3ETJA

Crystal structure e. coli purk in complex with mg, adp, and pi
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3etjA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3etjA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3etjA01
3BFPA 3VPBA 4O4JF 4MV7A 4HNTA 4FFRA 4E4TA 4QSHA 1DV2A 3RFCA 2R7MA 4TUYF 1JDEA 2R82A 4MV4A 1B6RA 3AW8A 4MV6A 3WO0A 4C5AA 1A48A 5BMVF 4O4HF 1VBHA 5EZYF 5HV6A 3R23A 1JLLB 3K3PA 5FNVF 2FPIB 3G8DA 1Z2OX 2YRWA 5DMXA 4O7WA 4IZOA 4MAMA 5K2MA 1DIKA 3Q1KA 1PX2A 4WBNF 2QF7A 4EG0A 1OBGA 4IIJF 5C8YF 1IOWA 3K5HA 4EABA 2I8CA 2YZMA 2CZGA 4NYEA 3N8DA 3MWEA 3V4ZA 4O7NA 5JQWA 5J2UF 4MA0A 2R85A 4IHJF 3ORRA 4DLKA 2WYOA 5JH7F 5D8DA 4MV3A 3Q2OA 1WR2A 3OUZA 4MV8A 4O4IF 4O84A 2YS7A 2SCUB 2W6NA 4O4LF 3VOTA 3RUPA 4O82A 5J2TF 1C3OA 3TINA 1B6SA 4O2AF 2W6MA 4FU0A 4O7LA 3GLKA 2GPSA 2R7KA 1KUTA 4EAAA 1M0TA 2W6PA 3RV3A 1GLVA 3LWBA 1ULZA 2P0AA 4O7TA 4IWXA 3WO1A 2W6QA 2YWVA 1UC9A 2VR1A 2NU6B 4YBZB 1VBGA 3OUUA 1C30A 5JVDF 3BSWA 1BNCA 1EUCB 2CNVA 4O83A 4TV8F 3I12A 2PN1A 2R7NA 1I7LA 3VMMA 1W93A 1E4EB 2R86A 2XD4A 1KJ8A 2NU7B 2W6OA 5LOVF 4O7RA 2W6ZA 3ETJA 4HR7A 2DWCA 4WD3A 2VQDA 2VHEA 4FFOA 2YZLA 3V4SA 5KX5F 1E4EA 4FFLA 4ZI7F 2W70A 5CB4F 4EA8A 2YZGA 4M98A 3KREA 4YB8B 3BSYA 4J6EA 4ZHQF 2V5AA 4EGJA 2HJWA 2GLTA 2ZDQA 4MV1A 1M0WA 2ZDHA 5H80A 2FPGB 1EZ1A 4YAJB 2R6FA 3U54A 5JQGF 4C5BA 4HNVA 4ME6A 4XX0B 4XZ3B 3RV4A 4XYMB 1EUDB 4FFNA 4FE2A 4RZQA 2V58A 4TV9F 3R5XA 4GGMX 3HBLA 2NU8B 2Z04A 4EA9A 4DIMA 1I7NA 2OLSA 4YAKB 3R9RA 1Z2PX 3BSSA 2VPQA 2YYAA 4Y8VB 4FFPA 5IYZF 3KAKA 2PBZA 4YJ3F 3U9TA 4O7VA 3JRWA 2CNUA 5LP6F 3KALA 3R5HA 4O7YA 2XCLA 2YL2A 1GGOA 5BPHA 2ZDGA 2FP4B 1KJJA 2YRXA 2I87A 1AUXA 4M99A 3R5FA 3SE7A 1KBLA 5JVLA 5GONF 2R84A 3AX6A 4HNUA 2CQYA 1KJQA 5C1OA 3ORQA 2CNQA 1KEEA 1M6VA 5LXTF 1EYZA 2GQSA 5CA1F 3WNZA 5C1PA 1JKJB 1PK8A 2X0SA 2FB9A 2DZDA 1KJ9A 3TIIA 2HGSA 5BPFA 2DIKA 1CQIB 1T36A 4O7ZA 2W71A 2YW2A 3QFFA 4M9CA 2GQRA 3KAJA 4HQ6A 2GPWA 3U9SA 4XYLB 2FPPB 4FFMA 1EHIA 2I80A 4MV9A 2DLNA 4O81A 4EGQA 2IP4A 1UC8A 2QK4A 4FGRA 2NUAB 4I4TF 4O7SA 5CAEB 1CE8A 2C00A 4YJ2F 1A9XA 1KJIA 2YS6A 3ETHA 2R7LA 1GSOA 4ZQIA 3G8CA 3VPDA 1IOVA 2J9GA 1KC7A 1GSHA 3JZFA 1W96A 3TIGA 4EA7A 3BG5A 3DF7A 5LA6F 3U55A 1OBDA 4L1KA 4IWYA 1DV1A 5LYJF 3MJFA 3TW6A 3JRXA 5I47A 1VKZA 2PVPA 2NU9B 3E5NA 3LP8A 3GIDA 1SCUB 4C5CA 3MWDA 3K5IA 4M9UA 4O86A 1AUVA 3N6RA 4I55F 4MA5A 2Z02A 3NUAA 3UFXB 2NPOA 1CS0A 2V59A 2YZNA 3HO8A 3VPCA 4I50F 4O2BF 2R87A 5KKNB 1GSAA 3TQTA 1Z2NX 3VA7A 3HB9A 5HBRB 3JZIA 1BXRA 5CA0F 1JDBB 4ZOLF 1CQJB
chains in the Genus database with same CATH superfamily
3ZY6A 3DMRA 3PJDA 1PI3A 2QW1A 2QPOA 4X7PA 4EJFA 4MV4A 2FNAA 4LHSA 3B82A 5CNJA 3OAAA 3OAAD 4EFBA 3JW8A 3S8EA 4X44A 2IOQA 1O6FA 1ZIXA 2ZIVB 4LTDA 5I3CA 3NTXA 1I1MA 3KD2A 1F8YA 1SK8A 3NPMA 2CFMA 3F46A 4MQUA 1YRWA 1L5MA 2BFDB 3MUEA 3PRKE 4OBEA 1BWPA 4FXPA 4DPMA 2C92A 3HJHA 4ED3A 1SJ9A 5JD4A 5C7OO 5HPYB 5IAOA 4ZQCB 2WOJA 2PSHA 2PWAA 3KM0A 5JMWA 4J0JA 3QNMA 3THXB 5HZMA 4FINA 4K6NA 4NU0A 3STHA 2FE1A 4YAOA 3E84A 5LNK6 3WO1A 2XNSA 1EUYA 3NKFA 2OCBA 4RVDA 5ICEA 2P2LA 3TB6A 1UOEA 3Q1LA 7MHTA 5HG0A 2QD5A 4IIFA 3P5BA 5C3MA 3MCVA 3U7EB 4PG7A 1JDUA 2ZB8A 4KC0A 4OBWA 4FS2A 4YCBA 4OJNA 1FFAA 2WMOB 1TWHA 1M76A 3FN4A 2PHZA 4AIIA 5I9LA 3ZXYA 1SQSA 4IJMA 4IIJB 4UQLA 4MH0R 3GB8B 5BORA 1W59A 4QUHA 1E4EA 2O2YA 3JYLA 4NTZA 3PD7A 3UQYS 5CJJA 1G5IA 1U4SA 3BL5A 4OB6A 5KFGA 1RWKA 5LVAA 3R5TA 3B52X 3O84A 4QXOA 2BH2A 3ICQB 1M5UA 2MYNA 1EFLA 3I42A 2OPBA 2H1WA 4FIDA 1NN5A 2D1TA 5B3JA 5CYFA 1ISGA 1YB7A 3K5PA 2R11A 2VK1A 2WHQA 3BGDA 1ZUWA 1MIOB 1CKNB 2Z04A 3MD0A 3CVOA 2UVVA 4UBLA 3WRVA 1E3IA 4CCYA 1AHPA 2ZS7A 5BYAA 2EEZA 3FIJA 1VXOA 3OLCX 5JEDA 1QHHB 1OKKA 1GO3E 3I5XA 4YONB 2ORVA 4RCVA 3DAYA 3R9XB 4AWXA 3ICVA 3ZE9A 1S3IA 3RK0A 2IU6A 4D92A 1PV4A 4YWJA 2JLRA 2QRQA 3HZRA 3BX1A 3RE1A 2JEZA 2UXDB 3DE6X 1ZMBA 4MHSA 4KQJA 2HMVA 1G8SA 3WP1B 5KWIA 2GUGA 2XKAA 1KEEA 3TWOA 2YWXA 4CEIB 3K2QA 1YR9A 1N8TA 4F6RA 4PPQA 1BU5A 4PZ9A 3R74A 1DG3A 4CUKA 4LSWA 2Z2JA 3F97A 3WNDA 1YZGA 3IBCA 3QELA 3GVHA 4I1RA 2A59A 5FPOA 4RO0A 4K40A 2JCYA 1ZC3A 3W6UA 3WYDA 3JQEA 3PL5A 1JI3A 3HLKA 2E5WA 3DL4A 1GGJA 2P67A 4AS3A 5CJPA 3DWGA 5DM0A 3I9V6 2QIOA 4F6LA 4GS5A 1WSBA 3EPJA 3A26A 3QBJA 1I5EA 4Q12A 3RH0A 2BFMA 3FPCA 4O4IA 4Y2TA 5ICFA 1V2GA 2O8VA 4DQVA 2PZKA 3EPIA 1Q2UA 3OIYA 1AB5A 3W5DA 2K5UA 2WB4A 1AQJA 3LPDA 1NYQA 3SLRA 2PVPA 3LFHA 4GMXA 2NUPB 1G3IA 5EZQA 4MGIR 2WTXA 5AW6A 2HT1A 1I2AA 1RQGA 1HPLA 3DOFA 1KI2A 5GM1A 4R41A 3E23A 4PTLA 5CR5A 3NETA 1H0KA 1PG0A 2NO5A 4H6XA 4BBRG 4EHNA 1N6LA 4KFSA 4L16A 3P96A 2GBCA 3W4IA 4D80A 1GM5A 3K53A 4DNFA 5KFVA 1L8OA 2TSYB 2F64A 1JIKA 2HDWA 1L3BA 2ZRLA 3HB4X 3A3NA 3C15C 1S2LA 4CF7A 4NFSA 4Q45A 2VJMB 1PYOA 1SU8A 1N32B 5L4LA 3I8SA 4WDRA 4WL0A 3L0ZA 5JRJA 1A9OA 4CKEA 4J75A 3PUYA 5MFZA 3MWEB 4MGKR 1T8SA 4OXRA 3RRJA 4UOQA 2C7PA 4PSVA 1GZUA 3ZNQA 1BS9A 3CNOA 4OXQA 3JWHA 3FMFA 2G06A 1P2FA 5JAMA 3T5AA 3F8SA 1NMZA 4Z53A 2COJA 4E11A 5KG1A 1FNNA 2AVDA 2BHLA 3T1YH 1LDMA 4MLCA 4PXYA 4V0KA 1ODSA 3VZBA 1OWLA 