3NUAA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase from clostridium perfringens
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
236
structure length
236
Chain Sequence
AMVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFGRYNGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase from Clostridium perfringens
rcsb
source organism Clostridium perfringens
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 84
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuaA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3nuaA02
5IH5A 2VAGA 3CPCA 3DQXA 2BR1A 1BX6A 4QSHA 4U3ZA 5BYZA 4BYJA 4QO9A 3RJCA 2R7LA 3BV2A 5AAGA 2EB3A 2YWVA 4M97A 1KWPA 3THBA 4FSWA 1ZOEA 3PPKA 5EOBA 4AXAA 4TRLA 1GIIA 2ESMA 2XNGA 2OXYA 3VUGA 3O17A 2B1PA 5F9EA 2F57A 3EIDA 2V59A 3EQFA 2WEVA 1Q8YA 4G6LA 2Y6MA 4FKSA 1OKZA 3JRWA 3LFEA 2Z7QA 3HKOA 2NNWB 4H05A 2JIIA 3WYXA 4Y73A 4NFMA 4QP2A 4EK8A 1IOVA 5BNJA 1ZY4A 2OBJA 3TKIA 4DGGA 3HB9A 3WO0A 3QZGA 5E1SA 4AUAA 3BWJA 3D14A 1GZOA 2GQSA 4ACDA 3IOPA 4C35A 2EWAA 2F7ZE 4M67A 5HG7A 2R7MA 2BHHA 3ERKA 3D7ZA 1DIKA 3FMLA 2VNWA 5HVYA 2RF9A 4WBOA 1P4OA 4A4XA 3L1SA 3FI2A 4RQVA 4XBUA 2CKEA 4G9RA 5EM7A 4DE4A 5M09A 3ETHA 5EK7A 3PUPA 4JG7A 1Q4LA 5CU0A 4ACMA 5CANA 4YP8A 1Q8WA 4C4HA 4D4VA 1JKTA 3RWQA 1Z2NX 2PVRA 4E93A 4EGJA 3T3VA 3NYNA 5GNKA 1ZAOA 4IDVA 3VUIA 3RPSA 5B2LA 2ZDQA 4ZHQF 2NP8A 4QYGA 4FTQA 3W1FA 4BIBA 1UU7A 4JQ8A 3O23A 3TWJA 3WIKA 3JY9A 3LIJA 2R3MA 3SC1A 3TG1A 3FC1X 5CVFA 1ZY5A 4YJRA 5CYIA 4Q2AA 3Q04A 5DE2A 3U9NA 3UO6A 4USFA 4KIQA 3HV6A 3QUPA 4TL0A 3NZ0A 5C8NA 3PXKA 5FXSA 2J51A 2ZDUA 4UBAA 1XH5A 2F7XE 4LUDA 5AP7A 1TKIA 3GI3A 3K3IA 4WD5A 4A06A 3KMWA 2XM8A 5FDPA 5CTPA 3K54A 3V5WA 3TUBA 1JDEA 1NW1A 3DFAA 4JQEA 3ZM4A 3GU5A 1G8AA 2XEZA 3Q96A 1SYKA 2XK6A 2H9VA 2GLTA 3E3BX 4EGQA 1H4LA 2GNIA 3GU7A 4NKAA 3DBQA 3FLSA 3L9LA 3KMMA 4KWPA 2W1HA 3ZBFA 3COKA 3H9OA 3OT3A 2GTMA 5KMOA 2C5YA 3QA0A 2Y0AA 3LKMA 4BDJA 4FSZA 4ZOLF 1OUKA 4FOCA 1ND4A 4C5BA 4JRVA 4U40A 2XJ0A 3GEQA 3F3UA 3VUKA 2V5AA 4XHKB 1YOMA 2RGPA 3UYSA 4PTEA 3W2QA 1HCLA 4AA5A 3R2BA 3QRUA 2XK9A 4NT4A 3D9VA 4GEOA 4GFMA 3RAIA 3VPBA 4ZQIA 3PSCA 2RFEA 3QGYA 4U42A 4EKKA 4ZTHA 4IM2A 4JDKA 1SVGA 1OVEA 3BHUA 3PY1A 5HNGA 3CBLA 4EONA 4HR7A 4O7YA 4PNIA 5FTQA 4RVMA 4YJ2F 3FI8A 5KUPA 2E9OA 4MH7A 4D1XA 2QNJA 1U46A 4BGHA 1ZWSA 5LCKA 4EQUA 4EYJA 3K3JA 3PZHA 3Q5ZA 2PZPA 3ZSIA 5K9IA 2H6DA 5A6NA 5HQ0A 5KHWA 3DKGA 1CMKE 3RMFA 2ZV8A 3LFAA 4BTKA 4MXOA 1OGUA 2C5XA 2VPQA 3JY0A 3KREA 5CZIA 3R9HA 3E8DA 4I5MA 4I0RA 3ZTXA 3EJ1A 5E8VA 3SXRA 4O7SA 4L67A 2HW7A 2GQGA 4IWOA 4O7ZA 3TNPC 2W5HA 3I5ZA 2HENA 2YDIA 1Y57A 3TKUA 2I87A 4BDCA 4IEBA 1BXRA 2NO3A 4G31A 3HRBA 5AAFA 5C9CA 5JVDF 2X81A 2QO9A 3QXOA 3VA7A 1G5SA 5GIPE 3UIMA 1PKDA 2UZOA 5CQUA 4AZFA 4P5QA 4ASEA 1J3HA 4GRBA 4NW5A 3KXXA 3TT0A 3WF8A 3Q9WA 4BI1A 2VU3A 4FTLA 4J7BA 4PP9A 4O0TA 4ZZNA 3FY0A 2X6EA 4IHJF 2R7IA 2QQ7A 1ZZLA 4ZY5A 4F08A 4QMQA 2XKFA 3TKHA 3G8DA 1RQQA 5JT2A 5CSHA 3NUXA 5EI6A 5HNBA 4U6RA 3QD4A 4AA0A 4I1ZA 4OT6A 5ANDA 1R0PA 1O6YA 1RW8A 5E92A 2YIYA 4RZVA 5CF5A 1DV2A 3R00A 4QOXA 4I41A 3AT3A 4P90A 3G0FA 4EH2A 1OIRA 5FG8A 4WHZA 1PXPA 3BLRA 1UVRA 2O63A 1MRVA 4ZS4A 3KGAA 2PUUA 3N6RA 2YWPA 1PK8A 2XK8A 5KKNB 4C0TA 3ZM9A 1TQPA 5IA5A 2I0YA 2P2IA 1JNKA 1UKHA 3RM7A 3G90X 3WF5A 4BDKA 2QONA 5T3QA 3CJFA 4O22A 5IQHA 2UZDA 2OXXA 3KALA 3DGKA 4LG4A 1IOWA 3SE7A 4WRSA 2XIXA 3HP5A 4FKVA 4MD9E 3OOGA 3TEIA 3PPJA 4M84A 4CNHA 4QTAA 1P5EA 1SNXA 2YJRA 4GCJA 3VBXA 1VYWA 1JLLB 1MRYA 2WMXA 5ETFA 5CASA 3I81A 4PX6A 3PXRA 1QPCA 4MHAA 3DK7A 2C5NA 3QQLA 4Z7HA 2C30A 5AX9A 2O8YA 4ZI7F 4HVIA 5BYYA 1IA9A 3A7IA 4CFNA 5C1OA 3GQLA 3M42A 5HGIA 2ZM3A 3ETJA 2IZRA 2GMXA 3CIKA 2W99B 4FKRA 2YM3A 3BHVA 1H1RA 4CTBA 4PP7A 4ZMFA 4FFMA 3Q2MA 5A4TA 4HNIA 1XBCA 2ZVAA 1YHWA 2J6MA 1KJQA 1DI8A 2KULA 5DLSA 3UOLA 4BCQA 4C3PA 3H9RA 2GTNA 2IZSA 2IZUA 4FFLA 5IEVA 1UWHA 5BVEA 4QMMA 2R9SA 3D7TA 4DFBA 4IM0A 4C4FA 4TT7A 2BROA 2YISA 2VWWA 3UZRA 4BDAA 4TYHB 4I5PA 1HOWA 2ETKA 1WBNA 2H34A 4L3JA 4BKJA 2VTOA 4R5YA 5AP3A 2BZIB 2C6TA 3C9WA 2HY0A 2PE0A 2W0JA 4KBAA 4YJPA 1KV1A 3FKNA 1UA2A 4X3JA 1SCUB 3FMDA 4MX9A 4XG6A 4U5JA 3FWQA 3WZUA 4GV1A 2WQOA 5J2TF 5AMNA 4PNKA 3W33A 5CF6A 4FEVA 4TZRA 3CD8A 1M7NA 4YLJA 5AP1A 5DA3A 5ANGA 3KRJA 3GC9A 4QQ5A 2NRUA 5BUIA 4ASXA 3R8LA 3QQJA 4FTKA 4AP7A 4RWKA 2CZGA 1FBNA 1REJA 3WI6A 5HE1A 5I9XA 1JBPE 3VO3A 4EHVA 2F2UA 3RTPA 3R71A 3DZQA 2UVZA 2XIZA 3FZRA 3NR9A 3LQ3A 4MQ1A 4PL5A 3MI9A 4RFMA 3VBQA 2CGXA 4BRXA 3RM6A 5HIEA 3QA8A 5IEYA 3LXNA 4K33A 3D5UA 3OWJA 4IWDA 4XG2A 1YXVA 4U43A 1H01A 1ZZ2A 2PWLA 4QTDA 3HZTA 3RFCA 2BZJA 2UW9A 2FUMA 3FE3A 3MIYA 4K18A 3SRVB 1KUTA 3CS9A 2VTLA 3HDMA 4DFYA 2X4FA 2B9HA 4UB7A 4W8DA 3AXWA 1FVTA 3KULA 4OBQA 4FU0A 4X2GA 5CZHA 2YM8A 2UV2A 2UZTA 5CVHA 2OU7A 3R7YA 1TVOA 2R3OA 2XM9A 3BYUA 3BX5A 2WTJA 3ZUVA 3BQRA 2V62A 3K2LA 1E9HA 3ORNA 4FKLA 3C4ZA 5J8IA 2XNOA 2I7QA 4RIOA 4BY9E 2R7NA 3DK6A 4IFGA 4KD1A 2ERKA 2IJMA 3BELA 4H36A 2A4LA 2Z8CA 3UQCA 4ZTQA 2FB8A 1H1PA 2YAKA 1WBPA 1PXLA 4PDPA 4BIDA 4EOOA 3Q2OA 2OXDA 3IG7A 1UU8A 4LRKA 4B9DA 2XUUA 4HYHA 3EFKA 4FL2A 1F5QA 4L7SA 