3ETJA

Crystal structure e. coli purk in complex with mg, adp, and pi
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
b'MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
molecule tags Lyase
source organism Escherichia coli
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3etjA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3etjA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3etjA01
4FGRA 4HQ6A 1M6VA 1KC7A 5LXTF 2NU6B 2YRXA 2XCLA 2YZLA 5J2UF 4ZQIA 4FFNA 4FE2A 2C00A 1I7LA 2XD4A 2FPPB 5JQGF 1EHIA 3V4SA 4TUYF 1PK8A 2QF7A 1A9XA 2J9GA 4O7YA 1CQIB 3K3PA 1JKJB 4HNUA 1AUXA 5JVLA 3KAJA 1CS0A 1WR2A 1GSAA 2W6PA 4MV8A 2DWCA 2GQSA 3Q2OA 1JDEA 1DV1A 2GLTA 3VPBA 4O4LF 1GLVA 2PVPA 2FPIB 3V4ZA 1GSOA 1KJ8A 2GQRA 1Z2NX 5LYJF 3ETJA 3K5IA 5CA1F 4M9UA 4O7SA 4MV9A 5BMVF 4O7LA 1AUVA 1UC9A 2I87A 4XYMB 4O7WA 1M0TA 1KUTA 4MV6A 2X0SA 4YAJB 3G8CA 3ORRA 3BG5A 2YW2A 4DLKA 5H80A 4O86A 2R7LA 3ETHA 1KJIA 2YZMA 3TIGA 1KJQA 1KEEA 2GPWA 1C30A 4E4TA 4O7VA 5KX5F 4O82A 4QSHA 1E4EA 3SE7A 3VA7A 1Z2OX 2Z02A 4ME6A 4IHJF 1E4EB 5I47A 4YB8B 2CZGA 1UC8A 2YRWA 4M99A 3DF7A 2FB9A 4I55F 3VPDA 2QK4A 2NUAB 4C5AA 3JRWA 5DMXA 5C1OA 1BNCA 5CAEB 1ULZA 4M98A 2VQDA 3MJFA 4FFPA 1A48A 2CNQA 5IYZF 4EA8A 4HR7A 3K5HA 3LP8A 3MWEA 4EABA 1OBDA 4O4JF 2VR1A 4YJ3F 1EUCB 4FFMA 3G8DA 3BSYA 5FNVF 4O83A 4O7TA 3RUPA 3HO8A 3TINA 4EA9A 5KKNB 2OLSA 4I4TF 4TV8F 5K2MA 2YYAA 3WNZA 3RV3A 3BSSA 3R9RA 3JRXA 1BXRA 1GGOA 4M9CA 1Z2PX 2V58A 3BFPA 2W6QA 3KREA 2IP4A 2NU8B 4XYLB 5BPFA 5CB4F 2DIKA 4YAKB 3U9SA 3VMMA 5JH7F 3LWBA 4EGJA 4O4HF 2ZDHA 4FFRA 2NPOA 4MV1A 2R7KA 5D8DA 1VBGA 4YJ2F 3RFCA 4ZI7F 1PX2A 1W93A 4O7ZA 5BPHA 1EZ1A 4YBZB 3TW6A 4WBNF 3R5XA 3RV4A 3N8DA 1B6SA 3WO1A 1B6RA 1VBHA 2R86A 4O84A 4Y8VB 5CA0F 5JQWA 5J2TF 2ZDGA 4O2AF 4MAMA 4EA7A 3WO0A 4O7NA 4DIMA 4HNTA 3VPCA 2W70A 3MWDA 2W6MA 4ZOLF 4L1KA 4HNVA 3GLKA 2YS7A 2P0AA 1DIKA 2W6NA 2PN1A 1I7NA 1VKZA 3OUZA 1DV2A 3I12A 3UFXB 2R82A 2V59A 3TQTA 3KALA 4RZQA 3VOTA 2GPSA 5HV6A 1OBGA 1KBLA 3R5HA 4EG0A 2VHEA 2W71A 4MV4A 4MA0A 4ZHQF 4J6EA 2YS6A 2Z04A 4TV9F 5HBRB 1JLLB 4IWYA 5LOVF 1M0WA 2FP4B 4IWXA 3JZIA 2FPGB 2NU9B 3Q1KA 3TIIA 2WYOA 3U54A 2YL2A 1JDBB 3NUAA 1CQJB 4I50F 5C8YF 4FFOA 2NU7B 3R5FA 1CE8A 1KJ9A 5LP6F 2R6FA 2CQYA 3HB9A 3U55A 1IOWA 5EZYF 3BSWA 4IIJF 2W6OA 2I8CA 4FU0A 2CNVA 3AX6A 2R7MA 2V5AA 4WD3A 1SCUB 2HJWA 4C5BA 2R7NA 1T36A 5LA6F 4GGMX 3E5NA 4O81A 2DLNA 1EYZA 2R84A 2YZNA 1C3OA 4O2BF 1GSHA 3JZFA 2YWVA 4EAAA 4MV3A 2R85A 3QFFA 2R87A 3N6RA 2ZDQA 5JVDF 3HBLA 1EUDB 4XX0B 4MV7A 3AW8A 3KAKA 4NYEA 3ORQA 3OUUA 2SCUB 4C5CA 3U9TA 2YZGA 3GIDA 4MA5A 1W96A 2CNUA 2PBZA 2HGSA 4IZOA 1IOVA 4O7RA 1KJJA 2VPQA 4O4IF 4EGQA 2DZDA 2I80A 5C1PA 2W6ZA 5GONF 4XZ3B 4FFLA 3R23A
chains in the Genus database with same CATH superfamily
1GRVA 3OTOH 3AJRA 4DCVA 4NV0A 4TWIA 1A0IA 1QP8A 4JXJA 2QRKA 4Z99A 1UBFA 1GU1A 1UP6A 3JQ7B 1CZRA 2HC9A 3FWPA 4F86A 5I4KA 5FR9A 4YH1A 1PX0A 4CMAA 1VTKA 3PQDA 4ZYYA 5ILQA 3GARA 2E48A 4QODA 5FD8A 1PCXA 1E2UA 3H6KA 3LGSA 2II6A 4Z4FA 2C00A 1LXCA 3PUWA 4Y9DA 1VG1A 3D3QA 5KDLA 4CIWA 3BIXA 3EEBA 3E9CA 4YY3B 3BIJA 4U39A 1O96B 3DWFA 3IPAA 4X60A 4OJTA 4TUYF 4Q9AA 3O38A 3WHPA 5HKBA 1PK8A 4RVCA 4J7CA 5EJIA 3GJZA 4DRFA 1MCZA 2AEFA 1QO0A 2EATA 1WSAA 2FW9A 2IPOA 3BAZA 3D7LA 5H59A 3LC0A 3K3PA 1ODLA 2AA3A 4NZNA 5J59A 5T57A 1JU3A 3PBKA 3YASA 2FZVA 5FTLA 4UHBA 2UXBH 3AEKB 5BR8B 2V65A 4G56A 3Q7IA 3JYPA 3TF5A 1H5NA 2CNDA 3QV1A 3CCBA 2R8OA 2VP2A 1ZG3A 3A9VA 3EPIA 2ASJA 4KWHA 2YY7A 1NZDA 3BN3A 3DVSX 4QSMA 4G23A 4DA9A 1EHYA 4LMYA 1XD2B 3V8MA 1V39A 1N75A 3K0SA 2FZEA 2UYQA 4UXHA 3JCZA 3LW7A 5IUKC 3LBIA 4YAIA 3GDOA 1CDEA 1T0IA 4UDNA 1JFTA 3F2IA 3ZI0A 2WTMA 4JKIA 4X7RA 1XU7A 3EPKA 1JIUA 4U5QA 3GX1A 4ZEVA 3EPJA 3KELA 3KB2A 1KK0A 8ADHA 3GQCA 1H5QA 4N5LA 3PEYA 1GLVA 2PVPA 4FUQA 4YP6A 4OBWA 2GM3A 3OZGA 2WRZA 2Y4NA 4KR9A 2BH2A 1BA2A 2QTVA 3C1TA 3COVA 3O4GA 3UGTA 2CUNA 3ZS8A 2VDLB 3LPLA 4GBED 1B8NA 2BI8A 2FK2A 4BLQA 1KJ8A 2HMYB 3HRIA 5T4HA 2ZAMA 3QHAA 3DMNA 1FDIA 4MYTA 3UXYA 1X92A 1BYUA 2IZ0A 5ESDA 1M1NB 1NVXQ 5K20A 4HLCA 3CMCO 3NVAA 1AN9A 2WB2A 2AWOA 5B5SA 2WKWA 3OBIA 1FQWA 5EP2A 2WJ3A 1G1MA 5CB0A 1T1IA 2O23A 2OV2A 3LT2A 1IUKA 1P1CA 5KJCA 4IPTA 2E1RA 4NICA 1Z7WA 1WXXA 5BSHA 4O7WA 2ON6A 3FTFA 2JFNA 2AOUA 3TPFA 4EFEA 1KUTA 3TY8A 4FBTA 1N32H 1GGKA 1NW3A 2IF0A 3NIDB 1EMDA 4OQYA 2H1OA 2G83A 4LW8A 3W5BA 4LHXA 1VA5A 1UDWA 2HJRA 4FWBA 2JEZA 3SIXA 1NV8A 2IHTA 2ZUTA 2RH5A 1S8OA 3MNFA 2XVYA 3W06A 1X1BA 4RDHA 5IZCA 3G8BA 2BFEA 4W5TA 1JEQA 5L1JA 5ALEA 3E0XA 9LDTA 1C7ZA 1SCAA 2DFPA 3NOQA 2C95A 2AC4A 4ZI3A 2AFHA 5FH9A 4XPIB 5KNDA 1IBMB 4X7BA 1NJ1A 1MB2A 2W0MA 2X5KO 2C31A 5CMLA 3M83A 5DIZA 4WEOA 1F0PA 4UEWA 3ROPA 4DUZH 1FFGA 3EZ9A 3EXAA 5IT9A 1NNEA 3O93A 1Z2DA 1U7WA 3IOYA 3KX2A 3ZWPA 1PZEA 3O75A 4D3SA 4KFRA 4ROTA 1MW8X 3DC7A 2J6IA 2YCLA 1FDRA 1MAVA 4W7IA 4BFCA 4E3WA 1GFIA 4PCUA 4XQ0A 3SE7A 1T6BY 5K0GA 1D5WA 4UUGA 1FYFA 1T3LA 4GUDA 1QRAA 4BTLA 3PA8A 4L3OA 3PRYA 4U7FA 3UJBA 1PAUA 2P7IA 2WVGA 3QLTA 5EPUA 4QLOA 2ADMA 2VXBA 2FW8A 3FB4A 4H1VA 3UXHA 3V46A 3NKFA 5SICE 5FOVA 