4I50F

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
379
structure length
303
Chain Sequence
MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYLAAYNRRREGREGNVWIAKSISSEASELLDFIDEVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSTNHCIQKEYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLADPTSIFIKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 78
structure length 303
sequence length 379
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4i50F02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4i50F03
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i50F01
3TQTA 4C5CA 2I8CA 4O84A 2Z04A 2CZGA 2W6ZA 1KEEA 5CA0F 4FU0A 1Z2OX 1OBGA 4ME6A 3KALA 2PN1A 4O4LF 2FP4B 4MA5A 5LA6F 2VR1A 3V4ZA 3VMMA 4HNVA 4DLKA 1M0WA 4O7NA 1A9XA 3ORQA 1EYZA 3Q2OA 4ZI7F 2YRXA 3JZFA 3BG5A 4O82A 2YZLA 3KAKA 2PVPA 2CNUA 2W70A 2R86A 4HNUA 1EUDB 3OUUA 1KBLA 2ZDQA 1DIKA 5JQWA 2DWCA 4O7YA 3U54A 4O2AF 3R23A 2SCUB 4I55F 5C1OA 5D8DA 5EZYF 1T36A 3SE7A 4MA0A 1B6SA 1IOWA 3U9SA 1GSOA 1Z2PX 2PBZA 2I87A 4O7SA 2OLSA 4MAMA 2NUAB 2W6PA 2Z02A 2NU8B 4HQ6A 1E4EA 3HO8A 2VPQA 2YL2A 2P0AA 2CNVA 2XD4A 1CQJB 3OUZA 2V5AA 2DIKA 3VA7A 1A48A 2J9GA 4IHJF 5LP6F 4MV6A 3N8DA 5J2UF 1PX2A 2HGSA 1ULZA 4HR7A 3TIIA 2R7MA 3KREA 1GLVA 2R7NA 4EG0A 4O7RA 1VBGA 3E5NA 5CAEB 4MV9A 5LYJF 1CE8A 2NU7B 1OBDA 4IWXA 2CQYA 3UFXB 3DF7A 3WO1A 1I7LA 2R87A 4I4TF 4FFLA 3I12A 3ORRA 4IZOA 2V59A 4YJ3F 1M6VA 1I7NA 4WBNF 4O81A 1JDEA 4O7TA 3Q1KA 2YS7A 1IOVA 3K5HA 5KKNB 2X0SA 5BPFA 3RFCA 3TINA 4FFPA 1EUCB 1M0TA 4I50F 1DV2A 4MV8A 5CA1F 1W96A 1JLLB 2FPGB 4XX0B 4XYLB 3G8CA 4FFMA 3MWEA 4FGRA 2NU6B 2YZGA 4O7VA 3JRXA 2ZDHA 3R5XA 4O7WA 4DIMA 4O83A 5BPHA 4ZQIA 4Y8VB 4M9UA 4XYMB 3ETHA 4IIJF 2FPPB 2W6NA 4MV3A 2YRWA 4TUYF 3JZIA 1CS0A 1BXRA 5I47A 4IWYA 3U55A 3LP8A 2I80A 3HB9A 1JDBB 2IP4A 2YW2A 4MV7A 3HBLA 3VOTA 4YBZB 3AW8A 1BNCA 3VPBA 4RZQA 4L1KA 3U9TA 4TV9F 1KJQA 3JRWA 5LOVF 4O4HF 4XZ3B 4TV8F 2V58A 2QF7A 3V4SA 2YYAA 5CB4F 2GQRA 2YS6A 4YAKB 2WYOA 1Z2NX 1AUVA 5C1PA 1KJ8A 3KAJA 4C5AA 4ZOLF 5K2MA 3ETJA 3VPCA 3WNZA 4QSHA 4FE2A 2VQDA 5C8YF 4O86A 3GLKA 3MWDA 3R9RA 5JQGF 2YZMA 3MJFA 3TW6A 1C30A 1VBHA 3LWBA 3R5HA 2CNQA 1KJIA 4NYEA 5DMXA 4WD3A 4MV1A 4YAJB 5BMVF 2XCLA 1CQIB 2FPIB 2GLTA 5JVDF 4HNTA 2GPWA 3AX6A 3NUAA 1UC8A 1GSAA 4ZHQF 3GIDA 5H80A 3RV3A 1EZ1A 3RV4A 5JH7F 2FB9A 2R7LA 5IYZF 3K3PA 4YJ2F 5KX5F 5HV6A 1GGOA 3N6RA 1EHIA 4E4TA 4O4IF 5FNVF 3QFFA 4O2BF 2W71A 3VPDA 2GQSA 2ZDGA 5JVLA 4O4JF 1KUTA 2W6QA 2W6OA 2DZDA 5HBRB 2R85A 4FFOA 3G8DA 1WR2A 5LXTF 2NU9B 1JKJB 1AUXA 2YWVA 2GPSA 1VKZA 2DLNA 1KC7A 4YB8B 4FFNA 2R7KA 1B6RA 1W93A 4O7LA 2HJWA 2W6MA 4EGQA 1C3OA 3RUPA 1E4EB 3R5FA 5GONF 2R82A 2R84A 1GSHA 1SCUB 2C00A 2QK4A 1UC9A 4FFRA 4MV4A 5J2TF 2R6FA 1KJJA 1DV1A 3WO0A 3TIGA 3K5IA 4EGJA 2YZNA 1KJ9A 4O7ZA 1PK8A 4C5BA
chains in the Genus database with same CATH superfamily
4A16A 3C8MA 1XTBA 4QXMA 1DCMA 3RM3A 1JALA 3K0EA 3FAKA 3F78A 4OX9H 3G0CA 3OEED 4QICA 2XEDA 1P8AA 4G89A 5H59A 3LUJA 4TM8A 3AHHA 5CR9A 2YHSA 2ZSAA 4JV1A 5AKYA 3ZU5A 1E92A 1G59A 1IPFA 1CHNA 1JPVA 2R7AA 1DU4A 3UK7A 3O4FA 3BDIA 2ZIZA 4Z0NA 5F9FA 2HXGA 4BLVA 1JAYA 4B81A 1CJVC 3IIKA 1CR4A 1DRWA 3DHNA 4CR7A 1FLVA 1UDWA 3I1IA 5D00A 5CPBA 1CLEA 2UVQA 3RGGA 4WXPA 4LWQA 4LV8B 3EE6A 3GV7B 2A8YA 1CULC 4K87A 2G6TA 4WOBA 1XNRB 5FUVA 4YQFA 4B4DA 1LX7A 4S2UA 4N8SA 1SG0A 2NV0A 3B6EA 4PPGA 4YAWA 2YL2A 2F1JA 1BEEA 5HX7A 4Z7NB 2GK6A 1T9BA 5AI4A 1DCKA 3LTEA 3HN2A 3HMKA 3TB4A 3IPXA 4H3SA 9MHTA 1BCRB 2XA1A 1NW8A 2O06A 1A2BA 4IH1A 1Z34A 1NAIA 4R9UC 2O05A 3FYCA 2GD0A 1ZO8A 4BGUA 2VLIA 2Q41A 1CQIA 1B23P 2P0YA 2VH1A 4INAA 1E3LA 1ZICA 4HFNA 1RJ9A 1VJGA 3HN6A 4LJ9A 3CW8X 1PJ8A 4DAOA 2KSWA 5JXGA 2I34A 4BNDA 1R1DA 3TGLA 1NX6A 1KNXA 1XK7A 5JJCA 4R7RA 3LKZA 3KZXA 2ASJA 5JD5A 1EXWA 3TOCA 1I2KA 2PD6A 1D2EA 2HOQA 3CZ5A 3MK31 2GK7A 4PLVA 1H3NA 2BKUA 5AW4A 4HLCA 3BFVA 1UKYA 3O73A 5AW8A 3MBIA 4E13A 2B35A 4F91B 4H16A 5FAKA 3J81k 4KBFA 1CYDA 3D02A 4KN8A 4GYYA 3HEBA 1WHSA 4ED1A 4G36A 2B4YA 4Q1AA 4HN9A 1SUEA 5J5CA 1NXPA 1JDBB 2FAXA 3PQ4A 2WIJA 4IX1A 1BNCA 4L6CA 1JZQA 4QT0A 1H8HD 2BFPA 2G9UA 1TM3E 3P19A 2XB6A 3MMPA 1YL6A 2J6TA 3VRHA 1P9OA 4MVXA 2PWPA 4HAXA 3WL8A 1TJYA 5FH9A 2BI8A 1E61A 2G6BA 2CLCX 2M1XA 1JHRA 3A2NA 2I6XA 1FVOA 1UBTS 3FTPA 4A8JC 5BV1A 4OK3A 4WNYA 2QQ5A 2Z2YA 4FSXA 5C5JA 5COQA 5T7BA 2A1HA 2R68A 4KIJA 1RXSA 2ZOSA 2C03A 1B2LA 3O74A 4TL6A 4HMPA 1I36A 2XODA 2GEDA 3L8HA 4RK4A 2IDMA 5ESXA 2PA3A 3CGWA 2VWHA 1SUFA 4OQXA 2BZSA 4XVQA 3RFTA 3UMMA 1JDBC 3UH1A 1TD9A 4KR0A 4IEEA 1P29A 3I0ZA 1ZWLA 3LYHA 3P96A 2ETVA 3DQPA 4UCQA 4Y18A 3PR3A 4JXZA 3EPIA 2P2NA 4FE4A 1DJQA 1X7ZA 5BNZA 4KP7A 4C6TA 3DS8A 3QX3A 4BWGA 1SM4A 2FCAA 4ECRA 4HF7A 1LF5A 4OHBA 5FR9A 1D2GA 4YDQA 2VPTA 1VI5A 3O7WA 5K0NA 4PYQA 2LXNA 4BGVA 3HY4A 4IRMA 4X1IA 4LK3A 5EWFA 5FWDA 2R1TB 4PHTA 2XQGA 4NQZA 4CKZA 3ESXA 4O3NA 3F8WA 1J97A 1HF3A 4HDQB 5D86A 2VEOA 4COOA 3ZWAA 1KVUA 1QH0A 3V32A 3SZMA 1V48A 1KSFX 3FCSB 1PJZA 4RHCA 2PMDA 4EG1A 4KKVA 2ZFUA 1NU6A 1JDZA 5C8DA 1NXQA 2WIGA 4QREA 3UXEA 3H2IA 5JTTA 4RK5A 1R0XA 4L02A 4XA8A 2F3SA 3RS8A 3ZLJA 1XUOA 