1SVNA 1U3WA 3RAEC 1N5OX 1HE3A 4FKZA 4YV0A 3WIBA 4EPWA 4A3DG 3TUJC 3D4OA 3TZHA 2ADOA 4R1SA 5AVQA 1IBMH 1YZNA 3O2QB 1C7EA 1RMQA 4F9FA 1WCMG 2D5LA 4QELA 3L05A 4R81A 2P69A 3LF1A 3AETB 4FYJA 4BFYA 1IULA 2C96A 1L4LA 4CMDA 1FMLA 1Y7IA 3N1UA 3RK1A 1KE1A 3CUTA 3FCUB 1SWVA 2AOTB 1XJCA 3EQ6A 3EDYA 4EY6A 4FM9A 4BMVA 4BFXA 3KCNA 2CVOA 2GN8A 3CM0A 2JI4A 3M6LA 5BT9A 3M6UA 5F9FA 3OQPA 2PZAA 3RAQA 1O8BA 3CB2A 3RFTA 2IBTA 3SEFA 3A9CA 5CCBA 4RVFA 3LQYA 4U2GA 2I67A 1M2EA 1L8AA 1T15A 4L8GA 3JD4A 5KKAA 2IYZA 3ETLA 4DWVA 1AKYA 1TQ8A 5IXJA 2I4IA 2EFEB 3A4LA 3V55A 2CXXA 4N18A 3C7DB 4MGZR 4B3FX 4TM7A 3E2IA 3NOOA 3Q5GA 1C81A 3QKRA 2R0QC 2XT0A 4WAUA 2RC5A 3AJDA 3NDPA 4ACAA 1P5RA 4JP5A 1PNRA 4DDHA 4MULA 2ETVA 3V2GA 1U0FA 2GN2A 5IP9G 3CRRA 4CM6A 5ADHA 2E4ZA 1FYXA 2DC1A 1Q0ZA 5HIAA 3HVIA 3UBTA 1HL3A 4P4UA 3PX3A 3I45A 4J0KA 5ALTA 4YJ3F 4F4XA 3M1YA 3KVVA 2PA0A 5HFAA 1NW6A 5C5JA 2BEUB 3AUTA 5IKXA 1HDXA 1PZNA 3R9KA 3B3GA 2OBYA 3IEVA 2GESA 2VP9A 3SHQA 1XNRB 4Y2UA 1RWWA 4M0KA 4OMCA 1GNRA 3GEHA 3K4HA 4KPYA 1O87A 2C5BA 4OHBA 4NECA 1GZHB 5JLAA 3SVLA 3WWCA 2SNIE 2R8ZA 5JXGA 4RCNA 3OETA 2AQ4A 2PE5A 4YJFB 3P5SA 5J59A 3ZZUA 4JT8A 5I9MA 4CMAA 2QZJA 4V3BA 2ZJFA 1I4DD 3N2KB 3E70C 4KXYA 2UZAA 4UOEA 2TYSB 5EMMA 1JWBB 2Q4DA 1BO6A 2I2DA 4HAUA 5TT1A 4RTLA 1BIFA 1I9GA 3SQXA 3X1JA 1XOIA 1HG0A 2KJQA 2IU3A 1M75A 2YBDA 1CQIA 1VKNA 4DV5B 4HDRB 4W8OA 1Z6QA 2RJ3A 3ABQB 1PDOA 2O3JA 4BU1A 2Q1XA 3UVEA 4FOSA 3IV9A 5DIFA 4I9UA 3RVKA 2REQB 4P34A 5DH9A 2J7KA 1OY1A 2ZIUB 3KQUA 2G5GX 2XYRA 2FTKE 4PHTA 4C6TB 4HQOA 5CX1B 1AZTA 1TEVA 1DEKA 3U37A 2Z95A 1QGAA 3U5TA 5DM70 2H92A 4PCLA 4HDSA 2XJ4A 1VGVA 1IQ0A 1FYVA 3DEKA 1RMYA 1X1EA 3UK6A 1OPRA 3INGA 4GSLA 5A9TA 1MPTA 3X2SA 2XUGA 1EVJA 2VZ8A 2C88A 5CA0F 4B75A 2CLIB 5AW0A 4XYEA 1RNLA 1ZZEA 3EDOA 4RCZA 4NLLA 5HF9A 1PR3A 2A5JA 3QVKA 3J81W 2DSTA 3D8RA 4MV6A 4IMIB 2LIPA 1RC8A 2QUIA 4G3XA 2IY9A 5THXA 4H3VA 3DHWC 1BCRA 4CWAA 5AW3A 2JLWA 5L8VA 4ECSA 4QPZA 1FPQA 2XWPA 2H1RA 3K5HA 1TUIA 4D45A 1WCXA 1TTTA 3DB2A 1NN1A 4JI2H 3TNFA 3G2NA 4MPJA 3GJ8A 2VLIA 4A3SA 2E5LB 4N7BA 1YA4A 1KY5A 5IYZA 3PW0A 3CKKA 4CBVA 2ZIGA 4NS1A 3GMDA 3OPNA 3RO7A 5ALFA 2FZVA 2ACVA 1TK2A 4G1CA 3TX6A 4ZARA 3WBFA 3NIGB 3X1XA 1H6AA 1P1KA 3ACCA 3OSNA 1GZ7A 2NXNA 1YZVA 3UK1A 4PLTA 3WQSB 1JT2A 2Q6LA 2FUEA 1ONNA 4ZCPA 4RHUA 1M1YA 1UC9A 1JJAA 1BE8A 4KQ1A 4MCHA 4C0HA 5CIQA 4BBPA 2C1ZA 4N3AA 1C9NA 3RJTA 2R1ZA 1A5AB 3GC6A 5ELMA 3GRPA 1PR5A 5EJMA 3H2GA 1G3UA 3TH5A 4X62B 4AMUA 4D0SA 3T0GA 3KZNA 3ENWA 5E8RA 4IHQA 4ZKDA 1R1DA 4MUYA 1XDZA 2ESRA 2JAUA 5LQRA 2DBYA 1TJ4A 3JQRA 1E6WA 2QTTA 2OMEA 4CG2A 5B37A 1AGNA 1ZSNA 5LB4A 3EGVA 1Q15A 4F4FA 2H07A 2RHDA 3ILSA 3LYAA 4UAVA 4OKIA 5C7YA 4QPPA 2MYTA 2XW6A 2ZW9A 1N36H 3S55A 2OGWA 1Y1TA 1V41E 4U2KA 1HRDA 3AM1A 4QIWE 4MW2A 3IHKA 3O3MB 2RDIA 4IR1A 5FTJA 4EMUA 5AKLA 3ASYA 5E2BA 4CIXA 3HXPA 2UU9H 3LLMA 3C48A 2O05A 1VI6A 1WZIA 3ILVA 1X9NA 3IUYA 4HMPA 3V4RA 1VMIA 1NQUA 2Q0QA 4QLOA 2Y05A 4QYIA 3SNKA 3SYTA 3QVSA 1RKBA 3K9LA 2XCPA 3T1TA 2VVTA 2NSYA 3ZXUB 2P9JA 3QHAA 1K7EB 4HDMA 3SSOA 4ZZIA 1VLZA 4RPJA 2IPNA 4OYRA 2QIPA 1G17A 4LRUA 1I50A 1UKZA 4FZ5A 4TL8A 4CF4A 4X95A 1UDAA 5CBPA 2WAQA 4Y6SA 5BVHA 4EIWA 1WDWB 1E3JA 3WYBA 4KR9A 1UJBA 1HK7A 4MINA 4QTTB 2VTBA 3VTAA 3GXOA 1L5VA 5IN4A 4RY9A 3SQNA 3KAJA 4EKIA 4MR9B 5DLEA 3MINB 2BMJA 4FFMA 3JZ6A 1UJ6A 4EX7A 4CR6A 2PUDA 3DQQA 3REQB 4QYSA 1ZM7A 3TL6A 1KI7A 1QTRA 3JAKA 3A1VA 5KG7A 3OBIA 2LPMA 1KSGA 4ZYUA 4EK9A 3H1TA 3WV5A 3LKZA 4QUDA 1E8NA 4RDHA 3VZQA 4E6EA 3CW9A 4DV6H 3GROA 5FBHA 3H18A 5REQA 5BNZA 1VDZA 4XGQA 2PEYA 4UDXX 2ZUBA 2FA9A 4ADSG 5LKAA 3PPYA 2MSWA 4PYIA 5LJIA 2J6UA 4F2GA 1D2EA 5AHRA 4Y1RA 4LWZA 4N0PA 3TSZA 1UAGA 1ULUA 4NYMR 5J5AA 4ZODA 1XRMA 4FBGA 2BDTA 2CJXA 3O2JA 5I7SA 5CYGA 3DUWA 2GF2A 4G56A 3TR0A 4JDPA 4MV7A 4K9NA 1NYLA 4NBRA 1WLYA 1WUTA 3SMQA 2AVNA 4PGAA 4JBIA 5AI4A 4FZJA 3EVAA 2ZJ7A 3F98A 4S1NA 4MKIA 2YZ7A 4FYVA 2NQ2C 4ZDIA 4WN9B 1E59A 1H1DA 3D7MA 2ZSJA 2ZZNA 1OYYA 5ECWA 1ADJA 3SVZA 5JBQA 5M3BA 4P83A 4PN3A 4GOMD 5FOXA 4B7ZA 1QH0A 1S3SA 5F4BA 1SURA 2CNKA 1ECCA 1DVRA 1OV4A 2DWPA 1KWGA 4IZIA 5JSZB 4IG4A 3VR2A 2NUAA 1ZZGA 4JT4A 2Y1CA 2VSXA 2OKGA 4LYFA 1I7QB 1U3CA 3W3ZB 4GQBA 1KTIA 4ARBA 4BP9A 1U7UA 5FI3A 4F45A 3HVJA 3JQDA 4PQGA 3ZV5A 4G0PA 4N6NA 4NEQA 3GVXA 4UMEA 1QHFA 5IKPA 4C43A 2JJ1A 2JJ1D 2FPXA 3G0OA 1S7CA 1WZNA 2UUBH 1T8WA 3H1PA 1KR2A 4LMRA 3G1TA 4UW9A 3G2QA 4UXIA 2GCPA 2VPXA 3MJ4A 3PIRA 4BJ5A 2XTZA 4UKDA 3KK0A 3OCVA 2W6OA 3PP8A 3RSQA 7AT1A 4OOFA 2QENA 3W5AA 1FS4A 3KOUA 1BMFA 3W5IA 2X2FA 1CQJA 3OM0A 1JVSA 1RE0A 1KAHA 3I76A 1EFPB 3F4KA 4CMEC 3L5KA 2CHGA 1DWOA 2CB9A 4YMHA 1PF7E 4P4SA 1YDEA 4GDMA 1P2SA 5FLMG 4G5HA 2C7VA 1Z75A 1GG5A 2CC2A 2WYIA 4DSZA 4ALNA 2EW1A 1CG6A 3FRHA 4AY5A 3CT4A 4TRNA 4KRFA 4ESEA 2VYQA 3BTUA 1J70A 3GTKA 1JG6A 5FUXA 4PGHA 4AZ0B 3Q8RB 2R60A 4ZRNA 2H54A 3ZK7A 4JI1B 4M21A 1IFXA 4TTSA 5KUTA 3RADC 3TCNA 3QEOA 3AR2A 1AZLA 3LW7A 4A3LG 1UIRA 1NASA 1QQ7A 3BAAA 2Z30A 2OOSA 4GEKA 3BIWA 3FKSD 3C41J 1QGYA 4QO7A 2XUOA 4NMHA 4G97A 1TAUA 2PS3A 4WKPA 1GFWA 4RUKA 3NAQA 1E89A 