3ETJA

Crystal structure e. coli purk in complex with mg, adp, and pi
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3etjA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3etjA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3etjA01
2R6FA 1E4EA 4O84A 3TINA 2VR1A 5IYZF 2PBZA 2V58A 5I47A 2VQDA 4WBNF 4RZQA 2NU6B 4IHJF 2YZGA 3JRXA 2YL2A 4EABA 3Q1KA 4TUYF 3V4SA 1EHIA 4O4HF 2I8CA 2W6OA 4MV1A 5HV6A 3I12A 3MWEA 4J6EA 2X0SA 3RV3A 4O4LF 1VKZA 1E4EB 3N8DA 3KAJA 2HGSA 3N6RA 3G8CA 3GIDA 2W6PA 4IZOA 2R7MA 2YW2A 1JDEA 2W6ZA 1M0WA 1M6VA 4WD3A 2YRXA 1AUVA 2W70A 4M9CA 2Z04A 4FFLA 1KJ9A 2I87A 3RUPA 4O7NA 5LXTF 4ZI7F 4O7WA 4MV9A 3U54A 4MAMA 4DIMA 3G8DA 4MV6A 3JZIA 3ORRA 1PK8A 3QFFA 4HNVA 1CE8A 4IIJF 2WYOA 4O7ZA 2P0AA 4L1KA 4EA9A 1A48A 2GPWA 1BXRA 1BNCA 4XX0B 3VA7A 1GSOA 4O83A 1B6SA 4TV9F 2DLNA 4HQ6A 5CAEB 4YBZB 1KJIA 3E5NA 3U9TA 5HBRB 3R9RA 5LYJF 2NU9B 2W6NA 2CNQA 4O2AF 2VPQA 5DMXA 2CQYA 1SCUB 4O4IF 5BPFA 4O86A 4Y8VB 3K5IA 3ETHA 1KEEA 1DV2A 2SCUB 1DIKA 2YZNA 3WO1A 4FU0A 4FFPA 2FP4B 1IOWA 3LWBA 2Z02A 4MV3A 5JH7F 3BSSA 4O2BF 5J2UF 2XCLA 3VPBA 4ZOLF 2OLSA 2YZLA 4MV4A 4O4JF 2DIKA 2R7NA 2R7LA 2C00A 4XYLB 1IOVA 1GLVA 4XZ3B 3VPCA 5JQWA 1CQIB 2YS7A 3BSWA 5JVDF 2V59A 4TV8F 2PN1A 4O7VA 4I4TF 2YZMA 4I50F 2DZDA 3RV4A 1Z2NX 1OBGA 4MV7A 4EAAA 2CZGA 1A9XA 5LP6F 1EUDB 5C8YF 1KUTA 2QF7A 2W6QA 4NYEA 2XD4A 3TIIA 3LP8A 1JKJB 1VBGA 5FNVF 1T36A 3BG5A 3R5HA 2FPIB 2J9GA 3BFPA 5J2TF 3VOTA 5CB4F 2FB9A 1GSHA 1B6RA 2ZDQA 4FFMA 4M98A 1CQJB 1VBHA 4ME6A 2IP4A 2GLTA 2ZDHA 5CA0F 3RFCA 4O7SA 3JRWA 4I55F 1KJ8A 3OUZA 4HR7A 4EA7A 5JQGF 2GPSA 4DLKA 4EA8A 1Z2PX 5H80A 4YAJB 4XYMB 3AW8A 4FE2A 2FPGB 4GGMX 3KREA 1ULZA 2GQRA 4ZHQF 4ZQIA 3NUAA 2R86A 2CNUA 2QK4A 2R85A 2YYAA 3R5XA 4YJ2F 3R23A 5KKNB 4MA5A 2CNVA 4MA0A 2NUAB 1WR2A 5D8DA 1KJJA 3Q2OA 1C3OA 1GSAA 3HO8A 1AUXA 1M0TA 4HNTA 1JLLB 2R7KA 4HNUA 5BPHA 3KAKA 4O81A 3TW6A 3MWDA 3U9SA 2NU8B 5LOVF 4YAKB 2W71A 4O7TA 4C5AA 2YS6A 2HJWA 3WNZA 4M9UA 4C5CA 2YRWA 4O7YA 2R84A 3BSYA 5C1OA 5LA6F 4FFRA 2PVPA 1CS0A 5K2MA 4IWXA 2FPPB 3ETJA 1Z2OX 1EYZA 5JVLA 1JDBB 4EGJA 3VMMA 3U55A 4YJ3F 1OBDA 5C1PA 4O82A 1PX2A 3SE7A 4EG0A 3GLKA 3K3PA 1DV1A 5EZYF 1EZ1A 3DF7A 3KALA 4FFNA 4YB8B 3HB9A 1I7NA 4E4TA 5KX5F 2R87A 3WO0A 2NU7B 3OUUA 2YWVA 3MJFA 4EGQA 2V5AA 3R5FA 4FGRA 2DWCA 3UFXB 1C30A 3V4ZA 1W93A 2R82A 5GONF 1W96A 1I7LA 5CA1F 4IWYA 3K5HA 4MV8A 2VHEA 4FFOA 3AX6A 4QSHA 3TIGA 3VPDA 1KBLA 3HBLA 1EUCB 1GGOA 2W6MA 3JZFA 1KC7A 3TQTA 4O7LA 3ORQA 2NPOA 1UC8A 2ZDGA 5BMVF 2I80A 1UC9A 4O7RA 1KJQA 4M99A 2GQSA 4C5BA
chains in the Genus database with same CATH superfamily
3IEMA 4Q82A 1LTKA 2V4RA 2BELA 1R3DA 3AHEA 1K8YB 3OJFA 4U6QA 4CL0A 3VGJA 3BWDD 3IC5A 5HWSA 2HOQA 4FDTA 4M0EA 4N49A 4CLDA 2J6CA 2WG2A 1BJTA 4ND6A 4XB2A 5F2OA 2GYVA 1QQAA 3SVLA 3QMPA 4X7BA 3WQHA 3D5QA 1M6VB 4TS1A 1T2AA 3WMWA 1GNRA 1J1UA 3Q8XB 3LBIA 5BWNA 5CW2A 3KYDB 2FJUA 2VAWA 1EJ0A 4G65A 4MGIR 3PNSA 4WY8A 2I2BA 4OLHA 4BJ1A 1Y7LA 1GITA 4BNDA 4AY2A 1ZM7A 3IN5A 2QLTA 2NVYA 2NV6A 3FBTA 3EUWA 2C9CA 3PF8A 5AK3A 3RS5A 4AY4A 4TV9B 1XOIA 5KIAA 1A98A 3BHMA 3LG2A 5JAOA 1DELA 5LMZA 4B7UA 1X8KA 3KPJA 4OMUA 4R2WA 3WHLA 1SBCA 2DUWA 5DN9A 1II0A 4R2KA 4G5OA 4CTJA 3K05A 4AQYH 5AVUA 3K2BA 4QGAA 3EPIA 1D5CA 2H2DA 1OLXA 4ED1A 4AC9A 2ZYTX 1QJ4A 2VUGA 4DV7H 1NSYA 3H2IA 4I81A 1UWKA 4LC9A 4RTLA 1T6YA 1RT9A 2HC9A 2Q1YA 1B6TA 1KO7A 1K9SA 2HFJA 2OHJA 2O54A 3WX0A 3QWBA 2PUWA 3PHGA 4EBDA 2R6CA 1T6NA 3IDZA 3ILVA 3RV3A 3IJEB 4KRYA 2WJJA 3M6IA 3AY6A 2P2DA 3SHOA 4EHFA 3WG9A 1N78A 3CW8X 1P31A 4JGIA 3GNSA 1PJSA 5M7EA 5CH8A 1EEHA 2VP0A 4EI2A 3QLEA 1KZ4A 2WJGA 1OI4A 1U28A 3CUEF 4R3WA 1E1YA 4TV8B 3SBXA 4BNKA 3Q0IA 4EEQA 3H3XA 3A05A 1QHYA 1DHTA 1NVFA 1QHFA 2OFXA 1XDWA 1Q1BA 3HABA 1FP4B 4X64B 5CEFA 3HXKA 3MT0A 4FFLA 1RS0A 1SHZA 2DWPA 2YFQA 3IQHX 4WFKA 3I3OA 5B55A 1YZQA 1YL7A 2E1RA 3HSSA 5AJWA 2Q1TA 3S2UA 2EC5A 2HK9A 2PL9A 4DJTA 4L6AA 2Z83A 3DV0B 3OIDA 4N5LA 4EG4A 5I5GA 3Q11A 2VKTA 3GI1A 5C3EG 3EMVA 4HQOA 5HZMA 4MJ7A 4JI3H 1BCSB 1I4TD 3DEAA 3GTPA 2YN0A 4B81A 1PK8A 4GWGA 3DG9A 1CUHA 3C6YA 1G4UR 1G8MA 1HPLA 2VA2A 2Z5LA 3RODA 5KUTA 3QFSA 4PY2A 2YVAA 3MR2A 3GJTA 3O38A 2AMJA 1ORIA 3RRZA 4CCSA 1JMYA 2HRQA 2NX2A 3WL6A 1XK6A 3H4MA 3MHPA 4WIAA 5HJ5A 2FUCA 2Y1LA 3QPAA 1E1CB 4M1MA 1U5CA 1YZKA 3OCYA 1ENPA 2CMHA 2V4QA 2E9SA 3E9ZA 4MTDA 3GFPA 4MW2A 1LWOA 2H2AA 2YVUA 1BNCA 5E1MA 3VA7A 2N0SA 4RFVA 1J90A 1YHNA 2R5FA 3K9GA 4HK4A 3ZV6A 1L3CA 1SXHA 4F4UA 5KFHA 2PX8A 4PLVA 3HT5A 4MGHA 4DR3B 1E9SA 3FOZA 4Y2YA 2B9EA 4M1EA 4RJ2A 3Q5GA 1V7QA 3CH7A 1H85A 2HUPA 2IQ5A 1P44A 4A5SA 5G53C 1GR0A 2KMLA 1NN0A 4P4SA 1A0IA 3H0GG 1PJZA 4BNHA 4DMHA 3ZEAA 1Z4QA 1HTTA 2WTBA 4H7FA 4FOPA 2CQYA 2WPDA 1BDIA 1L8LA 3FLMA 4B46A 3TN7A 1V2GA 3V1KA 4RANA 5DGHA 3CF6R 2R8JA 4WZBA 3SNKA 2FEXA 5BPFA 3NPMA 1DCKA 3OD1A 3VPGA 4M0CA 1W35A 3UQYS 3K5IA 4ZEVA 3DDNA 1B8PA 4NSNA 1ESNA 4WXMA 1ZOIA 4WZAB 5LMNB 2XIQA 4KE9A 5IJWA 4NX2A 3MTDA 4FNGA 5BWMA 5I9LA 1U7WA 2XUPA 3DD5A 4G5RA 1C9EA 2KE5A 1VJDA 3IV7A 3VHXB 4IIDA 5JVDA 2WF9A 3D3WA 2DBZA 4I8DA 2XOXA 3T3NA 2ZE7A 