3NUAA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from clostridium perfringens
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
236
structure length
236
Chain Sequence
AMVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFGRYNGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal Structure of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase from Clostridium perfringens
rcsb
source organism Clostridium perfringens
total genus 84
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuaA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3nuaA02
1KUTA 5DLSA 1GIJA 2GQRA 5HICA 1CKJA 2UW3A 2W4OA 4BIDA 5E8SA 3A7HA 4UY9A 4MD9E 5E4HA 3MVHA 2XK7A 2ITNA 4GT3A 4QQ5A 3NUXA 4QMMA 1WAKA 2XIYA 2XKDA 3SX9A 2W05A 3TM0A 2GNFA 5TKDA 3RTPA 4BHNA 3QL8A 4GL9A 4I4FA 3DXPA 3MJ2A 1DV2A 4UXLA 2QO2A 3FPQA 2YIWA 5FTQA 5AAGA 3DK7A 5E8XA 3DJ7A 3EKKA 3NGAA 2J4ZA 3QXPA 3ROYA 4ALVA 3JY0A 3GCVA 3OCGA 4D0XA 3MWUA 2YEXA 2FSTX 3FY0A 3NUYA 4A9RA 3WZDA 4YJOA 4JG6A 5CASA 3LXLA 3EN5A 5HQ0A 4K18A 3SAYA 2Y7JA 2XIZA 4FV2A 4W8EA 3VUHA 3CJGA 4EH6A 4F65A 1Q41A 4AW2A 3Q52A 3CGFA 4D1SA 3DJ5A 4R3RA 3UNZA 2QG5A 2JDVA 4EOQA 2R3RA 2VWUA 4G3DA 4I93A 5DH3A 5TT7A 4QP1A 3KC3A 3QU0A 4MAOA 4X6QC 3I81A 4HGSA 2R84A 5CAVA 3R30A 4FV6A 2VRXA 4MD7E 1C30A 5A4QA 3EQCA 3QTQA 4Q5EA 1WBOA 3K5UA 1Y91A 5AP5A 5M4CA 3TIYA 1B6SA 4AZVA 4GS6A 3B2WA 2FYSA 5AFVA 3KF7A 5C01A 3BGQA 3UOJA 2OU7A 2WMRA 4N6YA 4CFFA 4FNYA 2XCHA 4YNEA 5JH6A 1IAHA 3GVUA 3HV6A 3UZTA 1OL1A 1QPCA 2J7TA 4FT5A 3AD5A 5JFXA 1I7LA 3QD3A 1PYEA 4S31A 3HO8A 3GENA 4S34A 5EW3A 2HOGA 3EHAA 2ZMDA 2CJMA 1GOLA 3ZXZA 1E1XA 2WO6A 5IZFA 2WKMA 4J8MA 5KZ0A 3EMGA 4O0UA 2V5AA 2YS6A 2FGIA 4I3ZA 4IB3A 1M7QA 5AP0A 4DH5A 5F9EA 3DKOA 4I6QA 1JWHA 2XKCA 1MRYA 4JOAA 4X21A 3IW6A 4FL3A 4IAYA 5CSXA 2PULA 4HGTA 3R9OA 5D11A 3E8NA 2FPGB 5KX5F 4QQJA 1Q97A 4EYMA 5JH7F 1DM2A 2ZJWA 4I6HA 3KK9A 4TYHA 4APPA 1IOVA 3RHXA 5KMLA 4XG6A 2I80A 2Y4PA 5I9WA 2UW4A 2ITYA 4LOPA 4IJPA 2GS6A 3VJOA 4AW5A 4FKRA 5IMEA 3NW6A 4FG7A 3E5NA 4AX8A 5CVHA 5LCKA 4UB7A 4BDIA 4ENXA 1Z2PX 2V0DA 4D4YA 3DFAA 5TOZA 3WF7A 4FFLA 4O2AF 4BCPA 3BV2A 3GB2A 3QD0A 3QHWA 4RWKA 5HO8A 2J5FA 2R3QA 1W7HA 4NU1A 3PJ3A 4X3FB 4RJ3A 5ETFA 2YM3A 5KMKA 1ULZA 4CQEA 5IQAA 4W4WA 2X6DA 4E4TA 2HIWA 5J2TF 5DT4A 4E93A 2ZAZA 1M2PA 2ZV2A 5DR2A 4KBCA 3RM7A 3ZSHA 5BVWA 3ITZA 3PG1A 4TWOA 2JLDA 4G3EA 4RX8A 4YZDA 1NXKA 5EQEA 5CEQA 4X3FA 2IG7A 4BICA 1GJOA 2J0KA 3A4PA 4G34A 3SV0A 5AWMA 5CNOA 4DFBA 4ME6A 1KWPA 4XG8A 3H0ZA 1PXMA 4CFMA 3WO1A 4EOJA 1JNKA 2VTIA 3C1XA 4USFA 2PVKA 4F1OA 3FMMA 4IBMA 4H39A 4UV0A 5BVFA 4GSBA 3C9WA 4EOIA 5L8LA 2PTKA 2WEVA 2JBPA 4FR4A 2WTCA 5LMBA 1SCUB 3WE4A 2IW8A 3ID6C 4BTJA 4EQUA 5BMVF 1AQ1A 3TZ9A 2YAAA 1PMVA 3A8XA 2X4ZA 2PE2A 4WG4A 3LHJA 2VGPA 4OTFA 1L8TA 3U87A 2F57A 3ULIA 5L3AA 3A60A 3MTFA 4YU2A 1VYWA 3EFKA 4G6NA 4BDAA 4AXAA 4PP7A 1W82A 3VBYA 3AMAA 3FXXA 3EQHA 5EK7A 3REPA 1HOWA 2WYOA 1H4LA 3O7LD 4CZTA 5L8KA 1R39A 4R77A 4EOMA 3W8QA 3UJGA 4HOKA 4EC9A 4HCUA 3LXPA 4H1MA 4F9WA 4QMZA 2WTIA 3SDJA 3U8WA 5K3YA 3EQIA 5C03A 3OMVA 1Y8YA 3TIIA 3R6XA 3F5GA 2ITVA 5FGKA 2F4JA 4IW0A 5EM5A 3BE9A 3ZO2A 3A61A 4C33A 4F64A 2HW6A 2R82A 4XYMB 5JKGA 2XNBA 2GMXA 5TF9A 2W4JA 5BPYA 5CU0A 3HL7A 4O7ZA 3RV4A 2BHHA 4O2ZA 3S4QA 4MK0A 5D8DA 2PVFA 1CKPA 3NUNA 2XUUA 2ZM3A 1VBHA 2HZIA 1U46A 3H4JA 4RJ7A 2R3MA 4FA2A 3ZC5A 1UU9A 5FQDC 2A4LA 4YLJA 3TZ8A 3GT8A 4ZLYA 3QZGA 1BL7A 2NU6B 1JKSA 2YFXA 3R83A 3PVGA 2HZNA 4O7NA 3TKUA 4G17A 3ORZA 4O38A 4PNKA 3VULA 3U6HA 4NT4A 4AN9A 3BYMA 4EZ5A 2VO0A 1YXTA 5A4LA 2ONLA 1UNLA 3KY2A 4LRKA 4MQ1A 4WBNF 4KSPA 3VHKA 2PMOX 3HRBA 4O7VA 3NMUF 4MBJA 4KS8A 3RZBA 5IA0A 4QTAA 2GNIA 3QQKA 4QMQA 4EJNA 2C5NA 4AZSA 3Q9ZA 3QTWA 2VNWA 3DZQA 5DYJA 3JRXA 2JDOA 1DAWA 3CSVA 3GQIA 3GQLA 3GFEA 4YLLA 1JSUA 5CU4A 3GU5A 3VHEA 2V58A 5CZHA 3VBTA 3KFAA 4JDHA 3VF8A 4QP9A 4K8AA 1DIKA 3UNJA 1PMUA 4H3PA 4FKOA 1H0VA 3DNEA 3F69A 1VZOA 4W4YA 2YM6A 3ZDUA 4KIQA 3E64A 4RMZA 5KBQA 5LARA 1WBTA 4ZEGA 4AZTA 4EUTA 2W6QA 3E7OA 4FFPA 5HG9A 3S1HA 3MPTA 2YZMA 3D83A 4A9UA 1YI6A 5HBHA 1M2RA 3SD0A 5ANJA 3TZ7A 1GGOA 2BIYA 2X2MA 4AFEA 2ITXA 5IUHA 2J90A 2CKOA 2GLTA 5EDRA 3RWQA 2UZUE 2VU3A 3PIYA 5TR6A 3V04A 4I24A 4I5HA 4IB5A 4J52A 5JQWA 5EOLA 5A6OA 3QA0A 1BXRA 3LFEA 5M56A 2CGWA 4M9UA 4YZBA 1FMOE 3U9SA 4NUSA 1W93A 5CAQA 3DY7A 4BDDA 4E20A 1H27A 3HV7A 2W1CA 4QYHA 2PMIA 2UW8A 5BYLA 3Q6WA 4IMYA 5LOHA 1JKJB 2JIVA 4ZXTA 2PK9A 3ORXA 1KOBA 4M67A 4RC4A 1CMKE 4FV1A 4KSQA 3CIKA 1YRPA 3MESA 3SLSA 3FI4A 4J53A 4Y95A 2UW9A 4FIFA 4X2FA 3TUBA 5F1ZA 3GU6A 2JITA 4JLCA 2CKPA 3A8WA 4AE6A 3RPOA 4O82A 3E3PA 2ITOA 2XVDA 2X7OA 3ETHA 2ONLC 5HCXA 3BGPA 4YTFA 5KKRB 2QOQA 3VN9A 4CFWA 2R7MA 4MNEA 2WU6A 3DB8A 3DLSA 5HLPA 4XG9A 3V4SA 1OKWA 2FVDA 2HW7A 3NVMB 4R5SA 5DRBA 5E92A 2PZ5A 1SVEA 4RC2A 3OCBA 4MHAA 3R7EA 4USEA 5I4NA 3S2PA 3B8QA 3U4UA 3FMHA 3ZZWA 2UW0A 4JJRA 5A6NA 3NEWA 4QMNA 4ANSA 5CF4A 4U3ZA 2QK4A 2R3GA 5IU2A 2YZLA 3KL8A 3A7JA 4YZMA 3W33A 3MH3A 4D5HA 4ZS4A 2GPHA 4GK4A 4GU9A 1WBNA 4FUYA 3NUUA 2Z7SA 2IVSA 3KAKA 1H1SA 3HV3A 5DMXA 3MPMA 2BHEA 1UVRA 3L8PA 4AN2A 3F5UA 4NW6A 4Z16A 