3R5XA

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
302
Chain Sequence
SNAMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis complexed with ATP
rcsb
source organism Bacillus anthracis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 84
structure length 302
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r5xA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r5xA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r5xA01
2R6FA 3TINA 1KC7A 4ZQIA 5FNVF 2R7NA 5BPHA 3KAJA 3VOTA 1AUXA 2R85A 1CQIB 3SE7A 3VPDA 5GONF 5J2UF 4FFLA 2WYOA 3GLKA 3N8DA 4YJ3F 4EGQA 2I87A 1C30A 2VR1A 4O4LF 1A9XA 1BXRA 1DV2A 3R5HA 4M9CA 4EA7A 1KJJA 2CNUA 4MV3A 5IYZF 3U54A 2HGSA 3MWDA 4YBZB 3RFCA 2W71A 2GPWA 1M0TA 1GSOA 4O2AF 2GQSA 1VBGA 3BSSA 3Q1KA 4FU0A 4WBNF 1E4EB 2R86A 5J2TF 4TV9F 4O7VA 4M98A 2ZDHA 1T36A 4YAKB 1ULZA 3MWEA 1KUTA 5C1PA 4HNVA 4M99A 4FE2A 4IIJF 4TV8F 3KAKA 4WD3A 5LP6F 1DIKA 3U9SA 2CNVA 3G8CA 4MV1A 2W6NA 4ME6A 3VPCA 3AW8A 3V4ZA 4NYEA 3K5IA 3U55A 2PVPA 1KBLA 2NU8B 1Z2NX 3BG5A 2YYAA 2GLTA 1IOWA 1KEEA 4FFPA 3K3PA 4EA8A 3DF7A 2YW2A 4MA5A 3NUAA 4L1KA 4YAJB 5KKNB 4XYLB 2NU6B 2W6MA 3N6RA 3GIDA 1GSHA 5JQGF 1W96A 3VMMA 4O84A 3HB9A 3VA7A 3WO1A 4MV4A 3HO8A 2VPQA 3TIIA 2J9GA 4IZOA 5C8YF 4FGRA 2DZDA 1KJIA 4O7ZA 3G8DA 1GGOA 2FP4B 5I47A 4MV9A 5JVDF 2QK4A 1B6RA 5JVLA 4EA9A 3RUPA 3ETJA 4EG0A 2NPOA 3BFPA 4O86A 4EABA 2DLNA 2W6ZA 1WR2A 4HQ6A 4O83A 4EGJA 4C5BA 5EZYF 3E5NA 2R7KA 5LXTF 5CAEB 4HNUA 1PK8A 3OUZA 4ZHQF 2QF7A 2R7MA 2YZNA 5DMXA 1A48A 5CA1F 2P0AA 2YRWA 2VHEA 5JQWA 3LP8A 2I8CA 1GLVA 4O4IF 5LA6F 4O7NA 3ORRA 1M0WA 4FFRA 3WO0A 2FB9A 1W93A 2V58A 4GGMX 1M6VA 3TQTA 2YL2A 1I7LA 2NU7B 5HV6A 2W70A 2X0SA 1JDBB 2PBZA 2R87A 3ORQA 4MV8A 2V5AA 1JKJB 5HBRB 4FFOA 1KJ9A 3BSYA 4M9UA 4MA0A 3BSWA 1B6SA 1DV1A 2YS7A 4O82A 5BMVF 5BPFA 4MAMA 4I50F 5K2MA 2YS6A 5LOVF 1EZ1A 3TW6A 4O4HF 4I4TF 1CS0A 5D8DA 2R84A 5KX5F 2YRXA 3K5HA 4C5AA 4QSHA 5CA0F 2GPSA 1EUDB 1OBDA 4IWXA 4E4TA 4O2BF 3UFXB 4HR7A 2FPPB 4ZI7F 1I7NA 1UC9A 4EAAA 1C3OA 3R9RA 1UC8A 2W6QA 2DIKA 3R5XA 2R82A 3LWBA 1CE8A 3U9TA 3HBLA 2CZGA 3I12A 3WNZA 4DIMA 1VKZA 3MJFA 4DLKA 4YJ2F 4O81A 4IHJF 4FFNA 1IOVA 1EHIA 1AUVA 3KALA 4XYMB 2CNQA 2YZGA 2XCLA 3ETHA 2NU9B 4Y8VB 4YB8B 1VBHA 2FPGB 5H80A 4MV7A 1BNCA 1PX2A 2Z02A 4O7LA 2ZDQA 4RZQA 3OUUA 2W6PA 4MV6A 3V4SA 4XZ3B 4O7TA 3Q2OA 3R23A 3TIGA 4IWYA 1GSAA 4O7YA 5LYJF 4XX0B 1E4EA 3JRXA 4J6EA 3VPBA 2GQRA 5CB4F 2IP4A 4I55F 3JRWA 2W6OA 2DWCA 3KREA 3QFFA 3JZFA 5C1OA 4C5CA 1OBGA 1KJ8A 2NUAB 5JH7F 1CQJB 2R7LA 1JLLB 2Z04A 1EUCB 4TUYF 3AX6A 3RV4A 1SCUB 3JZIA 2YZMA 2C00A 2V59A 2HJWA 4O7WA 4ZOLF 4O7RA 4O7SA 4FFMA 1JDEA 1KJQA 2OLSA 1Z2PX 4O4JF 3RV3A 4HNTA 2YWVA 2SCUB 2PN1A 2FPIB 1Z2OX 2YZLA 2XD4A 2ZDGA 2VQDA 3R5FA 2I80A 1EYZA 2CQYA
chains in the Genus database with same CATH superfamily
2O50A 2J46A 2O1SA 3NBFA 2IH2A 4EHLA 1FFAA 3LWDA 2VHUA 3JQEA 1KYXA 4YQWA 3HOYG 1L5RA 1FYDA 2R7NA 4HEA6 1OXMA 2MSNA 1WDMA 3SBDA 1W9HA 1ZBDA 3ITKA 4XWGA 3P71T 2H17A 2ZT6A 4DV2B 2PL3A 3G0HA 2I54A 5FPRA 2YDYA 1R5NA 3RSSA 1MIHA 1Q1ZA 2OLJA 3MT0A 5JSFA 3V3KA 1JQ5A 1UDXA 2WFZA 2B4AA 4CHTA 3FRIA 3ROFA 5JAIA 5CFRA 4MMZB 4ZJPA 3PQ3A 4FFLA 4V0OA 2QMUA 3UB4A 5DX0A 4EFBA 3ZWOA 2ZUBA 1KAGA 1VE7A 4LOKA 4O4LF 2OOKA 1DV2A 1I4WA 3F49S 3O73A 4Y6GB 5ALLA 4RTSA 3L4SO 4ZT5A 4B6OA 3AR2A 4F2WA 3OE5A 1FFHA 1H66A 1SCAA 1TU3A 4I08A 1P5ZB 1WSBA 3O7MA 3GVPA 4O2RA 2ZIUB 1YHZA 5KT5A 2XOXA 2W58A 2IBSA 4UM5A 1K4KA 4U6NA 5BN4A 4KHPB 4U7GA 2NVUA 2XTNA 3RFCA 1FFXA 2B1JA 1GA1A 3WRYC 1TOAA 5A3QA 3MXOA 3QQMA 3QEJA 4JU9A 2YFYA 4PQYA 3NOQA 2ZIXA 4C7KA 4CMBA 1DIHA 4EA6A 4ZOQI 4US2R 4UNQA 4OQMA 1NSYA 4JC4A 3CY6A 3NBYB 1RXEA 1J09A 4R9UC 1YVUA 1KK0A 3I62A 5HK9A 1BEEA 1RI3A 3DULA 1Z5PA 1DG9A 2ZT8A 5KFJA 1P4JA 3EFBA 3IVRA 4ECTA 5JS6A 2OBFA 4HAOA 5GVSA 2VPZA 1X7YB 3S8EA 4LF4H 1VJ1A 2OOSA 4JASB 3GRVA 4MTCA 4HLCA 4OHFA 3DLAA 3EPJA 4GI1A 4LIPD 2ALZA 3C87A 3ZLVA 3WGMA 4JP5A 1MF7A 3L6CA 1F3OA 3C7DB 1SEIA 4YJFA 2HEGA 3RB8A 2JIBA 4IZ6A 1MC8A 3KAKA 2OGUA 3DZGA 1NM5A 2O8NA 4LF6H 4DJJA 5C1BA 2Z4TA 5FA8A 5LIPA 1GCOA 2CNBA 2E18A 4KVZA 3VKWA 3GQCA 3E9EA 1KZ7B 1LQUA 4LXIA 3RUAA 3ED1A 5BMVA 4CMGA 4ZVQA 1LWNA 2GWRA 3LKBA 4NG4A 3CLRC 4E4YA 2CHFA 3GA5A 1CVLA 1CZKA 2GN8A 2RGDA 3OTGA 4F6RB 1SK9A 3K72B 4D8TA 2Z57A 4M88A 4RIFA 4Y0AA 1X1AA 3WLJA 4KE7A 1QDUA 3NVMB 3WZMA 3H42B 3L7CA 2QX8A 4DKJA 3DF7A 1R0KA 4BMPB 3S2UA 1TEHA 1ISIA 4Q16A 2JLSA 4XB2A 1AKRA 1SKUA 5TSDA 2UXCH 4YLGA 1L4LA 5A04A 2QP3A 3UIEA 4X94A 1KNQA 1SBIA 1NJ5A 2D2FA 5I5WA 3UPDA 3UA3A 4PYLA 3K5PA 1QGED 4KIFA 2NU6B 2J0UA 1CXZA 4OXXA 4UJ3A 2QVXX 2R8GA 2OZKA 4MEBA 1M2NA 1XKXA 4QELA 1N6KA 4XGRA 3P2KA 4CEIB 1J20A 1TO2E 3SE0A 3ZWMA 5IT9A 1I5RA 2VAMA 1WCIA 1LVGA 4IEFB 4UKDA 3TNYA 3KPVA 4R0MA 4RADA 1H4VB 1XHFA 1Y1TA 1WOMA 1YOBA 4NBUA 5CLGA 3A2NA 3PJEA 5K5EA 1UIMA 3EZ9A 3G2LA 5TXGA 3KYIB 2WJIA 2X3FA 1YZFA 3V55A 1AKNA 2D5CA 2QGFA 3GVCA 3TZCA 5E3JA 3OIGA 4EX7A 1UBNA 1QCZA 4G1MB 1JQAA 3F6EX 3ZXIA 1VRWA 2J0VA 4MICA 3N58A 3ITNA 1GG8A 2AFHE 2V55B 3A6LA 1HXHA 4E13A 3SY8A 2AC2A 4NEQA 4IFEA 4IZOA 1ZXXA 4DCUA 1XZEA 