3NUAA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from clostridium perfringens
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
236
structure length
236
Chain Sequence
b'AMVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFGRYNGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRLRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal Structure of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase from Clostridium perfringens
rcsb
source organism Clostridium perfringens
molecule tags Ligase
total genus 84
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuaA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3nuaA02
2VX1A 3B2TA 4ASDA 2C5NA 2C68A 3LAUA 2C69A 2UW0A 2EB2A 2B52A 2PVNA 3QZGA 2VZ6A 4X21A 4EKLA 4DEBA 3ZU7A 4EQMA 5BVNA 3NNUA 1U59A 2R3PA 1Q4LA 5DE2A 2FA2A 4TNDA 4EUUA 1UU7A 1E9HA 1YQJA 1Z9XA 4UB7A 5KMJA 4MA5A 4NM3A 4XV3A 4U45A 5KHXA 3P78A 5AUUA 3KULA 3KXXA 4FMQA 3PP1A 1IA9A 5LJJA 3KU2A 2GQRA 3WARA 1P2AA 2C5YA 3EKKA 1PMEA 4L3PA 4QQJA 2G1TA 1H01A 3QGYA 5EM5A 3TZ7A 3MW1A 4GS6A 3FZ1A 2LAVA 3PY1A 3VBYA 2PL0A 2ITTA 5ETFA 3RP9A 1JSVA 4C38A 4DTBA 3E88A 3AGLA 3OD6X 4MNEA 3FSKA 3THBA 3QTIA 4I41A 1SCUB 1PXOA 5M4FA 3P08A 3R7YA 4UY9A 4A4XA 4EWQA 4I0TA 4NUSA 3SD0A 4TL0A 4XBUA 4LOOA 2JDSA 3R2BA 3GCSA 5AUWA 4ZTQA 2BTRA 3QZFA 4FKLA 2VWWA 4JIAA 4Z3VA 5HVYA 2OWBA 5AUXA 5C8YF 2VPQA 4FT0A 1XQZA 4DLKA 5I9YA 2CDZA 4ACHA 1ATPE 3UYSA 5IA5A 2BFXA 4GIIA 3VIDA 5M57A 4C0TA 4I0RA 4MYGA 4CNHA 4DFUA 4O86A 5DPVA 3CTHA 4FEQA 3KRLA 5J2UF 4H3BA 5HESA 3DBQA 4QP9A 3KY2A 2C6KA 3FL4A 3IGOA 3E8NA 1KJJA 2PUIA 4NFNA 3V8WA 4IM0A 3HRCA 3RALA 4FIJA 1DV2A 1KUTA 2W1FA 2QR8A 5M08A 3JZIA 3F3ZA 3PXYA 5CB4F 4WKQA 4KRDA 3UODA 2JKOA 1H1WA 3DB6A 5IDPA 3BYUA 2GS6A 4BCJA 4DT9A 3L8SA 3VO3A 3I4BA 4GVJA 2B9IA 3SXSA 5LVMA 2CNVA 2R9SA 2ITVA 3JS2A 5EI8A 4FT9A 1FGKA 2PN1A 3MJFA 3NUPA 3ZONA 2WMQA 4EZ7A 4F63A 4X6RA 4HR7A 3R1YA 3U9SA 4IM2A 2WTJA 4U80A 1ZWSA 3ZC6A 3LCTA 4ZJIA 4ALUA 4L43A 5GJDA 4O6EA 3LIJA 2O3PA 4Z9LA 1U54B 2YZAA 3O7LB 2UZBA 1PYXA 4MTAA 3HX4A 4EH6A 1YI6A 2IN6A 3NYOA 4FGBA 4FODA 3TWJA 3DS6A 1KJ8A 4AQCA 5CS6A 4F0IA 4D55A 5AWMA 2NU8B 3E92A 2IJMA 4BBMA 4MX9A 3JY9A 1Q8ZA 4YJPA 2VTRA 4YNOA 3UO4A 2OZOA 3FMNA 5BQ0A 4MV6A 2JGZA 5A54A 2PSQA 4J1RA 3U51A 4TWCA 3QD0A 3FZTA 2XRUA 3HL7A 2CNUA 3ID6C 3LFEA 4FTJA 5D41A 2A1AB 4HCTA 4OTQA 4YSJA 5GHVA 3LFDA 4OBOA 3BBTB 1BX6A 5B2KA 1TQIA 2PPQA 3Q3BA 3EQHA 3V6RA 3BX5A 5EQPA 3L9LA 1O6KA 3IPHA 3DXNA 2FVDA 2Y4IC 3MSSA 3QTWA 1XH6A 4GFMA 2X4ZA 4Q9ZA 2ESMA 4IAIA 3U9TA 3PIZA 4OW8A 3OY3A 4IWDA 3ZYAA 2YWVA 2RFEA 4FT7A 2OLCA 3O17A 4XP2A 3VS4A 2G2IA 4OTHA 3UIMA 4OTDA 4QMPA 4FC0A 5J87A 5EYDA 4ZHQF 1GZ8A 3GU4A 3OUKA 5IA0A 3B8QA 2YA9A 4R7IA 3K5IA 4CMOA 5KZ0A 2CKQA 4FSNA 3II5A 4U97A 3TJDA 2CN8A 2PZ5A 2YIYA 3QQFA 4ZS4A 1QPJA 5IH6A 4CRSA 5KMMA 3VS3A 3UC4A 5D12A 4CTCA 4O83A 4G1WA 1KE7A 2YJRA 3AGMA 4EK6A 3EYGA 5J8IA 3VW8A 4DH1A 4NCTC 3WE8A 3GCUA 3LCOA 4H39A 4CFFA 2IVTA 4XG6A 4RIYA 5DHJA 2F9GA 4ZLYA 2GQGA 1DAWA 2AYPA 4L00A 1CQJB 3NIEA 4PX6A 3MJ2A 4EOLA 2H8HA 3VHEA 2ITXA 2NRUA 2DYLA 2PVYA 2OJJA 3CCNA 3PWDA 4XG7A 4YZBA 5IQFA 2BRMA 4RLLA 4FL3A 3FQEA 2W06A 1OL7A 3NX8A 4NTSA 4KSPA 3COMA 3F66A 3CY2A 5DIAA 3CJGA 5EI6A 4G3GA 2JIVA 3FKOA 3VUIA 3LKMA 3TNQB 5DYJA 2XM9A 4BI0A 3PE2A 2I0YA 4IQ6A 5FM2A 4AU8A 5KNJA 1UU8A 3GP0A 1Z57A 5CEPA 1JAMA 3R21A 1YOMA 4MF1A 4R1VA 3Q2OA 5FP5A 5LCJA 4E5WA 4ZSGA 4CG9A 3AC2A 3GU8A 3I5NA 4J95A 5AP0A 2PZIA 2ZJWA 3C4EA 3OT8A 4YHFA 4PMMA 3KEXA 5K4JA 1JQHA 4DH8A 4EH5A 1ZMWA 5EFQA 3R7VA 4E4XA 1B6SA 3ZS5A 5CU3A 4DIMA 4XX9A 4QP7A 5H8BA 5IA3A 1GSAA 5A9UA 3WO1A 1WVXA 3PUPA 3O8PA 2QD9A 2VV9A 4DFBA 5LWNA 4DTKA 3WF7A 2XCLA 1W0XC 2IW6A 1F3MC 2A27A 2O2UA 2X7GA 3OMVA 4RVMA 5CASA 4EK5A 2YABA 4O81A 3D9VA 3ZUUA 3REPA 3FZPA 1OMWA 2PYWA 2VTSA 3P4KA 3H30A 2IZRA 2XP2A 3ZLSA 1XH9A 4QSHA 3C50A 3DBDA 3PPJA 2XK3A 1IOWA 2OZAB 3HV5A 2CJMA 5EYMA 3TXOA 4WNPA 3UJGA 2YJSA 4GIHA 4BDGA 4E6CA 5M09A 4R78A 3SKCA 3ZSIA 4FR4A 4K1BA 3LFAA 5DGZA 3I6UA 5LMAA 3RMFA 2IVUA 3F5XA 2Y6MA 3VOTA 4FL2A 4IAAA 4IZOA 5LXMA 4JBQA 4CCUA 2HYYA 2WMTA 3ETAA 4P2KA 3LMHA 3MVLA 1QPDA 3ZRKA 2HZ4A 1CS0A 1OIYA 3FMJA 5ACBC 5IMXA 3DY7A 4ACGA 4GG7A 3ATSA 4MD8E 2XEZA 4TYHA 4FG8A 3BPRA 4KD1A 4YBKA 2XZSA 4O27B 3WI6A 3TIIA 2YN8A 1ZRZA 2R3LA 3O7LD 1OVEA 4RX9A 4R3RA 3HZTA 3FLWA 4KBKA 4BDFA 5CVGA 1JKLA 3KRRA 5AAFA 4CZUA 1SM2A 3I79A 2OGVA 3V01A 4RMZA 4FFPA 3MFRA 4DF3A 2RGPA 3GC0A 4GUEA 5ANOA 3MN3A 2OIBA 1VEBA 2PE2A 4DT8A 3OEFX 3NVMB 4EQUA 3OG7A 3DNEA 4HPTE 4G3CA 4CKJA 4EOJA 4ZMEA 3DPKA 1G3NA 3KRJA 3QXOA 3LM0A 4RT7A 3UE4A 4JI9A 1OBGA 3Q5IA 2ZV2A 3MFTA 4DE4A 3QGWA 3LFFA 3AXWA 3OXIA 3U4UA 4B8MA 2J5FA 4PP9A 4ACCA 2VQDA 3D7ZA 3GT8A 4L8MA 4NJ3A 5EDRA 5IUGA 3TDVA 4JDIA 4NU1A 3TKHA 2X2KA 3F88A 1NVQA 2V5AA 2WD1A 2WTIA 4GT4A 2GDOA 3DLSA 4DEHA 3HDMA 4G17A 4L44A 4EHGA 3TQTA 4WRSA 3MJ1A 3UQCA 4FVRA 4C3RA 3EZVA 1MP8A 4LV5A 4M67A 3W2OA 5IA1A 1KOAA 2PE1A 3WE4A 3W32A 1FVVA 1OECA 2RL5A 3T3UA 4Q5HA 5IQCA 2QR7A 3SA0A 1REJA 5EOBA 2F57A 4DFNA 4AAAA 2WFYA 3LFBA 5BMSA 5C1QB 5CNOA 3IS5A 4HGTA 4FL1A 1O6YA 4N70A 2R3NA 2PMNX 3CC6A 