1PX2A

Crystal structure of rat synapsin i c domain complexed to ca.atp (form 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
294
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTWKLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Synapsin I
total genus 89
structure length 294
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1px2A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1px2A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1px2A02
4HQ6A 5BPHA 2VQDA 5I47A 4MA0A 1KJQA 4O81A 3U9SA 1KEEA 3VPCA 5DMXA 1BNCA 2FB9A 2R7NA 4C5AA 3JZFA 1GSHA 1Z2NX 2W70A 4EA9A 4MV4A 2C00A 4RZQA 4TV8F 2W6MA 4FFMA 5J2TF 2R86A 4FU0A 4EAAA 2VHEA 1EZ1A 4O7LA 5LXTF 5JQGF 5H80A 3SE7A 3Q1KA 2YRXA 4YAKB 3Q2OA 3R5XA 2DZDA 4MV6A 2FPIB 2YZMA 2YS6A 1OBGA 4HR7A 4J6EA 2YRWA 2DLNA 2FPPB 1DV1A 4C5CA 1OBDA 2W6PA 3JRXA 2W6QA 4YB8B 3U54A 3RV3A 4XX0B 3QFFA 3BFPA 3I12A 4O7TA 1BXRA 5C8YF 4O2AF 3RUPA 4IIJF 2R7KA 4YAJB 1PK8A 4I4TF 2YZGA 3V4SA 2NPOA 4O83A 3MWDA 4ZQIA 2R6FA 2SCUB 4O7ZA 5LOVF 2V58A 2W6OA 3G8CA 2NU9B 4EGJA 4YJ3F 2FP4B 2PVPA 3OUZA 1PX2A 2XD4A 4O7SA 1A48A 3U9TA 1KBLA 3ORRA 1EYZA 3G8DA 4MAMA 1EUDB 3KREA 4HNUA 2PBZA 1I7LA 2I87A 1WR2A 2W6NA 3BSSA 5EZYF 5CAEB 4FGRA 5LA6F 2QF7A 5C1PA 3JZIA 5JQWA 2ZDQA 2ZDGA 4I55F 1JDEA 1CS0A 2YZLA 4XYMB 1UC9A 1VKZA 2X0SA 4O2BF 3MWEA 5LYJF 3HO8A 1IOVA 2CNVA 4IZOA 3AW8A 1DIKA 3BSYA 2YWVA 5CB4F 4EGQA 3ETHA 4O7WA 3TINA 2VR1A 2VPQA 1KUTA 2YYAA 4M9CA 4YBZB 4EA8A 2ZDHA 3ETJA 2PN1A 5FNVF 2J9GA 4YJ2F 4O7RA 5HBRB 2CQYA 3GIDA 3K5HA 3NUAA 1VBGA 3VMMA 3AX6A 1M0WA 4MV8A 5CA1F 4FFPA 5KX5F 3N6RA 2R87A 4FFNA 1UC8A 4EABA 1KJ9A 3KAKA 1C30A 1B6SA 3HB9A 3E5NA 3VA7A 1GGOA 3ORQA 2I80A 4TUYF 2YL2A 1AUVA 2R7LA 1KC7A 2CNQA 4M99A 3DF7A 3LWBA 3HBLA 3OUUA 1EUCB 3R23A 4ZHQF 4I50F 4O86A 1KJIA 1M6VA 2R7MA 4MV3A 1CE8A 1SCUB 1B6RA 5BMVF 3U55A 4O84A 1ULZA 2NUAB 2R84A 4O4LF 4O4HF 4WD3A 3UFXB 3RV4A 4XYLB 3GLKA 4EG0A 2HJWA 2NU7B 3TIIA 3KAJA 1GLVA 4O7VA 3VPBA 3TQTA 1A9XA 2GLTA 1W93A 5K2MA 2QK4A 1C3OA 2I8CA 4IWXA 3K3PA 2DIKA 1M0TA 1EHIA 2YS7A 3WO1A 1KJJA 4QSHA 3LP8A 1KJ8A 2GPWA 4IHJF 1I7NA 2IP4A 1T36A 2NU8B 5JH7F 4DLKA 2V59A 4XZ3B 1IOWA 3BG5A 2CNUA 2GQRA 1CQJB 4DIMA 4Y8VB 4FFLA 1JDBB 4FFOA 4O7NA 3R5FA 2R85A 1GSAA 3V4ZA 5KKNB 4EA7A 4HNTA 3R5HA 1AUXA 5GONF 3K5IA 4WBNF 4ZOLF 4E4TA 2P0AA 4C5BA 5J2UF 5HV6A 2OLSA 3TW6A 1E4EA 3TIGA 4HNVA 4IWYA 2YZNA 5LP6F 3RFCA 4FFRA 4MA5A 3R9RA 3KALA 5JVLA 2HGSA 4M98A 2NU6B 4FE2A 3WO0A 2Z02A 5CA0F 5JVDF 5D8DA 2WYOA 2GPSA 2R82A 2FPGB 2CZGA 2DWCA 3N8DA 2W6ZA 4O4IF 1CQIB 3BSWA 4ZI7F 1DV2A 3MJFA 1VBHA 1Z2OX 3JRWA 1GSOA 4NYEA 2W71A 2YW2A 1Z2PX 4GGMX 4MV1A 5IYZF 4MV9A 2Z04A 2GQSA 1JLLB 2XCLA 4O4JF 4MV7A 1E4EB 4M9UA 4O7YA 4O82A 3VOTA 3WNZA 1JKJB 4L1KA 1W96A 2V5AA 4ME6A 5C1OA 5BPFA 3VPDA 4TV9F
chains in the Genus database with same CATH superfamily
3DH0A 2NXNA 2H48A 1C7QA 3DOJA 4RLHA 2CCGA 4HQ6A 1ISIA 2DQZA 3CUEF 1MPTA 3QVKA 3EASA 3L8DA 4L75A 4JT2A 5E7IA 1UBTS 3WNQA 2ZSIA 1QZTA 3H3JA 3IIKA 4JB8A 1VMEA 3UG7A 2OCXA 3GNSA 4H6WA 4NV3A 4URZR 2A0WA 1ODIA 3VJRA 4O4HB 3LOPA 4P4UA 3L84A 2XKKA 5CXSA 2QD5A 2FU5C 3GYGA 5BMOA 1M76A 1SOAA 4H7HA 2FOIA 4QWBA 1MIHA 1JEQB 1QX3A 2GXAA 4CKEA 2CNNA 2BL4A 2C83A 5BSVA 1HM5A 2HCTA 1A5SB 4M83A 4C05A 1IHDA 1OYWA 1JQ3A 2R79A 4ABTA 4EI8A 1GFWA 2QG9A 3JQ7A 3BYZA 3CXUA 3ZCSA 1LV8A 4DV6B 3NGXA 3T1OA 3GLQA 4L7QA 2HPAA 2EFGA 2X19A 5AQEA 2QIPA 1ENZA 3DL0A 4RTMA 3ZE2B 3BGOS 2A4MA 2WTAA 3AU9A 1EFDN 1HT2E 3OX1A 2IS2A 4G5HA 2GI4A 4B35A 4EL0A 4D9KA 4YV7A 4B73A 3IULA 1DX9A 3AF0A 4CKWB 3GILA 3PP8A 2A2ZA 1B8PA 3GJYA 1LB1B 1Q77A 4OJYA 5T3YA 4PTZA 3UYLA 3ILVA 1O77A 1XLUA 5CFZA 4UAJA 3HB0A 3PEWA 2DPLA 2W48A 3B1XA 3CEAA 3C8MA 3DTGA 1CTQA 1CJBA 1VP3A 4RW0A 1ZY2A 3X2FA 3L2PA 1DAMA 2BI8A 2ZSEA 1Y6ZA 4JUIA 5ELXA 1BEZA 3PU6A 4XSHA 1XTSA 1T36B 1EX7A 3P45A 2RC5A 5IC5A 5L7TA 4OK5A 5DU2A 1Z4JA 2GNOA 2PFKA 4X6LA 5A4FS 3FZYA 2E9SA 1DKOA 4K6KA 1VMIA 1YNOA 4IP0A 1DWQA 3O1JC 3VR6D 4LJ8A 2WT9A 3WDMA 4BGIA 1Z74A 2R8PA 1Q22A 2WYHA 4J0QA 3FPCA 4GC7A 1AZWA 1QHHB 2AS0A 3DBVO 3T0IA 4I4CA 3RRZA 3WBBA 4BV2A 5B36A 3MTQA 5LCXA 3LUGA 1GYRA 4UQPA 4R2IA 2C97A 1RAHA 1GAXA 1OBDA 2NQTA 4JNCA 1QQBA 2FJPA 1SEIA 4EY6A 5DMHA 3CO0S 4B6EA 3LBHA 2FTKE 3KZMA 5K20A 3H6KA 1X80B 3Q8RB 3UB4A 1W48A 5L1KA 4KO1S 2H31A 4OKIA 4HSEA 4NV0A 2I5PO 3U54A 4BO3A 1JWLA 1ZCFA 2QPAA 4X3PA 1IY0A 3LQRA 1R50A 5EZ6B 5NLLA 3ZWKA 1B16A 1P4AA 3CRW1 1BHO1 4EYSA 3PGJA 2C5HA 3USCS 2A0UA 3HDHA 4MW2A 1E0AA 1QS0A 2WJWA 3AP2A 2VSFA 3SC2A 3OKFA 4OV6B 1QNFA 2FFBA 3GAAA 3H4TA 4PC6A 1RM0A 1S1CA 5BNZA 1JG7A 5TQ0B 2QS9A 5EIWA 1BW9B 1QC5B 4MVJD 5KOYA 1TT7A 1G5PA 3R7NA 1XK7A 2W93A 3UJNA 1NTOA 3MGAA 3AC0A 1MZBA 4I99A 1HNZB 3EBPA 1EKXA 2EKDA 2O3QA 1FVFA 4I46A 4QFBA 2GM4A 1OXTA 1ZM3A 4PAQA 3F9CA 1W25A 1KJZA 1TJ5A 3EDQA 1M8KA 2VEDA 1UAGA 4NY1A 3KJHA 3TXXA 2J7PD 2AUNA 2QJRA 2X6RA 5G1NA 4BO8A 1C1YA 3BFJA 1F8UA 3DMPA 1UXHA 4QEZA 3OPQA 4JJZA 4WKOA 2G36A 2ZWOA 3DDCA 2V4RA 4PGFA 3WMEA 3IJPA 4JUAA 1UEJA 2QA5A 1Z34A 3PQ2A 5KTTA 2IC5A 3HBAA 1YT5A 1YJXA 2D06A 1VJ1A 1DAEA 4ITRC 4J0DA 2IODA 2Q1TA 3QELB 