1L5MA 5TVGA 3SJCA 2HBYA 3G89A 2B5VA 2Q3DA 4XTCS 4EUHA 1Z25A 4DSTA 2JI4A 2JEOA 4X62H 1KGSA 2NU7A 1VKJA 4ID3A 1KTVA 1UWVA 4ZVUA 1H4SA 4QWAA 4YMTA 3KL2A 4Z5XA 1JMYA 1B6RA 5IYZA 1U9JA 1YDHA 1ZVQA 4TTIA 4LC9A 1IRIA 4HCJA 4QVIA 2NPOA 3O31A 2A9KA 2A57A 1KFBB 1NHGA 1Z75A 3UXYA 3SS8A 4E6EA 5E6UB 2JLXA 1KL7A 3Q3IA 4EF6A 4F5ZA 2JS7A 5DQIA 1RXUA 3MILA 4FN5A 4X66B 4OQEA 2J3HA 5KHAA 3H7IA 4I6JA 3SPXA 4S04A 2G36A 1U2GC 1M2JA 5DM60 5KFAA 1E7YA 1XA0A 1N2ZA 1ZAYA 2ZU6A 3Q41A 4FNMA 5CE8A 4URZR 5B36A 3I5AA 2OSBA 3MTIA 5A71A 2LE0A 1E94E 1Q17A 3FJ1A 4BEJA 1QYDA 1UKAA 2CHEA 2FZ4A 3QYAA 1F2VA 1T6XA 1IBRA 3RUHA 1E77A 3E35A 5EGSA 3K0AB 1Z5VA 5KMGB 1WUYA 4Q1DA 2BYTA 5IT9W 5GM1A 4RTKA 4YR0A 2NSYA 4F6CA 3W6NA 1P9LA 2QLFA 3GK3A 4Q66C 5D1PA 1WDTA 3K4HA 4H6VA 3O2QB 5CA1F 2P0AA 2IP2A 1UFRA 2AC7A 4EIWA 3V9PA 3X1MA 2YFHA 2JEZA 3BCRA 3KFXA 1JAHA 4KBFA 4AUKA 2EJTA 3GFRA 4ZWNA 5JQWA 1C9KA 4Q93A 1N1MA 3GGJA 1KDTA 2OFOA 3OZXA 2CHUA 2PEYA 3L0DA 2R92G 3WGTA 1C3JA 2VBGA 3R0JA 2VPTA 3ZOKA 4OSEA 1NXVA 1YDMA 4EKNB 5JAPA 1DX4A 1EK1A 2E4WA 4WOKA 2DQSA 4UPVA 5HTOA 2XNDA 2VKTA 4G3XA 4I4TA 3HHEA 3HV0A 2HF9A 3WOVA 1NQTA 3ORRA 2OGWA 3WO0A 1YVEI 4GT1A 2YV5A 3RKRA 1DQZA 2WU3A 4QO7A 4BJ3A 2YYZA 3KR0A 2OM6A 1I33A 1UMDB 2VEOA 4O3NA 1E1NA 3ZD7A 5AJXA 2EJ0A 4WI1A 4NOJA 1U7PA 2DBVO 4NMHA 1P74A 3E8SA 4TTJA 4MV8A 1NC3A 2V5AA 1TC1A 5UKDA 3VR5D 3ZVKA 4OA8A 4XDHA 4AJ2A 4I4TB 1M54A 1JVNA 1MRNA 2PRIA 1RJRA 1X70A 1QKJA 3BSFA 5H83A 3CG4A 4YGYA 3STTA 4UXIA 1ZCJA 1VDMA 3AI1A 2QIOA 1K0FA 2Y1FA 3I83A 3ZNNA 1XP8A 1IAQA 3HL0A 3SDSA 2DERA 2P69A 2VH1A 5IYDG 4M9UA 1OZGA 1XKTA 1ZX1A 3AUTA 3OESA 4JMLA 4KO8A 4EWLA 2XZDA 4Q3KA 4UZFA 1ABBA 4Z4IA 2Q21A 4J9LA 4IQGA 2I9KA 4L8GA 2YS7A 3TW0A 3WRWA 3NAMA 5KSWB 2FDRA 4KRGA 5BMVF 4ZJUA 4JYAB 3PRHA 4R2JA 1LPSA 4Q1VA 1TO6A 2B1QA 2FKLA 1EQAA 1DE0A 3K94A 4M0LA 4KN6A 2ODTX 1FMCA 3OOEA 2R66A 3EW9A 3M9NB 3G2IA 4HNAA 1OB2A 4CDRA 1QYWA 4M1OA 4QOGA 4RK5A 2XCAA 2ZTHA 3IVAA 1BN6A 3WS7A 1XB2A 1GP2A 1JW9B 1NXSA 2X1MA 3UJCA 3D3NA 3PC8A 1X38A 3U5TA 4RAZA 3TTUA 1RYDA 2ZXFA 1OZ0A 2XCIA 5KSPA 1M5TA 1DAAA 1L4KA 3UGJA 3PVZA 5MGBA 1BHSA 1ZUD1 4X45A 5BURA 1L5YA 2HREA 1I1NA 1L4EA 2QVLA 3G0CA 3SM3A 5KO2A 2CSXA 2AD1A 1QCDA 4D43A 1MIOA 3P0IA 4ETMA 3SVZA 1T2NA 5BMOA 1EP2B 3KKKA 1NE7A 4LCBA 4AJEA 3TZEA 1BWSA 4IUYA 4F92B 5JO0A 5HP4A 3IXLA 4JYBA 4GIBA 1X6VA 4XASA 4XEUA 2Z6QA 3G8AA 3QX7A 4ZA2A 4Z4GA 3VI3B 2J0QA 4QGHA 3T7CA 5KMGA 3N0WA 2J85A 3MWDB 5K8CA 3OWHA 2GM5A 3JYHA 3LZDA 3U4QA 4MVJA 3TKAA 4DWOA 4LZPA 2J7PA 2A94A 1D1PA 2OCDA 2C96A 2O9JA 2OQVA 5A0VA 1OU0A 1KSJA 1VLJA 2V9CA 3T1QA 2QXUA 3NDIA 3LHDA 4PLVA 5F2EA 2LIVA 2ZUCA 4QECA 3VVMA 3T9DA 1V6SA 4YAOA 4BVJA 2YY5A 3HCDA 3OCCA 4LF5B 4N54A 2DIKA 1L7VC 3AT1A 2QW8A 5H3HA 4GRDA 1SRRA 3EDYA 5FF9A 3W1WA 4KVAA 4R0NA 4BIIA 3M1AA 4JI2H 3DQQA 3ZU2A 1P7VA 1A8IA 2FSUA 3QLTA 1R4NA 3N53A 3ZV5A 4D3YA 4ECRA 1Q1GA 1V1JA 1JDTA 2A9RA 5C5IA 5D2CA 2Q4EA 4A3MG 3VNNA 4LHVA 4A6EA 1LPOA 4YEDA 1XV5A 4FXPA 2NQ8A 3IHWA 2DFKB 2Z08A 3NCHA 1O6FA 4G2TA 1K7SN 4RLFA 2B2CA 1PDWA 2CVZA 2QRKA 4R8RA 2ZZKA 1W25A 4JBXA 2PMZA 2P7IA 3HCEA 2JEGA 1GO3E 1D7AA 4YO7A 3OLYA 5JSZA 4APMA 1UUFA 2C3YA 3IODA 1AJEA 3FNRA 1PE0A 3OC6A 1K0UA 4ARVA 2VJYA 4KNYA 1RDFA 1KDPA 3IEKA 1QKKA 3OPMA 3E9ZA 1ORDA 4XYMB 1J0AA 3VSAA 3ZE1B 3COVA 4Q7JB 3EW7A 4KO4S 4F8EA 3EWSA 3GG9A 1U3CA 3R7LA 3DFMA 3S4YA 4KLZA 2GUGA 4FBGA 4EP1A 3SHOA 4UPDA 2RARA 1A95A 4JZYA 4AJ9A 2J08A 1EG2A 3IKLA 2NG1A 3MOIA 4YXWA 4BLTA 1G21E 3HOWG 2EFDB 4DAAA 1G9TA 1LF0A 2JAOA 1RJQA 2O23A 3QVSA 4G6ZA 4GOOD 1FPQA 2VP3A 5ENDA 1RWXA 4E31A 4MXDA 5FI1B 5BV8A 2I55A 1Z9BA 3U9LA 3S1SA 4QVGA 1KQ3A 3GFTA 4QDJA 1XDZA 5HDQA 5SYAA 2O8CA 3KQLA 2EGGA 3OFNA 5HKAA 5LFAA 1Y6GA 1N2JA 1RWMA 1UMKA 2QV0A 1EWKA 2ODAA 1DJQA 3F78A 2CLLB 3OBBA 5DGIA 3AF2A 1AKMA 1SUIA 4CGYA 4WN3A 4Y0VA 1VJDA 1BOOA 3M49A 5TRTA 3UT5B 3QLJA 5HBGA 3ZY4A 5LMNH 3EYYA 1L5VA 4E1VA 1Q15A 4CWAA 5SZHB 3LCCA 3SOPA 4AYBA 5EMNA 4NU0A 1LCIA 3Q72A 3QUBA 2C7BA 5CW1A 3FTDA 4MULA 2BFFB 3OG9A 1T3NA 3T3HA 1P3JA 2FQYA 1XMQH 1U2ZA 2G28A 2V4UA 3WQQA 1Z56C 1MAVA 2YJNA 1ZCAA 3F4KA 2QROA 1TZ2A 1TYEB 2QR2A 3DVLA 2B2NA 3RQIA 5F2KA 1TZMA 5LP6A 1M72A 1NNLA 1QR6A 1X9GA 4LVNA 4WTOA 3EMDA 5FTNA 3MW8A 2NVOA 5BP7A 3DCNA 4XQGA 5DCUA 2ZWAA 2ODWA 4UEJA 5DTQA 3N8IA 2Q3MA 1YFZA 2AFRA 1N3LA 3C97A 4FK8A 2XOKA 4BRUA 2DJIA 3QOWA 3DTGA 1BN7A 1TVKA 3SYRA 4G0PA 2ZSEA 4MRMA 4FI3C 1BWPA 3V1MA 4FYHA 2C78A 1VHJA 3TTTA 1X1DA 3LLVA 4PAOA 2G4LA 4IOLA 3PUYA 3RVDA 2GEVA 3E53A 3DDSA 1HF3A 3OA0A 4RU9A 5B1HA 3W05A 1Q7BA 1Z5NA 4DQ0A 4TMVA 1NVKA 4EF4A 3L77A 2CBZA 3PEYA 3IUQA 2Z9DA 1NVWQ 1PP4A 1RTTA 1Z0FA 2O6LA 5F73A 3GUYA 5JW6A 2Z04A 3AX6A 3SBOA 4HV4A 1I1HA 1XTRA 3OM8A 5ERGB 2BKEA 2F1OA 4PFJA 4EMUA 2L0XA 3W5CA 2IV3A 4QNMA 1SKBA 5DGXA 4JOBA 1E2UA 3MCVA 2BGLA 4HDNB 5I9NA 2XWSA 2GM9A 3G6WA 3JW8A 3D6VA 1P7CA 2LIPA 3SKVA 4R3WA 3KTDA 5BSHA 1RXWA 1NSFA 1G7RA 1FP6A 2FPPA 4IXMA 3SZLA 5HMMA 5IAKA 4LOAA 1E60A 3EZNA 2H1IA 5IBQA 3A70A 3VDQA 3VMFA 3OA2A 5EP3A 4O4JA 1XCGB 5REQB 4QU0A 4PZZA 4FJ1A 4FW9A 4EBFA 1OXKB 2B7BA 4LYYA 2CUKA 2WWVD 4CKXA 1LBQA 