4O86A

Saicar synthetase (type-2) in complex with adp and cdp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-2) in complex with ADP and CDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 75
structure length 227
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o86A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o86A02
2Y9QA 5TO8A 3PRFA 4ZXTA 3C7QA 4FKWA 4BR3A 3DNEA 4QTEA 4PDOA 1WBNA 2E9PA 2IN6A 4NUSA 2JC6A 4FV5A 3GQIA 4GRBA 4XG3A 5KE0A 1XQZA 2HIWA 2CNUA 3I6UA 3MA6A 3EQFA 5JEBA 5D10A 1RJBA 4Q5EA 4IB1A 4QP4A 5DR2A 5ACBC 4HCTA 4BCFA 3BLHA 4MH7A 4RMZA 3UYSA 3VPCA 3OS3A 5EDQA 2XB7A 1UKHA 4M67A 3P08A 5CF8A 2CGXA 1ZARA 3KRJA 2UW4A 3VQHA 3JS2A 3OCTA 5CWZA 3R7VA 5EW8A 3SG8A 5IQCA 5LMBA 4FG9A 2A2AA 3UO4A 4DG2E 4KD1A 1Q8UA 3LXPA 2VWIA 5AUXA 5BVWA 3UO6A 3CY3A 2W1GA 4GV1A 3PA5A 5GHVA 3UFXB 4O91A 2B53A 2LAVA 5KMKA 2FUMA 2YWPA 2WELA 2XK9A 4F4PA 2GLTA 4FG7A 2YS7A 3HL7A 3AOXA 3BGZA 3V8SA 5HO7A 2NU7B 4M15A 2VZ6A 1Z2OX 4R7HA 1TQPA 5T3QA 5GINE 3A2CA 3D5XA 4CXAA 4O38A 4YZBA 5EZYF 4EORA 4EZ7A 3P7BA 2A27A 2JKOA 3AMAA 4XYFA 3W16A 3ORMA 1W98A 5AUVA 2V59A 3JR1A 4YC8A 1XO2B 1CQIB 5HG8A 2C6EA 3DAJA 4ARKA 5HTBA 5FG8A 3AD6A 3OWKA 3R9DA 2WQNA 2C6IA 3KKVA 4QP9A 4AT4A 2BROA 4AQCA 2XJ1A 5CANA 3POOA 5IQEA 4FKVA 3S0OA 2YABA 5EQYA 1PXNA 5E8SA 5E91A 2UZWE 2VX3A 3EN7A 3FMKA 5F1ZA 2XK7A 3KULB 2PY3A 2JBOA 4U44A 1QPJA 1TQMA 3KN6A 3Q2MA 3VW6A 3R0TA 4ASZA 3B2TA 1K3AA 3Q4ZA 5IMEA 5AMNA 3FLYA 4HJOA 3AGMA 5C27A 4GIHA 3ZH8A 1ULZA 2GNHA 1Q8YA 4NM5A 1YDTE 5H2UA 3RM6A 1GZKA 2SRCA 3H9OA 1OZ1A 1VR2A 5IH5A 4C5CA 5IUGA 2XKCA 4XMOA 4F7LA 4MV7A 4M84A 3MY0A 4XG6A 3HMPA 3QRKA 4NCTC 4ZJVA 2OGVA 4AACA 3BU6A 3QYZA 1YXXA 2BHHA 3E3PA 4X3JA 3W33A 5HE1A 5CSPA 4KRDA 3G9NA 3OBGA 1O6YA 3H10A 3FL5A 1H27A 2IW8A 4Z55A 3NYXA 4AA5A 2Z2WA 3AC1A 4IDTA 2X0GA 4PDSA 4RIYB 3DKCA 3IECA 2P0CA 5CXZA 4H05A 3UE4A 3D94A 4S2ZA 3D83A 5J95A 3R01A 4GS6A 5FRIA 2Z02A 3E5NA 4DT8A 1KOAA 2XS0A 1VZOA 4ZI7F 2E9OA 2PYWA 3D9VA 5CEKA 1Q97A 2DZDA 3OTUA 5BUIA 2BZIB 2OSCA 3U9CA 4EONA 4RIWB 3ETJA 5AP4A 1KUTA 2OICA 2XBAA 3ETAA 3FQEA 4I50F 3I7CA 2W4OA 4MXZA 4QQTA 2Y4IB 4YSJA 2XIYA 3ETHA 3OOGA 4FU0A 1KWPA 3LCDA 2ITVA 1YI6A 1KSWA 2UZNA 4Y72A 3P0MA 2P0AA 4XRJA 4YJNA 2VQDA 4FFLA 4DLIA 4QQ5A 2YZAA 5JN2A 3CD8A 4RIXA 2BDFA 2WTIA 3PVWA 2R3GA 3PTGA 4IB3A 3FLZA 4NK9A 3MY5A 3OG7A 3NAXA 1CKJA 4A9UA 4V04A 1R78A 4AGDA 4MHAA 1ERKA 2NP8A 2BALA 5HV6A 2Y0AA 4OLIA 1BL7A 5C4KA 5JGAA 5L2TA 4RFMA 3MPTA 2V5AA 1YW2A 3AGLA 3BPRA 4IVBA 4EOPA 4HNFA 2CSNA 1U54B 1JNKA 5IEXA 2WQOA 3M11A 4EK8A 1OI9A 3I0OA 2PUUA 4L3JA 5A4TA 4X3FB 1K2PA 2IVVA 2R2PA 2WYOA 5C8YF 4L44A 4MBJA 4M68A 3MA3A 3SOAA 5JFXA 3TUBA 4MCVA 4IC7A 3BHYA 5CY3A 1PXIA 2R3QA 3SV0A 5HBJA 2R85A 5EFQA 5HESA 1LR4A 2OWBA 5BVFA 1PJKA 2XIRA 3VULA 3R9RA 1VBHA 2WNTA 2SCUB 1OL1A 2Y4PA 2V7OA 3Q4CA 4HNIA 2IWIA 2ITUA 4GG7A 5H8EA 3QFFA 2F7ZE 2RL5A 3FYJX 4PMMA 2RFDA 3RHXA 4UV0A 3V5TA 3DDQA 5CLPA 2OW3A 4KWPA 4G6LA 2OIQA 4HYIA 3PVGA 5EG3A 5AJQA 2XCLA 1XBAA 5JQGF 4FSMA 3CTQA 4BCNA 4XYLB 1KC7A 4PMSA 1Q3WA 3V8TA 2IO6A 4W4VA 3AQVA 2X7FA 3KB7A 4GKIA 4WNPA 2FA2A 5E8XA 5HZNA 2PVPA 5JRSA 5AIRA 3NYVA 4IE9A 3CQUA 3WNZA 3HAMA 4ZTQA 4O82A 4CLJA 2YIQA 5EI6A 4GUEA 3LAUA 4EBWA 1WBSA 2B9IA 4Z7GA 5C8NA 1VBGA 5B7VA 3GCSA 2WQMA 2OFUA 2JDRA 4M12A 4RZVA 5E8ZA 1W82A 4I4TF 5FTQA 1JVPP 4A4XA 3Q2OA 3NNXA 2PE1A 3VS5A 4XNEA 5H9BA 5FP6A 3MI9A 4AZVA 4RJ6A 3UO5A 2JLDA 1FMOE 2JDSA 3ZUVA 2ZMDA 4BIBA 2FSMX 2VO7A 4FC0A 1PF8A 1Z9XA 3EZVA 4YZDA 3MH0A 4D2SA 5HVKA 3NZ0A 4R5SA 3DBEA 4Y73A 4YJOA 1IOWA 4X2NA 3ZO3A 4DH8A 1S9IA 2XH5A 3R21A 3TJCA 2I0EA 3EL7A 5KMLA 2PTKA 3K5HA 5D11A 3JVSA 2R7BA 3SX9A 3UOLA 4A4LA 3SKCA 1KBLA 4CLIA 2NU8B 2PZIA 3GOPA 4IX6A 2QI8A 4C35A 3UVPA 1GAGA 3IW4A 3RVGA 3VHKA 5I0BA 2C5OA 2C5VA 2QOFA 3ZRKA 4C3PA 3TKHA 3V5LA 2ZM3A 3DZOA 2VR1A 4ZMEA 2YW2A 3R7UA 5GIOE 1GIIA 3UG1A 4ZZOA 1AUVA 5CU0A 3EN9A 1YXUA 2R0UA 2VUWA 3EN6A 3NUAA 3VIDA 5B2MA 4DEBA 3UZTA 3P86A 4F65A 1W84A 3FZTA 3I6WA 2YERA 5JZJA 3AC2A 3DBCA 3AC4A 3F9NA 3KRLA 3PWDA 4RLKA 2VTRA 2CGUA 4QT1A 4C62A 2OK1A 5D7AA 1BX6A 3RM7A 5EM8A 1OKWA 4MV1A 2ZAZA 3A7HA 3FZSA 4RC3A 3CPCA 4BTMA 4BZDA 5C01A 4AA0A 2YIYA 1WMKA 2Y4IC 3F2AA 5LCJA 5M56A 2GS7A 3MIAA 1WFCA 2GS6A 2QU5A 4LFIA 4QTCA 3IDBA 4S33A 4AGUA 5BYLA 2A0CX 3VRZA 4H1JA 2B9HA 3S2PA 3TL8A 3MV5A 1OUKA 1E9HA 4ZTLA 4PQNA 4FFOA 1H0WA 2WTKC 3NEWA 3K2LA 5KKRB 4EOLA 4JS8A 4RLLA 3GEQA 5CALA 3FKNA 3GNIB 2OKRA 3IG7A 3NUPA 4H39A 5IDNA 3ZONA 3ZO1A 3UODA 4CV9A 3TJDA 1M14A 4QMTA 3KXMA 3WO0A 3VPBA 4NH1A 4O21A 1WBWA 2YL2A 3MY1A 4M3QA 2A1AB 5LMKC 1KJIA 3K3PA 1APME 4JOAA 4FR4A 2V62A 4X3FC 4QSHA 1MP8A 3RPOA 1H07A 5E8UA 2F57A 4FKTA 4FV4A 4J1RA 1GY3A 3DDPA 5AUYA 3F82A 3MFRA 4DEEA 3NUSA 4ZTRA 3AC8A 4WD5A 4MF1A 3RV4A 3D5WA 3CPBA 5DFPA 2YAAA 1YXTA 3UIBA 4J99A 4XHKB 5AV4A 5A14A 4ZK5A 3C4FA 2EXMA 3K5UA 1NVSA 5CQWA 5GNKA 5T6KA 3VBQA 1H24A 2YEXA 2R86A 3AX6A 4YJTA 5CU3A 4YC6A 2XCHA 3UQFA 2BZHB 3Q4TA 4QYEA 3SXRA 5I9VA 2VWBA 4IANA 5FDXA 5CSXA 3OROA 4ANMA 4O7TA 3TN8A 2XK4A 4G5JA 4JQ7A 5E90A 2X8IA 3RWQA 1KJQA 3QTQA 3Q60A 1Q24A 2G15A 