1PX2A

Crystal structure of rat synapsin i c domain complexed to ca.atp (form 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
294
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTWKLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synapsin I
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 89
structure length 294
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1px2A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1px2A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1px2A02
2NU8B 1EHIA 3BG5A 2IP4A 2VR1A 1KJIA 2NUAB 1AUXA 1GSHA 3ORQA 5JQGF 2V59A 3RUPA 2R84A 4TUYF 4QSHA 2SCUB 2PN1A 2R82A 3N8DA 4O2AF 2Z04A 3KREA 5C8YF 2YRXA 2YL2A 2HGSA 3JZIA 1BXRA 3OUUA 2YZNA 1DIKA 2W6ZA 4YAKB 4MV8A 4O81A 2C00A 4Y8VB 4O4HF 5JQWA 4ZOLF 1A48A 2W6OA 3TW6A 4WBNF 3VPDA 4FFNA 4O4JF 2QK4A 4IWYA 4O83A 2NPOA 4O7TA 2DZDA 3RFCA 5IYZF 3WNZA 3LP8A 3V4ZA 2VHEA 3V4SA 1JDBB 3K3PA 3HBLA 4RZQA 1KJJA 1KJ9A 4GGMX 1AUVA 4J6EA 4EGQA 1M0WA 2R87A 3ETHA 2R7NA 3VPCA 3BSSA 4IZOA 1UC9A 2FB9A 2OLSA 4YAJB 2YWVA 5CA1F 5HV6A 2YZGA 3ETJA 3E5NA 1KC7A 1CQJB 3KALA 3BSWA 3ORRA 4YBZB 3JRXA 2FPIB 5J2UF 4EGJA 2W6NA 5H80A 5K2MA 4DLKA 5LA6F 4HNVA 1Z2NX 4TV8F 2ZDGA 2CNVA 3JZFA 1EZ1A 3U9TA 1KJ8A 4FFPA 5JH7F 5LXTF 5HBRB 2FPPB 4WD3A 3MWDA 3BSYA 4O2BF 1B6SA 1EUCB 2YRWA 4EAAA 2QF7A 1UC8A 1JDEA 3AW8A 3RV3A 2R7MA 4O84A 4O86A 2DWCA 4YB8B 1Z2PX 1CS0A 1KUTA 2V5AA 2Z02A 5BMVF 4IHJF 4XYMB 3HO8A 4XYLB 3KAJA 4MAMA 2FP4B 5CB4F 1PX2A 4HR7A 1GGOA 2FPGB 3VOTA 1I7NA 3WO0A 5CA0F 3TIIA 4O7RA 4FU0A 3VA7A 3JRWA 3NUAA 3R23A 4IWXA 4MV7A 4E4TA 1W93A 3VPBA 2VQDA 5LOVF 2W71A 1A9XA 3Q1KA 3OUZA 4C5AA 5KX5F 2W6QA 1C30A 1ULZA 2GLTA 3R5HA 1I7LA 3LWBA 2GPSA 1CE8A 4O7YA 3RV4A 4C5BA 2YS7A 4MV1A 2CNQA 5LP6F 3MWEA 1GSAA 1KBLA 3QFFA 4YJ3F 2P0AA 5EZYF 3GLKA 1BNCA 1OBDA 3TIGA 2R7LA 3DF7A 1EUDB 4O7LA 4MV6A 2PBZA 1GLVA 3U54A 3R5XA 3MJFA 4FE2A 1PK8A 3BFPA 1E4EA 1KJQA 1OBGA 1T36A 4EG0A 5KKNB 2W70A 5C1PA 4O7WA 2R86A 5JVDF 1KEEA 4O4IF 2W6PA 5JVLA 2NU6B 1JLLB 3U9SA 4O4LF 2HJWA 5C1OA 4M99A 2GQRA 5BPFA 4EA8A 4MV4A 5GONF 2R85A 5I47A 3R5FA 2YW2A 1CQIB 2XCLA 4O7NA 4HQ6A 3TQTA 4ZI7F 5BPHA 2I8CA 2ZDQA 4MA5A 4XZ3B 3K5HA 4XX0B 2GQSA 1W96A 5J2TF 4C5CA 3K5IA 4NYEA 2YYAA 3WO1A 2YS6A 2W6MA 2DLNA 1VKZA 4IIJF 4L1KA 2I87A 4FFMA 1M0TA 3HB9A 2YZMA 3G8DA 2CNUA 2CZGA 4HNUA 1VBHA 4MV3A 3SE7A 3KAKA 5LYJF 1EYZA 3N6RA 2VPQA 4M9UA 5FNVF 5CAEB 2R6FA 2V58A 4M9CA 2NU7B 4TV9F 4I4TF 2ZDHA 4HNTA 4O82A 2WYOA 3I12A 3VMMA 1B6RA 4FGRA 2I80A 2R7KA 4O7VA 1SCUB 2XD4A 4ZHQF 4O7SA 3UFXB 2GPWA 5DMXA 3R9RA 4ME6A 4EA9A 4FFOA 1IOVA 4FFRA 1DV2A 3GIDA 4FFLA 4MV9A 1VBGA 2NU9B 1IOWA 1C3OA 4EABA 4M98A 4EA7A 4MA0A 2PVPA 4DIMA 3AX6A 1WR2A 3TINA 1M6VA 3G8CA 2X0SA 2DIKA 1DV1A 2YZLA 5D8DA 1E4EB 3U55A 4I50F 1JKJB 4ZQIA 4O7ZA 1Z2OX 3Q2OA 2CQYA 1GSOA 2J9GA 4YJ2F 4I55F
chains in the Genus database with same CATH superfamily
2GNAA 4F5YA 4BMDA 5CH5A 4TLLB 3C87A 2IXTA 4YP0A 1II9A 4FXOA 3RF7A 4DZZA 3HKDA 3EUAA 3AINA 4GR5A 5EFOA 2WQZA 1XHLA 4B09A 4TUYF 3HU1A 3CH4B 4ASUA 1ECJA 1G4AE 4CMKA 3RQSA 1EQAA 4FWBA 3WAJA 4YRFA 1I5RA 3VHXB 3SVLA 1QRUA 3FD8A 5SZIA 1XMVA 3FNFA 3UMBA 2R68A 2QU8A 5AIAA 4RUAA 3STWA 4F6RB 3BHMA 5FPHA 4ZQGA 1H3NA 1AUVA 4S0XA 2HIGA 1ZN8A 2DRIA 1OU4A 1H3EA 1VP3A 1FXUA 1MNQA 3LX5A 4Y2RA 2QW8A 4PYKA 1W88B 4IQFA 2XMGA 1NOIA 3D59A 2HWXA 5JAHA 2EBFX 1HDRA 1OIXA 1RP1A 3DMHA 2PKWA 3ZY6A 5INTA 3FCUB 2G1AA 2XRFA 2NYVA 1XA0A 2ZR9A 3PGA1 2VZLA 3ONFA 4KUEA 4H1WA 3RR5A 5DG8A 5KYYB 4ER0A 1TM5E 4Q34A 3ZXYA 3PC6A 4RSHA 3RBZA 3R5KA 2LDXA 4N49A 3CF4A 1NP7A 2XSZD 1WUJS 4PSAA 2NX2A 2XA2A 2R1TA 3GH3A 2GPYA 1HL3A 4F4YA 2EZUA 2X6QA 4KQXA 5P21A 5AUQA 1XD2B 2W0MA 3WO0A 4V0LA 1YE8A 5DT9A 5G02A 4D44A 4HRYA 3DKRA 2ACWA 1BZYA 3VA7A 2IV7A 2NPFA 1IONA 2FR0A 1XKQA 2OFPA 2YOFA 3K0CA 3GLTA 1E62A 5AIBA 3RBAA 3OFNA 5KYTA 5EIAA 2NSLA 3RUAA 2Z8XA 5LMNB 3JSLA 4W8OA 3FSEA 2OBLA 1KDPA 2NV6A 3U1VA 2Q9BA 2QD5A 2R8HA 3QFFA 2XA9A 4YJ3F 2W37A 3EVBA 5EZYF 1QHIA 3DG9A 4NK4A 2NM0A 3AQ4A 2F1OA 4DLPA 1Y1QA 1VIAA 2GDJA 4ZVMA 3ZDBA 3CRNA 2AN9A 5EUBA 1N0WA 3EXIA 4G01B 3ZIAD 5BR8B 2RGWA 3FPBA 1IBKH 5AW1A 4KFUA 1G6Q1 2ZI4A 1MFZA 2D3WA 1XXLA 1V51A 3AVWA 1DEAA 2PUAA 4QWWA 4NDZA 4HYKA 4QWMA 3VR4A 1TWAA 4PLCA 3E3LA 2NW6A 4QWCA 3TR0A 2H00A 4UZFA 3E2MA 4ZZ3A 1MRNA 5KC8A 3CS3A 3DWGA 3GJ5A 1M34B 4QD3A 1JALA 2Q6IA 5BY2A 1EKXA 4HAOA 4NICA 1BKDR 4OLJA 4A3BG 1E92A 2B5VA 4ED6A 1XCMA 4RTRA 2DYKA 3OVMA 5FORA 1JILA 3U4HA 2J5BA 1NVTA 4DLVA 5CCEA 3TXAA 3L6CA 2GHQA 4PWYA 2G63A 2XRYA 2Y05A 2I34A 1J33A 4IIVA 2NU7B 3EFBA 2EF0A 1NI4A 1PR6A 2OBFA 3VAYA 5DLPA 3WGZA 3KRTA 3CZQA 4O7VA 1S02A 1WCWA 2PSDA 2ZJOA 4KN9S 2REQB 1MPTA 2XC9A 1BHO1 1FFGA 4AJKA 1T34A 2V98A 3VJKA 2YX1A 4N41A 3I8SA 4TXNA 1GQQA 4EPRA 1XL0A 1F2DA 3A04A 3JQFC 3W78A 4TN5A 4ZYYA 4Q01A 2O5EA 3B6EA 3V7FA 1O4VA 3MMSA 4KGXA 5CK4A 2VUMG 1MX3A 3WOVA 1YI8A 3FW1A 3K0FA 2HQSA 2UYCA 3FR7A 3ISVA 4D9KA 4YDHB 2ZSEA 4MQ6A 4XWTA 2VJNA 3ZBPA 4DJJA 3R8XA 3IP1A 1GLGA 4XWKA 3GTMA 1O2DA 3MILA 5AI6A 1KGSA 3AV0B 2O8BA 1TNDA 4I4CA 3TS1A 4AZ3A 1O1YA 4ARZA 1O5IA 3Q3GE 3PR1A 1CDZA 