1OHHD 4B34A 5DK6A 3DE1X 5CB6A 4W8HA 4KLZA 3LPMA 5ELXA 1E3DA 4LN1A 3UJ9A 2BGIA 2IDMA 4XR4A 1NE7A 3AXSA 1NYTA 3K6JA 4ZRMA 5CT8A 2RGRA 5J2UA 4DJDC 2R92G 4B3MB 3S2ZA 1Z29A 1QR2A 3WGVA 4LYEA 5AO9A 5HK8A 2ZAGA 3EPKA 1VKHA 2VQEB 2J9GA 4XKJA 1KQ3A 4R84A 4ASUA 4ASUD 5LZ7A 2WUFA 1U7DA 2G9NA 2YXBA 2HR1A 1ZMTA 1N2HA 4LJ8A 2DWUA 1SR8A 3U7QB 5CEFA 4J7CA 3OZ7A 2EP5A 2E89A 1Z7BA 4E5UA 3OPYI 1JQ5A 5LOVB 5K0LA 3VYRB 4TV8A 4MZXA 3RAFC 5C1IA 2EARA 4HEA1 1YQTA 5BQFA 4JFAA 2GERA 4AP5A 2JHPA 2CVHA 3HBAA 5DHAA 5LDDC 3TAUA 5GGXA 4GOLD 3WDSA 4P82A 1JAXA 2O3UA 4CMKA 1HL7A 4QSHA 1A72A 1BSVA 1YAJA 3WLKX 2VC2B 1DG1G 1KYXA 3QX9A 3W3AH 5D01A 1FQJA 4HAIA 1A48A 2ZZMA 5JO9A 4L07A 4BB0A 4LW8A 4B4UA 4ESVA 4TKLA 4CT5A 1MAVA 1H2AS 2A5YB 1PJCA 1R6VA 3RABA 5ENVA 2QI9F 3UOAB 3QBDA 4PZ7A 2XMPA 5K2MA 8ADHA 4YRAA 3RNLA 3QU9A 1CR4A 3U7FB 1M34A 3HOVG 4NYEA 3TLXA 1EESA 4REMA 2HF9A 3RJ0A 3ONEA 3TRFA 3UCXA 1OJ7A 1WHTA 2P65A 2JRCA 4A6DA 2BM0A 4DR1H 3U09A 3JCZA 2CZQA 1QGDA 2C4VA 2FK7A 3U3JA 1S6YA 4W1SA 3THWA 5A3VA 3FOBA 1YHYA 2ZFUA 5DTQA 3RJ9A 3PRHA 4MRSA 1PBTA 2ALJA 3BWXA 2W2VA 4A1OA 5BYJA 5F3RA 2JBAA 1XP5A 4ZYXA 3FPHA 3OTGA 2HC9A 1C5KA 4XE5A 3Q88A 3BGSA 4OSOA 2E82A 3RIEA 4ECTA 4HATA 2X8AA 5JY6A 1Q57A 2C28A 3NR2A 4WLVA 3F5FA 3FDJA 1JB9A 4DNPA 4NZ9A 2WSIA 1N0UA 4Q1VA 4Q37A 1L8QA 1A8QA 2AW5A 4DJTA 5ES3A 1RBQA 1UNNC 2P5YA 5BUQA 3PUVA 3GZTB 4YUYA 1C3XA 4XAQA 3M6AA 1NT4A 2Q7XA 1FFGA 1G19A 4WK2B 4RIEA 4N5HX 3ZHBA 1VP9A 4LNHA 4KW7A 1W4ZA 1TI7A 3TLBA 5F9HA 4PZ8A 1HNWH 5I9SA 3SJZA 3LT2A 4BNGA 1ZK2A 2HZBA 3AG5A 3HL0A 2XEDA 5KWSA 4OATA 1WZUA 4XYBA 1YWGO 4DDWA 1P4AA 3D1JA 5JI3E 1TYZA 2RHMA 4FHCA 2CW8A 3NP9A 1U4OA 4HFJA 3M2TA 3PX7A 3I4FA 3OZTA 4FFPA 5T57A 1JYFA 2YFKA 5A3JA 3RLFA 2ERXA 2ABWA 3K92A 1QIJA 3LDUA 2QMEA 5KAMA 3RTGA 2DG2A 2G09A 2P9YA 3RD5A 2IBMA 4LHEA 4PPFA 1TYEB 3FROA 1N2BA 5DULA 5HF8A 2CMHA 1Z2DA 1POWA 4KSYA 2IYWA 1T9GR 1KT8A 4DMUB 2UZ1A 3BXPA 4QLBA 3FKJA 1IN6A 5JNUA 4UAUA 3WP0A 4DKXA 3VHRA 3IH5A 1OFVA 2OQ2A 4WPGA 1KJ9A 3KG2A 1YA6A 3RRXA 3RT1A 3LX5A 2GWRA 4MJ7A 4W99A 4UD2A 2H1OA 3IP9A 1W0KD 1KO1A 2GD2A 4PBRA 3AERB 5JRDS 3L4BA 4YR9A 2RK4A 3M1IA 4TYMA 1JIUA 2AQIA 1U9CA 2OBMA 3EMVA 2I33A 1JEOA 4KHPH 1Z8DA 2P5TB 2BGJA 1WDTA 4JLDA 1SXHA 4RBNA 4F86A 1CEYA 3EVTA 3U40A 2VQSA 2J6HA 2Z43A 4HTAA 2QJWA 3NC4A 3GTQA 3N70A 3JQGB 1PJLA 1KMMA 3Q10A 5GINE 5CAEA 4ZMBA 1V1RA 2ZJAA 1XTRA 4E4RA 1LNQA 2OAP1 4D9HA 2Q3MA 4OAQA 4G1EB 4DQDA 2WVJA 4NMXB 1D04A 1MBZA 1ZH8A 5FULA 3HKBA 1P9NA 2DUNA 3FTNA 1YIOA 2OORA 4MR7B 2XGMA 2QORA 3QH4A 3I5UA 1T9ZA 2EZ9A 4JOBA 1Z63A 4P08A 5IG2A 3WR5A 3OA0A 1DIRA 1VIVA 4PSCA 3Q9NA 1J9EA 4MUHA 3I9LA 1SEPA 3ZHUA 2R00C 2HLPA 5BURA 5DXFA 4ND4A 3L92A 3L7BA 5IVPA 3L0OA 1EB8A 4Y2YA 3G5TA 3WLJA 3LKDA 3ZWOA 3ZWQA 2OQVA 2CL5A 8AT1A 4IZOA 2HHHH 4FR0A 1GA1A 5BVGB 3E9NA 4B6GA 4ECXA 2ZJYA 4FDAA 4FUTA 2IPXA 4EABA 1T0JB 1FTGA 4P7FA 1KQFA 2IZ6A 1B33N 2TRSB 3L8CA 3VOBA 2ODAA 3IEUA 5AKXA 4K03A 1FMFA 3H4IA 1IEQA 4LYDA 5GV8A 2DFKB 4FT4A 2P9GA 2HGWA 4D3FA 2QHXA 2W9BA 2AI2A 4KQ6A 4GRIA 2D06A 3NEAA 4RU1A 5C46F 3ZG6A 2GBGA 4C08A 2HX1A 1ONPA 4EA6A 1YRHA 1X38A 3IT3A 3GRUA 4MUGA 2GYUA 4BVHA 1U2GA 1HFJA 2VLBA 1GQOA 3Q3HA 2Z98A 2R66A 3V7NA 2G9UA 1FFWA 1Q7RA 2P27A 3I12A 2FX2A 3QVMA 3ESRA 3HVHA 3UFXA 3I92A 2EC5A 2ASDA 1KO7A 3K1ZA 3TZQA 4ZICA 3PDHA 1KXZA 2OXIA 3PR4A 4YUVA 1X9IA 3DS8A 3TTUA 4F1KA 4TLCA 3BWMA 4S2UA 4LF7H 4GI3A 1NG9A 4AJIA 1NZJA 1V51A 1KHHA 3PC8C 2GA8A 1AKVA 2GBLC 3CW8X 4UBMA 3SJUA 4EDFA 3ZC3A 5DX1A 2VH2A 3AILA 3FTEA 1FIUA 2A9KA 1RRKA 3VYVA 3H3XA 1F4PA 3EZ7A 1G5HA 1W87A 2W11A 4RM3A 4WMLA 4CU5A 4JJZA 2JA5A 2RK6A 3A36A 4KDFA 4E88A 1JHMA 3HDJA 2CKMA 1ZJ4A 2X8WA 1E58A 4Q34A 1Z7EA 3B6JA 3HBLA 2P3SA 5HIIA 4BFCA 1BDJA 2FG7C 1T3LA 1WL8A 3TM4A 2M6LA 2H4ZA 4NH4A 1NXSA 1X7DA 3PENA 2JD1A 3MUNA 2P9FA 4EPTA 2VTVA 2J9XB 4TVOA 1X2BA 2XEXA 5TPWB 3I5MA 1Y4ZA 4L5YA 2WOOA 4KB5A 3UHJA 4QQRA 3FCEA 5JS2A 3IT2A 3LT0A 3P20A 2J46A 3MTBA 5AOVA 2CQYA 3KDSE 1GNLA 1M2VB 2CMFA 4AUEA 1FJ2A 1CY0A 2YMQA 1WKVA 5B58T 1CNEA 3HA2A 2VUMA 5LXTF 1SEIA 2WMNB 5A02A 4IVPA 4D79A 1MMFB 3LC7O 2Q6IA 1C8KA 1J8VA 4B47A 2DPJA 3W78A 1J49A 1GZ5A 2ZYIA 1B26A 1MG5A 1KSJA 1GYRA 3R5JA 4JD5A 4NULA 2C5AA 2WWXA 2Y0BA 2CZCA 2GDZA 1TIPA 5C4GB 4ARVA 2GEBA 3A4MA 4C4TA 1BOFA 4FBUA 4KAFA 1KH1A 2AA3A 5KWEA 2BM8A 3NW9A 2B4TO 3ZIUA 3D8BA 2V3CC 4KPFC 5JSFA 1TTPB 1K08A 2Q41A 3W8EA 1TL7C 3DAFA 2BCEA 1XLVA 2ZVDA 4Y9RA 4MB6A 2B61A 2F7SA 2ZCUA 3O1IC 4AJKA 1AOXA 2B8NA 4GPBA 3VU9A 2VUHB 1W1UA 1XALA 1NIJA 4CYMA 2KM1A 1CY1A 3KE8A 1V7QA 1O94D 2IIPA 4B4VA 3G6YA 4CC6A 1FTNA 5BWMA 2VCEA 4QAJA 5EZ6B 1J7JA 4Y6LA 1ZI6A 1GG9A 3VPBA 2XZPA 1HTWA 2NAFA 1Z2EA 4UXHA 3P19A 3EXHA 2ASVA 4KUEA 4PG6A 2BFCB 3KOMA 2J41A 1COWA 1COWD 4YDRA 2ONZA 3I05A 1W9HA 1Z2OX 2VBFA 1E1CB 2NV6A 3ZIAA 3ZIAD 5FYDA 4NATA 4MAMA 2B92A 1YL5A 1ZVQA 4O0LA 1ZD2P 2FCRA 2XMCA 1XNRH 1YD7A 4HQNA 3NG1A 1KRXA 4ZPXA 3H11A 3UQ8A 5K09A 3FZEA 4R98A 2UYCA 1K7SN 1RTKA 4LC9A 3C74A 3O92A 5HQTA 2RBEA 3OFJA 4P93A 4BJ3A 4N0DA 4MV8A 1CQXA 4N8DA 2F2TA 2J09A 3SJAA 3IJPA 4AMZA 4A3JG 2CK3A 