4O86A

Saicar synthetase (type-2) in complex with adp and cdp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP and CDP
rcsb
source organism Pyrococcus horikoshii
total genus 75
structure length 227
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o86A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o86A02
4GG7A 4AT4A 2BKKA 1FVTA 4EKLA 3TM0A 2FYSA 3D7ZA 2F4JA 1A48A 2IN6A 2X8IA 3KL8A 5HVJA 3UODA 4EI4A 3MH0A 4ANLA 3I4BA 4FEXA 2I0YA 4GS6A 2H6DA 2H34A 5FXSA 4HVDA 2W99B 4DG3E 2UZWE 5E7RA 4H36A 4JAJA 3QKKA 3HV3A 3PLSA 4JIAA 5CYIA 5IH6A 5IQCA 4GIIA 5CENA 2VR1A 4ACHA 2Y4IB 4O0TA 1CSNA 5BMSA 2E9NA 4MAOA 4AWIA 2W6QA 2AYPA 2NRYA 3R04A 4XBRA 5HIEA 3FMLA 2IW9A 3RP9A 3D5WA 3O8UA 4CXAA 4EOLA 4D0XA 2YJRA 3MB6A 4FKWA 2PZYA 2X81A 1PYEA 1VEBA 2P2IA 4Z9LA 4HNUA 3POZA 3BX5A 3P08A 4C2WA 2FPGB 2VRXA 3F2RA 4M69B 3PP0A 4WG3A 4YLLA 5J9LA 3CQUA 4GJ2A 3IW8A 5E8VA 3QU0A 5L3AA 4RIOA 2UVXA 3ETJA 4EKKA 2W9FB 4IZ7A 5EW8A 3V4ZA 2ZV8A 3OFMA 4FIIA 2VWZA 2HIWA 4JG7A 1B38A 1CM8A 1BYGA 2YDIA 3F61A 3FQHA 3R73A 4L68A 4NKSA 4PTCA 2OF2A 4EJ7A 4DIMA 3UC3A 1Z2NX 3QCQA 4P90A 1TKIA 5E9EA 1E1VA 4M14A 4O84A 2QD9A 4DYMA 4G1WA 3WE4A 4BYJA 4AA5A 4U6RA 2P3GX 5IQHA 1KJ8A 3SX9A 3CD8A 2PU8A 2O2UA 4XRJA 4ASZA 3VIDA 2JDOA 3OROA 3COKA 3W8QA 4CMUA 4HVSA 4QMXA 5J87A 2UW0A 3FZTA 2QG5A 3QZFA 1JKSA 4OTWA 3U6IA 5F94A 1XH6A 3QTSA 4KBCA 5BQ0A 5FDPA 2GSFA 2XZSA 3GFWA 2PVRA 3HX4A 3K2LA 5C1PA 3FZOA 2OK1A 4FKJA 3BI6A 4ANSA 2CNVA 2WEVA 1H25A 2R5TA 3BHVA 4BTMA 3AC8A 4FOBA 4XP3A 4C58A 2I0EA 3E64A 4DBXA 3FMHA 2DS1A 4K11A 4UZHA 3HA8A 1ATPE 4CRLA 4N6ZA 2C0IA 4MXAA 4PMTA 3T9TA 5C8MA 5DFPA 5LVMA 5JZJA 5KX5F 3OMVA 5J2UF 4BDDA 2R7MA 3OT8A 5CSPA 2B4SB 4K8AA 1KV2A 3MPAA 1ZMUA 4FSZA 2HW6A 4CV9A 5I9VA 1XBCA 3TV7A 5FEDA 4M9UA 4O82A 1I44A 2XA4A 3BYSA 3UZRA 2XNPA 4EC8A 3F3VA 4HYSA 4A4XA 4FTKA 2VD5A 3LFDA 4TYIA 5HBHA 1FPUA 3QRKA 5IYZF 4I3ZA 3SD0A 5HVKA 1GZ8A 4HGEA 1KUTA 2IPXA 1XJDA 5BVFA 4MBIA 2WPAA 3W10A 5CAUA 3BELA 2IW8A 4DH3A 5ANEA 4RT7A 3VRZA 5BPFA 3HGKA 3BIZA 3KRXA 5D1JA 4QMPA 5KE0A 1Z5MA 4D9UA 5JFSA 2R3FA 3SGCA 4YB8B 4QP1A 2FSLX 4F9YA 3O71A 2J0LA 2JFLA 3IDBA 5IEYA 4UWCA 2ITYA 3QX2A 4YJRA 4YJVA 2YRXA 2WXVA 5LCKA 4IBMA 3JR1A 2PVJA 1FVRA 3R22A 3LHJA 5CF4A 3KKVA 4P2KA 3TTJA 5K4JA 1VBHA 4GK2A 2GU8A 4CLJA 1W96A 4Y5QA 4I94A 3ANRA 5E1EA 4QTDA 3QYZA 1KE7A 4IVDA 4TXCA 4PL4A 3U9TA 2A0CX 4PMMA 5C9CA 4RC4A 4H1JA 3R9OA 4ALUA 3ETAA 2J51A 2NP8A 2QLUA 2OXXA 3Q96A 3OBGA 2XRUA 3NW6A 3RMFA 4G6LA 4BB4A 5IPJA 2QOLA 3CTQA 5TKDA 3RM6A 3JY9A 4FOCA 1GAGA 3BYUA 5JKGA 2XK3A 4FV9A 4XG3A 1A06A 4KSPA 4LGGA 4JT3A 1SVHA 4IMYA 5AAEA 3DGKA 2PVKA 4PWNA 2BAJA 3I6WA 4UZDA 4EWHA 4N6YA 4LI5A 1YI4A 2OFVA 3OZ6A 1OMWA 3FI2A 4BTKA 2WAJA 3PIYA 2BRGA 4EH2A 3KMMA 2C5YA 2WGJA 3DBDA 4X2GA 3ZRMA 2X7OA 3CKWA 3ELJA 3PZHA 4JDJA 1UKHA 5CI6A 3FKLA 5AX9A 4FG9A 4RJ7A 5JVDF 3FKNA 3P4KA 3CE3A 4GVJA 3NZ0A 2ONLC 5BYZA 1H1SA 3F3WA 3LQ3A 1YKRA 4V01A 4ASDA 4WG4A 3QTRA 4NWMA 4JVGA 3VS0A 5KMIA 4H1MA 1QPJA 4RJ6A 4LV5A 2XYUA 3OW4A 4USEA 2VTOA 3IS5A 3R5HA 5BYLA 3SA0A 1KJJA 3AGMA 3NUYA 1ZY5A 4G2FA 4XZ3B 1ERKA 1CQJB 4R77A 4A4OA 3O51A 2C3KA 4R3RA 3AXWA 3R8UA 5HNBA 4F6UA 5C8KA 2UW5A 1H27A 4H3PA 5K5NA 4FV4A 4O4HF 3II5A 4RA4A 4FT9A 2W17A 2A19B 3WI6A 5EHLA 3ZYAA 5FM3A 1JPAA 5L6PA 1F3MC 3OWPA 2FUMA 3QFVA 4RLLA 3DKFA 3V3VA 3DK3A 4F1OA 3AD6A 3NUSA 4TPTA 5AA8A 2WNTA 4G31A 2ZOQA 4FV7A 3MVLA 4FICA 3TL8A 4HPTE 2YABA 3CSVA 1H1WA 4QMUA 5DN3A 1W84A 2HZIA 3ZXTA 3ET7A 3QGWA 4IC8A 3L8PA 1FMOE 1RJBA 4C2VA 2WO6A 3C4CA 3HRCA 4WRGA 5LQFA 4J96A 3CD3A 4CGAA 4EGJA 4O7SA 3H4JA 3FWQA 1UU7A 3BWJA 4IJ9A 4MWHA 5CX9A 5AUVA 3HMIA 4O2PA 4CZTA 4NM3A 2FPPB 3UC4A 3LFSA 2E2BA 2PWLA 2ZDQA 4X2JA 3ZFYA 2PY3A 3H3CA 1Q8TA 3VO3A 1M2QA 2GHMA 3FQEA 4ENXA 4L6QA 4RFMA 4AU8A 5BPYA 3ODZX 3R9DA 5LXMA 2RFSA 3VUHA 2WU6A 2BHHA 3MDYA 1OPJA 3GNIB 5JK3A 5FTGA 2YM3A 4NCTA 3JPVA 4FFLA 2Z02A 3FMNA 2FH9A 3UVRA 3D2IA 3JUHA 4GW8A 3OOGA 4K6ZA 3UO5A 3UIBA 2QG7A 3LFAA 4RG0A 1IAJA 4RX9A 4ACDA 3I5ZA 5JGDA 5LVPA 5M53A 4I1ZA 4XG9A 4IB0A 4J53A 4D4RA 2J9MA 4FV6A 3QTXA 4NT4A 5EQPA 2HYYA 3RAWA 2YL2A 3FAAA 3R83A 1UNGA 3GIDA 5ETIA 1UWJA 4BI1A 1BL7A 5M07A 4FSWA 2WD1A 3BBTB 3C4EA 5CA0F 3E3BX 1SVGA 4QMMA 4AZWA 2R0IA 2V58A 4RVMA 2O3PA 2P2HA 3MH3A 1J7UA 5K4IA 2ZDHA 3Q4ZA 5DT3A 2GPHA 4Y8VB 4YBJA 1WVYA 3BE9A 1GY3A 2X7GA 3F66A 4FGRA 3DJ7A 1WBOA 5IQIA 3TKIA 1URCA 2WMTA 2R3MA 3GC8A 2BRMA 4G9CA 3U9NA 1RDQE 3ZHPC 1W0XC 2NUAB 5EM6A 3TINA 4RX7A 4XCUA 2UZBA 3EOCA 4CLIA 4TYGA 2CKQA 3DXPA 3S95A 4BDKA 4EBVA 5HBRB 4LGHA 2GS2A 1SVEA 4D2RA 1H01A 1NVRA 3MWUA 4R3CA 4IAAA 4K18A 4AACA 4HCVA 1JSUA 2QKRA 3PY3A 2ITTA 3EQIA 2A4LA 2R64A 5IISA 5LVNA 1B6SA 4DEIA 3TIGA 3SV0A 4FIEA 4JJRA 2WMXA 3QHRA 2PMIA 2HZ4A 5JRSA 4J71A 2PUPA 1K2PA 4BHNA 3VUMA 3SE7A 3HZTA 2GQRA 3FSKA 4QP3A 4BKJA 5HTCA 3RZBA 5CVFA 3IW4A 4DTKA 2J0JA 2GFCA 2EB2A 3DT1A 4A9TA 4G9RA 4ZZOA 2RG5A 5JSMA 3ZMMA 3EN7A 4WKQA 4BRXA 5IMXA 1PMEA 3QTWA 5D12A 3IKAA 3TUCA 2YZLA 5J2TF 4YMJA 2G01A 5KBRA 3A7GA 5CSXA 4RIYA 1YHWA 5HEZA 5TOZA 4S30A 4GJ3A 1H0WA 2PE1A 3MB7A 3TNHA 3VNTA 2XRWA 4O91A 3EQPA 