4I50F

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
379
structure length
303
Chain Sequence
MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYLAAYNRRREGREGNVWIAKSISSEASELLDFIDEVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSTNHCIQKEYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLADPTSIFIKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 303
sequence length 379
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4i50F02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4i50F03
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i50F01
1VKZA 2W6ZA 3WNZA 2R86A 1KJIA 2WYOA 2R84A 2R7KA 3Q1KA 1WR2A 5D8DA 3R23A 4I50F 5C1PA 5HV6A 1UC9A 3JRXA 4O7TA 4EGJA 1CQJB 4O7YA 3TW6A 2XCLA 4YJ3F 4ZI7F 4O81A 3AW8A 3HB9A 5LA6F 4TV8F 4HNVA 2W6OA 1JDBB 4I55F 3LWBA 3TQTA 5CA1F 1KC7A 5KKNB 2P0AA 4O7LA 2YWVA 3R9RA 2YRXA 3V4SA 3MJFA 1GGOA 1EHIA 2V59A 2Z04A 4YBZB 3R5HA 2ZDGA 1GSOA 3K5HA 3GLKA 4ZQIA 4IHJF 2IP4A 5K2MA 1Z2PX 1OBDA 1CS0A 2DZDA 5LP6F 3I12A 1C3OA 2CNUA 1E4EB 3KREA 4DLKA 4O7NA 4O4IF 2HGSA 2FB9A 2OLSA 2YRWA 4O82A 4HNUA 1KJQA 4E4TA 4ZHQF 2GPWA 3JZFA 1E4EA 5C8YF 4O84A 4MV8A 4TUYF 4TV9F 4FFLA 3LP8A 1VBGA 2GPSA 3WO1A 3RV4A 2ZDHA 2NU7B 3OUZA 1IOVA 4EG0A 5JQGF 4XX0B 1DIKA 3U55A 3U9SA 1UC8A 3WO0A 4O7VA 2DWCA 4O4LF 2C00A 3QFFA 3AX6A 3VA7A 5CA0F 2YL2A 3KAJA 1KJJA 4MA0A 3U54A 5J2UF 4MV7A 2YZNA 3KAKA 5LYJF 3RUPA 1JDEA 3VOTA 3VPBA 2DIKA 2FP4B 4NYEA 1B6SA 2PVPA 2YS7A 3K5IA 2W6MA 5CAEB 3U9TA 1A9XA 4MV9A 4O7SA 4YB8B 1CE8A 2YS6A 4MV3A 3HBLA 4RZQA 4O4HF 1AUVA 4MA5A 5HBRB 5IYZF 2PN1A 3R5XA 2CNQA 3V4ZA 4IWXA 2W6NA 2W71A 3G8DA 5EZYF 1W96A 4MAMA 4ZOLF 4WBNF 1KUTA 3KALA 2VPQA 2GQRA 3JRWA 1IOWA 5C1OA 3RV3A 1JLLB 1CQIB 3Q2OA 4QSHA 5JH7F 1I7NA 2YZMA 3OUUA 2VR1A 5FNVF 1I7LA 2R82A 1KJ8A 1M6VA 4HR7A 2NU8B 3TIIA 1Z2OX 1EYZA 4FGRA 2HJWA 4IZOA 5JVDF 3GIDA 3N8DA 3TINA 2V5AA 2VQDA 2NU9B 3VPDA 1AUXA 2CNVA 4FFOA 4XYMB 4MV1A 5KX5F 2DLNA 1OBGA 1ULZA 2YZLA 5BMVF 1W93A 1SCUB 4MV6A 4HQ6A 2FPIB 1GSAA 3MWDA 1EUDB 2R85A 2GLTA 4IWYA 2I8CA 4FFPA 3SE7A 3BG5A 4O83A 3JZIA 2X0SA 1PK8A 4O7RA 4XZ3B 3RFCA 1M0WA 5I47A 1EUCB 4Y8VB 1EZ1A 2R7LA 4FFNA 3VPCA 3UFXB 2W6PA 4WD3A 3N6RA 3MWEA 5J2TF 1Z2NX 1PX2A 2R87A 3ETHA 2PBZA 3R5FA 2YW2A 1DV2A 2ZDQA 4DIMA 1GLVA 1A48A 4EGQA 4I4TF 4XYLB 4IIJF 3K3PA 5BPHA 4ME6A 1KEEA 1KJ9A 1B6RA 4MV4A 1BXRA 2J9GA 4YAJB 5JVLA 2W70A 4C5AA 2NUAB 3NUAA 1BNCA 2YZGA 2FPPB 2YYAA 1VBHA 3DF7A 3VMMA 4HNTA 4L1KA 4FU0A 5JQWA 4M9UA 5GONF 2CQYA 1C30A 2CZGA 2I87A 4C5BA 3G8CA 5DMXA 2Z02A 2R7MA 4FFMA 2QF7A 4O2BF 3ORRA 4O4JF 4O2AF 5BPFA 3E5NA 2I80A 1GSHA 1JKJB 2W6QA 3HO8A 4YJ2F 5CB4F 3TIGA 5LOVF 4FE2A 2QK4A 5H80A 3ETJA 2SCUB 4C5CA 1KBLA 4YAKB 4O7ZA 5LXTF 2NU6B 2XD4A 3ORQA 2R7NA 1DV1A 2V58A 4FFRA 1T36A 2GQSA 2R6FA 4O86A 4O7WA 2FPGB 1M0TA
chains in the Genus database with same CATH superfamily
2DSNA 5HFAA 2R86A 1RR6A 3L1VA 4PICA 4RWZA 1K1EA 1N34B 5KOYA 3GFVA 4N39A 1ZH6A 1L8QA 3Q3JB 5DGBA 1K06A 3AVUA 3WMFA 1W581 3QPWA 2QUAA 4I6GA 4JKIA 3BTOA 1LPOA 4MVCA 5LN1A 2EQ5A 3TQTA 2F1HA 1YDGA 2YV2A 1W5BA 1ZVQA 1ZQ9A 1GAWA 1N1DA 2PUCA 1RHMA 3A70A 1XDZA 4P0TA 3UAVA 2LTAA 4YJ3A 1Z8NA 4YBZB 2PVCA 2D0PB 4C01A 4C6SA 5KJEA 4R1TA 3ZDAA 2GM5A 3K5HA 2O8CB 2EU8A 1GGEA 7AT1A 2OE2A 5CYGA 4MPPA 4DV1B 3KPWA 2G3YA 2UXCB 3W5SA 2QXUA 5SZHB 3W7BA 3AEZA 1QHHA 3GTGA 4FKZA 3I04A 1WQ4A 2WJHA 4Y2HA 3LX5A 1NOKA 1RKVA 2SKCA 4EL5A 4TN1A 4MROA 3VNAA 2MSLA 4Q4JA 5DTRA 3AWIA 1II8A 1W76A 3PIDA 3K6SB 5CNMA 2CXNA 4GR9A 4MAFA 4CVNA 4YACA 4CMIA 5KFUA 4PQYA 1ZWLA 2Q8PA 4ZT6A 1M34A 2XJ9A 3BF8A 3GFSA 4QREA 4BVKA 3DGEC 4UEJA 5HIIA 4LJYA 1EGHA 5ALJA 4FGSA 2YOFA 5ALIA 2AOUB 3HV0A 3OTGA 3AR7A 3KAKA 1NDQA 4EJ6A 3BGOS 3B5JA 2B35A 2FP4B 4YEDA 2IYPA 2H8KA 3K0EA 3I1YA 4RPGA 2EJTA 3W8FA 2IHJA 2C61A 2CB9A 5SICE 4D9IA 4L8GA 3HBLA 2H1WA 1E5XA 1VQ1A 4DBVO 3FOWA 4AXXA 1QORA 3F3SA 5G40A 2PJUA 2R96A 3BWVA 3UQZA 4BVAA 2B2XA 4J2OA 2Q4TA 1XOIA 3H0CA 1BX1A 1K5GA 3MLAA 1UM8A 5F2OA 1VSBA 3EZFA 3A6ZA 2ETVA 2I54A 1L4MA 4N9WA 5KT6A 5JYEA 3WKBA 4MUMA 2AJ8A 1FVOA 4A10A 3SYMA 3DBRA 5KYWA 2CHVA 4TX1A 4HDSA 3FUCA 4IZOA 3GRRA 2DLCX 3N43B 3TKLA 3WGMA 5L6LB 3L6RA 1HNNA 2HK7A 3P9XA 2DFDA 4LXYA 4CEJA 4ENWA 3PC3A 3RJMA 4BQSA 3PHJA 3G7SA 4L8LA 2AOWA 3VNNA 4QUDA 3KDAA 1P5ZB 3QE0A 4XYMA 3AV3A 5KX5B 3A4TA 1M8KA 1NVFA 4UXJA 4JXXA 3WZLA 3DUFA 5ARCA 4ZP1A 1ZUWA 1XEXB 3QU9A 2O0KA 2NZ2A 1ZIPA 3GJ8A 3NDRA 4WHMA 3I61A 3CH7A 2ZWAA 1XUOA 2CJPA 4Y2YA 3D31A 2AR9A 1OYVA 4JYAH 2VNIA 5IVPA 3ZLUA 3CYFA 2I2FA 4IXNA 2AXNA 4X20A 2JFOA 2WBLC 4CKCB 1K6JA 3UKOA 4JI0H 4Y2PA 5DNDA 2LD4A 3L04A 3LPMA 4Q47A 4R1LA 3E82A 4KQIA 3JZ6A 5K8UA 4FINA 1JFFA 4JI7B 4LRWA 4A15A 3IAS1 3CFYA 2VC2B 1PEYA 1GCOA 1ZOIA 3ENVA 3NM6B 1NBWB 4V3CA 4UM7A 3V8NA 2NVYA 5CPFA 1NAIA 2HTEA 3DDOA 5BSWA 3G9TA 4MICA 3GA7A 4N49A 2ZUTA 3G9UA 1DV1A 1H1LB 3QI2A 3H20A 1LLCA 1COWD 1E18A 4RIHA 1QH9A 3PXBA 3F8NA 5AOAA 1DC5A 1O4VA 1DAAA 3C74A 1DAPA 1SXGA 3K9QO 2P75A 4ZOCA 5KFIA 1JSCA 4MRPA 4CL0A 4K03A 4H6VA 3DEAA 3A4IA 1UPAA 2CNNA 5KQRA 4LJLA 1QHEA 2HMUA 4OIMA 3LYAA 1F6BA 4OUKX 3E2PA 2O8FB 2WKPA 3G5MA 1DLJA 4R2MA 5GZ6A 