4O7ZA

Saicar synthetase (type-2) in complex with gmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
226
Chain Sequence
b'AKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with GMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 226
sequence length 227
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7zA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7zA02
4CG9A 2A0CX 2C6KA 3H9RA 3KB7A 4FTAA 3PY3A 1HCLA 1FMKA 3NRMA 5EW8A 3FMJA 4FVRA 4Q9SA 2ZVAA 3NYNA 1RQQA 1IA9A 4FL1A 4GT3A 4U41A 1LR4A 4Y72A 2ITOA 5J1VA 4EH7A 2EUFB 1PK8A 2Y6MA 3QD0A 1KEEA 1QMZA 3N4TA 2XYUA 1PXOA 4QMYA 4TV8F 2WAJA 1YXSA 3DKFA 3H30A 3QZIA 3R1QA 4YJVA 1GZNA 4FV5A 2O64A 5KO1A 1VYZA 2OZAB 3G15A 4L68A 4M14A 2F7ZE 5A4LA 1B6RA 4EGQA 3FXZA 3GLKA 4UWBA 2VAGA 3UVRA 4U79A 4YJNA 3BLQA 2XNEA 5HKMA 1ZXEA 3MIAA 4PMTA 4FFPA 5K5NA 2JIVA 5JN2A 1CQIB 4RQVA 3COHA 3VS3A 3CQEA 4EYMA 3FZTA 1Q8YA 4KNBA 4HPUE 4YJTA 4NYEA 3QX4A 4X2KA 1JKSA 5IA3A 3PWYA 1YKRA 4JBOA 3GCSA 5F95A 2XK6A 2PZPA 4E4LA 3R01A 4K9YA 4Q5EA 3W10A 2W6ZA 3TIGA 3ET7A 2ZV2A 3QZGA 3CTHA 4D9TA 4LQMA 2KTYA 4U0IA 3OROA 5KX8A 3FLSA 2WTKC 3RTPA 3LCOA 3NW5A 4IB5A 3LCKA 4AQCA 5CEIA 4EOLA 3HMOA 4I22A 4P7EA 4FEQA 4W4XA 4FVPA 1RJBA 1OKYA 4FKLA 3BV2A 4G1WA 2YFXA 4YJPA 3U87A 5J95A 2X39A 3LM0A 3EQFA 4BZOA 5EQPA 1M14A 3OXZA 2FA2A 1VKZA 3A99A 3NX8A 4FTMA 4AA4A 3DBCA 4QTEA 5AIKA 4TWPA 5JT2A 2GNHA 3F5UA 4G3EA 5CNOA 4OBQA 3C51A 4D55A 2RIOA 3LLAA 2PN1A 1GZOA 3FSKA 3EN4A 3PDTA 3Q1KA 4GVJA 3MB6A 3LP8A 5L6PA 4EK4A 4EL9A 1J3HA 5KHWA 4OTGA 4FSNA 4GG5A 4YSMA 4C3FA 4FEVA 5I9XA 1DIKA 1F5QA 2W6MA 2ERKA 3P9JA 1UVRA 2CJMA 3A7JA 1CE8A 4JX3A 5KE0A 5JZJA 3QCYA 4MNFA 4FG8A 2XKCA 4PWNA 3V01A 3ZH8A 2XJ2A 2WD1A 3QC9A 2BPMA 4QYHA 2XRUA 2ETRA 4XG3A 1KUTA 4IM2A 4IC7A 2P0AA 3R9RA 1P2AA 5AX3A 3PP1A 3PFQA 5TT7A 3ZO4A 4UXLA 5CZIA 3R04A 2I0VA 4FT9A 4ZSLA 5J9YA 2IVUA 2VX3A 4QMQA 1OITA 3ODZX 4DEAA 4GRBA 4AS0A 4JQ7A 4BR3A 5BX0A 3HB9A 4F9WA 4JIKA 5EI6A 1OL6A 4ALUA 1OBGA 5A3XA 4JAIA 3I60A 1R39A 1KJ8A 1O6LA 1UV5A 2E9VA 3P08A 1KOBA 5AP3A 4EHGA 1URWA 1AGWA 5M56A 3QF9A 3VRZA 1GSHA 1GIJA 2XVDA 3O23A 4FOCA 4FKWA 2W5AA 3DNEA 3FMNA 2QK4A 3PRIA 2C6IA 2UZNA 3C5UA 4AW0A 3U6IA 4RJ4A 1Y6BA 4O0VA 3QQKA 4WNMA 5BNJA 2C3JA 5HQ0A 3QZFA 2XK7A 3OT8A 4DH8A 5CAOA 3RVGA 3ZSHA 2ZDHA 4KA3A 3LFBA 3QFVA 3UOKA 5J9ZA 5BPHA 4L00A 1BL6A 3OD6X 2XZSA 2R3OA 5EYCA 3ZZEA 5CEMA 2CKQA 1FVVA 4MV7A 1Z57A 3MFUA 1NXKA 3MPMA 4MAOA 4YO4A 3FMEA 3AQVA 2X8EA 4EI4A 4ZMFA 4TYEA 5A46A 4ZTQA 4YZDA 3D14A 4MA0A 3DV3A 4MXXA 4OT6A 4WA9A 4BI2A 5A6OA 4EZ3A 1LP4A 3QALE 2PU8A 3NYVA 2R4BA 4PMSA 1J91A 3BI6A 3M42A 4RA4A 5AA8A 3TV6A 3JUHA 3AMBA 3PE2A 1DV2A 1VZOA 3ZHPC 4XHKB 3VBWA 2UZOA 3D0EA 2PUUA 4EH3A 2NRYA 2OJ9A 3C0IA 5HI2A 4AOTA 2YWVA 3LMIA 4BI0A 4GS6A 4AW5A 4MWIA 1TQIA 3KY2A 2IG7A 5E90A 3I6UA 3EN5A 4B8LA 1E9HA 1WVXA 3ROYA 1DS5A 3IK3A 5DEWA 4YSJA 2OWBA 5BUEA 3FWQA 2JIIA 3T3UA 2VWIA 1S9IA 4XRLA 4FKPA 5HCXA 2I80A 3AG9A 4O2PA 5AEPA 5CQWA 3NMUF 4D2RA 5D10A 3E8NA 4E20A 4NKSA 3E8CA 4FG9A 3R8UA 4HYSA 4LUEA 3ZDIA 1JKKA 5IQCA 4XG8A 4ALVA 2OFVA 5LMKC 3IOPA 3T3VA 3PJ2A 4KKHA 3KVWA 1FVRA 2JIUA 2X4ZA 4ZP5A 5IG1A 3U6HA 1ZARA 2FO0A 4N0SA 4JNWA 3TJCA 4YGAA 5JH6A 4ZLOA 4FT5A 3G6GA 4DTBA 4EUTA 5LVNA 4PDYA 3OHTA 1H27A 3ORRA 2ZB1A 1U4DA 3KVXA 3D9VA 4J99A 4OTDA 3KREA 4YZ9A 5EDPA 3ZC5A 3UQFA 2VUWA 2ZYBA 4HGEA 4CQEA 1SVHA 3OCGA 3F3TA 3ZDUA 4MXZA 4PNIA 4QP2A 5HX6A 1M0TA 3I5NA 1PRYA 4EJ7A 3ZUVA 1H24A 4WG5A 4DEEA 3DDQA 2CGVA 4YC3A 2BZIB 3SD0A 1F3MC 4RGJA 5FLFA 1R1WA 2UZWE 3TDVA 3V4SA 4G3GA 3GU8A 4BTFA 2LGCA 4ACGA 3VJOA 3R23A 2X4FA 2HZ0A 1J7IA 3HAVA 3UIBA 3ZC6A 2HW6A 3D2KA 4DAWA 3FSFA 3UZPA 2X0SA 4IAYA 3AT3A 1V1KA 2X9EA 4C61A 2RFNA 4C3RA 4BICA 5E8SA 4C3PA 4E73A 4Z55A 4TV9F 5CI7A 1EYZA 3LZBA 3RAHA 4H3PA 4TL0A 4FV8A 3UO6A 5IU2A 3NGAA 4CEGA 3NUYA 2ZM4A 3EMGA 2IZSA 2WTJA 3A60A 3TXOA 3DAJA 4ZQIA 3DQWA 4WOVA 4UWYA 4PRJA 3PSDA 3NYXA 2X8DA 4U7ZA 3HAMA 5BQ0A 3OY3A 2VWZA 1JLUE 3SOCA 5HEZA 3GEQA 4O6LA 5C1OA 3CTQA 5E92A 1XQZA 3AC5A 4PY1A 4YTFA 4BRXA 3GIDA 4BGHA 3K5IA 2H34A 2J5FA 4FSQA 3ZXTA 3TEIA 5HZNA 4BTKA 2P55A 1YOMA 3VC4A 2UZBA 4JQEA 5JFSA 1L8TA 5GJGA 4A4LA 2VX0A 1Z2NX 1YXXA 1PXJA 5JH7F 2YAKA 4L7FA 3LFQA 5J1WA 3LKMA 2CZGA 2JAVA 3WNZA 3NUXA 4TNBA 2R3IA 3KN6A 3AX6A 4HVGA 3ZEPA 4ZTRA 1JDBB 4RJ8A 2Z7LA 3FPQA 2PVPA 5M4UA 2WTVA 3UIMA 3F2AA 4P5ZA 3K3JA 1IR3A 2X7GA 5CX9A 5FUTA 4M69B 5EK7A 5E1EA 2JFMA 3DGKA 3G90X 2YA9A 3TIZA 4MA5A 2V55A 4CKJA 3U6JA 3EN9A 5H80A 3AGMA 3LLTA 5CENA 4ZSAA 5TF9A 1JKLA 3PY1A 3ZOSA 5D8DA 4EK3A 1M6VA 3KXMA 3WF8A 4L3PA 2WMSA 4F65A 4FI1A 4MF1A 4IH8A 5JZNA 4KS7A 4IDVA 3QD4A 3SAYA 4HZRA 2BHEA 1ZOEA 2BAKA 3KRWA 3QTSA 4RLKA 2VTHA 4EEVA 3R5XA 3ALNA 4A9YA 2R7LA 2B0QA 4P90A 2BIKB 4RIOA 4X3FC 3EN7A 4R7IA 2WMAA 1FGIA 1GIHA 3EFJA 4YNOA 4BCPA 4KAOA 3SG9A 4O0TA 4K8AA 3V5JA 5A4CA 2FB8A 3RHKA 4CNHA 3I4BA 3EN6A 3M11A 4YLLA 4JDJA 3TJDA 1EHIA 3GFEA 4C62A 3FI2A 5JFVA 4QT1A 2ZB0A 2G01A 3F2RA 4EWQA 4PDOA 3K5VA 5KMOA 5CWZA 3VS5A 4EC8A 2V5AA 3UP7A 5EKNA 2UW9A 4LMUA 2QCSA 2YM7A 3FQHA 2RL5A 4FGBA 5EHLA 4YPDA 3SHEA 3AMYA 3DPKA 4W8EA 