1DC8A 1JR3A 2BZ1A 3KZCA 4JL6A 2VSQA 5H4GA 3H75A 1Y3IA 1LC3A 4MQFA 1NFFA 2AZ4A 1NF2A 3FW1A 4DMKA 1A3CA 3H97A 5GOZA 2GLXA 3L41A 3LTEA 5JZBA 1I2KA 3JQ6A 5K20A 5JH7F 4GI3A 4H59A 1MF7A 4TZTA 2I7VA 4QWEA 4YQWA 1BX3A 2XB6A 2RBEA 3G8AA 3X2EA 3WHKA 3VR4H 3ZHZA 4BFUA 4LYJA 5DI9A 4YQYA 3RC1A 3J7AC 1MOSA 4JXKA 2Z8YM 5HJEA 5DWDA 1MXFA 1QTNA 3KB1A 1NG9A 3G9QA 3GILA 1NDQA 3MQFA 1YB1A 2UYOA 3DMPA 4BFTA 4ZAXA 5CFNA 1XCPA 4W5TA 3CS3A 3EHDA 1Z62A 3RYIB 3C5HA 2X0RA 1C3JA 1TADA 2R7NA 1K06A 5FPHA 4MTEA 1E3IA 4JB2A 2R2AA 3G1UA 2GZRA 1BU8A 1GR1A 2ZWMA 4QUGA 4CIXA 1D1QA 2NUAA 3N2GA 4KYUA 3UGJA 4DR5B 2CDRA 4JI7H 1B04A 2XVXA 2D8AA 4ESOA 4RAZA 1YA6A 1U1GA 221PA 1OZHA 4ALKA 2JCXA 4NCBA 1KEZA 2BEUB 1Q7BA 3FB1A 5THXA 3WC4A 2CSUA 2TYSB 3EXAA 3H2SA 3Q3VA 5F21A 3ZXXA 2ODAA 2PY6A 3L1UA 3LBHA 3VPXA 3EF3A 3T1YH 4BWYA 4QYSA 1CUIA 3I45A 3ELYA 1N48A 4HZUB 4MJLA 1AB6A 1PT9A 3QPBA 3LKBA 3R24A 5AIAA 4F3YA 2OXCA 3MAJA 4XB1A 2Y1WA 4QNMA 1OIVA 2RF4A 1FVXA 3HN6A 4YFVA 1BXZA 3KXIA 4B3DA 5KJ6A 3N2KA 2QE6A 3KOWA 3R3XA 3UBTA 5FAKA 1SBZA 3TI7A 2RE8A 1P1BA 5LP6F 1I80A 1GKLA 2Q6IA 4LNUA 2IEYA 3D4LA 1W8IA 4YT2A 4HWRA 5EJ9A 3AUXA 3AY7A 2V98A 1MKYA 5KG7A 3BB1A 5H9VA 3VZCA 1HOXA 1YNOA 3WSTA 4CM6A 1LD3A 4F4XA 4XLTA 5BVGB 1NX6A 3NGDA 4LDPA 1QU2A 5JXHA 1T8UA 3E9QA 5T8KA 1VJCA 2RAVA 3A14A 4ZCQA 5EEHA 4DPMA 1Q6ZA 2AFHA 3KZKA 3P2JA 5FNVB 3M3DA 4JP5A 1A5BB 3BXOA 3C5EA 3OHMA 4OKSA 4DIFA 3C48A 1LVGA 4WFJA 2CV1A 1Z0SA 3QWUA 4IM7A 5ECWA 2VPXA 4PCVA 4Q9HA 2IT1A 4X9XA 4JOSA 1MFZA 3RTBA 1Q17A 3GFOA 4ACAA 2A14A 1JRLA 3ESYA 2Y76A 3RAGA 4WDRA 4BLWA 1DC7A 1Z6ZA 2QJRA 1HNZB 4URFA 5FUQA 2PSJA 2PR7A 3OIYA 4UFOA 1IZYA 3UANA 4MSUA 4JU8A 1T0BA 4BFWA 5JS8A 4UUAA 1IOLA 2AH5A 3DBRA 2D5BA 2BGMA 5HX7A 3FZEA 5BWLA 1Y7HA 3BRSA 1T5TA 3L5OA 5KFLA 4K9DA 1CR0A 5TT1A 3I2GA 3KHKA 3O26A 3R5TA 5LBIA 4GYYA 4R2LA 3B1WA 3QJ5A 4LF7H 3BXXA 3CINA 4EQZA 4ZOLB 4A2WA 5CA0F 3RFCA 3SSAA 4YIHA 2VQEB 4ZICA 2I78A 2XAAA 4YP6A 2DFVA 4MLCA 2GDJA 4O4IB 3SZMA 1SBTA 2H6EA 2HLHA 4ENPA 2NNWB 2YWXA 3AM3A 5BMOA 1TWHA 1GN8A 4A0FA 4D9NA 3FOFC 4RZHA 3BH6A 1RQNA 1V5FA 4OP1A 2FLVA 2WA1A 4GI2A 5TRTA 5H80A 4MQ6A 4RFLA 3RFTA 4B8WA 4ZI3A 3NEAA 3SI7A 3MN1A 1T5LA 4KZKA 2DB3A 5AESA 3HZZA 1LSSA 2EWWA 2IH4A 2ACVA 3GY0A 5DISC 2QTTA 3AHCA 4MVJD 4BMNA 1Q1NA 2PKCA 1JR6A 4KBGA 5KQLA 4BS9A 4D4IA 2Q3DA 3MNFA 1M5RA 1LC0A 3OTGA 4D6PA 5AKEA 2IUEA 2WFMA 3KP1A 1LPPA 3EYWA 1KP2A 3EOAI 3L7YA 4FHCA 4Y2JA 5IC6A 2FSVA 4IILA 3ULKA 4G25A 4YYEA 2C96A 2P9EA 4B76A 1E5XA 4FUTA 1SU7A 3I05A 3T5PA 4QECA 5KTMA 2QUKA 3DQPA 4YJ3A 1RYHA 2GOYA 2JA1A 2NO7A 1GQSA 2VZLA 3LHIA 5TJ9A 1YUBA 4A6PA 3L6EA 4O29A 3REGA 2GGSA 3EPHA 2ECFA 2PRYA 4OJNA 1CUVA 3DBLA 2PIAA 4DLWA 3PLNA 1SU4A 2FQYA 4QWAA 2L2QA 4MW5A 1Y3FE 3I9MA 1GTJ1 4A2PA 5E7MA 1HT1E 3ET4A 3FCUB 4MAFA 2H0QA 3LPLA 2MSWA 2A9VA 4BC0A 3QH4A 2GAJA 3G9TA 2ZSKA 2DFPA 3OC0A 5DX0A 1Z5WA 5E38A 5BSRA 4YY3B 4RTSA 1YZHA 2IIPA 2PGAA 3TBFA 1BXGB 1QYCA 4DLZA 4Z7NB 1XDSA 3TLJA 1WXQA 4K6GA 2FFRA 3B53X 3MSXA 3IR7A 5L7YA 1JKJA 3BMOA 1FBTA 2IU4A 5T3UA 5JISA 3IBFA 1OXSC 5FL7A 1GTSA 1LUAA 1O58A 3DWIA 4XGIA 1ZEJA 3DUFA 4TYQA 3ZKWB 4LGVA 4NPAA 4EYKA 2R7KA 3I0MA 5CFZA 3K8OE 2V65A 4XD7A 3SF0A 4G1FA 4MUXA 4RTPA 4GNRA 2WY2D 1PX0A 3ESRA 4JENA 1MAAA 1Z7WA 4OYYA 8MHTA 5MN6A 3BMNA 1RBQA 2ZCJA 3OIUA 3FN4A 3E58A 4AL4A 2Y93A 3A1NA 2RJOA 3MWDA 2I1WA 1QZXA 2QNBA 2ZWPA 5BT9A 4B75A 2P35A 4JUCA 2IY8A 2GK6A 2PT5A 3JQGA 3L77A 2AN5A 2UVPB 4TMYA 2ISSD 3OI7A 1ZRSA 4LSWA 4ZQBA 5EKUA 4BLSA 3ZCQA 1U0RA 4M8IA 3IKTA 4KMOA 3PDWA 4FKZA 4C88A 1ZHHA 3RSZA 4EGSA 2B8JA 1E2NA 3GG9A 2VZ8A 2ECPA 5LXTB 3I6ZA 3G0BA 3U31A 4MVJA 3IQWA 3F73A 3LS2A 4KN6A 3FYCA 4GGPA 4RSHA 1I7SB 1M2NA 4FHFA 1KK2A 2R6AA 2DM6A 5HMLA 1KHTA 4PAGA 1V96A 3AU9A 1L4FA 3CEAA 3KQNA 3D9QX 5B3JA 4PYOA 1W2GA 1PT8A 1EYZA 4RIEA 4GZ5A 3SQWA 4TTPA 1FUYB 2WIKA 3TAHA 2GYUA 4BXOB 1LBSA 2YBEA 3U55A 4EB8A 1RRKA 1N1DA 5EIAA 5BSKA 3HU1A 2PO7A 2UZIR 2EARA 3ITNA 3UT5B 4CF6A 3ZWQA 1N2SA 2RI1A 1GLGA 1CK4A 3HKDA 3A6LA 3SJZA 2X13A 2OECA 4RVHA 5K99A 2Y9PB 4D0GA 1NZFA 5CA1A 3DT8A 4ZHQA 4KN9S 4INPA 4PZ9A 1M1YB 4CF3A 4JLOA 5FBWB 3N2EA 4EFNA 1SHUX 2RH8A 1UZUA 1P0QA 5CITA 4BVJA 3T99A 1CUSA 3ZY6A 3OPYB 1Q1EA 4HNHA 4K87A 1XU4A 4FILA 4H4EA 3RTEA 5CFLA 1R0WA 2HIVA 4LWZA 4ZREA 3SKXA 3X1XA 3IVAA 5I4CA 1L7XA 1Z6XA 3EBPA 3UXHA 1KDVA 1D0VA 2ZZKA 1NVMB 1MABB 3Q3IA 1L5LA 4ZAFA 3EH1A 3U48A 3UG7A 1Q3KA 2H3EA 2Q3BA 5IK2D 3NYWA 3V3TA 4OHCA 5J2UA 2RGWA 3L6DA 3J81k 5KVSA 3C1OA 3CRMA 2FQ1A 3RE1A 2JA6G 3A2MA 1NR5A 4ITVA 4LZPA 3WMXA 4D4KA 2EKZA 5L1LA 5CB6A 1TO2E 5HR5A 4UNNA 1IC6A 4RY2A 5M34A 2FMFA 4QT4A 1ZK0A 2ORIA 2BT4A 3RJ9A 4FFOA 1XXHB 2J0UA 3QUAA 5J2TB 3X1ZA 3VTZA 3Q2KA 5EJGA 4L15A 5I5UA 5IKPA 1V6SA 3GFVA 1WKBA 3KEFA 3WB0A 3V2GA 3WISA 4NE2A 4DV3B 2PD6A 1SVIA 3QTTA 3H9EO 1G21B 3AB3A 3AV0B 2Q6KA 4P7GA 2JS7A 1KBLA 3IUJA 4Y9SA 3CIOA 2WU0A 1YQXA 1ODLA 3GHHA 4PX5A 4QRDA 1PKXA 1ZSYA 1OH6A 1TJPB 1RLIA 3THYB 4CG3A 2FLLA 3D8RA 4OX9B 3TQTA 4XWAA 1Y4SA 2QE7D 4LY0A 3RVPA 2NPOA 1MG5A 3P71T 1FOEB 1C14A 3H7AA 2I3BA 3I42A 2BFEA 3EH2A 4XH9B 3E3MA 