3NONA 3ZS9A 4ESOA 1N32B 4P31A 2VRWA 4XVQA 1E64A 3PZBA 3ZU5A 1IBKH 1T5IA 1WXGA 2I33A 2GAJA 5EP2A 4L22A 3N6VA 1VDZA 1PO7A 1FJGB 3RKSA 4IMJB 3UT0A 4ALIA 2ZDGA 3GRUA 4TTTS 3ODPA 4N76A 3BS4A 3T7EA 3VTFA 2FR8C 2ZSAA 4BQOA 5D7BA 5CFZA 5I7WA 4L75A 1HORA 5JCOA 5D3MA 3U3OA 3GPDG 3AEYA 1HFEL 3AFOA 2XUKA 3K9QO 1J24A 3QFCA 4IRUB 4YC7A 1GQRA 1TK9A 1CFZA 1TNDA 1ZD9A 4K87A 5MFZA 1W0JA 2VT6A 4MS4B 1K06A 2ATEA 2I0FA 4PLWA 3GHYA 3HY3A 5FPPA 4DSNA 3QXSA 2Y4NA 1O08A 1YE3A 4NYMQ 4Z7QB 5C18A 1H3EA 4O3PA 3MVEA 4KXFB 4PVCA 5EMMA 3ZI4A 3KJXA 3X1DA 2OCIA 5IFKA 4ENVA 2QD4A 2DVMA 1E79D 1V3QE 5L8VA 1T8WA 4J4BA 3PUZA 3R3HA 1ZL0A 2KBFA 1CQIB 1YONA 4MUIA 4RA6A 1NT4A 4XIJA 1Z17A 5JCJD 1F0PA 5HZKA 4IW3B 2QG6A 4Q4AA 1M66A 2WVHA 2IPAB 2IOHA 3V1LA 4DNFA 5JH7B 1RVV1 3AI7A 2DFDA 3F5MA 3QLEA 3HA2A 4H31A 1NR1A 1ZIOA 2AUMA 2ZAYA 2IXBA 3L8ZA 2ZSJA 3F4LA 1OH6A 1R12A 4CL2A 1UBLS 1ZG3A 4AM8A 1AB6A 4WK4B 1LK0A 2C9BA 3ADDA 3OEHA 1QTRA 1JVBA 2ZRNA 3GCGA 1XMIA 2C2WA 4HO1X 1SUPA 3HVHA 3IH5A 5MN4A 4QM7A 4HVAA 3W9YA 2E0IA 3QVXA 1DMSA 1B8NA 4UEWA 1HG0A 1SPBS 4N9QA 3GLIA 4J9OA 1ISJA 2R7ZA 3Q7QA 4O8ZA 1CYEA 2I6FA 3DBIA 4OAQA 3MWDA 3L8HA 4ML3A 4WACA 1NF3A 5BWXA 2GYYA 1P91A 3IAAA 4YBZB 4YBRA 2AZXA 4MDHA 1TA0A 1IY2A 3C3XA 3L7OA 1EBUA 2H92A 2OM2A 1XRMA 2Y0DA 3T9FA 2DTEA 4OLAA 3MWEB 2GQSA 3SX4A 5BVHB 4GKKH 4KQFA 4B48A 3BVPA 1SRQA 1ADFA 2XZPA 4U9HS 3VAYA 6ADHA 2WP0A 1FVOA 2P40A 2GBGA 3EULA 1E3WB 2XNSA 3LPCA 3OPXA 4M21A 1DC3A 4NCKA 5J2TF 1Z73A 4TXJA 4V39A 1Z4QA 2JLYA 5HM8A 1NKSA 2C9YA 3GRKA 3X1YA 3FXAA 1FSGA 4NAHA 1L7NA 2GFQA 1JAYA 1NUPA 2FRXA 1G5TA 1R4NB 2C0CA 5B2FA 2IZ5A 5ILQA 5K3OA 4YXFA 4L7VA 5BW4A 1ULZA 3VV2A 3MWEA 3S2YA 1JBKA 1AGXA 1P17A 4AC9A 3GNSA 3ZXXA 3FVWA 5EJ7A 4MLDA 4PSKA 4CW7A 3B1JA 5EVJA 3BQ2A 1IQUA 2VYCA 5AVTA 5HKOA 3ZIDA 2QN7A 3QOYA 2XXJA 2WU1A 1HE2A 3LT1A 3BQ0A 5IVKA 1UPXA 2EDAA 4F4ZA 3ZZTA 1MB9A 5BWOA 3IUEA 2C57A 2GO7A 3M0EA 4LI0A 4RTQA 2HU7A 2ZUFA 3BJEA 3P9PA 4GKAA 1P7ZA 4PO3X 2Y1LA 2PA0A 4J9NA 2YC4C 4B3XA 3WLKX 3C8ZA 1MO4A 4RV9A 3T3GA 3ZWYA 1UOOA 1TT5B 1DCMA 3HFSA 1Z2NX 3KKZA 4JSTA 1I4OA 3MGKA 1GT6A 1Y48E 5BR1A 3DYIA 3OP4A 2EW1A 1CTQA 1Q20A 3AVPA 4JLNA 1PR4A 3JRNA 1IJKA 3UYKA 2PGOA 2QX6A 1EHCA 3EFHA 4CL0A 4RMHA 4EKDA 5B2EA 3ADBA 2ZB4A 4D3XA 3LUKA 1VKOA 4GW3A 3I9LA 2GNOA 1XXHB 4RHUA 4RUKA 5EI5A 3HWRA 3TH5A 1NT2A 1VSUA 2FW0A 2Z9CA 3GZ4A 2H06A 2RJNA 2Z83A 3K1TA 4JC0A 4J7AA 4BLSA 3W3AA 4KFCA 1YD7A 2ZAGA 1WXEA 2OV3A 3RJZA 4U00A 2B5WA 3D5EA 1TADA 4ZVVA 1FLAA 3MK31 2EIHA 1YL5A 1MKYA 3LPNA 4BKQA 1N2GA 3T1HB 3PXXA 3K53A 4XI9A 5DQGA 1ZA2A 2CVOA 1UBJS 3CJRA 2E1PA 5HNEA 4ZFNA 1Z18A 3QOXA 4Q7LA 3ZQ6A 1NLZA 5KQRA 2VT3A 1DBWA 4OUKX 1Z5ZA 4OUDA 2FW1A 1UDBA 5T8KC 4A3FG 4LF7H 4MNTA 4JNCA 1HQKA 2IPOA 1S5PA 2PZJA 1AM4D 1ZICA 2I5PO 2QI9F 3BUSA 4K40A 2VYND 4EFMA 3NORA 1GEGA 3RR5A 1PZFA 2WG1A 2WMDA 1U1FA 3A3NA 3FCXA 3M34A 3OJCA 1CEYA 4ZAGA 2IHZA 1V51A 2VHQA 3EEFA 5J58A 3EJWA 3M1YA 4A0RA 5C8YF 1N7JA 2R4UA 3AP3A 3ISJA 4UUGA 3AVVA 1KAEA 3REOA 5HGXA 1F8FA 3LPAA 1VL5A 2A9JA 3T4XA 4MS3B 4V0RA 3TY9A 1DOZA 1E0DA 2FOIA 1VKHA 2Q50A 2YWDA 3Q12A 4G65A 1ESMA 5C32A 4QUBA 1V1MB 2YOHA 2IEAA 3ZR4B 5I8PA 4ESVA 4HN4B 5I5XA 2XA9A 4PPYA 3UG7A 4I5EA 5I4KA 4EG0A 1WMBA 2VNHA 1RWWA 1P2SA 2J9XB 3D3EA 2FEMA 3FVRA 4EYIB 4ZTZB 2X2PA 4N12A 4CBVA 4HLDA 4BMSA 3WIEA 3I4NG 2X86A 1ZHSA 2ABWA 5EWLA 2QTWB 3KVVA 4UHKA 1NA5A 1EVKA 3QRWA 1MDFA 1NBIA 4KXLA 1TQ6A 2O20A 2JAPA 3ZDXB 1V4BA 1NIPA 3DMTA 3PTZA 4H27A 1AE1A 4G5GA 5CLQA 3C5VA 4BLUA 2D13A 4V0MA 4JJIA 3GJYA 4IIDA 5DNAA 1IXYA 2L19A 1GVNB 1UXJA 3TLGB 5TX7A 2OFFA 1SVSA 1RYZA 3CHYA 3FLMA 1H85A 3DT9A 1NZDA 3ITDA 3AHIA 2OZVA 4XPIB 1W4RA 5AR1A 3E6AA 2X8AA 1CDDA 1RBMA 2YV4A 3LO8A 4EPYA 3GEGA 1RRGA 1FXWA 4YH1A 1AQYA 1ANKA 1ZA1A 1FDTA 3DE3X 4HQNA 4WH0A 4KQHA 3TTXA 3ZGXA 4C0AC 1V48A 3RS7A 16PKA 1TUEA 3KXKA 3L6BA 4GQAA 4ZICA 1R8YA 4A8JA 1TKBA 2ZT7A 5D86A 3CKYA 1MOPA 1VMAA 1ESNA 2WTMA 2ZE6A 4X1OA 2HSDA 4FEEA 1WS6A 4N3BA 4Z0HO 4CI9A 4E11A 3L7AA 3CW9A 1E1QA 3L7YA 2DBQA 1J97A 2P9BA 1Z8FA 3KEOA 4L07A 3W6UA 2ZJBA 4F9TA 4AMBA 3SS9X 1K7FB 2WB1A 1Y7IA 2O8VA 1KJZA 4GOXA 5DO9A 3PDCA 3RVPA 2HMYB 4E15A 1OZHA 5LA6F 2VT7A 4LV5B 3IXQA 5CX4A 3TGPA 2IKSA 1G9XA 4X91A 1U2DC 2JKZA 3J7AK 1AXGA 1NLYA 1NMYA 2VZEA 2QD2A 1XCPA 3WMXA 5GJWC 1ORHA 4WZZA 3ZN2A 2OCPA 2PIAA 3P1JA 4MROA 3WAJA 1KI6B 3IELA 3KJFA 4BQQA 2X0IA 2BHRA 4LSMA 1JNYA 4BFXA 4HFMA 2QS9A 2RGEA 4HGOA 1W4AA 1C41A 1JEDA 2KJQA 2G1KA 2P8SA 1E7WA 1NVTA 3CM0A 2R87A 3ORQA 3GNQA 4YRQA 2ZJOA 1E1KA 1ELOA 1F5NA 4MQ5A 2ASJA 5KVQA 1JH9A 2K6GA 1YS6A 4PG5A 3RC2A 4CVNA 2A5LA 5KFFA 1Y9AA 1TAQA 1HLPA 4KN5A 2RHJA 3F6SA 3MBKA 4LYDA 1UWCA 1Y4UA 3B1FA 4RNDB 5ALOA 5HVNA 3D7SA 3GC6A 4PBCA 2OHXA 1Z82A 5KVCA 1W8IA 4LHWA 4Q12A 4AULA 4OQFA 4FT2A 3QPCA 2KB0A 1Q21A 3VC2A 4C4OA 4EI2A 1D0VA 1PT5A 4PBTA 2QVCA 4DA8A 1XHLA 4Z9FA 1A9SA 2YIJA 4HD8A 4DIEA 5I5EA 4YJGB 3G6KA 1CUXA 1C29B 1T4DA 2FMUA 3AEXA 3IHLA 4GR4A 1KVRA 4BS9A 1XROA 2ZK7A 4RKQA 1Z68A 2L2QA 3A14A 3HACA 3ENKA 4LF8H 3I23A 4J0GA 5IEBA 4PF1A 4L02A 3QH4A 4LJAA 4U6SA 4UASA 5ICCA 4R8LA 3LYAA 1ZQ1A 4IJ6A 3KWFA 4O0MA 