4MQ2A 5E7RA 4G34A 3G8CA 4EGJA 5A4QA 4IACA 3PXRA 2F2UA 4DFUA 3MVJA 3FLNC 3H0YA 3NW6A 2RFDA 2GHLA 2VTPA 2Z7QA 4XMOA 2ZV9A 1H1QA 3BYOA 3MH3A 3CBLA 4ASDA 3SQQA 4J8MA 2C00A 5ETCA 2VTJA 3FLYA 2NU6B 4AE9A 5AWMA 1B6SA 5B2LA 4FYNA 2BCJA 5LYJF 4EZ7A 5C8YF 3E88A 4F0FA 3IO7A 3CCNA 4RVMA 3TKHA 3F69A 2YDIA 3DKOA 2VO7A 2CNVA 4QTCA 5EQEA 5FRIA 3QUPA 4AACA 4ANMA 1HCKA 3UE4A 3R6XA 4DFNA 2UVXA 4U3YA 2O5KA 3Q4TA 3L9PA 1G8SA 3AT2A 3E5AA 3GOPA 1W96A 2VTMA 4OGRA 2WU6A 2FSLX 1CKPA 2OJIA 2X1NA 5HD7A 4ANSA 4BC6A 3FMMA 4PDSA 3LWBA 4F1TA 1VBHA 1YHVA 4YAJB 3NSZA 3SOAA 2VWBA 3PZEA 3QXOA 2PUPA 2XNOA 4FKGA 4P5QA 4IADA 4PDPA 3CD8A 2CLXA 4FKOA 5EM6A 1I7LA 4RT7A 2R7KA 2QG7A 3ZSGA 3MVHA 3IG7A 5BMMA 3L8PA 4X0MA 2ZOQA 3TW6A 3QKKA 3OWPA 3BEAA 1SYKA 2C5VA 4U8ZA 5JVDF 1Y91A 4I0RA 3R1YA 1YHWA 1PXKA 3FZSA 3DQXA 3R73A 3W18A 3GC9A 3TZMA 2QODA 3BZ3A 3WI6A 5FXRA 4UX9A 3JRXA 3LXLA 4MH7A 5AP2A 5CSWA 3OEFX 4DEDA 3ORNA 5CT7A 1BL7A 1UNHA 5E8VA 5HO8A 4O4JF 2NO3A 3II5A 4MYGA 4TYJA 2B53A 2F57A 5HNBA 5LXTF 4GSBA 3R7VA 5I9VA 4O0YA 1STCE 2PVYA 5JGBA 4LOOA 2B1PA 1WVYA 1YHSA 2GS7A 2JBOA 4FNXA 4RIXA 3OT3A 4IJPA 4TUYF 5DWRA 3UIXA 3GU7A 3L9NA 3I6WA 2B54A 3DB6A 4HGLA 4HVHA 2VTOA 5CEKA 4FSYA 2J0KA 3DAEA 3MSSA 4O0UA 4IIRA 3C0HA 3QRJA 4AT4A 2VZ6A 2IZUA 3LFAA 4DCAA 5AIRA 3O7LD 4J95A 4QMPA 4E6CA 4NWMA 4LGHA 4O84A 2YIRA 4RFMA 4BDAA 3WZEA 4ZS4A 5C4LA 3ENHA 5E4HA 3PJ8A 3PJ3A 3VBYA 2I6LA 3TNPC 4UY9A 3LFDA 1Q8ZA 3UZRA 5HORA 2YZGA 2G1TA 1SCUB 5J87A 1OIRA 2WTCA 4J53A 3BYVA 3S2PA 1ZOGA 2VD5A 1HOWA 3V5LA 5JSMA 4O21A 1B39A 3IDBA 3QQFA 4OT5A 4EORA 3NPCA 3HV5A 3EQDA 1DI8A 1Q5KA 2GTMA 5AV2A 4FIGA 4MV8A 3ZRMA 3GU6A 4GYIA 3B2TA 4OTQA 4F09A 2OH0E 3HV6A 3DDPA 5DG5A 3SGCA 2PPQA 3UBDA 2CN5A 2Z8CA 4II5A 3TTIA 4ZJIA 2GPWA 2JC6A 3EZVA 3QL8A 4A06A 4FV1A 1ULZA 2OF2A 2QOHA 4JQ8A 4F1OA 4WRSA 2OG8A 3QTUA 1CQJB 1SZMA 4O0WA 4OTRA 4EUUA 4YR8A 1JWHA 3MWUA 3PLSA 4WUNA 5HE2A 1RDQE 2WQBA 4PX6A 1P4FA 5LCJA 4FTNA 4BCGA 3D15A 5IQBA 4GK4A 2HZIA 3H3CA 4O7YA 4RWIA 4HYUA 4EOSA 1Q3DA 2XNMA 2BFYA 2QF7A 4E5BA 2B52A 4U80A 4ZK5A 3W1FA 2C68A 2WMBA 5IUGA 1PXLA 2AYPA 4FTQA 4IX4A 2WZJA 1XHAA 4MXAA 4UALA 4GUBA 5ANGA 2ITWA 4PTGA 4XOZA 5EHOA 4CKRA 2AC5A 4DITA 5DIAA 2F9GA 3ODYX 3VN9A 3TG1A 4FV0A 3F6XA 4WHZA 3TKIA 1QL6A 1JQHA 3EKNA 3BKBA 5JFXA 2QR7A 4EZ5A 2WO6A 3BLRA 3QD3A 4D5HA 1E1XA 1PY5A 3Q4ZA 4QTDA 2BRHA 4I93A 5HESA 2GHMA 3GC8A 3TNQB 4FZAB 2VTTA 3TCPA 4O96A 4DG3E 2OXYA 1IRKA 3CKWA 3FY2A 4JT3A 4KABA 5KMKA 1EH4A 3OTUA 1YWNA 3QRTA 4F6SA 5C01A 3CLYA 3FZRA 3HP5A 4ALWA 3DJ7A 3Q53A 5I9WA 4O0SA 1RE8A 5IA1A 2CNQA 4BN1A 5AP5A 4GVAA 4I21A 3FL4A 2R3KA 4IX5A 3PXFA 4R77A 5E8TA 2ITZA 5KKRB 5TKDA 5A14A 4WD5A 2OLCA 2OICA 4LGGA 4R1VA 5CVGA 2PE1A 3VMMA 3F66A 3O8UA 4BHNA 3IW4A 3VS7A 5M09A 2ZMCA 3RHXA 1WAKA 3U9SA 4AN2A 3CGFA 3OP5A 1BLXA 3FKLA 3FI3A 4JRNA 3MVMA 4FFOA 4TYGA 2W1HA 3V51A 2X81A 4O81A 4XV2A 4CMOA 5IISA 4Y83A 3I1AA 2UW0A 3NWWA 2J7TA 4FKTA 4XBUA 3LJ0A 4O22A 1JBPE 2BDFA 4OBPA 3VQHA 4D4YA 2YRXA 3KCFA 2R3HA 1WBOA 4AZEA 2XK9A 3R00A 4XBRA 2O63A 2BRMA 5I9YA 3D7TA 2J50A 3ANRA 4L43A 4I6QA 3W2SA 3PVGA 3PRFA 2F2CB 2XKDA 4IE9A 1YRPA 2YCRA 4I5CA 4I5HA 2X2KA 1FQ1B 3WARA 2IJMA 4ZY6A 3P23A 5AUYA 5ETAA 3VUGA 2XNPA 5HBEA 5HVJA 4WBNF 3LQ5A 3ENMA 4FV4A 3AD4A 4XG6A 4AUAA 3HO8A 4FL3A 4AP7A 4KKEA 3UMXA 3R8MA 3QWJA 5IQAA 4BIBA 4M15A 4W4YA 2OIDA 5FP6A 1NA7A 3BE2A 4QMNA 4LV5A 3UYSA 3T9TA 3A4OX 4NFNA 5CB4F 4UBAA 2SRCA 3P7AA 3QZHA 3R7OA 4M67A 4EH8A 3IS5A 2PSQA 3RZBA 5H8EA 2PMIA 3AD5A 4MD9E 3QTRA 4X2JA 5LOVF 5CALA 3E3PA 5H2UA 4I24A 3KF7A 3R2YA 1XR1A 3TZ8A 4EOPA 2PY3A 5C8KA 2R7MA 2R5TA 2VGPA 3R63A 3AW8A 4K1BA 3ZUTA 4WRGA 4YTHA 5BUJA 5EM5A 1ZAOA 4CFNA 2NU7B 3FQEA 3K3IA 5LVMA 3MFSA 2WIPA 1M17A 4FEUA 1W98A 3S3IA 1JSVA 1T45A 3ORXA 4K2RA 4DEBA 5BVDA 1YDSE 4RIWB 1KJQA 2I8CA 3TDWA 1JNKA 2ZJWA 3DZOA 3ZO1A 4KBCA 3FLWA 4AE6A 2IVVA 4RZQA 2YZAA 4KRCA 2BHHA 4LYNA 5EFQA 3G9NA 3O7LB 4H1JA 4IVCA 2XCHA 3HMMA 4V0GB 3WF6A 4QOXA 3Q9YA 3E87A 3FMLA 1PMEA 4IW0A 4NW5A 1OIQA 4AWIA 3G2FA 3TI1A 2C0TA 5K5XA 4K33A 3E3BX 3DY7A 3E93A 2G9XA 3VBTA 3BEGA 4KWPA 3EB0A 3O50A 3TV7A 3UG2A 2PVMA 4FTRA 3V8SA 4CTBA 4ERKA 2BZHB 4WO5A 5HNIX 5KZ0A 4XRJA 5GIPE 3OZ6A 2R0UA 3GFWA 3CC6A 3KAKA 4XLIA 3MY1A 2C3IB 4FR4A 3R9DA 2G2FA 3O2MA 4C33A 4FIEA 1REJA 2JDVA 4EQCA 1WCCA 2C3LA 2WXVA 4MQ1A 2ITUA 4KIOA 4DFLA 4ZJVA 4YU2A 5AAEA 4XG9A 4C4HA 3S1HA 4F0IA 1PYXA 1GZ8A 2W5HA 4I0SA 3HDNA 3BLHA 5IA2A 3L9LA 3REPA 4M8TA 2R2PA 1U54A 2WMTA 2IWIA 3D7ZA 3MYGA 3Q9ZA 4NIFB 4XLVA 5BPFA 5CYIA 3CQWA 1A9UA 2XRWA 3NW7A 2OF4A 4E7WA 2HENA 2R3LA 4AGCA 4EJNA 4U3ZA 4DLKA 3N51A 4GW8A 4GU9A 4IAAA 4O7TA 4EK5A 5AAGA 3ATSA 2QD9A 3E7OA 2QVSE 2ITYA 4XG7A 4MK0A 1TQMA 4HNUA 1IAJA 3U51A 3VS2A 4BDFA 4BDJA 4LOPA 4PQNA 3F5GA 4RC2A 4G6LA 4TZRA 3SX9A 3VHEA 3R83A 2PWLA 5HG5A 5F9EA 5KMJA 4ZZOA 3BX5A 4Y85A 3CEKA 3TINA 5HTCA 4RJ6A 4MV1A 4O4IF 3EL8A 3FHIA 4G16A 3COMA 3MS9A 2YISA 1EZ1A 3DTWA 3Q4CA 3PY0A 4E5AX 4C7TA 3PSCA 3Q2MA 5F20A 3Q04A 3R8VA 5A9UA 4C4GA 4L45A 3FAAA 3UPXA 1FGKA 3FJQE 4BCHA 4ZHQF 2VNWA 5JFWA 4GKHA 2FYSA 2GPSA 2GSFA 4L52A 4LL0A 2PZ5A 2R86A 1UWHA 5M08A 