4O7SA

Saicar synthetase (type-2) in complex with tmp/tdp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
MIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-2) in complex with TMP/TDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7sA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7sA02
4E7WA 2CHLA 2NNWB 2WELA 3DDQA 3EQGA 3GT8A 4O2ZA 2PHKA 4IM3A 4BCJA 4KKEA 2XNBA 2CJMA 2J5EA 3K5VA 2V58A 2W1FA 4HOKA 1G8AA 1BLXA 3VUDA 2PBZA 5IYZF 3C0GA 1QCFA 4C02A 2YIRA 4YB8B 3PUPA 5J2UF 2IPXA 3CEKA 3VMMA 3TIZA 4MXYA 3OWLA 4QMOA 3DKGA 2Z7QA 3M1SA 3Q96A 3HV3A 4KB8A 4QMUA 2OIBA 2UW3A 5EHLA 3UMWA 1KC7A 4EOSA 4WNPA 2C6LA 1PHKA 4ZSJA 4RBLA 4XG4A 1TQMA 3HA8A 2OW3A 5D11A 3CQUA 1DM2A 3FC1X 1W96A 4G6NA 2ZDHA 3LFDA 3HO8A 4BC6A 4DIMA 1LP4A 2ZM4A 3LHJA 2YCQA 4U41A 4EKLA 1BXRA 1TKIA 2C5XA 3EFKA 5C1QB 4CV9A 3OCSA 5M53A 4XV2A 3W18A 5JGDA 1OKVA 3NCZA 3ATTA 5ACBC 4XH6A 4RJ8A 4FEUA 2JBPA 4FR4A 4DFUA 3MB6A 3S0OA 3IECA 5CAQA 2UZUE 4CMTA 2B52A 2CGXA 4BDHA 5AFVA 2BAJA 3MVHA 4NFNA 2I8CA 2W6ZA 3JZFA 3LFEA 1V1KA 4O4JF 4U3ZA 5CALA 2YW2A 2JDOA 2BCJA 2OLSA 1M17A 4P4CA 1ERKA 1WFCA 2WQMA 3QRTA 4L67A 3RWQA 5CT0A 5AV2A 1F0QA 4FZ6A 3R7EA 3TNIA 1PXJA 4OT5A 4BTKA 4Z3VA 1WBVA 1ZAOA 1UU9A 3IOPA 3R73A 3OT3A 3UO4A 3N9XA 5A4LA 5HO7A 4NJ3A 2BFXA 4YAJB 3ZFYA 1WBNA 4WBBB 3ANRA 3UE4A 3DJ5A 4FSYA 4EEVA 2WU7A 1IAJA 4O27B 3KKVA 1P2AA 5JQ5A 2BHHA 4MBIA 4CD0A 3LZBA 3ZONA 4KSQA 1TQIA 2HELA 2YM5A 2C6EA 3NW7A 4YC3A 1L8TA 3WARA 2YN8A 3OWJA 2Q83A 4AX8A 1H27A 4M8TA 5AP2A 5KMMA 4M97A 3DK7A 2CKQA 2PVYA 5H9BA 3TV4A 1OIUA 3EN4A 3GC9A 4AA5A 2WTVA 3AC1A 4BCOA 2QOBA 4FODA 3LVPA 4E4XA 3MFSA 4O84A 4IB5A 4O7ZA 4W4WA 4M69B 3PG1A 4I24A 3NNVA 3RGFA 4YO6A 3PPZA 4UALA 3BELA 2PZYA 1Q61A 4PWNA 2FA2A 4Q9SA 3TXOA 2JBOA 3VAPA 2XJ1A 3OOGA 2OBJA 3SD0A 1IG1A 4AZFA 5CZIA 2I0YA 4PV0A 3KXHA 1ZXEA 4CNHA 4LM5A 3TV7A 4ALWA 4IW0A 1YOMA 4JI9A 4DH7A 4X7QA 1Q8YA 3VRYA 3ZC5A 3CIKA 3Q52A 3MFTA 4QP3A 2XRUA 4NW6A 4XCUA 1ZWSA 3V6SA 3V5PA 3QKMA 4I6QA 5JZJA 3JY9A 3U51A 5EG3A 4CMUA 4UY9A 3MSSA 3FBVA 1X8BA 5CSVA 5JRQA 2OJFE 2R3JA 3F61A 2PVPA 5A4EA 4QQ5A 1ZYJA 2JITA 2P4IA 4I5PA 2P2IA 4YBJA 4YJOA 5AX9A 3TW6A 3H3CA 4IAAA 5J1WA 4QP4A 3E8DA 4QMZA 5BMMA 2XJ2A 4GKHA 4DEEA 5KHXA 5IQIA 3NRMA 4DEAA 3MTFA 4TNBA 2GMXA 2HAKA 2WKMA 2YAAA 5ANOA 3HA6A 2UW0A 4PTCA 1J1CA 3LQ5A 1H26A 3E7OA 2HJWA 4NCTA 4ZAUA 5BVNA 4FV8A 5EOBA 1ZZLA 2YIQA 4TWNA 4DH5A 3R6XA 4E6CA 4UV0A 3VS6A 1Q24A 4ZQIA 2GHGA 2QKRA 2FVDA 3BEAA 4KKHA 5ETFA 2HW6A 4F1TA 2VWWA 3V4ZA 3LCTA 4RIOA 1YVJA 1FBNA 2IO6A 2W1GA 3HV4A 3HAVA 2RL5A 2EVAA 4IHPA 5K3YA 4JRNA 4E26A 1FVRA 1H25A 3CY2A 5CF5A 3PSDA 2QODA 1PXIA 4ZSGA 3FC2A 2ZB0A 3OCGA 2R3KA 1JSUA 4ITHA 3V51A 3I5NA 4TV9F 4GYGA 4FFRA 3D2IA 4BYJA 2OK1A 2GNLA 1MP8A 4KA3A 1CQIB 3ZMMA 3NYNA 4I5MA 2BIKB 3GCVA 2BILB 2WQBA 4IZOA 1E9HA 3FMJA 4XRJA 3FXXA 1BNCA 4BIBA 3BHVA 1M7QA 4BTFA 4CLIA 5IH5A 3GLKA 3FLZA 3I4BA 3VS3A 4FFNA 4L44A 4BB4A 5BVEA 5F4NA 3R5HA 1ZLTA 5IG1A 4FKRA 4QTBA 4DFLA 1CKPA 3OXTA 3EQIA 3UYSA 3KEXA 2R3PA 4OTGA 3RAKA 1O6LA 4AGDA 1XH6A 4I4TF 4I94A 1G3NA 1YI6A 4IZ5A 1TQPA 4II5A 3HUCA 2PUUA 4AWIA 4GKIA 2VPQA 4F0GA 4FSNA 1PX2A 3PJ1A 4ZK5A 3HB9A 1XH5A 2WO6A 5CA0F 3MA6A 5EYDA 3LXLA 2VZ6A 5E4HA 4X2FA 4DEGA 3FYJX 4JG7A 1JKSA 4RVTA 5GJDA 4EBVA 5HORA 2QF7A 3V5LA 1YHWA 2GNGA 1LUFA 3EIDA 4O2PA 3A8XA 3TJDA 3ZRLA 2OU7A 4IFCA 5KX8A 2ITNA 2XK4A 3PSBA 3ZEPA 3R7IA 2P0CA 2VO7A 3QQLA 4TWCA 1KJIA 2X4FA 2PUIA 3DLSA 3D94A 4U43A 3EHAA 3UPXA 1Q62A 4HZSA 3GU8A 2QR7A 3KULB 4G9RA 3FJQE 1PXMA 4BCMA 3UZPA 1AGWA 2FSOX 4R3PA 3KRLA 4A9UA 4AQCA 5AADA 1BMKA 5HCZA 2XZSA 3MVJA 1GAGA 4C4FA 3NW5A 2BVAA 2GNFA 4C58A 4FV3A 3I7BA 5IA5A 4OBOA 3F7WA 4DC2A 2FO0A 2ITOA 1IASA 4XOZA 2VTOA 3QZFA 3QD2B 4YC6A 5AP1A 2NPQA 4D4SA 1DAYA 3I5ZA 3MJ2A 2PVJA 3DBEA 3OFMA 3UNJA 1M14A 4BDKA 4ANSA 4GMYA 5A6NA 2F49A 3O23A 1GIHA 4M12A 4RIWB 5IA4A 1URWA 4MNEB 1Y8YA 4EONA 5JFSA 2I80A 3KF4A 4TY1A 3WI6A 3CBLA 3BLHA 3CTHA 2FH9A 4YPDA 4IAIA 5DHJA 3QXPA 5HO8A 3FXZA 1OZ1A 1C30A 4RJ3A 1J1BA 3SC1A 1I09A 2ONLC 3DB8A 3PRFA 4C34A 1XR1A 3F66A 3DDPA 4O38A 4H05A 4O6LA 2OO8X 2QONA 3DLZA 4IBMA 5FEQA 4HNTA 4RA4A 5EQPA 2ETRA 3G5DA 4FK6A 2C1BA 2PMOX 4IEBA 5AA8A 1KWPA 5EZYF 4L42A 3O8TA 2V5QA 4FTMA 5HHWA 3RAIA 2BR1A 5CAEB 5HE3A 4BZDA 4EWHA 3Q2MA 3QL8A 4IM2A 5E1SA 4PP7A 1SVGA 3B8QA 2CGWA 2OJ9A 3UOJA 5LVLA 3KN5A 3UO6A 2OFUA 2XK7A 5DYJA 4BHZA 3F88A 1LEWA 4IC7A 4ZS0A 2RFEA 2PVLA 2C3IB 2X6EA 5I9YA 3R5FA 2W7XA 2ZB1A 1U54A 2C5NA 3PFQA 4FG8A 2R3LA 3E64A 5E92A 3TZMA 4AAAA 4S32A 4OW8A 3UQFA 3F5XA 4RC4A 4M9UA 3RFCA 1ZRZA 5C9CA 5IEYA 5HE2A 3EQHA 3FL5A 2VX0A 2GDOA 5ACKA 5ANIA 3JS2A 5IISA 4MXXA 3A7GA 4B99A 5JEBA 1BI8A 2WZJA 4EH5A 5DLSA 2XNOA 5EKOA 4PMPA 2R86A 4AZVA 1GIIA 4FT0A 5HG5A 4CEGA 2F7XE 2HWOA 4E93A 3MWUA 5AUWA 2X7FA 4C36A 3F2NA 2BZKB 4G6OA 4I50F 4DGMA 4YTFA 4LRKA 1T46A 4U9AA 2C47A 2C6DA 4NW5A 4AT5A 1XO2B 4FNYA 3BYUA 1XQZA 2ONLA 3DXQA 1KSWA 4DE4A 1L3RE 3AOXA 4BBMA 2R4BA 5HGIA 2OH0E 5M09A 4QMXA 3R7OA 4U5JA 5AM6A 4S34A 4D1SA 2DS1A 1KE8A 3E92A 3D5XA 4B8LA 1PYEA 4YSMA 5FM2A 5EH0A 4BF2A 4EQUA 2B9JA 3A7IA 