4I50F

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
379
structure length
303
Chain Sequence
b'MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYLAAYNRRREGREGNVWIAKSISSEASELLDFIDEVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSTNHCIQKEYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLADPTSIFIKLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 78
structure length 303
sequence length 379
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4i50F02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4i50F03
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i50F01
3TW6A 2YZNA 3R23A 4HNTA 1B6SA 4MV8A 1BNCA 2W6PA 3MWEA 3R5FA 1KJIA 5C1OA 4ME6A 3LWBA 4I55F 5EZYF 2YWVA 5J2TF 3HO8A 1EYZA 4FFMA 2J9GA 3K5HA 2YYAA 2Z02A 1I7LA 1B6RA 1W93A 4TUYF 2FPPB 1VKZA 4XZ3B 2W6QA 1W96A 1PK8A 3G8DA 2DLNA 2R86A 2CNQA 1Z2PX 4O2AF 1EZ1A 4I4TF 5CA0F 2CNUA 3VMMA 4IZOA 4YB8B 1M6VA 1ULZA 3TINA 3WO1A 1DV2A 4O7LA 3JRWA 5JVLA 3V4SA 1VBGA 2NUAB 3G8CA 2Z04A 3V4ZA 4O7VA 5CB4F 3R9RA 4O81A 2SCUB 2YS6A 4ZOLF 2NU6B 1E4EB 1EHIA 3VPBA 2W71A 4MV1A 4O7TA 5LOVF 1AUXA 1BXRA 2V59A 1GLVA 2VQDA 3NUAA 1KJQA 4YJ3F 2QK4A 4ZHQF 5LYJF 4O4JF 4DLKA 4EGJA 1KBLA 3DF7A 2W6OA 4O4IF 2ZDQA 2W6MA 1IOVA 4MAMA 1C3OA 1GSAA 2FPGB 4IHJF 1Z2NX 3MWDA 1JKJB 4MV3A 2C00A 4MV4A 3GLKA 2R84A 5CA1F 1JDEA 2HJWA 4XX0B 2R7KA 2FPIB 4L1KA 1UC8A 1OBDA 4MV7A 5LXTF 2CQYA 4E4TA 4YAKB 1AUVA 4Y8VB 3N8DA 3TIIA 1E4EA 4HQ6A 1EUDB 3MJFA 4MA0A 3RV4A 3JZIA 3TIGA 1A9XA 2GQRA 1WR2A 3ORQA 1C30A 4C5CA 2CZGA 1PX2A 1GGOA 4TV9F 4HNVA 4DIMA 5C1PA 4XYLB 2GQSA 2OLSA 4MV9A 3VPCA 5BMVF 2DZDA 1KJJA 2R82A 4FFPA 2GPWA 2DWCA 5J2UF 3K5IA 4NYEA 1GSOA 3GIDA 5KKNB 2P0AA 2X0SA 1DIKA 3AX6A 4HNUA 2PVPA 4IWYA 2FB9A 3N6RA 2YZLA 2IP4A 1JLLB 2DIKA 4FFLA 2I87A 3SE7A 2CNVA 2YRXA 4EG0A 3JRXA 2W70A 3LP8A 1GSHA 1JDBB 5JQWA 2NU7B 5C8YF 4FGRA 3U54A 3RUPA 3WNZA 4XYMB 2I80A 1CQJB 2W6NA 5KX5F 3ETHA 1CQIB 5BPFA 2V5AA 5HBRB 5JH7F 4IIJF 3KREA 3I12A 4WD3A 2NU8B 5H80A 4FFNA 3UFXB 2ZDGA 3JZFA 1KC7A 3AW8A 3KAJA 3Q2OA 1M0WA 1CE8A 5JVDF 4O7SA 3HB9A 1Z2OX 1KUTA 5D8DA 4FU0A 2NU9B 2YW2A 3RV3A 1OBGA 2WYOA 5LA6F 4O7NA 4QSHA 3OUUA 4O2BF 2VPQA 4O84A 4ZI7F 2XD4A 2YL2A 2GPSA 2YRWA 4M9UA 3RFCA 3VA7A 3ETJA 4O7ZA 2HGSA 3WO0A 3R5XA 4C5BA 2QF7A 3VOTA 1I7NA 5DMXA 1KJ9A 4MA5A 2YZGA 4WBNF 5LP6F 1KJ8A 3OUZA 4ZQIA 5HV6A 2V58A 4C5AA 3VPDA 2PN1A 3HBLA 3ORRA 4TV8F 1DV1A 2R87A 2R7LA 1A48A 3Q1KA 4I50F 4O7WA 2PBZA 2ZDHA 4RZQA 5K2MA 2GLTA 2R7NA 4EGQA 4HR7A 1M0TA 3KAKA 5GONF 4FFRA 5IYZF 2W6ZA 2FP4B 3TQTA 1CS0A 3U9TA 3R5HA 5I47A 1EUCB 3BG5A 4O7YA 4O7RA 3U55A 4YAJB 3KALA 5FNVF 5JQGF 2YS7A 4O82A 4O4LF 3K3PA 4O4HF 4IWXA 1T36A 4YJ2F 2I8CA 2R7MA 2XCLA 3U9SA 4O86A 1UC9A 2YZMA 4O83A 3E5NA 3QFFA 4MV6A 1SCUB 4FFOA 2R85A 1IOWA 4FE2A 1VBHA 5CAEB 2VR1A 2R6FA 5BPHA 1KEEA 4YBZB
chains in the Genus database with same CATH superfamily
2CVZA 1KPHA 5AP9A 4FZRA 2VJMA 2NVUB 1OBFO 5HQTA 1X9HA 3VVBA 1KVTA 2HK9A 2QD1A 3EVCA 3WSTA 1IYDA 1I01A 1JKXA 4GLXA 4NMXB 3WWDA 3BMQB 1E77A 2FLKA 4RIEA 4ALJA 3WDMA 4ND2A 4MDHA 4WZAE 2WAQE 4RV5A 3EXHA 1Y1WA 4QXRA 4GOLD 3P9NA 3W8FA 2TMDA 4YYEA 1H05A 5F7XA 1KFBB 3SOZA 5ALWA 2GZSA 2FK8A 4PLHA 3LQYA 1F2TB 1O4WA 5AKYA 2VF2A 4GI2A 2R8ZA 1Q83A 5DSTA 3PLAE 1Q12A 1S7GA 5ILQA 2J6UA 3SC2A 4NPAA 4IDFA 4AJ2A 1U2DA 3VGPA 3RD5A 1H2EA 2FVYA 3VTAA 3OT1A 4HMQA 3BQMB 3IOCA 4RHTA 1CVLA 5KFZA 3GTPA 3W5CA 1CKOA 1G2IA 3DNMA 1C4WA 4O4IF 5KG4A 3SQWA 3KV3O 4CQJA 2N1MA 3QKRB 1I5OA 2GA9A 3PC7A 3I83A 1G0NA 4WDRA 1EK6A 3NJ8A 2YH2A 1RI5A 1P16A 2OV1A 4LZJA 1K1SA 4R83A 2DYKA 1EFRA 4GEKA 3DTVB 4YLGA 3EE6A 2R5NA 4ACBA 4DEVA 1GAXA 3IIIA 4TTRA 1BOOA 4N6GA 4D8XA 2B37A 3ND9A 3AFGA 1GD1O 5LQJA 3BIFA 2JGJA 1UAAA 5D86A 3FNGA 3OIFA 3D81A 2AKAB 1QZZA 5GZ6A 2OLSA 4DJEC 3IDFA 5K3OA 1RP7A 2IH4A 2WIDA 3ULKA 1WTAA 3H97A 1V2GA 1LPBB 3L7KA 4HTFA 3UBMA 4J7XA 1PG2A 2B30A 2W2VA 5TLSA 1E5XA 4JIMA 1PFWA 1BEUB 1FFXB 5COAA 2UYGA 3E2IA 2X15A 3RYHB 4RL6A 3B78A 3GTMA 4KLRA 1K9VF 4HLQB 4WECA 1IATA 2IHYA 3CLUD 3CPEA 1T5IA 4UMEA 4FWIB 1DFHA 2R8XA 3ONEA 4JVNA 1NT4A 4JL6A 3U62A 3MYRA 4OHYA 2BZGA 1DKMA 1WOMA 3MOSA 2WJ4A 3EUEA 4YRBA 4TLCA 4D3SA 1Z6XA 4HDRA 2CW7A 4RTQA 1EK5A 1BXGB 3T3IA 2EYUA 4AY5A 4ZI7A 5CU7A 5IRCD 4C7OA 4QREA 3ND8A 3OAAD 3MLAA 3LCVB 2QJTA 3KO8A 5EZQA 4HUTA 1CUDA 5ER9A 3G49A 5KWEA 3R5XA 5E3IA 1NVMB 4LYFA 4CKYA 5JSZB 4LGVA 1MDBA 2YZGA 3V1NA 4FB5A 1C5KA 2DPGA 4YT2A 3IVAA 4QBGB 4QYMA 1O75A 3MHPA 2Y66A 3FPSA 4B47A 3OFNA 4FYPA 1LH0A 3G8AA 3TIXB 2A5YB 3QG1A 4C05A 4EW2A 2XV1A 1PR2A 4QJ3A 2C5SA 1MX5A 3PFIA 1KWGA 1DC7A 3GLFA 1X42A 2EQAA 4H6PA 3FUWA 3NM6B 3JQAD 4MVJH 3T5PA 1XQ6A 4JIGA 1UBKS 1XFDA 2JHPA 5HS4A 3CWQA 3E9QA 2BE7A 4OQPA 3P2YA 2O8DB 1I6MA 4NV0A 1CD5A 1XD8A 1G6HA 2H5EA 4FLMA 3M4NA 2CXQA 2QN7A 3OFSA 5TPWB 4Z4EA 4P2BA 4QO7A 3QPAA 2N47A 1KMHB 3AHIA 5BRJA 4UULA 4JLOA 1LZKA 2RHHA 2NPFA 5GV8A 3KBOA 1BQEA 1HSZA 5C5DA 1JLLA 1H42A 1DEXA 1H66A 2H07A 4G36A 5C8ZA 1XYYA 3QFSA 3C3YA 3T3PB 4BEVA 3BGSA 2D4AA 4XWKA 1K6XA 2MMCA 4KXMA 2XY4A 1VI5A 5K6RA 3R5JA 4B33A 4LOLA 1YI1A 3JARB 3PYLA 3LFTA 1Y9AA 4JYAH 3RRBA 5CXQA 2ZGVA 