2B1PA 3IW5A 2NU7B 2J9MA 2JKMA 4YJSA 3CD8A 1I09A 1OVEA 2J0MB 2H96A 1Q8YA 2C6OA 4HR7A 4ZS0A 3L8XA 4MWHA 3G9LX 4FT3A 1FOTA 3BU3A 3ELJA 3G33A 4FNXA 3PA5A 4RJ5A 4ALUA 3KAJA 2YZAA 3BLQA 3DTCA 3KRWA 3ZOSA 2WTKB 2VGOA 5FEEA 2YM4A 2CZGA 3VA7A 1Z57A 5GJFA 1KBLA 2X8IA 4GMYA 1XR1A 3ZEWA 4FSRA 3M42A 2P33A 5CU6A 2X39A 4FSTA 4RIOA 3K3IA 5DEYA 4FKTA 1OIYA 2X6EA 5A4EA 2I0VA 5I9XA 5CF8A 2ZDQA 3TINA 4Y8DA 4HNTA 4L3JA 4O0YA 4BIBA 3R2YA 1JSTA 4D1XA 3R1SA 4EH2A 3LIJA 3CLYA 4D2SA 3ZBXA 2R3JA 2WMXA 4ZJJA 2HCKA 2Z7RA 3RVGA 1R3CA 3MI9A 5GONF 3PSBA 4QP4A 4HCTA 3MWDA 3HMMA 4UYNA 3HB9A 3R2BA 4IC7A 4V04A 3R73A 4FVQA 3EL7A 4TWCA 1XH7A 3G6HA 4NK9A 1UU3A 3MFRA 4YPSA 4PP9A 3IONA 3DV3A 1R0EA 4WNKA 5E1EA 3SG9A 4DFNA 3DAEA 1AUVA 5E7RA 4A9YA 5HE1A 4MXZA 1OIUA 4FFOA 4BKJA 3L9LA 4EI4A 4OT5A 2VPQA 2P2HA 3QC9A 4FIHA 3E8DA 3TWJA 4KKEA 4FTOA 4FSQA 1TQMA 4RX7A 3GGFA 2PVPA 1GSHA 3AW8A 4Z9LA 1A48A 4C5CA 1IR3A 2VTLA 4Y5HA 3P7CA 1IG1A 3LPBA 3V6SA 3ZZEA 1KE5A 1ZYJA 3EQPA 3PFQA 4BZDA 2YM5A 4OTRA 2R3OA 2PMLX 5DVRA 5M4FA 2BRHA 2R9SA 1H1PA 3NW5A 2HZ4A 1XH4A 3NSZA 4MWIA 4TN6A 3HLLA 2VTTA 4BI0A 4XP0A 4C59A 4I4TF 3FXWA 2WD1A 4I0SA 5EQYA 4CLIA 4YBKA 3UP7A 3V51A 5KMIA 4N70A 2WTWA 4D2RA 1ZOGA 5HG8A 2CNVA 4FSUA 3DBQA 2B7AA 2WMWA 4ZI7F 3U4WA 2CPKE 2VTQA 4YJQA 1W0XC 2C5VA 2WTVA 3QCXA 3WF8A 5I9UA 3PRFA 3ZLWA 1JKKA 3WZKA 2CCIA 4I0TA 3BLRA 4CV8A 3PPZA 1Z2OX 4ACDA 2YERA 1OPJA 4FKWA 4N4SA 5EM8A 3THBA 3R71A 4X0MA 3MS9A 4Q5HA 2C47A 5CAUA 1ZLTA 3ZFYA 2P2IA 4P5QA 3VBQA 3NYXA 2W1EA 3FBVA 2F7ZE 2BILB 2XNNA 3FZRA 4FZ7A 4YBJA 4AOIA 3C4ZA 3ALOA 4A7CA 1JBPE 1YI4A 3RP9A 1WCCA 5LVNA 5LYJF 3AG9A 1YHWA 3MTLA 3KGAA 4Y8VB 5KMNA 4RZQA 2G2FA 4FIJA 2YL2A 4QT1A 1FGIA 4MKCA 2XZSA 3LM0A 4H3BA 5DE2A 1LP4A 3RAKA 3LFDA 4FICA 4D4RA 2R7NA 3QX2A 2QQ7A 2C6TA 4U80A 4FIGA 1NT2A 1WZYA 4X2GA 4CFXA 5CYIA 5AV3A 4GEOA 3NYVA 5EH0A 5EDPA 2NO3A 2BAKA 2W99B 4E73A 1VYZA 4WUAA 4QRCA 4F7JA 4I55F 4DBNA 2RG5A 3HP5A 2VTJA 2JEDA 3NNWA 4BGQA 4CFUA 1WBWA 4U81A 3FZTA 3KK8A 5HG5A 4HYUA 3EN4A 4KBKA 4DC2A 5HZNA 3DQXA 3ZO1A 1QCFA 2NU9B 4LUEA 2BCJA 2GNGA 4C4IA 4C3PA 4CV9A 4QMXA 3Q4ZA 4NFMA 1OMWA 4YJRA 4DIMA 4TY1A 4BR3A 5HE0A 5B7VA 3MA3A 3QQJA 5M09A 1PHKA 3PY1A 3R9RA 3BE2A 3SC1A 3ZO3A 1H1QA 2HWPA 2VWYA 4AAAA 5CS6A 3RUPA 2C3KA 3SXFA 4M8TA 3SW7A 2BKZA 2OGVA 5ETCA 2FH9A 3U54A 3UTOA 1PKGA 5HG7A 3I7CA 2VWIA 2XBAA 2QVSE 3U9TA 5JEBA 2XNEA 4GVJA 3MJ1A 5CQWA 5H8EA 3U51A 2WGJA 4GFOA 2XIRA 3VS3A 2C1AA 3I5NA 4M69B 4F0GA 4NYEA 4XH6A 2VTHA 3AT4A 3T8OA 1GZNA 3G9NA 5ITAA 2BDFA 2OSCA 2YCFA 5AV2A 3R7IA 3ZDIA 4I6BA 5CY3A 2R4BA 3Q9WA 3WILA 4OT6A 2O2UA 3OBJA 2PBZA 4ACHA 1XH8A 4Z55A 1ZY5A 3HZTA 3LVPA 5CU3A 2VTNA 1W8CA 3AOXA 4CFNA 1CTPE 4N0SA 5LVOA 1Q5KA 2GTMA 4YSJA 2ZV8A 5JRQA 2I0HA 5BMSA 4Q9ZA 2B55A 5JVDF 2RFDA 4XJ0A 1PXJA 2R3FA 3RK7A 3HYHA 4QOXA 3LW0A 4G3CA 5AP6A 4BHZA 4FV0A 2JFLA 1FQ1B 3I79A 4JI9A 4ZOLF 3DQWA 3Q9YA 4LOOA 1JOWB 4I5PA 3SW4A 5I0BA 4DITA 3R1YA 4FTRA 3IECA 3R1QA 5DT0A 2FB8A 4EOKA 5LP6F 3LQ5A 2I0YA 2CMWA 3G2FA 4RIYB 3VS2A 3ODYX 3OCTA 5CVGA 3MBLA 5EKOA 5FTGA 2VO7A 2W1FA 4FV8A 2E2BA 5J87A 5IQCA 2QO7A 4FKQA 4ZTHA 1JDBB 2HY81 2YM8A 4XV3A 4MVFA 1J7LA 3TQTA 4C61A 1KOAA 4GUBA 3W2OA 2O64A 3Q32A 3S00A 2OH0E 4KKHA 2RF9A 2R2PA 3BU5A 3NRMA 4DEAA 1BLXA 2YN8A 4RFZA 5FLFA 5JZNA 4DTAA 4I23A 3T3UA 3F3WA 4HGLA 1MP8A 5BVKA 4FGBA 2Z60A 5FXQA 3TACA 1Q8TA 5CENA 4I94A 3QTUA 4WOVA 1G5SA 1UV5A 4FFMA 3PJCA 3TXOA 3Q04A 5LWMA 3O2MA 5H8GA 3JXWA 4X6RA 3TJCA 2PY3A 1WVYA 4FTUA 3VQUA 4NM3A 4ERWA 2AC5A 3AMYA 1P5EA 3FAAA 3W2QA 4BZNA 2PUUA 5BQ0A 4PTCA 5D9HA 3VBXA 4MXCA 5EI8A 1ZMUA 3ZO4A 2QU6A 4XBRA 1F3MC 3JR1A 2W6ZA 4ZJVA 3NZ0A 5EYKA 2QOFA 4DFYA 4G1WA 3JPVA 3C50A 2W0JA 3HDNA 2ZB1A 4APCA 4RC3A 5ANIA 3ZRLA 3NW7A 4YC6A 5D41A 5AP2A 2YS7A 3LAUA 4DLIA 3OUNB 4TL0A 4CMTA 3KULA 2OKRA 4LFIA 3EL8A 2I0EA 1PKDA 3IQ7A 3QQUA 1Z9XA 2XA4A 3PZHA 5C27A 3VQHA 3VOTA 4RWLA 4TW9A 4XP2A 3SOAA 4MXYA 4HCVA 2GHGA 3JUHA 2WHBA 1J7IA 4FKJA 3ROCA 4DGNA 3ZM4A 4ZTRA 2XK4A 4ANMA 1UNGA 2PVRA 3KXNA 4ZSEA 2OJGA 3UMWA 4YB8B 3TNHA 4C35A 3GP0A 4L7SA 4KUJA 2RG6A 2UZVA 2F9GA 2YCQA 2YIRA 1H08A 4QO9A 3V5TA 1M7NA 4C38A 4DGMA 4DN5A 5CAOA 5JFWA 4HNVA 4B0GA 3CKXA 3PY3A 3LJ0A 3K54A 4BCNA 1VJYA 2W6PA 5JQGF 3R9HA 3LLAA 4U3YA 1T45A 4D28A 2EUFB 2X9FA 2XYNA 3BELA 1FINA 4CRSA 1MRVA 2AC3A 1UU8A 1ZZ2A 4J95A 5AUYA 5GIPE 3W1FA 4GK3A 3HAVA 1J3HA 5EQPA 1IASA 2W9FB 3EQBA 3ALNA 3RM6A 5K5XA 4WD5A 1B39A 5HCYA 3ZUTA 5IQHA 4IAAA 3LFSA 2WQEA 3QZIA 2G2IA 3FC2A 5K5NA 4R78A 4FOBA 3OVVA 3OW4A 4XHKB 3KXXA 3PWDA 4UXQA 4CTBA 3QWJA 4FT7A 4ITHA 4J98A 5KE0A 4L43A 4NIFB 5FUTA 2OK1A 4KKGA 3PDTA 4LG4A 5L2SA 5IQBA 1OIQA 2Z7QA 3OC1A 4D5KA 3OUZA 4ASXA 4AZWA 3ENMA 3HMPA 3PLAE 1UWHA 1CQJB 2ESMA 2X7GA 3TUCA 1YHVA 1XWSA 3F3ZA 2YDJA 1PXLA 2Z8CA 2OIQA 3FLSA 4K6ZA 2OLCA 5CI6A 4IX4A 4EOOA 4AUAA 3PJ1A 4AA4A 2DS1A 3NDMA 3OS3A 4BDBA 2ZDTA 3PTGA 2CN5A 3TT0A 5IH6A 4DFZE 3QTSA 4RGJA 4I21A 4AWIA 2YRWA 3E7VA 4MAMA 3LMIA 1YDTE 5F20A 5HVJA 1ZAOA 3MWEA 5AUWA 1M14A 2VNYA 2AUHA 1DI9A 3LCOA 4M13A 2WTJA 4B4LA 3CS9A 5KHWA 4ANQA 3BIZA 2SCUB 2V62A 4A4XA 3IPHA 4MH7A 5AV4A 3MVLA 5CSWA 2GU8A 3BBWA 5CSHA 3UOLA 