3NUAA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from clostridium perfringens
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
236
structure length
236
Chain Sequence
AMVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFGRYNGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal Structure of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase from Clostridium perfringens
rcsb
source organism Clostridium perfringens
molecule tags Ligase
total genus 84
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuaA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3nuaA02
1YW2A 4RC2A 1MP8A 4IWOA 3R8UA 2VGPA 4V0GB 1M0WA 4RZQA 2XP2A 3O8UA 4TYGA 5AM7A 2X1NA 4U0IA 2VU3A 2P0CA 3KFAA 5EM8A 5HHWA 1TKIA 2W7XA 3KXHA 1FBNA 4J7BA 4G3GA 2W6NA 1LP4A 3GC8A 5KX8A 3BU3A 4BN1A 4XLVA 3ZSGA 2XK7A 4B4LA 3R21A 4PL5A 1J7IA 4FYNA 4O7TA 4BCNA 3JZFA 2OJGA 3I5ZA 3L8VA 4A4LA 4YZMA 2AUHA 5E8XA 3PA4A 5HVKA 3V5TA 5AX3A 5I0BA 2BZJA 3MS9A 3R7EA 3CY3A 5CA0F 1CKPA 4P7EA 3NVKI 3NUSA 3ODYX 3EL8A 4L9IA 2OG8A 4WO5A 5A14A 2QR8A 3TNWA 3QLGA 4AGWA 5EM5A 3UVPA 2YABA 4MNFA 3ORRA 2X7FA 1OZ1A 3QRIA 4FFMA 4WOVA 2W17A 3VUGA 4ZZOA 5JK3A 4DG3E 4FTRA 5LVPA 2CGUA 4RX5A 4YTIA 3AD4A 3L9PA 2Q0BA 5KHXA 1CS0A 3R8PA 4ZSAA 2DWBA 3RPRA 3CKXA 4YJTA 5ETAA 5L6OA 3R7IA 1OL2A 3FZOA 3QXPA 2OW3A 3PVUA 5L6PA 2VNYA 1YVJA 1Z5MA 2XIZA 3K5UA 3OVVA 4NT4A 3GU8A 3ZXTA 4UN0C 1W93A 2BHEA 3D83A 3G2FA 4IB0A 4WBOA 3ZS5A 1UKHA 4V01A 3NYVA 2W05A 2PUIA 4F6WA 3H9FA 1H1RA 4N0SA 3F61A 4IANA 2BAKA 5J95A 2Q0NA 4M0ZA 4AACA 3F6XA 4DTBA 3ZO2A 2OXDA 1RE8A 3CLYA 3QX2A 4EHVA 5HBJA 4WD5A 1RJBA 2PZYA 4I0TA 2XBAA 4R3CA 5FQDC 2WTCA 1JDEA 3WZEA 2UZTA 3F5UA 4ORKA 3RHXA 3ET7A 3FY0A 4QMVA 4XUFA 3GB2A 1EZ1A 4XNEA 3OXIA 5HCYA 5A3XA 5JN2A 2X8EA 2IJMA 4TY1A 4FFOA 2HWOA 3HP5A 3UP2A 4JNWA 4YTHA 4DEEA 3FI8A 2HJWA 2EUFB 2DQ7X 1KJIA 3FXWA 1ND4A 2X0GA 4YAKB 3OWPA 3QZHA 2OZOA 5AP5A 5L8LA 2XKDA 2F57A 5FLFA 3DBFA 3O2MA 4USFA 3F5PA 5LMKA 1V0PA 3DKFA 4IE9A 2VTSA 2O3PA 1JKSA 3PSBA 3KF4A 3QHWA 5EHLA 4BCKA 4WG4A 5LJJA 3K3PA 4U3ZA 2C3LA 2J0KA 2XJ1A 2ZB0A 2GNJA 2JDVA 4J53A 4B7TA 2YACA 4HYIA 3RNIA 5A6OA 1O6LA 3MJ1A 4IZ5A 4TYEA 2VX3A 3LM0A 1KE5A 5AAFA 4ASDA 4L3PA 5ETFA 2J5FA 4QYFA 2VTPA 2A19B 4PL4A 4EZ3A 2WTVA 1ZYJA 3II5A 2XUUA 3BBWA 2C3JA 2CPKE 3ZM9A 4AAAA 4DIMA 5AP3A 5FEQA 1OITA 1IEPA 1PKDA 1H0VA 3QD3A 2LAVA 4F9BA 3V04A 3ZC6A 3Q96A 4JQ8A 3NUXA 3UGCA 3KMUA 3RZBA 3VBYA 4ENXA 5CAVA 3E5AA 4DH5A 5HKMA 4O0XA 2CCIA 4RIWA 4IC7A 4DTAA 5KMMA 2F2UA 3B8RA 3I79A 3RP9A 4AT4A 3DXNA 3DCVA 3DAEA 4FTIA 2VTLA 4XBRA 3DAKA 2QD9A 3CPCA 5EKNA 3HL7A 3FSKA 4YLJA 3W2SA 3QTWA 3CD3A 3BV3A 2BHHA 3I81A 1WZYA 2C5XA 2YIWA 4H1MA 4IWPA 4NFMA 2F7ZE 4OTWA 3N51A 2R3IA 4O0UA 3ZDIA 2JLDA 2J4ZA 4R3PA 3ZLSA 4ZMFA 3VJOA 4E6QA 2ITWA 3MTLA 4ZJIA 2R5TA 4FTKA 5DE2A 1KJQA 1YHWA 2WHBA 2WO6A 3CKWA 4KSPA 2BALA 2CZGA 3KRJA 4IACA 1UWHA 3MSSA 4HJOA 4UEUA 2XNNA 4L01A 2ITXA 3F2AA 3IGOA 2B0QA 2WQNA 1Q61A 4FNXA 4RWIA 5CI6A 1H00A 3U9CA 4WBNF 1CM8A 2VGOA 2C5OA 2QLQA 1YOMA 2X4ZA 5FP5A 5K4IA 3TNHA 3WIGA 3EZRA 3OROA 5KX5F 2HY81 2WIHA 3OTVA 3R71A 3U6JA 3SAYA 3HUBA 1OL7A 1L3RE 4AU8A 4EH4A 3HLLA 5H2UA 3ZH8A 1M2PA 4LOOA 2Y9QA 4K33A 4RFMA 2XEYA 1Q8UA 3RWPA 2O0UA 4AS0A 4D4SA 5CU6A 3AT3A 5GNKA 4WHZA 5E4HA 2XCKA 4USDA 3N4TA 2R9SA 1DAYA 2W06A 4HGSA 2J0JA 4PX6A 5IQFA 1YDRE 2YM5A 4MKCA 4GKHA 4O22A 2XK4A 4XCUA 5CNOA 5EOLA 3UBDA 3VRYA 2WMXA 2FUMA 4TKSA 4E93A 3QTRA 4CCBA 2CLXA 1GZKA 1CKJA 4FVRA 3HRCA 5EK7A 3DB6A 5IEVA 4PDYA 3CGOA 4MBIA 3CXWA 1FGIA 1TQMA 3FMMA 3PUPA 3NYXA 5DVRA 3ULIA 4EKKA 5IDNA 3QTIA 3VA7A 3RVGA 3VS5A 2DUVA 4DLKA 3D4QA 3P9JA 4BIEA 4H05A 2PL0A 3VS7A 4AW5A 4S30A 5F94A 2BDFA 2R7NA 5BVFA 3BKBA 3V5QA 3TI1A 5IF1A 4S2ZA 4CNHA 3SQQA 3UG2A 2ZAZA 3E64A 3L9MA 3QQJA 4GCJA 4BICA 2C30A 4MCVA 4EOIA 3AQVA 1AUVA 2R3JA 4QYHA 5AMNA 4HVIA 3A7HA 2R7IA 1OI9A 3GCPA 3IW8A 4I93A 4J99A 1UU8A 5JQ8A 5C03A 4G5PA 3SOCA 4MV6A 3GCSA 3S95A 5BUEA 2PVHA 4E5AX 2PY3A 2GLTA 4D9UA 3MJFA 3N4VA 4Z3VA 5M56A 2WMRA 4W4WA 4FKUA 1Z9XA 3LFCA 3SVVA 4F09A 4YLLA 3OBGA 3RWQA 4UALA 3KVXA 2VTRA 4EK5A 1U46A 4L52A 2IVSA 4QMLA 3ZU7A 3ZYAA 1LEWA 3A7IA 4FK6A 4FV3A 3QQFA 2YDIA 5E8VA 3FPMA 1SM2A 5BX0A 3EH9A 4RIWB 5K4JA 2WTDA 2VTOA 4U42A 4RZVA 3GVUA 5C8KA 4IB5A 5GONF 4CKRA 2ITPA 2OIQA 2W1FA 1OIYA 1AQ1A 3FMJA 3FZSA 4OTGA 4RRVA 5HG9A 3TZ9A 3VBQA 3C5IA 5K5NA 3VUDA 2NPQA 4ALUA 1OUKA 3B2TA 3GP0A 2GHGA 4XG4A 5HG5A 4PQNA 3RM7A 1WVWA 2OWBA 3HV7A 4CFUA 4XG8A 2JAVA 3RPYA 4GL9A 5HGIA 1JVPP 4I20A 1BI8A 4MWHA 5DWRA 3SLSA 4F70A 3KY2A 4JX3A 2IW6A 5CVHA 3NZ0A 2ACXA 4Z7GA 2PHKA 4I0RA 2X9FA 5J5SA 3BE9A 4TWPA 5CAEB 3MW1A 4FE2A 5HLWA 5ANDA 2QOCA 5CU3A 4M3QA 4LQMA 2XEZA 5CEIA 3ACJA 4I4EA 4A9TA 4EH8A 3QTUA 1IR3A 2CKQA 3Q4UA 2PK9A 1PXNA 1YXUA 5CAUA 2BRMA 2BRNA 5H8GA 4E26A 2BMCA 3MYGA 3DNEA 2J6MA 4M68A 5IQIA 3ETJA 3GXLA 4BKJA 4F99A 4AW2A 4YZBA 3AMAA 4JOAA 4HCVA 4FZAB 3VW6A 3FUPA 5IH6A 3LJ0A 2UVZA 5DH3A 4DEBA 2HZNA 2XMYA 3BYVA 5M57A 1QPDA 4MEDA 4E4LA 4ZHQF 4J8MA 4M13A 4J97A 2FP4B 5AV3A 4V04A 3PY3A 4BBMA 1B38A 1YHVA 4MNEB 1KV2A 3DPKA 4FT3A 3AT2A 2YCRA 3LMIA 5EG3A 5EZYF 3FI4A 