4O7SA

Saicar synthetase (type-2) in complex with tmp/tdp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
224
structure length
224
Chain Sequence
MIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with TMP/TDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 224
sequence length 224
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7sA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7sA02
1OVEA 1NVSA 4O6LA 2V58A 1B39A 5CA1F 4II5A 3EN9A 3MY1A 4FNWA 3BU5A 2XA4A 4FL3A 4QP2A 3KFAA 3FZRA 3ORXA 2HIWA 4RIWB 3RALA 3ZDUA 5I5ZA 2ITUA 2R3LA 3R7IA 2WKMA 2ZDUA 3F2RA 5AP1A 4J71A 4LL0A 3GVUA 3E3PA 4ZS4A 3R1SA 1CTPE 2AC5A 1ZY4A 4X3FA 1JQHA 1UNGA 4JBPA 5CSVA 4JQEA 1A9XA 4YJRA 2F9GA 5CQUA 3CD3A 4ZXTA 1Y91A 1KOAA 3LQ8A 4MAOA 2Z2WA 2GS2A 5C1QB 5EZYF 4ANQA 3ZLXA 2UUEA 3DB6A 3QCSA 4ZHQF 3LM5A 3TW6A 2NPQA 4FSYA 3WZKA 3MH2A 3VO3A 3TIIA 5LCKA 3GENA 1PYEA 2RFSA 2XM9A 5IEYA 3VC4A 2UVYA 1WBWA 5B2MA 1T45A 3SW4A 3D4QA 4IJ9A 3AD5A 3HV7A 2XYUA 3A61A 4XBRA 2XCKA 1XH4A 4C4HA 5KKRB 3GU7A 1SMHA 3SOCA 3NUPA 3BZ3A 3R8ZA 3TTJA 5FP6A 4F63A 3LCSA 1V0PA 5TOZA 3OCBA 5EHOA 3QF9A 3UP7A 1OI9A 3TV7A 4FK3A 1RJBA 2W5AA 3DJ5A 3G5DA 5K9IA 4X21A 3HKOA 4DAWA 3SV0A 2O65A 1M52A 3PG1A 4BTJA 5HI2A 4U3YA 2JBPA 4QRCA 2OLSA 3R9DA 3KULB 1UU7A 4FIJA 2R3KA 3IS5A 2YWVA 3R7YA 5BVNA 3BGZA 4AW2A 3ATSA 1ZWSA 2Q0BA 4BKJA 4KABA 4RC4A 3GC9A 1H28A 1PXIA 3UQCA 3AD4A 3F3WA 3VQUA 3A2CA 4ORKA 3U4WA 4MV7A 5CEOA 1M0WA 4ZP5A 4B8LA 5EH0A 3SE7A 3UYTA 5AP2A 3MPTA 4BDDA 3QD3A 2YJSA 4U44A 1H25A 4A9YA 4DFZE 2X7OA 3OMVA 4DCAA 2FA2A 1HCKA 4XG2A 4YJNA 2X8EA 3GCSA 4K0YA 1SYKA 3CGOA 4I6FA 2PULA 3ROCA 4ZAUA 4FTKA 5ANGA 4J95A 1KBLA 3ZRLA 3C0IA 4RSSA 3KKVA 1JOWB 4U8ZA 4BDEA 3PPZA 4QP8A 4CKRA 4BI2A 2IW8A 4AWIA 5IA0A 3WILA 4MAMA 2E9OA 2ETMA 5JRQA 4AW5A 3TQTA 4FT3A 3LPBA 4O4HF 5E8SA 5GHVA 5J2TF 4IH8A 4YR8A 3PA5A 4F6UA 3LLTA 3R1YA 1H07A 5GIPE 5HE3A 5HCXA 3NRMA 5CAPA 3LZBA 5AX3A 5AIRA 3AC4A 3GOKA 3A4PA 2YIWA 2OF2A 3BQCA 3HZTA 5AAFA 3IG7A 4CG8A 4DH3A 1GSOA 3CP9A 3H9OA 5FUTA 2X8IA 3Q32A 4IVBA 4PRJA 5EKOA 4A9RA 2BZIB 3RK7A 4QMVA 4UY9A 3RJCA 1W8CA 1QPDA 5E91A 2Z7QA 5A9UA 5BUJA 3U6IA 2BIYA 2DIKA 4QMYA 4FT9A 5HD4A 3MDYA 4M8TA 3VAPA 3ZONA 5BVOA 2OH0E 2R3JA 3NWWA 4R3CA 4G3EA 5GNKA 4F0IA 3RTPA 2YIQA 2A4LA 4LGGA 5IMEA 5J1VA 2I80A 1JNKA 4FVPA 3U55A 3A62A 4PL3A 2VWYA 3MVMA 3VUGA 1KC7A 4RMZA 2I6LA 1VYWA 3R8MA 1H1QA 3C5IA 4FSZA 3KMMA 3FLNC 4DEAA 1LPUA 5E8VA 4QMZA 1KE6A 4XG9A 4E8AA 4BCGA 1GIHA 4ENYA 4TRLA 1FGKA 1M2PA 2W1HA 3VS6A 2BAQA 4V0GB 4RRVA 4EH8A 4BHZA 1Q8UA 2BALA 3KRRA 2UW8A 1QPJA 4ACGA 3CTHA 1YI6A 4L67A 4FFLA 4EC8A 3UFXB 5LMKC 3C0GA 3POOA 3PE1A 2HZ4A 3AT3A 2R3QA 4JDKA 3NX8A 3D5XA 1OUKA 3F3VA 1J7IA 1YQJA 3NPCA 3ZO2A 3JS2A 4QQ5A 2R3NA 4RBLA 1P14A 2HK5A 4JL9A 3ZM9A 4OTFA 3TKUA 4HOKA 1JVPP 3PXZA 3HVCA 2XNNA 4U9AA 3WF8A 3FZTA 4ZEGA 3SLSA 4OGRA 2R5TA 3IECA 1R0EA 4O0TA 5DIAA 2BFYA 3WZUA 4NU1A 1ZMUA 4KD1A 5HESA 2ZDTA 3G9LX 4YBJA 5AWMA 3WE4A 3FZOA 4ZZNA 5JGAA 4RA4A 2HELA 2QU6A 5DR2A 4GK2A 3FMJA 2EWAA 2XS0A 4C4FA 1H1SA 2IW6A 2W1ZA 3OEZA 2XNBA 5BUIA 4DYMA 3G8CA 3D7TB 3IGGA 5ANKA 5CAVA 2IP4A 3IW4A 4N70A 2PVRA 2WQEA 4LQMA 4L3LA 3ENMA 5KBQA 2QK4A 2YS7A 1AD5A 4CTBA 2X6DA 4AFJA 2YDIA 2GHLA 3W33A 3CPBA 4EBVA 2R3GA 3NMUF 4EOKA 4DINA 4FKRA 3DNEA 3Q6WA 3QUEA 4F4PA 2Z8CA 3Q52A 3IQ7A 2GQSA 4RWIA 5GIOE 3UE4A 4F70A 5KKNB 3RVGA 3WBLA 1EYZA 3MN3A 2VZ6A 5FDPA 3ZOSA 5CU3A 4EG0A 5HICA 2WTWA 2B55A 4F6SA 4FI1A 3L8XA 3FV8A 2B54A 2CN5A 3QTSA 4IVDA 5JRSA 2XP2A 4C4IA 2G2FA 3GU5A 2R7MA 4QMNA 3KY2A 3NUSA 3DTCA 2YIYA 2OW3A 3UVPA 4CMUA 3QX4A 2RF9A 1TQPA 5EQYA 5L6WL 3BPRA 3EKNA 5AAGA 3QWKA 3TZMA 3U9CA 3RPVA 3RFCA 3KN6A 4M7IA 1SCUB 3T8OA 4KUJA 4D4VA 2B52A 2XVDA 1UU9A 3E7OA 3MY5A 3Q5IA 3QQGA 2Q83A 3DBEA 4YSMA 1QL6A 4KWPA 4YNEA 4IZ7A 3Q4UA 5HU3A 4MNEA 4GFMA 1YWVA 1JKSA 2WIPA 3O8UA 5HO7A 2VWBA 2A19B 3TL8A 2ERZE 3QTXA 4G16A 3OXIA 3QRTA 5LMBA 5EM5A 1PXLA 4JI9A 4W4VA 2UVXA 3MTFA 3F7ZA 1DI9A 4NJ3A 4PDPA 5AP6A 5T3QA 3JRXA 2BPMA 4RX7A 3QGYA 3IDPA 2JFLA 4RWKA 3R02A 2UZBA 4K8AA 4OBPA 5CSWA 4YLLA 2A27A 3PVWA 3NUAA 3ZMMA 5ITAA 4OBQA 4NM3A 4KNBA 5IA5A 4U40A 3GB2A 1IAHA 4HGEA 4ME6A 4TYJA 4QNYA 4O7YA 5C4LA 1XHAA 3IW6A 4S34A 3QD2B 4FIGA 4JG8A 1BI8A 4HVSA 3LMHA 4YAKB 3VJOA 1CKJA 2C3LA 3QZFA 5M4FA 3BBTB 3DU8A 2CNVA 4YHJA 4XV9A 2I40A 4OR5A 4YJTA 5CALA 5C8YF 1LEWA 5KO1A 1GZ8A 2RFDA 3OP5A 4IAIA 3MA6A 3BYSA 4FEWA 1YDTE 4E6QA 2R64A 3RK5A 4YZBA 4E4NA 3BRBA 2PUUA 2WGJA 4FV5A 1I09A 2PZIA 3Q60A 3R5HA 3GI3A 1YWNA 3FE3A 3FI8A 3ANRA 3FMMA 1ZYDA 3COKA 4QYFA 3RM7A 3HA8A 2WMRA 4O2ZA 3VS7A 4DLIA 3FPQA 5HE0A 2IVUA 5F20A 2WTKB 3R6XA 3SAYA 3LVPA 4RVTA 4IX6A 3ZBFA 2GS7A 3DZQA 2JKQA 3PXFA 3I81A 3UODA 5CTPA 4BRXA 3TJCA 3F3TA 2UW3A 4JIKA 3W10A 4AA4A 2YL2A 5HBRB 4Q2AA 4U97A 4AQCA 3P78A 3VS5A 4AZVA 3CJFA 2R86A 3C1XA 3WZDA 4XYMB 3KEXA 5JVLA 2HOGA 1YRPA 2BKKA 2WZJA 4G3FA 3ORLA 5CVGA 3ZXZA 4FSTA 4FV9A 3L9MA 4P5ZA 5DG5A 5IH6A 3FDNA 1DV1A 1O6YA 4J53A 2FVDA 3CEKA 2Y9QA 2YCSA 2R4BA 5HGIA 5JQ8A 2XK7A 2XK8A 3ZSHA 2CGUA 2OFVA 4J7BA 2OK1A 4W4XA 3MPMA 2GS6A 5JGBA 4MEDA 4WG3A 2ZV9A 3HMIA 3EMGA 