3ETJA

Crystal structure e. coli purk in complex with mg, adp, and pi
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3etjA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3etjA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3etjA01
5CAEB 1KJ8A 4TUYF 3SE7A 3DF7A 5KX5F 5LOVF 2GPSA 2R7NA 2P0AA 4O2BF 2FPPB 4Y8VB 4FFPA 4DLKA 4MV4A 1IOWA 1AUVA 1Z2OX 2HGSA 3U9SA 4ZHQF 2R7LA 1GSHA 3JZFA 1CQJB 4O84A 2XD4A 3E5NA 2W6OA 2CNVA 2I8CA 2I80A 3U9TA 2OLSA 3BSYA 4MV3A 5BPFA 4WBNF 2YYAA 3TINA 4QSHA 3RV3A 4O4JF 4MAMA 4WD3A 2Z04A 4FFRA 2ZDGA 1EUCB 3JRWA 3VPBA 1M6VA 3K3PA 4FFNA 3OUUA 4YB8B 1JDBB 4O83A 2V58A 5BPHA 4O7WA 2NU7B 3BFPA 4HQ6A 4C5AA 4O7TA 5CA1F 4O4HF 3NUAA 2W6ZA 1EUDB 3K5HA 4E4TA 5CB4F 4M9UA 4C5CA 5BMVF 1PX2A 4O86A 3R5FA 2W6PA 5EZYF 3VMMA 3U55A 1C30A 4XZ3B 4O7ZA 3HBLA 3BSWA 2R7MA 4RZQA 2VPQA 2W70A 4ZQIA 1EZ1A 1A48A 2R84A 5JH7F 3VOTA 3N8DA 2J9GA 4FGRA 1B6RA 5JVDF 2CQYA 2NUAB 2NPOA 4NYEA 4EGQA 1A9XA 3JRXA 5JQWA 4HNVA 1C3OA 4ME6A 4I4TF 1JLLB 2YL2A 5FNVF 2FPIB 2PBZA 2QK4A 4XYMB 3LP8A 5K2MA 4ZI7F 3KALA 4XX0B 4IWYA 3ETHA 2ZDQA 1E4EA 2V5AA 2I87A 1Z2PX 2YS6A 4EA8A 3U54A 3KREA 4L1KA 4MV8A 4FFMA 4YBZB 3G8CA 5C1OA 2DZDA 1CE8A 2W6NA 5J2UF 2DLNA 4IIJF 5CA0F 2VHEA 3ORQA 4GGMX 4ZOLF 2HJWA 2YWVA 4O7SA 3VPDA 2SCUB 5LA6F 3MWDA 2W6QA 4O7VA 3R5HA 2NU6B 3MJFA 4MV7A 1GLVA 3RUPA 2YZNA 2GPWA 4MA5A 2R6FA 3HB9A 2C00A 3VA7A 2IP4A 1EHIA 4MV9A 1I7NA 2NU8B 2GLTA 4EGJA 5JQGF 4I55F 3VPCA 5D8DA 4O7NA 3ORRA 2Z02A 2R82A 3TIGA 2YRWA 2YRXA 4EA9A 3TQTA 5LP6F 2GQSA 1DV1A 1KEEA 4O81A 3WO0A 2ZDHA 3K5IA 1DIKA 2R7KA 4O7RA 4TV9F 3GLKA 3LWBA 2QF7A 2R85A 5J2TF 5C8YF 5HV6A 3KAJA 5GONF 2CNQA 1OBGA 4O82A 3V4ZA 4HR7A 1Z2NX 1VBGA 4O4LF 1KJJA 4YAJB 2YS7A 4M9CA 4EAAA 2W6MA 4DIMA 1BNCA 1KJ9A 5I47A 2FB9A 2PVPA 3GIDA 3V4SA 1GSAA 1CS0A 2DWCA 1IOVA 1E4EB 3BSSA 2R86A 3AX6A 1AUXA 4IZOA 4O4IF 2DIKA 1OBDA 3R5XA 1M0WA 4YAKB 3WNZA 3Q2OA 4M99A 5C1PA 1EYZA 3OUZA 4YJ3F 3G8DA 2GQRA 4FFOA 3TW6A 2X0SA 2CZGA 4EG0A 4EABA 2VR1A 2XCLA 1VKZA 2YZGA 1KC7A 2YZMA 3RV4A 1KUTA 3MWEA 3RFCA 2V59A 4MV1A 3UFXB 4O7YA 3WO1A 1GSOA 4EA7A 1UC8A 3R23A 5IYZF 4I50F 2W71A 5LXTF 4MV6A 5H80A 3AW8A 1W93A 3ETJA 3I12A 3TIIA 2PN1A 1WR2A 4J6EA 2YW2A 3BG5A 1ULZA 4M98A 3HO8A 4XYLB 2CNUA 1CQIB 2NU9B 1DV2A 2WYOA 1BXRA 4FU0A 4O2AF 5LYJF 1T36A 3R9RA 2VQDA 4TV8F 3KAKA 1KJQA 3JZIA 1M0TA 4FE2A 3N6RA 1GGOA 4HNUA 4MA0A 4IWXA 5KKNB 3QFFA 4O7LA 2FPGB 1JDEA 1UC9A 4C5BA 1VBHA 4YJ2F 2FP4B 2R87A 5JVLA 5DMXA 4HNTA 1W96A 4IHJF 1SCUB 1I7LA 2YZLA 1B6SA 1KJIA 4FFLA 1PK8A 1KBLA 1JKJB 5HBRB 3Q1KA
chains in the Genus database with same CATH superfamily
1M1ZA 1SXGA 1ZUNB 3L1VA 3KS9A 4JXXA 1I4DD 4EHNA 4OATA 4DT1B 4KQIA 2P0AA 1GN9A 3JSLA 2WQ7A 2AUNA 1V41E 4RMJA 1TWGA 3OC6A 1XZEA 4Q0YA 5JROA 4GKAA 3DDZX 1TAEA 1RCFA 1RYHA 3CLUC 3IULA 1GQFA 3JZFA 3TTXA 1CEXA 1F1JA 2VC2B 2M2IA 2WJZB 3RIGA 4X64H 2GJ8A 1NASA 2JA2A 4Q3BA 1R8QA 1EJ2A 1IBMH 3E9RA 3LSTA 3OE7A 4J9OA 2XVAA 5FNVB 1F51E 3GLRA 2RHGB 4D9GA 2OSBA 3TZHA 2BM1A 3MBKA 4GZ5A 4DZTA 2D7CA 4L27A 1LQ2A 4KFSA 3DLBA 5IXYA 4DDTA 2XUGA 4C5AA 1ZI6A 1CY0A 1GZDA 2HRDA 2C7RA 3WGZA 3RYHA 3ZWOA 1QYDA 3QXXA 2FAXA 5ABPA 1YDGA 1KJZA 1N77A 5BR8H 4JP3A 2B63G 3PNVA 4PIVA 2P1ZA 2BE9A 2QDXA 3KJZA 3Q8QB 4WNCA 4EW1A 3LOQA 1QSGA 4F46A 2MSEB 1V3QE 1DG3A 2OPBA 3KD2A 1C81A 5AVSA 1NUPA 5IDXA 3QVWA 4WZBA 3HA7A 4JJ8A 3OY7A 4Z1OA 4XYGA 1P91A 1WW3A 4CQNA 2ZKIA 4W8OA 2R5WA 5EIOA 2YMLA 1F8GA 1IAVA 3OTGA 4UDXX 2X7JA 3HB1A 1RAEA 3AEQA 3TECE 4Y2PA 4HDMB 3PHLA 1CERA 2B25A 2FJPA 2Q2UA 1SB8A 2QX7A 1YE3A 4X1KB 3BJZA 2G76A 2G9VA 5EUQB 3Q72A 3RF6A 2ZYVX 3HL4A 3VGPA 4GWGA 4FGWA 4FOPA 3HWSA 5HQJA 2Z1NA 5EP3A 4ONEA 2EJVA 4BU1A 5KT7A 3HBNA 2A9FA 3V7FA 3OPXA 5AMXA 4O4LF 1D2HA 5LZ5A 3U3MA 5BSEA 3FYUA 3R9KA 3KAQA 1SBTA 1V9LA 2YW9A 4BBSG 1C7IA 2F3RA 3DBVO 3CG0A 2WZBA 4YJDA 1GPJA 1Y5NA 1UJMA 3HDGA 4W1QA 3V33A 3V4RA 3OZ7A 2FDRA 2QRPA 2J09A 3LC1O 2I9KA 4YFVA 1A8QA 1IHYA 4I4LA 4H35A 5T57A 1GGFA 2WP0A 2IWRA 4FFOA 1NVKA 4E32A 2QW1A 2YIJA 2ZVPX 3LLVA 4X9XA 3IOMA 4JLUA 4F3YA 4B34A 1IB6A 1SFOA 4MVWA 2QW0X 2XUPA 4O3PA 3VOSA 1J2RA 4EAQA 1SBHA 5DGIA 2FEMA 2ASLA 4RFLA 3MWYW 3ZK7A 3JQBA 2XOXA 5JNTA 2WJYA 1G1MA 3L7BA 3TPFA 1NQWA 4GNKA 3ETDA 5CHEA 3V1LA 1OI3A 2G5TA 4RNMA 3HG7A 4AD8A 3AESB 5C4MA 4WZAB 4BO1A 1T0PA 1OA1A 2JAWA 2P6PA 1RJFA 4J9QA 2VJQA 1DHTA 4ALMA 3T0FA 3NWEA 3A3OA 4DUZH 4NBUA 4NQRA 1T5IA 3BC1A 1SULA 4UQLA 4J0GA 1YB5A 2WZDA 5AICA 1Y37A 4QPZA 2YWJA 2XGQA 1VSQA 4PRZA 1PO7A 1C80A 3THXA 1JXQA 5MN5A 3PF8A 4OA5A 1L5WA 3D31A 1A7AA 3D4BA 3MYRA 4Q01A 1KYZA 2WJVA 1SWVA 4CM4A 4RSMA 5JZ9A 4ERNA 3ZY4A 4V3CA 3KJEA 3PWTA 4B87A 3LU1A 2P9BA 3EXHC 3DWGA 4LEIA 4CQLB 5DTMA 5DJ5A 2ZULA 4DJDC 3CEPB 4D42A 1NFRA 2P62A 2QXYA 4J1TA 4K9QA 2OV4A 3WYNA 4H18A 3B6EA 5JXHA 4H60A 3K0CA 1PYDA 4RKRA 5ALXA 4U2BA 4LYEA 2FW6A 3CJQA 2Q7DA 2AX3A 5FFMA 1L7DA 3HU3A 4LRWA 1G60A 1Q2XA 2I4MA 5FBQB 4C07A 3EH2A 5TLSA 1UNNC 2ZYHA 1UKVY 4QC2A 2G9ZA 2GVZC 5LD2C 1E1RA 3V6HA 5A7FA 2JA6G 4L72A 1H8HD 3HY6A 3MT9A 3KXKA 4PLZA 1I2KA 2JGAA 2H9AA 3AR5A 3KR0A 3GVCA 4DMGA 3MD0A 