4DCEA 2OZAA 1S9JA 4JAJA 2YERA 4LRKA 3VF9A 3BHVA 4CCBA 3CTJA 4QTAA 2FGIA 2O2UA 1UKIA 5FGKA 4EONA 5IDPA 3PJCA 1YOJA 2H6DA 4QTBA 5LA6F 1YOLA 2UZUE 2ZV8A 1H26A 3MJ2A 4RC4A 3SW7A 3ORMA 1GLVA 2R7IA 2V5QA 3OXIA 4CTCA 4JXFA 3MFRA 3I5ZA 1R3CA 1WFCA 2ITNA 4M0ZA 5CS6A 4K11A 4B8MA 2GFCA 3P7BA 4NH1A 2PUIA 2OFUA 3QU0A 3E64A 4ASZA 3QLFA 1VEBA 4FZ7A 1YXTA 4R3CA 2W4KA 2ESMA 3FYKX 4MNEB 5I5ZA 5KMMA 2YCFA 1PHKA 3OUKA 4GMYA 2PMLX 2XMYA 3M1SA 3DF7A 2QU5A 4DGMA 4HGTA 4EK8A 3G51A 3ZM9A 3N6RA 3VS4A 1K3AA 4KS8A 1PKGA 2WQOA 3KMMA 5CAPA 4Q9ZA 4FSZA 5T68A 2UZEA 2Z7SA 5T6KA 4FMQA 4DTAA 1KV2A 1OVEA 2ITQA 2UZDA 2J9MA 3UQCA 2P0CA 1MRVA 3TZ9A 2QG5A 4A9RA 3OCSA 3JY0A 4ID7A 4JOAA 4AT3A 4MHAA 1H00A 2QOQA 5D11A 4ACMA 3QQGA 4B6LA 4ZXTA 3KF4A 4G6NA 4RJ3A 4Y95A 5M07A 1QPDA 3TV4A 2B7AA 4DLJA 2HWOA 4C4EA 5L8KA 4RX9A 1ZYCA 4ZIMA 3HGKA 5CU4A 4BDIA 2WTKB 1FBNA 3E5NA 2OJFE 1UU7A 4UZHA 4I50F 2ITVA 3DBEA 3QUDA 3ZU7A 2W1CA 5CY3A 3TNWA 3BWJA 5L6OA 4F6UA 1VJYA 3EIDA 3OS3A 3Q2JA 4GU6A 4HCUA 3MIYA 2UZLA 4UWCA 4XP0A 4F6WA 5LWMA 1WVWA 4HGSA 3ZFXA 2IP4A 3Q60A 4H58A 2FPPB 1NVSA 2PZYA 4NKAA 5IA0A 5HBRB 4FE2A 5LVLA 5AP4A 4O4HF 2V0DA 4NJDA 3C4XA 2CGUA 5JQGF 4QSHA 4TPTA 4ZLZA 1P5EA 2Q0BA 1Q3WA 3OFMA 3OMVA 4O83A 3OW4A 4QMTA 4E4NA 5M57A 2O3PA 3QA8A 2HZNA 3V8TA 2WHBA 3OCTA 3Q9XA 4QMXA 3PA3A 4WIHA 3UNZA 3IGOA 4RBLA 2YS7A 3IDCA 2J0LA 4EOIA 5AM6A 2OSCA 4GKIA 4ZSJA 3A7GA 5LXMA 4DFZE 1R0PA 3LHJA 4M13A 2UW8A 4O86A 3DJ6A 2DWCA 4F7JA 2JKOA 3LXKA 3MW1A 4JX7A 5D7VA 2J51A 4M9UA 2Q83A 3VOTA 3NUNA 4DIMA 4IM0A 1DAWA 3A62A 4YTIA 3E7VA 4UEUA 1WBTA 4YO6A 3E8DA 4AZTA 2XNNA 5K4JA 3JZFA 2X2LA 4FL2A 2PHKA 5IQFA 3LFCA 3DLSA 4O7RA 1BI7A 3FL5A 2W1IA 4HR7A 3SLSA 2XS0A 3TWJA 3P78A 4H36A 4FIIA 3VHKA 5EG3A 1YWVA 3HV4A 3Q6UA 3GXLA 3P7CA 2W1FA 2XUUA 3W32A 5DYJA 4QP4A 4B99A 2QI8A 4NM5A 3RFCA 2ZM1A 2BKZA 4R7BA 4DLIA 2VTLA 2WQNA 1G5SA 3ZRKA 2JKMA 3FLZA 1SM2A 2GU8A 2P2IA 3HRBA 2BTRA 4L53A 2RF9A 4IB1A 5AJQA 1H1SA 4IWPA 4KUJA 2XK3A 3UTOA 2WYOA 4O0XA 4V01A 3MH0A 4JG7A 4ZMEA 4O7WA 2VTNA 3PYYA 4GK2A 4XOYA 2UW5A 4J98A 4WT6A 4FT3A 4FFNA 4D5KA 2FPGB 2P3GX 3EHAA 2ZDTA 4EH6A 3IW8A 4O2AF 5CAVA 5A4TA 5H9BA 4AZFA 3BU5A 2EB3A 3SRVB 4AF3A 3IW5A 2ONLA 4RQKA 2OJJA 4XX0B 1W0XC 1OIUA 3LW0A 2UW7A 3JS2A 4C5BA 2IZRA 2XBAA 4ZOGA 3F3UA 4U97A 4CKIA 5JKGA 4ACDA 4Z16A 1Q8TA 4JL9A 4FSRA 3S00A 4L7SA 1KSWA 4PV0A 4FTJA 1WMKA 4R78A 5FDPA 2W96B 4RWLA 3UC3A 3PJ1A 3JVSA 4IZYA 4ERWA 1OKWA 2X8IA 3GC7A 4MVFA 5GJDA 4JBPA 4ZY5A 2PVJA 1OKVA 3OOGA 3BELA 3R71A 2O0UA 5C8MA 5DR6A 4IZ5A 5EH0A 1GNGA 2PVLA 2YHVA 4USFA 3CD3A 2OXXA 2R3PA 1MQBA 3CP9A 3HUCA 4F9YA 4LV8A 5L8LA 1FOTA 3GI3A 1IG1A 2JEDA 2PYWA 3R7UA 4F99A 4KBAA 5JVLA 4ZTMA 5CTPA 4G17A 3BQRA 2HY0A 3GCPA 4IBMA 4TYHB 4AAAA 1OL1A 4GG7A 3BWFA 4PL4A 5E1SA 4BGGA 2DQ7X 5ANOA 3R0TA 4I55F 1V0BA 4I6HA 4IWOA 2Z2WA 4MTAA 4WSYA 3OC1A 3S4QA 5KZIA 5CSVA 3AMAA 3S95A 3UGCA 4AXAA 5IEXA 4RSSA 4YURA 1B6CB 3RM7A 3V5TA 5A54A 1BXRA 1OM1A 5CSHA 2P4IA 4YP8A 5LMKA 1OPKA 4FBXA 4AN3A 3KEXA 5JRQA 3FMDA 4TTHB 3EQHA 2VWXA 3C4CA 3UO4A 4BDDA 4ZOLF 4JIAA 4DGOA 3SXSA 4FTCA 4E6DA 5F94A 4FKIA 3CIKA 5HBJA 3QCSA 3KMUA 4NM0A 5K4IA 4FTOA 1U46A 4F4PA 3AXWA 5AV3A 3KK9A 1OBDA 3KMWA 4CFFA 3O0GA 3M2WA 2E9NA 5J9LA 3EQBA 1XBAA 1OIYA 4GIIA 4JBVA 4IC8A 3THBA 5EYDA 5FG8A 4M12A 2GS6A 4BGQA 2E2BA 1GJOA 4RLLA 3VRYA 3KAJA 4I0TA 4F7SA 2W06A 4X2FA 3SDJA 4O4LF 4LRMA 4O2ZA 4C4JA 3ZSIA 1U5QA 3DB8A 2CGXA 3ORPA 4PNKA 2Z60A 4MBJA 3Q6WA 2Y4PA 3UFXB 2UW6A 4JJRA 3DKGA 4XG4A 3VUDA 5AAFA 1KBLA 1OMWA 5HE0A 5AUWA 4W8DA 4NT4A 4C2WA 2FH9A 2XH5A 4RJ7A 4EH9A 2W5BA 3POOA 2HAKA 2XA4A 4NM3A 3R7IA 3DKCA 5HCYA 3TNIA 4QNYA 5JGDA 2EVAA 5C26A 3FPMA 4OLIA 3IW6A 5M4IA 3N8DA 3PZHA 1WBWA 3C4FA 4BTMA 4CFVA 4Y5HA 5CU0A 3RJCA 4IQ6A 3KK8A 3IOKA 2HXLA 3MGYA 2A2AA 3HMNA 2A19B 4CCUA 2VPQA 4X6RA 1PMUA 3TZ7A 5A4EA 3EQGA 1U59A 3R8LA 4EHEA 4I4EA 3BIZA 4ANBA 4RWJA 4J97A 4MBIA 1BX6A 3QX2A 4DYMA 3Q2OA 4Y46A 4BIDA 3LJ2A 3Q52A 5AX9A 4Y5QA 2I40A 2XNGA 3VUIA 4PMMA 5JQ8A 3W8LA 4FSTA 4DN5A 5GONF 4K6ZA 5G6VA 4EWHA 4FC0A 1SVEA 4ZSEA 3VW6A 4QMVA 2J0IA 2X6DA 3N4VA 3OVVA 4FIFA 4J71A 3A2CA 5EI2A 5EKOA 2W6OA 1Q61A 1UU3A 5BMSA 5L2IA 3IECA 2VTIA 4GK3A 2R3MA 2C6MA 2CPKE 1SVGA 2QOBA 3VPBA 4FFLA 3IDPA 3F7ZA 4QP3A 3RK7A 1ZMVA 3KRXA 5EDRA 1PMNA 3DU8A 4DFYA 3DK6A 2C4GA 3FUPA 3BBWA 3UPZA 4FTTA 4L3JA 3LVPA 4ZY4A 4C5CA 4CLIA 3F9NA 5LARA 4U44A 4O38A 1Q97A 3WF7A 4XEYA 3R7EA 5IQEA 2C6TA 4JDKA 1OKZA 3NNWA 3Q9WA 4C2VA 2P33A 2KULA 3LXPA 4PMPA 1F0QA 4FNWA 4X3FB 4D0XA 4FV9A 5KCVA 5JQWA 2X7FA 3FI4A 1DAYA 3VF8A 3VNTA 4IIJF 3HX4A 2HY81 1WBNA 3O8PA 4D0WA 2NNWB 3IQ7A 3JPVA 2CNUA 5C1QB 3FYJX 3DS6A 3VWAA 4B9DA 1DV1A 4RPVA 4FK3A 2W6QA 3WO1A 2WTIA 2HCKA 3QHWA 1KJ9A 3L9MA 1OL7A 4YJRA 4QYEA 4FOBA 1H07A 2W0JA 3PVUA 2AUHA 4I6BA 1ZOHA 4YZCA 5BYZA 4BF2A 4RFZA 3UOJA 3D5XA 2REIA 5DPVA 1H0WA 3ANQA 3FKOA 4CT1A 3GOKA 4LRJA 5AMNA 3RINA 3ULIA 4XS2A 3S0OA 1W82A 3FXWA 3VO3A 5M55A 3QQHA 3DAKA 3MA6A 5IQHA 4IZAA 3KCKA 4RA5A 1TQPA 3H10A 3HMPA 4CMTA 2Z02A 3NNXA 5FTOA 2O8YA 3BYUA 5FBNC 3FXXA 3P86A 3R21A 4FZFB 4DEHA 4BCOA 3OXTA 4PP7A 3MWDA 4FV7A 3LMHA 