4O86A

Saicar synthetase (type-2) in complex with adp and cdp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
molecule tags Ligase
source organism Pyrococcus horikoshii
publication title SAICAR synthetase (Type-2) in complex with ADP and CDP
rcsb
total genus 75
structure length 227
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o86A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o86A02
4XNEA 3L8PA 4FIGA 5IU2A 5J8IA 4MWIA 4FR4A 4RA5A 3S95A 3ORXA 5JFSA 2R7KA 5GHVA 3E3BX 2GHMA 4KKEA 4O0SA 2F2UA 4RC2A 2ESMA 4WG4A 4I41A 4I92A 5E8VA 2CGXA 3ZO2A 2JLDA 3BHUA 4AW2A 1PYXA 3AC3A 2YZAA 4BYIA 2OO8X 2XA4A 2YHVA 3MH0A 4IEBA 4RWIA 2GNGA 3EKKA 3FLYA 2XNGA 4KIPA 3ID6C 2AUHA 2BAJA 2PVLA 2C6MA 4QMVA 5FG8A 3AOXA 3PY0A 4LMNA 4O4LF 4TUYF 4O7VA 1SYKA 2BRHA 2GHLA 2W1IA 3ATTA 5FTQA 4S2ZA 3ZSGA 3JYAA 4LRJA 4UBAA 3VRYA 5C4LA 1JKSA 2C69A 4PWNA 4APPA 4O7NA 2Z8CA 4FT7A 5FP5A 2PVJA 3MIYA 2VWIA 2WQMA 2O5KA 3C51A 4RZVA 4L1KA 4ANQA 4G6NA 4G3CA 2QO2A 5BVOA 4RX7A 2XM9A 1Y8YA 4NW5A 1OIRA 5AP7A 4ACDA 4FYNA 4LGHA 2O65A 4OT6A 3ZLWA 5FDPA 4GIIA 1QCFA 4HGTA 4A07A 5IUHA 4M3QA 4MBIA 1E9HA 4ME6A 3Q52A 3VBWA 5AWMA 3WF7A 5LARA 2X2MA 3UODA 1XH6A 2V62A 5CSVA 5AAFA 3W55A 3UMWA 2Y4PA 3CQWA 5KMNA 4O4IF 4YR8A 2OLSA 3PA5A 4EWQA 3SKCA 5BVDA 3NYOA 5KCVA 4FNZA 3ERKA 2YN8A 2GTNA 1CKIA 4DBXA 2ZV7A 1WBTA 2DYLA 2QO7A 3G0EA 2J5FA 4FV9A 2CKOA 3R8PA 2ITVA 4MXYA 4DFYA 3L1SA 3LMIA 2JITA 3MIAA 3NUUA 1KJJA 1Y6BA 1KJQA 5HCXA 4CGAA 1KE9A 4E8AA 4EOSA 2C5OA 1F3MC 2CN8A 4DYMA 1OI9A 4R6VA 2VNWA 4O4HF 3KN5A 5EYCA 3MA3A 1AD5A 3T3UA 4FG8A 3ZO3A 3MTFA 2VTIA 4C36A 3F82A 5C8NA 2ZB0A 3FKNA 1BL6A 2IVUA 3LJ0A 3MFSA 3CPBA 1V1KA 3FMMA 4LL5A 4WBOA 3W2QA 4Q9ZA 2W1HA 3EMGA 3RHXA 1W93A 2DLNA 5DNRA 5KZIA 4KBCA 4AE6A 4F4PA 2FSTX 3NX8A 5L2WA 3ZM4A 3GCQA 5HICA 4EQCA 4FL2A 3D15A 2HXLA 2XRWA 1JPAA 3DZQA 3RNIA 4Q2AA 4EOQA 5JN2A 5IQFA 5C1OA 4ZAUA 2YWPA 3RTPA 1H4LA 5ITAA 1DAWA 2WQEA 3ZDUA 4JS8A 2ZDGA 5HE2A 3HMPA 4YBKA 5C1QB 5CF5A 4CFMA 2YZGA 4I4EA 5ANKA 5E1EA 2H8HA 3OXIA 4G3EA 1LP4A 4GS6A 3ORPA 4KIQA 1W0XC 2R7IA 3FYJX 4BVUA 2EXMA 4F0FA 3UG1A 5DVRA 3KK8A 4NKAA 4V0GB 3O8UA 2C3JA 4IWQA 3UZRA 3G8CA 4GK3A 4OTHA 3FHIA 4P90A 4DC2A 4KS8A 1GSHA 3T9TA 4KIOA 3LIJA 3KB7A 2XZSA 4K18A 4HVDA 1UA2A 4FSUA 4FSYA 3LXPA 4W4WA 3EQHA 3MVHA 5A4LA 5CEPA 4JOAA 1A06A 3HMNA 3O71A 3F69A 4C35A 3GT8A 1I7NA 3HRBA 3BV3A 4CTCA 1SVEA 4JBPA 3QRTA 4WUAA 5E92A 4XZ3B 3F5PA 2JBPA 3EN7A 1Q3WA 4ZSAA 2RFDA 4RX9A 2OJJA 2BZJA 2OF4A 3VQUA 1UWHA 5HLPA 4C3FA 3OBJA 5C9CA 3O23A 2WD1A 3EZRA 1VR2A 4R78A 4NTTA 3FUPA 4AU8A 4HVSA 2OGVA 4U81A 1H26A 3RAIA 3NCZA 3VW6A 4DBNA 3QLGA 1UKHA 3JS2A 3GI3A 2G1TA 3PY3A 4H05A 4JBOA 4L8MA 4K9YA 4HCTA 3HA8A 4P7EA 3KMMA 4NUSA 3UZPA 4TY1A 3D7ZA 4L46A 4LRMA 5IH5A 2OH0E 4IIJF 3OMVA 2W1CA 5IUGA 5GONF 2XS0A 3W2SA 1WBWA 2XB7A 4AS0A 4DH1A 5JVDF 3RK7A 2QOKA 2PYWA 5A6OA 4MNFA 3V6SA 4BDBA 5FEDA 1H1SA 2JKOA 2PVFA 2YCRA 2ITQA 4IX4A 5BVFA 5CU2A 3F2AA 4GJ2A 4TYEA 3JVSA 3QRUA 5JRSA 5D10A 5CU3A 4GUEA 3QZGA 3KXMA 4JQEA 5F95A 3MA6A 3QF9A 4GH2A 4NCTA 2ZV2A 1XH4A 2XEYA 4WNKA 4RX5A 4CFXA 2UZNA 2QR8A 3C5IA 3FAAA 4G5JA 4L6QA 2PULA 3MESA 4OLIA 4QQ5A 3F3TA 1PXIA 5CAVA 5M55A 1U5RA 5KHXA 3NR9A 1J1BA 3K3PA 4PP9A 2WMUA 4U5JA 3DK3A 5ACKA 2JC6A 3JPVA 4FZDB 4QYFA 5DR2A 2XIRA 3VF9A 5A54A 3QTZA 2YCQA 2J9GA 1Q61A 5LVNA 3HUCA 4KD1A 2F57A 4BDEA 4FTJA 1WCCA 2C5VA 1LUFA 3G33A 3QTQA 3NRMA 4FIFA 4LOOA 3O50A 5AV2A 4YSJA 1QPDA 4Z16A 3BU3A 4TV8F 4TXCA 5JH7F 3F5UA 2JDVA 4FT3A 4BI2A 4BCOA 2LGCA 2HAKA 3TW6A 1OKZA 3PVBA 3REPA 3VUGA 4J8MA 4I0TA 4A9YA 2C6OA 5FBOA 2J9MA 2CCIA 2B0QA 3DV3A 2FP4B 3QTXA 2FPIB 3W8LA 4EGQA 1KOBA 2H34A 4C4HA 3CY2A 4DT9A 4QMSA 5JFXA 3ULZA 4IM2A 2J0JA 3DU8A 3F66A 4QPSA 4XH6A 3KAJA 2FH9A 4KABA 2ZJWA 1OBDA 3SG8A 4EHGA 3HMMA 3PY1A 3U9SA 3ANQA 1Z9XA 3GOPA 3NW6A 4FK3A 5FRIA 4PDSA 4FZ7A 5J9YA 4JDIA 4EQUA 4ENXA 3IQ7A 2WTKB 4K6ZA 2IG7A 4DE4A 4AF3A 5AUWA 4XG7A 4BCQA 3BLRA 3WE4A 3IONA 3ORTA 4BTFA 1XO2B 4L01A 3VUIA 3RV3A 2JFLA 3WIKA 4RT7A 3TL8A 4WA9A 3GGFA 4MV9A 3PJ1A 5FXQA 1K3AA 1L3RE 3A60A 5AX9A 1PKDA 2C6EA 4C62A 4DEEA 3JRXA 3UNZA 3F5XA 1M14A 3AQVA 3HGKA 2UUEA 3HUBA 3KMWA 4J99A 4BBMA 4YAKB 2JBOA 4XG4A 4MCVA 3AT3A 1VYZA 4FTNA 2YRWA 3QXPA 3FMHA 2V5AA 3V8TA 3F61A 5BUJA 3ZO1A 4LM5A 4QP2A 5FDXA 2IVTA 4QTAA 2BMCA 4GVAA 3OW3A 1XH9A 3FV8A 4S33A 1P2AA 2GQRA 3EL7A 2UV2A 4I0SA 4FC0A 1GLVA 2PE1A 2ZB1A 5AUYA 3BV2A 1J7UA 3M11A 4BZDA 2C6KA 3RAWA 1RDQE 5EQEA 4L42A 1PXMA 2OJIA 4IADA 3D9VA 2YS6A 4IAYA 3ZRKA 4JL9A 3HYHA 2FSOX 2Z60A 3ORKA 5HBJA 2VRXA 3FEGA 4QRCA 5HG9A 2C6TA 4LMUA 3BYUA 2PVNA 3EWHA 3K2LA 5GJFA 4EH7A 3BHHA 2IPXA 2PMOX 5DPVA 4YP8A 5C03A 1IOVA 2ZM3A 1HCKA 2ITOA 2R5TA 1YWVA 3BYSA 1URWA 1P4OA 2QOLA 1NVRA 1K9AA 3DK6A 4HNIA 4TWNA 5LXTF 1Q99A 2G2HA 4BI1A 1H08A 3DFCB 2I1MA 1H07A 4YTFA 1XBAA 3BBTB 3AC8A 1FVRA 3AD6A 5JQWA 2CPKE 3PYYA 3GU6A 3NVKI 4AXAA 1DI9A 3VN9A 5FD2A 3TDVA 5AP6A 4N4SA 4DTAA 5CS6A 2JFMA 4FIEA 4M12A 3MN3A 2CLXA 3PJ8A 5DOSA 1WZYA 4EOIA 3RPOA 2R3OA 1KJ9A 5C01A 1Q8TA 5EFQA 4I21A 3LFEA 2PZPA 2X2LA 3C0IA 3CXWA 2W5HA 3W32A 1H01A 2XIZA 1DI8A 3FI3A 4OW8A 