2G76A 4WHXA 5B6IA 4CCWA 2DM6A 3PC6A 4GM0A 3ZD8A 1PQ4A 3U48A 2ZIXA 2W00A 4KI7A 3GLQA 3O03A 2NO9A 4G23A 3TX6A 3I9FA 1NDQA 2PYDA 5AKIA 1U99A 3TZEA 5EP3A 1ADCA 3ZIUA 2OGZA 3QE0A 3W5UA 2F1HA 5M5BA 2W9AA 4GPAA 1MRSA 4IP0A 2WKQA 1A9SA 4E31A 1K97A 2VDRB 3DFZA 2WVAA 4YJ3F 1YZTA 1YOVB 2R79A 4YI5A 4LG1A 2X4DA 2Y9PB 5LQKA 4NNPA 4J1QA 1IG0A 2X5OA 5FUXA 1L5LA 4Z9BA 3TUZC 1NVBA 4O1IA 2ADMA 4BYMA 5T8KC 3R0QA 3ZV6A 2C54A 3FHLA 3S24A 3DDNA 4PGAA 1XMPA 3CIFA 4DSUA 2J3JA 1IONA 2A9QA 3IO3A 2B35A 2JLRA 4BTEA 3DVQX 3GJ8A 3RVRA 3ZBPA 4FBLA 4B5KA 4I4NA 1TWAA 3N70A 1Y1SA 3EAQA 1QTQA 3E9CA 3TKYA 4L8GA 3O8BA 4IEIA 1CRPA 4IFTA 2Q4RA 5BSTA 4IBOA 2EZ8A 3KTDA 4QJIA 4U2BA 1PFUA 1XNHA 1F5SA 1DAAA 2R82A 5HZKA 1J9EA 2J45A 3ZDBA 2RH4A 1UK9A 1XV5A 2CD9A 4P86A 3MW8A 5EYPB 3WB9A 3FDJA 2OD9A 2A35A 1S89A 5HKAA 1TK3A 4BFSA 2A0WA 4ILEA 3RFUA 3TS1A 1LFDB 1GTL1 4AWBA 5JNRA 1MAUA 1N1DA 5CFMA 5LP6B 5KX5F 4N7RA 3LM8A 3AR9A 2Z57A 4P2GA 1ZETA 1QVZA 1U2PA 4EBBA 1RT9A 1JHXA 4GSKA 5FUVA 3RIHA 1HWYA 4O3FA 4IIVA 3BHIA 3HB9A 4QPZA 4QDZA 2IEBA 4AJKA 4F4ZA 2IHKA 2EFYA 1P75A 3S2GA 3LDHA 2C4WA 3N07A 3KJZA 4K1XA 1DBIA 4YUYA 3PU6A 3FFBA 4KE8A 1ODTC 3KHRA 3A1VA 4PSKA 1NUUA 1C9JA 2W9CB 1UPAA 1Y6JA 2Y0PA 4C0HA 5B2EA 1GPH1 2J59A 4E03A 4Q1CA 2PKQP 1XZGA 4RY0A 1Z5ZA 4CG3A 4PYRA 3ETGA 1V9SA 1NR1A 5JYEA 5LZ9A 5I9NA 4F60A 2QTNA 4KLCA 4DAOA 2VXOA 1Z6PA 1C1HA 3GJQA 5TQ0A 1PS9A 3FPAA 3EF0A 4JI0H 3TDKA 3F98A 5AJUA 2GRUA 1XD2B 4TMZA 3VR6H 3OU6A 4YUXA 5BNTA 4DIUA 3ICEA 3BA9A 3GUHA 3D8HA 4B75A 2C4VA 3A9UA 2WJIA 2ISQA 2JEGA 3BG5A 3EIEA 1EUDA 1XCOA 4MLDA 4NXNH 1YE5A 3A1TA 3NHYA 3JAWB 1FYXA 5CH8A 2WJ6A 1I30A 2C03A 4REQA 3C8ZA 4O1HA 3WGLA 3ZE1B 4LF9B 4HLNA 5IH7A 1YK1A 2FUG6 4TKVA 1Q6YA 4ECEA 5BQPA 4PFJA 2BEUB 2ZR9A 1Q57A 3W1BA 1XTPA 3SCZA 5CAEB 4A3MG 4QELA 4JUBA 4D9EA 1OA0A 2PX5A 3NEYA 4V1CA 4G5GA 5EKDA 2QTAA 1N6IA 3DUWA 3KR9A 3E3LA 2ZIGA 1Q16A 3FPEA 2BDEA 2V0NA 1FFWA 4F2DA 4RLQA 4IGIA 3OSNA 1FTYA 5JYDA 3K0KA 3PPVA 1DOZA 4MKGA 3RBAA 3QX7A 3HMQA 2NTYC 2P2SA 4PCUA 4ZXFA 1N32H 2I2AA 2YVUA 2ADOA 1KBOA 4IIEA 4EB6B 5T4FA 1GR1A 5ENDA 3AHGA 2UUBB 3G6XA 3NO4A 5D5PA 5FUMA 5KFJA 2NYVA 5JDIA 1KC1A 2QQ5A 2X23A 2FPLA 3WLTA 2FEMA 1T13A 1VKRA 3EYAA 5IJXA 3FCAA 3CFYA 1L8LA 3CLTC 3BKXA 5E6UB 1FTSA 5B2FA 5AKEA 2DHRA 3O3NB 4BNYA 4Q7EA 4KE6A 1OX6A 1H2AS 2H17A 3K7EA 4YY3H 1SELA 2WSLA 1OXVA 1DU4A 1WRBA 1KSJA 1V2HE 1BVRA 1TLLA 1IG3A 2ZIEA 1J70A 2QA5A 1BW9B 4PONA 4YEDA 2RJNA 2DQYA 1ZM2A 3ETDA 1YB1A 2OHVA 1J8MF 1UDAA 2J5QA 2X14A 4HPWA 1HFJA 4A91A 3ILHA 4G0OA 3KU4A 4M8KA 1YR1A 1ODLA 2D1FA 3PT5A 5I9LA 3G2HA 3VNBA 1VYUA 4NJMB 3GTOA 1XC7A 2EWMA 4LWOA 5KFKA 4D9JA 2O5CA 1AU9A 3B60A 4L5CA 5MF6A 2JARA 3K1ZA 2R11A 3OHPA 1JSLA 4LYDA 1P2UA 3OD5A 5IXYA 5LB4A 3FOCA 5ALUA 4UU1A 1E1RD 3JWJA 3OWOA 4KPGA 1OC4A 3HBJA 4B3SH 1Y48E 3HUFA 3KP1A 4NDZA 1HQCA 4PWYA 4HYYA 3LY5A 4MUFA 2OXTA 1S6YA 1AGNA 2XRYA 4OI0A 1NBMD 3REQB 1K3FA 1G7TA 3BL6A 3S2EA 5GADl 1RRVA 5AH0A 5E7QA 2CB0A 1G0OA 2I71A 3IDAA 4UEWA 5BW8A 5ADWA 1KETA 3TW7A 4MO9A 4W5WA 3A6ZA 5KCMA 2G71A 4RNDB 3WFZA 1SK9A 1R0SA 1ID8A 4JNKA 3U7GA 4G24A 3FPHA 4IKPA 2UZAA 4QQ8A 5FWDA 2EDCA 1E4FT 2ECPA 2QUZA 1G20E 4F92B 1VCMA 1CJUC 1KSHA 4EKEA 1F3LA 5BT8A 2VA8A 5LFAA 5GONB 2OORA 3ZVNA 2FH5B 3M1AA 3WNQA 4YDRA 2E18A 4TRNA 1QUEA 1J0DA 4KAJA 4IQFA 4K9PA 4AQYH 3EIUA 3LI2A 4CGYA 4ETMA 3EZLA 4WNAA 3I73A 4UBNA 1GOTA 1B0AA 4ZIRB 3LO8A 1NXXA 3TQCA 3O83A 1A9YA 1SZDA 4F1KA 1O96B 2LIPA 3O0TA 4ZICA 4KHZA 4FE7A 5FH9A 2HDWA 3MOIA 4V03A 4KPUA 5EP4A 3ABQB 2I3ZA 1T24A 4DV5H 2PN1A 1I6UA 1RFGE 3HXOA 4I50F 4JT4A 1IEXA 5DM60 3FNRA 4PZ8A 3HN7A 2A9KA 2B4KA 3PC2A 4REOA 4KXUA 2P5TB 2PRKA 4XLZA 1PNVA 4TN5A 3FNQA 5JSYA 3IMEA 4G0XA 1BGWA 2FSUA 4XRRA 3HOZG 5DEOA 3K3PA 4D8TA 1B0UA 1NQ5A 2E9SA 2W48A 4WLUA 3IV7A 4HLUA 3CYFA 2GJ4A 4RENA 3L04A 2HYIC 1ZJJA 4URFA 4MCJA 2PUFA 1K8RA 3M9NB 4TZTA 5CYPA 5FOUA 1HFWA 6YASA 4YFVA 1BDJA 3PGA1 4EFBA 5EP2A 2QUJA 5C4XG 3AF3A 4L9SA 3AHHA 1FOEB 1D6NA 3CZQA 4DUGA 3BJYA 4ZOLB 3UUEA 1Z5OA 1HL3A 2AJTA 3V2GA 1YA4A 4TWIA 5ITVA 7REQA 3VYTB 4E22A 2GNPA 4DJDC 2CE7A 1NBWB 3HO8A 4Q4DA 2JEFA 4X66B 2VDMB 1DQPA 1I3LA 2VJQA 3IBCA 1WF6A 2YWGA 1RI2A 1GJRA 1PJLA 4OHRA 2JZNA 1ODCA 1FTNA 3SG0A 3GJXC 3WLLA 2WDPA 2X2PA 4YI3A 2AUMA 4EIWA 3E1GA 5IEJA 4KXNA 3PYXA 1POXA 4L3WA 2WIBA 3B1ZA 1DG3A 5BSHA 4H7FA 4U1RA 1WCMA 5T7BA 4JQYA 2WWIA 1C1YA 4B35A 2ZSFA 3NOQA 3ZKWA 3V4ZA 1KVSA 4Y2YA 4YROA 1FSPA 2A6PA 1SXJD 1I0ZA 2WABA 5EWJB 3RUIA 5IASA 2JIOA 4K05A 2HNAA 1F0PA 1U9YA 5KDDA 3GGDA 4A8JB 3BGDA 1BC5A 1H2RS 2WAYA 3OE4A 1Z4NA 4GS5A 4NOLA 1CZKA 3H1GA 4H60A 3LLSA 3T5HA 3SZUA 1ESMA 3LKBA 1SQ6A 2QBYA 2E5FA 1BGVA 3ZY5A 4A3FG 3M6WA 8AT1A 1P17A 1QVRA 1DAFA 1KKUA 2D0OB 3KT8A 3M82A 1NBEA 4G01B 1JEYA 3P2JA 4KPYA 2RAPA 2WZCA 1XEWX 4BRWA 3T9DA 5EEHA 2PMWB 1JQAA 3OSPA 1JBEA 4EFLA 5F1YA 3VHQA 3GEDA 4B3IA 5IT9A 1K6JA 3T12A 1GUAA 4MO2A 4XQGA 2G6BA 1CJCA 2GBLA 5GJCA 3V48A 4ND6A 3L18A 1G21A 3EY9A 3VR3D 1LWNA 3BORA 5TPZD 3DWEX 3LBYA 4J9UE 2ZKLA 2F9MA 3C1TA 2FFAA 1V45E 4C7BA 3OWHA 1HDXA 3ZQKA 4GQBA 2IYUA 4B0OA 4JZKA 1C8VB 2CUNA 2HW8A 5FI5A 1D1PA 4K9NA 4NYEA 2OFOA 3LQRA 2Z1DA 