3ETJA

Crystal structure e. coli purk in complex with mg, adp, and pi
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3etjA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3etjA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3etjA01
1A9XA 3RFCA 2P0AA 2NU8B 5IYZF 2YZMA 3R23A 4WD3A 4XYLB 4O2AF 4C5CA 1T36A 5H80A 1E4EA 2NUAB 3G8DA 2DWCA 1B6SA 4HNUA 3VPCA 4C5BA 4E4TA 5KX5F 2YL2A 3V4ZA 3BSYA 4FFNA 4C5AA 3VOTA 2R6FA 5J2UF 3BSWA 1B6RA 3BFPA 2CNUA 4HR7A 2VPQA 4IWYA 4TV9F 2OLSA 3AX6A 5LYJF 5JQGF 3VMMA 1DV1A 5EZYF 2W6ZA 4EA9A 5BPFA 2PBZA 1Z2OX 2PN1A 4HQ6A 1KJ9A 2R84A 2YZLA 4M99A 4IWXA 3MWEA 1PK8A 1CE8A 3TINA 5I47A 4O7TA 4EABA 4YB8B 2V59A 1DIKA 4YJ3F 3GLKA 4YAJB 3WO0A 4XZ3B 1KJ8A 3KAJA 4ME6A 5FNVF 1GSAA 4IIJF 5JVDF 2YW2A 4EG0A 3U55A 4NYEA 2I8CA 2GLTA 3BSSA 1IOVA 3DF7A 2GPWA 2W6MA 1C30A 4TUYF 2XCLA 5HV6A 3E5NA 3VPDA 2YZNA 4O81A 5JQWA 3OUUA 3AW8A 4O82A 1PX2A 4RZQA 5K2MA 1CQIB 4GGMX 3K3PA 3QFFA 1EUDB 4QSHA 2XD4A 4EGJA 1I7NA 2R86A 2FP4B 5J2TF 3JRWA 3LWBA 2W6OA 3TIIA 2I80A 1E4EB 4FFLA 3OUZA 4J6EA 2VHEA 5LA6F 3JZIA 1KUTA 1JKJB 1SCUB 4O7LA 3VA7A 4O4JF 3I12A 3R5XA 4M9UA 2YZGA 2GPSA 2W71A 5LXTF 5CAEB 3V4SA 3WNZA 3R5HA 1VKZA 2FB9A 1UC8A 2YYAA 4FE2A 4MV6A 1OBGA 2Z04A 2VR1A 4MV7A 4ZQIA 4L1KA 2YRXA 2DLNA 1M6VA 5LP6F 2R87A 3RV4A 4TV8F 2PVPA 4EAAA 2HJWA 1KBLA 4FGRA 3KALA 4WBNF 3Q2OA 3R9RA 1C3OA 5C1OA 5DMXA 4IHJF 1KEEA 2W6NA 4DLKA 1EHIA 4HNTA 3LP8A 2NU9B 2QF7A 4M98A 2CNQA 2X0SA 4MA0A 3G8CA 5HBRB 2NU7B 3N6RA 1EZ1A 3Q1KA 4EGQA 1OBDA 4MV9A 2ZDGA 4O2BF 1KJJA 3ORQA 1IOWA 1I7LA 4FFMA 4O84A 3KAKA 4XX0B 1CQJB 3U9TA 4YJ2F 3BG5A 2R82A 3RV3A 4O7RA 3ETJA 3ETHA 2YRWA 3JZFA 2R85A 1BNCA 3N8DA 4ZI7F 2DIKA 2FPIB 2W6PA 1KJQA 4XYMB 1DV2A 1GSHA 4I4TF 2YS6A 2R7LA 2CZGA 2Z02A 2R7KA 1JDBB 1M0WA 4O4IF 3ORRA 2V5AA 5GONF 4YAKB 4FFRA 1ULZA 3HB9A 4ZOLF 4O7ZA 4I55F 4O83A 4EA8A 2FPPB 4EA7A 2R7MA 2ZDQA 2FPGB 2CNVA 1EYZA 4IZOA 1A48A 2GQRA 2WYOA 2SCUB 4O7NA 5CA1F 3WO1A 2ZDHA 4O7VA 1CS0A 3NUAA 5C1PA 4YBZB 4O7SA 3UFXB 2HGSA 3GIDA 3TIGA 3VPBA 2GQSA 4O7YA 3TQTA 3MWDA 2C00A 4MV4A 2J9GA 2NPOA 5BMVF 2YS7A 3TW6A 1M0TA 4O86A 1VBHA 1AUVA 3K5IA 2DZDA 3MJFA 4I50F 3JRXA 5CB4F 4O4LF 4MV3A 3KREA 4MV8A 1W93A 4DIMA 4FFOA 1JDEA 4MA5A 5LOVF 4M9CA 1Z2PX 5JH7F 4ZHQF 4MV1A 1W96A 3RUPA 2I87A 4O4HF 2W6QA 4Y8VB 1JLLB 1KJIA 3U54A 5BPHA 3SE7A 1GLVA 5C8YF 3U9SA 4MAMA 2R7NA 2QK4A 5JVLA 1EUCB 4O7WA 1WR2A 2V58A 4FFPA 1VBGA 1UC9A 5KKNB 4HNVA 2IP4A 1Z2NX 3K5HA 5CA0F 1AUXA 2CQYA 2VQDA 1KC7A 3HBLA 1GSOA 5D8DA 1BXRA 2YWVA 2NU6B 3HO8A 1GGOA 3R5FA 4FU0A 2W70A
chains in the Genus database with same CATH superfamily
2BUCA 2KE5A 2RGNA 4ZREA 4DLZA 5LIPA 1GAXA 1A9XA 4UARA 2DPHA 2HLHA 3HCFA 4N5HX 2HCTA 3W1VA 2JJ1D 5D1PA 3OOSA 2JCXA 5L4LA 2AUNA 2H59A 5NLLA 4QXPA 5IYZF 1T24A 2VNJA 3PGKA 2K7FA 4BZWA 2FJPA 3OZCA 1TIBA 2BEVA 2BI4A 1DAHA 1C50A 3GRVA 2NWQA 3LE8A 3R0JA 5D1HA 4KI7A 5CM0A 3E7PA 3PUWA 4X7BA 4ZVVA 3KPUA 2RI6A 2RIPA 1BCSB 2LDBA 1KYXA 1NXXA 3P2JA 3IBGA 4BMNA 4KPUA 1SCUA 1XZAA 2FK1A 3QVSA 3GDGA 4HBGA 4NF2A 2FXIA 4AURA 5C46F 3LWNA 3RVBA 4F4JA 1EFRA 2DKFA 3T52A 1N3BA 3KK0A 3IDSA 5GWXA 3VPCA 1BA3A 1KU6A 2WUDA 3LXMA 4PSKA 3I2HA 2JPDA 1J0BA 4AI6A 1CUDA 4A1FA 2MSCB 2AOTB 3L79A 4DSZA 4MQ4A 1RWBA 2WBLC 4KQ9A 5A4IS 4V03A 1N5RA 2NTYC 5DHUA 4AY6A 4MWGA 1CB7A 2XZOA 1N1GA 3ENNA 3TNJA 2EZ9A 4AG6A 4U2FA 1E3WB 3QXSA 3TVYA 1GZVA 1OHHA 2O1EA 1KZ4A 4X3CA 5IDXA 3AEKB 3B7GA 4OXYA 1FNCA 1Z45A 2Z2ZA 3JX9A 1CP2A 1HYBA 2I2FA 3C48A 3G1TA 3PEUA 2FDCA 2RKBA 4EEKA 1OXVA 3IVXA 4IFEA 1YVRA 4ZAXA 5FUVA 4IIHA 3SYKA 3VMMA 1UXOA 4QOJA 1KTIA 4Y0VA 5LC1A 1VCOA 4NBLA 4IPTA 3LWDA 3SQXA 3VAYA 4Q9IA 2F1OA 2EJBA 4CE5A 2PL9A 3ZIDA 1EKXA 3JW8A 4RTLA 1DXQA 1W8IA 3UMVA 1ZGBA 4BVAA 3OJOA 2E5LB 1K0UA 1U8EA 4AT1A 1YRHA 4CBVA 5L1JA 2C9MA 1IY9A 1C9NA 3ROQA 1WUIS 4HWSA 1I1QB 4WK4B 3P94A 1DBIA 5DX1A 4N01A 3ZLJA 2C2RA 4N49A 4ZAWA 2NO7A 3I9KA 3HCWA 2YBEA 3OA0A 3PVSA 4WY8A 4CKZA 2NSLA 3ACBA 3UUWA 2BI7A 1MAHA 3EPHA 4MPPA 1P2UA 2JA1A 1U4NA 3IPCA 3OIDA 1KDYA 1PJ3A 4FI3F 1C0KA 3MMZA 2O6LA 1K6JA 2QL6A 3KZMA 3X2SA 4CNQA 1EXVA 4BY1G 5HKKA 2FUG6 3U3JA 2ZS8A 4B3BA 1ZRMA 4IOKA 1K68A 2IZ6A 3BHNA 2PX8A 4MKXA 4ID3A 2CLDX 3CGGA 3HCNA 2H29A 1XTTA 1OMOA 4ED1A 1JLMA 1QH8A 1LZLA 2GSWA 2R44A 4AO6A 4NCAA 1K6IA 2X19A 2ZI9A 3HT5A 4YR3A 5HCIA 4KITB 3AF3A 3KAJA 5JRZA 3H0CA 4PQYA 4QECA 4EEQA 3A26A 2QR5A 5J4KA 4UVEA 4FONA 1HBJA 2NV2B 4IIJF 4QUKA 5H9WA 1J2EA 1N2EA 3GLFE 3WLTA 2OR3A 4D4JA 3UMMA 2PX4A 3NKVA 3O9ZA 1L4LA 4UBJA 3EIWA 1H0RA 2ZSJA 2YWDA 2JFQA 2Y6VA 4FC6A 1ONSA 3OCJA 5F2OA 2ZZNA 4OM8A 1EXWA 3CLHA 3WK7A 1F8GA 2CVZA 5E4FA 1AM4D 4LFCB 3C3XA 3SXJA 3OFVA 4QXRA 1IQPA 3ES9A 3EBOA 4TN1A 4MTDA 1Z6ZA 1VJ0A 2HCRA 2D0IA 3AJAA 3MSXA 4KVZA 2FSVA 4M7OA 3I2GA 3SQWA 4Q3DA 4EPVA 6REQB 3HKEA 4BMDA 3CVVA 4FYXA 4MCIA 1AZWA 2BOVA 3OZTA 4I6JA 3GV0A 3RUFA 3OP4A 5HJ2A 3I04M 1F0NA 4PDBA 1AS0A 1NGSA 1H85A 4YMSA 1QGED 2C28A 3FMPB 2HH9A 4CGZA 3DMHA 2G9ZA 3QYAA 2RGWA 1CUYA 2ZBQA 3FZNA 4WGFA 1NWCA 3RVSA 3VNAA 2R3SA 4YAOA 4B73A 4I4IA 1Z2EA 1JSLA 4IBOA 2OCXA 2PTGA 1DOHA 3T1YH 