4BRUA 4JLUA 1E1KA 4AJPA 4KFCA 1ZGCA 5IT5A 4ZI7B 1SPBS 5P8WA 4CHGA 4LVNA 3FNGA 3JU3A 3V7NA 4NFSA 4XJTA 2OSBA 2B98A 2DCUA 4JR1A 4EB0A 3UPUA 4I1SA 4RE5A 1PGQA 4R05A 1NBMA 1X1SA 5AJYA 3C3CA 3I4MG 2VDKB 5I7RA 1OXXK 1DEHA 4HOYA 4DNQA 1INLA 1QIKA 1CQJA 1YRWA 2OHIA 3KXLA 3LNCA 4IJWA 2R1VB 4AK9A 3U61B 1MZPA 2HDWA 1G20E 1PEDA 3JASB 4J9VA 3GJYA 4JGGA 3W2HA 1AF7A 2VPYA 2GYYA 5LMNH 4IXDA 1SKAA 1SZCA 2B92A 1DP4A 3H05A 5BWRA 4G23A 4G5XA 3M49A 1OV6A 4ON9A 1SZDA 1XQ6A 3MCWA 3NBQA 3TO5A 1U5AA 1NN1A 3L7LA 3WA6A 1CF9A 1ARZA 2X0DA 2P0EA 5IVPA 4P4NA 1Q3HA 1IB0A 1RVDA 1AMNA 1A4XA 3EA5A 1UFKA 2CXNA 3BUSA 1PS9A 5EL0A 4A8JA 3FDFA 3H84A 2COUA 3ZDBA 3EXFB 1RKXA 3DV0A 3KWLA 5DDIP 4KPUB 1JFVA 2UKDA 1R0KA 1U8UA 3A3YA 1BE6A 3BGDA 5H83A 5CDUA 4XIYA 3HWWA 3AEXA 3K09C 5G1PA 3TGPA 3SQMA 1U0HC 1SMKA 2P8JA 4UHBA 3V1TC 4J9KA 4ECXA 4YJGB 3WLQA 2GRAA 4JT4A 1W1UA 2ZTVA 4QBTA 3I58A 5ALUA 5A3VA 3UMJA 1RCTE 1XD2B 1EHIA 4MVCA 1XAGA 4AP6A 1HE1C 2EG5A 3UAXA 2FE3A 5ILQA 4ZHSA 4M0JA 2QR2A 1P16A 1Y4ZA 2IYPA 1QHHA 3FOBA 4JCCA 3ZQ6A 4PN7A 5IYZA 5HTOA 5DCUA 1XZFA 2ZJ6A 4RVDA 5F7OA 1YV9A 1NW7A 1VKZA 1SG6A 3WDLA 4B9AA 3NUQA 2V9PA 1F60A 3ZQKA 2XEDA 3AUFA 1LDBA 4KO4S 3PWTA 3V8VA 4F6LA 1GQOA 1UEJA 3FWNA 3L0IB 3LQKA 1JMVA 2JI4A 1XFAA 3D54D 1FPQA 3LLCA 2OMKA 3OA0A 4IL5A 4PGMA 4AZTA 3WWEA 4RMHA 1Y8QB 4JR0A 2GESA 2KJQA 1TIPA 3SDBA 1O03A 2WUFA 2XODA 3DMFA 3K32A 4H0FA 2SBTA 4K0KB 1U02A 1RJFA 1UWLA 2WPNA 4MPRA 4NLGA 3WNDA 3THXB 4IHJA 4CMIB 2A7QA 4KNWA 2PT9A 4R68A 1M8GA 1DJOA 2GF9A 2ZT7A 5ALNA 2G9NA 3AT1A 2D3TA 2I4RA 5BMVA 4G2TA 1DXHA 3V8EA 4DSAA 4F56A 4M9XA 4DKJA 2X8WA 1PK9A 3ICCA 4I1YA 4IH9A 5FOWA 1ZC4A 1YFKA 4D57A 3KE8A 4KC0A 121PA 1SHLA 4ZMBA 3H11A 4QWCA 2XRYA 4CQNA 3DHEA 3UAGA 4H35A 4L3VA 5DNWA 4HNVA 1SA0A 2E82A 1QC5B 1NZJA 3UZOA 2P9GA 5BNTA 2R1VA 3MFYA 4CR7A 3RUCA 3IP3A 5CE8A 2Y1KA 2W2LA 2XR1A 3TEMA 4BQRA 3JYOA 3IP7A 2O50A 3PFFA 4FYKA 3LQYA 1JFSA 1P9LA 4INAA 3SYKA 1H93A 4AS2A 2EHJA 2OB2A 1IULA 1M6YA 1O9BA 1UM8A 1QNLA 1SOUA 2OV8A 2ZGVA 3BQ9A 3JQ7B 3ND7A 4FBMA 3DC2A 4J2HA 3HBFA 1AO3A 1Y1TA 2C54A 1Y8QA 2X58A 5KFIA 3M5PA 4OHOA 1QV6A 1LFAA 1DJNA 1YUMA 4GOLD 4A0QA 4BNWA 2OHFA 5CAEB 2NG1A 1E3JA 1NUSA 2ETVA 2F43A 2H48A 2HV9A 4HDNA 4Y9TA 5F7JA 4EK9A 5HFAA 3PKJA 3ZGYA 1PS0A 4EB6B 1BEZA 3OZVA 4K2AA 2FUG6 1E3WB 4RETA 4AJLA 5DM60 4B3MB 1A7JA 3P4XA 1XTZA 3DUWA 3OUTA 3CXUA 4D3SA 1MO5A 4U9UA 2OVBA 5GIOE 2CT8A 2WSSA 3ZVLA 4GVPA 4CLOB 3TQFA 4DR6B 2FE4A 5IDXA 4CTKA 1OYOA 1F2DA 1CLUA 2QZZA 2JIDA 3GOHA 4JV5B 1R9GA 1QIHA 3FZGA 2JVKA 1HZZA 3DCIA 3K09A 3TOSA 2X2PA 1OX6A 1YU9A 3ND6A 3OECA 4S1NA 1Z2AA 4NU0A 2FQXA 1DLIA 3L07A 5CLJA 1UBHS 4A16A 3HXTA 1PGOA 3HA3A 3D6NB 3O3CA 3MC1A 4U2FA 3C3XA 9GPBA 1OWLA 4LMRA 4ND7A 2I2XB 3LWBA 1FE8A 1VM6A 1G9TA 5KFSA 1OI3A 2PU7A 4RHFA 2WSIA 3STXA 1LCIA 3IELA 4RCYA 2VSOA 3W9YA 1TEZA 1WMAA 1WSBA 2EHDA 3BSSA 3WJ2A 3UPTA 3I1IA 4OM7A 3CEPB 5DRYA 3D1LA 1LW7A 2R00C 2B3DA 1CRLA 2OBLA 1VRCA 3DWEX 3LXUX 3D4BA 4HYYA 3CCFA 1SHKA 1PD0A 3F4LA 4LPKA 1MRZA 1PWYE 3MFIA 3GF4A 3Q2IA 3IB3A 2WTAA 3I6MA 1ZFNA 1AA6A 3D02A 4BN4A 1C7QA 5DASA 2YINC 5JNWA 5COAA 5I5SA 3IT1A 1ORHA 4PAOA 4YJ2B 5IU6A 2H1WA 4YDHB 3JARB 4R84A 2OBFA 4QUKA 3ECSA 4Y67A 1P18A 4DL9A 4U9HS 5HQTA 5IH3A 4CCAA 1QGAA 2XPCA 3PDIA 4S1WA 3T5JA 1DPGA 4XYMA 2AG6A 3BJEA 5F7ZA 2G1KA 4DQLA 5L3SB 3ZNNA 1H6AA 5IZ4A 4HTAA 2D8MA 4I55A 4CODB 3G8YA 4FYWA 4DZZA 5A62A 5BQXA 3WGTA 2P9HA 3RIZA 2IXEA 5FQOA 4CMGA 4D02A 4YY3H 2C3OA 4RMGA 4C30A 2FJ0A 4BL5A 3VTKA 3ZWVA 4BMCA 3T1TA 2R1TB 2G88A 2P75A 2G07A 2CCGA 4HLCA 3B51X 3ST7A 2ZYDA 5DOZA 3QFHA 5B6PA 2W9CA 4CKWA 3PR5B 1AKNA 4JN6B 2BE7A 5KINB 5JBNA 2ZM6B 2NV2B 3SDSA 1OYWA 1V9SA 5IDVA 4PQRA 4F3CA 3JAWA 4REOA 1PSDA 3UYYA 4A10A 1H2ZA 4G4SO 1WNFA 3HDJA 4TXJA 3EY9A 1LXCA 3LY7A 3OC6A 3A9SA 4QOJA 4ABTA 4DCSA 3ZOZA 4BNYA 4CIWA 1EGQA 1U0EA 1CRPA 3VR6D 2WVGA 4J03A 4C7MA 4WBNB 2WNHA 1U2GA 1QYXA 1WTAA 2EIHA 3CR3C 5CX4A 5TPZD 3MVEA 3U62A 3ZBPA 4CEHA 3ZEIA 5FQNA 1Z4KA 2JIZA 2W6JD 3EIQA 2NSDA 3ZHRA 1GNSA 2W8ZA 3C39A 5EJFA 3TLKA 3RTCA 3IQZA 3DOFA 4ZVQA 4BX9A 4LK2A 4PZPA 4QYXA 4R1NA 3VDRA 4HYQA 2G0AA 3A4IA 4R9SA 5L51A 4G26A 4G85A 3LDUA 4RY9A 1WSAA 2MSLA 2ZQYA 3BFPA 4GAEA 5PGMA 3KQTA 1EDOA 3SG0A 5LN1A 4KIFA 5FO1A 5DHRA 5TLSA 5E2AA 3FCCA 4QW8A 4IGEA 1Z6QA 1L4NA 2OCKA 3LK6A 4UBJA 1ODCA 2HWKA 5CA0B 2QVCA 4IS3A 4OREX 2DH6A 4H7DA 1G7RA 1NBIA 1HK7A 2VP5A 3A70A 1FYVA 1T3TA 2D06A 2M6RA 3I92A 3PNOA 4J0JA 3TBHA 4G1VA 4ASUA 1HY3A 2IX3A 4AWAA 2BR0A 1GCAA 1F38A 2DAPA 2GFQA 3NRJA 2Z4SA 3PU6A 1WCMG 4FMDF 2F8LA 3E23A 3FM9A 2RDIA 4DL7A 5AKYA 5AJXA 1T5BA 4RIFA 4DR1B 3PXBA 3NBZB 1IQ0A 3EW9A 3HB0A 4Y1RA 1V5GA 2DHRA 4I1VA 4NYIQ 1JR4A 4ZRDA 4PS1A 3V8MA 1YDGA 1SCBA 5AUPB 1KDTA 4BX8A 1KOJA 1KL7A 1UZMA 3JSLA 2GEJA 1Z2PX 2Y6VA 4QJ4A 1N1GA 4TS9A 4MRMA 3AF2A 3B70A 2A86A 3DTVA 3ZE0B 3C1UA 5BUQA 5I5XA 4JP1A 5JWRA 1ZW6A 3GAMA 2WMOB 5MN5A 1E2PA 1P7PA 5K0TA 4UVIA 2P6UA 5ALQA 1E6LA 3D7KA 5DLDA 3DMDA 4J75A 5KFVA 4DL3A 2IEZA 5A2QW 2WJ3A 3EUEA 2HA0A 1VIVA 3GV7B 3EDMA 3E2IA 3K35A 1AUPA 4GBGA 4OUKX 1UODA 2AI3A 1EGMB 3OICA 