4O7ZA

Saicar synthetase (type-2) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
226
Chain Sequence
AKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-2) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 71
structure length 226
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7zA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7zA02
3JY9A 5CU3A 2BPMA 5CA1F 2WMAA 3DZQA 4O0RA 4B7TA 2PTKA 3W1FA 5D11A 1FBNA 3ZLYA 4TW9A 5HE1A 4KUJA 3VQUA 4F7JA 1OL2A 4GKHA 4M12A 5A4TA 3P7BA 3QL8A 3W2RA 2OLSA 4XNEA 1JDBB 5JRQA 4ZTSA 2VTSA 5FDPA 3MB6A 4LM5A 5LYJF 4ZY6A 4ITJA 3D4QA 3ZLSA 3EZRA 5DGZA 3TL8A 3N4TA 5BVNA 4C59A 1H24A 4YJOA 5IZFA 1C30A 4MV9A 3QTQA 4X3FC 1YVJA 2OLCA 3AMBA 4QMVA 4ALVA 1ZXEA 4QP7A 2ACXA 3PIZA 4RZWA 2Z7RA 4FTIA 2J90A 4C62A 3R9OA 4DH7A 2WFYA 3ZM9A 2O65A 3PP0A 5CS6A 5CVHA 4ZMEA 1WBTA 4DGGA 4WRSA 4IX4A 2VGOA 2VV9A 3GEQA 4ASXA 3OWLA 4X6QC 4KIOA 4FTOA 2BIYA 5HIBA 5IH5A 2C68A 2E2BA 4M67A 1OIQA 3BLQA 3HUBA 3K3IA 4UXLA 3R00A 5H80A 5AM7A 3UZRA 3KAJA 1KV1A 3OEZA 4JDKA 4KKEA 5E8YA 4A7CA 3RV3A 2BHHA 3FC1X 2G1TA 4E4TA 1OB3A 2X8DA 3QC4A 5LMKC 4EHEA 4TYJA 4ZI7F 3DT1A 4JI9A 3UC3A 5EKOA 5ETIA 3GC0A 1OBDA 2XNOA 3TWJA 4AT4A 4USFA 4U42A 4IAYA 1JKJB 3K5HA 1ZYCA 5C1OA 2O5KA 4L3PA 3F5GA 3CIKA 5C27A 3LP8A 3R01A 2X1NA 3CLYA 4TWPA 4WRGA 5AIKA 4BC6A 4RX5A 2HGSA 4XYMB 5CU6A 2IWIA 1FVTA 1PYEA 2OF4A 3DB6A 3V8SA 3OY3A 4X2GA 1K9AA 4Z3VA 4H39A 2CGVA 4ARKA 3GCQA 4I1ZA 4BCFA 1GGOA 5L8JA 1Z2NX 4F9CA 4YB8B 4BI1A 3DNDA 5BUIA 4PF4A 2YERA 3WZEA 3DDQA 2C00A 2PUIA 3ANQA 3Q9WA 4AW0A 1U59A 5IF1A 3HO8A 4MNEA 4ZXTA 4F6SA 3KXXA 3RM6A 2R7BA 3DBCA 3R1YA 4EORA 1YOJA 3K3PA 2GHLA 3ZSGA 4O4IF 2YHVA 3DXPA 3ORLA 3MFSA 3IW4A 4D9UA 4I4FA 4RSSA 4E6QA 4ENYA 4CKIA 2P4IA 2O0UA 3CTQA 3TKIA 1WBNA 2GLTA 4NFMA 3KALA 5CWZA 3EQGA 3QD0A 4FV5A 5HX8A 1VBGA 5EM6A 3WE8A 3FMNA 4P4CA 1OBGA 5DVRA 5A54A 2GPSA 1PYXA 4JBPA 3TIGA 2ITZA 3DAEA 3NUPA 3IECA 4GUBA 4HOKA 2C4GA 4EKLA 5I9VA 4YBKA 3RK5A 3IPHA 2VD5A 4AZFA 5EI8A 4NJDA 3CD3A 3DXNA 2QLUA 2GMXA 2W1IA 2QHMA 2CJMA 3BBWA 4TXCA 4CMTA 2J5FA 1XH8A 2ONLC 1PHKA 4PV0A 4S2ZA 4A4LA 4MBLA 3LPBA 3DNEA 3BU6A 3EH9A 3O51A 3DKGA 1PXIA 3WZDA 4ZJJA 4FTLA 1GNGA 1O6YA 1E4EA 4Z7GA 3GC7A 5CF5A 3QFFA 3FMHA 4DBXA 2C1AA 2CGXA 4YURA 4FKSA 3F3UA 4IAKA 5C4KA 5LMBA 4PL5A 5KKNB 5J2TF 3C4EA 5EDRA 4JX3A 5K9IA 1Z2PX 2YM5A 3D94A 3MFTA 4QMOA 1TQIA 5KMIA 1OIRA 3BWJA 4JIKA 2JKQA 3EQRA 3FKNA 1KWPA 4UB7A 4N57A 4TWNA 4WO5A 5M08A 1KJ9A 2CGUA 4D4YA 2BIKB 3BZ3A 1H1RA 4JXFA 4EUTA 3K5UA 3DBEA 4YJRA 3LLAA 4F7LA 5CANA 1CKJA 4FNWA 3UQFA 3KRRA 2DS1A 4HZRA 3EFJA 4NIFB 2JDSA 3EOCA 5CSPA 2YZAA 3R0TA 4MXOA 4FFMA 3ORMA 4D2RA 4S32A 3U4WA 3UE4A 2PVKA 4IWOA 1H25A 3I0OA 5F4NA 4K9YA 4C0TA 3OW3A 3U87A 3NNUA 2WMSA 4LQMA 1Y6AA 3NYVA 4FTTA 4UZHA 2B7AA 5FGKA 5HCZA 4A06A 4AA0A 4FL2A 2KULA 2JDTA 3KMUA 2W1GA 1OL6A 1PMUA 2VWBA 4FTAA 4MHAA 3T9TA 3REPA 3NSZA 4EOJA 2WNTA 3NYOA 3ZH8A 3MV5A 4ZK5A 3UC4A 4BDJA 4FA2A 4O2AF 4JAJA 3UJGA 4MBJA 3GFWA 3BYUA 4J8NA 4AFEA 5HO7A 4JOAA 3LCSA 4JBQA 2IPXA 5BVWA 3R5XA 2Y0AA 5DLSA 5C8YF 4BDGA 2ZDQA 1GJOA 3UVRA 2YAKA 3GP0A 3UTOA 5EYDA 4XRJA 3QTIA 3U8WA 3SW7A 3VN9A 4DGNA 2R3PA 2OXDA 4NT4A 2OW3A 2W9ZB 4MF1A 3G9LX 3VUGA 4AT5A 5BNJA 5BPYA 4QTEA 2YL2A 1R78A 4KRCA 4DN5A 4N70A 4QMLA 3BLHA 3S3IA 3VO3A 4HJOA 3ELJA 3HV7A 4AW2A 5D41A 4ZS0A 3PSDA 4YJNA 3KF7A 4I22A 4YC3A 1OL7A 4RC2A 3FSFA 4I24A 4QTBA 1XH6A 2VTAA 3PJ1A 4FGRA 4AS0A 2AC5A 3TACA 3LMHA 4GU6A 3OFMA 3Q53A 4NM3A 3HECA 4OTIA 4PTGA 5E8UA 3NIEA 2CHLA 2YJSA 2IZRA 4FKVA 3OOMA 4HYUA 4AE6A 5IH6A 4RWJA 3PXKA 3HP2A 5FBNC 3TNQB 1Q3DA 3KRJA 4V05A 4CMOA 4CKRA 2YDKA 1CS0A 4CVAA 3GOPA 4TYIA 5EHLA 3ZC6A 4YJ2F 3I60A 2XJ1A 4IC8A 4HNFA 4EWHA 2VTMA 3WIGA 3CQWA 3KVWA 2W06A 3B8QA 4AN3A 4C36A 1C3OA 4FU0A 4YTIA 3U6HA 5CSWA 4M84A 3I6UA 3TZ9A 3B8RA 2P0CA 4DFYA 5AM6A 5HNBA 5HIEA 4LOPA 2X9EA 1GZNA 5G6VA 1WBSA 4BZDA 3COKA 3L1SA 3M2WA 4KD1A 4Y8VB 3ZFMA 5BVFA 4GK4A 3ZEWA 1EZ1A 4GK2A 3PJ3A 1H27A 5EOBA 4DEIA 4C3PA 3OWPA 3ZO2A 1WR2A 3PUPA 3QXPA 4NJ3A 4YTFA 2BAJA 5FXRA 5CQWA 4E8AA 4BCHA 1H01A 2PY3A 2UZDA 2EVAA 2X2LA 5FTOA 5JRSA 1AUXA 2C6TA 4D1XA 2R86A 3U9CA 3EYHA 5CI6A 3QQUA 3SOCA 2XIKA 3FEGA 3JPVA 3QCYA 2JFMA 3DBDA 4MBIA 4YGAA 5AUZA 3R83A 3SG8A 4C37A 2C0IA 3SHEA 3BGPA 4XOZA 1ERKA 4ACHA 3V5QA 5AUYA 3R7IA 1BKXA 2G2HA 3WF8A 5A14A 1Y57A 3UQGA 3ZLWA 2QNJA 4DINA 4TUYF 2WMUA 3VBTA 3VJNA 5HEZA 2YIQA 3CY2A 3V01A 4G6LA 1I44A 3HMMA 4X0MA 5IA2A 4RQVA 4RX9A 5AUXA 3NNVA 5HESA 3SKCA 5CI7A 3I6WA 4F08A 5JH6A 3HUCA 3VUHA 2FH9A 3LCTA 4NU1A 2F9GA 4YJQA 3DCVA 1HCLA 2IZTA 4PDPA 5D1JA 4DH8A 4LMUA 4O7ZA 2C5XA 1YI6A 3H0ZA 2HWOA 3HMOA 3A60A 4O7LA 5FEQA 5IQHA 1CSNA 4XEYA 1SNUA 1YXSA 5EK7A 2C3JA 4AW5A 3NUUA 5KX8A 4B9DA 4EJ7A 3CGOA 2VNWA 4JX7A 4NUSA 5HVKA 3NLBA 4WNPA 4WHZA 4EOOA 3R1QA 2O64A 3QC9A 2W9FB 1E4EB 4QMMA 4QP3A 3EQFA 5LARA 4LMNA 3WILA 1QPEA 2GFCA 5AV1A 4MQ2A 5AV2A 2C47A 2HY0A 3OEFX 2XK8A 3QA0A 3MWUA 4YZBA 5TR6A 2DWBA 3VRYA 3VS1A 4IACA 4F63A 3NMUF 4O7TA 2VWUA 3P5KA 3QTZA 1XH9A 4OT5A 1BNCA 3NUYA 2QKWB 5AUVA 3TJCA 2QR7A 4BDDA 4BTKA 4F0IA 2SRCA 2IO6A 3LQ8A 4DT9A 