2W48A 1EFLA 1Y7PA 4E5SA 5IHPA 2EJ0A 2BUCA 3MUNA 4K9SA 1KR2A 4E70A 3KCNA 3K6SB 2BSQA 1A9TA 4O3SA 2D2VA 3LHKA 2R7ZA 2VYQA 4DLSA 3RHZA 2NACA 1YVDA 2ZEJA 1CVRA 4BAGA 2W4MA 5AOAA 4RJ2A 5F23A 5B2EA 2E3JA 4QQKA 1NLZA 1WY7A 3H97A 2GEVA 1ZD4A 2G80A 3MAJA 3PDUA 4X54A 4ZVRA 4BMCA 2FEPA 3PWKA 4LOJA 4JUBA 4DZZA 1T3NA 3EWNA 4BZXA 3S2IA 4X62H 2FXIA 1NQTA 2P5TB 2XKAA 3A1UA 3AVUA 5EYPA 2BOVA 4F4JA 4ND8A 1W88B 1L7OA 3BIWA 4EFKA 3JY6A 1C9MA 4OIFA 4MB0A 4TTIA 3OQMA 2EJUA 5CNKA 3TFWA 2BGLA 5F1PA 4BV8A 3V7NA 4EUEA 2Y1KA 1RXUA 1YULA 3GRUA 2GK4A 1U1FA 4L4YA 4QXPA 1QHSA 4YRLA 3QWFA 4BEVA 1UP7A 2NW6A 1A8IA 4AUNA 2ZRNA 1JHYA 3PVZA 2QTZA 1IBSA 4HUTA 2EVWX 5HR5A 4QWCA 3PU6A 1CUFA 4V0NA 1IG3A 1O4WA 4YJ3F 2H00A 4X65B 3F6SA 3QY9A 4QD3A 4BFXA 5K8LA 3HUFA 4X1OA 2DFLA 1KYWA 2C92A 5JASA 5KSWB 5FPSA 3THWA 3TLEA 4JYMA 3FJ1A 4R8VA 3WYEA 3JQAB 2X1HA 2JG3A 4O83A 2VSXA 1GXSB 1ZM9A 1I6UA 2IEBA 2A9FA 2E7ZA 3HO8A 3SKYA 4PZPA 2O8VA 4QRHA 3HI6A 3QXJA 5FBLB 4FJ1A 3BKXA 4XB1A 1VHWA 1PJQA 3UQZA 4U0JA 1YASA 4W99A 3O8CA 5BWRA 2H59A 4MW2A 1LQTA 5JADA 2RHOA 4UREA 1G6OA 1KVRA 1U2RA 4WK0B 1G41A 1RPAA 3GLFB 3GTOA 1S9FA 1Y4ZA 2GZSA 3KUKA 2V7XA 3KZ1E 4YLGA 4BDTA 5GGYA 3CSSA 4M9RA 3D64A 1MC8A 1F20A 4QFBA 4M9CA 4XEUA 3CRMA 2XNHA 4C4ZA 2I67A 2J5BA 3FLMA 4QWBA 4GOMD 3SP1A 3RW9A 3TUIC 1Y1SA 2JIZD 3PEEA 5BWOA 1X7XA 3LWZA 4Y6LA 2HHCA 3GIQA 4JC8A 1LDMA 3VR4D 3OP4A 1A9XB 3JQBC 5NLLA 3K1AB 1PEAA 2C99A 3PC8A 2APJA 1OBHA 1QOZA 2QI9C 5FEUA 1T8YA 2QW1A 3OPYI 2H4YA 4KX5A 3K3VA 2OBNA 3G8YA 1UPBA 3T5HA 1QVAA 2HUPA 4NBWA 3RUFA 4X5OA 5BMVB 5J2UA 1X86B 3IG0A 2IEIA 4UTZA 4L8LA 1TRHA 5ERYA 1JJFA 1YB5A 2RIRA 3NC4A 4JJZA 1CY2A 4B2YA 3T7IA 4DR5H 3WMRA 4A0GA 3PHCA 2D1QA 3R3SA 2F6RA 3N8IA 4IFEA 2WSMA 3EISA 3SHQA 1XTJA 2FK8A 4NH0A 3FTCA 1N36H 4MQEB 4B84A 1AOXA 4UC0A 5IF3A 3ESCA 2KYRA 1VLJA 3SHWA 2UUBB 2X3YA 1VPDA 3PNKA 1WB6A 2XV1A 2MINB 4AJIA 3TY9A 1KE2A 4P33A 3T5AA 3ZIDA 4HDSB 2PFSA 3EAQA 1GCUA 1ZH4A 3KJQA 1JDJA 4IF6A 4MRAA 2NV0A 2FH5B 4RXUA 4M8NE 2ZB8A 5BNZA 1ZAUA 4TVIA 1ZIPA 3KUDA 5KKCA 1WZ2A 1A95A 3NNSA 4AD8A 2D1RA 4F8EA 3ICQB 3N8DA 3O3MB 3NDBB 5EVJA 2A9QA 2IOFA 1X38A 3G5LA 1TJPB 1ZVQA 4L51A 3SYLA 3L8FA 2ZWOA 3MSXA 1YQWA 4DBZA 2P69A 4I1YA 4JN6B 2GCEA 1B6RA 1OBCA 2PX2A 2I5PO 3DFFA 4EBEA 3OA2A 4JC5A 4EHHA 4Z7NB 4JH0A 4IRCA 2RI0A 3PQ4A 2Y3IA 1L5WA 3WGOA 1UK8A 4BGIA 1B4DA 2XYPA 3UMVA 2UDPA 2PD3A 4J29A 2V6JA 2VATA 1PU2A 2XCQA 1C1YA 4PCLA 3Q41A 1RAGA 3W8EA 3WA6A 5AW0A 4UULA 2CV0A 4EMTA 1OWTA 3LE8A 5G0TA 2YH2A 1JBEA 1OIXA 4J4BA 3QVLA 3CRZA 3N6XA 4K8RB 2XUOA 5I5EA 3NJ4A 4HTAA 1XZNA 3RANA 1ADCA 1DRWA 1LBSA 3NBFA 1ZMOA 4N3BA 3T5DA 3T54A 3TE6A 3GLKA 2VCEA 3QKIA 1X9GA 2V9PA 2Z6VA 2ZUDA 5K05A 4WX2B 4BGEA 1IYEA 4AAYA 2JARA 4DNQA 2E2WA 4J9KA 4U0KA 3AKCA 4REOA 1G9XA 2QMZA 4C21A 3D7NA 4RF3A 3DKIA 1E7RA 3VPAA 4C4PA 3DEJA 2PKXA 4YQFA 1WDLA 1GL6A 2J3LA 1XKXA 4HNAB 1XRNA 2R82A 3AUSA 1GTZA 3MINB 4OGFA 5K3OA 4F1KA 1NR5A 1R9MA 1CZUA 2JIPA 2PZEA 1O4VA 2YYSA 4Q3BA 1DO0A 2PGLA 2Y1GA 5FTNA 3WAGA 1UOEA 2F43B 2BKVA 2JZOA 3TLAA 4YV1A 4XIYA 5DTRA 1GAWA 1TEXA 1J22A 2CHFA 4PY2A 1STOA 2AJCA 1QH1B 2YVQA 3HYCA 4HVCA 3ANNA 5JXWA 1YD7A 3K0KA 2C78A 4F3CA 4IOMA 2I6QA 4P38A 5DISB 1TTHA 1S8FA 2Y66A 3T7CA 2J6CA 1VJRA 4YUXA 1RABA 2JFHA 4LXIA 1UKVY 5FDFA 5IJ9A 1NLFA 3QVSA 3QXCA 1HX7A 2A9RA 1UM9B 3Q3VA 4MZDA 5EI5A 3G23A 5BV0A 2WNSA 3STYA 2QAGC 1J8VA 2KLHA 3M0EA 1XP5A 4BN5A 1OAKA 5JCZA 4TYYA 5ALZA 1O08A 3I04M 1WH2A 1M0WA 1S0OA 2R1ZA 2ZJ0A 3AFGA 3QFCA 4EQZA 5CFRA 621PA 4P7BA 5J2TA 3SMVA 4DJ5X 2AEMA 4X6YA 3G5UA 5C3UA 5KOJA 2HDHA 3CG4A 4B8ZA 1AURA 2FX2A 3STWA 3NTRA 4HC4A 4O2AA 3UAVA 1G5FA 2V6IA 1ZGHA 2ZR7A 5CA1A 3ZK8A 1U3VA 5KFUA 4OV6B 2ERYA 3LCRA 4L9SA 5ESWA 5IJ0B 3MIIA 3H8VA 4KR3A 1SIBE 3O1HB 4EGCB 5I5GA 3ROGA 1YA4A 4UPDA 3TSCA 3LGXA 1TK3A 4CVNA 2ZYAA 5GZ6A 5DT9A 3G13A 1GTG1 1CE8A 2O03A 1P2SA 1NXVA 2PTHA 3DHNA 4GP6A 4BE4A 2HMAA 4BVBA 2PGJA 4OUDA 4M1KA 2PXAA 4EI8A 2P9ZA 2WY2D 5DN6D 4ZP1A 3HGQA 2XF8A 3E2IA 5JSQA 3H7IA 1EJ0A 1ZMBA 1CUBA 3L5OA 5FBVB 3NBAA 3ND7A 1VCHA 2ZFUA 1AQYA 5BW6B 1DG1G 3BSWA 3WL6A 3IURA 5I60A 1DCKA 5B3JA 4OX9Y 4DM3A 3MFQA 4HEA1 2C03A 2JVIA 1BFDA 4FONA 3BFKA 2YY6A 2ZJ2A 1VE9A 2HBZA 4PO3X 1DIGA 2VA8A 2B7LA 3NMUF 2NYUA 1EQ2A 3HYTA 3KHTA 3OE7A 4JT9A 4NBRA 2BMWA 3CVUA 1YBMA 3JQ8B 4TXLA 1KZ9A 1CUXA 5IUNC 2PQMA 3TW7A 1ZUWA 4WNCA 1FP6A 2N0SA 1YBAA 4JI2H 3A8TA 4YCSA 5E0OA 2B99A 4QATA 1GQOA 3C0FB 3NALA 4QOIA 5DZSA 2PZGA 1ISGA 1E2NA 2DPYA 2AQ4A 3FPLA 3NH9A 5CR9A 3UWOA 3T9AA 1J2TA 3IKMB 3PHHA 1ATIA 4MMYB 3TCXB 1T9CA 1HG1A 3R9KA 4X91A 1G63A 2CF6A 4HGQA 1VLQA 2OWDA 3CCFA 2WPDD 3H9GA 4UCSA 2R00A 3R4VA 1AD2A 4UPVA 5KFVA 2J67A 5KYUB 2XBUA 5LM3A 1JKIA 1ORHA 4LMRA 2FSFA 4BVJA 3D3JA 1ZIOA 2XI4A 4R0NA 3VV3A 1ESNA 3KSAC 2X9GA 1GFWA 4TM5A 4LDRA 3KBBA 1VIDA 1U8EA 4FDVA 4XUDA 5CH8A 4PQGA 4CPDA 1Q0QA 1AGRA 5E6SA 3MXOA 4EW6A 1UFOA 2WTEA 1M33A 3HJGA 2YJ6A 2R85A 1XX6A 4O4HB 5EXSA 3U9LA 1KAHA 4U7JA 4A0QA 3BWEA 3I1JA 3COYA 2B2CA 1NQUA 1XVAA 2ANBA 4BMPB 4QUGA 1IWBB 2IU0A 2J85A 3CF4G 3O94A 4NVRA 2BC9A 4KO4S 4BUJA 2ODEA 5DBIA 3KV1A 1SULA 3SLKA 