3R5XA

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
302
Chain Sequence
SNAMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis complexed with ATP
rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 84
structure length 302
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r5xA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r5xA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r5xA01
2I8CA 2V5AA 2NU8B 4EAAA 3MJFA 3Q2OA 2NU6B 5LA6F 3BFPA 4O7WA 1I7NA 1UC8A 4FFMA 1IOVA 2P0AA 5BMVF 4YBZB 4MA0A 1CQIB 3GIDA 3TQTA 3KALA 2CNQA 4O7SA 3UFXB 1KBLA 3TW6A 3OUZA 4FFLA 2NU7B 2GLTA 4I55F 4QSHA 4EG0A 5GONF 4EABA 3K5HA 1E4EB 4J6EA 2YW2A 4IWXA 3JZFA 1IOWA 3LP8A 2CNUA 3ORRA 4L1KA 2W6PA 2R85A 4FE2A 3BSWA 2FPGB 2XCLA 4EGQA 5D8DA 3QFFA 4MV8A 3VPDA 3JRWA 4O7RA 4O7NA 2W6ZA 3BG5A 4IIJF 2YZMA 4FFPA 1KC7A 3BSSA 4C5AA 1BXRA 2DWCA 4IHJF 2R7LA 4M98A 5BPFA 1KJ9A 2DIKA 4YAKB 4ZOLF 5J2UF 4ZQIA 1GSOA 1EUDB 4MV7A 1KJ8A 3R5FA 1OBGA 3MWDA 5LYJF 2CZGA 2DLNA 4YB8B 1DV1A 2GPSA 3ETHA 5HBRB 1VKZA 4IWYA 4EA9A 4ZI7F 4MV4A 2YZNA 4O4IF 3ORQA 1GSAA 1EHIA 3N8DA 1C3OA 1M0WA 3U9SA 3U9TA 2FP4B 1GLVA 3JZIA 3VA7A 1B6SA 2Z02A 4MAMA 4MV9A 2V59A 1A48A 2R87A 2PN1A 3R23A 4C5CA 3K3PA 4O83A 3U55A 3E5NA 4NYEA 1CE8A 3WO0A 4O7TA 3DF7A 5LP6F 3R5XA 3I12A 3R9RA 4MV3A 5CAEB 2QK4A 1ULZA 1W93A 3TINA 4EGJA 2OLSA 2YWVA 2FB9A 3JRXA 4WD3A 5BPHA 4M9CA 3HO8A 1JKJB 1M0TA 4O7VA 2YS7A 4WBNF 4O82A 4O2BF 4DIMA 4MV1A 3VPCA 4I50F 2J9GA 1Z2PX 1B6RA 5CA1F 1VBGA 2PVPA 2ZDGA 4XZ3B 2QF7A 2R7MA 5KX5F 4O7YA 2IP4A 4ME6A 2W6OA 1JDBB 4O4JF 4Y8VB 3V4ZA 3VOTA 4XYLB 2W71A 5JQWA 1KEEA 4ZHQF 1JLLB 2R7NA 3KAKA 5JQGF 2R6FA 3GLKA 1WR2A 2C00A 3BSYA 4FGRA 5I47A 4E4TA 1Z2OX 1DIKA 3NUAA 3G8CA 1T36A 2W6NA 4C5BA 1M6VA 2W6QA 3WO1A 1AUVA 3HBLA 3HB9A 1PX2A 1OBDA 1KJQA 4RZQA 4M99A 3RV4A 2GQSA 2ZDQA 3VMMA 3Q1KA 1W96A 1E4EA 1PK8A 1Z2NX 4M9UA 1VBHA 2NUAB 3TIGA 4TUYF 2I87A 1AUXA 3AX6A 5FNVF 4TV9F 4MV6A 5JVDF 1KJJA 2CNVA 2XD4A 2GQRA 1EYZA 4FFNA 1GSHA 2YYAA 5HV6A 1C30A 2YZLA 2CQYA 2HGSA 5C1OA 2ZDHA 5IYZF 5J2TF 3KREA 2VR1A 2V58A 5EZYF 2YRXA 1CQJB 4I4TF 4O4LF 1BNCA 3RV3A 4YAJB 3U54A 3SE7A 2VPQA 4XYMB 3R5HA 4O81A 2Z04A 5C8YF 2WYOA 4DLKA 4HNVA 3G8DA 5DMXA 5JVLA 1A9XA 4FFOA 2W6MA 3K5IA 4FFRA 4EA7A 5KKNB 1SCUB 3V4SA 5H80A 2X0SA 4O84A 2R82A 4YJ3F 1JDEA 5LOVF 2GPWA 3LWBA 3KAJA 2PBZA 5LXTF 2FPPB 1EUCB 2NU9B 2NPOA 2SCUB 1UC9A 3RUPA 4HR7A 2VQDA 1KJIA 5C1PA 5CA0F 1DV2A 3VPBA 5CB4F 1EZ1A 1CS0A 3OUUA 2HJWA 4XX0B 1KUTA 4O4HF 3WNZA 2R86A 3N6RA 3TIIA 1I7LA 2VHEA 4HQ6A 2DZDA 3RFCA 4HNUA 4GGMX 5K2MA 1GGOA 2YZGA 2YS6A 2R7KA 3AW8A 2I80A 2FPIB 3ETJA 4O7LA 4YJ2F 4O86A 2W70A 4O7ZA 4IZOA 2R84A 4FU0A 4TV8F 2YRWA 4O2AF 4EA8A 2YL2A 4HNTA 5JH7F 4MA5A 3MWEA
chains in the Genus database with same CATH superfamily
2C22A 1M0EA 4C0SA 3MJFA 3HKCA 3UYYA 1NFQA 2A5DA 1K08A 3O9VA 2OA0A 3HJGA 2OCKA 2MSWA 1CUBA 4XJSA 3ADCA 2CLLB 1OA0A 2GKOA 1CQIB 3PENA 4ED8A 3MWYW 2Y0BA 5EA2A 3CIOA 2PKCA 3PC2A 1FTYA 4PCAA 1JDZA 1S01A 3IP8A 1W76A 5HM6A 3PLNA 2NAFA 5CT6A 3TLGB 1IBCA 1Z0ZA 4FE2A 3K1TA 1EVQA 3MTJA 2IYTA 1D0IA 5KTMA 1UDXA 1J2EA 5BRJA 3OJFA 4ZWNA 5FD8A 3AF2A 3BQNB 1L4YA 2FDCA 1RE0A 3HCAA 3IDOA 3OM1A 4WZAA 3JPYA 1NV8A 4J9SA 5KKCA 4D4HA 5F1OA 2XB4A 1G8GA 3K9GA 3VR4D 3FKSD 4U2CA 2A1TS 4FXOA 2Q21A 3OEHD 3GB8B 4N0DA 5BT8A 3PHBE 4UATA 1TJPB 2JFPA 1N5OX 4F0JA 4FCVA 1BE1A 3DYIA 4F5ZA 3TLKA 3D6JA 4B3TH 2I6SA 4R2KA 3UJDA 1UBRS 1PEAA 3TDNA 4U0KA 4NIMA 3E3LA 1ZHOA 5CDYA 4HWRA 4DJ5X 1AHPA 4RQBA 1B8VA 3O21A 5JR3A 4LJ9A 2A30A 1H9BA 4UVDA 4ZCQA 1CS4C 3KZKA 1GA4A 1MTZA 3R20A 4ZEVA 3H19A 2GM9A 3MQ2A 2ZB2A 5JXHA 1B14A 5LBUA 2JGMA 1FFEA 1GARA 1J56A 4NFHA 1CNMA 3A4NA 2CXNA 1RM4A 2J3LA 1VJDA 3I4MG 5CX1B 4UPEA 2NVUA 2HQ1A 1QU3A 1T3GA 3AUUA 2P4UA 3NVKI 2G1JA 6REQA 4HAYA 1RXYA 5MHTA 5L4LA 1TEVA 2C31A 1Q3KA 5JS1A 2OMKA 3FKSA 3KAKA 1KIAA 2KBFA 4D4MA 3QZUA 2RD2A 4BKMA 2C1XA 2Z8YA 2HG8A 4FPXA 3F6PA 1GG2A 2ZRPA 2OXFA 4OHKA 2BGIA 3KS9A 1CQIA 2CNDA 2Q4EA 1NI4B 5CB0A 1VE9A 1GFWA 4TMXA 4L28A 1IH8A 4NESA 4KIGA 3N41B 3P5SA 2VZEA 2QUZA 1NOKA 4BQFA 3HYTA 3L8FA 5ALXA 4Z1MA 1JEQB 3KJQA 3TLGA 3IEMA 3Q12A 1XTRA 1PUXA 4DJJA 4B6EA 5EIBD 4BPRA 3G2HA 5JS7A 5IDVA 1Q83A 2PWBA 4IRCA 5JYEA 3L8MA 2JCBA 3IGFA 1G7SA 4I1UA 1GL7A 4MR9B 4JUZA 2WAYA 1CY8A 5BNFA 2E0IA 2NO4A 3KQOA 3PVXA 1JA9A 4H9GA 1FP4B 3I8SA 1NJ1A 1O89A 3GNLA 1NLFA 3FOBA 1A50B 4D8WA 1SB9A 3NORA 3QTBA 1NQTA 2GAIA 1NVTA 1NT4A 1ZMOA 3M3HA 4Q45A 3BZWA 3AFHA 1LDNA 3I0MA 5I5XA 3FZNA 4GT1A 4TL7A 4UVIA 1Y37A 1U3DA 3AZOA 5AJVB 3E1KA 1N5IA 3L0SA 4QPJC 1C1XB 3ROZA 4OO3A 4UVGA 4OEHA 1P0PA 3TLJA 2DE0X 4MIKA 1VXRA 1XD2B 4GEGA 2QW0X 4C7OB 4CQMD 5SZKB 5CX1A 5IT0A 4DEXA 3EPRA 5C5JA 1WKCA 5ECDA 5IN4A 1IZYA 4BLVA 3ZU2A 2XE6A 2PA0A 2W9CB 1KQFA 1VI2A 4YLEA 9ATCA 1R10A 2J48A 1ZMTA 2J59A 2EKLA 3AILA 2OTCA 5E2BA 4AY4A 3OVMA 1VJGA 3F7NA 2HJ9A 4DQLA 1EUDA 1P0IA 3ILXA 4BX0A 3FHOA 1KMCA 3A1CA 4HWOA 3UA3A 3GLHB 3I4FA 3SYRA 2C5EA 3WOVA 4D6XA 2E4XA 2IOQA 3UMSA 1JEQA 1GO3E 2CK3A 1LRKA 5KFTA 1T5HX 4RWZA 3KE9A 2IGTA 2ONCA 1WXXA 4EHNA 3TRJA 4L3VA 4QYTA 4M1TA 5I9BA 