2Y8EA 4DABA 1XMJA 2UXBB 2VPTA 3JQ7B 1TQHA 1Z39A 3HU2A 4K3VA 4OSPA 4Y1RB 3S27A 3ZY4A 1A9TA 2VSYA 5DLGA 3N2LA 4ZYXA 4DHEA 3ZDCA 1L8AA 2PL5A 3AHEA 2WKPA 4GE3A 3F6RA 3QI7A 4TPKA 3H0EA 1BZYA 3D3NA 3GEEA 5ERGB 3TIIA 1YZKA 3RNLA 5TIIA 4WKBA 3IMKA 3U7JA 4U39A 2ASVA 1TPZA 3V2IA 5LJLA 3KSMA 1HPLA 4PS1A 2PFKA 4BWYA 1SQ0A 4MH0R 1SBQA 4GT1A 4J1TC 2I1VB 3ANSA 5L3QB 4D3YA 2Z30A 4GMFA 4UD6A 3R75A 4D43A 3OOHA 1A77A 1N7GA 2A1UA 2GXSA 1AGRA 1K06A 2Y0EA 2QRQA 3D8RA 1GEEA 5D00A 5I7WA 3KEFA 2C5BA 5LQRA 1NR7A 1YS2X 2X0JA 1DG9A 3KZNA 1GRVA 1NDQA 3R5HA 2IDJA 1XQXA 2VT3A 4KJXA 2VQEB 1XK7A 4KUHA 5AHKA 4QGHA 1I2BA 1KAQA 3V6LA 1YBAA 3GY0A 3LO8A 4M0EA 1ZHQA 3P2YA 5L3QA 2RGUA 4JB8A 3AHFA 2WM2A 4GOXA 3IKMB 3G23A 2ASJA 2YZ7A 4G41A 1O8CA 3H2ZA 4F5ZA 1M6VA 3VKGA 1J56A 1JHYA 1Z28A 2J87A 5U9CA 4BZXA 4KLZA 3TFOA 4AQYB 3HRHA 5J9FA 4L28A 2O3SA 4OEHA 2QNBA 4DQ0A 2WZQA 4ECAA 4MVJH 5KWEA 4GO1A 5IKPA 1VBFA 1N2GA 1K5HA 3TIXB 4OKSA 3VDQA 3D54D 1IYEA 1S0OA 4JX8A 1KO8A 2EWWA 4MW5A 3U31A 2JB9A 1JR3E 3L4BA 2WJGA 3WLJA 2EP5A 5C5EA 2E6KA 5LD2C 2QI9F 5F98A 1HV8A 3JQAD 1FYVA 1GCUA 2AJTA 3M4NA 4M1KA 1FF9A 1N33B 4YJHB 1MO6A 2EQBA 4AMVA 1XVIA 4HUJA 3IULA 1IHYA 1Y8RA 1H2AS 3G8BA 3NEJA 1H2YA 1WXFA 3OF5A 3QMMA 1T5OA 3CBGA 2Z4TA 4IIGA 1KZ9A 3AOGA 2AYZA 2EIXA 3MWEB 4PINA 5EZSA 1AB5A 2P40A 5FT9A 1O9BA 3EY9A 1N6OA 2J6CA 5FORA 4BMOB 3S7ZA 2QZ4A 4RULA 1PT7A 4P4SA 1D8AA 3I23A 4AIRA 4TYNA 3MMSA 5C32A 2E7ZA 5HOQA 5M7EA 3ESBA 4OYLA 4KQEA 3AF4A 2E5FA 1JV2B 3HOVG 1KEWA 1UADA 3D3QA 4JELA 1M5TA 1FFAA 2HJGA 3AR2A 4V38A 3DAPA 1LWOA 1VGVA 2HIHA 3UJAA 1AKRA 1T6XA 3GD7A 4AZ0A 3BL6A 5JAUA 1KQFA 4GL2A 3UKOA 2IZ0A 1YR9A 2GXQA 1WD7A 2XQFA 2UZ1A 4WLFA 5EJ6A 1SZPA 2O0LA 4PR0A 3ZZUA 1WIWA 4E5UA 3BJZA 1JKJA 3QEBZ 4Q02A 3U9LA 4RH1A 4RPCA 1TTPB 3M2PA 3H1AA 3HACA 2PGAA 4LF6B 1FSFA 5EKDA 3W3AD 5U4QA 4RE6A 2QWXA 2NP7A 4IDDA 2NVXA 2V7GA 5C5CA 4AG5A 1UBGA 3AYHB 1LJUA 3LULA 1Y1QA 2A84A 3NRJA 4RD1A 3MT8A 3B9QA 4DAOA 3D3WB 4HATA 2FSSA 4A3SA 3TUZC 1A04A 4I4TB 1DVRA 1RRVA 4ZO4A 2H1RA 1ZMOA 3ZGLA 2RG7A 1ZH6A 1DKQA 3FHJA 4RGYA 4DYDA 5AKJA 3PCXA 3V4FA 3K1JA 2SNIE 4LDJA 3WAGA 1XX6A 3UYLA 1Z0UA 3LX4A 3IIJA 1J1IA 1XEFA 1Y1PA 2FJ0A 3R09A 3H4BA 1VE9A 3AY7A 4TKVB 4UBLA 4B6FA 4NAUA 3KAKA 4CN8A 3LUPA 4CKEB 3KT3A 5K8TA 4U6NA 5DW3A 1H4SA 1FSGA 3NYRA 3IYLW 1KO7A 5EE0A 3TTUA 3DPSA 4IV0A 3FGZA 3WK5A 1P61B 4C78A 3MXTA 3OSZA 4FYKA 4PN3A 1FU7A 2XHZA 3KZXA 4RUAA 4A6XA 1DAIA 1ZCFA 1XBTA 2WA1A 3CHYA 3GG9A 3MLEA 1ZW1A 3QBVA 4V02A 1PR5A 3E27A 3OLWA 5LMUB 2V4RA 1MXHA 4R69A 4KW7A 4DCGA 3HUUA 1KEPA 2Y1XA 5I9LA 3O47A 2JLRA 2XWJI 5EP1A 4YMVA 2W6PA 1QGDA 2C4MA 3HABA 4JJAA 4CL3A 1G59A 4CC6A 2CXNA 1BE0A 4Q3LA 3DTYA 1TW2A 2A35A 1KOFA 1EIWA 1ZM2A 2EZTA 4Q3OA 4O2BB 3OM0A 4BRWA 4URYR 3QI2A 2HSDA 4TZKA 5ERYA 2QX9A 4EQ6B 4AYWA 2H8GA 4EHIA 5KWSA 3JQAB 5ESRA 4EF5A 5I4CA 3C6XA 2G4LA 4MR9B 1L7XA 1FPQA 1YKGA 1YQTA 2FSHA 2JH8A 1S3IA 2Y05A 3ELWA 4XGQA 4BGIA 6Q21A 5K8VA 2VF2A 4GLFA 2IP2A 1J09A 2VAVA 2QRMA 2WFZA 4JYPA 4RIIA 1WCXA 5ESWA 3FMAA 1P80A 3PF8A 1X1SA 1B04A 3EVZA 3WWYA 4KAAA 4HNGA 4I9NA 5JCOC 3AIKA 3PQ5A 3U6BA 4MTLA 4IM7A 1KSJA 2PBLA 3JASB 4PHTA 1RK5A 1ZJYA 3DO5A 1Z6QA 5D3ZA 2JAPA 5CFOA 2BM0A 4KQFA 3NVKI 1PZEA 4V2UA 1PSDA 1Z6GA 3OKCA 1DEOA 2GN8A 2XOEA 3TLKA 3OX4A 2ZITA 1E9EA 1WXIA 2QTFA 3N8HA 1R6XA 1KK2A 2NACA 3DYVA 2XE8A 4RVHA 1FNSA 5B2ZA 3ZWNA 1N6HA 2XGSA 3R2JA 4FOTA 1AF7A 1SD2A 3WO1A 4O2AA 3WB1A 1KXZA 1MOZA 1YE3A 3UAVA 4CCYA 3AR6A 4JLMA 1ORIA 2DT8A 5DCWA 2GR9A 2Z9DA 4ECUA 4UDOA 1R1DA 1V1RB 3BK7A 4FP9A 4PZEA 4DV3B 4G9GA 3H2GA 4QFBA 2HU7A 2QZ9A 1QANA 2ODQA 2HGSA 2W9XA 1MH1A 2AZ4A 5JJKA 2YH2A 4QYSA 3WL5A 2H8KA 2UDPA 3TH5A 4BWVA 4YV0A 5CB6A 1CUSA 4QRHA 5ICMA 3TGLA 3FKJA 2A9VA 2DHDA 4H7FA 1YVDA 1HC7A 1OFVA 3QF4A 2PZMA 3T1YB 2ZM6B 5JI3E 4B3XA 1A0IA 4O1MA 1WB4A 4A4DA 5BY2A 4QW8A 1EG2A 1CY4A 5EWFA 3SKXA 2QUZA 2OV4A 2QUHA 2VUUA 4HGQA 2H0QA 4Y7DA 3SX4A 5DIFA 4ECEA 5CFRA 1VB5A 3U44A 3OIWA 3VC2A 1Y42X 2BLLA 3I4LA 3TRDA 2GBCA 2C7VA 1NQTA 1HL3A 1ZJ4A 3TXAA 2L82A 3WK6A 4PAOA 1KIAA 1SEVA 2WTEA 2UXDB 1YE8A 3H9CA 3FYSA 1FUIA 3WRWA 2IBKA 2PHZA 1WLSA 4CTNA 3GPDG 2IKQA 4HGYA 1DAAA 3ZWMA 4RUCA 1OSNA 3DOHA 4KQ1A 2HJSA 2HMWA 4GVPA 4QAJA 4LFCH 1HG1A 4HX9A 4OUDB 3TLJA 2CLMB 5IKXA 3R5SA 3M1IA 3PS9A 5C5DA 5C51B 3GLIE 5DAAA 3OO0A 4Z4QA 3JU3A 4QULA 1TRKA 2R2GA 4EBEA 5GJVC 3RU2A 3F3KA 2WMYA 3FVVA 1ZGZA 2Q5FA 3MR2A 3JD1A 1B1AA 1XDGA 2NN3C 1OOEA 2XGMA 2W6QA 1EUCA 4IJKA 4TVSA 4HGZA 2WIFA 2FLNA 1NSYA 1PGNA 3KVOA 3AILA 3NWOA 3SHQA 4ZAFA 2HHHB 4WZBB 4ED8A 2ZJAA 1CEQA 2G6BA 4RHYA 2AHOA 1NJFA 4RA6A 1W4BA 3FHCB 4WBSA 5ECDA 2FHSA 4Q34A 3BH7A 2W2LA 1U8XX 4QQ8A 1QH8B 2WB1E 4RPLA 4ENTA 3BD6A 2EFDB 1C41A 2B4RO 3KT8A 3LQ4A 1S02A 5KT7A 2CNKA 3MTIA 2CLSA 2D2XA 1SVNA 1C1YA 3FRJA 3E9QA 1NVXQ 2XJ9A 4JFRA 4PO9A 3WLIA 3WZMA 4IZHA 3AVUA 2QN2A 2WZBA 3ZK8A 2XAAA 1BEZA 2PJZA 3UUGA 4F04A 4MDFA 4LEIA 2B35A 1JIHA 1SIOA 2FF7A 2PH3A 3IE0A 3K5HA 1B8OA 4L0QA 1A8UA 1OWNA 4ZGWA 3QX9A 5CBPB 5JDCA 3UJNA 5K8CA 2YXBA 3BL5A 1DQPA 2TMKA 1TQ8A 2WAMA 1N0IA 3NAGA 3SM3A 5CYGA 1XPOA 4N3CA 