1PX2A

Crystal structure of rat synapsin i c domain complexed to ca.atp (form 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
294
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTWKLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Synapsin I
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 89
structure length 294
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1px2A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1px2A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1px2A02
2PVPA 1DIKA 2W6PA 2YS6A 4O84A 4YAKB 4M9UA 4O4IF 4IIJF 3U55A 4NYEA 2W6QA 3VPDA 5BPHA 1IOVA 4O2BF 2W6OA 1Z2NX 2VQDA 3BG5A 4IWYA 1DV1A 4O81A 2V5AA 3LWBA 4ZHQF 1ULZA 4YB8B 2W6ZA 2HJWA 4FFNA 3G8DA 1PK8A 3KREA 4XYLB 5EZYF 4EGQA 4FFOA 5FNVF 4YJ2F 1EUCB 3ETJA 5KKNB 2R87A 3K5IA 1Z2OX 2GQRA 1BNCA 3RUPA 3KALA 4MAMA 4C5CA 2NU6B 4MA0A 4FU0A 1M6VA 3RV3A 3BSWA 4O7NA 1JDEA 2ZDGA 4MV3A 1C30A 4O86A 4I55F 4MV7A 2ZDHA 2CQYA 2HGSA 4O7YA 4EGJA 5CB4F 2FP4B 2VHEA 3R9RA 2YZNA 2R6FA 4O7ZA 4M9CA 1EZ1A 3U54A 1KJIA 4O83A 1KBLA 4O7WA 4O7TA 5JVDF 1KC7A 1KJ9A 5LP6F 1M0WA 1B6RA 4MV6A 3NUAA 5JQWA 2R84A 3OUUA 2X0SA 4C5BA 4EAAA 3K3PA 2I80A 1VBHA 4FFRA 1EHIA 5CA1F 4O7VA 2DLNA 3HBLA 5CA0F 3QFFA 3BSYA 3GIDA 3WO0A 4DLKA 3V4ZA 3KAKA 5JH7F 3K5HA 1CS0A 4FGRA 1JKJB 3HO8A 4XZ3B 2DIKA 4FE2A 4ME6A 1EUDB 1GGOA 2WYOA 3U9TA 2I87A 3MWEA 4YBZB 3V4SA 1KJQA 1DV2A 1EYZA 2R7MA 2GPWA 4IZOA 5DMXA 2QK4A 2ZDQA 5BMVF 3MJFA 4HNTA 4QSHA 2YZMA 1VKZA 3OUZA 3G8CA 4O82A 4O2AF 4O4JF 3R5XA 4EA9A 4RZQA 4MV4A 4MV9A 1GSAA 1A48A 3TIGA 2R7LA 3ETHA 4HR7A 1OBDA 2DZDA 4L1KA 2YZLA 2VPQA 1B6SA 1I7LA 1AUXA 4O4LF 3VPCA 4WD3A 3MWDA 3TIIA 1A9XA 5H80A 4I4TF 1M0TA 2R86A 4TV9F 4E4TA 1GLVA 3I12A 5J2UF 1KUTA 3TINA 3E5NA 4EA8A 2DWCA 2R7KA 4HNVA 3GLKA 3KAJA 2XD4A 3AX6A 4FFMA 2SCUB 1OBGA 3VA7A 2OLSA 5IYZF 2V58A 5GONF 1SCUB 1E4EB 2CNUA 5D8DA 2Z02A 2GLTA 5C8YF 4XYMB 3R5HA 4O7RA 4ZQIA 5BPFA 4YJ3F 2YRWA 3R23A 4HQ6A 1PX2A 3ORRA 2NUAB 5I47A 3Q2OA 2Z04A 1GSOA 2YYAA 2R85A 4C5AA 2CNVA 4TUYF 2NU8B 2I8CA 2P0AA 1IOWA 3BFPA 4HNUA 4EG0A 3JRXA 3Q1KA 5LYJF 3AW8A 3VPBA 5JVLA 3VMMA 2J9GA 4O4HF 2R82A 4FFPA 4Y8VB 4ZOLF 1AUVA 2IP4A 2PBZA 5C1PA 1I7NA 4XX0B 4IHJF 4YAJB 2V59A 5K2MA 2YW2A 4MV8A 1WR2A 2FPGB 5LXTF 3JZFA 3N8DA 2CZGA 1W96A 1KEEA 2W70A 4EABA 4FFLA 3UFXB 1T36A 2YWVA 2NU9B 5C1OA 1KJ8A 1KJJA 3HB9A 2YL2A 3LP8A 3RV4A 1C3OA 4WBNF 1UC9A 1CQJB 2YS7A 5LA6F 1JLLB 3ORQA 1W93A 2C00A 2W6MA 2NPOA 4ZI7F 5KX5F 1VBGA 4TV8F 5J2TF 1E4EA 5HBRB 3RFCA 4DIMA 1JDBB 3SE7A 5HV6A 1CQIB 3TQTA 2FPPB 4GGMX 2FB9A 2GQSA 3JZIA 5JQGF 4M98A 3DF7A 1GSHA 2YRXA 5CAEB 4IWXA 3R5FA 3WNZA 3BSSA 2XCLA 2VR1A 3JRWA 3VOTA 3N6RA 2NU7B 1BXRA 2FPIB 2W6NA 4MV1A 5LOVF 4EA7A 4MA5A 2CNQA 2GPSA 2YZGA 3U9SA 1Z2PX 4J6EA 2R7NA 1UC8A 1CE8A 4I50F 4O7LA 3TW6A 2QF7A 3WO1A 2PN1A 4M99A 2W71A 4O7SA
chains in the Genus database with same CATH superfamily
2WJ3A 3LT5A 2FOLA 3L7CA 1COWA 2HDHA 1PDWA 4Q6WA 5DTIA 1CRWG 1JE0A 1FYEA 1ODCA 4X6LA 2RKWA 2FEAA 4P83A 3H6GA 1S2OA 1EVJA 2GD2A 3U3JA 1TAUA 1EVEA 2WP0A 3CSDA 5JJKA 3VNQA 2FSUA 5F9FA 1L2TA 1T24A 5EJ9A 2QQGA 2WJAA 4WNYA 2BBSA 5HUQA 3C8UA 3K35A 3EYYA 1KXZA 4CN9A 3GDGA 4M1OA 4CEIB 5JMPA 2AE2A 1W5AA 1F5NA 1FLNA 1M8PA 1AQUA 1RIFA 1WD5A 4JCOA 1XT6A 4YIKA 1T9GR 1CEXA 3JXEA 4C78A 1ZHQA 2Q6LA 2VDOB 2Z4RA 1DIHA 1KS9A 1DTWA 5CLIA 3W9YA 3RKUA 1E69A 2G07A 4ETIA 4BNNA 3JWGA 4L07A 1KYVA 4D9KA 4BV8A 3Q8XB 1DUVG 2MINB 4UE6A 5FOWA 3DSRA 1MV5A 3UQYS 2VYQA 4CLOB 2VTBB 4UHJA 1DAEA 2WILA 1VIMA 4FGWA 2WB2A 3ZX5A 3LVRE 2BMDA 1HKUA 4JDUA 5L4SA 3E82A 1AUQA 1E9AA 2HF7A 4G5XA 5FEMA 3A4VA 1TDJA 4HGRA 4I55B 4H6XA 4UZEA 3JQ9C 3RADC 1W5FA 2M98A 1V3TA 5DHRA 2NX2A 3O31A 2EZ8A 3EPIA 1G1MA 4ZMRA 3OA0A 3SR0A 4NXMH 3MGAA 2DHDA 2QVGA 4OH1A 1Y7IA 2EP8A 4JYBA 1XEXA 4JLVA 4FBMA 2RG7A 3M8KA 3C5VA 3GJ0A 3ZCXA 4X7RA 4AJEA 4RAOA 2VAVA 5CDYA 2ZSEA 2WC1A 3CLRD 1TWFA 4RNOA 1P75A 3BA1A 2WOJA 2O03A 1JECA 3F90A 4MR9B 4MW7A 4Y2JA 2REXB 1JR3D 5JH7B 2YY6A 2OWEA 3N8IA 3FR8A 2ORWA 1L7MA 3VA7A 3U1VA 4O6VA 3PZPA 1GU7A 2RGNC 1L9KA 4WN3A 5KT7A 1R4NB 1E1CA 1TMGE 3SEAA 3EA4A 1HG1A 3PR1A 3SVZA 3T99A 2HK8A 5FJIA 4G4SO 4CCWA 4D4MA 2CXQA 2KJQA 1QPBA 1BGXT 3WE7A 1KYIA 3WLOA 1JAXA 3AC0A 4FWBA 2B92A 3SS8A 1GPJA 1NW4A 3W5BA 1EAYA 2R82A 4JUIA 3GILA 3U80A 1OLUB 2X1MA 4DLRA 1DIRA 3NTXA 1NUPA 4E70A 1T3NA 2B8EA 1KSGA 4TKVA 3PI6A 1D8AA 3V8PA 5ER9A 1RZVA 1HDZA 1QJCA 1U5AA 2I54A 2FPGB 1II8A 5WRFA 1SK9A 2XMZA 2EW8A 1JIIA 3Q3GE 3WBJA 1A3GA 5FV4A 1TT7A 5DNEA 3LUBA 2BFFA 5J4HA 2DFVA 4MUJA 3AERA 2R2GA 3ONVA 2RIRA 2JIMA 4ZQGA 4ZVSA 4CTJA 1UBHS 4PIPA 1PFQA 4JU9A 1UM9B 5FHQA 5DCLA 3G79A 4MQ4A 1ZBDA 1D7AA 4FILA 4DCSA 2O2GA 5JCZA 3R5FA 1IOZA 4GPEA 2ZB4A 3IAM1 1FQWA 1NI4B 1U8TA 3NBXX 4YRGA 1Z0UA 3I04M 4O4LA 4JLJA 5AK0A 4BNWA 3TQHA 4R05A 3ZE6A 3FKJA 3N2GB 2R7NA 2Y68A 5AKJA 3KHUA 3ZXXA 2Q4EA 4QBKA 1ZM9A 1GDHA 3G9ZA 2HMUA 1ULUA 3OJXA 4DBVO 2X22A 2XNKA 1KU6A 5CX4A 4BNYA 1G7CA 1VP3A 3UF0A 3GQCA 2WT8A 1NRJB 3WWPA 2W6ZA 5KWEA 4X93A 4O3PA 2I7CA 4WK0B 1K89A 2J6BA 1KP3A 5EZYF 2AW3A 3C3JA 1SXJC 2R1VB 2YHUA 4CGZA 1U9JA 4ER5A 1EFCA 