1HL3A 2HMWA 3U4AA 3I6ZA 3HDVA 1NVGA 2LTAA 1Z25A 5DEOA 3A3PA 2CHUA 2H7XA 3W5AA 5L3QA 2HSJA 3Q9UA 1GL7A 2ZE5A 3PQ6A 5CVEA 1IZ9A 2BFFA 1Z2AA 4KPUA 4INPA 2BFDA 4EW6A 3VJMA 3FZEA 4DC1A 4DSUA 2WJAA 5BN3A 1AZTA 4O6VA 3ND6A 4PZCA 4NHEA 5IUKC 5DM70 5I5YA 4RL4A 2WJPA 4ZA2A 3H6KA 1J1ZA 1JNYA 1VPEA 2XZTA 2PIAA 4OU5A 4X85A 5EJ8A 4HZGA 1T0HB 4BO6A 1RYSA 4C4RA 5K45A 1ODIA 2P91A 5KG6A 5B53A 3VR6H 4I2NA 3D7RA 1YDEA 4GP6A 4CI0B 1E5TA 4R2IA 1Q92A 2HCBA 3VGJA 4MW7A 3P96A 2WTAA 3WGJA 4QYIB 2JGLA 1UP4A 2Z02A 3I9V6 2YRWA 1P0QA 4PPQA 1HKHA 1MJHA 1N2CA 1YQXA 2UYCA 1IMJA 3BS4A 3N8HA 1HZZA 2PX6A 1M1NA 1GR0A 3MCTA 2QV0A 4Y7DA 2QUKA 1EFRA 4POOA 2PFKA 2UU9B 5FWYA 4YRSA 1AB6A 4JYMA 1SEIA 2WEKA 3C7TA 5BN5B 4HGYA 1JSRA 3FHJA 2H4ZA 4TMXA 3AH8A 2HWWA 2C9YA 1CRLA 1G3RA 1HPLA 2QN6A 2FPSA 4UHJA 5JZVA 1P9RA 4NONA 3ZCQA 2DIKA 3TNYA 4P3OA 1YDFA 1P6UA 5CDUA 1CE8B 5DN6D 2DVMA 4AP9A 5AW2A 3L4BC 4LI0A 2OHGA 3G2JA 3NGXA 3ZJ4A 3HKZE 5EDWA 2C7GA 4MRAA 1WVIA 1EBFA 4ZVMA 1L7RA 4NU6A 4IOMA 4LF6B 3K31A 1JBQA 5EINA 2QTCA 1GPBA 1P9WA 3DXXA 4O7YA 3MR3A 2D8MA 5ENDA 3H2BA 4EJFA 2OZKA 4LY0A 4BXOA 1NBHA 4LE2A 5IUJC 4URFA 2B4YA 3O75A 3AWIA 4K9PA 2XTMA 3FGOA 1KI3A 1YCHA 2WTFA 5LLSA 3RC7A 4E14A 1JG4A 3PXAA 1E6CA 3OIDA 1XE3A 4TS4A 3KCQA 3WLEA 5E3IA 1GADO 3HHPA 3A6DA 1M0TA 4BGEA 3KWFA 1NA5A 1DZIA 3S8EA 2R7ZG 4JT2A 2FPGB 3M6FA 1A3CA 2WPNA 2AF4C 3PFNA 1Z68A 2G09A 3DBRA 3ESRA 3HV2A 4WJZA 5KZMB 4Z0PA 4MPRA 4CKXA 4A6EA 1ZXXA 4ABYA 4E11A 1G16A 2VA9A 3IPYA 3UT5A 3GAZA 1EWYA 5JG7A 3F5QA 4AMZA 4ZV7A 1R88A 2G72A 2JLBA 3R8FA 4KTTE 2JFYA 3MWMA 1DUIA 2WUWE 3E7FA 3AJDA 5B3KA 3FCSB 2BSQA 2YJNA 2EIXA 5CLGA 2I62A 2GNAA 3KKMA 3KB8A 4XX0A 4BMOB 5AQEA 1COWA 3HL0A 2WD7A 3FPHA 4OKSA 1B6TA 4UBLA 5C8YA 1H2XA 2R6JA 1XMJA 3JALA 2IIVA 3EXFA 5ALZA 3ZWXA 2GYYA 4IVRA 4KIWA 4PHFA 4YCBA 4JI3H 3L84A 3PR4A 1T3ZA 5LYYA 2F64A 1DEOA 2OCKA 2QBYB 2Y66A 1NMZA 1P4HA 5IM5A 1S1CA 2VYNA 2AEMA 4B46A 2HM7A 1IYEA 3PUXA 2PBLA 5E0OA 1R12A 3CVXA 4LXHA 4C0HA 3GUYA 1A88A 1Z08A 3G88A 3MMZA 3RS2A 1UDAA 5C5EA 3IUQA 3TZQA 2ZM6H 3HSYA 4PZ8A 5DI3B 4IYJA 2PUDA 4AKTA 1TNDA 2F1RA 5L3ZA 3CLRD 1N5KA 5H8WA 4IDDA 3UB2A 3CTPA 4DILA 2PBZA 1FFSA 4NU0A 5JXWA 3LNCA 4H7DA 2QRNA 2H2DA 3RGZA 1XWWA 1A4UA 4X61A 4RDXA 4HH1A 1N2XA 1ZOOA 3S44A 4D9KA 5EN4A 4DLVA 3GZNA 1Z7EA 3PNPA 4GLWA 1ZRNA 3L8EA 1G38A 3OM9A 4D0NA 2QVGA 1J8FA 5DWDA 2OYRA 2Q62A 1ILWA 1XD8A 2GBGA 4LYFA 5KWEA 1RBQA 5JZBA 1E9AA 1IJKA 1AOXA 4YRFA 5IAGA 2NO9A 1RWXA 2B94A 2NU6B 3NKFA 4RXTA 2Y99A 4O29A 4M6WA 2X5KO 2JIPA 1E5DA 3VR3A 3OJFA 3U7FB 2R8ZA 3OCJA 2LD4A 2JH8A 5DKFA 3RU2A 2JRCA 2VHUA 3CUVA 3ZU6A 2J08A 1Y3DE 3GTJA 5ICSA 3PXCX 3TIGA 4YMTA 4A7PA 1BCRA 1EFUA 5HQ3B 4M1EA 2EG9A 3OLQA 2PX2A 3AY6A 1KK3A 1SBIA 3ZS9A 4DR1H 4RTRA 3VM6A 2BZ1A 3PWSA 2R5FA 2LNDA 5BWMA 5TRTA 1CIPA 2OZVA 4D96A 3LUFA 1E89A 4I9GA 2GX6A 4IVQA 2JZCA 1YC2A 4A92A 2AFIE 3F9IA 4HQKA 2FJZA 4DF3A 2NUTA 4M0KA 3MJVA 1P7WA 1QB7A 1IOVA 3VYSB 4OQNA 1OKKD 3JYQA 3FH0A 4OHYA 3R7NA 2GN4A 2Y0SA 5CDTA 1UXKA 2UZAA 5JD5A 4YAKB 4OXKA 5JXIA 4F4JA 5JV5A 3GGJA 1GRNA 4R3UC 5J3JA 1JDUA 3IIKA 2JATA 3OQBA 1Z8NA 1SVOA 5I8PA 3LKZA 3WMEA 4XD7D 2FK8A 1IHOA 2FOXA 3TZ6A 2BBOA 3IN5A 2CVZA 4KQ9A 3HRKA 1KWGA 3G82C 2H1RA 5KYTA 3LY8A 2UV8A 4ICIA 4G26A 1YXMA 2GBPA 1RADA 2PWBA 3NYIA 2YJ3A 1JX4A 1GFWA 3RYHB 1ZIYA 3L2OB 4LJLA 2BKVA 1ZKMA 1QWSA 4H3KB 4Y2GA 4QPNA 2R1TB 3JARA 1B04A 1CF4A 1F06A 2X9VA 4JMLA 1V1MA 1UBUS 5L9AA 2PSFA 1WZUA 1NHGA 3N1UA 4Y1RA 2R1UA 2OMEA 3D8HA 5C4IA 1GQYA 3R7BA 3SYKA 2ZAOA 4WDRA 4JI8H 3EUEA 5F9LA 4CMIB 2O4UX 3VU1A 1FFGA 1LSUA 2HQBA 2Y68A 3QY0A 2TMDA 4BCDA 3HBAA 1DAFA 3QX9A 1J97A 3IP3A 5I9BA 3DMHA 3N8NA 1WOMA 3CZ5A 1K63A 2GPSA 5FB3A 2F3UA 1DQPA 4XQCA 2WDPA 1NF2A 3HU1A 3DPUA 4INAA 2UXCB 3NI2A 1NT2A 3F0TA 1HEUA 1CNMA 5IH7A 1U3CA 2D4AA 3UQZA 2VTKA 2EEZA 4QJ4A 2HBZA 3VDXA 2WVHA 1XJ0A 4CG3A 3O90A 3H5TA 3BTSA 1DBSA 2POQX 1W8IA 3LCVB 5CB0A 1WW8A 4MP6A 1Q0UA 4HGPA 1T5BA 1AHIA 3ZD7A 1PEKE 1V37A 1JG1A 1T3LA 1VFNA 4F6RB 3ROTA 4RAOA 4EFBA 2EJUA 3QNUA 3FYUB 4RTKA 3C5CA 1ZA2A 2QIOA 4H4EA 1OFHA 2R6DA 1QGOA 1XEWY 5DAAA 4XB1A 3LV8A 3BMQB 3RRMA 3ZTWA 1C29B 3DP7A 2NSHA 1XZKA 1JZSA 1Z12A 3ZY6A 4ZKDA 3R9XA 2OZPA 2XE4A 4OQEA 1PR3A 4U3JA 4I4TF 4CN9A 3TJRA 1FDTA 3MB5A 3V1YA 3WLAA 3D64A 4LJ5A 4EW3A 4D9HA 4A36A 3QQ5A 4DYDA 3G68A 4WQMA 2JGDA 1IQUA 3JQGA 1H2EA 2JD2A 4RXUA 2DZDA 3VC2A 3R0XA 1DJPA 4B0OA 2XKAA 1E5XA 4G09A 4O4LB 4CM9A 2ZQZA 4GKJH 4R2XA 2IKQA 1XTVA 3OZTA 3AETA 1FP4A 1IWBB 2GCIA 1RHMA 3PTZA 1JMVA 1WX1A 7ADHA 3DOJA 2R6FA 2QMYA 2P1RA 2XRYA 2E7ZA 3CT6A 1X9HA 1ID1A 3PFWO 4E5MA 4CE5A 4DFDA 4KWCA 1FU8A 4DLUA 2R68A 1FSSA 4W9NC 2CFOA 3NCHA 1XL1A 4ADSG 1RM5A 3TPCA 4ZQCB 3GBPA 1WRBA 1DIKA 2VHJA 3B3GA 3B20A 2B1RA 5CTJA 3THXB 4KR0A 4O2BA 4S1OA 2QYHA 3RKSA 4CM4B 1PS9A 4HJRA 2IEYA 4XI9A 1BDIA 1JIVA 3ADPA 2SKDA 3FDIA 4K0KH 3ZV3A 2AL7A 3BSSA 2BMEA 1XDZA 2GESA 3MGAA 1XZCA 1YBFA 4QTYA 3ND5A 1JRLA 1GNRA 1ZH0A 4ED6A 1A0OA 1SCUA 4RK7A 2P3LA 3NRBA 4IDEA 2GB4A 4M99A 1OOEA 1R27A 4D99A 3LK7A 4IOKA 4CNQA 1JDSA 1JW9B 1XPUA 3BK1A 4ECAA 2XGGA 1KI8A 3TKLA 