5CFRA 3KLOA 1FLVA 3C6XA 2AQ4A 3AEKA 5D3MB 2GD2A 1Q3HA 1EGHA 1YDGA 2BHLA 1I4TD 1WETA 4FEYA 4IDHA 1G8GA 5FBLB 3E2PA 1JQBA 3ZV3A 4KBYA 1MP0A 2PR2A 3OJCA 3NEJA 2C7BA 3GLIE 4IIJF 2VEOA 1AURA 2HQRA 3HOYG 3RVPA 1FRQA 2H06A 1X77A 3ZD7A 4BHTA 2GNOA 4NARA 5JEEA 1SKQA 2AE2A 4KCGA 4M7EA 3R0VA 2VQ6A 4Q3NA 4JT2A 5CB8A 5HJ2A 3GDOA 2O03A 1AS0A 3SR3A 2QPLA 4RVOA 4HQRA 1Q22A 3P9SA 5SZHB 2VF5X 5FI0B 1V37A 1KYXA 2JG3A 2Q6KA 4AECA 4GE0A 1V25A 2BP7B 3FD8A 1PJ8A 1XALA 1NATA 2V9PA 1LF5A 3BQ9A 3KSZO 4B5LA 2O2IA 1F12A 3GAAA 3AIKA 4RGQA 1EDOA 3F97A 2VA9A 2YMMA 2YW9A 4LSGA 2ZRHA 1DFIA 4P7FA 2Y3IA 1GQQA 4FSDA 1P1IA 5I5UA 4GYYA 2DY0A 3TW8A 4G5YA 5T4HA 1IHDA 4KQ6A 4PSVA 3BBPA 3GMIA 4ZAGA 2WT9A 1VKOA 4DYVA 5F4BA 1WBDA 1SBHA 1VIYA 2YWBA 3PNBA 4EUKA 5FBRB 1VDMA 1YZYA 4F0JA 5EWEA 1XF9A 1R9MA 2PSHA 4XB2A 5JQGF 2BFMA 2REBA 2CNOA 1OX4A 4AJOA 1L5OA 4Z9YA 5LNK6 1ZSYA 1RYMA 2XSZA 4BGIA 2G5CA 4NOKA 4MVXA 2PM8A 4OI1A 4PE5B 1UWLA 3UMCA 3R7SA 2FK1A 2C9DA 5F2NA 4D9NA 3JS5A 2VR1A 1QAMA 4LK3A 4LQ4A 2Q49A 2JI6A 2Q0XA 1ZO8A 3L46A 2XF8A 3SLKA 3A6JA 5ELXA 2A4MA 3WYEA 4HK4A 2HA5A 2ZE7A 1X1TA 4HX9A 4KRYA 3IUBA 2OXCA 4G5RA 4U9UA 3OUTA 1KI3A 5KYNA 3IFSA 4JI4B 4I6JA 1OLSA 2BIFA 4R8MA 4GVXA 2H6EA 4IIGA 3HDHA 5F64A 1R6DA 3ZH2A 2Z1MA 3QTBA 3VU9B 1YGPA 5EHXA 2C61A 4YRMA 1PI3A 5CDGA 4PWQA 3NVDA 4R8RA 4FFSA 1XTBA 1MRNA 3I2GA 3BSSA 4Y7CA 2Q99A 1UJBA 3TINA 2HSZA 3IDOA 4D4LA 3EQ2A 2OBBA 2NMVA 2VUMA 3OIVA 4JWTA 4PAGA 4GC5A 4U7JA 1LBEA 1TJ4A 1E2PA 4JL5A 4BFUA 3OOSA 1W88B 4AAYA 1S96A 1L6IA 1V7ZA 2JFZA 1O94A 3ZOZA 5A2QW 1Y8ZA 1WKBA 2L18A 1TFRA 4R8LA 3HXKA 4CWAA 2QI9F 1XE3A 4QWDA 1EXNA 4EFEA 1F5NA 1U2EA 2OGSA 4C9BA 2XPCA 1PS8A 3F6RA 2P5UA 2YCHA 2NT4A 3RC8A 3P5BA 1VKHA 3LW8A 2XYRA 1G41A 1W48A 3HWX1 2CVHA 3PQ3A 4LJ5A 4WBXC 2Y05A 1NVTA 4DCJA 1LNSA 4IDEA 2RARA 3RKUA 3IQZA 3HYCA 5JH7B 3RV4A 4K0RA 1ZXBA 4L73A 1OVMA 4N18A 3NUGA 3K2QA 2P7HA 1NI4A 1TAHA 3ZHCA 5FA5A 1ZFNA 2H08A 3G0CA 1UM8A 3R3ZA 4KN8A 5JNWA 1RAGA 4J9NA 4GP6A 4F97A 4D02A 4DUZB 4OYHA 3SIPA 2HY7A 2R62A 4BCBA 1PR4A 5DASA 4MROA 1V7QA 5JALA 2BM1A 4UCUA 3Q7SA 1PD0A 2JLQA 5HDBB 1Z4QA 5K8TA 1U1IA 5ESDA 3RUPA 4QATA 5IM5A 4FYMA 1TM4E 3C6KA 1Z0AA 1HNWB 3DDHA 1II0A 1JHQA 4XQCA 3HUUA 4EITA 4E08A 4M7OA 2WC1A 3DW1X 4ARZA 3M7IA 5JROA 2OVBA 1I9GA 3R76A 3IAAA 2LDXA 4XYLA 1RJRA 3ZHOA 1NMZA 1Q44A 4WKGA 4LX0A 4R8VA 1KI2A 1E2IA 5EGNA 5TRTA 4ZCLA 2O8EB 3R77A 3JQQA 2X9VA 2V5VA 2RB5A 2QAGA 1CLUA 3UWPA 2WINI 4RQUA 5CH3A 5EIBC 2YN0A 2FPUA 1O0CA 1T8RA 2VUIB 3T1OA 5EPUA 4YJ2B 4R1OA 4KJZA 4XJTA 1NM5A 1QHYA 1VMIA 1X8JA 3NHWA 1RLJA 3E9ZA 3AM1A 5F2OA 5JJ5A 4DABA 2QSJA 1MC5A 2JRLA 3NTRA 1AA9A 1TO1E 1E2NA 3DO8A 5K99A 3RS3A 3VNQA 3DT6A 1H2HA 4JBLA 3C4QA 3FKQA 1V11A 2WJZB 3PS9A 1ESCA 3A1DA 2PUGA 1X1DA 4PINA 4NEQA 5CBPB 1SVOA 5ALEA 4LF9H 3OP1A 4EJSB 3M6UA 3U60B 4JQOA 1ADYA 3L4BA 4D9KA 5EVCA 4CEHB 2IQIA 3HFJA 5EWGA 3HU2A 5JZ9A 3IEXA 2AMFA 3CM0A 4B6QA 3KHKA 1BDMA 2I66A 5K03A 2BFOA 2X3UA 1YVRA 2ZAGA 1HG1A 1WUIS 5JASA 3LWNA 3CLSD 2DKOA 4HPJB 1T3LA 4TXJA 1KERA 3ZWCA 3JWPA 1MH9A 4CTNA 4Z99A 2RJOA 3SFVA 3A9VA 5KFAA 4YMTA 3KWMA 2ZBGA 1ULTA 2UUBH 4CPDA 5K6AC 4JBHA 4M7RA 1ESEA 3OJ0A 5FFFA 3UYYA 2VSYA 4LJ7A 1A2KC 3DMPA 4L0DA 1MNAA 4PXAA 2CW8A 4IHKA 1YZKA 3EPIA 5KOIA 3WHLA 1JEDA 3EFBA 5KOJA 1PJTA 2ALJA 4I9GA 1GXSA 1X3SA 3FCSB 3H3JA 3IVGA 2HRBA 3JY6A 1EDDA 1PFKA 4G1EB 2GBCA 1FFDA 1N3BA 5DNEA 1QWOA 3TM4A 1F06A 1T5DX 3IQXA 4FIZA 3SKVA 1OTHA 1T2FA 1LBHA 2UKDA 3ROFA 4ZA2A 5AK3A 3SZMA 1SXGA 3ZE8A 1G2OA 2G1JA 3NUAA 3LRTA 4MI1A 1TAQA 3O2JA 4UBMA 1KBLA 3IRVA 2W7TA 3DLCA 4MNTA 3ZJTA 2PZBA 5AIBA 4G5SA 3COWA 2FK2A 2V45A 5C3MA 3H9BA 4FCVA 2REQB 2UVPA 3CF0A 4MJ7A 2ZTMA 2JW5A 4UQPA 4G1MB 3GGCA 1FW6A 2FSVA 2ZBDA 2Q3MA 2QGNA 1XVAA 2XB8A 2I55A 1EA5A 4I8XA 4C89A 3VR2D 1L5SA 2LCFA 1RAIA 4Y1FA 3BL5A 1ZOLA 3EIOA 5F3DA 4BMNA 3FYUA 4BU1A 1V8FA 3H6GA 5DYGA 5FBZA 2E0IA 5F5XA 1T0UA 1ZGZA 3NAGA 1YL5A 4BBZA 2JKVA 1QPBA 3PHLA 3KYHC 3W34A 1T4CA 3EXIB 4BB0A 2DZDA 3NM4A 4PV7A 4M22A 3T3NA 1O5OA 4LAFA 5C0OE 3BMCA 1SEPA 4UATA 2CNLA 4DLNA 1YUBA 1E3MA 3OFVA 4IICA 3P0RA 3WWEA 5IC5A 2VDNB 3JQFA 2GN6A 4E21A 3OQ1A 3VDXA 2AE1A 4M38A 1P2VA 3W5VA 2XC9A 3QIVA 1MQ8B 1LJLA 4IHJA 3THSA 2GYYA 4JD5A 2GILA 3LUAA 3QEMB 4ZCMA 5HQJA 5L4LA 2IPAB 3SHOA 3DBLB 3HKBB 3BDAA 2XGQA 1LRLA 5K3FA 4FHDA 4PTYA 5KKCA 1FFCA 3F3KA 1JILA 1V9PA 4RKYA 3HP1A 3M5PA 3INRA 5CVJA 1KI9A 2WB2A 1GN8A 2JA1A 4YECA 5AUPB 3R7LA 1QKIA 1S5PA 4O08A 1I2ZA 1G3QA 3ZJ4A 4NZOA 5JR3A 3A7EA 5A71A 4PIPA 1IVSA 3M89A 1Y6RA 1BMTA 1HYGA 1V8OA 1Z4JA 2UZ1B 1W19A 5A9TA 2V7BA 2Q8QA 3MRXA 4M9RA 1YNSA 1HNXB 3TQFA 4UAUA 2WU4A 1IOZA 2NU8A 3VNRA 3AL0C 3PCRB 2VCEA 2O7SA 5K2MA 2R7NA 3DMTA 2H5IA 2BQUA 3H5TA 2VJDA 3FFXA 4EW3A 5KTTA 3AHCA 5DU2A 3K8ZA 4GNRA 4U0KA 5CNIA 2CMFA 1V7PC 3BSWA 3ZK7A 5E4YA 1CNMA 3T1QA 5F2EA 4HAXA 4O82A 5DLQC 4UUMA 2FN8A 3RBZA 3WIBA 8MHTA 3L4SO 2P3LA 1OXBB 4KQIA 3BUSA 1EPUA 3B5EA 4WA8A 1DBQA 2NVYA 1GWNA 2BFPA 2JBAB 4JOBA 3QFFA 1D2RA 3VO1A 2I6SA 1NJ1A 3KUXA 2FLVA 3KKZA 4HB4A 4X66H 1P91A 2C29D 2E1PA 4JOSA 3GG9A 3H42B 1ODFA 4BQRA 1FF9A 4PNPA 4YTEA 3EDYA 2RONA 3R23A 4C88A 2CV0A 2OD7A 4P58A 