2XTJA 4CM7A 3S0JA 1S1MA 3MJVA 4QIWE 1SB8A 2SKDA 1EIWA 4EGFA 2R84A 2OWOA 3G1WA 4UVIA 4TZTA 2YRXA 4YRKA 8MHTA 5AM4A 1QRRA 1Y8AA 2Q99A 3BL6A 1YRAA 2YJ5A 1W36D 1KO4A 1UXHA 4L15A 4LJSA 4XFDA 4RH0A 2YZ7A 4LQLA 4YJHA 1FZTA 2A9OA 3ZHBA 1RZVA 2C0QA 2I76A 1C7QA 2ZVQX 3LUBA 5IBRA 5DGBA 3FSRA 3A1CA 3EXEB 3HKCB 1GGNA 3H7AA 3QNUA 4Z99A 1A69A 2VHZA 5T6BA 1OBDA 4LEIA 2ASDA 1J2EA 1VTKA 1QQ5A 5KSZA 2R44A 1B1AA 2FWPA 3DMPA 1S89A 4Q4HA 5D51S 2AZ4A 3WFJA 3THXB 2G06A 2I71A 5HF6A 1QPBA 4FFWA 4MCJA 3NALA 3NYQA 2GHTA 2RGAA 3AIIA 1ACMA 3TI9A 3EYAA 5CB4B 4MUBA 1P2VA 3DXXA 4A2PA 5K0GA 2XCQA 2G5CA 2R8JA 1IEXA 2WVGA 1OC2A 3O9ZA 4F72A 3S2ZA 2VSNA 3C1TA 5BUQA 4HSGA 2FR0A 2CVPA 3S40A 1S03G 3PHBE 3DKKA 1ECJA 4NYJR 4HAIA 3I76A 5J4HA 1GZ7A 3R3VA 2V6FA 4L78A 4ECYA 2FZCA 3WDKA 2VQFB 1DG1G 3HVKA 5F64A 5HJEA 4U2KA 2VAWA 5LYJA 1MEEA 3T1OA 1TCCA 3RODA 3PC7A 4DS3A 1W4CA 4YP6A 5FLEX 4CN9A 4NE2A 3DD1A 1VPEA 3OTOB 2GEUA 3C5WP 2Q4DA 4YAEA 4E0BA 4UMEA 4GSYA 4I9NA 1IVYA 3D1LA 1XP5A 5JMOA 3M9LA 5AKJA 4AJNA 1ZN7A 3A1NA 4C3UA 1Y1SA 3MS2A 2XB6A 1XU9A 3QWAA 1EE2A 4I6EA 5BWNA 2COUA 4W9NA 4B35A 1R66A 1Y8RA 3LD9A 5T4BA 2XUPA 1G5IA 3PQ4A 5G0WA 2QVGA 4OK3A 4QNRA 4AMYA 3H75A 3ZWWA 5E2AA 3LTNC 3BXOA 3Q8RB 4LYHA 1NRIA 1LRLA 3PKIA 1ES9A 3MGGA 5H1YA 4YUZA 1TIKA 3KALA 1C9MA 2XWQA 1JE1A 2DX7A 4NSNA 1X77A 2ODQA 2ZW9A 3M7IA 3T1YB 4QULA 4FOPA 4IAOA 7GPBA 4ZVRA 1WLYA 3CNNA 2PFKA 4B6EA 3SSOA 2Z3VA 2A1UB 5HEKA 3KDPA 1Z7YA 5JECA 4YB8B 3EDCA 5JWOA 1KEUA 3MWKA 1B4DA 4E70A 1AURA 1PR9A 4U02A 1VQ1A 1PX2A 3GBPA 5A03A 4DHEA 1H2BA 1PWYE 2BW0A 5C7YA 1KT8A 5FNVA 3O8RA 1TJ5A 1WW8A 2FEWB 4KR0A 4ZYZA 1U8ZA 4A26A 2QYSA 4N65A 4EFNA 3Q8SB 4WBNB 4E5NA 5AQ1A 1FEZA 1X1BA 2BMDA 2RGCA 2JFFA 3QKRB 4QBGB 4RCVA 4DV7H 4F56A 4PV7A 3T1TA 4KREA 2IYQA 4KE6A 3HKBB 2BEWB 3L41A 4YCLA 2VAVA 3SFVA 4UE3S 2O8CB 3DR3A 3TYXA 1KJNA 3KK0A 3M3PA 4RD4A 1BMTA 1U2SA 1L5WA 2YJ4A 3PC8C 3Q2OA 5DYTA 1ZGBA 4NRDA 4DV7B 4KSBA 5JC1A 1AQ6A 2D74A 1QLHA 1KMHA 3DV0A 3VVCA 5CHYA 1XMQB 1FTWA 3IOCA 1PYDA 2G1AA 3O91A 3B9RA 1VJGA 4C0HA 1KETA 5KG2A 1LXCA 1YBFA 3FKSA 5AHWA 3R9XB 1RLUA 2JCYA 5EZQA 3OLVA 3H9EO 2PSDA 3L18A 3ZY2A 4ROSA 4N5HX 1CKNB 3DHYA 2F8TA 4JLOA 4OK5A 3L8YA 3D6AA 2C31A 4RPCA 1XTJA 2PUHA 3PPWA 1D4FA 5KDLA 2TECE 4GLXA 2W4QA 2XMPA 4LGMA 3G2MA 4QODA 2OYRA 3TLZA 5TMPA 4DDWA 1W34A 4RFSA 4R84A 1P7YA 1RU3A 2BSXA 2B0JA 2P30A 1QLWA 2G4CA 4DCVA 1MVLA 1TUBA 3T38A 5KFHA 5B5SA 3A28A 4ECVA 4ZREA 3IEXA 5EJIA 5GADl 5TDHA 2IZOA 4O4HB 4PIMA 5BO5A 4DBVO 1NBWB 1I2DA 2AEMA 1E2LA 2IHYA 3HNPA 2EHDA 3A8TA 1YAHA 1ZJ6A 3G6YA 3Q8XB 3C8HA 4NCIA 3R8FA 1UJ5A 5EKSA 2VPIA 2R1ZA 2X0JA 3E7WA 3FNEA 1Z0JA 3RNLA 4OQPA 3THOA 2VOBA 1KJ8A 1BKYA 1GLNA 3IP1A 1S9DA 1EFKA 2OCLA 3LYLA 3MQ2A 1OILA 2PL1A 5KB3A 4NHEA 2D3TA 4ZK2A 5DOZA 2AR9A 4JBGA 3E58A 2UYYA 5KNCD 4W8GA 3H2JA 5FI3A 3EPHA 2PX5A 1E4OA 3E5HA 3RASA 5JCPA 4KK3A 1ZMOA 5F52A 2PUDA 1CQJA 2R3SA 1O96B 3B2EA 1XEWY 3QPBA 2DHEA 5FPSA 3IBYA 4E22A 4YP0A 5A05A 2V03A 5CM2Z 3OBIA 1UZMA 5KYVA 4WWHA 5TB5A 4EFLA 3FDXA 2E5WA 4LZNA 3TF5A 1RZRA 4E09A 4WEOA 4ATNA 4DPMA 3N76A 4MP3A 4UCSA 3TS1A 4R9VA 4W82A 1J9ZA 1ZVKA 2Q5LA 4XVRA 2HDHA 2D0DA 2I4TA 2ST1A 3OPYB 5DI3B 3KUCA 3SLKA 4U1RA 5BORA 4O4JF 1EKXA 3OM1A 1P3DA 4MTEA 1I1KA 4MYUA 1DEKA 3PXAA 5A9RA 2QMHA 1OLUA 2XTAA 3NTVA 4XARA 5HPYB 1SZDA 2JLZA 2HW8A 4M0CA 5AKLA 3EGVA 3HP1A 3IPAA 4LK3A 5KG1A 4KMMA 4MJXA 2ZUTA 2P9CA 4NJMA 4ZDIA 7ADHA 3FPLA 1T35A 3VH3A 3IAS6 1L4UA 4CR7A 4EY7A 5BYKA 2X4IA 1O75A 3KB6A 1RYNA 1QZ3A 1T25A 4G0VA 1Y1WA 1OT3A 1QPZA 3KS9A 4DB2A 3CN9A 3KSDO 3ZDFA 3A6PC 2AE2A 1B16A 1NY5A 1TMGE 2ERXA 1XG5A 1P6QA 3EZXA 3FNIA 1XYVA 1Y98A 2IZ7A 2V9PA 2CMKA 1FYWA 3RIHA 4D46A 3Q3VA 1TWHA 3IUSA 3GP8A 2C2MA 4XYBA 3I6MA 1US8A 3PR4A 1XVLA 2EKQA 1NQUA 2EJBA 2YASA 1X15A 1Y9JA 2J4CA 3DAPA 4J3JA 4I8XA 1VCOA 2JFUA 3EZLA 3JAKA 1EM8A 4L74A 3RRNA 4KH0A 4RVNA 1IBKB 1YL6A 4HDRB 1R6XA 3D0QA 4XUEA 2C2HA 3O38A 2QRMA 1JJ7A 1GGMA 1TM3E 3EIQA 4YWHA 4RJKA 3KZMA 1P0CA 4HQKA 2W0SA 1R37A 3BWDD 3LMLA 1LZKA 1IONA 2VH5R 5K0LA 4YJ3A 3V80A 2Q7XA 1Y89A 2W9XA 3S3TA 4AY2A 3AWDA 1GPBA 2E5LH 1XWFA 3ZWNA 2DH5A 5EJEA 2HDWA 2OO3A 4R2WA 5H59A 5EUMA 4BC1A 1KVSA 3UVEA 5L3QA 4I3FA 4DY6A 4RCNA 1YCDA 2HU5A 2DSNA 2X4GA 3JQAA 1KI9A 1U7WA 1VLQA 4Q24A 5DX8A 4ER3A 5HSGA 5TQJA 3FFWA 4EI8A 4YLYA 1UBTS 5JT1A 3TL6A 2F3QA 3DFZA 1KRWA 1MH9A 2G80A 4LC1A 2C9DA 4PG6A 4UZEA 5KYKA 2X42A 3DNMA 4YCJA 2GPWA 4QRHA 1M0TA 1GSOA 1R8QA 3D7RA 3EVTA 1DAGA 4TTSA 5C2JB 4GPEA 3A3YA 1WEHA 3OQ1A 3H9JA 5DXFA 2HQOA 4B3JA 2CXUA 3HDTA 5KWJA 4BTEA 1J8MF 2Y0BA 3LQSA 4QTZA 1SGWA 4G1BA 2P67A 2Z8YM 1BGVA 1BS1A 3A32A 1P0FA 2E4XA 1WSCA 4KQEA 3UK6A 4NNOA 1G64A 4DM4A 1UZNA 2FPIA 2PUAA 1KI2A 1KI8A 1CY0A 3O1IC 1SKQA 3K71B 3EY9A 2WF7A 3FAZA 4M98A 1BH6A 2WI8A 3DV9A 4WZBE 5D1HA 1S1CA 1EK0A 1GL3A 2A5FA 1YGYA 2NOAA 3MTBA 1U90A 1B43A 1P3Y1 3BZWA 3FGZA 5DHUA 4BATA 1UJCA 3E7FA 3RUCA 1DRUA 4GFDA 4C4AA 1WEKA 1SVLA 2K2WA 1PKXA 4K9QA 1MQSA 2NV0A 2ZVJA 4LVCA 5CFNA 4B75A 4QW9A 4YR7A 2H31A 2WQ7A 2JF0A 3E82A 3QZUA 4GLLA 2BEVB 5JAZA 1PFWA 4CMEA 5EG5A 2M6SA 3WY9A 4ZU6X 4YAJA 4JUIA 4DQLA 1EESA 