2VJPA 2ZIXB 3OSUA 4MIOA 5TMPA 4I6EA 2AN5A 4ESHA 3IHKA 4MA5A 3D8BA 3L06A 4A3KG 3BC1A 1Q16A 3CPHA 4RMJA 5TEVA 5L3QA 1JHMA 4UW9A 2JGJA 4TPKA 4GE0A 1MKYA 3OZUA 5D85A 1EVJA 1ZBDA 3TFQA 1FYXA 1SC3A 3LX4A 2P0YA 4YAJA 4DMFA 3E1GA 1B04A 4JLVA 4WN3A 5T3UA 2NTEA 1BU5A 3SF8B 3W6NA 1L4MA 3J81k 2IYPA 1RQLA 1L7AA 2R4TA 4HWGA 3ZWYA 4E21A 3VGJA 4FFLA 5FWXA 3UT0A 1E59A 1X19A 2MU1A 4FGUA 3BXFA 2CJWB 3ITKA 4WFKA 3UAZA 4LTDA 3RODA 3QG5A 4ZV7A 4BFSA 3PJGA 4LE2A 5K4HA 4M1EA 2DHEA 3C5HA 1BU8A 4KZKA 3FFTA 1PR6A 2NSJA 1A88A 5J2UF 4OMDA 3CO0S 1MB3A 5JECA 3VZQA 5J43A 3FTPA 3L0PA 4R4JA 2XUKA 5KTMA 3OI7A 1QF9A 4TQRA 3DCYA 3FVTA 4CKZA 3QWUA 4YP3A 4UAUA 3CB4A 4DREA 2VUHB 3B9BA 4OLAA 1GA1A 2C7RA 3V4SA 3ZHBA 1II9A 2NU7A 1OLXB 4H7HA 4ID3A 2QF7A 3DDSA 4IG4A 1J09A 1LB1B 1NPTO 1Q20A 2CF5A 2JIRA 3GRFA 3WNDA 2XXJA 1Z73A 4DT1A 1J97A 4I6GA 4K9RA 4S24A 1X9IA 3KYHC 4URYR 2PA3A 3FLEA 2N75A 3CZ4A 1J7KA 3HTXA 1M2HA 3OU2A 3RYFB 2YIMA 5LYJA 4QQNA 1FP4A 1EXNA 5CYFA 1SWVA 1XVUA 2Z30A 2VYVD 4HLDA 3UW3A 1K4YA 5LR6A 2HSJA 1XTTA 2WDPA 4RE6A 4A6EA 4IY1A 2D0IA 3ESBA 2PDAA 3MOGA 4RAYA 3EOBI 5THXA 5KDOA 1N32B 2H54A 2EGHA 3ZZ1A 5B3KA 2IS6A 1II8A 1CRLA 1YA8A 1P45A 1WXWA 2AI1A 5H9VA 1QMGA 1J9ZA 2O8DB 3E9ZA 4OQZA 1ZNZA 4OHMA 5LBTA 4LI0A 1GQ2A 1KI3A 2XE7A 2G9UA 4MW1A 5JBIA 3DTVB 2ZBPA 4O4LF 1BMTA 3MUOA 4FE4A 4KYVA 4XASA 4TWAA 4XGRA 1J00A 1OQAA 2VTDA 2VDWB 3K73O 4RZSA 3TX6A 5DQIA 4QQ8A 1TA4A 2OZLB 4B4KA 1GSOA 1N8SA 5D3KA 1X94A 4R1TA 4ZREA 2AQHA 5D3QA 4YJ3A 3FBGA 3CUEF 4G63A 3DEKA 5JT1A 2EKLA 1ODJA 3JYOA 4RNDB 1QGYA 2VRBA 5EQFA 2WJ4A 2FPOA 1KNXA 2AN9A 3TX2A 3BL5A 2AS0A 5KG1A 3K9LA 1NY5A 4LAFA 2ZRQA 2GPTA 1R9NA 4LYYA 1H69A 1GNPA 4MLDA 3QITA 4PPYA 2AFHB 3ZKWA 3OESA 1VP3A 3C5WP 4ECAA 2AZXA 1IZZA 2I87A 2G6TA 3H8SA 4ECEA 4JUCA 3RB0A 1QH9A 1Y3FE 1C3VA 1ESDA 1ZN8A 2G88A 2JRLA 3JVVA 3OIVA 4S1VA 1Y1KE 2FFBA 4CUZA 2Z3WA 4DR7B 4DQ0A 3CISA 3ENKA 2ZZNA 4YWHA 5IN4A 2JHPA 2H52A 1CKNA 3IDSA 2EFCB 3KJEA 1KGDA 4K87A 4UASA 1E79A 5CA1B 1PJBA 3IKLA 1DC6A 1ML3A 1XZKA 3NCHA 3JQ9C 3JQQA 5JR3A 1AV7A 2B25A 2FZWA 3IT2A 1KAEA 2XZDA 3WLAA 2CDNA 4NMLA 3VNBA 1VSUA 2VLBA 1P1RA 1HQYE 2B2XA 2R6R1 1U0TA 3GEPA 4G4SO 3VO2A 2VDWA 2W57A 2J9FB 2QLLA 1FSSA 2YYZA 4NAVA 4II2A 1C7IA 3EY4A 3F3MA 5FPKA 5KREA 2B37A 3BREA 4OGWA 1XQYA 4QECA 2I3GA 2W37A 4K3UA 1LVGA 2HCJB 4LZLA 5BQOA 5MF6A 3CEPB 2OUKA 1N5MA 5B36A 1X77A 2NT4A 2FTKE 1GNTA 1Q17A 2P40A 1NMQA 1RK5A 1YS4A 4D9EA 4KGVA 2ZBQA 3DT9A 1U2EA 5GQSA 1Y14B 3ZE8A 2I6SA 4LSZA 5DB4A 1EJ2A 3C74A 3AB8A 2GTIA 1COWA 5B53A 1C1DA 5BQ3A 3M33A 4AU1A 5IYZA 1DTWA 2VAPA 3HLKA 3BGWA 1E6UA 1EH5A 2GJ8A 2Y9PB 4I4TA 3KT0A 3MXTA 1V3VA 2IT1A 8LDHA 4TN1A 1BCSA 2GXAA 3Q12A 2ERXA 2FOXA 2PNFA 4PG4A 5SZKB 5IYCG 4KQMA 1VJDA 2YRWA 2CVQA 3IEUA 3HSYA 4PTYA 4QM7A 3EW7A 2G1AA 2VJCA 5LCXA 2JJQA 4CKCA 2WZDA 4ID9A 3E2PA 3HO6A 3VO8A 1A8SA 3QY0A 1E2MA 4ADSG 2AW3A 3USES 3DPSA 3R8XA 3PWSA 1JMVA 2QP3A 1WXEA 4QNNA 1NDHA 2G70A 2BN4A 1WZUA 4J9OA 3CWCA 1J5XA 1P1HA 2R8IA 3L4SO 4IICA 4YRJA 1DOHA 3OTIA 3MWKA 4Q1AA 4ENRA 4X66H 4KL8S 1BE6A 1PR3A 4OL0A 2Q6VA 1W94A 5FPHA 1D5CA 1PWEA 3H5NA 3GGOA 1WZNA 4BEJA 5CB4A 4YYZA 4PG6A 2VUUA 1J7JA 1HYBA 1JIIA 4OAOA 4WKNA 3CZRA 3VR6H 3T94A 4A6PA 4AZ0A 1VBMA 2VXCA 3WYFA 2NTNA 4CWAA 4E5VA 2UKDA 5JH7A 4RB3C 4Z8YA 3NYQA 3QX3A 1RWXA 3VYWA 4DM7A 1ZU5A 4F46A 2OC4A 3LWNA 2NZUG 3DWGA 2IV7A 1WCV1 1CF4A 4E03A 4BV2A 2SKCA 1OGJA 3KEOA 1QG2A 1VPEA 2ODAA 3O91A 3PKJA 4WCFB 4EVIA 1SQSA 4J0EA 4MUEA 5TGTA 4BGVA 2IDMA 1SHTX 2RAUA 3SF0A 1GDTA 4FQ8A 4I81A 1GGMA 3BDIA 4IXMA 5DHQA 4B9AA 3VV2A 4LDJA 2IUYA 4RKRA 4BNZA 2H1FA 4G0PA 4ZHSA 5KBYA 3EF3A 3PX7A 3A4NA 1GYRA 4AYBA 2PSDA 3D3WB 3CUWA 3D4PA 3PHIA 1GNLA 2J9XB 1NJ2A 4UCXA 3KETA 1KWKA 2JFZA 5KYXA 5JUMA 3U3JA 1IY1A 1V9SA 1QQ5A 4RGVA 5TDHA 4BFWA 1GPKA 4LVUA 4XYGA 1G9SA 4FD3A 2VJKA 4TV8F 5TPZD 2GO7A 3VSAA 3WYBA 3WAJA 2RGWA 2SCUA 1R6TA 3M4JA 1AQIA 2WUFA 3HYLA 4PHHA 3R7AA 3UB2A 1TWGA 1ZX1A 2HLHA 5DJ5A 5GV8A 4RJJA 3HJUA 1VKNA 2SECE 3TRFA 1E1DA 3GJSA 4ZJYA 1D0VA 2HJ9A 1SVLA 4FMDB 3AI2A 4PFSA 2VTBB 1ZNQO 3DH0A 3G79A 4MP8A 2Q7DA 4Q5IA 1KZHA 5M34A 3RFVA 5AKYA 4G67A 4AMYA 3FNBA 4IYJA 1KMQA 3AH8A 3LHFA 4APMA 1MA3A 4PQEA 3NHWA 3AL2A 3FSGD 4OK3A 4IV5A 3UN1A 2PUTA 3KQOA 4IMJB 4OYRA 5FWYB 5GJWC 2C82A 1K7XB 4NNPA 2LUOA 2P3OA 1M1UA 1AHIA 1I1KA 2WMYA 3PO2G 1QVRA 2F2TA 3L93A 4ZAFA 3REQA 2PX3A 3Q88A 1CEXA 3RS8A 1S89A 2I3ZA 5B37A 1YI1A 4JEUA 5CP8A 1E1RA 3FOCA 4HQNA 1WUJS 3ZLBA 4N0DA 1NBWB 2O8CB 2LRHA 5C80A 5KFTA 5F1YA 1X8JA 1PLJA 3SDSA 4K05A 3A2LA 3UENA 3LQYA 2EIHA 3UZUA 5IJZA 3MUFA 3UPTA 5LXTA 1GO3E 2A9PA 1PR2A 2XECA 3IAUA 5C46F 4XLLA 1A98A 3ET4A 1HNWB 1EUQA 5KB3A 1NQVA 3S99A 2HV8A 1W4BA 5BSEA 3VC7A 1ADYA 4MWDA 2ATVA 1NUSA 2B36A 4DNPA 3KL2A 2XCSB 5HXAA 2RHCA 1JH8A 4IJQA 3SC4A 4DLZA 1YONA 1SOVA 1H0KA 3CH7A 2JHAA 3HXTA 1M8PA 4LWZA 4P98A 2WM3A 4G0XA 1XCGB 1O97C 1OAOA 5LA6A 5EFZA 1SOWA 2J9YB 1ZM4A 4OI4A 1U8YA 2YYYA 1XCLA 4MR7B 4CL8A 5EZSA 5A05A 3OCVA 3STXA 1CW2B 2GQ0A 1A27A 2FN4A 5JSHA 1E96A 1FEZA 3KYCB 1JHRA 5J9FA 1GV1A 5K8VA 2JGEA 1U8TA 3PV0A 1J2JA 3PEVA 4GOLD 2WQ6A 1JR6A 1RZ3A 