4O7ZA

Saicar synthetase (type-2) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
226
Chain Sequence
AKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-2) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 71
structure length 226
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7zA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7zA02
2VZ6A 4R3RA 2PMOX 4FV9A 3LP8A 1E1VA 3ITZA 4ZQIA 4O91A 1GIIA 1U5RA 4X3FB 2UZWE 4YB8B 2NP8A 2X6DA 2XIZA 5KMIA 2QOCA 4W4YA 4QP1A 5EKOA 2ZOQA 2BDFA 2GNJA 5FNVF 3PIZA 4YBKA 2Z8CA 3TACA 3SXFA 2JIIA 2X4FA 2VRXA 3HMMA 3MV5A 5ACKA 5HG8A 5M06A 3TNPC 5J7HA 1ZARA 2OIBA 1FBNA 3KVXA 2JDSA 3BX5A 5GJDA 3RPRA 4RX8A 4O0TA 4TT7A 4APPA 2W4OA 3O8TA 4ZS4A 4B9DA 2ITQA 3HDNA 3IQ7A 4WG3A 4FVRA 2BTSA 3W1FA 2GU8A 5HTCA 4Q2AA 5T68A 2H6DA 2PE2A 3QZGA 4LRMA 5DA3A 3Q6WA 4AT3A 3D7TB 4EK8A 1G3NA 5L2IA 5M4IA 3AX6A 1ZYSA 3EN7A 3VRYA 4BYIA 4DG0E 3V51A 3VIDA 2GQGA 4U79A 3GENA 4YSMA 3K54A 2PUNA 1LEZA 2GPSA 2I0EA 4TTHB 4UXQA 1YI3A 3PXFA 2I0HA 5LOHA 3ZO1A 1V0OA 3TL8A 2R7LA 2FPIB 5E8WA 1J91A 3ATSA 3FY2A 3LOKA 3PXYA 4W8EA 4FTAA 5CZHA 4C4GA 3I0QA 2DQ7X 1YHVA 4GFGA 1XH5A 2PWLA 4NFNA 4EORA 4BBFA 3ZU7A 3A8WA 4ZSGA 3KRRA 4C3PA 3CQEA 2O0UA 2XJ2A 2H8HA 4DLKA 2WELA 3QQHA 4I92A 3A7HA 2FUMA 4OT5A 3ZM9A 2QQ7A 2EB2A 2VO6A 1R0PA 4XLIA 4G34A 1OIYA 4C4HA 3MGYA 5AM7A 3MPAA 3PWYA 5JEBA 2CNUA 1ZY4A 1JVPP 2R3GA 1Z2OX 2YZGA 5JQGF 3EYGA 5FBNC 5H8BA 5IUIA 1JNKA 1WVXA 4GW8A 5AUVA 4B7TA 5C8KA 2B52A 2YITA 4IJ9A 4O84A 1JLLB 4D0XA 1BL7A 2HENA 4DA5A 2H34A 3NYVA 4Y8DA 3I81A 3LFSA 3POZA 1Y8YA 3PPKA 4CCBA 5FBOA 5ANKA 3T3UA 4L01A 5C4LA 5I9UA 3C1XA 4FTKA 4HNVA 1JDBB 5M4UA 1BL6A 3VS4A 3WBLA 4HVIA 4ZY4A 4WSYA 2XK3A 5KKRC 1QPCA 3SE7A 4BZNA 2F9GA 3N4UA 4DITA 4LOPA 5C1OA 4IFCA 3IGGA 4FT9A 4S33A 2C6LA 3PUPA 1CKIA 3CIKA 4NWMA 4H1MA 2ONLC 3PE1A 1B38A 4J71A 4FYNA 3U51A 1ZYCA 1OL7A 4L3JA 5FTOA 2X7OA 2G2IA 3BHTA 4EH3A 3UOJA 4I4TF 4GG7A 4QQ5A 2HZ4A 3SDJA 3ZDIA 4HYUA 2QR8A 3UYSA 1G8AA 4UALA 3P7AA 1OKWA 2A1AB 2Y6OA 4EBVA 2Z7QA 4KKGA 3GU5A 2NU7B 5H80A 4FT0A 4YZDA 4AGWA 5AX3A 5CF8A 2Y0AA 4OTFA 1GZOA 3RTPA 4IWQA 2EXCX 4C59A 3AGLA 5HLWA 4DAWA 2OBJA 2XYNA 3TZMA 4A9RA 4BN1A 4IZ7A 5IA0A 3R30A 4AG8A 3PWDA 4BTKA 3EH9A 4DBXA 4F6SA 3TV4A 5HNBA 3JZFA 3QRIA 2J0MB 3QFFA 2JDTA 4F1MA 4IZYA 4XCUA 5CSVA 4PL5A 2WU7A 5L8JA 5EM6A 3S95A 4FIHA 1H1QA 4BDCA 4CRLA 4IB0A 4AU8A 3ZOSA 5A6NA 3MJ1A 3TN8A 1DI8A 4HNUA 2R7NA 1XH7A 5ANEA 3OWKA 3AG9A 2R9SA 3GFEA 3OWLA 4G16A 3DKCA 5IQIA 4D2SA 2X8DA 4J52A 4PRJA 2P55A 3ATTA 5HE3A 3NZ0A 3WI6A 5M07A 1W96A 2BFYA 2BZJA 4HZSA 2IVTA 2VD5A 3F5PA 1KE6A 4LL0A 2V0DA 4Z55A 5FRIA 3QQFA 2OJIA 4FEXA 4E4LA 2C5VA 3KN6A 2XK6A 2YA9A 4FIFA 4FTUA 4YC3A 4WUNA 4G1WA 5KX5F 4X3FA 4H58A 3R7VA 3ZM4A 4O22A 3WF6A 4KNBA 5DLSA 5IMEA 4U80A 5LVPA 2R86A 3TDWA 2GS7A 3A7IA 4TYIA 4DEDA 4FNYA 2HY81 5EW8A 2JGZA 2VTOA 3UIMA 4R7BA 5LVNA 4AZTA 1NT2A 5J9ZA 4FBXA 2XIXA 3LPBA 3A7FA 5CSHA 5E9EA 2XCKA 4EC9A 3LM0A 5IG1A 2VWUA 5CEPA 2WTCA 2DYLA 2WMSA 3IO7A 4M15A 2JDRA 4I5CA 5LP6F 3IECA 4F65A 2NPQA 3DS6A 2QG7A 2OK1A 3OXTA 5LVOA 2QOQA 4GVAA 3CY2A 3OW3A 4M0ZA 1JSVA 4O0UA 2ITOA 4IZ5A 4PV0A 4A9SA 3GC8A 3MSSA 5M55A 2QG5A 5C03A 4ZLOA 5K5NA 1W84A 3ACKA 3GC9A 4YC8A 4MQ1A 5L2TA 3ORPA 5H8EA 3WF5A 4NU1A 4DGNA 3EFKA 1XBAA 3R7YA 4AN2A 5AAGA 5IF1A 4RJ6A 4YJ2F 5EI6A 2YISA 2IZTA 2WNTA 4GEOA 2X81A 2J9GA 1YWNA 3LE6A 4JBOA 2QC6A 3R04A 2JBPA 4O0YA 4AUAA 3SA0A 4AZSA 4WRSA 2QOLA 4BDGA 3LFFA 1CKPA 4USDA 5AUUA 3SQQA 4FUXA 3D83A 5CAQA 1XH8A 4EOPA 3W10A 3FMDA 1A06A 2P2HA 3KAJA 2PU8A 3HBLA 4JIKA 2OLCA 3DBDA 2B7AA 3EKNA 2HGSA 2UZUE 4IWPA 3EQPA 1REJA 2IPXA 3NNWA 2H9VA 3ULZA 3W32A 5K4IA 1KV2A 2ETMA 4UWBA 5AP1A 3HB9A 4M9UA 4MV4A 4M67A 4O4IF 3AC3A 1PXKA 1PKGA 4D4SA 4EBWA 2OXDA 3CPCA 3ULIA 5FEDA 4WNKA 5TOZA 4D4VA 4I55F 1OPKA 4YLJA 2IZSA 3QZHA 2RIOA 4TV8F 3BYOA 5DFPA 5A4LA 2BRMA 3QRTA 4V0GA 2C5OA 3NVKI 3MFUA 2JAMA 5HI2A 2VWBA 1ZMVA 3FPMA 4L44A 4CT2A 5DIAA 4EH4A 4O6LA 3F88A 4QP3A 3OP5A 3T9TA 2PYWA 4YJSA 5KBRA 2WTVA 1IG1A 3NS9A 2EVAA 2JFMA 3E7VA 4XYMB 2YCFA 2CKPA 2J51A 2YEXA 2ZV7A 3KA0A 4KBAA 4ZP5A 5M08A 4TL0A 3NEWA 2WZJA 4O0SA 1YWVA 4NW6A 2OXXA 4AZFA 3ERKA 3FY0A 4Q9ZA 2P2IA 3D7ZA 4CEGA 5CVHA 2C00A 4MBLA 3OW4A 3HKOA 3VJNA 4XJ0A 4J8MA 1IEPA 4FKSA 3LXLA 3ZO3A 4DH1A 5A54A 1ZZ2A 3F3ZA 3QA0A 4LQMA 4NCTA 4PNIA 2F49A 4AWIA 4F6WA 1WZYA 4FTNA 1KEEA 1EYZA 1H07A 3BYMA 1E4EB 3I1AA 3VUDA 2YM6A 3CTHA 3QWKA 3KVWA 3MPMA 4NT4A 2RF9A 2HZIA 4PTEA 1XR1A 3DXNA 3D5WA 3W8LA 4BI1A 3D15A 3PA3A 4N6ZA 4IM0A 3SRVA 3ZLXA 3QQLA 4WIHA 3CEKA 1PMEA 1H4LA 3BGPA 2XMYA 2PK9A 1FOTA 2W4KA 3Q9YA 4QYYA 5HE0A 3RAIA 3TNQB 4YHFA 2C6TA 4MNFA 3V5JA 3NSZA 1PK8A 4FT3A 5LARA 2ZYBA 3NCGA 3JRWA 1JSUA 1IAJA 5KMOA 5HBRB 4CFUA 3IW8A 2ACXA 2W1EA 3OUZA 2FSLX 2W1IA 3VF8A 4GV1A 5BVKA 3ZBXA 4YNOA 2X6EA 4ACHA 2XK9A 3HV4A 4Y5QA 2JDVA 4JLCA 5D10A 2YCRA 1URWA 3KC3A 4D0WA 2YM8A 3DXPA 2CN8A 1NVQA 3DDPA 3HVCA 3BYVA 3TKIA 3QUDA 4QMNA 1OITA 5AADA 2W4JA 5EW3A 5JK3A 3ORTA 5CENA 2LAVA 3FBVA 4FKRA 3NYXA 1M7QA 2XM9A 4GU6A 2WQMA 4UEUA 2GCDA 5CSXA 1IA8A 3VW8A 1P14A 3PXKA 3I5ZA 4C61A 5L6OA 