3HL4A 2N1BA 4A0FA 3IP9A 4KWIA 2X9LA 4UHHA 3BIOA 3UQ8A 5INTA 5E2AA 1YB5A 3QUQA 1IQPA 2C8KA 2YJNA 5ARDA 3T4PA 2VP6A 3DFKA 2XT6A 3PRHA 1EP1B 4KQJA 1V96A 1GKUB 5F5LA 4YPFA 1L7OA 4PHFA 1U9CA 4CV2A 4RZSA 2R6FA 4GG1A 2V74B 5DMHA 1P77A 4FCTA 4N5MA 1YDGA 1WTCA 1NDQA 1ZH4A 3AEKA 4P4SA 1V35A 5LMNB 3IVGA 4EY5A 2AFHA 2E1PA 1Y1VG 2PRSA 4PZAA 3ZV3A 5EIFA 4BMVA 1P16A 1XJ5A 3L4BC 3E9YA 2W22A 4MROA 1WTAA 4EW3A 3V4ZA 4EJ6A 4RELA 1SG0A 1C9EA 4NNOA 3R3YA 4LOLA 4K6GA 2FSIA 4J7XA 2VYFA 2QIPA 5KFSA 2QTWB 2P2ZA 1N2CB 2II6A 3NP9A 5FUBA 3N8NA 2SKCA 3FTPA 1L1FA 1I50A 2P9HA 1TWHA 1F6WA 2DYKA 2HCBA 2FX3A 3EGIA 3GIMA 5EC8A 4LTDA 2DU8A 2JIRA 3LUFA 2P5UA 3KBOA 5DLFA 1W2WB 1FFYA 1HYQA 4W8HA 1N8SA 1RM3A 2IQ5A 2WWTA 1EK6A 2XQFA 1ODJA 2FJPA 1HY3A 1BCSA 1NR1A 3P2JA 3SHWA 4FEYA 2ZWPA 4TZTA 4DC0A 2R7KA 1XHLA 3JX9A 5IDVA 1FXSA 4E2YA 1H1TA 1NGSA 3DAYA 5LQUA 2VBGA 3WGUA 1RRVA 4D26A 3AUAA 4EHKA 4QUJA 5CVEA 1Z5OA 2MTBA 3HCEA 4NS4A 3O2JA 4RZ2A 1VPEA 1BRMA 1L6RA 1E9FA 1EFVB 3GUCA 5FLKA 2Z6UA 1WDTA 3OQNA 3CSWA 1PGQA 1VOTA 1TQ8A 4OEHA 5ICFA 3X2EA 1KU0A 1B8OA 3WLRA 3GUUA 5I7HA 3K20A 2VWPA 4J2TA 1WB6A 5A0VA 1JHQA 5DKFA 3NHYA 4CKBA 1QQAA 4MCIA 1XLTA 1NBME 2PM8A 4D4JA 5I3CA 4QAQA 2AQIA 3CZ9A 2CKZB 1AZWA 3QF4A 1QIIA 4PAMA 2HQBA 2HK7A 4E07A 1O97C 1QVWA 3TLXA 3BIJA 2NTEA 3WMEA 2ZJOA 5JHHB 3TTTA 1UMKA 5BNZA 5KNDA 2C03A 1O94D 1OD6A 1IZ9A 1DAHA 3OLXA 1OWTA 1K8ZB 4DLAA 1PD1A 2FZWA 5T64A 4TMXA 3F6EX 4O29A 4JQZA 3ZG6A 4B3XA 5HTKA 3GGJA 3D8RA 5IAKA 1O8BA 3L8YA 4B6SA 5KU1A 5KFAA 3Q9SA 4A3LG 4WMLA 3DLBA 2IW3A 3AY0A 2A84A 3D1JA 4L5AA 3U19A 3R4CA 3UMMA 4X71A 4ZOLB 3PGXA 1P17A 3TWOA 5FI0B 2OAQ1 1I1OA 1IIBA 5UKDA 4FN5A 2XF8A 2CD7A 4PG4A 3P97A 5J23A 4KQEA 4CKCA 3PGA1 1XDGA 2VQ3A 4DYVA 2BGLA 5K0SA 3ZBTA 2ZS7A 4X95A 3EG9A 1I1LA 3H11B 3RIXA 1OT5A 4B3DA 3UKJA 3VKFA 1N8TA 2W2NA 4BQEA 4OF4A 3DHNA 5FB3A 4N0PA 5IYZA 2GVZC 3T6KA 4CM5A 4ZAVA 1HDEA 1FVIA 5AI8A 3HZZA 1V1MB 4BMSA 1M1YE 2FW1A 4NENB 2XUIA 2HHFA 3NX4A 2XGQA 3GFPA 3RB8A 2JGAA 1GRQA 2A5GA 2WUDA 4H1TA 3JQFA 4FYHA 4IXMA 2A9QA 4GW3A 3DLCA 4NJOA 2CXXA 1NBEA 3PQ2A 4J0IA 3H1EA 1CZNA 2OLEA 2JA2A 2QRQA 1R50A 1EVKA 1FDOA 1H1LB 1E3EA 1V0JA 4OKNA 2RGVA 3ER9A 4LWZA 3F5QA 4NH0A 2G3YA 3UA4A 4WVLA 1A9TA 5BWWA 3GUYA 2I3AA 3CLTD 3INRA 1RWXA 2ZJTA 3H0KA 4F3TA 2QAGB 4PLYA 3RJZA 1NATA 2A1UA 3CLVA 3SN6A 4XVCA 2E55A 3OD1A 1KBQA 1BXGB 1T0UA 2YFKA 5AUNB 2V7GA 3PUZA 4G0OA 1UJBA 3F7OA 3NVKI 4ALMA 1ZSYA 3OQBA 1S9DA 1HC7A 3NP7A 4KJZA 2CSUA 4PQYA 5LA6B 1L7PA 1YJCA 4E1BA 3JD4A 4IIDA 2BGJA 1ZGBA 1MG0A 4LF6B 1G8PA 3PGKA 1FC0A 1P2UA 4JUBA 4EW1A 3MS4A 2X40A 3B7WA 4R8RA 1SUPA 2XE4A 3DAGA 1E2BA 4MVJH 5P21A 4N3NA 1DO8A 3EASA 5IC5A 3MN1A 5LNK6 3M4JA 3RYTC 2MSCB 3DWFA 5DM70 1BKSB 1WSDA 1CKOA 3BE4A 1ZUIA 4E4TA 2RI1A 4KNWA 1U7WA 2EZ9A 2YQ5A 2VUMA 2VJQA 4D82A 3TINA 4NLLA 3EMBA 2CFRA 1IDOA 3KAJA 4PPFA 1OBGA 3BH0A 4IM7A 2YOHA 5DCYA 3OLYA 4F60A 1Y7LA 1QH1A 3NBFA 1ISPA 1ZSVA 3USZA 1AHIA 2FHPA 1C2YA 4EI7A 1BEUB 2JCVA 1HE4A 3AHCA 2PMFA 1P1FA 4NDZA 3G3EA 1STOA 2VTDA 4ZT3A 1UFQA 5BWTA 4X97A 4DNQA 1N0UA 4YMUA 4QJBA 5DLYA 1SURA 1LLCA 3MGKA 2ZE7A 3WWYA 3OTHA 5EERA 4JKIA 1O3YA 2I33A 2QSYA 1R5JA 2AG0A 1EXMA 5LQRA 4DNXA 5I7EA 4XQGA 4KXQA 3PIDA 1DC4A 4Q01A 1T9GS 3F97A 1Z28A 4WZBB 2DFPA 5TLSA 4PLFA 1N1DA 1P73A 2E6UX 2H4FA 2VJBA 2YW2A 2J0UB 2JFUA 5CR9A 3LX5A 3R9WA 4HWOA 3KEFA 3SOPA 3ADBA 1WXFA 1NXVA 3VSDA 4Q1DA 2YS7A 2R00A 1JG7A 1C29B 4FBTA 2XA2A 3F6BX 3OZUA 4TV8F 1M1XB 2NZXA 4C20A 3TNLA 3IP7A 4B84A 4NCJA 1QIKA 4MYHA 2GQSA 1RZ3A 3L7IA 4KBYA 1LJUA 4KQ2A 4MYUA 1GZHB 4U02A 4RFSB 2VJCA 3A9TA 4IQ8A 4D9IA 2X9VA 2QGFA 3AWDA 1SR8A 2FEXA 4C6HA 3LP5A 1UOPA 2HF9A 4M38A 1DCMA 2H2DA 3F7NA 2CVOA 3WLTA 4MVJG 3I4MG 4ZZ2A 4BO2A 3ZWMA 2PX4A 4Q3BA 1RXVA 4JJ6A 4TYMA 1CG6A 3HS3A 1K97A 5B6IA 2XR1A 1U8UA 4YR2A 4NCAA 4TV9B 2V7VA 1Z4IA 4F9FA 4ND5A 3VPDA 3X2SA 4JOCA 3O4IA 2ENWA 4K86A 1WCMA 3Q8MA 5DWVA 5B12A 1MQ8B 4HVAA 4JLOA 4RMIA 5KFYA 2WIKA 1YBMA 4KPGA 1XTSA 4LTNA 3B1FA 4F4DA 4MQEB 3WYGA 2YWXA 5EJMA 1I7SB 1WKVA 2PFKA 4FLFA 4JXXA 4B4WA 1JEAA 1LS1A 1JPUA 3BDVA 3PTLA 1JHVA 3HXQA 3AR5A 1XTPA 3OBIA 4PVCA 4RHTA 3VR3A 1TYBE 1FEZA 1G8JA 1ODFA 4ZCMA 2UYHA 1D07A 2FFBA 1ENYA 3KE9A 4ZK6A 1Z4LA 1SULA 2C29D 3EIQA 4NMMA 5LXTA 1A5BB 3TQRA 1RRMA 2FRVA 1PL7A 4MS1A 1P72A 1Z5GA 2CF5A 4Q9IA 4A6XA 2BQRA 3WKEA 3I8XA 3GBPA 4LJAA 1WZ2A 2COIA 1ZOPA 1RPNA 3DBVO 1J6UA 2WAQA 2EF1A 1I7DA 2VRWA 3DGFC 5EIHA 1KK2A 1VPDA 4NMXB 2QN7A 4C7OA 4O63O 3NDIA 1J21A 5JQGA 3KEQA 4N12A 1WABA 5BSFA 3R3ZA 3ANNA 2BFDB 2DIKA 3RB6A 4ZJZA 2WB1E 1K4MA 5JPDA 4O3RA 4D9NA 3O5AA 3FMIA 4A15A 5IVPA 4YMIA 1ZESA 4U9IS 1ODKA 4BDSA 4YCDA 1O58A 1T0JB 3THYB 4WDRA 4B6OA 1DCKA 4R9VA 1VKZA 5K03A 4XCXA 3S70A 4KFTA 4EPVA 2IE0A 3EAQA 1D04A 1NURA 2IU6A 3FYCA 2IV7A 1VLQA 3CNQS 4ABTA 4URZR 3W0LB 4CQLA 1E79D 3H83A 3OZXA 1WQ4A 3S81A 2WY2D 3DTVB 4TSKA 1BWSA 2P9ZA 1QB8A 3CVZA 2Z43A 3O8CA 1M34B 3WP0A 1HQYE 3KVVA 3N5KA 3DMHA 1PK9A 4GWGA 4H6WA 3E61A 2QYSA 4RIHA 1K4YA 1K83A 4KVGA 3DZKA 5IF9A 2BJWA 3P5SA 4D0RA 2XQIA 3CF4A 3RT7A 2X3YA 1K1EA 3MJVA 3U48A 1AKWA 4QQ8A 5L1KA 1A4IA 3R3JA 5A3VA 4KNYA 3BGIA 