4O86A

Saicar synthetase (type-2) in complex with adp and cdp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP and CDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 75
structure length 227
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o86A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o86A02
1CQJB 3C4FA 5I9WA 2VO3A 4FV9A 4Y73A 5HNBA 2YAAA 1KJIA 3C4XA 3GOKA 4OTWA 4FUXA 2CN8A 4GSBA 4WOVA 4FIEA 2KULA 4NT4A 4YSMA 4AF3A 4OTQA 5IEVA 4QMTA 5AA8A 1C30A 2W6MA 3VA7A 3HDNA 1KE5A 3JY0A 3MB6A 1YI4A 3NCZA 4I3ZA 1ZOEA 4JNWA 2YYAA 1Y91A 3OY3A 1NVRA 2XK8A 4G17A 4CLJA 3UOLA 4F08A 3O7LB 4ZLZA 3NR9A 2FPPB 3SC1A 3D5WA 5IA1A 1FGIA 2OJIA 2VWXA 1CTPE 3PWDA 1BUHA 5ANOA 3FEGA 3L8SA 1JWHA 2HY81 3VS4A 4F7JA 3FAAA 4M69B 3CEKA 3KA0A 2A27A 4FKSA 3R5HA 2QI8A 4RC2A 3RINA 1AQ1A 3O51A 4FIFA 3MN3A 3A2CA 2VTHA 5IEYA 4IIJF 2QHNA 3NPCA 4YJPA 5GNKA 3VO3A 4RFZA 4DEEA 4EH2A 5J1WA 2CKPA 2VGOA 4ZTQA 3O50A 2AUHA 3VRZA 1V0BA 3FLNC 3NYNA 4RJ3A 5BYYA 1Q24A 4FZAB 4IB5A 2YABA 3OG7A 5DBXA 3VHEA 5IEXA 3KCFA 4BDDA 4EJ7A 1E4EA 4J96A 2VTRA 5C1QB 3UIBA 4ZJVA 1YOMA 3A4PA 3AMYA 3ZZWA 2Z8CA 2J4ZA 3E7VA 3OWKA 2YS6A 4QRCA 4DEAA 3ZLXA 3OT3A 1UV5A 2R5TA 4HCVA 3IW8A 1LEWA 2J6MA 4EK6A 5E9EA 4O6LA 3ATTA 1B6CB 4MV3A 2PVFA 2BIKB 3H4JA 4FR4A 5J7HA 2VTPA 3QKLA 3D7ZA 4M9UA 3Q9YA 3JY9A 3ALNA 4BBMA 4MKCA 4CTBA 4C3RA 4FVPA 1ZWSA 3JUHA 1GLVA 3RV4A 4R3RA 4O81A 4ZJIA 3R2YA 5BMSA 5CT7A 5DE2A 3R7IA 3UIXA 3FQSA 3P7CA 5HE0A 5BMVF 2XKDA 3RKBA 4XUFA 3OOMA 4BDGA 2CNUA 3MFRA 4O4JF 5EM8A 4I4FA 3GU4A 2IJMA 1PKDA 2AYPA 1H26A 3IS5A 4EWQA 3DBDA 5CS6A 2UZWE 4G5PA 3EN4A 4MXZA 4D4YA 3MDYA 3TM0A 4ZAUA 2PVNA 2BHEA 3KXNA 2WNTA 4O84A 2WGJA 1KV2A 3EL8A 4CFUA 5JFXA 4MHAA 1YI6A 5B2KA 1E9HA 5HU9A 5BPYA 4DG2E 4ZP5A 2VO0A 3EN9A 3W18A 1SMHA 1TQMA 4KBKA 2CLQA 4KBCA 3PRFA 2PSQA 3U9NA 3GT8A 2FPGB 4RBLA 4ID7A 5C4KA 4EYJA 2OF4A 5D9HA 3WARA 2R82A 2PYWA 4EKLA 3FZSA 2PVKA 4LOPA 4FT7A 4QMXA 4W4YA 5CVHA 3E5NA 2C68A 3DDQA 3PJ1A 3FKLA 2W1ZA 5FD2A 3KRWA 1SZMA 4PL5A 3FMNA 3QU0A 3UYTA 4ZLYA 3RM6A 4KBAA 3MIAA 1K2PA 3HL7A 4U44A 4JG7A 5EOLA 3SAYA 1VEBA 3ULIA 4E20A 1A9UA 5JGAA 3G8DA 3O8PA 4RIWB 3F5PA 5L6PA 4O0TA 2QNJA 3BLHA 1PJKA 5C9CA 3W10A 4CKRA 4E5AX 3HX4A 4ASDA 4QMVA 3GLKA 4U41A 5FTQA 4WSYA 4QMZA 2Y4PA 3C0GA 3R7EA 2ITUA 3D5XA 4GIHA 4C33A 5AMNA 3A7FA 5CY3A 3R1YA 4YNEA 1OIQA 3I60A 2W6OA 3BPRA 4U3YA 2IN6A 2WOTA 4BY9E 1SNUA 5AP6A 4PNKA 3WYXA 3OS3A 1I44A 2IW9A 4TV8F 4IAIA 4X3JA 1XBCA 2QO7A 3OROA 3IGOA 1TVOA 4WT6A 1JOWB 4BBEA 1G3NA 4L01A 2C3KA 3U87A 3ZHPC 3QTXA 3EOCA 5HHWA 4EH9A 5HKMA 1Y6BA 2WQBA 3ZDIA 4E7WA 5KBQA 1OKYA 4IC7A 1IRKA 5ANEA 4C0TA 3H10A 4D0XA 5HU3A 3MVJA 4IE9A 4Q9ZA 2QOBA 2PTKA 4ASXA 4DFZE 1W84A 5IDNA 1M0WA 4CG9A 2C6MA 2UZLA 3S2PA 3PE2A 3RUPA 1IG1A 4YB8B 4MNEA 5LVPA 3TZ9A 3EWHA 2YDKA 3FV8A 1I09A 4YO6A 4BRXA 5ITAA 2WMAA 3ZUVA 5DWRA 3THBA 3NUUA 4A4XA 1W82A 4M14A 5BYZA 5KMKA 3O7LD 4BCFA 2ESMA 3ERKA 1IA9A 4M3QA 3VULA 4MXYA 3G90X 3UYSA 4BCMA 5D12A 2X0GA 5DG5A 5IQIA 3W32A 4IJ9A 3A7HA 5KO1A 5J1VA 3FBVA 2A2AA 2CJMA 5CZIA 4HVSA 2GFSA 2W06A 3EFLA 4GK3A 4L52A 4RC4A 2WTKC 4AZWA 4O21A 4BGQA 5AP5A 3TXOA 3MFSA 4O91A 4UX9A 4HYHA 5CB4F 4MEDA 4DFNA 5M09A 5F95A 2ZJWA 4O2ZA 4KSQA 3NW7A 3TIYA 4FEVA 3ID6C 4O0RA 3QXPA 4F1OA 2Z7LA 1XR1A 3E7OA 1PK8A 3G51A 2VTOA 1UU9A 4IACA 5E90A 5L2TA 3T9IA 4TV9F 4RLLA 3H9OA 4RWJA 3KVXA 2J50A 1YHSA 2XCHA 2H96A 3QX2A 3NSZA 2VTIA 2PE0A 3DQXA 4G16A 3UO4A 5DEYA 4F0FA 2ITZA 4I1ZA 2NU6B 3P0MA 2QG7A 2VTLA 3MPMA 5FLFA 3HNGA 3PYYA 3Q32A 3BU3A 3ATSA 2VV9A 4FTMA 2XCKA 3I81A 4PTGA 4U43A 4FOCA 5AUYA 5IF1A 3VUKA 4YJOA 1J7LA 5HX8A 2C5NA 4LOQA 4AFJA 3F7ZA 4CTCA 2BAKA 4EQCA 2DWCA 4MX9A 4MXCA 1BL6A 4FKTA 4FSRA 2NRUA 4I4EA 2HJWA 4HGSA 3O2MA 5LOVF 4O0UA 3AC1A 3UODA 3SGCA 1YWVA 4QPAA 5T6KA 4KKGA 4V05A 4D1SA 3EQBA 2HELA 5KMOA 5H3QA 5M07A 4FODA 4MV1A 4ZOLF 3E64A 2BDJA 2XNGA 4OTHA 4KD1A 5M06A 5JH6A 3LJ1A 3QC4A 4XX9A 2ITYA 5EDQA 1Z2PX 2WTCA 3NDMA 3OBJA 3KALA 2YHVA 3QD0A 3I4BA 3UMWA 2E2BA 1JBPE 2UV2A 3DQWA 3F88A 2R7IA 3KK8A 2PMIA 2E9PA 3HMMA 3UVPA 1H1RA 3NUNA 4NKSA 2QHMA 3UQGA 3IW4A 5A4LA 4YLJA 3D7TA 4MA5A 1OIYA 3WOWA 3FLSA 1JPAA 1ZYSA 3HV7A 4FTUA 3DBCA 4FKVA 1ULZA 4ZSLA 4ASZA 4IB0A 1BXRA 4WBOA 4YJQA 3FC2A 1XH5A 4FTJA 5CNOA 1QCFA 4OUCA 1Y57A 4TWOA 4GRBA 4ZTRA 5HTBA 3FMLA 3UNJA 4FSMA 4EZ5A 4FVRA 2ERKA 3WZUA 4E5WA 2PHKA 3NUAA 1VJYA 4I5PA 2YM3A 4R7HA 4BICA 5AV3A 2W70A 2WU7A 4NYEA 4EOMA 3FPMA 4B4LA 4BI0A 3W2PA 4RVTA 4DTKA 3MH3A 3FHRA 5J9YA 2OU7A 3VMMA 3PIZA 2ZB0A 4X3FC 3ZSHA 2H9VA 4ZTHA 4E4LA 2OXDA 2RG5A 1W8CA 4AA5A 1YXXA 3GC9A 3PXRA 5EH0A 3AC5A 3JVRA 4I94A 2YZAA 1H0VA 4WIHA 1ZMVA 2BZKB 4FGBA 4YZCA 4BTJA 3OCGA 3T9TA 2XVDA 1BNCA 1M6VA 3NZ0A 4FSYA 4DF3A 3D5VA 3VHKA 4IANA 2OICA 1GY3A 4NH1A 2C6KA 3VNTA 2PUIA 3F6XA 4AT4A 1ZOGA 4GMYA 2JKKA 3BV3A 2OXYA 3RAWA 1Q5KA 4FEUA 3ELJA 5CEMA 4CVAA 4BKJA 4R6VA 3BWFA 5LOHA 3OUZA 3FMEA 1PY5A 3JVSA 2DWBA 3KULA 2XH5A 5HD4A 3CPCA 2FPIB 3D9VA 4L3LA 2PMNX 1G5SA 2QR8A 3KKVA 3MY5A 5BVEA 4MWHA 3KFAA 3SXFA 3ACKA 5AAEA 2BR1A 4UEUA 3ZS5A 4IAAA 3UG2A 5E8SA 3UPZA 1P2AA 3QRTA 4YURA 2BTSA 