1VBHA 3QLGA 5KMMA 3OWJA 2XIYA 1Q8YA 4FKVA 4X2GA 1GNGA 5AIRA 4ZEGA 5A4CA 1Q3WA 2ERKA 5HX6A 4YBZB 2XNMA 4C02A 5EM8A 4LRKA 3MY0A 4RIYA 4EK6A 3NGAA 3BLHA 3RVGA 4XMOA 3WZEA 1OPJA 1OUYA 4O4HF 2YZNA 4ZTRA 1QMZA 3FJQE 5E8YA 5TO8A 3MA3A 1PY5A 3EMGA 2ETRA 3DK3A 4YTFA 1EH4A 4ZAUA 3DB6A 5J87A 2YABA 4BICA 4Z7GA 3P4KA 3GQIA 3NYNA 1AUVA 1HCLA 4X6RA 2CJMA 3H0YA 3LCOA 5IQBA 3CJGA 3JR1A 2JKQA 3EKKA 3PY0A 4UB7A 3ZSIA 4XX9A 3ORIA 3VC4A 3R01A 4IQ6A 4DFUA 2C68A 4V0GB 2OXYA 5EK7A 5DE2A 4O7RA 2R3NA 1XBBA 5HX8A 1NW1A 1H0VA 2Y8OA 3L9MA 3Q2JA 4O21A 4RJ8A 5A46A 3S1HA 2UV2A 4BCIA 3ETHA 1QPJA 1J1BA 4PMTA 2JIUA 3GVUA 2W1FA 3QCYA 3RAKA 3F5XA 5EDPA 3WO0A 3OCSA 2VX1A 3PVGA 3G51A 4H3BA 2UVYA 2XK8A 3QTIA 5EYKA 4AA0A 4O7NA 3KRJA 1VYZA 2GSFA 4FFMA 3QCXA 5JFWA 3WF9A 2ZDQA 4MHAA 4N6YA 1FVRA 4GT3A 4BCQA 3KCKA 2BIKB 3OWPA 4LI5A 3MH0A 5KZIA 3BGQA 4AQCA 1U59A 3PXRA 4HCVA 3A4PA 3K3JA 4J98A 2QOBA 4QMSA 3E3BX 3MBLA 1STCE 4ZIMA 2QNJA 4FKUA 4FTIA 4BHNA 2Q0NA 5HHWA 5CU4A 3L8PA 4EH6A 5IU2A 4I23A 3V5PA 2GMXA 4FFLA 2XK7A 3I0OA 2Z04A 2NU6B 1J7UA 4H3QA 3LFBA 3CTJA 3DZQA 4FOCA 5HU3A 5LMKA 4A4OA 4ZSLA 3FQSA 3SGCA 4BDDA 5I9XA 3JXWA 3A7JA 5L2WA 4MVFA 5CAEB 5E7RA 2HW6A 3BU3A 4N4SA 4FKPA 4CFFA 3QFVA 5JN2A 2O65A 2P0CA 1GIJA 3MWEA 4KSPA 2VX0A 3VJOA 3GFWA 4OBPA 4FU0A 2NU8B 3VPBA 2P33A 4FSWA 1C3OA 3QAME 1X8BA 4LGGA 4CLIA 4R7IA 3HECA 5HO8A 3WE4A 3R5FA 1XQZA 3QD0A 2NO3A 4ZZOA 3CPBA 1TQPA 4DLIA 3R8UA 4S32A 5FTQA 1NA7A 3EZVA 5FP6A 3WYYA 1ULZA 4O4JF 1SCUB 1Z2PX 3P23A 3ETAA 4QMPA 2QOHA 5C1QB 1JBPE 2F7ZE 2BRHA 1C30A 4OBOA 2XNGA 5AM6A 1CSNA 4G6NA 4MBJA 4P2KA 4BI2A 1Y6AA 3OBJA 3EL7A 2ZV2A 2QVSE 1OL2A 4JG8A 4JX7A 5E90A 3TW6A 4CMUA 4FEVA 2JKKA 3LCDA 3LFQA 3W16A 4IMYA 1OVEA 1T45A 3DK6A 4J95A 4K8AA 5DEWA 3BG5A 3TTIA 4D9TA 1Z9XA 2R4BA 3RJCA 2IO6A 3OF0A 2O2UA 4KBCA 1W83A 4FEWA 4X2FA 4Q5EA 1PXLA 3I79A 2RFNA 2ZM1A 1UWHA 2WMQA 2UW3A 3N4VA 3R2BA 1VZOA 4O82A 4I24A 4PDYA 4G3EA 4YZCA 5J9LA 4O38A 3EJ1A 2QO7A 4NSTA 1CKJA 1B6RA 1KJQA 3R7OA 4GL9A 4K11A 4WBOA 4DG3E 1UU9A 3D7TA 4FTRA 5DN3A 5FXQA 5CU6A 3V01A 2PVRA 3MFRA 3H9OA 3VS0A 2C6DA 5ANOA 3SC1A 3CR0A 5A4QA 4FNXA 3FMMA 2WAJA 5BMSA 3KMUA 3VOTA 3PXZA 2C0TA 2VTRA 3ANRA 3H10A 4G6LA 4O86A 4QT1A 4WT6A 2O8YA 5CZIA 4F0FA 4O96A 1YRPA 4XYFA 5ANJA 2WB8A 2VTHA 3QL8A 1ZOHA 3LFCA 5C8MA 4BBMA 4LMUA 3R8PA 4FEUA 4UBAA 4AZWA 3FYKX 3ROCA 4C4EA 5A4TA 2X9FA 4I93A 5I9WA 2XRWA 4U97A 3JS2A 3NNUA 4O2PA 5FD2A 3ORKA 2HJWA 4IJPA 2I80A 2OSCA 2PUIA 4RT7A 1YXVA 3SW4A 4RZVA 2JIVA 3TZ9A 1O6LA 4RIWB 2R3IA 3K3IA 4X2JA 4EJNA 3UMWA 3E8EA 3GNIB 3T3VA 2Z02A 4U8ZA 3A61A 3QRUA 4FL1A 5EYCA 4CXAA 3DBEA 4JDJA 2QHMA 1V0BA 4IAZA 3QTXA 5ANDA 3Q9XA 5BMVF 5IA1A 3W18A 2Y4IC 4ZY6A 2IW8A 3S3IA 3VBTA 4FICA 3I4BA 4AX8A 4H36A 3GXLA 4CG9A 2UZLA 5LJJA 4QMTA 1EUDB 1CMKE 1UNHA 1PYXA 2FGIA 2QONA 3G33A 1KE5A 4GRBA 4QTBA 4L45A 5AV3A 4FC0A 3VULA 5IQEA 3EFLA 3AD6A 4FTMA 4WOVA 4XBRA 4CKIA 3UBDA 4ERKA 3UQFA 5CQUA 4APCA 2GNIA 5CI7A 5IDPA 3F5UA 3G9NA 3PJ1A 4C3RA 5AV4A 1VJYA 3E7OA 4BRXA 5DG5A 5E92A 4E8AA 4F9YA 2YZLA 4YZBA 3UIUA 3E63A 1TQIA 5L8KA 1B6SA 1GAGA 2HW7A 3M11A 2PMIA 4USEA 4XG4A 2GHGA 5KNJA 3ORQA 2VNYA 3W2SA 1G8SA 3WO1A 3PVBA 2VTQA 3H3CA 4ITJA 3OXZA 3LFEA 5M4CA 2XEYA 3THBA 1Z57A 3LLAA 5LXMA 1H1SA 5CU2A 2WQBA 5HBEA 3NX8A 3LCTA 3VUKA 2CGWA 5K9IA 2HCKA 3ZEPA 1Q8WA 4NYEA 3R8LA 3H9RA 4J97A 4XP2A 5L2SA 2C6OA 3FLQA 5IA4A 3IOKA 1T46A 2BPMA 4C2VA 4PQNA 4ARKA 5KMJA 1NVRA 2PY3A 4GK2A 5FM2A 3RAWA 2R7IA 3UTOA 4JG7A 3EFWA 4DC2A 4EI4A 5EH0A 3CD8A 1OIUA 3ANQA 1IRKA 4U45A 4UYAA 4EH5A 1PYEA 2X9EA 3OT8A 3OY1A 4BDIA 3NWWA 3VRZA 4AGUA 3LAUA 4EH7A 3OCGA 4CKJA 3EWHA 3DLZA 2WMUA 3BIZA 3GGFA 3JYAA 1DS5A 3FLZA 4D28A 4LUEA 2R7BA 3RALA 5AP4A 4PMMA 2WMBA 3MYGA 2AC5A 4DH8A 4O2ZA 4RJ5A 2J50A 2YIWA 3BU5A 3BYUA 4JI9A 4E6CA 4F9WA 2YS6A 5F20A 2Y9QA 3GCSA 4F99A 3EIDA 3E3PA 2YM4A 2WFYA 4IAKA 4YZNA 4BCGA 3UFXB 2CLQA 3GOKA 3FC1X 3KF7A 2C6IA 2W1DA 3COIA 1M14A 4BIBA 4BI0A 1MRYA 3N51A 2Q83A 3I6WA 3UP7A 4RVLA 3C4EA 1J7LA 3BQCA 4IANA 4HNTA 3GCPA 2YDIA 5AP2A 5KBQA 2X8IA 4NTTA 4P5ZA 2XKFA 3KY2A 3V5TA 1YDTE 3Q6UA 1H24A 3VUHA 1ZY5A 4QNAA 3BQRA 3SXRA 3ZFXA 4DIMA 2BVAA 1SNXA 4FVPA 2C69A 1KE7A 5D9HA 2YCSA 3WE8A 4CGAA 4ZTMA 1H8FA 3P78A 3K5HA 2UW0A 4FV2A 4KAOA 4YHTA 3ZS5A 3R23A 2V7AA 5EQEA 4D9UA 4F1OA 2C5YA 3AD4A 4KINA 5CSPA 3ZLWA 3NAXA 2XF0A 4MXOA 4FV0A 4DYMA 3QRJA 2W96B 2F7XE 3L8XA 3D2IA 2AYPA 4KIPA 4D5HA 5LYJF 2CKOA 2UW6A 3LW0A 4I6HA 2HK5A 2C30A 5E8SA 3TDVA 3UOHA 2UZTA 2GNFA 5EYDA 1AUXA 3QZIA 3GU4A 4J96A 5JRQA 3FMNA 3IW4A 3LCKA 5CTPA 3UNKA 5CA1F 3GU8A 3H9FA 3SKCA 3TIGA 3ZCLA 3HV7A 1ZMWA 4K6ZA 1XH6A 3VQUA 3EOCA 2BDWA 2A0CX 4UZDA 3OHTA 3LQ5A 2PVJA 4ZLZA 4IVBA 4WA9A 3V6RA 4EK3A 4GT4A 2JDOA 5DWRA 4U7ZA 4U42A 3PE2A 2WMVA 3Q2OA 3LXPA 3KN5A 3DAJA 4LMNA 5AP3A 4DH7A 4L3LA 5T6KA 3UNZA 4DFXE 4OTGA 3RNIA 3QA8A 3NYOA 3LMIA 5AFVA 1KJ8A 2XKCA 3R7EA 4A9YA 2C6EA 1PJKA 3Q5IA 3QQUA 3E92A 4ASZA 2WMAA 3C13A 3R6XA 4JJRA 4MV7A 1W82A 4EGQA 2YM3A 3DCVA 4M3QA 4RJ3A 3BE2A 4X6QC 3Q52A 4FSZA 4BCJA 4TYGA 3U87A 1CQIB 4C7TA 5EDRA 2Z7LA 5ETAA 2UZVA 3DXQA 3JVSA 3MVHA 5EG3A 2J90A 3DA6A 