3R5XA

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
302
Chain Sequence
SNAMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis complexed with ATP
rcsb
source organism Bacillus anthracis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 84
structure length 302
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r5xA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r5xA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r5xA01
4O2AF 4MA0A 4O7WA 4YJ2F 4FFRA 4EGJA 2R86A 4O81A 2Z02A 4MV4A 4C5AA 4XYLB 1UC9A 4C5CA 1M0WA 2FPGB 2W6NA 3JRXA 2VR1A 1KJIA 4TUYF 5CA1F 5EZYF 3G8DA 4O4JF 3ORQA 3V4SA 1WR2A 2YZLA 1GSAA 2PBZA 3LP8A 4IZOA 3VPDA 2YZMA 2GLTA 3HBLA 4EAAA 1VBGA 2NU9B 4IWYA 4O7LA 2R85A 3HO8A 5J2TF 5GONF 3TIIA 3RV4A 2YYAA 2YRWA 1E4EA 2W6ZA 4EA9A 4FFLA 3ETHA 4FFMA 1IOVA 3MWEA 4DLKA 4HNUA 2YZGA 2I8CA 4MV3A 3BFPA 4O4LF 2CNUA 1EZ1A 1ULZA 3NUAA 4EABA 3TQTA 1DV1A 4ZI7F 4HQ6A 1KC7A 5DMXA 5C1PA 2IP4A 2PN1A 1JDBB 4C5BA 2R87A 4O83A 5IYZF 5KX5F 1DIKA 4TV9F 4O7SA 3JZIA 3U54A 3K3PA 3VOTA 3JZFA 2VHEA 2CZGA 2NU6B 3BG5A 3G8CA 3VPBA 1Z2OX 1E4EB 4O84A 4YBZB 4QSHA 3U55A 3WO0A 2YWVA 3K5IA 4O7NA 4O7TA 2FB9A 3AW8A 3KAJA 1AUXA 4M98A 3TINA 3TIGA 1A9XA 4M9CA 1JDEA 1I7LA 4O7YA 1EYZA 4IIJF 4MV8A 4HNVA 4O86A 4XYMB 5HV6A 1CE8A 2WYOA 1C3OA 1T36A 2PVPA 4L1KA 2I87A 1BNCA 3KALA 1BXRA 1W93A 1GSHA 4WD3A 5LP6F 2QF7A 2GPWA 5HBRB 3OUUA 1CS0A 3KAKA 2YL2A 4O7RA 4ZHQF 3QFFA 3UFXB 2YZNA 2YRXA 4XX0B 4MV7A 4MV1A 5KKNB 4DIMA 3VPCA 1JKJB 3R5XA 2V5AA 3BSSA 2V58A 4ME6A 2SCUB 2OLSA 2HGSA 5JH7F 1B6RA 4I55F 1EUDB 2X0SA 1C30A 3Q1KA 4FE2A 4ZQIA 2CNQA 3SE7A 4YJ3F 2XCLA 3BSYA 5CAEB 2R7MA 1VBHA 4FFNA 3RUPA 4I4TF 2CNVA 2W6OA 5LOVF 2HJWA 4EA8A 1GGOA 2R7KA 4HNTA 2FP4B 4YAJB 4RZQA 1W96A 5H80A 5BMVF 4FFOA 1KJJA 2R84A 4O4HF 5JQWA 4O4IF 2VQDA 5JVDF 3U9TA 2GQRA 2YS6A 4FGRA 3U9SA 1KUTA 2NPOA 2W6MA 1CQJB 2DLNA 2DWCA 3I12A 3OUZA 1Z2PX 3JRWA 5I47A 1OBGA 1KJQA 5D8DA 3E5NA 3WNZA 4M9UA 5J2UF 3TW6A 4WBNF 1PK8A 5BPFA 3R23A 2DIKA 4ZOLF 1UC8A 4Y8VB 4EGQA 2VPQA 3R5FA 1M6VA 4M99A 4O7ZA 4GGMX 2ZDGA 1KEEA 3HB9A 4FU0A 1A48A 3RV3A 3N6RA 4O7VA 4IWXA 1VKZA 3AX6A 1B6SA 3BSWA 2J9GA 2I80A 3ORRA 3R9RA 4E4TA 4I50F 4MAMA 5FNVF 2GQSA 1EHIA 2R7NA 1M0TA 1OBDA 4IHJF 2ZDQA 5CB4F 2R6FA 3WO1A 1JLLB 2W6QA 1EUCB 3MWDA 2YS7A 1KJ9A 3K5HA 4YB8B 4FFPA 5BPHA 2P0AA 1Z2NX 4EG0A 1KBLA 4EA7A 1CQIB 2YW2A 4YAKB 3N8DA 3Q2OA 3RFCA 4J6EA 2CQYA 2R82A 2V59A 5CA0F 5K2MA 2NU7B 4O82A 1I7NA 1SCUB 2DZDA 4MA5A 1DV2A 4HR7A 2XD4A 4MV6A 3LWBA 5C8YF 2NU8B 5JQGF 2W6PA 5LXTF 4TV8F 3MJFA 2NUAB 4MV9A 3DF7A 1GSOA 2FPPB 3R5HA 5LA6F 3GIDA 3KREA 3VMMA 4O2BF 2W70A 2QK4A 4XZ3B 2ZDHA 5JVLA 3V4ZA 2W71A 3ETJA 2FPIB 2C00A 1IOWA 5LYJF 3VA7A 1AUVA 1KJ8A 4NYEA 5C1OA 1PX2A 1GLVA 2GPSA 2R7LA 2Z04A 3GLKA
chains in the Genus database with same CATH superfamily