1Z6ZA 1O0BA 2WFAA 4POOA 2YWVA 2GFIA 4IRKA 4IH9A 3GJ6A 2F1RA 1XD8A 1K5DA 3GUCA 1VFPA 4TLEA 3C7AA 2AZXA 4LSMA 1IJBA 2QB5A 3IEPA 2Y4NA 4P7GA 4E30A 3LUHA 3WIOA 3OLWA 2I55A 3OCCA 5KQPA 1Z6GA 2K6GA 5BUQA 2O0LA 1LJUA 4CIXA 3FHLA 2VCHA 2VT2A 4M8LA 4R84A 5BSVA 4EFKA 3QXSA 1ZL2A 5IH7A 3AOEA 3FWHA 2FU5C 4LN1A 3L7YA 1DQZA 2FW8A 2HJVA 3ZIUA 4JODA 3O4VA 3P45A 1OGYA 1K66A 3SQXA 1N4AA 1M2NA 3FVWA 2R8IA 1BU8A 1QGUB 3BMOB 1PCXA 1JE0A 1JQLB 1WLSA 1US8A 1RAIA 3UZBA 4B45A 1E5LA 2VT6A 5BN4A 4KJXA 2UYGA 1LC0A 3R3HA 4JUDX 3H5LA 1G7CA 1JSLA 1VGVA 1LW6E 3M89A 5HW0A 4RETA 3HB5X 5D00A 3AY7A 1Y4UA 3VPSA 4NXMH 4LDNA 3EUFA 3B8HA 2G80A 3IDQA 2QVZX 1KJNA 3IEUA 4D0GA 4MCAA 2IYVA 1X39A 2QRVA 2J6TA 1P8AA 1F8GA 2ABWA 3ZWVA 2QDXA 1KDZA 4C6TA 2X0KA 2YHIA 1U2SA 3WLEA 2ASVA 1N32H 2RHDA 2XDAA 3AP1A 4PLGA 1ZI9A 5JJLA 3HEAA 2EWVA 3GLUA 3A1SA 4FE7A 1VTKA 3UXHA 4EATA 3RTGA 3ESYA 1OFUX 2VT7A 2HREA 1NW9B 1FYDA 4TWZA 4YX9A 4MYCA 4Q03A 4WV3A 2AA3A 3DAOA 1HKUA 3QMWA 2RI6A 3JVDA 3ZV7A 4AMYA 5ERYA 1AN0A 1WM1A 3UBTA 3HOYG 2H7VA 2AG0A 4RKQA 3AIOA 4G2NA 3TQRA 1MDBA 1HX7A 4HEQA 1K6MA 1I5RA 2HVSA 5HWSA 5AI9A 1O6ZA 1BHJA 2G6TA 4N0PA 1EE2A 2YWXA 1QE0A 1JR3E 1WP4A 1BTOA 3GAFA 4F0JA 2HIGA 4G0QA 4PCAA 3UJ7A 2XQVA 3FNGA 4DBZA 4DCUA 3O84A 4TTAA 5D5HA 2HIHA 1U8TA 2X1MA 2JFUA 2BTQB 5JS8A 1ICEA 1XZLA 1SBCA 3FVVA 5AM5A 5B30A 3FE2A 2Q5FA 4C2AA 2MSDB 3STYA 4LXUA 2YMPA 4RV4A 4FQ7A 4NZZA 2X5KO 2IEYA 3HKCA 4N8SA 1R0WA 1NZFA 5ILGA 3WV5A 5HE8A 3TJMA 3LPDA 4LHYA 4BMNA 1WPXA 1V5GA 2GPJA 3R09A 5J1SB 2P7HA 1JP7A 3L7AA 3PPXA 4MW6A 4XSGA 2XUIA 4DR3H 4I7HA 3IUJA 4UBKA 4YAKB 2BONA 2J41A 3CZAA 1H6CA 1H5UA 1L5WA 2VDOB 3ZS8A 3IHWA 1G17A 3RC8A 2WIJA 3VO1A 1ILEA 2RHCA 1IHPA 2O0HA 4PSDA 3OF3A 3MR6A 5LXTA 3N07A 4JU8A 3Q1KA 4TYMA 5KNCD 2IBSA 3DTTA 1GTVA 1QVWA 4PYLA 3E22A 4F8YA 2GN4A 2CUNA 3HFGA 2VHUA 2VLBA 3CSDA 1PP4A 4QECA 1K08A 5KG2A 5KFFA 4F8JA 2K7FA 1RAGA 3KKPA 1NUAA 3FZQA 3A05A 2XQKA 4B81A 3U16A 3CZMA 1TQ6A 2P4HX 5T8KA 1F51E 3U13A 5D1OA 4UCSA 1V5WA 3IR6A 3JSLA 3O9VA 4RNNA 5IPFA 4INJA 4EEKA 1C3OB 3EA5A 1TLFA 4HH3C 4J76A 4TGLA 3QUCA 2YXLA 4RV9A 5G0VA 4N5MA 4OXQA 1XD2B 4WZZA 5FWYB 3AKZA 2I0FA 3O2QB 3DJFA 2ZANA 3M5PA 1T5BA 1E7QA 2R6R1 3SX2A 4TRMA 1BFDA 2HGSA 2GAJA 5E3IA 1ISRA 5B3JC 3R2JA 2X5NA 4Y18A 3D4PA 4CRWB 4D9NA 4D8TA 3UPUA 4XM2A 1BD3A 4I5EA 1SFOA 5MN6A 2K4MA 1K6IA 1U4OA 4B3RB 5IKEA 3P9QA 4MVJD 2A9OA 2JLAA 3HOZG 3H11B 4IIHA 3U39A 1Z9BA 3SVLA 4RY0A 3AX6A 5CYPA 5AVVA 2WR8A 1L1EA 1PVDA 1N2EA 3P9YA 1GUDA 1K7EB 2ZT6A 1NUHA 3DVLA 3BBLA 1E7WA 1ZQ7A 2YS7A 2E49A 2ZSEA 1JALA 5CA0A 1SCBA 2ZW9A 4ADSG 1XNQB 5L3RA 5ER6A 2C2DA 3O47A 3OKFA 4P4SB 3BXXA 1MD9A 4CMBA 3HY4A 1OAKA 5FBLB 5J40A 4ZKEA 1JXQA 4FDTA 2UYQA 4MVWA 2JJ1A 4M53A 3WIDA 4LE0A 3SS9X 4EJSB 5LJIA 2HQOA 1T3LA 3KHLA 1XLTA 4OI2A 1X86B 4C2MA 1SBQA 1VFNA 5JH7B 2H4YA 4ECWA 1JLSA 5AHWA 3U81A 4NCAA 1P3Y1 4WPGA 1E96A 2XZDA 4WRRA 2PTHA 4QUIA 4L8YA 1E4GT 1Z7GA 2QTVB 3ZCPA 1RQ7A 1P4JA 3EEYA 3M3PA 3ZTYA 2IEIA 5JWRA 3AL0C 1M72A 3OD1A 4JASB 4Z4EA 3U3XA 4Z7NB 1A9RA 3FCSB 3ER9A 2PWZA 1X0VA 4AZ0A 4UQLA 5E6SB 4KIFA 3WAGA 2ZIVB 1KI4A 2N75A 3FPLA 1F5SA 4DLBA 1A9PA 4HDRB 3CB4A 4O8CA 3OTOB 3F2IA 1D1SA 1R0YA 3PWZA 2FPIA 5I9TA 4KNVA 1SNYA 2H6EA 4GPD1 1CQWA 3VTZA 5AM3A 4WKNA 3RS8A 2VZEA 4NOMA 2IE0A 4UHHA 4PAQA 3HUDA 3BEOA 3V55A 3OFKA 4B32A 3WWEA 2QE7A 3LOUA 1CUGA 3K4HA 4YB8A 3RROA 4G1VA 2FX2A 1HQCA 4EGSA 1Q44A 5FF9A 4PLHA 1PEDA 3M70A 2ODPA 3ENZA 1VBHA 3G0BA 4RPCA 1LVHA 1E2DA 1ZG3A 3DZBA 5DOVA 4JBXA 4NJMB 1JPUA 1FS4A 5HPYB 3IV7A 3S44A 1D1TA 3ZKAA 1QNLA 2BM8A 1QCZA 1M2VB 5DK4A 1JTVA 4L74A 1NNSA 4CMEC 4KO1S 1IAVA 2WF8A 1QZZA 2SICE 5FUXA 3GFFA 1E1QD 1ZCFA 4MS3A 4QWBA 2CDCA 1A9OA 1Q11A 4QKQA 5FUMA 3K9GA 4UM9D 1I3CA 3GU3A 3IAEA 1YHYA 1GKUB 3L3BA 4M8NE 4X1YB 5IARA 3SX4A 3N2KA 4ZT5A 2OFFA 3IQIX 2FW9A 3GOQA 3TW0A 1CUSA 3LBHA 2AFHA 2IIVA 3M6MD 4IMPA 1JRLA 3QE4A 5EJMA 4HKTA 3LQRA 2AI3A 3Q88A 3OMWA 1KEPA 4FP9A 3CIFA 2OBYA 3RJ5A 3T38A 3QPDA 3CINA 4DQUA 2O5EA 1ZVMA 5LUAA 3PFFA 3LX6A 3AR3A 1EHIA 2ZUSA 1OV6A 4XIIA 5AUOB 1SVKA 4EBEA 2A9PA 2DAPA 4AMGA 4YV7A 5H9WA 1MDFA 3S27A 4KLCA 1RJ9B 1QK4A 4B31A 2XJ4A 1BS2A 5DP1A 1OXVA 3G2MA 3KHHA 2JAWA 2B1IA 2ZBFA 4KVZA 4MQMA 1Q7CA 3R6LA 2OHXA 2BFPA 3R20A 4J7AA 3T1HB 1CZNA 1I50A 4BXOB 3G89A 3WC4A 1M2HA 2GSWA 3SEFA 4XQ0A 1OVGA 5HUJA 1N5RA 1FFXA 2R92A 4PX2A 3FMIA 3H5WA 3P2IA 3HLKA 4IMRA 3KT0A 2NTNA 4R2XA 2E7ZA 5BUZA 3UQ8A 1DL5A 3I64A 4RGQA 1A9SA 2QTFA 3P0FA 2AN3A 2LIPA 4AJHA 3IP9A 3GPLA 2OWEA 4CTKA 4RMIA 4EJ0A 2DCUA 4GKKH 4OLAA 5ITSA 4P93A 4UAUA 1A9XA 5SYNA 4TMVA 2HEGA 1P6UA 2NIPA 5AW1A 3NC4A 4H7FA 3JY6A 4J9RA 3KU4A 4DDWA 1TAGA 2Y1WA 2O07A 3HBAA 4CL8A 4YK7A 3ZUPA 4J75A 1JU3A 2RJ3A 4LHSA 1XMIA 1KI1A 2EJ3A 1NQTA 4IFBA 2IIBA 2OORA 4S05A 1W47A 5CW1A 1B3RA 3LCMA 1LRKA 3SN6A 3DDZX 2AMFA 3FCUB 4DTIA 4GOXA 3TIIA 1XRRA 4J9PA 3SIPA 3QIAA 2CFTA 2RAPA 3BA8A 2RGNA 3AKDA 1YUNA 2ZJAA 4MUEA 1C9MA 4ND1A 3LXRA 3V4VB 1VZ3A 1X19A 2WD9A 2NU9B 2JA5A 4D9GA 4V0LA 3JQPA 2ZTMA 3LHDA 3PENA 1Q3KA 2F4VH 3FUVA 2D4AA 1E0AA 1NBMA 4DR5H 2ZKIA 4X41A 2V0NA 4HI0E 3QVGB 3Q98A 2OTCA 2JCYA 1MO2A 1IAQA 3LF1A 3VOBA 