3ENHA 3R9NA 3W2RA 4OBQA 4CD0A 4E26A 4EH2A 1K9AA 4E5BA 2YFXA 3QUPA 4I6BA 5T3QA 1U46A 2ONLA 2W5AA 4JBVA 4YLLA 4R7HA 4WG5A 3TTJA 1Q62A 4BDJA 2YM7A 1W0XC 4DH5A 3UP2A 4BCPA 3V04A 3DAEA 4FODA 3PTGA 2BRGA 4CLJA 5L6WL 3NVMB 3P9JA 3KFAA 3LXNA 3ZLSA 2CDZA 2WTDA 4I21A 4Z9LA 5IQCA 3H30A 2QCSA 3G2FA 1SMHA 2P0AA 4HGLA 4UX9A 4YPSA 3R9HA 2CNQA 2XKEA 2Z60A 3ORZA 4PL4A 4JDHA 4OTRA 4HPTE 5D41A 4BY9E 3R7UA 1M2RA 3G9LX 5HE2A 3W55A 3HZTA 1H1PA 2V59A 2WPAA 5HU9A 1ZYDA 5H8GA 4C35A 1M2PA 4JOAA 3EQRA 1UNLA 3L1SA 4YP8A 1IR3A 2J0IA 3FWQA 4FIGA 4I6FA 3E8CA 2UVZA 1WFCA 3BEAA 5HIEA 1MRUA 3F82A 4FSQA 1GZNA 4CQEA 2DIKA 1GJOA 4TYHA 4BYJA 3EN9A 3QTWA 3B2TA 5HV6A 4O4LF 4U3ZA 3EQCA 1Q97A 4MXZA 2QR7A 4FGBA 4F0IA 4NFMA 5HVJA 3TKUA 4MK0A 3FKNA 3P1AA 3TM0A 5DOSA 2DS1A 3EN4A 1XWSA 4QMMA 4I5PA 1HOWA 4MV3A 4ZLYA 3OG7A 4O0XA 3M1SA 2NNWB 4LM5A 4UN0C 3GU7A 4TUYF 4ZSEA 2IWIA 5CX9A 3KULB 3TI1A 3CQUA 1YXXA 2OI4X 4KABA 3UZRA 4AW0A 1Y8GA 2W6ZA 2W71A 3OCTA 4M69B 3VA7A 4W8DA 4RWJA 4FIIA 3ET7A 3FI8A 2CCHA 4M14A 4YNEA 2I0VA 5TR6A 3VS5A 5IQGA 5CANA 3TIIA 3F2AA 3VBQA 2B54A 3LJ1A 5B7VA 3QC9A 4ZMEA 1EHIA 4KRDA 4GS6A 3HMOA 4BDAA 3HA6A 5CAOA 3MIAA 2W6MA 1JKSA 4YSJA 3WIGA 3JZIA 4M97A 2B0QA 3AMYA 3U6HA 2YM5A 4V01A 4R1YA 3DPKA 2C3LA 2QO9A 3II5A 3LXKA 3QCSA 5EHLA 3OY3A 4RIYB 3RHKA 4NIFB 3ZUTA 4F64A 3FLWA 4PDSA 4TPTA 4A4LA 2BZKB 2ITNA 3JUHA 2E9NA 2RKUA 1OKYA 5GHVA 5BVWA 1ATPE 4E73A 2A2AA 3A2CA 4XRLA 4Q5HA 3UE4A 3UMXA 5TKDA 4F08A 5JVLA 3TUBA 4AAAA 4RC3A 1GSHA 3HA8A 1O6KA 3CY3A 4QYFA 3FUPA 3PIYA 4H1JA 4U81A 4YURA 5BYYA 4XOZA 4BTFA 2QURA 3G0FA 5AMNA 4C4IA 3ETJA 1LEWA 2X2LA 3MJFA 1BX6A 5DEYA 2JBOA 3F2RA 3UVQA 2KTYA 1IOVA 3UVPA 5HORA 3BV2A 3OFMA 2R3PA 1JOWB 3G6GA 1ZMUA 1Y6BA 2OH4A 4M84A 2BILB 2EUFB 5CEQA 3RFCA 2B9FA 3E93A 4XH6A 5H2UA 4AW1A 4CTBA 1U4DA 3PZEA 4NJDA 2GTNA 2OH0E 4GUBA 5L3AA 5M51A 4MAOA 5LMKC 5CSWA 5AA8A 4RJ4A 5JSMA 4KUJA 4QRCA 1OUKA 4OW8A 3WZUA 4ALVA 3RPOA 4JG6A 1VYWA 5DHJA 4BCOA 3OUNB 5LMAA 3RWQA 4YTIA 4EQMA 3OZ6A 4OTDA 4DEBA 1O9UA 2C3KA 4JBPA 2UZNA 4Q9SA 1VBGA 2R7MA 4FVQA 2I8CA 3R8VA 2WIHA 3ACJA 4ITIA 5D8DA 3CQWA 5AUXA 3COMA 4O0WA 4WNPA 1KOAA 4K33A 2WOUA 3UPXA 1OBGA 2PMNX 3C51A 3HLLA 3HP5A 4ZY5A 4YJUA 5AP5A 2QF7A 3KKVA 4O0VA 3QALE 3RZBA 2ITYA 4B6LA 3R71A 3KF4A 4YJOA 4TNDA 2X0SA 2QOOA 1UWJA 1J7IA 4QMQA 4WKQA 2PVMA 3TV6A 4DEGA 3HMNA 1M0TA 4C5CA 3QKLA 2YAAA 4TWCA 5HCZA 4YTCA 2BZHB 4LRJA 1YKRA 4IAAA 4Y85A 4HVDA 4FKJA 4YJ3F 3C4ZA 4QOXA 4J53A 3NPCA 4F09A 4BF2A 2P4IA 3DB8A 3LFDA 4O7SA 3FI4A 3PDTA 2W6QA 1JKLA 4JDKA 1MRVA 3D94A 4DTBA 3LIJA 3EFJA 3GOPA 3H0ZA 4XV1A 1UKHA 3SG9A 3TKHA 1M2QA 5IQHA 4R6VA 4L46A 1UA2A 5JGAA 4A7CA 1WBPA 4AACA 2W5BA 3GU6A 3P7BA 2JKOA 2WIPA 5HLPA 5IH6A 4MXXA 2R84A 4L9IA 2O3PA 1JWHA 2VWIA 4TW9A 4FTCA 2E9UA 5EHOA 4RIOA 4BZOA 4CV9A 3PP0A 5JT2A 4ZI7F 4EL9A 1UVRA 2YWPA 4EHGA 5A3XA 2PZRA 1YQJA 4YO4A 1CS0A 2I40A 3Q9ZA 4RSSA 4ANLA 4AFJA 4K2RA 4AN3A 4G3GA 1ZYJA 3LFNA 3R8ZA 4N70A 2IW6A 3E5AA 3FKOA 3JY9A 2IVSA 4C2WA 5JMSA 2FSTX 3AD5A 4E5WA 5EQYA 2V5AA 3VWAA 3CS9A 2SRCA 3TEIA 3JRXA 1H25A 5EI2A 3R83A 2O64A 4NJ3A 5A9UA 2RG6A 3EQGA 3QKKA 4OTIA 4DCEA 4EOLA 2XJ1A 1OL5A 4FUYA 5IQAA 3UC3A 5J95A 3TNIA 5E91A 4HGEA 3NMUF 4ZTHA 4MAMA 5GINE 4G9RA 4FIEA 1H08A 4PMPA 5HCYA 2ITWA 2VGPA 2YACA 2I1MA 3HDMA 4O7LA 2WQOA 4IH8A 3C0HA 3OS3A 4TWOA 3QUEA 5CYIA 1YXTA 2CHLA 4O2AF 3DKOA 3V5QA 4HZRA 1P4FA 2W5HA 2XP2A 4E1ZA 4JQ8A 4IX4A 3QYZA 2YCQA 4BBEA 3QF9A 1KJ9A 2WMTA 2BROA 1PXJA 4N0SA 3EQDA 2J9MA 4OTHA 2PN1A 1M7NA 3NW6A 3W2PA 3DDQA 4FI1A 4YZ9A 4O0RA 1F0QA 4UXLA 4RWIA 4GFMA 3E8NA 3N4TA 4R3CA 4AS0A 3NIZA 2OF4A 3CC6A 5CEIA 2QLQA 4Y95A 5E8XA 3MI9A 5A6OA 1DM2A 3Q04A 4L8MA 4DFYA 1GLVA 1IAHA 2RGPA 3AC4A 3QYWA 3VBVA 4ASXA 4IHJF 4FMQA 4O7ZA 2GFSA 5F94A 5C8NA 4AZEA 4OT6A 3PJCA 3E88A 5EDQA 4QMWA 3RK5A 2E9OA 5HTBA 5I0BA 4XG8A 4XZ3B 3G0EA 3OC1A 2YERA 4JRVA 2IN6A 2VPQA 5L6PA 1B6CB 2OICA 3R1QA 4HGSA 3Q32A 3TCPA 4AA5A 2B9HA 3DJ5A 3OOMA 4I1ZA 1RJBA 2XB7A 3VUIA 5DVRA 5F9EA 5JVDF 2C0OA 2QI8A 5HIBA 2E9PA 4BDFA 4E93A 3N6RA 2GFCA 3DU8A 3MFTA 5B0XA 4AT5A 4HVSA 3ZRKA 2W6NA 4I94A 1WVWA 2UZOA 4YR8A 4FZFB 5DRDA 3NRMA 2XJ0A 3BZ3A 3RAHA 3VVHA 3WZDA 4UYNA 4YMJA 5AP0A 4QTEA 5AEPA 3BWFA 3VBWA 3AW8A 2PVLA 2CGUA 5F4NA 1U54B 3E5NA 3OROA 3ZSHA 3IG7A 2W99B 3UOKA 3FL5A 4IACA 1O6YA 5JH6A 3AMBA 5K3YA 4C5AA 3PSBA 4D1XA 4MKCA 2OZAA 2PVHA 4EYMA 2VNWA 4JXFA 4EOKA 3NUAA 4HW7A 4W4VA 2WTKB 3FZOA 4F9CA 1GGOA 2YW2A 2REIA 3PJ2A 4XLVA 2X2MA 1TKIA 4TYEA 2UW4A 4FKTA 3FPQA 4F7NA 2R87A 2O5KA 2BALA 4FT7A 4RGJA 2B55A 3LM5A 4K0YA 1PRYA 3NAYA 4X2KA 4YJTA 3VQHA 1TQMA 4R77A 1WAKA 3ZO2A 5A4EA 2C5XA 4I20A 3HMIA 4L1KA 4IM2A 1SM2A 5L8LA 3MA6A 3UO6A 4L52A 3VW6A 1Q8UA 3EQIA 3V6SA 3Q3BA 3RP9A 3WILA 3RGFA 3LMHA 2FPGB 2OWBA 3EN5A 2CNVA 3GLKA 3QGWA 4OTQA 2OZOA 1APME 2PVNA 2PE0A 4FTJA 3U9CA 4JT3A 2FB9A 3OTVA 1UU7A 4C5BA 5LQFA 1DI9A 4HCUA 2ITUA 2EXMA 4AXAA 3G5DA 4MA0A 2W70A 2X8EA 4KKHA 2PSQA 4FGRA 4IVAA 1KOBA 3FHIA 1XH9A 3AMAA 4U43A 1A48A 1XKKA 2NRUA 3PP1A 3QX2A 4FR4A 4NK9A 4YJQA 3U8WA 5I9VA 3QQJA 1BUHA 3PYYA 3C9WA 5CU3A 2PZPA 3R73A 4IW0A 4QYGA 3PSCA 3KXXA 