1MRVA 1RW8A 3LCDA 4F6UA 3RTPA 4D9TA 5LARA 3EZRA 4AGUA 4TWPA 4C0TA 3N4UA 3U8WA 4D1ZA 4E4TA 2C30A 5KKRC 3K5HA 2DYLA 4HYIA 3RV4A 4D0WA 2PVKA 3QBNA 4Z7HA 3BLQA 5BVKA 2ZV2A 3HEGA 3OUKA 4D2RA 3VBYA 3PY3A 3CQEA 4IM0A 2YCFA 3W33A 3UDBA 4JX3A 3E62A 1UWJA 1Y6AA 4IVCA 3G33A 1FVVA 2BTRA 2PY3A 3L8SA 4IJPA 5CVHA 3BWJA 3AC4A 2QVSE 4LG4A 1YXXA 3UNKA 1OIQA 3G9LX 3QCXA 4FKUA 3BYOA 4HGSA 5E9EA 1OL7A 3C4EA 3PXRA 4QMTA 2R2PA 2CLXA 2VTPA 3MDYA 3N4TA 2C0OA 3VIDA 2J5FA 4D5KA 4G6LA 3O0GA 5AP0A 3SQQA 3VULA 3ZFMA 2A1AB 1DI8A 4FG9A 4FV0A 3FY2A 1OL6A 3LW0A 2RG6A 1PMNA 2XNNA 2W1DA 4QOXA 5IA0A 2XNEA 1ZY5A 1Q4LA 4XEYA 2P3GX 2LAVA 3RJCA 2ZM3A 3VS5A 5EI6A 1R78A 2IP4A 3RP9A 4YLLA 1YXTA 1KE5A 2HIWA 2XVDA 4CLJA 1LEZA 4PMSA 2A2AA 2ZVAA 4H1JA 4RZWA 3R9DA 3HP2A 3KMWA 4G5PA 4B9DA 4AACA 3C13A 5FTOA 3TIGA 2BUJA 4FTCA 3KCKA 3QA8A 4HYSA 5HU3A 3GQLA 3R04A 3FSKA 3DBFA 3C0HA 4XBUA 5L8LA 3TINA 5IUGA 2PE2A 3LXNA 1QPCA 4FX3A 1XKKA 2BRNA 3VUMA 3O8UA 2WB8A 3R1YA 4OTWA 3M42A 3TM0A 2I0EA 4ONAA 1OITA 2ZM1A 4MWHA 1Z9XA 3GBZA 4AZWA 3S00A 5HLPA 5C4LA 2X2KA 5JVDF 4FEQA 4E6AA 2J7TA 2J0KA 2C4GA 3KXGA 4QO9A 2WMAA 4FKOA 2WFYA 2CKPA 2O63A 5DRBA 2YZLA 2F2UA 3ZZWA 5BX0A 3IKAA 4YTCA 5HZNA 3P7AA 3NVKI 4QMPA 4ZS4A 3GOPA 1R39A 3P0MA 5CAOA 3ACJA 4AGWA 3ZLWA 3RK9A 4OBPA 4R77A 4IDTA 4KRDA 4DLJA 4EQCA 5HG7A 2ZDQA 3ALNA 5HESA 2WAJA 5I0BA 4FTLA 4HVDA 4ZZNA 4DT9A 2E9PA 3WZDA 5LOVF 2XKDA 3K3IA 3WIGA 4C5AA 4KBCA 5CWZA 3IGGA 4Z7GA 3Q2OA 3VUHA 3RALA 2JAVA 2JDTA 1AQ1A 5IA1A 1OIYA 3TUDA 3BQRA 1YI4A 2QCSA 3KXMA 2W4KA 4AW1A 3E88A 1W93A 4H36A 3ULZA 3PPJA 3V3VA 2OLCA 3ORTA 4WO5A 5LVMA 2C6IA 1NW1A 3SG8A 4WOVA 5HTCA 5AUXA 4L1KA 3QYZA 2VWYA 3OMVA 5DMXA 1PXKA 1I7NA 5HCYA 4PDYA 4YZBA 5IQFA 3I0QA 2ZDGA 2XNMA 4QTCA 2GCDA 5JQWA 3Q4ZA 5HV6A 5DT3A 3GI3A 3CKXA 4ASXA 1YDRE 3CPBA 2VTJA 5AV1A 4FSZA 3NUPA 1PMVA 4MCVA 4FIHA 3LWBA 4GUEA 3MPMA 4E1ZA 5KE0A 4EQMA 4CQEA 2RIOA 3BGPA 4B6LA 2JFLA 4JXFA 4BCHA 1REKA 2HOGA 3OD6X 4FT3A 3TNPC 3ZHPC 4A06A 2Y4IC 1P14A 2OXXA 3QCYA 5EHOA 4ZY5A 5EKNA 3CLYA 4CFXA 1VBGA 3TL8A 4OBQA 4E6QA 1RJBA 4RMZA 2Z2WA 3LLAA 2UZTA 3BGQA 2CPKE 2J0LA 3PP0A 1U59A 5DH3A 2I0HA 2WHBA 3KAKA 4YJVA 1ULZA 3AMYA 4C7TA 3CGOA 1WAKA 1ZY4A 1R0EA 1XHAA 4IAFA 4XRLA 3FKNA 3LFAA 4ZTLA 5AEPA 4WNMA 3TNHA 3OEFX 4XG7A 4BR3A 4L00A 2B1PA 4GVAA 5A54A 3FHIA 4FTTA 3NAXA 4L45A 3IDBA 4IAKA 2VV9A 1JKKA 3KAJA 1J7UA 3L9LA 2PMLX 3PJCA 5J5SA 2UVXA 2XUUA 3FZPA 4FC0A 5BPHA 2REIA 4FKGA 4XV3A 5K5NA 3QWJA 2WNTA 3QALE 5KCVA 2NU6B 2XK3A 4RIXB 5FEDA 4L3PA 3NYXA 3PVBA 2IZSA 5HG9A 3RWPA 3SRVB 3F82A 3MIYA 4FL2A 4EL9A 3DTCA 2BFYA 4F1MA 3THBA 2UZVA 1OL1A 2GNHA 2ITYA 2WQEA 3TUBA 5ANKA 1J3HA 2WOUA 1NVQA 2PVHA 3BIZA 5AAFA 2QK4A 5IQGA 4RWKA 3U9CA 3DF7A 4KAOA 4KIQA 2YIXA 4PDPA 3SHEA 3KGAA 4PDOA 2CNUA 4U7ZA 4CG8A 3CQWA 2EXMA 3LKMA 4JQEA 4AT3A 3QX4A 4D4VA 3CP9A 4UWYA 4DG0E 2IJMA 1KUTA 4EC8A 2FUMA 2YABA 3Q53A 4MNFA 5DG5A 5HLNA 1ZARA 3SG9A 3DZOA 2YZNA 2RFDA 4AW5A 4GG5A 4LUEA 5CENA 2PULA 4QYFA 3JVSA 4GJ2A 3ZUVA 3GEQA 3E63A 2BRBA 2GS2A 2JKOA 2R3GA 4NWMA 4EI4A 4EGQA 1FGIA 3TZ8A 4KS7A 5DE2A 4BI1A 2O0UA 4C37A 1UNGA 4ZZMA 4ZJIA 3VW6A 4J8NA 3JY0A 3PY0A 3NYOA 4R5YA 4BZNA 3LCKA 5ANJA 4JG8A 3QKKA 4O0RA 5DNRA 3W32A 1PXOA 4C35A 4U79A 3D0EA 3DBCA 4GFOA 5AUUA 3R5XA 2JIIA 4M13A 2F7EE 2QOKA 4QP7A 2XK8A 3UJGA 2DLNA 3K5UA 3EQCA 2VTSA 2J0JA 4D4YA 3ZEWA 5IDNA 4LUDA 3RZBA 3WE4A 3TDVA 1R3CA 2FSLX 3BEGA 3ZXZA 4W8DA 2A19B 1CM8A 2G2HA 3LMGA 4GK3A 5D41A 3RAHA 4D1XA 4L68A 3GENA 4O0UA 3U4WA 4MV3A 1OPJA 3ANQA 3R1NA 4BIDA 3BGZA 5JH6A 4LFIA 5CF8A 4TL0A 2YIYA 2QOOA 1M52A 1UU3A 3D15A 3DXNA 4X2GA 2OIQA 3HV6A 5HNBA 3OVVA 3R1SA 2GPHA 3F6XA 4OTFA 5CSXA 3OHTA 4WBOA 3UNZA 5HE0A 3POOA 4QT1A 3MWEA 2UVZA 2C0TA 2E9NA 2Q0BA 4D4RA 4O86A 5HG8A 3BU6A 5B0XA 3W2RA 3VA7A 1TVOA 4FIIA 5LA6F 1OBGA 3JVRA 1GZOA 5GHVA 3KY2A 5I9UA 5L6PA 5A4QA 2J51A 3DAEA 3H0YA 3EN5A 3I1AA 3OUNB 3GOKA 1LR4A 3Q6UA 3P5KA 5AAEA 4MXZA 4Z55A 4HR7A 4DFNA 3ID6C 2VX1A 3FMDA 3SW4A 3ZTXA 3D9VA 3DFAA 4CTCA 3KRJA 1DS5A 4EZ3A 1KJQA 2XIRA 4IWQA 4G1WA 2PN1A 4F0FA 3C0IA 2WGJA 2WMBA 2ESMA 3C1XA 3OWKA 4CRLA 3JRWA 4GU9A 2R5TA 5HX8A 1A9XA 3G51A 3ORQA 2ITZA 4H58A 3DTWA 4PP9A 4YNEA 4XLIA 2JAMA 4IWDA 4UYAA 4AE9A 4EK6A 4EWQA 3R8VA 2R3QA 4IIJF 1R0PA 3QUEA 4FKSA 4D5HA 3SOCA 3COHA 1BX6A 2XRWA 4FFPA 3OG7A 4BBEA 3TJCA 3LFQA 2QURA 5EHYA 3PJ8A 2HW7A 4ANBA 1EH4A 3AQVA 4Z9LA 2ERKA 3D7ZA 5AM7A 5ETAA 2BZJA 4LMUA 5FBOA 2BRMA 3F5UA 4CV8A 4M0YA 4CFUA 4CZUA 1UWHA 3BBWA 3U9SA 4NM0A 5E8UA 5C8NA 2WMSA 4O7VA 4KRCA 4AW0A 4F4PA 3UBDA 3QRKA 3U87A 1UV5A 1SNXA 1M6VA 3K3JA 3FSFA 4ASDA 2HZNA 1R1WA 4FTIA 1PKGA 3I7CA 4EYMA 4USFA 4IIRA 1YOJA 4MK0A 2DZDA 2C68A 4PDSA 4ZJJA 3R02A 5JRSA 4U6RA 3UFXB 2W06A 2R85A 2HY81 3PIZA 3MH3A 2NP8A 3P79A 4QMYA 4NM5A 4QQCA 1YXSA 4E8AA 4GU6A 4V0GB 4I55F 4ERWA 2XEYA 3F5PA 2BTSA 4MVFA 5EM6A 5JK3A 4XZ3B 2VTNA 4JIKA 1UA2A 1Q8TA 3EN7A 3IDCA 4FNZA 1Z2PX 2XEZA 3FXWA 3F3UA 1B39A 2HY0A 4EK5A 4FFLA 2VO6A 1JKLA 3ET7A 4JL9A 3TEIA 3HKOA 4IFGA 4ZIMA 2BDFA 1YWRA 3ORMA 4FIEA 1E1VA 3E87A 2W6OA 3CPCA 5IH6A 1UKHA 2VWXA 3A8WA 4RIWA 2WTJA 3MW1A 4IVDA 4IX6A 