4UW9A 3WWYA 5LYJB 4N82A 1HG0A 2VG8A 1XHFA 4ARCA 2J9GA 1KAGA 2D2XA 3PQ6A 3VTKA 3GVXA 3BRWA 4F2GA 5AKHA 2VUHB 4PYOA 3GN2A 1KRWA 3ZWAA 4M54A 1QCCA 3RJZA 1IB6A 2C7GA 2W22A 1M2WA 2X0FA 3T38A 5IXJA 4PPQA 1J21A 1QVAA 4UCFA 5IZ4A 2QLBA 2LDBA 2Z98A 3WBFA 5HKOA 4BAUA 3TLGB 3WHKA 3C5HA 3UMFA 1U11A 2R4UA 4QVIA 2WWVD 4RZHA 4DPKA 2WFLB 3K1AB 4XGIA 2BFBB 3R8FA 2OHJA 1S1CA 1E2DA 5IBPA 3V7UA 4R9NA 3QNWA 3QPWA 4X6LA 5E9WA 2SHKA 5I7EA 4EQ5A 1V6CA 3TXAA 3T7AA 3DG9A 2LV8A 2K2QB 3CH4B 2ZI7A 1WUHS 2C88A 4YR7A 4WH0A 3G2KA 2AIRA 2H4WA 1KI8A 1JQEA 2VDKB 2GI4A 1RPZA 3ABRB 3TB6A 4R2MA 4XM1A 3V8EA 3CVXA 4GWLA 4NX2A 5J4VA 1MB3A 2RAFA 3DA8A 4X64B 1NZJA 2XF2A 2D1QA 4F5EA 1BKDR 1TO2E 2WYUA 5DN6A 4ZRNA 1ADBA 2D54A 3R3HA 2WZDA 4FHFA 4QOFA 4XFKA 3CY6A 3TK1A 1YQEA 2CZGA 1U3CA 4U7FA 1EFVB 3VHXA 2BMFA 1L4HA 1HNZB 2I4MA 2BMVA 3NBKA 3HT5A 4YP6A 4OSOA 3L43A 3LW7A 1QQBA 4FBMA 4OKNA 1PP4A 3NV7A 3PUHA 1AKQA 1QFZA 3ZDXB 1BD3A 1S02A 4KQKA 1ZUIA 4EHNA 3H7IA 1PGNA 4JB2A 1DQYA 2IRWA 4YGXB 4WLFA 1DO2A 5EMLA 1KZYC 1L5ZA 2W70A 3O8NA 3I3SR 1DJPA 2K87A 3EQ8A 3R4VA 2QOEA 4NYMQ 2PS9A 3DV0A 5D51S 2WHYA 3EXFB 4FFBB 4F4UA 3V34A 4BFZA 3D3WB 4LTNA 2V7XA 2P67A 1U2ZA 3OFND 3JYNA 5F3RA 5IN4A 3ZGVA 5SY6A 1Q0HA 3KOWA 5L3RA 1TUBB 1M9NA 4MIKA 3KB6A 4NEGA 4X45A 4WXRA 3MJRA 1C3JA 2NZ2A 5CLHA 3B20A 1CV2A 1ZOOA 4NULA 3KVOA 1IVYA 2VRWA 2XXBA 2P2CA 4LOKA 5FRDA 2WVGA 3BIXA 1I1KA 1T0IA 1RHMA 3G2JA 4O1MA 4MLZA 2J6BA 1WY7A 1E3SA 1GP2A 1E9CA 1VCOA 3LRXA 1US8A 5JS6A 1ZH0A 3QFHA 2LP4Y 3UUGA 1W5TA 2QEQA 3B7GA 1QIHA 1L5HA 5IHXA 3HV2A 2Z09A 4J3NA 3PWTA 3S55A 3VAZA 3DWIA 4Z7QB 1OFHA 3DKIA 4B40A 3LT2A 3WWZA 2Z6AA 2O54A 2C92A 2MWMA 2DQKA 5AVXA 3NVMB 2NSHA 2II6A 4Z0PA 1D5CA 1MA0A 3VSDA 4PU0A 4FGZA 4TTVA 4KVFA 1XMOH 1NVVQ 3BA6A 5DG9A 4CF5A 2O3SA 4ZGWA 5BSVA 4R1QA 4U5QA 2YZMA 1R4MA 3PR5B 1NNLA 3CEPB 3O4FA 4DLVA 5JU6A 3PW2A 1QIMA 5EJ5A 3MT9A 1I7DA 4JI4H 4PLYA 1VSVA 1VIDA 3BBLA 5EUMA 1RYZA 2W2QA 1BNCA 1RSZA 1MJGM 1SOVA 3DHEA 4JP3A 4MMXB 4XFJA 2BKLA 3GQCA 1GG5A 1FX0A 1S10A 4JI2B 4RPGA 4PO3X 1U65A 2JJMA 3LQQA 1RQNA 5EDWA 1VL2A 2D5CA 4IUDS 1HYQA 2O52A 1WA5A 3CNNA 1EFTA 5FR9A 1YJ5A 2EP7A 3BMNB 4XZ3B 2FMIA 1MV8A 4LOAA 9GPBA 5G0WA 4Q44A 1XA3A 1JI0A 4JV1A 2XBLA 1V51A 2GDZA 3CS3A 4NU8X 3J81W 3T3MB 1KI6B 5AI6A 4G9BA 3CVZA 4C7JA 4KIGA 2O7VA 2G80A 3T54A 5CIYA 2Z04A 5BN5A 4M0JA 2H7CA 4Y9RA 4OL0A 2I3GA 1LK7A 3F1LA 2JFUA 1P33A 1U1FA 4HAYA 3H2SA 2R8JA 1CUEA 4M3NA 4MQEA 2BR4A 4DSAA 2HIGA 1TM2A 4EJ0A 2DWPA 3CF4A 3KVRA 4CTMA 2AWOA 1M83A 5ECDA 3VISA 2ZSKA 1XRJA 5AJXA 2HDKA 3HWRA 4JBGA 3RF6A 2J0EA 4WFKA 5M3BA 1PJRA 1ZUHA 4ITRC 1FFGA 4C6TA 2PS1A 4LVCA 5CVUA 1Q7TA 3GJZA 3GVIA 3O38A 4AWAA 5EGSA 3WMGA 1RM5A 4PAOA 2XGPA 1OOEA 4K81B 5C7YA 4GX2A 5JUWA 3TG8A 5HR5A 1NYTA 3GW8A 2PTGA 2RGCA 3HO1A 1S4QA 1HO3A 1JU9A 5EG5A 5E2BA 1QUFA 5DGIA 3WA6A 1XMIA 4YAGA 1D4AA 2JA6G 2PX2A 4CDMA 3C5VA 4Q3LA 1JHRA 3C98A 1HNWH 1LB1B 1UFQA 3WLOA 1FXSA 1JIIA 3O91A 2QM0A 4AG3A 4LVNA 2GCNA 2ZSBA 4WZBB 4KIUA 3ACBA 4R16A 1BS1A 1WLSA 1JBKA 4LFAB 2C2RA 2H2WA 3BJRA 3OQIA 3L6EA 2OHXA 5DGAA 1KK0A 2OECA 2QVZX 1VE9A 4LYYA 1TE2A 2PWPA 4IILA 2PKCA 3JVUA 2O1XA 4RO0A 4CFZA 4OBEA 4XCVA 3F2VA 1RC8A 4NJEB 1ECCA 4FFVA 4A15A 2FKAA 2VRNA 2VF4X 1BFUA 3WADA 3KU1A 1C8KA 2VDQB 2RHBA 4URZR 3VI4B 5CFZA 3GFTA 5KS8A 4RMHA 1IOLA 2VDVE 3HA3A 5JFGA 2J9FB 3AQ4A 4O2BF 1JYFA 3LF2A 4NVRA 3UQ8A 2QXYA 1LTKA 3IN5A 2G28A 3RFCA 1ESNA 1IHXA 1YVPA 3JCZA 4PWZA 1VI6A 4JLNA 5FBVB 4YIKA 5EOYA 1TEHA 2JVIA 2DHCA 2V7QA 1KJ9A 2VPSA 3V4VB 4OG2A 1P1RA 1AK1A 1EJ2A 2KW5A 2RGXA 3QVTA 4G0MA 4MRVA 1GQFA 5IVKA 5C7IO 3RRJA 4A27A 2GFQA 3QOXA 4NR0A 1HZZA 5IJ9A 3GT7A 2O7RA 4S1NA 4P3OA 3T9BA 2V4UA 4NCJA 3DOFA 4GZMA 1WB4A 2WZBA 3P1JA 3M9XA 2B3TA 4QFMA 4ENSA 3RM3A 1M2OB 3TE7A 4R2HA 4I4TB 5JSFA 3IQWA 3VNSA 2ZJFA 1CJKC 4ROSA 1YV9A 1IBLB 3SSMA 3KWLA 2HXSA 1XN4A 2X5RA 3FUVA 4M83A 2Q7XA 2M05A 4BX2A 4NCHA 1RHJA 3FMFA 3DTNA 2I9KA 2X8AA 2UU9H 3I34X 3GLFE 4KVGA 4KH0A 4U2FA 1BFDA 4O0LA 4K26A 1RYYA 2J0UA 4CBVA 1Y3HA 1QNFA 3KEQA 3AR7A 5J58A 5L1LA 4C01A 2V5UA 3AUKA 3QKSA 4W5HA 2OXIA 4DE5A 4LXQA 1FS6A 4OVKA 3JD3A 2M6LA 2C3OA 3WQHA 5DGDA 4GDFA 1JYEA 4CKBB 5I7OA 4O3SA 5CW2A 1ZL0A 2VUGA 4F3TA 4OYYA 4JFAA 1UBGA 1GGHA 3CU5A 1QLJA 4MQFA 4KL8S 1MQSA 5JC8A 1JKFA 2JJ1A 3QIAA 1S2LA 2WA1A 3ZTYA 1MB0A 1EXWA 1K27A 5LR6A 4D3DA 1QH1A 4PQFA 1DTWB 1CU1A 2COIA 4BEWA 5ESWA 3Q3IA 1MOQA 2ID7A 3KQKA 5BNIA 3LQSA 3HYNA 4LYGA 3NC0C 4PLZA 1QDEA 1C7FA 2Q3DA 1T9AA 1A04A 2FPPA 2ZDQA 5A06A 3GZJA 3T4UA 4LF4B 1KDOA 1U2GC 4CTJA 2IPXA 2BLNA 2R0QC 4QFBA 5CB0A 2O8BA 2QRVA 3VR5A 1KK2A 1QIIA 1W25A 1G5PA 2ES4A 1L7XA 2GEJA 3AMVA 3VPSA 2J5RA 4X0EA 4C3VA 3GROA 3T9EA 1SVSA 3QMWA 3HXTA 5ALIA 1QYDA 5ANRB 3RBXA 3DMDA 4XCQA 1ZN8A 5LSAA 1D0SA 4OUDB 3W7AA 3U2QA 3MSCA 3TPZA 4AQDA 2O2YA 5T8KA 1I32A 1Y37A 3RBVA 1KDPA 3WC4A 3I09A 2WF6A 4K6NA 3O31A 2B7CA 1V4VA 4LYEA 3CX3A 4DKXA 5G0SA 3TD9A 2FDXA 2AT1A 3RTDA 2WHPB 4HGPA 3BMOB 1U04A 3UO8B 4QJBA 1KEEB 2NW6A 4HQ0A 2A78A 5SZIA 5I5XA 4NQRA 2D06A 2VOBA 2AJCA 1PRYA 2Q6LA 2HIHA 1IC6A 3I8SA 3D7LA 1BE6A 1K86A 2O2CA 3QBDA 4C4YA 3WL5A 1QGOA 4BV2A 1TKBA 2I8LA 4D0GA 