4O7SA

Saicar synthetase (type-2) in complex with tmp/tdp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
MIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with TMP/TDP
rcsb
source organism Pyrococcus horikoshii
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7sA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7sA02
4RC2A 4E93A 1OL2A 4G3EA 5KMIA 3L8VA 3EN9A 2UZDA 3FQHA 3VHKA 2C3KA 4G6NA 4EYMA 3PY3A 2BFXA 2G2IA 3UMXA 3UO6A 4ENXA 4QMXA 5GINE 2UZLA 1PK8A 5M4IA 2YDJA 2PVHA 4YJQA 5LCKA 5HBEA 3BHUA 4CFMA 2X4ZA 3NR9A 4ANBA 4DFUA 4O4JF 4F7LA 3E63A 4MAOA 1NVRA 4YZCA 1H8FA 5AV3A 5LP6F 4K77A 5JQ8A 2X2KA 3H0YA 2IPXA 5FP6A 2W4KA 3NRMA 3H3CA 2XCHA 3R9RA 4A9RA 2BAJA 2W7XA 3WE8A 5ANDA 2R5TA 5JZJA 4W4XA 2GS7A 1YKRA 3NUNA 2VWZA 4E4TA 3GI3A 2BZKB 3U9TA 3KK9A 3QL8A 3WI6A 5BPHA 1KWPA 3I79A 5I9ZA 3QUEA 4FEWA 2YAKA 1W96A 3C0GA 4PF4A 1KBLA 4X2GA 4YC8A 4BCIA 1YXSA 4MXZA 4QNAA 3ZDIA 3DKCA 3BBWA 4W4WA 1YRPA 2G1TA 4MBJA 5IZFA 4L7FA 2X7FA 3KU2A 4ZMFA 4RIOA 3A62A 3F2NA 1GSAA 1H28A 1OVEA 3KMMA 5AP5A 2GS6A 4EZ3A 5AUWA 3OCTA 3E8DA 2WTIA 4H3BA 4FEXA 4G17A 3R8UA 5LMKC 1IRKA 2HK5A 3L9LA 1XBCA 4Z3VA 3OP5A 4O22A 4I94A 5K5NA 1R0EA 5AA9A 3GB2A 3V51A 5HVJA 1PY5A 5T3QA 4JQ7A 3U51A 5LVOA 3QRUA 2F2CB 4XJ0A 3MVJA 4IZ7A 3PY1A 5FEDA 4LGGA 5E8YA 3UOJA 1OI9A 4GU9A 5EOLA 1PXJA 2VWXA 4GT4A 3UYSA 4O83A 1YDSE 3AMAA 4AQCA 4WNPA 4O4LF 2X0GA 4RLLA 3T3VA 4I22A 4AZEA 4U7ZA 2JKQA 4YPDA 4GK4A 4RBLA 3N4VA 1I7LA 4KS8A 4NCTA 1H01A 1W98A 2YAAA 3E64A 4FNWA 3U9NA 4G9CA 1UKIA 1JSTA 3FZOA 3OROA 3FLZA 4IM3A 4PTGA 4H3QA 4U44A 4YC6A 4QP2A 4IX5A 5C4LA 4RZVA 2C6DA 1F3MC 2VTTA 3A7GA 4HOKA 4QO9A 4S32A 3FLWA 2QG7A 5EH0A 3QD2B 4KKEA 4IVDA 5HTBA 3EL8A 1NXKA 3LLTA 4YGAA 2XK9A 2XKCA 2IZUA 3R9OA 2EXMA 2WTDA 3KAJA 3BRBA 4RX8A 3SXRA 4CMOA 4Z7HA 4AZFA 3F3WA 1CM8A 3ZBXA 4BB4A 1Z57A 3SG9A 4CKRA 4MAMA 4M12A 2GNGA 2EU9A 1U5RA 3VO3A 5KKRB 2XM9A 3KCKA 2QVSE 2QU6A 3H4JA 4OBQA 3THBA 3RNIA 3M1SA 3DA6A 2VX3A 4O6EA 5IMEA 4KIOA 2YZLA 4N70A 3ZLSA 3G8CA 4BGGA 2GCDA 2W4OA 5IU2A 2W5AA 2JD5A 3D83A 3LXPA 4E26A 4FE2A 3R5FA 5E8VA 5LQFA 3K5IA 2GMXA 4RVMA 4KA3A 3VBQA 2V58A 2WTKB 4FKGA 2OLSA 3LJ0A 4CEGA 4L43A 4YAJB 1NT2A 4D4RA 1C3OA 2JAVA 3BYUA 2HWOA 2XMYA 3QD0A 4I6FA 4IX3A 4L8MA 1WBWA 1GIHA 4WD5A 3OW4A 3U9CA 5HIEA 2GDOA 5DNRA 2X7GA 1PXLA 2GS2A 4A9YA 4PWNA 1FMOE 4BBFA 2LGCA 4FKIA 4X3FA 4BDBA 4KKHA 2YIWA 2V55A 4RC3A 4CG9A 1KC7A 5CU2A 1HCLA 5KBRA 5M09A 3VPBA 2OWBA 4YR8A 3AC8A 3EQPA 4RWLA 4YAKB 4F0GA 1BKXA 4BICA 1REKA 2NRYA 3UPXA 4JAIA 2V5AA 3AC3A 3M42A 4YTHA 3MIAA 3UO4A 4BYJA 5FD2A 4TWOA 5FEQA 2UW9A 4PMMA 4PQNA 2QNJA 3FLYA 3V5QA 5JVDF 4AW5A 3TZ7A 4QP7A 5ICPA 3ATSA 3KREA 3R21A 4F4PA 1O6YA 2WMRA 4I20A 4R3PA 4EGQA 3AD6A 4HCTA 5JGDA 3R02A 5FTGA 4QMYA 3DAEA 4AG8A 2XZSA 4XBUA 2XUUA 1PMEA 4BZNA 2CGXA 3MIYA 4IVAA 4YLKA 3O96A 3ORTA 3FZ1A 2VGOA 5CA0F 4ZS4A 2OGVA 4H3PA 4IZAA 3PJ2A 5BVWA 4RIXA 1ULZA 1W93A 3N9XA 3ETJA 3GP0A 3TDWA 5BVOA 3FHRA 3Q53A 3VBWA 3QZIA 4DLKA 5DBXA 3RAKA 3EFLA 3O17A 4TYHB 4YHFA 2ITPA 5CSVA 3U87A 1GSHA 4K6ZA 3SE7A 1MQ4A 1WBVA 3QTUA 3V5JA 4DFZE 4ACDA 3O8UA 3V01A 3MPAA 3LFQA 3ZO1A 4IBMA 1GNGA 2ZDTA 1K9AA 4BDEA 2WTKC 3IQ7A 3FLNC 4AT5A 5EI8A 4DG3E 4EOJA 3F3UA 4EOLA 2WOTA 3Q5IA 4EJNA 2PVYA 3R73A 4O7YA 1WMKA 3G33A 5I5ZA 3FPQA 4H36A 5IH5A 4CLJA 2WPAA 4IJPA 5CT0A 4KNBA 5IQFA 4UN0C 2VNWA 4FKTA 4MWIA 4WG3A 3MH1A 3UIUA 3B8RA 1UU9A 3QTIA 2F4JA 3LM0A 4LL5A 3CPBA 4C4JA 2W6ZA 2O2UA 2UW3A 2X9FA 3QQGA 3QUPA 4KABA 4YUQA 5FRIA 5KMOA 4QPAA 2UZBA 3EQGA 2GPWA 3R2BA 2W5HA 4UZDA 4WG4A 4FK3A 4F9CA 3BLQA 1XBBA 3PG1A 4FIIA 3NIZA 5HE0A 5GIOE 4ACCA 2BAKA 3G2FA 3DNEA 3KFAA 4EL9A 5DHJA 3U4WA 4TUYF 2WEIA 4C3RA 4N6YA 2YZNA 3PJ1A 4NM0A 2F49A 2PY3A 3AC1A 3DU8A 3NPCA 3NW7A 3O51A 4BCJA 4FU0A 5ETAA 2W1ZA 4CTBA 1SNXA 2VO7A 3BGQA 1QPCA 4EH2A 5HTCA 3DTWA 4W8EA 3D5UA 4XZ3B 4LQMA 4F9BA 1VJYA 3DF7A 3P9JA 3R22A 4MBLA 2BTSA 4JLCA 1E4EA 2CKOA 2BIYA 2YERA 5E1SA 3C4XA 3KRLA 4O27B 2YYAA 1W0XC 2QKRA 3T3UA 2J9GA 2NPQA 2PUUA 4YZMA 3I7BA 4BCKA 4CMTA 5EM7A 3VAPA 3BHHA 2BMCA 3CP9A 1W8CA 2WQOA 4RX9A 5CI7A 3R7OA 3C4ZA 4F6SA 1R39A 3EMGA 1G8SA 3CEKA 2Y4PA 4FT5A 4YHJA 3TCPA 5BUEA 1PX2A 3MJFA 5LA6F 4R5YA 3B2WA 3OMVA 4ANSA 1ZY5A 3SW4A 2R3JA 4AUAA 3COKA 3HMNA 3QQJA 5IQDA 2WD1A 4BYIA 3SOAA 2EXCX 5E91A 3TWJA 2W6PA 4AN9A 3BGZA 4GJ2A 3RAIA 2GTMA 5KBQA 3IDBA 4I6HA 3QLGA 4RIYA 1CDKA 1H25A 5AMNA 4GEOA 2OLCA 5LVMA 3LJ2A 4D28A 3BV3A 3UE4A 4DTAA 1PKDA 5EKOA 2QKWB 4U45A 1QL6A 3W2OA 4BZDA 1Q24A 3ALNA 3QTQA 4CD0A 5LVLA 2NU6B 3V04A 3W55A 5M53A 3ZC6A 4G3CA 4NL0A 3HZTA 4AXAA 4CFFA 3RWQA 4AOTA 1DIKA 4FBXA 4FKJA 4RIWB 2OF2A 2QOIA 1NA7A 2Y0AA 3FI8A 4IEBA 4ZK5A 2AUHA 4FFLA 3Q4CA 5C1PA 2JKMA 4CFNA 2YCRA 4FTAA 4MXOA 1IEPA 1M2RA 4BI0A 4DLIA 4XOYA 5KMJA 2J90A 3ENMA 2X8DA 2RF9A 4Q2AA 4L1KA 1BXRA 3U9SA 2I80A 1H1PA 2BILB 4XYFA 4EUUA 2C30A 1XHAA 2YM7A 4DFBA 2Z60A 4EH6A 3IW8A 2CMWA 3PXQA 4U79A 4MV6A 2YCFA 4F7JA 3DV3A 4J98A 1UWHA 2GNFA 3EQBA 4P5ZA 4AZVA 3NDMA 2G2FA 3U54A 2B9JA 3UOKA 4CZUA 5A4QA 4EHVA 3OOGA 2PE2A 4FMQA 4EOSA 4ZLOA 1OKWA 1UA2A 1VKZA 1PXPA 2JDSA 5FXRA 1XH6A 