3C0IA 4MTAA 3L8SA 4EK8A 3OEZA 2UZBA 4OUCA 5EYMA 3QHRA 2C68A 3HDMA 4Y85A 4ACMA 4X7QA 1Q99A 5HLNA 1OBDA 3WARA 3GC0A 4XG2A 3R7UA 1O9UA 3R1NA 3QGWA 4BBMA 4L67A 4AGWA 1U54B 3WYXA 3R04A 4EH8A 2BZJA 5FTOA 4AGCA 4QP2A 5AA9A 5EM7A 3TL8A 4PMPA 3LJ1A 4EBVA 4H58A 4C36A 3FSKA 5EI2A 4A4OA 4K1BA 2DWBA 3GCSA 2VWWA 4E1ZA 4CCBA 4PTEA 1E9HA 1W83A 2REIA 3LCKA 3FZ1A 5CALA 1RE8A 3EIDA 4AN3A 4XG4A 3V4ZA 1EYZA 1U54A 2FA2A 2IZSA 1JSVA 2QR7A 3V5JA 2FO0A 2UW6A 3C4FA 2W5HA 5CEIA 4G5PA 3U9NA 4EHEA 4HVGA 3PXYA 4IACA 5HV6A 3ULZA 1M17A 2UZWE 3F3UA 3Q60A 3O7LB 5HU3A 2C69A 3ETJA 4TUYF 3ZUVA 4U40A 3FKLA 1P14A 2KTYA 4B99A 1SVGA 3JY9A 4Y83A 5BYZA 2FSOX 2UW7A 3MN3A 4J1RA 4UYAA 4XLVA 3F3TA 4DGGA 3EFLA 1CDKA 3OBGA 5E90A 2JIIA 5A14A 4DH8A 5J9ZA 3KN6A 2QONA 5L6WL 3R5FA 4O22A 3FY2A 5JMSA 4TYHB 3CQWA 4J99A 4FE2A 4X2NA 2YITA 3TJDA 4C58A 3LFFA 4DLJA 2W7XA 3PJ8A 2J6MA 4O4JF 4AT5A 4E7WA 5HIDA 5B2LA 4QSHA 1KJQA 3O8PA 2BRMA 4D9TA 2FPIB 3ZU7A 3D5WA 1MQBA 5HVKA 3AT2A 1K3AA 4C4JA 4A9TA 2CGXA 2XNOA 2ERZE 2XJ2A 4B9DA 3H10A 1YOMA 5HD7A 3R9DA 3UQFA 1ZOHA 5J8IA 5GJGA 2J51A 3W16A 1R0PA 1P4FA 1KSWA 4OBOA 4PTGA 2R3IA 1ZRZA 3QD4A 2Q83A 4FKPA 4FTQA 5L2TA 3FEGA 1F0QA 1B6RA 3QLGA 2X4FA 3ZCLA 3U55A 2OIDA 1M2QA 2O65A 1L3RE 3GBZA 5ETAA 3QTZA 3GI3A 3H0YA 4AZEA 3E8EA 1PJKA 4F4PA 2DUVA 5AUUA 1P2AA 1G8AA 4K11A 3RALA 4YURA 4HVHA 3Q5ZA 4DG3E 2OIBA 4EGQA 2BZHB 1YDRE 2OBJA 4BCIA 2C6KA 2ZM4A 4JAJA 3CPCA 1XH6A 4XLIA 1XBAA 4HYHA 4EZ7A 4C2WA 4IZ5A 3LOKA 2J0LA 3IK3A 2R3LA 5AIKA 4YJ3F 4HZRA 4BTKA 1OPLA 2Q0BA 3CQEA 4DEHA 3AC3A 3FMDA 4E4LA 1UKIA 3I0OA 3Q2JA 4FV4A 1WVWA 3QF9A 2IW9A 4RA4A 4B8MA 4TXCA 4MA5A 3GUBA 3AXWA 4QP6A 4S32A 2X9EA 2OZOA 1BI8A 2PUPA 2HELA 3SGCA 4BTFA 4LRJA 3E63A 4EEVA 5IQDA 3FE3A 1ZOEA 2PE1A 4EH9A 4OBQA 1PMEA 4LL5A 3GNIB 5IQFA 1IAJA 4ZSLA 4EKKA 3CTQA 4DG2E 4YAJB 2BDJA 3C5IA 4O0TA 3S95A 3KVXA 4FYNA 4ZP5A 4O0WA 3VUDA 4RWJA 3CTHA 3QD2B 4KBAA 4D58A 4I50F 1Y6BA 3V6RA 4XRLA 1H0WA 1SMHA 4PMMA 4DFLA 4GRBA 3P86A 3LFAA 2UVZA 1H07A 4FV5A 4M7IA 4GIIA 2ZYBA 4FTNA 2VWXA 5A3XA 2V59A 2A27A 3LE6A 4FV9A 4M97A 4PQNA 4RT7A 4FV3A 2PVMA 3Q4UA 4G6OA 4KIOA 2ACXA 3KMWA 4CKRA 3FKNA 3DCVA 5CI7A 2DWCA 4YNOA 1OKZA 5FBNC 5KCVA 2OJIA 1V1KA 2FUMA 4YTHA 4F0FA 4FTCA 5HNGA 1K9AA 1XH5A 4IFGA 5HGIA 4BCMA 2QI8A 5ETIA 1G8SA 2QOLA 4L6QA 3VNTA 3ZRMA 2PMNX 3ORIA 3M1SA 4C7TA 3N4UA 4NKSA 3BBTB 5AX3A 4CFVA 4YJPA 4ZOGA 3C13A 4BTMA 5HKMA 2CN8A 3D7ZA 3NLBA 3OP5A 2XJ1A 4KWPA 2X7FA 5B2MA 3QUDA 4L53A 4LRMA 2JKKA 4RX9A 4BI1A 2FP4B 4QNAA 1AUXA 3ORQA 5M07A 5HESA 2PSQA 1HCKA 4IEBA 3CTJA 3UIBA 4TNBA 5A4TA 4IJ9A 4FTJA 5AV0A 2GTNA 4L46A 4RJ4A 3F5PA 4LGGA 4RLLA 5DA3A 2QURA 4TYJA 3D5XA 5CU2A 2B9HA 3PE2A 4UN0C 1VKZA 3H9OA 4DHFA 2XD4A 3K5IA 3WZUA 2X81A 4FVPA 4L45A 5AUVA 3IOKA 3D7TB 3LCTA 4Z7HA 1GY3A 2VR1A 4GJ2A 3G5DA 3BWJA 4R3CA 4W4VA 3SOCA 5IMXA 4RZWA 1ATPE 4ZY4A 2UZEA 4FT0A 3QC4A 1S9JA 4OR5A 4BCFA 2H9VA 3LFQA 2VO6A 5IQEA 3P78A 3BU6A 1DS5A 4L8MA 1YW2A 3EN7A 4DEEA 2Y6OA 2J0IA 3QKMA 5IQGA 3A7GA 3P9JA 5G1XA 2YDIA 3UDBA 5HBEA 3WF9A 4DYMA 5DGZA 4MQ2A 4XEYA 2HAKA 4XZ3B 1BUHA 4H05A 1QMZA 3D7TA 1YQJA 3A62A 4PL3A 5F95A 4EGJA 4LQMA 5LQFA 1X8BA 5CT0A 3UVPA 3KMUA 4DGLC 5HORA 1H8FA 2C3IB 5EFQA 2W06A 5KX8A 3NX8A 4QMYA 2JDSA 2JAVA 5IUGA 4M3QA 4UALA 4ANBA 3POOA 3MH1A 4J97A 2BVAA 4QYYA 4IVCA 5AX9A 4ZTLA 3TKIA 5E8YA 4RFYA 4EOPA 4FSZA 3TNWA 1DV1A 4OTWA 3HNGA 4EH7A 4BC6A 1O6KA 2JFMA 2VTMA 3LFCA 3BHVA 4FKLA 5E8UA 2W6NA 4WNOA 5DT3A 3WZEA 4KINA 4EHGA 2XEYA 3UO6A 5LXTF 2C0IA 4RQKA 4E4MA 4RIWA 2OF2A 3DKCA 4E26A 3R7YA 5AUXA 4EK5A 5CWZA 4F70A 2VZ6A 3LMGA 4KABA 2C30A 1GNGA 4MV7A 3K2LA 2BR1A 2QCSA 5IUIA 5K4JA 4FC0A 3UO4A 5L2WA 2XNPA 2C6DA 5HNIX 3OT3A 4W8DA 3EQRA 4JXFA 2WQNA 2QKWB 3ZLYA 2VTRA 5K4IA 3ZSIA 4BCOA 5DOSA 4ZTMA 3FI8A 3HMIA 3BYVA 4HQ6A 2ZV7A 2C6LA 4MNEB 4GVAA 3HVCA 4XCUA 4PRJA 2QO9A 3VS7A 2WOUA 2XP2A 2QOHA 4C2VA 2QC6A 4JQ7A 3BQRA 3DAJA 5LMKC 3CEKA 5M57A 3E5AA 1XHAA 1KE9A 2V22A 4IB0A 3V5QA 3C0HA 1Q8ZA 4DINA 3LKMA 2ZV9A 3UIXA 4FMQA 3UG1A 1YVJA 1LUFA 4YJ2F 4H1JA 2XK3A 3BGZA 3ZHPC 3SRVA 2X0SA 5EM6A 3VS4A 2C1BA 5BVNA 3R22A 5LVPA 2FB9A 2BFXA 5ANGA 3O51A 3ZH8A 2W6OA 2FSLX 1A06A 3KA0A 4I5MA 3M11A 4FTTA 5LVMA 2XKEA 3LM5A 4BCKA 4EOLA 4BVUA 2A1AB 2CKQA 2YAKA 4RVLA 4QYFA 4E5WA 2R85A 5DR6A 2PN1A 3DJ6A 3O71A 4I22A 3TV7A 4C37A 2ETMA 2PZPA 4V01A 2W1HA 5HNBA 4FNWA 3KCFA 5EHLA 3FXZA 3UVRA 3DBEA 5IF1A 5L6OA 4BY9E 1V0PA 1XH9A 1RQQA 4LV5A 2VWZA 4JDIA 4Z3VA 2WELA 4CKIA 3TV6A 2EXMA 4BDJA 4F08A 4ORKA 3TN8A 4PUZA 4MEDA 4O27B 4TT7A 3IDPA 5FG8A 4OTQA 5KO1A 1GZKA 2OZAA 4DA5A 2R3HA 1FVRA 2XK9A 4C5AA 5E8WA 4YJNA 4WG3A 2UZOA 2QF7A 2P4IA 3E62A 4E4XA 5DWRA 3D2KA 3CC6A 3VC4A 1LEZA 2JC6A 3OFMA 2BDWA 2CNQA 4YUQA 3VAPA 2BPMA 2GPSA 1WMKA 3DBFA 4S33A 4QNYA 4Y72A 2XCKA 1IRKA 3LFNA 2RFSA 2XRWA 5EYDA 5I9ZA 3GU7A 4IWPA 3FHIA 4QYGA 3L9NA 4FSWA 3R23A 3KRJA 5IYZF 4QMPA 5FEQA 4ANLA 1IA9A 4QMWA 3BEAA 2CDZA 4FEVA 4G16A 4BI2A 4L00A 2NRYA 3EYHA 5IH4A 4O7TA 5C1QB 3BV3A 2Z04A 4F1MA 2W96B 4OTDA 3G0FA 4BCHA 1KE6A 2XF0A 3P4KA 1H24A 2HK5A 2WIHA 1YOLA 4AFJA 4C4GA 3ODZX 2V7OA 4MXXA 1NW1A 2NPQA 3AD4A 3QRTA 4GT5A 3IW4A 4B6LA 4O4HF 