2XIGA 2VEDA 2E82A 1LW7A 1GNRA 4OXNA 4FJ0A 3UF0A 2PR2A 3RSLA 1HYQA 3DMHA 2B63G 1VP9A 3RS7A 4AYXA 3T4XA 5EGNA 1EUCA 3GZNB 3G02A 4QU5A 1AU9A 1JLRA 1RM3A 4EMSA 3T34A 4HB2A 4EKGA 1EHCA 4ZYWA 3R7SA 4CQMA 3W1GA 1U2RA 2EQBA 1CVLA 2IRWA 2E2IA 2C9OA 2B9VA 3D3NA 3T5JA 2GZ2A 5CB0A 2R1TB 1DAGA 2GNPA 4ECRA 4F5WA 2QIOA 2JCXA 3U7FB 4LX0A 4KR3A 5JSZA 3B1XA 1ONOA 2NQTA 5L1JA 1P8JA 3R8XA 3A9RA 1QRAA 2QAIA 4JI5B 3EMBA 4YHHH 4KSBA 1OSNA 3GXBA 2RI1A 4KI7A 2NSYA 5F1KA 1O5OA 3A1VA 1NLFA 3CT6A 2EGHA 4CMFA 4DLWA 3DB2A 1GPKA 4M22A 4ABYA 4XQ9A 5KFMA 5LZ5A 4DDMA 1UC5B 5KCMA 1YACA 1A8QA 3KQLA 1OIXA 1DFGA 4LZWA 1SKQA 2I91A 4MRVA 3WWOA 2JHGA 1RWBA 3IN5A 3AEXA 3PQDA 2YDXA 1YCFA 3KHUA 4KXFB 3PPYA 4BAGA 4DLSA 4EZEA 3HZHA 3KOWA 1H69A 1T1EA 1N2OA 4EMTA 5K3DA 4WCVA 2XCLA 4D57A 1ECFA 4EJMA 3B9QA 1QG4A 1L5YA 3IT0A 4F46A 1L5RA 1ZD4A 3SQDA 4AZVA 4L0MA 3WWIA 3I01A 4P3PA 4X1KB 2GT1A 2P0AA 4I5IA 4H2DA 2XDQB 1YAHA 2WG0A 1J5PA 3GNQA 1Q1AA 2JCBA 1GO3E 1FP4B 2FG7C 1AC5A 2OO7A 1RCUA 2Y1FA 2GTHA 4AN0A 2R4UA 2NACA 4U2EA 1G20A 1WZUA 3ED5A 2OBMA 3N2ZB 1YTLA 1TZMA 4YR0A 1YI0A 1C9EA 4TQSA 3MB8A 3DKRA 3PXXA 3GFGA 3EF1A 1DARA 5FQNA 1RPAA 2FJ0A 1EGMB 3ICVA 2OLSA 4MV0A 5J59A 4FCVA 2VJDA 4J03A 4MB2A 4PEVA 5FCDA 2BKLA 3CEPB 4ZU3A 1E8NA 1EI9A 4TUYF 3F8SA 5TXGA 1AK9A 1JFRA 4PFJA 4ALMA 5DNYB 3QQPA 3PUYA 1M6YA 2NU6A 5B7GA 2AD1A 2CUTA 4K2HA 5FKJA 3G2JA 4PWQA 1JV2B 4TV9B 2BSAA 2PSJA 3LLSA 4CM9D 2TMKA 2P3QA 4EKIA 2I62A 4QUHA 2I2DA 2QLMA 2JAXA 3NP9A 3CM0A 2I8LA 1WSCA 4H18A 3FBWA 2GRJA 4NDNE 2H06A 5DYTA 4DNXA 3PDIA 4ZV9A 2Q3FA 3H5IA 1VMAA 2AG1A 5JAPA 5HNKA 3TG8A 4GOOD 1GZDA 3OZFA 1EX9A 4PYKA 1VL6A 2KM1A 1J9GA 1I7NA 2ZTUA 1AOXA 2H65A 4QUJA 5T41A 1G6HA 2HMAA 4U2FA 4LRQA 2XMSA 2F3PA 4X6XA 4FGZA 1EHYA 4PC3A 4DADA 2KWIA 4CIVA 5KG0A 3TINA 1NUTA 4KV7A 3GJQA 3RYIA 4WLEA 4BKQA 1Z2DA 1TZBA 2SBTA 4LYJA 1WZEA 3WK4A 3H05A 3MWJA 1XKQA 4ESVA 1HLGA 3CVZA 3PR4A 2EFEB 4UFZA 1Z4PX 3CG0A 2G07A 1B42A 2Y4OA 3RB0A 3U40A 4HVCA 2NYRA 1NXQA 4DV6H 1ADJA 2I8CA 3ELYA 2ZM5A 4LJ5A 4Q48A 4F93B 2HHFB 1D4AA 2GYWA 2MSNA 4G37A 1FJXA 2BOVA 4GQIA 3EVTA 4QQKA 2PVSA 4M38A 3SXUB 2AGPA 4Y8VA 1R27A 4YYEA 1SVMA 4MP6A 1WPGA 4L3WA 3ZV6A 2XQIA 3IUEA 1TWAA 2YWBA 4LGYA 3X1XA 4MUBA 1P18A 1GFSA 1XP8A 5DXJA 3RSFA 3EN0A 5F12A 4AM8A 1SOUA 2UZ3A 2GCIA 1PLKA 1UBKS 4DLXA 2ZZKA 5IS2A 4GPEA 5HRCA 5ARBA 1EGVB 2VIIA 4TQGA 4LJRA 3M5CA 4C03A 1UBSB 8MHTA 4F3NA 1UEIA 3LFUA 4J0HA 1N0HA 1A5AB 4CFSA 1PLLA 2ZBQA 4M9XA 4JI8B 1QYDA 3JW8A 4C78A 1QR6A 4RELA 1WXWA 1AUPA 2CNLA 3W2FA 1W4ZA 3D0QA 5ECWA 2C2WA 2I2BA 4O2BA 1GNQA 1QRUA 4PO9A 3BD9A 3LCUA 1ZN8A 2C0PA 3EFHA 4ALKA 2JBHA 2WWGA 4C76A 3JSXA 4E1VA 1CIVA 4TN5A 2IWRA 4MJ7A 4JI6H 2CMFA 3KLPX 4XQCA 2Q7DA 4TLLB 4TRJA 1SEIA 4FYPA 2V3WA 5AUQA 5IZCA 4H1VA 1VJ5A 3GQBA 3NM4A 1PS8A 3LUJA 2NN3C 4NG5A 1T6XA 3O03A 2Q8NA 4GPTA 2ORIA 3A3KA 1TVMA 1ECJA 4PSKA 1YK0A 4V02A 1Z17A 3GFQA 5ERGB 4CL2A 3MHPA 5AI0A 3NHFA 4ODIA 3LCJA 2FI1A 4MPRA 2XY4A 2PCLA 2H2DA 3RKUA 2C7VA 1ZK3A 3LUAA 4QNNA 4YAUA 1H2RS 1EKFA 3MLBA 2WM8A 2FWPA 3NDJA 2O03A 1CUUA 3HXPA 1CUXA 3WKCA 3I2IA 1E4EA 2EIYA 1DPFA 2WWRA 2I7XA 3D8SA 5E7JA 3JYNA 4O25A 2NUPA 1SVLA 3GLRA 4G0WA 4LTDA 2HRZA 2ZSHA 4Y0VA 1W8IA 3FDFA 4KGXA 5ESDA 1ZYUA 3OEWA 1QYIA 3ZHRA 2CV2A 4CV1A 1TTQB 3NGMA 1BFKA 4J9KA 1IUPA 2PG3A 3NTOA 4O7SA 3IHTA 1R9MA 1HE3A 1E3IA 1ZCZA 4L5IA 4DQDA 5J2TB 1CW2B 1GCUA 1M2KA 3TY5A 1JDSA 5DXFA 4AJPA 2O7SA 3ENQA 5F2KA 1HZZC 4HUQA 1ZIOA 4AXBA 3UOGA 3BMQB 3ZK9A 2FDRA 1DRJA 5FO1A 2IZ5A 3H1AA 5KT4A 4JROA 2L2QA 1XKXA 3PYMA 5SV2A 3QKTA 1BJRE 4ZEXA 5LQNA 3PX2A 5JHGB 1GPDG 2HQSA 5C4MA 1JEDA 2X22A 1QJCA 2VP4A 1AGPA 3NEJA 2D06A 1NXWA 5B3LA 4B44A 2V4QA 3THXB 2J3LA 2UU9B 1PJQA 1UMDB 3MVEA 2B1QA 2GXSA 5D3MA 3HJRA 4XB6B 2J7PD 1DEAA 3E23A 3HC7A 2VDMB 4F92B 1L7BA 4EFMA 3HL0A 1HL7A 1TD9A 2R7LA 1XVUA 1SRQA 2JAPA 3L0YA 3KPVA 4RAYA 3TMKA 5KUTA 1XLWA 1AX9A 3O93A 2IITA 4O5OA 3KWFA 3J7AC 2R4TA 2WEKA 1QYCA 3IAXA 1FUIA 2DHQA 1M6NA 1VMEA 2P2GA 3O9MA 4K86A 3DTGA 1L7RA 4ZCIA 4MV4A 1Z29A 2GARA 1VYHA 2E1RA 1GLNA 1HURA 1NYLA 2P35A 2QZZA 2BEUB 3EBOA 4M88A 3UG7A 3W4IA 2HT6A 2JAQA 1VCOA 4NMXB 4Y2QA 5JQWA 3MAGA 5C1IA 1ZC3A 1XQ6A 1QIEA 5KREA 2WIAA 4IUBS 2YFHA 2IY7A 3GGDA 4A3CG 2OHVA 3WICA 4BVJA 1L2ZA 1IM8A 3KSRA 4QLAA 5DCWA 4O2AF 4PSCA 4NZMA 1R0XA 1VJRA 2E6KA 3Q41A 3NUGA 1WS6A 3RB3A 2OSBA 3SK0A 4DR7B 1MABA 1Z4MA 1T29A 1ND6A 3WGVA 2FEXA 3BSFA 5AW3A 1OASA 3AVWA 3F5DA 3MUEA 1EFRA 4UCQA 1MO6A 3CEJA 2D7JA 3F97A 2JNWA 3NHWA 1TT7A 2GJ8A 3ZHZA 3NORA 5AD1A 2CUKA 3F4BA 5M34A 1ADBA 5CCEA 4RL6A 1XE3A 4CF5A 4NAVA 4D98A 1RYHA 2HAEA 5F4BA 4TV8F 5DLFA 1J2RA 5EIBD 4Y6RA 5DHFA 3OCJA 3VH2A 1XTJA 3KYIB 5KHLB 2BHTA 2E37A 3L8CA 5B55A 2W2OA 3GDHA 4RXMA 1UP7A 2C99A 3RUAA 4DYHA 2H0RA 2VPWA 2W2MA 1Y33E 2FMHA 2GLXA 3ELUA 2DQKA 3M3HA 1ZVKA 3EZ6A 2BRUA 1EDOA 1EUQA 3UUFA 5AOBA 4KAFA 1YZLA 2D2VA 3KQHA 4RA6B 3W6PA 3RE1A 4P6VF 3QELA 3UJ6A 1SXJD 1YRLA 2FW1A 1N25A 3W2IA 2X0EA 5ICEA 1R9TA 3ZWNA 3R75A 2R5WA 1LNQA 3U3OA 2X4IA 2B92A 4L4SA 1X9GA 3I5UA 3WK9A 5G02A 2Q2TA 1DIKA 2C7RA 2QRPA 5HTOA 3HLTA 1U8ZA 4WSOA 2ES4A 1JDEA 1M74A 1FDRA 5KG7A 4YP5A 1UZUA 5IJ0B 