3AMBA 5EDRA 3P79A 1ZZ2A 4UYAA 2ITTA 4BDKA 2JBOA 3LJ0A 4OT5A 4X2FA 3LJ2A 5EYCA 3GP0A 3CXWA 1DV1A 4KB8A 2WIHA 4IQ6A 3ZLYA 2YCFA 3ENMA 2X4ZA 3LFEA 3F2NA 3FI2A 3OTVA 3CKXA 5AAGA 3OCSA 1NXKA 4F64A 5JRQA 3NNVA 2YL2A 5I9UA 5M55A 4BZDA 2LAVA 4NCTA 2WMRA 2VTSA 4C36A 2OJGA 2BDFA 2C6TA 4MWIA 3VIDA 4R3CA 5BX0A 3TUCA 4ZK5A 5M4UA 4NW6A 5ANKA 4O82A 4QSHA 4E4MA 2GFCA 5FXQA 3R8PA 3PP0A 2UW3A 3TI1A 4XV2A 3LXPA 3W2CA 2R3OA 3QWJA 2YDIA 3DAJA 4YC3A 5CALA 1BI7A 3GU7A 4GFGA 2ZM3A 3D2KA 3MFUA 5DPVA 3NNWA 2WB8A 4A9TA 2WMBA 4V0GA 3F3ZA 1GNGA 3AOXA 3MTLA 2H8HA 3UFXB 5BVKA 3R71A 4C59A 4R77A 1PKGA 2V22A 4HNVA 3WZDA 5EHLA 3JZIA 3PPKA 4H58A 4RIXA 5JK3A 2EUFB 5KMIA 4KIOA 4YHFA 5HI2A 4NL0A 5JEBA 4DFLA 5L2WA 5E8XA 3HMPA 3DBFA 1U46A 4OTRA 3KMWA 4A7CA 4WNMA 3K5HA 2AC3A 2NNWB 4G6OA 3F9NA 3R1SA 4EZ7A 4DLKA 3A8XA 3FQEA 4LG4A 4M68A 2PZ5A 3CR0A 2R3FA 2BRBA 3PIYA 1URWA 4NW5A 3OFMA 4F0GA 4JI9A 3F82A 1HCKA 3QC9A 2W1GA 1H1QA 5A4TA 4IZOA 2ZV8A 4IC8A 4R1VA 2VR1A 1ZXEA 3BYSA 4F7SA 2YERA 3LFAA 3LCKA 3QGWA 4KABA 3HGKA 4HQ6A 4JDJA 5JFSA 5KMJA 4G3GA 5CAUA 4B9DA 2QCSA 4PDOA 2GNIA 1H08A 2ZDHA 1F0QA 4HCUA 1DI8A 2VRXA 4FNYA 3TACA 4FV8A 5HNIX 3Q2MA 5FTOA 3WO1A 3BHUA 3ORXA 4N70A 3R8MA 3V01A 3EJ1A 4OR5A 3A7JA 5AV2A 2OLCA 4ZY4A 4CSVA 3BBWA 3FY0A 4ZSAA 2FUMA 3I7BA 3MESA 4ZJJA 3DXPA 5CF4A 5HG8A 2W4JA 4MQ1A 3TT0A 2FH9A 1OMWA 1T36A 3LFFA 5IYZF 4V01A 3I12A 3GVUA 5DR6A 3LMHA 3MPTA 3QQKA 2GU8A 5HCYA 4ZQIA 1APME 3TZ7A 3V8WA 4M0ZA 1LP4A 2W4KA 4KUJA 4YR8A 3L1SA 3RZBA 2R0IA 4X7QA 2UVYA 3HVCA 4RQVA 2WMQA 4FZ7A 3U55A 3L8XA 3LAUA 2H34A 4ZI7F 4FSZA 4CT1A 4LRJA 1XH6A 2HZIA 4I4TF 3PG3A 3EQCA 1LR4A 5ETFA 4Y72A 2QG5A 4FTQA 4JQ8A 2GDOA 3HECA 4FT0A 2OFUA 4TWPA 5AAFA 4BIBA 2PUPA 2R3KA 3LCSA 3U54A 2B52A 2YIWA 4AUAA 3MPAA 5H8EA 4BDFA 5IQGA 3SOCA 2YACA 2GQSA 1OPKA 3W8LA 3HMIA 2JIIA 2HY0A 4W8DA 2VUWA 1OKZA 4QQJA 2V7OA 2W9FB 3MJ2A 4QQCA 2J7TA 4C4EA 1M14A 2O2UA 3FLQA 1SVEA 4IVDA 2JGZA 3BU6A 4LYNA 2CGXA 3ZXZA 2C69A 2XK6A 3PSDA 3TWJA 2ZB1A 4ACDA 2HGSA 4FTOA 4J7BA 4IH8A 2IW6A 4G3DA 3SW4A 3HAMA 5E1SA 3FHIA 4KIPA 4E73A 3LXNA 4LL5A 4KIQA 2J0LA 5I5ZA 3FYKX 3CJGA 3EN6A 4FIJA 5DT4A 4MV8A 4ANQA 4FFRA 1WBVA 4DC2A 5CU3A 3VBQA 4DH8A 4AG8A 2CNQA 2PBZA 4NFNA 1YQJA 3IDCA 1CKIA 4RIWA 3IKAA 3W8QA 1YHWA 2GCDA 4CNHA 3DTCA 3K5UA 3IW6A 4ACMA 2XM8A 4C58A 3FE3A 3U4WA 3TTJA 4RGJA 3P23A 4O7ZA 3LCOA 3VBWA 4DTAA 1GZ8A 3D94A 1KOBA 5M44A 1MQ4A 4RIYA 3Q5ZA 4HYIA 1S9IA 4RJ4A 4WUNA 5FBOA 3ROYA 3TNIA 1GIIA 2PVJA 2XK9A 4GT5A 3TKHA 3DNEA 4IHPA 4C34A 2X1NA 1VKZA 5CSHA 4BTFA 1V0PA 2CKQA 3QRJA 3KVWA 4LMNA 1Q8ZA 3UPXA 3DBEA 4DG0E 2W71A 5D11A 4LL0A 2J90A 3MY1A 1RE8A 4QP2A 3ZO2A 1OM1A 4YJVA 1Q62A 3QTRA 3UP2A 3ZFYA 3K3IA 4S31A 3CKWA 4DAWA 3NUYA 4FT5A 2YM7A 1Q8WA 2R3IA 2ZDUA 2V5AA 2PE2A 5IG1A 2X8DA 3KXZA 2QKRA 3FLZA 5JFVA 2ONLC 3VWAA 2R3NA 1WZYA 4MXOA 3NVKI 2CDZA 3QCSA 1DV2A 2GQGA 3ET7A 1CKPA 4AA4A 4B8MA 2HXLA 2UZEA 4KKEA 4EOPA 2OIQA 5EM7A 5IQDA 1CQIB 4MV7A 4TN6A 1REJA 3UZTA 1UU8A 3H0ZA 3R7YA 5LCKA 1DIKA 3Q5IA 4L67A 2OJFE 4FZDB 1Z2OX 1RQQA 2PVRA 3EQFA 3DPKA 1VZOA 3F3UA 1ZMWA 3G8CA 4QP6A 3NNXA 2BKKA 5BUJA 2OSCA 3S95A 2HENA 5A6NA 4M67A 4GV1A 3HYHA 5BVWA 4RA5A 3V6RA 1WBSA 5HICA 3O8TA 2HZ4A 3HRCA 4DH3A 4CFWA 3C5UA 4EH3A 3VQUA 3EQGA 5TR6A 3R2BA 1KUTA 3RHXA 3TNQB 3EKKA 2VAGA 2W5HA 2R2PA 4RJ7A 4ANMA 4YGAA 4C4HA 4E4XA 1GAGA 4MXXA 5DH3A 5AADA 3LFDA 1YOJA 3ZO3A 1YXTA 3TNPC 4JG6A 1SNXA 1O9UA 5HLWA 5E8WA 4BCQA 4DEDA 1VBHA 5HESA 2BHHA 3ZFMA 4A07A 5HIBA 1H1PA 5K5NA 4FU0A 4QTEA 3KAJA 3FMMA 3AT2A 2ZDTA 4YZDA 2X2LA 3FZPA 4G6LA 3PP1A 3B8QA 3RHKA 5HIEA 3QZIA 1ZRZA 3P9JA 4O22A 4XG3A 3V5QA 2VWYA 5HV6A 5CASA 1JKTA 2Q83A 3EZVA 3TTIA 3BU5A 4O0SA 3EN7A 2WQMA 3Q60A 5E91A 4S30A 3IPHA 5ICPA 3HRFA 1F3MC 3UNKA 3BRBA 4F6WA 5H2UA 5EYMA 3UE4A 3L9MA 3FDNA 3QD2B 4O0XA 2PZYA 3O0GA 4J97A 5BMMA 4ERKA 2PY3A 3FKOA 3NNUA 3RPRA 5CA1F 5AWMA 3NWWA 5EFQA 5H9BA 4D9UA 3FMJA 3OXZA 3AQVA 4QQ5A 5EHOA 4ACCA 4PL3A 1H25A 3LLAA 4H1JA 4FUYA 2WEIA 1TQPA 4DEGA 1PXIA 1CM8A 1WBPA 3QL8A 4CEGA 3EHAA 3ULZA 3WF6A 3RVGA 2RFEA 4XEYA 4EH6A 2X9FA 5LMAA 3R00A 5H8GA 3WIGA 4E1ZA 1XH8A 4IZYA 4JL9A 4YHJA 3CD3A 2R7KA 1W7HA 3RWPA 4NU1A 2HOGA 5EK7A 3HO8A 5F9EA 2XNEA 5KKRB 1M7NA 2PPQA 5FEQA 4DFUA 3RP9A 3P7AA 3ZO4A 2G9XA 4GKHA 4F9CA 1BI8A 3E88A 3OOGA 4D5HA 1B39A 3FXWA 3KL8A 4EUTA 2ZV7A 4G1WA 2C3LA 3BZ3A 3LVPA 3PXFA 2IZTA 3QYZA 4IZ5A 4I41A 4X3FA 4MVFA 2GNJA 4C02A 4X2JA 4G6NA 2IG7A 2UZBA 2CGUA 4LV8A 4NFMA 3OZ6A 4DBXA 4C3FA 4LQMA 3AW8A 2QOHA 3SG9A 2JDSA 2GPHA 5DIAA 5L8KA 4EQUA 3GC7A 4RWKA 4GL9A 4F70A 5CVFA 3COMA 3KF7A 4QYGA 2R86A 4A9SA 3OXIA 1XH4A 5AUUA 4O4LF 3I7CA 5L8JA 4K6ZA 3U4UA 2FSTX 4ACHA 4EONA 3EIDA 4BR3A 1UNGA 2QURA 5JRSA 1KE7A 1PW2A 4L44A 2DZDA 3UNZA 5EZYF 4FKQA 5HVYA 5C1PA 4USDA 3E5AA 1ZYCA 3F3WA 3DFCB 4U97A 2WQOA 4FV3A 4BIDA 2PE1A 2QOLA 5AV1A 3V51A 4CZUA 4V04A 4FA2A 2RGPA 4XG8A 5EQPA 5HE1A 3E92A 4A06A 4F9WA 3ZO1A 2B54A 4KWPA 1PXLA 5CYIA 3QX4A 1YKRA 4IVBA 4CGAA 2IVUA 2XK4A 5HORA 4D0WA 4O7YA 1IEPA 3HA8A 3PRIA 4FL3A 1FMKA 3V6SA 4AGUA 1JLUE 3P78A 4LV5A 3UQCA 3LLTA 4JR3A 2B53A 3PJCA 4YMJA 3ORTA 1PMVA 4TYHB 