4G2FA 4AGWA 4CRLA 3ZEWA 5E8XA 3A60A 3OD6X 4IEBA 4O7WA 3P23A 4AZTA 5HTCA 1VBGA 1BI7A 3MPAA 5B2KA 3WIKA 4G6NA 1NW1A 2W9FB 3C4EA 3EZRA 4MXZA 1R39A 3KXHA 3O51A 4DIMA 5L6OA 4UZDA 5J8IA 5LARA 1KE7A 1PY5A 3V5WA 2VQDA 4DT9A 3VBTA 4GK3A 4WBBB 1OECA 2V7OA 2YCRA 3DK7A 4IDTA 5IYZF 2XKDA 4EK3A 2SRCA 3B8RA 5BX0A 1K9AA 1VYZA 3W32A 5EYDA 3OT8A 3BYMA 5KBRA 3QD0A 4KRDA 5CZHA 2VUWA 3H30A 2IPXA 4QNAA 4XYFA 5H9BA 3WIGA 3SDJA 5ETIA 3PFQA 2IZRA 3U6JA 3I7BA 1VZOA 4QPAA 1HCLA 1V0OA 2GQRA 4Y5HA 1O9UA 1M14A 3UYSA 4I6BA 5C9CA 4LOOA 2PVYA 3AC8A 5JH7F 2WQNA 1K2PA 2HW6A 4I23A 2OGVA 3KXGA 3VW8A 5M4IA 4HVDA 4QPSA 5KMKA 4GVJA 4BDFA 2VO7A 4F7JA 2VNYA 5F9EA 2QKRA 4FSWA 2WOTA 4L00A 2ZM3A 4TWPA 3PJ3A 4YPSA 5LWNA 1FGIA 3EN6A 3QQJA 3OY1A 1J1CA 1IG1A 2FO0A 3EQCA 5K5NA 2XK9A 2DWBA 2PVLA 3I0OA 4MA0A 3MH1A 3EIDA 2C6IA 2CGVA 3BX5A 3HAVA 4QTCA 4NTTA 3R9HA 3TDVA 3SRVA 4JBVA 3KL8A 5FBNC 3EFLA 3GCUA 2R3OA 3NIZA 4FKTA 5EKNA 3UTOA 5T6KA 1DS5A 1JLLB 3TTIA 3F88A 3PSCA 2V55A 3R28A 2EB2A 4FTNA 4S32A 5TR6A 4F7SA 3K3PA 3OY3A 4XX9A 3C5UA 2C6TA 5AMNA 4KKGA 4QTEA 4YTFA 4GH2A 1CS0A 4YBZB 4TZRA 4RJ4A 1BUHA 3CQWA 3RMFA 1VBHA 2V5QA 1UNLA 2J5FA 5GINE 2X7GA 2ITTA 2FGIA 3F66A 1ATPE 2BDWA 4XP0A 3HP5A 3W2RA 2QOBA 1WFCA 2VWWA 3V3VA 2GNFA 4X6QC 3DKFA 4DE4A 3GIDA 1G5SA 3LFSA 3B2TA 3QYWA 4G6LA 4ERWA 2HAKA 3G51A 4R1VA 5C8KA 4R3PA 3S4QA 1C3OA 1M6VA 4DTKA 2QOOA 4BCNA 1NT2A 2JKMA 1Z2PX 3NNXA 4PMTA 5E92A 4WNMA 4BCJA 4XG6A 5DI1A 4DITA 4ITJA 3NAYA 5F4NA 3P0MA 2WMQA 3TT0A 2SCUB 5BYZA 4WNPA 2ITVA 2XNEA 4HNFA 2HZ0A 3PXKA 2G9XA 5CLPA 2Z60A 5E90A 1IRKA 1OIRA 4DH8A 3QZIA 3TN8A 4BCFA 3OWPA 4YZNA 2P0CA 3P79A 5HNIX 1PMVA 4J8NA 3E8DA 3QLGA 4D2RA 4X3FB 2QLUA 4YHFA 5AA8A 3NNWA 4RX5A 4M84A 2X81A 2PK9A 5EG3A 4AE6A 4FA2A 2PL0A 3QC4A 5LOHA 2PZ5A 2BAJA 4Z7GA 3D5VA 4MV6A 4LYNA 3DQWA 4O7TA 3W8QA 4IC8A 4M9UA 2B7AA 3PIXA 4EGJA 1WBTA 4HCTA 3AGMA 2PMOX 3II5A 3IOKA 5ANIA 2J9MA 3QTUA 4HNIA 3V6SA 3BWFA 4GIIA 4U81A 3HMOA 3M11A 4FUYA 1WBVA 3POZA 5HBJA 5C1PA 4U41A 4CSVA 1TKIA 4IBMA 5GJFA 3PIYA 1OGUA 4QMPA 4UYAA 2WNTA 4F65A 2C47A 1WR2A 2P3GX 5DNRA 4UYNA 5H8BA 4IWDA 1LP4A 3TUCA 2YZNA 3RPSA 3VBWA 5HE2A 5FBOA 3VRYA 3MBLA 4CEGA 4RIYA 3ZLWA 2Y6OA 1R1WA 1UU8A 5A4TA 5KZ0A 4QQJA 5HG8A 4RJ7A 4FV0A 4MX9A 4DT8A 4X3JA 4FZFB 4GT3A 4JG7A 2R3RA 4CV9A 4FYNA 1J91A 3N51A 4XV2A 5KMMA 3HEGA 3GQLA 5CSXA 2F7EE 3U8WA 1Q3DA 1CQJB 3QWJA 4HVIA 3FXXA 1QPEA 3W18A 3H0ZA 4MV3A 2CCHA 2BDFA 5L8JA 3VUKA 4BYJA 4M15A 4NL0A 4C3RA 4F9AA 3FKLA 3TZ7A 4CMTA 2YAKA 4O91A 3AD6A 3WF6A 4FSQA 2WTKC 4DTBA 1UNHA 4IADA 5BPHA 3DK3A 2C6DA 4I4TF 1G3NA 4HZSA 3IW8A 2WTCA 4XUFA 2ZDGA 1O6LA 4NT4A 5LVMA 2OF4A 4MBJA 2PVHA 3CTJA 3WE8A 4LOQA 1OBGA 2XIXA 3ITZA 4XRJA 4JX7A 2BIKB 4OBOA 4DCEA 4JR7A 3ZZWA 3CTQA 1JBPE 4FT5A 4C7TA 1CSNA 3IKAA 4TNBA 3P7CA 5BMVF 4BCMA 5HG9A 4JDIA 4NM5A 4WT6A 3IO7A 4FKIA 5AP4A 3FHRA 4FT7A 2R3IA 2WTVA 4JAJA 3CC6A 2XNOA 2W1FA 5JKGA 4F0FA 1H24A 3IONA 3VOTA 4C4GA 2CMWA 2IG7A 4JXFA 3EFKA 5DFPA 5CF6A 1EHIA 2YAAA 3EL7A 3EKKA 4IVAA 1H8FA 4WNOA 3RWPA 5AV2A 3TZ9A 4BTKA 1KE8A 5I9YA 3KRXA 4BCQA 1ULZA 4BF2A 2YRWA 3Q4ZA 4DGMA 2C0OA 1YXUA 4D0WA 3RCJA 4AA0A 2XJ1A 5C4KA 4CCUA 5TKDA 4FMQA 1Q5KA 5DT3A 3PJ8A 3CCNA 3RI1A 3MFSA 3TNIA 4IHPA 4I93A 3GOPA 5L8KA 3QUPA 2X2MA 4X2KA 3SOAA 3TV4A 2O64A 3MVJA 5KMJA 4FZAB 1F3MC 2ZOQA 4O81A 4TYEA 4ZJJA 3SXFA 3ZFMA 4QTAA 4EQCA 4WIHA 4GW8A 4Y46A 3DFCB 3H4JA 3IW7A 4TNDA 4ALUA 1Q99A 2OSCA 4CV8A 3FEGA 3T3VA 2VGPA 2YIRA 1ZZLA 3PXYA 3D5WA 3F6XA 4AGDA 4OLIA 3BYOA 3MVLA 3AQVA 4RZVA 4A7CA 4J1RA 4KIQA 2WMUA 2UW4A 4O38A 5JEBA 5J5SA 2P4IA 1ZYSA 5EQEA 4RLKA 5M53A 3FQEA 4AOTA 1ZZ2A 3LHJA 3UG1A 5CY3A 4NM7A 3UO5A 4QQCA 3ID6C 3Q04A 2YZGA 4YPDA 3ZLSA 2XNGA 3R8VA 4IWQA 4NH1A 3SXRA 5DA3A 3TACA 2J4ZA 3EQIA 4BGGA 2PYWA 3VWAA 2P2HA 4RIXB 2WMVA 4G9CA 5KNJA 4JJRA 3C7QA 3LQ3A 1Z57A 2R7IA 4GKHA 2UZDA 4FVQA 3PY0A 4AP7A 5BUEA 3PZEA 4O0RA 4FNYA 1H27A 2UZWE 2QOKA 4WNKA 3UIUA 2GHMA 2WTIA 5AADA 5FNVF 2OH4A 2X0GA 3PXRA 5DH3A 5AP5A 4DEDA 2JFMA 2X2KA 4JDJA 4Z16A 1EH4A 3FMLA 4GUBA 1GSAA 3OOGA 1YXXA 3I0QA 4ZSEA 3MH0A 1OBDA 3FZ1A 3VJNA 4RVKA 4CFVA 1M2RA 5D9HA 4EK5A 1WBNA 2BTSA 3GU6A 4MD8E 3R0TA 5BVFA 3BHYA 3QALE 5K5XA 5DRBA 5KE0A 2BRGA 3O17A 3PP1A 2QCSA 2GNIA 3BYUA 3GXLA 4OTHA 5EFQA 1L8TA 4BI1A 4E5WA 4HJOA 4ZOGA 3FUPA 4AACA 4L42A 1OL7A 2BAKA 1JAMA 5EW9A 5AM6A 3UGCA 3VS1A 3AGLA 4ZZOA 3RM6A 4E6CA 5IH4A 3MYGA 4MH7A 3WARA 3CGFA 1WAKA 3RCDA 1URWA 4L9IA 2VTTA 3FKNA 1YDSE 3ET7A 3HNGA 4FTOA 2BFXA 4JOAA 2PMNX 2FUMA 2UZVA 4OTQA 3DJ6A 5E8UA 4GFOA 4PMPA 5CF5A 4O4LF 4Q9SA 2HY81 3C0HA 2ZM1A 4EEVA 1PMNA 3C4ZA 4FTUA 1U5QA 2IVTA 3RAHA 3KXMA 1Z2NX 4IM2A 3MGYA 4EOQA 3H10A 2QC6A 4D4SA 2FPGB 1DM2A 1MUOA 1ZMWA 3TI1A 2GPWA 4W8EA 2LGCA 2WMTA 5AV0A 4FV8A 3BCEA 4UX9A 3R83A 3CLYA 4BIEA 4EH9A 3NYOA 5EYCA 3QX2A 1YI4A 4CZTA 5IDNA 3HB9A 4L6QA 4FSRA 1A06A 4RQVA 4PF4A 3FBVA 3WF9A 3CY3A 2EB3A 2XMYA 4X0MA 1B6CB 4PMMA 3ODYX 4X3FC 5CNOA 2BR1A 4XG3A 4BCIA 4BDIA 4BDAA 3FZPA 4IMYA 4YURA 4XG4A 3N4VA 4DG2E 4EOOA 4NIFB 2OJFE 4M12A 4Q9ZA 3D9VA 4H3PA 5ETFA 4GU6A 4MNEB 4FKPA 4RJ6A 3KQ7A 4G9RA 4RGJA 2C5VA 3TV6A 2JDRA 2OLCA 