5I8WA 4CM1A 1F9EA 4MR9A 3AUJB 2RK3A 1Z5GA 1GEEA 2OB2A 3OCXA 1X8XA 3PNLA 4CUZA 2PR7A 1EH5A 2Q7DA 4PHGA 1FP4A 4KXQA 3CF0A 4HT3B 1A2BA 2WIAA 3R0IA 4Y18A 3GT0A 3LV8A 5FTJA 2E82A 4D43A 2FK3A 2IPNA 2ANCA 2CNOA 2X2EA 3VUFA 2O8EB 3R7SA 2RBKA 1CVIA 4ETWA 1VE1A 1TIBA 3TDMA 4OU5A 1HMPA 3WIVA 4O3NA 1K8ZB 1WVGA 1PLLA 2V9CA 3DDZX 2PXCA 3BWEA 3NNDA 1AS2A 1P7ZA 3DGFC 4UBJA 1SXHA 4OHOA 1RYHA 4HGNA 2FOIA 2YNMD 1YJCA 1UM9A 1XPJA 3CEAA 3ZKWA 1XD2A 3K31A 4B45A 4OXRA 4C7OA 2Y1CA 4PHCA 3ND9A 4D0RA 2QBYB 3DEHA 5AIAA 2QMOA 4A7PA 2X2FA 4X54A 1RBZA 3OKAA 3ZE6A 1DVRA 1KYVA 3I2YX 1CQPA 1DGQA 1DO2A 1WY7A 4Q6WA 1XC7A 3MOIA 3I6QA 5HBGA 3PCXA 1SUBA 2P68A 1JLLB 3F5MA 2PQ0A 2E85A 4DANA 4BKRA 3O4JA 1E3SA 3ZYCA 1SKBA 3P5BA 1SHTX 1P0QA 4UMVA 4FHZA 4AZVA 3KUXA 4G3XA 1R00A 1Q1EA 4JKIA 1D9ZA 4UBNA 4EF4A 4B80A 2UXBB 3TI9A 4DA9A 4DIFA 3WHIA 5A9SA 3GLHA 3RB0A 4KUEA 1XLTC 1HPLA 1S89A 2OCLA 2I87A 3WWIA 1FYXA 1GGJA 3ETCA 4MV6A 2QTZA 2P5YA 5EIHA 4BQRA 2I1VB 4ZVVA 1WZNA 2X8BA 1MEEA 5GOZA 2W22A 1ZMRA 1SU8A 4FGJA 3GVXA 3WWCA 1JA1A 5GZ3A 4AP5A 2FU5C 2E2IA 1PFKA 4RJJA 3OTQA 3R5HA 1WXDA 2YNMA 3EWNA 4KLNA 1A3GA 3DVAB 3SSNA 4RDIA 4K9PA 3B3FA 1DDOA 5MFZA 2DTXA 1S5PA 3CX3A 4XFKA 2D1RA 2X22A 3REQB 1NVUQ 2PIAA 4BLWA 2Y3IA 2CWDA 4BECA 4DZTA 1KEVA 2O8EA 1PNVA 3GYBA 1RRFA 2OV1A 1EDDA 2WOJA 1MVLA 4YK7A 3WGGA 1Z34A 3MF4A 3O1HB 4X7RA 3TLMA 4O2AA 1AD2A 1NVBA 4BKUA 4B3RH 2J3EA 4P4LA 3VNQA 3N0WA 4EA6A 1HQYE 3F47A 2Q5FA 3IAUA 1Q7EA 3LHKA 5JAPA 2XGPA 4L5JA 3RKSA 2YS6A 1JR6A 2BGKA 2OM6A 1ULTA 4WN9B 2DFVA 2XQVA 3H5VA 3SIWA 4PPFA 5E3HA 4XGNA 3A14A 3KUCA 2V0NA 2QBYA 4JBYA 4GVXA 2ZKIA 1SBYA 4BNLA 4C22A 4Q18A 4X85A 2GPBA 1NF8A 1P6UA 2XUGA 2QS9A 2OO7A 3SZUA 5FFFA 2VDNB 3WDKA 1JLLA 2XUPA 1YDEA 2HADA 2WAMA 3WMRA 3FGZA 2IE8A 5B3AA 4QA9A 2BMVA 1ZINA 5DBOA 4A8JB 3T94A 5DKFA 3HCBA 4UTPA 4LRXA 3P0FA 5AVQA 4H1TA 3L7JA 5BORA 1C0LA 3ROTA 4PN7A 3TXXA 5CDUA 4AJOA 1S97A 5JZSA 1VCIA 4B6FA 2FYTA 4L0MA 4B74A 2YDYA 5L6MB 2CE2X 1U3FA 3VZRA 1UJMA 3C3MA 1QGDA 2WJIA 1XMQH 3Q2KA 1QQTA 4XYGA 3MS4A 2C2GA 3QX8A 2GN9A 3I1YA 4JA2A 4KSBA 4ZMBA 3GHYA 4D9MA 3D3JA 3D0QA 1KARA 3ROKA 3DVAA 1CXZA 4JLNA 2XYHA 2AQHA 3QEBZ 1B0AA 3REQA 1OH5A 3TXAA 3AF6A 3H0CA 1KY3A 1BFDA 3U9TA 3VZCA 5C7YA 1DRVA 1G2IA 4UNRA 1DX9A 1U1DA 3T5HA 2VOJA 4V1CB 5HA5A 2CYCA 1Z35A 3H0EA 2DC1A 4L73A 2JFZA 2GAFA 4URFA 5EMLA 3N43B 4D81A 2JEGA 3BORA 1D03A 4WN9A 4LISA 4DIMA 4C0XA 1G4UR 1V8ZA 3NC4A 4C0AC 3UKJA 2OCIA 4X65H 3JAMA 1J5PA 5KU7A 3GP3A 1RVV1 3JV7A 4UEJA 4ZEOA 4CCAA 4IKOA 1R27A 5IJ9B 4HZGA 1S2NA 3DL7A 4IG4A 5GVSA 3SJAA 2VNHA 1ECFA 2BEWB 2PJZA 5K4GA 4XIGS 4BNMA 1ISIA 5LSAA 3ZG6A 5FLKA 1TYAE 2XTAA 5B1HA 5BW6B 2Z9BA 4A8JA 5IG2A 1GRNA 1Y1QA 4DG8A 1PQYA 2XVZA 3MMNA 4GZMA 3GOHA 2F59A 4KAXA 1OYVA 4C4SA 3AERB 4IHQA 4X6UA 2IPXA 3URMA 2VT2A 4CHTA 2Q3EA 2VWHA 3LUPA 4WCVA 1JALA 2DKOA 1K5GA 4EZIA 4EO4A 3VTFA 5I4KA 4JNKA 2UXDB 1MO3A 1Z4KA 3C1TA 1POWA 2UKDA 1L6IA 1U80A 1BNCA 4K9KA 5CEJA 2CCGA 2BFCB 3BK7A 3RUEA 2P90A 3EGEA 4GS5A 1AF4A 3CE9A 3D0RA 3D4BA 2B21A 4K2AA 2VQ6A 3L7AA 4PO8A 1KTVA 3H40A 5TQJA 1BEZA 1DXOA 2WTXA 3ICQB 3VPXA 3O2JA 3WGMA 3PUVA 1TRHA 5DH9A 2L2QA 5HNKA 2OYRA 4IF4A 3QBVA 5KB3A 3R3ZA 1JH8A 2DFLA 4OJKA 3WL5A 5AW3A 2GAAA 2B8NA 4AY3A 1UFQA 5D5HA 3VHRA 1Y4UA 1WG8A 4KO1S 3K0AB 4V1CA 2VJLA 4NV3A 4UBKA 1DIHA 2WMDA 3V8EA 3PFFA 5G40A 3ZOKA 3G9XA 2AV6A 3I34X 3FHCB 2WABA 4FOSA 2QI9F 4MUMA 4EYOA 4G01B 2OXCA 4PC6A 1WW3A 4O2AF 3HU5A 1IYZA 4MW0A 4MKZA 1TO2E 1PJ3A 4EQ5A 4M7EA 3PVCA 5IJ9A 1VL1A 3BFKA 4GKKB 4QO7A 1Q2UA 4ZO8A 3AVQA 2QSYA 1E59A 1Y1SA 4MVJI 4FFMA 3FPKA 2V7UA 3V1UA 5HWSA 4C76A 1VLLA 1YBFA 3T7JA 3ADBA 1YVRA 4GXTA 2FG7C 3WS7A 2EG5A 1GPBA 3DEZA 3N2GB 2CVPA 3LFHA 2B94A 2OWEA 1E3QA 2JD2A 1Z6QA 3AERA 2PMDA 2REOA 4AYWA 4J43A 4MGZR 3PQ6A 5BR1A 3WJ1A 3BM5A 3L6CA 4H1WA 1FY2A 4AZWA 1W47A 4F4JA 1QFYA 4R41A 1HFKA 3W6PA 2OZLB 1T9AA 4LAFA 1PNTA 2C59A 1ZC4A 3DTNA 3KUDA 3RANA 4MKGA 5HX7A 3HJNA 2BMEA 4FOPA 1SBCA 5DQHA 3OZCA 3CSUA 5TIIA 2EGHA 4AKEA 1UXOA 4RW0A 3OQJA 3MCVA 2BFCA 2EJUA 4X71A 2ZIZA 2DB3A 4R1SA 4ZCPA 3P0EA 7MDHA 5LMCA 1ZMBA 5FXMA 3EZYA 2LZ0A 3B7GA 1K68A 5EMNA 4AN1A 3KEMA 1MO6A 4NEGA 4M1OA 2VSYA 5G0SA 4HDOB 4R9VA 1C9MA 4E3WA 3MBOA 1U7UA 1R0BA 2G28A 1YRYE 2YOGA 1PQUA 4NL4H 2FJPA 5DG8A 2Q9CA 2IUYA 1TQDA 2BJWA 3WL6A 5A2QA 3K0AA 1OASA 3HKDB 3UK0A 1BVRA 3GJ7A 1FMFA 2X7XA 1G5TA 3TSWA 1MVOA 3DP7A 1FXSA 3D4LA 2XH8A 4XA8A 4DR6H 4YQEA 1ZJJA 2VYND 3JQPA 1YJBA 4Z0PA 3BN3A 1H1DA 1C80A 2EBFX 4Q9NA 2R60A 2FZGA 5IC4A 3UHAA 1MB2A 1ZRNA 1N1DA 2W58A 4WEOA 5KC8A 5LZ4A 3JQFA 2PM8A 4KW7A 4R0NA 3DAPA 5C8XA 5IBPA 2WC1A 2N46A 2IS4A 521PA 1FDUA 3R75A 4F72A 4DVJA 1NXWA 3IAS1 3C14C 4H3VA 3IN5A 3HLYA 4BB5A 4IHKA 2NUPB 3N2GA 3S2IA 4JBNA 3RGGA 4HGZA 4C2MA 4B83A 4BNDB 1TFUA 3AGQA 1E6EA 1N7GA 2ZBEA 4MGEA 4NNJA 4Y0AA 2HF9A 5JEEA 5IARA 3MBKA 3RUAA 3GZJA 5DG9A 4PGGA 1WCV1 3UANA 3CBGA 5KNDH 4Y2QA 3CX4A 4OBWA 3QPVA 1R1DA 3R1IA 5IKMA 4F6LA 1BWPA 2JJMA 1VE6A 4YAJB 5KFQA 3C7TA 2QQGA 3SE7A 4ENSA 3D4IA 3QPAA 1I6LA 3EMDA 3LXUX 5KFMA 1R8XA 1UZNA 1VBNA 4IF6A 4ZAFA 5ENVA 3QVUA 5KT2A 3I32A 2FRDC 4OHXA 