4OGRA 3GIDA 3ZRMA 3UP7A 3W1FA 2BALA 4EH8A 3LE6A 3PXZA 4DH5A 2XRWA 4RWIA 3JUHA 4I5HA 4L42A 3TUDA 3E62A 3ERKA 2V59A 2Z7SA 1J7IA 1LP4A 4A4XA 4ZTMA 3PUPA 4FZAB 5EHOA 4DH1A 4BHNA 4BCHA 5J2UF 3GU8A 3LAUA 3P78A 1PRYA 1RQQA 4PY1A 1SM2A 3ZO4A 4ACGA 3RK5A 5TKDA 3GUBA 4LV5A 1WBOA 2OJGA 4MQ1A 4YHTA 2BRHA 3R9DA 1BYGA 3MS9A 4GG5A 3PLSA 4C58A 1OKYA 5AIRA 4Y72A 4I50F 4CFUA 4FVPA 2C68A 4WOVA 4RFZA 3ZSGA 4HGLA 3IDCA 3FY0A 1H4LA 5DE2A 3O8PA 1IG1A 1LEZA 2C5VA 3QYZA 3IG7A 2CJMA 4FSWA 1Q8UA 1Q3WA 5AUTA 1VEBA 2XB7A 3O50A 3OT8A 4BGHA 5DT3A 3OUUA 4QMQA 2FSLX 2VN9A 3PPJA 3R63A 4FIFA 4G5JA 4QYEA 4C59A 4DTKA 5KCVA 2W1CA 3DPKA 4QOXA 2BZHB 3GCUA 4I5PA 5DGZA 5EKNA 1GJOA 5BMSA 2W6QA 4JBVA 3TZ9A 4W8DA 2HGSA 4KS7A 2PPQA 5J9LA 1W82A 1FVTA 4GKIA 1RE8A 1U54A 2XP2A 3FDNA 5GJFA 3LFEA 1URWA 5HCYA 2VTLA 3IKAA 4R1YA 4BDKA 3EQDA 5AUUA 2I8CA 5BVDA 2ITUA 5CF6A 3UQFA 2X8EA 3TKUA 4E5AX 4GCJA 5HKMA 4DFNA 1PXNA 4D5HA 4YMJA 4APPA 5IEXA 3UGCA 5IH6A 3VPCA 4TT7A 1VBGA 1Y91A 4UY9A 4BHZA 3FJQE 4I4FA 3DCVA 3KALA 3O0GA 2C6MA 3PRIA 3AD4A 1ZLTA 1CE8A 4HYIA 4MKCA 4WRSA 2QQ7A 5AUYA 5HG7A 5IA1A 3Q1KA 3QHWA 1I09A 3P5KA 1CS0A 3GU4A 5HBJA 4C4FA 1OKZA 3D5VA 4KINA 2BIKB 3K5HA 4JDHA 4RFYA 4EG0A 3K3PA 2JBPA 3F6XA 1PMVA 1DS5A 4ZTNA 2I1MA 3TTIA 2CNVA 5KMMA 2FPIB 3L8SA 2UZEA 4HZRA 4BTJA 5BX0A 4V04A 2BVAA 4I41A 1KV2A 2F9GA 4WBNF 3QX4A 1Q3DA 5FP5A 2CCHA 3CR0A 3EB0A 2CCIA 1W83A 5LOHA 4EK6A 4CRSA 5J5SA 4H1MA 5C8NA 4C3PA 1P14A 3MN3A 1XH9A 3PIZA 4JI9A 3GENA 5C26A 3KY2A 2C5NA 2JLDA 3NSZA 3W16A 3U6HA 4TV8F 2QOKA 2PHKA 2X7OA 4R6VA 1JOWB 2HXQA 4KIPA 3AQVA 3JYAA 3L8PA 3IECA 3SXFA 1ZARA 2QOQA 5E4HA 3PP1A 3Q6WA 4GK3A 4R78A 5M51A 5HLWA 3UJGA 3D2KA 1PKGA 4O6LA 3VIDA 4FIJA 3VBYA 2WMWA 2PL0A 4BIDA 3ZZEA 4YURA 4FV6A 2X81A 3IPHA 3HKOA 5CI6A 3PTGA 3PWYA 4HGSA 3P0MA 4JVGA 3V4ZA 2ONLA 4O91A 3OY1A 3KEXA 4QP4A 4IAIA 1KJ9A 2QOCA 2WO6A 3LFFA 5EDQA 4QMUA 5CEPA 4HNIA 2VWUA 2ERZE 3E7OA 2I7QA 4QSHA 1M14A 4MK0A 2RKUA 4FV2A 2R7LA 2SRCA 3Q4TA 3QKKA 5K4JA 1BLXA 3RP9A 3PVWA 3A4OX 2WOUA 3P08A 2VO0A 3BE2A 3KCFA 1J3HA 4IWPA 5A14A 5AA8A 1MRUA 2BCJA 3NX8A 5CB4F 4MNEA 3L8XA 4UYNA 4E20A 3KQ7A 3A8XA 4KKGA 3C5UA 3KVXA 5M57A 5HLPA 2OZAB 4JNWA 4C33A 3ANQA 1CKIA 5H2UA 2W71A 3A60A 2FYSA 4WNOA 3W8LA 5D7VA 3I5NA 5FGKA 1XJDA 3QQFA 2ETKA 4C4HA 3ORQA 4FFNA 2IVTA 3CD8A 4QMMA 2OXXA 3QD3A 2VTQA 3ORXA 4QMZA 3W2CA 4E6QA 2OFUA 2XCKA 1I7NA 5DN3A 3VUHA 5CYIA 3WF6A 2W9ZB 2GQSA 4EOKA 2BRGA 3QXOA 3C4CA 4KD1A 3UQGA 5J8IA 5CNOA 4EJ7A 5KUPA 4BRXA 5CSPA 4FV7A 2IZTA 4RVLA 4AWIA 4ZLYA 4KBCA 3P23A 4RQKA 2SCUB 2A2AA 3DFCB 4JBQA 2F57A 3DXNA 4E6AA 3MDYA 1SZMA 5AJQA 3R8VA 4YB8B 3VS2A 2XNEA 1WBPA 4LI5A 3W2RA 3SOCA 4FT7A 5CU3A 2HY81 4KIQA 5CA1F 1OPKA 3CY3A 5EHYA 5HHWA 2JAMA 3OY3A 2V7AA 4BCFA 4FKWA 1JDBB 4LGHA 4FTIA 2X4FA 3OCBA 4KSQA 1EZ1A 2ZV7A 5IQBA 2P0AA 3BEAA 5C01A 3T9TA 4IHJF 4MWHA 3I1AA 1FVVA 4PUZA 2BR1A 3OUNB 4XP2A 5EG3A 3KN5A 4KBKA 3FZPA 2O8YA 4GIIA 3KF7A 3LOKA 4K9YA 2BROA 2VX1A 3RGFA 1SMHA 4QP8A 4E5WA 3A7JA 1ZZ2A 5BYYA 4OT5A 4DE4A 3ZUVA 3AMYA 3RAHA 2J9MA 3SA0A 3P7CA 3NS9A 3Q32A 1ZOGA 3RPYA 2XM8A 3QFFA 1Y8GA 4IAYA 1PXOA 1ZOEA 3QKMA 4GIHA 4ZSJA 2W06A 2RG6A 3V5WA 3C7QA 4RJ3A 3QGYA 4KSPA 1AD5A 3WF5A 3BYSA 5DH3A 5F94A 4WNMA 1YQJA 4R3RA 1JSVA 4RSSA 4USFA 2ITNA 4FVRA 2CLXA 3DKGA 3LFAA 5ACBC 3OWLA 4KAOA 4TKSA 2ITQA 1JAMA 4FZDB 2ESMA 2V5QA 3DDQA 3BYOA 3EQCA 3KXNA 4LUEA 4XG7A 4F99A 3P1AA 4KRCA 2EB3A 5ANEA 4ID7A 2HXLA 2WHBA 4O2ZA 3W32A 5A3XA 5IUHA 5FTOA 4B4LA 3E8NA 4ZZOA 1ATPE 5BMMA 4TWNA 4HYHA 3KXGA 2W17A 5AADA 1M7QA 4AGWA 4D5KA 4EBVA 2J5FA 4HPTE 4OUCA 2HCKA 3ZUTA 3GQIA 3QA8A 5K4IA 4D55A 3WF7A 2VNYA 5CEIA 2JIIA 5FEEA 5JVLA 4GG7A 1AGWA 4GMYA 5L6PA 5CX9A 4GW8A 5CQUA 2XF0A 3R1QA 2AYPA 4L9IA 4NYEA 4F9AA 2CDZA 3FYKX 1NVQA 4BDJA 3BQRA 4RIWA 5H8GA 3ANRA 3DBQA 2UVZA 2OJIA 5C9CA 2XYUA 3BU3A 1H07A 1Z2OX 2A4LA 2VUWA 4O7WA 4FKQA 3ROCA 1DAWA 4YZ9A 1H24A 2LAVA 1DAYA 3Q4ZA 4H39A 4HGTA 3AT2A 2X6EA 4HVDA 4FL1A 1PF8A 1P4FA 1Y6AA 3QC9A 3ORRA 5HG5A 1TKIA 2OXDA 3VNTA 1V0PA 3O2MA 4N57A 4QTEA 3G0EA 3K5VA 5JK3A 2XNMA 4ALWA 4Q9ZA 1LUFA 3O23A 3ACKA 1C30A 5BUJA 2YWPA 3GCSA 2PUPA 2WQNA 4OTGA 5DT4A 1B38A 4FI1A 3WIGA 4EQCA 3KMUA 4YNEA 2XBAA 4NT4A 3R9HA 3C0HA 4UV0A 3CBLA 2HAKA 5CZIA 3UBDA 3C0IA 4QTBA 3TDVA 2ACXA 2R0UA 2R3NA 4FSNA 1PMNA 3D5XA 3QC4A 3VS3A 4MXAA 1Q97A 4EOOA 4JIKA 2G01A 1KE8A 2BHEA 2F7ZE 1BI7A 2OICA 4JG6A 1GZOA 2FP4B 2WKMA 2PE1A 3AD5A 1VR2A 5I4NA 4FA2A 3CPCA 4EOIA 2VTOA 4NM7A 5BVKA 3EWHA 1MRYA 3RK9A 4BCGA 1XKKA 2WB8A 3IGGA 3FI4A 4ZQIA 1M0TA 4I0RA 3QTRA 4M3QA 3A61A 4D4YA 2ZM1A 2EUFB 2H96A 3D14A 4FSQA 5E8ZA 4ASZA 3OUZA 5ANJA 4FOCA 3EKNA 4BTMA 1R3CA 5A4TA 4JBOA 5KZIA 4D58A 3QQHA 4RA4A 4A9SA 4II5A 2W6MA 2YM4A 3WZDA 1OIUA 1BMKA 2WTJA 3EZVA 3QTZA 2CGUA 3HUBA 3OUKA 5IYZF 4AW0A 4A7CA 5CXZA 1ZRZA 3GVUA 2XNGA 4YJ3F 4L67A 3EHAA 4IC7A 4OTDA 2HY0A 1EUCB 4M68A 4E5BA 4J71A 3ETHA 1QPDA 3MI9A 3A99A 5CVHA 3BU6A 4N0SA 3KULB 2B1PA 1Y57A 3Q9ZA 4EEVA 3MYGA 3TINA 3E8CA 2I0HA 3PPKA 4D2SA 5C27A 1IR3A 3BV2A 3TW6A 3BKBA 2FPPB 4FTUA 5G6VA 2YWVA 1OGUA 2JDTA 5AAFA 5EW3A 3IW5A 4CV8A 4DAWA 3FXZA 3PJCA 