4Z3VA 4O21A 4WBNF 5HBHA 2ITWA 1ZYCA 2G15A 3HMPA 4FSMA 3VBVA 1PJKA 3OWJA 3Q4CA 3GCPA 4CKIA 4Y85A 4D1XA 2OIDA 2PZYA 3KAKA 1Z5MA 1ZOGA 2QODA 1Y6AA 2W4JA 4D4YA 4XJ0A 3NUYA 4PDSA 4QSHA 4GJ2A 5BVKA 2QOIA 4JRNA 4L1KA 2GHGA 3COMA 3EB0A 4FKQA 5IEVA 1CE8A 4L44A 4XBUA 2R7NA 3DT1A 3ELJA 4KAOA 2YDJA 4AGUA 2VTHA 3QA0A 3DBQA 3Q9WA 3ULZA 2ETRA 2XEYA 2UW7A 4H1JA 4MTAA 4F7LA 3PDTA 2O8YA 3CPCA 2QHMA 4MBLA 4W4YA 3ZXTA 5FM2A 3TIZA 3ACKA 5JN2A 2NU9B 1XJDA 2FPPB 4BGHA 5L6PA 5DE2A 4ZTMA 5LVPA 1ZY5A 2CNQA 5HBEA 4O96A 5ETAA 4D9UA 3BEGA 3U9NA 2XBJA 2V5AA 2GNJA 3DPKA 4FKVA 4C36A 4EH3A 2V0DA 1DIKA 4NUSA 5IH5A 2ZB1A 2DYLA 3MB6A 2W0JA 2QKWB 4QTDA 5E8ZA 5K3YA 4DHFA 3EFJA 4J96A 4WG4A 1G8AA 2VX0A 3WYYA 3OT3A 2WU7A 2C3KA 5HHWA 3WI6A 5JMSA 4G5PA 4TY1A 3MESA 4FV3A 3G2FA 4IAFA 4APCA 1DV2A 4FZ6A 4O83A 3EL8A 3TM0A 4DFXE 4G34A 3TNQB 3ULIA 2Z02A 2IZUA 3Q96A 5I9VA 5J7HA 1BMKA 3HLLA 3QKLA 5TO8A 4YSJA 4LOPA 4M13A 3BLHA 4Y5QA 4YLKA 3EN7A 4Z9LA 2PE1A 3QTZA 4TV9F 4JAIA 3FLSA 5D12A 5M08A 2PTKA 5JFWA 2XKCA 3QFVA 3HP2A 4FV2A 4M69B 5HX6A 3F82A 2X7FA 1XO2B 3O23A 5BVEA 3PLSA 1V1KA 1OL5A 1WVWA 3KVWA 3R1NA 3VBYA 1P2AA 4TTHB 4NTSA 4LL5A 5IZFA 2ERKA 1Q8TA 2H9VA 3DAEA 4GJ3A 1OKZA 4EI4A 2ZMDA 4JBQA 3WO1A 4BB4A 1WMKA 4FFMA 2QO9A 2JAMA 3V5TA 4LUDA 4KS8A 2QOHA 3NSZA 1Z2OX 4UWBA 4EYJA 3LMGA 5IUHA 2X1NA 3QQLA 2BRHA 2VTIA 4HNVA 3QTWA 4RIXA 3DKGA 4JQ8A 4NW6A 2R2PA 2PVPA 1FMOE 4YJSA 3O71A 3SQQA 3I6UA 3RAIA 5HLNA 5KX8A 3SA0A 4WHZA 1XH5A 2ZMCA 2V22A 3IOPA 3R30A 3W2PA 4QTBA 2ZAZA 2HJWA 5FP5A 3KCFA 4IAYA 4RC3A 4O22A 3V51A 2H6DA 3CJGA 3DA6A 1GZKA 3KXZA 2ZB0A 4AF3A 2GFSA 1KJJA 4IACA 4IX5A 4CT2A 5HIBA 4CQEA 2C5XA 3AW8A 3CY2A 1PMUA 5ICPA 3FMKA 2A0CX 5JQWA 1PXKA 3FSKA 3LXPA 4XLVA 4MD7E 1H1PA 3SGCA 4KBCA 4ONAA 1J3HA 4K2RA 4HZRA 3AC5A 3PY1A 4O7NA 3VIDA 3F2AA 4HPUE 4ASZA 5LYJF 4TUYF 1OITA 1KUTA 3DDQA 1REKA 3GU8A 4IX4A 2Y4IB 3Q9XA 4PL5A 4ZZMA 5ANOA 2R9SA 3OS3A 4FKSA 3NYVA 1CMKE 4A9SA 4YC8A 3DFAA 4TV8F 2YW2A 3GC8A 4YZCA 3TUDA 4FGRA 1FMKA 2UZNA 4FKJA 3SRVB 3PJ2A 3OTUA 5HIDA 2VO3A 4CXAA 5CI6A 4L01A 4E5BA 3REPA 3BE9A 3PXQA 5CASA 3WO0A 1Y8GA 2IO6A 4PTEA 3W2CA 2O3PA 2Y6MA 2WXVA 3MFUA 3OWLA 4L3JA 4NKSA 4I0RA 1U54B 4R5SA 5E7RA 5LOVF 2W6PA 4C5CA 4YC6A 3EOCA 2QOLA 1Q24A 2FSLX 2PMLX 4KIOA 2OZAB 2GQGA 4LRKA 5IU2A 3MJFA 4O0VA 4YGAA 2WMBA 3ERKA 4OTGA 3AC3A 2KTYA 5J9ZA 4FG9A 4IZ5A 2UW6A 4MF1A 2J5EA 4WRSA 5CEMA 2XCLA 2W70A 3TIGA 4U3ZA 5FGKA 4EC9A 4LRJA 4C4JA 4UXLA 4IDVA 5IQFA 5DGZA 3RPYA 4BZDA 4QYYA 4C38A 5LA6F 3FSFA 2BRBA 3BU6A 2G2HA 5C26A 4ASXA 4EYMA 3NW7A 2CPKE 4H1MA 3UC4A 3DJ7A 1JLUE 1KWPA 4YJPA 2BZKB 4TYHA 3U4UA 4IE9A 1XH6A 4O7RA 1QCFA 2PVKA 2RG6A 4W8DA 4AA5A 4A06A 5AIKA 4CTCA 4QYEA 2WHBA 3HRFA 2WQBA 4F0GA 2VWIA 4O2PA 3GCQA 2OBJA 1YVJA 5CNNA 1UA2A 2W4OA 4N0SA 4ITIA 3UOKA 5I9WA 4I4EA 2FP4B 5CZIA 2UV2A 3LQ5A 1RE8A 4G3DA 3NVMB 3RK9A 5AP0A 4K6ZA 5GJGA 4PNKA 5KKRC 2IJMA 4YJUA 2VTNA 4D4RA 4R1YA 1RDQE 2NP8A 4WD5A 5DBXA 4FBXA 4BBFA 1JDBB 1JSTA 1OL1A 3I79A 2J6MA 4FTJA 3P08A 2YEXA 4YTHA 4EH2A 3HUBA 4EHZA 5KCVA 4UWYA 2BHEA 2VTPA 2YCQA 4X2NA 4KINA 4MXCA 5D41A 4AT4A 1DI8A 2F2CB 1M17A 3FXZA 1IA8A 4TT7A 2B0QA 3QA8A 3FLYA 5ACBC 4KS7A 4EOPA 4BTFA 3RZBA 3OWKA 3C4CA 3BKBA 1OIUA 3RHKA 3FLQA 3BHHA 3JRWA 3VHEA 5BPYA 3ORRA 5D7VA 3ZH8A 4EORA 2X4ZA 5BNJA 4RQKA 5F1ZA 3AMYA 3MFTA 5EYKA 3NW6A 4RIYB 4PNIA 1SVEA 5FXQA 4I22A 5D10A 1CDKA 2DUVA 2I0VA 4I21A 2OXDA 2W5BA 3MJ2A 3EQBA 4LUEA 3FMHA 1OPKA 3SW7A 1ERKA 2HZNA 5BVDA 3RV3A 3VHKA 1APME 5CQWA 4D5HA 2WQOA 3FY0A 1GNGA 3IPHA 1OUYA 4FTMA 4R7HA 3UIMA 4WO5A 1YHWA 3TUBA 2HGSA 5FDXA 4A4OA 4UB7A 2C3IB 2XYNA 3SG9A 2B9JA 2YM3A 4XH6A 4CGAA 2XBAA 4GK4A 3SX9A 3TKHA 5FLFA 5CA0F 2GCDA 4RJ5A 4XNEA 4YZDA 4E93A 4ZJVA 1H26A 2YJRA 1IR3A 4HYHA 3DGKA 4PL4A 3UZTA 3QHRA 5HZNA 2OIQA 2NNWB 4IANA 5HG7A 4QQTA 3KREA 4D28A 4JS8A 1PXMA 5JK3A 4KBKA 4QO9A 2YM8A 2XIKA 2XF0A 3R22A 4O86A 4V05A 5ANJA 4JIAA 4YZ9A 4YC3A 5KMIA 2JGZA 2OIBA 4HGTA 2PZRA 2HY0A 3W55A 5EQPA 2OJJA 1M2QA 2OJGA 2EVAA 2F7ZE 1SVGA 2YIXA 3MI9A 2ITXA 4O7LA 4UZHA 4FZ7A 3BG5A 3G0FA 4JBOA 4ACDA 3UNJA 4M0ZA 2R85A 4E1ZA 2H96A 2NRYA 1GZOA 2ONLC 4FNXA 5FTGA 2E2BA 3D7ZA 3ZSGA 3PWYA 4XG7A 3LJ1A 2YZAA 3TG1A 1UWJA 5IA3A 3PYYA 1Z9XA 5EI8A 4DFBA 5CU2A 2XJ0A 3DKCA 2C6MA 1JPAA 1NVQA 3DXQA 3FY2A 3MIYA 4S30A 2FB9A 3E5NA 3LWBA 1A48A 3R8UA 2YA9A 3DKOA 3UDBA 2IZSA 5IA2A 5HIEA 3E7VA 5FD2A 3S00A 4GUEA 5CU6A 4M97A 1WBPA 4FTCA 4RLLA 4KB8A 1P5EA 4GIHA 4IFGA 5EM8A 5AUUA 3OF0A 4EZ3A 2WMXA 4I20A 2G2IA 2OG8A 4FTTA 4GV1A 2XRWA 3H9FA 1Q8WA 2VX3A 3TZ8A 4LRMA 3UBDA 2CJMA 3LFDA 1IOWA 3ROYA 1UU3A 4U79A 2QNJA 4HGLA 4XP3A 2CHLA 5HVKA 5E1EA 5C1OA 3VA7A 2VTSA 4QMOA 5CSHA 4DFYA 3L1SA 4J8MA 2YM6A 3FLWA 3OC1A 3AG9A 2ZV2A 3CXWA 5FEEA 3VS3A 4AN2A 1MRYA 4EQMA 3CQUA 3LXKA 2ITYA 4MWHA 3GBZA 4AUAA 2C5NA 3A8WA 4FSNA 2P55A 3RWQA 2VRXA 3DZOA 4NCTA 4AW1A 3UP2A 4CLIA 5D7AA 5B2LA 4DBXA 3JZFA 3NGAA 2JBOA 2WIHA 4OTDA 3SC1A 1WCCA 2C1BA 4XV1A 4AZSA 4ZY4A 4JX3A 5CANA 4YUQA 4L45A 3G8DA 4IZOA 3FQHA 2PUIA 1KE5A 2OJIA 1SVHA 4HYSA 4DFLA 1U54A 1YOMA 3PSBA 4PY1A 5FRIA 2Y4IC 4X7QA 3MA3A 2XKFA 2QOFA 2JDTA 4F1TA 2X9EA 