3KUUA 2B30A 4MPPA 2F55A 3U4QB 2IHNA 2E1PA 2QB5A 3SPXA 5A9SB 4RSGA 5BN4A 2IYOA 1GNPA 3SZGA 4ZYXA 5L40A 5LFAA 4M49A 2WFAA 4M54A 1S1CA 4RHTA 3INTA 4LF5H 1PG0A 4GLWA 4QPPA 3K3PA 1E1KA 1QS0A 2J08A 3A4TA 5HW0A 3TLKA 5F78A 1XQ6A 5HCUA 5C8DA 1II0A 1U8XX 1ENOA 3PWSA 3QEOA 4Q9IA 2GNOA 1YVDA 4C0HA 1KI1A 3DW3X 3VU9A 1RC8A 4D74A 3HNOA 2G17A 4CEIB 1P4AA 2Z08A 1FVFA 2GTPA 5EERA 2G40A 3FPFA 1GFSA 2QVYX 4JD5A 1WEKA 2WHRA 1CKNB 1YL7A 2VZ8A 3PQFA 4OX9B 3AFGA 1AKUA 1NMSA 3QZ7A 4FQ8A 4F1JA 5CLLA 3FPHA 3LF1A 1TCUA 4YRMA 3MLBA 3S7ZA 3HU5A 3TEMA 3TR6A 3ORFA 4RGQA 3UXYA 4K6KA 4TLBA 1WOMA 3FKJA 4WSOA 4XVHA 3P9YA 4BAGA 2CNNA 4D3DA 1PJSA 2A9QA 4A7PA 4XYLB 5DBEX 4PCUA 3CX6A 4JN6B 3UENA 4UD2A 5A4AA 1C50A 3UWMA 1W36C 1FFYA 1NYLA 2BBTA 4D0SA 4GPBA 4UCOA 2QJTA 5KFTA 4JHLA 1WW3A 4Y6LA 5BP7A 3NHAA 4G0WA 1JV2B 2QVLA 3P0FA 4BTEA 5KB3A 3L0IB 3I2HA 2W71A 3L0DA 2QN2A 2VCHA 3K05A 1J0XO 5IBQA 5IXJA 2J67A 1VSQA 4ZYVA 2PLRA 5LM3A 1DADA 1Y1PA 4ZOQI 3VHLB 3NHBA 4CG1A 2I1LA 4Y1EA 3KQPA 1MA0A 1R66A 3AR5A 1RYHA 1HEUA 5AOVA 3BMOB 3WK7A 2GKSA 5SY9A 3USES 4LTMA 4BQFA 2ZPTX 3TX2A 3GBVA 4EG6A 1CEYA 2WIGA 2WB4A 5EJAA 1BWPA 1QGDA 3U1TA 1IJBA 1A9ZA 4XXHA 3IGFA 3QQPA 3WK9A 2J4FA 5LQSA 1UCFA 3HDHA 3P2EA 2D1FA 3M89A 2NTVA 1NVEA 2Q1SA 3U3DA 1A82A 3RTXA 3BD8A 4X3OA 2O0MA 4A8JA 4L4ZA 3T5HA 1PR9A 1GVHA 2NZUG 1P80A 1UWKA 4Y8VA 1K98A 3WSWA 4GIBA 1E3QA 2CV0A 3E4DA 3QPWA 3P2IA 4IMIB 1V3UA 3L8FA 4UBNA 1VLVA 3W04A 4WK2B 3MS4A 5AW8A 1OIVA 5GM2A 1OV4A 2Z43A 1Z29A 2ET6A 4O4HB 1H5UA 4MO2A 3RIXA 4HFRA 1Q1NA 3IOMA 2QRQA 4GKKB 3NYIA 4MKIA 4LF6H 2CZCA 2CMHA 1JQJC 1UMCA 2RE8A 2QP4A 3LLCA 1QK5A 2I80A 4B6RA 1KI7A 1RNLA 2HT1A 4X1YA 3GVXA 1WETA 2WTFA 1NN5A 4RB1A 2BHNA 1N2ZA 1SPBS 5HTOA 1LUAA 3NTXA 1IAVA 5IUJC 4EF5A 2Y6VA 4CMEC 3QTLA 1UDAA 3GJXC 4CCSA 3KQQA 4UXJA 2ZWIA 2ONKA 5WRFA 2E2HA 2NTJA 3ZWXA 3ADOA 3DAOA 2X7HA 2RAVA 2P9FA 4R8SA 621PA 1FVHA 1Z07A 2W7TA 2GK7A 4E7OA 4O2BB 3MTQA 4MTLA 2F2TA 3O8BA 1LPSA 3VO2A 2M1ZA 2V7WA 1H4SA 4AAYA 2QAJA 3QKWA 2JA2A 4IIUA 1IM5A 1ZQ7A 4FZVA 5HE9A 2RBKA 3A10A 3N8DA 3GZNA 4B3JA 3QLTA 4PLZA 2WNHA 2UVQA 1M1NA 4EUSA 4F86A 5ER6A 4RD6A 2G6TA 3S5UA 3OP1A 1SPXA 4YCLA 4BWVA 3E58A 2QXYA 3AR2A 3ZKWB 4EYQA 3R3VA 3FHJA 4BFUA 2X4DA 4EITA 3QXCA 4BOYA 4DM7A 3LM8A 1WCV1 5AHOA 1OXMA 1N5OX 1COWD 1E1MA 4G5YA 1GUBA 4AMVA 2GEVA 1NJFA 4I4TA 5M3BA 3O8OB 2HCRA 5ADUS 5E7QA 1XO1A 5M5BA 1HL7A 2O2HA 3DT8A 4D6PA 3PHGA 2VPXA 2P0YA 3AW9A 1T3LA 2J6HA 3P9SA 3SI8A 2QG6A 2EKBA 3UEOA 2YXEA 2J6TA 3FFWA 2PJUA 4YXWA 2HIHA 3CLTC 3QVOA 1QR6A 2WNIA 1Y5IA 1YZTA 4XKJA 1NFRA 1P74A 4V0NA 1AKWA 4HDNB 3H9JA 2BFFB 4GW3A 2FGKA 1DAKA 3TTTA 1Z2EA 1IHPA 4F4JA 1E99A 1F1JA 1PQPA 1DP4A 5TXGA 5KDOA 4QPJC 4AF8A 1AKVA 4RVGA 3PVXA 2IOFK 5AYVA 2QZJA 1RYRA 2KYRA 2ZI7A 1HSZA 2A3NA 1PWEA 2O1EA 1R4NB 4BY1G 4CL2A 2BV3A 5JYDA 2PJRA 3AUSA 1RBQA 1TIPA 2QN6A 1W49A 3KKQA 1QH1A 1KZ6A 3QF7A 1WD7A 1JPJA 3SYMA 3IVRA 3QG1A 2NAFA 5A6VA 5KU1A 2XCTB 1JLMA 2PBFA 4GKAA 5A04A 3N75A 3O8CA 2B9EA 1N2CE 3HI4A 4RQAA 1OXKB 3GCGA 1CCWA 5KTKA 1OKKD 3DMPA 3UT6A 1FP2A 3PXGA 2ZBEA 3T9DA 4OQLA 3O4IA 2RSLA 3RC2A 3W3ZB 1ZK2A 4YMHA 4QUEA 3STUA 5FI1B 4O7LA 1NNUA 1NG1A 4ES6A 5JZOA 4JQSA 1PKXA 4KXVA 1ZGJA 2D5IA 4BFZA 4KPUA 3NP7A 3L7MA 5BSMA 2NOAA 4MVJI 4Q9KA 4ED7A 1NLUA 1T1GA 1L8LA 2DFLA 3H2SA 4G0ZA 3VR6D 3D0QA 1LQ2A 2DT8A 2XB6A 3E9QA 2ZVQX 1OC2A 3IULA 3ML1A 1HYEA 1QF6A 2XOKA 2O3UA 3JVDA 4LV6A 2I2XB 4RENA 2VS1A 4R2XA 3OJEA 4Z49A 1YQDA 4QTYA 3NW9A 5JBNA 1FJHA 2HHFB 3IQZA 3JQ6A 4KMOA 2AYYA 2X4LA 5JWOA 2XADA 2I6QA 1S9FA 4CCYA 4E5NA 1D0SA 3DZCA 1CBUA 1Y1WA 1D07A 1NVAA 1NMQA 1HE4A 1MHPA 4D5EA 2XZDA 1U0LA 4GNKA 1D4FA 3CW8X 2XQIA 2AF4C 1SG9A 4XGRA 4AL4A 5TB5A 3PC8A 2ERCA 2XUFA 4AZSA 2O0HA 1APBA 2D00A 5DLQC 5EXPA 4O82A 3LCCA 1BMDA 2HGZA 5ILOA 3P0RA 1Z82A 3SEFA 1KYXA 4TMXA 2X7JA 3KJIA 1CY6A 4OA5A 4LRXA 4JI4B 1M1ZA 4BQEA 1DV2A 1DUIA 3MJRA 1YV9A 3C4VA 1X13A 4K9OA 1GGJA 2CLKB 2ZFUA 4N7JA 4LXUA 1RI4A 3BE8A 1QG4A 4MRAA 3GJZA 1FDWA 4K46A 1JT2A 2ZGVA 4FP9A 4BO9A 5FV7A 2ZQYA 4DY6A 3IDAA 5ALEA 2AFIB 3MR6A 2X6RA 3IH5A 4IRDA 1XOIA 3CSSA 2VK2A 3H3FA 4N18A 1ZCBA 4I1UA 2FZCA 1R8XA 4WASA 3O83A 4PGHA 5CIQA 2JIMA 4EJ6A 5IW8A 2RHJA 1IZZA 3U6BA 1TIBA 3L2OB 3EBLA 1YZLA 1U7OA 4ZOCA 3RASA 1RWKA 4MZXA 4YUYA 3IE1A 4N1AA 4RZHA 3EFOA 1EAYA 3VU0A 1OF1A 4PICA 1F7UA 2CJYA 3V4ZA 2AOTB 1A0GA 5JXWA 5CEJA 2BHRA 1Q12A 4E6EA 1HBJA 5DT2A 5BV0A 2J3LA 1CV2A 4PEVA 4ECEA 5KTRA 5HKOA 1RYNA 3DVSX 2YXDA 1MIOB 3FDJA 4K9SA 4GPAA 2F67A 4Q44A 2WU3A 3LLMA 3RSQA 4C6TB 4GUAA 2TMKA 5E2BA 3HB1A 4JBWA 4ZDIA 3DAHA 2EIXA 4NG5A 4JB8A 3A6EA 2E5LB 2H0QA 1DOHA 3WQSB 2X5JO 1KPGA 2FF7A 5BNZA 3KB1A 4BMYA 3PI6A 3RC1A 1V3QE 4D8YA 3B85A 4PIMA 4UUOA 4E5YA 5FL3A 4R54A 2PEYA 2R44A 4OHBA 1SVKA 3PUVA 3BIWA 2MDTA 4UNIA 4KR6A 1YB4A 3TLMA 2ZTUA 3Q5DA 3M81A 1JG6A 5KFPA 4LVNA 4Q7QA 4M8SA 4ATNA 5FB3A 3ZHVA 4BO3A 2VF8A 5KIAA 4PPYA 1X7ZB 2HMUA 5ITZA 3P7MA 1X7XB 1Z83A 1ODJA 5F12A 1YHNA 4NV3A 5FR2A 1LPPA 3BE6A 4R3WA 5DNEA 3DKPA 2BFEA 3O1JC 2RF4A 1YZHA 5DN9A 3ABSB 1Z6TA 2NV0A 5CJJA 5DYYA 3MYYA 3A37A 2PQ0A 3FJOA 3W1BA 1LBSA 2B61A 1VG0B 3IR5A 3SSNA 5E7JA 