3IIMA 4FHCA 4AO8A 3FPAA 1WDMA 2A3NA 1FA9A 4OHVA 4Y6OA 1NGSA 3DF9A 3BWEA 2CXQA 5E7MA 4B87A 4ERNA 3MQ2A 1XCOA 3SLRA 1VBMA 3SC6A 1TF7A 5HM6A 4RZ3A 4G4IA 1B00A 2O2YA 2IOYA 2FSHA 4WLVA 4TZ6A 3MGBA 1O7JA 4MUKA 5F1YA 4BNXA 1TU0A 4JLNA 3FSRA 2FGJA 3OJEA 4C22A 4U0KA 2UZ1A 1OGJA 5DFAA 2R751 4G1UC 5I60A 1GG8A 1RXUA 4R8MA 1WIWA 1EK1A 4NU5A 2XC9A 2EP8A 5AW9A 4EEYA 5HUQA 2RK4A 5EIFA 5KFOA 1ZDMA 3K1ZA 4N82A 5JMOA 1JIVA 2BLLA 4CUJA 1Z2CA 4KOAA 3LZCA 3L0ZA 3CH5A 4EVIA 3COZA 2J85A 3HI6A 2X41A 4UAGA 4KQXA 1IY1A 4OY3A 3L8GA 2OBXA 4X00A 2OFWA 2A8YA 3PC8C 1WXQA 2ZRGA 1L4BA 2C4TA 4F2PA 1KVTA 4BNHA 2V55B 2DUNA 4RPJA 1UPTA 5EE0A 5CEFA 1T3ZA 4WXYB 3BD7A 2NZVG 2ODAA 4BZQA 4X24A 4QGHA 4H3HB 3ZJYA 2VLIA 1DEHA 2WE8A 4K81B 2AMLA 3U6BA 1WUTA 7REQB 2QV0A 5CVTA 4PO1A 1PT9A 1NV9A 1JEQB 4DCTA 4J4BA 1KHHA 3GIJA 4L6CA 1UBJS 1FE8A 2CL5A 3SZMA 3TSOA 2ALJA 2GF2A 1EVKA 1YE8A 1U4SA 2HJSA 3N41B 1WW8A 3UHOA 5KFSA 2GVNA 2VSOA 3ZHTA 2QMQA 1TZCA 1CKMA 4C29A 3KTOA 1LDNA 1Z4JA 3HKZE 1GKIA 1IDN1 2GRAA 4JENA 3LQFA 2CL6X 1D2GA 3W1EA 5KG1A 4H7IA 4C7KA 4LMRA 5EL0A 2D1FA 4MPDA 5BV0A 2UZ4A 1T8RA 1X74A 1W4BA 1X8JA 3FPBA 2FPGB 3JYLA 2GCOB 2PKCA 3HZZA 4IG4A 1QP0A 3COPA 2FA9A 5GIPE 3TY8A 3ZX4A 3TW7A 1M2JA 2QBYA 1FDIA 2R8EA 4CR8A 4JA2A 5KS8A 3WGYA 5EE9A 2JGMA 2BAGA 1FVFA 2QRZA 4FGJA 4L3VA 2QQ5A 5DYIA 3C6ZA 1KJYA 3VBEA 4UARA 2CDNA 5H5JA 1IEVA 4JI1H 1C41A 3BXEA 4UZEA 1BXGB 5G3ZA 5D3QA 2ODEA 3S28A 3UCXA 2R8YA 2XKJE 1GGJA 3DE2X 3GLGA 4RDCA 3AI2A 3CGWA 1QVZA 2WM3A 4BLWA 5KJFA 5CIQA 2H4WA 5EIEA 1I7SB 4KN9S 4P0QB 4MZDA 4K3VA 4R1UA 1ISFA 2QHXA 3BH7A 1P9WA 4PR0A 2DTXA 2EF0A 4MR7A 3L1JA 3FF1A 1L4EA 3TMYA 1DMRA 1FNMA 1P1FA 4GVPA 2XLCA 4LDJA 4CU2A 3PNSA 4YCSA 5KTKA 2XWSA 1GKLA 2FZWA 2CL0X 4HGOA 2GPBA 4I1YA 2PMDA 1U2DA 2I65A 3QTLA 2XA2A 1D0IA 5DHRA 3LP8A 3LT4A 1J8YF 4ZIRB 4CKEA 2YCLA 4FFSA 2XCAA 4CT5A 5KOHB 5F35A 3GUHA 3IVMA 1UC8A 4YJKA 4M60A 1DC8A 1RM5A 4DIKA 3BREA 2UUBH 4X7BA 3FOAA 3C0FB 3RRZA 3TKAA 2A9JA 5IJZA 4ECYA 1VRCA 4QQNA 4BP9A 3KOZA 2VJPA 3ZU5A 1HDIA 3LDHA 4BMPB 4J4HA 4MV9A 2BVNA 2PANA 5EDWA 1JHOA 4CKZA 3UJDA 4MUGA 4HQFA 3HRIA 2WVAA 1WUYA 1LBEA 2BEVA 4N7MA 4JCCA 1R9JA 1JT2A 1CRZA 2PHZA 1P1IA 5HG0A 1MBZA 2ZKLA 4TS3A 4ESEA 4PVDA 4WBNB 4FJ2A 4Q4CA 1EYZA 4ECQA 2FMTA 4YCDA 2RMKA 4RY8A 2WE6A 1YA8A 2WT4A 1S8NA 3KHRA 3U5ZB 3WRYA 1QFYA 4BNLA 4DUZB 2F62A 1P4SA 1G2IA 5KU1A 4WKPA 3FTPA 3DO8A 2QPAA 1AVTA 3T5TA 4GGMX 4IV0A 3JZDA 1UJ2A 2B4TO 1PWXA 4LV8B 1OYWA 2BFBB 2ZM6B 1SCNE 2VZ0A 2AE2A 1WVIA 4IWYA 5A71A 1VKHA 2CFOA 3ZU3A 3PFBA 4TKUA 5BRJA 3SE7A 1H23A 3OOHA 1OBCA 4EA8A 2XTNA 4LCBA 2FFJA 2XB8A 3HU2A 4NPCA 2RGUA 2VA3A 2RBEA 3KTDA 1PGPA 1OI4A 5DASA 3EVFA 1QHXA 4GO1A 4LYEA 3PIRA 1XTRA 3PDJA 1SUBA 3DB1A 5F2NA 1MT3A 2M1XA 1V5EA 1DC4A 3A4LA 4F5ZA 4P2GA 2ZI6A 3T7RA 5KNBH 3DOEA 3DAHA 3MRVA 2G4LA 2Y0PA 1GZUA 3D7MA 1Z82A 1J5EH 2WZQA 4JLVA 3ISVA 2FR1A 1ST3A 3BJIC 2CY0A 3SZOA 5JJIA 4LY3A 3OOJA 1GGHA 1RAHA 2QJOA 2WYVA 1F1JA 3B38A 2H16A 4B6OA 3TLGB 1JJBA 1J23A 4LG1A 1XAGA 5B3KA 1VSUA 2J45A 4U9HS 2E85A 4Q1DA 1Q5PA 2GM4A 3OPYI 2BDUA 4F2HA 1U0EA 3OCUA 1ZP6A 2PGOA 1W9HA 3QNWA 5IJ9B 3IIJA 3EEQA 3PJGA 5ALLA 1ZIYA 1SUWA 1K2WA 1E1MA 1BROA 3DE5X 1XO1A 3ON5A 3P4YA 2IHNA 4TTIA 2VRCA 4QGSA 2W6CX 3VNQA 2CBGA 3NTLA 1YOVB 3WNDA 2Y0SE 1H4SA 2A1HA 4YT5A 5DF1A 4V0OA 1D5CA 1SA0A 3WRXC 2AQHA 2JI9A 1I3LA 4Q3DA 1DJOA 5IVKA 3K05A 3DHVA 3T35A 1E2EA 4BNVA 2G72A 3KJHA 4XYGA 5B6PA 4GLJA 3QXXA 4O7YA 4KWTA 2J0UB 2ZJ1A 2R6JA 3JATA 1BWSA 3QVOA 1KRWA 4A3JG 1C3VA 1II0A 2Q7OE 1RQGA 1P1JA 3LVQE 3F8WA 3I4NG 2WTXA 1XR3A 1KQOA 4MKGA 5TQ0B 4JT4A 3KLBA 1T10A 4W1SA 2BFEB 4D43A 2J87A 1JIKA 1AKWA 4HQNA 4B83A 1ZRSA 1UBTS 5JRJA 1XZKA 2BP7B 5F1PA 1CG6A 3VSAA 1PSDA 4NE7A 5EP1A 4YMGA 4KUHA 3ZCQA 2PS1A 4TTTS 2H3HA 3IQWA 3T0IA 1A8IA 1YQ9A 5CBPB 4QWEA 5AM1A 2HRRA 1USGA 2H1SA 3QP9A 1D2AA 1C1DA 4QUGA 5CJJA 1MZPA 3AEQB 1J1IA 3WLMA 1BIFA 4Q12A 2Q6KA 3JWJA 1ZGZA 3H1FA 5IANA 3TZHA 3O94A 2XOEA 2AVDA 4XJXA 3ILVA 2CWDA 4LYAA 1MRSA 5J2UF 2C9MA 5HYVA 4GPZA 5IF9A 4LXHA 3K0BA 3EUWA 3FDXA 3NPAA 4CF7A 5CAEB 2HSZA 1I0LA 1KO4A 3N2EA 3Q9LA 3EGIA 1PQUA 2LIVA 4GXRA 3EGXA 5BN3A 4YCLA 3WBKA 4IJVA 2OGSA 5JMPA 2WK1A 4L8VA 2XF2A 4CEIA 3ANLA 2W2XA 3V8RA 4TXHA 4QSHA 4UTPA 3K0AB 1K4YA 4BY1G 4RTJA 3FMOB 3WLJA 4MP8A 2Y71A 5TMPA 3MF4A 3VI3B 2PL3A 3JQBC 4LGMA 3P9SA 4V1CI 1UFRA 3PNKA 3E7XA 3N2YA 2CNWA 1FYXA 4L4ZA 4AFNA 1L5OA 2LW7A 4OKSA 1LTKA 1SCUB 2EFDB 1KH3A 1W19A 1VE3A 2LCFA 4WJLA 2QRHA 1RRKA 5K3SA 2WI8A 4L95C 3QFSA 1FDOA 1Y8QA 2JA8G 3VV3A 2I6SA 1ORHA 2KMLA 3QX3A 1GADO 1A0IA 4L28A 3RI3A 3T3EA 2E18A 1X80B 2I7TA 3GK3A 3E61A 4EL0A 4Z0HO 4H6WA 3REGA 5JNSA 3FGZA 1DV2A 4QOHA 3DUWA 4JL6A 4PPNA 3JQ9C 1T0PA 3WKDA 5TNXA 4LF6B 4IZ6A 4TQUS 2OCDA 4QX6A 4KIGA 3D6UA 2GZDA 2Q2VA 3K7EA 4NQZA 2ZQZA 1RC8A 3I83A 1BGWA 1IM5A 3GELA 3N74A 5K3AA 1YZ3A 2HSGA 3RQIA 2QL5A 4AJ2A 4JH0A 1XZEA 1AZWA 2P6PA 2G40A 5EMHA 3RVBA 2ZAGA 1CUWA 4ZDJA 3AHGA 3P0RA 2RGCA 4QARA 1UWLA 4M9CA 3RFVA 3M4ZA 3GPCA 4OVKA 1M83A 3IHLA 1RLOA 1K7YA 2TMGA 2WD8A 5K3FB 1T6BY 1S1CA 2G17A 1RI1A 4LRTB 5JATA 4U2DA 1IUKA 3AF4A 4EITA 2RFLA 3LXMA 1QYVA 3SQLA 5GP1A 