3CZ5A 3A9WA 3AKCA 1G2IA 1XCMA 2R65A 2WILA 3D8RA 2F1HA 4OQZA 2M6KA 3ZD8A 4CMKA 1MT3A 2HSZA 2JJ2D 3A6GA 3STVA 1LC0A 2EJBA 2WW8A 5FNVB 3TUIC 4WZAA 2A6PA 1CUYA 2H1LA 4YT4A 1XK6A 1P9RA 3HEMA 2EHDA 2VI5A 5ICSA 3CMCO 2UXDB 1YUMA 2DBRA 1J0XO 2IODA 3HB5X 3TB6A 5BVHA 4ENRA 1JG3A 4F8YA 5C32A 1KEKA 2FOLA 4Z99A 3MEQA 4DR4H 2A0WA 5TPZD 4BPRA 4OI4A 1GCUA 3HXPA 4PG5A 4G8CA 1ADJA 1QIKA 1ZESA 4JJGA 3WMXA 3KQPA 3JRXA 2PNJA 5IYZB 1XTPA 3BRWA 5EZYA 4EI2A 4NH0A 1WCIB 3W1EA 2OQIA 4CEHA 3RAPR 4DMMA 1DPGA 5EZYF 4DSTA 2ZPAA 2PJDA 4RVUA 2GKSA 3BT7A 4MVJP 3RYCA 1NJ2A 3H5NA 1SFRA 4W7SA 2CUKA 1HMYA 4QXQA 3GTJA 5EYPB 2QX8A 4RZSA 4QLOA 1KEUA 3KOYA 1KFKB 1R0XA 2D06A 5G4LA 3TQQA 1REQB 3O74A 3OFSA 4WK0B 3OZVA 2GCPA 4OK6A 1S4MA 1U2GA 3AW9A 3VZQA 1HDCA 4A2BA 1LPOA 1N7JA 3JYLA 4PLGA 1N2SA 1Z8HA 4B4DA 1BDIA 4OMFG 3DNPA 1WSDA 1ONSA 3L7BA 3MJ4A 1GTG1 5H59A 5P8WA 4CV3A 3G5MA 3GJYA 2D2XA 2HJVA 4G84A 1K9SA 1Z37A 5KNCH 2CXHA 5ADUS 1VC2A 3C3CA 4D42A 4K6GA 2Z6UA 5B4UA 2QNIA 3WL3A 1NSFA 1XZAA 1RVV1 5C4MA 1Q15A 2PV7A 4Z2YA 2J7KA 3LYLA 1RU3A 1M5RA 2Q6TA 1GUFA 3GGGA 1QO0A 1TYCA 3VTFA 3PFFA 1H93A 3KOXA 2OZLB 1I1OA 3VNBA 4MA4A 3LWNA 4XJTA 2D5LA 5HUHA 3DOUA 1AQIA 2ECFA 2FEMA 3DZCA 4G4GA 5AKXA 5KI6A 2GF9A 1CY7A 1RHRA 1SWVA 2OG1A 2PT5A 2VDJA 3DOIA 1YKSA 4WINA 3EVDA 2IZ7A 1Z88A 1E3SA 4FUTA 2TSYB 3IA2A 1JRLA 3KTOA 4QAJA 5FRDA 3GQBA 3RK4A 5K8JB 3TFWA 4KYUA 4LFAB 5EZ6B 4WZBA 2C8LA 2JI9A 1ENOA 1TIBA 3QXXA 4JLNA 5EQJB 3RRNA 4C4PA 3IAUA 1ZI8A 2YW9A 4EIWA 4PBCA 3KO8A 5KFHA 1XPJA 2JLVA 2DJ5A 3AJAA 3FPBA 1BZYA 2PZ8A 4I14A 5D01A 3GZNB 4Z5XA 3NDIA 2FJ0A 4DDTA 3VNNA 4O4LF 2JVKA 1JJAA 3PA6A 2PBFA 2P9JA 1VOTA 1QYIA 2OB2A 3TQTA 4YV7A 3FDIA 3S8YA 4DM3A 1WXWA 1EFRA 1C4OA 1P5JA 4R8VA 4X85A 4GUDA 5IJXA 1RYDA 2VJNA 5TEWA 2VJMB 1XMVA 1XMQH 1TU4A 2WJHA 4WZBB 1VLLA 2I2WA 3OEHD 1A4UA 2FY8A 4MCIA 2SHKA 3T9AA 1T2VA 3RCBA 4BMSA 5AOVA 3HTXA 3OZGA 2W2QA 4AK9A 3NWPA 1GTSA 1R4NB 3G0OA 4UD6A 2XCRB 1U6KA 3C48A 4N8SA 3IKLA 1AGRA 2Y0SA 2V3WA 1EVYA 3IOBA 3GRYA 5FUVA 2PMFA 1QC5B 2DKFA 4X6YA 1P3DA 2C2WA 5ECDA 5EUCA 2J3MA 3OZBA 4CT0A 1ODLA 1NVVR 2J41A 1LV7A 2QMOA 2NV6A 3LYHA 5I48A 1L5NA 1P4HA 4P0TA 1HLPA 2P67A 5DHPA 4B6PA 4B87A 3GP5A 3PQ3A 1SC1A 3V6JA 1PQWA 1NMEA 4E1AA 4WNYA 1G1MA 3MJHA 2Q27A 1R4NA 2OHHA 4IGEA 4KQGA 3BG5A 1EX9A 2AQIA 2ZJZA 4YCAA 3V6MA 4PX5A 4FHGA 2R1UA 2F2TA 5U4XA 3ECSA 3G0HA 1IM5A 5KSOA 1SD5A 3RC2A 2CXTA 3RUEA 5FWNA 1D4ZA 4EHBA 3SVZA 4H1TA 2ZIVB 2O3JA 4MKHA 1TEHA 3QBTA 5D2CA 5KO2A 4ZJYA 3PQ7A 4TKMA 1IXSB 4G0WA 4Q39A 3EVAA 1IVNA 3FSGA 2XJ4A 3DEJA 3LT4A 5KFSA 5DGAA 2CW7A 1X7HA 2FPGA 3M3PA 1V4NA 3RRFA 3TDKA 1R64A 1UM9A 1CR2A 3LDGA 4HYTA 1F9AA 1KDZA 3ZCVA 4DTCA 5IUNC 2HHLA 1SD2A 3RBXA 1TK3A 5F12A 3WQSB 3QJYA 4PZYA 1B16A 3P2YA 3TOZA 5CDFE 2PZEA 1HO3A 3FMOB 2Y76A 3I9JA 4JR2A 4O5AA 3STHA 4GZ3A 4X90A 3EVFA 3UBMA 4CNQA 2BEUA 2OGSA 2XJ9A 3LQSA 3I9NA 1PP4A 3RSFA 4RS4A 3LXRA 1XK7A 1SOVA 2JJQA 3FDSA 1AKYA 3OO1A 4R54A 5JMPA 3ZY2A 1P61B 4J9NA 1OYWA 2P11A 3F1LA 4MSUA 1KY3A 4NFYA 1WABA 7AT1A 4RTRA 2C99A 2PSEA 4Z1MD 3O2NA 4WBNA 4DC9A 1EVEA 3M9LA 2YZ7A 4LV6A 5AHRA 1Y14B 2WRZA 3W2EA 3BEOA 1TU3A 2HRCA 3BAAA 2MYPA 5HVNA 2XXAB 1B0AA 4NZ9A 1N5DA 2BL4A 3SBEA 3DV0B 