3CEAA 4LKOA 1NXQA 2UXCH 1G8KA 5F77A 4S12A 1Z18A 1HL7A 2P75A 3JZAA 3FXAA 1S68A 2FW7A 4J3FA 1KZ1A 1JG6A 1NTOA 3LX8A 3QVTA 3DAPA 4HMQA 4L1KA 4HNVA 4D96A 2DUNA 2G76A 1V4NA 4QRDA 2I3AA 4LY6A 4N03A 3TOVA 1P9NA 4MXDA 3SQWA 5JY6A 2JGLA 4KAAA 1EBBA 3DL4A 2GMWA 4EHIA 1CJMA 1Z6PA 5ICFA 4F6LA 1KWGA 4ZQFA 4D8VA 4HYEA 4XQGA 5HCNA 3ZYZA 4ZQBA 1GPDG 1DIKA 2JH3A 3IO3A 2J3MA 4JOSA 4QELA 4W8GA 4P32A 3W2HA 1MFPA 1UZAA 2CHQA 3G2JA 3PTZA 4X93A 4QG3A 5AVXA 5D1OB 4H15A 4X92A 3KXDA 3LAWA 4IIJA 1E5LA 1DV2A 1N2CB 3UF0A 4FB5A 5BN4A 1XCOA 3PN1A 1RKXA 2X86A 3UKDA 3KE9A 3S8YA 5ICEA 2W6IA 3ROZA 4O2BA 1NMYA 1O95A 3ZNNA 3SBOA 4XYBA 5EIEA 2H3EA 2GPSA 5HV6A 3Q7PA 4W5WA 4CM4A 2WJHA 3B3QA 5ALDA 4XLZA 4B48A 3A2MA 3EDYA 3QLUA 2VHXA 2Q4DA 1ICEA 3UPUA 2R47A 5G41A 4B44A 3PFNA 3D8UA 1Q3TA 4URFA 1IOZA 2A58A 1R0CA 1YS9A 1BMFD 2Q5QA 2WLTA 1CG6A 3PSHA 3TGPA 4UOQA 4US0R 3ZWXA 4YPOA 4LSWA 4XIIA 2X4DA 1R64A 3LOUA 1W2WB 4PC6A 4F45A 3B13B 4DDTA 2HF2A 1AN7A 3A04A 5KJEA 3RT9A 1U9IA 3D3NA 3LOQA 3H4DA 4BQNA 4FSDA 1QJ4A 1QE3A 2FUKA 2R1VA 3CH4B 4FLEA 4FSXA 4FYYA 4B31A 3T1YB 2HT1A 2RIPA 4YAUA 3AEUA 4MROA 1L5ZA 2ZJYA 1UINA 4LDPA 3B3GA 3I64A 5CNMA 3JZDA 3K32A 5FTMA 4GI2A 1A4IA 1KI8A 2G63A 3KU4A 3LUBA 4QREA 3TO5A 4UCFA 3ZWOA 4CT0A 2C4WA 1VXRA 1U8AA 2XTMA 4H1TA 2BR4A 3HLYA 3FMAA 1UBKS 4F50A 5HSGA 4X7MA 4B2IA 4MCJA 4L4RA 1TD9A 1GADO 3F7TA 1WKCA 4E12A 2WI8A 4NSNA 4J0IA 2VSQA 4X62B 1A9RA 4EENA 5IPFA 2R1VB 4CLEA 1H0RA 2PZMA 3GGPA 1GUAA 2CV1A 1OKKD 3C7DB 1VMEA 3PQ6A 4WACA 4R9RA 4AZSA 1NNSA 1MDFA 4A1FA 2CT8A 3SX2A 4D9GA 1QFYA 1LCIA 1YSCA 1SZDA 1Y34E 1PEDA 4I1RA 2WAQE 2MIIA 3HGTA 2A9KA 1GQQA 2GZHA 3GHYA 2CQYA 2NXNA 2ZR9A 1W36D 1N3LA 3CHYA 2XMCA 4PU0A 5EUCA 2P4QA 1PWXA 2J5RA 4RM2A 3Q4GA 4CM7A 4IEIA 4KNWA 2WPDA 2R2GA 3QHQA 4JKYA 5KINB 1UQUA 3NFRA 3P5BA 2QTVB 1V51A 1TCBA 2Q5CA 3D8NA 4E30A 1QANA 2CCJA 3VH3A 2I8CA 3ZZNA 1LY1A 5JV5A 1A8QA 1IBKH 3T3DA 4AULA 4CCYA 5G0VA 5JTTA 4P2BA 4NYIQ 3S70A 4HPWA 3OLCX 4WKBA 2ZREA 2PU7A 3CLTD 5JNTA 2F17A 1QF7A 1C3OB 4DNOA 5IJXA 3AY0A 3VR4A 3LBFA 1SKQA 1N6OA 2F43A 4DF3A 3DMGA 3W1VA 3PLNA 1ETUA 2XUQA 3K1TA 5K0SA 3PF9A 1KAMA 5IZCC 2VTKA 2AFIA 2OFFA 5K09A 2FE4A 4AECA 3V3KA 2ODWA 3KS9A 3ESDA 2D2XA 4JV0A 4ZWNA 4EUNA 2TYSB 1WUIS 4A8PA 5ITSA 2XE8A 2NUTA 1NI5A 2ZYHA 1U1GA 2VF5X 3N2LA 4YVFA 4V0KA 4B7XA 4B3JA 1Y8RA 4JP3A 3RS3A 3VVCA 2AYXA 1O0CA 2DLNA 1H4SA 4C0XA 2W22A 4D8UA 1WBDA 3VU9A 1G64A 1JIHA 3UPDA 2Q4OA 3AVPA 3G9XA 3V6LA 4BC0A 2JAWA 2XOEA 1DWOA 2IZ5A 2Y92A 3EB9A 3F97A 4GZ6A 4CV3A 3CRNA 4IIEA 2XW6A 3GDWA 3KLNA 4U2BA 3IQGX 1QHFA 1ZVJA 4N0EA 4E6EA 3N6RA 2YC4C 3IMCA 1LNSA 1U3WA 3RT1A 3UCXA 3ZY2A 1RRGA 1ZWLA 3IXQA 1ZYUA 1CY8A 4WZZA 3NATA 4WIAA 4JBIA 2ZOSA 1TQ8A 2JGAA 5CVVA 5CH5A 2WJZB 4B17A 5DI3B 4HYKA 1KEEB 1S9HA 4PGFA 4ZN6A 2VPIA 3JARA 2X2FA 4Q4LA 4R8MA 1ABEA 4CIAA 5D1HA 1XEAA 3EXEB 4LE0A 2LBPA 3WQQA 2IEGA 3I6YA 2AFIB 1YIAA 5IT9W 1GKLA 2DY0A 3A1VA 5H3HA 3RPEA 4CN9A 3F46A 4EGQA 4LYDA 1MT0A 2Q50A 1WSCA 3WB2A 1JPNA 2JEGA 1UZNA 2OHIA 2WWVD 3U0BA 3IE1A 4NLLA 3GPLA 3WP0A 3P9RA 1EIZA 1GQRA 3G82C 3A27A 2CXNA 3MK31 4J0JA 3LBAA 2CEKA 4IR9A 4WESA 4DRYA 1XPUA 2FZKA 2Y0PA 1VJTA 4INOA 1N33B 9MHTA 3V7FA 4JUAA 1VGRA 2BBWA 2YRXA 4JR2A 1FFAA 5EXDA 5HM8A 5CLHA 3D0KA 3BVPA 4EJSA 1NVTA 2OORC 3JALB 5I8WA 5JDCA 4LV8B 3GLGB 3KLOA 5EE9A 2AN1A 1EDZA 4C08A 1NC1A 4B3SB 5JANA 3DOHA 3MS7A 3INTA 3O8BA 4M7WA 3OT1B 4IXNA 3NS7A 2VEDA 4Z2YA 2AL7A 4XIGS 2PMBA 2FMUA 3BEDA 3OPYB 1B41A 1NWCA 1Q0UA 2YQ4A 5F64A 1VB5A 1NMSA 1KI9A 3ROMA 3CX8A 4JLMA 5IBCA 3OPQA 2QX4A 3C6BA 3TN7A 1QH8A 4KSBA 4S1WA 2DJIA 3ICCA 2HO4A 3KOUA 1NRIA 3ORHA 1N7GA 3MINA 3WLNA 3U6KA 1G291 1HQCA 4WWHA 1WU8A 4KREA 3OJCA 4MRPA 1L5NA 4NECA 3W2FA 3JWGA 2WDZA 3EQ6A 1XMQB 1VFNA 2Q3CA 4IP0A 1CS0A 1P5ZB 1UAYA 1GDHA 5EWLA 4KN6A 5KYKA 2RHDA 2W83A 4JQCA 2B9EA 4MGHA 4ZCLA 3AEKA 1WRBA 2IVZA 4BS9A 4HDOB 5AVRA 3GCDA 3SM3A 4F3RA 3ENQA 3ZY5A 2HA0A 3PQ8A 1NIJA 3C0KA 3M9MB 1SCJA 3W5IA 3MYYA 3ZDRA 1YS7A 4BZZA 4M49A 1N6LA 3L4EA 1E1CA 1Z7BA 4JD5A 2PWPA 1FBNA 2X23A 2E9SA 1G2PA 3CLVA 3EE6A 4DIKA 1RBYA 4NL4H 4YRMA 2P62A 5IFLA 2PT7A 3RSLA 1KRXA 3AFMA 3EF1A 5K0CA 3TAXA 1D03A 3DCNA 4I8IA 1UXGA 3KSZO 3TD9A 2C5HA 2ZBFA 4PAWA 2ZRAA 4AJLA 5HJ7A 3QSYA 2WWXA 3Q8QB 2UXDB 3UKOA 4K8OA 3G9QA 4NPAA 1F60A 3ZJYA 1E0DA 3L7KA 3I0MA 4HK4A 4AMVA 4D5EA 1RMYA 3AB3A 5H4GA 1N2OA 2GHRA 2O8FB 4QLBA 3EWSA 1O77A 2AGVA 1VPVA 4P58A 4A9AA 2FMAA 3RLIA 1F9AA 4IG9A 1O94C 1W35A 3PGKA 1HZJA 4I2VA 3ZE0B 1GPWB 1P3Y1 2JJ1A 5DG9A 2RFLA 3FVWA 4L9AA 5L9AA 4GM0A 3G8CA 4K9KA 4EG6A 2UYOA 2A59A 2AT1A 2TMKA 4C0WA 3RS0A 4JHLA 3I61A 1C4OA 2QRVA 1OFUX 4LJ4A 1JEYA 2ZI3A 4GRIA 1Y3DE 3DMTC 3T7SA 2YVLA 1HY3A 1SK8A 1LK7A 2OM6A 3NHLA 3VYUB 3F6EX 3WBBA 2VA9A 5H80A 4LHZA 5EL0A 3VR5A 1GZ4A 1MB9A 1U90A 3IQHX 4HWTA 1FYDA 4D9JA 3IQEA 3DUWA 1WSBA 1YBVA 3DCIA 2X22A 4Z1OA 1ULUA 3DNPA 4GP7A 1TIKA 3FIJA 1W0KA 3VR4H 4BO3A 4EEXA 5DNUA 1HF3A 4QGFA 1KIMA 2JJ2A 3LU1A 5B3LA 2W7OA 1J8QA 2H2IA 2JHGA 5KZMB 2RB4A 4MVJE 4N0QA 2HG8A 2BMAA 4D46A 3TPZA 1J0EA 3AF2A 3QVVA 2I2XB 2AU0A 3EBOA 2C97A 3OTHA 4UJ3A 1CSEE 1PGJA 5C3EG 