2BTRA 3TV4A 4A9RA 2BZHB 3TM0A 4BZDA 3VBWA 2KTYA 4EQCA 5BMSA 4FR4A 2BIKB 2PULA 2WQOA 3NR9A 4TYIA 2IW8A 5ANOA 3Q04A 2WB8A 4FZDB 3RPSA 3AC2A 3DDPA 4NFNA 4B9DA 4ZS4A 4O0SA 4UY9A 4E6AA 2GNGA 4AUAA 3R5HA 1XBAA 4BDBA 3LCKA 5LWMA 3CGFA 1XKKA 3CEKA 2IVUA 3EQFA 2CNUA 2X2KA 3PZEA 5BVNA 2HZ0A 3N9XA 4TWNA 5JQ5A 3C4ZA 4BI2A 3FZ1A 3QRTA 4XEYA 3TINA 3PFQA 4BZOA 4GK3A 2GQSA 2X6DA 3MH3A 3UOKA 4ID7A 4FG7A 2F9GA 4XOYA 3U9TA 5JH7F 2WIPA 4GSBA 5M55A 2NU6B 2NU7B 3ZEWA 3OWKA 4C37A 3CPBA 4YO4A 2X4FA 3QYWA 4PMSA 5KKRC 4F08A 4PWNA 5CU4A 1PMEA 2J9GA 1URWA 4FIHA 4EHGA 4BCHA 4C62A 5AP4A 2VTHA 4E5WA 5IEYA 3DKGA 3BWFA 3O7LB 2VTTA 2GQGA 4FNYA 4HVSA 3UMXA 3FQSA 1Y6BA 2R7BA 5AUYA 3TXOA 5LA6F 4KSQA 4O7RA 1ZXEA 1H26A 2PVYA 4IJ9A 4RJ8A 4D9TA 5CEKA 4YU2A 3W2RA 3TT0A 4FG8A 1IOVA 1OL5A 1Q99A 2CKPA 4GFGA 5FNVF 4HCTA 2ZB1A 3WI6A 5M4CA 4RJ4A 1JKKA 4I5CA 1EUDB 5CQUA 2WU7A 3FMDA 4H1JA 3LFAA 3FWQA 4O7SA 4TPTA 4NH1A 1UNLA 2QI8A 3ZLXA 5BPHA 3UIUA 2FGIA 5A4EA 3QA0A 4DFZE 3NYOA 1SCUB 3E8DA 1H07A 1GNGA 4F0GA 1BL7A 5HE2A 4RPVA 4C5CA 4FIIA 1W84A 2ZDUA 3VQHA 3A4OX 4HPTE 3CJFA 3OW4A 3FJQE 4AE9A 5C1QB 3JZIA 3ZO3A 5I5ZA 5GJDA 2BFXA 4KBKA 1VYZA 5L8JA 3PDTA 5AJQA 2YM4A 3UNZA 4O7VA 2QLUA 2QO2A 4II5A 1OVEA 4PDSA 5CF6A 1RW8A 2YWPA 4TWCA 2JITA 2Z7SA 4V05A 1V1KA 5CY3A 1I09A 4F6SA 2I0EA 3LPBA 3SD0A 5KMNA 4O27B 2UZUE 3FMLA 5B0XA 3F3TA 3HV4A 3ZSHA 5C4KA 5AP2A 1KJ9A 2VNWA 4EK3A 3UZPA 4HYUA 4NM0A 2WXVA 4QTCA 2BZIB 2CGWA 2OJFE 3QGWA 3ORZA 5HG8A 4PTCA 3PSCA 4ZSJA 4U80A 4FIEA 1STCE 3TNQB 5CSVA 3JPVA 3UTOA 2WPAA 3R9OA 4MV4A 3IKAA 2P0AA 1GLVA 5JVLA 4DH1A 4GMYA 2WTJA 4QP4A 1SMHA 5DT4A 4IMYA 3RI1A 3I5NA 3KULA 4XG3A 3TNIA 1G5SA 3HB9A 1H4LA 3BLRA 4QOXA 2QO7A 1W82A 2OIDA 3DJ5A 3HUCA 5IU2A 1GZOA 4D4RA 2WOTA 4O7LA 2R3LA 1Q62A 2HW7A 3F3VA 3R8LA 5JFVA 2RF9A 3UO4A 1W98A 4RFZA 3UE4A 3HRBA 4ZTHA 4GS6A 3R7VA 4C33A 4ZLOA 3ZHPC 2BVAA 1FVVA 3AGLA 3OCTA 2XD4A 4U40A 4K6ZA 3NDMA 1Q41A 2ZV8A 2W5BA 3HX4A 2W99B 3LFQA 1SVHA 3CY2A 3D7TB 4C38A 5CAPA 5CB4F 1G3NA 5DA3A 3RJCA 2ONLC 2PVJA 4YJUA 5IQBA 2JEDA 3EN9A 3LZBA 3RALA 4JX7A 1XHAA 3BQCA 1QPEA 4ACGA 5IMXA 3O8TA 4XHKB 1IRKA 4O96A 3HGKA 3QZIA 4GKIA 3NYNA 3SX9A 4CRLA 3N8DA 5HVJA 2JKMA 2YIQA 1J7UA 4UV0A 5LMBA 4L3JA 3MY1A 2C6EA 3NW6A 5D11A 2JDOA 3TN8A 4BTFA 5M07A 4BIDA 1I7NA 3E5NA 4I50F 2XA4A 2W70A 4E4XA 1GZ8A 3VUIA 3DQWA 5E92A 1E1XA 3GOPA 4LL5A 4BCQA 3G15A 4BHZA 4ZJVA 5IA4A 3W10A 4YJRA 3O0GA 3C51A 3F3UA 4RX7A 5IUHA 3N6RA 4QMWA 3GI3A 3R5FA 2PPQA 4N57A 1UU7A 4JVGA 3S4QA 4KBAA 3PXFA 4ZZMA 3O71A 4L67A 5DT0A 3MVHA 4RJ6A 2R3PA 5HG7A 2Y6MA 3QCXA 2XNPA 3BGZA 5JSMA 4M9UA 1J1CA 4O2ZA 2R3OA 2I1MA 4K1BA 2G1TA 4ITIA 2HW6A 2XIYA 1OMWA 4ZSLA 2ZV9A 3OP5A 4OTQA 5HEZA 3U54A 4J71A 2FSOX 4QMYA 5LARA 5LVNA 4TV9F 4JL9A 4FEUA 3QQHA 4V0GA 5IUIA 4QMUA 4ANLA 1H28A 1OL1A 3E93A 2YWVA 1GIIA 3MFRA 4UWYA 3LVPA 3PE1A 5AUZA 2C0TA 3HV5A 4FKVA 4C4HA 2GNHA 5IMEA 5LOVF 2VTNA 4MXOA 4P2KA 5L2WA 4IDTA 5AUWA 2OFUA 2B7AA 4O4HF 4EH2A 1Q3WA 1OIQA 4ENYA 3D5VA 2R7MA 4BCJA 5ANEA 4EH6A 3TKHA 2QKRA 3R00A 2SRCA 4KKHA 4HNIA 4KRDA 1QPCA 5CTPA 5JEBA 3ZFYA 2VN9A 3H30A 2PE0A 3DT1A 3TIIA 4ZTNA 4QMTA 2VRXA 2QONA 1GY3A 2J0LA 4A9YA 2CGXA 2ZDGA 4C4IA 2R3GA 4D5KA 2VWYA 4FC0A 5HNIX 1JKJB 4IVCA 4R5SA 3ENHA 3FI2A 5DEWA 5BNJA 4QP8A 3VF9A 2F7EE 3OFMA 4HYSA 3TZ8A 1KOAA 5JQGF 5GJGA 4TV8F 2B9IA 3MTFA 2VTMA 4KKGA 4QQTA 2Z7RA 3MBLA 4BDJA 3FE3A 5DR9A 4LL0A 4ACDA 4YNOA 3DBEA 3RCJA 2QOIA 3O8PA 4KNBA 5AV2A 3OC1A 3UVRA 1U5RA 4O6EA 4RVLA 4C36A 5A4TA 1R0PA 2CHLA 2YDJA 4RGJA 3MI9A 4ZK5A 4JI9A 3H0YA 4EC8A 3OXZA 1WVYA 2XVDA 2W9ZB 2GPHA 4NKAA 4U41A 4Y73A 4KABA 4Y83A 1CTPE 3SW4A 2QK4A 4J52A 5CNNA 4FKGA 4ASXA 2AC5A 3RPVA 2ITOA 4CQEA 2R7KA 5M06A 4YJ3F 3ALNA 4FSZA 4J1RA 5FP6A 3HO8A 5CXHA 2R3MA 2VQDA 2W6OA 4RVMA 1YWVA 2W9FB 3NAXA 3VS4A 3G6GA 2WAJA 3PZHA 1PXLA 2WZJA 3F3ZA 3P79A 4BTKA 2G2FA 2W5HA 4IAKA 4O82A 4WT6A 1HCLA 1W96A 3BX5A 3LIJA 2FB9A 5L2TA 2PMIA 4LMUA 3SG9A 1S9IA 4GU9A 3AMYA 4CT1A 4O0YA 2OBJA 2VO6A 3AC8A 3L8XA 1P5EA 5I9UA 1UA2A 1W83A 2VR1A 4C4JA 3LQ5A 3BLQA 3TKIA 4ZMEA 3EHAA 4QRCA 2Y7JA 1ZOHA 1W8CA 4NM3A 3DS6A 3VO3A 1EUCB 5HBRB 5EW3A 1WCCA 3DNDA 5I9XA 3E92A 3OY3A 3OCGA 2CDZA 5FXQA 4ZY6A 3ETAA 4ME6A 5IZFA 3LMGA 4TTHB 5CANA 3LLTA 4FTMA 1SNXA 3MVLA 3WZJA 3GC0A 4TW9A 1KC7A 2VWXA 4YPDA 5AWMA 4XZ3B 3LXLA 4A06A 3DGKA 3F5XA 1KE8A 3BGPA 3OF0A 4JRNA 4YC6A 4C61A 2YIYA 3PXZA 4XLIA 3ZRKA 2X6EA 3G0FA 4ANBA 4MBJA 3LW0A 4EL9A 4DEDA 5I4NA 4ZTQA 5JFSA 3FMHA 2A1AB 4GRBA 4IAYA 4YP8A 3ENMA 4ZIMA 4D4YA 5IA0A 3IPHA 2OH0E 3OWLA 4KBCA 3PA5A 4YNEA 2PUPA 3QCYA 3QD0A 3QC9A 4QYYA 4PNKA 3SGCA 2WGJA 5HBEA 4G31A 3C7QA 3EN4A 3O17A 2VTIA 2G01A 3LQ8A 3UG1A 4GYIA 3R5XA 3VAPA 3BU5A 4LM5A 5IG1A 4DFNA 4OTIA 4FEWA 4E7WA 4RWJA 3RFCA 2ITZA 3OXTA 2YITA 5E8UA 3UPXA 4BCOA 3FLQA 3DXQA 4M7IA 4FSWA 4IDVA 4QTDA 4ZOGA 3MY5A 4W4XA 3R8VA 2W1GA 3RV3A 5IA2A 1YQJA 2JIVA 1GIJA 2XK8A 3EFKA 3FL5A 3PP1A 1K2PA 2UZEA 5EYDA 3TW6A 1H25A 5EW9A 3UQCA 3M1SA 2GPWA 4D55A 2WMBA 3LM5A 4HNVA 2HWPA 2W6PA 2XZSA 2PMOX 2QG5A 3EN7A 1CSNA 3PPZA 3R6XA 1YDTE 1BKXA 3B8QA 3QXOA 3REPA 3VUHA 3Q9ZA 3QZFA 3U9SA 4GK2A 4R77A 2REIA 4O0TA 2P3GX 3LFBA 