2F2CB 5DIAA 4DH5A 4ASXA 4QP3A 1GSOA 4NKSA 4YC6A 4A4OA 3ETAA 4N6ZA 1BLXA 4ASEA 4BTMA 2PVMA 3G2FA 2YIYA 4FSQA 4O0VA 2FO0A 3EQPA 1YKRA 4YPDA 3Q53A 3CBLA 3GVUA 3HKOA 4YJNA 1KE8A 2XNBA 2E9OA 4PTEA 5HE3A 3TUCA 3FY2A 1PHKA 2R3KA 3P4KA 4R5YA 4TW9A 3R8VA 2WMBA 4IX5A 4FTMA 3QD4A 5AV3A 4F08A 3BLHA 4ZSEA 4ZXTA 2DWCA 3R8MA 2E9VA 2CSNA 3P9JA 4A9SA 4U3YA 3ET7A 2OZAB 1JVPP 3F9NA 4H3QA 4DH8A 2C5YA 5HG5A 5IQCA 5KMJA 2B9HA 4G9CA 5I5ZA 4YNOA 2P4IA 1DM2A 3QUDA 1T46A 2PVHA 1Q8WA 3OWLA 5AIKA 5KE0A 1HOWA 4MV7A 1YDTE 3LFSA 4U45A 3ETHA 4IAAA 4O7YA 3PXKA 4RZWA 4YHFA 4EQMA 4WNOA 2IWIA 4JJRA 4UB7A 4KS7A 3PA4A 4C58A 4OTIA 4IX6A 4YSMA 5L6PA 5J1WA 2WMQA 4FNYA 2CZGA 2YABA 3C9WA 4QYGA 4FTRA 3FPQA 3CKWA 3C50A 2XK9A 2YDKA 3QX2A 4II5A 4KWPA 1AGWA 3K5IA 4NZWB 3OY1A 3LPBA 2YFXA 4EWHA 2W1EA 4MBJA 3AW8A 4IHPA 5JZJA 3N4VA 2NU7B 4U79A 5E4HA 4MH7A 3RPVA 3LMGA 1QMZA 2CN5A 3POOA 2ITTA 3RGFA 3LM5A 4FV6A 4X0MA 5L2TA 3R28A 3F3ZA 5HHWA 3R1SA 4BDKA 1A9XA 3FQHA 1R3CA 5HG8A 4HVIA 3PIXA 2GHGA 1UU3A 2B9FA 1MP8A 3FZSA 4O7LA 5LCKA 5EK7A 2HGSA 4CMUA 2ITWA 2CKEA 3UOHA 1Q24A 2ACXA 3D5VA 1H1PA 1NVSA 4I0RA 3GU5A 5FLFA 3KRWA 2IW9A 5IQAA 2I80A 4O0TA 4TL0A 1SCUB 3KXGA 3C4WA 4YTCA 4F70A 3GLKA 3VULA 5AAEA 3KRLA 4CMOA 1JSUA 4BDJA 1OKYA 4ZZMA 4BY9E 3QAME 5FP6A 5BVWA 3GEQA 3CCNA 1SVHA 4YJVA 3HEGA 3RM6A 2XIXA 4IWDA 3RUPA 5JQ8A 4K2RA 4PTCA 3W18A 5EI6A 3D14A 3LFFA 4FKIA 3EN4A 2Y7JA 4ALVA 2IW8A 3DJ6A 3E7VA 2VO6A 1WBVA 4FSMA 5EHLA 3UG2A 5CX9A 3KXXA 1B6SA 2WPAA 1YXXA 5JFWA 2OSCA 5L8KA 1YWRA 3QFFA 5JRQA 3E8CA 3FLQA 4IZYA 3NSZA 5CAPA 3FKOA 3QHWA 4WRGA 4F1TA 2A4LA 3VVHA 2W6ZA 3CPCA 4DFNA 2EB2A 2YZNA 2CGUA 3UIBA 3HZTA 4ID7A 3I5NA 5LVPA 2R3HA 2GU8A 3GBZA 2XBAA 3ZRMA 4ALUA 3EB0A 4I5HA 3LFQA 3WF5A 1WBOA 5E9EA 1UNHA 1G5SA 4HYUA 4H39A 4NM7A 2XM8A 2XNEA 2J90A 3P79A 4YZMA 5I9ZA 1UVRA 5CAQA 2R3QA 3A7FA 4ZTNA 4FFLA 4E4LA 2XNNA 3RCDA 3TDWA 4XV3A 4YJOA 3SDJA 3DBDA 4XUFA 3V5WA 4KUJA 2AYPA 3KCFA 3NAYA 4FKLA 1EZ1A 4CFWA 3ORIA 4KRCA 2V7AA 2WIPA 3FWQA 3LP8A 5BYLA 2XP2A 2NU6B 4A9UA 2FVDA 4YO4A 1JLUE 2YCFA 3P7AA 4L3JA 2A19B 2YDIA 4AT5A 2W6OA 3POZA 4AOJA 1CKPA 1IA9A 1KE7A 2HZIA 4D2SA 4EUUA 3I1AA 2W1GA 3RAHA 3VBXA 4DGGA 4GKHA 3KC3A 4O84A 5EM5A 4AT4A 3DF7A 5HNGA 1GSAA 3A7HA 5G1XA 4W4VA 3UIMA 1TQMA 2ZV9A 4U40A 1LR4A 4AZEA 3F7ZA 3K5VA 4QP9A 3QX4A 4XYFA 3TJDA 2WEIA 5L6WL 2W71A 2UVZA 3VBYA 4CT2A 5CQUA 1XR1A 2OFVA 4S34A 5LMKA 1PMVA 3TIIA 3UNJA 3VQHA 3UPZA 5HNBA 3ZLSA 4NWMA 4O82A 3ALNA 3QTRA 4HCVA 2UW0A 2XJ1A 3TKHA 3NNUA 4I93A 4Y72A 1GIJA 3IKAA 2VUWA 5TT7A 3DCVA 3U6JA 4J98A 4MQ2A 3Q5IA 3VOTA 4XMOA 3U6HA 1SM2A 4ZEGA 1BI7A 4LV5A 5HESA 2JKMA 3QC4A 4GT4A 4KBKA 3KREA 2I7QA 5HI2A 1P5EA 4J53A 5CT0A 4K33A 3SXSA 2R3RA 3CTQA 4E93A 2SRCA 4O86A 4BZOA 3CGOA 1ZARA 4F9WA 4OTGA 5A4TA 4PUZA 3QQKA 5HO8A 4CG9A 3AMYA 2NU9B 3R73A 4HCUA 3WZDA 3KMUA 4ITIA 3I79A 2W70A 2PMNX 2HY0A 5EHOA 3R8LA 3U87A 1ZYSA 4FZFB 2H96A 3VF8A 5CALA 3VA7A 3QTUA 2P0AA 3IOKA 4EBWA 2O2UA 1FGIA 2C1AA 3NNWA 3RKBA 4QMNA 4ZY4A 5J9ZA 2ITPA 4IM3A 4L7SA 1J7IA 3TNWA 1W83A 3IGOA 1ZAOA 5D12A 5HIBA 4IBMA 3R8ZA 4EHZA 4HGSA 4FVQA 5ETCA 2WELA 4F6SA 2QHNA 1OL1A 3PA3A 4ZY6A 2WTJA 3ORZA 4FZAB 3C4CA 1OL2A 5ANGA 3UOLA 3AC2A 2OBJA 2OKRA 4PTGA 1OKWA 2IW6A 4FG7A 4PV0A 2XCLA 3JY0A 4FKVA 4FMQA 5E8TA 1KSWA 3NIZA 4FI1A 2VX3A 4RMZA 4USDA 2XNMA 4B7TA 4LUDA 3SXFA 5IZFA 2XMYA 3G15A 1RJBA 4IJ9A 4IZOA 3FE3A 5HKMA 4MTAA 4ZJJA 5AJQA 3IW8A 4JT3A 2B53A 3UP7A 4HNUA 4AA5A 4XCUA 1Z5MA 2C47A 3PXRA 5HCYA 2IO6A 5J95A 3RINA 4ZTSA 4FVPA 4O2PA 3W33A 3ZBXA 2W7XA 4AFJA 2PK9A 1M0WA 4LQMA 3DQXA 1YHVA 1QL6A 2BKZA 4PL3A 5LQFA 2WTVA 5EYMA 1W8CA 3L9NA 1PX2A 3PDTA 4JX7A 3OWPA 4FT0A 1FVVA 3VAPA 4UN0C 4GK2A 4QTBA 4E6DA 3ROYA 2NP8A 5HO7A 4E1ZA 5LMAA 3TIGA 3AC4A 4HYIA 4MD7E 2NU8B 3LFAA 3ANRA 4G9RA 3E64A 3MSSA 4OBOA 1EUDB 4C4FA 4MNEA 4FV2A 1SVGA 4PDPA 4IM0A 3NUPA 2VAGA 4D9TA 4EK6A 2R0IA 3HV5A 5EKOA 3FLNC 3MB6A 3FL4A 4M0ZA 3A8WA 3H3CA 4RC4A 3SQQA 4XOZA 3OCTA 3ZHPC 4DEGA 5J7HA 1B6RA 3BRBA 4RVTA 3QZIA 2G2IA 3M2WA 2WFYA 5AUZA 4HNFA 3LKMA 4O22A 1YQJA 3DK7A 3LM0A 5CZHA 5EG3A 5GNKA 4EOLA 2GPSA 4TYIA 3Q2JA 3KGAA 3MPAA 3QGYA 2F4JA 1PJKA 5HG7A 4O0YA 1A9UA 2XUUA 3FI4A 4RGJA 4CKRA 3LMHA 2V0DA 3QTIA 4C4GA 1GZKA 2HXQA 3DOGA 3LHJA 2UZLA 4J96A 4WHZA 3TEIA 3OW4A 3ZCLA 4DAWA 1ZMUA 3MJ1A 4F9YA 4C3RA 4IVBA 4MHAA 3W2RA 3GOKA 3WOWA 4ZZOA 3PXQA 1XBCA 5AFVA 4C7TA 3BI6A 3E92A 4M68A 4V01A 3SX9A 2XK7A 3UO4A 3LAUA 3R63A 4G16A 4K77A 3LCOA 3ROCA 4FL3A 4FUYA 4O7SA 3UIXA 4E6QA 1JBPE 4FYOA 4O96A 3UC4A 4FFMA 4O0WA 4O4JF 3CIKA 4NFNA 4FSNA 4GG7A 2UZDA 2YM3A 4FTCA 3C13A 4U7ZA 3AT4A 1E1XA 3QQUA 4CG8A 3KXZA 4QPAA 4W8DA 4XP2A 3EYHA 5DA3A 4DGOA 4ZSJA 3LCTA 3M42A 3BELA 2YW2A 4ERKA 4U80A 3KRXA 3EL8A 4L67A 4O91A 5TO8A 4AACA 4XX9A 4Y5QA 4BDIA 2A0CX 5HCZA 5JVLA 3FI2A 4GT3A 4RVMA 2EWAA 5L6OA 3TNIA 1OVEA 3R1QA 3VUHA 3IW4A 1EUCB 1YI6A 2GQSA 3LQ5A 3S2PA 2XEZA 3DBFA 3F3VA 5EOLA 3ZXZA 4AE9A 2VGOA 3UO6A 3SA0A 2W6QA 4PL5A 5J2TF 5M06A 1YOMA 3DAJA 4DINA 4QP1A 4Y83A 5JEBA 4RBLA 3GB2A 2FPGB 5CEOA 2I8CA 3OUUA 2NO3A 1V0OA 2E2BA 5KO1A 3MDYA 3AD5A 4XLIA 3U9NA 4B8LA 1FOTA 3WYXA 3CTHA 