5BMSA 3OF0A 5CVGA 1JSTA 3OEZA 4F9WA 1XBAA 4X3FB 3V4SA 3ORLA 5HD4A 2OICA 2CLQA 5FXSA 3RPOA 1SNUA 3C4ZA 4FKLA 2WMXA 4EH3A 4WA9A 3EYGA 4R1YA 5J9LA 3FY0A 5FGKA 5BUJA 4KIOA 3E5NA 2VO3A 5CXZA 3CJGA 4G3FA 2C6OA 2R3NA 4Q2AA 4WBNF 1W82A 4FGBA 5H80A 4BDIA 2QHMA 2WTWA 2W5HA 4GFGA 4PUZA 5J2TF 3E8NA 4X2KA 4JRVA 3EN9A 3KALA 4JDHA 2IZRA 4JR3A 2HGSA 3NUAA 5AUTA 3NZ0A 5IA2A 3IQ7A 1S9JA 3TZ9A 2DIKA 5AP3A 2B0QA 3EJ1A 5DFPA 4DLKA 1H0WA 2C3LA 4IQ6A 2DWBA 4ZSLA 3WO0A 2WYOA 1Q3DA 4YURA 5LCKA 1F5QA 3BHYA 3GC8A 3GU7A 4XBRA 4DF3A 2G9XA 4UWBA 3II5A 3TTIA 4FKJA 4U80A 4LYNA 2IVVA 3W2QA 5J1VA 2B4SB 4YO4A 2QNJA 4K0YA 5L8JA 1OUKA 2PU8A 1YHVA 3B2TA 1ZMWA 4I41A 2QG5A 4AN9A 1XH9A 2C1AA 2CCHA 2VNYA 3QTSA 4O7WA 5DPVA 5IZFA 5CU2A 4CTBA 1JDBB 4F08A 3F3VA 4BICA 3SVVA 4JNWA 3TT0A 3QLGA 1H1WA 1WMKA 3C5IA 2RF9A 2ZDUA 3FMKA 5TR6A 3ROCA 4ARKA 4O4IF 3ZUTA 4FOCA 4X2NA 1W7HA 3N51A 4FTRA 2WTCA 3DAKA 3VS4A 4TYIA 4DGLC 4FTKA 2FPGB 5HBHA 5IUIA 4QYGA 3R28A 5JQGF 3FI2A 3PZEA 4XMOA 4DFYA 4ITIA 5KMLA 5CT7A 3W2SA 4Q5EA 1Q8ZA 4FV4A 1B6CB 3AT3A 4LRMA 4PL5A 4QMMA 3MBLA 4JT3A 4RWJA 2F9GA 4WNOA 2R64A 3MPTA 1F3MC 2PUNA 3AC3A 3DKOA 4YUQA 1M0WA 4GCJA 1CSNA 4OTIA 4C2WA 2VX3A 2O65A 3QD4A 4L6QA 3A99A 1GSOA 2GNJA 3UZRA 2C3JA 5HNIX 2WTKC 4D58A 5ICPA 3UO5A 2VWVA 2KULA 4M7IA 2YERA 2FP4B 5HU9A 4EHVA 1GZKA 3FV8A 4RLKA 4TXCA 4LOOA 5EQEA 4EOOA 3FYKX 3W1FA 4DT8A 4D9UA 2W6QA 2JDSA 3PVUA 4BDBA 3K2LA 3WF5A 2FSMX 4FV6A 4MAOA 4YZCA 4OTDA 5BPFA 4O6EA 4N6YA 4I23A 4MQ2A 3EFLA 3HAMA 4JS8A 2YFXA 4EOJA 1JQHA 1FINA 1OL5A 5CQWA 4S30A 4BDJA 2DQ7X 5JFVA 4YR8A 2ITWA 2QLQA 4A9YA 1ZMUA 4BZOA 2YWVA 4TT7A 3FMNA 3DA6A 2YITA 4GS6A 4NUSA 2IWIA 2Y4PA 4Y83A 1Q8WA 5IH4A 4F6SA 3MPAA 4IB3A 3U54A 3WYYA 4BTMA 3ZBXA 3UP2A 4BCPA 4KD1A 4Y5HA 2VTRA 2X6DA 4YJ3F 3UIBA 4LV5A 4WG4A 3ORXA 2GQGA 2VWZA 2WIHA 4UEUA 2WEIA 2A0CX 3EYHA 3WF8A 4FYNA 3QAME 3JZIA 3BRBA 4ERKA 3WF7A 2WQOA 5C4KA 3E3BX 4WHZA 3IS5A 5GINE 1H07A 4Q5HA 4CGAA 5HVJA 1WBSA 2WTDA 3GCQA 4GFMA 4IVBA 5H2UA 4FA2A 3WNZA 3LMHA 3KXXA 1IAHA 3A7HA 3VUKA 4DEHA 1H00A 5D10A 4RZVA 5K4JA 2I1MA 3BE2A 5EM8A 3FMHA 3ZM4A 4ITJA 1WBWA 4NT4A 3V04A 3KMUA 3Q5ZA 4E4LA 1UU7A 3S2PA 2VR1A 3QXOA 4TKSA 3KB7A 3ORNA 4ACHA 3PXQA 3S4QA 3GGFA 3NSZA 4ZTRA 5C8KA 5JN2A 4NIFB 4ZY6A 5IQDA 3AT2A 2HZ0A 2YDIA 2Z7LA 2IN6A 4CKJA 4GH2A 4EYJA 2Y0AA 5HIBA 2IVUA 4YJQA 4PNKA 3DAJA 5TT7A 5T3QA 4K77A 2YM4A 2BZIB 3QA0A 1CQJB 2IVSA 3GFWA 4NFMA 5AX3A 2X81A 3R8UA 3FMEA 3GP0A 3ZO3A 5TO8A 4TYJA 1KJJA 1DV1A 4F99A 2CKEA 3HUBA 4HJOA 3BWFA 3COMA 4EH7A 1GIJA 3HV7A 2UZBA 1SMHA 3DPKA 4A9TA 3F2RA 3MJ1A 3G6GA 5FG8A 2XCHA 5HD7A 3ZZEA 3BBTB 3DBQA 3F3WA 5FTQA 3RNIA 3QTQA 4EZ7A 4F7NA 4QP1A 4J99A 4XUFA 3UC3A 2B9HA 4TN6A 4I21A 4O7LA 1E4EB 3Q9YA 4S31A 3V8SA 3MY1A 3R8LA 5C1PA 3IG7A 2PZPA 3SLSA 5HBEA 3HDMA 4AG8A 4QTDA 2EUFB 2OFVA 3O17A 3BU3A 3B8RA 3IW8A 5BYYA 4X6QC 4Y85A 4PQNA 2B9IA 4TW9A 4C2VA 2JKKA 3KQ7A 1UNLA 1K9AA 1JNKA 4DGNA 2BRHA 2W4OA 3MESA 2BRGA 2B55A 5IQEA 3R83A 5CANA 2YZAA 3ORRA 4KINA 3CY3A 4Y8VB 1KBLA 4QMNA 3NS9A 2QHNA 5FUTA 4FSTA 4AS0A 2VGPA 1KV2A 3C5UA 3RHXA 5C01A 3HDNA 4V04A 1QPJA 3TN8A 4EK3A 4GT4A 4TNDA 2VTTA 4WD5A 5CEQA 5B2MA 5HVKA 5D12A 5AP4A 5L3AA 3BU5A 3IO7A 4U8ZA 4RIXA 3SRVA 2HENA 2OH4A 5E8ZA 4E20A 4IB0A 3ATSA 2AUHA 2W5BA 3Q5IA 5BVWA 2Y6OA 4O7TA 5CAPA 4MV9A 3N8DA 2P55A 3MTLA 3UOKA 3CXWA 3Q9XA 4FZDB 2UW6A 4QP6A 5D7VA 4C3PA 5JZNA 4HPTE 5CSPA 5M06A 1CS0A 2V62A 2C5OA 3DK6A 3CTJA 4IB1A 2YISA 3ZLYA 3U6IA 3PTGA 4XG3A 4O4LF 1A9UA 3L8XA 3WO1A 4FKVA 3C51A 3TDWA 1M2QA 3FKOA 2NRUA 1VYZA 3VPCA 4IHJF 1DV2A 4FGRA 4YJRA 2E2BA 3UQGA 4C61A 5LVOA 3VF9A 2R84A 4XG2A 4O7RA 3VN9A 4TYGA 2ZV7A 4BIEA 5KX5F 4YJ2F 2XMYA 3C7QA 3VJNA 4BCNA 3L9PA 4A4XA 4CCBA 3AW8A 2XIZA 5BUIA 5EW3A 2Z7RA 2VD5A 4CG9A 1U4DA 4U3YA 2V59A 3CJFA 3R22A 1T45A 3OBJA 4MEDA 3IW4A 5LWMA 2CCIA 5HICA 4U40A 4J52A 1KOAA 5CSWA 5M08A 1GSAA 3L8VA 4I0RA 2C0IA 4KABA 3V8TA 4FV5A 3DS6A 2J9MA 3D5VA 5T68A 3V5JA 4QMLA 5AWMA 3RMFA 3H9OA 1G5SA 2OGVA 2PUPA 5CEKA 4EOQA 3KCFA 3MI9A 4OUCA 1BYGA 4Y5QA 4A7CA 4ACDA 4J53A 4C4HA 4F65A 4TTHB 2YACA 5HQ0A 5KBRA 4K1BA 4EH6A 2W96B 3QKLA 1PJKA 2RGPA 5AP7A 4J97A 4EHEA 4BDGA 3NNXA 4ZOGA 4I1ZA 2VRXA 3BV3A 2O3PA 5CNNA 4LOPA 4AZSA 1W83A 3VUGA 3DT1A 4UBAA 3RHKA 4RSSA 5KMOA 3TNWA 3K3PA 1PW2A 3EQFA 1KE6A 2JGZA 3SXRA 3UYTA 4BYIA 2I87A 2WQNA 2JC6A 4F6WA 2PSQA 3AC5A 4K2RA 3QF9A 5AV4A 1XJDA 4ANQA 1VEBA 2NU8B 1M7NA 3ZC6A 3RK5A 2X8IA 3RI1A 2UZOA 2NO3A 1Z2OX 4MV4A 1ATPE 1Y6BA 4C62A 2PVRA 3AX6A 2YS7A 3SOAA 2VNWA 4BN1A 4EK8A 4HVGA 5A4TA 4XG6A 4DN5A 2Y7JA 5FXRA 2V22A 4JIAA 1JWHA 5KZIA 2GPWA 4AZTA 5K4IA 4TWOA 3C4FA 3IK3A 4JDJA 2R3IA 3PWDA 5CEIA 4EJ7A 4HZRA 5FTGA 3VQUA 1ZOHA 1J7IA 2XJ0A 3RCDA 3OROA 2C69A 3RPYA 3SX9A 2ITTA 2W6MA 3BV2A 4CXAA 4RJ5A 3EFJA 3VC4A 3LIJA 4RT7A 3MH1A 3M11A 3RM7A 4ZSAA 1GLVA 2F4JA 4AOTA 1WBTA 3IW6A 2IG7A 4IX4A 4WG5A 5M51A 4O7SA 4X0MA 4YGAA 5AV0A 4YHJA 2GU8A 4FV7A 4XP0A 2CN8A 1CE8A 3HLLA 2V7AA 3P9JA 2VGOA 3PDTA 4JX7A 3V01A 2FB9A 3BYSA 3W55A 3TIYA 1LPUA 3GCSA 5IQAA 3PE2A 3Q4CA 4BDFA 1H28A 4I0TA 5HIDA 1C3OA 4XV1A 2R7NA 3HNGA 5A3XA 3ELJA 4C38A 