5EE3A 4RPJA 5DZSA 1R3DA 1YBAA 1T10A 2WOJA 2XGPA 1J20A 4BMXA 1FDIA 4OAPA 5L7TA 5T4HA 3TUZC 3TEJA 3T06B 3G59A 4MVJD 3D6JA 2CLSA 1H42A 5EWJB 4HB2A 4FMCF 1N2CA 3V9PA 1N6OA 2GF9A 1NVVR 2XUJA 1PTJA 1JAIA 4LBYA 4WDRA 4BQFA 2A3NA 1HNZB 1PGNA 5H1YA 2R8BA 3RAQA 1ZJJA 3JQGB 1JXQA 4YRQA 3ZZMA 2JJQA 2JS7A 3H9BA 4FDVA 5FYQA 1QVZA 2YNMD 3T5JA 1XMPA 4YAUA 2OEPA 1ENZA 1QYRA 1KEKA 1WQ4A 4PFQA 1NBOA 5ESDA 5CCXA 4KQMA 2ZJOA 1EUQA 3PQ7A 4O4LB 4R83A 3FNRA 2ONZA 3MXTA 1CUHA 4NXNH 1N32H 5H70A 5FOQA 5JAQA 3SIRA 4RAOA 4UU1A 3SYKA 3BSYA 3DXYA 1Z6TA 4CLHA 1U5CA 3P9ZA 2VJOA 1NVAA 2FLWA 1D2CA 2C7BA 3N0WA 4C21A 3D7LA 2F1RA 3WJ7A 1W96A 2RFLA 1E2PA 1NQWA 1D2HA 1RWXA 1P5RA 3T1QA 2PUVA 4M22A 1M7BA 5I3CA 2ERXA 4N6OA 4OGWA 1GGFA 4LMAA 4N8DA 5EA2A 1CKMA 1O77A 1YFKA 4BX3A 3LP8A 3ENNA 1XVLA 1NY6A 1T36B 4M1TA 3NHLA 4OHYA 2YWCA 4UASA 2D8MA 5E0KB 4DYDA 2WG0A 1ENYA 2OESA 3HK2A 1KXZA 5AHWA 3DE0X 1G6KA 2B21A 4M1YA 3BE5A 4CNBA 1Y7LA 4D26A 3OICA 4FKZA 2W7PA 2C99A 4R2LA 2FW1A 2IEIA 3LC1O 3PRKE 4BLPA 1PUJA 4BE7B 2VG8A 1NP3A 3W5HA 3X2SA 4TWAA 2JH8A 1H5NA 4RESA 4PAQA 2R65A 1KEEB 3O8DA 2AV6A 1E4VA 1M2GA 2F3UA 4NZNA 3JARA 4UM9B 4L76A 3U4MA 2Y76A 5DYIA 1UXJA 4P22A 3UTCA 1RI2A 5DHQA 5L3RA 5DYNA 1QX3A 1WDWB 3RV4A 3S1AB 3LXUX 4QGFA 3IBTA 3O8OA 5B4VA 3FAZA 3AETA 1GNVA 2QL6A 1YTLA 3F6BX 2D0IA 3WDKA 3I37X 3IQZA 2NUBA 4WOJA 5ITZB 1ORWA 3VVBA 4MVCA 4G5SA 1LWOA 4BE4A 3K92A 1WPXA 2R93A 3R9WA 3O5AA 2W93A 3PDWA 2C3YA 2UYQA 4J2TA 3RTDA 3R5FA 5GZ1A 2NACA 2Y1LA 4B0PA 4RFSA 2I6FA 3WIDA 3H65A 2HMWA 1ZMTA 1JFLA 1NLYA 4ZI3A 3K9LA 4MWZA 1P2BA 3ZD9A 3FWNA 5CW1A 3ZZUA 1C7FA 3DBHB 4F4IA 4LJKA 3HKZE 2CDRA 1FFSA 3QY0A 5TV2A 4A92A 3M9OB 3N2NA 1H2ZA 3QX9A 2SHKA 1IBMB 3V4ZA 2FPOA 4QD3A 5JCJA 4PY2A 1T3SA 3QPBA 4X64B 1E1CA 1T9ZA 3KOYA 2D2VA 4XX0A 1FQOA 1P4AA 2OD7A 4HADA 4YMWA 1WUKS 4AKEA 1ZQ7A 3NETA 4DJJA 4LNUA 1TA4A 2VP4A 3PB3A 3AEQA 4PQGA 4QDOA 4YJ2B 2ZAIA 2VL7A 3UQZA 2EX4A 2V4ZA 2CE2X 5DBIA 2PD4A 4HDOB 2RB5A 4J2OA 2RJNA 1U99A 2J1LA 4JA0A 5M3BA 1WVIA 2DJIA 4V39A 3FMOB 3H86A 4N12A 4DCTA 5JNSA 1DEHA 1OFVA 1AK1A 4WRRA 3HJNA 3L04A 2V5AA 4QXOA 1NUQA 1NKVA 1OXBB 5A4IS 1EI9A 1NASA 3UWSA 4D7AA 3TZ6A 4MVJE 2QB5A 5AKLA 4IGEA 3BA1A 2G40A 3RSSA 2VBCA 1BDIA 2WAAA 4UQLA 4Z1OA 2ZRJA 1DAIA 2GHTA 4RSGA 4FFLA 3PFIA 4R54A 3TBKA 3OPMA 4RCVA 1HNWH 4QOHA 2I2DA 4FK8A 4GRDA 4YROA 3GTJA 4HWRA 1GU7A 3D6MA 5K8IA 2CF6A 5K4AA 4FS3A 3OLVA 1I9GA 4RV5A 1R6AA 3TINA 3TSAA 1EUCB 5E6SA 2YMLA 2SNIE 1IN5A 3TZLA 2YVQA 2P67A 2XCUA 5ALTA 1QBGA 4I8XA 3P0HA 1V5WA 1E9BA 4TTRA 4ALMA 4R8LA 4RD6A 4LZWA 1X8KA 1VE7A 1N3YA 3SYNA 4OAOA 1W1UA 1FJHA 1PEDA 3N70A 3P9RA 2X0RA 3GIWA 4WGFA 4ZGGA 4R2XA 4HL6A 1B26A 2QE6A 5EKTA 4HGPA 2HHJA 2D74A 1HKUA 1ZN7A 3BSFA 3CZAA 1IBLH 4HWTA 1H1DA 1NUAA 4I9FA 4J9RA 4NU5A 3THWB 1Z6GA 1L4BA 4HJRA 4MAFA 3TX2A 1LI7A 4RB2C 4OUDA 4UFPA 1GFIA 3G2OA 4JD5A 2HA6A 2CL5A 5CVEA 3URMA 3R9IA 4X66H 5IKPA 2PL5A 3IQWA 1UBCA 1QR6A 1C9YA 4FYYA 4A8JA 3TZQA 3E03A 4N4AA 1ABFA 3LPCA 1YONA 5JUWA 4I9NA 5E4JA 2CNQA 2W2MA 4BTVA 4YAJB 4ZU1X 4NOLA 1FFWA 1ISGA 3LGXA 1NBWB 3ILXA 3S4YA 1IMJA 2WINI 1UF9A 4KVAA 3A3YA 5HJ7A 5EWMB 1MG0A 1I4WA 5KYVA 1V47A 1XKXA 4Q93A 3RYCA 1FS4A 4XLZA 5EJFA 4WACA 5EJ4A 1HDGO 1YNOA 4W9MC 3VR4D 4H0CA 4FYJA 2Y1WA 1D8TA 3W9YA 1E79A 1NF2A 4RNCA 5AESA 4UE2A 4M60A 4C4OA 3QE2A 2JIMA 1P60A 3FTNA 3AK4A 4TVOA 4DUYB 2E5LB 1U0RA 2C1ZA 4NARA 4N76A 5KNCH 4JZYA 2O52A 3BDAA 2JZOA 1RM4A 2WD7B 5E9JA 2RCYA 1YBMA 1SBZA 3N8GA 4PAMA 4NFLA 3SOPA 1NR7A 4CHGA 4G97A 1EQUA 3BKXA 1AHPA 1WMEA 3OFSA 3EIOA 2BGJA 2H2IA 3RJTA 3PTLA 2C59A 4GSYA 4OA5A 3OMWA 4HGQA 5BN3A 2JI6A 1ZW6A 4FU0A 4LRWA 4EY6A 1GRNA 4OLBA 3RTCA 2AW5A 6ADHA 2KHZA 3TLGA 4AYBA 3HKEA 2YHUA 3CZRA 5F73A 2PKQO 4NULA 3NFYA 1XDZA 4CL8A 4YI3A 3X1DA 4ZVQA 4JUDX 2YZLA 2V4QA 5T64A 4I6GA 3MCAA 1NAHA 1DGSA 1FMLA 2HBZA 5KFJA 3MR2A 4BATA 5A5FA 4R3UC 4JP8A 4YR9A 3AYXB 4R8KA 2PZ8A 4GP7A 4HLNA 4MITA 1DAKA 4KI0A 1OILA 4V1CB 4HGRA 5LBIA 3EVTA 4BMPB 5FUMA 2XZTA 3C39A 5ALDA 1UJNA 3R0XA 1HV8A 4GI5A 4YUAA 4QTXA 3S0JA 4BTEA 1LNZA 3KD2A 3FKSD 4EEYA 4DNQA 5AVWA 3IUEA 6CHYA 4MA4A 5I45A 4S12A 4UMDA 3KIPA 3SKYA 1ZD5A 1XZDA 1GYFA 1LFDB 2AOWA 3U6BA 1DC5A 1NXVA 4QVKA 2AIRA 2MSWA 4DEYA 4MW9A 1ZC3A 4UVEA 2R1TA 3F3MA 5G40A 4TSFD 3EUWA 4EW3A 1P1CA 2H0AA 2Y66A 2BZ1A 2FQWA 3MTAA 5IASA 1STOA 5BOVA 3EEBA 4I2NA 2ZQ5A 4B84A 5AVSA 4AJKA 2GEJA 4CC5A 1W8IA 4JYMA 5K0ZA 4MTEA 3CX7A 1AGXA 2VHXA 1SKBA 2VTBA 3WLJA 4J0EA 5CDFE 3D8NA 4TGLA 3OJ0A 5IDYA 4JQYA 3UAXA 3PHIA 2X9LA 1EHCA 2PPLA 1VSQA 3SC4A 4XWKA 3WOHA 1YR2A 5BW5A 4AZVA 2GWHA 2D5LA 4LQLA 4JKYA 1V8FA 3FPSA 1VMDA 5JMPA 1DAEA 1DHTA 2EAUA 3NRJA 2ZTSA 3ZCTA 3W7AA 4IUYA 1T4GA 2V7EA 4BFSA 1S7CA 5ALQA 3HUTA 1OXMA 5KEIA 3GVPA 3I5YA 2ABWA 3BWVA 1M2JA 3JQGA 1ZVMA 4Q3OA 5LOVF 5ER9A 2CW7A 2Q21A 3VKHA 1FNNA 1SEVA 2YN4A 1USUA 2C2DA 2C4HA 5KNBA 2HREA 2H5IA 4Y2GA 5FBLB 2JAWA 1YV9A 4O4LA 3OECA 4NEGA 4QWMA 4IVNA 3INTA 4R0NA 3WNZA 4G4SP 4CE5A 1H23A 3W5OA 1UIMA 1NVDA 4WZAA 3EG5A 2GZHA 1KSHA 2GSWA 3IKJA 2W6ID 3B6IA 2PQMA 1US8A 2M2IA 1QQTA 4LGMA 3LFTA 1I0IA 3J7AK 1RWKA 2BEVA 5B57C 5CLJA 2RGDA 4CFSA 4JBXA 1Z5NA 4OBBA 