3MQ2A 5EWMA 3UOWA 3T3HA 4YLYA 3TGPA 3E9ZA 4GP7A 5F51A 1NF3A 1ZRMA 3VX3A 1NQVA 2HN9A 2X0FA 1P39A 2BEWA 1KHTA 4JXKA 1YZQA 1VKHA 1JWBB 3ZHQA 2FMAA 1BQ4A 3Q15C 1Y1PA 1JG2A 1I32A 2ZS8A 4U2DA 2BMAA 5JYCA 5CCEA 4JOQA 2WSIA 1XTUA 1O9BA 3M6LA 1EGAA 3RI3A 1V45E 3R9RA 2Q3LA 4FYWA 4ZK6A 2VUSA 5L3QB 3ML1A 2ZBGA 2OZEA 3GFOA 4PCUA 3PDHA 4RVOA 1QIFA 4JQZA 3RC2A 2RK6A 3DTVD 2PKYX 2TS1A 1DAOA 3NC0C 2OXIA 3Q3IA 2QJWA 1T4MA 1Y80A 4F60A 3ZJYA 3OUTA 3AJRA 2D2XA 2QR3A 3FI9A 2IOQA 3OU2A 3HV0A 5JBQA 2VK1A 5F78A 2HWYA 2Q4RA 5K51A 1LQUA 2JCSA 1EFDN 1L4KA 2AKEA 2HMAA 5IKMA 1GFSA 5K0CA 3SYNA 5LNK6 3MJSA 1L6RA 4OK5A 4UFOA 3M2PA 3RAXA 1GU0A 3TVTA 3S7ZA 4A0GA 1ADCA 1REQB 4FI3F 5ALHA 4KXXA 3FRHA 4RORA 2PH7A 2A5YB 4LTDA 2O8DA 4I8XA 4N9QA 1M1UA 5AVWA 3UTCA 3WICA 2I22A 3TL3A 421PA 3UMGA 1M1NB 4GKVA 1HG1A 3SJCA 2X42A 1UBGA 2I29A 2GNPA 5FWYB 3NZEA 3RHSA 5JSUA 3I9V1 3W5OA 3L4EA 1XU9A 1MTZA 3EFHA 4YP5A 1RW4A 5I5XA 3IIEA 1Y4ZA 4F84A 4ITRC 3SKXA 2ZS9A 3RB6A 3K5WA 1AQJA 3M0EA 3KKEA 4Z99A 1BJRE 1COWD 1HK7A 4MYRA 2YNMD 2P9QA 4GXTA 2C2DA 1F9EA 3COWA 1B8OA 2RGCA 3EEIA 4J4BA 1DPFA 2WYUA 1A5AB 4RPKA 1DMSA 2GN1A 1PSDA 3KJQA 4Q7QA 3RAJA 1N8TA 3QIVA 1OPXA 3HT5A 2VA2A 3GV8B 3ENZA 2JFVA 1KKUA 2C4HA 2PWAA 3BAZA 5JJLA 1UADA 2GM5A 5EWJA 5C8ZA 1ANKA 4O2AA 4HAIA 3QEAZ 2CK3D 1V96A 5ALUA 4F3NA 3CZAA 2HJWA 3IL2A 1FCJA 3E5HA 4MVJI 3D5EA 4OK3A 3BN3A 1YU9A 5E9QA 2X1MA 1K7YA 2FSSA 2PXCA 2W11A 3I9KA 4G1BA 1D6MA 3BDIA 3ODPA 4FMCB 4P82A 2QZ9A 2Q0QA 2C98A 3VRHA 2HX1A 2XZPA 3G2HA 4LBVA 4G23A 4QBFA 4CTJA 5B6IA 1GCUA 4I5GA 3HBMA 3DZ8A 2IYXA 3H0KA 1SJ9A 1K3FA 3ND9A 4UASA 2MOKA 4G4SO 3AQIA 4IIHA 2H92A 2OAGA 2Y0DA 2DUWA 3LPMA 5CW1A 1U6IA 5EWGA 8ATCA 2Q3BA 3HO6A 2PMZE 3VYRB 3L0ZA 4CC5A 2AQHA 2PY6A 2O06A 4S1PA 2GERA 4LSWA 1U02A 1EM8A 1VKJA 4JSRA 1NW4A 1RAHA 5KYYA 3WYFA 1TZJA 3BGVA 1DXYA 1ZP6A 3LT2A 4ZCPA 1GTJ1 4JGGA 3CW8X 4JB3A 3SEAA 2A8YA 3UV3A 1W75A 2CC2A 2MHCA 4MVYA 5TS3A 2WD7B 3WAKA 1FYVA 2CDBA 3ANXA 4J07A 1NATA 1W6UA 3G9XA 1U94A 5BQOA 3UGKA 4ECUA 1V6CA 1YVPA 3JALB 3K9QO 2XUHA 3EXFB 5A9SA 1LW7A 4KHPH 4NYJR 4NCXA 4F93B 3KIPA 4JYAB 2F1KA 3T8YA 4C6TA 5KQGA 4M55A 5IABA 4JI5H 2AN9A 2HDOA 1G20A 2C2WA 2JJ1A 1VG9B 5A4FS 4LFBH 4EO9A 1M76A 2RI1A 1W5AA 3BH7A 5BYAA 3I12A 1Z0ZA 2JLYA 2CVQA 2NN3C 2VNAA 2JA5A 4FB4A 2ZSDA 4G5SA 1Q5PA 1L4NA 2VP6A 2H8GA 1FFDA 4J9NA 5L4NA 4DKJA 3MFQA 3W8EA 4AVYA 2R1ZA 5JAOA 3KPWA 4BFXA 3N5CA 2Z8ZA 4K3UA 4JEHA 3FROA 3HM2A 1QDLB 1PNRA 3IAEA 2RGVA 1RSZA 2ZRNA 4AL4A 1EUDA 1P17A 1YU6A 4LFCH 4C4PA 4MGEA 1JV2B 1CUSA 5FUBA 3VBCA 4NBLA 3HCPA 1E7SA 5FQNA 4DXHA 1RCUA 4S1TA 1XRNA 3O82A 4GSLA 1QVZA 2E5LH 3OFKA 4YEDA 2W7OA 4NS1A 4AUEA 1E6KA 4MP3A 4RDIA 4JLJA 3QPDA 3W3AH 1CNFA 4AN1A 2AMVA 3PHCA 3BWEA 3E18A 2W4MA 1IIBA 3NM4A 5A71A 2J85A 4HDNB 3HQ4O 5I7EA 2YFYA 2A9VA 2O5CA 5GVRA 1NXOA 4IINA 4YMGA 2XADA 4DIEA 3M5DA 1C1XB 1JU9A 1YSCA 2WABA 5FLEX 4NLLA 2CLDX 1HDCA 5FBRB 4RSGA 5CB6A 3GJXC 1HTBA 5FBVB 3NAQA 2Q1TA 1HNWB 2E3JA 1B7GO 3CEJA 3DTNA 3ASUA 2ZYDA 1Z18A 3W7BA 2OC4A 2PGLA 3B1WA 1GTRA 1GZSA 4MINA 5BWUA 3WYEA 3I4NG 4M1MA 4D3FA 3ZXSA 5I9NA 1IDOA 1O77A 3GCGA 4HPJB 5I7OA 4A6XA 2HK6A 3EPKA 2NUTB 2CL0X 2UZ4A 4LJRA 4N03A 1W581 2AOVA 1ZVJA 2GMWA 3QMMA 3CZMA 1LDBA 1WSBA 4ZDWA 2HXYA 4I0WB 3GJ6A 5ECWA 3QUTA 5CDGA 3U3RA 3ORHA 5EC8A 1R5JA 4D44A 3K1AA 1E2QA 1XMXA 2OFFA 3NBQA 2Z0MA 3CF2A 4MLDA 3KQQA 3GLUA 4JQCA 4D3ZA 4U00A 5ALRA 2QSUA 4IZ6A 4REQA 5DYYA 1P60A 4K6KA 4MGIR 4KKXB 5F7XA 5I5TA 3FHCB 5BSKA 2OK7A 3ECSA 3LXXA 1AKMA 3B1FA 1QAQA 3OECA 3CVWA 1UZUA 1S7CA 4L75A 5BNWA 3TCNA 4IH1A 2IELA 3IVCA 1E6UA 5EZ6B 3KPYA 4TM5A 3IXQA 5E1MA 1MAHA 1KZ6A 2I2FA 3K9CA 1HE5A 4N1AA 1MB9A 1KOFA 2QD1A 4YAIA 4HDKA 4P58A 2WG1A 2XMCA 1JHQA 4EGCB 4DQNA 1W94A 3U3KA 1VOTA 1OWOA 1VMAA 2ZBQA 1Z45A 1K6XA 3GJRA 4TSFD 1U63A 2CYCA 3GLKA 3WDLA 3KZVA 2IDJA 4FHEA 2GN0A 4COOA 2W00A 4TKUB 2FVYA 5BUZA 3PQ5A 1VL0A 4NK4A 4KGDA 1YT5A 1GYQA 2AUTA 4LX8A 4BN0A 4CM9D 2AJDA 2RGGA 5BY2A 4LPSA 5GPBA 1EWVA 3KTMA 1YBHA 3PX7A 4KQ1A 1GPWB 1JJBA 1Y7HA 2HSZA 1TF5A 2BEUB 2UYOA 4A4DA 4AECA 2Q7XA 5IBRA 4U7HA 2QI9C 1XNQB 1SVKA 3BXGA 3QUAA 2XTZA 2CBGA 4KUHA 4N3GA 5I48A 4B3HA 2W0SA 5J58A 3UAXA 3HZRA 4DBLE 2DPMA 1V3VA 5EIAA 2COGA 1GARA 3DEKA 2ZU0C 1JBEA 1HNXH 1GZ3A 1QVVA 4HQRA 2WY2D 4PZEA 4BE7B 1L0BA 3Q7RA 2VF5X 4XOUA 1VGRA 1CQPA 1G6Q1 4JJ7A 1KRHA 5LXTF 4DM3A 5T41A 2JDIA 4B17A 4HFRA 1NN3A 1GPDG 5TE9A 3T7SA 2X15A 3PUIA 4NDNE 4QTTB 2ABWA 1WB9A 3P9QA 4AXXA 4LOLA 1SZCA 1T1RA 1FL9A 4C7MA 5C37A 4HTAA 1GG8A 2GEUA 1UQUA 2DQSA 1YR3A 3LBFA 1FX1A 3R9XB 3U49A 3QFFA 5KTKA 4IRMA 1JA9A 1V3TA 4BZWA 1MJNA 1D6SA 2BJWA 1F48A 2ZRBA 5BV7A 4Q7JB 5DV9A 1XEXB 2P5UA 4FEEA 2OLKA 2R8OA 3KHRA 4BJ5A 3OHAA 4YRIA 3I6MA 2PO5A 3AINA 2MSLA 4MNTA 4P86A 3F8NA 3AETB 1KE1A 4OJMX 1UK7A 2SECE 1CUZA 3WGHA 2ZB3A 3OCUA 6NULA 3I32A 1F2TA 2J5KA 3B2EA 3GP3A 3IEKA 4RSRA 2Q21A 3CNNA 4G5XA 3FDZB 2G0AA 2EQ5A 1Z88A 5JSYA 1EP9A 5FTJA 4D4JA 3KU1A 4Q43A 3H16A 4TWIA 4CCWA 2D62A 2HYDA 3FUWA 4AMUA 5A3RA 4CEJB 4ZVKA 4HYKA 4LC1A 2AG1A 1D5CA 4NV1A 1T36B 4II7A 3GX1A 4O2BB 2AUMA 2ZBDA 2IX3A 