4BTMA 4AAAA 2DLNA 2C3IB 4O0VA 4YSMA 4ASDA 5EYCA 2WB8A 2BKKA 2O3PA 1JPAA 3EFKA 5JK3A 1QMZA 4M3QA 3AD6A 2YN8A 4IBMA 2X9FA 3IGOA 5AV4A 1FVRA 2VO7A 3I79A 3WYYA 4F9WA 5CEOA 3ETJA 3P9JA 4FKQA 3PJCA 2W5BA 4G3GA 4MNEB 2A2AA 2GPHA 3UZPA 4EQUA 3A62A 1J7LA 3WIKA 2OSCA 3VA7A 4BHZA 4EK6A 2P2IA 1B6SA 5AX9A 1XR1A 5LVOA 3Q4TA 1DI8A 2UW3A 3WZKA 3N9XA 3EYGA 3KKVA 4ORKA 3KFAA 4OTHA 5HI2A 4FZDB 4QP6A 5DFPA 3W8QA 4BDHA 4L67A 4DLIA 3GQIA 3JS2A 5CQUA 3IONA 1H26A 1XBBA 2VTRA 2X4ZA 1QCFA 2VX3A 3HAVA 3MPTA 3QQJA 4L68A 4M97A 5FP5A 4CLJA 4EH2A 4EOLA 4LYNA 3GC9A 4BDEA 2A27A 5AADA 2UUEA 4CNHA 5IMEA 5LOHA 4FTQA 3PG3A 2IW8A 3A99A 3GU8A 3RHKA 4EKKA 3AW8A 3FHIA 3FY0A 5E90A 4XP3A 4YO4A 1E1XA 1OECA 3LZBA 2C6LA 3QD3A 2WELA 1FMOE 3COHA 2WO6A 5ANGA 1XHAA 2FB9A 4WUAA 3CKXA 3MFRA 3ORKA 4FFNA 4FVQA 2H8HA 5JQGF 5CAVA 3AGMA 2C6DA 3ZYAA 4AOJA 4QYGA 3UODA 4DLJA 3PXQA 1PMVA 3GU6A 4M69B 2UW6A 4ACGA 2XM8A 4WT6A 4EH9A 5LXMA 3FMDA 4QNYA 2GQSA 3BI6A 3QTWA 4DITA 4RIXA 4YR8A 5HICA 3ZEPA 3ZM4A 2IVTA 3QKKA 1H1SA 3I5ZA 2JKOA 2HCKA 2XEZA 3JZIA 2GQGA 2OIQA 3G6HA 2ITUA 2IN6A 5IQDA 5JEBA 2VTQA 5E9EA 4U3YA 4AFJA 2CDZA 4HCTA 1CTPE 4H58A 2V59A 3HRFA 2OXXA 4FK6A 4YC6A 4IWPA 4YNEA 3MPMA 4UXQA 4AACA 3JRXA 4XYFA 4FTKA 3EKNA 3FMLA 3PJ2A 4TV9F 3BU3A 4FT5A 5GINE 2YIWA 2V62A 3Q6WA 1JVPP 2YCRA 2BKZA 2NNWB 4O7YA 2YDJA 2JAVA 2DUVA 3PXYA 4PQNA 4DTAA 3MJ1A 1JDEA 3DJ6A 3RAHA 5DA3A 5JZNA 5HKMA 3ZXTA 1Q8TA 4L9IA 4RJ8A 4IJPA 1MUOA 1QL6A 4KBAA 2YEXA 4RWKA 5FXQA 5JFWA 1WCCA 4G3FA 2C3KA 3IQ7A 4O4HF 3AQVA 3FJQE 4IB3A 1YW2A 4S30A 1IOWA 5CB4F 3ODZX 2PVLA 2J0KA 4I6BA 4DF3A 2ZMCA 3BE2A 3I4BA 2SCUB 3UOKA 3V4ZA 4J96A 2PMNX 2J9GA 3OD6X 5D10A 1GY3A 2VAGA 5IEVA 4O0UA 4QTAA 4M8TA 2XB7A 1A9XA 2IG7A 3S2PA 4DTBA 5DEYA 4JDJA 5EW3A 2VWWA 2JAMA 1UU9A 2R3LA 4YHFA 1Q61A 1GZKA 3WF6A 4GJ2A 4X2FA 3ZO4A 4K77A 3ZDIA 3L8VA 4L1KA 3LFFA 5F1ZA 4B6LA 4XHKB 2BRBA 4DEGA 3BHUA 3HL7A 4I5HA 4IM0A 4GUEA 1W7HA 4J7BA 3SLSA 5HD4A 3QHRA 5LCJA 3DAKA 4L7SA 3E5AA 4R3CA 4E6AA 4KAOA 3DBFA 5HX6A 4I92A 5TT7A 3C9WA 4OTRA 1MRVA 4TTHB 4WG5A 4MD8E 2ZJWA 4O6EA 4XV2A 2UVXA 4ERKA 2R64A 4ZTQA 1R3CA 3IK3A 1PF8A 4YC8A 2WU6A 3FQEA 4M14A 3BLRA 2LAVA 3PSBA 5GJGA 4D5HA 2I87A 4TL0A 3L9PA 2PZIA 3GU5A 3LJ0A 2OXYA 3ZXZA 1M2QA 3BBTB 4WKQA 4NL0A 3KK9A 5E8ZA 3TTIA 5BYYA 2QOCA 4I21A 3G15A 4E4LA 3LFAA 4PL3A 2W05A 5ITAA 3F5XA 5CEIA 5K5XA 5HVYA 3RWQA 1W93A 3VBVA 4A9TA 5C26A 2YYAA 3FQHA 4OLIA 3O23A 3F3WA 2Y6MA 4MV6A 1ZARA 4M7IA 3GB2A 2C6IA 2EWAA 4FT3A 4GG7A 2G2FA 2WQEA 3SOAA 1H00A 3E8EA 5DMXA 1S9JA 4IX6A 2X2KA 2XKCA 5EG3A 2GS7A 1YWRA 3KF4A 5CZHA 2J2IB 1IR3A 5EW8A 2CNUA 4IFGA 4EOPA 1UV5A 4Z9LA 1UWHA 2A4LA 4H1JA 3DQXA 1DV2A 5LMAA 4MAMA 2VX0A 5DRBA 4FMQA 3FLNC 2P3GX 1NXKA 2Z60A 2BALA 2PVMA 3JY0A 4EH5A 4A07A 4W8EA 4ASZA 5HU3A 3CQUA 2YA9A 4FZFB 4GVAA 4PMPA 2J5EA 2XIZA 3ATTA 3HRCA 3AC4A 4QO9A 2VTPA 3V5TA 1ZAOA 3OBGA 3O7LD 3BG5A 2X6EA 3CTJA 2ZYBA 3W33A 2F7EE 2V22A 3G2FA 3H10A 4U43A 3ACKA 4O7SA 4Y8DA 4ACMA 3SX9A 2XK4A 4WD5A 2WMQA 1PXNA 4CQEA 3C50A 4IAAA 4MD7E 4QP8A 1K3AA 4FEUA 4IZ7A 2WPAA 3DFCB 4WG4A 4CG8A 5JT2A 5EM7A 5BVEA 2GTMA 3H9FA 5DR6A 4FFLA 3RMFA 4BHNA 3H3CA 2CKEA 1M0TA 4RLLA 5I9ZA 3DF7A 1EHIA 2GU8A 4PP9A 4CT2A 1FQ1B 4MCVA 4IVDA 3T8OA 5KMNA 2QK4A 5C8MA 3U55A 3OXTA 3EZVA 5AUUA 4I5PA 4R78A 3THBA 3PIYA 4Y46A 4HVDA 2WGJA 2H34A 3PIXA 3ZO3A 2X39A 2YACA 2R3OA 3BGQA 2V0DA 3CJFA 4XV3A 5ETAA 5E8VA 4U97A 5HCXA 4FTRA 3NZ0A 4TV8F 3UPXA 1H08A 3MY0A 1MRYA 3RP9A 3GQLA 1KE6A 2QOQA 3W18A 3PPZA 1PJKA 1OUYA 3TEIA 5GIPE 4FT9A 1CMKE 3VUMA 3TDVA 4HR7A 4E26A 2EU9A 2W1ZA 3ZDUA 4DFBA 4O0WA 5CAPA 2CKPA 2UZEA 3C4ZA 3QAME 1PW2A 3CPCA 4HGLA 4I55F 1OM1A 1ZYSA 5HNGA 2B55A 3KMWA 2XBAA 3TV7A 4C7TA 4XBUA 4D28A 5HU9A 4O7NA 1UU3A 4RBLA 1XH7A 4QPSA 5HNIX 2VN9A 1Q41A 4O83A 3F6XA 5HE3A 3KULB 4M68A 3G0FA 3UP7A 4CXAA 3MH0A 1XH4A 1DM2A 4KINA 4TYGA 4BVUA 5L2SA 3RINA 4A9YA 4ZY4A 4E7WA 3FI3A 2VRXA 5HBJA 1OITA 5HTBA 2GFSA 5E7RA 2JDVA 3Q4CA 4AWIA 4ZSLA 5M53A 2PZYA 4HVSA 3E3BX 3E8DA 3MESA 2G9XA 2XRWA 2GDOA 2ITVA 3E92A 5HGIA 5BMMA 3RTPA 3UVQA 2F57A 5LA6F 2X8EA 3F5PA 4O2PA 5J1VA 2YM8A 4R3RA 2ZM4A 3Q60A 3A2CA 1OKWA 1FOTA 4ANLA 5CXHA 1Q24A 3MN3A 4JRNA 3OC1A 2ETKA 4FUXA 1U46A 4ZY5A 2AYPA 4AP7A 2WOUA 3V6RA 5CTPA 2XCKA 3HZTA 4ASEA 1KJIA 5BMVF 4BY9E 3H9OA 3BCEA 3DDPA 4D0WA 3Q96A 1VJYA 3IDPA 4O7RA 5LQFA 3D5XA 4ZLZA 4QMUA 2QC6A 4EWQA 1F5QA 3G6GA 3V5WA 4EQCA 4ONAA 3LCKA 4KBCA 4QP2A 5H8GA 5KKRB 1OPJA 5DEWA 5HBEA 3UBDA 4YSJA 4ITHA 5FEEA 4I94A 3R02A 2BROA 5ACKA 3PA5A 3IW6A 3I0QA 4ZIMA 3K5IA 3ORTA 4IX3A 3MYGA 2X81A 3EQIA 2YRWA 3O7LB 5BPFA 5EZYF 4O2ZA 3AG9A 3AC3A 1WAKA 2GSFA 2RL5A 3LHJA 4CD0A 4FSMA 4YHJA 3UMXA 4MV8A 5T3QA 4EGJA 4D58A 2G15A 1G8SA 4IFCA 4R5SA 2JIVA 4YNOA 3O0GA 1G3NA 5HZNA 4UWYA 4I50F 3UQCA 4FG8A 3FL4A 2ZV8A 4QSHA 3FZPA 3TV4A 3KRXA 2YCQA 3DTWA 4M0ZA 2QU6A 3RPOA 3WO1A 1U4DA 4JBOA 4QYFA 3W8LA 1KE7A 2FGIA 3ZRMA 4HGSA 1I7LA 3HGKA 1TQPA 2CNQA 4AA5A 5EKNA 4U45A 4AGWA 3DS6A 5AUTA 3FC2A 2VO6A 3R30A 1Z9XA 3O2MA 2OG8A 2RIOA 1P5EA 3D14A 4UWCA 4IZYA 2B52A 2R3QA 2X8IA 1NVSA 1OL5A 4OR5A 4TNDA 4FL3A 4A9UA 1RW8A 4K33A 2R7MA 