4MA5A 2RFDA 4FV8A 1GY3A 3BZ3A 1FVRA 2P0CA 3HAMA 2DZDA 4IWQA 4X7QA 3G9NA 2BKKA 3TIYA 3V6RA 5EYMA 4ZY5A 5DRDA 4GFGA 3BU5A 4TZRA 5CASA 2VTIA 1OUYA 2ITXA 3MJ2A 4XV9A 5FNVF 2I40A 5HNBA 4GL9A 3JZIA 1WFCA 3EOCA 4U8ZA 5HU3A 3KXHA 2NUAB 2C1BA 3KL8A 3MW1A 3Q9WA 4RJ7A 4WT6A 5FM3A 4RJ4A 1TQPA 5AP3A 2JKKA 3FMEA 3KKVA 3U6IA 2V0DA 3HL7A 2ITTA 1OBDA 5J87A 5BYZA 4A9UA 5HVKA 4JT3A 3E3BX 3H30A 2ZJWA 3OWKA 3UIMA 4YJUA 3GNIB 1PYEA 4K1BA 3UIXA 1Y6BA 4QMPA 4AGCA 3UNKA 5FDXA 4BIEA 4FTJA 4FV3A 3OTUA 4P2KA 3SQQA 2IW6A 4QTCA 2XKDA 3FZSA 2XEYA 1AUVA 4IZOA 1R0PA 4PDYA 3UQCA 1UNGA 4MD8E 3K3IA 4NK9A 4O0TA 2ITZA 5CF5A 4EK5A 3SW7A 2X0SA 2O0UA 2OU7A 5HE1A 3W18A 5JMSA 4GK2A 4IADA 3AX6A 4KWPA 5C1OA 3AXWA 3DNDA 3R5HA 2OIBA 4GUEA 4NZWB 5H8EA 5HCXA 5ITAA 4EGJA 2IVSA 5FXQA 4ERWA 2QI8A 2OI4X 3HDNA 4YJVA 4RX5A 2DIKA 3NAYA 4QQ5A 4RVKA 3LCOA 4YJNA 4QP3A 4AN3A 1OB3A 5IQAA 3EIDA 4S31A 4APCA 3HX4A 4MV4A 2JBOA 2WNTA 2QOHA 3MFSA 1BL6A 2R3RA 4U42A 2GQRA 4A4OA 3FZTA 1PW2A 2WMSA 1JQHA 2FPGB 3BX5A 3EN7A 2W9FB 2R7KA 2VO3A 2YIRA 2YM6A 3IO7A 1YDRE 3LZBA 4E73A 2YITA 3BLRA 5HNIX 2C3IB 2Z2WA 4CCUA 4G3DA 4ITHA 2Q83A 3MFUA 2PMIA 2C3LA 4E4MA 4ZOLF 2QO2A 2J7TA 3R01A 4F08A 3H0ZA 1UVRA 3ORMA 4IFCA 2IW8A 2JKOA 3ZZWA 4EH3A 3H9RA 5FG8A 2RIOA 1FBNA 3TI1A 4AE9A 4NW6A 3V8TA 3VN9A 5AAEA 5GONF 2BPMA 3F7WA 3QD4A 5KHWA 3GFEA 4S30A 4DGGA 4QMLA 4Y83A 2C47A 4JJRA 2GU8A 3R83A 3VHEA 4UWBA 3ZO3A 4BDGA 4BZOA 2XK8A 1ZMUA 4JDKA 4ZSEA 2J0JA 3LQ3A 4G3FA 3ROYA 4V0GA 3MTLA 3HMIA 2HZ0A 2R7MA 1OITA 2R4BA 3QAME 4FEVA 4H58A 4NJDA 4EOQA 4GFMA 4MX9A 4PL5A 3VC4A 4EBWA 3WBLA 3M11A 3Q3BA 3LFNA 4K2RA 4XP3A 1O6LA 4PTEA 2OH0E 2OFVA 3LFCA 3BGPA 3MH3A 5EDPA 3TJDA 4BCMA 5K5XA 1OL6A 3QRKA 4MBIA 3G15A 2J4ZA 5D7AA 4JS8A 5JEBA 3PFQA 4X3JA 4YZNA 3FUPA 3BI6A 3IDPA 2O3PA 4GS6A 3VS1A 4A9TA 1OIYA 3RUPA 1P2AA 4OR5A 4WBBB 4I4TF 5A54A 3R8LA 5J9YA 3QHRA 2QO7A 4JRNA 4U3ZA 4FOBA 2J0LA 3JY0A 5C8YF 4HNUA 4HNTA 3FZRA 4XG6A 4NW5A 3LXLA 3QA0A 4ZTSA 3VF9A 3NIEA 1Q99A 1TQIA 5J95A 4ZOGA 5EW8A 3HGKA 3VQHA 1IASA 3V8WA 4WRGA 4DFXE 3UO5A 4U81A 3FKNA 1JDEA 3HV7A 5LVNA 3BHVA 5M55A 4OLIA 4S34A 3PZHA 5DA3A 2P2IA 4F0IA 3ELJA 4J1RA 5ETIA 2OO8X 4BR3A 4C0TA 2R84A 2WYOA 4C4IA 3MFRA 2Y8OA 5HU9A 4IHPA 4IM2A 3HMOA 4CV9A 2R9SA 4G9RA 4BF2A 4PRJA 2CN5A 3TV7A 2UZWE 3MBLA 1UKHA 2WMBA 3FEGA 3UZPA 3ZO2A 4BC6A 5JRSA 5JFSA 3FBVA 2IZRA 2I0YA 4IFGA 5LWMA 2O63A 4YPSA 4M97A 4BTFA 4L53A 4EH5A 3UZTA 3VS0A 1KEEA 4GRBA 5AV2A 5ANIA 1S9IA 1KJJA 4FG9A 1R78A 3FI3A 3QQUA 2C1AA 3WYYA 1OIRA 1KJIA 3FXXA 4P7EA 3GU7A 5C8MA 3MVHA 4CT1A 1REJA 5F95A 1IOVA 1L8TA 2HELA 4UWCA 3D0EA 4ZTHA 4XEYA 5AP4A 2C00A 2W5BA 4AOJA 5E8WA 3C4FA 3FQEA 4IE9A 1JPAA 3REPA 2QODA 3DLSA 3ZTXA 5L2WA 5D41A 4NH1A 4ZMEA 2J50A 5CU4A 2PULA 3ZLWA 3VW6A 5LWNA 4I93A 3QU0A 3VS6A 4YTIA 3IS5A 5TR6A 3UVQA 4PMTA 1KOAA 3NLBA 1R1WA 5GIPE 1OL7A 3VW8A 4ASEA 4YC3A 2Q0NA 1FPUA 2FSTX 4KUJA 4HPUE 4RQVA 5DMXA 3LQ8A 4OTQA 3QYWA 3HDMA 4EOPA 3D7TB 3DBCA 4NFNA 3AGLA 5JN2A 4Y8DA 2REIA 2PK9A 3TT0A 3TV4A 2C5OA 4EONA 2YS7A 2YW2A 3PXFA 4EK8A 5BVFA 1DV2A 5HE2A 4JBPA 2QC6A 2UZTA 4LRJA 3SRVB 3FQSA 3S1HA 2HZ4A 3GC7A 5HORA 2Q0BA 2R3KA 1DI9A 3L9PA 2CNUA 4JXFA 4O7ZA 1M2QA 3LFSA 2YFXA 4UBAA 5CLPA 4BDIA 2GNJA 4O2PA 3FSFA 4JIAA 3S3IA 4C34A 2VV9A 3QFVA 3RWPA 5A4LA 5E90A 3ODYX 2WELA 4Y73A 4DEAA 5DPVA 4U80A 1KE9A 2GQGA 2IP4A 5LMKA 2I6LA 3R7YA 3MV5A 5KZ0A 2X8IA 5CF8A 1Q8ZA 1PXIA 3Q60A 3F3TA 4K18A 4MQ2A 4M14A 4ASDA 5LVPA 1JKLA 3FHIA 4JRVA 4LOOA 4Z16A 3GXLA 4GT5A 5DI1A 4I55F 4RZWA 4FKRA 5DG5A 4AZSA 3PE1A 3HRCA 3I4BA 4O2AF 2J2IB 3E92A 4M13A 1GIJA 3OCGA 2RFSA 2PN1A 3GQLA 4BDCA 3RPRA 3TZMA 3EFWA 5L6OA 4L3PA 2YRXA 2YZAA 3NNVA 3V6SA 5T68A 4NWMA 1EHIA 5HESA 3RMFA 3ZHPC 4YO4A 1KSWA 1HCKA 3ITZA 3LCDA 4M67A 4XUFA 3L9NA 3QCQA 4TYEA 4G2FA 3R7UA 3PPZA 1LPUA 5L2SA 3EFKA 5CAPA 4I24A 5IMXA 2C6KA 3CQUA 2GPSA 3PWDA 4C4GA 2FB9A 5KMNA 1UNHA 5CNNA 3RV3A 1G3NA 1Z9XA 1H1RA 4V01A 2QF7A 5L3AA 2Z7QA 3ZH8A 4BDFA 4FZFB 3FMMA 2ITYA 5A9UA 3W33A 3LCTA 1H1WA 3NCZA 4QPSA 3NW5A 3E88A 4QTDA 4B8MA 2VRXA 4FZ7A 4ACMA 4ORKA 1YHVA 2W05A 3VS5A 2RFNA 3ETAA 5DRBA 3H9FA 3DTCA 3AT3A 3AG9A 3R04A 4B8LA 5HQ0A 3C50A 3LLAA 4RRVA 1ZYCA 3OS3A 3VS7A 1OL1A 1YDTE 3I60A 4TYJA 4D1SA 4L00A 3F5GA 3AC5A 4RJ5A 5E8SA 2R3IA 3WIKA 4GVJA 4HQ6A 4OTIA 3DQWA 3FMJA 2HZNA 4I5CA 4X2KA 3VRZA 3W2PA 3WILA 4QQTA 5IQEA 4CZTA 1Z2NX 3LXNA 3NVMB 3PZEA 3BIZA 3UC3A 3DKFA 1JNKA 2VTSA 2Y6OA 1ZYSA 3BEGA 5LXTF 3GC9A 4M0ZA 4MV8A 2BKZA 1GZKA 4O81A 5EYCA 3FPMA 3DB6A 4F6UA 4QTAA 3RI1A 1QCFA 4O2BF 3CLYA 4IAAA 4HCVA 1CKPA 2CGWA 3MY5A 5F20A 4MTAA 4AU8A 4C3FA 4EWQA 2Z04A 2OG8A 4YSJA 5ETFA 3IW6A 3SLSA 3SXSA 5EM6A 2YCSA 1MUOA 4G3GA 3SHEA 4C7TA 4G6OA 3GGFA 3I81A 1BX6A 5IQIA 3SAYA 5J1VA 2DQ7X 4GVAA 4D2RA 4FTMA 4IQ6A 3QCYA 4ZTLA 5IUIA 2UW6A 1LR4A 4NKSA 4HVIA 3W2QA 2XNBA 5AAGA 3E5AA 4XBRA 3SD0A 2XIRA 4CKIA 3UNZA 4QYFA 5B0XA 4CKJA 1SCUB 5AP1A 3SVVA 4RMZA 3RCJA 5E8UA 2VPQA 4S2ZA 2CLQA 3TTJA 4AS0A 3KVWA 4IDVA 4MD7E 2Y9QA 4F65A 4OTRA 3KC3A 5CSXA 3QZGA 2R3QA 4EC8A 2XCLA 3MH0A 4JAJA 3NNWA 2JIVA 3KRWA 1ZMWA 5DWRA 1HOWA 3CS9A 5AP2A 3WZEA 4BI2A 4FEUA 