4O7SA

Saicar synthetase (type-2) in complex with tmp/tdp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
MIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with TMP/TDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7sA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7sA02
1PW2A 3FLQA 2CKOA 3E63A 3R8LA 2HW6A 3P23A 2NU9B 2A4LA 2C0OA 2HWOA 4RA5A 3ZLYA 4FV2A 2XA4A 4YZNA 2JKMA 3FSFA 2EU9A 5HVJA 4BDFA 4L3JA 3PPKA 1Q8TA 4Y83A 3UE4A 3UQCA 4Q2AA 4BTMA 3EZRA 4L46A 4YLLA 4B8MA 3LMIA 4J99A 4FT3A 3R8MA 1Q99A 3KXMA 4I6QA 2ERKA 4FTLA 4M0YA 5ANDA 1ULZA 5CANA 3HMPA 4WO5A 3DAJA 5AP0A 1Q3DA 5M06A 3E8NA 3W18A 1KE7A 3A61A 4FKOA 3EWHA 2LGCA 3IDCA 3BHHA 4GVJA 3TXOA 3TM0A 2WMAA 3PXFA 3V5JA 2WMSA 1WZYA 4IACA 4JT3A 4DTBA 1YW2A 3RKBA 4BZDA 4EGJA 1UU7A 2GMXA 4HVIA 2BZJA 2I0HA 4GU9A 4HGLA 3ORRA 3H9RA 5IQFA 1PF8A 4XG3A 5EYMA 3OC1A 4DFBA 3UTOA 1MRYA 1TVOA 4HCUA 2YM8A 4KNBA 3II5A 2BTSA 2VRXA 3ULZA 4E4XA 5DRDA 2XKDA 5CF8A 2OIDA 3IQ7A 4E4NA 4RLLA 5FTGA 4M15A 5CEPA 4W4WA 2UVXA 2V62A 1RE8A 3L8PA 5FUTA 5CT7A 4RC4A 3UVQA 2XK7A 3ZLWA 1JKSA 4FFPA 3BBWA 4IM0A 1SZMA 3EQIA 5GJDA 2O0UA 4MWIA 2WMUA 2OKRA 5J87A 4MA5A 2YCQA 2E9NA 2P4IA 2PL0A 3QF9A 5H2UA 1QPEA 4EBVA 4FZDB 2R7MA 4IAKA 4JR7A 3HEGA 2XBJA 3GCPA 4LV5A 5HICA 1YOJA 2QOQA 1W82A 2WXVA 5CU4A 3HB9A 1O6KA 4AT5A 3DJ5A 4M14A 2I87A 2H96A 4BIBA 1OIQA 3FLZA 5HU3A 3MWEA 4TY1A 1OL2A 5DVRA 4XJ0A 1OKZA 4XLVA 3SX9A 3IW8A 4NWMA 4NKSA 2HELA 4FFNA 2Q83A 1CE8A 2V5QA 4FL2A 4TWPA 5M56A 1LEZA 2C6OA 5FM2A 2BAQA 2W1ZA 3ANRA 3FZOA 3N9XA 4I3ZA 4QMSA 4BDJA 2XK4A 4XG8A 5TF9A 4IEBA 2HENA 2VGPA 4LUDA 5DYJA 4QMXA 3VBVA 4MV8A 1ZOEA 2XB7A 3MFRA 1P14A 4BCMA 4I4EA 3HDNA 4XX9A 1JDEA 4FKUA 2UVYA 2VAGA 3G2FA 4O7TA 1H27A 4GRBA 5AUXA 1Z2NX 3L8VA 2OIBA 3ITZA 4HPUE 3HV4A 4J52A 4S32A 3UODA 1CMKE 1SVEA 4AZFA 4C0TA 5BX0A 5C1OA 1PY5A 3R01A 3DJ7A 5HCXA 3G8DA 1KV1A 3DS6A 3POZA 1ZY5A 2PVPA 4EOOA 1G3NA 3GP0A 1WMKA 3C7QA 2B7AA 5E8SA 2R7BA 3QFVA 4FKJA 3LCTA 3TZ8A 4C59A 3RUPA 1SVGA 4X2KA 5IQEA 1YWRA 2XCKA 4A4XA 3LM5A 4G3FA 4IADA 4ZSJA 1JSUA 1PKDA 2GHLA 4EUUA 3MBLA 4R5SA 2QONA 2YAKA 3OOMA 4WG5A 2FSMX 2WMVA 4CZTA 1IOWA 1Z2PX 2UV2A 3TTJA 2X8DA 2X8IA 5H80A 3K5HA 5JQ5A 5HBRB 3U51A 5KUPA 4QMUA 5CQUA 2PVYA 3D9VA 3GEQA 4AW1A 4ME6A 4TUYF 5EQYA 4ZEGA 3VN9A 5J95A 2VWVA 5EI8A 2W9ZB 5I9VA 4EG0A 4PNIA 4ZJJA 2UUEA 3FBVA 5FEDA 4F9WA 3QGYA 3ZDUA 2PE1A 3FL5A 3QAME 4BI1A 2GSFA 3QKKA 3V8SA 4F7JA 4PL4A 3VF8A 4QRCA 4B99A 3LKMA 4DEGA 2JFLA 2VV9A 3ZOSA 4FR4A 4YO4A 3LXLA 5FDPA 3IW6A 3OD6X 2JIIA 1YVJA 3RPVA 4FFOA 4GVAA 2UW3A 5BVWA 4O96A 4BIDA 4V0GB 2H8HA 1E4EA 3LXKA 1B39A 2OIQA 3PY1A 3WI6A 3SVVA 4FTNA 3MA3A 2OZAA 3WZDA 4HYSA 1Q5KA 1VYZA 3F2NA 3MW1A 4M68A 4IFCA 2XP2A 4QTDA 2CNUA 2ZVAA 4I5MA 3ZONA 3NVKI 1J91A 4P5QA 1R78A 5EYDA 4C4IA 4X2FA 2VTOA 4FTMA 1M2QA 3UNZA 5IEXA 5GHVA 4Y5QA 3L8XA 2ITOA 3OHTA 2R3PA 3E7OA 4ZZNA 2YWVA 3V6RA 5HTCA 1U46A 2W17A 3Q5ZA 4I20A 2ZV2A 5E7RA 4RVLA 3EQHA 2ITTA 2I1MA 2QURA 3IKAA 3MPAA 4M7IA 1P2AA 3R22A 4JIAA 4UV0A 2F4JA 4FK6A 2OXXA 4EBWA 4GK2A 5T68A 3UOHA 5IMEA 1BMKA 3F3UA 3NUUA 3KN5A 3O51A 4X2NA 3FYKX 4G1WA 4NM7A 4U41A 3D14A 4QQTA 4I94A 4YJ2F 5L8LA 3Q60A 2JDOA 4EK5A 4ZJVA 2GPHA 5EZYF 3O23A 3Q1KA 2BKZA 2UZNA 3QRJA 4Y72A 2C6EA 2ZB1A 4JBQA 4L8MA 3JZFA 3S3IA 4H05A 4CT2A 4ASDA 4YSMA 3LP8A 2YCRA 3LCOA 5LARA 4UZDA 4PMPA 5KO1A 3DLSA 4L67A 5LMKC 3E88A 2FUMA 4HGEA 3C0GA 3Q4ZA 3RFCA 3TNPC 4P7EA 5ETAA 3D7ZA 1GSOA 4XV3A 2EWAA 2OI4X 1PXNA 3LOKA 4NFNA 2JDRA 4RVMA 5D1JA 3MS9A 3ETAA 2OF2A 3HVCA 4TL0A 2PE0A 1ZMWA 3P79A 4ZS0A 2VO7A 4GK3A 4HNTA 4QP8A 3NUXA 2WIPA 4IB5A 1EHIA 4CFVA 2AC3A 4AG8A 2ITPA 4O91A 2W7XA 4FG8A 4O7NA 2CCIA 3AMAA 4YZDA 5J9YA 5IQGA 1KJQA 4M8TA 2BHHA 3DOGA 3MTLA 4BCNA 1VKZA 3EQBA 5CEQA 1OKWA 3VF9A 3BIZA 3JVRA 4EH8A 4IZOA 4C62A 5HG8A 4EH3A 2ZDUA 2B53A 4CNHA 4WG4A 2X2KA 3MI9A 5F94A 5DFPA 2PBZA 1WBOA 2WMWA 1OL6A 4IZ5A 4V05A 4IE9A 2OJGA 2W4OA 4L3LA 1GGOA 3FC2A 3DK7A 2JC6A 3QZIA 1U4DA 1F0QA 4J8MA 3EH9A 3MH2A 5HO7A 3KVXA 3MDYA 3KXGA 3NW6A 5F1ZA 4L53A 1Q62A 2GHMA 2XNMA 3JVSA 5HIBA 4LQMA 3W8QA 5JVDF 4DCEA 1UNHA 3E3PA 3NCGA 1UU9A 3FI4A 1IEPA 4PMSA 4NYEA 3B2WA 4BCQA 4TNBA 1PXLA 4ONAA 3M1SA 2C68A 4RMZA 3W8LA 1EYZA 4DG0E 2GPWA 3FMHA 2HYYA 1P5EA 1PYEA 2R2PA 3QTIA 3DJ6A 1Y6AA 3T8OA 5L2IA 1A48A 5DWRA 4HGTA 3EN4A 1I44A 3UZPA 1K3AA 1Z5MA 2R5TA 4CMTA 3ORPA 4KWPA 4OT6A 4PY1A 3W1FA 2OG8A 3MESA 4R3PA 3PLSA 3CS9A 2VTSA 5CAEB 1YOMA 3I6UA 3L9NA 3RPRA 4EH5A 4FYNA 5C8KA 3HV3A 3NW7A 3QQUA 3S4QA 2CCHA 3DTWA 3R9NA 3ZFMA 4CV9A 2GLTA 2IVUA 3GC0A 5EDRA 2YEXA 3JXWA 3OS3A 4GK4A 4KS7A 3WF5A 5AAEA 3FXXA 5CEMA 3O17A 2W71A 5LVMA 1OECA 2Z8CA 2G2FA 3BLHA 2YWPA 4KRCA 1ND4A 3Q2JA 4A4OA 2X9FA 1PHKA 1VYWA 4S33A 4AA4A 3QC4A 4ASXA 4BC6A 2X7OA 4E93A 3CKWA 3ZSIA 5EW9A 1L3RE 1ZOGA 3FKOA 3MA6A 3QTQA 3L8SA 3OUNB 2SCUB 2ZM3A 1DS5A 4XV9A 1Q3WA 5L2SA 2H6DA 4DITA 4XYFA 1SCUB 3VPBA 3RI1A 2YIQA 3PXYA 4IDTA 4LI5A 2BIKB 2REIA 4U80A 4AF3A 3WO1A 3HO8A 5KX5F 2XCHA 3EOCA 2UW5A 3BCEA 3DB6A 2A2AA 2XVDA 5KE0A 4MAOA 1FPUA 4DEAA 3W2PA 2O8YA 2VX3A 4I0RA 4YJUA 5DR9A 4ZLOA 2V0DA 3SXRA 2XK8A 