2CK3D 5KFHA 4DLPA 1FA9A 4BLWA 2GK6A 3OUTA 4L9SA 4YGXB 3B8EA 1YDGA 4KO2S 2IS2A 3NHBA 4BNHA 1YJAA 2GM9A 4LF5H 1JDZA 1OXXK 4FWIB 3CNLA 4D4IA 5DI9A 3VZPA 1N77A 2F43A 1T5BA 4GLFA 1TKCA 3OT1A 2DUJA 1U3VA 1I7LA 4M1EA 4E5VA 1W46A 2EYUA 1F7VA 1QCZA 4YP3A 1VCHA 2PUGA 2OV8A 1G8AA 1P61B 3NHFA 4ZVLA 4X1IB 3FUUA 3PFFA 4MR8B 1D2RA 3GI1A 1QLHA 2EHJA 3PXGA 2YZGA 3T34A 3EZXA 4UTVA 5TQ2B 3MELA 2ZAMA 5B53A 4JLWA 2YR0A 4HDNA 3BSYA 2W5UA 1AF4A 2WKPA 4RPGA 4A2PA 5FJ8G 3FY4A 5LD2B 1F4LA 5H80A 4AZVA 2IV3A 5IVHA 3EEIA 2QL5A 3ND7A 3CTPA 2XITA 4NSNA 2VUSA 1N6PA 5ESWA 4BMZA 2L17A 1ODFA 3KTFA 1Q1EA 4TN1A 1AS3A 2HBRA 3KZ1E 4JBNA 1SBNE 3BMQA 1MZBA 1TE2A 4W5OA 1REQA 1WV0A 4A3GG 4IIXA 3Q87B 1ECLA 3VYSB 4BQFA 4HK4A 2ZRJA 1EX6A 2CD7A 1R0BA 3R5HA 2YVLA 2D3TA 2XDQB 2BWJA 4LXHA 4DIKA 4TTPA 3ZN2A 4F7DA 3C3YA 1AUXA 3D5EA 2Q9CA 3RIGA 1YQEA 4AWBA 1TYCA 1RLTA 4U3JA 1JIXA 2G72A 4Q6BA 1SHUX 1G3RA 3H04A 4DJFC 4DCJA 3CA8A 3FHOA 5JFGA 2YN2A 4DVJA 3JVUA 5HXAA 3OU2A 4JI8H 2O7SA 3BTOA 4LSZA 1IVYA 1JSCA 2XUHA 1LI5A 4CR8A 5DV9A 2UYOA 3RRMA 1FP4B 1H2RS 1RXIA 1C1HA 4G1VA 1E3QA 4AJLA 5A5DA 2WV7A 4PAWA 5DLYA 2WUGA 2AFVA 3ZS8A 3IV6A 3WKCA 1IBSA 3PCXA 1LLCA 4BASA 4PLCA 3GWZA 3JRXA 3DVLA 1ZN2A 3DM5A 1NUSA 3TYXA 3A3PA 1EKXA 5A9RA 1DKUA 4C89A 2Q2OA 1U9YA 5CT5A 1ZU5A 2V7BA 5K7SA 4B5KA 3GRFA 1I3CA 2CDNA 1IYDA 2GETA 2JFFA 3TZBA 3WOVA 1JLSA 2IHJA 1AQ6A 1RYYA 2EBHX 2R44A 1PL6A 1ZI9A 1ZD8A 1FJGB 4DUYB 1N2GA 3CINA 3TW8A 3TW4A 5D2CA 3MFHA 1GZVA 2BR4A 4JBLA 2P1RA 3TG8A 2O5RA 2PT5A 1C9KA 2C42A 4NG4A 2JPDA 4GECA 3PB3A 1SH7A 3TZCA 4B79A 1W5TA 4PC6A 4B17A 2H9IA 1FVOA 5TARA 4FDVA 3V1UA 2WG1A 1B1CA 3PHCA 5TXGA 3MCZA 5IJ0B 4OH7A 2PZ8A 1BFUA 1DJPA 1VDMA 4DYHA 1KQOA 1NBMA 3RTBA 4EENA 3P7MA 3ZJ4A 1EFDN 4URUR 3EZ6A 4KNYA 4CG1A 1YQGA 4FDTA 5JH7F 4PBTA 2WWYA 4O1HA 1YR3A 2A0XA 2Z1NA 4ECAA 4U0JA 4DL6A 1JA9A 5GAJA 1G291 4ZQFA 3FKIA 2IEBA 3BMCA 3CX7A 1SULA 4BFSA 2ACKA 2PUHA 4M0CA 4J8PA 3HCFA 1I0LA 4H77A 4Z4GA 3F78A 2UVUA 4TXHA 2O54A 2GZRA 1OKKD 2EGGA 1ULSA 2JF0A 3GEGA 2VHQA 2H8GA 3ZE1B 4C4PA 3VPAA 3ESCA 4PO1A 2PX3A 2Z3ZA 1I5OA 3IHTA 2GXUA 4TOIA 5LUAA 5CA1A 4H7PA 4R5HA 3TQHA 1YAHA 3HC7A 5JXJA 3KBBA 4ZO4A 3TGLA 3ZD7A 4OV6B 1GN9A 1GPLA 4DZTA 3DDNA 1E9CA 4XVUA 2VBGA 2J3IA 4Q9LA 5FX2A 3BMNA 3LTEA 3AM5A 4MGYR 2EKLA 3A6KA 5D1HA 3D0RA 3CPEA 4EA8A 3K0HA 4U6QA 1KRWA 1M2GA 1X39A 4B3SB 4UU8A 1SKYE 1ORIA 2AG1A 3PW5A 3GT7A 3UUWA 4LFAB 4DV7B 3FETA 4DKJA 2AGOA 4IRUB 1R0WA 4XGKA 1A9SA 4BP3A 1T5OA 4M76B 1ZETA 3AEKA 3FVQA 1WG8A 3IJ5A 3EJWA 1GARA 3RGWS 4YPOA 3AG6A 4L72A 1RYBA 3RS8A 1I4TD 3NAZA 3AHIA 1CR2A 2FPMA 2H17A 1CZRA 3AKYA 5CJ2A 2OZLB 1DQRA 2E4YA 3DCYA 4A1FA 4H2DA 5TR9A 3T6KA 4QGFA 5IHPA 1GAWA 4MGHA 4F5DA 2JGJA 3SX0A 2EW2A 4IVNA 5HTKA 2ABJA 1II8B 5TIIA 2W90A 5JHHB 3AKCA 3OM1A 2Q2WA 4BBSG 5CT9A 2GLUA 2DH5A 1MFZA 2WM3A 1TRHA 5CM9C 4YIHA 4U6PA 1JEQA 4BNIA 2V9CA 4E09A 4NX2A 4WINA 4X92A 1T6ZA 1Z4KA 1WVIA 3KZXA 4B4DA 3T7EA 1Z7WA 3DUFA 5AM5A 4CTNA 1NKTA 1OC2A 4RF3A 3ROKA 1PCXA 4ZA2A 2JH8A 4G1UC 5C51B 2AOUA 1CE8B 2J6BA 3BK2A 3QU5A 2LGJA 1EHIA 1EM8B 1V5FA 4ECQA 2CFTA 3DGFC 4HZGA 2XB2A 3AVWA 3UXMA 2GOYA 3HCRA 1E96A 1C8BA 5K0SA 2JCSA 1RI3A 1ISFA 2MJLA 4AKIA 3IEKA 2F1JA 5ALLA 1Z13A 4JLPA 1Y3BE 2ZUEA 3NHRA 2H2AA 5E2AA 4B8YA 4DLYA 4NL4H 4RHXA 3FUTA 3DP7A 2EVWX 4KAJA 3OJCA 1VLVA 4CF5A 4Y30A 4ALLA 3MTGA 2PMBA 3T4PA 5IZ4A 4URVR 3L84A 2HCRA 5FL3A 3WHIA 2PX5A 3FLAA 2QN9A 2RCYA 4QVGA 1QRDA 4Z8XA 1CT9A 2QYSA 5HF5A 1Z12A 2FEAA 4A15A 4PG8A 2UVDA 3D7NA 3HP1A 8LDHA 4L95C 1V9CA 3WFIA 3N8NA 3MCTA 3VR4H 1TTQB 1Y7TA 2R8YA 1LBSA 5TX7A 3RS7A 2WUEA 3BMOA 3TQTA 1FUIA 3EXFB 1YR7A 3V48A 3SE0A 4ZJYA 3TQSA 3IUQA 3QEMB 2K7FA 4FS1A 2R82A 1V45E 1U0EA 3CCCA 2FWJA 4KE6A 4B3GA 2VBIA 2X7JA 4MYRA 3TRDA 4O4HF 4IRKA 3H4MA 3KTDA 4HI0E 3R3YA 2OYSA 4DLSA 4BO1A 1O89A 1RAGA 4J43A 1OLOA 5F9MA 1TW3A 1W48A 4K8OA 1PUXA 4EI9A 1OOEA 1T0IA 4X0EA 1EG7A 1OBOA 1XKLA 4OK3A 2GRJA 1WXFA 2M6RA 2W7PA 3RYCA 1BGXT 3QVTA 2R85A 1XVLA 2HCBA 1MA3A 3ROFA 1PZHA 1G8KA 2WIAA 4PGFA 4O84A 4V0ME 2DF8A 4QUAA 4PLZA 4RSHA 3WHKA 2H06A 4FU0A 1YACA 4L15A 1BXGB 3EXG1 5JYCA 1TEHA 4FW8A 6GPBA 4DSNA 3MJTA 3K2BA 4NNJA 2ANBA 3FMAA 3PQFA 3ZNPA 1QZZA 2GJ8A 3B85A 1D2NA 5JAIA 3MS2A 1U8CB 5ALQA 1H5QA 2XUAA 4R1LA 1X42A 1NQAO 4TWJA 1K1QA 1W5BA 2VHWA 3AONB 3JVEA 2WSMA 4PR0A 3DZFA 5AKKA 1XZQA 3N42B 4KKXB 1KEPA 3L7KA 3CN9A 3KQLA 2OXEA 1L6IA 3TW0A 1XRLA 3GJYA 5IM4F 3E9EA 1FXWF 5CB4F 4URXR 2WSSA 3MOIA 5TGZA 4JOCA 4BO8A 1MJHA 1UOPA 4XIIA 4DMCA 4YJ2A 2W9XA 3MRVA 1HNXH 3IKTA 3JWEA 5GZ1A 3A6EA 3E9MA 4IFIA 4LBWA 3WMEA 3OY7A 2G8NA 3GARA 1ESCA 3OE1A 3A6LA 4A0HA 3V00A 1TQDA 3B9PA 3LUGA 3ZJVA 3EDMA 3OLQA 4YV1A 5I7EA 3URMA 5L9XA 1PUIA 3WYFA 5KHAA 2GJAA 4DGSA 2GAJA 1UZMA 4ZQGA 3OX3A 2OT3B 4J9VA 1X7WB 3TZ6A 4I5EA 2II6A 4NNPA 3EVEA 4O2BB 3G0GA 3N2GB 4XLZA 3WHLA 3MAAC 2QUJA 4E13A 1L5GB 3VNSA 1RHUA 5K6AC 3REGA 1NOIA 4TN5A 5JR3A 4MO9A 3WSTA 4F06A 3QSYA 3A06A 5CYOA 1GGKA 3ZE6A 3I1FA 1E1NA 3EIOA 2GPBA 5JS6A 4AG6A 3D4BA 3E7XA 1XWFA 1PIWA 3STVA 1YBAA 5JYBA 4CE5A 1RJGA 2YJGA 2NSJA 4URZR 4Z99A 5P8WA 4H6VA 