3DKOA 3LFNA 5IQIA 4JDHA 5KHWA 5BNJA 3A99A 4APCA 1XH5A 4O7RA 2PBZA 3ZM9A 5HEZA 3OEZA 3JPVA 5AP7A 4AZSA 3ORTA 4CVAA 1P14A 4M8TA 4OLIA 5K4IA 2Z04A 4O2ZA 1JNKA 3U4WA 4FUXA 3UVRA 5GJGA 4FG7A 2OXXA 2QO2A 2WB8A 3ZLWA 4MA0A 2QURA 3ET7A 4DLIA 2NRYA 4BCMA 3GFEA 4UWBA 5ANEA 3V4SA 3BCEA 3F5GA 2W1EA 4Z7GA 4S33A 2WTVA 4YJUA 4DG3E 4O2BF 1YI4A 3EL7A 1VR2A 4EKKA 4FKVA 1LEWA 5HORA 3G9NA 4RX7A 5AX3A 5FXRA 1YVJA 3RPYA 3VS5A 3CQEA 4EZ5A 4DAWA 2FP4B 4HNUA 3RM6A 3MVHA 3KMMA 2GTNA 4PNIA 4U42A 2BRHA 4WIHA 2UW4A 1K9AA 5JN2A 5LCKA 5JFSA 3PXZA 2GNGA 5E92A 5J9YA 2FPIB 1GIIA 2R3HA 3D0EA 5H8GA 2BKKA 3CTQA 2DWBA 5HIBA 3R9RA 2XNBA 3Q04A 3ZDUA 4I6HA 3G8DA 2C47A 1UU9A 3FQSA 4IW0A 3RAHA 1M14A 4UX9A 3VULA 1CKPA 2QU6A 5CU2A 3VN9A 3ZRMA 4ASZA 4DGGA 4ZAUA 1Q24A 3PJ8A 2ZOQA 4GK4A 1LR4A 2GMXA 4JX7A 1GSHA 3PY0A 3G5DA 1E1XA 3KA0A 2GS7A 2G01A 4O0RA 5CU6A 3R01A 3E64A 4FKSA 4CFVA 5A4CA 4PDYA 5D11A 1BL7A 1WBWA 3WIKA 3LCSA 2JKQA 4UXLA 4BDEA 4D4VA 4FV2A 2BR1A 5IA4A 1YI3A 4FKJA 1G8SA 5H80A 5IMEA 4I4FA 3NAXA 4FOCA 2HIWA 3TKIA 3POOA 5HTCA 2WKMA 3C7QA 3BIZA 2I6LA 2XB7A 5M44A 3OCGA 2J0LA 2C5OA 4J97A 2OSCA 3DB8A 4DITA 4RA5A 3QUEA 4IE9A 3OS3A 5DR2A 2CGXA 4IDTA 4B4LA 5BMVF 1JBPE 5HBHA 5BVKA 5DR9A 1JWHA 4HCVA 2Z7LA 2OF2A 4EOIA 4D0XA 3A61A 1JKKA 3G0FA 3WF5A 4HYUA 4DCEA 4EBWA 3RFCA 4QMXA 5DT3A 4IZYA 4YJNA 2ZVAA 3QUDA 4XHKB 3HDNA 5M4IA 3RHKA 4DFYA 3F2NA 5CQWA 3R7UA 5GIOE 3IDCA 2W1ZA 3V6SA 4AP7A 1PXPA 4ZIMA 5JMSA 5L2SA 4MV3A 1P4OA 3AQVA 3HMMA 4JBOA 4TW9A 5IQAA 3QZHA 4YZCA 3Q9WA 3S95A 1OUYA 4V05A 4YHTA 4A06A 3ROCA 3I0OA 4L46A 4F6WA 4IACA 4CEGA 5TR6A 5EDQA 5FBOA 5FTOA 4ASXA 2W6NA 5LP6F 4ZI7F 1OKWA 4FIIA 2W5BA 4DH3A 3CJFA 2R7KA 5ACKA 3WF9A 3QRJA 1W82A 1NA7A 5IUHA 3FEGA 3QKLA 4Y8DA 2PVRA 3FYJX 3P9JA 5FDXA 1JLLB 3PP0A 4WBNF 1NY3A 2PUPA 2VWIA 3DJ6A 5AP3A 2YACA 4KIOA 3WZDA 4BDKA 4APPA 2GNIA 5F9EA 5JGAA 4LL5A 4QTCA 5LQFA 1BNCA 1G8AA 3EJ1A 4CLJA 3RV4A 4NFMA 2R2PA 2YCQA 3MWUA 2QLQA 4TWPA 4ZTRA 5DRDA 3NYVA 1YWRA 1VYZA 1RE8A 2G15A 1H1PA 4U9AA 5HX6A 1J7LA 1LEZA 4O21A 4GCJA 1Y8GA 1YRPA 2UW8A 3VJNA 4MH7A 2CKPA 3AMYA 4RJ3A 2JIIA 2F4JA 4P5QA 4O7SA 1YXSA 1STCE 3BWFA 3MYGA 2Z2WA 4GT3A 2YS7A 3FPMA 2HAKA 3BHHA 1IOVA 3RK7A 2R7IA 2XK7A 3RTPA 3F6XA 3Q96A 4BCPA 2DUVA 3F3WA 5T6KA 3SQQA 4C4JA 4DGNA 4RVLA 4HNVA 5IQHA 3JYAA 4BDDA 2YCRA 3CD3A 4JL9A 2UVYA 4TZRA 5CEQA 2GCDA 4Z55A 4M9UA 3S3IA 3MH3A 5D9HA 3VS7A 4FKOA 4IZ5A 3F3VA 4HNFA 4FTAA 4XP3A 4FEXA 3FUPA 3Q4ZA 3DLZA 2YDIA 3O23A 4O2PA 1WBOA 3KB7A 4XG9A 3VS0A 3W2SA 3KGAA 5IU2A 4ORKA 1SMHA 3PA3A 4JR7A 2P33A 4NWMA 3KAJA 3H10A 2RFNA 4MNFA 1W98A 2XYNA 2ZMCA 3IQ7A 5IG1A 5LVNA 3KRWA 3V4ZA 4ANQA 4YTHA 4F7LA 2Q0BA 4X2KA 1OUKA 1KE9A 3QUPA 4WHZA 5L6OA 4ZTLA 3R9OA 3UPXA 2X2LA 1JLUE 3MV5A 3OW4A 4MKCA 3NAYA 3NUNA 1PXNA 3BYMA 5HQ0A 1SYKA 3W8LA 1U4DA 2XIZA 3HLLA 3KF4A 4FNXA 3QRIA 4ZTSA 4EG0A 3MH2A 4YBJA 4I4EA 3LXPA 3E87A 4USEA 4IDVA 3PXRA 4GRBA 4IAYA 4RWKA 3MTLA 4KS7A 3A2CA 2RFDA 2XH5A 2ZB0A 1UU3A 3CPCA 3DK3A 3QX2A 3AT3A 5C8MA 5CX9A 2QOFA 4U3YA 1H8FA 3R9NA 4RIXB 3HV7A 2ITNA 4Y85A 4BYJA 4Z16A 2R86A 3LCKA 4NW6A 2Z02A 4DTAA 1OZ1A 1Y57A 2BIKB 2FSMX 4WBBB 5KBRA 3PG1A 5LYJF 3M2WA 4N57A 3UZTA 5CT0A 4FFRA 4UYAA 3RUPA 3DBCA 4ZZNA 3FBVA 3PDTA 3LM5A 4D1SA 3UBDA 4BBFA 3C9WA 3IKAA 3SOAA 3GGFA 2WIPA 3FSFA 2J0KA 4QTDA 1Y91A 1M7NA 4NCTA 3UZRA 4XZ3B 3JUHA 1TVOA 4U41A 3HECA 4U79A 4L7SA 4E93A 2CLXA 1W7HA 4RJ5A 2BHEA 1BMKA 2NO3A 2QOOA 2XIXA 4QMLA 2X4FA 1OPJA 3QBNA 5ANGA 4BB4A 3SGCA 5I9ZA 4AS0A 2UW7A 2J0IA 3E3BX 1Y6BA 4QYFA 4K0YA 3PIXA 3P5KA 4FTKA 3RAWA 5ETCA 3VRYA 4BHZA 2I0HA 3MY5A 3RGFA 3FYKX 3UIXA 1URCA 3I60A 3NDMA 1ZXEA 4FYNA 3RI1A 4DYMA 2IW9A 4F6UA 2YW2A 5DWRA 3A7FA 3OXZA 4E6QA 3GUBA 3UMWA 3N9XA 5B0XA 3DDPA 4C62A 3SG8A 3FHRA 5IISA 1KEEA 4CTBA 4AOIA 3E5NA 2LGCA 4ALWA 3ETJA 3QL8A 2YZNA 2VO0A 3ZBXA 3LW0A 3BLQA 1WVYA 3CD8A 4WNMA 4D1ZA 3OUZA 2ITPA 2W0JA 3LQ3A 4CG8A 1VZOA 2KULA 1BXRA 5CNNA 4RZVA 2XD4A 4LQMA 3G0EA 2RFSA 2B53A 2NU7B 4FNYA 4U3ZA 3RCJA 4EI4A 2UZUE 1URWA 1UVRA 2QOHA 5AV2A 2OIQA 5IEVA 4W4WA 5KUPA 4RWIA 4RWLA 2V55A 4AZTA 2W99B 2WO6A 4G6OA 2PHKA 3EB0A 3IECA 3QFVA 4FI1A 4I5HA 3TIZA 5F94A 3D7TA 2QQ7A 2IO6A 4TUYF 1Q99A 3BKBA 3JZFA 3HAMA 1P4FA 1Z5MA 3OXTA 3FDNA 3U54A 2OH0E 4C61A 4WUNA 5DEWA 3K3IA 4WRGA 3IW4A 3TV4A 4AN3A 5KKRC 4FFMA 4YLJA 4L01A 3WZUA 4FFOA 5GIPE 3GLKA 2YWPA 3BRBA 4BTKA 4EJNA 3NW5A 3DDQA 5FLFA 2Y7JA 2JDTA 4BY9E 4A9TA 4IB0A 4MQ1A 4WD5A 4BGGA 2WQBA 2XM8A 4CFUA 4MHAA 4F1OA 1BI8A 4AG8A 1WR2A 2YYAA 4C4HA 2DZDA 5LMKC 3ZUTA 4KS8A 4AFEA 4CFNA 2FH9A 2FPGB 4AUAA 2GNLA 3E7OA 3MB6A 3VPCA 3I1AA 3VBQA 5CLPA 2EXMA 5C8KA 4EC8A 3G2FA 4BKJA 3COKA 3LE6A 3ZLYA 2PK9A 1W84A 4AW2A 4USFA 1OKZA 2B54A 2R64A 3KREA 3Q53A 4I92A 1J7UA 1JKTA 5BYLA 1W93A 4FTTA 4YU2A 4BTMA 4FNWA 4IVCA 4UALA 4UYNA 2QONA 2C6LA 4FTMA 3CQUA 4L53A 5CEIA 4JOAA 4ZQIA 2F7EE 4ITJA 4CV8A 2PVLA 1IRKA 5FNVF 2UZWE 5JVLA 1IR3A 4D4SA 4D58A 2GPSA 3E8CA 1SVHA 5HKMA 4KRCA 1I7NA 3GBZA 4OTFA 3PYYA 1YDTE 3OF0A 3QQGA 3TTIA 3QD2B 4JQEA 3R71A 5LOVF 5IPJA 4ZTHA 1XJDA 4FEWA 2ZYBA 4AOTA 4IHJF 2JBOA 4HNIA 3QLGA 3FKNA 4ONAA 5EHYA 2I8CA 4FEVA 2V0DA 3VBWA 5K5NA 3KFAA 1R0EA 2NNWB 