2OZAA 1BXRA 4E4MA 3PA3A 2F4JA 3MW1A 5EM7A 2W17A 4UEUA 2VN9A 4C61A 2GNGA 4Q5HA 1KJ8A 2JKKA 4DEHA 3KALA 1OIQA 3RPRA 3HRBA 2AC3A 4RVLA 4BDKA 3QU0A 3QQUA 2BRNA 4FK6A 2CSNA 3EH9A 4TPTA 5EOBA 4PX6A 3VUHA 2XK6A 4I55F 4D0XA 3N4UA 3IDCA 2GTNA 3UZPA 4DEGA 4UN0C 3JUHA 4QMWA 2REIA 4BICA 3UOLA 3DQXA 2Y4PA 4DLJA 4DA5A 2WO6A 4XOYA 1CM8A 4C0TA 4EJNA 1YOJA 3TNPC 2AUHA 3KC3A 3KXNA 4CKJA 4EZ7A 3Q1KA 5ETCA 1JKKA 1WVYA 4L53A 3W8LA 5KHXA 5LQFA 5M57A 4RWLA 2HXQA 4TXCA 2BZJA 1YXSA 5AP7A 5M06A 1VKZA 4AX8A 4OUCA 4FEQA 3WOWA 5AUZA 3RKBA 4P7EA 3RINA 4I50F 2CNUA 5EDPA 4M14A 5T68A 3ZRKA 3DF7A 3COHA 5LVLA 2JAVA 2HWOA 4C59A 4CMOA 5CAOA 4BHNA 4KKHA 3EQRA 3HGKA 4DGNA 5M44A 4EWHA 2BILB 4FVRA 4QYGA 3S2PA 2VO6A 5BQ0A 1A9UA 3PLAE 2NU8B 4D58A 3NW5A 4BGQA 4FTRA 5IQDA 3OVVA 4MA5A 2E9UA 2WOUA 1PKDA 3MB7A 2J9GA 4CFFA 2ACXA 2YZLA 3RAKA 3TNHA 1PHKA 1BKXA 1BLXA 4JG6A 4X2GA 4EH6A 5CVHA 4IC7A 3P86A 3G6HA 5CAUA 2ZVAA 3MFRA 4WBOA 2CGXA 3LXNA 3QTRA 2VTMA 4FC0A 4OTIA 3KXXA 5A6OA 2ZDHA 5AUTA 2PWLA 4NFNA 4QMMA 4RT7A 4ZTRA 2NU6B 4FV4A 2ETKA 3BWJA 5DT4A 4ZSJA 3R7EA 3V5LA 3ODZX 3QL8A 4EOIA 2JC6A 3VBQA 5IQEA 2C6OA 3MSSA 3R2BA 4MXYA 5E8YA 2R3HA 4FODA 1H1RA 3QRKA 1IASA 4FSUA 3LFBA 3RGFA 4Y73A 3PY3A 4NKAA 2R7LA 3KMWA 4JDHA 3JXWA 3MIAA 5EI6A 3VN9A 4EHEA 3KGAA 2C00A 5AAEA 3EWHA 2QOQA 3DLSA 1U46A 4TN6A 3V8TA 3GLKA 2FSMX 5HU9A 2VU3A 2J50A 4DFUA 4MCVA 2XNPA 3JVRA 4I5CA 4QMTA 4GCJA 4CCBA 4DEEA 5IISA 3U6HA 5H3QA 4FICA 4CNHA 5EHLA 5DOSA 3AXWA 4ITHA 3C4FA 4MBIA 3U51A 4NSTA 4U80A 3W2SA 4MKCA 4UWCA 3QBNA 2X6EA 3DBDA 3I60A 1AQ1A 3QFFA 1VEBA 3R1QA 5JFXA 5K4IA 2B53A 3EYHA 3OUNB 4BDHA 5M07A 3BHUA 2YYAA 4AZFA 5J1WA 1GLVA 1J7UA 4QMSA 4HYUA 2GNHA 5HLPA 2OFUA 2NO3A 5FG8A 4FGBA 3ZFYA 3VBXA 3NR9A 3HX4A 3FWQA 3PVGA 5IQIA 4CFMA 2UZLA 5HQ0A 3KF4A 4G1WA 2PUNA 4WUAA 1H1WA 5LP6F 3B2WA 3QD4A 5A6NA 3C9WA 4O4JF 1NA7A 3W2OA 4G5JA 4I0SA 4A9TA 1X8BA 2BHHA 3ZO4A 4ZLYA 3OG7A 3FL4A 3VUDA 4AG8A 3WZEA 1K3AA 3MWUA 5CYIA 1VR2A 4C4EA 2VTAA 5HD7A 4F9WA 3EQHA 4MYGA 3R8LA 2F2UA 3NUUA 3F3UA 3ZUUA 2WTDA 4UXQA 4DH7A 4D1SA 4XOZA 4ZTQA 5IA4A 3R5XA 4C35A 4FFOA 1RQQA 2OWBA 2ZM4A 3THBA 3ZDIA 3KAJA 3GP0A 2PUPA 4EJ7A 3FMDA 1OKYA 2VAGA 3UQGA 1U59A 2OKRA 4I41A 4IAKA 3QUDA 4DTAA 4IM3A 2DS1A 3R63A 1STCE 2ITZA 2BCJA 4I94A 4P90A 4Z55A 2GPHA 3A7FA 4EH4A 3CSVA 3D94A 2C69A 4HW7A 4ZQIA 5DHJA 4GT4A 5FQDC 2C68A 4H58A 4TWNA 5HO8A 2XCHA 3QZHA 3AMAA 2O63A 3UJGA 2YM4A 5FEDA 1KOBA 3NUXA 5KMNA 5M4UA 4E20A 2PVJA 3MS9A 3ZUTA 4FV7A 2JKOA 3S0OA 3ALNA 2JIUA 4IVCA 1E9HA 3UMXA 4AU8A 3R04A 4YO6A 3ZBXA 4ZLZA 3ZLYA 3O2MA 4RFZA 5I9UA 3R01A 4BI0A 4DGLC 5JT2A 3EN5A 3OOMA 3D14A 1UWHA 3FJQE 3NAXA 4B4LA 2J0JA 4AFEA 1TVOA 3PE2A 3I12A 2XIZA 1P4FA 2J0KA 3CIKA 4NJDA 5LWMA 2R87A 2RGPA 3Q2JA 4C02A 5AUWA 5I9ZA 2JLDA 2XNMA 1H0VA 3A8XA 4PTGA 3FLZA 5BPFA 1XBCA 2QG7A 3OW4A 1Q8YA 2BZHB 2WEIA 4IQ6A 2JDSA 2P2IA 4QMLA 3PP0A 4J98A 5IQHA 2XK4A 3QAME 5A14A 4ACMA 3DY7A 2V59A 4IIJF 4O82A 4EGQA 4LI5A 3OTVA 4M0YA 4QP7A 1BL6A 4C58A 3PVBA 1R78A 2WMWA 3Q5ZA 4H05A 2HYYA 4BDJA 4EOLA 5DMXA 4K77A 4C34A 1BX6A 4FTAA 5A3XA 4CFWA 5HORA 4FZDB 3P9JA 4QMXA 3VF9A 1BYGA 2ITNA 4QMQA 3F7WA 4ZY5A 1GAGA 2G01A 2IZTA 3QHWA 2EXCX 4PTCA 2R0IA 4DEIA 4EH5A 2W71A 4FTIA 3N6RA 3K54A 3K3JA 5AV3A 2PY3A 3FC2A 3OUKA 1MRVA 1KV2A 2QVSE 3ATTA 4JR3A 4L7SA 4EUTA 1OB3A 3NUNA 3KRWA 2QI8A 3PJCA 1UKIA 3CQEA 3JR1A 3PPKA 5DPVA 4XX0B 3OCTA 1E1VA 5HKMA 3B8QA 3N4TA 3LIJA 3R21A 3R9RA 4BZNA 4NZWB 4I1ZA 5M51A 2VTQA 3V4SA 5HV6A 3CKXA 2UZUE 4JLCA 3Q9ZA 2YRXA 2GPSA 2XD4A 4FFNA 1AUVA 1OPJA 4CFUA 3QQKA 5E8TA 2OICA 4E73A 2GLTA 3HAMA 4MXOA 1JSVA 3F5XA 4WSYA 3VNTA 1PRYA 1Q61A 2PE2A 2R84A 4KSPA 3LXLA 4EHVA 3BHTA 5DYJA 4FG8A 4D1ZA 5CAEB 3BE2A 3EYGA 1JWHA 3PUPA 3SG8A 1W0XC 3HDNA 4P4CA 2WU6A 4GL9A 2C5YA 5AM7A 2R7BA 3BI6A 1YXTA 2ZV8A 1JKTA 3HA6A 3LJ0A 4DG0E 2R7KA 2B9IA 3VS0A 1PX2A 2PHKA 5DT0A 5L3AA 4A07A 4XLIA 4Y95A 2BUJA 2RFEA 5BYYA 4AAAA 5A4EA 3K5VA 3QCXA 4IB1A 2P33A 4RPVA 5HCZA 5HVJA 3HRCA 4GYGA 3OCGA 3UVQA 4ENXA 4B99A 3NCZA 4O0UA 4TYHB 4UALA 3L8SA 4QP1A 4TWCA 3T9IA 4DG3E 4F99A 4MV9A 5L2WA 4B9DA 4M3QA 3HDMA 3R8PA 1PK8A 2F49A 3HO8A 4ZS0A 2OU7A 3EJ1A 2OZOA 4QP9A 4ZLOA 5I9XA 5AX9A 4IFCA 5E4HA 5HVYA 5EW8A 1BNCA 2A1AB 4JQ7A 2NUAB 2PZPA 2GDOA 2Q0NA 2BVAA 1URCA 4GEOA 3V5JA 4ZI7F 3F61A 1I7LA 3MH3A 2C30A 4WKQA 4TYIA 5KUPA 5HX8A 2IVSA 2CLXA 3EN4A 4FV6A 4K1BA 1Q62A 4YJQA 3DV3A 3KU2A 4G6OA 2VGOA 5AP3A 3C4XA 4C33A 3HV6A 1OL6A 3AT2A 2UW0A 2VWVA 4NWMA 2O2UA 4L3PA 4U43A 5KX5F 4RFMA 1KE9A 3K2LA 4LGHA 2VWXA 3CBLA 3BLQA 3LFNA 2H34A 5HLWA 3DLZA 4KBAA 5FTOA 2GFCA 2WMAA 1EUCB 3LFQA 3TWJA 5A4LA 2OJ9A 4GFGA 4K18A 4QOXA 5KMLA 3LOKA 3LFEA 4M67A 3VS2A 2VX1A 2RL5A 2YDKA 4XEYA 3WF5A 1XQZA 1YKRA 3HV4A 1M7NA 2X4FA 3GFWA 3SKCA 2WD1A 2XIRA 2JD5A 3C13A 4RA5A 4IWOA 2CN8A 2JIVA 3CR0A 2I0YA 3DBFA 3R00A 4O0YA 3NS9A 4QT1A 4GYIA 2XUUA 5IG1A 1ZOEA 4WOVA 1JKJB 4RWJA 1LR4A 4FL2A 4ZY6A 5KZIA 2CZGA 1AGWA 3AC2A 1NVRA 1DAWA 1V0BA 1YDRE 1G8SA 2ITQA 4BCOA 4MQ1A 2GNLA 4QP6A 3ORZA 4HVGA 3LE6A 2W5HA 4F1MA 5A4CA 2XKEA 5FEQA 4O6EA 3IW5A 2GMXA 3GEQA 4GSBA 4O0WA 1GGOA 2B1PA 3SXSA 4F7NA 3PIZA 