3Q9XA 5JH7F 2C00A 2C6DA 4GEOA 4EH7A 4K11A 5HICA 2PVLA 4IB0A 4RA5A 4UZDA 3LFDA 3MBLA 4CFFA 4XG7A 3W32A 3GU4A 5L2SA 3LFQA 1JSVA 3PLSA 3LLAA 4F09A 5FLFA 2JFMA 2GNGA 4FTJA 4LOOA 3QZGA 4BGHA 5CF5A 4JJRA 2NU6B 3IKAA 5LWNA 2OO8X 3C50A 3I81A 3UC3A 2GHLA 5CU2A 3DK7A 4BY9E 2PZPA 3UIUA 5M4IA 3VF9A 4ZSGA 2XK3A 4O0VA 3ZFYA 5AM7A 1H4LA 4WBBB 4G3CA 2PUNA 3LCKA 4ANQA 1O6KA 3I79A 3FXXA 2VTHA 3QQLA 5DEWA 5J9LA 4FKIA 2C0IA 1YHSA 4IADA 1PYXA 4USDA 1B38A 5EM7A 5H3QA 3FMNA 3WZJA 4JBPA 4FTIA 1EYZA 3KULA 3OZ6A 2UW3A 4KAOA 5DRDA 4O7SA 3BRBA 4MBIA 4DH7A 3QTZA 2UV2A 1QCFA 5AWMA 2Z7RA 3FMDA 4GK4A 4ZY6A 2RFNA 2W0JA 4YUQA 4WUNA 2GS2A 4YJVA 5IQIA 3ZLXA 3MVLA 4G16A 4S30A 3NWWA 4RC4A 3UZPA 3EH9A 3VF8A 3FJQE 5FEEA 5IEYA 5TF9A 3FV8A 2VTMA 3ORRA 4Q9ZA 4L01A 2YWVA 5LMKA 3R02A 2R3KA 4GG5A 2EUFB 3JPVA 5TT7A 1F0QA 4NYEA 4RVLA 3O96A 3LFAA 5JRQA 3R23A 4I4FA 4OW8A 3FMJA 4WIHA 5I9ZA 4H3QA 2IG7A 3COHA 3LQ3A 4YNOA 3R9NA 4LV8A 3VWAA 1DI8A 5LVMA 1R3CA 4O27B 3H3CA 5K4IA 5EI8A 2R3RA 3E88A 4EHVA 2Z7LA 4PL4A 5CZHA 5M06A 2XIZA 3LW0A 4IZYA 5C1QB 3TKUA 2QHMA 3TQTA 2JDVA 1RW8A 1OIRA 4KINA 4J52A 4U80A 3NUNA 1OIQA 3FPMA 1NT2A 1YXSA 4DFLA 4B0GA 1Q3DA 3SRVB 2VWZA 3DQXA 3H4JA 4IHPA 3BQRA 4L1KA 4QMUA 3EFJA 5CI7A 2W71A 4FI1A 2X2LA 3HRFA 4NZWB 4TYJA 3BI6A 4AW0A 3S00A 4Y5QA 2J5EA 2OJGA 4ZY5A 3PE1A 2WMVA 4TW9A 4MVFA 3RJCA 4RRVA 5AA9A 3AMYA 2XKDA 4R7BA 3RUPA 5C9CA 2C6TA 4UXQA 4RVMA 5LJJA 2VTIA 2YM7A 4FX3A 1MQBA 3TNQB 4H3BA 4MAMA 1XH7A 4XEYA 5E4HA 5A54A 3N51A 3MIYA 3ZM9A 2V22A 3QD4A 2YRXA 3C13A 3JY9A 3KFAA 3MPMA 4DN5A 2BZKB 5C03A 4MV9A 3MVMA 1OECA 2PK9A 3VS1A 2YHVA 3RWPA 4OR5A 2BHEA 4FZ6A 4JT3A 5DMXA 3MJ2A 4XG4A 2VRXA 5IA1A 2JITA 1AGWA 1PMUA 3PXFA 4K1BA 5B0XA 1BKXA 2WAJA 4MWHA 3VAPA 4CKIA 1P14A 4C38A 4E26A 5D8DA 2J4ZA 3LXNA 4O4LF 1XKKA 3PP1A 1PHKA 4FVRA 2GPWA 2BDWA 4F64A 4CFNA 3SE7A 3VW8A 3DK3A 3LMIA 3BIZA 3PP0A 2RFSA 4DA5A 3ZFXA 2UZUE 3TZ7A 3HMOA 2PL0A 3LFNA 2QG5A 2XD4A 3CIKA 3D5VA 4I5PA 5KMMA 3E3BX 3ZUTA 4CFMA 3FZOA 3ODYX 2XK6A 3ZU7A 3OF0A 4PP7A 3ZC6A 4QNYA 4YAKB 2J2IB 2OF2A 3MFSA 4GH2A 3QRJA 4FBXA 3FI2A 3GFWA 4CMTA 2WB8A 3VO3A 2HY0A 3BHVA 3ID6C 2JAMA 3HB9A 2W6ZA 5CZIA 3Q32A 3VMMA 4ACCA 5M4FA 1LEWA 2P4IA 4X6QC 4ALUA 4E1ZA 4BHNA 3R00A 4D0XA 5EH0A 1GLVA 2Q0BA 3DTWA 2GPHA 2YCFA 4RZQA 1URWA 3HRCA 4DGOA 4FSWA 3OXTA 4DTAA 2CKEA 2YACA 1LP4A 4O81A 4EOMA 3U9SA 1SCUB 1SZMA 1OKVA 1SVGA 3DV3A 4E4TA 4O0SA 3LZBA 4QNAA 1XH4A 2OXDA 4GVJA 3CJFA 4IX5A 4DHFA 4TWCA 3RMFA 4FMQA 1HCKA 3DF7A 4E7WA 5J2UF 2O65A 4O0XA 2WMSA 3R2YA 3EQBA 4FIIA 3TI1A 2WTDA 1Q5KA 4UX9A 4FKQA 2X6DA 3ORLA 4GT4A 3F88A 2C47A 4MXOA 1WR2A 4HNTA 5LWMA 2V5QA 1J7IA 4F9BA 4NKSA 4AFEA 2VWVA 5IMXA 1U5RA 4FODA 3WE4A 3EQGA 4XLIA 5DT0A 4TTHB 5AP2A 4AOIA 3QX2A 4C5BA 4OTFA 4GMYA 5EM6A 3G51A 4FL1A 3FZPA 3LKMA 4BDHA 4DF3A 4BTJA 3F5XA 2CKPA 5DN3A 4G6OA 3RPSA 4TT7A 2HY81 3W2OA 2B54A 3W8QA 1ZRZA 4ACDA 2XUUA 4AOTA 2X1NA 2I0HA 3DZQA 3NW7A 1JPAA 1F5QA 5CEOA 4I3ZA 5HD7A 2C0TA 2BUJA 4FNYA 4NSTA 5CSVA 3EOCA 4TUYF 4DFXE 3GC0A 3QUDA 2I6LA 4GYGA 3OUUA 4WG5A 2X4ZA 4A9SA 4CCBA 2HAKA 4MD9E 1I44A 5JFWA 3KA0A 2W6NA 3KMMA 4ITHA 4UBAA 2YJRA 4FKLA 2OU7A 3HBLA 2UVXA 2ZM1A 3W2RA 2ONLA 2EWAA 3Q96A 2PUPA 4KS8A 5BQ0A 1V1KA 2GU8A 1W83A 4XYMB 4MQ1A 4XS2A 1JAMA 2J6MA 4TXCA 4JQ8A 3UNKA 3C9WA 2JBPA 2X7GA 3OOMA 3P9JA 4FKJA 4JAJA 4JDIA 4JBVA 4C2WA 3T3VA 1WBVA 1O9UA 4B8MA 2J90A 5IYZF 3LCOA 4F9WA 2ZDGA 4JDKA 3MWEA 2B1PA 3VUKA 3L1SA 4FIFA 4QYGA 5CA1F 3VUDA 3GU7A 1DAWA 2NRUA 3LJ0A 4RIWA 4XP2A 2CPKE 3HV4A 1YVJA 3BWJA 4LL5A 4FSRA 4AXAA 4CFVA 4Y46A 3ZM4A 4W4XA 4BYJA 2J7TA 3AT2A 4A9TA 5FM2A 5HCZA 1OKYA 3BELA 2C6OA 2QOHA 5CAQA 2W4KA 5KMNA 1YOJA 5HORA 1XJDA 2PHKA 4C3FA 4ZSJA 3FQSA 4IM0A 5KMIA 3O8PA 3R7IA 4HNUA 2XVDA 3BYUA 4MX9A 3QZFA 1B39A 3C4CA 4X6RA 3IOPA 2UW8A 4XV2A 4F70A 2VTOA 3BCEA 4C61A 1KV2A 4KBCA 4YJQA 5J7HA 1ZYJA 5CYIA 3G0EA 5KX8A 3A61A 1CE8A 3RFCA 4OT5A 3VUGA 5M08A 3ZLWA 4M97A 3IGOA 2H34A 3U6HA 4PP9A 5ACKA 4D28A 3HVCA 4TPTA 3ACJA 2FH9A 4FT7A 1AD5A 1LPUA 4O83A 3ZDUA 1OIUA 3LFFA 2OXYA 3MFTA 2V58A 3FY2A 3LLTA 5L6OA 5M57A 5JGBA 4Z9LA 5BPYA 3JRWA 3BYSA 1BI7A 3E8CA 2PVYA 4JQEA 2Q0NA 4UWYA 5AAEA 3U54A 4S31A 4O7ZA 5AADA 2CLXA 1GSOA 2NU9B 4IIRA 4KIOA 4LG4A 2UVYA 3ANRA 4NFNA 2IVTA 3EYHA 1PXMA 4TYHB 4YJUA 2NO3A 2VGPA 3DNDA 4MXCA 4DCAA 4FFMA 5M07A 3R2BA 1E1VA 4NM3A 3V6SA 1OIYA 1BUHA 2RG6A 3TIYA 1JQHA 4OT6A 4E5BA 2ESMA 4EZ5A 4IVDA 4F9AA 3TTIA 3U8WA 5HU3A 3ITZA 5J87A 3PJ1A 5AUTA 5K5NA 4JXFA 1KE9A 4U41A 1XBBA 4BZNA 4DLJA 3UQGA 2YZGA 2PVHA 2ZB1A 3R8ZA 5CVGA 1OB3A 3FMEA 4AN9A 4BVUA 3U9TA 4QO9A 4ANSA 3OWLA 5JFVA 1DI9A 3KXGA 3RK5A 5CA0F 3COMA 4U3ZA 3I4BA 4ASEA 4QMMA 4B8LA 5M44A 3QQJA 4U42A 1JSTA 4ANLA 2DWCA 3LM0A 1XH5A 5CEIA 1E4EA 3D7TB 2HWOA 4NTTA 5JQ8A 4IB5A 4AT5A 3ZS5A 4QQJA 5AUZA 2R3MA 3C4EA 4WUAA 3EHAA 1Q62A 3EQRA 4G2FA 4FKUA 4NWMA 3CD3A 4BI2A 3E7VA 3GCUA 5A6NA 4EKKA 4LI5A 2R3FA 4EK6A 3D7ZA 5C8KA 1P5EA 4ALVA 3NNVA 2H8HA 2RIOA 4YAJB 4A9YA 5BUJA 4FEUA 3FZ1A 3LPBA 3SA0A 4BHZA 3A7FA 1J1CA 4IX4A 2RG5A 2QLQA 4BDCA 5JH6A 3C5IA 5HI2A 4GVAA 3V01A 5LOVF 2QO2A 5D1JA 4Y8DA 1JKSA 4BDAA 2CNVA 