2GHLA 1ZYSA 3OY1A 5M44A 5H2UA 4HPTE 3R21A 3PZEA 4DCEA 4IX5A 2VX3A 1EHIA 4LGHA 4EONA 5K9IA 4BBFA 5KHXA 3FYKX 4JIKA 3OHTA 4BDCA 1JDEA 3GU4A 3RAWA 4ZHQF 3COKA 2P55A 3FPMA 2CCHA 5JFVA 4F63A 2OXYA 4BB4A 1TKIA 4U79A 4GJ3A 3V8SA 5A54A 1VR2A 5H3QA 4FT9A 4YSMA 5T68A 1W96A 4FTLA 2BRNA 1PF8A 3CE3A 1C3OA 2B0QA 3O0GA 4R7HA 4EWQA 3ORTA 4QP7A 2YIYA 4JQ8A 2IN6A 3NCZA 3AD6A 5EYCA 2OF4A 1KV2A 3DKFA 2IZRA 3OTUA 3WF5A 2BIKB 2B4SB 4AA5A 4PDSA 1ND4A 4BF2A 3UO5A 4WKQA 3ZM9A 3A4OX 3TTIA 1Z2NX 3FMKA 4ASEA 3MV5A 4G2FA 4O96A 4PDYA 3AGMA 4GFGA 4M14A 4GUEA 3D15A 3LXNA 2UW5A 2R5TA 1U5QA 3R28A 5AV1A 5M4UA 3KREA 3EQDA 4ZSGA 1SNXA 2Y4IC 5HHWA 2WMAA 2JKOA 3KXMA 4YLKA 4EK6A 5KMJA 5CF5A 3GC7A 2X0GA 3UFXB 4PV0A 3CY3A 5CA0F 3BG5A 4EZ3A 5E9EA 2VWVA 3PP1A 4F9BA 4PF4A 3W8LA 4EH5A 3AC4A 2IW6A 4O7SA 4WNMA 3F7ZA 3V3VA 5DFPA 2YHVA 4MCVA 3HECA 3RPSA 2PVJA 4UX9A 2F7EE 1URCA 3VF9A 4LM5A 4O7RA 1ZXEA 2BFYA 3EZVA 2OICA 3G15A 3QAME 4RRVA 4A4LA 3IKAA 3L1SA 4HJOA 4QMTA 4RFMA 3F7WA 3I4BA 4UWYA 4E5BA 3O50A 4OGRA 5CTPA 2YW2A 3HBLA 3QXOA 3DFCB 5HCZA 1OL7A 3QZHA 3N4VA 4G6LA 2OI4X 3FMJA 4OLIA 2ZM1A 3C4WA 3E8CA 4NWMA 5DN3A 5J2UF 4C62A 3CR0A 2UZTA 1OECA 4NH1A 4BDGA 4ZMFA 1MRUA 2XEZA 2RFNA 3HA8A 2X1NA 5CEKA 3W2RA 1M0TA 4UBAA 4L68A 4I92A 2BRBA 4EQCA 2EWAA 4AG8A 2WMQA 3E88A 3NUAA 4OW8A 3W10A 4DGOA 2CLXA 2VN9A 3QTRA 3FZPA 4AS0A 1OGUA 4FG8A 4NSTA 2B53A 2J2IB 4U43A 2JAMA 4EHZA 3WNZA 5IG1A 2XB7A 4TRLA 4JBOA 3BHUA 3QA8A 3QGYA 3E87A 1UKHA 2O63A 2BAJA 2RL5A 2O8YA 5H80A 3PVBA 4FZ6A 3NYOA 4X2KA 2V7AA 4IH8A 4XX9A 3P7AA 3LQ3A 4RA5A 5EOBA 1F5QA 3KF4A 3HMOA 3L9PA 5BMMA 3ETAA 1ZYCA 2UUEA 4DTBA 4QMVA 2JGZA 2ZDUA 2ZOQA 1KE8A 2W71A 3UZPA 5IDPA 4FKIA 3HV5A 2QD9A 2C0OA 4HVDA 4FOCA 4BCGA 3I7BA 5FNVF 1S9IA 5IEYA 1IEPA 3L8VA 4HZSA 1PYXA 4FKGA 4G5JA 4J8NA 4ZTNA 5DHJA 4C0TA 1V0BA 4JBVA 5CEPA 2CKEA 5I9VA 4O86A 1WR2A 3MY1A 4GKIA 2W6MA 3R5XA 3H9RA 3VS1A 2HYYA 2WOTA 3FZOA 4KIPA 3OUKA 5HE3A 3PXFA 4YTIA 2WMVA 3MA6A 4KNBA 3G8DA 1BYGA 2VV9A 3VIDA 4L3LA 4JX7A 3HA6A 3NIEA 3RNIA 4YR8A 3N4TA 4IZAA 2OLSA 3D5UA 3GCPA 1M52A 4XRJA 1DI8A 1H26A 2PZIA 2ETRA 5E91A 5F94A 3RWPA 3SQQA 4FK6A 2B52A 5EDQA 4U42A 3OW3A 4IB1A 2QOIA 3HUCA 2XJ0A 2YIQA 3MVMA 1NVRA 3O23A 4PDPA 3ZFXA 2C00A 3P1AA 2UZNA 5I9YA 1DAYA 3D4QA 3PJ2A 3QRJA 4IZYA 4V0GA 4ACCA 5DI1A 3RMFA 4OTIA 3K3JA 4ZAUA 3KMMA 3KN5A 4WNPA 3LCSA 4JDJA 2VO3A 1J1BA 3OT8A 2PVHA 4FEUA 2I40A 4FODA 4OTGA 3RPVA 3DKGA 5CT7A 4FI1A 3D9VA 1XBBA 5AM7A 1E4EB 2C5XA 3LLTA 2Y8OA 1CM8A 3PLSA 4O2BF 4FKSA 3ERKA 3ORRA 1FVVA 3QFFA 3ZONA 3EOCA 3I6WA 4TTHB 4IANA 4MNFA 5AP4A 4CNHA 4G3GA 1IA8A 4YJTA 1Q4LA 2NU8B 3FMNA 4CT1A 4L3PA 4HW7A 4IVDA 4A07A 5IDNA 3JZFA 3MH2A 3KULB 4XV2A 1FBNA 1E4EA 2WMUA 4XNEA 4USDA 2IO6A 4E6CA 5KKNB 3BPRA 4R3PA 3DBDA 4CD0A 2R0IA 3GCQA 2QLQA 3QRIA 4P90A 3R8MA 4D4SA 5CSPA 4TWPA 2YABA 4Y5QA 4AW1A 1KJJA 3P23A 4JRVA 4EH3A 1OIRA 4PMSA 2XBJA 3R8VA 4ENYA 5BNJA 3BEGA 3TEIA 2W17A 5CAEB 5JT2A 3Q1KA 2W4KA 5EG3A 4ASDA 1WFCA 3DGKA 4EKLA 4HYSA 3BLHA 3FZSA 3UOHA 4CG9A 1YXXA 1QPDA 4YAKB 2O5KA 3HKOA 3HAMA 3MY0A 4R7IA 5LVLA 4BZOA 1BNCA 1KEEA 2OXDA 4PL5A 4O2PA 3MSSA 4IQ6A 5CNNA 3GIDA 3LWBA 4YJVA 4FUXA 4NL0A 3TIGA 4WHZA 5CXHA 2RKUA 3E93A 4IX3A 4MBIA 2ZVAA 4NCTC 5FDXA 5CVFA 2GNHA 2J0JA 3MFSA 2UV2A 3WF6A 4BN1A 4K2RA 5HEZA 3UIMA 1M6VA 4WRSA 3RHKA 4M68A 3TUDA 5ANDA 4RIXB 5JN2A 4C34A 2ZDHA 1KJ8A 1U5RA 3EJ1A 3CY2A 2WQMA 2BTRA 5T3QA 2QHNA 4YP8A 2LAVA 1CE8A 3CXWA 4DAWA 4IHPA 1XO2B 1PXOA 4P7EA 3JRWA 2WQOA 4DH7A 1GIIA 3Q4CA 5F4NA 3QFVA 2VTOA 1Q62A 2NNWB 5EHYA 3GC8A 2PZYA 3PIXA 4BDFA 4FZFB 3QUEA 4UWBA 5D1JA 3ANRA 2GSFA 4FTMA 1LPUA 4QQCA 4RIXA 1YXVA 3KXGA 1JLUE 5JGBA 3SXRA 2HXQA 4K77A 3QBNA 3POZA 2XK8A 3C4XA 3RFCA 3GLKA 2W1DA 4JL9A 1T46A 3DXNA 5JSMA 2BZKB 3ACJA 3K3PA 4FTAA 4HNFA 2ITUA 3R0TA 3RAHA 4I5CA 3AT3A 4AGDA 4F6WA 2JBOA 4DFXE 4WSYA 3FWQA 4FGRA 4IWOA 5EW8A 2GS7A 3QKKA 3Q96A 4R1YA 4GU6A 2XNGA 1O6LA 3DDPA 4PWNA 4DTKA 3MIYA 4U9AA 3IW7A 3PXZA 5DRDA 2IPXA 5DIAA 2NP8A 1YKRA 3GU8A 5D7VA 5ACKA 5LA6F 3VUIA 4I0RA 4LI5A 3ZFMA 4RWIA 4ZTSA 5IPJA 3RAIA 3DK6A 3OUUA 4ZZMA 4JVGA 2W1GA 3EWHA 1RDQE 2OO8X 3OWJA 2C3LA 2QOCA 2YJSA 5FXRA 3ANQA 5GINE 5L8JA 3FL5A 4FFNA 4YMJA 3LP8A 5BPFA 3DU8A 4C02A 4BDHA 4BCJA 5HO7A 1OITA 1Q61A 5JRSA 4JT3A 3MDYA 2O3PA 4TV8F 5BUJA 4PDOA 3EKNA 3IS5A 4RLKA 3FUPA 4FNZA 1NA7A 4WRGA 3QWKA 4FZDB 4GKHA 4U6RA 3U6IA 4O7YA 2P0CA 3I1AA 3QKLA 5BVEA 4BBEA 5BUEA 3V5LA 3EN9A 3VW8A 3NUSA 3F2RA 2PVNA 3NNXA 5JZJA 3MB6A 4AOJA 4JG8A 2Z2WA 3DAKA 3U9CA 5B2KA 5KBRA 2NUAB 2WEIA 5AUZA 4C4FA 3RJCA 4YZ9A 4N6ZA 3QYWA 4PMTA 4QMSA 2F2CB 5ANOA 3PWYA 4FFRA 3AC1A 4RZVA 3GEQA 4E5AX 5ICPA 5GHVA 5ANKA 2HXLA 1QPEA 4ZY6A 5HI2A 2GFCA 2PUIA 4RJ6A 5D7AA 3AMBA 2YIXA 4EK3A 3MH0A 3NUPA 4F6UA 4LV8A 4L1KA 4AA0A 2YYAA 4TV9F 5DEWA 4ZTQA 3F9NA 5C4KA 2ZB0A 4B8LA 4FG9A 1TQIA 3HRFA 4MF1A 4F9YA 3ORKA 1PRYA 3G0EA 2E9UA 4FV7A 4XBUA 1BI7A 3TKHA 2J50A 3AC5A 3TZMA 5EKNA 1ZMVA 3SA0A 1NVQA 3P5KA 2RIOA 4RX5A 3PY0A 1YI3A 4AGUA 4QMUA 3F88A 5E8ZA 2B9JA 4B7TA 4ALWA 5IH5A 4XYFA 1JLLB 2B9FA 3TV4A 2ETKA 4X3JA 3FDNA 5ACBC 5HIBA 3WI6A 3C51A 2WB8A 3E3BX 5M53A 1ZARA 3TI1A 4FTKA 4M84A 