4QUEA 5I7VA 3OLVA 3ADBA 2X9NA 3SVZA 5G40A 1M5UA 3JQBC 4GM1A 5J43A 1C3EA 4F9FA 3EGOA 2V4UA 4NX2A 4GZ5A 4HDMA 1YJBA 4HNUA 3OOSA 3FOEC 1A4XA 3GVCA 1TW3A 2REQA 1VFNA 2RH5A 2XIQA 3ND9A 3K9LA 4P0TA 4J9UE 2I3GA 3SM9A 4JI1H 1X1BA 2CD9A 3H1AA 3O03A 3CX3A 1ECLA 1A3GA 2P4UA 1E2IA 3O8OA 4OK6A 2OHIA 2UZ1B 2HNKA 2X5KO 1I2DA 3H5IA 2A9PA 3IODA 3BPSA 5KFOA 1GCOA 5CR5A 3PDHA 4LY6A 5JUMA 2B1QA 2C0QA 2CB9A 3IUNA 3LNCA 1CZUA 4WUTA 1H65A 1U9CA 2EX4A 1UBOS 1U99A 2PKWA 2REBA 3OMXA 1N7HA 4MRMB 3I28A 4RLFA 3A1FA 3WJAA 2UUAH 1O8BA 2HOQA 3RF6A 3RDPA 3NHSA 4WLUA 1H8HD 4PGGA 4WTOA 2EKZA 1CHNA 4ZC1A 1FP7A 1HQCA 3H0CA 4C4ZA 4LCBA 2I4MA 2GESA 3F9RA 3CUTA 3OQBA 4HUJA 4L9AA 3DDNA 1MT3A 1YS4A 2PVSA 3VSAA 5TNXA 2O3UA 5LQAA 1KI7A 4ZEMA 4BKRA 4W5OA 1VKZA 2YFKA 4JV0A 4NXMH 1SOUA 1ZD2P 3I3SR 4N3BA 5AHXA 4YREA 1OLSB 5JRZA 5L1JA 2PRSA 3FOWA 2DBVO 1ISMA 3B2NA 4IOLA 2JFPA 5IVDA 1KFBB 3PFCA 1D4ZA 1M2GA 3MCAA 5DEOA 4INZA 4OXRA 4N9QA 1NT4A 5ALWA 3CH5A 3NAMA 1TDJA 2VPPA 3EAFA 4IDCA 1QMPA 2HSZA 2WJ4A 4RHUA 1UMDB 4HG2A 3E0QA 2AEFA 1OX4A 2QLNA 2YMQA 3L41A 1HSOA 3OZSA 3OZDA 3R3JA 3ZWAA 3OQNA 1OXKB 2YZKA 4XRRA 2AF4C 2VNKA 3LOUA 3M6FA 1WB4A 3O1LA 3M9WA 5G02A 4CE6A 3TOXA 5H9VA 2G9UA 4EFBA 1YACA 3HKCB 2E48A 2QE7D 1KR2A 4GLJA 5FNVB 1BHQ1 1T35A 2AWNA 2ASJA 3PXAA 3AKEA 3CZCA 2OOSA 3F2VA 1E62A 3HV2A 3LIPA 4LXQA 2LV8A 4Q7KA 4WCVA 2QVLA 1H2RS 5ANRB 3IPRA 1G291 2DFNA 3VV2A 1JR3E 2PUJA 2QIOA 4YRKA 4CLRA 3CBGA 2YJGA 1DTWB 3GFPA 4CN8A 4GOMD 4LOHA 4C43A 1YMUA 3VUFA 3GC6A 1EK6A 3JQRA 4EP1A 1FYFA 4MIKA 1CFZA 4CW7A 3K6KA 1T2EA 5BVGA 5HK8A 5KNCD 2QM0A 3KYIB 5AR1A 5FEUA 4ZGWA 5FBWB 4ZHSA 5I5WA 2JVJA 1JHZA 4Z9XA 3T3NA 4Q3BA 1RBMA 4B0OA 2Q7DA 2A0YA 3K30A 3L1UA 3LA6A 4FJ0A 1RHRA 3ILHA 3LV8A 2VPTA 3NBZB 2JNWA 3BMNA 1PNTA 3WNBA 4D79A 5IF9A 3PGKA 3CVWA 1RXVA 4W99A 3QPVA 2F00A 5BWXA 1V7PC 4DDHA 2R87A 3U3KA 4DLRA 4EHLA 1LF5A 2P6NA 2MMCA 4KKXB 2ES4A 2H9IA 4GUDA 1YDHA 4U6QA 2V9CA 3T41A 4B17A 2UYQA 2OVFA 1YI1A 1OGIA 2BBOA 4AC9A 4BFXA 4A7PA 1BMQA 2NXWA 4RYDA 4E08A 5A4DA 3F8SA 2G8NA 5CFRA 2AMVA 3OKPA 2Z6QA 3HB9A 2EBUA 3ADDA 2O2GA 3CONA 1VIDA 3MT8A 1A8PA 3KOMA 1TM4E 1UBHS 5ADWA 2XT9A 1NDUA 4MEBA 4ZDJA 3NBMA 2I80A 5L4SA 3HA7A 2EGGA 3O38A 2VDNB 3PV0A 2Y1EA 5BV8A 1VLLA 5IJ0B 1T8PA 5DW0A 3LY7A 2C0PA 5FI5A 1AK1A 4I4TA 2R7LA 3OM9A 3S81A 3RVDA 3KKLA 3GLIA 5BN4B 3GCDA 1N2IA 3W77A 5B2FA 5HJEA 4KPYA 3TQRA 1JSXA 3CBQA 3BEOA 4FZRA 5CH5A 4LJSA 3NVKI 2VK1A 1ILWA 2HA2A 4LF7B 2C4NA 2ON6A 1MEJA 1R2QA 3DTVD 3ENKA 4LGVA 3W7VA 2J5XA 4PO3X 3SEAA 2UYGA 5K05A 2X0DA 3ZTTA 1BKDR 4YRJA 3E8MA 3W5SA 1IONA 2VBIA 1FFCA 1IEWA 1SCIA 3D3NA 5EIOA 4DRXB 5K99A 1NXWA 1ECBA 5CB8A 1Q20A 4LBWA 3WMGA 7GPBA 1DBIA 1NIJA 3HCRA 5G3ZA 1NVGA 4H0FA 1WW3A 1K68A 4DIOA 4KHZA 3I64A 1J8QA 5BSWA 3CLKA 3M49A 3P26A 1XK5A 2B34A 4C4PA 1C1DA 2IY8A 1CJVC 1B43A 2O4UX 3SX2A 4K1XA 5GQSA 3WYNA 2QTBA 1A8SA 1Z12A 2Q6LA 2VUHB 1ISHA 4QYMA 3TE6A 4CEJB 4WKPA 1FFHA 3TQIA 3GV7B 4GX2A 3AR2A 3MM4A 3VNRA 1JI0A 4MR8A 1ULUA 2PY6A 2PUDA 2CFMA 4WCFB 1LDYA 4YC7A 1ZVKA 4FT4A 2R5NA 3SC3A 2QDXA 3UFXB 1BIFA 2QKYA 3GJTA 3GLKA 3ZHXA 1RR6A 1H4QA 1TGYA 4EY4A 2R7ZA 1Z88A 1S2IA 2BMEA 3QRWA 1ZU5A 3PHCA 3FRIA 4OGKA 4KI0A 1E6EA 3DAYA 1E9AA 1GXSA 4LWZA 4TTRA 4EEXA 2QTRA 2DE0X 1B0UA 3CCBA 1CXZA 1S9HA 2SICE 1Q12A 1RVV1 3DHVA 4HYEA 4CM1A 5KTNA 4FGZA 1XZQA 3DT8A 4RVSA 4F1KA 1LJUA 4UVGA 1HZZC 1W4CA 1TEHA 5BYJA 1DAOA 2XTMA 5DHTA 2JS7A 1NZDA 1W6RA 4AN0A 4C1NA 2O03A 4NF2A 1KYXA 5F3WB 1A4UA 1XLWA 3NBFA 2GEBA 2CLMB 3HR7A 3PZBA 4YRSA 4U7FA 1YZTA 2PJZA 2YS7A 2R6GA 3GPCA 1JHAA 1DFIA 5GOTA 3QTBA 1SKUA 4J0JA 4BVAA 4TSKA 1T5OA 3LBYA 3C3MA 4ZU3A 1JT2A 2QTHA 4L95C 1CB7A 3DE0X 4AX8A 5K0NA 3KKMA 1N6HA 3R7DA 4E11A 1X1EA 3FYSA 1Y34E 4AROA 5JG7A 1XKXA 1C7FA 4ZQHA 1Y3CE 2ZITA 3ROGA 2GCGA 2ZRLA 2BN4A 4RSHA 2HDOA 4D74A 2CLDX 5ALXA 4EM6A 3SIRA 2TECE 1AB6A 4DWOA 2UZ4A 2YZ2A 3TZCA 3NWJA 1GNPA 3VDQA 4CMEA 3FUTA 3SHOA 3DPIA 3WLEA 4WLFA 3GNTA 1HNWB 3KNZA 4JEMA 4PXAA 5CYGA 2GRAA 3ED5A 5JNLA 3KRTA 4PPYA 3MJVA 1E92A 4JMLA 5BVHA 3PDJA 3DG9A 1DT3A 4CV0A 4OLBA 4S35A 1RQGA 3NALA 1PWHA 4BO6A 3CPHA 1IQUA 1V5FA 4Z0NA 1KPIA 2DH5A 4NE2A 2EYUA 4A1FA 4RABA 4EYEA 3OZTA 5M34A 3BAZA 1DU4A 3EWIA 3P2KA 1R6TA 4POAA 3VR6H 2ODAA 4QT4A 4FCWA 4E4TA 3FOBA 4S1WA 3WB0A 5DFAA 3D7NA 4WV3A 5DNUA 3R8FA 2C4HA 2J59A 3IEXA 2F3TA 3KZCA 1C9YA 3M6VA 3PGMA 4CM9D 2D7JA 5IZCA 2Z3ZA 3U19A 5ARDA 1JEQA 2AOTA 1NG1A 4QEDA 4X90A 3Q6NA 3OLXA 1T5BA 5AUQA 1N3BA 2Y1WA 4OHPA 4UBIA 3BE4A 3M6WA 5DHUA 1SRQA 4RK0A 2Y67A 3LFUA 3PITA 2Q6OA 3SYRA 4EQ5A 4OX9H 3BDVA 4GQAA 4L15A 3OMWA 4RACA 2GJAA 2ZKIA 2YV5A 1X0VA 3PQ7A 4JL5A 4M6WB 1QGOA 1JIUA 4IIEA 4R5MA 1ZN9A 1JDPA 2J3KA 3HQ4O 5EQTA 1VMDA 5AW8A 5BWRA 3RW9A 4Q93A 4DYDA 2R00A 4HGZA 5KNCH 4IAJA 1EI9A 3O8BA 4H08A 1CZHA 1H85A 2AFVA 3KBBA 1ADYA 4MS3A 3U0VA 4A6XA 2FX2A 1IATA 1UEIA 3IYLW 4YRIA 3COJA 4RVOA 1EESA 2GPSA 5IVHA 1XKLA 3S5UA 2ZUDA 2GK4A 5H3HA 4EO4A 3IJRA 4CM4B 4Y1RB 3IP8A 1GJRA 2WPDD 3Q15C 4C07A 4ZJYA 2ENWA 1LPBB 3QPCA 5EJIA 4DE5A 1EX6A 2W0SA 1JEAA 3X1WA 2GK6A 3AEUA 1A3CA 3QF4A 4IO0A 4RV9A 3SXUA 4E5SA 3C2QA 5AFSA 2A1UA 2I4NA 