1RRVA 5BWUA 4LF8B 2AEEA 3UOWA 1QS0B 1J9ZA 1BMDA 5F7JA 3WB0A 5FBRB 2CXHA 1MRNA 1JNXX 4TMVA 3KR0A 2F3RA 1ENZA 2QMZA 3OJFA 4J1SA 3NBZB 2O8FA 2JIMA 1IIRA 4CT0A 1NURA 4Q9AA 3B53X 4PZAA 2ONCA 5E2IA 2YJZA 5KQRA 4G09A 4ALMA 3RIZA 4S0XA 2JH3A 5E6SA 4MCJA 3UB3A 3CLRC 3OH8A 4ARUA 1F2UB 3BS4A 1NFRA 1VPVA 4DLLA 5I4IA 4ENVA 5DAAA 3LX6A 1RCFA 1LBIA 4FS8A 3DDZX 1HE2A 2QSZA 5KTPA 3ISVA 1Y8AA 1WJGA 2Q4OA 3WGHA 1G9XA 3WAKA 3PGXA 3BT7A 5L45A 3N3AC 3MQ2A 1W73A 1F1BA 2RHTA 2Z02A 3TG2A 1CF2O 1PJSA 1VCNA 3JQFC 3FWPA 4QDXA 1YTUA 3VTKA 2BYTA 1TU0A 3SSAA 4XTRA 5LN1A 1TWFA 1S01A 2A5GA 2HDKA 3SBDA 4KO8A 1JDJA 2I2WA 3ZBPA 4EECA 4B3TB 5HDQA 5ALXA 5G4KA 4JI7H 2ZT6A 1SIOA 2BR5A 1SKUA 4BNUA 3EIWA 3PC3A 5IT9W 5KT3A 1ZAKA 3I0ZA 4P22A 1B14A 3NBKA 4RDCA 5ELLA 3FI9A 2W7TA 2IU0A 2WINI 3AR6A 4FBMA 3ZLVA 4GGOA 4M7EA 2J0UA 2PZBA 2O7QA 1XKQA 5AM4A 3WB1A 5F2NA 5ED0A 4EG0A 5CM8B 2E2HA 2V7XA 2WV9A 4OHZA 4B3BA 1HDIA 4JQCA 4ARAA 1I2BA 1L1QA 2O20A 1Y1SA 2FSPA 4ARCA 4G4SO 2IYXA 3MFQA 3O4VA 3UMSA 2E18A 4GC5A 1EP2B 4QSMA 1CVIA 3VSEA 2BMFA 4U7GA 3PR1A 5K20A 1K3TA 5L4NA 1MB9A 3LVBA 2R96A 4XRRA 3U1TA 3EQ2A 4M88A 4CG3A 3ZOZA 4MWZA 2Q6KA 1PZMA 2FJZA 5IHXA 1ZK1A 1FMJA 1Z88A 2Q1SA 1RZUA 2WB1A 2RHHA 3CLSC 3IQXA 1ZH2A 3ESQA 3IUSA 1P1HA 2BQ3A 4U8HA 5TQVA 2V9ZA 2GR9A 2XY4A 3SNOA 3V4OA 4R7GA 3VH1A 3RB4A 3TTVA 5EXXA 4WA7A 2QLTA 2PCJA 1OXKB 2J9FA 1E1LA 1DELA 1JR3A 1JR3D 3KT3A 4UCSA 4G0WA 4KQXA 4TYPA 4DMFA 3WGNA 4LTNA 5I5TA 2Y2VA 1TM5E 2D2XA 3TTTA 4RZXA 3RS0A 1CU1A 3U49A 2QVXX 2X8JA 1Y1WG 1O3YA 4BX3A 1FTWA 2RF4A 1XQYA 1D0IA 1FYDA 4R8UB 1RM5A 3EQ8A 4J49A 1YZHA 2HWWA 4BTEA 1XD9A 2D5AA 2FEMA 3EZ9A 1S97A 3HWWA 3NWJA 2HQ1A 1PQYA 1Y6ZA 4C4AA 3ZLUA 1A98A 1P7YA 3DO5A 5GZ3A 1V3TA 2VYNA 5H3CA 2VYND 3ODGA 1DBPA 4MW5A 1SU7A 2VP5A 3V8VA 3ZGYA 1OH6A 3JAWB 4BP1A 2X4LA 4XGNA 2Z5FA 4BZXA 1Z2PX 2ZJTA 1QH9A 2PGNA 1JSRA 2P9BA 1XNJA 1NXWA 3F7TA 2ZPAA 1ND5A 5CNKA 3CE6A 1U8TA 1AXEA 5ALYA 4UTPA 4A3FG 1ADYA 3IQZA 3R8XA 3O4GA 2QZ9A 5FPKA 3EJ6A 1E98A 2H5LA 4MI1A 3MR3A 3ZK9A 4JUBA 5GPBA 2HQRA 3L1KA 3O26A 5K51A 3P71T 1XDUA 4C4OA 3HI6A 4NRDA 3R5KA 1CKEA 1K0FA 4HNUA 1FX0A 5LZ9A 1CDDA 2YFQA 4K3UA 3KKPA 1Y4SA 4F4JA 2F55A 4CV0A 1SBIA 2HA4A 4LZLA 5EGNA 2AMLA 1Y5LA 4AL4A 1OWPA 4OK6A 3ER9A 3UC9A 4U02A 1GTSA 3TIIA 1CUFA 3M4YA 1BYUA 4DLVA 5EHIA 1XDNA 3GJZA 4ND8B 5IDXA 2X9GA 1YZQA 3V4FA 1IYZA 3L7JA 4S0ZA 5F78A 3GFSA 4DXHA 2XWSA 3BRSA 2RGVA 1CKOA 4F0JA 4Q00A 4L9WA 1N2OA 2H16A 4DB4A 3GZNA 5JHGB 2J0EA 4F9GA 3OKFA 2P1ZA 3O8LA 1IEVA 1KO8A 2ZE7A 4UBIA 2R9VA 5KCMA 2ZBPA 1K75A 5TQ0B 5BV7A 3VR2D 4WH0A 3EXIA 3GLHE 5BSRA 5DLPA 5L53A 5LYJF 4Q3EA 3FZYA 1YHNA 4OHCA 3W6OA 2O8DA 3AF5A 1JNYA 2YQ4A 2EKZA 3IAS1 3VR5H 1IUPA 3BCRA 3LP8A 3AHHA 2OFOA 3E8SA 2OO3A 3C5WP 1X80A 2ZOSA 3LT4A 4PLYA 5A5EA 3R7FA 4FGLA 5DOZA 7ADHA 4F85A 5AXCA 3JZIA 3QVOA 2JGDA 4YHHH 3PNPA 1C8VB 3GIPA 3CEMA 4NONA 1XEXB 2WFLA 4EYOA 2R6GA 1BEZA 1Q74A 2P4UA 4FMDB 1BMFD 2GHIA 3P97A 4LZOA 2ZYVX 3MJEA 3BM5A 4WX2B 2YVKA 2H9YA 2XNDA 2XNDD 4CM8B 1MU0A 5E8JA 3VI4B 3GELA 1F20A 1IOWA 4E31A 5KFCA 3N5KA 1C14A 1RAFA 5BSMA 2JAXA 1IZZA 2KLHA 3BZBA 1QLJA 2OUIA 4KN8A 3PGVA 3R5SA 5IFKA 3PRYA 3JAMW 2NVUA 1FXUA 4L2IA 3GAAA 4HFNA 4BCBA 4CMEA 2KX7A 3KE9A 1NXPA 5IWAB 4QIHA 5KFIA 3MCUA 1TUBA 4C0JA 1FZQA 1BE1A 1S7GA 3BWCA 5CGQB 2HH9A 3PC4A 1M0TA 3D54D 2VF2A 4EB3A 2OILA 4WDQA 1P2BA 3G5LA 5EZSA 4ZJPA 2NTVA 1BRMA 2C4MA 5BW4A 3VUFA 3N28A 1IRXA 4BE4A 5A4FS 1OIWA 1AN7A 1H4TA 1JJ7A 1Y6QA 3ZD8A 5C3UA 1Z15A 1ZD9A 4L51A 1KI8A 1N75A 1B76A 4RJTA 3QBEA 3KWLA 2H2IA 3DD5A 1N2EA 4U9UA 2ZYGA 1GIAA 3ADPA 4E6PA 4H0NA 2WU1A 4JROA 3IESA 1W36C 4L57A 1Z5VA 1DQZA 2GVZC 1E4FT 1D1TA 1XCPA 2Z9CA 1KDPA 1U8FO 3ICWA 4BEWA 3G3EA 1QZ3A 2E4WA 4H0FA 4A91A 3OVMA 2RK3A 2I2XB 5TDHA 1DQPA 3OJXA 2QTMA 4YIKA 4Y2HA 5C9ZA 5F23A 1VI2A 2MMGA 3Q8KA 1G5FA 3B2QA 4YAFA 3LOQA 4WZAA 1DXQA 1Z36A 4UHFA 4B8WA 2J3QA 2Y4RA 2OHFA 2RHOA 4CKBA 3GNLA 3U7GA 4I1YA 3D8UA 4UCFA 4EG3A 4F1WA 4KXXA 5BSTA 4BBAA 5CTJA 4KTTE 3UAVA 3B20A 1JEDA 2YC4C 4MWCA 4N1AA 4HEQA 3MWKA 4PYQA 5GOTA 4MW0A 3WGQA 2NYVA 1YVUA 1Q50A 1VKRA 3OLYA 2HRZA 5A6SB 5ALSA 2C4KA 5IC5A 1GXSA 4TUYA 4DAOA 2PD3A 1T2UA 2XB9A 4X3PA 3GUHA 5EZYA 1NTOA 5KWJA 1P6UA 4FFBB 2ZSBA 2XVAA 4O7ZA 1FTQA 2ZQYA 3NANA 3MC1A 1M8FA 5GJWC 1A9XB 4S35A 5BWWA 3JQAB 4F5EA 2BJHA 1T3ZA 4LRSB 4NU6A 4KAAA 4YRZA 5AW2A 2EW8A 4QBGB 3SLGA 4DV0H 1RLJA 3KKNA 5ETJA 3GCXA 3KFLA 3UZUA 4PLFA 3VJLA 3G6XA 4JKOA 4JKYA 3AWIA 3D31A 4HWRA 1JQJC 1RJWA 5ITSA 1ZVVA 4GU5A 3AVUA 4PBCA 3T7DA 3WZ2A 2F8MA 3NEYA 1GN8A 3QEBZ 3AI3A 1JS1X 1P0IA 1OSNA 3PGMA 4FYXA 1FDRA 2CNWA 1ZIPA 2CNWD 1N9GA 3FRJA 1OFUA 1MZPA 4HPXB 3EZLA 5FOTA 4UFPA 4CTOA 3C3DA 4O86A 4CDRA 1DC5A 1JHZA 1DAGA 4I4NA 2NSHA 3C2QA 4BO0A 1EVZA 2ZXEA 2Q62A 3D8HA 1GUYA 3LZ6A 3C3PA 1C7RA 1J8DA 4JGIA 2JFHA 3OHPA 2ZXFA 4C87A 1SHJA 2PZEA 3NI2A 3GIIA 1CUWA 2FWNA 5KTTA 3A2NA 4JN6B 1CHDA 2AKYA 2I76A 1SMKA 2EIXA 721PA 2GJ4A 1N9ZA 4RKFA 1CR6A 3UJ7A 3ZQJA 1WE2A 2Z9DA 3HKDA 4G63A 4WCFB 4ZD6A 1T2CA 3A6GA 1NY6A 1ZO8A 1CUSA 3DVRX 3JTEA 2K4MA 2WG0A 3IRVA 3R3HA 5L40A 1N1DA 1UPAA 2BBOA 