4O86A

Saicar synthetase (type-2) in complex with adp and cdp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-2) in complex with ADP and CDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 75
structure length 227
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o86A01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o86A02
3DK7A 3C0IA 5HVJA 4BCQA 2ZMDA 3QWJA 2ITPA 1TVOA 2XKFA 3NYXA 5BUEA 4IVCA 3WIGA 4FIFA 4O96A 4C4JA 5LVNA 4YO4A 4LYNA 5C1OA 4O2BF 4J8NA 4FV8A 4U40A 3L9PA 2VTQA 4MBJA 4J96A 2BPMA 2UZEA 4V01A 5CEIA 3OY1A 3RWPA 1BMKA 1YHWA 2OI4X 3PWDA 4NH1A 3TTIA 4C34A 4DH1A 4EYJA 2OZAB 5KMLA 5LMKC 4EH5A 4G9CA 1WBTA 2WMSA 4M9UA 4G3FA 4TL0A 2WQMA 3DPKA 5E1SA 4MBIA 5I0BA 4IB0A 4C5CA 2V22A 2IZRA 3F7ZA 3KVWA 3UGCA 3P5KA 3LCDA 1OIQA 3PJ8A 4FE2A 2W1CA 4IZ5A 1RE8A 4LV5A 4EOMA 4O0SA 5HI2A 2VUWA 3O8TA 5J5SA 4GKHA 5LVLA 2WMTA 2QODA 5DG5A 1V0OA 2RG5A 3D5XA 5CVFA 4F0GA 4XCUA 5HLWA 3BLRA 5J1WA 2QHNA 2P2IA 3Q9YA 3V5JA 3GGFA 4YO6A 3CGFA 4O2PA 3HV5A 1REKA 5AP6A 4M68A 3LE6A 3O2MA 4IIRA 5CU6A 2DYLA 2YZGA 2CPKE 2VTTA 4J71A 4USDA 4FSZA 3QZHA 5JKGA 2XNPA 5IQEA 3LOKA 5HIEA 5ICPA 3MESA 3FY0A 4IWDA 4M84A 5EKOA 4EC8A 2UZLA 4Y83A 2YS6A 1GNGA 1JSTA 3CTHA 3SQQA 3P08A 2HZNA 2C68A 2GNLA 2WTJA 4H1JA 1O6YA 2B4SB 1OM1A 3W55A 5HEZA 3DBDA 2O0UA 4DEDA 3RZBA 4RJ4A 5JK3A 3CEKA 1G8SA 3WO0A 3R9NA 2WXVA 2ZDUA 4D4SA 4JR3A 1JSUA 4GG5A 1Q8UA 2WQOA 4O7SA 5IQBA 4FSMA 3ZO2A 4CXAA 3W8LA 1KJQA 4L44A 4NCTA 5KCVA 3GCPA 3PIXA 5AIRA 5FM2A 3D5UA 3FMMA 3T8OA 4ZTMA 3KMWA 3GC8A 5IEXA 1Y8YA 3OBGA 3CQEA 1OUKA 1QMZA 2BZKB 3FMLA 3LQ5A 4GVJA 4F64A 3TNHA 1WCCA 3ALNA 1Y91A 2A1AB 2CCHA 3DB6A 4DH3A 1OBDA 2FYSA 3BWJA 4IB5A 3VUIA 3UVQA 2XBJA 2OG8A 1MRVA 4MH7A 3NVKI 3UIBA 3C4ZA 3G90X 4PY1A 2E9VA 1UU9A 4OBOA 4F7LA 4BCGA 4BDKA 1BLXA 3HLLA 4KIPA 1CQJB 3DF7A 4RJ6A 2RFEA 4IEBA 4W4WA 5GONF 3U9NA 2LAVA 2YEXA 3U6JA 5KO1A 4D4VA 5EW8A 4YBJA 5EFQA 4EWQA 3NUPA 5A4EA 2V58A 2YZLA 3OW3A 5K4JA 2BRGA 3FQSA 4XV9A 1XO2B 1O6LA 4Q5EA 4ANLA 5HO7A 4WBBB 2XYNA 3UODA 4HGSA 3PJ3A 5AUYA 3KEXA 3QX4A 2R7KA 4U45A 5DT0A 3DQWA 1E1VA 4O0WA 3NSZA 2XNEA 4BZOA 1DS5A 3CLYA 3RPOA 4ID7A 4AZVA 3R8ZA 4MNEA 1Y6BA 4HVIA 1ZMWA 2W05A 4JQEA 5K3YA 1FVTA 3RTPA 3W2PA 1XH9A 2JEDA 5CU2A 5EOLA 3U55A 4YURA 5IH5A 2XUUA 1MUOA 2JKOA 3QKLA 4IC8A 2UVXA 4JBOA 4UX9A 3MA3A 2BKZA 3RAWA 4EYMA 5CEMA 3E93A 1ZYCA 3CKXA 2WQNA 3LCOA 4FTNA 3VHKA 2XK9A 4QNYA 3JY0A 5CT7A 3VW6A 2GS7A 4C59A 4IAIA 1GAGA 4LOQA 1IOWA 3CD3A 3QWKA 4YPDA 3R9RA 4MNEB 3R7UA 1AQ1A 3DKOA 4J1RA 2OH0E 4P5ZA 3HEGA 2GQSA 3Q4ZA 4UB7A 5TF9A 3W33A 3WZEA 4FTUA 3OBJA 4DFLA 3E64A 5AADA 5LVMA 5AUWA 4OTWA 1TKIA 4ZTSA 1GSOA 1KUTA 3SAYA 4W4XA 3RFCA 2PZRA 4AW2A 3R23A 1PXJA 4RIWA 3GLKA 3WE8A 4ZQIA 2E9OA 3ACJA 4L7FA 4NJDA 4R3PA 4XOZA 4AT3A 2C6DA 2ESMA 3QCYA 4RWJA 3VAPA 4L3LA 2WOTA 5LYJF 3Q04A 3VHEA 3BU6A 3ATSA 4AT5A 3UC3A 3TKUA 3W8QA 3O71A 1VZOA 1YHVA 4RJ5A 5JGBA 4C4HA 4G3CA 1FGIA 2BZIB 5CF5A 3ORIA 3BI6A 3OP5A 5ACKA 3AD6A 4RPVA 5CSXA 3VMMA 4ZJJA 3CXWA 2QO7A 3WF9A 3WZDA 4C3RA 5CF6A 3UZTA 4JI9A 2C6MA 3CGOA 2HYYA 3M42A 4F7SA 5EYCA 2PVKA 3Q4CA 5HNGA 4G2FA 4YTIA 3RVGA 1JBPE 3GENA 4EOSA 5M09A 4AP7A 4F6UA 4E5AX 2BFYA 1Y57A 4U41A 5A4CA 3DK3A 4BDAA 1U5QA 4NFNA 3T9IA 4JRNA 4D1XA 3FXXA 1PXOA 4F9YA 4RC3A 3TCPA 1EUDB 3MA6A 3NCZA 4P4CA 4QMMA 3UE4A 3HAVA 1BYGA 4RA5A 2VTRA 5E8VA 1PMUA 2WEIA 4JXFA 4L00A 3V6SA 2VGPA 4HVDA 3S4QA 4YJNA 3MFUA 4BBMA 4RA4A 3E87A 4MWHA 4ACGA 4IWOA 4DTKA 2DIKA 1MRUA 4EHZA 2VX3A 1JDBB 3ZLXA 3BHYA 4EH4A 3ZO3A 5KHWA 4IX6A 4M15A 1Z9XA 2X4FA 3LLTA 2B55A 3OWJA 3QRTA 3QQLA 3R22A 2WMUA 1A9UA 2R0UA 4G3DA 2VV9A 4J97A 5D9HA 5EHLA 5CA0F 1KJJA 4S2ZA 4JX7A 3W18A 5EOBA 4ALWA 4DGOA 3MB6A 2B7AA 4HGTA 5IYZF 4FOBA 2C3JA 2IN6A 4GUBA 4O27B 4TY1A 3VS0A 3ZSIA 4I5MA 4JBPA 3A7FA 1PK8A 3OHTA 4EK8A 2GU8A 5TO8A 3Q9XA 3GU7A 4TYHA 5C03A 4DLJA 2I0EA 3IW6A 1P5EA 1T45A 3G9LX 4HCTA 2EB2A 2BIYA 4E4MA 4DINA 2YFXA 1KJ9A 3WARA 2VO7A 4C2WA 3ZEPA 5BPFA 3I5NA 3SG8A 3F5UA 4U0IA 4BF2A 2GNJA 4TWNA 3LZBA 4QMVA 3KXGA 4RLLA 3BHVA 4WG5A 4QQCA 5FBOA 3C5UA 5HO8A 2R85A 3G0EA 1ZYSA 4NJ3A 4CTCA 5BVOA 4WHZA 3A4OX 5DBXA 4ASZA 4G5PA 3PSCA 4YZCA 4PDPA 3QKMA 4GW8A 5LJJA 4QMZA 4EORA 4I41A 2WO6A 3L8PA 3LW0A 4G6LA 1IASA 5B0XA 3UZPA 3EFWA 1K2PA 3WZKA 5HTBA 3VPBA 3AG9A 5L3AA 2XYUA 3BYVA 3DXNA 4YP8A 3FZTA 2PVLA 4IANA 2ZV7A 4L43A 4M69B 4X6QC 3E5NA 2A0CX 2HIWA 3C9WA 5CEQA 5AA9A 4JIAA 5DGZA 1DAWA 3WILA 5HU9A 4HZSA 4AZTA 4G31A 2YACA 2HZIA 3PXRA 4QP4A 3HMPA 4FMQA 4X2JA 4ZSEA 4Y46A 5ETAA 3QALE 4IHPA 2XIRA 4EOKA 1PJKA 2JC6A 4EH8A 2O5KA 3HV6A 3IW7A 5IUGA 4APCA 1UNGA 3DZQA 3ELJA 3EN9A 4XG2A 4DBNA 3ZUVA 5K4IA 4FZFB 4KB8A 3G9NA 3VS4A 4QTDA 5GJFA 3SC1A 2CKEA 5I9WA 2VPQA 4RFZA 3EWHA 4ZJIA 3LFQA 5EQYA 5M53A 4JQ8A 2GS2A 2YYAA 2VTLA 4KSQA 2FA2A 4JT3A 2GNIA 4I4EA 4ZTHA 3V8WA 5BVNA 3R5HA 2GPHA 4XV1A 1Q4LA 3PE2A 3LQ8A 3PZHA 2GHGA 4CLIA 3MFRA 4FA2A 2HZ0A 2JAMA 1PXLA 5FM3A 4FKOA 4XBRA 4TYEA 4C2VA 4EOLA 1J7UA 1FQ1B 1AUXA 3B8RA 5M08A 3BYOA 5CTPA 5DN3A 1VBHA 4FU0A 4ZHQF 3FMEA 4OT5A 3S00A 3QYZA 2FPIB 4MNFA 5HGIA 4M3QA 3FPQA 4EUUA 2W6OA 2ERKA 4HYSA 3CQUA 