2ECFA 1IXSB 1YCDA 1DAAA 1W4ZA 4JBWA 4TMKA 4FYIA 1JNXX 3UJNA 3KXIA 3A4VA 5ETJA 4P0QB 4L5IA 1M1YA 2OR3A 4XWAA 3AF0A 5H68A 1THGA 2ZETA 4Q0MA 3IILA 2F3PA 1VIMA 1R16A 2BFEB 3UICA 2VXBA 3PLAE 3DA8A 4MJLA 1G8GA 4Z8XA 3CSUA 1CF9A 5CVUA 3PENA 3WTBA 1NJ6A 4LRYA 2RK3A 4PFJA 2ZJ0A 3IVRA 2RDMA 2O2JA 5AVKA 5E7IA 1R9TA 3BDAA 3KK0A 3W9UA 1ESCA 5B37A 5EJ2A 3ZLJA 2XQFA 4HDAA 4D5GA 2A57A 5BV8A 3AM3A 5B2EA 2C9OA 4JI6H 4RKYA 4LE0A 1A7KA 4IXWA 1YD7A 2GT1A 3DB1A 4JNKA 2ZIWB 4N54A 2F8SA 3VAYA 1AE1A 3CPJB 3WQHA 2JBHA 2YHIB 1DFGA 2YOGA 4RU1A 3V55A 4XEUA 4N4AA 2QR5A 2C99A 4IPTA 1D5WA 4CLEA 1KEKA 1RI2A 3HI6A 1GKUB 2J6SA 3FOZA 1AV6A 3GFBA 3GFPA 3ZDRA 2IDZA 2BP7A 2H07A 4X7RA 3O3CA 2R62A 4ZP1A 5CDFA 3GTKA 8ABPA 2X23A 3HMKA 3N2YA 3AG6A 2PR7A 3KSAC 4KAJA 1Y7LA 3OQPA 1TAQA 2ATCA 1RHJA 1X94A 4GM4A 2CNDA 1VBGA 2QRQA 1PLLA 1GZHB 4IGKA 3QWHA 4KO1S 2ZOSA 4OFBA 2DPXA 1GV1A 2WAAA 2CFRA 5KFPA 5BN1A 1BXKA 2IHTA 1WMDA 2JA7G 3UUEA 3PXXA 3QXCA 1TUBA 3L7DA 1FP1D 3PDCA 4G0PA 3HI4A 2YQ5A 4R1SA 4Z7QB 1DDGA 3KQTA 2O8DB 3OT5A 4R8MA 4O3RA 1SBNE 1PJTA 3USZA 4HAXA 3RJ0A 1S0NA 2WM3A 3ZDEA 3BJEA 5BMVA 3NT2A 3G2NA 4M1TA 5LNK1 4D7AA 4X3PA 2J5XA 4L8YA 4D79A 1FX0A 1V8PA 4IGFA 3W4KA 5HS4A 3LWNA 5K6AC 5IMBA 4RHTA 4V0ME 3UY4A 4BAUA 5EMKA 3U4QA 1H5UA 4RV4A 2FE4A 2IS1A 2P5SA 1I7QB 3AL3A 1VSUA 4GE0A 3ZQ4A 4MPDA 2W4QA 3NHBA 1MO5A 1GKYA 2QAGB 3T6KA 1Z37A 1IBKH 4S1WA 4Q9IA 5AOAA 3K05A 2DXIA 3MR5A 1J22A 5K8LA 3AJEA 4BY1G 3UYKA 4LBWA 3NBYC 5GTDA 3ROZA 3BIWA 2C4VA 3GGDA 1V0JA 5ALYA 1T5TA 5C52B 1YS9A 2O7SA 5AK3A 3FKSA 1TPYA 1BTOA 4MLCA 1BHSA 1XHLA 4IF6A 4DYVA 4Q18A 2WHYA 1B2RA 2XX3A 3ZIDA 3KSMA 5KG2A 2X0DA 4P0PB 5J40A 3ZTYA 1KZYC 1KH3A 4EG1A 1GCGA 5DW0A 2C5FA 4XYMA 3TQ1A 1MZBA 5K4AA 3C6BA 5DO9A 2OQIA 3TX6A 2MCFA 5FHQA 3LA6A 3NQ41 1BOOA 2H51A 5T3UA 1GTSA 4JV0A 2GJ9A 4C7OA 1KNQA 4UUNA 1RWVA 1PZXA 4QDOA 4ZAZA 3CHYA 5BOVA 2H31A 2O0KA 2BFBB 1VE7A 1QIHA 4MSUA 3QHPA 3I2KA 5EQTA 3SMVA 3A1FA 3T9EA 3FZYA 4GC9A 1K8RA 2FF5A 1KT8A 3JVVA 2HAEA 1UOPA 1P2VA 4WY5A 5C9ZA 1JJAA 1L1QA 3Q2IA 1ZM4A 5EMMA 1Z38A 4E5YA 5CEEA 2C3OA 5A5VA 2PANA 4CL8A 1E18A 4IR1A 3C15C 1W9MA 4ZHSA 1E63A 5BYBA 3EIWA 3OD5A 1SZJG 1P0IA 3M5PA 4EHDA 1PSWA 2QVYX 5DBOA 3ZS8A 5A9SB 1ZH6A 4C20A 2HA6A 4J7AA 2OO3A 4P3NA 4KQFA 3I6QA 1DWUA 4ZAFA 1C3VA 4ZT5A 5JDIA 4QUAA 1OLUB 1G20B 3PEEA 2P4EA 3C41J 3WWPA 3LX5A 4M9SA 3GTLA 4YDQA 1XRQA 4UVGA 5DHSA 4H0FA 3RJTA 2QRLA 1E7QA 3B6ZA 1RPAA 5BNIA 1I3QA 2VT2A 4GBGA 5ARCA 3UJPA 4E13A 1SBCA 4TMYA 4FBTA 2H1HA 1NYQA 1LPBB 3D6HA 3NHUA 1DQZA 1DB3A 4J76A 5A1TA 2YIVX 3QVKA 1W52X 1FY2A 4Q93A 3MBIA 2ZIEA 2UUAH 3H0GA 3FWYA 1GTL1 4UHHA 2V7VA 3B1JA 2JIRA 4CV2A 4RFSB 3FF4A 1BGXT 1EUCA 3KLPX 2ID7A 5ALVA 3H3JA 1RWKA 2VOBA 4WLUA 1NUQA 2QRVB 1FS4A 1XPRA 3NBMA 1TVEA 1KXZA 3SOPA 1XMQB 4MHTA 4ID3A 2JG3A 3WZMA 1FLAA 1Z5ZA 5FORA 3W34A 1AZLA 1P19A 2MSKA 2JGEA 1TJ3A 3KYCB 2P67A 3T99A 3OPQA 4HSGA 1B8UA 1IVSA 1SUPA 1XWFA 3KOZA 4C6SA 4E03A 3WLPA 4P31A 3QKUA 4G5OA 1PQUA 4AB1A 4A26A 2G77B 3A31A 3NHKA 3LCCA 3QWAA 1WPQA 4C1BA 3VYWA 7GPBA 2R5NA 2R751 4G2TA 2GSWA 2Z4SA 5KBYA 3PFHA 2Q2TA 3C7AA 3W2TA 2C96A 2HBYA 2BCGY 3UAYA 2B99A 2LXNA 1IN4A 3BK7A 3ED5A 4WOJA 3BWYA 2GI4A 1Q7RA 1IY0A 2ISCA 2HC9A 2QORA 1TGVA 4RC9A 3PD1A 5EEHA 5IARA 3IVAA 3HO8A 3L43A 2HV8A 2XTJA 3HWX1 4NBVA 3MGBA 5KQLA 5JAZA 3RRXA 3K1AB 5KYXB 2AQ8A 4JUAA 3RR2A 2B3TA 5KKCA 5CLIA 2HA4A 4YY3B 3LIIA 1C2YA 2GGSA 2H1LA 1QGAA 4DCSA 2M6SA 3SBOA 4EHIA 1SB9A 3EGVA 2MSNA 2FI1A 2X8AA 3P4YA 4R3NA 2BDEA 3SBDA 5IEBA 3T3NA 1J33A 5KNBD 2P6OA 3C3BA 2VAPA 2ZJ1A 4I19A 3FAZA 3ADCA 2BJHA 3DUFA 1DX9A 1DUSA 3PVCA 1E2BA 4WGFA 3CH6A 2HIAA 1IMOA 1KI2A 1HX7A 1PFVA 1WA5A 3PPXA 4RK0A 3DQZA 3E53A 1M10A 1IK4A 5F73A 4PO9A 2I80A 3WGMA 2Q6OA 1KJNA 3BJMA 3V4OA 3DBHA 1QYCA 1A3GA 2QG9A 1NNUA 1RAIA 4LNUA 3CS3A 4ZEMA 2OQVA 1FQWA 3W6NA 3O95A 3CUEF 4KO2S 3CN9A 3GT3A 3IIJA 3IERA 4M22A 1WXIA 4WBSA 2Z4TA 3DAAA 1CY6A 3EASA 4S12A 3RROA 2WF8A 4W6QA 2Z3VA 3PS9A 2TYSB 1PUIA 3VFDA 2NO6A 2J1LA 1N9ZA 1X8JA 1J25A 5BQ3A 1KMCA 1VKNA 4MKGA 2QGZA 3M9MB 3CB4A 1A9ZA 4QECA 5HCIA 2GN6A 3SAJA 2PX8A 4EGQA 1LSOA 2ZROA 5TJ9A 2YINC 1R4MA 2HADA 3MYYA 3NRCA 4OGWA 1K5GA 4GI5A 4ZVLA 2IA6A 3TXAA 3CF4A 4M87A 1EK6A 2OCDA 1SRRA 3S27A 3PVXA 4FMCF 5REQA 1SD5A 1L5SA 2QEQA 4O1HA 3QW2A 3VDRA 1V35A 5DMHA 4D4MA 5DQHA 3ON5A 5GGXA 2BKEA 5JD3A 3Q8KA 2UUPA 1E99A 1HC7A 5DWVA 1XZJA 3BB1A 3U3JA 4ABTA 1JQEA 2GA8A 1L5LA 1U1IA 4CKWA 4LOIA 5CLFA 1P1HA 2X1VA 10MHA 4F3RA 2CE2X 2NO4A 3MLAA 2GRJA 1ENZA 3TO5A 2ZIZA 2GNOA 4QWDA 2ODQA 4FILA 1PWXA 3D3KA 4RD4A 4Z2AA 4F2GA 3LHKA 4B3DA 1Q50A 1VJRA 4TLBA 4W1SA 3SHWA 4CU5A 1R8JA 5C8YF 3PEWA 4YHHB 2CNQA 4FWIB 3H4TA 3FRJA 5DHTA 4CVNA 1IN6A 2YCBA 2VBCA 4YK7A 1NKVA 1XYGA 1ZNXA 3QU4A 4FNMA 1KY5A 5LXTB 2AF3C 1IWPB 2CLCX 2JFOA 1GSAA 2C1XA 1ZH4A 4PO3X 1ZJYA 1WJGA 3IQIX 3LRTA 4PC3A 1PJ2A 3DHVA 3MS4A 3EPIA 3IPRA 4GD3Q 1ISSA 5BWRA 5ADVA 4EEXA 2C7PA 3CINA 4TVIA 4FS1A 4FR5A 2YYZA 3OZSA 5E6UB 2RHMA 1EMDA 2HF7A 3GCXA 1X80A 4ZC8A 5EUMA 4QNNA 3BQ9A 2WIBA 4LGYA 3KCNA 1ZW1A 5I7UA 3OQ1A 2XCOA 3CVUA 4UCFA 2PQ0A 1B0AA 