4GFDA 2A3NA 3F46A 4OJYA 1FL9A 2BR3A 1MTOA 1F8UA 3HFGA 1ZAKA 2GNOA 5EY5B 4URZR 1NLUA 4ZQIA 3K2EA 1V1MB 2JEIA 1E2MA 2D3WA 2NXEA 3AERA 4N8EA 3U9LA 2UVPA 1IFXA 5I6DA 3P9XA 2XB2A 1C8VB 1P5RA 2ZVPX 3LI2A 2VDWA 4NY1A 2Y2VA 5BO5A 1DGQA 2FEWB 1XJWA 2CVZA 3KSMA 4AULA 3JAKB 3S1AA 3ZYCA 4DV3H 1KI1A 2B7CA 3QVOA 4P5DA 1H8HA 1USKA 4G63A 5JC8A 1ZOPA 4CDRA 2BEJA 5BY2A 1E7WA 2BKUA 1Q1GA 2IHKA 1JV2B 5KDDA 1ZJWA 4O1MA 3OPVA 3OM1A 5KX5B 4R0VA 5IYBG 2OXRA 1CEQA 1M9NA 3DCJA 2F4NA 1FX0A 4M1ZA 1QF6A 1ZJZA 2VATA 3SMQA 4YRAA 4BMSA 5ADVA 3I4LA 3ONDA 4B40A 1HL7A 3DJYA 3FFTA 4PXSA 4XOUA 2IS6A 3K15A 1FA9A 1RAIA 5KKAA 4R7RA 1J39A 4C14A 4BQOA 4GWLA 4X5OA 1K7FB 1KIMA 2A57A 2DX7A 2ZJ3A 3OKFA 3HVJA 3LXMA 4R8UA 2PWZA 4L8LA 4B43A 5FBLB 3AM5A 1GPAA 1L5WA 3NVDA 4PNPA 2IODA 3KZ1E 1NKTA 2O2YA 5CLGA 3UB3A 4CM5A 1GG8A 4MVJE 2M32A 1QZZA 4KKVA 4B0PA 1RMYA 4TPKA 2Z43A 3F74A 1V0JA 1G6KA 2F3QA 1KKMA 3GD5A 3Q7QA 4R8VA 3DWFA 5CK5A 4YAKB 1JPJA 4EHJA 1GZHB 4Z7JA 2RB5A 1REQB 3BJYA 2VWPA 2Q7XA 2WHPA 5C7OO 3NBAA 4XUDA 3KPUA 2CE7A 2XE8A 3CZRA 5LOVB 1T3LA 4P84A 2A5YB 3HVKA 1IN1A 4DAOA 5CLQA 3C45A 5LDHA 4AKHA 4HEA1 2O2XA 3N2ZB 4RHCA 3PK0A 3IODA 3QBVA 1J0BA 1DMRA 5I5TA 2VF5X 4F96A 5AM0A 5GY7A 4URXR 3RB4A 3KETA 3O2JA 4FHDA 3CSDA 1I2DA 2HREA 3PNBA 5KFCA 2BGUA 2RGNC 4L0MA 2XNJA 3AM4A 2HBYA 2M1ZA 4R1QA 4EY4A 4C89A 4KQMA 2IXTA 4EGJA 4PZDA 3ZGNA 1ODSA 2YW9A 3PZBA 2GI4A 2XVYA 1EH5A 3FHOA 2OWDA 1SO8A 2ZBVA 4ZHQB 3ZVNA 4FMPA 4N8DA 1II8A 5IP9G 5JSYA 3TSOA 1C7ZA 2LTAA 3SC4A 1QO0A 1T9HA 1UPUA 5HBGA 4Y9UA 3TYXA 2J1LA 5B3JC 2XWSA 4KDRA 5D3KA 5FI3A 4ZTUB 3GLKA 2Z08A 1T4MA 1SG0A 3P1JA 3T95A 4ILEA 1K6MA 1DOZA 4C2MA 5EZYF 2WJPA 4MR8A 4ZU6X 4LWQA 2GJ8A 4EY3A 2ZGIA 1OI2A 4FFNA 5IKOA 2D1RA 2P2ZA 4LJAA 3VSCA 7YASA 4GMXA 2G7MC 3HB9A 1K88A 3ZHSA 4JUAA 2ZAYA 2QUZA 1WE2A 3GEBA 1QLWA 2QNIA 2WFLB 3FHJA 3O8CA 3NHWA 1BD3A 4JA2A 3RASA 1GAXA 4EG3A 2VHXA 3AMVA 3WR5A 5ICEA 3CLSD 5JMWA 5TQ2B 4RKYA 2IYOA 1IK4A 2HSEA 5JT1A 2O7NA 4MDFA 1KYWA 3TRFA 1QIGA 1YA8A 4X64H 4PBCA 1K7XB 2B1QA 2ZRKA 1FVIA 2CUNA 2JFGA 3A31A 2WHQA 1W96A 2ZUCA 3AKEA 1RAAA 1TFUA 3NT2A 4P3XA 5AW8A 2Q2TA 2NYRA 4WMLA 1TUBA 2HF8A 2VPWA 5HDBB 5AI8A 1AF4A 4TTJA 4PF1A 1P62B 3FPCA 5JW6A 1DL5A 3E8MA 2DFKB 3UMVA 1W6UA 2VHEA 5HM6A 2UYCA 2OZLA 3GFGA 1Y9DA 4EFLA 4KWEA 4MWZA 1L5HA 1D1TA 1NJFA 3KHSA 4FFBB 5CVUA 2IELA 5ARCA 2A33A 1GSIA 4CMEA 4JJKA 3A1UA 4RTRA 4Q19A 2JBHA 3IP9A 3CCBA 1NPYA 2HV8A 1WP4A 4Q5IA 2QAGB 3R2JA 1JAZA 4PQEA 3JZFA 2XKBA 4IJUA 1TYAE 1OUMA 3N2KB 4FIDA 1N5IA 5D7NA 4EW6A 3H42B 1A4RA 3SM9A 2FK1A 1YQWA 1W5SA 3H6KA 1PL0A 3VUEA 4DNPA 2E18A 1L4MA 2C22A 3R77A 4C1BA 2X1HA 3AILA 5CIWA 2O0MA 1XAJA 2AT1A 2IX9A 3ZI0A 4MB0A 4ZCTA 3V97A 1L8QA 2P3LA 3C4JA 4BXXG 1P0FA 2R5NA 4G1BA 2WIDA 2EJ0A 2F3RA 3NQ41 4W9RA 2I1QA 3V9PA 5IT9A 5EKXA 4YBZA 3GH3A 4FMDB 3EULA 4MWDA 4PPGA 1VECA 1VSBA 1CKMA 2D1QA 2HB6A 4GWKA 1V7ZA 4W63A 4UD6A 3CE9A 1SCQA 2BFBB 3U56A 1JIIA 1U0JA 3RRJA 4J8PA 1NJ1A 2BJWA 3CSWA 2AA3A 2Q1SA 3KQPA 4J3JA 5G2OA 3NT4A 1XK5A 1JIKA 5JD6A 5K8JB 3D7SA 4I7HA 4B6PA 1LS1A 4UBOA 4J4HA 3H9GA 4DR6H 1L8AA 2R6FA 4TX1A 3RB8A 4AMVA 2JIZD 1B3BA 1EJ2A 3HUDA 4RWEA 4DC1A 1MAVA 1HEYA 1W8DA 4ZAVA 3ES9A 1RBYA 2IZ7A 4UBKA 1KS2A 2CUTA 2Q21A 2RGEA 3L18A 1G20B 4J29A 4DDKA 1KPIA 3KTAB 3BQ2A 1JEJA 4HBGA 4BAUA 5B7PA 2OCPA 2XZTA 1NP3A 2FQQA 2GJ4A 2FR0A 2OE2A 4L5JA 1ZI9A 2GX6A 5EJ7A 4DVJA 3EA4A 4GM4A 1TZBA 4NCIA 3ZY4A 3KUCA 1AKEA 3U09A 3WP1B 1DO0A 4WY5A 2AS0A 4S24A 3WGUA 2QRLA 3HVRA 4DA4A 3L8DA 4CMCA 2C2YA 1X7WB 2FUEA 8LDHA 3H9JA 5IKXA 1N7HA 1FK8A 1NXTA 4JP3A 1R66A 1J21A 3LVFO 4GPAA 4NARA 4CU2A 1EFRD 3SQXA 2YL2A 1ODTC 1TYEB 2IWRA 3PNLA 3EEQA 2XQVA 2R6GA 1KTIA 1ZCFA 1HMPA 4WGGA 1BQ4A 2O1WA 1TF5A 3FGPA 4MB6A 1FP1D 4MRNA 4TUYF 2BJHA 2CCKA 1P1CA 1WULS 4PYNA 3RUFA 5FEUA 4B3RB 2X5JO 1DC3A 5D6NA 1OAOA 1SVUA 1LVHA 3QYJA 4ER7A 2IHVA 4W1QA 5B5SA 4GI1A 3K6RA 3I12A 3GEPA 3K3VA 3SIRA 4EIWA 3DFZA 4DR5H 1M6HA 4NFHA 4JI7B 2OO3A 1GEGA 2X0EA 1QK4A 3GLSA 4EEZA 3A58B 5FT9A 3C70A 5IXYA 5JY6A 1E98A 1E60A 1YVPA 3UICA 1HGXA 3HACA 4JX9A 1Q2UA 1DJLA 2VK4A 1N32H 2VYFA 3MWEB 3QBJA 4WOCA 1I2ZA 3SFTA 1RYNA 4UXJA 5DNDA 1CJKC 5ICFA 2VDLB 2O7QA 4OQYA 3AZPA 5BORA 1RYBA 2OQ2A 4J4BA 1H66A 3ZS9A 1JT9A 1WD7A 2RG7A 4ARSA 3ROQA 5J58A 4Y6GB 1PNRA 1SKQA 4RVOA 5JQGA 5CYFA 1EGHA 4TQGA 1E6EA 4ZI7F 2YR0A 2AXEA 5BN3A 3LUBA 2BM9A 4H1HA 4B87A 1VLLA 3AGPA 1UF9A 3A28A 3FCAA 3IUNA 4XSVA 3VR4A 1KI9A 2J7KA 1G8SA 3QP9A 4M9QA 4LA4A 4OLJA 1MGPA 2HU2A 1WCXA 2W2NA 3V9AA 2PUBA 3WB9A 5DLYA 4IRMA 3L4KA 1S9HA 1NWHA 1AKUA 2R7ZG 5TMPA 3KYJB 3O8OB 3UQ8A 3U3ZA 1I3MA 3C14C 3VSDA 2OK8A 3QWFA 3P27A 4IIJA 4MS3B 5I9BA 4CKYA 3T4UA 1ML3A 2WWXA 3OKAA 3KRTA 2GERA 1WB6A 1X42A 1PP4A 1FNCA 4Q1AA 4S12A 3SYNA 1KAEA 4Q4JA 4RVGA 4KPYA 3L0PA 2P0AA 1QTRA 2V7GA 4FOTA 3THSA 1A8SA 3CONA 4LBYA 1TLFA 1I32A 2OLEA 3HXMA 2V5UA 5C3MA 1CDDA 1M7BA 2ZJ2A 1H69A 1MB0A 3QUQA 4D0NA 2I3AA 1E4YA 2IS2A 2X15A 1QWOA 3LMLA 3B6JA 4K28A 3REOA 2XNDD 3VR6H 3N87A 5FX2A 1S1MA 2DLNA 1Z28A 4B5LA 3PL1A 5BVHB 1E0KA 3S81A 2BKXA 3BA1A 1TCUA 2X40A 1GU1A 4BVLA 1NNEA 3KCNA 