4O7ZA

Saicar synthetase (type-2) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
226
Chain Sequence
AKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 226
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7zA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7zA02
2YCSA 4Z16A 2Y9QA 4S32A 5HESA 3LXPA 4ME6A 1BI8A 3DT1A 3I0OA 5BVNA 5HU9A 3F3WA 4AP7A 3ACKA 4U3ZA 5AUYA 4IAIA 3WNZA 1WAKA 4J99A 4IIRA 4K33A 2QONA 4IJ9A 4O91A 4O7ZA 3GCPA 5ANJA 1WBPA 3HKOA 3MFRA 5L8LA 3G6HA 4G17A 3H9FA 3UQCA 2YS7A 4JR7A 1I7LA 4FV7A 5E1SA 1Z2OX 2VTHA 5J8IA 1U5RA 4I20A 1G8SA 3KXMA 2PPQA 5EW3A 4BICA 3ETJA 5J7HA 4GT4A 2V58A 2CSNA 4UZHA 3O17A 3NRMA 3ZRKA 5AP2A 5BMVF 3QALE 2G15A 2B9IA 2OJJA 5E8YA 3RVGA 2YIWA 4E6CA 4ANSA 1DIKA 2J9GA 3WO0A 3AX6A 3IECA 5A6NA 3R8LA 3HV3A 5C27A 4L00A 2XK8A 4AZFA 4HQ6A 4KRCA 2VWVA 1XH4A 4QP7A 5AP7A 3H3CA 3COHA 3H4JA 1SVHA 4YTIA 3RPSA 3U9NA 4MF1A 4F1MA 3VPCA 4JBVA 5JH7F 2ITPA 4NZWB 4QP8A 3NDMA 4FIIA 5H3QA 2JIVA 4JDKA 1KWPA 2A2AA 5KMOA 5CT7A 4O7TA 1JKSA 1URWA 2OJ9A 4MA0A 3R7OA 1ZWSA 3ALOA 2WTKB 3MTLA 1CM8A 2IG7A 4WA9A 5EHYA 4BCIA 4ENXA 5EOBA 3W55A 1XH8A 3MFUA 4FUYA 4BCOA 4D9UA 1ZRZA 4RWKA 2GCDA 3KQ7A 4O2PA 4W4VA 1W98A 5JK3A 4KNBA 3KXXA 2KTYA 4R5SA 5DNRA 5AV1A 2QR8A 4D5KA 2NPQA 3R1QA 3B8RA 5E7RA 4O7LA 3ZONA 1Q8WA 3FI3A 4YJUA 4M15A 1YKRA 2OKRA 2YIQA 4E6AA 4PDPA 4CQEA 3DTCA 4BI1A 5FBOA 2IZUA 4MV7A 4ZZOA 3B2WA 2X0GA 4NCTC 5DR9A 2C6IA 1OPJA 3TL8A 3R5HA 4C36A 5LJJA 1IAHA 1ZMUA 1KOBA 3ENMA 3OTUA 4LL5A 4MAOA 3BV2A 4IZ5A 5FDXA 4CV9A 5LWMA 5TO8A 2ERKA 3DLSA 5A4EA 4JOAA 4XOZA 5FTGA 4BDIA 1ND4A 2JDOA 4UBAA 3VF9A 3FUPA 5A4LA 3EQFA 2XRUA 2XNGA 1YVJA 3EQGA 1M2RA 5D7VA 3FPQA 4ZLZA 4EH4A 5HBJA 4L53A 5AP4A 5A9UA 3QQGA 1YXUA 4XS2A 1MP8A 4WOVA 2ZM4A 1FGIA 3VIDA 1T36A 3FXXA 3BLQA 5IA5A 4MWIA 4QOXA 5AV3A 3BYOA 4O38A 3V5LA 4CFWA 3F5UA 3GC7A 3QX4A 1JDEA 4PL3A 1QPDA 5JQ8A 3FLZA 5AA9A 1KOAA 2XM8A 4I24A 5CT0A 3FZOA 3FXZA 4AOTA 3OWPA 5AUTA 1OKYA 3VBVA 2YRWA 2BKKA 4HGEA 4DBXA 4XH6A 2FSLX 3RFCA 2CKQA 2G1TA 4PRJA 3SLSA 4DC2A 3KXGA 3U6JA 3IDPA 3R9HA 3E88A 2HK5A 3GQLA 4W4YA 3F6XA 3G33A 4IX4A 4DTKA 2QNJA 3LFDA 2C3KA 3P4KA 4C4HA 3VO3A 2ITUA 1YWVA 3D14A 2OLSA 1FBNA 2QHNA 3QLFA 3OCTA 1PXLA 4L3JA 2VO0A 4Y46A 3ORPA 2W6PA 1CSNA 2W1DA 3JY9A 5ACBC 1I7NA 5H8GA 3JRWA 2X1NA 3F9NA 2CGWA 3C4EA 3VUGA 2XF0A 3ROYA 4NWMA 2DIKA 2RG5A 3UP2A 3C13A 5BVEA 5EH0A 4XBRA 4OBQA 2XD4A 4IWOA 5FXRA 4C33A 4DG0E 4AW0A 3U6HA 4LMUA 3P78A 2WAJA 3QD3A 4FG9A 4NKAA 4HGLA 2FB9A 3S4QA 1JNKA 5K5NA 4ZJVA 3RAIA 3UIXA 2QI8A 4AOIA 3S2PA 3KY2A 1KJ8A 4DINA 1HOWA 1ZZ2A 2WEVA 1Q8TA 3OCGA 5L2TA 5LCKA 4XBUA 2XNMA 2ZDTA 3LXKA 3IW6A 4XHKB 2Q0NA 1H0WA 5KUPA 4QP6A 4FKJA 3TCPA 1B6RA 2HGSA 3KB7A 4LG4A 3KF7A 4NM3A 3DQWA 3KK8A 4BC6A 1WVXA 3DB8A 5CTPA 5TOZA 3UNZA 4C3PA 5KKNB 1WMKA 3GB2A 1B38A 4HNFA 5EI6A 4HVIA 5C1QB 1B6SA 3PPKA 4EYJA 2ZYBA 3PVGA 4M0YA 3FLYA 3ORKA 4E1ZA 3ETHA 5L2SA 4BKJA 2WO6A 3DPKA 3IW8A 4IBMA 4EOOA 4IX3A 4AX8A 4MBLA 4TWPA 5A54A 4NM0A 2C47A 2W4OA 1OBGA 4JX3A 4QYGA 5DT0A 2ETMA 3V6SA 4BIDA 3PE1A 4XG8A 3G0EA 5E9EA 5KMKA 2XNEA 3I79A 3QZFA 4L68A 3WE8A 3NW7A 4QQTA 2WZJA 3QQLA 3D5XA 4BYJA 5FEEA 3F5XA 4Y95A 4FKVA 2A27A 1SMHA 3V5JA 4AACA 5LXTF 4EOLA 3G5DA 1Q97A 3LE6A 3S0OA 3CPCA 3F2RA 2GQGA 2Y4IB 4AA5A 5HG5A 4WIHA 5BYZA 4FSYA 2FA2A 4FT0A 4ID7A 4DHFA 3LFQA 4JL9A 1NVRA 4EOPA 1CDKA 3PJCA 1H24A 3JYAA 4GS6A 1STCE 1O6LA 3O8UA 1FPUA 2ITOA 3Q96A 4FKIA 4RC4A 2BVAA 1BYGA 4EK5A 1G5SA 3ZEWA 3EFJA 3QKMA 4AOJA 1YDTE 4G6NA 4IH8A 4WBNF 2AUHA 3K2LA 2B9JA 3D94A 2Z8CA 5LMKA 3D0EA 4WT6A 4EH5A 2OZAB 3L8XA 3AMAA 4GVAA 3AGLA 3F3TA 4M69B 1BL6A 4ASZA 3O8TA 2OXYA 5C1OA 2VX1A 2WIHA 2W5HA 3D2KA 3FMNA 3VWAA 4W4XA 4C62A 4XP0A 5KX5F 2IWIA 2R3HA 3FXWA 3RTPA 4C4EA 5EKOA 4X2KA 4OTIA 3MWDA 4F7LA 4HNIA 4O96A 2OJIA 5AP0A 3BGZA 1ATPE 4MXOA 4S2ZA 4ZLYA 5HNGA 3QHWA 4XG4A 1QPJA 2YAAA 3KXZA 4BGHA 4CMTA 3D2IA 3BU6A 5M57A 2QOQA 2QO7A 1E4EA 3TKUA 2FPGB 4HCTA 2DQ7X 3OZ6A 3SHEA 3SQQA 2Y8OA 3COIA 3QHRA 1VYWA 5JGDA 1JDBB 1UNGA 2YM4A 5EG3A 4F4PA 5L2WA 4I0SA 3W2QA 4FKGA 4E7WA 3DJ7A 1A9UA 1BLXA 1L3RE 4RT7A 4IX5A 3NUPA 4G5PA 3O2MA 1NY3A 5HVYA 5TR6A 3GT8A 3GENA 2B0QA 4GK4A 3UIBA 3ZDIA 1IASA 4YLLA 3RP9A 5LVMA 4APCA 3ZMMA 4FFPA 5FLFA 3BEAA 3LFFA 4O7NA 2VX0A 4FZFB 2ZB1A 4W8EA 5DFPA 3UFXB 4U9AA 5A46A 4LM5A 4UWBA 3CTJA 4PDOA 3C51A 5L6OA 4IHPA 3NNWA 4EHEA 5BQ0A 2Z60A 3OY1A 1PXOA 1XH6A 1KV1A 3BQCA 2UW0A 1Y6AA 3F61A 2BTRA 2Y0AA 3GI3A 5E92A 3SAYA 4R3CA 2EUFB 4XX9A 4CCUA 3BHVA 1ZXEA 2VTTA 3R30A 4FIEA 3RPVA 4A9TA 2PZRA 4ZTMA 5GIPE 4L1KA 4FSMA 5AV2A 5KZIA 4M14A 4MNEA 3RK7A 3OEFX 3BGQA 4AZSA 4FNZA 1DS5A 3MPAA 1GZ8A 4PMTA 5DBXA 4ZOLF 4O0VA 3V6RA 5EQPA 3AC4A 5D1JA 4QMQA 4EC9A 5KX8A 2J0IA 4LFIA 3GGFA 2R7NA 3DOGA 3COMA 3N8DA 3PZHA 2WMTA 2WB8A 3PIXA 3E87A 5CSXA 4BTKA 2ONLA 4LYNA 5HD4A 3DDQA 2YM7A 3FMMA 3RK5A 5KMJA 2XNNA 4BZOA 1ZLTA 2OBJA 2WQBA 2ZV7A 4JJRA 2PVLA 3ORTA 4JDHA 2XBJA 4IM3A 4EHGA 3R01A 4FL3A 5HG8A 1JSVA 4NL0A 4F6WA 4JR3A 4HYUA 4DN5A 4Z55A 4D1SA 2IW9A 2FO0A 4BCQA 4BVUA 5EM5A 5FM2A 4G1WA 4FSUA 4F1OA 2Y4IC 1Z9XA 4LRKA 3U55A 1CKPA 3UZPA 