1TU3A 1ZX1A 3UFBA 3KKQA 1Q0PA 1RIIA 2ZIAA 4Z5XA 3ROMA 5E9AA 1RZRA 4AUNA 2JCGA 4IIHA 3NJ8A 4IFEA 5ABPA 3ZUGA 2WD9A 1NSYA 1HT3A 4BWFB 1I2DA 4EY5A 3LW7A 4CKBB 1RYZA 1F0PA 2DT5A 3IO5A 2Z2IA 3PO3G 2BMWA 1II8B 3HKDA 4B3XA 3ZY5A 1WUHS 3PX7A 2Q50A 1CZLA 2A9PA 1MEJA 2AC2A 2BFAA 5LJLA 1W0JD 3PJFA 2RE8A 5CH8A 1DEAA 4YCJA 2ACVA 3J7AK 2VL7A 1X19A 3Q3CA 2GRJA 1FSGA 5EWLB 3P2OA 4TWZA 3BXFA 3LUBA 4J94A 4TT8A 4QU8A 4ED9A 4I1YA 4K40A 3ESCA 1E7WA 3HN7A 4C2BA 1IWPB 2QJOA 4GSLA 1XNGA 3H4IA 1CRPA 5AW6A 3O73A 3RI3A 1APBA 2OCYC 4TZTA 1SQ0A 3FPBA 1G4AE 4D9HA 1T6NA 1YUMA 4FDAA 4MDYA 5JZMA 3H9BA 3DT6A 4UE6A 3OZRA 5BRNA 3DBRB 2PUAA 3RS3A 4FVTA 3G8BA 4K9QA 2PSFA 2D7DA 4DQVA 3TW6A 2NUPA 1WZ2A 1NZFA 3GJ5A 2HA6A 4EABA 3DM9B 2Z83A 3CX8A 4CDRA 3KT8A 1G4HA 4YAFA 5ELMA 4BNDA 1XIVA 1Z0IA 1F5NA 5AXBA 3C5VA 2AIRA 1GILA 5DSZA 4I9UA 4M3NA 2FPGB 5FWAA 5CXUA 5ALMA 1DO8A 4RZSA 1XBTA 4JGIA 1X1QA 2FSVC 3HEAA 3N2ZB 1K06A 1N0WA 1ODKA 2QM3A 1NMZA 2HMSA 4A8HA 3O5AA 2G83A 4QRDA 3BAFA 3CVUA 4XCQA 5LOVB 2ZYVX 1IUNA 2QP3A 4ZDKA 1X8KA 1LBTA 4YAJA 1KO7A 3L1UA 1Q20A 4YAKB 3H2ZA 4N76A 4PGHA 3DZHA 3F4BA 1CUIA 1UM8A 1U0EA 5F64A 4I8XA 3G7NA 4TRMA 2C5GA 4Z9XA 3K0KA 3EXFB 1JQ3A 5CEFA 5A7GA 2GJKA 4E6EA 1GOTA 3B38A 1EPUA 2VQEH 1SIBE 5SZJA 4O29A 3GTLA 4CEIB 2NO0A 4D3XA 3E84A 1IRIA 4Z3DA 3I52A 1H3FA 4CKBA 4GWGA 2PZAA 2G5PA 1HNXH 3T06B 1WOYA 1V9SA 4YP9A 3IBSA 3TSOA 1II8A 4O7TA 3TVTA 1XKQA 1YCGA 4LJ6A 2XQGA 2JJ8A 2OZEA 4EHLA 3HWX1 4RJKA 4QUBA 1FJGB 1U0LA 2ZR8A 2I6QA 1KS2A 3IMKA 3SJ7A 3QSGA 3T3HA 1HLPA 5EWLA 3CTPA 4H17A 2O57A 3M1AA 1Z38A 5HF5A 1LSUA 1VGRA 3TEJA 1FS4A 1VPWA 3RAQA 3JWEA 2VHJA 2B1GA 3GGDA 4PLVA 4OKNA 3EHDA 3HXQA 1A8IA 2W37A 3OQNA 1PKXA 3STWA 4RJLA 1H2AS 3M5CA 1ZICA 4HBZA 2FR8C 4G4JA 5SZIA 4RD3A 4ROTA 5EHNA 3DBRA 4MLPA 4D0SA 2IY7A 2W6NA 1R9TA 4MEAA 4GUAA 1X7XA 4APMA 3DOEA 3AYZB 1P7YA 4BE4A 1JWBB 4FDTA 2ZVPX 1N32H 3RVQA 1KK3A 2GM3A 4O4LA 4IXTA 2V7XA 3EVAA 1JG7A 3TOSA 3W5BA 4UDXX 3SJBA 5IK2D 4DR1B 1MP0A 2FPGA 2XD4A 3N53A 2UYOA 4MDHA 1PJTA 4HX2A 2I3BA 1MO2A 4BJ1A 5EIAA 1JNXX 5LOVA 3AZPA 1YRHA 3K8OE 1TX4B 2BW0A 1X3SA 4NCHA 1M2VB 1LLFA 4YAKA 5KAPA 4DILA 3RWMB 1EI9A 2QRLA 3RWBA 2P6RA 2WIDA 4I81A 1T94A 3NASA 2RGDA 3MWFA 1W29A 3F5DA 5E6SA 3M3DA 1T9BA 4IQGA 3KWMA 2CJWB 3Q4GA 4YAUA 4NOLA 4PBTA 4UE2A 5IUKC 1CDDA 2YUIA 1P7PA 4CEIA 3LPCA 4MGIR 3TG2A 2C8KA 2BFWA 4H7JA 2J87A 4WMLA 3OO1A 4TKLA 5FBLB 3NX4A 2EJTA 2WLSA 4RTSA 5P21A 3EDOA 1I7LA 4KR6A 1WW8A 3X1KA 2QD2A 2DZDA 4EYHB 4HNUA 2IZOA 3ZNOA 3VKGA 3IC5A 3SDSA 4F4DA 4DL7A 3CBQA 2JLSA 5AW7A 1NC1A 3NM4A 3JQ8A 3RS0A 2IA6A 4M60A 1G8YA 2BQUA 5TDHA 1P1JA 2IOHA 1GQFA 2NZXA 4CDGA 5JZ9A 1CP3A 4UBMA 5KFGA 3UV7A 2J07A 1TCAA 2DPMA 5CPBA 2JEZA 3JZMA 3WYCA 2GSWA 2NTVA 1X1EA 3QVGB 4ZKDA 3OIVA 1C7RA 3L3BA 3VR6D 3HBJA 5AH0A 5EHQA 4Y6GB 1B0UA 3MTAA 2G1AA 3AZQA 3CZMA 5JNLA 4JV5B 2EKBA 4L4SA 4WCDA 3OJWA 1JR3D 3S70A 1SXJD 5AW0A 3VNUA 4XWTA 3UCXA 4OK6A 4JC4A 2GHQA 4IL5A 2BFOA 4MVJM 4J0MA 3L40A 1YMUA 3RT1A 4R1OA 3MNFA 5IS2A 1E9CA 5BN3B 3WAKA 2WV9A 4RL4A 4AG6A 1G38A 1ZD2P 3AF5A 4GOKA 2LR0A 1X15A 1X6VA 2P7HA 3TZLA 3V46A 4HRYA 5JNRA 2I65A 4X8HA 5AJXA 4R4JA 4EL5A 3MJSA 3OKPA 2Q2OA 1Z08A 3D9QX 3W2HA 1I6KA 3KUKA 1F0KA 4X7PA 2VTKA 2ZAYA 2CZCA 4OGLA 5HZHA 2F6RA 2QAIA 4MV4A 5J58A 4EKGA 2ZTHA 3HGTA 1RJDA 1RC0A 3CNQS 1XNRB 5H3LA 3CA8A 3QLUA 3TD6A 3LPMA 1E7MA 4NENB 5KREA 2AZXA 4L4ZA 3QU5A 4RNDB 3P4YA 4IRUB 1JG4A 3DKRA 4JT2A 4PTYA 5K1ZA 3PEEA 4LNAA 1TF2A 3TZQA 1CDZA 2ET6A 1R6AA 3PD1A 2BEKA 2CV1A 4A2WA 3LWDA 4JL6A 1X77A 3T5DA 1RBQA 4Z7JA 5J4VA 4R1TA 2KLBA 1Y7LA 4WZBB 3U7IA 4M86A 1VE3A 1Y5MA 1HTWA 4NJMB 2J9GA 1ACJA 3OFKA 3W9BA 2NTEA 3SQXA 1DC3A 3AP2A 3WKAA 1I80A 1TGYA 4FWIB 3DXYA 4B6GA 1U2PA 4DA7A 1KEEA 2BFMA 3NDIA 4C87A 3OJLA 1N33H 2XC9A 3QVGA 3UM9A 4PANA 1NVWQ 1XT6A 2G7ZA 1S68A 1GR1A 3W3AA 2OLJA 2XCSB 3EOZA 3P2IA 1OB2A 3AM1A 4CQLB 1YH3A 2AOXA 4ZYTA 1AUVA 2JHAA 3TCNA 2PUEA 5JBIA 5T67A 1W0KD 4XJTA 2O0LA 3HJHA 2DUMA 4CXMA 2BE9A 4Q24A 1ZLXA 4JI7H 2HPZA 1KEUA 3H5LA 2ZRGA 2HHCA 2PMZE 2NSYA 3ZVKA 2C95A 1RC8A 3FBTA 5K6AC 1HORA 4J9UE 3RJ9A 4PFKA 2X76A 3FNHA 1IIRA 4F3CA 2NSLA 3KLBA 3KB6A 1GCGA 3UW1A 2MT9A 4O4LF 2W2OA 4WXHA 4QDOA 4ZV4A 3B70A 3HYLA 3RK0A 4F4HA 2KLHA 4K88A 2XZLA 1E2FA 4UM9D 4NZZA 1CRWG 3VC3A 2UZ4A 3GPIA 3C4QA 1SHKA 3C6MA 1E1MA 2WAXA 4WJZA 1IDN1 4UOEA 2Y9MB 5AKGA 5LOVF 1J2RA 3JZDA 3OCZA 1O97C 1U2GC 1C3OB 2PS3A 2ZBDA 5C3MA 4QOGA 4QDXA 3I9JA 2QUHA 4NENA 4LSXA 3KJNA 2Z5FA 1Y63A 4LVCA 4JENA 2Y76A 4JI0B 4U7PB 4QM7A 1JFRA 2ZRBA 3OCJA 3TG8A 2CXPA 5HKLA 4BKPA 1PCXA 1XLWA 1PJAA 2VZ9A 5DIFA 4KG7A 1W0KA 3CLHA 3VAAA 1O6FA 2NXEA 2I8LA 1EXMA 4O3OA 3GFVA 2CV0A 3HC7A 3DTGA 4M9QA 2QN9A 2YJZA 1XL0A 3QKRA 1ULHA 1KQPA 2QMHA 4EAAA 2R65A 1Z6TA 1O9GA 1YMQA 4LMBA 4WPGA 3JQAB 3EGCA 3JYQA 4PYNA 1T2UA 3C98A 4AC9A 2XUDA 4E30A 3UJPA 2VJMB 3PF9A 1MV8A 1Z12A 3LW8A 3A58B 4CQLA 3GIDA 2ZJ4A 4O8ZA 2ZZMA 4JC5A 3H9CA 1VP9A 1E6CA 4KV9A 3GRRA 3Q7QA 2YHUA 1GU1A 3A11A 4RZ3A 2OCAA 4RVOA 4F8YA 1UBKS 1S9HA 4GI1A 3K4PA 4UC0A 2IS1A 1FU4A 3UJ9A 2DPJA 5DF1A 4BGVA 3KYCA 1MG5A 2VPZA 4KRYA 1CTQA 3KSZO 1MQAA 