2C5OA 3E88A 2VTOA 3O50A 3E92A 2WB8A 3AX6A 3KF7A 3BELA 2W99B 3GU4A 5CENA 4B0GA 2C0IA 2PMIA 3LKMA 3QXOA 3ZUVA 4FT0A 4A9UA 2PPQA 3ORKA 1I7NA 3VRZA 2Z7LA 2V62A 3LJ2A 2O0UA 3UOHA 5CB4F 2QHNA 2I87A 1ZMVA 3T9TA 5TF9A 2BDJA 4KA3A 4RZWA 4EONA 3ETHA 2J0IA 4LFIA 2EUFB 4XS2A 2XJ2A 3NIEA 2QO2A 4G3CA 4C5AA 3FPMA 5CVFA 5BYLA 3GT8A 3D15A 4ZJIA 5AUVA 4ZMFA 5KMOA 4I92A 4BCPA 4YMJA 2WYOA 4AXAA 3COIA 2Y7JA 5G6VA 4USEA 4EZ5A 2C3JA 3UNKA 3PPJA 1AUXA 1XKKA 4LV5A 4C5BA 1GZNA 2C6LA 3A4OX 4U42A 1CKIA 4C3PA 2CKQA 5LCJA 4E4TA 4YJ2F 1UV5A 5BVWA 5LMKA 4U45A 4GKIA 4I4FA 3HBLA 4ZK5A 4EL9A 2R82A 2VR1A 2Z7RA 1FVTA 1IA9A 3HYHA 3ZYAA 4F64A 2HW7A 3LMIA 1DAYA 2YISA 1U5RA 3DDPA 3LFAA 2ZJWA 2I1MA 5CAQA 5J9LA 4FKOA 4O2AF 3CE3A 2JEDA 4LG4A 4I5MA 5J9YA 5HNGA 4OT5A 3WZJA 2JITA 3R73A 2G1TA 1I44A 4ANMA 2W1GA 4FIFA 5AUYA 1KJQA 4FFPA 1GJOA 2J51A 4I6HA 5CI7A 4DF3A 4HNTA 3W1FA 3HMMA 1IEPA 4MQ2A 4O7VA 2YITA 5C8MA 3L8VA 4L52A 2NRUA 1NY3A 5D11A 3U54A 2IWIA 4YJOA 1E4EA 2VTJA 3EZVA 2XZSA 5LXMA 3ZC5A 3MJ1A 4EH7A 2YERA 2A2AA 4JNWA 4F08A 5GJDA 3Q2OA 4J97A 4DGOA 3M2WA 2HENA 1B6SA 2BKZA 4RZQA 1YOLA 2W6ZA 2YN8A 4ERKA 4U5JA 1MQ4A 1GIJA 4BC6A 3UO4A 1PXNA 3P7BA 1CQIB 4GVAA 4YLJA 3SD0A 2HCKA 4QYHA 3L9PA 1WBSA 3NZ0A 4U0IA 5AJQA 3HL7A 2X8DA 3UO6A 1XBBA 3MV5A 3ZZEA 2I7QA 3DAJA 3IK3A 4EWQA 2W6QA 3U9TA 3DCVA 5IEXA 3HECA 4RIWA 4GRBA 3MVHA 3ACJA 4G31A 1FPUA 3R7VA 1Y57A 4FG7A 2YFXA 4FX3A 3NEWA 4H39A 4XRLA 4PDYA 4LMNA 4HPTE 2VD5A 3VUIA 1Q41A 1ZYJA 3LCTA 4ANSA 1EUDB 2QG5A 4FOCA 3PVUA 3TDWA 4F9YA 3FYKX 3GC0A 4HQ6A 4YBKA 3JVSA 3W16A 5M55A 4ACHA 3E87A 4WUNA 1WVXA 3FAAA 4MNFA 5IQAA 4E7WA 3DBCA 4YU2A 1KEEA 3D2IA 4Y83A 2UZOA 2YHVA 3D5UA 3TIYA 1OPLA 3H9RA 4PV0A 5M56A 4FIIA 1XH7A 5BMSA 3I5NA 5JFSA 5EHYA 3OROA 4ZTLA 3BV2A 3K5UA 4NM0A 3KK9A 2UZTA 2WQMA 4ZTSA 5IDPA 2DQ7X 1HOWA 4FIEA 5CF4A 2J0LA 1PXPA 4FR4A 3KVXA 4ZSLA 4CT1A 3QLFA 2OO8X 5AV1A 4PP7A 4AOIA 3M1SA 5K4JA 3ZSIA 4K33A 4IHJF 1WZYA 1B6RA 3FC1X 5J2UF 4I5PA 3KK8A 3UVRA 2WMSA 5CU0A 3NYXA 3U9SA 3G33A 5CXHA 4EBWA 2OXYA 3WYXA 4GG7A 5LMAA 4BBMA 4USFA 3QRIA 4UV0A 3Q6UA 4MWIA 5JGDA 1W7HA 4RX9A 5CS6A 3VPBA 1OKWA 4MVFA 5DEYA 2IN6A 3V04A 3FI2A 2NU7B 3QXPA 4K11A 3TKIA 4RG0A 5EW3A 5F94A 3K5IA 1YW2A 2CDZA 3PRIA 2ESMA 1R0PA 1OL2A 4FKGA 4N6YA 3R23A 1H4LA 4AT5A 2QD9A 2VTLA 5HTBA 3DB8A 4DBNA 2QONA 3JZIA 3BEAA 3HV5A 3WNZA 3FXWA 3O8TA 4RJ8A 2W7XA 2AYPA 4EQUA 1FQ1B 2VO0A 3KULA 3O7LB 4FV1A 3AT4A 5CWZA 5E8WA 4V04A 5HCYA 1XH9A 3R9OA 4PP9A 4GMYA 2W06A 4G3GA 4IX3A 2WAJA 4TW9A 5DRDA 5GONF 2CKEA 3SHEA 4O7SA 3FI3A 3NNVA 1XR1A 3C50A 3E5AA 3E64A 3FMEA 3NYNA 4O84A 5ACKA 3VW6A 3ZFXA 3ZRMA 3ZCLA 1O6KA 1C30A 5CT0A 2EXMA 3OBJA 3EHAA 2QLQA 3G90X 4IIRA 4R77A 2QR7A 3I6WA 1FBNA 3A7HA 3ORTA 4OW8A 4BCKA 4F9BA 5LVNA 2VNWA 2YWPA 3QGWA 3QRUA 1YXVA 4HYIA 4XYLB 1TQMA 1KJ9A 3K5HA 2W4KA 3L9LA 1BL7A 5IQBA 4YJ3F 3O8PA 1ZAOA 4N6ZA 3DOGA 3P7AA 3BU3A 3E8EA 4J99A 2W96B 3F69A 3E93A 1W98A 4ALVA 4EOSA 2QURA 3VF8A 4ZTNA 2UW9A 3PJ1A 4D5KA 4XG8A 4U7ZA 4KSQA 3GUBA 3UZRA 3NLBA 5L2SA 2BMCA 3ZC6A 3FI4A 3D0EA 5EDRA 3LCKA 1P4OA 3NCGA 3RAWA 4J52A 4G17A 1CKPA 3A7JA 3VMMA 5D1JA 3R7UA 4DH1A 4ID7A 3WF7A 2Z04A 3G15A 2PN1A 2KULA 2RIOA 2W05A 4IB5A 1SNUA 1H08A 3LAUA 3DTWA 4O27B 2J0MB 3HMNA 3QC9A 2PE0A 5EDQA 5H8EA 4IAZA 4EUUA 2PBZA 2QR8A 2VTRA 2VV9A 3O0GA 4MXXA 2E9NA 3UNZA 5JFVA 2BTRA 4YJVA 4ZSAA 3H3CA 3ZU7A 3F9NA 1XBAA 4HR7A 4X2FA 2DWCA 1LUFA 2Y8OA 3P1AA 4WA9A 4X2JA 5AUXA 5CEPA 4ZTHA 1YI3A 3U87A 4WG5A 3QQHA 4RC2A 3BYVA 2ONLA 5LVOA 2XM8A 5FTQA 3EQFA 3RUPA 5IQCA 3K3IA 3PTGA 1FVRA 5CEQA 4KRCA 4BZOA 3UOJA 2EU9A 4MXAA 1GY3A 1RW8A 4AOJA 4BTMA 1F0QA 4CRSA 5EI2A 5FXRA 3E8NA 5ANDA 3RHXA 1PYXA 3ORMA 2RKUA 2YCFA 1S9IA 2J7TA 3UPXA 3GQIA 4W4WA 1T36A 4IB0A 1H01A 4FFRA 4BDGA 5DN3A 5EYMA 3L9NA 3Q9YA 5AV4A 3N8DA 2W6OA 4OTRA 2H8HA 2OI4X 1Q97A 4C37A 5IUGA 5JVDF 3LCOA 1Q8ZA 3FHIA 3Q53A 4V0GA 5E1SA 3L8PA 3OFMA 4XP2A 5JQ5A 3BGPA 1J1BA 3FQSA 3HUCA 4JRVA 4N4SA 2ZV7A 1H0WA 5H80A 3KRLA 5M4CA 4FTQA 1W96A 3VQHA 2YZMA 5JQGF 4BIDA 2FSOX 2J90A 1MP8A 1T46A 3BIZA 3VUMA 5A54A 4B6LA 4C2WA 4P2KA 3C4WA 3O7LD 2FYSA 3LCDA 3VULA 5LJJA 4NK9A 5J95A 2PSQA 2XB7A 3OHTA 3ORPA 3TXOA 4DEBA 3PG3A 4Q5EA 4Y72A 5DR6A 1ZOHA 3ZM4A 2IVVA 4EKKA 5CT7A 4NW5A 2I0EA 3HV3A 4PUZA 2YACA 2FPIB 3LLAA 4CG9A 4D55A 2RFNA 2YM5A 4FEVA 1LEZA 2BROA 4R5YA 1OZ1A 3S95A 2CLQA 3ZO1A 4EOMA 4AS0A 4P5QA 3BBWA 3D7TA 3EQPA 4HVHA 4L7FA 5JH6A 4AN9A 3S1HA 1B38A 2ZDQA 2PVNA 3N9XA 4FOBA 4IB3A 4I24A 1GOLA 4IAAA 4NCTC 4FNZA 4YB8B 2XIYA 3F3ZA 4MD9E 4YHTA 2F57A 4FKUA 4IZAA 3QTIA 4Y8DA 4FUXA 3F5PA 2R3MA 4DC2A 5A4QA 3AOXA 4LMUA 3PA4A 2PVMA 4B7TA 3M42A 3UPZA 4FYOA 4C3FA 1PMEA 1H00A 3OUUA 4YAJB 3Q2MA 2CKOA 3R5FA 1R3CA 2J2IB 5G1XA 3ETAA 1IOVA 2C4GA 2DLNA 2BRMA 4QMUA 1W93A 4XV3A 3I7CA 5E9EA 4HCVA 5H2UA 2B9HA 2UZEA 3AMBA 4EK8A 1OM1A 4ZMEA 4USDA 4L8MA 5FM3A 5B0XA 3JYAA 4APPA 3RV4A 1MQBA 4XMOA 4E6AA 2Z7SA 2ITPA 3UG2A 3DK6A 1Y6BA 1PW2A 5AA9A 2P0AA 2C6EA 4BVUA 2R3FA 4YZMA 4E6DA 1ZXEA 3CKWA 4ZIMA 2FB8A 4CD0A 3GFEA 5CEIA 1JKLA 3DS6A 4K9YA 3ORQA 5DEWA 4MV4A 2Y0AA 3I1AA 4H36A 4NYEA 4GG5A 1FINA 4HGSA 1XWSA 1YHSA 1JSUA 3UIBA 