1PNOA 1Q1QA 1NZFA 2WF5A 3QLUA 3WLNA 3GLIE 1KJQA 1SC1A 1O57A 3V1NA 1V48A 3L5OA 1T0JB 2BELA 3RAXA 1H2EA 3RYHA 2NUTA 3CNHA 4G6ZA 4FCVA 2A0WA 4CMAA 3E3OA 5MN5A 3KYIB 2FWJA 1LBEA 1ZJJA 5T4HA 4NE2A 3HBJA 4HYEA 4JVOA 1TRKA 4PFQA 4PY2A 4PQGA 4RLFA 2CKDA 3MPOA 3CW9A 3Q41A 3HNPA 2VH5R 4ZI3A 4FDMA 1BS2A 4F3YA 1L2ZA 3T1QA 2DG2A 3CX4A 2QY9A 3U81A 2VDNB 3TCXB 4AG5A 2Z2IA 3INGA 2DLNA 1TCBA 4MGHA 4ZQEA 5BXQC 4QHYA 2HVRA 4MICA 1FOEB 3Q8LA 1S96A 4OCZA 2IDMA 2HBRA 4C29A 3CVXA 4UCXA 4OX9Y 3RK4A 1XMPA 4WBNB 1OFUX 1KMQA 1TAUA 1YJ5A 5ALFA 1Z74A 4PC3A 3W34A 1SXJC 3BAFA 5AK0A 1RCFA 5IYZB 1STOA 2Q1YA 3JPYA 4X6LA 1AO3A 3GCWA 1TZKA 4OH1A 1NV8A 4FI3F 4O3QA 3HJHA 1YWGO 1CU1A 4ZEMA 5AKIA 4DKXA 1B0UA 3UJNA 3F5QA 1Z73A 4M8NE 2V3VA 3KO8A 5I9SA 3HXOA 3RREA 4BBAA 1WMSA 2AZ4A 3AWDA 2H31A 4TKVB 3UMYA 4Z54A 4P7FA 1JBKA 4CETA 3ANNA 1N6IA 4LZAA 4LF9H 5JRJA 4B3CA 5BWLA 4AZTA 1YOVB 3O75A 4RKQA 2RC5A 3A8TA 4FHCA 4J0DA 3ANYB 2BFCB 2CD9A 4XR4A 4Y18A 2EG9A 3LDGA 3VR3A 1CYDA 2JEOA 3K8QA 3RTBA 3DMFA 1IEXA 2YMPA 5ISMA 1U3TA 4HXEB 1YCDA 1P0CA 5SZHB 1DDOA 3GLGB 4PR0A 2QRHA 2C00A 1W85A 2JAWA 3G7SA 4W5OA 3K9BA 1CRPA 2LZ0A 2QK4A 3PTZA 3A05A 4KFRA 5AJVB 2FW6A 2G80A 3QI2A 2QRZA 2POQX 1EDOA 4N76A 3AB8A 3HCEA 4K9LA 3I2KA 3BM5A 1Y7LA 1TUEA 1KH2A 1Y4UA 4G09A 1QO0A 4ILEA 1OILA 3HP7A 4JJIA 1JBQA 1JG7A 4B3HA 2FUKA 1N34H 4HFJA 3GJSA 2GF9A 1BOFA 1NY6A 1QVVA 4LY3A 3NR2A 3EASA 5HNEA 2WB2A 2OH2A 3R7AA 5AVJA 1TVCA 2XUOA 4R2JA 1X7YB 2PSFA 5TY0A 5HK8A 2AR9A 4LXYA 2P8JA 5J5AA 3RABA 1H23A 2DWCA 3CCFA 4E0BA 4PPQA 2VYNA 1CUFA 3GFTA 4AI6A 4RZIA 4C2UA 1S2DA 3RB4A 3H5TA 2NZJA 2GFHA 2ODNA 2VQFH 4D9HA 2YKGA 4F4DA 2QT0A 5AHKA 3H7IA 3LP5A 3EIXA 4MVJG 1GADO 3ECAA 1H8HA 2CK3A 3AHJA 2VZ0A 5JMWA 4BGVA 4BZPA 2AXPA 4WN3A 5D1HA 4JEIA 5FUMA 1M33A 3BMNA 4KDRA 4QSMA 3SF8B 3F3KA 2GPBA 4CFZA 3G9UA 4BNJA 2FJ0A 4R1NA 3VYTB 1W94A 4MB0A 5B1DA 5FHQA 4EPXA 1O95C 3HYNA 5FOXA 1CQZA 4A2BA 1ZRNA 4Q43A 3TTSA 2Q0XA 1CRZA 3NGLA 3ENVA 4YRZA 3OSZA 1ISJA 5E25A 1ZMBA 4B5KA 1SCIA 2QN1A 4DR5H 3V8MA 4REQA 2WMYA 3CEHA 3IAUA 5K6AA 2YVKA 3AL2A 1Z5OA 2B7LA 4MYCA 5CB8A 1NJSA 2G4VA 2CNBA 4KZPA 2UUCB 3G2PA 1SCBA 1NOKA 3CRZA 1MF7A 5TGZA 3JWJA 3ILYA 1Y98A 3EGWA 4W99A 2AI2A 1GZ5A 2GS9A 3KPYA 3LT1A 1T5DX 4M9SA 2ZP1A 1EGVB 4M0JA 3TZQA 1SOVA 2OCYC 3S2EA 2BKUA 221PA 2UUAB 2VHZA 4EEQA 1N4DA 2EXXA 2YICA 3INYA 4J9MA 3GA7A 5HILA 2BFAA 5JECA 5G1PA 3JYPA 2ZJ8A 3WDKA 4UE6A 3CKLA 2PEZA 3H86A 3E3MA 4EBCA 1MO5A 1QCZA 3PQEA 4ASUD 4ZHQA 1JR3E 2G28A 3EPHA 4D9EA 4DJEC 1U1DA 2GAFA 1NJGA 2FSVC 4RSMA 1A97A 3INRA 2JGMA 5HF8A 3EQ2A 3IURA 4KBGA 4MI3A 5L9AA 4LZLA 4Z86A 4QWBA 4EZBA 4MR9B 2ZIVB 3KR2A 1OLXA 2BTOA 4LH6A 5KWIA 4L2IB 4ZAYA 5TGTA 1RK6A 5I3CA 3LUFA 1G98A 1XRQA 1TEZA 3ONWA 1HH4A 3VU3A 1NE2A 9MHTA 3W5JA 3AG5A 4Y0NA 4OMCA 4KK4A 2J41A 1S10A 2M6SA 4KHZA 2WHPA 4ZOLA 1IY8A 5HFNA 3FUUA 1GQSA 5EIBC 4B85A 4CKBA 1TUBA 1HFEL 5DNDA 4WK6A 3E1SA 4QDXA 4KHPH 4A3KG 1CJMA 2E89A 4QO7A 1V1MB 3OFJA 3RPEA 5F3RA 1QOZA 1YDFA 4IZOA 2X8AA 2W2TA 4KHPB 4CM1A 2YWVA 2O2GA 1TYBE 3WLPA 3I9MA 1UAYA 2JA8G 3SIRA 1G9SA 5BWMA 1UBMS 4EVRA 2R6DA 1EJ6A 1F38A 5CYOA 3MGGA 1RLUA 1FXWA 2W6NA 1XJ5A 3A4VA 4I3FA 3OFND 3L4SO 4FFDA 1OFHA 4HTFB 3RRMA 3ZDRA 1DEKA 4INOA 3VPAA 2ZSJA 2O2EA 4HB0A 4K86A 2P9CA 4DMKA 4WD3A 2WV9A 1C4WA 2NXNA 4A36A 4KQKA 3NTUA 3UJ7A 4LOHA 4URWR 4GEKA 4MWBA 2VCYA 3BRWA 5CDFA 3IAEA 4PZYA 4K88A 2ECKA 4F71A 1VYHA 1I2KA 4DIBA 1TD9A 4YAWA 1YNSA 1XN1A 1VFPA 4DV1H 1H6BA 2FOLA 4NMWA 3GX1A 3QU4A 2FDXA 2X7XA 4Z3DA 4JLWA 4LXTA 3COSA 1HFJA 4ZGWA 4ZCIA 3G7NA 3VR4D 5J47A 1H5QA 3Q11A 4MWSA 4XVCA 5E6SB 2SKDA 4DR2H 3ZY3A 3ITDA 3O0DA 3QZ8A 3HVKA 5HIKA 4F4HA 1TQ8A 1G3QA 3QKRB 1C3VA 2C2ZA 1RYYA 2CFCA 4GQIA 3DV0B 3U5ZB 5KYWA 3OZBA 2LBPA 3O1IC 1I7QB 3KJQA 3FJYA 4EBFA 4AQ7A 4ON9A 4E08A 1GZ3A 3GRCA 2GERA 3VPSA 3CN9A 1TQ6A 1XDSA 4RK7A 3GJ3A 3W5IA 4H08A 4EG0A 5E8JA 2TSYB 3FGNA 3NTQA 2QR2A 3PX2A 3ZW7A 2H07A 1SU7A 4K5QA 1PQYA 3NTOA 2FW1A 5SZJA 5HX7A 3IIKA 3DP9A 3DVQX 4C0LA 5EMMA 3UKDA 4Q18A 4EMUA 2DSNA 2R85A 1ZJ4A 1SIBE 1RDFA 1NMYA 2BGKA 3K09A 4JEMA 3EW7A 4BFVA 4IG4A 3L07A 1Y5MA 3U6KA 1W96A 2YWDA 3RLIA 2PZKA 4F56A 1Y6FA 3HK2A 3H5LA 4PXYA 4BU0A 3BCRA 3HXPA 3LQ2A 3ZU5A 4DJTA 3SJAA 3F0TA 1OWMA 4GLXA 3IIIA 3R7NA 5BVGA 1ZH6A 1ST2A 4BGDA 2R6FA 8AT1A 3N42B 1LLQA 4TRNA 1XMOH 4UAGA 4LHSA 5H9WA 1WJGA 3TY8A 5F3DA 3E27A 3SXPA 3K9WA 3H84A 4A27A 5KCMA 3RU3A 1JWAB 2H63A 3VI3B 3EWSA 4HMOA 5DTEA 2BSXA 1FFWA 3CCCA 2WG0A 1M72A 2FZLA 4F4FA 4DL2A 4QBHA 2G08A 2HV8A 1L5YA 3C7DB 1X94A 3K9LA 1AK1A 3WL6A 3STVA 4LAFA 2DFPA 4OEHA 3X1KA 1F0YA 2WE6A 3E81A 1BXZA 2J09A 1CJBA 2CJXA 3ACCA 1TWCA 1I6WA 3NUGA 4KJZA 3OCJA 1YF3A 3O2JA 4B6QA 1YDEA 4DC9A 5DLGA 3SJUA 1D2EA 5J2TA 1YS9A 3PI7A 2J4DA 3DW1X 1XVTA 2ZYHA 4BP1A 1TO1E 4TMVA 5JSKA 1EK6A 4I5IA 2D5BA 1XA3A 1VZ2A 3UT5A 5CJ2A 3UG7A 3QBVA 5IXSA 1M2JA 4ESEA 5KVAA 4HB3A 2E5FA 1VL8A 4UAJA 3EODA 2JH8A 4B3DA 4TV9A 4IH1A 2TMYA 1RYBA 3Q6IA 1L9KA 3WDMA 3QOFA 3OH8A 5FTNA 3S70A 2AR7A 3QXHA 3JQ8B 5CFMA 1UXIA 4DCMA 4DDKA 5JLAA 1ODCA 1J2YA 4DR4B 1AN7A 3QEAZ 4YRKA 3VKGA 5B6JA 3WHPA 5ALLA 4YJFA 1UADA 3HOWG 5PNTA 3ZWNA 