4CTCA 4RMZA 4P4CA 3UNKA 3FLNC 5JRQA 1UNLA 4CFWA 4MV7A 3ROYA 2E9NA 4ERWA 4DH5A 4FTRA 1XHAA 2CSNA 2JEDA 3FMEA 3FZSA 3PRIA 2YJSA 3HEGA 4O0SA 4UWBA 5FTOA 3GIDA 5HEZA 2QOKA 4ARKA 4HCTA 5C27A 3ORQA 3AGLA 5IQAA 2HXQA 2IVTA 5HLNA 3G51A 2XB7A 5M08A 4U3YA 4AGUA 3RV3A 5H9BA 2HCKA 2QOBA 3U9TA 3TW6A 2Y4IC 3C1XA 4AWIA 1KOAA 4YU2A 5BPHA 4QMPA 4R3PA 2W1DA 4EJ7A 4LV8A 4UWYA 3CQWA 3R7UA 5JFVA 3TDVA 5DT0A 4M15A 4AE9A 4E6AA 5T6KA 1GSAA 2YACA 2X8IA 3HMMA 5E1EA 4BGGA 2WIPA 4BCHA 4EOQA 4XP3A 4B7TA 5M57A 3QKLA 1BL6A 4JL9A 1VBHA 3B8QA 3BWFA 4YZCA 3U6JA 1VBGA 5ANIA 4AS0A 1PHKA 1UKIA 2W06A 3FXXA 3V5JA 2HZ0A 3KKVA 5JSMA 5BX0A 1PXOA 4FFPA 3E3PA 2PZYA 4ALWA 2UW6A 3ZXZA 4KS8A 4QPSA 2R3NA 3P5KA 4ZTRA 4RIXA 4GG7A 2C0IA 4GK3A 2UW4A 3LFFA 4PUZA 4C59A 2X39A 3GLKA 3CKWA 3MN3A 4O2ZA 3R6XA 5JH7F 2WMWA 4LGHA 1URWA 3Q9YA 3IGGA 3U87A 4D4RA 4LOPA 5AX3A 3ZRKA 4FV5A 4JJRA 4DA5A 5CT0A 1OM1A 1GZKA 4PV0A 3VS3A 2BTRA 2XNEA 4ASZA 3B2TA 4FNYA 3ZH8A 3Q3BA 4FIIA 4USDA 1H8FA 3W8LA 2VO7A 4DF3A 3OG7A 5L8LA 4K6ZA 3EN4A 3Q4ZA 5DT3A 3LOKA 3ZO3A 4L3PA 1FVRA 3HV7A 1B6RA 2WYOA 2R86A 4HGLA 2JDSA 3SXSA 3T9TA 2GHLA 1XJDA 4UALA 3IO7A 4O7VA 1P14A 2DWCA 5D41A 3LE6A 5BMMA 4LM5A 5HX8A 2OSCA 2YHVA 5J7HA 5KMKA 3I60A 4S32A 1TQIA 4KS7A 2ITUA 3PLAE 4ITIA 3AMYA 4NTTA 5C01A 5L2SA 4GW8A 4NW6A 4GU9A 1Y8GA 2YZAA 4FV9A 5A3XA 2PYWA 3RAKA 1H0VA 5JGDA 1WVYA 4M13A 3VBWA 4H1MA 2J0MB 5AV1A 3RNIA 3R8ZA 5E4HA 3ET7A 3F5GA 4MEDA 3H10A 4GKIA 5D7VA 4ACGA 4CQEA 5LVPA 4F6SA 3BYMA 4BDGA 5CAQA 4F0FA 3CLYA 2J7TA 1Q3DA 4CMOA 2WTKC 2Y7JA 2W05A 3A4PA 3E64A 3F5UA 4AN3A 5LXTF 4FTNA 4ZIMA 4FSYA 2XYUA 1Y6BA 4QMUA 4P2KA 3SLSA 4PDOA 2UZEA 4C38A 1KV2A 4ALUA 3E92A 2PZ5A 4J8MA 2QI8A 2GNJA 2P0CA 4QYFA 4D2RA 5FEDA 3GOPA 4AAAA 4CFXA 2O0UA 1U54A 3KB7A 2WKMA 3K5UA 4QMSA 3ORPA 4FEXA 4R6VA 3IW5A 5CVGA 3ULIA 1VKZA 4MXYA 1CKJA 3EN7A 5C26A 4WBNF 2JBOA 4GG5A 5E8SA 3RKBA 2WU6A 2VO3A 4IWQA 5D9HA 4U97A 3DBDA 3F61A 4J95A 2XMYA 1XO2B 2ZV7A 3TNIA 3QF9A 4O83A 5BVDA 2W6NA 3WO1A 4GT3A 3KEXA 4ZSJA 2IPXA 4JIKA 4WA9A 5AUUA 5CI6A 2XJ1A 2W71A 5CI7A 5DMXA 3TACA 3R22A 2VRXA 3FZPA 4Z16A 4EH4A 1W7HA 2XS0A 3ZLYA 4FKQA 4N4SA 1NA7A 3IDCA 1CQJB 1JKSA 2V22A 4XS2A 5DRDA 5ANEA 2DWBA 4MBJA 3GCPA 3KK9A 2HY81 3RALA 4B8LA 4ID7A 3UVQA 4RIYA 4E6CA 3F2RA 3EL7A 3NNXA 5A54A 2LAVA 3DB8A 2QCSA 2X8EA 3RHKA 4CFFA 3FHRA 4EC8A 2XVDA 5IU2A 2REIA 4IZ5A 5JN2A 3QQGA 5CU3A 3WZKA 2IG7A 2ZMDA 4HGEA 1UU3A 4FSRA 2V55A 5J87A 3A8XA 3D0EA 4L52A 5HO7A 4QTCA 3W2PA 4J71A 3QHWA 3EZRA 1O6KA 3I6WA 3NUPA 3FXWA 1JQHA 2R3JA 3A60A 4DG2E 4F9BA 5JVLA 4RVLA 3CGFA 4CZUA 2QOHA 2CCIA 3LZBA 3MDYA 3NSZA 4S30A 3REPA 5HORA 1S9JA 4BB4A 4I4TF 4YBJA 4ZJJA 1YWNA 3VF8A 4D1ZA 2YRWA 3NNWA 4P7EA 4NK9A 4JBOA 4I0SA 5DWRA 4DT9A 2CCHA 4L53A 4FT5A 2XBAA 2WNTA 3CSVA 3PSDA 3R73A 4IVAA 4MNEA 2R7BA 4QPAA 2YDKA 2CLXA 2BRNA 2XKDA 2XBJA 2ITPA 3PXFA 2V7AA 4LOOA 4MKCA 4TWCA 3UODA 3ZYAA 4ZMEA 4DLKA 5FBOA 4RPVA 3OF0A 5A4LA 3Q53A 3R8VA 1WAKA 3A4OX 2IVUA 4LGGA 2W6OA 4BCOA 3ORRA 4BCNA 3O50A 2J50A 3HAVA 4HVDA 4H39A 3RVGA 5B2KA 2CGWA 2XKCA 3HA6A 2BAJA 4N57A 5C1QB 2HZIA 3A7HA 3QKMA 4AOIA 4GUEA 3EH9A 2YIWA 3ZRMA 3TDWA 2PN1A 2EVAA 4H1JA 4BDBA 3UOHA 4BC6A 4C34A 2ITOA 2R87A 1U5RA 4CZTA 5EZYF 2XJ2A 3PJCA 4O7TA 4FZAB 2VWIA 4D1SA 4V05A 3ZBXA 2O5KA 1PF8A 4AZVA 1Z57A 3OWPA 2EU9A 3A61A 2YM5A 1SM2A 3MFTA 1M2RA 2IVVA 3OUNB 5D1JA 3R9OA 4W8EA 2PPQA 4RWIA 4F09A 4YZNA 3F66A 2VWUA 3LM5A 3D4QA 1CS0A 3PWDA 5E8XA 2OG8A 1OIUA 3HDNA 5IH6A 1H28A 2IZTA 3DOGA 4EQMA 4AA4A 1BUHA 3ROCA 5E7RA 1KBLA 3G0EA 2F2CB 4MV3A 4GH2A 4I5CA 4DAWA 1RE8A 3OOMA 5FDXA 3AC2A 4K1BA 1V0OA 1E1VA 4KUJA 3QCYA 4BHNA 3UZTA 3UNZA 3TQTA 3KXMA 4M12A 2BFXA 4DLIA 2R2PA 5LVOA 5LQFA 2UVXA 3EYGA 3M2WA 4QP7A 3DDQA 3G15A 1R0EA 4NH1A 3QXPA 2EXCX 2PVPA 1PXNA 2PVJA 2BRBA 1H27A 2Q83A 2JIUA 2CNVA 2R64A 3P79A 3KRXA 4IAZA 4IC8A 5EI2A 3ORMA 4JNWA 5KE0A 1DV1A 3HV4A 5IQGA 3NIZA 5JFWA 3UNJA 2OF4A 4E4LA 2F7EE 5BVOA 4YGAA 3S0OA 4XUFA 4MTAA 4YZ9A 4O21A 3B8RA 3UOKA 5EHYA 3UC4A 4FV7A 3GC0A 5CY3A 3ACJA 3HMOA 5EYKA 4IVBA 3MGYA 3HMNA 2BCJA 4YTIA 5EDRA 5M4FA 2VV9A 3V3VA 4HNTA 4RZWA 5CF8A 2I1MA 3CGOA 4XG7A 4NJDA 4EL9A 3DK3A 4DH8A 4TY1A 4AW2A 3NAYA 4IADA 1PXIA 2YRXA 1IASA 1GIJA 2ZM1A 3BZ3A 3NIEA 3Q52A 4RA5A 3POZA 4D0XA 1OIYA 2WTKB 4LMUA 4U80A 2R3HA 4MAOA 5CNNA 3QZIA 3WZEA 4AZEA 5IUHA 3ZUTA 4BCKA 5FBNC 4E1ZA 2WO6A 4J97A 4LYNA 4EOPA 4GMYA 3OCGA 2YZNA 4E5AX 2J0LA 3KF4A 5G1XA 4EOSA 3R8PA 4BZOA 2XIYA 5HLWA 4L43A 3FQSA 4CGAA 3P23A 5M56A 4FKJA 3CQEA 3FLWA 1KOBA 2XK7A 3COIA 3JVSA 5A46A 4XX0B 4FFRA 2F9GA 3LCTA 2JKOA 4FVPA 4ZEGA 4LQMA 1IA8A 5B7VA 4RJ3A 4LRMA 1XQZA 3E8EA 4R7IA 5CAPA 4NZWB 3UO4A 3GCVA 2O65A 2YN8A 2EXMA 4MXCA 2X2LA 4GK2A 4RFZA 3IK3A 4FG9A 5AUTA 3BG5A 4TNDA 2FSLX 2X7OA 2IW6A 2ZV2A 3F5XA 1X8BA 2H8HA 3VBYA 2HXLA 1OL6A 2PUIA 3A8WA 4WKQA 4F0IA 4M9UA 5EHOA 2DYLA 4IWPA 4IB5A 4QMNA 3LP8A 5EDPA 3MPTA 4ANMA 2B0QA 3ZXTA 1E1XA 1FGIA 2BDFA 3A99A 5AP2A 3U8WA 3QTQA 3R7IA 4GS6A 3NS9A 2CPKE 3QX2A 3R9DA 2C5OA 1PYXA 4I55F 1PJKA 2QU6A 3O0GA 3G8CA 2YITA 4BIEA 3CCNA 4I6HA 4GFOA 2O3PA 4DC2A 3UQFA 2C6KA 1VZOA 2OZAB 1B6SA 4O4LF 5CXHA 3GT8A 3UMWA 