4O7ZA

Saicar synthetase (type-2) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
226
Chain Sequence
AKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
total genus 71
structure length 226
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7zA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7zA02
3OY3A 3H0YA 4MXYA 2WELA 4FEQA 4YTHA 4N70A 4XLVA 5BVKA 3KK9A 2UW5A 3F5XA 4YSJA 3DDQA 1B39A 2FUMA 5CALA 3UIUA 4MV1A 3Q4UA 4JVGA 1IOVA 4E4TA 3NEWA 3ROYA 5KE0A 4IB3A 1Q99A 3FWQA 4U3ZA 2XVDA 4QMUA 3QQKA 4FSRA 3ZO2A 3VNTA 4LOQA 1R3CA 4MX9A 1M2RA 4XV9A 5A6OA 4QYYA 2JFMA 3G6GA 4O83A 1U46A 5C4LA 1DM2A 3ETJA 4MD7E 3W18A 5AIKA 4G6LA 2W06A 4YHJA 2G01A 3LFEA 2I7QA 1K3AA 4L46A 4FTJA 4QQ5A 4KRDA 3FLSA 2YA9A 3R02A 2EXCX 3R04A 2HAKA 5HLNA 4XEYA 4RVMA 3UBDA 3RHKA 3N51A 3FQHA 3EQPA 1BL6A 5H3QA 2NNWB 2YCQA 4N0SA 3OG7A 1JKLA 1FINA 3ZZEA 4B6LA 2WOTA 4DG0E 4FV6A 2JEDA 4EH6A 5LVMA 1R78A 4IZOA 2VWWA 4H58A 5L6OA 2JIUA 4XG7A 4IM0A 2Z7QA 4DEAA 5H8EA 3MYGA 4GIHA 4TNDA 4YNEA 4BI1A 3U6HA 3E3BX 3F7WA 3KRLA 5A4EA 2WTJA 4QMOA 4AOTA 3R2BA 4ANSA 3VBVA 5IZFA 4XBUA 4S34A 2W70A 4IAZA 1CKPA 2C1BA 2X2MA 3RAHA 4E6AA 2X2LA 3FZRA 3RPRA 2AC5A 2J7TA 2HK5A 1OKWA 4BCMA 5IMXA 2QOHA 4C59A 1KUTA 4GRBA 3RPSA 1YWNA 1R39A 4TW9A 2GQGA 4F63A 4J8NA 4WO5A 5LOVF 4I0TA 2UZOA 4O7VA 3R8MA 3KCKA 4OW8A 4PV0A 5IA3A 2OJJA 4RRVA 5IDPA 3PJ8A 4LOOA 1BYGA 2F49A 3BHHA 2NU9B 2X7FA 5HX6A 3QQGA 2C6KA 3EB0A 5M55A 4HZRA 3TKUA 2R3KA 4PMTA 2PZRA 2XK6A 3E8NA 4Y5HA 4Z3VA 3RK5A 4WRSA 3ZO3A 4RIXB 5CNOA 4O7ZA 3UO5A 3FI3A 4W8DA 4FV2A 5CF4A 5IEVA 3AT4A 5I9YA 2R3NA 1P5EA 2R2PA 3BX5A 3CBLA 3DTCA 4PL5A 3OFMA 4IFGA 4QP3A 3W32A 4KIOA 2JAMA 4FKIA 3VAPA 4HGTA 4MV3A 2R84A 3NUXA 5IQBA 4C4EA 3O71A 4G31A 4QMQA 2EB3A 5FUTA 4XOZA 4I50F 4R1YA 4RJ6A 4ZXTA 1YQJA 2IZTA 4H39A 2WFYA 2VWVA 2ZVAA 4GSBA 1Q61A 4G6NA 3W55A 5EM6A 3RK7A 3Q60A 4XCUA 1XH9A 3ODZX 5EDQA 3SXSA 4C02A 5JRSA 3R7UA 4ZZMA 4OTRA 1IRKA 4QSHA 5IYZF 5KNJA 3PXKA 2WU6A 3EN5A 3PY1A 4IHPA 4DTKA 5KX8A 4B99A 3DKCA 5D8DA 3W1FA 3W8LA 2CKQA 4U41A 1RE8A 1T46A 2V62A 2IG7A 1Q8TA 2VWYA 3AOXA 5JRQA 3KAKA 4I4TF 4F09A 2C5OA 2QU6A 3COIA 3AC1A 4GK2A 3MB7A 1RQQA 3O7LD 5CX9A 1J1BA 4EWHA 4EZ5A 3U4WA 1OBDA 4D1XA 4CLIA 3A60A 4AZWA 2QOBA 4HYHA 4PMPA 5A4TA 3JRXA 4BDHA 2WMSA 5CVFA 4D4RA 4TYHA 3NIEA 1QPDA 4BIDA 3A61A 3G0FA 2R3IA 5EG3A 5FDXA 1KOBA 4LV5A 2VNYA 3WZJA 1YWVA 4TKSA 3EQBA 3FE3A 3QL8A 1OL5A 3HMNA 2X7GA 3T9IA 3C1XA 4ENYA 3BE2A 2QOCA 4QP9A 3COKA 2VRXA 3M42A 2PMLX 5C8KA 4TN6A 3C0GA 3H9RA 5A14A 3OUZA 2C6EA 4ZY5A 3QZIA 4LRMA 4D1SA 4ARKA 2YIWA 2C6DA 2G2IA 4GT3A 5BVDA 2Y4PA 4EUTA 4EK6A 5AAGA 3LFDA 3MVHA 1MQ4A 2QONA 4K6ZA 5A9UA 5DBXA 1UKIA 3GU4A 3BEGA 3K3JA 2IP4A 5AM7A 3FHRA 5EI8A 1KE9A 4QMXA 4MBLA 4BBEA 2C69A 3DS6A 4JI9A 4EH4A 2XH5A 3GI3A 3Q4CA 2W5AA 4FIIA 4FV4A 4DFBA 3LM5A 5HO7A 3WIGA 4F9AA 5IG1A 3KB7A 1MRYA 3AT2A 3MGYA 3EJ1A 2EB2A 1Y8GA 4FTIA 1ZYCA 4QMSA 5DYJA 5AWMA 3OF0A 3PY0A 2OG8A 3TNPC 2ZDTA 5LVNA 1KOAA 1WCCA 2CNUA 3AT3A 5HE3A 4IWQA 3OXIA 1H28A 2XB7A 1SNUA 4W4VA 5CT7A 4ACHA 2YFXA 4ZJVA 1YKRA 3NSZA 5D1JA 2C6TA 5H8BA 4R3PA 3H0ZA 5JK3A 4XX0B 3FUPA 4A4OA 3E93A 5EM7A 2X39A 4DFNA 2GFCA 5CU4A 5FG8A 5KZ0A 1WMKA 3PA3A 4FTAA 3BU5A 4TT7A 4D0WA 3EZVA 3NW5A 1KWPA 3QZGA 2ETRA 4I24A 4W8EA 1V0OA 3K2LA 3ORIA 3QQJA 4PWNA 3ENHA 2QC6A 4RSSA 2GMXA 2O65A 3DZOA 5CWZA 5DN3A 4F7NA 3R01A 4HVIA 1PJKA 2DS1A 2W1CA 3IO7A 3F69A 5DGZA 4GU6A 4R7BA 2E9PA 4Y83A 4AW0A 2ZDHA 4HNVA 3C4FA 3ZRKA 4YURA 3U6JA 3AC3A 4C2VA 3RPVA 4MXOA 5CZHA 1CMKE 2B52A 3DQWA 3CR0A 4L8MA 4AGCA 3CPCA 4RVTA 2YCFA 4EEVA 4YBZB 4AQCA 4NK9A 2X0SA 3G8CA 3VBWA 3KCFA 5KX5F 2YZGA 4OTDA 4XLIA 3JY0A 3FMLA 4DEGA 4BCJA 4ZIMA 1H1PA 3T9TA 3DBFA 4WUAA 3DA6A 3BWJA 3VS2A 4DE4A 4HVHA 4JIAA 4KA3A 4YJ2F 3QD4A 4DAWA 1Z2PX 4BTJA 3NUAA 4IACA 2O63A 4QMYA 4FA2A 3JZFA 4I6FA 3NYOA 4X2JA 3L8XA 3QTZA 4MKCA 5AP5A 3RNIA 2BRGA 1TKIA 4R1VA 2WTDA 1CSNA 5M44A 3E3PA 2VO0A 5KMLA 3F6XA 3MH3A 2CMWA 5JEBA 2UZDA 4HOKA 4XOYA 5EQEA 3I4BA 2GS6A 4XRLA 2XIYA 4J52A 2F4JA 1G3NA 4TPTA 2ZMCA 3FMMA 5B0XA 4QTBA 2PUIA 5G6VA 5FP6A 4YZ9A 2IPXA 5BUIA 2UZTA 4DBXA 2IVTA 3Q32A 4AAAA 4RIYB 3DLZA 3IECA 1GZNA 3IW5A 4U45A 3AD6A 1G5SA 4CD0A 4DBNA 1W96A 4TNBA 4DEHA 4RQVA 2G2HA 2Z7LA 3DK3A 4AA0A 3D5VA 5HBEA 1EUCB 3BWFA 2BKZA 4IM2A 3ZRMA 1G8AA 5AUZA 3DV3A 3BGZA 2YM3A 3HKOA 2ETMA 2OH0E 3HVCA 5JH7F 1UVRA 2P2HA 3QTQA 3I12A 2H8HA 1ZYJA 4EG0A 1XBCA 3JVRA 1FBNA 3EQHA 4G9RA 2BRNA 2PVYA 1VKZA 4IWOA 4F70A 2ITXA 3PP1A 4I0RA 3IK3A 4BTKA 3PIYA 2LGCA 4WKQA 5CNNA 3I0OA 4E6CA 2O0UA 4BKJA 5EHOA 4W4XA 4BGQA 4O7WA 5ETIA 3VBYA 3EYGA 3O8TA 3GC0A 5M08A 2PUNA 4U80A 3GEQA 4Y8VB 1JKKA 2C3IB 2PVLA 4XP2A 4ZAUA 4G34A 3K5HA 3FKNA 4HYIA 5J9LA 2Y4IC 3R2YA 2JD5A 1ZYDA 5DRDA 3BYMA 4YO6A 2YRXA 5AP7A 3TKHA 1OUKA 4QTAA 3AD5A 3PJCA 1KJIA 1I09A 4GUEA 4R78A 3OWLA 1M6VA 2YHVA 4UZHA 3TINA 4WT6A 3SE7A 3FLZA 2CSNA 3R1NA 1MRVA 3RM7A 2V59A 2HENA 5E90A 4C5CA 3QRIA 1JWHA 3QRKA 4K33A 4U40A 1VYZA 4BDCA 2VTHA 3TNQB 4G5PA 4FEXA 3V5TA 3VUIA 3RV4A 3UFXB 4AG8A 4N4SA 4ZJJA 4E5WA 3G9LX 3IS5A 2SRCA 3QHWA 4FV5A 5ETCA 3V5LA 3VJNA 4C37A 