5HBJA 3R73A 3PJ3A 5BVDA 1OKWA 4I55F 4A4LA 4QP8A 1YW2A 2WHBA 4FV5A 4E4NA 4YLLA 3HUCA 3CGFA 3QD4A 4BBFA 4MAMA 5HG9A 3REPA 4CV9A 4DLIA 5HLNA 2YJRA 2JIVA 2O0UA 4PTEA 1SCUB 3C7QA 4ME6A 1Q61A 4J95A 3BBTB 5EI2A 4EYMA 3VS0A 3LCTA 2C6DA 1W96A 4EUUA 4JAJA 5I4NA 4RMZA 4CCUA 2QOCA 3KREA 2ZAZA 1OVEA 2QOOA 2XUUA 3ANQA 3PTGA 3U8WA 3HB9A 4QT1A 2WXVA 4TTHB 4EOJA 4OBPA 3ZC5A 5JFWA 5HX6A 3R7UA 4YPSA 5HTCA 2C1BA 2XP2A 3OVVA 3S3IA 4DCAA 1A06A 4TYJA 5DVRA 3C0IA 5IH4A 4P5QA 2UZVA 3C1XA 1WBTA 4EH8A 4RIOA 5CXZA 3DT1A 4RFMA 5JT2A 4ITHA 2F2UA 4FBXA 3V3VA 4AXAA 2V58A 3RCJA 3W55A 4FSNA 5HE3A 4WUAA 2ZM1A 3FUPA 3DXNA 3TJCA 2I80A 1W98A 4ORKA 5CTPA 1Z5MA 2VD5A 2YAKA 4EK3A 3OUKA 3N8DA 4FX3A 2FYSA 3D15A 4JBVA 4UZDA 3LOKA 3QRKA 5KZIA 2FB8A 4BN1A 2W1EA 2C4GA 3AMAA 4MYGA 3FLYA 4YTFA 5CEPA 3H9RA 3VUDA 2YZMA 5E92A 4Z55A 3QXOA 4Y8VB 3LM0A 2WKMA 2GPWA 1PYEA 2R3JA 3OY1A 4GK2A 5GJGA 1G8AA 3O71A 2W96B 3HZTA 5JQ8A 1IA8A 1XKKA 4FKLA 4FV0A 4G9CA 3ORRA 3ORLA 1W0XC 4FICA 1GIJA 1GZNA 3O96A 4S32A 5HCZA 4DEHA 2JLDA 3Q4UA 3QA8A 2O63A 2QONA 4PQNA 3QQFA 1KE9A 2WTVA 2XIRA 4K33A 3BGZA 4NTSA 5J2UF 1BYGA 3QTSA 3FZ1A 3RJCA 4IWOA 3BYMA 5CAOA 4YTIA 5LMKC 4XCUA 3LM5A 3G15A 1H27A 4IEBA 4XV1A 5H80A 4D2RA 4EQMA 4XLVA 4LGGA 3QGYA 3BIZA 1YXUA 2YISA 3TEIA 5AFVA 1UWJA 4YAKB 1GZKA 3GNIB 3MFTA 1WCCA 2P3GX 4RX9A 1JKLA 4QNAA 4JQ7A 2OZAA 4E6CA 3CSVA 3MH0A 4I0SA 2VQDA 3ZM9A 1Z9XA 3EFKA 1YDTE 2R7NA 4XG7A 5E1EA 4ZHQF 4D2SA 1JVPP 3KC3A 4LFIA 4CFFA 2ITXA 5FXSA 3F2AA 4C5AA 1YXSA 2HW6A 5ANJA 4FG9A 5JQWA 3SRVB 3FI4A 3ANRA 1Q99A 2FVDA 3CBLA 5IZFA 2OZOA 4H3QA 5FP5A 1CE8A 5LP6F 2QF7A 2VWWA 3JRWA 2WAJA 3FY2A 2VTQA 2P2IA 4GIIA 5C8KA 5CAQA 1EHIA 3BQRA 4BB4A 3DNDA 4CKJA 2EXMA 2PU8A 3KMMA 3QLFA 4M12A 3VJNA 2VNYA 3DKGA 3EH9A 4AZSA 4BI1A 3C4CA 3ZLSA 2BRGA 2JDOA 3SDJA 3GXLA 1YHVA 5J87A 1KJQA 3HP5A 2Z7RA 3JR1A 4L7FA 4XOYA 2XNOA 5L6OA 1ZMUA 5FNVF 2EWAA 4G3CA 4G5JA 3ZCLA 1J1CA 5K4IA 3OF0A 5HBHA 4FFNA 3AD4A 3W2RA 4U81A 2W6PA 3WNZA 4FSWA 3T8OA 4Y5HA 2JFMA 4HPTE 5FBNC 5HNGA 3COIA 3G5DA 3ORPA 4KRDA 4ZS0A 4AZFA 2JKQA 5A4QA 5CF8A 3Q6WA 2VZ6A 1J1BA 4NM7A 3ZH8A 4CMTA 4FV7A 2F7XE 4NWMA 2ITQA 4DH5A 4K9YA 4HVHA 1OB3A 3WBLA 2PN1A 2V0DA 2C6EA 4ENXA 3QKMA 4HYUA 3H9FA 5ETAA 3U9TA 4AZEA 1YRPA 3KRLA 1UVRA 2FSOX 2R0UA 3N4VA 4L3PA 4EC8A 2G2IA 5CQUA 4ZZMA 3LE6A 2QC6A 4II5A 4BVUA 2IZSA 4ALUA 5KHWA 4GEOA 1A48A 3WO0A 4ZTMA 1VYWA 3VUGA 3K2LA 3FXZA 4C7TA 4GYIA 3K3PA 5ANDA 5A46A 4D58A 4GVAA 3NGAA 3WZKA 3OP5A 3SW7A 2EXCX 4I6QA 2PWLA 3F69A 4P7EA 4XHKB 3R7OA 3R01A 3IDBA 4LRKA 4O7VA 2JKOA 1P4OA 3A60A 1OL5A 3FZOA 1HOWA 3K54A 4KS7A 4FEXA 3ZRKA 2XJ2A 3F2RA 4RLKA 3TNWA 2I8CA 2YITA 2CHLA 5LJJA 3KRJA 4RPVA 2RFDA 4YJSA 5BUEA 3EZRA 4BGGA 3ZUTA 3BYOA 2XB7A 4BGHA 2CNVA 2ONLA 4TW9A 1Y8YA 3TZMA 4M15A 4EC9A 2UUEA 3PJ2A 4NIFB 4RC3A 1U5RA 3P1AA 2BRNA 3CQEA 5B7VA 3HKOA 4IFCA 3FL4A 4Z3VA 2Q0NA 4IAZA 4XRJA 4FKGA 3PFQA 2FSLX 1R39A 3ZU7A 1B38A 4PWNA 4H05A 4HOKA 3TG1A 1A9XA 5HBRB 2XKFA 5IU2A 1QMZA 4DLJA 4GJ3A 2VU3A 4WRSA 1OBGA 1YXVA 4C5BA 3D14A 5M4IA 3BGPA 2XNBA 5KNJA 4KRCA 4E6AA 2QK4A 4O7SA 3VS5A 5CU0A 3COKA 4IDVA 4RT7A 4HZSA 4PV0A 3L8PA 3R0TA 2B55A 3P7BA 3QQLA 3BV2A 4YJUA 3ORNA 4HCTA 5BVOA 2GNFA 2J0JA 2BROA 3GCQA 3NUSA 2HZNA 2Z04A 2R9SA 3MJFA 3FC1X 3LWBA 1H07A 3FMDA 5J2TF 3R1QA 4IM3A 4HGTA 2PULA 2DQ7X 2E9NA 3RK9A 3BKBA 2P55A 4QMWA 2X8IA 4FT9A 4AWIA 3L9NA 4RWIA 4ALVA 1Y8GA 3C4EA 3PY0A 4HVIA 2Y6OA 2XRWA 5KCVA 2B9IA 1PYXA 4K18A 4XYFA 3ZSIA 1KEEA 4XS2A 4BI2A 1U54A 4Q5EA 4BF2A 1BMKA 4I50F 4PRJA 3RK7A 4JRNA 2C47A 5TT7A 3UMXA 3AC4A 4H3BA 3SLSA 2WTDA 2VWZA 3DAKA 3DLSA 3OBGA 4KS8A 4BYJA 3NX8A 4FL2A 4CFVA 5B2MA 5LXMA 4J98A 5C01A 3DB6A 4WRGA 4J52A 2ZMDA 4PY1A 3B2TA 2UZTA 5CEIA 4ENYA 4IDTA 5IH5A 3MA3A 3BEAA 2GHGA 3KN5A 3SX9A 2HXQA 3A4OX 1NA7A 4YTHA 5JVLA 1NVSA 4XNEA 4QYFA 4OBQA 4A4OA 1WBWA 2VPQA 5B0XA 3CTJA 1FPUA 3NIEA 4HNIA 2FB9A 3M11A 1AUXA 3V8TA 1UNHA 3PG1A 4EG0A 4QP9A 3ODZX 4AW1A 4TY1A 3TKIA 3DJ7A 1KJ9A 2YRXA 4QMMA 3DK7A 5HGIA 3FLWA 5IH6A 3S4QA 5EI8A 3VS7A 3EN5A 5CNNA 4D1XA 2F9GA 3P86A 1CMKE 3MB7A 3RAIA 2ZV9A 4NSTA 4XG6A 2XD4A 3W33A 5E8TA 2UZOA 5HLPA 4FKUA 4WNPA 2VNWA 2ZM4A 2JDRA 3OCBA 4U6RA 3RWQA 1JKJB 4QMSA 3HV5A 5EOBA 1Q3WA 3RM7A 4RSSA 3R8ZA 1G8SA 5EG3A 3ZFXA 3QQHA 4XBRA 4MTAA 4BCNA 1E4EB 3GUBA 2UW8A 4C5CA 4PF4A 2X7FA 3GU6A 3OW3A 1PF8A 2QR7A 1H01A 2J51A 4BDHA 4XOZA 1Q3DA 1YVJA 3GCPA 3R9OA 2B9JA 3RGFA 4X2GA 3U9SA 2W0JA 4E5BA 5I9ZA 2Y6MA 4U3ZA 4AE6A 2R87A 1FGKA 4JIAA 4UV0A 2NU9B 3Q9ZA 3VOTA 4TT7A 5M53A 3KN6A 1PRYA 4RX8A 5E8YA 4I6FA 2ETRA 5FRIA 5CI6A 3MI9A 1JKSA 3SA0A 3VS2A 3V5TA 5IQEA 3Q4ZA 4BZOA 3N4UA 3CJFA 3ACJA 3VS6A 2UW6A 3MGYA 2XRUA 2J2IB 2B0QA 3DK6A 3EQPA 4R1YA 3IOKA 4JJRA 4QP4A 5FM3A 4ZZOA 4I6BA 4ARKA 4AZTA 3DBQA 4QMNA 3E8CA 3KRRA 4PDYA 5JZJA 1BL7A 1NY3A 4GCJA 2V62A 4USFA 2V59A 3UBDA 3KXXA 3Q4TA 2W05A 5KX8A 4X0MA 3RK5A 3VBVA 3CE3A 4IFGA 4UXQA 5JMSA 4E4TA 3VUMA 3QWKA 4RJ6A 3I0OA 5EKNA 1SYKA 4UBAA 2NPQA 3KRXA 3PVWA 4A9UA 1JDBB 3PXKA 4ZSEA 4FVQA 2G01A 4JG8A 5F94A 2YEXA 4WG3A 4GFMA 4UWCA 4EOOA 5K5XA 4EH5A 4I0TA 4AOTA 1OKVA 1XBBA 2JDTA 3I6UA 4YLKA 