5KYXB 4MPDA 3WWHA 5JVDF 4MW1A 5FYDA 1BX3A 4AN0A 4Q0YA 1YQ9A 1Z06A 2V0NA 3IQEA 5DGDA 1H0SA 3F5MA 4CF3A 1BHO1 5KU7A 3JVDA 2HCTA 3RIZA 1LKZA 5JH7B 2JI9A 4OQPA 3AJRA 3EYAA 1J0BA 4ALKA 1QXSA 4OHUA 5BWMA 5C5CA 2O8NA 3UN1A 2IYTA 1M10A 3KL2A 3AM4A 5ED0A 3ZYCA 4N5IX 5KVAA 2YJZA 4KMRA 5E9QA 4WVFA 4C0KA 2ZRLA 3LRXA 3VR1A 4IMIB 4ZEXA 4YFVA 3MTEA 3UUEA 3JSAA 5J4KA 4B73A 2JH9A 3ED1A 4K46A 5AK6A 4FDMA 1KGSA 5DK4A 4Y6GB 2RAUA 1GVNB 4V0NA 1D4AA 4L3VA 2JJ2A 1OF1A 4HN4B 5HUJA 3AKEA 3TAUA 3WI7A 4WAUA 3IURA 3OU6A 4EO9A 1QU2A 4UQOA 2I8CA 3R44A 4FGKA 5KYGA 2GNPA 1KEEA 4YRKA 2JA8G 4MA5A 2P40A 3O8BA 1SOAA 1GSIA 4PTYA 2Y1KA 2DSTA 2PIAA 4IV5A 3K6KA 1CNFA 2VKQA 2X0NA 2ARKA 4ZAXA 2XUDA 4L4YA 3S1AA 1DIGA 1N4AA 4B3HA 3VO1A 2CNUA 3DAHA 2ONKA 3CG4A 1NVEA 5ELLA 2PAFA 4KV9A 3V46A 1VAJA 1YQGA 3ZI4A 1M34B 5K3FB 2I22A 4AICA 3NP9A 3KUDA 2J7PA 3AJEA 4ITRC 1WMAA 4UNRA 1M2OB 2ADFA 2WP8J 4G3IA 2M6RA 1M6YA 4D1YA 1ZD9A 1W0KD 1PT7A 1RJFA 4HGNA 2WJ6A 2CKZB 4EX7A 1F06A 3AEYA 3QA9A 2Q6OA 2IYPA 1KOFA 1DBQA 3E7FA 4U3JB 4RVUA 4LJSA 5AQEA 4OHXA 2J9FB 5J4YA 2J3LA 2QM0A 4LKOA 3CZ9A 1J8VA 2IEYA 2J6CA 4BN0A 4CQJA 5U4XA 1GL7A 1DC4A 4I8IA 3QXHA 1EGQA 4MCIA 3WTCA 3Q3HA 2L0XA 4X92A 1UOEA 2QZPA 3DGFC 4MHOA 3ABRB 2L2QA 5G1NA 3SBXA 4KOEC 4O3MA 5TPWA 1EP9A 4G5FA 4MQLA 1YB5A 2GUWA 3V97A 1OYVA 3DPIA 1LGYA 2VPIA 4CCYB 1VJ1A 3PL5A 2QLMA 1MOSA 2TMGA 1ZY2A 4JI0B 3PHGA 4PEVA 3PBKA 1IOVA 3QX7A 2G67A 4DZRA 4YJ2A 4I50F 1JEOA 1IM5A 2D5CA 3PUKA 1NY5A 1P5JA 4Q9LA 1ORTA 4ZT2A 4AF6A 1EAMA 3DOEA 1L5KA 3N86A 1JKJA 1UPTA 5CCEA 1PNQA 1T13A 3FHCB 4NCHA 2PEYA 4AVYA 2NZJA 4O83A 3Q87B 2ZZNA 1GCOA 1I3OA 1EFAA 3CUEF 4D57A 3UUWA 1WUHS 3MAAC 2I80A 1UL1X 1ZUD1 3SNKA 2GZDA 5EG5A 5EE0A 4CG0A 1QFZA 1KAGA 1DP4A 3PNKA 2DSNA 5EIEA 5FF9A 3AB3A 4ZOEA 2R93G 3TXYA 4B3RB 4RD0A 4ESHA 4NMMA 4WJZA 1TX4B 2OD9A 3JQAD 4ED8A 5MDHA 3GCGA 1ATIA 1ILWA 3LH5A 2QVXX 1GNRA 4WOCA 5JT1A 2J0UB 3EJWA 4AQ7A 4L51A 3EPLA 4QEDA 4RPCA 2FPWA 1GQQA 4FMBB 4Q8FA 2I7VA 1JHQA 4GR9A 3UAYA 3M4IA 2F3PA 1OCEA 4L4SA 3GIPA 4QYIB 1CQIB 2R0QC 5LMNB 2PYIA 2MYUA 3DZ8A 3GTGA 4HLQB 3NHJA 4MUJA 4KSCA 5JNUA 4BMSA 1O6FA 2PSDA 5A0VA 3MNFA 3AI1A 2YICA 3C7DB 4BNDB 2ZYSA 4JGIA 3GG9A 4CF7A 1PSZA 1ZETA 1W36C 5L9AA 4CF5A 2HHFB 4E46A 5U9CA 3RJ5A 5EHGA 1B0UA 2HWXA 5KG6A 4J0MA 4DV6H 2RDJA 2B83A 2QN1A 2PU7A 1N5IA 5LQNA 4PAGA 2QTLA 1KTAA 3WWJA 5EGSA 1KYQA 3ZVLA 4EP1A 2VPYA 1TT5A 4UU8A 2BN4A 2I2WA 1WHSB 2HJWA 4HZGA 2JW5A 2Q3CA 1ITZA 3T35A 2H00A 4FCVA 5T3YA 3STVA 5LMZA 4J03A 4I4CA 2A1IA 3PQCA 5EE1A 2I66A 3G0OA 3WC4A 4F3NA 3KQVA 1I7QB 5BOSB 3EPJA 3D6NB 4XUEA 1Q0QA 4B3MB 3ORFA 4RTMA 3LHDA 2Z5LA 1RRCA 3RAGA 5HIKA 1HDXA 3HV2A 4WTOA 3PXUA 3A9UA 3ZBUA 1QH8A 3ZWWA 3VAAA 1SZPA 5LYYA 3W5IA 4RMHA 4KUHA 3NXSA 1A9XA 1ZCAA 2XNKA 3GL9A 4RTLA 1JUDA 4F4JA 2OO5C 2ATVA 1JVSA 4JT9A 3AJ9A 1P3JA 4F4CA 4XM2A 1T8UA 4DC0A 4CLEA 4ILKA 2BZGA 2QUKA 5I9SA 3J7AC 2QJOA 3V55A 2OV2A 2FFRA 2P9GA 3P9QA 3SSNA 4AY2A 1QHXA 2XCPA 3D0QA 3IJRA 5AW1A 3RVLA 4BLRA 3IPYA 1GRQA 2FGJA 2EKBA 1GSOA 1N6NA 3ZWDA 4X91A 3O8RA 3RB0A 1EE2A 3SAJA 3IA2A 5M2QA 1QTRA 2W7TA 2Z02A 3WLSA 1RPZA 3U3ZA 5AW3A 4Z54A 2BFOA 1VL0A 2DTDA 4P33A 2IZOA 2AXNA 5EHNA 1E3IA 3GVIA 5FA5A 2IU4A 2YDYA 1DC6A 3RVQA 4C6RA 4OP1A 1FTYA 4C6TB 4R9SA 3BCRA 2ORIA 4ZK2A 1C9KA 2YVAA 4FJ2A 1QRTA 1DQPA 3AFGA 4M0EA 5AKKA 5EXSA 4BU1A 3QJGA 4UPVA 3SQNA 2CXPA 2GSDA 2HQBA 4PO9A 8ABPA 3DO8A 3ROXA 4OI4A 3T54A 4B46A 1FP7A 1ZGGA 4WNIA 3DOCA 4X8HA 1TM1E 1ZH8A 5BW8A 3IAM6 1Z08A 1QP8A 3MEQA 2FJUA 2G0TA 4DQ0A 4F1WA 1NUTA 1Y48E 3O1JC 2Q0QA 4W82A 3BBPA 1Q5PA 1OPRA 1FP1D 4GLXA 4WK6A 1N5JA 4Q48A 3B7GA 5D5QA 4M0LA 2CSUA 3RBVA 2JAXA 2NUTB 3TNLA 4XXHA 3ZLUA 3L6BA 1VG9B 1QDUA 3TQQA 1HDOA 1TCCA 3H1FA 4M0UA 4QUGA 2LVBA 3RTAA 2D8AA 1GDHA 3ZU3A 3WB0A 4AQYB 3D64A 4KYTA 3PHCA 4FYWA 3KUKA 3GW8A 5ELMA 1S96A 1W4AA 1FKAH 5JS8A 4EABA 3CTPA 2ODNA 4FX5A 3H5VA 4ETMA 1CF9A 4CUZA 4HQNA 2PKWA 3C6KA 1WSDA 4EO7A 3S68A 3BL8A 3GLUA 4OJKA 2ZIWB 1I2AA 3Q9LA 2YVUA 3LJKA 4D79A 2UU9H 4CU2A 2V65A 3Q3CA 3IE2A 3KU1A 2HA5A 2HIGA 3ZVRA 4E1BA 1NHGA 3C7KA 3DAPA 4QWBA 3BREA 4X60A 3WGGA 2JLQA 3LXRA 3DV2A 2BIFA 2C0QA 2XA2A 5NULA 2IZZA 1PNRA 4G25A 3W5VA 5SYAA 1KOJA 1YJCA 5B7GA 2WE8A 3ZCUA 5E7JA 5CX4A 4ATNA 4H1WA 4D9EA 3PLRA 1XRLA 4BEVA 3NQ41 5EKSA 1JZTA 1ZOLA 1N1EA 2COIA 3DWGA 2W6OA 1A72A 2BONA 4RNNA 1WR2A 1C9NA 4AYXA 2MHCA 2R11A 5ALVA 1TU4A 5HM8A 1PTJC 2EIHA 1PKXA 3H2YA 1ECJA 1C50A 1UMCB 4TTTS 1N2OA 2REOA 5E4TA 1RQ7A 5K6TA 2PH5A 5C46F 3SI7A 4D80A 5DTQA 2JA6G 2D2FA 3H4DA 1KARA 1FL9A 1N5DA 2QTAA 3TJMA 4RM3A 4WASA 5H9VA 2E48A 1XRMA 3UANA 2AWNA 1GPJA 2NQ2C 5K3CA 3BJRA 1M1NA 3OA0A 4GC5A 1WMBA 2WVGA 2RK6A 2ZRKA 3RQIA 2KBEA 1AXEA 2PMZE 1DVRA 5AHXA 5CLLA 4BNTA 1XDUA 3U56A 3IT3A 1DIKA 3M3PA 2AC4A 3NMUF 4Z4EA 3JARB 4R16A 3V6JA 2N75A 1T5DX 1FZTA 4L78A 4I55B 3NGMA 4UBLA 1P6XA 1QZXA 5AHKA 2Y1CA 4GC9A 5DTJA 1MFZA 2ZITA 1XN1A 3O8OB 1PZHA 3WNVA 5B3LA 4IR7A 1ZCFA 3IHWA 1K8RA 3VOAA 6Q21A 4E2WA 1EX7A 3D4PA 4J43A 1QV6A 4MWEA 3DEIA 3EUEA 1HKHA 4OGGA 2R8PA 5TQ2A 4ZWNA 3NRCA 1J90A 4MMYB 2XMQA 2NZVG 1TGVA 3SF8A 3L6DA 1UZLA 3EGWA 4O25A 5GP1A 1JECA 3UA4A 1YQXA 4R69A 