4P5ZA 4WNOA 3ZMMA 4O7VA 2PZPA 1U54A 3L8PA 4QYYA 5LVLA 1UWJA 2R3GA 4FOBA 1E9HA 4IWQA 5B0XA 3ROYA 4AQCA 3V4SA 4GMYA 2QOIA 4AXAA 1U5QA 3D0EA 2ETRA 1YI4A 1CM8A 1M6VA 4HVHA 5M09A 3DJ5A 3LFQA 4D0XA 2NU8B 3KC3A 1WMKA 2IZUA 4B99A 3V8WA 4G5PA 2C3LA 5AP3A 4DYMA 4QMSA 4L42A 1Y8GA 5LWNA 3R9DA 3V5JA 4ZTNA 3HBLA 2I80A 4DH5A 1YOMA 2UZVA 3MA3A 5L6WL 2ZV7A 1T46A 2QOHA 5ANDA 5IQGA 2H9VA 3U9SA 5CSHA 3F7ZA 1EUCB 2VZ6A 2AUHA 4O7WA 4XH6A 4M13A 2XRUA 4U5JA 2FPIB 4FFOA 5B2LA 1YRPA 5E8WA 1DS5A 4IM2A 2FB8A 3P7CA 2R2PA 5ICPA 1Q5KA 3BEGA 5CF4A 5E92A 3UG2A 4MXCA 1ULZA 2WMWA 3QTRA 4PRJA 5IQFA 3EFLA 4BGHA 2XJ0A 4TYHA 3SAYA 4EZ3A 3UO4A 2WQMA 3Q2JA 3W2OA 1X8BA 2JDOA 1H4LA 5GJFA 3FKOA 3Q9YA 5KE0A 4R7IA 3GOKA 1V0OA 1JSUA 5CT7A 5IA3A 3DPKA 3KK8A 4QQTA 3MB7A 1REKA 5LVMA 4YZNA 3ZRLA 4O22A 1UKIA 5I0BA 4PNIA 2FPPB 1XO2B 3R7OA 1Q99A 4K11A 3NAXA 5JGAA 3COIA 3GVUA 4IAZA 5DYJA 4NM0A 4BDIA 4MKCA 2FVDA 5HLWA 1YDTE 3FI8A 4TY1A 1YQJA 4X3FA 3NR9A 3FZTA 3C4FA 2JD5A 1K2PA 3FI4A 4D5KA 1NVRA 2E9NA 4ZP5A 4IDTA 2NRYA 1SVEA 4CGAA 2OFVA 3QD4A 1XJDA 4XMOA 4FE2A 2HK5A 1ZOHA 3SA0A 1GAGA 5HO8A 2ZDUA 1H0VA 3QWJA 3CC6A 4LFIA 3LE6A 4FI1A 4J95A 4EGQA 3L8XA 4GVJA 4J8MA 2ITTA 4FT0A 4R6VA 5JZJA 2BZJA 2GS2A 1KJ8A 4CFMA 2FSMX 1Q8YA 3OXIA 3LCOA 2PN1A 3W55A 1F3MC 4O81A 5EQPA 4FKPA 5AWMA 4BCQA 3FLQA 4IX5A 5AUWA 3C0GA 5HG7A 4BZOA 1XWSA 3LMGA 4ZOGA 4TN6A 1IOVA 2XNBA 5KMOA 1IRKA 2XS0A 3AT3A 1YDRE 4IVAA 3MY1A 5CY3A 2IZSA 4FKOA 3KAKA 4TWCA 4BTJA 3EN4A 4IHJF 5BVKA 3W10A 5TKDA 2XK7A 3B2TA 3Q5ZA 3PLAE 4IEBA 3PE2A 1GZOA 4JNWA 5CSVA 2RFSA 4JVGA 4KBKA 3S0OA 4XG8A 4YZ9A 2C6OA 3R9NA 4LV5A 1UNLA 1OVEA 2R3KA 2W4JA 2Y6OA 4N6ZA 4TZRA 2UZUE 3DY7A 4JG6A 5E8TA 1GZ8A 1YKRA 3RK7A 3P1AA 2I0YA 2YWVA 5A4CA 4U3ZA 1LPUA 3TNHA 4YZMA 4LUEA 4RJ7A 4KIPA 4CKJA 3TUDA 4HGEA 1Q8ZA 3OW4A 4YO6A 2NO3A 3EQCA 4O91A 4E1ZA 4F6WA 3RHXA 4XS2A 3TCPA 2F2CB 3CCNA 3S1HA 3PRFA 1JNKA 4EI4A 2WD1A 1P2AA 4CTCA 3AGLA 4GCJA 4BIEA 4GV1A 2BZIB 1PRYA 4PDOA 4E6DA 2Z7QA 2J50A 3LM5A 4W4WA 3OY1A 4KSQA 4E4XA 2XNGA 4WUNA 3ZCLA 3GCUA 4EZ7A 4EH4A 4O4JF 4DG0E 2EXCX 1E1VA 4R1YA 5M4CA 3ORPA 1IA9A 5HE2A 2YAAA 2ZOQA 4JDHA 5IQEA 2R3RA 1DIKA 2B53A 4EOKA 2JLDA 5A46A 4R1VA 1ATPE 3HDNA 2QO9A 4RIXB 3VUKA 2W17A 2XYNA 3PJ8A 3PPKA 3W32A 5KHWA 3EN5A 3ODYX 3BELA 4I41A 2IJMA 1JKLA 3FY2A 3BYSA 3BV3A 3F3TA 2Q0BA 2WU7A 2I40A 3H30A 3M11A 4KSPA 4NSTA 1J7IA 3KVXA 1KV2A 3E8CA 1M2PA 3FLSA 3VOTA 3NUNA 4IZ5A 4W8DA 3GU4A 4BDCA 5HLPA 3PYYA 4CMUA 4NTTA 2Z8CA 3WF9A 4CFVA 2FUMA 2WTDA 4M0YA 3WZJA 1JAMA 4RQKA 5CF6A 3FUPA 1EYZA 1LEZA 4C34A 3UIUA 3LXPA 3UIXA 4IAIA 2PWLA 3CQEA 2CMWA 5C1QB 1Y8YA 4FKJA 5DT0A 1OKYA 3HDMA 3FXWA 3T3UA 4OW8A 3Q4ZA 3QZHA 1WVXA 2UZLA 2W4KA 4CV8A 1R1WA 2OGVA 2PPQA 1UA2A 2QOBA 4YU2A 5JQ5A 1UU8A 3C51A 3Q9ZA 3FLWA 2EB2A 2QODA 4GT5A 3JUHA 3PXZA 4NKAA 2UVZA 5FEDA 4IADA 3ZFYA 1YOLA 1SZMA 5KBQA 3EN6A 4G3CA 3BYMA 4BYJA 2CZGA 1NVQA 4V01A 2R7NA 3VUIA 3AT2A 4ZZMA 1WVYA 5IUIA 2PVHA 3CE3A 2CKOA 4BCOA 2BDWA 3GIDA 3KRWA 3AC2A 5IA0A 4U44A 3VS2A 2CCIA 4QQJA 1YWVA 4DA5A 1JSTA 3WF5A 3MWEA 4QMZA 2EUFB 2R87A 3QTXA 1J1BA 2ZDTA 1QPJA 2Z7LA 3OMVA 1B6CB 2QG5A 3W2SA 4RFYA 3QUDA 4EC9A 3KEXA 4RIWB 5C8NA 4ZSJA 2ESMA 3ORXA 4F99A 3CKWA 2BAQA 2OZAA 2OZAB 3D2IA 4O27B 5IQCA 4PTCA 3SXSA 1UNHA 2V5AA 3ROCA 4OUCA 5ANIA 4IAFA 4BCMA 2HELA 3MFUA 4TRLA 1URCA 2WTKC 3A4OX 4EQMA 4AX8A 5HBRB 3HV4A 4FIJA 4C02A 3RPSA 3TM0A 3OWJA 1PKDA 3A61A 4XV1A 2J51A 4CZTA 4RZQA 5AV0A 5KBRA 3FMEA 2UW8A 4KWPA 3SRVA 3CXWA 4FIHA 4ZSGA 4Y83A 4IB5A 3FZOA 1NA7A 2W4OA 2DWCA 3L9MA 2XD4A 5J87A 3BYVA 2Z2WA 3A8XA 3LM0A 5CX9A 4PP7A 2PBZA 3TNPC 4YMJA 5ETCA 4AA4A 2PMOX 4U0IA 5AJQA 3I81A 3QYWA 2PVRA 4CFFA 2X4FA 2UZOA 4DG2E 4EOIA 2B4SB 4WBOA 5GHVA 3A4PA 1OKZA 5FNVF 3LQ3A 3R2YA 4TYEA 4XLIA 2QKRA 3JVSA 4F9BA 4JQEA 5C4LA 2JGZA 5IA1A 4PDSA 2YJRA 4FV1A 3E7OA 3P08A 4KKGA 3BRBA 4EBVA 2PVJA 4BBMA 3E87A 4IB0A 5C03A 5C8KA 4ZTRA 4FX3A 5HTCA 2E9VA 4BIBA 2VTJA 4DEAA 3VBYA 3D83A 4CCBA 4XV9A 3KREA 4CFXA 4CSVA 1PXKA 1RDQE 3DZOA 3UO6A 4J99A 3W16A 4FVRA 3F9NA 4DCAA 3HKOA 4QPAA 3PY3A 5KMMA 3OUKA 5T6KA 4EG0A 3Q1KA 3R7VA 4AN2A 4E20A 3SQQA 4DFNA 4JT3A 4PY1A 3Q5IA 5B7VA 4MX9A 4F9YA 4ANSA 3G51A 3QX2A 4IM3A 3PXFA 1WBVA 3DK6A 4C4IA 3DOGA 2WTCA 5AFVA 3EQBA 3A7HA 4RFZA 5ANEA 1MQ4A 4NCTC 5JGBA 5M56A 3FYKX 3ZOSA 5F20A 4ERWA 1G5SA 4C5AA 1BX6A 2GCDA 4TYHB 4FBXA 4Y72A 5JQ8A 5K4IA 2VGPA 2WQBA 2P55A 4YJSA 1ZYDA 3ZS5A 4HNVA 4ZJVA 4IVCA 5IU2A 3CJGA 1M14A 5FXSA 4APPA 2R3JA 3VQHA 2J4ZA 4EH8A 2FSTX 4ZOLF 5M44A 1AUVA 4N4SA 2JKKA 4H1MA 5JVDF 1ZMUA 1BL7A 3LIJA 4K1BA 3UIBA 2OJFE 3BQRA 4HQ6A 1LEWA 4I5MA 3TQTA 3OCBA 4H36A 3QQHA 4EEVA 1VZOA 4O86A 4BGQA 4FUYA 4UZDA 4CV9A 4IB1A 2B9IA 3KY2A 3R8ZA 4EONA 4TPTA 3A7GA 3B2WA 4FSNA 4KRDA 4QOXA 4C2WA 3OXZA 3ENHA 4PMTA 4NW6A 2VO0A 3OUNB 3TKUA 4V04A 4NH1A 4RIYB 3F2NA 1OPLA 2IVVA 4FNYA 1A06A 4XP0A 3FZSA 5KO1A 3LJ2A 4F6UA 1EUDB 3QZIA 4I6QA 3N4VA 4LRKA 3OUUA 4LRJA 3F3ZA 4XG4A 3EQHA 1BI7A 4ANMA 3R5FA 3MY5A 4OBOA 4WNMA 3VRZA 2VX1A 4AUAA 2WTWA 3BHVA 2BILB 4BN1A 1M0WA 5IQAA 3BGZA 3GNIB 3QZFA 4CZUA 5BQ0A 2LGCA 2OBJA 4GL9A 1U54B 5CU2A 4BBFA 2J0IA 