2EHJA 1MX1A 1W85B 2W0SA 3QOYA 2BKEA 3FFAA 4JU8A 4L6AA 4R84A 5HFNA 3NTXA 4GOKA 2R8GA 4ZA2A 2GTPA 3EQ8A 4FFDA 4P4UA 1OGJA 3CW9A 1ZXLA 4KU4A 5JO0A 4ZVUA 4FMBB 1T5SA 3AP1A 1JYSA 1K4MA 1OT5A 2NZUG 3DE6X 1CZOA 2AN1A 3PT5A 3GIQA 2CMFA 3ACCA 3AM4A 1E20A 1BN7A 4JT4A 1U2GA 1Y3IA 4RY8A 4D8VA 1U7OA 1ZETA 3WGQA 2PH1A 4Z4EA 3MSCA 4U8HA 1DSSG 1RWXA 2L42A 4YAGA 4R9NA 1QP7A 5J4VA 2IU4A 3ZDRA 3JAWA 4YUAA 2XE7A 4LH7A 3FPHA 3K9WA 3VGPA 5BSEA 2Y0PA 1TCCA 1R18A 1H1TA 3UHFA 2GWHA 5TX7A 1RXYA 2H4HA 3CJTA 3ILSA 4YRIA 1V9SA 3FPKA 4J1QA 3VTKA 4A8JB 1UFRA 4LOLA 1AQIA 5LYJB 5FPTA 2VHTA 1ELOA 3I01A 4JYCA 4RK7A 5AUOB 1HOTA 1PR3A 1OW3B 1GD1O 2X5RA 4G09A 1WXDA 3QE4A 3P2IA 2PQ2A 4NMLA 3VV2A 4L0MA 1CRPA 3AHJA 3KTAA 1P1FA 4KHZA 2E4WA 4KX5A 3Q5DA 4WDRA 1Q16A 3WGVA 3D8TA 4E4TA 3TG8A 2PO5A 1KMHB 1ZNWA 4JJ8A 4Z8XA 5A4DA 2PCJA 4HDCA 5JISA 3B5EA 1UFVA 4X44A 3QX3A 4IMRA 1GP2A 4TTPA 4GLXA 2XQIA 2YWHA 3VOTA 3I92A 5JYCA 4KBFA 1WPXA 1ZUIA 2PWBA 4C4YA 4LSAA 3D7SA 1GGEA 4ZJYA 3H5LA 5GOTA 1X7XB 2Q0XA 3D0QA 1GG5A 3PPWA 3FLEA 3MS2A 4MQEB 1LBHA 4OQMA 4RTMA 3CBQA 3SX0A 3T7EA 1X8JA 2P9YA 2R8RA 5LYJF 4BVGA 5B6PA 3ANNA 1O94C 1E92A 4BNGA 3G49A 2WHQA 2X8BA 1E32A 3D8SA 1IXZA 4YJ3B 3UHPA 5K0TA 3CZCA 4GPIB 2XUFA 3HJCA 3QMPA 1H65A 2PBZA 2G5CA 5E6UB 3VU9A 1R9NA 4Z1MA 4BIIA 2QSZA 5IYCG 1NVBA 5AI0A 5BN5B 3KOWA 4AVYA 4R9SA 1AK1A 1T9ZA 1EB8A 2E49A 1C8BA 2H65A 1Z6AA 2OHFA 2WTXA 4UNRA 4B32A 5F5NA 1JDUA 1FFCA 3ZU3A 3KS9A 1I4TD 1YMUA 2PL3A 1XZKA 3GLHB 2CMDA 3A9CA 5J2UB 1XCLA 2QQEA 5CURA 5CK4A 3SC2B 1L7OA 1SHLA 4AWXA 4NXMB 3D6UA 3UEOA 1GDDA 5LZ8A 4B4DA 1KGDA 2POQX 4JUCA 3TB6A 4MKHA 1T4GA 1ISIA 1QH0A 1C0LA 4D0LB 4QKQA 1VPVA 2BMJA 7ADHA 1KMMA 5LSAA 1COWA 2FSFA 2WF8A 5KC9A 2E37A 4PU0A 4B6SA 5A5EA 4PBTA 1NNLA 2WJ3A 1GNSA 4CEJA 4EUEA 4NCHA 5K6RA 3FPCA 3K5WA 1GRNA 3TTYA 3BAFA 3LKBA 2BGIA 3OTGA 2AXNA 3I5YA 2PVSA 3B12A 4NY1A 4KXFB 1K75A 4J76A 4XZ3B 1G3QA 5ARDA 4RQBA 4BO5A 8GPBA 4H60A 1P60A 1WQ3A 3SS8A 1U5BB 3HKCA 3PVCA 5E8RA 1EVLA 1SQFA 1A9SA 1N0VC 2VDJA 2C3UA 5TPZA 5CG2A 4Q1EA 4DCPA 1B74A 3M3PA 1ZMRA 4IJWA 4R2WA 4OXRA 1RC0A 2IDMA 1A5SB 2QG6A 4GBMA 4X1IA 5HIJA 1KAMA 2IK8A 3OG9A 1Y5RA 4MIEA 1F0PA 1OIVA 4QPJC 3A9UA 2PIAA 2D2VA 1GZ3A 3DDZX 3IPLA 5DYWA 3U17A 1X7WA 2IXAA 3PE4A 4MNTA 3H2JA 1N3IA 1RCTE 3FBTA 2QP4A 4RA9B 2Y2VA 2MCTA 3HM2A 1OVGA 3RPEA 1E5TA 5TXGA 5I6DA 5KC8A 1E1NA 4XWWA 1BMFA 2AZTA 2HIMA 4H1WA 1FFGA 4M1WA 4X60A 4QDXA 2M1ZA 4J90A 5C4IA 5KNCD 3PC8A 3QVGB 5JYEA 2WUEA 4AXXA 1A50B 1PX2A 1GA6A 4PFSA 3E84A 1PTJC 4TXLA 3PLRA 2W2MA 2WUFA 2CY0A 2JRLA 2BDUA 5JLJA 2IS6A 4QSHA 3W9UA 1VP3A 3F9RA 4P36A 2VDLB 3Q0EA 3UTCA 4RB1A 4ARBA 4UM9B 4CFYA 3MT7A 3S2IA 4DARA 4ZICA 4X54A 3UJ6A 3ZWDA 1NXQA 2BZ1A 4KAFA 3KJXA 3RS5A 3M0EA 3ANLA 3I9V1 1F12A 1SKAA 1U2DA 1RYYA 4M9SA 3Q7TA 4OHOA 3O38A 1Q7TA 1R15A 3FNQA 4FLMA 4I6GA 3T1TA 2WR8A 3WAKA 1G55A 4GKAA 4X20A 2C97A 1EZ4A 1Z74A 4QNMA 3ZIAA 1TEZA 4CQLB 2R5WA 2YWGA 5FWNA 2H9IA 3IQWA 3MCAA 1GPKA 4CLRA 4EFBA 1JQBA 1US8B 3ROEA 2ODEA 5AKLA 4J6EA 5ANRB 1GARA 4TS3A 2DQZA 4HNQA 3SEAA 4BVJA 1SFRA 1CY1A 1E8NA 1FDSA 1OLUB 2O2SA 3EUFA 1N36H 4K0KB 5KFTA 2H54A 4FWTA 1BDJA 1N0HA 4O4JF 2LV8A 1T8SA 2Q4TA 4WLOA 2R751 4R7TA 5FOVA 3TW0A 3CISA 2XUHA 1AQLA 2ZS7A 3IELA 2O5VA 2P69A 2WU4A 3KOOA 2ZCUA 4KOAA 1MO4A 3C5EA 1L9KA 3S2GA 3AF6A 4L5IA 4BXOB 1ZOOA 2O2YA 3MGGA 4NG4A 4B3HA 1L2TA 4ZJUA 1IUOA 1SC9A 1XMPA 3GZNB 4RZ2A 3N86A 4NFHA 1CR6A 1U94A 3QFHA 2HRCA 4R2MA 4WOKA 4MV6A 4GI5A 2EKZA 1M1YB 4ESEA 4U6QA 1IN5A 3AWDA 1GR0A 3R77A 4WN9A 2B5VA 4EJ2A 3GI1A 1NYLA 4TQRA 2H2FA 2J3IA 3SK0A 2YOHA 3UOGA 5IRCD 1UL1X 2HTFA 5DGHA 4FBTA 1QMGA 2EP7A 2O6HA 1KHTA 1USGA 3HYTA 4RVOA 3VO1A 2R8ZA 2ZSBA 4FYPA 4P5EA 3OKFA 3OZEA 5LZ5A 1U3UA 3Q6NA 5CT9A 1PV4A 1T25A 1QWOA 3SEFA 5K5EA 2HU8A 3MWDB 2MOKA 2PL1A 3K0BA 5EINA 2CVPA 3E5RA 4FKBA 3EA4A 3IAS6 3C0FB 3GTLA 3I3OA 5KWJA 2FSPA 5BR1A 3IT2A 2AI3A 3RU7A 3DG9A 1MX9A 2ECQA 2FG6C 1PF7E 1TJ3A 4KPGA 2ZAMA 1KT8A 2GEVA 3OJFA 4RV4A 4IQ8A 4LNHA 2YMMA 1FFHA 2Q27A 3DLPX 4P80A 4CUZA 3CNBA 4Y2TA 3ONWA 1SC4A 1A3CA 2IYPA 5DGDA 5GV7A 5K2OA 4YALA 4UCTA 3PQ8A 5I7EA 3V1MA 4YWJA 5EGNA 1RJRA 4X24A 5YASA 4LWZA 1R64A 2CMKA 2FPIA 5L1LA 1PE0A 3GARA 4MUJA 4EVIA 4HDNB 1GTSA 1B26A 1N3YA 3TVDA 5BWRA 1G8PA 1NC3A 4JJ7A 1KPIA 2V7TA 2HJRA 4Y1RA 4N0EA 4TYWA 1X19A 2XSZD 3F5QA 4M38A 2QLTA 4ZOAA 5FD8A 1DUVG 2P0EA 5IS2A 4MQFB 4F0JA 4YQEA 2JIQA 3CR7A 1GJRA 3ED1A 4MA0A 5F33A 3NGMA 2X76A 1PYOA 1IBKB 4C6RA 1ULBA 4BKOA 2DJIA 3WWPA 3KKNA 3OI7A 2GZ1A 1WY5A 2YXPX 3CONA 3MUEA 5T3YA 3BL8A 2AZMA 4NFLA 2B4TO 4ZRMA 5EPEA 5EJAA 3QU7A 1WXXA 4OXNA 3V1YA 1Z5ZA 2JBWA 2E4AA 3JSXA 4B4UA 5IT9A 4YXFA 4ZI7B 4EGQA 2EW1A 5A03A 1YB4A 3MD9A 4IIJA 1IEXA 4BVEA 5C8XA 1YZUA 1YQXA 4NRDA 1VA5A 5HF5A 4QO8A 3SYLA 1L5ZA 3G5TA 2OWEA 5P21A 3ORQA 4D44A 5I7HA 4BVLA 3EEYA 2PUHA 2Z4RA 4MIKA 1ECPA 1UJBA 4CCAA 1YAHA 4CDMA 2FMFA 1T4MA 2BI8A 4IXTA 1UKAA 3ENWA 4LV6A 1FPMA 3R3VA 2OHJA 2HHCA 4P82A 4LZZA 2IPNA 3HJNA 5EL0A 3ANMA 3TWOA 4RHFA 4V0MA 1BS9A 2PXCA 2RH5A 2QBYB 3W3AA 3QFSA 5JCJA 1U7XA 1LDNA 1OWOA 4QWEA 3EVBA 5J5CA 2APJA 