2WELA 3A7IA 3LW0A 1ND4A 4GT5A 2VWZA 1FVVA 4RFYA 4AZEA 3PZHA 3MWEA 3CS9A 3FZSA 3UC3A 2XEZA 3ETJA 3I5ZA 4MV8A 3BGQA 1L3RE 3JY0A 5C8NA 5F95A 4BDCA 2W6MA 4PQNA 2FH9A 3QRJA 4QP3A 2W6NA 4ZOLF 4LM5A 4RIOA 1XH8A 2HZIA 3AC1A 4YTCA 4ANLA 4TYGA 1KJIA 4LV8A 3V8SA 1F5QA 1KV1A 1QMZA 3TEIA 1FOTA 1Q3WA 1IAJA 1W82A 2QQ7A 2YABA 1ZARA 2FSTX 2I0HA 3OBGA 4I6QA 2R0UA 4L68A 4MHAA 5C03A 5C27A 4Y8VB 3RPOA 4RJ3A 4DN5A 3E3BX 1Q4LA 4ASDA 3TINA 4FEXA 3ZS5A 2XH5A 3OXTA 5CU4A 3D83A 3NVKI 3DXPA 3OEFX 3A7GA 3OUZA 5IPJA 3GC7A 4XCUA 4E4LA 2ZYBA 3QTQA 4H3BA 4Z7HA 2IW9A 3F5UA 2LAVA 3QQFA 2RG5A 5DLSA 2JIIA 4AZWA 4O0XA 4ASEA 3R7OA 3V6RA 2XK3A 3BHVA 3FKOA 3KMUA 3V5PA 3ENHA 2W1DA 4QP4A 3UIXA 3V8WA 1E1XA 4ZSGA 4X6RA 1W84A 3PSDA 4ALWA 4FTLA 4I3ZA 3QKMA 4MV1A 4TWOA 4R3RA 4KKEA 2YM7A 3QKKA 5EM6A 3G0EA 3FYJX 3G6GA 4I0TA 3UMWA 4E26A 5HEZA 2R3PA 2CKPA 3ALOA 3MY0A 5IMXA 4ACCA 1EZ1A 3VVHA 3QCQA 3P4KA 5JZNA 3RP9A 2GU8A 3LM0A 3TNWA 4YNOA 4AT3A 5I0BA 4JT3A 5AEPA 4E4XA 2JDVA 3NNUA 4CVAA 4FE2A 2UW5A 4DLKA 2F7XE 1ZLTA 4YP8A 4CFXA 4S2ZA 3H0YA 3IDBA 3EQGA 4V01A 1VJYA 2W9ZB 3ANQA 3TJDA 2JDOA 5DWRA 1YHVA 4D2SA 2DZDA 2QF7A 3KN5A 5I4NA 3SVVA 3KCKA 2X0SA 2HXLA 3E8CA 2PVFA 1UKHA 4IZYA 2W1EA 3LP8A 4F6WA 1JDEA 3LFFA 3NDMA 5L2TA 2HWPA 2X9FA 1SM2A 3BQRA 2XRUA 3DAKA 5CXZA 3R2YA 5L2IA 4EKLA 3VS4A 4E5AX 2W1CA 5D8DA 3V5QA 1Y8YA 3EQDA 3V01A 3FL5A 2YS6A 1PF8A 5AFVA 5H8GA 4EK4A 2E9PA 4RX8A 4AN3A 4TL0A 4XHKB 4MK0A 3MTLA 4TKSA 3GGFA 4AGCA 1MRUA 4M68A 5CSPA 4BN1A 3E62A 1OKVA 1PXOA 4D9TA 3Q4TA 3ZEPA 4BYIA 3KB7A 2CGWA 4C62A 4ARKA 5HG5A 5IQGA 5CX9A 5BMMA 4FL1A 1OIYA 3EFWA 4R7BA 4BY9E 1TQIA 5DR9A 1M7QA 3R71A 3KA0A 5IUIA 2W1IA 3CD8A 1W83A 3JY9A 4H3QA 1SNXA 3T3UA 2C1AA 3A99A 5FXSA 4WRGA 3ORNA 3IGOA 3OZ6A 5EK7A 3Q3BA 4F9CA 5J87A 4FKLA 4PDOA 4F1OA 5HNBA 4KIPA 2O5KA 3D2KA 4JVGA 4CZUA 4CFNA 4DGGA 3OW3A 5ANEA 2PU8A 5EOLA 2C6KA 3OCSA 1S9JA 3ZHPC 4L43A 3ZTXA 1M0TA 4R7IA 4BIBA 4S31A 1J7LA 3F5GA 4EOJA 4A4LA 1SZMA 2OXXA 1REJA 4RVMA 2B9FA 2UVZA 2VPQA 3VPCA 3P5KA 4N57A 1UVRA 3DXNA 4FU0A 5TT7A 2WTJA 3FMNA 4IW0A 2B4SB 3RNIA 4BCHA 5CEKA 3R9NA 3PRFA 5KHWA 1NXKA 4O7ZA 5LXTF 1PKGA 4IJPA 4R6VA 5L8LA 4O0SA 2WPAA 4HCUA 4EHGA 1GSHA 4GU9A 5IF1A 2QU5A 4UBAA 2I8CA 4GS6A 4U6RA 4O2BF 4ANBA 3UQFA 4HNUA 3JPVA 3KRJA 4PWNA 5M09A 4EK6A 4BR3A 2GTMA 1ZRZA 2X39A 4B8MA 4DH5A 4O4IF 4FIHA 4CLJA 3ZO3A 3C51A 3W2QA 2ITOA 2QO7A 3O96A 1PXJA 3ORIA 3QYZA 4FEUA 4YO4A 4AE9A 4IWPA 1GIIA 2WEVA 5DVRA 4YTIA 3S3IA 4NFMA 2GSFA 5JSMA 2C0TA 4OTWA 5B7VA 4AW0A 3QZGA 4I5HA 1WBOA 3GCVA 5HE1A 1QPCA 1E4EB 3G9NA 4A4XA 1U4DA 5C01A 4FKWA 5JZJA 4DFNA 4L46A 2CCIA 3F2NA 1KSWA 5A46A 2QOCA 4BBEA 4OT6A 3I4BA 3OXZA 3BV3A 4S33A 4BDBA 5CF8A 4XZ3B 4C2VA 3E63A 3MWDA 4R78A 3TCPA 5IA1A 3V4ZA 3QCYA 3DNDA 3BLRA 1OMWA 2WFYA 2E9VA 1YWRA 2X2LA 2V7AA 3LFCA 3GNIB 3PWDA 4PMSA 4IM0A 2VWUA 4F09A
chains in the Genus database with same CATH superfamily
1OVEA 1NVSA 2A1HA 4O6LA 2V58A 1B39A 5CA1F 4II5A 3EN9A 3MY1A 4FNWA 3BU5A 2XA4A 2ZFYA 4FL3A 3KFAA 3FZRA 3ORXA 2HIWA 4QP2A 4RIWB 3RALA 3ZDUA 5I5ZA 2ITUA 1XMLA 2R3LA 3R7IA 2WKMA 2ZDUA 3W1BA 3F2RA 5AP1A 4J71A 4LL0A 3GVUA 3E3PA 4ZS4A 3R1SA 1CTPE 2AC5A 1ZY4A 1DGSA 4X3FA 2EIYA 1JQHA 1UNGA 4JBPA 5CSVA 4JQEA 1A9XA 4YJRA 2F9GA 5CQUA 3CD3A 4ZXTA 1Y91A 1KOAA 3LQ8A 4MAOA 3CEBA 2Z2WA 2GS2A 5C1QB 5EZYF 4ANQA 3ZLXA 2UUEA 3DB6A 3QCSA 4ZHQF 3LM5A 3TW6A 2NPQA 4FSYA 3WZKA 3MH2A 3VO3A 3TIIA 5LCKA 3GENA 1PYEA 2RFSA 2XM9A 5IEYA 5IQEA 3VC4A 2UVYA 1WBWA 5B2MA 1T45A 3SW4A 3D4QA 4IJ9A 3AD5A 3HV7A 2XYUA 3A61A 4XBRA 2XCKA 1XH4A 4C4HA 5KKRB 3GU7A 1SMHA 3SOCA 3NUPA 3BZ3A 3R8ZA 3TTJA 5FP6A 4F63A 3LCSA 1V0PA 3BLAA 5TOZA 3OCBA 5EHOA 3QF9A 3UP7A 1OI9A 3TV7A 4FK3A 1RJBA 2W5AA 3DJ5A 4Q4CA 3G5DA 5K9IA 4X21A 3HKOA 4DAWA 3SV0A 2O65A 1M52A 3PG1A 4BTJA 5HI2A 4U3YA 2JBPA 4QRCA 2OLSA 3R9DA 3GDEA 3KULB 1UU7A 4FIJA 2R3KA 3IS5A 2YWVA 3R7YA 5BVNA 3BA8A 3BGZA 4AW2A 3RV4A 3ATSA 1ZWSA 2Q0BA 4BKJA 4KABA 4RC4A 3GC9A 1H28A 1PXIA 3UQCA 3AD4A 3F3WA 3VQUA 3A2CA 4ORKA 3U4WA 4MV7A 5CEOA 1M0WA 4ZP5A 4B8LA 5EH0A 3SE7A 3UYTA 2XAMA 5AP2A 3MPTA 4BDDA 3QD3A 2YJSA 4U44A 1H25A 4A9YA 4DFZE 2X7OA 3OMVA 4DCAA 2FA2A 1HCKA 4XG2A 4YJNA 2X8EA 3GCSA 4K0YA 1SYKA 3CGOA 4I6FA 2PULA 3ROCA 4ZAUA 4FTKA 5ANGA 4J95A 1KBLA 3ZRLA 3C0IA 4RSSA 3KKVA 1JOWB 4U8ZA 4BDEA 3PPZA 4QP8A 4CKRA 4BI2A 2IW8A 4AWIA 5IA0A 3WILA 4MAMA 2E9OA 2ETMA 5JRQA 4AW5A 3TQTA 4FT3A 3LPBA 4O4HF 5E8SA 5GHVA 3NC0B 5J2TF 4IH8A 4YR8A 3PA5A 4F6UA 3LLTA 3R1YA 1H07A 5GIPE 5HE3A 5D1OB 5HCXA 3NRMA 5CAPA 3LZBA 5AX3A 5AIRA 3AC4A 3GOKA 3A4PA 3UDSA 2YIWA 2OF2A 3BQCA 3HZTA 5AAFA 3IG7A 4CG8A 4DH3A 1GSOA 3CP9A 3H9OA 5FUTA 2X8IA 3Q32A 4IVBA 4PRJA 5EKOA 4A9RA 2BZIB 3RK7A 4QMVA 4UY9A 3RJCA 1W8CA 1QPDA 5E91A 2Z7QA 2OWOA 5A9UA 5BUJA 3U6IA 2BIYA 2DIKA 4QMYA 4FT9A 5HD4A 3MDYA 4M8TA 3VAPA 3ZONA 5BVOA 2OH0E 2R3JA 3NWWA 4R3CA 4G3EA 5GNKA 4F0IA 3RTPA 1ZAUA 2YIQA 2A4LA 4LGGA 5IMEA 5J1VA 2I80A 1JNKA 4FVPA 3U55A 3A62A 4PL3A 2VWYA 3MVMA 3VUGA 3BACA 1KC7A 4RMZA 2I6LA 1VYWA 3R8MA 1H1QA 3C5IA 3WWHA 4FSZA 3KMMA 3FLNC 4DEAA 1LPUA 5E8VA 4QMZA 1KE6A 4XG9A 4E8AA 4BCGA 1GIHA 4ENYA 