2NUAB 3LJ2A 3CIKA 3R83A 4O2BF 4DGNA 1KE9A 3RKBA 1S9JA 3BHHA 3R04A 4XV2A 4ZZNA 3ITZA 4DFBA 3ELJA 5EYCA 1VBHA 4Y95A 4BCGA 4ALWA 2NRYA 4JIAA 2OKRA 1IOWA 5A9UA 1E1VA 2OJ9A 2V62A 1J7LA 2BKZA 4U7ZA 3PJ3A 2VWIA 5CU2A 5J2TF 1UKIA 3CR0A 3Q2JA 4KA3A 4CFNA 4DCAA 5EH0A 1JLUE 5EDRA 5DEYA 3CQEA 3EQDA 2PZIA 3LCSA 2C1BA 2PBZA 5FUTA 3Q9YA 3DK6A 3Q6WA 3QAME 4FOBA 4WKQA 3VS0A 4R1YA 4JR3A 1OPKA 3GU6A 3VS1A 4ZP5A 3W2PA 1OKWA 3OMVA 1GSHA 5A54A 2I0YA 2NNWB 3A60A 2CSNA 3OBJA 3ORPA 4ZEGA 3FMEA 3EIDA 4NJ3A 4MF1A 5CSXA 3LLAA 3KC3A 3I7CA 3KXNA 4NSTA 4CZUA 4IX4A 4IVBA 2BKKA 5FDPA 1FVTA 4IB1A 5FTOA 3WBLA 5CF8A 2ZV2A 3ZLWA 2X8IA 3LHJA 4S34A 3K3JA 5EOBA 4ERWA 2I80A 3IONA 4I5MA 3KXXA 3OEFX 4NM7A 5IQDA 1JSTA 2ZDHA 2PVLA 4QNYA 3MFUA 3PE2A 4NW6A 1Q3DA 3R02A 1VKZA 4YPSA 3FQHA 3V6RA 5HIBA 3QYZA 2O65A 4DITA 4FTQA 1WAKA 5IDPA 5J87A 1NA7A 3GC9A 4LOQA 3C4EA 5FTQA 4FMQA 2IN6A 3PTGA 4U3YA 5CVFA 3SOAA 3WZDA 4ERKA 1DI9A 3KCKA 3WO0A 4HVGA 1KV1A 3VPBA 3K5VA 1P4FA 1WBWA 2IP4A 5FTGA 4PMTA 2C3KA 2WKMA 5CASA 2ETKA 4FV2A 2UV2A 1U59A 1UVRA 1LPUA 4YC3A 3EQHA 4GFMA 3IOKA 1NT2A 4ZLYA 1OKVA 1XH6A 3D94A 4FODA 1E4EA 4FFRA 4NKSA 2V7OA 2YS7A 3VIDA 5CS6A 5HTBA 3NSZA 4H36A 4PY1A 1CKIA 4FG9A 1PF8A 2ONLA 4QP1A 4MHAA 4KUJA 4A07A 4X6QC 3BYMA 3MVJA 5DR6A 5BUIA 1B6RA 4WBBB 4Z9LA 3VHKA 4DGMA 5HIEA 4MAMA 4LV8A 1YI6A 4XYLB 1H8FA 2BZKB 2CJMA 2OLCA 3A7FA 3LCDA 3R63A 5D1JA 3ZONA 3GU7A 2HK5A 4IIJF 3NX8A 4OUCA 3VW8A 3VWAA 5KBQA 3ROYA 2H9VA 4FTUA 4ACMA 4USEA 4TUYF 4FZ6A 1TQPA 4NU1A 4I92A 3WF7A 5JGDA 4YBZB 3GBZA 4X2FA 3E63A 3JS2A 4RA4A 3U55A 5BVDA 4YHTA 3TZMA 5DFPA 5KKRB 2VTJA 3L8SA 2H96A 4OLIA 2HGSA 2EXMA 3R9RA 4OT5A 2Y4PA 4WSYA 2O2UA 3MIYA 4DHFA 4JQEA 5AA8A 1XWSA 2EU9A 4FV6A 2H8HA 4AE6A 3EJ1A 2C0OA 3BRBA 4LG4A 3PLAE 2UW3A 3I0QA 4EYMA 3K54A 4TYJA 3UP7A 2IPXA 4FKIA 3EMGA 3GU5A 3QRJA 4C3PA 4X21A 5M4IA 3NUYA 5IQHA 1DV1A 4BBEA 5TO8A 4M69B 4CMUA 3S0OA 3Q53A 4MA0A 4O7YA 1R3CA 2GTNA 3ATSA 5DNRA 3NEWA 4GVAA 3WF9A 3BG5A 4JS8A 2VV9A 3NGAA 4IVAA 4RC4A 3IOPA 4DG2E 5LCJA 4YURA 4M0YA 3ZC5A 4QP2A 2F49A 3AD6A 3PVWA 2XK9A 2W5AA 2O8YA 4ZS0A 2VO7A 3JVRA 3CQUA 3PJ2A 4RVTA 3R73A 1GGOA 3SC1A 3SDJA 5ANKA 2PUUA 4BGHA 1XH8A 3D2KA 4UXLA 1OPJA 4CMOA 4C4GA 2XYNA 1O6KA 3ZUUA 2JAMA 4P5ZA 3PIXA 4UYNA 3O7LD 3UNJA 3RAWA 4EQMA 1T46A 1V0BA 3R1QA 4FYOA 3EQIA 4E6CA 1T36A 3QRKA 1VBGA 4XOZA 5CF4A 4KS8A 3HV3A 2YCFA 5DIAA 4MNEA 5HU3A 4O21A 4YUQA 2FB8A 2J9MA 4QT1A 5J9LA 2CKOA 4RLLA 2VAGA 3ORNA 4WNKA 5B2KA 3TCPA 1VEBA 4W8EA 1ZYSA 1BX6A 4UBAA 4YO6A 3ZFMA 3LQ3A 1NVSA 5JGAA 5CEOA 3U6IA 1I7LA 4XG2A 2ZV7A 2Z04A 5J9ZA 2VWWA 3BV2A 4XX9A 5C4LA 4JBOA 4F1MA 2C6TA 2QOQA 3L9NA 4A4XA 4L53A 1Y8GA 3EKNA 4F0IA 5BVOA 2OFVA 2C6KA 4AFJA 4AOTA 4W4VA 3MPAA 5CT7A 3SHEA 2JKOA 4DA5A 3UPZA 2YN8A 3PY0A 4ANQA 4P90A 5CX9A 4AT3A 2OU7A 2X2MA 3A7JA 1PXMA 3QLFA 4ANSA 4YR8A 2WMQA 4GVJA 1YOJA 3TL8A 3WYYA 4JBVA 3SV0A 4FTOA 3TDWA 2XJ2A 4FSNA 1IAHA 2OXXA 3FMKA 4DH7A 3AT4A 2R7LA 4PV0A 2GCDA 1HOWA 4DF3A 4AWIA 2BAJA 3K2LA 2XB7A 4O38A 5M51A 3AC4A 1PHKA 4HGEA 1E4EB 4I6BA 3KQ7A 1ZZLA 5A4QA 3R1YA 4A9UA 3HDNA 4MQ2A 3ANQA 3OS3A 4XV3A 4O81A 2UW5A 4RX9A 3KRXA 2IO6A 4RQKA 2VWVA 5CT0A 5D41A 1IA9A 4YHJA 2VD5A 4EZ7A 4EOPA 1FOTA 2P33A 4EBWA 4D1XA 4EUUA 1ZY5A 4QPAA 5HCZA 3LXPA 3O23A 4FV7A 2UW6A 4H58A 3V3VA 2R3HA 3DB8A 5HI2A 5LVMA 4YJVA 4EGJA 2FA2A 4LMNA 2C1AA 3ZRLA 4RWLA 3PVBA 3KB7A 5HE3A 1H08A 2GFCA 3G5DA 3MB6A 3OUKA 3QL8A 4RMZA 4XJ0A 2QOLA 4B8LA 3W33A 3KAKA 5GIPE 4FTCA 2RG6A 3JRWA 2R82A 5FDXA 2ITUA 3NAYA 4AA5A 4U9AA 1W0XC 3CBLA 3ZBFA 1P2AA 2QU5A 4G16A 4H3BA 4QMZA 2OGVA 2WQMA 2BRGA 3D5WA 4WUAA 5GINE 3ULZA 2UVYA 5HTCA 1JKTA 5EHOA 4CV9A 3Q4TA 5BUJA 4F6UA 4R7IA 1WBVA 2XIRA 5DHJA 5I9WA 4K77A 1IA8A 4WG5A 3NIZA 3QC4A 5HD7A 4CD0A 3MWEA 1JBPE 1OGUA 2PZRA 4XV9A 2NRUA 4FVPA 2AYPA 3RAHA 3ORIA 1TQIA 3Q32A 4FICA 2XNBA 3QQKA 4HOKA 4BCIA 3GFEA 4O0RA 3R7OA 4S33A 4WA9A 4G6NA 3MGYA 4FGBA 2VO3A 5LVLA 5B2LA 2R3FA 5E7RA 5H8EA 2V5AA 2W6MA 2YFXA 4EONA 3QQLA 2GDOA 2R85A 1OPLA 2JC6A 3NRMA 1YKRA 5EW8A 5DN3A 5B7VA 3RHKA 1CMKE 1XO2B 5FEEA 1WBTA 4XP0A 3ZSIA 3EB0A 4KIQA 3ZM4A 4AW1A 3KL8A 4CLIA 4QMMA 1FGKA 5AV1A 2J0MB 4EWHA 1Q24A 3C4FA 4BI0A 3IS5A 2IW9A 3FYJX 4S32A 4KB8A 1MQ4A 4HZSA 3ROCA 4R3RA 5LQFA 2YM8A 3FYKX 4ZSEA 2R4BA 4DN5A 4LI5A 4OTDA 4WNOA 1QPJA 2W1HA 4AN3A 5M08A 3BHUA 4F9YA 2XYUA 3RCDA 4FSQA 2UZVA 3NNVA 3BGQA 2YISA 5L6WL 4A7CA 5AX9A 2C69A 4QQJA 3GT8A 3MFSA 2XRWA 4QMOA 4UX9A 4HGTA 2YERA 2C5NA 3GGFA 4N6YA 4CGAA 4DE4A 5DYJA 5FBOA 2BROA 3H10A 2QO9A 1C3OA 4MXCA 3KN5A 2ZDTA 2A4LA 5CAOA 5KCVA 4F1TA 4DFYA 1Q8TA 3UIXA 4XX0B 2FSLX 3E7OA 1OBGA 3TUBA 2YIXA 4W4YA 3D7TA 5CALA 2R3NA 2BPMA 5JFWA 3POOA 2WMUA 3P7BA 3DDQA 3LFEA 4GT3A 4XG6A 3UO6A 4WRSA 4ZOLF 3D5UA 2I0VA 2IG7A 1P4OA 1B39A 2PTKA 5HLPA 3ZEPA 4RIXB 4CSVA 5AUUA 5IH4A 2OZAB 4I4TF 3KK8A 4F9CA 2WNTA 3S00A 3IGGA 5HV6A 4I6HA 1ZLTA 3IQ7A 5IUGA 2XIXA 3TNPC 4AZTA 4IAFA 2GNLA 3A99A 5DOSA 5EKOA 4BDFA 3U87A 4RA5A 3R30A 4RBLA 4NIFB 4TNBA 3FBVA 3PLSA 4FIGA 1Q5KA 3OG7A 5A4LA 4DEHA 4GW8A 3HZTA 4GK4A 2YZGA 1WBNA 4FUXA 4U5JA 5I9ZA 3ERKA 4OTRA 1XH9A 4G3CA 3ATTA 4L46A 4KD1A 2B1PA 4FTTA 4CFVA 5LOHA 