4C7JA 3RYIA 4TROA 1P1IA 3I83A 1VGRA 3S7TA 3ZI4A 2R8IA 3ECAA 4K9PA 1RRFA 1QP4A 1DKLA 1PJCA 4FQ7A 2VNHA 1QOQB 1Y82A 4R9UC 4RNOA 3PFIA 4BMXA 4F9TA 3QE2A 5K3FB 1K89A 3NTXA 4R1OA 5IHPA 2ATVA 3FDJA 3FR7A 4ZOLA 1DQSA 3OH8A 4IDOA 4LJ7A 3TMKA 1T8TA 1NG1A 3DO6A 3ZY3A 1NM5C 1PJRA 1H0HA 2YUTA 5KG4A 4WH0A 5L4NA 1DBRA 3UTCA 3ZHVA 5CFQA 3I5YA 2ZSEA 2IPOA 2WM2A 3FKSD 3OU2A 1CUWA 2Y0DA 4DUGD 3BPSA 3E2MA 3FVTA 1DIOB 2QDKA 4JI8H 4UFZA 4B83A 4QGSA 2B4KA 2C7QA 3OPYI 1PDVA 3CR7A 3K9BA 4LZLA 3D6TB 5B64A 3TLMA 1YR7A 5AVWA 1BDBA 4RD1A 3WS7A 4BUZA 1Z0IA 4WNAA 1MXHA 2CHVA 4YCLA 1U8FO 4GR4A 1KEKA 1ECGA 1W9MA 3ED1A 5FTWA 1IWOA 1VFPA 1VSVA 1M1NB 4I4LA 2OD9A 3U0VA 4XUEA 1OXUA 2BHNA 1NQ5A 2GKOA 4O2BF 4IIHA 4BNTA 1PBNA 4XFDA 2XNSA 2VRCD 2EFYA 2ZJ4A 5JATA 4C0JA 1NJ8A 2OENG 3LH5A 4EF4A 2NQ2C 2O7VA 3M2PA 3AI1A 3SFZA 3VPBA 3QQMA 2ZJAA 3QF4B 1R8QA 4V2UA 1EVKA 3R3YA 4R2HA 3ZLJA 1K97A 3B6ZA 4L2IB 4HYEA 3TOXA 4UPEA 1IVNA 1NW9B 3QPCA 2AZDA 5KNBH 5FHQA 1AQ6A 5AVVA 2E2IA 2P9YA 2UAGA 2TMDA 4JBHA 1CR1A 3P9PA 4WK6A 4ALMA 4DV7B 5JJIA 1OYVA 1M2VB 3R7SA 3VPAA 5I5VA 2EKBA 3EGWA 3MWKA 1ECPA 1RPNA 1J5PA 1YB2A 3T3EA 3LYLA 5IX8A 4YV0A 1DCFA 2IOYA 2A92A 3DZGA 1E5QA 1X86B 1UPTA 4Z2YA 1IBRA 1QV7A 4QAQA 4RL4A 2RK6A 4LGCA 4OHRA 5C4GB 3OHBA 3OQIB 2D0PB 1XEFA 3RD5A 4A6DA 2IZ5A 2LCFA 4NIMA 1DX4A 2P78A 5C1IA 1NBOA 1JX6A 5FJJA 1RCFA 1E1CA 2QPAA 4JBNA 1RRCA 2C4HA 4IYJA 3CNOA 4K9MA 4V1CB 3PXGA 4D79A 1HQCA 4CG0A 1E58A 3B2EA 3VKHA 1AGPA 1AG9A 1FSSA 3FPKA 3TCNA 4D4MA 3FOEC 4OV6B 2QM0A 5LZ7A 3TMAA 1H4SA 1QHEA 2WHRA 4B17A 4A0HA 3REFA 2ZSJA 1BCSA 1HFJA 4ISBA 1BW9A 1IXSB 2GPNA 3DGFC 3JQ8B 2YFHA 3A36A 2PX5A 2QYSA 5DK4A 3IFSA 1N4DA 2C1XA 2YBDA 2QMZA 4WESA 5UKDA 4YHBA 1U8XX 3TJRA 5BW8A 4M7PA 5FWAA 5SY6A 4P0QB 2G83A 3BMNB 2XYHA 1XL1A 1MNQA 2VXYA 2GCEA 3DDCA 5HGJA 1JHDA 1V43A 1YL6A 2H0AA 3L4BA 2X7JA 4Q1VA 3KFXA 4ND2A 5DBIA 1M0EA 1Y0BA 4QGFA 1E63A 4MITA 4BB0A 4EMTA 3MGAA 4A0SA 2ZI6A 2SKCA 1VL8A 5H02A 4UHKA 5TSDA 3AKZA 1FFDA 2AD1A 2HU7A 4HB2A 5DXJA 3I5MA 4R4JA 1JKJB 1UXIA 1O6BA 3BMOB 1ULTA 3VNBA 5ITWA 5J23A 3E8XA 2A1HA 2RKBA 1PR3A 2ZVJA 1I4OA 2B69A 1C8LA 1JWBB 3HCWA 3QYPA 3QVLA 3P9NA 3O9MA 1CB7A 3FNBA 4ZVPA 4G81A 5EXXA 4YHHH 1OZ0A 3I61A 2C2BA 4NG4A 4AKGA 1T0UA 2OZKA 4NZZA 4IR7A 3G9ZA 4F46A 4RIGA 2J3DA 4ICIA 3EIOA 2IHUA 2Q3LA 1H2RS 4M98A 3KVRA 1QE0A 3Q9NA 1QAQA 2OZVA 2PGLA 2A5GA 2XA2A 3TQIA 2WUEA 5IUNC 2WJWA 1U4SA 1N56A 3HEBA 1P2UA 3PZRA 1XCBA 4NYIR 4DRZA 5IKMA 4FYVA 4MUEA 3DE1X 3SOPA 3ZJ4A 4XPZA 3R0ZA 2HL6A 3RW9A 2PWYA 3Q15C 4IQGA 4BNGA 4KIWA 3ANMA 4NMLA 2C82A 1HBJA 4YR9A 2JLCA 3ZDQA 2FMHA 2CFMA 1U7DA 1QQ6A 2R65A 3ZZTA 1N75A 1XTIA 3DZIA 3GTKA 4E46A 4XM0A 1W4CA 4P2BA 1YNSA 1TZJA 3ZDXB 3HGTA 1SKUA 2P40A 4RK6A 4LHVA 3UWKA 1MW8X 1L5VA 4DV4H 2ZRGA 5EC8A 2OFOA 2XUIA 2WPDD 2W2OA 4HO1X 4RB2C 5HCUA 4Y2PA 4Y2SA 2XMCA 3BD7A 4N0MA 2XUGA 2WWHA 4NH4A 1P7CA 5K0GA 4FEYA 1GO2A 2IA6A 3TPFA 1JIVA 2WDTA 1T0PA 1X7XB 2IPXA 3P2EA 3U4AA 5KOIA 3MJSA 2HIGA 4QFCA 2QN7A 3DR3A 3A32A 4PSVA 5KG0A 3I9JA 5HE8A 1C0LA 5HKOA 3QF4A 4I1IA 5CDTA 4Z1MA 1F4PA 4HNAB 1B93A 1GZ5A 1RACA 2IYQA 3JPYA 3AFHA 4LFBH 2CFTA 1I6UA 1ZK1A 3PFKA 4RY8A 4ZO6A 4D8TA 4DIBA 3DDOA 2I76A 4O2AA 2RDMA 4K9LA 3PQ2A 4YJ2F 2R7ZA 2HJ9A 1LEHA 1DRJA 2V6BA 1Z37A 1TCBA 4FZJA 4HDRB 4NBSA 2XEXA 5F1YA 4U00A 4UNSA 2FSSA 3CVOA 4Q6WA 3JQ9C 1ZGGA 2PKQP 1W87A 5C5IA 2C9DA 1C7EA 1W5TA 1OREA 3GAAA 3DYIA 3HXQA 3CZMA 3PDUA 2F55A 1EVIA 4U02A 2GR9A 4DUPA 2PKXA 1PI3A 5GJCA 1T2NA 1AUXA 2AVDA 1T9GR 3T9CA 1P72A 4HGYA 2A35A 2MMCA 4EFEA 2XTZA 3OZRA 3VR2D 6PFKA 4BXOA 5IVHA 3EG9B 4DWWA 3GGDA 4I5FA 5F78A 4B1FA 1F2TB 3HRIA 3K9QO 3Q8PB 1JPUA 3VNQA 4ZYYA 3SLKA 2XXJA 2YYYA 3MD9A 5JCZA 2F3TA 1BJKA 5AHOA 5C8VA 1NUHA 2I4MA 3B7WA 4CGZA 4E1VA 1RWBA 3F6PA 4L5BA 5EWFA 4A93G 1W29A 4MW1A 1PT5A 1QFXA 2O0LA 3BTVA 1YSCA 2CXXA 4DUZH 3OBBA 3OE4A 4NESA 2QROA 4FS2A 3HBMA 1TJ4A 2P2CA 4K7JA 4YB8A 4XDHA 3VNNA 1ZD1A 1WOMA 1Z2EA 3EZGA 2P4HX 3ORYA 3R3HA 3VU1A 4F1WA 2FLPA 5EJEA 1MIOA 3BIJA 1UBSB 5A9TA 4RK5A 1XT6A 5GGXA 2HT1A 1B23P 2W37A 3ILHA 2R25B 3Q3EA 2HHHB 2X0IA 1E6UA 3TY8A 3G9UA 4NJEB 1E1RA 3TXXA 2XZOA 4E3ZA 1VPTA 4RTJA 2ZXUA 1TKBA 1DIAA 1S8AA 1PV2A 1XRQA 5D85A 5H0IA 3C3YA 4Z3KA 5KT7A 1DBVO 2R93G 2DC1A 3V1YA 3OLYA 2OH2A 3RJ5A 1NDHA 2XHEA 5A3QA 3EQ2A 3PKIA 4UOQA 1A7AA 4EFKA 4HQLA 4R0NA 4O2BB 2DWUA 3CVZA 5A7HA 2XKJE 3HBJA 4ETSA 1HNZH 1Y1LA 2AF4C 5K45A 4I9NA 4BWFB 1RE0A 4MYSA 2I7CA 2IC5A 1GUDA 4ZV4A 1ID1A 2VP3A 3CV3A 2E5WA 5AW5A 3BXHA 1MVNA 4II2A 1FNMA 3K0CC 4FX5A 3B1VA 1HI9A 1P7YA 2F2TA 2O1EA 4LRWA 4UQPA 4WFIA 3ZU5A 2VYQA 2NO5A 2WF5A 3OE5A 4UKDA 1BCRA 3VAYA 1FDUA 5LP1A 2PR2A 4Z4CA 2E37A 3IEPA 3E3OA 3FJ1A 4U3JA 3ZCPA 4Z8XA 5KYGA 4LF7B 2QORA 3ISVA 3PC8C 4M88A 2Y99A 1PBTA 2FSPA 3SXJA 3E9EA 1Z8NA 3AI7A 3SI8A 3HHPA 3FXAA 2D62A 2I4OA 2V7BA 4PQGA 4POOA 3HV0A 4ZARA 1H2XA 4MWGA 3G2OA 1Y1WG 3NBUA 1D4ZA 1X70A 4GP6A 1J33A 3GZ4A 5IYCG 1TVKB 4ZZ1A 3GQCA 3JPWA 2FSHA 1GUZA 3WB1A 1RKBA 1VL6A 2IGTA 2VPPA 3DPIA 3WRXC 1TZKA 1BDMA 1HSZA 5JSHA 2R87A 2W2PA 5BSFA 2F4VB 3G2JA 4N3GA 1M6NA 5CCBA 1U0GA 1ZOLA 