4L8MA 4RVTA 4IX3A 1GSHA 3R04A 3RPYA 4BCKA 2F7EE 3OZ6A 5IQFA 3SDJA 2CZGA 2C5XA 5CU0A 3LFDA 3PUPA 2XIXA 3CKWA 3OY3A 5HIBA 4FIEA 3F3ZA 3RHXA 4QMXA 3VO3A 5GNKA 5M57A 5ANJA 3C1XA 5E8SA 1OL6A 2C3KA 2XNOA 4IZ7A 1DV1A 4CMTA 3PWYA 3ET7A 2W6NA 4D0XA 4HVGA 3VS7A 4YZ9A 4A06A 3FXZA 2Y6MA 1CMKE 4KD1A 2JAVA 2ZDQA 2VAGA 2RKUA 2BDJA 4JAIA 4BTJA 2O3PA 2W70A 1BUHA 4U80A 5ANEA 4GFGA 2X39A 2KULA 1CSNA 2X7FA 4LGHA 2ZJWA 4EL9A 5I9VA 4ZZOA 3D94A 4ZZMA 3QLFA 4RC4A 2R3RA 3O8PA 5CNOA 3ORRA 4G6OA 4AUAA 2C6TA 4R1VA 4X3FB 4XZ3B 3DU8A 5EI8A 3ORXA 4A9SA 3OOMA 2OF2A 5ANIA 2A2AA 1Q3DA 1Q8WA 3U87A 4CQEA 3OWKA 2YDJA 3R0TA 4F09A 2P2HA 2V7AA 1OL5A 3RI1A 2R3HA 5HVYA 2IO6A 1P2AA 5HU3A 1PXKA 3ZZWA 5BMVF 2WIPA 4A9TA 5KKRB 2YCSA 1AGWA 5AV1A 1ZY4A 3WE4A 2GCDA 4ACMA 3OWLA 4MV3A 4TYGA 3PYYA 1DI9A 1JWHA 3ID6C 4DG0E 4FL3A 4F1MA 4IAFA 5IZFA 2RGPA 3QFVA 3PVGA 1TQPA 4YZMA 3BWFA 1XH8A 3UOJA 3F5PA 4TNBA 3RNIA 5BPYA 3BV3A 3KULA 3O0GA 4Q5HA 1W82A 5AP3A 5EDPA 4KKGA 2IW8A 4TNDA 3U51A 4DFUA 2GDOA 5AP2A 3CPCA 4CRLA 3VUKA 4KS8A 3FSKA 5DOSA 3R9HA 2GFSA 3TW6A 4X6RA 1WFCA 5AP0A 3O7LD 4RFYA 5LCJA 2X6DA 3WYYA 2OFVA 3HKOA 3R6XA 3QYWA 2JIVA 5EQEA 4ITIA 4PV0A 1KV2A 3VF8A 4O4LF 2J5EA 3MVLA 5F4NA 4K0YA 4PDOA 3ZTXA 3KULB 3TV6A 2PN1A 3BHHA 3P7BA 3PXFA 4YJOA 3TWJA 4R1YA 4LMUA 1GLVA 5CT0A 3VA7A 4HPTE 3GFEA 2DQ7X 1GOLA 3ZBXA 3NR9A 2OSCA 4EOJA 2HXLA 2Z04A 3OXIA 3SW4A 2ITNA 2LGCA 3GFWA 3IS5A 5BYYA 2JDSA 4FZDB 4RWLA 5DA3A 1CS0A 5L8LA 4C4EA 2FSMX 4I6QA 4AQCA 2W6QA 1SVGA 4ASEA 3TV4A 3H9FA 3FKNA 3HRBA 5A14A 3PXZA 2R2PA 1J1BA 1YW2A 4WUNA 1JLUE 3WF8A 2F57A 4UEUA 4U6RA 2PE2A 3OG7A 2EB3A 3TI1A 4CFUA 1LEWA 1WBPA 2XNNA 5CI6A 5FTQA 4HYHA 4DEGA 4E6CA 4PMSA 4QMNA 1AUVA 2QOBA 3UOKA 1JAMA 1SZMA 3EN5A 3KC3A 3QC9A 3QRJA 4UYAA 1Z2PX 4U79A 4ANBA 5CXHA 3MH2A 4ENXA 2F2UA 1M52A 2PVRA 2VNYA 3AGMA 4CD0A 4L01A 2Y4IC 5AA8A 3LXKA 4FG7A 3TIGA 5I9XA 3L8SA 2W71A 5IU2A 2C6OA 4QQ5A 2R3QA 2WTKB 3KRWA 4OLIA 3VBWA 3FPMA 5F1ZA 2OXDA 4MA5A 5IDNA 2XK3A 2ZV9A 5B2KA 3ETHA 3OS3A 2X9EA 3R01A 4U7ZA 5DFPA 5M55A 5CU3A 5FP6A 2R7MA 2W6ZA 2PZYA 2WMQA 2PVPA 2WD1A 2R86A 1B38A 2ZM3A 4ZLYA 2H34A 3ATTA 3PP1A 5AMNA 2IP4A 1OB3A 4V0GB 3EH9A 4EUTA 4MKCA 1ZOHA 2ITVA 2Z8CA 4IAYA 4A4LA 1U4DA 4E6QA 4H58A 3BX5A 2CN8A 5IA0A 4ZSJA 4H05A 2UZTA 1OIRA 2A19B 4R7IA 4MV1A 1M7NA 3NVMB 2FB9A 4AFJA 3EOCA 3DOGA 2J0MB 4DLKA 3R1YA 4RX9A 1QPJA 4XRJA 1J1CA 4WNOA 2W5AA 4CSVA 2XCLA 3A61A 3HB9A 5AAFA 4W4VA 4QMOA 4K77A 4B6LA 4NUSA 3ORTA 3Q60A 3WZJA 3KAKA 3KF7A 4EGJA 1OECA 2VD5A 3HUCA 3QGYA 4NW6A 3U9TA 5C1PA 2C5VA 5D11A 4DGLC 3SW7A 2HGSA 4PDSA 4E73A 4YR8A 3FLQA 4FEQA 3U9SA 5M07A 2I0VA 4M12A 1W93A 1QCFA 5GINE 4LG4A 5CSPA 4BDHA 4WRSA 5E8XA 5HCXA 1G8AA 5M06A 3EJ1A 2VWBA 1R3CA 3MS9A 3OC1A 4EC9A 5HX6A 5LVOA 1WR2A 4XG7A 2YM3A 3QQFA 4N57A 4RJ7A 4FVPA 2HJWA 3BBWA 5DIAA 3K54A 3KMMA 4DAWA 5I9YA 4O7VA 4YZNA 4I6FA 3VQHA 2VTIA 4FZ6A 2UW4A 2VO3A 4KKEA 4IAZA 2XS0A 1UU7A 4L67A 2XNGA 4DG2E 4X2FA 4MQ2A 3ORPA 4D2RA 4A4XA 2X8IA 4FT3A 3E7OA 1YDTE 3UO4A 3QQUA 5M4CA 2CMWA 2V55A 2DZDA 1PMEA 3FUPA 3I4BA 4U97A 1SVEA 1GZKA 3OMVA 4I1ZA 4FFRA 2OIBA 4D4YA 4KBCA 2HOGA 3I7CA 4ZK5A 4AS0A 3K5HA 4MTAA 3ZUUA 2BHEA 4TWOA 4CT1A 1M17A 3OVVA 5ACBC 4JG7A 5BNJA 3AT4A 3EFLA 2UW0A 3IPHA 4G1WA 5FEEA 5HQ0A 4L52A 2IZUA 3BHUA 4GT3A 4WSYA 4IB1A 2OH4A 3FMDA 3DDQA 1UKHA 1H00A 4A9RA 3A60A 4BDEA 4I3ZA 5KZ0A 5JH7F 5J9LA 2C5NA 2BZHB 3QQGA 4DT8A 4JR7A 3QTXA 2I8CA 2CCIA 1NA7A 3BKBA 3RPSA 4L9IA 5KE0A 5H80A 1PHKA 4FSRA 4WOVA 5C8MA 2CGUA 4DEBA 3NNUA 5D7AA 2CNQA 5AX9A 4JQ7A 3R83A 3V01A 1DI8A 5LP6F 3FKLA 4BCIA 5AEPA 2W6MA 2RG6A 3GOKA 4ORKA 3HP2A 3F66A 3RGFA 1KSWA 2CJMA 3AT3A 4WBOA 4AW0A 4YJ2F 1M6VA 5L8JA 3LKMA 2WNTA 2PVNA 1PYEA 2GFCA 2ITUA 2HWOA 4KAOA 3F3UA 3H0YA 3UIMA 3BELA 1PX2A 4W4YA 3NUSA 2ZOQA 2QU6A 2Z7SA 1OITA 3KXXA 4U42A 3G8CA 3UYTA 3LWBA 3GU4A 3R63A 5AUVA 4PQNA 2RFNA 4TN6A 3HA8A 5K9IA 1NT2A 1A06A 4IM2A 3ROCA 4K8AA 4RQVA 4Y5HA 5HE2A 4RIWB 4YC6A 3NAXA 3VS2A 5DPVA 2KTYA 4D55A 3HMOA 5JRQA 4IX4A 2OO8X 5A9UA 1ZLTA 2BALA 4DGGA 1M0WA 4RJ8A 3NNVA 3PY0A 5F95A 2NRUA 4ZI7F 2BTSA 5KUPA 3KK8A 2Q0NA 3ZOSA 2UVYA 3I6UA 3EHAA 2I0YA 5JSMA 3R30A 3JPVA 4IADA 3SXSA 3A2CA 2DUVA 1F0QA 2PZ5A 3ZC6A 1ND4A 3PXQA 4CFWA 5M44A 2QLUA 2R3JA 4FL1A 4J98A 2PMLX 3LJ2A 2VWYA 4JIKA 4UWYA 4B99A 4LUEA 1C30A 4KRDA 3IOKA 3TM0A 5C27A 2RFSA 1BX6A 4EOQA 5AV0A 3Q2JA 4QP2A 5C8KA 5I9ZA 5CZIA 2W96B 4JNWA 3ZM4A 2ERZE 4YZDA 4F4PA 4NYEA 2B1PA 5FLFA 1GGOA 1ZMUA 2JKKA 3SXRA 5CAPA 3QQKA 5D8DA 4I5HA 4DYMA 3OTVA 4CFVA 1Y6AA 1Q8TA 3D15A 5CU4A 5H9BA 3BU3A 4JDHA 2YM6A 2EUFB 4AZWA 2QNJA 4O82A 2C3IB 2OZOA 3V8TA 3UBDA 5HE3A 2XK4A 4QYYA 3VBXA 2XK7A 3KRLA 2OK1A 4HOKA 5CZHA 4F7NA 1NVRA 3BGZA 1XH5A 2QC6A 3IKAA 3ZHPC 4AN2A 2BMCA 1VEBA 2XRWA 3A7IA 3R02A 5AV4A 3JZFA 3O23A 1H1PA 1PKGA 2C5OA 4FV3A 2B53A 2P4IA 4FFOA 4FEUA 2DLNA 2WPAA 2R87A 2VWZA 1OPLA 2ONLA 2G2HA 1T46A 4FNWA 5A4QA 2FP4B 2VTHA 1DAYA 2P3GX 1YXXA 2ITTA 3F69A 5DT4A 1E4EB 3R9OA 3UO6A 3PZEA 1PY5A 3BZ3A 2C69A 4LOOA 5IH6A 4RX7A 4YC3A 4FTOA 4WBNF 5DHJA 2WTKC 5E8WA 3LXPA 1OL2A 3R7IA 2B9IA 2PL0A 2BROA 4BCMA 4BGQA 3HUBA 3VOTA 4FKVA 