3DJ6A 4WUNA 2VWIA 4EHGA 2O64A 3R1QA 2VU3A 3KXNA 4JBPA 3PY1A 4QMQA 2CKOA 3OBGA 3GFEA 3CCNA 4P7EA 4C33A 3H10A 3KRXA 1VZOA 3Q04A 2RKUA 1JLUE 3L9MA 4EBWA 4K18A 3G0EA 3QX2A 3CKWA 3QTWA 3P78A 3VF8A 4DG3E 4DTAA 3ZOSA 2FPPB 2GPSA 5FP6A 2EU9A 1HOWA 3VW8A 4DFBA 4XG9A 4FEWA 4JBVA 5ANEA 2WU6A 3LFSA 2XM8A 2HK5A 2GTMA 4G16A 4R3CA 5E7RA 4MA5A 5CNOA 4D55A 2XKCA 3KREA 3U55A 4QTEA 5DOSA 1JSVA 3HBLA 3MY5A 5AIRA 2YAKA 5LVNA 4G3CA 5BVOA 4FFOA 2YWPA 3Q3BA 5M4UA 3BI6A 4J96A 2OKRA 2ZDTA 5E91A 4FEVA 3RCJA 4AT4A 4G34A 4G2FA 2IW6A 3BPRA 4ASZA 3UIUA 5I5ZA 2XIKA 1OPKA 3BQCA 2W1HA 3IDPA 3KRRA 4RX9A 5DN3A 1WZYA 2OWBA 3MGYA 1B6RA 3QQGA 3E3PA 4A9RA 5TF9A 5H8GA 2CSNA 4G5JA 5I9ZA 3NIEA 3BX5A 3ZFXA 1Q97A 1PMEA 2BROA 3KU2A 4S2ZA 4MV1A 4A4LA 5KMKA 4U0IA 3UG1A 5EK7A 4L46A 4QNAA 5M56A 4DHFA 3FZOA 5HI2A 4JBOA 3L8PA 3A4PA 4WRGA 4FSRA 3G8DA 3BHTA 4A9SA 2XS0A 4J8MA 2X9EA 3VWAA 5M07A 3VPBA 4XX9A 1E1XA 4RJ6A 2RG5A 4I20A 4ZTSA 3C4XA 2YDJA 1GY3A 3FI4A 4FBXA 2GSFA 4K9YA 1CKIA 5EW9A 3EQPA 2W5AA 2BPMA 4A4OA 3R21A 4W4YA 5HTBA 3ZLSA 1PXPA 2R3FA 2YEXA 4RGJA 2G15A 2FYSA 4MXOA 4NJDA 4RX8A 4RVMA 3UVRA 4NYEA 1MRYA 3FE3A 3HRFA 3W10A 1WVXA 5HKMA 4LI5A 3ZS5A 4DTBA 1IEPA 4E73A 4GL9A 5IPJA 1FMKA 2CNQA 2XH5A 3G0FA 4PMMA 4I4FA 4HVSA 2JEDA 3QTIA 3FZSA 4IZYA 4ENYA 5L8KA 3FAAA 1VBHA 4EG0A 5DVRA 1BL6A 4HNIA 1APME 3LJ1A 4EUTA 2G01A 4U97A 4H3PA 2E9VA 3ACKA 5CTPA 3ZU7A 5L2IA 3VBWA 4Y8DA 4RC3A 4PL4A 3EKNA 5KKRB 1P4FA 3OOMA 3AGMA 2IZUA 3ORIA 3QHRA 4I5HA 2R9SA 4BGQA 3I6UA 5IEXA 4HNVA 5BMVF 4DLIA 3PXFA 5CAUA 2ITPA 4MV6A 4HCUA 3A7FA 4ENXA 3C4CA 3ZO1A 2B7AA 3NCGA 5DWRA 1B6SA 4RIYA 2VAGA 4DH8A 1NT2A 4EOMA 1VKZA 2YJRA 1H01A 4L8MA 4AA0A 4F9YA 4ANLA 4QSHA 5LMAA 1OBDA 4O82A 3JYAA 5LMKC 3QYWA 5E1EA 2FSTX 2XK6A 4FKWA 4C4EA 1I44A 3M2WA 3ROYA 4RLLA 3W8QA 4GG7A 3TTJA 3VVHA 3EOCA 4DYMA 3FPMA 1YQJA 4DBNA 1M2PA 3ETAA 1SCUB 3V5QA 2YJSA 4E4MA 3POZA 2OIDA 2QO9A 5KMNA 3PRIA 1OUYA 3GU4A 4FV9A 4KIPA 3FQHA 2W1EA 3QCSA 4HNUA 2YM3A 4HGTA 2JLDA 2OZOA 2R3OA 5EFQA 3P23A 2ITUA 3GVUA 4IAYA 4M3QA 2HXQA 2HWPA 1ZYSA 1W98A 1JKJB 5CX9A 3SXFA 3QRIA 2OSCA 3QRUA 4ANMA 5EYKA 3IGOA 2BDWA 1PF8A 4WT6A 4DEBA 3GUBA 4D0XA 5A14A 2B54A 4ZTMA 2B53A 1WVYA 4IDVA 1NVSA 3COKA 4MD9E 3QCQA 5HEZA 3UPZA 3LP8A 4CMOA 3ZLXA 1YXVA 3LCOA 3NUYA 5AMNA 2IW9A 2QOLA 5G1XA 4ACGA 4J71A 5DR9A 3FHRA 4RVKA 4UZHA 2W9FB 5CQUA 4E5BA 4YPSA 3SA0A 1MUOA 4BKJA 3PLAE 2G2FA 3KK8A 5CYIA 5HIEA 3ZRMA 2I0VA 3OY1A 4NL0A 5H8EA 4AOIA 4L52A 1ND4A 4L7FA 4ZHQF 4YZDA 2PYWA 5JMSA 4LQMA 3BLRA 4E5WA 4EZ5A 1QL6A 1UNHA 2EWAA 4S33A 4X21A 3VQHA 3I60A 4HCTA 1T36A 3A60A 4DEDA 4P2KA 2UZWE 3GQIA 4EOLA 1U46A 3T9TA 5JFXA 3LXPA 4RFZA 1RQQA 4CCUA 4J95A 2JIUA 3FZ1A 3ORZA 3F7ZA 3OW4A 3MWDA 4FTAA 3WILA 4ZI7F 4B0GA 2R3RA 1OKZA 2H8HA 2RFSA 5BPYA 5KHWA 4MAMA 2WMTA 1U5RA 1VR2A 3V5TA 5GJFA 3PLSA 3MH2A 4J1RA 4K8AA 3T3VA 3UTOA 5BYLA 1IOVA 2X39A 4NCTC 1CMKE 4M67A 4WNKA 3U9NA 3I81A 2XCLA 2Z60A 2H9VA 3A7JA 5A46A 4IWOA 3UIXA 1U5QA 3LOKA 1O6YA 3QD0A 3TV6A 5B2LA 3VBXA 5GONF 4RC2A 4TRLA 4YJUA 4O0VA 4P5QA 3PA3A 3LM0A 3OT8A 3HVCA 5T6KA 3REPA 4FT9A 2SRCA 3DNDA 3IOKA 4Y72A 2W1CA 4R7IA 3SE7A 2YRWA 4FVPA 4QRCA 3NVMB 3OCTA 5CEPA 3PYYA 4F64A 4F0IA 5FXQA 3A2CA 3ZDUA 3BKBA 5CASA 5L6OA 3Q1KA 1E4EA 1S9IA 3L1SA 3OC1A 4FIJA 3ALOA 2UW4A 4RFMA 4QYEA 3C9WA 2YL2A 2IVTA 3DU8A 1H1PA 4O2BF 3SKCA 2BAKA 2WEVA 3DXPA 4O0TA 4AA4A 4J98A 3ZM9A 1DIKA 2BDJA 1XBBA 2UZLA 1W8CA 3RINA 5FDPA 4BGHA 3QFVA 4NZWB 1WCCA 2PWLA 4C3RA 3NR9A 3FPQA 5IUHA 3QUPA 3EKKA 3FZRA 3GCPA 4MXCA 2X8EA 3AG9A 1WBPA 2C3KA 4ZSEA 1WBOA 5A4CA 2UV2A 3LFCA 5AJQA 4F63A 2YA9A 5DA3A 4IVAA 2UZNA 3EZVA 2GS6A 2QU6A 3HGKA 4O91A 4G31A 1GOLA 4F7SA 1OL2A 1GGOA 4O7YA 5LYJF 4MV8A 4CFVA 1M0TA 2BALA 2OJJA 5FDXA 4X2JA 3FUPA 2VTLA 3GU5A 4IADA 1FVTA 3TG1A 2WMVA 4ZLOA 3OW3A 2R7LA 3F9NA 5E90A 4MA0A 2G1TA 3RPVA 3Q4UA 3RPRA 2PZ5A 3BE9A 3AMAA 4NTSA 5HLWA 3HMMA 5FP5A 3C4WA 3PSCA 4U42A 4FKTA 3SGCA 3HMOA 4OLIA 4CVAA 3ETJA 3KVXA 5FNVF 5HBRB 2X7GA 2UW8A 3MA3A 4DG2E 4E4NA 4M68A 4ZJVA 5IEVA 3UMXA 4P90A 1K2PA 3R8ZA 4EH8A 2GFCA 4XP3A 5DEYA 4TZRA 2CGUA 3KFAA 3QZGA 4FSUA 1BL7A 3QZIA 4I6HA 5D1JA 3FLNC 4IZAA 3WYXA 3VRZA 3QC4A 5EI8A 5ETCA 4LL5A 5JQ8A 4RX5A 2W05A 3GCUA 4IE9A 4MHAA 3KK9A 2C6MA 3PVGA 4I0SA 5FBNC 1DI9A 4I4EA 5KBQA 3W2CA 3U6JA 4C5BA 3HYHA 3LFBA 4B7TA 4FMQA 4FSWA 3VBQA 5AAGA 2VO0A 1H0VA 1XWSA 3NWWA 2WD1A 2Q0NA 4GT3A 3QTUA 3PE1A 5L6WL 3E8CA 2V5AA 3MV5A 4BDEA 4FNXA 4PL3A 3EQRA 4HW7A 1OECA 1AUVA 3IPHA 4AN3A 4FI1A 4N57A 2PMIA 1JLLB 2GS7A 5KNJA 3FZTA 5FM3A 3GC0A 3NAYA 3A61A 4I22A 2J0MB 3D83A 3VS7A 4JQ8A 4AFEA 4BDDA 1ZYDA 4YTHA 5CEOA 3S3IA 3E7VA 2Y6MA 3QRJA 5KKNB 5C03A 3Q2JA 3QU0A 3GB2A 1NXKA 1BUHA 4OGRA 1PY5A 4FUXA 1PYXA 4FIFA 3FMLA 2A4LA 3QQHA 4FVQA 4UB7A 4E5AX 3WZUA 5ANDA 3N6RA 1IOWA 2C5YA 4H39A 4ZXTA 5K5XA 2OXYA 2QKWB 4HYHA 4RWIA 1Q41A 4Y46A 3K54A 4FV2A 1H1RA 4MKCA 3QLFA 5DRDA 2GTNA 4C4IA 3VJOA 3LJ2A 3V8WA 4HVIA 4AZEA 2XB7A 4GT5A 4O81A 1IRKA 3MIAA 4W4XA 3UP7A 4AUAA 3PP1A 4QMVA 4JQ7A 3BYMA 4IJ9A 4FTJA 4RJ4A 3TWJA 2F57A 3NMUF 2QU5A 5JSMA 5KMJA 1RE8A 2R7BA 2AYPA 3OXIA 3R30A 2XKFA 1Q5KA 