4EEKA 5BY2A 2PR2A 3VH3A 1UJ2A 2GD1O 1MX3A 4ZDJA 4RFSB 4ZKDA 5K8TA 2GRJA 3G0DA 2YVLA 3GAMA 4LJ7A 4R1OA 4J0FA 5KG3A 3R7DA 2W5UA 2H5LA 4AS1A 1HT0A 3PUWA 2I1WA 1W5SA 4B35A 4YMSA 4LHZA 1QPGA 2NVUA 1PVVA 1QO0A 1UKCA 5JXWA 1ISSA 5I7FA 3EPPA 1RRGA 3KDSE 4EKYA 1M34A 4CG1A 2AR7A 3DM9B 4IJ6A 2YYSA 4JLOA 5JAUA 4HVCA 4Y2XA 1UT8A 3RAJA 2RKBA 4XX0B 1ZGAA 3RC9A 5LBUA 1ILEA 4Y1GA 3JD4A 1THMA 4LNUB 5IUNC 3AMVA 2YU9A 2R1ZA 5E3IA 4JI1H 1LJUA 3AEQB 3NWBA 1T3GA 2OENG 4QECA 5ALSA 3DZDA 4U3JA 2VJNA 1C7JA 1FFBA 1KK2A 4D98A 3CLSC 5DQGA 3P97A 2J48A 4YBZB 2JAHA 3E7PA 2WM2A 4PZ0A 1ET0A 5IT5A 2M6SA 1YXMA 3V4RA 3D3QA 4D41A 4KAXA 5GZ6A 4Y6RA 2BFDA 2COKA 5K4GA 3QUTA 5I9MA 2OXTA 5FIUA 4IOMA 2CBGA 3VU9A 3QG5A 4AS2A 2VHUA 4BNWA 3HBAA 3HCDA 4XLTA 4EEZA 4CCYA 1PR6A 1CRQA 2O19A 1YS6A 1Q0RA 4IM7A 1TJPB 1SD2A 3AESA 3WVNA 3FNHA 5B1SA 3VDNB 5KS8A 4FUTA 1JSCA 4GM4A 5KFFA 3VR5D 3F8NA 1NXWA 4CDGA 4OM7A 1EP2B 1BU5A 4HPJB 1U2GC 3UJ8A 1NNEA 4KFCA 3S44A 2BZ0A 4FE3A 3WNBA 4NSNA 4RWEA 5JY6A 1E58A 3NTQA 2GCEA 1JAZA 3KU4A 3OJCA 1ZW1A 3UHAA 4KEAA 1FC0A 5E6SB 3IT0A 4RJJA 5BN5B 1DRVA 5DK6A 1C3VA 3AILA 1V7ZA 2PZMA 4GYJA 1XAIA 1CQJA 5HBRB 4DLYA 5JPIA 1ICIA 4R0VA 2Y0PA 1GV0A 4UCWA 1S7GA 1Z8DA 3ES9A 2CHQA 3VNNA 3NOVA 2BR0A 3B6JA 4KW7A 4EF6A 4DLWA 2R1UA 2NMVA 2JPDA 2JIOA 2ZUDA 2VTEA 3AONB 2J0UA 3ZW9A 2GPJA 4KXNA 4JUBA 4CEJB 5KFRA 1XTPA 5TRTA 1YQTA 1KJJA 5C32A 2C97A 1WKCA 4HWSA 4OQNA 1MHPA 4MWGA 5EQDA 4L2IA 2RHHA 2HLPA 4RZSA 1T4MA 4XX1A 2O7NA 3KWFA 3CINA 4QYIA 4OUDB 4BP1A 4L75A 4YMVA 3VMMA 4EFEA 3DL7A 5T41A 2I5PO 1LXCA 4YS6A 5KFAA 3T5DA 4A8JB 5KTKA 1RKQA 2OO5A 5F5LA 2B8JA 4JC0A 4HNUA 1LPAB 4GVXA 1KNQA 2NT4A 3DVSX 1XU7A 2HHFA 4DR6H 2ZM5A 1XMVA 2QRZA 3UGJA 3ECCA 1Z6XA 4NVRA 2VTVA 3GIMA 1NM5C 3NHZA 3WQQA 4MWOA 3O90A 4D2IA 3RYCB 5IMBA 5LB2A 3VNVA 3OPXA 1AO0A 1NULA 3MAGA 5KTSA 1AQ6A 3FW1A 4EIWA 3NIBA 1DC7A 1PJ3A 2AJCA 3ZY6A 1E6CA 5KT2A 2UVDA 3WYGA 2Z8YA 3JZDA 5BOSA 3MUNA 2VCHA 4WLNA 5B3AA 4NBSA 2R7ZG 1QTIA 3LUKA 4PPNA 3AR2A 2B20A 5EKXA 4G0XA 4BQRA 1NTOA 5K7SA 5DM1A 1FNMA 4Q3CA 3G0BA 4DWWA 2BMDA 3U6KA 3WKDA 3IERA 4MXDA 1PQUA 1G21A 4LQDA 4HGOA 4WQMA 5IP7G 3AY6A 2BCGY 4MW6A 3SLKA 1IWBB 1JB9A 2FSSA 5KOIA 4URVR 5KB3A 5BN3B 2D06A 4EHDA 4MEJA 2YS7A 3RS4A 3TLGB 3HKEB 5KT4A 3SDBA 2COUA 3FYSA 4YUXA 4TZ0A 5AM4A 1N3BA 3OVMA 3PGMA 4ON9A 3KZNA 4DAAA 4IDCA 5GADl 3O1IC 2PG3A 4FOSA 3VR2D 3PEWA 2LKDA 3M1AA 4OOEA 3S6JA 1Y1LA 4EKGA 4PS1A 1TTTA 1X14A 4OLFA 5IPFA 3T7SA 2HD4A 4Q12A 4AMVA 1M1YB 2CEKA 3GHYA 2QI9C 4RLQA 3P7MA 4UUQA 3WLKX 4BL5A 1KJQA 4P92A 4XYBA 4YCMA 2QL5A 1NLUA 2VDNB 2AVNA 1BMQA 2VKTA 1GITA 4CTNA 2C7VA 1NV9A 4RVHA 1DC3A 1VI6A 1XVUA 2FG7C 3EFHA 4PWYA 5CK4A 5FPYA 1SKAA 3WL3A 2R47A 2P65A 4H1VA 5P8WA 2OCIA 2ZLBA 1G19A 2VAXA 4KR3A 3TW6A 1WQ1R 3P26A 3N0TA 3REGA 4RV9A 4BBSG 1NF8A 1NF3A 1HTWA 4XWWA 2GPWA 2GO1A 3TTUA 1HFWA 3SKXA 2DPHA 4BB5A 2VTBB 5DE3A 4YUZA 2NUTA 2WK1A 5DX1A 1Y1SA 4C7BA 4QELA 2JI7A 4PGAA 3CR8A 5FO0A 3GUUA 3WGKA 1H2BA 1G8AA 4NV0A 5BVGA 5AJYA 3QXJA 1WS6A 3Q8PB 3WMEA 4CV0A 2DCMA 3A25A 4FMDB 3DLHA 3MRVA 4B83A 3ZGNA 1G2WA 3M1YA 4JLNA 1U3DA 1YOBA 1IATA 2B2XA 1MJGM 3SQDA 1PO7A 3D81A 4P7GA 3NT5A 5IZ4A 1LSSA 3EQ7A 4F4UA 2BKAA 3FY4A 1SVUA 2E6KA 1P73A 3TPCA 2H06A 3WLNA 1KFJB 2F17A 3E4DA 2VA8A 1GYRA 1IN6A 1LX6A 4I3HA 3D3JA 1G8KA 5A7FA 3WADA 3CE9A 1SQGA 1W30A 3NDJA 3AIIA 4YIKA 5JPCA 5HVNA 1Y9DA 3A1DA 5B6JA 2QW8A 2RGXA 5JI2E 4EKDA 2PT9A 4O84A 4B7ZA 2HG8A 1S10A 1QDLB 4ZJUA 3VTZA 1ZJYA 1Q0UA 4EAQA 3ESYA 2QN9A 3LT2A 4ZMBA 1S68A 5K0CA 4RVOA 5EUBA 1GKLA 1UJBA 5HF6A 3ML1A 2LRHA 3TEKA 4DV7B 2I29A 4WZAB 4PNEA 1US8B 2GPYA 3KXIA 4IS3A 3IN5A 1W75A 4CMAA 2BEVB 4HWOA 2GILA 4NBWA 1F7UA 4IJQA 1NBAA 4IQ8A 5CU7A 3UHJA 3ND7A 1W2HA 5A9SB 2CV2A 1CYEA 4I7HA 2VJPA 5IS2A 3PSHA 2DB3A 5AFSA 1U1CA 4YJKA 1IZ0A 2PX6A 5HGXA 2ZI7A 5FPQA 3MMXA 2JFYA 4BQOA 1R4NB 4EL5A 4DLPA 3EK2A 5DP2A 2FQQA 1UMCA 4LVUA 2IXFA 3CVJA 5DHAA 1WUYA 4JJ6A 1VRCA 3KE8A 2HGZA 2IYUA 5FLXW 3LPDA 2PXAA 5F7XA 4P34A 3VA7A 3B9RA 4FJ0A 5EHZA 4OFWA 3UT6A 2QD4A 2B4RO 2FZEA 4CHIA 1K6XA 1O5IA 4F3TA 1GM5A 2N1MA 1UFOA 4DR7B 2VAVA 4UAGA 1E3SA 4HTAA 1DIRA 3TDMA 4UE6A 4DV1B 3GVCA 3EEQA 1JH9A 4JDPA 3C97A 5SZHB 3TTWA 1YVUA 1JQBA 3O3OB 4ZC8A 3ETCA 2HIMA 2XHEA 3JQBC 3T4EA 4DUZH 2W58A 1BYIA 1RAHA 4I55A 5DSXA 1RBMA 1JN0A 1O95D 5L40A 4ARZA 4NDAA 3Q7QA 1VLQA 2Z4TA 2F48A 2RHTA 3BGDA 3VYVA 3KQTA 3WNQA 4JYPA 4L8LA 1Y1QA 2W2LD 3BGSA 1OREA 3SNOA 4JODA 1G9XA 4EG3A 1JNXX 4A3LG 2MTBA 3AM5A 1JDVA 3O84A 2O8BA 2YXDA 3S24A 4ZAFA 1KPGA 1LC0A 1R5JA 4HQLA 4J75A 5EZQA 1NXXA 1OB5A 1XA3A 3QGMA 3PUIA 2HFJA 2XYVA 4EFDA 4N47A 4M8NE 1T0BA 5TMDA 1RYHA 3N7TA 2NV6A 1D6MA 3LHFA 4JP1A 5HQJA 4S1PA 3QX8A 1DT3A 4G01B 3QVUA 1HDIA 3J81A 4L73A 4RY0A 2D4AA 1KY4A 2XDQA 3GVHA 3NBQA 3FNFA 4QUEA 2JFGA 2E21A 4DV3B 1MX9A 2ZSUA 4MW5A 4QBKA 5FD5A 4JEMA 1YRQA 3GZJA 3I01M 3CF0A 1K3FA 1CY6A 5LQDA 4ITUA 3DC7A 5TPWB 1DKUA 1SAYA 3BQNB 2FFHA 2R60A 5KSZA 4DLRA 1KI3A 4B3CA 2QX4A 4BVFA 5HOEA 4BVAA 2IEBA 3A1CA 3CGGA 2PUAA 1U2GA 5PGMA 3ANXA 5ADWA 1NN1A 3AOGA 1CKNA 2FQXA 4PCAA 4UCTA 3K6RA 3I4FA 1VP9A 1ZLXA 2C0PA 4HP8A 4BY7G 5HMLA 4YPFA 4YBZA 3H0EA 