4D4VA 2X9EA 4F1OA 4M69B 4FG8A 4UYAA 5CXHA 1BNCA 3H10A 4O0RA 4AZTA 2B9HA 4TRLA 4D1XA 4GFOA 4E4NA 3HA8A 3TUBA 2CGVA 4FFPA 3QCXA 3W10A 1WVWA 4O7LA 4AA4A 4AX8A 4PNKA 4J53A 2A1AB 1RW8A 3V4SA 4QP9A 4XX0B 1F5QA 3PJ8A 3ZS5A 1WBNA 4U5JA 3OXZA 3PJ3A 4FIHA 5AV0A 2GNIA 3FLSA 3MVMA 4RT7A 4DEIA 2ZOQA 3Q9YA 5AIKA 4RX7A 4ANQA 1JWHA 2IVVA 5F4NA 2XK3A 3ORIA 3R8ZA 4XX9A 1KE5A 2YA9A 4DBXA 3ZRLA 4AAAA 3EN4A 2WFYA 4ZEGA 5AP0A 4G16A 4D4SA 2JFMA 3R8MA 4ERKA 4RA5A 4WA9A 4XH6A 3ID6C 3R23A 2W1FA 1JVPP 2YIQA 2I0VA 2PZPA 1SNUA 2J0MB 3FLQA 4IB3A 2XJ0A 2YABA 2ZB1A 2VTPA 4O96A 1J7UA 4Y85A 3COHA 4L7SA 2YACA 4DH7A 2QOLA 3WF8A 5IA2A 3C13A 3Q2JA 5A6OA 4UB7A 1JKTA 2XJ1A 4P4CA 2UV2A 5HD7A 1U46A 2A19B 4JOAA 3WYXA 4UWYA 5BVEA 2C6LA 2UZNA 3RAWA 5IPJA 3OD6X 3POZA 3TV6A 1WVYA 4K11A 4XV3A 4O7SA 4GSBA 2R3LA 3DLZA 4RC4A 3OWPA 3BYMA 3G51A 1BUHA 5JH7F 5IISA 2FSOX 3WARA 3PA3A 2IWIA 3MGYA 2BZIB 2R64A 4XYLB 4KBAA 5KMKA 1YXUA 1GLVA 3WNZA 3PP0A 5T6KA 5B2KA 3PIXA 1AUXA 3LP8A 1OZ1A 4FIGA 4ME6A 4QP1A 4U43A 4TL0A 1DV1A 2QOFA 3NUUA 5DEYA 5L8JA 3ZCLA 2BRNA 1FGKA 4ZTRA 1KJ8A 1GGOA 2VO6A 3G5DA 3UYTA 4X2NA 2YS6A 3HMMA 3NEWA 3ZC5A 3RM7A 4FSRA 4MHAA 2VX0A 5IUGA 5CY3A 4AN2A 1H00A 4DG0E 2W1GA 2W1DA 4TYHA 4JL9A 3MY0A 3UVPA 3RM6A 4X3FB 3SG8A 4N6ZA 2YDKA 3K3JA 3LPBA 4O82A 4UZHA 4Y46A 4L46A 5CAOA 3ZLXA 4MV9A 5HNGA 4MV1A 3RV4A 3N4UA 2XH5A 3QRIA 3BG5A 5D10A 2YHVA 3RHXA 4NCTC 4FIEA 1ZAOA 2F7XE 3RTPA 4J96A 3PXKA 1H0VA 1GZ8A 5I9WA 1OKVA 2A27A 3Q52A 3TKIA 4ZAUA 2R0IA 3HECA 3ZSIA 3CY2A 2W1IA 4QYHA 5E7RA 3UC4A 1ZXEA 5CF4A 2BRMA 4ALVA 3KRRA 3MWUA 4M15A 3KRXA 4FNXA 5DEWA 5BPYA 1P4OA 1YXVA 2OJJA 5AUZA 3IK3A 5M44A 1Z2PX 1YWRA 3AW8A 5KMLA 3JZFA 3POOA 3EQHA 3I6WA 3VMMA 4FTLA 4Z9LA 4I0TA 4CRLA 4IAZA 4XG8A 5C4KA 4ZY6A 4DCAA 3F61A 1RDQE 4QRCA 1WR2A 1H26A 2O65A 4R7HA 2YZMA 5ETCA 4RIXB 1PXKA 5AFVA 3SGCA 4F63A 3ORLA 4F9YA 4IZYA 4FKVA 5B2MA 5CAVA 5D11A 4PTCA 4QYYA 2PVRA 3OT3A 2ITWA 2YM3A 3AMBA 4YNOA 3JY9A 3KB7A 5EDRA 4L68A 4HGEA 2CHLA 4B99A 2J5EA 2XD4A 3DXPA 4IDTA 1YOMA 2E9OA 2BRBA 2OIQA 2Y4IC 2Z7LA 4WHZA 4DGMA 4CVAA 4LM5A 2B0QA 4DINA 5CS6A 5L6WL 5A4EA 3C9WA 3GT8A 1UU7A 4ZJVA 4RLKA 4D0XA 4IMYA 3MWEA 3GCQA 1GIIA 3TZ8A 5AP6A 3Q2OA 3ZEWA 2UW4A 2ZDHA 5IDPA 4OBPA 1PXMA 3D7ZA 1OIQA 4C2WA 5JSMA 2CKQA 5E9EA 3L9MA 1KV1A 3B8QA 3DK3A 3NCGA 1KOBA 2EVAA 2ZAZA 3ZYAA 4X3FC 2XKEA 5M08A 3LVPA 3OVVA 3DJ7A 3DK7A 3WZKA 4DYMA 2IZSA 3CTHA 3MWDA 2NNWB 3KK8A 3SRVA 3LFDA 2V7OA 1FGIA 4F09A 3A7IA 3NMUF 5KE0A 1M2PA 3FL4A 2W6OA 2W96B 4NTSA 2GFSA 5CAUA 3O71A 4USDA 4DHFA 3MPTA 5E1EA 3DFAA 3OTVA 3C51A 3TNHA 3UTOA 4ZXTA 5DIAA 2DUVA 3VWAA 3MTFA 4MV3A 4BBMA 3FMHA 3N4TA 4L52A 2PUNA 2YJRA 2QHNA 5ANGA 2FH9A 2PWLA 3GU6A 2GSFA 3ZFMA 4F1TA 4QMTA 3NYXA 2NU9B 4O84A 4FKSA 2QR7A 2QU5A 5HO8A 1JBPE 5EM5A 5LARA 3QALE 3QF9A 2OJ9A 4IIJF 2JIUA 2ZM4A 4XG9A 3E87A 4MEDA 4M7IA 2WMUA 5C03A 4TY1A 4EORA 2YEXA 3F82A 4UEUA 3CTQA 5C1QB 2VTRA 3EN6A 5B2LA 2W1HA 2Y6MA 3JPVA 4F70A 1QMZA 3EN5A 3AC2A 3MFTA 1E4EB 3A7FA 2E2BA 4FVQA 4L01A 4YLLA 3F2RA 4EKKA 4ZSAA 4DN5A 4O7NA 5CWZA 4RFMA 4PP7A 3UPZA 3DS6A 3FL5A 3BQCA 3GOKA 2QLUA 5GNKA 4CGAA 4DEGA 5HG9A 4AE6A 5IEVA 2J51A 4E6CA 3NWWA 3A7HA 4PDOA 3SX9A 2BDJA 4FYNA 3W2SA 2P55A 2WQMA 3R1YA 2DLNA 2QURA 1IA9A 2XK4A 5EI6A 4ZY4A 1J7LA 5M07A 2HENA 1XH7A 2WEVA 4WO5A 4RIYB 5JGBA 2QOOA 3HBLA 1QPEA 2PVMA 1K2PA 4RWJA 4MF1A 4ALUA 5IA3A 4PDPA 3NUAA 3GC8A 4TXCA 3TNIA 4BCNA 2UZVA 3PY0A 4FTRA 1GZNA 5FBOA 1ZZLA 4NKAA 1FMKA 2NU7B 5I0BA 3RFCA 2VWBA 3ZOSA 3DBEA 4FT9A 4LOQA 1QPJA 4ZZNA 1M52A 4E1ZA 4LRMA 3MA3A 2VTHA 3IONA 4TPTA 5EQYA 4I5MA 4IIRA 4MXXA 2QD9A 3ZM4A 5H3QA 4QQJA 2OBJA 3VBVA 3ULIA 3EH9A 3R6XA 1OM1A 4HR7A 1XH5A 3FWQA 4BCPA 4GH2A 3DBFA 4AT3A 3TIZA 3F3VA 5JKGA 4U9AA 1Q5KA 3COIA 1A9UA 1ZMVA 2DS1A 3AGMA 3CGFA 2QR8A 4GV1A 1NY3A 1U5QA 5AM7A 4ZSLA 4G1WA 3WOWA 5IQGA 4AW2A 1O6KA 3DZOA 4K0YA 2YIXA 3WZJA 3QUDA 4Y95A 1OPJA 4IVCA 3D4QA 4F1MA 5LOVF 3QWJA 4FK6A 4X2JA 5HIDA 3G6GA 4X21A 4Q5HA 3LHJA 1IAHA 2GHGA 3W8QA 2I0EA 2P3GX 3ORNA 1J91A 3TUCA 1ZWSA 4A06A 4Z7GA 2CN8A 4G31A 3C5IA 3MJ1A 3OHTA 5HIBA 4ANMA 2YM8A 4AA0A 4XV2A 2E9NA 3R9NA 2QK4A 4X6QC 5BNJA 5M4CA 4CFWA 5AV4A 4EH4A 2YDIA 5FTQA 1L3RE 1FINA 3VUMA 4BKJA 1JKJB 5KX5F 1YXTA 2HW7A 1SVGA 2C0IA 3JR1A 4MCVA 4U40A 5CAQA 5JQGF 4AFEA 3ORPA 4OTFA 2RG5A 2UZUE 4K33A 2X6DA 4F0FA 2XNPA 5EYKA 3T8OA 3TN8A 4ARKA 4YBJA 5EK7A 5JQWA 2JDOA 4FTOA 4TN6A 5D9HA 3CXWA 5CTPA 1G8AA 4RJ8A 5HE3A 4FV5A 2GPHA 3ZFXA 5K9IA 2ZMCA 4DBNA 2VAGA 4WG5A 3GCPA 2Z8CA 3OXTA 4XLIA 4GJ3A 3DQXA 5HG8A 4TNDA 3S95A 4QMWA 4J8MA 1VYZA 4FR4A 3I5ZA 4AT4A 4E8AA 3RALA 4EK3A 5J9ZA 5L8LA 2JC6A 3R2YA 4H05A 3VJNA 4EQMA 1PYXA 2B9FA 5CALA 3LXKA 2YZGA 4BDDA 2XK6A 4X2FA 3BHTA 1YWNA 3BLHA 3V8SA 4C5CA 1Q8YA 2FSMX 3FE3A 2XKFA 4XMOA 3RCDA 4DEDA 5E92A 4QP6A 2JEDA 1E9HA 4KRDA 2O64A 4MD9E 1KJQA 1ZYJA 5ANKA 5EI2A 5FM2A 3RZBA 1I44A 4J95A 4O4HF 2R3PA 4BGQA 4AOIA 2R3HA 1U54B 2C4GA 4B6LA 5DYJA 4QQCA 1S9JA 4HNVA 4QNYA 2W4JA 3BCEA 4I3ZA 1U59A 4O0VA 3UG2A 3LFBA 2WTCA 2WTWA 3QX2A 4RPVA 4YO6A 4ZIMA 5HZNA 4O0XA 1SYKA 4UALA 3UODA 4M0YA 2C5XA 2PZRA 3F5XA 4NUSA 4HW7A 