2P9YA 1KI6B 1T9KA 2V97A 3W5JA 1B8NA 2O5EA 1JJ7A 4YCNA 2B0CA 4RV4A 5T14A 3M1IA 4TWJA 4NNJA 1JKXA 3HU1A 3OOJA 2FWAA 3JRWA 1KSGA 4XPZA 1EM8B 1V1RA 2X1LA 4KRYA 1T0HB 1PKXA 2PLNA 4D8WA 2YW2A 4OHXA 4OIFA 5KQMA 3D6JA 4MKRA 4N01A 2ZU6A 3IDSA 1BCSA 2EJWA 3UEOA 4F7WA 1ZSNA 1A7JA 1GCIA 3MWDB 1O97C 3R1IA 4ETIA 4KQ6A 5DCUA 3LC1O 2XCLA 5EE9A 5HBGA 4F1JA 1X13A 4X61A 3CZRA 5TT0A 1HDRA 3ZWMA 2JCVA 1UKBA 3KHGA 3EZ6A 4AZTA 1E4EB 4BZXA 1GDTA 4A3LG 3VPAA 3ZLVA 1XNJA 4FMDB 2YJ3A 5I3CA 2IY7A 1K2WA 1GR0A 1Q1NA 1WXQA 4Q1DA 4YV0A 2PUEA 1Z37A 4QYIB 3P0FA 2F43B 4MSUA 4I3HA 5BRNA 5CEJA 4MWTA 2C8JA 1XQ9A 2GXQA 4NKRA 1W4AA 4JYPA 1S2MA 3ENZA 1WBBA 5LZ9A 2WYWA 1RHKA 3O2JA 5BPFA 1YE3A 2J08A 3NKLA 4LRWA 3VVCA 2IHNA 1M6VB 4MS4A 1L5NA 1RYRA 1O58A 3EXHC 3FCCA 2EP8A 3PXUA 3HHPA 4WDQA 4Z3OA 1CY2A 4B3MH 4IDOA 4W1QA 5BR4A 3WYBA 2R96A 4BYMA 2CJWB 1GU7A 2QSUA 3F98A 4JC0A 2FK7A 4JU9A 1B0ZA 4FKBA 3NV7A 3T7KA 3ZDXB 2VVTA 3ETEA 3GIIA 4JI6B 2D7CA 1IUOA 3KPVA 1SELA 4TZ6A 1XJ5A 3KQVA 2IUEA 1H5UA 1JJBA 2IV7A 3TNLA 5EHXA 3V5NA 5LD2C 2VPIA 3PXCX 2P62A 1JDTA 1T8UA 2DFDA 2FSFA 1TQ2A 1V45E 4I1PA 1WIWA 3QKWA 5AVWA 1EFVA 1USWA 2R6JA 2W0MA 3AB8A 4EFEA 4G89A 4NFYA 2WKRA 1QGYA 3STYA 1R88A 3EE6A 4XFJA 4UCSA 1IC6A 1K5HA 3A2MA 3T3MB 5JBQA 2WTMA 1A5ZA 1J42A 2X4LA 3HP4A 3HGTA 4MVJH 4GLWA 3B51X 1YR9A 2VAVA 1XZ8A 5A3JA 1JKMA 2IYUA 2PMZA 4BX3A 4ZYZA 4CF4A 3PNLA 4AJ4A 3SZMA 4CQMB 2YU9A 1JF8A 3ESAA 721PA 1QUEA 2PWAA 3F71A 3OWXA 4R9SA 2C8KA 2IA5A 3L07A 3U1BA 3PHJA 1XNQB 3EXG2 2CHVA 3WFIA 2YV1A 3Q8WA 2OXIA 1TA0A 4BGUA 1SVKA 3RSLA 4MDHA 4YVFA 1UDBA 1DAPA 3IPXA 4QVKA 3E9EA 3M34A 1EPUA 1G9SA 1NXVA 4A23A 4F3CA 4CG2A 4UOEA 2M2IA 4LHSA 1GUDA 1KA9H 3I2HA 4J91A 1VLMA 2IV3A 3SZOA 4CUZA 3A1WA 3G7NA 4WJLA 4UHFA 3ZWCA 5A4AA 1Y6JA 1EUYA 4I8XA 3HE3A 1ORTA 3EW9A 4AQYH 3X1MA 4YALA 2VNSA 2F43A 1ZUD1 3ZUPA 3D8TA 2XMZA 5JYCA 3PX3A 4JP5A 4L5YA 1JG1A 4F4FA 1SGWA 3H8WA 2KQUA 2P5YA 1W49A 3R3VA 5HFNA 1GFSA 1PT6A 2XVZA 2Y0EA 3KXDA 3W2HA 3FFTA 4LYHA 1L4MA 1U8ZA 2QTNA 1NVDA 1CX9B 2JVKA 2FOLA 1AGRA 3M5PA 5ERGB 1EZ4A 4JI2B 2I3BA 3ELDA 2OXTA 3A2NA 4UHHA 4NZOA 1K63A 2OXEA 3GEGA 1CY6A 3PICA 1INLA 4MK4A 2ZUFA 4Q39A 1G0NA 1X7WA 4F3TA 2XMRA 4GR9A 1ECCA 2EJ3A 3RC9A 2PBFA 3GF4A 3ZY4A 3BFPA 4MVJA 1BXRA 1WBJB 1H1LB 1BX1A 1F12A 1CUVA 2IXAA 2XCAA 1NQXA 5ALIA 1P2GA 4RDXA 1KWGA 4TQ9A 1K98A 1T43A 3IIIA 4R8LA 3MYRA 3HJNA 1ZNYA 5KDDA 3OCVA 3TG2A 4D80A 2R2GA 3GLUA 3ZW9A 2JA5A 2RARA 3KTAB 2H0RA 1RRGA 3N76A 4OO3A 3S1AB 3SFTA 3HXMA 1G4HA 2R6HA 3AG5A 4MJLA 3GIKA 1I36A 3A4VA 4V3BA 2WDTA 4NYJR 5CLFA 3MFIA 1QNLA 4QGGA 2NPOA 1T1GA 1W9MA 2H1SA 4FR0A 4PAWA 3T0FA 4D8TA 5CU7A 4FYHA 4K28A 4D0SA 2IDZA 5DSXA 5AW1A 1MFPA 1I1NA 3LKBA 4MICA 3LYAA 3B1WA 2F3PA 3TMAA 4D9MA 2SCUB 1P19A 1RHUA 3WMRA 4E07A 4Y1FA 5AO9A 2HD4A 4S1VA 4BFZA 4ZDIA 3TJRA 2PUVA 4PINA 4TT3D 4CM8A 1ZUWA 4QJ3A 3B9RA 2YXNA 2O8CB 1R6BX 2JLYA 1OASA 1F14A 1T9HA 1NLMA 2I8AA 3BJZA 1RLJA 2X86A 1KH3A 2VSOA 1Z7EA 3CB2A 2RHGB 3DBRA 3EXHA 3GUVA 1W2GA 4JUCA 4QGFA 2PMBA 4JJFA 2FG5A 4RXMA 1EUDB 3RKRA 2QX6A 3WQQA 4IV8A 4Q4HA 5FHQA 4Q21A 1NJ5A 1VHJA 4MDYA 5JZOA 2WC1A 4FFBA 1E8MA 5T67A 1ZJYA 2FKAA 1WOMA 2SKEA 1OREA 4FUTA 5JZMA 3N2LA 3F96A 4XOUA 1HK7A 2W8BB 3Q1LA 1JJVA 4JA0A 3ENQA 1JAYA 1DINA 1P7CA 5HPYB 2VJNA 1MOPA 3AF4A 3G6KA 1Q91A 3DJYA 4B48A 4U7GA 1LPPA 4FGRA 1NWCA 3TB4A 5LA6F 2C0CA 1T6YA 2GCPA 5C5CA 1SUDA 2HUNA 1G42A 2IXEA 3E82A 3PUKA 3UT0A 2HKIA 3OOWA 4F93B 1RYSA 4F6RA 2BFWA 2NGRA 2J0UA 2CUTA 3PA6A 4ZO4A 1R5NA 1TAQA 2DECA 4FDMA 3ZS9A 4X6UA 2F8TA 1JDEA 1OPRA 2FW9A 4XZ3A 4HS9A 5FPQA 1W0JD 1R6VA 3D2LA 1GPMA 2B2CA 3SHWA 3CXRA 3QWIA 2XKJE 5CT5A 2OL4A 1SUIA 1ULAA 2HT6A 1HQKA 3AFOA 4WZBE 3BKXA 4R3WA 1P5JA 2QZ4A 1GARA 1HRDA 2Z8ZA 1JFLA 2ASEA 1ZVVA 2NYRA 3D4OA 2RF4A 1V11B 2VTVA 1E2UA 2AZTA 1NYLA 2HXGA 5IKMA 5I5UA 4IWNA 4EDHA 3E6AA 3ZDDA 3OHSX 4JGBA 4L0DA 3GDHA 4GMGA 5I7RA 3OURA 3RIHA 2ZBEA 4UBOA 5JQGA 1FW6A 5CT4A 3UPUA 1FP1D 3C3CA 5B37A 5CB4F 3G5AA 4U2DA 1SVOA 2VDQB 2RHBA 2QE7A 1IY9A 2JA6A 4JB3A 3RHTA 2R60A 5F9NA 3BIFA 1TJPB 1HE2A 4OREX 1OMOA 5ALMA 3BMXA 2EFCB 3I5UA 3KQTA 1N1EA 1U2GA 4D81A 1XEFA 2YVQA 2YN0A 4TZKA 5ED0A 4BJ1A 4BNZA 2QN8A 3GZ4A 4M9CA 2YY7A 1GVHA 3HJCA 3Q5GA 3HGMA 1ZAUA 1V2GA 2A3RA 2C4TA 1M2KA 4H6XA 2VP5A 4J90A 1TNDA 1BD3A 1I33A 2R47A 5L9XA 1JHOA 1YHYA 4PLPA 3WIDA 2P77A 3IUJA 1RJ9B 2DH6A 4Y1RA 4Y9DA 5G2OA 3DBRB 4D3DA 5JROA 4WQMA 1XMSA 5CBPB 4MUFA 3N6XA 2WWRA 3ANLA 1MN6A 4JI3H 1GTRA 5HZKA 2VBCA 1JEJA 5EIAA 2YUIA 2XXBA 3JD3A 5LLSA 3RVMA 5CFLA 1P1JA 2WE7A 4X66H 2IPAB 3K2BA 2EZ8A 4EJ6A 4DR2B 5K8UA 5D51S 4U4AA 1E6MA 2GERA 3H83A 4RSGA 3O3MB 1GQ2A 5BW8A 1YQEA 1UDXA 1H4TA 1M2HA 1T8TA 3PWSA 1WSWA 4N03A 5CLGA 2BFOA 1KU0A 4U7HA 3TUZC 3WX0A 3I72A 3PRKE 5EPUA 5F4ZA 2V98A 3DKPA 3L8MA 1AKYA 2Q9CA 4Z0PA 1WAMA 2NU7A 3N28A 5TE9A 3UA3A 4EGAA 2DJIA 4CKCB 4QYWA 2V55B 1RXEA 3O9MA 1N32B 4MUIA 2OD7A 2QTVB 5DT9A 2W42A 3G0GA 1PNOA 1E9VA 1REQB 4UZEA 4OLAA 4N7MA 4DSNA 2P5SA 4JIGA 4AN1A 5DYWA 1WHSB 1JECA 1GGOA 2E6KA 2ZB4A 3C45A 4KXNA 3EDCA 4PBTA 2C5AA 1GNSA 3CV3A 1KKMA 3L8YA 4H60A 4I5DA 3DFIA 4R8MA 1JHXA 4PTYA 4PZ8A 