3PXRA 2YIRA 3WE4A 4FV3A 2NP8A 2VQDA 3II5A 3EJ1A 1JQHA 2RF9A 4X2NA 5JKGA 2I0HA 3MVMA 2BZKB 1NW1A 1P4OA 2YITA 3ZSHA 5IEXA 3FHRA 2Y4IB 2NRUA 4FKWA 3Q6UA 1RE8A 2ETMA 2OK1A 4LUDA 2PMLX 4FG7A 4FG9A 4KA3A 5DG5A 4FVPA 4NWMA 5D12A 4RJ5A 4FC0A 1W82A 4L44A 5AX3A 3O50A 1GLVA 3POZA 4BCJA 5EHYA 2C6EA 4I6HA 3RUPA 3FXXA 4FFPA 1ZZLA 3BU5A 2PUPA 1KUTA 2JBOA 4KS8A 4X6RA 5HCYA 3I1AA 2WIPA 3FMJA 3Q2OA 4GKIA 4E4NA 4L3LA 5JMSA 4DEDA 3GCSA 1GSOA 4XLVA 4CT1A 2PUUA 4Y5HA 4DBNA 3V04A 2YIXA 4O38A 4OTFA 4FV2A 5BUJA 2Y4PA 5AIRA 3ZO1A 2Z04A 2PHKA 5DE2A 3VVHA 4Z7HA 1YHSA 3F3VA 4NFNA 3UG1A 1B39A 4ZTMA 3UYSA 4OTDA 3DLZA 4BDBA 3E7VA 4C33A 3TTJA 1OI9A 4I3ZA 3SGCA 4GFOA 1B38A 5EH0A 4CG9A 3Q32A 4FEQA 1RJBA 2JITA 1KOAA 4TWOA 4Y95A 4HNTA 3QRTA 2A1AB 1M52A 2YZNA 1IAJA 1U5RA 4E73A 1F0QA 1VYZA 3L9NA 3NAYA 3ZTXA 3ZZEA 4BDAA 2Z02A 1VEBA 2WMVA 4J53A 1ZOGA 2QOLA 2VWYA 3R63A 4MNFA 4FV8A 5DN3A 1PX2A 5IISA 3H4JA 4G9CA 1UKHA 4G17A 4QMXA 4JLCA 5CAOA 3R71A 4M9UA 4CTBA 4ZJIA 2X2MA 5EDQA 2I1MA 3O96A 2QVSE 3HVCA 4I0RA 5DBXA 2ZDHA 3IW8A 3VW6A 2W99B 3AOXA 3KB7A 5KMKA 1KEEA 4QQCA 3TNIA 5M51A 4N0SA 4JL9A 2BAKA 4CFNA 4RRVA 2OKRA 2F7ZE 4Y73A 2XKFA 3MIYA 3ACJA 4YZDA 1WFCA 3E88A 4XP2A 2OFUA 3C7QA 4JG8A 5HG5A 4A4XA 1RQQA 2H96A 1YXVA 4RFMA 3CGFA 4UYNA 3M42A 4IZOA 4YLLA 1TVOA 3SG9A 2R84A 4DGMA 2PE0A 3UNKA 3P23A 3KULA 5KKRC 4FEWA 3VAPA 3A7IA 1T45A 3F82A 5F95A 1YDSE 3TIYA 2QF7A 2YWPA 4LL0A 4DAWA 3MBLA 2IP4A 4UWBA 4ZQIA 3PPJA 2WHBA 5AP7A 2OJIA 2UZBA 4C4GA 1PXPA 4DHFA 5L2WA 5J1WA 4LGHA 1L3RE 2WEVA 3ZBXA 4RIOA 3D7TB 5LVPA 3PWDA 2CKQA 1V0PA 3RJCA 3JXWA 4FGBA 4O0TA 3BX5A 4RC4A 3JR1A 1OL1A 2PL0A 3NYNA 3OOGA 3RZBA 3OVVA 3VBWA 3ZSIA 2WMTA 4A9SA 4FSUA 1HOWA 3Q4UA 3LMIA 2C69A 5CASA 5ANKA 3D7ZA 3EQPA 2CNVA 2HYYA 2QCSA 3HA8A 5TOZA 5J9LA 4MXAA 4OT6A 4RIYA 3V8TA 3PZEA 2PU8A 5FD2A 1BL6A 2VR1A 4OTGA 5FUTA 2FSOX 4IIRA 3UNZA 3AX6A 4TKSA 5CU4A 2ZB0A 2VWZA 4CFWA 1PMNA 3OCGA 3Q52A 4AZVA 3TXOA 2YRXA 2A19B 1GIJA 2RG6A 2W71A 2CN8A 3G9NA 4EH6A 4JRVA 3D7TA 1ND4A 3VUDA 2RFDA 1GIHA 3PLSA 1FMKA 5D7VA 2R7LA 3LJ1A 3QBNA 4ZTLA 4A4OA 2NU6B 3MJFA 3QCSA 2R3MA 4YTCA 3UPZA 2ZVAA 3LXKA 3QRUA 2YDIA 4BCIA 3TIIA 3TI1A 1DV1A 2CGWA 1FPUA 3C0HA 2VU3A 2ZMDA 1O9UA 1WBOA 4MXXA 3ALNA 4NM7A 1UU7A 4Q9SA 2FP4B 2W6NA 3RV4A 1SCUB 4FSZA 2BTSA 2NU7B 2QLQA 1WVWA 4U9AA 5D7AA 5D9HA 1MQBA 2X6DA 4H05A 2R3HA 1H1PA 4GYGA 4HNIA 5DWRA 4I23A 3LLTA 5JH7F 1H8FA 2HZNA 2YS7A 3EMGA 3G90X 4C4FA 1P14A 3OZ6A 3GBZA 3OS3A 3ZLXA 4IIJF 2BMCA 3WBLA 3LXLA 4L7FA 4DEHA 3CS9A 1YHWA 5EHOA 4RJ4A 2BVAA 4L45A 3Q2MA 5CNNA 5IMXA 1FGIA 4JG7A 2XBJA 4YPSA 3R7EA 4E6CA 3VBXA 5AMNA 3TW6A 3HB9A 3GCPA 1YWNA 2FSLX 4NK9A 5IA5A 3R7YA 3FWQA 5M4IA 5BMSA 2W5AA 3KXGA 1S9IA 3TN8A 4L3JA 3OUZA 3U4UA 4CRLA 4X3JA 3TT0A 3TNWA 4UBAA 2HXQA 5DOSA 1MRUA 1PY5A 5AP1A 3TZMA 1JBPE 2X0GA 4ACCA 4F0GA 3NDMA 3QU0A 5AP2A 4FL1A 5FTGA 3D15A 3WI6A 4BDKA 5FRIA 3BQCA 4FR4A 3FDNA 1JKSA 4QRCA 3MSSA 2HOGA 4C38A 2GQRA 1JWHA 4FNZA 1ZOEA 4K18A 4L43A 3UYTA 3QA8A 4QTCA 4ACDA 3DKOA 2HY81 5J7HA 3DK3A 1DAWA 3ATSA 5B2MA 3MA6A 2H6DA 3WO0A 3PWYA 2WTIA 3BHTA 5DIAA 3WZUA 2J0JA 4XG3A 1YI3A 4GG5A 1OZ1A 2QO2A 4I6FA 4O21A 5EQEA 5J9ZA 4GYIA 4Q5EA 3R1NA 4AW1A 2OH0E 5EM5A 4IVBA 2XVDA 5DR9A 4D1SA 2JFLA 4WBBB 5FP6A 4C61A 4QMWA 3GFEA 5E91A 2BRMA 5IUGA 3MW1A 4U8ZA 4FK3A 3G8CA 2W1CA 3ORRA 3ID6C 4JDIA 1CDKA 1OPKA 3UIMA 3VW8A 1GSHA 3QZGA 4DH1A 2QOKA 3AD5A 2VWIA 4HZSA 3LW0A 4FV4A 2CN5A 5JN2A 1FVVA 4XUFA 3WF7A 2UW0A 4BGGA 2PSQA 4RIWA 3QRJA 1A48A 4FV7A 4QYHA 4RPVA 2RGPA 3NRMA 3RAKA 1PK8A 2X7GA 3VS3A 3TKHA 3S4QA 5A6NA 3ERKA 3UVPA 2ERZE 3CP9A 3E63A 4BDFA 4UYAA 1Q4LA 3EL7A 2XNEA 2XP2A 4HYHA 3CTHA 4USEA 3Q3BA 3GU7A 2XJ2A 1H28A 1HCKA 3F66A 3IKAA 2CCHA 3KXNA 4G2FA 3DK7A 4O82A 5E8SA 5FDXA 3RPVA 5LOVF 2HZIA 5ANJA 1ZYJA 3TZ7A 3ZONA 1LR4A 3V3VA 3EL8A 4YPDA 4RVTA 4XJ0A 3R73A 4AZSA 4F4PA 4JQ8A 1KSWA 4I5CA 4Q9ZA 3BEAA 1XBAA 2GS6A 1W0XC 1L8TA 4FEXA 4RA5A 2UW5A 4PMSA 4W4XA 5ETFA 3CBLA 4WSYA 4Q5HA 3V5PA 4EBWA 5A4LA 3E3PA 3NUSA 4I0SA 2QURA 3JYAA 4RMZA 4LGGA 1PMEA 3IOKA 4AGCA 5EQYA 5AAEA 5L2TA 4L53A 3OCSA 4QYEA 4IDVA 2QU5A 4K8AA 2CLQA 2YISA 1URWA 3TZ8A 5A4QA 3DJ7A 3MS9A 4XZ3B 5CEMA 4GIHA 2WTVA 5DR2A 2F2UA 2PE1A 4WIHA 3RCDA 4WA9A 3HV5A 2XNMA 4O0XA 3E62A 5L8KA 2VNYA 4G9RA 5KUPA 1CKPA 2GTNA 3KCKA 2VTTA 3F61A 4GW8A 4FTUA 4HYSA 4KABA 1Y91A 3EN9A 4Y85A 4DTKA 3VMMA 3VS7A 4FSWA 3ZUUA 5HVJA 4FOCA 3K5VA 4FKTA 4L52A 4E4MA 5KZIA 2B0QA 1YXXA 4MK0A 3SVVA 3QQFA 3MGYA 3LFSA 3MIAA 3AC8A 4NZWB 3TDWA 5BPHA 2UW4A 1IG1A 3KU2A 2PULA 4DE4A 4OTWA 2I0VA 3TG1A 1SMHA 2BRGA 3RKBA 4Z16A 4CCUA 3ALOA 3OHTA 3T3VA 3VF8A 3PE1A 2GPWA 4R77A 4G3DA 2V7AA 4F1TA 3CEKA 4X2KA 1IAHA 3D5WA 5CALA 4FSQA 2ZM1A 3D9VA 3U9NA 3MI9A 3KXHA 4BR3A 1YXUA 4LG4A 4B8MA 2W6ZA 2F7XE 2VWXA 4F64A 3IDBA 2VWVA 2V58A 4MXZA 1JKKA 3BHHA 3HEGA 3QHWA 3Q04A 1Y6BA 1ZRZA 3AC5A 4G3EA 4LV8A 3QRKA 3N4UA 1CQIB 3CR0A 1XKKA 4ZAUA 3MWDA 3KQ7A 2J9MA 3NW6A 4AZWA 4BCGA 4HYIA 3NS9A 2XK9A 4WNKA 2HAKA 3O71A 4Z55A 1J3HA 3ORZA 4MH7A 4IC7A 2JBPA 3PZHA 3BYOA 4K2RA 3PFQA 3HYHA 5F9EA 5KMLA 4X7QA 3E64A 3T9IA 3RGFA 1VKZA 2ZB1A 5CLPA 4I20A 