1OZ1A 3II5A 4LMNA 3WO0A 2OFVA 3F6XA 1YDSE 2YM7A 4LYNA 4DBXA 5C8NA 2QOOA 1TQPA 3Q3BA 4FX3A 2B54A 4U44A 2CSNA 4JIAA 4OBPA 3VS0A 4GFMA 3C4EA 3CQUA 4YHJA 5IA2A 4GCJA 5C26A 1UU7A 3COHA 5IEVA 1J1CA 1H01A 2C4GA 4RBLA 1STCE 2WMTA 3SXSA 2O0UA 4FSYA 2BRGA 4YC3A 3SKCA 5HX6A 3UPZA 1MUOA 3JS2A 3FMLA 3DPKA 4ZK5A 4XS2A 3VRYA 3RV3A 5JQ8A 4L01A 4O4IF 3TG1A 4CCUA 1KC7A 4YZNA 2R86A 2QOKA 2GHMA 3LCDA 4EL9A 1OBGA 4DT9A 2W1ZA 4GV1A 3UYSA 4YTCA 5KUPA 1JPAA 3ORMA 3QYZA 4FKVA 4XX0B 4JS8A 4GG7A 4Y46A 3DA6A 3OXZA 5HTBA 3BHHA 3UE4A 3VW6A 3ZEPA 2XM8A 3EQGA 3PSCA 2I6LA 3DBCA 4I1ZA 2HENA 5CAPA 3CKWA 3FLQA 4WUNA 5DNRA 3W2PA 3VUMA 4CVAA 4E6AA 3R5HA 3PVWA 4EJ7A 4TYGA 1AD5A 3ET7A 3MVJA 3ATTA 1LEWA 2YACA 2X8EA 5HVYA 3MGYA 3OCSA 3NS9A 4O6LA 5IA5A 3R02A 3Q6UA 3V8WA 5FEDA 4ERKA 5IA1A 3UNKA 2I1MA 4QYEA 4TYIA 3OG7A 4D4VA 4PY1A 1OL6A 3BKBA 4XV1A 4QP3A 3NAXA 2JDTA 4HVIA 5HLWA 2C6EA 2X2LA 3QRUA 3FLNC 2G15A 3T3VA 4H36A 2X8DA 3WZJA 4D55A 1PK8A 5KZIA 5KNJA 4F9AA 1WBSA 1ERKA 4IWDA 1YHSA 3MIAA 4O84A 4GYIA 4JRNA 5B0XA 5AUTA 3SVVA 3VPCA 2YRXA 3VMMA 3EFWA 3FLYA 4IADA 4O0VA 4Q9SA 4EWHA 3ACKA 1APME 2EVAA 1FGKA 4GYGA 3FC1X 1T36A 5HBRB 1AGWA 3FL4A 2VUWA 3OEFX 1P4OA 4ARKA 3OROA 4J7BA 4NKAA 2BROA 3R9NA 3JYAA 3PSDA 4MV1A 3VPBA 3DTWA 3TIZA 3OF0A 4LL0A 1NVSA 2GQGA 4QTEA 3DLZA 2PVLA 3CGOA 4I20A 1Y57A 5FRIA 4BDEA 5M4IA 1GLVA 1PXNA 2OH4A 4C4HA 4WIHA 3ZMMA 3NR9A 3KKVA 1XBCA 2UZLA 2XNMA 3GFWA 4YC8A 3TDVA 2ZDGA 3RI1A 1A9XA 3ZYAA 4ZSJA 1XJDA 1OKVA 2E9OA 4FL1A 2QHMA 3M2WA 5FP6A 3RK5A 1JAMA 4DFUA 3D94A 4G3FA 4AOTA 4EUUA 4HNUA 2VWBA 3JVSA 4IM3A 3ATSA 4O7WA 1SNUA 2IVUA 4EH4A 4QTCA 5LMKA 4AQCA 4DF3A 4O21A 4WA9A 3F66A 4IIJF 4CEGA 3PG3A 2RGPA 4F6SA 2C5OA 5BX0A 2YCRA 2OW3A 2OXXA 3RPRA 2PYWA 1SVHA 1BMKA 1V0OA 4EQMA 5JGAA 2R87A 1WBVA 4HGEA 4LMUA 2EB3A 2ITQA 1EUDB 5AMNA 4KS7A 2G01A 3VBVA 3UOKA 2YZNA 4KAOA 3T9TA 5LJJA 2DLNA 3BYSA 4I4EA 3D5VA 3DB6A 4QPAA 4TNDA 5IQIA 2PU8A 5CB4F 5EI6A 1RW8A 2YDKA 5IA4A 4K33A 5L2IA 3HGKA 4JNWA 4X3FC 3I12A 3IDBA 4M0YA 2GNJA 5JFSA 3D14A 5C8KA 1ZMWA 5LWNA 3AX6A 4IAZA 4NM7A 4RIWB 3EZRA 3PE1A 2C0TA 3I5ZA 3MB7A 4FVRA 2QR8A 5E8VA 4U8ZA 4YHFA 3KU2A 4U7ZA 3QCQA 3NNVA 4JR7A 4Q2AA 3B8RA 3NPCA 1J7UA 4O0XA 1Q24A 4NJ3A 1G3NA 3OOMA 4BGGA 5AAEA 3IO7A 3R8PA 4ACGA 4UWCA 2WAJA 3G6GA 4IDVA 4UZHA 3FHRA 3QLFA 2XS0A 2OG8A 2VTSA 3Q5IA 3RGFA 3PIZA 2WXVA 2B9IA 4JR3A 5CZIA 3FV8A 3TNIA 4J71A 5TO8A 4CRLA 3VO3A 5J5SA 4LOQA 3WYYA 3IGOA 3A99A 1BKXA 5AIRA 1CS0A 1NY3A 4JX3A 3SRVB 2BUJA 4CG8A 4MXAA 1GAGA 3W18A 2WFYA 3GOPA 1SZMA 4EK4A 1W98A 3MJFA 3C4CA 2YZGA 1UWJA 2H8HA 1PXKA 2CGUA 4ID7A 4XMOA 4CTCA 5C4LA 4EG0A 1TVOA 4ZZNA 4O0SA 4MV3A 3FYJX 4NTSA 2VX1A 4I41A 3NIZA 3WE8A 1GSAA 3NCGA 3MW1A 4CGAA 2XK6A 4HVSA 1GZ8A 3FKOA 1H1WA 5FXSA 2H6DA 3W32A 2UVYA 4AU8A 4YBZB 1GIHA 1RJBA 3S0OA 1URWA 1CQIB 3OOGA 3ZBFA 2PHKA 4S2ZA 4NM0A 3N8DA 4U97A 3ZUUA 3PPKA 4L9IA 3K5HA 3EQFA 2ITTA 3LFBA 1FPUA 1OUKA 3O96A 4DEBA 1Q8WA 2UVXA 4AT4A 3IGGA 3WOWA 3MFUA 2F2UA 3P0MA 2ITWA 4A9SA 4ZZOA 5BPHA 3DXQA 3ZS5A 2QG7A 4FBXA 5FD2A 2G9XA 2OZAB 4FIIA 2PZRA 3UGCA 3P08A 1MQ4A 4IZ7A 5AADA 4EYJA 4PL4A 4NM5A 3GC9A 3OWPA 4DH1A 5JK3A 2J5EA 2R3KA 3FJQE 4YZCA 2OJ9A 3A7FA 3HX4A 4XV9A 1UNHA 2GCDA 3UC4A 4ZQIA 4P2KA 3G90X 1XQZA 2P0AA 3KRLA 2Z7LA 3PUPA 4MBLA 1PMNA 2Y4IB 3RINA 4F99A 3TNPC 2IZUA 2UZDA 4KB8A 3EB0A 3RPYA 1UA2A 2PUNA 4HNIA 2IJMA 3DK3A 3WBLA 4CLJA 5C9CA 1WVXA 3F2NA 1Z5MA 4E6DA 3AQVA 3BHTA 1BL6A 3NAYA 3KEXA 3E92A 5BVDA 1EH4A 4BCQA 5J9LA 2J9GA 3R63A 3TNQB 3UPXA 4AZFA 5I5ZA 3G8CA 5LCJA 4C3FA 4ITJA 5M06A 3UYTA 2DIKA 1R1WA 3VBWA 4IWQA 4RG0A 4IAIA 4BRXA 4ZMEA 3TCPA 5KMOA 1J91A 5E1SA 1QPJA 1B6CB 2BKKA 3HRCA 4O6EA 4RVKA 3VWAA 4IHJF 5LOVF 1JKLA 2C6MA 2FSMX 4R5YA 4DG0E 1E1VA 3FQSA 4EHVA 3I60A 2V5QA 3BRBA 3KXZA 3QQFA 5L6PA 2W70A 4GIHA 1U4DA 4MV4A 1REKA 4JDKA 4F0IA 3RKBA 4JG7A 3VRZA 1Q3WA 3BQCA 4M15A 4ZSAA 3QQLA 2FPPB 4RPVA 3ZC6A 2YISA 1EUCB 5DG5A 4MYGA 1ZYDA 4S30A 3AC8A 1B38A 2ERKA 3PA4A 5H8BA 1WBPA 5C1OA 2WU7A 3Q53A 3L9MA 4J96A 4ZIMA 4CKJA 5D10A 4C5BA 3NNUA 2R3PA 4YPDA 4FTIA 3EN6A 3OTVA 3CD3A 4C3RA 4XG3A 3VS6A 4EOSA 5FM2A 5CANA 2EXCX 4TYEA 5FP5A 1CKIA 4EC8A 3UC3A 4MD8E 3ZLXA 5IA3A 3UQGA 4HPUE 2OWBA 2PWLA 4MX9A 1LR4A 4R6VA 5LXMA 2OJFE 2WQBA 3ORPA 2JD5A 5KKRC 4O83A 5AA8A 4BGHA 2BMCA 4BYIA 3WIGA 2R7BA 2RFEA 3FI3A 2BAQA 2QU5A 5T6KA 5E8TA 2XCLA 4K9YA 1Q3DA 2VTPA 5JQ5A 4F7LA 5EHOA 2W9ZB 2WNTA 4DEGA 1CSNA 2QLUA 2R7IA 2C6IA 2XRUA 4FIEA 1W84A 3QCYA 2WMBA 2QOBA 4FL2A 2YJRA 4KRCA 3BWFA 2IVTA 4MV8A 4NZWB 3ZRKA 2DQ7X 4CZUA 4EBWA 4DEDA 5HIEA 2PE0A 4H3QA 2GPWA 3IDCA 3OWLA 1PW2A 4YO6A 5DPVA 4JBPA 5BUIA 3OWKA 3EFJA 2Y0AA 2F49A 4KD1A 1SM2A 3MYGA 3UP2A 4BIEA 4DT8A 5M08A 2BALA 2DYLA 5J95A 4CSVA 2CGVA 3D0EA 3H3CA 3R7OA 5JGDA 2Z02A 2WPAA 2WZJA 4IAKA 4XOYA 5CSVA 2DZDA 4FU0A 3ZLSA 2A19B 5HTCA 1KE7A 3CCNA 2VTAA 4WBOA 4QQTA 4L42A 3PXRA 3GCUA 3C7QA 3DS6A 3LXKA 3F3VA 4F9CA 1PXIA 2W5BA 3WIKA 4AP7A 1OI9A 5BVOA 3LJ2A 2P3GX 2WTKC 3R7VA 5IISA 3HP2A 2PPQA 3OXTA 4RSSA 3ZXTA 5AJQA 4XOZA 1YXSA 4FKUA 1OL2A 4QTBA 5AP1A 1KV1A 4JBQA 4AT3A 4YO4A 4DLKA 4V05A 3G51A 3HEGA 3VUKA 2QODA 3PA3A 3Q4TA 2XH5A 4D1ZA 