1LRJA 1J25A 1PT9A 2EATA 4J0GA 3LE8A 4Y1GA 1F2DA 3NBZC 3QU9A 5CA0B 2JZNA 5CXQA 4EMUA 3N44B 3U2QA 4EW1A 2ZJZA 3Q9NA 4XLTA 3LO5A 2P6RA 4TSFD 1L0BA 2I1VB 4R9NA 1ZHSA 1DKRA 1NBMA 1XDBA 2YJ4A 3V2GA 5BWBA 3CS3A 4C0QC 2XDYA 3V7FA 6PFKA 2JPDA 2JK1A 3RWMB 2P75A 1E2LA 2WJJA 1XZLA 4JBHA 4AF7A 1PS0A 3PEVA 1CQJA 1NC1A 2RAPA 3G6WA 4YDRA 5LP6B 4OAOA 2BGJA 3I6BA 3F8WA 3J81W 5A5DA 3W06A 1G66A 5BW6B 3F6CA 2Z3VA 1CUFA 1OT5A 3PQEA 1US8A 3H17A 4CHTA 1D1QA 2HW8A 4Q7QA 5G0WA 1D8AA 1J2YA 3R0IA 1OW3B 3QVLA 4P84A 4XWOA 4F1WA 1QRUA 3UZOA 2VDMB 4I1YA 4A73A 2D54A 4DRFA 1QQ7A 4WNCA 2AC4A 5J2UB 3ZZMA 1U0BB 3V7UA 4YGXB 2H18A 1JHPA 1RYYA 2JHGA 2NACA 3AYZB 3QH4A 4GMDA 1B23P 5AKJA 2R8ZA 4LA4A 1ZAKA 4C78A 2QD2A 1WV0A 3DLIA 1NBEA 2R84A 4JHLA 1ZRMA 3S70A 3P2EA 5DE3A 4OHOA 2PU5A 5ITWA 3L49A 1ZHQA 3TAHA 2VDVE 4A8JA 5E1MA 4D3FA 4DR5B 5CDHA 4MWOA 2IP2A 5D7NA 1R8YA 1GTJ1 2R1VB 4ZI5A 3PX2A 5C9ZA 1B74A 3ZD6A 3ZY3A 1MJGA 3FGZA 2Q1UA 3NYRA 4JK3A 4O4LA 5B12A 4Q4AB 4IFEA 4CM3A 4QWCA 4YAOA 1GU1A 1R10A 1PR9A 1SC3A 2P4SA 4P86A 1WMEA 4IWXA 1VOTA 2PMCA 4OATA 4PX5A 4JI4B 1FVHA 3JQAD 2DQYA 3D4NA 4KN9S 4G6ZA 4WBNA 5DCWA 4J9OA 3QTLA 2BAGA 1JX6A 5I9NA 5IYZB 2VUSA 5I8PA 2XOEA 3UK6A 2TSYB 3AO0B 4TYYA 2RGEA 5AW5A 1Y3DE 1RRCA 3EMBA 2WAQA 4MVJP 3Q8LA 5BOSA 1ZVJA 4ZVMA 3SIXA 5JZSA 1JV2B 3D64A 4H9GA 4Q9JA 3TBKA 1MLDA 1TAGA 1FPMA 2HJHA 1WZUA 1ZN8A 2IZOA 1R8SA 5IMBA 1AZLA 1IRIA 2FPKA 1CRZA 1CNEA 1DCKA 2IXTA 3GFFA 1G6KA 2J5RA 2M6LA 4RAYA 4Y8VB 3H2KA 3TOZA 3FIUA 5E1DA 1L7PA 4FBLA 1EFLA 4I9UA 3E9NA 4OU5A 4ZEVA 1X1CA 5DM1A 4O7NA 2NTVA 1ZP6A 2KB0A 2SKDA 2JIQA 3RGGA 5K6AC 1YR7A 2HHFA 4K6GA 2F1KA 2XEDA 4QBKA 5TQ2B 3HI6A 1ESZA 4XX0A 4FI3F 1Q92A 4KZKA 1T5DX 4JC5A 2GEDA 4WBNF 3NO4A 3CN9A 4M7WA 3D3QA 1JIKA 1WSDA 4OIMA 2R9VA 2GZ2A 1PV1A 4FUQA 1GZ5A 1LTQA 3Q8XB 4MVCA 4P2BA 3C74A 1FJGH 3QF4B 3X43A 4DARA 2XQVA 2AOUA 1MOZA 3IBFA 2XUQA 4NENA 2VOBA 1I9GA 1WUKS 1E1LA 3D43A 4ZXPA 3HZZA 3IUBA 1MX5A 3T7CA 5TPWB 4AMBA 3S29A 3FMIA 1LFAA 5DG7A 1MAAA 4AZ0B 5A4JA 2GUWA 5FBRB 2YBDA 1Z7YA 1PJBA 3BCHA 3OECA 1QMGA 4JVNA 5AHWA 3JWHA 5AXAA 2WVAA 4HMQA 4KK3A 3V1MA 4E32A 4ILEA 4QU0A 4RK7A 4H4EA 1EM8A 4LZAA 2BKXA 2P0YA 2RSLA 4GNKA 4NZZA 2HGSA 1YSCA 5DTJA 3GLRA 3ZY5A 3TLEA 4UDOA 3H2JA 4ZMRA 2VRNA 3OIYA 4C0KA 4NJMA 1ZNWA 4IR9A 2VH2A 1DDIA 2Z09A 3AKCA 1YR1A 3HUFA 3CX8A 4KX3A 4NK4A 1U28A 4XUCA 4DCGA 4ZAGA 2GB4A 2Y92A 1D2RA 5EWJA 1BWQA 3RE1A 1S0MA 1IBRA 3IT0A 3GT3A 1P6QA 2BR3A 1RQRA 3DZ8A 2R82A 1WXHA 3G2HA 3KFXA 3LLCA 3O0TA 3C3KA 4JJGA 2AL7A 2ZJ1A 1AMOA 2DWCA 1NUAA 1O57A 1SAYA 5DX1A 3L9XA 3RS9A 4LS3A 5EFZA 3VU9B 3X0DA 4BWGA 4NQRA 4FWTA 1WZ2A 1SXJB 4WK4B 3GIMA 3A7DA 4B82A 4N8DA 4LDJA 4WN9A 1SWVA 1T1JA 4ZI7F 1T5TA 1XTPA 2EZUA 2NO7A 2RHTA 1GA6A 2C5BA 3LUCA 4X6XA 3RFFA 4RULA 2PX2A 2W5UA 4PICA 2YHAA 1RBZA 1S01A 3GUHA 4K9MA 3IQWA 1X38A 3IAAA 3KOUA 1MO2A 3ZUGA 3TDMA 3K0EA 3OQIB 1NMXA 1OFIA 3EWAA 4DRYA 1W52X 2I71A 3GG2A 2H9AA 1QIIA 2BI4A 2IYVA 2VOEA 1MX3A 3DAFA 4FOPA 3DDOA 3P1JA 3CSUA 4RD1A 2N1MA 2VYFA 1TFRA 2DOKA 3LPLA 4QARA 1G5RA 1M2VA 3GD7A 521PA 1UMDA 4F9TA 4O0MA 5C18A 1E1QD 1EIZA 3OJ0A 2OP1A 1H9AA 2M32A 2NO9A 3O2NA 3EZGA 4OPMA 1XDSA 4DRZA 3KKNA 5JRJA 3M3DA 4U8HA 2FSSA 4KB5A 1RYMA 2PXHA 4GT1A 4US0R 4CLOA 2ISQA 1Z2EA 4FGSA 4HHEA 4MWEA 3NHBA 1VIMA 3A06A 3D2AA 4PSUA 5LQMA 4TKUB 2HF8A 4X63A 1XAGA 5E3HA 5JV5A 4PG8A 1OFHA 2H1LA 4ED0A 4OKNA 2HT1A 3B85A 1N3IA 1U1DA 2W6JD 4DSTA 1DTSA 4B3DA 4BO0A 2ZBPA 4J7UA 1OVMA 1SVSA 5BPHA 3LC0A 2EXXA 5TVKA 4YP9A 2I65A 4MA0A 3DQZA 3F6YA 5ERXA 3RBVA 1XKQA 2QLLA 4A26A 2WT4A 1PGQA 1MIOB 3E48A 4GP7A 4O81A 4QLOA 4Q1EA 1VMKA 3ZDFA 2B4RO 4LZLA 1YIDA 2ZYSA 2XSZA 4JB0A 4UUPA 1H2EA 2VUMA 4RADA 1EHCA 1P0QA 2HIXA 1PX0A 3L7CA 4G36A 4K6FA 5TV2A 4AUNA 4EMSA 2HBYA 3VZSA 2WA1A 1IBCA 3AFHA 1V43A 3LHFA 5LLTA 3JYLA 3KXPA 3TTSA 2F1JA 3PUVA 3EULA 1U0OC 1XLTA 2ZRHA 2ZJ2A 3D6TB 4AMVA 1F9EA 5BV1A 1SXJC 3VH4A 1FCJA 1CP3A 2K87A 4ECUA 5GZ6A 4DJFC 2CT8A 4RUKA 2EWWA 4LY3A 1DC7A 1FJHA 1CUUA 4RZQA 2XE8A 3FOAA 5EVJA 1HL3A 3NVAA 2W6MA 3KQOA 4IOJA 5DO9A 5DGHA 1E2FA 4X00A 4REOA 1C0LA 3DGFC 3T12A 1MJHA 2AB0A 4C2TA 1SXJA 4B44A 3D4LA 1GTZA 1LBIA 1A9PA 2HMYB 4IG4A 4PZ9A 4UE6A 4KR9A 1SC1A 1D6MA 2JFZA 2VP9A 1KYIA 2GKOA 1R12A 2BF7A 1VIYA 5DG8A 1Y1VA 1XEXA 2RHCA 3LCCA 5TARA 1S03G 1QR2A 5JQGF 3RGWS 3V33A 1JKFA 3VPXA 1N0WA 3WNCA 1Y1SA 3EPKA 1I2BA 1VBNA 4RJIA 5FOUA 3ZBTA 2C04A 4QD3A 5JNWA 3OPYI 1B33N 1Z4PX 3Q3CA 4EZBA 1OIWA 3ND8A 1RAAA 2N1BA 4XIYA 2CDCA 3H4MA 5DYIA 1GWNA 4BX9A 4IRCA 3LUAA 4QO8A 4UVDA 3DEHA 3LYUA 4Q01A 3H2YA 3I0MA 2NG1A 1OWPA 2GVZC 2QU8A 2Z2XA 2FQXA 4R81A 4IDEA 4OY3A 5DZSA 5E3IA 3GFQA 3JPYA 2YZMA 3WL7A 1NGSA 5I7OA 2IXFA 2A5YB 2OAEA 3KV3O 4EHDA 2JC3A 3M7IA 3CMCO 3A58B 3GEPA 4HN4B 2CVOA 3GJ8A 4FNOA 4QQKA 3VR5A 1WXDA 1ZKDA 4GD3Q 4N3AA 4Q15A 2NUBA 1L7MA 1YU6A 1DHTA 1VG9B 3PTLA 3TLGB 3U9LA 1GAJA 1LCIA 3DYIA 4E5YA 1I3LA 4AKTA 3COWA 4NOMA 3LTNC 4QUJA 4UUQA 2W6PA 4AX4A 1AVTA 2IYEA 5EPOA 3U5ZB 2Q3CA 4M37A 4KGXA 3V1KA 2FFAA 3GEDA 3U48A 1N5OX 4B7CA 5JD6A 3K9FC 1FFYA 4NU0A 1YDMA 3T5BA 3VHQA 3PG5A 3LP5A 1F60A 1JSRA 2ZJ3A 4DV7B 2RDMA 2IHYA 5BQ5A 