2NXNA 3JQ8B 3WL6A 1IBKB 4NENA 1S3GA 4B47A 4YN3A 4M1MA 2DR0A 4JYCA 5CEJA 4WD3A 221PA 1NIPA 3A28A 3LUJA 3FNQA 4L5AA 3A32A 2X6QA 1U80A 4N6GA 4PRLA 1PWYE 3FSGD 3IP7A 1GNRA 1KZ7B 4J0DA 3C41J 1JR3E 2NNLD 2G0TA 3FI0A 3FZQA 1L5HA 5KC9A 5LMUB 5F23A 2Q45A 3OUUA 2FV8A 2VPTA 1WZUA 1NF2A 3VNQA 3SXJA 3Q7SA 1GVHA 4HDMB 3ABRB 4Y0AA 3T4UA 5K3DA 4EH1A 5BSKA 3MQFA 4ZAGA 4DNOA 3TMAA 5CA1A 3D4LA 4MTEA 3C6XA 3FLAA 3HWX1 3F7NA 1UDWA 4JBXA 5KFJA 1BEEA 5G0UA 1GPAA 1XF9A 2ZI7A 3DT9A 3ZGXA 5F1PA 4D96A 5M29A 4YWHA 1GVNB 4J43A 2JAXA 3IN5A 5JE8A 2SCUA 5CT9A 1TUBB 1ISSA 1N4AA 4FS3A 3HFJA 2F7SA 3D0OA 4LDNA 4OSPA 5FPOA 1JX4A 1J9ZA 2R68A 4LYFA 3GZ4A 4OA8A 1N34H 2FE1A 2LP4Y 2YFKA 1NXTA 3HKBB 5T67A 3IVCA 1YR3A 5AW8A 2PY6A 3QUQA 5BV8A 1L3CA 1VPLA 1EP2B 1ZNZA 4B5LA 5C2JB 1DBVO 4G1MB 5BSTA 2HBRA 4FHEA 5L4NA 3GGDA 4A0RA 3I2GA 4FGWA 3ZCTA 2P4UA 3QKIA 2UVPB 1XTUA 1XN4A 4M7EA 3RI3A 3M1LA 3EBPA 4LXGA 1ZNWA 4FEYA 4GMGA 3P1JA 4QU5A 3W6PA 3W5JA 4DCNA 1EWRA 4NOKA 1ONNA 1H5UA 2XCLA 4R6WA 2NZWA 4MICA 4DBLE 3WGJA 1QZZA 3SM3A 3PE4A 1ZK1A 2QPOA 2ZXFA 4C0BA 4FFNA 3PHCA 4YP5A 4F38A 4F7DA 5I7SA 2X7JA 3DBLA 5AJVB 4B40A 2CCGA 1SKYB 3AEUA 3LQ4A 1JHXA 4DADA 4IKOA 4FBUA 3AR5A 3IRUA 5ER9A 3JQ7A 5T6MA 4AJPA 3DLCA 4QRDA 4PAQA 4TN1A 1ZKDA 2BT4A 5HBGA 1IQPA 2I4TA 1AA9A 3ZZ1A 3CN9A 1AUPA 2B9EA 2EZ4A 2HT6A 3WAJA 4OH1A 3C6ZA 3L8HA 3ZJ4A 4EB6A 2J6UA 4HUQA 4OHUA 1DC5A 2N9UA 3K0HA 1H5NA 4IV8A 1U8TA 4I9GA 3BJEA 4B3JA 2FUG6 3KS9A 4Q8EA 4ZGWA 4BJ6A 2FFBA 2BM9A 4BZZA 4EW2A 1J39A 4EJSA 4AIIA 1DKMA 1OFIA 3ZCSA 1G3QA 4P93A 1KYYA 1ODTC 3A9VA 4R51A 2C8JA 3KJHA 4JJ7A 4UBLA 2HLNA 5D85A 2CHEA 2IBTA 5HOQA 5D5QA 4JJKA 4K6NA 5DU2A 2BCGY 4XGQA 3UWKA 3ZBUA 2EVWX 4I50A 4LBYA 3GELA 4GMDA 4RE5A 4WACA 4C30A 1YXMA 2Y1LA 1GZUA 3NTUA 4Q44A 5NLLA 4GKBA 3WADA 3BXOA 5TDHA 2XRMA 1OGJA 3ZK8A 4BNDA 4YMIA 2GA9A 3R40A 3P2IA 1OYOA 4KV9A 4A5OA 2JHPA 2RAVA 3L5KA 4WCFA 5GOTA 1VIDA 3TI7A 3UG6A 5JAPA 3NETA 4FZJA 2J08A 1Y9JA 3HBNA 2A35A 4JI4H 2C5AA 2G1AA 1G9SA 4P34A 1YFZA 4ARZB 1DCFA 1SB8A 4LDQA 2UUCB 2P5SA 2WD7A 2ZWAA 5IRCD 1AQJA 1MZBA 3BB3A 2I4OA 3PL5A 1J21A 1AV7A 1D6MA 1C1XA 2YCBA 3COYA 5GJVC 3IOCA 4A3CG 2FK1A 2DPYA 2E4WA 2H63A 4L08A 5KSZA 1JEAA 1JIQA 2GYWA 2O1EA 2Z8ZA 3FNEA 4UREA 2DIKA 3WGKA 3R9WA 1YMUA 4W5RA 1UKCA 3HCPA 3WMRA 3WLIA 5KTOA 1E63A 3D7RA 3U7IA 5BYAA 5K6AC 3INTA 1DWOA 5FFFA 4F4WA 1L4HA 3DB2A 4C03A 3RYIB 5BXQC 1XVIA 4G9EA 3UATA 1V5GA 4TPKA 2J5XA 2EZ8A 4S05A 2R93G 2OECA 1J4AA 1A7JA 1V1MA 2ZRLA 3EOZA 5AJWA 1BFUA 2QT0A 5TPZA 4DHEA 1U9ZA 3PYMA 2P6MA 1EGMB 4X64H 1Z34A 3LMKA 2Z8XA 2CLCX 4IWXA 4IDPA 1W88A 4I4NA 2WTXA 3ME5A 1Y7IA 2FG6C 3LNTA 1UAAA 3W9SA 5ARDA 1E7QA 1EFDN 2DWQA 3ZWOA 5JDCA 2QTWB 4G3IA 3OTOB 3EDCA 2AD5A 2VQEH 1XQWA 2A1IA 3LDAA 4JDPA 1R16A 5ICFA 3IJ5A 4UW9A 4E3WA 5AW3A 2X13A 1HKUA 2HA0A 3GR6A 3F3YA 1OWTA 1QJCA 2E55A 2I0FA 1L1FA 4B82A 2FW0A 4LMBA 3CVYA 2ZATA 4JLKA 4E7OA 1AHHA 2PX8A 3A1TA 4Z4GA 1VP3A 4DYDA 5KG3A 1U02A 2ODBA 3IERA 3QU5A 4GM4A 4K87A 5EUQB 4MAAA 4ECUA 5CK5A 2HPHA 4J0IA 