4CFMA 4FC0A 3QL8A 4RWIA 5BNJA 1FMKA 5EK7A 3W2PA 5D7AA 2I87A 2C6MA 4CNHA 3WF7A 4DIMA 3BE2A 2Y4PA 3UC4A 5CA1F 3BYUA 2GPWA 5IA3A 1NVQA 1UU7A 4RLLA 1U54B 5CANA 4FT9A 4RJ4A 1CKJA 1SNXA 1ZOHA 4JXFA 3ZUUA 3E62A 5IEYA 1PF8A 3PTGA 2QLUA 3HUCA 3QFVA 4FODA 4IVAA 3NS9A 5C8KA 4DCEA 3MWEA 2JFMA 3FI2A 5BX0A 4FIFA 4ACGA 2EXMA 4RC2A 4GU6A 4ZXTA 4IDVA 4CKIA 3PG1A 2VWBA 3BZ3A 3IO7A 4U97A 3W2CA 4G5JA 2C68A 2QOLA 2WNTA 3WILA 2QK4A 4K0YA 4A9UA 3A4OX 2GLTA 1QL6A 2W6OA 3RM7A 5HBRB 5J9LA 4HNUA 4LGHA 4YZNA 2OG8A 3VUIA 4AFEA 1M7NA 3VUKA 3DNDA 2Z7RA 2W99B 4C3RA 4HVDA 2VR1A 2BRHA 4C7TA 5DE2A 2X4FA 4ANLA 2ZV2A 2QQ7A 1CE8A 1KJ9A 2WMVA 4TWNA 5JFWA 4UXQA 3P08A 1XBBA 4RJ3A 2NP8A 1XJDA 4RVTA 3E5AA 4G9RA 2VTLA 4TYHA 4CZUA 5JGBA 2GFSA 4G9CA 1OL1A 5HE1A 3S95A 1OIUA 2FH9A 4G3GA 2UZUE 4QTAA 3NNXA 2QCSA 2OICA 1VEBA 3LCKA 3A62A 4BDKA 5CAQA 1SCUB 4EWHA 5CAPA 3RV3A 1R78A 2GU8A 3LMHA 3LFBA 3TNPC 1REKA 5LCJA 3ZBXA 2OF4A 4BCPA 4FKOA 5EI8A 1UVRA 3ZZWA 2A0CX 2GHMA 3C1XA 2VTRA 5DT3A 2WD1A 3DKCA 4RWJA 4DEIA 2B53A 2PVRA 4E8AA 4RIXB 2EU9A 1GAGA 2B4SB 4C3FA 2VWXA 4QNYA 4M3QA 2IZRA 4LI5A 4DEGA 4UZDA 4NTTA 5CSVA 4KD1A 4QNAA 2XIRA 4EQMA 4FA2A 3KCFA 3VBQA 2XCLA 3GVUA 4C4IA 4L46A 3IOPA 3TXOA 4EOSA 2I0HA 4AWIA 1QPCA 4PTCA 4DCAA 2FPPB 4WKQA 2HZIA 4QP2A 1IOWA 2BFYA 4U81A 3K54A 3KRXA 2YA9A 4OT6A 1H01A 2B9HA 3MESA 3DJ6A 4WBOA 3M1SA 3N4VA 3FYJX 4FEUA 5FG8A 5HE3A 3V8TA 2W6NA 3NAYA 1PXIA 5CY3A 4NH1A 5HG9A 3BQRA 3KREA 2C6DA 3FV8A 5F9EA 4TTHB 3BE9A 5EKNA 2HAKA 3PFQA 3IONA 3PSDA 2QOFA 3PJ1A 1SZMA 5JN2A 4LUEA 1F5QA 3JS2A 1VZOA 3U51A 4FI1A 3UNJA 4A9YA 3ELJA 4DBNA 4EZ5A 1JLLB 1OBDA 3DAKA 4ZMEA 4X6RA 3TJDA 2C0IA 2IO6A 4WG4A 2E9PA 2VWWA 4QP3A 3L9MA 1LPUA 4RJ7A 2XH5A 3GCVA 5I0BA 3SA0A 4JVGA 2W70A 2A4LA 3N4UA 2REIA 3SKCA 2YM8A 1MRUA 3GLKA 4XLVA 3DXNA 4MBIA 4XG7A 4D4YA 4CT2A 4O2ZA 1WBTA 1APME 1MRYA 3LQ5A 4YZCA 2OJGA 1Q8UA 2VO6A 4P2KA 4ANMA 1DV2A 4K6ZA 4J7BA 4FR4A 4X7QA 5HD7A 1URCA 4O7RA 3Q9YA 4FTIA 4DFLA 1M2QA 4IANA 3I5ZA 5FP5A 3WF5A 2G01A 4EZ3A 3G0FA 3QKKA 1PK8A 3UYSA 3JUHA 5J5SA 3VPBA 4I50F 5JRQA 1BKXA 2IN6A 1SVEA 1GOLA 2J4ZA 3C5UA 3LLAA 2C6LA 4FTQA 2WYOA 1PYEA 2KULA 3EIDA 3MIAA 3HV5A 4PP9A 5JRSA 4TUYF 5IQAA 1YQJA 5HV6A 3CP9A 4TZRA 3UGCA 4IFGA 4ANQA 1GSHA 3BG5A 4H1MA 3OCSA 4IB0A 1Q8ZA 3U9TA 3NUYA 3QUPA 5F20A 1Z2PX 3G9NA 4O0TA 5FD2A 5M4UA 4I23A 3PZEA 5BMSA 3GXLA 5IEXA 3R28A 2XNOA 4H05A 4XV2A 4O2AF 3QKLA 2H34A 2OK1A 3DBDA 1OI9A 2CHLA 2GNGA 2PVYA 3H9RA 2ZVAA 4JX7A 4X6QC 5L6WL 2WTJA 3FLNC 1IRKA 3GNIB 3I5NA 4I94A 4FVQA 5LVPA 3DKGA 2UW3A 2HENA 4IWQA 3QU0A 3F82A 3P79A 4RPVA 5T6KA 2YCFA 4JG7A 2CGVA 5EFQA 4JQ7A 3FMDA 2R3RA 2YABA 4IZ7A 4PMMA 3Q4UA 4OBOA 3V5WA 3ZUTA 4AU8A 5CU3A 4N0SA 4JG6A 1Z2NX 2W6ZA 4G3EA 4AN9A 4GT3A 3E8CA 4HZRA 3FJQE 4EKKA 4EK4A 2JBOA 4O7VA 1OL7A 5JGAA 3VA7A 3WE4A 3ZYAA 3R23A 2VZ6A 4AW2A 3E3BX 2BRGA 4F9AA 1YOMA 4OTWA 4HCUA 2HY0A 1QPEA 1JPAA 3ZO1A 1WFCA 3QBNA 4U6RA 4V0GA 1CQIB 5GNKA 3HX4A 2X2MA 2X2LA 3P86A 3QWKA 5C9CA 2A19B 3FQSA 3FE3A 2UW7A 4I4FA 1UKIA 4JAJA 4GKIA 3G15A 1U59A 4ANBA 2WMAA 4I6FA 3KCKA 3ORMA 3QF9A 3VS4A 1KJIA 4PDYA 3JVRA 4HGTA 2C5OA 3DA6A 1GLVA 4CG9A 2EWAA 4ZS4A 3EQCA 4CFNA 3DKFA 3PWDA 4FVRA 3D5UA 4B99A 4QQ5A 4BIEA 4CLJA 3N9XA 5FP6A 4C2VA 4DGLC 4M9UA 5FRIA 3OXIA 2XIYA 4RIYB 5BVWA 3D4QA 3QZGA 3BKBA 4FTRA 4RFYA 4ERWA 5IA0A 4OR5A 4C4GA 4EJNA 3D5WA 2ZOQA 4QMXA 4AUAA 4E5BA 2YM3A 5AP1A 3VUMA 2YZMA 4X3FB 2I0YA 5CWZA 3D15A 4O82A 5IUGA 1Q99A 2VTIA 2VUWA 3KRLA 4PL4A 2UW5A 1OL6A 2GS7A 4FSRA 4F7JA 2R3PA 1LUFA 5D41A 3EQHA 3ZM4A 5J1VA 3ORZA 5AJQA 5AUVA 3LOKA 3OBJA 4AA4A 5HO7A 5I4NA 1M0WA 4D28A 5BPYA 5HU3A 2JAMA 4XG9A 4R7BA 5CENA 3HB9A 3ZCLA 4XCUA 2XMYA 4FFOA 4LOPA 5TKDA 4CD0A 2WTIA 3OG7A 2OJFE 4E93A 3GU5A 2BZJA 1PXKA 4RJ6A 2PMLX 1FVRA 4DEAA 5BUEA 2SCUB 1DAWA 1P14A 4GUBA 5GJGA 4BGGA 4I1ZA 2X7FA 3VS0A 3WZJA 4C4FA 4CVAA 3UPZA 2R82A 1YHWA 2WMSA 4IAYA 4PX6A 3TM0A 3C50A 1M0TA 4DF3A 2R0UA 3SRVA 2I8CA 4BB4A 1O9UA 3QUEA 3EYGA 4QPSA 1FVVA 5M4CA 5CXHA 5AMNA 4FV0A 4IWDA 4U42A 4Q5HA 3KFAA 4LGGA 4OGRA 5C1PA 3AC5A 4GH2A 3JZIA 4YBZB 4NTSA 3QZHA 5J2TF 2XCHA 3ZUVA 3RJCA 5J87A 5M09A 1J7LA 4FL2A 3G2FA 3OF0A 3DJ5A 4IB1A 3N4TA 4JQ8A 3UO6A 3DF7A 5M53A 3FBVA 2W5BA 3LXNA 5TT7A 3RK9A 4E6QA 3OUNB 3DBQA 2JDVA 3IPHA 3U9CA 4JRVA 5IYZF 1CQJB 1FQ1B 3U54A 3P23A 2R3GA 2UZOA 1EYZA 3RWQA 1GJOA 3MH0A 2BR1A 3ZSGA 3SG9A 1UNHA 1G3NA 3MN3A 2XKEA 2VO7A 2GNHA 2VX3A 4DITA 4FEQA 3HAVA 4C58A 2FYSA 3CGFA 3HVCA 4O0YA 4ZTQA 4IJPA 5IMEA 3PE2A 4IMYA 2DWCA 3TINA 3F66A 1VYZA 3A7GA 2IZSA 3D9VA 4N6ZA 4EK6A 3TIGA 1OM1A 3QA8A 4CFFA 2C5YA 4JBQA 4X2NA 1TQPA 3W10A 2RFSA 3UOLA 2ZJWA 5AADA 5LYJF 4H3BA 1C30A 3ZO3A 4EZ7A 5IF1A 3TJCA 3UBDA 3R8UA 3QXOA 3ODYX 3OWLA 4FIHA 3QZIA 4MA5A 2XK7A 2W0JA 3IDBA 3BIZA 3DU8A 4FEVA 4RVKA 4FTMA 2QC6A 1KE5A 4RZQA 1H1SA 2ERZE 4YJQA 1I09A 2PYWA 3LAUA 4PNIA 2HCKA 3IKAA 2C6OA 2WTCA 3I0QA 4FTKA 1ZYSA 4QMVA 2GSFA 4K18A 4ZSEA 5BUJA 4FTAA 3K5VA 2VAGA 1Q3DA 5J1WA 3CXWA 5LOHA 1FINA 4IM0A 2XM9A 4KIPA 5HI2A 4C59A 2BDWA 1K3AA 1K9AA 5CNOA 3VBXA 2PE0A 2YDKA 3GQIA 3II5A 3O23A 4BTJA 2PTKA 3FLQA 4MCVA 2HZ4A 