1IJBA 1DKLA 2NXJA 1Q0RA 4YPOA 1DDGA 2QLNA 1DIRA 4ED7A 4UEQA 5KFVA 3DVQX 1Y9EA 4ZOAA 3HZHA 4CF6A 4ZVSA 4AYTA 1BHQ1 4HUTA 4NQZA 5CFPA 4CUJA 4MGIR 3T4UA 2IBTA 2EGUA 1TF5A 1TMOA 4F5YA 3IMFA 4L5CA 5ERYA 3FR7A 3N1UA 3U7IA 1UIRA 4C07A 5ALTA 2BHLA 4AKSA 1H0HA 5JTUA 3TO5A 1ECLA 3OP1A 4G5QA 4C43A 3P2JA 3TNLA 1PL0A 2JCSA 5LIRA 3GA7A 3K3PA 4CCYA 2R62A 3DBOB 5HE9A 5KOJA 4KTTE 4OLFA 4Y67A 3MCWA 2DF8A 2H5JA 3JQBA 3R5KA 1M6HA 2J09A 4FGKA 3P94A 2WY2D 2JFPA 2A88A 2WTAA 2IHUA 2X41A 5IWCA 1Y63A 4C7MA 5CLFA 1MJGM 2VHTA 3GDWA 1F5SA 5TEVA 2HIXA 1P5FA 2WMNB 1DAFA 1SAYA 2WZBA 2ODEA 2P41A 4QKQA 2EKDA 3PCXA 3T7TA 2BP7B 1F1JA 1NULA 3D6JA 3QVLA 4J9QA 1HV8A 3NEYA 4NBRA 5B58C 5JQGA 4QDTA 4P9NA 2R47A 3GZJA 4WKOA 1E1CA 4P3XA 1ND5A 3Q0EA 1NQWA 3BAZA 1HR0B 5ICFA 4DGSA 3SQLA 5HJ2A 4EKIA 1JSCA 1P7WA 4OP3A 2H4WA 3JPYA 4TSFD 4PNZA 1QVVA 2FUG6 5FQNA 2ZLBA 1P2DA 1YC5A 3DDHA 1VB3A 421PA 2L18A 1J5XA 2ACKA 2ZWOA 3Q2IA 1AF4A 4RAOA 4RABA 3TIIA 1S68A 3KHLA 4JITA 2P65A 1NBHA 3HCWA 4G9BA 1T3LA 3ASVA 2CCGA 3B78A 2VPXA 1GL7A 3KU4A 3RSHA 3VZDA 2VN8A 3BJZA 1H8ED 1UP4A 3FDJA 3KYCA 3P2MA 4GMDA 4GPD1 4XSVA 3I3SR 4DBLE 4LUCA 1YL7A 5LQSA 1JFSA 3H6HA 4KDFA 5INTA 3U37A 1IJEA 4H7KA 2XB9A 2WKSA 3I2HA 3O4HA 2C04A 3SHQA 4YRIA 1F6DA 2P0YA 5IC4A 2XADA 3LBHA 3K7EA 4R7RA 3KOXA 1Y3AA 5G0UA 3B48A 3M82A 4Y6RA 5TJ9A 4WFIA 1ZZGA 3W77A 5J47A 3ZJ4A 1E2IA 4UMFA 4XLTA 2NSLA 3BICA 3HGMA 4OD0A 1K3FA 5CCXA 3GH3A 2DLNA 3DUWA 2W9CA 1SWVA 5BR8H 2VF4X 3IPCA 4JVSB 1G0NA 1GFWA 1NXPA 2CB9A 3PDHA 3QKWA 2MSLA 2VRNA 2WIJA 1YCFA 2Q8QA 4GYWA 4CT5A 5I5VA 1CKOA 3THWA 1L4MA 4R9NA 3IX7A 4GWLA 1JEAA 2E4ZA 4RKRA 2BCJQ 4GEKA 4DJAA 3T3IA 4EGJA 3EGCA 4MJ3A 5EZYF 2RGGA 4MTDA 3RVOA 2JAQA 3PYLA 4EGAA 1TEVA 2YOFA 3I4LA 3TMAA 4WCDA 4YMGA 2UXCB 5LQJA 1ZISA 2GR9A 4F91B 2EX0A 4FS2A 1FPMA 3QU7A 4D3ZA 3KETA 3TQSA 2O8BB 3AJEA 2R7MA 4D82A 3PGVA 1KQGA 2HB6A 4R2KA 4WKGA 3L4BA 5HKKA 1IQRA 1OXXK 2NTNA 3HYTA 3T54A 4KZPA 2ZG6A 3H9BA 4YP3A 1DBVO 1B6TA 1OIVA 2CXNA 1GCGA 3S6JA 3HCPA 1ZHOA 3ACDA 1QNLA 2F4NA 4V24A 1PS9A 2XZOA 1PR0A 1E6UA 2J6CA 3IHKA 1QIHA 3K9NA 3QTBA 5GWXA 5KI6A 4HDCA 3RWOA 2BFNA 2IPNA 3SFZA 4D4HA 1SFRA 1O3YA 3HFJA 4UTZA 2AD5A 4B31A 1CNFA 5HQ3A 4L9WA 1VE3A 2H51A 3B6EA 3AR6A 3OZEA 4QPDA 3VHQA 3CEJA 4RSHA 4YRRA 3PLAE 1T3HA 1JTEA 4D6XA 3BXEA 4L7QA 1VE5A 2GBFA 1XC7A 2OCYC 1XAHA 1JPJA 2POQX 1R3UA 4LY6A 1AN0A 1IDN1 1R64A 2F2TA 4JIMA 3FRHA 4CFZA 4J49A 3EEYA 2OO5C 4FINA 2QRPA 4HMPA 3R7SA 5JDIA 2DFVA 1RE0A 4ZHQB 1XQ1A 2GTIA 3GGPA 2DLDA 2X9LA 4FDTA 4MR9B 4H7FA 5B3JA 5HBRB 1JGTA 1TO1E 1YDGA 3QWHA 4HH1A 1AMNA 3COZA 3M4JA 1ZH0A 2PA3A 1ONOA 5IKOA 2Y0SA 3I8OA 3IP6A 1BX1A 1CULC 4ER6A 1NAIA 4UVGA 2H63A 4YWJA 1FU7A 4TUYB 1EQ2A 2IA6A 4RTNA 1ZR4A 3JWGA 1XK5A 1LFDB 1ZM4A 5B7NA 4G84A 1OX5A 4LISA 2C2OA 1E2FA 3RHSA 1LRKA 2XRZA 2CLIB 4C3ZA 5AOBA 2BM1A 3NTRA 4U5XA 3ZDZB 4A92A 5BSKA 3DKRA 5FHQA 3FKIA 4KHPH 1J2JA 2GCPA 1MB2A 1J8YF 3ER8A 1PLKA 5JCOC 4RVOA 2BBWA 4MI6A 1EZ1A 2PX0A 2XUHA 1D8AA 3K0FB 4ZO6A 4J0QA 3NHFA 5JLAA 3OE1A 2I3GA 3MLAA 5ICEA 1SB9A 3I61A 2J9ZB 2HSGA 3ML1A 1QHFA 5CEFA 1XTVA 2OCXA 4JBWA 1R6DA 3QKSA 3QX9A 3LK6A 1T2FA 4N48A 1FUIA 1U2RA 2O2ZA 3ZW8A 1IXRC 4KH1A 1Q0SA 1N56A 1DZ3A 1VP3A 3I8SA 2GUWA 1TWGA 1BU5A 1XRJA 3GUHA 3HWX1 1OA1A 1MJ5A 2CLHB 4MWDA 4U8GA 4JV5H 3KHRA 1DL5A 1FQJA 3AZOA 4US1R 3O1LA 3ZXUB 1JSRA 5GP1A 2H7CA 2PQ0A 4U9UA 1Q7RA 2BISA 2AMYA 4UM7A 4XWYA 1BFKA 4CU5A 4WNCA 1KYIA 3ZHQA 4GH5A 2BF4A 5FR9A 3IQFA 2R8EA 5E95A 2CEKA 2XCRB 2X8BA 2B21A 3O4FA 3REFA 4JJ7A 4DIOA 4E5KA 2ZJYA 1NG9A 3G88A 3WWCA 3GLIB 2X5RA 4ZPJA 1GPJA 5EOVA 4DUZB 4EAAA 1SQGA 3LDGA 2PXHA 4HS4A 1LTKA 1NJ8A 3I34X 4N49A 1XFAA 1JDJA 4KUHA 3Q9NA 4KXYA 4D3FA 3V8QA 2GA9A 1E4GT 3BZUA 4KI7A 5C46F 2RGVA 3TSOA 4LGCA 2ZU0C 7REQA 4A2BA 1P62B 3K3VA 3V8EA 1GA6A 1Q77A 4WLNA 4M1WA 1PSZA 3OX2A 2IYEA 2FA9A 3BK1A 3UWKA 3O8CA 1KMMA 3HMQA 4QGFA 2RE8A 3KTAB 2FW9A 5JU6A 2BDUA 1ZK3A 4ZU3A 4I7EA 4HDMA 4B45A 1N36B 3U60B 2GAAA 5EPUA 3EAQA 1E1LA 1XVIA 2X4LA 2BBOA 2AOVA 3P19A 4HL6A 3LPMA 3W3AH 2XVYA 2GM4A 4DKXA 1TECE 3GN2A 4FFBB 4JV5B 2Q0QA 4RZHA 4YUVA 1JHMA 3NJRA 4PPGA 1TM4E 1YZVA 4UNPA 4GE3A 4WL0A 4DDHA 2XCSB 4CM4A 2GN1A 2VZ0A 2P6NA 2XUIA 1S0UA 1SC4A 5EHGA 2BM0A 4EL0A 3JAMA 3L2PA 1DLIA 1O0BA 2PXCA 4K6HA 1C0IA 3FPSA 1BS9A 4X1YB 1VECA 4Y2PA 1ZJJA 4JX9A 2WB4A 4HRXA 1RYHA 2ZYGA 4B79A 3PGA1 2YHIB 4B3TH 4UXHA 4E46A 3HXLA 2G40A 2AI3A 4OJTA 1WTCA 2ZBFA 4M9ZA 4Y2SA 1M7GA 5AESA 1H2ZA 1UXIA 4V03A 1AQUA 3TMKA 2NU9B 3TAUA 3W90A 4TKVB 2RBGA 4G1VA 1W35A 2ESRA 2A9VA 3AG5A 4Q1AA 4LVUA 2PK3A 1RC8A 3WB2A 3N2GB 1FXUA 2BEKA 4ZCIA 5AQEA 3K6JA 2ONYA 4Y6LA 5K3AA 4PG8A 4KUGA 4BNTA 5B53A 1BNCA 3CUVA 2NV2B 3PWZA 1D3AA 1SVKA 1IATA 4LF9H 2EU8A 5KTYA 2VDQB 2GEDA 1OYYA 4MVJD 5DSXA 2Z02A 2EJVA 1GGEA 3BA6A 4RVUA 3STWA 2GM3A 3JV7A 2DY0A 4O7LA 3OOYA 1G55A 1DX6A 3K9WA 3AUKA 3OEHD 3KDAA 4K3VA 2ZDQA 1QLJA 4RY9A 4RY8A 2B61A 1P33A 3G79A 4D2IA 2Z6UA 4RZQA 3VOAA 1GZDA 5DMHA 3HO6A 4M9SA 3C3BA 1YI8A 4M0DA 1S4QA 1N4AA 3UJDA 2ZGVA 1ZETA 3QMWA 2RAVA 4O7TA 2XKJE 4Y9UA 4A6XA 4YV1A 1JMKC 4AD8A 3CVZA 2HHAA 5AVQA 1M0SA 1GPWB 1X7HA 3FJOA 