3R5KA 4RNNA 3V2UA 5BVHB 4OD0A 5K3BA 3BK1A 2RJNA 4IDBA 4QOEA 3SIXA 3DAYA 3L0SA 3SOPA 3UENA 3R9WA 5AW2A 4QOHA 2D0DA 3E70C 2GEDA 4X84A 1Z22A 2BJVA 1PJBA 2RK3A 2X7XA 4I1IA 3SX2A 2X0EA 3IXLA 3LXRA 4C0XA 5EWEA 1SIBE 2BGTA 3RHZA 1AHPA 4WK2B 5DB4A 4TM8A 3NT5A 1T3ZA 1SY7A 2ZIZA 4I4TF 3UJ9A 2VDWA 2YJNA 3NEAA 4V2IA 4C4ZA 4EFMA 3D0KA 4EJ6A 3RRBA 1OFUA 1ZVKA 3DAOA 1LTKA 3ZHRA 4ZOQI 3LYUA 4CNBA 3G0GA 3RYFB 1N6LA 3OPMA 4JVSB 3HJRA 3FJYA 6ADHA 3RREA 4INOA 5IYBG 2I7TA 1Y5LA 1XRRA 2Q6LA 5EZ6B 1HH4A 3ZE1B 4EGFA 4BAGA 3T95A 5E1BA 4O33A 1KYVA 5DP1A 3T4XA 5AI9A 2AX3A 4QRIA 4DIFA 5A7FA 1U8CB 1O6GA 2XA9A 4EHAA 4X95A 4QPPA 5DOVA 2HDOA 1KQ3A 4JLKA 3TX2A 1WZCA 5GJBA 3FB1A 2G77B 4N4AA 2ZDQA 1U9CA 1XJWA 1DFHA 4HQOA 4TOIA 1XNHA 1GGJA 1GAEO 3H8JA 2EJUA 2C5FA 4IZOA 5D3KA 2D4AA 4ZIRA 4FMDF 2WTFA 3AERB 5CYOA 2VJMB 4TWRA 2G9NA 3TR6A 2WYOA 1EFKA 2WK1A 1JKXA 2GPBA 3VBEA 1EVZA 1L4UA 1HLFA 3CW2A 4OQQA 3RVOA 3T8YA 4UHEA 3H2SA 5KT4A 1FFWA 1V7ZA 1XWWA 1YDFA 4J0FA 4O7SA 5L1IA 4M7EA 4AZ3A 4FGUA 1P1CA 1USUA 4QFCA 3OEHD 2MMCA 3DNMA 1FMJA 3DWFA 2UZ1B 3KYCB 4K9QA 4Q1VA 4HRVA 2D1RA 1X15A 4TWAA 3IIKA 4GYWA 2JS7A 4MR8A 1T2DA 3FYDA 2PMKA 3PQ6A 4FB5A 2LIPA 3QQMA 4Z4IA 2ZRKA 5F76A 3NDJA 5EJMA 3ISJA 2NPIA 4M21A 1HSOA 3A1SA 2JFNA 1OASA 4GKBA 4HF7A 2VNSA 1NP3A 4HRAA 5GZ1A 2IHNA 3E82A 2DRIA 4MRRA 4V0KA 4GMDA 4ERNA 4YRNA 4KMOA 1AQNA 2HA7A 2Y66A 4Z86A 3RB6A 4NH4A 1N32B 2QMUA 3V46A 3KKQA 1NIJA 4G4SP 5CB4F 4FGSA 5AVZA 1TKCA 4MS1B 4LMAA 1L8LA 1KDPA 4WW0A 4D9GA 3GUCA 1V6SA 2PRSA 2CUNA 4G01B 5AO9A 3ABQB 2BFCB 3ZIUA 2D2IA 2I33A 3SVLA 1YO6A 2CKZB 2NXEA 2UVPA 2O2CA 1KQOA 2NZWA 3NAZA 3BWMA 5BRAA 4F91B 4GC9A 2HNBA 4AX8A 3HVRA 1FRZA 3KUXA 3MRXA 5ILOA 2BFOA 1U11A 1ZKMA 2PZBA 5CD9A 4ZHQF 3TXYA 3VYTB 2ZJOA 4DJTA 2ZBPA 3DBOB 4OJNA 1AKYA 2YCHA 1DWPA 1SUPA 1C9KA 4G0NA 4P5PA 1JVSA 5DNEA 3IEKA 3CSWA 4PZZA 4POOA 2QRLA 2VF5X 5BMVB 1JHAA 1DU4A 1PL6A 2NUPA 4HO1X 2R66A 1JBQA 5THQA 3GIIA 3DTVB 4IDPA 5LQKA 2ZT7A 4CM7A 3NDBB 1FU4A 1JILA 1NJ2A 2C3PA 1O8BA 1DXHA 4PV7A 4EPXA 1LLDA 5I8WA 1JU4A 4X6XA 5C18A 3QZ7A 2ZVQX 1QYDA 3RSLA 3DDNA 1DAEA 2P2ZA 2P4EA 4OHCA 4I1YA 4JLBA 1PNQA 2OBMA 3RRZA 4M0PA 5DNVA 5IUJC 2OYSA 2HB6A 2OB2A 1Q1GA 2QVBA 4PX5A 5CVDA 3HXPA 2XWQA 3HDYA 4Q3KA 2HG8A 1D9ZA 5KVVA 1DGSA 3EF3A 5KG1A 2JVKA 2BBSA 4HDQB 4WKGA 1G8YA 1Z83A 5KOIA 3A4TA 1LDMA 10MHA 5BSUA 5LDDC 1B93A 4MJLA 4YLEA 4X1YB 1IVSA 1DC5A 2Q3LA 3H65A 3V3TA 2ABJA 2HPZA 2GASA 2R0QC 4G9EA 4FIDA 3UB2A 1SH7A 3UH0A 2YXNA 3R6WA 3AETB 3F1LA 4GRAA 4QLBA 1OFHA 2Q2OA 3G2PA 2BGGA 1EK5A 1QQAA 3U4CA 1W4RA 4UCVA 1E6LA 4UVIA 2O59A 4KG7A 3H3JA 1HETA 4KHPH 1X7YA 2O8DB 1BXRA 1H6DA 3HGMA 3NAQA 2F1HA 1DELA 1Y5NA 2D2EA 4Q8EA 3E3AA 2BFBB 3MG9A 3SKVA 5C8YB 1NPYA 4GOND 3KV3O 3MZ0A 5FD5A 2C96A 3L7AA 1VJCA 4AMUA 2DPIA 2LBPA 2WIJA 4JBYA 4XM0A 5SZIA 3W7AA 5JNWA 1Q0QA 3U7HB 5K8LA 5AVQA 4KN8A 4UMDA 1AX9A 5BQ5A 2A67A 1QF7A 3E81A 3MPUA 4LZOA 1N7JA 3H8WA 1O95D 2R5FA 2V6FA 2I1QA 1K3FA 1L6IA 1R0WA 3BXGA 3QJ5A 5H7XA 4CLXA 5KQRA 1I2AA 3SHTA 2JLQA 2X86A 4HXYA 1O75A 1S0MA 2HQRA 3H11B 1Z35A 3INTA 1WB5A 3WL8A 1LU9A 1EG7A 5F7OA 2Q1XA 1Z63A 4IUYA 4XYGA 4LC0A 1VL1A 1EWVA 1YQ9A 5E9AA 1OY1A 2DR0A 5COBA 2H2GA 2UVUA 2IYYA 3LAWA 1JDVA 1T6ZA 4XD2A 1ZRNA 3D7LA 3C3WA 2FWBA 4KYVA 3ZBQA 1BX1A 4D80A 4OHPA 2GEFA 3SFTA 3TLBA 2Q5IA 5FEMA 4FKZA 4Y2SA 1BX3A 4CFSA 5IWAB 1XL0A 2FWMX 1MC5A 2YFYA 1FMLA 3NYIA 3O0TA 4ZCTA 2Z57A 1A9OA 1MDBA 2C31A 4XGIA 2XDWA 5KYGA 2VTBB 5K4HA 4JI6H 2F3UA 3USZA 2NPFA 5C9ZA 4Q9LA 1QX4A 4XSGA 1Q7EA 5ALIA 3Q4GA 4ND8B 1MD9A 4OAOA 4DA0A 1A7JA 1KGSA 2ZRJA 3C8MA 2BHRA 3RBZA 1OXBB 4UUGA 2XUKA 4C5AA 4HH1A 1NBHA 3L2OB 1XRSB 4R8UB 4PC3A 5FBWB 1K27A 1QYRA 2FJUA 3D7KA 2RHRA 1B6RA 1NQXA 3OC6A 3EPJA 1SYXB 1MC1A 4LVUA 1G66A 4PICA 3G2IA 4A0RA 3RBVA 2OFFA 4D5GA 4EB6B 5LQUA 3AG5A 2OBLA 4QBTA 1VG8A 4HWOA 3VNNA 4TROA 3O8CA 2G9UA 4BTEA 4WJLA 1Q57A 2JI4A 2DFLA 2L19A 2YRFA 1E9RA 1K3TA 1NM5A 3AESA 4IF6A 4PYNA 4WJZA 4C20A 2VIIA 3K9QO 5G40A 4NYJQ 1ULHA 3LX5A 4IG4A 2QTVA 4NYMQ 3V8EA 1Z2OX 3H40A 3AFIA 5A6VA 5BN4A 2ZU0C 1R6DA 1V16A 2OFXA 1JALA 1EK2A 3PR1A 5H1YA 1YJCA 1GNLA 3KSZO 3UK7A 2EJ2A 3MCVA 3UG7A 4IL5A 4M99A 2WDPA 4MP6A 3D3WA 5I01A 5FL7A 1JLLA 5ALLA 5ALPA 3JD3A 4PZ6A 4R0VA 2J0UA 4P08A 1HG0A 3FYTA 3LNTA 2WPNA 4OX9B 3TIFA 3CRW1 4J9MA 1GXSA 3HA3A 4MINA 3WJ1A 4EABA 1H3EA 2HSEA 3K70B 2AC2A 1DQYA 2WIAA 3B1XA 4FINA 4EGSA 4F12A 3RIHA 2IDZA 1K4YA 4G3IA 4K6GA 4ZZ0A 1WVGA 1SIUA 1G16A 1HQDA 3L49A 1WU8A 1FKAH 4H16A 3CY6A 2HLDA 3V8MA 3T41A 3AUKA 2F59A 2P8SA 1BA2A 1V3QE 3D6HA 3VZPA 2X0IA 2ZR7A 1USIA 1E2QA 2AGOA 4D4KA 1EGHA 1QNFA 3DHYA 2RSLA 3AESB 2EFHB 2ABWA 4RMGA 3DFKA 3H6KA 1A72A 3WXMA 3AVXA 4YNBA 5DHTA 1U02A 4I1UA 3CX8A 4DEXA 4L6IA 2IH2A 1T5IA 3GUZA 5TGZA 2ZIVB 2XYGA 3GTKA 4K8RB 4RF4A 3HYNA 4WFQA 5D3MA 5SY4A 5JVDF 2IBTA 2ISSD 2WU3A 1JE0A 4NAHA 5FFFA 2WYHA 1ZC4A 2CKDA 4I5GA 5SICE 1CIJA 5JD6A 2AKAB 2JH9A 1JH9A 5BQXA 2CT8A 1XPRA 2F8MA 1TT5A 3I8SA 3FWKA 3NETA 3JQDA 2BGLA 2OK7A 3QBEA 4FNGA 4C0QC 4QG3A 2OBFA 1CKOA 4YCNA 3KSUA 4P93A 4II3A 2ZBRA 3GGJA 1GO2A 3SVTA 4YPVA 2J4FA 2H1HA 