4I50F

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
379
structure length
303
Chain Sequence
MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYLAAYNRRREGREGNVWIAKSISSEASELLDFIDEVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSTNHCIQKEYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLADPTSIFIKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 78
structure length 303
sequence length 379
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4i50F02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4i50F03
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i50F01
4XZ3B 4FU0A 2YZGA 3RV4A 3VPDA 3KAJA 1KUTA 1B6SA 1DV2A 4FFRA 1JKJB 1KBLA 2PN1A 1JDEA 1CQIB 1BXRA 4IHJF 4IZOA 2YZMA 4O7RA 3HBLA 2VR1A 1C30A 1GGOA 3I12A 5BPHA 2I80A 2HJWA 4DLKA 1BNCA 4WBNF 4FFPA 4HNVA 4MV3A 1VBGA 1A9XA 2XD4A 4TV8F 2FPIB 2GPWA 3E5NA 3KALA 1WR2A 4HNTA 3U9SA 2R86A 3DF7A 4ZOLF 4ZI7F 5LYJF 5LOVF 4MV4A 3AX6A 1Z2PX 1UC9A 3TW6A 5CA0F 1GLVA 2Z04A 1M0TA 3JRWA 2ZDHA 4FFMA 4MAMA 2GQRA 1GSHA 1GSOA 3V4ZA 3TINA 3R5FA 3N6RA 3WO1A 1T36A 3OUZA 2J9GA 3VPCA 5C8YF 4O4LF 1KC7A 4YB8B 2YRWA 3JZFA 2NU8B 4M9UA 2FPGB 2YZLA 2YYAA 2I8CA 1M6VA 2GQSA 4RZQA 4MA5A 3VOTA 2I87A 2W6MA 1JLLB 4FFOA 5JH7F 4FE2A 2DIKA 3LP8A 4O83A 4QSHA 2R7LA 2R85A 3K3PA 5JVDF 4FFLA 2R7MA 2W6PA 1PX2A 5C1PA 4EGJA 2ZDGA 2CNQA 2NU6B 3R5XA 2HGSA 2CNUA 3G8CA 4O7LA 3R5HA 4MV9A 3GIDA 4O7SA 2P0AA 4O7YA 3UFXB 5HV6A 1GSAA 3K5IA 3BG5A 3HB9A 3TIIA 3MWEA 4YJ3F 4YBZB 3K5HA 3RV3A 2WYOA 3VMMA 2W6ZA 5I47A 2DZDA 1VBHA 2R6FA 3VA7A 1I7LA 2VQDA 3WO0A 5FNVF 5IYZF 2NU9B 2R87A 2W71A 2V58A 2W6NA 3N8DA 4EG0A 4I50F 4FFNA 4XX0B 1OBDA 3RUPA 5BMVF 3ORQA 5BPFA 4EGQA 4XYLB 2NUAB 2GPSA 1EZ1A 4O7VA 2Z02A 2NU7B 1Z2NX 4HQ6A 3U55A 4MV1A 4O7ZA 2C00A 4YJ2F 1EHIA 1OBGA 3R23A 2R7NA 3Q2OA 1IOVA 3ORRA 3KREA 5LA6F 3OUUA 2PVPA 2PBZA 2OLSA 2W70A 1UC8A 5H80A 2CZGA 5HBRB 1KJJA 3ETJA 2FP4B 1VKZA 3RFCA 5LXTF 2SCUB 2XCLA 5CA1F 3MWDA 2DLNA 4O86A 5KX5F 3TQTA 4XYMB 2X0SA 3QFFA 4MV7A 2QK4A 2ZDQA 4Y8VB 4IWXA 4O82A 4TV9F 3TIGA 4O4HF 1JDBB 4HNUA 3NUAA 4I4TF 5J2TF 3KAKA 1AUVA 2DWCA 3MJFA 4YAJB 3HO8A 2FPPB 1AUXA 3AW8A 1EUDB 2W6QA 3G8DA 3GLKA 1W93A 1CS0A 4E4TA 4WD3A 3R9RA 4HR7A 4O7TA 4MA0A 5JVLA 5JQGF 5CB4F 4IWYA 5CAEB 2V5AA 2YWVA 1EYZA 1A48A 3JRXA 4O2BF 5EZYF 4O81A 2IP4A 1Z2OX 1C3OA 2CNVA 5GONF 2R82A 4O7NA 4DIMA 5K2MA 2FB9A 3JZIA 4O4IF 5DMXA 4C5CA 4NYEA 4MV6A 1EUCB 2YW2A 2YZNA 1CQJB 2R84A 2R7KA 1PK8A 5LP6F 4C5AA 1KJ9A 4O84A 1KEEA 4ZHQF 1I7NA 4FGRA 2CQYA 5JQWA 2YS6A 3U54A 2GLTA 4C5BA 1KJ8A 3U9TA 3VPBA 3WNZA 2YL2A 4I55F 4L1KA 4MV8A 1E4EA 1E4EB 2W6OA 3Q1KA 4IIJF 1M0WA 1KJQA 1DV1A 4ZQIA 1IOWA 3V4SA 2VPQA 3SE7A 4TUYF 4O4JF 5J2UF 4O2AF 2YS7A 2V59A 5KKNB 4ME6A 2QF7A 3ETHA 1CE8A 5D8DA 1W96A 5C1OA 4YAKB 1DIKA 1KJIA 1ULZA 3LWBA 2YRXA 1B6RA 4O7WA 1SCUB
chains in the Genus database with same CATH superfamily
4QFDA 3QJYA 1O97C 3DE4X 3BF7A 4UBNA 2XRFA 4MJXA 1GEGA 3UAOA 3RV4A 4FS2A 2GZSA 4WDQA 1PR4A 1VIDA 1R10A 4OSOA 2IZZA 5HGXA 1B8VA 4EA6A 2QVCA 2RHMA 2FPXA 3G5AA 3MXOA 4OLFA 4PGHA 3QQ5A 1DTWA 2CK3A 4C7OB 2PGDA 4FUTA 3T3IA 4Q1DA 3V6MA 1GXSB 1KDZA 4EFEA 1FMJA 1GARA 1VB5A 4LRUA 2A9FA 4LBVA 4RVSA 2C61A 5G0SA 1E8DA 2KWIA 2MJLA 3NJ8A 4Z9XA 3IRUA 4F5DA 2PYZA 4P7BA 3G0GA 3NOQA 4YUVA 5LQKA 1D09A 2WV7A 3O8BA 1X80A 3HXMA 2B2XA 2HIXA 3DMPA 4GBGA 3VJLA 4D02A 4FB4A 1TIPA 2PX4A 4LJYA 1XUOA 1G4HA 1QHHB 2YIDA 3DJYA 3R3JA 4JYAB 1KK0A 4YDSA 4PVDA 4S05A 5H1YA 4Q1BA 4JLUA 3I12A 1G1MA 2PD6A 1KVRA 4H1HA 2A0XA 3EFOA 5EXPA 1PDOA 4F2DA 4O4LB 3OLQA 4FILA 3ULKA 2I6UA 4YONB 4EPRA 1YDEA 1MCZA 2VUTA 4MUJA 4FE3A 3W4KA 1GL3A 2D00A 1UP6A 2DWUA 1CIVA 2I9PA 1H69A 1JX6A 2Q8PA 3BMOA 3IXQA 1YBMA 2DPGA 1IJKA 2EP7A 5K3SA 4EARA 4PU0A 4DR2H 5I7RA 1O4VA 4UNSA 1XPOA 3M4YA 3ZTTA 1YC2A 1T91A 3BSWA 1Z45A 5FWAA 3QPAA 4AWBA 1VPDA 1GO3E 1TEVA 2FRDC 3AVWA 1HMPA 1HMYA 1R6VA 1PE0A 2AZMA 5D6NA 3V2HA 1JEOA 4A2PA 2VPIA 1XQYA 2A1TS 3TMAA 1SXHA 2B20A 1BD3A 3BBLA 3NVAA 4JUDX 4ZD6A 1CDOA 5SICE 4AKTA 5ENZA 3CONA 3TRFA 1KQ3A 2QE6A 3KLMX 3CZ5A 1JQEA 3EMVA 3O47A 3GBPA 4EJ6A 1ZGAA 4WZBB 3RODA 1MPXA 1WW3A 1DG9A 1PJ2A 2FW0A 1JSLA 3ENNA 3H1PA 3L4BA 3NETA 4R6XA 1EBFA 1ORWA 1Y98A 4D9JA 4DBLC 3CUUA 4NWIA 2EHDA 4D92A 5FEUA 3MTBA 1PWYE 3VR6A 1TJYA 5GZ6A 4NJMA 4MP8A 3DE3X 4D96A 1N6PA 1I5OA 2XZDA 4GGPA 5IABA 1TB4A 2DU8A 1KARA 3NUGA 5KDDA 1A98A 1U2ZA 2QY9A 2ZVPX 3RSHA 3WQHA 1NOIA 4EPYA 2R00C 1RM0A 1V9PA 1XP5A 3GTOA 3R5FA 3A26A 3UMJA 3VNBA 3K1AB 4YYEA 3AJRA 1AQIA 4CEJA 2G0NA 4G8DA 4JJ8A 4POOA 4YAOA 4PO8A 1PEYA 2I76A 2Y4OA 3RBZA 5ANRB 1K7EB 5CNMA 5PNTA 5C8YF 3OT5A 5E8RA 3SOZA 1SHUX 3JZFA 2FCRA 3HRHA 1D0SA 4HNAA 2JCYA 2HQOA 4MTDA 2QUJA 5BYBA 3M6LA 4UVIA 1RLJA 5LQAA 4FGLA 5TT0A 1M9NA 3DBHB 3J7TA 1ONSA 2RBEA 3ND5A 4NKRA 4E5VA 5EXDA 1IRIA 2IV2X 4Q6BA 5CH5A 2BCGY 4BZZA 3WLQA 3RRFA 2O2EA 2R79A 3GLVA 3CRMA 4CMGA 3PPYA 3BGWA 1SVWA 1C0KA 3EK2A 2ZG6A 4J0QA 4RM2A 1PJAA 3CUWA 7REQB 4HDAA 3BH6A 3T3OA 4EJSB 1S68A 2HJSA 4KYUA 3DP7A 3ZGNA 2FR8A 4J4TA 2EV9A 2EOAA 3BL5A 3OURA 1S6YA 2E1PA 4U7GA 1GIAA 1T2UA 4FTWA 1FFXA 1XZDA 1OBFO 2XDWA 4TQAA 3ZNQA 1AK2A 3ROZA 