4H35A 3TYXA 4QAQA 1YBFA 3Q8KA 4MTDA 4O4IA 1FVIA 1DMRA 4F72A 5K2OA 2EF1A 5HILA 4IZIA 1SOWA 1Y6RA 3VH2A 2W2LA 3HJUA 2C7OA 4YAWA 4ZXFA 4QT0A 1E7RA 3S1AB 3ZOKA 4DW8A 3HUTA 3RS5A 2JFBA 2QQ5A 2GHQA 2A5FA 2RHRA 1S7CA 1XYVA 3TSOA 2VTBB 1UM8A 1DTWA 1BHO1 1G3UA 3EAFA 1GPYA 1U81A 1OXKB 1YB6A 1HV8A 4OL9A 3WP0A 2I55A 1CUJA 3GFBA 1YK1A 4H4EA 4O3FA 1XZBA 1NQAO 3K9LA 1GPLA 3F3MA 4UVEA 4EG0A 1RMQA 1X14A 2X8WA 3BX1A 1FDOA 4E09A 1OBVA 1ZIOA 2XIGA 1J06A 1T1SA 3RVLA 5EJ5A 4V0SA 5DM4A 1AE1A 1VE6A 3NTXA 4GECA 1WSCA 3RB8A 3TGPA 4J3FA 1QKKA 3MGAA 1RWQA 1ZJ5A 4P3KA 3KB8A 1A69A 1CRPA 2ZT8A 4OSEA 5BR8H 4AROA 5F3WB 3IDZA 3N2LA 2L19A 3Q2OA 2C2DA 3OJWA 2JGLA 3JAKA 4K9DA 4UVGA 3M6AA 2EQ5A 4YMUA 1U8YA 3E61A 1OIXA 1SBIA 4CTKA 2HFKA 4BVKA 1KEPA 4KR7A 2B21A 3PO3G 2NPFA 5LJLA 3LQKA 3AEZA 5LDGA 3TQCA 2DZDA 3C7AA 4MA5A 1DV2A 4NCKA 4MV6A 2ORIA 4BIIA 5I9BA 3U3ZA 4DN6A 1VJDA 5BWMA 4URVR 1K5GA 1K3FA 4OHPA 4CM4A 1W4AA 3CB4A 3DBIA 3NJ8A 5CFOA 1FYWA 3H1AA 3JQEA 3SFTA 2WP8J 4WVLA 4B9AA 5C8ZA 4HK4A 4NNOA 1O57A 3Q3CA 5AHKA 1EI9A 4EG5A 2A84A 3DEHA 5LMCA 1NP3A 3JRNA 2HQOA 3AESB 4K9SA 2JLCA 2W4QA 3T35A 2X2FA 4JJ4A 4MIYA 1Y1QA 4AZ0A 4LFCB 2W93A 3RIZA 2IQIA 4RFVA 1E9RA 1NQUA 2GEVA 4I8IA 1PGOA 4P4SB 4R7ZA 4L57A 4XB2A 3FYCA 5IAAA 5KT7A 1ZR4A 2RKWA 1RWNA 4JX9A 4M9RA 1LBEA 3PDWA 4S24A 3ANMA 4UTNA 4ENTA 2ZSDA 1B23P 2XTJA 1DEHA 4QTYA 3KTAB 1NW6A 2C4HA 1NYQA 3LVBA 4D8YA 2B83A 3F98A 3DKKA 1SUWA 2OORC 4Y98A 1ZNQO 2P79A 3M2TA 2QX9A 1GL7A 1PR3A 4P3XA 5TIIA 2GRJA 1TVEA 2CY0A 3T1HH 2POCA 4LKRA 2XB4A 4QHTA 5TARA 1Z73A 1V2HE 2ENWA 3R20A 4IBOA 3KLOA 1P81A 4TMFA 4PPQA 1T0UA 3C4VA 1QTNA 1FX1A 3CE9A 3MTEA 3TW4A 4FC6A 4IDOA 3T7TA 4O3MA 3JCZA 1X70A 2CL0X 3HQ4O 1DT3A 1HRKA 2ZG6A 4M0DA 4OMUA 3VJLA 3WGOA 1U99A 4ZAWA 2PUDA 2CBZA 1DS6A 3JWPA 3B52X 4RVCA 4XVCA 5LOVB 1UOPA 1WF6A 2IP2A 1I7PA 2R2AA 3Q8RB 4MUKA 5IUKC 1WTCA 1UDCA 3TM5A 3UYYA 1LDNA 4OHKA 2R86A 3QZ7A 4Q8FA 3VGPA 2OXRA 4K0KH 3UQYS 4C7JA 1QGAA 4ZQEA 2UXBB 5TVKA 2D7DA 1G3MA 4TTRA 5EN4A 4C14A 1C1YA 1GPNA 2EIHA 4MLZA 4TXNA 1HYGA 2G9ZA 2V7UA 3LKZA 1OYVA 4RNNA 2B35A 4KMMA 1CB7A 1I4TD 4M9XA 4UOEA 4DV7B 1KS2A 1A0OA 1NBMD 2Y6UA 4JYZA 3IAM6 1NWCA 2R8RA 1DQPA 3TD9A 2W8ZA 4ZRMA 4XOUA 5LZ2A 4JI3H 4KQ1A 4ARZA 5C4IA 1G8GA 3JSLA 1PL7A 3SR0A 1H0RA 2Y4RA 3JSNA 1UT6A 3MMPA 3UMRA 2A9FA 3B5IA 2XT0A 3A9CA 1NOKA 4XAQA 5FLKA 5EKUA 5IYBG 4RJJA 1DAOA 1ZS9A 1NBHA 2V0NA 3MCTA 4L3OA 1PD1A 3IULA 2OWEA 4M8IA 3HBFA 1EGQA 1M54A 5DFAA 4I5GA 3D3KA 5TY0A 3VKWA 4BYGA 1F2UB 1OA0A 2HMVA 1VJGA 3EXFB 1PO7A 1QIJA 1QP7A 1O94A 3TOVA 4BLVA 4D8WA 2NXWA 4GVPA 1VFNA 3PQCA 4JLUA 4KXFB 2OUKA 3PSAA 2X0RA 1NR7A 4JR1A 5FL7D 3ZDCA 1II8A 1KOFA 3IR6A 3ZHRA 3G8BA 5KTRA 1E69A 1H5QA 1MABA 1VE5A 2C3MA 3EJWA 3KV1A 3O9VA 2LWIA 3GT0A 5LXTB 4JBGA 2NXEA 3M70A 4BLWA 1C3XA 4KWHA 4F6LA 1I4WA 1U2DA 3CR3C 3DR3A 4RESA 1OH5A 2F43B 4ZCRA 4KX3A 2PKRA 4MB6A 5AIBA 4HZUA 3NGDA 3AXTA 1FXUA 3NBQA 5ALQA 1N6PA 3WWYA 4IWNA 1NFFA 2XT9A 2RGGA 3MFIA 1ZGZA 3O2QB 3F9IA 3PWSA 3ETCA 3H2KA 1B2RA 3H0GG 4IILA 