1J1ZA 3FZNA 4CT4B 2W11A 2HHHB 2PGIA 2XUQA 1B15A 3BSYA 1IC6A 4QYMA 3M6IA 1FRQA 4TT8A 1DQZA 1VHQA 1VL2A 4HCJA 1SURA 4QQFA 3JPWA 4UJ5A 2PX5A 1C9KA 3CJRA 1M7BA 3EC2A 1EAMA 1ZGGA 2CVOA 2PLAA 2XE4A 1XKXA 5DNYB 4DADA 4WW0A 4IRKA 5DBFA 2XIQA 2CXNA 1IXSB 2UVDA 5JR3A 4LMRA 4Z6KA 5THKA 3FWKA 5DLFA 2V4RA 4JGGA 3IP8A 1BXGB 1D0VA 2FFBA 3VSAA 2CEKA 2QTGA 3D6UA 4UTZA 3KLPX 1TJ4A 5CT5A 5AJYA 2PO5A 2C5LA 3Q12A 3KQTA 3ZOZA 3ICEA 2JCXA 2I4NA 3HY3A 3HKBA 4OF4A 5K0JA 2ENUA 4FD3A 4DOMA 3E03A 4XRGA 1OI4A 1F14A 2YY6A 3CSWA 2KLHA 3ZZ1A 1U6KA 4C21A 5E95A 4ZIRA 3DF7A 4UNNA 3ND7A 3CT4A 1M8JA 2AN3A 4YI5A 3FNRA 2Q29A 3DPSA 1JP7A 3DULA 4AUMA 4NRDA 4O63O 4F85A 1P9NA 1CIPA 2FX2A 3OZEA 2JHAA 1O58A 2ZTVA 4RD1A 3L7OA 1BDMA 5JISA 1KVUA 3S68A 1SKUA 3LT0A 5TQVA 3A1VA 3SF0A 4U7GA 1GD1O 2JFGA 4V02A 3RD5A 1PR5A 1XXHE 5IVHA 2IE0A 2CBXA 4IG9A 4WZZA 2DQSA 5BWCA 3AHFA 3KR1A 1GAWA 1YFLA 4JYBA 3R9IA 3PPWA 5EZSA 2BR3A 4O7NA 1XVAA 2FHSA 3NMUF 1JDTA 4QGAA 3G49A 2VUIB 4J9RA 4IQ4A 1MOQA 3X1DA 2QM0A 5LQMA 1S2MA 5IBRA 4QJIA 1NVFA 3BYZA 3LUBA 1MQ8B 3UV6A 2WAAA 2YH2A 2FMUA 4M4SA 4WERA 1H2ZA 3FNQA 3MBKA 1V45E 4I1OA 3R6LA 4OB6A 1NBOA 1Z26A 2HA7A 4EHBA 5LP6A 4DLSA 1T9GS 2V7QA 2PUBA 3M9LA 2CXPA 2LV8A 1CG6A 4OLAA 5JNLA 2NVWA 1CY4A 1NXSA 4Q0MA 4CC5A 4JJKA 1G17A 1MG5A 3WKEA 4H7IA 4OXQA 1TT7A 1T5SA 3ND5A 4UQPA 2JZCA 1IQUA 1GITA 2ZIFA 1HRDA 2W8KA 2AVDA 3OTQA 4CLRA 3TQ1A 1M2WA 1YBAA 4HGOA 5HS6A 2PO7A 3T3GA 1WA5A 2J1LA 1V11B 1RHRA 2Y92A 2VN8A 1KEEB 3TAXA 5ITVA 1VPDA 3EAFA 1X86B 4MXDA 4M86A 3WXMA 4BL5A 1UF9A 3H4TA 4Q8FA 4R9UC 3N41B 1R9MA 5TVGA 2E4VA 3ZE2B 4YXWD 3IBFA 1DWUA 1NVWQ 1TM7E 1U9JA 1KYYA 5THXA 4E15A 2NMVA 2R4TA 2XUIA 4OGKA 1DMSA 4IBOA 2PVCA 3NVMB 1X9GA 4DDVA 3B3JA 3M5DA 2G5PA 5LMNH 1UOPA 4P7BA 1Q2UA 2Y9MB 2NV2B 4B75A 2XTAA 2DZDA 3CUYA 2JPDA 2B4KA 3CW2A 3CPSA 3R6DA 5A1TA 2D8AA 5JJLA 5KX5B 1M0WA 3SHVA 3WRXC 1EUDA 1P17A 3RSOA 1QUEA 4DRXB 2WIFA 1UDBA 1QDEA 1ZBQA 1B2RA 3GV8B 2IRWA 2BLNA 3THWA 1OHHA 4FW8A 3JQ7B 4NMXB 4RAOA 3I9V6 2PUWA 3EFHA 5BR8H 4G0YA 1JWLA 3IDQA 1KEVA 2XMPA 2H4YA 1Y8QB 3NBYC 3JSAA 4MGYR 3SAJA 3A2KA 5EEHA 2G71A 4KSYA 1O7JA 3TQCA 5K8VA 3F4LA 3COJA 3IVGA 3VNQA 3FKSA 4TRMA 3AEQA 1RC1A 3MVEA 3ST7A 4EJSB 4KACA 2FFJA 3LZCA 3BWVA 1SWWA 3I1JA 2C2XA 2PGAA 3DSRA 2ZRAA 1WF3A 2ZKLA 2C3MA 1K6XA 5DQHA 2YJ5A 3QHAA 4Q1DA 1XX6A 1WPQA 4ZVUA 1VCOA 4XDZA 5D3ZA 4JI0B 2VSFA 5CXXA 1D2AA 5J4KA 3IQXA 1N5RA 1G7SA 2PZLA 4Q16A 2SBTA 3Q7SA 1M9NA 3OUZA 1CVLA 2OECA 3IUNA 2XOKD 1Z0UA 2WTEA 4G4IA 1R4MB 2BDTA 1XQVA 1BQEA 4L75A 4G1MB 2JGJA 2K4MA 2QMHA 1L1FA 2WJ4A 4MS4B 1P1HA 4HVTA 1QVAA 1TEHA 3ROEA 2WA1A 3FPLA 3R5XA 5AUOB 1EVLA 1L5HB 4FR0A 2PMZE 5K8LA 3H4VA 1KH3A 2HGXA 4J9NA 1FFBA 1RWMA 3HWX1 4NECA 4EFNA 4YASA 4HRVA 3VZSA 3AG6A 4TKZA 5JFOA 1IYDA 4HWGA 4BNDA 4IMJB 3QELA 4CFSA 1XYVA 4FEYA 2ZIZA 5TC4A 5JWHA 4YT5A 2P2LA 3LCRA 2R6CA 4BV9A 1S4MA 4F72A 2ECQA 1BA2A 1KRXA 2CXXA 1TU0A 1R9TA 1Q2XA 5JNUA 3EY9A 1IN6A 3AJ8A 3WO1A 5FV4A 3AF2A 3BMCA 3OSNA 2PZFA 2Y4NA 2RAFA 1KTVA 1UBHS 1N2JA 3AM1A 3O2SB 4NAVA 3FWHA 2GXSA 4XLLA 5FFFA 4GXRA 5GQSA 4AD8A 3EVTA 2E0IA 3UQZA 1EYZA 1Y1SA 3HBFA 3VYUB 1I1KA 4N9QA 1XTRA 2VG8A 1U1EA 2P3QA 3UB2A 1WQ1R 3HPRA 5I7UA 5JSZB 4L8VA 1JDJA 3DGEC 2ZJ5A 4ZHQF 4L73A 1DO2A 2W7OA 1US8A 3WIDA 3TLGB 4YRSA 1Q3HA 1VS0A 1VTKA 3GIDA 1TAEA 4XWGA 2ZJBA 4OX9H 5ALOA 4U2CA 1N1MA 5ALNA 4IMPA 3D6JA 3RAEC 1XZIA 5DZSA 4F9EA 1QAMA 1F12A 1D6MA 2YIVX 3SFTA 4K6OA 3NH9A 4UFOA 3CB2A 3RYCB 1D4AA 3FBTA 3I5XA 4H35A 3WIEA 5B64A 5AW4A 1HETA 4ZVKA 1D09A 1ZQ9A 3S6JA 2DWQA 1N2CB 1UKYA 5HUQA 3NT4A 2AA3A 4JQYA 4CIXA 4JJ4A 1SZJG 1R50A 2YTZA 2FTKE 4RFSA 1UAAA 1MO4A 4RK6A 1NBIA 2QN9A 4C78A 4DQNA 4ZOLF 3S2GA 3JS5A 1UK8A 2C9ZA 2XXAA 3PV0A 2OORC 1GPNA 3C43A 2ZYVX 3TLCA 2XXJA 1N9GA 3HBLA 1T1RA 2O4UX 3I4CA 5IVDA 3NYWA 1KQOA 5I51A 4C7OA 3D7MA 5CB6A 4WLVA 1SVLA 4PSVA 3AR9A 4U8GA 4F97A 1JPUA 2GJKA 1WCIB 3BSWA 1JAYA 3R6GA 3EF0A 2GBLA 4H4CA 4EY5A 2OGSA 1G8PA 1FXWF 1JU4A 4OIMA 4JC8A 3PR4A 1I4EB 2AK3A 4IX1A 3H8WA 3F98A 3ZK8A 4QFMA 4O5OA 3QPDA 1Y3IA 1X1CA 4AMUA 3L7NA 3OD1A 1SEPA 4MW7A 3FOWA 1VMDA 3TH5A 4M9ZA 3B8EA 1SAYA 4FKZA 4ESOA 4JP5A 4RELA 5DYNA 3EQ7A 2FX5A 1Z13A 2V8OA 3P4UA 4LJAA 3REFA 4IVQA 3B70A 4RCNA 3IBCA 4TMZA 1C1DA 1K27A 3ZE7A 2J3JA 2JRCA 3KT6A 3TD6A 2VP2A 4GYWA 4E4TA 1T6ZA 2B3TA 4GRAA 1JAIA 1O54A 4ACBA 1YS4A 2FZ5A 4BVAA 4BUJA 3OEHA 3WNVA 1ZJ5A 4CI9A 3PA8A 1OAOA 2BFDA 3EXFA 4EKEA 4H0NA 4GKKH 3DAFA 4O4JB 3AY7A 1NGSA 2BGNA 3KZNA 3TGLA 4JJEA 2HK9A 4QOHA 2JZNA 2JIQA 5D7NA 1P2BA 2QLMA 3DNMA 5EMHA 4QFBA 2Y1FA 1QFMA 1IUPA 2L0XA 3GGCA 2B69A 2QWXA 3R3SA 2MSDB 3HDJA 3GIJA 1P5FA 3G5TA 3DL4A 5KKCA 5BN5B 4JVNA 1JDBC 4LJ6A 4LX8A 4PO1A 4YUAA 3E5HA 1OMOA 1FB5A 2QDKA 4OV6B 2OV3A 4EHNA 4FYVA 4JB3A 2QGFA 2TECE 1H42A 3IAXA 3EWNA 4ZO8A 4D8UA 5ADWA 5FOTA 3GZTB 1NVMB 1TFRA 2PLFA 5EOVA 3C6YA 5I4CA 3M4YA 2BQ3A 3FH0A 3HO1A 2GQSA 3OEEA 1S2OA 5L3SB 1DHTA 3H75A 4JQOA 2HWKA 3HM9A 1LJLA 2AUMA 4EG4A 3C15C 5DRTA 2ODAA 1G1AA 3GRPA 4RD4A 3Q87B 4YCMA 1RWPA 2IYEA 1P77A 1T9GR 1EXWA 4EDFA 3OIGA 3RSGA 1SVSA 1EFLA 2ZSAA 4INPA 1OBCA 1QZXA 2EAUA 3VR3D 4EKGA 1C9NA 2B0CA 