5T3QA 5M07A 4DEIA 3DLSA 3SAYA 3OCSA 1KJ9A 4FFOA 3HRFA 4FIGA 4XRJA 2WOUA 3DK7A 3FLQA 3AC2A 4G3EA 4FZFB 5EW3A 4F6UA 5HLWA 2ERZE 4CT2A 3OOGA 4GV1A 3AX6A 3A8WA 3OD6X 3QA8A 3LCDA 3C4CA 4MYGA 5BYZA 4G2FA 4IAIA 3PZHA 2AUHA 5AM6A 4FIJA 3HECA 2Y9QA 2O8YA 4I93A 5AUVA 5ACKA 4LL5A 4UXLA 3RAWA 2UVXA 4IVBA 2VTIA 4L6QA 2R3PA 2C0TA 3HP2A 2XJ0A 2YM6A 4AN2A 4HW7A 5C1PA 3EQRA 3U55A 2BZJA 2ZM1A 1BXRA 1Z2OX 4YZCA 4CFVA 4R3RA 1PXMA 4FEUA 3ENMA 4XG6A 3C0HA 3H4JA 4USDA 3CTHA 3ZO1A 3FMJA 4K8AA 4DITA 5AP0A 4JQ8A 3LFFA 4M69B 3VS6A 5IISA 4ZLYA 3WE4A 2HOGA 4EK4A 1IA9A 1YDRE 2E2BA 4YPDA 3EL8A 2BTSA 1C30A 2IN6A 3WZEA 4NJ3A 1OB3A 2NP8A 1BLXA 4E4XA 4ZY4A 3TUCA 1QPEA 4KBKA 3BE9A 4MF1A 4NKAA 4USFA 2ZMDA 5IQIA 3NPCA 5LMKC 5FTQA 4BVUA 2XZSA 3LP8A 3VC4A 4LMNA 2ZV8A 4M67A 4WSYA 4I6BA 2ZDUA 4O7SA 1VBHA 4WNOA 5JFSA 4XZ3B 5ANJA 4JR3A 2PULA 2X9FA 5FXRA 3ERKA 3P79A 4WNMA 2WNTA 4XBRA 2W6OA 3N9XA 3R8ZA 2XYNA 2BDWA 3ALNA 4JOAA 4H3QA 4I21A 2Q0NA 3AC4A 1PHKA 4S33A 4U44A 5E8UA 1XO2B 3SW4A 4D2RA 3D15A 3FYKX 4QP1A 3ULIA 4BZNA 1GZ8A 4TYGA 2O64A 4H3BA 4L3PA 4AW1A 2I80A 1QL6A 2RKUA 3N6RA 4F7LA 5DEWA 3MV5A 4L7FA 2YM4A 4ZSGA 1OMWA 1EZ1A 1M52A 4P4CA 4EWQA 1Z9XA 3H10A 3NCGA 3EQFA 4BIEA 4FFRA 3KULA 3LLTA 3QTIA 5EYKA 2ZV2A 5LVLA 5E8VA 4EONA 1TQIA 3SKCA 4AGUA 5TF9A 1U59A 5IUIA 1PF8A 2XIKA 3DTWA 3EH9A 4ZMFA 1TVOA 4FBXA 3EQIA 2OJ9A 1P2AA 3ORZA 2B54A 2QOIA 2VTNA 1KC7A 3VW8A 3E87A 2C5VA 3DJ5A 5D41A 4LUDA 4UN0C 3QX4A 1GJOA 4IDTA 1YXVA 1NVSA 3CQEA 4DH5A 2Z7SA 4I55F 2C68A 2PPQA 3OTVA 4L44A 3EKKA 4WD5A 2B1PA 3IONA 4RZWA 4RJ3A 1PMUA 3H30A 3O17A 4G6OA 4YJNA 5BPHA 1NT2A 4E4MA 4EH7A 3NX8A 2VX3A 4EBWA 4G9CA 3ELJA 2CCIA 3PXFA 5JVLA 1XQZA 2UZNA 4YBJA 4CV8A 3U9SA 3BHYA 2PVFA 2J0IA 3A7IA 4QTDA 2J2IB 4M12A 4YR8A 4OT5A 3G90X 2WTIA 3DPKA 5FBOA 4IDVA 1YOJA 4FYOA 1NXKA 3EQGA 2JIIA 3S95A 4O7YA 4FL1A 2ZDQA 3GC7A 4HQ6A 3T3VA 3SOCA 2PVNA 3FL4A 3UP7A 1NA7A 3G51A 3GCSA 3CTQA 3H9FA 4MAMA 4WG5A 5H9BA 2ITPA 5J8IA 5A4CA 5EW9A 2ZM4A 4D28A 5KZIA 1PMEA 3ROCA 2DWCA 2PMNX 3OHTA 4FSTA 3QFVA 4F0GA 4MXCA 3QD2B 4EYMA 2HWOA 5AUTA 2QG5A 3ZUTA 4FSMA 4IQ6A 4EGQA 1ZAOA 3KA0A 4DEEA 1DAYA 2VNWA 2VTLA 5GNKA 3UTOA 1RDQE 1FMKA 5K4JA 3ZRLA 1LUFA 1YHSA 2J51A 3I6UA 3ZONA 3VBTA 3LLAA 4LYNA 5TKDA 2GHGA 3BG5A 3K5UA 3EHAA 2PE2A 2VTQA 2OZAB 4BCQA 3COHA 1PXKA 4BF2A 3PG3A 5K5NA 5BUEA 4CSVA 5ANKA 1EHIA 1O6YA 5DWRA 3FKLA 5HU3A 3VRZA 1OZ1A 5J9YA 1K9AA 3SRVB 1R1WA 2ZJWA 4L42A 1AD5A 4MNFA 3A62A 4E26A 3DGKA 2WEVA 1GLVA 5BX0A 5IQDA 3FL5A 3UG2A 4XP0A 5A46A 1H00A 5E8TA 3LPBA 2YDJA 4DYMA 2R5TA 5EH0A 4XX9A 4NZWB 4EGJA 2WU7A 5L2TA 4RJ7A 4U43A 2R64A 4DA5A 3ZLWA 4MV8A 2WMAA 1U54B 4KS7A 4MAOA 4JDIA 5CSHA 4NM3A 4S2ZA 1WR2A 5BVOA 3OMVA 4UYAA 4ZTSA 4UWCA 2C5XA 3KMUA 5AUXA 4BHNA 3AW8A 2HIWA 3A4PA 2YS6A 2IZRA 4HNIA 3BI6A 4ACCA 5CS6A 5F95A 5LXTF 3FJQE 4P2KA 4AT4A 5IU2A 4KSQA 2GNJA 2J6MA 4O91A 2R7IA 3VS5A 4JQEA 1ZZLA 4LQMA 1FVTA 2IZSA 3QTSA 2F2CB 3NW6A 4FKVA 4PRJA 4TWOA 4YBKA 2RL5A 4V04A 3RPYA 3CXWA 4FKUA 4FNXA 3R7EA 1WBTA 3QGYA 4J1RA 4AFEA 5JN2A 1VBGA 4U9AA 4FGRA 2GCDA 3R30A 2WMQA 2CPKE 5DG5A 1NVQA 3KXGA 2Z7RA 3ATSA 4ACGA 5L3AA 3VBXA 4K9YA 3HDMA 4F6WA 5L2IA 5AUWA 2OK1A 4JQ7A 2JFLA 4O7RA 2ZYBA 4UALA 5L6PA 1OI9A 3WARA 1PY5A 3OVVA 5BQ0A 3TV7A 2VTAA 3FXXA 5ETFA 2OGVA 2AYPA 5D10A 2XKFA 3UNZA 3ZC6A 2W5HA 2W6ZA 2C6IA 4EHVA 4EOLA 4I20A 2B9JA 4GIIA 1PW2A 1Y91A 3IOKA 4IX3A 3P1AA 4NIFB 2BIYA 3DZQA 4F0IA 3A99A 3BRBA 4IM3A 5K5XA 4X3FA 2GTNA 5CASA 1PX2A 4P7EA 1OECA 1XR1A 2WMWA 2ITUA 3FSKA 3E8CA 4XYMB 2HCKA 5CQWA 4CG8A 3PPKA 4YSMA 3PXQA 4Y73A 2GNFA 4O7LA 2JIVA 3LE6A 4OBPA 4YC3A 4YNOA 3TIZA 2UZEA 2YJRA 2DWBA 3ORPA 5B2MA 4GFOA 3IW8A 2YZAA 2UZBA 2OW3A 4XYFA 1Q8YA 2DLNA 2JAVA 4DT8A 4YAKB 2BAJA 5HCYA 5M4FA 3JVSA 4QMZA 2GSFA 1AGWA 2UV2A 2OH4A 5DI1A 2W9FB 5J7HA 2BR1A 3MN3A 3ZFYA 3WILA 3WYXA 2ITVA 2B53A 2Z8CA 3O8PA 4I94A 4PMSA 3MH2A 4QMVA 3PWYA 4DGOA 2XUUA 5DT0A 3MSSA 1I7LA 4I5HA 4D4SA 3R7IA 2F2UA 3D0EA 4HPTE 1GSHA 4JIKA 1K2PA 3VHEA 1XWSA 5M56A 2B9IA 1Q24A 3ZBFA 3R83A 3F2NA 1A06A 3F3ZA 4RT7A 2P55A 3PA5A 1ZMVA 3KK8A 5IEYA 4QRCA 5LQFA 4IZ5A 4O82A 1TQMA 2OZOA 1GSAA 4O22A 4EH5A 3S00A 2FPPB 4XNEA 5HO8A 2C6OA 3RM6A 5HD4A 5LOHA 1Q3DA 2VWXA 4UZDA 3MA3A 4FKWA 4D0XA 3FPQA 3UC4A 2YN8A 1B6CB 4BN1A 4BTMA 1BKXA 3C51A 1STCE 4KKHA 3DKOA 2J0MB 4IZYA 4C0TA 1YHVA 1ZRZA 3DKGA 4O4IF 3CD3A 4X2GA 3UIBA 4AP7A 5C8NA 4KKGA 3QD0A 2W1FA 4RWKA 1Q4LA 2BVAA 4FKTA 2OIDA 2W4OA 1H1RA 5EDRA 2C47A 3TTIA 4E7WA 2CN8A 3AMAA 4CEGA 2FSOX 5C1QB 2Q0BA 4K2RA 3QQLA 3TUDA 3AMBA 3PPJA 4DFLA 4K18A 1YI6A 3D2KA 5CY3A 2CGXA 3ORTA 4M84A 5EK7A 4EQCA 1OL7A 2XD4A 3CTJA 4QTCA 3BQCA 5FTGA 1QPJA 1UU8A 5CLPA 4P90A 4JG6A 4Q5EA 5E91A 5BMSA 3Q53A 3BLQA 3LCTA 5E8XA 5LXMA 2I8CA 1RJBA 5CEMA 2VTTA 4CKJA 5FXQA 4FL2A 3L8PA 3R1YA 3ATTA 4O86A 5HBHA 4ZTMA 3PUPA 4CMUA 3PJ3A 3V01A 3WZDA 1H27A 3MTFA 2W1IA 2V5AA 3TIGA 1B6SA 3E7OA 3KF4A 4F4PA 3U9CA 2CGWA 3PVBA 1PMNA 2QVSE 2X2KA 4OR5A 4IHJF 1V0BA 3FV8A 4Z55A 3W2SA 2PVMA 3GXLA 4ANBA 5HEZA 2VO7A 1BUHA 3FC2A 1ZY5A 2Q83A 2VO6A 2NUAB 5HU9A 2J0KA 3CC6A 3F3TA 2J5FA 3I79A 4IIJF 3TW6A 1NVRA 4C34A 