3KPVA 3PEWA 4C43A 5FD6A 4PRKA 4YJ3B 3VH1A 1SOWA 2OV3A 4BNWA 2P9TA 3EC1A 1WKVA 4X8OA 4ZEMA 2IHJA 1TYDE 1P9WA 2P1DA 4UHBA 2A6PA 1KQGA 1F0NA 4PYQA 3SKVA 2YYYA 1KPHA 4UBIA 3NDJA 3G2MA 1SPBS 2K7FA 2WJ3A 2CJXA 3UW3A 1JBQA 2PO5A 4FNMA 3HYRA 1PJZA 1ZPDA 4U7TB 3PJEA 4LZZA 1C3OA 1V4NA 2H08A 2BUCA 4DR2H 1B6GA 1E9FA 1NTOA 1DOHA 1ZIYA 2QTHA 1VMIA 2WM2A 1K75A 3H99A 3S4YA 1CS0B 1GDHA 1ZQ1A 1CCWA 2PPVA 3Q40A 3EK2A 4WZAB 3RODA 4QVKA 1JKIA 1NPDA 2JCYA 1JXQA 5LP6C 4D99A 4CCWA 2FB9A 3SJZA 4G0WA 1KI6B 3A70A 2B61A 2B7BA 3AEXA 3VDRA 3L77A 4GHWA 1SG0A 5JPCA 2VZLA 2R5FA 1ZD4A 4BNIA 2M05A 2B83A 1CQWA 3O1LA 1SBQA 2R48A 1OX4A 2H2DA 3QUCA 4GP7A 4MW5A 3SX0A 3RVLA 2BMJA 1YOVB 3UG7A 3GA0A 1K5HA 2FJZA 2VJMA 4G5FA 4N82A 4IIUA 3ZU4A 2JEJA 3IUJA 1RC1A 2QPLA 3VU9A 3Q8RB 4UKDA 2XUFA 4ZU3A 4XD7A 3LYUA 3MGCA 1N2BA 1ZK1A 3CXRA 3DOIA 3UT0A 1EDBA 1W59A 1YGYA 3IP5A 4JLSA 2NVUB 1RLOA 3JWPA 2BSXA 3LPAA 4PZ9A 3K1JA 4CFZA 4JT9A 4B4UA 2CUZA 4TYMA 5ERXA 1M2HA 5KT4A 4ML3A 4JB2A 4OKIA 1QAOA 1RK5A 3KOOA 4YJ3A 3L1JA 2GN0A 2H9YA 4Q9IA 1OPRA 3GT7A 1KY2A 1SEVA 5ALSA 2WYOA 4DLKA 4HNVA 2Q6OA 3NEAA 4QUHA 3OZIA 3FCXA 4EHIA 1PFUA 1AS0A 5IFKA 2J6BA 2F1JA 2H2FA 3EQ8A 2RIRA 3ZZTA 3VKFA 1W6UA 3LVBA 2AL7A 3GPDG 3BRWD 5AM3A 2E37A 3Q8LA 2BGLA 2CHEA 3LK7A 1UKZA 3TW7A 4YGYA 1VOTA 3QOFA 4PGFA 1P9LA 1V48A 3ER6A 3HFRA 1ISMA 2CXUA 5JRJA 4R2XA 2IDZA 2JPDA 4TV9A 4JUCA 4PLGA 6LDHA 1EBFA 1CS0A 1KAMA 2GHIA 2Z9CA 2B82A 3P9NA 2VHYA 2I99A 1X13A 2C0CA 3ANXA 4RVCA 3OE5A 4TQGA 3NUGA 3AR5A 2VUGA 2ZYUX 1ZA1A 2WTMA 1KI6A 4IDCA 2WWFA 3ESQA 1PUIA 2FEAA 2F3UA 2DFTA 3MUOA 5KT5A 3HYSA 1N2CB 3ON5A 4Q3EA 1UDBA 1HK7A 3OQOA 4MXDA 3G8AA 2WU3A 1X9NA 4N3NA 4DV3B 1CR6A 2I2FA 3NBMA 3WI7A 3IHTA 1T6XA 4OFZA 1Z8FA 2IDMA 4I55A 1ZI6A 1MOSA 5E38A 1NP6A 3KHHA 3E4CA 3I1FA 3CUVA 3D2BA 4IH1A 2FN9A 1IQUA 3DL2A 4Y0VA 4KVFA 1YOVA 1I4OA 1PJQA 2CMDA 3PE6A 2ZUUA 1USGA 4ECXA 3F3KA 5JSUA 4Z9FA 1GPNA 3ZXXA 3LG2A 3PI7A 5JBNA 2C8VA 1T10A 4RVDA 1CJVC 5K8UA 1G5QA 4PPYA 3WICA 1U9ZA 3TTTA 3K5HA 1UWVA 3ESZA 4MUGA 5KVVA 2H1WA 4HYYA 3LHDA 3QQMA 3G5TA 3LL7A 3PA8A 1BVYF 2HTFA 2VAXA 1GAEO 3EG5A 4LXUA 1ORRA 4RVGA 5DNDA 1LQUA 5C8ZA 1NUAA 2Q99A 1QVVA 5C1BA 4P84A 1AQYA 2QD5A 5KCZA 1K7YA 3NBFA 4U4AA 5DTJA 2VSFA 2WFZA 2A9FA 5LDDC 2XTNA 3PCTA 2MYPA 3VR4A 2G7MC 3OEHA 1VS0A 3ZNPA 1VA4A 4LDQA 5F21A 4F38A 5CIQA 2IYUA 3OTOH 1LKZA 5I5UA 2ZROA 4J4TA 1EUDB 2OGUA 1TCUA 3TO5A 3N8GA 4E33A 2CLEB 4EBDA 2X1MA 1E0AA 1W7AA 5IAKA 4IFIA 3DDOA 3ABIA 4E51A 1OQAA 3ODPA 2ODTX 1AH2A 1O9HA 2ZS7A 3TW8A 2ZSJA 1YD7A 1I5EA 1X74A 3I9V1 5HF6A 3RADC 3HOZG 2XQFA 5DHFA 4KK4A 3ZGXA 4JEHA 3L4SO 2R8IA 1XFDA 1PR5A 4FLMA 1GZ5A 1OZ0A 3UKDA 1EXWA 1VZ3A 3B6IA 3L8CA 5K8JB 3JASA 2PA3A 2H9IA 3QPCA 2ZT7A 4Q1CA 2CL0X 1IXKA 1W93A 3BXPA 4B9EA 4FYMA 4LPSA 1KFKB 1S3GA 4CTNA 2QL9A 1JXOA 5BMVB 3DYVA 4TTTS 4MWBA 4CQMB 1QQ7A 1N2CA 3ONDA 3OIWA 1U7TA 5JZBA 4HQKA 1YE3A 5DGDA 1ANKA 3EWIA 2QP4A 1FTQA 5IABA 3ZIDA 3SKYA 1YKSA 3F7TA 3ENWA 2RJNA 3HXLA 3TNLA 1U9IA 1T24A 2WJZB 5JVDA 4M9XA 1V4YA 4ZZ3A 1Z2OX 4XCVA 2A8YA 3NLLA 3DFUA 4RKEA 1V51A 1RMTA 2G9QA 3S1LA 3R6DA 1TTHA 5FOUA 3WLMA 1KWGA 3AR3A 1UM9B 4RZQA 3CLUD 4ZOAA 3C3JA 3ZKWB 2BRUC 5IAGA 1Z5PA 2VAWA 4PZPA 3JQDA 1AURA 1DOAA 1E2UA 3ZIAD 2JCVA 4E2YA 4LGVA 2AYXA 4KQKA 1PYOA 1A8QA 1P4HA 4IINA 1P7WA 1XCLA 1Y4SA 3DZDA 1XYYA 2C83A 4BX9A 1GTJ1 3ZCQA 3GP8A 1WQ1R 5KFVA 4XTRA 4BB6A 3C8UA 3LCCA 4IOJA 4G0VA 2VYVD 2VAMA 2BUAA 5A9SB 2HIAA 3DL0A 3EIHA 2W4QA 4YJ3F 2VK4A 4K6CA 3KSBC 2WDTA 2IHZA 1YA4A 2C8LA 3KAJA 1M10A 1Z5UA 3GARA 2EARA 3HK2A 3I5MA 4BJ3A 4GXQA 5SY9A 4TRJA 3BREA 1JAHA 5MDHA 3RW9A 4FFSA 4KTVE 1KZHA 1J2TA 1DJNA 1DV2A 1DRWA 4YAWA 2HJGA 2C4NA 3BWVA 3GLIE 3RVRA 3HNPA 4PRLA 3OUUA 3PITA 2O3QA 3L4KA 2H54A 1AZWA 2O7SA 4N8DA 4CG0A 1TUGA 2F67A 2OHJA 3OMXA 2V4MA 4Y6PA 4ARIA 5LA6A 4QFDA 4V1CI 4Y6SA 1SAYA 3DEJA 4MEJA 5BMVA 4O7LA 2ZI4A 4IMRA 2XADA 2B5OA 1Y3HA 4CQMA 1VSVA 2R84A 1Z6ZA 3DLAA 1LBIA 4DIKA 2X0RA 3RGZA 3DCYA 2J67A 4IJMA 1SBIA 5T8KC 3ZIAA 1U0RA 3PDCA 4BBAA 3PXDA 4DZRA 5CVJA 4BO0A 2FE3A 3N59A 3B5IA 5EJEA 1W4BA 3Q2OA 3L4JA 2PS1A 1FJXA 1N6PA 3ABOB 1E2JA 3HCFA 5L9XA 3K1YA 1RZ3A 1FUEA 1JG1A 3M9WA 4O2AB 1JHQA 5EI5A 1HEUA 3VYWA 3O47A 2GCPA 1KTIA 3L0CA 2V0CA 2OMEA 1QIFA 4RULA 1U4NA 4I55F 3BD7A 1NATA 4Q5IA 5JROA 1KEWA 1R50A 1PRYA 4J6EA 4Z86A 2ESRA 3O4VA 1OWNA 2NADA 1WUTA 5I7OA 4I14A 2GCOB 2CLKB 1Z83A 2HLPA 2PGOA 4JI2H 1BU5A 3IDSA 3MR5A 4B76A 1VLHA 4MYHA 3RC3A 3HV0A 3THXB 2XHEA 1G6HA 1ZM3A 4MCIA 2NQ8A 1TLTA 1DIOB 2XUZA 5K8CA 5CYPA 6ABPA 2OD2A 3ZE2B 5LN1A 1U3WA 1Z74A 3TLXA 1FZQA 1ZP6A 3JQ7B 3I1JA 4B7XA 1U0GA 4RTMA 4MTLA 1J8YF 5CGZA 1PR6A 2HBYA 2CHGA 1BE6A 2WWTA 4AMBA 3ISTA 2XZTA 3WFJA 2RG7A 2I6UA 4ECSA 1PFQA 1WWKA 1DG1G 1E3JA 2D0DA 3QTLA 5FPKA 4CF6A 4JSRA 5KCMA 2FX2A 3SR4A 1OTYA 3WB2A 2V59A 3BTOA 4OQZA 2IOFK 1QB8A 3ZQUA 3AVTA 1IHUA 5EE0A 3GVIA 4EKDA 5I4IA 1WBBA 4L07A 1RYRA 1NMXA 1UKBA 3GLVA 4LC9A 1FFAA 1P2BA 4MX8A 4WK6A 5BN5B 5EKDA 3GFQA 1NW6A 2F3QA 2BR5A 1D8AA 3CNHA 3CEPB 3LY5A 2JGDB 3FYSA 5FUWA 4U2GA 5DHPA 4Q6BA 2W9XA 3SFVA 1C81A 2BBOA 4HWKA 4OIMA 5KEIA 2PGAA 3OE4A 4EFLA 