5F98A 4YGXB 1H2AS 4IF4A 3TLJA 2H4JA 3R3JA 3OFND 3Q8XB 4YUAA 5CLLA 1NW7A 2CMFA 3K6KA 3G2LA 4NBTA 4QHYA 3GT4A 1PD0A 3LT1A 3T5GA 4G24A 5BSVA 2N1MA 3WBBA 3TTYA 1DT3A 1BRMA 3AONB 1ECGA 2G36A 4MA0A 4N5HX 2VDWA 4E7OA 1XDUA 4DA7A 2W6JA 5LL6b 3UC5A 3SF0A 3EIOA 3PO2G 5B36A 1NW8A 2PEZA 4KCGA 3IEPA 2H1FA 2RHHA 2BYTA 1GRVA 2ZZMA 1TC2A 5AIBA 5IEJA 2AFHE 1TEZA 4QUJA 1Q17A 2A1IA 3OE7D 3GTOA 1XDSA 2VJCA 3F67A 3ESCA 3A9VA 4LISA 1RJQA 1D1TA 1RWNA 1NF9A 2V03A 4U7WA 3AHFA 1CVRA 5IVIA 3MWFA 4LZZA 1KI7A 3GP5A 1SRQA 3EVAA 5LKAA 1V1RA 3ELDA 2CNVA 4NPAA 1F1BA 3IHKA 5ADWA 4YBZA 2BP7B 4MMYB 4A8HA 2YBEA 2QRUA 3O8QA 4CYMA 1XRPA 2Y0BA 1UT8A 2Y1WA 1U1DA 1EUQA 3K0FA 3O4VA 2WHXA 1VYHA 3EQZA 1Q0TA 1U5AA 5MDHA 4FS2A 5GIPE 3R3VA 1S0OA 1FXUA 3T41A 1GAJA 3O4FA 3KDPA 4Y2SA 5F3RA 1YJBA 4H15A 1Y9AA 1CF2O 3ZE0B 3GTMA 3ZOZA 5CFRA 1U28A 5HKOA 4HNGA 3UAGA 3T5HA 2HU7A 1TM7E 5HUQA 3QKIA 4LZNA 4QXQA 3I04M 1B6RA 3GRUA 3PZRA 1RXUA 1CDOA 2DTXA 2O2IA 4L6CA 1ESMA 1TUBB 4JD5A 1R0KA 1PL8A 2VUIB 5BSFA 4N82A 4N3AA 4BPBA 4GVXA 3OTWA 2RH9B 1YH3A 3F3KA 1CC1S 2D7JA 1U2ZA 3KWMA 1ZAUA 2BPOA 5EJMA 2O3JA 1GT6A 2Q99A 3S5JA 3ILSA 2XUOA 2EWVA 5BMVB 1EQ2A 5KFDA 3DTGA 2EJ2A 1JDJA 1YFKA 1GGJA 1DBRA 3REQA 4G65A 1CPYA 3WWIA 5AW7A 5I8WA 1E9EA 2C92A 3B1ZA 1NLZA 2PRZA 2XGOA 4FOSA 5T4FA 4TWZA 3L77A 3ESAA 3SHVA 4L2IA 3H9UA 1ZI9A 3S8MA 4JI2H 3SLGA 2UUBB 3U4QB 3TRFA 1IM5A 2XBUA 1SBYA 4L4RA 3EPGA 2IPLA 4PSKA 4DE5A 1ZO8A 2Z4RA 5L6MB 1KEZA 3ZQ6A 4OX9Y 2WSYB 2D5BA 2COUA 3GWGA 4KK4A 2YICA 1K83A 4AIRA 3VPCA 4DG5A 1QHSA 2VF2A 2RG7A 2BGNA 4HVCA 3TTTA 4A8PA 3RT7A 1Z0DA 1Z4PX 3ZU4A 3ZDZB 3U4IA 2O0HA 4O7RA 1FQKA 3MWJA 4AG5A 3QLUC 3KJHA 2VI5A 4MARA 2VPXA 3WQRA 2WW8A 4MYHA 2ERYA 6ABPA 3T06B 5FL7A 1H9CA 1YMUA 4FP9A 2OBYA 1ISMA 2N9UA 2OL4A 4CGYA 5ALLA 4X94A 1NONA 1T8PA 1XB2A 2QAJA 2O0JA 3GXOA 4G1CA 4RS4A 4WZBB 3ZI7A 1UOQA 1J0BA 2WK1A 3THRA 3V1UA 1X74A 5AKZA 4C7OB 2JLCA 1EJ0A 5F52A 3ES9A 4M89A 3N7TA 4RYLA 5BT8A 4C30A 4CU2A 3B13B 3AEQB 4D6PA 1RQPA 3KQLA 1WMBA 4II2A 5KTMA 1ZONA 4KIGA 2W43A 4IFEA 4ZAXA 3WL4A 2H11A 1ZHQA 1D6NA 2LWIA 3F3YA 3DKKA 5B58T 5B64A 3A2LA 3W4IA 2WSSA 3M4XA 3ND8A 3CEMA 5KCZA 4MTCA 2A9QA 4LF7B 1QO0A 4Q5IA 1IIRA 4JH0A 1TB4A 3MGGA 5KNDH 1UDRA 2QGFA 1RXYA 2NO1A 2E4VA 1ABBA 2JJ8A 4R8SA 4L8FA 2ZPTX 3AB7A 4X6LA 2L17A 3COZA 5DK4A 2PMCA 2AMYA 3OICA 2PPVA 5KFRA 5J23A 1ZVVA 3EMDA 3OMLA 4MVJG 4HGZA 3CZPA 1IM2A 3CE6A 3ICOA 1BE1A 3J81A 3WA7A 2AR7A 3PPYA 3E23A 5CBPA 4EF6A 1RPTA 1S3SA 2R7NA 2ZIUB 4O2BF 5FEMA 1TMGE 1ZQ7A 4DV0H 1XMSA 5KTOA 3CM0A 1SUIA 2TMGA 4B7UA 1H4TA 4HWSA 2FMIA 1IU9A 1XT6A 3S2UA 4O2RA 2CL6X 5MN4A 2ZW9A 3N28A 1E1RD 2G28A 3E9QA 1ODKA 4MTDA 3QTBA 4DSAA 4FYMA 3GLFA 5BPFA 3M89A 4BNIA 1QHXA 2OO7A 5CLJA 1G8JA 3G0DA 4HADA 3EN0A 1EUCB 5ALDA 1ADGA 3SMQA 4FFNA 2QYZA 4QVKA 1XRMA 2V58A 4PGMA 4GH5A 3K71B 2G5CA 2W6ZA 2C5GA 1R0ZA 4NQZA 5C7IO 3I9FA 2GD1O 1K89A 5A62A 4PR3A 4NMXB 3A4TA 4JI7B 3UJ8A 1F17A 4YAUA 3HN6A 1OU0A 1XKQA 5B4TA 1ZQ9A 3P9NA 4RJ2A 2DH6A 4Q15A 4WT7A 2IHVA 3SX0A 4UVHA 5E3JA 5IYZA 4IOJA 2EZ8A 1Y8ZA 1H4VB 3D2LA 3MAJA 4CCSA 1KVSA 3G0BA 3OF2A 5HVNA 4P93A 4DC0A 5HBRA 2BGWA 1II9A 4UDOA 3R75A 4FW9A 4I1UA 1H6AA 3S29A 5CITA 4LJ9A 4ZOEA 2XRZA 1KQGA 5TS2A 4TV8A 4IEFB 3D3JA 4TXNA 2E2WA 3GGSA 4WERA 3GJYA 5FPTA 3WMXA 3R5HA 3KQHA 4N5LA 1AZSC 3IXMA 2YZNA 4ND7A 1M8PA 4UVEA 4AYXA 1EFRD 1G5TA 3VC3A 4XCVA 5JWOA 3KOUA 4UPDA 4IQ0A 3KQOA 3A9TA 1L7OA 5ULLA 4Q24A 1E1NA 2WA1A 4X90A 1MOSA 3K35A 3SI7A 3H1EA 3TLKA 2ZWIA 2VG8A 3UKDA 4PXSA 3JZAA 4QSMA 1A96A 4R51A 1F12A 4LXQA 5K99A 2BFFB 4Y30A 1RYNA 4KPUB 3GEBA 4BMXA 2BFDB 1Z34A 4J94A 5JECA 4B7CA 5KOJA 4RB2C 5BN3B 3URKA 3DUFB 1HMYA 1D2MA 4EPYA 1G4UR 1BDMA 4ENQA 1M0WA 4FK8A 4LXUA 1U31A 1J1UA 1NVMB 9LDTA 3RTBA 2BHTA 4C2TA 3DSRA 2JGMA 1O94C 4R2LA 4WA7A 4E15A 1FTNA 2E2HA 1O9GA 1GP2A 1OF1A 4LNUB 4L8GA 1WW2A 1PJQA 1E66A 3A9WA 2ORWA 3E9EA 4LOJA 2FN8A 2WUEA 2R8JA 4NKRA 3RIMA 2AZ4A 2I2CA 3UK2A 1NXWA 4OGKA 4Q9LA 5LQUA 2FMFA 1N2CB 2W6IA 3C97A 1WXFA 2Y93A 4DMRA 4YQWA 3SHOA 2QNRA 1HM5A 4R6WA 1VMKA 3GEPA 4P1ZA 4Q1VA 4O2AF 3B9RA 1T9BA 2PGDA 3JZIA 2R96A 3LQKA 4Q7MB 2EC5A 1JH8A 3LBAA 1J5EB 4WPGA 1UAAA 2I4LA 2O07A 4YQYA 3FSRA 1KAQA 4ZV4A 3BTUA 2MSCB 1G8SA 1FTGA 1PEYA 4WNAA 3PFIA 1EA7A 1I7LA 3GEGA 3VR1A 1NNEA 2DFTA 1IPFA 4TVKA 4EOGA 4LS3A 2Y77A 4JBHA 3OO1A 3LMKA 3QA3E 1MNQA 3P20A 1MJ5A 5FTWA 4LF9H 2H2WA 3M49A 1L7QA 2V3WA 5LP6C 4AWXA 2YMQA 1T9KA 3HP4A 3A1DA 3L6RA 4KBYA 4OXRA 4JBXA 3ZDDA 2JEJA 1BDJA 1YUMA 1VL2A 1QDEA 1JDPA 3ZNOA 5AKJA 4K3VA 1C8LA 2X9GA 2VYND 1DC3A 3BQ1A 4BXOB 4ZTZB 2V0GA 5KI6A 4YHBA 2WM2A 2ZR7A 1MHTA 2OCLA 3ZDYB 4MPTA 4Q39A 1CLUA 4U9UA 2A94A 6AT1A 1T6NA 4KO8A 1G1AA 4PWQA 4B5KA 3H9CA 3NDPA 5A3SA 2CW5A 2Z1MA 4PLHA 3OUUA 1LSSA 1NHWA 2IOFK 2QT1A 3I04A 4RTMA 3O8BA 4MO2A 3VKFA 4O7TA 1FA9A 3DBRB 4I2VA 3B89A 3FPBA 3ODGA 4JL8A 5D7NA 4QDJA 3EFBA 3UT5B 2Y0CA 5JPDA 3SQMA 1E2GA 1KBQA 3W0LB 1DJMA 3W5UA 2E5WA 4HAVA 4ECQA 4HTFA 5DLDA 4IDNA 3VR3D 4TWRA 5EOVA 4OHMA 4XX0B 2WB2A 2CNLA 1MORA 3WFZA 4F5DA 4IFIA 4EKYA 1W34A 2QMHA 5C8YB 3ZZNA 5JALA 1FDUA 3MMNA 1SVUA 