1PX2A

Crystal structure of rat synapsin i c domain complexed to ca.atp (form 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
294
Chain Sequence
b'AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTWKLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synapsin I
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 89
structure length 294
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1px2A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1px2A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1px2A02
2DIKA 3AX6A 3K3PA 4YJ2F 3JZIA 3JRWA 4EGQA 1B6RA 3HO8A 4FU0A 4O2BF 2CNUA 1EUCB 2J9GA 4IZOA 5JVLA 4TV8F 4EGJA 4YBZB 1KJIA 4ME6A 5J2UF 2IP4A 2W70A 3VPDA 1BXRA 1I7NA 2GQSA 3KAKA 1C3OA 4L1KA 4O7VA 2GPWA 5H80A 3HBLA 3SE7A 3V4SA 3BSSA 2V5AA 5D8DA 2ZDHA 3GIDA 4WBNF 4O7SA 3RV4A 2I80A 2R7KA 5C1PA 3G8DA 3WO0A 4IHJF 1EUDB 3HB9A 4HNVA 4M9UA 4EA8A 2R6FA 3K5HA 3ORRA 4M98A 3JRXA 2W6NA 3KREA 2W6OA 2YL2A 4MV7A 4FFLA 2R87A 3R23A 1JLLB 2V59A 2CQYA 5DMXA 3MWEA 3TW6A 3U54A 2XD4A 4TUYF 2FPIB 4FFOA 1EYZA 4TV9F 1T36A 2FPPB 5JQWA 2YS6A 2YZGA 4O81A 3V4ZA 3OUUA 2YS7A 3AW8A 2HJWA 1GSOA 5HBRB 4EA7A 3VMMA 1KJJA 2C00A 4HNTA 3Q1KA 3BFPA 4O4LF 2Z04A 3BSWA 3QFFA 3MJFA 4O83A 5JH7F 3UFXB 1E4EB 1DV2A 5C8YF 1AUXA 1CQIB 3ETHA 4O7RA 2VR1A 1DIKA 2R82A 3VA7A 2R86A 2W6QA 5K2MA 2X0SA 3NUAA 2FP4B 2HGSA 3WO1A 4FFNA 4MA0A 4E4TA 1W93A 3RFCA 4XZ3B 4O7YA 1EZ1A 4WD3A 2ZDQA 2DLNA 4Y8VB 4HQ6A 5HV6A 2I87A 4YAKB 3MWDA 1A9XA 1GSAA 2GQRA 3TQTA 3ORQA 4MV3A 3GLKA 2PN1A 4M9CA 4XYMB 2YRXA 4YB8B 3TIIA 1BNCA 2W6PA 4O82A 1KJQA 4EAAA 2FB9A 2Z02A 2VHEA 1KC7A 3ETJA 4DLKA 1M0WA 1OBDA 1VBGA 5KKNB 4GGMX 3E5NA 1OBGA 3VPBA 3RUPA 1KBLA 5CA0F 1PK8A 2DWCA 5JVDF 2VPQA 4FFRA 2SCUB 1IOVA 2PBZA 2GPSA 1JDBB 1UC8A 5LOVF 2QK4A 2NU8B 4I4TF 4ZI7F 5GONF 3TIGA 4RZQA 3BG5A 3VPCA 4C5AA 1EHIA 2NPOA 2R7MA 4O7WA 5CA1F 4O7LA 3WNZA 4O84A 4O7NA 4QSHA 1Z2NX 4O2AF 2V58A 5I47A 1M0TA 3RV3A 3KALA 5JQGF 2CZGA 3N6RA 1KJ9A 4O7TA 5BPFA 1JKJB 1IOWA 4MV9A 3VOTA 2NU6B 3R5FA 5C1OA 2CNVA 3U9TA 2W6MA 4DIMA 3BSYA 2I8CA 2YWVA 2CNQA 1W96A 3KAJA 1Z2PX 4O4JF 2R7LA 4MV1A 4ZQIA 3DF7A 4EA9A 1Z2OX 3LWBA 4HR7A 4IIJF 2ZDGA 3U55A 5EZYF 4C5BA 4I50F 4MV6A 4FFMA 5KX5F 2R85A 1GSHA 3R5HA 4O7ZA 3I12A 4MV8A 4ZOLF 4EG0A 5IYZF 4MAMA 1AUVA 1KJ8A 1CQJB 4FE2A 4HNUA 5LA6F 4IWYA 2R84A 2NU9B 1VKZA 4NYEA 1JDEA 1VBHA 4YAJB 2OLSA 3K5IA 4YJ3F 2GLTA 2NUAB 3U9SA 3R9RA 5LP6F 4MV4A 1GLVA 1I7LA 4O4IF 2QF7A 2VQDA 4EABA 1KUTA 2W6ZA 1WR2A 5FNVF 2YZNA 4J6EA 5J2TF 1UC9A 3G8CA 2YRWA 2YZLA 1GGOA 4IWXA 1SCUB 5CB4F 4M99A 4XX0B 1E4EA 2YZMA 4FGRA 4MA5A 3JZFA 2PVPA 2R7NA 2DZDA 1C30A 1M6VA 1CE8A 5LXTF 3OUZA 5BPHA 2P0AA 2FPGB 1ULZA 4ZHQF 1B6SA 2XCLA 3LP8A 2YYAA 5BMVF 4C5CA 4FFPA 1PX2A 3TINA 4O86A 1DV1A 1CS0A 3N8DA 4O4HF 5CAEB 2W71A 2NU7B 1KEEA 4XYLB 1A48A 3R5XA 3Q2OA 2YW2A 4I55F 5LYJF 2WYOA
chains in the Genus database with same CATH superfamily
1KO7A 4D82A 3H7IA 4ZALA 2NO7A 3NJ4A 3AR5A 1I3QA 1GKUB 3V2HA 3JS5A 5ALIA 1G6OA 3FPJA 1VJDA 1H5QA 2Q2VA 4TQ9A 3H5RA 1PJZA 4Q1AA 5FR9A 3COWA 2E21A 1JB1A 1E2UA 3GWGA 1Z0SA 5CFLA 5EG5A 4HN4B 4BHTA 1JFRA 5HCIA 2YOGA 3CEJA 1P0PA 5FLXW 5CLJA 3GNLA 4D3SA 1RWPA 4H60A 1HDRA 4GUAA 3NHWA 2ATXA 4FIZA 2DRIA 3UZUA 5FOQA 3ZCQA 3JPWA 5I7WA 2BSAA 1A5ZA 1U7WA 2QMHA 4IIFA 3TQIA 2I1LA 1LB1B 1NXVA 1JU4A 3U54A 3WHPA 4P0QB 1CJTC 5ALHA 2YRFA 4B4DA 4K05A 1K86A 4C01A 5IU6A 4KH1A 2CHUA 2G7ZA 1TMKA 3FKQA 1Y48E 1QQBA 4AF8A 3HDYA 1U0SY 3O38A 1R6UA 1U8UA 3FMGA 4G5QA 2QX9A 1C30B 1V71A 4J0QA 2CXNA 3KT8A 5KDOA 2DLCX 5BMVB 3QV1A 4GR5A 3EPPA 1LY1A 4FN5A 4QAQA 5AJZA 1E9SA 4NOKA 2W8ZA 4W5OA 3QFRA 1P1FA 5IJ0A 4UCOA 2A14A 4B3RB 3OCCA 4Q05A 2I03A 3ROPA 3JQ8B 5CEJA 3PGLA 2IELA 1SXPA 2N46A 1SKUA 3MPUA 3RIGA 1Z5WA 3N2GA 4M9CA 3SQMA 2HMAA 3HJHA 3E7DA 3AU8A 3TLGA 4DV2B 2RC6A 3ICOA 3M33A 3SGLA 4HGYA 4UM8B 2FB9A 3HSSA 3QUTA 3CXUA 4IUDS 3YASA 4A82A 4QU5A 3CVWA 4I5GA 4EFEA 1QE0A 4EENA 1NIPA 4MAAA 2FLNA 4HP8A 1OC2A 4ID9A 1XTKA 1XMOH 4MI1A 2DUMA 1Z5GA 4A5SA 3FIJA 2C99A 4YACA 2UXCB 1MAVA 2P6UA 1I2DA 4JGIA 1T8WA 3DVAB 8OHMA 3MCZA 4YK7A 1DU4A 3A2MA 2Q50A 1RDFA 4IO1A 3U49A 1HH4A 3FI0A 4TKVB 1G5FA 3DVSX 3P19A 2FRDC 1Z6TA 4N5DA 1JLSA 4ZI5A 3TLEA 4BYMA 3TQOA 2GF2A 4YJDA 2HJRA 2DR3A 4KQJA 4LGMA 3BWXA 4FYPA 3PITA 3G3EA 1ZW1A 1RK6A 2VQEH 3HDGA 1SUBA 2NXNA 4DV4H 1X1BA 2CD7A 3F7TA 4Q21A 3H1GA 5H1YA 5AW7A 2O50A 2Z5VA 3WVNA 4RU1A 4TT3A 3MJCA 4D1YA 5F1PA 3PXGA 3RS5A 5A3QA 3MGGA 5LQMA 2GZ3A 1XN4A 3ESQA 1X2EA 3C1UA 4EFKA 4PS0A 4MP6A 2WOOA 3OZBA 1MIOA 3COJA 2ANCA 1MGPA 4OHVA 2ACWA 5CBPB 1NN5A 4GPAA 4BGIA 1D1SA 3OD5A 1EDEA 3OWXA 3GLIE 2J3QA 3PGMA 1U6JA 4WK2B 5EQTA 4Q3AA 4URHA 4A0RA 2IVZA 5HMLA 1H94A 4KIJA 4V0ME 2ORYA 3EIOA 3FLBA 5KFTA 1X1DA 3HDHA 3LP8A 2YYAA 1HNXB 2BFFB 1OWLA 2WABA 3HYCA 2JA7G 5J5AA 1LDEA 4XYLB 2YW2A 1C7QA 4AO7A 4L3WA 3HCBA 5AI8A 2VNIA 4PY2A 2EOAA 4JZKA 1OWNA 3VNBA 1DO0A 1UMBB 3IJ5A 2VPTA 1G8HA 4KUEA 4XQ9A 1E61A 3KAKA 1XTBA 4BNVA 4XD2A 2X13A 5HTKA 1F8XA 2D5BA 1K9VF 1NV8A 1JMYA 2BFDB 2K4MA 5CH5A 1YL7A 5K0ZA 4PLCA 5KT4A 3EYAA 2HI0A 2OM2A 3DOOA 4OQPA 3ELUA 2ZVPX 1WIWA 3K8YA 