5CT4A 4CU5A 1BXZA 3IDSA 4FOLA 4I4CA 3R5XA 3HOYG 3EQ2A 3C1AA 2GK7A 5AO9A 5TEVA 3SXPA 4YRFA 4L4YA 1MKYA 3KUXA 4JQCA 5KOJA 2QJOA 2GNOA 3A4LA 3FCUB 1GILA 4A8TA 1RAFA 4XYEA 1D2MA 2RK3A 3EG9A 3TD2A 5DK4A 1A88A 4RANA 2V4MA 4AJPA 3TZEA 1AN7A 3MOIA 4CMHA 2PIAA 2GBIA 1QH1B 2O3SA 4EW1A 2VQEB 1XIVA 3L4BC 4CBVA 1TF7A 2MSLA 1G59A 2WNSA 1VLJA 1ZOPA 4ZU3A 1TPYA 4LJ8A 4DV1H 5E6UB 5CURA 3T3MB 2E2HA 2AG0A 5TS3A 1GG5A 3DGEC 4H6PA 4H1WA 3LT2A 2PDAA 2AXQA 4QREA 4YJ3F 4X65H 1Y34E 2AJLI 4QOHA 5EPUA 4C0AC 2P9HA 4C6TA 5BOSB 2RGDA 1WHTB 5HE9A 3A10A 4RJ2A 3N2ZB 3UG7A 4OJMX 1ECLA 4LYDA 2P2GA 4HXFB 1H1LA 5CPBA 1U2TA 4QDJA 5F21A 2GRJA 1TA9A 3EFHA 3WIEA 4YCLA 5IK2D 3VH2A 3T5MA 1JFTA 4ZAGA 1SXJE 3PL5A 4YT4A 4EEYA 5CTAA 1EXDA 4WY2A 1G3RA 1MEOA 1A7UA 1XTQA 3TIXB 3ES9A 1LFAA 3ZUPA 5AHKA 1Y4SA 1NLUA 1PR1A 4H1VA 4KL8S 1XNQB 4XWGA 4DQDA 4WKCA 2XGGA 4BEWA 3S8YA 3KT3A 1Z0IA 1FBNA 2J3DA 2EL9A 4J9OA 3L0ZA 4B7UA 4S24A 1CF2O 1W9HA 2ZRKA 5FTJA 2H4FA 5KNBH 3NRJA 3OIFA 2ZVJA 4BBSG 3DAHA 3W2EA 2WOJA 1UFOA 3H9GA 3SHOA 4AKEA 3T9DA 2EJVA 4XLZA 1UKAA 2F59A 2H1CA 2X0RA 2YWHA 3FW1A 3GI1A 3WVNA 1QR2A 5AHOA 4EVSA 1INLA 1J0AA 2QX9A 2JARA 3C7CB 4GEGA 1UBOS 4YMUA 3OFNA 1FX1A 4WH0A 2C9BA 3I52A 5BN1A 1BDBA 3FB1A 2OGZA 1TYEB 3O3NB 1V8FA 3BORA 3H0KA 2GPSA 3HCOA 1LNSA 1A9SA 4EKNB 5A5DA 4XARA 4IZ6A 1KMMA 3GPIA 2O07A 4A3SA 2ALZA 4YP6A 3J80A 3DBRA 1ZQ7A 1AKUA 1KERA 2ROQA 3EX7C 3HP1A 3K15A 1M7BA 1V3TA 2A59A 2FG5A 3KLOA 2WSSD 5DLQC 4B43A 2JAHA 5LOVB 2C2WA 1XZGA 1CDDA 4MQFB 4KPEC 5CM9C 4M9SA 4I1PA 1OYVA 5K03A 1ATIA 4B3SH 2D1FA 2EEPA 3MAGA 5JJCA 2FCAA 4A23A 2VT2A 5LXTA 4DJEC 2AJCA 3PUIA 4Y2GA 1U63A 1YB4A 4K9MA 3O4VA 4JLKA 5F1YA 2BM8A 1MO4A 4RXUA 4C0XA 4DUYB 1JFSA 3LC7O 2ZXEA 1UPXA 1KK1A 5GADl 1PGNA 4M7WA 4O33A 2WIGA 3E58A 5A05A 3BICA 3AILA 1HL3A 1UIRA 2JJ2A 3DNFA 1XVLA 3NEAA 1T8TA 3EMKA 4Y1EA 4AJ1A 5L53A 3UUWA 2YNMD 2W2VA 3JAKB 3EIHA 2XUGA 3MUNA 1XEXA 4KXLA 4R2KA 5C8VA 1AGRA 4H4EA 1WKVA 1U5CA 1Y42X 4QOJA 1IZ8A 4KIJA 4RIHA 4S12A 4CL8A 2ZGIA 2GH1A 4G09A 2H1LA 4OUKX 3UICA 2ORVA 4NMHA 4HAZA 1TA4A 2P2LA 3ESDA 4LF8B 2GFHA 1EWYA 5H70A 2D8MA 3BMNA 4JI2H 5C3EG 1L4GA 4ZOAA 4U7WA 2HLNA 1IN6A 3L92A 4PSUA 3WBJA 4N7RA 2WAYA 1EUQA 2Q6KA 5I9MA 1MEEA 3KXLA 2EYQA 4ITRC 1TKRA 5F3DA 3UCEA 2JLZA 2OCPA 2Q5HA 2R97A 3SJ7A 4BQOA 1OLUA 2J07A 3MWLA 3QEBZ 2IHUA 2JA7A 3ENKA 3IAUA 3JVIA 4GOKA 5TPWA 1G42A 4P4NA 1V8DA 1XHEA 2Q3HA 4RS3A 1RLUA 1OLXA 5FOSA 3IAFA 3Q4GA 4JI3H 4RPHA 3HKCA 3QE0A 1ZM3A 1W0KA 2QORA 5FFMA 3BHIA 2WE6A 1J8QA 1MAHA 1P2DA 1P0PA 3O21A 3NUAA 2AN1A 4JCOA 4RQTA 4OXYA 3I9OA 1YZYA 1G20B 1NM5C 3PQ5A 1HTBA 4Z99A 1THMA 4RF3A 2OYCA 1UJ2A 3IUMA 3OZUA 1Y1SA 1BU5A 3IJRA 5KWSA 4ZVSA 1N3LA 1RZ3A 4BAUA 1QHXA 2OCYC 2RC5A 5ESRA 2P40A 4HAXA 4KWIA 1OBCA 1UPFA 1SBTA 3EBLA 2G9QA 2JH8A 3TVYA 4EFMA 3NIDB 1OIWA 4F4YA 3UHPA 1ZL0A 1Y8CA 3GLKA 2IEGA 3OSUA 3RC8A 4Z0PA 2HK6A 2JCXA 3AR3A 5DM70 4ND7A 1WKBA 1YMQA 1P9RA 1YZGA 1RKXA 2P91A 1QVRA 1C8KA 2P77A 1MNAA 1WDKA 2W4MA 1OROA 3PWKA 4QC2A 3IPRA 1L1FA 1ZQ1A 2PZMA 3QE2A 1HI9A 1KFKB 2I9KA 2HCBA 4ZGGA 1F8XA 3L1UA 4YRAA 2KSQA 2W8BA 4XFJA 2CLDX 3EMDA 5EJEA 5IT9A 4DRFA 5CAEB 2B83A 2WFLA 1IXKA 2B37A 4HLUC 4RZXA 5THKA 5GTDA 3K96A 4UREA 4P3NA 1DJOA 1SQFA 3OY2A 4O2BF 1KO5A 4Z1OA 1SVKA 2JC3A 3CJTA 2PXCA 1CJVC 1PU2A 2FW8A 1T4BA 3OZVA 4U0KA 5KAPA 4XIIA 5T41A 1I94H 1TAEA 2LVBA 2ZUSA 3CG0A 1GTVA 3H9QA 3TX2A 4CMIB 2RD2A 3QF7A 1I2DA 1S0OA 1GPWB 2V4ZA 3PYLA 2OQ2A 4MZXA 1P44A 2I6XA 3ZTYA 5BN3B 4JI6H 3RC9A 3L77A 3W9UA 1XK7A 4BB5A 3MCAA 2AJBA 1KAQA 2X7JA 1N33H 4NXNB 4N9WA 1NBMA 2BBTA 3QOYA 2C4WA 5DTQA 4IKPA 5EWJB 2VATA 5JTUA 2YIMA 3OAAD 1Z83A 4PLFA 2Y4RA 3FKJA 4U7TB 3D64A 3PZBA 4QUEA 5DSTA 5EIBC 3UKOA 3FPAA 4IIXA 1CHDA 4LJ4A 1FUEA 4MW0A 4TKVA 2QBYB 2BM9A 4IICA 2BCEA 3VC1A 1X15A 3E7PA 4HJXA 4MGEA 1DHTA 3LF2A 4BWYA 4C6RA 4AY3A 1PRYA 1YXMA 2PCJA 1IHYA 3C45A 3N3BC 3OM0A 3R40A 5G4LA 1VKNA 1T8PA 2WAOA 3QWAA 1QWSA 5L9XA 4Z54A 1BA2A 1UEXC 3F5QA 4HZUB 4EYIB 4P5EA 3MAAC 4CLOB 2ZW9A 5ITZB 2R7KA 4F5EA 3UAWA 1YR6A 4MVJG 4IUDS 3GFRA 3ZY6A 4C5AA 1DIGA 3IDAA 1RQ2A 4II2A 2JVIA 2BMEA 1VSTA 4L85A 5TQ2B 1T5HX 1K0UA 1VTKA 3RB8A 4YCMA 3IBSA 2G1UA 1IYDA 2WIAA 4MDYA 4U39A 2GK6A 2Y67A 5DE3A 3NIBA 4TGLA 2GJ4A 5LZ8A 4IV8A 1OZHA 1ZC4A 3P9XA 4HAOA 5FXMA 4AP5A 2YIVX 5CM0A 3QU4A 5GM1A 1KGDA 5K1ZA 2ZTLA 3OJ0A 4CLXA 2OZEA 2P5UA 5TPZD 4N0PA 1LQUA 1WXIA 4IVRA 2NLOA 5HKBA 1PFQA 2DPLA 2VBGA 3K71B 3I6QA 2HJHA 4YRGA 2FSSA 4B6RA 3PQDA 2WA2A 2WFMA 1FRZA 1N92A 1UM9A 2IOQA 1M6YA 2ZTVA 3TZQA 5DU2A 1EM8A 4NNPA 3GUUA 2BZ0A 2HLDD 1G8HA 1D4FA 2BMFA 3FNBA 3FJOA 2WMDA 3PUWA 2LKDA 2NZ8A 5DX8A 2QMHA 3UWSA 3HGMA 1OSNA 1RRPA 3TF5A 2NTYC 1L4UA 4HDQB 1H2FA 1SHZA 4L16A 2PUDA 1Q7BA 1XRNA 3O8DA 4JJ7A 3R6WA 1FLAA 1NASA 1E9DA 4UU7A 2J6HA 2GD2A 3FPSA 4BKUA 4PTYA 5BRAA 4ZMBA 1WABA 1RTTA 3RGXA 5ECGC 2FI1A 3GP8A 3E53A 5JE8A 2HT6A 5CT5A 1MOQA 2OFXA 4UUPA 5J2UF 1VMKA 1DBVO 4A8JC 5JD4A 2F2TA 4BMXA 4JQZA 5CJ2A 1N6RA 3LLVA 5EUCA 1GYFA 3K2QA 4WASA 1FU8A 3L7BA 4QO7A 3P2MA 4V0OA 5IH7A 3G2PA 4GD3Q 4JT2A 4R1UA 1QDUA 5BR4A 3CB2A 5AXBA 2YHAA 2BLNA 1U28A 2VEOA 3NGDA 1R0LA 2B1GA 2L18A 2ZYGA 4CMIA 