3D7TB 3MFRA 3RAKA 4EH2A 1GIJA 3PPZA 5LP6F 2W0JA 3KREA 4ASZA 2ITNA 3FMKA 3DFAA 2R0UA 3R8PA 3DXPA 1YDTE 4C61A 2XS0A 3AMYA 3ORRA 3I7CA 1KE7A 1UKHA 2R82A 3BGPA 4LI5A 2WMTA 1HCKA 4MCVA 4ZSJA 4N6YA 4EQUA 1W98A 2GNLA 4M7IA 2EWAA 5IEXA 5ANEA 5HNBA 3DCVA 4ZY6A 5JZJA 3ZH8A 3QAME 5F20A 1JPAA 3RCDA 3JZIA 3QBNA 4EOSA 2C4GA 5JQ5A 4ZK5A 3PE2A 4O6EA 1B38A 4IAAA 4YJQA 5DA3A 1OKZA 5JMSA 5J2TF 4KRCA 3GU6A 3V6RA 5K9IA 4HPUE 3L9NA 3BHTA 2WGJA 4RA5A 3D5UA 5IQCA 4M0YA 2BALA 1PKDA 4MBIA 3PE1A 4WBBB 5HLPA 4L01A 2R87A 4CFXA 3QYWA 5M06A 4AFJA 3QX2A 1H1SA 3K5VA 4X0MA 1CTPE 4F1OA 4JAJA 2QKRA 3W16A 3UVRA 3ZU7A 3ZLXA 4L7SA 3GU5A 4E4LA 4BDKA 5JQ8A 1U5QA 4GKHA 4K0YA 4PMMA 4YJPA 5M4CA 2GNGA 4PL4A 3L8SA 4RWIA 2ZB0A 5T6KA 2QODA 3LHJA 4QMPA 4D2SA 2OIBA 2F7EE 2EXMA 4FG9A 3LAUA 3WBLA 1PYEA 4BRXA 4MWIA 2VTRA 3HAMA 4C7TA 3NR9A 3UO6A 5HV6A 3HUBA 4DTBA 4FSWA 4A9TA 2XM9A 2V5QA 5BYLA 4EOOA 5L2WA 4JJRA 4AW5A 4JBQA 1I44A 4CFMA 3R7OA 4A9RA 5FBNC 3QC9A 5CANA 3OW3A 3DDPA 2VWIA 3DKFA 4FKPA 5BVNA 2W1EA 4J7BA 3C0IA 4WBOA 1UU7A 2C00A 3HMOA 4KIQA 5HNGA 4EC8A 2RFEA 2C0OA 3LXLA 3C9WA 5IF1A 2YS7A 4NW6A 4EL9A 5LMAA 4KNBA 4BYJA 1LR4A 2CNVA 2IWIA 3TIIA 5A4QA 3PXZA 4C4FA 3S1HA 3CY2A 4FFNA 3C4EA 3MY1A 4J53A 2JBOA 3Q5ZA 4I4EA 4TTHB 5FLFA 3CS9A 4EHZA 3OP5A 5D12A 5HIBA 3SGCA 4AACA 4F65A 4DG2E 5I9VA 1W0XC 3L9LA 4MTAA 2RFNA 4II5A 4RIWB 5FM2A 4YAJB 2YDKA 4C4IA 2BZKB 4F9CA 2OJFE 4F7SA 5GIOE 3NAXA 3VQUA 3QCQA 3E5NA 5CTPA 5IA0A 3TN8A 3HRCA 4NH1A 4CG9A 3LFCA 5CU2A 4M13A 5I9ZA 4LRKA 2FPGB 4FOBA 2C3LA 1Y6BA 3VA7A 4QT1A 5BMVF 4GJ3A 4RC3A 4RPVA 3OROA 3UO4A 4FEWA 3BYOA 3LCOA 5DNRA 4V01A 3IDPA 3VQHA 1UU3A 5J87A 2R7MA 4X21A 3BPRA 4AOIA 2XK4A 3QTXA 2C3JA 2OI4X 2GDOA 3DBEA 3L8VA 3UNJA 3DT1A 5E7RA 4KIPA 3U8WA 4EOJA 3MS9A 4YZBA 4EYJA 2WTWA 2XCKA 4HCTA 3TZ8A 4ZSEA 2X6DA 4C4JA 4JX7A 4D55A 2OLSA 4S32A 4LM5A 3WNZA 1UNGA 3HZTA 4C58A 3SQQA 4DH3A 3MPAA 4KINA 5HBRB 3R63A 4BDAA 2UVZA 2XMYA 1RW8A 3MI9A 3H9OA 4UB7A 1TQPA 3GLKA 3HL7A 4O0TA 3GOPA 4O0WA 2FSTX 2CKPA 4X2KA 1ZMWA 3PFQA 2J50A 2QU5A 1UWHA 1VYWA 3PY3A 4PF4A 1OPLA 3Q2JA 1BL7A 3CE3A 3KU2A 4WG3A 3U51A 2UW9A 1IASA 3R7YA 4TWCA 4C5AA 4ACMA 1ATPE 4ZOGA 2VWBA 4EOMA 1O6KA 4EH8A 3QRTA 5H80A 4IZ7A 1ZWSA 3OY1A 3QHRA 4OTFA 1CQJB 3OT8A 3Q6UA 4APPA 4F9BA 2VR1A 4DGMA 2XK3A 2F7XE 4IVCA 4Q5HA 4AZVA 1XH6A 3FLNC 2W99B 1B6RA 2VD5A 2HZ4A 4H3PA 1U54A 3LXNA 4NM5A 4FG7A 2FA2A 4AF3A 3B2WA 4RX7A 4ANLA 3A7JA 2EU9A 3QKKA 2R3HA 3UQGA 4LFIA 5LARA 4XG4A 2W6PA 3OCGA 4BDJA 2UW7A 3SHEA 5B2LA 4FKSA 4EK8A 3R1SA 3ZCLA 2I40A 3U6IA 2YACA 4FKQA 3S0OA 4B8MA 5CU3A 1JKSA 2BMCA 5LVPA 3KXZA 4HVDA 2H34A 1CKIA 2YRWA 4O7NA 3DF7A 4QQCA 3A8XA 2PBZA 1J3HA 2YIRA 4FYNA 5M53A 3ZM4A 5J2UF 1HOWA 5CXZA 1KV2A 1Q62A 3RP9A 3HA6A 1WBWA 4IVDA 5DT4A 3HYHA 3R9HA 3WZUA 4YB8B 3QGWA 4QNYA 3T8OA 2UZLA 3D94A 4F9WA 5HI2A 5IQAA 4MNEB 3RHXA 4CMOA 3F3VA 4GYGA 2XNOA 4GMYA 4B8LA 1E4EA 3QTUA 5G1XA 4TUYF 3QZFA 3PTGA 4XG9A 3MH1A 4A4XA 3ZSGA 4MXXA 4FTTA 5E8ZA 4E93A 5JKGA 5KKRC 2Y0AA 2JKMA 4U5JA 4ITJA 2P0AA 2I0EA 1XBAA 2GS7A 2QO2A 3R73A 4FTQA 4QP4A 4BDEA 5C8YF 3VOTA 4IAYA 4MWHA 4QMWA 3IOPA 4EZ3A 2ITZA 2XYUA 1OBGA 3OTUA 4FKRA 1KV1A 3DJ6A 2VGPA 3F2RA 3QLFA 2QOKA 4GT4A 3PIZA 2R3OA 4I1ZA 3GU7A 3SD0A 3VULA 3BHVA 4B0GA 4AZSA 5AFVA 4AZTA 2RF9A 4AXAA 2WAJA 3EIDA 1JBPE 3MIAA 4YJSA 3V04A 3CEKA 3QWJA 1Y6AA 1UNLA 4CFWA 2XNEA 4NCTC 3L9PA 3P7AA 5JH6A 4JBVA 5IMEA 2WB8A 2QO7A 3BLRA 4QMTA 2I0HA 4BR3A 4J8MA 3HA8A 5DOSA 3R9NA 4O81A 3RCJA 3R5FA 3IG7A 3CGOA 4EUUA 4PP7A 2VGOA 3GVUA 1UA2A 2Y8OA 2ERKA 4TWPA 5E1EA 3KXNA 5C03A 2WEIA 4RX9A 3WZKA 4JG7A 4NT4A 2J4ZA 4FFLA 2HELA 3HB9A 3DBQA 4OTHA 4FV7A 4PNKA 4G3DA 5JGAA 4DT9A 3VUMA 5AP1A 2VTMA 3EOCA 4G3CA 3QTWA 2ONLC 4FMQA 4GW8A 4KWPA 4O7TA 1Q3WA 1R0PA 4FU0A 3Q2MA 2C30A 4BCGA 4I6HA 5ITAA 2R3RA 3F3UA 2BRBA 5C9CA 4GU9A 2O3PA 2ACXA 2WTKC 5CT0A 3ORKA 3UC3A 3M2WA 3R6XA 2OXXA 5HG7A 4V0GA 3QC4A 4OTGA 4MA5A 1ZYSA 4A06A 2GLTA 3N4TA 4GFMA 2W96B 4ZTQA 3SG8A 5ICPA 3FZSA 2WXVA 4E5AX 2UW8A 4BHZA 4XV2A 3TI1A 3ODYX 3K54A 3A4OX 4TWNA 5CVGA 3E88A 1ULZA 1EH4A 3S4QA 3OBGA 4Y5QA 5CAOA 3F5UA 1ZMUA 3TJDA 3LFBA 4KABA 4TZRA 1Z5MA 2XJ1A 4GUBA 1AUXA 2UW6A 4E4NA 4QP8A 2Z02A 2NRYA 3K3PA 3AGLA 2F57A 2PU8A 4DIMA 5JSMA 2C1AA 2CGUA 2X6EA 2GTMA 5E1SA 5KKNB 4CZUA 3D5XA 4XG8A 3KMMA 4KS8A 2QCSA 3ANQA 3PSDA 4ITIA 5HBJA 4RLKA 4FVRA 3PRIA 4JG8A 4DH1A 4PDYA 1SNXA 5GONF 5HORA 3ID6C 3O96A 3PVGA 4IIRA 4V05A 4X7QA 3OC1A 4YLKA 3MFUA 1H1QA 3BV2A 4W4YA 5LMKA 3QXPA 3D7TA 4IB0A 3LQ5A 1M2QA 2X1NA 4O2BF 1PMVA 2UW4A 4RFZA 4N57A 5HZNA 1OL2A 5IQFA 4IZAA 5HG5A 3D83A 4ZMEA 4C3RA 4G3FA 4WHZA 4FSZA 2BIKB 1ZLTA 3E64A 3FC1X 4UBAA 3WE8A 2VZ6A 5IPJA 4CFUA 3PIXA 2WQEA 2YDIA 2PUUA 4QMNA 3W10A 4D9TA 1H0WA 3EN4A 4MXZA 4FV3A 3U87A 5CA0F 4Z9LA 2WIPA 4BC6A 2EUFB 4BCKA 4I23A 4J95A 4NFNA 5GJGA 3TT0A 5DHJA 2G9XA 4A9YA 1KJJA 4QYHA 1A9XA 2SCUB 3KC3A 3VS1A 3E63A 2YYAA 3NS9A 3R8UA 2G2FA 1ERKA 3ET7A 4IX4A 4AN3A 2XK7A 3WF6A 4Q9ZA 2XP2A 5AIRA 4AZEA 4RX8A 3LFSA 3D14A 1FVRA 1E1VA 2R3QA 4J98A 3R7VA 3VUHA 3IKAA 4O4LF 2ZAZA 2V22A 2W1GA 3Q3BA 3VO3A 3E8DA 2GQRA 5JFXA 5LWNA 2J9GA 