2QTAA 1V1RB 2PRKA 4UFZA 3ZDQA 2FWBA 5IASA 3B1ZA 3ELBA 2GJ9A 4W8HA 3KR9A 2AN5A 1JHXA 1RJEA 3AL0C 3QM1A 3KWFA 1JTEA 1ZHQA 3NIFB 1ZI8A 5D8DA 3UY4A 2IJGX 3HXLA 1A77A 1PJQA 4I50F 1IM2A 1JR2A 2CF6A 1XWFA 1P61B 4DTIA 3GFQA 4WY5A 2WUGA 3NZEA 1WV0A 2ZU0C 1QO0D 1ES9A 2GN1A 4E5VA 3FZEA 1EA7A 4XPIA 1RM0A 2O54A 2W2KA 4KO4S 4Y6PA 1TVMA 4MVWA 4BXOA 4LCBA 2YIMA 3EX7C 1L8QA 1VG8A 4MMYB 1FZTA 4QJ5A 2VPPA 1ZAYA 1E7SA 4XOUA 4YQEA 1ZZGA 3AU8A 2MMCA 4FGZA 5MFZA 4ZGGA 1J4AA 2XYQA 5EGNA 3KQYA 1LK0A 1E7YA 3UUGA 3ZQUA 1RC0A 2FLLA 2OSVA 5FP0A 3TMAA 4CM6A 1R9NA 5JC1A 4JH0A 2ZJ4A 4K9DA 1W87A 4RZ2A 5CDHA 2VYND 4UVGA 4LJ5A 4RGBA 1K9SA 2QRJA 4WNYA 4DABA 1RM4A 2YINC 3RHTA 1PR4A 2BGGA 5LUBA 4UEKA 3P2YA 4NENB 3S1AA 3ZDCA 3R3UA 3GBSA 1FLNA 2QM3A 3IUMA 4QJBA 5H81A 2V7XA 1XLTA 2KI5A 2R5NA 1IZYA 5HQ3B 2R93A 2ZK7A 3NHLA 1H8HD 2CK3D 2APJA 3JALB 5AVRA 1NVBA 4ZI2A 1YQWA 5ALQA 3JQGA 3KB8A 1KK2A 4KO1S 4MUMA 2SKCA 2FPUA 2JK1A 4B6PA 3D7NA 1SD2A 2AOUB 3MLAA 2WBLC 1PJ3A 4R40A 4CZ2A 4YRGA 2QJRA 1KOLA 4JENA 2VK4A 3GIIA 4OQYA 3UQ8A 2O03A 4RL4A 4OB8A 3K1TA 3TL3A 2W2OA 4FMCF 1YMQA 1N1GA 1ZMRA 1FFSA 3F97A 1CKEA 3EZ7A 5LU8A 4ND1A 1KBOA 1QVZA 1ZU4A 4FS8A 4UREA 1CVRA 2J3IA 1PT7A 3ZTYA 3D0RA 3M3DA 2G25A 3JYOA 3LBYA 5K8TA 5C8YB 1EKVA 3W2EA 1A9XA 2F3QA 3KZOA 4NNJA 16PKA 4RHXA 2VNJA 4LDRA 5HR5A 1SB9A 3KHUA 1XZMA 4Q0YA 2IEAA 1E96A 2ZWVA 5ALJA 3RTDA 2JJ2A 3MSXA 1NOJA 1Y9DA 4K6HA 4JI4H 4PQFA 1K7YA 2PWAA 1THMA 2X5RA 3GTPA 1W1UA 1TWHA 2QAIA 3G79A 5DXJA 1KI2A 2XUJA 3DBLA 5FBZA 4V24A 4BXXG 2NAPA 2MYPA 1JLLB 1GQYA 2FE1A 3KOUA 4KQHA 1O6BA 3OWXA 3ED1A 4OKIA 3RIEA 5BN3B 3ASZA 2EJUA 4MV4A 5GONA 5K0FA 1AHHA 3NJ8A 4Y1GA 4DLYA 4QIWA 2WU0A 3CE9A 3LBHA 1X1DA 1E3IA 4G0QA 1MKYA 4BJ1A 2D5CA 1Q0RA 5CA0A 4N82A 3BOSA 5EDWA 1CJCA 4O2AB 2EERA 2Z9BA 1KR2A 1NF9A 3GUVA 3GWGA 2X1HA 4ZEVA 1Z68A 3WIOA 1GPBA 1TGVA 4KTTE 1FQJA 1V6CA 4HDSB 1SQGA 5A4MS 3VGJA 3AUAA 4WINA 3BIXA 1UFKA 3BACA 3UPDA 5DBIA 3UKOA 3SEZA 1SOAA 4GSKA 2D2FA 2C22A 3Q2KA 1IEQA 2QTCA 4LMYA 4OK5A 2G04A 4JLKA 5IAKA 1K06A 2P69A 3N28A 5L3VA 1TOAA 2AG6A 2RD2A 4LXIA 2YUTA 2E3JA 1G2IA 1WHTB 5I8PA 1MUUA 5IG2A 4Q4JA 1CTQA 4URXR 2IY8A 1S5PA 2AQKA 2CUZA 3RS3A 2E5LH 3FYDA 1BVUA 3A9CA 3H5VA 2JIOA 3I5YA 2FH5B 3NGDA 3LDHA 3QE3A 4KRGA 3ZLUA 5JU6A 4J9PA 1V5EA 2Q4OA 4FINA 3IT2A 4AZVA 4LA4A 1GR0A 3ZCTA 4J6FA 1LTHR 2A8YA 3CM0A 4G8CA 2QRVB 2WP0A 1YVUA 1V1JA 1KWGA 4Q02A 2ALJA 2V59A 3GDGA 4LCEA 1R00A 3IDFA 5IS2A 1QHFA 1JA9A 3J81A 4LE1A 3LMLA 1P0IA 3WYAA 3KZCA 3F6EX 3KJZA 3JQQA 3AGPA 1CFZA 2N46A 5JFTA 5IT9W 1GUAA 4MNTA 4FDLA 2NSYA 4DLZA 3HKCA 4BCBA 2R8KA 4JSYA 4Y6GB 1XCOA 5K1ZA 3F6BX 3BRWD 3IO3A 4WACA 2O3JA 1N6RA 3S55A 5A4FS 1SQ0A 4WESA 2COKA 3A26A 3OQIA 5BRAA 1XJ0A 3MB8A 4G8BA 1J70A 1JR4A 2V6BA 3TTYA 3EUEA 1GP2A 1N6NA 1RXSA 3UATA 2KBEA 4PZEA 3GLUA 3Q7PA 4PZAA 4LJLA 2JGAA 3KCQA 1GY8A 1OFTA 1MB0A 4AXXA 4ETWA 3MTEA 2MSCB 2R8JA 5JADA 1KDZA 2IYLD 4KCGA 2GBCA 2JL1A 4PN3A 4HSGA 5EUQB 1YJQA 1QQTA 2VUSA 3Q7RA 4L4SA 5MN6A 1W73A 4BB6A 5DSZA 4G89A 5SV2A 4X63A 2HK6A 3AHEA 1I01A 1LLUA 2FSHA 2HN9A 3WRYC 3OIUA 2PD6A 3GAZA 1I4LD 2D4AA 5KPJA 5B6PA 1TGYA 4OATA 5CIYA 5I7HA 1G8AA 3J7AC 4IDFA 3NLLA 2F8MA 4L3VA 2AVNA 4ZT6A 2H51A 3GV5B 3P9RA 4KV7A 3CRW1 2Y1DA 4FE7A 5CCXA 1BW9A 3GUZA 4FFBA 3VR5A 3IJ5A 2JLXA 5LN1A 1JXLA 3PEYA 4C4AA 4M3NA 4MWZA 2A5GA 3R24A 4QDJA 3H5RA 4N3CA 2XWJI 1QYDA 1EUZA 1F20A 2Z5VA 5AI8A 2LCFA 2M6LA 4TZ0A 1N5LA 3SOPA 2JBAB 1JDZA 3NC4A 3VSCA 3FOBA 1CB0A 3NCTA 2V55B 4E88A 1XTKA 3LGXA 4BZQA 1ECCA 2B1QA 5KMGB 1AQIA 1W0JA 1WNFA 1XDBA 3IT3A 1QZ3A 4AS3A 3TZKA 1XHFA 1CUUA 2QYTA 1BDIA 1N8TA 5KAMA 2R6ZA 3OJOA 5LYYA 3I6MA 4TWIA 1XVVA 4LIPD 1C3XA 2QL5A 1QIEA 2QVBA 3BDVA 3V33A 4A6PA 4KPGA 4EJFA 2D62A 3G2OA 2MOKA 1IK6A 4C4XA 2PGOA 4LFCB 2D0OB 2A4KA 2ZPAA 3L43A 5LMZA 4CLXA 2YNMA 1UFRA 3FYCA 5M34A 3KB2A 3K5IA 4PCAA 1EBFA 5B37A 2C4HA 3G9QA 4QU9A 1Q1AA 3WQHA 2QEQA 3FFAA 2VNHA 4EEZA 5DIFA 3ELUA 4QULA 3TDNA 3T3PB 4L1KA 4MKZA 3PUIA 4NBRA 3CLKA 4BPBA 4XCXA 4FWTA 1GARA 3IE0A 4DJDC 4JLBA 3GQBA 3I5MA 4UFNA 4Z7NB 1IZ8A 5T8KC 3QH4A 5E4TA 4M9UA 3D3WA 1HZZA 1JXAA 3ICQB 3NNNA 2P9BA 2WB1A 2C2DA 1ZLXA 4ROTA 4D4JA 4JC4A 1SXJE 2WYOA 3I12A 4L5BA 1NF2A 2IPNA 3N2LA 3U4AA 5IX8A 1ZMOA 3DFIA 1BVYF 5AVYA 1PN3A 5FWXB 4NATA 1LSUA 4ZJZA 2VA2A 5MF6A 2IBMA 3MWGA 3NBZC 1O8BA 3IQFA 5HTKA 1HT2E 4RY9A 2ZB2A 2O2ZA 1NQ5A 4NS1A 3DO6A 4PRZA 3AR4A 4CG0A 4EUKA 3ODGA 4TV8B 5AOAA 1XTJA 4C04A 3JQEA 2H8GA 4PW0A 3KUCA 4QHSA 2EFJA 4P4TA 4OHVA 2HA3A 3HABA 3AIMA 1CRLA 3L18A 4FYWA 1G5IA 4AO6A 3W1VA 5FWNA 1JX4A 3H17A 1KAOA 3IJPA 3DHVA 3G0GA 1QAOA 4BVGA 1NRXA 3X43A 2ODWA 521PA 1K8QA 4IF4A 5GOTA 3Q9UA 4M0PA 4GLLA 5HA5A 4F5DA 3D8NA 4OLBA 1DJQA 2TS1A 4C30A 2PRZA 1NONA 2XB2A 3L5KA 3L41A 3KNZA 4NDAA 3V4OA 3FPGA 3BQNB 5IJ9B 2IYAA 3U39A 1LNSA 3C6KA 5AHWA 5FBWB 2NO0A 4OUKX 1GDTA 3LHFA 4DAAA 4HF7A 3JYHA 5JWRA 3RE1A 3ZHQA 3H8JA 4QJ4A 4ZCMA 1Q95A 2V6FA 4M1QA 3BGSA 2GEJA 3IO5A 4H4EA 2WDTA 4MYUA 4P4LA 5FUWA 2YBEA 1ZJ6A 8ATCA 2IYRA 3LL7A 4YR0A 2X8LA 2B99A 4HX5A 2DPXA 3AI1A 2CEAA 3CUKA 3CUTA 1B42A 1H2YA 1CSEE 2J59A 1JDEA 1DLIA 2F3SA 2UUCH 3DTYA 4BMPB 