2X7FA 2C5VA 4TT7A 4ZHQF 4F9AA 3F2AA 3NUXA 3RAIA 1T36A 2G2IA 3TJDA 3OWKA 4I4TF 4FTCA 4QP4A 4BICA 2V55A 4F7NA 4MV4A 3QTSA 1XQZA 1O6KA 2GHGA 4UEUA 1I7NA 1PKGA 2WOTA 2RKUA 3R1SA 4DG3E 1W96A 5BYLA 4EYJA 4IANA 3NCGA 4LRMA 2FO0A 3R8UA 5IPJA 4P7EA 1LP4A 2OICA 4QQ5A 3V6SA 3QCXA 4BTFA 2O2UA 2C6KA 3IW7A 4PMMA 2E9UA 1J7UA 5JGDA 3CPBA 2B54A 4JAIA 2JEDA 4AGDA 2E9OA 2NPQA 4LOOA 5M55A 2WTJA 4RWLA 1OMWA 1SYKA 5EI2A 3UNJA 4BF2A 2UVYA 5IH4A 4FKRA 2C0OA 5AP4A 2YIYA 4G31A 3UGCA 3FXZA 5CF8A 3E8NA 3FLYA 4C4JA 2PVNA 4MV7A 2HW6A 4FZAB 5DNRA 3BV2A 1UVRA 3UZTA 4R7BA 2R7KA 3R8VA 4YBZB 2VTIA 3MVLA 2OU7A 3NWWA 2IVSA 2UZNA 5HIDA 4FICA 1AQ1A 4NM5A 5TF9A 4FIIA 3VIDA 3VS4A 4UV0A 5I9XA 3ETAA 4OGRA 4W4YA 3VS5A 2XA4A 4AZTA 2PZRA 1KE5A 3N51A 3GGFA 4FV0A 4BCPA 2GNFA 2NUAB 4G6NA 2J7TA 2PVPA 2R85A 3U54A 3F7WA 3VF9A 3R04A 2RFNA 3F88A 4F65A 2W6PA 2WYOA 3CD8A 4GFMA 4RVMA 2Y8OA 5GIOE 2Y9QA 4F09A 3NVKI 1M7QA 2EXMA 5IG1A 3FMKA 5C01A 4FZ7A 2OO8X 1J91A 3COMA 1M2RA 4FODA 3U6JA 4MV1A 2OF2A 3NIZA 1XH5A 2V5QA 2QOOA 1P4FA 2VTLA 4P2KA 4BKJA 3ORNA 1AGWA 2BRHA 2XK6A 3HMIA 3UOJA 4J1RA 3ZU7A 1BLXA 5IDNA 3R2BA 1V0BA 2WKMA 1KC7A 4H3BA 1IASA 3PSCA 4L46A 4L8MA 4NCTA 4BI2A 2HZ0A 2W6OA 4CEGA 3L8SA 5L8LA 3GI3A 4EOMA 4C58A 2Z7SA 5J8IA 4J71A 3TUCA 4QNAA 4HGTA 3PY1A 5E8XA 1KBLA 2VUWA 4GU9A 5AA8A 5GNKA 4AG8A 4FYNA 1JLLB 3FPMA 4M15A 3ZRKA 5K5NA 4GT3A 2WMXA 3SD0A 3DBQA 4EOQA 4QMQA 2BZHB 5IDPA 2W0JA 5TO8A 1KE8A 4D55A 5KHXA 2W1HA 5J9YA 5DRDA 4EHZA 4MWIA 4BB4A 1BMKA 1KOBA 4RG0A 5DPVA 3VWAA 4JQ7A 5LXTF 4F0FA 5LWMA 3VHEA 4JIAA 3BPRA 2G01A 4IE9A 4MEDA 5B2KA 2OIDA 3EN7A 3KXZA 3QYZA 4HPUE 4UALA 4KKHA 1GOLA 4F1OA 3C1XA 5CEQA 1ZMWA 3PVUA 2QR8A 3RM7A 3A7FA 5E4HA 4D2SA 3PVBA 5JSMA 2Y4IC 4XCUA 5FBOA 3FLZA 4EHGA 1R0PA 2QHNA 3DGKA 5CNOA 3NYXA 2OJGA 4YLJA 3OCTA 3R7UA 3AMAA 1WZYA 2REIA 4XOYA 4G16A 5CXZA 3OBJA 3RVGA 3GT8A 3RPYA 2JKMA 4BZNA 3MH2A 5IA4A 4X2JA 4FSYA 4YP8A 4XRLA 4AT3A 3OT8A 2I6LA 5HD7A 2X0SA 5CU0A 2PK9A 3DQWA 2UW7A 2R9SA 2W1EA 4F1MA 3LFEA 3QTUA 3EFWA 4B8LA 1SVHA 5BYZA 3SC1A 1OUKA 3KCFA 4KS7A 4OTQA 4XG7A 4AZEA 4E5WA 2J0MB 4PNKA 3UDBA 5LP6F 3GUBA 4XBRA 2UW9A 4PDYA 2PVYA 2UV2A 4OBQA 5DI1A 5I9YA 2OJ9A 4L00A 4BCNA 3GLKA 4QMYA 4E93A 1FGKA 3SDJA 3FSKA 3SXFA 5HQ0A 2QONA 3QLGA 3IOPA 4UN0C 4PUZA 4R3PA 3DU8A 4MWHA 3RAWA 3VPBA 3NCZA 2RG5A 5BUEA 3DB8A 4MTAA 3JRWA 3UFXB 3P86A 2W96B 3SE7A 3ULIA 3R8MA 3FYJX 3ET7A 4EYMA 5DT4A 4C3FA 4D4VA 5FTQA 4R5YA 2CSNA 2HWPA 1KJJA 5AEPA 1BUHA 3MPAA 2UZWE 2WXVA 2ITYA 5JVLA 4J97A 3QQKA 3H0YA 4ZLOA 2V7OA 2O63A 2ONLA 3QQGA 5EW9A 1OIUA 3ORQA 4B4LA 5G1XA 2WTKB 3DA6A 3IS5A 4ITIA 2BFYA 5A4EA 2NU9B 4ZSAA 5M57A 5EOLA 4IW0A 5LJJA 3EKKA 2P33A 4WOVA 3HRBA 4D9TA 2C0TA 3OROA 4O0YA 4DCEA 4X3FB 4EK5A 4WBNF 5CA0F 4HVIA 3QLFA 3OTVA 1BI8A 4S31A 1JKTA 4IHPA 2PYWA 4DFXE 1M17A 5ACBC 5HBHA 4EH7A 5CAQA 1NT2A 4IQ6A 4U6RA 3RPRA 4AU8A 3C4WA 4PWNA 3UO5A 3U9TA 4RJ6A 1MP8A 2QI8A 3FL5A 3TINA 1WBWA 1OKVA 2QO7A 5EI6A 5HG8A 2KTYA 3O8UA 5M4FA 3TUBA 4YAJB 2PMIA 3G33A 4DIMA 3QGWA 1Z57A 4QMPA 5HG9A 1JSVA 3RK9A 4YJ3F 5L6PA 3QUEA 3PA4A 2AC3A 4KB8A 1Q8UA 4O0SA 4ME6A 5FM2A 3PVGA 5H8EA 4EL9A 3QALE 2C6MA 3K3JA 4AF3A 3VNTA 5H8BA 3FKLA 5DT3A 1LUFA 2YM6A 5HE0A 1YHVA 4YBJA 3G0EA 5EFQA 3P7AA 4DFUA 5JFSA 3P78A 3BIZA 2PVFA 2GNGA 3D2KA 3PA3A 3PRIA 3ETHA 3LQ5A 3FI2A 5AV3A 4RLKA 4CRSA 2WIHA 2PE2A 3I5NA 3QXOA 4I4EA 5CZIA 2XCLA 2YZGA 3IGGA 2JIIA 5H3QA 3N8DA 3LKMA 3UP2A 1JOWB 4FEVA 2GNLA 2WMRA 5IEYA 2XEYA 4YAKB 4ZS4A 1UNGA 4YJTA 2ERKA 4GJ3A 3SW4A 5T68A 5I4NA 1CQJB 4FFRA 1YXTA 5AAGA 2BUJA 3M1SA 3GXLA 4U7ZA 3GENA 3A7JA 1STCE 3C5IA 1ZY5A 3C13A 3HX4A 2O8YA 3KGAA 5AP0A 4ID7A 2F49A 3EWHA 4BYIA 2XIXA 4EUUA 3FZRA 4J52A 3LCDA 3LFNA 3L9LA 1CKIA 2XF0A 2YM7A 4FV6A 2JC6A 4RX7A 3ORIA 3ULZA 3BKBA 3ZC5A 4D1ZA 3R8LA 1GSAA 3S95A 3O8PA 4EC8A 2OZOA 4QT1A 4C4HA 3NNWA 4O96A 3FQSA 3DXQA 2PUNA 4G34A 3R8PA 3RFCA 4Y5QA 3TV6A 4HPTE 3VC4A 2PZ5A 3WNZA 2B1PA 3RI1A 2ZDGA 5JQWA 4GIIA 3OTUA 3KN5A 1FINA 3S00A 4O2BF 4NYEA 4ANBA 4ANQA 3MTFA 5BVDA 3NW5A 3VHKA 3R28A 2HZ4A 2W7XA 3UOHA 2W6QA 1QPCA 4BIDA 4GH2A 4GFGA 5EDPA 3F69A 3R6XA 2A0CX 2XMYA 1SM2A 3DFAA 5AP6A 5HLNA 1PXMA 5CSXA 3NW7A 4N6YA 3ITZA 2W5HA 4R7HA 3KA0A 2BDJA 2ZV2A 2R4BA 1REJA 1ZLTA 4FTMA 1ZZ2A 5AAFA 3HMNA 4UX9A 4JBVA 5L3AA 2YZMA 5KNJA 2OI4X 2YCFA 5LMKA 4V0GB 2WEIA 4O4LF 3NNXA 2JIUA 2ZAZA 3NEWA 2BCJA 2YZLA 2BHEA 5CAEB 4DGOA 2VTOA 4YZCA 4XX9A 2XM9A 3BE9A 4XG2A 4XYLB 3RWPA 4EJNA 4X21A 4DT8A 4ZMFA 3R21A 3FZ1A 2W6MA 3LFBA 4C2VA 2DZDA 4V0GA 1EH4A 2XK3A 5BX0A 2WQOA 1QPDA 5GONF 4H3PA 1I09A 3H9RA 4GK3A 2YW2A 5K3YA 4DFLA 3V51A 1TQMA 3VBQA 3ZUVA 2DQ7X 2R0IA 2VO3A 4EHVA 3ANRA 5L6OA 3KN6A 1O6LA 2B9HA 4RX8A 5HORA 2I8CA 2W70A 3WYXA 4P5QA 2OH4A 4CLIA 4FTNA 2R5TA 2ZM3A 4U41A 3PY0A 2VTNA 3QD2B 4U40A 2YCSA 3KXMA 3KMMA 3BWFA 5AP5A 4EK4A 3PTGA 4G1WA 4EK8A 4IMYA 2QQ7A 4II5A 5FLFA 3IDCA 3P0MA 4FSRA 3PP1A 1A9UA 3UOLA 2CPKE 4YUQA 2XYUA 4HCUA 2I7QA 4JR7A 4QTDA 4D4RA 4L6QA 4ALWA 3C0IA 5EYMA 4HCVA 4IWDA 4AOIA 4ZTHA 4ZZOA 3DKCA 4IH8A 4IZAA 3R5HA 5IYZF 3LWBA 3ENMA 2WAJA 3RCJA 3ZBFA 1APME 2ITOA 2QG7A 3EB0A 4DLKA 1G8AA 1WBPA 