3E2IA 1P0MA 3L1HA 1XRPA 4FR5A 4MB6A 2IYQA 1EK0A 4NBLA 5KNBA 2FZGA 5K5EA 5SYMA 1Q0PA 3GH1A 1EHYA 3KDAA 3UPDA 1D0SA 5GMOA 4XXHA 3AR9A 2VT3A 4B80A 3UQ8A 4IUBS 4DIBA 3G9ZA 2DHCA 1J8YF 4G01B 3UH0A 1XZDA 2NXCA 3NKVA 3HU2A 2YKGA 4IR7A 5C8DA 3IOYA 5EUQB 3EC7A 1PVOA 3ZXIA 4RNNA 3KR0A 3ZEAA 4BV3A 1PK8A 4G4GA 1PD0A 1G7RA 1WZCA 4YT8A 5KYNA 1VL0A 1QF9A 3KZXA 3U81A 3IEMA 3IKTA 4ALNA 3N2ZB 3G0BA 4MGKR 3JWPA 3F3YA 3N8NA 2DYKA 4DDUA 5EJ7A 2C98A 1X7ZB 3MR3A 2FK1A 3GT0A 1OY1A 3QBDA 4GLXA 2L19A 1OE0A 3GLVA 5KPJA 3CR7A 1N2XA 1P8JA 3F6PA 3QX3A 5J58A 4EO9A 1K86A 2C7PA 2YY6A 3KT6A 4BKPA 1VGQA 821PA 1ADFA 3BK7A 3SBXA 2ZQ5A 4Q8EA 5E7MA 3EPLA 5JHGB 1BMDA 2CMDA 3JQQA 4QWMA 3H84A 2X6QA 2G70A 4JLWA 1R9JA 4WCDA 2Q2QA 2X5JO 1ZK1A 3W2GA 4AKEA 3OTIA 2UYCA 1H9CA 1FFBA 1PTJA 2RFLA 2G04A 3G2IA 1KU6A 4G1UC 3ZX5A 3O26A 2PQ0A 1HX7A 1EGVB 3RSSA 3HN7A 3V2UA 2FKLA 3L7BA 2V7EA 3DEZA 4A8JB 3UJDA 4ZKDA 1WY7A 1XTVA 2QR5A 1Y8QB 5AKHA 1FE8A 1J0CA 2GZ3A 2P9TA 1Z8HA 2OGSA 3LC2O 1AHIA 1TQ4A 1PWYE 3GGSA 1KQNA 4TKVA 4J3FA 4AJ9A 1S2GA 2EEZA 3HUUA 1G9TA 1DG1G 4GF5A 3ZDZB 1K92A 2O8FB 2A78A 1G3MA 2HSWA 3CC8A 3K9WA 3L6CA 2PANA 4RBNA 5A5EA 1VCHA 3AR5A 2EKLA 2O0JA 1I3QA 2Q6VA 3K0BA 3EFOA 1XG5A 4IRMA 4ND7A 4BFYA 4AZ3B 4BWVA 2GILA 4OSOA 1MC4A 3PL5A 3TD2A 1DKQA 2WG1A 4B6RA 4WACA 4C0HA 3H20A 4TV8B 1P6UA 5JDIC 2FN9A 4XJSA 1D1PA 2GM3A 4BMPB 4CTKA 1B73A 1Z5UA 1CIJA 2O0LA 3L1KA 3K0CC 4WJZA 1ZQ7A 1W5FA 4QJFA 1BCRA 2GJ4A 1DBPA 1QDUA 3HXLA 2WSYB 2QZSA 2YXDA 3ILSA 5D5HA 3RUHA 3GGDA 4DL9A 1X9IA 3ET5A 5DYTA 4EYKA 4B8ZA 1IOVA 1Z6GA 2WB1A 2BGRA 3AETB 3NDJA 3BD6A 1WTAA 1KIMA 4M1QA 3AW8A 1VJTA 1ZNZA 3ND6A 1DIKA 3QU7A 2UXDH 2VYVA 4OYYA 2C22A 1PZEA 2D1FA 3CCFA 4UU7A 4PZCA 3SS8A 4FR2A 1QRTA 1QQ6A 1JFVA 3EGXA 3EDYA 3F6RA 4IAOA 1RZRA 2GN2A 2JFBA 1GPH1 4OX9B 2K4MA 3Q0IA 3SR0A 3B6JA 3AGPA 1KK0A 1I1QB 1LBEA 4YJKA 3PCRB 5C51B 3ZJUA 3ESQA 5F1YA 3NNDA 1O08A 4CHIA 3UOWA 2E49A 2JKYA 1I6UA 4PLWA 2NPFA 2WQ7A 3ZLBA 4RS4A 1I8TA 4MRNA 5B3JA 2XWBF 3VR5H 2O2JA 2PGNA 4HQFA 1ABFA 1FDVA 1XJQA 4NCKA 3PYLA 4E5PA 2OPHA 3U7QB 5AK3A 2I34A 2B7BA 4F3RA 3TCNA 1C0IA 1QVVA 2OOKA 4HFRA 4Q4JB 4EKGA 1W87A 2YXLA 3QLJA 1LZLA 1TLFA 2A9JA 3BMQB 4Q3KA 4K6OA 5IFLA 4O7RA 4D9JA 3QKUA 1C1DB 2JEZA 5AJUA 4LTMA 5IJ9B 4KQXA 3KKZA 1JLHA 1NJ2A 4H3VA 1XIVA 4HWKA 1ND6A 4LGMA 3NANA 1DAHA 4QIWA 2PGAA 4MGIR 1C80A 2CNKA 4WINA 1BDBA 1EVJA 1U65A 5DAAA 2CDAA 3ANMA 2JEJA 3D3WA 2YY5A 2H4FA 2DUNA 3PEFA 4R8VA 2E18A 4AJOA 4EHHA 5I01A 3ZDAA 2A5FA 4MVXA 3QW2A 4HQLA 1TO1E 2WMDA 3ENNA 3O4IA 3OIVA 1RJ9A 1NXQA 2EFJA 5EJ8A 2VDWB 4JI3B 3MS2A 4TMZA 3FYDA 5SICE 3TBFA 2ST1A 1MO6A 2OCBA 3OU7A 1PZNA 2OP0A 5DW3A 5TIIA 5JH7A 1EP1B 3KAKA 3T4XA 4AY5A 1C30A 3DDZX 5FLEX 3OZVA 1TEZA 1AHNA 1FDWA 5MGBA 3CNHA 5E95A 3K32A 2OVBA 2C9BA 3R5KA 1JAXA 1NF8A 2FMFA 5F2KA 1E89A 2XD9A 2MYNA 3L05A 1QAQA 4P35A 2FE1A 1D2CA 1YRQA 2Y8EA 3ORHA 1R9MA 2G17A 4KAJA 5L3RA 3WYGA 1EUDA 3WGNA 4UHDA 1A1SA 1XO1A 4KWCA 2POCA 3NEPX 4I5GA 3T3OA 5H8WA 5JVDB 2JCSA 4BV9A 4FGWA 1YXMA 4J9MA 2C4KA 2I66A 5JEEA 1QU3A 2HMWA 1PUXA 1XFAA 2E2IA 3GVHA 3EH1A 1Z4MA 1FFAA 2V65A 2VAXA 1BE8A 4H1UA 1W4ZA 1U81A 4JKIA 4LQDA 3RASA 9LDTA 2IIBA 2E37A 1V3QE 2AIRA 3K96A 4G5GA 4UCRA 1WZNA 3LUHA 4KPFC 5FX2A 4S2EA 2VRWA 3KOWA 5K7SA 3U3OA 2F55A 3ZW7A 4X84A 4FINA 1MMFB 2AMJA 1G2OA 1KFEB 4DQ0A 3ZHQA 2WHQA 2X4DA 4MWZA 1L4GA 3IILA 1BU5A 1AOXA 1JIIA 1QX4A 2DFLA 2IZZA 3KTAA 5FL7D 5G0VA 2HDKA 1CVLA 2FKNA 2I4LA 5M3BA 5YASA 1VBKA 3U55A 1J0XO 4U7WA 1KI2A 5FPYA 3ILYA 5B55A 3PPIA 1OH6A 4HGOA 5B53A 4HLQB 3AKZA 3D3WB 1MA0A 3R4VA 1LNZA 2F8MA 2GS9A 3QYAA 1IBMB 3AIIA 4ZI2A 3ELUA 5ARCA 4HRYA 5IJ9A 5M7EA 1L4EA 1TU0A 3QPDA 4B6QA 5B7GA 3DEJA 4A3GG 3LA8A 5BR8H 3ONFA 5L7YA 3RB8A 2O8VA 3MTBA 4WN9B 1S6YA 3RB0A 1V1MB 1VHLA 4HDNB 3W4IA 2JI9A 3TIIA 1IM8A 4XCQA 3QZUA 4JQCA 1MG5A 3ZE8A 4LQ4A 4FXOA 2NUPA 2G8LA 3NNSA 4TYNA 2P8JA 3OEHD 4PQYA 1YDWA 1Z08A 5K2MA 1QTNA 2GPYA 3NC1C 3GLGB 4CNBA 1TZMA 4O4JB 1XEWY 3RUAA 3OOYA 1GUZA 3G2MA 3IKJA 4U00A 3TRKA 4CF5A 1TCBA 1E1YA 2BRUC 1GPAA 3H2ZA 1JDSA 5REQA 5AVZA 5FBKA 4BLSA 2FHSA 5K0EA 2X5OA 2YICA 1LU9A 3QV2A 4LE1A 1DFHA 3QOXA 4BQQA 1ILEA 3VJLA 3ZD9A 2XYVA 5HDQA 5FH9A 2CLOB 4IHJF 2FE4A 5BYAA 4M7RA 3LUFA 3W2FA 2X6TA 2I2WA 4Q0MA 1CQIA 4P4TA 1HA3A 4L3VA 3DFKA 3OP1A 1T1SA 3O1IC 5DNAA 3SYTA 2AQHA 3E5RA 2YQ5A 4KW7A 3TZEA 2BLLA 3W6OA 4WN3A 4FX2A 1G20B 2GQRA 4P93A 1SC9A 2GBCA 3RVBA 1WHTB 4ND8B 4HAWA 2CVZA 1LW7A 4XIJA 5A71A 1XD2A 3KIPA 4YP1A 3S2YA 3PSAA 3TI9A 3PR4A 5L3QB 5DG9A 2EAUA 3GVPA 4AY6A 5HCUA 4NMHA 1Y8RB 3A9VA 2AJBA 3EGDB 1XXHE 1G20E 3OLCX 3ETNA 4D02A 5BSUA 2PHZA 1HGXA 3B3JA 2J3DA 4MYTA 2C7BA 2R25B 4J0HA 1Y5IA 2RC6A 4QBIA 1V8PA 3L92A 2Z08A 3Q7SA 4R2MA 4RYLA 5H16A 3OF5A 3TIVA 4KR7A 3D2CA 2O8FA 5IVKA 2ORIA 4RIEA 1R00A 3TIGA 1E4FT 1WB6A 2IVZA 4TLDA 3H9CA 4HDRA 1SG0A 1U0SY 4HT3B 2PKQO 4L57A 1VQ1A 3VU8A 3KCQA 3HOYG 4ECWA 4DXHA 1BA2A 1U8YA 3I53A 4E3ZA 1UWLA 3H9JA 4OQ4A 3I76A 5LP6F 1TX4B 5ED4A 4EG7A 1L7AA 4AJKA 4YCDA 2QY9A 2YZ7A 1ZA2A 4P4SB 1NF2A 1BMFA 1E6UA 2Q3HA 3PI6A 3P9IA 1SZJG 3E22B 3O4VA 4LSZA 4XYBA 1DBVO 5KNBH 3W6ZA 3L1VA 4HNAA 