2I40A 2R3LA 4YU2A 5K4IA 2C6MA 4FIHA 3V3VA 2XJ1A 3EB0A 2W1DA 1V0BA 4FG9A 4TYJA 2QOKA 5DEWA 5BVDA 2AC5A 2GQSA 5M51A 2YIWA 3SW7A 4NK9A 5JGAA 5E8UA 1SMHA 2RKUA 3KMWA 3V5QA 3NIEA 5ITAA 5JMSA 4DT8A 5AP2A 1WVXA 2ITVA 3QQLA 4I0SA 5E8ZA 5JGDA 3GU7A 3D83A 2UZEA 4E5BA 2PSQA 4NM0A 3AD5A 4O0UA 5T3QA 3C5IA 2PTKA 3LFNA 3EKKA 3O8TA 4G3GA 3AW8A 3D94A 3BX5A 3VNTA 5KMMA 1DV2A 1GIIA 5B2MA 2PVFA 2WU7A 2R7KA 3QCYA 4GT4A 1DI8A 5CAVA 5LA6F 2P3GX 2YM5A 4HNVA 4G3EA 1OGUA 4PDPA 2Y8OA 3TUBA 2YS6A 3OVVA 1GSAA 3TTIA 2B9JA 2VWZA 4MTAA 4AW0A 4FKWA 4RFZA 4R5YA 3FWQA 4F9CA 5EOLA 1CTPE 1CDKA 4EI4A 3QRIA 1PXPA 1Q8UA 1Q4LA 1URWA 4FV6A 3DGKA 1FINA 3OT3A 3S95A 4NCTC 1IOVA 4S34A 3DCVA 3QHRA 2WIHA 5IQAA 3Q9XA 5J7HA 4ZSEA 4D2SA 5HG7A 3CXWA 4FZAB 2ETKA 5I9ZA 3ZU7A 3O50A 4MX9A 4YLJA 3THBA 4DH3A 2X0GA 3BLRA 4NM3A 4CKIA 4MXAA 5JFSA 4IC8A 5FBOA 1H1PA 1W7HA 1Y91A 4TPTA 4U9AA 1YOLA 3QCSA 1H4LA 4QP3A 3ZS5A 4PL5A 4CTCA 4ERWA 2OGVA 3R8ZA 2VO3A 4ZP5A 4Z16A 5JZJA 4Y8VB 3DDPA 2VNYA 2CN5A 3VUIA 3K54A 4MNEA 3BZ3A 2R3FA 4WD5A 3W16A 5CSVA 2W6ZA 5FEQA 3CGFA 3LCSA 3Q5IA 5EHYA 4B0GA 1OVEA 4DHFA 3E8CA 4NH1A 3MY0A 4ZTRA 4CMUA 4D9UA 2JBPA 4F6SA 4K0YA 3CQWA 2BVAA 4I6FA 3LFFA 2QHMA 2Z04A 5FNVF 4ZTNA 4QMLA 2HZ0A 5A14A 4F70A 5FTQA 4FVRA 1A9XA 4OTWA 2W5BA 5CZHA 4YJ3F 5HI2A 3D5UA 3BGZA 3ZUTA 4PP7A 2HWPA 3GNIB 4KAOA 1BI8A 4N57A 3TJCA 2J7TA 1MP8A 4GEOA 4EOLA 3UNKA 5J2TF 3GGFA 2ZDHA 4MBIA 3DKOA 5HO8A 3ZUVA 1L8TA 4IFGA 5JFVA 3T9TA 4U97A 3PJ1A 3IW7A 2X0SA 2RGPA 5DEYA 3ZEPA 2HZIA 5K9IA 1F3MC 3GC9A 4DGLC 3VMMA 5LQFA 3HNGA 4E6AA 3OY3A 2QG7A 3E3BX 1OBGA 4BDAA 2E9VA 5GJFA 3R04A 5K3YA 5IF1A 1XBBA 3QCQA 2YN8A 4GKIA 5LMKA 2J9MA 4IAFA 4IHPA 4JX3A 4LL5A 3TDVA 3VUGA 1Z2OX 4HNIA 3NYVA 3P7BA 1WBSA 2KULA 3MYGA 3HECA 2HW7A 3ORTA 4M67A 3GFEA 4IIJF 2WMQA 3DNEA 3R6XA 3UIBA 3PVBA 4IVAA 3ZFYA 3N4TA 4XRLA 3UMXA 1T45A 4RWJA 4J1RA 2QOIA 3A4PA 2B4SB 3GCVA 4FV9A 2QOHA 2UZWE 1J1BA 5JRQA 3OFMA 2FH9A 3OWJA 4OBPA 4R7IA 3QGWA 3MJ1A 4GIIA 4IQ6A 4BR3A 4CV8A 3CP9A 4OBQA 4YLKA 2V58A 4YAKB 4ZY4A 3F88A 2R3IA 3PXRA 5LMBA 2PY3A 1CKIA 2E9UA 3OWPA 5IDPA 3DFAA 5HBJA 3G9NA 4QYEA 4QSHA 3VBQA 4FNXA 3WZUA 4YNOA 3NRMA 4FGRA 5EQEA 4BGHA 4C4JA 3K3IA 3KRLA 1OUKA 4AW2A 2DWBA 4F6WA 3TZ7A 5IA0A 1YI4A 3V5WA 3U9NA 1W93A 4FUXA 3H0YA 4D4SA 2ERZE 1OI9A 2CMWA 5KNJA 1ZYCA 3PP1A 5HGIA 5JZNA 4FTOA 4M12A 4EZ7A 4MVFA 5D41A 4I4TF 3PPZA 3A62A 4ZTQA 1JQHA 3Q32A 1NVQA 1FGKA 4GJ3A 4QMYA 4WNMA 4XH6A 3QTXA 3EFJA 5DGZA 2FSLX 4CRLA 2RF9A 2YACA 3BKBA 4YC6A 5H9BA 3D0EA 1R39A 4C38A 4UY9A 3ALOA 3WBLA 4EOPA 3DKFA 4QTEA 4RQVA 5IEYA 4ANQA 2IO6A 3AC2A 1ZXEA 4DFZE 3ZC6A 1NXKA 5A3XA 3PA5A 2W1IA 3UQGA 5HX8A 4BY9E 2WMRA 4TYHA 2WQBA 2DUVA 2W99B 3LFQA 5CAOA 1XQZA 5IA3A 3GOKA 3E5AA 3GLKA 3HV7A 5FQDC 4F64A 1BUHA 1PXKA 4R78A 3SGCA 2R87A 4WRSA 4ZTLA 4FIGA 1PYXA 4O4HF 3GC7A 3MH1A 2HJWA 2VO0A 5DI1A 2VNWA 4G2FA 1OIRA 5AX3A 3SXSA 1SM2A 5IISA 4DGGA 3UG2A 1YI6A 2WOTA 5DR2A 3DA6A 4YHJA 4RIWB 4F9YA 3F3VA 4BYJA 2B55A 3ZSHA 3LFBA 4CVAA 4FTRA 2QO9A 3OBGA 3VS3A 4L7SA 3W32A 4NKAA 4M3QA 3DXNA 3NIZA 2GNGA 5FXSA 4DYMA 5EM7A 1GAGA 2PWLA 2XK3A 4DGOA 4QO9A 5DIAA 4U44A 3F69A 3BGPA 2YHVA 4X0MA 5LCJA 2BCJA 2R3HA 4WIHA 1NW1A 2GDOA 3REPA 2WELA 2CNQA 4MD9E 4QMTA 1JNKA 3QD2B 3FZRA 3BYUA 1KJIA 1Y8YA 3ZC5A 5C4LA 4CEGA 4FX3A 1FVTA 3AC5A 3NYOA 3LXNA 4JBOA 5C8NA 5FG8A 1EZ1A 3KCKA 1BXRA 3QWJA 3PIZA 1JKKA 3QLGA 2OLCA 4LRKA 2XK6A 2JDVA 4C2VA 1YXUA 3FQEA 3LVPA 3Q53A 3QX2A 4RJ8A 5EOBA 2YDKA 4ITJA 1YKRA 4WOVA 4TRLA 4RX5A 2QOLA 3FHRA 2PUIA 5AP5A 2QLUA 5A4TA 4TT7A 3KQ7A 4XOYA 3TZMA 4EWQA 4RIOA 5C03A 3NYNA 4YTIA 3R63A 3TEIA 4BCPA 2CLQA 3BEAA 4G3CA 4JI9A 1KJ8A 3O7LD 5H8EA 4G9CA 4I50F 1ERKA 4MQ1A 2IVSA 3DXPA 4UWCA 4CCBA 3D5XA 4DFUA 2XKEA 3B8QA 1W8CA 2BRGA 2FSTX 1JSTA 3FZSA 4CXAA 1DAWA 3A60A 3C1XA 5A6NA 1XR1A 4PP9A 2VWBA 4PTEA 2C6DA 4GUBA 2W6PA 5KMOA 2PVMA 4FSWA 4U7ZA 4EORA 4FVQA 3TIGA 3WIKA 3OCTA 3P7CA 2XEYA 3BGQA 3LPBA 3ZO2A 3H4JA 3KRRA 4GJ2A 5IQBA 4ACDA 3VWAA 4TYGA 2QOBA 4F63A 4V04A 2DIKA 2WAJA 2VGOA 3EFKA 4PNKA 5C8YF 3OUKA 4GFOA 3P86A 3ZZEA 2OBJA 1R0EA 5EFQA 5HG5A 1HCKA 3I60A 3N4VA 4NCTA 5H8GA 4C3FA 4DFLA 2B52A 3GT8A 2VTPA 3UDBA 2F7ZE 3NNUA 5D11A 5DA3A 2C6LA 4HZRA 2G9XA 2X9EA 3NUYA 4RBLA 4Z7HA 4G6LA 3TL8A 4YR8A 5M53A 1M0TA 4ENXA 3WF6A 4RWLA 2YIXA 4AA0A 3BWJA 4AU8A 1G8AA 4ZTSA 1NVRA 4DF3A 1QPDA 4ALWA 2ZV7A 3NUAA 4CMOA 5AUYA 2JBOA 2G2IA 1AQ1A 5HZNA 5AJQA 3O7LB 5IQHA 5A9UA 3ZO1A 3MPTA 3GU5A 2J2IB 3T3UA 3U4WA 4J8NA 5DR6A 5EW8A 5I9XA 1EUDB 2YS7A 4O2AF 2VTHA 4RIXA 1ZYSA 4HNFA 4BCFA 4YZMA 4JS8A 4QNYA 3OTUA 4RIWA 4RVKA 2BMCA 3Q4UA 2O63A 2XK9A 4I92A 5M4FA 3UO5A 5DMXA 3SHEA 4D4YA 3AG9A 3A8XA 3LJ2A 2JKQA 2W6QA 4ZY6A 4FTCA 4KKEA 2EUFB 4MXOA 4W4VA 3BG5A 2WHBA 2XYUA 1XHAA 4ANLA 4ZLYA 2PZRA 2ZMDA 3ID6C 5JEBA 4ZSAA 4G17A 3FLSA 3VHKA 4BTFA 4UWYA 4FFLA 2O65A 2QC6A 4RRVA 5E8YA 3U55A 4Y73A 4GT5A 3HBLA 4PL3A 5FTOA 4MYGA 1UNGA 3R83A 3S1HA 3HAVA 4DBNA 2OJJA 4U6RA 5A54A 4XP3A 2GPSA 1GIJA 4B7TA 1C30A 4HQ6A 3Q04A 2CSNA 4YMJA 3PSCA 3RHKA 1K9AA 3GXLA 2XJ2A 3P1AA 3C50A 4LV8A 2X1NA 4JJRA 3EL7A 3QYZA 2OZOA 2C5VA 5GONF 4BHNA 4EOMA 