3CH7A 3N58A 2IF2A 1JHUA 1E5DA 3WBBA 3WRWA 2WIKA 3T7KA 2GVZC 3FPEA 1YS2X 1O6ZA 5FIUA 1FDVA 2JNWA 2V45A 4ENPA 5IT0A 2C4NA 5HCNA 1XDNA 2GZ1A 4RGVA 4US0R 5KNBH 1Q15A 3LU1A 5B7QA 3EIWA 4S04A 1DTSA 4TKUB 4PAQA 1Q3TA 4JHXA 4WFQA 3JR7A 2DX7A 2UUAH 1ZISA 3ZI7A 1I51A 3TE7A 3KQSA 3R75A 3AEKB 1ONOA 4U63A 3HACA 3MB5A 4XJTA 3LY8A 4HPXB 4BKMA 2BJWA 5BSWA 4MV1A 4Q9NA 1JFLA 3N8KA 3ONVA 2X8WA 1GHTA 2BHTA 4S1NA 3DZFA 2H9YA 3NU1A 2A14A 2ZUBA 2GXAA 1FK8A 3NWEA 1SUPA 2IZOA 1MDBA 3O3NB 1P73A 3NM4A 1XZLA 1E0SA 5CVTA 2QRMA 2RGYA 4ZFNA 2W6PA 1ECLA 4F84A 2WJ6A 5J23A 1N0IA 1I0IA 1GNTA 4DXHA 1R6XA 4N7MA 1E63A 2V7QD 3UBMA 1TTQB 3HO6A 1ZSVA 1A7UA 3WGGA 5E7MA 1AG9A 2PMDA 3SDZA 1N56A 4E5UA 1YZVA 1G5PA 2DTXA 2PZJA 3KU1A 4P35A 5KO2A 4ZJPA 1FBTA 1JHOA 2BM1A 4N65A 1MGPA 4HLUA 3QPBA 3I01M 1E9AA 3TW8A 4PFKA 1V37A 3VSBA 4MCAA 2I87A 2JATA 2DBZA 2ZUCA 3SM3A 4JVSB 2CZGA 1J2JA 3H2GA 4CEJA 3V2IA 3UHPA 2WHYA 4XQCA 5HDQA 3TK1A 4YAIA 4B4KA 1G2WA 3AP3A 3TKAA 1GPH1 4I4TF 2XHZA 3AESB 3B7WA 1L6RA 2KBFA 1QC5B 1BVRA 1V16A 4KE9A 2C5EA 4U3JB 2DAPA 2PU5A 3BN3A 3HLYA 1XQWA 2CXRA 3RVDA 4ER3A 3U7HB 3IXMA 4D43A 3KB6A 3K94A 4RK0A 4BDSA 4BFTA 2Z9CA 1NFQA 1B14A 1KEPA 5F51A 5HFJA 1EP9A 4HZUB 2AW3A 3SYLA 4D9JA 3AUTA 4N9WA 4JEHA 1ECPA 2Y99A 3PJDA 3D2AA 3NH6A 1PT5A 1UT5A 3UJDA 1RWQA 5LCXA 1OHHD 2GF0A 2WFLB 3ROQA 2VDVE 5LQAA 3AH8A 1ODKA 5DI3B 4GSYA 3UWKA 1P0MA 3GRRA 4GR4A 3DKVA 1TE2A 3GIPA 3FSGA 2HNBA 4LFAB 4BWFB 1QJ4A 3NHSA 4EKIA 3FTNA 1PVOA 1TQDA 3BK7A 3FKSD 5BR7A 3H19A 1AS0A 2FZWA 1QNFA 1T8UA 2QT1A 3VPCA 3H4IA 2V5VA 5CFQA 3CF4G 1MABB 1CR1A 2QPAA 1BWQA 4Q9HA 1O97C 3C0KA 2ZOSA 1FQOA 4IGAA 3WIUA 5CYGA 2H4XA 4F3RA 3AIIA 5B1SA 3UNXA 3TX6A 4INJA 2B6NA 5IWCA 3LKDA 4H1TA 4D7AA 1IU9A 4JODA 4UM9B 4MYRA 1RBMA 5EWLB 2ISCA 2P4HX 2PY6A 4TMKA 4EB0A 3EXAA 1NQOA 5DYIA 2DUWA 4Q4HA 3S99A 1JBEA 1XNGA 3DTGA 4CMHA 3G5LA 5HIMA 3RT1A 2DLDA 4QREA 4BZXA 4EDHA 1NXQA 4YDRA 2PYDA 2BJHA 5KFEA 3H16A 1XZHA 4P31A 3RC3A 5FEUA 4U9UA 3VDXA 4JNCA 4PLHA 3QA3E 2CMKA 4R7TA 3FYUA 3B9PA 4U7CA 4BY7G 5L3QB 2IUYA 1TU4A 4TL9A 2H92A 4E11A 3N40P 1E5LA 1C30A 1INLA 3FUWA 4LHEA 4H60A 3N59A 3AXSA 4QRHA 4HDMB 2QJFA 2HHAA 3HJGA 3UYYA 1N32B 5CX1A 1PEAA 2V7BA 3NBXX 3BMQA 2QTTA 3HBAA 5ALYA 1JFFB 1FX0B 1GA4A 1KO8A 5EJIA 5HKLA 2CBGA 1DAAA 4WLUA 4NLGA 5KWSA 2EHJA 3GNQA 4X92A 5IHXA 1F8YA 3V1TC 3E53A 3GEEA 2GM4A 1Z6GA 1ONNA 5D6OA 1N2XA 1V9PA 4E2XA 5IDQA 4QYTA 2VJBA 3UMVA 2A57A 4LWPA 4D02A 1OFGA 1DQYA 4O3NA 5DTIA 5GONF 5BV7A 3OLXA 1FW6A 5B3KA 3R3ZA 4DGSA 4M21A 2XCRB 2JKZA 4UVHA 4LGYA 1YZNA 2RHMA 1U2RA 4FR2A 5JS8A 2EJ0A 3VPHA 4OQMA 4MVJE 1ZP6A 2PPLA 2ZIXA 5IEJA 3OM1A 3GRFA 3IE2A 2HQ1A 1GU7A 2J3DA 2WU8A 3WWDA 4DV6B 2BFNA 1ZPDA 1FYVA 4PFJA 2BRUC 1VLMA 2X5XA 3KLNA 2NSJA 4BNLA 2P2YA 2Q1UA 2GJAA 1J8YF 1XNQB 3F6CA 1HKUA 1IEVA 3R0XA 1ID1A 3HYRA 4EY6A 2QX6A 1L5NA 1WCXA 3B9RA 1Q7RA 1L2TA 4GMKA 3K9NA 2OCPA 4EGAA 4DR4H 4WHMA 2GJSA 3JARB 3GDWA 1E6LA 1BE6A 1L7VC 3VTKA 1F9AA 2JGIA 2LIPA 2XVZA 3UCEA 1DJOA 5AR1A 2PM8A 3ID6C 1P6UA 1XTUA 3AC0A 1C7IA 1WKBA 1Y3DE 1D9XA 3I8XA 1TCCA 2HHHH 3UJHA 2JBHA 4O4LA 3K0KA 3HKEA 4YR7A 4GD3Q 4I4LA 1OX4B 2X9QA 4ILKA 4UDYX 4MQEB 1SGWA 2ZXFA 4DCJA 2ZEJA 4Q1BA 3ORQA 4XVUA 4IJ6A 2HLPA 1U8CB 5K01A 2EP8A 1FFDA 4B7AA 4RTPA 3ZXSA 4ZZIA 1XZCA 1V3TA 1WQ3A 2JCBA 4O25A 2F62A 1YB1A 5EP4A 5DM0A 4XGIA 4TVIA 1IVSA 5IZCA 5TJHA 1Z6ZA 1GGEA 1JEQA 1ZKMA 1N9KA 1EGHA 2O23A 5IM4A 1NATA 4PTZA 3BIFA 2QAGC 1VJDA 5AI5A 2Y0PA 4IXWA 3IAS1 4XA8A 4YJGA 4G0XA 3NBYB 3PWTA 5JDCA 1JZQA 1F2UB 1GM5A 2E5WA 2HMWA 2WZCA 1KFBB 1SVWA 4PQEA 2CLHB 1EXDA 2HRRA 4LDJA 1FVIA 5BSHA 5HXAA 3TZBA 2VRCA 4DS3A 3DZJA 5F2KA 3DWFA 4DUZB 4B3XA 5TMEA 1LQUA 3UH1A 2VAWA 2OV2A 3AY3A 2XGOA 3OEHD 5IAJA 4CF6A 1DELA 1ZXLA 1LWOA 1I5EA 2HHJA 3PFCA 3QKSA 3RFXA 3N2NA 3ZU3A 5LSAA 3K5PA 3EA4A 3IOEA 1C8LA 2ZJ7A 4C07A 1EK1A 4RXUA 4LGVA 2WJ3A 1KTIA 1DG3A 2FP4B 3D7KA 1A8QA 4LHXA 2BT4A 1U31A 2AFHE 5I7WA 3HRHA 4IEFB 5EWEA 4A0GA 3LQ4A 1I1OA 5DP2A 2Q0QA 5EKUA 3HWWA 3QY0A 4IWXA 3DO5A 3WHIA 6AT1A 2GNPA 4QEDA 3ZWKA 2YJTD 3KTMA 4MUBA 4EMBA 1Z4LA 1DAOA 3V7WA 1UWCA 1F9EA 4N3BA 1L5WA 5G2OA 3WVNA 3FKQA 2DLCX 3A6ZA 2QN7A 4N0MA 4EFMA 2J0UB 5ULLA 3FAKA 4YJDA 2G7MC 3NWJA 3OEED 3OHAA 2VHCA 3AKEA 2WJPA 3T5GA 2W4QA 4KXYA 3E82A 4EW6A 4IAJA 4Q7EA 4QYXA 2R7AA 5EMLA 4F2PA 4M7OA 1XZPA 1D2HA 5EC8A 4JV2A 1WKCA 3EE6A 3HWRA 3GYBA 3GNLA 4EHDA 5JH7A 3M4ZA 4TQAA 3L0CA 4NFSA 2PNFA 4BLUA 5AVKA 1U2DC 3LF2A 5D3MB 1T2EA 1DTWB 4P4NA 1KT8A 1MTOA 5AM4A 1OXXK 3G8BA 4AQYB 1W9MA 2HHCA 2HA0A 1U8UA 2XGMA 1TUGA 4RM3A 1AK9A 2WIAA 3QKIA 3KTOA 2XRZA 1J07A 4CQLA 2OV4A 4HGRA 2P9YA 5JXHA 1OVMA 1V47A 2I4LA 2KM1A 1OFVA 2MINA 5IFLA 4JUDX 4LJKA 1PWZA 4O1MA 2WD8A 3R5JA 3YASA 3VTZA 3VUFA 2VXBA 1SUIA 1W4CA 1XQYA 3G1UA 3A9WA 4EECA 4TZ6A 2HFJA 3P0EA 1PW7A 4KGDA 4LMBA 4JP3A 4MUNA 4HQKA 3SDBA 2QUAA 1B6RA 2AXQA 4RTJA 5EUMA 3QWIA 4YMTA 1T4CB 1U7PA 3W9UA 3A2LA 2LWIA 1E1QA 5FPPA 4BFXA 3OFKA 4ECQA 3AZOA 1MDFA 4M38A 4GZ6A 2CHQA 2DQKA 4ZT5A 5F76A 2P4SA 3FVRA 2F3TA 4V38A 4OHZA 1QRAA 1QHSA 3QENA 1L5FA 5JPCA 1W36B 1UP7A 5EPOA 2CFOA 1J22A 3G2KA 5IDVA 4TRRA 1VSTA 1AZTA 2COGA 