3G2OA 3I2JA 4YREA 3G59A 4YB8A 2V6IA 1UBEA 3VO9A 5ABPA 5IZCC 1RYEA 2JFOA 2WPNA 4BASA 1M1UA 1BX3A 1N0VC 5C5CA 4W5HA 3JATA 1V45E 3BCUA 1KFEB 3UWPA 2EBUA 3LQ2A 3AUAA 3AUXA 3DDWA 2ZSHA 3ESBA 4ZQEA 1VE1A 5KKAA 5IDQA 1I6UA 1GTRA 4EB3A 3W1GA 1E92A 4BO7A 1TK3A 5CA0A 1E4YA 4BNDA 1A5AB 4L72A 4NBSA 4BNHA 1F6BA 3VPFA 1I1QB 3MA0A 3LI2A 3VBEA 3RAFC 2ORYA 1BXZA 4DR2H 2VP0A 3OCYA 1W5BA 4WESB 5B64A 4J07A 1JHOA 3ME5A 5K01A 1XZ8A 1EVQA 1HC7A 4FMDF 4IINA 2O59A 2W7OA 3TNFA 5BUSA 4X6YA 2B4TO 3PNVA 5FR2A 2REOA 2VDMB 4AP9A 3CVXA 4H08A 2WSYB 1GQQA 1KI1A 3M5WA 4QQKA 4DDVA 1JA1A 2Q4BA 5DHRA 1HZZC 1C3XA 4IV8A 3KKLA 4MVJM 3I45A 3HU1A 1FC0A 4X64H 3P9CA 4S0XA 1WY5A 3PI6A 3D31A 4TUYF 4UQOA 2VQSA 5EXEA 5IVHA 5M34A 5KUTA 4KN9S 4JC8A 3SYMA 4F6LA 2X14A 1M8JA 3AYXB 4QU9A 4X97A 3WLTA 3QEKA 4A23A 3RB4A 3WGIA 2GZMA 3EZ7A 4NZZA 4ZOLF 4HQRA 3UT5A 3P2YA 2YUIA 4GMXA 1CY7A 5FWDA 3DZ8A 4P8RA 2Q5CA 2XQGA 2I6GA 3NATA 3WNQA 3PDWA 3JQAB 1ISMA 4Z2YA 1SBCA 2XAAA 3PEVA 4DG8A 3S81A 3OQIA 2HMAA 4BZZA 1HZZA 1MAUA 3HADA 2QNIA 4BRWA 3LFTA 5FOXA 1H2AS 3IBCA 2KQUA 3SEZA 1NFRA 5KQSA 2JHFA 1QR2A 3BH6A 1A9OA 4CETA 5L6LB 4WXEA 1ZP6A 2D4HA 4LJ7A 4ZXFA 5ADHA 4Y2GA 1SCBA 1E1YA 3N2GA 3RB0A 2J6BA 4DV2H 2Q2TA 2D8MA 3D7MA 3U0BA 2F43B 1GTMA 2GLUA 3MN1A 3N28A 3GIQA 3OO1A 2YZLA 4H35A 5ETJA 4DRXA 4LSAA 4QTTB 1LD3A 4ZVTA 1PJ4A 3IR7A 4DTCA 1G19A 5AVSA 4WZAA 4J3NA 3B5EA 3WWJA 1FSFA 2FPSA 2VNIA 1CJBA 3ELBA 4D74A 3OU2A 3GDOA 3UJNA 5BRNA 1SULA 2VZ8A 3HUDA 3U40A 2IXDA 1L3IA 1J70A 1JZTA 2JA5G 1DKUA 1NBEA 2HMUA 2VHJA 1X7ZA 1RNLA 4RSRA 4UCXA 3GIKA 2PKXA 3D81A 2JJ1A 3CLUD 3A6FA 3KOMA 4XR9A 1RJGA 3H5AA 1G2PA 2FN8A 5L1IA 5JVDB 2DFTA 4PZ8A 4RE6A 5B7GA 4GOJA 3LX4A 4UTPA 5JAQA 1V39A 4NQRA 5JZ9A 2R8RA 4W63A 1CUDA 3HJHA 4TM7A 3C3YA 1Q84A 4I1OA 3JSAA 2O8DB 4G25A 3SCZA 1A9ZA 1J0XO 1PT7A 4KO2S 3T7JA 4R8UB 1IQPA 4OB8A 2R6CA 4N8SA 2V4ZA 4CLOA 3LL7A 5GONF 1VBNA 1JLHA 3EXG2 5AD1A 4IY1A 4DUGD 2QRVA 4HX9A 4I1YA 5EJ6A 4BVEA 1JXQA 2RHOA 2GAIA 4NBWA 4CE5A 3F7NA 4WUTA 3ZV4A 3ZGZA 2Q5JA 4G0MA 4RQUA 2CNLA 3GLVA 1XLVA 3L82B 3R1IA 2G9ZA 2QXTA 4JUCA 3K8YA 1L1FA 1XL0A 3N2KA 4OFBA 2OMKA 3RHZA 5KFCA 1VKNA 1KJJA 1PFUA 3U81A 1XD8A 3PUVA 4M0FA 1K5PA 3T5MA 1RYFA 3LBNA 1R7RA 2CVQA 4GSLA 4M3NA 3U54A 1QMGA 2MSEB 3R4CA 2P3OA 4GLWA 2W93A 2CMFA 1OFIA 1HDYA 1BO6A 1YT5A 2HGSA 4UDNA 1NVVQ 2R6HA 3S5JA 5BQFA 1YKSA 2G72A 4RXMA 1V35A 1CHDA 3EPLA 1E9BA 2HH9A 3QJYA 2CL0X 2E55A 1JHDA 3ZH9B 1IDOA 1Y33E 4Z9AA 1HDEA 1N34H 2EL9A 4M7WA 5FT9A 1DRKA 4OV6B 4JGGA 5KTNA 2ZBEA 3PVCA 5KQMA 4YIHA 4XJTA 3VR2D 4J9RA 4X41A 4DBLC 1AQNA 2IVZA 4ED6A 2OGZA 3KV3O 3IHTA 2Q3FA 4WQMA 3RS0A 3V5NA 4WHMA 1N7HA 1ND6A 4PAGA 2QZZA 3RREA 1KI4A 5L1JA 3H2IA 1M1NA 2B8NA 2X8WA 3FM9A 2AI2A 2GCIA 4ZCTA 1GITA 4G0YA 4RD6A 1XCJA 5FPYA 3GROA 2GJKA 5I7RA 1L1RA 5AM2A 1TYAE 4DQNA 2P9YA 3RJMA 5CR5A 5A62A 5FJIA 4CIYA 2HU8A 3AL2A 3VTKA 4E2XA 1U99A 2DOKA 2XYHA 4I99A 4IH9A 1RAHA 3RVBA 3TTYA 5LJIA 4H59A 3BWBA 1LC3A 1RYRA 4MVJH 1DIKA 2V7QA 3JD2A 3ZHYA 4MV1A 4ME6A 3EQ9A 2BE9A 1FFWA 3IURA 3PHCA 4M6WB 4UZSA 5E2IA 4JI4H 2JBAB 2QJRA 3EZ6A 3PL5A 4KQJA 3ADCA 1TJYA 4UJ5A 3NGXA 3VC1A 2WM9B 4J29A 3RFVA 4TKVA 5M7EA 1LDGA 4Z8XA 4RJJA 4GZ3A 4PGAA 4FCTA 5HX7A 4LE1A 1CU1A 2ZR9A 2AJDA 2GNPA 4P86A 4DMLA 5KJ6A 2HJ9A 2HHCA 1D0SA 1H9AA 1PJRA 3TLMA 2IYAA 5JS7A 5B6JA 5EHXA 3AI3A 4ND5A 4WFJA 3KG2A 4YAJB 4BFLA 4JWKA 1G8SA 1MA0A 1OWNA 1Q0HA 3GG2A 3Q1LA 3NI2A 1VA4A 5TR9A 3JCZA 3M6MD 4N6OA 3EIFA 2A9QA 5I45A 1KOLA 1E2DA 3P0EA 4JJGA 3O1HB 3UFBA 1N8SA 3HZZA 1U4NA 3N6RA 3RVQA 2CCJA 3IILA 3PDUA 1D2MA 3I64A 2Y1XA 1Y1LA 2JLAA 3OTWA 1JILA 4CFYA 3BMXA 1PL8A 4A0HA 4MCIA 3MELA 5DM2A 2Q5QA 4J0FA 2NAFA 1H8HA 2YHBA 4YUXA 1I0LA 3RVKA 2BDTA 1CHNA 1QH0A 2NGRA 5L3ZA 3WICA 4AN1A 2HSEA 5LWHA 3RRXA 5M2QA 2D62A 1D09A 5DTIA 1TI7A 2P78A 1LDBA 2WNSA 1UOQA 1SVWA 3V6JA 1EJ6A 1RBQA 3QPUA 4IM7A 4JZKA 2UXBB 1X13A 4TT3D 2ZYUX 5FUVA 3OLQA 4JP8A 3RUEA 1EBBA 3WKDA 4BNNA 2CNWD 4REOA 1ZNXA 1SXGA 1Q22A 3W5DA 3QI7A 1J8QA 2GZRA 5FOUA 2PWYA 4DMUB 1T1GA 4PLHA 1XALA 4IIHA 3KQTA 3MCAA 1WD5A 1E2HA 4GBGA 4EUNA 2ZKLA 3L1JA 3RT7A 3GEPA 4H1TA 2YU9A 1DC7A 1F2TB 2BELA 3GBVA 3C43A 5HF8A 2H57A 4RLQA 2OHIA 1XTUA 1P1CA 3PFGA 4MV9A 1TDJA 1EX9A 2D4AA 2I29A 3FUUA 3N2NA 4ZC8A 3TAXA 6YASA 3QY9A 1M8FA 1C0EA 5D7NA 3K92A 1LS6A 1UDCA 2MTBA 3ILXA 4UEKA 4FUTA 1M2HA 1QYRA 3WB1A 3RU3A 5CDGA 4ZTUB 3T1HH 5IH3A 4AY4A 1NU6A 1Z36A 3RVRA 1E1MA 1DS6A 2JW5A 3NLLA 3W9SA 1BXKA 2HDNB 2XYQA 3PGXA 2FLLA 2QM8A 2I2DA 3INYA 4Q15A 4YTEA 2F8SA 1HSZA 3A4TA 4EB8A 1B8OA 1VIYA 4JCCA 1I1LA 3OFJA 4D3SA 3FPFA 3NEAA 3P32A 1SBZA 1FNSA 4O83A 1DGQA 4C5BA 3LKZA 3MUFA 5SZIA 5IAOA 5DNVA 4YUAA 3GZNA 2HMSA 5ED4A 2B4KA 4F4HA 3VU1A 5CH5A 2BSAA 4LKRA 1IVSA 2HZ7A 1ZH6A 1NE2A 4JP2A 4BAGA 2X8JA 5JJLA 1P31A 2PO5A 3QU9A 3CVWA 1Q0PA 1VYHA 3QXGA 4NICA 4DM3A 5AVRA 2YZNA 2OKGA 3B6IA 5DMXA 1T9DA 1O4VA 1A48A 1ZN8A 4RCYA 3ZX5A 3LY8A 3JPWA 4B5LA 4EHAA 3FOAA 2GBCA 4DL4A 3BGWA 1KK3A 3KLOA 5EJ5A 1QU3A 2G7ZA 3NGLA 3BE5A 1QGOA 2CYCA 3PCTA 3ABZA 2DEUA 1U3TA 3L6OO 4FHCA 3CZRA 4PGMA 4B2IA 3LP8A 2ZBRA 4XJSA 5B7QA 2D06A 1LQ2A 2AEJA 1OW3B 5BT8A 