4YT5A 3THRA 4LZAA 3N59A 3H04A 1VJGA 4CUJA 1QPGA 2ZWMA 1NMXA 2FSGA 3DLTA 3JRNA 3N2KB 4P8RA 4DLYA 4W5NA 2YZ2A 1FX0A 4NEQA 3K7EA 2JL1A 1DAFA 5K3SA 1M2VB 2QNRA 3E7XA 4OFXA 1JDPA 1DBSA 2BM1A 3M9LA 3MF4A 4H18A 1CE8B 1RQNA 4L8WB 5A3QA 3SU8A 4KJZA 3BERA 4OBEA 2HO4A 4YQWA 1GFIA 4LWPA 5B7PA 4Q1BA 5L3VA 3D8UA 4DR3B 2GD6A 1NQOA 2OKCA 4RSGA 3SHFA 1RM0A 2RMKA 3M6FA 5A7HA 5DGBA 2EBHX 2FGKA 1BS2A 1ACMA 2W2LD 3HVJA 3OZUA 4HDKB 3NIDB 1L5GB 1J6UA 1F9EA 3D4LA 3JQBA 1SD1A 1Y9JA 4LCJA 4PWZA 1TKRA 2QGZA 2ZG6A 4KK4A 3GLFB 1QIMA 2KSQA 5G4KA 5I45A 3PUKA 1Z25A 1Z6XA 4I1PA 3TW8B 3HCEA 4RDXA 4TSKA 1XLTC 4RKWA 2PMZE 2HDKA 2FE3A 4FVTA 4ZTUB 3FNEA 3OQIA 5CVUA 1FC0A 1X7XA 4BNVA 2CBZA 4ETMA 4DR2B 2J46A 5H68A 4XE5A 4ZYWA 1NRJB 1NVEA 2QTCA 1BMDA 3TM5A 1U3CA 5CIWA 1N78A 1I4OA 2R6R1 4NATA 1L5KA 2D5CA 3HMQA 4AF8A 1ZGCA 5D7BA 4EF4A 1ZC3A 1NT4A 4X7RA 1WUKS 2IXFA 2W83A 4OB7A 4KPUB 1Q0UA 3IOEA 3JZ6A 3ZU4A 3TECE 3FH0A 3E15A 5AJYA 1CY0A 4F06A 5HS6A 1M5RA 2OY0A 3T3PB 4R0NA 2A5DA 2A5JA 1DAOA 1R12A 3QKTA 3A37A 4FEGA 1IRXA 1IXSB 2WD9A 5LPNA 1JL3A 2PWYA 1MIHA 4GBGA 4JC4A 4Q37A 4Q93A 2ZS9A 3T3MB 3VDMA 3VSAA 4DQUA 2CB0A 3UWSA 5MN4A 3SYNA 1I51A 3OHSX 2DPMA 1V1JA 1OBGA 1LF0A 3CLTD 2Z04A 3ZQ4A 3WGJA 1ZOPA 3BJRA 3IJEB 4DV4B 3I64A 1LUAA 1VE6A 2IEIA 2EARA 4F60A 1T5LA 5F1PA 1GQRA 1I80A 3BGDA 3IAAA 3QUCA 4F1JA 2R25B 1T9KA 2ID4A 1BRMA 5K4GA 2GS9A 4P7JA 1X2EA 1QFSA 3FMVA 2ORIA 4TLAA 2VYQA 3G8AA 1RW4A 2GFHA 3U3DA 2BP7A 4X6LA 4RX1A 3KE8A 1C2TA 4MGIR 2J6TA 1N5LA 5CX1A 1N8KA 4MKZA 1M83A 2GH1A 4JLNA 3FM9A 2VP3A 1KI8A 2HXYA 3MINB 1J20A 3AR9A 1AGPA 2YDYA 4P6VF 1GPNA 1NFRA 4L57A 1T36B 1N4DA 2B21A 4H1HA 4LHEA 3AZQA 3RKUA 5JS7A 3WAJA 3DFUA 1RYEA 3VTAA 1YRYE 3JAKB 5DH9A 1POXA 4PSCA 2I4LA 3Q6MA 2ODAA 3BIJA 5JS2A 3UAXA 3LY9A 3NIGB 2CGEA 5CD1A 2G0TA 3FNRA 1R27A 1XA4A 3QVTA 1G4AE 1VHDA 4FOLA 3RSQA 4BJ5A 4BVKA 4WCVA 4EP1A 1F06A 3BMNB 2QMZA 4KYTA 3Q8KA 5HJEA 4YHHH 4DGQA 1FP1D 2IPXA 3N3BC 4WPGA 2ASDA 3K6JA 1U4SA 1OD6A 3L2PA 1PD1A 2H85A 2FWPA 2X77A 4K03A 5TQ0B 1SMKA 2B78A 2P8JA 5EWJB 2V7BA 1QB7A 2EFYA 4GXQA 2NO1A 3I05A 3I6ZA 4QYWA 3VNRA 4LNUB 3ZV6A 3LQSA 3IH5A 3WNBA 3LFUA 4Q4AB 3NGXA 1SWVA 4UTXA 4OHFA 2JCYA 3ZCXA 1NP7A 2I0FA 1W1IA 1GQQA 1TJ5A 2PXHA 3JATB 3NYWA 4H3KB 4UE3S 4IDHA 3WDSA 3WWZA 3BTUA 1AG9A 1SUWA 5REQB 4QL3A 1PZGA 3IR5A 3C6BA 4J2HA 4H4CA 4CMIA 1DGQA 4OJYA 5CLLA 5J63A 1UP7A 4FFMA 1ADFA 3O03A 4B45A 4AZTA 2IHBA 1QJ4A 3L1HA 5EKXA 3QKWA 1W4AA 1YSCA 1W36B 2BDEA 4R6WA 2OSBA 2WE8A 4ESOA 4KFSA 5TB5A 1U0OC 3KBOA 1T34A 1GQSA 2EATA 2J3EA 1B0UA 2JI9A 3X1YA 2Y6UA 2X4DA 5GIOE 4CKBA 3C5HA 3CLKA 1U7ZA 3WJ2A 4NQZA 3VR3A 2GOYA 2O0KA 1Q2XA 2PJDA 3AT1A 2XKKA 4X63A 3GROA 1IMOA 3BC1A 4FXPA 1RADA 4YRRA 2VHUA 4CV0A 4WXEA 3HSYA 3WKDA 4NH0A 3CH7A 4XPIB 2EZ4A 1OX4B 2AV6A 4UATA 1KMIY 1MX5A 5EVJA 1Z4KA 1TK3A 1N0UA 1ISRA 2ENWA 3Q87B 3I30X 3JYQA 4IZ6A 5CM9C 3E61A 2HT1A 1U3VA 3NBXX 3QSGA 1S9HA 3NUZA 1QJCA 3OE7A 1FTYA 5JJCA 3ICQB 3FCUB 2R7KA 3S6JA 3STTA 4CV3A 2MDTA 3FTCA 2DUUA 4NBKA 3WXBA 3ZK7A 1AHHA 3DT6A 3KYIB 3KUCA 1CJTC 4ZVQA 1S1CA 4U0KA 1X9NA 1C1XA 1BMFD 2DVMA 4EBBA 3TD2A 3O75A 2EC5A 1T15A 2PYIA 2WWFA 4LXXA 1XPJA 2HF2A 4YJ2B 5F1OA 3GJTA 3C97A 4RIGA 1CQXA 4TTQA 5F5XA 3ZE6A 1Z73A 1JYEA 3EE6A 4N7JA 1G98A 2UZIR 4NJEB 5TQ2B 5AW6A 3HJBA 4EA8A 4G1BA 5C3EG 4NFSA 4Y1GA 5AOBA 1ZPDA 2IYFA 2QMEA 1C80A 2VKTA 2ZUBA 1SIWA 3AF0A 4R5MA 1G3MA 5EUBA 1SUDA 1B8NA 5H0IA 1WCV1 1MOPA 4U63A 2XLBA 4A92A 2FFRA 3MAAC 4PLPA 1I7SB 1K1QA 1JDZA 3WTCA 2VOBA 4YJDA 2FPKA 1A48A 2W2VA 2XMSA 3R1IA 5CJPA 1I1OA 2CL0X 2HFJA 2VAWA 4GICA 3T1VA 4DR5B 3BHIA 3GFVA 7MHTA 1N1MA 3SICE 5L4NA 5M3BA 3U4QB 5THKA 4ZZIA 1L7QA 5GP1A 2IYRA 4IUDS 3ZJ5A 1X9HA 2J6UA 1IQUA 1QKKA 3V7FA 5CBKA 1RPZA 2XE6A 2RKWA 2IMWP 3ABZA 1OAAA 2CHGA 4HAYA 4MUIA 4IJVA 4YO8A 5DO9A 1CYDA 2E82A 3MTQA 5KT2A 4BB5A 2WKQA 3ORYA 4REQB 5LWHA 3DMDA 4NXNB 1QO9A 5EE5B 5ENZA 5JH7B 3S8EA 1I30A 1S0NA 2PPVA 2OUIA 3TQTA 3NHKA 4O1HA 2PWZA 1L1EA 4UTNA 3R7LA 1MO3A 3WS7A 3K94A 1Y3HA 2WOOA 4ED6A 3QXHA 1N1EA 2CXHA 2AFHB 4JODA 1QLWA 4YRDA 5TJHA 4AQ7A 1K63A 3T5HA 2CV2A 1OH6A 2D0PB 3B8EA 1F48A 3LV8A 5BWNA 1I5EA 4K3UA 4MVJI 4IUCS 5LCXA 1J9EA 1W19A 4DV2H 2ZYWX 2ZLBA 3GN2A 5BXYA 5IPFA 2F1RA 4R41A 1RI2A 1ZCBA 3GLHE 2FDRA 1TUIA 3UHAA 5T7BA 1I3MA 3OE5A 4GLWA 3ZE9A 2AK3A 1TWCA 2AFVA 2FWNA 1DARA 3GMIA 4ZGBA 1KI7A 1O6FA 2HYIC 3KJQA 3AJ9A 2VUHB 3KREA 3NRCA 4QU8A 3T1HH 2V4UA 5A7GA 2GPNA 1GKLA 3PT9A 2IX9A 4ZVLA 4R1MA 5AKKA 2Q3FA 3TCNA 5K9ZA 1PHRA 3HVHA 2XNDD 3NAMA 4NZ9A 4OB8A 1G7CA 1W59A 4RIEA 2ICAA 3RS3A 3RUPA 2Y0SE 1B42A 4Y2VA 3VHQA 3W2IA 5KJCA 1DKUA 2FV8A 3OP1A 2BWJA 4GKJH 3HJTA 4CMEC 4J3FA 2GCOB 1RXUA 1YS6A 4WNCA 4YAEA 5F73A 4BP8A 1ADGA 4D45A 4KR6A 5ARBA 1XTZA 4EFEA 1U2TA 2HT6A 2ZSDA 1SVWA 1TWHA 1BE6A 4IDNA 3T5KA 5BPHA 2ACKA 3ZQKA 3AM5A 4WK0B 4QJFA 5ELLA 4PZ0A 1TLLA 4C0WA 1PS8A 3ZS9A 4RCVA 2CD7A 4PTYA 1GRRA 2B61A 2KS6A 3IBFA 5TSDA 4BYMA 1DCFA 3RIGA 1M75A 5C80A 1NI5A 4XIIA 3LLSA 2IHKA 4JJ4A 4TMVA 1S7GA 3W5UA 5KMGA 5AXCA 1FMTA 3KOMA 1WW3A 1DJNA 3I0NA 3RLIA 5JVLA 3HFSA 1M34A 3EVNA 4E5NA 2I6SA 