1DWOA 5FBRB 2I5PO 2Y1LA 5CMLA 3SYNA 1MB0A 3K3VA 3UJBA 3CJQA 1N9KA 4J0FA 2PSEA 3KUKA 3WP0A 3WXMA 2ZT6A 2ZUTA 1RPAA 1P7PA 1IQPA 1NDQA 3D8RA 3LZDA 5G1NA 1V3UA 4EX6A 4F1JA 1K3UB 1OZ0A 1XMPA 1LPMA 4MUKA 2BRUC 3WWPA 2XKKA 2QPLA 4ZYZA 2REOA 1K2VN 1Q15A 2QR3A 3OFKA 4Y9UA 3W8RA 3GLIE 3ZNNA 1XR3A 4H27A 4RTOA 3QKUA 1B8NA 1VGVA 1V1MA 4GOMD 1GPNA 3FVWA 4B17A 4UW9A 4DMUB 2ZPUA 1Y3DE 1N77A 2HA0A 1QRDA 3E3AA 5CFRA 1SCUB 1JDSA 2Y77A 4M4SA 4ZCTA 1LDGA 4DG8A 2AQHA 4HVAA 2XEDA 3FDZA 3ESYA 1HT3A 1P29A 1ZKMA 4YCAA 1ODKA 5GM2A 3K9QO 5KUTA 4HRAA 1SG9A 2HK9A 3AHEA 3RU3A 4LSAA 3WB9A 4GZ5A 5AKLA 4RZ3A 4HLCA 5CD9A 4GX2A 2QRNA 5B4UA 3E9ZA 1ULSA 2EJUA 3AWDA 5L3ZA 1E9FA 2E4AA 1JKJA 2DGDA 1YK1A 4ZRMA 3EZ2A 4URVR 4AKSA 4EHJA 3EWSA 4BFUA 4DA0A 5KFIA 3I5MA 2OAP1 3OWXA 1PWXA 1TAHA 4F06A 1YVUA 3JQAB 1I24A 2DBRA 2YR0A 1ZOOA 4Q1AA 1E7RA 3QVGB 3D4LA 3AERA 3FTDA 3FPFA 1NE7A 2AKAB 4R84A 1ETUA 4RAYA 1I7DA 3MQFA 3VYUB 4O7RA 3KB8A 3GJSA 1YFKA 5L3VA 1RQRA 1P1HA 4KMSA 2WQ6A 1GDHA 1C3JA 2MSEB 3FE2A 2VR1A 1UMBA 2OB2A 2C8VA 1IBLH 4X85A 5KAMA 1JVBA 1V16B 4NZYA 3WYDA 4YNBA 4B84A 4KGZA 1K89A 3L1JA 2O3RA 2HCFA 4LVNA 4OD0A 2O48X 5CJJA 4HLUA 2WAQA 3DVRX 3FHOA 3HYCA 4QT4A 4BFWA 1TEXA 1XAJA 3I62A 1SUDA 1J49A 3WDKA 3H9BA 1TMOA 4D80A 1VJDA 4FNAA 4WWHA 4KXXA 2F4VB 2YN2A 3TEFA 2DUJA 3DVLA 3HV0A 4KMRA 3TQCA 3N7AA 5A6VA 5LL6P 1GCOA 2B25A 3GUYA 4AJ2A 3QA3E 4D81A 3CSWA 3ILHA 1WW8A 2GPYA 2PMZE 2QMQA 1UJNA 2XCTB 1UMDA 1ZK3A 2P2DA 4PFQA 4UM7A 3AXTA 1TXGA 4NDNE 4O4JA 3LC0A 2GEBA 1AO0A 2Z98A 1W75A 5DHPA 1H4TA 2ZSJA 4BWVA 3FYCA 2IHNA 1SUBA 2P4HX 3JD4A 1Z22A 4WKNA 5BOVA 4JEIA 3GLGA 1GAWA 1UT6A 2IYTA 4MV4A 2PNJA 5LP6C 2BM1A 4LF6B 3AHFA 1N2BA 1ZJYA 2RGUA 2WWTA 2XCOA 4ER0A 2K4MA 4OL9A 5CA0F 3T5JA 3BMCB 1K8ZB 1ZN2A 2AFHA 2O05A 4ZO8A 5EJ4A 1M0TA 4CGYA 4MAMA 1L7XA 3KYCA 4LYAA 3B52X 4I1OA 4IHJA 4G0PA 4N54A 1PJ4A 3CZAA 5BWVA 4CCWA 1P1BA 2Y71A 5CCEA 1IUOA 4LISA 1GSOA 2MSKA 5EA2A 5A6SB 3T1HH 1NIPA 2DUWA 4G9BA 4LKOA 4AP6A 3IP9A 1RDFA 4YQYA 3ZN2A 3PDWA 2WICA 2R8JA 3SE0A 1N0UA 2WJWA 3PD7A 1EK1A 4A93G 4HH4A 9LDTA 4EKGA 4ZJYA 1TWFA 4RHEA 2RIPA 3S27A 1H8HA 4BQIA 3I9FA 3ECCA 4OV6B 5JD3A 1T2EA 3THYA 2HY7A 3SC4A 3W06A 4MRMA 2V65A 2BCJQ 3AB7A 4U6SA 4YMWA 3F4LA 3TRDA 3NTVA 4CKWB 1SUPA 1XTKA 3L0IB 3ITNA 2J7PA 4MIKA 4IWNA 3F9RA 3MUEA 4HMPA 1E1QA 1QVWA 1W87A 1JLLA 2CUKA 2MYPA 3P45A 4QBIA 4FOPA 4WLNA 1WDWB 1Y48E 2Q5JA 2WKPA 2P4SA 4DDKA 2PTHA 4EUFA 1YVPA 2O8BB 2O14A 3M5WA 1DPFA 4YN3A 4YXFA 4DQUA 2J5QA 4YO8A 5JC8A 3C74A 3LS2A 3OQMA 5ELXA 3KHRA 1VB3A 3GRAA 3NKLA 4MI6A 3C7TA 2GM3A 1V7CA 1UUFA 1J90A 2ZWIA 2XHEA 5BNWA 4Y0VA 3U62A 2C4HA 3L7YA 2DTDA 3RIZA 2I4RA 2QV0A 1JKXA 1C8BA 2YW9A 3BFPA 4MUNA 4ZQBA 4D0LB 4W6QA 4F4FA 2WJ3A 3L0PA 2AUNA 4K6MA 5LMUB 3W5AA 1I80A 1SC9A 2IHBA 3QX7A 1MVOA 3D6HA 4QHSA 4E1AA 1YJ8A 1C14A 3ELUA 3RHSA 4E6EA 3FRJA 1IBSA 4UVGA 4S1VA 3HRKA 3L06A 4BO7A 5JNRA 3QVKA 1L7RA 1J8VA 1Z2CA 3WMWA 3KQMA 2P8SA 3TBFA 1YI0A 4PGAA 5LIPA 1N2GA 1WUYA 4OM7A 1C7FA 1NLZA 1XRMA 2YHSA 1NJ1A 4ETMA 2FMTA 1C0IA 1A9YA 2FRXA 3F47A 3WLKX 3SFTA 1JDTA 3CGWA 1Z5OA 1ZOSA 1M5UA 3EZFA 3OZ7A 3BQMB 3UJHA 3WIOA 4BZPA 2ZJZA 3IEUA 1TLTA 5KG0A 4A3FG 1OAKA 2Y99A 4FCWA 4ZVTA 3T3HA 4ZV9A 1U3GA 1RAGA 1WEHA 3NHPA 4ECSA 4JVLA 1SA0B 3MBKA 4BVKA 3IQDB 4DVJA 4H3KB 5DX1A 3PGMA 2X42A 3X1WA 3GTKA 3BXEA 1D6SA 1YCFA 4ZO4A 4IIBA 4YMSA 1J39A 2OCLA 4H1TA 4JI4B 3CURA 3V2UA 3LBAA 5FNVF 2GDJA 3P9CA 1WNTA 4JOCA 4YRQA 5GGXA 1LLCA 1GQRA 1U2GC 2NZYA 4NYMR 5DWQA 4KGXA 1T3SA 1JIQA 1EFDN 5F1OA 4Z1MA 3C3CA 2O6LA 3KT0A 4JI7B 3NHZA 1H0KA 4IW3B 4B3DA 3VR2A 5DWDA 1IATA 4YP5A 2W6NA 1E2UA 1EA5A 3INRA 4Y2PA 2IUSA 3OEHA 2VAPA 4X7BA 5I8WA 2XUZA 3F90A 5TVGA 2JLUA 4RMNA 3JSNA 2FWMX 3FTFA 1R16A 5FA6A 2H8GA 3QUCA 1NY6A 1ODSA 1G6Q1 2XEXA 4YQFA 4YPVA 3WLHA 4YUAA 1UBNA 5K8LA 2D7DA 1PNQA 2PSFA 3K72B 2BGIA 2Z2JA 3NTXA 3JQPA 3SXJA 2VHQA 2B2CA 4LMAA 4KN8A 3VC3A 3EGDA 3MGCA 1VSUA 3G5LA 3GIMA 2IRWA 2UVQA 2WR8A 3GL9A 3H65A 3UF0A 3VOAA 1VECA 3IUQA 3WGQA 2B35A 5K0EA 2Z02A 1E3MA 2BVNA 2ZB7A 2ZIGA 3DBRB 3IUBA 3ZG6A 1M5RA 3A2KA 4KPFC 1F8FA 5IDQA 2QX4A 5HNEA 2YHBA 4LNAA 1OZGA 5ABPA 2XUQA 1VHDA 4JVOA 4QDUA 4IP0A 2GBLA 1ZD4A 1DOZA 1PG0A 1PW7A 4DL2A 1PV1A 2BFPA 2BGMA 3AVQA 4L9SA 5FOXA 5D5QA 2HHLA 3GFVA 3VNAA 2C00A 2ZI4A 4FQ7A 5KU1A 3I5YA 2VF2A 2FWRA 3G6YA 2AD1A 4KQEA 4EB6A 4DRYA 3D7SA 3FDJA 2W83A 4CM7A 1O7JA 3R3UA 2I3GA 5IAOA 5JEEA 3ZBUA 1SUCA 1MX3A 4MULA 4S0ZA 3S2FA 4E15A 2BE7A 3EPRA 2KBFA 5LA6F 4LF4B 3LCCA 3AT1A 3ZHOA 4WLFA 5ED0A 5AM0A 3K35A 5AVOA 4C6SA 1QUEA 4H7KA 1GQSA 3RVRA 1ECCA 1S2LA 5BRJA 2ZI6A 2QMYA 2F3PA 1UC8A 4GYJA 1L5KA 4U7HA 1IOZA 4JUIA 4XD2A 6GPBA 3B3FA 3BHJA 2YX1A 3LG2A 1UAAA 5KC9A 3FNHA 1NVXQ 2Q1UA 3AUXA 5IKXA 2QE7D 5EZYB 2K5UA 2JJYA 4Q9HA 4N8EA 2ZQYA 4PHGA 1EFLA 3BMNB 5AKIA 3ZC3A 3RO7A 3AEKA 3FUWA 5KPDA 2C2BA 3AZPA 3FXAA 3HB1A 3KE9A 4CW7A 3A2MA 4JV5H 2PKQP 3IGFA 4N7JA 2XMBA 4F7DA 4BXOB 4W1RA 1GADO 3KQNA 1F8UA 2Q8NA 3H5IA 4KE6A 5HJ7A 3HKZA 4C4OA 3MK31 4KBGA 5BNFA 4IG4A 1SK8A 3EE6A 1XNHA 4MS1B 2FUEA 2ZYVX 4UHKA 1X1DA 3ZI4A 3JASA 5JI3E 1ORHA 3DOJA 3UW1A 2AH5A 3EODA 4GQBA 4AICA 4EBFA 1BGWA 1LWNA 