2W1DA 3I1AA 5FXRA 1EUCB 4MAOA 1K9AA 1KWPA 3QCXA 5FGKA 1WBNA 4PNIA 4AGCA 3AXWA 3BG5A 3WOWA 3LMIA 3NIEA 1E4EA 3VPCA 4QOXA 1HOWA 4D28A 1OL1A 4EH3A 3TXOA 2REIA 3A99A 4C36A 3HMIA 5LXTF 1KC7A 4FR4A 5ANDA 2QOLA 5TOZA 4CFFA 1C3OA 4AGUA 2X2LA 4WIHA 2FPPB 1A48A 4G34A 3PPJA 1VR2A 4O0XA 2QOFA 5CVHA 3A4PA 4Z7GA 5L2TA 4HGEA 4U44A 3QTUA 3ZLWA 2R4BA 1J7IA 2HXQA 3IW5A 4C4FA 2IZTA 3LPBA 3DTCA 1J7LA 1J91A 2XCHA 3MY1A 3QA8A 5GJDA 5A54A 1JDEA 1QL6A 2NPQA 4IJPA 5CSHA 1WMKA 2UZBA 4WA9A 4F1OA 5HLNA 4LMNA 5DR9A 4FTRA 4YBZB 4D4RA 5EM5A 3QFFA 1M2QA 2GHMA 3QU0A 1FINA 3BBTB 1DM2A 4AE6A 2PULA 1YI3A 3ZXTA 4F0FA 4B7TA 3MBLA 2QK4A 1B39A 2X4ZA 3Q52A 2GS6A 3OTUA 2I80A 2YERA 4CKIA 2B52A 3R2BA 5A4TA 5JVDF 4YJQA 3UNZA 2I1MA 3IDCA 4J53A 4BCFA 4ANMA 3FL5A 4OTRA 4FKRA 4GK3A 2XRUA 4USFA 3EB0A 4M97A 5LWMA 3PPZA 1QPCA 5CQWA 3G8DA 2PU8A 4QMSA 1OKVA 4ACDA 3V4ZA 4C37A 4CZTA 3R1NA 3U6IA 5JH6A 4BKJA 1UKIA 2VTAA 5HD7A 3TUDA 4K6ZA 4YJ3F 2B9FA 1JPAA 1APME 5CF4A 2QQ7A 5KNJA 2Y6OA 4O7WA 4FT5A 4LFIA 4ZY4A 1YWNA 4NW5A 4ERKA 4G3GA 4JDIA 4FIHA 3AC1A 5C8NA 4XG4A 5L2IA 5KX5F 5HE1A 4IAAA 3VF9A 3HV4A 4O7YA 5KKRC 3FBVA 4Z9LA 3BHTA 3R1SA 4I21A 1ZYDA 4JOAA 4CMUA 5JFWA 4YNOA 4IBMA 5BVEA 2R64A 1UA2A 3ORLA 3QBNA 2XKDA 4CRSA 3FC1X 3DLSA 4PL3A 5EM8A 5HBJA 5GIOE 3EQPA 4RG0A 1H0VA 4UWBA 4CFNA 3POZA 3JRXA 4I92A 3G6GA 1LR4A 2JGZA 2R0IA 3E8EA 3KGAA 3PY3A 5E1EA 2YZMA 5E8ZA 4FV5A 4CNHA 5BQ0A 4XG9A 3R2YA 2OXXA 4M14A 5ETFA 4L7SA 3OCGA 3G33A 2VTPA 3MH1A 4S31A 2X81A 5KZIA 3E8CA 3VBVA 4HGLA 3DS6A 3ZFYA 5I9UA 3C13A 4EQUA 2P0AA 2F7XE 3TJDA 3TZ7A 2OU7A 3RM6A 3QTSA 4FK3A 4H3PA 4EH6A 5LOVF 4FKUA 2GNFA 2H9VA 2VGOA 3HGKA 3RCDA 3OEZA 5JFVA 3DGKA 3E5AA 3HP5A 1ZWSA 4QYGA 1REJA 3KN6A 2IPXA 4IAKA 2HW7A 2XNBA 3D14A 3TZ8A 3MPMA 5H8EA 5JGDA 4U8ZA 2WTDA 3A8WA 3EYGA 4YC8A 2GNGA 5IF1A 1U54B 2WMBA 2PWLA 5HHWA 3E3PA 2ZV8A 5AV2A 3RAIA 4O22A 3VJNA 4IFCA 1OZ1A 4WUAA 4R78A 5C9CA 2G2FA 2QOHA 2X2MA 3Q4UA 3QXPA 5FD2A 3RAKA 3VNTA 3RALA 5AUZA 2PPQA 2FSTX 3OUKA 2PZPA 1GIJA 3TUBA 2OIQA 1Q61A 4UZHA 4YGAA 2OF4A 1MRYA 2W1EA 3LCSA 4GFMA 3QA0A 1YDRE 4G16A 3VS6A 3GI3A 4Q2AA 2J0JA 5DNRA 3U54A 2XIYA 5IEYA 3QRUA 3PVBA 1ZRZA 3Q4TA 3D7ZA 3PRIA 2V62A 4WNPA 1M7QA 2XJ1A 3EKNA 3T3VA 1HCKA 1ZARA 3LFEA 3PXYA 5IA4A 3VBTA 2I6LA 3DNEA 4FIIA 5FDXA 3CBLA 3LFCA 3KL8A 5FNVF 1Q5KA 3NW5A 1YXSA 3SHEA 4EH7A 4I6BA 4JDJA 5CEKA 3GBZA 1FMKA 5FXSA 4F9AA 2BZJA 4AA0A 5IG1A 5L8KA 2QOOA 3D2KA 1WVWA 3W10A 4EHEA 3FMNA 4R3CA 1OPKA 1YKRA 2R9SA 2XEZA 4YJTA 2R5TA 3FSFA 3KN5A 5CWZA 5HBHA 3VW8A 2Y4IB 5C26A 1H28A 4YTHA 4O38A 4QO9A 3V8SA 3MB7A 1OMWA 4ALUA 4F6WA 4QQTA 2W1ZA 3EQRA 3D9VA 3DT1A 4NWMA 4MX9A 4DGMA 5A4LA 3UNKA 2J7TA 3GCUA 1YXVA 2ZVAA 4FSNA 3R8MA 4I23A 3SRVB 3L9MA 3ULIA 3G51A 5LQFA 3NZ0A 3ZYAA 1BL6A 1XH7A 2VZ6A 2BAKA 3PJ2A 3NW6A 4JG6A 5IUHA 4EONA 5I4NA 1QPEA 3TDWA 4K11A 2O63A 3R73A 3NDMA 4RIYB 3MTLA 3UIUA 4TV9F 4X3FA 2C1BA 2WQEA 4IVBA 4WT6A 1Z57A 4Y8VB 4YJUA 2HY81 4E20A 3LAUA 4MXOA 5M4IA 3OCTA 4ZTLA 4I6HA 1WVXA 2Z7RA 4OR5A 4QP9A 2ETKA 4BCHA 4FG8A 3DK6A 1DIKA 4FFMA 4FTAA 2VO0A 5A6OA 1W8CA 2CGXA 4EKKA 4PMPA 4BRXA 2C0OA 5IQHA 5CAVA 5IA1A 1I44A 3OT8A 4LL0A 4F9BA 4I22A 1WVYA 2WMXA 2YIXA 5E7RA 3IOPA 4R5SA 4BCNA 3MV5A 1H8FA 4ZP5A 2WAJA 4RZWA 4ZSLA 2R7IA 2WFYA 3R7EA 4ZXTA 3UZRA 5KX8A 2EXMA 3R9DA 5CYIA 5KMOA 2CNVA 3QUPA 2YN8A 4AE9A 4BIEA 4E26A 4J52A 5LXMA 4E5BA 4XS2A 2ZM1A 2OWBA 3N8DA 3FMJA 4E7WA 4ZY5A 3R8UA 3I5ZA 3NUNA 4YZBA 5KMKA 2QG7A 5CASA 2DS1A 2OJJA 4Y72A 4GT5A 4DCAA 4HZRA 4C38A 4EGQA 2UUEA 1KBLA 4YJRA 3O51A 4L3JA 3Q96A 2ZV2A 4FKWA 3UPXA 3EIDA 2OLCA 3DA6A 4AFEA 3K3PA 5DR6A 4V05A 3H4JA 3WBLA 3DXPA 4L6QA 4EI4A 4DIMA 4GYGA 2XH5A 3ROYA 4TRLA 2FPGB 4YB8B 4GIHA 4DN5A 2CNUA 2OIDA 2PUPA 4FEVA 5IUIA 4N6ZA 4DT9A 1WAKA 3AC4A 4R5YA 4FEWA 1PKDA 2GTNA 2SRCA 3R7OA 5AM6A 3PG3A 5H8BA 4FSYA 4BI2A 5CENA 4FC0A 3V04A 3ZU7A 1K3AA 5FUTA 3PIZA 4AW1A 3MDYA 4BDGA 5BMMA 4YJVA 4IWPA 3NUUA 4MCVA 3P86A 3BE2A 3AC3A 1SNXA 3EKKA 4Y95A 2YIQA 3R7YA 4CGAA 3AC2A 5HBRB 3R21A 2NO3A 2JKMA 3FWQA 3O8UA 3C4CA 4GT4A 1U59A 2OJ9A 3IDBA 2JLDA 4WNMA 4AG8A 1F5QA 4P90A 4ANQA 5HTCA 3HECA 3HAMA 5EDQA 3CP9A 3D83A 3BV2A 3EQHA 3JVSA 3KFAA 3ORKA 3GC7A 4BTMA 1W84A 4QTEA 2IWIA 2CSNA 1SCUB 1URCA 3ORNA 3C0HA 3PPKA 2EVAA 5JFSA 4LRMA 2VTNA 5AFVA 1SVHA 3O17A 3COKA 2X0GA 1FMOE 3FZ1A 4BZNA 4QYEA 4WG4A 4O81A 3SX9A 4MD8E 5HD4A 1KE8A 4UWCA 4R6VA 4J7BA 1ZYJA 4GCJA 3P7CA 2NU9B 2BRBA 3KCKA 4K33A 3GU6A 2G15A 3FKOA 3NW7A 5DT3A 1XJDA 1Z2NX 2G1TA 1M14A 4TW9A 5H2UA 3M11A 3DKCA 4GK2A 2XM9A 2OJFE 3IW4A 5M51A 3QD3A 3SLSA 3MWEA 5BVWA 3A8XA 4YPSA 1PMVA 5AV3A 4U81A 5IMEA 1ZY5A 4AGDA 1M2PA 5DLSA 1BI7A 4C58A 3F82A 4FSQA 3KREA 3ORMA 3D5VA 4RIXB 4V0GA 3PLAE 5GIPE 3EL8A 1U5RA 2PVJA 2QG5A 3Q9ZA 2GSFA 3GU8A 4FK6A 1JVPP 1KE9A 3W2RA 4HW7A 3NMUF 4DH7A 4G6NA 4DG3E 3FY2A 2XJ0A 3AOXA 3AMAA 4ZJVA 2QKRA 4WO5A 3H0ZA 3W32A 2QI8A 4DEAA 5DEWA 1XWSA 4FKTA 4GV1A 5DRDA 2O65A 4CKJA 3HDMA 3VWAA 2X8DA 4O0TA 3QX2A 4ITHA 3KRRA 1PYXA 3DKFA 3ZDUA 3ZH8A 3UOLA 2OW3A 3HNGA 3P1AA 5E8TA 2ITWA 3KK9A 5BPHA 4GL9A 2QO2A 4P5QA 2V0DA 3ZO4A 3TIZA 4M0ZA 5BUJA 3Q2MA 5CALA 