1F17A 2C7VA 1URPA 2BZ0A 4JP2A 4WTOA 2ZSIA 4RJIA 1KEUA 3UOAB 4XRGA 1GPLA 2PZBA 1E4EA 1KARA 4NZMA 2YBEA 3HKBA 3PNBA 4U1RA 5DNDA 4E5KA 5JJIA 1ILEA 1HKHA 3G59A 3LKDA 5T7BA 1LPNA 3SFTA 1B43A 4G1CA 2GN2A 3VA7A 2QRGA 2WHQA 3C3AA 3G5TA 4YA6A 2OFXA 4XSGA 1S8NA 1EP2B 3ELDA 1G8FA 4DL5A 3K92A 4YB8B 4M0JA 1EEXB 1EFKA 4MS3B 5I5WA 1XDDA 1M6YA 3G88A 3NRJA 5AJHA 4B5KA 8ABPA 1NQ5A 1WPQA 2CJPA 2O2XA 1LX6A 3K9HA 3DF7A 1E9EA 3LHSA 4K7JA 4M99A 5JYEA 1U8CB 3RTDA 2NQTA 3PLRA 4QDOA 4TTTS 4Y1GA 2ZRIA 2E37A 2QL6A 4DL9A 1R74A 2G40A 5FR2A 1V71A 5JG7A 3GRZA 3F1LA 3JRWA 4QHSA 5AHXA 4HYTA 3UGJA 2JA2A 2XGMA 2NU8A 3UWPA 4Y6PA 4B7UA 3HXMA 1B15A 3UUEA 1HQKA 2UXDH 2PHZA 1P6QA 4KSYA 1JWBB 1V5GA 3TQ1A 4ZT3A 4CG1A 2GASA 7MDHA 4D25A 1S0MA 1AKYA 3JX9A 4JLUA 5IYZF 1FUYB 1KYVA 2C57A 2Q5IA 5H02A 4AJHA 1ZHOA 5KQRA 3UMBA 1CWUA 1ICIA 2P9EA 3ESAA 4YMIA 1RWOA 6LDHA 4HR7A 1E7QA 3ASVA 4A5SA 4AJJA 1HXHA 1MX9A 2WSBA 2XDWA 2QR5A 3DFUA 1T0UA 5EJ8A 1K83A 1SQ6A 1V1MA 3DXFA 1AS2A 2VKTA 5IXYA 4IIHA 1PGOA 4IIJB 4BZWA 1GAEO 3KPVA 2V7QA 1V4BA 1L5RA 3IPLA 3KYIB 3IP1A 4RCVA 5DIFA 5F5LA 2HZ7A 2Y99A 4TRNA 3M2TA 3FPAA 1CQZA 1NJFA 2JGKA 1D1SA 4NJMA 5E7JA 4OB8A 4LIPD 3R1IA 3B3AA 3QTBA 4ZT5A 2IHVA 5I51A 1YH3A 4J0FA 2ADFA 3SZUA 4BVKA 5TIIA 2QQFA 2CJXA 4M0CA 1DX9A 3OHBA 1BKYA 2V7GA 4CE6A 3T15A 3AKZA 2A1TR 1T6YA 3WZ2A 3GV5B 1BO6A 4BNVA 2GN8A 3RR2A 3EK2A 4OA5A 3TLZA 2ILVA 1EB8A 3SE0A 2AZMA 4YRTA 1CP3A 2ZVJA 3LA6A 4O8CA 4QBHA 5D5QA 4CYMA 5BWNA 2L17A 1BQ4A 3IKVA 3HR7A 4L4SA 3K72B 3VNNA 1CIVA 2C4NA 3E9RA 4RPLA 3RC3A 5U9CA 2PJUA 1H4QA 1Y5MA 2IYXA 2LXNA 1S2IA 2NZJA 3K0AA 2J3EA 1PBNA 4RS4A 3NQ41 4KX3A 3K4PA 1A77A 3NC1C 5CXSA 4EYGA 1V1MB 3B5EA 2WOOA 2VEOA 3DLHA 1GGOA 4XWOA 1E98A 2BR3A 2YV5A 3WHLA 2HL6A 2G0NA 1CYEA 4YMHA 4XPZA 1P8AA 2LV8A 1BXGA 1IQ0A 3IUMA 4F2WA 4O4IA 3E3MA 4TTRA 3BWDD 1KZ6A 3WGKA 4C4OA 6REQB 4PLGA 1X39A 2WP0A 3K09A 1JKFA 1YIOA 2JBHA 4NEQA 5AKXA 3C5CA 2QVYX 3K9NA 2Y1DA 1BCRB 2G4CA 4W7HA 2JB9A 1QIGA 4LCBA 4GVLA 1VPLA 1LLFA 3E5MA 4X65H 5ICGA 2IP4A 2YIVX 4YJKA 1PUXA 4RUKA 3DFZA 3GRKA 3H9JA 3MT9A 3CLHA 4RCZA 4RD6A 1DQRA 5EJAA 5J4KA 3L40A 3OJOA 5ENDA 2QTAA 4D42A 2OYCA 1XDUA 1SUWA 1QYXA 3OQJA 2QRPA 1G0NA 3G68A 4XZ3A 3KEFA 5FBRB 1IN1A 3GJRA 3LECA 4FOOA 3VSCA 3HR8A 5FR1A 4NBTA 1BKSB 1OX4A 4PC3A 4B2LA 4AURA 4BJ5A 5IMSA 3T3MB 3ANMA 5JD3A 1TWFA 1FTQA 1E4FT 1NDUA 4IEFB 3TRKA 1RXVA 1JJIA 1XWIA 2RGGA 1T2CA 1XZEA 3FNIA 3MTGA 5MN5A 4E2WA 3OETA 4WGGA 5BPHA 4W63A 4ZFNA 5HJEA 2ET6A 3V4PB 1U65A 1OIVA 4I1SA 2OM2A 2JD2A 3SC6A 3SR3A 3GLFE 3LBNA 4L6AA 2NIPA 4DB2A 3S2FA 2OD2A 1JBQA 1B6SA 4G1EB 4L9WA 4E88A 3GQVA 3NOXA 5E7QA 2WV7A 6YASA 5KOJB 3LX5A 2HJGA 3OD1A 3F8NA 2E82A 1OB2A 1X7ZA 1KYIA 4IJ6A 5DLPA 1D6NA 5G2OA 1HDGO 4EG5A 2ID8A 4IIVA 4FE7A 4O84A 4Y8VB 4DA6A 3AILA 2QT1A 4Y9TA 4ZV4A 4AS2A 5JQWA 2ZI6A 3RUCA 1NXOA 3VHQA 2EDCA 1JNXX 1CETA 4JSTA 4ND4A 4OATA 4Y2TA 4AY5A 2FPIA 1H2BA 1RQ7A 3C3XA 2VC2B 4OQNA 5DHSA 4BO6A 2J4DA 1P72A 3L8YA 4K9NA 2HTEA 4KWIA 4CQJA 1HC7A 1P7CA 2XODA 1OLUB 1XHFA 1ZJJA 4IGFA 4AKTA 4O3NA 3SBEA 3EFBA 2WAQA 1G8SA 1FVXA 1TAQA 3OCZA 2CNBA 4RA9A 4JI0H 4XVQA 5FQNA 3PUZA 1U3TA 2JW5A 4JB8A 4R98A 3ZJTA 2YS7A 3TL3A 3M1IA 4FDMA 4JV2A 1U0EA 2LDBA 3T5BA 3RUHA 4DL6A 3PE4A 2R8GA 3G0DA 3ZK9A 4G85A 1ORIA 3MR2A 2AKYA 2VHJA 2ZQ5A 4DV1H 1IL0A 3CS3A 4K40A 3X1YA 3NM4A 2CXOA 1I7NA 1N9ZA 2WBLC 3JQRA 1EFTA 4UUAA 4BHTA 2O06A 3I12A 2ZAOA 2OH2A 3GDHA 4KH0A 4ECRA 2J3IA 4C6RA 4MP3A 1JU9A 1W49A 2WZCA 5E0KB 1WUKS 3ZNPA 5KTKA 3N5KA 1YZYA 1WA5A 3A32A 1XZDA 2OV8A 3H9CA 1U0OC 1YUMA 5CX4A 1BTOA 1R4ZA 5LQMA 4GS5A 4Q4DA 2O0HA 3HLTA 2MYUA 4F9FA 2VJLA 1JLRA 2FMXA 1ZN7A 2XIGA 1OV4A 2FHPA 4D4JA 4ZPXA 2ZSUA 3SQLA 3QPVA 4ONEA 1S3FA 1D2GA 2LKDA 3H2JA 5EJ7A 2IA5A 1EK5A 1N6HA 1ZQ9A 3U13A 4NS4A 4TV9F 4F4YA 3NM5A 1KOJA 2NUTB 3X2EA 1Q74A 4S2UA 4D9KA 4NDNE 5ITZA 1VDMA 1TKAA 2BMVA 2JZCA 3BA6A 3T1TA 2JCYA 3WKAA 5IAKA 4ZI2A 3N2NA 3DOIA 1P0CA 5LOVF 4HYQA 4LMPA 1NHWA 4IUYA 1AXEA 2Q07A 2VHTA 1BCSB 2ETVA 3NGDA 1OBOA 3D4LA 1YFKA 3WZMA 4X85A 3DBRA 3C7TA 4LV6A 1XJQA 3VR2D 1GPUA 1LH0A 5DT2A 5E7IA 4BFLA 5HOEA 1U7DA 2IYQA 1MX5A 1V7QA 3EPRA 2QGNA 5JAQA 4KPFC 3SZ3A 3D0QA 4XQ9A 3HKEA 1DBIA 1KAGA 1R6BX 4ZJUA 1Z4IA 4JJIA 1H9CA 1P3JA 2R6AA 3RNLA 1JJBA 4G0NA 3T1QA 4Q7JB 5KSOA 3GUYA 2WTUA 3U3KA 5KU1A 1U5CA 2BFNA 3IBSA 3HY6A 3OFND 1L7DA 3C3JA 1RCUA 5ALRA 4MVJG 5JZSA 2YWRA 3CQZA 5KNCD 3R7DA 4B0OA 5K03A 1U7ZA 2OL4A 3EIXA 3F7NA 3P27A 3PDIB 5HIJA 3S8MA 3T0GA 1EM8A 4DHWA 3R5FA 1PTJA 2CBGA 2YASA 3D1JA 4PS1A 5KTNA 5SY6A 5HIMA 3SQDA 1DJNA 2AQ8A 3A10A 6NULA 1NOJA 5AVOA 1E2LA 4WBNA 3HB9A 2IHKA 3T8YA 3ED5A 3KUXA 1I1LA 3GRYA 3K0BA 4FW8A 2JA8G 1D7AA 2R62A 4HFNA 3HXLA 1FNNA 2W9CA 2AD5A 3MF4A 3W1WA 1KSHA 2C3MA 2JAQA 1ZUNA 4MCAA 4BMOB 2WFLB 4EUFA 4URHA 2GKGA 3FZNA 5EZ6B 4C0JA 1AKRA 1RLUA 1Q1BA 2COUA 3CWQA 2PKQO 1QVVA 2OMKA 1ODKA 2BSAA 2O3QA 2VQSA 3KG2A 1DEXA 1M3SA 3JARB 4BCDA 1QZUA 4QAJA 1C81A 2H8GA 3SLRA 1Y7LA 2PPVA 2YN2A 4NP6A 2O52A 4KC0A 2EWWA 4UAGA 2GD0A 1ZGJA 4Y6OA 3HJTA 5IXSA 3G2NA 3ZKWB 1CZLA 2PSJA 1OXTA 1FDWA 3QGMA 4R8SA 3LCVB 4ZAGA 3SM9A 1PW5A 2XDAA 2YIDA 