4BX0A 4E09A 4WUVA 4WVLA 3K2IA 1MB9A 3I1IA 1REQB 1SHLA 3MWKA 3GH1A 3OU2A 4WEOA 2OQVA 1E6LA 1IEQA 4FD3A 1X1CA 1FJ2A 3QXCA 2G82A 1G5PA 3N70A 3KUKA 2Q5IA 1N8TA 4F5EA 1TIKA 4OBWA 4EARA 2UKDA 3BFKA 3RNOA 3FBTA 1R8QA 2C8KA 3OECA 4MKZA 1U6IA 3WA7A 1QIFA 4DUGA 5H0IA 4HDKA 3KLNA 5B53A 4F8EA 4F7WA 2I6UA 2EHJA 4NYIR 3BHMA 1NMYA 4U5QA 3K9BA 4J0DA 5KG3A 4NEQA 1XROA 3TIFA 4URXR 3HCFA 4G5HA 2BGJA 4GXNA 3CGGA 2WAOA 5D7BA 2X6QA 3H9CA 2JGDA 5G2OA 3RVJA 5CM8B 4Q8FA 3Q1LA 3UMMA 2VHWA 1NKTA 2XTZA 3SIXA 1Y1SA 3FSEA 2WTNA 4BQOA 3ITEA 4IY1A 1MB4A 3TOZA 2BGRA 1XVAA 3AY0A 4FZRA 1P81A 2Q5EA 3RNLA 1C29B 4MARA 2FG6C 3BIJA 4C7XA 1TC1A 4ZAWA 4W82A 1D07A 3QGMA 1VI6A 4KBGA 3L82B 3WDMA 2XI4A 4FIDA 1QH1A 3NIWA 1RMTA 4AS2A 1PKXA 3F6CA 1W6UA 2CYAA 3SNKA 4R5MA 5HQ3A 4EY6A 2Y6UA 1VJCA 3R7AA 1A27A 3JARA 2VHTA 2XE8A 2XVMA 1WCYA 2O5RA 2RHTA 4B40A 3AUTA 1J8FA 2VPQA 5CNKA 1JT9A 5IKOA 4J2HA 1ST2A 5T4EA 1J9EA 5AICA 3KQOA 1OH7A 4JY7A 1VJDA 4ED1A 1N2HA 2X4DA 3NC0B 1OT5A 4NPHA 2OAP1 2VH2A 1HYBA 3T52A 4CU5A 1HQYE 3U4QA 4A5OA 3KLOA 4EPYA 5ULLA 3E6AA 2DPLA 2IUTA 3IC5A 5TMEA 2Y76A 2PO5A 1V6SA 3FNRA 1UT5A 1FTYA 1OXKB 1DQNA 4HATA 5C51B 1WA5A 1Q7EA 4PC1A 4D8XA 3WWHA 1BXZA 3FIUA 1PNTA 5DK6A 3HZRA 5FULA 3NKFA 2PLRA 5TQJA 5AKJA 2VQFH 2YVUA 3LVRE 2W7OA 3G68A 2C20A 3IB3A 2IT1A 3KT3A 1VDZA 4YRAA 3GOHA 1C0LA 1IUOA 1QVAA 5HIKA 5KB3A 2R87A 4C7JA 4M9ZA 2EDCA 3HYCA 4M4SA 1MIOB 3NTXA 1A82A 3RDPA 4KQ2A 2IPOA 3I9MA 3IP8A 5EXPA 3CKLA 5KT3A 1H6DA 4M1QA 1LH0A 4NBKA 3PX7A 4YAJB 2JJ1D 3LT2A 4KO2S 4MRSA 1GR0A 4FOOA 3UXMA 1H3FA 3A8TA 2Y1DA 1OLSA 2QL7A 1R0KA 3GVXA 2R8KA 1P1KA 5GPBA 3L0CA 1X8KA 4HVTA 1AS3A 3KQMA 4BFYA 3P1JA 1J4AA 2RHWA 5A7FA 2WJYA 2P62A 4FE2A 1TYDE 3CU5A 3W2GA 3DEIA 2GN1A 4ZCTA 2O23A 1HE1C 2GQSA 4F4FA 3W06A 3SZGA 1U3FA 1O5TA 1OX6A 3HCCA 3L7DA 2VBCA 1O0CA 3KSUA 1VE7A 3NRCA 5DP2A 4D3SA 1F06A 4ERXA 1U8FO 5BR1A 4LS3A 3VC3A 1WB4A 1GIAA 2IA6A 3AHEA 1SXHA 1CFJA 3PD1A 4G67A 2JJYA 3N6XA 4TTPA 5CK5A 3A4VA 2QE7D 5BQPA 2X86A 5LIRA 1NT4A 2IE8A 2I78A 4WY8A 2XXBA 3IP1A 1XDNA 5A05A 3FAKA 1Q12A 3MWFA 1SCAA 4DV4B 3ZZ1A 1OY1A 1C7ZA 2OESA 4G5XA 1S7CA 4Q18A 3IKVA 1E9DA 3AUUA 1W1UA 4L7VA 3Q85A 1UXIA 1WH2A 2WHQA 4Z4IA 3H0GG 5KVQA 3NBYB 1G63A 2PJDA 1LLFA 4H6PA 5E7QA 4CKWB 5TQ2A 4X91A 5E4YA 3DXZA 2V7EA 4IIVA 5ALUA 2OA0A 1YQUA 1QO9A 3KKZA 1IYEA 8ATCA 4A3BG 2FFQA 1ZNQO 4ANFA 4XE5A 2Z5VA 2KJQA 2W2KA 5MFPA 1GDHA 4AY5A 3D2LA 1XNQH 3AUAA 1U5BB 4NCHA 3GPDG 4GSYA 2I4LA 1R8YA 3PC7A 2ZWVA 5LKRA 5K6AC 4TMWA 4UMEA 3VZPA 4GLBA 3FMAA 5IC4A 3GLSA 2WUWE 4C4PA 3STWA 1SQSA 5CRIA 4ZYLA 1TDJA 1G2WA 4IOKA 4TM7A 2FRVA 2JBAB 2GCGA 1M76A 2QNRA 2VJBA 1CWUA 4HYKA 2RK6A 3SJBA 1E5DA 3OOSA 4REMA 5IDXA 4LY9A 2EGUA 5BNIA 1E92A 5F7XA 1W6RA 4NS4A 4EGFA 3A1UA 4OXXA 2H8GA 2XB6A 1AMNA 5BWVA 2JLQA 1Q0SA 4Q4HB 2ZYVX 1I1HA 4R1NA 2WMNB 3JWGA 4RTNA 1UXKA 4W6QA 2O2HA 1GWNA 5FD6A 4OHUA 1M6VB 4F4HA 4V03A 3LQKA 4AB1A 2YC4C 1Q22A 3NYIA 3T7KA 5JOQA 4RUCA 4M1TA 3CNHA 5G4LA 3UJCA 4YIKA 1HR0B 4XGQA 2DUJA 2PSSA 1TZJA 3EIOA 3VO2A 5E8JA 3O3NB 1YJBA 2QLTA 1GU7A 3F73A 4RNMA 4DA4A 4PGMA 1U2GA 2YWJA 3G0GA 4N18A 3H97A 5JVDF 4J90A 5CFOA 3IVXA 3WSVA 4HEHA 3N75A 5AHKA 2RGBA 4AN1A 3ZY5A 4E5SA 3E7WA 2GH1A 4CLEA 2UXDB 5ES3A 4W99A 2WSSA 1E99A 2NP7A 1HNWB 4NENA 2HF2A 2GPNA 1C3XA 3K9NA 2QGZA 3CRZA 3K0FA 2PX5A 4H15A 4GDMA 2GFQA 4UPVA 2NQ2C 3NHYA 5CEEA 3ITNA 2HA2A 3GUZA 4GI2A 3MTQA 3QUBA 1EG2A 1KGSA 1IN5A 3CUSA 4DNQA 3MERA 1FTNA 2QR3A 3IMEA 3WQRA 1LSOA 4MA4A 4OAQA 1YZYA 4LI0A 2AK3A 3NB0A 4LDZA 4OF4A 1I6UA 3QFRA 5IBCA 2DY1A 1KJ9A 1D4OA 2YXDA 2XR1A 1RQXA 1JKFA 3CEAA 1Q50A 4ZKDA 2ZWPA 4WXMA 1HH4A 1CETA 2ZZMA 2YZGA 1FB5A 1JIIA 3BQ9A 1ENYA 5AVQA 5LQAA 1YAJA 4G5QA 1U0NA 3BGIA 3BTVA 3PG5A 1C30A 2ZR0A 1HV8A 4HUJA 5JSYA 2IHVA 3FNBA 1XV5A 3M6WA 1KYXA 4QVKA 1ZJ5A 2VP0A 2C2KA 4AZSA 1M1NA 4PZLA 4UNRA 1TFUA 1G18A 4B0OA 1JG6A 4RLSA 5KTOA 2EKLA 5ITVA 1F60A 1NBMD 3W8DA 5C5JA 3DDWA 1YA4A 4OU5A 3COWA 4WZAA 2GUGA 1FMTA 4JLPA 1T36A 4HDMB 3LX4A 1YC5A 2WF9A 1A98A 1EU1A 1PNVA 2IBMA 4CF3A 5DQIA 3RC1A 3UGTA 3L84A 1XVTA 2G1PA 1KZGB 1XCLA 1ZH2A 3U7JA 2QY9A 4P08A 4QPJC 3HTXA 1E0KA 3DHEA 4IR7A 1STOA 1WV1A 3NUQA 4UUQA 2C8LA 2VTDA 1THMA 3JQFA 3LULA 4ZVKA 3UJAA 3PI6A 1WQ1R 1XP5A 4I0WB 3BL5A 4CQMD 2ZJ8A 2OH2A 2HVRA 3AF6A 4GOKA 2ZE8A 4ECXA 3O2JA 4R4JA 2O2IA 1ISJA 3ONFA 4TQ9A 4KDEA 2QTLA 3J7AK 5EKTA 2X15A 2QZ9A 3MWMA 3EPPA 4ZQCB 1S3GA 1NU8A 3B9PA 4A6PA 3Q11A 3WYGA 3ENKA 2PBFA 1P33A 3WMRA 4CCYB 1F6DA 3ACCA 4MYSA 4O5AA 2FQWA 4YPVA 4APMA 1Q3TA 1ICIA 1LZKA 5JJ5A 4X93A 2EJUA 3HGMA 1T15A 1TKCA 4QDXA 1O6FA 1U0FA 3GTLA 5ALWA 3IGFA 1WCMG 4YT2A 4L2IB 4I6JA 1E0DA 4NULA 2OZVA 2JA2A 2FSVC 4XEHA 3T3MB 3SQMA 1I2BA 4R8UA 4YASA 4CQNA 2PFKA 1ZAKA 1K6EA 1L5MA 4O7VA 4K9NA 1ZJWA 1Q0QA 1NVVR 2PV7A 3GT0A 2OENG 4TUYA 3PN1A 4CMHA 4Y2RA 1BJKA 5DTIA 4WMLA 4X44A 3FFXA 4N0DA 4LFBB 2YS6A 1ZRNA 4ZO8A 1G41A 1XRMA 4YRTA 1YVEI 4L73A 4NDAA 1GCIA 5DCYA 5CVVA 1ZNZA 4TXMA 2QUJA 1U9IC 1IY0A 5AI4A 2AUTA 1R12A 4OUDA 3GAAA 1KI2A 2MSKA 3C0KA 5KSWB 3B51X 2GBGA 2X5JO 5HX7A 4PFKA 4KPFC 4EPXA 1F7VA 1TJYA 3BFVA 4ENPA 1PHRA 4E5MA 4KE7A 1MG0A 1E9AA 2J31A 1NL3A 1VDMA 