2PVMA 2OJIA 4RQKA 1K3AA 2VWBA 2R3HA 3HECA 3KL8A 3LM5A 1V0OA 4ORKA 4Y95A 5DT0A 2QD9A 3D5WA 1SVHA 3HRBA 2CZGA 3NNWA 3DBDA 4L9IA 4FYOA 3FI3A 1FOTA 3P86A 4QMSA 4BI2A 4QP2A 1XH7A 4P5ZA 4FKQA 5EOLA 4MTAA 2UUEA 1FPUA 4TYHB 5EYCA 1V0PA 1HCKA 4OR5A 3HMIA 2ETKA 4ME6A 4FKPA 4K6ZA 1OIRA 4ZTQA 4ZLYA 4ZTNA 4IX5A 4Q9ZA 3U6HA 1OKWA 4RRVA 5IMEA 3R9RA 5F94A 2XKEA 2GFSA 2O2UA 3AC8A 3RM6A 3T3UA 4HYUA 4Z16A 4CZTA 4FZAB 4AU8A 2J6MA 4UXLA 5LXMA 1MQ4A 2BAQA 4QPSA 3CGFA 3G90X 1NA7A 1PRYA 3VOTA 1FMOE 2OZAA 3NW6A 3SV0A 5I9WA 5KMIA 3OXZA 2Z8CA 1B38A 5EQYA 5JGAA 2NU7B 4YTIA 4RWLA 5L2TA 1I7LA 2R7KA 3DKCA 3ODZX 5AA9A 2W6PA 4EOIA 2WIPA 2ZMCA 2QLUA 4ACMA 5M57A 3D5UA 4GIHA 4DAWA 5LOHA 1OKYA 3R0TA 2YCRA 4KBAA 4N6ZA 4R78A 2X4ZA 5CLPA 1Y91A 3AD6A 3CD3A 3AT4A 3O50A 4IX3A 5A6OA 4KS8A 4LRJA 4CSVA 3HMNA 3KRWA 3JRXA 3ZH8A 2NRYA 4R7BA 5KUPA 1KE7A 2X2LA 4YLJA 3MN3A 2W9ZB 3TI1A 1SVEA 3I6WA 3LLTA 3R2BA 4KNBA 3CSVA 4LGHA 5DEWA 2V0DA 4H3BA 4JOAA 4TYEA 3WF6A 5LWNA 5LJJA 5EDRA 1AD5A 5IF1A 2VTIA 3OUZA 1JOWB 1H1QA 4G17A 4O21A 4ACCA 5IDPA 3O96A 2ITQA 4XG8A 4AOJA 5HBJA 1KJ8A 4RZQA 3QFFA 3LQ3A 4XS2A 1OGUA 3N4VA 2VWUA 3UOLA 3TKUA 1Y8GA 4YC8A 4XNEA 4GUBA 4JJRA 3PIXA 4FL3A 4PF4A 5I9XA 3OS3A 2PZIA 3NUSA 5LVPA 4APPA 4DGOA 4HVHA 4XLVA 5HVYA 4UZDA 1KOBA 4U44A 2XYNA 3QQKA 4V0GA 2QOHA 4EKKA 2V7OA 4KKGA 4X3FC 4HGEA 3TQTA 3R8MA 2VTHA 2CDZA 4N0SA 5ANGA 4FSMA 1CKJA 2PPQA 3QUDA 3RV3A 5M55A 2PK9A 4TYHA 3LFFA 2XYUA 4WRSA 5BVDA 5D8DA 3ZRKA 2OXDA 2ZYBA 2JKQA 4IMYA 4NM7A 2UW7A 2J90A 1Z5MA 3NIZA 2YS6A 4H1MA 4GVJA 2UW9A 4I5CA 4LGGA 3KN6A 4D28A 2WOTA 2CN5A 3OZ6A 4O0WA 3F5GA 3VBVA 2XK9A 3EQDA 3E5AA 4CKIA 3LE6A 2PL0A 3EL7A 2ITXA 1IA9A 2V55A 5GNKA 4V05A 3TCPA 3C50A 1YRPA 3KXZA 4YZNA 4B4LA 2H96A 3HRCA 4BCIA 4UWCA 3IONA 3OTVA 4A07A 4N70A 4RJ7A 3LQ8A 4FUYA 5FQDC 3PXZA 4JVGA 5K9IA 2IZTA 2GHMA 4EH4A 3OUUA 1MRUA 3ZCLA 1GZ8A 2GQSA 2BIYA 2EXCX 4HCVA 4L01A 3G8CA 4YAKB 4DFZE 3EN6A 4KSPA 3VS0A 1ZOGA 4BCGA 4YJPA 1UU8A 5C1OA 3ZSGA 4PMTA 1XH4A 3FMMA 3IW7A 4OTHA 5IQHA 2ZV8A 1GSHA 5DI1A 1O9UA 4FZFB 1AUXA 2E9UA 4U81A 3PXKA 5CI6A 1PXNA 3D7TA 3H9RA 2AC3A 3HP5A 3I0OA 3O71A 5GJGA 4YU2A 5JFWA 3FDNA 4F9CA 1OM1A 4NU1A 5EYMA 1Q8UA 4DTKA 5J7HA 2J50A 3FKLA 3Q6WA 3V5WA 1JBPE 4F09A 2HZ4A 2YZMA 3GIDA 4RFYA 1UKIA 2XBAA 4MF1A 3NLBA 2BMCA 5J87A 3F3ZA 5HNGA 4XX0B 3B2WA 3UG2A 3Q4TA 4JAJA 5EW8A 4EOPA 4YMJA 4QMWA 3QQJA 4YLKA 4F1OA 4YZ9A 4MBLA 4XYMB 3QTXA 2NUAB 3CS9A 3PA5A 5IQCA 2BHEA 3PIYA 4FTQA 3VHEA 4FV1A 4NSTA 3ZO2A 5JT2A 2XD4A 3DCVA 1PKDA 3W2OA 1URCA 2H6DA 2Z02A 3GXLA 5CI7A 5CB4F 2XA4A 4NM3A 5F1ZA 4AXAA 4BI0A 1KE9A 3NYVA 5E8YA 3VS1A 1J91A 1A48A 4WIHA 3TKHA 3BG5A 2DWCA 5C8YF 3R7UA 4DH1A 3ZBFA 4FG7A 3LPBA 5LXTF 2UZDA 1CTPE 2VTQA 4R5SA 1XH8A 5CY3A 5LCJA 2R82A 1KJ9A 3TACA 2X7OA 4YHFA 3ZO4A 4O2AF 1YI3A 2PZRA 4AGCA 2YIWA 4YJTA 2ZMDA 4G3EA 2W0JA 5JGBA 4DGGA 1PXLA 4K33A 5HCXA 4TPTA 4F70A 3EMGA 2WMWA 1FGKA 1H08A 3K5IA 4YZMA 3PPKA 2KTYA 3T9IA 3HZTA 1ZOEA 4QP9A 4DBXA 3NEWA 4O0XA 4R7HA 4FFMA 2JFMA 3R63A 3ZYAA 3BHUA 4PY1A 4ZEGA 2BZHB 4JR7A 4C3FA 1QPEA 2GNIA 5G6VA 4MD8E 5H3QA 2CNVA 4PTEA 4XP2A 3KVWA 4AN2A 3OY3A 4R3RA 4PX6A 3P1AA 3NUUA 5CF6A 2W4JA 4GSBA 5EDQA 3O7LB 4ZMEA 5DT4A 3UODA 2BKZA 3ITZA 2Y8OA 2EB2A 3DV3A 3EQBA 3VO3A 4DEIA 5TKDA 4EH2A 4TV8F 1YDSE 3NGAA 2W17A 2XP2A 4LMNA 3UOHA 4EGJA 2JKMA 4N4SA 3ZSHA 5GIOE 3LFNA 4FE2A 2C6TA 5FLFA 4BCKA 4MX9A 4M15A 1OMWA 4QYHA 4LOQA 3E8EA 2JIVA 1OVEA 4ALVA 4M84A 4CFFA 3SW7A 2VQDA 2X9FA 1KV1A 3MY0A 4MD7E 4F7JA 5ETIA 1GNGA 4XOYA 3AGLA 3OP5A 2JDVA 4W8EA 4KWPA 4FEXA 4IH8A 2RFNA 1YHSA 2PE1A 1MQBA 3FL4A 3O8PA 4RX7A 5B2KA 2R87A 1PK8A 4YBZB 4DCAA 5DIAA 2UW5A 2O8YA 3RKBA 3ZXTA 2WMUA 4O7NA 5IA3A 2QI8A 2YCSA 3CR0A 3SDJA 2ZJWA 2Y4IB 1H4LA 3H9FA 3LCSA 2EB3A 5FEEA 4E6DA 2W71A 1PMUA 1SYKA 2XM9A 3COIA 3O51A 3BHHA 4R1VA 4O22A 2R0IA 3H0ZA 2R7MA 4R6VA 4NKSA 1ZZ2A 4BCFA 5J9ZA 5BUEA 4DA5A 3DY7A 3ZUUA 3KA0A 2G2IA 2OF2A 2R3MA 3VBTA 2O5KA 1WVWA 4JLCA 3U4UA 4ZMFA 3E93A 5I9VA 3R8PA 2QOIA 3NUXA 3WBLA 4DFXE 4BY9E 2GHLA 3JXWA 5FRIA 5HX6A 3TUCA 3EB0A 5CXHA 5BYZA 4BBFA 5M4FA 4WG3A 3CC6A 4MXAA 2A27A 4QQTA 1EUDB 4XV9A 3TZ7A 4BRXA 1P4OA 2Z7SA 4CFNA 4DH3A 5A9UA 2E9OA 3CE3A 3F69A 2VN9A 4QNYA 4UN0C 5B7VA 2YZGA 3UZTA 3QHWA 3DNEA 1BI7A 4FT5A 1J7LA 4L3JA 5CU3A 2X1NA 2UZEA 2OG8A 2P2HA 2PTKA 3OTUA 4BGGA 4CT1A 3ORKA 3FQSA 4CT2A 2I7QA 1EUCB 3SXSA 5AUVA 1JKTA 5BNJA 2ITVA 4GIIA 4C4JA 4BDAA 3VNTA 5J8IA 4DINA 3ENMA 3AMBA 4PTGA 3ETHA 3MH0A 4W4VA 2I6LA 4CFWA 1YXUA 4MQ1A 3ULIA 4ID7A 2HZIA 3FI8A 3R01A 3D14A 4RIYB 2BKKA 4L7SA 4UYNA 3MS9A 2OZAB 3FWQA 2F7ZE 5EM7A 4MV7A 3QWKA 5M4CA 2OJGA 3G6HA 1Q3WA 4AFJA 3WF9A 1EHIA 4HGLA 3V6RA 3PA4A 1YWVA 4FK3A 2J9GA 3NNUA 1YDTE 5L2WA 3L9NA 3VS2A 1ZYCA 3GNIB 1GJOA 5IQBA 1WR2A 4GK4A 3UGCA 3P4KA 2P0AA 4I93A 4IC8A 4GEOA 1NVRA 5F9EA 1HCLA 2YM8A 4O0YA 3G2FA 4CRSA 4QQJA 2JDRA 4CFMA 3PZHA 4XJ0A 5AUYA 4I92A 4FTNA 3KC3A 4MWIA 4QYYA 5H8BA 5D9HA 4YJNA 5LQFA 2HCKA 4RG0A 4X3FA 1RDQE 3RPSA 3NX8A 3R71A 4I6BA 4NK9A 4ZY4A 5IMXA 5L2SA 2OF4A 2GQRA 3BCEA 2QG7A 3QTZA 4GV1A 1SZMA 4MYGA 5C8MA 1YW2A 4HQ6A 4QP8A 1QPDA 4FZ7A 4FSQA 