1KE6A 4JT3A 5CZIA 3L9LA 3TUDA 3W1FA 4ARKA 3SXFA 2FPGB 5CVGA 4FKQA 2R0UA 4MK0A 1HCKA 3FMNA 5EI2A 3ZDUA 1PXIA 4APCA 3WO1A 2OICA 3COIA 5T6KA 1KE7A 5LP6F 5M53A 5GHVA 3JUHA 4FU0A 1MRYA 5HO8A 1K3AA 4ZLZA 3V6SA 4BRXA 2R86A 3E3PA 4BDDA 3FLSA 3NUPA 5G1XA 3DLSA 5CWZA 4C7TA 4XH6A 4BCMA 4IIRA 5DRBA 5JZJA 3F2NA 3P4KA 2JDRA 3AD5A 3G33A 3HECA 1CDKA 5D12A 4FSRA 3RINA 5JFXA 5M4FA 4EH9A 2VO0A 2EB2A 2B9FA 3MA3A 3F2RA 4QMSA 3FPQA 4IB3A 4R1VA 3TQTA 3AX6A 2CCHA 3MWUA 1Y8YA 3FZRA 1EYZA 4CFWA 2G2HA 3FLYA 2ITVA 4BVUA 3HEGA 3MPTA 5KMJA 3KA0A 4C5BA 2WTWA 2RFDA 3BIZA 2E9NA 3HNGA 3JR1A 2GMXA 1C30A 2VTAA 1A9XA 2GS2A 4MV7A 3AC1A 1J3HA 3TWJA 4YZ9A 3AMBA 3DXPA 4E4MA 4DGGA 4NZWB 4RIYB 3SRVA 2CMWA 2A2AA 3TV7A 2FPIB 1H1QA 3DQXA 3EYGA 3KEXA 5TT7A 3R9HA 4OTFA 4ZAUA 5IH5A 1KJJA 3I6UA 4FV1A 3RMFA 3OT3A 4BR3A 4EOLA 4FKLA 3Q2MA 5HIDA 3K5IA 1YDSE 4YLKA 4EZ5A 1REJA 4U8ZA 2PVFA 3NNWA 2W1IA 4EC9A 4IX5A 4QP7A 1CE8A 2B9HA 3N4UA 1JDBB 3HVCA 2VX0A 4UXQA 4YHFA 3LXNA 1ZZ2A 4C3FA 2CLQA 4YTCA 2J51A 1H1PA 2CNVA 3JYAA 1F0QA 4CTCA 4YJPA 4MTAA 3I60A 3UYSA 4AX8A 4O4JF 4YJSA 1OKZA 3FC1X 2FSMX 3HMPA 2QG7A 4Z55A 4FVQA 3V8SA 3CQWA 3OOMA 2PZ5A 4G6OA 3CJGA 5DI1A 3OY1A 1DS5A 3FEGA 2VWBA 3QHRA 2RFSA 4XP2A 3RK7A 4C02A 2VZ6A 2Y0AA 3PJ1A 2IVVA 4JQ7A 2ITQA 2HOGA 2ZMDA 3HDMA 3A7GA 2BRHA 3HV6A 4MXXA 4F7NA 4YTFA 4YSJA 2HCKA 2JDTA 2RKUA 4D5HA 3IW6A 5JMSA 4KRCA 4TWOA 3Q5ZA 2XKFA 2GPSA 1Q97A 3C4WA 4YJQA 3K5HA 3G9NA 5HQ0A 2XM9A 4BYIA 2G2IA 2OJJA 5CYIA 3RGFA 2ESMA 2CGVA 3F3WA 4QMXA 5E1SA 3R7YA 3R7UA 4L8MA 3C4CA 4GIHA 4YZDA 2FVDA 3TEIA 4EK4A 3AC5A 4QTEA 4IZOA 4IZYA 4M67A 3FLZA 4QP6A 3BHTA 4I1ZA 4JR7A 5I9YA 4DFXE 2ZOQA 4D2RA 5BYYA 5KZ0A 3IG7A 4CLJA 3W32A 3IECA 4D58A 2R3KA 5ANIA 5BMVF 4FK3A 2UW8A 4ZSGA 3DZQA 3E87A 1PX2A 1M17A 3C5UA 4G5JA 2B53A 3NCGA 4FKTA 5BQ0A 1XR1A 5JH6A 1R39A 1JKLA 3U51A 1ZY4A 3TIYA 4AGCA 3WZUA 4CRSA 3Q3BA 1NW1A 1WFCA 1BXRA 4YB8B 3FHIA 4FSYA 4QMNA 1GIHA 2EB3A 2WQBA 3BI6A 3OD6X 4JXFA 1RDQE 1Y6AA 5KZIA 3I0OA 4AZEA 2J7TA 4DEAA 1ULZA 3PPKA 4UZDA 4B6LA 2YDKA 1AGWA 1M52A 4Y46A 3QWKA 3NUUA 3P23A 3DOGA 4GFOA 5FBNC 3U9NA 4BGGA 1ZMVA 2YRWA 4AG8A 4MV9A 3RPOA 4FT5A 3LE6A 5ACKA 1UU3A 4KINA 1X8BA 3VNTA 5DRDA 2W96B 5HE0A 4DH3A 4DFUA 4YAJB 2NU8B 2I40A 5CLPA 1JAMA 2O5KA 2X81A 3QKMA 5IA1A 4O4LF 4EG0A 1KEEA 3V5WA 3V4ZA 3COMA 2YYAA 4AZVA 1PJKA 2QKWB 3VBTA 1JNKA 4GUBA 2NU9B 1XH4A 2CN5A 3ORQA 1FMKA 2QOFA 1VJYA 2UVXA 4EH5A 2OXYA 3P7AA 3FLWA 5TR6A 2XK3A 3FZTA 4PP7A 4FUYA 4HZRA 4DC2A 4AOJA 3ORXA 4FNWA 5J1WA 2J50A 2HAKA 4HNTA 2HZIA 4OTHA 5CSPA 1PYEA 4J95A 1YXTA 4EH7A 4U6RA 4TXCA 4I24A 4U43A 3SRVB 2QVSE 4JBPA 3PJCA 3R2YA 5C01A 4QP3A 5CXZA 4X6RA 5AP7A 2UZOA 5AADA 3G9LX 1GJOA 4J8NA 4Q9ZA 4UZHA 3NNXA 1SNUA 1H1WA 2X7GA 1H01A 4WNPA 4M14A 3GUBA 1UNGA 3RTPA 2OH4A 2FPPB 4FKSA 2W1ZA 2E9PA 5FXSA 5KKNB 4MV3A 1WMKA 2W4KA 3GOKA 2VWUA 3HMMA 4U44A 2X0SA 3WIKA 3D7ZA 3QBNA 4PF4A 3QWJA 4AGUA 3TG1A 3G51A 1JWHA 2JIIA 2WTIA 3MWDA 4IBMA 3DAJA 3LJ1A 3QGYA 3VF8A 3QD2B 1ZAOA 4FV0A 3KMMA 5LCKA 3BWJA 4QTAA 4JDKA 2PMNX 1E9HA 2VWZA 3BYOA 3P08A 2DS1A 2PU8A 1ATPE 3HAVA 4FSUA 2XBJA 2RFNA 4RQVA 4O7NA 3QU0A 2HY0A 4TYHB 3F66A 3FSFA 4XBUA 1L8TA 3R1SA 2QHNA 4DEGA 3BU6A 4I6FA 3FY2A 1YRPA 2YCQA 3MH2A 2YCSA 1I44A 4FTNA 2YZLA 4KAOA 3PXRA 5HBHA 1KUTA 3A4PA 3KU2A 2XNEA 5EI8A 3TJDA 4FIFA 2JFLA 2WMTA 4FZ7A 2JDSA 5F95A 2YRXA 3KVWA 4MAOA 1FINA 5M09A 5HCXA 3W2OA 4BY9E 3W8QA 5CF5A 3ETHA 4XG9A 3CSVA 4M12A 2QODA 4QQCA 3A8XA 3VPCA 2UZNA 4XG7A 3OUNB 3TDVA 1M7QA 4G34A 1OUYA 2F4JA 3QQUA 4RLKA 1SVGA 1YI4A 1YWNA 2I0HA 2X39A 4F9WA 4I94A 5LVOA 2DWCA 3UFXB 4GUEA 4UWCA 3NW7A 2OSCA 4JDHA 4K11A 2UZDA 3BHYA 4AN9A 3BLHA 2YJRA 3MVMA 2XNGA 4MV1A 2FO0A 4K9YA 4IADA 4R78A 5AUTA 5L3AA 2XJ0A 2Y4IC 5ETIA 4YJOA 3BPRA 3VC4A 1AUXA 3EOCA 3KK9A 2C4GA 4HGLA 4QTBA 5LWNA 3BYUA 2VX1A 5HLNA 3DV3A 3WOWA 3IK3A 4GG5A 4EKLA 2Z8CA 3R23A 3R9DA 1SZMA 2ITTA 3GEQA 3IDPA 3IO7A 5EQEA 3CC6A 3V8WA 1YXVA 3H3CA 4K18A 4DAWA 3JY0A 3DTWA 3QFVA 1BI7A 4IEBA 3EFLA 3CP9A 2BIYA 1JSUA 4D4VA 3FV8A 4DT9A 4AZWA 3C9WA 3WYXA 3FXZA 4NL0A 1QL6A 2B4SB 4NWMA 3R22A 2PUNA 1PXKA 2B55A 3EN5A 1UWJA 3WE8A 2GNIA 4RSSA 4X3FC 4ZXTA 4HPUE 4YSMA 2JKKA 4MWIA 5DGZA 2NP8A 3HMOA 4I6QA 1EHIA 3LAUA 2WQEA 4EOKA 5KMOA 5BPFA 4QSHA 3Q9WA 2P55A 4H3QA 3EWHA 5JZNA 3ZXZA 1ZYDA 2ZM3A 3SG8A 1Q8YA 2UZBA 3BE2A 4IQ6A 5AP1A 5A6NA 4BIBA 4HNUA 3W16A 4CG9A 4L68A 2C47A 4YZCA 2YA9A 5DR2A 5K5XA 1XJDA 4DYMA 2GSFA 3UNKA 1O9UA 3JVSA 3QUEA 3KALA 4CFXA 5HORA 1PY5A 3KRWA 3DK3A 4ZTSA 4BGQA 4ZY5A 2GS7A 3A61A 3A62A 1A9UA 4ALVA 2Z7QA 4B8MA 1BYGA 4LGGA 3ZOSA 1PYXA 2GU8A 4M84A 4C59A 4O0VA 2W6QA 2R84A 2J2IB 5KNJA 2NO3A 3E88A 4IFCA 5AAEA 2XNMA 3EQGA 1ZARA 3T9IA 4XYFA 3FDNA 3PJ8A 3H4JA 5HESA 5L8KA 3ZO1A 2QOBA 2V7AA 3ALOA 3C4XA 3QTZA 3EQRA 4H3PA 1DAWA 2DYLA 3GU4A 1U54B 5E1EA 4BTJA 2C6OA 5CU0A 1CQIB 3GCVA 3PA3A 3R1NA 1KJ8A 4NCTA 4XS2A 4IAZA 3LCTA 2I6LA 4IX6A 5HO7A 4P5QA 5FG8A 1QCFA 1UV5A 3EQBA 2BCJA 4ONAA 1Z2OX 4PRJA 4FKOA 3UMWA 4XYMB 4IHPA 3QA8A 4TL0A 3WF6A 3WF5A 2HXQA 1NXKA 4G3FA 1GSAA 2ZM4A 5JQWA 3M42A 3CTJA 1R78A 4CT2A 4FFPA 1H27A 2BILB 3OW3A 1R1WA 4QP9A 4AFEA 5TF9A 3QKKA 1OECA 3WE4A 