3QAME 4G17A 2I7QA 4WSYA 1XH9A 2C5NA 3ERKA 3RCDA 4EH6A 5M57A 4KB8A 3R1YA 4EUTA 2HJWA 3PXKA 5CS6A 3NSZA 5AUXA 4C36A 1LR4A 5IQAA 3TJDA 3TV4A 4Z7HA 3ID6C 2GDOA 2GNGA 3PLAE 4FKQA 3CY3A 4XV9A 4JR3A 4O81A 1JLUE 3UQCA 3Q2JA 2G9XA 1G8SA 3FY2A 5AJQA 4WNOA 3T8OA 4ZTSA 1T45A 2IVUA 4FK6A 4P5QA 4AE6A 4MF1A 3SKCA 2RG6A 4GFMA 1CKPA 3DK7A 4RJ3A 4IIJF 4XX0B 3N4UA 3LXPA 4I20A 3WOWA 2QR7A 5H8GA 3ZZEA 3GCUA 5KZ0A 5C8YF 2O0UA 1OL1A 2CSNA 1JKKA 2XNOA 3C0GA 4ZAUA 4J7BA 4S32A 2OJFE 3OG7A 3C51A 3PXZA 3R2BA 2XCHA 1BL6A 1UNLA 2XK6A 3A7HA 1ZOEA 3K5VA 4OR5A 4ZSJA 2VNWA 3LFFA 4NIFB 2ZJWA 4B0GA 2IO6A 4C61A 3E63A 1YHVA 4H58A 4TV8F 3NUPA 2FO0A 3S00A 4IIRA 4AT3A 2XM8A 4E6DA 1OM1A 2PHKA 2XD4A 4EONA 1Q61A 4QP2A 3UDBA 3QBNA 2YN8A 4MV1A 1ZYSA 1RQQA 2R2PA 3CJGA 2XKCA 4BGHA 4NK9A 4YC8A 4EH8A 1K9AA 4L7SA 4AQCA 4WUNA 4AOJA 4AZVA 2PVHA 3R7UA 4OT6A 3BWFA 2B9HA 5IDNA 2GLTA 4HW7A 2VTPA 5CTPA 1NVQA 5AV2A 2X0SA 5B7VA 3VOTA 5M55A 4TNBA 4ZJVA 4U79A 2RFDA 4IC7A 4TY1A 2YM5A 3VC4A 4B6LA 2VWXA 4FSYA 3PVUA 4ARKA 4AW1A 1R0PA 3QRTA 5M09A 4C7TA 3GENA 4PY1A 4KSQA 3K54A 4FNWA 2CLQA 3R1SA 4EK8A 2ZV2A 1H0VA 2F7EE 4DGGA 5CU4A 2BDFA 4YO4A 4E4TA 3PUPA 4QQJA 3C50A 4O86A 1FGIA 5AV4A 4QTBA 4M7IA 3JRWA 4MV8A 5JH6A 3REPA 4KNBA 4BTFA 4ZSLA 5ANOA 1PXIA 1PXJA 4OTIA 5E4HA 1M7QA 1K3AA 2C69A 2VO7A 5FTQA 3IPHA 4HR7A 5CALA 4RIYB 3NAYA 3OOMA 4XG4A 2BZIB 3NUXA 4PP7A 3GXLA 2VTQA 2C1AA 3ORZA 1DV2A 2HZ0A 5FP6A 3AD4A 4XV2A 5CVGA 5DHJA 2Z7QA 5LMKC 3QYWA 4L9IA 2VX0A 5EYDA 5CASA 3LXKA 1ND4A 3RGFA 3VS3A 3Q32A 4YPSA 5AP7A 1QPCA 3UMXA 1PF8A 3NYXA 5BX0A 2B0QA 4G6NA 4G6OA 4E1ZA 5EHOA 3OUZA 2VUWA 1APME 2W1IA 4L8MA 4RFYA 1Y91A 3W2RA 5HORA 5HQ0A 5KX8A 4WBNF 4C4FA 2C00A 2XKDA 2CDZA 4M0YA 2QOQA 4CT1A 4BGQA 2BDJA 4UXLA 4W4YA 4GT5A 3HB9A 4AA4A 3R8MA 3A7JA 1P14A 4I0TA 4MD8E 3GC7A 4CMTA 5IUGA 2ZB0A 4YHJA 2NNWB 2PK9A 4J52A 2XEYA 2PMLX 4E73A 5BVEA 4TW9A 3W33A 4CG9A 4UWYA 3TIIA 4R1YA 5CAOA 1TQMA 4OTDA 5FDXA 2C5VA 1PMUA 2UZOA 2BRNA 3N9XA 2R3QA 4DCEA 2CN8A 4YJTA 4O2ZA 1I7NA 5EW9A 4PQNA 2GNLA 5E8WA 1NA7A 4FVPA 4U42A 3AMAA 4DFLA 4GG5A 5AMNA 4BDFA 4JDIA 4KKHA 4EOKA 4EQUA 4F99A 5C27A 4U5JA 2QOFA 5HHWA 1IR3A 4L52A 1OL5A 4YC3A 5BNJA 3R23A 4G34A 4BCIA 2YZNA 2OW3A 2GNIA 4BDGA 4XH6A 3N8DA 5DOSA 3SXFA 4EZ3A 2X4FA 4M13A 4JS8A 5GIOE 4BI0A 5C01A 2PZPA 2W6NA 5DVRA 2X6DA 2XIZA 5E92A 4OBPA 2WTDA 5D7VA 3EZVA 2IG7A 5A4QA 3E93A 4EOMA 2XBJA 3SAYA 2ZDTA 2R3OA 3DAKA 4YJOA 3JRXA 3BU5A 2CCHA 3IOPA 2R9SA 5CVHA 5LOHA 1BLXA 1IA9A 4C3PA 4C59A 3OTVA 4M8TA 1JOWB 2RGPA 3ZDIA 3FHIA 5AAGA 5CQUA 4IB1A 2F7XE 3NVMB 3LQ5A 2R7LA 3EFKA 2BCJA 2BAQA 4XOZA 4L42A 5IH4A 1U5RA 3C1XA 3OY1A 4BCNA 1H8FA 3DXNA 5E8ZA 3R9NA 4F6SA 3TNWA 1PXNA 4WO5A 2WQOA 4FVRA 4LOOA 3UNZA 1GGOA 4B9DA 2V5AA 4FKGA 2W4JA 2XP2A 3CS9A 4K9YA 1MRUA 3U8WA 2R3HA 2ITNA 3QQFA 3PPJA 3DTCA 1P4OA 1REJA 4FKRA 3V01A 4JG8A 4N70A 4OW8A 3F6XA 4YSMA 3OWKA 1GIIA 4I93A 4MVFA 4MX9A 3DTWA 5DE2A 3CGOA 4E5BA 5CT7A 2HY81 3ZH8A 3DJ5A 5HD4A 5D9HA 1UNHA 5HNGA 3LJ0A 4HYUA 3WYYA 3KGAA 2W1DA 4IX4A 4FGBA 3RVGA 4MXZA 3W32A 4IFGA 4QTCA 3GU8A 1YXVA 2PULA 1U4DA 1WMKA 3DA6A 3QQHA 4GCJA 4XV1A 1FQ1B 3QX4A 3W2QA 3ZC6A 4BICA 4A06A 4Z16A 1H26A 1Q4LA 3MVHA 3NR9A 4AT5A 2YYAA 1DAWA 4AGWA 3PJCA 4E20A 4ZZNA 5CNNA 3BKBA 3P23A 4FTAA 3TZMA 3FDNA 3UP2A 2P4IA 4ANBA 3UZPA 3D83A 5HX8A 3WARA 2FA2A 1V0BA 1PYXA 3AT2A 2V55A 3CGFA 4YC6A 1KJIA 4KIQA 4QMYA 2P55A 2BR1A 5IF1A 2YIXA 5D41A 2JIVA 1CTPE 4GU9A 2PVNA 3QD0A 5DG5A 5J95A 3ZSHA 4DLKA 1BI8A 4G3DA 4AG8A 2QO9A 4BGGA 3A99A 3OP5A 4D1ZA 3IECA 5ITAA 4EK4A 5K5XA 3VWAA 1KE6A 4UY9A 4L44A 1I7LA 2OZOA 4YTHA 2CMWA 2W7XA 2FGIA 4FV5A 4FTRA 4LFIA 3TIYA 2QHMA 2C47A 4DH5A 1LEWA 1ZYCA 4O6EA 2GNJA 1H00A 5EM5A 4ZMFA 5A4LA 2OF4A 4KWPA 4NU1A 2HAKA 4R7BA 3THBA 5EKOA 2UW6A 1Z2PX 4EOSA 4LQMA 4J8NA 5HCZA 3PSBA 4RFZA 5HX6A 5AP1A 3ZOSA 4DGOA 4IVCA 4XG7A 5B0XA 4HYHA 4AOIA 3QTUA 5JMSA 2F49A 2YM8A 3FBVA 3MJ2A 4EHEA 4JQEA 4AAAA 1AUVA 3KB7A 1JDEA 1WBVA 4FI1A 2R3IA 4O7YA 3PP1A 3ZBXA 1MRVA 4FZ6A 2JIUA 4K1BA 3GP0A 2W06A 4JG6A 4O0SA 5CLPA 3DBQA 5FXQA 4EEVA 3QQLA 2B7AA 3NYNA 1CKIA 2R3NA 3F82A 3OF0A 1GZNA 3GCQA 5CXZA 5KKNB 4HNIA 5CQWA 4C3RA 4WT6A 5H3QA 1BUHA 1OKYA 4ZTRA 3DK6A 3C4ZA 4D4YA 3PPZA 1MQBA 3OUUA 1F5QA 1OIUA 1QPDA 5AA9A 3KK8A 4JLCA 3OWJA 2ITQA 3FMEA 4RVTA 3C0HA 1HOWA 3GI3A 4XS2A 5D11A 4JDKA 3QTQA 4YJ3F 1IASA 4MKCA 5KMJA 3LWBA 1XHAA 2BTSA 3IW7A 2YCRA 4WIHA 4ALVA 5CEQA 3AC4A 1H28A 1OZ1A 4IZ5A 3MWDA 2Y6OA 3GB2A 5HG8A 4FKTA 3PG3A 2WMBA 3EFWA 5AEPA 4N0SA 4YJNA 3NX8A 4F1MA 3G8CA 5BYYA 2YZAA 5AUTA 2HELA 3KQ7A 3LIJA 3N4VA 5D10A 2VWYA 2W6MA 2UW9A 2PN1A 3NW5A 2HWPA 3ZONA 3HRFA 1YOMA 5F95A 2BVAA 2R3JA 3G9NA 2F2UA 4MXOA 3ORNA 2C6DA 4CKJA 3R28A 2YIYA 3K5HA 4HNTA 1O6YA 4CMOA 3FV8A 1WZYA 4I55F 2C6OA 4XNEA 4O38A 2YACA 3FUPA 5HICA 2B9FA 2YIQA 3G2FA 2XNEA 5DBXA 1KSWA 2VV9A 5EHYA 3WF8A 4QQTA 5A14A 2W70A 2I6LA 4ZS4A 4CFUA 1J3HA 1TQIA 3DU8A 3W2PA 2R7NA 2GS6A 4KBAA 2PTKA 3MFUA 3TEIA 3V5PA 3HV6A 3MIAA 5EDPA 3EL8A 2HY0A 4DEHA 4N57A 3DDQA 4W4WA 2XUUA 3S1HA 3IGGA 1G5SA 5CAPA 3Q60A 4KA3A 4TTHB 1YHSA 3BQCA 2P0CA 4MXCA 3ACKA 1JQHA 5HNIX 