2ZCUA 1YIAA 1JKJB 3OWHA 5AVVA 1BVYF 2AG8A 4NYJQ 1UAGA 2C4NA 1GL6A 3B3JA 4CM9A 3MM4A 1VDZA 1MJ5A 4KUGA 1ULTA 3MTIA 1SC9A 4PO8A 4ED2A 4ZODA 1NUHA 3HSYA 2HYIC 3WLFA 2DFDA 4KFTA 4NNOA 4UUMA 1TF5A 4WMLA 4JB3A 4L0MA 4EPRA 3DZHA 4YEDA 5DXJA 3RRYA 1OAOC 1Q74A 3Q7IA 1DKPA 2IYYA 3RS9A 3IP8A 1L5VA 5KNCA 1UBOS 1N1DA 3HYNA 5DIFA 1XP5A 3G8YA 4DHEA 4BWSC 1MQSA 3MR6A 3ESBA 5EZ5A 4DLKA 1SC4A 3C3JA 2Z5VA 4UHCA 3LT0A 4UTRA 2Z9BA 4ZQCB 3S5JA 5HKLA 3V00A 1KEWA 2M6LA 5AI6A 3EXAA 1JW9B 4ALIA 4ZA2A 4INJA 2OFXA 4R1NA 1A3GA 3HOXG 5HQ3B 5CH3A 3T1YB 1EFVA 4MRMA 5BN5A 2Q5QA 5BURA 4ER7A 1QIJA 4R8MA 5DMHA 4AYWA 2JFUA 1XTZA 3B53X 3T5CA 5HBRA 3NBKA 3NNNA 4EYQA 1WSWA 1NM5A 1JFFB 4G1VA 4HFRA 3N6XA 3MJTA 3T4XA 5DPMA 2PK3A 1BO6A 2YV3A 1OFHA 1OVMA 3V1UA 5TF4A 4EMUA 4QBHA 1U7UA 1MVLA 1CUAA 3I34X 3BXOA 4CEJA 2BT4A 3HJCA 3VAYA 2ZTUA 2XQJA 3IEMA 3WXMA 5BSUA 3MERA 3AJDA 1KTVA 1TT5B 3W04A 4BLWA 4N3AA 1IDOA 1X7GA 5K3AA 4DYVA 3TRIA 1H2EA 1RBQA 3LVRE 1VA5A 2XCAA 4XVHA 3ECSA 2QUBA 2VYVD 4HAUA 1IJFA 3PC4A 2CXSA 1LSOA 3QZUA 3NM4A 3MFQA 1R9TA 1LSUA 4IH4A 3WMRA 3I12A 1QDEA 5I7SA 4P7KA 4IJMA 4MVJF 3GLIE 3QYJA 5EEHA 2XMPA 2YXNA 2P8JA 4MV0A 3OCXA 3OZEA 4OQ4A 1QH8B 2X19A 4AJEA 4F7WA 3JZ6A 3QKUA 2ESRA 3ENKA 4QE3A 1A9XB 5HKBA 3IHLA 4LFAH 2ZRDA 1NE7A 2H4YA 2J85A 2EW1A 4XQ0A 2FSPA 3SSAA 5C4IA 1FUYB 5FWYA 2A84A 1ND5A 1C0EA 2W6NA 1A95A 3KT6A 4PR3A 3TM5A 1WOYA 3BFJA 2V1XA 5BNIA 3COYA 2JRCA 2XE7A 1NI5A 2Q45A 2G9RA 4TMTA 2CFOA 3BMQA 4BMCA 4N7BA 2G5PA 3F74A 4ZT7A 3PQ3A 4QDZA 3AC0A 1XA0A 1ML4A 1WX1A 5FV4A 1ABEA 3IKTA 4EHBA 1QMGA 2HJVA 4PNHA 3JWPA 1I32A 1AD2A 4WCVA 5LNK1 3OIDA 3I5MA 2FE4A 1ZR2A 3LLSA 2WBLC 4AKHA 3WA7A 3A8TA 1C4XA 3OH8A 4RTNA 2GO7A 3QRWA 4Y67A 3RVMA 3ANLA 4AIIA 2I76A 1PCXA 1D8AA 3PGXA 5DGIA 1QO7A 4TVKA 1X38A 2JLAA 4AG6A 2A0UA 1Y3AA 3N6VA 4G5QA 3DT8A 5FULA 4PQFA 4OI1A 2H1RA 4F3RA 1I6MA 3UHPA 1G5QA 2VN8A 2DU8A 4JK3A 2D5IA 1J99A 4Z2AA 5COBA 3ND8A 4U0KA 1THTA 3CZCA 1BJTA 2X3YA 1M1YA 5DIZA 2PV0A 2X1MA 2CK3D 2UZ3A 5JSHA 3PXDA 4JXUA 4I4IA 5H3CA 4CM1A 4N54A 3QUBA 1I5EA 3KD3A 4IIHA 4BFVA 3VOBA 4EGQA 4CLOA 5GONF 2QTHA 1Y3BE 2ZT5A 1PL0A 3I9LA 3LVFO 2FN4A 3KVYA 1KIMA 4IX9A 3KG2A 2W6ZA 3G49A 3HWSA 4ZVVA 1HE8B 2X13A 2ZIEA 4NONA 2OCAA 1XMIA 4LE0A 4C0JA 1YF3A 2HU5A 1CFZA 3MQ4A 5ER6A 3COPA 3ZIAA 5JR3A 3SVTA 3U7HB 3O93A 2F9LA 1RPNA 3FPAA 3UWPA 1JDNA 4DLXA 1U0SY 4AY4A 3UAWA 4B44A 3QPUA 4NYMQ 4BFLA 1XNQH 1KMCA 4TWIA 1FX1A 1DJOA 3L8CA 2C29D 3AHCA 2RHMA 1ISHA 5JYCA 3MWMA 4F2WA 3OTGA 1L7MA 4F3CA 1IHXA 1Q0LA 3B1XA 3UG6A 4ND7A 2OAGA 1OIVA 2PEZA 2PT7A 2B4KA 4J7CA 4U63A 2ATIA 4I6EA 3HA3A 3FHLA 3EIEA 3C8HA 1OU4A 3PW4A 1BFDA 3R8XA 1T5BA 4CKCA 1YB6A 1U1FA 1R2QA 4J4HA 1UWVA 1IM2A 3E23A 1QYVA 4PVCA 1ZA1A 5DLYA 5L53A 2GYYA 1ZISA 1KEVA 4PG8A 3G6YA 3L4JA 3DO5A 4JYBA 2VNJA 1YIOA 4FT2A 1MA3A 1N0HA 1EBUA 3AG6A 1YU9A 3IX7A 1OBDA 4WKCA 1J33A 4P3NA 3GLGA 3AV0B 1V7QA 3IEIA 5BMVA 1ZU4A 3M8KA 2OKCA 3MIZA 1GTL1 4ZAWA 2ODAA 3CG0A 2QGFA 4H0FA 2XT9A 3JQFC 4QDXA 1YFJA 1IAVA 2YBEA 2GI4A 4D8YA 4L57A 1H2RS 5T6MA 3SS8A 1M54A 3JQBA 5KX5A 1M1NB 3D8SA 3PC7A 1Y6JA 5A9SA 3GX1A 3PZRA 2C95A 2V54A 4ZVUA 1DPGA 1O8CA 2NU6B 4OX9B 4F72A 4I5FA 1T8TA 1Q0TA 1R4NA 4G6ZA 3GAZA 3OM9A 1H0KA 4F8EA 1A1SA 1TK3A 2HBRA 1YULA 4JJ7A 3CNEA 5EIWA 3T7EA 2WPNA 3FDZB 4TL8A 4QODA 1U7DA 2BSXA 4JLKA 3EBPA 5CJJA 1U8CB 1GWNA 4QJIA 1P74A 2ACKA 1XEWX 3RSFA 3VH2A 3FCYA 3ZJ5A 7YASA 1F6WA 3E8XA 2VUTA 3MQFA 4B82A 1N3IA 2GQRA 2ZAMA 2O2XA 5IG2A 3HDJA 3SC2B 5TQ2B 1H2HA 4KLZA 4G84A 2AXQA 1W25A 4ABTA 1N5OX 4A91A 3SF8B 2DHCA 2VZ9A 5IF9A 1E9CA 2AOXA 2P75A 1C8LA 1HSZA 2NOAA 3R5TA 4V03A 3LUFA 5JAMA 3AKYA 3RUEA 4E5SA 1PWYE 4UBMA 2IYFA 4HFMA 5B58T 1EFHA 1QSGA 4PZLA 1V51A 3K15A 2PS1A 1EZ1A 2NVUB 5LD2C 3PUJA 4HAWA 1WRBA 4QATA 2VTDA 2Q3EA 1YC5A 4TYNA 4Y2JA 4EVQA 2XKJE 5F4BA 1CWUA 3BIOA 3U13A 3B70A 3OQNA 4CM8A 4RVCA 3OCVA 1UC5B 3QV1A 1HDZA 3VR4H 1EZ4A 1N1GA 1IXKA 4B85A 1ZH4A 3QYFA 4EYSA 2WIKA 1HORA 2IBKA 2BLLA 4E7OA 4O7LA 5CDSA 3N40P 4C22A 4MNTA 1RYEA 4J3FA 4MEAA 3VYRB 5L3ZA 1D1PA 3HJFA 4TQRA 4GX2A 3QI7A 8AT1A 2R66A 1S9FA 3GWGA 2PGNA 2BTQA 5B5SA 1AXRA 1OAOA 1I6LA 4EGJA 5CDYA 5A4FS 2P9HA 5I5TA 2O5EA 1TFUA 3TO5A 1PNVA 1ZHFA 2V7QA 3ZUPA 2BFDB 5FBQB 4D3FA 3QFTA 5KNDH 2EX0A 3VU9B 4DL2A 1VMKA 5BWTA 3P2KA 4IINA 3V1YA 3TFOA 1Y89A 5DX8A 3BM5A 3SPXA 4DR1H 2WE7A 3S55A 2BR3A 3I52A 2QMYA 4XQ9A 4IIFA 1TM5E 3WIEA 5JDIC 1ZUIA 4KPUB 3AESB 2ZE8A 3A9VA 1E2JA 1N8KA 4OSEA 4DM3A 3FCCA 2Z83A 2IF2A 3OZVA 3GU3A 4DILA 3OOSA 4FB4A 2IPNA 5IDWA 2IYOA 5J5AA 1GVHA 3S2IA 3WJAA 1AZWA 4EPXA 4GPD1 1M73E 2N1BA 4MR8B 3AVQA 1W36B 4W5QA 1P44A 3HO8A 3X0DA 1Y8ZA 1EK1A 2H4HA 3EXG1 3CKKA 3BGWA 1CQJB 1M8FA 5HNKA 3PW5A 4F21A 5FQNA 1RZUA 2DRIA 4C20A 2Y9MB 4NBNA 4Q9IA 3W2TA 4YC7A 1M2WA 3D6AA 1YWGO 3ITEA 5IBCA 1SQ5A 2CV1A 5KTYA 1ZA2A 2UXDH 1B8NA 2P6PA 2RHBA 3A4YA 3DFMA 4PZDA 4MTLA 4NU6A 1O97C 5IFKA 3KSUA 4FPXA 3Q12A 2LP4Y 4WH0A 2BWJA 4KO3S 1TZCA 4QARA 2XUZA 3G2PA 4TTQA 4UD6A 1DFIA 4L2IB 3F7TA 3EZXA 1MT3A 1QOZA 3WMXA 5BNFA 4Y2HA 5HQ3A 1Z45A 1GG8A 3FZEA 3E9QA 4K9PA 5CLFA 3ELWA 5AVXA 2BCEA 4B6FA 2J45A 3MXOA 2QRNA 2VRBA 4RNOA 1B04A 2D2EA 