4CL3A 4LRYA 3FN4A 3T5CA 3OMWA 4IFBA 2Z08A 1CUYA 1V41E 4FUTA 1PJTA 4AQ7A 1IXRC 1IHYA 2IEYA 1C2TA 1H2ZA 1E2NA 2IKQA 3EZ6A 1H5UA 5FWDA 1MHTA 1XNRB 2MMCA 1NVVQ 1UNNC 3BXZA 3OECA 1IXYA 5GVRA 1EFKA 4R7RA 5JZBA 2YJTD 1Q2XA 4Q44A 5CA0A 4XJVA 5AMXA 1YFLA 4ZCRA 1ID1A 4ENQA 1UAAA 2BFNA 2JFXA 1NPYA 5BT9A 1PQUA 2FSPA 2VT7A 1ZZEA 1F3LA 3CXRA 3CY6A 2YZ7A 3PK0A 3TAUA 1RZRA 4UM9D 3EGDA 2OXEA 3HHPA 4HX2A 2Z2ZA 1FDRA 3W5IA 2G67A 3BMOA 1TAEA 1V25A 1MEOA 3AHJA 2CNOA 4O4HB 1G16A 3HOVG 4CU5A 1YR8A 5KVQA 3VR2D 2I6XA 2V96A 3TN7A 3A31A 2ZTHA 1E5XA 4LSWA 1JA1A 4BB5A 3FTFA 1R4ZA 1P0FA 3DJFA 2Y77A 4Y30A 1PGJA 1CKEA 4DBZA 5K0FA 2EBHX 5IAEA 2I3ZA 1BJRE 1FY2A 2IWRA 4EK9A 3ROEA 1Q50A 5DGAA 3PQEA 3R0QA 1WVGA 1QFSA 1VLLA 5CLQA 3BGVA 5LMNH 3O3OB 4QXMA 5EWMB 3EFEA 3WRYA 4LZNA 4GEGA 1OMOA 3K2EA 2GHTA 2D5AA 4TXJA 1R8QA 4OQLA 3WA7A 1RXUA 2WG1A 2EKPA 4XQCA 4P34A 3DYVA 5BSTA 1XSEA 3UN1A 2RH4A 4TPKA 1THTA 3GVHA 4WINA 2G17A 2CB9A 3KYCA 1A82A 5EY5B 1QZUA 1X7YB 2PLRA 1KWGA 4R8MA 3GYGA 2JGLA 2ZIVB 1U2DC 4W9NA 1DHRA 3SHQA 4GI7A 2QE7D 3N2KA 4WVFA 3LA8A 5A04A 1J23A 1FUUA 2NO1A 4PBSA 4IOLA 4B32A 4HAYA 3A36A 4V3BA 4Y2PA 5DN9A 1X1RA 1K0UA 2FW8A 3W3AD 4RIIA 1FSSA 1D5WA 2AC4A 2NM0A 4N7RA 2VQSA 4CG0A 4YQEA 4CQMB 5AW8A 4MKRA 2ODBA 3OCZA 5EPUA 4Z9YA 5IS2A 4R2MA 2Q5JA 2WU1A 5CA1F 2W2KB 3UB2A 3Q8LA 1XOIA 1EUDA 2Q6KA 4UHEA 1NZFA 4L50A 1EX1A 1ISGA 3G7UA 1YBHA 3WTBA 2H11A 1CS0A 1AB5A 2AJDA 3JTEA 1XPOA 2GRAA 5JNSA 4NE2A 4NAVA 2V98A 4J91A 5HEKA 2NXCA 4G0WA 2ZBGA 4QG7A 3VKVA 2WAXA 2JAXA 1REQA 3C3YA 5JZ9A 2VYND 3UUGA 1WS6A 5EPEA 5J58A 2ODEA 4QEKA 3BHJA 1KAOA 5BUZA 5EE5B 1J09A 1RQ7A 2Z1DA 4RDCA 1SIOA 1KDRA 2HHHB 3RWOA 3MMZA 2XBMA 3MT9A 1YR3A 3LPAA 3IAFA 2X13A 2CMHA 1XHFA 2FP4A 2WD9A 1O7JA 2F55A 1SQSA 2JGIA 1A97A 3OEED 2YQZA 3ORFA 3B1WA 1BQEA 1KUTA 1R37A 1Z63A 4PZ0A 1V8ZA 5FWNA 3GOHA 4DWVA 2XD4A 4B7XA 4Q34A 3N05A 5B3AA 1YR6A 3M83A 1BXKA 1Y4SA 3RC9A 2W9BA 4QOGA 1H0KA 3TOCA 4REMA 4IH9A 3I83A 4OBXA 5L40A 5BPFA 3IKMB 1DOAA 4BNXA 2VZ8A 4CKZA 1TAGA 4CUZA 3MJTA 3DF9A 4H59A 4L8VA 2CYBA 3ZUPA 4LQCA 1Y1LA 2WJZB 2GFIA 1U6JA 4ED6A 2NUPB 4OI2A 1NUSA 2JVIA 4FMCB 2O4UX 4F4YA 2GA8A 2PV7A 2QQ0A 3BORA 3KYHC 4D9MA 3PR4A 2JA5A 3AVYA 2ZKLA 3LUGA 3Q3EA 4RJ2A 1YWGO 3ICVA 3ZQJA 3G0HA 1Y3AA 5ALYA 1ULBA 3SC4A 2R8JA 2NADA 3T5AA 3KTDA 4TXLA 2UU9B 5DASA 4EITA 1R16A 3HJBA 3QVUA 4XUDA 1OLSB 4F91B 4N41A 5KFTA 4OXNA 1TVCA 3H7AA 1R0SA 2NO5A 4HSGA 1E2DA 4AB1A 4D46A 2CB0A 3D02A 1W1IA 2ZTUA 4RPJA 5JLAA 2DUJA 1PP4A 4LYGA 1QYDA 4NE9A 4LV6A 1QRDA 4CL2A 1CVIA 3A4NA 3I62A 1IN1A 1LDYA 2JIOA 1GPDG 3DTGA 2WWHA 3CTMA 1HE2A 1KHTA 1NNLA 3ZK7A 2D1TA 4NYIR 1SU7A 1DIAA 2B2CA 5FOXA 4DMRA 3Q9NA 1NX9A 1YMVA 2R8GA 1GPBA 3KKPA 2VUIB 2GZHA 1SOWA 4N3GA 2DHQA 3LV8A 2ZYGA 3KJGA 2PNFA 3OIUA 4NH4A 5KQPA 2D7CA 3L04A 4E09A 1T3LA 4Z9XA 1XEWX 4HX9A 1I3MA 4WRRA 4N5DA 2MDTA 5GM1A 4HTAA 3DLTA 1N7JA 1GHTA 2FF5A 2JLBA 1UODA 4UTXA 4M1QA 3H9GA 3S44A 4B3HA 1JEOA 2C1ZA 1H5QA 3T9AA 4PQEA 3ZV6A 2QT1A 3KB1A 1AVTA 1N5KA 3PKJA 2QTAA 1RYZA 3GOQA 2VFAA 3EW9A 1R00A 1V1JA 1X39A 1LF0A 1L4UA 4AG3A 3ZJYA 2RGWA 1EX9A 2WD7B 3A2MA 1Z0ZA 3LHDA 4RTPA 3G8AA 1Z36A 4EJSA 4IGEA 2ZK7A 3O3MB 3TOZA 4L27A 2WWXA 2FE3A 3AVUA 1Y34E 2QEQA 2ZAYA 5F2NA 2IUEA 5B3LA 4XA8A 2NU6B 2JFNA 2QRVA 2B83A 1P6UA 4HVLA 4R7GA 3DBOB 1B0PA 3M6AA 2M32A 5EKDA 3LXRA 5DO9A 2BZ0A 1HEUA 4J8PA 4BNMA 2IHVA 4XW2A 3LF2A 3VNUA 1RLOA 1CLUA 3LIPA 4PRLA 4Q7LA 3HWRA 3R7WB 5GINE 4O83A 3GDEA 1L4NA 4YMSA 4NATA 2BH2A 5GGXA 4N49A 2D0OB 2ZU0C 2WM2A 5AVZA 1QH9A 3RIZA 2JLWA 3GQBA 3KFVA 3M34A 2C3UA 3A4TA 1I2DA 5LQDA 3PRJA 2GN8A 1ZITA 4I5DA 2JA1A 4P58A 2EWVA 3PWTA 1Q7EA 3QBVA 4A7PA 4DCTA 5KFEA 1T8SA 3ADOA 3BZUA 2NUTA 4QUEA 4G0NA 2JFWA 4PAQA 1VLHA 4HAUA 1PR6A 4G07A 4JJKA 3WQHA 4TL6A 5BV1A 4H31A 4IQ0A 1B3BA 1KR2A 4O2AF 5A5GA 4KI7A 1SQ6A 4LG1A 4UUPA 1YA6A 4ED0A 5E3IA 4V0OA 4PAOA 4EGSA 2Q9CA 3UPTA 1T29A 1P6QA 1XRSB 2PKCA 2VOBA 3JWJA 4IYRA 4Z49A 5FBZA 4DQ0A 2VBIA 3LIIA 2PWZA 1VGRA 4LC1A 1QIDA 4WT7A 2E49A 1VG1A 4M0DA 4R0VA 3EUFA 1BTOA 1F3OA 5DM1A 5EZYA 1JIHA 1W29A 3QSYA 3CEBA 4D0GA 3NV7A 1X70A 1ZR2A 3A06A 1Z5ZA 4YAGA 3I42A 4R3WA 1YRQA 4N48A 5JSHA 4YP0A 4E88A 2WE8A 1J56A 2IYNA 3ODGA 4HI0E 1H2AS 1MVOA 3HNRA 4JI0B 1N6IA 2Z04A 1Z6ZA 3BRQA 5JXJA 1IN6A 1JU3A 4ZYZA 1UP4A 3F67A 1Z4KA 4GZMA 1PLLA 5J40A 5A4FS 3HXOA 2ERXA 3KJIA 3FSJX 5FOSA 1V1RB 1TD9A 4N8EA 3P4YA 1CLEA 5DJ5A 5K0TA 3FKIA 4AZWA 2AB0A 4KGZA 4NARA 2C99A 2RI0A 3G6WA 4LE2A 2OM6A 2G4VA 4RV4A 3H3JA 1FW8A 5DM0A 1HYEA 1L4KA 1ZXBA 1P19A 2FMIA 3SC2B 1H6AA 1ND6A 5TF4A 1SXHA 1AXGA 3LW7A 4Y98A 4Q7JB 4MW2A 4RNDB 2OG1A 1VBMA 5HFJA 5IZCA 1M1YA 2M6KA 3DBHB 4PPQA 2HK9A 3MRTA 2CBXA 2WKQA 2VLIA 4AZSA 1U0TA 4AUEA 5ENVA 1XZEA 4N6GA 4IINA 4IICA 3D31A 3FR7A 4NJEB 3PW4A 3L1KA 3V6LA 7GPBA 3CUWA 3M5DA 4MJXA 2CK3A 1GGFA 3CWCA 4HF7A 1KYTA 1OI4A 1U5BA 5DF1A 1ORHA 1GZSA 1Q1EA 2W2PA 5DTEA 2FW6A 4GOOD 1ZEMA 5HQTA 2GBGA 4GLFA 3AVOA 3IR5A 2FN7A 2YCLA 2LUOA 1D2EA 4GX5A 1YZHA 3H5IA 1RVDA 2JHFA 4RADA 3Q87B 7ADHA 2D62A 1KTAA 3IODA 2ZVQX 1F48A 1D2MA 3QEBZ 2VF5X 5KFLA 2W6QA 3T94A 1VZ2A 1KYZA 3HA5A 3MTBA 2IYAA 5CM9C 1FYDA 5IASA 