4TRLA 1FGKA 1M2PA 2W1HA 3VS6A 2BAQA 4V0GB 4RRVA 4EH8A 4BHZA 1Q8UA 2BALA 3KRRA 2UW8A 1QPJA 4ACGA 3CTHA 1YI6A 4L67A 3T7AA 4FFLA 4EC8A 3UFXB 5LMKC 3C0GA 3POOA 3PE1A 2HZ4A 3AT3A 2R3QA 4JDKA 3NX8A 3D5XA 1OUKA 3F3VA 1J7IA 1YQJA 3NPCA 3ZO2A 3JS2A 4QQ5A 2R3NA 4RBLA 1P14A 2HK5A 4JL9A 3ZM9A 4OTFA 3TKUA 4HOKA 1JVPP 3PXZA 3HVCA 2XNNA 4U9AA 3WF8A 4DRFA 3FZTA 4ZEGA 3SLSA 4OGRA 2R5TA 3IECA 1R0EA 4O0TA 5DIAA 4AXDA 2BFYA 3WZUA 4NU1A 1ZMUA 4KD1A 5HESA 2ZDTA 3G9LX 4YBJA 5AWMA 3WE4A 3WWJA 3FZOA 4ZZNA 5JGAA 4RA4A 2HELA 2QU6A 5DR2A 4GK2A 3FMJA 2EWAA 2XS0A 4C4FA 1H1SA 2IW6A 2W1ZA 3OEZA 2XNBA 5BUIA 4IWYA 3TY9A 4DYMA 3G8CA 3D7TB 3IGGA 5ANKA 5CAVA 2IP4A 4TVIA 3IW4A 4N70A 2PVRA 2WQEA 4LQMA 4L3LA 3ENMA 5KBQA 2QK4A 2YS7A 1AD5A 4CTBA 2X6DA 4AFJA 2YDIA 2Q2UA 2GHLA 3W33A 3HT5A 3CPBA 4EBVA 2R3GA 3NMUF 4EOKA 4DINA 4FKRA 3DNEA 3Q6WA 3QUEA 4F4PA 2Z8CA 3Q52A 3IQ7A 2GQSA 4RWIA 5GIOE 3UE4A 4F70A 5KKNB 3RVGA 3WBLA 1EYZA 3MN3A 2VZ6A 5FDPA 3ZOSA 5CU3A 4EG0A 5HICA 1A3GA 2WTWA 2B55A 4F6SA 4FI1A 3L8XA 3FV8A 2B54A 2CN5A 3QTSA 4IVDA 5JRSA 2XP2A 3ML1A 4C4IA 2G2FA 3GU5A 2R7MA 4QMNA 3KY2A 3NUSA 3DTCA 2YIYA 2OW3A 3UVPA 4CMUA 3QX4A 2RF9A 1TQPA 5EQYA 5L6WL 3BPRA 3EKNA 5AAGA 3QWKA 3TZMA 3U9CA 3RPVA 3RFCA 3KN6A 4M7IA 1SCUB 3T8OA 5E25A 4KUJA 4D4VA 2B52A 2XVDA 1UU9A 3E7OA 3MY5A 3Q5IA 3QQGA 2Q83A 3DBEA 4YSMA 1KT8A 1QL6A 4KWPA 4YNEA 4IZ7A 3Q4UA 5HU3A 4MNEA 4GFMA 1YWVA 1JKSA 2WIPA 3O8UA 5HO7A 2VWBA 2A19B 3TL8A 2ERZE 4E6NA 3QTXA 4G16A 3OXIA 3QRTA 5LMBA 5EM5A 1PXLA 4JI9A 4W4VA 4PZ6A 2UVXA 3MTFA 3F7ZA 1DI9A 4NJ3A 4PDPA 5AP6A 5T3QA 3JRXA 4DDIA 2BPMA 4RX7A 3QGYA 3IDPA 2JFLA 4RWKA 3R02A 2UZBA 4K8AA 4OBPA 5CSWA 4YLLA 2A27A 3PVWA 3NUAA 3ZMMA 5ITAA 4OBQA 5I5VA 4NM3A 4KNBA 3W0QA 1TAEA 5IA5A 4U40A 3GB2A 1IAHA 4HGEA 4ME6A 4TYJA 4QNYA 3L2PA 2HGXA 4O7YA 5C4LA 1XHAA 3IW6A 4S34A 3QD2B 4FIGA 1VLRA 4JG8A 1BI8A 4HVSA 3LMHA 4YAKB 3VJOA 1ST4A 1CKJA 2C3LA 3QZFA 5M4FA 3BBTB 3DU8A 2CNVA 4YHJA 4XV9A 2I40A 4OR5A 4YJTA 5CALA 4M0JA 1LEWA 5KO1A 1ET0A 1GZ8A 2RFDA 3OP5A 4IAIA 3MA6A 3BYSA 4LH6A 4FEWA 1YDTE 4E6QA 2R64A 3RK5A 1FVIA 4YZBA 4E4NA 1G2WA 3BRBA 2PUUA 2WGJA 4FV5A 1I09A 2PZIA 3Q60A 3R5HA 3GI3A 1YWNA 3FE3A 3FI8A 3ANRA 3FMMA 1ZYDA 3COKA 4QYFA 3RM7A 3HA8A 2WMRA 4O2ZA 3TMOA 3VS7A 4DLIA 3FPQA 5HE0A 2IVUA 5F20A 2WTKB 3R6XA 3SAYA 3LVPA 4RVTA 4IX6A 3ZBFA 2GS7A 3DZQA 2JKQA 3PXFA 3I81A 3UODA 5CTPA 4BRXA 3TJCA 4CKEA 3F3TA 2UW3A 4JIKA 3W10A 4AA4A 2YL2A 5HBRB 4Q2AA 4U97A 4AQCA 3P78A 3VS5A 4AZVA 3CJFA 2R86A 3C1XA 3WZDA 4XYMB 3KEXA 5JVLA 2HOGA 1YRPA 2BKKA 2WZJA 4G3FA 3ORLA 5CVGA 3ZXZA 4FSTA 4FV9A 3L9MA 4P5ZA 5DG5A 5IH6A 3FDNA 1DV1A 1O6YA 4J53A 2FVDA 3CEKA 2Y9QA 2YCSA 2R4BA 5HGIA 3SGIA 5JQ8A 2XK7A 2XK8A 3ZSHA 2CGUA 2OFVA 4J7BA 2OK1A 4W4XA 3MPMA 2GS6A 5JGBA 4MEDA 4WG3A 1CKNB 2ZV9A 3HMIA 3EMGA 4G2FA 4AGWA 4CRLA 3ZEWA 5E8XA 3A60A 3OD6X 4IEBA 4O7WA 3P23A 4AZTA 5HTCA 1VBGA 1BI7A 3MPAA 5B2KA 3WIKA 3BABA 4G6NA 1NW1A 2W9FB 3C4EA 3EZRA 4MXZA 1R39A 3KXHA 3O51A 4DIMA 5L6OA 4UZDA 5J8IA 5LARA 1KE7A 1PY5A 3V5WA 1EKFA 2VQDA 4DT9A 3VBTA 4GK3A 4WBBB 1OECA 2V7OA 2YCRA 3DK7A 4IDTA 5IYZF 2XKDA 4EK3A 2SRCA 3B8RA 2X5RA 5BX0A 1K9AA 2HDKA 1VYZA 3W32A 5EYDA 3OT8A 3BYMA 5KBRA 3QD0A 4KRDA 5CZHA 2VUWA 3H30A 2IPXA 4QNAA 4XYFA 5H9BA 3WIGA 3SDJA 5ETIA 3PFQA 2IZRA 3U6JA 3I7BA 1VZOA 4QPAA 1HCLA 3QWUA 1V0OA 2GQRA 4Y5HA 1O9UA 1M14A 3UYSA 4I6BA 5C9CA 4LOOA 2PVYA 3AC8A 2XALA 5JH7F 2WQNA 1K2PA 2HW6A 4I23A 1IYDA 2OGVA 3KXGA 3VW8A 5M4IA 4HVDA 4QPSA 5KMKA 4GVJA 4AXEA 4BDFA 2VO7A 4F7JA 2VNYA 4QDVA 5F9EA 2QKRA 4FSWA 2WOTA 4L00A 2ZM3A 4TWPA 3PJ3A 4YPSA 1DAAA 5LWNA 1FGIA 3EN6A 3QQJA 3OY1A 1J1CA 1IG1A 2FO0A 3EQCA 5K5NA 2XK9A 2DWBA 2PVLA 3I0OA 4MA0A 3GB8B 3MH1A 3EIDA 2C6IA 2CGVA 3BX5A 3HAVA 4QTCA 4NTTA 3R9HA 3TDVA 3SRVA 4JBVA 3KL8A 5FBNC 3EFLA 3GCUA 2R3OA 3NIZA 4FKTA 5EKNA 3UTOA 5T6KA 1DS5A 1JLLB 3TTIA 3F88A 3PSCA 2V55A 3R28A 2EB2A 4FTNA 4S32A 5TR6A 4F7SA 3K3PA 3OY3A 4XX9A 3C5UA 2C6TA 5AMNA 4KKGA 4QTEA 4YTFA 4GH2A 1CS0A 4YBZB 4TZRA 4RJ4A 1BUHA 3CQWA 3RMFA 1VBHA 2V5QA 1UNLA 2J5FA 5GINE 2X7GA 2ITTA 2FGIA 3F66A 1ATPE 2BDWA 4XP0A 3HP5A 3W2RA 2QOBA 1WFCA 2VWWA 3V3VA 2GNFA 4X6QC 3DKFA 4DE4A 3GIDA 1G5SA 3LFSA 2ZGIA 3B2TA 3QYWA 4G6LA 4ERWA 2HAKA 3G51A 4R1VA 5C8KA 4R3PA 3S4QA 1A0GA 5FPRA 1C3OA 1M6VA 4DTKA 2QOOA 4BCNA 1NT2A 2JKMA 1Z2PX 4GLWA 4CC5A 3NNXA 4PMTA 5E92A 4WNMA 4BCJA 3JSLA 3UQ8A 4XG6A 5DI1A 4DITA 4ITJA 3NAYA 5F4NA 3P0MA 4UFZA 2WMQA 3TT0A 2SCUB 5BYZA 4WNPA 2ITVA 2XNEA 4HNFA 2HZ0A 3PXKA 2G9XA 5CLPA 2Z60A 5E90A 1IRKA 1OIRA 4DH8A 3QZIA 4DHIB 3TN8A 4BCFA 3OWPA 4YZNA 2R87A 2P0CA 3P79A 5HNIX 1PMVA 4J8NA 3E8DA 3QLGA 4D2RA 2ODTX 4X3FB 2QLUA 3AKJA 4YHFA 5AA8A 3NNWA 4RX5A 4M84A 2X81A 2PK9A 5EG3A 4AE6A 4FA2A 2PL0A 3QC4A 5LOHA 3LQSA 2PZ5A 2BAJA 4Z7GA 3D5VA 4MV6A 4LYNA 3DQWA 4O7TA 3W8QA 4IC8A 4M9UA 2B7AA 3PIXA 4EGJA 1WBTA 4HCTA 3AGMA 2PMOX 3II5A 3IOKA 5ANIA 2J9MA 3QTUA 4HNIA 3V6SA 3BWFA 4GIIA 4U81A 3HMOA 3M11A 4FUYA 2HVQA 1WBVA 3POZA 5HBJA 5C1PA 4U41A 4CSVA 1TKIA 4IBMA 5GJFA 3PIYA 1OGUA 4QMPA 4UYAA 2WNTA 4F65A 2C47A 1WR2A 2P3GX 5DNRA 4UYNA 5H8BA 4IWDA 1LP4A 3TUCA 2YZNA 3RPSA 