4O0XA 3R7EA 5K4IA 4FI1A 5EM5A 3AC1A 4YPSA 2C69A 4BZDA 4XG4A 2W1ZA 1G3NA 1OL2A 2OJGA 3EOCA 1XBAA 4I94A 4IE9A 4M0YA 3ZDUA 4AT5A 4Y8DA 5IDNA 2V58A 4HVHA 2YZMA 4EH9A 4IAAA 3TIZA 1J7UA 3R21A 2YAAA 4L68A 5FP6A 5HIDA 1CM8A 3LCSA 4AX8A 3ZONA 4CVAA 4O96A 1EZ1A 1YXSA 3C5UA 2NRYA 1KJIA 3KXHA 3R5HA 3V4ZA 3ZS5A 3OS3A 5CU2A 1JKJB 1T45A 3FZTA 4Y83A 2WMAA 2R3KA 5FEQA 1AQ1A 5IA4A 4G3DA 3OBJA 2X7FA 3C5IA 3CD3A 2BALA 2BZHB 3FQHA 4O4HF 3QYWA 2C6DA 3MFSA 1OKWA 4RC2A 5LOVF 3BE9A 3MY5A 1FINA 4WUNA 4YZDA 1A06A 1VYZA 5DHJA 4OTIA 4PMPA 3LMGA 4FIJA 4BDFA 3A62A 3AD4A 5HIBA 1XH7A 3E63A 2PTKA 3ATSA 4P5ZA 4BVUA 3IDBA 4ZP5A 2YCQA 4KRCA 3IQ7A 3DNEA 4B0GA 5KBRA 4JBQA 4EWQA 3QLGA 4UEUA 2FA2A 4O0VA 3UJGA 3QAME 2BFYA 2PHKA 4BCMA 2FPGB 3V51A 2VZ6A 4QP4A 3JZFA 1CKPA 3UVRA 4QQTA 1H00A 1WMKA 4GL9A 2ZM4A 4GVAA 5GIOE 3OMVA 3FL4A 4G6NA 5LARA 4CT2A 2WQBA 3KQ7A 4BCJA 1RDQE 1JLUE 4FL1A 1W8CA 3RPVA 4YSJA 3UOJA 2XNPA 4X2KA 4D4SA 4UY9A 3L9MA 2BZKB 5GHVA 4YSMA 3MVMA 3UPXA 2HELA 3ORKA 2C6OA 5JQ5A 2OLCA 4GJ3A 4MWHA 2VX3A 4BDHA 3F7WA 1WVXA 4KBKA 4UWCA 4C3RA 4DBNA 2HZ4A 4F9CA 5J1WA 5IQBA 4KABA 2Y4IB 3DPKA 4M7IA 4RIYB 5M4CA 3PG1A 2PE1A 2ITWA 2W7XA 3U4WA 3AGMA 3DBEA 5E8WA 2QC6A 5TF9A 4AW1A 4ZK5A 3SGCA 4KSPA 2C4GA 5AA9A 3RP9A 5HTBA 2IW8A 4TNBA 2KTYA 3DQWA 5G6VA 3NAXA 4FKWA 1NXKA 5L6OA 3G9LX 3HNGA 2XD4A 5AUWA 3FPMA 4XG3A 3AX6A 1R78A 4C4EA 1YQJA 4IX4A 1STCE 5FM3A 3TZ7A 3DNDA 4QMVA 5HVJA 2HJWA 2VTRA 2C00A 4TWNA 3KAJA 3VAPA 4O2AF 4R77A 4V04A 4CV8A 5I4NA 3CJGA 3AT4A 3UYTA 2QOLA 2CMWA 2PVKA 3PJ8A 4CFMA 4E26A 2GS7A 1WFCA 4IHPA 2YL2A 4W4VA 5IA1A 2UW8A 1FVVA 4FGRA 3ZFXA 5IG1A 5IH4A 4NSTA 4O38A 5KBQA 1V0BA 3DJ7A 4I93A 3ZZEA 4BCIA 1HCKA 3SX9A 3VNTA 4R78A 4OTQA 3ATTA 2YZLA 2OWBA 3Q4UA 4IJ9A 3LLAA 4WNKA 3DY7A 5IUGA 3MA3A 4D55A 4WG3A 3PIXA 3ODZX 1I7LA 2WTCA 4TPTA 4X21A 5HX6A 3VF9A 4DHFA 3OWLA 4E6DA 4ENXA 4RX7A 5BQ0A 1XBBA 2YS7A 1GZ8A 3I4BA 5JFXA 3PP1A 1MQBA 4DN5A 3CE3A 2PUNA 2VWBA 4F70A 1ULZA 4PDSA 5EW3A 1YRPA 3CTQA 4O27B 5AJQA 4AU8A 4O2BF 3P9JA 2BIKB 1URCA 3UP2A 4MNFA 3BGPA 3ORTA 3GCQA 3PVBA 3EQBA 2QHMA 4RFYA 4F7JA 2OJIA 3OTVA 1WBSA 5BYLA 3GU8A 5KKRB 4FC0A 3C0GA 5D11A 3NDMA 3UFXB 4YJOA 3FI3A 2OGVA 4FV2A 1OPJA 2CN5A 3E62A 2X1NA 4O91A 3E5NA 2XF0A 1R3CA 4FBXA 1OITA 1CQIB 1GSOA 2B7AA 3P4KA 5CS6A 4NJ3A 1JOWB 1BI8A 4F63A 3F6XA 4C33A 4C4IA 3KRWA 3PY0A 3ENHA 4RVTA 5HG9A 4AFEA 1JPAA 3R1NA 4L42A 4EKLA 1GGOA 4E4TA 2YA9A 4MXZA 3PJ2A 4ZY6A 5T68A 3COHA 1ZMUA 2DS1A 3VVHA 1DM2A 5DI1A 3VRYA 3COMA 3O8PA 4NYEA 5ACKA 3ZCLA 4Q5EA 2Y6OA 4HZRA 5BUEA 3N4UA 3V5QA 5FNVF 5CA0F 2X2MA 5CX9A 3Q32A 1UV5A 2ITTA 5TO8A 4FV3A 3TV6A 3V8TA 4MA5A 1ZLTA 3N4TA 2W1IA 4KKEA 2E9PA 1A9XA 4IZOA 3MH3A 3V4SA 5BMVF 2C1AA 3AOXA 5I9UA 4F4PA 2UW5A 4DG0E 2W5AA 3LAUA 4FTIA 4YHFA 2ZDHA 1Q62A 3R8UA 3O51A 4WUAA 3OT8A 3QRIA 4ZJVA 4EOLA 4NCTC 3TCPA 3VPCA 1E4EB 1LUFA 3NNUA 3JXWA 4DEBA 2XH5A 3S3IA 4FX3A 4MV1A 3FMMA 5ETAA 2J0KA 3BLQA 1OPKA 4QP8A 4U41A 2O2UA 4NWMA 2W6PA 2VO0A 2BDJA 3CTHA 4C7TA 3EQRA 4OT5A 5CSPA 1Y6AA 3S1HA 3I5NA 4O6EA 3MB6A 4FV1A 4MQ2A 4EZ5A 4A07A 2I8CA 4L6QA 1LEZA 4XBRA 4YMJA 2GFCA 3VW6A 5LMBA 1LPUA 4MBLA 1AGWA 3OUKA 5EDQA 4FSNA 3ZU7A 4DFUA 5DH3A 5FM2A 4DTBA 2OLSA 3W8QA 1UU9A 3FL5A 4WG5A 4YURA 5AIKA 3S2PA 5IQEA 4RRVA 2DQ7X 2Z02A 4U8ZA 5JGBA 1EH4A 2XNNA 4IC7A 3NRMA 3KVXA 4G17A 4ZSGA 4ZTNA 2QLQA 4RZQA 3UPZA 4FNWA 2GPWA 4XMOA 5AFVA 5FP5A 3R8MA 2X2KA 4IAIA 3V8WA 3QTSA 5HTCA 3KAKA 4IAKA 3FLZA 2VD5A 3O7LD 4WNOA 2Z7RA 3U9CA 4C61A 1L8TA 2QOQA 4J98A 3SG8A 3Q2JA 3W10A 5L8KA 5C8KA 5LMKA 2WTDA 4JRNA 4O0RA 3E7VA 2BILB 3L8XA 1CKIA 4OTRA 4RG0A 4EBVA 3MWEA 3QD0A 3QQKA 4F1OA 2W17A 2IN6A 3BKBA 2ZJWA 4II5A 4X6QC 3UG1A 2GPSA 5L2TA 3DDPA 4O2PA 5IUIA 4Y8VB 4OBPA 2BAQA 2WMBA 3HV5A 2YDJA 3F3TA 5M53A 4OTFA 2VO6A 5DPVA 5CENA 3VOTA 5K3YA 2X0SA 2FP4B 5FD2A 5K5NA 4C37A 5B2MA 5CF4A 2YIQA 3BU6A 2C3LA 2WB8A 3DBCA 5KMJA 3VMMA 4K11A 3U6HA 4OW8A 4EEVA 4RX5A 1OKVA 3VS0A 4CFVA 4DG3E 3PDTA 4JVGA 1PKGA 3EYHA 3VQUA 3QTXA 5HICA 3UP7A 5CEPA 2PBZA 5ANOA 4YLKA 4G5JA 3SQQA 5EQPA 5F4NA 5ETIA 2BDWA 3ID6C 4EJNA 3FZOA 5CSVA 4TYJA 4DFXE 4YC8A 4F6WA 2YIRA 4IIJF 3Q9XA 2VTHA 3IW6A 3V8SA 1AD5A 3PVUA 4FKUA 2DZDA 4HQ6A 4WNPA 1U5QA 2QOFA 3TTJA 1QCFA 3MH0A 4S31A 2QOOA 3R23A 3R1YA 1ZYSA 2IW9A 4X3FA 5EYCA 2JLDA 4XV1A 3EZVA 5CQWA 5HBHA 4D28A 5DBXA 4FG7A 5EQEA 4B99A 3CY2A 1KE9A 4A9SA 2F4JA 3ULZA 5KX5F 1JVPP 1Y8YA 3OHTA 4AG8A 4FUYA 3VS4A 4GSBA 4CLIA 3MTFA 5A6OA 4M0ZA 4OLIA 3E5AA 3H9FA 3N51A 3I1AA 5AP0A 4MCVA 4E20A 1Z5MA 4TWOA 3CTJA 5AM6A 3I7BA 4ZLZA 3ORLA 4GVJA 4WSYA 5IDPA 4HPTE 1H1WA 4H3PA 4UYAA 5IQDA 5IA3A 4WBBB 3MFRA 2VWZA 3LXLA 3QCSA 3MTLA 3JYAA 4IVCA 4C02A 1R1WA 2JAMA 3G5DA 1CE8A 3BHHA 1XR1A 2XEYA 5LYJF 3D7TB 2ZB1A 2WMTA 4ZSEA 1WZYA 4F65A 3WZJA 2VR1A 2PULA 3VN9A 3MVHA 3GCSA 5ICPA 4JR3A 2OJJA 3TI1A 2J90A 3DXNA 3BYVA 5I5ZA 5IZFA 2NPQA 2RIOA 2R0UA 4NTSA 4XOZA 2YM6A 5DT4A 4JQ7A 4U45A 4RWJA 3I0QA 3QTIA 3FY2A 2FO0A 2UZLA 4YJQA 1WBOA 5LJJA 4L7FA 3JZIA 4L46A 2I0EA 4K0YA 3NUNA 4E8AA 4C36A 4G9CA 4EQCA 5LWNA 4CLJA 5EFQA 3NVKI 5CEMA 2ETMA 3D15A 3ACKA 1J1BA 4TYEA 4XJ0A 3GP0A 4ANLA 2QU5A 4N6ZA 2XCKA 4I6QA 3II5A 