4QYGA 4QYFA 3WILA 4S33A 4CFUA 2NUAB 4XV1A 1CKJA 1AUVA 2DYLA 3VAPA 4QQ5A 1Y57A 4ITJA 5AP7A 1H1RA 2YEXA 4TYIA 5BVKA 4EQMA 2JDOA 3TTJA 3CGOA 2Y0AA 4FKUA 4NFMA 4QMOA 5IH5A 5HLPA 4RG0A 1ZMWA 5AV1A 3OF0A 5B0XA 5FXQA 3RPOA 2HWPA 4MV3A 2OXDA 3QTQA 2LAVA 1CM8A 3QAME 2Y8OA 3RCDA 1OUKA 3BRBA 4FIHA 1XH4A 3HVCA 2R64A 2NP8A 3IPHA 5IMXA 3ZYAA 1XH9A 4LOQA 4L46A 4D1SA 1ZY4A 3RWQA 4APCA 2WOUA 4KINA 4QPAA 1YI6A 4NL0A 2JLDA 3GQLA 1AQ1A 2XIKA 4FV3A 5HIDA 3FQSA 2X9FA 4GH2A 4H1MA 2I0YA 2VTRA 2V22A 3AOXA 4LL5A 5HLNA 2VWUA 2C1AA 1OB3A 2G2IA 2WB8A 4JBQA 3I12A 2W6NA 4QRCA 4S31A 4D4VA 5ANDA 1ZZLA 2XCLA 3OBGA 5T3QA 2DIKA 3JRWA 1H4LA 2GNIA 3ZEWA 3BV3A 3COIA 4C59A 2XEYA 3HV3A 4E4XA 5EYMA 1WR2A 2G15A 1OL5A 3UVPA 1BUHA 1OI9A 2IO6A 1PXMA 2IW6A 2PVHA 3ROCA 4EOKA 3QRUA 4R5YA 3QCQA 4NUSA 2I0HA 1W8CA 4O91A 3ORZA 3UP2A 1JVPP 3WF5A 1GGOA 2YZLA 3E62A 4QNAA 4BDKA 2OW3A 4JS8A 3HNGA 3QQLA 2YM8A 4I23A 4E93A 1UWJA 5EQYA 2DZDA 4MD8E 3LMGA 3EFLA 2XB7A 1MRUA 3D94A 4OTFA 4XYLB 2GQGA 3DOGA 2YDKA 2Q0NA 3F3WA 3DA6A 4GFGA 5D12A 3OW3A 4F9AA 4O7NA 4TWOA 5DEYA 5HO7A 5JMSA 3PP0A 4YJOA 4C4FA 2ZDQA 3BGQA 5KKNB 3O17A 2JGZA 1M2PA 3C7QA 4HCVA 2WMRA 4F70A 4IAZA 5HHWA 2WEIA 2ZAZA 5GINE 3PLAE 1NVQA 3MH1A 4FYOA 4QPSA 3W33A 4EBWA 1AUXA 4AA0A 1R0EA 2C0IA 3MVLA 3V04A 3EZRA 3LQ3A 2J0JA 3N4UA 2BZJA 5AUZA 4RX5A 4MV6A 3SG8A 5D41A 4L8MA 2GLTA 3PPJA 4PTEA 2H9VA 4U45A 2P2HA 3MESA 4YC6A 5IF1A 3D5UA 4ZI7F 4FT7A 4CXAA 4JLCA 2VQDA 4X7QA 3SC1A 4WBBB 4DT9A 3EL7A 2XNBA 3QWKA 3K5UA 1H08A 5L6WL 4X2GA 1REKA 3VULA 3U9CA 5DRBA 2YCSA 3NAYA 1Z2OX 5HX8A 4O0RA 5BYLA 5IQGA 2XD4A 1Q99A 5ETIA 4DHFA 5J7HA 3QLGA 4X6QC 2QLUA 5L3AA 2QC6A 5EDQA 3RI1A 2UW3A 3P1AA 4GCJA 3ETJA 2YAAA 3KRRA 4HYHA 4BIEA 4EC9A 3ZTXA 4EBVA 4ENXA 1IA8A 5E8XA 5L2TA 2CN8A 2SCUB 4IWQA 5FM3A 3FE3A 4PUZA 4YJSA 2Y6OA 3U54A 4IB0A 5H3QA 3JY9A 4IANA 3WZJA 4IFGA 2W1EA 4BYIA 3G5DA 4FNZA 2XJ0A 2JITA 3H0ZA 2BROA 4J1RA 3V5QA 2BVAA 4KD1A 4YBKA 1ZY5A 4QMMA 5HE3A 2R0IA 3ELJA 1JPAA 1KOAA 3DK3A 3JXWA 1ZYDA 1Q4LA 4V05A 2YW2A 3EH9A 1IAHA 2RG5A 3BHYA 3ATTA 2J4ZA 3Q5ZA 4IX6A 2NU9B 5ANEA 3EQCA 3ORTA 5FTQA 4E5WA 4AW2A 3ALOA 4U81A 4W4WA 2E9PA 3R5HA 2PE0A 1FMOE 4IWDA 1XH5A 3VS0A 3ACJA 1JKJB 2J9GA 2OJGA 4MV9A 4G3FA 3KXHA 3UOHA 2H8HA 2J0MB 3L8VA 1LEZA 3WIGA 2CCIA 4D2SA 4E6QA 4TY1A 3GNIB 4U5JA 2YCQA 2YJRA 1KE5A 3LPBA 5M44A 4I4TF 2PE2A 3CXWA 5B2KA 5CF4A 3R5FA 4KRDA 1APME 4G3CA 5CQUA 3QGYA 2E9OA 2V58A 3MN3A 5AFVA 5AA9A 2VO3A 4EG0A 4BBEA 5FNVF 5AUTA 1K9AA 2GHGA 3FZ1A 3P5KA 5CEPA 1CMKE 5FEEA 5CU6A 5G1XA 4AZSA 4ZZNA 2R3JA 3K2LA 4K18A 2Z7RA 4DFBA 3O8TA 2UVYA 4XG2A 5EHYA 4CV8A 5BPYA 4JR3A 3ZMMA 2JKKA 2ZDUA 4RIWA 4A4OA 5EZYF 3W16A 4GEOA 4BCMA 1ZWSA 2BAJA 3AC8A 2ETKA 2A1AB 2UUEA 4C0TA 3RAWA 2F7XE 3E92A 4BBMA 5EW9A 3AD6A 3RK9A 4RC3A 5EM7A 1BYGA 1YW2A 1T46A 3QTIA 2UVZA 3WBLA 4XYMB 4V0GA 5CF6A 1E4EB 3QKLA 2ZDGA 4H3QA 3WZDA 4EK6A 4KBKA 4WNKA 4AW1A 1R78A 1JAMA 2YDJA 2PVRA 4HZSA 2CHLA 2GTNA 2PZIA 3C4ZA 2YS6A 4BHZA 1B38A 3D2IA 3DCVA 4FUYA 4L9IA 2XM9A 5JGAA 5DT0A 1KV1A 2YZMA 3PIXA 3NNUA 5H8BA 3UIUA 4UXQA 4USEA 3DBQA 5LMAA 4TRLA 3B8QA 3W2RA 1ZLTA 1EUDB 3CY2A 3KXNA 3ORIA 4FKSA 4R7HA 3HP2A 3FKNA 4GIHA 3LCSA 3NLBA 3BYMA 4LG4A 1ZYSA 2VO6A 2HOGA 4N57A 3ZLWA 2EB2A 2YIXA 3UMWA 4C02A 2W70A 5I9UA 4PP9A 4IVAA 5E91A 4ORKA 3OUNB 3NVMB 3KKVA 3PIZA 4BZNA 3KXZA 1DM2A 4I92A 3DFCB 2DLNA 2R3GA 5F1ZA 5IH4A 4EQUA 4C37A 2PZRA 4I1ZA 3VA7A 3RKBA 2JDSA 2XYNA 5TO8A 3BHTA 3P0MA 4EH4A 5CF5A 2BRNA 3F3ZA 3JZIA 1CS0A 3GU4A 3ACKA 4IVDA 5LVPA 3UQGA 2BILB 2HGSA 4D1XA 1ERKA 2OBJA 3I7CA 3MA3A 4XZ3B 3K54A 1FVTA 2QKRA 4NW6A 3ZZWA 3V8WA 4ACCA 4BCIA 4UYNA 2W4JA 3LIJA 1LPUA 1GAGA 1KE8A 2GCDA 4S34A 3VUMA 4AGDA 4PF4A 2BMCA 1YVJA 3F5PA 4C36A 4FNYA 4C34A 5CSPA 2RFSA 4LI5A 4QMSA 4USDA 4V04A 2WPAA 4DGGA 2BAQA 5AP6A 5FTGA 4DC2A 3HECA 5TR6A 4YBJA 3BGPA 2EWAA 4PTCA 4M97A 4NCTA 4YJQA 2GNFA 2XIZA 3DNDA 3TUBA 3ORQA 2XF0A 3RMFA 4CFWA 4DEIA 1GY3A 4FZDB 1KWPA 3NUUA 4NTTA 2YL2A 2C5YA 5CSXA 5CAEB 3GCVA 3NVKI 1LUFA 5L8JA 4FTLA 4L1KA 3OOMA 5JEBA 3TUCA 2QNJA 2EXMA 3RP9A 2IPXA 2OH4A 3SA0A 4CZUA 3VPCA 4AFJA 4WNPA 5D1JA 3W2OA 4BY9E 5CNNA 5DHJA 1MP8A 4PL5A 2X2MA 5DOSA 5IUIA 2R3RA 1NT2A 3ZLYA 3R30A 1VBGA 3V5PA 4ANLA 1ATPE 1CTPE 3R22A 2FSTX 5E9EA 4A9SA 2QO7A 3FDNA 3FY0A 1BNCA 4MNEA 4YAKB 3QD2B 2VV9A 3O71A 3PA4A 4K77A 1MRYA 2C5XA 5EI8A 2HELA 5F4NA 2OU7A 4A9UA 4NK9A 4BVUA 4C5AA 3HA8A 4UB7A 4XV3A 4UV0A 4EOMA 3U9TA 3EYHA 4JRVA 2C30A 3HKOA 4GV1A 1JDEA 3H9FA 3RV4A 2HW7A 1JOWB 3ITZA 4N6ZA 1OPJA 4YZNA 2B55A 5HNGA 5ANKA 3L8SA 3NZ0A 4JI9A 1H28A 4JG8A 4RZVA 5HU3A 3C4EA 4TT7A 5IEVA 5KMNA 4CFMA 4EH5A 5FXSA 4YNEA 4CG8A 3TQTA 4FA2A 3MPAA 4RX7A 4O82A 4OTIA 1KJIA 2F4JA 4ZEGA 5IA5A 3KQ7A 1H0VA 3N9XA 5DE2A 4UZDA 5DA3A 2V62A 4GJ2A 5JRSA 3BCEA 4C58A 1IEPA 3QC4A 2OIQA 1IOVA 4OR5A 4OTHA 3AC4A 2BDJA 3LJ1A 3GUBA 4HVDA 1FPUA 4I41A 4TW9A 3E8EA 4C38A 2ZM3A 4YBZB 2E9UA 3HV7A 3QGWA 4RVKA 3RPSA 4F9BA 5HTBA 3QFFA 1P4OA 4C35A 1QPCA 3R1SA 4IM3A 4N70A 5LP6F 3C5IA 3MPTA 4B0GA 4ZTLA 3HRCA 3AGLA 2FUMA 4NJ3A 4U6RA 5J8IA 3C1XA 1M2RA 4HW7A 5C4KA 2JBPA 2QURA 5DGZA 3BGZA 4FUXA 4L6QA 5KMLA 