4R1TA 1Q91A 1ETHA 2ET6A 3VHXB 2VQ3A 2RHGB 3U5ZB 4AW9A 1YHZA 3RS0A 2ZU6A 5F2EA 3IUSA 2BZ1A 4ITVA 2BGIA 1T5HX 5EINA 4B8WA 4Q45A 4R40A 5I8PA 4O3OA 2B3DA 1QMPA 3G2PA 3QFHA 4LG1A 4P4NA 2X9VA 3I0MA 4UEKA 4CG0A 4CHIA 4A0FA 3RUIA 1RC1A 4MDHA 4JQCA 1RACA 1TFUA 4ZVPA 4D57A 3Q3IA 5EJEA 2C95A 3QX7A 3OX2A 4KKVA 3JQ8A 3ZWWA 4DSNA 3UT5A 1HNXB 1AY0A 1QZUA 2F4NA 4K9RA 4YV2A 1NMYA 1SXJB 4P3YA 4DWOA 3VR3A 2R8JA 2DKOA 3HCRA 3LCRA 2IV7A 1JDBB 2I29A 2HJGA 2P6OA 1I5EA 3WGUA 1FU4A 3DHYA 3L43A 2B37A 2Q29A 2Z3VA 2ODNA 3FWYA 2CHVA 4PWQA 1UWVA 2CC2A 3KUCA 3M9XA 2G9QA 3K73O 2YJ4A 3NXKA 2HSWA 4JGBA 4XVUA 4DR7B 1DIKA 2D6FA 3A26A 4A6EA 1USUA 3CUTA 5AVVA 2QR2A 3U54A 1HEIA 3TR5A 4CKEA 4F4DA 3JQFC 1WB4A 1MJGM 3K9BA 2HHFA 3TI9A 5AUNB 1L6IA 2NVBA 1BW9A 2HKIA 2O06A 3GEGA 2FLPA 3E9MA 4X1YB 1T35A 4B76A 1AKMA 5HGJA 5CYGA 2NU6B 5AVSA 3WYGA 1IJKA 3KFLA 2HXYA 3O8OA 2D1TA 1FX0B 2DVMA 4YJ3A 4RYLA 2DERA 1TDJA 3KPWA 4IINA 4XW2A 5KFOA 4XPIB 1KE1A 1NUHA 4CMIB 1IFXA 3LT1A 4HNAA 3QNWA 5TQJA 3LK6A 4R84A 1HSOA 3OA2A 2V1XA 1ENPA 2RG1A 1HMPA 1U0LA 3GV8B 2AX4A 2JFNA 3IUEA 4M53A 3RHFA 1R0BA 4C0SA 4UBJA 5I3ZA 5FUWA 1FMTA 2VRNA 1V7PC 3M9OB 1DUSA 2HSJA 3CEMA 4OF4A 4BP8A 1S1CA 1LW7A 1U8UA 1JEQB 4E1BA 1FSFA 4YMVA 4FZ3A 4RK6A 1OJ7A 4DLXA 1N1GA 4QXRA 5ELXA 3G7NA 2A7XA 4FVTA 1ZK4A 4CIWA 2BM8A 1EB8A 1P1BA 1THGA 3PR5B 1VL8A 2ZB2A 4XUEA 3ROGA 3TAXA 4O7YA 2WZBA 4EYGA 4KXUA 4IRXA 3DLBA 1DRWA 4JT4A 4XM2A 3CNOA 3H3JA 1XA3A 4OJQA 2IUUA 4BQPA 2O3SA 5C7LO 2X19A 2LTAA 1XEXB 3L7DA 1OFTA 1OGIA 3CEAA 1JR3D 4UHCA 1N77A 1QUFA 4LHWA 4DMHA 3ETEA 3ZTYA 4I7HA 2NW6A 5EHZA 4YDSA 3TLBA 4BMPB 4O6VA 4BQNA 1Z8FA 1RCFA 1GGNA 4WKBA 4Y67A 3WRXC 4MJ3A 4UTPA 1WMAA 2DPMA 1XV5A 4KNWA 5I9NA 4B6GA 2QZPA 4KR6A 2Q0XA 4QOJA 3S1LA 2MJLA 1MJNA 1W93A 1PV1A 1TF2A 1P4RA 1K97A 2ONKA 3WLJA 2EKZA 3KWMA 2HLPA 5DHFA 1YO6A 2PKQP 2Q5EA 3ZWCA 4BLRA 5BNIA 1TF7A 1EP3B 1KP9A 3DP9A 3QWAA 1U2DC 4NE2A 1HNXH 1EG2A 2XSZA 3OEEA 3RAJA 1EX6A 1JYEA 3ZU6A 5AMXA 1EFCA 1PTJA 2Q1SA 2R6R1 4GLOA 4UU8A 2C2YA 2F1OA 2Z6VA 1W76A 2C94A 3PJGA 4IDQA 4M1QA 4HZGA 1K7XB 2PWBA 3FCOA 3OPMA 4UARA 4AXBA 2K2QB 4J7XA 1QHIA 2FHSA 3FFTA 4L27A 1US8A 4MCAA 4DRFA 3SS8A 4O7RA 1S0MA 1G5RA 1N1EA 4BB6A 1WXQA 1U8ZA 8LDHA 4C4TA 1K83A 3PCTA 3J80A 3IAXA 3ZVNA 4BO3A 1PUXA 4K2AA 1ZK0A 1K6EA 3AF5A 3HOVG 2IP1A 1T2NA 4PO1A 1DFIA 1RAAA 2JFYA 5TQ2B 3WZLA 3RJ0A 3BC1A 3MR3A 2XYHA 1SBYA 3W1WA 1AB5A 3GTOA 3ZQUA 3RVPA 4BWVA 5HJEA 4AFNA 1CYDA 2VJMA 4PYJA 2W9CB 4Z3KA 2XE7A 2OLSA 1EFPB 4EPWA 4HDRB 3QUSA 4LYGA 3E7XA 4BTLA 5I4KA 1M7BA 2BFFB 3ZI7A 2HY7A 2CFSA 5ILQA 3TL3A 3IJEB 1DT5A 4AF8A 4ZAYA 1GO3E 1NRWA 1U1DA 3AKZA 3P0JA 5EJMA 5K0CA 4Y2GA 4DWWA 3NO4A 4GOOD 2OLKA 3DEYX 2Y2UA 4I9NA 3ZW8A 1GQYA 1GFWA 2N1BA 2NTYC 3ACDA 3DLTA 4WUTA 1U2GC 4M1ZA 3H4IA 3W9UA 2XWSA 3MG9A 4NFHA 2QP3A 5KG4A 2W6JD 3F8NA 1EESA 4JVOA 1RI5A 5CEEA 5LBUA 5E2AA 3WGVA 3PHIA 4X65H 4AO7A 2QVZX 3HBAA 4OXNA 5EPEA 5K03A 1S9FA 5FBZA 5IT0A 1QHNA 1KWKA 5J4KA 1V3TA 4JFAA 3V00A 2Y9MB 2PX0A 3KFVA 5LLTA 5FPKA 2R84A 4J4TA 