3WE7A 1COWA 2WKQA 2HQOA 2P1ZA 5C51B 1X70A 2OBNA 1N6IA 2J33A 1JFFA 4FN5A 1XZFA 1C7QA 4ZCMA 4N5NA 4WLFA 4OATA 4PM4A 4U4AA 1YDWA 1Q7RA 3S81A 2ZUBA 5JXJA 1ESNA 1TYAE 4Y6SA 4MYRA 3A6GA 5B6IA 1ZFNA 2OORC 3J80W 3P0EA 1X1BA 1WEKA 4E88A 3L79A 5JNLA 2ZTVA 2WUWE 1QFXA 3IPLA 3FN4A 1LW6E 4JCOA 2DTXA 1UQTA 5KYWA 1GRCA 1AQIA 1WB6A 2XNDA 1R66A 4KAJA 5DNAA 2WJIA 3EVDA 4ZAZA 3I4CA 4EI2A 1XR3A 3FUCA 3O4GA 4JI6H 4XJXA 4UNQA 2H11A 1W7AA 1D5WA 2G70A 3ZOZA 1NURA 1GCUA 5JNRA 1F2TA 3FHOA 3MCZA 1EDEA 1OD6A 1CJUC 1K98A 3CPHA 2YZKA 1CFJA 1TAHA 1OLUA 1ZVJA 2OCYC 5I8PA 4ER0A 1WH2A 2D1QA 2IHTA 4H6PA 3RK1A 3IMCA 3M6UA 4CQNA 1G21B 3KEFA 4M9CA 1OSNA 3CVYA 4HFJA 3IPRA 2X6TA 1FCJA 2A3RA 2RHWA 2E0IA 4HK4A 5F5XA 5JZMA 4ZHQB 3RYIB 4PXAA 4LF7H 4D8XA 4JLJA 4WGGA 1SHTX 1BD4A 4QUIA 5LP1A 3U39A 4BNHA 3D8UA 4BHTA 4NXNB 1N32B 1TJNA 3LE8A 2PXCA 5TVGA 4XEUA 1GT6A 5LXTF 1OA0A 2ROQA 3PDCA 4FGUA 5KCMA 1HNNA 3AUUA 1ZD1A 1DG9A 3A32A 4F06A 4GI3A 4MMZB 3U81A 3SR3A 1XI2A 2NVOA 4BO0A 5FI1B 4J0IA 3IALA 4I08A 2C00A 2P5SA 1M67A 3ZWPA 2WKPA 4BCCA 2CXTA 3H3FA 1QP4A 4TYPA 4C7MA 2MSNA 2HRRA 5AXAA 4RM2A 5E3HA 3IQDB 2CV0A 3GJZA 2VF7A 3AOEC 3L0CA 4L27A 4HEA6 3SCZA 1A97A 2BM9A 2PVSA 2FF5A 3FCOA 2RSLA 5HZHA 1G7SA 3UJBA 2PFSA 3FVTA 6LDHA 1XELA 2BMVA 4KMOA 4NDZA 2G9QA 1L4EA 2EJ2A 3MT8A 4KTTE 2PUHA 3DAOA 3KKPA 1P77A 2BMJA 2QYZA 1CS4C 3G9XA 1PDWA 5CYFA 3V4FA 4PFJA 1Y14B 1SHKA 2NTVA 2Q28A 4B79A 3ZHVA 3CW2A 2ZYAA 4P86A 3C3MA 4MCAA 2P9FA 2YKGA 3NTXA 1VKOA 4ZCSA 4ZC1A 4DCPA 2FGKA 2VAPA 4MUFA 4K6CA 3D8HA 3KOWA 3CTMA 3EXFA 3RT9A 2H48A 2QPOA 4AG3A 5L3QB 1IEXA 3BICA 5JDCC 1PJ4A 3L93A 4A3KG 5T4FA 5BVGB 3L0BA 2W6JA 2X86A 2XMBA 1BDMA 3IMFA 2YQ5A 1JHXA 1TB4A 4A2PA 3CUKA 4NZZA 3S29A 1SQFA 2CYAA 2WEKA 4FFVA 1M33A 3AP1A 1Q2UA 4PLYA 1UDXA 3OT1A 4E5MA 1W6UA 1Z4OA 4O3OA 2OV1A 1A4IA 5JJLA 4TQSA 3GLRA 4B3SH 1WR8A 1ZCJA 3VR6A 2VK2A 2UAGA 3QZ7A 4A93G 1YZ3A 1PAUA 3WYNA 1OPXA 3KAPA 3A1FA 1RLIA 1QMPA 2HLHA 2P68A 4KQXA 5TPZD 1RWWA 1WULS 2RBEA 3DMPA 4QUAA 3JQFA 2OXEA 2PRSA 4JLDA 2GEUA 3K16A 4M0JA 4XWTA 2YJNA 1U0EA 1AKNA 1WHTB 1FNDA 5ALPA 5KFHA 1P2UA 3ZY3A 5KUTA 2CB9A 4G5XA 5HDQA 1EBBA 1I3NA 3E2PA 4DVGA 2N46A 2VF4X 3FSGA 5CW2A 2BFCA 2RAPA 4IDQA 5FBRB 2QY9A 1K6JA 2IXTA 3HGQA 3H2HA 4FNMA 3PNMA 3OAAD 4NAUA 2H85A 3FVRA 1BXRA 1B8VA 4KVFA 2AA3A 1UPBA 1ZNZA 2JLBA 4MIKA 4MR7A 5K8UA 2GHIA 4I1IA 1JG1A 3H9EO 4M0DA 1LNSA 1C29B 3P9SA 1QG2A 5JJIA 5E2AA 5CFRA 4CMCA 2HF9A 3F3YA 1VHWA 3SJUA 1YE3A 3H84A 3H20A 4K9OA 4UBOA 3QVGA 1CD5A 2O2ZA 4HAZA 4NNJA 1Z8NA 4F4WA 1TKBA 5JHHB 2O59A 2QXTA 4PC3A 1SC1A 2FCRA 2AS0A 1CK4A 3NC1C 3ZDZB 2F1HA 3ESZA 4W9RA 5EGNA 5CG2A 3V2UA 1RFLA 1A8QA 5A2GA 5K09A 3BL5A 3LWZA 2ZYRA 1BKDR 3AGQA 4JBWA 4Q44A 1ZD4A 1F9EA 3IR6A 3QFHA 5D7NA 3O95A 1AZSC 3IOEA 2DXIA 2WF8A 3VU0A 2NU6A 2JDID 3RRZA 4EVRA 4TXHA 4FEGA 4EZIA 1QE5A 2G06A 4EO4A 3W3AD 4C01A 1YVRA 2G0NA 5HKKA 4BUZA 3PWKA 4KQEA 1AKVA 3LDFA 1PV2A 1O58A 3AIMA 2W57A 4ARZB 3FDZA 3Q3IA 5BR1A 3EEOA 5HCIA 5K9ZA 1HNWB 3UQ8A 4O4JB 3SVLA 3ROMA 4LS3A 2O7RA 1L7QA 4BKOA 1QIIA 2CMKA 3TKYA 2HJ9A 2I4RA 1Y1RA 1GL3A 1DADA 2Q1UA 1YMVA 2GN1A 1TKCA 3E5RA 2ZYTX 4Q9NA 4YV1A 5DI3A 3NALA 3SC2A 2O8BB 4RD2A 2Z8XA 4P3YA 4E11A 3QEOA 3THXB 1HUQA 5IABA 3PFFA 5E9AA 3T3IA 2EX1A 1ESDA 2V4RA 4AC9A 3OJXA 2FYTA 4TL9A 1S1CA 4G0QA 1E7RA 3BA8A 1K4YA 2P7IA 4DLLA 4A9AA 4X84A 2JIZA 3VVCA 5HK9A 1T6ZA 2NV2B 3ZIDA 1K7YA 1IBLB 4X1KB 3ZY4A 2DQKA 3AL0C 2XDQB 1G20B 1P4JA 1RHJA 2C77A 2YRXA 4Z7QB 4RK0A 3VX4A 4B3XA 1QQAA 4A2AA 2I2FA 1QM5A 1E6WA 5K0LA 3RC2A 5JDIA 2UUAH 1OB2A 2J3JA 4GYWA 3JWHA 1J42A 4Y8VA 3VR3D 4BNVA 1RHRA 3KVVA 4X66B 3C15C 3ACBA 3F97A 3PQEA 4RGVA 4DVJA 3R40A 2J08A 2H4FA 3FFBA 3HEMA 2FEAA 4OMCA 3HCOA 4WUVA 3GJ3A 2I87A 3W34A 1NIJA 4URYR 2GKOA 4IR1A 2QUAA 1CKNB 2O2EA 1ZX1A 3KYCB 5HE8A 3T5KA 1V9LA 4O5OA 4ETSA 1XNJA 1M1ZA 2FW6A 4RKYA 4S1WA 2RHJA 3KHUA 1A7UA 2XSZD 2RH8A 3VC3A 1ZM9A 3L49A 1UPUA 2R7MA 2G5CA 2C35B 5KWJA 3R3XA 4FNAA 1P75A 1VZ2A 3CB4A 3TW8B 4CM7A 3HYTA 5CJ2A 3SEAA 1DIHA 4YLGA 1SFOA 4MUIA 1P2SA 2AMYA 4RKWA 4QQKA 1ID8A 3G82C 4V0ME 3K2IA 3EIXA 3PQ8A 4E12A 5CT8A 1BA3A 4KPUA 5ILGA 4EBBA 4EHIA 4K9DA 3VSAA 3I9V1 2YY5A 1P7VA 1VBMA 2JLCA 4GOKA 5KFEA 3HOWG 4LXTA 1JBEA 3O47A 4RPKA 4V2IA 1YFZA 3I9MA 1O0BA 3O4JA 2P6OA 1WTCA 3SJAA 4TYWA 1L4KA 1WU8A 1XTJA 1E77A 3NDRA 2WSIA 3QFRA 3PW2A 2BM1A 1X2EA 4HUTA 3RB4A 1U2SA 4GC6A 3M3HA 4L3WA 1EFVB 4MR8A 4MRMB 3RKSA 4DLAA 4MRSA 3T1NA 4G0OA 3KKMA 3FLAA 5CIYA 1ZYUA 2YZ2A 4LRUA 3W4KA 2OORA 1C5KA 1R64A 1E8DA 4RJIA 2RMKA 3JQQA 3VVMA 2IOHA 5ES4B 1JIVA 3GEGA 3CLRC 3QOWA 4EECA 5AJWA 2DPIA 4PG6A 2JA2A 3C7TA 4XDHA 1GPUA 4PYOA 3KKKA 4KIWA 1CEQA 2CMGA 2YYYA 3WK9A 3EMVA 5FA8A 3EVAA 3VNAA 1KO7A 2H2DA 2FDXA 4BJ1A 2HRCA 1P33A 1O08A 1DS6A 3ORYA 1ZZGA 1CY2A 1EINA 1REQA 4S05A 4CMJA 3TQFA 1RJDA 1V4VA 1AJEA 5BXQC 3BEOA 2Q3BA 3QWHA 1MRSA 3OFKA 1FLAA 3C3EA 4FYMA 5D2CA 4IXMA 4G07A 3VMFA 4BQPA 3RKRA 3WGMA 1JTVA 4FVTA 3GEDA 2NVWA 1QYIA 2Q5CA 2P6UA 1UC8A 4V0SA 3U5ZB 1DUVG 4DJDC 2CT8A 3HNOA 4KWIA 3HLYA 2ZREA 1WCYA 3E9MA 5C80A 2A5FA 4BS9A 4IDOA 4E07A 3ZCSA 2HAEA 2R4QA 2EHJA 5E7MA 3EW7A 1JE1A 2QL7A 3G2HA 4DWVA 4KLCA 