4QMYA 2VWUA 3G0FA 4TYHA 3IW5A 2YM6A 5A14A 3EQIA 2YJSA 3PVBA 4L00A 4YC6A 5J95A 4UALA 1JSTA 4I20A 5DA3A 4WBNF 5AX9A 2IVVA 3IW7A 2GLTA 4BDJA 3ZRMA 4P4CA 4JAIA 2VX0A 5DOSA 5FDXA 1OIRA 1Q8TA 4JX3A 3LFSA 3BI6A 4FI1A 4YZ9A 1XWSA 1X8BA 1DAWA 1XBAA 2BDWA 3SE7A 4R78A 4BYIA 1JSUA 1P4FA 1H8FA 5EW3A 3WE4A 4IM2A 4IVAA 3ZYAA 1MP8A 2GS2A 2W99B 3N4TA 3U6IA 1J91A 3FI3A 5D1JA 4DINA 3MS9A 5KKNB 4I23A 3DKOA 2RKUA 3LXKA 1KOAA 4G31A 5JVDF 4TWCA 2CN5A 2ZV2A 3DDPA 5C27A 4ZTSA 4BCJA 2F49A 1UU7A 2IWIA 4MV9A 2OJ9A 2BAQA 4C4FA 1K9AA 3HAVA 1XO2B 5AEPA 2BMCA 3A61A 3HLLA 3U51A 5DEWA 5IMXA 3SG8A 3DZOA 5TKDA 3ROCA 4G3EA 4MAOA 4O4HF 1J7IA 2G15A 2VTNA 3LFCA 2CCIA 3EYHA 1ZZLA 3GB2A 1H28A 2X7OA 3MH1A 1H0WA 2BZJA 2IZRA 4BHZA 3E62A 3KY2A 4Y85A 5AP3A 4GJ2A 2B4SB 3HUBA 5ETCA 2CZGA 4FFPA 3RI1A 5IMEA 4F1TA 3DOGA 3VBTA 1JSVA 1MUOA 1V0OA 4HJOA 4DT9A 4O0YA 5K9IA 2REIA 3NCGA 4F0IA 4MNEB 5D41A 5CEQA 1KE8A 1YWRA 3FMKA 3POOA 4XLIA 4O2BF 4IW0A 4RFYA 3IGGA 1PXPA 2JEDA 3NAYA 5FEDA 5H8BA 2FA2A 3GCUA 5DT0A 2J0IA 2NUAB 2BRMA 1J7UA 2VGPA 2FO0A 2YCQA 3ZBXA 4F9YA 4QTDA 2VWBA 5IUHA 4WA9A 4FIHA 3WILA 4FG8A 5JQ5A 4CQEA 3VRYA 2CCHA 3QTWA 4ONAA 5KX5F 3QTIA 3R30A 4AA0A 3LZBA 3BHVA 4I24A 5C03A 3UGCA 3E8NA 5HVJA 3AT4A 3RPSA 2P0CA 5IQAA 1ZY5A 3QTUA 3R28A 4AFEA 4GUEA 4P5ZA 3AD5A 4AGWA 5C8NA 5LMKA 1WBOA 4AACA 4TYGA 5I0BA 4GKIA 2PVYA 4DH1A 5KBRA 4FTIA 5KHXA 5A6OA 4DHFA 3PIXA 2QLQA 3FI8A 3E8EA 2Z60A 3L9PA 3PLSA 3C4ZA 3QKKA 5K4JA 4X2NA 4IX6A 4EJNA 4OW8A 1Y6AA 4L42A 3I6WA 3W2SA 5E8UA 4U9AA 1RW8A 3AG9A 3ZTXA 2BVAA 1TKIA 1R0PA 4D4RA 4QO9A 1PMEA 3JS2A 1KE6A 2QOIA 3PY3A 3E8DA 2HW7A 4FIGA 4MCVA 4RX7A 5FM2A 4G3FA 4Q9SA 2XBJA 2Y4IB 5JZNA 3AGLA 3ZUUA 3WZJA 2Z2WA 1ZOHA 1VR2A 1SM2A 3R1NA 3G9NA 2W6QA 4MBLA 3WYYA 5M56A 1R1WA 3BELA 5FTGA 1ZAOA 3UZRA 2C0TA 1M52A 2YDJA 2XMYA 3AXWA 3QTQA 4GG5A 3VUHA 4CLIA 1UWHA 1DI9A 3GENA 5AP4A 3DA6A 4GS6A 2R3RA 3VS1A 2F2CB 2HIWA 3OTUA 3RV3A 4GW8A 2BCJA 4IADA 3HEGA 3KXGA 3ZEWA 3C0HA 5BNJA 4BTKA 4W4WA 3QYWA 2UW0A 2GNHA 2BTRA 1H1SA 1T46A 1EZ1A 4FOBA 4E6DA 2XIZA 3PA4A 1GGOA 3PA5A 5LVMA 3SOAA 1PMNA 4I5HA 5HG7A 2A19B 3PPJA 3DKCA 4GG7A 3RAHA 3KXHA 4BCHA 1BKXA 4DCEA 2WELA 3GC8A 1KSWA 4FYNA 3D7TB 4FV1A 2F57A 3VJOA 3QZFA 1OUYA 4YPDA 3RNIA 3W2OA 3K5VA 5A54A 2BIYA 3F66A 3KF4A 1UNLA 2C30A 4N6YA 3SQQA 2SRCA 5BUIA 2O8YA 2WMTA 2X6DA 2ZVAA 2NO3A 1CSNA 2IPXA 1OITA 3DAEA 2WMWA 2CMWA 3R63A 5LVLA 5IA4A 3ETJA 3LW0A 3ZONA 5D8DA 3C13A 4FMQA 2W6NA 4F6UA 2XIXA 3NUXA 2HWOA 4RJ8A 2C5OA 5KZ0A 4QTAA 4APPA 1CDKA 3BYVA 4FT3A 4EOQA 4S33A 3OCTA 2GS7A 1PXMA 5HO7A 3R23A 4LGHA 3EB0A 3NUPA 5HE2A 4ZLOA 5L2SA 3LQ8A 5B2LA 2C00A 3FPQA 5C1OA 2JD5A 3A62A 1M2PA 3SHEA 4R7IA 3UG1A 3KGAA 4AX8A 3KCKA 2FP4B 4CT2A 2JAMA 4GU9A 3QFVA 2ZOQA 5DI1A 1JAMA 4MK0A 3PJ8A 4R3PA 5JN2A 3MV5A 1GSAA 3TW6A 3M1SA 4J99A 1OPJA 5CU2A 5M08A 4G9RA 4XH6A 2BALA 3WE8A 4GVJA 2HK5A 4FNXA 4W4VA 3V4SA 4Z9LA 4IX4A 4Y5QA 2OI4X 3AGMA 3ZXTA 2EB2A 2C1AA 2Y9QA 2CGWA 3RAKA 4S2ZA 5KE0A 4Q5HA 4QMLA 3QBNA 1IOVA 3KULB 3PVGA 2XK7A 3HRBA 2ETMA 4FK6A 4U8ZA 4ZTNA 3OUUA 2SCUB 2W1FA 3G6HA 5KKRC 3IOPA 3QRUA 4GFOA 1QPJA 2GS6A 1JQHA 2R3LA 2GTMA 3CS9A 4LUEA 4CFNA 3C5IA 2W1CA 3OT8A 4HNUA 3FSFA 3SV0A 4IJPA 4CZTA 5CSPA 3QCYA 4I5CA 3ORIA 1YOLA 4K77A 5AUVA 4AS0A 1M2RA 2ITNA 3QQJA 4EEVA 2BAJA 5IPJA 4EWHA 3NRMA 4AGCA 4DIMA 2OG8A 4R5YA 5KMNA 1WAKA 5E8VA 2OJJA 3SKCA 4GT3A 3DTWA 5IUIA 4HZRA 5A3XA 2C6IA 3DXQA 4X2KA 5CX9A 3NEWA 1S9JA 4NJDA 2QODA 2WMVA 4C37A 4PMPA 5FDPA 2PVLA 2XF0A 5LA6F 4NK9A 2NU8B 3UQFA 4HNFA 2R3HA 4BTMA 5LYJF 2XA4A 1LUFA 3ORQA 5EHYA 3ZRLA 3ZSGA 4V0GB 5CANA 1H24A 1R78A 5EW8A 4ZY5A 2WTJA 4PP9A 1R3CA 1WVWA 3TNHA 5AP0A 4RIXB 3V5PA 3AD6A 1XJDA 4UZHA 5E8ZA 3V04A 4D4VA 4F4PA 3TL8A 3EMGA 3IQ7A 3VQHA 5JKGA 2WTIA 1JLLB 2WFYA 2XK3A 5DFPA 3MIYA 5IISA 2XNPA 3PSCA 3UZPA 4O7LA 2BFYA 3PDTA 4E6QA 4D1ZA 2VWIA 4H39A 2UZNA 4AOJA 4YZBA 5M4CA 3OMVA 4KA3A 3Q53A 4EL9A 4I5MA 4AOIA 2GMXA 4F09A 4EBWA 4ANSA 3DY7A 4FTRA 4PMSA 4QP1A 3QHRA 2HAKA 1Q41A 3EL7A 4UXLA 1RDQE 5M51A 4YJ3F 5ACKA 4C3PA 1PXOA 3LKMA 3K3JA 3NIZA 4EBVA 4FG7A 3QTZA 2OW3A 4JIKA 3C50A 4QTBA 4R5SA 4CFMA 4DA5A 4KKHA 2W4OA 2WO6A 5GJFA 4ZSJA 3WI6A 4L46A 3GOPA 4MBIA 5GINE 4XBUA 5DGZA 2NRYA 3RMFA 4PP7A 2I6LA 4HGEA 3R7VA 4F9AA 1JKKA 4WKQA 2DLNA 4B6LA 3Q2JA 3ETHA 3PZHA 4GH2A 5FG8A 5GIOE 1WR2A 3UC3A 4C2WA 5DMXA 3QUPA 4DBNA 3DF7A 1Z2NX 5C26A 3QD3A 1DM2A 3U6JA 2WEVA 3I1AA 4FE2A 1ZYDA 4EOIA 5FXRA 4G2FA 2X39A 3F5GA 1I7LA 4YU2A 5BPHA 4L7SA 5AUTA 4ERWA 2I0VA 2QKWB 4X6RA 3UOJA 1OBDA 4FTAA 4IZAA 3ZDUA 3ZZEA 2YZGA 2OBJA 5AUZA 4AW0A 2ZDGA 2OLSA 5L8LA 5CAPA 2XIYA 3MH2A 1I7NA 4J8MA 4FZFB 4OBOA 4ZSGA 2XNNA 2J9GA 5FEEA 3LIJA 3RPYA 2OKRA 3F61A 3OW4A 2YM8A 5CT0A 3SVVA 4BDCA 3N51A 3Q6UA 2I0EA 3Q9XA 4MBJA 3UC4A 4JBPA 5T3QA 4TUYF 1ATPE 4O86A 3D2IA 1IR3A 1WMKA 4OLIA 5AUWA 4O7RA 5CSVA 1U5QA 4DH7A 3OHTA 2IW8A 4BCOA 4FFLA 3ORZA 4MF1A 4EGQA 5IQCA 3GQIA 3Q9WA 4YC8A 3AX6A 1C3OA 1Q8UA 4YBZB 4AAAA 4CD0A 3MTFA 2GNLA 4K11A 4BCGA 1EUDB 2ITWA 2UW4A 4P90A 3IO7A 1PXKA 4XMOA 3TCPA 2RFNA 5KMLA 3KB7A 2QVSE 4DGLC 2GSFA 4CG8A 2ACXA 4QMUA 3RPOA 3SXRA 4EI4A 