2R0UA 1NW1A 2VTHA 2VWBA 2J9GA 2WU7A 4V01A 4XV2A 3KAKA 3ANQA 2R4BA 3PXKA 5HG8A 1OPLA 5L8JA 4BVUA 1PXJA 4F64A 4C33A 3WF8A 4RQVA 3GU5A 5HG9A 3WZKA 2H6DA 1FVRA 4JRVA 5A3XA 3W10A 4BR3A 4LFIA 3ZCLA 4YJTA 2HXLA 3D94A 1H1RA 1GY3A 3KCFA 3SXFA 3F5PA 3DJ5A 4FSWA 4P5ZA 4XRLA 2V7OA 2WHBA 3G51A 4KUJA 2R3MA 2ITYA 3ODZX 3FMEA 3BGQA 3L1SA 4RZWA 1J7IA 3NUSA 5IA2A 4YJ2F 4V0GB 3MGYA 4UN0C 4BHNA 2WTCA 2QKWB 3QWKA 2GNJA 5EYKA 1GLVA 4U43A 4E4TA 4AA0A 5FM3A 3PPZA 1FINA 4RBLA 1W8CA 2W70A 5CF4A 2C30A 2QG7A 1DS5A 5JFVA 3HMIA 3GOPA 4TTHB 5GJFA 2CZGA 5EW8A 3DOGA 5BUJA 2OH4A 4YJOA 2O65A 4PDSA 2UV2A 4XLVA 5I9VA 3RM7A 3RJCA 3BHUA 4MXCA 3QTRA 1Q8WA 2X1NA 2YIWA 3N4VA 2PTKA 2FYSA 2QK4A 4EK8A 4G9CA 5CZIA 4M0YA 1JKSA 2Z60A 4I5PA 4PP7A 4O96A 4ME6A 4YNEA 4ANMA 4FZAB 4KBCA 4L1KA 4D4RA 2W1GA 3NMUF 4U0IA 4IWPA 5FEDA 2A0CX 5CA0F 5CAEB 4G34A 4IWOA 2VTOA 3NYNA 1KE8A 2EB3A 4Y8VB 5ETAA 4EOOA 4X3JA 4O7LA 4LOQA 2I0EA 4BDJA 4GVAA 4ZXTA 4JDJA 3Q9ZA 4QQTA 3FMLA 1M2QA 3WF6A 3R30A 4JVGA 3BLHA 3AD6A 3SLSA 3UNKA 2DLNA 1QL6A 5J2TF 4TXCA 3OTUA 5CAOA 1GIHA 3FV8A 5KX5F 2ETRA 2ETKA 1M0WA 2JKKA 3R9HA 4ZTMA 5FXSA 2CGUA 3SDJA 4LUDA 4QP1A 2HOGA 5GINE 5EZYF 3FKLA 1R1WA 2ZDTA 3A62A 3CBLA 5CU4A 3UOKA 4MV7A 5M06A 4C5AA 1W96A 2ERZE 4C37A 3S2PA 1B6CB 4F4PA 2G2HA 4YJSA 2W6OA 1IA8A 2Y6OA 4EQCA 2JAMA 2GFCA 5CXZA 3ZFMA 2XIKA 5AUZA 3LJ2A 1WFCA 3Q32A 5IYZF 3QU0A 4QMVA 3AC4A 3ALNA 1XKKA 1UKHA 2PMLX 1EUDB 5DLSA 5DBXA 4IHPA 3PG3A 4EOSA 3TG1A 5HCXA 3A7HA 4J71A 4BCFA 3GC9A 5FG8A 4R5YA 3EFKA 3QHRA 3EQFA 2BIYA 3QAME 4TYIA 4BDIA 4IC8A 4YJQA 2WMSA 2JLDA 3AC1A 4FTLA 4RJ4A 5HE0A 3FPQA 2PY3A 3SXRA 5BVFA 3KXHA 4CFWA 5BPFA 4UZHA 4RIWB 1ZY5A 4CMUA 5HIEA 2R7MA 1WAKA 3JVSA 3QYWA 1Z2OX 3SC1A 4E5BA 4EH8A 4YTIA 4BIDA 2R3GA 4IJPA 2QHNA 2YCFA 3GU6A 2VD5A 3K2LA 2X8DA 3L9PA 3MPTA 3PJ3A 4PY1A 5HCZA 1J3HA 3OP5A 4XX0B 4DC2A 4M12A 4RG0A 4EC9A 2BZKB 3VUMA 4YAKB 3EN7A 5E8WA 4NM0A 3ENHA 5AP1A 1O6LA 1GZKA 2BALA 4LRJA 4Y46A 3CPBA 2FSLX 1MRVA 4XH6A 5JQGF 5DVRA 4KINA 4KNBA 4MBIA 1BLXA 2X81A 3ACKA 4W4VA 4AE6A 5IH4A 3DKCA 3P1AA 3R8LA 1IASA 1KV2A 2JD5A 4IAZA 4QTAA 2HW7A 2R0IA 1IAJA 2RG6A 3LFSA 3ORLA 3R0TA 4L52A 4RC4A 3MY1A 4ZSLA 4GYIA 4BICA 5DN3A 2VTAA 4PWNA 2BROA 2XNEA 5ANJA 3AW8A 3DBEA 2X7FA 3LXKA 5B2LA 4PTGA 3GNIB 4EH9A 1CE8A 3UP2A 4HGLA 5A4TA 5KX8A 2OJIA 3EQDA 2XNMA 3NUUA 4IMYA 4N0SA 1EHIA 4GFOA 2XJ0A 1ULZA 3DFAA 3F3TA 3NNWA 3VMMA 2C6TA 5E8VA 4F65A 4IX3A 3ZZEA 3HB9A 1RDQE 5KMIA 3IW7A 4YC8A 5IEXA 3TT0A 3QQLA 3G8CA 2C6IA 2VO6A 2ZDUA 4NSTA 1KC7A 4U6RA 2CHLA 3GEQA 4X3FC 4C4FA 3I7BA 4C3PA 1CSNA 5DEYA 3A7JA 2JITA 5TF9A 3W2RA 4G5PA 4R5SA 3UG1A 3MBLA 2OW3A 4E73A 3NGAA 2Y8OA 4K11A 3DZQA 4PRJA 2B4SB 2PVMA 1QPEA 3ALOA 1ND4A 2XK9A 2QOKA 3DCVA 3IGGA 4H1MA 5AP6A 2I87A 4EGJA 2JKMA 2XNPA 1DV1A 3D2IA 3DT1A 3BE9A 2YFXA 4FSUA 3C4ZA 4RX8A 1H27A 4FV6A 4I21A 1E4EB 1M0TA 4I55F 4FKIA 2R7BA 3C5UA 4BGQA 4BDBA 4BCGA 3E62A 2J2IB 4QT1A 5A14A 4X7QA 1XH7A 4QP6A 2UW9A 4AA4A 2O5KA 4QMOA 4NL0A 4AACA 5CSWA 5LWMA 4ZOLF 1OBDA 5LMBA 2YM3A 2NPQA 3GENA 3C0IA 1GAGA 5E1SA 2WYOA 3JRWA 4IJ9A 3FJQE 4KKGA 3MY0A 5HBRB 5F95A 2GPWA 2BILB 4JAIA 3I12A 5J9ZA 3UO6A 4JRNA 2I80A 2W6PA 2R5TA 5FRIA 5L8KA 4RJ6A 3K3JA 2V62A 4CLIA 2QOCA 2XYUA 4ERKA 1MQ4A 2HGSA 3TINA 4QP4A 2A4LA 2CMWA 4FV5A 2X8EA 4HVGA 2C1AA 4MK0A 4I4TF 5CI6A 2QI8A 2R3QA 2VAGA 4G31A 4XV9A 4AX8A 3QHWA 1OIRA 2B0QA 2PVKA 4AT5A 3MVJA 2HY0A 3R1SA 2XCHA 2WXVA 1ZYSA 3QQJA 4JQ8A 3TV7A 2E9UA 3ETHA 5IH5A 1OKYA 1UNHA 3VNTA 5CAVA 5E8XA 4GH2A 3LP8A 2IVSA 1S9JA 4W8EA 1Q3WA 3Q6UA 2R3JA 3IG7A 3ZSGA 5LVPA 3ZFYA 4XNEA 5HTBA 4G3EA 4MXOA 2GFSA 4U40A 5B2MA 1SVGA 4LGHA 5F4NA 5CI7A 5FD2A 5IQDA 4AWIA 3NPCA 2I7QA 4X2NA 5DRBA 3WYXA 4Z7HA 1PMUA 3ZH8A 4F9WA 1KJQA 3BU5A 3HUCA 4IB1A 1U5RA 2PUNA 3OOMA 3DTWA 4OT6A 3RVGA 4FVQA 3ULZA 1O9UA 3ZLXA 4DN5A 2HZNA 4E6AA 5AUTA 5LVOA 3H3CA 1YWNA 3PVGA 2CCIA 5KMNA 3NVKI 4YHJA 1XO2B 4K33A 3RNIA 1PKDA 3DK7A 2WTDA 1F5QA 1JSUA 4YC6A 4DFXE 4HVSA 2W1DA 3ANRA 3Q4UA 2WQMA 4H3QA 5AX9A 4C5BA 5M4UA 2XIYA 4PL5A 4M13A 4TYEA 4I6FA 3VUKA 4ENXA 1GGOA 1WBSA 4HYIA 5KMKA 4FTRA 1I09A 1WBTA 3BZ3A 1PJKA 2VTTA 3DAEA 2W96B 3GI3A 3HA8A 3HV6A 3PRFA 5CTPA 3TNPC 4QP3A 2YIXA 3KL8A 4BF2A 3MWEA 4PV0A 3ZUVA 4CCBA 3SRVB 5HVKA 3A4OX 2XA4A 4F7NA 4RQKA 5TKDA 3QA8A 1OGUA 5JQWA 4ZMFA 1F0QA 5L6WL 3SV0A 3PTGA 4B99A 3HRBA 4LYNA 1FMOE 4WUAA 5M55A 3EN6A 3G6HA 1Q61A 5AAGA 4CT1A 2BDWA 4S2ZA 1A9UA 4JLCA 5JZNA 2XBJA 3MPAA 2XEYA 4FVPA 4UWCA 5HO7A 3HP2A 4FZ6A 1DIKA 3L8XA 1PX2A 2OJ9A 2CKOA 3OOGA 3QTXA 4RFYA 5L2WA 2HW6A 4DEAA 2IWIA 1OL2A 4F0FA 4LRKA 4IB3A 5I9UA 4FTOA 3U87A 4B6LA 1FBNA 5JKGA 5DI1A 5EOLA 1GNGA 5KMOA 3N4UA 4AFJA 2QOBA 4R7BA 4ZOGA 5HBEA 4D5HA 2W1CA 1K2PA 3L8VA 4YGAA 3GQLA 3NR9A 5A6NA 3Q1KA 4C2VA 5IQGA 5CENA 3FY2A 5HNGA 3F3UA 4JIKA 1A9XA 2YDKA 4A9SA 1IAHA 1HOWA 3R00A 4EHEA 2W17A 1OKVA 3VWAA 2YZGA 5DA3A 3W2PA 2VGOA 4H36A 3ZEWA 4Q2AA 3CGOA 3Q9XA 1LP4A 5CA1F 4WNOA 4ZJVA 3GQIA 2BPMA 3R1NA 2C00A 3MI9A 2C0TA 2PULA 4YC3A 5A4EA 5LMKA 4ITHA 3FLYA 3QYZA 3T9IA 5DMXA 5AIRA 2GLTA 4IAFA 1R3CA 2F7ZE 3BLRA 3QTQA 2BAKA 3DKGA 5LOHA 3DGKA 4DEDA 4O0TA 3V5PA 3NW7A 3ZXZA 4O4IF 3ZHPC 4TV9F 