3MTLA 3KKVA 3U54A 4FVRA 2X8DA 2W1ZA 4GU9A 5AV1A 5IQGA 4FZ6A 5CF8A 2GPWA 4WRSA 5HBEA 1U4DA 2QVSE 4GYGA 4OT5A 2PE2A 3DA6A 4IFGA 4OTFA 4JRNA 4QMUA 3KN6A 4DEIA 2BCJA 4F7SA 3W2OA 1XBBA 3HDNA 5F94A 5HV6A 2J0LA 4HGLA 4BB4A 4J52A 3MJFA 2JDTA 3EQCA 3PJ3A 1Z2NX 4Z55A 4YHJA 2OZAA 5F4NA 4AZSA 3UBDA 4I4TF 4RVKA 3DKOA 1MRYA 4ASDA 3MB7A 2WMAA 4DGMA 3D4QA 5AP5A 4BIEA 4WO5A 4OUCA 3COIA 3LFDA 4QYYA 4HNTA 3Q2OA 5A4EA 5BVNA 4AW1A 4BCNA 2HIWA 4DFLA 1V0BA 4ZLYA 4GFOA 1QPCA 2VTTA 3MBLA 5CNOA 4QNYA 4AUAA 1KEEA 4F7JA 1H1RA 4GSBA 4MV6A 4AA4A 2JDOA 2QONA 2RGPA 3DB6A 2IZUA 4QMLA 2VTQA 4UWYA 1NY3A 5IDPA 4ITHA 3SLSA 4EOMA 5GIOE 5EW9A 5KMKA 4ZQIA 3RALA 5FUTA 4E4XA 3EFLA 3HX4A 5IISA 3IDCA 4QMZA 5GIPE 5LA6F 1Q8UA 3I6WA 5CWZA 5L8LA 4MV8A 1KBLA 2HWPA 3R21A 2XKFA 2JGZA 3I7BA 3R04A 1BUHA 1JSTA 3OG7A 3QGWA 4FT9A 4I5CA 2Y4IC 4WG3A 2PUNA 5AV0A 1WVWA 3I7CA 4FSZA 4F09A 4TYJA 2ZMCA 1SNUA 3SW4A 5EM8A 4YGAA 4KSQA 1MQ4A 5KBRA 5EW8A 5BUIA 3NUXA 2JKKA 4X2GA 1Q8ZA 3MVJA 3TNQB 4DFXE 2R7LA 4C5BA 2PVRA 2OIQA 3DXNA 3E8NA 5KKRB 4BDGA 2O64A 2P55A 3G5DA 4IAFA 2XNOA 3UQCA 4XV2A 4I24A 4L9IA 2WNTA 3ZRLA 4CD0A 5EI2A 1JLLB 4HR7A 4IWPA 2UW8A 1JKTA 2Y9QA 2OH4A 2J51A 4V04A 2QOOA 2I0EA 3NUAA 4FKWA 4YHTA 3C0HA 4F9BA 3ZH8A 2JKQA 5HORA 5BPHA 1R78A 2I6LA 3VS1A 3D7TB 3Q5ZA 3Q9XA 1B39A 4XP3A 2QURA 5AUXA 2QD9A 3TZ9A 5H8BA 3PP0A 4WG5A 3DB8A 4N6YA 3F6XA 4AX8A 2WMVA 2R4BA 4QO9A 5ANDA 2A27A 1OZ1A 3DNEA 3F3WA 1OMWA 1R0EA 4LUEA 3LCDA 4U43A 3RVGA 3MJ2A 3DXPA 4X3FC 4KINA 4RX8A 4GFMA 3QYWA 4X6RA 1JNKA 3OEFX 3QC9A 4FTAA 2CNVA 3KALA 3VJNA 4HGEA 4LV8A 3EH9A 4M14A 4DH7A 4IFCA 1GZOA 3QWJA 4XJ0A 5CENA 4N0SA 5CF6A 2WTWA 1WFCA 3QTSA 4FSRA 3TQTA 1PKGA 3O51A 1SZMA 3JY9A 3O0GA 4FEVA 5KNJA 2ZOQA 4OTRA 5D9HA 1WBSA 1GOLA 5HE0A 4YZNA 1UU7A 3GCUA 3I6UA 4GCJA 4ENYA 3R5XA 3SRVB 3TTIA 1M6VA 4MV3A 3FMJA 2G01A 3TV7A 3PVGA 1CQIB 4JX3A 3QZFA 5HLWA 2BDWA 5IQEA 2W6NA 3W16A 1VYWA 3ZC6A 1H0WA 4IB0A 2Y6OA 4EZ7A 2V7OA 5JQGF 3A99A 4DTKA 5J87A 2GPHA 2CKPA 5HEZA 3AC1A 1CQJB 3W1FA 4YAJB 3D5XA 4C3PA 2VTPA 5E8UA 4ZMFA 3FSKA 3BU6A 4DTBA 4RIYB 3ZLXA 3IS5A 3O2MA 4ZSGA 2BDJA 5CSHA 3TV6A 5CF4A 3WF9A 3HV4A 2YRXA 2X8IA 2O63A 4YNEA 2WQOA 4EBVA 4MXAA 2F7XE 2B9JA 2PL0A 3BHTA 1M0TA 2VTOA 3DQWA 3UYSA 2XKDA 4AGDA 2F7EE 5DGZA 4CKJA 4D5KA 1AUXA 1LEZA 2XJ0A 3PRFA 4JG6A 3GENA 4H36A 4GMYA 3ZZEA 3I12A 2R3MA 1AQ1A 4BDCA 5DHJA 4R77A 3ELJA 3OEZA 4BTJA 1O9UA 2EB3A 5GJDA 2E9UA 3E8EA 4ZZNA 2W4OA 4TKSA 1YW2A 4JNWA 4RJ6A 5IA1A 1YI3A 1JKLA 1XJDA 5HVYA 3RM7A 2E9PA 4USFA 4DEDA 2QODA 4QTCA 4DG3E 5JQ5A 3UVRA 3R7EA 2VX0A 4QP6A 2X9FA 3D5WA 3P0MA 4Y85A 3V6RA 2W4JA 2Z7QA 3DDPA 3TIZA 2BHEA 4R1VA 5F20A 4EI4A 4G2FA 5BX0A 1Y91A 2QLQA 2RFEA 3OXZA 2C6DA 4QSHA 5BVEA 2XK6A 2OXDA 4KRDA 2CNQA 1GAGA 3HAMA 4EONA 2PZYA 3S3IA 2XJ2A 1Q5KA 3QALE 2RG5A 3COHA 5IMXA 4D4RA 4G3DA 2YEXA 4PF4A 4ASZA 3UMXA 2IJMA 4EJ7A 1F0QA 3BG5A 2ONLA 3U6IA 4C2VA 1G8SA 3HAVA 4UX9A 2W0JA 4AN2A 3BYMA 3KFAA 4F65A 5AADA 3A2CA 4FA2A 5LVMA 2PZ5A 5KMMA 4JVGA 1Q41A 2ZM4A 3PSBA 4RFYA 3KK9A 2VWWA 3WNZA 3A4OX 4QMOA 3NYVA 1OKVA 3DAEA 4YZ9A 3AC5A 5T68A 4EC9A 1PXLA 4AGCA 2DUVA 3H0ZA 4RIWB 3GFWA 5CEQA 1R39A 4TPTA 4GG5A 2ZYBA 3QQLA 5TOZA 3LCSA 1ZYCA 4H1MA 4JQ8A 1ZXEA 1WBPA 3A7JA 3COKA 3R00A 3C1XA 4C34A 2BIKB 4RIXB 4ZTMA 3R1YA 3PG1A 2R84A 3PVUA 3SXRA 4BC6A 3DLZA 4BDDA 4D1ZA 2QLUA 4FKPA 3HV6A 3PIYA 3MH3A 2BFYA 2PHKA 3NYNA 2VWVA 1UV5A 3EQIA 5A14A 5EKNA 5I4NA 1UWJA 1S9JA 4EOOA 3D0EA 5EZYF 2YM7A 3QKMA 1CE8A 3CLYA 3UP2A 5K5NA 2BKKA 2ITYA 4CV8A 4CRSA 4UZDA 2R85A 2X7GA 5JKGA 3CTJA 2YJSA 3Q2MA 4XRJA 3QFVA 3R9NA 3ZO4A 5A3XA 4AOIA 2YCSA 5TF9A 5M4FA 4YLJA 2YL2A 3D2IA 3Q96A 4EOKA 2ETMA 5DMXA 2BR1A 5FEEA 3SD0A 5CEKA 2B9IA 5HNIX 4FFRA 4DA5A 4HPUE 4DLJA 3A61A 4RQVA 3AMAA 3H9RA 3IDBA 3AX6A 1WBNA 2CMWA 4PRJA 4EHEA 4B0GA 3FXWA 2Z7RA 5HTCA 4G3GA 4IANA 2YIXA 2YM5A 3DKCA 4JDKA 3RWQA 3OT8A 5EI8A 3I0OA 5DR6A 5E8ZA 5DI1A 5B0XA 4CCBA 2XH5A 1EYZA 2C5XA 1U46A 1RE8A 2BIYA 3I4BA 3G9LX 5K3YA 3BX5A 3TZMA 3MV5A 5L2IA 1OITA 4L44A 3BWJA 1NT2A 1PYEA 3KL8A 4KNBA 4PY1A 4WNPA 5EYKA 2LAVA 1U59A 3UE4A 4E7WA 1DAYA 2FSMX 5ANEA 4YJ2F 2VNYA 1GY3A 1OUKA 5J2UF 3PFQA 4TTHB 3A7IA 1ZZLA 3QCXA 3E5NA 4W4XA 3CSVA 4KKGA 4EOPA 4R5SA 3MVLA 3NZ0A 4OR5A 5IPJA 4UXQA 5L3AA 1M2RA 5C27A 2Y0AA 1KUTA 5M51A 3KRRA 5H3QA 5C8KA 2W5AA 3AMBA 3FSFA 4P4CA 4CMTA 2C3IB 1GNGA 3BE9A 5ETFA 3DZOA 3R9RA 1DS5A 4YBJA 3FKLA 3ODYX 3L8XA 1OL6A 3B8QA 3TNHA 3VS6A 4CCUA 4D4SA 1JDEA 4WUNA 3OC1A 4RFZA 2E9NA 2B7AA 3E63A 4RVLA 4YJSA 5IEXA 4N57A 5FXRA 2R3FA 4J1RA 5AUVA 3UQGA 4AW0A 2QOBA 5IYZF 2B1PA 2AC3A 2JIVA 3JVRA 4IB3A 4J7BA 3COMA 4JAJA 5EH0A 3FXZA 5DBXA 1ZY5A 5M44A 1H28A 3QQGA 1M2PA 5BYYA 5I9VA 2QHMA 4ZOLF 3R5HA 5BMVF 2PSQA 3DGKA 1W7HA 2WTIA 5IA2A 5KX8A 4NU1A 1ZYDA 5CEMA 1OIQA 3BE2A 3PE2A 4NJDA 2OJGA 2W17A 3ZXTA 2Z2WA 3RWPA 2PUIA 3V5TA 4EH3A 3EKNA 4QQCA 3TWJA 4EK4A 2J4ZA 4IAZA 4PNIA 3FLWA 3NAXA 3GIDA 2WIHA 4F63A 3V8SA 5J5SA 4IDVA 2W5BA 4O81A 1IEPA 4L3PA 5EW3A 4IVCA 3R6XA 2WTKC 4YBZB 2BRBA 3OD6X 4I50F 4IHJF 4FTKA 4GU6A 3EOCA 4QMQA 2R3JA 4NM3A 2OFUA 3H30A 2X9EA 2R7BA 4M7IA 3QHRA 2YYAA 3OOGA 4F6WA 2BRNA 