2B52A 4FODA 1OZ1A 2HIWA 2R3LA 3KL8A 1MP8A 4AE6A 3GOKA 2YM7A 5KMIA 1ZMVA 3EWHA 2A27A 2GSFA 4QYEA 4RC3A 2J5EA 5HG5A 3LJ2A 3KC3A 2XIRA 2QF7A 5BMSA 5GONF 2YW2A 3F69A 2R3GA 3U4UA 1FQ1B 2PUPA 4HGSA 5DRBA 3KULB 3R7VA 4QNAA 1YOJA 3VULA 4ALVA 3PXQA 4BF2A 2DLNA 4L1KA 3G2FA 3PY3A 2G9XA 1V0PA 4YJTA 3NUYA 2ZV9A 4RA4A 3BYOA 2XYNA 3MVJA 2OFUA 3RPOA 4I24A 2W5BA 5EKOA 4APPA 5HE2A 4I6BA 4DEGA 1NT2A 3ITZA 5HE3A 4ZXTA 4XYMB 2UZNA 4EUUA 3ZC6A 2W6QA 3E8NA 2R85A 3EKNA 4G6OA 3ZLSA 1YXUA 5A14A 2AYPA 2W96B 4CFUA 2YABA 5HU9A 3P1AA 3DLZA 3L9PA 2GNGA 1YKRA 2W4JA 4XH6A 4ZTMA 2JFMA 3G6GA 1JDBB 5BPYA 5JEBA 4A9YA 5KNJA 2PK9A 4FZ7A 4CV9A 1GIHA 1ZARA 5J9ZA 1APME 5IQFA 1I09A 4W4XA 4RC4A 4MV8A 5AV0A 3FXZA 2LGCA 4CG8A 4EOMA 2GS6A 4X3FC 4FTJA 2QOCA 4DITA 2WTIA 4EI4A 2RFSA 3LWBA 3V6SA 3N9XA 4RT7A 2DIKA 3MJ2A 4QP1A 4F7LA 5CAOA 1WVWA 2RG6A 1Q5KA 4ITHA 2ITQA 2FYSA 4OTWA 5E8TA 1ERKA 3SHEA 2GNLA 1GJOA 3NUUA 3P86A 1T36A 3BGQA 4FL3A 2ZB0A 3E8CA 2ONLC 3MSSA 4MXXA 3DB6A 2Y4PA 5IPJA 5AAEA 3NUSA 3W2OA 5CAUA 5HNIX 2VTNA 2A2AA 4YO4A 3QWJA 3TIYA 4HNUA 4DFZE 5CA1F 1OL7A 4YJVA 4AF3A 2CDZA 3IECA 3QTUA 3MS9A 4RIWB 4EH5A 2XK3A 1Z2PX 3QL8A 3TL8A 4HVSA 3A7GA 5H3QA 1W0XC 5C8MA 3HMPA 2QR8A 2J0IA 3SAYA 3LFDA 4BDEA 2GNHA 4D9UA 5IMEA 5ETCA 2J4ZA 5FXQA 4I0TA 5EM8A 1YHSA 2JBPA 2W9ZB 3RAWA 5LA6F 3MV5A 3LLTA 3QYZA 3R9NA 1JSTA 3BU5A 3PPZA 5C4LA 4FTMA 3EN9A 3P7AA 1H1SA 3KN6A 4EK5A 4QTEA 4F99A 5LWMA 3MA6A 1GOLA 4FIHA 1E4EA 2PY3A 1H08A 3OWKA 3T8OA 4G5PA 3SV0A 4A9TA 5LMAA 4NCTA 3AT2A 3BHTA 5HCXA 5ACBC 1NY3A 3ANQA 3QTZA 5H8BA 4O6LA 4IACA 2ITVA 1F0QA 2OIDA 3MFUA 2PU8A 3QQHA 4NIFB 3S00A 4XV2A 4BI2A 2C3IB 5HLPA 3BRBA 5IA0A 3SXFA 3A7FA 3DAKA 4PRJA 4XP2A 4C62A 4E5WA 5M44A 2WMVA 4Q9ZA 1YWRA 2R3QA 4A9RA 4ACCA 4DGMA 4EH8A 4JG6A 2NU7B 4TWPA 1JSVA 1QMZA 2WQEA 5KMMA 3SD0A 3I79A 1H24A 4YC6A 3QZHA 5HESA 4OGRA 1NVRA 4EYMA 2BAKA 5IQIA 4HPUE 2PVHA 1H1QA 4I4FA 4O0YA 4V01A 2RFDA 4CCBA 3Q5IA 3HX4A 3V5PA 2UW3A 4X7QA 5DIAA 2NU6B 3HRCA 2PVLA 3FYKX 5C03A 3V6RA 2VTAA 1IG1A 4BTJA 3UE4A 4B6LA 3I6UA 4EH3A 3AW8A 4JX3A 2P55A 2QO2A 3HL7A 3QKKA 3LXKA 1LEWA 5M55A 4YBKA 3JRXA 3ZRLA 2OFVA 1Q41A 2ZOQA 3C4EA 3PA5A 3PJ1A 5H2UA 2JKQA 4ZS0A 1S9IA 4XYLB 3VS7A 3LFSA 3DKOA 3R01A 3UIUA 3GUBA 3U9SA 4YC3A 3TV7A 1H0WA 4FNZA 2YCRA 1PX2A 3SW7A 3EFWA 3CEKA 3R1QA 4YZBA 1ZYJA 3F2AA 4OTGA 4BZNA 3LMHA 4F9AA 4FEWA 5CXZA 1OMWA 5D8DA 2WMSA 3LPBA 3MWUA 4W4YA 3QWKA 2RKUA 3OXZA 3TZ9A 2PE2A 4DT8A 2I0HA 2E9VA 3QC4A 3PLSA 4UZDA 4C3FA 3BU3A 4J53A 3O8UA 2UUEA 4V0GA 4X2JA 3RWPA 5EQYA 4ENYA 4C4JA 4FV6A 3DBFA 5E90A 2J9MA 5AV2A 1Z9XA 2Z2WA 1BNCA 4CKIA 3NYXA 5H80A 2WQNA 3DAEA 4BN1A 2YCFA 2XP2A 5EYDA 2UZBA 4S34A 3RCJA 4B8MA 3QRKA 4PL3A 2P3GX 2QKRA 2B9IA 3G33A 3DV3A 2IWIA 4XX9A 4YO6A 2UZWE 5CU6A 3TJCA 3TJDA 4Z3VA 2C6LA 1Z2OX 5CSXA 3PJ3A 4H58A 4HYUA 5J95A 3VIDA 1MQ4A 2CGVA 3OY3A 3QRJA 1B38A 1YI3A 2JKMA 3DU8A 4FIEA 4FVRA 4GK4A 4L9IA 3R63A 4MF1A 2Z60A 4GYIA 4QP3A 2QO7A 4LL5A 5EOLA 4HNVA 5KZ0A 4JR7A 2XIKA 3NYVA 3DT1A 2WAJA 3MY0A 3Q60A 4F9WA 1DS5A 1FPUA 4XCUA 5DNRA 4WG4A 4Y46A 5AP5A 2UZUE 2QLUA 3FKLA 5TKDA 2ZDGA 4FTCA 4DGLC 2UW0A 2X9FA 4TKSA 4G1WA 3R7OA 3W16A 4AOTA 5EH0A 2PMIA 2XA4A 4FFNA 5AUVA 3W2RA 3BEGA 4XRJA 4DINA 1OBGA 5E8YA 4LL0A 4OUCA 3OUZA 5E91A 3RPYA 1ZYDA 3RZBA 5JZJA 1OPLA 5BVKA 4XZ3B 4FT3A 2YYAA 3R04A 3NCGA 4XG9A 1GLVA 4FUXA 3QZFA 2J5FA 4JOAA 4JBVA 1IAJA 3V04A 5HV6A 3P7BA 2OH0E 4I4EA 2OJFE 2PVFA 2RFNA 1PMEA 5HE0A 4EWHA 2R82A 1YWVA 4MV9A 3LFQA 2R84A 1VEBA 3Q9ZA 3WILA 1VJYA 2WOUA 3DAJA 1AUXA 2V0DA 4L3LA 4QT1A 4RJ5A 4TUYF 4FV8A 2VX0A 1Q61A 4H3QA 1YVJA 2CKQA 3AC3A 4HJOA 4IM3A 3VBTA 4C5AA 1L3RE 2C68A 2WMRA 1PRYA 1F3MC 2W4KA 5HI2A 1KSWA 1QPJA 3TNHA 4LOQA 2P4IA 1J1CA 3IS5A 4D0WA 1IR3A 3H30A 3VBVA 5D10A 4Q9SA 4YB8B 5CEQA 1XWSA 1U54B 3QHRA 3D2KA 5DEYA 4PMMA 4NUSA 3C4XA 4DEDA 4M68A 3WARA 3GENA 3KFAA 1EUCB 5FLFA 4EUTA 4IVDA 4JX7A 4HCUA 4UXLA 1KJJA 4TN6A 3NVMB 3PIZA 5DR9A 5KZIA 2BRGA 3BGZA 3FUPA 2EB2A 4FGBA 2JITA 3D5WA 4E4NA 1M17A 3VW8A 3TUDA 3T3UA 1A9UA 2UVYA 3ORIA 4TTHB 3QC9A 5DR6A 3RK5A 4IX5A 4IX3A 2AC3A 4PWNA 4B4LA 1YW2A 5HKMA 1BL7A 3OTUA 3LQ5A 4PL4A 5FQDC 3HA8A 4RIXB 4CKJA 5CT7A 2VTJA 5JK3A 3FHIA 4YTFA 4BDDA 5CEOA 2JDRA 1WBVA 4FICA 2W9FB 5L2WA 3DKCA 2V5QA 5JGAA 3TZ8A 3QALE 4TXCA 4BBMA 4BBEA 4FEUA 3TV4A 4DH3A 3CR0A 1H26A 3MBLA 4FV4A 3QRTA 3UIXA 3ZO1A 2BUJA 2Z7LA 3Q1KA 2ACXA 2R3IA 3BLHA 3QD3A 1FGKA 2X4ZA 2X9EA 5HBRB 3MW1A 3MVLA 3VC4A 2FSMX 3DS6A 4FR4A 3TNWA 3OEZA 5B0XA 5JH6A 2GHMA 3HO8A 3E88A 5AP6A 4WO5A 3F5PA 4KBCA 3W18A 5M07A 1LR4A 4A4OA 2VGOA 4O81A 3U51A 3R0TA 5J9LA 5HVKA 3ZUUA 3KK8A 2XCHA 1U59A 3BE2A 2FH9A 3N4VA 3OEFX 3RUPA 4M3QA 4ME6A 3EQCA 4CMTA 3P08A 4QYHA 4FIGA 2JIVA 5EM6A 4FA2A 1YHVA 3CP9A 3LHJA 3PVWA 3CC6A 4FZDB 4EG0A 2AUHA 3NW6A 3POOA 4ZZOA 4O7NA 3F7ZA 2PMOX 1PMNA 3E87A 3ZO2A 4U9AA 3LCOA 1M2QA 2WMQA 3IDPA 2O64A 3PRFA 3KXGA 4FSQA 3RHXA 2A0CX 3WE8A 3NMUF 5LVMA 1M0WA 4PTGA 5J9YA 4IFCA 3IPHA 2IP4A 1KE8A 4EC9A 3LXPA 5HU3A 3PFQA 5DR2A 5D7AA 5CEKA 2J0JA 5L8JA 3BYSA 1KEEA 4KIOA 4I22A 3ZFMA 2QR7A 4YTCA 3C4WA 2J2IB 3H4JA 3MJ1A 4IDTA 4D2SA 2C3KA 3W2CA 2C3JA 3GFWA 2OZAA 4IZAA 