2QHMA 4HJOA 4IZ7A 5CVFA 3ODYX 4HYSA 5A4LA 2UZVA 1X8BA 2C0IA 2YISA 2B1PA 4XBRA 4L3LA 1UWHA 3HMNA 4DHFA 2XKDA 3PZHA 4MXXA 4NTTA 3V5JA 3R8PA 3VRZA 5JEBA 4NYEA 3ITZA 4KIPA 5E9EA 3GCQA 3DFCB 2B7AA 2R3RA 5C27A 1DI9A 4GFGA 4JBPA 5HE2A 3C4XA 3VQHA 1EZ1A 5C26A 3UNZA 2JFMA 3G6GA 3KCKA 3KXGA 5I5ZA 5D10A 3EKNA 5EKOA 3WBLA 3ZBFA 4BC6A 3VUHA 5CF6A 4G3DA 4MXAA 1UWJA 3BEGA 3I6WA 2XNNA 4K77A 2P2HA 4NM7A 4P4CA 4L42A 1REKA 2X7OA 4TWOA 4IX4A 4OGRA 4PNKA 3D5WA 3MIYA 3QC4A 4YPSA 4AA5A 5A4QA 5CF5A 2WTWA 1B6RA 1Z2NX 2JDRA 2J9MA 3MA3A 5CAUA 3C4CA 4WOVA 1AUXA 3IOKA 3F82A 2QO7A 2QU5A 3C0GA 3LHJA 3PJCA 3DF7A 3HMOA 4XG2A 3SOCA 5IQEA 4JT3A 3AD5A 4X2GA 4V04A 2W71A 3LCDA 4J8NA 3G9LX 4JG6A 5BVWA 4ITIA 4O38A 5EG3A 1XBBA 2HWPA 2FUMA 5E8SA 3ZRLA 2FPPB 1I44A 4C36A 5I9WA 4M14A 2BTSA 5I0BA 4FU0A 1DAYA 2Z7RA 1R39A 3PJ2A 5HD7A 4WSYA 4EOPA 5ANIA 4AE9A 4IX5A 3HGKA 1J1CA 3NSZA 4NKAA 3F2RA 3PJ1A 4I20A 4P7EA 4L6QA 5CANA 4C58A 5BVOA 3PWYA 3TM0A 3SE7A 2QC6A 3MPMA 5IDNA 2W4JA 1SZMA 3QZIA 4HZRA 4WG4A 2Z8CA 4CZTA 4YLLA 5M56A 2W4KA 4ANLA 4YZDA 4G3FA 2REIA 4ERWA 3EWHA 3HP5A 3KN6A 2CPKE 4E20A 3OCTA 2QCSA 2VU3A 5H9BA 4G5JA 2O63A 5LVLA 3NLBA 2WZJA 3N6RA 3W8QA 4M97A 4RC2A 3PLAE 3AG9A 3E5AA 5IZFA 4MAOA 3VF8A 4D9TA 4HVIA 3A8WA 5CWZA 5CQUA 4DA5A 2OI4X 4PDOA 3WNZA 2B55A 1JKJB 3OBGA 5CSVA 1TQPA 3LQ5A 5BMMA 2G2FA 3AC5A 2WELA 5C4KA 3BGZA 5DH3A 2R7NA 3BU3A 3NCGA 3R23A 2UUEA 2CGVA 3OWJA 4I5MA 3LFCA 2JBPA 3RK9A 3UDBA 2JC6A 3UVPA 3QQHA 4DH7A 2E2BA 4QRCA 2J5EA 1ZYDA 3ZM4A 3ZO3A 2JDOA 3CIKA 4EH7A 4O4JF 3P0MA 3OTVA 1H08A 1CKIA 4O82A 4FFNA 2ZV7A 3FLZA 4BCKA 2OK1A 2VWYA 4FIGA 4QMMA 3QCYA 5EHOA 5HZNA 2W9ZB 2OICA 2H34A 3PFQA 1JOWB 2DS1A 2ZM4A 2PVPA 2C0OA 3FXXA 2OIDA 3F5UA 2W4OA 4MV4A 3COIA 1YWVA 2CGWA 4J96A 3R8MA 3LFQA 4JDKA 4FSMA 4FV7A 4IBMA 4FT5A 3Q4TA 4GMYA 4WG5A 2J0MB 4AW5A 2CLQA 4QOXA 5C4LA 3QQKA 2YS6A 5KZIA 2W7XA 3TN8A 2WMXA 4W4XA 1V0OA 3COHA 4YO4A 1RQQA 3KXMA 4GV1A 5E7RA 3TDWA 4AGCA 3A8XA 2HY81 4QNAA 4HCUA 3RV3A 3VF9A 4EGQA 2JEDA 4Y72A 2SCUB 3VVHA 5FDPA 2YRXA 3FLNC 3A7IA 1H1QA 1WBPA 5EK7A 1VKZA 5D7AA 3Q2MA 2UZEA 5EQEA 5EQYA 4BN1A 5EW9A 4BZOA 2Q0NA 4D5KA 1NT2A 4TWNA 3ORRA 2GPHA 3WZJA 4DGMA 3D83A 1OM1A 2XUUA 3AX6A 2WOTA 2OJFE 2ZV8A 4FK3A 5HU9A 3S1HA 3WOWA 1Q8UA 4JQ7A 3MH1A 4KA3A 4EJ7A 2QG5A 3D15A 5EM7A 3JVRA 2CN5A 3NRMA 3OHTA 4AGWA 2IZUA 4PTCA 1ZY4A 5KKNB 2IVVA 1YXVA 2WEVA 4RIXA 3RWPA 3FY0A 3W55A 4FIFA 5HICA 5TO8A 1PXKA 5C1PA 3OFMA 4GK2A 5E1EA 4F7JA 3JRXA 5AADA 3UZPA 3LMGA 2R84A 4QYHA 1XBAA 5KO1A 5L6PA 5BX0A 5DOSA 3FLSA 4E8AA 4FV0A 5E8UA 4KSQA 3RPVA 4MAMA 4CKRA 5I4NA 2NU9B 4QP8A 2JDVA 3GIDA 3R83A 4D9UA 2CKEA 3WO0A 3E8EA 2X0GA 4KKHA 4I3ZA 4WBOA 3LLAA 4FT3A 4YP8A 5IF1A 2FSTX 2C4GA 2F2UA 3K54A 3CKXA 3O2MA 4FSTA 2ZAZA 3F69A 3FI8A 1PF8A 5GONF 4X3FA 4RPVA 5EKNA 4LG4A 5HCYA 3FQHA 3ZO2A 2Y0AA 1J1BA 4FEUA 3OW3A 3MFUA 1JSTA 2C6OA 4F1TA 3ZMMA 1IG1A 2VGPA 2OXYA 3DV3A 1Z2PX 1AUVA 3QQUA 3E7VA 1OIQA 3N51A 3ORNA 2VO3A 5AP4A 4B8LA 2XKCA 4DFZE 4U5JA 3AMAA 1OL1A 3DNDA 1OPKA 3MB7A 4E4MA 2V58A 4IIRA 4L9IA 1P5EA 4EEVA 2BZIB 4FSRA 3TNIA 5AP2A 2ZDGA 3NNXA 3BHYA 3CGFA 3RAIA 2BRNA 2ITQA 4F7SA 3SVVA 2P55A 4FYOA 3Q5ZA 3TZ8A 5KBQA 3DAJA 4C59A 5CAPA 4MWHA 4CKIA 1FVTA 1APME 3TUCA 4LI5A 4JG7A 3QF9A 3QWJA 4QO9A 2YEXA 4LMUA 3BYSA 4IEBA 2OG8A 3KULB 4NW5A 5JFWA 2WQOA 5GNKA 3K3PA 2BMCA 2YHVA 2CNQA 1MRUA 3ULIA 4O7TA 2X6EA 2OU7A 4TN6A 2VTLA 4BTFA 4IIJF 3KN5A 2BFYA 3UVQA 3U6IA 4JG8A 1RJBA 2GHMA 1OITA 3KVXA 4M68A 4MD7E 5CEOA 4C5CA 1ZARA 3FXWA 4I5CA 1XHAA 4AW0A 4Y5QA 4EK4A 1Q5KA 1ZAOA 3EFJA 3SW4A 5JQ8A 3IDBA 4DBNA 2VO7A 3V5WA 4WA9A 4MNEB 4CMTA 1JDBB 4XUFA 3OC1A 3VUDA 4LGGA 4FZFB 4FFLA 2XCKA 3Q4CA 4BI2A 1IEPA 3GB2A 3QRTA 4K9YA 5E4HA 4C2WA 2YZMA 4MD9E 4QQCA 1A48A 1OB3A 4NH1A 3BQRA 5D1JA 3PSBA 2BZJA 3NWWA 4AN2A 3DU8A 3QA0A 2GHLA 3FE3A 3VW6A 4EBVA 3LXLA 3LJ0A 4ID7A 4UEUA 5B7VA 2QOIA 3O8UA 4X2JA 4BCHA 4C7TA 2BDJA 4IANA 5EYCA 2QLUA 2E9PA 4QMYA 3R22A 4EYJA 3EQPA 4RLKA 4QPSA 4EONA 3AOXA 2V5QA 2PZRA 1GJOA 3EQIA 3DK6A 1VBHA 3LQ8A 4FIEA 4O7NA 2W6QA 4QYEA 5CALA 3D14A 4QMTA 2BRGA 5AM7A 2WPAA 4L7FA 1OL6A 4XOYA 3BV3A 3QX4A 4ZK5A 4DCAA 4YB8B 4CD0A 3VBVA 2WMWA 5J95A 3U6JA 4M3QA 3FC2A 1CTPE 3VS1A 4HOKA 3TV6A 2BKZA 2B9JA 4AT4A 2YM4A 3R7EA 3U6HA 2OLSA 3R5FA 3TNHA 3WILA 1KOBA 3MFSA 2ZM1A 3ZTXA 4DEGA 3HMPA 3BHVA 2WGJA 3FL5A 3F2AA 3BELA 4RX5A 2Q83A 1U5QA 3O71A 4YZ9A 3CQWA 4ASEA 3RWQA 4MV1A 3PXQA 1HCKA 3EN5A 5G6VA 3EFWA 4TNBA 3P86A 3DJ7A 3V3VA 2F7XE 4CQEA 5FXQA 4O0XA 1RW8A 3ORXA 1KE6A 2P3GX 2J4ZA 1YHSA 4OTWA 5HU3A 2WNTA 3PXFA 3FI3A 1PXIA 3EQGA 1SVEA 3FAAA 3VJOA 4XLIA 3GCVA 3ORMA 4DEEA 4XV1A 5HV6A 2J0JA 4U8ZA 5DNRA 3ATTA 1ZYCA 3R04A 5FTGA 5H2UA 1L8TA 2XK6A 3DTCA 3QD4A 1BKXA 4V0GA 3KXZA 3OBJA 2AUHA 4J98A 3CKWA 5CAQA 3UO5A 4IWQA 3EHAA 1L3RE 1M7QA 1H07A 1ERKA 2X9FA 3O96A 3KRXA 3TNWA 3OT3A 2YM5A 4CV9A 2OFVA 1S9IA 2J51A 2QOLA 3ZXTA 2O8YA 3C51A 4FK6A 5HLPA 3V5TA 3BG5A 4BGHA 4HQ6A 2EU9A 2YM8A 1PK8A 1FOTA 2ETMA 4AT3A 4EWHA 1BI7A 2I40A 4O4HF 3MTFA 5M07A 1PW2A 2R3OA 3NW6A 2V7AA 4XCUA 2GU8A 4JS8A 1FQ1B 4QMNA 2W6MA 4TYGA 2ZB1A 3F7WA 4R7HA 3N4TA 4Y95A 5ITAA 1M6VA 3GC7A 4QTBA 1KWPA 5F20A 