3E64A 2BZIB 3HP2A 1E4EB 4OTDA 4EH2A 4ZXTA 4TYIA 3BYOA 3Q2MA 5FBNC 2CNVA 2OZAB 2ZV8A 5E1EA 5KKNB 3KXXA 3OP5A 5ICPA 3NNXA 4X3JA 4AUAA 2W6MA 2R86A 3DTCA 3GU6A 2ZB0A 3WZKA 4C4FA 3OWKA 4BDBA 5HE2A 2PUUA 3Q96A 4FTQA 4JRNA 1AGWA 3DY7A 2PUPA 2JEDA 3L1SA 4BGGA 5CXZA 1ATPE 3F2AA 3QBNA 4RIYB 3ULIA 1OITA 3RM7A 3RCDA 4QMNA 5DT3A 4XX0B 3BYMA 3JUHA 5AV4A 2R0UA 4FKSA 3CY3A 3E92A 1XBCA 4FSQA 4IW0A 3FPQA 4F4PA 2W4KA 2BIYA 2YABA 5AUZA 2YRWA 3CD8A 3QTWA 3ORIA 2JIVA 5B7VA 4BBFA 2OWBA 2OJIA 3FC1X 4XG7A 5AV3A 4LFIA 3ORQA 4C5BA 4W4XA 2Y4PA 3EMGA 5A4CA 5I0BA 3NUNA 4C4EA 4D0XA 4MF1A 4RVTA 2FO0A 3D15A 3IW4A 3LHJA 4O6EA 5D9HA 4D28A 1H26A 5GIOE 4F6UA 3EKNA 4Y8DA 5C01A 2V59A 3GENA 3NZ0A 1UU8A 2GHGA 4NSTA 3Q52A 4YZ9A 4XG4A 4DLIA 3HA6A 4U43A 5AUUA 4YTHA 5DLSA 1V1KA 2I6LA 2FA2A 2YZGA 4QYYA 4KKGA 4OBOA 3Q2OA 3TT0A 3R71A 1TQMA 4FSTA 3RPSA 5M4IA 3OCSA 3QQKA 4FC0A 3ZSGA 2P0CA 4H3BA 2Z60A 4IB0A 5LVLA 4D4RA 1QL6A 3EQCA 5CT0A 1NY3A 4P90A 5JFXA 1KC7A 4JDKA 3AC4A 5C8MA 4FFMA 4GMYA 2PYWA 3B2TA 2BUJA 1ZZLA 1XH7A 4O22A 4ZJIA 4JG7A 3S00A 1K2PA 4YBZB 3LM0A 3IOPA 4FNYA 4PV0A 5JT2A 5L8KA 2V7AA 3UP2A 2IP4A 5BQ0A 3RGFA 4PDYA 4TWNA 4JG6A 3FLNC 3GOPA 4RGJA 2WZJA 2P2HA 3EYGA 3KREA 4ZK5A 1ZMVA 3ATSA 2DZDA 3CTQA 3EHAA 4ZTMA 1CKPA 4FE2A 3OXZA 3I0QA 4JDJA 5DOSA 3WARA 5E90A 4QYFA 4DFNA 3RWPA 3IK3A 3BHTA 4BZNA 3KXHA 3FQSA 3TW6A 4CFMA 1LP4A 5CF5A 3QRKA 2R3NA 1GIHA 2GS2A 2HXLA 2HZNA 2YCSA 1OMWA 3NWWA 2XZSA 3FY2A 3BU6A 4WSYA 4QMQA 5ACBC 5CENA 5D10A 3FMEA 4FNZA 5AX9A 2QI8A 5C27A 2IW6A 4O7VA 3W55A 3LFEA 2BFXA 5IQCA 2NPQA 3PUPA 2Z7SA 2VZ6A 3DFCB 4RWIA 4NZWB 4EQMA 4X6RA 4M84A 5J9LA 3C13A 5C1QB 4WUNA 4I5PA 3KVWA 3SXFA 5CAQA 5IEVA 3U8WA 4C7TA 2VX0A 3BE9A 4XYLB 1PXIA 4MXYA 3CR0A 4C3RA 3MVHA 3CPCA 2J5FA 5IQDA 4HW7A 3AGMA 2OICA 4A9YA 4LMUA 2ITXA 4MBLA 2KTYA 4EOIA 1ZOHA 3V4ZA 2J0IA 3ORKA 4L3PA 3TV6A 3SDJA 3COMA 1J7LA 3C51A 5C1PA 4RIYA 3VJNA 4AZWA 1G5SA 1YHSA 4QYHA 1VBGA 4O4JF 5C4KA 4O7RA 4LL0A 3EFLA 3HRBA 3LQ3A 4JQEA 2XIZA 3GBZA 2BDJA 4CKRA 5IUIA 3HV5A 1Y8GA 3EYHA 1OPLA 4BI0A 1WR2A 1ZRZA 4RT7A 4EQCA 2VTQA 1IG1A 2B1PA 3M42A 4F0IA 1CQIB 3ALNA 2W1GA 4FKPA 3FPMA 2XNOA 2PN1A 2ITWA 4O82A 1M0WA 5LCKA 2YM7A 3H9FA 4NJDA 5L2TA 2BKKA 2FPIB 5AV0A 2X7GA 2XIXA 5I9UA 2O2UA 2PMNX 3CIKA 3PVWA 4L7FA 4O7YA 3AC8A 1FQ1B 1OL5A 3PJ8A 5HIDA 2YRXA 1P4OA 5I9WA 5KBRA 1QCFA 1YDSE 3ANQA 4FKQA 2CKPA 4IM3A 3W2RA 4YAJB 2W1EA 2UW7A 2NU7B 1W98A 2GTMA 4EK6A 4FGBA 3VS7A 4D0WA 4EHZA 5BVNA 3ETHA 1UWJA 3AC1A 4R3CA 3FLYA 5AV1A 4R6VA 4BCKA 5M08A 4OR5A 4DT9A 3RK5A 1YXXA 4OLIA 1YDTE 3BYSA 4YJSA 4AQCA 1PJKA 3VBYA 4BBEA 4S31A 5CZIA 4FUYA 3TZ9A 4ACHA 3UGCA 3Q6UA 4XV1A 3VAPA 3LMGA 2C3JA 3FI3A 3LIJA 4EC8A 4BBMA 1PMVA 5I4NA 4RPVA 3RZBA 3MB7A 4EHVA 3HUCA 5E1SA 4IAAA 1KOAA 1J3HA 3BV3A 4GIHA 3N51A 4JBVA 3R7EA 4AOIA 4F9AA 5HD4A 2WPAA 2CZGA 4YB8B 4K9YA 4IZ7A 3OW4A 5CQWA 3FMNA 4EOSA 4PRJA 5HD7A 3WZJA 2OJ9A 3F2RA 2WGJA 4O84A 3U6JA 4BHZA 3VS5A 1UWHA 4QMOA 1UKIA 2JAVA 3G5DA 4H3QA 5FM3A 1YXTA 4TN6A 4QMPA 5H8BA 3BU3A 3QD4A 5FP5A 1U54B 1O6YA 4DIMA 5EW3A 1WBPA 4K1BA 2XNNA 3PRFA 4M0ZA 3QKMA 4F1MA 2PZIA 3GIDA 1FGIA 1VJYA 2X6EA 3BBTB 4LGGA 2HCKA 3ORLA 5JFWA 3TUCA 5BUEA 1H0WA 5DE2A 2B9FA 3NSZA 3R2YA 5FD2A 4YJVA 3FMMA 4L43A 4ENYA 3ZM9A 2AYPA 2WTKC 4XHKB 1H0VA 5LWMA 3QD0A 3TKHA 1Y57A 1Q61A 4IVDA 1PXJA 3Q9WA 2H9VA 3K2LA 4MKCA 1KV2A 2WTJA 3FI8A 2BAKA 3ORMA 1H01A 4B9DA 1OZ1A 5HORA 4AS0A 4DLJA 3DXQA 3EN5A 4YC3A 5AM7A 4HR7A 1YXSA 3KA0A 2X8EA 1STCE 2R3QA 3QCXA 4LUEA 4MNEB 4I55F 4ZZMA 4IWQA 5CSHA 3ZZWA 1J7UA 2X4ZA 3MY1A 5EDQA 1DV1A 3A7FA 3WYXA 2C5OA 4C35A 1KBLA 2WNTA 4AWIA 1YQJA 4LYNA 5CI6A 3TWJA 5CA1F 3CJFA 3R2BA 2RIOA 2R3JA 4UYAA 4A7CA 1REKA 3OG7A 5DBXA 3BI6A 5IZFA 5JH6A 3QQFA 3BWFA 3I5NA 4I21A 5E8TA 4KSQA 3UVRA 5IQIA 2BFYA 3VBWA 3RK7A 3V5LA 3UQFA 4WA9A 4QYGA 5KKRC 3FMLA 3WIGA 2Y7JA 2C5XA 2GCDA 4M13A 2R3RA 3OMVA 5DG5A 5KX8A 2W5AA 1OIUA 1WVWA 2JITA 3HAMA 3P5KA 2XEZA 1RQQA 2O3PA 5CU3A 3UZRA 4BCIA 3SD0A 3V8TA 1JOWB 3COHA 3KXNA 3C4ZA 1PXMA 2OW3A 3QU0A 4KKHA 3UPXA 5HV6A 3MJ2A 2W1CA 4N4SA 1B38A 4HOKA 4ZZOA 2YJSA 4FTIA 4LM5A 2R3KA 4OUCA 3IW5A 4QOXA 4YZCA 3E62A 4O86A 4Z7GA 2R7IA 4BDGA 3QALE 1XH5A 4O0TA 2IWIA 2R4BA 4MCVA 2IVVA 3JRXA 1M7NA 4FSUA 2PULA 4FV1A 4QMVA 4EJ7A 1H1RA 5BNJA 4PDSA 3ZXTA 4ZI7F 3QXPA 2UZVA 3DT1A 1QPJA 4DBXA 3I79A 5DNRA 5C26A 2C5NA 3FHIA 5F95A 2I8CA 2B9IA 3VUKA 1OL7A 1QPCA 4L68A 4YGAA 3ACKA 3BYVA 2R3OA 4A9SA 4CT1A 3PPJA 1Q8YA 4DH8A 1M2PA 1TKIA 4BCGA 4FVPA 4FTAA 5FLFA 3RHXA 3TKIA 4WHZA 2X39A 2PMIA 1DIKA 2F49A 4I6BA 5CVHA 4EC9A 4TKSA 4DN5A 2DQ7X 4O2PA 4F9BA 3VRZA 4GYIA 1BL6A 1OPJA 4IX4A 1U54A 2JD5A 2W5HA 2C0IA 2XM9A 4WNKA 2OH0E 1PK8A 3OOGA 5DRBA 3BLQA 2X81A 4KRDA 4O0XA 3QKLA 3R02A 4G9RA 4CFFA 2CGXA 4BI2A 4HVHA 3P9JA 4DG3E 2YJRA 1R3CA 3NX8A 2VU3A 3R1YA 4JIKA 4WBBB 5CLPA 4L00A 2LAVA 3TUDA 2GNHA 4UWBA 5CSPA 3P7AA 4FMQA 4EONA 4O2ZA 1H1WA 5G1XA 4ZMFA 2QLQA 4BIEA 5KMIA 3VOTA 3V5TA 5AAGA 2VQDA 1KWPA 1U5QA 3VS4A 2UW9A 5JK3A 2I0VA 4LOOA 2EB2A 4O27B 4TYHB 2WTKB 3VS6A 4ALUA 4AW5A 2VWXA 1S9IA 4RJ4A 4KUJA 3ZUUA 1JKJB 2JAMA 4Q5HA 2VUWA 4XLIA 5EM6A 