4BCKA 3ODZX 3WI6A 3PIZA 5IA4A 3NNXA 4FKQA 5J1VA 3Q9WA 2X39A 4B9DA 3HNGA 5H8EA 2QCSA 4JR3A 4H3PA 4YURA 4M9UA 2UZVA 1PF8A 4NH1A 3R9DA 4EKLA 3KXNA 2P3GX 2QK4A 4D2RA 3CEKA 4U6RA 2J2IB 1W98A 3U9TA 2C5NA 4XV9A 4KAOA 3E8DA 3P1AA 1REKA 5HU3A 3EFWA 4C4EA 5C8MA 2NNWB 3VNTA 3OZ6A 5HBHA 3WO0A 3LVPA 2OXXA 4MBLA 3E3PA 1E4EA 4FBXA 2VTMA 3IO7A 4RLLA 3R2YA 4ZTHA 2ITUA 5CASA 3QKKA 1MRUA 3MWEA 4X2NA 3D2KA 4MYGA 4CLJA 2J50A 2GFSA 3MPTA 2VN9A 5HE1A 3L8SA 4U8ZA 4N70A 2IZRA 4G5PA 3HA6A 4Y73A 3HRFA 3OWKA 2Z7SA 3DT1A 4IAKA 4Z7GA 3TV4A 2BAQA 2OF2A 4OGRA 3PSDA 5FNVF 1M52A 4AZTA 4XG8A 5BQ0A 3EIDA 2FA2A 3GFEA 3PPKA 4S30A 3R7OA 3ZTXA 3ALOA 5AP0A 3QRIA 3BIZA 3KA0A 4A9TA 2QO9A 3VO3A 3DJ5A 3ZFXA 1H8FA 3WZEA 5AUUA 5JK3A 4C5CA 1XH5A 3OT3A 3CJFA 3D7TA 3QQFA 4PMMA 2UZOA 3N51A 5D7VA 4JG7A 2NRUA 5IEYA 3VUDA 3O7LB 4K0YA 4JQ7A 4NM0A 1OECA 2OLCA 4D4VA 5IH4A 2HZ4A 2G9XA 2JIIA 4H1JA 1FBNA 2YISA 4ZIMA 4HQ6A 1IAHA 2KULA 3O8PA 5AMNA 5M4CA 1KJ8A 3JZIA 5CXZA 3TKIA 2O0UA 4RIXA 4AGUA 1Q4LA 3LW0A 4XV1A 2J0MB 4CT1A 4M8TA 5CSPA 4A4LA 2XYNA 2R7MA 5B2KA 4TWPA 2ZAZA 2RFSA 2J7TA 4CV9A 2ETRA 3R02A 4OBQA 2QR7A 4EZ3A 4RIWA 3FMNA 2IP4A 1PXNA 3EHAA 2C6LA 4X2KA 3V3VA 2GFCA 3OS3A 3R0TA 4BCGA 4C38A 3SE7A 3C4ZA 3Q04A 1Q3DA 2YIQA 4O83A 4EH2A 3ORNA 3V4ZA 3ACKA 5LYJF 2HJWA 1OPLA 4E4NA 2HZNA 3JRWA 3F88A 4XG2A 3R23A 3MH1A 4PL4A 1YVJA 5BPYA 4IH8A 3GU4A 5M07A 3FQEA 4DLIA 3K5UA 4QMTA 5AM7A 5AV4A 1TQPA 3L9MA 3CJGA 2OK1A 2J5EA 4NJ3A 4EHVA 2ZMDA 1OL5A 4X3FA 1PXOA 5BUEA 4GKIA 2JIUA 4LOQA 2SCUB 4L45A 5EM6A 2QU5A 3BYVA 5CQWA 5DT3A 4I55F 2WO6A 1CMKE 2VZ6A 5EYDA 4MXOA 4Y46A 5DEYA 3TACA 1Q62A 3NS9A 3O17A 5CU4A 4E73A 4YC3A 4JDHA 5JGAA 1XQZA 3NEWA 2ERKA 3H10A 1UKIA 2GNFA 3FMKA 3OXTA 2WXVA 3P7CA 4IWOA 2NRYA 3T3VA 3GCPA 5HZNA 2BROA 4GW8A 2REIA 3FZRA 5H8GA 3ORRA 1TVOA 4WNMA 3JUHA 3FZTA 2FUMA 4DFUA 4YC8A 5CU6A 4FSWA 3S00A 3VUKA 2PZRA 2F49A 2XF0A 1VEBA 4IVAA 2VPQA 3RPYA 1VJYA 2YM6A 3TNPC 4IC7A 5LMBA 5LWMA 3PPJA 1OB3A 3ZOSA 1IRKA 1PK8A 3OUZA 5AA9A 2PBZA 3HP2A 3K5HA 1NW1A 2P0CA 4AWIA 2VTNA 4MNEB 4RJ4A 4G6OA 3V04A 3DBEA 1KV2A 2J6MA 3D94A 5ACBC 4RIYA 3NYXA 4MQ1A 4BDHA 4G6LA 5ANJA 4C2WA 2R3IA 4C4JA 4A7CA 3Q4ZA 4IE9A 4UZHA 4ALWA 4NK9A 4CFNA 1KV1A 1YI4A 4I5MA 2W9ZB 1C3OA 1M2QA 3ORQA 3AGMA 3FYKX 3ZBFA 5CTPA 4BIBA 3FC2A 4BCJA 5HX6A 4MV1A 4U3ZA 4D4YA 1FVTA 1YHSA 2FPPB 5D41A 3PVWA 5L8JA 4ACMA 1I09A 2UW6A 2OXYA 4IACA 5EQPA 1YDSE 2VD5A 3I81A 3R71A 3SRVA 1BYGA 4JG8A 4AZWA 3E5AA 3TUDA 2YITA 4O2BF 2QOHA 1UU9A 4NYEA 5D1JA 1K2PA 3AG9A 3DXQA 4DGNA 2OIDA 2IVSA 3ORMA 1FPUA 3UPXA 2R87A 5M57A 4I3ZA 5AP3A 4HPTE 3R30A 3KRJA 4BBFA 4EL9A 3ULIA 3E62A 3PXZA 2V22A 1L8TA 1DIKA 3NW7A 5DYJA 3RPSA 4JRVA 4XBUA 3RCJA 5JGDA 4J71A 3P86A 3O7LD 4NTSA 4U42A 3BGPA 3Q9ZA 4O27B 3PWYA 4QP8A 5HGIA 2W1DA 4YO6A 4BDAA 1ZLTA 2DWBA 4EH4A 3OHTA 4EH8A 4AGWA 5BPFA 4CSVA 2VO3A 1ZY4A 4CFUA 2BZIB 4G17A 2C68A 4WBNF 4EGJA 2BFXA 3N4UA 4G34A 4XS2A 4XRLA 3ZMMA 3PXFA 1H27A 1ZYJA 2UW4A 3QUPA 1BMKA 4LI5A 4ZP5A 2UVYA 3R7VA 4D1XA 1MQBA 3B8RA 2CDZA 1JQHA 5T6KA 4CVAA 1G3NA 2VU3A 4QMWA 4EZ5A 3C4FA 3MH2A 4O7RA 4QQJA 3FZ1A 5E90A 3RAKA 5KX5F 5JSMA 1Q97A 4TNBA 4YJTA 3K3JA 3A4PA 4AZVA 3PXYA 4QMXA 4UYAA 2YAAA 5KKNB 5AP2A 5BNJA 4ZLZA 4X3JA 4MA5A 3IK3A 5AEPA 2IZSA 4AOTA 4DT8A 4R3CA 2ZV8A 5CAEB 4O6EA 1OGUA 4TWOA 3DTCA 3RK5A 3G0FA 4RFMA 4YLKA 1FGKA 3R22A 3ZS5A 4R1YA 2HK5A 5CI6A 3CGFA 3ORLA 4X21A 4EEVA 1WVYA 4RZQA 1T45A 5C1PA 1KC7A 3DKFA 3P7BA 2OI4X 2YA9A 3MWUA 4GVJA 3EN6A 3NW5A 2PE0A 3P08A 4MVFA 3C4XA 1H24A 3P23A 2QKRA 3GC9A 4FV8A 4FTQA 3BBWA 1ULZA 2W4KA 1TKIA 3UC3A 5TR6A 3H9FA 1J7LA 2CLQA 1KE5A 3QRJA 4FV5A 4JBVA 4M67A 2YZMA 4KB8A 3N8DA 1ZOHA 4DEBA 3QYZA 3DDQA 3KCKA 3FC1X 3UZTA 2OICA 3OCSA 3KF7A 3IW5A 3TINA 3VBQA 2XNPA 4A4XA 3GU7A 3GNIB 5B2LA 3VWAA 2YACA 4ZLOA 3QD3A 2YS7A 4C33A 2ZDQA 2X6EA 2BHHA 3BCEA 2PN1A 3K3IA 4I4FA 2R7NA 4FFPA 4I6QA 3RZBA 3U55A 4TV9F 3MS9A 4ANBA 4FV4A 3JR1A 4R7BA 1BI8A 4UALA 1GJOA 4Q5EA 2BILB 1PY5A 3O96A 4ZJIA 3TM0A 4MXZA 3LJ1A 3RV4A 4XG6A 2ITZA 2EXCX 1REJA 2UVXA 4HVHA 3RPRA 3HLLA 4HZRA 4FODA 4FGRA 4L3LA 4DF3A 4L68A 2OWBA 2X2KA 3NMUF 4HW7A 4AA0A 2FYSA 2HENA 3R9OA 4FKSA 1ZWSA 3C0GA 4O21A 2GLTA 2Z04A 2IZTA 1R1WA 2VWYA 5AUTA 4F9CA 4XEYA 2PZIA 2VWZA 3ITZA 5LVOA 2VWXA 2YJRA 1KWPA 5M09A 3QQJA 2CCHA 5A6NA 4ZY5A 2HYYA 3G51A 3V5LA 3BGZA 3H0YA 3QRKA 1ZRZA 3GQLA 4B4LA 3UQFA 4PDYA 3VS5A 1FMKA 3G90X 1JKKA 4IZ5A 5LVLA 2JAVA 3SHEA 4I22A 1V0PA 2C6IA 3FL5A 2GS2A 5D8DA 1ZZ2A 3A62A 3SG9A 4NIFB 4NCTC 3VRZA 5LCJA 4USEA 5FTOA 1H1WA 3BU5A 5CLPA 4EYMA 5GJGA 3DJ7A 3UVQA 4F0IA 3VPBA 4FICA 1YWNA 4FV3A 3N6RA 3WARA 2DQ7X 1XH8A 4FIHA 5D11A 3WIGA 1UNLA 2VTSA 4O0XA 4BHZA 3FDNA 4NFMA 3BLQA 5H2UA 1M17A 5JMSA 5CANA 1Z2PX 4FFOA 4DFZE 3OF0A 4WT6A 4ZS0A 4MXCA 3PUPA 5BVKA 3FI8A 3G6HA 1CDKA 4E4TA 3QA0A 2WOTA 4QP4A 4MD8E 1UNGA 4RJ3A 2WU7A 1OM1A 4PMSA 4RWLA 1DV1A 3QTWA 4FG9A 2VR1A 4D55A 3VBVA 1NA7A 4B99A 4XYMB 2PTKA 2XCHA 3TI1A 1X8BA 4EH9A 3Q4UA 3F7WA 4IMYA 4K11A 4YZDA 5CT7A 3H9OA 3CY3A 5T3QA 1U5QA 4BBEA 1WVXA 4FEUA 1RQQA 2VTHA 3FY0A 4UV0A 3MY0A 5CVHA 5E7RA 1GGOA 1RW8A 4GEOA 4AQCA 1JKJB 4MWHA 3V4SA 