4RLSA 1C0PA 3V4LA 1FZQA 2G6BA 2RGVA 3D8UA 1XZPA 4IIYA 4PXYA 4LH6A 2XWSA 1SO8A 1XUOA 3GWZA 5IJZA 2XOKD 4ZOLB 2VO1A 1UMBA 1W85B 2DPJA 5ALEA 3U60B 3THWB 3COYA 3AR7A 5DEIA 5TXGA 3T94A 4FJ2A 4ARAA 5EKDA 3G9UA 4LE2A 2IYRA 4UTNA 1DCTA 1U5BB 5F98A 1I2AA 5AJWA 4Y0AA 1GZVA 4ZZ0A 4MUEA 2OCLA 5TX7A 3L8FA 1OB5A 3SFZA 1NVXQ 1S5PA 1WEHA 5A05A 4C89A 2W6ZA 4WVLA 1SQFA 3HZRA 4C6TB 3KJEA 2MR5A 2QX7A 3ZN2A 5CLJA 4MR7A 2Y66A 1R64A 3QLVC 4BKMA 1JHMA 3NXSA 2ZRAA 1PBTA 3DFZA 4JJ6A 4ZP1A 4MTCA 3GT4A 4F3YA 1VBHA 2FNAA 3HR8A 3E9MA 3K09C 3O3OB 3S2ZA 2ZJ8A 3T3GA 5LOVA 4HVCA 1N8TA 4NDAA 4F21A 4QG3A 2E0IA 4JKOA 5KOJB 2AK2A 3RT1A 3WBKA 3RU7A 5A4IS 5K9ZA 3CGWA 5J1TB 1G6HA 1G9XA 1YL5A 2UDPA 3CX4A 2WMNB 3T34A 4Q03A 2YWXA 2A86A 2PMDA 4GC6A 4M76B 3FETA 1PT8A 3QHPA 4YN3A 1UZLA 1M1YA 3FYUB 4HUQA 4Q7JB 3K1YA 3I4LA 4TL9A 9GPBA 3RF7A 2FZKA 4EQZA 4H7JA 2ICAA 4J1NA 4NVRA 4G37A 4B3RH 1LK0A 4Q4HB 5G0TA 2OQVA 2R1ZA 2M98A 2FWPA 1B8OA 3PC8C 4OKSA 5B58T 2OFFA 2VLBA 4YXWD 5JS6A 5CM0A 1JEDA 3H1GA 2DR2A 4CT5A 3WNZA 3ECAA 3RS4A 3EQ7A 1RKBA 3FDZA 1KQGA 3S1SA 4PHFA 4B76A 2NTNA 1TI7A 4JL8A 3UAOA 1YFKA 3NH9A 5JCXA 1P4HA 4K6CA 5CW1A 3USES 3GB9A 4AF8A 4ZI7B 1XVUA 1U0EA 4XKJA 4JR0A 2VI5A 5DASA 4B3CA 4DQDA 1GDHA 5KVCA 4HRXA 3WKEA 4RVCA 5BWLA 4V0LA 5CYOA 1E4VA 1GZHB 3N8HA 5BQPA 3T9CA 4WSOA 5EI5A 1HKUA 4AMZA 2O2ZA 3W5UA 2W4MA 3CRRA 2VTEA 1ZBQA 5TB5A 4RWEA 2WFLA 1ZPDA 4OLHA 1QYIA 2X7XA 2QNRA 2WHRA 2NQ2C 3EVNA 4HTAA 1EXWA 3Q8QB 4PN3A 3RVJA 2H92A 1I7SB 3RIGA 3E70C 1SRRA 4Z5XA 4C5AA 3S0JA 3HJRA 2WM9B 3IALA 3PNYA 2NUAA 4FGUA 3JARA 2W2QA 3S40A 4B6OA 4CTJA 4D45A 4HPJB 1KMIY 2WG2A 2VP4A 3GT7A 1UBSB 3JQPA 2QN3A 4MQMA 4PZZA 3VC3A 4ABYA 3LKDA 4YUAA 2ZEJA 4BNUA 1G3IA 4UEOA 1Z39A 3I52A 3RIZA 1AMUA 4YY3H 1O54A 5KFSA 4J0KA 3CUSA 4FN4A 5HGJA 2ZZMA 1XL1A 3DTVA 4UCTA 2R1TA 3DVRX 5HA5A 2VSNA 3WLSA 4N65A 3C4JA 2J5QA 1QF6A 1V9LA 2EZ4A 4U5QA 2JAOA 4MW5A 2Q3JA 1G21B 1JWAB 1T29A 3HOUG 1XR3A 4KR0A 3AT1A 3KKOA 4QODA 4ED6A 3WB9A 3C41J 5J4VA 2RCNA 1Q7TA 1J39A 3IOEA 4BFVA 1PZHA 5HZHA 5KYTA 5JMWA 4M21A 4RCNA 3QQPA 4LYFA 4RPIA 1AKUA 3UWDA 4CLDA 1KO7A 1RWKA 3H4DA 3SX4A 1ZISA 1Y42X 5C3EG 1GNVA 3JALB 1EEHA 3Q0TA 3U44A 4MLZA 3AY0A 4JDPA 3VAYA 4J7CA 3Q2IA 4ZO8A 4KOEC 4ENQA 2JLWA 1DOHA 2ZB3A 4OCZA 1A8UA 4CM7A 3R5XA 5LDDC 1XVAA 2BZ0A 3NH6A 1Q7EA 4HPXB 3TK1A 2EX1A 4X0EA 2G0NA 2DZDA 1ODFA 4W8OA 5KFFA 4LHYA 3SK0A 4F72A 1H3FA 1Q0QA 3ZE6A 4AUKA 4HOYA 4Y9UA 4OEHA 3BJEA 4QDZA 4UHBA 5GOZA 3EPHA 4ECTA 5KEIA 3KETA 2YRWA 1I5OA 2W7TA 5HM6A 3O8CA 4DV5B 1GGMA 3L46A 1HPLA 3I4MG 1YMVA 1UJ5A 3KU1A 3MGGA 1XNQH 1HF3A 2RHLA 4REQB 2ZI5A 3RNLA 1JFTA 2MYUA 1AD2A 4KQHA 1VCOA 1WPGA 3RS2A 4RHEA 2XNDA 5EMMA 2FUG1 1KAEA 4HAYA 1M2WA 2HF2A 1EM6A 1LI4A 3FMVA 1EFAA 3TY8A 1ZIDA 2QSJA 3ONEA 2PRKA 1FRFS 1CRQA 5AVSA 3IBCA 3E58A 4FBMA 2X2FA 4IICA 1YB5A 2X8WA 6YASA 1Q0TA 1HTTA 3TS1A 3DBIA 3HKCA 1MD9A 1U2PA 3V46A 1F3LA 3ZWDA 4TYWA 4BEWA 5I5VA 3TTUA 2OUIA 3M83A 4PQRA 3EEYA 5KFPA 5IZ4A 3WSVA 2ZRCA 1FDSA 3NYQA 2WAXA 5KAPA 4AXBA 1J2TA 4F6RB 1VG1A 3OD1A 1VG8A 2HSJA 2NZVG 1JZTA 4HWTA 3NFYA 4JZKA 1O9HA 3TMYA 1LSSA 5EWMA 1CUBA 1W1WA 3QY0A 1BRMA 4JLKA 4P80A 4RESA 4F5DA 1BKSB 2G72A 4D3YA 2OZVA 4BTVA 1V3TA 1AHHA 1Y1LA 2CVPA 4U7TB 4G0WA 1ZWKA 4DGSA 5KYWA 1CKMA 3FHLA 4QBFA 1S0OA 4ZQIA 1NMQA 2F3UA 3IR5A 5I5GA 3R9XB 4BRUA 4AM8A 4X9XA 4G3IA 1C4KA 2ZWIA 4LNHA 1G3RA 3I9JA 4MQBA 3W05A 1QHYA 2YINC 3VU3A 1X8JA 3BGSA 1Z6TA 2W2KA 2ZXFA 5C7IO 1AKEA 4K9PA 3ZJTA 5SYAA 1P44A 2M1XA 4GR5A 2B9VA 3NHZA 1OPXA 4MUYA 3UGKA 4RM2A 4RPCA 4O7SA 3BZWA 1A48A 2GN9A 5EIFA 3PA8A 2I91A 1KVRA 3OJWA 4A9AA 4E5MA 4MUXA 3H8SA 3VNQA 3IO3A 4L2IA 3O4RA 3LUJA 3OU2A 1XNRB 1T9ZA 2WKQA 3OHBA 4GQIA 4OD0A 1HXHA 2CNOA 2P6OA 1WQ3A 4MVJG 2OLKA 1LTKA 3EWNA 3HVUA 4ZODA 4WY2A 2GNPA 4LNUA 4BO1A 5MDHA 2Q2VA 5J47A 5HUHA 3ULKA 4I1IA 4ITVA 1F0KA 1LH0A 2Z58A 3NHLA 4UFNA 4PNPA 5CVJA 1PDWA 5GJWC 1A0OA 1GTVA 1H05A 1XHFA 5DNEA 2JCYA 3BJYA 4LFCB 3W90A 4DKJA 3MJHA 3DDSA 3WWPA 1SG9A 2O06A 5KTRA 4OHYA 3K3VA 2DQSA 2ZDGA 1B76A 1OF1A 1RWVA 2IJGX 4N8EA 3OZRA 3RVPA 2YZLA 2P9QA 4ESEA 1JAHA 1OYVA 4U7DA 5CAEA 1GM5A 2G5TA 1G3QA 2HPZA 1UC9A 2WOOA 1J5PA 2Z4SA 3NHWA 4ND5A 1HDIA 1QHNA 3F1KA 4KIWA 4IIXA 3UJAA 2VG8A 4UPDA 4H27A 4NJEB 4EB8A 5EYPB 2QP3A 4GYYA 3FPGA 2YC2C 3NBQA 4G41A 4KO2S 1NW4A 1QH0A 2EFEB 1FQOA 1I13A 4MVJE 2AH5A 3TLBA 3QZ8A 1RLUA 4IZOA 3R7WA 2AKEA 2QUZA 2W7OA 3DE7X 3HKEA 3I32A 4ED8A 1D2NA 2YXPX 3I83A 4DV5H 4PRKA 4ZTBA 3UXYA 1WCWA 3T3IA 1JLLA 4GLBA 2MSCB 3EB9A 4GWKA 1MO5A 3TPFA 3KSZO 5HQTA 5KCMA 2YMLA 1LNQA 4NFSA 4V1CB 2HHJA 1RQNA 3UZUA 1WP4A 1VAJA 2UVQA 4RD2A 2NVOA 1C4OA 3WK5A 3MSXA 1A96A 1GIAA 3EXIA 3ZXYA 4AJEA 3ICEA 1E0JA 3T1NA 2LUOA 4KDRA 4Z9YA 2WF9A 4PS0A 3KL2A 4HH4A 4JVLA 1QOPB 4E2WA 4RVGA 3ROXA 2IBMA 7REQB 3DMDA 4DA4A 2QZ9A 4GRAA 5FXMA 5U9CA 4DLWA 2QD4A 4IIJB 4I4NA 5KVQA 2G6TA 2QHXA 3DCNA 3OKAA 3SU8A 3UGQA 3CH4B 4A27A 5BV0A 3AM3A 5ALJA 2J9GA 3RKUA 2RI0A 3BKWA 2JANA 4OYLA 1H3NA 3JZDA 1L5MA 4PYQA 4DMHA 1XJ0A 1GCUA 4J3JA 4EI7A 3F4KA 2QGNA 4IRDA 1JMYA 2G7ZA 3HDVA 3PC6A 2IIPA 1BFKA 1DRWA 3ROTA 5KFJA 5CE8A 2JJ8A 4JX8A 4WIAA 