5A6OA 2Z8CA 4FKRA 3FLSA 2YRWA 3DLZA 2XM8A 3KRRA 4Q5HA 1QMZA 4C4IA 4EQMA 1KV1A 4EQUA 4DC2A 3ZXZA 4AZTA 3MTLA 4YBKA 3DGKA 5A3XA 4F99A 4BIEA 3K54A 2NRYA 1VJYA 4RIYA 2G01A 1GZOA 3GGFA 5CT0A 3RZBA 3FXWA 5BYYA 2EB3A 2XM9A 1IRKA 4G9CA 3WYYA 1QL6A 1ZYCA 3ATSA 4I24A 4PUZA 4TWNA 3Q1KA 4DE4A 4N4SA 3QQUA 5AM6A 4F63A 3TXOA 4IVAA 4HVIA 5HCXA 3VUHA 2XJ0A 4CTBA 3E87A 4OTRA 5CNNA 5LMAA 3ZEPA 3ZYAA 3ORKA 1WVWA 3KRXA 4G31A 3V51A 5CEPA 3FPQA 4FTQA 4J71A 3PJ2A 4QMWA 3Q52A 3HNGA 4GK2A 4PY1A 3KXXA 4E4LA 2HXQA 3ALOA 4K6ZA 1VYWA 5DA3A 5KBRA 4FK3A 3JZFA 2WU7A 3O7LD 1ZWSA 3KY2A 2Z7SA 4L9IA 4OBPA 4CVAA 1OPLA 3HV3A 5HU9A 1ZZ2A 2HZNA 3GVUA 4EC9A 3V5PA 3VC4A 2UW5A 4G17A 4NFMA 4IIJF 4CG8A 5BMSA 3L9NA 3HAVA 3KF4A 3LXKA 2GPSA 2I87A 4MXAA 3FDNA 3RAHA 2YCRA 3MGYA 4BCGA 4YZMA 5J2TF 3PSDA 3PUPA 5BVNA 3UQCA 3NW5A 5DBXA 4TV8F 3ORXA 5D41A 4ALWA 5HD4A 4DG0E 4JIAA 2RGPA 3HKOA 4UY9A 3DY7A 4JBOA 1JDBB 4ITJA 2YM5A 2X81A 1CTPE 5BYZA 1J3HA 4FV0A 2OJIA 2VTLA 3JUHA 4DT9A 3KC3A 4ZJIA 1FGKA 1V0PA 4FTTA 4DGNA 3ROYA 1W96A 4G3FA 5IISA 1CMKE 4O96A 4C2VA 3QZIA 3BQCA 4PV0A 4RGJA 4BTKA 4AOJA 4CZTA 1IAHA 2QHNA 1PKGA 2YIRA 5BMMA 2BAJA 2V0DA 3P4KA 5DT4A 3ET7A 2W5BA 3OCBA 2R7KA 4B4LA 2OLSA 2W9ZB 3E64A 3EQHA 4E93A 5ANGA 2FB9A 1KE8A 1EH4A 3O17A 4OGRA 4X2JA 3QU0A 3L8SA 4ORKA 3QHWA 3Q4UA 5ETFA 3LJ2A 4RWLA 4BYIA 5BX0A 3U87A 3E8NA 1U54A 4F6SA 2WIHA 2YDJA 2EXCX 4MNFA 4O0WA 4G34A 4YGAA 3WZDA 2UZLA 1PX2A 4CFXA 5EHOA 4IVCA 5EYMA 4LOPA 3FI3A 4I41A 4JAIA 4XG2A 5HE0A 3PG3A 1FVTA 4M0YA 5AP5A 4YO6A 1ZMWA 4FGBA 5T68A 4FSUA 4OTGA 4FFRA 4ZOLF 4J8MA 3G2FA 3KRWA 4MXXA 4RWJA 4EBVA 1YWRA 4LMNA 2X2MA 4MNEB 4DGMA 1Z2PX 3P7AA 4U79A 3LMGA 3CEKA 3UG2A 3PPZA 5LARA 2C0OA 3E93A 4PRJA 4IC8A 1JKKA 5DR6A 4IHJF 4IFGA 2O63A 3D4QA 1DM2A 2XNNA 3R1YA 3DB8A 5BNJA 3ODZX 5EHLA 5CASA 5DLSA 2WEVA 3DBQA 2V7AA 4EKLA 3KAJA 3R30A 2QD9A 4TWOA 3TV6A 1Y6BA 1JLLB 2W6MA 4FIJA 4FOBA 3GP0A 3NUUA 4NIFB 1Q8TA 4AUAA 2AC5A 5BMVF 4UWBA 4CZUA 2F9GA 2FPIB 2YISA 1WBPA 1IG1A 2O0UA 4MXYA 2B55A 2B9JA 2QVSE 4PNKA 2FGIA 5LVPA 1CS0A 2RF9A 2W70A 4KRCA 4NM7A 4V0GA 2XMYA 4JG7A 3HV6A 3PPKA 4MYGA 4EJ7A 2JGZA 4FV2A 3TNPC 3CKWA 4UZHA 4PDPA 4U3YA 4QP8A 4CKJA 4V05A 1I7NA 3R8MA 3DKFA 4Z16A 3DKOA 5J1VA 1PXJA 3VBTA 4F7NA 4A7CA 3VS0A 2HW7A 1H08A 2QCSA 5IH4A 5IA5A 5LCKA 3FSFA 4WKQA 4IJ9A 3UVRA 3VBXA 3GLKA 5CSWA 2R9SA 2QC6A 3MB6A 2C5XA 2XNMA 3SXFA 4O2BF 3D15A 2VTQA 4FTLA 5DWRA 1JBPE 3D7TA 2J0KA 2X6EA 4KKGA 3DA6A 5KZIA 3R9OA 4C3RA 4FG8A 4AA4A 1SNXA 5JVDF 4EGQA 5HBEA 3C4WA 1R39A 2R7NA 2E9VA 5FEQA 5CEQA 4RWIA 2R7MA 2C69A 4R1YA 4CFWA 5L8LA 3OW3A 4L7SA 3THBA 3R73A 1EUDB 1XR1A 1FPUA 4U8ZA 2OZAB 2UW7A 2WPAA 2YZMA 3R28A 3WILA 3HX4A 4G1WA 5LA6F 3G6GA 2GFCA 5H80A 2IPXA 3CQEA 4I22A 5JZNA 4IWDA 2XYUA 4RC2A 4YTHA 3FI8A 4GUBA 5CEMA 5L2WA 4PNIA 2JIIA 3KU2A 1KJJA 3HA8A 3R8PA 4ENYA 2XKFA 3DQWA 4Q2AA 2JIUA 4ZIMA 3I60A 1ZOEA 3ORZA 4TZRA 4WNMA 3U6IA 4JDJA 1W8CA 3F5PA 2CDZA 3OBJA 4I21A 4K8AA 3VUMA 4BGGA 4N70A 2WMAA 4LMUA 4YPSA 3UNJA 2BKKA 2QR8A 3CQWA 2ZB0A 1VEBA 4E73A 2JDTA 3HECA 3SD0A 3C4ZA 3QALE 4F1OA 4AZSA 4RX7A 3B8QA 4MEDA 4OTQA 4Y95A 1U46A 3FLQA 4JRNA 2VWUA 1CDKA 3CKXA 4M14A 3QD3A 4EH6A 3QAME 1AQ1A 4D5KA 2W4JA 1DIKA 4JL9A 5EDPA 1QPEA 2OF4A 3LCSA 2REIA 2VX1A 3WF7A 3C1XA 1V0OA 1VYZA 5AP1A 4D58A 2VPQA 4DEGA 1PXOA 3DJ6A 3R8VA 5G6VA 1PYEA 3DXPA 4X21A 4KIQA 3HDMA 4NTSA 2BILB 2R7LA 2XP2A 3ORPA 2UW9A 2W9FB 4NW6A 4AU8A 2OLCA 3VVHA 4GU9A 3LFCA 3PJCA 4RG0A 2BTSA 4ME6A 4I94A 4FV1A 4LGGA 2OIBA 4J7BA 5JQWA 5I5ZA 4FE2A 4RPVA 2I0VA 2GFSA 1BYGA 3EQCA 3I7BA 4A07A 1GSAA 2BTRA 4YJSA 4DFYA 4W4WA 2QODA 3O7LB 4G5PA 3PWYA 4FVPA 3RNIA 3EZRA 4EH3A 2I0YA 3OWJA 2XEYA 4YP8A 3SLSA 1A48A 3O0GA 3PRIA 4HZSA 1H8FA 5J5SA 1Z2NX 3QCYA 4FICA 3FKOA 4FV8A 4PTGA 3FLNC 4AGCA 3ZUUA 2ITTA 4AZFA 1QPDA 5IQFA 2HCKA 4CMUA 1P4OA 5CT7A 5M53A 1OL6A 4RVTA 5HHWA 3P78A 4D9TA 5EOLA 5KX5F 3KVXA 4ZHQF 4HCUA 4D5HA 4C36A 1R0EA 4F9YA 3DFCB 4IH8A 5CTPA 2P55A 4RQKA 4DEIA 5LVNA 4BI0A 3L9LA 2VNYA 4CEGA 3KREA 1UKIA 3P5KA 3QQHA 3PY3A 4L8MA 4RJ5A 4ZTSA 5LP6F 3LQ8A 3GCQA 5DG5A 1XBCA 2W1DA 3ENHA 3ZTXA 3FUPA 4RJ7A 2OJ9A 5IU2A 4EI4A 3LFBA 4R5YA 4EOIA 1BL6A 4OTWA 5EI2A 1H1RA 2FB8A 3NMUF 4FTOA 4L43A 2B7AA 3R5HA 3A8XA 4L68A 1M0WA 4GW8A 1YWVA 4PL5A 1PY5A 2UZEA 4HYHA 5BUEA 3ZLYA 4YB8B 3WI6A 1PXKA 2PZ5A 2VO6A 3A7GA 3PXZA 2EVAA 2VWXA 5A46A 3ROCA 4Y83A 4O84A 5DR9A 2PZRA 3R8UA 4D1SA 4XG9A 3ATTA 2ERKA 2WGJA 1ND4A 3NRMA 4LGHA 5GJFA 3CE3A 4NW5A 4IWQA 3F5GA 3DJ5A 3SG9A 3V4ZA 4JVGA 4CT1A 4EWHA 2R3OA 5EM5A 1Q4LA 5HLWA 4P2KA 1U4DA 3C0GA 2XYNA 2C30A 2IZUA 3BKBA 4EOSA 4GT5A 3EYGA 1BMKA 2XNOA 3DS6A 4AFJA 3POZA 1CQJB 4M69B 3PY1A 4JG8A 4U81A 5ITAA 1U5QA 2GTNA 2VGOA 1IA8A 4F7SA 5BVDA 5FDPA 3ULIA 2HK5A 3N4VA 5ETCA 2PPQA 4ASXA 5FBNC 5AUWA 2BAKA 5IPJA 2ERZE 2R0IA 4JNWA 2Z7QA 2VD5A 4L67A 2XA4A 3PJ8A 4APPA 3HP5A 3IOKA 4EOJA 3CS9A 3QGWA 4LRKA 4OBOA 4FSTA 4BDBA 5AV0A 3R22A 2CGWA 3FAAA 2I80A 3AC5A 5HGIA 3QL8A 4DYMA 3OT8A 1OMWA 3V5JA 2XRUA 3AW8A 3KL8A 3QX4A 2PWLA 4C5AA 3NIEA 3GENA 2QNJA 2W5HA 4WT6A 4YHFA 5BVOA 3SVVA 3TUDA 3A99A 4FTAA 3PG1A 3ZC5A 3S4QA 3G8DA 3V3VA 