2E18A 2Y1CA 8OHMA 1AV7A 1DWQA 1CZUA 5SY9A 1E7SA 1WDWB 1RE1A 4O3SA 2XVMA 3PRHA 3QPBA 5GGYA 3VNQA 1UJMA 4LOJA 2GX6A 4Q8FA 2UVWA 3F6EX 3RYCA 4AU1A 1EMDA 1X3SA 2QT0A 1G2QA 3LL4A 3OCXA 4LSXA 2O8FB 2ZXFA 2P2NA 3HQ4O 2AX4A 2C8LA 4QBFA 1Z2NX 2A5YB 2R7ZG 5FR1A 4RJTA 2V97A 3EEIA 1LSJA 2D5LA 5FCDA 2FQYA 3AHGA 5HUJA 2E2WA 3PFGA 3IV7A 5AQEA 5K8UA 1Y1VG 3WL6A 1O89A 1SPXA 2ZJ2A 4BWGA 5C5IA 4FYVA 4F5YA 5J1SB 2INGX 1ETUA 2XCOA 4MMZB 3SJUA 1P7WA 3GVXA 5HRAA 1WM1A 1FL9A 3UC5A 2GWRA 1EB9A 4X62B 4R8VA 4TVBA 3IQHX 1E6MA 4KXNA 2AOUA 2XUZA 3VJLA 4F96A 3UGJA 1L4YA 3ZXSA 2EGGA 4REOA 3OECA 3PRYA 5DLYA 4DR5H 5C8DA 5J2TA 4MQFA 4J16C 1YZQA 1FU8A 4R2JA 4Q4HB 4H27A 5FWDA 5ADWA 3CH5A 4QVGA 4O3OA 3PD7A 4A8TA 2XEXA 2NT3A 4NMXB 1NTOA 1YZ3A 3HL4A 1YQWA 3LZCA 1E0DA 3AUFA 2NU8B 1ZK0A 3K4PA 3R7BA 4ZALA 2WSIA 5ALFA 2FWJA 4FX2A 4MAAA 5ICFA 1CRLA 4NLLA 3TNFA 2RGVA 2AB0A 4BV3A 5K0LA 3TOVA 1KI3A 4KV9A 1HYEA 5HCNA 5IFKA 2F1JA 4HNSA 3GJ8A 3L1UA 4J9NA 5LMNH 1YZFA 1ORRA 3GJ0A 3UHJA 1LD3A 3AEZA 3LFHA 3OQIB 5FLKA 4LTMA 4OKIA 4AY3A 1O3YA 3NHRA 4G5GA 1PEAA 4HXFB 3E2MA 2PUDA 2HOQA 4C7BA 3OY7A 3L7KA 2ADMA 4I9GA 4TL7A 4Y8VA 3EPLA 2EGHA 3MFQA 2RAPA 4LZPA 1SU4A 2ON6A 2XMQA 3T54A 3D59A 3IDAA 4KYIB 3OMLA 3O4FA 1QV9A 3VV3A 5F4ZA 2JJ2D 1WOYA 3GPCA 3WZLA 1SOVA 3KFXA 5HQJA 4LV5B 1VHJA 3BSYA 2HDNB 2Z43A 2DY0A 2ZAOA 4Y2HA 5D2CA 1JZQA 3GCXA 4EZBA 4RJJA 3WL7A 3BXFA 1RPNA 4AJ2A 4TVOA 4NEHB 2IV2X 1EE2A 3X1WA 1Y8AA 1X39A 3NBFA 3IUJA 4HR7A 1AURA 1FLAA 1W46A 2R00A 5A1JA 3ITNA 1ZR4A 1PVOA 3DUWA 5F3WB 3STUA 1F8YA 2TMGA 3QU5A 5AVJA 2MYUA 4Y9DA 5CTAA 2KW5A 3ND8A 3ZCQA 4DZZA 1BU5A 3Q7SA 4UEJA 2M9MA 3COYA 3A6GA 5F64A 3CVUA 1WDKA 2QSJA 3C1OA 2UV8A 1PL7A 2HO5A 4P0PB 1CRQA 3HDVA 1CD5A 1N5IA 3CCFA 1UBTS 3CRVA 1FDWA 4H0CA 5HYVA 1UODA 1QNLA 5LLTA 4KR7A 3D31A 1PUJA 2X5JO 1E5QA 3MEQA 3J80W 1EP2B 3G82C 2XMPA 2JASA 3NOXA 4GU5A 1GQYA 4EY8A 3ENQA 2FW1A 4AO7A 5HVNA 2GM4A 3CF0A 3RVQA 2GZ3A 1BQ3A 2CUTA 1H2FA 2J0EA 3HRIA 3UT6A 1JG2A 4CEHA 1GY8A 1BXKA 1NZFA 3PWSA 3BMQB 1YJ5A 3KC2A 3IUYA 4LI3X 4RPKA 2ZUCA 2I2XB 1G4HA 1OR8A 2AS0A 2VKQA 1EXNA 1VG9B 1Y9AA 1V7CA 4FGZA 4RB2C 1Q6ZA 4DWVA 2JFBA 5IJ9B 4E5KA 1SCBA 4JWTA 1X80B 4CG1A 4H7HA 4M1MA 4UBNA 4EYGA 4MW0A 2B8EA 3PI6A 1J5PA 3HUEA 1VL6A 3KEOA 4NJMB 3GBSA 3HC7A 3IT1A 2I78A 3D5EA 4LJ4A 4XCXA 1ESDA 3GNSA 4NDNE 4W7IA 2H1FA 1QH9A 3UWMA 3U56A 2E55A 1SBCA 2XGPA 1W0CA 2GN6A 4HRYA 5B1DA 4HWKA 2IC5A 1LTHR 3DZHA 3S55A 3IA2A 3TSZA 3LPNA 3FKQA 3IO3A 1UKVY 4KTTE 4I5DA 5BOVA 2EBFX 1G5QA 1TM1E 2I2WA 2O2XA 2WHEA 2VZ9A 3RUDA 3PZRA 1DKOA 4Y6QA 4DNXA 2EG5A 3SHOA 3OT5A 5IJXA 1VMKA 4Q4CA 3L92A 2IF2A 3NEYA 2VDVE 2MINA 3UKJA 2XAUA 2YMQA 2WFAA 3G5LA 4TUYF 1AUQA 4DLUA 3CEMA 1C8VB 2VP2A 4C87A 5D86A 4YLYA 4L5BA 1HL7A 4MRAA 4A93G 5JQWA 2G1KA 1QLHA 4FOPA 3AY6A 4PLVA 1V45E 1EA7A 1HE1C 1PEDA 2VXYA 2J07A 2O8NA 4YDSA 4BNIA 3A14A 3BF7A 4YYZA 4IXNA 4XX0A 3KOXA 1WQ4A 1RJ9A 4F1WA 4PLGA 3BSFA 2AMJA 3GX1A 4R8UA 5LQDA 3KEGA 4J0JA 1K97A 5AHWA 5AJTA 4IJUA 1ZWKA 3H4MA 2DPJA 4KI0A 1YIDA 3WGZA 1BCRA 1U0TA 4OHYA 2FKAA 1V3VA 2SECE 3RAQA 1QK3A 1DZIA 3GTQA 2FW8A 2O5RA 4L0CA 5I7SA 3CLSD 3KWLA 4X61A 3FCSB 3ILYA 4G65A 3RG2A 1X9GA 4E03A 1EK6A 4I7EA 1O95C 3MFIA 3KPVA 1TLFA 3A70A 3FDIA 5HW0A 1CVIA 2NP6A 3O9MA 1Q3TA 4E3WA 2CC2A 1ZESA 4OFWA 4M86A 2RCYA 4CQMB 4B09A 2UYCA 1VL0A 3R3UA 4KQIA 3L8EA 4LQDA 1N5MA 2VHEA 3PYXA 3CKKA 5AKGA 4D3DA 3I4FA 5JASA 1UWVA 3R7FA 1SCUB 1T35A 4LXTA 3TL2A 3HA5A 1L7BA 3NI2A 2D5AA 4BX0A 4QPDA 4UCUA 1V71A 4M0LA 5ALDA 1LJLA 1UJ4A 3HB7A 4JYMA 1D1SA 2JCGA 1GTRA 2OECA 2QM0A 2VAXA 3GFRA 1D4ZA 1VKOA 2A4MA 4CDRA 1OA1A 4S1NA 4H6PA 1NZDA 1TCBA 3OLXA 5HBGA 1PP4A 3D02A 4HK4A 4D7AA 5HHTA 1CF9A 4CCWA 2Z98A 2YYAA 2RF4A 3F3SA 4TQSA 2WWRA 2X9VA 3BZBA 3E8MA 4OREX 4QU5A 3LX8A 1H93A 4ERXA 3KJFA 5CFNA 1PTKA 1ML3A 3FCOA 5F78A 5E2BA 5G4LA 4QWBA 3N8NA 1HT1E 3I4MG 1JR4A 1STOA 3FLAA 1QQ7A 1ZCZA 1E94E 2XD9A 5G2OA 8ABPA 1Y7LA 2LPMA 3C8HA 1YDMA 4QBGB 2JJQA 3O8BA 3RIMA 4EO7A 1M74A 5KFEA 4BHTA 1GLGA 4BIMA 4YAWA 3IIEA 4B3SH 1NVKA 1Y5MA 3I5AA 3MTAA 4KRGA 4DV3H 2DKNA 4MGEA 5J1TB 4W5RA 4HAIA 5IDWA 1X1QA 1G2IA 4DR6H 3M5PA 1U3WA 3G89A 3ONEA 2IGBA 4OGWA 4XM2A 3WQSB 1YKSA 2ZRNA 4CKBB 1X14A 4CF5A 2UVDA 5L7WA 3AM1A 3IP6A 1FVHA 2DWQA 1KK3A 3WR5A 4BE7B 1KORA 2QN3A 4YR2A 1FDRA 3WNCA 2W7PA 4R7ZA 1KY2A 1R5OA 1Y8CA 2J3DA 2Z8YA 4IDAA 4PYLA 2XGOA 2Z09A 3HE3A 4LHZA 1JBKA 3ESQA 1WD5A 3LLMA 4NBVA 1JXAA 2IPOA 2QAIA 2H4YA 3MCTA 4JT9A 2AMLA 5AH0A 1FXWF 1NVVQ 4Q12A 5BT9A 5B7NA 3I83A 2V0NA 2QVZX 2XCIA 5ESXA 3NV9A 3VTFA 2HHFB 1F8FA 3B3GA 4R8RA 2V98A 2AVDA 4ALMA 5AVTA 5DZSA 2QYZA 1Y37A 3B53X 1KF0A 1C9DB 5TS2A 2Z56A 2LIVA 1EDBA 2OAP1 4ZPXA 5CXQA 3F73A 3SC2A 1RJDA 1RWWA 3OESA 1P5FA 4LHSA 3CN9A 1SR8A 2C22A 2MSDB 4G5FA 1VMIA 4UBIA 1KKMA 4YH1A 3WYFA 3AR8A 5H4HA 1HNZB 3GOHA 2OCYC 1JI0A 3OAAA 3TTVA 3LQQA 3E23A 1EZ1A 1Y1RA 2I6UA 5IXYA 5KS2A 3PPXA 2FK7A 3E0XA 4D26A 2BPOA 4BNTA 3AHDA 3MRSA 4KDCA 5A4MS 3FZQA 3CNOA 1R8YA 2AC4A 2GUWA 3KVVA 4B3RB 2GA8A 3URKA 2JD2A 2PNJA 1P9RA 2F3SA 2N75A 3N2EA 2W48A 3UIEA 2XB6A 2A6PA 2EEPA 2PUTA 3DDOA 