4Q3AA 2MSDB 2RIPA 2GHRA 1OE0A 2G0TA 4P80A 3RSSA 1MJGA 2VSFA 5EIWA 4X6XA 5JXWA 1I0IA 3UW1A 1ZVMA 1PFVA 4LY0A 5E3JA 3N8DA 3PNYA 3GJ7A 3BJZA 2V54A 3O74A 4FK8A 2J8ZA 2OBNA 3VC1A 4HPWA 3SF8B 4MICA 4IFEA 3ZV7A 1UP6A 1B43A 3EZNA 2NTNA 5FR9A 1YT5A 1DOAA 1ZCAA 5F7OA 3SD7A 1EI9A 2XA1A 2CYCA 4O2AF 3DEZA 5A0VA 1OB2A 2D2VA 1TNDA 3GBSA 2FPUA 1H66A 3QRWA 3RNOA 3LBAA 2O2IA 3QOWA 4E1BA 3ESYA 5KOHA 1NXQA 4YK7A 4YBZB 1U3TA 3G6WA 1UM9B 3PT5A 2BH9A 2GAOA 2Q9BA 4URHA 2I91A 5AK3A 3OTIA 5F12A 4DAAA 3N0XA 2QTVB 1E5QA 4MIOA 3LLSA 3RSHA 3N5CA 2AXQA 3GFOA 3PWZA 1E7YA 4MI3A 1ORTA 3FYCA 3G5MA 2J08A 5G40A 3JQ8B 3F4BA 3QIVA 4IIHA 4CIYA 3UT5A 1Z0AA 3A7EA 1LVUA 3QX7A 2X2EA 4HS4A 4IGAA 3CRMA 2Z2IA 1G64A 1Y37A 1I6KA 4OMUA 2P75A 2UVRA 4X6LA 1Z4OA 2IOYA 2QL9A 4H60A 1NY5A 2BMDA 1DGQA 3CBQA 4Z9FA 3P1JA 4YB8A 1NP7A 4XB6B 1TO1E 4D9NA 3MWMA 2QVYX 1AKEA 2HU8A 3D2LA 1FJGH 3FNHA 4XPIA 4DUYH 4W9NC 3GV8B 3B7GA 2UYGA 2NU8B 1GKKA 1QH8A 4RHEA 1XR3A 5J1SB 5KO2A 3AW9A 2V9PA 1GP2A 3KUDA 1TAHA 1CQPA 1Q19A 4BXOB 2X2OA 3GB9A 4KOAA 1O6BA 3FYSA 1YRBA 3PSHA 1QGUA 1JLRA 2JFUA 3LOUA 4JQOA 3LG2A 1TCAA 2GFIA 2JGKA 2O3SA 5AK6A 1KHTA 3I8OA 3PFWO 2AF4C 4K3VA 3NUZA 4MUBA 1VG0B 4XOIA 5C4MA 2AIRA 1ATZA 2JEFA 3NBQA 2OXRA 1UQRA 1FFEA 1Z07A 3PHHA 3Q8SB 2BFEA 3HABA 3NGXA 2AMVA 3KS9A 4II7A 4JASB 4NFYA 3DTGA 4ZVNA 3FDXA 2XGOA 4BVEA 2YWHA 1KTVA 3DTTA 1U2ZA 3D1LA 3AIIA 2HN9A 3HDYA 2R00A 1IY1A 3G2HA 1WPRA 2UXDH 4O4LA 2AUMA 3JZFA 3P9SA 4LSMA 4JBYA 3GG9A 2D7DA 2PANA 3TIGA 2P30A 1MPXA 4OL9A 1LDEA 3DV0A 3FSJX 4ZCQA 4D8UA 4PC2A 3R7DA 4IKEA 3A10A 2QMHA 1ANKA 5J1TB 3HBJA 1V8BA 1BDIA 1CZUA 5GONB 4UVEA 2ZJ1A 4F72A 3EBOA 1ZUIA 1K8ZB 2OD7A 5JWOA 3CF6R 3ASVA 3PVZA 3VDRA 4A27A 4LFAH 4DV7H 4YDQA 1M72A 1G6Q1 1NBIA 2P41A 2W8ZA 2IXBA 1E5DA 3QKIA 2X58A 2J85A 4OJTA 3ZEIA 3QXCA 3RBVA 2V6GA 3H8JA 2HGZA 4R2LA 2WD7A 2UVPA 3K9GA 5AVXA 5B4VA 1YRLA 4UXJA 1B7GO 4ZKEA 3B6KA 1NV9A 5FLXW 1M1UA 2GKSA 2QLFA 4XEHA 3A1FA 1Y9ZA 4NMWA 2ECQA 3UMMA 3G9TA 4UULA 1T91A 2FFJA 1MB3A 4PTYA 4GRAA 3M9XA 3THRA 1HH4A 2X9VA 4BQPA 2FUG6 4C01A 2DGDA 1R00A 2XMDA 5EXDA 5GVSA 1S0MA 4X5OA 3OEHA 3OEHD 5EEHA 3DBOB 1HR0B 4DMKA 3RYFB 1MABA 3P9NA 2QTCA 3FMPB 1EQ2A 2RSLA 1MCZA 2OQIA 3A70A 3W8FA 2QMYA 1QQBA 3PC8A 3GVCA 4V1CB 3L7IA 3OUZA 1Q21A 2GBLA 4OYHA 4O4IF 1DQYA 2BGKA 5DISB 5K4HA 1L5FA 3TD9A 3NKVA 1V43A 4A3KG 2EFGA 1B6SA 1N32H 3RVMA 1YKSA 3R7LA 5KOIA 2PBLA 1I6MA 2P8JA 4R83A 4L78A 1DLIA 5BSKA 1P29A 3L7AA 2WWHA 4FSHA 3OZFA 4WK6A 1P3Y1 3DJFA 2CJWA 1NT2A 4RD1A 3EEOA 4DW8A 5JNSA 1SOWA 3FFAA 4APMA 4B6OA 1E7RA 1ONSA 1L7QA 1PS9A 2DFPA 2VJOA 1PX0A 1V37A 3LKVA 3TRJA 2I55A 4G9EA 5JANA 3GDGA 5KFKA 4KI7A 1L4UA 3L6EA 2HLDA 2ATEA 3ICEA 1A0IA 5DOVA 3BFXA 5EPOA 2CLHB 2W2XA 1HRKA 4WECA 2GEUA 4JX8A 3ERCA 4K6KA 2N42A 2Z0MA 1TM1E 4TS4A 4FX2A 3TI9A 3SM9A 4DHEA 3E4CA 3UGKA 3EAFA 2AUNA 2NTEA 4WFKA 3F7NA 1I3OA 3G2IA 1SC1A 4F8YA 3Q40A 3QG5A 4ZC8A 2EYQA 5LDHA 3AWDA 1UPBA 1CLUA 2PSJA 3BH7A 3HKEB 3KYBA 4EA9A 1L5QA 2ETXA 1Z4PX 1C0KA 2WJGA 1ISJA 2WF7A 1SN7A 2GYWA 2RONA 3HE3A 4B3XA 4DEXA 5EMJA 3ZXIA 3JZDA 3A4TA 4M1SA 1MNAA 2ECKA 2LDXA 5FUWA 5HQ3A 4LISA 5EUBA 1U0NA 1OVGA 1WXGA 1SM4A 4O3PA 3U1VA 3PZPA 2C04A 2LR0A 4X8LA 4NE2A 4BMXA 3P0HA 3ESDA 3Q7EA 3H2BA 3DBRB 2HT6A 5AD1A 2G40A 3ABOB 1UK7A 4DG5A 5A9SB 5IT0A 2HGSA 4IV5A 3T52A 4CIBA 3ZD6A 2IYAA 3KAPA 1IVNA 4MYUA 4X24A 3PF8A 4AZ3B 3ENKA 1LPPA 2GCOB 1PTKA 1I6LA 1WZEA 5C8YA 2E49A 4EITA 4R16A 1JX6A 1Z5GA 2OFWA 5DT2A 3BQ0A 2JNWA 3P2KA 1IYEA 3E1SA 4J29A 4AN0A 2CBZA 1FDUA 3TEJA 3CQ9A 1WCMA 3WHPA 1D8TA 4RTNA 4I9HA 3MT8A 1XZDA 2HSGA 3PGA1 2HMTA 4LXIA 1ZD4A 1V3QE 1HYEA 5FTLA 3EFEA 3IE0A 4D6PA 4MIKA 1NTRA 1P16A 3V3TA 1K5GA 4HB3A 1Z2CA 3VO9A 3SJCA 3U6KA 3AHDA 3ZBQA 3FPFA 4B1FA 2VIIA 3KYCA 1VLJA 1PZGA 1KRHA 3ZVKA 3M7IA 4DV5H 2CDRA 3HR4A 3A6DA 1OTHA 4AZTA 4EG8A 1V16B 3UTDA 1KKMA 5FD5A 2JD2A 3DMGA 3KJHA 1EGVB 3KQOA 3TO5A 4OP2A 4FQ7A 4P58A 1DAIA 4QU9A 2QRZA 2XB6A 5AVRA 3QQPA 3TJMA 2CHEA 1NBAA 2JEIA 2A67A 1IM8A 3OZRA 4ETWA 4QTZA 4RFSB 1RYEA 1JKXA 1U3GA 4KQ9A 4HTFA 1JHYA 4TLAA 2QW8A 4M89A 3CCFA 1SCNE 2VF7A 5K3FA 2QT9A 4LF8H 4UUAA 2J3EA 4YAUA 4RQBA 1UFVA 2XV1A 4I1OA 1JSXA 3TTSA 1XTPA 4I55A 4P5EA 2CJYA 2F1RA 3N75A 1YGPA 4Y2SA 2FH5B 1Y5NA 5AOCA 4FGJA 2V97A 4J16C 2HMUA 5JE8A 2Z83A 1J6UA 3HOZG 1Z3CA 3O4IA 3KQQA 1JHRA 3LE8A 4ZTBA 2W8KA 3ML1A 2OHOA 4UMFA 2IXDA 2VJLA 3EXAA 4DADA 2COGA 4RLSA 3Q3EA 2E5LH 1D6JA 4LFBB 5EPEA 5AK4A 3G5AA 3X1DA 3LC1O 1TPZA 1PGOA 5BNIA 5JDCC 1BWSA 4WK4B 5JJBA 3KU1A 1H8EA 1Z4MA 4X7BA 2QD4A 5KG2A 1TKBA 5KYXB 4KQHA 3DG9A 3A3YA 3GJSA 4OFXA 3K5WA 1PJAA 1R9JA 4RZIA 1O9HA 4RAYA 3RKUA 5DE3A 1TQ2A 1EUDB 2O14A 5HF6A 3R5XA 1PVVA 2B2NA 3C6MA 4N6OA 1DEHA 1QO0A 2Z9BA 3IVAA 3USZA 1JVBA 5E6UB 4F3KA 4X62H 2R68A 3E9DA 2IU4A 5IYZF 16PKA 1XP8A 3VDXA 3DDUA 4O7VA 4GX1A 1VL2A 3ID6C 1KXJA 1E0KA 1AQYA 3P9KA 1J8YF 3RC3A 4D8YA 4J4HA 1S1MA 2C94A 3ZHRA 2PGLA 1Z5ZA 2ZIAA 1HZJA 4MITA 2AWNA 5H4GA 1FW6A 1YMQA 2IPAB 3C7KA 5CTAA 3TY5A 2A5FA 4JYPA 3EOZA 1Y3DE 5CK4A 4ONEA 3VUEA 1RW4A 1B16A 3TR5A 5BN4B 5AVUA 2QN7A 3HTXA 5I4BA 3P2IA 3NZEA 