4ANSA 1Y57A 4IE9A 4EOMA 3FSKA 1R3CA 4EEVA 2OJFE 2YZAA 4Y83A 1OKZA 4B8LA 5AUTA 5HNIX 5LWMA 2EU9A 4RZQA 1MUOA 2BTRA 4OLIA 3MIYA 3RWPA 3TXOA 4I41A 4O81A 3PA5A 4ITHA 4G6OA 3L9NA 2OJJA 4PY1A 5DGZA 2OF2A 3R5XA 4WNMA 1I44A 2HXQA 1NXKA 2YS7A 3JY0A 1I09A 4YU2A 5BUIA 5FXRA 5C8YF 2J0JA 4I3ZA 5IEXA 5JQWA 4OUCA 4X3FC 2ZJWA 2EWAA 4XG3A 4I0SA 3T8OA 3UPZA 2FA2A 2IZRA 1H00A 5J5SA 1FQ1B 2W6PA 4JAJA 4AOTA 2YAKA 1OBDA 3UC4A 4FFNA 2ERZE 4LYNA 4HNFA 4C38A 1PHKA 2BDJA 1J3HA 3F3UA 3ORLA 4LFIA 3JVRA 3E62A 4B4LA 5IYZF 2V62A 3W2OA 4KRCA 4WNOA 4PNKA 4NM3A 5C4KA 1OI9A 2WEIA 4EHVA 4GJ2A 4L00A 4KWPA 2YN8A 3MB7A 3MH1A 3PLSA 2ESMA 3HL7A 3IONA 3RK7A 4IIJF 4KBKA 1MP8A 2OJ9A 4LUDA 3EHAA 3MESA 3LJ2A 3LLTA 3OT3A 3ZBFA 5HVYA 4A4XA 4B8MA 4K18A 4PF4A 4QO9A 3Q4TA 3K5IA 2VTMA 3F69A 5IUHA 4FIJA 2I7QA 5G1XA 5IUGA 3ALOA 3Q53A 4LOOA 2YIYA 4O83A 4FTTA 3F66A 5IA5A 3DLSA 3UGCA 3DZOA 3EQFA 1YOJA 1WBOA 4JIAA 2E2BA 3EZRA 5I4NA 5BUJA 5FUTA 3IK3A 3K2LA 5E8ZA 4E20A 1M52A 2CPKE 1KE9A 4K77A 1H0WA 4MBIA 5KKRB 5LWNA 2LGCA 4U9AA 5KCVA 5DH3A 2OFUA 4G3FA 3MVJA 2X7GA 4ALWA 4MEDA 2DLNA 4DN5A 1WBVA 3BKBA 3M42A 1FMOE 4MNEA 4EG0A 4JBQA 2BZIB 3A7GA 3RPVA 4B0GA 1JAMA 4CG8A 1YXSA 3ZUUA 3G6HA 4RFMA 4JQEA 1FGKA 2UVXA 4QMXA 4RFZA 4RWKA 3GI3A 3T9IA 4CKRA 4D1ZA 3FDNA 5HIDA 3QD4A 4L3PA 3EQBA 4AGCA 2B53A 4BGQA 2DWBA 3BPRA 3I60A 3R21A 2V5QA 1WR2A 3V4ZA 2BR1A 5M09A 4FSTA 5HLNA 4DT8A 1PXIA 2G15A 2PHKA 3C50A 4IVCA 3W8QA 4FT5A 4IDVA 1A9UA 4Y46A 3V5LA 5FDXA 1P5EA 3RM7A 3FMEA 3U54A 5J8IA 2XNPA 2B9IA 3L8SA 2PZIA 4LOQA 4O6EA 4O7VA 2FP4B 3BE9A 4IZAA 2Z2WA 4QMUA 3O71A 4E6AA 3UVRA 3NLBA 3DKGA 5LCKA 4LV8A 4MXYA 3FL4A 3BWJA 4ZZNA 5BPYA 3ORMA 3HP2A 3HV6A 3OMVA 2YDJA 4U0IA 3PVUA 4AW5A 4E4MA 2ZB1A 3AQVA 4DG2E 2W1GA 5HZNA 2AUHA 5GIOE 4MYGA 4RA5A 4O27B 5JGDA 4QTCA 3KRWA 2OZAB 4IAFA 2XM8A 5BVEA 4EH8A 5KHWA 2C3IB 1OIRA 3ORNA 5CEMA 4DFLA 4MV8A 4L53A 5D1JA 4H39A 5HD7A 2PE1A 4GYGA 1U54A 2R3KA 3AXWA 3C4XA 4TWNA 3SV0A 2V22A 1ZWSA 2Y4PA 4L6QA 4PDOA 3R1YA 2YL2A 3IW6A 4L42A 4FTQA 4X2NA 5HESA 1L3RE 3D2KA 4MX9A 4FV5A 4KS8A 4EYJA 1F3MC 1EZ1A 4YC6A 3BELA 3OD6X 5JFVA 4FG9A 4MH7A 3NUXA 4YLKA 4ASEA 4AE9A 3ELJA 3F3TA 2CKQA 4QP9A 2J4ZA 3VS6A 1PXNA 3DGKA 5DT4A 1WVYA 3DJ7A 2HY0A 3ZXZA 5BUEA 2R2PA 3PZHA 2J6MA 2XH5A 4U5JA 3O7LD 3PRFA 5IMXA 3RUPA 3VBXA 3G8DA 4CZUA 3FZTA 3PSDA 4WUAA 4BVUA 2FB8A 2Y4IB 3TNWA 2NU9B 3CE3A 3PJ8A 4RJ7A 2F7EE 2RFSA 4HYIA 4X21A 5E1EA 4GIHA 3D5VA 4FZ6A 4IB5A 2FYSA 5IISA 3FMKA 4FSMA 4MXAA 2OO8X 1YVJA 3AGMA 4NTSA 2RG5A 5D12A 4IC7A 2XUUA 2W1ZA 3MFSA 2R5TA 4TNBA 4G3DA 3ODYX 4U6RA 4TKSA 1E1XA 5JQ5A 2R3FA 3NUYA 4WG4A 2WGJA 2ZDUA 4CT1A 4GFOA 5FDPA 2UZBA 1Q4LA 4X0MA 3HUBA 5HICA 3RHXA 4XG9A 5CXZA 5IEYA 3PPJA 3P79A 3TV7A 4GT5A 3HO8A 2WQNA 1PKDA 3UJGA 5H3QA 1CTPE 5GONF 4PUZA 4RIXB 3F61A 4BTJA 4EQUA 1JSTA 3D5UA 5D7AA 3R9OA 1E4EA 5EOBA 3IOPA 2X39A 5BVDA 1ND4A 2OJGA 5EQPA 3SAYA 3U4UA 1S9IA 2ITPA 3CKWA 4AGDA 3DT1A 3B8QA 4CMTA 3FXWA 5ETFA 2UUEA 4BCFA 2GNGA 3IGOA 3P86A 1LR4A 2PVPA 2YZMA 5K5XA 1SNUA 3A8XA 4JRNA 4F63A 3Q4CA 1SVGA 5J1WA 4ZK5A 3R9RA 1OB3A 3FZPA 2A4LA 2A27A 4I5HA 3O50A 2J0LA 3DNEA 2W9ZB 4IEBA 5CNNA 3R2YA 3R5HA 3I7BA 2O63A 2QLUA 2WXVA 4IAIA 3LFAA 3VO3A 4RLKA 1NY3A 4NM5A 5ANGA 2VTNA 1FMKA 4XV9A 2F2UA 5ACBC 4C4FA 3QC4A 4IADA 2WOTA 4FX3A 4HVGA 1Q41A 4EJ7A 5JGBA 4C62A 2B4SB 2IG7A 5FG8A 3KGAA 4EUUA 3KULA 4Z7HA 5JH7F 4XRJA 1E9HA 3A60A 4FKWA 4HGTA 5FQDC 5HE1A 4EOIA 4FV6A 5I5ZA 1RW8A 4UY9A 3UIXA 3GT8A 4FKQA 4DH3A 4U3YA 3TIYA 2PZ5A 4R5YA 2Z7RA 2ZAZA 3Q96A 1KJIA 3GCVA 4YAJB 1BI8A 3HNGA 1Q8TA 2ITXA 4EC8A 1YDSE 3S0OA 1GZKA 5D7VA 5TT7A 3M2WA 4TYHB 4YJRA 4RZWA 4PP9A 3FZRA 4BC6A 2PZYA 1Q3DA 2BKZA 3U9SA 2FSOX 3GUBA 1BLXA 1F5QA 1H28A 3QTUA 1HCKA 3ALNA 3CBLA 1V0PA 5DNRA 3W33A 4I0TA 1GSAA 5M44A 5EZYF 4IHPA 3A99A 4BGHA 3C7QA 5M56A 1L8TA 4FZAB 3FV8A 4BKJA 2CSNA 2XKDA 3L9LA 1PXPA 4FOBA 4C4JA 2DZDA 1A9XA 4CFWA 3DBQA 2BHEA 4GK3A 5AV2A 1DAWA 1VKZA 3O23A 5CT7A 5AJQA 3ZZWA 3B8RA 3KREA 1H27A 3WOWA 4BCHA 1VEBA 3QU0A 2OIDA 5DMXA 4DTAA 4XG7A 4RC2A 5CLPA 1REKA 3R02A 1BKXA 4IDTA 1YOMA 2GTMA 5F95A 4D55A 1OIQA 2UZEA 4ENXA 1Q8ZA 4NZWB 5CVFA 4RIXA 2XNBA 5AUWA 3FMLA 4ANMA 4CFMA 1T36A 3R1NA 5KX8A 4ZJIA 5CAUA 4EWHA 3FZSA 3OBGA 3GIDA 3VMMA 5HD4A 4O7WA 1YDRE 4DFBA 1PX2A 4M12A 4RC4A 5CQWA 3VUMA 4AOJA 1PMNA 2HXLA 2W0JA 3SVVA 1OZ1A 4F1TA 4IZOA 3C4FA 4EWQA 2VTIA 5FGKA 5B2KA 3WF8A 3WIKA 4FKLA 4MNEB 2VTAA 4BDKA 5KMKA 4Z16A 2V55A 4ALUA 2IW9A 2YIXA 2G2FA 4Y5HA 4L68A 5CU0A 3FI2A 4QQTA 4DFZE 4ZJVA 3FXZA 3KALA 4HJOA 4YAKB 1K3AA 2DUVA 5EM5A 2SCUB 2HOGA 3TZ8A 3Q5ZA 4A06A 5I9ZA 2BRNA 3O17A 1UKIA 4IX3A 4WBBB 4IC8A 3NW7A 5AUZA 3KMWA 4C34A 3FEGA 4YGAA 3QQGA 5IZFA 3RINA 4QMOA 3MS9A 3UQCA 4PX6A 2JKMA 4ZTQA 2VTPA 3ZTXA 3SG8A 1ZOEA 3VAPA 3C5IA 3DY7A 5CI6A 5FM3A 4RA4A 4ACMA 2JFLA 1OECA 2OLSA 4XNEA 4BCKA 5BVNA 4FG8A 1KUTA 2VO0A 4E6QA 4FSNA 2XVDA 4LL5A 4MQ2A 1CE8A 1DV1A 2VV9A 2W1CA 2XK4A 2ZB0A 1UU3A 4IFGA 1JKJB 4EK4A 4AW2A 5JZJA 4GSBA 4UWCA 1CDKA 4G5JA 4XYLB 1PMUA 3DAKA 3BHVA 5LMBA 3S00A 4YJVA 3R1SA 1UV5A 2WQEA 1ZOGA 4JX3A 4RMZA 2KULA 3FQHA 3BBTB 4BTMA 5BX0A 4EZ7A 3ID6C 