4BCQA 1VYWA 2HYYA 2YHVA 5DR6A 4FICA 4H3QA 4YJSA 2YRXA 1STCE 1OPLA 3S1HA 2J0IA 5CU4A 2X0GA 1V0BA 4LL0A 2CGVA 4ZP5A 5AP5A 4NH1A 5C26A 1XBCA 2X0SA 2WTKB 4RA5A 3W16A 3DOGA 5AUZA 2Z04A 5EDPA 4F7LA 3OCBA 2HXLA 3RVGA 2ZAZA 4OTQA 1Z2NX 2QC6A 3G9NA 3I79A 4JG6A 4WUAA 3R9HA 3MB7A 4RVLA 2XBJA 1FQ1B 3PJ3A 2FGIA 4GYIA 3R9NA 3UQCA 4V01A 2YDKA 4EK4A 3QZHA 2FB8A 5F95A 2F2CB 3Q60A 3FLWA 5LP6F 4NTTA 3D2KA 1OI9A 2QOQA 1JDEA 2Y9QA 3UVPA 4M14A 2ACXA 5E8WA 1O6KA 5ITAA 5HE1A 3MJFA 4L43A 4FTUA 4ZOLF 2W99B 3AD5A 4I3ZA 2ZOQA 3JPVA 4YBKA 3UIMA 4ZLZA 2QO2A 4OT6A 5EI2A 5EM5A 4MBJA 5CAVA 1H8FA 3AC2A 2C6KA 3AD4A 4JDKA 4BDCA 4IANA 4EOKA 1Y57A 4C5CA 3D7TB 3A62A 2P33A 1W84A 5CS6A 5CVFA 2PMNX 5DBXA 3F3TA 3W2PA 2ERZE 4USEA 3P08A 3QD3A 5CZHA 1EYZA 2XNPA 4APCA 1EZ1A 3H30A 2XIYA 3FLQA 1SM2A 4X3JA 2QOCA 3ENHA 2XNGA 2PVFA 4ASEA 4DCEA 2WMQA 3WZEA 3F2AA 5LMKA 4QTAA 3DK3A 3MFUA 4KUJA 2ETMA 2WMRA 2YM6A 2X2MA 3OWPA 3QGWA 4GRBA 4IACA 3UC4A 3WE8A 4G3DA 4O4HF 3RAWA 4EH9A 3NPCA 4C4GA 2AC5A 2B9FA 2DUVA 5I4NA 4UX9A 2C00A 3KMMA 4WSYA 2W1ZA 3MYGA 3LAUA 5AV3A 3DGKA 4XHKB 2FPIB 4O96A 3KF7A 4FTOA 4FIGA 1YWNA 4L3LA 2SCUB 4EJNA 1G8SA 4AP7A 1DAWA 3W8LA 3O7LD 4GK2A 3WOWA 2VTMA 4G3GA 5F20A 3PXYA 4FOBA 3WIKA 4X6RA 2NU9B 4FKIA 4BHNA 3TIIA 5TOZA 1U54B 3NDMA 4C59A 3O2MA 3R7YA 4EHZA 1YKRA 4KBKA 3U9TA 4D2SA 4UXQA 5CA1F 1BKXA 4IWPA 1QMZA 3Q9WA 1P5EA 2PVNA 3GU6A 4USDA 4FNWA 4YNOA 1W0XC 5J95A 3QC9A 3DKFA 2C5VA 1M2RA 3FEGA 3RK7A 3R9OA 1IR3A 2XCKA 1Q99A 2PE0A 3DQWA 5E8XA 4AF3A 1IA8A 4F9BA 5C27A 4K11A 2W70A 3G15A 4JBQA 1CDKA 3FLSA 5E8TA 2J4ZA 2IW8A 3MVLA 4XYFA 5E8SA 5KZ0A 4ALUA 3H4JA 2QOFA 5AP6A 4YSJA 4JAIA 2CMWA 1H24A 4PNIA 1YOLA 5M4IA 5BQ0A 3JR1A 3VHKA 4O0SA 2XF0A 2GLTA 3I12A 3WZKA 5FD2A 3LJ0A 3T8OA 2QO7A 5JVLA 2ZV9A 3R00A 2VTAA 3JUHA 2VUWA 3DFCB 3ODYX 3R23A 4DITA 3S95A 3CD8A 4AW2A 3ERKA 5E8VA 1KEEA 1JAMA 4MNEA 4EORA 4TUYF 4FT7A 3HMPA 3HX4A 4EC9A 4EUUA 3FLYA 1ZMVA 1A06A 4GW8A 4XYLB 3R7VA 5IU2A 2W6NA 3ORPA 5LMBA 2I40A 3DJ7A 5JH7F 1Z57A 4I6FA 5CSHA 5CF4A 4Y73A 3DQXA 2WPAA 2QQ7A 2X8DA 5CEMA 3RUPA 2WXVA 3MFRA 1OB3A 3FQEA 4FVRA 3EFWA 3HV5A 4RQVA 5CU6A 5D7AA 4M0ZA 4ZTHA 4YP8A 3P7CA 2UVYA 2YYAA 3QQUA 1GZNA 4PRJA 4O83A 2R0UA 4G9CA 3QGYA 4QPAA 1VJYA 3QTRA 3EH9A 4RPVA 4AE6A 2H34A 3PWYA 5M44A 3KULA 3EWHA 3PG3A 3UVQA 3HL7A 3PJ2A 4LV8A 3QQFA 4U45A 3Q32A 3D4QA 1NY3A 4HPUE 5DGZA 4FU0A 3BZ3A 2OI4X 3IW5A 3TKIA 2W1IA 3P7BA 3LMIA 4MH7A 4HNFA 4BVUA 4FL1A 4GJ3A 2J2IB 5AIKA 3EL8A 3WZJA 3DZQA 3ZSIA 4JDIA 3PVWA 4BTJA 3NUNA 3VUIA 2XIXA 4IAZA 2QR8A 1JPAA 4L53A 5DR2A 4B8MA 1UVRA 3Q9ZA 4IZ7A 3SAYA 3DB6A 4WKQA 3TNQB 1REJA 5CU0A 3GC7A 5J9YA 1H1SA 2R7IA 4J7BA 2WTIA 3A4OX 3BYVA 5GIPE 3MVMA 5BVFA 4CKRA 3LXKA 4ZZOA 2YM7A 3CTQA 4NKAA 1JVPP 4YHTA 4F9AA 5KO1A 3R2YA 2LGCA 2JD5A 4OTRA 5JKGA 3ZDIA 3AXWA
chains in the Genus database with same CATH superfamily
4E7WA 2CHLA 2NNWB 2WELA 3DDQA 3EQGA 3GT8A 4O2ZA 2PHKA 4IM3A 4BCJA 3GJXB 4KKEA 2XNBA 2CJMA 2J5EA 3K5VA 2V58A 2W1FA 4HOKA 1G8AA 1BLXA 3VUDA 2PBZA 5IYZF 3C0GA 1QCFA 4C02A 2YIRA 4YB8B 3PUPA 5J2UF 2IPXA 3CEKA 3VMMA 3TIZA 4MXYA 3OWLA 4QMOA 3DKGA 2Z7QA 3M1SA 3Q96A 3HV3A 4KB8A 4QMUA 2OIBA 2UW3A 5EHLA 3UMWA 3RR5A 1KC7A 4EOSA 4WNPA 2C6LA 1PHKA 4ZSJA 4RBLA 4XG4A 1TQMA 3HA8A 2OW3A 5D11A 3CQUA 1DM2A 3FC1X 1W96A 4G6NA 2ZDHA 3LFDA 3HO8A 4BC6A 4DIMA 1LP4A 2ZM4A 3LHJA 2YCQA 4U41A 4EKLA 1BXRA 1TKIA 2C5XA 3EFKA 5C1QB 4CV9A 3OCSA 5M53A 4XV2A 3W18A 5JGDA 1OKVA 2ODTX 3NCZA 3ATTA 5ACBC 4XH6A 4RJ8A 4FEUA 2JBPA 4FR4A 4DFUA 3MB6A 3S0OA 3AKJA 3T99A 3IECA 5CAQA 2UZUE 4CMTA 2B52A 2CGXA 4BDHA 5AFVA 2BAJA 3SGIA 3MVHA 4NFNA 2I8CA 4CMFA 2W6ZA 3JZFA 3LFEA 1V1KA 4O4JF 4U3ZA 5CALA 2YW2A 5BWUA 2JDOA 2BCJA 3TY5A 2OLSA 1M17A 4P4CA 2HVSA 1ERKA 1WFCA 2WQMA 3QRTA 4L67A 3RWQA 5CT0A 5AV2A 1F0QA 4FZ6A 3R7EA 3LQSA 3TNIA 1PXJA 4OT5A 4BTKA 4Z3VA 5BWRA 1WBVA 1ZAOA 1UU9A 3IOPA 3R73A 3OT3A 3UO4A 3N9XA 5A4LA 3W0RA 4NJ3A 5HO7A 2BFXA 3BAAA 4YAJB 3ZFYA 1WBNA 4WBBB 3ANRA 3UE4A 3DJ5A 4FSYA 4EEVA 2WU7A 1IAJA 4O27B 3KKVA 1P2AA 5JQ5A 1I1LA 2BHHA 4MBIA 4CD0A 3LZBA 3ZONA 4KSQA 1TQIA 2HELA 2YM5A 2C6EA 3NW7A 4YC3A 1L8TA 3WARA 2YN8A 3OWJA 2Q83A 4AX8A 1H27A 4M8TA 5AP2A 5KMMA 4M97A 3DK7A 2CKQA 2PVYA 5H9BA 3TV4A 1OIUA 3EN4A 3GC9A 5BV3A 4AA5A 2WTVA 3AC1A 4BCOA 2QOBA 4FODA 3LVPA 4E4XA 3MFSA 3JZ6A 4O84A 4IB5A 4O7ZA 4W4WA 4M69B 3PG1A 4I24A 3NNVA 3RGFA 4YO6A 3PPZA 4UALA 3BELA 2PZYA 1Q61A 4PWNA 2FA2A 4Q9SA 3TXOA 2JBOA 3VAPA 2XJ1A 3OOGA 2OBJA 3SD0A 1IG1A 4AZFA 3TYKA 5CZIA 2I0YA 4PV0A 3KXHA 1ZXEA 4CNHA 4UCRA 4LM5A 3TV7A 5I5WA 4GLXA 4ALWA 4IW0A 1YOMA 4JI9A 4DH7A 4CKEA 4X7QA 1Q8YA 3VRYA 3ZC5A 3CIKA 3Q52A 3MFTA 4QP3A 2XRUA 4NW6A 4XCUA 1ZWSA 3V6SA 3V5PA 3QKMA 4I6QA 5JZJA 2NYAA 3JY9A 3U51A 5EG3A 4CMUA 4UY9A 3MSSA 3FBVA 1X8BA 5CSVA 5JRQA 2OJFE 2R3JA 3F61A 2PVPA 5A4EA 4QQ5A 1ZYJA 2JITA 2P4IA 4I5PA 2P2IA 4YBJA 4YJOA 5AX9A 3TW6A 3H3CA 4IAAA 5J1WA 4QP4A 3E8DA 3P5JC 4QMZA 2XJ2A 4GKHA 5BMMA 4DEEA 5KHXA 5IQIA 3NRMA 4DEAA 3MTFA 4TNBA 2GMXA 2HAKA 2WKMA 2YAAA 5ANOA 3HA6A 2UW0A 4PTCA 1J1CA 3LQ5A 1H26A 3E7OA 2HJWA 4NCTA 4ZAUA 5BVNA 4FV8A 5EOBA 1ZZLA 