5HE2A 1I7NA 1AQ1A 4PTGA 4NTSA 3L1SA 3PWDA 4RIXA 4CNHA 2XNGA 5CI6A 3KAJA 5L8KA 5D7AA 4FK3A 4CGAA 2QNJA 2XBAA 4PL3A 3BIZA 2CCHA 3OW4A 1XH5A 4CFNA 2XCHA 4YTCA 2QO9A 4PUZA 3G0EA 4WUNA 5DE2A 2PHKA 5HD7A 3RVGA 1GAGA 2XA4A 3CQUA 3FZOA 4M3QA 3VS4A 3GC9A 5FDPA 5CYIA 3I6WA 5FEQA 3BBWA 4RX5A 5CAPA 2PWLA 2C5NA 4WNKA 4ERWA 5LCJA 3Q9ZA 3SOAA 5EZYF 5DVRA 4BCPA 4KKEA 4OBOA 3OWPA 2ITTA 2QG7A 3N8DA 4FC0A 4PQNA 4ZS0A 4FT5A 1YVJA 3UODA 4U7ZA 2VTPA 4X6QC 1MP8A 3LFNA 5EI6A 3ZYAA 4M68A 1PXNA 3CKWA 4HNTA 3REPA 4U3YA 2R3FA 3ACKA 4FZDB 1GNGA 5CAVA 4RC4A 4YO4A 1M0WA 3VHKA 2QOQA 1PRYA 3KEXA 3P23A 2CLQA 2PE0A 1ZARA 4YC6A 5I4NA 3PP0A 2E9OA 4O2ZA 5E9EA 4C3PA 1OIQA 3TZ7A 3UJGA 5A6NA 2NU7B 1WBNA 4MV9A 2JKQA 1OUYA 4CKRA 1XKKA 3I0QA 3NNUA 3NZ0A 5AP2A 4CXAA 2P33A 3ZSHA 2X7OA 5AP3A 3EFKA 3EFWA 3NUYA 2R4BA 2YCSA 3EWHA 5ANOA 2BROA 2NPQA 2RGPA 3MA6A 2FPIB 3CGFA 4PY1A 3O50A 4EI4A 2OXYA 4DH8A 4ASXA 2XNPA 1BI8A 2YCRA 3DAEA 1MRUA 3D9VA 4FNWA 4Y95A 4C4GA 4MV6A 3NVMB 2CKOA 4XHKB 5HVKA 1FOTA 4G3GA 4FT0A 2XK9A 4ZZOA 3VBQA 2YJSA 4JRNA 1JLUE 3WO0A 3F61A 4IFCA 3BYVA 3MB6A 5KMIA 3VS7A 4MEDA 5D7VA 4L67A 2B55A 3QCYA 4JX3A 3LXKA 1O6LA 3MESA 2Z60A 2XIZA 4QYEA 5AX9A 3TXOA 4K77A 1R0EA 1W7HA 4EBVA 3IGOA 4ALVA 4FIHA 3BEAA 2JLDA 3IW7A 4G5JA 1JAMA 3WIKA 3BLHA 4Y46A 3TJCA 1U4DA 3UNKA 2H96A 4R5SA 4MQ1A 3RJCA 3T3UA 4KBCA 3SW7A 1DV1A 1T45A 4B4LA 2R3LA 2CZGA 2IZUA 3KL8A 4USEA 4U81A 4E6DA 4EHEA 3HLLA 4FOCA 1FGIA 2W5BA 3Q52A 1P4FA 4J71A 3TDVA 4EOIA 4AT3A 3ZUVA 2PMOX 2WQNA 2HYYA 2XIXA 3P9JA 2OF2A 3PVUA 3ZO4A 3LJ2A 2A2AA 3FZPA 1CM8A 2XJ2A 4YZMA 3VUKA 3FI2A 4HGLA 3C5IA 4HCUA 1WVWA 1GOLA 3LMIA 4D1ZA 5E92A 2HXQA 3OXZA 2FP4B 1W83A 3TQTA 4MQ2A 3G9NA 5F4NA 5HVJA 3KQ7A 4PX6A 4BCHA 4GG5A 1SCUB 2NU6B 3HP5A 1QMZA 4EC9A 3HV3A 4H1MA 3KRWA 4UYNA 1VZOA 3NNXA 3FMDA 2UW3A 1YXXA 3FSFA 3HUCA 3MY0A 4EH3A 1YRPA 2ITQA 2VU3A 3NIZA 3R5HA 4DG3E 4I5PA 5BVWA 2HJWA 3ZZWA 5IQHA 2C6LA 3FMNA 4UXQA 4QPSA 3POOA 3V51A 5A54A 1YI4A 3Q2OA 3SXFA 3GUBA 3QQFA 5TT7A 1IG1A 2OU7A 4EORA 1SZMA 4FSNA 2FB8A 4G1WA 4CMTA 5HVYA 2CN5A 3TNIA 4AX8A 3P7BA 4C38A 3SC1A 4ZEGA 4UX9A 4FZ6A 2ETKA 2V55A 3LJ1A 2ESMA 2WQMA 4FTNA 2F9GA 4IAFA 2BZIB 1ZZ2A 3QXOA 3UZPA 3ORQA 4R7HA 3PA4A 2DIKA 4EJNA 1YXSA 3NNWA 4X2FA 3UE4A 4QTEA 2X4ZA 5HNIX 5KKRB 3GNIB 2J9MA 2JKKA 2C5YA 3PJ2A 4O0RA 2QHNA 5DEYA 5ANDA 2AC3A 2Z2WA 5HHWA 1WBVA 4TY1A 5EHLA 2BUJA 4BTFA 5F9EA 4IB5A 5M4UA 4FNYA 4DLKA 4DFZE 2WMUA 4FUXA 3C50A 4LRJA 3A7HA 1WAKA 4DGLC 3LFQA 3QUEA 4MNEA 2CHLA 3O8UA 5FD2A 3ZTXA 4UY9A 3DJ7A 4BB4A 2UW0A 5DIAA 3TUBA 2BILB 3ULZA 2BFXA 4O96A 5AMNA 2GPWA 2WQOA 4WRGA 5L8JA 2WO6A 3MDYA 5I5ZA 3F5PA 4M15A 2JDVA 3QCSA 4R5YA 4YZDA 1XH7A 3UP2A 4XH6A 4BCOA 4ERKA 1J7IA 3EN6A 1IOWA 4PTCA 5L8LA 1EUDB 4RIYA 1PKGA 1URCA 1FGKA 3BBTB 2PZPA 3VN9A 3G8DA 5DMXA 3DB8A 1UU9A 2A27A 3SG9A 2IW6A 3VIDA 3VPBA 5IA5A 5EQYA 2R7KA 4TV8F 5KMNA 5EOBA 4QP6A 3MY5A 3ZM9A 1WZYA 3CY3A 2QLQA 3BKBA 4YLJA 3ZBXA 3ZUUA 3ZFXA 4BZOA 2HGSA 3LZBA 2J90A 1OM1A 4E20A 5JQGF 2QLUA 4A9SA 3OUNB 4Y8DA 5IDNA 1XHAA 3ZLSA 2BDFA 3ZLYA 2X9EA 1PYXA 4L3LA 4DCEA 2OWBA 3K3IA 4FV0A 3UVPA 4Y72A 3EZRA 4FV1A 4RVLA 4MD9E 3D4QA 3PXYA 3W2QA 2PL0A 1FPUA 4AGDA 2QOFA 3NYVA 4DFXE 2PUPA 3DAKA 5EKNA 5M57A 3V5QA 2J0LA 3FDNA 2XEYA 2R85A 4ANQA 2WTKB 2Y6MA 4O84A 3RZBA 1A9UA 3IDCA 1S9JA 3SVVA 3NUPA 5HQ0A 2P4IA 2RFSA 2WZJA 5ANIA 4AE9A 3FAAA 5FXSA 3HDNA 2ITOA 1G8SA 4XYLB 4ONAA 4W4WA 1SYKA 2UZWE 3UMXA 3CJGA 3I1AA 5E8YA 4BI0A 3R1QA 3HBLA 4QMLA 5BUJA 4L00A 3QRUA 5DR9A 4PDSA 3IGGA 4J96A 3JPVA 4MBJA 5KBRA 3DU8A 4O0XA 4FTLA 3B2TA 4RLLA 3UMWA 4NJDA 4S31A 4D5KA 4U42A 4YJUA 5CSXA 4JT3A 3GQIA 5I0BA 5CAUA 4YHTA 2W17A 4FTCA 2P0CA 2NU8B 3DY7A 5AUYA 4ZSLA 1H26A 2WKMA 5AA8A 4BDBA 3GB2A 3FLWA 4RGJA 3UPXA 4ZS4A 3BZ3A 1YXUA 5TR6A 4FT7A 4FSUA 1YXTA 2C3KA 4GK3A 4A7CA 3NUUA 3ZEPA 4FT3A 5I9XA 4DF3A 4J99A 3EKNA 2W71A 1UWJA 4WOVA 3LVPA 3MFSA 3UZRA 4RWLA 4HJOA 4FFMA 2IVUA 4Z7GA 5KO1A 2BAQA 4RIOA 2I6LA 3DXQA 1DI9A 4O0UA 4DEBA 3ZHPC 2YWVA 3D2IA 4FL3A 3OS3A 3HGKA 4FR4A 5IH5A 4O0VA 4ZTHA 2B9HA 4DH7A 1YOMA 2X8EA 4DLJA 1PK8A 5J95A 3IQ7A 4O38A 3KKVA 5CEKA 4CCUA 2HZ0A 3FKOA 2XNNA 4FZ7A 3MH0A 3WF8A 5IH6A 4HGSA 4ZTNA 1KJ8A 3AQVA 4OGRA 1PXJA 2JGZA 3BYSA 4JL9A 2VTSA 4BCFA 5CEPA 1H07A 3WO1A 5BMMA 3ZC5A 1Q8UA 3FI4A 2YWPA 5HG9A 3F3WA 3FMEA 5GIPE 3GU8A 3S2PA 2OJIA 1UV5A 2YIYA 1PXOA 3ZDIA 1YI3A 4CCBA 2DZDA 1LEZA 4BIBA 4EQMA 4MV7A 3DXNA 4C35A 1REJA 2KULA 3MWEA 3ZS5A 3WI6A 2V0DA 1GZKA 1AUVA 2QOLA 3HV7A 4F64A 3F82A 3OEFX 3TDWA 5FNVF 1GSOA 5LVOA 5AAFA 1M0TA 4FX3A 4Y85A 4KSPA 2WTVA 3V5PA 3KGAA 5CSPA 5EI2A 5AV4A 4DC2A 3A7FA 4YTFA 3RI1A 4GJ2A 2JDOA 1Q8ZA 3QZHA 4HYUA 2VPQA 4F08A 3R21A 1JQHA 4O2PA 5FTOA 3BU6A 3HMMA 3TKIA 4AE6A 3KY2A 4GKIA 2PZ5A 1DI8A 1APME 3PLAE 4ORKA 3UPZA 3RPOA 2RG6A 4AN9A 2A1AB 1V1KA 3QCXA 3E62A 3DBCA 4UEUA 3SX9A 2PTKA 3AGMA 3NUSA 3NYNA 5EHYA 3RALA 3ZXZA 4E8AA 2QKWB 2OKRA 1M14A 2ZB1A 3O0GA 4A9UA 4HVSA 5JGBA 4YLLA 2ITWA 2OXDA 4FG8A 4L45A 4ZHQF 1PXLA 1OPJA 4YTIA 1O9UA 2HW6A 2WMVA 5E4HA 3QTRA 4L52A 4FKGA 3CLYA 3QFFA 4RG0A 2B7AA 2W6MA 2BKKA 3EN9A 3MJ1A 3QD3A 4QYGA 5CQUA 