4DYHA 2O8FA 4EVSA 2B9VA 1OGIA 1ZGBA 2X8BA 2QI9F 2CHFA 5FULA 3ZIDA 1JECA 721PA 3OOHA 4L72A 5C5EA 1IJFA 2I1QA 4IEIA 4FS1A 4H3SA 1E6UA 5AVUA 1D6SA 1V25A 4JI0H 1TPZA 2R79A 1HUQA 3N6VA 2J9FB 3JVIA 3W8EA 5EINA 3D6FA 1OOEA 3ZD8A 2W6OA 3GT4A 1JJFA 4KEAA 4IWYA 2Y8EA 3GXBA 2NPOA 1FNMA 2NO6A 5KOJA 2XOXA 5JD6A 3V4SA 4Q6BA 2A5JA 1PGPA 5ITWA 2L18A 3ICWA 4Q1VA 4Z4QA 4D96A 5EOYA 1XEFA 4GBJA 4WA8A 3MXTA 3QVTA 4RTSA 3R7WB 4P2GA 1P5HA 1YD7A 2HF8A 2JFUA 2XVYA 2EOAA 4GKJB 1ZITA 2OBYA 1J1IA 2YQ5A 2BEKA 3MINB 1PG2A 1K8XB 1V7ZA 3HMQA 1HG1A 2XMCA 4OLFA 1BX0A 3HOZG 3K0AA 5JCXA 2HW8A 4MYHA 4XDHA 4QLBA 1JMYA 4PAGA 4UM5A 1TF7A 1XZJA 5I9LA 3QG5A 1Z6YA 4A15A 3TI7A 4JV5H 4COKA 3FMFA 1OH8A 1L1EA 1NUTA 3CQZA 2JJ2D 2VTVA 5F2EA 2P4QA 4ECSA 1U5BB 2XW6A 4JV5B 2JCSA 4ONEA 4LXXA 3QNUA 1NUAA 3IKTA 8MHTA 4RKWA 3MJTA 5CB4A 1EP2B 4LYAA 1ANKA 1D1SA 1S97A 5KG4A 4E1AA 2QGNA 1ZNQO 2IY7A 4OY3A 2HMVA 1ENPA 3KX2A 1M8KA 1L3IA 3URKA 1E4GT 5I01A 2IW3A 3Q0IA 2QLNA 3VPBA 5JD4A 1XU4A 4JI8H 3G59A 4DDHA 2JB9A 3RODA 3GC6A 1SU8A 3B6JA 5FUQA 3GJXB 3R9XB 1IDN1 3VKFA 3W5HA 3NM6B 4JI8B 2ZT8A 3UFXA 2VDKB 2YYSA 5FF9A 3AI7A 1NV9A 3CPHA 1QG0A 4BVKA 3OZCA 3WR5A 1WZEA 3EUFA 3V1KA 5K0CA 2ORWA 2JJYA 1P7PA 3W05A 1BEZA 4YX9A 2J0EA 1YFJA 4CLEA 3PZRA 1B8NA 3PSAA 5ALUA 1MH9A 2E55A 1GTRA 3LRPA 1T10A 4YIKA 4FNMA 4YDSA 2XDYA 2C7QA 2HT6A 1Y1WG 3KEFA 5SY4A 2WDZA 4RAQA 1RHUA 3CXUA 5KWJA 2QQGA 1DIAA 3B6ZA 3PQDA 1J0EA 2SCUA 1N8SA 2CJWB 4UUMA 2Q49A 4EMTA 2UZ1B 1OXSC 5CLGA 3SX4A 1CUGA 2ON6A 2XEXA 4NYEA 3EXEA 3WSTA 1Q83A 4IOMA 4RHYA 3UAVA 4RS3A 4ZHSA 2J45A 3OPYA 3EYYA 3D54D 1N2IA 1PEKE 4LZWA 5BWXA 3W5SA 4MW6A 4IR1A 2VT7A 2BGRA 3L1VA 1OI3A 4XFDA 5LYJA 5IVPA 2Q45A 2P62A 4RHUA 4CIBA 1FFCA 1X0VA 3UM9A 2ZE5A 4M0CA 2ID8A 1BU5A 1HE2A 4G0NA 1X77A 3OPQA 2CLFB 1WB6A 4I4NA 5KS2A 1GUYA 4B4VA 1JLKA 1E18A 1ZD3A 1S9DA 4LZJA 3TLEA 2GPNA 3ZNQA 3TZLA 1KYVA 5LNK6 3TDMA 3QUTA 1U9CA 2YV1A 4EA7A 5IF3A 1U0JA 1Q0TA 2Y1OA 1WR2A 3PE4A 5EUCA 4FGLA 1KWKA 4NYJQ 4MGZR 1Q14A 2FLPA 3OP4A 3IILA 3U7RA 2FPKA 1LS6A 3ZU2A 2XOEA 2EJTA 2IIVA 3RCBA 2FYTA 3KSBC 1J8FA 1OJLA 4B3BA 1C9MA 1ZJYA 2ACEA 2PZ8A 3S8EA 4G5SA 3GOQA 1CS4C 2I7CA 6YASA 1E2IA 1TO6A 4B7CA 5H4GA 4W4TA 2XUKA 3V8EA 3FPCA 2YY7A 4D3FA 4P0QB 1L9XA 1H1LB 4E30A 3N3BC 5CEFA 2ERYA 4X97A 4BPRA 3DMTA 4RF2A 2B1IA 4MP6A 3BT7A 3AM4A 4M0DA 2GD0A 3MW8A 3OOJA 4M1TA 1DBQA 1KQGA 1VIVA 5BQ3A 5FLKA 3UOWA 5K3DA 3CFYA 4QVGA 1JIJA 1C5KA 2JFYA 3JYQA 2CNOA 4IR9A 2OG2A 3DT9A 4R6XA 1A5BB 3EBOA 2C5AA 5BRNA 3PNOA 1T9DA 5JZSA 2JEJA 4G67A 4OQZA 1ORHA 4DJAA 4HPWA 4UULA 1L7BA 1X8LA 5K8UA 1YR7A 3VR5D 1J2EA 1RBZA 1WVGA 2IDZA 5CG2A 3NUZA 2B8TA 2VTBB 3B7PA 3CJQA 4MQFA 4CIYA 4QU8A 4KQ1A 4UZSA 2FDCA 3G0OA 4P98A 1PZNA 2O05A 1K66A 2Z02A 3BWBA 1RRGA 2R62A 4IRMA 3KAJA 5HS4A 4BQSA 5HF5A 3DDZX 3E1KA 2VXOA 4FU0A 1W0JD 4KK3A 1LFAA 3LSTA 2VP3A 4R69A 1TB4A 1UZAA 1QV7A 5LLSA 3GLFA 2RB5A 5U4QA 3RAGA 1DVRA 2AN1A 1QHHB 5DLEA 3T1TA 1YRBA 4CV0A 1UMBA 3M83A 2FLVA 3EH1A 3PDIB 1IUNA 1P7CA 4IJMA 3RVLA 3GJQA 1GIAA 4GF5A 4JVMA 4BV3A 3EHDA 2FY8A 1JAHA 1WV1A 4I3HA 1F3OA 3OCXA 2YNMD 4BVFA 3GZ4A 4E2FA 4WCDA 4X1IA 1QP7A 2OCBA 4UASA 2NO1A 3VZRA 7YASA 4X60A 3OI7A 2FCRA 1JVNA 3N0TA 4RAZA 2C0QA 2DF8A 4HOYA 3ITEA 4R1TA 3Q8MA 1OLUA 4CXMA 2O5CA 3RUDA 1U2PA 1PFKA 2EX4A 3BL6A 4M88A 3N5KA 1TMOA 3CO5A 3RU9A 4NXNB 1XU7A 3OFVA 1G1MA 4QUDA 3WG9A 4IILA 3H0CA 1WUHS 2IT1A 4RJTA 2PG3A 4N5LA 4S2EA 4XD2A 1K6MA 4ZQCB 4LNUB 5J2TF 4I66A 1G5RA 2DOKA 3EN0A 3RT7A 4BRZA 4I1RA 2PH7A 5AOCA 3VM6A 3G0CA 1UFVA 5EWMA 4I6JA 2N0SA 3QMPA 3UH0A 1IHDA 1NMEA 3PEEA 2ZRBA 1Z0JA 4LDPA 3HVJA 1XQ9A 2MR6A 2W9BB 3ZWYA 3GLIB 1IY0A 4PZPA 2RGDA 1HE8B 2WKQA 2YJGA 4TV9F 5EHIA 5HJ2A 3NJ4A 3FFBA 4DMHA 1XTQA 1WQ4A 2QZ9A 4YR9A 3KKLA 4RHFA 4LOKA 1FX1A 2Q0SA 3VHRA 1LDYA 1E0AA 2UVUA 3ETGA 3QOYA 3T0FA 4KO8A 3JVEA 2BCGY 2O8CB 1CWUA 3S27A 4UEWA 1GXSB 2J46A 4QWEA 5FLXA 2FPPA 3EDCA 4M98A 1QLJA 8ABPA 4F4CA 5BYAA 3FRIA 2F43B 3PEFA 2AWOA 2KMLA 3ESAA 3WS7A 1ZO8A 1WZIA 3L7IA 4IR7A 3L0ZA 1NE7A 3RUCA 5F2OA 5ICEA 1JHZA 4ZJUA 2FZVA 2PDAA 2Z9DA 1NM5A 4UTVA 4F4WA 4N54A 5COBA 3BCUA 3SK0A 4BO5A 2MCFA 1PZHA 5BV8A 2XI4A 1ZR4A 5D51S 2OUKA 4IHJB 3EPLA 3TSOA 1PJBA 1Y33E 2HGSA 1BE1A 2YHSA 3ETEA 2VSYA 4JBNA 3M6LA 4OBWA 4TGLA 2GK3A 1SBYA 1JQ3A 5J4VA 3BABA 2XE6A 5CT6A 5CR5A 1JIHA 5CD9A 1O4WA 3TG8A 5D1OB 2WR8A 3PD7A 1Z45A 3AYZB 5AVVA 1NURA 3TGWA 3HJFA 4U2FA 2JEFA 1DX6A 3VOSA 3MMNA 3ROFA 2H1IA 2UKDA 1Y4SA 1DCTA 1SC9A 4RS4A 1WEHA 4PHGA 2GAOA 4YACA 4GUDA 4UE2A 4WDQA 4L4XA 4R31A 1KBQA 3FTFA 3O0TA 5F2NA 5KJCA 4HY3A 1SBZA 1FFAA 2B8WA 5E9AA 1X92A 4RVHA 4W5QA 4P82A 2V4QA 4RH1A 4AUEA 4UPDA 1A2BA 4FT2A 3CLUD 2E2IA 1AXRA 5E8RA 1A04A 5M29A 3DE4X 1UC8A 3BCHA 4N6NA 4I1VA 4MX8A 4XSGA 1I36A 1DG1G 2P4UA 2GFQA 4PO9A 1J00A 3NWPA 4D8TA 3OTWA 4NBWA 4BYMA 2B2XA 3MOIA 4KYTA 3DZBA 4QELA 1HORA 5AW6A 1REQA 1SXJB 4DARA 4YRAA 3TR5A 4TS3A 5IUNC 1H05A 1M54A 3VKVA 3FYHA 4O7RA 3KKEA 1U3UA 3FKIA 2OWDA 3HA3A 4D0GA 4RLSA 1LPMA 3L82B 5EWJB 2ST1A 4DM3A 3CVOA 2VA8A 4MQMA 2A1UA 4F12A 1UPCA 3T34A 1WXIA 2GWHA 1A9YA 5C3MA 4QQRA 4BB0A 1UZLA 4QEZA 1CE8A 3C6QA 2QLFA 4UTNA 