5IUIA 5CF8A 3PLAE 3NUNA 1BNCA 5HNIX 1BL7A 5CU2A 4II5A 4OLIA 3UMXA 1XHAA 4ORKA 5LVNA 3NVKI 3UE4A 3VUDA 4XZ3B 4C5BA 2HZ0A 4ZZNA 1J7UA 3BHTA 1XBAA 3TKHA 4FU0A 4M13A 3UZRA 3W1FA 4XYLB 5DVRA 4FKTA 4LUDA 4X3JA 5CX9A 4ZP5A 3TG1A 5KBRA 5AUZA 3SX9A 3FKLA 2HW7A 4X3FC 3F2NA 3NWWA 4FEWA 4AN2A 2PZPA 3WOWA 3RGFA 2ZAZA 3DFAA 4R7IA 5ANEA 3E92A 3W8LA 4BDBA 5AX9A 3VOTA 2PVKA 2R2PA 4U3YA 4BY9E 1W84A 4ZI7F 1UWJA 4HYHA 2E9NA 2BHEA 2Q0BA 5E8UA 3TT0A 5FUTA 5AAEA 4F7SA 3NYVA 3NCGA 4QMZA 3RPOA 2X9EA 3QYWA 3PSCA 4J96A 1YWNA 4FKLA 3VS1A 4F9WA 3G8DA 3P7AA 4RIWA 2YYAA 2XA4A 3GU8A 1WZYA 4K9YA 2O63A 3EQBA 4MBJA 5L6PA 3DGKA 2GS6A 4F1TA 1OIQA 2PSQA 3QD4A 4AFJA 4HR7A 3ETAA 2W06A 3G6GA 1W83A 2RFDA 3R00A 5CS6A 1H1WA 3NNUA 2GS2A 4CG8A 3QQKA 4FFRA 2JKKA 3DBFA 4BDFA 5A4TA 3CQWA 2P2HA 3RCDA 2PVHA 4FTTA 3SVVA 3WI6A 5K3YA 2CN5A 5IQCA 2R3JA 1H08A 3CTQA 3NW6A 1W8CA 3Q9WA 5A6OA 2CCIA 4NFMA 3QCSA 3OEZA 3ORRA 2G9XA 4BGQA 3UIMA 3E8DA 2WPAA 5IPJA 2P3GX 2V7AA 4EH9A 1XBCA 4NW5A 3CC6A 3EL7A 2BILB 3C7QA 2QURA 4NM7A 3PJ8A 4LQMA 3PJ3A 2CLXA 4J52A 2XK4A 3KA0A 4GSBA 4ZY6A 3R7VA 3DBEA 2OIQA 1JSTA 3HV6A 4Q9SA 1PKGA 2GQRA 3Q2JA 5HG7A 4ACDA 4U41A 3NEWA 3QTUA 2OXXA 4ARKA 4BI2A 4YJTA 4YJPA 3MPTA 3Q4ZA 3QRIA 4O6LA 2I7QA 2J0JA 5EYCA 3UVPA 1ZYJA 4BTMA 4C2WA 4DH3A 3Q3BA 5E8ZA 4ASXA 4PMPA 5LXMA 2I6LA 2AC3A 2R3IA 5EM7A 3LIJA 5CVFA 2B1PA 1DI9A 3HUBA 4JNWA 3RHKA 1UWHA 2C5XA 3NLBA 3ODZX 4L01A 2OZAA 4FX3A 5GHVA 5IH4A 2NRYA 4JRNA 1YDRE 2X2KA 3UPXA 2V5AA 4TT7A 3WF8A 3FZ1A 5JFVA 1XH5A 1P2AA 2BPMA 4C5AA 4L45A 3R8MA 5LMAA 1PMEA 2AC5A 2E9OA 2QOBA 3MVJA 5B2KA 4I21A 1KE8A 4HNTA 3EH9A 1H27A 4JS8A 4TN6A 5DRBA 3CY3A 2XBAA 4EUUA 1Y57A 3POOA 4FGBA 2JC6A 2VTNA 1PMUA 2R3MA 5LMBA 4FT3A 3BHHA 3LXLA 1AD5A 4Y8DA 3VULA 1SNUA 5DYJA 2IW8A 4Y85A 1UU3A 3BPRA 3L8SA 4XX0B 1LR4A 3UJGA 3PA3A 3HECA 4O27B 4PL5A 4HW7A 3OBGA 5HLNA 3P5KA 4TKSA 4YJVA 5AV0A 3ZSHA 2BALA 3A8XA 5C4KA 3KKVA 3PPZA 5M51A 1M14A 2BRMA 3KF4A 1H28A 3QD2B 4M12A 2I0EA 1KE9A 1ZYDA 1Y6BA 4GYGA 5F4NA 2YCQA 1W96A 2BMCA 5BUIA 3G51A 5E8WA 3ALNA 4AS0A 2CGXA 1GGOA 3P7CA 3NSZA 2B7AA 3AT3A 3I6WA 4X0MA 3TKIA 4D9TA 4KKHA 2J5FA 4HZSA 2XVDA 4DT8A 5F1ZA 2ZV8A 3L8PA 4MQ2A 3OW3A 3UP7A 2I0VA 3ACJA 3BLHA 3GFWA 4U44A 4WG5A 2C6EA 2W7XA 5EOLA 1WCCA 2OH4A 3ZXZA 4D1XA 4LOOA 4QP9A 3ZRMA 3FKOA 4AT3A 5I9ZA 3QD0A 4IACA 2WMRA 2QG7A 5K5XA 5LWNA 4W4WA 4ZSLA 5D8DA 4QMUA 5FNVF 2C1AA 3RAKA 2X6EA 3MGYA 5HVKA 4A4LA 4E4XA 5HIDA 4XNEA 4USEA 3OT8A 3I12A 5CAVA 3EQDA 4G3CA 2YS6A 5D10A 1M7QA 2F9GA 1R0EA 4TV9F 4TNBA 4EGQA 4L7SA 4I22A 4U80A 3PXZA 3NR9A 4I4TF 5EHOA 4FEXA 4LRMA 4O4LF 4HPUE 4CEGA 5LQFA 5JFXA 3TV4A 4UYNA 3BBWA 3KVXA 4BCMA 3TDVA 3KMMA 2VWZA 4R1VA 1ZAOA 5HICA 3ZSIA 4DLJA 4V04A 5B2MA 5DT4A 3TTJA 5HVJA 4QYFA 3SV0A 3R1NA 2R84A 2UZDA 5L2IA 3ORQA 4AT4A 3LMIA 4O7WA 2BCJA 2PY3A 2XNPA 3KU2A 4KA3A 3TZ7A 3VHKA 3LFNA 3OMVA 1GIHA 3Q04A 3QTQA 4H3PA 3ZO4A 4EK8A 3HO8A 4PP7A 3BBTB 2NUAB 4J1RA 4ZSGA 3R7EA 4FNXA 3U9SA 4FSWA 5FQDC 3IS5A 3KK9A 1H25A 5I9XA 2ITQA 5ANDA 3ORIA 1JBPE 2YDJA 4IDTA 4D2RA 4FT7A 2ITVA 3COKA 4ALWA 2X6DA 5BVKA 3VBTA 2J0LA 3UO5A 2QODA 4FZAB 3RPYA 5DG5A 3V01A 4GT5A 4YAKB 1IG1A 1YI4A 3D5VA 4QYYA 5CAUA 3F5PA 1KE7A 1NA7A 5B7VA 2E9UA 4IW0A 2ITZA 2VTQA 3AD6A 3ZLWA 4RX8A 4GRBA 4IIJF 1Q24A 1VJYA 3HMIA 3K5UA 3EL8A 1V0OA 4L6QA 4RX5A 1OMWA 4FTCA 2BIKB 4H58A 4QYEA 3V5QA 4C0TA 2ZMDA 3AQVA 2A1AB 4XV1A 3HNGA 3ET7A 1Y91A 3NIZA 3NVMB 1Q4LA 4XRLA 4NIFB 4B0GA 2QF7A 4ZSAA 5BVOA 5HKMA 4I3ZA 3VS6A 3DS6A 1PW2A 3C4XA 3E8NA 4L7FA 3SXFA 4IQ6A 5D9HA 4FL1A 5BYYA 2PL0A 2XIXA 3KEXA 3ANRA 3EMGA 4FNWA 3Q5IA 2GMXA 5AV4A 4MV8A 4XG2A 1H07A 2EB2A 3ZU7A 2J50A 4MV6A 2P0AA 4ZHQF 3NYXA 2RG6A 1VBGA 2VN9A 3O71A 4BDAA 4YSJA 3OWJA 1X8BA 5A4QA 3QQHA 4MV1A 3HMOA 4B9DA 5L8JA 2EB3A 1DM2A 3UIUA 1TVOA 2WHBA 3TN8A 2BFXA 3TIYA 1YI6A 3FLSA 2ZM3A 4JT3A 4EH6A 2CPKE 5KNJA 4KB8A 3A8WA 3C4WA 3R9OA 4ZMFA 3CJFA 4RZWA 2NO3A 4FSQA 2Y6MA 4LV5A 3ZFXA 2QOCA 3E93A 4MD8E 3AD5A 4AGWA 5F94A 3DAEA 3DXPA 4YJSA 1AUXA 4L9IA 4DT9A 3A7IA 3TQTA 1M17A 5CSHA 3GCQA 2V59A 5F95A 4O4IF 1NT2A 4GFOA 4HNVA 3DAJA 3LWBA 2HELA 4O0WA 3TNWA 5CF6A 2J6MA 4I5PA 2GHLA 3MVHA 2YIYA 3QRUA 4WNOA 4D2SA 4JIAA 2CNUA 2XJ1A 4BZNA 2XYNA 4RLKA 4GEOA 3PWYA 3R7IA 4U8ZA 2QOIA 3QFFA 1PRYA 4ENYA 5KZ0A 1H1RA 4B6LA 4KIQA 3LM5A 4RA4A 1RQQA 1H1QA 3D7TB 4AF3A 2HJWA 2PE2A 5C8MA 3KULB 4KUJA 3VRZA 3TI1A 3ZC5A 2G2HA 5GJFA 4A07A 1RJBA 1Z5MA 4GKHA 2FP4B 4FKUA 2HXQA 4MD9E 5BYLA 2ESMA 3VC4A 1FVTA 4OTRA 3MW1A 4MQ1A 4E4MA 2JKQA 2GFCA 4NK9A 3CSVA 3ATSA 4O0XA 4I5HA 5CNNA 1Z57A 1KSWA 2F7EE 3ZTXA 4BCFA 5K9IA 4ZEGA 1OIRA 2GQSA 4E73A 2R3OA 3B2TA 5FTQA 4IAKA 4MXZA 3OD6X 5LP6F 5FEQA 1H4LA 3CQUA 5CSPA 2R3NA 2YERA 3W33A 3VMMA 5JT2A 4FTLA 3JPVA 4OTHA 4BF2A 4DLKA 4OTGA 1KJJA 4EOIA 2XEYA 3UMWA 4KIOA 5IQFA 3HMMA 4FKSA 4E20A 2BZHB 2I1MA 2UVXA 4LOQA 5BPFA 4CTCA 3UG1A 3GOPA 2J51A 3EYHA 3HMPA 1E9HA 2VTSA 1Q5KA 2YEXA 3WF6A 5M4IA 4MD7E 3Q9ZA 5EW9A 3MH1A 5HZNA 4F6UA 5IQEA 3EN5A 2QU5A 3KRWA 2BAKA 2XIKA 3E3PA 2ITYA 3FMEA 3MH2A 3FAAA 2X7OA 4Q2AA 5ETFA 4BDHA 4D5HA 4O22A 4JIKA 3BGPA 3CKXA 4FKQA 2XB7A 4ZIMA 3WF9A 