2AYYA 2VJNA 3OUUA 3CTPA 3LA6A 1IBLB 2MHCA 3COWA 3N5CA 4DLSA 4EGQA 1FTNA 3B7GA 3FF1A 1NRXA 3OTIA 4DLPA 2NXNA 1JB9A 4Q48A 2YIDA 3JWJA 1G8PA 4OATA 1IY9A 1FRVA 3MINA 3HN7A 2DQYA 2QTFA 2NYUA 3CQ9A 5TEVA 4F21A 1M34E 2P1DA 3JV7A 2JGAA 4Z7QB 3DP9A 1UDAA 1V7PC 3PC8A 3QV1A 2VDWB 4NNJA 3TIFA 3K5HA 5BT8A 1A8HA 1OX4A 1Z74A 1SXGA 4JLNA 2FN8A 3ZLTA 1NYLA 3TXYA 1U7ZA 4X41A 3VKFA 3P32A 2VK1A 3QSGA 2OWOA 1EG2A 1O6GA 5TXGA 2HQRA 3ODPA 3GMSA 3M9LA 4RCVA 4C0BA 4IDDA 4D8YA 3GDGA 3I8SA 3AF4A 4N12A 1S4MA 3I76A 1BAPA 2JA7G 2P4UA 1NHGA 1GRVA 3QVJA 1G6Q1 1E64A 4FWIB 4AMBA 1CF4A 1C41A 4FE3A 4KLCA 3LP6A 4ZOEA 3EXHA 4I1UA 5IM4F 4RKFA 4ERNA 2P41A 3L8FA 2XF8A 3TTSA 4DT1A 5GVSA 2W6MA 1WB9A 3AJ8A 1DQRA 1K2VN 3GRRA 1UBLS 4H6XA 3GIMA 3IEUA 3CW2A 2JHPA 1GN9A 1HXHA 2DBVO 2HPAA 3GLRA 1KNQA 5LWHA 1T8WA 2JFFA 1VPWA 4N0PA 4ZIRB 4ZRMA 1ZGAA 3CB4A 1VI2A 1P1HA 4RLSA 3RT9A 3SC3A 4CG1A 4QJBA 5KNCH 1RYFA 3R5KA 4HX2A 4MKRA 3W9UA 3WYCA 5AJTA 3J81W 1E4VA 1QZUA 2J87A 2CFOA 3PITA 5FORA 4CETA 1PUJA 1II8B 2JZCA 2IOQA 3JQBA 2PZMA 1P2GA 3E9MA 1KH3A 3FSGD 3SZLA 1V4YA 4FZ5A 5AI0A 4MJ3A 4L73A 4B3MH 1DRUA 1PJQA 1IHXA 2WB1A 4D3XA 2UZ4A 4RE6A 3ZQUA 1FS5A 3COZA 2JW5A 4HB3A 2QUAA 2IRWA 3JZ6A 4PHFA 3NCTA 1ISSA 5BSHA 5BWBA 4KHPB 4GOKA 2VKQA 4YRNA 3SHFA 1LY1A 5A03A 5G1OA 4OHVA 3LD9A 2EJTA 3L84A 5TQJA 4ZOCA 4YCCA 3PDCA 4HG2A 1S2GA 1VXRA 1DAMA 4M8LA 5BWOA 3BTUA 4NVRA 1WP9A 1A27A 3EXG1 3M4YA 2BRUC 4KSYA 2PUVA 4MR8B 4AZWA 3ND8A 1IBKH 3VTFA 1GAQA 2BIFA 2GKGA 3EDOA 3WLNA 1GTG1 1H3FA 5E2IA 5L1KA 5CR5A 4JGBA 4BV9A 4MINA 5E8RA 5DHPA 1I3LA 3Q9UA 4G09A 4CMKA 3KXPA 2YYZA 3CWZA 4LV5B 3UGKA 3I1FA 5L9AA 3MCVA 2JGJA 4DBVO 3G88A 3F78A 3HPQA 2P9FA 2VQ3A 3JRXA 1PF7E 1ZO8A 4M1KA 4RF4A 1NSTA 2WWRA 3K5WA 4QDUA 1KE2A 4LG1A 1OZFA 3VSAA 3RU3A 4UHHA 4LTDA 3NKVA 4UTZA 4BZWA 1OC4A 3EPGA 4CUKA 2CXQA 1T43A 3K6JA 3HDQA 2CVOA 4DQDA 4EJ6A 1CULC 3QXSA 1CP3A 4ZO8A 4ZVUA 1M1XB 4BB5A 1N2BA 4MULA 2QRZA 2CNKA 1K7SN 5T6MA 2CLOB 1GLNA 3SPXA 4WKCA 3E4CA 2GNAA 1YZTA 1VGQA 4DMGA 4H7HA 3KL4A 3RAQA 3W5CA 1HT3A 1IBMB 5FEMA 2QIOA 4E31A 5I51A 3EEFA 2I33A 3UA3A 4ENWA 4GS5A 1LV7A 1P2FA 1K8ZB 2Z2ZA 3O1JC 3BULA 3Q7PA 3EF0A 3EHEA 3QITA 3TW7A 4YLEA 4TOIA 3D6VA 3IBSA 2HU5A 1TM5E 2W6IA 3C6MA 5DCYA 1SIBE 2J6SA 1N36H 1RVV1 1JJ7A 1RJPA 1ZR4A 1X1RA 3PRYA 1JDEA 2W9BA 1SK8A 1XWFA 1YR1A 4HJRA 4MHSA 1PEKE 3EY4A 1M6VA 1ULUA 3O1IC 3O2SB 4BKMA 5KB3A 2FPWA 1T1JA 5KYUB 1L5RA 5EP2A 4P4LA 2I62A 1GY8A 2R00A 3A04A 3FNRA 5EXEA 1DGSA 5JH7B 2VTBB 2V4UA 3T41A 4EFMA 1JFTA 2B3TA 3I6IA 3VI4B 3GB8B 2ODPA 2XDQB 4GSYA 1ECJA 4WHXA 1GXSB 3B5IA 1FFBA 1PR5A 5FPQA 3ZXYA 3RAEC 1TYZA 3IAS1 3PX3A 2HW8A 4QBFA 4DIMA 2GK3A 2H00A 2PVCA 1JXAA 1UDXA 1XCMA 3A6EA 5JROA 2PKWA 3ZHXA 5A6SA 2O2IA 4JJZA 3C8HA 4Y7CA 4Y2HA 2FUKA 4Q0MA 3V6JA 4OPMA 4JT9A 2CHGA 2QN9A 1COWA 3NWBA 4ZJUA 2O1SA 4NTZA 3INGA 1DWPA 4OHBA 5JO0A 4DA8A 1RXVA 4F06A 3IRUA 5B3AA 5KYUA 1HRDA 2OD7A 3T7CA 1AKQA 3LCRA 5EZYA 3GCGA 4WRRA 2O59A 1P60A 3FETA 3GBSA 1B8VA 4U7CA 1HT2E 4GLOA 4NECA 4OX9H 4EA9A 4ER0A 2QQGA 2RONA 1DIRA 1PW7A 2FK7A 1DX9A 4U2DA 4BO9A 2J6IA 4EJ2A 3RFXA 1BXRA 4U3JB 2O2GA 3H4VA 1SUBA 2YHSA 4P33A 3T8YA 3ZUGA 1V48A 1E3MA 3QEMA 1S6YA 1B6SA 1YVUA 2K2WA 3KIPA 1BX1A 2GM4A 1RJEA 1W75A 1JEQA 1BGWA 2HDOA 2BKLA 2IW1A 3GMIA 3NANA 4OB6A 5EIOA 1L1FA 1KJZA 4R1SA 2IDKA 1D3AA 2XWQA 4QU9A 1R3UA 4NK5A 4Y2UA 3WWOA 4CLRB 4E21A 3G6XA 3UHAA 3R9RA 4NAVA 5IANA 3PWSA 2WQZA 4NBNA 4AYBE 3CX3A 4EEXA 2W7OA 3NP9A 1LSJA 4W9NA 2VP9A 2AOTB 3L49A 2W2VA 2YOFA 5FFFA 3R7WB 1KBZA 5GGYA 1IM8A 5CK4A 5IDQA 3JQFA 4DM3A 2IDMA 1VXOA 2HSJA 1G8FA 1WZEA 2R8ZA 4BEWA 4ED9A 1L5QA 1ZKDA 3LC0A 1QNFA 3QLUA 4GL4A 2GFHA 2FPMA 2V5VA 2ZWOA 2O3QA 5K3SA 2JARA 4A26A 4RNCA 4FQ8A 4DCTA 4C78A 1THZA 2NYAA 4UDNA 2H4ZA 2WNSA 4HNRA 2FLWA 2YZNA 1BCRB 1RNLA 4AMUA 4DSNA 4V1CA 3HY3A 4RNDB 2OO7A 3RC2A 1XNHA 4RKEA 3PXAA 4J1TA 3AOEC 1Y89A 3KB6A 1E89A 3TCKA 2CFIA 1RTTA 4YROA 4NCNA 5FLKA 5J4KA 3U3JA 1RHJA 5FPYA 3UA4A 1P7VA 5A7FA 3OZIA 2IXFA 4OG2A 1JLRA 4ENVA 3QNMA 2F7SA 1O1YA 4RFSA 3C2QA 1ZXXA 3EAQA 4IX9A 4RDHA 2C61A 1F6DA 1OZAA 3LC1O 5KVVA 5DE3A 1IBSA 3TG2A 1KC3A 3CJQA 2YY6A 1LX6A 2COGA 2DPGA 3L7OA 1HM5A 4B3SH 1JQDA 1YASA 2VYVA 5G0VA 2I4IA 1Y4AE 1FTWA 1XU9A 3IPAA 4UVHA 5KSPA 1WM1A 3LLVA 1C9MA 4ARBA 4XVHA 2O2SA 3NAQA 3O0DA 5GQSA 1UJBA 4EKDA 4R9VA 3BWYA 4PC6A 1VLQA 4LJSA 1XA0A 2H7XA 2CHEA 5AR1A 3CSSA 5M2QA 2WKSA 3CNNA 3ZHOA 2ENWA 1GFWA 3LRPA 3LY5A 3NBYC 4DQNA 2IHNA 3TG8A 3GFSA 4OK3A 4ONEA 2RK3A 5FNZA 4N47A 3AI2A 4CMDA 3L8MA 1EQUA 1EGAA 2MWMA 2J9FB 2BYTA 1F2TA 3BWVA 4K0KH 1Q14A 1PG2A 2JI9A 4KX5A 3IBGA 4QNRA 1Q0QA 1EZZA 2YQ4A 2QW8A 4QE3A 1IPFA 4KUHA 5H4HA 4MW7A 3JD3A 4H16A 4OM8A 3D3EA 2Y1GA 4BUCA 1M7GA 3FYHA 3EJ6A 4FLMA 4YFYA 1ULSA 3IAS6 4KDFA 3IAM6 1C7FA 2I03A 3VR3A 1ZBQA 4DIOA 1W581 3RUAA 1CP2A 3FG9A 5EJMA 3EMBA 2J3MA 5IMBA 1JHQA 2PKQO 2JDIA 4PV7A 3ROXA 2UV8A 3KJQA 4QICA 2J4DA 3OF5A 5TF0A 3U3DA 1DRVA 4RTNA 2GD0A 5I4KA 1RPZA 3AVTA 1E5TA 3RHTA 2HGXA 3W5HA 1ISPA 1JECA 2G82A 2VDMB 3QG1A 3Q7RA 4YXFA 5IT4A 1PWXA 4G9GA 2O8BA 1GGEA 5HZGA 2VQFB 1G6OA 1VKOA 