4PF4A 4OBPA 4F0GA 4DG0E 5IUIA 4A9YA 5FUTA 4E7WA 3LXNA 1U54A 4GK3A 2BZHB 1WBNA 2P2IA 2XNOA 2VTMA 4U44A 5G1XA 5BUEA 4W4YA 2GQSA 4BCOA 4D0WA 4I50F 3EQBA 3Q60A 4I94A 4G2FA 4DG2E 4IC7A 3WYYA 3CY3A 4UXQA 4E4NA 4EYMA 2WMBA 4H3PA 5F1ZA 5J7HA 1H1SA 1XH4A 4S30A 4D1XA 1H25A 3KK9A 2HZIA 1Q41A 5BUIA 4N4SA 4MCVA 1YKRA 4PTEA 1T46A 3C4FA 2DIKA 1Q8YA 4RIYB 4XG3A 3H9FA 4HW7A 5KKRB 4RFZA 3CS9A 2B9HA 5JQ5A 3QXPA 4RA4A 1NXKA 4FV4A 2E9VA 4GSBA 4L3JA 5JGBA 4RC3A 5JSMA 3KXNA 4O22A 4G9RA 2UVXA 4AN9A 4IB5A 4AZFA 4BI1A 4A4OA 4JX3A 3VBTA 3LVPA 4BIEA 4TV8F 3UOLA 1SNUA 4DFLA 1J91A 1WVWA 5AMNA 4QQ5A 4FSYA 1KBLA 2R3IA 3FI4A 4KABA 4TT7A 3ACJA 3QKKA 1DM2A 4Y73A 3SHEA 4AGUA 4BCIA 3DZOA 2GNHA 4FKTA 5BYYA 2W5AA 4UV0A 1MQBA 4X0MA 2RF9A 4F70A 2F49A 2C3LA 3WIGA 4H1JA 2VR1A 4M15A 5A46A 3C0HA 3R7IA 3OUNB 1M2RA 4GKHA 4BYIA 1Q3DA 4E26A 1PKGA 3IOPA 2VWVA 2ITOA 4O7YA 1T36A 1TKIA 3FXZA 3OROA 3BHTA 2W6ZA 4FTIA 4K2RA 1YW2A 2UW6A 4Q9SA 3RZBA 5M4CA 4A07A 5IQBA 3EN9A 2VNYA 5AA8A 4JR3A 4RIWA 5EHLA 5HGIA 1KJIA 2C5VA 4AF3A 4OTGA 4FKWA 5K9IA 2W1IA 5H3QA 5FQDC 2UZNA 5AUYA 4KB8A 4NZWB 4TKSA 4MBJA 1UA2A 5JT2A 2G9XA 3HNGA 3NEWA 4IFCA 4CT2A 2A2AA 3F61A 4O7ZA 2PVFA 2VWZA 3GVUA 1B38A 3LMIA 2X6DA 4N6ZA 3TCPA 5CZHA 4ZSJA 1KV1A 1XWSA 4NT4A 3FC1X 3P7AA 4RZQA 4XYMB 4QYYA 2YITA 4FV1A 2FB8A 4YURA 4RJ8A 1FPUA 5CU0A 3QTZA 2XMYA 4M84A 3ZDIA 5AV0A 2WTKB 5HBJA 3OZ6A 3RAKA 1FGIA 2R3FA 2VX0A 2HELA 3QTUA 4N6YA 3QD3A 5ICPA 1PXMA 5J1WA 4MWIA 3PRIA 2VN9A 4FV9A 4ZSAA 5AV4A 2VWUA 5AJQA 3HA6A 3O51A 5HIDA 3PVUA 4LMNA 3TTJA 2J7TA 5HO8A 3K5UA 2R85A 1K3AA 3E93A 4FV3A 2Z7QA 4ZS0A 4BTJA 5C03A 3M1SA 3UYTA 4RVTA 1XR1A 2BCJA 2ONLC 2R3KA 4FG9A 2HWOA 1KSWA 4LV8A 3LOKA 5EDPA 4F9CA 3U8WA 4C35A 3MDYA 4PL4A 2OJGA 3L9NA 3H9RA 4H58A 3UC3A 3E8DA 4LL0A 4B9DA 4XP0A 4CSVA 2OO8X 3HVCA 3PIYA 5ANDA 4J7BA 2NUAB 4FZDB 4PUZA 4TYHB 1H28A 5J9LA 3BE2A 4RIOA 5BPHA 3R2YA 5HG7A 3U9NA 3BEAA 3VS6A 3QC9A 4YMJA 1KJ9A 2ZDQA 3BV2A 3Q2JA 2W1HA 1Y8YA 4G6NA 3VC4A 4QMQA 3EMGA 3AT2A 3I5ZA 3UMXA 3EYHA 4PL3A 3KK8A 1HCLA 1JVPP 4W8DA 4NIFB 3HO8A 1Q8TA 4FSZA 2IP4A 3PE1A 1GIJA 1GZNA 4FICA 1ZYJA 4NK9A 3ORPA 4BIBA 3T3VA 3Q6WA 2OZAA 3CLYA 1E4EA 3DXPA 4QMSA 3NCZA 3ENMA 3MH0A 4PMPA 1LPUA 2PMIA 3PA5A 4J52A 4M0ZA 4TY1A 4FV8A 2C3KA 4BBEA 5M53A 5JZJA 4DH5A 3TIGA 2O0UA 4XG8A 3CEKA 1ZLTA 4GYGA 3HV3A 1H0WA 2C6DA 2ITWA 3DQWA 3R28A 1OL5A 4FNZA 4IM3A 4D2RA 2NP8A 4F99A 1B39A 2R87A 4IADA 4O7WA 4OT5A 3HUBA 2O64A 3FMHA 3MVMA 3HBLA 4MXZA 2IG7A 3PY3A 3PPKA 4J8MA 4DLJA 4YR8A 3PVBA 3MA6A 4E4LA 3QCXA 3GU7A 4D4YA 2HENA 1ZZ2A 2W5HA 1PY5A 3PA4A 1G5SA 4LOPA 4UZDA 3R7OA 3E3PA 2B9FA 1T45A 1YXTA 2P0CA 2ZV9A 3KVWA 4IFGA 5JK3A 2QOQA 4OBQA 1YDRE 2UZTA 5CSXA 2YIRA 2CCHA 5JGDA 4ENYA 4U7ZA 1EUCB 3LPBA 2NU6B 2YDJA 2GTMA 4U81A 1C3OA 4WG3A 2V59A 3UFXB 1YXUA 5HI2A 3LZBA 3QRKA 3KKVA 2BRBA 2ITZA 2J6MA 4GJ2A 4MBLA 3OUUA 4LRMA 5AAEA 2YM6A 5KCVA 3R5HA 2OFUA 4O7VA 5TOZA 5ETIA 3TZ9A 3SG9A 1TQMA 2RG5A 2XVDA 4USDA 4AW1A 2C3IB 2VUWA 2UZLA 2J90A 2C1BA 4JBVA 2QNJA 3FI2A 3FZSA 5T68A 1GZOA 3V8TA 4EK3A 5T3QA 3M11A 2PVHA 4HZSA 3O50A 4BDHA 2WMUA 4HGSA 4QPAA 5BPYA 4OR5A 4KKEA 2KTYA 1MUOA 1MRYA 3GC8A 4L45A 1QCFA 5H8EA 3AD4A 4YAJB 1VJYA 4YPDA 4GL9A 4Y5HA 1YHVA 3MWDA 3RINA 2UVZA 4UBAA 4ARKA 5J1VA 2YZLA 4EZ3A 4NM5A 3BU6A 4I24A 2WU6A 3MESA 3M42A 1CMKE 2CSNA 4HNTA 4OUCA 4R77A 4XEYA 2C6EA 3QLFA 4ZY4A 1KE5A 5L2TA 2JAVA 4F9AA 3AC8A 4O6LA 4NJDA 2VX3A 4O0SA 3O0GA 2X8IA 3CTJA 4ZTNA 4I1ZA 3IW6A 3TUDA 2Z7SA 3ZO4A 1AQ1A 3HEGA 4PMSA 2F2CB 4XOZA 3QTSA 3RK5A 1XH8A 2R82A 1BL6A 4AGDA 2X0SA 2PU8A 3EFLA 5EM6A 4LM5A 4FKUA 5E8YA 4FE2A 3HAVA 4F09A 3SRVA 5K3YA 4M7IA 5EI2A 4HPUE 5LARA 2E9OA 4KAOA 5JH6A 2FB9A 1Q62A 3FZOA 3L9MA 5C9CA 2FGIA 3C1XA 4BCNA 4RSSA 3GFWA 3CP9A 5DFPA 1PMVA 1E1VA 4WO5A 3TEIA 2WOUA 2XJ1A 2ZM3A 1PHKA 2DQ7X 4HYHA 4MXYA 4FA2A 1H4LA 4R3CA 3LWBA 4R3PA 2WMAA 2VNWA 4I22A 4TRLA 5AV1A 3VQUA 3OVVA 4ACMA 3SW7A 1C30A 1H0VA 5AIKA 1WCCA 4R1YA 5L3AA 3G33A 4QMWA 2XJ2A 3EL8A 3SX9A 4C4IA 4CFMA 1YOJA 4XMOA 4XYFA 3IK3A 4D2SA 2PMOX 3TIYA 2FSOX 3D5XA 5J5SA 1JDEA 3H9OA 5IEYA 4XRJA 4C4GA 3BWJA 4X2FA 3RPOA 3UQFA 2C5XA 3Q52A 4QYGA 4O0WA 3V04A 1NVSA 1SNXA 2HXQA 4J99A 5HNBA 4YZMA 2C3JA 3BYVA 5CEKA 2VTJA 3ORQA 1V0PA 3WZEA 4ZP5A 4RGJA 1YOLA 3S0OA 3VBXA 4KBAA 2VWXA 4A9RA 1W83A 2C6MA 2P4IA 2ACXA 2WMVA 3P79A 5BVDA 3TUBA 3FMKA 5FEQA 4S32A 3RPSA 2I0VA 3FLQA 3F9NA 3ZEPA 4AXAA 5D8DA 2E9NA 2WQNA 3V8SA 4LUEA 3QCQA 3BYOA 5BVEA 2EVAA 4H05A 1H26A 3EOCA 3R63A 2YCSA 3G90X 2HJWA 4O0YA 1Q97A 4GU9A 3W33A 3LLTA 2J50A 4IX6A 1H24A 2BAQA 4FKGA 4DBXA 4ZY5A 5CSPA 2RIOA 2X39A 1M2PA 3B2WA 3PSCA 4WT6A 5HE3A 4GW8A 5E91A 4CFXA 2R7LA 3VPBA 5JVDF 3K5VA 1YXXA 3KALA 3PLSA 4XS2A 1VYWA 2YAKA 5DT4A 1ZMVA 3IW5A 4UWYA 3AT4A 4A4LA 2W05A 1QPCA 2BAJA 3EQCA 1AD5A 4AZWA 4EOQA 3D5UA 1H00A 4MV8A 4IVDA 1GOLA 1YDSE 4D28A 4DGOA 3H4JA 5AA9A 3E63A 4I93A 1ZMUA 4YTFA 2IW8A 2H96A 3I0QA 4J53A 3UIUA 1PYEA 4X6QC 3DXQA 2PZPA 3HRFA 3ORIA 5KE0A 3PVWA 4ACDA 3K5HA 4EORA 2GHGA 4XG4A 4JNWA 3NYXA 5K5XA 4GEOA 3FWQA 4QNYA 1WBVA 2VTPA 4YLKA 3QALE 2OBJA 5CEMA 1A06A 4ZLOA 2AC3A 2V22A 3RPRA 5AEPA 3BI6A 4A7CA 3U9CA 1QMZA 5JRSA 3QKMA 