4AX8A 4TNDA 3DLZA 2YYAA 3C0GA 3QXPA 4UYAA 4K0YA 4FFRA 4EHVA 3ZXZA 5TOZA 3RM6A 4BYJA 1QCFA 4ZJJA 1UU8A 1Q8WA 4FZ6A 2ONLC 2IW8A 5CXHA 2QKWB 4XCUA 4RWKA 5M4CA 1A48A 4RRVA 3MY5A 5D9HA 5DI1A 3KALA 1P14A 1YQJA 4MKCA 5CU3A 1J7UA 4QP6A 3RCJA 3ULZA 3HBLA 3HDMA 2GQSA 1KE9A 4DEGA 3GBZA 2X0GA 3R28A 4G6OA 4QQJA 3FBVA 3OY1A 4RMZA 3WYYA 2FB9A 4GL9A 5EM8A 3TN8A 3KN5A 3UODA 5AUUA 2UV2A 3RGFA 3FI8A 3G0EA 3BG5A 5AADA 5KX5F 1OGUA 2Z04A 1ZRZA 4XP2A 2XIYA 4RJ5A 5L2SA 3ID6C 2YIYA 1NVRA 4H05A 3W55A 4YHFA 3BQCA 3BU6A 1Q8UA 1ND4A 1YXUA 4M84A 1H25A 3F61A 2FSMX 3QKMA 4IMYA 2XK8A 3FC2A 2DS1A 2W71A 3MTFA 4IB3A 4CV9A 4ZAUA 3W2CA 1QPJA 3ZBFA 5A6NA 4Q2AA 3POZA 1CSNA 3I0QA 3HLLA 3UYTA 2XP2A 5BVOA 4YB8B 1Z2PX 3Q3BA 2HK5A 4I3ZA 5FP5A 4F9CA 3V6RA 3RAIA 4YTCA 5LOHA 3CQUA 3F82A 3CKXA 3E63A 1O6YA 3OWKA 4NZWB 3SRVA 4QYYA 5FM2A 4BI1A 4H39A 4EOJA 4Y8VB 2CDZA 4YPSA 4QO9A 2WMQA 2R84A 4IHPA 4MV4A 2BTSA 4QQCA 4JDHA 4Z7GA 2WTWA 2J5EA 2XBJA 5CXZA 3A4PA 3P79A 3EQIA 4GFMA 4HNIA 5EW3A 3D5WA 1A9XA 4XNEA 4BB4A 4I94A 3UG1A 3BHHA 4ANQA 4AZVA 2BKKA 3Q32A 2F49A 1IASA 2ITXA 4FKRA 3BHUA 5LWNA 3RPYA 4NM7A 4B4LA 3DBDA 4MAMA 1PXIA 2W99B 3GB2A 3OWLA 1PF8A 2XKFA 3P4KA 5C03A 2WMWA 5FEQA 4IJ9A 4IZ7A 2I7QA 4FK6A 3I79A 2J6MA 4QP7A 4ZS0A 3ZRLA 2PBZA 4XP3A 2B9HA 2GS2A 3C50A 4QMLA 2YM3A 3OTVA 4XX9A 5HBHA 3TKUA 3WO0A 3JYAA 1GIIA 1OECA 3IONA 5LQFA 2BFXA 3LCTA 2W7XA 3WOWA 4BDEA 2YZNA 5BVWA 1VYWA 3LFNA 2VX1A 4TYHA 2QOIA 2RKUA 3VJNA 3LQ8A 1NY3A 3T8OA 5IQIA 1QPEA 4LM5A 4O7VA 4LUDA 4XYFA 2WNTA 3L8XA 5ACBC 5CEQA 3PTGA 2A27A 5L2WA 5GIOE 3G6HA 2UW4A 3GC0A 1DI9A 3UJGA 4YJ3F 4G5JA 3G33A 3NNVA 4Z9LA 2WQEA 3EFKA 4YJ2F 1ZYJA 3NUPA 1WBSA 2W4OA 3GU5A 2R82A 1RW8A 1LEWA 1XH7A 2GPHA 4ITIA 4BDGA 4E6AA 3ETHA 2XCKA 2CKOA 4FV6A 4JG6A 2J2IB 4XUFA 2VRXA 4IFCA 3KL8A 3EOCA 3VQUA 5FBOA 3EWHA 3HA6A 3GT8A 3Q5IA 3FC1X 2YABA 4M7IA 2IZTA 3B2WA 3CS9A 3EYGA 4WBOA 3CJFA 4O6EA 5CLPA 3WIKA 1XWSA 4HJOA 1J1CA 4MD7E 5AP0A 4AGUA 4ASXA 4B7TA 4CGAA 2PMNX 4MXYA 4XV9A 4J96A 2C6OA 3UOLA 1BMKA 5FDXA 5ETFA 2G2HA 5HG8A 3NAXA 3G9LX 4WNOA 1XBBA 2UZVA 2VTQA 3HUBA 2WEVA 3U4WA 1C30A 2OZOA 3DK7A 2CCHA 3HMIA 3DJ5A 1ZZ2A 2W6PA 4HVIA 3ZO2A 5DFPA 3KRLA 1Q24A 2BALA 3EQRA 1I44A 4AT5A 2C47A 4YHTA 4Q5HA 4DGNA 3AC3A 1OL2A 4FEXA 4AG8A 4WG3A 2YACA 2CMWA 2VTAA 4G2FA 2CKPA 4KIQA 3VUKA 4BTJA 4CD0A 4F7LA 1OUYA 2QQ7A 3HRFA 3PXYA 4FICA 3SV0A 3U8WA 5CZHA 2FP4B 5HG9A 3U9NA 4RIYB 4ARKA 1KC7A 3WF9A 2NU8B 3ZUUA 2ITTA 3PG1A 5DLSA 4FV2A 3PA5A 4PL3A 4TXCA 4FEWA 5BUIA 3LFFA 4NTSA 4R1YA 1PYEA 4O7ZA 4CSVA 5IYZF 2GQRA 3PUPA 3RWPA 1M0WA 2IVTA 4ZTHA 5HCZA 3QHRA 5HIEA 1I7NA 2VN9A 4FKVA 5ANIA 4ASEA 3MV5A 2PVKA 4N4SA 4A4XA 5HD4A 5DNRA 3EJ1A 4RIYA 5EYKA 5HG7A 4D58A 3EFWA 5DT4A 4TWCA 4KSQA 1IOWA 3K5HA 1H1PA 5E8ZA 4APPA 5D7AA 4W4VA 4BDCA 3UNKA 4IEBA 3R9NA 1C3OA 3OUZA 3G8DA 2CLQA 1XH8A 1JSUA 2PULA 4GJ3A 3AC1A 2X7OA 3FMHA 4QMUA 4OTWA 4RFYA 1JKTA 3NUAA 5IMEA 1ZMUA 5M4FA 3EQPA 2PTKA 2PVFA 3D83A 4QP1A 5IEYA 3OUUA 4HQ6A 2YIWA 3RALA 3VBQA 2JD5A 2GNLA 4Z7HA 5HGIA 3R9OA 4F64A 2QU6A 3CPCA 4MEDA 4MXCA 3VS6A 2XKEA 5B7VA 1AD5A 2HZ4A 3NCGA 3QBNA 4AU8A 3FZOA 3L1SA 3I81A 4L44A 3IKAA 3HYHA 3FMKA 4CLJA 3UZTA 4F7NA 4M0YA 3CPBA 5DN3A 4GFOA 3QQUA 4ENYA 2VO0A 3FLQA 5AUVA 4AOJA 3LFEA 3NS9A 3COKA 2WFYA 2ZV7A 4FVQA 2BR1A 3QUEA 3PE1A 5IUHA 5HVYA 4NSTA 4TWNA 4BCJA 3V3VA 2IVSA 5BVEA 3BYSA 5I9ZA 3HL7A 1PXNA 4XH6A 4Y73A 2BRBA 5ITAA 3C13A 4C4IA 4I5MA 5LVOA 1PW2A 2OKRA 1NW1A 2DWBA 3MBLA 4DH1A 4FSUA 4X3FA 1KE7A 5DR2A 4IAKA 5DVRA 5GJFA 4E8AA 5HU9A 4I6FA 2GDOA 2OK1A 5GHVA 2BUJA 3EKKA 3QRIA 4FSWA 4HNVA 4LFIA 5J5SA 5AV0A 4DGLC 3QTZA 3VW8A 3HZTA 2B4SB 4IHJF 5E8UA 1O9UA 3CSVA 2YWPA 3GENA 3TUDA 4X21A 2FSOX 3ORKA 4YZMA 5ANJA 5I0BA 3V5WA 2GFSA 2B9IA 4AOIA 4G3DA 3JVRA 1J1BA 1YI3A 2A4LA 4J7BA 4KB8A 3C4WA 1YWRA 4OBOA 3PG3A 1XO2B 2W1DA 1SNXA 1XH6A 4RZWA 3KU2A 5CI6A 2C6DA 3KXGA 2IW9A 3FV8A 5KHXA 3DXPA 3SKCA 2X6EA 4ZLYA 5HVKA 2HYYA 4FGRA 4FT0A 4I5PA 4DE4A 4DG0E 2V59A 2VTSA 3I0OA 3CY3A 4FFMA 3R9HA 1VR2A 2PK9A 5EOBA 5LMBA 1W7HA 3MY0A 2W9ZB 4E4MA 1Z5MA 2Y4IC 3A61A 1TKIA 2I0EA 1GSAA 4OUCA 2YRWA 4MWHA 1MUOA 5DMXA 2VWWA 3NR9A 1M2QA 2C3KA 2F7EE 4DH5A 2I1MA 3CE3A 2BRGA 4L01A 4BDHA 4DT8A 4RIXB 3B8RA 2R3QA 3MH2A 4DG2E 5I4NA 1OPLA 4YUQA 5M06A 2H96A 3QYWA 4S2ZA 5AV4A 1GSOA 2C6EA 4FG7A 5H8GA 3R8ZA 3PPZA 3VS1A 3CJGA 4MBLA 2HJWA 4QP9A 1H01A 2CGWA 2NRUA 2WIHA 4CZTA 4HCTA 5CAQA 5HIBA 2R87A 2VGOA 2V7OA 4E4TA 3PPKA 3LE6A 5IDNA 4AFEA 4YZBA 3TNHA 3ETAA 4O7LA 3H9OA 2WQMA 2W17A 1M52A 4GT5A 4M68A 4RX8A 2UZTA 4YC8A 5DR9A 2C5NA 2JDTA 1GOLA 3PSBA 3OEZA 3Q96A 4L67A 4WKQA 5FD2A 2WELA 3VUHA 4FTKA 4EHZA 5CEOA 5KUPA 2ACXA 5CA0F 4FTIA 3D4QA 2VWYA 3ZBXA 4IZOA 4U43A 2Y4IB 5E8WA 3SE7A 3QQJA 3ZCLA 3WZUA 4BCNA 4CVAA 3V4ZA 2RGPA 1MQ4A 4LMNA 2QO9A 4EH2A 1UKHA 2Y9QA 3MB7A 3DTCA 1OZ1A 5BVFA 3KFAA 3A8XA 2FPIB 2YM4A 4ME6A 1YDTE 3WYXA 3WZKA 5IH6A 2V7AA 3OG7A 3A7IA 5LJJA 5FEDA 2RFEA 3R02A 3AT4A 2OGVA 3ZFMA 2Y7JA 1TVOA 5C9CA 3PWDA 4DTKA 1YI4A 4L3LA 2WOTA 1UNLA 2XJ1A 4MX9A 1WZYA 4O27B 4Y8DA 1PJKA 2YN8A 3F2NA 4FTUA 4N6YA 4CMUA 4S30A 4FU0A 1BKXA 2WMVA 5CF8A 4XJ0A 