1V1MA 3LOQA 5JC8A 1OW3B 3L0SA 4GZ3A 3ZZTA 3TLJA 1FSZA 3OG9A 2VYNA 2VQEB 1ZOSA 1YBVA 2JA7A 1Z88A 4KN6A 2BJVA 1QQ6A 5I8PA 4UHKA 1SBHA 3C3JA 1EM8B 4LSAA 5CVDA 1SUAA 4JUAA 2WPNA 2D0DA 1GL9B 4UTOA 2DMRA 1MRNA 2BUCA 2O0JA 4X62H 4C07A 3EXHC 3AZPA 4D9EA 1J49A 5LU8A 5C3UA 3RUDA 4JI5H 3HFJA 3HACA 1QG2A 2Y68A 3AR5A 2VH1A 2HY7A 3FNQA 4RWEA 4AMVA 4QASA 1U7WA 3SGLA 3PEYA 1YBHA 4UD6A 3IODA 4Y6SA 2ANCA 3LECA 1TQ2A 4X54A 3SPXA 5JADA 1KSGA 2I4NA 1TGVA 3INNA 4IFTA 4PV7A 3TSYA 1UQTA 3I6YA 4E32A 1XDBA 2X1HA 1B0UA 1MCZA 2WIDA 5KYXA 2ZSFA 1UBFA 4R9NA 4F45A 1Y14B 4G5YA 3MT7A 4KH0A 4M3NA 1A7KA 2AOTB 5D1HA 5H82A 5BNFA 3B6MA 3LY8A 1QYXA 1FFYA 3IB6A 3BH6A 4RE6A 3KB8A 4ZEOA 3UWPA 3TL2A 4OAPA 5I4IA 4K9KA 4DG5A 1JMYA 3MUFA 2A0FA 4ER7A 3SAJA 5I9LA 2WILA 3FTFA 1HDRA 3CZ5A 5A02A 5JAUA 5B1HA 2H5JA 2JI4A 1UPUA 2BGGA 3WNZA 5HSGA 1OKKA 3NRJA 3CNEA 5D8DA 3NX4A 5JJKA 1PBNA 3SHVA 4DKXA 4PONA 4XZ3A 2O6HA 3CLTD 1NW6A 4F72A 3D8UA 3GA5A 1XCGB 1NBIA 3OQVA 2GZHA 2GEDA 2Q46A 4Q39A 2R8RA 3QVKA 1T3TA 2D74A 2YHAA 3HWWA 3E9EA 3EAQA 1VSTA 1R6TA 3JYQA 4QRHA 1ZC4A 2ZB3A 4WT7A 2QPOA 5LA6B 5EIBC 2XVYA 2XUZA 1MIHA 2W37A 1PZFA 3L40A 4P58A 2A67A 1Y9JA 4LRUA 1LS1A 5L40A 2BEWA 4MW9A 5L95A 5DLYA 4FM9A 2IP4A 4DLNA 2EW2A 1NMEA 5LZ4A 1EJBA 4P7FA 1SWVA 3IDZA 4PZUA 2DU8A 3USES 1OTXA 2TMYA 3U1BA 4A0GA 3QU4A 3IDSA 4F6LA 2Y2VA 4BZXA 4XSHA 4WESA 3HR8A 1ZHSA 1SXJC 3R0JA 1FVHA 1BEUB 3H7IA 1Z34A 1Z36A 4C7OB 2XE6A 2E55A 1BVUA 4BGVA 3BTUA 1I24A 1N5OX 3OUZA 1YZNA 3OKCA 5E8RA 5AUPB 4Q7LA 2JFWA 4QSMA 1KP3A 2CW8A 3FJ1A 3E2IA 1RWVA 5KQMA 2B4YA 3N7UA 3X1DA 2A9KA 1BVRA 5FWDA 4AURA 3PUHA 3SF8B 1EKVA 3CVVA 3FTNA 4P7JA 2R79A 2HL6A 3DBHB 4M37A 4M36A 4L76A 5EQTA 4FCCA 3LQ1A 2NV0A 4IDBA 2CNQA 2QTTA 4Q9DA 2H1RA 4H7DA 5TMBA 3MBOA 4ZOLF 4FC6A 4DFDA 4Q45A 3TNFA 2XNDA 4IOJA 3PT9A 3BJEA 4OP3A 3UAXA 1W4AA 1CP3A 3ED1A 1XZJA 3KDSE 3V1UA 3ORYA 3RWMB 4I81A 3EWAA 2V5VA 1EE9A 1N2SA 4D8VA 3HB1A 1M54A 3UK7A 1O2DA 5AMXA 4D4KA 3PNOA 3WLTA 2JAOA 3NV9A 3S70A 3CVYA 1KC1A 1AKVA 4HNGA 4KPUA 3RF7A 4PZZA 3E8SA 3ZXYA 3WBFA 2HQBA 1DXHA 4D82A 2HDKA 4QVIA 1EVLA 4II3A 4B35A 1PJCA 4D4HA 4FWBA 3B8EA 4IL5A 1OF1A 2JFFA 1UXOA 4R81A 4QTYA 3MWEB 1WNFA 2XUFA 1T9BA 1CUJA 2Y0BA 3DPSA 2W6PA 3HGQA 2O0MA 1E1KA 1V47A 2WE7A 3UT0A 2E2WA 4JFAA 3CKYA 1TCUA 2AHRA 3M6AA 4LSWA 2HLNA 1OB2A 4FS8A 1TKBA 4ROTA 2BHSA 5J4HA 1B6RA 2I2AA 2FV8A 1PW5A 5TB5A 3RR5A 2HK6A 2ORVA 3GIPA 1Z33A 3C3XA 2LWIA 3LM8A 3NHPA 4RABA 2WWIA 3V7FA 3VYSB 1D7AA 1MNQA 1RWNA 2C2GA 2B69A 4TYQA 3O2SB 5LIPA 5EZQA 2B9EA 4QBTA 3U3KA 4YROA 5GONB 1QAOA 4EW2A 2OHJA 4QQFA 4D0LB 1FY2A 1RBZA 1ABEA 1NYRA 2DLDA 3SU8A 4Y30A 2BMJA 4ZRMA 2ZJ3A 4C30A 1TYEB 4PBRA 2QLFA 1Q1GA 3W77A 5JCXA 4DWJA 2J1LA 5I4CA 2O48X 1XN1A 3EULA 2I3DA 3L18A 3WAKA 4FC7A 1E4YA 5A3VA 4O2AA 1A5TA 2ETXA 4R71A 2JEYA 4G0PA 1TWGA 5KS2A 1P7WA 3LGXA 3N2NA 3FZEA 4PLTA 4DC9A 1K89A 3QOYA 1SQFA 3IRUA 3WLSA 3L4JA 2PH5A 3G1WA 5I7WA 2ZUCA 4JJIA 4HN2A 4J0JA 1FFHA 3B6KA 4BNDB 3H19A 2XYHA 2AVNA 3IEMA 1OBHA 2FW6A 4KTTE 5JJBA 1JDPA 1NR1A 1AH2A 1C2YA 5JFTA 2G0NA 4PO3X 3MMZA 4BTLA 1ZI8A 1CRLA 3TL3A 1QPBA 2J6CA 4JBHA 2R8GA 3B6IA 2YZKA 2JASA 4TV8A 1A88A 2DFTA 2BMWA 2CNKA 2ZSKA 1L2TA 5AXAA 1UMBB 2CHGA 4QYSA 4BNWA 1Z2PX 2GAFA 1OWLA 2OQRA 2VWPA 5T4BA 4F84A 5L9XA 3B6EA 3R44A 3T1TA 1EBBA 1AIPA 4JITA 1GILA 1P2GA 4LDRA 3I6IA 3R7BA 4AJJA 5BW5A 2GHIA 2NT4A 1Z0KA 2O5CA 1A1SA 3BHNA 4U7TB 1KTAA 1HMYA 3PNPA 4KX5A 5AI5A 2FZVA 3Q9SA 1EWTA 2AFIA 4WZBA 5FLMG 3RS5A 4KL8S 2ZI4A 1DKLA 5JNRA 1EFRD 3T1YB 2HIXA 4N0MA 2V65A 3IMCA 2GN6A 4GYJA 2PX2A 1NRJB 3WP1B 2NSDA 3VR3A 5CK4A 3G2KA 4NQRA 3F4KA 4CMKA 3VO8A 1JECA 1M2FA 2BR3A 3DMRA 4MJXA 1TMKA 1AKUA 4EYOA 2C57A 3GARA 3F5MA 1Y1QA 4DPKA 2NO9A 1KWKA 2FHSA 3P8ZA 5JZOA 4O3PA 1UEXC 1XJQA 2LUOA 1T4GA 5BWMA 2DRIA 1CZLA 4DBLE 4MAMA 3OQJA 2OD2A 2UU9H 2VPTA 3FDJA 4ZJUA 4O33A 3EY9A 1WHTA 4LJ4A 2WINI 3C3YA 2NX2A 2E5WA 4S1VA 1M2GA 4HSEA 6YASA 3AI1A 4FUQA 1XZHA 3RR2A 2X5XA 1JEJA 4V0RA 4DCOA 3ZJ4A 2V9CA 4N7BA 2YFQA 3HUEA 1OH6A 3G49A 1Q0LA 2V7XA 4U00A 1U81A 3CX3A 4OYYA 2ZJ0A 4QDJA 5BVGA 4X65H 3LNCA 2YQ4A 4M1ZA 1ZAUA 2H63A 4N41A 4F96A 4FYKA 2AKAB 2JGAA 3QBJA 1N2CA 2JDIA 5A03A 4HOYA 1DIAA 1G9SA 3HNRA 2X5OA 1RYFA 1B8NA 4EF5A 1U1FA 2EJVA 2RBGA 2ECQA 4G2TA 4UNQA 1CJUC 3PFHA 1JMKC 4D4MA 1LFDB 4OHXA 3SSNA 3QF4A 3VNRA 3JQAB 4S1TA 1QAQA 4NLLA 1Z6PA 1UBMS 3KRTA 4QIWE 5FRDA 5T3UA 1T2FA 4URFA 4L3OA 9GPBA 2AJLI 3GP8A 2WAQA 3GEHA 1OFVA 5IG2A 3MCVA 1QH0A 5LLSA 3E9QA 4MSUA 1HTBA 1RYNA 3HB4X 3L79A 2MU1A 4YAIA 2HRQA 4MDFA 3F90A 1Z5NA 1EVJA 4HAUA 5A6VA 1H22A 4QLOA 4HY3A 4Q9IA 1UKZA 2W9BB 1J21A 2BH2A 1OXTA 5H81A 4TZ0A 2N46A 4K9RA 4F4JA 2I7DA 2REBA 3RGWS 1G8JA 3KL2A 5BRNA 1XYYA 4J9LA 4DSUA 4MAAA 3HXKA 1NZDA 2R48A 4P3OA 4AQYB 5CLQA 2QF7A 1JHQA 3IE2A 1BVYF 1TQ4A 3B1ZA 3L7KA 3JVIA 3DZ8A 4MVXA 4MLDA 3UOAB 2A88A 3F7TA 3EYWA 3RTCA 3ORQA 1ZXLA 4NJEA 4E94A 2O8DB 1G3IA 5FA8A 3QOWA 4YMVA 5FLYA 4BDSA 1TM1E 5KO2A 4D02A 3IIKA 2IUYA 4FT2A 1G2OA 3ZNQA 1FYWA 4KCGA 1PN3A 2JLSA 2AF4C 1M7BA 4ZI2A 3WL5A 1HQKA 2CLLB 2FPXA 3BGWA 3DVAA 1IMJA 3AU9A 3DV9A 3A25A 4ER0A 3RYTC 2JHCA 4PLCA 4KACA 3DT8A 2MSWA 