3EGIA 3WGVA 5LP6F 4CMFA 4O3PA 1ULAA 3B6KA 2NU9A 4JBYA 2IXDA 4QDKA 1QAQA 1M5RA 2J5XA 1GZUA 2HIMA 1PUIA 1EK0A 1AZWA 3TLBA 1RMQA 1S89A 3ZE0B 4IIXA 3HRKA 1CUAA 2GMWA 1R0YA 3O9ZA 5I5VA 1E3SA 2YJNA 3AONB 4TSKA 1Q1BA 5I5WA 3P94A 2OSBA 2NTYC 5JTTA 4RDHA 2VSOA 1JFSA 4BYGA 2ZYRA 1K5GA 3AOEC 4JT9A 3K9CA 1KAHA 4MDHA 3FBGA 1C41A 3ITKA 5JQGB 3HRIA 1DJNA 4D6XA 1U6IA 2Q3JA 1HOTA 2X2EA 3GRVA 3FXAA 3SEQA 4E2WA 5LOVA 1F5NA 3EGXA 3MGKA 5JY6A 2WF9A 3OJ0A 3NI2A 1QIDA 2QD4A 1PX0A 2H1WA 1A8PA 3I42A 4RULA 1MENA 5TQ2B 4JIMA 4AP9A 1K4MA 2MSWA 5ALVA 2QT9A 1CZLA 4IY1A 2IYXA 1UXHA 3L7DA 2QENA 3UCXA 2WD9A 4YBZA 4BCCA 3WKCA 1NT4A 3S44A 3X2FA 2XCIA 1TM4E 2WA2A 2I7XA 1DTEA 3KQMA 3BAZA 1XFDA 3ZW8A 5EL0A 4PC1A 3FSGD 3HCFA 1RJDA 2PRSA 3SKXA 3ES9A 2QTHA 4Y6QA 4BJ3A 3R41A 5FXMA 4QG3A 3BHJA 4A1FA 2ZLBA 2N42A 2ZVJA 1XRRA 1Q44A 4ZQIA 3D3QA 1VPVA 2WYVA 3J7TA 1COZA 1GOTA 4EY8A 2RB4A 1UM9A 5EE3A 1OBVA 2IMWP 3BL5A 2WJZB 2YBDA 1RQPA 4DR6B 1J5XA 2DXIA 1DMRA 2FPGA 1UBFA 4KQJA 2A5DA 2P5YA 1GT6A 3P9PA 1HR0H 5BUZA 5BO5A 1ZM2A 3QYAA 2CYAA 3KKZA 3SQNA 1V5WA 5DEIA 2JI6A 2YRXA 5ALPA 1HR0B 2YL2A 5IK2A 1GU0A 1WW2A 1WRBA 4LOIA 5EJFA 1Y81A 1NPDA 4LHZA 1EXVA 3I2FA 2AOVA 1H2RS 1LDNA 3KK0A 4A3MG 3RS7A 3QVWA 1A3GA 3H4MA 3FVWA 4ICIA 2C94A 1J1UA 1F5SA 1LTKA 1VPLA 3SSAA 3VAAA 5LQRA 4OSEA 3FHOA 3BQ0A 3OZUA 1PS9A 5FNVB 3ZZUA 2WIDA 4NCNA 1YNOA 4IPTA 5FAKA 4I1PA 3CB4A 2GHRA 1JVBA 3ESDA 1W34A 2E4ZA 1V26A 1H2FA 1MAVA 3MTGA 4MLZA 4XCVA 1O94C 2RGNA 2YVAA 3CLSD 1I2MA 3ZWOA 4RJKA 5KFUA 1JH9A 4MCHA 1UBTS 1C3OB 4MVJM 2G5TA 4F2HA 4W7HA 4JP2A 4MS1A 5DYWA 3IQEA 1RLMA 3REGA 4LFCH 4KX5A 1KBZA 3NIWA 4MTDA 5CJPA 2Q3EA 4Q4AA 3AERA 3SI7A 2F90A 4KV9A 3K6SA 5CB4F 3Q8PB 1I6LA 2A2ZA 4ZI7B 4J9OA 4F4IA 1JI3A 4MKHA 5JANA 5FBKA 4AP6A 2GEUA 1PR3A 3JRWA 5D87A 4NKRA 3E2IA 4TTPA 4AVYA 2P6UA 4D4HA 3KOWA 3Q3IA 5IFKA 3WWYA 2R7ZA 3RKSA 3PUJA 4X7MA 4WDRA 1TYCA 3OCUA 4EQZA 2B4AA 3TLXA 3G0BA 3GP5A 1BFDA 2FKLA 3V3KA 1RQGA 2BI8A 3GJ0A 1N2SA 3I6BA 1V95A 1E79A 3VNVA 5C35A 4G8JA 1PVVA 5GINE 1QMPA 1E4EA 2YMLA 2GTHA 1P39A 3DQQA 2JI4A 5DM4A 2WE7A 1T3GA 1EMDA 2X2FA 3OICA 2M1XA 2LDBA 5JYEA 1VSVA 2VQSA 3AEUA 2C03A 2GQRA 2NUAA 5DHUA 1UFQA 2HAEA 3P26A 2ILTA 4BMSA 1L5QA 4N0QA 5EXDA 4A5OA 1JAZA 2W8ZA 4LTNA 1M1YE 1N3IA 3VTAA 2OPHA 1PZMA 3W2HA 1SNYA 4IINA 4JELA 2DTDA 4BRUA 4N7RA 3GARA 2H06A 3TLJA 4LNAA 1VKOA 1ATIA 2YCLA 2V6GA 4HKTA 1FLDA 1RQLA 3U31A 1ZD5A 1CERA 4ZMSA 2OUIA 3F5FA 2JLWA 2C2OA 5FPQA 5FJJA 3RYFA 5F64A 4BAUA 1R0SA 4QQNA 3FLBA 3R74A 1QRSA 2C4VA 5LYJF 1JHMA 5KOHA 2XWPA 1LBIA 4PIVA 2UDPA 3FWZA 4QWAA 1I3KA 2VJOA 1T24A 1RJQA 1WSBA 3HKZA 2R7KA 1AGXA 5G41A 3GFFA 3S2ZA 3KOMA 5BWOA 4LJ9A 4LHWA 5HHTA 1ABFA 3B53X 1N3BA 1MAUA 5FA6A 1W6RA 1QHXA 4UARA 4REMA 4MEBA 1TLLA 1U2ZA 5KT2A 4MA0A 1G2PA 3FE2A 1WXEA 3WYCA 4XASA 1Z5PA 3VSDA 4JI1B 3DB2A 1MAHA 4L9WA 5CVCA 4TTTS 1OPRA 1RR6A 4B6JA 2Y1LA 2ZETA 4B9AA 4F21A 1HA3A 4CDGA 2Z8YM 2E85A 2A67A 3MT0A 1XDGA 2VRCD 3DEKA 3IEPA 3VFDA 2G9QA 1E3TA 4WZBE 1VBNA 2A7XA 3SBDA 4KU4A 3MUNA 2R0QC 4Y6RA 5IEBA 1MEEA 1MRZA 4RB3C 3L02A 4HWSA 2FK2A 4ERXA 3ICVA 2Z2ZA 1DB3A 4AKTA 5KTMA 1V6AA 4Y2JA 4HAUA 2O8DA 2V7GA 4IZHA 2PXHA 1NA5A 3ZBTA 3EGDA 5L1KA 4GKBA 5KFVA 3IEXA 1YQ9A 4EPYA 2R8GA 4NH4A 4S2UA 1OH6A 4CQMA 1EX7A 2AT1A 3QLEA 3R7BA 4PPFA 4AMZA 5CGZA 5P8WA 3SR0A 5DSXA 3BJZA 3EZYA 3PG5A 3UBTA 3S1LA 3A6PC 3H0KA 2GN0A 5LQNA 1B4DA 1E58A 2DWUA 3RKUA 3ROGA 3AVTA 4FHZA 3CZ4A 4TWJA 2I62A 3CR7A 1LVUA 1T3TA 4W1SA 3DB1A 2ZRPA 3JWEA 4FHEA 3PIDA 3I4FA 2FK1A 4PBSA 3H9UA 1G20A 3M8KA 4YPFA 1GKIA 2BE9A 3GFSA 3T5LA 1BXKA 1MTZA 3TAHA 5HQTA 3ELWA 1UODA 3CEMA 1UC4B 1T13A 1CQIA 3RYIA 2EWVA 1MHTA 3RC9A 5DCLA 3EDMA 2VP0A 1XRNA 3GVPA 2ZIEA 1MOZA 3EEQA 1G41A 4YB8B 1QTRA 4QYIB 2RIPA 4YWJA 4AZWA 3KBBA 3AFNA 2AGVA 3MJHA 2QBYA 3DC2A 1M2OB 1UFOA 4KOEC 3B2NA 3I3OA 3BFJA 2WEKA 1TWGA 3ROTA 2YWCA 5I9NA 1ZETA 1EE2A 2GZHA 5AW3A 3FOAA 4OXRA 2EZ8A 5CG1A 3I9OA 2W2MA 2MR5A 4FGJA 1MJFA 1XF9A 2K7FA 2PMEA 4NHOA 4TWRA 4MW4A 1ZA1A 3OZFA 3KFLA 4LPKA 4TQSA 1SCUA 5KNCH 3ZCSA 3UZUA 4E5PA 4JUZA 2WUVA 3V8VA 5CA1A 3PD0A 4YUXA 4DLRA 4G84A 2UVWA 3W8DA 3T7TA 2PFKA 1IQ0A 1IG0A 1U8TA 1TA8A 1XEWX 3W2IA 3TQRA 5SYAA 2FAXA 1M83A 2B4QA 2JD2A 3DS8A 1S3SA 1CUYA 3D4PA 5L45A 3GA0A 5U1PA 1EVJA 4ND8A 3VOBA 5KKAA 1YT5A 1EM8A 1XROA 2Z83A 4ZRMA 4I08A 3ZHUA 5AXCA 4JOQA 4JP8A 2GEDA 4JLPA 4Q12A 1G60A 1LPNA 4NCJA 3KL2A 2YASA 3AHCA 4N3GA 3RSSA 3TPFA 2CYCA 5DI9A 2QUZA 5ALDA 1IRIA 4WCFC 1X8JA 3U1BA 1E2FA 2RGAA 3Q7QA 4PRKA 4YRIA 1A2KC 5DB4A 3B12A 3KYHC 4H6VA 2J3KA 4J3FA 1OVGA 2CLLB 1X9IA 5FPYA 3F71A 1M7GA 4KODA 1DAIA 5AXBA 3PX3A 5I5XA 1EZ4A 1SKBA 4ECVA 4LFAH 1R0KA 4KDCA 2YZMA 4PGFA 3ZN2A 1E2QA 4KXFB 3PDWA 1WO8A 5F1YA 1TMGE 2JLBA 4Q03A 3R3YA 1BCSA 2OV8A 4QNRA 1EEHA 3G0IA 5HUHA 4BO2A 3PKZA 2CNLA 1CUWA 1E5TA 1FU4A 3A2NA 1J25A 3LDUA 4V1CA 3FIJA 1XXHB 4KI7A 4Y7DA 1VZ3A 1KOGA 1DXOA 1A1VA 3NRBA 1CF2O 2C28A 3E0QA 5IYBG 2AFHB 4PG5A 3UV7A 1F48A 1MT3A 4C0XA 3KVNA 1U9ZA 2X42A 4TMWA 5KG7A 1NKSA 2QVGA 1KO1A 2H54A 4EFLA 1JKJB 2ZIGA 2A1TR 3ODPA 2VXYA 1E5VA 3A7DA 3IP3A 4RKFA 2PMCA 2WIBA 1VRCA 2A9JA 3JQPA 3ZZNA 1VB5A