4EOOA 1M7NA 2R85A 4GYGA 1KE6A 1UU9A 2JAMA 4YJUA 1Z9XA 3KGAA 5IZFA 2ERZE 3VVHA 1W83A 4KIPA 2I87A 2BIYA 4AZWA 4E26A 4BCFA 2C1BA 5CANA 3JR1A 3SXRA 2HIWA 2YJSA 2WTDA 2CSNA 4S32A 3UC4A 4A9TA 4ZTNA 3GGFA 4IDTA 5CA1F 4J52A 5KKRC 4EYJA 3TIIA 4RVLA 3ZLSA 3KXXA 5DRDA 2XM8A 4KSPA 4MXOA 4DBXA 2EU9A 2QOKA 3QTWA 3QYZA 4CRSA 1UNGA 3PXZA 4U42A 1H1WA 1SNUA 1WBVA 3F88A 2XK4A 3KA0A 2JKQA 3RNIA 5BMVF 3GQIA 4YLJA 5BYYA 4GUEA 2WMXA 2YIQA 1M7QA 1I09A 4QQTA 3W2PA 4G31A 5ICPA 5IPJA 2C6LA 3TM0A 4G9RA 4YMJA 2WMUA 4P2KA 3DFAA 5J2TF 5FQDC 1XKKA 3RPRA 3WE4A 1PKDA 3U4UA 1CKIA 2QLQA 5GNKA 3KRJA 2C0OA 4BCQA 4TN6A 4AN9A 5KNJA 2EXCX 2YM6A 5KMIA 3ZLXA 2OI4X 3LAUA 3NYOA 4TKSA 2W1GA 3NIZA 4MCVA 5DT3A 3W8QA 3ZS5A 3BE9A 4YHJA 4F1MA 5C8NA 5JK3A 3RV3A 2BZKB 2OLSA 2R7NA 3FZPA 1U5RA 3F3VA 5LCKA 1E1VA 3F7WA 4U9AA 3K3PA 4FKJA 1T36A 5CASA 2XIXA 2J90A 4YLKA 4BZDA 3A7FA 3V6SA 4BDBA 1X8BA 4AGWA 3HEGA 3ORLA 1V0OA 3NEWA 3TT0A 1WBPA 3UNJA 5B2MA 3WE8A 3D7TB 3CR0A 4JVGA 3LCDA 3TACA 1SMHA 2FVDA 3TIYA 4BBFA 3SVVA 2QOCA 3PVBA 4FKQA 1A06A 3A7HA 2O65A 1YDRE 3O96A 4R6VA 4U40A 2W05A 3GCUA 3PIYA 5HICA 5HLWA 5IA4A 4J8NA 2QONA 1Y8YA 5DBXA 4ZZMA 3UVQA 2QR8A 1PX2A 3MWEA 5J2UF 4IVBA 2PMOX 2GNJA 4HYIA 5AM7A 2C5OA 2JDRA 2WKMA 1W84A 2GNGA 4A07A 2QHNA 2QOFA 2ITPA 2VNYA 3ERKA 3KULB 3OWJA 3QCXA 5CT0A 5HE1A 3DZQA 3OBJA 3QRKA 1KJJA 3DXQA 3FHRA 4HNFA 2PL0A 1GZKA 5CVHA 4IAFA 3LFSA 3QA0A 3IGGA 4IX3A 3I7BA 5C27A 4CRLA 4F63A 4D4RA 4WUAA 4AA5A 4O2BF 4QMWA 4KKGA 1URCA 3NCZA 2BDWA 4D28A 2QOOA 4EKLA 4R3RA 4Z3VA 4L42A 3T9IA 1Y6AA 4QMZA 1JLLB 3D5VA 3KC3A 3KULA 3MTLA 2NPQA 5AUXA 5JQ5A 5BVNA 1L3RE 2VWVA 1Y8GA 5K9IA 1XBCA 3RAKA 5C1PA 2VR1A 4FX3A 2W9FB 2XEZA 3IW7A 3RK5A 4R3PA 1G3NA 4G9CA 4QP8A 4EKKA 4O7SA 5DH3A 3GVUA 5K3YA 2VU3A 4DINA 4CT2A 5EOLA 3ZO3A 3DT1A 3LM5A 3FEGA 2R9SA 4RVTA 2XIRA 4IAIA 4CFXA 4ZTSA 3R8PA 4DH7A 1PMVA 4DH3A 4EOQA 3PXQA 3OCBA 4ZSGA 4R5SA 1JSTA 1J7LA 3G0FA 2CKEA 3VBVA 3NUSA 4UN0C 3BPRA 1YXVA 2HXQA 2ZMDA 5CAUA 4E1ZA 1V0PA 4HVSA 3C9WA 2IN6A 4D1ZA 1PXPA 3O51A 5CVFA 5IQDA 3R1NA 2WGJA 3NDMA 2YM5A 1K2PA 3BU3A 3NIEA 4H3BA 3UO5A 4GT4A 3LOKA 3MJ1A 3QTXA 5AP1A 4HNTA 2GMXA 5CU2A 3TL8A 3UDBA 4DBNA 4OW8A 3RPVA 3ZM4A 4FIJA 4M3QA 2WU7A 1E4EA 4A7CA 3LXNA 4FODA 2W1ZA 1Q62A 2B9JA 4I4FA 3W2QA 4ITHA 4BKJA 3A8WA 3PVWA 5HV6A 1FINA 3Q4UA 3SW4A 2OIBA 5KBQA 1O6KA 2RG6A 4D4SA 2C69A 1BI8A 1UA2A 3ZFYA 4DF3A 4I20A 1U54B 2OO8X 2PUNA 2QOLA 4BCKA 5E8YA 1XJDA 3F5XA 4DA5A 4F08A 5KBRA 2DUVA 3MFTA 2R3NA 5M51A 3DBFA 1CDKA 4NCTC 3BBTB 4F0GA 3VIDA 3GCQA 1W93A 4X3JA 2R3FA 3MI9A 3R2BA 2R7BA 3PXKA 3GP0A 3R7YA 1G8AA 1EUCB 3MJFA 4HOKA 4D9UA 1Q41A 3H4JA 2QO2A 3RUPA 4WG4A 2ETMA 2YITA 4FSMA 4ACHA 4DFXE 3MDYA 3AC2A 2PVNA 2QHMA 2AC3A 3DXNA 4HPTE 1H8FA 4JR7A 4P4CA 3SXFA 3U55A 4JDIA 3ZONA 4G5PA 3VBXA 4X2NA 2JFLA 4ONAA 4NU1A 5ACKA 2B9FA 5M53A
chains in the Genus database with same CATH superfamily
4CG9A 2A0CX 2C6KA 3H9RA 3KB7A 4FTAA 3PY3A 1HCLA 1FMKA 3NRMA 5EW8A 3FMJA 4FVRA 4Q9SA 2ZVAA 3NYNA 1RQQA 1IA9A 4FL1A 4GT3A 4U41A 1LR4A 4Y72A 2ITOA 5J1VA 4EH7A 2EUFB 1PK8A 5BYBA 2Y6MA 3QD0A 1A0IA 1QMZA 3N4TA 1KEEA 2XYUA 1PXOA 4QMYA 4TV8F 2WAJA 1YXSA 3DKFA 3H30A 3QZIA 3R1QA 4YJVA 2ABJA 1GZNA 4FV5A 2O64A 5KO1A 1VYZA 2OZAB 3G15A 4L68A 4M14A 2F7ZE 5A4LA 1B6RA 5FPOA 4EGQA 3FXZA 3AKKA 3GLKA 4UWBA 5D1OB 2VAGA 3UVRA 3BA8A 4U79A 4YJNA 3BLQA 2XNEA 5HKMA 3BAAA 1ZXEA 3MIAA 4PMTA 4FFPA 5K5NA 2JIVA 5JN2A 1CQIB 4RQVA 3COHA 4QDEA 3VS3A 3CQEA 4EYMA 3FZTA 1Q8YA 4KNBA 4HPUE 4YJTA 4NYEA 2XAOA 3QX4A 4X2KA 1JKSA 5IA3A 3PWYA 5D1OA 1YKRA 4JBOA 3GCSA 5F95A 2XK6A 2PZPA 4E4LA 4TVIA 3R01A 4K9YA 4Q5EA 3W10A 2W6ZA 3TIGA 3ET7A 2ZV2A 3QZGA 3CTHA 4D9TA 4LQMA 2KTYA 4U0IA 3OROA 5KX8A 3FLSA 2WTKC 3RTPA 3LCOA 3NW5A 4IB5A 3LCKA 4AQCA 5CEIA 4EOLA 3HMOA 4I22A 4P7EA 4FEQA 5DISC 4W4XA 4FVPA 1RJBA 1OKYA 4FKLA 3BV2A 4G1WA 2YFXA 4YJPA 3U87A 5J95A 3T54A 2X39A 3LM0A 3EQFA 4QDVA 5EQPA 4BZOA 1M14A 3OXZA 2FA2A 3VNNA 1VKZA 3A99A 3NX8A 4FTMA 4AA4A 3DBCA 4QTEA 5AIKA 4TWPA 5JT2A 2GNHA 3F5UA 4G3EA 5CNOA 4OBQA 3C51A 3TEKA 4D55A 2RIOA 3LLAA 2PN1A 1GZOA 3FSKA 3EN4A 3PDTA 3Q1KA 4GVJA 3MB6A 3LP8A 5L6PA 4EK4A 4EL9A 1J3HA 5KHWA 4OTGA 4FSNA 4GG5A 4YSMA 4C3FA 4GLXA 4FEVA 5I9XA 1DIKA 1F5QA 2W6MA 2ERKA 3P9JA 5BWRA 1UVRA 2CJMA 3A7JA 1CE8A 4JX3A 5KE0A 5JZJA 3QCYA 4MNFA 1G2WA 4FG8A 2XKCA 4PWNA 3V01A 3ZH8A 2XJ2A 2A1HA 2WD1A 3QC9A 2BPMA 4QYHA 2XRUA 2ETRA 4XG3A 1KUTA 4IM2A 4IC7A 2P0AA 3R9RA 1P2AA 5AX3A 3PP1A 3PFQA 5TT7A 3ZO4A 4UXLA 5CZIA 3R04A 4CMDA 2I0VA 4FT9A 4ZSLA 5J9YA 2IVUA 2VX3A 3BLAA 4QMQA 1OITA 3ODZX 4DEAA 4GRBA 4AS0A 4JQ7A 4BR3A 5BX0A 3HB9A 4F9WA 4JIKA 5EI6A 1OL6A 4ALUA 1OBGA 5BV3A 5A3XA 4JAIA 3I60A 3NFFB 1R39A 1KJ8A 1O6LA 1UV5A 2E9VA 3P08A 1KOBA 5AP3A 4EHGA 1URWA 3T9EA 1AGWA 5M56A 3QF9A 3VRZA 1GSHA 1GIJA 2XVDA 3O23A 4FOCA 4FKWA 2W5AA 3DNEA 3FMNA 2QK4A 3PRIA 2C6IA 2UZNA 3C5UA 4AW0A 3U6IA 3JSNA 4RJ4A 1Y6BA 4O0VA 3QQKA 4WNMA 5BNJA 2C3JA 5HQ0A 5FR9A 3QZFA 2XK7A 3OT8A 4DH8A 5CAOA 3RVGA 3ZSHA 2ZDHA 4KA3A 3LFBA 3QFVA 3UOKA 5J9ZA 5BPHA 4L00A 1BL6A 3OD6X 2XZSA 2R3OA 5EYCA 3ZZEA 5CEMA 2CKQA 1FVVA 4MV7A 1Z57A 3MFUA 