1PYXA 4F0GA 1WBSA 5A14A 4F7NA 2VO3A 2J5EA 3VQUA 1GSOA 5EYMA 2JD5A 4F0FA 1SYKA 4J53A 1OKVA 1E4EB 4M7IA 3RALA 1KUTA 1PMVA 2YM6A 4H39A 4FNYA 2BKZA 4YNEA 3KALA 1E1VA 1U5QA 3C0IA 2OWBA 3M11A 4RJ5A 3F7ZA 3KRJA 2XKFA 3E5NA 1S9JA 4IVCA 4L3PA 4AN3A 5HCYA 3UODA 3OWKA 4RBLA 2XJ0A 1ZY5A 3H10A 3HRFA 5AM7A 1JKTA 3A4PA 2C5NA 3FC1X 3T9TA 4W8DA 3SGCA 1PKDA 5KMLA 3MDYA 4O2BF 2FSOX 3BWJA 5M06A 4BN1A 5J2UF 3DZOA 3Q6UA 4GUEA 2GPHA 3LJ1A 3O51A 4RMZA 4S34A 3WO1A 4YP8A 1Q62A 5ETCA 1XQZA 2GTMA 4FTUA 2C00A 5AUWA 1DI8A 4M8TA 1ERKA 1YI3A 3MIYA 3NYNA 4WNPA 4I6QA 1RW8A 4MX9A 2RKUA 3QWJA 2J0MB 3K3IA 5E8TA 3RCJA 4JG8A 4X2GA 4F6SA 2F7ZE 5IH6A 1M52A 1PX2A 2IVUA 4O0SA 4BIBA 2WOTA 1H1PA 1YXTA 2B9FA 3ULIA 3EZRA 5FEDA 2PULA 1B39A 3GU6A 4CMOA 2Z2WA 3OFMA 3EKNA 2XUUA 2OZOA 3R1YA 4GK3A 4IADA 4KAOA 4UWCA 4DA5A 2J9MA 2PU8A 3VJNA 3RHXA 5GINE 2IPXA 5C4LA 2YWVA 1GY3A 3AD4A 4TYJA 3PLSA 5G6VA 2YZLA 3K3JA 3SW4A 4BRXA 4UB7A 4AGUA 4EONA 1UU9A 3FHRA 4BCHA 3HA8A 4DTBA 3FYKX 3T9IA 4MXYA 2ITNA 4CRLA 1OL2A 3ID6C 3MVMA 5CSWA 4L44A 4L43A 5FGKA 5CEKA 3BEGA 3ZEPA 4O0RA 4RFMA 4TWCA 5EDPA 2NU8B 3MY1A 2IVSA 2BTSA 3QRTA 4J71A 3C5IA 4QO9A 4X3FA 3MBLA 5H8BA 3W2RA 4EQCA 5KHWA 2V0DA 4O84A 3UC3A 3V3VA 3VBYA 4CTBA 5CVGA 2CGUA 4U43A 4R3PA 5HX8A 3WIKA 5JZJA 1Q61A 2R3QA 4C34A 4C38A 4IAFA 3W16A 5HBHA 1RDQE 3CIKA 5T68A 3LJ0A 4MAMA 2CLQA 3IGGA 4TYIA 3LPBA 5JSMA 2VU3A 3GC8A 5IA1A 5ANKA 5I5ZA 1KJQA 2XK9A 2YZGA 4Y8VB 2PVJA 2YACA 4QMLA 4ZZMA 3FI4A 5LMKC 4CFXA 5EQYA 2YIRA 4YJNA 5FXQA 3JY0A 3HP2A 2E9VA 4JDIA 4NCTA 4EBVA 3UOJA 4YB8B 4G3DA 2YIXA 4YMJA 4NT4A 3R2BA 3UQFA 2BDFA 1EHIA 2JBPA 4IC7A 1Y8GA 2VGPA 3QCXA 3P0MA 4PDSA 1J1CA 1OGUA 2UW8A 5DR2A 4Z9LA 3QGWA 4KSPA 1PXJA 2WKMA 2W17A 2XYUA 2R7MA 3OVVA 5AIKA 3AG9A 3H0YA 5CQWA 2W4KA 4F0IA 4FTJA 3QTXA 5CASA 4YU2A 2C3JA 5L3AA 1VKZA 4B8LA 2O8YA 3MWUA 3PXQA 3Q52A 3TV6A 4UXLA 3IDCA 4G34A 3K3PA 4IVDA 5EI2A 1JQHA 3DZQA 4ASEA 3OC1A 5DMXA 4CKRA 3PXYA 2UVZA 2R7IA 2X0SA 3CEKA 4ITJA 3DV3A 3EB0A 2NNWB 2R3FA 4WUAA 5EW8A 3LCDA 4G3FA 3VW8A 5JQ5A 1JAMA 1KE6A 4D4VA 1UNLA 3ZC6A 2P55A 3VHEA 3LFAA 3F2AA 3TDWA 3KMUA 5JEBA 3EFLA 4G31A 3RKBA 2VD5A 5H2UA 3H9OA 4JI9A 4RG0A 3P7BA 3MFTA 4QRCA 2WEIA 4CKJA 4FE2A 3NNVA 2H96A 3QTRA 2OF2A 3B8QA 4X2JA 3U8WA 4JQEA 4AE9A 1ZYCA 5T3QA 4A4OA 2I80A 4BHNA 5AP6A 5KMIA 2PZ5A 5M55A 3Q2OA 4JAIA 1IR3A 3ZM9A 2YWPA 3AT4A 4TYEA 2CMWA 3EQRA 4RX9A 3TUDA 4TV8F 3LCTA 4RWLA 4KRDA 3BRBA 1HCLA 3UDBA 2ZDQA 5GONF 2W1CA 4O83A 2H6DA 4TRLA 2BDJA 4YURA 2GTNA 3WARA 3R7UA 4OW8A 1KC7A 3QRJA 4EL9A 1EUCB 1L8TA 3DKOA 4QTEA 4HYSA 4USDA 3BYSA 5M08A 5K4IA 4E5AX 4N70A 4L8MA 5DEWA 2R5TA 4EWQA 4YAJB 3MSSA 1SM2A 4J8MA 4QTBA 5CI6A 2XS0A 5DR6A 5CZHA 5CALA 5LVLA 2Z7SA 4IHJF 2JKMA 4HJOA 4O4JF 5D11A 2YW2A 4EG0A 2VWYA 4YLKA 4QMYA 3ATTA 5EYDA 4DH7A 4FV8A 3OP5A 3PXKA 2I40A 3FMLA 2JITA 3LHJA 4XJ0A 4ONAA 4PTGA 3UO4A 4AQCA 3F69A 1PY5A 4FICA 4C35A 5DIAA 4F9CA 2R4BA 4BHZA 2ZDGA 5ETIA 3MTFA 3ZDUA 1PMNA 3HDMA 5IUHA 4O86A 3QC9A 2VRXA 2C69A 3MA3A 4IAAA 2CKOA 4RA5A 5CAEB 4NU1A 4Y5HA 2OW3A 4EOKA 3W32A 3KAJA 3M2WA 4ITHA 3AMYA 3FMJA 4MH7A 4RRVA 4XYFA 5E4HA 3JZFA 1OZ1A 2CCHA 2YZAA 4XG3A 4YHJA 4E4LA 1VBHA 2JGZA 3BYMA 4FZ7A 3ROCA 4C61A 2NU9B 2OXDA 3ZLYA 3QRKA 4DH1A 4TL0A 3TWJA 3PG3A 4K1BA 3FDNA 1BUHA 5FBNC 3R7YA 3Q32A 3VS7A 5C8YF 3ITZA 2WELA 4ZQIA 4DGGA 4DE4A 4RVLA 4FBXA 2W9ZB 2SRCA 4UEUA 3RINA 4AXAA 4D55A 5AAGA 3T8OA 4IZOA 1H0VA 2VTPA 4CFUA 2O64A 5IQHA 1JVPP 2WQMA 1OB3A 3UVQA 5HX6A 1YRPA 1XWSA 3IG7A 3QQUA 2VTOA 4BCKA 4GK2A 4CT1A 5BPHA 2FB8A 4YZ9A 5C8NA 5M07A 1T46A 4OBPA 2ZV9A 1JSUA 3BHUA 3IW4A 5DEYA 4D0XA 2UZLA 2WQNA 2XZSA 4MXXA 3JRXA 4IAZA 4K11A 4XRJA 3DDPA 4QMTA 1YHVA 2CDZA 4PTEA 4ERKA 3UYTA 2QOHA 3LP8A 1KV2A 2F57A 4G2FA 2H9VA 4EHVA 2HOGA 3CPBA 1WVWA 3E64A 4MTAA 4NJ3A 3ZRLA 2C30A 3TTIA 3CCNA 4S30A 1IOVA 5FTOA 3MPMA 4P4CA 3ORXA 5ITAA 2GNFA 5CI7A 4ZY5A 2DUVA 2QO9A 3DK6A 4F09A 4DFZE 2JDTA 4A06A 3V04A 3O7LD 4ITIA 4MV9A 4DYMA 3UZTA 3NUSA 4IZAA 2ETRA 2UVYA 2C0OA 4AW1A 3OY3A 2Z7QA 4G6LA 3L9NA 3R6XA 1CTPE 4OTDA 2C1BA 3DK7A 3QLGA 3VS5A 2C5VA 4QQJA 1P4FA 4BDCA 2XEZA 2ITTA 2R86A 5EDRA 1OVEA 3JVSA 3TZMA 2P0CA 1WBVA 2JIIA 2QHMA 5AUUA 3GCUA 4YC6A 2XJ2A 3HV4A 4IWPA 4FTNA 5CF4A 4G16A 2Y7JA 2DS1A 2X7GA 2QOKA 4IB5A 3R83A 5CB4F 5G1XA 4YR8A 1A06A 4LRJA 4QTCA 3QQJA 3RPRA 3FZRA 4ASDA 3N6RA 1FOTA 1XH9A 5B2LA 4UWYA 2LAVA 2IZTA 2QG5A 4QP1A 4XYMB 2WOUA 4D4SA 1ZY4A 5EZYF 1QMZA 4C4JA 3TUBA 2XK6A 3PA5A 3IQ7A 4MNFA 3LZBA 1YW2A 4Y72A 3Q4CA 4YZDA 2YITA 3VUHA 4EH3A 2C3IB 2QO2A 4GG5A 4ZTLA 3Q9XA 4FG8A 4AZEA 5CEOA 2PUPA 3ZXTA 3MB6A 1WVYA 2QKWB 3F7WA 3LFEA 4H1JA 4BCNA 5KHXA 2RIOA 4CMUA 5IEVA 3R8PA 4Q5EA 3EJ1A 3ORNA 4TW9A 3DNEA 4YZMA 5CZIA 2Z04A 5HIEA 3NZ0A 3SRVB 4R3RA 4FV3A 4L3LA 4ZTRA 5AM6A 3RAWA 3GC0A 1F0QA 2OI4X 4PUZA 4U7ZA 5JQGF 3I6UA 1PHKA 3P1AA 3CQEA 3TZ9A 5I9WA 1UV5A 4S31A 3KL8A 1J3HA 5GJDA 2OGVA 3OOMA 3EQPA 4EI4A 4M84A 3I7BA 2DWBA 4CFVA 5IA2A 5JFSA 1DV1A 5HNBA 5KKRB 4ZK5A 3FLWA 5HHWA 3CD8A 2ZMCA 3TW6A 4TY1A 4RC3A 4F99A 4ZOGA 4YJ3F 3A60A 2O0UA 3ZHPC 2C6KA 4NJDA 4MXAA 5IH5A 4YTFA 2C4GA 3CTHA 4QPAA 3KN5A 