3MR3A 5BVGB 1V39A 2EQ5A 1WY7A 2BFCA 2NVUA 1H9CA 1DRUA 2N9UA 2NM0A 2VXCA 4GLFA 1XA0A 5IYDG 3CUSA 5EJ6A 1ZN7A 4JB3A 4W9NA 4YX9A 5LZ4A 4LJSA 4Q4CA 4GPIB 5AVJA 2C7GA 3GLHE 4GLWA 4FFWA 2X8JA 1IEQA 5DLDA 4YHBA 2DQKA 1I5EA 1I2KA 1L5WA 2FH5B 2IHVA 3DZJA 3GCXA 4FWIB 4PS1A 2BQUA 3MFIA 3G88A 5CDTA 1EKPA 2GGSA 1ZQ9A 1B76A 1XD9A 3GQVA 3PNMA 2AHOA 2EL7A 2AW5A 3L4SO 1ZHFA 4QA9A 1MR3F 3GLIB 1AHPA 1AXRA 1AMOA 2PZ8A 4M88A 2I71A 3RREA 2ZI5A 4ZP1A 2DUNA 3AU8A 3VU8A 2W6QA 1WXXA 4CCYB 5JD5A 5I5SA 5I9NA 1FRQA 1V6SA 1NYTA 3CUYA 5A04A 5I9TA 3KV1A 1EQUA 2IEIA 4PZ8A 1Z7BA 4V3BA 4DB4A 5H8WA 4DPMA 1OYYA 4D56A 1NN1A 3F5MA 5JVLA 2IFTA 2FZLA 3C8DA 5CB4F 1THZA 2VJLA 2HXGA 3N76A 5E4JA 3TN7A 1N5IA 1SOAA 3LWDA 3OVMA 1MFZA 4QBGB 1FUUA 1WP9A 1Y1KE 2GI4A 2OTCA 3I6IA 3QLEA 3R5KA 3SEAA 1SCJA 3EIFA 4MW1A 2GXUA 2MWMA 2WJYA 2AFIB 3TEMA 2Q6TA 1G8YA 1VLQA 5LB2A 4HD8A 2CVFA 5AR1A 1IE3A 1HC7A 4KHZA 3RUDA 1UWLA 1V6AA 1NP7A 4BNWA 5KNDH 1TVKB 1GCUA 2BMVA 2C8KA 1S3SA 4BO1A 3GLFA 1IHPA 3VR4A 4N6NA 4OAOA 2BL4A 2K2QB 3CFYA 5IBRA 1ONNA 3LWZA 4R7GA 3UAZA 5IEJA 3G7NA 2IYUA 4HKTA 4RK4A 4B80A 1AF7A 2FWNA 2WT9A 4IF6A 4B3GA 3BWDD 3O7WA 5I7OA 1DXQA 3HUDA 4RVDA 3LYLA 3ZOZA 2WD8A 2INGX 1MAAA 2RGNC 4BFLA 1ZUIA 3AW9A 1KPHA 1XO1A 2RARA 3G6KA 3VHXB 1QRTA 2B30A 2YXBA 4KN6A 4D26A 2FB9A 1EQAA 2HHCA 2V7QD 4TMWA 3HCFA 4UUAA 3ITDA 3DC2A 1Z0JA 1T6ZA 2VPYA 3OETA 5H82A 3RS5A 4YJ2B 1K7CA 3MINB 4E31A 2RGRA 4JI5B 4F4UA 5DPMA 4YDQA 5F35A 3T54A 4UTRA 3F0TA 3O26A 5JYCA 2ZJAA 4X3CA 1M8JA 3E9DA 3T7JA 3VDQA 1N0VC 1MV5A 4PZUA 3CLRD 5I4IA 2WMOB 5H3HA 1JG1A 1Z62A 3OICA 4DPKA 3KELA 4MW9A 3IHTA 3G85A 4OSEA 1TTHA 1NBIA 4ES6A 1QRUA 2FZVA 1WF6A 4YAFA 1P45A 3PNLA 1NBEA 3WIVA 2JRLA 4U1RA 3LDAA 1X7YA 2BFMA 4QJ5A 5CH3A 4ED9A 3PPWA 1AM4D 3ITKA 5IAKA 4EDFA 3E3OA 4DJTA 3CR3C 1X0XA 2W90A 4BEJA 5EERA 2O8EA 2YQZA 3QP9A 3TGLA 3Q7TA 4YRDA 4XCXA 2H18A 1OWTA 1FRVA 2RGEA 4FT2A 1T4MA 2H2AA 4DV0H 5G1PA 3WICA 5B1YA 3VKGA 1F5NA 3AI1A 4B3MB 1RKQA 3W3ZB 2B8JA 2QI9C 2JLCA 3L41A 4GOND 3VO9A 4H6VA 3X0DA 4MKIA 5HUJA 2BFCB 4DV5B 3DS8A 3PYMA 1GPLA 3EOBI 2IMWP 2HXYA 4EUEA 1U2DC 4PZYA 3JS5A 1E79D 4G84A 1IM8A 5JFGA 3AKZA 1MIHA 2CHQA 3G8YA 2EGHA 1F2UB 3PF9A 3OQVA 4PZEA 5FNVA 3NIWA 4I55F 4MV8A 3C3MA 2IUUA 1KMQA 5HS4A 4NYJQ 5L95A 4NU5A 3B3JA 1XCPA 4PG4A 5AICA 5EYPB 4WERA 4IJVA 5JXJA 4FVTA 2XV1A 4M21A 3QVUA 2WSLA 3UO8B 2VUIB 3IPAA 3H5NA 5CNKA 2I1LA 2C4NA 5KVSA 5JY1A 5K8IA 1EDOA 1RKBA 2W2LA 3QNUA 3DLTA 2UVUA 3A05A 4AN0A 2QD5A 3OMLA 1N6LA 1KJQA 2Q2OA 1DV1A 3K05A 4L3VA 2Q2NA 4UARA 4OK3A 1ZMRA 5CRIA 1D07A 1V4YA 5CT9A 4BO6A 4GL4A 4U0JA 2C88A 3OC6A 3S5UA 3I4NG 4O2LA 3DDHA 3IPYA 1QGYA 4JX8A 3WWEA 1HYBA 1DAPA 4D42A 3LIIA 2YOFA 2Y1KA 4RKRA 1P39A 3GRUA 2EF1A 1ZL2A 3S5JA 2FLWA 4BX2A 2NSDA 1SKUA 2ZKLA 4O5AA 2BEWB 3EXHC 1BA3A 3T0GA 1CR1A 1USKA 1EXVA 1JUDA 3H9JA 1ULHA 2ERYA 4EQ6B 3WYBA 5DM1A 5ALIA 4R68A 3KVYA 4U2GA 1N1MA 3GIQA 1ZD1A 3KQSA 3U0GA 4AWAA 2R2AA 4JD5A 1QU2A 1KI9A 2CLMB 3FR7A 1JP7A 5GVRA 2NTEA 4A91A 2D4AA 3PP8A 5ALQA 4WA8A 3PI7A 3NNSA 3L46A 4W82A 3B1FA 5C1OA 1KAHA 1ZH4A 2C20A 3K0CC 2AOTA 2QKYA 4DEVA 2FKAA 4GW3A 4CIYA 1CWUA 4C43A 4QWBA 4FGUA 2R6CA 3GEHA 1L5NA 1WVMA 4MWZA 1YS2X 5DQGA 3ZD8A 3ZVRA 2WPDD 3AJEA 3FFWA 3WNQA 3K73O 2VDMB 1B74A 3QVMA 4HLQB 2G9RA 3PK0A 5AD1A 2R62A 4QXMA 4BATA 1X14A 2WP0A 1UJMA 4FR0A 1P0QA 4QTYA 3ZZ1A 1TYAE 2P9TA 3AETA 2ZUWA 4DLYA 2AQKA 3C1UA 5CXXA 1T2CA 5LBIA 2JW5A 3JYQA 1NSYA 3PJEA 1EIWA 3M5PA 2CHUA 3A0UA 3DULA 3BXZA 3ADCA 2IH5A 2EKLA 1QG6A 1EZ4A 2JIRA 3JAWA 1MVNA 1VOTA 3ZLVA 2MHCA 2G72A 1WBBA 4LY9A 4ZGBA 2XCPA 2RGYA 5G02A 1UQUA 1P19A 4Q4JB 3BX1A 2R6HA 3WIUA 1MB9A 4C89A 3N40P 5FCDA 4WY5A 2GBCA 3ZCPA 1V95A 4LJRA 2D2VA 4MVXA 3IIEA 4YAUA 2B4KA 2CNKA 2Q2TA 4RZSA 4GOXA 1GYQA 3R7AA 4EBCA 2CLCX 4IHJF 2XVZA 3JQAD 3JZ6A 2XI4A 4NOKA 3VPFA 3NT5A 4H9GA 2ENUA 5DNYB 1Z4JA 4IR9A 2IOFK 4DR5B 4I5EA 4I9FA 4UZEA 3ZD9A 1VJRA 3W6UA 1TCVA 3FF1A 4GWGA 4HBGA 4M8LA 4JT4A 4OKNA 4F3NA 4ENSA 3KR2A 2JIOA 3PNOA 5BSGA 2UXDH 2HA5A 1K83A 4PSAA 4PPNA 4ZYYA 1JE1A 4GBED 1P1CA 1BNCA 3QMWA 2H65A 5AKJA 5HXAA 4GO1A 1WXDA 4L8YA 4RPCA 1CF9A 3SS9X 2AZ4A 1TGVA 1GA4A 3R0ZA 3Q40A 3VSDA 1JHVA 4QXAA 4TQRA 3KUUA 5C18A 4BZQA 1H9AA 4RJJA 1CQXA 3JXEA 1PW5A 3P9NA 2VJAA 3VHRA 2W0MA 5AW0A 1JA9A 1UDAA 2ZM6H 2O3UA 4D6XA 3ZZMA 1E60A 4N5HX 4PYKA 2R8ZA 1U04A 4UFOA 3TL6A 2RHDA 1WUJS 1HY3A 4ZIRB 5DV9A 3SAJA 5IVKA 2C2ZA 2G5GX 1K1EA 3KQLA 1E58A 1V11A 1GT91 4QAJA 1A3CA 1J1ZA 1KVQA 2F7SA 2ZRMA 1PT7A 3R6GA 5FUQA 3T1YH 2GETA 1N2EA 1OC4A 3NHSA 4AG3A 3REOA 5KOHB 3FRIA 4QFBA 2H0QA 2VOEA 2WUFA 421PA 5ICGA 5DG8A 4ROTA 4K9RA 2VTEA 2CVZA 4LBWA 4TLBA 2REXB 2XMDA 3G8AA 4Z3DA 3V97A 1TCAA 1L7DA 4K86A 3HFGA 4AO6A 4O8CA 3PW0A 1W30A 1Z73A 5JFTA 4R54A 1MAVA 1RMTA 1QQ5A 3S2YA 5CT8A 2QV7A 2R11A 5JH7A 1XMOH 3HUTA 4ONEA 1BH6A 2QTFA 4V0NA 3EWAA 3TS1A 1EESA 2PZEA 1TUEA 2IYVA 4Z49A 1E4FT 1ULTA 2PIDA 1KYTA 3LX8A 5KNDA 1TU3A 1NWHA 4UMEA 3H18A 4WNAA 3PYXA 4DT1B 4ND4A 3UV3A 2FLVA 3PA8A 2VZLA 3QPUA 4QGBA 5JQGA 1JHUA 2OOSA 4JBNA 5JYDA 5K4GA 3FYUC 4JY7A 4YB8B 1M8PA 5AHRA 5DJ5A 3BSFA 1C1XA 4MK4A 5KOIA 5JNTA 4V2UA 1XVTA 1Y9AA 1FJGB 1M6VA 