1NXKA 3MPMA 4MAOA 4YO4A 3FMEA 3AQVA 2X8EA 4EI4A 4ZMFA 4TYEA 5A46A 4ZTQA 4YZDA 3D14A 4MA0A 3DV3A 4MXXA 4OT6A 4WA9A 4BI2A 5A6OA 4EZ3A 1LP4A 3QALE 2PU8A 3NYVA 2R4BA 4PMSA 1J91A 3BI6A 3M42A 4RA4A 4AQKA 5AA8A 3TV6A 3JUHA 5FPRA 3AMBA 3PE2A 1DV2A 1VZOA 3ZHPC 4XHKB 3VBWA 2UZOA 3D0EA 2PUUA 4EH3A 2NRYA 2OJ9A 3C0IA 5HI2A 4AOTA 2YWVA 3LMIA 4BI0A 4GS6A 4AW5A 4MWIA 1TQIA 3KY2A 2IG7A 5E90A 3WWIA 3I6UA 3EN5A 4B8LA 1E9HA 1WVXA 3ROYA 1DS5A 3IK3A 5DEWA 4YSJA 2OWBA 5BUEA 3FWQA 2JIIA 3T3UA 2VWIA 1S9IA 4XRLA 4FKPA 5HCXA 2I80A 3AG9A 4O2PA 5AEPA 5CQWA 3NMUF 4UCOA 4D2RA 5D10A 3E8NA 4E20A 4NKSA 3E8CA 4FG9A 3R8UA 4LH7A 4HYSA 4LUEA 3ZDIA 1JKKA 5IQCA 4XG8A 4ALVA 2OFVA 5LMKC 1P16A 3IOPA 3T3VA 3PJ2A 4KKHA 3KVWA 1FVRA 2JIUA 2X4ZA 4ZP5A 5IG1A 3U6HA 1ZARA 2FO0A 4N0SA 4JNWA 3TJCA 4YGAA 3W0MA 4ZLOA 4FT5A 5JH6A 3G6GA 4DTBA 4EUTA 5LVNA 4PDYA 3OHTA 1H27A 3ORRA 2ZB1A 1U4DA 3KVXA 3D9VA 4J99A 4OTDA 3KREA 4YZ9A 5EDPA 3ZC5A 3UQFA 2VUWA 2ZYBA 4HGEA 4LH6A 4CQEA 1SVHA 3OCGA 3F3TA 3ZDUA 4MXZA 4PNIA 4QP2A 4DDIA 1P8LA 5HX6A 4LV7A 3I5NA 1PRYA 1M0TA 4EJ7A 3ZUVA 1H24A 4WG5A 4DEEA 3DDQA 2CGVA 4YC3A 2BZIB 3SD0A 1F3MC 4RGJA 5FLFA 1R1WA 2UZWE 3TDVA 3V4SA 4G3GA 3GU8A 4BTFA 2LGCA 4ACGA 3VJOA 3R23A 2X4FA 2HZ0A 1J7IA 3HAVA 3UIBA 3ZC6A 2HW6A 3D2KA 4DAWA 3FSFA 3UZPA 2X0SA 4IAYA 3AT3A 3W0NA 3UZBA 1V1KA 2X9EA 4C61A 2RFNA 4LDTA 4C3RA 2VUGA 4BICA 5E8SA 4C3PA 4E73A 4Z55A 4TV9F 5CI7A 1EYZA 3LZBA 3RAHA 4H3PA 4TL0A 4FV8A 3UO6A 5IU2A 3NGAA 4CEGA 3NUYA 2ZM4A 3EMGA 3DTFA 2IZSA 2WTJA 3A60A 3TXOA 3DAJA 4ZQIA 3DQWA 4WOVA 4UWYA 4PRJA 3PSDA 3NYXA 2X8DA 4U7ZA 3HAMA 5BQ0A 3OY3A 2VWZA 1JLUE 3SOCA 5HEZA 3GEQA 4O6LA 5C1OA 3CTQA 5E92A 1XQZA 3AC5A 4PY1A 1TAEA 4YTFA 4BRXA 3GIDA 4BGHA 3K5IA 2H34A 2COIA 2J5FA 4FSQA 4JMQA 3ZXTA 3TEIA 5HZNA 4BTKA 2P55A 1YOMA 3VC4A 2UZBA 4JQEA 5JFSA 1L8TA 5GJGA 3T7AA 4A4LA 2VX0A 5BYAA 1Z2NX 1YXXA 1PXJA 5JH7F 2YAKA 4L7FA 3LFQA 3PFYA 3LKMA 5J1WA 2JAVA 2CZGA 3NUXA 4TNBA 3WNZA 2R3IA 3KN6A 3AX6A 4HVGA 3ZEPA 4ZTRA 1JDBB 4RJ8A 2Z7LA 3FPQA 2PVPA 5M4UA 2WTVA 3UIMA 3F2AA 4P5ZA 3K3JA 1IR3A 2X7GA 5CX9A 5FUTA 4M69B 5EK7A 4WHXA 5E1EA 2JFMA 3DGKA 3G90X 2YA9A 3TIZA 4MA5A 2V55A 4CKJA 3U6JA 3EN9A 5H80A 3AGMA 3LLTA 5CENA 4ZSAA 5TF9A 1JKLA 3BACA 3PY1A 3ZOSA 5D8DA 4EK3A 1M6VA 3KXMA 3WF8A 4L3PA 2WMSA 4F65A 4FI1A 4MF1A 4IH8A 5JZNA 4KS7A 4IDVA 3QD4A 3SAYA 4HZRA 2BHEA 4PZ7A 1ZOEA 2BAKA 3W0RA 3KRWA 3QTSA 3UDZA 4RLKA 2VTHA 4EEVA 3R5XA 3ALNA 4A9YA 2R7LA 2B0QA 4P90A 2BIKB 4RIOA 4X3FC 3EN7A 4R7IA 2WMAA 1FGIA 1GIHA 3EFJA 4YNOA 4BCPA 4KAOA 3SG9A 4O0TA 4K8AA 3V5JA 5A4CA 2FB8A 3RHKA 4CNHA 3I4BA 3EN6A 3M11A 4YLLA 4JDJA 3TJDA 1EHIA 3GFEA 4C62A 3UDTA 3FI2A 5JFVA 4QT1A 2ZB0A 2G01A 3F2RA 4EWQA 4PDOA 3K5VA 5KMOA 5CWZA 3VS5A 4EC8A 2V5AA 3UP7A 5EKNA 2UW9A 4LMUA 2QCSA 2YM7A 3FQHA 2RL5A 4FGBA 5EHLA 4YPDA 3TY5A 3SHEA 2HG8A 3AMYA 3DPKA 4W8EA 4MQ2A 5E7RA 4G34A 1DAAA 3G8CA 4EGJA 4DAAA 5A4QA 4IACA 3PXRA 2F2UA 4DFUA 5D1PA 3MVJA 3FLNC 3H0YA 3NW6A 2RFDA 2GHLA 2VTPA 2Z7QA 4XMOA 2ZV9A 1H1QA 3BYOA 3MH3A 3CBLA 4ASDA 3SQQA 4J8MA 2C00A 5ETCA 2VTJA 3FLYA 2NU6B 4AE9A 3LULA 5AWMA 1B6SA 5B2LA 4FYNA 2BCJA 5LYJF 4EZ7A 5C8YF 3E88A 4F0FA 3IO7A 3CCNA 4RVMA 3TKHA 3F69A 2YDIA 3DKOA 2VO7A 2CNVA 4QTCA 5EQEA 5FRIA 3QUPA 4AACA 4ANMA 1HCKA 3UE4A 3R6XA 4DFNA 2UVXA 4U3YA 2O5KA 3Q4TA 3L9PA 1G8SA 3AT2A 3E5AA 3GOPA 1W96A 2VTMA 4OGRA 2WU6A 2FSLX 1CKPA 2OJIA 2X1NA 5HD7A 4ANSA 4BC6A 3FMMA 4PDSA 3LWBA 4F1TA 3JZ6A 1VBHA 1YHVA 4YAJB 3NSZA 3SOAA 2VWBA 3PZEA 3QXOA 2PUPA 2XNOA 4FKGA 4P5QA 4IADA 4PDPA 3CD8A 2CLXA 4FKOA 5EM6A 4AXEA 4RT7A 2R7KA 2QG7A 3ZSGA 3MVHA 3IG7A 5BMMA 3L8PA 4X0MA 2ZOQA 3TW6A 3QKKA 4IWYA 3OWPA 3BEAA 1SYKA 2C5VA 1G8KA 4U8ZA 5JVDF 1Y91A 4I0RA 3R1YA 1YHWA 1PXKA 3FZSA 3DQXA 3R73A 3W18A 3GC9A 3TZMA 2QODA 3BZ3A 3WI6A 5FXRA 4UX9A 3JRXA 3LXLA 4MH7A 5AP2A 5CSWA 3OEFX 1WRVA 4DEDA 3ORNA 5CT7A 1BL7A 1UNHA 5E8VA 5HO8A 4O4JF 2NO3A 3II5A 4MYGA 4TYJA 2B53A 2F57A 5HNBA 5LXTF 4GSBA 3R7VA 5I9VA 4O0YA 1STCE 2PVYA 5JGBA 4LOOA 2B1PA 1WVYA 1YHSA 2GS7A 2JBOA 4FNXA 4RIXA 3OT3A 4IJPA 4TUYF 5DWRA 3UIXA 3GU7A 3L9NA 3I6WA 2B54A 3DB6A 4HGLA 4HVHA 2VTOA 5CEKA 4FSYA 2J0KA 3DAEA 3MSSA 4O0UA 4IIRA 3C0HA 3QRJA 4AT4A 2VZ6A 2IZUA 3LFAA 4DCAA 5AIRA 3O7LD 4J95A 4QMPA 4E6CA 4NWMA 4LGHA 4O84A 2YIRA 4RFMA 4BDAA 3WZEA 4ZS4A 5C4LA 3ENHA 5E4HA 3PJ8A 3PJ3A 3VBYA 1I2KA 2I6LA 3TNPC 4UY9A 3LFDA 1Q8ZA 3UZRA 5HORA 2YZGA 2G1TA 4AAYA 3O5AA 5J87A 1OIRA 2WTCA 4J53A 3BYVA 1SCUB 3S2PA 5I5UA 1ZOGA 2VD5A 1HOWA 3V5LA 5JSMA 4O21A 1B39A 3IDBA 3QQFA 4OT5A 4EORA 5DAAA 3NPCA 3HV5A 3EQDA 1DI8A 1Q5KA 2GTMA 5AV2A 4FIGA 4MV8A 3ZRMA 3GU6A 4GYIA 3B2TA 4OTQA 4F09A 2OH0E 3HV6A 3DDPA 5DG5A 3SGCA 2PPQA 3UBDA 2CN5A 2Z8CA 4II5A 3TTIA 5I5VA 4ZJIA 2GPWA 2JC6A 3EZVA 3QL8A 4A06A 4FV1A 1ULZA 2OF2A 2QOHA 4JQ8A 4F1OA 4WRSA 2OG8A 3QTUA 1CQJB 1SZMA 4O0WA 4OTRA 4EUUA 4YR8A 1JWHA 2HIXA 3MWUA 3PLSA 4WUNA 5HE2A 1RDQE 2WQBA 4PX6A 1P4FA 5LCJA 4FTNA 4BCGA 3D15A 5IQBA 4GK4A 2HZIA 3H3CA 4O7YA 4RWIA 4HYUA 4EOSA 1Q3DA 2XNMA 2BFYA 2QF7A 3RTXA 3AKJA 4E5BA 2B52A 4U80A 4ZK5A 3W1FA 2C68A 2WMBA 5IUGA 1PXLA 2AYPA 4FTQA 4IX4A 2WZJA 