4AN0A 3LULA 5L6MB 3I2YX 4YJ2A 2D6FA 1XAIA 2QBYB 1D6JA 2V6IA 4FXOA 2HRRA 2ZJBA 1PIWA 1X7XA 4RKWA 5EPUA 3UF0A 4FGLA 3UHFA 3X44A 5J2TF 4FBLA 3UWSA 1D1SA 2BF4A 3FUUA 4UDOA 1QH1B 5EXDA 4B3HA 3TLGB 1BO6A 2XCPA 3R76A 1AK2A 3OETA 2FK3A 5FPPA 3M2TA 1LV8A 3I0ZA 3WRXA 1Y1PA 1ZXLA 2JI6A 2NU7A 1JHMA 3AUAA 5FWXB 1GYRA 1HE4A 1FMCA 4I1RA 1U3FA 4LZOA 2GPBA 1L2TA 3FNQA 1R6TA 1XZJA 5KFTA 2GK4A 2R6JA 1QRDA 1R0BA 5CFMA 3E15A 4AO7A 1KAQA 3DYBA 2YV3A 1P17A 1F2VA 3NM5A 4I55F 1AKYA 3DLCA 1F2UB 3IDFA 4LEIA 4RVUA 5LQKA 3RANA 3GV8B 1W49A 3HXLA 1ZGBA 2BY4A 2EIXA 2TS1A 1N6NA 4LOIA 3PCXA 3U3XA 2JAHA 2RHDA 4IHAA 3K16A 1HZZC 2R2GA 3FE2A 3UB2A 3ZIAD 3U6BA 5HS6A 4OLBA 4LF9H 1XJQA 4Q9LA 1H0KA 2JATA 4QRHA 1G5IA 1SM4A 2L19A 4X61A 2CD7A 1Y4UA 4KWHA 4E7PA 1Z18A 3QY0A 1AGRA 4M54A 5JQGB 2PD3A 3PDIB 3NC4A 3LC2O 3THYA 4EELA 2HPHA 4R5MA 4Z99A 3T0IA 4JP2A 4WVLA 5AVRA 2ZYIA 3W4JA 3W5OA 1T9GS 5C44G 2BTEA 4RVCA 2VZEA 3HOVG 2FX5A 4NI5A 4HH4A 1CY2A 2EWVA 2IYFA 2XRMA 3EFOA 4UTXA 5EE5B 4DLXA 2WE6A 2HO5A 1U81A 2PU5A 1DCMA 3CR8A 3KLOA 3QOXA 1DC6A 2ATIA 2NXCA 4TYPA 4TVOA 3W1WA 4EJSA 4P08A 1UKCA 3ENQA 2RHTA 1GG9A 1W73A 5ER9A 2R85A 1JG6A 2DSNA 2O20A 1UKEA 2ZG6A 3A9TA 1N8NA 2Q0QA 3C3EA 4PG5A 5CXXA 3WMRA 2RHCA 3OQNA 1HWYA 2IK8A 3V2UA 1EFHA 3PXCX 4Q4LA 5A5GA 1C7RA 3FNFA 3LRXA 3PPXA 2PX4A 3AR6A 3DGEC 3U4HA 4I9GA 4BE9A 3L0DA 3C97A 4NKRA 5EWMA 3ZWPA 3O4RA 3W5AA 3GPIA 1I50A 2QVZX 3Q9SA 4KXYA 5DPMA 3PUJA 5ELLA 4A0GA 3H11B 3E7PA 3GL9A 4RSGA 2R79A 3HP7A 5BOVA 5KTSA 1IXYA 3G59A 1QRUA 3PJRA 2B4RO 5CNJA 2WZCA 2VNJA 3L4BC 2YX1A 3NEJA 5KAPA 1NW3A 3BMCA 5I7UA 2DPHA 1Z68A 2IDZA 2REXB 1ZGJA 3BWBA 3IIIA 3CUUA 1JG2A 2EW2A 2Z3ZA 1POWA 2C95A 2VK8A 2DFNA 4QUEA 4XM2A 2O2HA 1KS9A 3ZG6A 1E9DA 2BMWA 5T57A 2ZM6H 1I5OA 4QM6A 1RU3A 5JD3A 4J2TA 2GN6A 1KOLA 1PD1A 2C84A 4KR9A 2Q27A 1XD8A 1GDTA 2O4UX 4EKIA 2DVMA 1PFWA 4IW3B 3KJHA 4IUDS 5J4VA 2PX0A 5IBCA 3OSNA 1SXJC 2ET6A 3KOZA 4JZKA 4HNAA 4O7TA 2HJSA 2WAAA 4LMPA 2UDPA 5F9MA 3UAOA 3DKKA 3VU0A 3EQ9A 3KKLA 4Z54A 2CW7A 3KSAC 3DTYA 1O87A 2R96A 4WHMA 5D1NA 1FJ2A 4I4CA 3TUJC 3UUWA 4M9UA 3ZGVA 3WKDA 4ZMSA 4TQAA 1JYEA 1JWLA 1E9FA 4KR6A 3T94A 5FTLA 1K6JA 4XJSA 3ZYZA 2R84A 4MKHA 3M4XA 3JASA 2G08A 4A3SA 1NVDA 2Z30A 2NPFA 1O4VA 5HRAA 3GLHA 2JIQA 2RC6A 3G5LA 4XAQA 5KJEA 1EKVA 1SA0B 2G1JA 4UAVA 2L42A 5LXTA 3I6QA 1X2BA 2FK2A 1J97A 1A9RA 1FJHA 1G5QA 4TKMA 1H8EA 3LYAA 4I8XA 4E6EA 2OOSA 2NVWA 4UXIA 5FA6A 1Q83A 1KDZA 1XJCA 2ODEA 1DU4A 3SEZA 4IG9A 4TYNA 4EJSB 5TNXA 1CETA 3W1GA 2QM7A 4GRIA 2YWRA 4ZPXA 1I94B 3L7CA 5IF3A 3LF1A 3JTEA 4H7IA 4URHA 4YT5A 4DLAA 3RUEA 3DVAB 4KDEA 1PZFA 1PLKA 3GV0A 4RAOA 4ER6A 4HRVA 1ZD8A 5KYWB 1U0TA 3C6QA 4LOLA 4H15A 2FSIA 4I4TB 4UNPA 4KOEC 2AFHE 3WIOA 4TWBA 2QYHA 3DBVO 3L8EA 3QKSB 1K75A 1QGYA 5C51B 3DF7A 3KALA 4OU5A 4UZEA 1JHYA 1Q0ZA 1DG3A 1Z0ZA 3KQLA 4PIMA 5AMXA 3L6RA 4HAVA 4J90A 4D97A 2G28A 3D2BA 3QYFA 2HX1A 3H99A 2ZUUA 1QV9A 1XF1A 2CXOA 3NJ8A 3PEYA 4GIBA 2AKAB 4UM5A 3X1DA 2AQHA 2YWVA 1IY8A 3GQBA 4KTTE 5KQRA 1CZLA 4IOMA 5D1OB 2EP5A 4NENB 4N7MA 2C5AA 4A8TA 4JJGA 3PL5A 3EWAA 4LZAA 3VVBA 1YB5A 4WNYA 1ZJ4A 5AQEA 1CWUA 3V6LA 5B7QA 4P4TA 1KIFA 3EC2A 4P80A 3PP8A 4ACBA 4DEYA 5JXGA 1RCUA 3KLNA 2DFLA 5KDLA 1QIEA 1DKPA 3MWJA 1NVKA 1Y1VG 3GXBA 2BR4A 4PHCA 4Y6RA 1C0IA 3KAQA 3LBFA 4WEQA 3MPOA 3HP1A 1D4OA 1SAYA 3OX1A 3UFXA 1E8MA 5K3BA 2K7ZA 1J20A 1WDMA 1T5OA 2X3YA 2IEDA 3MJ4A 1SBIA 1TL7C 2VAMA 3ND9A 4GZLA 4KXVA 2LCIA 1RTKA 4AJJA 3JQGB 2ADMA 2VPIA 4EUHA 3QKWA 3DL2A 3D3JA 3GG2A 1NVTA 2IYLD 4F60A 5EPOA 5IAGA 3IOCA 4EARA 3ORQA 1KPHA 3NXSA 4AO8A 3OAAD 4JQOA 2OLKA 3UJNA 1XRMA 4OP2A 4X7MA 3LW8A 3KLMX 2A59A 4FYJA 4IJMA 4V0MA 3LMKA 2HN9A 3BD6A 3OFJA 3FCXA 4A73A 4I4NA 3SC2B 4OOEA 2AJTA 1S0OA 3H5NA 4JYCA 3A9VA 4DYDA 2H1OA 4TYYA 3G0HA 3VOAA 2XYGA 2WQ6A 2W2KB 3MMPA 2HVSA 2WWIA 2O2CA 3MLAA 3P2YA 3CMMA 5D2CA 4BQIA 5ALPA 4F4FA 5BUSA 4W9MC 3NPAA 4MYDA 2AE1A 3AG5A 3GHYA 3SS9X 4DIUA 2UU9B 4CFYA 1X0XA 1ZRMA 3EPKA 2VCYA 4ZT7A 4OI1A 3ML1A 3KE9A 3GDHA 5CBKA 1E4EA 1YB4A 2FG7C 2M9MA 3BCSA 2H3HA 1FVOA 4L02A 1G8HA 4ZOBA 4D42A 5IT9W 4PTZA 1ONNA 4XWGA 2GCNA 3SS8A 4B09A 2P11A 1VBMA 3DAYA 2VR1A 4GLXA 1OH5A 3BK1A 3C6XA 1ISMA 4YP0A 1VRVA 4B6GA 3KQKA 1HNWB 1EBBA 2QJFA 3OZAA 2WKWA 3HS3A 4H7JA 5TPWA 3WZLA 4W5JA 4K05A 1KRWA 5C7YA 1EXDA 2CLKB 4EH1A 2FFJA 4CM9A 5CXQA 4P82A 2I9KA 4J9OA 3LLSA 1BOOA 1GNPA 1KORA 1P0MA 4WBNF 2BHRA 4RZQA 4KXNA 5LQCA 4LJRA 1C3VA 4P5EA 4E03A 1AOXA 2HIMA 3QVXA 5TQ2A 1GPLA 2CW5A 2Z1MA 3OZFA 4D25A 5DHAA 4MVJG 1CQIA 2FSFA 4BV2A 2O0KA 3CEJA 4ALJA 3L92A 3VU8A 1FCJA 3IDAA 621PA 4B4DA 5DLPA 3ACCA 4EJ0A 4EPWA 4NONA 2ZQ5A 3I5XA 1GPKA 4O4HF 1TUIA 1UC5B 4L8VA 4BASA 4OO3A 4B3SB 1NXWA 5DTEA 2QS9A 4R1TA 1L9KA 1N6LA 4IFIA 2EERA 3A1SA 1HE5A 3SHVA 3ZBQA 3GJ7A 4RF2A 5TMDA 4DCOA 2Q62A 1DFIA 4RGYA 3S0JA 4KCGA 3CVVA 5ICCA 3RU2A 1Z7BA 2CMFA 2Z6QA 2O5CA 4DABA 2YWDA 1ZUNA 5E4YA 1IYZA 5JDIC 1NV9A 2XIGA 4BWSC 4R1MA 1AM4D 1Z88A 2GVDC 3B3QA 3FMFA 4DG5A 4JI1B 3ZXUB 2WYIA 2BUBA 4XSHA 1JJBA 1GPBA 5CYPA 3D6JA 1X7ZB 3ID6C 6ABPA 1M83A 2WJHA 1ECCA 3DAGA 2Z56A 4QUAA 3LE8A 3PPYA 2XMQA 