4I50F 3HAVA 3RV3A 2C0IA 1PW2A 4XP3A 5BVFA 3MH2A 1JLUE 4RWLA 3DQXA 2I87A 2GNLA 2GQSA 4FSYA 1UNGA 3GQLA 5CF4A 3VS7A 1W7HA 4C36A 4CV8A 1YWRA 3VF9A 2YYAA 2R0UA 4NKSA 4EK5A 4QTAA 4GIIA 3L8VA 3LMGA 1R0EA 3BEGA 1QCFA 3WZJA 4XBUA 4QMZA 3S2PA 4DGLC 2GHLA 5KKNB 5IH5A 3UO5A 5EFQA 3OEZA 5M57A 5B2MA 5HNGA 4G3CA 3S4QA 3NUPA 2OKRA 5HQ0A 2XRUA 1XHAA 1U5QA 1GIHA 3QTQA 5CT0A 3GC7A 5BMMA 4P4CA 3ORRA 2Y7JA 4EHZA 4PP7A 4I22A 3E8DA 4MA5A 4XHKB 4F7JA 4BCNA 3RMFA 1QPDA 4J99A 1R39A 2VAGA 2XCLA 4U44A 2VTLA 2CMWA 3PPZA 2X7FA 1OM1A 3R9DA 3BRBA 3NNXA 4AOIA 1B39A 4RBLA 3VS1A 2WTKC 2R3OA 5EW9A 2OFVA 3D0EA 1BMKA 1WCCA 3V4SA 4ACGA 4KS7A 5EHYA 2YDKA 3OCBA 3Q4UA 5KMLA 4EZ5A 3O0GA 5DI1A 4JNWA 1QPEA 2PUUA 4QP6A 5BNJA 1ZRZA 2VQDA 5HO7A 4AT4A 3COHA 4NH1A 4JVGA 1P2AA 4W4WA 3RV4A 2YRXA 1MQBA 3BLRA 4CCUA 2R3RA 3KAKA 4YUQA 5E1SA 3F3VA 5HGIA 1JPAA 3BBWA 2FO0A 5DT0A 5EYMA 4RRVA 2BFXA 3C0IA 3QRKA 4KIOA 4LGHA 4TZRA 1XBCA 4MF1A 3SD0A 3ZO4A 4F6UA 3U9TA 3EN6A 4DINA 4CMOA 1ZAOA 4EH9A 4RIWA 2OGVA 2G01A 5DR2A 3UYTA 3N9XA 3TJDA 1Z2NX 4O7YA 4R3PA 3MVMA 3ZDUA 3DJ6A 3FLSA 2R0IA 5HG9A 5AIKA 2OG8A 2GS2A 3ENMA 5GJGA 3ZRLA 2WTIA 4QQJA 5CVGA 2BKKA 4C0TA 2CZGA 4FV4A 4G9CA 3W2QA 3IW5A 2I6LA 4G31A 4BIDA 1M0WA 3PXQA 4GUEA 1OL6A 3ZXTA 3V8WA 4USFA 4EONA 1GY3A 2G2HA 3DFAA 4CZTA 3B2WA 4KIQA 1GZ8A 3UODA 2QHNA 1Y91A 3R00A 2ITZA 4Y73A 1WBTA 3REPA 3VS3A 5H9BA 3FSFA 3LHJA 3WYXA 3PJ3A 3KXNA 5HEZA 4AZVA 1I7NA 2BCJA 3FE3A 2WHBA 3D9VA 4II5A 4CTCA 3GEQA 5D11A 4NUSA 2C47A 3KK9A 4A9TA 1SVEA 2W05A 3CD3A 3U55A 1NVSA 4GCJA 5FLFA 5GNKA 2C3JA 3CTQA 2YIQA 2IP4A 4PMSA 5GJFA 1WBWA 2WU6A 2YJSA 3ROYA 4RQKA 4PTGA 4JR3A 4BHZA 1JDEA 4GG5A 5EKNA 3DOGA 2VGOA 3QQKA 4RG0A 1DAYA 1Q5KA 3KMMA 3LQ8A 1RE8A 4I0RA 5KUPA 3UZTA 5CB4F 4UWYA 4BZDA 3QGYA 4NKAA 5EI8A 3R22A 4S30A 4QQCA 5JQ8A 2GLTA 1OL1A 1LUFA 4TY1A 2GPWA 3G8CA 1AGWA 4YBJA 3QWJA 2C4GA 4KSQA 3GP0A 4I5MA 4ZXTA 4FTOA 5CWZA 4A07A 4ACDA 2HIWA 3E64A 4JDIA 2JLDA 3HX4A 3NW5A 4HCTA 1S9JA 2UZDA 1XH4A 3LZBA 3A62A 4QMLA 4ERWA 3SLSA 3ZC5A 5DT3A 3NNVA 4WRGA 2XIKA 5AAFA 3K3PA 1UU8A 4MWHA 4XOYA 3BCEA 5AUYA 5BPHA 5A14A 4TV9F 3F9NA 4TXCA 4ZTLA 4DLJA 4QPSA 2UW8A 3O7LB 4RX9A 4F7LA 3H4JA 4CVAA 4S31A 3KCFA 2JC6A 3VHKA 3ORXA 4R78A 5AAEA 3TWJA 2VTJA 5LVMA 1XO2B 2ZMCA 3P0MA 3FI3A 2AC3A 4QYHA 5CS6A 5DPVA 5G6VA 4QNYA 1H26A 2J5FA 3GCUA 2PVYA 4YJNA 3V8SA 3QCQA 4DT9A 5IQDA 5ETIA 3MB6A 5CASA 4HYSA 2X4ZA 2ZMDA 4FV8A 2BHHA 2VN9A 2VO7A 2W9FB 4GKIA 1MQ4A 4QMVA 4TWPA 3UQGA 4P90A 3ZHPC 2IVUA 3P7CA 4R1VA 4AF3A 5ITAA 2VTSA 3FHRA 1TVOA 3FZ1A 5AWMA 4E7WA 1LPUA 1LP4A 2PMLX 2XEZA 4JS8A 1WBSA 2YHVA 4EKKA 1M17A 4YJPA 3TUDA 5K4JA 4ZTSA 5TF9A 4BIEA 2GQRA 3DFCB 3ZRMA 3NUSA 4M8TA 3F7ZA 4FFPA 2XNOA 3MN3A 4L43A 3Q4ZA 3RKBA 5HBJA 2R82A 2BMCA 2HZ0A 3V8TA 3G90X 3NDMA 4EZ3A 1BXRA 2W6OA 5C01A 4AE6A 1YOLA 3OUKA 1SYKA 4XUFA 1KC7A 3PY1A 2B9JA 2HAKA 3IW7A 3BV3A 2GDOA 3KB7A 1WMKA 4K9YA 4ZOGA 5HBHA 4HYHA 4DTKA 3BU6A 5CEKA 3KL8A 2OIQA 3O96A 4J1RA 3AC5A 4KA3A 5CEOA 1W93A 4PWNA 3GCQA 4EOSA 5JFSA 3GC0A 3I5NA 4GJ3A 3HV3A 4DGGA 4FYOA 4IB3A 3R28A 4CFNA 2A19B 4F70A 5CXHA 4EUTA 3FYJX 5JRSA 4ENYA 3MTLA 4AP7A 1Q99A 3FC2A 3RI1A 3Q2MA 3VNTA 4RX7A 5CAVA 1YW2A 2C5NA 3A4OX 2P3GX 3QZFA 4TYJA 4FG7A 5M53A 2JEDA 2ZM3A 4JR7A 2GS6A 3TQTA 2Q0BA 3C4CA 1IOWA 2EB3A 5HKMA 4GH2A 4DFNA 1FGIA 3ZMMA 2CN5A 4U40A 2V7OA 4ZJJA 1SZMA 2I0YA 4U41A 4F0GA 4M68A 3SW7A 5BVOA 5B2LA 5IQFA 1URCA 2R3LA 3U6IA 3BHUA 2CCIA 2W17A 2FH9A 2PULA 2R3JA 3BI6A 3CGOA 4E5AX 2ZV9A 3P08A 4HQ6A 2J2IB 4IWDA 1PF8A 1RQQA 3UOLA 4FKOA 5EM7A 3ZLYA 4UV0A 3AT2A 2C6KA 3TIZA 3AC1A 4TRLA 4MD9E 4FSUA 3QKMA 4NM0A 4BR3A 4FV1A 3NUUA 4QP8A 1AQ1A 4ANQA 3HAMA 4ME6A 1W98A 4BB4A 1I7LA 4D58A 3IDPA 3KK8A 4J8NA 4DGOA 4GU9A 3ODZX 5AX9A 2WTJA 2R85A 4DEEA 1YI4A 3IDBA 4DHFA 5HCXA 3UG2A 3V3VA 3KXGA 4DEAA 3F2NA 2CKEA 5J1VA 5KHXA 1Q61A 2W1HA 4CFXA 3HMPA 3ZFYA 4Z3VA 4G17A 3NCZA 4RVKA 5CF6A 4MXCA 1FVTA 4QP7A 1YXUA 5AV1A 2PBZA 4AN9A 4F7SA 3RCDA 3AT4A 1H1WA 5AA9A 4FTLA 4LV5A 4F4PA 2G1TA 2X0GA 5CAPA 2UW7A 3HRCA 5DBXA 3GB2A 5KZ0A 4OTWA 2XS0A 2JITA 3E87A 4S2ZA 1RDQE 2E9VA 2RL5A 4IM3A 3BYSA 2GNHA 2H96A 3C5UA 3DV3A 4JAIA 3VHEA 3SRVB 3KU2A 3RM6A 4E4XA 4BDHA 1IA9A 2JD5A 2OU7A 2WTWA 2VUWA 3QTSA 4LG4A 5DR6A 5JFXA 1J1CA 1PMVA 4XG2A 3RPYA 2J7TA 1KJJA 4I6QA 4R5SA 2WYOA 3NR9A 4FSRA 4WD5A 1YHWA 4FNWA 2XYUA 2PPQA 5KO1A 5ETCA 3QLFA 2XNNA 3ZFMA 4EKLA 2ITTA 1ZZLA 2C6MA 3UIBA 3TG1A 3R7IA 2J5EA 4UZHA 2WMXA 3FKLA 3PLAE 2PUPA 2R3HA 3WF7A 3QHRA 3DQWA 4QPAA 4HPUE 4IB1A 1YI6A 2WMRA 1BI7A 4RVTA 2UW9A 4XEYA 2W06A 3DKFA 2QODA 5E8UA 4DE4A 2ZVAA 4M7IA 2B1PA 3DF7A 2VTTA 3WNZA 4Y72A 3UO4A 5AP6A 5C9CA 3MH3A 3I6UA 3MDYA 5BYLA 5LVLA 2C1AA 3FLNC 2CGXA 4DEHA 4NCTC 3W2CA 5IPJA 1M6VA 4ZMFA 1K2PA 3QX4A 4QYEA 1KWPA 2QO2A 3TUCA 3EL8A 2Z7SA 3SXSA 2WMWA 3KQ7A 4IWOA 2PL0A 4C58A 1OGUA 4E4TA 4M13A 1OKVA 3CXWA 2HELA 4IIRA 4EOOA 5KMNA 2GPHA 3TT0A 4JL9A 4XV3A 4H3PA 5C26A 4J7BA 4CNHA 4ASDA 4RVMA 2VO3A 4KD1A 2QOIA 4D4YA 1VR2A 2CLXA 4BDBA 4QMYA 3MWDA 4PDPA 4Y8VB 3OEFX 3O8PA 1CM8A 3I7CA 5HG7A 5IA2A 5LOVF 3MY5A 2VWYA 4MWIA 3DTWA 2WO6A 2YJRA 4P5QA 2VWZA 1Z5MA 