1XHAA 4MXAA 4UALA 4GUBA 5ANGA 2ITWA 4PTGA 4XOZA 1CKOA 5EHOA 4CKRA 2AC5A 4DITA 5DIAA 2F9GA 3ODYX 3VN9A 3TG1A 4FV0A 3F6XA 4WHZA 3TKIA 1QL6A 1JQHA 3EKNA 3TY8A 3BKBA 5JFXA 2QR7A 4EZ5A 2WO6A 3BLRA 3QD3A 4D5HA 1E1XA 1PY5A 3Q4ZA 4QTDA 2BRHA 4I93A 5HESA 3T9BA 2GHMA 3GC8A 3TNQB 4FZAB 2VTTA 3TCPA 4O96A 4DG3E 2OXYA 1IRKA 3CKWA 3FY2A 2EJ0A 4JT3A 4KABA 5KMKA 1EH4A 3OTUA 1YWNA 3QRTA 4F6SA 5C01A 3CLYA 3FZRA 3HP5A 4ALWA 3DJ7A 3Q53A 5I9WA 4O0SA 1RE8A 5IA1A 2CNQA 4BN1A 5AP5A 4UCUA 4GVAA 4I21A 3FL4A 2R3KA 4IX5A 3PXFA 4R77A 5E8TA 2ITZA 5KKRB 5TKDA 5A14A 4WD5A 2OLCA 2OICA 4LGGA 4R1VA 5CVGA 2PE1A 3VMMA 3F66A 3O8UA 4BHNA 3IW4A 3VS7A 5M09A 2ZMCA 3RHXA 1WAKA 3U9SA 4AN2A 3CGFA 3OP5A 3QWUA 1BLXA 3FKLA 3FI3A 4JRNA 3MVMA 4FFOA 4TYGA 4CC6A 4CKCA 2W1HA 3V51A 2HHFB 2X81A 2XALA 4O81A 4XV2A 4CMOA 5IISA 4Y83A 3I1AA 2UW0A 3NWWA 2J7TA 4FKTA 4XBUA 3LJ0A 4O22A 1JBPE 2BDFA 4OBPA 3VQHA 4D4YA 2YRXA 3KCFA 2R3HA 1WBOA 4AZEA 2XK9A 3R00A 4XBRA 2O63A 2BRMA 5I9YA 3D7TA 2J50A 3ANRA 4L43A 4I6QA 3W2SA 3PVGA 3PRFA 2F2CB 2XKDA 4IE9A 1YRPA 2YCRA 4I5CA 4I5HA 2X2KA 1FQ1B 3WARA 2IJMA 4ZY6A 3P23A 5AUYA 5ETAA 3VUGA 2XNPA 5HBEA 5HVJA 4WBNF 3LQ5A 3ENMA 4FV4A 3AD4A 4XG6A 4AUAA 3HO8A 4FL3A 4AP7A 4KKEA 3UMXA 3R8MA 3QWJA 5IQAA 4BIBA 4M15A 4W4YA 4DRFA 2OIDA 5FP6A 1S68A 1NA7A 3BE2A 4QMNA 4LV5A 3UYSA 3T9TA 3A4OX 4NFNA 5CB4F 4UBAA 2SRCA 3P7AA 3QZHA 3R7OA 4M67A 4EH8A 3IS5A 2PSQA 3RZBA 5H8EA 2PMIA 3AD5A 4MD9E 3QTRA 4X2JA 5LOVF 5CALA 3E3PA 5H2UA 4I24A 3KF7A 3R2YA 1XR1A 3TZ8A 4EOPA 2PY3A 5C8KA 2R7MA 2R5TA 2VGPA 3R63A 3AW8A 4K1BA 3ZUTA 4WRGA 4YTHA 5BUJA 5EM5A 1ZAOA 4CFNA 2NU7B 3FQEA 3K3IA 5LVMA 3MFSA 2WIPA 1M17A 4FEUA 1W98A 3S3IA 1JSVA 1T45A 3ORXA 4K2RA 4DEBA 5BVDA 1YDSE 4RIWB 1KJQA 2I8CA 3TDWA 1JNKA 2ZJWA 3BA9A 3DZOA 3ZO1A 4KBCA 3FLWA 4AE6A 2IVVA 4RZQA 2YZAA 4KRCA 2BHHA 4LYNA 5EFQA 1UC8A 3G9NA 3O7LB 4H1JA 4IVCA 2XCHA 3HMMA 4V0GB 3WF6A 3HT5A 4QOXA 3Q9YA 3E87A 3FMLA 1PMEA 4IW0A 4NW5A 1OIQA 4AWIA 3G2FA 3UDSA 4TM5A 3TI1A 2C0TA 5K5XA 4K33A 3E3BX 3DY7A 3E93A 2G9XA 3VBTA 3BEGA 4KWPA 3EB0A 3O50A 3TV7A 3UG2A 2PVMA 4FTRA 3V8SA 4CTBA 4ERKA 2BZHB 4WO5A 5HNIX 5KZ0A 4XRJA 5GIPE 3OZ6A 2R0UA 3GFWA 3CC6A 3KAKA 4XLIA 3MY1A 2C3IB 4FR4A 3R9DA 2G2FA 3PFFA 3O2MA 4C33A 4FIEA 1REJA 2JDVA 4EQCA 1WCCA 2C3LA 2WXVA 4MQ1A 2ITUA 4KIOA 4DFLA 4ZJVA 4YU2A 5AAEA 4XG9A 4C4HA 3S1HA 4F0IA 1PYXA 1GZ8A 2W5HA 4I0SA 3HDNA 5DGHA 3BLHA 5I60A 5IA2A 3L9LA 3REPA 4M8TA 2R2PA 1U54A 2WMTA 2IWIA 3D7ZA 3MYGA 3Q9ZA 4NIFB 4XLVA 3KYHC 5BPFA 5CYIA 3CQWA 1A9UA 2XRWA 3NW7A 2OF4A 4E7WA 2HENA 2R3LA 4AGCA 4EJNA 4U3ZA 4DLKA 3N51A 4GW8A 4GU9A 4IAAA 4O7TA 4EK5A 5AAGA 3ATSA 2QD9A 3E7OA 2QVSE 2ITYA 4XG7A 4MK0A 1TQMA 4HNUA 1IAJA 3U51A 3VS2A 4BDFA 5BWVA 4BDJA 4LOPA 4PQNA 3F5GA 4RC2A 4G6LA 4TZRA 3SX9A 3VHEA 3R83A 1ST0A 2PWLA 5HG5A 5F9EA 4BJJB 5KMJA 4ZZOA 3BX5A 4Y85A 3CEKA 3TINA 5HTCA 4RJ6A 4MV1A 4O4IF 3EL8A 3FHIA 4G16A 3COMA 3MS9A 2YISA 4AXCA 1EZ1A 3DTWA 5K2MA 3Q4CA 3PY0A 1OGYA 4C7TA 4E5AX 3PSCA 3Q2MA 5F20A 3Q04A 3R8VA 5A9UA 4C4GA 4L45A 3FAAA 3UPXA 1FGKA 3FJQE 4BCHA 4ZHQF 2VNWA 5JFWA 4GKHA 2FYSA 2GPSA 2GSFA 4L52A 4LL0A 2PZ5A 2R86A 1UWHA 5M08A 4M0JA 4DCEA 2OZAA 1S9JA 4JAJA 2YERA 4LRKA 3VF9A 3BHVA 4CCBA 3CTJA 4QTAA 2FGIA 2O2UA 1UKIA 5FGKA 4EONA 5IDPA 3PJCA 1YOJA 2H6DA 4QTBA 5LA6F 1YOLA 2UZUE 1I7LA 2ZV8A 1H26A 3MJ2A 4RC4A 3SW7A 3S24A 3ORMA 1GLVA 2R7IA 2V5QA 3OXIA 4CTCA 4JXFA 3WWHA 3MFRA 3I5ZA 1R3CA 1WFCA 2ITNA 4M0ZA 5CS6A 4K11A 4B8MA 2GFCA 2EJ2A 3P7BA 4NH1A 2PUIA 2OFUA 3QU0A 3E64A 4ASZA 3QLFA 1VEBA 4FZ7A 1YXTA 4R3CA 2W4KA 2ESMA 3FYKX 4MNEB 5K3WA 5I5ZA 5KMMA 2YCFA 1PHKA 3OUKA 4GMYA 2PMLX 2XMYA 3M1SA 3DF7A 2QU5A 4DGMA 4HGTA 4EK8A 3G51A 3ZM9A 2EIYA 3N6RA 3VS4A 1K3AA 4KS8A 1PKGA 2WQOA 3KMMA 5CAPA 4Q9ZA 4FSZA 5T68A 2UZEA 2Z7SA 5T6KA 4FMQA 4DTAA 1KV2A 1OVEA 2ITQA 2UZDA 2J9MA 3UQCA 2P0CA 1MRVA 3TZ9A 2QG5A 4A9RA 3OCSA 3JY0A 4ID7A 4JOAA 4AT3A 4MHAA 1H00A 2QOQA 5D11A 4ACMA 3QQGA 4B6LA 4ZXTA 1EKFA 3KF4A 1UC9A 4G6NA 4RJ3A 4Y95A 5M07A 1QPDA 3TV4A 2B7AA 4DLJA 4HN2A 2HWOA 4C4EA 5L8KA 2HDKA 4RX9A 1ZYCA 4ZIMA 3HGKA 5CU4A 4BDIA 2WTKB 1FBNA 3E5NA 2OJFE 1UU7A 4UZHA 4I50F 2ITVA 3DBEA 3QUDA 3ZU7A 2W1CA 5CY3A 3TNWA 3BWJA 5L6OA 3GDEA 4F6UA 1VJYA 3EIDA 3OS3A 3Q2JA 4GU6A 4HCUA 3MIYA 2UZLA 4UWCA 4XP0A 4F6WA 5LWMA 1WVWA 4HGSA 3ZFXA 2IP4A 3Q60A 4H58A 2FPPB 1NVSA 2PZYA 4NKAA 5IA0A 5HBRB 4FE2A 5LVLA 4Q4CA 5AP4A 4O4HF 2V0DA 4NJDA 3C4XA 2CGUA 4RCNA 4QSHA 5JQGF 4TPTA 4ZLZA 1P5EA 2Q0BA 1Q3WA 4DDGA 3OFMA 3OMVA 4O83A 3OW4A 4PZ6A 4QMTA 4E4NA 1A3GA 5M57A 2O3PA 3QA8A 2HZNA 3V8TA 2WHBA 3OCTA 3Q9XA 4QMXA 3PA3A 4WIHA 3UNZA 3IGOA 4RBLA 2YS7A 3IDCA 2J0LA 4EOIA 5AM6A 2OSCA 4GKIA 4ZSJA 3A7GA 5LXMA 4DFZE 1R0PA 3LHJA 4M13A 2UW8A 4O86A 1A0GA 3DJ6A 2DWCA 4F7JA 2JKOA 3LXKA 3MW1A 4JX7A 5D7VA 2J51A 4M9UA 2Q83A 3VOTA 3NUNA 4DIMA 4IM0A 3L2PA 1DAWA 3A62A 4YTIA 3E7VA 4UEUA 1WBTA 4YO6A 3E8DA 4AZTA 2XNNA 2HGWA 5K4JA 3JZFA 2X2LA 3P5JC 2PHKA 4FL2A 5IQFA 3LFCA 3DLSA 4O7RA 1BI7A 3FL5A 3TMOA 2W1IA 3TYKA 4HR7A 3SLSA 2XS0A 3TWJA 3P78A 4H36A 4FIIA 3VHKA 5EG3A 1YWVA 3HV4A 3Q6UA 2EJ3A 3GXLA 3P7CA 2W1FA 2XUUA 3W32A 5DYJA