2C1BA 4BCFA 3OXIA 4F9CA 4ZLOA 5F20A 4O0VA 4F9WA 2GNFA 3CPBA 4FVQA 4I6BA 3LCOA 4LMNA 5HLWA 2O64A 5IH5A 2JDVA 1U59A 4ENYA 3QLGA 4QNYA 2V7AA 3Q1KA 3D0EA 4ANMA 4EH5A 5E8TA 3PE2A 4PTGA 4HGSA 1YWVA 2BAKA 5JFWA 1SNUA 4IX6A 3EMGA 3FZRA 1SYKA 2NPQA 4Y73A 2J7TA 3CLYA 4HCUA 4U7ZA 3QGYA 2X9FA 1CQIB 4FE2A 2OLCA 3P0MA 1JNKA 2H96A 4FTOA 3UFXB 3SG8A 1W93A 3PPKA 3F69A 4R5SA 4Y85A 4EH7A 2W6ZA 3IGOA 1Q97A 3OCGA 4X3FA 3EWHA 4F63A 3NRMA 1OPLA 3TG1A 4I41A 2GHGA 4IAIA 2VX3A 4LRKA 3MESA 3WZDA 3LM5A 4EORA 3R6XA 1ZXEA 2UW4A 2Z7SA 2NO3A 4AZTA 2VWIA 3PWYA 2QLQA 2O8YA 3EYHA 5J9ZA 5JRQA 1VYWA 3BCEA 3QZHA 4RWLA 2WTCA 4EQMA 4KD1A 5J5SA 5IQGA 1OGUA 2QOOA 4O0YA 2WTKB 3HP2A 3RK7A 3Q9XA 3RPYA 3QD2B 3TZ7A 1QPEA 4RX5A 3HDNA 2ZM1A 5DR9A 3TZ9A 3VS1A 4EK5A 3ZO4A 4RZQA 4RX8A 4YTFA 5EI8A 4LUEA 1CMKE 2XIXA 3PSCA 3V5JA 2WYOA 4V0GA 2Z7RA 3I6UA 2JGZA 3BZ3A 1M7NA 1YWNA 4X6QC 1M6VA 3JYAA 1W7HA 4FKPA 4JBPA 1P5EA 1Z9XA 3TW6A 4A9SA 1NXKA 4ASXA 3DS6A 3DJ6A 3P79A 5AP0A 1PHKA 4B8MA 1FOTA 1YDRE 3R7IA 4XP2A 3PRIA 3OBJA 4ZTMA 3L8VA 4IM3A 4P7EA 4JX3A 3QF9A 2WMWA 3R01A 4PNKA 3WE8A 2YHVA 1M14A 4JBOA 2RFNA 4EG0A 3FLSA 4DEEA 2EXMA 1R78A 2QCSA 4I5CA 1T36A 4FR4A 4O7RA 3UQGA 4F6WA 5BMVF 3I12A 5G1XA 2VTTA 4MH7A 3DZQA 2C6TA 5BVKA 1Z2OX 5M08A 4HVHA 2NRUA 3MA6A 3IK3A 5TF9A 2YRWA 3MGYA 2F57A 3UPZA 1PKGA 2XYNA 3AC5A 3SW4A 1CS0A 4EC9A 1J1CA 4DA5A 5LXTF 5CU0A 3JZFA 2W4KA 3LFBA 1W98A 2OJ9A 2XJ1A 3A8WA 4YHFA 4EBWA 3EYGA 2YFXA 2P33A 3R8PA 5FXRA 3PFQA 3VVHA 3QXOA 1WVWA 2GNHA 5HG5A 2C3LA 4ONAA 2YERA 3FLWA 2G2FA 4S33A 4BZNA 4EZ5A 4A7CA 2WMUA 4OUCA 1URWA 3GOKA 3HUBA 3LFNA 2XK8A 4FTJA 2FB8A 4O7WA 2WQBA 3TNQB 1Q8ZA 3VUGA 5CB4F 4K33A 1BI7A 4OTQA 4CTCA 2Y4IC 4BDHA 4DAWA 1PY5A 3LW0A 1VKZA 3DV3A 4IM0A 2ITOA 2Z60A 3LCKA 5DEYA 1TQPA 4ACCA 4D9TA 4HGLA 4FUXA 3COHA 4WBOA 1XBAA 3KRLA 4O0XA 3TKHA 3TN8A 3A4PA 3V5WA 3EB0A 3V8WA 4DT8A 4QMSA 4JL9A 5DA3A 1KC7A 4X3FB 3G5DA 3QZIA 3CQEA 4M97A 3UNJA 3PZEA 5LA6F 2R3GA 4C4GA 4C62A 3Q3BA 4MXYA 3NEWA 4L1KA 2VWUA 4ZTQA 5I9UA 3I1AA 1J91A 3QWJA 4JXFA 4BIBA 1H07A 1Z57A 3UOHA 4C34A 1IEPA 2VGPA 4F08A 4XLVA 2PVLA 2V22A 4BF2A 4MV9A 3ZDUA 2PE2A 1SMHA 3TV6A 3BV2A 3W8LA 4JBVA 2PMNX 3O50A 2W05A 4MCVA 2WTWA 4X2FA 3QA8A 4EOJA 4J8MA 2FSMX 3ZLSA 5EKNA 3GGFA 4IWOA 4FIHA 3F3ZA 4UBAA 5HIDA 2J2IB 3D2KA 4OLIA 3U6JA 4LL5A 5E91A 2PZ5A 3MY0A 5T3QA 3R9RA 4V0GB 5K3YA 4KS7A 4LL0A 5KMNA 3RAIA 3MI9A 4D4VA 4EYMA 5KHWA 3HVCA 4QYFA 4XBUA 3FYKX 1OBGA 3UJGA 1JLLB 2YDJA 2W71A 2WEIA 4TWPA 4O7VA 3PWDA 2XBAA 4HYIA 4O4IF 2FSOX 2VTMA 4KS8A 5M56A 3CTHA 3EQGA 3ZXZA 4F9BA 2OH0E 3QXPA 1Q41A 4S2ZA 2CKOA 2C3JA 4PDPA 5DR6A 4TV9F 1OI9A 3QQUA 5E90A 2VTAA 1H1QA 2XVDA 5HI2A 3BYOA 4OTHA 4RRVA 5JEBA 3PXQA 3ZTXA 4L3JA 3H0ZA 2ZAZA 2HENA 3PA3A 5DLSA 4QMNA 2VWVA 2O63A 3LLAA 5FBNC 4IWPA 3U9SA 3UP7A 1FBNA 4E4MA 1OB3A 4I50F 4OBOA 3G6GA 3OUNB 1PXOA 3JZIA 1UKIA 4FTIA 2QOHA 3KC3A 3G0FA 4ZS0A 4ZIMA 2PUUA 4IJPA 2BZKB 4YJPA 4D55A 1EZ1A 4DBNA 3E92A 5A4EA 3NS9A 4I0RA 1UV5A 3OVVA 4FKOA 3ZEPA 3IO7A 3PTGA 3QKLA 4QQCA 4Y46A 4J95A 4O0WA 5HLPA 3HAVA 2ITUA 2WMVA 5EM8A 4O4JF 3KMUA 1B39A 4FKLA 5FEEA 5IQBA 3HKOA 4CVAA 2YM7A 5EDRA 2VN9A 5HCXA 2J0MB 5JFVA 4ZMEA 2VTNA 3LOKA 3VAPA 5EM7A 1GSAA 1A9UA 3IQ7A 3LZBA 2R85A 3V04A 1PXPA 4GFGA 5DEWA 4XYLB 2F2CB 4MD9E 2UZLA 3FXZA 1Q62A 3G9LX 4WHZA 3RALA 4MV6A 5ANKA 2JEDA 4FTMA 3FZPA 2R3RA 5KMKA 1B6CB 5IG1A 3S2PA 2YWVA 3CIKA 4R6VA 3FI4A 2YCQA 4FTLA 4I0SA 3WZEA 3AGLA 3R8ZA 4E6QA 4F09A 3HV7A 4FU0A 3W2SA 5CEIA 1OUKA 4ITJA 3HNGA 2IJMA 3FXXA 5AWMA 2ERZE 4E26A 4E8AA 4ZP5A 5JQGF 1R3CA 2X2LA 3I0OA 3QUEA 1WBTA 3ZRKA 5IU2A 3B8QA 1ZLTA 3OT3A 4IHPA 1M0WA 3QFFA 5JQ5A 2YAAA 2AUHA 3NNUA 3O0GA 2VO0A 2DUVA 4CV8A 5KKRB 2V59A 5CF8A 3O8TA 4IDVA 4IZAA 3U55A 2QR8A 3TJCA 2OIBA 2YDKA 2VTHA 3LVPA 4FSNA 4ERWA 1V0PA 2BTRA 5C03A 3TIZA 3ETHA 4I4TF 4ZQIA 3RWQA 3NVKI 1YDTE 3HAMA 4X2NA 2XIYA 2WFYA 3D5UA 3E7VA 4XX9A 4C38A 4YJUA 3DB8A 3AW8A 4TYHA 1MQ4A 3P1AA 2X39A 4I23A 3E8EA 3ZS5A 4C0TA 3E62A 1Q3DA 3R00A 2X2KA 2JIIA 2CPKE 2YCSA 3EQFA 4NJ3A 2PUNA 1OIRA 3FL4A 4YUQA 2WOTA 4O7ZA 4RIXA 3UYSA 3FI8A 4G3FA 3U9CA 1LP4A 3S4QA 4H3BA 1EUDB 4GT4A 3PA5A 4RVKA 1ZMVA 2CN5A 4OTFA 3LMHA 5KCVA 4WA9A 4X3FC 2W1FA 3I0QA 4FX3A 4DE4A 3LPBA 5H8EA 2X9EA 3DXQA 3OS3A 4GMYA 4IEBA 3ZFMA 3EFLA 3H9OA 2I87A 1OKVA 2BZJA 2HK5A 5EDQA 3EHAA 2VQDA 3I7CA 3I7BA 3GOPA 3L8XA 5F1ZA 2GMXA 2GS7A 4PV0A 5FG8A 3TUDA 4DN5A 5J9YA 5L8LA 2UZTA 3SQQA 5C1QB 3A4OX 3O17A 4L3PA 4O7NA 2E9OA 2CNQA 4AW2A 1Y8GA 4C4IA 3FL5A 4FNYA 4TT7A 2BFYA 3H9RA 2WQMA 2CGVA 1XH8A 3GU6A 4OT5A 4AUAA 4BIEA 1UU9A 2R87A 2DIKA 3IONA 4BCKA 4BCHA 1L8TA 2XNMA 2R86A 4E5WA 2C0OA 4WNMA 2UZDA 3NDMA 5BVNA 2C0TA 5M51A 4EGQA 4X2KA 1ZYJA 3EJ1A 4I22A 4YJQA 1W82A 3CKXA 3QALE 4YNOA 5L8KA 3GQLA 3LP8A 3W16A 5LMBA 4W4VA 2QOCA 3V8TA 2R82A 4Q5HA 3MPMA 4X7QA 1BMKA 2W96B 5A4TA 3ZSIA 2BILB 4WD5A 4DGLC 4TKSA 3K5UA 3VQUA 2FVDA 2VO6A 3POOA 5HV6A 2IVVA 4J98A 3FI3A 1OL6A 4FKSA 3GC9A 3VBXA 4ZTHA 4BIDA 4NTTA 4DT9A 3ORRA 2J5EA 3DFAA 3ROYA 2AC3A 2Q83A 1M2RA 2JFMA 1IAHA 5KBQA 4EL9A 3LKMA 1OL2A 5ACKA 4ZY4A 4HGTA 3VS7A 4XJ0A 1M52A 3N51A 5A6OA 4C5AA 