4O86A 3BLQA 5CF8A 4F7JA 2X2KA 3HDNA 3P7AA 5J95A 3VBQA 4CCUA 1OGUA 3ZRMA 4ZMFA 2NRYA 4QTCA 3O50A 3UPZA 5GJGA 4YLLA 5IQCA 2X7OA 2QR8A 1JKTA 4ANSA 2CKPA 2J2IB 3EQBA 4EJ7A 2BAQA 3F3TA 1JNKA 3QTWA 2F9GA 2UZVA 5J7HA 4ME6A 3UP2A 1QPDA 5BMSA 4U5JA 2W06A 2QLQA 2VTMA 5EW9A 4XMOA 5K5NA 3E3BX 1UWHA 3VS3A 5CXZA 2UZWE 3PSDA 4UZDA 4Q9SA 3FI2A 3P23A 4XV3A 4QTAA 4EZ7A 1SMHA 1R1WA 4BB4A 2A4LA 1H25A 4I50F 5FEQA 2GQRA 4FNYA 2C1AA 4DEEA 4BTFA 2VQDA 3EYHA 1JOWB 4IM0A 4QMQA 5FXQA 4CEGA 1ZZLA 3AC5A 1PMNA 3L8VA 3LMGA 1VJYA 4KBAA 3MY5A 3QKKA 4GRBA 3CS9A 5HICA 4X7QA 1PXMA 2GNHA 3PG1A 4F63A 4FKPA 3PA5A 2XIZA 4FTIA 4NZWB 3DTWA 1BNCA 4XYMB 2B9JA 3I0OA 3HVCA 2PZIA 2Z7QA 1UNLA 3WZUA 2X1NA 3MWDA 4O4HF 4Y73A 5KKNB 1NVSA 4NK9A 4R77A 1R0PA 2XBAA 1CTPE 4FZ7A 5TT7A 4HCVA 4RRVA 5D1JA 3E88A 1X8BA 3K5UA 3L9LA 3E63A 3D5WA 2QO9A 3QQJA 3LLAA 1BXRA 5JN2A 5EI2A 5CSWA 3H30A 3I12A 3OOGA 1FVRA 4KKHA 3HV3A 4QMWA 5FP5A 5H3QA 4EHGA 5CEPA 1W83A 2ONLC 4MWIA 5I5ZA 3DNDA 3H10A 2WTCA 5DE2A 3NUAA 5EDRA 3S1HA 4IHJF 3GP0A 1YOJA 4W8DA 1WBSA 4DFXE 3OUUA 3NEWA 4ACCA 1GY3A 4OW8A 5E91A 1W0XC 2YM5A 3NIZA 2YRXA 2YM8A 3A7HA 3VJOA 4QP3A 5E8UA 3KKVA 4I5PA 4TKSA 4XV2A 5L6WL 3UYSA 3UDBA 1XH6A 3QL8A 3ZM9A 4C4IA 2OBJA 3E8DA 2PHKA 2UZUE 2ITZA 4MXYA 3OFMA 1Q8YA 4IVDA 4D0WA 4BBFA 2WB8A 2YRWA 4QSHA 4PRJA 5AUXA 4XYLB 4C61A 4G9RA 2BKKA 3TJCA 2UW6A 4N0SA 4KA3A 4ZAUA 4XX0B 5FBNC 2J4ZA 5A3XA 4ZZNA 2PK9A 3IGOA 4EWHA 3AC8A 4O83A 4YSJA 2YIYA 3L1SA 4JX3A 5CAEB 2WU6A 4PP7A 2UVZA 5JRSA 4ZOLF 3PFQA 3OWPA 3ZBFA 4QYFA 3BLHA 2JITA 1IR3A 3F9NA 3SOCA 3F7WA 4GK4A 2IJMA 4QP6A 2WTIA 2YM4A 5IA5A 2XA4A 1V0BA 3DBFA 5HLPA 2QU5A 2VN9A 3R8LA 1AD5A 4CMOA 3DY7A 1W98A 3EN4A 4ACHA 3GT8A 4PTCA 3NYVA 2VX1A 4LUDA 4DLIA 2BDFA 4IW0A 5C8YF 4YTFA 4FVRA 5CS6A 4FTJA 2GMXA 2O8YA 2X0SA 4I94A 5L2WA 3AGLA 4RT7A 1LEZA 5AM7A 4LGGA 4GFOA 4MV8A 4JL9A 1URWA 1Q62A 2C30A 3CR0A 3W2OA 1UNHA 3LFSA 3ZDIA 1STCE 3K2LA 3OROA 5D10A 4TYIA 4FT0A 3WF7A 4I24A 5FEDA 4JBVA 3VBYA 2WMWA 3KXZA 3QZIA 4IDTA 3NUXA 4N4SA 5CLPA 4G3EA 4WG3A 2J0KA 3MIYA 3P0MA 4R3RA 5AP4A 3DJ5A 4CCBA 3JRWA 3SE7A 3PJCA 2HELA 4NL0A 1KE7A 3ITZA 4ZIMA 4GJ2A 4I20A 2R3OA 4X3FC 4FV0A 4HJOA 2E9UA 1R78A 5F9EA 4OTGA 4QRCA 2QKWB 3MFTA 3HZTA 1MP8A 4YMJA 5IEVA 1ZZ2A 1ULZA 3ANRA 1V1KA 4TPTA 2YCQA 2R3IA 1XR1A 3V5QA 4DGNA 2R3FA 3TQTA 2W1FA 5B2LA 5HG8A 2BTRA 3W2SA 4APPA 3LCTA 4PMTA 3ODZX 3TKIA 1UWJA 3ERKA 1VBGA 3FZOA 3QHRA 2ITXA 5IDPA 2W0JA 2ETRA 4I0TA 3VUMA 4EZ3A 3HMNA 2G01A 3KF4A 4II5A 3COIA 4ITJA 1IRKA 3CJFA 5E90A 4X2NA 5C1QB 2VWIA 2EWAA 4YSMA 3FAAA 1Q99A 5CSVA 1OKYA 2C3LA 3LXNA 3MVMA 3QTQA 2HZ4A 4K18A 1KJIA 3RV3A 3OXTA 1RJBA 4L1KA 2O2UA 2BUJA 1H4LA 3PA3A 4UN0C 2R7LA 4QMUA 2I87A 3WI6A 1MQ4A 3NNWA 1SM2A 4UYNA 4C3FA 2F49A 2XD4A 3UFXB 2VWWA 3TIYA 2C6IA 2PTKA 3MGYA 3Q9WA 3B2TA 3EFKA 4F08A 3VQUA 4GEOA 4MVFA 4FX3A 5J2TF 4C5BA 4XH6A 5BYZA 3ZLYA 5IA2A 3CY3A 2Y0AA 4XLIA 1GZ8A 3PTGA 5LARA 3F2AA 3FHRA 2GPWA 3S3IA 2C47A 3Q3BA 4E6AA 4OTHA 1OIYA 2IVTA 3TZMA 5AUTA 4AZFA 1TQMA 4XBUA 2W4OA 5AJQA 2Z60A 4CVAA 5C4KA 5CANA 3V5PA 3W2QA 1SYKA 2J5FA 1IAJA 3BGPA 4XLVA 5D41A 4L46A 4XP3A 4AOJA 2PE0A 3V5TA 3JXWA 2V59A 4EK3A 4XG6A 4CLJA 4D2SA 4JJRA 4I5CA 3VULA 4FNXA 4YLKA 1XBBA 4BCOA 1DV2A 2QURA 2YDIA 4XYFA 3GQLA 3ZUTA 5HX8A 3VS1A 2YJRA 5BX0A 3GUBA 5LCKA 5KHXA 4IJ9A 2YABA 3RM7A 3R5XA 2W9ZB 4ZS0A 1Q41A 3C50A 4TWCA 3PSBA 5AP7A 3BGQA 2VTOA 5CX9A 4D5HA 4MHAA 4XEYA 5LMAA 3ZXZA 4BIBA 5IQGA 2R7NA 2C5YA 2R3LA 4O6LA 5C01A 4XNEA 3C4WA 3CPBA 3FDNA 1BL7A 4C33A 4G17A 3FZRA 3ACKA 2XNMA 4ZOGA 3FLSA 4AW5A 4X2KA 3SXFA 1PF8A 3MY0A 3DZOA 3ZRKA 4H3QA 5HCZA 3VUGA 4AOIA 3H3CA 3T3UA 2BDWA 3UMXA 3ZONA 4D9UA 4PX6A 3S2PA 4ENYA 2WHBA 1JKJB 3WYXA 1ATPE 2ITQA 3GU5A 3E7VA 4QP8A 4ZLZA 4GKIA 4FIJA 1JKKA 2NNWB 3KMUA 3CTJA 4RX8A 4C4GA 4HNUA 3KAJA 2QVSE 1E9HA 4BDFA 3K3IA 2HWPA 3D0EA 3MJ2A 4L3PA 4NIFB 4QTBA 4CZUA 5LWNA 1GIIA 2JKQA 3FLZA 4BC6A 5KMIA 4EKLA 3VRZA 4DFNA 4MV9A 3NS9A 4IWQA 2XKCA 3N4TA 2NP8A 2UZOA 5T6KA 3ORZA 3UQGA 2ZDHA 5JQGF 3CTQA 3EQGA 3QLGA 4C0TA 1FVVA 4GS6A 3LCKA 2ITYA 3UVPA 3EQIA 2WEVA 2CLQA 3NX8A 5AP5A 4AACA 3HL7A 1U54A 3KU2A 2YISA 3VRYA 1NXKA 2A27A 5FG8A 5LA6F 1FBNA 3L8XA 3EQDA 2BFXA 5IQIA 3SV0A 2I0HA 2W7XA 1S9JA 3UC4A 2X7GA 3VUDA 5JT2A 1OBGA 4CT2A 3FLWA 3PY1A 5EM7A 2HCKA 5HESA 3KVXA 4QT1A 5T3QA 4WRGA 4O84A 2E9NA 2G9XA 4ZSAA 4K9YA 4S32A 5KMMA 1YXTA 3JVRA 3IQ7A 3RWQA 2WQBA 3FMKA 4CTBA 5L2SA 4DHFA 4HNTA 1O9UA 3COHA 4F9CA 5IMXA 1ZMVA 2ZAZA 3AMYA 1KV1A 4IZAA 4BDCA 3UMWA 5LOHA 2JDRA 4BY9E 2HAKA 2HENA 3LFFA 3OEFX 1JLLB 2X9FA 1WBOA 2CKOA 1P14A 3GB2A 3EFJA 3O96A 2ZB0A 3QUDA 3DV3A 3IO7A 2UW5A 3TNQB 1H24A 5KMJA 5C4LA 2FUMA 4ARKA 3F3VA 3DDPA 4NSTA 4Y85A 4UXLA 4PF4A 3ZMMA 5FTGA 2BVAA 4IZYA 5IQAA 2JIIA 3S95A 1FGKA 4FV9A 3N4UA 3FLYA 4FTCA 1IAHA 1Q97A 2YZAA 4FKLA 4J95A 4CKRA 2CGVA 4U3ZA 1CKPA 3VIDA 2RL5A 2W99B 3ENHA 4GVAA 3VC4A 4D5KA 4B4LA 4RQKA 3UVRA 4IM3A 5KBQA 2R3PA 4ZSGA 3MYGA 4ZEGA 5HG7A 4BHNA 2EU9A 2IW9A 2CLXA 2VWVA 3F2NA 4BDIA 4FIGA 5E4HA 4YUQA 1J3HA 3OW4A 2XF0A 2BAJA 3MN3A 4A9UA 4S30A 4BN1A 4MAMA 4YU2A 4K1BA 2JDTA 3JZIA 1PW2A 3ZEWA 1JKLA 