1Z08A 2X5NA 3HU5A 4E3WA 3TAXA 4CKZA 1VL0A 4E5PA 3CZPA 3BAZA 2VVTA 4A03A 3ED5A 1GCGA 2E4XA 4CMBA 2IV2X 2YVLA 5B6JA 2H11A 1CUVA 4ZU3A 5C2JB 1H1LA 4ZVKA 2ZS8A 5HKKA 1JXQA 1SZCA 4HT3B 4ECUA 2E4WA 1HNXH 1DKNA 4DB4A 1E6EA 4RTMA 3PXGA 5B1SA 5HFAA 4J9VA 2ZBQA 1LDNA 4HAOA 3WI7A 1NNUA 1PR9A 4TS4A 2V7PA 1XDZA 5HZHA 2ZJ0A 3BTVA 2D3TA 1AHIA 1QH0A 4DUGD 4XPIB 1A8IA 2B94A 2VT6A 4QPCA 3A2KA 3ZWDA 4IIUA 1YFLA 4RGYA 3R9XA 1MX3A 3OZGA 5IK2A 4G0QA 1OXTA 3GAFA 4NENA 1N2CA 5HRUA 2LPMA 2DHQA 4KIWA 4XYBA 1BROA 4EYGA 2HF9A 1UUFA 3A1CA 4H2DA 1E9DA 1VL8A 3JVDA 2QMZA 3LHSA 4X85A 2QRHA 3OC0A 1L5MA 2QXUA 4BO8A 1Q1EA 4ZCQA 1KOFA 3RG8A 2FG5A 1RI3A 4X94A 2XCLA 3DDCA 1UBLS 5E1BA 2YDYA 3T5LA 4K3VA 2NYAA 4RFVA 2ETXA 4XTRA 2CLOB 1JDNA 4IYJA 1P2BA 2WTMA 1ONOA 3H9QA 5KHOC 4P1ZA 1XZNA 3D2BA 3C15C 2MMGA 4AW9A 2J1LA 4Q02A 2EU8A 3NBAA 3GLHA 3WQRA 4A26A 2FE4A 3GDHA 3G8YA 2VHTA 1RXVA 1KYYA 3NCTA 1OH6A 2XWJI 4L4YA 4WXPA 4OREX 2QTVA 4TUYF 4G5OA 4OK3A 2XB2A 5B7QA 3DPSA 4KXYA 1ESZA 1OFGA 2ACVA 1CUJA 5JS8A 4JKOA 4Q18A 1V47A 1E1CA 3H0KA 1M1YA 3WYCA 1P73A 1IXRC 4YPVA 3KWFA 4O7LA 1CXZA 1JHUA 3TNFA 1HE5A 1Q7CA 4UCOA 4PLWA 4L28A 1X7XB 3AZQA 2PU5A 6Q21A 2DPYA 2O9JA 2ZRKA 1CF2O 3O1LA 4G25A 5JLAA 4LDNA 4P4LA 1V1RA 3GRUA 2XIJA 4LMBA 3H1BA 3B2EA 4EGJA 5KYWB 4BVKA 2HCTA 5DK4A 1DIGA 3O74A 1LWOA 3FSGD 1IY9A 2PL3A 3FETA 4WI1A 3W04A 1GGVA 4JV0A 3K6SB 1H3NA 2JEJA 1AM4D 1UZMA 1WZUA 3NWPA 5KQPA 1P9WA 2E2WA 2PRIA 1LSOA 1SG0A 4BJ3A 4BNWA 3QLVC 5GIOE 1P6QA 2F1KA 1D2HA 1P5FA 1P5RA 4NCAA 1T0PA 2OHGA 3TZBA 2SKDA 3D9QX 3G17A 1IB0A 1EP1B 3KJHA 1EJBA 2A14A 5EIWA 1C29B 3NYWA 2VRBA 3M9LA 4KQJA 4KEAA 3CJQA 4K1LA 3AKEA 3DZDA 3U19A 1JEOA 3AEUB 3CPJB 3OEED 5KPJA 4OAPA 3CNBA 4EX7A 4AXBA 1MORA 1Y1WG 4DV0B 1IZ8A 3HRKA 2UVRA 3IP5A 4P83A 3OTQA 1UZLA 4EYIB 4TT8A 5FCDA 3V1KA 4CQLA 2I2CA 4FS2A 5E3HA 1KP3A 3DEYX 3NKVA 3OJOA 4LISA 4GC6A 1Q20A 1F1BA 1I3OA 2V03A 1OILA 2CUZA 3WNBA 4A8TA 1K98A 3BXHA 2E4ZA 3DMFA 4MGYR 4RVSA 4UTZA 2IIPA 1K88A 5ITZB 2WYIA 4C03A 3QJGA 2QM8A 4LDJA 1UZAA 3CVOA 2Y76A 4MWEA 2OFFA 1VL1A 1IJKA 3FTPA 4CMJA 5THKA 2ZI6A 2V98A 5FTMA 3K70C 3FLEA 4EG3A 2ZJ2A 5DG7A 2V4RA 3TTTA 3VA7A 4OK6A 3BZBA 1SUWA 1C3LA 1GR0A 2WJGA 3D4PA 3PB3A 1GU7A 3GHYA 2J3LA 5HNEA 3DCYA 5EINA 2R8GA 1NW7A 3OX2A 4GP7A 3OIDA 3GA0A 1TNDA 5EOVA 1YJAA 1C9NA 1R9TA 5THQA 3ISVA 4TYMA 2R1UA 3OP4A 2R00C 3ACDA 4G1CA 1JMKC 5F33A 4L5BA 3AKYA 3VV2A 3LX8A 3TSCA 1Q6ZA 2D0DA 2FRVA 3RAEC 3U9SA 2JEZA 3JD1A 4R1MA 1F2DA 4CLXA 4JI2H 3F71A 2RH9B 2XT0A 1L8AA 4MUYA 4M0LA 4HLDA 3WMRA 4E30A 4AJ4A 2C8KA 4A23A 1F7UA 2IHJA 2HB6A 5F23A 4Q47A 1M0EA 3SXJA 1I3KA 3RE1A 1YONA 4GL2A 3E27A 4BUJA 1J8YF 3TQIA 2W2NA 2VHCA 3OT4A 3R8CA 1NN1A 3HY6A 1AQUA 1TC1A 4MGEA 3O4JA 1PTJA 1U0EA 3MLEA 2M98A 3RGWS 3UHPA 4UBOA 2CLFB 1UMKA 3PVZA 5JAMA 2X8BA 3I32A 4U6SA 1Q95A 1KAOA 3K71B 1RP1A 1QC5A 2IYAA 4UHDA 3TIFA 1IPEA 5KJFA 2M32A 3T0FA 1TUIA 3O2QB 1V8BA 1DV2A 4ISCA 3LT5A 4CTOA 1X13A 4C30A 1GZ7A 1VRCA 1JFSA 2FZWA 3NP7A 2ODNA 5K09A 2BKAA 3U4GA 1PT5A 3H2HA 1SC3A 4ZHQF 2XZPA 1C14A 4ARVA 3A6GA 2H0AA 1HDCA 2R8IA 2Y77A 1XQWA 1OBHA 1EK0A 2XT6A 4X1YA 2G5PA 3IVCA 4RA6A 3LT4A 3AUJB 4D9MA 4C29A 3KZOA 5JXHA 3G7SA 4QAQA 5CLJA 2QTBA 2BFCB 1H1TA 2XUZA 5BNWA 3OM9A 3IDSA 1U94A 3G5UA 2B82A 4EYHB 5JNTA 5BWTA 4Q3AA 5KQLA 4EOGA 2XZLA 2GOYA 4ZMRA 3QZUA 3Q9NA 221PA 1A8QA 1TM5E 2AN5A 1DKUA 4AY6A 5ADHA 4LFAH 5EJIA 3CLRC 3KSBC 3NC4A 4RCYA 3QYAA 3GYGA 1PW5A 2A4KA 4LI0A 4W5QA 4BKOA 1N5OX 3NWJA 4TWRA 5HNKA 3RRFA 2QU8A 1UKZA 1G21E 3WLFA 4PO1A 3QXHA 4QO8A 3I62A 1UJ5A 2P77A 1CFJA 1GL6A 2I80A 1PG5A 1XTSA 4HH3C 4BN0A 4JVLA 3VMFA 3TR6A 4UOEA 3EZYA 4BAZA 5EE0A 4QXMA 4DUYB 2AVDA 3UFXB 1LX7A 1ZGBA 5JVDA 5IDQA 4K6KA 3A7DA 2ZI5A 1L5RA 5JSUA 1FP4B 5K7SA 1OH7A 2VFAA 3ZY2A 5BSGA 4HSGA 1EFDN 4S04A 3SYLA 1DUIA 2BFDB 5ULLA 3VGJA 3LCUA 4D2IA 3ZHVA 3ZN2A 3E53A 4X97A 1MVOA 1SPXA 4W1RA 5DHFA 4YMHA 5FD5A 3R7BA 2VPQA 4DMLA 2YL2A 4ENWA 1NI5A 3OZWA 1R10A 1STOA 2F3SA 1AQIA 1MABB 4MUBA 1X1QA 3ITKA 3VOTA 2PG3A 3EB9A 4DR3B 2CHFA 3PFWO 4TV8A 2XCRB 2WWFA 5EFZA 3I4NG 3ZHYA 1YRQA 3GT4A 3HL4A 2GCOB 3DOCA 4MUKA 5AXAA 4V3BA 3VI3B 2WT8A 2V7GA 1UBMS 1QF7A 2FE1A 1VKNA 4XVUA 5BRAA 4IDBA 4PLCA 1PG0A 4M0DA 1QV9A 3EMBA 1EVKA 3KJFA 1IBLH 1W8IA 5JDCC 4RHEA 1T2NA 2OOSA 4N5NA 3LBHA 2GETA 1ULUA 2CXPA 3IPRA 3TO5A 5CT8A 2OP1A 3O1JC 1ES9A 3GCGA 2QLTA 2XMDA 4ZVVA 1EVYA 6GPBA 5GZ1A 1T5TA 3TBFA 2O3TA 2QIOA 3B2QA 2CDCA 2VF7A 4KR3A 2WKSA 5TR9A 2DULA 5KVSA 2QYHA 1LLUA 3A05A 5EUQB 1U0LA 2QM7A 4I9NA 3E5RA 3SLRA 2FWIA 4JODA 3D6VA 3TW6A 3WGVA 1B04A 4UBLA 1UOEA 4M0MA 3OZUA 2CV2A 3DL4A 1HT2E 1DQNA 3TLBA 4MWTA 4KIJA 1H69A 5GY7A 4RNMA 1QANA 1RXUA 3QXGA 3PXBA 1J6UA 3AP3A 1X87A 3A9WA 1Z5NA 4XA8A 2E4UA 3A27A 3IA7A 4R7ZA 4RHFA 3ER8A 4B3RB 3KYBA 2AFIB 1XCMA 1QRSA 1CIJA 5JG7A 1I7QB 2AZMA 2EX4A 1Z3IX 2O6HA 3N7UA 3ITNA 5I7WA 2BZ0A 1UBOS 2XHEA 4HV4A 2BM8A 4LF4H 1QH8A 2IODA 1A2OA 2GM3A 4FYWA 5ICFA 4Y2HA 4YO7A 1OWOA 1VE7A 3V4OA 3ZQ4A 3N43B 5TIIA 4BLWA 3FRIA 4DHEA 3VU1A 4MIYA 3IEVA 2UYCA 3JD2A 2QL7A 2QU7A 3SQXA 2C7RA 1PDVA 1ZIPA 3HCEA 1QP4A 2XXAA 4Z54A 5I5VA 3VKWA 1CY0A 4MRMA 3O82A 5KYXA 4OQQA 4I81A 