1OBGA 1M7NA 5HI2A 5LJJA 1OMWA 2E9PA 4FX3A 5TO8A 5AM6A 5M06A 4Q9SA 4O86A 3ZONA 4U0IA 3ALOA 4IW0A 4ZJJA 2GLTA 3RVGA 3LJ1A 3OBGA 4C61A 4OTHA 1Q41A 1CMKE 3BHYA 4DCEA 4YTCA 1XO2B 2Z02A 1O9UA 5DR2A 4ZSGA 2J6MA 3I0QA 3A4PA 3FMDA 1B6RA 2R3FA 3OEZA 4X0MA 3HA6A 3HP2A 4EWHA 3QTSA 3TKHA 4FFMA 4AFJA 1H08A 2CKPA 2WGJA 2PMNX 4G5PA 4E4LA 3TJCA 3QTXA 1YOJA 3ZUUA 3Q2MA 4C37A 3VVHA 5IQHA 4DFYA 1OL5A 4CNHA 2R7BA 4IB5A 5F9EA 3O7LB 3TIGA 4GUBA 3PA4A 2WXVA 2E9VA 4GYIA 3LM5A 2R7NA 2W0JA 4YZDA 2OZAA 3VA7A 1VZOA 5EFQA 3PYYA 4LYNA 1ND4A 3GCVA 4DEEA 3F5UA 4JQEA 4E7WA 2A0CX 5EYDA 5L2TA 5H8BA 3ZEPA 3CD3A 2XK7A 5EQPA 2VGPA 4IM0A 3ZBFA 2CPKE 4R7IA 3QBNA 4XS2A 4DH3A 5CEMA 3OZ6A 4CMUA 1JKKA 4NFMA 2B7AA 4U97A 3TACA 3ZFYA 4AGUA 3JVRA 3OW3A 3R7EA 3QLFA 2R86A 3QQLA 3NUYA 1CSNA 4YJ2F 2QCSA 3KRJA 3HV6A 4I92A 4HVHA 2B9IA 4RZQA 2R85A 3HRFA 5AX9A 4EOMA 4GKHA 4UX9A 4BBEA 4FV9A 1WVXA 4BTKA 3PDTA 2BDFA 2IG7A 1MP8A 5KO1A 2IJMA 3DT1A 1V0BA 3HEGA 3IOPA 3Q5ZA 2IW9A 3K5UA 1JKSA 2VTJA 2C6TA 2OXYA 5LXMA 3DZQA 3OFMA 2PVLA 3R30A 4CXAA 3COMA 3EQRA 3F88A 4FKLA 4F7SA 5CU0A 2ZV9A 4O0WA 2H8HA 4TWPA 3NW6A 5FBNC 4MNEB 2GNLA 4EQUA 2Y7JA 1EH4A 3DJ6A 3HRBA 2ITOA 3CKWA 4WNKA 3SDJA 3MB7A 4I23A 4JX3A 4C38A 3FV8A 5KKRC 5M4FA 3PE2A 2R2PA 4OTWA 4JR3A 2QLQA 4TV9F 4PP9A 4BDAA 5I9UA 2PMLX 4W4YA 4F6WA 3ZXZA 1WBTA 3TQTA 3NUPA 3PRFA 3VUGA 2B53A 1YI6A 4B7TA 2XNOA 3HNGA 1GSOA 3QKLA 4PMSA 5EOBA 1OUKA 1XH4A 3RKBA 4A07A 5M4UA 3I7CA 3PVUA 4WBOA 5JFVA 2PZYA 3HYHA 4L6QA 3OOMA 4I1ZA 4WKQA 3MPMA 4FT0A 2QHMA 5AUVA 2X1NA 3HV4A 4QMOA 2BHHA 2GFCA 3IW4A 5F1ZA 3S00A 4ACHA 3VS4A 4C4EA 2UVYA 3EJ1A 3FY2A 5HVYA 4DF3A 2P2HA 2YN8A 4QMSA 3RPVA 3ULZA 3VUDA 4F9WA 3PVBA 1X8BA 3B2TA 3LMHA 5CQWA 4ZI7F 4O0UA 1FOTA 2F7EE 5CENA 3KAKA 1WZYA 3CKXA 4I6QA 2O5KA 3FXWA 4H1JA 5GHVA 2IO6A 4XG2A 4B0GA 3R1NA 2WIHA 3WE4A 2R3MA 5GJGA 2B52A 3ZXTA 3OWJA 1WAKA 2AC5A 3HUCA 4C36A 5DVRA 2VU3A 2ONLC 3E3PA 3FMNA 5BMVF 2JDRA 3JRXA 5H80A 5J1WA 4PDSA 2JFLA 3CC6A 3FAAA 4TTHB 4F7NA 5HV6A 3MA6A 2PZIA 2G15A 3MVLA 3ZSHA 2VR1A 3EZRA 5JT2A 3F66A 1Q8TA 4RGJA 3PIYA 3KXZA 4E6DA 4XRLA 2ZMDA 1J1BA 2QONA 3EYHA 2ZM3A 5ACKA 4OBOA 3LQ5A 4EZ7A 5I9YA 2CZGA 3N8DA 3FYJX 4XG4A 3LMGA 4IB1A 2UZOA 4IAFA 4WUNA 4BI1A 1NW1A 1UWJA 1H0WA 1MRVA 2OW3A 3GEQA 3C1XA 3JXWA 2RGPA 4U3YA 4IZ5A 2YIYA 4S33A 1EUDB 5D8DA 4DFLA 4PV0A 5JZNA 3VRYA 4QYGA 4FICA 3RK7A 4FSYA 4JG7A 3Q9XA 4YJRA 2F2UA 4ITJA 4FKPA 4FUXA 5IEYA 3HB9A 4C2VA 1JLUE 3UVRA 3HP5A 1FQ1B 4NIFB 1URCA 1ERKA 2H6DA 3D5WA 4FGBA 4FT3A 1CTPE 3NAXA 4GT3A 4U41A 4FTCA 4Y8VB 2OH4A 4C02A 2ETRA 1E1VA 4LUDA 5JH6A 4HNFA 3E5NA 3KN6A 2WQBA 3CJFA 3HVCA 4B9DA 5EW9A 3UIBA 1DM2A 3CQWA 3G9LX 4J97A 4EZ5A 5CEKA 2FA2A 1H1QA 4FC0A 4FKUA 1E1XA 3ATTA 3R0TA 4FFOA 3NYOA 3EL7A 2C69A 3LWBA 4FTNA 5I9XA 4MNFA 3DAKA 3G90X 3TNQB 3UG1A 2C5YA 3R28A 3GU5A 2WQEA 4ZTQA 5AV1A 5BPFA 2XYNA 4K8AA 2OIDA 2QO9A 3FSKA 4DGLC 3LCKA 1A9XA 4EHZA 1ZY4A 2EWAA 2VWYA 3E93A 3NYNA 1F0QA 2B4SB 2FGIA 2GNHA 2ZYBA 3R71A 5AP7A 4UXQA 5EM8A 5IA5A 3K2LA 3N51A 4LFIA 4P90A 2YL2A 2VWWA 3AC4A 4TNBA 3L1SA 4I6BA 1DI8A 3LW0A 1Q61A 3D9VA 2BZJA 2CSNA 4JQ8A 4HYSA 4CSVA 2WZJA 2XEZA 2JITA 2XJ2A 4DGOA 4HCUA 3PXYA 2X2LA 3GOPA 2PYWA 4HYUA 4YZBA 5HBHA 3VJOA 4L3JA 3S2PA 3NGAA 2EB2A 3RPOA 3U4UA 3ENHA 3ZDUA 4D0WA 2ETMA 2ZDGA 2YCQA 5HBRB 3UOHA 4XHKB 2QOBA 3DDPA 2JGZA 4QMVA 5C8KA 4ZHQF 4PL4A 3V3VA 2J0KA 5LYJF 2XS0A 3DGKA 4C62A 4E4XA 3P86A 1T36A 3PSBA 4O7TA 3DB8A 2PU8A 4TW9A 4YBZB 3A2CA 3VQUA 2CKEA 4D1ZA 4FZ6A 4NU1A 3CSVA 4C35A 3I6UA 3BWFA 3PLAE 4ITIA 3TNPC 2WMQA 3KULA 3A8WA 5CVGA 3KXMA 5HLNA 5CEQA 2C0TA 4AGDA 5B7VA 5CT7A 4L44A 2R3OA 2KTYA 4CFVA 5KX8A 4M84A 3QTWA 4IJ9A 4MXYA 3LIJA 4O0YA 5AUXA 2ZDQA 3P4KA 5KKNB 4ZP5A 3UOLA 1CQIB 1EYZA 1UU3A 4J99A 4XCUA 1APME 2OF4A 5K3YA 5BQ0A 4FEQA 3CIKA 2P33A 4LMUA 4EH7A 3N6RA 3LCSA 3P79A 3WO0A 1NVSA 3R5XA 3JVSA 1U4DA 3BBTB 3I0OA 3ZLYA 3RINA 3TXOA 4BDHA 3V5PA 3OF0A 3ACJA 5EHLA 1GAGA 1T46A 3R1SA 3Q04A 2WMAA 2XIKA 4RG0A 4ZS0A 2OKRA 1M17A 2VQDA 3DOGA 5FUTA 3EQFA 3PSCA 3E8EA 3F2AA 4M8TA 1YHSA 5LMAA 3I12A 3S4QA 3VBXA 5HICA 5TOZA 2C3JA 3DXQA 3WO1A 3PVGA 3DAJA 1V1KA 1MQBA 3F5PA 4HVGA 4FV0A 4XOZA 4IB0A 2PVPA 5E8XA 4YTFA 2UUEA 3F3ZA 2PZ5A 2G9XA 3PG3A 4RVTA 3HO8A 3JS2A 5HD4A 2RFEA 1H1SA 2PTKA 4FV1A 4J52A 4IWOA 3RJCA 4XV1A 1RJBA 3ZRKA 3GLKA 1UV5A 3ORZA 5E8TA 2C0OA 2XBJA 5A46A 3U8WA 1K3AA 3GFWA 4EI4A 4M9UA 2CNQA 2XA4A 3S0OA 2Z7RA 2H9VA 4FL2A 4D9UA 2PVKA 3FMLA 2HOGA 3G8DA 4O21A 3BELA 2B55A 4NJ3A 3BPRA 4D9TA 3CJGA 2XIZA 2W99B 1GOLA 4FSMA 4FSUA 5L2IA 3R00A 2R87A 3HMPA 3OBJA 4DA5A 5LCJA 1YI3A 5DOSA 2DYLA 4XG3A 1Z5MA 4HJOA 3DBDA 2BAQA 4NM3A 3QGWA 4O7RA 3KMWA 4IACA 4JR7A 1IA8A 5AX3A 3RPSA 4DTBA 2ZDUA 1AQ1A 2RL5A 4Y5HA 5CVFA 4P5QA 4IX6A 3VF8A 4EKLA 3P7BA 3WF9A 1VBHA 5IQCA 5JFWA 1KUTA 2YISA 4LG4A 3F69A 3ODZX 4XRJA 3U55A 4WUAA 1IOWA 3TG1A 4RJ6A 2FUMA 2GHLA 5I9VA 2WAJA 2BUJA 4CT2A 3T9IA 3AT4A 3QRTA 4DLJA 5HO7A 1SVHA 3P7AA 3VUIA 4DT8A 3JRWA 1Q4LA 3ORKA 2ZVAA 3IGOA 4R1VA 3D2IA 1J1CA 3GC0A 4L45A 2JDVA 4IX4A 4DEBA 3C4EA 1XQZA 4BN1A 1PJKA 5CAEB 4AP7A 3ZU7A 3KGAA 3U6JA 3DJ5A 1V0OA 1XWSA 2E9UA 