3TIGA 1IASA 4GJ2A 4OBPA 3QX4A 3UJGA 2B54A 2QOKA 4CTBA 2WMWA 4F4PA 3ZZWA 3KKVA 3Q4CA 4FFLA 4E4NA 5H9BA 3AGMA 2C6IA 1Q8WA 3ORLA 4IWDA 4L6QA 4FTJA 4IM2A 3KMWA 4IVDA 3BEGA 4FX3A 4GEOA 3MFTA 2BFYA 3C13A 4RIOA 2WEVA 4AA0A 2PVRA 4UB7A 2IZUA 5AUXA 4DLJA 4O86A 5J9YA 3TTIA 3ZBXA 3ZZEA 3I12A 1EH4A 2QF7A 3E7VA 3CE3A 2FSTX 4PTGA 4ZTRA 5IQAA 5CQWA 4I22A 1VR2A 4C34A 4F63A 4U45A 5F20A 3SW7A 4G9CA 4RC3A 5ACBC 5KHWA 3GC7A 5KBRA 4FV8A 4EK6A 4R5YA 4ASZA 3ZUTA 3UC4A 2PWLA 3HMNA 4DT8A 3MDYA 3W2CA 5D9HA 4OW8A 5JGBA 1OB3A 3UZRA 1Z57A 5H8BA 4IM0A 5HICA 4MVFA 4F0FA 5EI6A 2W71A 2W1CA 3I4BA 3E62A 1PMVA 1MRUA 1Y91A 2IWIA 3GFWA 4M97A 3CS9A 2H6DA 4APPA 4NJDA 2CN8A 3FZPA 2YZNA 3LP8A 4DGLC 4FGRA 4PMPA 3C0GA 2ZMCA 4L00A 2YIRA 3VS3A 4C4FA 4QNAA 3EFWA 4I55F 3GLKA 4CFMA 4EJ7A 3G8DA 3BELA 2QR7A 3KN6A 4YBKA 1MRVA 2PYWA 3DKCA 3O51A 2E9UA 3DLZA 5CI7A 4FL3A 2ZVAA 1M2QA 5KMKA 3UQFA 3PPJA 5JVDF 2ETRA 1GAGA 4HYHA 4EOOA 4HVDA 5E8YA 2VPQA 5ETCA 2HENA 3WARA 2A0CX 4AT5A 4FTLA 5DBXA 4F7LA 4OBOA 3NW5A 2JGZA 3ORMA 2WYOA 4L42A 3EYHA 3V51A 2I87A 4ZI7F 3TTJA 3ZO4A 4AW0A 3RUPA 1NY3A 2FH9A 1A06A 1MQBA 3DFAA 3QUDA 4LRJA 4YJNA 4TZRA 2ZJWA 5F4NA 4GH2A 5L2SA 5DPVA 4C35A 4O4IF 4RT7A 2V22A 1OL6A 3EN6A 5BMMA 1APME 5HNBA 3OT8A 1YOLA 3DA6A 1YWRA 4I4FA 4LUEA 4ZTLA 1WBOA 4EJNA 2Z60A 3VN9A 3S2PA 4O7WA 4PTEA 3IDCA 3M2WA 5CENA 1ZOGA 3H9OA 3UC3A 4JG8A 1DM2A 2YM3A 4NTSA 3DF7A 4CKJA 2W6ZA 1LEZA 1G8SA 3ZUVA 4IJPA 5DG5A 3P5KA 2ZDQA 2GFSA 3CCNA 4EQUA 2XCHA 4I0SA 4EGQA 4GV1A 4FTAA 2JFMA 1ZOEA 3UIMA 4QYGA 3TJCA 4D0XA 4FL1A 4AGDA 4IZ7A 3OWJA 4TNDA 4R6VA 5LXTF 3ZTXA 4UYAA 5K3YA 4CZTA 3NPCA 3UZTA 4IAAA 4RIXA 2OZAA 4U79A 1Y57A 1M14A 4PMMA 4MQ1A 3MV5A 3NLBA 4L7FA 2DLNA 2BAQA 3Q4ZA 3KRRA 3NNUA 4M8TA 5HX8A 3DKOA 4NW5A 3KXMA 3FKLA 4O83A 4PL3A 4FKPA 5AUVA 3C0HA 1NVQA 2YAKA 4RJ3A 4Y5HA 2R2PA 3THBA 3UVQA 5D8DA 3D0EA 4DEIA 2OF2A 1CQJB 3DK7A 5C27A 3T3VA 3DBCA 5EQPA 1J1BA 4AXAA 3KXGA 3OCBA 2I7QA 5B2MA 1XBCA 1T45A 3QALE 4BBFA 3D9VA 3F5GA 4O7ZA 4YGAA 1VZOA 2HIWA 3G8CA 3MA6A 5T68A 1DV2A 4K8AA 1ZWSA 1KWPA 5J7HA 4I5HA 5D7VA 3R2BA 3W2QA 4EBVA 1GSOA 4IX3A 3LOKA 4HVHA 3B2WA 1WBSA 5T3QA 1WBPA 4TRLA 4F65A 3LWBA 5EYMA 4IAIA 4GU6A 3VS2A 5E90A 4QPSA 5IEXA 1YXSA 4O84A 3PRFA 2WELA 1O6YA 3F9NA 3ORKA 3SE7A 2XH5A 4FIJA 2E9OA 3AW8A 2BR1A 2G9XA 4NK9A 3QRUA 3F7ZA 2PE2A 4WG3A 2R87A 3R0TA 3VOTA 2X9EA 2Q83A 4BDCA 3MJ2A 4OR5A 4LRKA 1M7NA 3P78A 3T3UA 5CZHA 1ERKA 3ZLYA 3IW4A 2YL2A 2YZAA 2JBPA 4Q9SA 1OKYA 4J98A 2A27A 4FV5A 3L8PA 4KKEA 4EWQA 1J91A 5F1ZA 2QCSA 4DGOA 2WTKB 3FKNA 3C0IA 3UDBA 4GYGA 5E8SA 4GG7A 4QO9A 5E8ZA 2GQRA 2BDWA 4YC8A 2PMLX 3BBTB 5EFQA 5FD2A 4JBQA 2UW0A 3AG9A 4MD7E 4RZWA 4AQCA 4DFLA 4O91A 4RIYA 3W8LA 4A9SA 3DY7A 4DTKA 2C0IA 3V8TA 2O64A 1AD5A 3WILA 4CKIA 3GQLA 4WNMA 4CXAA 2BTSA 4RJ5A 4X2NA 3P7CA 1Q4LA 3PG3A 3RV4A 3ORTA 3DZOA 5C26A 3EFJA 5IA5A 3Q5IA 3I7BA 3AXWA 3QD4A 3HMIA 5AV4A 3NWWA 2R3QA 2V5QA 2RFEA 4JDJA 3UO5A 3WF8A 2F7XE 4FI1A 5JRSA 5KUPA 4OGRA 4CCUA 5DT3A 4X3FA 5IQCA 4KWPA 4BB4A 2PVNA 4FT7A 1B6SA 3RAIA 4Z7HA 1URCA 2PVMA 1PXOA 4X2KA 3ACKA 3FQEA 4Y85A 1V0OA 2UZLA 4G3EA 3DFCB 4E8AA 5HX6A 4EH3A 1BNCA 4E6DA 4F7JA 1DIKA 3LXKA 3QFFA 1JPAA 4FT9A 3EL7A 1REKA 3VUMA 2GNFA 3Q9XA 3S3IA 3UIBA 4CV8A 4FT0A 4N70A 1PMUA 4I23A 4CFFA 3SA0A 3D14A 4K0YA 2R3RA 4DCEA 4IWQA 1PK8A 5BVKA 3F7WA 4G17A 1OIUA 5GJFA 3UYTA 5HE1A 5M4UA 4ASEA 2E2BA 3A8WA 3OTUA 4D28A 3MPMA 4BCFA 1OBDA 2W4JA 5FXRA 4QMPA 4Y72A 5BYLA 3T9TA 2JBOA 3NUAA 4Z16A 4Y8VB 4IFGA 4MBLA 5EQYA 4HCUA 2LGCA 5JRQA 3PXQA 3H0ZA 2YW2A 4JLCA 2HXLA 3E3BX 2BDJA 4QQ5A 2J90A 3R8ZA 2CNQA 5EHYA 2R64A 4F1OA 2WOUA 2P2HA 3CD8A 2E9VA 5CAQA 4E4TA 3HA6A 3V5JA 3FKOA 3G90X 3SKCA 4H39A 4NTTA 2X2LA 4BDEA 3HA8A 4S31A 1Q8ZA 2UZWE 3VULA 3QTXA 2PN1A 3LFNA 4X2JA 4CVAA 3OUUA 3RAKA 3W55A 3OZ6A 4Q2AA 4YMJA 1IAJA 4FOCA 2ERKA 2WD1A 1ZMUA 3DBDA 3KF7A 3CTHA 3IW7A 4C5AA 3KRLA 3FL4A 2QOHA 4ITHA 3ODZX 2R0IA 5H3QA 4GT4A 4G6LA 4XRJA 2UW9A 3HAMA 3EQPA 4A4OA 3U4UA 5JT2A 3BYSA 4GJ3A 3P1AA 5AM6A 1SYKA 5FGKA 4FL2A 4L43A 3M11A 3PP0A 3V5LA 5I9VA 5ITAA 4L1KA 2RL5A 4C58A 2H34A 1A48A 4JDIA 4D0WA 4E1ZA 4NM5A 1H24A 1B6CB 2XM8A 4EHEA 3FAAA 4RWKA 2W0JA 4YBJA 1ZMWA 2Z7LA 3GQIA 3VS6A 5HD4A 1GZNA 3WZKA 5TOZA 5A46A 3VQUA 4ZY4A 2YJSA 3PVGA 4C0TA 5EYKA 1H0WA 1XBBA 4KIOA 2Y4IB 4FKJA 3HRFA 3RK5A 4G9RA 5FRIA 3U6HA 4GT5A 3MB7A 1MUOA 3UOLA 4EORA 3NUNA 5E8TA 4PDOA 3F82A 4FBXA 4L44A 4U97A 5EDPA 5BPYA 1M0TA 3MH1A 4BDIA 1BUHA 2ITYA 2PE1A 2XRUA 4DH8A 3NCZA 3U8WA 5C8MA 4EK8A 4RJ7A 3W18A 3FC2A 2XKEA 3PG1A 1F5QA 4LUDA 4XRLA 4BHNA 1YXXA 1DI8A 3GCQA 2QOOA 3JY9A 4FKWA 4LV5A 4GIIA 5EM6A 3VVHA 3PXKA 4FEQA 4X0MA 4IHJF 3BCEA 4IM3A 4NYEA 4AA4A 2F2CB 4IW0A 3DU8A 4TN6A 2VUWA 4F64A 3TUCA 1FPUA 3F69A 3K3IA 3NS9A 5IISA 4NCTC 3V5PA 4RVKA 4BDGA 4ITJA 4EUTA 3R8MA 4X3FB 2V55A 5AEPA 5C8YF 3KAJA 2JD5A 5K9IA 2HZ4A 2X8DA 3ZMMA 2BRBA 3PSDA 1WR2A 3DTCA 3R28A 3DJ7A 2RG5A 3UOHA 4UWBA 2ERZE 4BI1A 3TV6A 2B9JA 1U5QA 2GHMA 3F88A 3H9RA 3QTQA 4BDAA 4DG0E 4EOJA 5J2UF 2C6DA 4HNFA 3FHRA 4FV4A 5D7AA 4EI4A 2XNOA 5J1VA 2C5VA 4NUSA 2YM6A 4R7HA 5CA1F 5HVYA 4MV8A 2OJIA 5EDQA 1XQZA 5IQEA 2C68A 4FNZA 1PKGA 4F9AA 