5HBRA 3CF2A 3GB9A 4D9HA 2DERA 1CULC 3RHFA 4RZQA 2C3YA 2P2NA 4U2BA 4MA5A 3V55A 1OKKD 2FQQA 4MEAA 4Q1CA 5C8XA 5HOEA 3IIJA 3RKUA 3WJ7A 1KBZA 4Z86A 3CSUA 3LUGA 4F6LA 4F72A 3FMVA 3EDRA 2RAPA 3FLMA 3A4NA 4TVKA 3WB0A 1ET0A 1Y8AA 1O89A 5BR7A 1DKRA 3U1BA 3ESAA 2I7TA 3LP8A 4FHCA 1D1QA 4GC5A 4TRRA 4CM4B 3R75A 2P65A 1TWHA 1EP1B 3M6AA 3TNLA 3S1SA 1QZZA 5H68A 1RRMA 2CJWA 1XDGA 1HSOA 1WA5A 2PJZA 2XQIA 3E22A 3DC7A 4EZBA 1JRLA 3ZWKA 3RIHA 4HGPA 4UHDA 4JLPA 5DYNA 4UOZA 4RULA 4RTMA 2CJXA 2Z95A 1IHXA 3K8YA 3O7MA 3IN5A 5D87A 2RHLA 1A2KC 3QY0A 1U2PA 3CQZA 1E89A 2W7PA 2JRCA 3LCUA 1KFJB 4GI1A 4G0VA 1L9KA 2CW5A 1H6AA 1TZBA 3OKFA 1TU4A 4PG6A 3CB4A 5EWMB 1LK0A 2ID4A 4BB6A 4AFNA 3AI2A 4K5QA 1Q7GA 4I9HA 4C7MA 2EGUA 1MOZA 2ZIXA 4PYNA 2BFEA 1W36C 1Q84A 2H2GA 1XJCA 2Q49A 1UWCA 3T7RA 3BA1A 4PLWA 4DC1A 5IWAB 3FSGD 3GIDA 4O7SA 1O96A 1RRFA 2HHJA 2VYND 2CNBA 1UBLS 1Z68A 5A9SA 1FMCA 5KTYA 4JYCA 5CVCA 1RJQA 1YE3A 2GPJA 2PGAA 2Q21A 3GUZA 4QOEA 2H7CA 3ZKWA 2BR3A 5DLFA 1DOHA 3R09A 2GM5A 2A35A 2OCBA 1VSQA 1YZFA 2SBTA 1O75A 1L5HB 3EGCA 3KPYA 3QVOA 4D9GA 4B35A 2PR7A 1NT4A 2R8BA 2Z83A 1LSUA 2GXQA 3DAOA 5TMDA 2IHKA 1SUWA 3AEZA 3BMXA 3O9MA 5AKHA 1CQIA 3JSLA 1HYHA 3QA9A 3RJZA 3N53A 2CZQA 5IYZA 5JS1A 3EIUA 4LZNA 4YI5A 3RJTA 2EC5A 3KJIA 1X74A 3PI6A 4QARA 1IOLA 1T4CB 3I2IA 3MTIA 4JGBA 3OEED 3LGXA 4HAWA 4IEFB 5TJHA 1NAIA 1DIAA 2EGGA 1RRCA 2XADA 1NI5A 2FP3A 2W6IA 2KS6A 5EIHA 5KFFA 1BGVA 3T4PA 1V5EA 5KFGA 2D3TA 5BUQA 1L7VC 4JJZA 4W5WA 3FCCA 5DGIA 4DR5H 3PX2A 4DVGA 1NKSA 1ZNZA 4XDGA 4UQLA 3TSCA 4B3RH 3DAAA 4FYKA 2F17A 4PLZA 5DT2A 4YRIA 5EMMA 5HOQA 5K8CA 3DL7A 1M2JA 4KIUA 3GD7A 5FUMA 3Q3HA 1KO4A 3UT0A 4E94A 1KE1A 5FBQB 5JH7B 3EVCA 2WM9B 1RMQA 5BQPA 3TCKA 5ICMA 3KUCA 4EWLA 4FMBB 4RVCA 3UJAA 3GB8B 1RRKA 2H07A 3BS4A 1CFZA 4LUCA 1TJPB 3NDBB 3FGPA 4KE9A 4UNPA 4EGQA 4MS4A 2QUHA 3C8UA 1LVHA 2Z2ZA 1O0BA 3QHPA 5CX1A 5D3KA 4HH0A 1Y0BA 2PGOA 3N43B 3M83A 3SVLA 4UAGA 2HGWA 4FDTA 4PLYA 2ZZNA 1BAPA 2ADOA 3QHQA 2P2SA 5DWVA 3CF6R 1SO8A 3AR5A 2X8AA 5FORA 1TTTA 3FYTA 1L6IA 1CQWA 1N2SA 4XGQA 3LULA 4L2IA 4L27A 4MVJF 1KIAA 5B7PA 3OTIA 3WLMA 2VQFB 1N0IA 5EP4A 4MV1A 3VTFA 3ICPA 4WGGA 4AUKA 3ZV7A 4TSRA 4CUJA 4EQZA 4FD2A 5KIAA 5H02A 4YUZA 1NATA 2EDAA 4POAA 2ZJYA 3H20A 4PZ7A 4NNOA 1NPYA 4D46A 2QTAA 4RH0A 4IRCA 5KFJA 3I30X 5D6OA 5FTMA 4EF4A 4RNCA 2J0EA 4YALA 3UMFA 4CMDA 3RT1A 2ZUUA 4UJ3A 5DBFA 3BQ2A 2Q28A 1Z34A 1W59A 1ZSYA 1JAIA 2Z6AA 4LHVA 1HDXA 1XD2B 1IXRC 1KSJA 3M1LA 2B1QA 2ZAMA 5BW6B 1T9HA 4A26A 2P3OA 2PD3A 4CM8A 4JI8B 1NW6A 2P5TB 2HFJA 5GIOE 4BE7B 5BV7A 1RM4A 4PC2A 2DYKA 2QRUA 4JDPA 5KYKA 4UEQA 5FHRA 2H11A 2FP4B 2WLTA 1VRVA 2JGDB 3AEKB 3KOWA 4MCJA 5EUQB 1W5AA 2Q1WA 2FY8A 3GFTA 4BGDA 1G21A 4Y9RA 3RJ5A 4AI6A 2NVYA 1ENOA 3IAM6 3QV2A 2CVQA 3AEUA 3UJ7A 2SCUB 1OILA 4N3NA 1EK5A 1GGJA 4P3KA 4BBRG 4PC7A 3H84A 3E9MA 2DLNA 3VYWA 2H92A 3D4BA 2NP6A 1WUTA 1FYXA 4MS1A 1Q3TA 1QF9A 3KZNA 3TX6A 2GSDA 3B9RA 2GILA 2NTVA 4MGKR 1Z74A 2DOKA 3ETCA 4PNHA 5E6UA 5A7GA 3N8NA 3TH5A 1H2XA 3GGDA 3LKDA 1EVZA 3TMKA 3X1DA 2PVSA 1WWKA 4Y8VB 2C2KA 3SHFA 1TUBA 3HJCA 1BVYF 5ALHA 5FX2A 2Y93A 1A8HA 2AV6A 1U0FA 1JXLA 4O82A 4OU5A 2UKDA 2HCRA 4Q7MB 3QEOA 4WEOA 3ZWBA 1D2AA 2NU6A 2YJ4A 4IO1A 4PONA 3SU8A 1A82A 3KZCA 1GUFA 2VYVA 1KFBB 5BNTA 2PX0A 1JEQA 5BMVB 4R1LA 4CODB 4LEIA 4MQMA 3BH0A 4W5OA 3ETGA 1IY1A 3HN6A 3VR5D 3ABZA 3D5QA 3EEFA 3Q9NA 4B81A 4LMPA 1GPUA 2ST1A 3ADDA 2VSQA 4R9NA 4F38A 3D8UA 1RXEA 3GDFA 3ZJVA 4BP9A 4A0GA 5I5EA 2JDIA 2C28A 1CBUA 3EZGA 3TOCA 1I1KA 4K0KH 1YBVA 4I1SA 2V4RA 4JUCA 2IA6A 3DQQA 1Z8HA 4BNXA 3IVCA 1TFRA 3IVXA 4E4TA 1C2YA 1GU7A 2F1RA 3MTGA 3W6OA 5IDVA 4AY4A 4FZRA 2WEKA 3EVGA 4YCDA 5FD8A 1UF9A 3IKMB 5K0LA 4MA0A 1ZNXA 4EI9A 4C2UA 1MIOB 1ZUD1 2Q62A 2UAGA 3BE5A 3EYAA 2TYSB 3IIIA 4FSHA 4RE6A 1M75A 1O6FA 3P2YA 4BO4A 4PANA 4ARZB 1W46A 3F4KA 3COVA 1FA9A 4BNZA 1ACJA 4ENTA 4BOYA 1FDWA 2ZYRA 1U7WA 1CB7A 4GNKA 3ADKA 1XQ1A 3GC6A 4PZDA 4CDNA 3SF0A 2W2XA 3DYBA 2Q7OE 4B45A 3V1KA 4BMNA 2RONA 3STTA 3LBHA 5C7IO 1TLLA 1E1DA 3FA2A 3Q8KA 1C3OB 1VMAA 5FPTA 1QBKC 3OQJA 4EG3A 5HFJA 1LJUA 3BIXA 4ZANA 5BURA 2IXDA 1IYEA 2I03A 2RG7A 2WRZA 4RY2A 2C2DA 1MV8A 4B6QA 5KSYA 2YJ6A 3QITA 1CUBA 1P73A 2B3TA 4DIMA 4PWYA 4R8RA 4G4SP 6REQA 1TTQB 1U0SY 3OQIB 1UZAA 1N5RA 2BEUA 1YQWA 3D1JA 4PF1A 2WB1A 1OXBB 1RYYA 5T6BA 2XCUA 4KPGA 1DARA 3VH4A 4S1NA 1PNTA 4HGYA 1XTVA 1Y14B 3C1TA 3IMEA 1V71A 1GHTA 5AJYA 3NC4A 3RS0A 3JWPA 2DEUA 3Q7PA 3VNUA 1JKMA 1QHHA 4KWTA 1E1NA 3Q6IA 4B5LA 5F33A 1CIPA 2YW2A 3TLXA 4JWKA 4UPDA 4UUBA 5J59A 3R9XA 2IIBA 1Z12A 2NV0A 2RAUA 3TOVA 1SBCA 2QJRA 3VGJA 1HE3A 2WHEA 4R8MA 1SVMA 3QWIA 5SZHB 3PHHA 2DXIA 4MQLA 1ISIA 2J1LA 3CWQA 4J75A 4QWWA 2R751 3VOBA 5AVTA 2V0CA 5LP6F 5AJUA 2RHHA 4YBZA 2AR9A 4IX9A 1N6IA 2ZI9A 5JSUA 2IYEA 6YASA 3W7VA 2FLKA 3HKEA 3HYRA 1S0UA 1PR3A 1E66A 3P20A 1TK3A 4O1IA 4P7KA 3WLOA 4IRUB 2E6KA 1XEAA 3KDAA 4KJXA 1R9MA 3HVJA 2OEPA 4MRRA 4ZT7A 2YS6A 3AL2A 1H6BA 2CKDA 4TVOA 2FJZA 4C5BA 3PRYA 3DAFA 3QK7A 1RCUA 1KORA 1PN3A 2H2FA 3KSUA 1UZUA 1SURA 2I2CA 1ZN9A 1ZBQA 2PLWA 1U7XA 1V7PC 3T5LA 3I6BA 3MYRA 4WN9B 5IFLA 4TMTA 2YFKA 3DVSX 4DNOA 2KLHA 4RYDA 