4MKCA 2XK3A 3ZFMA 3KXHA 4GIHA 5KBQA 3UTOA 3CR0A 4H36A 3DBCA 3O96A 4FFLA 2B54A 2UW4A 4XG6A 2PVFA 2QKRA 3OCBA 3R22A 3BLRA 4RSSA 3HDNA 2FSMX 3KAKA 4C5CA 1YXVA 3F3VA 3R1SA 4DEEA 2C3LA 1JKJB 5JQWA 4KS8A 3R9RA 3LW0A 4NSTA 4YHTA 2OIBA 2JIUA 3PRIA 3EN7A 4XMOA 2GHGA 2R87A 3CKWA 3LM0A 1GSAA 5E8SA 3U4WA 2GNIA 3H30A 4EKLA 2YZNA 4O7SA 3WIGA 3LQ8A 4U40A 2H8HA 3F88A 5ACKA 4BDGA 3KC3A 2WTWA 5FM3A 2CKPA 3AMBA 5I9YA 2C6TA 4Z7GA 4IFCA 5H8EA 3QAME 3G8CA 1OUYA 3AC2A 3HGKA 4GG7A 4J98A 4FOCA 4BDEA 5EDQA 3LVPA 4KINA 3R04A 4WHZA 1OECA 3PP1A 4BI0A 3HP5A 3C4FA 3R21A 5E1EA 1IEPA 5HBEA 3FZPA 4YTCA 4MVFA 1YOLA 5ETAA 4APPA 2HWOA 2F7XE 3BU5A 1UKHA 3QUDA 4XUFA 2W5AA 5AUXA 2FSTX 4YO4A 5JMSA 3V8WA 3FSKA 2IVTA 3GUBA 4MEDA 4IVBA 4DEHA 1K2PA 3ZS5A 2OU7A 3ZLSA 2BZIB 4CXAA 5IU2A 5FDPA 4DTAA 4O0UA 4BCGA 3TACA 4HVGA 3AC3A 5JKGA 1M6VA 3S00A 2YFXA 4MK0A 3FSFA 1ZOGA 5E8VA 3A2CA 3UNKA 4M0ZA 4J95A 4RX7A 4BBMA 1MUOA 3I7CA 3LQ3A 4EC8A 2BRBA 2G2IA 4Q9ZA 4YPSA 3REPA 4BR3A 5LOVF 3LJ2A 2GNJA 4DEBA 4O6EA 1R1WA 2G2FA 3PXRA 2O3PA 4YTHA 1IAJA 4WRGA 3HL7A 3TIZA 1KBLA 2R7LA 2CN8A 5EYKA 5DWRA 3R0TA 2P2IA 4FV4A 3TUCA 3Q6WA 3HA6A 3WZDA 2ZDHA 4RJ8A 1H8FA 5IQGA 4RIWB 5E90A 4TPTA 3FY2A 4RFZA 3NAXA 1R3CA 3DY7A 4AA0A 2X39A 4U45A 2CNQA 3VJOA 2E2BA 2W1GA 1J7IA 2UZNA 2HYYA 2X9FA 3CE3A 3EKKA 2JDSA 3GEQA 4GIIA 2PMOX 4GFGA 4MHAA 3V4ZA 2WTKC 5DGZA 2ZM1A 3DLZA 4M68A 4AZVA 3TV7A 4KKEA 4FSNA 2PUUA 2XKCA 3OXZA 4YC8A 4YPDA 4EJ7A 3VAPA 3ZZEA 2WU7A 3AXWA 3VBWA 3F3ZA 1REJA 4E4NA 4FTOA 3ULZA 2CJMA 2O65A 3E63A 5CLPA 1YDSE 2IJMA 4EEVA 5KKRC 3PIYA 3Q60A 4D4RA 3P9JA 3SG8A 2BRNA 5H9BA 3UOKA 2R7BA 2VGOA 3F5GA 5A4CA 2QOOA 3O50A 5A3XA 2UW9A 4YHFA 4PY1A 2GNLA 4XOYA 4PMSA 5C01A 5CEMA 4FKWA 2V22A 4IM2A 3BX5A 4YNOA 4XEYA 3D7TA 3MJFA 3OHTA 3ZOSA 4V01A 1PXPA 3L9PA 3PY3A 5DN3A 4IZYA 3KULA 3MFSA 3E7OA 2R3LA 2VTMA 1MQBA 3W2SA 3ZLXA 3NUAA 3QCQA 5CU0A 3OTVA 3PXFA 4NUSA 4I55F 3PRFA 3R02A 3C9WA 4R6VA 3IGOA 4ALVA 3CY2A 3FQHA 3DFCB 5HE2A 1V0BA 3HAMA 3PY0A 5IG1A 5M4FA 2UZWE 3MYGA 1OL5A 3FPMA 5HTBA 4PWNA 5FXSA 4DH8A 4PNKA 1U54A 4ZAUA 2O2UA 4B8MA 3AT2A 4BTFA 1W93A 3SE7A 3ORLA 2YDIA 3HEGA 4MV4A 1PXMA 2WQOA 2XNBA 1R39A 3RZBA 3T3VA 3AOXA 4YC3A 3GIDA 2Z02A 3BU3A 4Y73A 4CV8A 4UYAA 5LA6F 5IMXA 2W1IA 1J91A 5EHLA 5EQEA 3SD0A 4EH2A 4FMQA 4XP3A 1Q41A 3RV4A 4HPTE 3UOHA 5KO1A 5AX3A 1YOJA 4DFBA 4UN0C 3HV7A 5AFVA 5AAFA 3SW7A 3PIZA 4HCVA 5M56A 4AZTA 4ACMA 5I9UA 4XV3A 4AGCA 3GU7A 3FKNA 5HCXA 2VPQA 2XRWA 4M67A 4ZTSA 2P33A 4L67A 3MA6A 2UZEA 2X4ZA 4H3QA 5HTCA 5J9YA 4C02A 1JKLA 2FUMA 4CCBA 4R77A 4DGOA 4F63A 4AE6A 2R85A 5IQBA 5J9ZA 1JOWB 4LV8A 3RMFA 1OIYA 4YBJA 5AEPA 1IA9A 3LFSA 3FWQA 2ZB0A 4NW6A 2BAQA 3E8EA 2HY81 4CSVA 4O81A 1Q8YA 1WBOA 3L9LA 3IK3A 4R78A 4O21A 3HRBA 4F64A 2QU6A 5E91A 1R0PA 3QXPA 3U87A 3JR1A 4RZVA 4QMOA 5CEQA 2IP4A 3HLLA 4XV9A 2PVPA 1I44A 5JVDF 4FZDB 4GCJA 4QYHA 4BDJA 3N51A 3RAHA 2UUEA 4RIXA 3MY0A 3GP0A 4O4HF 1IA8A 3C0HA 4WG3A 4WSYA 2VNYA 3FI8A 1O6KA 1O6YA 2PMNX 2W4JA 3AC1A 1OKWA 2VWIA 4O7YA 4DFNA 3EWHA 2PBZA 5HO8A 2YL2A 3QGYA 3ANQA 4XP2A 2W9FB 3SXRA 1LP4A 3WZEA 3CLYA 3LFCA 4GVJA 4YO6A 4CRSA 4B7TA 2JAVA 2CKEA 2Z7LA 3KGAA 4I92A 2NRUA 4E6DA 5KMNA 3HBLA 3A7FA 4GMYA 4KWPA 1OPKA 3ZH8A 4N57A 4NYEA 5K4JA 4A9SA 3L1SA 2LGCA 5BMMA 1AUVA 1GZNA 4F9BA 2VTAA 4ZJIA 4OT5A 1W7HA 4ZTNA 3VNTA 4Z7HA 5KCVA 3I60A 2B55A 4FK6A 1XH7A 4J8NA 1PJKA 1JKKA 3EN6A 4TXCA 3I4BA 3VF8A 2OIDA 4QT1A 1QCFA 5DHJA 1Y8YA 3NMUF 4FVPA 3V5TA 1OPLA 3POZA 5AP5A 1NW1A 4I0RA 4EGJA 5CF5A 3PVWA 1G8AA 2WIPA 3FZSA 1WBWA 2WMQA 4UY9A 3R8VA 3VRYA 4FZ6A 4E26A 2WGJA 1H00A 3L8VA 3FEGA 4FSZA 1GZOA 1XKKA 4BDDA 4D1ZA 1U46A 5DI1A 3QTWA 4HOKA 3I81A 5DLSA 1W0XC 2PMIA 4AW5A 3Q53A 2DLNA 3U4UA 4Y5QA 3FY0A 5AWMA 4KS7A 2V7OA 5DH3A 5IZFA 2AYPA 3ZFYA 3SC1A 2RFNA 3GOKA 5HE0A 4DGMA 2HZNA 4AG8A 4F9YA 4ALUA 2PUNA 3MJ1A 2CNVA 4C37A 2X8DA 3BELA 2PHKA 1TQIA 4FFMA 1CKIA 3UQGA 3WBLA 5D12A 3RWPA 2NU7B 2ETKA 4I5CA 5IDNA 5CYIA 4BBFA 2PUIA 3LCOA 2CZGA 4FUXA 4MV3A 4FSTA 4QSHA 5JVLA 4FV5A 1HCKA 4GL9A 3G9LX 4EORA 2W71A 2WTVA 4EK3A 2V5QA 3TNQB 4LL0A 2PWLA 4D0WA 4GV1A 1XR1A 1YXXA 3GU4A 4K77A 4ZTHA 5TF9A 1BXRA 1S9IA 2JDRA 2WMWA 2XKDA 4YGAA 3K5IA 4M97A 3KN6A 1NXKA 1YXSA 5DA3A 3VVHA 5KMMA 1EH4A 4ZS0A 3Q5ZA 3DCVA 4IB3A 3AW8A 4E4TA 1T45A 2R9SA 2P4IA 4R7HA 4QQCA 4AZWA 2PN1A 3VW6A 4D58A 4OUCA 4UX9A 3Q2MA 1U4DA 4XLIA 4EQUA 3A99A 2IVVA 3LCSA 1ZZLA 5I9VA 5HQ0A 5E8XA 4A7CA 4MYGA 4RIOA 4FV2A 3FHIA 3QCYA 4ACCA 1TQMA 1LEZA 1XO2B 2PK9A 3OOGA 2GPSA 3KVWA 3CD3A 1LEWA 3SDJA 2RL5A 4ZY4A 4FGRA 3EFWA 4PQNA 4I6BA 2DZDA 3UVRA 4ACHA 3MJ2A 3MH3A 5DRDA 1MRVA 4FV1A 2UV2A 3EN4A 4K2RA 4TYGA 2J0KA 5IQIA 2HWPA 4I5MA 1W82A 4TWOA 3PPJA 4MNEB 4RQVA 5AP3A 2X8EA 4V05A 3FL4A 3PJ2A 1DAYA 3FQEA 2Q83A 3NCZA 2XIZA 3A7JA 2JKOA 3HMNA 3TNHA 1Q3WA 4HVHA 3V4SA 3MB7A 1FGKA 4MXCA 4ZLOA 4EH8A 4YJ2F 2EXCX 5BVDA 2BZKB 3OS3A 3TNIA 4FIJA 5LARA 3FC2A 4EOJA 5LVOA 3BI6A 4RIYA 3S1HA 2FGIA 3IW5A 5CXZA 4EYMA 4FKPA 5HLPA 5DOSA 5B0XA 3CJGA 4DAWA 1JLUE 4AAAA 4QMPA 1A9XA 3LMGA 4FYNA 3NUUA 3R8ZA 3VN9A 1UA2A 2YM5A 3RUPA 4OTQA 2YN8A 4WNKA 1J1BA 3RI1A 1EUDB 3JXWA 