2GKOA 3CNBA 2A0KA 3EMVA 4C3ZA 4IIYA 3I83A 3SM9A 2IYZA 3RK0A 3B5IA 3UA3A 1VQ1A 1H69A 4Y0VA 1HA3A 2FZCA 3GUUA 2MT9A 4QO8A 1H6CA 3E3AA 5I3CA 4KDCA 1U7HA 4DJTA 4KE6A 4JLVA 2D8AA 3GRPA 5CNMA 2GLTA 1R15A 5TF4A 4ER6A 2DTDA 4K1XA 1NZFA 4HWGA 2OB1A 3TJZA 1XCBA 2VDWB 3JYNA 3F96A 4F7WA 3WKCA 4R05A 1BDHA 1C1DA 2VVTA 3E7DA 4PQGA 4C22A 3RRBA 4F50A 3BERA 1UBCA 3T5CA 4WCFA 2C4MA 4HQLA 3M5WA 2GPAA 4RY2A 4UCVA 5ISMA 4FLEA 2P5YA 2XVZA 1Y1VA 3KYJB 2C5EA 1XROA 5JEEA 3NONA 3AF4A 4TN5A 3GZNB 4H08A 1KYTA 1Y7TA 5DM60 4LF4H 3Q2OA 2SHKA 3EPRA 1V1RB 5B7QA 4I4IA 2HEGA 5CAEA 3BXXA 5KTRA 1Q12A 3C74A 4QGHA 2XMRA 4M6WB 4S0XA 2PX5A 3OPVA 5FTKA 1VJTA 1Y33E 2FPPA 1BD4A 1B4DA 1TM1E 3LP6A 3PUJA 5MF6A 2XIJA 3BFKA 1T94A 2IU4A 1JEOA 4OYHA 2I76A 4CT4B 3I72A 3KJNA 1EX6A 1KK2A 1BCRB 2R8PA 2QNIA 2NXEA 2EW1A 4LUCA 2XMPA 1UBJS 4PO8A 2PTGA 3G7UA 1U7XA 2FG5A 3IDSA 1IRIA 3CNQS 5CLHA 3WNQA 5T7BA 4KV9A 1NKSA 4UNNA 4ZI7A 1UBRS 1W4RA 2C9BA 4BTEA 4NYIR 1S2DA 1RC1A 5D1OA 2NVOA 1ECCA 4EKEA 3ZEIA 2RBKA 1O8CA 2MMCA 4H4DA 3EVZA 1HQKA 3BXFA 4ARIA 4K2AA 1CVIA 3DPIA 3HXMA 3PXGA 1HF3A 1CUAA 4F6LA 4X95A 4P5EA 1XZHA 1DTSA 4URYR 3REQB 1YZHA 5AD1A 2WKWA 1W25A 3Q5DA 4GLJA 3GCWA 3RYTC 3HABA 3B5EA 1JJVA 2Q46A 2WSSD 4OK6A 1FXWA 1N7JA 3FDSA 1ONOA 3T9DA 3T3GA 4MV4A 5EJ7A 1GGKA 3KQKA 1EB8A 1WV0A 3TG8A 5BO5A 5KOYA 2J4FA 4YCDA 3JVUA 4JV5B 3C43A 3ZCVA 5FTNA 3VR4A 2FQYA 4YV7A 4CUZA 1TLLA 4GUDA 3AUJB 1I1QB 3PF9A 3IGFA 1CKMA 2II6A 1GNSA 3QE4A 3L4JA 1KP3A 4RH1A 1N5JA 2XY4A 1M72A 4KN9S 3JARB 3D6TB 3H1TA 1V1MB 4F8JA 3REGA 4Y1RB 1G21E 5G0SA 2E2IA 4E5NA 3W2IA 2BFWA 3S55A 3B9PA 3LYAA 1ZCJA 1LNZA 3B85A 4GLBA 3GA0A 3LUBA 4DTCA 4CHIA 2OO5A 4KO3S 5BWBA 2V4MA 2WT9A 4PPYA 5KFIA 1JIJA 5EJAA 1YWGO 4IZHA 3CZCA 1LV7A 1XCPA 1B00A 1G66A 2CQYA 5FD5A 2NPOA 1O7JA 4MWGA 3T1OA 1D0SA 4Q16A 3OC0A 5GJCA 4P5PA 1ZCFA 4EJSC 1TDJA 5C35A 4LIPD 2PZGA 3E2MA 3EGXA 2XPCA 4FZVA 4TLEA 4OQDA 5D51S 2V7EA 4KODA 2QSJA 3QFCA 4NXNB 1I2MA 4HH4A 2OV8A 3JD2A 4ILKA 1YKFA 3LSYA 1P18A 5A5EA 1ZOSA 1H3EA 2YWRA 4CLOA 3KSBC 1PFGA 4L0QA 1KS2A 3KT8A 4B3RH 4TTIA 3H2YA 1M9NA 2Q1YA 3VTZA 1YO6A 4AC9A 4P32A 2ENWA 5CM0A 4XVCA 1Q0QA 1Z29A 4E2FA 1KDPA 2V4QA 1BHQ1 4PSCA 3LYHA 1AHPA 3TQTA 3F7MA 2BMJA 3A6FA 4ZZIA 1T8RA 2H7VA 3GV7B 3PC8C 2QENA 1SG6A 1PGNA 1PCXA 2W2PA 5AKKA 5ALFA 3KUKA 1BKYA 1D2CA 4TQGA 2FP3A 1U4NA 1CUXA 4BFUA 4U3JB 4CBVA 3JQFC 4NFSA 1VKOA 2PVPA 1RMYA 3AB3A 3D8SA 2RONA 1C3LA 2IXBA 1N33B 2JGDB 3UH1A 5DX1A 3JQGB 4HBZA 1VL1A 1R0CA 2C97A 1K4MA 1ST2A 4E1AA 2OAQ1 4PVDA 1FP4B 3QUSA 2PZMA 5TPWA 3WJAA 5CIYA 1CB0A 1D4ZA 1FDVA 3FPJA 3UH0A 1AA9A 2REQA 3H99A 4C0SA 3GMIA 1TRHA 1TWFA 5KT4A 4HL6A 3AR9A 3ISTA 1O57A 3FJYA 1ZHOA 4KXVA 4KRFA 5FV7A 5EQDA 3JQ9A 3FUVA 4HNRA 3LJKA 1XN1A 1P1FA 5JS1A 2GYWA 5C8DA 4OXQA 4D26A 3PGMA 1D07A 3ETNA 2I6FA 3TLCA 2G9NA 4IDFA 2A9JA 1QS0A 2AXEA 1TJ5A 2FSHA 2IL1A 4ZYYA 3S3TA 4AQYH 1SVWA 1NVVQ 3PRKE 2EOAA 3D7LA 1T2CA 1H65A 4DADA 2OORA 4QT4A 5IYZB 1ONBA 1GV0A 1IYZA 1ENYA 3QW4B 1AF4A 3IT2A 1KR2A 2Q28A 4XUCA 3ASYA 1UDBA 3IUYA 3OJOA 4L8LA 1SCUB 5HIJA 4RCNA 3MAAC 3TTWA 2WU3A 2WKPA 5ECYA 5FOWA 5HBRB 2GN9A 2FEWB 5IPFA 5G41A 4NXMH 1BOFA 3A58B 1VIDA 4TV8B 5D3ZA 2NUAA 5EWMB 3UGQA 4CR6A 2ONJA 5E3HA 3PW5A 3GJ0A 5KHAA 5K5EA 2BEWB 4AZSA 5E6RA 4PS0A 1LK7A 3DUWA 1KI1A 4UBKA 4E31A 2ZRMA 2IYUA 3FW1A 2OFPA 3IOYA 3MBOA 3RVQA 4IW3B 1QTIA 1GTVA 1N4DA 1T35A 2JFZA 4HEQA 1PYOA 2G9RA 1YZLA 3UYLA 4BLRA 4DL7A 4QHTA 1TLFA 1NXXA 3HR4A 5HP4A 2WB1A 3JAMW 3BFPA 3U4CA 4CDNA 1KH1A 3FUCA 2CXTA 5BMVF 2WFLA 1IHDA 3TZKA 4W8GA 3OQNA 4JJZA 1X70A 4WXYB 4UD6A 2HTFA 3RS7A 4RK4A 2NNLD 1GD1O 1LVUA 2R92A 2CVPA 2GUWA 2ESRA 2CL7X 1I2BA 1RXIA 4M0LA 1U3VA 4OLAA 1HDRA 1HE8B 3FUXA 3CW2A 1ZGHA 3WTCA 4PNEA 1AS3A 4URXR 4LF8H 3W1BA 2QPLA 4LQ4A 2WU8A 3CH4B 2FFHA 4ROTA 3BJRA 4JIMA 4AJNA 5IVPA 3KE8A 4GMKA 3A2MA 4QU0A 1Y82A 5JY6A 4YI3A 3W6ZA 3F3MA 3DDOA 3SSOA 2W8KA 1QF9A 1FRNA 1HEIA 1H8EA 4H7EA 2UYQA 3SICE 3FZGA 1RXVA 1K2VN 5IKXA 2EKDA 2F62A 4R1PA 2PSEA 5MGNA 4IYRA 2FZEA 2B21A 1CZHA 4AZTA 4BZQA 1S2IA 1ZIPA 2NAPA 1JVNA 3QXGA 1HEYA 1CZUA 1AK9A 4H6PA 4WNAB 2X0IA 2EKPA 1NLFA 1WAMA 2ZSJA 2MIIA 2VSOA 4PGGA 4KUEA 1UBSB 1P8LA 3KHGA 3MR2A 4PN3A 4JASB 4D8VA 4WH0A 1ZSNA 4ENPA 4X63A 1GFZA 4YT8A 5JSFA 5H4GA 5HKBA 4LKRA 2XZLA 4QGAA 3SIXA 3ENVA 5I5VA 2JJ1D 2R00C 3DXYA 1TVKA 4JA0A 1MOZA 5EWJB 2ASEA 1CV2A 3EVEA 3WR5A 3TRKA 2HHHB 4O2AB 3DMRA 1OBVA 3O74A 5KT3A 1VPVA 4CG0A 3GBVA 3ZE6A 1E0JA 1FLDA 2PGJA 2DFKB 2CZGA 2Q9CA 2QLLA 5LLDA 3FGPA 3HJAA 3U39A 1VA4A 2FUEA 3QMVA 4X20A 4QEZA 4R01A 2XCAA 3DOCA 4G4IA 1IULA 3VU8A 5IANA 4ZAWA 2J5RA 1R8SA 4MWCA 4C7XA 1FNBA 3F8SA 4URZR 5J4KA 1J8QA 4JC5A 4TXMA 4KAXA 3VKUA 4JSYA 4CIBA 4L9WA 1PT5A 1ZPDA 3PC6A 4TYNA 2RGUA 3MTDA 4I7HA 1K6MA 2BSAA 2Z3WA 2WRZA 1UUFA 1GRRA 3BMXA 2ZIVB 1EM8B 2A1TR 4K05A 5KYYB 1P7PA 5EXPA 3FNRA 4EMSA 3C4VA 3PQEA 4RQTA 2DWOA 2YZKA 4YCAA 1YZFA 4KC0A 2O20A 3NHPA 1F8UA 4DV3B 1FTWA 2DY1A 2IJGX 1PE0A 4A3MG 4FUQA 4QT0A 5F7JA 4B9EA 5BP7A 4QW9A 4Z3DA 1D9XA 1QF6A 1Y6QA 5JQGA 3W1GA 3DMPA 4C6TB 5AH0A 2ZUFA 4NRDA 2PUWA 2QWXA 3JCZA 4E4YA 