3F3SA 2H07A 1DINA 2BR3A 3TW8A 1T8TA 4G0NA 3CPHA 3C5CA 1UJ6A 1TJPB 1QHIA 1II0A 3NBZC 3KTFA 5ALOA 4RXUA 2BMJA 3ZWQA 4AUNA 4ED2A 3JYNA 5EVJA 3BFPA 1NAIA 2HHCA 2WT9A 3QFFA 2Y6UA 2G5TA 1IY9A 4LDNA 4A1OA 4YR9A 4DPMA 1EWVA 1CQIB 4FSHA 1HL3A 3EWAA 3H99A 3HKBB 2DUUA 3HB0A 5DIFA 5EXSA 1Q21A 3BFKA 1FJHA 3R3SA 3V9AA 5A02A 3CNOA 2B8WA 3QYFA 4R1UA 1MA3A 4LYYA 1TIBA 3WE7A 4YREA 2W6ID 1M1NA 3RAPR 1QQ5A 5H9WA 2VSNA 2DUWA 2XGSA 2FFRA 3OZ7A 5GQSA 2HB6A 3HJGA 4ENTA 4UBJA 3PU6A 1UMDA 1XZKA 1SGWA 1F7VA 3LUAA 5IYZB 3L01A 2E49A 2E4AA 2YWCA 4B33A 1G2WA 3VKUA 3CCCA 4AMUA 2DFNA 1ODFA 1PT7A 4D8UA 5AD1A 2C2RA 1RSZA 1JAYA 5CD9A 3AP3A 1A4IA 4IV8A 2H1RA 5E2BA 1A96A 1MNAA 3MOIA 4G1UC 4M8IA 4DRFA 3DAFA 1DBSA 4IGEA 4DMRA 4EAAA 3W1EA 3ADKA 1IBKB 2W2NA 1CQWA 3OKFA 5K0FA 2P27A 3T7IA 3R7WB 1P2VA 3C0KA 3FVQA 4C14A 2EERA 1YDMA 2A9RA 1HDZA 4ZK6A 3CUYA 1O94A 3U37A 4TKZA 1M9NA 5ADHA 5AKYA 1TCVA 2RI1A 3TXXA 1FSPA 3PHGA 4IGAA 2TMKA 3JQDA 3HVKA 3I37X 1JHVA 3H7AA 5LDGA 4NCXA 4H3SA 3X1MA 2ZSHA 1FSGA 3KQWA 3CO5A 2WUDA 2XRMA 2NVYA 1MB4A 1OV6A 4M38A 1BOFA 4FGWA 1CQPA 1E9EA 2C2MA 2JI6A 1Y6FA 1FYDA 4IX9A 2P3SA 4IZIA 1S3GA 4CCYB 2ZJ0A 4OJNA 3FFXA 2GCNA 3QI2A 3R5HA 2E6UX 2R97A 2WWTA 2AX3A 4EYOA 3RPEA 3RCBA 4GW3A 3SC3A 3RIZA 1H2AS 1RI5A 2R8XA 1HE3A 3TPCA 2A5JA 1DXQA 3JY6A 5JISA 5BY2A 3Q3EA 1W2WB 2QPTA 4IOKA 1EBBA 1P3Y1 4KYTA 3PUIA 5ALSA 4URYR 4N7BA 3CVYA 1ADCA 2HZ7A 2WFMA 1V9SA 3TTUA 2YZLA 5DHRA 3B6KA 3A3NA 3JD3A 5FPKA 5JAIA 3MBOA 4ZQGA 3ZHSA 3KB6A 4UDOA 4DRXA 1UEJA 1VCNA 2VA9A 4NQRA 4L6IA 3MINB 4HNQA 5AMXA 1V16A 1O6FA 3QPUA 2A8YA 2ZT7A 2A7QA 4JN6B 3RABA 1T8SA 5AM4A 2EJWA 1Z0KA 5KNBH 1U4OA 1V41E 1WLSA 3DVRX 2DPIA 4KQ9A 2Y1FA 4G8JA 1P39A 2HFJA 3A6LA 5KHLB 1TWCA 4AYXA 3OPQA 4DV0B 4S0ZA 2DBRA 3VR2D 3WWEA 4BLOA 1FMFA 2A1UB 2Q5IA 4JR2A 1FZQA 4D0NA 4Z0NA 3TM5A 3PCXA 4P7FA 1GFIA 3MW8A 1VIMA 1HE2A 4E5UA 4AJ2A 4EB0A 2KLBA 1GADO 4MH0R 2WAYA 3E9DA 1WSBA 3GMDA 2Y2UA 4GBED 4DARA 1EUYA 1VB5A 3WBKA 4WACA 3OCYA 4I9FA 2ZM5A 2OK8A 1AZWA 1FNDA 4F60A 4GR9A 1MAWA 1YR7A 3ZE6A 3FTPA 4PYMA 2WMYA 1J99A 1G5IA 1KQOA 2P5UA 1MFZA 5I7UA 5CURA 4KBFA 3ZNOA 1ZN8A 2ZQ5A 1T36A 4BMVA 1T0HB 5L3RA 5BMVA 3ZDCA 2JFYA 1F9AA 3O4IA 3LXUX 5AR1A 4BFWA 3UJAA 3VR5H 1I3LA 4A3LG 2JGNA 3O7WA 3KSDO 4RPGA 3ZGVA 1XZIA 2XE8A 1TI7A 3JQ8A 1E2EA 3QTLA 1HI9A 521PA 3QBJA 3NTRA 5DGIA 5EZ5A 4KR0A 2B7CA 2XZTA 4OBWA 1CFJA 5DHSA 1LTKA 1ZH8A 2QAGC 3QHQA 4M1SA 3RADC 2W37A 4D8XA 1WU7A 1W76A 4F4ZA 2OAP1 4RA9B 3ADPA 4WZBA 3MHPA 2YOHA 2ZRLA 5HTOA 4YRDA 1YZVA 4X71A 2K2WA 4WTOA 3QXSA 1DO2A 1UPXA 4OIFA 1TVEA 2JFGA 1YVEI 5ERYA 3DZFA 5E1MA 3S3TA 1BXRB 5AQEA 3USZA 2VHYA 3IIEA 3H6HA 3ZK9A 2JRLA 1PWHA 3K71B 4HFMA 4CV3A 2GJSA 4AJKA 2I2WA 3QKIA 2CUKA 1KZ6A 4RCYA 2P3OA 3DMFA 1W4ZA 3ZD6A 4C6TB 4WXRA 3C16C 2D54A 4FYIA 1U9IC 4RO0A 1UBNA 3IP5A 4N3AA 2HMVA 2Z1NA 5E6SA 3KDSE 2ZYTX 2Y0CA 3QQPA 4RMHA 1E6CA 2FNAA 2WJYA 2ZSBA 3CRRA 5E1BA 1GZSA 3GFFA 2GKGA 1W5EA 3PPXA 1W59A 3PHBE 2ANBA 3PR3A 3JZAA 1IUNA 1DQZA 3EIXA 4QDOA 2CNQA 3F7NA 3TVTA 3OZFA 2O2CA 4G0YA 2UU9B 1XZGA 1EFAA 4KO1S 4PYRA 1T1RA 4Q4HB 1C4KA 1THMA 5KYKA 4MV8A 2VOJA 3MGAA 5AJXA 2A0FA 3AOEC 4N0PA 2H92A 3RJTA 4QT4A 1CQJB 1PYOA 5K20A 4CIAA 3UHFA 5LC1A 5CBPA 4YQFA 3VSCA 4E6EA 2LV8A 2MHCA 5CDHA 3GQCA 1NYRA 2P91A 2WJ6A 2WDTA 1L5SA 1F2VA 1MW8X 4JZYA 4OA8A 2CW5A 1RWXA 4C0AC 1B6GA 1Y5LA 3RHTA 1IBKH 5J2TF 2OO5A 2J3KA 5INTA 4RLQA 2B35A 5KFFA 1W73A 3THYB 1OSNA 3NBYC 5IP9G 2BFFA 3T1YB 3L1JA 3CGGA 3OCZA 2H06A 3AYHB 2CY0A 5CM8B 4LX8A 4QDKA 1AIPA 1PTJC 5LUAA 4H7HA 4AIRA 4WT7A 2IX3A 4S1NA 2B0CA 4ACAA 2PUCA 1U2GA 3IKJA 2D7CA 1Y1QA 1QSGA 4V38A 5ERGB 2IXBA 2B4TO 2GD6A 4DC1A 2FK7A 2YJ3A 4L7QA 5LYJF 2XKAA 2C97A 3H5OA 2OENG 5I7FA 1RWMA 2FPLA 1KWGA 4MYRA 1P1RA 3UJPA 2E89A 1LJ8A 3OLWA 3O1HB 4RFLA 4Q44A 4TLDA 1YQQA 4NBUA 3E0QA 4ER5A 1KMMA 6Q21A 4C7MA 1O77A 1NATA 4FJ0A 2Y0SA 2E4UA 4FZJA 3JX9A 4K0RA 2Z9CA 3OE1A 5E3IA 4Q01A 1S2NA 4TMVA 4JV2A 3PO2G 1B0UA 5F3DA 4OJTA 1YOBA 3V7YA 3PDHA 5BVHB 3SNOA 2VQSA 4OQZA 2CZCA 5TLSA 2OQRA 5J4KA 5LNK1 4IICA 3NBUA 1CQIA 4W7SA 1Z17A 4N0QA 2A88A 4OHFA 4XGNA 4XTCS 4BRUA 2IHBA 3PEUA 2DP4E 3MFIA 4I8IA 2QROA 3WYGA 4FS1A 2PL9A 2PYIA 1A0GA 1T9BA 3N8HA 4OM7A 5B36A 1MRNA 1N6NA 1WBBA 4KMRA 4P80A 3SIWA 5IVIA 4GMFA 2B1JA 3T9CA 2VDRB 2CLFB 1EINA 5FYDA 3DONA 2G6BA 4KXXA 2HLDA 4EK9A 4D8TA 3WP0A 3NUAA 1UT6A 1ETUA 3KYHC 2VH5R 1O5TA 3ZD9A 5DW3A 2WFZA 2CDBA 4J29A 3K0BA 1JWBB 2Q8PA 4R7ZA 5F52A 1I2LA 4DV0H 4A6PA 3A4TA 4KQWA 4B5KA 1TQHA 3FZGA 1DPFA 3M4NA 4IIXA 2ZJ7A 4CL3A 2DSTA 3UJBA 3DJFA 4LZPA 2NPFA 4N4AA 2VN8A 2F1IA 1DJOA 1IE3A 4EDHA 1TTHA 3S81A 1P9NA 5CCDA 1Z6PA 1ZGAA 5FTLA 5DGBA 5DN6A 4I2VA 4PPNA 4MYHA 3JYOA 3WK6A 4CM6A 2QI9C 3Q9SA 3GP5A 2EC5A 2R6GA 4QPPA 3ONEA 4AW9A 4IHQA 2PCLA 4CKWB 3WGYA 1OROA 3S2EA 4CF7A 1IQPA 2DOKA 1J39A 4OREX 1YC5A 5FJJA 4BMSA 3A58B 2ZI6A 2Q41A 1NGSA 1GPUA 2VPYA 3GJXC 4K9LA 3WHLA 4R8LA 1IOWA 1TMYA 3GIWA 4Z3KA 3H3VH 2IZ0A 1M6HA 1TECE 1W7AA 1SCDA 3CH7A 1KI2A 5JO0A 3VUEA 2PX5A 2F3QA 1TUBB 3QXXA 1U1DA 1BWSA 1QIGA 2Q3DA 1QIFA 3ZJ5A 5FI3A 3OHAA 3QLVA 2EZ9A 1C7EA 1D2NA 1MO3A 3GTLA 3DE5X 2PZBA 1TFUA 