2PL0A 3BCEA 4XG7A 4IIRA 3VS5A 3NWWA 1R78A 1GSOA 5GJDA 4YGAA 3R01A 2GQSA 3N6RA 1KJIA 1Q8UA 4FEXA 2QKRA 4FYOA 3TW6A 2CHLA 4IM2A 1BX6A 4KRDA 2YWVA 4RJ8A 2WTDA 4IFCA 4WBBB 3JVRA 3COIA 3H30A 1JVPP 3R00A 4R7BA 2F7XE 2E9NA 2R64A 4MXOA 1JKTA 3F82A 3QALE 2IVVA 4L52A 3IW8A 1Y8GA 3PXKA 5CEMA 1VEBA 4L44A 1SYKA 4G9CA 3ZTXA 4DCAA 2GDOA 2XIKA 2VAGA 3N51A 3IG7A 4ZLOA 2OFUA 3QQHA 2ZMCA 4RVMA 4FZAB 4U45A 5CF6A 5M51A 2GS2A 2V55A 3NVKI 1I7NA 4AE9A 1OM1A 4QP8A 5C8MA 3KQ7A 3QX4A 3DNDA 4O0RA 2G1TA 2I8CA 4A06A 5LMAA 2HWOA 1HCLA 3PXQA 3MFTA 4GW8A 4NJDA 3SE7A 3COMA 4UEUA 2HY0A 5CLPA 3C0GA 4FSNA 2AYPA 5HBJA 3PP0A 4FEQA 4FSMA 4YJUA 3IOPA 2NRUA 4PNIA 4D9UA 5J9YA 1REJA 3FLZA 4CMOA 3AC2A 1OPKA 3GXLA 4L7FA 3ORLA 4IDTA 2R7LA 3P7BA 4NFNA 4ONAA 2C3JA 5EZYF 4O91A 3CPBA 4ASZA 3FQEA 3C5UA 4RVTA 5CEOA 5GIOE 2H34A 3D2IA 2CLQA 2LGCA 4CXAA 4GG5A 4V0GB 2JIUA 4ITIA 3HV4A 3DDQA 4RQVA 3Q2OA 2EB2A 2E9PA 2A2AA 3F5XA 3UG2A 3BYUA 3CJFA 4NCTA 2BZIB 2PVYA 3FLWA 3KVWA 3EH9A 2IWIA 3OZ6A 4IE9A 4Y73A 4AF3A 3F61A 2CNUA 3O17A 3UQCA 4IC8A 2XM9A 4DEIA 3ENHA 3DF7A 1U59A 4IM0A 3MPAA 4GH2A 3V5PA 3KXHA 4QPSA 3UIUA 4CT2A 3B2TA 1H00A 2I7QA 1OL5A 4DE4A 1H28A 4JAIA 4W4XA 2HGSA 3UZRA 1EZ1A 1M0WA 5DR9A 3DOGA 2A0CX 3GOKA 1JQHA 5HU9A 5IEXA 1A9UA 3JZIA 1I44A 5JVLA 3BZ3A 2R0UA 4U5JA 5H9BA 3R8UA 4DH3A 1VBGA 3SHEA 1FVTA 5A4CA 3BHYA 5D12A 5AAFA 3VVHA 1FMKA 4F7NA 3UMXA 4WT6A 1YWNA 2GFSA 5CQUA 4D0WA 4G9RA 1PY5A 4IAFA 4K0YA 3HUBA 4U41A 5FBOA 1ZZLA 4JQEA 3UVQA 4QTDA 3MY5A 3A2CA 3I0QA 4TZRA 4BDKA 3I6UA 5G6VA 5DBXA 4O7LA 3F2AA 3QTIA 2ITPA 4G31A 3RCJA 1H25A 1KJ9A 3ZSGA 1QL6A 4RIYA 2Q0NA 3NYNA 3DT1A 4UZDA 3W55A 4U0IA 4HYIA 2W1IA 4P5ZA 5J1WA 4II5A 3DZOA 3FQHA 4Z7GA 1OKYA 3QZFA 1Y6AA 2W5AA 3FMEA 5AEPA 4E8AA 4EORA 4F1TA 3V5WA 4IZOA 3V01A 2EU9A 4NTTA 5C1PA 1ZWSA 3O8TA 3SG8A 5KMMA 2YA9A 5HX8A 3OXIA 3H9FA 4LUDA 3PPJA 2R7KA 4QMOA 2HZ0A 2XIXA 3K5VA 4O4LF 5HD4A 5J1VA 3BYOA 2XMYA 4ZLZA 5FDPA 3KALA 4F7SA 2KULA 3QQGA 1YXUA 1PXPA 3OY3A 4TKSA 3RK9A 3R8ZA 1IOWA 5CA1F 2Y9QA 2XYUA 4IVAA 4F09A 4E4NA 2VD5A 3QCSA 4TWNA 5A46A 3FSFA 3AGLA 4YHTA 5CXZA 5AM6A 5GNKA 4X2JA 4MV9A 4GT4A 5BYYA 4FK3A 3KRXA 5CX9A 5C8YF 4MA0A 2E9VA 1YOJA 4IX6A 4MV6A 2XKFA 2R3NA 3HMNA 2GNLA 2C5YA 3UBDA 5ANEA 3KRRA 3P79A 5FM3A 3PVUA 3OD6X 2ITZA 5EW9A 4KA3A 2JDRA 4O81A 2JKQA 2VX0A 4FEWA 3W2SA 3TDWA 2OJJA 3CBLA 3LZBA 3Q9XA 4C4EA 2WMSA 4QMLA 3W2CA 3VUGA 4GK2A 3T9IA 3EYGA 3QUPA 4R1VA 1ZY4A 3LQ8A 2YCSA 1PX2A 1OUYA 3Q2MA 3PRIA 2IZTA 4N57A 4M12A 5HE2A 2IP4A 3QRKA 1H1RA 2BTSA 5AP3A 4WO5A 4CMUA 4NW5A 3KCKA 4WG5A 2WIPA 3S3IA 4AACA 4ZY5A 4XP3A 3TTJA 2G2HA 3A7IA 5M55A 3O8UA 3QTXA 4ZJIA 2SRCA 5J7HA 4E6QA 4XYLB 4IVBA 1OB3A 3ORNA 3FI2A 3KB7A 4PX6A 4TPTA 3N9XA 2YWPA 4AW0A 2HJWA 2X2KA 3VJNA 2I87A 2Y6MA 3V8TA 3CP9A 2QNJA 5A9UA 4P4CA 5AP7A 1GZOA 4M0ZA 3BX5A 4I6FA 3LMHA 1YWRA 3UODA 1O6YA 4XUFA 1XKKA 1K2PA 3R8LA 2VQDA 3BI6A 4BYJA 3PYYA 3U6JA 4OTHA 1YWVA 3RCDA
chains in the Genus database with same CATH superfamily
1KUTA 5DLSA 1GIJA 2GQRA 5HICA 1CKJA 2UW3A 5I5SA 2W4OA 4BIDA 5E8SA 3A7HA 4UY9A 1TFFA 4MD9E 5E4HA 3MVHA 2XK7A 2ITNA 4GT3A 4QQ5A 3NUXA 4QMMA 1WAKA 2XIYA 2XKDA 3SX9A 2W05A 3TM0A 2GNFA 5TKDA 3RTPA 4BHNA 3GDEA 3QL8A 4GL9A 4I4FA 3DXPA 3MJ2A 1DV2A 4UXLA 2QO2A 3FPQA 2YIWA 5FTQA 5AAGA 3DTGA 3DK7A 5E8XA 3DJ7A 3EKKA 3NGAA 2J4ZA 3QXPA 3ROYA 4ALVA 5BWXA 3JY0A 3GCVA 3OCGA 4D0XA 3MWUA 2YEXA 2FSTX 3FY0A 3NUYA 4A9RA 3WZDA 4YJOA 4JG6A 5CASA 3LXLA 3EN5A 5HQ0A 4K18A 3SAYA 2Y7JA 2XIZA 4FV2A 4W8EA 3VUHA 3CJGA 4EH6A 4F65A 1Q41A 4AW2A 3Q52A 3CGFA 4D1SA 3DJ5A 4R3RA 3VNNA 3UNZA 2QG5A 2ABJA 2JDVA 4EOQA 2R3RA 2VWUA 4G3DA 4I93A 5DH3A 5TT7A 4QP1A 3ML1A 3KC3A 4BJJB 3QU0A 4MAOA 4X6QC 3I81A 4HGSA 2R84A 5CAVA 3R30A 4FV6A 2VRXA 4MD7E 1C30A 5A4QA 3EQCA 3QTQA 4Q5EA 1WBOA 3K5UA 1Y91A 5AP5A 5M4CA 3TIYA 1B6SA 4AZVA 4GS6A 3B2WA 2FYSA 5AFVA 3KF7A 5C01A 3BGQA 3UOJA 2OU7A 2WMRA 4N6YA 3UDZA 4CFFA 4FNYA 2XCHA 4YNEA 5JH6A 1IAHA 3GVUA 4BJJA 3HV6A 3UZTA 1OL1A 1QPCA 2J7TA 4FT5A 3AD5A 5JFXA 1I7LA 3QD3A 1PYEA 4S31A 3HO8A 3GENA 4S34A 5EW3A 2HOGA 3EHAA 2ZMDA 2CJMA 1GOLA 3ZXZA 1E1XA 2WO6A 5IZFA 2WKMA 3P5JC 4J8MA 3EMGA 4O0UA 5KZ0A 2V5AA 2FGIA 4I3ZA 4IB3A 2YS6A 1M7QA 5AP0A 4DH5A 2HIVA 5F9EA 3DKOA 4I6QA 1JWHA 2XKCA 1MRYA 4JOAA 4X21A 1XK5A 3IW6A 4FL3A 4IAYA 5CSXA 2PULA 4HGTA 3R9OA 5D11A 3E8NA 2FPGB 5KX5F 4QQJA 1Q97A 4EYMA 5JH7F 1DM2A 2ZJWA 4I6HA 3KK9A 4TYHA 4APPA 1IOVA 3RHXA 5KMLA 1KTAA 4XG6A 2I80A 2Y4PA 5I9WA 2UW4A 2ITYA 4LOPA 4IJPA 2GS6A 3VJOA 4AW5A 4FKRA 5IMEA 3NBYB 3NW6A 4FG7A 4Q4DA 3E5NA 4AX8A 5CVHA 5LCKA 4LV7A 4UB7A 4BDIA 2XAOA 4ENXA 1Z2PX 2V0DA 4D4YA 3DFAA 5TOZA 3WF7A 4FFLA 4O2AF 3UDTA 4BCPA 3BV2A 3GB2A 3QD0A 3QHWA 4RWKA 5HO8A 2J5FA 2R3QA 1W7HA 4NU1A 3PJ3A 4X3FB 4RJ3A 5ETFA 2YM3A 5KMKA 1ULZA 4CQEA 5IQAA 4EFBA 4W4WA 2X6DA 4E4TA 2HIWA 5J2TF 5DT4A 4E93A 2ZAZA 1M2PA 2ZV2A 5DR2A 4KBCA 3RM7A 3ZSHA 5BVWA 3ITZA 3PG1A 4TWOA 2JLDA 4G3EA 4RX8A 3WWJA 5KS8A 4YZDA 1NXKA 5EQEA 5CEQA 4X3FA 2IG7A 4BICA 1GJOA 2J0KA 3A4PA 4G34A 3SV0A 5AWMA 5CNOA 4DFBA 4ME6A 1KWPA 4XG8A 3H0ZA 1PXMA 4CFMA 3WO1A 4EOJA 1JNKA 2VTIA 3C1XA 4USFA 2PVKA 4F1OA 3FMMA 4IBMA 