1CM8A 1V0BA 2AC5A 4C02A 3KMUA 5CSHA 3UGCA 3QFFA 4JXFA 2WQEA 3P7CA 3R9DA 3UNJA 3W1FA 2VRXA 1JPAA 2QO9A 2GSFA 4EHZA 4F9YA 3N8DA 4IZAA 3C5IA 4CXAA 2OXDA 3RKBA 1CQIB 4FKRA 5FBNC 4BDAA 3U55A 1FMKA 3CE3A 3P7BA 4RRVA 4Q5EA 3R5XA 3ZSHA 2BVAA 1R0PA 2FO0A 2PUUA 2ZDHA 5AP5A 3JR1A 2HZ0A 4YJVA 4TYJA 4FSQA 3C13A 4KWPA 3UOHA 3UOJA 5JH7F 5CT7A 2OF4A 2BUJA 3VA7A 2OKRA 4GJ3A 3NZ0A 4I6QA 5AM6A 4DINA 4ZZOA 2VTNA 4K6ZA 4GKIA 4Y83A 3ELJA 5HE1A 2WTKC 3EN4A 3DBFA 1UV5A 4PMTA 4ZSEA 4E5AX 4EHVA 3OY1A 4P90A 4E6DA 4O2AF 3KMWA 5E8ZA 2ERKA 1LUFA 3D5VA 4E1ZA 4FIHA 2RKUA 4S34A 1U46A 3UG2A 5KMLA 2QODA 2Y4IB 3CSVA 1VBGA 5DG5A 4RJ7A 4FGRA 2H9VA 2SRCA 1CDKA 4GT5A 3R8ZA 4EOMA 3BGPA 3ERKA 4DEIA 4YSMA 3W2QA 4B7TA 1OI9A 5CF8A 3EH9A 5FTQA 4FOBA 5HLNA 4O91A 4GUBA 3SAYA 3EQRA 4K18A 3LJ1A 3IDPA 3MIAA 5A6OA 2DWCA 4CRLA 3AC3A 3GOKA 3KC3A 4NKSA 4EH3A 4YUQA 1WZYA 2XKEA 4FTNA 3V51A 2XF0A 4PQNA 3D2KA 2UW5A 4AZVA 4CGAA 4G6LA 3BQCA 3DQXA 2WAJA 4WNKA 5TT7A 3ZZWA 3GXLA 2QVSE 3KF7A 1EYZA 4RVKA 3CXWA 3IW8A 2IPXA 3W16A 3V5QA 2XRWA 4I0SA 5HNIX 3BBWA 4F08A 4MVFA 5C8NA 4ZY6A 4O4LF 3GCPA 4XYLB 4IVAA 2PWLA 1UNLA 4GU6A 5AV3A 2XBAA 1R78A 2W9FB 3HYHA 3ZFXA 5CYIA 3HV4A 5BYZA 5D7VA 3I7CA 4BZDA 5FEEA 1PRYA 4BZNA 3UQGA 5DT0A 2XKFA 3P23A 1I7LA 3A60A 2VTQA 4C4EA 4MEDA 4L68A 1AGWA 3ZC5A 1UNGA 4EUTA 3UPZA 4EL9A 3R8UA 3PSDA 2XK4A 3S00A 4ZJJA 2YL2A 4II5A 3B8RA 4FX3A 4BDCA 4EH2A 4MV9A 3OCSA 2EWAA 2XS0A 3EIDA 2A19B 2JIUA 3R1QA 4O84A 3NS9A 3NUYA 2P0AA 5EM8A 2WMRA 2PE0A 5L8LA 3FZRA 3L8PA 2X9EA 3O8TA 3ORKA 4S31A 3QCSA 3VAPA 5C01A 3UTOA 3OWPA 2ZMDA 5HD4A 2PVJA 4B0GA 1WMKA 4O0VA 3OWLA 4OTRA 1BUHA 4HVHA 4QMZA 4DGLC 4I6BA 4IVBA 5EW3A 3C4WA 5JFXA 4HGEA 3TL8A 2IZSA 4TPTA 2PZYA 1PMNA 2X2MA 2UZOA 2WIHA 2XNGA 3PZEA 4ZZMA 3I81A 4JJRA 3D7TB 4X3FB 1EH4A 3DAKA 2XIRA 4ZEGA 4O0UA 2YRWA 5LXTF 5AUVA 2EUFB 5CXHA 2JFLA 2Y4PA 3IO7A 2UW3A 4G16A 3POZA 1NVRA 4YZNA 3H0ZA 3ROYA 4FKQA 1BYGA 3VUGA 4BRXA 5EH0A 4AOJA 4JAJA 4I23A 3RHXA 2HCKA 1OIUA 3T8OA 4GG5A 4QP2A 1GSOA 3R8VA 2QKRA 3JXWA 2YERA 5L2IA 3FMMA 1Y6AA 2HK5A 3H0YA 3G15A 3QRUA 4FTQA 5FP6A 2GS2A 2IZTA 2YM7A 2YAAA 2VTIA 3FMDA 4PDPA 5CY3A 2I1MA 4RWJA 3DA6A 5HHWA 3UIBA 3UP7A 4FBXA 5C1OA 4FKPA 5E8TA 3TI1A 3NNVA 3R6XA 4FZ7A 4M69B 4C34A 2ITUA 3TKUA 3F7ZA 5I9XA 2WEIA 1YHWA 3W2CA 2QF7A 1DI8A 2ONLA 4FUYA 3RCDA 3VHKA 1V1KA 4K8AA 3ZO1A 3Q9YA 5LA6F 2YIQA 1PXLA 4MQ2A 3R02A 3TACA 3TJCA 4AZEA 3DKFA 3VS2A 2EXCX 1CKJA 3A7GA 3EZRA 4YJRA 1XBCA 4F1MA 3D4QA 4KIQA 3OCBA 5AFVA 3S4QA 5ANKA 4A9UA 3V5LA 4EOKA 3R73A 4OTIA 3IONA 3NUXA 3CR0A 4ALVA 5M51A 2BHHA 2UZDA 2XK8A 4ANBA 4RFMA 4BCQA 1ZOEA 3A4PA 4R6VA 4FTCA 5HG5A 3T9TA 4EH4A 1M17A 3AMBA 5HVJA 3TW6A 5FGKA 1ZOGA 4F6SA 4IH8A 3W18A 3KQ7A 4QMUA 5DR6A 4FTUA 4YTCA 2BDFA 2GNFA 3FHIA 3ORZA 3OWKA 4YO6A 4YBZB 3JY0A 4YJ3F 3NIZA 2Y9QA 3MS9A 4ZLZA 1M52A 4L67A 4QTEA 5HX8A 1ZOHA 4XJ0A 4ANSA 4F9BA 5E90A 1UKIA 3NUAA 5CVHA 3TZMA 3HKOA 4C3FA 3ZOSA 4IAKA 4HVDA 5HLWA 5JRQA 1ZZLA
chains in the Genus database with same CATH superfamily
2VX1A 3B2TA 4ASDA 2C5NA 2C68A 3LAUA 2C69A 2UW0A 2EB2A 2B52A 2PVNA 3QZGA 2VZ6A 4X21A 4EKLA 4DEBA 3ZU7A 4EQMA 5BVNA 2XARA 3NNUA 1U59A 2R3PA 1Q4LA 5DE2A 2FA2A 4TNDA 4EUUA 1UU7A 1E9HA 1YQJA 1Z9XA 4UB7A 5KMJA 4MA5A 4NM3A 4XV3A 2NYAA 4U45A 3P78A 5AUUA 5KHXA 3KULA 3KXXA 4FMQA 3PP1A 1IA9A 5LJJA 3KU2A 2GQRA 3T7AA 3WARA 1P2AA 2C5YA 3EKKA 1UC8A 1PMEA 4L3PA 4QQJA 2G1TA 1H01A 3QGYA 5EM5A 3TZ7A 3MW1A 4GS6A 3FZ1A 2LAVA 3PY1A 3VBYA 2PL0A 4HN2A 2ITTA 5ETFA 3RP9A 1JSVA 4C38A 4DTBA 3E88A 3AGLA 3OD6X 4MNEA 3FSKA 3THBA 3QTIA 4I41A 1SCUB 4E6NA 1PXOA 5M4FA 3P08A 3R7YA 4UY9A 4A4XA 4EWQA 4I0TA 4NUSA 4IWYA 3SD0A 4TL0A 4XBUA 4LOOA 2JDSA 3R2BA 3GCSA 5AUWA 5KS8A 4ZTQA 2BTRA 3QZFA 4FKLA 2VWWA 4JIAA 4Z3VA 5HVYA 2OWBA 5AUXA 5C8YF 2VPQA 4FT0A 1XQZA 4DLKA 5I9YA 2CDZA 4ACHA 1ATPE 3UYSA 5IA5A 2BFXA 4GIIA 3VIDA 5M57A 4C0TA 4I0RA 4MYGA 4CNHA 4DFUA 4O86A 5DPVA 3CTHA 4FEQA 3KRLA 5J2UF 4H3BA 1I2KA 5HESA 3DBQA 4QP9A 3KY2A 2C6KA 3FL4A 3IGOA 3E8NA 1KJJA 2PUIA 4NFNA 3V8WA 4IM0A 3HRCA 3RALA 4FIJA 1DV2A 1KUTA 2W1FA 2QR8A 5M08A 3JZIA 3F3ZA 3PXYA 5CB4F 4WKQA 4KRDA 1ST0A 3UODA 2JKOA 1H1WA 3DB6A 5IDPA 3BYUA 2GS6A 4BCJA 4DT9A 3L8SA 3VO3A 3I4BA 4GVJA 2B9IA 3SXSA 5LVMA 2CNVA 2R9SA 2ITVA 3JS2A 5EI8A 3T9AA 4FT9A 1FGKA 2PN1A 3MJFA 3NUPA 3ZONA 2WMQA 4EZ7A 4F63A 4X6RA 4HR7A 3R1YA 4JMQA 3U9SA 4IM2A 2WTJA 4U80A 1ZWSA 3ZC6A 4CC6A 3LCTA 4ZJIA 4ALUA 4L43A 5GJDA 4O6EA 3LIJA 2O3PA 4Z9LA 1U54B 2YZAA 3O7LB 2UZBA 1PYXA 4MTAA 3HX4A 4EH6A 1YI6A 3BACA 2IN6A 3NYOA 4FGBA 4FODA 3TWJA 3DS6A 1KJ8A 4AQCA 5CS6A 4F0IA 5DGIA 5LYJF 4D55A 5AWMA 2NU8B 3E92A 2IJMA 4BBMA 4MX9A 3JY9A 1Q8ZA 4YJPA 1S68A 2VTRA 4YNOA 3UO4A 2OZOA 3FMNA 5BQ0A 4MV6A 2JGZA 5A54A 2PSQA 4J1RA 3U51A 4TWCA 3QD0A 3FZTA 2XRUA 3HL7A 2CNUA 3ID6C 3LFEA 4FTJA 5D41A 2A1AB 4HCTA 4OTQA 4YSJA 5GHVA 3LFDA 4OBOA 3BBTB 1BX6A 5B2KA 1TQIA 2PPQA 3Q3BA 3EQHA 3V6RA 3BX5A 5EQPA 3L9LA 1O6KA 3IPHA 2HGWA 3DXNA 2FVDA 2Y4IC 3MSSA 3QTWA 1XH6A 4GFMA 2X4ZA 4Q9ZA 2ESMA 4IAIA 3U9TA 3PIZA 4OW8A 3OY3A 4IWDA 3ZYAA 2YWVA 2RFEA 4FT7A 2OLCA 3O17A 4XP2A 3VS4A 2G2IA 4OTHA 3UIMA 4OTDA 4QMPA 4FC0A 5J87A 