3OG9A 4D56A 4YMTA 3LM8A 1IUPA 1E6KA 1VTKA 5CT8A 2ZIEA 1I3CA 5C5CA 5I7WA 5KVQA 1B73A 5JFTA 5F3RA 1ZD4A 3DEZA 3MT8A 5K7SA 1Y37A 2HTFA 3QX7A 1DQYA 1KMNA 5LOVA 2NVBA 1QTQA 2IEGA 3N53A 3GEMA 1M67A 2XRFA 4TSRA 3TL6A 2QX4A 3PIIA 3TIXB 1R0XA 2OC4A 2HLDD 2WYWA 3PXXA 4BP3A 5AQ1A 1F9AA 1XO1A 5H3LA 3RVOA 3DXFA 2QTMA 4GKBA 1DI0A 4BX2A 5A2QA 2MJLA 2OXIA 3ZDZB 5DTRA 4C6SA 1TTHA 4O3MA 1EVZA 4IIJF 5DLGA 1KI4A 4Y6QA 4YDRA 4E08A 4PWQA 1JHUA 3COVA 1Q22A 3AQ4A 5CCEA 3DMRA 1IEXA 1O96B 3SR3A 1Q15A 1SCKA 3MGKA 1I5RA 1OLSA 3ABZA 3CTMA 2ZRFA 2H2IA 4BEBA 3HY4A 5CUQA 1GUAA 4GX5A 2VYNA 4H18A 4BU0A 3PGXA 1XSEA 5CYGA 3H2YA 1GSOA 5DXFA 3UWOA 4YHHB 1K6XA 4MQMA 4BZPA 4TV9F 2JH8A 1RFGE 3FCEA 2PMDA 3DOOA 1DAKA 2VOJA 1FX0B 4XCQA 3U9TA 1JQ3A 5JECA 2QRJA 2HA6A 3ZIDA 4MUBA 2W6NA 1JSXA 3KBOA 1U0FA 4N3AA 1D4FA 3UMRA 5B3LA 1LSUA 3BVPA 1XUOA 4N4AA 2IV7A 3STHA 3KQHA 4HTFA 4R0MA 3F6BX 1OROA 2WUWE 2W2MA 1KMHA 3P4YA 4Y2TA 3BM5A 3WGQA 5LLDA 3C4VA 2HK7A 5T67A 4J0GA 1ZIOA 4Z86A 1GG2A 2AG5A 5CU7A 5LSAA 4NYJR 1W94A 4BJ6A 2OCIA 2YWCA 1KK0A 2QENA 3ZWMA 3TZHA 3ODGA 3T35A 1KGDA 4UCOA 4ZKEA 4C0KA 1DV2A 1DUIA 5BR4A 1PK7A 2GAIA 2YCLA 1DIKA 5DM1A 4HFJA 1OJ7A 5K3CA 3WO1A 4FU0A 2ANBA 3SQNA 1XMOH 5FBKA 1BXKA 2XTAA 4L9RA 1K9VF 3S7ZA 1L6IA 4IOLA 1LI7A 3LF2A 1XTTA 3DBIA 5JS6A 1PR6A 4MKFA 3W8NA 2AOTA 4DJ5X 3BWCA 5TIIA 5KT2A 3P20A 1P33A 1K7YA 4Q7MB 4L72A 1IATA 1E3QA 1CKNA 1K3UB 4Y18A 1PDOA 3PXEA 2RKOA 4K8RB 4I55B 3DXXA 4L76A 3IUSA 1QIJA 1VLZA 3T6KA 1NI5A 1WETA 2Z4RA 2QTBA 3HKBA 1YQUA 2NSYA 4OD0A 5EERA 5HIIA 1Z83A 2MU1A 1ZMTA 2RHOA 1JSRA 2SKDA 3ZGLA 1TA8A 1ULHA 1YCFA 4D9FA 2JASA 3L0ZA 4EHAA 1ZRNA 1X39A 2BQRA 4AVYA 3IE1A 1XPRA 3MYYA 4GVXA 3UV7A 4H6PA 1MEEA 5EWGA 1ZCAA 3PFCA 1Q0RA 3S68A 5KVCA 2C00A 2Y1OA 1ZH8A 3KD3A 2XTJA 2ONCA 3MTEA 4PGFA 1W0JD 4QDJA 3RRXA 4HEJA 1V5EA 1COZA 4WBXC 5EQJB 3V80A 5JAQA 3BE6A 1F6WA 4NNPA 3QRWA 4B79A 4Q7KA 4JQZA 4EI7A 2AXQA 1AJEA 1MW9X 4C4YA 3LC7O 4A91A 3BSWA 3DTNA 3FUXA 4YVFA 3VYWA 5BVGA 3T5AA 3U5TA 1T5SA 4UDYX 3DAAA 4BDTA 2NLOA 3GVXA 3VV2A 4MCIA 4L6CA 2XA9A 2X4DA 3ZIAA 1UBUS 5AM3A 3ABSB 2WNIA 3PXUA 3G8BA 4MV7A 1ENZA 1W76A 1XP8A 3DAHA 3AH8A 1S9DA 3GLUA 4BX0A 3TKYA 4IVQA 1YDEA 4EEYA 4YCBA 3SDZA 5IFKA 4N40A 2O07A 3P2IA 4PFKA 2IHJA 1H5UA 4RH1A 4H4DA 3LHFA 4AQDA 4DUZB 3GUZA 3SYLA 1RJDA 1C3EA 1YVEI 4QLBA 2DR2A 5F35A 1T26A 1M2JA 3C7AA 3DF9A 1JA9A 2PT6A 3WFIA 2PS3A 1HYQA 2H2HA 1WBDA 4UCUA 2CJYA 4HS9A 2F9FA 3LWNA 2QGFA 4ILKA 2JLVA 1RMQA 4P5PA 2I6QA 4PRYA 3ORFA 4QATA 4UVGA 3WK4A 4EQ6A 2ECKA 2VAXA 4F92B 4LRUA 3D6UA 3N8IA 1YD7A 1GKIA 4MPTA 3ZU3A 2OPBA 3F0TA 2PFGA 3M33A 4JQYA 1VBGA 1CQZA 3A0UA 2Z5FA 3NHJA 1UMKA 4XX0A 2ASVA 1KDYA 4OH1A 4MDEA 3L8GA 2ZRHA 3IXQA 1XNRB 1VPEA 3ER8A 5K6AA 1QU3A 3G6YA 2DLDA 2V7UA 2UVQA 2VJPA 5LP6A 3Q4GA 2TMKA 1MLDA 2CVHA 3ESXA 3U7RA 2ERYA 3IEXA 2BDTA 4IZ6A 1SVSA 3G6WA 3MBOA 3B20A 4KWCA 4FFMA 4ARZA 2XWJI 1IUKA 4DLBA 5KJ1A 1JH8A 2ZYWX 1E79A 1I3NA 3DDSA 2GCIA 2B8TA 4BNXA 2P91A 2O8DB 5CNMA 1I2AA 1KEPA 3PD1A 4HTFB 3X1MA 2AYZA 1BS9A 1MX1A 1BVYF 5U9CA 4Q39A 4FX2A 3MINB 4U7HA 3BKXA 1TFRA 4HN4B 1RE1A 2CY0A 5DQIA 4RKQA 3IOYA 1SU8A 2YN4A 1GCGA 1VB3A 1C4KA 1OJLA 4D9EA 4RTMA 2GPSA 4P0TA 3WYDA 2QD4A 4E11A 3H0GA 3KUDA 4JT2A 4DMRA 1KFBB 2GZSA 2Y9MB 3IOBA 1I14A 4KYIB 5DQHA 5E9JA 2OORA 3GNLA 3S2EA 4AKTA 3E3LA 2JLZA 2FEMA 2XA1A 3AHHA 3KKPA 2HNKA 3DLTA 3FOCA 5AOBA 1GU0A 4ZALA 5THKA 4DREA 3B1XA 4QDOA 4BKQA 2FWPA 1JG1A 4NEHB 3V6KA 1UJ6A 4DYHA 3O93A 1MIHA 3B6KA 3K53A 4KXFB 3AIMA 3E0XA 1KRXA 2AFRA 2QV7A 1GRQA 1BE1A 4N41A 4Q03A 4AJ4A 2R93A 2GRUA 5ALYA 1HRKA 4MW4A 3GLVA 4KZPA 5JH7A 4HP8A 4MGYR 1O0SA 1KKUA 1IN8A 2GQRA 1HR0H 1D6NA 1DVRA 2DTEA 2FPXA 3LY8A 3KUUA 4IOJA 1NPDA 4NJOA 4XDZA 3RU9A 5FBVB 3QHQA 3V4RA 2AC7A 2J4FA 2WJZB 1D09A 5IJAA 1AZSC 1GCOA 1TYBE 1IJKA 1GPH1 4M1QA 3I39X 1IJFA 4DHWA 2G09A 3GZNA 2FDXA 1TDJA 4UW9A 2GRJA 3R23A 1X1AA 2PLAA 3UAYA 4V39A 3SX0A 2XGOA 4MA5A 1U2EA 4MARA 5EUQB 2VP6A 4GPIB 1Z5PA 4XYBA 1MG0A 5DYNA 1V3VA 1KZHA 1VL0A 1QMPA 3O5AA 1GGHA 4JUFA 4PO3X 2IKSA 4CBVA 1ZM3A 3L6BA 4QPZA 5HSGA 3ITEA 3KTDA 4H6VA 3JQRA 3P94A 2W8LA 1GSAA 1CR4A 5FBHA 1EP1B 4JEMA 3E81A 3S24A 1FYDA 2LCQA 2Q6OA 4UCTA 4KBYA 1NVGA 1FU8A 4KQFA 2J32A 1GEEA 1RYEA 4R98A 2JLYA 1X6VA 3OA2A 3OPXA 5HQJA 1F9EA 2FMTA 1NE2A 3BTOA 5EMJA 4BJHB 2W57A 4HNUA 4DUYH 1VJ5A 2IF2A 2ODNA 1VBNA 2REQA 2XUAA 3MTGA 5TT0A 3V4VB 4AJKA 1SXPA 2GD1O 4RACA 1L4HA 1M73E 4NQRA 2I29A 5DBHX 4B7CA 2PZLA 2ZYUX 2ZSDA 4AZ0B 2WINI 2AZXA 1G0NA 3DAFA 3R0VA 3G5AA 1PTJA 3H4DA 4KN5A 1C1HA 1U2RA 4MUIA 4UUPA 2ZAMA 4WW0A 1ZHOA 2PH3A 1GTVA 4K6FA 2M98A 3NCHA 3COSA 1DT3A 3K31A 1SH7A 2ZTHA 1ZD3A 3CNBA 2YASA 1GKYA 2JGRA 2QN6A 2QT0A 3GJXC 2CXRA 3NVAA 4PWYA 5TX7A 2G63A 4C5CA 3E18A 4WECA 4TVIA 1SXJA 1GYQA 5HKLA 5I01A 4TZ6A 3WMEA 3VDMA 2ECQA 5LNK1 1US8A 1GL9B 3BD9A 1S3SA 1UFOA 3FROA 4KXQA 4UUMA 3S4YA 4QG3A 4O1IA 3N76A 3BDVA 3BZWA 4BC1A 5JFOA 4OQNA 4Z0HO 1FSZA 3A1FA 3EIEA 3MJTA 4V24A 2XSZD 2VDUE 4ZDJA 3M6LA 3HADA 3ZS8A 5KJFA 5C32A 3ITDA 1KYTA 1P75A 5ALOA 1S7GA 3N42B 1XVUA 2XH8A 3ESBA 3LAWA 1CDOA 1UXJA 4PZAA