5M56A 4DN5A 3NVMB 4RJ5A 3KQ7A 4FNXA 3FBVA 4OTDA 5LMKC 1JDBB 5LOHA 4R3PA 4CKIA 4L43A 1T36A 3IW7A 4FUXA 4BGGA 3MFTA 4IZ7A 5G6VA 1YXSA 5DLSA 4BDFA 4ZTRA 4C59A 3S1HA 2HOGA 2F9GA 5CA1F 4EK8A 3EZVA 3ZLYA 4PMPA 4OTWA 2QOCA 2GQGA 5ETIA 1LPUA 5DG5A 3P5KA 4CXAA 3K54A 4E4MA 3BYOA 4M69B 4YTIA 3V5JA 3DNDA 5IG1A 4X6QC 5KUPA 2YWVA 1JAMA 3I5ZA 3U51A 4HYSA 2PUPA 3HV7A 4L53A 2ZDHA 3HBLA 2V55A 2GMXA 2I0HA 2OIBA 5FM3A 3U4WA 2C0OA 4PMTA 3CD3A 3DY7A 4I1ZA 4YU2A 2JDSA 4M15A 5CVFA 3ZYAA 3E7OA 2QKWB 1O6LA 4FNWA 4S31A 3VJOA 3KVWA 1YRPA 2I87A 4FV0A 3V5PA 5HIDA 5IF1A 3KF4A 1J1CA 1YOLA 3QXOA 4GRBA 1DV2A 2V58A 3MFUA 2GS7A 3DTWA 3FZOA 3CC6A 4FEWA 4IZAA 4D9UA 4DITA 4U44A 3Q6WA 1M7NA 4ONAA 3TIYA 3E87A 1KE6A 3A8XA 2BTSA 2C0TA 2GCDA 2UW3A 1W82A 4IW0A 3HP5A 5CYIA 3R5FA 5IQHA 4O38A 4EC8A 2GNLA 3IW6A 4IVDA 4YJ3F 5FTGA 5EQYA 3VMMA 5IA5A 2HZ0A 1NXKA 3V51A 3OVVA 3U4UA 1WR2A 4E6AA 4YB8B 1IOWA 4IC8A 2QG5A 5HVJA 2C30A 4YJQA 4WBBB 3THBA 4MA0A 3DLSA 1PW2A 4KKHA 3LQ8A 4M97A 3IG7A 4O0RA 2XKCA 4YPSA 5DT4A 5E8XA 2WTCA 2P2HA 4QNAA 4ORKA 2YM4A 4DCEA 5JT2A 1VKZA 2GTMA 4HOKA 5K4JA 3OP5A 2R3LA 4BN1A 3W2PA 1ERKA 2QG7A 3LZBA 3DBCA 2HY81 4I6BA 5IA3A 3QL8A 3TKUA 1O6YA 2CHLA 2VWBA 4UXLA 4ZSLA 4YZBA 5KZ0A 4IIRA 4ZK5A 4CFFA 4Y8VB 5CU0A 4JDJA 3TG1A 1WMKA 4DG0E 3ZFYA 4F1OA 2R9SA 3QU0A 4G3FA 1XHAA 2Y6MA 4JIAA 5BMSA 3Q6UA 3ETJA 5IUIA 2R82A 3ZFMA 4C37A 2WB8A 2R3PA 5IDNA 3ZUVA 2WAJA 1OPJA 2BDFA 2DS1A 3LCKA 4HYHA 4RIOA 4ZTLA 3ZONA 2WQBA 3R8UA 5KMIA 2XIYA 5A4QA 4FK6A 1Y57A 2RG6A 2VX1A 4NL0A 5DEWA 5E1SA 4YLLA 5H80A 3L9PA 2VGPA 5C8YF 3NLBA 4IDTA 3QCQA 1Y8GA 2W99B 4FV7A 4P5QA 5HU9A 3E93A 1B6CB 4MD9E 5EDQA 3TZ8A 2WMWA 4M13A 1Z57A 3FMEA 4FSTA 3ZZWA 4QMPA 4O7WA 1IAJA 4FKGA 2GS6A 4CLIA 3BPRA 3FLZA 4FE2A 4QT1A 4F0GA 4K8AA 3MY1A 4IAIA 4ZTQA 4ZOGA 4FTIA 4TZRA 5ANOA 3BQRA 5HD7A 1A48A 1IASA 4HZSA 5FXSA 5H9BA 1JWHA 4UYNA 2BTRA 2WGJA 4E6CA 4PX6A 2NPQA 4FKUA 5IQBA 2KTYA 4IB5A 3QD0A 3VS2A 5AP4A 2I0YA 2VTLA 3GQIA 4GFGA 1H0VA 2QU6A 2ITXA 4TT7A 2H6DA 4QTEA 3PP1A 3TUBA 4IX3A 3WZJA 3KVXA 3QD2B 4CQEA 1GZ8A 5GINE 3KXHA 2B52A 4CEGA 2H9VA 5KKRC 2W06A 4GK4A 1BNCA 4U0IA 2WEVA 4CNHA 3FJQE 3IPHA 3DKGA 3GXLA 4BHNA 3NUNA 3R7YA 3Q32A 2W6PA 5DR9A 1LEWA 4R7IA 3TN8A 4MAMA 4C61A 4JI9A 5CXHA 4D1SA 4O0UA 3DS6A 2ZDTA 4DLKA 3GC7A 2IVVA 3FPMA 1VZOA 3G9NA 1ZMVA 3EN9A 4XLVA 3VW8A 2PMLX 4CZTA 3GUBA 3FMDA 4B6LA 1CM8A 2RL5A 3BGQA 1C30A 2GSFA 4FTOA 4FTTA 1ZOGA 2J0KA 3R01A 2W6MA 2HCKA 4D0WA 5FM2A 4JBQA 4XOYA 5HQ0A 2YIRA 3ZSHA 4HJOA 5KHWA 4ACGA 1P4FA 3RP9A 4ACCA 1OPKA 4D0XA 1QPJA 4LL0A 3DBQA 2CJMA 2ERZE 2R3GA 2X7OA 3GCVA 3ZSIA 3HB9A 1FQ1B 5EHYA 5EOBA 3BEAA 2FGIA 3UJGA 1PMNA 1CKJA 3GCSA 3OROA 3WE8A 4YZCA 4WOVA 5AIRA 3EFKA 4MAOA 2EVAA 4Z3VA 5J9LA 3PZEA 2BALA 5I9UA 3F2RA 2C00A 5K4IA 1BX6A 4U9AA 3ZEWA 5HVKA 3UDBA 3VC4A 3HVCA 2Z02A 3BEGA 5CSXA 5A9UA 4RLKA 2A1AB 2UZWE 2Q0BA 1MRVA 2P2IA 3A7GA 3QUEA 4BIDA 5EDPA 3OOMA 2BPMA 2QI8A 2F7ZE 3AGLA 5CY3A 2BVAA 1OUYA 3S4QA 1H00A 1P14A 4MX9A 3NPCA 4DCAA 4MKCA 5JGBA 4FIJA 2G2FA 3BQCA 3PLSA 4G31A 4DEHA 3PLAE 4UEUA 3QZHA 3VHEA 5K9IA 1AUVA 1EHIA 3LWBA 2I40A 2YZLA 4BCMA 3TZ7A 1O6KA 1NVQA 3WZUA 2R3NA 3KULB 2X0SA 3B2TA 4F9AA 4TRLA 3ATSA 1ZMWA 4I5PA 3ZU7A 4BCFA 1XWSA 3PWDA 1E1VA 2XKEA 3JZFA 4EG0A 4BCPA 4WKQA 2WQNA 5HX8A 4RQKA 1STCE 4I23A 2WHBA 3MFRA 3EFJA 2GDOA 3NUSA 5FQDC 5DT0A 2O8YA 2RFNA 4GIHA 2OW3A 4E26A 2AC5A 4GL9A 4DIMA 4S32A 1OIYA 5CEIA 3FZPA 2IN6A 4H58A 4LOPA 5FBNC 5HLNA 3PJCA 4OBPA 2QOQA 3ENHA 4E5AX 4C0TA 4YTHA 2W05A 2NUAB 2BUJA 2VV9A 5ICPA 1BXRA 3ZEPA 5DE2A 2CKQA 3N9XA 5JFVA 2X1NA 3VUMA 2YAKA 3E88A 4QMYA 5M53A 2WZJA 3MVMA 5I9YA 4A9RA 5DH3A 4EYJA 4QOXA 2B4SB 4W4YA 2UZUE 2YIWA 3LXKA 4RG0A 5CVGA 5AM6A 3C7QA 3TTJA 3WF6A 4ACHA 4A06A 4FOBA 2C3KA 2Q83A 2VO7A 2ZVAA 4XBRA 3V8WA 5M08A 4F64A 3SVVA 2WU6A 5BMMA 3LFCA 5E8WA 1OL7A 4FOCA 2VQDA 1U54A 2Q0NA 2ZDUA 2GNIA 4X7QA 1CS0A 4O7TA 4ZS4A 2UW7A 2WMXA 3UOKA 2VTRA 2XCKA 4QQTA 1VBGA 2BZKB 3SV0A 3FXXA 1B38A 4YJRA 5IQDA 3KU2A 5D7AA 4FKRA 3II5A 4DH3A 1KJIA 4FL1A 2R0UA 1Z2OX 2OZOA 4P2KA 4AN3A 5AX3A 5A4CA 4RWJA 3NNVA 5HD4A 3RHKA 2JD5A 2FSLX 4C5AA 4KSPA 5I0BA 3G6GA 3NCGA 4Y5HA 2WMSA 3EQRA 3IDPA 4TYHB 3R7IA 5C4KA 3D83A 5M4IA 3S0OA 4Y95A 2CGWA 3I60A 4Z9LA 3MYGA 3QLFA 3ZUUA 2RIOA 3LQ3A 1SMHA 5DRBA 4FTUA 4O2AF 4Q5HA 1H1QA 3CQEA 1S9IA 1GZNA 2RF9A 4W8EA 4AN9A 3LFBA 4Q9SA 4NSTA 2QC6A 3F3UA 2B55A 3VBTA 2VTAA 5IQIA 4F6UA 1VBHA 4EK5A 4EJNA 5CSWA 4IB1A 4AZFA 2UZBA 5HIEA 3ZUTA 3IGGA 2YDJA 4ANSA 5IA0A 1J3HA 2DZDA 3NIEA 1CTPE 2XK3A 3PZHA 3W2CA 3MI9A 4FKOA 3W8QA 4GV1A 2EU9A 4U97A 4D28A 2PY3A 1W84A 2VWUA 3TJCA 4RA4A 5HTBA 1WAKA 4RPVA 4BRXA 2PMIA 2OU7A 4ANMA 3SGCA 3GU8A 2HWOA 2WTDA 5CAOA 4MK0A 4TN6A 4GYIA 3ZDIA 5I9WA 2WYOA 1IA8A 4KA3A 1ATPE 5F1ZA 2OG8A 3C5UA 2XIKA 2XD4A 3DPKA 3VHKA 2W1FA 2QNJA 2UZEA 3UGCA 3HMIA 5A46A 4XP0A 3MPMA 4EH5A 3UOJA 4RWKA 2CGVA 1I7LA 2YERA 4FKJA 3NDMA 4LGGA 5E91A 4L52A 1OBGA 2C4GA 4E5BA 4DFBA 3R1NA 5IMEA 3QWKA 4I20A 5CZIA 4ERWA 5CNNA 1MUOA 3Q3BA 4NM5A 4JXFA 2OJFE 4MEDA 3O8TA 4WD5A 1PXKA 3EJ1A 3LOKA 3SC1A 4AAAA 4APCA 4PP7A 2XK8A 4HNVA 4PQNA 3Q60A 3H4JA 1URCA 