2HHHH 1E2NA 3ZYCA 2V9PA 4OU5A 3N70A 4D3SA 4HC4A 1IHPA 2VFAA 2GETA 2C92A 2AZDA 1BVYF 1DKRA 3L01A 5AHWA 5DBHX 5EGNA 1SM4A 4IEEA 2ZAIA 4CCAA 4HTAA 4WHMA 4XJXA 1H2XA 3HKEA 3ZE2B 3CWZA 3L0DA 1FL9A 4DV3H 5A9SB 3I58A 1RM3A 2C29D 5CURA 3RTEA 2HSDA 2J4FA 1JBKA 3L1HA 3MWDB 3UK2A 1G5PA 4P4TA 1JXQA 4F96A 5KFUA 1ZO8A 4MV0A 1KYXA 5H3LA 4LSXA 1XKTA 2VHXA 2CLMB 4CG1A 1O9BA 4JI8B 3A6JA 3CLHA 2RHCA 5FL7A 3JPYA 2W00A 2ZTVA 3CXUA 4P08A 4JXUA 1IQ0A 3OOHA 1N7IA 2UVWA 2DWCA 1R00A 1RQGA 2HD4A 5AICA 2V4UA 4YMGA 2B92A 2ESRA 3CJRA 3ZLJA 2ZTHA 3EGDB 1VL6A 1TJNA 2ZYTX 4A1FA 4GKAA 4DLBA 2GHTA 3PYXA 3L18A 4QARA 1H6DA 1UXKA 4B8ZA 1BU5A 4MX8A 3X2SA 3JPWA 3MB5A 2EFGA 2XE4A 4GR5A 4DMRA 4EQ5A 4BQQA 1V4VA 2JFXA 4KQXA 3UJ6A 3QKSA 2P5YA 3W06A 2HRBA 2HA7A 3C3AA 4UCQA 4XB1A 3DMDA 1GD1O 2B3TA 5CGZA 2UVRA 3OECA 5G1PA 3C3EA 5H7XA 4PLTA 1RYRA 4YV1A 2CVZA 4KJXA 4I55A 3IC5A 3VTZA 2MSKA 1CRLA 3M4JA 2O23A 5JBIA 4CMEC 2X5KO 1RK5A 3LVQE 3QMWA 3WWPA 4HZUB 3AQ4A 1CP3A 3N6RA 1WSWA 2HCTA 2C5FA 1CQZA 4C88A 1NW9B 1TJ3A 3BWEA 2KSWA 1UDRA 2PFSA 4JI2H 3TR6A 1UPBA 2QPTA 3AX6A 3FN4A 3LPNA 4YC7A 2H52A 3BMQB 1OV4A 3EVCA 4CGYA 1FP4A 4MH0R 4UTOA 2WU0A 3PXXA 1RT9A 1HTTA 1U5CA 4QJFA 2J9GA 3DEAA 1KQFA 4XDYA 2QUZA 1W59A 4U7FA 1MO6A 2YFQA 1I80A 4YRRA 3AVQA 4E13A 4TX1A 4E4TA 1NQXA 1T4CB 4KIUA 2QLTA 4MLCA 4A9AA 4DJAA 3ZY4A 2OSBA 3PC8C 1JXLA 5CLJA 2R8XA 5AJTA 1H4TA 1EHIA 4YPFA 4M54A 2NYRA 3OTQA 3ZHZA 2GN9A 4AY5A 1ZL2A 4IHJF 4RU1A 4A2QA 5ERYA 4TKVA 2CKMA 1IYEA 4MS4B 4DHWA 1GITA 4RUAA 2GBPA 3GLGA 2R6FA 1R1DA 3MT0A 3VDNB 2BRUC 1SCAA 2SICE 1HSZA 4DNPA 4IP0A 1ZAUA 2JAOA 2X15A 2MR5A 3AP1A 5KFWA 2N47A 3NYQA 1SHJA 4H7JA 3G3EA 4WERA 4E7PA 2WSLA 3H1FA 3PO2G 3K9HA 3KSUA 1SG9A 3MOGA 4PWYA 4IG9A 4ENQA 3MTQA 1XAJA 3OIFA 4ND8B 5IH3A 1R4AA 2ZSAA 1BXGA 2RAUA 3B5JA 4KNVA 4BMYA 4DIDA 3O4RA 3GNQA 4DY6A 4EKNB 4XI9A 2IYVA 4JT8A 2QMEA 4GFDA 3W5SA 2BBSA 3QFCA 2CMKA 3BDIA 1PIWA 1Z2NX 5AH0A 4J3NA 5C1IA 1W1UA 3S2SA 2KSQA 1TAUA 5CU7A 1U98A 2W2LD 4G89A 3U13A 3AHFA 2M1XA 2FSIA 4JI8H 5FJJA 4C01A 1V7CA 3MGKA 2ISSD 3PKZA 1A8PA 2OCAA 2BKEA 2PJUA 3C5HA 1VI5A 2QQ0A 5FI3A 1D04A 4DJ5X 3SC2B 2HHFB 3ER9A 1CZHA 1JQLB 3LT2A 4LNUB 5F9HA 2B98A 3GB9A 4BX8A 3WYFA 4IRDA 2MU1A 1E7SA 4A3EG 4YHBA 1DIOB 1NN1A 2FE4A 4CQJA 1FFSA 4CHTA 4B09A 3NUQA 4HRYA 4TRNA 4X41A 5BNFA 4BCDA 3H99A 1K5DA 3ZXIA 2CJPA 1SC3A 4FXOA 5NULA 1W8DA 1KSFX 2BBTA 5SICE 4HR7A 1KEZA 3MAJA 3LWBA 2HIVA 1EAYA 4IQ4A 2C2HA 2ZM6B 5CDHA 1H4QA 1Y37A 1N3LA 1GNTA 1E2LA 2IW1A 4MKFA 5IKMA 2DUMA 3D64A 5DNCA 2I54A 3KV3O 4Y1RB 3RUCA 1X7ZA 1NNSA 2ACWA 3L7IA 2Y1CA 4MW6A 4PFKA 4DUPA 2BD0A 4J0EA 3WGZA 1R7RA 2XMBA 3C8ZA 4PTLA 4TS9A 3KSAC 3G88A 4MV9A 4LF7B 4QRHA 4DTIA 1W5AA 2HMUA 2VHJA 2WTMA 1BGXT 4RVFA 3OEED 3I2FA 1A2BA 3ZCRA 1ZUWA 1XAGA 3KYBA 4HEA1 4J0FA 3L0SA 1GSOA 1KFBB 4JOBA 4BFWA 4ZTZB 1PFKA 4K6OA 3HP7A 4BQRA 3DZGA 4MR8B 4U1RA 4EY6A 3Q7RA 2IDKA 2N3ZA 3DWGA 2WAQE 2Q6KA 1MNQA 1TMGE 2X0IA 3CVWA 2F55A 1EWYA 2G17A 5E6RA 1TQ2A 2QYTA 1EGVB 1SG6A 4D0GA 1FU7A 5ALOA 1NU8A 