1TKRA 3M6LA 2E4VA 4QX6A 2IFTA 1K3FA 4AMBA 4KQFA 3E15A 5B3JA 3H75A 4HXFB 4NV1A 3JPWA 1EFLA 4MCHA 4D43A 2B7LA 2Z0MA 3GJ7A 2ZBDA 3TQFA 4WXHA 3KPYA 5EVJA 3HOWG 3PNQA 4FU0A 4GBGA 4BXOB 2ZQYA 4MWSA 3VC3A 4S1OA 1C1HA 2G71A 1Z68A 3RUFA 4EO7A 1HYBA 1LVHA 3RFUA 2BEUB 4DQVA 5A2GA 1E89A 1KY3A 2EDAA 2ZTSA 3R7BA 5EE1A 1B0ZA 2RHGB 2YWGA 1KP9A 3TLGA 4RXUA 4UJ3A 5DBOA 1KBLA 2DCMA 5HF6A 1NVFA 3NW9A 1EWRA 3SD7A 4DRXA 1G5QA 5TQ2B 1CZUA 3AGPA 1GO2A 1NULA 1QYWA 3GARA 4J9UE 3EWIA 4Y6GB 1BS9A 1W6RA 4S3MA 2K2WA 2FSGA 1II0A 1TJ5A 4FGRA 3OPNA 2FJ0A 3I34X 1IM8A 4XYLA 4Z86A 4MHSA 2LDBA 4MB2A 2R7MA 4NCBA 2VOJA 3TD6A 4EG3A 3S24A 1H2FA 1UJ6A 2Z5GA 4R9RA 1VHTA 3BJRA 2DWQA 1UWVA 1KI9A 1OREA 1EVQA 5KCMA 2DSTA 5KNBD 1XDZA 2ISQA 5T14A 1PNQA 3S55A 4YJFA 1Y8RB 2PE5A 2YJZA 4PEVA 4FEAA 2KW5A 2YZLA 3VO2A 3WMGA 1XNRH 4BO0A 1UANA 4OQDA 5CDHA 1GZ4A 3GVCA 4G26A 1YHZA 3K30A 2LTAA 4BBPA 3HJUA 3MJCA 2OGUA 3IPXA 1PYDA 1X80B 3GJXC 3QKSB 3R7LA 1O6CA 1CUEA 1P5RA 1RWBA 1MJNA 2IYPA 4S12A 3ECAA 2UDPA 1UK6A 5C8YF 3BRSA 1RSZA 1U4SA 3DLPX 5REQB 1N3LA 3UAYA 1VDZA 4XCVA 5LCXA 2GRJA 2DQ4A 1N1GA 4GO1A 2NUAB 3U4MA 1GFZA 2XH8A 2QM0A 2CEAA 1IRXA 3M9MB 3OMLA 3B6ZA 1KJZA 2K5UA 4PPNA 2Q8PA 4WV3A 3S2SA 3KB6A 5KTOA 3GAZA 4OV6B 2OBNA 1VL0A 3ER8A 1D8TA 2ZJ2A 2H4JA 4FC6A 2AH5A 4M8LA 4DR4H 2JBAB 3A6LA 2V59A 5CCXA 1K1SA 3TQ1A 2AJ8A 2FV8A 3VX4A 3JZFA 5ALKA 1UBLS 4E3WA 4MLZA 1Z74A 3HV0A 5ALFA 4GD3Q 2NZWA 5FI3A 4AP9A 1UKVY 3FPLA 3U31A 5EPOA 3CKYA 1TZ2A 2C1XA 2OP0A 1R5NA 3SGIA 3LQQA 3MTAA 5DGDA 4E03A 3U16A 1OYWA 1ACLA 5DTJA 5B1SA 3ENWA 4FOPA 3UWMA 2QQEA 5EMHA 4LNHA 3MD9A 3TGPA 4MDFA 4K8OA 4HFNA 1UOQA 2FPSA 1L5VA 3FPCA 1SHZA 1GA4A 3D7MA 3GU3A 1CTQA 1MEEA 5AVQA 4PSCA 4XSVA 2XRYA 4CFSA 3AUKA 2R5FA 4BU1A 3PEFA 4KLZA 5MGNA 2V03A 4JB0A 1E5DA 1AKVA 4KEAA 1P8JA 4A8JC 4HGQA 2Z3WA 4P9NA 1U28A 5GGYA 3GY0A 2B8JA 2IY7A 2PUCA 4CUKA 3QX7A 2GKOA 3KNZA 4IR7A 1FFAA 2B61A 3T61A 4F6LA 2XMBA 5GPBA 2NSLA 1LK7A 1ZD8A 4MKXA 2HA2A 2VPWA 4I8DA 1E6LA 3T5TA 2KX7A 5AQ1A 4HGPA 3FY4A 1UBJS 3U4QB 3K6SA 2R5WA 4M4SA 4Z9BA 3HNOA 1IY8A 3B13B 3B6EA 3B70A 4DWJA 5AIAA 3A4YA 1XDWA 1KQGA 3BN3A 1Y5NA 2YVUA 3PLAE 4NU8X 3UK1A 2J67A 2MYPA 3OHMA 4GMDA 2G9RA 4M2LA 1GCUA 3FWYA 2H5EA 2ZVDA 3EGWA 5DN6D 5ALQA 4TLEA 1KPIA 2HHHH 3RBEA 1KKLA 3K0KA 2EP7A 4PFKA 3R3UA 5JS1A 1QVAA 4MIKA 2BFAA 2VPXA 3MM4A 3LK7A 3KXKA 3W5DA 1G5HA 3GUHA 1LPBB 2IMWP 4MZXA 3WYAA 5K4AA 3R9RA 2QTFA 4YN3A 3WGKA 4AWXA 2QE6A 1EB8A 4LJSA 1U3WA 1Z88A 3OZGA 1WVMA 1DX9A 1Q7BA 4EAAA 1PN3A 2QTVB 4TV8A 2R8IA 1DQZA 5CFQA 1NE2A 4MDEA 3NIDB 2VWQA 4L8YA 1ICIA 2FKAA 5I5GA 3RG2A 3BILA 1L3BA 1XHEA 3MPOA 3HXKA 4ED7A 5JE8A 1THZA 1IUNA 3QI7A 5SZIA 1UXIA 1VBKA 3LBFA 4D0SA 1SKAA 3FVRA 3S40A 5EINA 2HN9A 4OREX 4O5AA 3AETA 2P1DA 5K05A 5CK5A 4ML3A 1N3YA 4L3WA 1X15A 4EFNA 4TYWA 2XQJA 5C3MA 2VK2A 3H4BA 1U8XX 5BWXA 2W7PA 2UU9H 4ILEA 2DPHA 3D0OA 2DECA 1UBEA 3BTOA 1ESNA 5KSPA 3O1JC 8MHTA 5K0BA 1YMUA 2Q1WA 1RAFA 4IVNA 2O52A 2QRMA 4AO6A 2P27A 4JBNA 3AR2A 3IG0A 3L7NA 4G0PA 1GDTA 1CZOA 1IOLA 1R0XA 3FHLA 5I9IA 3MA0A 2YU9A 3E70C 3HRKA 1XXHB 3LCJA 1G17A 5CHYA 5JRDS 2QAGC 1W4RA 1PGOA 3FWNA 3WIBA 1BXRB 1RHMA 4M0LA 3BB1A 4EG0A 2AWNA 3V1MA 2FZ5A 1FTSA 1Y48E 2A0UA 3CVOA 4WN9B 2AQHA 5CYOA 4J1TA 3IURA 5CD1A 2Q9BA 1XDBA 1U4OA 2QQFA 1KOGA 1XCOA 4A0HA 1LSSA 4QLAA 4R2IA 4NF2A 3GNQA 6GPBA 3DEZA 2O2SA 1LF5A 2XOXA 2BONA 3WLLA 4KDEA 2YY7A 3QELB 1PL6A 2O3QA 1PEKE 1UH5A 2QUKA 4ZREA 2SCUA 5A5FA 5ALLA 3WZLA 1ISIA 3E1GA 2BP7A 1H2RS 2BGTA 3FCEA 5J59A 4TX1A 2VO1A 4EGCB 4AUMA 2PH7A 4UBMA 2WFAA 1JXQA 1ZMTA 3NHAA 4LSZA 1QFMA 3T1TA 3U4GA 1ZP6A 2B36A 4MW6A 4RM2A 3RUDA 4IG9A 4UNRA 3DHVA 3QXGA 4DCJA 3GRUA 3U9SA 1FTWA 2Y1GA 1JDNA 3HJGA 4OBEA 1E3IA 5IARA 5BO5A 3MT0A 4IIEA 5KTPA 2HFJA 3P0HA 2Q7XA 3RHTA 1KBZA 1OI2A 4JVMA 1ARZA 3HY4A 1F8GA 3COYA 3KDPA 2C8VA 1AJEA 1I2KA 4PZCA 3H5RA 4ZQFA 3MSCA 2AOWA 2RDMA 3GHHA 1SCIA 2XMPA 2W2XA 5GVSA 2R1TB 3IT0A 3BQ0A 4IH4A 1ISRA 2ZP1A 1N3IA 2G1AA 3MWEB 2OAP1 3C3MA 4DL9A 3HZOA 2Q3FA 1KZGB 4F45A 3OQOA 2JH3A 1QLJA 4N03A 2C2ZA 2WQZA 3BSWA 5JO0A 3LQSA 2ZI6A 4DL7A 2LE0A 1XV5A 1GL7A 1RQPA 1DQPA 4CKEA 1KPGA 3H2ZA 2IODA 2HNKA 3LRXA 2XVXA 3FYTA 1Y6GA 3BVPA 1WY7A 4IW3B 2DH6A 4AJHA 4RA9B 3Q1LA 1H2XA 2I5PO 3O8QA 3AI7A 5GZ3A 4CI9A 2IZOA 1RM0A 5F77A 2H2HA 1ECJA 3KZ1E 1E1NA 3M1IA 1C9NA 4TZ6A 3PGVA 4DG8A 1XZAA 2Q3CA 1QHIA 3BMNA 4DNPA 1COZA 4GLXA 1AA9A 4R54A 1WP9A 3U4IA 1T2CA 2XJ9A 4JI0H 4FE2A 3T7EA 3ROQA 1S97A 2JFFA 1XELA 3B3GA 3T5JA 4W4TA 5CB4B 2Z1MA 5AHRA 1Z82A 1COWD 4DWOA 3F7TA 2NG1A 3G8CA 4CIBA 3RBVA 4U6NA 4XVHA 2Y0PA 2P77A 4X65B 1YDMA 2QVZX 3R0VA 4JJGA 4GOLD 1VCHA 4JVNA 3C39A 5K51A 2XYQA 2OCLA 3FNGA 3T5MA 2CV0A 1EPUA 3T3NA 1T0PA 3LWZA 3QNWA 4QGGA 4BVBA 5CVJA 3F3YA 1I10A 4OUKX 2PLNA 4HZUA 2YCHA 3MS7A 5D84A 3QWUA 4DC1A 3BTUA 4Q9DA 3UBMA 2OCAA 3A11A 4C3ZA 1FDVA 3VJRA 4FMDB 1YJAA 1A5ZA 1QO9A 2CJXA 3GLUA 4J29A 4AJOA 3CVWA 4C4XA 4JY7A 3TS1A 3GCGA 4EGAA 5BY2A 5FAXA 1FNSA 1J8MF 1JIXA 4ER7A 4ZKDA 4L3VA 5M2QA 2R5NA 4JKYA 1FS5A 4ZO4A 3TW8B 1DINA 4BKOA 3QQPA 2VDWB 5TMEA 3B9QA 4XX0B 5G0TA 3F4KA 1FDSA 2BZSA 3RHFA 5CM0A 2PKQO 3K0BA 3ZWCA 