4FNGA 3ZGLA 4YRPA 3WLQA 3JV7A 1F8GA 3DOOA 4MW9A 4ZEXA 2AR0A 5DGIA 3H7AA 3GZNB 4PHCA 4DR1H 2JGDA 2CLIB 4HVLA 3FHLA 2PL5A 3IGFA 1N92A 5EIOA 5AQ1A 1YZUA 2YV4A 3I28A 2JJYA 1E7WA 1JE1A 4LQDA 1WZEA 1L5OA 1VECA 1OA1A 1X2EA 2HWYA 2R97A 3I3SR 1WR8A 4I4IA 3WFJA 1K7SN 2EZUA 2I4NA 3GF4A 4PLFA 1AS3A 4UFNA 1E1NA 2IBSA 4FKZA 1FNCA 4EI2A 1OU4A 4EYSA 4Z54A 3CLSC 2E0IA 1ZIDA 3NRBA 1C1HA 1WP4A 5EIFA 4C3UA 4IFBA 2YZ7A 1WX1A 3DXZA 2O8DA 4Y9SA 3IUSA 1K97A 2XNCA 1EE2A 3QA3E 3VRHA 1VM6A 3HPQA 5BNWA 3HBLA 4XX0B 1ECCA 3FPHA 4RVUA 3UTCA 3GB8B 4DIUA 4UTRA 1TJYA 2BY4A 3AEQB 5CM9C 2XYHA 2KM1A 4WLUA 3SEFA 1XRRA 1PFKA 3RHFA 1IXKA 5FAKA 3KAKA 1BWRA 1AQUA 4CM9D 4MDEA 3OUUA 2MT9A 4NTZA 2VDNB 1RFGE 4CODB 5MFZA 1Z4OA 3D8TA 2C9YA 2QSYA 2D1YA 3PW0A 1UMKA 2IEZA 2IW3A 1LZKA 3RI3A 5E1DA 4HADA 1TJ4A 1SOMA 4JBNA 1IOVA 5JPCA 3DG9A 1P8LA 1QLWA 2CMGA 3U1TA 2SNIE 4AO8A 1GRCA 4QVIA 1C14A 2ZQYA 1JU4A 1UXHA 1OXBB 1UMCA 3LPAA 4G26A 2I80A 1LW7A 4KXYA 4CV0A 5KPDA 2PX0A 1WUHS 2E49A 3NIFB 2JA7G 4LX0A 1IH8A 3MW8A 5SYNA 2HBQA 4GFDA 3OHMA 1WD5A 5HPYB 3CVWA 5LL6b 5LDHA 1N2IA 4XZ3B 1EXWA 3BTUA 4ZGBA 3ZBPA 2WTNA 2CXSA 2HPHA 4R1NA 4HQKA 4L8YA 3BXXA 5IKEA 1LDNA 4JL6A 3N7TA 3RUDA 4W9MC 3OC6A 1HPLA 2Z0MA 5EMKA 2ARKA 4BAZA 4WNIA 5LUAA 2O8FA 1E9AA 3KYDB 3AEQA 1VA4A 3TAUA 3U7IA 3V34A 2QRLA 3EOAI 5HQ3A 1MVLA 1DKMA 2ZRLA 3OLWA 4JVOA 1CPYA 1PYDA 4LJSA 1AQ6A 1S4QA 3EXEA 4IDAA 2BIFA 3THYB 4YR9A 2GX6A 2XD4A 2CBZA 4MR7A 5KO2A 1L4UA 1Y1VG 4IHJA 2WUWE 4LTNA 2CNWD 2IE0A 1SKAA 4M0LA 1CR0A 1XLTC 4ZOAA 1QVZA 2AR7A 4TTJA 3S6JA 4B6JA 1IWPB 2XLCA 2C84A 4WDRA 4AL4A 5ECYA 4L0QA 3KDSE 1CR2A 2WT4A 5AOVA 1VBFA 5ICMA 1JKJB 4JR1A 1M5UA 2PWZA 3AW9A 3O83A 4V39A 4PZEA 4DCJA 2VAXA 2REOA 4MVJM 1YCHA 5EP4A 3A9TA 1LSSA 3NEYA 3TLXA 4B7ZA 3JTMA 4CI0B 3A2KA 3P4YA 3PZRA 4E1VA 4OQDA 4S0XA 5K8IA 5JOQA 1LJ8A 4FGZA 1Z5WA 3FHTA 5AVJA 2VZEA 2DTEA 5GP1A 3K5PA 4DHEA 4CL2A 4L5YA 3R0QA 1O3YA 3RBXA 1TT7A 5DHAA 5CT9A 4H27A 2QT0A 3MCUA 3SQOA 2BHTA 4AP6A 2CNLA 2ST1A 4GMKA 4M21A 3GUHA 4YRKA 4YBRA 3ELUA 3BMQB 1KYXA 2BFWA 4ZGGA 2VP4A 1G8GA 1CUCA 3A9CA 3ENWA 3PK0A 5JVDB 1I5OA 2ZYIA 3I01M 1ISRA 1XD9A 4PLYA 3LQFA 4E33A 4QDTA 2PH1A 3FX2A 1YU9A 2GQRA 1WM1A 1XXHA 3QELB 4D6YA 2W6JD 2O7NA 4AQYH 3AEZA 4X1YA 1UJ6A 4QJ5A 5KSPA 5EQDA 5TQ0B 3GAZA 1NA5A 4BWFB 2IIVA 8OHMA 3P0IA 4RHCA 4UCWA 4CIYA 2VTBA 2DAPA 1CR6A 4O7LA 2RGNA 4IS2A 4KGXA 5ECWA 3NW9A 5BV7A 5A3RA 1DOAA 3GUCA 2VF8A 1OBFO 1UC9A 1U2TA 3ONDA 2C8LA 4GPZA 5C35A 5JSZA 2QIPA 3LKBA 4P53A 1I4OA 4HDMB 4R83A 4K6FA 3UFXA 1RC8A 3HKZE 4PINA 2A67A 3MJ4A 3RB6A 3DONA 3IE2A 4Y6SA 2A0YA 1ZLXA 3ORRA 2VXOA 3DZHA 3ICVA 3IIIA 4Q34A 1Y4AE 1YL6A 2OD7A 1NNI1 2FPXA 2IZOA 1U1EA 3FTDA 1K6IA 5C81A 1BROA 1QXSA 1ZRHA 4MO2A 1VB3A 3DB2A 4IDHA 3BK2A 1A4UA 2XITA 3PUIA 4MJ3A 4OKNA 5CA0A 2I2FA 3ZLUA 3H0GG 5TVGA 5LPNA 2NUPB 4BOYA 2OBFA 1R27A 2QL7A 2XMZA 2Y77A 4KN8A 3OJ0A 4KQFA 5HF9A 2OTCA 4D7AA 1MD9A 2QN7A 4H7PA 1UJBA 4KXWA 5KFNA 3LC1O 4NU5A 2B0CA 3GZJA 3KBOA 1KEEA 3F0TA 1RQ2A 3L49A 3H9BA 3N8NA 5CT4A 1A1VA 3GY0A 2PR2A 4DQVA 3ELWA 1G8HA 5A2QA 2GXQA 3SXUA 1MFZA 4WQMA 3TZEA 1XT6A 3TW0A 3V4LA 4MRRA 4DCUA 5KMGB 1M0EA 4N9WA 1BEUB 1PNQA 5LBUA 4CMEC 4DEVA 4WZBE 3PPYA 4O6VA 1NRXA 1BXZA 1GEGA 3NJ8A 4P5DA 5IM4A 1TTTA 2OUIA 4MYDA 4MX8A 3MJVA 1K7YA 3NO4A 1GFSA 3Q11A 4IW3B 4LXTA 4XIJA 1ISPA 5AW9A 5FOXA 4HDNB 1SEIA 3BABA 1DAKA 1HURA 2NLOA 3VVBA 4LMBA 1Q19A 3OM1A 3OLYA 2CUZA 4F0JA 3I37X 4HRXA 1YCGA 1OY1A 3C8ZA 2O0KA 4YRFA 3CLKA 3F1KA 4F11A 2W2KA 3WBJA 3I2KA 4L22A 4M38A 2ECFA 5GJVC 4DQUA 2WTXA 4ZOBA 3JR7A 1KP9A 5EP1A 3C3KA 1U0GA 4LRSB 3K8ZA 4TLMB 4N6OA 3RROA 3CUYA 1ZIYA 5E1OA 2J7PD 2QX6A 3EGEA 2OQVA 3VO9A 5CEJA 2HZBA 5KFRA 1TA8A 4R8KA 5IEJA 3UJDA 4CTNA 1VJCA 2WYUA 4MPDA 2C35B 3EEFA 1V4VA 5EMMA 421PA 1JA1A 4D97A 2WYHA 4DDKA 2P9HA 5BNIA 1UWCA 1GCAA 3AB7A 3IILA 3Q87B 1MVNA 4MKHA 5KNCA 2ZM5A 1G60A 2IXTA 5EHQA 1RJ9B 2BR5A 4GC6A 1RRPA 3V6MA 2JFQA 3ROXA 4DARA 5JCJD 3IQDB 2CYBA 2Z4TA 3SZMA 3EXIB 4J4HA 4IDGA 2R48A 4XSVA 3K9WA 3Q85A 1VE3A 1X6VA 2WA2A 3EIUA 5EHNA 1UDBA 2Y68A 4UBNA 4D26A 4QW8A 1JZSA 4PSAA 3VHRA 4AICA 1OBDA 2C2OA 2QS9A 4B4VA 1JX4A 4Q9NA 4I1IA 2Y1OA 4YLEA 1BS9A 5ULLA 3UO8B 1UH5A 5JS8A 3U7EB 2RH4A 1N7HA 2R93G 2OVBA 2QQEA 1XDZA 1VMAA 1RI2A 4HYYA 4LI3X 4MYHA 1U1IA 1UBNA 3CZ5A 4TSKA 4NULA 4MH0R 2VHYA 4C1NA 1RWPA 1UDAA 5KCMA 3TLGB 4GM1A 5JFOA 2HRQA 2Y0DA 1SBQA 2D8MA 4BBJA 4V0OA 1Z6ZA 2QUBA 2EZ9A 3DV2A 4FCWA 2IH5A 4LGMA 2OCLA 3AR7A 3PFKA 4UEKA 3HB4X 1YC2A 2OCXA 1THZA 4NPHA 5DGTA 4KV7A 5BWBA 1PFQA 3AFHA 1KDTA 3FCUB 1T9DA 1NJ8A 2REQA 4G0UA 4QUEA 1FA9A 3BT7A 3QX9A 5JC1A 4PAOA 1W6UA 1ZSNA 4QBIA 2NWQA 5DXFA 3JRXA 3TR5A 1IHYA 1TM1E 4ZCPA 1UNNC 4HH4A 1QYVA 5BY2A 4TOIA 4JU8A 2AEJA 1KDVA 3U48A 3TL2A 3E23A 9ATCA 5JCOA 1UJNA 3HXQA 1TF2A 2O1EA 4XYEA 1KY4A 4L2IB 2AX3A 1GRQA 2PCLA 3GT3A 1E92A 2ZT6A 5C9ZA 2X0IA 3D7SA 2UYYA 3G5AA 1D4AA 5KG5A 3H8WA 3K2BA 3N87A 3ONNA 1KEZA 3L0BA 3NTOA 3T5TA 3C3MA 4DEYA 1S8AA 4YMVA 2CUKA 2MINA 4EEKA 3IP8A 4F8JA 3A4YA 3M89A 3OZTA 1Q0ZA 2JA1A 3VDNB 1T2EA 2BP7B 3H40A 3STTA 1YZVA 4F6RA 2C4TA 1E1YA 1V0JA 1V5EA 3RM3A 4MUFA 