1P2GA 3TVYA 4F1KA 3QHQA 4DV5B 4B85A 4NCIA 1XEWX 3MCWA 4DIOA 3JATB 2CMHA 3IXLA 3M2PA 3I6ZA 4GPBA 2H9AA 3E05A 4NAVA 4JVLA 2QJTA 3L7OA 3PQDA 3LX5A 2QQEA 2IPNA 4BN4A 1KJ8A 2EFHB 3O4FA 2XY4A 1JR6A 3QOWA 4PAMA 1XHEA 4Q82A 3RANA 1K6MA 2D7JA 5DX0A 1TEVA 1UDAA 3RGZA 1CY8A 1JDNA 1NBME 1QU2A 2VH5R 5GZ6A 2WEKA 1VI2A 3KK0A 4RF2A 4UNNA 4LZOA 3KSDO 5IT9W 3FSEA 3HYNA 5G4KB 3SQOA 3W6NA 3KVNA 3TXXA 3RABA 3LAWA 4UDNA 1CJTC 5C5EA 2DOKA 2XCOA 4L8WB 1MG0A 2VP4A 3HY3A 4U7DA 4Y6QA 5IKPA 4YAIA 3L8DA 1TKBA 2OD2A 3DDZX 4TV9A 4C6TA 1TZCA 5F52A 1KETA 2QN3A 3U0GA 4R9NA 1QQBA 4FBTA 1N6OA 4KE8A 4WW0A 1YS2X 4HRVA 4RPKA 5ULLA 3QENA 1K8ZB 2VNAA 3B82A 4R05A 4DSAA 3F71A 2AJLI 4KN8A 1XBTA 5BWXA 1NI3A 4BGEA 2ID8A 2RGCA 2XLCA 3RQSA 3WRYA 5ALYA 2V65A 3QP9A 3A9SA 1JB1A 4IIHA 1KOLA 3QFTA 3QI2A 4TYPA 3O1IC 3R76A 3REGA 3FTPA 4CR6A 4Y3UA 2X9QA 5FULA 4CI0B 2VR1A 3WZ2A 3GA7A 1I50A 1KJIA 1HDXA 1X9IA 2CB0A 3WWJA 1UPTA 3B48A 2WG0A 2DCMA 1ITZA 4PYNA 5GGXA 3STWA 2NYAA 1A96A 1G55A 1H2AS 1Q20A 1R0YA 1RXSA 4GC6A 1B8VA 4LISA 4OB7A 3V4SA 4PSKA 3ZDDA 1NDUA 2QIOA 3DTNA 3L7KA 1NLYA 3G2MA 2HFJA 4IOLA 2H1OA 2XSZD 1CUEA 3H2GA 4BV9A 3GTPA 1QHYA 1D2GA 4FQ8A 4G1CA 3DDHA 4WLUA 2M1ZA 2QLLA 5IVIA 1U65A 3GWGA 3L1VA 4KC0A 4KRFA 3MT8A 2VZEA 1OB5A 1OPXA 3HBLA 1WOMA 3A2NA 2IX9A 4DMCA 3OJFA 1Z4MA 2VT6A 2QTFA 4FDVA 3RFTA 3DD1A 4E2XA 2CJYA 5DBIA 3O9MA 5L3SB 3B1KA 4EJFA 1YNSA 2QGNA 4D9BA 4M8LA 4GT1A 3ZWBA 3CUSA 2OV1A 4JKOA 4E4YA 1EXDA 2EGGA 3T7AA 1H6CA 3G6WA 1VP9A 1RWXA 2Y1KA 4M1KA 2XQKA 2PGXA 4W5QA 2V9WA 1T0PA 3RV4A 4EYIB 5FA5A 3ZDYB 1BMQA 2VUSA 3T5TA 3ZDXB 2Q5QA 4MI9A 3W5AA 2OAQ1 2VCHA 5BUSA 3KELA 3KHSA 2X41A 3BB1A 3DBHB 2L42A 2WJAA 1DTSA 2RGRA 3F8WA 3KOUA 2QG9A 2ZRBA 3MXOA 3P0EA 1IBLH 1OFUX 4REMA 3UV7A 3NKFA 5AVUA 1LV8A 1JIIA 1C0LA 1OZAA 3MAAC 1LPMA 1M83A 3TPCA 4UAVA 1G18A 3GUZA 5A3VA 1ZBDA 4DLKA 1JBQA 1P2FA 2CLKB 2E18A 2IZ5A 3KPJA 5DIFA 1EUQA 1NTOA 2H0RA 1B76A 2VSYA 1PUIA 5CVEA 4KFSA 4DV0B 5FKJA 4H7HA 4F5DA 2DR2A 3HKCA 2HB6A 2WYHA 2B34A 3AEQB 3BFKA 3AV3A 5HK8A 2BEKA 2IOHA 3KEOA 4DR1H 2C0QA 2QPAA 1X19A 3S2GA 4CKWB 2WMNB 3N8GA 3TNYA 1CR1A 2OM6A 2G7ZA 1ZICA 2E9SA 1JSLA 4O3QA 2UVVA 4YEDA 3TOSA 5AW4A 4EF6A 2IP4A 3BJZA 2P1RA 2DPHA 2DH6A 3WISA 4YLGA 1CDZA 1CTQA 1NVTA 2P6RA 1FZQA 1ZCAA 3A2LA 5KOJB 1Y3BE 3SC3A 3GPDG 1T9BA 1E2UA 2AXEA 1Q6ZA 2CEAA 1SUAA 1KHTA 4AUKA 3GVIA 3JD4A 3R0JA 4K9KA 4XCXA 2HBYA 4IJKA 1TUEA 5F2OA 3DCIA 3VOTA 3VR3D 5AW2A 2BTQB 2R62A 1VE1A 3CZ9A 3IBCA 2JEFA 1H2EA 1MMFB 2B5OA 2O7RA 3RTAA 4DB4A 4NICA 1TIKA 3DJYA 4FSXA 1S2GA 1ZI6A 1D2HA 1W87A 5JY6A 4AIRA 5ALJA 1BKDR 1E4EB 2WPNA 1YAJA 4RGVA 5KG5A 2J9FA 4W5TA 2Q3LA 1U3FA 1C0PA 2IKSA 3BWXA 3VR5H 1N2XA 1Y6QA 4YRNA 3AGPA 3OWHA 4XM0A 2OQVA 1Q83A 1CD5A 3I42A 4YIHA 4DLLA 1KYZA 5TGDA 4DZZA 1SPXA 5FTJA 1KTIA 1KRXA 3G5AA 2RGAA 1KC1A 2OPBA 2Y6VA 1PVVA 1W5TA 4WKOA 4X0EA 4Y9RA 1ORWA 1SZDA 4GYJA 1O4VA 1PJBA 2PZKA 5FADA 1JP7A 1GAJA 1P0CA 1XVTA 3WRYC 2GPAA 1TW3A 2YVKA 3O38A 3BVPA 5AXAA 3T5HA 4A8JB 1JQKA 2G0NA 1NVUQ 3VBCA 2ZVDA 4BJ3A 