3VBWA 5HE2A 5FBOA 3VRYA 3MBLA 4CEGA 4RIYA 3ZLWA 2Y6OA 1I1MA 1R1WA 1UU8A 5A4TA 5KZ0A 4QQJA 5HG8A 4RJ7A 4FV0A 1CKMA 4MX9A 4DT8A 4X3JA 4FZFB 4GT3A 4NZNA 4JG7A 2R3RA 4CV9A 4FYNA 1J91A 3N51A 4XV2A 5KMMA 3HEGA 3GQLA 5CSXA 2F7EE 3U8WA 1Q3DA 4JMQA 1CQJB 3QWJA 4HVIA 3FXXA 3PN1A 1IYEA 1QPEA 3W18A 3H0ZA 4MV3A 2CCHA 2BDFA 5L8JA 3VUKA 4BYJA 4M15A 4NL0A 4C3RA 4F9AA 3FKLA 3TZ7A 4CMTA 2YAKA 1I1KA 4O91A 3AD6A 3WF6A 4FSQA 2WTKC 4DTBA 1UNHA 4IADA 5BPHA 3DK3A 2C6DA 4I4TF 1G3NA 4HZSA 3IW8A 2WTCA 4XUFA 2ZDGA 1O6LA 4NT4A 5LVMA 2OF4A 4MBJA 2PVHA 3CTJA 3WE8A 4LOQA 1OBGA 2XIXA 3ITZA 4XRJA 4JX7A 4I6LA 2BIKB 4OBOA 4DCEA 4JR7A 3ZZWA 3CTQA 1JBPE 4FT5A 4C7TA 1CSNA 3IKAA 4TNBA 3P7CA 5BMVF 4BCMA 5HG9A 4JDIA 4NM5A 4WT6A 3IO7A 4FKIA 5AP4A 3FHRA 4FT7A 2R3IA 2WTVA 4JAJA 3W0NA 3CC6A 2XNOA 2W1FA 5JKGA 4F0FA 1H24A 3IONA 3VOTA 4C4GA 2CMWA 2IG7A 4JXFA 3EFKA 5DFPA 5CF6A 1EHIA 2YAAA 3EL7A 3EKKA 4IVAA 1H8FA 4WNOA 3RWPA 2XANA 5AV2A 3TZ9A 1KE8A 4BTKA 5I9YA 3KRXA 4BCQA 1ULZA 4BF2A 2YRWA 3Q4ZA 5BWUA 4DGMA 2C0OA 1YXUA 4D0WA 3RCJA 4AA0A 2XJ1A 5C4KA 4CCUA 5TKDA 4FMQA 1Q5KA 5DT3A 3PJ8A 3CCNA 3RI1A 3MFSA 3TNIA 4IHPA 4I93A 3GOPA 5L8KA 3QUPA 2X2MA 4X2KA 3SOAA 3TV4A 2O64A 3MVJA 5KMJA 4FZAB 1F3MC 2ZOQA 4O81A 4TYEA 4ZJJA 3SXFA 3TYKA 3ZFMA 3BA9A 4QTAA 4EQCA 4WIHA 4GW8A 3NBYB 4Y46A 3DFCB 3H4JA 3IW7A 4TNDA 4ALUA 1Q99A 2OSCA 4CV8A 3FEGA 3T3VA 2VGPA 2YIRA 1ZZLA 3PXYA 3D5WA 3F6XA 4AGDA 4OLIA 3BYOA 3MVLA 3AQVA 5DAAA 4RZVA 4A7CA 4J1RA 4KIQA 2WMUA 2UW4A 4O38A 5JEBA 5J5SA 2P4IA 1ZYSA 5EQEA 4RLKA 5M53A 3FQEA 4AOTA 1ZZ2A 3LHJA 3UG1A 5CY3A 4NM7A 3UO5A 4QQCA 2XARA 3ID6C 5BYAA 3Q04A 2YZGA 4YPDA 3ZLSA 2XNGA 3R8VA 4IWQA 4NH1A 3SXRA 5DA3A 3TACA 2J4ZA 3EQIA 4BGGA 2PYWA 3VWAA 2P2HA 3UZBA 4RIXB 2WMVA 4G9CA 3RR5A 5KNJA 4JJRA 3C7QA 3LQ3A 1Z57A 2R7IA 4GKHA 1EKVA 2UZDA 4FVQA 3PY0A 4NZMA 4AP7A 5BUEA 3PZEA 4O0RA 4FNYA 1H27A 2UZWE 2QOKA 4WNKA 3UIUA 2GHMA 2WTIA 5AADA 5FNVF 2OH4A 2X0GA 3PXRA 5DH3A 5AP5A 4DEDA 2JFMA 2X2KA 4JDJA 4Z16A 1EH4A 3FMLA 4GUBA 1GSAA 4CMDA 3OOGA 1YXXA 3I0QA 4ZSEA 3MH0A 1OBDA 3FZ1A 3VJNA 4RVKA 4CFVA 1M2RA 5D9HA 4EK5A 1WBNA 2BTSA 3GU6A 4MD8E 3R0TA 5BVFA 3BHYA 3QALE 5K5XA 5DRBA 5KE0A 2BRGA 3O17A 3PP1A 2QCSA 2GNIA 3BYUA 3GXLA 4OTHA 5EFQA 3QQMA 1L8TA 4BI1A 4E5WA 2EJ3A 4HJOA 4ZOGA 3FUPA 4AACA 4L42A 1OL7A 2BAKA 1JAMA 5EW9A 5AM6A 3UGCA 3VONA 3VS1A 3AGLA 4ZZOA 3RM6A 4E6CA 1G8JA 4DDGA 3MYGA 4MH7A 3WARA 3CGFA 1WAKA 5IH4A 2PBZA 3RCDA 1URWA 4L9IA 2VTTA 3FKNA 1YDSE 3ET7A 3DTGA 3HNGA 4FTOA 2BFXA 4JOAA 2PMNX 2FUMA 2UZVA 4OTQA 3DJ6A 5E8UA 4GFOA 4PMPA 5CF5A 4O4LF 4Q9SA 2HY81 3C0HA 2ZM1A 4EEVA 1PMNA 3C4ZA 4FTUA 1U5QA 2IVTA 3RAHA 3KXMA 1Z2NX 4IM2A 3MGYA 4EOQA 3H10A 2QC6A 4D4SA 2FPGB 1DM2A 1MUOA 1ZMWA 3TI1A 2GPWA 4W8EA 2LGCA 2WMTA 5AV0A 3LULA 4FV8A 3BCEA 4UX9A 3R83A 3CLYA 4LV7A 4BIEA 4EH9A 3NYOA 5EYCA 3QX2A 1YI4A 4CZTA 5IDNA 3HB9A 4L6QA 2COIA 3WWIA 4FSRA 1A06A 4RQVA 4PF4A 5BV3A 3FBVA 3WF9A 3CY3A 2EB3A 2XMYA 4X0MA 1B6CB 4PMMA 3ODYX 4X3FC 5CNOA 2BR1A 4XG3A 4BCIA 4BDIA 4BDAA 3FZPA 4IMYA 4YURA 4XG4A 3N4VA 4DG2E 4EOOA 4NIFB 2OJFE 4M12A 4Q9ZA 3D9VA 4H3PA 5ETFA 4BJJA 4GU6A 4MNEB 4FKPA 4RJ6A 3KQ7A 4G9RA 4RGJA 2C5VA 3TV6A 2JDRA 2OLCA 4Z3VA 4O21A 4WBNF 5HBHA 2ITWA 1ZYCA 2G15A 3HMPA 4FSMA 3VBVA 2HIXA 1PJKA 3OWJA 3Q4CA 3GCPA 4CKIA 4Y85A 4D1XA 2OIDA 2PZYA 3KAKA 1Z5MA 1ZOGA 2QODA 4QDEA 1UC8A 1Y6AA 2W4JA 4D4YA 4XJ0A 3NUYA 4PDSA 4QSHA 4GJ2A 5BVKA 2QOIA 4JRNA 4L1KA 2GHGA 3COMA 3EB0A 4FKQA 5IEVA 1CE8A 4L44A 4XBUA 2R7NA 4LDTA 3DT1A 3ELJA 4KAOA 2YDJA 4AGUA 2VTHA 3QA0A 3DBQA 3Q9WA 3ULZA 2ETRA 2XEYA 2UW7A 4H1JA 4MTAA 4F7LA 3PDTA 3T9BA 2O8YA 3CPCA 2QHMA 4MBLA 4W4YA 3ZXTA 5FM2A 3TIZA 4AAYA 3ACKA 5JN2A 2NU9B 4Q4DA 1XJDA 2FPPB 4BGHA 3TEKA 5L6PA 5DE2A 4ZTMA 5LVPA 1ZY5A 2CNQA 5HBEA 4O96A 3AKKA 5ETAA 4D9UA 3BEGA 3U9NA 2XBJA 2V5AA 2GNJA 3DPKA 4FKVA 4C36A 4EH3A 2V0DA 1DIKA 4NUSA 5IH5A 2ZB1A 2DYLA 3MB6A 2W0JA 2QKWB 4QTDA 5E8ZA 5K3YA 4DHFA 4F78A 3EFJA 5CE8A 4J96A 4WG4A 1G8AA 2VX0A 3WYYA 3OT3A 2WU7A 2C3KA 5HHWA 3WI6A 5JMSA 4G5PA 4TY1A 3MESA 4FV3A 3G2FA 4IAFA 4APCA 1DV2A 4FZ6A 4O83A 3EL8A 3TM0A 4DFXE 5I60A 4G34A 3TNQB 3ULIA 2Z02A 2IZUA 3Q96A 5I9VA 5J7HA 1BMKA 3HLLA 3QKLA 5TO8A 4YSJA 4LOPA 4M13A 3BLHA 4Y5QA 4YLKA 3EN7A 4Z9LA 2PE1A 3QTZA 4TV9F 4JAIA 3FLSA 5D12A 5M08A 2PTKA 5JFWA 1S68A 2XKCA 3QFVA 3HP2A 4FV2A 4M69B 5HX6A 3F82A 2X7FA 1XO2B 3O23A 5BVEA 3PLSA 1V1KA 1OL5A 1WVWA 3KVWA 3R1NA 3VBYA 5BWXA 1P2AA 4TTHB 4NTSA 4LL5A 5IZFA 2ERKA 1Q8TA 2H9VA 3DAEA 4GJ3A 3W0RA 1OKZA 4EI4A 2ZMDA 4JBQA 4DHJA 3WO1A 4BB4A 1WMKA 4FFMA 4IWXA 2QO9A 2JAMA 3V5TA 4LUDA 4KS8A 2QOHA 3NSZA 1Z2OX 5I5TA 4UWBA 4EYJA 3LMGA 5IUHA 2X1NA 3QQLA 2BRHA 2VTIA 4HNVA 3QTWA 4RIXA 3DKGA 4JQ8A 4NW6A 4UCTA 2R2PA 2PVPA 1FMOE 4YJSA 3O71A 3SQQA 3I6UA 3RAIA 5HLNA 5KX8A 3SA0A 4WHZA 1XH5A 2ZMCA 2V22A 3IOPA 3R30A 3W2PA 4QTBA 2ZAZA 2HJWA 5FP5A 3KCFA 4IAYA 4RC3A 4O22A 3V51A 2H6DA 3CJGA 3DA6A 1GZKA 3KXZA 2ZB0A 4AF3A 2GFSA 1KJJA 4IACA 4IX5A 4CT2A 5HIBA 4CQEA 2C5XA 3AW8A 3CY2A 1PMUA 5ICPA 3FMKA 2A0CX 5JQWA 1PXKA 3FSKA 3LXPA 4XLVA 4HN2A 4MD7E 5I5UA 1H1PA 3SGCA 4KBCA 4ONAA 1J3HA 4K2RA 4HZRA