4NM5A 5DGZA 4N0SA 1CSNA 5GJGA 4C4GA 2C6IA 4ZTLA 1W98A 1YI6A 3ZLWA 2W6ZA 4CT1A 2OZOA 4XNEA 4AFJA 3R28A 5A4EA 1C3OA 5CAEB 3IW8A 3FZ1A 3P0MA 2WFYA 5LXMA 3AC8A 3K5VA 4DEEA 4CD0A 4JAJA 4XRLA 3SG9A 1JKLA 4E7WA 1JKKA 1PXJA 1YXXA 3BCEA 3A7JA 5HCZA 3TZMA 2RG5A 3EQGA 4ZLOA 4Y72A 4FEQA 1M6VA 5J1VA 4QMOA 4I92A 1JWHA 1W82A 4NU1A 4DTAA 1CDKA 2JFLA 5BVWA 1J7LA 3GB2A 3O8TA 4DEHA 5JFSA 4ZLYA 5BVFA 4UX9A 3D94A 1M2PA 5HD7A 2YZGA 3RV4A 2VTSA 3LVPA 1Q97A 3K5IA 3DCVA 3NW5A 2YFXA 4FTOA 3PG3A 2PSQA 2R7KA 4IAYA 3TM0A 2CLQA 1XH6A 4JBPA 2W1EA 2PMLX 3FAAA 5HHWA 3NX8A 4AT3A 3NWWA 2F49A 3AC5A 3ZDIA 3CPBA 1J91A 4W4WA 2WOTA 3WBLA 3K5HA 4FYNA 4DIMA 4YJSA 5TR6A 3BV3A 3OZ6A 3UO5A 3HRFA 3OC1A 4FG8A 4IMYA 3EL8A 3PYYA 4BDIA 4KKGA 4QTBA 5KO1A 2GHGA 5IEXA 4AZSA 2OH4A 4R3RA 2BRMA 4ZY4A 2VTMA 2E9UA 2ETRA 5IISA 4J8NA 2CHLA 3UIBA 4AT4A 1P4FA 2G1TA 2HWPA 2YERA 4DLJA 2PL0A 3HUBA 2WPAA 5AUYA 2CNQA 2I0VA 3CY3A 4AQCA 4QP9A 2C1BA 3S4QA 4ANBA 3MYGA 2VTPA 4PF4A 2I80A 3I12A 2J9GA 3M1SA 2XNBA 4IH8A 5HBJA 2VN9A 3JUHA 1M52A 5AUZA 3BQCA 4I23A 2OO8X 4GYGA 4BR3A 4CRLA 3QFFA 4I50F 2ZYBA 4QMLA 3ELJA 2B55A 3F2NA 2NU9B 4USEA 3CXWA 3LJ1A 1YXTA 2NU8B 3UZPA 1FMKA 3BPRA 4EORA 2OK1A 4O4IF 4FNXA 3LCKA 2C0TA 4Y5QA 3BBTB 4XEYA 1EYZA 2ZAZA 3IW4A 3TXOA 3SOAA 4AN2A 3QCXA 2C6MA 3ANRA 3O96A 3QTWA 2QG7A 4XYFA 2X7GA 2WTWA 4UV0A 1Q8ZA 4UYNA 4EK3A 5ITAA 4IIRA 4UZHA 3Q4TA 5EW9A 4NL0A 3G9NA 3QFVA 1YDSE 4L44A 3OXTA 2W70A 4N70A 5K5XA 3HV3A 4YJUA 3RK9A 4GIHA 5IQCA 3GFEA 4Z9LA 4DEIA 3DF7A 2YIXA 4IB3A 1M7QA 3OW4A 3WF9A 4M14A 2GU8A 4EHGA 2OW3A 2YS6A 3AMBA 5L6WL 3VHEA 3MPMA 1DAWA 4GT4A 2JDTA 3VS1A 1PXKA 3PZEA 2BRHA 2ZMCA 4QMZA 1JSUA 1PMVA 5KCVA 4RGJA 3HMIA 2R4BA 4RLLA 2XCLA 4RX8A 3JR1A 5K4JA 1CTPE 2WGJA 3QD2B 1UNHA 2XK4A 1AUVA 2PVMA 4AOJA 3MWDA 1SNUA 5HO8A 4OR5A 2OJ9A 5AADA 1R39A 5FGKA 1Q3WA 3PA4A 3LQ8A 3GU4A 4KB8A 2PMNX 4JAIA 1O9UA 3MIAA 4NM7A 5AWMA 4XLVA 3UQGA 4D58A 4C5CA 3MH2A 2C6EA 3V5TA 3EN6A 3R02A 3CQUA 5FUTA 3DKFA 2PZIA 4L8MA 3V01A 2BVAA 2HOGA 3JVRA 3ZHPC 2VTTA 3EQDA 3EHAA 4CKRA 5EG3A 5E8UA 4ITJA 4DH7A 3ZZWA 4RJ8A 5JZNA 5I0BA 1MRUA 1P2AA 4YTHA 3NPCA 3QLFA 2FSOX 4BI0A 4BTFA 3FMJA 4WOVA 3MJFA 1GY3A 5GINE 3ZSGA 4I6FA 2VTQA 4G16A 3NGAA 5LOHA 4FK3A 4RLKA 3R30A 2WQMA 4YZMA 3UBDA 4YAKB 4FFOA 4OTDA 3SDJA 1OI9A 5AA8A 1B39A 4ORKA 4HYIA 4YHTA 4HVGA 5F94A 3FSFA 1LP4A 4AN9A 3Q6WA 3FDNA 3RGFA 3KU2A 2CN8A 3OCBA 4WNMA 3LW0A 5JQWA 4EH6A 4QMYA 1FMOE 2QHNA 5IF1A 3R5FA 2WZJA 2HWOA 2OIQA 2XKEA 4QMWA 4MYGA 2H96A 5FRIA 5JKGA 4FYOA 3UMXA 3O71A 3QTRA 4EZ7A 3C0IA 2ITXA 4AW5A 3SA0A 3FLYA 4OTHA 3DZOA 4RJ7A 1KE6A 3RI1A 3DXPA 3ZO4A 2C0OA 2QK4A 3H0YA 4FIFA 5J5SA 3LM0A 2VGPA 1KE7A 4O86A 1Q24A 3GBZA 3PA3A 2ONLA 5E9EA 5I9WA 1PMUA 5H8GA 3OCTA 5JMSA 1YOLA 4N6YA 3HYHA 4ZSLA 3DFCB 4O7LA 5F20A 1NVQA 2QODA 3GNIB 3P7CA 4F9YA 2X6DA 4FSMA 4JDIA 4R3CA 4RJ6A 1DAYA 3VWAA 4DBXA 4Z55A 5KKRC 5HBEA 2P2HA 3F9NA 1WBTA 3FYJX 3H0ZA 4M8TA 4R5SA 4X2NA 1PW2A 3WOWA 2PVNA 2W6MA 3OXIA 4IB1A 4MD7E 4MBIA 4KRDA 1VR2A 4MWIA 2C47A 3OVVA 4J52A 4QP6A 5AIRA 5A4CA 5DFPA 5EKNA 3TTIA 4EH7A 3K3PA 3AG9A 3FSKA 3NW7A 1BLXA 3MY1A 3OBGA 2IO6A 4O7WA 4KAOA 5AM7A 3F88A 4FOBA 4K2RA 3PTGA 4R1VA 2BHEA 2SRCA 3WIGA 4APCA 2BKZA 1JAMA 2YEXA 4HOKA 4YR8A 3UTOA 3PE1A 4FMQA 3VHKA 4PMSA 4C58A 4CSVA 4XP0A 2GDOA 3KXZA 3NLBA 4DFNA 3EQIA 4RQKA 3ZSHA 2EUFB 2P33A 4MVFA 4O0WA 5EI8A 4ZZMA 5LMKC 3WYYA 4KNBA 1V1KA 3A2CA 5DVRA 2R5TA 1K9AA 1QPEA 5D12A 5DOSA 1K2PA 3UGCA 3DTCA 1DI9A 2PZRA 3AMAA 3D2IA 3F3WA 4F6UA 3IONA 2CKOA 3NUAA 5KX8A 4EZ3A 2VWXA 4IQ6A 4R1YA 3IW7A 5LP6F 3HBLA 3LFBA 3GU6A 3KVWA 3P78A 5JQGF 4M69B 2C5VA 2WELA 3PSBA 4FZ6A 4JDJA 5F95A 3C4CA 5L6PA 2OI4X 4HNFA 4L00A 3ORZA 4K77A 4EOJA 2HW6A 2X0GA 4QQCA 4RBLA 3QQFA 1KC7A 3T9IA 4AACA 4IBMA 3G6HA 3QU0A 4HCVA 3ZFYA 4NM0A 2UZVA 4KIPA 5F1ZA 4BBFA 3ORXA 4YLLA 2QD9A 4BICA 1OECA 3C7QA 3D5VA 5IMXA 4I5HA 3AD5A 5DEWA 1GAGA 2DUVA 2Q0BA 1REKA 2W1FA 4HGTA 5M4UA 1KJ9A 2B4SB 3ALNA 3LMIA 4FE2A 3B2WA 4ANQA 2OKRA 2W1CA 3OD6X 4QRCA 3FMKA 4X6RA 1EHIA 2WIHA 4ZOGA 4MD8E 4QNYA 1C30A 3FQEA 4IANA 2SCUB 1OUYA 4V0GB 4WIHA 4WT6A 2B54A 4ERKA 3NNVA 4ANSA 4E6QA 5L2IA 2YM4A 4FKIA 3O7LB 4CXAA 3OFMA 4DEAA 4O4JF 4MV6A 3QBNA 1BKXA 3L8PA 2VNYA 4YJNA 3EMGA 1UWJA 1IRKA 4O0UA 3SW4A 4BTMA 3HGKA 5BVNA 3TIGA 3W2SA 3D83A 2QG5A 2E2BA 5M51A 3O2MA 2FPIB 4A4LA 3ODYX 4JG8A 2GPHA 3GQIA 4O7RA 2V7OA 2G2HA 3MH1A 4ZSAA 1QL6A 3KMUA 4BYIA 3DJ6A 2ITNA 2FPPB 5FXRA 4NFNA 4YUQA 3KXNA 5H8EA 2JKKA 4E73A 1WCCA 4I3ZA 5DYJA 4ASDA 3OUUA 4X2FA 3S95A 3ALOA 5CEIA 2WMUA 4A9UA 4FT7A 4F7SA 3WE4A 3AC4A 2FSTX 2A19B 2OICA 3D5XA 3FEGA 4O84A 4FT0A 4CRSA 1H07A 2IVSA 2OIBA 4GU6A 4BHZA 4O82A 4BCFA 4E4MA 3PWYA 3QUDA 4IW0A 1K3AA 4UN0C 3ZLXA 4HW7A 2BKKA 3RK7A 4E4XA 3GGFA 3KN5A 5CU4A 3V5LA 4MK0A 3HAMA 4GIIA 4U79A 4YBZB 1ZYCA 2W4OA 5I9VA 2HZNA 3UVPA 4IX6A 2XRUA 3C13A 3WF7A 4YNEA 2G15A 2WD1A 2B53A 4DCAA 4EK6A 3OY1A 4F64A 3VJOA 4YAJB 4AZTA 3GCUA 3KY2A 2BMCA 4Q5HA 4Y95A 4TYIA 3U54A 3W55A 4EHEA 4CG9A 4DTKA 3GC7A 1EUDB 3EKKA 1OKYA 2R3RA 3GXLA 4MXAA 3TNQB 3MESA 2R3FA 2VWYA 4BGQA 5L3AA 4KINA 5C8YF 4GUBA 2QOIA 1J7IA 3VS5A 4F7NA 3EFLA 5CLPA 