1YXTA 3F2NA 4QYEA 3FLSA 1FINA 1W96A 2Y8OA 3GC0A 2G15A 2WMRA 5KBQA 4U41A 3RMFA 4D5HA 3QCYA 5LWNA 4BGQA 2P33A 2PVYA 3DAKA 1G8AA 4HVGA 4XYLB 1U54B 3CKXA 4D58A 3NGAA 5E8YA 3MWDA 3B2WA 3FQSA 4CRLA 3GC8A 4F7LA 4FKTA 3WYYA 4FEXA 3UO5A 1H25A 2XVDA 3G8DA 2UW9A 3OWJA 4XG3A 4AG8A 5ETAA 2BRMA 4NW6A 3V01A 3R7UA 4ZHQF 3FHRA 4R3RA 3M1SA 2V5QA 3RK9A 5AAGA 4DEAA 4C02A 3C4EA 2PWLA 3WO1A 1R0PA 3HECA 2BRGA 3R83A 3WF8A 3KEXA 1HCLA 3L8VA 3RI1A 3VIDA 3WILA 4WIHA 3EQFA 3CR0A 5K5XA 1YHWA 4JAIA 3Q4CA 1XKKA 3Q4TA 2X6DA 4JLCA 5DFPA 2RKUA 2Z7LA 3WZKA 4MV4A 4RSSA 4RC3A 4YMJA 3OBGA 3SAYA 2PVPA 2GNJA 2R64A 3JXWA 1KOAA 4BCIA 5HBRB 4KBAA 4O2ZA 2BZHB 3D5UA 4QP7A 1JSVA 3PPZA 4FV1A 4L00A 4BI0A 4F1MA 4Z7HA 5IEVA 1TQIA 4H3BA 5LXMA 2WKMA 1ND4A 4LFIA 5C26A 3Q1KA 3LLAA 4G1WA 1ZOEA 3OUNB 2VO0A 1YXUA 2BAKA 4EUTA 3ENMA 3MY5A 4ZJVA 3PTGA 1BKXA 3I0QA 5EM7A 3W10A 3SOAA 4BF2A 4TWCA 3LXNA 4UY9A 3OFMA 1FMOE 3ZC5A 4BCHA 3UNKA 2QOIA 2VTJA 3DFAA 3OCGA 3IOPA 5CI7A 5JH6A 4JR7A 1F5QA 4BYJA 3HV3A 5KMLA 4FU0A 5AP1A 3UIUA 1EH4A 2X4FA 5I9XA 2FB9A 4PNKA 3CQUA 4E20A 1XH7A 3QBNA 3BHYA 5FEQA 4ARKA 2W96B 3TXOA 5JZNA 2WOUA 3ZM9A 4C4IA 2OJ9A 4IJPA 5CAUA 4F99A 4K1BA 2X81A 3EQBA 4TYHA 4Y8DA 3BKBA 3LJ2A 3NUYA 5IH6A 3AD4A 4XG9A 4LYNA 4ZMEA 4B8MA 5KMOA 4V05A 4I6FA 3NWWA 2FB8A 4UWBA 2PPQA 4QTDA 1YDRE 1M7QA 1QPEA 3OUKA 1I44A 4JIKA 4QMMA 4CZUA 2PU8A 5LOVF 3VS0A 4ZI7F 4F7NA 3WBLA 2ONLC 3PJ2A 5CB4F 1IR3A 4P5ZA 3OTUA 2J0IA 4X2JA 4FTLA 3UYTA 4FX3A 4ANLA 3GP0A 3HMOA 3VPCA 4YJUA 1GIHA 2PUUA 3N4TA 3BHVA 4E5WA 2CNUA 5LP6F 3TT0A 1Y6AA 3LE6A 3LFNA 2JAMA 4RJ7A 4EH6A 4EOJA 3MW1A 4L7FA 1OIUA 4I6HA 4M84A 3ACJA 3FMLA 3T9IA 2ZM1A 5M4UA 3QCSA 4BGHA 3EQGA 4RRVA 3VS3A 3OY3A 2XYUA 3CS9A 3UTOA 3F5GA 2B54A 1YXVA 4EKKA 2XBJA 4BTKA 2X0GA 3VS7A 3SOCA 2PVKA 4QYHA 1SNXA 2I0VA 3AXWA 3HDMA 4CTBA 4DG2E 2A2AA 4FIIA 3OTVA 4GJ3A 2UZTA 4GUBA 4CFVA 2C3LA 5DWRA 5AA8A 4BZNA 4AFEA 4PDOA 4I94A 2GNHA 2R2PA 4TNDA 4BICA 2X8EA 3QA8A 3OCBA 5DRDA 4YUQA 4BKJA 3KAKA 4R7HA 4IQ6A 4ITJA 2EUFB 3BZ3A 2HW6A 3Q9YA 4J8NA 3BWFA 4TYGA 1PMUA 3MGYA 4O6LA 4DHFA 3EN5A 3PG3A 2DIKA 1APME 4FEQA 3P78A 4X2FA 2XRUA 4FGBA 5DN3A 2W9FB 5ANIA 3T8OA 2C0IA 3KULA 4V0GA 5E8SA 5B7VA 3UFXB 4AW5A 5L2SA 4MXXA 3SW7A 2Y4IB 3R2BA 3LXLA 1BL7A 3R9HA 3PSCA 3VS4A 4AP7A 4XX0B 2WMTA 4WSYA 1PRYA 2JDRA 4M0YA 3LLTA 4BR3A 4FT5A 4GT5A 2X4ZA 3HRCA 5BYZA 2HW7A 2JEDA 1UU8A 3AT2A 5CA0F 1PXPA 2QF7A 2XK4A 3RJCA 3HO8A 4YJPA 2C1BA 4LG4A 1JOWB 1PMEA 3HL7A 3KY2A 1GIIA 4FFNA 5LJJA 2ETKA 3EYGA 5EDRA 3QKLA 3UVPA 4UWCA 2ITNA 3PRIA 1IG1A 2X7FA 4EORA 3U8WA 2UW5A 3U9CA 1Q8YA 3CP9A 4LRKA 4RJ8A 4XHKB 4AT3A 3V5QA 2QOFA 1E4EB 4J95A 2V59A 4NT4A 2O3PA 5TKDA 3TCPA 4EK3A 2YM8A 4MF1A 1CSNA 3CD8A 3QQHA 1PXJA 2HELA 3PE1A 5B2MA 5F9EA 4J97A 4X3FB 4DGLC 2R86A 3EQDA 1J91A 3IECA 3CE3A 4OTQA 3L9LA 3RFCA 1YOJA 5FGKA 2QQ7A 4O7ZA
chains in the Genus database with same CATH superfamily
4XNEA 3L8PA 4FIGA 5IU2A 5J8IA 4MWIA 4FR4A 4RA5A 3S95A 3ORXA 5JFSA 2R7KA 5GHVA 3E3BX 2GHMA 4KKEA 4O0SA 2F2UA 4RC2A 1VS0A 2ESMA 4WG4A 4I41A 4I92A 5E8VA 2CGXA 3ZO2A 2JLDA 3BHUA 4CC5A 4AW2A 3TY8A 1PYXA 3AC3A 2YZAA 4BYIA 2HVQA 2OO8X 2XA4A 2YHVA 3MH0A 4IEBA 4RWIA 2GNGA 3EKKA 3FLYA 2XNGA 4KIPA 3ID6C 2AUHA 2BAJA 2PVLA 2C6MA 4QMVA 5FG8A 3AOXA 3PY0A 4LMNA 4O4LF 4TUYF 5DISC 4O7VA 1SYKA 2BRHA 2GHLA 2W1IA 3ATTA 5FTQA 4S2ZA 5D1OA 3ZSGA 3JYAA 1ET0A 4LRJA 4UBAA 3VRYA 5C4LA 1JKSA 2C69A 4PWNA 4APPA 4O7NA 2Z8CA 4FT7A 5FP5A 2PVJA 3MIYA 2VWIA 2WQMA 2O5KA 3C51A 4RZVA 4L1KA 4ANQA 4G6NA 4G3CA 2QO2A 5BVOA 4RX7A 2XM9A 1Y8YA 4NW5A 1OIRA 5AP7A 4ACDA 4FYNA 4LGHA 2O65A 4OT6A 3ZLWA 5FDPA 2XAMA 1QCFA 4GIIA 4HGTA 4A07A 5IUHA 4M3QA 4MBIA 1E9HA 4ME6A 4UFZA 3Q52A 3VBWA 5AWMA 3WF7A 5LARA 2X2MA 3UODA 1XH6A 2V62A 5CSVA 5AAFA 3W55A 3UMWA 2Y4PA 3CQWA 5DGIA 5KMNA 4O4IF 4YR8A 2OLSA 3PA5A 4EWQA 3SKCA 5BVDA 3NYOA 5KCVA 3WWIA 4FNZA 3ERKA 3WWHA 2YN8A 2GTNA 1CKIA 4DBXA 2ZV7A 1WBTA 2DYLA 2QO7A 3G0EA 2J5FA 4FV9A 2CKOA 3R8PA 2ITVA 4MXYA 4DFYA 3L1SA 3LMIA 2JITA 3MIAA 3NUUA 1KJJA 1Y6BA 1KJQA 5HCXA 4CGAA 1KE9A 4E8AA 4EOSA 2C5OA 1F3MC 2CN8A 4DYMA 1OI9A 4R6VA 2VNWA 4O4HF 3KN5A 5EYCA 3MA3A 1AD5A 3T3UA 4FG8A 3ZO3A 3MTFA 2VTIA 4C36A 3F82A 5C8NA 2ZB0A 3FKNA 1BL6A 2IVUA 3LJ0A 3MFSA 3CPBA 1V1KA 3FMMA 4LL5A 4WBOA 3W2QA 4Q9ZA 2W1HA 3EMGA 3RHXA 1W93A 2DLNA 5DNRA 5KZIA 4KBCA 4AE6A 4F4PA 2FSTX 3NX8A 5L2WA 3ZM4A 3GCQA 5HICA 4EQCA 4FL2A 3D15A 2HXLA 2XRWA 1JPAA 3DZQA 3RNIA 4Q2AA 4EOQA 5JN2A 5IQFA 5C1OA 4ZAUA 2YWPA 3RTPA 1H4LA 5ITAA 1DAWA 2WQEA 3ZDUA 4JS8A 2ZDGA 5HE2A 3HMPA 4YBKA 5C1QB 5CF5A 4CFMA 2YZGA 4I4EA 5ANKA 3JZ6A 5E1EA 2H8HA 3OXIA 4G3EA 1LP4A 4GS6A 2EIYA 3ORPA 4KIQA 1W0XC 2R7IA 3FYJX 4BVUA 4DDIA 2EXMA 4F0FA 3UG1A 5DVRA 3KK8A 4NKAA 4V0GB 3O8UA 2C3JA 4IWQA 3UZRA 3G8CA 4GK3A 4OTHA 3FHIA 4P90A 4DC2A 4KS8A 1GSHA 3T9TA 4KIOA 3LIJA 3KB7A 2XZSA 4K18A 4HVDA 1UA2A 4FSUA 4FSYA 3LXPA 4W4WA 3EQHA 3MVHA 5A4LA 5CEPA 4JOAA 1A06A 3HMNA 3O71A 3F69A 4C35A 3GT8A 1I7NA 3HRBA 3BV3A 4CTCA 1SVEA 4JBPA 3QRTA 4WUAA 5E92A 4XZ3B 3F5PA 2JBPA 3EN7A 1Q3WA 4ZSAA 2RFDA 4RX9A 2OJJA 2BZJA 2OF4A 3VQUA 1UWHA 5HLPA 4C3FA 3OBJA 5C9CA 