2XCLA 5HX8A 3SXRA 1JLLB 3Q1KA 2GU8A 2W1HA 2ZV9A 4LGHA 3RMFA 3O2MA 3AC5A 3OBJA 1H01A 4EKKA 1PXIA 1YDSE 2NRUA 5EM8A 3VWAA 3AD4A 2VX1A 3CIKA 3HV5A 4AGWA 5CF6A 5AV0A 2V58A 4FFPA 3KULB 1VEBA 1F5QA 3F88A 4RFMA 4ZJIA 5AEPA 4TRLA 3Q4TA 3R22A 2HY81 4GT5A 3PVWA 1Z57A 4XP3A 2IW8A 2FGIA 2FSMX 3VS3A 3R9OA 4IBMA 5JZNA 5IQEA 3R0TA 4BBFA 4QOXA 3IW6A 5CI7A 2BHEA 1H0VA 4UV0A 3VS0A 4QMMA 5HTCA 3TNWA 3FZ1A 3ALOA 5KHXA 4D9UA 5AP4A 4PDOA 4F1MA 5BPYA 4QPAA 2Z04A 2WD1A 3W2RA 2XNMA 3M1SA 3MJ2A 3V8TA 5I9UA 2X8DA 2YM7A 5F1ZA 3JR1A 2G15A 2UZUE 4L43A 4ZQIA 2YZLA 4HVGA 4IX6A 3UZTA 3QA0A 4I5MA 5IQGA 2J5EA 1L3RE 4JDHA 1WBSA 2YABA 3GENA 5B2KA 1GZOA 1WVYA 3UYTA 5LWMA 2WHBA 1L8TA 2W9ZB 3AC8A 3DOGA 3DFCB 4FTUA 4J97A 3WF9A 5AADA 5TOZA 3POZA 4YJRA 5JVDF 4ZLZA 3KVXA 3N4UA 3QU0A 2YISA 3LMGA 2WTCA 4NYEA 4LGGA 1VJYA 1H25A 1XH4A 4M97A 4F7JA 1WFCA 5BPFA 2W05A 5EDPA 5CAQA 4XJ0A 2W6QA 3QRJA 5AV3A 5J5SA 5KBQA 2I87A 2DUVA 3TV6A 4L1KA 3GCUA 2QURA 2XKCA 4FSQA 3RTPA 4ZLOA 5FEDA 2YL2A 4D4VA 2VX0A 4NM0A 4IJ9A 2CJMA 3W8QA 4AA4A 5L2SA 3HO8A 3R9DA 1JOWB 1NW1A 4HZSA 1JNKA 4XS2A 2YM8A 1ZOGA 4EJ7A 4ENXA 4HCVA 4MV4A 1QPCA 2WMXA 3NRMA 1C3OA 2PY3A 5EKOA 3RK9A 5H2UA 4WNPA 1H08A 1W84A 2E9NA 2OZAA 4GFGA 3V4ZA 4U6RA 4BI2A 3JUHA 3OCTA 3CSVA 5BNJA 3A2CA 1GY3A 3EL7A 3VW6A 4CQEA 3SRVA 3C5UA 4O27B 4EZ7A 1Y57A 4O0YA 2QHMA 4X2NA 2B9FA 3P08A 4YC8A 2WPAA 3QWKA 4Q2AA 4FTRA 1YWRA 2XNBA 3HNGA 2GNIA 4ALUA 1URWA 4S30A 2CLXA 1T36A 4DFUA 3F7ZA 4O2AF 3WF5A 1CQIB 4CTBA 3LMHA 2R7NA 2OSCA 4IC8A 3U4UA 3ANRA 4CT1A 5FQDC 4YU2A 3BQRA 1LPUA 3LXPA 3TG1A 2W6NA 4BDGA 4BDIA 2OIQA 2QR7A 2H9VA 3WOWA 5IH4A 2I1MA 3BYUA 3UYSA 4QO9A 2XKEA 4GCJA 5KCVA 4YJOA 3FY2A 1JDEA 3FHIA 2GHMA 4YJVA 5M09A 3DBDA 4IC7A 4AT5A 5BYYA 3U54A 2R3JA 2GQSA 3F9NA 2OFUA 3QQUA 3NDMA 4FV9A 1Y8YA 3V8SA 5M4IA 3DNDA 2V7AA 4RA4A 3WYYA 4LMUA 3VF9A 4DTAA 2BPMA 1GIHA 2NO3A 1KE5A 3LJ0A 4I41A 2HW7A 4KD1A 5CSVA 4F6SA 4RQKA 4FODA 3G15A 3FQSA 2P3GX 3SDJA 4FKLA 5HICA 2YAKA 3COMA 5C27A 2QF7A 1H8FA 1BMKA 4H36A 4HYSA 3V5WA 1E9HA 4R3CA 1OKVA 5TO8A 1KE6A 3FMHA 3P5KA 4M8TA 1IEPA 2ZOQA 4NWMA 4YP8A 3VPCA 3MPMA 4AZFA 1WBPA 2B4SB 1ZOEA 4B9DA 5K4IA 2OJGA 4OTWA 4BZDA 3SV0A 3FXWA 3DB6A 4FVPA 3VJOA 4CRLA 4YJ3F 4LV8A 4NCTA 3OWKA 5CU6A 5C4KA 5DRBA 2OBJA 3FY0A 3LCSA 3OXTA 3I5NA 3QF9A 4PP9A 4QP7A 1KEEA 4IANA 1BI7A 4K1BA 4FT9A 3HAVA 3QYZA 5FGKA 3PLSA 1LEWA 4L53A 3WF7A 3GQLA 3JXWA 4XV3A 4ZP5A 2XRUA 4TYJA 4FEVA 4ASEA 3LQ8A 2FB9A 5CXHA 4MA0A 3NCZA 4G17A 4FV8A 4AS0A 4G16A 3RFCA 2VWZA 3C4XA 4ZI7F 5GJFA 5LMBA 4X3FB 2RIOA 3P86A 3EYHA 3O23A 4O21A 5HIDA 3MVJA 4ASDA 4ME6A 2ONLA 2GNHA 4FIFA 2XRWA 2FVDA 2QR8A 5KUPA 4GS6A 4FI1A 2PSQA 3LCKA 4RJ4A 4RZVA 5AV2A 1P14A 4YMJA 3RKBA 2Y6OA 3GBZA 4R6VA 1SM2A 4IAKA 3EN7A 3EQDA 3HV4A 4MD8E 1VR2A 2HXLA 4KUJA 2CKEA 1ZXEA 3OOMA 4I4FA 5DPVA 1X8BA 4DGNA 2W4KA 4D5HA 4ZZNA 4JS8A 3RUPA 2BRHA 2VV9A 2Y7JA 4FK6A 1JDBB 2YITA 5F94A 4AOJA 4C62A 3UOJA 2JDTA 3MPTA 3FZTA 3JYAA 2HY0A 3NW7A 4IB1A 4LL0A 1OPKA 1OKYA 1M2PA 3TTJA 5J1VA 4FZAB 3UGCA 1A48A 3F5GA 5IA2A 2HZIA 4DEDA 4QQTA 1DV2A 2R0IA 4E73A 5IA4A 5AUUA 3UIXA 4PTEA 3RWQA 4FTMA 1GGOA 4B7TA 5M51A 3PZEA 5FRIA 1M17A 1FMOE 5EYDA 1W93A 2PYWA 4O4HF 5J9ZA 1IAJA 3SA0A 1SVGA 3LKMA 2JKOA 3G33A 4IWPA 1F0QA 2P2IA 2VO3A 3TL8A 3OUKA 3ZDUA 3H3CA 2VTJA 3KN5A 4OLIA 3V8WA 3QKLA 5AA9A 3LIJA 4CV9A 2FSLX 2XF0A 2I0YA 4I0SA 2XKDA 2BZHB 4FKJA 5HGIA 3W33A 2RG5A 2QI8A 4NW5A 1XJDA 3QKMA 4GK4A 5L6WL 5AJQA 4OBQA 3E5AA 3II5A 4XG3A 4YGAA 3UG1A 3V3VA 3OCBA 5CSWA 3ETHA 3KRJA 2OF4A 4N6ZA 3MW1A 4APCA 4MVFA 5BVEA 4K11A 2BHHA 4JDJA 4QP2A 5CA1F 1QCFA 2YERA 3K5IA 5DLSA 4OTQA 1F3MC 1YOLA 3LQ3A 4C5BA 5AAEA 4KB8A 5JFWA 2X81A 2E9VA 3KRRA 3S3IA 1P4OA 5BVFA 3EFJA 3BV3A 3CCNA 4GL9A 3QUDA 2ITYA 2PVJA 3BCEA 2JDRA 3C13A 2FH9A 2A0CX 5AX3A 5KMKA 3W2CA 4IH8A 5LJJA 1OIUA 1OL1A 3C4ZA 4EKLA 4NKSA 4X3JA 4ACDA 1H4LA 5E8WA 2FO0A 2IVVA 3Q96A 2CNQA 4DN5A 4IX5A 2BFYA 5EFQA 1XH8A 1DIKA 3ORNA 2QD9A 2YAAA 3LW0A 5CF8A 3GIDA 2F7ZE 2XBJA 3PYYA 3RAIA 2C6MA 2H6DA 4C36A 3G6HA 1NY3A 5C26A 1U5RA 5I9WA 2W7XA 3JY9A 3Q6WA 3VUDA 3LWBA 2JC6A 4QQJA 4YUQA 1JVPP 2BTRA 4F0FA 3TV4A 4ALWA 4HR7A 2R3MA 4FUYA 4XMOA 4FSYA 2JBPA 4GEOA 5B7VA 1H1WA 1IR3A 4CKIA 5ETAA 3KN6A 2GPHA 4TXCA 1OITA 2W4JA 5LYJF 3BELA 5CEQA 3RWPA 5EW8A 4E1ZA 3BHUA 4U8ZA 2YW2A 3MFTA 2ZDGA 3W2OA 3NYXA 3FYJX 5ACBC 2GHLA 2WMRA 2GFSA 3HX4A 1JSTA 2OO8X 4Q9SA 5DR6A 3SLSA 4E5BA 4M9UA 4P5QA 5AV1A 1CS0A 5CENA 4BYIA 3PRFA 3E8EA 2PK9A 2DYLA 2XEZA 3HMIA 3O7LB 4TYEA 5ANGA 2HWPA 5DT3A 5HTBA 4U97A 1BNCA 1JSVA 5EQPA 2BAKA 2J0JA 4L9IA 4NU1A 2A19B 5AP6A 1XBBA 3GOKA 4HGEA 2EVAA 3NAYA 1W82A 5CVHA 5A4LA 4FTOA 2W1DA 3D7ZA 1FQ1B 3P7CA 1KJQA 4OTIA 1DAWA 5KMMA 2BDJA 3KXXA 5KMJA 4MK0A 4AA5A 4PDPA 3IPHA 1M7NA 3QLGA 3CD8A 3DAJA 4XUFA 2VAGA 3KMWA 3R8VA 1Q8WA 3E7VA 5GJDA 1REKA 3I81A 4GVAA 3LFAA 4P5ZA 5LCKA 3R00A 3G5DA 3DNEA 4NSTA 2C0IA 3ZSIA 2R7LA 3ZFMA 4C4HA 2XK8A 4D58A 3RGFA 3KXMA 4C3FA 3P0MA 4NTTA 2PMIA 3O51A 3R28A 4F1TA 2WQBA 3TEIA 4RIWA 3HEGA 3TZMA 4BY9E 3PG1A 1W8CA 4FICA 2VTOA 4RWJA 4JRVA 4WIHA 1V0PA 1SVHA 1MQBA 2OICA 3KFAA 3KF7A 3OWJA 5D9HA 