4FEQA 3SC1A 3TNQB 5BVFA 1ZZ2A 4IJPA 4MXCA 4ZAUA 4AT3A 4M9UA 4G34A 2YDJA 4BCJA 4F65A 3IECA 2CLXA 4DC2A 3HUBA 5KZIA 2OFVA 3TNWA 4AZVA 4W4YA 4YZBA 3FMKA 3DZQA 4OTFA 5E8WA 2W6OA 3CLYA 4PUZA 3DK6A 3PZEA 2JDSA 1KOBA 3FXWA 5TOZA 3V04A 4F99A 3SG8A 5J2UF 3FMDA 4UX9A 3F66A 3A8WA 3MPMA 1NA7A 3RAKA 2YAAA 4QTBA 1BX6A 2UZOA 2WMTA 3PJ3A 4QQCA 3PA4A 2RFSA 3CPBA 2HGSA 3SAYA 4GL9A 4QP9A 3ENHA 5K5XA 3ODZX 5HG9A 2GS7A 3POOA 3ZRKA 4BB4A 4RX7A 3NAXA 3NEWA 3Q9ZA 4F08A 3LLAA 2XIRA 3LLTA 3KB7A 4XEYA 4FT0A 2XS0A 5FXRA 3FDNA 4IANA 5KKRB 4BDHA 4C61A 1PX2A 4IWPA 3H30A 2VTIA 4EQUA 3QLFA 4PTGA 3KULA 3PJ2A 4N0SA 1V0OA 2ITNA 5ANJA 2G1TA 2YIYA 4C02A 3QRUA 4EKKA 4QT1A 4MEDA 3G15A 3IONA 1A9UA 2UZUE 3PZHA 1JDBB 3ZBXA 4AGWA 4FOBA 4FIFA 4KIQA 5BPFA 3ATTA 4MK0A 5DN3A 2GQGA 3R7IA 5J5SA 1CQJB 4XG6A 1H25A 2YM4A 4XMOA 5HHWA 1MUOA 2W9FB 2J50A 3KF7A 4N6ZA 3ZH8A 4C5CA 3ZXZA 5M07A 4LRJA 4LRMA 2G2HA 5FRIA 2H34A 2W1HA 5AUTA 4IC7A 4MHAA 5CEIA 3QHWA 3ETJA 4S2ZA 3UFXB 4C36A 3ZBFA 2QODA 1CM8A 2X6DA 2BTRA 3Q4TA 4B6LA 3KCFA 4FL1A 3ZLXA 1E9HA 5KMNA 4IZAA 3VVHA 5LP6F 2ESMA 3LFAA 2Z2WA 2J0KA 4EUTA 1YWVA 2CDZA 4DFYA 2GS6A 2JGZA 3VUHA 4JQ8A 3PLAE 4IAYA 3W10A 2F7XE 4KIPA 4PDOA 4KBKA 4P2KA 5DT0A 2Z02A 1M7QA 1YI3A 3CTJA 3ENMA 3K5UA 5D7AA 5B0XA 2J90A 3TJDA 4D4VA 1GLVA 1B6SA 3QL8A 4WNOA 1H07A 4XV2A 5IPJA 3KAKA 1ZYJA 4J53A 3C4XA 2ETMA 3U6IA 2WTDA 3K3JA 3OWLA 2W96B 4FT9A 4FV4A 2CGUA 3QA0A 3R7UA 2XKFA 2R0IA 5IA4A 3OUZA 1MRVA 3AMBA 5AEPA 3VO3A 3UNJA 4OTQA 5HE3A 3TNHA 3MFTA 4K77A 1M17A 1M2RA 2UZTA 3MTFA 2P33A 3U4UA 2Y6OA 2C4GA 1CSNA 3O8PA 3V8WA 3A4OX 5LMAA 3F61A 4AFEA 4AOJA 3BRBA 4O0YA 1V0PA 4RC3A 4D1ZA 4UN0C 5CEKA 2HY0A 4ZSLA 2WKMA 1FVVA 4F7LA 4JNWA 5LVOA 1DAYA 3BHUA 3AQVA 5CALA 2OK1A 4R7HA 4FEUA 2ITQA 2E2BA 3PG3A 2NUAB 4RIXB 4J98A 2OFUA 5EHLA 5CF4A 2R9SA 3A7JA 2FVDA 3Q9YA 3PJCA 2PK9A 3AMYA 4O2BF 4I5HA 3BE2A 5LVPA 2JFMA 3E93A 4JDIA 2NRYA 4E6QA 2IN6A 4YTFA 2BRBA 1IA9A 4BF2A 2BROA 1J1CA 2NNWB 1FBNA 4UALA 3O71A 4Q5EA 3EJ1A 4WNPA 5AUWA 5A4QA 2R64A 5DT4A 4F7SA 2QCSA 3VS2A 3FLWA 3QTUA 3PXQA 5AA8A 3OF0A 4HCVA 4ORKA 4C37A 3VHEA 4E1ZA 1DI9A 2QNJA 2RFNA 4I93A 2QU6A 5ANGA 3KGAA 5L6WL 3C5UA 4YUQA 5A46A 3CSVA 4FKLA 3R8VA 4YTCA 2RL5A 3DNDA 5LXMA 2VPQA 4X2JA 2VD5A 4CFXA 3SLSA 3EQDA 4QTAA 4YBJA 4ZIMA 3VRYA 3MFUA 2J0LA 3GU4A 4Y46A 4XG2A 5F9EA 5EQPA 4BDKA 4IWDA 4HNUA 1PKGA 4I23A 2FYSA 2R84A 3C9WA 3FQHA 4DGNA 1H28A 3CEKA 3KK8A 3EZVA 2C69A 4KABA 4TWCA 2X7FA 1XH4A 2QO7A 4DFXE 4QTCA 2XUUA 3P0MA 5CI7A 3F5XA 4RA4A 5JH7F 3S0OA 3R7OA 4CFWA 1WFCA 2B54A 2VWIA 3ORZA 4PQNA 4GG7A 1URCA 2J0MB 4E20A 4DTAA 2UVZA 5D8DA 4ERKA 3HZTA 4ID7A 3UO4A 4F0GA 2NRUA 3AD4A 4L01A 3MGYA 3T9IA 5ANOA 3LAUA 4TW9A 4U42A 2X4FA 4HGSA 3KN6A 2WQEA 5HVYA 4AA5A 2W6NA 2XYNA 5FGKA 2JKKA 5L8JA 3NLBA 2W05A 4YJNA 3VQUA 4GW8A 3VPCA 1Q24A 1S9JA 4C58A 3OXIA 1REJA 3KK9A 5K5NA 2PZ5A 2YZNA 3GI3A 2Z7QA 2QOCA 1WAKA 3ZRMA 1YDRE 2ETRA 3F7WA 4FV5A 5FXQA 3FYJX 3RAWA 3LCKA 4EOKA 3O8UA 3BV2A 3UOLA 4MD7E 4AXAA 4EWHA 2IZTA 1ZLTA 2Y0AA 1O9UA 3FKNA 4KS8A 5EYKA 4MD8E 4NL0A 3S2PA 3VUMA 4PWNA 2UZDA 5ETIA 2OXYA 2BHEA 3JZIA 4KSPA 3V51A 1PXOA 4NUSA 1BYGA 3NR9A 4L9IA 3NAYA 1PRYA 1B6CB 1UVRA 2BDFA 2VX1A 2IJMA 2XM8A 4XRJA 5TO8A 4GG5A 4TNDA 3EQGA 3PE2A 3QTRA 4UXQA 1W84A 4DH5A 2XKCA 4C2WA 4CLJA 5IA2A 5LYJF 3PYYA 5L6OA 2GFCA 2UW6A 4X3FA 3DV3A 3VW8A 4Z9LA 5G6VA 2YZMA 4EOQA 4LMNA 3OCGA 1U59A 2PU8A 3KMMA 4KD1A 3VW6A 3R7YA 1ZMUA 4HYHA 4AOTA 5KHWA 1E1VA 4FIJA 2C0TA 2WEVA 4J7BA 4F1OA 1EUCB 5AAFA 2W0JA 3G9LX 5IUGA 5IU2A 2CGVA 4IAIA 4E5AX 1XKKA 2XNGA 2OO8X 5CA0F 1PMEA 3FXZA 2ITYA 3VULA 3RP9A 4IHJF 3HMMA 1PMNA 5HNGA 3PP0A 3F6XA 3RPOA 3SQQA 4ANBA 5HVKA 3NCZA 3LQ5A 4OT5A 3OEZA 4HVSA 5LWNA 3R23A 1KEEA 2O5KA 2ZAZA 5BMVF 3LFCA 4MBJA 2ONLA 3FZ1A 4FKTA 4KBCA 3CQUA 2OSCA 5EM8A 2DWCA 3F3WA 2X2LA 2UZBA 4YHFA 5JN2A 3NUSA 1MQBA 2AUHA 2QR8A 2E9OA 2V7OA 2BRMA 2EXCX 2W4JA 3MVLA 3OT8A 3I6WA 3PVUA 4FKRA 4I0TA 4L45A 4XNEA 3LJ0A 3AT3A 4QNAA 2WMXA 5HLWA 4O0SA 3IDBA 1IAHA 4IB3A 4XBRA 4LOPA 3D2KA 4G6NA 5CYIA 5BPHA 3G0FA 1VZOA 3LFDA 3R1QA 5T6KA 4EH4A 1GZOA 1SVHA 4B4LA 3VS1A 1LR4A 2XNPA 4XBUA 2FB8A 5HESA 4O4IF 1H1SA 3COIA 3BELA 4AE6A 3D5WA 4FT7A 4O0RA 2SRCA 3HDMA 2C47A 2UW0A 4R77A 4TTHB 3JY0A 4R1YA 5LJJA 3FAAA 3U9TA 1HCLA 1APME 1MRUA 3HL7A 4RSSA 3SV0A 3KALA 2CN8A 2OH4A 5BVEA 2F2CB 1UA2A 3NYXA 4MV1A 2XCLA 4USFA 3ZO4A 4FBXA 2WEIA 4FU0A 1BI7A 3M2WA 2CHLA 3ZTXA 4JBPA 3MWUA 3ZLSA 3PSDA 3AGLA 4JXFA 4NU1A 1JSVA 4DAWA 4FEXA 4FSYA 3GUBA 4P5ZA 4BDCA 4ASZA 4RFYA 3WE8A 2NP8A 3G6GA 3AC3A 4U79A 4Y95A 3RM6A 4JR3A 5AIRA 4AE9A 2OU7A 3DK3A 2QR7A 3NDMA 3MVMA 3SRVA 3KMUA 3ROCA 3UOJA 5AV2A 1Z57A 2JKOA 4XG9A 5C9CA 3UMWA 2PVHA 3AOXA 3F5PA 3HRCA 3VC4A 2VWUA 3TCPA 2FPGB 4RZQA 4RJ3A 4J96A 3C4WA 3F3ZA 4H1MA 2V5AA 4FSNA 2DS1A 2QOFA 4CRSA 3KXZA 2WQMA 3OCBA 4H3PA 5AUVA 1WBNA 4BCHA 4MA0A 2XNEA 4AGCA 3QRTA 2CKQA 5DH3A 5JQWA 2R3GA 4KBAA 5AADA 4BICA 4UBAA 3EN7A 4IIRA 3GC8A 2ZDTA 4FOCA 5JSMA 4FSZA 5AIKA 5HEZA 5EM5A 1UNLA 5E91A 5BYZA 4L1KA 4O6LA 4D58A 3DB8A 1CKJA 1ZYDA 5BMMA 5CU0A 2IPXA 3RVGA 5F20A 3ET7A 2BR1A 4MH7A 2IW8A 