4JQEA 4FFOA 1FVRA 5ANGA 3TV7A 5LVOA 4IWQA 4K0YA 2VWVA 3KXMA 3SXSA 2FGIA 3PVUA 3LMIA 4O4IF 2BFXA 2I0YA 5EM6A 5F20A 3BE9A 5CF5A 3F7WA 1PHKA 3MWUA 5IUGA 4M13A 3PWYA 3FQHA 4YJ2F 3F5UA 1B6RA 4FIIA 4AU8A 4EOSA 3ZOSA 4YJNA 4USEA 3R9RA 2YIXA 4HNTA 4UWYA 5HG5A 2YIRA 3QLGA 4I6HA 1AGWA 2YWVA 5HEZA 4F1MA 3II5A 2NU7B 4U42A 3M2WA 4PTCA 3AT3A 4AN9A 2VO6A 4NM3A 4QMQA 1B6SA 3B2WA 2E9UA 2O3PA 3NMUF 2NP8A 4WO5A 2P33A 1E1VA 4DGNA 4O96A 1QPCA 4FGRA 2X8EA 4DFBA 4RVKA 1LEZA 4RIYB 4FYOA 4FTLA 4RQKA 1UU3A 3E3PA 3CP9A 4FSUA 4J8NA 4IWPA 4MQ2A 4OTGA 4E93A 5IQHA 5KMMA 2X0SA 3MWDA 2Z7QA 3CPBA 4MD9E 2CKOA 3UO6A 4BC6A 3NS9A 3KMUA 3BEGA 1MRUA 1WVXA 5EQEA 4EZ3A 4O27B 5AV4A 1YI3A 3FZTA 3S0OA 5F1ZA 2R3GA 4F65A 2H6DA 3LQ5A 4BIEA 2YA9A 4MV6A 3MVLA 5J8IA 3QA0A 4IX5A 1XQZA 3R04A 4KSPA 2ITPA 1OGUA 4H3PA 4AT5A 4TL0A 2J0MB 2PZRA 3ORMA 3QZHA 1F5QA 3KU2A 2PUUA 4L53A 5HZNA 2FSMX 2DS1A 3G6GA 1KC7A 2I1MA 3F3TA 4ITJA 4PMTA 5GIPE 3QFFA 3C51A 1VBGA 4QNYA 5JSMA 4FKRA 3CQWA 3VC4A 3LCDA 4Y46A 3TDVA 4L8MA 1GSOA 1IOWA 4MD8E 3BHYA 4W4XA 2J5FA 3DK3A 3PUPA 4IMYA 3E87A 4BHNA 3JXWA 5F4NA 5CU6A 3C9WA 3QQGA 2WMXA 4EOLA 4FK3A 4LUDA 4X21A 3VW8A 3TQTA 1QPEA 4L45A 3P4KA 2O64A 2P2HA 3RTPA 3WZEA 2EU9A 2JDVA 2WU6A 3DCVA 4XRLA 4FKWA 2UVZA 4TYEA 2R3QA 5LQFA 1DS5A 3IK3A 4B99A 4WNOA 3W1FA 5LXTF 1NVQA 3TJDA 2A0CX 2F7EE 5T68A 3P5KA 4XV3A 4JDKA 2W5BA 2OF2A 2WTKB 2VTAA 4FTTA 4YZNA 4HR7A 3VW6A 2E9VA 2XYUA 3JPVA 3FJQE 1ERKA 2OXXA 4FKOA 3RPVA 3UIMA 3GCSA 3LFNA 4N0SA 5FGKA 3W16A 3UO5A 3M42A 4MNFA 4TNDA 3TZ8A 2DIKA 4Z7HA 2PVHA 3GFEA 3I5NA 4MH7A 4AW2A 5I9XA 3COHA 4RG0A 1CKJA 5EI6A 5CAEB 4UN0C 4I21A 2YCSA 4PNIA 4ZMFA 3V5WA 4JS8A 5HCXA 4WNKA 5GHVA 4QQTA 2QOQA 4EK5A 3R8LA 4JT3A 4WHZA 5AJQA 4FSQA 3T3VA 4M0YA 5E7RA 5CXHA 5D10A 2YM5A 2I7QA 4O0WA 3IONA 3DLZA 2C3JA 2W1DA 2Y7JA 3D4QA 3PZEA 2C5XA 4FEQA 5DT3A 1GIHA 4Z7GA 3OXTA 4OTIA 2XM9A 2ITVA 3GEQA 4AW5A 4IB3A 4EH7A 1M17A 4S34A 2BZIB 3V4ZA 3RFCA 2C5YA 3HV6A 4AGDA 3E63A 4JR7A 4FTKA 4KNBA 5AP1A 1ND4A 5AP7A 4HVDA 4O7TA 5CZHA 4F63A 1OL1A 4H36A 2JBPA 3HBLA 4HW7A 2XBAA 5D7VA 4JOAA 4O0VA 2YZLA 2CPKE 2BPMA 2Y0AA 3BYUA 3C4WA 3CTHA 3AC8A 2JAVA 4NKAA 2DYLA 5DN3A 3FKNA 1TQIA 5DRDA 1OL2A 4UWBA 3SD0A 2XCLA 3ZC6A 2UW7A 4EK4A 4XG9A 3H0YA 1UKHA 3LMGA 2HYYA 4QTCA 2Y8OA 2DUVA 3L9LA 3KQ7A 3I5ZA 4GT4A 2LGCA 4C2VA 3NYXA 3MBLA 4FTNA 4XP0A 1U59A 3RALA 3DZQA 4U5JA 3HP2A 4ANBA 4DFXE 5DR2A 3NYOA 4U45A 4YTCA 4ZTLA 5CAVA 4F99A 5IQFA 3O17A 2R3MA 3ITZA 4C4GA 4LM5A 4I0RA 3HMNA 4ALWA 4NM0A 4RZVA 4Y83A 5L2IA 1ZLTA 4IAFA 4B0GA 3QRIA 4IZ7A 4J53A 4X6QC 3R9NA 5BQ0A 3TUDA 3VPBA 2R4BA 3QZGA 4Z16A 2PZIA 1H1WA 2W7XA 3QF9A 2PK9A 4EOKA 2IZUA 4BCPA 1M7QA 5LWNA 2IVTA 1PXJA 3GU8A 4Y95A 4B8LA 2UW5A 4X3FB 4QOXA 5G1XA 3KK9A 2QU6A 2XYNA 1KV1A 1Z57A 3DS6A 4DGMA 3EQDA 3NVMB 3R5FA 2OWBA 2QD9A 4FZ6A 3GGFA 5IA3A 3EQRA 4FSTA 1WBNA 2QOFA 1XH9A 3UIUA 3CQUA 4H1MA 2CLXA 2VTTA 1KJJA 4P2KA 2W9ZB 2XNMA 2B1PA 1H00A 3PLAE 4CXAA 3S00A 2VO7A 3NAXA 3PXZA 2R7MA 1VYZA 4DT8A 3VF9A 4QPSA 3E3BX 4NTTA 3TDWA 4C62A 4B7TA 4FEWA 1OZ1A 1GOLA 3FXXA 2IVSA 1OUKA 1WFCA 3UOKA 5JGDA 2W6ZA 1ZYJA 2BUJA 4D5KA 2W1HA 1OPLA 3I79A 4W8EA 5G6VA 3UDBA 4M97A 5JH7F 1BX6A 2CKEA 2UW9A 4DGOA 5J9LA 3BLRA 3R21A 3VBYA 1MRYA 4YUQA 3CLYA 1YWNA 2C0OA 2VX3A 3LFQA 4IIRA 3G2FA 1EH4A 5DYJA 4GK4A 4A9YA 3BG5A 3TINA 4O2PA 4O7WA 4RX5A 3FWQA 1J3HA 4C38A 5GJDA 5BPFA 3BHHA 4EHZA 1ZARA 3FYJX 1UA2A 4IVCA 1ZY4A 4K2RA 5CSWA 2QO9A 3IECA 2QLUA 5CU4A 4Y8DA 4JX7A 5EQYA 4EHGA 3AC3A 3DFAA 3U6HA 3LHJA 3MVHA 5HIDA 3G0EA 2VN9A 4J71A 3R9DA 5HBEA 3W2QA 1WVYA 2J9MA 3QALE 3CY2A 4IX3A 2YWPA 2O65A 4XP3A 4YBJA 2XS0A 2YN8A 3Q96A 2E9OA 2G2FA 3A99A 3VN9A 4DGGA 1IAHA 2YRWA 2JC6A 4TKSA 2OK1A 3DV3A 5AM7A 4D55A 4FV6A 4LI5A 1R0EA 4UYNA 3JZFA 3GFWA 2A4LA 3QUEA 1FVVA 1OIUA 2UZUE 4IBMA 2WIPA 2X4FA 4ZY6A 4E26A 3PY1A 4AP7A 5M57A 1KJ8A 5C4LA 4YBKA 4DG3E 5A4CA 2YS7A 5HVKA 1SVGA 3BGQA 2YW2A 1EUCB 3D83A 2B9HA 4BDEA 4ZMEA 3ENHA 4YZMA 2OIDA 3T3UA 2C6LA 2RIOA 3V5LA 5BVNA 5J9ZA 5EW9A 5EYDA 5HO8A 2A1AB 2VTMA 4WD5A 4GU6A 2YCRA 3WF7A 4C4JA 3TN8A 3R5XA 2BKZA 4FFMA 2P4IA 4IAYA 4L43A 3I0QA 4HYSA 4QYEA 3S1HA 3EFJA 4YJRA 3EYGA 4K8AA 2Q0BA 5FQDC 3DGKA 3O8UA 4F9BA 5J5SA 5CVGA 4NUSA 1XH7A 4N57A 1EYZA 3A7IA 3UVQA 2GPSA 5FUTA 2V7AA 4KAOA 3VBXA 4JDHA 4M8TA 4I92A 4L68A 3EFWA 4LOOA 4QYYA 2KTYA 3GU5A 3QCQA 3WF9A 4PMMA 2WTWA 2YIYA 4PDSA 5ETIA 5IQBA 4FKIA 2X6EA 4ANLA 2F7ZE 1PXNA 4AE9A 4BDIA 5ACBC 4DTBA 3B8RA 4YSJA 3E93A 4F6SA 2JFLA 4FNWA 2WYOA 4ASEA 4HVGA 5GONF 3UTOA 4DN5A 4G34A 2JITA 4RVMA 3MYGA 5DHJA 4EH4A 4FNZA 5AIRA 4AT3A 1KBLA 2PVMA 4ZIMA 4MV4A 3G33A 4YP8A 4AN2A 5EKOA 3LPBA 2PMOX 3ORKA 2WPAA 3HV4A 3R22A 1O6YA 4JLCA 1REKA 2R85A 4JXFA 4U7ZA 2C5VA 1URCA 3R6XA 4TPTA 3WIKA 2PUNA 3V5JA 5BVFA 2OH4A 3BE2A 2XKEA 1MQBA 3CTQA 4UB7A 5CLPA 1K3AA 4RWLA 2ITOA 3TIGA 3OC1A 5CF6A 4L1KA 3AC2A 1P5EA 3OWPA 3CY3A 1U4DA 1FBNA 3A7GA 4EGJA 2ETKA 2YFXA 3NW5A 2G2HA 3UP7A 4EKKA 3MWEA 1OL7A 2B7AA 4FTCA 1NT2A 3TIZA 4EHEA 4NM5A 4MXAA 3OWLA 3ZBFA 4LRMA 2X2MA 3OEFX 5EM5A 4C35A 4HPUE 3BWJA 4RVLA 3WF8A 4APCA 2R3PA 5C8YF 1QL6A 1XHAA 3DJ6A 3G9LX 