2P2HA 3LOKA 5DHJA 3RNIA 3TIZA 5KCVA 5E1EA 4J98A 1Z5MA 3JVRA 2BDFA 5M4UA 4C5CA 2IW9A 2FPGB 4AGUA 2Q83A 5EYKA 4EOSA 3NPCA 3W2CA 2GHMA 5C1PA 3QQLA 4JS8A 4S34A 2W1DA 3HAMA 4A9RA 5LCKA 3HA6A 4U79A 3MVHA 3CSVA 5CAUA 4HW7A 5KMJA 3NGAA 4XG9A 3R23A 4FSTA 2WMBA 2UZTA 4P90A 4D4SA 3SV0A 5CVFA 4MQ1A 4APCA 3VULA 2DIKA 3A8WA 3C5UA 4WG3A 4MD9E 3POOA 5I5ZA 1CE8A 3U6IA 3D5UA 1DAYA 5I9WA 3QKMA 3DTCA 2J6MA 3LXNA 5CVGA 3LFCA 3VS6A 4BRXA 3I12A 4QMNA 5M06A 4XX0B 4F70A 1B6RA 4GEOA 4JR3A 3IO7A 3V5LA 2XIRA 2GNIA 4AOTA 2XH5A 3HV6A 2B9JA 3RALA 5KX5F 4LOQA 4FKGA 1Q3WA 3P79A 4PTEA 4I0TA 4QP9A 1VYWA 1W8CA 4BBEA 5J5SA 3ZUTA 2OJJA 3R22A 3CY3A 3FBVA 5FM3A 1NY3A 2C30A 2DYLA 4ZLYA 4RVLA 4MA5A 4NTSA 4QMTA 3FAAA 2OWBA 2R3IA 4XG6A 3VS0A 1R39A 3QCQA 2R0UA 4FKIA 1PXLA 2IVUA 3AC1A 3WARA 1BYGA 1V1KA 2HW7A 2OIBA 3QX4A 4PX6A 3QFVA 1VBHA 3WOWA 2BR1A 2R7IA 3MDYA 4KNBA 2XUUA 2E9PA 2XKEA 2BRNA 4O6LA 5J95A 3PG1A 4MAOA 4L01A 4NW5A 2XNNA 1H1WA 4Q2AA 3K54A 4YJUA 3EQDA 5CENA 3IG7A 4UY9A 1JLUE 3PVWA 3ZZWA 4EK3A 2J0LA 4TNBA 1BXRA 3OG7A 5HV6A 1W83A 4FZ6A 3AXWA 1H07A 3VPCA 2HENA 3AD4A 4RWIA 4DGLC 3FMMA 3KL8A 4MXYA 4C4EA 3LFDA 5E1SA 2XCHA 4DEEA 3HV3A 4K0YA 4DC2A 3AMYA 5BVOA 3DLSA 4FIGA 2IW6A 3HLLA 3ZHPC 3OP5A 5IUHA 4NKSA 1W84A 1ZWSA 3I7CA 2RFEA 4RGJA 3BHYA 3O8TA 1J1CA 3QF9A 4KIQA 2C1BA 4PL4A 4YJPA 5H2UA 4RJ3A 2HXLA 2CLXA 4U81A 3HNGA 2ITNA 3MH3A 4LL5A 4RC3A 4ZEGA 4C3RA 4DEBA 4ENXA 2C5NA 5FG8A 5FQDC 3R9RA 4C35A 2ITXA 2F4JA 5CEKA 4E5BA 3GC8A 3JZFA 2ITQA 5I9UA 3E5NA 4GT4A 4HNUA 3EHAA 3SRVB 3UMWA 5H9BA 3Q9XA 4FTJA 2ITWA 3MH1A 4YJVA 5K4JA 2VTHA 3DAJA 1VR2A 4O84A 4G6OA 1H0WA 3MTLA 2QD9A 3P4KA 5A3XA 4JJRA 4MA0A 2HJWA 3PDTA 1H1QA 3IW5A 5HHWA 2YM3A 4DH3A 4FIEA 2Q0NA 4W4VA 1GIIA 3FPQA 4MV3A 4FIFA 4FNXA 3D5VA 4FV9A 4HVGA 4YTHA 1SNXA 4GS6A 3FE3A 3R9HA 4C5BA 4FKUA 3LAUA 1SVGA 3LVPA 4AN9A 3NX8A 2XIYA 5JFVA 3HP5A 3QGYA 4GSBA 5LVNA 3OF0A 2I0EA 3C4XA 4RT7A 3W2QA 3GCVA 1ZY4A 2XZSA 2X7OA 4ZSEA 3SXRA 4FT7A 4BI0A 4F7SA 1IEPA 4MYGA 3QRIA 2YABA 2EB3A 2B9FA 2FA2A 2C5YA 1XBCA 2P0AA 1KE9A 1PXJA 2C5OA 3MVJA 4YLKA 3VJOA 1PXOA 3DKFA 1KJQA 4FYOA 3I7BA 3O17A 1DI9A 2ITPA 2Y7JA 4LI5A 4G5JA 2WZJA 1IA8A 3K2LA 2BFXA 5CEPA 5CT0A 2FYSA 4CFUA 4H3QA 4S33A 2HIWA 5EM8A 5IQIA 3W2PA 1R0EA 1Q62A 5GJDA 4BCKA 3F5UA 3C4CA 5F94A 5KZ0A 4B0GA 4EH3A 2YFXA 4RA4A 1OGUA 4FKLA 3G5DA 3MJ2A 4IJ9A 2GNHA 5C9CA 5M07A 2QOFA 4DFZE 3ZFXA 1Q97A 5A9UA 3QUPA 4EZ5A 3N6RA 2YM4A 2R3FA 5AA9A 1ZMVA 1M7NA 3FV8A 3OT3A 4YHTA 5J2UF 4U80A 2GNJA 3HMPA 4RVKA 2BTRA 4E5AX 5ANOA 3KRLA 5JFXA 1Q8WA 2R82A 5D8DA 2ZV9A 3E93A 4QP1A 3F2RA 3NUAA 4OBPA 2XNPA 4RZVA 5L2IA 4USDA 2R3NA 1W98A 2XKDA 2WQNA 4ZZNA 2YS6A 5A6OA 4I93A 2JDRA 4K6ZA 5CYIA 5DH3A 3NVMB 3QWKA 4GRBA 5IQBA 3DV3A 3EIDA 2W1FA 3AT4A 3U51A 1Z2OX 4AE9A 2VPQA 3G8DA 1AD5A 1TKIA 4MVFA 4ALUA 1OIYA 3QKLA
chains in the Genus database with same CATH superfamily
3JY9A 5CU3A 2BPMA 5CA1F 2WMAA 3DZQA 4O0RA 4B7TA 5DGIA 2PTKA 3W1FA 5D11A 1FBNA 3ZLYA 4TW9A 5HE1A 4KUJA 3VQUA 4F7JA 1OL2A 4GKHA 4M12A 5A4TA 3P7BA 3QL8A 3W2RA 5I5XA 2OLSA 4XNEA 1JDBB 5JRQA 4ZTSA 2VTSA 5FDPA 3MB6A 4LM5A 5LYJF 4ZY6A 4NZOA 4ITJA 3D4QA 3ZLSA 3EZRA 5DGZA 3TL8A 3N4TA 5BVNA 4C59A 1H24A 4YJOA 5IZFA 1C30A 4MV9A 5FR9A 3QTQA 4X3FC 1ST0A 1YVJA 2XALA 2OLCA 3AMBA 4QMVA 4ALVA 1ZXEA 4QP7A 2ACXA 3PIZA 4PBCA 4RZWA 2Z7RA 4FTIA 2J90A 4C62A 3R9OA 4DH7A 2WFYA 3ZM9A 2O65A 3PP0A 5CS6A 5CVHA 4ZMEA 1WBTA 4DGGA 4WRSA 4IX4A 2VGOA 2VV9A 3GEQA 1V9PA 4ASXA 3OWLA 4X6QC 4KIOA 4FTOA 2BIYA 5HIBA 5IH5A 2C68A 2E2BA 4M67A 1OIQA 3BLQA 3HUBA 3K3IA 2COGA 4UXLA 3R00A 5H80A 5AM7A 3UZRA 3KAJA 1KV1A 3OEZA 4JDKA 4KKEA 5E8YA 4A7CA 3RV3A 2BHHA 3FC1X 2G1TA 4E4TA 1OB3A 2X8DA 3QC4A 5LMKC 4EHEA 4TYJA 4ZI7F 3DT1A 4JI9A 3UC3A 5EKOA 5ETIA 3GC0A 1OBDA 2XNOA 3TWJA 4AT4A 4USFA 4U42A 4IAYA 1JKJB 3K5HA 1ZYCA 5C1OA 2O5KA 4L3PA 3F5GA 3CIKA 5C27A 3LP8A 3R01A 2X1NA 3CLYA 4TWPA 4WRGA 3BLAA 5AIKA 4BC6A 4RX5A 2HGSA 5CU6A 4XYMB 4CKCA 2IWIA 1FVTA 1PYEA 2OF4A 3DB6A 3V8SA 3W0NA 3OY3A 4X2GA 1K9AA 4Z3VA 4H39A 2CGVA 4ARKA 3GCQA 4I1ZA 4BCFA 1GGOA 5L8JA 1Z2NX 4F9CA 4YB8B 4BI1A 3DNDA 5BUIA 4PF4A 2YERA 3WZEA 3DDQA 2C00A 2PUIA 3ANQA 3Q9WA 4AW0A 1U59A 5IF1A 3HO8A 4MNEA 4ZXTA 4F6SA 3KXXA 3RM6A 2R7BA 3DBCA 3R1YA 4EORA 3RNYA 1YOJA 3K3PA 2GHLA 3ZSGA 4O4IF 2YHVA 3DXPA 3ORLA 3MFSA 3IW4A 4D9UA 4I4FA 4RSSA 4E6QA 4ENYA 4CKIA 2P4IA 5I5WA 2O0UA 3CTQA 3TKIA 1WBNA 2GLTA 4NFMA 3KALA 5CWZA 3EQGA 3QD0A 4FV5A 5HX8A 1VBGA 5EM6A 3WE8A 3FMNA 4P4CA 1OBGA 5DVRA 3DAAA 5A54A 2GPSA 1PYXA 4JBPA 3TIGA 2ITZA 3DAEA 3NUPA 3IECA 4GUBA 4HOKA 2C4GA 4EKLA 5I9VA 4YBKA 3RK5A 3IPHA 2VD5A 4AZFA 5EI8A 4NJDA 3CD3A 3DXNA 2QLUA 2GMXA 2W1IA 2QHMA 2CJMA 3BBWA 4TXCA 4CMTA 2J5FA 1XH8A 2ONLC 1PHKA 4PV0A 4S2ZA 4A4LA 4MBLA 3LPBA 3DNEA 3BU6A 3EH9A 3O51A 3DKGA 1PXIA 3WZDA 4ZJJA 4FTLA 1GNGA 1O6YA 1E4EA 4Z7GA 3GC7A 5CF5A 2HVQA 3FMHA 3QFFA 4DBXA 2C1AA 2CGXA 4YURA 4FKSA 3F3UA 4IAKA 5C4KA 5LMBA 4PL5A 5KKNB 5DAAA 5J2TF 3C4EA 5EDRA 4JX3A 5K9IA 5BYBA 4DRFA 1Z2PX 2YM5A 3D94A 3MFTA 4QMOA 1TQIA 5KMIA 1OIRA 3BWJA 4JIKA 2JKQA 3EQRA 3FKNA 1KWPA 4UB7A 4N57A 4TWNA 4WO5A 5M08A 