5CA1A 4RENA 2FCAA 4ALKA 1KYYA 1HK7A 2O48X 1IUKA 2H5LA 3JRNA 3A27A 3HB7A 3CEHA 3E2IA 2O3SA 4ZWNA 4GM0A 4WESA 3JQEA 2XIGA 2ABJA 1XFAA 1JAIA 4PICA 4C43A 2PU7A 4AROA 1FFCA 3X1WA 5DLEA 1NQVA 4GI5A 5E4JA 1VKJA 1OUMA 2QTZA 5CPFA 3M3PA 5IJXA 3HPRA 5IEBA 4UD2A 5EIAA 1Z8DA 2XKBA 1KE1A 3NOXA 2NU7B 1ZOOA 4HB3A 1UIMA 3Q8SB 2XWQA 4MRSA 2YXBA 4Z53A 1HTTA 1DP4A 3C1UA 2G36A 1S0MA 3NAGA 1TCVA 1V9LA 2RGAA 2IBSA 4GPTA 2Y0DA 2Q5CA 4RC9A 4JT4A 2H7YA 3RTEA 1THGA 3PIRA 2O8DA 2AN4A 4JR1A 4FT4A 4UM7A 1G59A 1WCYA 4IIJF 2UUBB 2VDJA 5J2TB 1IOVA 3HA3A 4CZ2A 2ASVA 1C1YA 1C7JA 5F1KA 2ZYTX 3MINB 4F6RB 4BFYA 3NKLA 3UHAA 5E9WA 3DLIA 4QU5A 4P7GA 3R8FA 4AIRA 1X77A 1U0NA 5ESWA 2A0WA 2QRPA 4WLNA 1T8YA 1IAVA 2C07A 4A73A 2HGXA 3ND6A 4ILKA 2EL9A 4BNLA 4PG6A 2OPHA 4LZJA 1EDDA 4G5SA 5CEEA 2BEVA 2E37A 2X14A 5EMLA 4EGJA 2FR1A 1PFKA 4BUJA 4QDTA 1XLUA 3QXJA 4YR9A 1EZ1A 3JZ6A 1JWLA 4IZIA 1XD2B 1VSBA 3DW1X 3DBLA 3F6RA 2FFRA 2NSDA 1L5KA 4L5CA 5BUSA 3R3VA 1GG2A 2DAAA 1RC1A 3MTEA 3PFGA 4XH9B 3CM0A 4ZQEA 1VRWA 2YKGA 2O8CB 5B1DA 2IUSA 3N3BC 4PWZA 1L9XA 3D4LA 1OLOA 4LSMA 3BEOA 2LRHA 3LG2A 3IKTA 3H17A 3IV7A 4ME6A 3M3DA 1QQTA 4XSHA 4O8CA 4ZAYA 4REQA 5B58C 1PR5A 1SBQA 4OQQA 2C5LA 5DQHA 1U2GA 1DKUA 1Y1SA 1IBSA 1NR7A 2ZIXA 3CIOA 3PT5A 5LQKA 1S96A 4Y0NA 2O7SA 3VHLB 1TCAA 2WSBA 4OQXA 2Q5QA 4GWKA 4K3VA 3ITDA 1GTRA 1XPJA 2G09A 3V6HA 3ZCQA 3B1KA 4BBAA 4ARZA 3KUKA 2A1IA 3PQDA 2AJTA 2FF7A 1V5IA 5KUTA 2FTKE 3MJRA 1TVKB 1Q11A 3ICCA 3DLHA 2RAVA 5K8VA 4WK4B 5JJLA 1QGUA 1GGVA 1ZS9A 2EX1A 4IKOA 4U1RA 1Y7PA 4DUYH 1C8KA 1EX6A 3CUTA 4LIPD 3G8YA 4R2XA 4RB1A 2GEJA 4WERA 4EKIA 2KPOA 3B6KA 4HB0A 3EVBA 1C50A 2GCPA 1R7RA 2BW0A 3E22A 1EBBA 1JU4A 1WLSA 4RY0A 4OXIA 3QY9A 2AC2A 3ANLA 2Y67A 3LXUX 1RT9A 1G7TA 3HSSA 3TZCA 4Q19A 4TRJA 1FVOA 3H2GA 1W6UA 4PR0A 2JK0A 4TKZA 3Q7RA 5L9AA 5DNAA 3TY9A 2GYUA 1MJGA 1M6WA 2BVNA 1ML3A 4MV8A 2VTKA 4YRCA 5EUMA 5G3ZA 1E5LA 4ZCLA 1UMCA 1YUNA 3R3SA 2FPWA 1I0LA 5JBNA 4BO7A 1W5EA 3PD7A 2XMCA 2COUA 4FFLA 5EJ8A 4MJ7A 5EIWA 1KZHA 3D4BA 3TYXA 3MRXA 4QGSA 1RJEA 1CNEA 3H4IA 2O8BB 3DTFA 3AEZA 3SLRA 3QLJA 4PCLA 3SX2A 1ZSNA 4JV2A 1JDBB 1ZIXA 3VOSA 3RCBA 1ECBA 2PD4A 4O2AA 1Z8HA 4DXAA 4HGOA 1GKIA 1LPOA 2GR9A 3EPRA 2P9TA 4F2PA 1RJDA 2NVOA 3WX0A 1CQWA 3OE4A 1N4AA 1KHHA 2J5XA 1NBHA 3RYHB 3RHZA 5K99A 1Z6TA 2OWOA 4BP3A 2BE7A 4D81A 2NQ8A 4DT1B 4OUDB 2V6FA 2CZCA 5D1HA 3MOGA 3PS9A 2I6QA 3RIYA 5EUQB 1R6AA 2GERA 1KJNA 4P4LA 1JNXX 5JEDA 3EVDA 4Z0TA 3B7GA 4M7OA 1SG6A 4GUDA 4ZMSA 5EYPB 2XXJA 5BSRA 2HYIC 4QXPA 2J3KA 1RYDA 3JAKA 1OTYA 5FR9A 4KXWA 4JJ8A 2WFLA 1Q0LA 3U1BA 4WTOA 1S0UA 3PP8A 3L49A 3HGTA 4HMOA 1T5HX 5F98A 5L6LB 5K3FA 4NC9A 3TNDA 3EPJA 4MUMA 1XQWA 1OYYA 1SZCA 4FOSA 3LUAA 5KNDD 3AR4A 2EU8A 3N59A 3RS0A 3EUWA 4FLEA 4W8OA 221PA 1XA0A 2F7SA 4FLMA 3HC7A 2GASA 4O2BB 3G5UA 2B25A 5BORA 4GPBA 1R3UA 1XALA 5GP1A 3DD1A 2ZIZA 3SLGA 1PWXA 2VQFB 2QY9A 3OUUA 3PYMA 2NWQA 4G0QA 3M2TA 4YDHB 5FNVB 1T4BA 4AQDA 5T57A 3NRCA 2XF2A 2WKPA 3CJTA 2QJTA 2A5DA 1NSYA 4YRDA 1JDUA 5G0VA 2DVMA 3IDOA 4UTVA 5FTKA 2B4AA 2FSFA 5FCDA 3OQVA 3ZKWB 3THXA 2C2BA 2HMVA 2OKCA 1P1BA 3UJBA 3GJ6A 2Z5VA 3V8MA 5I9NA 2TMKA 4ZALA 3TSZA 3U49A 1UWKA 3KZNA 5CXUA 2HV9A 4F72A 2OBLA 5KTYA 2M2IA 2X7HA 2ZT6A 2YV4A 2I4RA 5F52A 3RWMB 1V5EA 3WSWA 4GQBA 1XTZA 2PT5A 4QAJA 4A2CA 5AW0A 3KFLA 3EZYA 4EUEA 3KLPX 4DCOA 3QVSA 1JDVA 2IP2A 1J0EA 3EWAA 4TXHA 2FOIA 5EG5A 4P33A 1B76A 1GGEA 1W8IA 1OV6A 3WR5A 4BGEA 3VYUB 2YRWA 4JHLA 3GDHA 4RK0A 4EFBA 2QD4A 2J5KA 3WQQA 4RGVA 2GARA 1Z38A 3G1UA 2VJOA 1X7WB 3HT5A 2MR5A 3WL6A 1VHQA 2Z2KA 3ANXA 3PWKA 5KSZA 2VHCA 3WWEA 1KJYA 5CLJA 4DR4B 3WHLA 4H7PA 1B6GA 1YOVB 4OPMA 1DAPA 2C2KA 3I04A 3UNXA 4R2JA 4UDOA 5JSUA 5KJEA 1KMCA 1W88B 2OESA 1ZL0A 3B1YA 1CJUC 3ZV4A 4D4GA 4HBGA 4S04A 2X8LA 3VR6A 5ECYA 3HB4X 4FSHA 2V4RA 1R8YA 1BHO1 4TKVB 3B1ZA 1SOUA 4DAOA 4L6AA 3UFXB 2PMKA 1T36A 4D41A 3EUEA 2G88A 3STUA 1GKKA 5B4TA 1MO5A 3AZQA 4INOA 5EL0A 3TKAA 4EY4A 1NA5A 4D3DA 2W6MA 2OXTA 2O54A 1ETUA 2Z5FA 4LQLA 3W79A 2ID8A 3SYNA 4LZAA 3FKSA 3ICEA 2G76A 5JXIA 4P86A 5FBWB 4K8RB 2RK4A 3KE8A 1QO7A 2C82A 4N7JA 2GAFA 1A95A 4R3NA 3FHCB 3IVAA 1K7FB 3W8FA 3KTOA 3SYLA 4HL6A 3V8QA 5F1OA 2J5BA 2J1LA 4Z0PA 1KS2A 1P0PA 1VMEA 3K31A 1HNZH 1JT9A 5JXHA 3QPVA 2H59A 4I7EA 3GLHB 3K2IA 3ZOZA 5B6JA 1WQ1R 2FN8A 1GGHA 1RYBA 2Q2VA 4K6FA 3NIWA 3QFTA 4K2AA 4IIGA 1QZ3A 1SOVA 5C8YA 4RNNA 3K9QO 3EFBA 4KE6A 1W5TA 4ZTUB 3N2ZB 3LI2A 3LWBA 1U7UA 2MWMA 2ZYWX 2KS6A 4B8YA 3KCQA 4BB0A 4KGDA 4DIDA 5TF0A 1E18A 4ZI3A 5FO1A 5KKNB 4Y7CA 3PR5B 1MC1A 3DBIA 5FOVA 2IIQA 4LGMA 3W6ZA 3FDIA 1CQIA 1I2AA 5IABA 3TNFA 1NLZA 2HZ7A 4ZAWA 4D6PA 121PA 4GBJA 3FFBA 5KQLA 3OZSA 2BGUA 3RVSA 5J1TB 1TADA 4KLAA 4ROTA 3HKDA 3SFVA 2P6RA 1O9BA 1KRXA 4JVSB 4X65H 2I3DA 3PWZA 2I67A 5CB6A 2Q1UA 1LVUA 3RJ9A 5KFIA 3WGLA 4E5KA 3UAWA 2FK3A 2C04A 3R3HA 4U63A 1VPLA 4EF5A 1KZYC 1JSXA 1ZICA 4TL7A 3REGA 2H29A 5L3SA 5LQAA 2FR8A 2FMAA 2OG2A 1VRCA 2QXYA 3CCCA 4KZKA 3L6EA 4ARAA 3D9QX 2ZUDA 4O0LA 1PDVA 1OZAA 3SGLA 4D3FA 2GXSA 2OGZA 4UTPA 4HWTA 3FDZB 3QVTA 5FIUA 3TH5A 3S7ZA 4KLCA 1HR0B 3A8TA 3U7FB 2H85A 2A9PA 2XY4A 2R25B 4FYWA 4PSKA 4G01B 