3R8VA 3DBCA 3E62A 1IG1A 2E9PA 4KINA 3V6RA 2Q0BA 4A4OA 4J99A 2B0QA 5DVRA 2P55A 3FL4A 2YJSA 3RPVA 3NYOA 1VYZA 2VNWA 3MJ1A 3OCSA 4O7LA 2VWUA 1OKZA 3QD4A 3NPCA 4BR3A 3R71A 4ALVA 5KMNA 4O0UA 4MD7E 1NVQA 2DWBA 3W16A 3IG7A 4P7EA 3V51A 4GYIA 2WIHA 3WO1A 1BI8A 2C0IA 2I40A 3II5A 4ASDA 4EQCA 4MQ1A 4IVAA 4MYGA 5HNBA 2PVHA 3QQHA 3RHKA 5BYLA 4B0GA 2YAKA 3NAYA 2BCJA 3D2IA 4I55F 5HKMA 3R1QA 3K3JA 1PXIA 1FPUA 4KS7A 5EG3A 1CKIA 1ZOEA 2QHMA 4LRJA 2PSQA 5CAOA 4AN3A 1F3MC 4BTKA 3DB8A 2GQGA 3IDPA 4C3PA 2ZB1A 4JBQA 4BDJA 1YVJA 1KOBA 3G15A 2C00A 2WOUA 3KXNA 3REPA 4MK0A 1NY3A 4TT7A 5BVFA 2XM8A 4MD9E 5JMSA 3Q32A 1PXPA 4AU8A 3QD2B 4RC2A 4QPSA 3UQCA 3LJ1A 5EHOA 4PTGA 2RF9A 3MH0A 2Y9QA 4LM5A 2VTSA 5M56A 3I7BA 4BI1A 4BYIA 4DA5A 2HY0A 5JQ8A 3E8NA 2BILB 3Q6WA 4FL2A 1LP4A 2UW9A 3LHJA 3N4VA 3QCQA 3G2FA 4NM0A 3IECA 5L6PA 3KB7A 2OZAA 2XCKA 3BQCA 4QMLA 1H1QA 5CNNA 3RCJA 5JEBA 5K5XA 2GPSA 3Q5IA 2WTWA 3N51A 1G5SA 4PDYA 4PTEA 3VUHA 3OF0A 4AWIA 2UW7A 4RVKA 3PA4A 2YIRA 3ALOA 1H08A 3FYJX 1Q3WA 5FRIA 2O64A 4OT6A 4FG9A 3DCVA 5F94A 3ORQA 2WU7A 1B6RA 4WNKA 1PXNA 3Q6UA 1U46A 3F5XA 4B8MA 1RQQA 3FEGA 4CG8A 4DEIA 2YS7A 2JD5A 4RBLA 3JS2A 3PP0A 3ULZA 4UY9A 2W1HA 2OFUA 4I93A 4XP0A 1IA9A 3BU5A 4DF3A 4CFMA 4OGRA 4FOCA 4MV7A 1EH4A 3BE9A 4N70A 4X0MA 5EYKA 4A7CA 3TNPC 3PIYA 4YLJA 1UVRA 1ERKA 5ANGA 4UV0A 1S9IA 4H39A 3LM5A 4FV7A 4S34A 3G0FA 3FC2A 4KIQA 4C7TA 2GTMA 4WKQA 4OTFA 3V5LA 4F0IA 4O7NA 2JFMA 4FSUA 4BCPA 4YHTA 5LVPA 4AT4A 4L42A 4EQMA 1P4FA 2X8EA 2C4GA 1Y8GA 4GU6A 3CE3A 3WF5A 4AF3A 3FZPA 4XG3A 2QOCA 4EH2A 3RPRA 4FFLA 2PVYA 2XIKA 4RIXA 3TL8A 4F1TA 3QHWA 3PVUA 1YWRA 4EOPA 4YHFA 3RMFA 4UXQA 4BICA 4IMYA 4EH9A 5ITAA 3B2WA 4YAJB 3P79A 4FVQA 2PY3A 2XMYA 5AIKA 4TYJA 3ZO1A 2IVVA 2P0CA 4C35A 2R3NA 1YRPA 3CD8A 3C4XA 3LVPA 3GNIB 1YOLA 5D7VA 2W9FB 4HCUA 4IDVA 4AOTA 4I4TF 2AYPA 1Q24A 1W7HA 4E1ZA 3SKCA 4GH2A 5HG5A 3FQHA 2YCRA 4O7TA 4O0VA 4O6EA 4E93A 1B6SA 3BYUA 4YJPA 4LQMA 3RJCA 3KRXA 4V04A 2OJIA 3UO5A 3QRIA 3ZFXA 2C6LA 5AUUA 3H9OA 2YM7A 4KABA 3LM0A 1GZNA 2YIWA 3BYMA 3W2CA 4D9TA 4ZTRA 4RJ3A 4C62A 5BUIA 4FICA 2CN5A 1UU3A 3LFBA 4RFMA 5BVKA 3Q5ZA 3EZRA 4LV8A 3TEIA 4EOOA 4IH8A 2V5AA 1T36A 3F61A 3LMHA 1H0WA 1EZ1A 3PJ1A 2YWVA 3TTJA 2F4JA 4KWPA 3P9JA 3UP7A 4FT9A 5IPJA 3TKHA 2QF7A 3GQIA 2QD9A 1H07A 2GLTA 2FO0A 5CAUA 4HVSA 5A46A 2Y8OA 3TINA 2BIKB 3GXLA 3I0QA 3VS5A 4F70A 2ZM4A 2XB7A 4O7RA 3EN6A 3TT0A 3UNJA 3HRFA 1OKWA 4FNZA 3GIDA 4HNFA 4OUCA 1WZYA 3A62A 2YITA 5AAGA 5G6VA 3C51A 2Y4PA 2QOQA 3LFNA 3BEAA 4ZMEA 3AMBA 2XK6A 3G6HA 4FKQA 4ZTQA 5HIDA 4YAKB 5ETIA 4EOIA 3MI9A 2UZNA 3F5GA 2PUNA 2J9MA 2WELA 4H1MA 3QCSA 4FTKA 3FYKX 4OTDA 4DITA 1CE8A 2C6EA 1B6CB 2C0TA 2VWXA 5H8GA 4ZY6A 4XX9A 4Z3VA 2R7BA 2NU7B 3I6WA 3TNIA 4QMPA 1NW1A 1Q8ZA 1MQBA 1O6KA 2R3KA 3FZSA 4J8MA 3POOA 4LRKA 4CFXA 3QZFA 2NU8B 4C5AA 4QYHA 5JQWA 3LJ0A 3QAME 3HYHA 5F20A 3OCBA 3DJ7A 3DAEA 3VN9A 4UALA 3MWUA 3P4KA 2AC3A 3F88A 3C5IA 2IVSA 2BHHA 4MXCA 3BEGA 4R7BA 5AWMA 3M1SA 2JBOA 3NGAA 2PUUA 4L45A 4NM3A 4NM7A 4R7HA 2CDZA 2J51A 4WD5A 5HG9A 3RAHA 4DH8A 3H9RA 3NWWA 4RVLA 3UTOA 4X21A 5JQ5A 1ZAOA 4XUFA 4D58A 2Q83A 4KSPA 2UZDA 4YTCA 4AXAA 3TN8A 2W6PA 4E6DA 4BZDA 4DFZE 3EQCA 1HCLA 3RK7A 3ZSHA 5EKNA 4RVMA 4L68A 3QD0A 4P2KA 4MXZA 1KEEA 1XBAA 4TWPA 3U4UA 3ZZEA 3MVJA 4F9WA 4U43A 5CEOA 4O0YA 4AZSA 1OL7A 2CHLA 4W8EA 4H36A 2WMAA 4ZTNA 3R8PA 4DH5A 5CVGA 3D7TA 2YHVA 2W1GA 1YI4A 2R84A 3R5FA 5EK7A 4DCEA 3DJ6A 2V5QA 4MBLA 3R7VA 1UU8A 3GCSA 4EG0A 2P33A 4AA4A 2PE1A 2H8HA 4XHKB 2JFLA 2QOIA 4KRCA 2CGWA 3FMHA 4IACA 3I60A 3QTZA 1KJ8A 4FYNA 2OLSA 5JZNA 3BIZA 3PRFA 3EZVA 1E1XA 1KOAA 5TKDA 4YJSA 2OGVA 3MPTA 4AX8A 5HCYA 3KA0A 2H6DA 4AZEA 2J50A 2X6EA 4DFYA 3TG1A 3CIKA 5HORA 3HV7A 3TNWA 3SG9A 4BIDA 2XP2A 4A07A 1I7NA 2ZDTA 3OUZA 1YHSA 4O91A 4A9YA 2NU6B 3TIIA 1Z5MA 3GCVA 3D7TB 4XP2A 4JRVA 3PVWA 1V0PA 4BDDA 3RUPA 5DMXA 3MH3A 2Z7LA 5E92A 4BI0A 4XRLA 4DC2A 4NTSA 4EBWA 1H27A 5DYJA 5EYMA 4NFMA 2V7OA 3C7QA 4FEXA 4Y5QA 4X3JA 5ANKA 4AA5A 4RX5A 2QOKA 1JKSA 1CM8A 3R00A 4RGJA 5B7VA 4FGBA 5EHYA 5BVDA 1H1WA 2JDOA 3E92A 4QMTA 5JZJA 3GCQA 5CB4F 2QONA 3PE1A 3MFSA 3FE3A 4O7ZA 3C0GA 4PNKA 1Z2OX 4QNAA 3KY2A 3QC4A 3GEQA 5HNIX 3KCFA 1IOVA 2VTJA 2WTVA 3QTRA 3NYNA 3RV4A 4RWIA 4D1SA 3DQXA 4KUJA 1UV5A 3FV8A 5DH3A 5HV6A 4TYHB 3CY2A 5AP1A 2G2IA 3MVHA 5DRBA 3UIXA 4FGRA 5CQUA 5M4UA 2OJGA 3OUNB 4ZS4A 4DTBA 4BGGA 2FGIA 1KE5A 4LL5A 1SNUA 4EZ5A 2PUIA 4GMYA 3UG2A 4HNIA 4O21A 3RINA 5T68A 4K2RA 2ACXA 3Q1KA 1M2RA 4PL5A 1ZXEA 4PWNA 4RLKA 3CCNA 4GJ3A 4AAAA 2FSLX 4QPAA 2AUHA 3S0OA 2JIUA 3IONA 3TV7A 3JY9A 4Q9ZA 3I81A 4FKSA 1H1RA 2XEYA 5EI6A 4E4NA 5FTOA 3V4SA 1WBWA 1H01A 3FJQE 5LMBA 3Q53A 3QXOA 3BCEA 2XJ2A 3NRMA 5E8YA 3U8WA 1OI9A 3CC6A 2W17A 4MXXA 1JSVA 5G1XA 3U4WA 4QP7A 4OTQA 1GJOA 5IQDA 4FFPA 2OICA 1GSAA 4FKGA 4U9AA 3C4EA 3FXWA 3UQFA 4QP1A 3ETJA 2ITOA 2J0LA 2BR1A 3BRBA 3UG1A 4FZAB 1ZOGA 2J9GA 3AT2A 3GC0A 1OIUA 2IG7A 4JLCA 3G5DA 3UOHA 3MW1A 3HRCA 4FV4A 2YAAA 3KQ7A 5CI7A 4B9DA 4BGHA 3THBA 2R3GA 1L3RE 5CA1F 4FBXA 4FV2A 2OXYA 4EK4A 4IB3A 4MF1A 5TR6A 1M0TA 2WZJA 1YXUA 2J0IA 3JR1A 4NU1A 3WF6A 2AC5A 3KALA 2XVDA 