4ENQA 2Z57A 2H1OA 4G0UA 4OJKA 4CMEC 3DCJA 3PIIA 2Y1WA 1XXLA 3NAGA 1O9BA 4LS3A 4DNFA 2CSXA 4EEQA 3RQSA 1K7FB 2AA3A 1Y5NA 3BE6A 3ISVA 4BFZA 1P8AA 4NJMB 3RVBA 2QLNA 4QWAA 2C82A 4M0MA 3CVYA 3UNXA 4BDSA 2VA2A 2K7ZA 3EAQA 5CEEA 2R9VA 3BJZA 4I9GA 3W2TA 3HA2A 5DYIA 3WMEA 4CV1A 4ALMA 2HIGA 3WQQA 2JGMA 1I3MA 4MROA 3WGKA 1JJVA 1TD9A 3FFTA 3UT5A 1FW6A 2DQYA 5MGBA 4R41A 2GXSA 1E18A 4Q4LA 1WPXA 4AS3A 1NVBA 5JMWA 3P9QA 1E6MA 1L4KA 4E3ZA 3ZCRA 1XJWA 3KPUA 5E1BA 3HN7A 5IUKC 3ELBA 5KI6A 4U6PA 4KVAA 1GD1O 5L3SB 3E4DA 4TYYA 1PG2A 4FM9A 4RA9A 3HR7A 4IIEA 4CZ2A 3INYA 2JHGA 4UHJA 4W8HA 5DBGA 1Q16A 3PC4A 5E1MA 5B1HA 3SS8A 2AG8A 1SEVA 5CAEA 1LRLA 4XEHA 4J3FA 5HE8A 4M1ZA 4RGYA 4PYJA 2QUZA 4GC9A 3HK2A 2HX1A 1BMFA 2V54A 2XGJA 4JB8A 2QPTA 2AGOA 1R50A 3AK4A 3D2AA 1D2EA 2R6R1 3B53X 4ZC8A 1PZNA 1Z82A 3RTEA 1Q57A 2X5XA 2XUJA 2I3DA 5EQFA 3FYSA 1ENPA 3PENA 5D00A 1JXMA 3SF8B 4EKEA 3UJ8A 1I7QB 4WIAA 4IXMA 6REQB 5DNUA 4TLLB 1CUIA 1FFBA 1O94C 3G2NA 1WQ1R 3RARA 1ACLA 5BP7A 3CXRA 2IBTA 2ERCA 3FJYA 4NAVA 4U00A 5AK3A 4BWGA 2HHFA 4ZOLB 3BAFA 3HJTA 4KVZA 4E5MA 2KSWA 2HSZA 1WKCA 2IU6A 4G81A 4ZVLA 4MQUA 5A7HA 9MHTA 3OT4A 4NZPA 5BSTA 4KQFA 3TOZA 7MDHA 4DL6A 2FR8C 2G08A 1LLUA 1ZGHA 2P9FA 2JZNA 2R1TB 3A25A 1Q3HA 2C84A 1UDWA 1NYQA 3R9XB 4LFCH 4JV2A 2C96A 2LDXA 2YHIA 2QG6A 4Q03A 3FMOB 5JNSA 1L2TA 4MQFA 2BDUA 3DTVD 3C70A 3KTFA 1UXJA 4NZ9A 5KTMA 2HMWA 3RYIB 3WA6A 5EIWA 3ZQKA 1ZHSA 4B4DA 1PFWA 5KG6A 3QVSA 4YV2A 2J9ZB 4TT3D 3U60B 3CZQA 1NBOA 1FDRA 1IY9A 5C37A 1JDEA 3L9WA 2HH9A 4UM9B 4YJHB 3KFVA 1G18A 2CLLB 2H63A 3O8QB 3N42B 2AS0A 4PBRA 3TLAA 1SC6A 3V1UA 5ITVA 5EUMA 1H1LB 2QP9X 2XF8A 3VTAA 3DLIA 3RGWS 4I0WB 4DIDA 1GZ3A 1HNXH 2IOYA 1C30A 3CCCA 2BSXA 4YR0A 5IUNC 4Y67A 3KAPA 1Y7LA 4DLKA 4C22A 2VJDA 3NFRA 1T10A 2G25A 2C5HA 2YC2C 1TJ4A 1KYXA 5KT6A 4GICA 5KNBA 3KJNA 2FUKA 5A4FS 3ZXXA 3L0BA 1LXCA 1HR0B 4RHFA 1KI6B 2OR3A 3W5VA 1VYHA 4D8YA 3KALA 1RXYA 3LD9A 4JR1A 2JA1A 2Y6UA 5MFPA 1Y7IA 1LX6A 1CUJA 4IGKA 4O8ZA 2IYWA 4RX1A 1KKLA 2IIPA 3PW5A 1L5ZA 4M9QA 3UAVA 2WSBA 4MPPA 4YAIA 3HZOA 3EGOA 2WD9A 3ZHZA 1W85A 1ZH8A 4FHDA 4L08A 2GARA 2C7QA 3TRKA 2VP3A 4PR0A 4QGFA 3P9ZA 4AZTA 3PW7A 1V7ZA 5AT1A 1KZ7B 1AKQA 3GCWA 2GCNA 3RB3A 4YQEA 1VDZA 1PFKA 3HKCB 3K8QA 5EWEA 3NHWA 2PQ2A 1N56A 1S9FA 3DR5A 3F1LA 4RK0A 1N8SA 1H2YA 3I04A 5U9CA 3NBKA 1V9CA 4KRFA 2IHTA 2PWZA 4YJKA 5AKGA 5KYTA 5KO2A 3BD7A 4ILEA 3QEAZ 1FNMA 3QVXA 4FT4A 3JRWA 2EDCA 2FF7A 2OZLA 3E9RA 4MOWA 3PPXA 2BTQB 3MT9A 2GQRA 3EBOA 1GSHA 4PWZA 4KYTA 3RUFA 1J8YF 4E1VA 5IAGA 2WYVA 1EGAA 1MAWA 4EMUA 1W47A 3AR4A 4QPDA 4MH0R 4EPTA 5FV4A 3TINA 5DAAA 1OB5A 3NP9A 1C9EA 3X2EA 5F3RA 5AHWA 4UTOA 4KC0A 2W37A 1CUHA 1MT3A 1T36A 1G9SA 3AOEA 3Q98A 4U7PB 4DOMA 1YZTA 4LYEA 4F2WA 1YIOA 3WLFA 3OQHA 4RELA 4BKMA 1Z5PA 4MYHA 1ZZEA 1ESMA 4HWTA 3JR7A 3QU9A 4UD2A 3HLTA 3AL3A 3EBPA 2R5FA 4E07A 4ZOCA 3M9MB 3K6SB 3EZ7A 4AROA 3FTEA 3S28A 1R5JA 3I32A 4PYLA 3HM9A 1W7AA 3TVDA 1VMEA 4WBNA 5IF3A 4MO2A 4GE0A 3P27A 2TMKA 2Z8XA 5KEIA 1KDYA 1YQDA 2JAUA 3IMGA 1ZK1A 1XZIA 2W2TA 3HM2A 4FYVA 5CE8A 3JPYA 3KOUA 1WCXA 2RH9B 1X7GA 4IFEA 4IEEA 4WECA 5JSYA 4QSHA 2XBUA 2H7YA 1R66A 4GQAA 4DCPA 3AUJB 3QFHA 4C4RA 3W5CA 3I2JA 1TDJA 4M0PA 4ECYA 1E1QD 2HSEA 2CFCA 3CNLA 3K3PA 1G5FA 2Q1SA 4HPXB 1YAHA 3F2IA 3CS3A 3ND6A 1AB5A 1T3NA 4W9NC 4RTRA 1BKYA 4CQMB 4S1OA 3RYIA 4DWOA 2X2FA 2AR0A 3PVZA 4I5IA 5IP5A 2IDJA 1EEHA 3ZQ4A 2G1PA 1RZVA 1RCTE 1N6KA 3UN1A 4G8JA 3PKZA 1FC0A 2VSFA 2B1IA 3THOA 1E3WB 2C95A 2WAAA 2BFFB 3CN7A 1GNQA 3HUFA 2JZOA 1S10A 3PHLA 1CQPA 2D5CA 3LKVA 3N39C 5JCJA 4CU2A 3IKLA 4Z3KA 1IM5A 2JH9A 5BOSA 2JCBA 3Q8PB 2NSYA 4L4ZA 4ND6A 4AD8A 3HU3A 3ZEIA 1XAGA 1XMVA 1ZZGA 2DBQA 2DT5A 5EKSA 3CUTA 3RRMA 3KM0A 5IJ9B 2W6JD 4O7YA 2IDMA 1EJ0A 3FPKA 5E1OA 4B2LA 3IHKA 3PE3A 1S2DA 1GQ2A 4Q6WA 1REQA 2O2JA 4R31A 5DG7A 2LV8A 5KU7A 1H93A 4RUAA 4MDEA 1UOEA 3NVKI 4OB8A 3GEMA 2XRMA 4PBCA 1NI4A 3LX4A 4A8PA 5JVDA 4AX8A 4EO9A 4LFAH 5DXAA 4YMGA 5KHLB 2HK8A 1VLZA 4WJZA 2C04A 5C31A 1F2VA 1JHMA 2EERA 2ZYTX 3URKA 4OXKA 2VDJA 5I7WA 2IBMA 2R4TA 2W2LD 3O73A 1K97A 1KC1A 1AD2A 5C4XG 1UMDB 2IPAB 4R16A 4UVDA 1KQFA 1XEFA 2FWAA 3FD8A 2RDMA 3DTVA 2HPZA 3QVJA 4CMAA 3C3PA 1U65A 3RRYA 3N59A 1BWQA 1I4OA 4ITVA 1O5TA 4X1IA 2I7VA 1GRRA 3U16A 3OCJA 3FBWA 4DL5A 4U2CA 2FW9A 4JI5H 4UQPA 3K0EA 1FDVA 4RLHA 1CT9A 5EJ7A 4GKKB 1XLVA 1I7PA 3TXAA 1GPYA 3GAZA 5ADWA 5D1OA 3OTQA 4AJIA 1SUFA 3OJWA 4GS5A 4BMZA 1R3UA 3N8DA 4BCCA 4EM6A 3LPNA 5LNK1 5KQGA 4MI9A 1ZOIA 5BN3A 1JH9A 4F50A 3N6VA 2G5CA 3Q3VA 2F8SA 1ZAUA 2RFLA 5LA6A 3P94A 3PCRB 3F7NA 4MR9B 2H1IA 3OX3A 4BQPA 5F2OA 1TL7C 3VPXA 3MCUA 5EWJA 4LC1A 2HDOA 3RDPA 4O0LA 5KFWA 1Z6TA 1GNRA 1NZFA 2VRCD 3IX7A 3R3SA 2OCDA 4HEQA 4BBAA 3UWPA 2RGNA 5B3JA 4NU6A 5HFNA 1R2QA 3QU7A 4L78A 2FQWA 2Z5GA 5E7IA 1QX4A 3AEQA 2AGPA 4FQ5A 4MZDA 5HKLA 3CTMA 3MS4A 1STOA 3SMQA 3X1MA 1BMFD 4ZYUA 3CVWA 1I0IA 3TMYA 1ZCBA 3BK2A 4HN9A 4MUAA 4HQ6A 3EGEA 4GZ3A 1R5BA 1D4ZA 2PL9A 2Y4NA 5KINB 3L05A 3T06B 2QD1A 2XW6A 2HW8A 3DQPA 2FUG1 3WLJA 2REBA 3HCCA 4ZA2A 5FPYA 3VI4B 3X44A 3V4RA 1M6HA 3KFXA 2OO7A 1MUUA 2WWRA 1NVVR 4IBOA 4JI6B 2FKNA 2VSOA 3K4PA 1RQLA 3C3BA 1LJ8A 