4MQ5A 3WJAA 5B30A 4EMBA 3ADKA 4N4AA 1C4OA 3V4LA 4GIBA 1VE1A 3I5AA 1IZ0A 5C4MA 1KH2A 2MR6A 4QA9A 2VBCA 4IR1A 1DBIA 5KT6A 3CEAA 3V32A 2DWCA 4DBLE 4X41A 5H0IA 5KT5A 1JHPA 1GTG1 3ETCA 4BWGA 2C83A 2QVYX 1XR3A 3CEJA 3CSSA 1O9GA 3VR3D 1JG4A 3T5BA 2PD6A 1U9ZA 1QGZA 3GPCA 3WIDA 1P4GA 3KDSE 2KSWA 2QX7A 4MKIA 2QY6A 3U5TA 4YV1A 2PXXA 1VI6A 1FMCA 5FDFA 3FAKA 3IRUA 3SS9X 1SZPA 2VPTA 3GZNA 1Z7WA 4A0QA 1DBPA 3UJPA 4OXRA 4EATA 4WW0A 2JHPA 2XZPA 4MP8A 1BE6A 4QULA 3C0KA 3RRXA 3A32A 2H1IA 3P20A 5ALNA 1ONNA 4C0SA 1K2VN 4UNQA 3OTIA 1WMDA 3FCAA 4IHJF 1BKDR 2J3EA 3SIWA 2UUBH 4BLUA 3DBRA 4F3RA 2FFAA 3LQ2A 3GB8B 1JXOA 1ZN8A 4IBOA 4X20B 3K0AB 4IVRA 4M8NE 1KJ8A 4CWAA 4B7ZA 1WDWB 5BQFA 1TA0A 3QF4B 2UZ0A 3CN7A 4L8FA 4ENUA 5TMDA 1R64A 3OJ0A 4M49A 1T2DA 2C00A 2YOGA 1FVFA 4HC4A 3TB6A 3K9BA 3TECE 2Q46A 4QYIB 1N2IA 4M36A 5TVKA 2RHCA 5K8TA 1QK5A 1FBTA 3IBCA 2JIQA 4EYHB 1AN9A 2XCIA 5FYDA 2YRXA 4BP8A 5ITZA 3HFSA 4G2TA 2C7GA 2ZU6A 3JZAA 1NBOA 2IU3A 3MCTA 1K88A 4G0YA 1IIRA 1OZHA 3O9ZA 2J46A 2H0QA 3K94A 1CU1A 2J4DA 3LQFA 5D3MA 1NVBA 1MD9A 2RFLA 3VH1A 3GUZA 4DC9A 4LX0A 4R01A 4G1BA 1YNSA 2ADFA 2ZROA 1W4CA 3PBKA 5SY6A 1UDCA 2QJRA 3DXYA 4MGIR 4CKCB 1PBTA 3KV3O 4ECXA 1XQ9A 2VJPA 3DUFA 3WLKX 1X1BA 2D2FA 5FUYA 4MUXA 1MKYA 3ZLJA 4IOKA 2EFYA 3K5WA 3ZXUB 1QKJA 3N0WA 3VBEA 3LY9A 3UCFA 3C41J 1W19A 1DB3A 1RBYA 5J5AA 4JA2A 3DMDA 2ZRBA 5GOTA 3GV7B 5KG6A 3BMCB 1ICEA 2DC1A 3V4PB 1P7VA 2MCTA 4UM9B 1M6VA 2FK7A 1O96B 1FMFA 1LLFA 3BHIA 3LOUA 4BZPA 1NBMA 5AKIA 4UHKA 4OMDA 1RZRD 1FLAA 4I08A 3G88A 3G0IA 4AY6A 3VX3A 4OU4A 3ZWNA 4Q4AA 421PA 3NATA 3PDIB 2JGDB 2A1UB 3KXPA 4X7MA 4UBIA 1MJ5A 4NG5A 4OTZA 1WV0A 1S1MA 3GX1A 2WVHA 3PGLA 2H2IA 3CONA 4BJ5A 3ZE1B 2ATEA 5JD4A 2BLNA 4EFEA 2D0IA 4XLLA 1JTFA 1SVMA 2IH2A 1RFLA 1VI2A 4DS3A 3ACCA 3N7AA 2GCNA 2B4YA 1W44A 5IU6A 3QH4A 5GJBA 5JU6A 3RF6A 3NRBA 3GZ4A 2D1RA 4PC1A 1U3CA 2QN8A 3I39X 4M6WA 4NOKA 1DFGA 4D98A 3VV2A 5HDBB 4Z4HA 1WAMA 2F1HA 5BVGB 1G9XA 4NYJQ 2OUKA 1BD4A 4BNHA 5AJZA 3IMKA 3P94A 3M5PA 4PC6A 2V5UA 1KAHA 3A1DA 2JFZA 3A6HA 3GJ5A 3JVVA 3V8RA 4EZEA 5KWJA 3DV0A 3U56A 4B43A 3ZIUA 3SJCA 3UFBA 3ZY6A 1C1DA 2DR2A 4RVOA 4QGHA 2AMFA 3D3KA 1P91A 3TXYA 3AF2A 4XIFA 4GPAA 3BB4A 3BZBA 3PXUA 2ROQA 2BUCA 2VNSA 1TC1A 2CEKA 1FX1A 1TPYA 3MRSA 3QLUC 4L5BA 1KMMA 3GTLA 2YYAA 5IT5A 4ZI2A 1EGMB 2QL6A 4L76A 1G8AA 4PFSA 3A3KA 1FFGA 3H6HA 1E3TA 4KH0A 5LLDA 4RKWA 1G9SA 4XWKA 2GETA 1UDRA 2NGRA 1U90A 5I45A 3IUBA 2QJOA 4JX9A 1GAEO 2PH1A 4G1FA 2DLDA 1I3OA 4RYDA 4G0VA 1D2HA 4P22A 1OXUA 3EQ7A 3GTJA 3GH3A 1N9ZA 3RODA 4FE7A 3GJ4A 2ONKA 4B6RA 2TECE 2NU9B 1BQ3A 4CM8B 3B12A 4M7EA 1PJZA 3L40A 4ETMA 3L46A 1CYEA 1XTUA 2FKLA 5IULC 4KL8S 3A9RA 2WFMA 3UHFA 3SE7A 5PGMA 4U5XA 1K66A 3LD9A 4ECZA 3Q8QB 1GZ5A 2GJAA 2QR5A 2F17A 1FJGB 4TSFA 3EOAI 4DL6A 1YK1A 4LRXA 1HI9A 5I9MA 2C7QA 3U13A 3WKBA 5JMWA 4C08A 3N07A 3V1NA 1GYFA 3S5UA 1YQDA 4Y2VA 1NC3A 4DJJA 4TMYA 1EXNA 4U7HA 4MK4A 1ODLA 3BE8A 2W2VA 2GI4A 3MQFA 4KN5A 2Q28A 5HS6A 2PL5A 2QPLA 2G5TA 2IE8A 4D1YA 2C4TA 1K8XB 2VQFH 3PW7A 3FTDA 4CCYA 2O7QA 3WOVA 5IJWA 4EBDA 4IV8A 2GCOB 3S1AB 2QVBA 1I4EB 1XL0A 2I2BA 1QHHA 5HTOA 1NLMA 3WLPA 5CVCA 1T1RA 1HFKA 2IPLA 1QP8A 1WULS 2AN9A 3LDUA 4BWSC 2C61A 2HGWA 1CRLA 2QW8A 3GLGE 4ED1A 4MUAA 1TQ6A 2C42A 1TF5A 1L7AA 4Q7KA 1A8QA 1FFXA 4BATA 3A9WA 4ZYUA 4JOSA 1VB5A 2FW7A 4RHFA 4EG4A 2WMYA 4CR8A 2C5HA 2ESRA 4YR7A 4L5YA 5KDOA 3T15A 4C0KA 4AIIA 4BPBA 1PS8A 1UQTA 1KKUA 3BQMB 4KMMA 5HJ5A 4JI6B 2GX6A 5K8CA 1Q3HA 1TC2A 2BR3A 4NICA 4H35A 2E4ZA 2X3FA 1MV8A 1G19A 4Z4GA 1Z7YA 1XMQH 2ERYA 2VK8A 1NNUA 3N40P 2P6PA 4FW8A 5AVTA 4A3FG 3MRVA 2R7ZA 4O7TA 3ADDA 2UYYA 4OGFA 4MS1B 3FPSA 3HOZG 3IAS6 5KPJA 3SICE 3CLUC 1GVNB 1PS9A 2PRZA 1GNLA 4IZHA 2R8HA 2GAIA 3QG5A 1ZAKA 3O0TA 4V38A 5AW5A 1YS9A 2HI0A 2BGNA 3KLMX 1K5DA 3AF6A 2GPBA 3EGCA 1L7VC 3CBQA 5FD6A 1T5TA 1CUIA 1QAOA 5ULLA 4LJLA 1ZY2A 4XUEA 3SFTA 3H2IA 3OQ6A 1JXMA 5KYGA 1XJCA 1RJ9A 4OI1A 3C3XA 5ECWA 4GC7A 2BTQA 2XUOA 5F4BA 1H3FA 3PB3A 2NZJA 3AB3A 3M2PA 4LGVA 4XPIB 2YJ6A 3GHYA 4MO9A 4H0CA 5I8ZA 1G8HA 4A93G 1Z5VA 1M1NA 3DMGA 1I7LA 1LW6E 2F00A 3W5UA 5ALVA 4IIJA 3VPCA 4BE9A 3OO1A 4E4RA 4AP6A 2QG9A 3CSUA 5H80A 3RS5A 4AM8A 3ZWPA 2KB0A 2PR2A 2L0XA 5J2UF 4PLWA 2O8VA 3T3IA 2HEIA 4B79A 3K15A 3RUAA 4DUYB 4AN1A 2P2YA 4M1WA 4A8PA 1DXOA 4AXXA 3UV6A 3UH0A 3AFGA 3ZLBA 2QB5A 4WFJA 1W48A 5AKEA 3FZQA 1QG0A 1BS2A 4M37A 2B7CA 3CV3A 4J90A 3L06A 1UBSB 1EVIA 1KBOA 1NONA 2JD0A 3PICA 2BHNA 1RYYA 3AUJB 3DP7A 3F73A 3COPA 4B8WA 1XMXA 5A4MS 4B5KA 2OFWA 2Q5IA 1A8HA 3JWPA 1F1BA 3L7MA 2Y1CA 3RRZA 2I99A 3I1IA 2X3UA 1S01A 4KZPA 5BWUA 2P9QA 4ZEOA 4FYJA 5IPFA 3VSEA 4YAJB 3COWA 1Q14A 3Q7SA 1YTUA 1MXHA 1YCHA 2IF0A 1YQEA 1BE8A 1R74A 1I2MA 2DFLA 2NNLD 1OE0A 2GN1A 2X4DA 3MT7A 3KV1A 1QP7A 1HDOA 3LWNA 1JW9B 2VLBA 3TPFA 2Q2UA 4NXNB 1LZLA 1T94A 4HDNA 5KG4A 5LJLA 3GT3A 3WYEA 1XL1A 2I6GA 2WB1A 2PJUA 4P3OA 1PEYA 1RK5A 2CJPA 3LQKA 3KK0A 2EJ2A 4LH6A 3A0RB 2W93A 3ZHCA 1A8UA 1YR9A 4OQYA 1BQ4A 5FUVA 3L9XA 3VUEA 4DLLA 4QJFA 1S3IA 2J6IA 2P4EA 3TX2A 1KORA 1ECFA 3CX6A 4C2TA 3FWKA 3U3OA 2XUZA 3EDMA 1JIQA 4KYVA 3B48A 4HVCA 4YCSA 5DWDA 2JLSA 