4EOQA 4JG7A 3Q52A 4TYHA 5AP6A 4EHZA 3OUZA 3BZ3A 3D15A 4PDPA 4PP9A 4D2SA 4KS7A 4DINA 2Z2WA 1PXPA 4IC8A 5LXMA 4AZSA 2C6MA 4JAJA 4BDHA 4MYGA 1TVOA 2Y8OA 3HYHA 3TZ7A 4EOSA 4YJ2F 3GNIB 2WEIA 3IW5A 4JG6A 5LMKC 3S1HA 3COHA 3UOJA 1FMOE 1NVRA 3OOGA 3R9NA 3RK9A 2YZMA 3V4SA 3ZFXA 4LYNA 2HYYA 5BYZA 4C2VA 2I8CA 2Z02A 3KXZA 4OT6A 3C50A 3EKKA 1ZYCA 4X7QA 5C1OA 2UW4A 4ACHA 3TACA 4KIPA 3GCUA 3Q60A 2IZSA 4EEVA 1UU9A 2EXCX 3LKMA 1RQQA 4C2WA 4BZNA 3QCQA 5IQGA 5FM3A 2RIOA 1PRYA 2W1EA 4QMQA 4C3RA 4E20A 5E8WA 4O2AF 5A4CA 2SCUB 5LYJF 4HR7A 4O0WA 4FA2A 3QKLA 4ZQIA 3BQRA 4CEGA 5C9CA 2GHLA 3Q1KA 4BF2A 3E8EA 2V59A 2WU6A 2OLSA 1F3MC 4YZNA 4HQ6A 3PY1A 4LRMA 3FLNC 4F7SA 3C1XA 2WTKC 1FQ1B 3KGAA 3V01A 4I3ZA 4TT7A 2C00A 3EQCA 4DBNA 4MXAA 4MD9E 3BEAA 3E8CA 3NIEA 1JSVA 4I5PA 4AN2A 4AF3A 4JRVA 3ID6C 3QCSA 1SVEA 2V0DA 2X7OA 2ETMA 3VUKA 4BYJA 4M15A 1U4DA 1UNHA 2YHVA 2XS0A 3LCOA 4D1ZA 5KMLA 4RFYA 4RG0A 2PVKA 5IA3A 1KSWA 2OIBA 3QUPA 4L45A 2CKEA 3PRIA 1KOBA 4I21A 1BMKA 5F9EA 2OI4X 4N4SA 3DJ6A 2WFYA 3IDBA 2KULA 3QQGA 4X3JA 3PIZA 2JKQA 2DZDA 2G15A 4FEVA 2ZM1A 2YEXA 4MXYA 2V58A 2RGPA 5ANGA 3AOXA 2WMSA 4AZFA 2QU6A 4G1WA 5ANJA 1VYWA 5G6VA 2W4OA 4BTMA 3Q2OA 5AV0A 1Z2NX 2IZTA 2C5YA 2FYSA 4E5BA 4AOIA 3OEZA 1G8AA 5AP0A 1OM1A 2W1DA 1YI3A 2UUEA 3VBVA 5HU9A 5H80A 2XIKA 4ANMA 3O50A 4WRGA 4Q5HA 2XKCA 4QYEA 2J5EA 1OIRA 4MD8E 4FFNA 3MIAA 4PUZA 3SXRA 3QZGA 4JAIA 2OK1A 3HP2A 4LOPA 3E8NA 3NMUF 3O96A 5L2IA 1W7HA 4X2GA 4I41A 1BLXA 5BVWA 3PYYA 2QQ7A 3NVMB 4XMOA 3SXSA 4FSTA 4DBXA 4E73A 4G2FA 1JLLB 4WIHA 4HW7A 3OCSA 3PIYA 3LFDA 5CSHA 2QHMA 5D10A 2J0IA 2UW7A 5HNGA 2PSQA 5HZNA 4CG8A 5KO1A 5AAGA 2DIKA 3GENA 3PXYA 4XV1A 4R7BA 2OO8X 3CTQA 4MA5A 1U54A 4OBQA 4N6ZA 2O63A 5EM7A 3VBXA 1XH5A 1JOWB 3R01A 4FKRA 4DLIA 2IZRA 1PW2A 2P4IA 5LMAA 2Y6OA 5C8NA 3A2CA 3BHVA 5BVEA 1Z2PX 2XF0A 5DLSA 5E9EA 2ITNA 3VJNA 4L3LA 4K2RA 5FM2A 4EOMA 4G3DA 3RM6A 2B52A 5CEQA 2YAAA 3G0EA 5CEPA 4ZTMA 3G6HA 3LMHA 4P4CA 4U81A 2JIUA 3KULB 2XCLA 2C6LA 3OHTA 3ZRMA 5AA9A 4LFIA 1M6VA 3PWYA 2PVPA 4ACCA 2P2IA 2YS6A 4FEXA 5J8IA 1H1SA 3COKA 1IG1A 3FI3A 4BC6A 4BCPA 4AP7A 3Q6UA 2XK6A 5CSWA 5JKGA 1YHSA 5AFVA 4C4EA 5GIOE 3D2IA 3P86A 1BL6A 4MXZA 3ANRA 4WUNA 3UQGA 4CMTA 5C1PA 1KBLA 2GS6A 3VHEA 4B0GA 3VMMA 4FZFB 3ZCLA 3KCFA 4JIKA 3MN3A 3MESA 3PWDA 3HBLA 1R0EA 3KREA 4XP3A 3U4WA 5IPJA 3GIDA 5KE0A 2VTQA 2QURA 3AC3A 2ZYBA 4IZAA 4Y8DA 3TKUA 4Q5EA 2OF4A 3D5XA 1K9AA 3I6WA 1PXJA 2WMAA 1GOLA 1LUFA 3QF9A 3DBQA 3UODA 3P0MA 4MH7A 4PNIA 2PZPA 3LFFA 5M44A 3POZA 5TKDA 4BDKA 3JXWA 3L1SA 4FSMA 1LR4A 1JQHA 2AC3A 1QMZA 2GTMA 3I1AA 2QNJA 4J96A 3MY0A 4RX8A 4Y5QA 5CEMA 3T8OA 5KMIA 5AIRA 4EYJA 5E91A 5FEDA 3MH0A 3VRZA 4L7SA 2C3IB 5AIKA 4FV9A 5ICPA 3TIZA 2EWAA 2BUJA 3EZVA 3LFSA 2YM7A 1PMNA 2HELA 3WNZA 2QC6A 4JJRA 4ZJJA 1M2RA 2IVTA 4LGHA 1XH7A 4MX9A 4IH8A 4D1SA 2EVAA 4B99A 4O2PA 5DMXA 1P14A 3FXXA 3QTSA 4O6LA 4W8DA 5IYZF 3JRXA 1FVRA 1WVXA 2WMVA 1ZRZA 3HKOA
chains in the Genus database with same CATH superfamily
1YW2A 4RC2A 1MP8A 4IWOA 3R8UA 2VGPA 4V0GB 1M0WA 4RZQA 5KS8A 2XP2A 3O8UA 4TYGA 5AM7A 2X1NA 4QDEA 4U0IA 5I5YA 3W1BA 2VU3A 2P0CA 3KFAA 5EM8A 5HHWA 1TKIA 2W7XA 3KXHA 1FBNA 4J7BA 4G3GA 2W6NA 1LP4A 3GC8A 5KX8A 3BU3A 4BN1A 4XLVA 3ZSGA 2XK7A 5HNEA 4B4LA 3R21A 4PL5A 1J7IA 4FYNA 4O7TA 4BCNA 2HVQA 3JZFA 2OJGA 3I5ZA 3L8VA 4A4LA 4YZMA 2AUHA 5E8XA 3PA4A 3W0QA 3V5TA 5AX3A 5HVKA 5I0BA 2BZJA 3MS9A 3R7EA 3T54A 3CY3A 5CA0F 1CKPA 4P7EA 3NVKI 3NUSA 3ODYX 3EL8A 4L9IA 2OG8A 4WO5A 5A14A 2QR8A 3TNWA 3QLGA 4AGWA 5EM5A 3UVPA 2YABA 3WWHA 4MNFA 3ORRA 2X7FA 1OZ1A 3T7AA 3QRIA 2COJA 4FFMA 4WOVA 2W17A 3VUGA 4ZZOA 5JK3A 4DG3E 4FTRA 5LVPA 2CGUA 4RX5A 4YTIA 3AD4A 3L9PA 2Q0BA 5KHXA 1CS0A 3R8PA 4ZSAA 3KIOC 2DWBA 3RPRA 4BJJA 3CKXA 4YJTA 5ETAA 5L6OA 3R7IA 1OL2A 3FZOA 3QXPA 2OW3A 5FR9A 3PVUA 5L6PA 2VNYA 1YVJA 1Z5MA 2XIZA 3K5UA 3OVVA 4NT4A 3GU8A 3ZXTA 4UN0C 1W93A 2BHEA 3D83A 3G2FA 4IB0A 4WBOA 3ZS5A 1UKHA 4V01A 3NYVA 2W05A 2PUIA 4F6WA 5BYBA 3H9FA 1H1RA 4N0SA 3F61A 4IANA 2BAKA 5J95A 2Q0NA 4M0ZA 4AACA 3F6XA 4DTBA 3ZO2A 2OXDA 1RE8A 3CLYA 3QX2A 4EHVA 5HBJA 4WD5A 1RJBA 2PZYA 4I0TA 2XBAA 4R3CA 5FQDC 2WTCA 1JDEA 3WZEA 2UZTA 3F5UA 4ORKA 3RHXA 3ET7A 3FY0A 4QMVA 4XUFA 3GB2A 1EZ1A 4XNEA 3OXIA 5HCYA 5A3XA 5JN2A 2X8EA 2IJMA 4TY1A 4FFOA 2HWOA 3HP5A 3UP2A 4JNWA 4YTHA 4DEEA 3FI8A 2HJWA 2EUFB 4UUGA 2DQ7X 1KJIA 3FXWA 1ND4A 2X0GA 5CM0A 4YAKB 3OWPA 3QZHA 2OZOA 5AP5A 5L8LA 2XKDA 2F57A 5FLFA 3DBFA 3O2MA 4USFA 3F5PA 5LMKA 1V0PA 3DKFA 4IE9A 2VTSA 2O3PA 1JKSA 3PSBA 3KF4A 3QHWA 5EHLA 4BCKA 4WG4A 5LJJA 3JSNA 3K3PA 4U3ZA 2C3LA 2J0KA 2XJ1A 2ZB0A 2GNJA 2JDVA 4J53A 4B7TA 2YACA 4HYIA 3RNIA 5A6OA 1O6LA 3MJ1A 4IZ5A 4TYEA 2VX3A 3LM0A 1KE5A 4AXDA 5AAFA 4ASDA 4L3PA 5ETFA 2J5FA 4QYFA 2VTPA 2A19B 4PL4A 4EZ3A 2WTVA 1ZYJA 3II5A 2XUUA 3BBWA 2C3JA 2CPKE 3ZM9A 4AAAA 4DIMA 5AP3A 5FEQA 1OITA 1IEPA 1PKDA 1H0VA 3QD3A 2LAVA 4F9BA 3V04A 3ZC6A 3Q96A 4JQ8A 3NUXA 3UGCA 3KMUA 3RZBA 3VBYA 4ENXA 5CAVA 3E5AA 3RV3A 1A0IA 1WRVA 4DH5A 4PZ8A 5HKMA 4O0XA 2CCIA 4RIWA 4IC7A 4DTAA 5KMMA 2F2UA 3B8RA 3I79A 3RP9A 4AT4A 3DXNA 3DCVA 3DAEA 4FTIA 2VTLA 4XBRA 3DAKA 2QD9A 3CPCA 5EKNA 