4LOPA 4WIHA 3D94A 1Q62A 1ZOHA 4XP0A 4C5AA 1YI4A 3TEIA 3K54A 4OW8A 1BI8A 2WMXA 3PA5A 4MVFA 5JFXA 1OPLA 3QXPA 4FSTA 4ZJIA 4CQEA 4EHGA 3GBZA 4BY9E 5DR6A 2HZIA 3M2WA 2Y4IB 2HYYA 2W6NA 3UFXB 1VYWA 5HX6A 2B54A 3ZMMA 5IH4A 4ZZMA 1XBAA 3EKKA 3OG7A 4QT1A 4UXLA 4YSMA 3UMWA 1KE6A 3QQKA 5KNJA 3HAVA 2C6IA 4GU6A 3UZRA 4EC9A 4N4SA 2OZOA 4IVBA 4FFRA 5EQEA 3O7LD 3V5TA 5IA4A 4DITA 4ENYA 2VTNA 5EZYF 1Y8YA 2OSCA 3CGOA 4I0SA 4YLJA 4ONAA 3SC1A 3CTJA 4JG8A 4LL0A 5IG1A 4IH8A 2XNNA 4MH7A 5FXSA 4ANLA 5TF9A 1B6CB 3Q96A 4O4IF 4FNYA 3DY7A 3QRJA 4V0GB 4BCOA 5HEZA 3SV0A 3KF4A 4EK4A 2WU6A 4LRKA 5CEOA 4ZLZA 2P4IA 4W4VA 2G2HA 3II5A 4O38A 5AEPA 5D1JA 4ASXA 4JDIA 3CE3A 3F7ZA 4FUYA 2NO3A 2UVXA 2UW0A 4IAKA 5G1XA 3IOKA 1IAJA 4R5SA 5CSWA 5AWMA 4FSZA 3FMKA 5IA0A 2VTAA 3G6HA 4DC2A 4FV4A 4I21A 3PSDA 2PUIA 1A06A 5BYLA 4Q5EA 4DEHA 2HWPA 4XLVA 5H9BA 4FKOA 3BYVA 2IN6A 1YXXA 3QZFA 1WCCA 2C6EA 4BIBA 3CCNA 4MYGA 5LMBA 4AZWA 3C4WA 2DWBA 4PNIA 2I87A 5TT7A 4FNZA 5CSHA 3VOTA 1YVJA 4DG2E 2BDWA 3EYGA 4FTKA 4TYGA 3VUKA 4V05A 4G34A 4CTCA 2UW5A 2DWCA 1PHKA 2R7IA 3FC2A 3F9NA 1YW2A 4JX7A 2H34A 3CQEA 2PMOX 4PMPA 2OJFE 4IWDA 4QMNA 4BCQA 3UDBA 2BTRA 4CFXA 4CG8A 3R8PA 2XIXA 1KE7A 2ITVA 1TVOA 3MSSA 3MB6A 5FLFA 3BE9A 5ANOA 4AA5A 3DKOA 4EUTA 3FC1X 2C6OA 4GYGA 4HZSA 4IANA 4NTTA 4O7VA 4EH9A 3MY1A 4YJTA 1JSUA 4DIMA 3MH2A 4NM5A 1XH8A 2VWIA 3NUXA 4YBKA 3TL8A 3V5LA 3RHKA 3D7TA 4AACA 1B39A 3MESA 3OC1A 3QCSA 2FB8A 3NVKI 4X6RA 2R3GA 2GTNA 4PL3A 1UU8A 4RWKA 2R82A 3UP2A 2QG5A 4MV7A 2IVUA 2ZV2A 2VD5A 3FKOA 5HGIA 4FGRA 4CLIA 4L3LA 3NUSA 1Q8WA 2YM5A 2ERKA 5BUIA 3QWKA 2VZ6A 4DGNA 3VULA 1T45A 5DLSA 2XVDA 1TQMA 4MXCA 1OECA 4PX6A 1CKJA 5CU6A 2AC3A 4G6LA 5FQDC 1W84A 3Q4UA 2VTMA 3VBTA 2PVJA 4R7BA 2FO0A 4I4EA 3LMIA 1B6SA 4IC8A 4YJSA 1A48A 5CANA 4R3CA 2WMVA 2OK1A 2KULA 2UW7A 4NSTA 4TYIA 3TNWA 2X39A 4CCBA 4YJPA 3LKMA 2W70A 5GJDA 5J2TF 5FDPA 1YHWA 2UW8A 3ET7A 3TIIA 2XRUA 3HV3A 4AW1A 3HV5A 5M56A 2ZV8A 1G5SA 3IW7A 4YP8A 5HX8A 1P5EA 2J0IA 3DK6A 4DH8A 2NU8B 3QZHA 2HJWA 3O8TA 3WZUA 2PE0A 2WU7A 2PSQA 4FL3A 4LV8A 4WSYA 4Y5QA 1LEWA 4JDJA 5CZHA 2V22A 5BVNA 4OT6A 2YRWA 5DT0A 5JQ5A 4DT9A 2PBZA 4MA0A 3E7VA 2NP8A 3KA0A 1STCE 3UNJA 4EYJA 4HVSA 1M0WA 1H27A 1XR1A 1BL7A 2FVDA 1UNLA 5DR9A 1SVEA 4A4LA 4F64A 4YJOA 3AOXA 4Z55A 4EHEA 2W1EA 4BVUA 2NRUA 1M6VA 5A4CA 4XYMB 2PVNA 4FODA 2BFYA 5IDNA 3H9OA 3OCSA 3KXXA 4O0SA 5JGAA 2WTVA 4FTTA 2XIYA 2YJSA 3EQIA 3SKCA 5IF1A 4FG7A 3BWJA 3OXIA 4J7BA 1JLLB 1WBSA 3R7VA 4J8NA 1PMUA 3Q6UA 2HW6A 5KHXA 3PXRA 4FTQA 5HCZA 3HLLA 2HIWA 5D12A 3FI2A 5A6NA 4C5BA 4FYOA 3R7IA 1W7HA 3OEFX 3G0FA 4KB8A 3NZ0A 2V62A 4LMNA 2VWVA 4YU2A 4R77A 5L8KA 3ZM9A 4XNEA 4U6RA 5J7HA 2X2MA 3TM0A 3EFJA 2WMTA 1YWVA 5DFPA 3NNXA 5JRQA 3D15A 1YOLA 3NNUA 3NYVA 4TWCA 4USEA 1CQJB 1ZYDA 4AF3A 2PVFA 2GHMA 2WIPA 3FKLA 2ZB0A
chains in the Genus database with same CATH superfamily
4RC2A 4E93A 1OL2A 4G3EA 5KMIA 3L8VA 3EN9A 2UZDA 3FQHA 3VHKA 5I5YA 2C3KA 4G6NA 4EYMA 3PY3A 2BFXA 2G2IA 3UMXA 3UO6A 4ENXA 3QWUA 4QMXA 5GINE 2UZLA 1PK8A 5M4IA 2YDJA 2PVHA 4YJQA 5LCKA 5HBEA 3BHUA 4CFMA 2X4ZA 3NR9A 4ANBA 4DFUA 3SGIA 4O4JF 4F7LA 3E63A 4MAOA 1NVRA 4YZCA 1H8FA 5AV3A 3W0SA 5LP6F 4K77A 5JQ8A 2X2KA 3H0YA 2IPXA 5FP6A 2W4KA 3NRMA 3H3CA 2XCHA 3R9RA 4A9RA 2BAJA 2W7XA 3WE8A 5ANDA 2R5TA 5JZJA 4W4XA 2GS7A 1YKRA 3NUNA 2VWZA 4LH6A 4E4TA 3GI3A 2BZKB 3U9TA 3KK9A 3QL8A 3WI6A 5CM0A 5BPHA 1KWPA 3I79A 5I9ZA 3QUEA 4FEWA 2COJA 2YAKA 1W96A 3C0GA 4PF4A 1KBLA 4X2GA 4YC8A 4BCIA 1YXSA 4MXZA 4QNAA 3T99A 1EKFA 3ZDIA 2XALA 3BBWA 3DKCA 4W4WA 1YRPA 2G1TA 4MBJA 5IZFA 4L7FA 2X7FA 3KU2A 4ZMFA 1B04A 4RIOA 3A62A 3F2NA 1GSAA 1H28A 1OVEA 3KMMA 5AP5A 2GS6A 4EZ3A 5AUWA 3OCTA 3E8DA 2WTIA 4H3BA 4FEXA 4G17A 3R8UA 5LMKC 1IRKA 2HK5A 3L9LA 1XBCA 4Z3VA 3OP5A 4O22A 4I94A 5K5NA 1R0EA 5AA9A 3GB2A 3V51A 5HVJA 1PY5A 5T3QA 4JQ7A 3U51A 5LVOA 3QRUA 2F2CB 4XJ0A 3MVJA 4IZ7A 3PY1A 5FEDA 4LGGA 5E8YA 3UOJA 1OI9A 4GU9A 5EOLA 1A0IA 1PXJA 3WWIA 2VWXA 4GT4A 3UYSA 4O83A 1YDSE 3AMAA 4AQCA 4WNPA 4O4LF 2X0GA 4RLLA 3T3VA 4I22A 4AZEA 4U7ZA 2JKQA 4YPDA 4GK4A 4RBLA 3N4VA 1I7LA 4KS8A 4NCTA 1H01A 1W98A 2YAAA 3E64A 4FNWA 3U9NA 4G9CA 1UKIA 1JSTA 3FZOA 3OROA 3FLZA 4IM3A 4PTGA 4H3QA 4U44A 4YC6A 4QP2A 4IX5A 5C4LA 4RZVA 2C6DA 2ODTX 1F3MC 2VTTA 3A7GA 4HOKA 4QO9A 4S32A 3FLWA 2QG7A 5EH0A 3QD2B 4KKEA 4IVDA 5HTBA 3LULA 3EL8A 1NXKA 3LLTA 4YGAA 2XK9A 2XKCA 2IZUA 3R9OA 2EXMA 2WTDA 3KAJA 3BRBA 4RX8A 3SXRA 3W0MA 4CMOA 4Z7HA 4AZFA 3F3WA 1CM8A 3ZBXA 4BB4A 1Z57A 3SG9A 4CKRA 4MAMA 4M12A 2GNGA 2EU9A 1U5RA 3VO3A 5KKRB 2XM9A 3KCKA 2QVSE 2QU6A 3H4JA 4OBQA 3THBA 3RNIA 3M1SA 3DA6A 2VX3A 4O6EA 5IMEA 4KIOA 2YZLA 4N70A 3ZLSA 3G8CA 3UDZA 4BGGA 2GCDA 2W4OA 5IU2A 2W5AA 2JD5A 3D83A 3LXPA 4E26A 4FE2A 3R5FA 5E8VA 5LQFA 3K5IA 2GMXA 4RVMA 4KA3A 3VBQA 2V58A 2WTKB 4FKGA 2OLSA 3LJ0A 4CEGA 4L43A 4YAJB 1NT2A 4D4RA 1C3OA 2JAVA 3BYUA 2HWOA 2XMYA 3QD0A 5D1PA 4I6FA 4IX3A 4L8MA 1WBWA 1GIHA 4WD5A 3OW4A 3U9CA 5HIEA 2GDOA 5DNRA 2X7GA 3UZOA 1PXLA 2GS2A 4A9YA 4PWNA 1FMOE 4BBFA 2LGCA 4FKIA 4X3FA 4BDBA 4KKHA 2YIWA 4GLXA 2V55A 4RC3A 4CG9A 1KC7A 5CU2A 1HCLA 5KBRA 