1KJ9A 2CGUA 4D4YA 2BIKB 3BZ3A 1H1RA 4JXFA 4EUTA 3K5UA 3DBEA 4YJRA 3LLAA 4F7LA 5CANA 3W5OA 1CKJA 4FNWA 3UQFA 3KRRA 2DS1A 4HZRA 3EFJA 4NIFB 2JDSA 3EOCA 5CSPA 2YZAA 3R0TA 4MXOA 4FFMA 5CE8A 3ORMA 4D2RA 4S32A 3U4WA 3UE4A 1ET0A 2PVKA 4IWOA 1H25A 3I0OA 5F4NA 4K9YA 4C0TA 3OW3A 3U87A 3NNUA 2WMSA 4LQMA 1Y6AA 3NYVA 4FTTA 4UZHA 2B7AA 5FGKA 5HCZA 4A06A 4AA0A 4FL2A 2KULA 2JDTA 3KMUA 2W1GA 1OL6A 1PMUA 2VWBA 4FTAA 4MHAA 3T9TA 3REPA 3NSZA 4EOJA 2WNTA 3NYOA 3ZH8A 3MV5A 4ZK5A 3UC4A 4BDJA 4FA2A 4O2AF 4JAJA 3UJGA 4MBJA 3GFWA 3BYUA 4J8NA 4AFEA 5HO7A 4JOAA 3LCSA 4JBQA 2IPXA 5BVWA 3R5XA 2Y0AA 5DLSA 5C8YF 4BDGA 2ZDQA 1GJOA 3UVRA 2YAKA 3GP0A 3UTOA 5EYDA 4XRJA 3QTIA 3U8WA 3SW7A 3VN9A 4DGNA 2R3PA 2OXDA 4NT4A 2OW3A 2W9ZB 4MF1A 3G9LX 3VUGA 4AT5A 5BNJA 5BPYA 4QTEA 2YL2A 1R78A 4KRCA 4DN5A 4N70A 4QMLA 3BLHA 3S3IA 3VO3A 4HJOA 3ELJA 3HV7A 4AW2A 5D41A 4ZS0A 3PSDA 4YJNA 3KF7A 4I22A 4YC3A 1OL7A 4RC2A 3FSFA 4I24A 4QTBA 1XH6A 2VTAA 3PJ1A 4FGRA 4AS0A 2AC5A 3TACA 3LMHA 4GU6A 3OFMA 3Q53A 4NM3A 3HECA 4OTIA 4PTGA 5E8UA 3NIEA 2CHLA 2YJSA 2IZRA 3NFGB 3OOMA 4FKVA 4HYUA 4AE6A 5IH6A 4RWJA 3T9CA 3PXKA 3HP2A 5FBNC 3TNQB 5E25A 1Q3DA 3T7AA 3KRJA 4V05A 4CMOA 4CKRA 2YDKA 1CS0A 4CVAA 3GOPA 4TYIA 5EHLA 3ZC6A 4YJ2F 3I60A 2XJ1A 4IC8A 4HNFA 4EWHA 3NC0B 2HVRA 2HGXA 2VTMA 3WIGA 3CQWA 3NBZB 3KVWA 2W06A 3B8QA 4AN3A 4C36A 1C3OA 4FU0A 4YTIA 3U6HA 1KT8A 5CSWA 4M84A 3I6UA 3TZ9A 3B8RA 2P0CA 5K3WA 4DFYA 5AM6A 5HNBA 5HIEA 2DABA 4LOPA 2X9EA 1GZNA 5G6VA 1WBSA 4BZDA 3COKA 3L1SA 3M2WA 4KD1A 4Y8VB 3ZFMA 5BVFA 4GK4A 3ZEWA 1EZ1A 4GK2A 3PJ3A 1H27A 5EOBA 4DEIA 4C3PA 3OWPA 3ZO2A 1WR2A 3PUPA 3QXPA 4NJ3A 4YTFA 2BAJA 5FXRA 5CQWA 5I5UA 4E8AA 4BCHA 1H01A 2PY3A 2UZDA 2EVAA 2X2LA 5FTOA 5JRSA 1AUXA 2C6TA 4D1XA 2R86A 3T9AA 3U9CA 3EYHA 5CI6A 3QQUA 3SOCA 2XIKA 3FEGA 3JPVA 3QCYA 2JFMA 3DBDA 4MBIA 4YGAA 5AUZA 3R83A 3SG8A 4C37A 2C0IA 3SHEA 1XDNA 3BGPA 4XOZA 1ERKA 4ACHA 3V5QA 5AUYA 3R7IA 1BKXA 2G2HA 3WF8A 5A14A 1Y57A 3UQGA 3ZLWA 2QNJA 4DINA 4TUYF 2WMUA 3VBTA 3VJNA 5HEZA 2YIQA 3CY2A 3V01A 4G6LA 1I44A 3HMMA 4X0MA 5IA2A 4RQVA 5I47A 4RX9A 5AUXA 3NNVA 5HESA 3SKCA 5CI7A 3I6WA 4F08A 5JH6A 3T9BA 3HUCA 3VUHA 2FH9A 3LCTA 4NU1A 2F9GA 4YJQA 3DCVA 1HCLA 2IZTA 4PDPA 5D1JA 4DH8A 4LMUA 4O7ZA 2C5XA 1YI6A 3H0ZA 2HWOA 3HMOA 3A60A 4O7LA 5FEQA 5IQHA 1CSNA 1TFFA 1SNUA 1YXSA 4XEYA 5EK7A 2ZGIA 2C3JA 4AW5A 3NUUA 5KX8A 4B9DA 4EJ7A 3CGOA 2VNWA 4JX7A 4NUSA 5HVKA 3NLBA 4WNPA 4WHZA 4EOOA 3R1QA 2O64A 3QQMA 3QC9A 2W9FB 1E4EB 4QMMA 1EKVA 4QP3A 3L2PA 3EQFA 5LARA 4LMNA 3WILA 4AXFA 1QPEA 2GFCA 5AV1A 4MQ2A 5AV2A 2C47A 2HY0A 3OEFX 2XK8A 3QA0A 3MWUA 2AEGA 4YZBA 2DWBA 5TR6A 3VRYA 4IACA 3VS1A 4F63A 3NMUF 4O7TA 2VWUA 3P5KA 3QTZA 1XH9A 4OT5A 1BNCA 3NUYA 2QKWB 5AUVA 3TJCA 2QR7A 4BDDA 4BTKA 4F0IA 2SRCA 2IO6A 3LQ8A 4DT9A 4BTMA 4AAAA 2DLNA 2C3IB 3UYYA 4O0VA 4YSMA 4ASDA 5EYCA 2WB8A 4GLWA 2BKKA 2O3PA 5CM0A 1JPAA 3EFKA 5JK3A 1QMZA 4M3QA 3AD6A 2YN8A 4IBMA 2X9FA 3IGOA 5AV4A 1FVRA 2VO7A 3I79A 3WYYA 4F9WA 5CEOA 3ETJA 3P9JA 4FKQA 3PJCA 2W5BA 4G3GA 3PFFA 4QDEA 4MNEB 2A2AA 2GPHA 3UZPA 3JSNA 4EQUA 3A62A 1J7LA 3WIKA 2OSCA 3VA7A 4BHZA 4EK6A 2P2IA 1B6SA 5AX9A 1XR1A 5LVOA 3Q4TA 2ODTX 1DI8A 2UW3A 3WZKA 3N9XA 3EYGA 3KKVA 4ORKA 3KFAA 4OTHA 5HI2A 4FZDB 4QP6A 5DFPA 3W8QA 4BDHA 4L67A 4DLIA 4M0JA 3GQIA 3JS2A 5CQUA 3IONA 1H26A 1XBBA 2VTRA 2X4ZA 1QCFA 2VX3A 3HAVA 3MPTA 3QQJA 4L68A 4M97A 5FP5A 4DHJA 4CLJA 4EH2A 4EOLA 4LYNA 3GC9A 4BDEA 2A27A 1IYDA 5AADA 2UUEA 4CNHA 5IMEA 5LOHA 4FTQA 3PG3A 2IW8A 3A99A 3GU8A 3RHKA 4EKKA 3AW8A 3FHIA 3PN1A 4UCVA 3FY0A 5E90A 4XP3A 4YO4A 1E1XA 1OECA 3LZBA 2C6LA 3QD3A 3TW7A 2WELA 1FMOE 3COHA 1OGYA 2WO6A 5ANGA 1XHAA 2FB9A 4WUAA 3CKXA 3MFRA 3ORKA 4FFNA 4FVQA 2H8HA 5JQGF 5CAVA 3AGMA 2C6DA 3ZYAA 4AOJA 4QYGA 3UODA 4DLJA 3PXQA 1PMVA 3GU6A 4M69B 2UW6A 4ACGA 2XM8A 4WT6A 4EH9A 2OWOA 5LXMA 3FMDA 4QNYA 2GQSA 3BI6A 3QTWA 1X9NA 4DITA 4RIXA 4YR8A 5HICA 3ZEPA 3ZM4A 2IVTA 4Q4DA 3QKKA 1H1SA 3I5ZA 2JKOA 2HCKA 2XEZA 3JZIA 5BWXA 2GQGA 2OIQA 3G6HA 2ITUA 2IN6A 5IQDA 5JEBA 2VTQA 5E9EA 4U3YA 4AFJA 2CDZA 4HCTA 1EKFA 1CTPE 4H58A 2V59A 3HRFA 2OXXA 4FK6A 4YC6A 4IWPA 4YNEA 1ZAUA 3MPMA 4UXQA 4AACA 3JRXA 4XYFA 4FTKA 3EKNA 3FMLA 3PJ2A 4TV9F 3BU3A 4FT5A 5GINE 2YIWA 2V62A 3Q6WA 4BJJB 1JVPP 2YCRA 2BKZA 2NNWB 1TA8A 3VPDA 4O7YA 2YDJA 2JAVA 2DUVA 3PXYA 4PQNA 4CE5A 4DTAA 3MJ1A 1JDEA 3DJ6A 3RAHA 5DA3A 5JZNA 5HKMA 3ZXTA 1Q8TA 4L9IA 4RJ8A 1A0GA 4IJPA 1MUOA 1QL6A 4KBAA 2YEXA 4RWKA 5FXQA 5JFWA 2HGWA 1WCCA 4G3FA 2C3KA 3IQ7A 4O4HF 3AQVA 3FJQE 4IB3A 1YW2A 4S30A 1IOWA 5CB4F 3ODZX 2PVLA 2J0KA 4I6BA 4DF3A 2ZMCA 3BE2A 3I4BA 2SCUB 3UOKA 3V4ZA 4J96A 2PMNX 2J9GA 3OD6X 5D10A 1GY3A 2VAGA 5IEVA 4O0UA 4QTAA 4M8TA 2XB7A 1A9XA 2IG7A 3S2PA 4DTBA 5DEYA 4JDJA 5EW3A 2VWWA 2JAMA 1UU9A 2R3LA 4YHFA 1Q61A 1GZKA 3WF6A 4GJ2A 4X2FA 3ZO4A 3BACA 5BWWA 4K77A 3ZDIA 3L8VA 4L1KA 3LFFA 5F1ZA 4B6LA 4XHKB 2BRBA 4DEGA 3BHUA 3HL7A 4I5HA 4IM0A 4GUEA 1W7HA 4J7BA 3SLSA 5HD4A 3QHRA 5LCJA 3DAKA 4L7SA 3E5AA 4R3CA 4K6NA 4E6AA 4KAOA 3DBFA 5HX6A 1S68A 4I92A 5TT7A 3C9WA 4OTRA 1MRVA 4TTHB 4WG5A 4MD8E 2ZJWA 4O6EA 4XV2A 2UVXA 4ERKA 2R64A 