4IJ9A 4X7QA 3OROA 3TNIA 1XH9A 3CGOA 4AX8A 5E4HA 4QPAA 2BAJA 1SYKA 2FGIA 2W70A 1J7IA 4FZ6A 4RX8A 5ETCA 3NW5A 4NW6A 3O2MA 3RALA 1WBWA 3PVGA 4AGUA 4EKLA 4FFRA 1VR2A 4XOZA 4XS2A 4HVGA 1BKXA 4HCTA 5JVLA 4R1VA 2ZM4A 5L6PA 2BDWA 3GB2A 4XUFA 1XO2B 3ZHPC 3GVUA 3ORXA 5L3AA 4IBMA 3C0HA 4G6OA 4DG2E 3KAJA 3JRWA 4NFMA 4TWOA 1OL1A 4TV9F 3QC9A 3DAEA 1GZ8A 5M44A 2C1AA 2VTMA 1MQ4A 2YERA 4QP2A 2ZJWA 4QP7A 1FMKA 5HKMA 2WQOA 1WCCA 2Y9QA 3EQPA 3LE6A 3N4UA 3V5PA 4GT3A 4YJRA 3ZDIA 3T3VA 3A7HA 3NUPA 3VJOA 3DBCA 1O6LA 3BPRA 1E1XA 1OUYA 4N70A 3TN8A 5CNNA 4BVUA 4D2RA 3MJFA 5CVFA 3LXPA 3LJ1A 3QXOA 3KRXA 1Z9XA 3L9PA 3QYWA 2YZAA 5IDNA 1XJDA 5HQ0A 4IX5A 3WILA 3WOWA 4EGQA 3R0TA 5AM6A 3FV8A 4WT6A 5JQ8A 3QZHA 3TV7A 4FV3A 2C3KA 4KB8A 3TINA 4BYIA 1GY3A 4KINA 1A06A 4JAJA 1UU3A 1NVSA 2UZLA 1I7LA 1UKHA 3I7BA 4D55A 4JAIA 4E4LA 1H1QA 4USEA 3KKVA 3OZ6A 3MH3A 1OKYA 4MNFA 4D9TA 3P08A 5BUIA 3UYSA 2Z7LA 2QHNA 2I7QA 4O38A 4X2GA 1AUVA 5AP1A 2X2MA 4U81A 3Q6WA 3SA0A 4EL9A 5LOVF 4HYUA 3FJQE 3AT2A 1BNCA 5GIPE 2V55A 2YFXA 2FPPB 3F5GA 5ANIA 4AN3A 3MSSA 4QPSA 3BU5A 2EXMA 4NTSA 3DAKA 4CTBA 1EH4A 3AX6A 3GU8A 4I41A 4EZ3A 3FZPA 3KFAA 3I7CA 3HMIA 5FEEA 5A4LA 5EYCA 4CZUA 2QF7A 3A7GA 4BGQA 3VA7A 2F2UA 4EH9A 2PPQA 1AUXA 3RTPA 4E73A 3KRWA 4XCUA 2J51A 1M6VA 2VTNA 4FTTA 2A1AB 4FYOA 4J71A 3IGOA 2IW9A 2Y6MA 3I0OA 5BYYA 4LOQA 5IH4A 3R5HA 2OJFE 4RFMA 5BVKA 2CGWA 3PFQA 2J9GA 5TR6A 1HOWA 4A06A 4ZY5A 3JS2A 3MV5A 2FSOX 3D7TB 4G5JA 4FODA 4QMWA 5GJGA 4ANMA 1KSWA 3IOKA 5CNOA 5A4EA 4FSRA 3DQXA 3IPHA 3PA3A 4FTUA 3SE7A 2HZ4A 4FG7A 3ELJA 2R3MA 5AA9A 3AT4A 4P4CA 3NS9A 3PY3A 2WTCA 4KA3A 2XRWA 4MV9A 3PRIA 5IYZF 3DQWA 2NO3A 2YZLA 5IH6A 4GV1A 3SOCA 1GNGA 2OXDA 3DU8A 4ACCA 2BILB 4FEVA 1JVPP 3H3CA 4OTRA 5AMNA 5J9ZA 2NU6B 4ASEA 3D2IA 3LW0A 3HRFA 3QZFA 4I4FA 4YC8A 3R9OA 4ZQIA 4AFJA 4MXZA 4FNWA 4ZSGA 4G31A 4QP6A 3LFSA 3EIDA 4CFNA 3OTVA 4K8AA 5KCVA 5H3QA 1G8SA 2R85A 3DBQA 2BALA 4APCA 3IDPA 3QX4A 5B2LA 1W96A 2Q0NA 3DPKA 4FV8A 3QWKA 2F57A 4IMYA 2YA9A 4IX6A 3HLLA 2HIWA 3JYAA 5EI2A 3TDWA 4DEDA 3VUDA 3FI2A 3RCJA 5CSWA 3L9LA 3A7IA 3KL8A 3Q3BA 5HTBA 3WO0A 2C6KA 5HBHA 5M57A 3NVMB 4G5PA 3ZYAA 3R1SA 3ORNA 3TIIA 2J5EA 2BRHA 3K5VA 4C5AA 4Y85A 4FV0A 4LG4A 1KE5A 2PZPA 3GQLA 4FI1A 4L6QA 3W2OA 1PMUA 3COKA 4AAAA 2C3IB 3CY2A 5L2WA 3NMUF 1C3OA 3TI1A 3OUUA 1TQIA 2BPMA 2HK5A 5AP4A 3CBLA 1GZNA 2IZRA 4IVCA 2XBAA 3VQHA 3W2CA 4CG8A 5HNIX 3FE3A 4V0GA 4TXCA 4U3YA 3PXKA 4JVGA 4AN2A 3JPVA 4YNEA 1KE9A 4PTCA 1XWSA 2GNIA 2VN9A 3V01A 3RNIA 2XRUA 3EL8A 3EN9A 3QQHA 4QMMA 2PE2A 1H8FA 3RINA 2C5YA 5M55A 4TV8F 1JKLA 4DEHA 4MV3A 2Q0BA 3UC4A 3WZEA 3VBXA 1SNUA 1R0PA 2O64A 3FMJA 3ZRLA 4MWHA 5IH5A 2W06A 1U5RA 3UYTA 3QD3A 4DE4A 3MVJA 3G33A 4R7BA 4UYNA 5DPVA 5B2KA 3R9RA 3BEGA 3JY9A 3ACJA 5TT7A 5LXTF 4RWKA 1YHVA 3C4EA 3IO7A 4H36A 4DCAA 4I5CA 4K2RA 2XH5A 5CEOA 4OTHA 4UB7A 3UIUA 2ITZA 5AP6A 4ZLZA 1IA8A 3DF7A 4EZ5A 3TACA 3R7VA 3A99A 3D7TA 3KEXA 3KULB 3WF8A 4XP0A 5I5ZA 4DEBA 2GQRA 4AZTA 3BHYA 3CE3A 3DDQA 3F9NA 4ZMEA 2PUNA 4ZS4A 1Q8ZA 5CASA 2P2IA 2C1BA 1JKTA 1H00A 2WTWA 4GKHA 3WF7A 3HV6A 3QFFA 3U54A 5BPYA 4O83A 4U5JA 3R9HA 2XNBA 3G90X 4HZSA 2I80A 3R9DA 1GZKA 4J95A 2C6TA 4PMMA 3W2SA 3UJGA 5ANEA 3WE4A 4FA2A 4GYGA 2ZM1A 4ZTHA 2VTTA 3SG9A 1VBHA 5CS6A 3CTHA 1FVRA 2YIRA 3MB6A 5HE0A 1Q41A 2Y4IC 5CWZA 3EN6A 3GQIA 5HNBA 4DH1A 1FOTA 4CFUA 4II5A 4FV7A 3U6HA 3SKCA 4GS6A 4PX6A 2YCFA 4U8ZA 4E6DA 3HP5A 3FSKA 3HYHA 5EK7A 3N6RA 4MV4A 1ZWSA 4O4LF 3UVPA 4FTJA 1WBTA 4LGHA 5E8VA 4M69B 2Z7RA 3G51A 4S30A 2PVNA 4I1ZA 1JWHA 2VTJA 3IS5A 5CX9A 5CAUA 3I12A 3ZMMA 5KHXA 4U45A 5ACKA 3MY5A 4EEVA 4YJPA 5M4UA 4EH6A 3PWDA 2ZMCA 5CVGA 3R5XA 2P0AA 4EH7A 1WVYA 4L52A 4NIFB 4YJOA 3UO6A 3G8CA 4MXXA 4ITHA 5HIEA 4BRXA 3WYYA 4DA5A 2I0EA 4JDHA 4BTKA 3VIDA 4FKIA 3PTGA 2ZV9A 3CCNA 4QP4A 3V6SA 3RAIA 2FB9A 3U9SA 2A19B 4BKJA 4HPTE 2EB3A 2R82A 5K4JA 1SNXA 4CG9A 4AN9A 3ZEWA 4X21A 4OGRA 3RJCA 4A07A 3QQGA 2F7EE 4C4HA 4WBNF 3ROYA 4X3FC 3QTSA 2DLNA 4KIOA 5E8XA 3NGAA 4USDA 5KMJA 4Q9ZA 2QG5A 3Q4CA 4RG0A 3GCQA 3UIMA 4E4MA 2QD9A 4PMTA 4U40A 5HU9A 4ZOLF 3PSBA 5BUJA 4UZHA 2QVSE 2C3LA 4GU6A 2WTVA 5HLPA 2VWYA 5M09A 2GNLA 2IVTA 5J8IA 2ZYBA 3DZOA 4Z3VA 3BQCA 1R1WA 1RJBA 2ACXA 5CU6A 4YPSA 3KRJA 5M4CA 1KUTA 4IH8A 2IZUA 1FMOE 3NPCA 5JRSA 3IG7A 1DM2A 3TIZA 3QQJA 3R8PA 4XYMB 3UOKA 1WBVA 5J1WA 2OF4A 4U3ZA 4YHTA 1OB3A 4WG3A 2QO2A 2WU6A 4FKGA 4O81A 3W33A 4FSMA 4FT5A 5BVOA 3LWBA 2W1FA 2B0QA 1GOLA 5CF6A 1BL7A 2ONLC 2A0CX 1OBDA 3BQRA 3E87A 3QUPA 4EK8A 4BCOA 3N8DA 3W2QA 2G15A 2B9HA 2WD1A 3I81A 1AD5A 3I1AA 3QA8A 3UZTA 2PVRA 3OXTA 1W0XC 1YXVA 4G16A 4OTGA 4NT4A 3ZO3A 4EHEA 3R28A 4CLIA 4AP7A 3K5IA 2IG7A 3QUEA 4APPA 2G01A 4FTKA 1KE8A 3R73A 1P4FA 3UC3A 4QMZA 4NTTA 2J4ZA 3D4QA 3CKXA 5EHOA 2XMYA 4CCUA 3ZFXA 4ITIA 2FP4B 4BDEA 2PVKA 3MIYA 1KJJA 3R00A 2DYLA 2YM6A 3E8DA 1RDQE 3DKCA 4D1SA 5EKNA 2HOGA 5IA1A 4O7WA 1NT2A 4YBKA 5JQGF 4I24A 4QQ5A 2XF0A 3FEGA 2CJMA 5IG1A 4OW8A 3O0GA 2RG6A 3SOAA 3C4CA 3PY0A 2R7LA 4NW5A 4JQ7A 2QKRA 4MQ2A 3F7ZA 4QP1A 4RX9A 4QQJA 1IRKA 3E7VA 5EDPA 3U9CA 3TG1A 4ACMA 4D5HA 1T36A 4E5WA 5CTPA 4A9TA 1UV5A 3PDTA 