3TACA 4BICA 4C33A 1H24A 2VWUA 2KTYA 3P4KA 3Q9XA 3CJFA 5IUHA 5D11A 4H05A 5JT2A 3FBVA 3Q5IA 4GYIA 3P78A 4EK5A 2A4LA 3G2FA 3GP0A 2IO6A 3LOKA 4TYHB 4UWBA 3TZ9A 3NNVA 4QYFA 1Q41A 3VVHA 4A07A 1JKJB 3PSBA 4L68A 4IE9A 4NM7A 4DCAA 3NWWA 2OLCA 3FPMA 4IADA 4I5CA 5HCZA 4BBMA 5HE1A 4FTKA 4FGBA 3DQXA 3MBLA 2PE1A 5C8MA 3TCPA 3HV6A 4Z7HA 2I0VA 3MTLA 3MVLA 1OGUA 5CU0A 2UUEA 3FEGA 1ZY4A 4F9YA 4I92A 2ZM3A 3KALA 3GFEA 4TV9F 4CFFA 3R71A 3EMGA 3GGFA 2IVSA 4XG2A 5LA6F 5HIEA 4ZSAA 3OT3A 2CGVA 3MIYA 2LAVA 2ZV7A 4OT6A 4AU8A 5GINE 1EYZA 3GCVA 4KAOA 3Q9WA 2R86A 2IJMA 1YW2A 3GCPA 2WMBA 3C7QA 4FKOA 4BGGA 3NUNA 3MVMA 3V5JA 1J7LA 2YEXA 3AG9A 3ZOSA 3PSCA 5C01A 3KXHA 2HZNA 3GC8A 3B8QA 4HNUA 2E9UA 2JITA 3R8LA 1CE8A 5JFVA 4O6LA 5K3YA 2QQ7A 5EM5A 1M7QA 4ZOLF 3MWUA 3AXWA 3U9TA 2PVPA 4C2WA 3L9MA 2O5KA 3OZ6A 4GH2A 4YPSA 1IAHA 3KVWA 5T68A 4JXFA 3EFLA 1HCLA 3ZEWA 5IUGA 1E1XA 2GPSA 2REIA 4FNZA 4BDDA 4U0IA 4RBLA 4DLIA 3ORXA 3MWDA 3A7GA 3RV3A 3HRBA 4LG4A 3W2PA 1CKJA 1OL6A 2B0QA 4AUAA 4RMZA 1ZOHA 4LOPA 2YIXA 3I5ZA 2X8IA 4IEBA 3TM0A 3UOLA 3GFWA 4A4LA 2PVKA 3Q9YA 5CB4F 1KBLA 4EOKA 4YJTA 4YZNA 4RJ8A 3R9RA 3ITZA 5FEEA 4BGHA 3HMPA 2R7BA 1Q97A 2QOOA 3GT8A 3FXZA 5KMOA 3JS2A 3CP9A 4F99A 3I7BA 4DHFA 3FI8A 4RVKA 3Q04A 3NGAA 4JBOA 5EOLA 5GHVA 5KHWA 3JRWA 5DFPA 4JNWA 2JDSA 2X4FA 1S9IA 3ORMA 3ACJA 4TYIA 4FE2A 1SMHA 3ETAA 4DINA 4EH9A 3MJFA 1DS5A 4XV1A 5DH3A 5HESA 2X0GA 4ANMA 2XM8A 4RFYA 1MUOA 2VQDA 5A3XA 4BCIA 4D4YA 4PNIA 4ZTLA 2QK4A 3BU3A 5HE0A 4EK3A 1LP4A 4EOPA 4JLCA 3UQCA 4CRSA 3TIYA 5CEOA 4I3ZA 3V6SA 2PZIA 2WIHA 4IJPA 5IA1A 2BCJA 2YIQA 4WA9A 1J91A 3KRXA 3B8RA 4CLJA 3FLYA 1Z2NX 3TNHA 3UOKA 4AW2A 5HCXA 3BGQA 4IMYA 3QQHA 2WYOA 4E6QA 1ND4A 1GIIA 4AWIA 4LUEA 3I60A 4Z16A 2O2UA 4MHAA 5EYMA 3M11A 4CZTA 4NL0A 4O0SA 3Q4ZA 3UOHA 5H8GA 4BCNA 5C1OA 2OFVA 4IW0A 4RC2A 4EHGA 3CQWA 4ID7A 1E4EB 2GS2A 2FYSA 3CKXA 3ORLA 3U9NA 2YZMA 4M14A 2DQ7X 5E8SA 3ZXTA 4HNFA 4X6RA 5HG8A 3PXRA 4R77A 4GVJA 2RFDA 2G1TA 3F66A 4JR7A 1OIYA 2YM5A 1J1CA 4R7IA 4ZTRA 5FP5A 1WVXA 3R23A 3OEZA 4DGGA 4KBAA 5JQWA 4FIEA 3NMUF 5JGDA 4FVQA 1OVEA 2VN9A 4QNAA 4YHFA 1JKTA 2UVYA 3E92A 3UQFA 2PZYA 1BX6A 1UNHA 4I6QA 4IWDA 2V7OA 4X3FC 3N4VA 4ITHA 4M0ZA 5CF5A 3IDBA 4JBPA 2VUWA 4NUSA 3DK6A 2R3GA 4OUCA 3NVKI 5EYCA 1YHWA 5CEIA 3UVQA 4CTCA 4TL0A 5HKMA 1PXPA 2PVRA 4O4JF 1CDKA 2Y4IB 1IA8A 3CPBA 4RJ5A 2R9SA 1JSUA 4GG7A 3OUUA 4H1JA 5CAEB 2IW9A 1J7UA 1OIRA 3GCQA 4IVAA 3QUPA 4JDKA 3V4SA 3IW4A 2PVHA 3FQEA 3VUGA 3UIMA 4CVAA 4DFYA 2YZNA 1KE8A 4MXAA 3R5XA 2UZVA 1FVVA 3LM0A 2PN1A 3TWJA 3PDTA 3ZMMA 3PJ1A 4NFMA 4JAIA 2W1ZA 4U79A 4I22A 4UWYA 3EQCA 4L3JA 1Q5KA 1SVEA 3C4WA 3D5WA 3VRYA 3THBA 5FM3A 4MH7A 3UDBA 4WBNF 3VMMA 1WBOA 4WG4A 2XIRA 2CDZA 3QALE 4V0GB 1KSWA 3VF8A 4EOQA 5J1WA 5CZIA 5DR2A 3RINA 3NLBA 3F2AA 4RZQA 4BDFA 2BRMA
chains in the Genus database with same CATH superfamily
3OY3A 3H0YA 4MXYA 2WELA 4FEQA 4YTHA 4N70A 4XLVA 5BVKA 3KK9A 2UW5A 3F5XA 4YSJA 3DDQA 1B39A 2FUMA 5CALA 3UIUA 4MV1A 3Q4UA 4JVGA 1IOVA 4E4TA 2ABJA 3NEWA 3ROYA 5KE0A 4IB3A 2HGWA 1Q99A 3FWQA 4U3ZA 2XVDA 4QMUA 3QQKA 4FSRA 3ZO2A 3VNTA 4LOQA 1R3CA 4AXEA 4MX9A 1M2RA 4XV9A 5A6OA 4QYYA 2JFMA 3G6GA 4O83A 1U46A 5C4LA 1DM2A 3ETJA 4MD7E 3W18A 5AIKA 4G6LA 2W06A 4YHJA 4LDTA 2G01A 3LFEA 2I7QA 1K3AA 4L46A 4FTJA 4QQ5A 4KRDA 3UDSA 3FLSA 2YA9A 3R02A 2EXCX 3R04A 2HAKA 5HLNA 4XEYA 4CHIA 4RVMA 3UBDA 3RHKA 3N51A 3FQHA 3EQPA 1BL6A 5H3QA 2NNWB 2YCQA 4N0SA 3OG7A 1JKLA 1FINA 3ZZEA 4B6LA 2WOTA 4DG0E 4FV6A 2JEDA 4EH6A 5LVMA 1R78A 4IZOA 2VWWA 4H58A 5L6OA 2JIUA 4XG7A 4IM0A 2Z7QA 4DEAA 5H8EA 3MYGA 4GIHA 4TNDA 4YNEA 4BI1A 3U6HA 3E3BX 3F7WA 3KRLA 5A4EA 2WTJA 4QMOA 4AOTA 3R2BA 4ANSA 3VBVA 5IZFA 5BWTA 4XBUA 4S34A 2W70A 4IAZA 1CKPA 2C1BA 2X2MA 3RAHA 4E6AA 2X2LA 3FZRA 3RPRA 2AC5A 2J7TA 2HK5A 1OKWA 4BCMA 5IMXA 2QOHA 4C59A 3BA8A 1KUTA 4EFEA 4GRBA 3RPSA 1YWNA 1R39A 4TW9A 2GQGA 4F63A 4J8NA 4WO5A 5LOVF 4I0TA 2UZOA 4O7VA 3R8MA 3KCKA 4OW8A 4PV0A 5IA3A 2OJJA 4RRVA 5IDPA 3PJ8A 4LOOA 4CKBA 1BYGA 2F49A 3BHHA 2NU9B 2X7FA 5HX6A 3QQGA 2C6KA 3EB0A 5M55A 4HZRA 3TKUA 2R3KA 4PMTA 3TYKA 2PZRA 2XK6A 3E8NA 4Y5HA 4Z3VA 3RK5A 4WRSA 3ZO3A 4RIXB 5CNOA 4O7ZA 3UO5A 1KTAA 3FI3A 4W8DA 4FV2A 5CF4A 5IEVA 3AT4A 5I9YA 2R3NA 1P5EA 2R2PA 3BX5A 3CBLA 3DTCA 4PL5A 3OFMA 4IFGA 4QP3A 3ML1A 3W1GA 3W32A 4CKCA 4KIOA 2JAMA 4FKIA 3VAPA 4HGTA 3LULA 4MV3A 2R84A 3NUXA 5IQBA 4C4EA 3O71A 2DAAA 4G31A 4QMQA 3GJXB 2EB3A 3W0QA 5FUTA 4XOZA 4I50F 4R1YA 4DDGA 4RJ6A 1XMLA 4ZXTA 1YQJA 2IZTA 4H39A 2WFYA 2VWVA 2ZVAA 4GSBA 1Q61A 4G6NA 3W55A 5EM6A 3RK7A 3Q60A 4XCUA 1XH9A 3ODZX 5EDQA 3SXSA 4C02A 5JRSA 3R7UA 4ZZMA 4OTRA 1IRKA 4QSHA 5IYZF 5KNJA 3PXKA 2WU6A 3EN5A 3PY1A 4IHPA 4DTKA 5KX8A 4B99A 4Q4DA 3DKCA 5D8DA 3W1FA 3W8LA 2CKQA 4U41A 1RE8A 1T46A 2V62A 2IG7A 1Q8TA 2VWYA 3AOXA 5JRQA 3KAKA 4I4TF 4F09A 2C5OA 2QU6A 3COIA 3AC1A 4GK2A 3MB7A 1RQQA 3O7LD 5CX9A 1J1BA 4EWHA 4EZ5A 3U4WA 1OBDA 4D1XA 4CLIA 3A60A 4AZWA 2QOBA 4HYHA 4PMPA 5A4TA 3JRXA 4BDHA 2WMSA 5CVFA 4D4RA 4TYHA 3NIEA 1QPDA 4BJJB 4BIDA 3A61A 3G0FA 2R3IA 5EG3A 5FDXA 1KOBA 4LV5A 2VNYA 3WZJA 1YWVA 4TKSA 3EQBA 