1GSHA 3I12A 2WF9A 2TMGA 1A27A 3S1AA 3DAAA 4TSFD 4ROSA 2Z95A 1RC8A 5IHPA 1KYIA 1QOZA 4RH0A 3KLOA 3OPVA 1Z3CA 3GFRA 1QKIA 4GX0A 2B98A 4OQ4A 1VPLA 4O1HA 5CA0A 2C07A 5F77A 5CG2A 4ECSA 4BX0A 3MT7A 3SJZA 3ADDA 3R6LA 4RC9A 3N0TA 3M6WA 3FPHA 1DQNA 2VP0A 3L7LA 2ZJYA 1TU4A 1U0EA 1JDBC 5FULA 1QB7A 3L1UA 3OOYA 4W8HA 5BR7A 3X2FA 1S0OA 2XCSB 1T5LA 2BBTA 1EEXB 1DKPA 3HA5A 4FGRA 4JEHA 2YY7A 1D2CA 3UT5B 2UXDH 5IXSA 3UQYS 5FBQB 2RJNA 5B7NA 4RTQA 4Z4IA 5IKEA 4JOCA 1LV8A 3ZOZA 3B1ZA 3K1JA 1ENOA 5TMBA 5EJGA 4WKNA 3WZLA 2CJWA 5ARBA 3TY8A 5HJEA 4O86A 3GLVA 2E9SA 4JI7B 3EVZA 4KQHA 1QAMA 3LFTA 5SYMA 1R6VA 4OHXA 1NHWA 5DLFA 4R2HA 3PNLA 3AVXA 2UU9H 2MYNA 4GMHA 3RLIA 4N82A 3OPYI 2PGAA 3A9WA 4JJEA 3S2UA 2BDEA 4D6XA 3OA0A 4F3KA 3M9LA 3QZ7A 2ZSFA 4U9UA 3K70D 7ABPA 4ECZA 2GQSA 1L1QA 3SX4A 5CXQA 4P58A 4BLQA 4X1OA 4LJLA 2ZRQA 3PD1A 1WWKA 3CB2A 4PSKA 4LZWA 3AY6A 2RHTA 1O95D 1W5TA 5KTNA 4E2YA 2GF9A 3TI7A 2QUHA 2H16A 3FOZA 1M5UA 3JSXA 4MWBA 1IBSA 2H0AA 4KJZA 3WTBA 1YE3A 3AGPA 3TX6A 1CJKC 1U0FA 4J4BA 1QYVA 1C0PA 5JNRA 4YX9A 5KFYA 3WDLA 3GAFA 5DHQA 2W8KA 1OZHA 2N1MA 3O6VA 3P5BA 4UZFA 4ETNA 2VDKB 3KM0A 1FFGA 4JX9A 4LRQA 2OV2A 3C5EA 4ZVPA 5I9BA 4N3NA 4BVKA 3DQPA 3W1GA 2CJYA 2ASJA 3RVDA 1UKBA 5JASA 2BGWA 4H9GA 2XECA 3QKRA 4HBZA 4FDAA 1P75A 3HKZE 4FNMA 1CD5A 5LBUA 1NW9B 1AHIA 1NASA 1RNLA 5EJ2A 1RQRA 3SNKA 2WWXA 4HY3A 1RBQA 3ESRA 4RVGA 2SICE 3M9NB 4WPGA 4C6TA 1JBQA 3DE4X 4LE0A 3VQTA 5CX1A 3EFOB 2PYDA 3PK0A 3OFJA 2XTJA 2VJQA 1ZMRA 3DKPA 3ZWVA 2M6KA 1I3CA 5IVHA 2BGNA 3RUPA 4HVAA 4XYEA 5D01A 2WK1A 1T6YA 1JDUA 4JP3A 4C08A 4IKEA 4C4YA 1GTVA 3LOPA 3F3KA 2JGKA 3D0QA 3UK2A 4ER7A 3OESA 4P2BA 3TIGA 3TG2A 4E94A 4YDRA 4F06A 4O84A 2FW9A 5T64A 3K2BA 2QZ4A 4MW0A 3RS2A 1Z38A 4CG1A 1TO1E 4Q4HA 4KDEA 1QG2A 1XTJA 4BQRA 2HNBA 2W2QA 3Q85A 1TYCA 2NZUG 2EJTA 3OE7A 4EQ6B 1QM5A 4YYZA 4ITRC 1E7RA 1R5NA 4MV1A 1CQJA 2QTTA 1EX1A 2VYCA 1JG6A 3QMPA 3A31A 1IB6A 4I5FA 1C7JA 4DNFA 2CDAA 2WB1A 3DFUA 1Y5NA 3L18A 3W9YA 2OWDA 3E0XA 2XY4A 2H7CA 5JO9A 1AUVA 4BP9A 1WCMA 2JANA 2R84A 2DWUA 1AKTA 5FXMA 1YZGA 5TQ2B 1AXGA 3AUUA 3ET4A 1ESEA 3T5BA 2VJBA 1L7RA 1V4BA 4AJ9A 1H2XA 4IWNA 3ZDQA 1IFXA 3LMKA 4NG5A 3B9QA 4ARUA 4NE9A 2Z8ZA 1CRLA 2QI9F 3IMKA 4KX5A 5EXTA 3WHKA 2WJ3A 5JVDB 4JBWA 1XAIA 2NTYC 3HB5X 2GF0A 4LV5B 1CT9A 1WEKA 4WOKA 5KQGA 2Y4OA 3SHFA 2OYRA 4JSRA 3B1VA 3W2IA 5KQRA 5LKRA 4AZ0B 4UEOA 4R3UC 4MVJM 3Q7RA 3UBMA 3KP1A 4XD7A 4F46A 3SCZA 4HZGA 2JFFA 3OZEA 1J22A 4HN9A 2VKTA 4NCIA 1QZUA 3CBQA 1Z2AA 4EKEA 2AFHE 3LSTA 1JI3A 5C1BA 2ZRGA 4DGSA 5KU7A 1EGVB 1T3HA 4IDGA 3WK4A 3JTMA 1DAGA 2EU8A 1B00A 2IP4A 1OX6A 4HTFA 5BVHA 1M6EX 2HUNA 1F17A 4DZZA 2AG5A 4JI5B 2PUAA 2ZROA 3JVEA 2GZAA 3WLTA 3EXIB 1AKVA 4BB0A 5THQA 3UOWA 3NS7A 2XCRB 3KR1A 2HHHB 2ID7A 2V03A 1NUPA 2BKUA 1KAQA 4TTTS 1K7XB 1D07A 4FKMA 3L6RA 2HF7A 4M22A 2PZKA 4XVCA 4HX2A 3KJHA 4IF6A 1OIXA 1PJLA 3IEIA 3L93A 4BLTA 1XROA 2YCBA 3CZ5A 1ZOPA 5L9XA 2ZSDA 4C2AA 3MK31 3FMFA 3B1XA 4OUKX 2A7XA 1VIYA 1AKEA 2BC9A 2QW0X 1KBQA 2DUJA 2OL4A 2Y9PB 1U99A 1K5HA 1ZH0A 3IP9A 4JI7H 4Y6LA 1ITZA 4Q43A 2DLNA 1OFUA 3U4QB 1O58A 2EZUA 5DM0A 5T4FA 2DQZA 3OSNA 1XRLA 3EEQA 2DX7A 1EXWA 1KMNA 4FVTA 1G2PA 4KQMA 3VR6D 3FSJX 5HE8A 4BX2A 3KU4A 1MO4A 2I6UA 2CUNA 4BV8A 5BR1A 4D44A 3NGLA 1YL6A 1A2BA 3W4KA 5FPHA 2DFLA 3L6EA 4CKWA 3GDEA 2BFBA 3FCSB 4UUPA 2XKJE 3M4ZA 4QOJA 3NAGA 2XQGA 4RKEA 1V4VA 4OO3A 2YNMD 4RTRA 4G0UA 3SR0A 1PS0A 4MR7B 2FVXA 2WP0A 3SKVA 4AX8A 4J0EA 2OZLB 4RJJA 3ZS9A 4GVLA 4P6VF 4M55A 1C3VA 3TD2A 1DIRA 3DBLB 5GMOA 1ODTC 4RZQA 2HPZA 1T9AA 2IC5A 3JARB 3WR5A 3F4LA 3RWBA 4HDKA 3GNSA 1AZSC 3VAAA 4ZO6A 1N5MA 3D6VA 4KGVA 1RJRA 1CRPA 4US2R 2X2EA 3KOUA 1GG8A 2J9FB 2ZYGA 5ESWA 1BX3A 4Q4JB 3ISTA 2ZITA 2W6MA 1QWSA 5ER9A 3AF0A 1AZTA 1B0AA 4M0DA 3SEQA 3AT1A 2E5LH 5B2EA 1MDFA 1DEAA 1D04A 3CCBA 4X7RA 5BNFA 4UUAA 4MV6A 2X58A 4JBLA 1VZ2A 3P9IA 1TA4A 3MAGA 4Q9KA 4P5EA 4L9AA 2ZVJA 3IJRA 2IX9A 3RTDA 4PC2A 3IPCA 1GGNA 2Z2YA 5I7EA 1SHZA 5BUCA 4D5EA 3ENNA 4JEUA 2WVGA 2IBSA 2HHFB 2BI4A 2Y99A 4GM4A 5A4KA 1XMVA 3GEEA 3UT5A 4XUGB 4YDSA 2D5CA 2Z3WA 2ZTHA 1S02A 4XGKA 3M4YA 4QQKA 5D7BA 4ZARA 3HKCB 1KOLA 2JRCA 5M04A 3LPAA 1XMOB 3V6HA 1TT7A 4LG1A 3PLNA 3IE2A 4ZHQA 4TM8A 3D2LA 2GK3A 2SBTA 4MRPA 4BBZA 1C0LA 2PKYX 3B7PA 2Y1DA 1JL3A 3DR3A 3ZV3A 1Q0PA 2Z2IA 1H2ZA 1VHTA 2G71A 3H65A 4HAYA 5KEIA 2GTIA 1BQEA 3M6XA 1DQRA 5HGJA 1U3DA 2YU9A 4GM1A 5FTMA 5JY6A 5CHEA 2PZJA 4F86A 3O8NA 2ABWA 1NPTO 2KX7A 3PUWA 4TLCA 2VQEB 4KREA 3TVDA 4QJFA 4EY6A 3EG5A 2RHDA 3LY9A 2J6BA 4JOSA 3VISA 1BX0A 3HXKA 3ONDA 4BNTA 1G1MA 1RRGA 5FH9A 3N8NA 4KSBA 4LN1A 4NE2A 2BKAA 2HOQA 1TAGA 1OGJA 5F2NA 2ZUCA 1N2JA 3H9QA 4OGLA 1LCIA 1P73A 2LP4Y 1D2EA 1VYUA 3LYHA 1EUDB 2VZLA 3FJ1A 4OSOA 2D1FA 3VH1A 3G0HA 3QPVA 4H3HB 1T6NA 2PA3A 4F97A 2Z2JA 3LX4A 3QIVA 3C8MA 2GEUA 3GVHA 5DBHX 2AOXA 1E4OA 4NRDA 3TSAA 4QZVA 3V1TC 4MWOA 2XE4A 4QXRA 5IX8A 2V7BA 4PSVA 3VAYA 5LJIA 1WUKS 3AF1A 4OQNA 4C3OB 1XCMA 2X4IA 1CUEA 3L9XA 3OZUA 3R0ZA 2IF2A 3D6HA 3PBKA 1YK0A 3ULKA 5GVRA 6NULA 5HEKA 2HEGA 3EPRA 3C45A 1CR6A 1HRDA 4IS2A 1P4JA 4G5HA 1GKLA 2JZNA 4LH7A 1ZD4A 1TLLA 5JPCA 3ELDA 4ZKEA 5ILQA 