2XIRA 4QP2A 3ZH8A 2NUAB 4DEIA 4QP4A 1H1RA 3P5KA 4ZHQF 1IASA 4CFVA 1FPUA 4EOQA 3LWBA 2QU5A 4V04A 2ZDGA 4YZMA 1ZXEA 3ZZEA 2VU3A 3SOAA 2C1BA 1KBLA 2YIRA 5IDNA 1PXOA 4FZDB 3QHWA 1V1KA 3FLYA 2XCHA 4F9BA 4E6DA 4IX5A 4C37A 2BAQA 4PTCA 2QD9A 1AD5A 1Q24A 3FMHA 2G9XA 3HRFA 3TZ7A 4BDEA 4IX6A 3F3WA 4YHJA 2R3QA 4NM7A 5BQ0A 4XS2A 3QD2B 2HYYA 5GIPE 4RQVA 5M4FA 2VWXA 3C0GA 4E4NA 4ZSJA 4FKGA 2QKRA 3SX9A 1EUCB 4RFYA 1ZLTA 3MWUA 3WZKA 2VX3A 3TNHA 4BGGA 2FVDA 3MJ2A 1W8CA 4HNIA 4JQ7A 1JQHA 5DR9A 3QTZA 3AT3A 4MV6A 4S34A 5CNOA 2BAJA 3PY3A 4L67A 4YO6A 3F7WA 3QXPA 3PG3A 2HWPA 4YPDA 5IEVA 2HWOA 2PVFA 4DBNA 2ZM4A 2BRBA 3R8MA 3RPSA 5J2TF 3EQHA 3ZEWA 3DNDA 4FKIA 4MV1A 1FINA 2ITVA 5FEQA 1CQJB 5C1PA 4L7FA 3U9NA 2QOFA 4MCVA 5IH4A 2DWCA 5F1ZA 2GHMA 3AC2A 1R1WA 5E8TA 3KXMA 3ZC6A 3ZUVA 4F9AA 3PRIA 2QU6A 3FMJA 3RCJA 3BGZA 3HGKA 5HVKA 3O8UA 3EYHA 2UW5A 2WKMA 3ZYAA 3WARA 4K1BA 2QK4A 4I4FA 3U6JA 3QBNA 3MVLA 5LA6F 3MPTA 1R78A 4FL2A 4WO5A 2QKWB 5EOLA 2BAKA 2F2CB 2ETKA 3HYHA 2R64A 3UDBA 2R3MA 4RLLA 1WBNA 1FVVA 1JKKA 2R7KA 4MV9A 5I9YA 4WBNF 1G5SA 4GVJA 4C3FA 2F57A 4XV2A 5CF5A 4QSHA 3OXIA 3V5WA 4AA4A 1DIKA 3NUNA 3OUUA 3RK9A 3IDCA 3N8DA 4FV3A 3QD3A 4HR7A 2VWVA 4XG6A 3TINA 4FK6A 3ZONA 3O2MA 4V05A 4D1SA 1PXMA 4EOJA 4I4EA 3Q1KA 2CGVA 3LKMA 3KEXA 2NRYA 3PG1A 4ZOLF 2X1NA 1KV1A 1BNCA 3PFQA 3U4WA 2HZNA 4AFEA 4FE2A 4EGJA 3FAAA 2XD4A 1DV2A 4FK3A 4NL0A 2F4JA 2V58A 1QL6A 3SOCA 3SHEA 3OOGA 4KB8A 3VS2A 4IAYA 4O2BF 3OVVA 1OPLA 2J0KA 3D14A 2W7XA 2YWVA 2RFEA 3BHYA 3CGFA 3UG1A 2XNEA 3HUCA 5DRBA 3K5UA 4OGRA 4FFRA 1JKTA 4YTHA 3PVWA 5BPFA 4GK4A 4QTDA 3KXZA 4DGMA 4CSVA 3AOXA 2XZSA 3IPHA 4ONAA 2PTKA 3CP9A 3FXXA 4HOKA 2PVKA 3D4QA 4X7QA 4MTAA 3K5VA 2WEVA 3BLQA 3HV5A 4G5PA 4BCMA 5ICPA 5FEEA 4FA2A 3C4WA 3F5GA 4FNZA 4W4XA 5JZNA 4FZ7A 2YRWA 4MD7E 5CY3A 4FFOA 3G15A 3D5XA 3QXOA 2IVVA 3PA4A 4FEQA 4HVHA 3HRBA 4H05A 2XBJA 4ZSAA 1YHSA 4FL3A 3POOA 2JAVA 3F6XA 1XJDA 3CSVA 5FP5A 3NIEA 3VN9A 4EHEA 5ANIA 5CA0F 3BHHA 3DBFA 4NW5A 4DCAA 2Y6MA 5J9YA 3DTCA 5LCJA 3ZSGA 5BYZA 2FPPB 5E8VA 4P7EA 4ACCA 2XBAA 5KE0A 3IS5A 2ZDTA 1GSOA 4XX0B 3LVPA 4O7TA 4RPVA 4WHZA 4B99A 3CCNA 4ORKA 3COKA 3DBCA 3UZPA 4A9UA 5CALA 3MTFA 3PIXA 1KE8A 3OTUA 2IJMA 4IBMA 5AP7A 4L7SA 5JKGA 4FV7A 5AV0A 5IA3A 4D2RA 3Q60A 3VUGA 4EQCA 3TJCA 3QTRA 3LJ0A 4GKHA 2QOKA 3KRXA 5E4HA 4X3JA 3MY1A 5HG5A 4ANBA 1GOLA 3DK7A 4ID7A 4KKEA 3UNJA 4CRSA 1BYGA 1ERKA 2VR1A 3IKAA 1KSWA 3L9PA 3CKXA 3FQEA 3CLYA 3CJFA 3AC8A 4GMYA 4D4RA 3I12A 1OMWA 2RFDA 2ZV8A 4GYIA 3JPVA 4DF3A 4PL3A 3VBYA 5LXTF 4RX5A 4G2FA 3GBZA 2VWWA 1P4OA 3MW1A 4IVDA 3Q9WA 4ZTNA 2BIYA 3HEGA 5J2UF 1SVHA 3LCSA 3KXHA 3VPCA 4XP0A 5FTGA 5DYJA 4ZZMA 4D5KA 4ZS0A 4TN6A 3EB0A 2WD1A 3R0TA 2OW3A 1H01A 2IZUA 2XA4A 3KRLA 3O51A 2FSMX 4M0YA 4MD8E 3LQ3A 5C27A 2BUJA 4OR5A 4C33A 2X2KA 2ZDHA 5FXSA 4N57A 3R63A
chains in the Genus database with same CATH superfamily
2VZ6A 4R3RA 2PMOX 4FV9A 3LP8A 1E1VA 3ITZA 4ZQIA 4O91A 1GIIA 1U5RA 4X3FB 2UZWE 4YB8B 2NP8A 2X6DA 2XIZA 5KMIA 2QOCA 4W4YA 4QP1A 5EKOA 2ZOQA 2BDFA 3QQMA 2GNJA 5FNVF 3PIZA 4YBKA 2Z8CA 3TACA 3SXFA 2JIIA 2X4FA 2VRXA 3HMMA 3MV5A 5ACKA 5HG8A 5M06A 3TNPC 5J7HA 1ZARA 2OIBA 5IQEA 1EKFA 1FBNA 3KVXA 2JDSA 3BX5A 5GJDA 3RPRA 3DTGA 4RX8A 4O0TA 4TT7A 5D1OA 4APPA 2W4OA 3O8TA 4ZS4A 4Q4CA 4B9DA 2ITQA 3HDNA 3IQ7A 4WG3A 4FVRA 2BTSA 3W1FA 2GU8A 5HTCA 4Q2AA 5T68A 2H6DA 2PE2A 3QZGA 4LRMA 5DA3A 3Q6WA 4AT3A 3D7TB 4EK8A 1G3NA 5L2IA 5M4IA 3AX6A 1ZYSA 3EN7A 3VRYA 4BYIA 4DG0E 3V51A 3VIDA 2GQGA 4U79A 3W0QA 3GENA 2XARA 4YSMA 3K54A 2PUNA 1LEZA 2GPSA 2I0EA 4TTHB 4UXQA 1YI3A 3PXFA 2I0HA 5LOHA 3ZO1A 1V0OA 3TL8A 2R7LA 2FPIB 5FR9A 5E8WA 1J91A 3ATSA 3FY2A 3LOKA 3PXYA 4W8EA 4FTAA 5CZHA 4C4GA 3I0QA 2DQ7X 1YHVA 4GFGA 1XH5A 2PWLA 4NFNA 4EORA 4BBFA 3ZU7A 3A8WA 2X5RA 4ZSGA 3KRRA 4C3PA 3CQEA 2O0UA 2XJ2A 2H8HA 4DLKA 2WELA 3QQHA 4I92A 3A7HA 2FUMA 4OT5A 3ZM9A 2QQ7A 2EB2A 2VO6A 1R0PA 4XLIA 4G34A 1OIYA 4C4HA 3MGYA 5AM7A 3MPAA 3PWYA 5JEBA 2CNUA 1ZY4A 1JVPP 2R3GA 1Z2OX 2YZGA 5JQGF 3EYGA 5FBNC 5H8BA 5IUIA 4NZOA 1JNKA 1WVXA 4GW8A 5AUVA 4B7TA 5C8KA 2B52A 2YITA 5I5WA 4IJ9A 4O84A 1JLLB 4D0XA 1BL7A 2HENA 4DA5A 2H34A 3NYVA 4Y8DA 3I81A 3LFSA 3POZA 1Y8YA 3PPKA 4CCBA 5FBOA 5ANKA 3T3UA 4L01A 5C4LA 5I9UA 3C1XA 4FTKA 4HNVA 1JDBB 5M4UA 1BL6A 3VS4A 3WBLA 4HVIA 4ZY4A 4WSYA 2XK3A 5KKRC 1QPCA 3W0OA 3SE7A 4BZNA 2F9GA 3N4UA 4DITA 4LOPA 5C1OA 4IFCA 3IGGA 4FT9A 4S33A 2C6LA 3PUPA 1CKIA 3CIKA 4NWMA 2HHFA 4H1MA 2ONLC 3PE1A 1B38A 4J71A 4FYNA 3U51A 1ZYCA 1OL7A 4L3JA 5FTOA 2X7OA 2G2IA 3BHTA 4EH3A 3UOJA 4I4TF 4GG7A 4QQ5A 2HZ4A 3SDJA 3ZDIA 4HYUA 2QR8A 3UYSA 3TY5A 1G8AA 4UALA 3P7AA 1OKWA 2A1AB 2Y6OA 4EBVA 2Z7QA 4KKGA 3GU5A 2NU7B 5H80A 3TW7A 4FT0A 4YZDA 2OWOA 4AGWA 5AX3A 5CF8A 2Y0AA 4OTFA 1GZOA 3RTPA 4IWQA 2EXCX 4C59A 3AGLA 5HLWA 4DAWA 2OBJA 2XYNA 3TZMA 4A9RA 4BN1A 4IZ7A 5IA0A 5CM0A 3R30A 4AG8A 3PWDA 4BTKA 3EH9A 4DBXA 4F6SA 3TV4A 5HNBA 3JZFA 3QRIA 2J0MB 2NYAA 3QFFA 2JDTA 2VUGA 4F1MA 4IZYA 4XCUA 5CSVA 4PL5A 2WU7A 5L8JA 5EM6A 3S95A 4FIHA 1H1QA 4BDCA 4CRLA 4IB0A 4AU8A 3ZOSA 5A6NA 3MJ1A 3TN8A 1DI8A 4HNUA 2R7NA 1XH7A 5ANEA 3OWKA 3AG9A 