2XCKA 3DQWA 3UVPA 3UYTA 3LJ2A 5EW3A 4CNHA 4GH2A 3DAJA 4KUJA 2NU7B 1E9HA 1WAKA 2RF9A 3GCSA 3A2CA 4DFNA 4F7SA 2ETRA 4ZLZA 4DFZE 2QOKA 2E9PA 4KKEA 5CF6A 5TT7A 3G15A 3WZKA 1IOWA 3BHTA 5CY3A 4DEDA 2QONA 4IWDA 4RZVA 5T6KA 3NLBA 2EUFB 5CZHA 3SOAA 2GTNA 3SRVA 3UMWA 5CAQA 4ANQA 2J90A 2VTJA 2GQGA 4O2BF 4TYHB 5CEKA 2G1TA 3FMJA 3G0EA 3I81A 4JOAA 4YLKA 3D15A 4USFA 2XNBA 3QTIA 2Z04A 3WYXA 2W1GA 4XEYA 3EN9A 2JBOA 2Y9QA 3PA4A 4O83A 4RIXB 2XK9A 5J1WA 1ULZA 5CAEB 2ZV7A 2RKUA 5DPVA 4D1XA 4DC2A 5LOVF 5AX3A 4K0YA 3KAJA 2OU7A 2CGUA 2GHLA 1P2AA 2Y8OA 1KE5A 4I92A 4IZYA 5BVWA 3VHKA 3AX6A 3GCVA 2PVPA 3IW5A 4TWOA 2R7IA 2JBPA 5FRIA 3BHHA 4YPDA 3ORQA 5LCJA 4GEOA 1STCE 3DAEA 4FUYA 2IVTA 3OUKA 4KBKA 4D0WA 3VQHA 3Q4UA 4QMTA 2J0IA 2OXYA 2Z2WA 4D5HA 1KJQA 2QKWB 5CZIA 3HMMA 4P4CA 4APPA 1DAYA 2WKMA 1ZAOA 5LJJA 3D5VA 4S31A 3BV3A 3VBTA 3HL7A 5KKRC 3BLQA 3CJFA 2WMSA 2OFUA 3VS5A 3K3IA 3R5FA 4FV2A 2YCFA 4RQVA 4MHAA 3PYYA 4RWKA 3U51A 3BQRA 3PIZA 1LEZA 3QCXA 3JVRA 2CKPA 4W8EA 4K77A 3RI1A 3L1SA 4FODA 1M2PA 4JRVA 3C7QA 2OIDA 3D9VA 4C5CA 4R7IA 5HKMA 5KO1A 5H8BA 3QC9A 3NIEA 4GK3A 3CTJA 3KXGA 4CZUA 3FMKA 4M3QA 4BY9E 2JKOA 2QF7A 1PXKA 4F65A 4FV3A 3KRWA 4ZHQF 3TT0A 4IZOA 5IDPA 2C6IA 3UGCA 4C02A 3LLTA 4BDBA 1OL7A 2EWAA 3NCGA 1SM2A 1EYZA 4AZEA 3ALNA 2PVFA 4U3YA 1EH4A 3HRBA 4ITHA 3UO4A 3JS2A 4C3FA 5M4UA 4E5AX 3ATSA 4HPUE 3ZSGA 2CZGA 4XP0A 4KABA 3H30A 4Y83A 3VBWA 1ZYDA 3HUCA 5L6WL 4NCTC 3FLZA 4QP6A 4FSRA 5IA2A 3P86A 5DIAA 5IEXA 1M0TA 3HBLA 1YI3A 1FGKA 3ZLXA 4CSVA 1EHIA 1OVEA 1YDSE 3NNXA 1PK8A 5AP6A 2I40A 3L8SA 3H0YA 3BLHA 1LUFA 1XR1A 4YURA 2FB9A 2B55A 1ZZ2A 5H9BA 3QL8A 3SRVB 4DEAA 3VUKA 5JQWA 4E4LA 2WIHA 3CR0A 3ACJA 3KF4A 4QYHA 1ZOHA 4JQ7A 5CEPA 2VTRA 2UZUE 5DRBA 3V5LA 4A4LA 3PIXA 2OJGA 3GBZA 3MVMA 5HBEA 1BKXA 2J6MA 3HDMA 3WIGA 4FL3A 4PMPA 5JGBA 2ZDGA 3D14A 5LVLA 3LFQA 2B9IA 3C4FA 3WF9A 2WTJA 4ACGA 4CEGA 3QRUA 3BHYA 2X1NA 3JY0A 4LYNA 4YZNA 5AIKA 5EH0A 5LP6F 4IH8A 3FSFA 4DH7A 3VPCA 3RFCA 2HCKA 4YR8A 2BRHA 2XKEA 3M11A 4IVBA 4GYGA 3MIYA 4TZRA 3K3PA 3TQTA 3OCSA 4O27B 3OC1A 3BG5A 3JVSA 3QRIA 2IZUA 3AQVA 3TKUA 4CRSA 4ZY5A 4JBQA 5IUIA 3FMMA 2QURA 2CGXA 4C33A 2C68A 2R3KA 2UW3A 1H08A 1KOAA 2BDWA 3I5NA 3RHKA 5GINE 1H24A 4UV0A 3P9JA 3KULA 2BHEA 5AV3A 3UG1A 4BTJA 1E1XA 5DMXA 2G2HA 3RHXA 4X21A 3KVXA 4LV8A 4PRJA 2GTMA 3DBCA 5JQ8A 3NNWA 2ZMDA 3QQGA 3RPOA 5FTOA 5IZFA 1GZKA 2PZRA 2XH5A 2A27A 3FE3A 3A62A 3OD6X 4FV1A 4NFMA 3QZGA 4AA0A 3UO6A 5M4IA 4CG8A 5J1VA 5CSWA 3ENMA 4AF3A 2XNNA 3SXRA 2B54A 1DI9A 3QTZA 4HNFA 4JNWA 4Y95A 4GUBA 1ZZLA 2KULA 3TDWA 3GU5A 1S9JA 3QA0A 3B8RA 2PVMA 2WB8A 5AP2A 3C5IA 2ONLA 2C5XA 5HTBA 5AP5A 5GJDA 3Q4TA 4RSSA 3QQJA 5CXHA 3R7YA 5D8DA 5EQYA 4F0FA 3AT4A 3DNDA 2ITPA 4Y5HA 2WQNA 4D58A 4DTBA 4QSHA 4D1SA 3DOGA 4NTSA 2ITXA 2JAMA 1UA2A 4BCJA 1F0QA 3SOCA 5GIPE 2VNYA 3LM0A 4J99A 3NUUA 2OXDA 3O23A 1CE8A 3BEAA 4ZZMA 5AUZA 5C1OA 4FT7A 1Y8YA 5DT4A 2RIOA 1V1KA 2R3LA 2QC6A 3R63A 4PF4A 1CKJA 1YQJA 1ZRZA 4RJ5A 2W6OA 4FFNA 5FP5A 4X6RA 4Q9ZA 4M15A 3KVWA 5HIBA 4R1VA 5AV0A 5KUPA 3R5XA 2PE0A 3OEZA 5HZNA 2I0HA 3FLNC 4E7WA 3UTOA 2WMRA 4ME6A 4FC0A 3ZRLA 4AN9A 4EWQA 4KKGA 4FTCA 2C6KA 4BN1A 4R78A 3UIMA 3MN3A 5HG9A 4KRCA 4QPSA 2V0DA 1XH5A 1BXRA 5AUUA 1Y6AA 3O7LD 3ORXA 4YZMA 3MJ1A 4RJ8A 1PJKA 4TRLA 3WF7A 5HE1A 3FPMA 3WNZA 2XJ0A 2ITWA 3BBWA 5CI7A 2BROA 4YNEA 2CKEA 1PXLA 5J7HA 4I5PA 2VU3A 5CSVA 1OIYA 4E4NA 3B2TA 5CU2A 2GPSA 4O22A 4YJ2F 1WBPA 3ZO2A 3WIKA 2UZNA 3S0OA 3E3PA 2BMCA 4RA5A 4CFVA 1G8AA 1YVJA 3AD5A 4DFYA 4PDSA 2B9JA 2UUEA 2EXCX 3MFSA 2IZRA 3N4TA 3R2YA 4V04A 5DT0A 5HU3A 5I4NA 2YIWA 2Y0AA 3SG9A 1WCCA 4FEQA 3EKKA 3V5QA 4BDCA 1KJ9A 2YS6A 2J50A 4BBFA 3BLRA 3WBLA 4XG8A 2HZNA 2PPQA 4QYEA 1DV1A 3RK9A 1XBBA 2UV2A 5HVYA 2YIRA 4MXXA 4XYMB 3MA3A 3G51A 4Z7GA 5E8UA 2GFSA 1B6RA 3KULB 3T9IA 4QMOA 1Q8UA 3CP9A 4RPVA 3H9FA 2XKFA 2W1ZA 3AG9A 3QUDA 4FTUA 3RV4A 4P5ZA 4WOVA 4FFMA 1DM2A 4QTEA 1GZOA 3EH9A 5E1SA 4DGNA 3ORPA 1JBPE 3VUIA 2QVSE 5GHVA 4RIWA 5L2SA 2WMQA 4IM2A 3MWEA 4U45A 2QU5A 5M06A 4NYEA 2X7FA 3PE1A 3PJ8A 4IX5A 3RINA 5JGAA 5L2TA 4QYGA 4IAZA 5EYCA 5AAFA 2AC5A 1NW1A 2YISA 3FQSA 4FNZA 4ZTLA 3W2CA 5K9IA 4UX9A 5EQEA 5JN2A 1XH4A 3A7FA 2VTSA 3CEKA 1RE8A 3PVWA 1Q24A 5M4FA 2VWWA 2RL5A 1G3NA 4RMZA 4DF3A 5E8YA 2UZEA 1UVRA 3RAHA 4ZXTA 1AQ1A 4O4LF 4I4FA 1FINA 4KINA 3QWKA 3VJNA 4YAKB 3F7WA 4R7HA 3HEGA 5HU9A 3RPRA 4DH8A 4LG4A 5HE3A 5EI2A 2IWIA 3U4UA 4FK3A 4RC3A 1UU8A 2OI4X 3M1SA 3HMOA 3NUAA 4F7NA 3R1QA 4Q9SA 4QO9A 2WQEA 5I5ZA 2JKQA 3MFTA 1PW2A 3BGZA 3FPQA 2JDTA 3KXMA 3W55A 3ZFXA 1NY3A 3CQWA 1DIKA 1JWHA 3KXHA 2W1EA 4GKIA 5B2MA 5E8SA 4CKIA 3P78A 3GT8A 3UNKA 3PY1A 3FZSA 3VA7A 4HZSA 3OWLA 2PVYA 4JAIA 5EOLA 5ETCA 4F7LA 3VBYA 2I0VA 4FNXA 1OKWA 4BR3A 1HCKA 4FIJA 3E5AA 3PG1A 5HLNA 3NW7A 2JDSA 2WIPA 1XH7A 4AN2A 2SRCA 4MTAA 1J7IA 1KV1A 2X2MA 2YA9A 1WBWA 1PMNA 5FQDC 4EHVA 4MA0A 1FVVA 3CBLA 1XO2B 3V6SA 2BRBA 4FMQA 4ASEA 2QK4A 4L43A 3C4XA 3Q53A 3TNPC 2KTYA 3U54A 4NJDA 3MBLA 4FV0A 5FUTA 4CFFA 5I9WA 3DKCA 4FKIA 2JC6A 4CFMA 2QI8A 1T46A 4TN6A 3G33A 4L46A 4EOPA 4MK0A 5GNKA 4BVUA 2BKZA 3C0IA 3OXZA 3BYVA 3AC3A 5EK7A 