1M1YE 2VSOA 3CY6A 4WNYA 4WFIA 1UK7A 4RNMA 1N2GA 1M54A 1P9NA 3FKIA 4JYAH 3TKYA 1R5NA 4UPDA 4MW2A 3EA4A 3IO3A 4XDYA 3S55A 4DVGA 1T5DX 4AMGA 2WT4A 3AKZA 1L8QA 1ZNZA 4EI8A 2PYIA 4DLRA 4HFJA 1GZUA 2DPLA 4B40A 4JOBA 2QU8A 1V3VA 4G2NA 3LKVA 4G81A 2GZDA 3GL9A 2WM8A 4HXGA 3WA7A 2OYCA 3BMXA 4LQCA 3AV3A 5JVDF 4KKXB 3QU7A 2GCOA 3VAYA 2QJRA 5L4NA 1ZEMA 1D2GA 3QX7A 5TB5A 1P0CA 2BF7A 3MC1A 3THXA 2JNWA 1KDTA 4L5AA 1VHQA 4E1BA 1Y7PA 2XE4A 1SGWA 1DINA 4JCOA 3WRVA 1JBKA 3GRZA 3I2GA 2C7RA 2IUTA 1BYUA 1DX4A 3JQ7A 5IT9W 2K7ZA 2L82A 4LV8B 5BXYA 1ZD3A 3E8SA 3RS5A 4GMGA 2AN9A 4DSAA 4US0R 1BDJA 1IHPA 5BWLA 3ZY6A 5LVAA 5B7GA 5TX7A 1H1LA 4RB2C 4HR7A 1FBTA 1ZI9A 1CLEA 2O0KA 3G2OA 4MVYA 1EU1A 2UVUA 2JLUA 2FZKA 4QBTA 1ZUD1 4N3BA 1PTKA 821PA 1E98A 2XIGA 4MQFB 4RHYA 3H5OA 1BKYA 4DAEA 4JASB 4UEOA 5BN5A 4S1VA 2BM1A 3LWZA 3D8SA 2IPMA 1IY2A 3REFA 1N8TA 4HJRA 4AJ4A 2VP6A 4LECA 2H07A 2JGDA 2CB0A 1EWYA 1QSGA 4HNTA 3A6FA 3DE4X 4KRFA 4NMHA 4ID9A 5BNIA 2H7CA 3P0HA 3OJOA 3SX4A 1JHYA 1ZSYA 5LA6F 2OQRA 1IB6A 5BMVF 1EFLA 3WLIA 1WSAA 3BD9A 3U3DA 4CUKA 3RRYA 1T36B 3FFAA 2WZCA 5TC4A 1AQ6A 2BJVA 5HTKA 5CVVA 5FBVB 1GTZA 2DR2A 3ZK7A 5ER9A 2N1BA 2C9BA 4TWIA 4H27A 1A1VA 2B7LA 3GRVA 4EF6A 3LP6A 3F3YA 3WQRA 1ZJWA 1JSZA 4C0BA 3FKIG 2ZYGA 4KBFA 4QO8A 3MUNA 4W7HA 4URUR 3S7ZA 2PRIA 4CT5A 1F9AA 3C3CA 5ALDA 2ADMA 5KFNA 5DXAA 4EJMA 4WTOA 1KJ9A 2W2LD 1ZC3A 2CDBA 3B1WA 5C4GB 2OBYA 3CRW1 1VL6A 3I83A 3UY4A 4DDMA 2JI9A 1C14A 3Q8SB 3PKIA 4NU6A 3L7IA 1NP7A 1YI1A 2HHJA 4Z49A 2FSGA 1GRRA 4F6RB 3BQ2A 4JI1H 1A96A 1K8YB 1T1RA 3QU4A 4MUKA 3FUXA 3Q6NA 1K7FB 2BHTA 4Q3CA 4MQFA 3V1TC 3QY0A 1BSVA 3PR5B 1W6RA 1XQ9A 1L9XA 2J3DA 5BQFA 1CDEA 4EF5A 3TOZA 2V54A 2X9LA 2WKWA 4MQUA 1YZQA 2W2PA 2YXLA 3EXIB 1I32A 1EUQA 5TPWA 5AO9A 4M4SA 3QUQA 5BWUA 3UC9A 2JA1A 4ZGGA 1QG0A 3PSHA 3BGDA 5EIWA 3DG9A 1BGVA 4FP9A 4BAGA 3K2QA 4FGRA 2XB9A 4IDAA 2VQSA 2PD6A 3KT6A 4DY4A 1T36A 3LWNA 2JAOA 4GBMA 1IB0A 2EQBA 4P36A 2GNPA 1EJ2A 4GLLA 1RI3A 1XQ1A 3ABRB 3OD1A 3QPUA 3CKYA 4NATA 4KN8A 4RK1A 2YIVX 2BL4A 4YONB 2NN3C 4LZNA 5JUMA 3BDIA 3A4VA 5LDHA 1ZISA 3TQ1A 2XMRA 5LQKA 1W48A 4YR3A 1JZSA 4OHMA 4HAOA 4NZPA 1N5MA 3GNTA 3DM5A 5C1OA 3WLEA 2FI1A 2Z98A 3O7WA 3BYZA 3GJ8A 2QKYA 5DE3A 2X0NA 1F6DA 2TMYA 5BUSA 5ALRA 4M1YA 4ZYUA 2XMBA 2F3PA 4P5PA 1MRSA 2HLDD 1R2QA 4EA7A 4YCMA 1NRJB 5CUQA 3VNBA 1HDYA 1BAPA 1EX1A 2WF8A 1IDOA 1BG6A 2C4MA 4GWLA 2HX1A 4IJVA 4IJQA 1FW8A 1PR0A 4F6RA 1QK3A 4M9ZA 1JPJA 4R2JA 4EY7A 2POCA 4GRIA 4DNFA 2WT8A 5JCJD 4EMBA 1CHDA 1M1ZA 1UPFA 3GUUA 1XQ6A 4Y9UA 2I34A 2WUVA 4G6ZA 4YQYA 3ROEA 4C07A 2KHZA 4V0QA 4QPPA 1XEWX 2VDRB 3SHVA 4C0QC 5LIPA 2BI4A 5FPQA 4FU0A 1Q21A 2O8BB 2ZSHA 5EHGA 2ID4A 3W9UA 4HDMB 4QLBA 3EXIA 3MQ4A 4XIJA 3H9EO 1I1LA 4E2ZA 2HQOA 3I0NA 3OTGA 3CUKA 3EDMA 3LD9A 4JQZA 2A5YB 3OFJA 4L78A 4O7WA 5DEIA 1JEYB 1SZJG 2OHIA 1HKUA 1ZH4A 3N2YA 4X6YA 1MB3A 3R5KA 5F35A 3FFXA 4DLBA 9LDTA 1RYMA 1FUKA 1FFCA 1I7DA 3OLYA 3ZE0B 2BF4A 2W00A 3QIVA 3BGVA 2YJ5A 3HA7A 1B43A 1VSTA 4BRSA 1IEVA 1E4EB 4Q15A 5ALYA 3SQDA 3G2IA 1DPGA 4UTXA 2SHKA 4Q7EA 3P2KA 3O3NB 2JARA 1DQRA 3I4NG 2M6SA 4BAZA 3LY8A 3RTAA 1EWRA 1USUA 2QMYA 5E9WA 2IXDA 2WHQA 4KU4A 3NBZB 1DC4A 4KH0A 2QN6A 5IF3A 3I2FA 1W4ZA 1T8SA 1XTIA 3CB4A 4J1TA 4N5HX 4E4RA 5KFIA 4MQ6A 5D01A 3QSYA 4DSZA 3D7MA 1UMBB 4WOBA 4OY3A 4B3SB 1MORA 1E9SA 1GGMA 5F5NA 2LV8A 4NS4A 4YPOA 4U5QA 1X1DA 3INGA 2XYGA 1LV7A 1AS3A 4LRWA 2OR3A 4MROA 1Y7IA 1Z6GA 3HBFA 2Q29A 4NZOA 3D4NA 1NHWA 1C2TA 2XF8A 5D85A 4H18A 1I94H 1H69A 3R9RA 2HF7A 4FGUA 2WV7A 4RUAA 4MVCA 2X9NA 4OQQA 1QR6A 1WKBA 3DZGA 1GCAA 2M6KA 4HKTA 3KXIA 2X23A 2VYNA 4KI0A 1S0NA 2O8BA 2OBBA 3BEDA 5LZ7A 2J0EA 4HDMA 1CZHA 3PW7A 2F9FA 1QRUA 4E09A 3IIIA 2GXUA 1T0BA 2NMVA 1EFKA 1LDBA 2H1RA 4CLEA 4XTCS 2UUBH 1JEYA 4PYKA 1XA4A 2PRYA 3T5LA 2W2KB 4UUBA 5EPOA 1JJFA 3GFOA 1P74A 3PFGA 1GTMA 3QXXA 1Z8DA 4BNNA 5DOZA 2V7VA 3K70B 5K4AA 1Y1LA 4O3MA 3ZDEA 1VBMA 3RC7A 2JK1A 1RKVA 1E4EA 3U62A 4KDRA 3H1GA 1YJXA 1N1MA 3EQ6A 3NT2A 3RB4A 4N5LA 4A2BA 2R5WA 2QA5A 3GJRA 1U8FO 2CFIA 4RNOA 4DR3H 4FHDA 1UK9A 1NW3A 3A6DA 2YASA 2PK3A 3W8FA 1XRQA 4DV2H 2QSUA 4WFKA 4LJ4A 3K92A 1JU3A 3H18A 4WXEA 3LUCA 1X7XB 3VOSA 2HLHA 3QLUC 4ESVA 4MMXB 3SK0A 3DMPA 4L8YA 4O4LB 5FLMG 4LF7B 3AR9A 3IAEA 2FPLA 2GPAA 1UMBA 1CLUA 1TI7A 3VKHA 1WEKA 3C3DA 1K7XB 3R9XA 3L18A 2NPOA 1QTQA 5H81A 2GEBA 1TK3A 3R4VA 1VL0A 2IHYA 4LSGA 5GM2A 2ZRHA 3BRSA 1JTFA 2HGWA 5KS8A 4CE6A 1XHLA 4OA5A 3GIPA 4RF4A 1NLZA 1W0JA 3ULKA 4NFSA 2ORYA 3OLCX 5L53A 1CPYA 2RGNC 3AW8A 4BKOA 2OQVA 2ASLA 2MJLA 3AF0A 3C3KA 1SZCA 1ZWKA 3EVBA 3BGSA 5JNVA 3QI7A 5E6SB 3E35A 1PR1A 3QLJA 5KTSA 2I8CA 4QGFA 3IV6A 4YR7A 4YCDA 5A5FA 2RK4A 1SD5A 3LGSA 2ZBUA 4QJ4A 3EUWA 1I3NA 5SICE 5KJCA 4DQKA 3O2NA 2W2KA 3HFSA 3S5UA 3A7DA 3C8DA 2LP4Y 4U7CA 4UTZA 3HKZA 2Y1KA 2VBIA 4JQOA 1ZGZA 1L1EA 1KAGA 4L6IA 3JQ8B 1IBRA 4EKIA 1XXLA 5FOSA 1E7RA 2EW2A 2VJAA 1UXGA 4GKVA 1PYGA 2ZGIA 1ICEA 3MS2A 1NR7A 4TMKA 1VI5A 3VBCA 2RHGB 1XXHE 2JATA 4BQOA 4HFNA 2PMFA 2WJGA 5BVGB 4CC6A 2FLWA 4Q12A 3ADKA 1DCKA 2R7LA 4LTDA 4QSMA 2YWDA 4II7A 4WSOA 3GJYA 1OSNA 2ZYAA 3LIIA 3EQ2A 3GFGA 3KDPA 3VYUB 