3OQVA 3FDZB 3UJCA 2WTNA 3RO7A 2NX2A 4DUPA 4ZIRA 4HRYA 4B2LA 1Y80A 3KT3A 2VYFA 3GFVA 4Z0PA 5BWTA 4RLFA 3AUYA 1OWMA 4JU8A 4ZVQA 1XUOA 2VF8A 4Q3KA 5CT9A 1Z34A 1ZJJA 5CJJA 4K3VA 3AY3A 3M83A 5JAMA 4RGBA 2ZCUA 4GOOD 4XFJA 3TQSA 5GV7A 5LD2B 4CMIB 2IZ5A 1L1FA 2HHHH 2V0CA 4KE7A 1NKVA 2VPQA 4X6LA 3MD9A 2XSZD 4YVFA 3V2UA 1UZNA 2PR2A 1SA0A 2OR3A 1EUZA 1DAEA 3KD3A 5EE1A 2VP9A 2IOHA 3FAKA 4YNBA 2YYSA 2FR1A 1S3SA 2CCGA 4GM0A 1NURA 3CNNA 4UHCA 3QHAA 4DS3A 3TGLA 4MCIA 5JHHB 4YR3A 4NMHA 2DFPA 2P9HA 2JFZA 2C3YA 2VZ8A 1EH5A 1R5BA 2AMJA 1VKJA 4HDAA 1N33H 1V11A 4WL0A 3LHFA 1GQOA 4EPYA 4NS1A 1NX9A 2JA5A 1QNFA 4UJ3A 3Q12A 5LQCA 1P62B 5HM6A 1C2YA 3QE3A 3K0KA 3ZU6A 4NYJQ 2W8BB 4S05A 1XVVA 3RHFA 1CX9B 4F2PA 1T1GA 2X5OA 1TRKA 1EFVA 3HACA 4N7RA 5ER6A 1ZL0A 5FL7A 3AF5A 1CHNA 4HV4A 4IWYA 1GYPA 3SK0A 2JGFA 1SXJA 1EVKA 1KE2A 1MXHA 4B31A 5EFOA 3LP5A 3B9PA 4O4IF 4KP7A 4PNPA 3CZMA 1BD3A 1C80A 3QKSB 1UM8A 4GP9A 4JI1B 5LDDC 5DH9A 1KOFA 2UDPA 1U8TA 1DJMA 2YJ4A 4AZ0A 2O7RA 2XMSA 3OIVA 1YMVA 1AA6A 2GBCA 2JPDA 3QX3A 1I10A 3GLGB 2O8DB 4BJ3A 2FN9A 2CFCA 1EAYA 1EP2B 1IN5A 2HR1A 1THTA 1FQKA 3T41A 5HIAA 4HEHA 1KI3A 3SM3A 3RJZA 3AG5A 2XNDA 4CFYA 3P0HA 3R0JA 1UQUA 1G7CA 2EKBA 2VTKA 2MIIA 3KQLA 3LYLA 2VA8A 1Z6ZA 4KMMA 3PW7A 3H87A 4I55F 1NU6A 1H3NA 3C3DA 3OSUA 2R25B 4HK4A 2REXB 4EQZA 1C9KA 1XQ9A 2YJNA 1HK7A 2GJKA 3H1FA 1Z4JA 1ML4A 4M21A 3UMGA 2GNPA 1JEYA 1XQVA 4BJ1A 2FPWA 3PZRA 2GDJA 4DM3A 5J1TB 2WJHA 3V7UA 5JBQA 4G86A 2ZS8A 4OHCA 1X80A 1M10A 1BS9A 2FQ1A 1L1RA 4AP6A 3WSVA 3U5TA 4HADA 3GV8B 1SKMA 3ICCA 3PHLA 3ZR4B 3CM0A 2Q21A 5ENDA 3OMLA 4ZTUB 3IGFA 2P35A 4PLYA 1XQ6A 2R92G 2J3MA 4OP1A 1Q74A 1T4GA 3ADOA 2PTHA 1ADBA 4DDWA 1M5RA 2EGGA 2XRFA 3PFHA 4LXGA 1J06A 4Q12A 5G53C 4GKJH 4RQUA 4V2IA 5AVUA 4FYMA 1VSQA 3GN2A 4AQYH 4EI9A 3Q0EA 3U4QA 1CC1S 4WGGA 4HDMA 5I7SA 2DULA 2YN2A 4FKBA 1G60A 3SLKA 2W9CB 2CE2X 2R6DA 3I83A 4X20B 2AVDA 4L73A 4BO8A 1H2YA 5I60A 1HZJA 3IBFA 1SMKA 3W2HA 1IXYA 1YONA 4LXYA 4PQYA 3B3QA 2C5HA 3DWIA 2QYSA 4N40A 1E9VA 2HXGA 1QHHB 1NQ5A 4BNZA 2WI8A 5FBKA 1J8MF 1IJEA 3SZRA 4AQ7A 5U4QA 4YFVA 4AKSA 1E1RA 1BE0A 1W34A 1IH8A 4Q24A 4ZVTA 1KXJA 3B5JA 1PNRA 3Q8QB 3Q87B 3KSUA 1XRRA 3G9UA 2GTPA 5THXA 4J0FA 3EVNA 3FCAA 1LVUA 3ETJA 3NM6B 1DAHA 2APJA 1VBGA 4HH3C 5JEDA 4RSRA 1QKJA 3NUQA 4Y30A 1V9CA 2ZRHA 3IEXA 2QRNA 3CNBA 4U7WA 3WAGA 3MTBA 2PBZA 4RVSA 2FEAA 2JIZA 3T7RA 1WV0A 5TJHA 1MOQA 5EXDA 3IUJA 4K5QA 3SQWA 2NNWB 4RTKA 3UC9A 1TNDA 3JQ6A 1E20A 2QDXA 3E6AA 4JVSB 1Z2NX 4BJ5A 2C4MA 2B25A 3LC0A 3JVVA 3I4LA 3LPDA 5EN4A 3MJSA 4ND7A 5DWVA 1TA8A 3AR6A 5IZCC 3EQ2A 2C2DA 4K8OA 1SG6A 1IYZA 1N5DA 1ORRA 3AHHA 2LCQA 1VJCA 1RM5A 1SCNE 2XVMA 1FUYB 5EXEA 5KFLA 3X44A 1TCUA 2HSDA 5EP2A 3G2HA 1SQFA 1NZDA 3IAS6 3KD2A 2FWIA 1WKBA 3BCUA 2G5CA 3PR5B 1R3UA 3OECA 2WHPB 1VBHA 4BQPA 3HADA 1HLGA 3USCS 3EEBA 4HNAB 4L3VA 2WWFA 3P1JA 4ZANA 2GA8A 2QZJA 2NO4A 4ID3A 2YVUA 1T5OA 2B0JA 2JVKA 4UPVA 4OYLA 2ZPAA 4ZT7A 4P33A 3HU1A 1R0BA 1Z8NA 3QSGA 2BFWA 2HVRA 3I6IA 2D1RA 1Y6ZA 4U2DA 2F48A 4ABYA 4JXUA 5CB0A 4J2TA 1NPDA 1Z0AA 4L4RA 3HXTA 4WOJA 2JFXA 5EI5A 1P45A 3E9EA 5E7QA 5EPOA 5THKA 2W83A 2WA2A 2G09A 2OXCA 2FFJA 4RORA 2K7ZA 4TTVA 3ASUA 1BWRA 4YRZA 5T67A 1IHDA 2VZEA 3HR4A 2B7LA 1I4EB 1B7GO 1E3JA 2QS9A 4JBNA 4QVIA 3FPFA 1KOJA 1XDBA 2H2AA 4LDZA 1IN6A 1AE1A 2XQIA 3RIYA 3J7AK 1NR5A 1YH3A 4NCBA 1JIVA 1LTHR 2PIDA 3KHLA 4HPXB 1P7YA 4RPJA 2OSVA 3AUJB 3NFRA 1PV2A 1QAOA 3GLSA 3CH4B 2GD2A 1PR1A 1G38A 2WVJA 1SURA 2WZQA 2CSXA 3PFCA 2R79A 2ZYAA 1EM6A 5EQDA 4UU7A 4ZEVA 3WISA 2IP1A 5MFPA 2GEVA 4G6ZA 4DUZB 4PGHA 4PG4A 4U2EA 3TDNA 3DL7A 3LRPA 2GM4A 1YL5A 2ZJ1A 3HXOA 4JI1H 2ODWA 4E5DA 2EJ2A 4QUGA 1E4GT 3OZGA 1L5GB 3KKLA 1L6RA 2X8LA 2ZK7A 5CDFE 1E2PA 1UKVY 3SEFA 2YX1A 4RZIA 1XTVA 1FDSA 1QGOA 3ACCA 4D9HA 3CCFA 1DMSA 2BFEB 1HE8B 4OD0A 5IDXA 4P4UA 2QBYB 2R86A 2GUGA 2H2WA 3KFVA 2NM0A 2E48A 4DV1B 1X9GA 5K99A 4JKYA 1EJ6A 3EQ6A 3FPKA 4UNRA 1ZQ9A 5DFAA 4GI7A 1TWAA 4MDYA 2CDRA 3UF0A 4HVLA 4H18A 4IQ8A 5B2ZA 3KLMX 4ZC1A 2P41A 4DLSA 1Y7IA 4Y7CA 1Y8AA 3G5TA 2HPHA 3FZQA 1X1AA 3W05A 1OXTA 1DKQA 3M1IA 2AXNA 4JODA 3PQDA 1J25A 2QGNA 3GQBB 3NWBA 1P1HA 4CMIA 1NW4A 1BMQA 1H23A 3QU7A 5CVJA 5HXAA 1QP4A 2Y68A 1QNLA 2X86A 2Z2XA 4Y1RA 2WJWA 2EKZA 5JS6A 3NIDB 4UTNA 1G2IA 1VP9A 2WFLB 3G49A 2GCPA 2EKLA 2C82A 1RLUA 1XNJA 4FQ8A 2I7DA 1ZA2A 1KZ7B 1OT5A 2EATA 3G2IA 4JQZA 2YY5A 4BO4A 1HM5A 1QC5A 1KEWA 5A6SA 3IDQA 2EQ5A 2NO0A 2B6HA 4DR5H 3LNCA 4YUZA 2PRKA 4EBFA 3GNTA 3WLLA 4LEIA 1GPYA 1XPRA 3G1WA 2W9XA 1GRNA 4IIDA 4X7BA 2Q3HA 3NGMA 4N7JA 3CH5A 5F2EA 2R4UA 3ETEA 1XI2A 5IBCA 3DTYA 6REQB 2B7BA 4V2UA 4EA9A 2DWQA 2HBYA 1JKXA 5B55A 5AHKA 1SIUA 1PNOA 5T8KA 1DKOA 1MXFA 4BWYA 5FPTA 3Q10A 4A92A 4UASA 5KCMA 4HWSA 2L0XA 2D74A 3IUEA 2IWHA 4K2AA 3IVGA 1DEHA 3IB3A 1TE2A 3URMA 2C94A 1TEVA 1L4HA 2EKDA 4M88A 4NYEA 4W5JA 5JJIA 3II6X 1WM1A 5LU8A 3VKVA 3HEAA 5DBFA 4RD1A 5KYUB 4A2QA 3LIPA 2O8DA 2OG2A 4J0HA 4WZAE 2LCIA 2EARA 4TMWA 2IH2A 3NYQA 6LDHA 2QYTA 2VDOB 4QVGA 1GKIA 5IWCA 1XZAA 3E15A 2WDZA 1VXRA 4F9FA 4CXMA 1E5VA 2PL5A 3JAKB 3CLSC 1DQSA 3NONA 1C30A 2ASDA 5CT5A 5DYNA 3BQ1A 1HT0A 2RHJA 