5KNJA 3EQDA 3S3IA 1BX6A 3AC2A 3FXWA 3MVJA 3N6RA 2NU8B 1VZOA 4RJ4A 4FSTA 4UWBA 2HXLA 4PDYA 3VF9A 3KALA 3TACA 3NAXA 4O0UA 3NYOA 3ZU7A 4UB7A 4QMQA 3BU6A 3DQXA 4FSQA 4RLKA 4HVGA 3EKNA 1Q5KA 3CPCA 4GL9A 4QOXA 4G3CA 2CNUA 3M2WA 1QL6A 5D7AA 4RC2A 2IVSA 4J97A 5LARA 4C4EA 3MY5A 4F9AA 5DNRA 4XG2A 4F64A 3P7BA 3ZBFA 4FL2A 3QUPA 2WZJA 1SZMA 2PYWA 2YM6A 3SVVA 1U54A 3DKOA 3QD3A 2ESMA 3PRFA 4YSJA 4ID7A 3RNIA 5L6OA 3D5XA 4PNIA 5AUWA 3RAKA 1WBSA 2QNJA 2Z7LA 4RIWB 5HGIA 2P0AA 2DWBA 3IDPA 1I09A 2XF0A 3MTLA 3OXTA 2REIA 2Y4PA 4FZ7A 5DGZA 4DFBA 2IP4A 3BE2A 1MRYA 3TTIA 3KEXA 3P5KA 4EOQA 3L9PA 3P7AA 1H1RA 4XOYA 3VBQA 3E8CA 2GQSA 4MNEA 4AGCA 3FJQE 3K3JA 3AMBA 3ZLWA 5EOBA 4U40A 4BCOA 5IEVA 2XIKA 4BZDA 1QMZA 4G3EA 3FYJX 3DLZA 4YZCA 1OITA 2V7OA 4L3LA 5ANDA 4AS0A 3UQFA 4W8DA 4L53A 5HD7A 4DTAA 3QKMA 1JSVA 2YZMA 3MY1A 3ORKA 4B7TA 3GEQA 2XCLA 5DI1A 2UW8A 4ITIA 2VPQA 2YW2A 4APCA 3DBEA 3KA0A 2X6EA 4EQCA 2WTVA 4FG8A 4L45A 4D2SA 2X0GA 3DBFA 3A61A 4XG6A 5M44A 3HMPA 4BBMA 1VYZA 4NFNA 2OWBA 4M84A 4ZK5A 4AFEA 2YS7A 3DDPA 1IG1A 2JKMA 2WTIA 2WHBA 3QCYA 4MEDA 4U97A 4USDA 4XV3A 1IRKA 1MUOA 3NYVA 3HO8A 3D7TA 4BZOA 4Q5EA 4O2AF 4LUDA 2G2IA 5AM7A 3PY0A 4BCPA 5IA0A 3FHRA 5GJFA 1LPUA 1YOJA 3HV5A 3R1NA 4E6AA 3WF5A 5I9ZA 2FP4B 3PXYA 1KWPA 4FA2A 4JQ8A 3AT3A 4ZLYA 2OG8A 3WZUA 1J7LA 1TVOA 3ZM9A 5CU6A 4JRNA 5ICPA 4YBZB 2YM4A 4ZY6A 3MTFA 2DYLA 1O9UA 2BZHB 3HLLA 3G6HA 1SNXA 4NL0A 3PVGA 3W1FA 4IW0A 2OJIA 3L9LA 4DGMA 3KXXA 3KAKA 3Q6UA 3W2OA 1SCUB 3FLQA 3ROCA 4R3PA 3OW3A 1YXUA 2VTLA 3C9WA 5LMKA 4MV7A 3ATTA 3C13A 1U46A 2E9UA 4U41A 4TWCA 4M68A 4QRCA 4BCQA 5DYJA 3EL7A 3GU4A 2UVYA 3MW1A 3UZTA 3Q5ZA 1J1BA 4YGAA 3QCSA 5EYMA 1WFCA 4AOTA 1KEEA 5KMLA 3EQCA 3Q9WA 4QMZA 3PJ2A 4BCMA 2XB7A 5J8IA 4WRSA 3SXSA 2Y7JA 4C5BA 4YO6A 3TXOA 3VS2A 2PMOX 2OIQA 2W5AA 3F7ZA 3TZ8A 4U0IA 4AZSA 3LCDA 5CEMA 4CFWA 4GVAA 3GLKA 5ANIA 2EU9A 4IB3A 4D4SA 3E5NA 1U54B 3VF8A 3UE4A 5IA3A 4MQ2A 4OGRA 2EVAA 2HXQA 4LRMA 4H39A 5JZNA 3R9HA 5IUHA 1GSHA 1S9IA 4DH1A 4RGJA 4IANA 3OTUA 1WVXA 4RWJA 2IZTA 5FEQA 4YJSA 3LFEA 2VZ6A 3NUNA 4L00A 4CFXA 2WU7A 1ZARA 2YAKA 1IOVA 4QT1A 3LCTA 4I6FA 4IHJF 4AE9A 4V05A 5G6VA 4I21A 4FKVA 3RCJA 4BDEA 4MNEB 4E4XA 3CC6A 4ZTNA 3SLSA 2QOBA 1PXMA 3ZLYA 4G5PA 3VRYA 3A7IA 5KMOA 4RQKA 3LQ8A 4QTAA 2WTKC 3R0TA 1W8CA 3ENHA 3ZO3A 4KAOA 4MA5A 5LWNA 1CDKA 3ZC5A 2BFXA 2QU6A 3C4WA 2C5OA 2E9VA 3HMNA 4LMUA 4FZDB 2B53A 2ETMA 5AM6A 5BMMA 4YZDA 2XK4A 3R71A 3QRJA 2ZM3A 5HO8A 3VN9A 4FEUA 4F4PA 2IZSA 2F9GA 1PX2A 4I4EA 4IVAA 5F9EA 3LXLA 5HE0A 4X0MA 4CT2A 5FGKA 2B52A 3A60A 3TI1A 3ORIA 4QYYA 2R3PA 3ZM4A 4ZSGA 2VX1A 3FEGA 2BIYA 4FYOA 4BI2A 5CSHA 4AP7A 5CF5A 4UYNA 3TDVA 3K5IA 4PDOA 4TYJA 4BDJA 4LOQA 5ANJA 3D7TB 2Q0BA 5BUJA 2ZV9A 4QP7A 4FIFA 2B1PA 4QNAA 4PL5A 3BPRA 4JIKA 3UIUA 2W1HA 3UG2A 4DFXE 5L2IA 4GKHA 1KBLA 2ITZA 3EN5A 3B2WA 4PP9A 3Q9ZA 4ORKA 3DF7A 4U9AA 1GLVA 1AD5A 3NWWA 4L01A 4YP8A 3PXFA 3E7OA 5KMMA 1PKDA 3AC1A 2W0JA 4K2RA 4UEUA 4XHKB 5BPHA 3DNEA 3OHTA 3ZUUA 4QP9A 5TR6A 4ZOGA 2C4GA 2C6EA 3EQRA 3C5UA 2BPMA 1Y6BA 4L67A 4XMOA 1WR2A 4IACA 3GFEA 4JR7A 1BNCA 4FBXA 5KHXA 3E8NA 2XS0A 4F70A 3W18A 5FLFA 4BDIA 2JDRA 3NIZA 5AUYA 2I1MA 3AOXA 3UBDA 5T68A 5HCYA 4DEBA 3V8SA 2YEXA 4HOKA 4Q2AA 2NU9B 1IA8A 1OUYA 2FSTX 2ZB1A 4AN3A 1YXSA 3VW6A 1MP8A 1A9XA 2XIRA 4DG0E 3ZUTA 4UN0C 2IW6A 2R4BA 4R5YA 4C35A 5CA1F 3AMYA 4YLJA 2PZIA 2W5HA 4AGDA 3IOKA 2HWOA 5A6NA 5I9YA 2JLDA 4KRDA 2C6MA 2J9GA 5CT0A 3EN4A 3KU2A 4QMLA 4RWIA 2OICA 5EFQA 3PJ3A 2V62A 3EIDA 4NUSA 3V6RA 3DKGA 3GVUA 4YTCA 3GQIA 4J1RA 3ODYX 4XLIA 4GYIA 2PSQA 3KN6A 4CCUA 4C37A 3KK9A 3UOJA 3COIA 4I24A 4DHFA 2Z8CA 4FTTA 4NM7A 5EG3A 4TUYF 2JITA 4XRLA 2R84A 4DFUA 3ANQA 4O7TA 3NCZA 1Q8YA 3QLFA 5B2KA 3FC1X 3IW6A 3RM7A 1C30A 3OEFX 4G5JA 4BYIA 5LVOA 1YI6A 2BUJA 3O2MA 5DWRA 5GONF 4H3QA 4W4XA 3ZO1A 4AZFA 3UPXA 4GSBA 5EI6A 3FKOA 1RW8A 1U5QA 2UVZA 3FLYA 3EN6A 3FMDA 3ORTA 3Q5IA 2O5KA 3U6HA 4DLIA 3SHEA 1EUCB 3TNIA 3BYMA 1DI8A 4YBKA 5FBOA 3OCTA 3VS4A 1Y57A 4FTQA 4A07A 3R8VA 4FSUA 4QQ5A 5AV1A 5LYJF 3CXWA 3T3UA 3GU7A 3Q6WA 4EYJA 4FSMA 4OBQA 3ZUVA 4HVIA 2XNGA 1GJOA 2ITVA 3RUPA 3LJ1A 3ULZA 2O65A 4EHZA 4O21A 2R7BA 3M42A 4WG5A 2I8CA 5BVOA 4TWNA 2DWCA 3L9MA 2SCUB 5C8NA 5ETFA 3ULIA 4DEGA 5AIRA 1KOBA 5A9UA 4DG2E 1GNGA 3QQKA 2A2AA 2QO2A 3G90X 4FIGA 3QC4A 4ERKA 3VULA 4FT0A 4I5MA 4IB5A 3MH2A 3BEGA 5EZYF 4DITA 3MSSA 4EJNA 3VMMA 5CNOA 3BRBA 5DRDA 3ZCLA 4PMSA 1VR2A 3VJOA 4BBEA 5C26A 2C6LA 3L9NA 4FT5A 1Q8WA 4EOIA 1YOLA 3DY7A 3DZOA 4FV8A 3HA6A 4KIPA 3Q2OA 4IQ6A 4MYGA 4AW5A 4EHGA 3PJ1A 3ALOA 1OPKA 3BGPA 2R7KA 3RV3A 2V5QA 5I0BA 5L2WA 4NM0A 3ZEWA 2LGCA 4U44A 3DFCB 5DR2A 3KREA 4E6CA 1PRYA 2A1AB 4IDTA 5AP3A 2OH4A 4L7FA 3ZZWA 1GSOA 1ZMWA 4F7JA 3FZ1A 4FL1A 3U87A 4RZWA 1ZOGA 3LE6A 3LAUA 1ZWSA 2YJSA 1OBDA 1PMVA 3KFAA 4YHTA 2VAGA 5C4LA 2PL0A 4NH1A 5AP4A 5GJGA 1Q99A 4QMWA 3NGAA 1JSTA 2X8DA 2WMAA 5LWMA 4XUFA 2F7ZE 4QP8A 3MJFA 4MBJA 1NVSA 5FD2A 2Y6MA 3O7LB 2J0KA 4EH9A 4CCBA 4YAJB 2ZYBA 1QCFA 4FG7A 1JKTA 4GFOA 4EH4A 1VJYA 4TYEA 3Q52A 5HO7A 1DS5A 3BGQA 5IQEA 4FYNA 4ZEGA 4XYFA 2C30A 4MD7E 3MYGA 3FC2A 4DCAA 4DINA 4I5HA 