4L52A 3DB6A 4L42A 4I0TA 4KBKA 3LLTA 3TZ8A 2W1ZA 3EOCA 4N4SA 4X2FA 4S33A 4DLIA 3A61A 3PVUA 4HYIA 2F4JA 3PUPA 4DGNA 3OROA 4AGDA 3NPCA 4DFUA 4EUTA 2YHVA 2OH0E 2RF9A 2IW6A 3KMWA 4K8AA 4R1YA 3WYYA 1NVSA 4DFXE 3K5HA 4DG2E 2ZDUA 3EQIA 4WUNA 3FL5A 4YJRA 2W6QA 5CA0F 5EM8A 1B6CB 5JH6A 4ZSJA 2W1FA 1ULZA 3H0ZA 5ANIA 3MV5A 2V62A 3HRCA 3CGOA 4YJOA 3ZBFA 3NUXA 2Y6OA 4CZTA 2PZIA 4FOBA 4CGAA 4U79A 5IA4A 3DXQA 4RGJA 3MVLA 3NYOA 1E1XA 2BAJA 3IOKA 3O8PA 4FT5A 4UALA 3V5PA 2PE1A 4HVSA 2W96B 3LKMA 3OT3A 4JBPA 4ZJJA 3RM6A 3CS9A 4PF4A 3EFKA 3NGAA 1P4OA 3WZUA 3EHAA 1AGWA 4YLJA 2GDOA 2QVSE 4U0IA 2DYLA 3D7ZA 4CLIA 3PY1A 3DK3A 3PDTA 4FG7A 4N6YA 5CVHA 3V51A 2WMXA 1FMOE 1YHSA 3DQXA 3FMHA 4MWHA 2QD9A 2VV9A 3KXNA 3OXTA 1AQ1A 3MY5A 4WRSA 3ZO2A 4A9RA 4BBEA 2QLQA 5AA8A 1CS0A 3QA0A 4TYHB 3A7HA 4P5QA 1UU8A 4I41A 4J97A 4RVMA 4X21A 3VQHA 1GIJA 5CU4A 1KEEA 2HIWA 3PVBA 1PXNA 4P90A 4QMMA 2FPIB 4B4LA 3D83A 5HEZA 2B52A 3F3UA 1H26A 3R9DA 3R9NA 2HW6A 2F2UA 2X8IA 2VTJA 4UV0A 3RNIA 2V55A 3Q4TA 2BROA 2PVNA 4EOQA 5AIRA 3C4ZA 3R71A 3R73A 3AC8A 3PP0A 5HORA 1WR2A 4GYIA 4KBCA 2OFVA 1BI7A 3O0GA 4Y83A 4QMNA 3SOCA 3UG2A 3FMKA 5IISA 4WO5A 4IEBA 2YRXA 3TIIA 3FZTA 2ACXA 4RQKA 4NFNA 3QYZA 2R7KA 2W6MA 4EHZA 1SVGA 5ANGA 5HCZA 1WBNA 4TNDA 1P5EA 4IC8A 4YSMA 3VS2A 2X81A 5IDPA 5M44A 1BX6A 1GIIA 1V1KA 5CEIA 3G90X 3R5XA 4DG3E 2BUJA 4YZBA 5JZNA 1BMKA 4F08A 3HZTA 4KABA 4JDJA 2ITWA 3WZKA 3V8SA 5IQDA 2J7TA 3BWFA 2FVDA 2XCKA 2W1HA 3Q1KA 3EZVA 2W05A 4WBBB 4YBKA 4BZDA 1OKZA 2QR7A 3PSBA 3OUUA 2BIYA 3GCSA 1ZOEA 4LMNA 3T3UA 2OFUA 2YAKA 3OUKA 4F70A 5EM6A 3MS9A 3PYYA 5CU6A 3WYXA 4JLCA 2JFLA 2WMUA 4FYOA 2OO8X 3SXSA 1JWHA 2WU6A 3KRRA 2ONLC 4GJ2A 4QMSA 1GNGA 1M2PA 4GJ3A 4GFMA 4P5ZA 3O7LB 4DEDA 4GU9A 4PV0A 4Z3VA 2UW6A 4FV9A 2ITXA 2OLCA 4IX6A 1EZ1A 2WXVA 3I1AA 2JEDA 4NM5A 3TEIA 5GIOE 4EBWA 1V0PA 2HXLA 3C4CA 2YISA 4BCJA 2PVMA 3BV3A 2J90A 4I93A 4DFYA 4WD5A 5H80A 2XP2A 2RFEA 4JBOA 4KKGA 2RGPA 3HYHA 4AT5A 2R0IA 5CEPA 4DH5A 5ICPA 4FK3A 3DTWA 4IE9A 4KBAA 1MQ4A 3NW5A 3QC4A 1ZMWA 3W8QA 4QP4A 5ANOA 4EH7A 2F2CB 3QTSA 5HIBA 3GFEA 2VWUA 3OUZA 4FFNA 1RE8A 1ZARA 2WQEA 1ZMVA 4NKSA 3BHYA 1VR2A 2R64A 5HGIA 1YWRA 2WTDA 1F3MC 3ENHA 5J95A 1A48A 2YJSA 2F49A 4F65A 3R5FA 2W1EA 3NX8A 2C0TA 2UZBA 4EOMA 4FIGA 3BCEA 4R5YA 5C26A 2UZVA 3OW4A 4KSQA 1TKIA 3PA4A 3E7VA 3GC9A 3QTIA 4QMWA 1OITA 3IW7A 4FV6A 4FKRA 5KE0A 2WMBA 3GBZA 3NIEA 2VQDA 4OTFA 3U6IA 2O5KA 4E5WA 5DPVA 4GW8A 2EVAA 2OSCA 5L8KA 3AGMA 3ERKA 3QTZA 3C0GA 5C03A 3VS3A 2JLDA 4USFA 3QQFA 2YJRA 4I4EA 4WNMA 5CQUA 4BYIA 3BYVA 3W2OA 2UZTA 4I6HA 3R2YA 2R3KA 5BVFA 1OUKA 1CMKE 2NU6B 2PZYA 3EN9A 2VNWA 3QX2A 3W18A 2YCRA 3MI9A 1C3OA 3M42A 4QTDA 5HLWA 4U5JA 3R63A 4V0GB 3CBLA 1GZKA 2J2IB 5CAOA 2WFYA 4P7EA 4YUQA 3S3IA 4HGSA 3SOAA 3THBA 4A4XA 2BHHA 4G6OA
chains in the Genus database with same CATH superfamily
2YCSA 4Z16A 2Y9QA 4S32A 5HESA 3LXPA 4ME6A 1BI8A 3DT1A 3I0OA 4JMQA 5BVNA 5HU9A 3F3WA 4AP7A 3GB8B 3ACKA 4U3ZA 5AUYA 4IAIA 3WNZA 2Q2TA 1WAKA 4J99A 4IIRA 4K33A 2QONA 4IJ9A 4O91A 3T7AA 4O7ZA 3GCPA 5ANJA 1WBPA 3HKOA 3MFRA 5L8LA 3G6HA 4G17A 3H9FA 3UQCA 4BJJA 2YS7A 4JR7A 4E6NA 1I7LA 4FV7A 5E1SA 1Z2OX 2VTHA 5J8IA 1U5RA 4I20A 1G8SA 3KXMA 2PPQA 5EW3A 4BICA 3ETJA 5BWRA 3T9AA 5J7HA 3PFFA 4GT4A 2V58A 2CSNA 4UZHA 3O17A 3NRMA 3ZRKA 5AP2A 5BMVF 3QALE 2G15A 2B9IA 2OJJA 5E8YA 3RVGA 2YIWA 4E6CA 4ANSA 1DIKA 2J9GA 3WO0A 3AX6A 3IECA 5A6NA 3R8LA 2ABJA 3HV3A 5C27A 4EEQA 4L00A 2XK8A 4AZFA 4HQ6A 4KRCA 1A3GA 2VWVA 1XH4A 4QP7A 5AP7A 3H3CA 3COHA 3H4JA 1SVHA 4YTIA 3RPSA 3U9NA 4MF1A 4F1MA 3VPCA 2Q2UA 4JBVA 5JH7F 2ITPA 4NZWB 4QP8A 3NDMA 4FIIA 5H3QA 2JIVA 4JDKA 1KWPA 2A2AA 5KMOA 5CT7A 4O7TA 1JKSA 1URWA 2OJ9A 4MA0A 3R7OA 1ZWSA 3ALOA 2WTKB 3MTLA 1CM8A 2IG7A 4WA9A 5EHYA 4BCIA 4ENXA 4K6NA 5EOBA 2XANA 3W55A 1XH8A 3MFUA 4FUYA 4BCOA 3T54A 5DGHA 4D9UA 1ZRZA 4RWKA 2GCDA 3KQ7A 4O2PA 4W4VA 1W98A 1UC9A 5JK3A 2A1HA 4KNBA 3KXXA 2KTYA 4R5SA 5DNRA 5AV1A 2QR8A 4D5KA 2NPQA 3R1QA 3B8RA 5E7RA 4O7LA 3ZONA 1Q8WA 3FI3A 4YJUA 4M15A 1YKRA 2OKRA 2YIQA 4E6AA 4PDPA 4CQEA 3DTCA 4BI1A 5FBOA 2IZUA 4MV7A 4ZZOA 3B2WA 2X0GA 4NCTC 5DR9A 2C6IA 1OPJA 3TL8A 3R5HA 4C36A 5LJJA 1IAHA 1ZMUA 1KOBA 3ENMA 3OTUA 4LL5A 4MAOA 3BV2A 4IZ5A 5FDXA 4CV9A 5LWMA 5TO8A 2ERKA 3DLSA 5A4EA 3NBZB 4JOAA 4XOZA 5FTGA 4BDIA 1ND4A 2JDOA 4UBAA 3TYKA 3VF9A 3FUPA 5A4LA 2HIVA 3EQFA 2XRUA 2XNGA 1YVJA 3TEKA 3BLAA 3EQGA 1M2RA 5D7VA 4PZ6A 3FPQA 4ZLZA 4EH4A 5HBJA 4L53A 5AP4A 5A9UA 3QQGA 1YXUA 4XS2A 1MP8A 4WOVA 2ZM4A 1FGIA 3VIDA 1T36A 3FXXA 3BLQA 5IA5A 4MWIA 4QOXA 5AV3A 3BYOA 4O38A 3V5LA 4CFWA 3F5UA 3GC7A 2COGA 3QX4A 1JDEA 4PL3A 1QPDA 5JQ8A 3FLZA 5AA9A 1KOAA 2XM8A 4I24A 5CT0A 3FZOA 3FXZA 4AOTA 3OWPA 5AUTA 1OKYA 3VBVA 2YRWA 2BKKA 4HGEA 4MUQA 4XH6A 2FSLX 4DBXA 4IWXA 5E25A 3RFCA 2CKQA 2G1TA 4PRJA 3SLSA 4DC2A 3KXGA 3U6JA 3IDPA 3R9HA 3E88A 2HK5A 3GQLA 4W4YA 3F6XA 3G33A 4IX4A 4DTKA 2QNJA 3LFDA 2C3KA 3P4KA 4C4HA 3VO3A 2ITUA 1YWVA 3D14A 1X9NA 2OLSA 1FBNA 2QHNA 3QLFA 3OCTA 1PXLA 4L3JA 2VO0A 4Y46A 3ORPA 2W6PA 1CSNA 2W1DA 3JY9A 5ACBC 1I7NA 5H8GA 3JRWA 2X1NA 1OGYA 3F9NA 2CGWA 3C4EA 