2A14A 1G3QA 4NWIA 3L43A 5F51A 2AZXA 1SKQA 5KJ1A 1AUXA 1S3IA 3FNQA 1I2MA 3QVLA 2H07A 4C4SA 4YRRA 5C5IA 2BGIA 5FWYB 5BUQA 1NOIA 2DWQA 4UEKA 1RLTA 3U3RA 4KMMA 1R8XA 1I0LA 5LOVB 4CDRA 1UXIA 4JOCA 4E30A 1A3CA 3BMQB 5FL3A 5BWRA 1JXOA 4F4DA 3CLTD 3E05A 1E9SA 3D2AA 3CX8A 2OCKA 4NJMA 2IC5A 3HWWA 5KG7A 5F77A 2PUDA 3LA8A 1FBTA 5KQRA 3OO1A 4P93A 2PZFA 1QIMA 4C3ZA 3DD5A 2ZAYA 3GPIA 2AX3A 3K0FA 4Q6BA 4DBZA 4LSXA 3EVZA 4MUKA 3OSUA 3A1SA 3AOEA 4DMLA 1BWPA 1DBRA 3U49A 4PWQA 1CUUA 3NYIA 1Z4QA 4ZI7F 5TQJA 2E4VA 3ACDA 4ZHQA 3NVMB 3LK7A 5JVDB 3RYIA 1XKTA 1T8RA 5A1JA 4R8RA 4JVMA 2H2HA 2QUIA 5H7XA 1EVQA 3VDQA 4ECVA 4KQIA 4JBLA 1EFKA 2HI0A 2P69A 4KQFA 2GVDC 1GG5A 3WHLA 1MW8X 5FBHA 4EVSA 4U2EA 5CEEA 1GAQA 3R20A 1XPOA 3T15A 3BTUA 3FNGA 4KIFA 2OG2A 2AI1A 5GV8A 5DG8A 2E4WA 2YCLA 2MSLA 3ROGA 2WWRA 1Z5PA 5JDCA 1UJ5A 2J6SA 2PBRA 4YAKA 1UMDA 3CSDA 2JGJA 2NYUA 3I3SR 1ZK2A 4LCEA 1PJBA 3GJ5A 3WNCA 3HDQA 1N75A 4CKXA 4DIKA 3I05A 4Q1DA 3OJOA 1IVSA 4BYGA 1A2KC 1EB8A 3NYRA 4AROA 4CLOB 4MYDA 2DTEA 3AUTA 3HADA 1E1YA 4BNXA 5JANA 5EHXA 3RTEA 4GBMA 4Q7QA 1RT9A 2Z6AA 2BGKA 1UAYA 1LVHA 4RKEA 2FZCA 1ANKA 1I7NA 4O81A 1SELA 4Z1MA 2FKAA 1QGDA 3O26A 3ONNA 3EMBA 4P8RA 3CXRA 3AUAA 3OOJA 3NHSA 3BFPA 3L0SA 1Q11A 2ISCA 5BSHA 3E2MA 2WJJA 2GX6A 4ARVA 4FBGA 2WWVD 3TKAA 2O0HA 2X6RA 1QORA 1NDHA 5CH8A 5E1BA 5A6SA 3PPIA 2OBMA 2GMWA 2E55A 3RKUA 4KYUA 2VK1A 1E2FA 5L3QA 2NSYA 3CO0S 4H2DA 1W47A 3FOWA 3IRVA 2VHJA 2D3TA 1Z73A 2W98A 2E82A 4P82A 3VOTA 2FU5C 4P32A 4QXQA 1T5IA 5E8RA 4JOQA 2CB0A 3DVRX 3WIOA 3F47A 1Z47A 5COAA 5K8VA 3V34A 3N9IA 4UCUA 1E2QA 3N5CA 1WXXA 2XOKA 4BEWA 3AVUA 2E37A 2HJRA 4CKCB 3KHRA 5TDHA 4A2QA 3SZ3A 1H8ED 2WTFA 4ZT6A 2HBQA 1D5CA 3FKIA 5SYMA 4R6WA 4XH9B 4NMLA 1JJFA 1P9NA 1F6BA 3UYLA 4RHXA 1NC1A 4ZT3A 1DZIA 4D92A 1CRWG 4A3BG 3MMNA 3EQ2A 2PJUA 3W2HA 3X1MA 1WHTA 2BKLA 5IKOA 3WYCA 1EX9A 3I0NA 5JASA 3GLGB 3LCUA 2G4CA 1BX0A 5BMVB 1I1HA 5AK0A 1N7GA 2XYRA 4JV5H 5ETJA 3GC6A 3HV0A 3AY3A 2ZBUA 1F51E 2QJTA 2IEDA 4AM8A 4ZYVA 3G9TA 3KZVA 5KX5B 1FPQA 4OFZA 3H0KA 1YDHA 5EJ8A 3W8NA 2BR5A 3HG7A 4BC1A 3CX4A 3P0FA 1B74A 2NPOA 5ICSA 2O0JA 5EHIA 1WZCA 3TN7A 4BV2A 1F0PA 2Q1YA 4LRTB 3VJLA 1M2FA 4ETIA 3RH0A 4L0DA 4GXQA 3MN1A 4RUCA 2IHUA 2IUEA 3QI2A 5KG2A 2FJZA 1MRZA 3TMKA 1GV1A 2VF5X 3K5IA 4CT4B 3GCXA 5TE9A 4KXQA 4C5CA 1YZHA 4EFBA 2X4IA 2IK8A 3GCWA 1GNSA 3QKWA 3VSCA 2Q6IA 2ISSD 5EE9A 3HPRA 3PX7A 1DKOA 2O1EA 4YHHH 2OHOA 1T8YA 1USKA 1R0YA 3O8CA 4MP6A 3RODA 3W7VA 3C6QA 2FK1A 2Q07A 4FKBA 3FTEA 2UXDB 4AY6A 1CEXA 5F78A 4A2WA 3PFWO 2Y1EA 5KJ6A 4Y6OA 4U7CA 1JMYA 5IAOA 3FWZA 4J9NA 2A35A 3HXMA 3PNLA 2YUIA 3R7AA 4PO1A 4O4JA 1XD9A 1CUJA 5CB6A 5HJ2A 3ZX4A 1X42A 2CVOA 3LBNA 2XVYA 3N05A 2V3VA 4TTVA 2GAOA 1CR6A 1JR2A 4YPOA 1QF7A 1R15A 1W34A 4K1LA 4CM8B 1AKEA 1RXCA 2QP3A 1W4CA 5HS6A 1TWHA 3THXA 3L6EA 4HXFB 3WLMA 1NIPA 2DIKA 3AHDA 4K2HA 4NU8X 1EWQA 4HR7A 1ORHA 2HMVA 4JITA 4Y2VA 4K2AA 2BPOA 5AKHA 5JALA 4C0HA 3LHKA 3QF4B 1NPDA 3H04A 4LBVA 4F12A 4DV6B 4QTUB 1Z74A 3R9KA 4KQ1A 2NSHA 2C2ZA 2LTAA 4X1KA 1MC1A 1G20A 3B1FA 3HDVA 3DE4X 2BTQB 3WB9A 3WWZA 4A4DA 4YP9A 3FROA 5C1IA 3VGJA 1SC3A 4V0LA 3H05A 1SXHA 2ZVQX 4G56A 2JCBA 1TOAA 1Q84A 2QG9A 1ZGCA 2H1VA 1I4LD 2OD2A 3RVJA 4M46A 3G7SA 4R05A 5HILA 3TFQA 3SZRA 1Z16A 5A04A 4D46A 5AUPB 4LMPA 5FLYA 4PZAA 4CUJA 4XCVA 3FOCA 4ZYZA 4XYLB 5DGTA 1NMYA 3LMLA 3P9PA 1Y1PA 1E1RA 2VHQA 2G83A 4RBNA 1F9AA 3S8YA 4RKQA 2AD1A 5BPHA 7REQA 4QVIA 2DY1A 1PNOA 3KYCA 4LHVA 1E1MA 2C2RA 3L18A 3DTVB 4O1HA 1T5SA 1ZK0A 3D8TA 1V3UA 2UVWA 4OB6A 3WGIA 3PUZA 1F3OA 2AF4C 4DJTA 1POWA 4BCBA 2YOFA 3IAFA 3KHLA 4R1SA 3RYTC 1NJ5A 2Q6LA 5GM2A 3IP9A 2TMYA 3IVAA 3JYNA 3TW8A 3H5NA 1Q16A 3KLOA 4F2GA 1HLFA 4BO1A 4WXHA 3K0HA 3AVYA 3Q7SA 1AKRA 2VDMB 3KUXA 4PRKA 1W1WA 1GQSA 3NV7A 1I4OA 3WX0A 2C4VA 2WSBA 5KG1A 5E1MA 1UBHS 1Q15A 1VLJA 2APJA 2EJWA 4MI1A 4OP2A 1RAEA 4YQWA 5H9WA 3UJPA 5LKRA 3VSEA 3W6UA 5IZCC 3AYZB 5A0FA 4M0PA 5BYJA 4RXTA 3CJRA 2HWKA 1ICEA 4NS4A 3JW8A 1KZYC 1GTSA 2FLPA 5FTNA 3GDOA 4ZYTA 3PL1A 3RTXA 2VTKA 1PU2A 5FTKA 4CU5A 5KWEA 5I8WA 3KQWA 3GPDG 2C58A 5TQVA 2ANCA 2DP4E 3L0IB 4GX0A 1KETA 2Y93A 3L1KA 4C29A 5KFBA 4JR1A 2WKRA 1B15A 3S3TA 4BJ5A 1XTTA 1ZP6A 1VMIA 2JC3A 3F6EX 1E9VA 3DD1A 4MVJH 3AF2A 1C3OA 3WAGA 4QDUA 3QHAA 2X2OA 5EIBC 2H5JA 4L9WA 1HL3A 3LBAA 4URFA 1LU9A 4DJEC 1Q22A 2ZB4A 2YV2A 3BOSA 2OQ2A 3OOYA 2JRLA 5KYWB 1RJGA 1EMDA 2OZKA 1CT9A 2IYSA 2AKEA 1I1OA 3M81A 2EG5A 3NWPA 5FPSA 5CCBA 3C5HA 4GLWA 1R12A 1F2TB 1BDBA 2XCOA 1JHMA 3AFHA 3JZAA 5B7NA 5MFPA 4Z9BA 2CW5A 4LDPA 2PLAA 4BLUA 3E1SA 4BUJA 5G02A 4M1MA 4MWSA 2IOQA 1YMQA 1KBLA 5TS3A 1OLUB 5EXTA 4FR0A 1XCMA 1OROA 4ZO9A 1X7DA 3LKDA 2G88A 3G2JA 2RK4A 1KVQA 1YCDA 2P9TA 2UU9B 1B6SA 2W2KB 4YDRA 1ZUWA 4KDEA 1OFIA 5FBVB 1I2CA 4S0ZA 4UNSA 1INLA 4C0BA 2AOUA 3ZQUA 5LOVA 4MIEA 2P2CA 4IZ6A 2IZ1A 3A1WA 3NHPA 1XHFA 3CNNA 5AQ1A 1OOEA 1Z0JA 3OJFA 3W77A 4YJGB 3T7RA 1RWPA 4GE3A 4J7AA 2CMFA 3H16A 2GB4A 4TMKA 4GKJH 2C5EA 4NPHA 5F5NA 4IHJF 3UYYA 5AOAA 1NPYA 4J16A 4BU0A 3NYQA 2WLSA 3THOA 3HVKA 3LDHA 2OBFA 1GZ3A 4LF4H 3RSGA 3N42B 2EWVA 4UDYX 3M9LA 2XMRA 5CT9A 1Z0ZA 4F4YA 1POXA 3EVBA 4QWDA 1RKXA 