3FE3A 3QL8A 1OL5A 5BWXA 3HMNA 2X7GA 3T9IA 3C1XA 4ENYA 3BE2A 2QOCA 4QP9A 3COKA 2VRXA 3M42A 2PMLX 5C8KA 5I5YA 4TN6A 3C0GA 3H9RA 5A14A 3OUZA 2C6EA 4ZY5A 3QZIA 4LRMA 4QDVA 4D1SA 4ARKA 2YIWA 2C6DA 2G2IA 4GT3A 5BVDA 2Y4PA 4EUTA 4EK6A 5AAGA 3LFDA 3MVHA 5DAAA 1MQ4A 2QONA 4K6ZA 5A9UA 5DBXA 1UKIA 3GU4A 3BEGA 3K3JA 2IP4A 5AM7A 3FHRA 3AKJA 5EI8A 1KE9A 4QMXA 4MBLA 4BBEA 2C69A 3DS6A 4JI9A 4EH4A 2XH5A 3GI3A 3Q4CA 2W5AA 4FIIA 4FV4A 4DFBA 3LM5A 5HO7A 3WIGA 4F9AA 5IG1A 3KB7A 1MRYA 3AT2A 3MGYA 3EJ1A 2EB2A 1Y8GA 4FTIA 1ZYCA 4QMSA 5DYJA 5AWMA 3OF0A 3PY0A 2OG8A 3TNPC 2ZDTA 5LVNA 1KOAA 1WCCA 2CNUA 3AT3A 5HE3A 4IWQA 3OXIA 1H28A 2XB7A 1SNUA 4W4VA 5CT7A 4ACHA 2YFXA 4ZJVA 1YKRA 3NSZA 5D1JA 2C6TA 5H8BA 4R3PA 3H0ZA 5JK3A 4XX0B 3FUPA 1V9PA 4A4OA 3E93A 5EM7A 2X39A 5FR9A 4DFNA 2Q2TA 2GFCA 5CU4A 5FG8A 5KZ0A 1WMKA 3PA3A 4FTAA 3BU5A 4TT7A 4D0WA 3EZVA 3NW5A 1KWPA 3QZGA 2ETRA 4I24A 4W8EA 1V0OA 3K2LA 3ORIA 3QQJA 4PWNA 3ENHA 2QC6A 4RSSA 3W0OA 2GMXA 2O65A 3DZOA 5CWZA 5DN3A 4F7NA 3R01A 4HVIA 1PJKA 2DS1A 2W1CA 3IO7A 3F69A 5DGZA 4GU6A 4R7BA 2E9PA 4Y83A 4AW0A 2ZDHA 4HNVA 3C4FA 3ZRKA 4YURA 3U6JA 3AC3A 4C2VA 3RPVA 4MXOA 5CZHA 1CMKE 2B52A 3DQWA 3CR0A 4L8MA 4AGCA 3CPCA 4RVTA 2YCFA 4EEVA 4YBZB 4AQCA 4NK9A 2X0SA 3G8CA 3VBWA 3KCFA 5KX5F 2YZGA 4OTDA 4XLIA 3JY0A 3FMLA 4DEGA 4BCJA 4ZIMA 4UCOA 1H1PA 3T9TA 3DBFA 4WUAA 3DA6A 3BWJA 3VS2A 4DE4A 4HVHA 4JIAA 4KA3A 3U0GA 4YJ2F 1UC9A 3QD4A 4DAWA 1Z2PX 4BTJA 3NUAA 4IACA 2O63A 4QMYA 4FA2A 3JZFA 4I6FA 3NYOA 3T9CA 4X2JA 3L8XA 3QTZA 4MKCA 5AP5A 3RNIA 2BRGA 1TKIA 4R1VA 2WTDA 1CSNA 5M44A 3E3PA 2VO0A 5KMLA 5I5XA 3F6XA 3MH3A 2CMWA 5JEBA 4Q4CA 2UZDA 4HOKA 4XOYA 5EQEA 3I4BA 2XAOA 2GS6A 4XRLA 2XIYA 4J52A 2F4JA 2XANA 1G3NA 4TPTA 2ZMCA 3FMMA 5B0XA 4QTBA 2PUIA 5G6VA 5FP6A 4YZ9A 2IPXA 5BUIA 2UZTA 4DBXA 2IVTA 3Q32A 4AAAA 4RIYB 3DLZA 3IECA 1GZNA 3IW5A 4U45A 3AD6A 1G5SA 4CD0A 4NZNA 4DBNA 1W96A 4TNBA 4DEHA 4RQVA 2G2HA 2Z7LA 3DK3A 4AA0A 3D5VA 5HBEA 1EUCB 3BWFA 2BKZA 4IM2A 3ZRMA 1G8AA 5AUZA 3DV3A 3BGZA 2YM3A 3HKOA 2ETMA 2OH0E 3HVCA 5JH7F 1UVRA 2P2HA 3QTQA 3I12A 2H8HA 1ZYJA 2HDKA 4EG0A 1XBCA 3JVRA 1FBNA 3EQHA 4G9RA 2BRNA 4I6LA 2PVYA 1VKZA 4IWOA 4F70A 2ITXA 3PP1A 4I0RA 3IK3A 4BTKA 3PIYA 2LGCA 4WKQA 5CNNA 1TAEA 3I0OA 4E6CA 2O0UA 3LQSA 4BKJA 5EHOA 4W4XA 4BGQA 4O7WA 5ETIA 3VBYA 3EYGA 3O8TA 3GC0A 5M08A 2PUNA 4U80A 2OWOA 3GEQA 4Y8VB 1JKKA 2C3IB 2PVLA 4XP2A 4ZAUA 4G34A 3K5HA 3FKNA 4HYIA 5J9LA 2Y4IC 3R2YA 2JD5A 1ZYDA 5DRDA 5K3WA 3BYMA 4YO6A 2YRXA 5AP7A 3TKHA 1OUKA 4QTAA 3AD5A 3PJCA 1KJIA 1I09A 4GUEA 4R78A 3OWLA 1M6VA 2YHVA 4UZHA 3TINA 4WT6A 3SE7A 3FLZA 2CSNA 3R1NA 5I5WA 1MRVA 3RM7A 2V59A 2HENA 5E90A 4C5CA 3QRIA 1JWHA 3QRKA 4K33A 3QWUA 4U40A 1VYZA 4BDCA 2VTHA 3TNQB 4G5PA 4FEXA 3V5TA 3VUIA 3RV4A 3UFXB 4EQ5A 4AG8A 4N4SA 4ZJJA 4E5WA 3G9LX 3IS5A 2SRCA 4IWYA 3QHWA 4FV5A 5ETCA 3V5LA 3VJNA 4C37A 5T3QA 5M07A 4DEIA 1TA8A 3DLSA 3SAYA 3OCSA 3W0SA 1KJ9A 3HRFA 4FIGA 4XRJA 2WOUA 4FFOA 5DGIA 3DK7A 3FLQA 3AC2A 4G3EA 4FZFB 5EW3A 4F6UA 5HLWA 2ERZE 4CT2A 3OOGA 4GV1A 3AX6A 3A8WA 3OD6X 3QA8A 3LCDA 3C4CA 4MYGA 5BYZA 4G2FA 4IAIA 3PZHA 2AUHA 5AM6A 4FIJA 3HECA 2Y9QA 2O8YA 4I93A 5AUVA 5ACKA 4LL5A 4UXLA 3RAWA 2UVXA 4IVBA 2VTIA 4L6QA 2R3PA 2C0TA 3HP2A 2XJ0A 2YM6A 4AN2A 4HW7A 2CFMA 5C1PA 3EQRA 3U55A 1IYEA 2BZJA 2ZM1A 1BXRA 1Z2OX 4YZCA 4CFVA 4R3RA 1PXMA 4FEUA 3ENMA 4XG6A 3C0HA 3H4JA 4USDA 3CTHA 3ZO1A 3FMJA 4K8AA 4DITA 5AP0A 4JQ8A 3LFFA 4M69B 3VS6A 5IISA 4ZLYA 3WE4A 2HOGA 4EK4A 1IA9A 1YDRE 2E2BA 4YPDA 3EL8A 2BTSA 5BV3A 1C30A 2IN6A 3WZEA 4NJ3A 1OB3A 2NP8A 1BLXA 4E4XA 4JMQA 4ZY4A 3TUCA 1QPEA 4KBKA 3BE9A 4MF1A 4NKAA 4USFA 2ZMDA 5IQIA 3NPCA 5LMKC 5FTQA 4BVUA 2XZSA 3LP8A 3VC4A 4LMNA 2ZV8A 4M67A 4WSYA 4I6BA 2ZDUA 4O7SA 1VBHA 4WNOA 5JFSA 4XZ3B 5ANJA 4JR3A 2PULA 2X9FA 5FXRA 3ERKA 3P79A 4WNMA 2WNTA 4XBRA 2W6OA 3N9XA 3R8ZA 2XYNA 2BDWA 3ALNA 2Q2UA 4JOAA 4H3QA 4I21A 2Q0NA 3AC4A 1PHKA 4S33A 4U44A 5E8UA 1XO2B 3SW4A 4D2RA 3D15A 3FYKX 4QP1A 3ULIA 4BZNA 1GZ8A 4TYGA 2O64A 4H3BA 4L3PA 4AW1A 2I80A 1QL6A 2RKUA 3N6RA 4F7LA 2HVSA 5DEWA 3MV5A 4L7FA 2YM4A 4ZSGA 1OMWA 1EZ1A 3CSWA 1M52A 4P4CA 4EWQA 1Z9XA 3H10A 3NCGA 3EQFA 4BIEA 4FFRA 3KULA 3LLTA 3QTIA 5EYKA 2ZV2A 1A0IA 5LVLA 5E8VA 4EONA 1TQIA 4GLWA 3SKCA 4AGUA 5TF9A 1U59A 5IUIA 1PF8A 2XIKA 3DTWA 3EH9A 4ZMFA 1TVOA 4FBXA 3EQIA 2OJ9A 1P2AA 3ORZA 2B54A 2QOIA 2VTNA 1KC7A 3VW8A 3E87A 2C5VA 3DJ5A 5D41A 4LUDA 4UN0C 3QX4A 1GJOA 4IDTA 1YXVA 1NVSA 3CQEA 4DH5A 2Z7SA 4I55F 2C68A 2PPQA 3OTVA 4L44A 3EKKA 4WD5A 2B1PA 3IONA 4RZWA 2QB5A 4RJ3A 1PMUA 3H30A 3O17A 4G6OA 4YJNA 5BPHA 1NT2A 4E4MA 4EH7A 2HGXA 3NX8A 2VX3A 4EBWA 4G9CA 3ELJA 2CCIA 3PXFA 5JVLA 1XQZA 2UZNA 4YBJA 4CV8A 3U9SA 3BHYA 4CFWA 2PVFA 2J0IA 3A7IA 4QTDA 2J2IB 3WWIA 5I60A 1P16A 4M12A 4YR8A 4OT5A 3G90X 2WTIA 2XALA 3DPKA 5FBOA 4IDVA 1YOJA 4FYOA 4BJJA 1NXKA 3EQGA 2JIIA 3S95A 1G8JA 4O7YA 4FL1A 2ZDQA 3GC7A 4HQ6A 3T3VA 3SOCA 2PVNA 1VS0A 3FL4A 3UP7A 1NA7A 3G51A 3GCSA 3CTQA 3H9FA 4MAMA 4WG5A 5H9BA 2ITPA 5J8IA 5A4CA 5EW9A 2ZM4A 4D28A 5KZIA 1PMEA 3ROCA 2DWCA 2PMNX 3OHTA 4FSTA 3QFVA 4F0GA 4PZ8A 4MXCA 4EEQA 3QD2B 4EYMA 2HWOA 