4N4SA 1HCLA 3KXZA 3MS9A 1W83A 4M67A 4O96A 3NPCA 4QMVA 2XMYA 4EUUA 3PVBA 2CLXA 4HJOA 3E8DA 4IFCA 4WBBB 4BCGA 4F0GA 4FFRA 4EH3A 4C4JA 4IAKA 4U43A 4U80A 2Q0NA 2BALA 4IE9A 3OCBA 2VTIA 2QO7A 3I79A 1UU3A 2X4ZA 3R30A 4FEVA 4IX3A 1JAMA 3DLSA 2QODA 4QP4A 4H05A 1ZY4A 4Y72A 5A3XA 2GCDA 2ZVAA 4ACMA 4X3JA 4CTBA 4DLJA 3UIXA 4CKRA 1OKZA 4NKAA 2JKKA 5ETAA 2NU6B 1FMKA 5DH3A 3V5TA 2QOIA 3QHWA 4CFNA 4KIOA 3IDCA 4GUEA 4S34A 4JX7A 3COMA 3HECA 1O6LA 2YWPA 3NMUF 4FFPA 1KE9A 5CAVA 4Y8DA 1V0OA 1REKA 4YZ9A 2HOGA 2ZMCA 4WNPA 3RPSA 3R02A 5H2UA 4II5A 4FT3A 4FTNA 5A4CA 3UVQA 2H9VA 3V51A 1AUXA 2RFEA 4MAMA 4IADA 2OGVA 3ITZA 4MV3A 2EB3A 5CEOA 4WNKA 1KE8A 2PUIA 2ZDUA 1E4EA 5KZIA 2BIKB 3DB6A 3SC1A 3WO0A 4PTEA 1JKJB 3E87A 2ERKA 4ZJIA 3BHUA 3SDJA 3MFRA 4IAYA 2W6PA 1GIJA 5E8XA 3F2AA 4O7LA 3UOLA 2VWBA 3PDTA 2JD5A 3MPTA 4B4LA 3DPKA 1VBGA 5HBJA 3LFCA 5FNVF 1YXTA 1YRPA 4UXQA 3RPVA 1YXXA 1H4LA 4Z55A 3EQBA 3R7OA 3KMWA 4EZ7A 1R1WA 1M17A 4MWIA 3ORMA 5BUIA 1JDBB 2DZDA 5BVDA 2OJJA 5IA4A 4LRJA 3F5PA 3R21A 3RWPA 3F88A 2JAVA 2PBZA 3G8DA 1H1PA 5IQFA 2W1CA 4IAFA 2UW7A 3LMIA 2OO8X 3Q4CA 4GRBA 4B8LA 4EOOA 3LCSA 2OZAA 1R39A 1WBNA 4UYAA 5CU3A 5IMEA 5ACBC 5JFXA 4MBLA 4RBLA 5IA5A 5CANA 3QD4A 1GOLA 1O6KA 3D4QA 2CGWA 2J5FA 4BC6A 3R7VA 2VO3A 5TO8A 4A9RA 4NW5A 4CQEA 4G16A 4I6HA 4FKUA 4PL3A 5BUEA 4GV1A 2W9ZB 4FFOA 2R0UA 4NM5A 2ACXA 2HW7A 4F1TA 4C4HA 3P7CA 3KCKA 2ETKA 3LXNA 3FY0A 4NW6A 3KCFA 4FEWA 4ZI7F 2W5BA 2OSCA 4PX6A 2LAVA 5B2LA 2G15A 3OY3A 4FZFB 3D94A 3F9NA 2YZGA 3VPBA 5JH7F 3Q9YA 3KXNA 2DLNA 4MNFA 3F5GA 2QHNA 4O0RA 4HZRA 4ZJJA 3KY2A 3PXRA 2XJ2A 2YITA 3VHEA 4AFJA 4HCTA 4ALWA 3NNVA 4U81A 5CWZA 4ZSAA 3EZRA 3GUBA 3F2NA 3U4WA 5JT2A 2CCIA 4UALA 4AX8A 1YWRA 4GU6A 1XWSA 3GC0A 1JVPP 5IA1A 3I60A 4HQ6A 3O96A 3MH1A 3DCVA 3VS6A 3CY2A 3PSDA 5M4CA 1GIHA 3EQHA 3RTPA 3HYHA 5AFVA 5HESA 2XEZA 3O8PA 4YU2A 4U8ZA 3IG7A 3V4SA 1R0EA 4F0IA 5EYKA 5A54A 3JXWA 3MV5A 5JVLA 3A8XA 2WOUA 3F5XA 1OIQA 4NSTA 4D5KA 4U3ZA 4OTGA 4A9YA 2FPIB 1L3RE 3R7EA 3HP5A 4WUAA 2W4OA 1P4FA 4LOPA 4B99A 2OLSA 5H80A 4EK3A 3RJCA 2HGSA 3E88A 5ANGA 3VW8A 3RK5A 4TL0A 3HV4A 1E4EB 2H8HA 3BU3A 5HG7A 4YTIA 3Q2MA 3F3TA 3UOKA 2I80A 4AW0A 3KF7A 2XM9A 2UZVA 2OKRA 4MQ1A 5FM2A 3WF6A 2WELA 3ORLA 4FZAB 5L8JA 4CD0A 3VBVA 4LM5A 1XQZA 4GT3A 4RVLA 3VUDA 4AGUA 4E93A 2X8EA 5LMAA 2DQ7X 5C4KA 4O6LA 5F4NA 5IQDA 4Z3VA 1Q3WA 3KRJA 4IWQA 3TCPA 3KRRA 3CCNA 3WO1A 4I6QA 2C3IB 4M0ZA 4JDHA 3TUBA 1UWHA 2QQ7A 4BHZA 2GPWA 5I9XA 2VGOA 4D28A 3T3VA 4TNDA 3LMGA 1C3OA 3F5UA 2CHLA 1X8BA 3WILA 4GK4A 4NZWB 4AXAA 2XK7A 2ZM4A 3F3UA 3TWJA 2J4ZA 3EFJA 2OZAB 4BDAA 3Q04A 3H10A 5HE2A 4A9UA 4EK6A 3KN5A 3GCPA 4MV4A 4OTRA 4M12A 1XKKA 2OBJA 4GIHA 3WZJA 3SW7A 1NT2A 5A46A 4HNVA 1OECA 4JI9A 4QPAA 4ZSEA 4PUZA 1AGWA 1YW2A 4G3GA 4YZBA 3RKBA 5AADA 3R8LA 1JKLA 2CJMA 4ZOLF
chains in the Genus database with same CATH superfamily
4GG7A 4AT4A 2BKKA 1FVTA 4EKLA 3TM0A 2FYSA 3D7ZA 2F4JA 1A48A 2IN6A 2X8IA 3KL8A 5HVJA 3UODA 4EI4A 3MH0A 4ANLA 2COGA 3I4BA 5KS8A 4FEXA 2I0YA 4GS6A 2H6DA 4TVIA 2H34A 5FXSA 4HVDA 2W99B 4DG3E 2UZWE 5E7RA 4CKCA 4H36A 4JAJA 4BJJA 3QKKA 3HV3A 3PLSA 4JIAA 5CYIA 5IH6A 5IQCA 4GIIA 5CENA 2VR1A 4ACHA 2Y4IB 4O0TA 1CSNA 5BMSA 2E9NA 4MAOA 4AWIA 2W6QA 2AYPA 2NRYA 3R04A 4XBRA 5HIEA 3FMLA 2IW9A 4IWYA 3RP9A 3D5WA 3O8UA 4CXAA 4EOLA 4D0XA 2YJRA 3MB6A 4FKWA 2PZYA 2X81A 1PYEA 1VEBA 2P2IA 4Z9LA 4UFZA 4HNUA 3POZA 3BX5A 3P08A 4C2WA 2FPGB 2VRXA 3VONA 3F2RA 3W0NA 4WHXA 4M69B 3PP0A 4WG3A 4YLLA 5J9LA 3CQUA 4GJ2A 3IW8A 5E8VA 3QU0A 5L3AA 4RIOA 2UVXA 3ETJA 4EKKA 2W9FB 4CC5A 4IZ7A 3NBYB 5EW8A 3V4ZA 2ZV8A 3OFMA 4FIIA 2VWZA 2HIWA 4JG7A 1B38A 1CM8A 1BYGA 2YDIA 3F61A 3FQHA 3R73A 4L68A 4NKSA 4PTCA 2OF2A 4EJ7A 4DIMA 2Q2TA 3UC3A 1Z2NX 2EIYA 3QCQA 4P90A 1TKIA 5E9EA 1E1VA 4M14A 4O84A 2QD9A 4DYMA 4G1WA 3WE4A 4BYJA 4AA5A 4U6RA 2P3GX 5IQHA 1KJ8A 3SX9A 3CD8A 2PU8A 2O2UA 4XRJA 4ASZA 3VIDA 2JDOA 3OROA 3COKA 3W8QA 4CMUA 4HVSA 4QMXA 5J87A 2UW0A 3FZTA 2QG5A 3QZFA 1JKSA 4OTWA 3U6IA 5F94A 1XH6A 3QTSA 4KBCA 5BQ0A 5FDPA 2GSFA 2XZSA 3GFWA 2PVRA 3HX4A 3K2LA 5C1PA 3FZOA 2OK1A 4DHZA 4FKJA 3BI6A 4ANSA 2CNVA 2WEVA 1H25A 2R5TA 3BHVA 4BTMA 3AC8A 4FOBA 4XP3A 4C58A 2I0EA 3E64A 4DBXA 3FMHA 2DS1A 4K11A 4UZHA 3HA8A 1ATPE 4CRLA 4N6ZA 2C0IA 4MXAA 4PMTA 3T9TA 5C8MA 5DFPA 5LVMA 5JZJA 4IWXA 3OMVA 5KX5F 4BDDA 2R7MA 5J2UF 3OT8A 5CSPA 2B4SB 4K8AA 1KV2A 3MPAA 1ZMUA 4FSZA 2HW6A 4CV9A 5I9VA 1XBCA 3TV7A 5FEDA 4M9UA 4O82A 4BJJB 1I44A 2XA4A 3BYSA 3UZRA 2XNPA 4EC8A 3F3VA 4HYSA 4A4XA 4FTKA 2VD5A 4DHJA 3LFDA 4TYIA 5HBHA 1FPUA 3QRKA 5IYZF 4I3ZA 3SD0A 5HVKA 1GZ8A 4HGEA 1KUTA 2IPXA 3RR5A 1XJDA 5BVFA 4MBIA 2WPAA 3W10A 5CAUA 3BELA 2IW8A 4DH3A 4LV7A 5ANEA 4RT7A 3VRZA 5BPFA 3HGKA 3BIZA 3KRXA 5D1JA 4QMPA 5KE0A 1Z5MA 4D9UA 5JFSA 2R3FA 3SGCA 4YB8B 4QP1A 2FSLX 4F9YA 3O71A 2J0LA 2JFLA 3IDBA 5IEYA 4UWCA 2ITYA 3QX2A 4YJRA 4YJVA 2YRXA 2WXVA 5LCKA 4IBMA 3JR1A 2PVJA 1FVRA 3R22A 3LHJA 5CF4A 3KKVA 4P2KA 3TTJA 5K4JA 1VBHA 4GK2A 2GU8A 4CLJA 2HDKA 1W96A 4Y5QA 4I94A 3ANRA 5E1EA 4QTDA 3QYZA 1KE7A 4IVDA 4TXCA 4PL4A 3U9TA 2A0CX 4PMMA 5C9CA 4RC4A 4H1JA 3R9OA 4ALUA 