1XMMA 2WD1A 3O23A 3EZRA 1VR2A 4R78A 4NTTA 3FUPA 4AU8A 4HVSA 2OGVA 4U81A 1H26A 3RAIA 3NCZA 3VW6A 4DBNA 3QLGA 1UKHA 3JS2A 3GI3A 2G1TA 3PY3A 4H05A 4JBOA 4L8MA 5K3WA 4K9YA 4HCTA 3HA8A 4P7EA 3KMMA 4NUSA 4M0JA 2ZFYA 3UZPA 4TY1A 3D7ZA 4L46A 4LRMA 5IH5A 2OH0E 4IIJF 3OMVA 2W1CA 5IUGA 5GONF 2XS0A 3W2SA 4DAAA 1WBWA 2XB7A 4AS0A 4DH1A 5JVDF 3RK7A 2QOKA 2PYWA 5A6OA 4MNFA 3V6SA 4BDBA 5FEDA 1H1SA 2JKOA 2PVFA 2YCRA 2ITQA 4IX4A 5BVFA 3UQ8A 5CU2A 3F2AA 4GJ2A 4TYEA 3JVSA 3QRUA 5JRSA 5I5UA 5D10A 5CU3A 4GUEA 3QZGA 3KXMA 4JQEA 5F95A 3MA6A 3QF9A 4GH2A 4NCTA 2ZV2A 1XH4A 2XEYA 4WNKA 4RX5A 4DRFA 4CFXA 2UZNA 2QR8A 3C5IA 3FAAA 4G5JA 4L6QA 2PULA 3MESA 4OLIA 4QQ5A 3F3TA 1PXIA 5CAVA 1UC8A 5M55A 1U5RA 5KHXA 3NR9A 3UZBA 1J1BA 3K3PA 4PP9A 2WMUA 4U5JA 3DK3A 5ACKA 2JC6A 3JPVA 4FZDB 4QYFA 5DR2A 2XIRA 3VF9A 5A54A 3QTZA 2YCQA 2J9GA 1Q61A 5LVNA 3HUCA 4KD1A 2F57A 4BDEA 4FTJA 1WCCA 2C5VA 1LUFA 3G33A 3QTQA 3NRMA 4FIFA 4LOOA 3O50A 5AV2A 4YSJA 1QPDA 4Z16A 3BU3A 4TV8F 4TXCA 5JH7F 1XMLA 1I1LA 3F5UA 2JDVA 4FT3A 4BI2A 4BCOA 2LGCA 3UDTA 2HAKA 4JMQA 1OKZA 3PVBA 3REPA 3VUGA 4J8MA 4I0TA 4A9YA 3TW6A 2C6OA 5FBOA 2J9MA 2CCIA 2B0QA 3DV3A 2FP4B 3QTXA 2FPIB 3W8LA 4EGQA 5I5XA 1KOBA 2H34A 4C4HA 3CY2A 4F78A 4DT9A 4QMSA 5JFXA 3ULZA 1DAAA 4IM2A 2J0JA 3DU8A 3F66A 4QPSA 4XH6A 3KAJA 2FH9A 4KABA 2ZJWA 1OBDA 3SG8A 4EHGA 3HMMA 3PY1A 3U9SA 3ANQA 1Z9XA 3GOPA 3NW6A 4FK3A 5FRIA 4PDSA 4FZ7A 5FPRA 5J9YA 4JDIA 4EQUA 4ENXA 3T9FA 3IQ7A 2WTKB 4K6ZA 2IG7A 4DE4A 4AF3A 5AUWA 4XG7A 4BCQA 3BLRA 3WE4A 3IONA 3ORTA 4BTFA 1XO2B 4L01A 3VUIA 3RV3A 2JFLA 3WIKA 4RT7A 3TL8A 4WA9A 3GGFA 4MV9A 3PJ1A 5FXQA 1K3AA 1L3RE 3A60A 5AX9A 1PKDA 2C6EA 4C62A 4DEEA 3JRXA 3UNZA 3F5XA 1M14A 2XAOA 3AQVA 2UUEA 3HGKA 3HUBA 3KMWA 4J99A 4BBMA 2JBOA 4XG4A 4YAKB 4MCVA 3AT3A 1VYZA 4FTNA 2YRWA 3QXPA 3FMHA 2V5AA 3V8TA 3F61A 1B04A 5BUJA 3ZO1A 4BJJB 4LM5A 4QP2A 5FDXA 2IVTA 4QTAA 2BMCA 4GVAA 3OW3A 1XH9A 3FV8A 4S33A 1P2AA 2GQRA 3EL7A 2UV2A 4I0SA 4FC0A 1GLVA 2PE1A 2ZB1A 5AUYA 3BV2A 1J7UA 2Q2TA 3M11A 4BZDA 2C6KA 3RAWA 1RDQE 5EQEA 4L42A 1PXMA 2OJIA 4IADA 3D9VA 2YS6A 4IAYA 3ZRKA 4JL9A 3HYHA 2FSOX 2Z60A 3ORKA 5HBJA 2VRXA 3FEGA 4QRCA 5HG9A 2C6TA 4LMUA 3BYUA 2PVNA 3EWHA 3K2LA 5GJFA 4EH7A 3BHHA 2IPXA 2PMOX 5DPVA 4YP8A 5C03A 1IOVA 2ZM3A 1HCKA 2ITOA 2R5TA 1YWVA 3BYSA 1URWA 1P4OA 2QOLA 1NVRA 1K9AA 3DK6A 4HNIA 4TWNA 5LXTF 1Q99A 2G2HA 4BI1A 2HGXA 1H08A 3DFCB 1X9NA 2I1MA 3BL7A 1H07A 4YTFA 1XBAA 3BBTB 3AC8A 1FVRA 3AD6A 5JQWA 2CPKE 3PYYA 3GU6A 3NVKI 4AXAA 1DI9A 3VN9A 5FD2A 3TDVA 5AP6A 4N4SA 4DTAA 5CS6A 2JFMA 4FIEA 4M12A 3MN3A 2CLXA 3PJ8A 5DOSA 1WZYA 4EOIA 3RPOA 2R3OA 1KJ9A 5C01A 1Q8TA 4EFBA 5EFQA 4I21A 3LFEA 2PZPA 2X2LA 3C0IA 3CXWA 2W5HA 3W32A 1H01A 2XIZA 1DI8A 3FI3A 4OW8A 2F2CB 5DIAA 4DH5A 4ASXA 4QP3A 1GSOA 4NKSA 4CKCA 4YC6A 4A4OA 3ETAA 3PFFA 4N6ZA 1BLXA 4ASEA 4BTMA 2PVMA 3G2FA 2YIYA 4FSQA 4O0VA 2FO0A 3EQPA 1YKRA 4YPDA 3Q53A 3CBLA 3GVUA 3HKOA 4YJNA 4DHJA 1KE8A 2XNBA 2E9OA 4PTEA 5HE3A 5I5TA 3TUCA 3FY2A 1PHKA 2R3KA 3P4KA 4R5YA 4TW9A 1KT8A 5DAAA 3R8VA 2WMBA 4IX5A 4FTMA 3QD4A 5AV3A 4F08A 3BLHA 4ZSEA 4ZXTA 1DGSA 2DWCA 3R8MA 2E9VA 2CSNA 3BL9A 3P9JA 4A9SA 4U3YA 3ET7A 2OZAB 1JVPP 3F9NA 4H3QA 4DH8A 2C5YA 5HG5A 5IQCA 5KMJA 2B9HA 4G9CA 5I5ZA 4YNOA 2P4IA 1DM2A 3QUDA 1T46A 2PVHA 1Q8WA 3OWLA 5AIKA 5KE0A 1HOWA 2HIVA 4MV7A 1YDTE 3LFSA 4U45A 3ETHA 4IAAA 4O7YA 3PXKA 4RZWA 4YHFA 4EQMA 4WNOA 4MUQA 2IWIA 4JJRA 4UB7A 4KS7A 3PA4A 4C58A 4OTIA 4IX6A 4YSMA 5L6PA 5J1WA 2WMQA 4FNYA 2CZGA 2YABA 3C9WA 4QYGA 4FTRA 3FPQA 3CKWA 3C50A 2XK9A 2YDKA 3QX2A 4II5A 4KWPA 1AGWA 3K5IA 4NZWB 3OY1A 3LPBA 2YFXA 4EWHA 2W1EA 4MBJA 3AW8A 4IHPA 5JZJA 3N4VA 2NU7B 1I1KA 4U79A 5E4HA 4MH7A 3KIOC 3RPVA 3LMGA 4FJVA 1QMZA 2CN5A 3POOA 2ITTA 3RGFA 3LM5A 4FV6A 4X0MA 5L2TA 3R28A 3F3ZA 5HHWA 3R1SA 4BDKA 1A9XA 3FQHA 1R3CA 5HG8A 4HVIA 3PIXA 2GHGA 1UU3A 2B9FA 1MP8A 3FZSA 4O7LA 5LCKA 5EK7A 1IYDA 2HGSA 4CMUA 2ITWA 2CKEA 3UOHA 1Q24A 2ACXA 3D5VA 1H1PA 1NVSA 4I0RA 3GU5A 5FLFA 3KRWA 2IW9A 5IQAA 2I80A 3VPDA 4O0TA 4TL0A 1SCUB 3KXGA 3C4WA 4YTCA 4F70A 3GLKA 3VULA 5AAEA 1XK5A 3KRLA 4CMOA 1JSUA 4BDJA 1OKYA 4ZZMA 4BY9E 3QAME 5FP6A 5BVWA 3GEQA 3CCNA 1SVHA 4YJVA 3HEGA 3RM6A 2XIXA 4IWDA 3RUPA 5JQ8A 4K2RA 4PTCA 3W18A 5EI6A 3D14A 3LFFA 4FKIA 4DQNA 2OWOA 3EN4A 2Y7JA 4ALVA 2IW8A 3DJ6A 3E7VA 2VO6A 1WBVA 4FSMA 5EHLA 3UG2A 5CX9A 1UC9A 1OGYA 3KXXA 1B6SA 2WPAA 1YXXA 5JFWA 2OSCA 5L8KA 1YWRA 3QFFA 5JRQA 3E8CA 3FLQA 4IZYA 3NSZA 4QDVA 5CAPA 3FKOA 3QHWA 4WRGA 4F1TA 2A4LA 2VUGA 3VVHA 2W6ZA 3CPCA 4DFNA 2EB2A 2YZNA 2CGUA 3UIBA 3HZTA 4ID7A 3I5NA 5LVPA 2R3HA 2GU8A 3GBZA 2XBAA 3ZRMA 4ALUA 3EB0A 4I5HA 3LFQA 3WF5A 1WBOA 5E9EA 1I1MA 1UNHA 1G5SA 4HYUA 4H39A 4NM7A 2XM8A 2XNEA 2J90A 1XDNA 3LULA 3P79A 4YZMA 5I9ZA 1UVRA 5CAQA 2R3QA 3A7FA 4ZTNA 4FFLA 4E4LA 2XNNA 3RCDA 3TDWA 2HIXA 4XV3A 4YJOA 3PUFC 1VKZA 3SDJA 3DBDA 4XUFA 3V5WA 1TA8A 4KUJA 2AYPA 3KCFA 3NAYA 4FKLA 1EZ1A 4CFWA 3ORIA 4KRCA 2V7AA 2WIPA 3FWQA 3LP8A 5BYLA 2XP2A 2NU6B 4A9UA 2FVDA 4YO4A 1JLUE 2YCFA 3P7AA 4L3JA 5BWRA 2A19B 2YDIA 1ST4A 4AT5A 4AXFA 2W6OA 3POZA 4AOJA 1CKPA 1IA9A 1KE7A 2HZIA 3T9BA 4D2SA 