3IPLA 2B1GA 4BGUA 3GJ7A 3UQYS 1A5ZA 3RYIA 2FJ0A 3TR0A 4WADA 2JLBA 3RRXA 1TU3A 1AKYA 4DCMA 5KT4A 4Y1RA 1NBAA 1YI0A 2ZWOA 1CNEA 4HYKA 3TX2A 4EMBA 4DMFA 3UNXA 1I50A 4BC1A 4PBTA 4GBGA 2SCUA 3UY4A 4EECA 3QM1A 4V24A 5J1TB 3ROEA 2GO7A 4UVGA 7YASA 2YIMA 1ZC3A 5CJPA 1ZOPA 3PLNA 3GDWA 5FOQA 3T61A 1VSTA 1L4LA 3H18A 4D9HA 5JWOA 2OCXA 4JP2A 3R0XA 3W6UA 1JXOA 5IDYA 4DCCA 3EPHA 1Y4UA 1NN5A 3IUNA 4WDQA 1YA6A 1VJGA 4YRPA 1M8JA 1IMJA 3QPBA 3WKEA 1YJBA 2VPWA 2XDAA 2EIYA 4FGRA 3P8ZA 1MQ9A 3IIEA 1X80A 4EI2A 3O0DA 1YKGA 4LV6A 2YXPX 3WQQA 2OR3A 2HIVA 2QLFA 2XUFA 1B0ZA 3PE4A 5EP1A 2RBKA 2ONYA 4Q4JB 3H9EO 3KTFA 1E5VA 4W8HA 1ZCFA 4NC9A 1OBCA 1GZ6A 3L05A 4RANA 5AD1A 4PYNA 4BVBA 1YDEA 4Q01A 4F6LA 4L5JA 2NUAA 2J30A 4MS4B 3ZW7A 2F00A 2DQSA 3BHMA 3P96A 3ZU6A 3L49A 2DX7A 4TTJA 2XNHA 2WM9B 5BUQA 5AM1A 1VDZA 4WFQA 3AEQA 1SULA 3RSOA 1Q0UA 2GZ1A 1RW4A 1U5BA 2CXTA 4GBMA 3PR1A 5J2UA 4NFYA 4CT4B 3L1IA 4TKUA 2J9ZB 2HLHA 4RELA 2OE2A 1CEEA 3WGKA 1AGXA 2CXSA 4AWXA 3ACCA 3WJ2A 4NNJA 4YO8A 2HWYA 4F3CA 1PJ3A 2EF1A 4HRAA 5AKZA 3BRWD 3F8WA 3MWEB 4KSBA 5BQFA 4PYKA 3Q8RB 4GR4A 4DC1A 1F4LA 2ERXA 1JJIA 2ZVQX 4O4LF 2CJFA 1HL7A 5JISA 4IOKA 4NCIA 3VTZA 2R7MA 4BQNA 1SIWA 1BQ3A 2OHOA 3BCSA 4YHHB 1DWUA 3AVPA 2XWSA 4BCDA 4RMGA 4AF8A 1TO6A 4QU8A 2ZS7A 3RASA 5KAPA 2G70A 1VBHA 4QOHA 4V2UA 3ROMA 4OSPA 4EKNB 5DNCA 1NW4A 2BMWA 2JS7A 5DVZA 2VNKA 3TRKA 3QKTA 4KTTE 4HNTA 4B9EA 5BV8A 3LULA 1U3DA 5DTJA 1KS2A 2ZJ4A 2X0JA 3O95A 3UT6A 1B8PA 2R2GA 4Q3DA 3AI3A 3HCFA 1TZKA 3U3ZA 2VDLB 2PQ0A 5IBCA 4Q7QA 2JA7A 1ZK3A 4RYDA 4DRYA 3J80W 4R2KA 4HX2A 3KYIB 5DH9A 3BD7A 2C35B 3OTWA 1W1UA 2Y1WA 4AJHA 2Q07A 1R12A 5JSHA 3W3AA 5DN6D 4GLWA 2P0EA 4Q7MB 2I1LA 3CVYA 3ZWNA 3VMMA 5FR1A 1OCEA 2OILA 2R66A 3VBEA 3G1TA 4IGKA 1NWHA 5DNYB 4G9EA 4GD3Q 4NK5A 3VAYA 4RSMA 3WKBA 5K3SA 2RCNA 4UTOA 2ZRCA 1AZSC 5HG0A 5KNDA 4L8FA 4CKWB 1TWFA 1ETHA 3NRJA 1BXRA 1U8CB 1A9XB 4Q82A 4MWBA 1GN9A 4PGHA 3Q6NA 3L0SA 3UHOA 2ATEA 2GPBA 1YB2A 2X8LA 5HE9A 1JJVA 2OQVA 3CEJA 1IBSA 2C0QA 1NNEA 3F46A 2BKXA 2Q8NA 4QL3A 2X19A 3BH0A 1AGYA 1K8ZB 4P7GA 3W9BA 4ECWA 3S0JA 3S1AA 2ZAOA 4M7WA 2ORIA 2D5AA 3WYAA 4DV0H 3B9PA 4PLPA 5H70A 1ZHHA 3KC2A 2I78A 2CW5A 5CVCA 3IVRA 4GKJB 4L57A 3HBMA 1NMQA 1XRQA 1MZBA 2YV5A 1WQ3A 2CF5A 2HT6A 4N5IX 5HJ7A 4PGFA 4X90A 3QX3A 3I37X 4ETSA 2Y92A 4C1BA 3M6LA 1N4DA 4QQKA 4HDKA 3KHGA 3BOSA 4QYIA 2E6KA 3CX4A 2HA0A 2IKSA 4F9EA 2HC9A 3DBRA 4URYR 4CR6A 1ZKDA 1XZPA 4M76B 2LCQA 1ZCZA 4H6XA 2CLMB 3FMOB 4EFDA 1IM2A 2FRDC 5EE1A 3V9PA 3QBEA 5LLSA 4X1KA 1K8YB 3DS8A 2VNAA 4UHHA 1B26A 2V8OA 3TR5A 3HKDA 1UMDB 5DLPA 1JEQB 2F8SA 3C6ZA 4RH3A 1A88A 3DSRA 2EKDA 5A4AA 1YO6A 3ZX5A 4LOIA 4S2EA 5AI9A 5E9JA 1JTFA 1F8FA 4D3YA 5JMWA 4BBPA 3KAJA 3LPMA 1JPVA 1MHTA 1MV5A 2VTBB 4RMNA 4MW7A 3L8MA 3BK1A 4K9RA 2ZUDA 2V6JA 4J9PA 1E4YA 1Y9JA 5K0ZA 4FDLA 1D2EA 4TLAA 4IHAA 1GNSA 4RWZA 2CB9A 3SNOA 4O84A 4ZI7F 4CM4A 3QY9A 4MQ4A 1AQJA 1AV7A 2JVKA 3DOHA 5IKOA 1ABFA 3M5DA 3SIRA 4OLHA 3N05A 4OEHA 1EFRD 4BXOA 4TXHA 3PXCX 1A2QA 3UXYA 2HLPA 3M4IA 2XR1A 1LVUA 2HG8A 2RBEA 4XVHA 5JE8A 3R7FA 4EHAA 3VH2A 1RYBA 3C4VA 3KQMA 4O8ZA 2F3TA 2GJAA 2WTXA 4AJLA 2HF7A 1ULBA 1MC8A 4BQEA 1CR6A 3MJSA 2G9UA 2WWHA 4R0VA 1YTUA 4KQ9A 3ZU3A 3K0AA 2OQ2A 2GERA 3KQNA 1V26A 5JAHA 1MMFB 3BIJA 4CMCA 3LUCA 4RE6A 1XP5A 5LP6C 1UJ2A 4BNIA 1RJ9B 3O6VA 1Z8HA 5E3JA 4FJ2A 4GI5A 1YQXA 4ZVRA 1KP9A 1DEHA 5KUTA 3SY8A 3VPGA 1G2PA 3L0PA 3NJRA 2FMAA 5L3VA 1DC4A 1EVQA 1X7HA 2WMDA 2I54A 3FYHA 1YS9A 2GR9A 3WVNA 1JALA 3HH8A 3WDSA 2QX6A 5KTNA 2R6R1 2EZ4A 1NOIA 3EW7A 1GA4A 3L4KA 1KQFA 1LS1A 4EF4A 1NL3A 3HCCA 4PGMA 2W2OA 3ICOA 3KEFA 2O5EA 1HEYA 2NV0A 4OHCA 4E13A 3OHMA 1LLFA 3CX6A 5KSYA 2JAWA 2A9PA 1GDDA 3I6IA 4BMOB 1H6AA 3UT5B 2O05A 3G59A 4L4XA 1UIMA 2CWWA 4YPOA 2OH2A 2OAQ1 2ORVA 3MFYA 1MFZA 1E7QA 2Z3VA 4KR0A 1PYGA 2QZSA 2HJRA 2VOEA 1NF8A 5H4HA 1I7SB 5KSZA 3HE3A 1AOXA 4Q3BA 2C7PA 2QRUA 2Q3CA 3PRYA 4NBUA 3TJRA 3JZMA 1WUYA 3KPUA 3MSXA 1PZNA 3NEPX 4IQ8A 2CFSA 1Z35A 4R5MA 3EAFA 2BFNA 4DIKA 4FNMA 4P35A 4Q6WA 1FP6A 3OZDA 3ZXSA 1OB2A 2COJA 5J9FA 1B2RA 4RDCA 3TCNA 1TGVA 4QW8A 3QWHA 2BGIA 4ECXA 4INZA 4BNMA 3B2NA 1A5AB 1LLQA 3UJNA 4JDPA 3A1EA 1QYVA 1OX5A 3HNRA 3W5SA 3QMVA 5ED0A 3TOZA 5KYVA 4Z5XA 3I1JA 4MRAA 1AY0A 3ZQUA 3MELA 1T1EA 3DVAB 1GKKA 2C5EA 1HTBA 3HBNA 4GVLA 2P9YA 3EH2A 3E9DA 2VPXA 2AFHA 4KGVA 1U2RA 1PWEA 1YBMA 2ZB7A 4NOMA 2CN1A 2CMHA 3ELYA 3MILA 3KE8A 4QXOA 3FTQA 2ZRDA 2MSLA 1QR6A 3AYZB 1L4MA 3EX7C 3ANMA 1U4NA 3GMTA 3IXMA 4LSXA 4LXIA 4OL9A 3TWOA 4UFZA 3H5OA 2VDJA 2WOOA 5C8DA 2YJ6A 3RJ5A 4XX0A 4LRYA 1DJNA 4DCNA 3TGPA 2EGGA 4RAZA 3USZA 4DUYH 4FMCB 3SBEA 2CVFA 2IPLA 3DM5A 4QGFA 1VLMA 3UYKA 3HJRA 4GPTA 2E55A 2AV6A 4M21A 3GG2A 4B8YA 1J9ZA 2QZ9A 5IANA 3SIXA 1KZ1A 3OMWA 1CZLA 3FMIA 1PJAA 3UXHA 1RJEA 4KQXA 2UUPA 3GV0A 3X2EA 5IT0A 5LQNA 2QQFA 4OUKX 3CUEF 4DR3H 1U7OA 4QLOA 5FO1A 1I1MA 2C04A 2GRAA 3IHLA 4AMGA 2QMOA 3H0CA 3F6PA 3BWXA 4KWTA 1TVKA 4ILKA 1NW8A 2Q0QA 1P1KA 3JAMA 3V8RA 2WW8A 1NR7A 4RHYA 4Q39A 4FE4A 3F67A 2HGSA 3LU1A 1KMQA 2VOJA 1E96A 2O3RA 4QIWA 5H8WA 4IRMA 1DX6A 4CV3A 1ZAYA 1J8VA 4LTDA 4MYHA 2XDQA 3WLAA 1EK2A 5ARCA 5AVZA 3LOPA 4AYBA 1GFWA 