4H39A 4UV0A 5BVFA 4GSBA 3C9WA 4EOIA 5L8LA 2PTKA 2WEVA 2JBPA 4FR4A 2WTCA 5LMBA 1SCUB 3WE4A 2IW8A 3ID6C 4BTJA 4EQUA 5BMVF 1AQ1A 3TZ9A 2YAAA 1PMVA 3A8XA 1ST4A 2X4ZA 2PE2A 4WG4A 3LHJA 2VGPA 4OTFA 1L8TA 3U87A 2F57A 3ULIA 5L3AA 2Q7DA 3A60A 3MTFA 4YU2A 2DAAA 1VYWA 3EFKA 4G6NA 4BDAA 4AXAA 4PP7A 1W82A 3VBYA 3AMAA 3FXXA 3EQHA 3W0OA 5EK7A 3REPA 1HOWA 2WYOA 1H4LA 3O7LD 4CZTA 5L8KA 1R39A 4R77A 4EOMA 3W8QA 3UJGA 4HOKA 4EC9A 4HCUA 3LXPA 4H1MA 4F9WA 4QMZA 2WTIA 3SDJA 3U8WA 3S24A 5K3YA 3EQIA 5C03A 3OMVA 1Y8YA 3TIIA 3R6XA 3F5GA 2ITVA 5FR9A 5I5TA 5FGKA 2F4JA 4IW0A 5EM5A 3BE9A 3ZO2A 3A61A 3W0RA 2AEGA 2HW6A 4C33A 2R82A 5JKGA 4XYMB 2XNBA 2GMXA 5TF9A 2W4JA 5BPYA 5CU0A 3HL7A 4O7ZA 2VUGA 3RV4A 2BHHA 4O2ZA 3S4QA 4MK0A 5D8DA 2PVFA 1CKPA 3NUNA 2XUUA 2ZM3A 1VBHA 2HZIA 1U46A 3H4JA 4RJ7A 2R3MA 4FA2A 3ZC5A 1UU9A 5FQDC 2A4LA 4YLJA 5HNEA 3TZ8A 3GT8A 4ZLYA 3QZGA 1BL7A 2NU6B 1JKSA 4M0JA 2YFXA 3R83A 3PVGA 2HZNA 4O7NA 3TKUA 3RTXA 4G17A 4DHJA 3QQMA 3ORZA 4O38A 4PNKA 3VULA 3U6HA 4NT4A 4AN9A 3BYMA 4EZ5A 2VO0A 1YXTA 5A4LA 2ONLA 1UNLA 3KY2A 4LRKA 1I1LA 4MQ1A 4WBNF 4KSPA 3VHKA 2PMOX 3HRBA 4O7VA 3NMUF 4MBJA 4KS8A 3RZBA 5IA0A 4QTAA 2GNIA 3QQKA 4QMQA 4EJNA 2C5NA 4AZSA 3Q9ZA 3QTWA 2VNWA 3DZQA 5DYJA 3JRXA 2JDOA 1DAWA 3KAJA 3CSVA 3GQIA 3GQLA 3GFEA 4YLLA 1JSUA 5CU4A 3GU5A 3VHEA 2V58A 5CZHA 3VBTA 3KFAA 4JDHA 3VF8A 4QP9A 4K8AA 1DIKA 3UNJA 1PMUA 4H3PA 4FKOA 4EFEA 1H0VA 3DNEA 3F69A 1VZOA 4W4YA 2YM6A 3ZDUA 4UCOA 4KIQA 3E64A 4RMZA 5KBQA 5LARA 1WBTA 4ZEGA 4AZTA 4EUTA 2W6QA 3E7OA 4FFPA 5HG9A 3W0NA 3S1HA 3MPTA 2YZMA 3D83A 4A9UA 1YI6A 5HBHA 1M2RA 3SD0A 5ANJA 3TZ7A 1GGOA 5DGIA 2BIYA 2X2MA 4AFEA 2ITXA 5IUHA 2J90A 2CKOA 2GLTA 5EDRA 3RWQA 2UZUE 2VU3A 3PIYA 5TR6A 3V04A 4I24A 4I5HA 4IB5A 4J52A 5JQWA 4UCRA 5EOLA 5A6OA 3QA0A 1BXRA 3LFEA 5M56A 2CGWA 4M9UA 4YZBA 1FMOE 3U9SA 4NUSA 1W93A 5CAQA 3DY7A 2OWOA 4BDDA 4E20A 1H27A 3HV7A 2W1CA 4AXFA 4QYHA 2PMIA 2UW8A 5BYLA 3Q6WA 4IMYA 5LOHA 1JKJB 2JIVA 4ZXTA 2PK9A 3ORXA 1KOBA 4M67A 4RC4A 1CMKE 4FV1A 4KSQA 3CIKA 1YRPA 3MESA 3SLSA 3FI4A 4J53A 4Y95A 2UW9A 1P16A 4FIFA 4X2FA 3TUBA 5F1ZA 3GU6A 2JITA 4JLCA 2CKPA 3A8WA 4AE6A 3RPOA 4O82A 3E3PA 2ITOA 2XVDA 2X7OA 3ETHA 2ONLC 5HCXA 3BGPA 4YTFA 5KKRB 2QOQA 3VN9A 4CFWA 2R7MA 3QWUA 4MNEA 2HVSA 2WU6A 3DB8A 3DLSA 5HLPA 4XG9A 3V4SA 1OKWA 5I60A 2FVDA 2HW7A 3NVMB 4R5SA 5DRBA 5E92A 2PZ5A 1SVEA 4RC2A 3OCBA 4MHAA 3R7EA 4USEA 5I4NA 3S2PA 4DDIA 3B8QA 3U4UA 3FMHA 3ZZWA 2UW0A 4JJRA 5A6NA 3NEWA 4QMNA 4ANSA 5CF4A 4U3ZA 2QK4A 2R3GA 5IU2A 2YZLA 3KL8A 3A7JA 4YZMA 3W33A 3MH3A 4D5HA 4ZS4A 2GPHA 4GK4A 4GU9A 1WBNA 4FUYA 3NUUA 2Z7SA 2IVSA 3KAKA 1H1SA 3HV3A 5DMXA 3MPMA 2BHEA 1UVRA 3L8PA 4AN2A 3F5UA 4NW6A 4Z16A 2B1PA 3IW5A 2NU7B 2J9MA 2JKMA 4YJSA 3CD8A 1I09A 1OVEA 2J0MB 2H96A 1Q8YA 2C6OA 4HR7A 4ZS0A 3L8XA 4MWHA 3G9LX 4FT3A 1FOTA 3BU3A 3ELJA 3G33A 4FNXA 3PA5A 4RJ5A 4ALUA 1S68A 2YZAA 3BLQA 3DTCA 3KRWA 3ZOSA 2WTKB 2VGOA 5FEEA 2YM4A 2CZGA 3VA7A 1Z57A 5GJFA 1KBLA 2X8IA 4GMYA 1XR1A 3ZEWA 4FSRA 5I5UA 3M42A 2P33A 5CU6A 2X39A 4FSTA 4RIOA 3K3IA 5DEYA 3LQSA 4FKTA 1OIYA 2X6EA 5A4EA 2I0VA 5I9XA 5CF8A 2ZDQA 3TINA 4Y8DA 4HNTA 4L3JA 4O0YA 4BIBA 3R2YA 3TMOA 1JSTA 4D1XA 3R1SA 4EH2A 3LIJA 3CLYA 4D2SA 3ZBXA 2R3JA 2WMXA 4ZJJA 2HCKA 4F78A 2Z7RA 3RVGA 1R3CA 3MI9A 5GONF 3PSBA 4QP4A 1CKMA 4HCTA 3MWDA 3HMMA 4UYNA 3HB9A 3R2BA 4IC7A 4V04A 3R73A 4FVQA 3EL7A 4TWCA 1XH7A 3G6HA 4NK9A 1UU3A 3MFRA 4YPSA 4PP9A 3IONA 3DV3A 1R0EA 4WNKA 5E1EA 3SG9A 4DFNA 3DAEA 1AUVA 5E7RA 4A9YA 5HE1A 4MXZA 1OIUA 3VONA 4FFOA 4BKJA 3L9LA 4EI4A 4OT5A 2VPQA 2P2HA 3QC9A 4FIHA 3E8DA 3TWJA 4KKEA 4FTOA 4FSQA 1TQMA 4RX7A 3GGFA 2PVPA 1GSHA 3AW8A 4Z9LA 1A48A 4C5CA 1IR3A 2VTLA 4Y5HA 3P7CA 1IG1A 3LPBA 3V6SA 3ZZEA 1KE5A 1ZYJA 3EQPA 3PFQA 4BZDA 2YM5A 4OTRA 2R3OA 2PMLX 5DVRA 5M4FA 2BRHA 2R9SA 1H1PA 3NW5A 2HZ4A 1XH4A 3NSZA 1XMMA 4MWIA 4TN6A 3HLLA 2VTTA 4BI0A 4XP0A 4C59A 4I4TF 3FXWA 2WD1A 4I0SA 5EQYA 4CLIA 4YBKA 3UP7A 3V51A 5KMIA 4N70A 2WTWA 2XANA 4D2RA 5I5YA 1ZOGA 5HG8A 2CNVA 4FSUA 3DBQA 2B7AA 2WMWA 4ZI7F 3U4WA 2CPKE 2VTQA 4UCSA 4YJQA 1W0XC 2C5VA 2WTVA 3QCXA 3WF8A 5I9UA 3PRFA 3ZLWA 1JKKA 3WZKA 2CCIA 4EEQA 4I0TA 3BLRA 4CV8A 3PPZA 1Z2OX 4ACDA 2YERA 1OPJA 4FKWA 4N4SA 5EM8A 3THBA 3R71A 4X0MA 3MS9A 4Q5HA 2C47A 5CAUA 1ZLTA 3ZFYA 2P2IA 4P5QA 3VBQA 3NYXA 2W1EA 3FBVA 2F7ZE 2BILB 2XNNA 3FZRA 4FZ7A 4YBJA 4AOIA 3C4ZA 3ALOA 4A7CA 1JBPE 1YI4A 4LDTA 3RP9A 1WCCA 5LVNA 3BABA 5LYJF 3AG9A 1YHWA 3MTLA 3KGAA 4Y8VB 5KMNA 4RZQA 2G2FA 4FIJA 2YL2A 4QT1A 1FGIA 4MKCA 2XZSA 3LM0A 4H3BA 5DE2A 1LP4A 3RAKA 3LFDA 4FICA 4D4RA 2R7NA 3QX2A 2QQ7A 2C6TA 4U80A 4FIGA 1NT2A 1WZYA 4X2GA 4CFXA 5CYIA 5AV3A 4GEOA 3NYVA 5EH0A 5EDPA 2NO3A 2BAKA 2W99B 4E73A 1VYZA 4WUAA 4QRCA 4F7JA 4I55F 4DBNA 2RG5A 3HP5A 2VTJA 2JEDA 3NNWA 4BGQA 4CFUA 4F64A 1WBWA 4U81A 3FZTA 3KK8A 5HG5A 4HYUA 3EN4A 4KBKA 4DC2A 3L2PA 5HZNA 3DQXA 3ZO1A 1QCFA 2NU9B 4LUEA 2BCJA 2GNGA 4C4IA 4C3PA 4CV9A 4QMXA 3Q4ZA 4NFMA 1OMWA 4YJRA 2EJ0A 4TY1A 4DIMA 4BR3A 5HE0A 5B7VA 3MA3A 3QQJA 5M09A 1PHKA 3PY1A 1I1MA 3R9RA 3BE2A 3SC1A 3ZO3A 1H1QA 2HWPA 2VWYA 4AAAA 5CS6A 3RUPA 2C3KA 3SXFA 4M8TA 3SW7A 2BKZA 2OGVA 5ETCA 