1MC5A 1IUKA 2BP7B 1FXSA 5C2JB 4FYYA 4P31A 4XE5A 3OOSA 4G5RA 3P9NA 4C0KA 4WXMA 1M6VB 1EWTA 3DVLA 5BWXA 2HF2A 1TZMA 1WBDA 4WV3A 3RUDA 5ADUS 3HYSA 5JYCA 3MWGA 3WWOA 3KUUA 4RCZA 5H02A 2OYCA 4PNEA 4TTSA 1TD1A 2UVDA 3LVBA 4JGBA 3VFDA 2P5SA 4YN3A 4ZOAA 3AI3A 5DSTA 1NBWB 2C4KA 3BX1A 1EBUA 3H84A 2L17A 4KI7A 2PZMA 4M86A 4QVKA 1SJ9A 2IYFA 3PFFA 4J07A 1T5IA 5EDWA 3T9DA 8ATCA 3WKBA 3K1AB 4KRFA 3RK1A 1JN0A 5EJIA 3QVVA 2B6NA 1J9ZA 1Z4QA 1E5LA 2AOUB 3M49A 2Q0QA 3P8ZA 5HRUA 2PMCA 4P4SB 3HOXG 1T0IA 5KNBA 4B8ZA 3DO5A 1E2FA 5DMXA 5LQKA 3GMIA 2I6QA 3FDSA 3DVAA 5AK6A 4DJAA 4FINA 3OFKA 5K3CA 1QVZA 2ZBQA 2UXDB 4TKVA 3RBXA 4AS1A 4X20A 2ZXEA 3FWKA 3OLZA 5FYQA 2W2VA 3HABA 4BV9A 2GAIA 2ZZMA 2ENUA 1YJ8A 4EBCA 4ECTA 3RFXA 1DIKA 3AERB 1F8YA 4Y2GA 5ETJA 3ZX4A 2IV2X 5LP1A 5EIXA 2AUTA 4D25A 3WS7A 3WBBA 5KPJA 1T9GS 2AYXA 2I22A 3UEOA 2OGTA 3KHTA 4DIOA 1XE3A 2F9FA 2I4NA 2NW6A 3BE8A 1C0IA 2XWQA 4JIMA 1VIDA 3A6DA 1CUYA 3OF2A 4MR8B 1JPUA 1LBHA 4CG0A 1VMKA 4QUBA 3SXJA 4MV3A 1Q0SA 3W0LB 4ZN6A 2PAAA 1ZD9A 1EDDA 3V8VA 5LA6B 4Z7JA 1ZIYA 2I4MA 3HCNA 2Q4OA 1BNCA 3KSRA 4A3BG 2QVYX 2IUEA 5EE0A 1P1IA 3ADBA 1A69A 4WEOA 1FTNA 1KH1A 1EFDN 3G9QA 4DUZH 1QGDA 3H19A 2J33A 5MDHA 1D9ZA 1KWKA 1LNSA 5HNKA 2Q8NA 3X1JA 1Y3FE 3TCKA 3A4IA 3TSCA 3IXMA 3GH3A 4DL5A 1CZHA 4HS9A 1VJGA 1ODIA 4DXDA 2ZCJA 4XVQA 1E89A 1T9ZA 4GYJA 2HIMA 4TL8A 4EFNA 3WYAA 4N7MA 4D46A 3UW3A 3L7OA 4XYLA 3SBOA 2WIDA 1L5VA 2Q4DA 2ILVA 3CR7A 4LVNA 1LQ2A 2PS3A 4IRDA 3AUSA 4L7VA 5IASA 4JUBA 2W57A 1UJBA 5DJ5A 1B1CA 4ZJZA 3D6UA 1KVQA 1UMBA 1GZ5A 3G85A 3GEGA 3Q9UA 1KA9H 2PUJA 3EIFA 1GZ6A 4DV1H 2P5YA 1VKNA 1BX1A 3FYSA 3ZY4A 2ZM6B 3PWKA 3IQGX 3SPXA 1N5OX 2VPIA 2H6EA 3UK1A 4ZOLF 2BFDA 2DHRA 5JZSA 2IYPA 3FROA 2HRRA 3I3OA 2HMSA 2OOSA 5C32A 4ETSA 2HRBA 1ISRA 1JQDA 5HF5A 1RAEA 5A2QW 4F3CA 3EN0A 2VYVA 1PAUA 4HLCA 1HYBA 3KZOA 4KQ2A 3T4EA 1T24A 1ZXLA 4G4SP 1U9ZA 3ROXA 3UAXA 4JYAH 5MHTA 5E6UB 4MKZA 2RCYA 5IT9W 4BLSA 2ZZNA 1RD4A 4C3VA 1NVEA 2EIYA 2V7UA 3IXLA 2ABJA 2NMVA 4OH7A 2XHEA 5DYGA 2H1FA 2XE7A 4FEGA 2OV4A 5ANRB 1RJFA 4WHMA 1XWIA 4WA7A 3QWIA 1DE0A 2VAVA 3HKBA 1DUSA 2X0IA 1HNWB 1WBJB 1HE5A 2I3AA 1JIIA 4QGHA 4Y9UA 5JZMA 3T3GA 4U4AA 1N34B 4EJ2A 4D57A 5JNLA 3K9NA 4NAHA 4XUEA 3VZBA 5C8YB 4DQVA 5FQNA 4GOMD 5FD6A 3B2QA 3PJGA 3ZWNA 4GZMA 4AYBA 2ZE7A 1KEVA 1Q57A 1WDWB 3QXGA 5LLSA 2O0HA 4DQDA 4G23A 4W7HA 2XOEA 4ER6A 1P1BA 3D6TB 3QUCA 4MTLA 1ZN7A 3VTFA 4GWKA 4D02A 5IYZA 2CGEA 4B6SA 1QO7A 3UAOA 2AB0A 1N2EA 5EL0A 2X19A 5J2UF 4URUR 1N1GA 4YRKA 4LHVA 3UMYA 1VGRA 2GBLC 2HJGA 4UAUA 3ELYA 2Z1MA 3ENWA 4LKRA 4HXEB 5JXHA 2XNHA 5EMNA 1PNQA 4A3SA 3R7WA 3V4OA 2QLBA 1T43A 1WETA 3PNQA 5EE5B 4K9SA 2ZTSA 1Z2EA 1NBAA 2ZSKA 2PG3A 4MUAA 3NAZA 3PI6A 4XLZA 1E6UA 3BJMA 5B64A 2D13A 2R48A 2BFEA 4RVHA 4E2WA 4LF7H 3DTGA 2Y1OA 4PFQA 2QBYA 1XPUA 4HFRA 1LRJA 5CT6A 1GQFA 3X0DA 4Y1FA 1OZ0A 3HV0A 1YS1X 4EA7A 1F2DA 5BRAA 2P9ZA 3N2NA 2EBHX 3CS3A 1U94A 1C1HA 2VHWA 1QK3A 1STOA 3GJ8A 4CCYA 2PGLA 4R1NA 3HVUA 2FEMA 1L3CA 2KSQA 3GGOA 3R74A 4NBNA 1VBNA 4OOFA 4HT3B 5H3CA 3RHSA 2X5KO 1NUHA 2FKNA 3KTDA 4PEVA 4H16A 3IP7A 4C0WA 2C7VA 5FFFA 3HE3A 5AK3A 4BBJA 1IY2A 4LQCA 3PFGA 4YT8A 3DOEA 2Z02A 4DZRA 2RAUA 1PSZA 4Q7QA 2AOTB 5C4GB 1OBGA 1R0CA 5HQJA 3MINA 3NCHA 1ORHA 2HWYA 4I9NA 4C88A 4JEIA 4FFWA 2XRZA 4G65A 2RDMA 3KBOA 4BAZA 3GBVA 5HKBA 4Z0HO 4ZI7F 1L7MA 3HHEA 1RMQA 1VJTA 4QW9A 3CJRA 3OZTA 3M9XA 4WXPA 4L9WA 4OHOA 3WL5A 4XUDA 4JL5A 4NH4A 4OBEA 4PLVA 3PD0A 3W8NA 4X64H 3KXKA 2NU6B 1WMSA 1L2ZA 2A1UA 2BM0A 3A9VA 4GS5A 5F5XA 2ZIEA 3UKJA 2BGLA 2REBA 3E7PA 2I8CA 3JU3A 3L04A 1DDGA 1KYWA 3IB6A 5GY7A 3UMBA 5BYJA 4ECAA 3E9MA 1IOZA 4YT5A 3FWNA 4BNUA 1YDEA 1DSSG 2FX3A 1SU4A 1QDEA 3R40A 1VLVA 3KXLA 4NE7A 3JPYA 3G9TA 3EWSA 5I51A 1B8NA 4OHMA 1DRWA 3AIKA 3B82A 2HD4A 5SZHB 4YLGA 3V1YA 3ZXIA 1L2TA 3QY0A 1D4AA 1OBOA 3SIXA 4ZDWA 1L8AA 2GLTA 3JAKA 3E81A 3CNHA 2AEFA 1G5RA 3GJZA 1C1DB 4PLZA 121PA 4BNXA 1Q50A 2W6ZA 3L0SA 3CLTD 3TLCA 3L7NA 4YTEA 3LQSA 3ZK8A 1GL7A 2BGTA 3RROA 3TBKA 2MYPA 2RGAA 3HNPA 1K27A 2RCNA 4H7EA 3RSQA 4I14A 1M6VA 2E6KA 3ORFA 1YB1A 3JYLA 4M6WB 4RA6B 4IXNA 1G7SA 5FQOA 2O20A 3I72A 4Q5IA 2X77A 4FUTA 4N3CA 1BH6A 2RAFA 4DJEC 4JFRA 4KRYA 3RKUA 4EMTA 2O52A 4G1MB 3DDNA 5BWUA 4RBNA 4OAOA 1YJQA 3JWJA 2E5LB 1I4TD 4QPCA 4RA9A 4QWEA 4DA6A 4TT3D 2QJRA 3FPAA 3L92A 2YZ2A 2P7IA 4JYCA 2PD6A 4UM5A 2H0RA 1K0FA 3NR2A 3QQMA 3K1AA 3LQ1A 5CD1A 3H2SA 2IS6A 1M66A 4J8PA 3BB1A 4RKRA 2ZM6H 1E0DA 3TFOA 1KEEB 5JROA 2Y4RA 1BXRA 2W7PA 4JNCA 3BC1A 5JALA 2C29D 5GAJA 3T5DA 2WSMA 3RTXA 4JMPA 1DBQA 4E09A 4A2CA 3H2IA 4K86A 1K3TA 2BE9A 4M1WA 1TKRA 4YRQA 5JPIA 3F9RA 1ULBA 4ITVA 4ARAA 5K01A 3LVFO 4HI0E 3ND6A 4HGRA 4NZPA 1FP4B 2QVLA 1KEPA 2Y1EA 3PRKE 3B3FA 3M5CA 4CTKA 2GQ0A 2QVXX 3V5NA 2NV6A 2WIJA 4YP0A 1A2QA 2OCIA 3CVUA 4G5YA 3UHAA 4MUEA 1HNWH 1DT3A 1C14A 1OWTA 2FG7C 4MROA 2QR5A 4GE3A 4IQ4A 1IJFA 4F4YA 1N34H 4EO4A 1O6CA 4GXTA 3QJGA 1OB2A 4HWKA 1EVZA 2Y76A 3D7RA 4YI3A 3CE6A 3NM5A 4UPEA 1OJLA 1SRQA 3N2YA 3NBFA 2JGMA 4WD3A 1VYHA 4RHXA 3O1LA 2C5EA 3MUOA 1CY1A 3PRJA 3MIZA 1HFEL 3CR8A 1I1KA 3DC7A 3NWEA 3CR3C 1T10A 3IPYA 3IVRA 3G0OA 2WWRA 3W8FA 