5TS3A 1I7LA 1R6UA 3PP8A 4J9OA 2QSUA 4R8SA 2BZGA 5HM8A 3KJIA 1EGQA 4IKEA 4BMVA 4C3UA 2BCJQ 2OAEA 3L9XA 2XV1A 3OUTA 3AL3A 4XX0B 2Q46A 2CFCA 4BJ6A 4I4NA 1CQJB 1F0KA 2JATA 2VL7A 4F4FA 4Z4FA 4RIFA 1J42A 3U9TA 1E1QA 1M7BA 2HLDD 3RIYA 1J0CA 2YFKA 2B4KA 3OJCA 2AWOA 5HFJA 3U3RA 1FQKA 2ZBUA 5BWOA 1UBMS 3LSTA 2FYTA 5ALVA 4INAA 2XHEA 3ADPA 3K32A 4ZT7A 1YMVA 3TZBA 3JTMA 5LQAA 4KRYA 2W2XA 2H2AA 2ADFA 3AY3A 1FS4A 4GMXA 1AN0A 2QRVA 4DT1A 1DV2A 2Q49A 4IV8A 1L4FA 3ZHZA 2GKSA 1UKYA 2R48A 5ALSA 3ZLBA 5LDGA 5KNBD 3REQA 5IWAH 2O7VA 3WIUA 1UXHA 1P4HA 1VXRA 1XIVA 1Y3AA 1M0WA 4GR5A 3SNOA 1R0RE 3GEBA 3ORRA 5FD6A 4PGAA 3VR3D 5BP7A 1KZ7B 5A6SA 1ACLA 2J0SA 1SKYE 1A69A 1NX6A 3MINA 2BR3A 4KQ6A 5EMMA 3KJEA 4GX5A 2R1UA 3T4UA 3TSWA 4S1PA 3WYAA 1A1SA 2W9BA 5EKUA 1N77A 5LZ4A 2QE7A 1GOTA 5TQJA 4DT1B 3OPYI 4EAQA 4YP7A 2X9QA 3HB9A 2IE8A 1MA0A 3NC0B 1YZYA 2PLNA 4W5JA 5G0VA 2PMCA 4O83A 5BR4A 1ILEA 5CCXA 2NYUA 5ALOA 1U2PA 1OI3A 2A9RA 2Q4OA 2FZEA 3ND6A 4J0IA 3RGWS 5HP4A 3BT7A 3BJMA 4BO6A 4FT2A 3K3VA 3AR7A 1RKQA 1XNJA 3IAHA 4I8XA 3WQRA 3RTCA 3PX7A 4WBXC 4P4TA 1O6BA 3IB6A 3JZAA 5G0TA 4H1VA 2CN1A 2DECA 3T12A 4C08A 3BQ9A 5IJAA 1M67A 2VJYA 2PRZA 1ZAKA 3MOIA 1M34B 2RGGA 3OX1A 2HDHA 1EH5A 4WECA 3ZUGA 5EJ8A 1CPYA 2FGJA 3IOCA 5C37A 3DWGA 3IV9A 5HA5A 3UA3A 3P9PA 5B6IA 2G3YA 1V5FA 2O14A 5DG7A 2ZGVA 4H4DA 4YBZB 1SN7A 1UDRA 2FR1A 1YDWA 3GIWA 3PUJA 3RSSA 2BSQA 2FLPA 4HNHA 5ER6A 1Z5NA 3O8OB 2VUGA 3EULA 5FYQA 3STYA 4C3ZA 3QLEA 4ALNA 1SD5A 1E3WA 5EJIA 5DGXA 3D2AA 3R4CA 3TVTA 1PFWA 1C81A 1SHZA 2N46A 2C2BA 3GTJA 4P38A 3QLUC 1MB9A 5FLXW 5IVPA 2VPZA 1Q6YA 2HF9A 2WHPB 2C00A 2X42A 4TRRA 3A2LA 3D2CA 4ZARA 3GC6A 3CRZA 4R3NA 4JU9A 2C1EA 2PO7A 5TMPA 2WJWA 5BQOA 3HUDA 4J29A 4PG7A 1RYHA 1MKYA 1ESMA 4BNKA 3M6XA 4FYWA 1M0TA 5DBIA 3PXUA 1JDJA 4GG1A 2BTEA 1VC2A 1PG2A 1TLTA 1UZNA 1OBVA 2FPGA 4B31A 4ZTZB 4RBNA 1ODCA 3UUFA 2IOHA 2RH9B 3VC3A 4IR9A 3SOZA 2XRMA 1PU2A 2BFNA 3SI8A 4O2RA 1SU7A 1J5XA 1JLKA 3AF2A 3IBSA 2VQEH 1AZTA 1MVOA 2GMWA 1JX6A 4G5HA 5B1EA 3ZWXA 3MT9A 2XGGA 3THSA 2B7BA 2HMVA 2G07A 1EKVA 2P6MA 3ESCA 3PWTA 5FRDA 3UV7A 1SHJA 4FFOA 3WOHA 4AJLA 1XKLA 4EKNB 2NADA 2P9CA 4DMMA 1YHZA 2OZEA 3S28A 1P7ZA 3ICWA 4QW9A 5TC4A 5HR5A 1W5TA 3N8IA 5F2EA 5FJJA 3W9YA 5AM5A 4A73A 3PITA 4G86A 2HCBA 2YWRA 3UQ8A 2WHXA 2XEDA 3HCPA 4LSWA 3Q98A 3DLAA 1Z5WA 2R7AA 4RGVA 3AKEA 1DG1G 1D3AA 4HP8A 4Y7CA 5CM8B 1MT3A 2AGVA 1PYDA 4O63O 1KHHA 3A9VA 5DXFA 3IOMA 4IGAA 1IC6A 1USVA 1EUYA 3U54A 1EX7A 4PGFA 5BOSB 2WQ7A 3G7NA 1X1TA 3QV2A 5M2QA 3F8TA 1T0JB 3GQBA 3CNEA 3E9ZA 1ZW6A 2CYCA 3C3AA 4LZLA 2G0NA 1VIMA 2C3YA 1H1LA 1CY7A 1T1GA 2LD4A 3IR6A 1XEWX 2GD0A 4Q1CA 5GONA 3AM3A 4A3IG 1ZD4A 4B82A 2DPXA 5AJWA 5DYNA 4XEUA 4D81A 1SCJA 2Y3IA 4UASA 4UUAA 1D03A 4B87A 2A9OA 1NW6A 2C2XA 3EGCA 4B47A 2BEKA 3AU8A 1NUHA 4LDRA 3DZKA 5AHRA 2JEIA 1RKXA 4JQOA 2ZRGA 2GZDA 4L5CA 4W7SA 2FPMA 2FUCA 4IQ4A 1SB8A 1T3HA 4H1TA 4N3GA 1UWLA 2XOXA 4LSGA 5GIPE 1QE0A 2P9JA 2G9QA 3IAFA 1OU4A 5TARA 3IAM6 4XWTA 4ZCMA 1JECA 1T2FA 2KLHA 4LDPA 2IH5A 4ENUA 5KOYA 1FCJA 1M2EA 1OILA 3VYRB 5A62A 1ENZA 3E9YA 4K6FA 4AO8A 4ZXFA 3DBVO 1Z6YA 3ONFA 1P5JA 2GBLA 4G5OA 2E5WA 4NVRA 1YUBA 3FUXA 2QVGA 1HRDA 1V2GA 2QR3A 4IIYA 3MB8A 2GAJA 4M8KA 1Z0SA 1CUBA 2A94A 1IG3A 2PGIA 1IBRA 3UMJA 1UPAA 2Q6VA 3L4KA 1WMFA 3G6KA 3DEZA 3EAGA 1LFAA 3T1NA 1KWKA 1E3LA 2FETA 3TLEA 2ZU6A 1SO8A 3CEHA 4II7A 2KYRA 4POAA 4FU0A 1JEEA 4JASB 4GSYA 3CE9A 3CEJA 4I99A 1M2GA 1YWGO 3N0RA 1YR1A 5KX5B 3LOPA 4UVDA 4WRRA 2HPVA 5U1PA 5IEBA 1BVUA 4MRPA 1BFKA 2JHCA 5JG7A 8ATCA 1WVMA 3SSAA 2P9QA 4CYMA 1H0KA 5FULA 1NBOA 3DF9A 2MYNA 5ICEA 2QYHA 2ONCA 4L6CA 3I09A 1XDUA 2COJA 4BFLA 1X13A 4P54A 4J0MA 2VSFA 3FG9A 1E5VA 2O4CA 1Z75A 3GFFA 4MRMA 1Z0JA 4XD7D 5KYUB 5B1HA 3TSOA 4NZOA 3H1FA 3FWZA 4AB1A 4BCDA 4NNJA 3ABRB 4PZYA 3RVDA 4H3HB 1EHYA 3KB2A 3QEMB 2QRGA 4H7IA 1NW7A 3WWHA 2IW1A 1DCKA 4H2DA 3OIFA 4E22A 5LMNB 2DWCA 5DWQA 1CIVA 1HNZH 1HM5A 1QIIA 2IPMA 4HZUB 3B1JA 4WNAA 2V7WA 1BEEA 1QGZA 3SYRA 4F71A 5KAMA 2GFIA 4Z8YA 2I65A 4YS6A 3ZBUA 5JNTA 1YCGA 3ADKA 5DDIP 4BQFA 2WTBA 3D5QA 1RXCA 1ZD3A 3NHMA 2XUDA 3F7MA 3PI7A 3ZR4B 1CUGA 4MA4A 5F35A 3Q8WA 3V97A 4FFNA 1OWTA 3ST7A 4NBNA 3W5IA 4KXVA 4YCLA 1T13A 2AGQA 1UMDA 1N2SA 2OCGA 1KI9A 2FPWA 3QY0A 4XEHA 3ROTA 3W6ZA 3L6OO 3ZD6A 4LSZA 4DFDA 4RTOA 2V3WA 2HEIA 1EPUA 2BEUB 3OFJA 4A3EG 4BX8A 1IPHA 1JF8A 1MVLA 3UXYA 2DT5A 4NZZA 3KR2A 3LY8A 2A0KA 4D4GA 1LTQA 2DMRA 3RYIB 3MB5A 4ACBA 5FO0A 4FFBB 1TZBA 2IWRA 5IABA 2GK4A 3HKBA 4B6GA 3U3ZA 3WSTA 2A30A 1X7YB 1OZFA 5KSOA 1SOWA 3FLMA 1Y9EA 1PVVA 1QC5A 4ZV9A 3S0JA 5IZCC 4YJFA 2VNHA 1GDTA 2WWXA 4C2BA 3K6RA 2QIPA 3SQLA 3OZFA 5DNCA 1VM6A 4KPFC 4B3JA 3PC3A 3QY9A 1IXKA 3MOSA 1HA3A 4GGOA 3UT0A 4U7WA 1EK1A 3F1KA 2ZRLA 2BL4A 4TKLA 4C03A 5M29A 4BNXA 5K51A 3W9SA 1W4ZA 1PKEA 2DFNA 3INYA 4P35A 4HS9A 5KPJA 4OQZA 1F38A 3EYYA 3G0CA 4NEGA 4HDRA 2IS4A 3AQIA 2QQ0A 4GPD1 4B0PA 4PYKA 1FIUA 2H4WA 2J5KA 4XB6B 1ONBA 3GCZA 1DWUA 1E2NA 4R8LA 2SCUA 3VU8A 3B6MA 2W8ZA 2HPHA 2WILA 4LOIA 1DIKA 1SG0A 5K0BA 6NULA 5IWCA 4JLDA 4HFRA 3SNKA 1H4VB 5A2QW 2ETVA 2IA6A 3HGQA 