3LBIA 1PL7A 1RNLA 1RE1A 4TTTS 1CDEA 5K0NA 5DHPA 1XXLA 2YOHA 1OY1A 1XVVA 2HRZA 1JT2A 3D5EA 1XGKA 4MGHA 3ZLJA 3EZGA 3COVA 4K8OA 2CNKA 1IN4A 3W8RA 4L08A 1ZBQA 2ZR0A 3AM3A 3FRHA 2BT4A 4WQMA 4JEUA 3G2MA 2JJ1D 3EJWA 2B5OA 4CF6A 4YVFA 2WIJA 4CHIA 4DY4A 4MSUA 4F6CA 2F6RA 4BKQA 5G41A 1ZD2P 5FL7A 2DFKB 4XOUA 3DLPX 5C3UA 4HGQA 3FPJA 4W7HA 1M5UA 2CLIB 3FZNA 2YZNA 1TT5A 4B3RH 2ZYSA 1PHPA 2NSDA 4KI0A 4L4UA 3F6EX 1NSTA 5I5GA 4O3NA 4Y9DA 3D5TA 4EQ6A 2VTVA 1G3IA 3VR5D 1X92A 4AKGA 2OSBA 4DUZH 1ZU5A 5EE5B 4IR7A 5K0FA 2XB4A 2VUUA 3EY4A 3PSHA 1RI1A 3ZIDA 2W6JA 1DIBA 5KNLA 1SUBA 4YMIA 2HXYA 4IY1A 5B6PA 3FHJA 2Z58A 4CR7A 4M1KA 1M6NA 2FOLA 3LCMA 1F2VA 5EJ9A 2VAWA 3G2QA 3AESA 1W9MA 1EUQA 3VH3A 3TL3A 4YRFA 5KT6A 3MN1A 3F4LA 1CR2A 2WRZA 1TYCA 4X5OA 5BMVB 4IAJA 3ZCTA 4YJKA 3IPCA 1DEAA 2OGWA 3N39C 1R4NB 4Z8XA 4QGHA 2WD9A 3WGUA 2XWQA 4Z1MA 4PNZA 1AHNA 2AGPA 2FLNA 3BN3A 2NZJA 1MX1A 2DABA 4YXWA 5DNWA 2GBIA 4XX1A 4CIBA 3SYTA 1BWQA 4HNHA 2CQYA 3QI7A 1KTAA 3GUZA 1U90A 3IG0A 4YLEA 1GUDA 2X1MA 3PDIA 3AU8A 3N8DA 1QFXA 4UQLA 3HVIA 1QIFA 3FCEA 3GIQA 2Q8PA 1NBHA 1NW5A 4BNXA 5IW8A 5HKKD 1PL0A 1CQXA 3HU3A 4EBFA 2PUDA 1KJJA 3AVUA 3U0VA 4AFNA 4ZI3A 1ORVA 4DCVA 1OU0A 3AETA 3AB3A 5BSKA 4CM8B 1W0CA 2VJYA 1N36B 4CCYB 1CSEE 3CE6A 3LQ1A 1N9KA 4BVHA 5LA6B 5A04A 1N9ZA 3TTUA 4A8PA 2DC1A 5B55A 1CJMA 3RC9A 3AHEA 3LC0A 3EDCA 4JNCA 1HGXA 2B9EA 1O54A 4J9MA 4H7JA 1P4JA 2C9BA 4Y8VA 2XQIA 9MHTA 4CT5A 4INOA 5IK2D 4GC7A 1T3HA 1GNPA 4EA7A 3EVDA 3DKVA 2HSJA 4A8JC 1DOHA 2ZSJA 1T6XA 2JASA 1QQTA 5DI9A 3QVGB 3UAXA 1L4KA 5KTYA 4CEJA 4GU5A 3P2KA 1VFNA 2CFIA 3BFXA 4CIXA 3IKMB 2IIQA 1XU4A 1X14A 5JC1A 1EZZA 3EGDA 2LVBA 4R7GA 1FDIA 4C0SA 1RLIA 4J3JA 2COUA 2ZUBA 2WQ6A 4ROTA 3W5AA 1OV6A 4BGVA 2IHZA 1Q84A 1FSSA 3F5SA 5PNTA 3BZUA 2O7NA 2Z8YM 4EHFA 3U4HA 2IFTA 2PXCA 4EB0A 4MI3A 3AM5A 2MYUA 1FYFA 4RM2A 1X1AA 2XUIA 1PWYE 4WBNF 3LLUA 2RC6A 1ZVKA 1UKVY 3ZNOA 1R8XA 1FQJA 2B1IA 1IL0A 4BO5A 3EIQA 2GTHA 2RHWA 3KT0A 4LJAA 1ZW1A 1BS2A 1QOPB 5TGDA 2Q9BA 2GD1O 1V8ZA 2Y71A 4YHHH 3G0GA 5ES4B 1GQRA 3TLYA 4I55B 1RWMA 5IAKA 5J2TB 3A36A 2QRJA 3OOEA 1UC4B 2NU9A 1J22A 3VM6A 1GM5A 4E33A 1QKKA 4QZVA 2WE6A 2Q5QA 3T3EA 5ERYA 2BGLA 3LX6A 4FDMA 4K0KB 3P9RA 4DDVA 3DV2A 4MIOA 4B81A 5AXDA 5E4FA 3C0FB 3WAKA 5IPFA 4XJSA 3B6IA 1OZFA 2Z2IA 5BN3B 3Q8MA 3X1WA 2DFPA 3KBBA 5EC8A 2C9YA 3MUEA 5A9SB 5BPHA 4TLLB 4CGZA 4RPCA 3W1GA 5G4KA 2W6PA 2ZIZA 2Z5VA 4J0EA 1JIVA 4R31A 3FHOA 1IFXA 4EUNA 2FZLA 3JALA 1NSYA 3UN1A 3ZDYB 1BFKA 5G40A 1UAGA 1W4BA 5TT0A 3IE1A 2GARA 2CL5A 3LYHA 3ZU4A 5FLMG 1CHNA 1O89A 2DLCX 6ADHA 3FNHA 4XFDA 4C14A 4FWTA 2PLRA 3L6UA 4TWAA 1R1DA 1IEWA 2J85A 1N0IA 2Y0BA 4JX9A 1D2MA 5KYUA 4BLUA 3FVTA 1EFUA 2JZCA 2WKRA 2OCLA 2QB5A 1XAGA 4HAVA 3V1UA 3BQNB 1KHHA 1E3LA 4LZAA 2VWHA 3H1FA 2IYEA 1JVBA 4B7AA 1SCBA 2I9PA 4F6RA 2GEVA 4DR2B 4YGYA 5AKGA 1QG2A 5IAEA 4FWBA 5KG2A 3GZNB 2HSEA 3TTSA 4OXRA 1ZZGA 2NZYA 3UG7A 4EHLA 1GNLA 2D5IA 4WOBA 5IKEA 3AH8A 3GLKA 4E32A 3VVLA 5JJCA 3EJ6A 5IDWA 1E66A 4N40A 4HEHA 4X24A 4YCLA 3WGJA 1SGWA 4DNPA 2VJCA 4BWSC 3FCYA 3Q5EA 2ZZKA 2VDWA 3MT0A 4X7RA 4RM3A 3TXXA 1OUMA 1F8UA 4XAQA 2HHAA 3WMEA 1QTNA 2P2ZA 4MQMA 1AKUA 3RYFB 3IALA 4B3DA 1XEXB 1FYEA 1RM0A 2H4JA 3I04A 4JGGA 1E20A 2R8HA 2ZWPA 3IV9A 5CB4A 3NHJA 2VK1A 3CC8A 2AEEA 1A8HA 5DBOA 3FPGA 1XLWA 2HADA 5CG2A 4YV7A 2IP4A 1DO8A 2EEPA 4DOMA 1YOBA 2UYOA 2WF7A 2BTQB 2WLSA 3AVQA 3ZV5A 1ZNQO 4FD2A 1SVIA 3G6KA 3KDSE 1WMBA 5AM4A 1I2AA 4U6PA 3F7NA 3ETHA 3AY6A 3UJ3X 5D5QA 1XKTA 2VN8A 1MO5A 3HCAA 3OQPA 3CE9A 4B3MB 4QXAA 2BR0A 5FWNA 1MAVA 3PN1A 5AM5A 4KACA 3E22B 2RHRA 2WTEA 4HQFA 2QV7A 4PRZA 1WY5A 1M2NA 2IU0A 2FK3A 3V7FA 3WGZA 1D6JA 4GI7A 3FPCA 1AKVA 1OI4A 2H2HA 4PZYA 2HREA 1WDKA 2FSPA 4HDMB 2QPOA 3CPSA 4TV9A 2C0PA 1FVXA 4YRLA 3ANNA 4A2QA 1Y3BE 4DR1B 4GKBA 5M34A 2Y4RA 4QWCA 3KAQA 5B36A 4BBSG 4F4WA 3DE7X 2RGRA 3B1FA 1EGMB 3AK4A 5CDHA 1ZICA 1C80A 2VT2A 3U7EB 5TNXA 4ND1A 5EQTA 2V58A 3GUVA 3GRVA 2LCIA 3C5CA 3LHFA 1A48A 4AT1A 5K45A 3GEIA 4EEZA 1E2QA 3LLCA 3DL0A 4FOOA 1DJLA 3L7IA 3PR3A 3GJ5A 1OVGA 2AOWA 3IQIX 3IL2A 4BO3A 1XCPA 2H29A 1ZDMA 4AM8A 1N9GA 2D2EA 4JVSB 3SKXA 1CETA 1P2SA 5M7EA 3U7HB 4ONEA 2H7YA 3IMGA 3LOQA 2MOKA 2DCUA 2PEYA 4X64H 1M1UA 4HJXA 4LRWA 4CEIB 3Q7RA 4E5MA 5KFMA 1N2CE 3Q6IA 4TGLA 4YDSA 2GN8A 3E9RA 1XX6A 3ZDAA 1MO4A 5EJ2A 3EVAA 1BVYF 3G3EA 3R40A 2HCJB 3PYMA 4QEKA 3ZBTA 5HK8A 4RB1A 1OB5A 3P9KA 1HNZH 1M5TA 3B51X 1VJTA 4JBIA 1PZFA 1I1LA 1L4BA 4MICA 3OEWA 2Q45A 3VO9A 2O4CA 1TXGA 1SNYA 2QUHA 4LBVA 3SP1A 3ZD9A 2QJFA 5HQ3B 2ZROA 4NZPA 2EJCA 5EQDA 3E4DA 1JIJA 5IZCC 4PLFA 1YULA 4O2AA 5T4BA 2R1TB 1W94A 4OP1A 3TKLA 3L93A 3TEMA 2ILVA 2DLNA 4QDTA 4A2BA 1SCJA 3SZOA 5JY1A 1CRZA 4IDGA 3GLHE 3PZRA 1IVNA 4LJYA 2P4EA 5HF8A 3H19A 1O8CA 5KFCA 4KFCA 3VVMA 3REFA 4EJSC 1O9GA 4EHJA 1LNQA 3CO5A 1W87A 1Y3DE 1YQ9A 5F9MA 2QL5A 4IXDA 2J6SA 1M1YE 3PHHA 4JUAA 3UMBA 1M74A 2IBSA 2TSYB 2XUOA 4JUCA 4CQMB 3EN0A 2BAGA 3O8QB 4IJUA 2XADA 4YB8A 4C6HA 5B5SA 2PVCA 1FDOA 4XQ9A 5C8YB 5LQAA 1XMQB 3CEHA 3HRIA 4O3RA 1CS0B 2XSZD 4F38A 4LKRA 1TKAA 3T5MA 3TMKA 1JQ5A 3RODA 2P2YA 2GFIA 5C5JA 2YJ5A 2BM9A 5KOHA 3I2JA 1SKYE 1NN3A 