1Z7GA 2GF2A 3R5FA 1MRZA 1L7DA 1I30A 2XYQA 3I8XA 4OQMA 4B34A 1RDFA 2ZRCA 5BN4A 2XF2A 2C9YA 2F1IA 3S8MA 2R9VA 1ZN7A 7MHTA 4KRXA 4RZUA 3FOWA 4F6CA 3QA9A 4TMZA 3E5NA 2CC2A 2RJ3A 3KVOA 1M76A 4OOFA 5K3WA 5AKIA 4IZHA 3EVFA 2DWQA 2QL7A 2R8XA 1CY2A 1Q1AA 1Z2DA 4GICA 2K87A 1NVKA 3W5UA 3CRMA 4WBSA 2OK8A 5BYBA 1Q91A 3EASA 4YBRA 3ZD9A 4MYUA 1IAQA 3LA6A 4UFPA 1FMTA 4MRAA 1FMJA 3IT0A 3UG6A 3VSCA 1BDBA 1QGYA 2AJDA 1R37A 3HVKA 3KPYA 3V4ZA 1UAYA 1NBHA 1O75A 2NNLD 3EZLA 1EFRD 1JMYA 3UQYS 1YZFA 4RIFA 1XRLA 3HOXG 4LS3A 3WVNA 3T3DA 4H6PA 1U9YA 2HA7A 3X43A 1TA0A 3CUEF 4N54A 2O3UA 4IGEA 2J08A 1MC1A 3KJEA 3N0TA 1SXJB 1F20A 1PX2A 3T15A 1YBMA 1M1XB 3UWKA 3GLUA 1PZMA 4E3ZA 5EQTA 2PRKA 1ZBQA 1X7HA 1R7RA 1Y5LA 5IK2A 4IV5A 5GZ6A 4KXLA 2UZ0A 3ZGOA 5B58C 2XUIA 4NZNA 5IP5A 4BNYA 3H4DA 5FL3A 1KEEB 3IEUA 4UOZA 5BVGA 4RAZA 2R4UA 3F9RA 2Z2JA 1PNQA 3DOHA 3KVYA 4P32A 1ZQ9A 2WIKA 1UOOA 2W6MA 4B79A 2CUTA 1X1RA 1X80A 4RJ2A 1RJEA 1KO4A 3HZRA 1TQ4A 3RD5A 1NNLA 2YFQA 3QM1A 2V6IA 1YK1A 2VC2B 4HVCA 1EG2A 2QVZX 1WMBA 5KFDA 1AY0A 3AK4A 1GNRA 2IYWA 1YI8A 2YXEA 2D1FA 4D3ZA 3LU1A 5I51A 3SLGA 1GA6A 5DT2A 1XZAA 4CM5A 5KIAA 1VIVA 2DSTA 3IOCA 4WAUA 4HMOA 1PHRA 3FVWA 2JLYA 2JI4A 2C5FA 1JSXA 4FQ7A 3DJYA 4YT8A 4OQLA 4IXWA 3DTFA 2EG9A 3T34A 3VYTB 1K1EA 4F21A 2O2JA 1O95C 1DKUA 3HDHA 1MNQA 4IW3B 3BIWA 3EAFA 4K0RA 3E5RA 1NUTA 2IEGA 4F5EA 2FWBA 2V45A 1TVEA 2ERYA 3EH1A 1PS0A 4BY9E 1KO8A 2P77A 3ZI7A 3MRXA 1WF3A 1F6BA 3BQ1A 2X7HA 3S27A 4BO8A 5GM1A 3VR6A 2GASA 3FETA 1HZJA 4ZA2A 4XRRA 3KYJB 3SEZA 1IU9A 1FRFS 3NJ4A 2DHDA 3KDAA 3B5EA 2CNQA 4LQDA 1NG1A 1JR3A 5AK0A 1SXJA 3SR3A 3DXZA 5EDWA 1S4MA 3BDAA 2H06A 3KXDA 4EELA 5KFRA 3A25A 3COWA 1IYDA 4V0RA 4PO9A 1DQYA 3M4XA 1RHJA 1OIWA 1XALA 3QKRB 1VI6A 3IODA 1GG9A 5K45A 1H94A 3KTFA 1PGPA 2GN6A 1HYEA 1SUIA 4F4UA 4PPQA 2W90A 2GCNA 1RRMA 5IT4A 4P2GA 1VAJA 1Y8QA 2ATLA 4UM9B 4Z9YA 3K94A 4YN3A 4TYYA 1DAOA 2PZEA 3FWYA 1DELA 2HA3A 3C48A 1GIAA 1ODCA 1S1CA 1ARZA 1RW4A 1QHEA 4TKVB 4GLJA 4B6QA 3KYCB 3OWXA 1TM4E 1C7EA 5DGBA 1ODLA 2I03A 5IF9A 1SD1A 4NEQA 3KQWA 4O3QA 1XTJA 4WKBA 2LKCA 3TD2A 1WDTA 2BEVB 4AIRA 3FB1A 3PQFA 4K8OA 4U0JA 3CNOA 2XX3A 3L82B 2VUMA 4XKJA 3LJKA 4JLPA 3CHYA 2VBCA 3CR8A 2HRCA 2FLKA 3G17A 4X94A 3D43A 1AC5A 5DN6D 1IN4A 2X86A 4FKBA 2CLOB 4Z0HO 4QHYA 4BDSA 4KR2A 4NQZA 4LCEA 4ONEA 2VA3A 3WGOA 2E21A 3DE7X 3O8OB 4Y2YA 3LDUA 3GLKA 4MRPA 3EGIA 2RAFA 2X2OA 5EMJA 3TL3A 3LLUA 1XJ0A 2GZRA 1KZ6A 4WLOA 1IQRA 2J6TA 4RQTA 3TZ6A 4FCCA 1AB6A 1P1CA 3DVQX 5FYDA 3KTAB 4B84A 3IULA 4WZZA 3IPAA 3ZWKA 2V7WA 4PQFA 2RONA 3ASZA 2RSLA 1Z37A 2NZJA 4NXNH 2VA9A 4JT8A 2C42A 2UUCB 2G3YA 2IFTA 2VWPA 3LY9A 3KQLA 1OX4B 4EL0A 3GDEA 4Y2UA 3P9YA 1U0HC 1AQUA 3M5DA 5LC1A 4G5XA 3NRBA 4R9UC 5FOWA 3VVCA 3LS2A 1MJNA 2W2TA 4ZXPA 5DLYA 5G1NA 1RU3A 3VU9B 4HEA1 2AU0A 4G4IA 4FONA 2VCHA 1DP4A 4JROA 1XRRA 4N0PA 2DH6A 1IM2A 3T5MA 5KFJA 3GA7A 1L4NA 1P2UA 1UC9A 2YIMA 1HNNA 1ZZGA 3HJBA 2H1VA 3I05A 2DERA 4S24A 4TKVA 5KFYA 3D6AA 4II2A 4MKRA 3DOOA 2FUCA 3E7PA 1F5SA 3U4MA 4W5QA 2CKMA 2ZYRA 3LUJA 2VTBB 2BEVA 3QZ7A 1RSZA 4ZT4A 5M04A 1EP2B 2I4MA 3R6GA 4WHMA 4GZ5A 4EJSA 4QG3A 2AG6A 4DMHA 5B7PA 2G6BA 3PGXA 3BL8A 1O8BA 1Q14A 3B9RA 3KB8A 3DLHA 4YRLA 4HCJA 1J4AA 3PQ5A 4L5CA 5C52B 1BVHA 4PYLA 4JVOA 1ZR2A 1GTVA 2C0PA 1AKWA 3O8OA 4RF3A 4ESHA 3QEOA 5KNCD 1HT2E 4IUCS 1UC8A 4AU1A 4TV9B 2YFYA 2WTEA 2FFJA 2VUMG 2WMNB 3RYCB 4CR7A 1RQPA 1XZFA 3OQIA 2FVYA 3FNRA 4ZCIA 3E2MA 2R6ZA 3UFXB 1PFGA 3DMDA 3Q85A 3NXSA 3KOWA 4GFDA 2JFYA 2AWNA 5EWJB 4N47A 3BGIA 3KTAA 1J90A 2ZJAA 4TZ0A 1CKNB 2XVMA 5CPFA 4XVUA 5KFUA 3AB3A 3OF5A 5KT7A 4D46A 2ASEA 2PWYA 4CBVA 4RDCA 2R6JA 4E4YA 4I55B 3KELA 2JJQA 1NNEA 4LJRA 3A9WA 4YUWA 2IUEA 1A0IA 2EFGA 5TY0A 1QO7A 3T5CA 4C1BA 4RY9A 4C5AA 1YQ9A 4I4CA 3SNHA 3HVUA 3QKIA 3ZDDA 3TE6A 4HZUA 3LP5A 5EWEA 1QGED 4P4TA 5C46F 4M1WA 5F73A 3HDJA 4RVHA 5HXAA 3GTGA 5KPDA 1U2SA 2COUA 5C31A 4F45A 1E2HA 1DV1A 3BCSA 2EX1A 4AY6A 5A06A 1RCFA 4RQAA 4K0KH 2CFOA 4JP1A 1UKEA 1C1DB 3CSWA 5HS4A 1ORVA 1S9FA 4PG8A 3UGKA 1ZS9A 3PR2B 4DQUA 1W5FA 4BO7A 3IEXA 4IDQA 4C29A 4B2IA 3O2QB 2VTBA 2B4TO 4UPVA 1ULZA 3EG9B 4JI5H 1U9CA 4BYMA 2DCUA 1AV6A 4K03A 2DLCX 1UJCA 1TJNA 2MSEB 1WPGA 1ZD5A 3R7WB 1DADA 1VBGA 4HH0A 5DM0A 3TGWA 2RFLA 2SKDA 3TW8B 2CD9A 3BHJA 1ZI8A 1SYXB 4IIBA 5KNBH 4C21A 1SHUX 5KDOA 4K9SA 1JQBA 4DLYA 3RHTA 2R7NA 1JDTA 2XWJI 4FDVA 2XWSA 4R5HA 3QFRA 1GL3A 3RYCA 3AW9A 3VMFA 1X9GA 3JASB 5AKEA 4EO9A 3R6LA 1SHZA 2W2MA 4M8KA 4U7HA 1O0SA 2XA2A 2RGCA 2PV0A 3UFXA 1FVIA 3IPCA 1PW7A 3RVJA 4DA4A 5B1DA 5EWJA 4ODIA 4YV1A 3L05A 4G1FA 1CKNA 1KPIA 5J4YA 1BFUA 3WIEA 5CTAA 1AN0A 3EFBA 4TGLA 4TMWA 3OFVA 4XCXA 1MH1A 2A0XA 4FD2A 2ETXA 1JI3A 4ZI7B 2XGMA 1T9DA 3NGXA 4PG5A 2AF3C 2YRXA 4AICA 3ETLA 3A3OA 3GNSA 4BOYA 1RYYA 4BVBA 5TMDA 1ISHA 5JVDB 1R18A 5JVLA 2J09A 3T41A 4FFOA 3Q8PB 1PJSA 3EODA 3RTBA 3M5PA 4L95C 5K3SA 1P4JA 3CGWA 5IC5A 2PT6A 2KS6A 2QENA 4WGGA 3BRWA 2CFRA 1EDZA 4B6RA 3RO7A 3CJQA 3QVVA 3OHSX 3HFJA 1PWHA 4WNIA 4JLAA 1NUUA 1K6JA 2XB6A 4ZHSA 1C1DA 3RNOA 2B1IA 2YNMC 3L92A 3GTPA 1RM3A 5EIXA 3M6VA 3P19A 3AEYA 2NUBA 1V3UA 4GPAA 3BERA 3F2VA 