3HL7A 3FSKA 4YLJA 3W2SA 3QTWA 3CD3A 3BV3A 2BHHA 3I81A 1WZYA 2C5XA 2YIWA 4H1MA 4IWPA 4NFMA 2F7ZE 4OTWA 4AQKA 3N51A 2R3IA 4O0UA 3ZDIA 2JLDA 2J4ZA 4R3PA 3ZLSA 4ZMFA 3VJOA 4AAYA 4E6QA 2ITWA 3MTLA 4ZJIA 2R5TA 4FTKA 5DE2A 1KJQA 1YHWA 2WHBA 2WO6A 3CKWA 4KSPA 1TFFA 2BALA 2CZGA 3KRJA 4IACA 1UWHA 3MSSA 4HJOA 4UEUA 2XNNA 4L01A 2ITXA 3F2AA 3IGOA 1XMMA 2B0QA 2WQNA 1Q61A 4FNXA 4RWIA 5CI6A 1H00A 3U9CA 4WBNF 1CM8A 2VGOA 2C5OA 2QLQA 1YOMA 2X4ZA 5FP5A 5K4IA 3TNHA 3WIGA 3EZRA 3OROA 5KX5F 2HY81 2WIHA 3OTVA 3R71A 1XK5A 2EJ0A 3U6JA 3SAYA 3HUBA 1OL7A 1L3RE 4AU8A 4BJJB 4EH4A 3HLLA 5H2UA 3ZH8A 1M2PA 5I5WA 4LOOA 2Y9QA 5I60A 4K33A 4RFMA 2XEYA 1Q8UA 3RWPA 2O0UA 4AS0A 4D4SA 5CU6A 1A3GA 3AT3A 3BL7A 4EFBA 5GNKA 4WHZA 5E4HA 2XCKA 4USDA 3N4TA 2R9SA 1DAYA 2W06A 4HGSA 2J0JA 4PX6A 5IQFA 1YDRE 2YM5A 4MKCA 4GKHA 4O22A 2XK4A 4XCUA 5CNOA 5EOLA 3UBDA 3VRYA 2WMXA 2FUMA 4TKSA 4E93A 3QTRA 4CCBA 2CLXA 1GZKA 1CKJA 4FVRA 3HRCA 5EK7A 3DB6A 5IEVA 5BWWA 4PDYA 3CGOA 4MBIA 3CXWA 1FGIA 1TQMA 3FMMA 3PUPA 3NYXA 5DVRA 3ULIA 3W0PA 4EKKA 3QTIA 4I6LA 5IDNA 2ABJA 3RVGA 3VS5A 2DUVA 4DLKA 3D4QA 3P9JA 4BIEA 4H05A 2PL0A 3VS7A 4AW5A 4S30A 5F94A 4UCRA 2BDFA 5D1PA 2R7NA 5BVFA 3BKBA 3V5QA 3TI1A 5IF1A 4S2ZA 4CNHA 3SQQA 3UG2A 2ZAZA 3E64A 3L9MA 3QQJA 4GCJA 4BICA 4DDIA 3T99A 2C30A 4MCVA 4EOIA 3AQVA 1AUVA 2R3JA 4QYHA 5AMNA 4HVIA 3A7HA 1KT8A 2R7IA 1OI9A 3GCPA 3IW8A 4I93A 4J99A 5DISC 1UU8A 5JQ8A 5C03A 4G5PA 3SOCA 4MV6A 3GCSA 3S95A 5BUEA 4E6NA 2PVHA 4E5AX 2PY3A 2GLTA 4D9UA 4NZMA 3MJFA 3N4VA 4Z3VA 5M56A 2WMRA 4W4WA 4CKCA 4FKUA 1Z9XA 3LFCA 3SVVA 4F09A 4YLLA 3OBGA 3RWQA 4UALA 3KVXA 2VTRA 4EK5A 1U46A 4L52A 2IVSA 4QMLA 3ZU7A 3ZYAA 1LEWA 3A7IA 4FK6A 4FV3A 3QQFA 2YDIA 5E8VA 3FPMA 1SM2A 4IWYA 5BX0A 3EH9A 4RIWB 5K4JA 2WTDA 2VTOA 4U42A 4RZVA 3GVUA 5C8KA 4IB5A 5GONF 4CKRA 2ITPA 2OIQA 2W1FA 1OIYA 1AQ1A 3FMJA 3FZSA 4OTGA 4RRVA 5HG9A 3TZ9A 3VBQA 3C5IA 5K5NA 3VUDA 2NPQA 4ALUA 3DTFA 1OUKA 3B2TA 3GP0A 2GHGA 4XG4A 5HG5A 4PQNA 3RM7A 1WVWA 2OWBA 3HV7A 4QEBA 4XG8A 2JAVA 3RPYA 4GL9A 3LULA 5HGIA 1JVPP 4I20A 4NZNA 1BI8A 4MWHA 5DWRA 3SLSA 4F70A 3KY2A 4JX3A 2IW6A 5CVHA 3NZ0A 2ACXA 4Z7GA 2PHKA 4I0RA 2X9FA 5J5SA 3BE9A 4TWPA 5CAEB 3MW1A 4FE2A 5HLWA 5ANDA 2QOCA 5CU3A 4M3QA 4LQMA 2XEZA 5CEIA 3ACJA 4I4EA 4A9TA 4EH8A 3QTUA 1IR3A 2CKQA 3Q4UA 2PK9A 1PXNA 1YXUA 5CAUA 2BRMA 2BRNA 5H8GA 4E26A 2BMCA 3MYGA 3DNEA 2J6MA 4M68A 5IQIA 2X5RA 3ETJA 3GXLA 4BKJA 4F99A 4AW2A 4YZBA 3AMAA 4JOAA 4HCVA 4FZAB 3VW6A 3FUPA 5IH6A 3LJ0A 2UVZA 5DH3A 4DEBA 2HZNA 2XMYA 3BYVA 5M57A 1QPDA 4MEDA 4E4LA 4ZHQF 4J8MA 4M13A 4J97A 2FP4B 5AV3A 4V04A 3PY3A 4BBMA 1B38A 1YHVA 4MNEB 1KV2A 3DPKA 4FT3A 3AT2A 2YCRA 1UC9A 3LMIA 5EG3A 5EZYF 3FI4A 2BTRA 3TV4A 4A9RA 2BZHB 3TM0A 4BZDA 3VBWA 2KTYA 4EQCA 5BMSA 4FR4A 2BIKB 2PULA 2WQOA 3NR9A 4TYIA 2IW8A 5ANOA 3Q04A 2WB8A 4FZDB 3RPSA 3AC2A 3DDPA 4NFNA 4B9DA 4ZS4A 4O0SA 4UY9A 4E6AA 2GNGA 4AUAA 3R5HA 1XBAA 4BDBA 3LCKA 5LWMA 3CGFA 1XKKA 3CEKA 2IVUA 3EQFA 2CNUA 1CKMA 2X2KA 3PZEA 5BVNA 2HZ0A 3N9XA 4TWNA 5JQ5A 3C4ZA 4BI2A 4DHIB 3FZ1A 3QRTA 4XEYA 3TINA 3PFQA 4BZOA 4GK3A 2GQSA 2X6DA 3MH3A 4JMQA 3UOKA 4ID7A 4FG7A 2F9GA 4XOYA 3U9TA 2XARA 2WIPA 4GSBA 5M55A 2NU6B 2NU7B 3ZEWA 5JH7F 3OWKA 4C37A 3CPBA 4YO4A 2X4FA 3QYWA 4AXEA 3NBZB 4PMSA 5KKRC 4F08A 4PWNA 5CU4A 1PMEA 2J9GA 1URWA 4FIHA 4EHGA 4BCHA 4C62A 4DQNA 4F78A 5AP4A 2VTHA 4E5WA 5IEYA 3DKGA 3BWFA 3O7LB 2VTTA 2GQGA 4FNYA 4HVSA 3UMXA 3FQSA 1Y6BA 2R7BA 5AUYA 3TXOA 5LA6F 4KSQA 4O7RA 1ZXEA 1H26A 2PVYA 4IJ9A 4RJ8A 4D9TA 5CEKA 4YU2A 3W2RA 3TT0A 4FG8A 1IOVA 1OL5A 1Q99A 2CKPA 4GFGA 5FNVF 4HCTA 2ZB1A 3WI6A 5M4CA 4RJ4A 1JKKA 4I5CA 1EUDB 5CQUA 2WU7A 3FMDA 4H1JA 3LFAA 3FWQA 4O7SA 4TPTA 4NH1A 1UNLA 2QI8A 3ZLXA 5BPHA 3UIUA 2FGIA 5A4EA 3QA0A 4DFZE 3NYOA 1SCUB 3E8DA 4UCSA 1H07A 4PZ7A 1GNGA 4F0GA 5BYAA 1BL7A 5HE2A 4RPVA 4C5CA 4FIIA 1W84A 2ZDUA 3VQHA 3A4OX 4HPTE 1EKFA 3CJFA 3OW4A 3FJQE 4AE9A 5C1QB 3JZIA 3ZO3A 1P16A 5I5ZA 5GJDA 2BFXA 4KBKA 1VYZA 5L8JA 3PDTA 5AJQA 2YM4A 3UZBA 3UNZA 4O7VA 2QLUA 2QO2A 4II5A 1OVEA 4PDSA 5CF6A 1RW8A 2YWPA 4TWCA 2JITA 4DDGA 2Z7SA 4V05A 1V1KA 5CY3A 1I09A 1G8JA 4F6SA 2I0EA 3LPBA 3SD0A 5KMNA 4O27B 2UZUE 3FMLA 5B0XA 3F3TA 3HV4A 3ZSHA 5C4KA 5AP2A 4UCTA 1KJ9A 2VNWA 4EK3A 3UZPA 4HYUA 4NM0A 2WXVA 4QTCA 2BZIB 2CGWA 2OJFE 3QGWA 3ORZA 5HG8A 5BWRA 4PTCA 3PSCA 4ZSJA 4U80A 4FIEA 1STCE 3TNQB 5CSVA 3JPVA 3UTOA 2WPAA 3R9OA 4MV4A 3IKAA 2P0AA 2ZGIA 1GLVA 5JVLA 4DH1A 4GMYA 2WTJA 4QP4A 1SMHA 5DT4A 1IYDA 4IMYA 3RI1A 3I5NA 3KULA 4XG3A 1I1LA 3TNIA 1G5SA 3HB9A 1H4LA 3BLRA 4QOXA 2QO7A 1W82A 2OIDA 3DJ5A 3HUCA 5IU2A 1GZOA 4D4RA 2WOTA 4O7LA 2R3LA 4CFUA 1Q62A 2HW7A 3F3VA 3R8LA 5JFVA 2RF9A 3UO4A 1W98A 4RFZA 3UE4A 3HRBA 3T9DA 4ZTHA 4GS6A 3R7VA 4C33A 4ZLOA 3ZHPC 2BVAA 1FVVA 3AGLA 3OCTA 2XD4A 4U40A 4K6ZA 3NDMA 1Q41A 2ZV8A 2W5BA 3HX4A 2W99B 3LFQA 1SVHA 3CY2A 3D7TB 4C38A 5CAPA 5CB4F 1G3NA 5DA3A 3RJCA 2ONLC 2PVJA 4YJUA 5IQBA 2JEDA 3EN9A 3LZBA 3RALA 4JX7A 1XHAA 3BQCA 1QPEA 4ACGA 5IMXA 3O8TA 4XHKB 1IRKA 4O96A 3HGKA 3QZIA 4GKIA 3NYNA 3SX9A 4CRLA 3N8DA 5HVJA 2JKMA 2YIQA 1J7UA 4UV0A 5LMBA 4L3JA 3MY1A 2C6EA 3NW6A 5D11A 2JDOA 3TN8A 4BTFA 