3OCSA 2GS2A 4Y5HA 2OF2A 4NKSA 2ZDTA 4GFGA 3KCFA 4YNOA 4FSTA 4JT3A 2WU7A 3BIZA 4IB0A 2BIYA 2Y8OA 1XH8A 1IEPA 2CGUA 1PY5A 4HZSA 4PY1A 1SMHA 3I7CA 5TOZA 4FSUA 4HYSA 3FKOA 4H3BA 2QVSE 2A1AB 3VUDA 4TYGA 4LRJA 5CAVA 5LVNA 5M4IA 5HZNA 4D9TA 3F82A 5ANKA 3SOCA 3EB0A 2HK5A 1W83A 3QX4A 4FVQA 4TV8F 3LFCA 3U6IA 4UXQA 1YI4A 1Q8UA 4XLIA 3U55A 3NYOA 4FTTA 4IZ7A 4U7ZA 3ENMA 4C2WA 1KE5A 3C51A 4FKOA 4G3FA 3BBWA 4G3CA 4A7CA 2WEIA 4ZAUA 3IOKA 3F3ZA 4ONAA 3FLQA 2NUAB 2ITZA 5EYMA 3SKCA 1W96A 3L8SA 4LFIA 1W93A 4FT9A 1GNGA 5AUXA 3W32A 1QPDA 1UNGA 2WXVA 1OB3A 3I0OA 4QQJA 5IYZF 2XZSA 2HYYA 3KRRA 4DYMA 2G2IA 4LI5A 3EQHA 3FV8A 4CEGA 3BHYA 1BYGA 2Z04A 3FBVA 4S2ZA 4CMUA 5LVLA 2XNMA 3HUCA 5GJFA 3ZEPA 5CSWA 5JRSA 4F0GA 3PXYA 3HP2A 1B6CB 1T46A 3FMNA 3M11A 4IAFA 4U44A 2WTVA 3UG2A 5BUJA 4LMNA 5KMNA 4E5BA 3KF7A 1PYEA 2YCSA 4K8AA 3HECA 4FKTA 1OBDA 3SRVA 3EFJA 4I21A 4G2FA 1ATPE 1ZXEA 3ETAA 4XG8A 5CB4F 4TV9F 3IGOA 2GFSA 4R7HA 1BMKA 5ANJA 4Y85A 3OROA 2Y9QA 3FC2A 3VJNA 4EOIA 4D5KA 4XV9A 2B9JA 2JC6A 2JGZA 1I7NA 4RVKA 5CNOA 5EHLA 4MA0A 1OL1A 3DXQA 4F1TA 3JS2A 4QMTA 5A4QA 3OW3A 2I40A 2G01A 4DGNA 4EOKA 4ZJIA 3UC3A 4FTUA 4D5HA 3VS6A 4Z7GA 4EBWA 4IZYA 5A9UA 1G8SA 3C50A 2PVYA 4RIWA 4PMTA 2RL5A 4GJ2A 2VWVA 4I20A 3WNZA 2JDVA 1XKKA 3DA6A 4JDHA 1ZOHA 5EW8A 2JDOA 3KA0A 4GKHA 1SZMA 2VTIA 3TUCA 4RWLA 2VQDA 3C4FA 3EQPA 4GT5A 5DN3A 4X3FB 3H3CA 1RJBA 1Q99A 1SVHA 3FMHA 4MAMA 3VS2A 4YJ3F 1TQMA 2CJMA 4CCUA 2JD5A 5IA2A 3ZEWA 4DGOA 3IKAA 3EN5A 3OP5A 1XH9A 4G34A 4TYHA 3R5XA 5BPFA 1U4DA 3PXZA 4RX9A 5E8ZA 4QYYA 4JS8A 5KHXA 3SVVA 5M06A 1MUOA 2W1GA 2HAKA 4XOYA 1WBWA 5I9YA 2HGSA 2R3PA 3DTWA 1ZOGA 4YPDA 4L01A 4DCEA 2WHBA 3QGWA 4YHJA 2AC5A 4G3EA 3TIIA 3DLSA 4KSQA 4U0IA 2FVDA 4JI9A 4NM3A 5TT7A 4LV5A 2QURA 4RSSA 3FPQA 5JQ8A 3E93A 1BI7A 4JXFA 2ITYA 4AGDA 1OL5A 1Y91A 3VUMA 4FKGA 4PQNA 2VUWA 2Z7SA 1XH4A 4AW0A 3QCQA 3R2YA 4D4YA 5AEPA 3BEAA 3FJQE 3BI6A 3VRZA 2G2FA 3HVCA 4TW9A 3F3VA 3HLLA 4G3GA 1FOTA 1M0TA 4J96A 4BCPA 2UW7A 3TN8A 3E7OA 3FI4A 4BCGA 5HCYA 4AGWA 3UDBA 5GJDA 4R7BA 3VQHA 5C1PA 4F1MA 5J2UF 1GSHA 2R0IA 3LFNA 4DFLA 2XRWA 1GZNA 4JIAA 3RCDA 1ZMWA 3VUHA 3KRLA 4S33A 3L9NA 2VX1A 3PE2A 4EHZA 2GQRA 2GCDA 4PTCA 5LCJA 2P0AA 5KMLA 4FZFB 4DH1A 4K9YA 4AGCA 3GC8A 4J99A 3PP0A 3C0HA 4ZTSA 5HG8A 5FTGA 1YDRE 3R9RA 3AQVA 2GNFA 2ERZE 3PVGA 4X0MA 3RAHA 4EK4A 3RINA 1A48A 2BPMA 4IJPA 4XV3A 4AZWA 1IAHA 4LUEA 2BTSA 4WRGA 4FTAA 2Q0NA 1Q8TA 1YDTE 2FGIA 3JPVA 3QUEA 3MPAA 1NVSA 3LCDA 3Q6UA 3NEWA 3AD6A 4QMXA 5HD4A 2QKWB 3N8DA 4U81A 3GVUA 5CWZA 3TINA 1H25A 5C4KA 3MB7A 3ZOSA 1O6LA 1KJ8A 4ACHA 5I9ZA 3R1SA 1WR2A 5AV3A 4JLCA 2I6LA 3ZMMA 3L8VA 1OIQA 4RJ4A 1SVEA 4MNEB 2FB9A 3PIYA 3NCZA 3R83A 2B9FA 4PDYA 1ZRZA 1I44A 1PXMA 2CKPA 2JAVA 3DJ5A 4L45A 3WZDA 4FV0A 2X8DA 5FEEA 4MV4A 3RPRA 1W84A 3Q4CA 3WF6A 4C2VA 1M14A 4FK6A 4KA3A 4J1RA 4KKHA 4OBOA 5CALA 3LJ0A 2CNUA 3QQUA 5AV4A 3KCKA 3CKXA 4FKPA 5DG5A 5AP4A 3ZC5A
chains in the Genus database with same CATH superfamily
5IH5A 2VAGA 3BL7A 3CPCA 3DQXA 2BR1A 1BX6A 4QSHA 4U3ZA 5BYZA 4BYJA 4QO9A 3RJCA 1IYEA 2R7LA 3BV2A 5AAGA 2EB3A 2YWVA 4M97A 1KWPA 3THBA 4FSWA 1ZOEA 3PPKA 5EOBA 4AXAA 4TRLA 1GIIA 2ESMA 2XNGA 2OXYA 3VUGA 3O17A 2B1PA 5F9EA 2F57A 3EIDA 2COGA 1XMMA 3EQFA 2V59A 2WEVA 1Q8YA 4G6LA 2Y6MA 4FKSA 1OKZA 3JRWA 3LFEA 2Z7QA 3HKOA 2NNWB 4H05A 2JIIA 3WYXA 4AAYA 4Y73A 4NFMA 4QP2A 4EK8A 1IOVA 5BNJA 1ZY4A 2OBJA 3TKIA 4DGGA 3HB9A 3WO0A 3P5JC 3QZGA 5E1SA 4AUAA 3BWJA 3D14A 1GZOA 2GQSA 4ACDA 3IOPA 4C35A 2EWAA 2F7ZE 4M67A 5HG7A 2R7MA 2BHHA 3ERKA 3D7ZA 1DIKA 3FMLA 2VNWA 5HVYA 2RF9A 4WBOA 1P4OA 4A4XA 3L1SA 3FI2A 4RQVA 4XBUA 2CKEA 4G9RA 5EM7A 4DE4A 5M09A 3ETHA 5EK7A 3PUPA 4JG7A 1Q4LA 5CU0A 3O5AA 4ACMA 5CANA 4YP8A 1Q8WA 4C4HA 4D4VA 1JKTA 3RWQA 1Z2NX 2PVRA 4E93A 4EGJA 3T3VA 3NYNA 5GNKA 1ZAOA 4IDVA 3VUIA 3RPSA 5B2LA 2ZDQA 4ZHQF 2NP8A 4QYGA 4FTQA 3W1FA 4BIBA 1UU7A 4JQ8A 3O23A 3TWJA 3WIKA 3JY9A 3LIJA 2R3MA 3SC1A 3TG1A 3FC1X 5CVFA 1ZY5A 4YJRA 5CYIA 4Q2AA 3Q04A 5DE2A 1TFFA 3U9NA 3UO6A 4USFA 4KIQA 3HV6A 3QUPA 2CFMA 4TL0A 3NZ0A 5C8NA 3PXKA 5FXSA 2J51A 2ZDUA 4UBAA 1XH5A 2F7XE 4LUDA 5AP7A 1TKIA 3GI3A 3K3IA 4WD5A 4A06A 3KMWA 2XM8A 4I6LA 5FDPA 5CTPA 3K54A 3V5WA 3TUBA 1JDEA 1NW1A 3DFAA 4JQEA 3ZM4A 3GU5A 1G8AA 2XEZA 3Q96A 1SYKA 2XK6A 2H9VA 2GLTA 3E3BX 4EGQA 1H4LA 2GNIA 3GU7A 4NKAA 3DBQA 3FLSA 3L9LA 3KMMA 4KWPA 2W1HA 3ZBFA 3COKA 3H9OA 3OT3A 2GTMA 5KMOA 2C5YA 3QA0A 2Y0AA 3LKMA 4BDJA 4FSZA 4ZOLF 1OUKA 3BACA 4FOCA 1ND4A 4C5BA 4JRVA 4U40A 2XJ0A 3GEQA 4EFEA 3F3UA 3VUKA 2V5AA 4XHKB 1YOMA 2RGPA 3UYSA 4LH7A 4PTEA 3W2QA 1HCLA 4AA5A 3R2BA 1XDNA 3QRUA 3CSWA 2XK9A 4NT4A 3D9VA 4GEOA 4GFMA 3RAIA 3VPBA 4ZQIA 3PSCA 2RFEA 3QGYA 4U42A 4EKKA 4ZTHA 4IM2A 4JDKA 3UDZA 1SVGA 1OVEA 3BHUA 3PY1A 5HNGA 3CBLA 4EONA 4HR7A 4O7YA 4PNIA 5FTQA 4RVMA 4YJ2F 3FI8A 5KUPA 2E9OA 4MH7A 4D1XA 2QNJA 1U46A 4BGHA 1ZWSA 5LCKA 4EQUA 4EYJA 3K3JA 3PZHA 3Q5ZA 2PZPA 3ZSIA 5K9IA 5HNEA 2H6DA 5A6NA 5HQ0A 5KHWA 3DKGA 1CMKE 3RMFA 2ZV8A 3LFAA 1CKNB 4BTKA 4MXOA 1OGUA 2C5XA 2VPQA 3JY0A 3KREA 5CZIA 3R9HA 3E8DA 4I5MA 4I0RA 3W0RA 3W0MA 3ZTXA 3EJ1A 5E8VA 3SXRA 4O7SA 4L67A 2HW7A 2GQGA 3T9FA 