2WYOA 5E92A 3PG1A 4GUEA 3F3TA 3HKOA 2Y4IB 3ERKA 3FUPA 4H1JA 4YJQA 5DHJA 5CB4F 2PVLA 2VTAA 1CS0A 2WMBA 4UXLA 1JLLB 5F4NA 4W8EA 1F5QA 3NNWA 3OBJA 4IM2A 1OPKA 1XBAA 3FL4A 3RWQA 3RMFA 2BZKB 4RQKA 2CKEA 3UG1A 4GCJA 3D5VA 3CC6A 3ODYX 4ACGA 1IASA 2J6MA 4HJOA 5HBEA 2VTLA 4IWOA 4F1TA 2GTNA 3RK9A 4C3PA 4EYJA 4C4GA 1LUFA 2UW4A 4K11A 3O96A 2YYAA 4IX3A 3KF4A 3DLZA 5A6OA 5I9YA 3G0EA 5KMKA 4OTIA 3PXZA 4N6YA 4ARKA 2GNFA 5AP3A 5CSXA 4R3RA 4RLKA 3MH0A 2UW8A 5J1VA 3RV3A 2PZYA 4ANSA 1VEBA 3AD6A 3H0ZA 4DEIA 4A9RA 2YM3A 4PF4A 4FKVA 1GJOA 4GFMA 5IA5A 4BDIA 4E6CA 5JGBA 1LEWA 3EQRA 4HVDA 4YPDA 3EFWA 3GCSA 1YRPA 2EVAA 3CJGA 2HY81 4WBOA 5JKGA 2WFYA 3VS0A 4NM5A 4D5KA 3FY0A 4RJ7A 4WRGA 4K33A 2ZOQA 4CGAA 4NJ3A 4X3FB 4CSVA 3DBDA 4RC2A 5KBQA 5BYLA 1I7NA 4C33A 2PHKA 3TIYA 3R1NA 4MV7A 2XIKA 3OY1A 4Q9SA 3NNVA 2WO6A 4Z55A 1XH6A 5EKOA 5KMLA 2VWWA 3OEFX 3OW3A 5EI6A 5GNKA 3U87A 3TQTA 3KC3A 4H58A 4JL9A 2OLSA 3MN3A 5KZ0A 1X8BA 4BTJA 3V4SA 4ZHQF 5HE1A 2YW2A 2YDIA 3JR1A 4FICA 4O7ZA 4L42A 4RJ5A 3AXWA 3TV4A 3MWDA 4IAZA 4AT4A 4EYMA 2QOOA 5LOHA 5BMSA 4DINA 3P4KA 1RW8A 1KE6A 3ZCLA 4GH2A 5FP6A 2R7NA 1LPUA 5D12A 2ZDQA 1M52A 2F9GA 4DEEA 3MFSA 3PWYA 4B8LA 3P78A 3MIAA 2XIYA 4RZWA 2C30A 1JAMA 3UPZA 1YHWA 4FK3A 2ITUA 4IB1A 3TKUA 4O7LA 5IUHA 3M11A 4FL3A 3QZGA 4ZOGA 1M14A 2NU8B 4YSJA 5GINE 4EK3A 1ZY4A 4EOJA 4MV6A 3LZBA 2HXQA 4FZFB 2WOUA 3CQEA 4O7SA 4ALVA 3FZTA 4FIIA 3WF9A 1IR3A 4GFGA 4C34A 4W8DA 4AZEA 5EG3A 4V01A 4JRVA 4E26A 2WB8A 3R8UA 2YL2A 5HX6A 3LCDA 3DKGA 1I09A 3E8EA 3I4BA 2I0YA 3L9MA 2CPKE 4I6HA 2QU5A 2J0JA 3DBFA 2XJ0A 3HGKA 5FDXA 3KY2A 5HLNA 3UBDA 2GU8A 3WNZA 5CU2A 4Y5HA 2PMOX 4CD0A 4G3DA 1OM1A 4CKJA 2C6IA 2JLDA 2WTIA 1JBPE 5TKDA 4BDDA 4IVBA 2BRNA 3ZM4A 3R21A 3B8RA 4RZVA 4E8AA 3QUDA 2BZHB 1QMZA 1ZAOA 1OKVA 3BHVA 2C00A 4E7WA 4DLKA 3LMHA 1Q97A 4EK4A 4BZOA 1Y6BA 4X6QC 3QTZA 2PVJA 2VO6A 4H39A 4XP2A 5ANKA 2PMLX 3KU2A 5ETFA 3SRVB 5HCYA 1BLXA 2JIUA 4A4LA 3GFWA 4HYIA 5CXHA 5AFVA 1H08A 1ZARA 4FZ7A 2HAKA 4WKQA 2GFSA 3IGGA 4YJTA 5HCZA 3SW4A 3FKLA 3H9OA 3A2CA 4GSBA 3K3PA 4L44A 4U0IA 4WUAA 3CD3A 2A27A 4O0VA 4JG8A 4D1XA 5EH0A 2JDTA 2V22A 2RFDA 3F82A 4TYEA 4DGMA 2WQNA 2IZSA 4EHGA 5AWMA 1JLUE 2QK4A 3HX4A 3EQFA 4JX7A 4M97A 4A9UA 1IAJA 4DTKA 1JPAA 3PE1A 5E9EA 3RPYA 1T46A 3RV4A 3PIXA 4CQEA 4UEUA 3RAHA 4YO6A 4K18A 4AGDA 4FEWA 5AP7A 4BN1A 3H10A 4DH7A 4I22A 4O21A 5CY3A 1B6RA 3R5FA 2YITA 4E4TA 4F0FA 3C4FA 4TZRA 4J97A 4FIEA 3UIXA 2E9PA 4IDVA 5LVNA 2QKWB 2RG5A 4YP8A 4EJNA 5IMXA 3C0IA 2VR1A 1H24A 3HA8A 2XD4A 3HMOA 2RFEA 3HMNA 1XH8A 3DBEA 4IZYA 1GSHA 4MAMA 2VTRA 4K6ZA 4XZ3B 3I5ZA 2P55A 3F5UA 2YISA 4JLCA 3R30A 4F7NA 1W83A 2GNJA 4RJ6A 3E5NA 3PIYA 4JOAA 4AZSA 1Q8WA 1OIYA 1TQPA 5D7VA 1YWNA 1KJ9A 4F09A 5CAPA 2QQ7A 3G6HA 3VBTA 4AACA 3GCUA 4YURA 3UP7A 2ZDGA 3LQ8A 4O0WA
chains in the Genus database with same CATH superfamily
1PW2A 3FLQA 3NFGB 2CKOA 3E63A 3R8LA 2HW6A 3P23A 2NU9B 2A4LA 2C0OA 2HWOA 4RA5A 3ZLYA 4FV2A 2XA4A 4YZNA 2JKMA 3FSFA 2EU9A 5HVJA 4BDFA 4L3JA 3PPKA 1Q8TA 4Y83A 3UE4A 3UQCA 3TY9A 4Q2AA 4BTMA 3EZRA 4L46A 4YLLA 4B8MA 3LMIA 4J99A 4FT3A 3BABA 3R8MA 1Q99A 3KXMA 4I6QA 2ERKA 4FTLA 4M0YA 5ANDA 1ULZA 5CANA 3HMPA 4WO5A 3DAJA 5AP0A 1Q3DA 5M06A 3E8NA 3W18A 1KE7A 3A61A 4FKOA 3EWHA 2LGCA 3IDCA 3BHHA 4GVJA 3TXOA 3TM0A 2WMAA 3PXFA 3V5JA 2WMSA 1WZYA 4IACA 4JT3A 4DTBA 1YW2A 3RKBA 4BZDA 4EGJA 1UU7A 2GMXA 4HVIA 2BZJA 2I0HA 4GU9A 4HGLA 3ORRA 3H9RA 5IQFA 1PF8A 4XG3A 5EYMA 3OC1A 4DFBA 3UTOA 1MRYA 1TVOA 4HCUA 2YM8A 4KNBA 3II5A 2BTSA 2VRXA 3ULZA 4E4XA 5DRDA 2XKDA 5CF8A 2OIDA 3IQ7A 5BWVA 4E4NA 4RLLA 4EFEA 5FTGA 4M15A 5CEPA 4W4WA 2UVXA 2V62A 1RE8A 3L8PA 5FUTA 4QDVA 5CT7A 4RC4A 3UVQA 2XK7A 3ZLWA 1JKSA 4FFPA 3BBWA 4IM0A 1SZMA 3EQIA 5GJDA 2O0UA 3DTFA 4MWIA 2WMUA 2OKRA 5J87A 4MA5A 2YCQA 2E9NA 3W0MA 2P4IA 2PL0A 3QF9A 5H2UA 1QPEA 4EBVA 3TW7A 4FZDB 2R7MA 4IAKA 4JR7A 4DHJA 3HEGA 2XBJA 3GCPA 4LV5A 5HICA 1YOJA 2QOQA 1W82A 2WXVA 5CU4A 3HB9A 1O6KA 4AT5A 3DJ5A 4M14A 2I87A 2H96A 4BIBA 1OIQA 3FLZA 5HU3A 3MWEA 4TY1A 4CMFA 1OL2A 5DVRA 4XJ0A 3UDSA 1OKZA 4XLVA 3SX9A 3IW8A 5I5VA 4NWMA 4NKSA 2HELA 4FFNA 2Q83A 1CE8A 2V5QA 4FL2A 4TWPA 5M56A 1LEZA 2C6OA 5FM2A 2BAQA 2W1ZA 3ANRA 3FZOA 3N9XA 4I3ZA 4QMSA 4BDJA 2XK4A 4XG8A 5TF9A 4IEBA 2HENA 2VGPA 4LUDA 5DYJA 4QMXA 3VBVA 4MV8A 1ZOEA 2XB7A 3MFRA 1P14A 4BCMA 4I4EA 3HDNA 3TY8A 4XX9A 1JDEA 4FKUA 2UVYA 2VAGA 3G2FA 4O7TA 1H27A 4GRBA 5AUXA 1Z2NX 4Q4CA 3L8VA 2OIBA 3ITZA 4HPUE 3HV4A 4J52A 4S32A 3UODA 1CMKE 1SVEA 4AZFA 4C0TA 5BX0A 5C1OA 1PY5A 3R01A 3DJ7A 5HCXA 3G8DA 1KV1A 3DS6A 3POZA 1ZY5A 2PVPA 4EOOA 1G3NA 3GP0A 1WMKA 3C7QA 2B7AA 5E8SA 2R7BA 3QFVA 4FKJA 3LCTA 3TZ8A 4C59A 3RUPA 4GLXA 1SVGA 4X2KA 3WWJA 5IQEA 1YWRA 2XCKA 4A4XA 3LM5A 4G3FA 4IADA 4ZSJA 1JSUA 1PKDA 2GHLA 4EUUA 3MBLA 4R5SA 4DRFA 2QONA 2YAKA 3OOMA 4WG5A 3QQMA 2FSMX 2WMVA 4CZTA 1IOWA 1Z2PX 2UV2A 3TTJA 2X8DA 2X8IA 3TMOA 5H80A 3K5HA 1ZAUA 5JQ5A 5HBRB 3U51A 5KUPA 4QMUA 5CQUA 2PVYA 3D9VA 3GEQA 4AW1A 4IWYA 4ME6A 4TUYF 5EQYA 4ZEGA 3VN9A 5J95A 2VWVA 5EI8A 2W9ZB 5I9VA 4EG0A 4PNIA 4ZJJA 2UUEA 3JSNA 3FBVA 5FEDA 4F9WA 3QGYA 3ZDUA 