1TVCA 2IC5A 2PGOA 4PYKA 4IRUB 3R3UA 4PW0A 4F2DA 5IHPA 3DO8A 3H9BA 1RHKA 4KO4S 1PI3A 3VKGA 3L6OO 1BX0A 4DQLA 2Q2VA 4IS3A 4HPWA 1MX9A 3OX4A 3LUCA 1MDFA 1C1DB 3WGLA 2XCRB 4G1MB 4JLKA 4K5QA 2QS9A 2VL7A 2DY0A 1SZPA 5CM8B 3HFRA 1VE6A 3WWOA 4YUWA 1KYVA 3ASZA 3P9IA 4NBKA 4WCFB 1MABA 1WPRA 4LPKA 1IY2A 1FYXA 1EUDB 3BGSA 2ISQA 4JENA 4F9EA 4CXMA 4MDHA 3WRYA 3TD9A 5HJ7A 3L7OA 3Q88A 1H2WA 4RWZA 2GILA 2XE7A 1XTKA 4PNPA 1VMEA 4ND5A 2JKZA 4S1VA 4P22A 4DXDA 2VTBA 3VI4B 5DLQC 5A5FA 3GPDG 2ZTHA 4BEJA 3D7NA 4FTWA 1E77A 1QIDA 3NNSA 3TEMA 1YKSA 3ZDAA 3EIEA 2XCSB 3QHAA 2X6TA 3H1BA 2D2VA 3TLXA 1GAWA 2FSUA 4R9NA 5DTRA 1LI4A 5LR6A 1U0HC 2PVSA 3LPDA 4LTNA 5AK4A 4JHXA 1E9FA 4AMBA 4CM7A 4G0WA 2BFNA 1ZK0A 4P7JA 4FNGA 3GFTA 1PJSA 2FHPA 4Z0HO 4EHHA 1GQRA 2R97A 5IP9G 4AM8A 1DOZA 3O4HA 1YZNA 4P4LA 4ALIA 4KMOA 4EECA 4O7NA 2A88A 1NVEA 1KEEA 2BLNA 2DE0X 4TT3A 4C2MA 3O03A 4RNCA 2QF7A 2J9RA 1RDFA 5D01A 1Z17A 1WETA 5C81A 2CNWA 1RIFA 1II0A 1SK9A 1J2TA 1MAAA 4XWWA 2XKKA 1OAOA 1FP6A 3PKJA 2J3MA 5M5BA 2Y0PA 1RKVA 4REQB 1GL3A 2NZ2A 3QK7A 5JNVA 3SQLA 3NHYA 3E3MA 3BXPA 4RJLA 3GPLA 4FDVA 1ZIOA 3EGIA 4EDHA 5A02A 3CJTA 2JDID 2YYSA 2H5IA 2R8EA 3WRXC 1UBOS 1VLLA 1DRWA 2ACKA 4INOA 4B4OA 4NZPA 4DDWA 1U6KA 3IQXA 1E7WA 2XA1A 3WJ7A 3GT7A 4HX9A 5BNTA 4YACA 4ZTBA 2YMPA 5DOZA 4HDKB 5CB8A 1JHPA 3QU7A 3K70D 2O1EA 3G9TA 2HL6A 4YR9A 3AZOA 5AM0A 1ZBDA 4QEDA 1JAHA 2VP4A 4A2PA 1WMEA 1R6DA 2IBMA 2ZWMA 3ZZ0A 1EVJA 1ADJA 4BRWA 2NZUG 2F1HA 5CFOA 1EUYA 2O0MA 3M5CA 3UG7A 1XSEA 1RK5A 3UENA 1WD5A 3QIAA 1D03A 4F91B 3BAFA 1E4VA 2I34A 5CGQB 2B69A 3QZUA 4QARA 4Y6PA 4ALKA 2JVIA 2A5JA 4HDOB 4AX4A 1YI8A 5DBIA 4NOJA 1M2WA 5CFZA 1TYBE 2O2YA 4ECYA 2YFKA 3CNEA 1J20A 3H8SA 5DX8A 4KLAA 3WK7A 1ZMRA 4BWGA 3FHOA 3W4JA 4GMXA 2F9FA 2XOKA 1H2HA 4GR5A 3OCYA 1PK8A 1YR7A 2CZQA 1Z9BA 4WNYA 1QV7A 4AMYA 1TD1A 3OMWA 3ESYA 4DB2A 4W5QA 3ET4A 1FNNA 5KQPA 2J9FA 4CLOB 1CB7A 5KNLA 2EYQA 4F4WA 4B3SH 2FTKE 5AUOB 2JLQA 1RCTE 5HA5A 4UXIA 1GUBA 3BF7A 4A8JA 4J90A 2WTUA 1RJPA 4UPEA 4DR7B 4BOYA 3RSSA 1H23A 3G89A 4G9GA 1JB1A 2I33A 1ZJ4A 5K1ZA 4JXJA 1E6MA 4QO7A 1TUEA 1JECA 1KO4A 3MNFA 2DPYA 4KP7A 3VKHA 4NI5A 5FA8A 4J29A 4OHKA 2ATXA 5EE3A 3K70B 2MSWA 4HAYA 2CW7A 5BSUA 3GW8A 3BM5A 5K0FA 3VO2A 3C3YA 1BWQA 5FYQA 4TKVA 5IC6A 3DOUA 1R37A 3D3QA 2ZGVA 3SYMA 3LLCA 2FSVA 5AXCA 3CPEA 4LXXA 2AI2A 4QIHA 2D5IA 1C0PA 4CPDA 5ENZA 1Q0PA 1KO5A 2CWDA 4HO1X 5ITZA 3JWHA 1I5RA 3WWDA 1XQVA 5FHRA 2O3RA 4ME6A 1L8LA 3EVNA 5AVJA 1U7TA 3VH2A 3FLMA 2OEPA 5CPFA 4Z4GA 1U9IA 2FMHA 1F2TB 1NJFA 3KUDA 3OP1A 2DUNA 1HURA 3NTXA 4A93G 4ZOBA 2X9QA 4RB0A 2AT1A 5BNZA 5EJ4A 1NPTO 4D9NA 1H6DA 3GEIA 4NFHA 4WJLA 1TWHA 1CT9A 3AKEA 1JWLA 3NUZA 1K4YA 3ICEA 5GADl 4BPRA 2IZ7A 4DNFA 3HSKA 3F78A 1KMNA 3TEJA 2C00A 4CF3A 1QS0B 4R2WA 1ZGAA 1M1YB 4I46A 3M9WA 4RV5A 1RYEA 1U8ZA 2VH2A 3PE6A 5HE8A 5AHKA 3D2AA 5IN5A 3C3PA 4WLVA 5HIIA 1FC0A 1OC2A 2VHTA 4B48A 2G70A 4DLWA 1D8TA 1C41A 2XUZA 3U4GA 4Z7NB 3FKIG 3HA2A 4FDUA 2JEFA 5FP0A 1HSZA 2OAEA 4IEEA 3N2GA 2Z2JA 1OVGA 3LO8A 3G79A 1UKEA 4UM7A 4WKBA 2Q50A 4LRSB 3N9IA 1C9MA 3NANA 3DOEA 1G3UA 4E5VA 3WWYA 4XLTA 5AESA 1DO0A 3KHTA 5IAKA 4BNJA 2OXRA 2NNWB 1XTQA 1ETHA 4LGMA 3Q87B 3AT1A 4K6GA 1C0LA 1N8SA 3TRHA 4JELA 5DNAA 2C2XA 4GPAA 2UUCH 1ZN8A 2GD0A 4AKGA 4KREA 1FE8A 2FETA 3ZXYA 3H1GA 3LHIA 4CMHA 4QBKA 1P3JA 1DRUA 2H16A 1T1EA 2OGTA 3QUQA 3V9AA 2VJOA 1XHEA 3LCMA 4TRJA 3ADOA 3OURA 2B9EA 4FFWA 4BYMA 1NBEA 4LOAA 1C3XA 1TWAA 4AF8A 3FKSD 4IHAA 4CETA 5KB3A 4PZUA 5AO9A 3GLIA 3L1IA 3LKVA 1NP6A 4W1PA 2ODAA 3ZU2A 2ZRHA 2XDAA 1G6OA 4BTVA 2C2RA 5K8UA 5TQ2A 1V11A 4FJ2A 3V1MA 1XZGA 3H2ZA 5EIEA 1PTJC 3EQ2A 1LFAA 3RJMA 4FNOA 3WS7A 2RHLA 1FW8A 1YTLA 1UPCA 1KQNA 4HNTA 1TMKA 5A6SA 1W36D 3CLSC 3Q3CA 4ZIRA 1CQWA 2Z2YA 5KTSA 4B4WA 4U7CA 2MCTA 4F06A 4RK6A 4AJKA 2DLCX 2WAMA 1TK9A 2YJ6A 1V4BA 3BZBA 4RTLA 3ROKA 4F4UA 1CWUA 1JIQA 2P9YA 1FX0B 4HLCA 4BEVA 4UBJA 1P5RA 2DB3A 3BXEA 4OKNA 3GC6A 2W6OA 2GCPA 1N7GA 1OASA 2OWEA 1DIBA 3GQCA 4JV1A 2W2MA 3O92A 3K4HA 2GO1A 2QX6A 2BMWA 3EB9A 1MCZA 4FFRA 3BHJA 3JD4A 1VI2A 3RS4A 4MGZR 3CISA 1HFWA 4ITUA 2P75A 3DZJA 4ERXA 2LGJA 1DEKA 2F43A 5I9LA 3DHNA 2R8HA 4RVHA 4E5KA 5GZ1A 5DTQA 3TGLA 3C8UA 1UPXA 4J9UE 4DY6A 1JR3A 4B84A 3F97A 1LNQA 3G85A 4F4HA 1Y6GA 1EK5A 3ZVNA 2QL5A 3DO5A 3DE6X 3WJ2A 1FVOA 1Y4UA 5EKSA 1DU4A 3NM6B 3TEKA 1WHSA 3LLMA 1JXMA 2IH2A 1NVTA 4IJ5A 3TZCA 4IO0A 2IE8A 1E5QA 2R93A 4J1NA 2BELA 1U2GC 3KNZA 3FBGA 3Q7QA 3LBNA 4G0ZA 4XYMB 3DNMA 4P08A 4G0QA 1MFZA 3BH0A 1IY8A 3KVRA 2G4CA 3BYZA 2MYUA 1W36B 3LUKA 4MDYA 4RDHA 4H7JA 4MYSA 2BR4A 3CPSA 4L1KA 4DR4B 2I1WA 5LZ8A 1LH0A 2VDLB 1LCIA 2A67A 3QKSA 1SXJC 1SPBS 3COSA 3PRYA 2D1SA 1QANA 3W05A 1WKCA 3ZU5A 2C03A 2GN2A 2J45A 4TL6A 1NJ1A 2IP4A 3UMBA 2BFCA 4NMHA 2GPTA 4O1MA 4WAUA 5D1HA 4J9PA 1M2FA 1FBTA 2LIPA 1IG0A 3ZVLA 4XH9B 1Y3FE 5KG4A 2CXQA 2CKDA 3WP1B 1S4QA 1YB2A 4F9FA 4ZCQA 3RVKA 2CNNA 3PXEA 4Y2JA 1DADA 2HIVA 1CRPA 3SFZA 2C2ZA 2R8YA 4RBNA 5KWJA 3KZNA 3ZDBA 1QX3A 4LWPA 1QK4A 2YVLA 4HB4A 1ZVKA 1Y9DA 2PBRA 4H7KA 3ASVA 2ENUA 3KT0A 3SX4A 4HXGA 2IY9A 2RHCA 2HA7A 3ZWCA 2AH5A 5KREA 