5EYDA 4ZHQF 1GZ8A 3GU4A 3OUKA 5IA0A 3B8QA 2YA9A 4R7IA 3K5IA 4EQ5A 4CMOA 5KZ0A 2CKQA 4FSNA 4UUGA 3II5A 4U97A 3TJDA 2CN8A 2PZ5A 2YIYA 3QQFA 4ZS4A 1QPJA 5IH6A 4CRSA 5KMMA 3VS3A 3UC4A 5D12A 4CTCA 4O83A 4G1WA 1KE7A 2YJRA 3AGMA 4EK6A 3EYGA 5J8IA 3VW8A 4DH1A 4NCTC 3WE8A 3GCUA 3LCOA 4H39A 4CFFA 2IVTA 4XG6A 4RIYA 5DHJA 2F9GA 4ZLYA 2GQGA 2DABA 1DAWA 2AYPA 4L00A 5BWXA 1CQJB 3NIEA 4PX6A 3MJ2A 4EOLA 2H8HA 3VHEA 2ITXA 2NRUA 2DYLA 2PVYA 2OJJA 3CCNA 3PWDA 4XG7A 4YZBA 1DGSA 5IQFA 2BRMA 4RLLA 4FL3A 3FQEA 2W06A 1OL7A 3NX8A 3DTGA 4NTSA 4KSPA 3COMA 3F66A 3CY2A 5DIAA 3CJGA 5EI6A 4G3GA 2JIVA 3FKOA 3TY8A 3VUIA 3LKMA 3TNQB 5DYJA 2XM9A 4BI0A 1TFFA 3PE2A 2I0YA 4IQ6A 5FM2A 4AU8A 5KNJA 1UU8A 3GP0A 5I5YA 1Z57A 5CEPA 1JAMA 5I5VA 3R21A 1YOMA 4MF1A 4R1VA 3Q2OA 5FP5A 5LCJA 4E5WA 4ZSGA 4CG9A 3AC2A 3GU8A 3I5NA 4J95A 5AP0A 2PZIA 2ZJWA 3C4EA 4DHIB 3OT8A 4YHFA 4PMMA 3KEXA 5K4JA 1JQHA 4DH8A 4EH5A 1ZMWA 5EFQA 3R7VA 3BAAA 4E4XA 1B6SA 3DTFA 3ZS5A 5CU3A 4DIMA 4XX9A 4QP7A 5H8BA 5IA3A 1GSAA 5A9UA 3WO1A 1WVXA 3PUPA 3TYKA 3O8PA 4BJJA 2QD9A 2VV9A 4DFBA 5LWNA 4DTKA 5FPRA 3WF7A 2XCLA 1W0XC 2IW6A 1F3MC 2A27A 2O2UA 2X7GA 3OMVA 4RVMA 5CASA 4EK5A 2YABA 4O81A 3D9VA 3ZUUA 3REPA 4AXEA 3FZPA 1OMWA 2PYWA 2VTSA 3P4KA 3H30A 2IZRA 2XP2A 3ZLSA 1XH9A 4QSHA 3C50A 3DBDA 3PPJA 2EIYA 2XK3A 4MUQA 1IOWA 2OZAB 3UYYA 4UFZA 3HV5A 2CJMA 5EYMA 3TXOA 4WNPA 3UJGA 2YJSA 4GIHA 4BDGA 4E6CA 5M09A 4R78A 3SKCA 3ZSIA 4FR4A 4K1BA 3T99A 3LFAA 5DGZA 3I6UA 5LMAA 3RMFA 2IVUA 3F5XA 2Y6MA 3VOTA 4I6LA 4FL2A 4IAAA 4IZOA 5LXMA 4JBQA 4CCUA 2HYYA 2WMTA 3ETAA 4P2KA 3LMHA 3MVLA 1QPDA 3ZRKA 2HZ4A 1CS0A 1OIYA 3FMJA 5ACBC 5IMXA 3DY7A 4ACGA 4GG7A 3ATSA 4UCUA 4MD8E 2XEZA 4TYHA 4FG8A 3BPRA 4KD1A 4YBKA 2XZSA 5HNEA 4O27B 3WI6A 3TIIA 2YN8A 1I2LA 5I5XA 1ZRZA 2R3LA 3O7LD 1OVEA 4RX9A 4R3RA 3HZTA 3FLWA 4KBKA 4BDFA 5CVGA 1JKLA 3KRRA 5AAFA 4CZUA 1SM2A 3NBZB 3I79A 2OGVA 3V01A 4RMZA 4FFPA 3MFRA 4DF3A 2RGPA 3GC0A 4GUEA 5ANOA 3MN3A 2OIBA 1VEBA 2PE2A 4DT8A 3OEFX 3NVMB 4EQUA 3OG7A 3DNEA 4HPTE 4G3CA 4CKJA 4EOJA 4ZMEA 3DPKA 1G3NA 3KRJA 3QXOA 3LM0A 4RT7A 3UE4A 4JI9A 1OBGA 3Q5IA 2ZV2A 3MFTA 4DE4A 3QGWA 3LFFA 3AXWA 3OXIA 3U4UA 4B8MA 2J5FA 4PP9A 4ACCA 2VQDA 3D7ZA 3GT8A 4L8MA 4NJ3A 5EDRA 5IUGA 3TDVA 4JDIA 4NU1A 3TKHA 4TVIA 2X2KA 3F88A 1NVQA 2V5AA 4TM5A 2WD1A 2WTIA 4GT4A 2GDOA 3DLSA 4DEHA 3HDMA 4G17A 4L44A 4EHGA 3TQTA 4WRSA 3MJ1A 3UQCA 4FVRA 4C3RA 3EZVA 1MP8A 4LV5A 4M67A 3W2OA 5IA1A 1KOAA 2PE1A 3WE4A 3W32A 1FVVA 1OECA 2RL5A 3T3UA 4Q5HA 5IQCA 1DAAA 2QR7A 3SA0A 1REJA 5EOBA 2F57A 4DFNA 4AAAA 2WFYA 3LFBA 5BMSA 5BWWA 5C1QB 5CNOA 3IS5A 4HGTA 4FL1A 1O6YA 4N70A 2R3NA 2PMNX 3CC6A 3DKOA 3LFNA 5IQIA 4JDHA 5KHWA 5BNJA 3A99A 4APCA 1XH5A 1IYEA 4O7RA 2PBZA 3ZM9A 5HEZA 3OEZA 3JPVA 5AP7A 4AZSA 3ORTA 4CVAA 1P14A 4M8TA 4OLIA 5K4IA 2Z04A 3WWHA 4O2ZA 1JNKA 5I47A 3U4WA 4FUXA 3UVRA 5GJGA 4FG7A 2OXXA 2QO2A 2WB8A 3ZLWA 4MA0A 1CKMA 2QURA 3ET7A 4DLIA 2NRYA 4BCMA 3GFEA 4UWBA 5ANEA 3V4SA 3BCEA 3F5GA 2W1EA 4Z7GA 4S33A 2WTVA 4YJUA 4DG3E 1A0IA 4O2BF 1YI4A 3EL7A 1VR2A 5K2MA 4EKKA 4FKVA 1LEWA 5HORA 3G9NA 4RX7A 3T9FA 5AX3A 5FXRA 1YVJA 3RPYA 3VS5A 3CQEA 4EZ5A 4DAWA 2FP4B 4HNUA 3RM6A 3MVHA 3KMMA 2GTNA 4PNIA 4U42A 2BRHA 4WIHA 2UW4A 1K9AA 5JN2A 5LCKA 3L2PA 5JFSA 3PXZA 2GNGA 5E92A 5J9YA 2FPIB 1FVIA 1GIIA 2R3HA 3D0EA 5H8GA 2BKKA 3CTQA 2DWBA 5HIBA 3R9RA 2XNBA 3Q04A 3ZDUA 4I6HA 3G8DA 2C47A 1UU9A 3FQSA 4IW0A 3RAHA 1M14A 4UX9A 3VULA 1CKPA 2QU6A 5CU2A 3VN9A 3ZRMA 4ASZA 4DGGA 4ZAUA 1Q24A 3PJ8A 2ZOQA 3PUFC 4GK4A 3LQSA 1LR4A 2GMXA 4JX7A 1GSHA 3PY0A 3G5DA 1E1XA 3KA0A 2GS7A 2G01A 4O0RA 5CU6A 3R01A 3E64A 4FKSA 4CFVA 5A4CA 4NZNA 4PDYA 5D11A 1BL7A 1WBWA 3WIKA 3LCSA 2JKQA 4UXLA 4BDEA 4D4VA 4FV2A 2X5RA 2BR1A 5IA4A 1YI3A 4FKJA 1G8SA 5H80A 5IMEA 4I4FA 3LULA 5DISC 3NAXA 4FOCA 2HIWA 3TKIA 3POOA 5HTCA 2WKMA 3C7QA 3BIZA 2I6LA 2XB7A 3W0PA 3OCGA 5M44A 2J0LA 5D1PA 2C5OA 4J97A 2OSCA 3DB8A 4DITA 4RA5A 3QUEA 4IE9A 3OS3A 5DR2A 2CGXA 4IDTA 4B4LA 5BMVF 1JBPE 5HBHA 5BVKA 5CM0A 5DR9A 1JWHA 4HCVA 2Z7LA 2OF2A 4EOIA 4D0XA 3A61A 1JKKA 3G0FA 3WF5A 4HYUA 4DCEA 4EBWA 3RFCA 4QMXA 5DT3A 4IZYA 4YJNA 2ZVAA 3QUDA 4XHKB 3HDNA 5M4IA 3RHKA 4DFYA 3F2NA 5CQWA 3R7UA 5GIOE 3IDCA 2W1ZA 3V6SA 4AP7A 1PXPA 4ZIMA 5JMSA 5L2SA 4MV3A 1P4OA 3AQVA 3HMMA 4JBOA 4TW9A 5IQAA 3QZHA 4YZCA 3Q9WA 3S95A 1OUYA 4V05A 4YHTA 4A06A 1CKOA 3ROCA 3I0OA 4L46A 4F6WA 4IACA 4CEGA 5TR6A 5EDQA 5FBOA 5FTOA 4ASXA 2W6NA 5LP6F 4ZI7F 1OKWA 4FIIA 2W5BA 4DH3A 3BL7A 3CJFA 5ACKA 2R7KA 3WF9A 3QRJA 1W82A 1NA7A 5IUHA 3FEGA 3QKLA 4Y8DA 2PVRA 3FYJX 3P9JA 3RR5A 5FDXA 1JLLB 3PP0A 4WBNF 1NY3A 2PUPA 2VWIA 3DJ6A 5AP3A 2YACA 4KIOA 3WZDA 4BDKA 4APPA 2GNIA 5F9EA 5JGAA 4LL5A 4QTCA 5LQFA 1BNCA 1G8AA 3EJ1A 4CLJA 3RV4A 2Y4RA 4NFMA 2R2PA 2YCQA 3MWUA 2QLQA 4TWPA 4ZTRA 5DRDA 3NYVA 1YWRA 1VYZA 1RE8A 2G15A 1H1PA 4U9AA 5HX6A 1J7LA 1VLRA 1LEZA 4O21A 4GCJA 1Y8GA 1YRPA 3KYHC 2UW8A 3VJNA 4MH7A 2CKPA 3AMYA 4RJ3A 2JIIA 2F4JA 4P5QA 4O7SA 1YXSA 1STCE 3BWFA 1KTAA 3MYGA 2Z2WA 4GT3A 2YS7A 3FPMA 2HAKA 3BHHA 1IOVA 3RK7A 2R7IA 2XK7A 3RTPA 3F6XA 3Q96A 4BCPA 2DUVA 3F3WA 5T6KA 3SQQA 4C4JA 4DGNA 4RVLA 4HNVA 5IQHA 3JYAA 4BDDA 2YCRA 3CD3A 