3TD2A 4M1YA 2JI6A 3DHEA 5SY4A 5AM3A 3HA7A 3KHSA 3VZDA 4GF5A 3HN2A 4EB6B 3BL8A 2DPMA 3RLFA 3A6EA 1I4LD 3FW1A 2RGVA 1MEJA 4WOJA 5KT2A 1N8KA 3DOFA 4WN9A 5DWQA 3TH5A 1WDWB 3DUFA 2O19A 1CT9A 4F4XA 5JAPA 4BWVA 1FTNA 1LVUA 3TNLA 3HSKA 4F4DA 3NDIA 4UNRA 7REQB 4OX9B 4DTIA 4ZC8A 3PI6A 3ANSA 2R66A 2HPVA 2Y9MB 1U4OA 3R5XA 1VAJA 2IPLA 1HR0B 3I05A 3OCWA 2QE6A 4BMXA 3E8XA 4Y1RA 1JGTA 4CHGA 4DQNA 1M1XB 1PNOA 1UEXC 4B32A 1N5RA 3CF6R 4B6FA 1HMPA 3MTBA 3KKMA 4R8UB 1SA0B 4K9OA 2XMPA 2YWCA 4NFSA 2H5LA 3GFBA 3H5WA 3C43A 4GG1A 4Z9AA 4D9MA 2OCAA 4YP9A 1COZA 4Q3EA 7AT1A 4B81A 4EYHB 2DBVO 2R6DA 1PRYA 3OY7A 1ESCA 1LFAA 4Z4EA 2FN8A 3F98A 1RI3A 4B33A 3QMVA 1I3MA 2B3DA 3ACDA 1YVEI 4U6SA 4X20A 2WUGA 1FMCA 4ERXA 3R7NA 2YU9A 4JLWA 3C6KA 3NYIA 5C8VA 4H1UA 3GROA 5E2BA 5ES4B 5IJ9B 2OGSA 1XK6A 2O59A 3WK8A 3RAXA 3V33A 2JS7A 1MQAA 4EAQA 2V4ZA 4YS6A 2IZ1A 1RXYA 4L72A 3GP5A 4RQAA 4XJTA 3JYQA 1UBMS 4JYAB 4WVFA 2GM9A 4ZO6A 1WVGA 3H4IA 4P5EA 3LK6A 1RJPA 1UT6A 3M81A 2XJ9A 3KZXA 3X0DA 4YV2A 2I76A 5F2NA 3H83A 4RNCA 3B52X 5FPRA 2QUZA 4HAXA 2GF0A 2OBXA 4JJAA 1KK3A 3E9QA 4Z9XA 2C3OA 5LQSA 3TZKA 2XGQA 1CS0B 5CFMA 1VLVA 2Z3ZA 2BTEA 3HCBA 3NFYA 3C3CA 4QDJA 3K9CA 3QF7A 3OY2A 5BSGA 1WULS 3G0GA 4QWWA 4FOPA 1TC2A 1F4VA 3DVRX 2GO1A 2W2MA 4GDMA 4B4UA 2XGSA 3QU7A 2BDEA 4Y9UA 3NRCA 5DK6A 5ALXA 5J5CA 3GJ0A 2P4HX 3KC2A 2JA5A 2VQFH 3P9YA 2COGA 2QUKA 2WWRA 1NPDA 4E4RA 2BFFA 5BQXA 3FSEA 4MPTA 1YR1A 3LWDA 4ED1A 1ZHFA 3FAKA 2XMBA 3GCXA 3B2EA 4LHYA 3ZEAA 2IPXA 2GAFA 4B40A 4ZAWA 4KNYA 1CDDA 4IAOA 4ZVMA 1JQKA 1Q6ZA 3LIPA 2HAEA 3E7FA 2B63A 3QWAA 3JD1A 3TNFA 3WGTA 4KNVA 4H3SA 3X1KA 2VT2A 4GSLA 1NN1A 2J41A 3TIIA 2WYOA 4F4WA 1IHPA 3AV0B 1GZ3A 3PGXA 4URVR 4ZYWA 4MB6A 5IAOA 2YL2A 4G3IA 3NDJA 1V96A 1EK6A 3OZSA 3RJ5A 1ZOSA 4EZEA 1PL0A 1EDBA 2ONCA 5C5JA 1K92A 2D3TA 1X70A 2J33A 2GCPA 3DZDA 3F47A 3HG7A 4NMHA 4XKJA 2W2TA 3TG2A 2CCKA 1Y9AA 3EG5A 4M7PA 4ND3A 3H5AA 4F85A 4ECUA 1G6HA 1K8YB 4V38A 3TZLA 3WXBA 5JISA 1OKKA 4BLWA 2AZTA 4WL0A 4Q9LA 5GGXA 1Z6QA 1E9RA 4RMGA 4L7VA 3UCEA 3WLFA 1SZCA 4A3GG 1SVKA 5JUWA 2C4VA 1JXQA 1QS0B 3ET5A 3P9SA 1Q21A 2FK7A 4PAQA 1AKEA 4W7SA 5IP7G 1QRDA 1EG7A 4MRMA 3USZA 3OLXA 2IU6A 3Q3CA 3TPCA 3TVDA 2CMFA 2G5PA 2Q4BA 1Y8QB 2R60A 4ZDWA 3W9YA 1ZJYA 2GYVA 1JALA 3C3DA 3IIKA 4P0QB 4IJMA 1VGVA 1BX0A 4DA4A 4LECA 1LLDA 4YJ2A 2CNVA 1EDOA 5HS4A 1JJAA 2GAIA 1ZK2A 2VH1A 3ILHA 1B6GA 1PZXA 4MI9A 5L7WA 2AOUB 5CD9A 1U3FA 4G0VA 1UADA 1XD8A 5KJ6A 4KTVE 2QUJA 1KS9A 3IBYA 5JROA 1L4NA 3DZBA 4RPCA 2EERA 1PD0A 2V5AA 4BDSA 1HDOA 2J0EA 1QYWA 2AI3A 2HJWA 1CJTC 3W5OA 2DKNA 4NONA 1N57A 3AUAA 2WAAA 2GPNA 4HQFA 5LDDC 5AKZA 1I2KA 3AHDA 2A88A 4W9NC 2EX0A 1H2ZA 2HXYA 5KQPA 1OXUA 4HV4A 2XBMA 4KACA 2ODTX 2ACKA 5JNVA 2JF0A 5JEEA 1FTGA 2PLWA 2Q27A 1NC3A 3DLCA 2QROA 4KLCA 4OJMX 3GCGA 4TQGA 3GOHA 4YUVA 3QYPA 1A1SA 3G0OA 3VHXB 1XWFA 2QG9A 3GFRA 4BZQA 1XYYA 4H1WA 3PUKA 2YNMD 1AA6A 1Q1NA 1WUTA 4O2BF 3TR6A 3ZGVA 4PPFA 4ALJA 2C2KA 3THRA 4PFJA 3DBHA 1LKZA 3MRTA 4G89A 5AI9A 5D3MB 4UARA 2OQIA 2BGMA 5BT9A 4Q39A 2OP1A 4ALMA 3PP8A 1LRJA 4B71A 1VKOA 5MHTA 5A4JA 2ZB2A 1LD3A 2A5YB 3AIOA 2QRJA 3FUVA 4YAFA 4B74A 3V7WA 4E32A 1OLOA 5DM60 2BHLA 3MBIA 3QJGA 3F6CA 2G8LA 4U8HA 5E4FA 1PYGA 4BX3A 5J58A 3F5MA 1KEWA 4C5CA 1AK2A 3PFIA 5CGQB 3S81A 3N1UA 3ZZ0A 2D0OB 1MABB 3CJTA 3OKFA 3Q2KA 3RTGA 3GIDA 1KI2A 4R05A 1I4DD 3VUFA 4A0HA 3R6GA 3B70A 1G7CA 4Y1FA 4ZTBA 4P80A 2XIQA 3VFDA 3ZEIA 4NQRA 4QUAA 3ND8A 1KDYA 1ADGA 3NR2A 1T15A 5B30A 4ETIA 4YAEA 3R9WA 2XWSA 2DUJA 4DCCA 1SUDA 2F55A 1PT5A 4Q05A 1TEHA 1U2DC 4GMGA 3T7DA 1FVHA 3LXMA 4RD0A 3UJ6A 2WB1A 2C54A 1DIRA 2YFHA 3EBLA 4B9EA 4RZRA 1E3QA 3PUHA 3BOSA 2AXNA 4MKRA 1LNQA 4Q44A 2DCMA 2VCHA 3K0CC 3HADA 3E84A 4Q4AB 3MR5A 1C1XA 3GIMA 3C4VA 5KFDA 1K68A 3FOBA 1KC7A 3BTSA 4HJXA 4XFJA 2CKDA 2ZPAA 2NU6B 1EFHA 2MMGA 3ZOKA 3HVRA 4RWZA 3ZX5A 4DUZB 3IXLA 2HBRA 2ZRCA 3QQMA 1R4MB 2WLSA 3F96A 3LV8A 2WJIA 3VVMA 4P0PB 1ECFA 4CNBA 2GN6A 2XMRA 3TQCA 2XAAA 4EYKA 1Z47A 3GHHA 4I9UA 4A03A 4D6PA 5ED4A 2FUCA 2QYSA 3H19A 4LXGA 4MGEA 4MJXA 1BW9B 1AMUA 3PENA 3PO3G 1L4FA 1P19A 3LPNA 4LPSA 3ER8A 1JIQA 1CUEA 5HG0A 5JS2A 3V1YA 4CLRB 1JSZA 4R7GA 2QJWA 4S1TA 4YEDA 1RHKA 5CX1B 1VRWA 2CL7X 1H4VB 1WWKA 1BCRA 1AQJA 4EHJA 3Q3IA 2V0NA 1IBLB 1NNUA 3FNEA 1AGNA 1TYCA 2GD1O 5B7NA 5E3IA 2VLIA 4G37A 3KJFA 4JB2A 3U7JA 2R8ZA 4P7GA 3DFKA 4INZA 3F67A 1CJBA 4ZVSA 1LPBB 3VKWA 5JLAA 2PH7A 2HF7A 2KMLA 1SXJC 5I7AA 1NFRA 2AVDA 1QR2A 4BX2A 5CCDA 4Q12A 2BEKA 4YALA 4EEZA 2BUBA 4IXTA 3GJ8A 1QRSA 3ILXA 5AKJA 3WWOA 2VK8A 3GB9A 1OU0A 1VYTA 3J80A 5H83A 2NO7A 4E14A 4ZANA 2LIPA 2FWJA 3ZW7A 3AUXA 4YFVA 4B45A 3HP1A 2PRJA 5B7PA 4A7PA 2B8JA 3BEOA 1UBSB 3IH5A 3NH6A 3S2EA 1IK4A 3R9XB 1ZFNA 2PUWA 4QOEA 3L6DA 2IYWA 4II7A 1QYCA 4N3AA 5BWUA 1XB2A 4MLZA 5DVZA 1I7DA 1CD5A 1T2AA 2FMHA 3OZEA 1K1QA 5KFJA 4C14A 3SYNA 3VJKA 1M6HA 3HI4A 3K0HA 4INJA 2NVUB 3U39A 5BMVF 5ABPA 3BILA 5DGAA 3EARA 3R0ZA 3GJXB 1FFYA 1H93A 1S3IA 4KG7A 1ONSA 1IRIA 2QRZA 1PZGA 1A9PA 1L8LA 5K0JA 3H05A 4M53A 4UPEA 4MIKA 3K15A 1HNXB 3ESYA 4OHPA 2H29A 3PNSA 3AYXB 4HMPA 2YKGA 4MVXA 3KKPA 3QWIA 2NUAA 