2DAAA 3VUGA 2XF0A 3ROYA 4NWMA 1G8KA 2DIKA 2RG5A 3UP2A 3C13A 5BVEA 5EH0A 4XBRA 4OBQA 2XD4A 4IWOA 5FXRA 4C33A 4DG0E 4AW0A 1ST4A 3U6HA 4LMUA 3P78A 2WAJA 3QD3A 4FG9A 4NKAA 4HGLA 2FB9A 3S4QA 1JNKA 5K5NA 4ZJVA 3RAIA 3UIXA 2QI8A 4AOIA 3S2PA 3KY2A 1KJ8A 4DINA 1HOWA 5D1OA 1ZZ2A 2WEVA 4CE5A 5BYBA 1Q8TA 3OCGA 5L2TA 5LCKA 4XBUA 2XNMA 2ZDTA 1P16A 3LXKA 3IW6A 4XHKB 2Q0NA 1H0WA 5KUPA 4QP6A 4FKJA 3TCPA 1B6RA 2HGSA 3KB7A 4UFZA 4LG4A 3KF7A 4NM3A 3DQWA 3KK8A 4BC6A 1WVXA 3DB8A 5CTPA 5TOZA 3UNZA 4C3PA 5KKNB 1WMKA 3GB2A 1B38A 4HNFA 5EI6A 3W0MA 1A0GA 4HVIA 5C1QB 1B6SA 3PPKA 4EYJA 2ZYBA 3PVGA 4M0YA 3FLYA 3ORKA 4E1ZA 3ETHA 5L2SA 4BKJA 2WO6A 3DPKA 3IW8A 4IBMA 4EOOA 4IX3A 4AX8A 4MBLA 4TWPA 5A54A 4NM0A 2C47A 2W4OA 1OBGA 4JX3A 4QYGA 5DT0A 2ETMA 3V6SA 4BIDA 3PE1A 4XG8A 3G0EA 5E9EA 5KMKA 2XNEA 3I79A 3QZFA 4L68A 3WE8A 3NW7A 4QQTA 2WZJA 3QQLA 3D5XA 4BYJA 5FEEA 3F5XA 4Y95A 4FKVA 2A27A 1SMHA 3V5JA 4AACA 5LXTF 4EOLA 3UDTA 3G5DA 1Q97A 3LE6A 3S0OA 3CPCA 4GLXA 3F2RA 2GQGA 2Y4IB 4AA5A 5HG5A 4WIHA 5BYZA 4FSYA 2FA2A 4FT0A 4ID7A 4DHFA 3LFQA 4JL9A 1NVRA 4EOPA 1CDKA 3QQMA 3PJCA 1H24A 3JYAA 4GS6A 1STCE 1O6LA 3O8UA 1FPUA 2ITOA 3Q96A 4FKIA 4RC4A 2BVAA 1BYGA 4EK5A 1G5SA 3ZEWA 3BAAA 3EFJA 3QKMA 4AOJA 3UZOA 1YDTE 4G6NA 4IH8A 4WBNF 2AUHA 3K2LA 2B9JA 3D94A 2Z8CA 5LMKA 3D0EA 4WT6A 4EH5A 2OZAB 3L8XA 3AMAA 4AXFA 4GVAA 3BACA 3AGLA 3F3TA 4M69B 1BL6A 4ASZA 3O8TA 2OXYA 5C1OA 2VX1A 2WIHA 2W5HA 3D2KA 3FMNA 3VWAA 4W4XA 4C62A 4XP0A 4UCTA 5KX5F 2IWIA 2HGWA 2R3HA 3FXWA 1CKNA 3RTPA 4C4EA 5EKOA 1TFFA 4X2KA 4OTIA 3MWDA 4F7LA 4HNIA 4O96A 2OJIA 5AP0A 3BGZA 1ATPE 4MXOA 4S2ZA 4ZLYA 5HNGA 3QHWA 4XG4A 1QPJA 2YAAA 3KXZA 4BGHA 4CMTA 3D2IA 3BU6A 5M57A 1EKFA 2QOQA 2QO7A 1E4EA 3TKUA 2FPGB 4HCTA 2DQ7X 3OZ6A 3SHEA 3SQQA 2Y8OA 3COIA 3QHRA 1VYWA 5JGDA 1JDBB 1UNGA 2YM4A 5EG3A 4F4PA 5L2WA 5BYAA 4I0SA 3W2QA 4FKGA 4E7WA 3DJ7A 1A9UA 1BLXA 1L3RE 4RT7A 4IX5A 3NUPA 4G5PA 3O2MA 1NY3A 5HVYA 5TR6A 3GT8A 3GENA 2B0QA 4GK4A 3UIBA 3ZDIA 1IASA 4YLLA 3RP9A 5LVMA 4APCA 3ZMMA 4FFPA 5FLFA 3BEAA 3LFFA 4O7NA 2VX0A 4FZFB 2ZB1A 4W8EA 5DFPA 3UFXB 4U9AA 5A46A 4LM5A 4UWBA 3CTJA 4PDOA 3C51A 5L6OA 4IHPA 3NNWA 4EHEA 5BQ0A 2Z60A 3GJXB 3OY1A 1PXOA 1XH6A 1KV1A 3BQCA 2UW0A 1Y6AA 3F61A 2BTRA 2Y0AA 3GI3A 5E92A 3SAYA 4AXEA 1B04A 4R3CA 2EUFB 4XX9A 4CCUA 3BHVA 1ZXEA 3PFYA 2VTTA 3R30A 4FIEA 3RPVA 4A9TA 2PZRA 4ZTMA 5GIPE 4L1KA 4FSMA 5AV2A 5KZIA 4M14A 4MNEA 3RK7A 3OEFX 3BGQA 3P5JC 4FNZA 4AZSA 1DS5A 3MPAA 1GZ8A 4PMTA 5DBXA 4ZOLF 4O0VA 3V6RA 5EQPA 3AC4A 5D1JA 4QMQA 4EC9A 5KX8A 2J0IA 4LFIA 3GGFA 2R7NA 3DOGA 3COMA 3N8DA 3PZHA 2WMTA 2WB8A 3PIXA 3E87A 5CSXA 4BTKA 2ONLA 4LYNA 5HD4A 3DDQA 2YM7A 3FMMA 3RK5A 5KMJA 2HIXA 2XNNA 4BZOA 1ZLTA 2OBJA 2WQBA 2ZV7A 4JJRA 2PVLA 3ORTA 4JDHA 2XBJA 4IM3A 4EHGA 3R01A 4FL3A 5HG8A 1JSVA 4NL0A 4F6WA 4JR3A 4HYUA 4DN5A 4Z55A 4D1SA 2IW9A 2FO0A 4BCQA 4BVUA 5EM5A 5FM2A 4G1WA 4FSUA 4F1OA 2Y4IC 1Z9XA 4LRKA 3U55A 1CKPA 3UZPA 4CFMA 4FC0A 3QL8A 4RWIA 5BNJA 1FMKA 5EK7A 3W2PA 5D7AA 1IYDA 2I87A 2C6MA 4CNHA 3WF7A 4DIMA 3BE2A 2Y4PA 3UC4A 3W0SA 5CA1F 3BYUA 2GPWA 5IA3A 1NVQA 1UU7A 4RLLA 2OWOA 1G8JA 1U54B 5CANA 4FT9A 4RJ4A 1CKJA 1SNXA 1ZOHA 4JXFA 3ZUUA 3E62A 5IEYA 1PF8A 3PTGA 2QLUA 3HUCA 3QFVA 4FODA 4IVAA 3NS9A 5C8KA 4DCEA 3MWEA 2JFMA 3FI2A 5BX0A 4FIFA 4ACGA 2EXMA 4RC2A 4GU6A 4ZXTA 4IDVA 4CKIA 3PG1A 2VWBA 3BZ3A 3IO7A 4U97A 3W2CA 4G5JA 2C68A 2QOLA 2WNTA 3WILA 2QK4A 4K0YA 4A9UA 3A4OX 2GLTA 1QL6A 2W6OA 3RM7A 5HBRB 5J9LA 4HNUA 4LGHA 4YZNA 2OG8A 3VUIA 4AFEA 1M7NA 4CKCA 3VUKA 3DNDA 2Z7RA 2W99B 4C3RA 4HVDA 2VR1A 2BRHA 4C7TA 5DE2A 2X4FA 4ANLA 2ZV2A 2QQ7A 1CE8A 1KJ9A 2WMVA 4TWNA 5JFWA 4UXQA 3P08A 1XBBA 4RJ3A 2NP8A 1XJDA 4RVTA 3E5AA 4G9RA 2VTLA 4TYHA 4CZUA 5JGBA 2GFSA 4G9CA 1OL1A 5HE1A 3S95A 1OIUA 2FH9A 4G3GA 2UZUE 4QTAA 3NNXA 2QCSA 2OICA 1VEBA 3LCKA 3A62A 4BDKA 5CAQA 1SCUB 4EWHA 5CAPA 3RV3A 1R78A 2GU8A 3LMHA 3LFBA 3TNPC 1REKA 5LCJA 3ZBXA 2OF4A 4BCPA 4FKOA 5EI8A 1UVRA 4DHJA 3ZZWA 2A0CX 2GHMA 3C1XA 2VTRA 5DT3A 2WD1A 3DKCA 4RWJA 4DEIA 2B53A 2PVRA 4E8AA 4RIXB 2EU9A 1GAGA 2B4SB 4C3FA 2VWXA 4QNYA 4M3QA 2IZRA 4LI5A 4DEGA 4UZDA 4NTTA 5CSVA 4KD1A 4QNAA 2XIRA 4EQMA 4FA2A 3KCFA 3VBQA 2XCLA 3GVUA 4C4IA 4L46A 3IOPA 3TXOA 4EOSA 2I0HA 4AWIA 1QPCA 4PTCA 4DCAA 2FPPB 4WKQA 2HZIA 4QP2A 5I5SA 1IOWA 2BFYA 4U81A 3K54A 3KRXA 2YA9A 3L2PA 4OT6A 1ET0A 1H01A 2B9HA 3MESA 3DJ6A 4WBOA 3M1SA 3N4VA 3FYJX 4FEUA 5FG8A 5HE3A 3V8TA 2W6NA 3NAYA 1PXIA 5CY3A 4NH1A 5HG9A 3BQRA 3KREA 5FPRA 2C6DA 3FV8A 5F9EA 4TTHB 3BE9A 3UDSA 5EKNA 2HAKA 3PFQA 3IONA 3PSDA 2QOFA 3PJ1A 1SZMA 5JN2A 4PZ7A 4LUEA 1F5QA 3JS2A 1VZOA 3U51A 4FI1A 3UNJA 4A9YA 3ELJA 4DBNA 4EZ5A 1JLLB 1KT8A 1OBDA 3DAKA 4ZMEA 4X6RA 3TJDA 2C0IA 2IO6A 4WG4A 2E9PA 2VWWA 4QP3A 3L9MA 1LPUA 4RJ7A 2XH5A 3GCVA 5I0BA 3SA0A 4JVGA 2W70A 2A4LA 3N4UA 2REIA 3SKCA 2YM8A 1MRUA 3GLKA 4XLVA 3DXNA 4MBIA 4XG7A 4D4YA 4CT2A 2EJ3A 4O2ZA 1WBTA 1APME 1MRYA 3LQ5A 4YZCA 2OJGA 1Q8UA 2VO6A 4P2KA 4ANMA 1DV2A 4K6ZA 4J7BA 4FR4A 4X7QA 5HD7A 1URCA 4O7RA 3Q9YA 4FTIA 4DFLA 1M2QA 4IANA 3I5ZA 5FP5A 3WF5A 2G01A 5BWTA 4EZ3A 3G0FA 3QKKA 1PK8A 3UYSA 