2F8MA 1V96A 4LJ5A 3LA8A 4HB2A 1DC4A 4PBTA 4QDUA 2GD1O 4M1YA 2XTNA 4YUYA 3Q98A 3FGZA 1Y9ZA 2RBEA 3WWPA 4ADSG 3THYA 2YFKA 1QX4A 3MHTA 3REFA 4GX5A 3MS7A 2RK3A 3C74A 4G9GA 1NJ5A 1VS0A 3X1YA 5F5LA 4BMPB 4HB4A 4MGEA 2HXYA 4RD0A 3L8DA 4Z1MA 4QPJC 2VQ3A 5CA1F 4O7LA 3U60B 2H9AA 3PSAA 3HWX1 1U3CA 3CSWA 2JD0A 2BYTA 1XZMA 4DF3A 1EVYA 3GCZA 16PKA 1E99A 4W63A 4GDMA 3RYFB 5J23A 1AHNA 2Z4RA 3AVVA 2C83A 5J3JA 3Q6MA 4C6HA 5EWGA 1F4PA 1YA8A 2ESRA 2YQZA 3UCEA 4Q9JA 3VSDA 4GEGA 2R7ZA 3ND9A 2I3ZA 4J2OA 1MO5A 3N8GA 3GRAA 5E6UA 4JOQA 3UK6A 3VZPA 1V7QA 2CD9A 5KINB 1IMJA 3MNFA 1SG9A 3RYTC 2HJ9A 1PFKA 3I73A 1ECLA 1Q0ZA 4EPVA 4CMEA 1SUEA 1D09A 3GDHA 3WLIA 3AJDA 4YRFA 1L5LA 4MHTA 2OZEA 4GMKA 4R9SA 2B8NA 3C6BA 4DYDA 5CLQA 2FMXA 2C88A 1YKFA 1F7UA 2YZ7A 4YIKA 3PR4A 4PZ0A 4ERXA 3KDPA 3G0GA 1RMYA 3A1CA 2VTBB 3D7KA 4DEYA 1DCTA 4UC0A 2PT6A 1RWNA 2O2ZA 2I2XB 1KVTA 5AHXA 2GASA 5EP4A 4M4SA 2ZWPA 4EZEA 2BL4A 3S24A 3NHUA 2NSHA 4XDGA 1YDGA 1DG1G 3RF6A 4M2LA 1UKCA 1NQWA 4O4HF 1N33B 4U7DA 5F78A 5KJ6A 5EHXA 4N1AA 3E3MA 3LCVB 1NONA 4ZMRA 4TS3A 3FWPA 4TWAA 3EUWA 4N48A 4NYJR 2CCKA 1VG0B 4MI6A 4Q6BA 4EOGA 1S6YA 4I8DA 3H83A 2GHQA 4NOJA 1ML3A 2GUWA 2CF5A 3O91A 3K96A 3OJOA 1UR5A 4Z8XA 4TKUB 4XUCA 4B6OA 2JEYA 2BBSA 2FE4A 3KKEA 1QYXA 4YCCA 2XBUA 1ZNYA 3F90A 1JXLA 4YR0A 4IHJF 3BAAA 3RTGA 1TAEA 3K5HA 4ATNA 5F4ZA 5D6NA 3GCDA 3P4UA 1JHPA 2NN3C 5BWVA 2QX4A 1V8DA 3O3MB 5KTOA 4ZCSA 2F43B 4UAJA 3VTZA 3PNBA 5AOVA 4IIUA 4CCSA 1AF7A 1QRSA 1MJGM 3CX7A 4ZDJA 1Q77A 2JNWA 2QYHA 3DDWA 1TUBA 4ZODA 4TL6A 4JOBA 3UTCA 3UXHA 5C80A 2PU5A 2QRQA 1SG0A 4C7JA 5K2MA 1E1MA 3PC8C 4EWLA 4BC1A 4Z1OA 2ODBA 4D9BA 4GXNA 3VZSA 1SUPA 4J9UE 1LVGA 4OI0A 4DTIA 4MV0A 1NL3A 2V4UA 4GBMA 3T5CA 1OBCA 4FBUA 3PDIB 3VKFA 2A5DA 2JF0A 2BKLA 1YCGA 3IUPA 3KB2A 3PA6A 2ORVA 2OHHA 4OH1A 5JNTA 1YV9A 1A2OA 4PDBA 4K9NA 4PHTA 3ZI7A 3TGWA 2FGJA 2HSZA 4TXLA 2Z3VA 1G19A 1BCSB 3HVJA 1MH9A 2NIPA 2YXEA 2EQBA 3ZGZA 5EFZA 2RGWA 5ED0A 3DFIA 3FTQA 3EDMA 2Z8YM 3CWQA 4QUAA 2EX1A 4J1NA 1NVKA 4LF9H 4OV6B 4YV2A 4DMCA 2BOVA 3BYZA 2PHZA 2IXGA 2NU6A 4GSKA 4KNVA 4AKEA 3IAM1 4ZV7A 3UKDA 1NFRA 2R7MA 5BWCA 2CXRA 1P19A 1VIAA 4GKJB 2PGJA 1E8NA 1HORA 2FEKA 4AQYB 2OXRA 4LJSA 4E22A 2AL7A 1GUBA 2WKQA 1LLCA 4LZZA 4OTZA 3PG5A 1GU1A 2P9YA 3N86A 3DYVA 3COYA 4ZOEA 1Z6YA 1KEUA 2PJRA 3RF2A 4O3RA 1DPGA 2A35A 4NICA 3ZUGA 2EWVA 1RYFA 3ZIAA 3WKCA 3WGMA 4I50F 1J8DA 1PBNA 2RJ3A 1XZFA 1M6YA 3L4BC 3HI4A 2XKKA 1C9DB 1RI2A 5FP0A 3NATA 1C1DA 1YZFA 2PD4A 4U7PB 2CL7X 1CY4A 4TMZA 2P9QA 1VRCA 2QN3A 5K03A 5KI6A 3ZOKA 2FW0A 4RTJA 2NO6A 3GQVA 1A9OA 3DMGA 4RL4A 4CF5A 3W2EA 1HYEA 2VRCA 1RHQA 1I4DD 5I5EA 3VUFA 2JHPA 2QRLA 4LHYA 3F9CA 5AHRA 4M6WA 4C04A 3AM1A 3LSYA 3DO8A 2Y1CA 4LISA 1R9JA 3QIAA 2YZMA 3SAJA 1M6NA 2XB8A 3RSLA 5FORA 1WZ2A 4EMBA 3TQCA 2RHWA 2R751 5GONB 3HRHA 3I62A 3IOEA 5BPHA 2D4HA 5HSGA 4BMNA 1EK1A 1OFUX 4I36A 3G79A 3EJWA 3SSAA 3OWOA 1RKVA 2C0PA 1G5QA 1KEKA 2QAIA 2GA9A 3VU3A 1WQ3A 5JDCC 2X3YA 4FMDF 2IIBA 1SKYB 1LDMA 1KEEA 3C70A 2BR0A 1TJNA 1IY0A 3RSGA 3U40A 5HIIA 2QM3A 2HGXA 2FWAA 4LIPD 1O0BA 3UHPA 4HD8A 3BDAA 3J7TA 2B8TA 1SU7A 3W6PA 1E9RA 4EBEA 4YBZB 1G2OA 3EFOA 1DC6A 2Q5FA 2XTAA 5D3ZA 1NNI1 3AYXB 2POQX 5AJWA 2VI5A 4JA2A 1IONA 2XJ4A 3I01M 4DR7B 4BKQA 3GI1A 3VHRA 1EE2A 3T9FA 1DC8A 5JJKA 4UD2A 4RETA 3GYBA 5FD8A 2YHBA 4U5QA 1N8SA 3KZ1E 4YDHB 3NBQA 1DBRA 4YCJA 3N2ZB 1LTQA 3VSBA 1QJ4A 3V80A 1ECFA 5B1IA 1IQRA 4TT8A 1CVLA 2RGUA 2B9VA 4PNHA 4TMFA 3RWOA 1YS9A 2QVZX 1CUZA 2WIGA 3QVGB 4RLSA 2J0EA 1XDWA 3EIUA 3UGTA 1UBEA 2HU2A 5KVAA 3PW5A 1QIEA 3QK7A 3VRHA 4ZEMA 1DCKA 4EQ6A 4OBBA 1HF3A 3MTQA 4HYYA 2FZ5A 4LXHA 5EUBA 4MKGA 4B1FA 2ZSAA 4ZGGA 1U6KA 2A0KA 3A6FA 1FFWA 4NIMA 1DG9A 2I2CA 5KSYA 1IZ9A 5FD5A 1XZPA 4EY3A 4CDMA 4D3DA 5A0TA 4RVOA 4BP8A 1IG3A 3KE9A 3USES 4Y8VB 3T1VA 2JLCA 3H1TA 2K6GA 3NTUA 5GWXA 5TQ2A 3PDCA 1ZEMA 4Q47A 1WA5A 4HDCA 1V35A 5DHFA 1KYYA 1ULSA 1XWFA 1XG5A 2V9CA 2HRCA 2F55A 3NUZA 1BRMA 1VJRA 2G9ZA 2BGUA 4DMMA 2W58A 3SFZA 2IIQA 2Z2KA 1KEZA 1LSJA 4G0OA 5JVDA 3EEOA 1E2NA 4JMLA 4DIFA 4MZDA 3K4PA 1JVSA 3ZW9A 2HLDD 1XYVA 4KBYA 5JD3A 5KNCH 4FXOA 3CN7A 4RADA 1URPA 2Y67A 1XX6A 3ST7A 4YP6A 1Q20A 1R8SA 3UAVA 2QN1A 3NHLA 3RYFA 4X3CA 4W5RA 1BDJA 1QHXA 3IG0A 1XVAA 4CNBA 3NX4A 1XZJA 3CGWA 3SZLA 5JQGF 5AICA 1U80A 3TYXA 2XIQA 2EFHB 1F12A 2FUNB 4WCFB 3S7ZA 5FRDA 3QRWA 2ON6A 3IPXA 2F9MA 5LU9A 2DPHA 3KQYA 3F97A 5A9TA 3TMKA 4RIEA 3D6AA 4BQEA 1EP3B 1Z0DA 3S28A 3EXIA 5D3MB 3BMOB 4F9TA 1JR6A 1TK2A 4AI6A 1EWKA 5DNUA 2CHVA 5C5CA 5C31A 1R0XA 1EVEA 1HA3A 4FHCA 3P94A 5KOHB 4RB2C 4JJIA 2WTXA 3IELA 1LPNA 1UPTA 1YBHA 1L0BA 2QTNA 3A6KA 3I1JA 5DP1A 4MVJE 4AFNA 3U4AA 4P82A 1L7PA 2V6FA 3CX6A 5EE9A 8AT1A 4MRVA 1VSBA 4ROTA 4WNAB 2P0EA 1JLHA 1I51A 3OHPA 2O1EA 4DPKA 4DR5B 2OCBA 2Q6TA 2GHIA 1WF3A 5EHGA 4DIUA 1L8XA 2WUFA 1U65A 2A9FA 3NWPA 1PL7A 5UKDA 3WWHA 2RKBA 1NKSA 4D9CA 3ECSA 1S01A 2XWBF 4KVZA 4QNNA 3W6UA 3R5XA 1XB2A 2G5GX 4F8EA 1GTRA 3OCXA 3AJEA 2BRUC 2I55A 1QRTA 3NNDA 4TKUA 4K6NA 4UZSA 2NZJA 3DYBA 4DTCA 4P8RA 1QQ7A 2WHYA 3WJAA 5JATA 2P2LA 3DWFA 4HB0A 1S2MA 3PRYA 3AQIA 2Q8QA 4L57A 1PGQA 2VHZA 3N75A 2HL6A 