1UNGA 3OVVA 4FSYA 3AXWA 4NKAA 2Z60A 3T9IA 4DEAA 3JY0A 4HVGA 3V5WA 2CLQA 4I20A 5AA8A 2ZV2A 3I0QA 5I4NA 4E6AA 3HA6A 2R3HA 4P5ZA 2J9MA 3QA0A 4JR7A 5EQPA 4FSZA 4CG9A 4W8EA 1KJ8A 2WFYA 4H36A 4IW0A 4AN3A 2C68A 1H26A 5IQHA 1XHAA 4XBUA 1DV2A 3GUBA 1G8SA 5FNVF 2FP4B 3ZXTA 3GCVA 3TZ9A 2R5TA 1UU7A 3QWKA 4GL9A 3TEIA 1ATPE 3BX5A 1FINA 2VX0A 3MYGA 2AC3A 3NPCA 4FNZA 5GJGA 5K3YA 3PZEA 3QYWA 4HCVA 3F3WA 4BCKA 4YPDA 3W2CA 2WMWA 2PN1A 3LCTA 1Y57A 3DXQA 4IAKA 4MKCA 4MA0A 2HW6A 2YM4A 4YR8A 4ZY4A 3EQPA 2A4LA 4QMPA 4O0TA 5DI1A 5CSHA 3TW6A 2HZ4A 2IZRA 4FNWA 1JKTA 3HGKA 4X2GA 3S3IA 4C7TA 4BCPA 3WF9A 3F2NA 3KEXA 4QPSA 5BPFA 3NIZA 1I7LA 2PVKA 5CVHA 5CXHA 4TKSA 3UTOA 1WCCA 2QKWB 3OC1A 5HBRB 4FFNA 2VAGA 2W1ZA 3FLWA 3NCZA 4KUJA 2ZDUA 2YJSA 3EN4A 4M13A 3OXIA 3QTSA 4MAOA 4NL0A 4U40A 4ZTHA 2ETKA 3VBWA 4ACHA 5IG1A 2R82A 3LMHA 4YTIA 4I0TA 4LYNA 1WVYA 2H9VA 3PY0A 2VWYA 2AYPA 3VHEA 2JKQA 4PMPA 2WTJA 5E8VA 1SVHA 2WOTA 3EFLA 5D7VA 2OG8A 3B2WA 1FMKA 3O23A 4BI1A 2OZOA 2UZVA 2R64A 3FHRA 3HMIA 3K3IA 5KCVA 4DG3E 2PVFA 5K5XA 4PTEA 4J53A 2ZOQA 3HEGA 3G5DA 3NUXA 3KVWA 1JKJB 3JZIA 3IW8A 3KGAA 3BEGA 4I5CA 5EYCA 2F4JA 3WZUA 4Y85A 3EQDA 1WBOA 2LGCA 4O7NA 4RX9A 4Q9SA 4EH2A 3PE2A 1OL5A 1PRYA 5CI6A 3G8CA 4U45A 3OY3A 3NNUA 4RQVA 4FT3A 2J0JA 4GYIA 3KCFA 5GIPE 3JRXA 4RSSA 4ACMA 5A4CA 1NXKA 1NVQA 3IGGA 1T36A 3HMMA 5FTOA 3TACA 3I5ZA 3VRYA 1TQIA 2HZIA 2W1HA 5EW9A 3ZO2A 4DTKA 4ZTNA 4EK4A 4DEDA 4M9UA 4F6WA 3VA7A 2WQBA 2QOLA 2XIXA 2XZSA 5DIAA 3ZFMA 3BE9A 2ITXA 4BDIA 2GNLA 4O86A 3V8WA 2WTKB 1TKIA 5CQUA 4XP0A 3OW4A 3BGPA 4APCA 1S9JA 1T46A 2HJWA 3QQFA 4FSNA 3E8EA 4HYSA 4XH6A 2DS1A 3D0EA 4HGLA 3LHJA 3NR9A 3FMMA 3BLQA 3I12A 4S32A 1YOMA 3BGQA 3F3UA 3HYHA 3QTIA 3L8VA 3TCPA 3E5AA 1YRPA 4OTDA 5AV1A 1C3OA 5C1PA 3H9FA 2HZ0A 3ACKA 3A7JA 4FIHA 1H1SA 1NY3A 4TWPA 2IZTA 4AS0A 3QUPA 4ACGA 3SDJA 1QPCA 3NDMA 3S95A 5HNIX 4IM3A 4BB4A 1YWNA 4YLJA 3ERKA 4QMNA 5AUUA 3NGAA 4FVQA 4BCQA 2IVSA 3O51A 3FL4A 2JEDA 4U9AA 2ITPA 3UMXA 2JD5A 3IPHA 3NW6A 4TNDA 4E4XA 3G0FA 2J0IA 5CX9A 5DEYA 3UPXA 1UNHA 2UW6A 3T3UA 3UDBA 3LWBA 5CB4F 3Q53A 1JWHA 5A4EA 2R3NA 4QP6A 3MESA 5ANDA 2WTWA 2YIWA 2OH4A 2Y8OA 4ENXA 1GIHA 3PA3A 5EYDA 4EQCA 1YQJA 2O2UA 4IAFA 4K77A 5TOZA 5A4LA 4FSQA 4CKRA 4EYJA 1YHWA 2IZSA 2JKKA 3ZDIA 4IWOA 4RJ8A 3G9LX 3RPVA 2F2CB 5CAUA 3N8DA 4A4OA 2Q83A 3PXYA 4YZNA 3WF5A 3O8UA 2KTYA 2VU3A 4H1MA 1DAYA 1AUXA 1M2RA 5DYJA 4B6LA 3HO8A 2OJJA 4EHZA 3PA4A 4FK6A 3LIJA 4AT3A 5IA4A 4FZAB 2YAKA 3ZMMA 3P79A 2R3LA 2FPGB 2GTMA 1H1PA 4EC8A 2QOCA 2W6OA 3KAKA 2ZV8A 2H6DA 4ONAA 2Y7JA 5CS6A 2PMNX 3FXZA 2C3KA 3GT8A 5DNRA 3W1FA 3ZSHA 3ZSIA 4BDGA 3EJ1A 3NVMB 3SRVA 3VUIA 2W99B 3HLLA 4GSBA 3TV7A 4AP7A 4XX0B 5FEDA 3U6JA 2BPMA 2WMTA 4HNVA 3DCVA 3FWQA 2W1EA 3IDPA 3W8LA 3P1AA 4DFBA 3BHTA 3NNWA 4KSPA 4AE9A 3CCNA 4LM5A 2HOGA 3IS5A 4XV9A 2VWWA 3HDNA 4C4EA 5IQGA 3E63A 1ZMVA 1M17A 1ZZLA 2XIKA 4MQ2A 4II5A 5AP7A 2QURA 4M7IA 4MD8E 2W7XA 3UGCA 2GQGA 5KHWA 2QU6A 3BE2A 4E20A 4QTAA 3B8RA 5AP3A 5AV3A 5CAOA 1O6LA 1OVEA 3L9PA 1YDRE 1SYKA 3QTWA 3GU6A 3QXOA 4XV3A 3QTXA 3KMUA 3F3ZA 3ZOSA 3NVKI 2IVUA 3GB2A 4YLKA 4CRLA 4ZMFA 3E8DA 5M55A 5M4CA 3F2RA 4RT7A 1IAJA 4EYMA 2F2UA 4C02A 5K4JA 1J7UA 1H01A 3L8PA 2BCJA 3W18A 4U7ZA 3ORQA 3D2KA 4E6DA 2B52A 5EQEA 4DH1A 1NVRA 3G90X 2QOQA 3Q5ZA 3Q9WA 1GIJA 3TNWA 2G2FA 4KBAA 4UWCA 2B9FA 4I6FA 3UIXA 3E62A 4FV7A 3RGFA 2GQSA 3NUYA 3ORNA 3WF8A 2DUVA 3ZHPC 1MRYA 3ZO4A 2QO7A 4FT0A 2UZDA 3FKLA 4FGRA 1Q41A 5AEPA 3N4TA 3NYOA 4ZQIA 3MWUA 1HCLA 3PIYA 1Q8ZA 4BICA 3LXLA 3LJ1A 1YKRA 1YI3A 2A19B 3DJ7A 5D9HA 3R8LA 3QCXA 4MA5A 3RPRA 4WA9A 3OXZA 2GNIA 3BYMA 3FHIA 1VKZA 3RAKA 4EH9A 4F1TA 4P4CA 2YM6A 2PU8A 3HRBA 5CU4A 4ZLZA 4C59A 3KK9A 1MRVA 3T8OA 3COIA 4ZS4A 2QONA 5CF6A 5GJDA 4DBXA 3FQHA 4C37A 3IO7A 4TYIA 5ANOA 2BRNA 2HWPA 4IBMA 5HEZA 5FXQA 1RQQA 4FA2A 1CSNA 3OFMA 5FXRA 4TY1A 4DTBA 3QBNA 3AT3A 2GMXA 2QLUA 2BMCA 2UZBA 3PJ3A 2DLNA 4J98A 3KALA 4U43A 2OI4X 5FUTA 3V6RA 1M52A 2DIKA 3AD4A 4L45A 4QOXA 3SAYA 1XH9A 2XNPA 4PX6A 3QTUA 5E92A 3Q9YA 3E7OA 1H0VA 4MNEA 4FEQA 5IA3A 2YIXA 4FZ7A 4C34A 2CMWA 1STCE 3F69A 1W93A 2W6QA 3OMVA 2BRGA 3VS7A 4QQCA 3WZKA 4AW5A 3QCSA 3MPAA 3DBFA 1SVEA 2C6KA 3A8WA 3LQ5A 3Q2JA 4K2RA 3TZMA 4U0IA 1M6VA 2YYAA 4LRMA 4IAIA 2GHGA 3RV3A 3FSKA 2VTNA 4G3DA 3Q5IA 5JMSA 1REKA 3ZCLA 2XBJA 5CF4A 2PMIA 2QO9A 3OD6X 3RAWA 3UC4A 5IH6A 4IEBA 3Q6UA 3ALNA 2V55A 3QD2B 4EOOA 2YITA 3TIZA 3F6XA 4FKSA 1KEEA 4TYGA 2BIYA 3MVHA 4XOYA 4M0ZA 4IMYA 4O4HF 4X2FA 3H9RA 4EK5A 5H8GA 4I5MA 1H1WA 5HG5A 4LRJA 3KXNA 4HGSA 4OTIA 4EEVA 4KA3A 5E8TA 2X8DA 5JVLA 4F1MA 1M7NA 2Y6MA 4DINA 4XX9A 1ZYSA 5DPVA 4Z7HA 2IW9A 3AD5A 5EK7A 2C3IB 2CN5A 2R3PA 4IACA 5F95A 3LVPA 4WOVA 3VS6A 2ZDQA 4V01A 2QG7A 1RE8A 4IM2A 5C1OA 2I8CA 2P2IA 2RFEA 4EHGA 3UVQA 5DOSA 3H0ZA 3FY0A 3DTCA 1JLUE 4Z3VA 4RWKA 3KN5A 4HW7A 3QRIA 4K9YA 2J51A 3LFEA 4UN0C 3OEZA 3FZRA 2X8EA 1LEZA 3BU3A 3F5UA 4O2AF 3AG9A 5KNJA 3L9MA 3KCKA 3P23A 3K5VA 4C58A 4W4YA 5C4LA 4FTCA 1B6SA 3NCGA 3MH3A 4E6QA 2WEIA 3AMBA 3TIIA 1Y6AA 4H3PA 4HZRA 5J9YA 5AX3A 3ZBFA 2XKEA 4FYNA 2UZOA 2VTSA 3G33A 4QMYA 1Z5MA 5A4QA 4DGLC 3D14A 