2OGVA 3NYVA 5DLSA 4CFXA 2VX1A 3RCDA 3O23A 3EQHA 2OZAB 2OIBA 1FVTA 2QU5A 1M0TA 2ERZE 5CA0F 3VUIA 1GZOA 3CIKA 4CV8A 4YNOA 4CMOA 3R83A 3POZA 3GI3A 2OO8X 3UVRA 4CKIA 4I93A 5JQGF 1MRVA 4RRVA 4YJTA 4UY9A 2EVAA 3LQ3A 1FQ1B 5AM6A 3CC6A 4RZWA 2GNGA 5E4HA 2PZPA 1PMUA 2X7GA 2XEZA 2XKCA 5AP2A 5EYKA 3TV6A 2XJ1A 4U0IA 1YDRE 3Q3BA 4EHVA 2R7BA 2RF9A 3FL5A 3OEZA 3TUBA 3BLQA 2QOKA 4F7LA 2Z02A 1HCLA 1L3RE 4ZEGA 3DB8A 5HQ0A 4JDIA 4BDBA 3D5UA 3CCNA 3MJ1A 4XP2A 5AIKA 3HV3A 3Q2OA 1L8TA 1OI9A 2YIQA 4M7IA 4IAKA 4O38A 2BILB 5CENA 5AX3A 3KEXA 4XG2A 1NW1A 4L6QA 4O2AF 3BX5A 2CSNA 1QPDA 3GBZA 2XZSA 4OGRA 4D28A 2X2KA 4ZS4A 2WQEA 4CMUA 5LVNA 4AZVA 3QUDA 1SVHA 5HD7A 3HMOA 4XV9A 5LWMA 4C4IA 4OTDA 4FKPA 3WF5A 2O5KA 4DITA 4OTFA 4L3JA 3Q52A 3BQCA 3DJ5A 5KUPA 2R7LA 4FV4A 3D0EA 4A9RA 4WG4A 3ODYX 5D7AA 4XX0B 3ETAA 2PMLX 4DYMA 2Y4IC 3L8VA 2WMSA 3CGOA 1AUVA 4IM0A 3R8VA 2XIKA 2YZNA 1JNKA 4QP3A 4FL1A 3UJGA 5DNRA 5DRBA 4N6ZA 5IDPA 4EORA 5LCJA 3R02A 1Q4LA 5CSXA 4J1RA 3SRVA 1V1KA 3U9CA 2QQ7A 3MY0A 5CEOA 1W93A 4LMUA 3CD8A 5K3YA 5TOZA 4AQCA 4YO4A 4WG5A 5LARA 5CEKA 2GQRA 2WZJA 2Z7SA 3Q1KA 1GJOA 2P0AA 4MD7E 5CQWA 3JRXA 4TNBA 4PDPA 4FV2A 3MSSA 1STCE 3LFBA 2XJ0A 4JRVA 1W83A 4TRLA 3TKUA 4RZQA 4ZOGA 1E1XA 1LPUA 5CWZA 3A8WA 4TZRA 4QP7A 5IA0A 3VS3A 2J0KA 1Q8YA 2ZMCA 2RL5A 4PX6A 4DEIA 5A9UA 4YHTA 4XYMB 3DKFA 4D4SA 1YDSE 2RFSA 2HCKA 3F5XA 1BLXA 2W1IA 3MW1A 5ANIA 2OH0E 1FINA 5C8MA 1O6LA 3VVHA 4N4SA 3QAME 4GUBA 5DR9A 2IP4A 4BDAA 1T45A 3PSBA 3H3CA 4CRSA 4WBBB 2HWPA 3ZMMA 3PE1A 3ZEPA 1M2QA 2C0IA 2GHLA 4TWNA 2R64A 4U80A 4BZNA 4C61A 4JBOA 4F7NA 2WOUA 4EK8A 5M4FA 1OL6A 3FMHA 4GYGA 1Q97A 1AD5A 3JYAA 2CGVA 2R84A 1KWPA 2YM4A 4ITIA 4QMOA 4R7BA 2J5EA 1GSHA 5TF9A 4DEBA 3N9XA 4TXCA 4AN3A 2I40A 2HZ0A 2WD1A 4XYLB 4ACGA 4BCKA 2W5AA 4O83A 5A4EA 2GTNA 1OECA 2ZDQA 1IASA 2W17A 3P08A 3BCEA 4FKJA 4BCIA 4U79A 2BRHA 2PVPA 3N6RA 5JGBA 2V55A 3OUNB 4U40A 3QHWA 2B9FA 2V5QA 4RA4A 4D9TA 2JIUA 3F3VA 2QO2A 2ZYBA 3MA6A 5L3AA 3IDPA 2VTJA 4L9IA 4TYIA 3OD6X 3HA6A 5IA5A 3R8UA 4ZXTA 3R9HA 3PXYA 5TO8A 2BZHB 3ZLWA 4IHJF 2RG6A 3VPCA 2C3IB 1U54B 3NW6A 4CCBA 2F4JA 4ZZNA 2IO6A 3ZM4A 1RJBA 4HGLA 3TIIA 4DE4A 4XJ0A 2I0HA 3UOHA 2UVXA 3K5IA 1H4LA 3DU8A 1FOTA 3FSKA 4JVGA 2OFVA 3PPZA 3FZRA 4RJ5A 4MA0A 5I9YA 1P14A 5L6WL 4Q2AA 3LP8A 3NLBA 2I87A 4JBQA 3VF8A 5AV0A 5FP6A 5AA9A 3PA3A 3BHTA 4O6EA 2PL0A 2X81A 3ALOA 3GC0A 3QQUA 4KINA 3EKNA 5AUXA 2EB3A 3TV4A 4NJ3A 4QMPA 4XZ3B 3KAKA 1O6KA 3GQLA 4PL4A 3VAPA 2C6OA 2GHMA 2AC5A 3Q4CA 3QCXA 4NCTC 3H30A 4M84A 3LXLA 4K1BA 4NZWB 4DFYA 1CS0A 1PX2A 3GIDA 1UKIA 2XEYA 4I22A 4IWDA 3PXQA 5CI7A 4E8AA 4XG4A 1DAYA 3HDMA 2UZDA 2JKMA 4IB1A 4FC0A 3MVMA 4OT6A 4YAJB 2WMUA 3IG7A 2X9EA 5EDPA 1JDEA 2G1TA 4PUZA 3OWJA 4CRLA 1FMOE 5IA2A 3Q04A 5LMBA 1IAJA 4QYHA 5I9VA 4O7NA 3GCVA 5BYLA 3V8SA 2WQNA
chains in the Genus database with same CATH superfamily
1CQJB 3C4FA 5I9WA 2VO3A 4FV9A 4Y73A 5HNBA 2YAAA 1KJIA 3C4XA 3GOKA 4OTWA 4FUXA 2CN8A 4GSBA 4WOVA 4FIEA 2KULA 4NT4A 4YSMA 4AF3A 4OTQA 5IEVA 4QMTA 5AA8A 1C30A 2W6MA 3VA7A 3HDNA 1KE5A 3W0NA 3JY0A 3MB6A 1YI4A 3NCZA 4I3ZA 1ZOEA 4JNWA 2YYAA 1Y91A 3OY3A 1NVRA 2XK8A 4G17A 4CLJA 3UOLA 4F08A 3O7LB 4ZLZA 3NR9A 2FPPB 3SC1A 3D5WA 5IA1A 1FGIA 2OJIA 2VWXA 2ZGIA 1CTPE 3PWDA 1BUHA 5ANOA 3FEGA 3L8SA 1JWHA 2HY81 3VS4A 4F7JA 1EKVA 3FAAA 4M69B 3CEKA 3KA0A 2A27A 4FKSA 3R5HA 2QI8A 4RC2A 3RINA 1AQ1A 3O51A 4FIFA 3MN3A 3A2CA 2VTHA 5IEYA 4IIJF 2QHNA 3NPCA 4YJPA 5GNKA 3VO3A 4RFZA 4DEEA 4EH2A 5J1WA 2CKPA 2VGOA 4ZTQA 3O50A 2AUHA 3VRZA 4AXEA 1V0BA 3FLNC 3NYNA 4RJ3A 5BYYA 1Q24A 4FZAB 4IB5A 2YABA 3OG7A 5DBXA 3VHEA 5IEXA 4UFZA 3KCFA 4BDDA 4EJ7A 1E4EA 4J96A 2VTRA 5C1QB 3UIBA 4ZJVA 1YOMA 3A4PA 3AMYA 3ZZWA 2Z8CA 2J4ZA 3AKKA 3E7VA 3OWKA 4QRCA 2YS6A 4DEAA 3ZLXA 3OT3A 1UV5A 2R5TA 4HCVA 3IW8A 1LEWA 2J6MA 4EK6A 2HDKA 5E9EA 4O6LA 3ATTA 1B6CB 4MV3A 2PVFA 2BIKB 3H4JA 4FR4A 5J7HA 2VTPA 2XANA 3D7ZA 3QKLA 4M9UA 3Q9YA 3JY9A 3ALNA 4BBMA 4MKCA 4CTBA 4C3RA 4FVPA 1ZWSA 3TINA 3JUHA 1GLVA 3RV4A 4R3RA 4O81A 4ZJIA 3R2YA 5BMSA 5CT7A 5DE2A 3R7IA 3UIXA 4UCTA 3FQSA 3P7CA 5HE0A 5BMVF 2XKDA 3RKBA 4XUFA 3OOMA 4BDGA 1WRVA 2CNUA 3MFRA 4O4JF 5EM8A 4I4FA 3GU4A 2IJMA 1PKDA 2AYPA 1H26A 3IS5A 4EWQA 3DBDA 5CS6A 2UZWE 3W0SA 4G5PA 3EN4A 4MXZA 4D4YA 3MDYA 3TM0A 4ZAUA 2PVNA 2BHEA 3KXNA 2WNTA 4O84A 2WGJA 1KV2A 3EL8A 3TMOA 4CFUA 4MHAA 5JFXA 1YI6A 5B2KA 1E9HA 5HU9A 5BPYA 4DG2E 4ZP5A 2VO0A 3EN9A 3W18A 1SMHA 1TQMA 4KBKA 3SGIA 2CLQA 4KBCA 3PRFA 2PSQA 3U9NA 3GT8A 2FPGB 4RBLA 4ID7A 5C4KA 5BYAA 4EYJA 2OF4A 5D9HA 3WARA 2R82A 2PYWA 4EKLA 3FZSA 2PVKA 4LOPA 4FT7A 4QMXA 4W4YA 5CVHA 3E5NA 5CM0A 2C68A 3DDQA 3PJ1A 3FKLA 2W1ZA 5FD2A 3KRWA 1SZMA 4PL5A 3FMNA 3QU0A 3UYTA 4ZLYA 3RM6A 4KBAA 3MIAA 1K2PA 3HL7A 4U44A 4JG7A 5EOLA 3SAYA 1VEBA 3ULIA 4E20A 1A9UA 5JGAA 3G8DA 3O8PA 4RIWB 3F5PA 5L6PA 4O0TA 2QNJA 3BLHA 1PJKA 5C9CA 3W10A 4CKRA 4E5AX 3HX4A 4ASDA 4QMVA 3GLKA 4U41A 5FTQA 4WSYA 4QMZA 2Y4PA 3C0GA 3R7EA 2ITUA 3D5XA 4GIHA 4C33A 5AMNA 3A7FA 5CY3A 3R1YA 4YNEA 2HHFB 1OIQA 3I60A 2W6OA 3BPRA 4U3YA 2IN6A 2WOTA 4BY9E 1SNUA 5AP6A 4PNKA 3WYXA 5HNEA 3OS3A 1I44A 