5DTQA 5BVHA 4X92A 1KK2A 3QYPA 2WB2A 3I76A 4B3CA 5C4XG 4BQQA 3EG9A 5A4JA 5IVDA 4IXMA 4I1IA 4J6FA 4K9MA 1V47A 4WLFA 3FDXA 2FZ5A 1MQ8B 1Y8RB 1PWZA 3R7WA 3GDHA 4K9DA 2QI9C 5CCXA 4XLLA 1R8YA 3V1LA 3HWRA 4LXQA 2I4TA 4GZ3A 2B25A 1ZOIA 3RIMA 2HCTA 3L1KA 5BR7A 1Q16A 3GFTA 1T4GA 3PUIA 1ZD8A 4OB7A 1OU0A 1ZK3A 3KHKA 4X95A 1Y9ZA 5HFAA 1NN3A 1Q2XA 4KE9A 3EEBA 4HYEA 1EVIA 1M1UA 4N7JA 3K4QA 3IMGA 1KBOA 1ZJ4A 1ODTC 2O59A 4FZVA 1VKHA 1ZA2A 2V7EA 4ARZB 5LA6B 1E89A 1K4KA 3W4KA 3V2HA 1GAQA 1KJWA 2J5KA 2PXHA 3ZEAA 1SVWA 1X94A 2OB1A 5I4BA 3MTEA 4FK8A 4LJ8A 4C4RA 4TYPA 1P8LA 4D25A 5D1PA 2ALZA 2RHTA 5CH3A 2VUIB 1ZK2A 3IUEA 3L0PA 3QEMA 4XYEA 4ZI7A 1SZPA 3KQUA 4FFPA 3JAKA 3PLRA 3Q88A 3O26A 1SVMA 2RCYA 2IL1A 3IUBA 4RWEA 1A7KA 2IODA 2QX4A 1IQPA 2X9QA 4FCWA 4RTPA 1L7EA 5JG7A 4IGAA 1VKRA 4Q9LA 1ORHA 4OMUA 1GUAA 1GGFA 3TOVA 2C9ZA 3TZCA 4AQDA 3JU3A 4J75A 4BL5A 4GQBA 2CNWD 1QR2A 2E5WA 5DX1A 5CP8A 3GUHA 2XCUA 2BQRA 1Q19A 2YYZA 5KFHA 1TKCA 4R7ZA 1T0JB 4G0MA 4CT4B 1Z17A 2Z8YM 2JHGA 5DYIA 1QNLA 2ID7A 5HQ3B 3BDVA 3IBYA 3DVSX 1GGNA 2FZCA 1M8FA 1H4VB 5E6RB 4OJMX 3BE4A 1C29B 1PD0A 2C2HA 4JY7A 5FA6A 2VPPA 3ICVA 1Y8RA 4XW2A 4KB5A 3B53X 1ZBDA 4JUIA 4UUPA 4OCZA 1UT8A 3DHYA 3KJFA 3W0LB 2HSDA 1MT3A 4CMDA 4TSRA 3OOSA 3OSNA 1T6YA 3MJHA 5HDBB 4P35A 2QE6A 4DR7H 4BX3A 5LQDA 2QD1A 1NN5A 1BX0A 4C06A 1G8KA 2VRNA 3CLRD 1Q0UA 5EYPB 2QN8A 5LMNB 4FUTA 3HBNA 1FJHA 3HABA 1TTPB 3NIDB 2IEDA 5JAUA 3EZFA 4ARZA 3F6BX 4LSMA 4TVOA 2FZEA 1YDMA 3OP4A 1U02A 2ZATA 3N8KA 2VA8A 3RTDA 1JQ5A 5INTA 3TTWA 2PV7A 4P33A 4TV9F 2CNWA 3UNXA 4YEDA 3EDYA 4TWBA 1G59A 2YJGA 4PLFA 2CKDA 1SC4A 4BVHA 1ZW1A 2JASA 1QHGA 3Q5GA 4HB4A 4A8JC 2ZR9A 2VSXA 3LK6A 1CQJB 1E2KA 3W8DA 3M9OB 4ITRC 3UAZA 2R0QC 2B1QA 1EAYA 2AFHE 2FPWA 2OORA 2EGGA 2HWUA 4OI2A 3JSXA 3M34A 5G2OA 3QP9A 3R2JA 3PJDA 3VVLA 3UAVA 2EKQA 2L17A 2VYVA 1FTWA 1T3HA 4C4PA 1YRQA 3F1KA 5H16A 5BRAA 2C3UA 4UU7A 1UXHA 4JLJA 4EYEA 2HJVA 4F9FA 3V8VA 1TUEA 2NPIA 1VYTA 4JV0A 4ZZ1A 3U1TA 2ZPTX 3G0IA 3K6RA 2DUWA 2R25B 4XX0B 3UHFA 2PSEA 3RBXA 1M9NA 3NHWA 2QVYX 1YQXA 2AGVA 2GJAA 4PNPA 4PAQA 5HQ3A 5HF9A 1W4LA 2O14A 2Q46A 4C4OA 1KI9A 3GEPA 4IMIB 4G26A 5JQGB 4R8MA 1FS5A 1FEZA 3IQXA 1QH8B 2FPIB 5E6RA 3VR5D 3U81A 3IMCA 2GJ9A 4HB3A 5LBIA 1U3CA 3ACBA 3TSAA 1ZHSA 1FTSA 2A0YA 2YL2A 2RGWA 3VVBA 5AHKA 2X19A 4DM4A 2WJVA 1ZXXA 2O05A 2C2RA 2QLBA 4QOEA 4QGAA 2YVQA 1H1LB 2P3QA 2WUEA 5L3ZA 2ZI9A 1E94E 4OSPA 4QLOA 1IEWA 4K28A 2BFFA 1NULA 5K8LA 5JFOA 3SHOA 3SQWA 5CX4A 3M4ZA 3JD1A 5DM1A 4QXRA 5EYPA 4C7MA 3SVZA 3KQSA 2BKEA 3GK3A 5JU6A 5HKOA 1N48A 1MB4A 3QITA 4IHJA 2VK1A 1LFAA 1TM2A 3ONVA 5F9HA 4KDCA 4BWGA 3OHAA 1S1MA 2W6PA 3T7RA 5JAZA 1A2OA 2OP1A 1UIRA 5TARA 4FR5A 1L4EA 1M0SA 3R5JA 3OP1A 2XJ4A 4JJKA 1GCUA 2E7ZA 2WJAA 1KJNA 1HNWH 4DMFA 2HIXA 3SVLA 4BQEA 2Z3ZA 3SNOA 3QE4A 4MUFA 2RMKA 1CQJA 1BEEA 5ADUS 1KT8A 3F2IA 1LPBB 2VVTA 2DECA 2P6NA 3RARA 3PFIA 4P7KA 3VO8A 2B6HA 4WKGA 4GPBA 3X1YA 1SU4A 3C74A 1GN9A 3WGZA 2HMTA 4HAUA 4DT1B 5I5WA 1J42A 1ZG3A 3L46A 4ZI7F 1JX6A 4QYWA 5L40A 1D1QA 4KNYA 3PPVA 4FFVA 4XGRA 5FWNA 3OZFA 1EM6A 1J0DA 3R23A 4JYPA 2ODBA 1ZAKA 4MOWA 3U55A 2E49A 3LQRA 3IUPA 4XX0A 1KFEB 3VSAA 3T3GA 1C0EA 1O6GA 2R6AA 1DJOA 3AI3A 4WD3A 1U1CA 2OECA 2WICA 5JQGA 3QQPA 1OXBB 3IG0A 1QH8A 2FPIA 3CRVA 2NUAA 3WWYA 4V0OA 2PJDA 1TM7E 2XUQA 1II9A 2P9FA 2C3YA 4E2XA 2EL7A 4JFRA 2HI0A 4ME6A 4L85A 1WU7A 2X6RA 3FCAA 1HQDA 4NBUA 3N5KA 1YR9A 1GCIA 4FI3F 1RXEA 1XNQH 4CE5A 1KFCB 2ATCA 3FYDA 3H2IA 4ZAGA 1W87A 4PO3X 3WV4A 1ZU4A 4QOJA 1U5AA 2GNOA 5IYZA 4GE3A 1BE8A 4P7BA 2WP0A 4M9UA 4YDRA 3JQFC 4I7EA 1NXOA 3RRNA 4Q9JA 1KP2A 3EXAA 2VRCD 5B3LA 2YU9A 4BQNA 2IIBA 4HATA 4GMKA 4IJWA 5TPWB 1TYCA 1U7WA 4XPZA 5IBQA 4ED3A 2X0IA 2ZDHA 2DHCA 4YHBA 4I9GA 3EZ2A 5K3AA 3RR5A 1B0ZA 3F9CA 2V58A 1DCTA 2C77A 1D3AA 2A9OA 1B8PA 1FNDA 4YRFA 5D00A 4I5GA 3CH7A 1Z15A 1UP4A 3FVRA 3W2FA 1L5VA 4ITVA 1PZFA 1X8LA 4Y2JA 4IDOA 3OHPA 2OENG 4DT1A 1MO5A 2GGSA 1OH6A 3FOFC 4Q03A 4QGGA 3HCEA 4IOLA 1M33A 1R0WA 2KPOA 2F90A 3EVEA 5HFJA 3M6FA 4I5IA 2O0HA 4WW0A 1ADYA 5AVUA 1AMNA 3GLGE 2BGUA 3ZI4A 4FE7A 4O2LA 2ZRFA 3N5CA 4JJGA 3PXUA 3DLTA 1N3IA 5AHOA 3RSCA 1RIFA 3IP3A 2OFOA 5LYYA 2ZXFA 5AXDA 2GK3A 1Y1KE 5J9FA 1YIDA 4YT5A 5KOYA 2Q1XA 1OBOA 1GZ7A 4Z7NB 2LCQA 3S8EA 3ETJA 3WK6A 2IXGA 4DQNA 5JI2E 3DAOA 1QXSA 2VSNA 5ALZA 2PG3A 5CT4A 5KJFA 1TCVA 3HXKA 2O2EA 1VIMA 5HIJA 3GUCA 5LQCA 1OZFA 1K9VF 5C37A 3PXBA 5FPPA 2G07A 1N3YA 2PKQP 1ZNWA 1XMOH 1HE4A 2WSMA 1KE1A 1JJ7A 1GQOA 4HDRA 4G84A 4XB1A 5IDQA 3IKVA 4X93A 5HYVA 3OF3A 4LDPA 2ZUSA 1B73A 2FW7A 1NA5A 1U3GA 1CIJA 5LU8A 1RJPA 1W9MA 1Z0SA 4GXRA 3OX2A 5F9FA 3GUYA 3NONA 4MKHA 4GD3Q 5F4BA 2J0UB 3QELB 1A71A 1QJCA 1KVTA 5J3JA 2IYPA 3E5HA 5A1JA 5KJEA 3NBZC 2C1EA 3PTLA 5IWAH 4XDGA 2JH3A 3E22B 2X0EA 1P2VA 1SC3A 2IOFA 3QU2A 2LDBA 4O0MA 1EAMA 4IHJF 3GMDA 5LXTB 1YBAA 4M98A 4GWKA 1EP3B 2W2LA 1QDUA 2WIBA 2ZK7A 4ED0A 4O5OA 5I5YA 3UMGA 1KRWA 4G65A 3DAAA 4LDAA 1A9PA 1GSOA 1U7PA 2BHNA 2EV9A 1Z5VA 1FMLA 3WK7A 1L5QA 2B37A 1B3BA 3FNQA 2W9BB 4A3FG 2ECOA 2YIJA 4RIEA 3PSAA 4A27A 3AUFA 1Z4LA 1TC2A 5EUMA 1BJTA 1XKLA 4AX4A 1DBWA 1A9SA 