1X9HA 4BZWA 5EXPA 4QJ5A 2VA9A 1AXRA 4ALJA 4D96A 2V8OA 4DV4H 4FFPA 5EXDA 3AKYA 1JEYB 1KEUA 1K9SA 5IAGA 2PSSA 2CNWA 2Q2UA 4DB2A 1C50A 1NJ6A 1Z28A 2PWBA 2GA8A 3IR6A 4FDUA 5T8KA 5I60A 4H7EA 4JEHA 3FF1A 4L4YA 4FDAA 2ZVJA 4FOOA 2HJVA 2V7WA 1Y6RA 3FD8A 1ZUNB 3WGTA 2AE2A 3EGWA 2XB2A 3CIFA 2REQB 4AP9A 2Y76A 1EFVB 3HJGA 3SJAA 3W3ZB 3LY9A 1QIGA 3DDUA 3ETLA 3F2IA 5EZ5A 4QSMA 3FNHA 2YJ5A 5DCYA 3AUUA 1WUJS 5JD5A 4RMIA 5C5EA 1PDOA 3CCCA 5ECWA 4U2BA 4XGRA 2Z95A 2EU8A 3QYPA 1UMCA 4FVTA 3ZK9A 3I92A 4UAVA 1LTHR 4LK3A 3CU5A 3QUQA 3JAMW 3NG1A 1ADBA 4AD8A 2CLKB 3J81k 5HIKA 2NSLA 4MW0A 1E7SA 5I9TA 3QBJA 4CQNA 1R9NA 2PX6A 1F17A 2W43A 4GKVA 4DR1H 3EDOA 1KO1A 5B7NA 1ET0A 3DWFA 5K0GA 3NTVA 4MX8A 1CT9A 2Q4TA 3LPMA 1T0IA 2W22A 1K8QA 1P0PA 1M6VA 2XBLA 5DM0A 3K9HA 4GNRA 5JNUA 3PJEA 3PRHA 1P77A 3V8RA 3OZIA 1E6LA 2AMFA 3O21A 4MDFA 3KQYA 5PGMA 4JYAB 1A04A 2IU6A 3IAM6 1N2EA 4U9IS 2F8SA 3I5YA 2OYSA 2FW7A 4G1VA 5DKFA 3VO9A 2FFRA 4JC4A 4WZAB 5KWSA 5C31A 4WEQA 4XYGA 4B4WA 1NNI1 2PFGA 4HVTA 2Y1XA 3MS4A 5JFTA 4IDAA 4Y7CA 4Z4IA 3LCVB 5CVCA 1QR6A 1M6NA 5EMKA 4B3SH 1W75A 1F4LA 5CNIA 4BEJA 2XYPA 1CK4A 3NM5A 4RNOA 4M1KA 4TV9B 2WKPA 5AVJA 5I45A 4EL5A 3QXCA 4A0FA 2YRFA 4UXJA 1IXSB 1NKVA 4Y2RA 4AIIA 3OO1A 4WVFA 1XMQH 1XKTA 2IGBA 4MUMA 5C1IA 1X7HA 2CWWA 1NN3A 2R0QC 4B4VA 4HGYA 4UPVA 1X92A 2ECFA 5FLMG 4KWHA 1IN7A 4D98A 1EK2A 1KYWA 3IBSA 2W2TA 4LJLA 3C7TA 2F3SA 5GJVC 4BEVA 2QYZA 2GUGA 4FEYA 5KG3A 3M1LA 3SZRA 4F9GA 3HA5A 1JHYA 1JWBB 2QK4A 5GV8A 1TT5B 4Q3NA 2I2XB 4J2OA 3OX3A 1MRSA 3REFA 3SZ3A 4EW2A 1UPUA 4BY1G 4XPIA 3DGEC 3K6SB 4IQ4A 2WAMA 4ESHA 5JAHA 5D3QA 1YQWA 3PPWA 3NIDB 4FYWA 1E2PA 1BAPA 3FNQA 2XVMA 4W1RA 3RYCB 3HB4X 3KELA 3N58A 4DV0H 1YZQA 3EZ2A 1NLYA 1Z0KA 4YRPA 4BBAA 4AS1A 1Q0HA 3O2QB 4ZZ1A 1H4SA 5DVZA 1UDAA 3D3JA 2QZZA 4RJJA 4K3VA 5LFAA 1ZM4A 1OV6A 3N9IA 1TUBA 2QRVB 5JC8A 5FI0B 1GDDA 1LF0A 4DLNA 4DG5A 3B1FA 4UASA 4KR2A 2E4VA 2AVNA 1W9HA 1UJNA 3HFJA 4URFA 4IZIA 2C5FA 4TT3A 5E9JA 3S4YA 3UXMA 4BBZA 4ZYYA 2BR5A 5JATA 2Z98A 1XCPA 4G4SP 2E85A 3FGOA 2ZIUB 1BGXT 1KDYA 2R85A 1N5MA 3S2IA 1ESNA 1Z22A 2QG6A 2CL6X 1CBUA 1AB5A 2AN3A 2WM3A 4Q45A 3QK7A 3TLKA 4M0LA 3O4FA 5JE8A 3VX4A 5L8VA 4E94A 3DTFA 1W5SA 4LVCA 2OGTA 1X86B 4G84A 1P2FA 3NW9A 3OE4A 2PEZA 3KYJB 4MUHA 4DILA 5KIAA 1RTKA 1KYYA 1NMZA 2HMUA 1EBUA 4P7FA 4RA9A 4HNVA 1M7BA 3LHSA 2PH1A 4BUJA 4DA7A 4F7DA 1TM5E 2QN1A 2I9PA 4P5PA 4QDJA 1HWYA 1PFUA 1WP9A 3IP7A 4MP8A 5DK4A 3RS7A 2CW8A 2MR6A 1BRTA 1I4WA 4G0VA 4N7JA 2WT8A 3FNIA 1WX1A 3SSOA 1NASA 3I30X 3L06A 4JWKA 4IGIA 4KDCA 4PIVA 3C8ZA 3VZPA 2OZLB 5JPCA 3B52X 1IM5A 3ROEA 3BM5A 3PENA 3H9UA 4ND3A 2QENA 1XWWA 1A7AA 1AN9A 2GTHA 4J16A 4LECA 1CDEA 1NR7A 4E46A 2ZFUA 4ASUA 1WUIS 1HE8B 4DPKA 5CDGA 1NWHA 4Q05A 5EAIA 4MW9A 2ZUUA 1U3VA 2DFVA 5G3YA 4WLNA 3FDSA 1VPEA 4DMUB 3OC6A 3PD0A 2V6FA 5HBRA 4PRYA 2GBGA 4PN7A 3LXMA 3PUXA 2DGDA 3PQ3A 5C3UA 5CDFE 2CZGA 2EW2A 5TS2A 1E3TA 5DK6A 4NL4H 1CUIA 1YZLA 4UHEA 3A2LA 2KI5A 2R6AA 5DXFA 4LG1A 4A8HA 2G9RA 5KQLA 1RXWA 1GXSB 1SCDA 1M34A 1RCFA 2P9CA 1P39A 1RQLA 2JGMA 1TW2A 1V96A 2AR9A 2FFHA 2FHPA 2GN6A 2GZMA 2X76A 3FLAA 2Q9AA 1S8AA 5DGTA 5EIEA 4DPLA 2ONKA 2XMQA 1T3ZA 1DV2A 1GG2A 4RZHA 1XZFA 1ZXXA 3FUUA 5K3SA 3EIHA 4KG7A 1WO8A 4QQ8A 4J94A 3WFZA 4R1SA 4TQRA 1A77A 3HS3A 4JVMA 4CHGA 1Y4ZA 2DETA 3RF2A 1G8JA 4HCJA 1SVUA 1JE1A 4EDFA 5J59A 2H3HA 4EW3A 2Z9DA 2WNIA 1SKMA 3VNUA 3H8JA 1X7WB 4MV9A 1N6LA 4EPWA 1ZSYA 3D02A 5E6UA 3AUKA 3I4FA 4KXLA 2FFJA 2OKGA 3V00A 4YUYA 4FMCB 5GPBA 2MSKA 3LCUA 3VKHA 4KGZA 1PJZA 1H1DA 5IS2A 1GCGA 5HM8A 1PGPA 3L4JA 3FNEA 3HCCA 4F46A 2C1XA 4LJ6A 4RF2A 1KZ4A 3MMZA 2DQKA 2RGWA 4DIUA 4TGLA 5DB4A 2B5OA 4F71A 1T24A 4Z51A 4L4XA 1S96A 3D3KA 5K8IA 4G5RA 4NBKA 2VLIA 5JO9A 1NUTA 1RS0A 2H3EA 3FG9A 5DLYA 2ODBA 4MI9A 4ZVOA 4YX9A 5JSZB 5F9HA 3VNNA 1LSOA 3FI0A 3FCAA 3GPDG 3PWTA 5CVVA 5EESA 4YP6A 5L9AA 1SXPA 2FV8A 4UZFA 3RRJA 4BLTA 4WLEA 3NGMA 4CMEC 4RFVA 4DG9A 2BBTA 4EB6B 1USGA 2KX7A 3G5TA 4L0CA 2A35A 3U4CA 2QRHA 1Q1GA 3N0VA 3KEQA 1X0XA 1ESCA 1KJQA 1SCUA 1Z07A 2OZEA 4M60A 5DSTA 1FQJA 1N6RA 3IQZA 4R83A 4CIDA 5IG2A 4Q19A 2FWIA 1NVBA 1VECA 1JALA 2BMAA 4QOGA 2R7NA 2W2NA 1HLDA 1PZFA 5FL3A 3WBJA 3EN0A 3QV1A 3PDWA 4AZSA 1XRLA 4EZEA 3GN2A 1PV2A 2HSEA 3MEQA 2ZJ7A 4JSRA 3CE9A 3QJGA 3QQMA 1J23A 1YO6A 1IN1A 4PYIA 5FLXA 4J9SA 5B2ZA 3WLIA 4Z54A 1P7PA 3L3BA 2QRNA 4ARCA 4N5LA 4QOIA 3SC2B 1VXOA 1QV9A 1RJGA 4MMXB 4ZZ2A 1W2HA 3W2TA 2DTDA 1DL5A 2FZEA 3MUEA 4TSFA 4WKBA 3WK7A 4TL8A 3M1AA 3RARA 2PUBA 1GQYA 1NT2A 4D6YA 2CXQA 3NRCA 1QE0A 1E5DA 4YRTA 4AWBA 4GKJB 2N0SA 3NASA 2B1GA 2EQAA 1KEWA 3QI2A 4GL4A 2G40A 1R0LA 2QP9X 2Y2UA 4KO4S 2OHVA 2V9ZA 4CIBA 1IY2A 2QD1A 2WFAA 3MUNA 1GO3E 3KOYA 3VUEA 3PTAA 1Q74A 4Y6OA 3H19A 4A82A 5J2UA 5LXTF 2O14A 5DBFA 3GLFA 3WLRA 4OA8A 4CTNA 1W30A 5FF9A 1OWMA 2ZYRA 3EBLA 5JU6A 4KREA 3OOHA 1KF0A 1X77A 4TZTA 1DAAA 3DZDA 3I2IA 3DV2A 4OXQA 1UFRA 2ETVA 5IK2A 2J4DA 3L5OA 1XN4A 3MT9A 1D2MA 1LPAB 2PJUA 3ZU2A 4DJAA 3U7FB 2GX6A 3MGCA 2ASVA 1FUUA 3B9BA 3G9XA 1V5WA 1VSVA 3KPWA 2QRUA 4NOJA 1GPDG 4DEVA 4RVDA 5LQRA 2XLBA 4NCXA 2FPIB 4AYBA 4FB4A 1WD5A 2BFBA 1TLLA 2BKLA 