5M07A 4BIDA 1I7NA 3E5NA 4I50F 2XA4A 2W70A 4E4XA 5I47A 3T9EA 1GZ8A 3TEKA 3VUIA 3DQWA 5E92A 1E1XA 3GOPA 4LL5A 4BCQA 3GDEA 3G15A 4BHZA 4ZJVA 5IA4A 3W10A 4YJRA 3O0GA 3WWIA 3C51A 3F3UA 4RX7A 5IUHA 3N6RA 4QMWA 3GI3A 3R5FA 2PPQA 4N57A 1UU7A 4JVGA 3S4QA 4KBAA 3PXFA 4ZZMA 3O71A 4L67A 5DT0A 3MVHA 4RJ6A 2R3PA 5HG7A 2Y6MA 3QCXA 2XNPA 3BGZA 5JSMA 4M9UA 1J1CA 4O2ZA 2R3OA 2I1MA 4NZOA 4K1BA 2G1TA 4ITIA 2HW6A 2XIYA 1S68A 1OMWA 4ZSLA 2ZV9A 3OP5A 4OTQA 5HEZA 3U54A 4J71A 2FSOX 4QMYA 5LARA 5LVNA 4TV9F 4JL9A 4FEUA 3QQHA 4V0GA 5IUIA 4QMUA 4ANLA 1H28A 1OL1A 3E93A 2YWVA 1GIIA 3MFRA 4UWYA 3LVPA 3PE1A 5AUZA 2C0TA 3HV5A 4FKVA 4C4HA 2GNHA 5IMEA 5LOVF 2VTNA 4MXOA 4P2KA 5L2WA 4IDTA 5AUWA 2OFUA 2B7AA 4O4HF 4EH2A 1Q3WA 1OIQA 4ENYA 3D5VA 2R7MA 4BCJA 5ANEA 4EH6A 3QWUA 3TKHA 2QKRA 3R00A 2SRCA 4KKHA 4HNIA 4KRDA 1QPCA 5CTPA 5JEBA 3ZFYA 2VN9A 3H30A 2PE0A 3DT1A 3TIIA 4ZTNA 4QMTA 2VRXA 2QONA 1TAEA 1EKPA 1GY3A 2J0LA 4A9YA 2CGXA 2ZDGA 4C4IA 2R3GA 4D5KA 2VWYA 4FC0A 5HNIX 1JKJB 4IVCA 4R5SA 3ENHA 3FI2A 5DEWA 5BNJA 4QP8A 3VF9A 2F7EE 3OFMA 4HYSA 3TZ8A 1KOAA 5JQGF 5GJGA 4TV8F 2B9IA 3MTFA 2VTMA 4KKGA 4QQTA 2Z7RA 3MBLA 4BDJA 3FE3A 5DR9A 4LL0A 4ACDA 4YNOA 3DBEA 3RCJA 2QOIA 3O8PA 4KNBA 5AV2A 3OC1A 3UVRA 1U5RA 4O6EA 4RVLA 4C36A 5A4TA 1R0PA 1XDNA 2CHLA 2YDJA 4RGJA 3MI9A 4ZK5A 4JI9A 3H0YA 4EC8A 3OXZA 1WVYA 2XVDA 2W9ZB 2GPHA 4NKAA 4U41A 4Y73A 4KABA 4Y83A 1CTPE 3SW4A 2QK4A 4J52A 5CNNA 4FKGA 5I5SA 4ASXA 2AC5A 3RPVA 2ITOA 4CQEA 2R7KA 3VPDA 5M06A 4YJ3F 3ALNA 4FSZA 4J1RA 5FP6A 4TVIA 3HO8A 5CXHA 2R3MA 2VQDA 2W6OA 4RVMA 1YWVA 2W9FB 3NAXA 3VS4A 3G6GA 2WAJA 3PZHA 1PXLA 2WZJA 3F3ZA 3P79A 4BTKA 2G2FA 2W5HA 4IAKA 4O82A 4WT6A 1HCLA 1W96A 3BX5A 3LIJA 3S24A 2FB9A 5L2TA 2PMIA 4LMUA 3SG9A 1S9IA 4GU9A 3AMYA 4CT1A 3JZ6A 4GLWA 4O0YA 2OBJA 2VO6A 3AC8A 3AKKA 1P5EA 3L8XA 1UA2A 1W83A 5I9UA 2VR1A 4C4JA 3LQ5A 3BLQA 3TKIA 4ZMEA 3EHAA 4QRCA 2Y7JA 1ZOHA 1W8CA 4NM3A 3DS6A 3VO3A 1EUCB 5HBRB 5EW3A 1WCCA 3DNDA 5I9XA 3E92A 3OY3A 3OCGA 2CDZA 5FXQA 4ZY6A 3ETAA 4ME6A 5IZFA 3LMGA 4TTHB 5CANA 3LLTA 4FTMA 1SNXA 3MVLA 3WZJA 3GC0A 4TW9A 1KC7A 2VWXA 4YPDA 5AWMA 4XZ3B 3LXLA 4A06A 3T9BA 3DGKA 3F5XA 1KE8A 3BGPA 3OF0A 4JRNA 4YC6A 4C61A 4PBCA 2YIYA 3PXZA 4XLIA 3ZRKA 2X6EA 3G0FA 4ANBA 4MBJA 3LW0A 4EL9A 4DEDA 5I4NA 4ZTQA 5JFSA 3FMHA 2A1AB 4GRBA 4IAYA 4YP8A 3ENMA 4ZIMA 4D4YA 5IA0A 3IPHA 2OH0E 3OWLA 4KBCA 2DAAA 3PA5A 2QB5A 4YNEA 2PUPA 3QCYA 3QD0A 3QC9A 4QYYA 4PNKA 3SGCA 2WGJA 5HBEA 4G31A 3C7QA 3EN4A 3O17A 2VTIA 2G01A 3LQ8A 3UG1A 4GYIA 3R5XA 3VAPA 3BU5A 4LM5A 5IG1A 3RTXA 4DFNA 4OTIA 3TYKA 4FEWA 4E7WA 4RWJA 3RFCA 2ITZA 3OXTA 2YITA 5E8UA 3UPXA 4BCOA 3FLQA 3SGIA 3DXQA 3PFYA 4M7IA 4FSWA 1ZYLA 4IDVA 4QTDA 3MY5A 4W4XA 4ZOGA 2W1GA 3R8VA 4LH6A 5IA2A 1YQJA 2JIVA 1GIJA 2XK8A 3EFKA 3FL5A 3PP1A 1K2PA 2UZEA 5EYDA 3TW6A 1H25A 5EW9A 3UQCA 3M1SA 2GPWA 4D55A 2WMBA 3LM5A 4K6NA 2HWPA 2W6PA 4HNVA 2XZSA 2PMOX 2QG5A 3EN7A 1CSNA 3PPZA 3R6XA 1YDTE 1BKXA 3B8QA 3QXOA 3REPA 3VUHA 3Q9ZA 3QZFA 3U9SA 4GK2A 4R77A 2REIA 4O0TA 2P3GX 3LFBA 2NUAB 3LJ2A 3CIKA 3R83A 4O2BF 4DGNA 3GB8B 1KE9A 3RKBA 1S9JA 3BHHA 3R04A 1I1KA 4XV2A 4ZZNA 3ITZA 4DFBA 3ELJA 5EYCA 1VBHA 3ML1A 4Y95A 4BCGA 4ALWA 2NRYA 4JIAA 2OKRA 1IOWA 1ST4A 1E1VA 2OJ9A 5A9UA 2V62A 1J7LA 2BKZA 4U7ZA 3PJ3A 2VWIA 5CU2A 5J2TF 1UKIA 3CR0A 3Q2JA 4KA3A 4CFNA 4DCAA 5EH0A 1JLUE 5EDRA 5DEYA 3CQEA 3EQDA 2PZIA 3LCSA 2C1BA 2PBZA 5FUTA 3Q9YA 3DK6A 3Q6WA 3QAME 4FOBA 4WKQA 3VS0A 4R1YA 4JR3A 1OPKA 3GU6A 3VS1A 4ZP5A 3W2PA 1OKWA 3OMVA 1GSHA 5A54A 2I0YA 2NNWB 3A60A 2CSNA 3OBJA 3ORPA 4ZEGA 3FMEA 3EIDA 4NJ3A 4CMFA 2HHFA 4MF1A 5CSXA 3LLAA 3KC3A 3I7CA 3KXNA 4NSTA 4CZUA 4IX4A 4IVBA 2BKKA 5FDPA 1CKNB 1FVTA 2EJ3A 4IB1A 5FTOA 2XAOA 3WBLA 5CF8A 4UFZA 2ZV2A 3ZLWA 2X8IA 3LHJA 4S34A 3K3JA 5EOBA 4ERWA 2I80A 4UCOA 3IONA 4I5MA 3KXXA 3OEFX 4NM7A 5IQDA 1JSTA 3BL9A 2ZDHA 2PVLA 4QNYA 3MFUA 4WHXA 3PE2A 4NW6A 1Q3DA 3R02A 1VKZA 4YPSA 3FQHA 3V6RA 5HIBA 3QYZA 2O65A 4DITA 4FTQA 1WAKA 5IDPA 5J87A 1NA7A 3GC9A 4LOQA 3C4EA 5FTQA 4FMQA 2IN6A 3PTGA 4U3YA 5CVFA 3SOAA 3WZDA 4ERKA 5K2MA 1DI9A 3KCKA 3WO0A 4HVGA 1KV1A 3VPBA 3K5VA 1P4FA 1WBWA 2IP4A 5FTGA 4PMTA 2C3KA 2WKMA 4AXFA 5CASA 2ETKA 4FV2A 2UV2A 1U59A 1UVRA 1ST0A 1LPUA 4YC3A 3EQHA 4GFMA 3W1GA 3IOKA 1NT2A 4ZLYA 1OKVA 1XH6A 3D94A 4FODA 1E4EA 4FFRA 4NKSA 5K3WA 2V7OA 2YS7A 3VIDA 5CS6A 5HTBA 3NSZA 4H36A 4PY1A 1CKIA 4FG9A 1PF8A 2ONLA 4QP1A 4MHAA 4KUJA 4A07A 4X6QC 3BYMA 3MVJA 5DR6A 5BUIA 1B6RA 4WBBB 4Z9LA 3VHKA 4DGMA 5HIEA 4MAMA 4LV8A 1YI6A 4XYLB 1H8FA 2BZKB 2CJMA 2OLCA 3A7FA 3LCDA 3R63A 4EFEA 5D1JA 3ZONA 3GU7A 2HK5A 4IIJF 3NX8A 4OUCA 3VW8A 3VWAA 5KBQA 3ROYA 5CR5A 2H9VA 4FTUA 4ACMA 4USEA 4TUYF 4FZ6A 1TQPA 4NU1A 4I92A 3WF7A 5JGDA 4YBZB 3GBZA 4X2FA 3E63A 1JLLB 3JS2A 4RA4A 3U55A 5BVDA 4YHTA 3TZMA 5DFPA 5KKRB 2VTJA 3L8SA 2H96A 3W5OA 4OLIA 2HGSA 2EXMA 3R9RA 4OT5A 2Y4PA 4WSYA 2O2UA 3UDTA 3MIYA 4DHFA 4JQEA 5AA8A 1XWSA 2EU9A 4FV6A 3TY9A 2H8HA 4AE6A 3EJ1A 2C0OA 3BRBA 4LG4A 3PLAE 3DAAA 2UW3A 3I0QA 4EYMA 3K54A 4TYJA 3UP7A 2IPXA 4FKIA 3EMGA 3GU5A 3QRJA 4C3PA 3UZOA 4X21A 5M4IA 3NUYA 5IQHA 1DV1A 4BBEA 5TO8A 3BA8A 4M69B 4CMUA 3S0OA 3Q53A 4MA0A