3JUHA 5J5SA 3VPBA 4I50F 4TM5A 5JRQA 1BKXA 2IN6A 1SVEA 1GOLA 2J4ZA 3C5UA 3LLAA 2C6LA 4FTQA 2WYOA 1PYEA 2KULA 3EIDA 3MIAA 3HV5A 4PP9A 5JRSA 4TUYF 5IQAA 1YQJA 5HV6A 3CP9A 4TZRA 3UGCA 3O5AA 4IFGA 4ANQA 1GSHA 3BG5A 4H1MA 3OCSA 4IB0A 1Q8ZA 3U9TA 3NUYA 3QUPA 5F20A 1Z2PX 3G9NA 4O0TA 5FD2A 5M4UA 4I23A 5BV3A 3PZEA 5BMSA 3GXLA 5IEXA 3R28A 2XNOA 4H05A 4XV2A 4O2AF 3QKLA 2H34A 2OK1A 3DBDA 1OI9A 2CHLA 2GNGA 2PVYA 3H9RA 2ZVAA 4JX7A 4X6QC 5L6WL 2WTJA 3FLNC 1IRKA 3GNIB 3I5NA 4I94A 4FVQA 5LVPA 3DKGA 2UW3A 2HENA 4IWQA 3QU0A 1ST0A 2ZFYA 3F82A 3P79A 4RPVA 5T6KA 2YCFA 4JG7A 2CGVA 5EFQA 1TA8A 4JQ7A 3FMDA 2R3RA 2YABA 4IZ7A 4PMMA 3Q4UA 4OBOA 3V5WA 3ZUTA 4AU8A 5CU3A 4N0SA 4JG6A 1Z2NX 2W6ZA 4G3EA 4AN9A 4GT3A 3E8CA 4HZRA 3FJQE 2HVQA 4EKKA 4EK4A 2JBOA 4O7VA 1OL7A 5JGAA 3VA7A 3WE4A 3ZYAA 3R23A 2VZ6A 4AW2A 3E3BX 2BRGA 4F9AA 1YOMA 4OTWA 4HCUA 2HY0A 1QPEA 1JPAA 3ZO1A 1WFCA 3QBNA 4U6RA 4V0GA 1CQIB 5GNKA 3HX4A 2X2MA 2X2LA 1DGSA 3P86A 3QWKA 5C9CA 2A19B 3FQSA 3FE3A 2UW7A 4I4FA 1UKIA 4JAJA 4GKIA 3G15A 1U59A 4ANBA 2WMAA 4I6FA 3KCKA 3ORMA 3QF9A 3VS4A 1KJIA 4PDYA 3JVRA 4HGTA 4NZNA 2C5OA 3DA6A 1GLVA 4CG9A 2EWAA 4ZS4A 3EQCA 5I60A 4CFNA 3DKFA 3PWDA 4FVRA 3D5UA 4B99A 4QQ5A 4BIEA 4CLJA 3N9XA 5FP6A 4C2VA 4DGLC 4M9UA 4CKBA 5FRIA 3OXIA 2XIYA 4RIYB 5BVWA 3D4QA 3QZGA 3BKBA 4FTRA 4RFYA 4ERWA 5IA0A 3W1BA 4OR5A 4C4GA 4EJNA 3D5WA 2ZOQA 4QMXA 4AUAA 4E5BA 2YM3A 5AP1A 3VUMA 2YZMA 4X3FB 2I0YA 5CWZA 3D15A 4O82A 5IUGA 1Q99A 2VTIA 2VUWA 3KRLA 4PL4A 2UW5A 1OL6A 2GS7A 4FSRA 4F7JA 2R3PA 3SGIA 1LUFA 5D41A 3EQHA 3ZM4A 5J1VA 3ORZA 5AJQA 5AUVA 3LOKA 3OBJA 4AA4A 5HO7A 5I4NA 1M0WA 4D28A 5BPYA 5HU3A 2JAMA 4XG9A 4R7BA 3BABA 5CENA 3HB9A 3ZCLA 4XCUA 2XMYA 4FFOA 4LOPA 5TKDA 3W0QA 4CD0A 2WTIA 3OG7A 2OJFE 4E93A 3GU5A 2BZJA 1PXKA 4RJ6A 2PMLX 1FVRA 4DEAA 5BUEA 2SCUB 1DAWA 1P14A 4GUBA 5GJGA 4BGGA 4I1ZA 2X7FA 3VS0A 3WZJA 4C4FA 4CVAA 3UPZA 2R82A 1YHWA 2WMSA 4IAYA 4PX6A 3TM0A 3C50A 1M0TA 4DF3A 2R0UA 3SRVA 2I8CA 4BB4A 1O9UA 3QUEA 3EYGA 4QPSA 1FVVA 5M4CA 5CXHA 5AMNA 4FV0A 4IWDA 4U42A 4Q5HA 3KFAA 4LGGA 4OGRA 5C1PA 3AC5A 4GH2A 3JZIA 4YBZB 4NTSA 3QZHA 5J2TF 2EJ0A 2XCHA 3ZUVA 3RJCA 5J87A 1EKPA 5M09A 1J7LA 4FL2A 3G2FA 3OF0A 3DJ5A 4IB1A 3N4TA 4JQ8A 3UO6A 3DF7A 5M53A 3FBVA 2W5BA 3LXNA 5TT7A 1VLRA 3RK9A 4E6QA 3OUNB 1FVIA 3DBQA 2JDVA 3IPHA 3U9CA 4JRVA 3CEBA 5IYZF 1CQJB 1FQ1B 3U54A 3P23A 2R3GA 2UZOA 1EYZA 3RWQA 1GJOA 3MH0A 2BR1A 3ZSGA 5FPOA 3SG9A 1UNHA 1G3NA 3MN3A 2XKEA 2VO7A 2GNHA 2VX3A 4DITA 4FEQA 3HAVA 4C58A 3UZBA 2FYSA 3CGFA 3HVCA 4O0YA 4ZTQA 5I5YA 4IJPA 5IMEA 3PE2A 4IMYA 2DWCA 3TINA 3F66A 1VYZA 3A7GA 2Q7DA 2IZSA 3D9VA 4N6ZA 4EK6A 3TIGA 1OM1A 3QA8A 4CFFA 2C5YA 4JBQA 4X2NA 4UCSA 1TQPA 3W10A 2RFSA 3UOLA 2ZJWA 5AADA 3WWHA 5LYJF 4H3BA 1C30A 3ZO3A 4EZ7A 5IF1A 3TJCA 3UBDA 3R8UA 3QXOA 3ODYX 3OWLA 4FIHA 3QZIA 4MA5A 2XK7A 2W0JA 3IDBA 3BIZA 3DU8A 4FEVA 3UQ8A 4RVKA 4FTMA 2QC6A 1KE5A 4RZQA 1H1SA 2ERZE 2AEGA 4YJQA 1I09A 2PYWA 3LAUA 4PNIA 2HCKA 3IKAA 2C6OA 2WTCA 3I0QA 4FTKA 1ZYSA 4QMVA 2GSFA 4K18A 4ZSEA 5BUJA 4FTAA 3K5VA 2VAGA 1Q3DA 5J1WA 3CXWA 5LOHA 4F78A 1FINA 4IM0A 2XM9A 4KIPA 5HI2A 4C59A 2BDWA 1K3AA 1K9AA 5CNOA 3VBXA 2PE0A 2YDKA 3GQIA 3II5A 3O23A 4BTJA 2PTKA 3FLQA 4MCVA 2HZ4A 5IUIA 5CF8A 3PLAE 3NUNA 1BNCA 5HNIX 1BL7A 5CU2A 4II5A 4OLIA 3UMXA 1XHAA 4ORKA 5LVNA 3NVKI 3UE4A 3VUDA 4XZ3B 4C5BA 2HZ0A 4ZZNA 1J7UA 3BHTA 1XBAA 3TKHA 4FU0A 4M13A 3UZRA 3W1FA 4XYLB 5DVRA 4FKTA 4LUDA 4X3JA 5CX9A 4ZP5A 3TG1A 5KBRA 2HVRA 2XALA 5AUZA 3SX9A 3FKLA 2HW7A 4X3FC 3F2NA 3NWWA 4FEWA 4AN2A 2PZPA 3WOWA 4QDVA 3RGFA 2ZAZA 3DFAA 4R7IA 5ANEA 3E92A 3W8LA 4BDBA 5AX9A 3VOTA 2PVKA 2R2PA 4U3YA 4BY9E 1W84A 4ZI7F 1UWJA 4HYHA 2E9NA 2BHEA 2Q0BA 5E8UA 3TT0A 5FUTA 5AAEA 4F7SA 3NYVA 3NCGA 4QMZA 3RPOA 2X9EA 3QYWA 4CC6A 3PSCA 4J96A 1YWNA 4FKLA 3VS1A 4F9WA 3DTFA 5CE8A 3G8DA 3P7AA 4RIWA 2YYAA 2XA4A 3GU8A 1WZYA 4K9YA 2O63A 3EQBA 4MBJA 5L6PA 3DGKA 2GS6A 1I2KA 4F1TA 1OIQA 2PSQA 3QD4A 4AFJA 4HR7A 3ETAA 2W06A 3G6GA 1W83A 2RFDA 3R00A 5CS6A 3AKLA 1H1WA 3NNUA 2GS2A 4CG8A 3QQKA 4FFRA 3BA8A 2JKKA 3DBFA 4BDFA 5A4TA 3CQWA 2P2HA 3RCDA 2PVHA 4FTTA 3SVVA 3WI6A 5K3YA 2CN5A 5IQCA 2R3JA 1H08A 3CTQA 3NW6A 1W8CA 3Q9WA 5A6OA 2CCIA 3DAAA 4NFMA 3QCSA 3OEZA 3ORRA 3QWUA 2G9XA 4BGQA 3UIMA 3E8DA 2WPAA 5IPJA 4UCRA 2P3GX 2V7AA 4EH9A 1XBCA 4NW5A 3CC6A 3EL7A 2BILB 3C7QA 2QURA 4NM7A 3PJ8A 4LQMA 3PJ3A 2CLXA 4J52A 2XK4A 3KA0A 4GSBA 4ZY6A 3R7VA 3DBEA 2OIQA 1JSTA 3HV6A 4Q9SA 1PKGA 2GQRA 3Q2JA 5HG7A 4ACDA 4U41A 3NEWA 3QTUA 4QEBA 2QB5A 2OXXA 4ARKA 4BI2A 4YJTA 4YJPA 3MPTA 3Q4ZA 3QRIA 4O6LA 2I7QA 2J0JA 5EYCA 3UVPA 1ZYJA 4BTMA 4C2WA 4DH3A 2HGXA 3Q3BA 5E8ZA 4ASXA 3VONA 4PMPA 5LXMA 2I6LA 2AC3A 2R3IA 5EM7A 3LIJA 5CVFA 2B1PA 1DI9A 3HUBA 4JNWA 3RHKA 1UWHA 2C5XA 3NLBA 3ODZX 4L01A 2OZAA 4FX3A 5GHVA 5IH4A 2NRYA 4JRNA 1YDRE 2X2KA 3UPXA 2V5AA 4TT7A 3WF8A 3FZ1A 5JFVA 1XH5A 1P2AA 2BPMA 4C5AA 4L45A 3R8MA 5LMAA 1PMEA 2AC5A 2E9OA 2QOBA 3MVJA 5B2KA 4I21A 1KE8A 4HNTA 3EH9A 1H27A 4JS8A 4TN6A 3T9BA 5DRBA 3CY3A 2XBAA 5FR9A 4EUUA 1Y57A 3POOA 4FGBA 2JC6A 2VTNA 1PMUA 2R3MA 5LMBA 4FT3A 3BHHA 3LXLA 1AD5A 4Y8DA