3IE1A 3LC1O 4I08A 3ZGNA 4YQYA 4D7AA 4EHJA 2I4OA 3PR1A 3TDMA 4MR7A 2JH3A 3O84A 1BHO1 1M2NA 4J4HA 3ZU5A 4K40A 4MDHA 4RQBA 2AN4A 5I9SA 5DG9A 2OZLA 3VH2A 5AI4A 4LK2A 3DBLA 3TR0A 4JS0A 5EOYA 4OK6A 1RFGE 3JARA 3D9QX 4DMLA 2DPYA 2OGWA 5KFBA 4NK5A 2JHAA 2J9FA 4D0GA 4Q4JA 3E03A 5DLPA 3BF7A 1Z47A 3U6BA 1J0XO 3A4NA 1JIKA 2NUPB 2H2IA 2XB9A 3RGWS 3V34A 2A9KA 4EEKA 3SZUA 5EJ7A 2XGMA 3U6KA 4YAIA 1WCMG 3MJVA 4XZ3B 1GAQA 3KYCB 4BKOA 4EW6A 4FE4A 3ZY6A 4ARBA 2QVBA 3INGA 3E58A 4DYHA 2JKVA 1T15A 1PEKE 3RC8A 1P77A 4IDEA 1EK5A 3ZZNA 3CZPA 4PHFA 1QO0A 2HHFA 3L43A 1OB5A 1JA1A 4B7AA 2TMDA 1J2YA 4K3UA 5ELXA 1R9NA 3K9BA 4HDNB 3WGLA 2LIPA 1QGED 4L22A 3HKCA 3GP3A 4DR7H 1E3EA 1R0SA 3ETCA 2VHEA 2Q9UA 1AH2A 3U7FB 2CWWA 2BTEA 1P4SA 4B4VA 3W7BA 5JJCA 1BGXT 3J81W 1JSRA 1ORTA 3RFTA 5ARCA 2CZQA 3T7KA 1KFEB 1GEGA 3HCAA 2XVYA 1OGYA 2KLHA 3DH0A 5COAA 2QT0A 1R74A 4PZPA 4PLPA 4HLUC 1E1DA 3CVZA 3EXHC 1QLJA 3U1TA 2MR5A 1XQWA 3T35A 4BGEA 1CR0A 4E6PA 4GWLA 3OF3A 1XP8A 3NHYA 4UMFA 1D0VA 3MMNA 1S8FA 2O6LA 2QU8A 4RCNA 4X65B 1TVKB 4AG3A 3DF7A 5ALWA 3X1XA 3FCOA 4W5QA 3CF0A 3AJAA 5FT9A 3WA7A 2FPSA 2EP8A 1RLOA 3I23A 3VXKA 5HKKA 1KZ9A 4AX4A 2C9OA 5IJ9B 1ZFNA 1SKAA 3U4CA 4Q4CA 3B1WA 2ZTVA 1JDTA 4B7XA 4ZAYA 3GUZA 1EKVA 3BEDA 2XGJA 1EUDA 4CL2A 5JD5A 2HQOA 1PG0A 3UO8B 3PVZA 1BEZA 4MKRA 2GRAA 3D4LA 3KSZO 4ZQCB 3AVTA 1AXEA 3T7TA 1NWCA 2Z6VA 4BBSG 2FDCA 1E63A 1YD7A 1QFZA 2FEWB 4FDLA 5GONA 2CDNA 1NHGA 2I7XA 4NBRA 3EDCA 4HVCA 1N2CE 1D0IA 2BLLA 2P9JA 4AMZA 3U2QA 2ALZA 4CM1A 4FD3A 2AJBA 4ZDKA 4K6OA 3V4FA 3OE7D 3PC3A 1MAAA 5TB5A 2J5QA 3QYAA 4IMJB 3WYEA 3UUEA 1SCKA 2CJPA 2C3PA 5DGXA 3O3CA 4ZU6X 4K6GA 3W5VA 1M1YB 3CVJA 1FW6A 4R16A 1AHHA 1OIVA 2IODA 1YQXA 3FDZA 3WC4A 1A1SA 4KH0A 9MHTA 4BIIA 3I3SR 1Q3TA 4X92A 4DJ5X 3A32A 4FHDA 4P7BA 5CXUA 2ZRPA 3NDRA 2GGSA 3EJ6A 4NEHB 4UFNA 1ZCZA 4O25A 3UIEA 4OA5A 1EK0A 3TI9A 1KY5A 1ZOIA 1JNXX 1UADA 4EKIA 4CEIB 1B33N 1LBIA 5K3SA 4NCKA 4BB6A 3UV7A 4BXXG 3H2BA 3ENVA 4P3YA 1F0KA 5DCWA 4JYAB 5H82A 3GIJA 4IV5A 3QVGA 5LP6B 4EHFA 3L8GA 3FNIA 2CL0X 3DZHA 5KC8A 2I3GA 2IYAA 1ZSVA 1FNBA 4H0NA 3D02A 4ZHSA 3KQUA 5KDLA 1KJNA 1K89A 4XD7D 3SNHA 1TKBA 3RU9A 1WZIA 3IO5A 3TW6A 3AFIA 4LI3X 4QQNA 4DABA 5B57C 2DQYA 2WSSA 4OGGA 4Q1BA 1E3WB 4O4LF 1YASA 4DQNA 4PO3X 4CL0A 1L8OA 1WLYA 3QNWA 4GWGA 5HJ2A 3K0FB 3DXYA 2IU6A 3MCWA 1FP1D 1Z75A 1DDIA 3AR9A 4CDGA 1OU4A 2W8BA 4REMA 4C0HA 5AJYA 3FD8A 3UT6A 1CR4A 1QYCA 3G6WA 3RVRA 4I9GA 1YGPA 4L8VA 2PE5A 4TSRA 1A8UA 4AU1A 2OORA 2M6SA 2COJA 1DL5A 2IPLA 3EOAI 4FS8A 2AG1A 3QKSA 1TWHA 3S7TA 1U5AA 2C4TA 4PZAA 2WPDA 1CRWG 4CDNA 4B81A 4UFPA 2Y8EA 3ETNA 3F5FA 3BXFA 4BO5A 3EMDA 4BQIA 4P3XA 3RVMA 4Q9NA 1N7IA 3EHDA 2UVQA 3LC7O 1SVKA 2F90A 3GLGA 4D9MA 4BX8A 1IN7A 2G4VA 3JZ6A 2N3ZA 3DLHA 4LY3A 1YR3A 1ABBA 2PUVA 2A9OA 4LF7B 1BFDA 1N9ZA 1E2QA 5IEJA 2ZT6A 1ZNWA 1JDNA 3EGWA 1GRRA 3BEOA 3EIHA 3I9KA 3O8QB 1I24A 3IQFA 2GI4A 3QTTA 2UZAA 3FNQA 1NUQA 3PKIA 4RF4A 3HUFA 4IXTA 2UVUA 2P2NA 3BBPA 1N0WA 4G8BA 5FR2A 3OEHD 1P4RA 1YZTA 3V4LA 2GESA 3ZUPA 1R8YA 2Q5HA 2AUNA 2ZDGA 9ABPA 5D5QA 4ETMA 3FGOA 3MJDA 1UFQA 3M7IA 4EVRA 2IBMA 3L7KA 1ZDMA 4AY5A 1JQBA 1L5RA 1Z0JA 1N7GA 3P96A 2NOAA 1PCXA 3D6JA 1EHYA 3L8CA 4PVCA 2ZE6A 2SKEA 1GTSA 3QVSA 1Y3CE 2AOWA 4CMHA 4YV7A 3UYLA 3WL8A 3EA5A 4L4UA 1A1VA 4UAVA 1ZBDA 4KQKA 4QTXA 2DG2A 4BQFA 1OFHA 1NFFA 1PZFA 1EESA 4PPFA 2FLPA 3KK0A 4MVJF 3OOEA 5JTUA 1V45E 2FTKE 4Z9BA 2Y1XA 3T06B 3LVRE 5F7OA 3P26A 1YRHA 5IJAA 3F67A 5JNUA 3ZWAA 1XPOA 2IUYA 5AVXA 2Z83A 1IQ0A 1SUWA 5DYWA 3GVCA 5FLMG 4DRZA 2GCIA 2W9CA 4GI3A 5DVZA 1H4SA 3WFZA 3THWB 1TT5B 1GZ7A 4AXBA 4X64B 3GJ0A 1RRVA 3AKYA 1AB5A 4KR2A 3OJ0A 3QUSA 4KHZA 1QHHA 4WFKA 4KSCA 2B8EA 3T5LA 3D3NA 3ROKA 2QRMA 5IVPA 1GNPA 2VJAA 1Z0FA 1FU7A 5ISMA 3DLCA 4X65H 2VQFH 4H2DA 3HO8A 1Y1KE 1SXIA 1V5GA 1H5UA 4GECA 1ACLA 4QD3A 1BVHA 4LRUA 4HO1X 4YUVA 3QW4B 5ALTA 3MTAA 2W70A 4A2BA 2CNBA 1S5PA 4B34A 3P0EA 1TM3E 4O7VA 2BMFA 3HCDA 3GPCA 2C5FA 2BQUA 2CUTA 1SOMA 1K4MA 1BU5A 2VF7A 2NT3A 3SZMA 2QUIA 3QMVA 2JAWA 2C61A 3DHEA 4N6GA 2H4JA 4EJSC 3VR5A 3TPZA 5BQOA 2HIGA 3RR5A 4DWWA 3GIKA 1WQ1R 8LDHA 2O3JA 2RAPA 4DM7A 2W6CX 1A7KA 3UV6A 3NRJA 5L45A 4QW8A 1KJJA 1EJ0A 2D0DA 2JA5G 3KYCA 3VDMA 2WD7B 2WF6A 1NMZA 4JLJA 5KYGA 4XJTA 1PZNA 3ROMA 1K2VN 2KBEA 1KI9A 4DB2A 1FXWA 1GNRA 1GJRA 1GYQA 1VI6A 5ELMA 3VTAA 4MA4A 3W1WA 4PICA 1PFGA 2PKXA 4MWDA 4QXQA 1NI5A 1A5TA 2A5GA 3T5MA 1H0KA 3ZIDA 4OKNA 1RZUA 1G9SA 2IHJA 4C20A 1ISIA 3H0KA 2WHPA 3WIDA 2FLKA 2H9YA 2HSGA 3FIUA 3AEXA 1GSAA 4F4XA 4HNAA 4UBKA 3G6XA 4F56A 2EX0A 4M0EA 4LHEA 3PF8A 1E2HA 3M5PA 5SYNA 4Q3BA 3SC2B 1U9YA 1P72A 2PVCA 2D5IA 1AS2A 5KG7A 4L5CA 4LOJA 4M1QA 5BQXA 2INGX 1S96A 4NCJA 4BFXA 3ISJA 1Q1EA 3QU2A 4CTOA 1PP4A 3GEDA 3EVGA 2B4RO 4FK8A 2ZIFA 2PH3A 4FE3A 4KDFA 1X70A 2O48X 4GMGA 1XC7A 3O4FA 1U1FA 4TTRA 2G9QA 1NMQA 3LX8A 4OCZA 2FN3A 2GYWA 4MWEA 3LBYA 4L2IB 4XW2A 1S2LA 3NEJA 4RF5A 2BZGA 5KG6A 3QELB 5G02A 2HEIA 1P91A 1USGA 5JLAA 4YJHB 3DMTC 2QTHA 1OYVA 2JCVA 4Q82A 5GJBA 4MB6A 2ZVDA 5D3KA 2XA2A 4P35A 4QJ4A 4KLAA 5KPDA 1P3DA 1GY8A 4GR4A 3ZCUA 3ND5A 3FRHA 1E5TA 3TL2A 3IURA 4PQEA 2F59A 3R7NA 