2PE1A 3FL5A 3QAME 4BI1A 2GSFA 3QKKA 3V8SA 4F7JA 4PL4A 3VF8A 4QRCA 4B99A 3LKMA 4DEGA 2JFLA 2VV9A 3ZOSA 4FR4A 4YO4A 3LXLA 5FDPA 3IW6A 3OD6X 2JIIA 1YVJA 3RPVA 4FFOA 4GVAA 2UW3A 5BVWA 4O96A 4BIDA 4V0GB 2H8HA 1E4EA 3LXKA 1B39A 2OIQA 3PY1A 3WI6A 3SVVA 4FTNA 3MA3A 2OZAA 3WZDA 4HYSA 5I5XA 1Q5KA 1VYZA 3F2NA 3MW1A 4M68A 4IFCA 2XP2A 4QTDA 2CNUA 2ZVAA 4I5MA 3ZONA 3NVKI 1J91A 4P5QA 1R78A 5EYDA 4C4IA 4X2FA 2VTOA 4FTMA 1M2QA 3UNZA 5IEXA 3GDEA 5GHVA 4Y5QA 1ET0A 3L8XA 2ITOA 3OHTA 2R3PA 3E7OA 4ZZNA 2YWVA 3V6RA 5HTCA 1U46A 2W17A 3Q5ZA 4I20A 2ZV2A 5E7RA 4RVLA 3EQHA 2ITTA 2I1MA 2QURA 3IKAA 3MPAA 4M7IA 1P2AA 3R22A 4JIAA 4UV0A 2F4JA 4FK6A 2OXXA 4EBWA 4GK2A 5T68A 3UOHA 5IMEA 1BMKA 2XANA 3F3UA 3NUUA 3KN5A 3O51A 4X2NA 4PBCA 3FYKX 4LH6A 4G1WA 4NM7A 4U41A 3D14A 4QQTA 4I94A 4YJ2F 5L8LA 3Q60A 2JDOA 4EK5A 4ZJVA 2GPHA 5EZYF 3O23A 3Q1KA 2BKZA 5D1PA 2UZNA 3QRJA 2DAAA 4Y72A 2C6EA 2ZB1A 4JBQA 4L8MA 3JZFA 4UCRA 2HVSA 3S3IA 4H05A 4CT2A 4AAYA 4ASDA 4YSMA 3LP8A 2YCRA 3LCOA 5LARA 4UZDA 4PMPA 5KO1A 2Q2TA 3DLSA 4L67A 5LMKC 3E88A 2FUMA 4HGEA 3C0GA 3Q4ZA 4M0JA 3RFCA 3TNPC 4P7EA 5ETAA 3D7ZA 1GSOA 4XV3A 2EWAA 2OI4X 1PXNA 3LOKA 4NFNA 2JDRA 4RVMA 5D1JA 3MS9A 3ETAA 2OF2A 3HVCA 4TL0A 2PE0A 1ZMWA 3P79A 4ZS0A 2VO7A 4GK3A 4HNTA 4QP8A 3NUXA 2WIPA 4IB5A 1EHIA 4CFVA 2AC3A 4AG8A 2ITPA 4O91A 2W7XA 4FG8A 4O7NA 2CCIA 3AMAA 4YZDA 5J9YA 5IQGA 1KJQA 4M8TA 2BHHA 3DOGA 3MTLA 4BCNA 1VKZA 4TVIA 1P16A 3EQBA 5CEQA 1OKWA 3VF9A 3BIZA 3JVRA 4EH8A 4IZOA 4C62A 5HG8A 4EH3A 2ZDUA 4RCNA 2B53A 4AQKA 4WG4A 3UDTA 4CNHA 2X2KA 3MI9A 5F94A 5DFPA 2PBZA 1WBOA 2WMWA 2HGWA 1OL6A 4IZ5A 4V05A 4IE9A 2OJGA 2W4OA 4L3LA 1GGOA 3FC2A 3DK7A 2JC6A 3QZIA 1U4DA 1F0QA 2NYAA 4J8MA 3EH9A 3MH2A 5HO7A 3KVXA 3MDYA 3KXGA 3NW6A 5F1ZA 4L53A 1Q62A 2GHMA 2XNMA 3JVSA 5HIBA 1A0GA 4LQMA 3W8QA 5JVDF 4DCEA 1UNHA 3E3PA 3NCGA 1UU9A 3FI4A 1IEPA 4PMSA 4NYEA 3B2WA 4BCQA 4TNBA 1PXLA 4ONAA 3M1SA 2C68A 4RMZA 3W8LA 1EYZA 4DG0E 2GPWA 3FMHA 3BAAA 2HYYA 1P5EA 1PYEA 2R2PA 3QTIA 3DJ6A 1Y6AA 3T8OA 5L2IA 1A48A 5DWRA 4HGTA 3EN4A 1I44A 3UZPA 1K3AA 1Z5MA 2R5TA 4CMTA 3ORPA 4KWPA 4OT6A 4PY1A 3W1FA 2OG8A 3CSWA 3MESA 4R3PA 3PLSA 3GB8B 3CS9A 2VTSA 5CAEB 1YOMA 3I6UA 3L9NA 3RPRA 4EH5A 4FYNA 5C8KA 3HV3A 3NW7A 3QQUA 3S4QA 2CCHA 3DTWA 3R9NA 3ZFMA 4CV9A 2GLTA 2IVUA 3GC0A 5EDRA 2YEXA 3JXWA 3OS3A 4GK4A 4KS7A 3WF5A 5AAEA 3FXXA 5CEMA 3O17A 1P8LA 5LVMA 1OECA 2Z8CA 2G2FA 3BLHA 2YWPA 4KRCA 1ND4A 3Q2JA 4A4OA 2X9FA 1PHKA 1VYWA 4S33A 4AA4A 3QC4A 4ASXA 4BC6A 2X7OA 4E93A 3CKWA 3ZSIA 5EW9A 1L3RE 1ZOGA 3FKOA 3MA6A 3QTQA 3L8SA 3OUNB 2SCUB 2ZM3A 1DS5A 4XV9A 1Q3WA 5L2SA 2H6DA 4DAAA 4DITA 4XYFA 1SCUB 3VPBA 3RI1A 2YIQA 4PZ7A 3PXYA 4IDTA 4LI5A 2BIKB 2REIA 4U80A 4AF3A 3WO1A 3HO8A 5BWRA 5KX5F 2XCHA 3EOCA 2UW5A 3BCEA 3DB6A 2A2AA 2XVDA 5KE0A 3T9BA 4MAOA 1FPUA 4DEAA 3W2PA 2O8YA 2VX3A 4I0RA 4YJUA 5DR9A 4ZLOA 2V0DA 3SXRA 2XK8A 3LULA 2I40A 2R3LA 4YU2A 5K4IA 2C6MA 4FIHA 3V3VA 2XJ1A 3EB0A 2W1DA 1V0BA 4FG9A 4TYJA 2QOKA 5DEWA 5BVDA 2AC5A 2GQSA 5M51A 2YIWA 3SW7A 4NK9A 3CEBA 5JGAA 5I47A 5E8UA 1SMHA 2RKUA 3KMWA 3V5QA 5I5WA 3NIEA 5ITAA 5JMSA 4DT8A 5AP2A 1WVXA 2ITVA 3QQLA 4I0SA 5E8ZA 5JGDA 3GU7A 3D83A 2UZEA 4E5BA 2PSQA 4NM0A 3AD5A 4O0UA 5T3QA 3C5IA 2PTKA 3LFNA 5BWUA 3EKKA 3O8TA 4G3GA 3AW8A 3D94A 3BX5A 3VNTA 5KMMA 1DV2A 1GIIA 5B2MA 2PVFA 2WU7A 2R7KA 3QCYA 4GT4A 1DI8A 5CAVA 5LA6F 2P3GX 2YM5A 4HNVA 4G3EA 1OGUA 4PDPA 2Y8OA 3TUBA 2YS6A 3OVVA 3RNYA 1GSAA 4CKCA 3TTIA 2B9JA 2VWZA 4MTAA 2DABA 5DGIA 4AW0A 4FKWA 4RFZA 4R5YA 3FWQA 4F9CA 5EOLA 1CTPE 1CDKA 4EI4A 3QRIA 5BV3A 1PXPA 1Q8UA 1Q4LA 1URWA 4FV6A 3DGKA 1FINA 3OT3A 3S95A 4NCTC 1IOVA 4S34A 3DCVA 3QHRA 2WIHA 5IQAA 3Q9XA 5J7HA 4ZSEA 4D2SA 5HG7A 3NBYB 3CXWA 4FZAB 2ETKA 5I9ZA 3ZU7A 3O50A 4MX9A 4YLJA 3THBA 4DH3A 2X0GA 3BLRA 4NM3A 4CKIA 4MXAA 5JFSA 4IC8A 5FBOA 1H1PA 1W7HA 1Y91A 4TPTA 4U9AA 1YOLA 3QCSA 1H4LA 4QP3A 3ZS5A 4PL5A 4CTCA 4ERWA 2OGVA 3R8ZA 2VO3A 4ZP5A 4Z16A 5JZJA 4Y8VB 3DDPA 2VNYA 2CN5A 3VUIA 3K54A 4MNEA 3BZ3A 2R3FA 4WD5A 3W16A 5CSVA 2W6ZA 5FEQA 3CGFA 3LCSA 3Q5IA 5EHYA 4B0GA 1OVEA 4DHFA 3E8CA 4NH1A 3MY0A 4ZTRA 4CMUA 4D9UA 2JBPA 4F6SA 1V9PA 4NZNA 4K0YA 3CQWA 2BVAA 4I6FA 3LFFA 2QHMA 2Z04A 5FNVF 4ZTNA 4QMLA 2HZ0A 5A14A 4F70A 5FTQA 4FVRA 1A9XA 4OTWA 2W5BA 5CZHA 4YJ3F 5HI2A 3D5UA 3BGZA 3ZUTA 4PP7A 2HWPA 3GNIB 4KAOA 1BI8A 4N57A 1VLRA 3TJCA 2J7TA 1MP8A 4GEOA 4EOLA 3UNKA 5J2TF 3GGFA 2ZDHA 5FPOA 4MBIA 3DKOA 5HO8A 3ZUVA 3SNOA 1L8TA 4IFGA 5JFVA 3T9TA 4U97A 3PJ1A 3IW7A 2X0SA 2RGPA 5DEYA 3ZEPA 2HZIA 5K9IA 1F3MC 3GC9A 4DGLC 3VMMA 5LQFA 3HNGA 4NZMA 4UUGA 4E6AA 3OY3A 2QG7A 3E3BX 1OBGA 4BDAA 2E9VA 5GJFA 3R04A 5K3YA 5IF1A 1XBBA 3QCQA 2YN8A 4GKIA 5LMKA 2J9MA 4IAFA 4IHPA 4JX3A 4LL5A 3TDVA 3VUGA 1Z2OX 4HNIA 3NYVA 4NZOA 5FPRA 3P7BA 1WBSA 2KULA 3MYGA 3HECA 2HW7A 3ORTA 4M67A 3GFEA 4IIJF 2WMQA 3DNEA 3R6XA 3UIBA 3PVBA 4IVAA 3ZFYA 3N4TA 4XRLA 3UMXA 2HIXA 1T45A 4RWJA 4J1RA 2QOIA 3A4PA 2B4SB 3GCVA 4FV9A 2QOHA 2UZWE 1J1BA 5JRQA 3OFMA 2FH9A 3OWJA 4OBPA 4R7IA 3QGWA 1CKNA 3MJ1A 4GIIA 4IQ6A 4BR3A 4CV8A 3CP9A 4OBQA 4YLKA 2V58A 4YAKB 4ZY4A 3F88A 2R3IA 3PXRA 5LMBA 2PY3A 