3Q9LA 4OM7A 4UFOA 3IEVA 4NWIA 3ZGVA 5KFNA 4MTLA 4JXZA 4UMEA 4PTLA 3MMSA 4Q66C 4JVLA 1I3NA 3ZPXA 5IFKA 3R6GA 1ZAUA 5KFBA 1DC3A 2EBWA 1UT8A 2X0DA 1FOEB 2FU5C 5DI3A 4YDRA 2XECA 3O1LA 3K9HA 5F9HA 1TIKA 4ENRA 2P0EA 1HL7A 3DWIA 2GEUA 2PCJA 2XYHA 2IYTA 5L7WA 5HRAA 5CHEA 2VJNA 4LBVA 2VEDA 1UBFA 4BVGA 1JKFA 1H1DA 1WW3A 4AXBA 1XP8A 5KS8A 3OIYA 4X9XA 1GPWB 1MABA 3ZZ0A 1MQSA 1ANKA 3I6BA 1HR0H 1M8FA 3T1HB 3KYCB 4YMGA 4GMXA 5KHAA 2BLLA 3NEYA 2RKOA 1JZQA 4BAGA 3MF4A 1QBGA 3GFFA 1JQJC 3IP3A 1CJMA 4XWAA 1Z8NA 1G41A 2C9DA 4IAOA 4PX5A 2VSQA 3Q7IA 5B36A 1Z08A 5E0KB 1Q44A 1A3CA 5K01A 1M33A 1Y3CE 4N8DA 3R6DA 2GGSA 1HMPA 1HRDA 3RS9A 4FHCA 3HVUA 4X44A 4LOHA 2V4UA 1DJNA 1A7JA 2O57A 4QFMA 3AR8A 5JEEA 1HOXA 3CEPB 1P2DA 4ZEMA 3JYQA 5JI3E 3FOAA 1I6LA 4GR4A 1ZN7A 2BKAA 4NQRA 1W4AA 1JX6A 5JYCA 4DTCA 4OP3A 4TS4A 4EEKA 1SBIA 2CK3D 4CUJA 4MWOA 1VJCA 3BWDD 4KCGA 2HNBA 4WUVA 3FLBA 1AQIA 4YB8A 1J1ZA 4TGLA 1FIUA 4Z1OA 3E03A 1EUDB 3IUEA 1OWMA 4IDDA 1CS0B 3AHDA 3ENZA 4ZIRB 1X1AA 3K05A 3STTA 4W5QA 4JYZA 1TVEA 3GBVA 4E5SA 4W99A 4IGFA 3NJ4A 3K53A 2AI1A 3FE2A 4DPMA 1XZDA 2FPLA 4P7KA 1K06A 1LDBA 5IT4A 2WTXA 1Z2EA 4TTQA 1OFHA 4MQFA 1YD7A 5KIAA 2VDMB 5KPDA 4J4HA 1J9EA 3VTFA 4JLNA 2VOEA 4MSUA 5KNDH 3OTWA 4MS3A 1LBTA 3TXAA 2OZLA 4W5WA 1YQGA 3W5VA 3BWXA 1ZVJA 3NUZA 2VUGA 2FP3A 4UNIA 3T3PB 4MR8A 1M74A 3IPYA 4I5EA 3GFRA 5JSQA 5CXQA 4YCAA 1N9GB 3CVJA 2H2FA 4Y1RB 2YY5A 4YRBA 1JSCA 3A9UA 2IY8A 5B37A 4Y2TA 3IJ5A 1GYRA 4EB0A 1HSOA 3C14C 4MUIA 4GPD1 1JX4A 3T4XA 2FETA 1QOQB 2J3HA 3P2YA 1A7AA 1G55A 4E2XA 3QOWA 1EAMA 3PW0A 1ONOA 1ZU5A 1QHNA 3KZXA 4ZVQA 5BR8B 2GZDA 3KZKA 1V71A 2YC4C 3HBFA 1QWOA 1O0CA 5H16A 1XPRA 4KO4S 5DNUA 4BLSA 3WI7A 3CTPA 5JASA 2RJ3A 3OOSA 1LV7A 4P6VF 1KJWA 2ZUVA 3N87A 5LZ7A 1KJJA 3I64A 4GNKA 1LC0A 3T5HA 4KVAA 5BT8A 1SC1A 4BQRA 4X94A 2J33A 2CNKA 4PTYA 2B3TA 3CURA 2QTHA 1ZUNA 1P29A 1MT0A 2W6CX 3EX7C 4LX8A 1XGKA 3WRXA 4P08A 2XGJA 4FC7A 3G68A 4UM8B 2IXEA 4L9WA 4E5UA 1Y9JA 5KFWA 1Q5PA 2BHSA 5JFTA 4XGQA 1I36A 4CV1A 5CCBA 4JJ7A 3GO4A 3LH5A 1TRHA 1P81A 2C4UA 1HNZB 4CHIA 2OILA 3AVXA 4ZJYA 5HGJA 3AYHB 2Z3ZA 4Y8VA 4UE2A 5JALA 3OTQA 1ENOA 2FPXA 5SYMA 2HHCA 2JZOA 3GZJA 4MI9A 3JSLA 1P2BA 5IEJA 4NFHA 3KEOA 5KG3A 2I2CA 1T5DX 2H54A 4F0JA 5KBYA 4A3SA 1DKOA 1PQ4A 3TLYA 5EJ4A 3HOYG 3E1SA 1PWYE 1XWFA 1RJQA 5EJIA 4DLXA 3G9UA 1AXEA 4JC8A 3P9CA 3AILA 2QTMA 1D2RA 4HDRB 2Q1YA 4CV0A 4U9UA 1ZFNA 5EQJB 2J6CA 3AK4A 1CKNA 1TU0A 3RTAA 3FCOA 3GFOA 1Z6YA 1YQ9A 4UMDA 4MA0A 2FK2A 4HWGA 5FOTA 5EAIA 4RZ3A 4LHXA 4OX9Y 3LP6A 3A6EA 3HJCA 1Z15A 1V6SA 1Z2AA 2ZIEA 3TEKA 2QL5A 1IXKA 3K8YA 3CH5A 1SPBS 2JATA 2PZEA 1BEEA 4BKQA 1M67A 4EPRA 3R44A 4IKEA 2PKEA 1AK2A 2WR8A 4GMFA 5D7NA 1XDNA 3W3AH 1Y5LA 3PTZA 2HDOA 1WDLA 3JQGB 2FQYA 4CN8A 1QH8B 1X1TA 4QO8A 2J48A 5G53C 4WJZA 4BKMA 4EL0A 1GNVA 3DE5X 2CLIB 1P2VA 2FE4A 5KT4A 4DYDA 2X0NA 4P3PA 2IBMA 2MSLA 1KI1A 4MIEA 4NAHA 5D5HA 4ANFA 3RYIA 5DMXA 1AF4A 5JR3A 3LUCA 4ZAGA 1K8RA 4E5NA 3AUTA 2IEDA 2DFNA 3E23A 1A2KC 3TBHA 3AONB 3ZY4A 3RFXA 4HNTA 3BXHA 3HR8A 1XVUA 1R0RE 1PEDA 2TRSB 4RZQA 1XX6A 2DUUA 1VMAA 2OK7A 2A0KA 1W5SA 4B44A 1SRRA 5CUQA 5AW1A 2GJ8A 5K20A 2VCEA 1TGVA 3H84A 3ZNPA 4I4TF 4U7DA 1E9SA 3LHSA 1CCWA 4EEQA 4M0FA 4Z99A 1Z62A 3OCXA 3FLEA 2GNPA 5AW7A 4EF6A 1QX4A 5IMBA 4Y9UA 2BISA 1TWCA 4DJEC 2ZM6B 3LLCA 3L1VA 3OLCX 1PR3A 3CN9A 5C5CA 1FJGH 4ZVKA 3OFSA 2GZ1A 5CW1A 5CYPA 1JRLA 4BCBA 2VJMB 3ZGNA 2HPAA 1UF9A 4KX3A 1TUIA 5EXDA 3QIVA 2PLAA 3JVUA 4K1LA 3M6VA 5TT1A 3LCMA 1GU0A 3R6LA 4IWNA 1U2QA 3PUJA 2PLFA 1SXGA 4YFYA 4FDVA 2P4HX 4JWTA 4WL0A 4A0SA 4MAAA 4WOPA 3DZGA 4LHYA 1Z45A 4JEMA 5E7MA 5K09A 4G85A 3L7JA 4YH1A 3IDFA 3MTGA 4LXQA 2G4LA 1A04A 2PMEA 5AO9A 1H4QA 5K2MA 3P0FA 4Q16A 1Z3IX 1KMQA 1N48A 1GV1A 2FG5A 3Q98A 4WLOA 3O1IC 5JOQA 2JKZA 2REQA 2Y0BA 2NP6A 3S28A 1ZR4A 3G1TA 3I2FA 4X1YB 4N01A 2BFMA 5DXFA 3H1GA 2IVZA 2GD0A 2P1RA 3ZHYA 4N9QA 1LQTA 1AKMA 4ZVTA 1Q0RA 3C3PA 3HM2A 2QX4A 1SVSA 4M0JA 2HDKA 2VHJA 5KTNA 4B4VA 5F2EA 2HHLA 5B4VA 3PEVA 2ZBQA 5IRCD 4JI6H 2Q21A 3L0PA 1QDEA 1OASA 1F0PA 5FO0A 3UAVA 3CLTC 1GCIA 1QV7A 1S10A 4YBRA 3TM5A 5BR4A 3ZDDA 4HLUA 3JS5A 3L05A 5B64A 1L7DA 3IR7A 1VSTA 3W5OA 1U5BB 1QE0A 3I9KA 5AICA 4KO2S 1DIKA 4UCTA 4W5HA 3OZ7A 4Q12A 4JL5A 2IDMA 4BMOB 1SXQA 3DD5A 4MVJI 2XD9A 4ACAA 3NBUA 3DPIA 4YEDA 4YPVA 4TL8A 4ENSA 3P0JA 1Q1AA 4LRSB 2VHXA 1X8XA 4OHXA 4YALA 2R11A 5JECA 4REOA 3NBYB 3Q4GA 3DZJA 1N0WA 4XX1A 3LUJA 3RB3A 3HXLA 3RRJA 4MV0A 5LKAA 1JIUA 4W7IA 3QOFA 2FSSA 3HRHA 3L18A 2KE5A 1NKTA 4EEZA 3RR5A 2VPSA 5AHXA 1KVRA 5AI5A 1RABA 4IHJA 1T6BY 4PW0A 4QXAA 2FLVA 1BRTA 4HTFB 2DBQA 2HGSA 2Q62A 3KUCA 2QRJA 2PSEA 2R68A 4XJTA 3C0FB 4TYNA 3CPHA 1JN0A 3H5LA 1US8B 2C20A 3EZNA 3B53X 3PXXA 4HLQB 3IPLA 1XWWA 1NT4A 2DF8A 5K3AA 2X0IA 2ZTMA 1AMUA 4P0TA 5GJVC 5FNZA 3L7YA 3NTOA 3H2JA 1PRYA 3JR7A 1GT6A 2WYOA 1DV2A 4CNBA 1WUKS 5DFAA 2CLOB 1BN6A 1PT5A 3MFYA 1EGHA 1T5LA 1V5FA 5LKRA 3S2UA 1A48A 5JVDB 1AZTA 2V7EA 1RKXA 1OBDA 4EQZA 3FFXA 2NYUA 3JATA 2QVXX 1X2BA 1VGQA 5ERXA 4OHCA 2H63A 2DUNA 2OB1A 5HFNA 5E4TA 3TVYA 1MDBA 2NVUA 4PZ7A 3J80A 2JFGA 4JYMA 4M1KA 3HTXA 4NXNH 5FLEX 2JHGA 1RDFA 