3F71A 3FRJA 3LT0A 2TSYB 5C8XA 5CFQA 3AY7A 2W93A 4GICA 1ODCA 3R9RA 2PCJA 1N77A 3IUQA 2ROQA 1G7TA 4OQYA 1ZGZA 4IEIA 5ALDA 3NMUF 1DXOA 3L6CA 4U6PA 5BNWA 4W7IA 1W6RA 2FX5A 2FR0A 4Y6PA 1V0JA 1WR2A 2HA2A 1AHPA 2GFHA 3F96A 2YRWA 1O9GA 1G17A 5CB8A 4JJ4A 5CB4F 3KCQA 3RBEA 5E0KB 1DWPA 1M1YA 1JR3A 3GOQA 2HHLA 4RGQA 4F1WA 1W47A 3S2YA 2GKSA 4WZ6A 4GRDA 4MW7A 4L9RA 5AXCA 4ALJA 2QQ0A 3QVLA 3OQIB 5BQPA 2YV1A 1HYQA 1SOAA 2AN9A 3H3JA 4LOAA 3H2ZA 5FL7D 3U7JA 5KIAA 3T0FA 2GN0A 2CF6A 3MB8A 1XAGA 4W5HA 4CEIA 4QRIA 1SXJD 4NZ9A 5F73A 1K7CA 3GQBA 4YUAA 621PA 1MU0A 2RK6A 1SBCA 5KFUA 4C2BA 2PSEA 3RS8A 4ZPJA 4W9NA 5DQIA 4GQIA 5LP6A 4PTYA 3KPYA 3N0VA 3BGOS 2B34A 2DHDA 2VO1A 3IUSA 3LY7A 5FLEX 3WNBA 2R1UA 1TK9A 2WFLA 2A9VA 4FP9A 3D8RA 2IYRA 3ONFA 3FOWA 3HK2A 3NOVA 3WI7A 4TYNA 5ICEA 2ZAYA 4GPTA 2ZT8A 1T29A 3OQHA 2H2DA 2W6OA 1G9TA 2XNDD 1BQ4A 3EG9B 2B9EA 2FKAA 4JLMA 2G08A 1PQWA 3GLFB 3GO4A 3ZS8A 4KWHA 3U4IA 5LDHA 4R9UC 5JCJA 5KFEA 3OCWA 2HVQA 2AG6A 3N8KA 6REQA 1F6BA 3A11A 5B30A 5JH7F 4KSYA 3C3BA 4HQFA 1KYXA 2RHHA 1P60A 2WKWA 2UUBB 3BTVA 4ZYUA 4Q1EA 3T94A 1A97A 2BZ0A 2V7EA 5KFCA 1P17A 3RG2A 3FUVA 2OHOA 1P33A 3K20A 1QS0B 3ZWDA 5IDYA 3TJMA 4QGSA 1RCTE 2X8BA 3CX3A 4NFSA 4DMUB 3C7KA 1NQUA 3T4PA 4IAJA 1IPHA 1XCPA 3RU7A 3ZHOA 3OU7A 3WJ1A 5F3RA 2R68A 5KYUA 1HPLA 1TEHA 2VWQA 3LXRA 4E70A 1Y8ZA 1HUQA 3ZQ6A 2O2GA 4QASA 5HS6A 3TEMA 2YWXA 1IM2A 1RWBA 2BQRA 3TW7A 3IV7A 4PFSA 5DOVA 4FFBB 2J30A 3A1WA 3DEHA 2JEGA 1JHRA 4GKVA 3WNCA 4D8VA 3O8QA 4G8DA 4ZQEA 5E4FA 5FOXA 2IT1A 4OQLA 5K4HA 2BP7A 4A27A 1RM3A 1NW3A 2WJGA 3IV6A 2OKGA 2FZCA 1FRQA 4BWVA 3LS2A 3OI7A 5G3YA 2IEDA 2XMGA 3QPWA 3F78A 2FE1A 4RV9A 4UNSA 3IH5A 4LPKA 1L7BA 3MWLA 1EK6A 1YBMA 2J0UB 2E4ZA 1RWOA 3TSYA 2OHVA 2FDXA 4QM7A 1XDGA 4U6NA 3ER8A 1E1RD 3W9BA 4MLPA 1F2UB 2ZJ2A 2B69A 4BNGA 3A3YA 3IMFA 3N7AA 4IIJF 3D6FA 5IAEA 3BHNA 3STYA 1U2QA 5D2CA 3SYKA 4AURA 2DY0A 3FWYA 2DFKB 1GIAA 2PANA 4X44A 2JCBA 4RS4A 4DR4H 4NZMA 1Q15A 2ORWA 1ILEA 2RGEA 4L5AA 3NTLA 3DLAA 1TUEA 3FYCA 1CVRA 2AOUA 1WTAA 2JIZD 3BJRA 3PPWA 2C20A 3V8PA 1JDEA 4P4SA 3PVXA 4ZFNA 3L0OA 5M2QA 4BV2A 1WH2A 3C8UA 1YZNA 1ULUA 2YV2A 4B76A 3MOGA 4JGGA 2ZBUA 1R0WA 3QITA 4A2PA 1LDGA 2QTGA 3G8CA 4JQCA 2ZANA 4LF9B 3THWA 1Q6YA 2WM8A 1TT5A 5JS1A 4H3KB 1G4AE 4O1IA 3BHJA 3LUGA 4M99A 5KAPA 1QO9A 2LDBA 1QONA 3AWIA 4LZNA 3BDIA 4LTMA 2ODAA 3AERA 4RD4A 2BCGY 1WF6A 4QOSA 4L76A 2ECFA 2P0AA 4C3UA 1NY6A 3AU9A 3BDVA 2ZJ4A 3EPIA 1FOEB 3REQB 3BIFA 2QRVB 3OWHA 2WB4A 1XMPA 4RPKA 3D3EA 1DT5A 2WEKA 3VH4A 3LMLA 4C3ZA 5CAEB 4JYZA 1F8FA 3B12A 1CUCA 3F3YA 2WWWA 1J1IA 4MR8A 1GKYA 4ZJYA 5EP1A 4JT2A 4LOKA 2GFIA 4NKRA 5EKUA 3I2GA 5LA6A 1CUAA 3WLFA 2ID4A 3HXLA 2R00A 3ESAA 1ZLXA 3WLPA 3WHIA 1NNLA 2WLSA 2GKOA 2O3UA 4Z4QA 3GARA 3AP1A 1C5KA 3RKRA 2Y1KA 2OA0A 6ABPA 5EC8A 5AXAA 4L07A 1AKMA 3TEKA 1CEXA 3LUFA 1FK8A 2CHFA 5FBWB 7MHTA 2JASA 2DYKA 4IJ5A 4DGQA 3NWOA 4BZQA 5JSHA 3R23A 5C46F 2EGHA 2Q4EA 1KVSA 3S27A 4QIWA 4N01A 4L72A 1M76A 4ZYVA 5IJZA 2C42A 4MCJA 2M05A 1TPYA 3W9UA 4KLRA 4UJ5A 2HQBA 1FB5A 2JFNA 4WINA 3PQ5A 1DBWA 2Z04A 4QWMA 3BD6A 4RZ3A 3VNRA 1E4EB 1QF6A 2R9VA 1N7HA 1YU6A 1Q6ZA 4ZRDA 4QYIB 1JH8A 3DZIA 5B4VA 1DO8A 1TEXA 3K30A 4Q15A 2GLXA 3AUTA 4O0MA 3GUCA 2YH2A 3R9KA 5IAJA 5ALZA 2B1IA 2HO5A 3LTEA 4HRXA 1OYOA 3PJDA 1WXFA 1ZRSA 4ZC8A 1GAEO 3OCVA 3EZNA 4D4GA 4EGSA 2YJGA 1HO3A 3SYRA 3CUVA 3KQQA 4L0CA 5LSAA 3D7LA 1DXHA 2GYYA 1ZRMA 1O94D 4RFSB 3KSBC 1JFFB 5DTIA 2VK4A 1CUBA 3ICPA 3H8VA 4E4YA 2V98A 4OKSA 3HA3A 2DECA 4XX1A 4KXYA 5I9NA 2ZWAA 2ORIA 4L2IA 1YCFA 5LOVF 5C8YA 2XVXA 1XK5A 3AHDA 4R2JA 4CM9A 4PG5A 1PJ4A 3L46A 4R4JA 4XLLA 4CLRB 4PGMA 1Z2CA 2EYQA 1KO8A 1PZEA 5A3JA 4GRIA 1S7GA 4UQOA 4UQPA 1KI4A 4GNKA 1EQUA 4K9RA 1VE5A 1T8RA 1KJ9A 4GE0A 5GZ1A 4NDNE 2UUBH 4C4XA 3CG0A 4HGOA 2QRJA 1Y82A 5B6IA 3I28A 2CFSA 2W11A 2Q2WA 1G4HA 1K7EB 3F8NA 4HR7A 4B2YA 3WG9A 1JQLB 2ERXA 3I2YX 2WR8A 4C6SA 3QWFA 2QSYA 1X3SA 4ZD6A 4ASUA 1QRUA 3W7AA 3EHEA 4RTLA 1DMRA 5FIUA 1LWNA 5FL3A 1G8JA 1R0YA 3CV3A 1OILA 3GG2A 5AO9A 2Q4BA 1E64A 1NC1A 4CFSA 4BNLA 5J43A 5FFMA 3EF1A 4AY2A 4M1ZA 1POXA 5TQVA 3R1IA 3LP6A 3FBTA 5TXGA 2CFRA 4IHAA 2MCTA 5KT3A 1L5YA 3HGTA 5K4GA 3L0IB 2X0JA 3GT7A 4OHYA 4QU8A 1GGOA 3WLRA 4D81A 3OQIA 3RRMA 1QMGA 1J1UA 5K0EA 1ZKDA 1MAUA 1Y9AA 3G7SA 2WZCA 1PFVA 3O82A 1EX6A 4PPQA 3DV2A 4HDOB 4QNMA 1A4UA 3UWDA 2Q5EA 2KSWA 4BFTA 4AT1A 3FFWA 4TN5A 3ZJ4A 5DKFA 1ZYUA 1CUUA 4P38A 1X7HA 1A48A 5JCZA 3C3CA 3V1KA 3NDBB 2BH2A 1KIAA 1WMEA 1N4DA 4JJKA 4E5MA 1KKUA 2AOTA 3PW0A 4ZK2A 4MGHA 4OQEA 1NRIA 2P69A 2PRJA 4HDRB 1J0EA 3B89A 1G4UR 1SZDA 4NZYA 3T3PB 3CRQA 1H1DA 2NVBA 1QUFA 4XLTA 3SKXA 3D4PA 2VPWA 4CWAA 3D64A 4BZZA 3AWDA 4UVEA 3TO5A 4F3YA 1XZNA 4BN0A 3OY7A 2D5AA 4WOPA 3KSAC 5HK9A 4RF2A 1PW5A 3FNRA 2FN7A 2PSDA 2QN2A 4BLRA 1QS0A 2JDIA 2WIBA 4KVFA 1BE1A 2PXAA 4F93B 4N76A 1YB4A 4KI0A 4R0VA 3A70A 4O3OA 1QIHA 3K32A 3CYFA 3DL0A 2II6A 4RAOA 5BR4A 1OZAA 4DSUA 5ENZA 3Q0TA 4R84A 2BZ1A 4CMDA 4Q34A 3OQOA 2OSBA 4ZRNA 5IJXA 1HEYA 3KT0A 3DBHB 3LOQA 3ZLTA 3WNVA 1SBIA 3NYRA 5KNBD 1M83A 2YFYA 1GGVA 5JT1A 1KI6B 3TKAA 1OAOC 1DGSA 4G0QA 3CHYA 3VC1A 2YRXA 5CIWA 1E58A