4G3GA 5L8JA 3TDWA 1GNGA 1PW2A 2W1CA 1FOTA 3OT3A 1MQ4A 3JXWA 4EUTA 4K33A 5B2KA 4FV6A 3UP7A 2FVDA 3KK8A 2J0LA 5M4UA 3E92A 2ZV7A 2W17A 3QLGA 3D2IA 3NAYA 3GC8A 2NPQA 4RA4A 3BBTB 4DITA 2E9NA 1ZYDA 4FL3A 2FSLX 4YTCA 3WIKA 2W6PA 4E6CA 5KMOA 1ZMUA 3DPKA 5DE2A 2J5FA 2WMRA 4G3EA 4ZOGA 4RVKA 2ZDTA 4HOKA 4PMTA 3QZHA 4GFGA 4QMOA 2E2BA 4R3RA 3DKGA 1NW1A 4PTCA 4E4NA 1SMHA 4D4SA 4I55F 4F0IA 3CBLA 4HYUA 2ITOA 4PF4A 2OXXA 3DFAA 4EHEA 4EUUA 5I9WA 1KE5A 2R4BA 4GCJA 3HUCA 2X7OA 4I23A 4LL0A 3BZ3A 4JRVA 3IDCA 3TV4A 3UYTA 1XH8A 3V4SA 3PYYA 2UZTA 3M1SA 1WBTA 2ETRA 3MJ1A 4AGWA 3GI3A 2O3PA 3MS9A 5HTCA 4R78A 4YJPA 4FTKA 4QMQA 2WO6A 3T9TA 2IW6A 3VNTA 4B7TA 4B99A 5AIKA 5IUHA 3MB7A 4A06A 4O7VA 1UU8A 3QFVA 5HLNA 2BZJA 3CTHA 3GIDA 4JG6A 1B6CB 4FTRA 1MUOA 4RX8A 4L6QA 4YJRA 4F9CA 5JSMA 3HP2A 3PSCA 4YBZB 4BBMA 5FP5A 3MDYA 4NM0A 4O7LA 5ANKA 4ASDA 2JIVA 4HQ6A 4DFZE 2CGVA 2R3IA 3COKA 3R63A 3OUNB 3EL8A 1YHVA 4YBJA 2BKZA 4BRXA 3OWPA 3TINA 1M2PA 4GKHA 4IAAA 4WRSA 2OFVA 3SW7A 1J7LA 4O6EA 3HV7A 1UU9A 4J97A 2R3JA 4OTHA 1E4EB 2QOOA 4YLLA 4AW2A 4AF3A 1JDEA 1ZAOA 4O0YA 4E4MA 4C33A 3U9NA 4AW1A 3HUBA 5HNBA 1MRUA 2QOBA 1ZY5A 4H58A 2X2KA 4O2ZA 5KZ0A 3TT0A 4CCUA 4CSVA 4ZSAA 1KE6A 4BTFA 5HX6A 1PK8A 5JQ5A 4O7YA 1V0BA 4CNHA 3UOJA 4GIIA 5C26A 1GZ8A 4G9RA 2OZAA 2XNBA 3FMHA 4AZWA 1FBNA 3M2WA 3BEAA 3A7IA 3QKLA 1C30A 1Z57A 4J8NA 5DGZA 3FEGA 2FPPB 3VN9A 3ORIA 4MV8A 3ZEWA 5FQDC 3GU5A 2CCHA 3EFWA 1FVRA 4WG3A 3DB6A 2X9FA 3FC1X 4L42A 4L3PA 4GT3A 1KE7A 4N6YA 5BPHA 1Q61A 1YDSE 3F7WA 1UA2A 3QQKA 3SOCA 4YJ3F 1W0XC 4LUDA 1PKDA 1BXRA 2G1TA 2WU6A 3QQGA 4AN2A 3KXHA 4FV3A 4L3LA 2C5NA 4QMSA 4QYYA 3RP9A 2X0SA 3DLSA 2YCSA 3QHRA 4BF2A 3BBWA 3SHEA 5E1SA 3F3TA 3MTFA 2OBJA 3BHHA 4YTFA 4YHTA 3PSBA 4I0RA 3P7CA 4XRLA 3IW5A 4RJ3A 3WIGA 1PXLA 4D55A 5KKNB 2BVAA 1P4FA 2WHBA 2FO0A 2YDIA 4HPTE 1BNCA 5E9EA 3QGYA 2C4GA 3EIDA 4EH5A 3N6RA 3CGFA 3OTVA 4WG4A 3LOKA 2PMOX 3NYNA 4CV8A 3DAEA 3U4UA 4Y5HA 1EUCB 2WQEA 1OGUA 4D2RA 3VS4A 5LQFA 4BC6A 4FEXA 5HO8A 3UOKA 2VNWA 3TUCA 2I7QA 3RHKA 3K5IA 1URCA 4O22A 3JYAA 3TWJA 1M0TA 4L53A 4CD0A 5IUIA 1FVVA 4XOZA 3OCSA 3O71A 5FXSA 4IAZA 4J95A 4ZEGA 1Y8GA 4AZEA 4TL0A 3MJFA 3BYOA 3R7OA 3RALA 2QOIA 1J91A 4QPAA 4I5HA 4O0RA 5E8WA 4IX3A 4C4GA 2F49A 3R7EA 4ERKA 1DV1A 5KBQA 4ZTMA 1WVXA 3GQLA 5HIEA 3SXSA 3V5QA 2QK4A 4QMLA 3Q04A 4IZOA 5JK3A 1U59A 3S1HA 1BLXA 2O8YA 3D5UA 3UZRA 2OIDA 3WYXA 1GGOA 3MSSA 4N57A 3MWDA 1RDQE 2GCDA 4X7QA 4O0UA 3OP5A 5J8IA 2Y6OA 4L7FA 4FIGA 3EMGA 2BDJA 4IQ6A 4EH8A 4XUFA 2JDOA 3R1QA 1UWHA 1L3RE 4DIMA 1G5SA 3RAIA 2HGSA 1JSUA 3HMNA 4D0WA 4E8AA 4DCEA 5FTGA 5A9UA 3BV2A 3QA8A 2IP4A 4I4EA 4GFOA 1TVOA 4KABA 5EKOA 2ONLC 1CKPA 4FTUA 3QF9A 4DAWA 1A9XA 3CTJA 1Y91A 1ZY4A 2ZMCA 1H25A 4U5JA 1PMVA 2ZJWA 2E9UA 3FI4A 2QKRA 4KNBA 2ACXA 4LOQA 4FUYA 5G1XA 2ITQA 3WE8A 2ZVAA 3R6XA 4F08A 2ZV9A 1EZ1A 1A9UA 5F94A 3ZZEA 5EKNA 3OUKA 3Q6WA 4D4YA 5L2IA 4EWQA 5F9EA 2UW0A 3DAKA 4WNKA 4EZ3A 3NLBA 4GK3A 4RZWA 3GBZA 1ZXEA 2F7EE 1F3MC 1OITA 2ITYA 4YURA 2VTJA 3AC3A 3BV3A 4E5WA 5L3AA 4USEA 2AUHA 4BBFA 4YSMA 4KKEA 4GU6A 1HOWA 3RI1A 3CGOA 2WMQA 4K18A 4QP3A 4UYNA 3RK9A 2GNFA 3UP2A 3CSVA 3FE3A 4D4RA 2XRWA 4QTBA 4WO5A 3V04A 3C5UA 1OUYA 4WHZA 4BDKA 2I1MA 2DYLA 3BU5A 1GJOA 2XCKA 5TKDA 1K9AA 1OM1A 3QD0A 5CU6A 5AFVA 5LVLA 5E7RA 3LM5A 2JFLA 2Z04A 1JOWB 3CY2A 4IZ5A 1PXPA 5J9ZA 3R71A 1IOVA 2CKOA 2G9XA 2ITZA 4IZAA 4IDVA 4JI9A 4QP7A 2VN9A 3F66A 5E1EA 5I9UA 3REPA 3RTPA 3ZRLA 4ZS0A 3ZRMA 3DXNA 4UB7A 5AP6A 2P3GX 2WXVA 5EW3A 5HE2A 3VJNA 5IA2A 3PXQA 2HYYA 3GC9A 4YZCA 4JBQA 5CAVA 3KQ7A 2C3JA 4P90A 4ZP5A 4FTMA 5FD2A 2WD1A 4PDYA 3BLRA 3ELJA 4P5QA 2HENA 3OHTA 2YCQA 4DGGA 3TKIA 5L6PA 1B6RA 1G3NA 2YM8A 3GFEA 4YC3A 4QYFA 3C0IA 5JKGA 4DH3A 4R77A 2QR7A 3VBYA 3VOTA 2WOUA 4V0GB 5BVEA 3O50A 4CGAA 4YZ9A 4QMVA 4O2PA 5ANIA 5ANJA 4X3FA 3WF6A 4AAAA 1I09A 2ZYBA 3JVRA 4EL9A 4L00A 1YXVA 1M7QA 4JR3A 4A9RA 3NSZA 2ZM4A 1YI4A 2ITNA 3RCJA 5JT2A 4KIPA 2GDOA 4YU2A 2P33A 3QWJA 4QMXA 3U55A 2NUAB 4IJPA 3IW6A 5FM3A 4HVHA 3CXWA 4JX7A 4OBQA 3FC2A 5LVOA 1Q99A 2XF0A 2C3LA 2UVZA 3LFSA 1FQ1B 2GQRA 2R7IA 2VTTA 4WSYA 1XH6A 3C0HA 4ZLYA 4R6VA 1IEPA 5LXMA 4D9UA 4JX3A 5HE3A 2XEZA 4CMOA 3NS9A 4MBLA 3PDTA 4FL2A 2BRMA 4MTAA 5EYKA 4EOQA 2ZDHA 2XK8A 4EOKA 5KUPA 4FT5A 3TG1A 2O5KA 2I40A 4FTNA 3IW7A 3EWHA 4XP3A 3LE6A 4TYEA 2FSOX 4I0SA 2CN8A 2NNWB 3EKKA 5F4NA 5TR6A 3FBVA 3R83A 2WIPA 4YJ2F 2HELA 2P2HA 3QRTA 2BRHA 2J0MB 5KO1A 2GSFA 5HIDA 2YA9A 3QC9A 3MN3A 4Y8VB 4P7EA 2VO0A 2GHMA 3A62A 2B0QA 2C5YA 2G2HA 4EH4A 2VV9A 4LQMA 4I6HA 4ZZNA 3DT1A 2PE2A 4IWPA 3FMLA 3UPZA 3R5XA 5EHYA 4MV4A 3SGCA 3M42A 3VS2A 2VTPA 1OL2A 1L8TA 4K0YA 3TNIA 5IQBA 4I93A 4FNXA 4D1XA 4IAYA 2PSQA 4DH5A 1ZOGA 3H0YA 5KKRC 5ANEA 1UVRA 4BCJA 3EB0A 4U97A 3EKNA 1YOLA 2PVMA 3EFKA 3QRUA 5IA0A 2IJMA 3QXPA 5AV2A 4BGQA 1UNLA 4MV6A 5J1WA 4EG0A 2CHLA 3Q3BA 4XLVA 3A60A 5I9YA 4RX5A 1WAKA 3HV5A 4G6NA 2C6MA 3I5NA 4BDDA 1A06A 3CLYA 4KSQA 4C4JA 4BCIA 4UEUA 5L8KA 5C8MA 3TM0A 4RBLA 4W8DA 5ICPA 2XNEA 1GOLA 4FIEA 2WMUA 4O7RA 4FV9A 3II5A 5HVYA 4D4VA 2UUEA 4GFMA 4B9DA 2C1AA 2CKQA 3C4XA 4BZOA 5H8BA 3N9XA 5M09A 3TIGA 3ZBXA 