3DOFA 5TNXA 2I4IA 5CDHA 5JIBA 3DE4X 2VP4A 3SR4A 3EGOA 1UJMA 1Q1AA 2RK4A 4D1YA 1Y82A 3NKLA 1HNXB 1QFJA 3II6X 4ECUA 1H42A 3WGUA 2XE7A 5B30A 1OB5A 2ZSUA 3CRNA 3KQPA 5FI5A 2JHGA 4WA8A 4EJ0A 5BN3A 1AXRA 2ATVA 2QX4A 2ZBDA 5JUMA 3KZCA 3PQCA 4L08A 4H6XA 1M0WA 3AF6A 1P1RA 4HRAA 1TD1A 3COPA 2B2XA 3WK6A 1FY2A 3NQ41 1GTG1 2OILA 4EATA 1H0SA 4JQSA 5DW3A 1KYTA 2I3AA 1XNJA 2PSFA 2ZTLA 3LHSA 4C30A 3WE7A 3HDVA 3PV0A 3W8NA 4MQEB 1MB0A 3OJWA 1IEQA 2XCOA 3LBIA 3REGA 1JI3A 2PBZA 1YJXA 1A9XB 1L6IA 4K0KH 1C4XA 1K63A 2GS9A 1C7RA 2WU0A 2YYSA 1ENYA 4HN2A 2AEFA 3AEQA 2R11A 1BVUA 3KRTA 1OHHD 1JKJB 4QBIA 3V2GA 5JNSA 1NW6A 5TPWA 2IZ1A 2NZVG 1NMEA 4LWOA 3CX3A 3J80A 4UDYX 2DFLA 3ULKA 4TYNA 3BSYA 2H1HA 1YVDA 2JARA 1U0EA 5A2GA 4TRNA 5I7SA 4XLLA 2JGDA 1W8DA 5KFTA 1K1EA 1ORTA 2WTXA 3SJUA 5JBNA 4MB0A 5DP2A 3FKSD 2XF2A 4EL5A 3MS4A 1ET0A 1RD4A 3NT4A 3MJTA 1IM2A 3S27A 4DILA 1XD2B 2OE2A 1YJQA 3P0HA 3JALB 4AURA 1L7AA 4CKWA 1Z7WA 1NBME 3BMNB 5B12A 1V37A 1JQJC 3TCXB 1DADA 4DV6B 2ZB7A 4EMTA 3DDNA 4FS8A 5HILA 1N9ZA 5C44G 3WYCA 5K0CA 5GGXA 1OBCA 3PL1A 1UBOS 2WAXA 5J5AA 5EXTA 1KK1A 3KXLA 5BYJA 3WDMA 4ZYLA 3EA5A 1CS0A 4J4HA 4I1PA 4Q0YA 2FQWA 2HSWA 2ZZNA 2ZRCA 5C8VA 3GJQA 1ECFA 3GFOA 5IZCA 1EXDA 1MJGA 3VU3A 1CR2A 1UQTA 3EQ6A 4INOA 4C08A 3F5FA 3FYTA 5DYGA 1JHVA 2IY9A 2NXCA 4MGEA 3THXA 1UPCA 3EDQA 3RF6A 5K4GA 2HI0A 3RGZA 5E4FA 4JP1A 4S1VA 4HLUC 3L6EA 5DYWA 3PFKA 2WF5A 4LDAA 5DLQC 3DR5A 4BJHB 3GHHA 1I9CA 3GTLA 1FQWA 1Z4NA 3REQA 1B0ZA 1DAIA 2HLDA 3AXSA 3GX1A 3Q6MA 4B4UA 3AVTA 2FPLA 4B3SH 4DB4A 2H3EA 4R1SA 2JI9A 3ETGA 5EVCA 4IS3A 1T8TA 3BBPA 5JNVA 3AC0A 4HB3A 1I50A 4BEBA 4IUDS 2NO9A 2XGMA 4UD6A 1PF7E 2O6HA 2UYQA 1HSOA 3A04A 4EVRA 3UB2A 1PEDA 3A3KA 1A72A 1DBIA 3UAXA 5LQCA 2D7DA 2C2ZA 2AIRA 2AQIA 4BXOB 1J90A 4JVNA 4B3SB 5D00A 2FUKA 4BXXG 1AK1A 2DPXA 3WVNA 4BUCA 2VC2B 1J4AA 3RBEA 2HK6A 1UOPA 2JHAA 2XNHA 1YB6A 3GJ6A 3MIIA 3R5SA 4P22A 4YJ2B 2NLOA 3LF2A 4IDQA 4XJVA 3GJ3A 4A2WA 4P83A 5FBHA 4CHGA 3KCNA 2JFHA 4MW2A 5F98A 4DLAA 2Q3CA 1WVGA 2WP8J 2V5UA 3FHOA 4YDSA 2A0YA 2FPWA 4NIMA 4TMWA 5DASA 4MYHA 3MERA 1JZQA 4KYVA 5HCIA 3GLGB 1OH7A 2BFCB 4D9KA 1JWAB 1BQEA 2HXGA 2I1WA 1C50A 1QCCA 3F6YA 4ID9A 4IGKA 4UUQA 3ZD8A 1BX0A 2BF7A 2PZKA 5ALWA 5KIAA 1CRQA 2NW6A 1GKUB 2D5BA 4MR7A 1TJ3A 3WGGA 4D0GA 1V47A 4JQZA 4Q3BA 3W4KA 3EC2A 1B8VA 4IGIA 1PGOA 1MVNA 4IJUA 2RHMA 3WGLA 4HG2A 4I81A 4W8HA 2I34A 1OBVA 1SZJG 3RAJA 3CXRA 2C4KA 4O81A 3GCDA 3O83A 1C1XA 3PKZA 5EXSA 3L7JA 1JHPA 2D2XA 1ZOIA 2WQZA 4FD2A 4U2BA 3OSPA 2HFJA 2Z98A 5KYYB 1U1CA 1VBFA 2PMDA 2BL4A 2HQBA 2QV7A 3LK7A 3CPHA 4CTMA 3HS3A 5IKEA 1R6BX 3WXMA 2XSZA 2Q29A 3TW4A 5JRDS 4HAVA 2WFLA 3NJ8A 1QHHA 4QDZA 3EB9A 3G0BA 1Z34A 2PWPA 4FYWA 1XIVA 2H0QA 3W4JA 1NXQA 4Y0NA 1FFCA 4DLLA 3JVEA 2ECKA 1XBTA 2QAGA 3QX8A 4D5EA 1Q16A 1XDDA 3MHTA 2QTBA 4FCWA 5JHGB 1LBTA 2EEPA 3DTVA 1PT8A 2BEWA 3PNBA 2O05A 4MZXA 1YZ3A 5H16A 4KV7A 3RRBA 1TQ2A 2PUJA 2W2XA 4P3OA 2XIGA 3IFSA 4RQAA 1S9FA 1UBCA 2R2AA 3PNPA 4NWIA 2PBLA 3HZRA 3JQBC 4FEAA 4EG6A 1MFPA 2LWIA 1OFHA 2P4UA 4TQAA 2HMTA 3WGOA 2FRVA 4P4GA 1NMXA 2VRCD 3CTMA 3IQHX 5A0TA 4ED0A 1RM5A 3DWGA 3WLMA 4GVXA 2ZRAA 3ZDAA 5AK6A 2AF3C 5J2UA 5DCLA 1CG6A 1CJCA 4PR3A 4ND2A 1ECCA 4F3YA 2KI5A 4Q9DA 1SZCA 3UHAA 1M1NB 1YJAA 2O2EA 1RVDA 1FVFA 1DELA 1RWBA 2NSDA 2VK4A 3H2BA 3IQXA 3JRXA 1Z88A 2C8LA 4BX0A 4CTOA 3VYSB 3G2JA 4J0KA 1G2OA 3R7WA 2VJAA 1ZL2A 4L16A 4YMUA 1X87A 2C54A 2FWMX 2YN0A 3TUJC 1ACLA 5JYBA 3R0QA 1QIJA 3BMOA 2GXQA 2OXRA 4RV4A 2I91A 4L8VA 2W6IA 4UCOA 1Z4OA 1UL1X 2AFHA 1E89A 4HZUA 1J5PA 3Q0TA 5HIIA 1K86A 5DK6A 1JYFA 1G5FA 1SZPA 4E2WA 4PY2A 4OHCA 4WIAA 3WBJA 4YYZA 5T3YA 1UWKA 2D1TA 4KJZA 3QFSA 2Q7OE 2G71A 4OHVA 1BWQA 3LG2A 1W36B 2DM6A 1QIGA 3ZC3A 2H54A 2I4OA 5FAKA 3VISA 3ORSA 4QQRA 4X6LA 1CJKC 3PA6A 1ZOLA 3R76A 4ZEWA 4YJGA 3UOGA 4BNKA 1M6WA 1JKMA 4DTIA 1BZYA 4C5CA 4H3SA 4ZJYA 4HADA 1CQJB 3G7NA 4DUPA 3B8EA 3L7IA 3ETDA 4FKBA 2A1TS 4A8PA 3NC1C 3FOWA 1VLVA 4L9AA 5GJCA 2VZ9A 2CD7A 2P2ZA 3D4PA 4HUQA 3H5OA 5EY5B 3C7TA 4EVSA 1QGAA 2WAMA 2JGNA 1WABA 2QTAA 4CM6A 1XMVA 3BD7A 1N3IA 1YI0A 1SM4A 5HJ5A 4EFEA 4BCDA 5I9IA 2LNDA 2CNKA 3I1JA 4QBTA 5JCZA 2C2KA 2C4WA 4TX1A 5BV2P 1JBEA 2ID4A 3G5LA 3M1LA 3SQDA 4ER7A 1UAGA 2JDIA 1JDEA 1RI4A 4L76A 3LULA 3ZI0A 1KS2A 1PVDA 2HQSA 3NHSA 4W5WA 3OZRA 5AK3A 4UQPA 5G3YA 2M05A 1WW3A 5C8ZA 3LH5A 4GXRA 2PD3A 3DO6A 1N5RA 3DVAB 1DXHA 3RABA 3K9FC 3H84A 3LUAA 4LRXA 3IPRA 3B3GA 4DT1A 4P7KA 5DKFA 1I4LD 13PKA 3L7DA 2YWVA 1QGYA 2FZ5A 5IHXA 1MN6A 2H4YA 4UBLA 3WISA 1LPBB 1EH5A 4J7XA 4YJHB 5I7AA 3HJGA 4BKOA 3HLYA 1I9GA 1D6NA 4F71A 4IRXA 4DMGA 1Q83A 1FFGA 4HTFB 3BM5A 3FTNA 1STOA 4RTMA 5JANA 2OAEA 2EFHB 2VQDA 1G0OA 1SQSA 1RABA 1UK6A 3R5FA 1KDRA 1TT5A 2JH8A 1XRLA 1CF9A 1TRHA 4L4YA 2EIXA 4MKHA 3TE7A 4LFBH 4FPXA 4JYMA 4C4RA 2ZZMA 2OBYA 4NU5A 1FUKA 3DYVA 3T7RA 3P27A 1D1SA 5DFAA 3R0XA 1ADJA 2R4TA 4CV0A 2WLSA 4KWTA 1ATZA 1IEVA 1DEXA 2XW6A 3AU9A 2XOEA 3BIXA 3OTQA 4BVBA 4LF9B 3KFVA 1EA5A 1X74A 1K66A 5BQXA 5FQOA 2O2GA 4WSOA 2EKBA 2X1VA 3OSZA 4JXZA 4QXOA 3OVMA 2ATLA 2PGJA 1QKIA 5C1IA 5KFSA 1KU0A 1B1CA 2XWPA 5I7HA 5L45A 1ZJWA 3E7PA 