3SY8A 2XMBA 4E4YA 3LO8A 2B6HA 5EHQA 4UVHA 5HZGA 3UJ8A 4HR7A 1Z35A 1ORIA 1U2DA 3VZDA 1N33B 2WKSA 2BMJA 2QGFA 4B3XA 4EJSB 4EYQA 4ECZA 3EXEA 5CH3A 4DUYB 3UJHA 5LXTA 2PKXA 3BH7A 3HB7A 4LMAA 3LH5A 3A1VA 5D1NA 1P73A 1TD1A 4BN5A 4CI0B 1T25A 1ZC4A 2VYNA 1AKQA 2E89A 3GROA 2DKFA 5CBKA 3E15A 2W6QA 4W4TA 3IEIA 2VHJA 1E77A 3DMNA 3ZXUB 2AOVA 4Y6LA 2Z9CA 1E96A 5FPOA 1PT5A 3K1ZA 2MCFA 3RM3A 4QUAA 1T4MA 4AJPA 5B2EA 4YJHB 1OXUA 2WAAA 3MXTA 1I2KA 3I12A 2ZYAA 4RHTA 3OI7A 1POWA 421PA 4FZVA 3RUPA 1BOFA 2UUAB 3MLBA 5K8JB 5TSDA 3HVHA 2KBFA 3GJ0A 1C29B 1JA0A 1YQQA 1KMNA 4CKBA 3RT7A 2QT9A 4MZXA 1FRZA 1S10A 1PP4A 2C20A 2AC2A 2AR7A 3T7DA 4V39A 1TAHA 2BFPA 5K0LA 1VJRA 1DBQA 3ISVA 5BWOA 2Q5IA 3NBYB 3OUTA 3L0YA 4WWHA 1G98A 1E4OA 1QYDA 1NV9A 1NQOA 3DEIA 4YTEA 2FZ5A 2Q3EA 4U39A 2YFYA 1K6MA 4R9UC 2ZJ6A 1U3CA 5A3VA 3LMLA 4YUXA 5HNEA 3L4BA 2VRCA 5AIBA 1IJFA 2Q5CA 3K7EA 4ANFA 4MHOA 5HIIA 4E7PA 3ZVNA 3VR3A 4LRUA 4HTFB 1VBFA 3K6RA 4JLSA 2HDNB 2HAEA 1Y0BA 4DCOA 3O4JA 4ZPXA 4DREA 4FD2A 2QQEA 2W6OA 2M05A 5KYGA 2D13A 2NU9B 4HEHA 3G0CA 3LMKA 5AUNB 1C3OB 3AM1A 4YJ3F 1FDUA 1ND5A 4CDMA 1XDDA 4U0KA 1P7WA 4MGYR 2BH9A 4BNDA 1QXSA 1PX2A 2XD4A 3F6BX 5INTA 1GAEO 2VPZA 5JAIA 1U2TA 2VHQA 2HVRA 2E55A 4BVJA 1NIPA 2QL6A 1QZUA 3V55A 4E03A 3D6FA 5DN6A 5JAZA 4ZC8A 2A92A 3HOVG 4HWRA 4DIKA 1GLGA 1NHWA 3PE4A 3QUSA 1T4CB 5ECYA 4DLSA 3C6XA 5BUSA 1POXA 3WIUA 4DV1H 1QYCA 1XDZA 2QLBA 2HHHB 2VQFH 2EP5A 4B0PA 4EY7A 2BKUA 3Q12A 4NAVA 3P9KA 1S3GA 3R7LA 2VN8A 2XCRB 3DA8A 4EFDA 5JALA 1GZ3A 3FUXA 4CF3A 3AUAA 1TOAA 1EU1A 1XHEA 4NS1A 1IVNA 1V11A 1NAHA 1EWQA 1N2CE 1A2KC 3KU4A 1KTIA 4UREA 4CL2A 1CR2A 1JLSA 4UD2A 4MVJM 1AGPA 1H6AA 1O1YA 5FDFA 4FHCA 4W5NA 1YRBA 3PLRA 2N47A 3R3ZA 3NHUA 3H0KA 3JQGA 4KHPH 3HZHA 3M8KA 2R92G 2XCQA 1RZ3A 4QWAA 2W8ZA 1DAGA 4CEHA 2DHQA 1Z47A 2OQRA 5HYVA 3AHGA 4DUGD 1THMA 2XCSB 2XF8A 4WNAB 3OCXA 4P54A 1T0BA 2ODQA 3MB8A 4PO1A 4UE2A 5DBIA 2CLLB 1CWUA 2ECOA 2X0EA 1WNTA 3F74A 3ZDQA 2XEXA 2YWVA 1GHTA 2HVQA 2KSQA 3OPNA 4JV2A 2BFNA 4EPYA 1P2VA 4P58A 4FYIA 1O7JA 1GAQA 4NH0A 2GFQA 1WEKA 1JAIA 3DWIA 3FW1A 2V6JA 4P7KA 3SQMA 3WOHA 3ZKWA 5ALZA 4HB2A 3R41A 3THXB 1OTYA 3G2JA 5GGYA 1DRVA 4YRBA 4ETMA 1MOQA 5AI9A 3URKA 2W9BB 3GJQA 5C53B 1U9JA 3DMTC 3CE6A 2HRQA 4QVGA 4MV5A 3MS7A 3GGCA 4IQ8A 2AJTA 3NTUA 1ZUIA 1CHDA 3GFVA 2C59A 5AK0A 1DBSA 2EDCA 2BSAA 3E7WA 2IGTA 1KORA 3ZZ0A 3ORYA 4H7PA 1JUDA 2XA9A 3ZDBA 2DFPA 4KVGA 5ALDA 3W7BA 3B70A 3F0TA 5AH0A 3R75A 4ZYVA 5B6IA 4IV5A 5FNVF 3OM1A 3U26A 2NSDA 2QVBA 4TN5A 5HQ3B 4YJ2F 4E2ZA 5LIRA 4CEIB 3TQCA 3GIDA 3PS9A 4WCFA 4XWYA 4XB1A 4QUIA 4RQUA 2IMWP 3ES9A 3NPMA 3VZBA 3ZWVA 4BVKA 4CM8B 4U7CA 1ZXBA 4B3MB 1S89A 2OILA 2X4GA 3WB2A 3EEQA 1LQ2A 3R7BA 4RZRA 1M2FA 4MV8A 3DBLB 2XI4A 3LI2A 3QEJA 2HFKA 1GNLA 4MKXA 4R2KA 4BTEA 1GT91 3O9ZA 5MF6A 3P2MA 4M1MA 1FU7A 5JS7A 3T54A 1YB2A 5HJ5A 5KU1A 1ENYA 1VPTA 3OZWA 1L5YA 3WJ7A 3KB1A 4MKZA 5AM5A 1FNDA 3W9BA 3X1DA 5JFGA 3ZV5A 1QO0A 2ID7A 2Q1YA 3W5BA 2LIVA 1V95A 3LBFA 4Q7LA 4UHCA 5G0UA 4F50A 3O5AA 4KVAA 3GYBA 1USVA 2LKDA 4ODIA 5F5LA 2JAWA 3GJZA 5FOXA 3VTZA 3W1WA 4O4IB 5LUAA 3CVVA 4P53A 5AVVA 2PM8A 5C34B 4PSKA 4QXRA 2W58A 3ZZNA 1AM4D 3KB6A 3LU1A 4BGVA 4C4YA 5AW6A 1K6IA 1X70A 2GSWA 3IMEA 5JBIA 1GRQA 1X87A 4TUYF 2BFDB 3PHIA 4IDPA 2YL2A 3T3HA 4A0QA 4JLPA 3GPBA 3PUHA 5LD2B 1UXJA 1CLUA 4WGGA 4C01A 5KOHB 3EPJA 5ICFA 2AGPA 2XGMA 5AM4A 4BIIA 2JA1A 1CB0A 2IXBA 4XDHA 3RUEA 3G3EA 4NQZA 5JMTA 1JB1A 4IQGA 4K0RA 3U56A 1XYVA 3C5VA 5HE8A 3VPGA 2QMQA 4N4AA 4NULA 1N5IA 4KSCA 3GEBA 3M6XA 3WA7A 1ICIA 1ECPA 1L5LA 3QF7A 3KLNA 5ITZB 1KZYC 3HYNA 3IBGA 2QN2A 3EEBA 1LC0A 1Q6YA 3EXEB 5HIMA 4WGFA 3QOWA 4HNSA 2CL0X 3N2YA 3L82B 3NMUF 3O3CA 5HS4A 4V3CA 1MDBA 3C14C 4U63A 1H22A 1QE5A 2A7XA 1TIBA 3NJ4A 1SXQA 3KYDB 1JMVA 1V16B 4JR2A 2G5CA 1CE8A 1I2CA 4LVNA 3P9NA 3ZC3A 2PSHA 1GPKA 3L7NA 4B74A 4M0JA 4YJ3B 2HWYA 5I7UA 1IYEA 1FFWA 4JOBA 3UG6A 4UVIA 3QU2A 1XTQA 5B64A 3OFSA 1WUTA 2BJVA 2UYOA 4FILA 4I8IA 1HR0B 1QE3A 3ABZA 1TTTA 4PFSA 1X7YA 1VL2A 2O6LA 1E9BA 2C78A 2PCJA 3K20A 4YAWA 4C0AC 3LCRA 1QKKA 5KOJA 2OTCA 3M9MB 1GA1A 4LMBA 5EXSA 2ZB2A 1BMTA 5ILQA 1OX5A 4A3JG 1ISFA 3KKQA 3ZXSA 3UT5B 4CQMA 2VATA 4NYMQ 1JR2A 1ORRA 1YFZA 3Q40A 2IPMA 4YFYA 1J6UA 2LCQA 4QIWE 3QFCA 2I7DA 4B4DA 5EWLA 4EI2A 1ATZA 2YJNA 2WY2D 3K1AA 1Q44A 1U8XX 4HDSA 5DBEX 1JVNA 1SHZA 2XB8A 1L1EA 2L18A 4OK3A 4PGHA 5JARA 1O8CA 1UC4B 3GMDA 4Z99A 2WUGA 3CY6A 3JD4A 3SHQA 2DIKA 2BI7A 4AQ7A 4RUCA 1CF4A 4H3SA 2CVQA 1Z33A 3AESA 1AUOA 1L6IA 1K7XB 4ZOLA 3S3TA 2EJ0A 1E2GA 1NW3A 3I6YA 4I2VA 2HRBA 4PVCA 4Z7JA 1QK3A 4IJ6A 1S4MA 2WSMA 1CDZA 3IQFA 5TDHA 4UQLA 1A69A 2ZPUA 3LL4A 3MJDA 1DG9A 5IKEA 1Q95A 1NOIA 1OH7A 2CHEA 3B2QA 2HQRA 3M5WA 4YJFB 3S27A 2JFOA 4YMVA 5I5YA 1PVDA 1E0SA 2D2XA 3BXOA 3I1FA 2DXIA 2V96A 1NC3A 1IOWA 1KL7A 3M4NA 4JUFA 4KRXA 3WADA 3HO1A 4R16A 3W4JA 3WOVA 1JIHA 5DLQC 4DIMA 1YL7A 3OPYB 4ZO9A 2WAOA 3JAWB 4PLGA 3HWWA 2QTFA 1FXWA 2H1RA 5ALOA 2PQMA 3FYHA 3QPBA 4WBXC 5JSYA 1F2VA 3RHZA 1UM9B 1SK9A 2J3IA 2PO7A 2ZSKA 3BCUA 3FMOB 1OC4A 5CNJA 4BFWA 3HXKA 4BC0A 3NTQA 4EECA 1CETA 2ACKA 1PGNA 4Q4DA 1V2HE 4GBED 4DDMA