2R9SA 3GFEA 3OWLA 4G16A 3DKCA 5IQIA 4D2SA 2X8DA 4J52A 3BL9A 2P55A 3ATTA 4PRJA 3NZ0A 5HE3A 3WI6A 5M07A 1W96A 2BFYA 2BZJA 4HZSA 2IVTA 3UZOA 2VD5A 3F5PA 1KE6A 4LL0A 2V0DA 4Z55A 5FRIA 3QQFA 2OJIA 1V9PA 4FEXA 4E4LA 2C5VA 3KN6A 2XK6A 2YA9A 3ML1A 4FIFA 4FTUA 4YC3A 4WUNA 4G1WA 3GJXB 5KX5F 4X3FA 4H58A 3R7VA 3ZM4A 4O22A 3WF6A 4KNBA 5DLSA 5IMEA 4U80A 5LVPA 2R86A 3TDWA 2GS7A 3A7IA 4TYIA 4DEDA 3AKJA 2HY81 4FNYA 5EW8A 2JGZA 2VTOA 3UIMA 4R7BA 5LVNA 4AZTA 1NT2A 5J9ZA 4FBXA 1ET0A 2XIXA 3LPBA 3U0GA 3A7FA 5CSHA 5E9EA 2XCKA 4EC9A 3LM0A 5IG1A 2VWUA 5CEPA 2WTCA 2DYLA 2WMSA 3IO7A 4M15A 2JDRA 4I5CA 3GB8B 5LP6F 3IECA 4F65A 2NPQA 3DS6A 2QG7A 2OK1A 3OXTA 5LVOA 2QOQA 4GVAA 3CY2A 3OW3A 4M0ZA 5BWXA 1JSVA 4O0UA 2ITOA 4IZ5A 4PV0A 4A9SA 3GC8A 3MSSA 5M55A 2QG5A 5C03A 4ZLOA 5K5NA 1W84A 3ACKA 3GC9A 4YC8A 4MQ1A 5L2TA 3ORPA 5H8EA 3WF5A 4NU1A 4DGNA 3EFKA 1XBAA 3R7YA 4AN2A 5AAGA 5IF1A 4RJ6A 4YJ2F 5EI6A 2YISA 2IZTA 2WNTA 4GEOA 2X81A 4DHZA 2J9GA 1YWNA 3LE6A 4JBOA 2QC6A 3R04A 2JBPA 4O0YA 4AUAA 3SA0A 1ST0A 4AZSA 4WRSA 2QOLA 4BDGA 3LFFA 1CKPA 4USDA 5AUUA 3SQQA 4FUXA 3D83A 3JZ6A 5CAQA 1XH8A 4EOPA 3W10A 3FMDA 1A06A 2P2HA 3KAJA 2PU8A 3HBLA 4JIKA 2OLCA 3DBDA 2B7AA 3EKNA 2HGSA 2UZUE 4IWPA 3RR5A 3EQPA 1REJA 2IPXA 3NNWA 2H9VA 3ULZA 3W32A 5K4IA 1KV2A 2ETMA 4UWBA 5AP1A 3HB9A 4M9UA 5I5SA 4MV4A 4M67A 4O4IF 5DAAA 3AC3A 1PXKA 1PKGA 4D4SA 4EBWA 2OXDA 3CPCA 3ULIA 5FEDA 4WNKA 5TOZA 4D4VA 4I55F 1OPKA 4YLJA 2IZSA 3QZHA 2RIOA 4TV8F 3BYOA 5DFPA 5A4LA 2BRMA 3QRTA 4V0GA 2C5OA 3NVKI 3MFUA 2JAMA 5HI2A 2VWBA 1ZMVA 3FPMA 4L44A 4CT2A 1VS0A 5DIAA 4EH4A 4O6LA 3F88A 4QP3A 3OP5A 3T9TA 1P8LA 2PYWA 4YJSA 5KBRA 2WTVA 1IG1A 3NS9A 2EVAA 2JFMA 3E7VA 4XYMB 4CKCA 2YCFA 2CKPA 2J51A 2YEXA 2ZV7A 3KA0A 4KBAA 4ZP5A 5M08A 4TL0A 3NEWA 2WZJA 4NZNA 4O0SA 2EIYA 1YWVA 4NW6A 2OXXA 4AZFA 3ERKA 3FY0A 4Q9ZA 2P2IA 3D7ZA 4CEGA 5CVHA 2C00A 4MBLA 3OW4A 3HKOA 3VJNA 4XJ0A 4J8MA 1IEPA 4FKSA 3LXLA 3ZO3A 4DH1A 5A54A 1ZZ2A 3F3ZA 3QA0A 4LQMA 4NCTA 4PNIA 2F49A 1CKNA 4AWIA 4F6WA 1WZYA 4FTNA 1KEEA 1EYZA 1H07A 3BYMA 1E4EB 3I1AA 3VUDA 2YM6A 3CTHA 3QWKA 3KVWA 3MPMA 4NT4A 2CFMA 2RF9A 2HZIA 4PTEA 1XR1A 3DXNA 3D5WA 3W8LA 4BI1A 3D15A 3PA3A 4N6ZA 4IM0A 3SRVA 3ZLXA 3QQLA 4WIHA 4IWXA 2HVSA 3CEKA 1PMEA 1H4LA 3BGPA 2XMYA 2PK9A 1FOTA 2W4KA 3Q9YA 4QYYA 5HE0A 3RAIA 3TNQB 4YHFA 2C6TA 4MNFA 3V5JA 3NSZA 1PK8A 4FT3A 5LARA 2ZYBA 3NCGA 3JRWA 1JSUA 1IAJA 5KMOA 5HBRB 4CFUA 3IW8A 2ACXA 2W1EA 3OUZA 2FSLX 2W1IA 3VF8A 4GV1A 5BVKA 3ZBXA 4YNOA 2X6EA 4ACHA 2XK9A 3HV4A 4Y5QA 2JDVA 4JLCA 5D10A 2EJ2A 2YCRA 1URWA 3KC3A 4D0WA 2YM8A 3DXPA 2CN8A 2ODTX 1NVQA 3DDPA 3HVCA 3BYVA 3TKIA 3QUDA 4QMNA 3AKLA 4EFBA 1OITA 5AADA 2W4JA 5EW3A 5JK3A 3ORTA 5CENA 2LAVA 5CE8A 3FBVA 4FKRA 3NYXA 1M7QA 2XM9A 4GU6A 4K6NA 2WQMA 4UEUA 2GCDA 5CSXA 1IA8A 3VW8A 1P14A 3PXKA 3I5ZA 4C61A 5L6OA 1VBHA 3QLGA 5KMMA 3LQSA 3OWJA 2XIYA 1Q8YA 1CKNB 4FKVA 4X2GA 1GNGA 5AIRA 4ZEGA 5A4CA 1Q3WA 2ERKA 5HX6A 4YBZB 2XNMA 4C02A 5EM8A 4LRKA 3MY0A 4RIYA 4EK6A 2A1HA 3NGAA 3BLHA 3RVGA 4XMOA 3WZEA 1OPJA 1OUYA 4O4HF 2YZNA 4ZTRA 1QMZA 3FJQE 5E8YA 5TO8A 3MA3A 1PY5A 3EMGA 2ETRA 3DK3A 4YTFA 1EH4A 4ZAUA 3DB6A 5J87A 2HDKA 2YABA 2XAOA 4BICA 4Z7GA 3P4KA 3GQIA 3NYNA 1AUVA 1HCLA 4X6RA 2CJMA 3H0YA 3LCOA 5IQBA 3CJGA 3JR1A 2JKQA 3EKKA 3PY0A 4UB7A 3ZSIA 4XX9A 3ORIA 3VC4A 3R01A 4IQ6A 4DFUA 2C68A 4V0GB 2OXYA 5EK7A 5DE2A 4O7RA 2R3NA 1XBBA 5HX8A 1NW1A 1H0VA 2Y8OA 3L9MA 3Q2JA 4O21A 4RJ8A 5A46A 3S1HA 2UV2A 4BCIA 3ETHA 1QPJA 1J1BA 4PMTA 2JIUA 3GVUA 2W1FA 3QCYA 3RAKA 3F5XA 5EDPA 1DGSA 3WO0A 3OCSA 2VX1A 3PVGA 3G51A 4H3BA 2UVYA 2XK8A 3QTIA 5EYKA 4AA0A 4O7NA 3KRJA 1VYZA 2GSFA 4FFMA 3QCXA 5JFWA 3WF9A 2ZDQA 4MHAA 4N6YA 1FVRA 4GT3A 4BCQA 3KCKA 2BIKB 3OWPA 4LI5A 3MH0A 5KZIA 3BGQA 4AQCA 1U59A 3PXRA 4HCVA 3A4PA 4PZ8A 3K3JA 4J98A 2QOBA 4QMSA 3E3BX 3MBLA 1STCE 4ZIMA 2QNJA 4FKUA 4FTIA 4BHNA 2Q0NA 5HHWA 5CU4A 3L8PA 4EH6A 5IU2A 4I23A 3V5PA 2GMXA 4QDVA 4FFLA 2XK7A 3I0OA 2Z04A 2NU6B 1J7UA 4H3QA 3LFBA 3CTJA 3DZQA 4FOCA 5HU3A 5LMKA 4A4OA 4ZSLA 3FQSA 3SGCA 4BDDA 5I9XA 3JXWA 3A7JA 5L2WA 4MVFA 5CAEB 5E7RA 2HW6A 3BU3A 4N4SA 4FKPA 4CFFA 3QFVA 5JN2A 2O65A 2P0CA 3W5OA 1GIJA 3MWEA 4KSPA 2VX0A 3UDZA 3GFWA 4OBPA 3VJOA 4FU0A 2NU8B 3VPBA 2P33A 4FSWA 1C3OA 4DAAA 3QAME 1X8BA 4LGGA 4CLIA 4R7IA 3HECA 5HO8A 3WE4A 3R5FA 1XQZA 3QD0A 2NO3A 2XANA 3CPBA 1TQPA 4DLIA 4ZZOA 3R8UA 4S32A 5FTQA 1NA7A 3EZVA 5FP6A 3WYYA 1ULZA 4O4JF 1SCUB 1Z2PX 3P23A 3ETAA 4QMPA 2QOHA 5C1QB 1JBPE 2F7ZE 2BRHA 1C30A 4OBOA 2XNGA 5AM6A 1CSNA 4G6NA 4MBJA 4P2KA 3VONA 4BI2A 1Y6AA 3OBJA 2ZV2A 3EL7A 2QVSE 1OL2A 4JG8A 4JX7A 5E90A 3TW6A 4CMUA 4FEVA 2JKKA 3LCDA 3LFQA 3W16A 4IMYA 1OVEA 1T45A 3DK6A 4J95A 4K8AA 5DEWA 3BG5A 3TTIA 4D9TA 1Z9XA 2R4BA 3RJCA 2IO6A 3OF0A 4CC5A 5BWVA 2O2UA 4KBCA 1W83A 4FEWA 4X2FA 4Q5EA 1PXLA 3I79A 2RFNA 2ZM1A 1UWHA 2WMQA 2UW3A 3N4VA 3R2BA 1VZOA 4O82A 4I24A 4PDYA 4G3EA 4YZCA 5J9LA 4O38A 3EJ1A 2QO7A 4NSTA 1CKJA 1B6RA 1KJQA 3R7OA 4GL9A 4K11A 4WBOA 4DG3E 1UU9A 3D7TA 4FTRA 5DN3A 5FXQA 3JSNA 5CU6A 3V01A 2PVRA 3MFRA 3H9OA 3VS0A 2C6DA 5ANOA 4DQNA 3SC1A 3CR0A 5A4QA 4FNXA 3FMMA 2WAJA 5BMSA 