4ZTQA 1R3CA 3IK3A 1PF8A 4YC8A 2WU6A 3FQEA 4M14A 1CKNB 3BLRA 2LAVA 3PSBA 5GJGA 4D5HA 2I87A 4TL0A 3L9PA 2PZIA 3GU5A 3LJ0A 2OXYA 3ZXZA 1M2QA 3BBTB 4WKQA 3CEBA 4UFZA 4NL0A 3KK9A 5E8ZA 3TTIA 5BYYA 2EJ3A 2QOCA 4I21A 3G15A 4E4LA 3LFAA 4PL3A 2W05A 5ITAA 3F5XA 5CEIA 5K5XA 3TY9A 5HVYA 3RWQA 1W93A 3VBVA 4A9TA 5C26A 2YYAA 3FQHA 4OLIA 3O23A 3F3WA 2Y6MA 4MV6A 1ZARA 4M7IA 3GB2A 2C6IA 2EWAA 4FT3A 4GG7A 2G2FA 2WQEA 3SOAA 1H00A 3E8EA 5DMXA 1S9JA 4IX6A 2X2KA 2XKCA 5EG3A 2GS7A 1YWRA 3KF4A 5CZHA 2J2IB 1IR3A 2HG8A 5EW8A 2CNUA 4IFGA 4EOPA 1UV5A 4Z9LA 4EEQA 1UWHA 2A4LA 4H1JA 3T9EA 3DQXA 1DV2A 5LMAA 4MAMA 2VX0A 5DRBA 4FMQA 3FLNC 2P3GX 1NXKA 2Z60A 4FJVA 2BALA 2PVMA 3JY0A 4EH5A 4A07A 4W8EA 4ASZA 5HU3A 3CQUA 2YA9A 4FZFB 4GVAA 4PMPA 2J5EA 2XIZA 3ATTA 3HRCA 3AC4A 4QO9A 5BWVA 2VTPA 3V5TA 1ZAOA 3OBGA 3O7LD 4LDTA 3BG5A 2X6EA 3CTJA 2ZYBA 3W33A 2F7EE 2V22A 3G2FA 3H10A 4U43A 3ACKA 4O7SA 4Y8DA 4ACMA 3SX9A 2XK4A 4WD5A 2WMQA 1PXNA 4CQEA 3C50A 4IAAA 4MD7E 4QP8A 1K3AA 4FEUA 4IZ7A 2WPAA 3DFCB 4WG4A 4CG8A 5JT2A 5EM7A 5BVEA 2GTMA 3H9FA 5DR6A 4FFLA 3RMFA 4BHNA 3H3CA 2CKEA 1M0TA 4RLLA 5I9ZA 3DF7A 1EHIA 2GU8A 4PP9A 4CT2A 1FQ1B 4MCVA 4IVDA 3T8OA 5KMNA 2QK4A 5C8MA 3U55A 3OXTA 4TM5A 3EZVA 5AUUA 4I5PA 4R78A 3THBA 3PIYA 4Y46A 4HVDA 2WGJA 2H34A 5BMVF 3PIXA 3ZO3A 2X39A 2YACA 2R3OA 3BGQA 2V0DA 3UQ8A 3CJFA 4XV3A 5ETAA 5E8VA 4U97A 5HCXA 4FTRA 3NZ0A 4TV8F 3UPXA 1H08A 3MY0A 1MRYA 2HIVA 3RP9A 3GQLA 1KE6A 2QOQA 3W18A 3PPZA 1PJKA 1OUYA 3TEIA 5GIPE 4FT9A 4CC5A 1CMKE 3VUMA 3TDVA 4HR7A 4E26A 2EU9A 2W1ZA 3ZDUA 4DFBA 4O0WA 5CAPA 2CKPA 2UZEA 3C4ZA 3QAME 1PW2A 3CPCA 4HGLA 4I55F 1OM1A 1ZYSA 5HNGA 2B55A 3KMWA 2XBAA 3TV7A 4C7TA 4XBUA 4D28A 5HU9A 4O7NA 3HT5A 1UU3A 4RBLA 1XH7A 4QPSA 5HNIX 3VNNA 2VN9A 1Q41A 4O83A 3F6XA 3JSLA 5HE3A 3KULB 4M68A 3G0FA 3UP7A 4CXAA 3MH0A 1XH4A 1DM2A 4KINA 4TYGA 4BVUA 5L2SA 3RINA 4A9YA 4ZY4A 4E7WA 3FI3A 2VRXA 5HBJA 1OITA 5HTBA 2GFSA 3TEKA 5E7RA 2JDVA 3Q4CA 4AWIA 4ZSLA 5M53A 2PZYA 4HVSA 3E3BX 3E8DA 3MESA 1FVIA 2G9XA 2XRWA 2GDOA 2ITVA 3E92A 5HGIA 5BMMA 3RTPA 3UVQA 2F57A 5LA6F 2X8EA 3F5PA 4O2PA 5J1VA 2YM8A 4R3RA 2ZM4A 3Q60A 3A2CA 1OKWA 1FOTA 4ANLA 5CXHA 1Q24A 3MN3A 4JRNA 3OC1A 2ETKA 4FUXA 1U46A 4ZY5A 2AYPA 4AP7A 2WOUA 3V6RA 5CTPA 2XCKA 3HZTA 4ASEA 1KJIA 4IWYA 4BY9E 3H9OA 3BCEA 3DDPA 4D0WA 3Q96A 1VJYA 3IDPA 4O7RA 5LQFA 3D5XA 4ZLZA 4QMUA 2QC6A 4EWQA 1F5QA 3G6GA 3V5WA 4EQCA 4ONAA 3LCKA 4KBCA 2NYAA 4QP2A 5H8GA 1OPJA 5DEWA 5HBEA 3UBDA 4YSJA 5KKRB 4ITHA 5FEEA 4I94A 3R02A 2BROA 5ACKA 3PA5A 3RR5A 3IW6A 3I0QA 4ZIMA 3K5IA 3ORTA 4IX3A 3MYGA 2X81A 3EQIA 2YRWA 3GJXB 3O7LB 5BPFA 3TMOA 4O2ZA 3AG9A 3AC3A 5EZYF 1WAKA 2GSFA 2RL5A 3LHJA 4CD0A 3P5JC 4FSMA 4YHJA 3UMXA 4MV8A 5T3QA 1WRVA 4EGJA 3BL9A 3U0GA 4D58A 2G15A 1G8SA 4IFCA 4R5SA 2JIVA 4YNOA 3O0GA 1G3NA 5HZNA 4UWYA 4I50F 3UQCA 4FG8A 3FL4A 2ZV8A 4QSHA 3FZPA 3TV4A 2Q7DA 3KRXA 2YCQA 3DTWA 4M0ZA 2QU6A 3RPOA 3WO1A 1U4DA 4JBOA 4QYFA 3W8LA 1KE7A 2FGIA 3ZRMA 4HGSA 1I7LA 4CHIA 3HGKA 5BWRA 1TQPA 2CNQA 4AA5A 5EKNA 4U45A 4AGWA 3DS6A 5AUTA 3FC2A 2VO6A 3R30A 1Z9XA 3O2MA 2OG8A 2RIOA 1P5EA 3D14A 4UWCA 4IZYA 4AQKA 2B52A 2R3QA 2X8IA 1NVSA 1OL5A 4OR5A 4TNDA 4FL3A 4A9UA 1RW8A 4K33A 2R7MA 4P5ZA 4WNOA 3ZMMA 4O7VA 2PZPA 1U54A 3L8PA 4QYYA 5LVLA 1UWJA 2R3GA 4FOBA 1E9HA 4IWQA 5B0XA 3ROYA 4AQCA 3V4SA 4GMYA 2QOIA 3W1BA 4AXAA 1U5QA 3D0EA 2ETRA 1YI4A 1CM8A 1M6VA 4HVHA 3DTGA 4AXEA 5M09A 3DJ5A 3LFQA 4D0XA 2NU8B 3KC3A 1WMKA 2IZUA 4B99A 3V8WA 4G5PA 2C3LA 5AP3A 4DYMA 4QMSA 4L42A 1Y8GA 5LWNA 3R9DA 4UCSA 3V5JA 4ZTNA 3HBLA 2I80A 4DH5A 1YOMA 2UZVA 3MA3A 5L6WL 2ZV7A 1T46A 2QOHA 5ANDA 5IQGA 2H9VA 4LV7A 5CSHA 3F7ZA 3U9SA 1EUCB 2VZ6A 2AUHA 4O7WA 4XH6A 4M13A 2XRUA 4U5JA 4AAYA 2FPIB 5B2LA 4FFOA 1YRPA 5E8WA 1DS5A 4IM2A 2FB8A 3P7CA 2R2PA 1ST4A 5ICPA 1Q5KA 3BEGA 5CF4A 5E92A 3UG2A 4MXCA 1ULZA 2WMWA 3QTRA 4PRJA 5IQFA 3EFLA 4BGHA 2XJ0A 4TYHA 3SAYA 4EZ3A 3GDEA 3UO4A 2WQMA 3Q2JA 3W2OA 1X8BA 2JDOA 1H4LA 5GJFA 3FKOA 3Q9YA 5KE0A 4R7IA 1I1MA 3BL7A 1V0OA 3GOKA 1JSUA 5CT7A 5IA3A 3DPKA 3KK8A 4QQTA 3MB7A 1REKA 5LVMA 4YZNA 3ZRLA 4O22A 1UKIA 5I0BA 4PNIA 2FPPB 1XO2B 3R7OA 1Q99A 4K11A 3NAXA 5JGAA 3COIA 3GVUA 4IAZA 5DYJA 4NM0A 4BDIA 4PZ7A 4MKCA 2FVDA 5HLWA 1YDTE 3FI8A 4TY1A 1YQJA 4X3FA 4UCTA 3NR9A 3FZTA 3C4FA 2JD5A 1K2PA 3FI4A 4D5KA 1NVRA 1CKNA 2E9NA 4ZP5A 4IDTA 2NRYA 1SVEA 4CGAA 2OFVA 3QD4A 1XJDA 4XMOA 4FE2A 2HK5A 1ZOHA 3SA0A 1GAGA 5HO8A 2ZDUA 4DQNA 1H0VA 3QWJA 3CC6A 4LFIA 3LE6A 4FI1A 4J95A 4EGQA 3L8XA 4GVJA 4J8MA 2ITTA 4FT0A 4R6VA 5JZJA 2BZJA 2GS2A 1KJ8A 4CFMA 2FSMX 1Q8YA 3OXIA 3LCOA 2PN1A 3W55A 1F3MC 4O81A 5EQPA 4FKPA 5AWMA 4BCQA 3FLQA 4IX5A 5AUWA 3C0GA 5HG7A 4QEBA 4BZOA 1XWSA 3LMGA 4ZOGA 4TN6A 1IOVA 2XNBA 5KMOA 1IRKA 2XS0A 3AT3A 1YDRE 4IVAA 3MY1A 5CY3A 2IZSA 4FKOA 3KAKA 4TWCA 4BTJA 3EN4A 4UCRA 4IHJF 5BVKA 3W10A 5TKDA 2XK7A 3B2TA 3Q5ZA 3PLAE 4IEBA 3PE2A 1GZOA 4JNWA 5CSVA 2RFSA 4JVGA 4KBKA 3S0OA 4NZNA 4XG8A 4YZ9A 2C6OA 3R9NA 4LV5A 4AXDA 1UNLA 1OVEA 2R3KA 2W4JA 2Y6OA 4N6ZA 4TZRA 2UZUE 3DY7A 4JG6A 5E8TA 1GZ8A 1YKRA 3RK7A 3P1AA 2I0YA 2YWVA 2COJA 5A4CA 4U3ZA 1LPUA 3TNHA 4I6LA 4YZMA 4LUEA