1KJ9A 3N4UA 1E1XA 3GU8A 1UWJA 3ENMA 3MFUA 2X39A 4M8TA 3GC7A 4N0SA 4X2KA 4D1ZA 2XNGA 5IQAA 1NA7A 5I9XA 4NT4A 4WRGA 2J50A 4AX8A 3EQIA 4RFYA 2QF7A 1JKLA 4WBNF 2ETMA 1OKZA 1W7HA 1IA9A 2PULA 3MW1A 3PFQA 3UMWA 4F6UA 2FSTX 2OJFE 4FZDB 3OCGA 3MH2A 3U51A 4UXLA 4QMZA 4GJ2A 4KS7A 3UOHA 5JGDA 5CENA 3R5FA 4FFPA 1H00A 2BFXA 4ZAUA 4XZ3B 2PBZA 4HVDA 4QYHA 2DWBA 4BCMA 1R0PA 4HVSA 4X0MA 5KMJA 3FYKX 3ANQA 1H1QA 5CNOA 3BYVA 3UNZA 1PMNA 4ITIA 5EDRA 4PL3A 4IFCA 4DFNA 4ZSLA 3U4WA 1ZOHA 5HVJA 4O4JF 3BWFA 3KXZA 5F20A 3R1NA 3ZZWA 1GZNA 3NX8A 3A4OX 1PMEA 2CCIA 2X9EA 3DK6A 4JLCA 2W06A 3O2MA 4KB8A 2ITWA 2EU9A 3HZTA 3QKMA 1SM2A 2WKMA 1ZLTA 2WTVA 4NU1A 4F0FA 3F7ZA 3OUZA 1REJA 3PVUA 1R1WA 3MVJA 3PXRA 2W1IA 5L6WL 1UV5A 5HG9A 3VJOA 3QTRA 1LUFA 3UJGA 2VTAA 2C1BA 2X4FA 4MK0A 4UYAA 4DEHA 1EHIA 4L46A 4ID7A 3W2PA 2F7XE 2J9GA 4HGEA 2QOKA 3DU8A 3UIMA 5IF1A 4YHJA 3GCPA 4TNBA 3KF7A 4FKGA 4BCHA 4FKOA 4XJ0A 5HLPA 4AE6A 4JDHA 2R87A 4OUCA 3L8XA 4R1VA 2EB2A 3PIXA 5HCYA 3WARA 2OH0E 2WZJA 3G6HA 4BCOA 4MD7E 3TZ8A 3SC1A 5KHXA 3QKKA 4JIKA 2CZGA 5IDPA 3BHUA 1CKIA 3WZEA 4ZJJA 4XG8A 4I1ZA 4NJDA 5IZFA 2G2IA 4FEVA 4LV5A 3RINA 5ETIA 3TDVA 3PZHA 1T45A 3KMWA 3RCDA 5CAEB 3ZLSA 3CR0A 1IR3A 4BN1A 2B4SB 2WMBA 3DOGA 4FEWA 3ZSGA 4R7IA 4KKHA 3ULZA 5HG7A 3RPYA 3R1SA 5HX8A 2DQ7X 4N6ZA 4CRSA 2YN8A 3VS3A 4DBNA 4DFUA 4F0GA 3LP8A 1DS5A 3OEFX 2W1FA 4GJ3A 2PVJA 2PVNA 4HPUE 5IQDA 2HXLA 4YO4A 3K3JA 3G15A 4YNEA 1P2AA 5DRBA 4O4IF 3WOWA 1GSHA 4R3PA 4BDFA 2PUIA 4NCTA 4IZ7A 4QP1A 1G8AA 1KOBA 4TN6A 3IONA 2WTCA 4FYOA 5AP0A 3SW4A 4USFA 2W05A 1WZYA 5K9IA 3BG5A 2H96A 3W10A 2WMXA 1M2QA 4HR7A 5AX9A 3CC6A 4C4FA 5EOBA 1OL7A 4UALA 4MWIA 3R9HA 4F7JA 4YMJA 4EGJA 3PXKA 1UU3A 3MH1A 2CNQA 1Q8WA 4XV1A 3QC4A 5DHJA 5CAPA 4AG8A 4CFUA 4AWIA 1SNUA 4LUEA 1OPJA 1Y8YA 4S34A 5LOHA 3R04A 1XWSA 2VO3A 2BR1A 2FYSA 5LYJF 5HBHA 4BIDA 4E5AX 5HKMA 5FGKA 1FGIA 4XCUA 3O8TA 3GXLA 3SQQA 4BDJA 1BI8A 5GONF 4I6BA 3QCQA 5M51A 3ORTA 4I92A 1H28A 3OY1A 4QTDA 2XJ2A 2PMLX 2O64A 4U6RA 5FBOA 4FT9A 4HGTA 5HQ0A 3AT4A 3PPJA 4ZZMA 4FZFB 3EN5A 5E8YA 5BVKA 3Q9ZA 3VBVA 2PE0A 3W55A 3WBLA 2BRBA 4EK3A 2YZNA 2BFYA 5ETAA 3RK7A 2BIKB 4KBKA 4ERWA 1OPKA 3VQUA 4FOCA 3R7YA 3RKBA 4C4HA 3GOKA 4L52A 1OBDA 4CTCA 4TRLA 2YZLA 4EJNA 3I1AA 3H30A 3PIZA 1CM8A 3DBDA 4RFZA 5B2LA 3W2QA 4NJ3A 5D12A 4RIOA 2PVRA 5HNGA 3IK3A 2YS6A 4BBEA 4WNOA 3QLFA 5JFSA 5LXTF 4QP2A 3W2SA 4RJ4A 5HIBA 3WO1A 5AAGA 4R3CA 3C51A 4XBRA 3F3VA 5DT3A 2GNJA 2PZYA 3UBDA 4BKJA 3F61A 5CVFA 4BDEA 2CJMA 5DH3A 2RKUA 5DVRA 4CT2A 2JAVA 2W96B 4ANBA 4CQEA 2JKMA 4FUXA 4MV3A 4ZSEA 4O6LA 4RIXB 3A4PA 4DLKA 2QQ7A 2R84A 3CJGA 4WBOA 1IASA 2YDKA 3CP9A 4J96A 5AAFA 4C0TA 2YM3A 4TV9F 4QRCA 4FKPA 3PLAE 5IEVA 4I6QA 3TNHA 4PWNA 2YFXA 4ZLOA 4O7WA 3QUEA 1OBGA 4TYHA 2C6LA 2KULA 1J1BA 2BAQA 1X8BA 2W5AA 3TTJA 3PVBA 3IQ7A
chains in the Genus database with same CATH superfamily
2Y9QA 5TO8A 3PRFA 4ZXTA 3C7QA 4FKWA 4BR3A 3DNEA 4QTEA 3BABA 4PDOA 1WBNA 2E9PA 2IN6A 4NUSA 2JC6A 4FV5A 3GQIA 4GRBA 4XG3A 5KE0A 3GJXB 1XQZA 2HIWA 2CNUA 3I6UA 3MA6A 3EQFA 5JEBA 5D10A 1RJBA 4Q5EA 4IB1A 4QP4A 5DR2A 5ACBC 4HCTA 4BCFA 3BLHA 4MH7A 4RMZA 3UYSA 3DAAA 3OS3A 5EDQA 3VPCA 2XB7A 1UKHA 4M67A 3P08A 5CF8A 2CGXA 1ZARA 3KRJA 2UW4A 3VQHA 4DHJA 3JS2A 3OCTA 5CWZA 3R7VA 5EW8A 3SG8A 5IQCA 5LMBA 4FG9A 2A2AA 3UO4A 4DG2E 4KD1A 1Q8UA 3LXPA 2VWIA 5AUXA 5BVWA 3UO6A 3CY3A 2W1GA 4GV1A 3PA5A 5GHVA 3UFXB 4O91A 2B53A 2LAVA 5KMKA 2FUMA 2YWPA 2WELA 2XK9A 4F4PA 2GLTA 4FG7A 2YS7A 3WWHA 3T9DA 5I5TA 3HL7A 3AOXA 3BGZA 3V8SA 5HO7A 2NU7B 4M15A 2VZ6A 1Z2OX 4R7HA 1TQPA 5T3QA 5GINE 3A2CA 3D5XA 4CXAA 4O38A 4YZBA 5EZYF 4EORA 4EZ7A 3P7BA 2A27A 2JKOA 3AMAA 4XYFA 3W16A 3ORMA 1W98A 5AUVA 2V59A 5CE8A 3JR1A 4YC8A 1XO2B 1CQIB 2Q7DA 5HG8A 2C6EA 3DAJA 4ARKA 5HTBA 5FG8A 1EKPA 3AD6A 3OWKA 3R9DA 2WQNA 2C6IA 3KKVA 4QP9A 4AT4A 2BROA 4AQCA 2XJ1A 5CANA 3POOA 4AXCA 1CKOA 5IQEA 4FKVA 3S0OA 2YABA 5EQYA 1PXNA 5K3WA 5E8SA 5E91A 2UZWE 2VX3A 3EN7A 3FMKA 5F1ZA 2XK7A 3KULB 2PY3A 2JBOA 4U44A 1QPJA 1TQMA 3AKKA 3KN6A 3Q2MA 3VW6A 1ZAUA 3R0TA 4ASZA 3B2TA 1K3AA 3Q4ZA 5IMEA 5AMNA 3FLYA 4HJOA 3AGMA 5C27A 4GIHA 3ZH8A 1ULZA 2GNHA 1Q8YA 4NM5A 1YDTE 5H2UA 3RM6A 1GZKA 2SRCA 3H9OA 1OZ1A 1VR2A 5IH5A 4C5CA 5IUGA 2XKCA 4XMOA 4F7LA 4MV7A 4M84A 3MY0A 4XG6A 3HMPA 3QRKA 4NCTC 4ZJVA 2OGVA 4AACA 3BU6A 3QYZA 1YXXA 2BHHA 3E3PA 4X3JA 3W33A 5HE1A 5CSPA 4KRDA 3G9NA 3OBGA 1O6YA 3H10A 3BA8A 3FL5A 1H27A 3VONA 2IW8A 4Z55A 3NYXA 4AA5A 2Z2WA 3AC1A 4IDTA 2X0GA 4PDSA 4RIYB 5BYAA 3DKCA 3IECA 2P0CA 5CXZA 4DHZA 4H05A 3UE4A 3D94A 4S2ZA 3D83A 5J95A 3R01A 4GS6A 5DGHA 5FRIA 2Z02A 3E5NA 4DT8A 1KOAA 1IYDA 2XS0A 1VZOA 4ZI7F 2E9OA 2PYWA 3D9VA 5CEKA 1Q97A 2DZDA 3OTUA 5BUIA 2BZIB 2OSCA 3U9CA 4EONA 4RIWB 1TA8A 3ETJA 5AP4A 1KUTA 2OICA 2XBAA 3ETAA 3FQEA 4I50F 3I7CA 2W4OA 4MXZA 4QQTA 2Y4IB 4YSJA 2XIYA 1CKMA 3OOGA 3ETHA 4FU0A 1KWPA 3LCDA 2ITVA 1YI6A 2A1HA 1KSWA 2UZNA 4Y72A 3P0MA 2P0AA 4XRJA 4YJNA 2VQDA 4FFLA 4DLIA 4QQ5A 2YZAA 5JN2A 3CD8A 4RIXA 2BDFA 2WTIA 3PVWA 2R3GA 3PTGA 4IB3A 3FLZA 4NK9A 3MY5A 3OG7A 3NAXA 1CKJA 4A9UA 4V04A 1R78A 4AGDA 4MHAA 1ERKA 2NP8A 