3SOZA 4M86A 4PS0A 1J0BA 2GILA 1M0SA 2NVUB 3T5MA 1XRJA 4ZJZA 2QPTA 1JVBA 4LJ6A 2HG8A 2LV8A 3F96A 1C4WA 3JX9A 4CLRB 1MLDA 5SY4A 4EGAA 4HNSA 1VLLA 3VYUB 4CTNA 4E5KA 1IPEA 4QFDA 5M04A 2LPMA 2XRZA 2HCRA 5CHYA 4BX2A 3B3JA 2OCAA 1OBDA 1N7JA 1JDNA 4DABA 1FMFA 4UTRA 4D9FA 1YHZA 1GVHA 4F9TA 3UV3A 1UKBA 1KR2A 2O5VA 3QUTA 3SBEA 3UW1A 3P7MA 5KMGB 4O82A 4TYWA 4I2NA 3R7DA 3H2KA 1HNZB 1YASA 3HKBB 3DMYA 4UTNA 3G5UA 4NKRA 3FYUA 2BKEA 1XMOH 1CLEA 4JVSB 4N03A 1WV0A 1VBKA 3I05A 4CKBA 1FRZA 3S2IA 4Q24A 5B58C 4E2XA 2NU7B 4BV9A 1WE2A 2BR0A 4GMDA 1VG1A 1UBNA 4KGVA 1TM7E 4JUZA 4WNAB 4K9QA 1H2YA 1BX3A 2PGNA 3C97A 5DM2A 1CHDA 2AD5A 3LY5A 5AKKA 3Q8SB 3F8TA 1GGMA 1YR8A 3LC0A 1EK6A 4D4GA 2ZG6A 5H4GA 3MYRA 2Z3WA 4PU0A 5DN9A 2MSCB 4RL4A 4ZYTA 1KQ3A 1M67A 4N40A 3PFIA 3UYLA 1V1RB 1QIGA 5HIJA 4TQRA 1N1GA 4IIEA 4M99A 3BULA 4H4DA 3KOOA 3SFZA 1KJZA 4O59O 4E07A 1J2UA 2XGSA 2H1HA 3DV2A 1ZD9A 5KFZA 1HMPA 1N57A 2VEOA 2J0SA 1XRSB 3FLMA 2FWAA 5FNVB 5EHIA 2Q6OA 3CX6A 3GUVA 5GJWC 4FGUA 1N34H 1QHYA 3UMVA 1RJPA 3O8NA 1GZ4A 5B12A 5L4LA 3H8WA 4U1RA 1P2TA 1FFWA 4AAYA 1W48A 3RSHA 1D7OA 3AOEC 5JW6A 1FLDA 2PUGA 4OQNA 1TW3A 4Z2AA 3P2JA 4ENTA 3K0CA 5HOQA 4IO0A 1O94A 4QHSA 2I3GA 3WJAA 4DL9A 1KOGA 1I33A 2UUPA 3PWSA 4PAOA 1UKYA 1KSHA 3ODPA 5LQCA 1PG2A 4QQ8A 4ZJPA 4IXTA 4DV1H 3F6PA 5IASA 2UXCH 2QORA 1WXFA 4CLHA 5JCPA 5IP9G 3CKMA 3ETHA 4II2A 3WJ2A 5CFMA 4GU5A 3DEZA 3QKWA 1MC1A 5JLJA 1MAAA 1KF0A 1YCGA 2JJ2A 5C7OO 3CF4G 4KLZA 3BABA 3MM4A 3ESBA 2X8JB 2VXBA 2NNWB 4JXJA 4J0CA 3H1TA 3W9UA 6CHYA 4F2GA 1U0OC 2WSMA 1G8MA 3LPCA 2F55A 1DBVO 4N5HX 4QUBA 2O3SA 4KWIA 4RJTA 1A8PA 3GTMA 6LDHA 4EUFA 1ODTC 3V1TC 1Z62A 4D6XA 3S4YA 1K3UB 1E2NA 4RS3A 1U3TA 4JOSA 1SELA 2YJNA 4CLOA 4BLSA 4B3HA 4YDHB 4ED2A 5DSZA 5EC8A 4QFBA 3JXEA 4EFEA 3MXTA 4FFBA 3C16C 4UPDA 4QE3A 1NQOA 1E98A 1NTOA 1IN1A 1KDTA 4A82A 5EE3A 1NXVA 5KYYA 1M0TA 3VYTB 3ULKA 5JXJA 3N8GA 3D81A 3DTYA 1SC6A 4EFLA 3AEUA 1VHTA 4R8KA 4D9CA 5EIHA 4J0GA 4KR2A 4XRGA 4AP9A 1JR2A 2BTEA 3BE6A 5DWDA 4TS4A 4QEDA 3O1JC 1TUBA 2XCQA 2GQ0A 4OK3A 1CQXA 1H5QA 4QC2A 1NE2A 2C9ZA 2W42A 1Y82A 1O77A 2V7UA 5FOSA 3EGCA 1Z08A 4GZ5A 4S24A 1T2DA 4NH0A 2A0XA 4EKEA 3RAQA 3KKNA 1EVQA 3ADCA 1J07A 3WLFA 2IX3A 4DKJA 2WHPA 5D5QA 3TO5A 2X7XA 4ZD6A 3A3PA 1G8SA 1LQ2A 4I4NA 2IOFA 4YR7A 1NX6A 4OJKA 3OIVA 4C0KA 1U0GA 3FPJA 4TWJA 4GWGA 3AJ8A 4EA9A 4YMUA 5ALSA 3WX0A 3G13A 4IKOA 1M1YA 3GR6A 3MOSA 3NHRA 1FEZA 4JLJA 2VRCD 3O75A 2NO5A 2PWAA 3SI7A 2FWMX 1O97D 4IS3A 4QZVA 5DGHA 4YMTA 2I3AA 2QQGA 4FYVA 4C4YA 3T7DA 4JI7H 3KXIA 3FFBA 4EY3A 1E69A 4NYEA 2Z58A 4X5OA 4A26A 4W5RA 2ZYUX 3ESXA 3C43A 1ZLXA 1FU8A 5EJ5A 3HSYA 4NICA 3TX2A 5FEUA 1L9KA 5J2UA 4TMKA 3VR5H 2Y27A 2HNBA 4JR2A 1AN9A 2NZJA 2QMOA 3Q8WA 1VA4A 1DDOA 2WJVA 2YZMA 3IVRA 5T8KC 2XGQA 3GTOA 3A1CA 4E6PA 1SBZA 2IHKA 1RKQA 1UDRA 5FOQA 3CISA 2Z4RA 1ZN9A 1JTEA 4JK3A 2BKXA 2YTZA 3NMUF 1MR3F 3QVJA 5IFLA 2IH4A 4PLWA 1WDLA 1LDBA 4NPAA 5HRAA 3DD1A 4C2TA 1RW4A 1LQTA 4IVPA 7ADHA 3OTQA 3VMFA 3GL9A 4QT0A 4RIFA 1X7WA 1Y0BA 1AHHA 2C35B 4F5DA 5BMVF 2IK8A 2V0GA 3GUYA 1QOZA 4RLQA 1DHTA 3FLBA 1ZICA 4K9SA 3R8FA 3DMNA 3I5AA 1W5EA 1EFDN 3SC2B 4CR7A 3G0OA 2J6SA 4LC9A 5I7OA 1R6VA 2Q3BA 5DI9A 1KSJA 2COIA 3IJRA 5JCZA 1U7UA 4KRYA 3Q0EA 2HJHA 3GIQA 3BE5A 4MYDA 1OZGA 3DC7A 2OM2A 4JI2B 3IQEA 5DISB 3OF2A 1R0RE 2FSUA 2R66A 2N9UA 3IVCA 1N2GA 4L8WB 4HJRA 3TSAA 1E3SA 4K1LA 5HJ7A 4XSVA 4ICIA 1GOTA 1V16B 1GPUA 4AZ3B 3OQOA 4B73A 3PUWA 2FPPB 5HKOA 4B74A 5FL7A 3MT8A 2UYCA 2CKMA 2FSPA 3IUQA 2BTOA 5EYPA 2VUUA 1XLTC 4IR9A 4WTOA 5C31A 2OCXA 3D2BA 5L1KA 3AERA 3JR7A 2YWGA 2WAXA 4FDMA 4S2UA 3D3WA 1S2DA 4CMDA 3C39A 2RH5A 5KFHA 1NQAO 5BNZA 3CF2A 1N3BA 1S2MA 4DM7A 1JKJB 3EDCA 1W0KA 3SR4A 2CC2A 2CNWD 3COVA 1ILWA 5FOVA 3ZWMA 3EIUA 4MEAA 2HF8A 4C5CA 4Q1AA 4UBIA 2R7ZG 4BZWA 4XPZA 4KFRA 5ALXA 3HR7A 1N6LA 2P6OA 1UFVA 1SULA 3DR5A 3TTSA 1Z26A 2JAUA 2G9QA 5GJBA 1JLMA 2Q2OA 2HHAA 3U3RA 1EA5A 3WJ1A 1Y1WG 2ZBGA 3JRXA 1FUEA 5FXMA 4N7JA 1Z07A 4IJ5A 2XB9A 2V4UA 4PQFA 1L1FA 3ZBQA 1YT5A 1TEVA 2DBRA 4OJQA 4G5FA 1YDEA 5DSXA 1FTWA 1KC7A 1E3LA 1BE6A 3WADA 1IZ7A 4FOTA 3ACBA 3MRSA 2RKBA 2FWJA 1QF9A 4Y98A 4H7PA 4TL8A 1RVV1 3UY4A 1AB5A 2DFKB 3IRVA 1JJAA 2FZLA 2VUMG 1ZW1A 3PGJA 2X23A 2MCFA 4QTUB 4PZ6A 3RVNA 2BKAA 2PLWA 2JJMA 3BQ2A 4AT1A 5LP6B 1RYBA 3GJXB 2NO6A 1WMAA 1U7XA 4UQPA 4TXNA 4DT1A 1K8RA 3CLKA 4FMBB 4WKBA 2AX4A 4OI1A 1CEQA 5TVKA 1T0IA 1TT5A 2HHCA 3II6X 4RKEA 2E4XA 4AWBA 5TRTA 1RRPA 2PYIA 3M49A 4CN9A 3C6XA 5DBOA 4XX0A 1ISIA 1M33A 4JC0A 2NP6A 2DWPA 2GWHA 1NYQA 2O7NA 1FNBA 3DNFA 9ATCA 1XZCA 3AF2A 1PFWA 3K92A 1P0PA 4DUGD 5FL3A 1M66A 4XI9A 3G7NA 4TM8A 2HPVA 2BFDB 1M0EA 3A32A 2JGRA 5L4SA 5FV4A 3G1UA 3GLVA 1IPHA 3VPAA 4ZEVA 3USZA 1SXIA 3IBFA 4OI0A 4PGGA 1V35A 1M6EX 3HT5A 2KSQA 1IBMB 3HNOA 3BIOA 1FX0B 4Z3KA 2B2CA 2AC2A 4BL5A 1D1PA 3DPUA 4N12A 1PWEA 5JBQA 3IIEA 3G9ZA 2BEKA 5UKDA 1LVGA 1I0IA 5LDDC 2RBKA 2ZBPA 3DEHA 4CTJA 3IIIA 5I4BA 2QA5A 3FM9A 3TZCA 4TLBA 4BP1A 5J1TB 3EVAA 3T5HA 1QHIA 2B30A 3U37A 1X8LA 4UUPA 4XIFA 2KI5A 1IWPB 1NFFA 3IJEB 4H17A 1V37A 4Y2VA 4BDTA 2WPDA 4UEWA 2ZE6A 4BNYA 4KG7A 3M9LA 2X0SA 2IWHA 1NUUA 4D3ZA 4ZV7A 2R4QA 