2IW9A 4TV8F 4IAIA 4X3JA 1XBCA 2QO7A 3OROA 4CMFA 3IGOA 1TVOA 4WT6A 1JOWB 4BBEA 1G3NA 4L01A 2C3KA 3U87A 3ZHPC 3QTXA 3EOCA 5HHWA 4EH9A 5HKMA 1Y6BA 2WQBA 3ZDIA 4E7WA 5KBQA 1OKYA 4IC7A 1IRKA 5ANEA 4C0TA 1TA8A 3H10A 4D0XA 5HU3A 3MVJA 4IE9A 4Q9ZA 2QOBA 2PTKA 4ASXA 4DFZE 1W84A 5IDNA 1M0WA 4CG9A 2C6MA 2UZLA 3S2PA 3PE2A 3RUPA 1IG1A 4YB8B 4MNEA 5LVPA 3TZ9A 3EWHA 2YDKA 3FV8A 1I09A 4YO6A 4BRXA 5ITAA 2WMAA 3ZUVA 5DWRA 3THBA 3NUUA 4A4XA 1W82A 4M14A 5BYZA 5KMKA 3O7LD 4BCFA 2ESMA 3AKLA 3ERKA 1IA9A 4M3QA 3VULA 4MXYA 3G90X 3UYSA 4BCMA 1I1MA 5D12A 2X0GA 5DG5A 5IQIA 3W32A 4IJ9A 3A7HA 5KO1A 5J1VA 3FBVA 2A2AA 2CJMA 5CZIA 4HVSA 2GFSA 2W06A 3EFLA 4GK3A 4L52A 4RC4A 2WTKC 4AZWA 4O21A 4BGQA 1XK5A 5AP5A 3TXOA 3MFSA 4O91A 4UX9A 4HYHA 5CB4F 4MEDA 4DFNA 1ET0A 5M09A 5F95A 2ZJWA 4O2ZA 4KSQA 3NW7A 3TIYA 4FEVA 3ID6C 4O0RA 3BAAA 3QXPA 4F1OA 2Z7LA 1XR1A 3E7OA 1PK8A 3G51A 2VTOA 1UU9A 4IACA 5E90A 5L2TA 3T9IA 4TV9F 4RLLA 3H9OA 4RWJA 3KVXA 2J50A 1YHSA 2XCHA 2H96A 3QX2A 3NSZA 2VTIA 2PE0A 3DQXA 4G16A 3UO4A 5DEYA 4F0FA 3VNNA 2ITZA 4I1ZA 2NU6B 3P0MA 2QG7A 2VTLA 3MPMA 5FLFA 3HNGA 3PYYA 3Q32A 3BU3A 3ATSA 2VV9A 4FTMA 2XCKA 3I81A 4PTGA 4U43A 4FOCA 5AUYA 5IF1A 3VUKA 4YJOA 1J7LA 5HX8A 2C5NA 4LOQA 4AFJA 3F7ZA 4CTCA 2BAKA 4EQCA 2DWCA 4MX9A 4MXCA 1BL6A 4FKTA 4FSRA 2NRUA 4I4EA 2HJWA 3W5OA 4HGSA 3O2MA 5LOVF 4O0UA 3AC1A 3UODA 4EQ5A 3SGCA 1YWVA 4QPAA 5T6KA 4KKGA 4V05A 4D1SA 3EQBA 2HELA 5KMOA 5H3QA 5M07A 4FODA 4MV1A 4ZOLF 3E64A 2BDJA 2XNGA 4OTHA 4KD1A 5M06A 5JH6A 3LJ1A 3QC4A 4XX9A 2ITYA 5EDQA 1Z2PX 2WTCA 3NDMA 3OBJA 3KALA 2YHVA 3QD0A 3I4BA 3UMWA 2E2BA 1JBPE 2UV2A 3DQWA 3F88A 3NFFB 2R7IA 4QEBA 3KK8A 2PMIA 1I1KA 2E9PA 3HMMA 3UVPA 1H1RA 3NUNA 4NKSA 2QHMA 3UQGA 3IW4A 5A4LA 4YLJA 4PZ8A 3D7TA 4MA5A 1OIYA 5BWVA 3WOWA 3FLSA 1JPAA 1ZYSA 3HV7A 4FTUA 3DBCA 4FKVA 1ULZA 4TVIA 4ZSLA 4ASZA 4IB0A 1BXRA 4WBOA 4YJQA 3FC2A 1XH5A 4FTJA 5CNOA 1QCFA 4OUCA 1Y57A 4TWOA 4GRBA 4ZTRA 5HTBA 3FMLA 3UNJA 4FSMA 4EZ5A 4FVRA 2ERKA 3WZUA 4E5WA 2PHKA 3NUAA 1VJYA 4I5PA 2YM3A 4R7HA 4BICA 5AV3A 2W70A 2WU7A 4NYEA 4EOMA 3FPMA 4B4LA 4BI0A 3W2PA 4RVTA 4DTKA 3MH3A 3FHRA 5J9YA 2OU7A 3VMMA 3PIZA 2ZB0A 5FPRA 4X3FC 3ZSHA 2H9VA 4ZTHA 4E4LA 2OXDA 2RG5A 1W8CA 4AA5A 1YXXA 3GC9A 3PXRA 5EH0A 3AC5A 3JVRA 4I94A 2YZAA 1H0VA 4WIHA 1ZMVA 2BZKB 4FGBA 4YZCA 4BTJA 3OCGA 3T9TA 2XVDA 5D1OA 1BNCA 1M6VA 3NZ0A 4FSYA 4DF3A 3D5VA 3VHKA 4IANA 2OICA 1GY3A 4NH1A 2C6KA 3VNTA 2PUIA 1VLRA 3F6XA 1ZOGA 4GMYA 4AT4A 2JKKA 3BV3A 1EKFA 2OXYA 3RAWA 1Q5KA 4FEUA 3ELJA 5CEMA 4CVAA 4BKJA 4R6VA 3BWFA 5LOHA 3OUZA 3FMEA 1PY5A 3JVSA 2DWBA 3KULA 2XH5A 2XAOA 5HD4A 3CPCA 2FPIB 3D9VA 4L3LA 2PMNX 1G5SA 2QR8A 3KKVA 3MY5A 5BVEA 4MWHA 3KFAA 3SXFA 3UZOA 3ACKA 5AAEA 2BR1A 4UEUA 3ZS5A 4IAAA 3UG2A 5E8SA 2QB5A 3UPZA 1P2AA 3QRTA 4YURA 2BTSA 3AMBA 5EDRA 3P79A 1ZZ2A 4UYAA 2ITTA 2HIVA 4BDKA 2JBOA 3LJ0A 4OT5A 4X2FA 3LJ2A 5EYCA 3GP0A 3CXWA 1DV1A 4KB8A 2WIHA 4IQ6A 3ZLYA 2YCFA 3ENMA 2X4ZA 3LFEA 3F2NA 3FI2A 3OTVA 3CKXA 1UC9A 5AAGA 3OCSA 1NXKA 4F64A 5JRQA 3NNVA 2YL2A 5I9UA 5M55A 4BZDA 2LAVA 4NCTA 2WMRA 2VTSA 4C36A 2OJGA 2BDFA 2C6TA 4MWIA 3VIDA 4R3CA 5BX0A 3TUCA 2ABJA 4ZK5A 5M4UA 4NW6A 5ANKA 4PZ7A 4O82A 4QSHA 4E4MA 4UUGA 2GFCA 5FXQA 3R8PA 3PP0A 2UW3A 3TI1A 4XV2A 3LXPA 3W2CA 2R3OA 3QWJA 2YDIA 3DAJA 4YC3A 5CALA 1BI7A 3GU7A 4GFGA 2ZM3A 3D2KA 3MFUA 3WWJA 5DPVA 3NNWA 2WB8A 4A9TA 2WMBA 4V0GA 3F3ZA 4I6LA 1GNGA 3AOXA 3MTLA 2H8HA 3UFXB 5BVKA 3R71A 4C59A 4R77A 1PKGA 2V22A 4HNVA 3WZDA 5EHLA 3JZIA 3PPKA 4H58A 4RIXA 5JK3A 2EUFB 5KMIA 4KIOA 4YHFA 1TAEA 5HI2A 4NL0A 5JEBA 4DFLA 5L2WA 5E8XA 3HMPA 3JZ6A 3DBFA 1U46A 4OTRA 3KMWA 4A7CA 4WNMA 3K5HA 2AC3A 2NNWB 4G6OA 3F9NA 3R1SA 4EZ7A 4DLKA 3A8XA 3FQEA 4LG4A 4M68A 2PZ5A 3CR0A 2R3FA 2BRBA 3PIYA 1URWA 4NW5A 3OFMA 4F0GA 4JI9A 3F82A 1HCKA 3QC9A 2W1GA 1H1QA 5A4TA 4IZOA 5I5YA 4DHJA 2ZV8A 4IC8A 4R1VA 2VR1A 1ZXEA 3BYSA 4F7SA 2YERA 3LFAA 3LCKA 3QGWA 4KABA 3HGKA 4HQ6A 4JDJA 5JFSA 5KMJA 5E25A 4G3GA 5CAUA 4B9DA 2QCSA 4PDOA 2XAMA 2GNIA 1H08A 2ZDHA 1F0QA 4HCUA 1DI8A 2VRXA 4FNYA 3TACA 4FV8A 5HNIX 3Q2MA 5FTOA 3WO1A 3BHUA 3ORXA 4N70A 3R8MA 3V01A 3EJ1A 4OR5A 3A7JA 5AV2A 2OLCA 4ZY4A 4CSVA 3BBWA 3FY0A 4ZSAA 2FUMA 3I7BA 3MESA 4ZJJA 3DXPA 5CF4A 5HG8A 2W4JA 4MQ1A 3TT0A 5K3WA 2FH9A 1OMWA 1T36A 3LFFA 5IYZF 4V01A 3I12A 3GVUA 3BL7A 5DR6A 3LMHA 3MPTA 3QQKA 3W0QA 2GU8A 5HCYA 2NYAA 1APME 4ZQIA 3TZ7A 3PUFC 3V8WA 4M0ZA 1LP4A 2W4KA 4KUJA 4YR8A 3L1SA 3RZBA 3T9EA 2R0IA 4X7QA 2UVYA 3HVCA 4RQVA 2WMQA 4FZ7A 3U55A 3L8XA 3LAUA 2H34A 4ZI7F 4FSZA 4CT1A 4LRJA 1XH6A 2HZIA 4I4TF 3PG3A 3EQCA 1LR4A 5ETFA 4Y72A 2QG5A 4FTQA 4JQ8A 2A1HA 2GDOA 3HECA 4FT0A 2OFUA 4TWPA 5AAFA 4BIBA 2PUPA 2R3KA 3LCSA 3U54A 2B52A 2YIWA 4AUAA 3MPAA 5H8EA 4BDFA 5IQGA 3SOCA 2YACA 2GQSA 1OPKA 3W8LA 3HMIA 2JIIA 2HY0A 4W8DA 2VUWA 1OKZA 4QQJA 4CC5A 2V7OA 2W9FB 3MJ2A 4QQCA 2J7TA 4C4EA 1M14A 2O2UA 3FLQA 1SVEA 4IVDA 2JGZA 3BU6A 4LYNA 2CGXA 3ZXZA 2C69A 2XK6A 3PSDA 3TWJA 2XARA 2ZB1A 4ACDA 2HGSA 4FTOA 4J7BA 4IH8A 2IW6A 4G3DA 3SW4A 3HAMA 5E1SA 3FHIA 4KIPA 4E73A 3LXNA 4LL5A 4KIQA 2J0LA 4UCVA 5I5ZA 3FYKX 3CJGA 3EN6A 4FIJA 5DT4A 4MV8A 