1CKIA 2E9UA 3OWPA 5IDPA 3DFAA 5HBJA 3G9NA 4QYEA 1XDNA 3VBQA 4QSHA 4FNXA 3WZUA 4YNOA 3NRMA 4FGRA 5EQEA 4BGHA 4C4JA 3K3IA 3KRLA 1OUKA 4AW2A 2DWBA 4F6WA 3TZ7A 4UCVA 5IA0A 1YI4A 3V5WA 3U9NA 1W93A 4FUXA 3H0YA 4D4SA 2ERZE 1OI9A 2CMWA 5KNJA 1ZYCA 3PP1A 5HGIA 5JZNA 4FTOA 4M12A 4EZ7A 4MVFA 5D41A 4I4TF 3PPZA 4AXFA 3A62A 4ZTQA 1JQHA 3Q32A 1NVQA 1FGKA 4GJ3A 4QMYA 4WNMA 4XH6A 3QTXA 3EFJA 5DGZA 2FSLX 4CRLA 2RF9A 2YACA 3BKBA 4YC6A 5H9BA 3D0EA 1R39A 4C38A 4UY9A 3ALOA 3WBLA 4EOPA 3DKFA 4QTEA 4RQVA 5IEYA 4ANQA 2IO6A 3AC2A 1ZXEA 4DFZE 3ZC6A 1NXKA 3DAAA 5A3XA 3PA5A 2W1IA 3UQGA 5HX8A 4BY9E 2WMRA 4TYHA 2WQBA 1I2LA 2DUVA 2W99B 3LFQA 5CAOA 1XQZA 5IA3A 3GOKA 3E5AA 3GLKA 3HV7A 5FQDC 2HHFB 4F64A 1BUHA 1PXKA 4R78A 3SGCA 2R87A 4WRSA 4ZTLA 4FIGA 1PYXA 4O4HF 3GC7A 3MH1A 2HJWA 2VO0A 5DI1A 2VNWA 4G2FA 1OIRA 5AX3A 3SXSA 1SM2A 5IISA 4DGGA 3UG2A 1YI6A 2WOTA 5DR2A 3DA6A 4YHJA 1DGSA 4RIWB 4F9YA 3F3VA 4BYJA 2B55A 3ZSHA 3LFBA 3QWUA 4CVAA 4FTRA 2QO9A 3OBGA 3VS3A 4L7SA 3W32A 4NKAA 4M3QA 1EKFA 3DXNA 3NIZA 2GNGA 5FXSA 4DYMA 5EM7A 1GAGA 2PWLA 2XK3A 4DGOA 4QO9A 5DIAA 4U44A 3F69A 3BGPA 2YHVA 4X0MA 5LCJA 3UYYA 4BJJB 2BCJA 2R3HA 4WIHA 1NW1A 1G8KA 2GDOA 3REPA 2WELA 2CNQA 4MD9E 4QMTA 1JNKA 3QD2B 3FZRA 3BYUA 1KJIA 4EQ5A 1Y8YA 3ZC5A 5C4LA 4CEGA 4FX3A 1FVTA 3AC5A 3NYOA 3LXNA 4JBOA 4LDTA 5C8NA 5DAAA 5FG8A 1EZ1A 3KCKA 1BXRA 3QWJA 3PIZA 5I5SA 1JKKA 3QLGA 2OLCA 4LRKA 2XK6A 2JDVA 4C2VA 1YXUA 3FQEA 3LVPA 3Q53A 1TFFA 3QX2A 4RJ8A 3W1BA 5EOBA 2YDKA 4ITJA 1YKRA 4WOVA 4TRLA 4RX5A 2QOLA 3FHRA 2PUIA 5AP5A 2QLUA 5A4TA 4TT7A 3KQ7A 4XOYA 3TZMA 4EWQA 4RIOA 5C03A 3NYNA 4YTIA 3R63A 3TEIA 4BCPA 2CLQA 3BEAA 4G3CA 4JI9A 1KJ8A 3O7LD 1TA8A 5H8EA 4G9CA 4I50F 5BWTA 1ERKA 4MQ1A 2IVSA 3DXPA 4LV7A 4UWCA 4CCBA 3GJXB 4EEQA 3D5XA 4DFUA 2XKEA 3B8QA 1W8CA 2BRGA 2FSTX 5K3WA 1JSTA 3FZSA 4CXAA 1DAWA 3A60A 3C1XA 3UDZA 1XR1A 4PP9A 5A6NA 2VWBA 4PTEA 2C6DA 4GUBA 2W6PA 5KMOA 2PVMA 4FSWA 4U7ZA 4EORA 4FVQA 3TIGA 3WIKA 3OCTA 3P7CA 2XEYA 3BGQA 3LPBA 3ZO2A 3H4JA 3KRRA 4GJ2A 5IQBA 3TYKA 3VWAA 4ACDA 1A0IA 4TYGA 2QOBA 4F63A 4V04A 2DIKA 2WAJA 2VGOA 3EFKA 4PNKA 5C8YF 3OUKA 4GFOA 3P86A 3ZZEA 2OBJA 1R0EA 5EFQA 5HG5A 1HCKA 3I60A 3N4VA 4NCTA 5H8GA 4C3FA 4DFLA 2B52A 3GT8A 2VTPA 3UDBA 4WHXA 2F7ZE 3NNUA 5D11A 5DA3A 2C6LA 4HZRA 2G9XA 2X9EA 3NUYA 4RBLA 4Z7HA 4G6LA 3TL8A 4YR8A 5M53A 1M0TA 4ENXA 3WF6A 4RWLA 2YIXA 4AA0A 3BWJA 4AU8A 1G8AA 4ZTSA 1NVRA 4DF3A 1QPDA 4ALWA 2ZV7A 3NUAA 4CMOA 5AUYA 2JBOA 2G2IA 1AQ1A 5HZNA 5AJQA 3O7LB 5IQHA 3TEKA 5A9UA 3ZO1A 3MPTA 3GU5A 2J2IB 3T3UA 3U4WA 4J8NA 5DR6A 5EW8A 5I9XA 1EUDB 2YS7A 4O2AF 2VTHA 4RIXA 1I2KA 1ZYSA 4HNFA 4BCFA 4YZMA 4JS8A 4QNYA 3OTUA 4RIWA 4RVKA 2BMCA 3Q4UA 2O63A 2XK9A 4I92A 5M4FA 3UO5A 5DMXA 3SHEA 4D4YA 3AG9A 3A8XA 3LJ2A 2JKQA 2W6QA 4ZY6A 4FTCA 4KKEA 2EUFB 4MXOA 4W4VA 3BG5A 2WHBA 2XYUA 1XHAA 4ANLA 4ZLYA 2PZRA 2ZMDA 3ID6C 5JEBA 4ZSAA 4G17A 3FLSA 3VHKA 4BTFA 5HNEA 4UWYA 4FFLA 2O65A 2QC6A 4RRVA 5E8YA 3U55A 4Y73A 4BJJA 4GT5A 3HBLA 4PL3A 5FTOA 4MYGA 1UNGA 3R83A 3S1HA 3HAVA 4DBNA 2OJJA 4U6RA 5A54A 4XP3A 2GPSA 1GIJA 4B7TA 1C30A 4HQ6A 3Q04A 2CSNA 4YMJA 3PSCA 3RHKA 1K9AA 3GXLA 2XJ2A 3P1AA 3C50A 4LV8A 2X1NA 4JJRA 3EL7A 3QYZA 2OZOA 2C5VA 5GONF 4DHZA 4BHNA 4EOMA 3E64A 3VONA 3UZOA 2BZIB 3HP2A 1E4EB 4OTDA 4EH2A 4ZXTA 4TYIA 3BYOA 3Q2MA 5FBNC 2CNVA 2OZAB 4TM5A 2ZV8A 1KTAA 1WRVA 3RR5A 5E1EA 5KKNB 3KXXA 3OP5A 5ICPA 3NNXA 4X3JA 4AUAA 2W6MA 2R86A 3DTCA 3GU6A 2ZB0A 3WZKA 4C4FA 3OWKA 4BDBA 5HE2A 2PUUA 3Q96A 4FTQA 4JRNA 4UCTA 4CKBA 1AGWA 3DY7A 2PUPA 2JEDA 3L1SA 4BGGA 5CXZA 1ATPE 3F2AA 3QBNA 4RIYB 3ULIA 1OITA 3RM7A 3RCDA 4QMNA 5DT3A 4XX0B 3BYMA 3JUHA 5AV4A 2R0UA 4FKSA 3CY3A 3E92A 1XBCA 4FSQA 4IW0A 3FPQA 4F4PA 2W4KA 2BIYA 2YABA 5AUZA 2YRWA 3CD8A 3QTWA 3ORIA 2JIVA 5B7VA 4BBFA 2OWBA 2OJIA 3FC1X 4XG7A 5AV3A 4LFIA 3ORQA 4C5BA 4W4XA 2Y4PA 3EMGA 5A4CA 5I0BA 3NUNA 4C4EA 4D0XA 4MF1A 4RVTA 2FO0A 3D15A 3IW4A 3LHJA 4FJVA 4O6EA 5D9HA 1H26A 4D28A 5GIOE 4AXDA 3EKNA 4F6UA 4Y8DA 5C01A 2V59A 3GENA 3NZ0A 1UU8A 2GHGA 4NSTA 3Q52A 4YZ9A 4XG4A 4DLIA 3HA6A 4U43A 5AUUA 4YTHA 5DLSA 4CC6A 1V1KA 2I6LA 2FA2A 2YZGA 4QYYA 4KKGA 4OBOA 3Q2OA 1XMLA 3TT0A 3KYHC 3R71A 1TQMA 4FSTA 3RPSA 5M4IA 3OCSA 3QQKA 4FC0A 3ZSGA 2P0CA 4H3BA 2Z60A 4IB0A 5LVLA 3T54A 4D4RA 1QL6A 3EQCA 5CT0A 1NY3A 4P90A 5JFXA 1KC7A 4JDKA 3AC4A 5C8MA 4FFMA 4GMYA 1XMMA 1IYDA 2PYWA 3B2TA 2BUJA 1ZZLA 1XH7A 4O22A 4ZJIA 4JG7A 3S00A 1K2PA 4YBZB 3LM0A 3IOPA 4FNYA 4PV0A 5JT2A 5L8KA 2V7AA 3UP2A 2IP4A 5BQ0A 3RGFA 4PDYA 4TWNA 4JG6A 3FLNC 3GOPA 4RGJA 2WZJA 2P2HA 3EYGA 3KREA 4ZK5A 1ZMVA 3ATSA 2DZDA 3CTQA 3EHAA 4ZTMA 1CKPA 4FE2A 4UFZA 3OXZA 3I0QA 4JDJA 5DOSA 3WARA 5E90A 4QYFA 4DFNA 3RWPA 3IK3A 3BHTA 4BZNA 3KXHA 3FQSA 3TW6A 4CFMA 1LP4A 5CF5A 3QRKA 2R3NA 1GIHA 4CKEA 2GS2A 2HXLA 4JMQA 2HZNA 2YCSA 1OMWA 3NWWA 2XZSA 3FY2A 4GLWA 3BU6A 4WSYA 4QMQA 5ACBC 5CENA 5D10A 3FMEA 4FNZA 5AX9A 2QI8A 5C27A 3PN1A 2IW6A 4O7VA 3W55A 3LFEA 2BFXA 5IQCA 2NPQA 3PUPA 2Z7SA 2VZ6A 3DFCB 4RWIA 4NZWB 4EQMA 4X6RA 4M84A 5J9LA 3C13A 5C1QB 4WUNA 4I5PA 3KVWA 3SXFA 5CAQA 5IEVA 3U8WA 4C7TA 2VX0A 3BE9A 4XYLB 1PXIA