2FH9A 3U54A 3UTOA 1PKGA 1IYDA 5HG7A 3I7CA 2VWIA 2XBAA 2QVSE 3U9TA 5JEBA 2XNEA 4GVJA 3MJ1A 5CQWA 5H8EA 3U51A 2WGJA 4GFOA 2XIRA 3VS3A 2C1AA 3I5NA 4M69B 4F0GA 4NYEA 4XH6A 2VTHA 3AT4A 3T8OA 1GZNA 3G9NA 5ITAA 2BDFA 2OSCA 2YCFA 5AV2A 3R7IA 3AKKA 3ZDIA 4I6BA 5CY3A 2R4BA 3Q9WA 3WILA 4OT6A 2O2UA 3OBJA 4MUQA 2PBZA 4ACHA 1XH8A 4Z55A 1ZY5A 3HZTA 3LVPA 5CU3A 2VTNA 1W8CA 3AOXA 4CFNA 1CTPE 4N0SA 5LVOA 1Q5KA 2GTMA 4YSJA 2ZV8A 5JRQA 5FPRA 2I0HA 5BMSA 4Q9ZA 2B55A 5JVDF 2RFDA 4XJ0A 1PXJA 2R3FA 3RK7A 3HYHA 4QOXA 3LW0A 4G3CA 5AP6A 4BHZA 4FV0A 2JFLA 1FQ1B 3I79A 4JI9A 1G8KA 4ZOLF 3DQWA 3Q9YA 4LOOA 1JOWB 4I5PA 3SW4A 5I0BA 4DITA 3BA8A 3R1YA 4FTRA 3IECA 3R1QA 5DT0A 2FB8A 4EOKA 5LP6F 3LQ5A 2I0YA 2CMWA 3G2FA 4RIYB 3VS2A 4JXUA 3ODYX 3OCTA 5CVGA 3MBLA 5EKOA 5FTGA 2VO7A 2W1FA 4FV8A 2E2BA 5J87A 5IQCA 2QO7A 4FKQA 4ZTHA 1JDBB 2HY81 2YM8A 4XV3A 4MVFA 1J7LA 3TQTA 4C61A 1KOAA 3W1BA 4GUBA 3W2OA 4DAAA 2O64A 3Q32A 3S00A 2OH0E 4KKHA 2RF9A 2R2PA 3BU5A 3NRMA 4DEAA 1BLXA 2YN8A 4RFZA 5FLFA 5JZNA 4DTAA 4I23A 4JMQA 3F3WA 3T3UA 1ZYLA 4HGLA 1TA8A 1MP8A 2Q2TA 5BVKA 4FGBA 2Z60A 5FXQA 3TACA 1Q8TA 5CENA 4I94A 3QTUA 4WOVA 1G5SA 1UV5A 4FFMA 3PJCA 3TXOA 3Q04A 5LWMA 3O2MA 5H8GA 3JXWA 4X6RA 3TJCA 2PY3A 1WVYA 4FTUA 3VQUA 4NM3A 4ERWA 2AC5A 3AMYA 1P5EA 3FAAA 3W2QA 4BZNA 2PUUA 5BQ0A 4PTCA 5D9HA 3VBXA 4MXCA 5EI8A 1ZMUA 3ZO4A 2QU6A 4XBRA 1F3MC 3JR1A 2HVQA 4ZJVA 2W6ZA 3NZ0A 5EYKA 2QOFA 4DFYA 4G1WA 3JPVA 3C50A 2W0JA 3HDNA 2ZB1A 4APCA 4RC3A 5ANIA 3ZRLA 3NW7A 4YC6A 5D41A 5AP2A 2YS7A 3LAUA 4DLIA 3OUNB 4TL0A 4CMTA 3KULA 2OKRA 4LFIA 3EL8A 2I0EA 1PKDA 3IQ7A 3QQUA 1Z9XA 2XA4A 3PZHA 5C27A 3VQHA 3VOTA 4RWLA 4TW9A 4XP2A 2HGXA 3SOAA 5BWWA 4MXYA 4HCVA 2GHGA 3JUHA 2WHBA 1J7IA 4FKJA 3ROCA 4DGNA 3ZM4A 4ZTRA 2XK4A 4ANMA 1I2KA 1UNGA 2PVRA 3KXNA 4ZSEA 2OJGA 3UMWA 4YB8B 3TNHA 4C35A 3GP0A 4L7SA 4KUJA 5K2MA 2RG6A 2UZVA 2F9GA 2YCQA 2YIRA 1H08A 4QO9A 3V5TA 1M7NA 4C38A 4DGMA 4DN5A 5CAOA 5JFWA 4HNVA 4B0GA 3CKXA 3PY3A 3LJ0A 3K54A 4BCNA 1VJYA 1KT8A 2W6PA 5JQGF 3R9HA 3LLAA 4U3YA 1T45A 4D28A 2EUFB 2X9FA 2XYNA 3BELA 1FINA 4CRSA 1MRVA 2AC3A 1UU8A 1ZZ2A 4J95A 5AUYA 5GIPE 3W1FA 4GK3A 3HAVA 1J3HA 5EQPA 1IASA 2W9FB 3EQBA 3ALNA 3RM6A 5K5XA 4WD5A 1B39A 5HCYA 3ZUTA 5IQHA 4IAAA 3LFSA 2WQEA 3QZIA 2G2IA 3FC2A 5K5NA 4R78A 4FOBA 3OVVA 3OW4A 4XHKB 3KXXA 3PWDA 4UXQA 4CTBA 3QWJA 4FT7A 4ITHA 4J98A 5KE0A 4L43A 4NIFB 5FUTA 2OK1A 4KKGA 3PDTA 4LG4A 5L2SA 5IQBA 1OIQA 2Z7QA 3OC1A 4D5KA 3OUZA 4ASXA 4AZWA 3ENMA 3HMPA 3PLAE 1UWHA 1CQJB 2ESMA 2X7GA 4DHIB 3TUCA 1YHVA 1XWSA 3F3ZA 2YDJA 1PXLA 2Z8CA 2OIQA 3FLSA 4K6ZA 2OLCA 4QEBA 4IX4A 5CI6A 4EOOA 4AUAA 5D1OB 3PJ1A 4AA4A 2DS1A 3NDMA 3OS3A 4BDBA 3BL7A 2ZDTA 3PTGA 2CN5A 3TT0A 5IH6A 4DFZE 3QTSA 4RGJA 4I21A 4AWIA 2YRWA 3E7VA 4MAMA 3LMIA 1YDTE 5F20A 5HVJA 1ZAOA 3MWEA 5AUWA 1M14A 2VNYA 2AUHA 1DI9A 3LCOA 4M13A 3NC0B 2WTJA 4B4LA 3CS9A 5KHWA 4ANQA 3BIZA 2SCUB 3W5OA 2V62A 4A4XA 3IPHA 4MH7A 5AV4A 1WRVA 3MVLA 5CSWA 5D1OA 2GU8A 3BBWA 5CSHA 3UOLA 3C0IA 4MTAA 3L8SA 4EK8A 3LULA 3OEZA 2UZBA 4OUCA 5EYMA 3QHRA 2C68A 3HDMA 4Y85A 4ACMA 4X7QA 1Q99A 5HLNA 1OBDA 3W0SA 5BWTA 2XARA 3GC0A 4XG2A 3WARA 4CE5A 3R7UA 1O9UA 3R1NA 3QGWA 4BBMA 4L67A 4AGWA 1U54B 3WYXA 3R04A 4EH8A 2BZJA 5FTOA 4AGCA 4QP2A 5AA9A 5EM7A 3TL8A 4PMPA 3LJ1A 4EBVA 4H58A 4C36A 3FSKA 5EI2A 4A4OA 4K1BA 2DWBA 3GCSA 2VWWA 4E1ZA 4CCBA 4PTEA 1E9HA 1W83A 2REIA 3LCKA 3FZ1A 5CALA 1RE8A 3EIDA 4AN3A 3BL9A 4XG4A 3V4ZA 1EYZA 1U54A 2FA2A 2IZSA 1JSVA 2QR7A 3V5JA 2FO0A 2UW6A 3TY5A 3C4FA 2W5HA 5CEIA 4G5PA 3U9NA 4EHEA 4HVGA 3PXYA 4IACA 4CC6A 5HV6A 3ULZA 1M17A 2UZWE 3F3UA 3Q60A 3O7LB 5HU3A 2C69A 3ETJA 4TUYF 3ZUVA 4U40A 3FKLA 1P14A 2KTYA 4B99A 1SVGA 3JY9A 4Y83A 5BYZA 2FSOX 2UW7A 3MN3A 4J1RA 4UYAA 4XLVA 3F3TA 4DGGA 3EFLA 1CDKA 3OBGA 5E90A 3UQ8A 2JIIA 5A14A 4DH8A 5J9ZA 3KN6A 2QONA 5L6WL 3R5FA 4O22A 3FY2A 5JMSA 4TYHB 3CQWA 4J99A 4FE2A 4X2NA 2YITA 3TJDA 4C58A 3LFFA 4DLJA 3SGIA 2W7XA 3PJ8A 2J6MA 4O4JF 4AT5A 4E7WA 5HIDA 5B2LA 4QSHA 1KJQA 3O8PA 2BRMA 4D9TA 2FPIB 3ZU7A 3D5WA 1MQBA 5HVKA 3AT2A 1K3AA 4C4JA 4A9TA 4LH7A 2CGXA 2XNOA 2ERZE 2XJ2A 4B9DA 3H10A 1YOMA 5HD7A 3R9DA 3UQFA 1ZOHA 5J8IA 5GJGA 2J51A 3W16A 1R0PA 1P4FA 1KSWA 4OBOA 4PTGA 2R3IA 1ZRZA 3QD4A 2Q83A 4FKPA 4FTQA 5L2TA 3FEGA 1F0QA 1B6RA 3QLGA 2X4FA 3ZCLA 3U55A 2OIDA 1M2QA 2O65A 1L3RE 3GBZA 5ETAA 3QTZA 3GI3A 3H0YA 4AZEA 3E8EA 1PJKA 4F4PA 2DUVA 5AUUA 1P2AA 1G8AA 4K11A 3RALA 4YURA 4HVHA 3Q5ZA 4DG3E 2OIBA 2COIA 2BZHB 4EGQA 1YDRE 1ST0A 2OBJA 2C6KA 2ZM4A 4JAJA 4BCIA 3CPCA 1XH6A 3NFFB 4XLIA 1XBAA 4HYHA 2Y4RA 4EZ7A 4C2WA 4IZ5A 3LOKA 2J0LA 3IK3A 2R3LA 5AIKA 4YJ3F 4HZRA 4BTKA 1OPLA 2Q0BA 3CQEA 4DEHA 3AC3A 3FMDA 4E4LA 1UKIA 3I0OA 3Q2JA 4FV4A 1WVWA 3QF9A 2IW9A 4RA4A 3NFGB 1VLRA 4B8MA 4TXCA 4MA5A 3GUBA 3AXWA 4QP6A 4S32A 2X9EA 2OZOA 1BI8A 2PUPA 2HELA 3SGCA 4BTFA 4LRJA 3E63A 4EEVA 5IQDA 3FE3A 1ZOEA 2PE1A 4EH9A 4OBQA 1PMEA 4LL5A 3GNIB 5IQFA 1IAJA 4ZSLA 4EKKA 3CTQA 4DG2E 4YAJB 2BDJA 3C5IA 4O0TA 3S95A 3KVXA 4FYNA 4ZP5A 4O0WA 3VUDA 4RWJA 3CTHA 3QD2B 4KBAA 4D58A 4I50F 1Y6BA 3V6RA 4XRLA 1H0WA 1SMHA 4PMMA 5FPOA 4DFLA 4GRBA 3P86A 3LFAA 2UVZA 1H07A 4FV5A 4M7IA