4EUUA 3I1AA 2W1GA 3RAHA 3VBXA 4DGGA 4GKHA 3KC3A 4O84A 5EM5A 4AT4A 3DF7A 5HNGA 1GSAA 3A7HA 5G1XA 4W4VA 3UIMA 1TQMA 2ZV9A 4U40A 1LR4A 4AZEA 3F7ZA 3K5VA 4QP9A 3QX4A 4XYFA 3TJDA 2WEIA 5L6WL 2W71A 2UVZA 3VBYA 4CT2A 5CQUA 1XR1A 2OFVA 4S34A 5LMKA 1PMVA 3TIIA 3UNJA 3VQHA 3UPZA 5HNBA 3ZLSA 4NWMA 4O82A 3ALNA 3QTRA 4HCVA 2UW0A 2XJ1A 3TKHA 4UCVA 3NNUA 4I93A 4Y72A 1GIJA 3IKAA 2VUWA 5TT7A 5DGHA 3DCVA 3U6JA 4J98A 4MQ2A 3Q5IA 3VOTA 4XMOA 3U6HA 4DHZA 1SM2A 4NZNA 4ZEGA 1BI7A 4LV5A 5HESA 2JKMA 3QC4A 4GT4A 4KBKA 3KREA 2I7QA 5HI2A 1P5EA 4J53A 5CT0A 4K33A 3SXSA 2COJA 2R3RA 3CTQA 4E93A 4E6NA 2SRCA 4O86A 4BZOA 3CGOA 3WWJA 1ZARA 4F9WA 4OTGA 5A4TA 4PUZA 5CE8A 3QQKA 5HO8A 4CG9A 3AMYA 2NU9B 3R73A 4HCUA 3WZDA 3KMUA 4ITIA 3I79A 3T54A 2W70A 2PMNX 2HY0A 5EHOA 3R8LA 3U87A 1ZYSA 4FZFB 2H96A 3VF8A 5CALA 3VA7A 3QTUA 2P0AA 3IOKA 4EBWA 2O2UA 1FGIA 2C1AA 3NNWA 3RKBA 4QMNA 4ZY4A 5J9ZA 1I2KA 2ITPA 4IM3A 4L7SA 1J7IA 4PBCA 3TNWA 1W83A 3IGOA 3W0MA 3SGIA 1ZAOA 5D12A 5HIBA 4IBMA 3R8ZA 4EHZA 4HGSA 4FVQA 5ETCA 2WELA 4F6SA 2QHNA 1OL1A 3PA3A 4ZY6A 2WTJA 3ORZA 4FZAB 3C4CA 1OL2A 5ANGA 3UOLA 3AC2A 2OBJA 1A0IA 2OKRA 4PTGA 1OKWA 2IW6A 4FG7A 4PV0A 2XCLA 3JY0A 4FKVA 4FMQA 5E8TA 1KSWA 3NIZA 4FI1A 2VX3A 4RMZA 4USDA 2XNMA 4B7TA 4LUDA 3SXFA 5IZFA 2XMYA 3G15A 1RJBA 4IJ9A 4IZOA 3FE3A 5HKMA 4MTAA 4ZJJA 5AJQA 3IW8A 4JT3A 2B53A 3UP7A 4CVAA 4AA5A 1G8JA 4XCUA 1Z5MA 2C47A 3PXRA 5HCYA 2IO6A 5J95A 3RINA 4ZTSA 4FVPA 4O2PA 3W33A 3ZBXA 2W7XA 4AFJA 2PK9A 3NFFB 1M0WA 4LQMA 3DQXA 1YHVA 1QL6A 2BKZA 4PL3A 3W0QA 5LQFA 2WTVA 5EYMA 2ZGIA 1W8CA 3L9NA 1PX2A 3TYKA 3PDTA 4JX7A 3OWPA 4FT0A 1FVVA 3VAPA 4UN0C 4GK2A 4QTBA 4E6DA 3ROYA 2NP8A 5HO7A 4E1ZA 5LMAA 3TIGA 3AC4A 4HYIA 4MD7E 2NU8B 3LFAA 3ANRA 4G9RA 3E64A 3MSSA 4OBOA 1EUDB 4C4FA 4MNEA 4FV2A 1SVGA 4PDPA 4IM0A 3NUPA 2VAGA 4D9TA 4EK6A 2R0IA 3HV5A 5EKOA 3FLNC 3MB6A 3FL4A 4M0ZA 3A8WA 3H3CA 4RC4A 3SQQA 4XOZA 3OCTA 3ZHPC 4DEGA 5J7HA 1B6RA 3BRBA 4RVTA 3QZIA 2G2IA 3M2WA 2WFYA 5AUZA 4HNFA 3LKMA 4O22A 1YQJA 3DK7A 3LM0A 5CZHA 5EG3A 5GNKA 4EOLA 2GPSA 4TYIA 3Q2JA 3KGAA 3MPAA 3QGYA 2F4JA 1PJKA 5HG7A 4O0YA 1A9UA 2XUUA 3FI4A 4RGJA 4CKRA 3LMHA 2V0DA 3QTIA 4C4GA 1GZKA 2HXQA 3DOGA 3LHJA 5E25A 1ZAUA 2UZLA 4J96A 4WHZA 3TEIA 3OW4A 3ZCLA 4DAWA 1ZMUA 3MJ1A 4F9YA 4C3RA 4IVBA 4MHAA 3W2RA 3GOKA 3WOWA 4ZZOA 5I5WA 3NC0B 3PXQA 1XBCA 5AFVA 4C7TA 3BI6A 3E92A 4M68A 4V01A 3SX9A 2XK7A 3UO4A 1EKVA 3LAUA 3R63A 4G16A 4K77A 3LCOA 3ROCA 4FL3A 4FUYA 4O7SA 3UIXA 4HN2A 4E6QA 1JBPE 4FYOA 4O96A 3UC4A 4FFMA 4O0WA 4O4JF 3CIKA 4NFNA 4FSNA 4GG7A 2UZDA 2YM3A 4FTCA 3C13A 3LQSA 3T9DA 4U7ZA 3AT4A 1E1XA 3QQUA 4CG8A 3KXZA 4QPAA 4JXUA 4W8DA 4XP2A 3PFYA 3EYHA 5DA3A 4DGOA 4ZSJA 3LCTA 3M42A 3BELA 2YW2A 4ERKA 4U80A 4NZOA 3KRXA 3EL8A 4L67A 4O91A 3TW7A 5TO8A 4AACA 4XX9A 4Y5QA 4BDIA 2A0CX 5HCZA 5JVLA 3FI2A 4GT3A 4RVMA 2EWAA 5L6OA 1ZYLA 3TNIA 1OVEA 3R1QA 3VUHA 3IW4A 1EUCB 1YI6A 2GQSA 3LQ5A 3S2PA 2XEZA 3DBFA 3F3VA 5EOLA 3ZXZA 4AE9A 2VGOA 2QB5A 3UO6A 3SA0A 2W6QA 4PL5A 5J2TF 5M06A 1YOMA 3T7AA 3DAJA 4DINA 4QP1A 4Y83A 5JEBA 4UCOA 4RBLA 3GB2A 2FPGB 5CEOA 2I8CA 3OUUA 2NO3A 1V0OA 2E2BA 5KO1A 3MDYA 3T9EA 4Q4DA 3AD5A 4XLIA 3U9NA 4B8LA 1FOTA 3WYXA 3CTHA 3MTLA 2HHFB 3KKVA 3U54A 4FVRA 2X8DA 2W1ZA 4GU9A 5AV1A 5IQGA 4FZ6A 5CF8A 2GPWA 4WRSA 5HBEA 1U4DA 2QVSE 4GYGA 4OT5A 2PE2A 3DA6A 4IFGA 4OTFA 5HNEA 4JRNA 4QMUA 3KN6A 3UDSA 2BCJA 4DEIA 4F7SA 3W2OA 3W1BA 1XBBA 3HDNA 5F94A 5HV6A 2J0LA 4HGLA 4BB4A 4J52A 3MJFA 5I47A 2JDTA 3EQCA 3PJ3A 1Z2NX 4Z55A 4YHJA 2OZAA 5F4NA 4AZSA 5I5VA 3UBDA 4I4TF 4RVKA 3DKOA 1MRYA 4ASDA 3MB7A 2WMAA 4DGMA 3D4QA 5AP5A 3TY9A 4AAYA 4BIEA 4WO5A 4OUCA 3COIA 3LFDA 4QYYA 4HNTA 3Q2OA 5A4EA 5BVNA 3AKKA 4AW1A 4BCNA 2HIWA 4DFLA 1V0BA 4ZLYA 4GFOA 1QPCA 2VTTA 3BACA 3MBLA 5CNOA 4QNYA 4AUAA 1KEEA 4F7JA 1H1RA 4GSBA 4MV6A 4AA4A 2JDOA 2QONA 2RGPA 3DB6A 2IZUA 4QMLA 2VTQA 4UWYA 1NY3A 5IDPA 4ITHA 3SLSA 4EOMA 5GIOE 4PZ6A 5EW9A 5KMKA 4ZQIA 3RALA 5FUTA 4E4XA 3EFLA 3HX4A 5IISA 3IDCA 4QMZA 5GIPE 5LA6F 1Q8UA 3I6WA 5CWZA 5L8LA 4MV8A 1KBLA 2HWPA 3R21A 2XKFA 2JGZA 3I7BA 3R04A 4IWXA 1BUHA 1JSTA 3OG7A 3QGWA 4FT9A 4I5CA 2Y4IC 4WG3A 2PUNA 5AV0A 1WVWA 3I7CA 4FSZA 4F09A 4TYJA 2ZMCA 1SNUA 3SW4A 5EM8A 4YGAA 4KSQA 1MQ4A 5KBRA 5EW8A 5BUIA 3NUXA 2JKKA 4X2GA 1Q8ZA 3MVJA 3TNQB 4DFXE 2R7LA 3DTFA 2PVRA 3VNNA 4C5BA 2OIQA 3DXNA 3E8NA 5KKRB 1P8LA 4BDGA 2O64A 2P55A 3G5DA 4UCUA 4IAFA 2XNOA 3UQCA 4XV2A 4I24A 4L9IA 2WNTA 3ZRLA 4CD0A 5EI2A 1JLLB 4HR7A 4IWPA 2UW8A 1JKTA 2Y9QA 2OH4A 2J51A 4V04A 2QOOA 2I0EA 3NUAA 1CKMA 4FKWA 4YHTA 3C0HA 4F9BA 3ZH8A 2JKQA 5HORA 5BPHA 1R78A 2I6LA 3VS1A 3D7TB 3Q5ZA 3Q9XA 1B39A 4XP3A 2QURA 5AUXA 2QD9A 3TZ9A 5H8BA 3PP0A 4WG5A 3DB8A 4N6YA 3F6XA 4AX8A 2WMVA 2R4BA 4QO9A 5ANDA 2A27A 1OZ1A 3DNEA 3F3WA 1OMWA 1R0EA 4LUEA 3LCDA 4U43A 3RVGA 3MJ2A 3DXPA 4X3FC 2EJ2A 4KINA 4RX8A 4GFMA 3QYWA 4X6RA 1JNKA 3OEFX 3QC9A 4FTAA 2CNVA 3KALA 3VJNA 4HGEA 1ST0A 4LV8A 3EH9A 4M14A 4DH7A 4IFCA 1GZOA 3QWJA 4XJ0A 5CENA 4N0SA 5CF6A 2WTWA 1WFCA 3QTSA 4FSRA 3HT5A 3TQTA 1PKGA 3O51A 1SZMA 3JY9A 3O0GA 4FEVA 5KNJA 2ZOQA 4OTRA 5D9HA 1WBSA 1GOLA 5HE0A 4YZNA 1UU7A 3GCUA