4I3FA 1PBTA 5T5QA 1DIBA 2DQYA 1B1CA 4BGUA 1KF0A 5LQKA 4C4XA 2E4VA 1Y1PA 3V4FA 5A3SA 1WAMA 4OQLA 1RACA 1YBFA 1ZAYA 3RWMB 2P4UA 4P6VF 3BHNA 1YOVA 1GL9B 3RVKA 4D79A 4V1CI 4ZAYA 3OM9A 1QGOA 1OSNA 2W9XA 3NB0A 4QTUB 3WJ2A 3QXHA 2FG5A 5JWHA 4DSZA 1IAVA 4JL8A 1TWAA 1EUCA 3G1WA 5IDVA 1RYEA 4CF6A 1AKMA 2XWBF 4KFSA 3DBHB 4M8IA 4EYIB 3WRWA 4TL6A 3QMMA 2Y2VA 1SOUA 1M76A 3EW9A 3L8EA 5BP7A 4TZTA 4DC1A 2IH2A 5B6IA 1NVAA 1C8KA 3GWZA 4GRAA 4HDKA 2NQ8A 4LISA 4IO1A 4WZBA 1W29A 1XCBA 3Q10A 1IFXA 1QORA 5EWJB 1WCMA 4O08A 4KH1A 5JSYA 5TB5A 4MS4B 4ABYA 5COBA 3WB1A 4B7AA 4DIFA 1APBA 4A8JB 1E20A 4G0MA 2B3TA 2IYEA 2XUFA 1E4EB 3NC0B 2ODQA 3AO0B 3QE9Y 7ABPA 2DABA 2IDJA 4PZ6A 4L28A 5CPBA 1M2JA 1L7MA 4FP9A 4BKUA 3U2QA 1NXSA 4DS3A 4NXMB 3ZU4A 3RYTC 2IYOA 3K0EA 4HX2A 1GPAA 3FRHA 2GCOB 2OEPA 3C3WA 4L6CA 1W85A 1HE2A 2OQRA 4UHKA 2G1KA 4UU7A 5FI0B 2PBFA 5PGMA 5DMXA 4BNFA 3DMFA 2IS1A 5AHWA 4JX8A 3GPCA 3GJTA 1HG0A 1P4HA 4ZHQA 3UT5B 2B4KA 3LBHA 1ULZA 3Q8SB 1E62A 2PRIA 2WAOA 4Q1BA 4Q9DA 1F4PA 3BTVA 2CFIA 1Q1QA 2ZRPA 5TEWA 4RD4A 1WO8A 5KFZA 1FX0A 1A48A 2YJGA 3QVJA 2XZTA 1KQOA 5IAGA 2A3NA 4AYBE 4WINA 4TTPA 1L2TA 1LLCA 2C2BA 3ROTA 1YF3A 3ZXYA 3E9EA 4YP0A 5ER9A 4KP7A 5EJGA 5KFEA 1SXPA 2BAGA 1XVVA 4EGAA 3ULKA 1Q2XA 4IL5A 4UCVA 4QOGA 4UM5A 2QRQA 2JLAA 2PBRA 2QXUA 2CKZB 1LV8A 1O58A 2F8MA 2REXB 3IP5A 1IB6A 4MEJA 3HWRA 4L85A 5H82A 3VUEA 5CITA 5CNJA 2V6FA 1K3TA 2B94A 2IZ7A 1VIMA 5CDGA 2VDVE 1PK9A 1J8FA 1QO0D 4KDFA 2OGUA 3OE1A 4YT8A 4O4JF 2VR1A 4LY0A 1U0LA 2X9QA 1RD4A 3WE7A 4DLXA 4BNGA 3SZGA 1EGVB 3HMKA 2PT6A 1TVMA 1EU1A 1YT5A 3CA8A 3CR7A 1HO3A 4FHZA 3L0CA 1VCOA 4MQBA 3CSWA 3S5JA 2E4YA 4LK3A 1Z5GA 3GH1A 1HT2E 1D1QA 5E2IA 4AZWA 2F67A 1S2OA 4N5DA 5D1NA 1XMOH 3PZBA 1II8B 2WM9B 3FTNA 4EHAA 3RUPA 5EE5B 4E2ZA 1CJVC 2GWHA 4PG7A 3MWDB 4A3MG 3L3BA 2V3VA 1X1CA 5EMLA 4BC1A 2BGTA 1XRMA 4CIDA 2M2IA 1V35A 1XE3A 3KIPA 3LYLA 3HSSA 1NUHA 2K5UA 1NMEA 3AHGA 3EC1A 4ANFA 2CLDX 5JY1A 4ARZB 3L9XA 4KFCA 4DV6H 2E4AA 2PKEA 3ASZA 2WIDA 3RV3A 4J16C 5ECDA 3UK7A 1TQ4A 1I2DA 1I6WA 1KA9H 1VLZA 2ZIXA 4YCJA 3NHRA 1CUYA 4JODA 5CXQA 3GA7A 3ROFA 1ZW6A 1FLVA 5KCZA 4DW8A 3CTMA 1K2VN 1NN5A 3CONA 4NYJQ 2HWKA 4TXMA 4C88A 4DKXA 5HGJA 3GNLA 1XMOB 4A82A 1HLGA 1P4JA 2OXCA 4LF7B 1LNZA 1HSOA 3M4IA 1P2UA 1YC5A 2WIKA 4ZIRB 5EWMB 4ED9A 3T9FA 1TO6A 1XELA 1YRBA 4J3JA 1EG2A 1I10A 1RC0A 1QHEA 3P2OA 4B3BA 2PM8A 3SSAA 4YPFA 3SNOA 4BNJA 2HFKA 4Q3KA 1YRHA 5IBRA 1USGA 4UVGA 2NU8B 5DM1A 3WNCA 4C20A 3RSOA 3UMRA 2Q5FA 3I8XA 3WMFA 4KV9A 4YXFA 2Y05A 4QGGA 1JDZA 4WADA 4ZV9A 4POOA 5C7YA 1T3HA 2Y0BA 2I91A 2ZGIA 2EJTA 1FSGA 1TT5B 1ZD3A 2BJHA 1U3DA 1N2SA 1PS9A 2IDZA 2QNRA 3BGDA 4LGYA 4ZXFA 4LFAH 2HHAA 5BW4A 1WXGA 1DQYA 3D3EA 2HIAA 1QTQA 4H35A 2GBIA 3IESA 3L7JA 3RBZA 4OI0A 5KFBA 5HZGA 3RFCA 4ZOLB 2JKYA 2OB2A 4B3IA 4YAGA 3TBKA 2EHJA 4IILA 4QU9A 2XOKD 3GUZA 2DCUA 2ZUBA 3TQHA 2UUCB 4YBZB 3BH7A 1DMSA 1ZJ5A 3E3AA 4R2WA 4R16A 4BNDA 1DTSA 2O2CA 1K6XA 4L4XA 4OLJA 1SEPA 2GETA 3DULA 5MGBA 2FOLA 3JPYA 3FGNA 3O92A 5EUBA 5KYGA 2EEZA 2HTFA 3GLTA 2ETXA 3AUTA 5EY5B 1RAHA 2Y1FA 4JENA 3G6KA 4LBYA 4FMPA 4PC1A 4XE5A 1JR3D 5EJ2A 4BO7A 3DQQA 5E3HA 4F71A 3G7NA 3NORA 4GD3Q 3TS1A 1VBHA 1Z5VA 1E64A 1UMDB 2FG7C 3W1GA 3OX4A 4HDQB 4L75A 2YJZA 5ESXA 2D3WA 2WUEA 2XAUA 4MNTA 5EMJA 1ZRNA 3FYUA 4TZ6A 1YQGA 3IA7A 5B2FA 1G8MA 3NHBA 4U2EA 1KJYA 2P6UA 1QCDA 1U11A 1L4HA 1XQXA 3MPUA 1FFWA 4P4TA 3W05A 1G5QA 2I2DA 3EIWA 3GBSA 2IXBA 1KYTA 4GMXA 1DXQA 2J3HA 2O05A 2VHQA 4DIMA 4QYMA 4REQB 3UXMA 4CM3A 4DLNA 1B93A 1JSXA 5EJMA 4MDFA 1ZM3A 4INPA 1BHQ1 5DNVA 5I7OA 4S04A 4RJKA 4YASA 4IGEA 4DMUB 4E1BA 2ZM6H 3GVPA 1R8XA 3I6BA 3AI3A 3LZDA 3MOIA 3FKSD 3QLVA 3B9PA 3NPMA 1EFRD 1NUUA 2EF0A 2RJNA 5DEIA 5L9XA 4F5YA 4HO1X 4E5PA 2CJFA 4XA8A 5KFHA 3OPXA 3FAZA 1V11A 4ZTUB 2DRIA 3BBLA 5ADUS 1ZGGA 4Q3OA 5ALGA 4DNFA 3I9MA 2EZ8A 4AUKA 1U7OA 4GKAA 3I09A 4E2YA 5FHRA 2X0EA 2KLBA 4LFBB 1GN8A 1YV9A 5BN3B 3ACBA 5JAHA 3TY5A 4RZQA 2CLCX 4WA8A 4GOJA 3KD3A 1KBZA 1E94E 1W5AA 5EJEA 1F38A 3GTQA 3FB1A 3B6KA 3LS2A 1SKUA 3CPEA 3VR0A 4KAXA 4K2AA 4ND2A 4TRJA 4GR4A 1EFRA 5TS3A 5ALUA 3MMNA 3GPDG 1R37A 4G0ZA 4EFLA 5BWCA 4A92A 4G8BA 3ASUA 2M6KA 3K16A 5CURA 3T3EA 3TRIA 1Y8QA 3DQZA 4MKFA 3RASA 1SXJA 2Z04A 3UMYA 1RE1A 3B38A 4AS1A 1H2HA 3QE3A 1T9HA 2VOJA 3O8RA 3F7OA 5HBRB 1WBJB 4U9IS 1GU7A 4JUIA 4DV5B 4A8JC 4C01A 2IIPA 4B3MH 3F4LA 4DVJA 2GVNA 3EXG2 2I8AA 3NTLA 2FFAA 4LXXA 4CL0A 4EW1A 3E82A 1A4RA 2CGEA 2YWFA 4KSCA 4CMCA 4J9RA 2WU8A 2IHUA 5U4QA 4PCVA 4DILA 1KEKA 1EFAA 2PQ6A 2B35A 3OJWA 1RLJA 1M8KA 5FBHA 1Y82A 4GU5A 3JQPA 3DYVA 4TXNA 1H23A 4BNMA 1M1YB 1DPGA 1HTBA 3PC4A 4IVPA 4F4HA 1PJRA 4BNDB 2G3YA 4BJ3A 1NFFA 1RJDA 1XKLA 4DC9A 1JDBB 3NUAA 2IPNA 3B8EA 3IV9A 1KBOA 5AVYA 4YI3A 1YS1X 2PGOA 2PRKA 3L1VA 1SHUX 3ZDFA 4KODA 2QZ4A 1S9DA 2I4OA 2XB9A 3G2HA 3U7QB 4V24A 5BSTA 5EE3A 2F4NA 2F48A 4HF7A 4RTLA 3CX7A 2AUMA 1THMA 4NZYA 3M8KA 5ERGB 3EPGA 5JBQA 3AVXA 2IS2A 3JAMW 1CUUA 3E15A 2PTGA 1S10A 5LZ7A 4YUZA 4GQBA 3RRZA 5KFSA 3U55A 2AMYA 2YWXA 3JYNA 3ELBA 3K70C 1IOWA 3DLAA 4BBPA 4DZRA 4C6SA 3M3PA 4GYWA 2XUPA 1U0RA 1E6MA 4IDFA 1JHVA 3LUAA