1OX5A 3HVUA 1ABBA 1H8EA 1S7GA 1DEXA 4TROA 2MU1A 3RTDA 4WADA 2FK3A 4R9VA 2YXLA 1AQYA 2E18A 5KNCH 2Z2KA 3O91A 3T34A 3HSKA 4K9LA 4KO1S 3ROPA 5CA0B 1TT7A 3W9SA 4XJSA 1ZY2A 1MTZA 2H16A 2IF2A 2IPXA 3DAYA 3O8LA 4GGMX 3MR5A 4LIPD 3O3MB 2QZ9A 2QTGA 1EXWA 4UXJA 4G0QA 4G5SA 3R0XA 2I78A 3D43A 1GTG1 5AK5A 1RZRA 2CCGA 3EARA 2NZ2A 4DYDA 5CBPA 2A9JA 5BW5A 1K8XB 1M7GA 4LMYA 2DCUA 2V3VA 3HADA 1ZEJA 3DQZA 4P92A 4AYXA 5AM5A 2YWBA 3P19A 4YHHH 4QBKA 4ZCLA 2HHHH 2GAFA 2IL1A 5KVVA 4JIGA 4HX9A 3GJ5A 3WGJA 2BEVB 4GYYA 3S2ZA 4BX0A 1A5ZA 2LDBA 3UBMA 4HFMA 1XLUA 1VS0A 3MWYW 3OJOA 1QGAA 3RSCA 5DM4A 1NVDA 3DE7X 1K66A 2E37A 5TPWB 5BT8A 3FPJA 4P83A 4QEZA 3TI9A 2UYCA 2W43A 3W77A 4Y98A 1G64A 2GTPA 2ORED 2VJPA 3GMDA 2DLCX 1PI3A 2MYUA 2V55B 5E95A 3VFDA 4HMQA 4WZBA 3KZVA 5FF9A 3AFGA 5JPIA 2Q5QA 3ZR4B 4P4TA 5B37A 3QG5A 2PUBA 2C99A 3U48A 1QDEA 3V8QA 1JLHA 2H1FA 4HXYA 1YJAA 4J76A 2JF0A 1PTJA 3ESXA 1XU7A 2Y3IA 1JSCA 2FEXA 2ZR8A 4HY3A 2QYHA 2FPLA 5DISB 2W2OA 3GPLA 1PQWA 4DR3H 4AO7A 3L0YA 2HLDA 3LOPA 4GXQA 2ZT5A 4DB2A 4PZAA 2LBPA 2ERXA 3RS9A 2J6BA 4II7A 3GJ7A 4RD0A 2DSNA 2QTCA 4QUGA 1XTSA 4BMYA 4KXYA 3PVCA 5JCJD 1ECJA 3OTOB 3IR6A 3X1XA 3BWBA 2QN8A 3SR0A 5IVHA 4BVEA 3VYRB 3K30A 1C0PA 2WG1A 4P6VF 4UNRA 1N2CB 3VDRA 1J0CA 1X19A 3B36A 1DAMA 2RH5A 5BQXA 2VUHB 5H5JA 2NTJA 2W58A 3SDZA 3TE7A 5FFFA 4FHZA 1A48A 4F4CA 1IN4A 1ZIXA 1M0EA 3A06A 2A3RA 5AJVB 5DTRA 4KHPH 4Q15A 4F6RA 1LI7A 2Q9AA 4LWQA 4M83A 3DLBA 2AMYA 1FVFA 5BYJA 1D8TA 1WCYA 3FDZB 1BKDR 3NM4A 4D4IA 1KDPA 1WSAA 3WOVA 2IEYA 1KI3A 2YY5A 1HE1C 2GZ1A 1BCRA 1I3CA 2GCEA 3BXOA 2R8KA 1RWXA 3BQ0A 1OFHA 4TKMA 4NBVA 2W9BB 3LYHA 5KYWA 5IP9G 2OHJA 5D3ZA 3HB7A 4P9NA 2ODNA 1UADA 1QHFA 1FCJA 1SYXB 4KLRA 4KQIA 3BSYA 1I0LA 3ZDAA 4X66H 5CP8A 2DWPA 2VP9A 4D9NA 4GAEA 4MKHA 1E20A 3UMSA 2OAGA 1PG5A 1XGKA 3UUGA 3S8MA 1IZ0A 4DCNA 1RM3A 1TNDA 2C3PA 1U5AA 3A31A 4QYIA 4F0JA 5CA0A 4DDWA 3S7ZA 3K53A 3PXXA 2IHYA 1DPGA 4K40A 1UXOA 3UFXA 1E6KA 2GFIA 4BQFA 3JTMA 4UE6A 5HF5A 5LQSA 2C58A 2W2NA 1QIEA 2PU7A 2Z5LA 2RJ3A 4C04A 4BPRA 5IASA 1ZHOA 4LX0A 1WD5A 4CKZA 3CNBA 2BMWA 3VRHA 1P2BA 4JC5A 3R76A 1RPTA 1J5XA 1X86B 4LF4H 1QYCA 2IEZA 3FPCA 3CZMA 3IFSA 1RQGA 4HUJA 4KCGA 2BEVA 2OHFA 1E79A 1MB2A 3DW3X 2F62A 3RSFA 4YV1A 4K1XA 2O2YA 2WT8A 3ET4A 5JQWA 3U54A 1ECPA 2FPOA 3NVDA 3MCTA 4CDMA 2BMDA 4HWOA 3PVXA 2XNDD 5HWSA 4RF4A 1JL3A 3KB2A 3TPZA 5BUZA 2YWRA 4L0MA 1NMXA 3BA6A 3TQQA 1EPUA 1Y4DE 4RZUA 3OEHD 1Z9BA 5GJVC 5TB5A 2LIVA 3CG4A 2ZIZA 1KBOA 1T4GA 5I5XA 1A9XB 1U0RA 2R1VA 2WAMA 2WILA 4FBLA 4HGQA 3E2PA 3ZDCA 4AUNA 5LQRA 1BVHA 5ESWA 2XZOA 2IEDA 4Z1MD 3GP5A 4NCAA 1GL6A 1VKOA 2GLUA 2H85A 3AP2A 3GWGA 3L7IA 4FZVA 4JJKA 4N82A 5ER6A 5C32A 3R0IA 3PJRA 5JZVA 2JI7A 4MWSA 2QMUA 3PC8C 5J58A 4ED7A 1XKQA 1QIHA 4HHEA 1XP8A 1Q0TA 2VZ0A 2P1DA 4DADA 3OO0A 1CKNB 1X3LA 2XOKD 5K51A 2E82A 4UU8A 5BWOA 3M4JA 3EPPA 4OMUA 3A3OA 1L5OA 4PPYA 4ETIA 3KHKA 1HYQA 2HDNB 2IOHA 5SV2A 5FYQA 4M1QA 4JMLA 3SE7A 3K2EA 4MKXA 1JMKC 1KSFX 4M1WA 3VNSA 2YN0A 2ODPA 4ESHA 3IAAA 3NDPA 4RQUA 2OQRA 4OB7A 1O95A 4EY5A 2JFYA 2X40A 1TYBE 3PR2B 2YXDA 4K7JA 4GPAA 4JUBA 1K88A 1R4ZA 2J5RA 4IVNA 4V2IA 3DDOA 3PNSA 3RKRA 4AWXA 4CGZA 3LCMA 5B1EA 1CE8A 1IK4A 4RPIA 4DMHA 1Y80A 2A3NA 4NS1A 4O2AB 3A2LA 2OC4A 3VVMA 4C0WA 1Q0SA 4F1WA 3KXIA 4YCSA 1M8FA 1I1OA 4WZAA 1H2RS 3QYAA 2HV8A 4HEA6 1R0YA 1YOVB 3QKIA 1W2WB 5F73A 1RPNA 2NO1A 4NPAA 3AF0A 5JRDS 4KQHA 1SJ9A 3KNZA 2DQSA 3AG6A 4GMFA 4DWVA 2YRXA 1HETA 1ND6A 3WDMA 2PJDA 4I81A 1XMJA 3BXXA 4DL3A 4Q4HA 4DSTA 2UUOA 2GVZC 4RL6A 4D5EA 2YJTD 2WFAA 4V03A 1FDUA 4S04A 1WXWA 1EFVB 2B21A 3EHEA 3ZE7A 2D59A 4Y7CA 3TTUA 2ZS7A 3IQFA 5K6AA 4BE9A 1N48A 1WF3A 2EZ8A 4OHVA 2VJNA 2W6ID 4RTQA 3IPLA 2W98A 5LDGA 4Z4FA 1WVIA 2Q4RA 3K5WA 4DBVO 4RH1A 3D3WA 2IEAA 2Q2QA 4ZI2A 4ALNA 4XCVA 1KAOA 1QC5B 1B6SA 1UIMA 2FZKA 2HAEA 4JT9A 3C8ZA 4N40A 5LPNA 4JSTA 1A76A 4FFRA 4WCFB 1V4NA 1XXHB 1H8HD 2GF9A 3CNQS 4DL4A 5DHRA 4Q3NA 4RENA 4YA6A 5EEHA 3EWIA 1HL7A 2ODEA 3BYZA 2J48A 5I5VA 3BD6A 2E2IA 2YINC 4US2R 4RW0A 4TMKA 1N25A 1ZMTA 5E6SB 3KP1A 2H51A 4PG8A 1HK7A 5BWMA 2GJSA 3BMQB 1CQZA 3E7DA 3JALA 2QD4A 5FLXA 4OFZA 4J8PA 1FBTA 4NFYA 5ITZA 1BS2A 2ADMA 2HU8A 1I01A 1W1WA 4RVFA 3L84A 2CT8A 3UC9A 1GDTA 1FEZA 2R1VB 3FWYA 2O50A 1E0KA 2IHJA 4LYYA 3VQTA 4D98A 4CG3A 4M87A 1RNLA 2P6NA 3QOFA 1N1DA 2GPBA 2P69A 4Q01A 3IAHA 4TMXA 1X9HA 4BBZA 3C97A 3DBOB 4HNTA 3S55A 2XT0A 3GAAA 4BXOA 2BBSA 3CBQA 2J5BA 2PH5A 3TKLA 4C88A 4LQDA 3SI7A 4CM5A 1H0RA 3TTXA 2UUCH 1BDJA 4MW4A 1NPDA 4O4JB 3TNDA 2P8JA 1FMTA 2CXRA 2WTFA 2ZBPA 3GAMA 2AJ8A 2NZJA 4Y2JA 3LQSA 1EK2A 1KKUA 1JQ5A 5GMOA 3HOWG 3GRVA 3BQ9A 2HGXA 3IP8A 5LM3A 3U3JA 2A92A 1XVAA 1OGYA 2Q5FA 2H2WA 2QWXA 4L0CA 4XDYA 1U28C 3EPIA 3F5DA 4Y18A 2J85A 5TX7A 3SYTA 4RSRA 1RXUA 4CTMA 3N2GB 3EFBA 3AWIA 3JARB 1JHOA 3ASYA 4DJJA 2PRIA 2P30A 1YA8A 3IT0A 4Q9KA 1OMOA 1GPKA 3FOAA 4JLAA 4UTZA 4D8WA 4QTTB 2BEJA 2IYOA 5F9FA 2KX7A 3JWJA 3PC6A 1R5OA 4YASA 1TX4B 3OZDA 1TIKA 2XE8A 4HF7A 3B82A 4XTRA 2IWHA 4DLLA 1P1JA 2EFCB 2OM6A 4RFSB 4C1BA 4BAZA 4D9MA 4U7DA 5CCDA 3WGZA 1UJ6A 1D1PA 3F7TA 3ISJA 3OZIA 4OJYA 1PT9A 2FW7A 4QYMA 3TW8B 1ZD3A 2WSYB 1YOBA 