3EIEA 3IQIX 4RVGA 3KHGA 3R24A 3EZ7A 1HR0H 1NI3A 1VIDA 3H5TA 2XVAA 5ULLA 1WXWA 3T7JA 4AS3A 1QHIA 4BAUA 5DGIA 3ZVKA 3EAQA 1U8ZA 3ZTTA 2P6RA 2H6EA 3BICA 3ONNA 2VS1A 3MWYW 2C9YA 4J2TA 4XPIA 4NONA 3RODA 4ZHQA 3H8VA 3EWNA 2C92A 5KS8A 2QXYA 3RDPA 4ISBA 3CEBA 4DNFA 5FUYA 5F4BA 2AI2A 5DKFA 2FPUA 3J7TA 4KWTA 4RSRA 4HGPA 1ODFA 4BNDA 4BUCA 1OAKA 1QRRA 1THGA 3LX6A 4LDZA 3KR9A 3U55A 4U2GA 4UMFA 2R6AA 1R88A 2I8CA 5AI8A 5B12A 2R97A 2ZB2A 1EP1B 3BMXA 2D4HA 4PBSA 4TMWA 3DGFC 4OXXA 3T3HA 3AJDA 4QOIA 2GPWA 1SFOA 3T5TA 3HDGA 5EUQB 3E22A 4EYSA 5AM3A 2ATLA 1A98A 1ABFA 4H31A 4QEDA 1F6BA 4ZT2A 2R6DA 1H8HD 4I4TA 4P4LA 1YFLA 3FKIA 1ZSNA 3OC0A 4R1NA 5EWLB 1NNUA 4B4OA 1J33A 2XT9A 1B15A 3Q88A 2H3HA 1J8MF 1L5HA 1YQGA 2BFDB 2WYUA 4EJ0A 1QZTA 3NTQA 5FUXA 4RTRA 2FZKA 1WP4A 5LP6C 3O94A 3GMDA 5H8WA 1JE1A 1P81A 4MDYA 1T5BA 3DL7A 4NE2A 4B7XA 1HFKA 3PEVA 1YR6A 3KVNA 1QCZA 1QTNA 3FYCA 4WT7A 4A6EA 1AMUA 3UCFA 3O92A 4HH0A 5ALHA 3PA8A 3B3JA 1CF4A 4MR8B 4C7VA 4PRKA 2XODA 1J1UA 3WV4A 4F4DA 5KSYA 2PIDA 5KTTA 5J2TF 4M88A 4OJMX 4ZKEA 2FG5A 2ZE7A 4HUTA 1MLDA 1MVNA 2E2HA 2RGXA 2Q8PA 4N5NA 3LWBA 2W6OA 3AUTA 3MPOA 1E79D 3CMMA 4KX3A 3TI7A 1UR5A 2R6JA 4ZEWA 4A2PA 3O7MA 4DIBA 2I80A 2YFHA 3W8RA 5AUPB 2XBMA 3VQTA 4IRCA 1MOSA 5AUQA 1ZU4A 1SHTX 2P7IA 2NUTA 2Q1UA 2WV9A 5LYJA 4CR6A 1MC4A 1PLLA 4X0EA 3TQIA 4MR9A 4DA4A 7GPBA 3O4IA 1I6UA 1V35A 1J1ZA 3WIBA 1HDRA 3LTEA 4IHAA 2I4IA 2VLIA 4UBMA 2GN1A 1E3DA 4UZEA 1UMDB 2B20A 2WT8A 2C2ZA 1WRBA 3IVGA 5AW3A 1H42A 2HQSA 4ESVA 5D1NA 2CLHB 5C7OO 4WY2A 4YIHA 2PKEA 2XNCA 3CGWA 2C42A 1P0MA 5KTPA 3CSDA 5CW2A 1NA5A 1TQ6A 2EFEB 3U19A 1KNXA 5F9FA 4KIUA 3NM5A 1NDHA 3BDVA 1UDAA 3TSCA 2E2IA 4XGRA 4JKOA 2YRXA 5JJIA 2XA1A 4B85A 5CB4A 4TV8F 2IYQA 2DBYA 5F7JA 2FFJA 2E85A 4FYIA 4YVFA 1FW8A 1IM5A 1QF6A 3OF3A 3E05A 1EVKA 1G2PA 2VXOA 3CJRA 4HH3C 2QT1A 2QW0X 4JT2A 1LC0A 2V7XA 3U1VA 4C4AA 4Z5XA 5B3LA 5JYBA 3P4UA 3MM4A 4FNMA 1RU3A 3FTEA 1PZHA 3WE7A 4Z3KA 5KG6A 1FDVA 1GLNA 4QHYA 2A1UB 5M5BA 2G09A 4NBWA 3NM4A 1JIXA 1TYEB 4NAVA 4N6OA 2OCDA 3DEFA 4EQZA 2ZCVA 3H9EO 4L0DA 5MN6A 4M9XA 2OEPA 1W9HA 2XCRB 4UAJA 4KSCA 4W6QA 2HNKA 3VC1A 3OOEA 4EFKA 1YZVA 4K9MA 4PXAA 1LNQA 3ETEA 3O1IC 3QA3E 2RHLA 1TA9A 2OXFA 3CX3A 1WSAA 4DVGA 3S1SA 4F50A 2Z5GA 3RO7A 2Q0HA 1P7YA 3ELUA 1YHYA 1DEXA 3V5NA 1XMIA 2DBZA 2HR1A 2F9LA 4E4RA 3IV6A 5J58A 4DC0A 4WLUA 3PR4A 2V5VA 2FEWB 3D6FA 3IESA 2EL9A 3Q9NA 4KDRA 2HW8A 2PJUA 1F1JA 4Y1FA 4O4LA 3SP1A 1LPNA 4QO7A 1P1RA 4JVOA 1EFCA 4Q1FA 4DC1A 3K0KA 1LVGA 3DL2A 4DQLA 1ODIA 1UQRA 4RU1A 3A6PC 1QKIA 1XNQH 2JFOA 2WTAA 3JVIA 4AUMA 1FQOA 5TLSA 1QVRA 1NN1A 2GETA 2G4CA 3O74A 2AG1A 4EW1A 5I4BA 3KPYA 2BW0A 3QOXA 2PMBA 1S97A 1DL5A 4L7QA 3LW7A 1SBIA 2P4HX 2PEYA 4JGGA 2YV2A 5CFQA 1U0JA 1T8TA 2JAUA 4MHTA 3SJBA 1VIYA 2CE2X 2DSNA 3BBPA 3IDOA 4O2BF 2G25A 4LC1A 1C30B 1YFZA 4F97A 5EIXA 2EX0A 5HF8A 1AZLA 2NOAA 2ZYGA 3HEAA 3TSYA 5KG2A 4L4YA 4OLFA 3ZC3A 3KIPA 3FPBA 2IEGA 1ULUA 4TV8A 3C6MA 2OGUA 3TLZA 3QWUA 1E5LA 1USKA 2B8WA 1TA0A 4BEBA 2DY1A 3N8GA 4HEJA 4JD5A 3DXFA 1RPJA 3NR2A 1YAJA 2O5EA 1QGAA 2OG1A 3O82A 1CEYA 1JIUA 4BWSC 3GCGA 2XVYA 5GQSA 4MUHA 1OJLA 2LRHA 2UVPB 4OJQA 3RAGA 4WXRA 4FYYA 4N47A 3T38A 3K0CC 4AYTA 1FP2A 3R0ZA 1XLUA 2XITA 5LQNA 1OZHA 2O52A 2QLMA 2PMFA 5DISB 3GWGA 2VJDA 1VZ3A 4MVJE 1XYYA 1E2FA 4CCSA 1MFZA 2R5NA 1GKUB 3ORHA 1FE8A 4AJEA 2Q7XA 1KJQA 4LRSB 1Z5PA 1DS6A 2P65A 4FDTA 1KYWA 4S24A 3H3VH 1WUJS 2WW8A 2CZCA 3LDGA 4R1QA 1L4BA 3D3EA 5EWMA 4PWQA 1VI2A 2BBTA 3LECA 1QM5A 2WPDD 4OMFG 2P4UA 2PPLA 2QRNA 3TAXA 4JV1A 1Z0KA 3VXKA 3WHIA 4E1AA 1E9FA 2JIOA 2OV2A 3I9FA 4J4HA 2QN6A 5ALUA 5H59A 3EUWA 3ZHTA 4DV0H 4JL5A 4D9CA 5IXSA 4FFRA 4HB4A 3RUAA 4II2A 3IHKA 4AUKA 5IMBA 4HT3B 2OD7A 2M6LA 2CCJA 3WMEA 4Q18A 3IMGA 3B52X 3CINA 1BW9A 1CERA 3H6HA 5KFSA 1OH7A 1S3SA 2PCLA 2GRAA 1X1CA 2I3DA 3WYCA 1KH2A 3OFKA 3H20A 5DM0A 4DCSA 3QA9A 4RLFA 2RHGB 4RIHA 1A9PA 4V24A 2JEFA 4F3TA 1VYHA 1D7AA 4FZVA 3TXXA 4WESA 4X1YA 4BQIA 3USCS 3KE9A 4M22A 4YWHA 2EYQA 2QV0A 4O0MA 1NTRA 3IDZA 2JIMA 3NH6A 3OSNA 2W90A 2WNSA 4ZCIA 1J4AA 2YR0A 4QAQA 4RWEA 2UUAB 1IPFA 1NXOA 5CB4B 3OQ6A 2CYBA 5BOSA 2BDTA 1PWYE 4RVSA 2EHDA 2UKDA 5DTIA 1T0BA 1GUDA 3MJHA 1SQ6A 4MZXA 5J3JA 1P62B 3I4CA 4N5LA 5IYZA 5JXIA 3C7DB 5TVGA 2B63A 2PMEA 1S9DA 2G5TA 5BURA 1KJWA 4ALKA 1AGXA 4I36A 1TUBA 3GIDA 2FZLA 2DLCX 1JKIA 1WUTA 2GDZA 3Q72A 3DQQA 4RJ2A 5ARCA 3DVAA 2YJ6A 3UWDA 3JWIA 3ZWWA 4AM8A 3L41A 1CCWA 4O3FA 4ZHQB 4B7ZA 4BQRA 3QEJA 2WDTA 3B3AA 1I6MA 3M5WA 5B64A 3HU5A 3DXYA 4NNPA 3NBZB 1C7RA 1THTA 1SULA 4DV5B 4M1ZA 1OAOA 2DGDA 4OLJA 1OGIA 4TXMA 4JH0A 1Z06A 1N6RA 2RHHA 3JD4A 4LQLA 3I62A 1XZIA 1G18A 3E18A 4KP7A 1KSHA 3GNTA 1VJ1A 1J07A 4IVQA 3RS2A 1I8TA 4DRXB 1TEHA 4HZGA 4UM5A 1RK6A 1FYEA 4WEOA 1QK5A 3A3KA 3AUAA 1YZLA 4ADSG 1PUXA 2HJVA 2UZAA 2LZ0A 1K8RA 3VDXA 2HMTA 1KE2A 1ISJA 2HGZA 1BGVA 2G7ZA 2CNWA 1VLVA 1JKFA 2RC5A 2VP9A 3COVA 3L82B 3UMGA 3DMRA 3RAXA 1YGYA 4G1CA 5JNLA 4MV8A 5KSWB 3BQ1A 1KC1A 3KVRA 3FRHA 2GYWA 4QVKA 2FPSA 1TD9A 3RUEA 3WJAA 4UM9D 5HNEA 2A59A 1Q15A 4FE7A 1BYIA 1W2HA 1FJGH 3K1YA 5D1OA 4PZ8A 3GJXC