3KMUA 3VOTA 3PXZA 2C0TA 2VTRA 3ANRA 3H10A 4G6LA 4O86A 4QT1A 4WT6A 2O8YA 5CZIA 4F0FA 4O96A 1YRPA 4XYFA 5ANJA 2WB8A 2VTHA 3QL8A 1ZOHA 3LFCA 5C8MA 4BBMA 4LMUA 4DDGA 3R8PA 4FEUA 4UBAA 5BWRA 4AZWA 3FYKX 3ROCA 4C4EA 5A4TA 2X9FA 4I93A 5I9WA 2XRWA 4U97A 3JS2A 3NNUA 4O2PA 5FD2A 3ORKA 2HJWA 4IJPA 2I80A 2OSCA 5I5VA 2PUIA 4RT7A 1YXVA 3SW4A 4RZVA 2JIVA 3TZ9A 1O6LA 4RIWB 2R3IA 3K3IA 4X2JA 4EJNA 3UMWA 3E8EA 3GNIB 3T3VA 2Z02A 4U8ZA 3A61A 3QRUA 4FL1A 5EYCA 3W0MA 4CXAA 3DBEA 4JDJA 2QHMA 1V0BA 4IAZA 3QTXA 5ANDA 3Q9XA 5BMVF 5IA1A 3W18A 2Y4IC 4ZY6A 2IW8A 3S3IA 3VBTA 4FICA 3I4BA 4AX8A 4H36A 3GXLA 4CG9A 2UZLA 5LJJA 4QMTA 1EUDB 1CMKE 1UNHA 1PYXA 2FGIA 2QONA 3G33A 1KE5A 4GRBA 4QDEA 4L45A 4QTBA 4FC0A 4I6LA 5AV3A 3EFLA 3AD6A 4FTMA 4WOVA 4XBRA 3VULA 3UBDA 4CKIA 4ERKA 3UQFA 5CQUA 4APCA 2GNIA 5CI7A 5IDPA 3F5UA 3G9NA 3PJ1A 4C3RA 5AV4A 1VJYA 3E7OA 4BRXA 5DG5A 5E92A 4E8AA 4F9YA 2YZLA 4YZBA 3UIUA 3E63A 1TQIA 5L8KA 1B6SA 3DTFA 1GAGA 2HW7A 3M11A 2PMIA 4USEA 4XG4A 2GHGA 5KNJA 3ORQA 2VNYA 3W2SA 1G8SA 3WO1A 3PVBA 2VTQA 3H3CA 4ITJA 3OXZA 3LFEA 5M4CA 2XEYA 3THBA 1Z57A 3LLAA 5LXMA 1H1SA 5CU2A 2WQBA 5HBEA 3NX8A 3LCTA 3VUKA 2CGWA 5K9IA 3T9FA 2HCKA 3ZEPA 1Q8WA 4NYEA 3R8LA 3H9RA 4J97A 4XP2A 5L2SA 2C6OA 3FLQA 5IA4A 3IOKA 1T46A 2BPMA 4C2VA 4PQNA 3VPDA 4ARKA 5KMJA 1NVRA 2PY3A 4GK2A 5FM2A 3RAWA 2R7IA 4LV7A 3UTOA 4JG7A 3EFWA 4DC2A 4EI4A 5EH0A 3CD8A 1OIUA 3ANQA 1I1MA 1IRKA 4U45A 4UYAA 4EH5A 1PYEA 2X9EA 3OT8A 3OY1A 4BDIA 4E6NA 3NWWA 3VRZA 4AGUA 3LAUA 4EH7A 3OCGA 4CKJA 3EWHA 3DLZA 2WMUA 3BIZA 3GGFA 3JYAA 1DS5A 3FLZA 4AQKA 4D28A 3TY9A 4LUEA 2R7BA 3RALA 5AP4A 4PMMA 2WMBA 3MYGA 2AC5A 4DH8A 4O2ZA 4RJ5A 2J50A 2YIWA 3BU5A 3BYUA 4JI9A 4E6CA 4F9WA 2YS6A 5F20A 2Y9QA 3GCSA 4F99A 3UQ8A 3EIDA 3E3PA 2YM4A 2WFYA 4IAKA 4YZNA 4BCGA 3UFXB 2CLQA 3GOKA 3FC1X 5FPOA 3KF7A 2C6IA 2W1DA 3COIA 1M14A 4BIBA 4BI0A 1MRYA 3N51A 2Q83A 3I6WA 3UP7A 4RVLA 3C4EA 1J7LA 3BQCA 4IANA 4HNTA 3GCPA 2YDIA 5AP2A 5KBQA 2X8IA 4NTTA 4P5ZA 2XKFA 3KY2A 3V5TA 1YDTE 3Q6UA 1H24A 3VUHA 1ZY5A 4QNAA 3BQRA 3SXRA 3ZFXA 3WWHA 2BVAA 1SNXA 4FVPA 2C69A 1KE7A 5D9HA 2YCSA 3WE8A 4CGAA 4ZTMA 1H8FA 3P78A 5BV3A 3K5HA 2UW0A 4FV2A 4KAOA 4YHTA 3ZS5A 3R23A 2V7AA 5EQEA 4D9UA 4F1OA 2C5YA 3AD4A 4KINA 5CSPA 4AXFA 3ZLWA 3NAXA 2XF0A 4MXOA 4FV0A 4DYMA 3QRJA 2W96B 2F7XE 3L8XA 3D2IA 2AYPA 4KIPA 4D5HA 5LYJF 2CKOA 2UW6A 3LW0A 4I6HA 2HK5A 2C30A 5E8SA 3TDVA 3UOHA 2UZTA 2GNFA 5EYDA 1AUXA 3QZIA 3GU4A 4J96A 5JRQA 3FMNA 3IW4A 3LCKA 5CTPA 3UNKA 5CA1F 3GU8A 3H9FA 3SKCA 3TIGA 3ZCLA 3HV7A 1ZMWA 4K6ZA 1XH6A 3VQUA 3EOCA 2BDWA 2XAMA 2A0CX 2HIVA 4UZDA 2DABA 3OHTA 2QB5A 3LQ5A 2PVJA 4ZLZA 4IVBA 4WA9A 3V6RA 4EK3A 4GT4A 2JDOA 5DWRA 4U7ZA 4U42A 3PE2A 2WMVA 3Q2OA 3LXPA 3KN5A 3DAJA 4LMNA 5AP3A 4DH7A 4L3LA 5T6KA 3UNZA 4DFXE 4OTGA 3RNIA 3QA8A 3NYOA 3LMIA 5AFVA 1KJ8A 2XKCA 3R7EA 4A9YA 2C6EA 2HG8A 1PJKA 3Q5IA 3QQUA 3E92A 4ASZA 2WMAA 3C13A 3R6XA 4JJRA 4MV7A 1W82A 4EGQA 2HVQA 2YM3A 3DCVA 4M3QA 4RJ3A 3BE2A 4X6QC 3Q52A 4FSZA 4BCJA 4TYGA 3U87A 1CQIB 4C7TA 5EDRA 2Z7LA 5ETAA 2UZVA 3DXQA 3JVSA 3MVHA 5EG3A 2J90A 3DA6A 3ENHA 3R9NA 3W2RA 4OBQA 4CD0A 4E26A 4EH2A 5I5TA 1K9AA 4E5BA 2YFXA 3QUPA 4I6BA 5T3QA 3QWUA 1U46A 2ONLA 2W5AA 4JBVA 4YLLA 2HVRA 4R7HA 4WG5A 3TTJA 1Q62A 4BDJA 2YM7A 1W0XC 4DH5A 3UP2A 4BCPA 3V04A 3DAEA 4FODA 3PTGA 2BRGA 4CLJA 5L6WL 3NVMB 3P9JA 3KFAA 4Q4DA 3LXNA 3ZLSA 2CDZA 2WTDA 4I21A 4Z9LA 5IQCA 4GLXA 3H30A 2QCSA 3G2FA 1SMHA 2P0AA 4HGLA 4UX9A 4YPSA 3R9HA 2CNQA 2XKEA 2Z60A 3ORZA 4PL4A 4JDHA 4OTRA 4HPTE 5D41A 4BY9E 3R7UA 1M2RA 3G9LX 5HE2A 3W55A 1G2WA 3HZTA 1H1PA 2V59A 2WPAA 5HU9A 1ZYDA 5H8GA 4C35A 1M2PA 4JOAA 3EQRA 1UNLA 3L1SA 4YP8A 1IR3A 2J0IA 3FWQA 4FIGA 4I6FA 3UDSA 3E8CA 2UVZA 1WFCA 3BEAA 5HIEA 1MRUA 3F82A 4FSQA 1GZNA 4CQEA 2DIKA 1GJOA 4TYHA 4BYJA 3EN9A 3QTWA 3B2TA 5HV6A 3L2PA 4O4LF 4U3ZA 3EQCA 2ZFYA 1Q97A 4MXZA 2QR7A 4FGBA 4F0IA 4NFMA 5HVJA 3TKUA 1VLRA 4MK0A 3FKNA 3P1AA 3TM0A 5DOSA 2DS1A 5K3WA 3EN4A 1XWSA 4QMMA 4I5PA 1HOWA 4BJJA 4MV3A 4ZLYA 3OG7A 4O0XA 3M1SA 2NNWB 3P5JC 4LM5A 3GU7A 4UN0C 4ZSEA 4TUYF 2IWIA 5CX9A 3KULB 3TI1A 3CQUA 1YXXA 2OI4X 4KABA 3UZRA 4AW0A 1Y8GA 4DDIA 2W6ZA 2W71A 3T7AA 3OCTA 4M69B 3VA7A 4W8DA 4RWJA 4FIIA 3ET7A 3FI8A 2CCHA 4M14A 4YNEA 2I0VA 5TR6A 3VS5A 5IQGA 5CANA 3TIIA 3F2AA 3VBQA 2B54A 3W0PA 3LJ1A 3W0NA 5B7VA 3QC9A 4ZMEA 1EHIA 4KRDA 4GS6A 3HMOA 4BDAA 1B04A 3HA6A 5CAOA 3MIAA 2W6MA 1JKSA 4YSJA 3WIGA 3JZIA 4M97A 2B0QA 3AMYA 3U6HA 2YM5A 4V01A 4R1YA 3DPKA 2C3LA 2QO9A 3II5A 3LXKA 3QCSA 5EHLA 3OY3A 4RIYB 3RHKA 4NIFB 3ZUTA 4F64A 3FLWA 4TM5A 4PDSA 5DGHA 4TPTA 4A4LA 2BZKB 2ITNA 3JUHA 2E9NA 2RKUA 1OKYA 5GHVA 5BVWA 1ATPE 4E73A 2A2AA 3A2CA 4XRLA 4Q5HA 3UE4A 3UMXA 5TKDA 4F08A 5JVLA 3TUBA 4AAAA 4RC3A 1GSHA 3HA8A 3TEKA 1O6KA 3CY3A 4QYFA 3FUPA 3PIYA 4H1JA 4U81A 4YURA 5BYYA 4XOZA 4BTFA 2QURA 3G0FA 5AMNA 4C4IA 3BABA 1LEWA 2X2LA 3ETJA 1BX6A 5DEYA 2JBOA 3F2RA 3MJFA 3UVQA 2KTYA 1IOVA 3UVPA 5HORA 3BV2A 3OFMA 2R3PA 1JOWB 3G6GA 1ZMUA 1Y6BA 2OH4A 4M84A 2BILB 2EUFB 5CEQA 3RFCA 2B9FA 3E93A 4XH6A 5H2UA 4AW1A 4PZ6A 4CTBA 1U4DA 3PZEA 4NJDA 2GTNA 2OH0E 4GUBA 5L3AA 5M51A