3LY8A 4JSYA 3FHTA 3AZQA 4WOPA 2ZJ8A 1ESZA 2G3YA 3QFSA 4Y6RA 1A1SA 1IN5A 1NUTA 1Y1TA 4RACA 1D0VA 2R6GA 4DV2H 1J06A 2PH7A 3TFWA 4EBDA 2QQ5A 1PJZA 2XWJI 5CNJA 2J9GA 2I7XA 5MN6A 2PSSA 2OVFA 2NOAA 3UMRA 3WADA 2OESA 3D6FA 4TUYB 4LF6H 1VL0A 1ATZA 1ZXXA 2VH2A 5DOZA 1GRQA 2COUA 2JAQA 3GEEA 3UJ6A 4DNXA 1BGXT 4YI3A 3EDOA 1JHZA 3H5LA 4IVQA 2BFWA 4JLVA 4MVWA 4E6PA 3AFMA 3SCZA 2V7TA 4WHXA 2XKJE 2NGRA 3FLBA 3LL7A 4D0GA 2QVBA 2AFIA 2X0JA 4O2BA 1PJ3A 1NXWA 5GIPE 1LDBA 4MUMA 5EG5A 5HKOA 4H6XA 1BO6A 4UFNA 4GC6A 1X7HA 4NY1A 4PQFA 4GL2A 1FZTA 4MIYA 4JZKA 1N0WA 4EY7A 3IBYA 4D8XA 5JSFA 4IDHA 1YH3A 3ORSA 2UUBB 5CVDA 3LQQA 1ISMA 3GIPA 1JHDA 1K9SA 3B70A 4M54A 1EFAA 1T2VA 1KOGA 3NIFB 4TM5A 3A9CA 3SZGA 1HFJA 1OT5A 2JFXA 1K9VF 4BP8A 5C1PA 1PDVA 2O5RA 2VPPA 3X1YA 4B3BA 4WCFA 3KPJA 5C8YB 2A14A 4KOEC 2Y0BA 3WDSA 3FCOA 2JAWA 1H4QA 3M6MD 1CRZA 1T8SA 1ISGA 1Q1EA 4FDUA 4LPSA 1R8XA 2Z9BA 4LOHA 3HGTA 4ZO6A 3PO3G 4PO1A 1I1HA 3HBMA 3VTKA 4YIKA 4AY6A 2IITA 4MI1A 5BN4A 1ANKA 2C2YA 5K4HA 3U4CA 2WYHA 3F4BA 4MV9A 4HLNA 2OY0A 4C1NA 2ZE5A 1HDCA 1VI6A 1F8YA 4MQ4A 3GJ3A 1L7OA 3GVIA 1J21A 3LUHA 2PLNA 3KLBA 4ZFNA 1FTSA 3K5IA 1CIJA 1KU0A 5KT2A 4G0YA 3VVLA 5DCYA 1LPAB 3TIIA 1W8DA 2W2QA 1A5BB 1CKEA 2JBWA 2PKEA 3C43A 3KSZO 4HNSA 4XJTA 5SYNA 4DV7B 2CV2A 3OIVA 3BGSA 2G83A 3P5BA 5FI5A 2VG8A 3ZXIA 1D7OA 1GVNB 4GYWA 4LN1A 4YP1A 2EZ9A 4NMWA 2OP0A 1K92A 5SY6A 2ZIUB 3RFFA 2MR6A 3AMVA 4DILA 1NOKA 3IVRA 3NTOA 4IJWA 2ATCA 2OYRA 2QAGA 4FMDF 1SWWA 4PO3X 1A9ZA 1PZMA 4J6EA 3H97A 4YJFA 1KQPA 4HQNA 1XRRA 3D6UA 2J6CA 4YMVA 2UXDB 2ZRQA 3GDOA 5KOHA 1ZMOA 4OHRA 3P1JA 1YTUA 2X5NA 4X6YA 5F51A 1IBMB 4E4RA 3U39A 1Q0PA 1C9KA 1PQUA 1RBMA 5F2KA 5IH3A 4JEUA 4WINA 3DCIA 1QK4A 4QDOA 4ZXPA 5F77A 2FG7C 3KIPA 2Z08A 1L5YA 2LUOA 3DFUA 4URUR 2ZSEA 2VT3A 2GYUA 1UT5A 4IMPA 3WLRA 2AEMA 5I3CA 1S01A 1Y3BE 3U4MA 5E1DA 2HKIA 3UJCA 5B4VA 1HBJA 2I4TA 1T9AA 2FZGA 3G17A 2IGTA 2JBHA 4X60A 4Q00A 2Y1CA 3W9YA 4XYLA 4YIHA 1S8OA 1QH9A 4F4DA 1FSGA 4J9RA 3UJ3X 3GIJA 3LDUA 2HRDA 3COZA 3FYHA 4LXQA 4NSNA 3FTPA 4I8DA 4IDDA 5K4AA 1Z2NX 3ZCVA 4C08A 2V6MA 1OFIA 4ATNA 1E94E 3BMCA 5KSZA 4PGFA 4QU0A 2CYAA 3T9BA 1JX4A 1EBUA 1PS9A 3RHTA 4URXR 5LQNA 4IOJA 3OLVA 2M6KA 4RB0A 4E5YA 3JATA 4YLGA 3TUZC 3KSDO 1U0NA 4J0EA 1CY1A 4LJLA 3RYCB 3WBBA 5CA1A 4KR2A 1DE0A 1R6DA 3F7OA 1T6BY 1EMDA 4HYYA 2H4HA 2CXSA 3NHYA 1A7KA 1RHQA 3QSYA 1N8TA 5FLMG 1MTOA 4S2EA 4E2YA 1Q7TA 2Q2WA 4U9HS 3R1IA 4JQSA 3VH3A 5DGDA 3RK4A 2HNAA 4LOJA 5KSPA 1DCTA 3DOFA 3UJNA 2GT1A 4AZ0B 1W9MA 1KI8A 1V16A 3EZYA 4HZGA 4NV0A 4ZHSA 2X23A 4GYKA 5K0TA 3F6EX 5CDGA 5KSWB 4UHBA 2JG3A 3A9VA 2AF4C 3GJ6A 3OPMA 4GPEA 1FP7A 4CKWA 4UEKA 2W2PA 2FRVA 4NE2A 2ESRA 2CVHA 2YFHA 3DSRA 2W4IA 4CTOA 2YVAA 1GTMA 1HE4A 2HRQA 3GPDG 3J80W 4IGIA 4IKOA 3A6PC 2RKBA 3I8XA 4G01B 2IZ1A 1FTGA 4M49A 4D79A 2IHZA 3FX2A 4B4VA 1MD9A 1QB8A 4R8UB 4NYJR 5AVKA 3X2SA 1LPBB 2O4UX 4U8GA 4YJGB 1QRAA 4BV3A 3SS7X 4N7BA 2XZLA 1BW9A 2C0CA 2IELA 4CL3A 1F06A 2JFOA 5A1JA 2AF3C 4O4IB 2GUGA 1JJAA 4OM8A 3ZKWB 3MT7A 2D8AA 5EZ6B 3LNTA 3VU1A 3KXPA 1SZJG 4WK6A 3EUAA 2JA5A 4HVCA 1EK0A 4NBUA 3ZPXA 2P2YA 1QOZA 3KYIB 1V5GA 1B2LA 5J43A 3QLVA 1I0ZA 2DJ5A 3NBYC 4Q47A 1JB1A 1NLYA 3DPSA 1JEYB 2PUFA 4DR4B 1E7YA 1PV2A 1ZRSA 2BPOA 3J7AK 3EDMA 4G0WA 1FJGH 4UVEA 1AUVA 3LLMA 3JQFA 3QXGA 2JGAA 5E0OA 4EAAA 3GGSA 2POQX 3CV3A 4BVHA 1G8KA 3PRKE 2VF7A 4B9EA 3JSAA 4I4TA 4Q66C 2B4RO 1GZDA 3SQXA 3M9LA 2JAXA 3U61B 2VJKA 1BOOA 3GLQA 1AKEA 1TQ2A 4JL5A 1ZAYA 1HURA 3UZBA 1A95A 2BUAA 2IXTA 3Q0TA 3A6ZA 1R18A 4WVLA 5EJAA 5C7YA 3U5TA 4IJ6A 2V6IA 1L5RA 4UBJA 5CVVA 2KLBA 3EGXB 3KXYT 2GCOA 1XFAA 4YK7A 5FUWA 4QM7A 1W93A 2CKZB 2I1QA 2J4FA 4RHCA 5BNIA 3N0XA 2JJ1D 3CEHA 1U98A 4IO0A 3N0RA 1GUBA 3A3KA 1GAJA 3FKIG 4UPEA 4M46A 1S2NA 3AP3A 1T3GA 2VRCA 4IS3A 1H2ZA 2VO1A 3QW4B 1Z6XA 4CQMD 4OP3A 1UK8A 3D8BA 3FYDA 2OHGA 5C4GB 3UOGA 5I7SA 1Y81A 1Q7RA 4BJ6A 2Z9CA 4NLGA 4AMVA 4F8JA 4TYPA 3IAS1 1EYZA 1HT1E 1XK6A 3GWZA 1RWPA 1NFFA 1GCAA 4FHGA 1DQPA 1KF0A 4HGNA 1O9HA 3FWHA 4X0EA 4IMIB 3KB1A 4BC0A 3MYYA 1W4AA 2HCJB 3BWXA 4KRXA 2IP4A 4CKBA 1DO0A 3CVZA 1KJZA 2QTMA 3KHGA 4RL4A 2WU1A 5DBEX 1E1RA 2G71A 2AHRA 1AV7A 1E8NA 5T14A 2ABWA 3CNHA 3FFBA 1PJ8A 2VYCA 3IT2A 3K0CA 3KFLA 4GVXA 4M9ZA 5JAPA 4K6GA 2R82A 1OZAA 2Z09A 821PA 2IVZA 1C81A 1SKYB 2WU8A 3VHXA 1AKYA 5KQRA 2A86A 2B8TA 5ICEA 2NO0A 721PA 1G60A 1G5IA 2LNDA 3NJRA 3QNMA 1QRSA 5JS7A 2IV7A 2A33A 1GPH1 4BKPA 4UCOA 2X1VA 2AMFA 4Y2TA 5DMXA 1FP6A 4H1UA 5EPOA 3NDIA 4JASB 4K87A 3K1AA 2G80A 3QUTA 1BXGB 3SC2B 1U7DA 1CDZA 3CH7A 2ZYHA 3UV6A 4AY2A 1RKVA 4FNMA 3GH1A 3KTAA 3R7WB 4KG7A 1YE5A 1WBJB 3MERA 1YKSA 5E8JA 3B7WA 3MMSA 2YZNA 5HA5A 1XTTA 3ZUGA 4LY0A 4OUDB 1N9GA 3FM9A 1CQJB 2D5LA 4P3OA 2AOVA 4QAQA 1E5DA 2R1ZA 2XNCA 2CFMA 1VXRA 3KKQA 4IPTA 4REMA 2OV6A 2ZRAA 4U63A 1L8XA 2I2BA 2QRMA 3DL2A 5ICFA 3HOVG 3BEDA 3O83A 4QQ8A 2QXTA 1KEZA 4MR8A 3MWEB 1SHKA 4CLHA 2W9CA 3PUZA 4S35A 4BYMA 3U4QB 3B60A 4U6QA 4OU4A 1PJRA 1VLVA 4B44A 4BN4A 2SCUA 3HXQA 1Q0UA 2CLOB 2QRQA 3G2KA 3OEWA 1JPJA 2Z1MA 4V38A 5JISA 3EC1A 2C8LA 2O2ZA 1ZAKA 2XOXA 3EH2A 4ZHQF 1QYRA 3C3JA 3MUFA 3Q9UA 4FC6A 2P5YA 4TYWA 3ZWAA <