2WNHA 4IXTA 5JVDA 3GJ0A 3X2EA 3QEKA 1KAHA 2O03A 4QKQA 4E09A 3T4UA 3M7IA 3K5HA 3KSDO 1T2NA 3I04A 3A70A 4BV9A 1Y63A 4MUYA 4XD7D 1FUUA 2VT3A 4YXWA 2X8WA 3JAMW 1OVGA 1JFSA 4E5YA 1U8AA 1Q77A 1KFKB 3WSWA 4DA6A 3MYYA 2X41A 2A59A 5IJWA 4ENSA 2CVZA 1RKUA 4F45A 4CIAA 5BT8A 3HBMA 1DO2A 2BR4A 4GXNA 1KYXA 5JMTA 1BWQA 1KI2A 4IDEA 2AUTA 3V8MA 1ODLA 4Z4FA 3IDAA 3GNSA 3R0ZA 4MHTA 3MOIA 2KW5A 1AUQA 3L92A 2A9PA 3EXFB 2GZRA 1S6YA 2ZSDA 1N8TA 4LCBA 2EJCA 2WV9A 4IVRA 5HGJA 4TQGA 3RGWS 3QE4A 1C81A 1Y4AE 4IIDA 2JIPA 2XGQA 2EKDA 1NXOA 3RC8A 4JR2A 3K70B 1GO2A 2H92A 2I2XB 2C04A 1ODIA 4BVHA 5IYBG 4JJEA 4A5SA 1XTRA 2HRQA 3L7IA 7MDHA 4R9RA 4EM6A 3OT1B 3CBGA 2VZ0A 2HLDA 2J6HA 1YAJA 2YV5A 1V9CA 1VBHA 5KYYB 2FA9A 5CXQA 1G98A 1OYYA 1ZC4A 3ZNPA 1OJLA 5JWHA 5HFJA 3PPYA 3UICA 5JZSA 4NE2A 3OQ1A 3DMTC 2Y4OA 3HBFA 3HABA 4EL0A 3KHHA 2LNDA 3RR5A 2QQGA 3IJEB 1CY8A 2LBPA 3N6RA 3ELUA 3D2CA 5JATA 1F0NA 3HP7A 4A3SA 2QX8A 3LZ6A 2Q9AA 4OHPA 3ZE6A 3HH8A 1SG9A 2IEZA 2X0FA 2BFCB 4GLJA 3T9BA 3BRSA 4FFNA 1CUCA 1H1LB 1NNUA 1AGYA 1FJGH 4OMUA 1BXRB 1ZOPA 4QHYA 1PJLA 3NVAA 1ADJA 1LC3A 2HDNB 3K70C 4MR7B 4CFZA 4XYGA 3FOAA 3JALB 3Q9NA 3VZSA 3LX4A 3VR4A 1ZPDA 3EGIA 4L28A 3KBBA 4HPWA 2ZJ0A 4KHPH 2ZXUA 3NHBA 4JI1B 1DDIA 3WB1A 1CRLA 1KVTA 2WU8A 4ERNA 4RD3A 4CW7A 1QH9A 5HMMA 2A9KA 2B4TO 3QVGB 4QIWE 3V48A 1I3KA 1YGYA 2HJSA 1U0JA 2FSVC 2OY0A 3ZU6A 1KEUA 3LBHA 1LJLA 2ZI5A 4EHLA 4PS0A 4I50A 1IK4A 1KY5A 3R5JA 2JIDA 2OAEA 1PN3A 4QEKA 2PUEA 4RZ3A 3W0LB 1TAEA 1YZFA 1S1MA 3KJQA 5KNDA 1YS7A 4KBYA 1KKLA 3WYEA 2PUFA 2DHDA 1B8OA 3GGPA 4RAQA 1G8SA 4RK7A 4BBAA 1D04A 1FP2A 2A4KA 5KVQA 3W8DA 1E2UA 3GDGA 3L1IA 3SE7A 1V7PC 4OAQA 2ZIAA 3EF1A 4Q4HA 1UMBA 2PGAA 5C5EA 2YXLA 4G0YA 4BE9A 1RZRA 4LUCA 3ITNA 4G4SO 3TIVA 4G0PA 1RYDA 4EUSA 5LD2B 3RBXA 2EFHB 5BWCA 1XZ8A 4EELA 4XVRA 4Q7KA 2TMKA 2M6KA 3RFVA 5ICFA 1E8NA 4LV6A 2AOTA 1UBSB 1RCFA 3QEMB 4WKBA 2KE5A 2G1PA 2XRYA 5E95A 1RU3A 2CJXA 3AFMA 3KR0A 1ZEMA 2OUKA 3FPJA 1UANA 1WF3A 3KOXA 4GE0A 3A4VA 4ZI2A 4Q6WA 2P27A 4ALNA 4C7OA 2ENWA 5DI3B 1XF1A 3CONA 2MOKA 3FKIG 3DMYA 1BFUA 3WMWA 1TWGA 4U9IS 1I6UA 5FOUA 2ONJA 3QU5A 1ZH0A 3KSAC 4BVKA 1UADA 5ALNA 4RY8A 2B36A 4J9OA 1T94A 3W8EA 3KV1A 4DGSA 1ARZA 4Y2TA 3RWMB 2W00A 4RMGA 4FSHA 4Z9AA 1JU9A 1V26A 1T1SA 7AT1A 3ZE0B 1C9MA 4UZEA 3LUCA 2CEAA 4TM5A 5KDOA 4Y0VA 4DDWA 2FEPA 3IILA 2IW1A 1Z68A 5C3MA 4IDAA 1U3GA 4FZ5A 1MBZA 3RQSA 4Y8VB 2AU0A 4BLOA 1JYSA 2AK2A 4JBNA 1L4HA 4M55A 2C94A 1RYSA 2BD0A 4GM1A 3GN1A 3F2IA 2VO1A 10MHA 5TB5A 2X5KO 1HOXA 2B1GA 3JATA 2C7RA 2FK3A 4CJXA 5LNK6 3F9RA 1UEIA 1R5OA 1T1EA 2GF2A 2G0AA 4YT5A 3HI6A 4GZMA 1L4FA 4DR6B 4WXRA 5GJBA 3CMMA 3QF4A 1NJSA 4G65A 5G4KB 3R6LA 1WV0A 2LWIA 2QTNA 4MZXA 1TPYA 3T12A 4HEQA 3QBVA 3AHIA 1A9RA 3KZOA 1HRDA 1V5EA 1XQWA 1WUJS 3ZK7A 3W1BA 1UBNA 2B8NA 5EAIA 3UZBA 4QGSA 2FDRA 2VZEA 1G3RA 5AW7A 3C4JA 4UCFA 1J56A 4O2RA 4GOXA 3HCNA 2JLWA 1CJMA 3PVZA 4HYTA 3PXAA 4HNTA 2BYTA 4XYLA 5EFZA 3G0HA 1MH9A 1NW6A 5IZCA 3R0QA 5BWLA 4CQMB 3HCWA 3RRBA 2O8CA 3K3PA 3CN9A 4UM5A 4YPVA 3DTVA 4HAVA 2ZUVA 4RNMA 4EENA 4O4IF 4QOJA 1M5UA 5CM0A 2YUTA 2C20A 2GPSA 4M3NA 1JWAB 1VKZA 3JU3A 5KFUA 1ONSA 3A10A 4C7JA 3V4LA 1RHKA 2BJHA 2HK9A 2A0YA 5EUMA 4AD8A 4TT8A 3WFJA 2YN2A 4TYMA 1E4OA 3OY7A 3RF6A 2OAQ1 3CR3C 4ZRDA 1DBIA 1N5MA 1A76A 1QK4A 5HM6A 1N0WA 2BJVA 1UZNA 3RSCA 3PCRB 2W2XA 1G6Q1 1U94A 3ZHSA 4MKZA 5DB4A 1U6IA 3B2NA 4RE6A 4A3DG 4NIMA 3ZH9B 4H3HB 2V4MA 1BE1A 2B0CA 3IO3A 2WFAA 4PYLA 3VKWA 4ZT5A 4HWKA 1CR1A 2A94A 3U3OA 2Z8ZA 3HDTA 3C2QA 5AVRA 3H3XA 1P7CA 1KZGB 3RASA 1CVLA 4IJWA 2WF9A 4APMA 3QOFA 2EC5A 1REQB 5K0GA 2GEVA 2Q5OA 1G7RA 5C7IO 5KPDA 1KI8A 2W70A 1ISJA 2DY0A 1X7YA 3UC9A 4K9MA 2PKRA 2QWXA 1ONPA 3DHEA 3IEVA 2ZPUA 3TR6A 3AKZA 3PE3A 3AVWA 3MB8A 2IHZA 1U3VA 4D3YA 4PG4A 2ZSFA 5C44G 3D5TA 2NAPA 4G0VA 3GNLA 1OYWA 4RQUA 5DW0A 3JQCA 4DMMA 2AGOA 2O1XA 2Y0SE 4BLTA 3V1NA 1G8FA 4F4FA 2PYZA 4C87A 2HB6A 4FMCB 1LK0A 3ZWVA 3LDGA 1H0RA 2EJUA 1QOQB 2H1HA 1G6OA 3GJ7A 2XNJA 4UZSA 1E96A 3K8YA 2C2YA 4TVIA 4F5DA 5FLEX 2DAAA 4IIYA 1Z2CA 4GEGA 5ISMA 3LKVA 3QVMA 2QTCA 1SKYB 1QBKC 2WFMA 4RPGA 1AQYA 1RPAA 1IBSA 3L9XA 1T0HB 5FKJA 1Y1VA 1K8QA 1AN0A 5DEOA 5UKDA 3OX1A 4NJMB 1UPAA 3BRWA 4Y2PA 3FKQA 4R7TA 4JP3A 1MNQA 4EY5A 2WDTA 4ZCTA 2GYWA 4DRXA 4KSBA 1PW7A 2P2DA 2QSYA 5EE5B 3RAPR 1W4BA 2P62A 3K0FB 1IRIA 4KTVE 4XWYA 4FIZA 2XGMA 1RYNA 1RLOA 4C4PA 4PLTA 2QMZA 2GFQA 4F9EA 2W2KA 1HZJA 1FRNA 3ND6A 1F2DA 2XPCA 5AICA 4KE6A 1XAGA 5F9MA 3C0FB 2V3CC 4YJGA 1O54A 3RAFC 4HZIA 2HUNA 4GOLD 1BN7A 4Y0NA 4ZEMA 3ZWNA 2L82A 4B6PA 1RHQA 3U9TA 3OZXA 1SU6A 1S01A 2FVYA 1WSBA 1TO1E 4LN1A 1LDGA 2ZGVA 2O5CA 4DQKA 2LCQA 4YRBA 3AB7A 4JXXA 4HDRA 2C3PA 3OTHA 4YAKB 1UMDB 1MP0A 1QF6A 2Z08A 3PGJA 2Y2VA 1XCGB 3LQRA 4BO9A 2VAWA 1JG4A 3P2IA 2PS3A 1P8JA 4XD2A 4B47A 3LOPA 3PIIA 3B3AA 3WGJA 5KFSA 2WOOA 2DECA 3H9GA 4RD4A 3LWBA 4AK9A 3Q2KA 1Y8AA 3ZBPA 1E5XA 2KSQA 1YR9A 4FFDA 3TTSA 1FMTA 3ZZ0A 3E9NA 1DGQA 1OE0A 4NHOA 3ZS9A 1P4HA 2ID7A 2P1RA 1XPRA 1CB0A 3DMTA 2OOKA 4JXJA 1SCNE 2R8IA 2H31A 4N0EA 3C3KA 2I9PA 1KH2A 1M8KA 1XZPA 4URXR 3ZWKA 1XAHA 4OQMA 1I1KA 3U2QA 1EVYA 3G8DA 5A6SB 2LDXA 1Z6QA 4UCXA 4BKQA