3PUFC 4IWOA 4O7ZA 2W5HA 3TNPC 3I5ZA 2HENA 2YDIA 1Y57A 3TKUA 2I87A 4BDCA 4IEBA 1BXRA 2NO3A 4G31A 3HRBA 5AAFA 5C9CA 3TY8A 5JVDF 2X81A 2QO9A 3QXOA 3VA7A 1G5SA 2HHFB 5GIPE 3UIMA 1PKDA 2UZOA 5CQUA 4AZFA 4P5QA 4ASEA 1J3HA 4GRBA 4NW5A 3KXXA 3TT0A 3WF8A 3Q9WA 4BI1A 2VU3A 4FTLA 4J7BA 4PP9A 4O0TA 4ZZNA 3FY0A 2X6EA 3KYHC 4IHJF 2R7IA 2QQ7A 1ZZLA 4ZY5A 4F08A 4QMQA 2XKFA 3TKHA 3G8DA 1RQQA 5JT2A 5CSHA 3NUXA 5EI6A 5HNBA 4U6RA 3QD4A 3UQ8A 4AA0A 4I1ZA 4OT6A 5ANDA 1R0PA 1O6YA 1RW8A 4PZ6A 5E92A 3JSLA 2YIYA 4RZVA 5CF5A 1DV2A 3R00A 4QOXA 4I41A 3AT3A 4P90A 3G0FA 4EH2A 4GLWA 1OIRA 5FG8A 4WHZA 1PXPA 3BLRA 1UVRA 2O63A 1MRVA 4ZS4A 3KGAA 2PUUA 3N6RA 2YWPA 1PK8A 2XK8A 5KKNB 4C0TA 1ST0A 1TQPA 3ZM9A 5IA5A 2I0YA 2P2IA 1JNKA 1UKHA 3RM7A 3G90X 3WF5A 4BDKA 2QONA 5T3QA 3W0SA 3CJFA 4O22A 5IQHA 2UZDA 2OXXA 3KALA 3DGKA 4LG4A 4AXEA 1IOWA 3SE7A 4WRSA 2XIXA 3HP5A 4FKVA 4MD9E 3OOGA 3TEIA 3PPJA 4M84A 4CNHA 4QTAA 1P5EA 1SNXA 2YJRA 4GCJA 3VBXA 1VYWA 1JLLB 1MRYA 2WMXA 5ETFA 5CASA 3I81A 4PX6A 3PXRA 1QPCA 4MHAA 3DK7A 2C5NA 3QQLA 4Z7HA 2C30A 4DHIB 5AX9A 2O8YA 4ZI7F 4HVIA 5BYYA 1IA9A 3A7IA 4CFNA 5C1OA 3GQLA 3M42A 5HGIA 2ZM3A 3ETJA 2IZRA 2GMXA 3CIKA 2W99B 4CKEA 4FKRA 2YM3A 3BHVA 1H1RA 4CTBA 4PP7A 4ZMFA 4FFMA 3Q2MA 5A4TA 4HNIA 1XBCA 2ZVAA 1YHWA 2J6MA 1KJQA 1DI8A 2KULA 5DLSA 3UOLA 4BCQA 4C3PA 3H9RA 2Y4RA 2GTNA 2IZSA 2IZUA 4FFLA 5IEVA 1UWHA 5BVEA 4QMMA 2R9SA 3D7TA 2EJ0A 2DABA 4DFBA 4IM0A 4C4FA 4TT7A 2BROA 2YISA 5BWXA 2VWWA 3UZRA 4BDAA 4TYHB 4I5PA 1HOWA 2ETKA 2HHFA 4DQNA 1WBNA 2H34A 4L3JA 4BKJA 2VTOA 4R5YA 5BYBA 5AP3A 2BZIB 2C6TA 3C9WA 2HY0A 2PE0A 2W0JA 4KBAA 4YJPA 1KV1A 3FKNA 1UA2A 4X3JA 1SCUB 3L2PA 3FMDA 4MX9A 4XG6A 4U5JA 3FWQA 3WZUA 4GV1A 2WQOA 1I2LA 5J2TF 5AMNA 4PNKA 3W33A 5CF6A 4FEVA 4TZRA 3CD8A 1M7NA 4YLJA 5AP1A 5DA3A 5ANGA 3KRJA 3GC9A 4QQ5A 2NRUA 5BUIA 4ASXA 3R8LA 3QQJA 4FTKA 4AP7A 1UC9A 4RWKA 2CZGA 1FBNA 1REJA 3WI6A 5HE1A 5I9XA 1JBPE 3VO3A 4EHVA 2F2UA 3RTPA 3R71A 3DZQA 2UVZA 2XIZA 3FZRA 3NR9A 3LQ3A 4MQ1A 4PL5A 3MI9A 4RFMA 3VBQA 2CGXA 4BRXA 3RM6A 5HIEA 3QA8A 5IEYA 3GJXB 3LXNA 4K33A 3D5UA 3OWJA 4IWDA 4XG2A 1YXVA 4U43A 1H01A 1ZZ2A 2PWLA 4QTDA 3HZTA 3RFCA 2BZJA 2UW9A 2FUMA 3FE3A 3MIYA 4K18A 3SRVB 1KUTA 3CS9A 2VTLA 3HDMA 4DFYA 2X4FA 2B9HA 4UB7A 4W8DA 3AXWA 1FVTA 3KULA 4OBQA 4FU0A 4X2GA 5CZHA 2YM8A 2UV2A 2UZTA 5CVHA 2OU7A 3R7YA 1TVOA 2R3OA 2XM9A 3BYUA 3BX5A 2WTJA 3ZUVA 3BQRA 2V62A 3K2LA 1E9HA 3ORNA 4FKLA 3C4ZA 5J8IA 2XNOA 2I7QA 4RIOA 4BY9E 2R7NA 3DK6A 4IFGA 3BAAA 4KD1A 2ERKA 2IJMA 3BELA 3RTXA 4H36A 2A4LA 2Z8CA 3UQCA 4ZTQA 2FB8A 1H1PA 2YAKA 1WBPA 1PXLA 4PDPA 4BIDA 4EOOA 3Q2OA 2OXDA 3IG7A 1UU8A 4LRKA 4B9DA 2XUUA 4HYHA 3EFKA 4FL2A 1F5QA 4L7SA 4CTCA 4RMZA 4P4CA 3UNKA 3FLNC 5JRQA 1UNLA 4CFWA 4MV7A 3ROYA 3W0QA 2E9NA 4ERWA 4DH5A 4FTRA 1XHAA 2CSNA 2JEDA 3FMEA 3FZSA 3PRIA 2YJSA 3HEGA 4O0SA 4UWBA 5FTOA 3GIDA 5HEZA 2QOKA 4ARKA 4HCTA 5C27A 3ORQA 3AGLA 5IQAA 2HXQA 2IVTA 5HLNA 3G51A 2XB7A 5M08A 4U3YA 4AGUA 3RV3A 5H9BA 2HCKA 2QOBA 3U9TA 3TW7A 3TW6A 2Y4IC 3C1XA 4AWIA 3QWUA 1KOAA 4YU2A 5BPHA 4QMPA 4R3PA 2W1DA 4EJ7A 4LV8A 4UWYA 3CQWA 3R7UA 5JFVA 3TDVA 5DT0A 4M15A 4AE9A 4E6AA 5T6KA 1GSAA 2YACA 2X8IA 3HMMA 5E1EA 4BGGA 2WIPA 4BCHA 4EOQA 4XP3A 4B7TA 5M57A 3QKLA 1BL6A 4JL9A 1VBHA 3B8QA 3BWFA 4YZCA 3U6JA 1VBGA 5ANIA 4AS0A 4M0JA 1PHKA 1UKIA 2W06A 3FXXA 3V5JA 1P16A 2HZ0A 3KKVA 5JSMA 5BX0A 1PXOA 4FFPA 3E3PA 2PZYA 4ALWA 2UW6A 3ZXZA 4KS8A 4QPSA 2R3NA 5I5TA 3P5KA 4ZTRA 4RIXA 4GG7A 2C0IA 4GK3A 2UW4A 3LFFA 4PUZA 4C59A 2X39A 3GLKA 3CKWA 3MN3A 4O2ZA 3R6XA 5JH7F 2WMWA 4LGHA 1URWA 3Q9YA 3IGGA 3U87A 4D4RA 4LOPA 5AX3A 3ZRKA 4FV5A 4JJRA 4DA5A 5CT0A 1OM1A 1GZKA 4PV0A 3VS3A 2BTRA 2XNEA 4ASZA 3B2TA 4FNYA 3ZH8A 1EKPA 3Q3BA 4FIIA 4USDA 1H8FA 3W8LA 2VO7A 3UZOA 4DF3A 3OG7A 5L8LA 4K6ZA 3EN4A 3Q4ZA 5DT3A 3LOKA 3ZO3A 4DRFA 4L3PA 1FVRA 3HV7A 1B6RA 2WYOA 2R86A 4HGLA 2JDSA 3SXSA 3T9TA 2GHLA 1XJDA 4UALA 3PN1A 3IO7A 4O7VA 1P14A 2DWCA 5D41A 3TMOA 3LE6A 5BMMA 4LM5A 5HX8A 2OSCA 2X5RA 2YHVA 5J7HA 5KMKA 3I60A 4S32A 1TQIA 4KS7A 2ITUA 3PLAE 4ITIA 3AMYA 4NTTA 5C01A 5L2SA 4GW8A 4NW6A 4GU9A 2YZAA 1Y8GA 1VLRA 4FV9A 2PYWA 2XAOA 5A3XA 3RAKA 1A0GA 1H0VA 5JGDA 1DAAA 1WVYA 4M13A 3VBWA 4H1MA 2J0MB 3UDTA 5AV1A 3T54A 3RNIA 3R8ZA 5E4HA 3ET7A 3F5GA 4MEDA 3H10A 2EJ2A 4GKIA 5D7VA 4ACGA 4CQEA 5LVPA 4F6SA 3BYMA 4BDGA 5CAQA 4F0FA 3CLYA 2J7TA 5D1OB 1Q3DA 4CMOA 2WTKC 2Y7JA 2W05A 3A4PA 3E64A 3F5UA 4AN3A 5LXTF 4FTNA 4ZIMA 4FSYA 2XYUA 1Y6BA 4QMUA 4P2KA 3SLSA 4QDVA 4PDOA 2UZEA 4C38A 1KV2A 3BL9A 4ALUA 3E92A 2PZ5A 4J8MA 2QI8A 2GNJA 2P0CA 4QYFA 4D2RA 5FEDA 3GOPA 4AAAA 4CFXA 2O0UA 1U54A 3KB7A 2WKMA 3K5UA 4QMSA 3ORPA 4FEXA 4R6VA 3IW5A 5CVGA 3ULIA 1VKZA 4MXYA 1CKJA 3EN7A 5C26A 4WBNF 2JBOA 4GG5A 5E8SA 3RKBA 2WU6A 2VO3A 4IWQA 5D9HA 4U97A 3DBDA 3F61A 4J95A 2XMYA 1XO2B 2ZV7A 3TNIA 3QF9A 4O83A 5BVDA 2W6NA 3WO1A 4GT3A 3KEXA 4ZSJA 2IPXA 4JIKA 4WA9A 5AUUA 5CI6A 2XJ1A 2W71A 5CI7A 5DMXA 3TACA 3AKKA 3R22A 2VRXA 3FZPA 4Z16A 4EH4A 1W7HA 2XS0A 3ZLYA 4FKQA 4N4SA 1NA7A 3IDCA 1CQJB 1JKSA 2V22A 4XS2A 5DRDA 5ANEA 3NBZB 2DWBA 4MBJA 3GCPA 3KK9A 2HY81 3RALA 4B8LA 4ID7A 3UVQA 4UCUA 4RIYA 