4YO7A 4PN3A 3OLXA 2GI4A 2YXPX 2AQIA 4EGCB 1SHKA 2J48A 4TSFA 5E25A 1SVOA 4LC1A 2Q4EA 4JB2A 3KBOA 3VHXA 4GEKA 5ENDA 4FUTA 3NYRA 2W98A 4K05A 1E1CA 4DL7A 4P4TA 2UVWA 2Q4BA 2HADA 3OJLA 4V2IA 2R6HA 2PS0A 2XZOA 1JQDA 3FI0A 2G1KA 5KG4A 4FYJA 5T64A 4B3RH 2GN9A 3MA0A 3PA8A 1WXHA 5LKAA 4A4DA 2OORC 2WRZA 5KKCA 3IURA 2V0CA 2I1VB 2HF7A 4I1UA 2WUDA 5DTQA 1VHDA 5IUKC 4IDQA 3BEDA 4RA9A 3KUUA 2AR7A 4DF3A 4G8BA 3E0XA 2RGNC 2VJMB 3O8BA 4YXWA 1VHLA 4X9XA 2ZAMA 3VR2A 5LOVF 4IDDA 1NW5A 1MW9X 1EX1A 1O87A 3V9PA 4BFTA 2AMYA 2PUAA 4NOJA 1T3NA 1YE3A 4BYGA 2ICAA 4GKAA 3BILA 3D4NA 1MT0A 1GNPA 2Y93A 4QDZA 1SCKA 1H65A 3DT6A 1J22A 5KOJA 5J4LA 1C7JA 4E7PA 1MRZA 4F4ZA 3K4PA 2OV3A 4WCFB 3VDNB 3CZRA 3O1IC 1NJ1A 1XYGA 2BQRA 2UYOA 2YKGA 1CUEA 4W1RA 3E4CA 4GMXA 2O2CA 1NMSA 1BMQA 4NBWA 3NTQA 1YDMA 1DJQA 3JD3A 1XI2A 4JB8A 4HK4A 3OEHA 5CA1F 3KSAC 1GGFA 3NVAA 3LMLA 1DAIA 2I4MA 2VAXA 1L8XA 3NHLA 1DUIA 1BDBA 1WUKS 5I7AA 4XLLA 4TKMA 3D4BA 3GLFE 2OPBA 3Q7TA 1DQPA 4J9OA 1GQOA 4E2WA 2V8BA 3IAHA 3LT1A 3OTOH 5IAAA 1HY3A 4OM8A 2OCPA 2GN8A 3M9MB 3GLHA 1NJSA 1WCV1 4A2AA 1HSOA 5ALTA 5I9NA 2WOOA 5IM4F 2B94A 2PSEA 2HMTA 2C9BA 4GKVA 1Z5UA 1YIDA 1P4AA 2Z09A 3BM5A 3W0LB 2ZR8A 1DU4A 5IYBG 1SN7A 3L4SO 4OEHA 1QLHA 4IIBA 5DRYA 3TW8B 4A6XA 3IVAA 4KQJA 1KJJA 4MIYA 2H7CA 4LF9B 1FUUA 3FJOA 4REQB 1IE3A 4ED0A 3WA6A 2FLNA 2PGDA 1ULHA 3ZHQA 4B3IA 4RHXA 1H1DA 2AOVA 2CLSA 2D5LA 2Q4RA 3KTAB 3V1LA 1DINA 3QX9A 1K7FB 3S3TA 3RVMA 4N8EA 4EUSA 2XYQA 3LIPA 3ROXA 4MWZA 1V0JA 3TGWA 3WDKA 3ETGA 5FP0A 2NNLD 3ZWBA 3K2BA 2DAAA 5LZ9A 1JSRA 4AJOA 1T2VA 1WXXA 1OV4A 2OV6A 1MAUA 4UVEA 2P5UA 4Q0MA 4BE4A 1E3QA 4FXOA 4HDNB 3J80W 2FR8A 1ORTA 4A8JA 5EXXA 3AH8A 3SVZA 3G6WA 2OSVA 1P45A 4P7KA 3OSPA 4HGRA 3EZNA 3A6LA 2ZUEA 2KW5A 1NVMB 5IP5A 3E8MA 2J5RA 4YJGB 3CNBA 3V8VA 2FYTA 5JVDA 4ZVSA 5FPOA 2IH5A 1ODCA 4H27A 3K9LA 5C52B 5EIOA 1TYBE 2Q1TA 1I5EA 3GAMA 3QVLA 3E0QA 3FDIA 2NLOA 4G07A 4DUPA 2QENA 2FJPA 2XCOA 2BSXA 5I5TA 3TR0A 3MGCA 3DAYA 4F3TA 4GM0A 4EYKA 4BLRA 1IEXA 3AVXA 3Q8RB 3RVQA 4AKSA 1Y9EA 3UICA 3RGZA 1A95A 4N3GA 3T1HH 1TFRA 1XDDA 4W1PA 2MHCA 3P71T 4W8OA 4M6WB 2TECE 1FRFS 4MRNA 2XWBF 3NVKI 5DGIA 2WLTA 1KFBB 5B64A 3CW9A 1FU7A 3KT6A 2JGLA 4IVQA 4BNUA 2NXJA 3A1FA 3QHAA 4IHKA 4EI8A 3O7MA 2F3UA 2O1WA 3AQIA 2YZ7A 4CG3A 2CV1A 5DZSA 1WVMA 4LYDA 5GVSA 4B79A 4AQDA 1LPBB 3QXGA 4P32A 3MCWA 4OQPA 3DG9A 3E5NA 3O8OA 2Y1XA 5I51A 4QWCA 1PGOA 3HEBA 4XJSA 1Z5ZA 2WSSD 3PXGA 5H80A 1N6HA 1GL3A 3HFRA 3H4BA 4PW0A 2GD6A 4M1OA 3ZE0B 4C87A 1YL5A 4AYBE 4QYXA 4RZUA 2COUA 1ORRA 4O7WA 2X0IA 2C1XA 2OECA 3THRA 2CZCA 3WLRA 5K4AA 3HL4A 1JZSA 1GRQA 4MRRA 3F3YA 6PFKA 1BEEA 1MUUA 1GVNB 5IAOA 3O3MB 3E9YA 1R64A 5COQA 4QNMA 3CLTC 4JJZA 1NUSA 3ZTWA 3L6DA 2H0QA 2PR7A 4NDZA 1C7QA 2Q45A 5K05A 3E48A 4KXUA 1KBQA 4OLBA 4P4GA 2ZUFA 3O8QA 3OQ6A 1MU0A 4R7GA 1Y8CA 3KV3O 3IVGA 1DGQA 1YB2A 3GLFB 3BJZA 2I6FA 3BK1A 4RDXA 1CNEA 4U7CA 1CF2O 1ITZA 5L3QB 4G86A 3HN7A 3EX7C 1GQRA 4GBJA 2XDYA 4IHJB 2XQFA 1RZ3A 3Q40A 1RKBA 3KD3A 4UVGA 4G0UA 4OHOA 1SHJA 5C8YF 3B89A 4K9LA 3WWCA 1C4XA 3CH4B 4HLQB 3UJPA 1CY1A 3I2KA 4ZEWA 1ZD5A 3WHKA 3A28A 4UE6A 3WWPA 4ZYVA 2V54A 2UV8A 1LGYA 1YR3A 1B6TA 2UVRA 3MBKA 1KO8A 3QFFA 3QE3A 3ZCRA 1R4NA 3MT9A 3RKRA 1A8UA 1HR0H 4D56A 3LWZA 2BI7A 1ZR4A 5DIZA 4LVOA 3E81A 1ECLA 1RKXA 4BNGA 1R4MB 1SUDA 3H1GA 2ZIZA 2WSYB 3PYXA 2RAUA 1BWPA 5ARDA 3ABOB 5IZCC 3T99A 1YJ5A 3UJ8A 1N1EA 3OETA 4DXDA 1T5IA 3VDXA 4MITA 2JI8A 1TAHA 1JLLB 2R0QC 2ECPA 2F1OA 1MA0A 1MEEA 4H08A 5CB6A 5ALDA 5IN4A 3TM5A 4M87A 3W79A 3S1LA 4KXMA 2YVLA 5IAEA 1MVNA 1EDDA 4G36A 3JTEA 3HCOA 3L43A 5HGXA 3CSUA 1GXSB 1F1BA 5MN5A 4XUGB 1Z6TA 5NULA 1RYRA 2PRJA 1SZCA 4B82A 4NYIQ 3OA0A 2ZJ2A 1B4DA 1PFKA 5EWMA 4KVGA 3C3PA 1MA3A 4GP9A 2FG5A 3HVHA 4QGFA 3TOVA 5KPDA 1Q7RA 1PEKE 1JPVA 4I5FA 3OU7A 5B1YA 5K3EA 2CBZA 4UCFA 2BM1A 3AV0B 3ZWQA 2R00A 3C1AA 4NBLA 4Q00A 3DLIA 1P0MA 2WD7B 1LCIA 3C1OA 1Z8FA 1J5XA 4R2WA 1XIVA 5L3ZA 5DM70 1USVA 3KUDA 2O4CA 4U9UA 3N39C 2ZJ4A 4FDAA 3O4JA 4RFSB 5ITZA 1J2TA 5FI0B 1I3KA 1CKNB 3QZ7A 3FA2A 3VZRA 5BOSB 2IOHA 3NFRA 5YASA 4ME6A 3A6PC 5JWHA 5DQHA 1DRVA 1U2EA 3BL6A 1M8GA 1H1TA 1RTKA 4FYWA 4ARVA 1N2IA 4WA7A 3DMPA 1TIBA 2DTDA 4XOIA 2JLYA 5ECYA 2PKEA 3EZ9A 3N0RA 4MR8A 3IPYA 4KZKA 1P2FA 3RGGA 2ZJFA 5EGSA 1TNDA 1E9CA 3I53A 3NBZC 5BQFA 3BSYA 3S7TA 4EP1A 3IOEA 2C5SA 3M7IA 3QRWA 2JLRA 3TAXA 3UYYA 3G23A 2IEBA 1YGYA 2OV2A 2VYND 2QJWA 3B20A 2JLCA 3PTAA 2XOKA 1QHFA 3E1KA 3BE8A 4JP3A 1BD4A 4EB3A 3HWX1 1YQTA 4FQ5A 3MQFA 1X94A 3S5UA 4RAQA 2EP5A 4S1NA 3V2IA 3G79A 3ANXA 1MTZA 4G5OA 2VZLA 2VYFA 1T6ZA 1GDTA 3DEFA 2X6TA 3U48A 3J81k 4CEHB 4OK5A 3HVUA 2JGEA 3R7WB 3SYKA 3C3MA 4IRMA 1QE5A 4ZK2A 2WW8A 4RD3A 1SVIA 3K8OE 2BE7A 4P34A 1S2GA 4MTEA 3BMCB 1DELA 4Z8YA 1N8NA 3BDVA 3UGJA 4RYLA 2ONYA 4BUCA 5MF6A 2OFPA 4Q3OA 3M1IA 5CD9A 4P80A 4FMDB 1L4GA 3HHPA 2IHZA 2L69A 3WGLA 3TVYA 3SGIA 3LV8A 2Z0MA 1ZKDA 3JASB 3MG9A 2JCSA 4QPDA 4WADA 2BLNA 4AX4A 4ZAXA 2BGUA 3HLYA 3M5WA 4FCTA 1HRDA 2QTWB 3N3AC 5CTJA 3PNYA 2PXHA 3PRYA 2VPSA 1VBGA 2G0AA 5AVJA 5D2CA 4HS9A 1PR2A 1GAQA 1GYRA 4JJAA 4A2BA 2CGEA 2GYUA 4D9BA 3BIXA 2IY8A 1GR1A 1RXIA 4CC5A 4ZYY