5M09A 3VPBA 2OWBA 4YR8A 3AC8A 3EQPA 4RWLA 4YAKB 4F0GA 1BKXA 4BICA 1REKA 2NRYA 3UPXA 4JAIA 2V5AA 3AC3A 3M42A 4YTHA 3MIAA 3UO4A 4BYJA 5FD2A 4TWOA 5FEQA 2UW9A 4PMMA 4PQNA 2QNJA 3FLYA 3V5QA 5JVDF 4AW5A 3TZ7A 4QP7A 5ICPA 3ATSA 4NZMA 5I5XA 3KREA 3R21A 4F4PA 1O6YA 2WMRA 4I20A 4R3PA 1KT8A 4EGQA 3AD6A 4HCTA 5JGDA 3R02A 5FTGA 4EEQA 4QMYA 3DAEA 4AG8A 2XZSA 4XBUA 2XUUA 1PMEA 4BZNA 2CGXA 3MIYA 4IVAA 4YLKA 3O96A 3ORTA 3FZ1A 2VGOA 5CA0F 4ZS4A 2OGVA 4H3PA 4IZAA 3PJ2A 5BVWA 4RIXA 1ULZA 1W93A 3N9XA 3ETJA 3GP0A 3TDWA 5BVOA 3FHRA 3Q53A 3VBWA 3QZIA 4DLKA 3HT5A 5DBXA 3RAKA 3EFLA 3O17A 4TYHB 4YHFA 2ITPA 5CSVA 3U87A 1GSHA 4K6ZA 3SE7A 1MQ4A 1WBVA 3QTUA 3V5JA 4DFZE 4ACDA 3O8UA 3V01A 3MPAA 3LFQA 3ZO1A 4IBMA 1GNGA 2ZDTA 3W0OA 1K9AA 4BDEA 2WTKC 3IQ7A 3FLNC 4AT5A 5EI8A 4DG3E 4EOJA 3F3UA 4EOLA 2WOTA 3Q5IA 4EJNA 5FR9A 2PVYA 3R73A 4O7YA 1WMKA 3G33A 5I5ZA 3FPQA 4H36A 2Q2UA 5IH5A 4CLJA 2WPAA 4IJPA 5CT0A 4KNBA 5IQFA 4UN0C 2VNWA 4FKTA 4MWIA 4WG3A 3MH1A 4AXDA 3UIUA 3B8RA 1UU9A 3QTIA 2F4JA 3LM0A 4LL5A 3CPBA 4JMQA 4C4JA 2W6ZA 2O2UA 2UW3A 2X9FA 3BL7A 3QQGA 3QUPA 4KABA 4YUQA 5FRIA 5KMOA 4QPAA 2UZBA 3EQGA 2GPWA 3R2BA 2W5HA 4UZDA 4WG4A 4FK3A 4F9CA 3BLQA 1XBBA 3PG1A 4FIIA 3NIZA 5HE0A 5GIOE 4ACCA 2EIYA 2BAKA 3VONA 3G2FA 3DNEA 3KFAA 4EL9A 5DHJA 4QDVA 3U4WA 4TUYF 2WEIA 4C3RA 4N6YA 2YZNA 3PJ1A 4WHXA 4NM0A 2F49A 2PY3A 3AC1A 3DU8A 3NPCA 3NW7A 3O51A 4BCJA 4FU0A 5ETAA 2W1ZA 4CTBA 1SNXA 2VO7A 3BGQA 1QPCA 4EH2A 5HTCA 3DTWA 4W8EA 3D5UA 4XZ3B 4LQMA 4F9BA 1VJYA 3DF7A 3P9JA 3R22A 4MBLA 2COGA 2BTSA 4JLCA 1E4EA 2CKOA 2BIYA 2YERA 5E1SA 3C4XA 3KRLA 4O27B 2YYAA 1W0XC 2QKRA 3T3UA 2J9GA 2NPQA 2PUUA 4YZMA 3I7BA 4BCKA 4CMTA 5EM7A 3VAPA 3BHHA 2BMCA 3CP9A 1W8CA 2WQOA 4RX9A 5CI7A 3R7OA 3C4ZA 4UUGA 4F6SA 1R39A 3EMGA 1G8SA 3CEKA 2Y4PA 4FT5A 4YHJA 3TCPA 5BUEA 1PX2A 3MJFA 5LA6F 4R5YA 3B2WA 3OMVA 2Y4RA 4ANSA 1ZY5A 3SW4A 2R3JA 4AUAA 3COKA 3HMNA 3QQJA 5IQDA 2WD1A 5D1OA 4BYIA 3SOAA 2EXCX 5E91A 3TWJA 2W6PA 4AN9A 3BGZA 4GJ2A 3RAIA 2GTMA 5KBQA 3IDBA 4I6HA 3QLGA 4RIYA 1CDKA 1H25A 5AMNA 4GEOA 2OLCA 5LVMA 3LJ2A 4D28A 3BV3A 3UE4A 4DTAA 1PKDA 3JSNA 5EKOA 2QKWB 4U45A 1QL6A 3W2OA 4BZDA 1Q24A 3ALNA 4E6NA 3QTQA 4CD0A 5LVLA 2NU6B 3V04A 3W55A 5M53A 3ZC6A 4G3CA 4NL0A 3HZTA 4AXAA 4CFFA 3RWQA 4AOTA 1DIKA 4FBXA 4FKJA 4DQNA 4RIWB 4IWYA 2OF2A 3T9EA 2QOIA 1NA7A 2Y0AA 3FI8A 4IEBA 4ZK5A 2AUHA 4FFLA 3Q4CA 5C1PA 2JKMA 4CFNA 2YCRA 4FTAA 4MXOA 1ZYLA 1IEPA 1M2RA 4BI0A 4DLIA 4XOYA 5KMJA 2J90A 3ENMA 2X8DA 2RF9A 4Q2AA 4L1KA 1BXRA 3U9SA 2I80A 4DAAA 1H1PA 2BILB 4XYFA 4EUUA 2C30A 1XHAA 2YM7A 4DFBA 2Z60A 4EH6A 3IW8A 2CMWA 3PXQA 4U79A 4MV6A 2YCFA 4F7JA 3DV3A 4J98A 1UWHA 2GNFA 3EQBA 4P5ZA 4AZVA 3NDMA 2G2FA 3U54A 2B9JA 3SNOA 3UOKA 4CZUA 5A4QA 4EHVA 3OOGA 2PE2A 4FMQA 4EOSA 4ZLOA 1OKWA 1UA2A 1VKZA 3W1GA 1PXPA 2JDSA 5FXRA 1XH6A 4OGRA 3GIDA 2OWOA 3ZRMA 3UP7A 3W1FA 2BALA 4EH8A 3LE6A 3PXZA 4DH5A 2XRWA 4RWIA 3JUHA 4I5HA 4L42A 3TUDA 3E62A 3ERKA 2V59A 2Z7SA 1J7IA 1LP4A 4A4XA 4ZTMA 3PUPA 4FZAB 5EHOA 4DH1A 4BHNA 4BCHA 5J2UF 3GU8A 3LAUA 3P78A 1PRYA 1RQQA 4PY1A 1SM2A 3ZO4A 4ACGA 3RK5A 5TKDA 3GUBA 4LV5A 1WBOA 2OJGA 4MQ1A 4YHTA 2BRHA 3R9DA 1BYGA 3MS9A 4GG5A 3PLSA 4C58A 1OKYA 5DAAA 5AIRA 4Y72A 4I50F 4CFUA 4FVPA 2C68A 4WOVA 4RFZA 3ZSGA 4HGLA 3IDCA 4HN2A 3FY0A 1H4LA 3RTXA 5DE2A 3O8PA 1IG1A 1LEZA 2C5VA 3QYZA 3IG7A 2CJMA 4FSWA 1Q8UA 1Q3WA 5AUTA 1VEBA 2XB7A 3O50A 3OT8A 4BGHA 5DT3A 3OUUA 4QMQA 2FSLX 2VN9A 3PPJA 3R63A 4FIFA 4G5JA 4QYEA 4C59A 4DTKA 5KCVA 2W1CA 3DPKA 4QOXA 2BZHB 3GCUA 4I5PA 5DGZA 5EKNA 1GJOA 5BMSA 2W6QA 4JBVA 3TZ9A 4W8DA 2HGSA 4KS7A 3NFFB 2PPQA 5J9LA 1CKNB 1W82A 1FVTA 4GKIA 1RE8A 1U54A 2XP2A 3FDNA 5GJFA 3LFEA 1URWA 5HCYA 2VTLA 3IKAA 4R1YA 4BDKA 3EQDA 5AUUA 2I8CA 5BVDA 2ITUA 5CF6A 3UQFA 2X8EA 3TKUA 4E5AX 4GCJA 5HKMA 4FJVA 4DFNA 1PXNA 4CMFA 4D5HA 4YMJA 4APPA 5IEXA 3UGCA 4LDTA 5IH6A 3VPCA 4TT7A 1VBGA 1Y91A 4UY9A 4BHZA 3FJQE 4I4FA 3DCVA 3KALA 3O0GA 2C6MA 3PRIA 3AD4A 1ZLTA 1CE8A 4HYIA 4MKCA 4WRSA 2QQ7A 5AUYA 5HG7A 5IA1A 3Q1KA 3QHWA 1I09A 3P5KA 1CS0A 3GU4A 5HBJA 4C4FA 1OKZA 3D5VA 4KINA 2BIKB 3K5HA 4JDHA 4RFYA 4EG0A 3K3PA 2JBPA 3F6XA 1PMVA 1DS5A 4ZTNA 2I1MA 3TTIA 4AXFA 2CNVA 5KMMA 4DDIA 2FPIB 3L8SA 2UZEA 4HZRA 4BTJA 5BX0A 4V04A 2BVAA 4I41A 1KV2A 2F9GA 4WBNF 3QX4A 1Q3DA 5FP5A 2CCHA 3CR0A 3EB0A 2CCIA 1W83A 5LOHA 4EK6A 4CRSA 5J5SA 4H1MA 5C8NA 2ZGIA 4C3PA 1P14A 3MN3A 1XH9A 3PIZA 4JI9A 3GENA 5C26A 3KY2A 2C5NA 2JLDA 3NSZA 3W16A 3U6HA 4TV8F 2QOKA 2PHKA 2X7OA 4R6VA 1JOWB 2HXQA 4KIPA 3AQVA 3JYAA 3L8PA 3IECA 3SXFA 1ZARA 2QOQA 5E4HA 2HIXA 3PP1A 3Q6WA 4GK3A 4R78A 5M51A 5HLWA 3UJGA 3D2KA 1PKGA 4O6LA 3VIDA 4FIJA 3VBYA 2WMWA 2PL0A 4BIDA 3ZZEA 4YURA 5I5VA 4FV6A 2X81A 3IPHA 3HKOA 5CI6A 3PTGA 3PWYA 3T9AA 4HGSA 3P0MA 4JVGA 3V4ZA 2ONLA 4O91A 3OY1A 3KEXA 4QP4A 4IAIA 1KJ9A 2QOCA 2WO6A 3LFFA 5EDQA 4QMUA 5CEPA 4HNIA 2VWUA 2ERZE 3E7OA 2I7QA 4QSHA 1M14A 4MK0A 2RKUA 4FV2A 2R7LA 2SRCA 3Q4TA 3QKKA 5K4JA 1BLXA 3RP9A 3PVWA 3A4OX 2WOUA 3P08A 2VO0A 3BE2A 3KCFA 1J3HA 4IWPA 5A14A 5AA8A 1MRUA 2BCJA 3NX8A 5CB4F 4MNEA 3L8XA 4UYNA 4E20A 3KQ7A 4PZ6A 3A8XA 4KKGA 3C5UA 3KVXA 