2AVDA 2RONA 3OJOA 2V7XA 4C3UA 1Y8AA 4R98A 3AJEA 1TOAA 4X1KB 3K73O 1RHQA 3AYXB 2ALZA 1LBIA 3BH6A 3PUHA 1OTHA 2VBFA 2DPMA 4QECA 1GNRA 1MB3A 4HPXB 3QG1A 1ML4A 3VYWA 4K0RA 3G0CA 5FBVB 1NXTA 1NP6A 4JI5B 4BS9A 4R5HA 5AK5A 7ABPA 4UNSA 2I8CA 3RBAA 3UHOA 4L72A 4GXQA 3O47A 1WHSA 3R77A 4EWLA 3HFGA 5ALXA 4TS9A 5KYYA 2Q7OE 1GM5A 4WCDA 4XYEA 1LI4A 2XEDA 5DVZA 1T13A 1D0IA 2EHJA 3QKIA 4D42A 5FPPA 5F78A 1ZX1A 3AO0B 2F1OA 2F8TA 2D1FA 3OE7A 3OJLA 1FSFA 1MAAA 4MMZB 2Z8ZA 5K6AC 1B8UA 1P9NA 3BCHA 4MGKR 4Q47A 2REBA 5CITA 4JIGA 4DB2A 3CPJB 2XUHA 4N5NA 4DLVA 4BBJA 1GR1A 3ORQA 1DCFA 3PX7A 3NASA 1G2IA 8ADHA 5AHKA 2AFRA 1N0HA 1P2TA 5BV8A 3T1HH 1RYMA 3U7EB 1YL6A 3RW9A 1DHTA 5T67A 3WRVA 2BZ1A 3LKZA 5EWEA 4TM5A 1Z17A 1FUIA 5CR5A 1WBBA 2FGKA 3S2FA 1CUZA 4CLHA 4KPFC 1DTWB 3PDJA 1YKSA 3IMCA 1P5HA 2XCQA 3WO1A 3D7SA 1HRKA 3SNOA 5TS2A 1M6HA 3L41A 4CMIA 1GCAA 3L0OA 5AKKA 2I65A 4J1SA 2R96A 2OV3A 1PR9A 5GAJA 3QVWA 2NTNA 4N5HX 2FWMX 2AK3A 4AKHA 4B47A 2V6MA 3WGVA 1EM6A 3K6SB 1USIA 1LNZA 4EBCA 1NUTA 1YCFA 3H4MA 1QIMA 5C53B 2C92A 1XE3A 3H8VA 3SBOA 1KMIY 4MEJA 4ZVUA 4FOLA 2O5RA 5DBHX 3PV0A 3JD1A 5J43A 2BH9A 3LY5A 4LMPA 1G5FA 2ZYVX 2N0SA 3OD5A 5LLSA 1XMQB 5EJEA 1KEWA 5FYQA 1T2EA 1XEXB 2C9CA 4YWHA 4Q05A 4CI0B 3W5HA 3HEAA 1ZGGA 4BZWA 1G8GA 3HVKA 2WJ4A 3KHGA 5BW8A 4A8TA 5E1MA 5JY6A 1AOXA 1J9ZA 3GD5A 5P8WA 5LP6F 5ANRB 1K0FA 4FB5A 2AX3A 2GF9A 2AX4A 3W7AA 3LX4A 1PL8A 1M2GA 3P1JA 4YI5A 2AW5A 2CLLB 4YP1A 2O7RA 3QWAA 5CFRA 4YUYA 3ZI0A 1E1CB 3F6CA 3ACDA 4BNZA 1LSUA 1A8PA 5AQEA 1KE2A 2W2OA 1Y9EA 4RF3A 4I6GA 5GWXA 1T3TA 3ZDAA 3KVRA 3K4PA 4F7WA 3L9WA 4CCSA 3LJKA 4IZOA 3QGMA 2ZDQA 2CFCA 3AXSA 3AMVA 1V5WA 4RHXA 1QDUA 3G6KA 3NGMA 3A3OA 3WIOA 1EXVA 1WMAA 4GPIB 4Y18A 4MUKA 2GAJA 1IJFA 5E95A 4LJ6A 4I1PA 1TEHA 4W7HA 4NZZA 5BR8H 3AETB 1G7RA 1R0KA 5KNBH 1II8B 3H87A 4PCUA 4M1EA 4INJA 4JQYA 4QDZA 2G5GX 1A9XA 1N2GA 3MPUA 1NF8A 2FUEA 3UJ9A 4EVRA 3S8YA 2BFFB 3ODPA 1H66A 4IUBS 3AERB 1AKEA 5HQ3A 3BXXA 3NTQA 3KU4A 2OYCA 4H4DA 1U02A 4YCCA 5HZGA 2C4HA 5IJ0A 3ZE8A 3QU7A 4P8RA 4KVFA 4ZVOA 3E5HA 2AZXA 2OQIA 4EVSA 1JKJA 1ESEA 1I33A 3T4EA 2VZEA 3D2CA 4HXEB 4UAVA 1XTKA 5LYJF 2YXLA 2QMUA 1V8PA 3ABSB 4LW8A 4O4LB 3KSDO 1EZ4A 3T35A 3U81A 5DSXA 1G6KA 1NMYA 1K2WA 3B38A 3A14A 3OHPA 3D3NA 5H1YA 4NP6A 2CC2A 4TLBA 4WZZA 4DEVA 3UV3A 1FE8A 1RD4A 5BN4A 2DABA 2EX4A 3N8DA 1DAAA 1XB2A 1ZRHA 5CD9A 2FSVA 1EIWA 2PWPA 2P6NA 4UCXA 1YB6A 2H17A 1ZO8A 3BJEA 3CT4A 3LVFO 2AQKA 1MZPA 3MWLA 2FN3A 2TMGA 1SCUA 2M1XA 3VUFA 4D9FA 5I5WA 2F9LA 3AOEA 4IGAA 4J9OA 5EJ2A 4AY2A 4IXTA 1AH2A 3VZBA 2ZATA 5GJCA 3D6NB 2OBMA 3C6ZA 3OPYA 5LOVF 5IDYA 3G2MA 3ROMA 2XA1A 1LI5A 4G8CA 1NT2A 2YZGA 2PKYX 2I9PA 3NVDA 1NLYA 2FMFA 5H9VA 5I9TA 5J2UA 1WUYA 3AEKB 4P4SB 2AFHB 1X3SA 3EQ8A 3F0TA 5A4JA 1QQ6A 3TAHA 3IEPA 4ALIA 1V8BA 4ZV4A 2H57A 3EDCA 3FYHA 1QGAA 3H2SA 1RM5A 1OX5A 1DXQA 3THWA 2B21A 3I9MA 1DV1A 1SA0A 3WGIA 3F1KA 4HO1X 2ZYAA 1L7NA 3W7VA 1C80A 4L7QA 5E2IA 3G8DA 4GBED 2AZ4A 3AYZB 1XMIA 5E9JA 1OBFO 4YRFA 3SQNA 5DDIP 3DE6X 2PG3A 4PM4A 2RGXA 2EBUA 4JC4A 3RUPA 3W1VA 5D00A 1NIJA 2COKA 1N5MA 4JSRA 1TTQB 1RCFA 4ECRA 1AF7A 3Q0IA 3U0GA 1XDUA 2DAPA 1ZRNA 1QFYA 5IK2A 2G70A 5AW4A 4JB8A 5FHRA 4JKOA 4J16A 4KMSA 4U7JA 3IFSA 1HF3A 1MX9A 1J33A 3ESZA 1BCSB 3PNSA 2H08A 4XVUA 4DDVA 5AYVA 1DSSG 2YRFA 4EYQA 4NOJA 4Q9JA 2ZM6H 2EJ0A 1UJNA 2CW5A 1TIBA 4V1CA 3CF6R 3TVTA 4CGYA 2ZOSA 2W9CA 3TTVA 3N76A 3SF8A 5THXA 5F2KA 2VTVA 2J3IA 3GQVA 1E9VA 4CM3A 1G8MA 4R0MA 5DTMA 2QNRA 2BCEA 4G1VA 4DJDC 2EIYA 3QYPA 4LYDA 1UFOA 1PU2A 4ENPA 3O94A 4BVAA 4H6VA 1XQ6A 1N0IA 3TZEA 1X0XA 2OC9A 4OLBA 1JQ5A 4CT0A 2F48A 3PFCA 3WHPA 5ILGA 3JVEA 2WNHA 3NHPA 4A8HA 2PQ2A 3P9YA 4CKBB 3QW4B 5F5XA 4E5DA 4FYXA 4S1WA 4M9XA 1CVLA 3S0JA 1A5TA 3ASVA 1CY7A 3U60B 4KK4A 5KC8A 1JVNA 3IIIA 4GPZA 3E9MA 3TL3A 1RXIA 1ZPDA 4LCJA 2EJCA 3D2AA 4JI8B 3SQDA 3A1CA 4BGVA 4KP7A 2ACWA 3ZWQA 2CXSA 1Q0UA 3EIEA 4EF4A 4CMEC 1NVTA 1PSDA 5I4BA 4BRWA 4H17A 1KSJA 3DEKA 2A33A 1PCXA 3DVAA 1ADCA 4DCCA 4IS3A 1FVHA 3R23A 1Z0JA 5FR1A 4LJ8A 1CZLA 4EP1A 1MW8X 3CEMA 1N56A 1QHFA 3K0CC 3X43A 3F3SA 2JVKA 5KFDA 4OHYA 3HDGA 2B4TO 3QE9Y 3DXZA 3EG9B 1QIHA 5EP1A 3L6CA 1QGDA 5AXBA 4RL4A 4UCUA 4LDJA 3RG8A 5IYZB 1NXWA 2DOKA 1FS4A 3TTYA 3A6KA 5AD1A 3OKFA 2GK6A 3F8TA 1E4VA 1VL1A 4LZOA 3PFWO 1U6IA 1IFXA 2HHFB 2J4FA 4CODB 2VDLB 1SOMA 1RLUA 3B6IA 2H4YA 1QGED 2HSGA 2ZWVA 4ARIA 3DOFA 3HCCA 4XGNA 3M4ZA 1RWVA 5EJ6A 1TAQA 1I1MA 3TSOA 3H1FA 4OK6A 5E2BA 1T6XA 1QCYA 1RQLA 2QUBA 3TTUA 5HR5A 3N53A 5IAOA 3V6MA 1RVV1 4F1KA 1RLMA 3FUUA 2B0JA 3I72A 2ODNA 4MMYB 1SBCA 1D4OA 3L0SA 2EJWA 3MVEA 4UCFA 3WLAA 1W85A 2V4MA 3IEXA 2ZIFA 4YXFA 4E2ZA 3DCIA 3U26A 5CVUA 4RCZA 3G9XA 3JZDA 4Q1BA 1RJWA 4LXXA 2BFEA 3BXEA 2P2CA 4ZRMA 3BSFA 3O9VA 3GRCA 3UT6A 4WKPA 4DLYA 3RVMA 1Z37A 5EWLA 2L2QA 2WBLC 3DGEC 2ZQ5A 5B1YA 3TW6A 2JC3A 1B8PA 1UXKA 2IYLD 3K9WA 2POQX 1NF9A 3N2EA 4W6ZA 4F4IA 1XTJA 5KG2A 3DOUA 2HIHA 4WZAE 4NYEA 3MCAA 4NTZA 2WWVD 5IP5A 1U0JA 3HL0A 2C2DA 2YX1A 3TR0A 2JAPA 3AESA 10MHA 4KN8A 3P2OA 1BX1A 3BBLA 3A2LA 2VWHA 4H7JA 3BXGA 2CXRA 5FJJA 5HPYB 3QLTA 3QLVC 1CPYA 3T7JA 1ZISA 1IY2A 2JANA 2GYVA