1XEFA 4GIBA 1XELA 4CTKA 1WOMA 4K6FA 1Q3TA 1S10A 4G97A 3WHLA 4E1AA 1VGQA 1GUBA 3J81A 1ACMA 3ZJ4A 3DDUA 4LHXA 3VU8A 1YS1X 3P0RA 3W2EA 4MPDA 1Y6FA 3C7DB 4L50A 1F8GA 3RRJA 2D54A 3C3XA 3ASUA 1R0SA 3FIJA 2FKLA 1L4GA 1XSEA 2J33A 1WB9A 5CJPA 4EBEA 3OWHA 2OGZA 1CP2A 3RU7A 1X86B 1GJRA 3KFVA 3D8TA 3B7PA 4DCPA 4D4JA 1HYGA 3IDZA 1V5IA 4IVRA 4GX1A 5CFZA 3PYLA 3K70C 5JQGF 1W2WB 1XPRA 1SULA 3ZU6A 4XYMA 1VCNA 3QKUA 2QRVA 1Q57A 1S0UA 1OF1A 1SXQA 5TT0A 4ZREA 3Q8WA 2RGRA 4UM7A 1ZK0A 2EL9A 2QRQA 4WCFA 1VJCA 2C94A 4TTPA 4HADA 3PW2A 3E9EA 3O1IC 4JWTA 4B3FX 4MI9A 4UUMA 4G1VA 2WDPA 4PTZA 1LW6E 2J0UA 3QELA 2XE8A 5TPZD 1MB0A 3BBLA 2NU9A 4LA4A 1XZNA 2H92A 5E3JA 2Z5LA 1NQAO 1PIWA 3HM9A 3BJEA 2YYAA 3H2JA 1OLUB 2TMGA 2GK6A 4RGYA 5IYZF 4K05A 4NCAA 2PX0A 3E22A 3BCHA 3DR5A 4LJSA 3CVYA 3HU1A 1V1JA 2X2PA 1JEAA 1REQB 2YWFA 1CVLA 2FOLA 5LXTA 2G5TA 1KGSA 2HK7A 4UD2A 3H6KA 1C3JA 2ZBRA 3I30X 3TRDA 4A5OA 2HLDA 3JPWA 3RU2A 1W35A 2ABWA 4FR2A 4YX9A 4WRRA 1ZRMA 4V3BA 1RBYA 2W9BA 5A7FA 4E6PA 4YTEA 2WJJA 3GUZA 4JLVA 3RVBA 2J41A 5CCBA 1FLAA 1YBHA 4LF4H 4B3GA 1V43A 3PT9A 2CNKA 3DQPA 1LDGA 1E2EA 4MB6A 1OLSB 5JCJA 4QZVA 1Z2AA 2ZQ5A 2G1KA 3AY6A 1XJWA 4FE3A 4PGAA 4DKJA 4BP8A 3SLKA 4S1OA 2O3TA 4IGFA 1CJCA 1W5EA 1J9ZA 2JGEA 1TW3A 3LFUA 4AP9A 4AX8A 3CQZA 3KM0A 4B8YA 3IMFA 5TPZA 5JWOA 1UKAA 2GDZA 4BZZA 3WKDA 4JZKA 3GIQA 3TTSA 2R8KA 3EOAI 3OEED 1WZIA 2NQTA 2AVDA 1DEOA 1Y42X 2V6GA 3OOJA 4BDTA 3R9XB 3MRVA 4CIYA 3G0GA 4KKVA 5TEWA 4H7EA 2P0AA 4MPRA 3DF9A 5K0BA 2NZ8A 1OFUX 3JARB 2ENWA 1UANA 4KQCA 1DBRA 1NBMD 5AESA 1Z7EA 3P0IA 3N0RA 2CNUA 2PGLA 4UCRA 3ETGA 2G0AA 1JG6A 2HREA 2Y4RA 4W4TA 1KRXA 5E25A 2BR4A 3UCEA 5AUPB 3I9KA 3VNSA 1RP7A 2DFPA 3MAGA 2W6ZA 1OLUA 1THZA 3ECCA 1MMFB 3ENQA 1NSFA 1REQA 1XVVA 2XVYA 4L0CA 3THWB 3F1LA 5T64A 1J9GA 2GYWA 1RI2A 4RSRA 4RL6A 5E2AA 3R3UA 3KWFA 2QLMA 5DSTA 3H9GA 4NDNE 5CK5A 1ZKMA 4GZ6A 3BQ0A 1HFJA 2D7CA 1FUYB 4YRQA 4ETIA 1CKMA 1IY8A 3F5QA 5HTOA 4PZCA 3GILA 3CN9A 3I4LA 1OLSA 4CYMA 5C32A 2WQ6A 5EOVA 5CAEB 1BU8A 4NFYA 1M2OB 1ZNYA 1M6NA 1PDVA 2O2ZA 4MYTA 4DCUA 4BFTA 4YS6A 1ZSVA 3T1YB 2QPTA 3PKJA 4M54A 5FB3A 2G6TA 4GNRA 2IU0A 5F9LA 4Z4IA 3U3ZA 5IRCD 5CD1A 3B82A 1CJKC 1Y8ZA 3G82C 3V3KA 5DYYA 5KFSA 2GILA 5BN4B 1QYWA 4QT4A 4L3OA 3AQ4A 1G3RA 4Y67A 3HYNA 1RAGA 1QHYA 4BLQA 1QRRA 4A23A 2Q41A 1SQFA 2ORWA 5JCPA 3AI1A 1UXJA 3C1OA 4J9VA 4LF6H 3ZDXB 2VAVA 3JARA 3G8CA 4AO8A 5CB8A 1NSTA 1YC5A 1A76A 1DUSA 1JGTA 2JI6A 5F7ZA 3DZKA 1AO3A 3D02A 5CLGA 3AEZA 3KOYA 4OJNA 1V3TA 4UQPA 3H17A 2P4HX 3ZBQA 3TIGA 3EBPA 1GUFA 4YWHA 2H2IA 2C28A 4NNPA 1BS1A 2C2BA 3HOVG 3H3FA 5C4IA 4KITB 1RM0A 1Y6RA 5L1IA 1LGYA 3FOAA 1TZCA 3RROA 3HLTA 4ZAZA 1Y3BE 3AHCA 1A69A 3E9MA 4UXHA 4PO1A 3GNQA 2DULA 2FK2A 3PXGA 3THWA 1UDWA 4KODA 1BHJA 1YZHA 3GCGA 2BI8A 3H4BA 4A3CG 2ZAIA 5IM5A 5J59A 4BB0A 5CVTA 5I9LA 1O3YA 3T5PA 2P2ZA 4AMYA 5E1DA 5DB4A 2Q3BA 4YRGA 2QG4A 3OTHA 3F74A 5JD5A 5KS2A 1P4GA 5LXTF 3GOQA 2PUCA 1FSFA 3DT8A 1A9ZA 3BWYA 3ZU3A 2QORA 3U5TA 3EPJA 4L9RA 1E2DA 1YZYA 4PQGA 3QXHA 2P7IA 4DMCA 4F1KA 2IRWA 4B7AA 5CAEA 1HT1E 2JGLA 1AB5A 1M2OA 1E0JA 1AUQA 1AJEA 1TPYA 4KR9A 4I1SA 1X80B 1FPQA 3WL4A 1XMJA 3RLIA 1E5XA 4RMIA 4BATA 4C20A 3DLCA 2CN1A 4EPVA 2D8AA 4BBPA 4EA8A 2FHSA 3ZVRA 3JQRA 1UH5A 3H2KA 4LYYA 3V9AA 1VC2A 3LNTA 1DC5A 5KSYA 1E7YA 4QOIA 3ZWCA 3NBAA 1VLQA 1Y6ZA 2OVBA 3TLCA 4TS4A 1SVIA 5C5EA 3MHTA 4F2DA 3DV0B 2H6EA 2O3RA 1W1WA 1C7FA 4Q21A 1OVMA 3ESRA 2A0UA 4G1EB 5BNZA 3H6HA 2BISA 1ZJZA 4EG0A 1LA2A 1V1RB 3A04A 4DPKA 3IIJA 3F4LA 3PGVA 4FYHA 3NNNA 2YW2A 1CZKA 2AFIA 5IHXA 3V6KA 1ENOA 1U0OC 1VSUA 4WNCA 3TVDA 2RHMA 2H7YA 4J4HA 2FETA 2A1TR 1Q95A 4ABTA 4ZV9A 2JLXA 1G6Q1 3CUWA 4JYMA 2F9LA 3AL3A 3QJ5A 1QYDA 3VFDA 3Q0IA 5E0KB 2XGGA 5I7RA 4AS2A 2ZETA 4QU0A 3E1GA 4P4SB 4GLFA 2WQ7A 4NPHA 5LQSA 4M0KA 4Y0NA 3PVSA 4RU9A 3LCJA 1XRJA 5JTTA 1E66A 4NABA 1Q1BA 4M7WA 2B2CA 4L0DA 2Q3HA 1V6AA 2H51A 1QO9A 1VTKA 3NGDA 2D1QA 1JB1A 2WKPA 2WPDD 4E21A 3U7EB 1K7SN 3L0IB 3DXXA 2BMDA 3IESA 1L4HA 3I5AA 2PGNA 1TZKA 5BXQC 4M53A 3RUFA 4LF5H 5F1YA 2IWRA 2D7JA 3F4KA 4YRBA 1S8NA 3E7WA 5TGTA 3B1YA 1KMQA 1M34E 2FSPA 4JSTA 3BXZA 2HQSA 1UAAA 2FEPA 1Y8QB 4BN5A 2F3RA 3H9QA 2PUDA 4AJJA 2XWPA 5LWQA 3DBHB 1UBUS 1E5QA 4NQRA 4DV4B 3MCUA 1HO3A 3B1JA 1X0VA 3Q7SA 3OOEA 2HU5A 2XAUA 4F1JA 2QEQA 5BQ5A 1AN9A 3GLFE 4H35A 3MCTA 1EFRA 3C87A 2FR1A 1WR2A 1GPUA 3U3MA 3C85A 3DV0A 3OIUA 1L4FA 3VPFA 2HBQA 1KP9A 4FYJA 2AK2A 3RT7A 3RV4A 1V1RA 4WOPA 1VYVA 2CXOA 4RHXA 3IT1A 4CU2A 3GGGA 3GVHA 4YRIA 4JX9A 4INOA 5FNZA 3RLFA 1CBUA 3EDQA 4J7XA 1JU9A 5F2OA 2XI4A 4PC7A 2COGA 2MCFA 4RS4A 1S7GA 4C4AA 1LWNA 3I5XA 1YIOA 1PR3A 2W8KA 4LH6A 4PC3A 4RYLA 1Z2EA 3ECAA 4P4SA 3PDUA 3CPEA 4P3PA 1UMDA 4WXMA 4DS3A 4RDHA 3EXEB 4D3FA 3L2PA 2VHZA 1R0XA 4O63O 4RF2A 2X5XA 3JYNA 2KYRA 1F7UA 4YMWA 4TMVA 1O4VA 4AJLA 4RORA 4RB3C 2AN4A 3ROPA 1TMKA 3ZLJA 3V42A 1P19A 3EULA 5AVWA 1WCXA 4W8OA 4CMAA 4E0BA 5BQXA 4DDKA 1M83A 2OBMA 4V24A 2ZOSA 4P0QB 4BV3A 4ECWA 4QUJA 4AMUA 1QFXA 4TTAA 4E07A 1Y1VG 5K20A 4G89A 1Z07A 1JA0A 3DE1X 1XV5A 4PZ0A 1HDIA 3SZOA 3GFFA 2Z8XA 4X1OA 2XMPA 2LXNA 3DFZA 2PMBA 1KSGA 5AKYA