4E6CA 3F2RA 3EL7A 3NNXA 5A54A 2LAVA 3DB8A 2QCSA 2X8EA 3RHKA 4CFFA 3FHRA 4EC8A 2XVDA 5IU2A 2REIA 4IZ5A 5JN2A 3QQGA 5CU3A 3WZKA 2IG7A 2ZMDA 1I1KA 4HGEA 1UU3A 4FSRA 2V55A 5J87A 3A8XA 3D0EA 4L52A 5HO7A 4QTCA 3W2PA 4J71A 3QHWA 3EZRA 1O6KA 3I6WA 3NUPA 3FXWA 1JQHA 2R3JA 3A60A 4DG2E 4F9BA 5JVLA 4RVLA 3CGFA 4CZUA 2QOHA 2CCIA 3LZBA 3MDYA 3NSZA 4S30A 3REPA 5HORA 1S9JA 4BB4A 4I4TF 4YBJA 4ZJJA 1YWNA 3VF8A 4D1ZA 2YRWA 3NNWA 4P7EA 4NK9A 4JBOA 4I0SA 5DWRA 4DT9A 2CCHA 4L53A 4FT5A 2XBAA 2WNTA 3CSVA 3PSDA 3R73A 4IVAA 4MNEA 2R7BA 4QPAA 2YDKA 2CLXA 2BRNA 2XKDA 2XBJA 2ITPA 3PXFA 2V7AA 4LOOA 4MKCA 4TWCA 3UODA 3ZYAA 4ZMEA 4DLKA 5FBOA 4RPVA 3OF0A 5A4LA 3Q53A 4NZNA 3R8VA 1WAKA 3A4OX 2IVUA 4LGGA 2W6OA 4BCOA 3ORRA 4BCNA 3O50A 4GLXA 2Q2TA 2J50A 3HAVA 4HVDA 4H39A 3RVGA 5B2KA 2CGWA 2XKCA 3HA6A 2BAJA 4N57A 5C1QB 2HZIA 3A7HA 3QKMA 4AOIA 4GUEA 5BWUA 3EH9A 1P8LA 2YIWA 3ZRMA 3TDWA 2PN1A 2EVAA 4H1JA 4BDBA 3UOHA 4BC6A 4C34A 2ITOA 2R87A 1U5RA 4CZTA 5EZYF 2XJ2A 3PJCA 4O7TA 4FZAB 2VWIA 4D1SA 4V05A 3ZBXA 2O5KA 1PF8A 4AZVA 1Z57A 3OWPA 2EU9A 3A61A 2YM5A 1SM2A 2AEGA 3MFTA 1M2RA 2IVVA 4EEQA 3OUNB 5D1JA 3R9OA 4W8EA 2PPQA 4RWIA 4F09A 4YZNA 3F66A 2VWUA 3LM5A 3D4QA 1CS0A 3PWDA 5E8XA 2OG8A 1OIUA 3HDNA 5IH6A 1H28A 2IZTA 3DOGA 4EQMA 4AA4A 1BUHA 3TY9A 3ROCA 5E7RA 1KBLA 3G0EA 2F2CB 4MV3A 4GH2A 4I5CA 4DAWA 1RE8A 3OOMA 5FDXA 3AC2A 1G8JA 4K1BA 1V0OA 1E1VA 4KUJA 3QCYA 4BHNA 3UZTA 3T7AA 3UNZA 1CKMA 3RNYA 3TQTA 3KXMA 4M12A 2BFXA 4DLIA 2R2PA 5LVOA 5LQFA 2UVXA 3EYGA 3M2WA 4QP7A 3DDQA 3G15A 1R0EA 4NH1A 3QXPA 2EXCX 2PVPA 1PXNA 2PVJA 2BRBA 1H27A 2Q83A 2JIUA 2CNVA 2R64A 3P79A 3KRXA 4IAZA 4IC8A 5EI2A 3ORMA 4JNWA 5KE0A 1DV1A 3DAAA 3HV4A 5IQGA 3NIZA 5JFWA 3UNJA 2OF4A 4E4LA 2F7EE 5BVOA 4YGAA 3S0OA 4XUFA 4UFZA 4MTAA 2HGWA 4YZ9A 1TAEA 4O21A 3B8RA 1S68A 3UOKA 5EHYA 3UC4A 4FV7A 3GC0A 5CY3A 3ACJA 3HMOA 1IYDA 5EYKA 4IVBA 3MGYA 3HMNA 2BCJA 4YTIA 5EDRA 5M4FA 2VV9A 3V3VA 4HNTA 4RZWA 5CF8A 2I1MA 3CGOA 4XG7A 4NJDA 4EL9A 3DK3A 4DH8A 4TY1A 4AW2A 3NAYA 4IADA 1PXIA 2YRXA 1IASA 1GIJA 2ZM1A 3BZ3A 3NIEA 3Q52A 4RA5A 3POZA 4D0XA 1ZYLA 1OIYA 2WTKB 4LMUA 4U80A 2R3HA 4MAOA 5CNNA 3QZIA 3WZEA 4AZEA 5IUHA 3VNNA 3ZUTA 3AKLA 4BCKA 5FBNC 4E1ZA 2WO6A 4J97A 4LYNA 4EOPA 4GMYA 3OCGA 2YZNA 3SGIA 3W1GA 4E5AX 2J0LA 3KF4A 5G1XA 4EOSA 3R8PA 4BZOA 2XIYA 5HLWA 3KIOC 3FQSA 4L43A 3P23A 4CGAA 5M56A 4FKJA 3CQEA 3FLWA 1KOBA 2XK7A 3COIA 3JVSA 5A46A 4XX0B 4FFRA 2F9GA 3LCTA 2JKOA 4FVPA 4ZEGA 4LQMA 1IA8A 5B7VA 4RJ3A 4LRMA 1XQZA 3E8EA 4R7IA 5CAPA 4NZWB 3UO4A 4UCVA 3GCVA 2O65A 2YN8A 2EXMA 4MXCA 2X2LA 4GK2A 4RFZA 3IK3A 4FG9A 5AUTA 3BG5A 4TNDA 2FSLX 2X7OA 2IW6A 2ZV2A 3F5XA 1X8BA 2H8HA 3VBYA 2HXLA 5BV3A 1OL6A 2PUIA 3A8WA 4WKQA 4F0IA 4M9UA 5EHOA 2DYLA 4IWPA 4IB5A 4QMNA 3LP8A 5EDPA 3MPTA 4ANMA 2B0QA 3ZXTA 1E1XA 1FGIA 2BDFA 3A99A 5AP2A 3U8WA 3QTQA 3R7IA 4GS6A 3NS9A 2CPKE 3QX2A 3R9DA 2C5OA 1PYXA 4I55F 1PJKA 2QU6A 3O0GA 3G8CA 2YITA 4BIEA 3CCNA 4I6HA 4GFOA 1X9NA 2O3PA 4DC2A 3UQFA 2C6KA 1VZOA 2OZAB 1B6SA 4O4LF 5CXHA 3GT8A 5I5UA 3UMWA 1ET0A 4O0XA 3R7EA 5K4IA 4FI1A 5EM5A 3AC1A 4YPSA 2C69A 4BZDA 4XG4A 3PFFA 2W1ZA 1G3NA 1OL2A 2OJGA 3EOCA 1XBAA 4I94A 4IE9A 4M0YA 3ZDUA 4AT5A 4Y8DA 5IDNA 2V58A 4HVHA 2YZMA 4EH9A 4IAAA 3TIZA 1J7UA 3R21A 2YAAA 4L68A 5FP6A 5HIDA 1CM8A 3LCSA 4AX8A 4RCNA 3ZONA 4CVAA 4O96A 1EZ1A 1YXSA 3C5UA 2NRYA 1KJIA 3KXHA 3R5HA 3V4ZA 1DGSA 3ZS5A 3OS3A 5CU2A 1JKJB 1T45A 3FZTA 4Y83A 1KT8A 2WMAA 2R3KA 5FEQA 1AQ1A 5IA4A 4G3DA 3OBJA 2X7FA 3C5IA 3CD3A 2BALA 2BZHB 3FQHA 4O4HF 3QYWA 2C6DA 3MFSA 1OKWA 1XMLA 4RC2A 3BE9A 3MY5A 5LOVF 1FINA 4WUNA 4YZDA 1A06A 1VYZA 5DHJA 4OTIA 4PMPA 3LMGA 4FIJA 4BDFA 3A62A 3AD4A 5HIBA 1XH7A 3E63A 4PZ8A 2PTKA 3ATSA 4P5ZA 4BVUA 3IDBA 4ZP5A 2YCQA 4KRCA 3IQ7A 3DNEA 4B0GA 5KBRA 4JBQA 4EWQA 3QLGA 4UEUA 2FA2A 4O0VA 3BLAA 3UJGA 3QAME 2BFYA 2PHKA 4BCMA 2FPGB 3V51A 2VZ6A 4QP4A 2EIYA 3JZFA 1CKPA 3UVRA 4QQTA 1H00A 1WMKA 4GL9A 2ZM4A 4GVAA 5GIOE 3OMVA 3LULA 2XAMA 3FL4A 4G6NA 5LARA 4CT2A 2WQBA 3KQ7A 4BCJA 1RDQE 1JLUE 4FL1A 1W8CA 3RPVA 4YSJA 3UOJA 2XNPA 4X2KA 4D4SA 4UY9A 3L9MA 2BZKB 5GHVA 4YSMA 3T9BA 3MVMA 3UPXA 2HELA 3ORKA 2C6OA 5JQ5A 2OLCA 4GJ3A 4MWHA 2VX3A 4BDHA 3F7WA 1WVXA 4KBKA 4UWCA 4C3RA 4DBNA 2HZ4A 4F9CA 5J1WA 5IQBA 4KABA 2Y4IB 3DPKA 4M7IA 4RIYB 5M4CA 3PG1A 3VONA 2PE1A 2ITWA 2W7XA 3U4WA 3AGMA 3DBEA 5E8WA 2QC6A 5TF9A 4AW1A 4ZK5A 3SGCA 4KSPA 2C4GA 5AA9A 3RP9A 5HTBA 2IW8A 4TNBA 4TVIA 2KTYA 3DQWA 5G6VA 3NAXA 4FKWA 1NXKA 5L6OA 3G9LX 3HNGA 2XD4A 5AUWA 3FPMA 4XG3A 3AX6A 1R78A 4C4EA 1YQJA 4IX4A 1STCE 5FM3A 3TZ7A 3DNDA 4QMVA 5HVJA 2HJWA 2VTRA 2C00A 4TWNA 3KAJA 3VAPA 4O2AF 4R77A 4V04A 4CV8A 5I4NA 3CJGA 3AT4A 3UYTA 2QOLA 2CMWA 2PVKA 3PJ8A 4CFMA 4E26A 4MUQA 2GS7A 1WFCA 4IHPA 2YL2A 4W4VA 5IA1A 2UW8A 1FVVA 4FGRA 3ZFXA 5IG1A 5IH4A 4NSTA 4O38A 5KBQA 1V0BA 3DJ7A 4I93A 3ZZEA 4BCIA 1HCKA 3SX9A 3VNTA 4R78A 4OTQA 3ATTA 2YZLA 2OWBA 3Q4UA 4IJ9A 3LLAA 4WNKA 3DY7A 5IUGA 3MA3A 4D55A 4WG3A 3PIXA 3ODZX 1I7LA 2WTCA 3CEBA 4TPTA 4X21A 5HX6A 3VF9A 4DHFA 3OWLA 4E6DA 4ENXA 2HIXA 4RX7A 3W0NA 1XBBA 5BQ0A 2HDKA 2YS7A 1GZ8A 3I4BA 5JFXA 3PP1A 1MQBA 4DN5A 3CE3A 2PUNA 2VWBA 4F70A