2YIQA 4TWNA 4DH5A 3R6XA 4E6CA 4UV0A 3VS6A 1Q24A 4ZQIA 2GHGA 2QKRA 2FVDA 3BEAA 4KKHA 5ETFA 2HW6A 4F1TA 2VWWA 3V4ZA 3LCTA 4RIOA 1YVJA 1FBNA 2IO6A 2W1GA 3HV4A 3HAVA 2RL5A 2EVAA 4IHPA 4LV7A 4JRNA 5K3YA 1FVRA 1H25A 3CY2A 5CF5A 3PSDA 2QODA 1PXIA 4ZSGA 3FC2A 2ZB0A 3OCGA 2R3KA 1JSUA 4ITHA 3V51A 3I5NA 4TV9F 4GYGA 4FFRA 3D2IA 4BYJA 2OK1A 2GNLA 1MP8A 4KA3A 1CQIB 3ZMMA 3NYNA 1KEEA 4I5MA 2BIKB 3GCVA 2BILB 2WQBA 4IZOA 1E9HA 3FMJA 4XRJA 3FXXA 1BNCA 4BIBA 3BHVA 1M7QA 4AXFA 4BTFA 4CLIA 5IH5A 3W0SA 3GLKA 3FLZA 3I4BA 3VS3A 4FFNA 4L44A 4BB4A 5BVEA 5F4NA 3R5HA 1ZLTA 5IG1A 4FKRA 4QTBA 4DFLA 1CKPA 3OXTA 3EQIA 3UYSA 3KEXA 2R3PA 4OTGA 3RAKA 1O6LA 4AGDA 1XH6A 2HIVA 4I4TF 4I94A 1G3NA 1YI6A 4IZ5A 1TQPA 4II5A 3HUCA 2PUUA 4AWIA 4GKIA 2VPQA 4F0GA 4FSNA 1PX2A 3PJ1A 4ZK5A 3HB9A 1XH5A 2WO6A 5CA0F 3MA6A 5EYDA 3LXLA 2VZ6A 5E4HA 4X2FA 4DEGA 3FYJX 4JG7A 1JKSA 4RVTA 5GJDA 4EBVA 5HORA 2QF7A 3V5LA 1YHWA 2GNGA 1LUFA 3EIDA 4O2PA 3A8XA 3TJDA 3ZRLA 2OU7A 4IFCA 5KX8A 2ITNA 2XK4A 3PSBA 3ZEPA 3R7IA 2P0CA 2VO7A 3QQLA 4TWCA 1KJIA 2X4FA 2PUIA 3DLSA 3D94A 4U43A 3EHAA 3UPXA 1Q62A 4HZSA 3GU8A 2QR7A 3KULB 4G9RA 3FJQE 1PXMA 4BCMA 3UZPA 1AGWA 2FSOX 4R3PA 3KRLA 4A9UA 4AQCA 5AADA 1BMKA 5HCZA 2XZSA 3MVJA 1GAGA 4C4FA 3NW5A 2BVAA 2GNFA 4C58A 4FV3A 3I7BA 5IA5A 4OBOA 3HT5A 3F7WA 4DC2A 2FO0A 2ITOA 1IASA 4XOZA 2VTOA 3QZFA 3QD2B 4YC6A 5AP1A 2NPQA 4D4SA 1DAYA 3I5ZA 3MJ2A 2PVJA 3DBEA 3OFMA 3UNJA 1M14A 1ST0A 4BDKA 4ANSA 4GMYA 2XARA 5A6NA 4EEQA 2F49A 3O23A 1GIHA 4M12A 4RIWB 5IA4A 1URWA 4MNEB 1Y8YA 4EONA 3AKKA 5JFSA 2I80A 3KF4A 4TY1A 3WI6A 3CBLA 3BLHA 4NZOA 3CTHA 2FH9A 4YPDA 4IAIA 5DHJA 3QXPA 5HO8A 3FXZA 1OZ1A 1C30A 4RJ3A 1J1BA 3SC1A 1I09A 2ONLC 3DB8A 3PRFA 4C34A 1XR1A 3WWIA 3F66A 3DDPA 4O38A 4H05A 4O6LA 2OO8X 2QONA 3DLZA 4IBMA 5FEQA 4HNTA 4RA4A 5EQPA 2ETRA 3G5DA 4FK6A 2C1BA 2PMOX 4IEBA 5AA8A 1KWPA 4QDEA 5EZYF 4L42A 3O8TA 2V5QA 4FTMA 5HHWA 3RAIA 2BR1A 5CAEB 5HE3A 4BZDA 4EWHA 3Q2MA 3QL8A 4IM2A 5E1SA 4PP7A 1SVGA 3B8QA 2CGWA 2OJ9A 3UOJA 5LVLA 3KN5A 3UO6A 2OFUA 2XK7A 5DYJA 4BHZA 3F88A 1LEWA 4IC7A 4ZS0A 2RFEA 2PVLA 2C3IB 2X6EA 5I9YA 3R5FA 2W7XA 2ZB1A 1U54A 2C5NA 3PFQA 4FG8A 5HNEA 2R3LA 3E64A 5E92A 3TZMA 4AAAA 4S32A 4OW8A 3UQFA 3F5XA 4RC4A 4M9UA 3RFCA 1ZRZA 5C9CA 5IEYA 5HE2A 3EQHA 3FL5A 2VX0A 2GDOA 5ACKA 5ANIA 3JS2A 5IISA 4MXXA 3A7GA 4B99A 5JEBA 1BI8A 2WZJA 4EH5A 5DLSA 2XNOA 5EKOA 4PMPA 2R86A 3UZBA 3KIOC 4AZVA 1GIIA 4FT0A 5HG5A 4CEGA 2F7XE 2HWOA 4E93A 3MWUA 5AUWA 2X7FA 4C36A 4UCSA 3F2NA 2BZKB 2ZGIA 4G6OA 4I50F 4DGMA 4YTFA 4LRKA 1T46A 4U9AA 2C47A 2C6DA 4NW5A 4AT5A 1XO2B 4FNYA 3BYUA 1XQZA 2ONLA 3DXQA 3PUFC 1KSWA 4DE4A 1L3RE 3AOXA 4BBMA 2R4BA 5HGIA 2OH0E 5M09A 4QMXA 3R7OA 4U5JA 5AM6A 2COIA 4S34A 4D1SA 2DS1A 1KE8A 3E92A 3D5XA 4B8LA 1PYEA 5DISC 4YSMA 5FM2A 5EH0A 4BF2A 4EQUA 2B9JA 3A7IA 1MRVA 1RW8A 3LCDA 4F6UA 3RTPA 4D9TA 5LARA 3EZRA 4AGUA 4TWPA 4C0TA 3N4UA 3U8WA 4D1ZA 4E4TA 2C30A 5KKRC 3K5HA 2DYLA 4HYIA 3RV4A 4D0WA 2PVKA 3QBNA 4Z7HA 3BLQA 5BVKA 2ZV2A 3HEGA 3OUKA 4D2RA 3VBYA 3PY3A 3CQEA 4IM0A 2YCFA 3W33A 3UDBA 4JX3A 3E62A 1UWJA 1Y6AA 4IVCA 3G33A 1FVVA 2BTRA 2PY3A 3L8SA 4IJPA 5CVHA 3BWJA 3AC4A 2QVSE 4LG4A 1YXXA 3UNKA 1OIQA 3G9LX 3QCXA 4FKUA 3BYOA 4HGSA 5E9EA 1OL7A 3C4EA 3PXRA 4QMTA 2R2PA 2CLXA 2VTPA 3MDYA 3N4TA 2C0OA 3VIDA 2J5FA 4D5KA 4G6LA 3O0GA 5AP0A 3SQQA 3VULA 3ZFMA 2A1AB 1DI8A 4DHZA 4BJJA 4FG9A 4FV0A 3FY2A 1OL6A 3LW0A 3T54A 2RG6A 1PMNA 2XNNA 2W1DA 4QOXA 5IA0A 2XNEA 1ZY5A 1Q4LA 4XEYA 2P3GX 2LAVA 3RJCA 2ZM3A 3VS5A 5EI6A 1R78A 2IP4A 3RP9A 4YLLA 1YXTA 1KE5A 2HIWA 2XVDA 4CLJA 1LEZA 4PMSA 2A2AA 2ZVAA 4H1JA 4RZWA 3R9DA 3HP2A 3KMWA 4G5PA 4B9DA 4AACA 3C13A 5FTOA 3TIGA 2BUJA 4FTCA 3KCKA 3QA8A 4HYSA 5HU3A 3GQLA 3R04A 3FSKA 3DBFA 3C0HA 4XBUA 5L8LA 3TINA 5IUGA 2PE2A 3LXNA 1QPCA 4FX3A 1XKKA 2BRNA 3VUMA 3O8UA 2WB8A 3R1YA 4OTWA 3M42A 3TM0A 2I0EA 4ONAA 1OITA 2ZM1A 4MWHA 1Z9XA 3GBZA 4AZWA 3S00A 5HLPA 2HHFA 5C4LA 2X2KA 3CSWA 4FEQA 5JVDF 4E6AA 2J7TA 2J0KA 2C4GA 3KXGA 4QO9A 2WMAA 4FKOA 2WFYA 2CKPA 2O63A 5DRBA 2YZLA 2F2UA 3ZZWA 5BX0A 3IKAA 4YTCA 5HZNA 3P7AA 3NVKI 4QMPA 4ZS4A 3GOPA 1R39A 3P0MA 5CAOA 3ACJA 4AGWA 3ZLWA 3BL7A 3RK9A 4OBPA 4R77A 4IDTA 4KRDA 4DLJA 4EQCA 5HG7A 2ZDQA 3ALNA 5HESA 2WAJA 5I0BA 4FTLA 4HVDA 4ZZNA 4DT9A 2E9PA 3WZDA 4DDGA 5LOVF 2XKDA 3K3IA 3WIGA 4C5AA 4KBCA 5CWZA 3IGGA 4Z7GA 3Q2OA 3VUHA 3RALA 2JAVA 2JDTA 1AQ1A 5IA1A 1OIYA 3TUDA 1CKOA 3BQRA 1YI4A 2QCSA 3KXMA 2W4KA 4AW1A 3E88A 1W93A 4H36A 3ULZA 3PPJA 3V3VA 4DQNA 2OLCA 3ORTA 4WO5A 5LVMA 2C6IA 1NW1A 3SG8A 4WOVA 5HTCA 5AUXA 4L1KA 3QYZA 2VWYA 3BABA 3OMVA 5DMXA 1PXKA 1I7NA 5HCYA 4PDYA 4YZBA 5IQFA 3I0QA 2ZDGA 2XNMA 4QTCA 5I5SA 2GCDA 5JQWA 3Q4ZA 5HV6A 5DT3A 3GI3A 3CKXA 4ASXA 1YDRE 3CPBA 2VTJA 5AV1A 4FSZA 3NUPA 1PMVA 4MCVA 4FIHA 1G8KA 3LWBA 4GUEA 3MPMA 4E1ZA 5KE0A 1I2LA 4EQMA 4CQEA 2RIOA 3BGPA 4B6LA 2JFLA 4JXFA 4BCHA 1REKA 2HOGA 3OD6X 4FT3A 3TNPC 3ZHPC 4A06A 2Y4IC 1P14A 2OXXA 3QCYA 5EHOA 4ZY5A 5EKNA 3CLYA 4CFXA 1VBGA 3TL8A 4OBQA 4E6QA 3VONA 1RJBA 4RMZA 2Z2WA 3LLAA 3UYYA 2UZTA 3BGQA 2CPKE 2J0LA 3PP0A 1U59A 5DH3A 2I0HA 2WHBA 3KAKA 4YJVA 1ULZA 