2BALA 5HV6A 2Y0AA 4OLIA 1BL7A 5C4KA 5JGAA 5L2TA 4RFMA 3MPTA 2V5AA 1YW2A 3AGLA 3BPRA 4IVBA 4EOPA 4HNFA 2CSNA 3QQMA 1U54B 1JNKA 5IEXA 2WQOA 3M11A 4EK8A 1OI9A 3I0OA 2PUUA 4L3JA 5A4TA 4X3FB 1K2PA 2IVVA 2R2PA 2WYOA 5C8YF 4L44A 4MBJA 4M68A 3MA3A 3SOAA 5JFXA 3TUBA 4MCVA 2QB5A 4IC7A 3BHYA 5CY3A 1PXIA 2R3QA 3SV0A 5HBJA 2R85A 5EFQA 5HESA 1LR4A 2OWBA 5BVFA 1PJKA 2XIRA 3VULA 3R9RA 1VBHA 2WNTA 2SCUB 1OL1A 2Y4PA 2V7OA 3Q4CA 4HNIA 2IWIA 2ITUA 4GG7A 5H8EA 3QFFA 1XDNA 2F7ZE 2RL5A 3FYJX 4PMMA 4TM5A 2RFDA 3RHXA 4UV0A 3V5TA 3DDQA 5CLPA 2OW3A 4KWPA 4G6LA 2OIQA 4HYIA 3PVGA 5EG3A 5AJQA 2XCLA 1XBAA 5JQGF 4FSMA 3CTQA 4BCNA 4XYLB 1KC7A 4PMSA 1Q3WA 3V8TA 2IO6A 4W4VA 3AQVA 2X7FA 3KB7A 4GKIA 4WNPA 2FA2A 5E8XA 5HZNA 2PVPA 5JRSA 5AIRA 4UCSA 3NYVA 4IE9A 3CQUA 3WNZA 3HAMA 4ZTQA 4O82A 4CLJA 2YIQA 5EI6A 4GUEA 3LAUA 4EBWA 1WBSA 2B9IA 4Z7GA 5C8NA 1VBGA 5B7VA 3GCSA 2WQMA 2OFUA 2JDRA 4M12A 4RZVA 5E8ZA 1W82A 4I4TF 5FTQA 1JVPP 4A4XA 3Q2OA 3NNXA 2PE1A 3VS5A 4XNEA 5H9BA 5FP6A 3MI9A 4AZVA 4RJ6A 3UO5A 2JLDA 1FMOE 2JDSA 3ZUVA 5KS8A 2ZMDA 4BIBA 2FSMX 2VO7A 4FC0A 1PF8A 1Z9XA 3EZVA 4YZDA 3MH0A 4D2SA 5HVKA 3NZ0A 5I5SA 4R5SA 3DBEA 4Y73A 4YJOA 1IOWA 4X2NA 3ZO3A 4DH8A 1S9IA 2XH5A 3R21A 3TJCA 2I0EA 3EL7A 1VLRA 5KMLA 2PTKA 3K5HA 5D11A 3JVSA 2R7BA 3SX9A 3UOLA 4A4LA 3SKCA 2HDKA 4CLIA 1KBLA 2NU8B 2PZIA 3GOPA 4IX6A 2QI8A 4C35A 3UVPA 1GAGA 3IW4A 3RVGA 3VHKA 5I0BA 2C5OA 2C5VA 2QOFA 3ZRKA 4C3PA 3TKHA 3V5LA 2ZM3A 3DZOA 2VR1A 4ZMEA 2YW2A 3R7UA 5GIOE 1GIIA 3UG1A 4ZZOA 1AUVA 4M0JA 2EJ0A 5CU0A 3EN9A 1YXUA 2R0UA 2VUWA 3EN6A 3NUAA 3VIDA 5B2MA 4DEBA 3UZTA 3P86A 4F65A 1W84A 3FZTA 3I6WA 2YERA 5JZJA 3AC2A 3DBCA 3AC4A 3F9NA 3KRLA 3PWDA 4RLKA 3NBYB 2VTRA 4EFEA 2CGUA 4QT1A 4C62A 2OK1A 5D7AA 1BX6A 3RM7A 5EM8A 1OKWA 4MV1A 2ZAZA 3A7HA 3FZSA 4RC3A 3CPCA 4BTMA 4BZDA 5C01A 4AA0A 2YIYA 1WMKA 2Y4IC 3F2AA 5LCJA 5M56A 2COIA 2GS7A 3MIAA 1WFCA 2GS6A 2QU5A 4LFIA 4QTCA 3IDBA 4S33A 4AGUA 5BYLA 2A0CX 3VRZA 4H1JA 2B9HA 3S2PA 3TL8A 3MV5A 1OUKA 1E9HA 4ZTLA 4PQNA 4FFOA 1H0WA 2WTKC 2EJ2A 3NEWA 3K2LA 5KKRB 4EOLA 4JS8A 4RLLA 3GEQA 5CALA 3FKNA 3GNIB 2OKRA 3IG7A 3NUPA 4H39A 5IDNA 3ZONA 3ZO1A 3UODA 4CV9A 3TJDA 1M14A 4QMTA 3KXMA 3WO0A 3VPBA 4NH1A 4O21A 1WBWA 2YL2A 3MY1A 4M3QA 5BWWA 2A1AB 5LMKC 1KJIA 3K3PA 1APME 4JOAA 4FR4A 2V62A 5BWTA 4X3FC 4QSHA 1MP8A 3RPOA 1H07A 5E8UA 2F57A 4RCNA 4FKTA 4FV4A 4J1RA 1GY3A 3DDPA 5AUYA 3F82A 3MFRA 4DEEA 3NUSA 4ZTRA 3AC8A 4WD5A 4MF1A 3RV4A 3D5WA 3CPBA 5DFPA 2YAAA 1YXTA 3UIBA 4J99A 4XHKB 5AV4A 5A14A 4ZK5A 3C4FA 2EXMA 3K5UA 1NVSA 5CQWA 5GNKA 5T6KA 3VBQA 1H24A 2YEXA 5FXRA 2R86A 4YJTA 5CU3A 3AX6A 4YC6A 2XCHA 3UQFA 2BZHB 3Q4TA 4QYEA 3SXRA 5I9VA 2VWBA 4IANA 5FDXA 5CSXA 3OROA 4ANMA 4O7TA 3TN8A 2XK4A 4G5JA 4JQ7A 5E90A 2X8IA 3RWQA 1KJQA 3QTQA 3Q60A 1Q24A 2G15A 3Q9XA 5JH7F 2C00A 2C6DA 4GEOA 4EH7A 4K11A 5HICA 2PVLA 4IB0A 4RA5A 4UZDA 3LFDA 3MBLA 4CFFA 4XG7A 3W32A 3GU4A 5L2SA 3LFQA 1JSVA 3PLSA 3LLAA 4F09A 5FLFA 2JFMA 2X5RA 2GNGA 4FTJA 4LOOA 3QZGA 4BGHA 5CF5A 4JJRA 1I1LA 2NU6B 3IKAA 5LWNA 2OO8X 3C50A 3I81A 3UC3A 2GHLA 5CU2A 3DK7A 4BY9E 2PZPA 3UIUA 5M4IA 3VF9A 4ZSGA 2XK3A 4WHXA 4O0VA 3UYYA 3ZFYA 5AM7A 1H4LA 4WBBB 4G3CA 3CEBA 2PUNA 3LCKA 4ANQA 1O6KA 3I79A 3FXXA 2VTHA 3QQLA 5DEWA 5J9LA 4FKIA 2C0IA 1YHSA 4IADA 1PYXA 4USDA 1B38A 5EM7A 5H3QA 3FMNA 3WZJA 4JBPA 4FTIA 1EYZA 3KULA 3OZ6A 2UW3A 4KAOA 5DRDA 4O7SA 3BRBA 4MBIA 4DH7A 3QTZA 2UV2A 4LH7A 1QCFA 5AWMA 2Z7RA 3FMDA 4GK4A 4ZY6A 2RFNA 2W0JA 4YUQA 4WUNA 2GS2A 4YJVA 5IQIA 3ZLXA 3MVLA 4G16A 4S30A 3NWWA 4RC4A 3UZPA 3EH9A 3VF8A 3FJQE 1ST4A 5FPRA 5FEEA 5IEYA 5TF9A 3FV8A 2VTMA 3ORRA 4Q9ZA 4L01A 2YWVA 5LMKA 3R02A 2R3KA 4GG5A 2EUFB 3JPVA 5TT7A 1F0QA 4K6NA 4IWXA 4NYEA 4RVLA 3O96A 3LFAA 5JRQA 3R23A 4I4FA 4OW8A 3FMJA 4WIHA 5I9ZA 4H3QA 2IG7A 3COHA 3LQ3A 4YNOA 3R9NA 4LV8A 3VWAA 1DI8A 5LVMA 1R3CA 4O27B 3H3CA 5K4IA 5EI8A 2R3RA 3E88A 4EHVA 2Z7LA 4PL4A 5CZHA 5M06A 2XIZA 3LW0A 4IZYA 2ODTX 5C1QB 3TKUA 2QHMA 3TQTA 2JDVA 1RW8A 1OIRA 4KINA 4J52A 4U80A 3NUNA 1OIQA 3FPMA 5DAAA 1NT2A 1YXSA 4DFLA 4B0GA 1Q3DA 3SRVB 2VWZA 3DQXA 3H4JA 4IHPA 3BQRA 4L1KA 4QMUA 3EFJA 5CI7A 2W71A 4FI1A 3TMOA 4GLWA 2X2LA 3HRFA 4NZWB 4TYJA 3BI6A 4AW0A 3S00A 4Y5QA 2J5EA 2OJGA 4ZY5A 3PE1A 2WMVA 4TW9A 4MVFA 3RJCA 4RRVA 3BLAA 5AA9A 3AMYA 2XKDA 4R7BA 3RUPA 5C9CA 2C6TA 4UXQA 4RVMA 5LJJA 2VTIA 2YM7A 4FX3A 1MQBA 3TNQB 4H3BA 4MAMA 1XH7A 4XEYA 5E4HA 4DQNA 5A54A 3N51A 3MIYA 3ZM9A 2V22A 3QD4A 2YRXA 3C13A 3JY9A 3KFAA 3MPMA 4DN5A 2BZKB 5C03A 4MV9A 3MVMA 1OECA 2PK9A 3VS1A 2YHVA 3RWPA 4OR5A 2BHEA 4FZ6A 4JT3A 5DMXA 3MJ2A 4XG4A 2VRXA 5IA1A 2JITA 1AGWA 1PMUA 3PXFA 4K1BA 5B0XA 1BKXA 2WAJA 4MWHA 3VAPA 4CKIA 1P14A 4C38A 4E26A 5D8DA 2J4ZA 3LXNA 4O4LF 4QDVA 1XKKA 3PP1A 1PHKA 4FVRA 2GPWA 2BDWA 4F64A 4CFNA 3SE7A 3VW8A 3DK3A 3LMIA 3BIZA 3PP0A 2RFSA 4DA5A 3ZFXA 2UZUE 3TZ7A 3HMOA 2PL0A 3LFNA 2QG5A 2XD4A 3CIKA 3D5VA 4I5PA 5KMMA 3E3BX 3ZUTA 4CFMA 3PFYA 3FZOA 3ODYX 2XK6A 3ZU7A 3OF0A 4PP7A 3ZC6A 4QNYA 4YAKB 2J2IB 2HHFA 2OF2A 3MFSA 4GH2A 3QRJA 4FBXA 3GB8B 3FI2A 1CKNA 3GFWA 4CMFA 4CMTA 2WB8A 3VO3A 2HY0A 3BHVA 3ID6C 2JAMA 3HB9A 2W6ZA 