5AUTA 2QG5A 3ZUTA 4FSMA 4IQ6A 4EGQA 1ZAOA 3KA0A 4DEEA 1DAYA 2VNWA 2VTLA 5GNKA 3UTOA 1RDQE 1FMKA 5K4JA 3ZRLA 1LUFA 1YHSA 2J51A 3I6UA 3ZONA 3VBTA 3LLAA 4LYNA 5TKDA 2GHGA 3BG5A 3K5UA 3EHAA 2PE2A 2VTQA 2OZAB 1X9NA 4BCQA 3COHA 1PXKA 4BF2A 3PG3A 5K5NA 5BUEA 1I2LA 4CSVA 3UDZA 5ANKA 1EHIA 1O6YA 5DWRA 3FKLA 5HU3A 3VRZA 1OZ1A 5J9YA 1K9AA 3SRVB 1R1WA 2ZJWA 4L42A 1AD5A 4MNFA 3A62A 4E26A 3DGKA 2WEVA 1GLVA 5BX0A 5DGHA 5IQDA 3FL5A 3UG2A 4XP0A 5A46A 1H00A 5E8TA 3LPBA 2YDJA 4DYMA 3GB8B 2R5TA 5EH0A 4XX9A 4NZWB 4EGJA 2WU7A 5L2TA 4RJ7A 4U43A 3T9DA 2R64A 4DA5A 3ZLWA 4MV8A 2WMAA 1U54B 4KS7A 4MAOA 4JDIA 5CSHA 4NM3A 4S2ZA 1WR2A 5BVOA 3OMVA 4UYAA 4ZTSA 4UWCA 2C5XA 3KMUA 5AUXA 4BHNA 3AW8A 2HIWA 3A4PA 2YS6A 2IZRA 4HNIA 3BI6A 4ACCA 5CS6A 5F95A 5LXTF 3FJQE 4P2KA 4AT4A 5IU2A 4KSQA 2GNJA 2J6MA 4O91A 2R7IA 3VS5A 4JQEA 1ZZLA 4LQMA 1FVTA 2IZSA 3QTSA 2F2CB 3NW6A 4FKVA 4PRJA 2XARA 4TWOA 2RL5A 4V04A 4YBKA 3CXWA 4FKUA 4FNXA 3R7EA 1WBTA 3QGYA 4J1RA 4AFEA 5JN2A 1VBGA 4U9AA 4FGRA 2GCDA 3R30A 2WMQA 2CPKE 5DG5A 1NVQA 3KXGA 2Z7RA 3ATSA 4ACGA 3UYYA 5L3AA 3VBXA 4K9YA 3HDMA 4F6WA 5L2IA 5AUWA 2OK1A 4JQ7A 2JFLA 4O7RA 2ZYBA 4UALA 5L6PA 1OI9A 3WARA 1PY5A 3OVVA 5BQ0A 1I1MA 5BWUA 3TV7A 2VTAA 3FXXA 5ETFA 2OGVA 2AYPA 5D10A 2XKFA 3UNZA 4DHIB 5KS8A 3ZC6A 2W5HA 2W6ZA 2C6IA 4EHVA 4EOLA 4I20A 2B9JA 4GIIA 1PW2A 1Y91A 3IOKA 4IX3A 3P1AA 4NIFB 2BIYA 3DZQA 4F0IA 3A99A 3BRBA 4IM3A 5K5XA 4X3FA 2GTNA 5CASA 1PX2A 4P7EA 1OECA 1XR1A 2WMWA 2ITUA 3FSKA 3E8CA 4XYMB 2HCKA 5CQWA 4CG8A 3PPKA 4YSMA 3PXQA 4Y73A 2GNFA 4O7LA 2JIVA 3LE6A 4OBPA 4YC3A 4YNOA 3TIZA 2UZEA 2YJRA 2DWBA 3ORPA 5B2MA 4GFOA 3IW8A 2YZAA 2UZBA 2OW3A 4XYFA 1Q8YA 2DLNA 2JAVA 4DT8A 4YAKB 2BAJA 5HCYA 5M4FA 3JVSA 4QMZA 2GSFA 1AGWA 2UV2A 2OH4A 5DI1A 2W9FB 5J7HA 2BR1A 3MN3A 3ZFYA 3WILA 3WYXA 2ITVA 2B53A 2Z8CA 3O8PA 4I94A 4PMSA 3MH2A 4QMVA 3PWYA 1EKPA 4UCVA 4DGOA 2XUUA 5DT0A 3MSSA 1I7LA 4I5HA 4D4SA 3R7IA 2F2UA 3D0EA 4HPTE 1GSHA 4JIKA 1K2PA 3VHEA 4PZ7A 1XWSA 5M56A 2B9IA 1CKOA 1Q24A 3ZBFA 3R83A 3F2NA 1A06A 3F3ZA 4RT7A 2P55A 3PA5A 1CKNA 1ZMVA 3KK8A 5IEYA 4GLXA 4QRCA 5LQFA 4IZ5A 4O82A 1TQMA 2OZOA 1GSAA 4O22A 4EH5A 3S00A 2FPPB 4XNEA 5HO8A 2C6OA 3RM6A 5HD4A 5LOHA 1Q3DA 2VWXA 4UZDA 2Y4RA 3MA3A 4TM5A 4FKWA 4D0XA 3FPQA 3UC4A 2YN8A 1B6CB 4BN1A 4BTMA 1BKXA 3C51A 1STCE 4KKHA 3DKOA 2J0MB 4IZYA 4C0TA 5FPOA 1YHVA 1ZRZA 3DKGA 4O4IF 3CD3A 4X2GA 3UIBA 4AP7A 5C8NA 4KKGA 3QD0A 2W1FA 4RWKA 1Q4LA 2BVAA 4FKTA 3HT5A 2OIDA 2W4OA 1H1RA 5EDRA 2C47A 3TTIA 4E7WA 2CN8A 3AMAA 4CEGA 2FSOX 5C1QB 2Q0BA 4K2RA 3QQLA 3TUDA 3AMBA 3PPJA 4DFLA 4K18A 1YI6A 3D2KA 5CY3A 2CGXA 3ORTA 4M84A 5EK7A 4EQCA 1OL7A 2XD4A 3CTJA 4QTCA 3BQCA 1TFFA 5FTGA 1QPJA 1UU8A 5CLPA 4P90A 5DISC 4JG6A 4Q5EA 5E91A 5BMSA 3Q53A 3BLQA 3LCTA 5E8XA 5LXMA 2I8CA 1RJBA 5CEMA 2VTTA 4CKJA 5FXQA 4FL2A 3L8PA 3R1YA 3ATTA 4O86A 5HBHA 4ZTMA 3PUPA 4CMUA 3PJ3A 3V01A 3WZDA 1H27A 3MTFA 2W1IA 2V5AA 3TIGA 1B6SA 3E7OA 3KF4A 1P8LA 4F4PA 3U9CA 2CGWA 3PVBA 1PMNA 2HVQA 2QVSE 2X2KA 4OR5A 4IHJF 1V0BA 3FV8A 4Z55A 3W2SA 2PVMA 3GXLA 4ANBA 5HEZA 2VO7A 1BUHA 3FC2A 1ZY5A 2Q83A 2VO6A 2NUAB 5HU9A 2J0KA 3CC6A 3F3TA 2J5FA 3I79A 4IIJF 3TW6A 3CEBA 1NVRA 4C34A 3D7TB 3MFRA 3RAKA 4EH2A 1GIJA 3PPZA 5LP6F 2W0JA 3KREA 4ASZA 2ITNA 3FMKA 3DFAA 2R0UA 3R8PA 3DXPA 3BA9A 1YDTE 4C61A 2XS0A 2NYAA 3AMYA 3ORRA 4CKEA 3I7CA 1KE7A 1UKHA 2R82A 3UQ8A 3BGPA 4LI5A 2WMTA 1HCKA 4MCVA 4ZSJA 4N6YA 4EQUA 1W98A 2GNLA 4M7IA 2EWAA 5IEXA 5ANEA 5HNBA 3DCVA 4ZY6A 5JZJA 3ZH8A 3QAME 5F20A 1JPAA 3RCDA 3JZIA 3QBNA 4EOSA 2C4GA 5JQ5A 4ZK5A 3PE2A 4O6EA 1B38A 4IAAA 4YJQA 5DA3A 1OKZA 5JMSA 5J2TF 4KRCA 3GU6A 3V6RA 5K9IA 4HPUE 3L9NA 3BHTA 2WGJA 4RA5A 3D5UA 5IQCA 4M0YA 2BALA 1PKDA 4MBIA 3PE1A 4WBBB 5HLPA 4L01A 2R87A 4CFXA 3QYWA 5M06A 4AFJA 3QX2A 1H1SA 3K5VA 4X0MA 1CTPE 4F1OA 4JAJA 2QKRA 3W16A 3UVRA 4DRFA 3ZU7A 3ZLXA 4L7SA 3GU5A 4E4LA 4BDKA 3RNYA 5JQ8A 1U5QA 4GKHA 4K0YA 4PMMA 4YJPA 5M4CA 2GNGA 4PL4A 3L8SA 4RWIA 2ZB0A 3O5AA 5T6KA 2QODA 3LHJA 4QMPA 4D2SA 2OIBA 2F7EE 2EXMA 4FG9A 3LAUA 3WBLA 1PYEA 4BRXA 4MWIA 2VTRA 3HAMA 4C7TA 3NR9A 3UO6A 5HV6A 5D1OA 3HUBA 4DTBA 4FSWA 4A9TA 2XM9A 2V5QA 5BYLA 4EOOA 5L2WA 4JJRA 4AW5A 3BABA 4JBQA 1I44A 4CFMA 3R7OA 4A9RA 5FBNC 3QC9A 5CANA 3OW3A 3DDPA 2VWIA 3DKFA 4FKPA 5BVNA 2W1EA 4J7BA 3C0IA 4QEBA 4WBOA 1UU7A 3T9FA 2C00A 3HMOA 4KIQA 5HNGA 4EC8A 2RFEA 2C0OA 3LXLA 3C9WA 5IF1A 2YS7A 4NW6A 4EL9A 5LMAA 3T9AA 5K2MA 4KNBA 4BYJA 5FPRA 1LR4A 2CNVA 2IWIA 3TIIA 5A4QA 3PXZA 4C4FA 3S1HA 3CY2A 4EFBA 2EIYA 4FFNA 3C4EA 3MY1A 4J53A 2JBOA 3Q5ZA 4I4EA 4TTHB 5FLFA 3CS9A 4EHZA 3OP5A 5D12A 5HIBA 3SGCA 4AACA 4F65A 4DG2E 5I9VA 1W0XC 3L9LA 4MTAA 2RFNA 4II5A 4RIWB 5FM2A 4YAJB 2YDKA 4C4IA 2BZKB 4F9CA 2OJFE 4F7SA 5GIOE 1DGSA 3NAXA 3VQUA 3QCQA 3E5NA 5CTPA 5IA0A 3TN8A 3HRCA 4NH1A 4CG9A 3LFCA 5CU2A 4M13A 5I9ZA 4LRKA 2FPGB 4FOBA 2C3LA 1Y6BA 3VA7A 4QT1A 5BMVF 4GJ3A 4DHZA 4RC3A 2HVRA 4RPVA 3OROA 3UO4A 4FEWA 3VPDA 3BYOA 3LCOA 5DNRA 4V01A 3IDPA 3VQHA 1UU3A 5J87A 2R7MA 4X21A 3BPRA 4AOIA 4PZ6A 2XK4A 3QTXA 2C3JA 2OI4X 2GDOA 3DBEA 3L8VA 3UNJA 3DT1A 5E7RA 4KIPA 3U8WA 4EOJA 3MS9A 4YZBA