4ANQA 4FFRA 1WBVA 4DC2A 5CU3A 3VBQA 4DH8A 4AG8A 2CNQA 2PBZA 4NFNA 1YQJA 3IDCA 1CKIA 4RIWA 3IKAA 3W8QA 1YHWA 2GCDA 4CNHA 3DTCA 3K5UA 3IW6A 4ACMA 2XM8A 4C58A 3WWHA 3FE3A 1ST0A 3U4WA 3TTJA 4RGJA 3P23A 4O7ZA 3LCOA 3VBWA 4DTAA 1GZ8A 3D94A 1KOBA 5M44A 1MQ4A 4RIYA 3Q5ZA 4HYIA 1S9IA 4RJ4A 4WUNA 5FBOA 3ROYA 3TNIA 1GIIA 2PVJA 2XK9A 4GT5A 3TKHA 3DNEA 4IHPA 4C34A 2X1NA 1VKZA 5CSHA 4BTFA 1V0PA 2CKQA 3QRJA 3KVWA 4LMNA 1Q8ZA 3UPXA 3DBEA 4DG0E 2W71A 5D11A 4LL0A 2J90A 3MY1A 1RE8A 4QP2A 3W0RA 3ZO2A 1OM1A 4YJVA 1Q62A 3QTRA 3UP2A 3ZFYA 3K3IA 4S31A 3CKWA 4DAWA 3NUYA 4FT5A 2YM7A 1Q8WA 2R3IA 2ZDUA 2V5AA 2PE2A 5IG1A 2X8DA 3KXZA 2QKRA 3FLZA 5JFVA 2ONLC 3VWAA 2R3NA 1WZYA 4MXOA 3NVKI 2CDZA 3QCSA 1DV2A 2GQGA 3ET7A 1CKPA 4AA4A 4B8MA 2HXLA 2UZEA 4KKEA 4EOPA 2OIQA 5EM7A 5IQDA 1CQIB 3DTGA 4MV7A 4TN6A 1REJA 3UZTA 1UU8A 3H0ZA 3R7YA 5LCKA 3TY8A 1DIKA 3Q5IA 4L67A 2HIXA 2OJFE 4FZDB 1Z2OX 1RQQA 2PVRA 3EQFA 3DPKA 1VZOA 3F3UA 1ZMWA 3G8CA 4QP6A 3NNXA 2BKKA 5BUJA 2OSCA 3S95A 2HENA 5A6NA 1XDNA 4M67A 5I5TA 4GV1A 4DDGA 3HYHA 5BVWA 4RA5A 3V6RA 1WBSA 5I60A 5HICA 3O8TA 2HZ4A 3HRCA 4DH3A 4CFWA 3C5UA 4EH3A 3VQUA 3EQGA 5TR6A 3R2BA 1KUTA 3RHXA 3TNQB 3EKKA 2VAGA 2W5HA 2R2PA 4RJ7A 4ANMA 4YGAA 4C4HA 4E4XA 1GAGA 4MXXA 5DH3A 5AADA 3LFDA 1YOJA 3ZO3A 1YXTA 3TNPC 4JG6A 1SNXA 3W1BA 1O9UA 5HLWA 3CSWA 5E8WA 4BCQA 4DEDA 1VBHA 5HESA 1G2WA 2BHHA 3ZFMA 4A07A 5HIBA 1H1PA 5K5NA 4FU0A 4QTEA 3KAJA 3FMMA 3AT2A 2ZDTA 4YZDA 2X2LA 3FZPA 4G6LA 3PP1A 3B8QA 3RHKA 5HIEA 3QZIA 1ZRZA 3P9JA 4O22A 4XG3A 3V5QA 2VWYA 5HV6A 5CASA 1JKTA 2Q83A 3EZVA 3ML1A 3TTIA 3PN1A 3BU5A 4O0SA 3EN7A 2WQMA 3JSNA 3Q60A 5E91A 4S30A 3IPHA 5ICPA 3HRFA 1F3MC 3UNKA 3BRBA 4F6WA 5H2UA 5EYMA 3UE4A 3L9MA 3FDNA 3QD2B 4O0XA 2EJ3A 5KS8A 2COGA 2PZYA 3O0GA 4J97A 5BMMA 4ERKA 2PY3A 3FKOA 3NNUA 3RPRA 5CA1F 5AWMA 3NWWA 5EFQA 5H9BA 4D9UA 3FMJA 3OXZA 3AQVA 4QQ5A 5EHOA 4ACCA 4PL3A 1H25A 3LLAA 4H1JA 4FUYA 2WEIA 1TQPA 4DEGA 1PXIA 1CM8A 1WBPA 3QL8A 4CEGA 3EHAA 3ULZA 3WF6A 3RVGA 2RFEA 4XEYA 4EH6A 2X9FA 5LMAA 3R00A 5H8GA 3WIGA 4E1ZA 1XH8A 4IZYA 4JL9A 4YHJA 3CD3A 2R7KA 1W7HA 3RWPA 4NU1A 2HOGA 5EK7A 3HO8A 5F9EA 3T9CA 2XNEA 5KKRB 1M7NA 2COJA 2PPQA 5FEQA 4DFUA 3RP9A 3P7AA 3ZO4A 2G9XA 4GKHA 4F9CA 1BI8A 3E88A 3OOGA 4D5HA 1B39A 3FXWA 3KL8A 4EUTA 2ZV7A 5FR9A 4G1WA 2C3LA 3BZ3A 3LVPA 3PXFA 2IZTA 3QYZA 4IZ5A 3DTFA 4I41A 4X3FA 4MVFA 2GNJA 4BJJA 4C02A 4X2JA 4G6NA 2IG7A 2UZBA 2CGUA 4LV8A 4NFMA 3OZ6A 4DBXA 4C3FA 4LQMA 1G8JA 4E6NA 3AW8A 2QOHA 3SG9A 2JDSA 2GPHA 5DIAA 5L8KA 3KYHC 4EQUA 3SNOA 3GC7A 4RWKA 4GL9A 3W0OA 5CVFA 4F70A 3COMA 3KF7A 4QYGA 2R86A 4A9SA 3OXIA 1XH4A 5AUUA 4O4LF 3I7CA 5L8JA 4K6ZA 3U4UA 2FSTX 4ACHA 4EONA 3EIDA 4BR3A 1UNGA 2QURA 3HT5A 5JRSA 5CE8A 1KE7A 1PW2A 4L44A 2DZDA 3UNZA 5EZYF 4FKQA 5HVYA 5C1PA 4USDA 3E5AA 1ZYCA 3F3WA 3DFCB 4U97A 2WQOA 4FV3A 4BIDA 2PE1A 2QOLA 5AV1A 3V51A 4CZUA 4V04A 4FA2A 2RGPA 4XG8A 5EQPA 3TW7A 5HE1A 3E92A 4A06A 4F9WA 3ZO1A 2B54A 1XMMA 4KWPA 1PXLA 5CYIA 3UQ8A 3QX4A 1YKRA 4IVBA 4CGAA 2IVUA 2XK4A 1KT8A 5HORA 4D0WA 4O7YA 1IEPA 3HA8A 3PRIA 4FL3A 1FMKA 3V6SA 4AGUA 2Q7DA 1JLUE 3P78A 4LV5A 3UQCA 3LLTA 4JR3A 2B53A 3PJCA 4YMJA 3ORTA 1PMVA 4TYHB 5HBJA 3R73A 3PJ3A 5BVDA 1OKWA 4I55F 4A4LA 4QP8A 1YW2A 2WHBA 4FV5A 4E4NA 4YLLA 3HUCA 3CGFA 3QD4A 4BBFA 4MAMA 5HG9A 3REPA 4CV9A 4DLIA 5HLNA 2YJRA 2JIVA 2O0UA 4PTEA 1SCUB 3C7QA 4ME6A 1Q61A 4J95A 3BBTB 5EI2A 4EYMA 3VS0A 3LCTA 2C6DA 1W96A 4EUUA 4JAJA 5I4NA 4RMZA 4CCUA 2QOCA 3KREA 2ZAZA 1OVEA 2QOOA 2XUUA 3ANQA 3PTGA 3U8WA 3HB9A 4QT1A 2WXVA 4TTHB 4EOJA 4MUQA 4OBPA 3ZC5A 5JFWA 5HX6A 3R7UA 4YPSA 5HTCA 2C1BA 2XP2A 3OVVA 3S3IA 4DCAA 1A06A 4TYJA 5DVRA 3C0IA 5IH4A 4P5QA 2UZVA 3C1XA 1WBTA 4EH8A 4RIOA 5CXZA 3DT1A 4RFMA 3LQSA 5JT2A 4ITHA 2F2UA 4FBXA 3V3VA 4AXAA 2V58A 3RCJA 3W55A 4FSNA 5HE3A 4WUAA 2ZM1A 3FUPA 3DXNA 3TJCA 2I80A 1W98A 4ORKA 5CTPA 1Z5MA 2VD5A 2YAKA 4EK3A 3OUKA 3N8DA 4FX3A 2FYSA 3D15A 4JBVA 4UZDA 3LOKA 3QRKA 5KZIA 2FB8A 4BN1A 2W1EA 2C4GA 3AMAA 4MYGA 3FLYA 4YTFA 5CEPA 3H9RA 3VUDA 2YZMA 5E92A 3BA9A 4Z55A 3QXOA 4Y8VB 3LM0A 2WKMA 3BL9A 2GPWA 1PYEA 2R3JA 3OY1A 4GK2A 5GJGA 4DHIB 1G8AA 3O71A 2W96B 3HZTA 5JQ8A 1IA8A 1XKKA 4FKLA 4FV0A 4G9CA 3ORRA 2AEGA 3ORLA 1W0XC 4FICA 1GIJA 1GZNA 3O96A 4S32A 5HCZA 4DEHA 2JLDA 3Q4UA 3QA8A 2O63A 2QONA 4PQNA 3QQFA 1KE9A 2WTVA 2XIRA 4K33A 3BGZA 4CKCA 4NTSA 2HG8A 5J2UF 1BYGA 3QTSA 3FZ1A 3RJCA 4IWOA 3BYMA 5CAOA 4YTIA 5LMKC 4XCUA 3LM5A 3G15A 5I5SA 1H27A 4IEBA 4XV1A 5H80A 4D2RA 4EQMA 4XLVA 4LGGA 3QGYA 3BIZA 1YXUA 2YISA 3TEIA 5AFVA 1UWJA 4YAKB 3NFGB 1GZKA 3GNIB 3MFTA 1WCCA 2P3GX 4RX9A 1JKLA 4QNAA 4EFEA 4JQ7A 2OZAA 4E6CA 5FPOA 3CSVA 3MH0A 4I0SA 2VQDA 3ZM9A 1Z9XA 3EFKA 1YDTE 2R7NA 4XG7A 5E1EA 4ZHQF 2CFMA 4D2SA 1JVPP 3KC3A 4LFIA 4CFFA 2ITXA 5FXSA 4AAYA 3F2AA 4C5AA 1YXSA 2HW6A 5ANJA 4FG9A 5JQWA 3SRVB 3FI4A 3ANRA 1Q99A 2FVDA 3CBLA 5IZFA 2OZOA 4H3QA 5FP5A 1CE8A 5LP6F 2QF7A 2VWWA 3JRWA 2WAJA 3FY2A 2VTQA 2P2IA 4GIIA 5C8KA 5CAQA 1EHIA 3RR5A 3BQRA 4BB4A 3DNDA 4CKJA 2EXMA 5DGHA 2PU8A 3KMMA 3QLFA 4M12A 3VJNA 2VNYA 3DKGA 3EH9A 4AZSA 4BI1A 4M0JA 3C4CA 3ZLSA 2BRGA 2JDOA 3SDJA