4M7IA 3W1FA 4ZLOA 4DFBA 4X2GA 3ZS5A 1XKKA 2I7QA 1P4OA 4GSBA 2W4JA 3LIJA 3ETAA 3DLZA 4FUYA 4DE4A 4HYIA 5JVLA 3DFCB 3EN7A 2FB8A 3JYAA 2PVFA 1I09A 3R28A 4AGWA 2UW3A 3TUCA 5DR2A 5DWRA 3EL7A 5EH0A 4CV8A 4FKIA 3ZRLA 3T9TA 4AN9A 5IH4A 4FSTA 3TZ9A 4E8AA 4USEA 3PXKA 3F6XA 4PL4A 5J8IA 5EM6A 3GVUA 3NCGA 2JDVA 4ERWA 3MPAA 5A6NA 5HZNA 2FVDA 4RMZA 5KBRA 3ZLSA 4E5WA 4PMMA 4CG9A 3NUYA 5EQPA 5JGAA 2PMIA 3NNXA 4TTHB 4IX5A 4BVUA 1YWVA 4NKAA 4FTMA 2F7ZE 1H1SA 3FHIA 3K5VA 4D1ZA 4HVHA 3SA0A 1LPUA 4FV1A 4CV9A 3RK5A 4BCJA 3AD5A 4F6SA 2FSOX 5HBEA 5JFXA 1CKJA 4O4IF 2J90A 4FKJA 5IISA 4MEDA 3PLSA 5IA3A 4MA0A 4F99A 4NCTC 2DWCA 4NM5A 3QGWA 4LOPA 5J87A 4JG8A 4XOYA 1CQIB 5CAQA 4FFNA 4Z7HA 3F3WA 3HO8A 2W5BA 3HX4A 3DBEA 3D4QA 1XHAA 3NLBA 4O2AF 2PYWA 1H26A 2PMNX 4XG8A 5D12A 1EYZA 4RZQA 3V5WA 4IIJF 2BRHA 1GIHA 3ZC5A 3RP9A 1I7LA 4C02A 3QTIA 4RWKA 3MJFA 3BQRA 4JDKA 2W5HA 4PP9A 2WYOA 4E4TA 4JS8A 4EJNA 1KE6A 4IZOA 3B8QA 2Y7JA 2YDKA 4QMYA 4HQ6A 3SD0A 2QR7A 2YW2A 1IEPA 3I79A 3EQFA 1R0EA 2PVMA 3OD6X 3LP8A 3TACA 2CKQA 2XKEA 3IW8A 5GHVA 2WMRA 1OVEA 4M0YA 4MV4A 3C4FA 5AX3A 4MXAA 3RK9A 3K5IA 1YDSE 2IW6A 2UW8A 3WNZA 2B54A 3ZSGA 4JVGA 3HA6A 1EHIA 4FUXA 5FQDC 3VVHA 2R82A 4HPUE 4FTLA 4FTTA 3OT3A 4ONAA 2BRMA 3AW8A 2ZMCA 3HMMA 3COMA 3DFAA 4E4LA 3ZCLA 5LMKA 3LQ3A 3HBLA 2VRXA 4HNVA 3CQWA 3DKGA 3OXZA 3PDTA 5J9YA 2YZNA 4S33A 3P78A 2PMOX 1WBVA 2WKMA 4GU9A 4XJ0A 5CY3A 4BHZA 1OPJA 4UBAA 3QF9A 3CSVA 3MTFA 3DBQA 3FLNC 4OBQA 2C6KA 3SGCA 2F2CB 4BDBA 2SCUB 3SOAA 1BKXA 3FI4A 3GC9A 3IGGA 4GG7A 4IE9A 4M67A 5B2MA 3BYSA 1W96A 5HVKA 3KXMA 2ETMA 3ZFMA 4F65A 3MSSA 3DAJA 2W4KA 5EW3A 3V3VA 3QZGA 4IC7A 1YQJA 5EZYF 5ETCA 1XBCA 1YOMA 1L8TA 3SRVA 4JAJA 3L9NA 1IA8A 4I0SA 4O2ZA 3AQVA 3ODYX 2FH9A 3MIAA 2XZSA 3IK3A 4I4FA 5L6OA 2YCFA 3LXLA 5EYDA 3ANQA 5AAEA 2HK5A 3DXQA 5J1VA 4B8LA 4TUYF 1TQIA 2WGJA 4QQJA 1FOTA 4OTIA 4U3YA 4LI5A 3AX6A 4PUZA 2IVUA 4FODA 3FQEA 4IQ6A 5DEYA 4TV8F 4RIYA 2RIOA 4NT4A 4M13A 1RDQE 1YI6A 2XK8A 1XH4A 5DI1A 3FI3A 2ZYBA 4DBXA 5E9EA 3EMGA 3CJGA 4FYOA 4G5JA 4BYJA 4MV6A 4BBEA 3N9XA 4RIOA 5FDPA 4FTQA 4RSSA 4GIIA 4EK6A 4FI1A 3SVVA 1VKZA 4FSWA 4N6YA 2VR1A 3ENMA 3WIKA 2GHLA 4FT7A 4EHVA 2VO6A 2ZDGA 2VU3A 4NTTA 2YL2A 2NUAB 2EXCX 4YNEA 4L53A 5ANOA 4EEVA 2J6MA 1GZOA 4TXCA 3F2RA 1JQHA 4KBKA 3JUHA 1OUYA 1RW8A 3KRJA 3O7LB 2R3MA 4HR7A 4KNBA 4OBPA 4IFGA 3U9CA 3BPRA 3DAKA 4H3BA 1PRYA 2RFDA 4RZVA 4HYUA 1XQZA 3U6HA 1A9XA 2PBZA 2H96A 4KIOA 1CDKA 2WMVA 2YA9A 3QUEA 4I0RA 4DEHA 4FV6A 4DTAA 1G3NA 2JBPA 3QRKA 4O0RA 4Y8DA 2B9HA 4EBVA 3AD4A 3RKBA 3LFAA 2Z2WA 4YBKA 4Z55A 3KXHA 4Z16A 3A7JA 3A7GA 4YHJA 1R39A 4O4JF 5J9ZA 2QCSA 5J2UF 1VYWA 2Z02A 2IZSA 4GUEA 5M4FA 3M2WA 4ASXA 3Q2OA 2OKRA 4TZRA 4EK5A 2BRNA 2UV2A 2E2BA 2YWPA 1LUFA 2W1IA 3FI8A 4E4XA 4M8TA 3TDVA 5HE0A 2VX0A 2HW6A 4NKSA 3N6RA 3GOPA 3UJGA
chains in the Genus database with same CATH superfamily
3DK7A 3C0IA 5HVJA 4BCQA 2ZMDA 3QWJA 2ITPA 1TVOA 2XKFA 3NYXA 5BUEA 4IVCA 3WIGA 3UDZA 4FIFA 4O96A 4C4JA 5LVNA 4YO4A 4LYNA 5C1OA 2EJ3A 4O2BF 4J8NA 4FV8A 4U40A 3L9PA 2VTQA 4MBJA 4J96A 2BPMA 2UZEA 4V01A 5CEIA 3OY1A 3RWPA 1BMKA 1YHWA 2OI4X 3PWDA 4NH1A 3TTIA 4C34A 4DH1A 4EYJA 2OZAB 5KMLA 5LMKC 4LH6A 4EH5A 4G9CA 1WBTA 2WMSA 4M9UA 4G3FA 4TL0A 2WQMA 3DPKA 5E1SA 1S68A 4MBIA 5I0BA 4IB0A 4C5CA 2V22A 2IZRA 3F7ZA 3KVWA 3UGCA 3P5KA 3LCDA 1OIQA 3PJ8A 4FE2A 2W1CA 4IZ5A 1RE8A 4LV5A 4EOMA 4O0SA 5HI2A 2VUWA 3O8TA 5J5SA 4GKHA 5LVLA 2WMTA 2QODA 5DG5A 1V0OA 2RG5A 3D5XA 5CVFA 4F0GA 4XCUA 5HLWA 3BLRA 5J1WA 2QHNA 2P2IA 3Q9YA 3V5JA 3GGFA 4YO6A 4AQKA 3CGFA 2HVRA 4O2PA 3HV5A 1REKA 5AP6A 4M68A 3LE6A 3O2MA 4IIRA 5CU6A 2DYLA 2YZGA 2CPKE 2VTTA 4J71A 4USDA 3AKLA 4FSZA 3QZHA 5JKGA 2XNPA 5IQEA 3LOKA 5HIEA 5ICPA 3MESA 3FY0A 4IWDA 4M84A 5EKOA 4EC8A 4UCTA 2UZLA 4Y83A 2YS6A 1GNGA 1JSTA 3CTHA 3SQQA 3P08A 2HZNA 2C68A 2GNLA 2WTJA 4H1JA 1O6YA 2B4SB 1OM1A 3W55A 5HEZA 3DBDA 2O0UA 4DEDA 3RZBA 4RJ4A 5JK3A 3CEKA 1G8SA 3WO0A 3R9NA 2WXVA 2ZDUA 4D4SA 4JR3A 1JSUA 4GG5A 1Q8UA 2WQOA 4O7SA 5IQBA 4FSMA 3ZO2A 4CXAA 3W8LA 1KJQA 4L44A 4NCTA 5KCVA 3GCPA 3PIXA 5AIRA 5FM2A 3D5UA 3FMMA 3T8OA 4ZTMA 3KMWA 3GC8A 5IEXA 1Y8YA 3OBGA 3CQEA 1OUKA 1QMZA 2BZKB 3FMLA 3LQ5A 4GVJA 4F64A 3TNHA 1WCCA 5I60A 3ALNA 1Y91A 2A1AB 2CCHA 3DB6A 4DH3A 3P5JC 1OBDA 2FYSA 3BWJA 4IB5A 3VUIA 3UVQA 2XBJA 2OG8A 1MRVA 4MH7A 3NVKI 3UIBA 3C4ZA 3G90X 4PY1A 2E9VA 1UU9A 4OBOA 4F7LA 4BCGA 4BDKA 1BLXA 3HLLA 4KIPA 1CQJB 3DF7A 4RJ6A 2RFEA 4IEBA 4W4WA 5GONF 3U9NA 2LAVA 2YEXA 3U6JA 3CEBA 5KO1A 4D4VA 5EW8A 4YBJA 5EFQA 4EWQA 3NUPA 5A4EA 2V58A 2YZLA 3OW3A 5K4JA 2BRGA 4EFBA 3FQSA 4XV9A 1XO2B 1O6LA 4Q5EA 4ANLA 5HO7A 4WBBB 2XYNA 3UODA 4HGSA 3PJ3A 3NBZB 5AUYA 3KEXA 3QX4A 2R7KA 4U45A 5DT0A 3DQWA 1E1VA 4O0WA 3NSZA 2XNEA 4BZOA 1DS5A 3CLYA 3RPOA 4ID7A 4AZVA 3R8ZA 4MNEA 3UDTA 1Y6BA 4HVIA 1ZMWA 2W05A 4JQEA 5K3YA 1FVTA 3RTPA 3W2PA 1XH9A 2JEDA 5CU2A 5EOLA 3U55A 4YURA 5IH5A 2XUUA 1MUOA 2JKOA 3QKLA 4IC8A 2UVXA 4JBOA 4UX9A 3MA3A 2BKZA 3RAWA 4EYMA 5CEMA 3E93A 1ZYCA 3CKXA 2WQNA 3LCOA 4FTNA 3VHKA 2XK9A 4QNYA 3JY0A 5CT7A 3VW6A 2GS7A 4C59A 4IAIA 1GAGA 4LOQA 1IOWA 3CD3A 3QWKA 