1KTIA 4P5PA 3VNNA 2H9AA 3DTFA 4HP8A 4IG4A 3S7ZA 1SQ0A 2HQBA 5MGBA 5CA0A 1NY5A 3V8BA 5KNCH 1EK1A 1LV7A 1FQKA 1T6ZA 1FX1A 2M1ZA 4IIBA 2Z83A 3SZ3A 3UMSA 5G1OA 3TI7A 5E1MA 1BWRA 4NABA 3PI6A 1FDUA 1QSGA 4E1AA 1GHTA 2JAOA 3L5OA 1OGJA 3WWJA 3JASA 2FF5A 4QVGA 6AT1A 3NIGB 2HIMA 5I9IA 5LDDC 4ZYTA 5K8LA 3B89A 4OAOA 3THWB 1VG9B 1K5DA 5DBFA 5A6SA 4HF7A 4M1TA 3OU7A 3TSZA 4BO2A 1RJWA 1RWWA 4IDNA 4AZ0A 4WAUA 4BP9A 3CF4G 4ED9A 5H1YA 2FSFA 1KMNA 2OWEA 1FVFA 3BIOA 4D3FA 1O94D 2IE0A 5JZMA 3Q5DA 3ZVMA 1IPHA 3PO2G 2PAFA 3ENKA 2F2TA 2CVPA 3WK7A 1VXOA 4K88A 5DYWA 1EM6A 1LY1A 4OFZA 3I45A 1XCLA 2W6IA 5G02A 1C0PA 3L0IB 4ZT7A 4ZI5A 5HGXA 2IXGA 3NALA 3LPLA 3OCJA 2I7VA 1Z26A 3QXSA 4B6FA 2QT9A 2Y27A 4D80A 3GB9A 1EP3B 1DT5A 4HR7A 1F6WA 9LDBA 2IYPA 4O4HA 1V3TA 4S0ZA 1HLFA 4L5YA 3CT4A 3I53A 2ZTSA 1YK0A 4TQUS 2Y99A 1E3WA 5JNVA 1EM8B 3LC1O 5CBKA 3G7UA 3HLKA 1TWHA 5FOVA 1XAIA 1YQDA 3AI7A 2GPJA 5CURA 4WY2A 4CDNA 2BHTA 4DQKA 3ZXXA 2O2HA 1ZJZA 2AG5A 2CJXA 1PL8A 1TRKA 4U4AA 3IB3A 1WX1A 3L0YA 4EZEA 4DLPA 3R3SA 1RYEA 3LQKA 5IJZA 4MYCA 3GV7B 3AJDA 4JLBA 3KQOA 3N2YA 2GVZC 4EF5A 1FYVA 1WVMA 1I2KA 2ATLA 4A3BG 4NI5A 2C4KA 3Q6MA 4YAUA 3FPBA 1X1RA 3U4QB 1Z15A 1V4BA 5IAJA 4B6RA 3QVOA 2H7XA 4JP5A 1RPNA 4QEZA 3C7DB 3IO5A 3G8CA 5J4YA 1NDHA 3DHYA 2P78A 3ZI0A 3DAPA 3UGKA 1E4EB 1KKMA 3KELA 3ECAA 3KK0A 1EESA 2OAP1 1YS1X 3HSKA 3NNDA 4IHQA 2FZVA 2Q5LA 1CLEA 4QDOA 3GNLA 4QKQA 3K1TA 3PUWA 1CWUA 2CDRA 3GJRA 4KHPB 2W58A 1C0KA 1LW6E 2ZATA 4P7KA 3K5WA 4NYJR 3B1XA 5FDFA 2Q27A 1Z29A 1YHNA 2FZGA 5LXTA 3RADC 4BZPA 2V7UA 2HK8A 4P4NA 4RK6A 7ABPA 1IWPB 1I0LA 1U31A 4ECQA 4IINA 3EGXA 3AEXA 1JS1X 2NAPA 2G9ZA 4EVQA 4UXHA 4RUKA 2C3MA 1PR5A 2XOEA 2FN9A 2OENG 1TL7C 2JEIA 4U7DA 3GUYA 2A9JA 1R0CA 1P3JA 2YHIA 5K3AA 5J47A 3AQIA 3CVJA 3RR5A 4UBKA 1REQB 2F1OA 2X0NA 2FB9A 1WVGA 3QF4B 3S3TA 2C0CA 3DKKA 4D6XA 2F55A 2Z4SA 3DFMA 3OLQA 5LZ5A 5AW1A 2YX1A 1B1CA 3UM9A 4FONA 1JJAA 1UDRA 3S27A 1CUFA 2DWQA 5TEVA 3HPRA 1L8XA 1P0MA 1PJQA 4DWJA 2ZR8A 4QNNA 3P20A 3PE6A 2ZUSA 4OB8A 2I4IA 4PXYA 2FMFA 5DM0A 2A58A 2BGKA 3A26A 2JKYA 2PRYA 2JGDB 3VJKA 3GT0A 3AFOA 4ZCTA 1MAAA 1K66A 1M2VB 2UAGA 5LN1A 1YU6A 1P9OA 3IUMA 2C5AA 4NDNE 5JIBA 2Q5FA 1XMVA 1TZ2A 3WGIA 4HS4A 3D0KA 3ASYA 1UPXA 3JQBC 2YW2A 2PWYA 3IAXA 3OQ6A 2BBOA 3PHGA 1YAJA 1FTQA 4ND8A 2BMEA 2NUTB 3C5EA 2A30A 2P75A 1X8KA 1KU0A 4GXNA 1H2BA 5J4KA 4ZT3A 3QELB 4GP9A 1VLZA 4HOYA 2VP0A 2CXXA 4K0KH 3Q1KA 4HDNA 2VXBA 3JPYA 3MUFA 1KZ9A 3RARA 4H7HA 3M5CA 3JR3A 1T43A 3R0IA 4BO6A 1X7ZB 1E5LA 1UM9A 1DIHA 1W34A 2MSWA 2FFBA 4DL9A 3KWJA 3QFCA 1AKMA 5FWYB 3EFEA 3PNSA 3W3AD 1N3LA 4KQFA 3O4VA 4F3RA 4W5OA 4OPMA 2VLBA 4NAUA 1E3QA 2QLNA 3EEOA 5I3CA 3KUCA 2KYRA 1HFKA 3IS3A 3ENNA 3BF8A 3CEBA 3RUEA 4HWPA 3O5AA 5KNDD 4FE2A 4RV4A 3UJBA 3F7MA 2O20A 3T3HA 2NIPA 5DF1A 2P2NA 4J94A 5I4IA 5CXSA 1FUEA 4YBZB 1EFAA 4LNHA 2D00A 4OXIA 2FR1A 2HBZA 5JANA 4BTVA 1P77A 5IVPA 3QQMA 1JNYA 1ZH2A 4MQUA 4RNNA 2Q4TA 2V7EA 3EIXA 3IBGA 4C0XA 1YE3A 4HH0A 4PFQA 4KJXA 4IF4A 5FPRA 4OLFA 4O02B 5AI5A 1B6RA 4IFIA 2IA6A 3TLAA 4DR4B 1WXIA 2ZTUA 3GA7A 4K6CA 3AUUA 4U3JA 3JYOA 4S24A 4YJGB 3W9YA 5KYYB 5KYKA 3NTLA 5KINB 4DCSA 1V1JA 1OMOA 1MXHA 3NBMA 1QHHA 3I64A 3RVSA 4DR2H 4B2PA 3FOZA 1TK2A 4D9FA 3JRWA 1Q92A 3ND7A 2HHFB 1KORA 2INGX 4GT1A 3HXQA 2P4QA 1OH8A 2DFTA 5BV2P 2LXNA 4ECAA 2XCQA 4FPXA 3SEZA 3JWHA 1CQPA 4MJXA 4PYMA 5EHZA 3TIVA 4E5YA 1ZVMA 1M7BA 5GP1A 1R18A 4BNKA 2ERYA 4AN4A 3O21A 4KDRA 2HEGA 2VNHA 4R6WA 1RWVA 3VKVA 4KDEA 3LFUA 4P4SA 4XDHA 3MERA 2XQVA 2PRJA 1KRXA 3A6HA 4Q4AB 3BXPA 1L7VC 1PT8A 3ZNPA 2NX2A 5L3SB 2XCUA 2HDNB 4LDRA 1QKJA 3HCPA 4MV7A 3PQDA 1QHXA 3N58A 2DAPA 4C0KA 1HMPA 3E48A 3DHWC 4K40A 2XRFA 3TUIC 4IVQA 2Y0SA 4ZVQA 2GQRA 1MHPA 2BR5A 2I34A 1DUSA 4RU1A 4Z8YA 1PX2A 4LVUA 3BXFA 1EE9A 2XMBA 4AK9A 5C1PA 2OQRA 3BHJA 2OCPA 3D7MA 2V54A 1NASA 1D2CA 3SSAA 2Y6UA 4JH0A 3C43A 1MGPA 4B44A 1J8DA 3DHVA 2NO0A 4B3MH 4J07A 2ZXFA 3CONA 1JG6A 1N7IA 1GFSA 2CNVA 4EFKA 4CMHA 2GEBA 3I3OA 2X41A 2WUDA 1BMQA 1Z0JA 5TMEA 3BMQA 5B7GA 4UUOA 3FUTA 1IN6A 3JU3A 4NZYA 1UDXA 4GE3A 3DQZA 4JEMA 2X1VA 1NE7A 1RBMA 4GMFA 3I9LA 5LD2B 1PO7A 1YR6A 4BCCA 4CIAA 3PV0A 4YWJA 1Z7EA 2OSVA 3IIJA 2VJLA 1S3FA 1VOTA 4IRUB 5IYZB 4DR1H 1M0SA 1OBOA 4Q3EA 1NAHA 4EO9A 4ESVA 4XR9A 1U98A 2FN4A 4RSHA 4O2RA 1I94B 5DM1A 3KOMA 3UWMA 4G8BA 3GCXA 3PDCA 4JUFA 3PLRA 2QD4A 3ZQJA 1CYDA 2ZE5A 1R8JA 2CKDA 2XD4A 2C3UA 1XQ9A 5EZ5A 5JWHA 1KPGA 2PCLA 4OHVA 2RH5A 3HKZA 1LDEA 4FLFA 4N1AA 2AX3A 4CCSA 2V3WA 5I7AA 2Q9AA 1H9AA 3QKRA 5AJYA 4RVDA 1NXWA 1NSFA 1V39A 4B9AA 5J40A 4NU6A 4Q12A 4F4DA 2KWIA 2P2LA 2DPIA 2JAPA 3SYNA 5AKXA 1TI7A 2WTUA 1XNQB 1HKHA 3V8MA 5K6AA 4YH1A 4TQGA 3LJKA 2ZUCA 2OBLA 3WV5A 4G89A 3RSQA 2EHDA 2X0IA 5IC4A 4DLWA 2IUYA 1QF6A 1S8FA 2VO1A 4ED8A 2Q2OA 1PQPA 3SDSA 3TMYA 2HRQA 2CLDX 1M33A 1WZEA 5BT9A 2H59A 1LTHR 2B4YA 2JGLA 2VL7A 3LGXA 1BQ4A 1FB5A 3B38A 2DBVO 4NY1A 4A6DA 3NETA 1RCUA 4ED1A 4EY4A 1UMBA 3RYHA 1LXCA 4OSEA 3NVKI 1FNMA 4E2ZA 3TYXA 4U7WA 1V9CA 4HN9A 3WJ7A 3CV3A 3JYPA 2ZT5A 4POAA 3UJ6A 4I1SA 1K5PA 3LQ4A 3FROA 1W4RA 3O8RA 4D9IA 2XQJA 1KE1A 5D87A 2AOTA 4I0WB 2QN9A 4JT9A 2OM2A 2B6HA 1Q74A 4Q0MA