5M57A 5HLPA 2OZAB 4JNWA 4C33A 3ANQA 1CKIA 5H2UA 2W71A 3A60A 1XMMA 2FYSA 4WNOA 3W8LA 1I2LA 5D7VA 3I5NA 5FGKA 1XJDA 3QQFA 2ETKA 4C4HA 3ORQA 4FFNA 2IVTA 3CD8A 4QMMA 2OXXA 3QD3A 2VTQA 3ORXA 4QMZA 3W2CA 4E6QA 2OFUA 2XCKA 1I7NA 5DN3A 3VUHA 5CYIA 3WF6A 2W9ZB 2GQSA 4EOKA 2BRGA 3QXOA 3C4CA 4KD1A 3UQGA 5J8IA 5CNOA 4EJ7A 5KUPA 4BRXA 5CSPA 4FV7A 2IZTA 4RVLA 4AWIA 4ZLYA 4KBCA 3P23A 4RQKA 2SCUB 2A2AA 5K3WA 3DFCB 4JBQA 2F57A 3DXNA 4E6AA 3MDYA 4CHIA 1SZMA 5AJQA 3R8VA 4YB8B 3VS2A 2XNEA 1WBPA 4LI5A 3W2RA 3SOCA 4FT7A 5CU3A 3RR5A 2HY81 4KIQA 5CA1F 1OPKA 3CY3A 5EHYA 5HHWA 2JAMA 3OY3A 2V7AA 4BCFA 4FKWA 1JDBB 4LGHA 4FTIA 2X4FA 3OCBA 4KSQA 1EZ1A 2ZV7A 5IQBA 2P0AA 3BEAA 3ML1A 5C01A 3T9TA 4MWHA 4IHJF 3I1AA 1FVVA 2CFMA 4PUZA 2BR1A 3OUNB 4XP2A 5EG3A 3KN5A 4KBKA 3FZPA 2O8YA 4GIIA 3KF7A 3LOKA 4K9YA 2BROA 2VX1A 3RGFA 1SMHA 4QP8A 4BJJA 4E5WA 3A7JA 1ZZ2A 5BYYA 5CE8A 4OT5A 4DE4A 3ZUVA 1UC9A 3AMYA 3RAHA 2J9MA 3SA0A 3P7CA 3NS9A 3Q32A 1ZOGA 3RPYA 2XM8A 3QFFA 1Y8GA 4IAYA 1PXOA 1ZOEA 3QKMA 4GIHA 4ZSJA 2W06A 2RG6A 3V5WA 3C7QA 4RJ3A 3QGYA 4KSPA 1AD5A 3WF5A 3BYSA 5DH3A 5F94A 4WNMA 1YQJA 4R3RA 1JSVA 4RSSA 4USFA 2ITNA 3O5AA 2CLXA 3DKGA 3LFAA 4FVRA 5ACBC 3OWLA 4KAOA 4TKSA 2ITQA 1JAMA 4FZDB 2ESMA 2V5QA 3DDQA 3BYOA 3EQCA 3KXNA 4LUEA 4XG7A 4F99A 3P1AA 4KRCA 2EB3A 5ANEA 4ID7A 2HXLA 2WHBA 4O2ZA 3W32A 5A3XA 4DHIB 5IUHA 5FTOA 4B4LA 3E8NA 4ZZOA 1ATPE 5BMMA 4TWNA 4HYHA 3KXGA 2W17A 5AADA 1M7QA 4AGWA 4D5KA 4EBVA 2J5FA 4HPTE 4OUCA 2HCKA 3ZUTA 3GQIA 3QA8A 5K4IA 4D55A 3WF7A 2VNYA 5CEIA 3UDTA 2JIIA 5FEEA 4DRFA 5JVLA 4PZ8A 4GG7A 1AGWA 4GMYA 1ST0A 5L6PA 5CX9A 4GW8A 5CQUA 2XF0A 3R1QA 2AYPA 4L9IA 4NYEA 4F9AA 2CDZA 3FYKX 1NVQA 4BDJA 3BQRA 4RIWA 5H8GA 3ANRA 3DBQA 2UVZA 2OJIA 5C9CA 2XYUA 3BU3A 1H07A 1Z2OX 2A4LA 2VUWA 4O7WA 4FKQA 3ROCA 1DAWA 4YZ9A 1H24A 2LAVA 1DAYA 3Q4ZA 4H39A 4HGTA 3AT2A 2X6EA 4HVDA 4FL1A 1PF8A 1P4FA 1Y6AA 3QC9A 3ORRA 5HG5A 1TKIA 2OXDA 3VNTA 1V0PA 3O2MA 4N57A 4QTEA 3G0EA 3K5VA 5JK3A 2XNMA 4ALWA 4Q9ZA 1LUFA 3O23A 3ACKA 1C30A 5BUJA 2YWPA 3GCSA 2PUPA 2WQNA 4OTGA 5DT4A 1B38A 4FI1A 3WIGA 4EQCA 3KMUA 4YNEA 2XBAA 4NT4A 3R9HA 3C0HA 4UV0A 3CBLA 2HAKA 5CZIA 3UBDA 3C0IA 4QTBA 3TDVA 2ACXA 2R0UA 1I1LA 2R3NA 4FSNA 1PMNA 3D5XA 3QC4A 3VS3A 4MXAA 1Q97A 4EOOA 4JIKA 2G01A 1KE8A 2BHEA 2F7ZE 1BI7A 2OICA 4JG6A 1GZOA 2HVQA 2FP4B 2WKMA 2PE1A 3AD5A 1VR2A 5I4NA 4FA2A 3CPCA 4EOIA 2VTOA 4NM7A 5BVKA 3EWHA 1MRYA 3RK9A 4BCGA 4CMDA 1XKKA 2WB8A 3IGGA 3FI4A 4ZQIA 1M0TA 4I0RA 3QTRA 4M3QA 3A61A 4D4YA 2ZM1A 2EUFB 2H96A 3D14A 4FSQA 5E8ZA 4ASZA 3OUZA 5ANJA 4FOCA 3EKNA 4BTMA 1R3CA 5A4TA 4JBOA 5KZIA 4D58A 4LH7A 3QQHA 4RA4A 4A9SA 4II5A 2W6MA 2YM4A 3WZDA 1OIUA 1BMKA 2WTJA 3EZVA 3QTZA 2CGUA 3HUBA 3OUKA 5IYZF 4AW0A 4A7CA 5CXZA 1ZRZA 3GVUA 2XNGA 4YJ3F 4L67A 3EHAA 4IC7A 4Q4DA 4OTDA 2HY0A 1EUCB 4M68A 4E5BA 4J71A 3ETHA 1QPDA 3MI9A 3A99A 5CVHA 3KIOC 3BU6A 4N0SA 3KULB 2B1PA 1Y57A 3Q9ZA 4EEVA 3MYGA 3TINA 3E8CA 2I0HA 3PPKA 4D2SA 5C27A 1IR3A 3BV2A 3TW6A 3BKBA 2FPPB 4FTUA 3TY5A 5G6VA 1IYEA 3TY8A 2YWVA 1OGUA 2JDTA 5AAFA 5EW3A 3IW5A 4CV8A 4DAWA 3FXZA 3PJCA 4MA5A 2RFDA 4FV8A 5FPOA 1GY3A 3BZ3A 1FVRA 2P0CA 3HAMA 2DZDA 3T9FA 4IWQA 4X7QA 3G9NA 2BKKA 3TIYA 3V6RA 5EYMA 4ZY5A 5DRDA 4GFGA 3BU5A 4TZRA 5CASA 2VTIA 4RCNA 1OUYA 2ITXA 3MJ2A 4XV9A 5FNVF 2I40A 5HNBA 4GL9A 3JZIA 1WFCA 3EOCA 4U8ZA 5HU3A 3KXHA 2NUAB 2C1BA 3KL8A 3MW1A 3Q9WA 4RJ7A 4WT6A 5FM3A 4RJ4A 1TQPA 5AP3A 2JKKA 3FMEA 3KKVA 3U6IA 2V0DA 3HL7A 2ITTA 1OBDA 5J87A 5BYZA 4A9UA 5HVKA 4JT3A 3E3BX 3H30A 2ZJWA 3OWKA 3UIMA 4YJUA 3GNIB 1PYEA 4K1BA 3UIXA 1Y6BA 4QMPA 4AGCA 3UNKA 5FDXA 4BIEA 4FTJA 4FV3A 4GLWA 3OTUA 4P2KA 3SQQA 2IW6A 4QTCA 2XKDA 3FZSA 2XEYA 1AUVA 4IZOA 1R0PA 4PDYA 3UQCA 5DGIA 1UNGA 2A1HA 4MD8E 3K3IA 4NK9A 4O0TA 2ITZA 5CF5A 4EK5A 3SW7A 2X0SA 2O0UA 2OU7A 5HE1A 3W18A 5JMSA 4GK2A 4IADA 3AX6A 4KWPA 5C1OA 3AXWA 3DNDA 3R5HA 2OIBA 4GUEA 4NZWB 5H8EA 5HCXA 5ITAA 4EGJA 2IVSA 5FXQA 4ERWA 2QI8A 2OI4X 3HDNA 4YJVA 4RX5A 2DIKA 3NAYA 4QQ5A 4RVKA 3LCOA 4YJNA 4QP3A 4AN3A 1OB3A 5IQAA 3EIDA 4S31A 3TMOA 3HX4A 4APCA 2JBOA 4MV4A 2WNTA 2QOHA 3MFSA 1BL6A 2R3RA 4U42A 2GQRA 4A4OA 3FZTA 1PW2A 2WMSA 1JQHA 2FPGB 3BX5A 3EN7A 2W9FB 2R7KA 2VO3A 2YIRA 2YM6A 3IO7A 1YDRE 3LZBA 4E73A 2YITA 3BLRA 5HNIX 2C3IB 2Z2WA 4CCUA 4G3DA 4ITHA 5BWTA 2Q83A 3MFUA 2PMIA 2C3LA 4E4MA 4ZOLF 2QO2A 2J7TA 3R01A 4F08A 3H0ZA 1UVRA 3ORMA 4IFCA 2IW8A 2JKOA 3ZZWA 4EH3A 4K6NA 3H9RA 5FG8A 2RIOA 1FBNA 3TI1A 4AE9A 4NW6A 3V8TA 3VN9A 3W0PA 5AAEA 4AQKA 5GONF 2BPMA 3F7WA 3QD4A 5KHWA 3GFEA 4S30A 4DGGA 4QMLA 4Y83A 2C47A 4JJRA 2GU8A 3R83A 3VHEA 4UWBA 3ZO3A 4BDGA 4BZOA 2XK8A 1ZMUA 4JDKA 4ZSEA 2J0JA 3LQ3A 4G3FA 3ROYA 4V0GA 3MTLA 5I5UA 3HMIA 2HZ0A 2R7MA 1OITA 2R4BA 3QAME 4FEVA 4H58A 4NJDA 4EOQA 4GFMA 4MX9A 4PL5A 3VC4A 4EBWA 3WBLA 3M11A 3Q3BA 3LFNA 4K2RA 4XP3A 1O6LA 4PTEA 3L2PA 2OH0E 2OFVA 3LFCA 3BGPA 3MH3A 5EDPA 3TJDA 4BCMA 5K5XA 1OL6A 3QRKA 4MBIA 3G15A 2J4ZA 5D7AA 4JS8A 5JEBA 3PFQA 4X3JA 4YZNA 3FUPA 3BI6A 3IDPA 2O3PA 4GS6A 3VS1A 2Q7DA 4A9TA 1OIYA 3RUPA 1P2AA 4OR5A 4WBBB 4I4TF 5A54A 3R8LA 5J9YA 3QHRA 2QO7A 4JRNA 4U3ZA 4FOBA 2J0LA 3JY0A