3ETAA 2J51A 2NP8A 2QLUA 2OXXA 3Q96A 5FPRA 3OBGA 2XRUA 3NW6A 3RMFA 4G6LA 4BB4A 5IPJA 2QOLA 3CTQA 5TKDA 3RM6A 3JY9A 4FOCA 1GAGA 3BYUA 5JKGA 2XK3A 3UZOA 4FV9A 4XG3A 1A06A 4KSPA 4LGGA 4JT3A 1SVHA 4IMYA 5AAEA 3DGKA 2PVKA 4PWNA 2BAJA 3I6WA 4UZDA 4EWHA 3JSLA 4N6YA 4LI5A 1YI4A 2OFVA 3OZ6A 1OMWA 3FI2A 4BTKA 2WAJA 3PIYA 2BRGA 4EH2A 3KMMA 2C5YA 2WGJA 3DBDA 4X2GA 3ZRMA 2X7OA 3CKWA 1G2WA 3ELJA 3PZHA 4JDJA 1UKHA 5CI6A 3FKLA 5AX9A 4FG9A 4RJ7A 5JVDF 3FKNA 3P4KA 3CE3A 4GVJA 3NZ0A 2ONLC 5BYZA 1H1SA 3F3WA 5I47A 3LQ3A 1YKRA 4V01A 4ASDA 4WG4A 3QTRA 4NWMA 4JVGA 3VS0A 5KMIA 4H1MA 1QPJA 4RJ6A 4LV5A 2XYUA 3OW4A 4USEA 2VTOA 3IS5A 3R5HA 5BYLA 3SA0A 1KJJA 4NZMA 3AGMA 3NUYA 1ZY5A 4G2FA 4XZ3B 1ERKA 1CQJB 4R77A 4A4OA 3O51A 2C3KA 4R3RA 3AXWA 3R8UA 5HNBA 4F6UA 5C8KA 2UW5A 1H27A 4H3PA 5K5NA 4FV4A 4O4HF 3II5A 4RA4A 4FT9A 2W17A 2A19B 3WI6A 5EHLA 3ZYAA 5FM3A 1JPAA 5L6PA 1F3MC 3OWPA 1A0GA 3SNOA 2FUMA 3QFVA 4RLLA 3DKFA 3V3VA 3DK3A 4F1OA 2HVRA 3AD6A 3NUSA 4TPTA 5AA8A 2WNTA 4G31A 2ZOQA 4FV7A 3MVLA 4FICA 3TL8A 4CHIA 4HPTE 2YABA 3CSVA 1H1WA 4QMUA 5DN3A 1W84A 2HZIA 3ZXTA 3ET7A 3QGWA 4IC8A 3L8PA 1FMOE 1RJBA 4C2VA 2WO6A 3C4CA 3HRCA 4WRGA 5LQFA 2XAMA 4J96A 3CD3A 4CGAA 4EGJA 4O7SA 3H4JA 3FWQA 1UU7A 1DAAA 3BWJA 4IJ9A 4MWHA 5CX9A 5AUVA 3HMIA 4O2PA 4CZTA 4NM3A 2FPPB 3CSWA 3UC4A 3LFSA 2E2BA 2PWLA 2ZDQA 4X2JA 3ZFYA 2PY3A 3H3CA 1Q8TA 3VO3A 1ST4A 1M2QA 2GHMA 3FQEA 4ENXA 1EKFA 4L6QA 4RFMA 4AU8A 5BPYA 3ODZX 3R9DA 5LXMA 2RFSA 3VUHA 2WU6A 2BHHA 3MDYA 5DGHA 1OPJA 3GNIB 5JK3A 5FTGA 2YM3A 4NCTA 3JPVA 4FFLA 2Z02A 3FMNA 2FH9A 3UVRA 3D2IA 3JUHA 4GW8A 3OOGA 4K6ZA 3UO5A 3UIBA 2QG7A 3LFAA 4RG0A 1IAJA 4RX9A 4ACDA 3I5ZA 5JGDA 5LVPA 5M53A 4I1ZA 4XG9A 4IB0A 5DISC 4J53A 4D4RA 2J9MA 4FV6A 3QTXA 4NT4A 5EQPA 2HYYA 3RAWA 2YL2A 3FAAA 3R83A 1UNGA 3GIDA 5ETIA 1UWJA 4BI1A 1BL7A 5M07A 4FSWA 2WD1A 3BBTB 3C4EA 5CA0F 3E3BX 1SVGA 4QMMA 4AZWA 2R0IA 2V58A 4CE5A 4RVMA 2O3PA 2P2HA 3MH3A 5I5TA 1J7UA 2Y4RA 5K4IA 2ZDHA 3Q4ZA 5DT3A 2GPHA 4PZ7A 4Y8VB 4YBJA 1WVYA 3BE9A 1GY3A 2X7GA 3F66A 4FGRA 3DJ7A 1WBOA 5IQIA 3TKIA 1URCA 5K3WA 2WMTA 2R3MA 3GC8A 2BRMA 4G9CA 3U9NA 4UCTA 1RDQE 3ZHPC 1W0XC 2NUAB 2HVQA 5EM6A 3TINA 1A3GA 4RX7A 4XCUA 2UZBA 3EOCA 3NC0B 4CLIA 4TYGA 2CKQA 3DXPA 3S95A 4BDKA 4EBVA 5HBRB 4LGHA 2GS2A 1SVEA 4D2RA 1H01A 1NVRA 1P16A 3MWUA 4R3CA 4IAAA 4UCRA 4K18A 4AACA 4HCVA 1JSUA 2QKRA 3PY3A 2ITTA 3RNYA 3EQIA 2A4LA 2R64A 5IISA 5LVNA 1B6SA 4DEIA 3TIGA 3SV0A 4FIEA 4JJRA 2WMXA 3QHRA 2PMIA 2HZ4A 5JRSA 4J71A 2PUPA 1K2PA 4BHNA 3VUMA 1ET0A 3HZTA 3SE7A 2GQRA 3FSKA 4QP3A 4BKJA 5HTCA 3RZBA 5CVFA 1DGSA 3IW4A 4DTKA 2J0JA 2GFCA 2EB2A 3DT1A 4A9TA 4G9RA 4ZZOA 2RG5A 5JSMA 3W0QA 3EN7A 4WKQA 3ZMMA 4BRXA 1PMEA 3QTWA 5D12A 3IKAA 5IMXA 3TUCA 2YZLA 5J2TF 4YMJA 2G01A 5KBRA 3A7GA 5CSXA 4RIYA 1YHWA 5HEZA 5TOZA 4S30A 4GJ3A 1H0WA 2PE1A 3MB7A 3TNHA 3VNTA 2XRWA 4O91A 3EQPA 3QAME 3L2PA 4G17A 2I7QA 4WSYA 1XH9A 2C5NA 3ERKA 3RCDA 4EH6A 5M57A 4KB8A 3R1YA 4EUTA 2HJWA 3PXKA 5CS6A 3NSZA 5AUXA 4C36A 1LR4A 4AQKA 5IQAA 3TJDA 3TV4A 4Z7HA 3ID6C 2GDOA 2GNGA 3PLAE 4FKQA 3CY3A 4XV9A 4JR3A 4O81A 1JLUE 3UQCA 3Q2JA 2G9XA 1G8SA 3FY2A 5AJQA 4WNOA 3T8OA 4ZTSA 1T45A 2IVUA 4FK6A 4P5QA 4AE6A 4MF1A 3SKCA 2RG6A 4GFMA 1CKPA 3DK7A 4RJ3A 4IIJF 4XX0B 2ODTX 3N4UA 3LXPA 4I20A 3WOWA 2QR7A 5H8GA 3ZZEA 3GCUA 5KZ0A 5CR5A 5C8YF 2O0UA 1OL1A 2CSNA 1JKKA 2XNOA 3C0GA 4ZAUA 4J7BA 4S32A 2OJFE 3OG7A 3C51A 3PXZA 3R2BA 2XCHA 1BL6A 1UNLA 2XK6A 3A7HA 1ZOEA 3K5VA 4OR5A 4ZSJA 2VNWA 3LFFA 4NIFB 2ZJWA 4B0GA 2IO6A 4C61A 3E63A 1YHVA 4H58A 3BA8A 4TV8F 3WWJA 3NUPA 2FO0A 3S00A 4IIRA 4AT3A 2XM8A 4E6DA 1OM1A 2PHKA 2XD4A 4EONA 1Q61A 4QP2A 3UDBA 3QBNA 2YN8A 4MV1A 1ZYSA 1RQQA 2R2PA 3CJGA 2XKCA 4BGHA 4NK9A 4YC8A 4EH8A 1K9AA 4L7SA 4AQCA 4WUNA 4AOJA 4AZVA 1I1LA 2PVHA 3R7UA 4OT6A 3BWFA 2B9HA 5IDNA 2GLTA 4HW7A 2VTPA 5CTPA 1NVQA 5AV2A 2X0SA 5B7VA 3VOTA 5M55A 4TNBA 4ZJVA 4U79A 2RFDA 4IC7A 4TY1A 2YM5A 3VC4A 4B6LA 2VWXA 3BLAA 1VLRA 3PVUA 4FSYA 4ARKA 2VUGA 4AW1A 1R0PA 3QRTA 5M09A 4C7TA 3GENA 4PY1A 4KSQA 3BABA 3K54A 4FNWA 2CLQA 3R1SA 4EK8A 2ZV2A 1H0VA 2F7EE 4DGGA 5CU4A 2BDFA 4YO4A 4E4TA 1P8LA 3PUPA 4QQJA 3C50A 4O86A 1FGIA 5AV4A 4QTBA 4M7IA 3UDZA 3JRWA 4MV8A 5JH6A 1EKVA 3REPA 4KNBA 4BTFA 4ZSLA 5ANOA 1PXIA 1PXJA 4OTIA 5E4HA 1M7QA 1K3AA 2C69A 2VO7A 5FTQA 3IPHA 4HR7A 5CALA 4RIYB 3NAYA 3OOMA 4XG4A 2BZIB 3NUXA 4PP7A 3GXLA 2VTQA 2C1AA 3ORZA 1DV2A 2HZ0A 5FP6A 3AD4A 4XV2A 5CVGA 5DHJA 2Z7QA 5LMKC 3QYWA 4L9IA 2VX0A 5EYDA 5CASA 3LXKA 1ND4A 3RGFA 3VS3A 3Q32A 4YPSA 5AP7A 1QPCA 3UMXA 1PF8A 3NYXA 5BX0A 2B0QA 4G6NA 4G6OA 4E1ZA 5EHOA 3OUZA 5CM0A 3TY9A 2VUWA 1APME 2W1IA 4L8MA 4RFYA 1Y91A 3W2RA 5HORA 5HQ0A 5KX8A 4WBNF 4C4FA 1S68A 4CMFA 2C00A 2XKDA 2CDZA 4M0YA 2QOQA 4CT1A 4BGQA 2BDJA 4UXLA 4JXUA 4W4YA 4GT5A 3HB9A 4AA4A 3QWUA 3R8MA 3A7JA 1P14A 4I0TA 4MD8E 3GC7A 4CMTA 5IUGA 3NFFB 2ZB0A 4YHJA 2NNWB 2PK9A 4J52A 2XEYA 2PMLX 4Q4DA 4E73A 5BVEA 4TW9A 3W33A 4CG9A 4UWYA 3TIIA 4R1YA 5CAOA 1TQMA 4OTDA 5FDXA 3TY8A 3UQ8A 2C5VA 1PMUA 2UZOA 2BRNA 3N9XA 3T9AA 2R3QA 4DCEA 2CN8A 4YJTA 4M0JA 4O2ZA 1I7NA 5EW9A 4PQNA 2GNLA 5E8WA 1NA7A 4FVPA 