4JL9A 2UVYA 4TZRA 5CEQA 2GCDA 4Z55A 4M9UA 3S3IA 3MH3A 5D9HA 1CKNB 3VS7A 4FKOA 4IZ5A 3F3VA 4HNFA 4FTAA 4XP3A 4FEXA 5I60A 3FUPA 3Q4ZA 3DLZA 2YDIA 3O23A 4O2PA 1WBOA 3KB7A 1P16A 4XG9A 4UCRA 3VS0A 3W2SA 3KGAA 5IU2A 4ORKA 1SMHA 3PA3A 4JR7A 2P33A 4NWMA 3KAJA 3H10A 2RFNA 4MNFA 1W98A 2XYNA 2ZMCA 3IQ7A 5IG1A 5LVNA 3KRWA 3V4ZA 4ANQA 4YTHA 4F7LA 2Q0BA 4X2KA 1OUKA 1KE9A 3QUPA 4WHZA 5L6OA 4ZTLA 3R9OA 3UPXA 2X2LA 1JLUE 3MV5A 3OW4A 4MKCA 3NAYA 3NUNA 2HDKA 1PXNA 3BYMA 5HQ0A 1SYKA 3W8LA 1U4DA 2XIZA 3HLLA 3KF4A 4FNXA 3QRIA 4ZTSA 4EG0A 3MH2A 4YBJA 4I4EA 1XMLA 3E87A 3LXPA 4USEA 4IDVA 3PXRA 4GRBA 4IAYA 4RWKA 3MTLA 4KS7A 3A2CA 2RFDA 2XH5A 2ZB0A 1UU3A 3CPCA 3DK3A 3QX2A 3AT3A 5C8MA 3UDZA 5CX9A 2QOFA 4U3YA 2ODTX 1H8FA 3R9NA 4RIXB 3HV7A 2ITNA 4Y85A 4BYJA 4Z16A 2R86A 3LCKA 4NW6A 2Z02A 4DTAA 1OZ1A 1Y57A 2BIKB 2FSMX 4WBBB 5KBRA 3PG1A 1TA8A 3M2WA 4N57A 3UZTA 5CT0A 4FFRA 4UYAA 3RUPA 3DBCA 3W5OA 4ZZNA 3FBVA 3PDTA 3LM5A 4D1SA 3UBDA 4BBFA 2EJ0A 3C9WA 3IKAA 3SOAA 3GGFA 2WIPA 3FSFA 2J0KA 4QTDA 1Y91A 1M7NA 4NCTA 3UZRA 4XZ3B 3JUHA 1TVOA 4U41A 3HECA 4U79A 4L7SA 4E93A 2CLXA 1W7HA 4RJ5A 2BHEA 1BMKA 2NO3A 2QOOA 2XIXA 4QMLA 2X4FA 1OPJA 3QBNA 5ANGA 4BB4A 2ZGIA 3SGCA 5I9ZA 4AS0A 2UW7A 2J0IA 3E3BX 1Y6BA 4QYFA 4K0YA 3PIXA 3P5KA 4FTKA 3RAWA 5ETCA 3VRYA 4BHZA 2I0HA 3MY5A 3RGFA 3FYKX 3UIXA 1URCA 3I60A 3NDMA 1ZXEA 4FYNA 3RI1A 4DYMA 4RCNA 2IW9A 4F6UA 2YW2A 5DWRA 3A7FA 3OXZA 4E6QA 5DAAA 3GUBA 3UMWA 3N9XA 5B0XA 3DDPA 4C62A 3SG8A 1G8KA 3FHRA 5IISA 1KEEA 4CTBA 4AOIA 3E5NA 2LGCA 4ALWA 3ETJA 3QL8A 2YZNA 2VO0A 3ZBXA 3LW0A 3BLQA 1WVYA 3CD8A 4WNMA 4D1ZA 3OUZA 2ITPA 2W0JA 3LQ3A 4CG8A 1VZOA 2KULA 1BXRA 5CNNA 4RZVA 2XD4A 4LQMA 3G0EA 2RFSA 2B53A 2NU7B 4FNYA 1X9NA 4U3ZA 3RCJA 4EI4A 2UZUE 1URWA 1UVRA 2QOHA 5AV2A 2OIQA 5IEVA 4W4WA 5KUPA 5K3WA 4RWIA 4RWLA 2V55A 4AZTA 2W99B 2WO6A 4G6OA 2PHKA 3EB0A 3IECA 3QFVA 4FI1A 4I5HA 3TIZA 5F94A 3D7TA 2QQ7A 2IO6A 4TUYF 1Q99A 3BKBA 4DDGA 3JZFA 3HAMA 1P4FA 1Z5MA 3OXTA 3FDNA 3U54A 2OH0E 4C61A 5DGHA 4WUNA 5DEWA 3K3IA 3O5AA 4WRGA 3IW4A 3TV4A 4AN3A 5KKRC 4FFMA 4YLJA 4L01A 3WZUA 4FFOA 4NZOA 5GIPE 3GLKA 2YWPA 3BRBA 4BTKA 4LDTA 3W1BA 4EJNA 3NW5A 3DDQA 5FLFA 3T54A 2Y7JA 3NBYB 2JDTA 4BY9E 4A9TA 4IB0A 4MQ1A 4WD5A 4BGGA 2WQBA 2XM8A 4CFUA 4MHAA 4F1OA 1BI8A 4AG8A 1WR2A 2YYAA 4C4HA 2DZDA 5LMKC 3ZUTA 4KS8A 4AFEA 4CFNA 2FH9A 2FPGB 4AUAA 2GNLA 3E7OA 3MB6A 3VPCA 3I1AA 3VBQA 5CLPA 2EXMA 5C8KA 4EC8A 3G2FA 1EKVA 4BKJA 3COKA 3LE6A 3ZLYA 2PK9A 1W84A 4AW2A 4USFA 1OKZA 2B54A 2R64A 3KREA 3Q53A 4I92A 1J7UA 1JKTA 5BYLA 1W93A 4FTTA 4YU2A 4BTMA 4FNWA 4IVCA 4UALA 4UYNA 3W0QA 2QONA 2C6LA 4FTMA 3CQUA 4L53A 5CEIA 4JOAA 4ZQIA 2F7EE 4ITJA 4CV8A 2PVLA 1IRKA 5FNVF 2UZWE 5JVLA 1IR3A 4D4SA 4D58A 2GPSA 3E8CA 1SVHA 5HKMA 4KRCA 1I7NA 3GBZA 4OTFA 3PYYA 1YDTE 3OF0A 3QQGA 3TTIA 3QD2B 4JQEA 3R71A 5LOVF 5IPJA 4ZTHA 4QDVA 1XJDA 4FEWA 2ZYBA 4AOTA 4IHJF 2JBOA 4HNIA 3QLGA 3FKNA 4ONAA 5EHYA 2I8CA 4FEVA 2V0DA 3VBWA 5K5NA 3KFAA 1R0EA 2NNWB 2R0UA 1NW1A 2VTHA 2VWBA 2J9GA 4LH6A 2WU7A 4V01A 4XV2A 3KAKA 3ANQA 2R4BA 3PXKA 5HG8A 1OPLA 5L8JA 4BVUA 1PXJA 4F64A 4C33A 1TAEA 3WF8A 5BYAA 4RQVA 3GU5A 5HG9A 3WZKA 2H6DA 5BV3A 1FVRA 4JRVA 5A3XA 3W10A 4BR3A 4LFIA 3ZCLA 4YJTA 2HXLA 3D94A 1H1RA 1GY3A 3KCFA 3SXFA 3F5PA 3DJ5A 4FSWA 4P5ZA 4XRLA 2V7OA 2WHBA 3G51A 4KUJA 2R3MA 2ITYA 3ODZX 3FMEA 3BGQA 3L1SA 4RZWA 1J7IA 3NUSA 5IA2A 4YJ2F 4EFBA 4V0GB 3MGYA 4UN0C 5D1OA 4BHNA 2WTCA 2QKWB 3QWKA 2GNJA 5EYKA 1GLVA 4U43A 2HIXA 4E4TA 4AA0A 5FM3A 3PPZA 1FINA 4RBLA 1W8CA 2W70A 5CF4A 2C30A 2QG7A 1DS5A 5JFVA 3HMIA 3GOPA 4TTHB 5GJFA 4DDIA 2CZGA 5EW8A 3DOGA 5BUJA 2OH4A 4YJOA 2O65A 2VUGA 4PDSA 2UV2A 4XLVA 5I9VA 3RM7A 3RJCA 3BHUA 4MXCA 2ZFYA 3QTRA 1Q8WA 2X1NA 2YIWA 3N4VA 2PTKA 2FYSA 2QK4A 4EK8A 4G9CA 5CZIA 4M0YA 1JKSA 2Z60A 4I5PA 4PP7A 4O96A 4ME6A 4YNEA 4ANMA 4FZAB 4KBCA 3TMOA 4AXFA 4L1KA 4D4RA 2W1GA 3NMUF 4U0IA 4IWPA 5FEDA 2A0CX 1ST4A 3JSLA 5CAEB 4G34A 4IWOA 5CA0F 2VTOA 3NYNA 1KE8A 2EB3A 4Y8VB 5ETAA 4EOOA 4X3JA 4O7LA 4LOQA 2I0EA 4BDJA 4GVAA 4ZXTA 4JDJA 3Q9ZA 4QQTA 3FMLA 1M2QA 3WF6A 3R30A 4JVGA 3BLHA 3AD6A 3SLSA 3UNKA 2DLNA 1QL6A 5J2TF 5I5SA 4TXCA 3OTUA 5CAOA 1GIHA 3FV8A 5KX5F 2ETRA 2ETKA 4DQNA 1M0WA 2JKKA 3R9HA 4ZTMA 5FXSA 2CGUA 3SDJA 4LUDA 4QP1A 2HOGA 5GINE 5EZYF 3FKLA 1R1WA 2ZDTA 3A62A 3CBLA 5CU4A 3UOKA 4MV7A 5M06A 4C5AA 1W96A 2ERZE 4C37A 3S2PA 1B6CB 4F4PA 2G2HA 4YJSA 2W6OA 1IA8A 2Y6OA 4EQCA 2JAMA 4IWXA 2GFCA 5CXZA 3ZFMA 2XIKA 5AUZA 3LJ2A 1WFCA 3Q32A 5IYZF 3QU0A 4QMVA 3AC4A 3ALNA 1XKKA 1UKHA 2PMLX 1EUDB 5DLSA 5DBXA 4IHPA 3PG3A 4EOSA 3TG1A 5HCXA 3A7HA 4J71A 4BCFA 3GC9A 5FG8A 4R5YA 3EFKA 3QQMA 3QHRA 3EQFA 2BIYA 3QAME 4TYIA 4EFEA 4BDIA 4IC8A 4YJQA 2WMSA 2JLDA 3AC1A 4FTLA 4RJ4A 5HE0A 3FPQA 2PY3A 3SXRA 5BVFA 3KXHA 4CFWA 5BPFA 4UZHA 4RIWB 1ZY5A 4CMUA 5HIEA 2R7MA 1WAKA 3JVSA 3QYWA 1Z2OX 3SC1A 4E5BA 4EH8A 4YTIA 4BIDA 2R3GA 4IJPA 2QHNA 2YCFA 3GU6A 2VD5A 3K2LA 2X8DA 3L9PA 3MPTA 3PJ3A 4PY1A 5HCZA 1J3HA 3OP5A 4XX0B 4DC2A 4M12A 4RG0A 4EC9A 2BZKB 3VUMA 4YAKB 3EN7A 5E8WA 4NM0A 3ENHA 5AP1A 1XK5A 1O6LA 1GZKA 2BALA 3U0GA 4LRJA 4Y46A 3CPBA 2FSLX 1MRVA 4XH6A 5JQGF 5DVRA 4KINA 4KNBA 4MBIA