4YPDA 3R9RA 4MNEB 3R7UA 1AQ1A 3DKOA 4J1RA 2OH0E 4P5ZA 3HEGA 2GQSA 3Q4ZA 4UB7A 5TF9A 3W33A 3WZEA 4FTUA 3OBJA 4DFLA 3E64A 5AADA 5LVMA 5AUWA 4OTWA 1TKIA 4ZTSA 1GSOA 1KUTA 3RNYA 3SAYA 4W4XA 3RFCA 2PZRA 4AW2A 4JMQA 3R23A 1PXJA 4RIWA 3GLKA 3WE8A 4ZQIA 2E9OA 3ACJA 4L7FA 4NJDA 4R3PA 4XOZA 4AT3A 2C6DA 2ESMA 3QCYA 4RWJA 3VAPA 4L3LA 2WOTA 5LYJF 3Q04A 3VHEA 3BU6A 3ATSA 4AT5A 3UC3A 3TKUA 3BABA 3W8QA 3O71A 1VZOA 1YHVA 4RJ5A 5JGBA 5BYAA 4C4HA 4G3CA 2X5RA 1FGIA 2BZIB 4PBCA 5CF5A 3ORIA 3BI6A 3OP5A 5ACKA 3AD6A 3DTGA 4RPVA 5CSXA 3VMMA 4ZJJA 3CXWA 2QO7A 3WF9A 3WZDA 4C3RA 5CF6A 3UZTA 4JI9A 2C6MA 3CGOA 2HYYA 3M42A 4F7SA 5EYCA 2PVKA 3Q4CA 5HNGA 4G2FA 4YTIA 3RVGA 1JBPE 3GENA 4EOSA 5M09A 4AP7A 4F6UA 4E5AX 2BFYA 1Y57A 4U41A 5A4CA 3DK3A 4BDAA 1U5QA 4NFNA 3T9IA 4JRNA 4D1XA 3FXXA 1PXOA 4F9YA 4RC3A 3TCPA 1EUDB 3MA6A 3NCZA 4P4CA 4QMMA 3UE4A 3HAVA 1BYGA 4RA5A 2VTRA 5E8VA 1PMUA 2WEIA 4JXFA 4L00A 3V6SA 2VGPA 4HVDA 3S4QA 4YJNA 3MFUA 4BBMA 4RA4A 3E87A 4MWHA 4ACGA 4IWOA 4DTKA 2DIKA 1MRUA 4EHZA 2VX3A 1JDBB 3ZLXA 1TFFA 3BHYA 4EH4A 3ZO3A 5KHWA 4IX6A 4M15A 1Z9XA 2X4FA 3LLTA 2B55A 3OWJA 3QRTA 3QQLA 3R22A 2WMUA 1A9UA 3L2PA 2R0UA 4G3DA 2VV9A 4J97A 5D9HA 5EHLA 5CA0F 1KJJA 4S2ZA 4JX7A 3W18A 5EOBA 4ALWA 4DGOA 3MB6A 2B7AA 4HGTA 5IYZF 4FOBA 2C3JA 2IN6A 4GUBA 4O27B 4TY1A 3VS0A 3ZSIA 4I5MA 4JBPA 3A7FA 1PK8A 3OHTA 4EK8A 2GU8A 5TO8A 3Q9XA 3GU7A 4TYHA 5C03A 4DLJA 2I0EA 3IW6A 1P5EA 1T45A 3G9LX 4HCTA 2EB2A 2BIYA 4E4MA 4DINA 2YFXA 1KJ9A 3WARA 2VO7A 4C2WA 3ZEPA 5BPFA 3I5NA 3SG8A 3F5UA 4U0IA 4BF2A 2GNJA 4TWNA 3LZBA 4QMVA 3KXGA 4RLLA 3BHVA 4WG5A 4QQCA 5FBOA 3TMOA 3C5UA 5HO8A 2R85A 3G0EA 1ZYSA 4NJ3A 4PZ8A 4CTCA 5BVOA 4WHZA 3A4OX 5DBXA 4ASZA 4G5PA 3PSCA 4YZCA 4PDPA 3QKMA 4GW8A 5LJJA 4QMZA 4EORA 4I41A 1CKOA 2WO6A 3L8PA 3LW0A 4G6LA 1IASA 5B0XA 3UZPA 5BWUA 3EFWA 1K2PA 3WZKA 5HTBA 3VPBA 3AG9A 5L3AA 2XYUA 3BYVA 3DXNA 4YP8A 3FZTA 2PVLA 4IANA 2ZV7A 4L43A 4M69B 4X6QC 3E5NA 2A0CX 2HIWA 3C9WA 5CEQA 5AA9A 4JIAA 5DGZA 1DAWA 3WILA 5HU9A 4HZSA 4AZTA 4G31A 2YACA 2HZIA 3PXRA 4QP4A 3HMPA 4FMQA 4X2JA 4ZSEA 4Y46A 5ETAA 3QALE 4IHPA 2XIRA 4EOKA 1PJKA 2JC6A 4EH8A 2O5KA 3HV6A 3IW7A 5IUGA 4APCA 1UNGA 3DZQA 3ELJA 3EN9A 4XG2A 4DBNA 3ZUVA 5K4IA 4FZFB 4KB8A 3G9NA 4CC5A 3VS4A 4QTDA 5GJFA 3SC1A 2CKEA 5I9WA 2VPQA 4RFZA 3EWHA 4ZJIA 3LFQA 5EQYA 5M53A 4JQ8A 2GS2A 2YYAA 2VTLA 4KSQA 2FA2A 4JT3A 2GNIA 4I4EA 4ZTHA 3V8WA 5BVNA 3R5HA 3SNOA 2GPHA 4XV1A 1Q4LA 3PE2A 3LQ8A 3PZHA 2GHGA 4CLIA 3MFRA 3WWIA 4FA2A 4CMDA 2HZ0A 2JAMA 1PXLA 5FM3A 4FKOA 4XBRA 4TYEA 4AAYA 4C2VA 1J7UA 1FQ1B 4EOLA 1AUXA 3B8RA 5M08A 3BYOA 5CTPA 5DN3A 1VBHA 4FU0A 4ZHQF 3FMEA 4OT5A 3S00A 3QYZA 2FPIB 4MNFA 5HGIA 4M3QA 3FPQA 4EUUA 2W6OA 2ERKA 4HYSA 3CQUA 4CKEA 4L8MA 4RVTA 4IX3A 1GSHA 3R04A 3RPYA 4BCKA 2F7EE 3OZ6A 3TYKA 5IQFA 3SDJA 4DHJA 2CZGA 1ST0A 2C5XA 3LFDA 3PUPA 2XIXA 3CKWA 5CU0A 3OY3A 5HIBA 4FIEA 3F3ZA 4CMFA 3RHXA 4QMXA 3VO3A 5GNKA 5M57A 5ANJA 3C1XA 5E8SA 1OL6A 2C3KA 2XNOA 1I1KA 4IZ7A 1DV1A 4CMTA 3PWYA 3ET7A 2W6NA 4D0XA 4HVGA 3VS7A 4YZ9A 4A06A 3FXZA 2Y6MA 1CMKE 4KD1A 2JAVA 2ZDQA 2VAGA 2RKUA 2BDJA 4JAIA 4BTJA 2DABA 2O3PA 2W70A 4GLXA 1BUHA 4U80A 5ANEA 4GFGA 2X39A 2KULA 1CSNA 2EJ2A 2X7FA 4LGHA 2ZJWA 4EL9A 5I9VA 3SGIA 4ZZOA 3D94A 4ZZMA 3QLFA 4RC4A 2R3RA 3O8PA 5CNOA 3ORRA 4G6OA 4AUAA 2C6TA 4R1VA 4X3FB 4XZ3B 3DU8A 5EI8A 3ORXA 4A9SA 3OOMA 2OF2A 5ANIA 2A2AA 1Q3DA 1Q8WA 3U87A 4CQEA 3OWKA 2YDJA 3R0TA 4F09A 2P2HA 2V7AA 1OL5A 3RI1A 2R3HA 5HVYA 2IO6A 1TAEA 1P2AA 5HU3A 1PXKA 3ZZWA 5BMVF 4TM5A 2WIPA 4A9TA 5KKRB 2YCSA 1AGWA 5AV1A 1ZY4A 3WE4A 2GCDA 4ACMA 3OWLA 4MV3A 4TYGA 3PYYA 1DI9A 1JWHA 3ID6C 4DG0E 4FL3A 4F1MA 5BWTA 4IAFA 5IZFA 2RGPA 3QFVA 3PVGA 1TQPA 4YZMA 3BWFA 1XH8A 3UOJA 3F5PA 3T7AA 4TNBA 4CE5A 3RNIA 5BPYA 3BV3A 3KULA 3O0GA 4Q5HA 1W82A 5AP3A 5EDPA 4KKGA 2IW8A 4TNDA 3U51A 4DFUA 1WRVA 5CE8A 2GDOA 5AP2A 3CPCA 4CRLA 3VUKA 5BWVA 4KS8A 3FSKA 5DOSA 3R9HA 2GFSA 4TVIA 3TW6A 4X6RA 2XAOA 1WFCA 5AP0A 1XDNA 3O7LD 4RFYA 5LCJA 2X6DA 3WYYA 2OFVA 3HKOA 3R6XA 3QYWA 2JIVA 5EQEA 4ITIA 4PV0A 1KV2A 4QEBA 3VF8A 2J5EA 4O4LF 5DISC 3MVLA 5F4NA 4K0YA 4PDOA 3ZTXA 3KULB 3TV6A 2PN1A 3BHHA 3P7BA 3PXFA 4YJOA 3TWJA 4R1YA 4LMUA 1GLVA 5CT0A 3VA7A 4HPTE 3GFEA 2DQ7X 1GOLA 3ZBXA 3NR9A 2OSCA 4EOJA 2HXLA 2Z04A 3OXIA 3SW4A 2ITNA 2LGCA 3GFWA 3IS5A 5BYYA 2JDSA 4FZDB 4RWLA 5DA3A 1CS0A 5L8LA 4C4EA 2FSMX 4I6QA 4AQCA 2W6QA 1SVGA 4ASEA 3TV4A 3H9FA 3FKNA 3HRBA 3W0MA 5A14A 1I2LA 3PXZA 2R2PA 1J1BA 1YW2A 4WUNA 1JLUE 2ZGIA 3WF8A 2F57A 4UEUA 4U6RA 2PE2A 3OG7A 2EB3A 3TI1A 4CFUA 1LEWA 1WBPA 2XNNA 5CI6A 5FTQA 4HYHA 4DEGA 4E6CA 4PMSA 4QMNA 1AUVA 2QOBA 3UOKA 1JAMA 1SZMA 3EN5A 3KC3A 3QC9A 3QRJA 4UYAA 1Z2PX 2HGWA 4U79A 4ANBA 5CXHA 3MH2A 4ENXA 2F2UA 1M52A 2PVRA 2VNYA 3AGMA 4CD0A 4L01A 2Y4IC 5AA8A 3LXKA 4FG7A 1P8LA 5I9XA 3TIGA 3L8SA 2W71A 5IU2A 2C6OA 4QQ5A 2R3QA 2WTKB 3KRWA 4OLIA 3VBWA 3FPMA 5F1ZA 2OXDA 4MA5A 5HNEA 5IDNA 2XK3A 2ZV9A 5B2KA 3ETHA 3OS3A 2X9EA 3R01A 4U7ZA 5DFPA 5M55A 5CU3A 5FP6A 1VS0A 2R7MA 2W6ZA 2PZYA 2WMQA 2PVPA 5K2MA 2WD1A 2R86A 1CKMA 1B38A 2ZM3A 3BLAA 2H34A 3ATTA 3PP1A 5AMNA 4ZLYA 4UCUA 2IP4A 