4U42A 3AMAA 4DFLA 4GG5A 5AMNA 4BDFA 4JDIA 4KKHA 4EOKA 4EQUA 4F99A 5C27A 4U5JA 2QOFA 5HHWA 1IR3A 4L52A 1OL5A 4YC3A 5BNJA 3R23A 4G34A 4BCIA 2YZNA 2OW3A 2GNIA 4BDGA 4XH6A 3N8DA 5DOSA 3SXFA 4EZ3A 2X4FA 4M13A 4JS8A 5GIOE 4BI0A 5C01A 2PZPA 2W6NA 5DVRA 2X6DA 2XIZA 5E92A 4OBPA 2WTDA 5D7VA 3EZVA 2IG7A 5A4QA 3E93A 4EOMA 4AXEA 2XBJA 3SAYA 2ZDTA 2R3OA 3DAKA 4YJOA 3JRXA 1B04A 3BU5A 2CCHA 3IOPA 2R9SA 5CVHA 5LOHA 1BLXA 1IA9A 4C3PA 4C59A 3OTVA 4M8TA 1JOWB 2RGPA 3ZDIA 3FHIA 5AAGA 5CQUA 4IB1A 2F7XE 3NVMB 3LQ5A 2R7LA 5FPOA 3EFKA 2BCJA 2BAQA 4XOZA 4L42A 5IH4A 4UCVA 1U5RA 3C1XA 3OY1A 4BCNA 1H8FA 3DXNA 5E8ZA 3R9NA 4F6SA 3TNWA 1PXNA 4WO5A 2WQOA 4FVRA 4LOOA 3UNZA 1GGOA 4B9DA 2V5AA 4FKGA 2W4JA 2XP2A 3CS9A 4K9YA 1MRUA 3U8WA 2R3HA 2ITNA 3QQFA 3PPJA 3DTCA 1P4OA 1REJA 4FKRA 3V01A 4JG8A 1G8JA 4N70A 3F6XA 4OW8A 3OWKA 1GIIA 4I93A 4MVFA 4MX9A 3DTWA 4YSMA 5DE2A 4JMQA 3CGOA 4E5BA 5CT7A 2HY81 3ZH8A 3DJ5A 5HD4A 5D9HA 1UNHA 5HNGA 3LJ0A 4HYUA 3WYYA 3KGAA 2W1DA 4IX4A 4FGBA 3RVGA 3RTXA 4MXZA 3W32A 4IFGA 4QTCA 3GU8A 1YXVA 2PULA 1U4DA 1WMKA 3DA6A 3QQHA 4GCJA 4XV1A 1FQ1B 3QX4A 3W2QA 3ZC6A 4BICA 4A06A 4Z16A 1H26A 1Q4LA 5K2MA 3MVHA 3NR9A 4AT5A 2YYAA 1DAWA 4AGWA 3PJCA 4E20A 4ZZNA 5CNNA 3BKBA 3P23A 4FTAA 3TZMA 3FDNA 3UP2A 2P4IA 4ANBA 3UZPA 3D83A 5HX8A 3WARA 2FA2A 1V0BA 1PYXA 3AT2A 2V55A 3CGFA 4YC6A 1KJIA 4KIQA 5BWUA 4QMYA 2P55A 2BR1A 5IF1A 2YIXA 5D41A 2JIVA 1CTPE 4GU9A 2PVNA 3QD0A 5DG5A 5J95A 3ZSHA 4DLKA 1BI8A 4G3DA 4AG8A 2QO9A 4BGGA 3A99A 3OP5A 4D1ZA 3IECA 5ITAA 4EK4A 5K5XA 3VWAA 1KE6A 4UY9A 4L44A 1I7LA 2OZOA 4YTHA 2CMWA 2W7XA 2FGIA 4FV5A 4FTRA 4LFIA 3TIYA 2QHMA 2C47A 4DH5A 1LEWA 1ZYCA 4O6EA 2GNJA 1H00A 5EM5A 4ZMFA 5A4LA 2OF4A 4KWPA 4NU1A 2HAKA 4R7BA 3THBA 5EKOA 2UW6A 1Z2PX 4EOSA 4LQMA 4J8NA 2Q7DA 5HCZA 3PSBA 4RFZA 5HX6A 5AP1A 3ZOSA 4DGOA 4IVCA 4XG7A 5B0XA 4HYHA 4AOIA 3QTUA 5JMSA 2F49A 2YM8A 3FBVA 3MJ2A 4EHEA 4JQEA 4AAAA 1AUVA 3KB7A 1JDEA 1WBVA 4FI1A 2R3IA 4EFBA 4O7YA 4DHIB 3PP1A 3NFGB 1MRVA 4FZ6A 3ZBXA 2JIUA 4K1BA 3GP0A 2W06A 4JG6A 4O0SA 5CLPA 3DBQA 5FXQA 4EEVA 4AXDA 3QQLA 2B7AA 3NYNA 1CKIA 2R3NA 3F82A 3OF0A 1GZNA 3GCQA 5CXZA 5BWRA 5KKNB 3PUFC 4HNIA 5CQWA 4C3RA 4WT6A 5H3QA 1BUHA 1OKYA 4ZTRA 3DK6A 3C4ZA 4D4YA 3PPZA 1MQBA 4I6LA 3OUUA 1F5QA 1OIUA 1QPDA 5AA9A 3KK8A 4JLCA 3OWJA 2ITQA 3FMEA 4RVTA 3C0HA 1HOWA 3GI3A 4XS2A 5D11A 4JDKA 3QTQA 4YJ3F 1IASA 4MKCA 5KMJA 3LWBA 1XHAA 2BTSA 3IW7A 2YCRA 4WIHA 4ALVA 5CEQA 3AC4A 1H28A 1OZ1A 4IZ5A 3MWDA 2Y6OA 3GB2A 5HG8A 4FKTA 3PG3A 2WMBA 3EFWA 5AEPA 4N0SA 4YJNA 3NX8A 4F1MA 3G8CA 5BYYA 2YZAA 5AUTA 2HELA 3KQ7A 3LIJA 3N4VA 5D10A 2VWYA 2W6MA 2UW9A 2PN1A 3HT5A 3NW5A 2HWPA 3ZONA 3HRFA 1YOMA 5F95A 2BVAA 2R3JA 3G9NA 2F2UA 4MXOA 3ORNA 2C6DA 4CKJA 3R28A 2YIYA 3K5HA 4HNTA 1O6YA 4CMOA 3FV8A 1WZYA 4I55F 2C6OA 4XNEA 4O38A 2YACA 3FUPA 5HICA 2B9FA 2YIQA 3G2FA 2XNEA 5DBXA 1KSWA 2VV9A 5EHYA 3WF8A 4QQTA 5A14A 2W70A 2I6LA 4ZS4A 4CFUA 1J3HA 1TQIA 3DU8A 3W2PA 2R7NA 2GS6A 4KBAA 2PTKA 3MFUA 3TEIA 3V5PA 3HV6A 3MIAA 5EDPA 3EL8A 2HY0A 4DEHA 4N57A 3DDQA 4W4WA 2XUUA 3S1HA 3IGGA 1G5SA 5CAPA 3Q60A 4KA3A 4TTHB 1YHSA 3BQCA 2P0CA 4MXCA 1UC9A 3ACKA 1JQHA 5HNIX 2C1BA 4BCFA 3OXIA 4F9CA 4ZLOA 5F20A 5BV3A 4O0VA 4F9WA 1UC8A 2GNFA 3CPBA 4FVQA 4I6BA 3LCOA 4LMNA 5HLWA 2O64A 5IH5A 2JDVA 1U59A 4ENYA 3QLGA 4QNYA 2V7AA 3Q1KA 3D0EA 4ANMA 4EH5A 5E8TA 3PE2A 4PTGA 4HGSA 1YWVA 2BAKA 5JFWA 2ABJA 1SNUA 4IX6A 3EMGA 3FZRA 1SYKA 2NPQA 4Y73A 2J7TA 3CLYA 4HCUA 4U7ZA 3QGYA 2X9FA 1CQIB 4FE2A 2OLCA 3P0MA 1JNKA 2H96A 4FTOA 3UFXB 3SG8A 1W93A 2HVSA 3PPKA 3UDSA 3F69A 4R5SA 4Y85A 4EH7A 2W6ZA 5BYAA 3IGOA 3T99A 1Q97A 3OCGA 4X3FA 3EWHA 4F63A 3NRMA 1OPLA 3TG1A 4I41A 2GHGA 4IAIA 2VX3A 2HHFA 4LRKA 3MESA 3WZDA 4DRFA 3LM5A 4EORA 3R6XA 1ZXEA 2UW4A 2Z7SA 2NO3A 4AZTA 2VWIA 3PWYA 2QLQA 2O8YA 3EYHA 5J9ZA 5JRQA 1VYWA 3BCEA 3QZHA 4RWLA 2WTCA 4EQMA 4KD1A 5J5SA 1VS0A 5IQGA 1OGUA 2QOOA 4O0YA 2WTKB 5D1PA 3HP2A 3RK7A 3Q9XA 3RPYA 3QD2B 3TZ7A 1QPEA 4RX5A 2Q2UA 3HDNA 2ZM1A 5DR9A 3TZ9A 3VS1A 4EK5A 3ZO4A 4RZQA 4RX8A 4YTFA 5EI8A 3VPDA 4LUEA 1CMKE 2XIXA 3PSCA 3V5JA 2WYOA 4V0GA 2Z7RA 3I6UA 2JGZA 3BZ3A 1M7NA 1YWNA 4X6QC 1M6VA 3JYAA 1W7HA 4FKPA 4JBPA 1P5EA 1Z9XA 3TW6A 4A9SA 3W5OA 5I5XA 1NXKA 4ASXA 3DS6A 3DJ6A 3P79A 5AP0A 1PHKA 4B8MA 1FOTA 1YDRE 3R7IA 4XP2A 3PRIA 3OBJA 4ZTMA 3L8VA 4IM3A 4P7EA 4JX3A 3QF9A 2WMWA 3R01A 4PNKA 3WE8A 2YHVA 1M14A 4JBOA 2RFNA 4EG0A 3FLSA 4DEEA 2EXMA 1R78A 2QCSA 4I5CA 1T36A 4FR4A 4O7RA 3UQGA 4AXCA 4F6WA 3I12A 5G1XA 2VTTA 5BMVF 4MH7A 3DZQA 2C6TA 5BVKA 1Z2OX 3TMOA 5M08A 4HVHA 3JSNA 2NRUA 2EJ0A 3MA6A 3TW7A 3TY5A 3IK3A 5TF9A 2YRWA 3MGYA 2F57A 3UPZA 5HV6A 1PKGA 2XYNA 3AC5A 3SW4A 1CS0A 4EC9A 1J1CA 4DA5A 5LXTF 5CU0A 3JZFA 2W4KA 3T9BA 4DAAA 3LFBA 3BA9A 1W98A 3T9FA 2OJ9A 2XJ1A 3A8WA 4YHFA 4EBWA 3EYGA 2YFXA 2P33A 3R8PA 2COJA 5FXRA 3PFQA 1CKOA 3VVHA 3QXOA 1WVWA 2GNHA 5HG5A 2C3LA 4ONAA 2YERA 3FLWA 2G2FA 4S33A 4BZNA 4EZ5A 4A7CA 2WMUA 4OUCA 1URWA 3GOKA 3HUBA 3LFNA 2XK8A 4FTJA 2FB8A 4O7WA 2WQBA 3TNQB 5BWVA 1Q8ZA 3VUGA 5CB4F 4K33A 1BI7A 4OTQA 4CTCA 2Y4IC 4BDHA 4DAWA 1PY5A 3LW0A 1VKZA 3DV3A 4IM0A 2NYAA