1O95C 3FDZB 2Z3WA 4XIYA 4J94A 3W06A 4D9KA 3NC0C 1P77A 3HP4A 1ESZA 3DQPA 3E9ZA 3WDKA 2PGXA 4KPEC 1EFHA 4M54A 4IGFA 3MTDA 1GFIA 1QC5B 2WM9B 3GPLA 1D8AA 1LKZA 3WIUA 4CW7A 2H48A 1FSGA 1NBMD 2CXOA 5KTSA 3ZI7A 2B1RA 4XD7A 1I5RA 4XD7D 5JZSA 2IYPA 3WY9A 2ZVQX 1O57A 3FOWA 3ZKAA 1H9AA 1UPCA 4RANA 1HKUA 2MYPA 2DOKA 1VP3A 3D6UA 1VSVA 4J0GA 1SBZA 3TW6A 3EEFA 1XDBA 1U3DA 1P9RA 1KQGA 1TD9A 1E9DA 4C05A 3OZVA 4Y0NA 3V6HA 3QJGA 4GH5A 3FW1A 1M83A 5DQHA 2Q6TA 4AROA 5JRZA 2MSCB 4KQ2A 3VA7A 2ZUDA 4YJHB 3EVGA 3RS3A 1FRVA 1RXCA 3KOWA 3L6CA 2RKOA 1X70A 4P8RA 4P3KA 1JH8A 3TLJA 1IXRC 5JUMA 4E4TA 2XE4A 1C3EA 1OI3A 2FN3A 4CM4A 3DE5X 2XI4A 3IBSA 4KWHA 2DECA 3I64A 3Q4GA 4CN9A 2GZ2A 4WLEA 1CY2A 5CH8A 4UTNA 2DH6A 1ORWA 5HEKA 2YRWA 1WOMA 4MPDA 2AD1A 3IIKA 3C6KA 4IZ6A 5LZ2A 3NM5A 1U0LA 1K5PA 4U00A 2WWWA 4PXAA 1UBUS 4KV9A 4ZOAA 1PWXA 5EHQA 4YT4A 4B46A 2QL6A 4KSBA 1FRNA 1LLUA 5EIOA 4MA0A 3PFIA 3RSCA 3I5AA 2H4FA 2ZIZA 3HSKA 1L1FA 4PICA 3LO5A 1WR2A 1NVWQ 3FVVA 1TU3A 1CJTC 3P9XA 4LV8B 1E3TA 3SR0A 4YRFA 5H5JA 2D7CA 2EWMA 1HOTA 5DO9A 2YOFA 4EO7A 5BWLA 3HL4A 2WF8A 3ZJ5A 1QMGA 4HB2A 1Z0ZA 4YH1A 5AKIA 4GPTA 1Q1QA 4TMTA 3VKUA 1U94A 4F93B 4JGGA 1R5JA 5BMVB 4G89A 1RYSA 4Q03A 3BD7A 4A36A 3DULA 1YC2A 1K6JA 2FFBA 4KREA 2ODBA 1NATA 4BKPA 2C2GA 2QTGA 2UZ3A 5L3QA 1J09A 2GYVA 2ZSKA 4JY7A 4JVLA 4QGAA 3V9AA 1EUCA 3DKPA 4YP7A 4IDCA 5H8WA 2IXTA 2ZANA 1XWWA 1RIFA 2R48A 3U16A 5A2QA 1QYRA 2X2PA 1IJKA 1VPEA 4U7DA 4YI5A 4C7OA 2KWIA 3MGGA 3CZQA 3IURA 4PINA 3CSSA 2WG2A 5JD5A 3W9BA 1Z6GA 3MRTA 3HCBA 3A2LA 4PYLA 3MMZA 3LHDA 3ZHVA 3HVUA 5DTEA 2GAIA 4JKIA 1DBSA 4XDGA 2J9RA 2PKCA 5ITVA 5KNBH 4OQZA 4G4JA 1ZJWA 1I0ZA 1PJZA 1ESMA 4U7CA 1T2NA 1YK1A 1VFPA 3JRWA 3BQ2A 3II6X 4RU9A 3CZ9A 3TCXB 4W5WA 4E2YA 4MDFA 1I8TA 1A8IA 2BISA 1F7UA 4BNZA 4N5IX 4QUEA 5E4FA 2F9LA 2DP4E 4X90A 2B4AA 3AVPA 5JVLA 4EX6A 5COQA 4PZCA 4QRHA 2NO6A 3G5UA 4MEBA 1MEJA 4HXFB 3H0CA 1BHSA 3ZY5A 1YUBA 3LF2A 5FWNA 4YROA 1JQKA 3WNZA 1CFZA 3PQ7A 3DCNA 1H3FA 1K1EA 4RHYA 4XM2A 4EJ0A 3HG7A 2JGAA 1GCUA 1TDJA 2YY5A 4M4SA 3PW4A 2RG7A 2QJOA 4JNCA 4KIUA 2YZKA 4EI7A 5BWOA 1T1JA 3UKDA 2DLDA 2JKZA 4A4DA 4QREA 4H7EA 4JI1H 1A2OA 3ZDEA 2QSJA 2CD9A 5KAPA 2W57A 4U63A 2A1TR 3REOA 3PQ2A 2QMOA 3PUXA 4MK4A 1Q7CA 1QOZA 4LZNA 3OPVA 1H6CA 4CCSA 2QN2A 3GEPA 2QG6A 3AFNA 2ZBQA 4GYKA 5DRTA 1WX1A 3BK7A 4BZZA 1GSIA 1NZFA 3SS7X 2XTAA 4A6XA 4UM9D 4ZOCA 5IX8A 2BDUA 3EZFA 3ZJTA 1U02A 5TSDA 9GPBA 5ALHA 1GRCA 5AW7A 4D7AA 4A8JB 1E2EA 2IA5A 1EWRA 1N0VC 3M81A 1CS0A 4X6UA 4C1BA 2GLXA 4BAGA 2NU9A 4B3MH 5KKNB 2ZWPA 1BXRA 2O8EA 1S02A 4X9XA 1XA3A 4BFVA 1G2IA 1V48A 2VQEH 2JEJA 4YT5A 4K9SA 4MA4A 1GL7A 4ZAWA 4CLHA 3KXDA 5I5EA 1ORVA 4P3XA 4ZO8A 4X93A 1J23A 5GGYA 4P31A 2PJRA 2FPIB 4TTRA 3GILA 2WSSD 5HKOA 2D4AA 4V0NA 4EUHA 3OFSA 3OCCA 1QVAA 4AJPA 1HETA 5CDUA 1SAYA 1I3MA 4JH0A 5H16A 3PW7A 2YWDA 2Q5QA 1SUPA 3S5UA 2Y8EA 3S40A 1U2EA 1AK9A 1H9BA 5J2UF 1TQ4A 2HJHA 3VPGA 2XE6A 4Y7CA 3ELBA 3DBVO 3AHJA 3KWFA 3BXEA 2I3BA 2JIPA 3NNSA 5C18A 4V2UA 1VYUA 4MQEA 5BWTA 1W4LA 1JDTA 4PC7A 4ABTA 1LX7A 2XVMA 2W2TA 1SOVA 2RGUA 4EJSB 5NLLA 2BQUA 2VDOB 1SBTA 1O4WA 3QNWA 3PFCA 4IIBA 4NC9A 3AU9A 2HLHA 1SKYB 2E7ZA 4H7HA 3FPSA 1SBCA 3HU1A 1NW5A 3COWA 4GSKA 4QXPA 5DNCA 1TCBA 5AI0A 2G7ZA 3E03A 3WB9A 1MX3A 3FGPA 1TX4B 3BSWA 4LJSA 4RGQA 3OQMA 4YT2A 1J7KA 1DG9A 3W6PA 4TV8F 3TK1A 3ZQKA 3M49A 1UPUA 2YV4A 3EGWA 3UHPA 1AS2A 3KJFA 4ZIRA 1YS1X 4XSVA 4NE7A 5K6AA 2R92A 3Q7RA 4FX5A 1RAAA 3EZYA 5SYNA 5A4AA 5KG6A 2RAUA 5T6MA 3PUKA 4AD8A 1LFAA 1RFLA 4OI0A 5KTMA 1Z6XA 4YUWA 1OD6A 3I2IA 2XQGA 3BB4A 2VJBA 5LU8A 2LKDA 2ZCJA 1EFCA 3BL8A 4HEHA 1LS6A 2FR8C 3V4PB 4EKEA 3M70A 1EBUA 1ZRMA 2OH2A 3K20A 4DQNA 3C16C 4CLDA 3T7RA 4BMSA 4YRCA 4EPVA 3LX4A 3QI2A 2V4MA 1KEVA 1DAPA 1XRSB 4BVJA 5IJ9B 1BN6A 5HIKA 4Q39A 3AKEA 3NWBA 4XARA 4H7KA 1N7GA 3VZCA 3N2ZB 3NORA 3CLRD 4Y8VA 3GH3A 1Q1GA 3DOIA 3U31A 5K8IA 1LNSA 1SVOA 1GFZA 1GG8A 4A3CG 3QMMA 1KAQA 2WC1A 5J43A 5CXXA 4F2WA 3ANTA 5D3KA 3HJTA 2QRPA 4Q5IA 2ZGIA 1MXHA 4F5YA 1T4CA 4DT1B 2JARA 4YBRA 3K1AB 4Y1EA 5H3HA 1PW5A 5BQPA 2OCKA 4LNUB 4IILA 4XGRA 4D46A 5SZHB 4G0ZA 1NQ5A 4QNNA 3RUFA 2OE2A 3JQFA 1OGYA 3Q3VA 1WB9A 1U2QA 4TTQA 4II3A 4YDHB 4EARA 1MV8A 4WIAA 4XD2A 3N58A 5JWRA 1Y8QA 2VHVA 3U3OA 4Y67A 3T7CA 1FVIA 1J56A 3DBLB 3GD7A 3PTZA 5HNKA 2I1VB 4X65B 3W7AA 1KJIA 1BVUA 2F1KA 4TV9A 3NHAA 4A3MG 2YJ4A 5CR9A 1MX1A 5JAOA 4X20B 2IGBA 3EASA 4OHYA 4LOAA 4WLFA 3M5PA 3DOOA 1V26A 4L50A 1WZCA 3I4MG 5CVUA 2X9QA 3B6ZA 2EQBA 2V5VA 5I47A 3BQ9A 3QYAA 5DTJA 1OA0A 1R4NA 1LW6E 4C6RA 1EQAA 4POAA 2XWQA 4FD3A 4Q4DA 3TOCA 2O1SA 3C3AA 3ZY4A 5B1SA 6REQA 4RKYA 4W5QA 2NPOA 3JD0A 2X5XA 2B4QA 4UCVA 4LC1A 4RM2A 1JJFA 1KZ4A 5B2EA 4Q0YA 3QA3E 4ED8A 4B3JA 1P8JA 3ZR4B 1ZBDA 2OZEA 2JAPA 5BR4A 3MLAA 2ZRHA 2RI6A 2R7MA 4EL0A 1WA5A 4UM5A 3OJWA 1KDTA 2EJ3A 4DNQA 2X3FA 2WJHA 3GCGA 4YR7A 3DEHA 3PUIA 1AKWA 1VBHA 3EYYA 1DKLA 4KACA 4ZK6A 2PAFA 5D51S 2BFPA 5BRNA 1CTQA 3MTIA 3HKZE 2HHFA 5DNEA 4AG5A 1V7PC 4CKCA 1IE3A 3GFFA 1V9PA 2Y0EA 2O2HA 4QJ3A 3Q3JB 5INTA 4KL8S 3QWAA 2YJ3A 2RHLA 1C3OB 2J31A 3B60A 2OV2A 3T38A 