1OB3A 4V0GB 3EH9A 4EUTA 4MKCA 1ZOHA 2ITVA 2Z8CA 4IAYA 4A4LA 1U4DA 4E6QA 2COGA 4H58A 3BX5A 2CN8A 5IA0A 4ZSJA 4H05A 2UZTA 1OIRA 3W1BA 2A19B 4R7IA 4MV1A 1M7NA 3NVMB 2FB9A 4AFJA 3EOCA 3DOGA 2J0MB 4DLKA 3R1YA 4RX9A 1QPJA 4XRJA 1J1CA 4WNOA 2W5AA 4CSVA 2XCLA 3A61A 3HB9A 5AAFA 4W4VA 4QMOA 4K77A 4B6LA 4NUSA 3ORTA 3Q60A 3WZJA 3KAKA 3KF7A 4EGJA 1OECA 2HIXA 2VD5A 3HUCA 3QGYA 4NW6A 3U9TA 5C1PA 2C5VA 5D11A 4DGLC 3SW7A 2HGSA 4PDSA 4E73A 4YR8A 4DAAA 3FLQA 4FEQA 3U9SA 5M07A 1UC8A 2I0VA 4M12A 1W93A 1QCFA 5GINE 4LG4A 5CSPA 4BDHA 4WRSA 5E8XA 5HCXA 1G8AA 5M06A 3EJ1A 2VWBA 1R3CA 3MS9A 3OC1A 4EC9A 3AKJA 5HX6A 5LVOA 1WR2A 4XG7A 2YM3A 3QQFA 4N57A 4RJ7A 4FVPA 2HJWA 3BBWA 5DIAA 3K54A 3KMMA 4DAWA 5I9YA 4O7VA 4YZNA 4I6FA 3VQHA 2VTIA 4FZ6A 2UW4A 2VO3A 4KKEA 4IAZA 2XS0A 1UU7A 4L67A 2XNGA 4DG2E 4X2FA 2VUGA 4MQ2A 3ORPA 4D2RA 4A4XA 2X8IA 4NZOA 4FT3A 3E7OA 1YDTE 3UO4A 2COJA 3QQUA 5M4CA 2CMWA 2V55A 2DZDA 1PMEA 3FUPA 3I4BA 4U97A 1SVEA 1GZKA 3OMVA 4I1ZA 4FFRA 2OIBA 4D4YA 4KBCA 2HOGA 3I7CA 4ZK5A 4AS0A 3K5HA 4MTAA 3ZUUA 2BHEA 4TWOA 4CT1A 1M17A 3OVVA 5ACBC 4JG7A 5BNJA 3AT4A 3EFLA 2UW0A 3IPHA 4G1WA 5FEEA 5HQ0A 4L52A 2IZUA 3BHUA 4GT3A 4WSYA 4IB1A 2OH4A 3FMDA 3DDQA 1UKHA 1H00A 4A9RA 3A60A 4BDEA 4I3ZA 5KZ0A 5JH7F 5J9LA 2C5NA 2BZHB 3QQGA 4DT8A 4JR7A 3QTXA 2I8CA 2CCIA 1NA7A 3BKBA 3RPSA 4AXDA 4L9IA 5KE0A 5H80A 1PHKA 4FSRA 4WOVA 5C8MA 5DGIA 2CGUA 4DEBA 3NNUA 5D7AA 2CNQA 5AX9A 4JQ7A 3R83A 3V01A 1DI8A 5LP6F 3FKLA 4BCIA 5AEPA 2W6MA 2RG6A 3GOKA 4ORKA 5I5SA 3HP2A 3F66A 3RGFA 1KSWA 2CJMA 3AT3A 4WBOA 4AW0A 4YJ2F 1M6VA 5L8JA 3LKMA 2WNTA 3GJXB 2PVNA 1PYEA 2GFCA 2ITUA 2HWOA 4KAOA 3F3UA 3H0YA 3UIMA 3BELA 1PX2A 4W4YA 3NUSA 2ZOQA 2QU6A 2Z7SA 1OITA 3KXXA 4U42A 3G8CA 3UYTA 3LWBA 3GU4A 3R63A 5AUVA 4PQNA 2RFNA 4TN6A 3HA8A 5K9IA 1NT2A 1A06A 4IM2A 3ROCA 4K8AA 4RQVA 4Y5HA 5HE2A 4RIWB 4YC6A 3NAXA 3VS2A 5DPVA 2KTYA 4D55A 3HMOA 5JRQA 4IX4A 2OO8X 5A9UA 1ZLTA 2BALA 4DGGA 1M0WA 4RJ8A 3NNVA 3PY0A 5F95A 2NRUA 4ZI7F 2BTSA 5KUPA 3KK8A 2Q0NA 3ZOSA 1A0IA 2UVYA 3I6UA 3EHAA 3T9CA 2I0YA 5JSMA 3R30A 3JPVA 4IADA 3SXSA 3A2CA 2DUVA 1F0QA 2PZ5A 3ZC6A 1ND4A 3PXQA 4CFWA 5M44A 2QLUA 2R3JA 4FL1A 4J98A 2PMLX 3LJ2A 2VWYA 4JIKA 4UWYA 4B99A 4LUEA 1C30A 4KRDA 3IOKA 3TM0A 5C27A 2RFSA 1BX6A 4EOQA 5AV0A 3Q2JA 4QP2A 5C8KA 5I9ZA 5CZIA 4IWYA 2W96B 4JNWA 3ZM4A 2ERZE 4YZDA 4F4PA 4NYEA 2B1PA 5FLFA 1GGOA 4CKCA 1ZMUA 2JKKA 3SXRA 5CAPA 3QQKA 5D8DA 4I5HA 4DYMA 3OTVA 4CFVA 1Y6AA 1Q8TA 3D15A 5CU4A 5H9BA 3BU3A 4JDHA 2YM6A 2EUFB 4AZWA 2QNJA 4O82A 2C3IB 2OZOA 3V8TA 4LDTA 3UBDA 4RCNA 5HE3A 2XK4A 4QYYA 3VBXA 2XK7A 3KRLA 2OK1A 4HOKA 5CZHA 4F7NA 1NVRA 3BGZA 3VPDA 1XH5A 2QC6A 3IKAA 3ZHPC 4AN2A 2BMCA 1VEBA 2XALA 2XRWA 3A7IA 3R02A 5AV4A 3JZFA 3O23A 1H1PA 1PKGA 2C5OA 4FV3A 2B53A 2P4IA 4AXCA 4FFOA 4FEUA 2DLNA 3RTXA 2WPAA 2R87A 4IWXA 2VWZA 1OPLA 2ONLA 2G2HA 1T46A 4FNWA 5A4QA 2FP4B 2VTHA 1DAYA 2P3GX 1YXXA 2ITTA 3F69A 5DT4A 1E4EB 3R9OA 3UO6A 3PZEA 1PY5A 3BZ3A 2C69A 4LOOA 5IH6A 4RX7A 4YC3A 4FTOA 4WBNF 5DHJA 2WTKC 5E8WA 3LXPA 1OL2A 3R7IA 2B9IA 3T54A 2PL0A 2BROA 4BCMA 4BGQA 3HUBA 3VOTA 4FKVA 2W1DA 3I1AA 5FXRA 1EUCB 4DHIB 4MAOA 1K9AA 1KWPA 3QCXA 5FGKA 1WBNA 4PNIA 4AGCA 3AXWA 3BG5A 3WOWA 3LMIA 3NIEA 1E4EA 3VPCA 4QOXA 3LULA 1HOWA 4D28A 1OL1A 4EH3A 3U0GA 3TXOA 2REIA 3A99A 4C36A 3HMIA 5LXTF 1KC7A 4DQNA 4FR4A 5ANDA 2QOLA 5TOZA 4CFFA 1C3OA 4AGUA 2X2LA 4WIHA 2FPPB 1A48A 4G34A 3PPJA 1VR2A 4O0XA 2QOFA 5CVHA 3A4PA 4Z7GA 5L2TA 4HGEA 4U44A 3QTUA 3ZLWA 2R4BA 1J7IA 2HXQA 3IW5A 4C4FA 2IZTA 3LPBA 3DTCA 1J7LA 1J91A 2XCHA 3MY1A 3QA8A 5GJDA 5A54A 1JDEA 1QL6A 2NPQA 4IJPA 5CSHA 1DAAA 1WMKA 2UZBA 4WA9A 2HDKA 4F1OA 5HLNA 4LMNA 5DR9A 5DAAA 4FTRA 4YBZB 4D4RA 5EM5A 3QFFA 1M2QA 2GHMA 3QU0A 1FINA 3BBTB 1DM2A 4AE6A 2PULA 1YI3A 3ZXTA 4F0FA 4B7TA 3MBLA 2QK4A 1B39A 2X4ZA 3Q52A 2GS6A 3OTUA 2I80A 2YERA 4CKIA 2B52A 3R2BA 5A4TA 5JVDF 4YJQA 3UNZA 2I1MA 3IDCA 4J53A 4BCFA 4ANMA 3FL5A 4OTRA 4FKRA 4GK3A 2XRUA 4USFA 3EB0A 4M97A 5LWMA 3PPZA 1QPCA 5CQWA 2ABJA 3G8DA 2PU8A 4QMSA 1OKVA 4ACDA 3V4ZA 3W5OA 4C37A 4CZTA 3R1NA 3U6IA 4UCOA 5JH6A 4BKJA 1UKIA 2VTAA 5HD7A 3TUDA 4K6ZA 4PZ6A 4YJ3F 2B9FA 1JPAA 1APME 5CF4A 2QQ7A 5KNJA 2Y6OA 4O7WA 4FT5A 4LFIA 4ZY4A 1YWNA 4NW5A 4ERKA 1I1MA 4G3GA 4JDIA 2AEGA 4FIHA 3AC1A 5C8NA 4XG4A 5L2IA 5KX5F 5HE1A 4IAAA 3VF9A 3HV4A 4O7YA 4UCSA 5KKRC 3FBVA 4Z9LA 3BHTA 3R1SA 4I21A 1ZYDA 4JOAA 4CMUA 5JFWA 4YNOA 4IBMA 5BVEA 2R64A 1UA2A 3ORLA 3QBNA 3T9DA 2XKDA 4CRSA 3FC1X 3DLSA 4PL3A 5EM8A 5HBJA 5GIOE 1XK5A 3EQPA 4RG0A 3TEKA 1H0VA 4UWBA 4CFNA 2OWOA 3POZA 3JRXA 4I92A 3G6GA 1LR4A 2JGZA 2R0IA 3E8EA 3KGAA 3PY3A 5E1EA 2YZMA 5E8ZA 4FV5A 4CNHA 5BQ0A 4XG9A 3R2YA 2OXXA 4M14A 5ETFA 4L7SA 3OCGA 3G33A 2VTPA 3MH1A 4S31A 2X81A 5KZIA 3E8CA 3VBVA 4HGLA 3DS6A 3ZFYA 5I9UA 3C13A 4EQUA 2EJ0A 2P0AA 2F7XE 3TJDA 3TZ7A 2OU7A 3RM6A 3QTSA 4FK3A 4H3PA 4EH6A 5LOVF 4FKUA 2GNFA 2H9VA 2VGOA 3HGKA 3RCDA 3OEZA 5JFVA 1IYEA 1G8KA 3DGKA 3E5AA 3HP5A 1ZWSA 4QYGA 1REJA 3KN6A 2IPXA 4IAKA 2HW7A 2XNBA 3D14A 3TZ8A 3MPMA 5H8EA 5D1PA 5JGDA 4U8ZA 2WTDA 3A8WA 3EYGA 4YC8A 2GNGA 5IF1A 1U54B 2WMBA 2PWLA 5HHWA 3E3PA