4MW7A 4PSVA 3VNUA 1Y6JA 3R8CA 4UTRA 2QD1A 5M29A 1LU9A 1ZVJA 4DSAA 4E94A 2GPJA 5EAIA 1ZSYA 1H2RS 4M9RA 4XD7D 4IOKA 3ROTA 3L0YA 3CR8A 4NESA 1RK6A 1E69A 1WP4A 4B33A 5HFNA 3MJEA 1PQUA 1SH7A 3H8VA 4DQUA 4F6RA 2R8IA 1QIEA 4YJ3F 2VYNA 1E9DA 3IUNA 4S1WA 4P0QB 3OCWA 1X1CA 5SYMA 1JDBC 4OJQA 1WU8A 5CVVA 4DHWA 4E7PA 3GILA 1Y37A 3H18A 3L0PA 2XWBF 4R40A 8AT1A 4DR5B 3N7UA 1V5EA 4TV8A 2G25A 4RUCA 3R6TA 3G13A 4GNKA 5IK2A 4DADA 1K75A 4WK2B 3SGLA 4Q01A 2V6MA 3J80W 5F2NA 1A76A 1UANA 4M7RA 2JHCA 4N7RA 4URHA 4YP1A 4DREA 1GTJ1 1TA8A 1DRJA 3D0KA 2VQFH 2C7PA 4B2PA 1HE4A 1U7UA 2HA4A 2VRCA 4KI0A 3ZK8A 2W71A 2XMSA 2IP1A 3ZS8A 5AW0A 2JJYA 3RHTA 4DM7A 4K9LA 1A8PA 4LDRA 1FYXA 2LR0A 2VYFA 4ZODA 1OAAA 1W581 4WAUA 1YR9A 2AJCA 2V7TA 4B3MH 1P45A 4URFA 2J32A 4KAJA 4I8DA 1YQXA 3IP8A 3SXJA 1IXKA 4D79A 4ENWA 1H05A 3NTUA 4Y9DA 1MQAA 3RFXA 3C85A 3L8MA 1XZLA 4P98A 4K28A 3WRXA 4GRAA 1WDKA 1YS4A 4YAKB 5CYOA 5HG0A 4J0CA 2QL7A 3NXKA 1HURA 2J3JA 2CJXA 1IBMH 1XDBA 1D2CA 3L43A 4X8HA 2R8KA 1FZQA 3NNDA 3ANYB 5IAGA 2QBYA 3P9NA 4IH4A 2GRJA 1CX9B 3QQ5A 3CLRD 4O1MA 1ZOSA 5K0NA 5K51A 5JR3A 1R5OA 2GOYA 2JI7A 3CW2A 3WG9A 4GM0A 1MDBA 1IMJA 1NXWA 1WCYA 3LVBA 3WLLA 4CDGA 4FBTA 3GLIE 4HDNA 1R15A 2P2GA 4ZO4A 4BVAA 5A3RA 3GUUA 3N70A 3BA9A 4BV8A 3U9SA 1UDWA 1P9OA 1WPGA 5IS2A 1SYXB 2GN2A 1MO3A 2WWXA 3HGQA 4LC0A 3E1SA 2QMQA 4JL6A 1G20A 3H8WA 4CUZA 3ZE2B 4ER0A 1XPRA 3G9QA 1J49A 1TQHA 3EVDA 1FP7A 3H11A 3R6DA 2OQIA 4I6GA 5AH0A 4EJMA 2GJAA 5HK8A 3E3MA 1TMYA 4UDXX 5KG3A 4EJ6A 2WAQA 1BTOA 3HMKA 4LBYA 1MHPA 2OFXA 2FOLA 2WM2A 1GNLA 1KPGA 2GAFA 4JXJA 3SYTA 2Z1DA 5LD2C 1J2UA 2EP8A 5EFZA 2FMTA 5ALMA 4II2A 5ESDA 4JAVC 3BE8A 1GXSA 2EARA 2I4MA 2H2GA 3FCEA 3HCNA 2HEIA 2O4CA 3M6IA 3DBLB 4LJLA 1CY8A 1DBPA 1ZBQA 1CP3A 2A2ZA 4N03A 2FEPA 2H52A 1G4UR 4XCQA 3L7LA 2IEZA 3AESA 3BQNB 1AV6A 4P3NA 4DLWA 3AL3A 3DHEA 3FLBA 4I3HA 2C35B 1FE8A 1YULA 2PQ6A 1WW2A 3JQAD 5AHOA 3UKOA 2Q5OA 5GZ6A 1P1JA 1G42A 2BKXA 3FR8A 2JJQA 2K4MA 1YV9A 1ZAKA 2HWKA 1R9NA 1M83A 4J0IA 3GQBB 4R54A 2TMDA 5BNFA 3SK0A 3ETNA 1KYZA 1GZVA 3I6ZA 3RROA 1PL7A 2EQBA 4CQLB 4JR0A 1YHYA 4O84A 4NX2A 5EWLB 1NYRA 1WE2A 1KHTA 1NOKA 2VHCA 4RB1A 1MO5A 4MV4A 1P7PA 5G40A 4C2AA 4D5GA 2O14A 2FSFA 2YWXA 5FIUA 3B9QA 3RIMA 5GV7A 2FSVC 3ZE9A 5CBPA 2EFEB 4PFKA 1YK1A 3C6BA 4HGRA 3HJBA 2OEPA 4BY7G 1NDHA 4RD2A 1O0CA 3LCMA 4B9AA 5BN5A 3M9XA 2QA5A 1D9XA 1X80B 5CURA 3C98A 1UP7A 4DWWA 4HP8A 1TLFA 2FU5C 3E5MA 4AIIA 3ZDBA 4BWFB 4DR4B 3KBBA 1FUYB 5KVVA 1SOVA 1DTWB 3OIDA 5JVLA 3PJGA 2O8EB 4C88A 1Z6GA 2Z2YA 3R4VA 4FBLA 1UDAA 2B30A 4DL9A 3V4LA 3BFPA 3ZHTA 3GMDA 2NYAA 2HWWA 1WB4A 3PE3A 3RD5A 4L85A 2UUCB 5BW6B 1BS2A 4OL9A 5CVTA 3QPWA 4K03A 4K6FA 2IZZA 5SV2A 5AIBA 2W6ZA 1JLLA 1U9YA 1T8UA 4DV3H 2H4XA 3CVOA 1RWOA 3PC6A 4JA0A 4JHLA 2W2LD 4YFVA 2LUOA 3VJKA 1E3DA 1Y5MA 2OV8A 3IVCA 5J5VA 2CXSA 5LKAA 3HOXG 5HRUA 3DOJA 4L8YA 1CNMA 4ES6A 4L28A 6CHYA 3BCHA 4QWDA 3V6MA 3BEOA 4OQNA 1XCOA 2NV6A 1LBSA 4E03A 2R7KA 4WBSA 5F21A 6GPBA 3LV8A 3CLVA 3CVJA 1V95A 3JQFC 2A3NA 1AKQA 2NO6A 3IT1A 2J3MA 2BMEA 4GO1A 4AP6A 1OOEA 5HZMA 1D7OA 1AH2A 4QXQA 1DC8A 3PNKA 3YASA 4WA7A 3G23A 2H4ZA 1X8JA 4WLVA 4HVTA 5CB8A 4NJEA 4PYNA 1OV4A 2H8GA 4OFWA 1S2IA 2HA5A 4HNQA 5KYUA 1JFTA 5ALJA 4XM2A 5FBQB 3IE0A 1DXQA 2C2XA 4C03A 2PT9A 2BMFA 5KHOC 2W8BB 1M8GA 1N8TA 2E3JA 3UQYS 5KX5B 2W98A 4H17A 3IG0A 1LGYA 1YTUA 3JVIA 4Q4DA 4LZJA 5KNDA 2HIMA 2PMCA 3E81A 4CNBA 1E5TA 2WIBA 2RHTA 4G9EA 1HLDA 1SC1A 3W8EA 2Q1YA 1BSVA 2DR3A 1IOLA 3R24A 4LXGA 5ED0A 3ZCXA 4FFRA 1F3LA 4B4WA 4ETIA 3D4OA 1GU1A 4GGMX 1GGJA 2ZR7A 3JZDA 4C4TA 3CRMA 4PSDA 2IJGX 5IABA 2FPMA 3VU8A 2X8LA 3MC1A 2YL2A 4CTJA 4MLPA 4IX1A 1O96A 1DHRA 1VJRA 4IV0A 3KYJB 2YICA 1G16A 1DJNA 1BDJA 4MUEA 2P11A 2YVAA 4HRYA 3RHFA 4TUYA 4A6DA 4BBJA 3CUWA 3ND5A 2W2TA 1RPZA 4ER5A 2FWBA 1U5BB 2B8TA 3N7TA 1VRCA 2AFHB 1F0KA 2IT1A 2J41A 3VR5A 4BYMA 2BE7A 3OQPA 1NYQA 5EZSA 3VPHA 4FGLA 3C6MA 4RTPA 1XOIA 2GKSA 3P4XA 1FUEA 4ZVMA 3TL2A 4BRZA 1Q6ZA 5DBHX 2CLCX 2JJ8A 2Y0CA 2PZAA 3M9WA 3BSWA 2CZCA 3HJCA 3VNBA 3QUCA 4X00A 4AZVA 1PJ3A 2Q9AA 1K4YA 3T9CA 1SEPA 2XUZA 2C95A 1GTL1 2PZ8A 2ZFUA 3GRCA 4LBWA 1GPDG 1N7GA 2P6OA 3QF4B 5GJVC 4DSZA 3OX3A 1YS7A 3VJRA 3PFFA 4I50F 4W6QA 3KEQA 4BV3A 4ZZIA 1VL8A 1ZSNA 2XT6A 4NDZA 4EG4A 1QFZA 4R8SA 2H48A 4ABYA 5IG2A 2YZ2A 1T1IA 2C84A 1IG3A 4HS9A 5GV8A 3VO1A 1AHPA 3ZY5A 1XTIA 2DKOA 1FXWF 1W4ZA 4NY1A 1QOPB 3OM9A 4NLGA 3R0VA 4MKFA 4DYDA 4PYJA 4B6QA 3M33A 3GGGA 4D7AA 3AZPA 4KWHA 1HETA 2HVQA 1VCNA 2FG6C 4H4DA 4KO3S 4J43A 1N36H 3F1LA 1QS0A 2CXXA 3WRVA 5JSHA 4EQZA 1FNBA 4HXGA 3VZBA 1I13A 5EJMA 5ADUS 2FK8A 3Q5GA 3AR4A 2MHCA 4L5YA 5HGJA 4D57A 2FW8A 3P5SA 1QZXA 1A88A 1J2YA 4OATA 3PE4A 4Q1EA 4TS9A 1W5EA 3MJRA 1KORA 4BBPA 4HDQB 4YCDA 5FA5A 1P4GA 4JI6H 1ICEA 4JD5A 2XA1A 2Z3WA 2R25B 2MMCA 4Q6WA 2J4FA 4KMSA 2O54A 2VPYA 1WBDA 1PJ8A 4XIIA 1GZ4A 2AOTB 2AVDA 1N6LA 5JNUA 2WWWA 4TTAA 1UC9A 1DU4A 1G63A 1KYWA 2QDXA 3B52X 3U7FB 1GUDA 3O93A 3T4EA 1YZLA 2QX7A 1N6HA 1L5ZA 3IIJA 4DCMA 2ZSIA 5KYNA 1V4VA 5EP1A 5C34B 2QTHA 4IF4A 4P4NA 2F3PA 3T1VA 5C37A 2AQKA 3LNCA 2AK3A 1D5WA 1IB0A 2FX5A 1HM5A 4LDJA 1PYOA