1FVFA 3U31A 3E9YA 3HEAA 2V6FA 3G23A 4F96A 3GLQA 3TW6A 3BGOS 3WA6A 4Z4FA 3P0FA 4TT3D 2VR1A 2UXBB 3B38A 4IJVA 2WSMA 3IEMA 5FIUA 1M2EA 3CKKA 3GYBA 4CUKA 4B3TH 2WT8A 4NDZA 2C57A 5CU7A 4HD8A 5IYZF 1MABB 3NC4A 3AKYA 1EE2A 1O97C 4LVCA 1THMA 2YJTD 4WRRA 1EXDA 4S3MA 1MRZA 1GZUA 5F4ZA 1VBNA 1N6OA 3C7CB 3KQYA 1Y4DE 1XKLA 4TZ0A 1VA5A 2O7QA 4YO7A 3RTDA 3D8BA 2BRUC 3UJBA 3RB4A 3QBDA 5DQIA 4TV8F 2JI6A 3TVDA 3AIKA 1T91A 4J4HA 3CR8A 4RELA 5C44G 4E2ZA 1E0AA 5TARA 3EZFA 1DX4A 1JDEA 3GNQA 2JFQA 2WILA 4TLLB 4LMRA 4RQBA 5C7OO 3IP8A 2OBXA 3H17A 1LWOA 2MR5A 4I9NA 4WECA 4JDPA 2W4IA 3AK4A 4M9XA 3T7IA 2NV0A 5K0TA 2BGRA 2UXDH 3CLTC 4PHHA 2ET6A 1JHVA 4FINA 3WZLA 3CEAA 1JUDA 3G3EA 4ALNA 3SSAA 2PUBA 1S8AA 1M5UA 1QH1A 2FRDA 2FSFA 4RZUA 2VOEA 3TBFA 3V80A 2PXXA 5JRZA 1EXNA 3HFJA 3HJFA 3O2NA 4A27A 1N0VC 2FK3A 3JQDA 4ZT2A 1OGJA 3NNNA 1Q2UA 4X66B 2Q7OE 4DLXA 2NVUA 3EYAA 5TT1A 2WAQA 2BBWA 3U1VA 2MMGA 4W7HA 3MPUA 5AUQA 2XXJA 2XDQA 5KWSA 4OTZA 2HI0A 4ZOQI 3W5DA 5IBCA 3T54A 1XNRH 2GAAA 2JKVA 4R1LA 1MZVA 4NJEA 1JFRA 5AVTA 1JIUA 3ZK9A 4FR2A 4MIKA 2RGYA 2A4KA 4MGHA 1TA8A 3EPJA 3UC9A 5BSGA 4PFKA 4EPWA 2GF9A 1ZIDA 4IIXA 2E4AA 4E4RA 2JZNA 2QZ4A 2NTVA 2JVKA 3MINA 3HJNA 3I37X 3FCYA 1ARZA 3G0OA 4LSMA 1P4RA 3BA1A 4J3JA 3H5RA 3EDOA 3EBOA 3EA5A 5BYJA 3WIVA 3M4NA 2IHJA 2ZE6A 1N2IA 2XA2A 1W88A 2GXSA 2C8JA 2QTLA 3PNKA 1ZQ1A 4ZVSA 2IW1A 1GUFA 4BUCA 3T5LA 3C48A 4EG3A 3DBHB 1A7UA 2VBIA 2P3QA 5KAPA 3BVPA 3BFJA 4KXYA 5G0TA 4BYGA 4KQKA 4WGGA 2FR8C 4RTPA 3RREA 3EEOA 3FHLA 4QQKA 5E9WA 3BXOA 2VIIA 4EYQA 5CNJA 4V2IA 3OX3A 2ZYSA 2OCPA 3H83A 5ITWA 4CMCA 3KG2A 4MVJP 1TA9A 4BMPB 3Q7EA 4ECRA 5LSAA 1ZUHA 3GRRA 5D3MA 5D6NA 2C0CA 4OU4A 4LWZA 5ICCA 2GZAA 4KZPA 3ZVMA 4IVPA 4M60A 2IBTA 1QR6A 2C4WA 5EP4A 1Q7BA 4D1YA 4MRRA 3AKDA 2E4UA 5KDOA 2VJMA 2VT7A 2FHSA 1FS6A 1R4MB 3AIMA 4X92A 2BKXA 3LCRA 1ZEJA 4G0YA 1Q7GA 4M0EA 3C8DA 2J9FB 1I80A 4JLBA 4B35A 2J3LA 4MRMA 3B1YA 2C8LA 1BVYF 3ZHVA 5REQB 1CS0A 4RKFA 2RH8A 3GROA 1P3Y1 2OQ2A 3ZWPA 4R1QA 4NJMA 4TQSA 1P6QA 3AUTA 3MUOA 1GQ2A 1FUEA 5C1PA 5J5CA 3R6DA 5ILGA 5P8WA 3PA8A 3YASA 5HWSA 3OOWA 1J09A 4ZCTA 2WBLC 2IYWA 1QIIA 1G2OA 2X1HA 3W2GA 1OJ7A 4X6UA 3LYUA 3ROPA 3NGLA 2XCLA 3C70A 4CKWB 4FE4A 2WTXA 1KDZA 2VDKB 3RAFC 4B43A 2J31A 1DDOA 1ZMOA 3QYAA 1XUOA 3MQ4A 1V5IA 4JOSA 3FMVA 3AI2A 3BE5A 2EJ3A 5CYFA 4LK2A 3OBBA 4TKVB 3JWPA 2W6JD 4TWJA 5SY9A 5EKUA 1Q1ZA 5COQA 1R4AA 4UJ3A 4GL2A 5E4TA 5JUMA 1XVLA 4RX1A 2OHHA 1Y8AA 2P8JA 4J6FA 5ITZB 1HI9A 2C28A 1JYEA 1JIKA 2WV7A 4B6PA 3BL5A 1JPVA 2C42A 3VPXA 4LC0A 3RQIA 2XWSA 1LDEA 1UKBA 3OM8A 1I1NA 1TEHA 4MUEA 1L5GB 1BAPA 1E2NA 2IYEA 3IKJA 3DZFA 4QELA 3EXG2 1KTAA 3GVIA 4GLXA 2GBCA 3WBKA 1O2DA 2J3HA 5CBKA 2QE6A 5LN1A 3A3KA 3G9ZA 5EUCA 3C98A 2OQRA 1X80B 1I9GA 3JS5A 1S89A 2JRLA 2ZBRA 4TSKA 2OCXA 4KWIA 5K6RA 3ZKWA 1USWA 2J59A 3L2PA 3MLEA 1RQLA 5EYPA 1FDOA 1A97A 3ZGZA 5AKEA 4QTXA 5FNZA 1MO4A 3OT4A 4RH3A 5E6SA 2WHRA 3F49S 1SQ6A 4DZZA 4MJ7A 4MLZA 1QZUA 2OLEA 2PWZA 1UXJA 8AT1A 2CLOB 4FUTA 3M1IA 1MW8X 2C0QA 3KEOA 1MX5A 3ER6A 3R3WA 1THTA 3RWOA 3VU0A 4DABA 4QXOA 2FQWA 2WJ3A 3IRVA 1N92A 1ZC4A 1SOMA 4YMHA 4R8LA 4KPEC 5AM3A 2O8NA 2YXBA 4DR2H 1IL0A 3BREA 1OXUA 4YRRA 5D86A 4EFNA 4KVAA 1YDHA 5JCXA 6Q21A 1NJSA 1RI1A 5FWXA 2EQBA 2G6BA 1ZESA 3U7RA 1O6BA 1T4DA 1BXZA 3VJKA 1NGSA 2CT8A 5HZHA 1E0SA 4TTPA 1O6CA 5T3YA 3TQCA 2FPKA 1ICIA 1GPYA 3I4LA 1GZ4A 1ND6A 5DM2A 5EHIA 3DEYX 3D0OA 2EX0A 3QXJA 2CGEA 2IOYA 4YJKA 4JK3A 1N34H 4Y1FA 1D2EA 3UQYS 2H5EA 4C0AC 5TVGA 3FIUA 1NRXA 3TIVA 1HDYA 4CWAA 5EHQA 4ZI7F 1ZN2A 3IQWA 2IDMA 4JLAA 3V4LA 1BC5A 4NYMR 3LCJA 3TIFA 4ND4A 3UUFA 5ESWA 1BH2A 3FOEC 4YBZB 4UNQA 4AJ9A 4C29A 1AGRA 4QU8A 2DLNA 3HYCA 2B7LA 4MQ6A 2WVJA 1JR3D 5DW3A 5A7GA 4PBSA 1Q15A 3O8QB 4R1OA 1H3FA 4O7VA 4JKOA 3N07A 3T0IA 2B5OA 2WC1A 4MA5A 3K0FB 2V0CA 5FL7D 2O8EA 3LPAA 1FXWF 4EG8A 3R76A 5TQ2B 3PA6A 1OHHA 5BWWA 4JSTA 4UD2A 2AG6A 2NYUA 4HLNA 3PNBA 5HIKA 4JQOA 3RS8A 2I4OA 3KJXA 2OENG 5A6SB 4TGLA 2XQVA 3LTNC 4EZIA 4ZIRB 4DL2A 2JNWA 3V4ZA 1Z2NX 3ETCA 5HMMA 3DYIA 1A27A 2ADOA 1ZGGA 1QQ5A 1IBRA 1ATZA 3GB8B 5EE9A 4GM0A 1BA3A 1K98A 2Q6LA 5IBQA 1K92A 1RLTA 1IEQA 1R3DA 3CB2A 2YOHA 3DE5X 1M83A 3HCBA 1NXSA 1C8KA 5TJHA 2JIDA 2I91A 4MO9A 1OTXA 1U5BA 2I6UA 3W9YA 4BUZA 4L2IB 1IATA 2GBLC 1SY7A 1PZEA 1FDWA 5ALEA 1QO0D 2FWIA 3SJAA 1Z75A 4EY7A 3IUSA 3RWMB 1PR1A 3AVPA 3NP7A 2SICE 3OE1A 5SZHB 1EFVA 2EDCA 3ZZTA 4ZK2A 4GG1A 1LSJA 3ZU3A 3U2QA 5EMLA 1UKYA 3KZMA 5ED0A 3C3MA 4OVKA 3TIIA 1M2OA 5BUCA 4CMJA 1E3QA 3OIYA 1KIMA 2IYQA 4U4AA 3L6UA 4FU0A 2BBSA 4ARZA 2VLBA 2L0XA 1DC6A 1W5TA 3A3YA 3K09C 5IW8A 1X9NA 1UMCA 1Q3HA 4KR6A 4OXXA 4R7GA 2QN7A 1M2HA 3HJRA 5YASA 3SIWA 3RK4A 4BMVA 2X41A 2ABJA 2P2SA 3GLTA 3TZBA 2VDMB 1EGVB 2A2ZA 4WZ6A 3ZDFA 5TT0A 4AG6A 3ZNPA 4WSOA 1WCXA 1FYWA 1KMIY 1CIVA 2HQ1A 3GJ5A 3MWLA 4G8DA 1XVUA 1DQSA 3OFVA 3HR7A 1HE2A 4OMUA 4B6SA 3HU2A 3GRYA 2F4NA 2IGTA 4CI9A 3QKSB 2ZRLA 4QODA 4LJ4A 5GQSA 1OZ0A 5EIFA 4BLOA 3VZPA 2PEYA 2J7KA 4NNOA 1Z2OX 2Z09A 1OFTA 2Q6IA 1U11A 1QPBA 1CUFA 3ZI0A 2QTTA 1VSBA 2ZCJA 1K8QA 3EXHA 3PZBA 3GDWA 4ER5A 2BFCB 5KFFA