5CZIA 3Q32A 3VMMA 4ACCA 5M4FA 1LEWA 2P4IA 4X6QC 4ALUA 4E1ZA 4BHNA 3R00A 4D0XA 5EH0A 1GLVA 2Q0BA 3DTWA 2GPHA 2YCFA 4RZQA 1URWA 3HRCA 4DGOA 4FSWA 3OXTA 4DTAA 2CKEA 5BYBA 2YACA 1LP4A 4O81A 4EOMA 3U9SA 1SCUB 1SZMA 1OKVA 1SVGA 3DV3A 4E4TA 4O0SA 3LZBA 2XARA 4QNAA 1XH4A 2OXDA 4GVJA 3CJFA 4IX5A 4DHFA 4TWCA 3RMFA 4FMQA 1HCKA 4DHIB 4E7WA 3DF7A 3T99A 5J2UF 2O65A 4O0XA 2WMSA 3R2YA 3EQBA 4FIIA 3TI1A 2WTDA 1Q5KA 4UX9A 4FKQA 2X6DA 3ORLA 4GT4A 3F88A 2C47A 4MXOA 1WR2A 4PBCA 4HNTA 5LWMA 2V5QA 1J7IA 4F9BA 4NKSA 4AFEA 2VWVA 5IMXA 1U5RA 4FODA 3WE4A 3EQGA 4XLIA 5DT0A 4TTHB 5AP2A 4AOIA 3QX2A 4C5BA 4OTFA 4GMYA 5EM6A 3G51A 4FL1A 3FZPA 3LKMA 4BDHA 4DF3A 4BTJA 3F5XA 2CKPA 5DN3A 4G6OA 3RPSA 4TT7A 2HY81 3W2OA 2B54A 3W8QA 1ZRZA 4ACDA 2XUUA 4AOTA 2X1NA 2I0HA 3T7AA 3DZQA 3NW7A 1JPAA 1F5QA 5CEOA 4I3ZA 5HD7A 2C0TA 2BUJA 4FNYA 4NSTA 5CSVA 3EOCA 4TUYF 4DFXE 3GC0A 3QUDA 3T9AA 2I6LA 4GYGA 3OUUA 4WG5A 2X4ZA 4A9SA 4CCBA 2HAKA 4MD9E 1I44A 5JFWA 3KA0A 2W6NA 3KMMA 4ITHA 4UBAA 2YJRA 4FKLA 2OU7A 3HBLA 2UVXA 2ZM1A 3W2RA 2ONLA 3W0PA 2EWAA 3Q96A 2PUPA 4KS8A 1X9NA 5BQ0A 1V1KA 2GU8A 1W83A 4XYMB 4MQ1A 4XS2A 1JAMA 2J6MA 4TXCA 4JQ8A 3UNKA 3C9WA 2JBPA 2X7GA 3OOMA 3P9JA 4FKJA 4JAJA 4JDIA 4JBVA 4C2WA 3T3VA 1WBVA 1O9UA 4B8MA 2J90A 5IYZF 3LCOA 4F9WA 2ZDGA 4JDKA 3MWEA 2B1PA 3VUKA 3L1SA 4FIFA 4QYGA 5CA1F 3VUDA 3GU7A 1DAWA 2NRUA 3LJ0A 4RIWA 4XP2A 2CPKE 3HV4A 1YVJA 3BWJA 4LL5A 4FSRA 4AXAA 4CFVA 4Y46A 3ZM4A 4W4XA 4BYJA 2J7TA 3AT2A 4A9TA 5FM2A 5HCZA 1OKYA 3BELA 2C6OA 2QOHA 5CAQA 2W4KA 5KMNA 1YOJA 5HORA 1XJDA 2PHKA 4C3FA 4ZSJA 3FQSA 4IM0A 1TFFA 5KMIA 3O8PA 3R7IA 4HNUA 2XVDA 3BYUA 4MX9A 3QZFA 1B39A 3C4CA 4X6RA 3IOPA 2UW8A 4XV2A 4F70A 1G8JA 2VTOA 3BCEA 4C61A 1KV2A 4KBCA 4YJQA 5J7HA 1ZYJA 5CYIA 3G0EA 5KX8A 3A61A 1CE8A 3RFCA 4OT5A 3VUGA 5M08A 3ZLWA 4M97A 3IGOA 2H34A 3U6HA 3RR5A 4PP9A 5ACKA 4D28A 3HVCA 4TPTA 3ACJA 2FH9A 4FT7A 1AD5A 1LPUA 4O83A 3ZDUA 1OIUA 3LFFA 2OXYA 3MFTA 2V58A 3FY2A 3LLTA 5L6OA 4LDTA 5M57A 5JGBA 4Z9LA 5BPYA 3JRWA 3BYSA 1BI7A 3E8CA 2PVYA 4JQEA 2Q0NA 4UWYA 3LQSA 5AAEA 4JMQA 4S31A 3U54A 4O7ZA 5AADA 2CLXA 1GSOA 2NU9B 4IIRA 4KIOA 4LG4A 2UVYA 3ANRA 4NFNA 2IVTA 3EYHA 1PXMA 4TYHB 4YJUA 2NO3A 2VGPA 3DNDA 4MXCA 4DCAA 4FFMA 5M07A 3R2BA 1E1VA 4NM3A 3V6SA 1OIYA 1BUHA 2RG6A 3TIYA 1JQHA 4OT6A 4E5BA 2ESMA 4DDGA 4EZ5A 4IVDA 4F9AA 3TTIA 3U8WA 5HU3A 3ITZA 5J87A 3PJ1A 5AUTA 5K5NA 4I6LA 4JXFA 1KE9A 4U41A 1XBBA 4BZNA 4DLJA 3TW7A 3UQGA 2YZGA 2PVHA 2ZB1A 3R8ZA 5CVGA 1OB3A 3FMEA 4AN9A 4BVUA 3U9TA 4QO9A 4ANSA 3OWLA 5JFVA 1DI9A 3KXGA 3RK5A 5CA0F 3COMA 4U3ZA 3I4BA 4ASEA 4QMMA 4B8LA 5M44A 3QQJA 4U42A 1JSTA 4ANLA 4AXDA 3LM0A 2DWCA 1XH5A 5CEIA 1E4EA 3D7TB 2HWOA 4NTTA 5JQ8A 4IB5A 4AT5A 3ZS5A 4QQJA 5AUZA 2R3MA 3C4EA 4WUAA 3EHAA 1A0GA 1Q62A 3EQRA 4G2FA 4FKUA 4NWMA 3CD3A 4BI2A 3E7VA 3GCUA 5A6NA 4EKKA 4LI5A 2R3FA 4EK6A 3D7ZA 5C8KA 1P5EA 4ALVA 3NNVA 2H8HA 2RIOA 4YAJB 4A9YA 5BUJA 4FEUA 3FZ1A 3LPBA 3SA0A 1ST0A 4BHZA 3A7FA 1J1CA 4IX4A 2RG5A 2QLQA 4BDCA 4AXFA 5JH6A 3C5IA 5HI2A 4GVAA 2ZFYA 3V01A 2QO2A 5D1JA 5LOVF 4Y8DA 1JKSA 4AQKA 4BDAA 2CNVA 3T54A 5A6OA 3W1BA 2Z8CA 4FKRA 3FLSA 2YRWA 3DLZA 2XM8A 3KRRA 4Q5HA 1QMZA 4C4IA 4EQMA 1KV1A 4EQUA 4DC2A 3ZXZA 4AZTA 3MTLA 4YBKA 3DGKA 5A3XA 1I1MA 4F99A 3AKJA 4BIEA 3K54A 2NRYA 4PZ7A 1VJYA 4RIYA 2G01A 1GZOA 3GGFA 5CT0A 3RZBA 3FXWA 5BYYA 2EB3A 2XM9A 1IRKA 4G9CA 5D1PA 3BACA 3WYYA 1QL6A 1ZYCA 3ATSA 4I24A 4PUZA 4TWNA 3Q1KA 4DE4A 4N4SA 3QQUA 5AM6A 4F63A 3TXOA 4IVAA 4HVIA 2EJ3A 5HCXA 3VUHA 2XJ0A 4CTBA 3E87A 4OTRA 5CNNA 5LMAA 3ZEPA 3ZYAA 3ORKA 1WVWA 3KRXA 4G31A 3V51A 5CEPA 3FPQA 4FTQA 4J71A 3PJ2A 4QMWA 3Q52A 3HNGA 4GK2A 4PY1A 3KXXA 4E4LA 2HXQA 3ALOA 4NZMA 4K6ZA 1VYWA 5DA3A 4GLXA 5KBRA 4FK3A 3JZFA 2WU7A 3O7LD 1ZWSA 3KY2A 2Z7SA 4L9IA 4OBPA 4CVAA 2COJA 1OPLA 3HV3A 5HU9A 4EFBA 1ZZ2A 2HZNA 3GVUA 4EC9A 3V5PA 3VC4A 2UW5A 4G17A 4NFMA 4IIJF 4CG8A 5BMSA 3L9NA 3HAVA 1B04A 4EEQA 1OGYA 3KF4A 3LXKA 5BV3A 2GPSA 2I87A 4MXAA 3FDNA 1I2KA 3RAHA 2YCRA 3MGYA 4BCGA 4YZMA 5J2TF 3PSDA 3PUPA 5BVNA 3UQCA 3NW5A 5DBXA 4TV8F 3ORXA 5D41A 4ALWA 5HD4A 4DG0E 4JIAA 2RGPA 3HKOA 4UY9A 3DY7A 3PN1A 4JBOA 1JDBB 4ITJA 2YM5A 2X81A 1CTPE 5BYZA 1J3HA 4FV0A 2OJIA 2VTLA 3JUHA 4DT9A 3KC3A 4ZJIA 1FGKA 1V0PA 4FTTA 4DGNA 3ROYA 1W96A 4G3FA 5IISA 3DTFA 1CMKE 4O96A 4C2VA 3QZIA 3BQCA 4PV0A 4RGJA 4BTKA 4AOJA 2HVQA 4CZTA 1IAHA 2QHNA 1PKGA 2YIRA 5BMMA 2BAJA 2V0DA 3P4KA 5DT4A 3ET7A 2W5BA 3OCBA 2R7KA 4B4LA 2OLSA 2W9ZB 3E64A 3EQHA 4E93A 5ANGA 2FB9A 1KE8A 1EH4A 3O17A 4OGRA 4X2JA 3QU0A 3L8SA 4ORKA 3QHWA 3Q4UA 5ETFA 3LJ2A 4RWLA 3BL9A 4BYIA 5BX0A 3U87A 1U54A 3E8NA 4F6SA 2WIHA 2YDJA 2EXCX 4MNFA 4O0WA 4G34A 4YGAA 3WZDA 2UZLA 1PX2A 4CFXA 5EHOA 4IVCA 5EYMA 4LOPA 1G2WA 3FI3A 4I41A 4JAIA 4XG2A 5HE0A 3PG3A 1FVTA 4M0YA 5AP5A 4YO6A 1ZMWA 4FGBA 5T68A 4FSUA 4AXEA 4OTGA 4FFRA 4ZOLF 4J8MA 3G2FA 3KRWA 4MXXA 4RWJA 4EBVA 1YWRA 2XAMA 2X2MA 4LMNA 4MNEB 4DGMA 1Z2PX 3P7AA 4CKEA 4U79A 3LMGA 3CEKA 3UG2A 3PPZA 5LARA 2C0OA 3E93A 2Q2TA 4PRJA 4IC8A 1JKKA 5DR6A 4IHJF 4IFGA 2O63A 3D4QA 1DM2A 2XNNA 3R1YA 3DB8A 5BNJA 3ODZX 5EHLA 5CASA 5DLSA 2WEVA 3DBQA 2V7AA