3AMYA 4C7TA 3CGOA 1WAKA 1ZY4A 1R0EA 1XHAA 4IAFA 4XRLA 3FKNA 3LFAA 4ZTLA 5AEPA 4WNMA 3TNHA 3OEFX 4XG7A 4BR3A 4L00A 2B1PA 4GVAA 5A54A 3FHIA 4FTTA 3NAXA 4L45A 3IDBA 4IAKA 2VV9A 1JKKA 3KAJA 1J7UA 4F78A 3L9LA 2PMLX 3PJCA 5J5SA 2UVXA 2XUUA 3FZPA 4FC0A 5BPHA 2REIA 4FKGA 4XV3A 2HGXA 5K5NA 3QWJA 2WNTA 3QALE 5KCVA 2NU6B 2XK3A 4RIXB 5FEDA 4L3PA 3NYXA 3PVBA 2IZSA 5HG9A 3RWPA 3SRVB 1EKFA 3F82A 3MIYA 4FL2A 4EL9A 3DTCA 2BFYA 4F1MA 3THBA 2UZVA 1OL1A 2GNHA 2ITYA 2WQEA 3TUBA 5ANKA 1J3HA 2WOUA 1NVQA 2PVHA 3BIZA 5AAFA 2QK4A 5IQGA 4RWKA 3U9CA 3DF7A 4KAOA 4KIQA 2YIXA 4PDPA 3SHEA 3KGAA 4PDOA 2CNUA 4U7ZA 4CG8A 3QWUA 3CQWA 2EXMA 3LKMA 4JQEA 4AT3A 3QX4A 4D4VA 3CP9A 4AXDA 4UWYA 4DG0E 2IJMA 1KUTA 4EC8A 2FUMA 2YABA 3Q53A 4MNFA 5DG5A 5HLNA 1ZARA 3SG9A 3DZOA 2YZNA 2RFDA 4GLWA 4AW5A 4GG5A 4K6NA 4LUEA 5CENA 2PULA 4QYFA 3JVSA 4GJ2A 3ZUVA 3GEQA 3E63A 2BRBA 3PFFA 2GS2A 2JKOA 2R3GA 4NWMA 1XMLA 4EI4A 4EGQA 1FGIA 3TZ8A 4KS7A 5DE2A 4BI1A 2O0UA 4C37A 1UNGA 4ZZMA 4ZJIA 3VW6A 4J8NA 3JY0A 5K2MA 3PY0A 3NYOA 4R5YA 4BZNA 3LCKA 5ANJA 4JG8A 3QKKA 4O0RA 5DNRA 3W32A 1PXOA 4C35A 4U79A 3D0EA 3DBCA 4GFOA 5AUUA 3R5XA 2JIIA 4M13A 2F7EE 2QOKA 4QP7A 2XK8A 3UJGA 2DLNA 3K5UA 3EQCA 2VTSA 2J0JA 4D4YA 3AKLA 3ZEWA 5IDNA 4LUDA 3RZBA 3WE4A 3TDVA 1R3CA 2FSLX 3BEGA 3ZXZA 3T9AA 4W8DA 2A19B 1CM8A 2G2HA 3LMGA 4GK3A 5D41A 3RAHA 4D1XA 4L68A 3GENA 4O0UA 3U4WA 4MV3A 1OPJA 3ANQA 3R1NA 4BIDA 3BGZA 5JH6A 4LFIA 5CF8A 4TL0A 2YIYA 2QOOA 1M52A 1UU3A 3D15A 4DHJA 3DXNA 4X2GA 2OIQA 3HV6A 5HNBA 3OVVA 3R1SA 2GPHA 3F6XA 4OTFA 5CSXA 3OHTA 4WBOA 3UNZA 2HHFB 3UQ8A 5HE0A 3POOA 4QT1A 3MWEA 2UVZA 2C0TA 2E9NA 2Q0BA 4D4RA 4O86A 5HG8A 3BU6A 5B0XA 3W2RA 3T9DA 3VA7A 1TVOA 4FIIA 5LA6F 1OBGA 3JVRA 1GZOA 5GHVA 3KY2A 5I9UA 5L6PA 5A4QA 2J51A 5I5VA 3DAEA 3H0YA 3EN5A 3I1AA 3OUNB 3GOKA 1LR4A 3Q6UA 3P5KA 5AAEA 4MXZA 4Z55A 4HR7A 4DFNA 3ID6C 2VX1A 3FMDA 3SW4A 3ZTXA 3D9VA 3DFAA 4CTCA 3KRJA 1DS5A 4EZ3A 1KJQA 2XIRA 3R23A 4IWQA 4G1WA 2PN1A 4F0FA 3C0IA 2WGJA 2WMBA 2ESMA 3C1XA 3OWKA 4CRLA 3TY9A 3JRWA 4GU9A 2R5TA 5HX8A 1A9XA 3G51A 3ORQA 2ITZA 4H58A 3DTWA 4PP9A 4YNEA 4XLIA 2JAMA 4IWDA 4PZ7A 4UYAA 4AE9A 4EK6A 4EWQA 3R8VA 2R3QA 4IIJF 1R0PA 3QUEA 4FKSA 4D5HA 3SOCA 3COHA 1BX6A 2XRWA 4FFPA 2QB5A 3OG7A 4BBEA 3TJCA 3LFQA 2QURA 5EHYA 3PJ8A 2HW7A 2VUGA 4ANBA 1EH4A 3AQVA 4Z9LA 2ERKA 3D7ZA 5AM7A 1FVIA 5ETAA 2BZJA 4LMUA 5FBOA 2BRMA 3F5UA 4CV8A 4M0YA 4CFUA 4CZUA 4IWXA 1UWHA 3BBWA 3U9SA 4NM0A 5E8UA 5C8NA 2WMSA 4O7VA 4KRCA 4AW0A 4F4PA 3UBDA 3QRKA 3U87A 1UV5A 1SNXA 1M6VA 3K3JA 3FSFA 4ASDA 2HZNA 1R1WA 4FTIA 1PKGA 3I7CA 4EYMA 4USFA 4IIRA 4LH7A 1YOJA 4MK0A 2DZDA 2C68A 4PDSA 4ZJJA 3R02A 5JRSA 4U6RA 3UFXB 2W06A 1A3GA 2R85A 2HY81 3PIZA 3MH3A 2NP8A 3P79A 4QMYA 4NM5A 4QQCA 1YXSA 4E8AA 4GU6A 4V0GB 4I55F 4ERWA 2XEYA 1CKMA 3F5PA 2BTSA 4MVFA 5EM6A 5JK3A 4XZ3B 2VTNA 4JIKA 1UA2A 1Q8TA 3EN7A 3IDCA 4FNZA 1Z2PX 2XEZA 3FXWA 3F3UA 4CC6A 1B39A 2HY0A 4EK5A 5I5XA 4FFLA 2VO6A 1JKLA 3ET7A 4JL9A 3TEIA 3HKOA 4IFGA 4ZIMA 2BDFA 3DTGA 1YWRA 3ORMA 4FIEA 1E1VA 3E87A 2HGWA 2W6OA 3CPCA 5IH6A 4Q4DA 1UKHA 2VWXA 3A8WA 4RIWA 2WTJA 3MW1A 4IVDA 4IX6A 5BMSA 3OF0A 5CVGA 1JSTA 3OEZA 4F9WA 1XBAA 4X3FB 3V4SA 3ORLA 5HD4A 2OICA 2CLQA 5FXSA 3RPOA 1ET0A 1SNUA 3C4ZA 4FKLA 2WMXA 4EH3A 4WA9A 3EYGA 4R1YA 5J9LA 3FY0A 5FGKA 5BUJA 4KIOA 3E5NA 2VO3A 5CXZA 3CJGA 4G3FA 2C6OA 2R3NA 4Q2AA 4WBNF 1W82A 4FGBA 5H80A 4BDIA 2QHMA 2WTWA 2W5HA 4GFGA 4PUZA 5J2TF 3E8NA 4X2KA 4JRVA 3EN9A 3KALA 4JDHA 2IZRA 4JR3A 2HGSA 3NUAA 5AUTA 3NZ0A 5IA2A 3RTXA 3IQ7A 1S9JA 3TZ9A 2DIKA 5AP3A 2B0QA 3EJ1A 5DFPA 4DLKA 1H0WA 2C3LA 4IQ6A 2DWBA 4ZSLA 3WO0A 2WYOA 1Q3DA 4YURA 5LCKA 3JSNA 1F5QA 3BHYA 3GC8A 3GU7A 4XBRA 4DF3A 2G9XA 4UWBA 3II5A 3TTIA 4FKJA 4U80A 4LYNA 2IVVA 3W2QA 3W5OA 5J1VA 2B4SB 4YO4A 2QNJA 4K0YA 5L8JA 1OUKA 2PU8A 1YHVA 3B2TA 1ZMWA 4I41A 2QG5A 4AN9A 1XH9A 2C1AA 2CCHA 2VNYA 3QTSA 4O7WA 5DPVA 5IZFA 5CU2A 4CTBA 1JDBB 4F08A 3F3VA 4BICA 3SVVA 4JNWA 3TT0A 3QLGA 2Q2TA 1H1WA 1WMKA 3C5IA 2RF9A 2ZDUA 3FMKA 5TR6A 3ROCA 4ARKA 4O4IF 3ZUTA 4FOCA 4X2NA 1W7HA 3N51A 4FTRA 2WTCA 3DAKA 3VS4A 4TYIA 4DGLC 4FTKA 2FPGB 5HBHA 5IUIA 4QYGA 3R28A 5JQGF 3FI2A 3PZEA 4XMOA 4DFYA 4ITIA 5KMLA 5CT7A 3W2SA 4Q5EA 1Q8ZA 4FV4A 1B6CB 3AT3A 4LRMA 4PL5A 4QMMA 3MBLA 4JT3A 4RWJA 2F9GA 4WNOA 2R64A 3MPTA 1F3MC 2PUNA 3AC3A 3DKOA 4YUQA 1M0WA 4GCJA 1CSNA 4OTIA 4C2WA 2VX3A 2O65A 3QD4A 4L6QA 3A99A 1GSOA 2GNJA 3UZRA 2C3JA 1DGSA 5HNIX 2WTKC 4D58A 5ICPA 3W0NA 3UO5A 2VWVA 3PFYA 2KULA 2XALA 4M7IA 2YERA 1A0GA 2FP4B 5HU9A 4EHVA 1GZKA 3FV8A 4RLKA 4TXCA 4LOOA 5EQEA 4EOOA 3FYKX 3W1FA 4DT8A 4D9UA 2W6QA 2JDSA 3PVUA 4BDBA 3K2LA 3WF5A 2FSMX 5BYBA 4FV6A 4MAOA 3T7AA 4YZCA 4OTDA 5BPFA 4O6EA 4N6YA 4I23A 4MQ2A 3EFLA 3HAMA 4JS8A 2YFXA 4EOJA 1JQHA 1FINA 3BA9A 1OL5A 5CQWA 4S30A 4BDJA 2DQ7X 5JFVA 4YR8A 2ITWA 2QLQA 4A9YA 1ZMUA 4BZOA 2YWVA 4TT7A 3FMNA 3DA6A 2HIXA 3GB8B 2YITA 4GS6A 4NUSA 4AXEA 2IWIA 2Y4PA 4Y83A 1Q8WA 5IH4A 4F6SA 2Q2UA 3MPAA 4IB3A 3U54A 3WYYA 4BTMA 3ZBXA 3UP2A 4BCPA 4KD1A 4Y5HA 2Q7DA 2VTRA 2X6DA 4YJ3F 5D1OA 3UIBA 4LV5A 4WG4A 3ORXA 2GQGA 2VWZA 2WIHA 4UEUA 2WEIA 2A0CX