4DRXB 4C9BA 2IITA 4UU0A 1YJ8A 5J4LA 1FP1D 2P6RA 4O82A 1Y1KE 3I28A 1CEQA 3R24A 1DTEA 1E4GT 4XWGA 1N5KA 5JASA 1K9SA 2KB0A 3BXHA 4Q43A 1YBMA 5ALNA 2D1RA 2ZJZA 3FR7A 2XBLA 4EFKA 4U7WA 2N1BA 3BSFA 1SU6A 4JOQA 2LZ0A 2FLPA 1JBQA 1BNCA 1TZKA 3R7WA 2ZPUA 1NI4A 4W5JA 2FUCA 5TJ9A 2FJUA 1JA1A 1J0AA 4PBSA 3LP6A 3DWEX 3W1WA 1V1MA 5U4XA 4FI3C 3GZ4A 3OFNA 3OFND 4HFRA 5F1YA 1MJGM 3OOWA 1G3MA 3W5VA 4QWBA 4NDZA 5LZ4A 1J5PA 4RB0A 2QD1A 4H35A 5LP6C 2C5LA 4RULA 2YUTA 4D99A 4MS4A 1B8OA 1M5RA 3KL4A 2QX6A 3COZA 4Q0MA 3L8FA 4FWBA 4LYAA 3W1GA 4C6HA 4QU0A 4B0OA 4CQMB 1J2EA 4PSAA 3PDUA 2H4YA 1I7DA 1ZKMA 4G8DA 1W581 5JJKA 5AM0A 2OLSA 4R8RA 1N6KA 2BF4A 4HNQA 2RGWA 3JX9A 1SA0A 4DPKA 1ETUA 2XCOA 4L5IA 1WM1A 4F2DA 5IT5A 2Y93A 3IR7A 3SNHA 1I14A 5JSUA 2ZJ6A 5BQ3A 4MVJM 2ZTLA 3UW3A 2IE8A 1OYWA 4DLUA 3B1FA 1GPKA 4HADA 4PW0A 3RBZA 1A71A 2G4LA 1NVDA 4RKEA 5DK4A 2H1CA 4ZOLA 5L3SA 3FLMA 1I1KA 3ZKWA 1X1TA 1ZIOA 1PQPA 3B1JA 3ND9A 2C9OA 3CX8A 4CMHA 1XMPA 4GWLA 3ORQA 4HEJA 5FPRA 2VJAA 3D6NB 3E3NA 5J3JA 621PA 4UUNA 2OTCA 5DPMA 3IE1A 1YFJA 1VGQA 3OQIA 4ETMA 4ZVOA 4QQ8A 3O3CA 4XIGS 1DB3A 4GXTA 3H0GG 4YECA 5TGTA 1X1DA 4Q16A 4XRGA 3AM4A 5KPJA 1ULTA 3KLNA 2WICA 2LD4A 1J97A 4BQEA 1P9OA 1R4ZA 4IHJA 5KSOA 2A1HA 4UZSA 4J76A 1UMDA 3G9UA 4Q7QA 2JATA 1SUEA 3GRCA 2JH9A 4GOND 4COKA 4A2WA 1SUFA 3VJRA 1ETHA 3TUZC 2FRXA 4Z0PA 4M7WA 5KKCA 4GI1A 3CY6A 3SFTA 3JARB 3NDJA 2CW7A 1Z2AA 5ALVA 4FHGA 2V1UA 1BQ4A 1RC0A 4BFWA 2CLEB 3E5NA 5TGDA 5KTYA 1S0NA 4EAQA 3JQ9C 3T1HB 3K0CC 1R4MB 4V0SA 3IE2A 4OIFA 4E5YA 1K3FA 1K6XA 4NENA 3VDQA 1L5NA 1TIKA 4CEJA 2P4EA 1YS2X 4B81A 3SXUB 3CZ5A 1PK9A 2G36A 2EAUA 4DJJA 2Z4SA 4D25A 2H08A 4I4TB 1E9EA 5HIMA 5B6PA 1XUOA 2FQXA 1M9NA 2X3UA 3SHVA 3U3ZA 1DTWB 1EP1B 5H9VA 4IDAA 1R64A 1R12A 1SB9A 4OQDA 2C8KA 3L04A 4IWNA 4Y2JA 4Q15A 1UJ2A 2YCLA 1Q3HA 1MOPA 1XMQB 2I22A 4MIYA 2XGJA 3ZVNA 3T5JA 3IP6A 2BEKA 3C6YA 3BKWA 1RJQA 3OOJA 3VTFA 1W36D 2M05A 3AH8A 9ATCA 2XADA 3WWZA 1DZIA 2BFFB 4YMTA 2YS7A 5HRAA 1MW9X 1KEKA 1DIOB 4RYLA 4JBWA 2WWTA 5COAA 1YASA 4QICA 1GITA 3O38A 1DEAA 4LX0A 1G0NA 1VHJA 1DWQA 3UOGA 4ZVUA 6YASA 4DARA 2V7EA 4D9MA 5LXTB 1BDMA 1WULS 2I3DA 3E9CA 3ZTWA 4A93G 1QGED 3I5YA 3LRPA 3OUUA 4K9KA 2H2FA 1C30A 3PCTA 2NZUG 4D43A 2O6LA 3UHOA 2ZUCA 5A0TA 3TPFA 5CT4A 3WLPA 3I73A 3L8MA 1ECJA 2WT8A 2CJFA 3DFFA 5AI9A 2UZIR 1C1DA 2OG1A 2ZG6A 3GFPA 4LHZA 3Q9LA 5K0CA 4N8SA 2KPOA 2BBSA 1AZWA 2CN1A 3T06B 3TMAA 5HMMA 1GQ2A 5DB4A 1QE5A 1MLDA 1HNZB 4LYJA 1NVFA 2Y6VA 3Q8XB 4NEGA 1AV6A 3RU9A 1GUZA 1OBHA 4OO3A 2XUDA 1RPAA 5K4GA 5KFYA 2QL7A 3EB9A 2O2GA 4MUEA 4Y0AA 4DLWA 4NMLA 3K72B 1KFJB 3L1HA 2F4VB 2BGTA 5JG7A 1OMOA 1K7XB 4OGFA 2G9ZA 2FMKA 4BN0A 3FMOB 4IIGA 3IRUA 1OCEA 1E4VA 1E32A 2YYAA 4I6GA 2WUWE 3KAKA 5D3MA 1CDOA 4YP5A 3LCUA 2HPVA 2I9PA 1W5SA 1TXGA 4KUGA 3GG2A 3DZBA 4ZT4A 4FMBB 3NVAA 3OTHA 1V25A 4AURA 2OB2A 3SIWA 4G2TA 1F0YA 1IN7A 5KFWA 2XCQA 1CFJA 4G1BA 3JASB 3B3AA 4OREX 2CVZA 5HZGA 4QYWA 3HHPA 2JA1A 2YVQA 1WNTA 4JMLA 2C3UA 5LZ5A 1DQNA 4L73A 3PICA 3GLHB 4HJRA 5BUCA 2ZE8A 3U3XA 3MERA 2I2BA 3AFGA 1WTAA 4YAWA 2G76A 4K9MA 2YIJA 3LUCA 4IXTA 3AVXA 2DUMA 3BGOS 1FRFS 5E3HA 4HYKA 3H2YA 1ZHFA 1TYAE 3AKZA 4MSUA 3MSXA 2DAPA 2IZOA 4LJ6A 2R2AA 2V4QA 4P98A 1EUQA 3HXQA 2BZ0A 5B5SA 2QRLA 5HP4A 3K9HA 4YLEA 2NAPA 3UANA 4AJOA 3TVDA 2O8CB 2XPCA 5I6DA 4FYYA 1QKJA 3PXCX 4OU5A 2OOKA 2BEVB 3ZH2A 5E1OA 2H7CA 3VU8A 4AAYA 5BQXA 4HQ0A 2NO1A 5K3WA 5KJFA 4I55F 3ORSA 4OX9Y 1UK9A 5DHUA 2JGIA 4LAFA 1T0UA 2EDAA 2GHQA 3BMXA 1IBLB 4MVJA 4MVJD 4I1SA 4W5RA 2DT8A 2FU5C 3RS9A 1VCOA 3K16A 4J3NA 5K2OA 2QG9A 1E2HA 3N0RA 2FRDC 5LUBA 4B4KA 2CVPA 4BHTA 4N40A 2XNHA 3FRIA 1N4AA 1JLLB 1HT1E 4BVBA 3K3PA 5KYWA 3F6YA 1O9BA 5T3UA 5T64A 3GMTA 3BHNA 3ZHQA 4XWKA 4I99A 1DIKA 4Y2GA 4JJAA 1CUBA 4MDEA 4GLWA 4JA2A 2I8CA 2EJCA 3W5OA 5JPDA 2ZIFA 2FFAA 1PZEA 3SKYA 3L18A 1S2IA 4QTYA 4R9UC 1DJNA 3WGJA 5AVWA 4JDUA 4RMIA 5KFTA 1DEXA 2WFMA 4V3CA 4Z7JA 4KRXA 1CIJA 4Q9DA 5KPDA 3E22B 3RWOA 2Z4TA 3IUEA 3OHBA 1GUBA 4D6XA 1P0FA 2YHUA 3CEAA 1Z16A 1CRWG 1QFSA 1AT1A 4JP8A 4XJSA 2F8LA 2X3YA 2M1XA 2ENUA 3FXAA 4W9NA 2XUKA 4E5DA 3O3OB 3L7YA 4TL9A 2X22A 2R7NA 4F3CA 3O0TA 5EE0A 3TEKA 4L8YA 1OREA 1QIMA 4DCUA 1E99A 4X1YA 1K92A 4HD8A 3LFUA 1QPBA 1B74A 3GJ0A 3I8XA 4L9RA 3NRBA 1J25A 4CHGA 4MJXA 3K1JA 2DPYA 3LXUX 2PR2A 3OICA 1SRQA 4B2IA 2JGMA 3BD9A 4YEDA 1DAAA 4ZOBA 4PSKA 1ESEA 1R8XA 2RMKA 1MHPA 5JI2E 4YX9A 4O5OA 4U8GA 3NBMA 3USCS 3T7IA 3U54A 4JX9A 2R1UA 1NKVA 2WZBA 3QA9A 2GTPA 4Q4CA 5HE9A 2BI7A 1RJ9B 1SC9A 2E21A 4B35A 2FK8A 1R18A 1R10A 1KVQA 4HQLA 4KIWA 4BWFB 3QM1A 3CUKA 2BUCA 3PZBA 2POCA 5KFFA 4PY2A 2QROA 1KSFX 1DXYA 1D5CA 1CJCA 1VCMA 4C2UA 1E6UA 2Q8PA 5EWFA 4XDZA 4EEZA 1YJ5A 5CFPA 4B3SH 2FLVA 3E8MA 2HHCA 1EAYA 2WMDA 1EJ2A 3A1SA 3T7TA 2RGBA 3FBGA 3ZI4A 3SS9X 1UQUA 3AINA 5DX8A 2ZEJA 2RBKA 2J6SA 1W8DA 3G1WA 3DZHA 1J8FA 3VVCA 4POOA 4V39A 1YOBA 3PGKA 3QLJA 1XPUA 5CA1F 4I1VA 4AJ2A 2YHSA 3D2CA 1SIWA 5K0BA 4NESA 1YIAA 2P90A 3PPIA 4KIGA 1PHPA 3FGOA 2AGQA 1OR8A 3ESBA 2C97A 2C98A 1XXHE 3EYWA 2EJTA 4QYXA 5AVSA 2FZLA 3WI7A 1CV2A 3ZQ4A 2BGLA 1VBFA <