4RQTA 4DSUA 2Q7DA 1RTKA 3K8QA 4LRUA 4RETA 3K0SA 3IESA 3A1NA 1I7LA 1G20B 1N5LA 1Y80A 1DGQA 5B1SA 2PYIA 4HNVA 3KDPA 1U0TA 3A6HA 3RVDA 5HV6A 3OZIA 1EKPA 5TMDA 2QVGA 5K5EA 2C4MA 1CE8A 2VDVE 2UKDA 4BP1A 1VHTA 4JI0B 4CLHA 1P6UA 3HJRA 3OQJA 4Q6WA 2YJ6A 1QDEA 2EX4A 1OVGA 3CINA 1YR2A 5MN5A 3U5TA 3JQBA 2JFFA 4BWYA 4RJIA 5L1LA 2ZJ8A 3LUBA 1HE2A 4R68A 1PT8A 2UXDH 2JI6A 4BGVA 2IFTA 1JQDA 1PZGA 3W1GA 2OR3A 1BCSA 4RSRA 4YTEA 2OYCA 3GLFE 4MR9A 3BF8A 3IE0A 3NC0C 4R01A 3TY8A 1TADA 2MHCA 5FOXA 1T1EA 4AM8A 2CHGA 2Q2VA 2GESA 2P6UA 3A9RA 3HSSA 3CLVA 1TAGA 3D3JA 3R5SA 2Q3HA 4NOJA 4R3NA 4YMSA 4ETNA 4Z51A 4LYAA 4N3BA 3WIDA 1XF1A 2P62A 3QXCA 4P98A 4YRZA 2OP0A 5BN4A 3DVAB 5LMNB 3GAAA 4GOXA 1A1SA 4OHXA 2QTGA 3AFGA 4NHOA 4PLYA 1WMFA 1JQJC 1BD3A 1JQAA 3FWNA 5ESDA 3HXOA 4FOOA 2VNIA 1DNPA 4IFEA 1NGSA 3PX2A 2DBZA 1ORVA 1X3SA 4WOPA 1E2IA 1RYNA 1L7PA 4INJA 2WLTA 3RIMA 3X43A 1KNQA 1UBGA 2C9ZA 2H4YA 3FCYA 4PHFA 5EIXA 1E9BA 4MYDA 5FD5A 1SVNA 5AI8A 2PO7A 4MRRA 3CPJB 5AOBA 1QF6A 2QX4A 4CCYA 4HUTA 1KHHA 3QI7A 2EWMA 1F2VA 3HCAA 4AB1A 3NYIA 4QYMA 4NLGA 3QPUA 3EMVA 4YP7A 3UCEA 2RE8A 4RVHA 3MFYA 4HAXA 1N56A 1JG7A 4ARAA 3HCBA 4M0JA 3VUFA 2GCOA 3VPCA 4F9EA 4LECA 1E4OA 2FCAA 3PJFA 4GEGA 3L8ZA 3QW4B 2Z3WA 1MH9A 3NTOA 4ZRNA 5CIYA 3SYTA 1EDEA 3UZOA 1SVWA 4H7IA 2HIMA 3BJMA 5ECGC 4KHPH 5KVAA 2AGOA 1KK3A 2HIGA 2ZCUA 4GD3Q 3WMFA 4JDUA 4YCLA 3M6UA 5TQ0B 1NA5A 3F74A 3QXGA 1G8YA 1RJ9A 2OE2A 3LV8A 5JS6A 3KPYA 2Z83A 4UZFA 1PK7A 4P38A 3HU5A 4M0KA 1OXTA 3VO1A 4OPMA 4X45A 4A8HA 3T5LA 2WPDA 5ARBA 1IEQA 3GFSA 3OLZA 3NNNA 2MSCB 1GA6A 4GKKH 3HUEA 5MGNA 1VA5A 3A3YA 1QX3A 3MTBA 3TF5A 3TLEA 1NMXA 1VBHA 3CPHA 3O4HA 3RROA 1L4NA 4TVKA 3RSLA 1O94C 1UH5A 2QYHA 4RJTA 3GRUA 1T9CA 4BB9A 5IT9A 4F84A 1EVQA 4DQ0A 2FZLA 1A5SB 2Q2WA 3F49S 3GEIA 2DPXA 2JA1A 1H2HA 5ALGA 5ALRA 5CVCA 4S1OA 5JBQA 2WB2A 3VKGA 3LC1O 5IZCC 4YJ2A 1GQ2A 4R1NA 4FE7A 4CM3A 1PQUA 1I4DD 1JHOA 2QE6A 1SZCA 2MIIA 5AM5A 3TDNA 2GO7A 2VWQA 1A5TA 1GKUB 3CA8A 4JJ8A 3BHMA 4MRAA 3WIBA 3N8KA 2ZI4A 1UIRA 1ABFA 3T1VA 1WXGA 1M34B 5KEIA 1AC5A 1GGVA 3IPAA 5KU7A 4QGHA 2BPOA 5JQWA 1A4XA 4Q18A 4OQEA 4O63O 3EF1A 3ZY6A 3OKPA 4X3CA 1ESDA 1RAEA 4EHHA 1YOBA 4CQLB 4RGQA 4EECA 1V47A 4ZZ2A 1XJ5A 3URMA 3L7NA 2VAWA 2FSUA 2QN9A 2IA6A 5MHTA 5EXXA 2IYOA 3M4YA 3D7MA 2XGSA 3AEKA 3EF0A 1J2YA 5CFPA 1ANKA 3U3JA 3EEYA 5AXDA 4AD8A 1PJ4A 1SCNE 4O1IA 3PEFA 3SF8A 1HNZB 5I4BA 2LCIA 5AHOA 5EQDA 4XB6B 3UOAB 4U9IS 2D5CA 4GBED 4ESOA 5FUMA 2JFWA 3BGVA 3OFNA 2QV7A 1MRSA 1L7RA 3GMSA 1FFAA 3UPTA 5J2TB 3FI9A 3PQEA 4B3IA 2M6LA 1G8JA 1RXEA 3RREA 5A3JA 1M1YA 1W5SA 5IAJA 1R27A 3CH7A 4NDAA 1AMOA 3C98A 1T4BA 1NMSA 3AJ8A 3NHPA 2WZQA 5IVHA 2L18A 3R4CA 1UBMS 4J75A 1MA0A 4CM7A 1OBGA 3SQDA 1XTQA 4E03A 3KJQA 3QBDA 4LMRA 4BASA 2G25A 3VU8A 4F3YA 4Z4QA 3QMPA 4L28A 3H5RA 5JO9A 4U2BA 3THXA 1YTUA 3IAFA 3IR7A 4ECVA 4UE3S 1E8NA 2A0XA 2HJHA 3T1TA 1RAHA 3FFBA 3FOCA 3TTUA 1G16A 3I04A 3Q11A 4K6KA 5B3JA 4CCWA 4F2DA 4FB5A 2XVYA 4JUFA 5DLPA 5EXDA 1E5VA 4JEUA 1U28C 1CUDA 4BHTA 2AFHE 1E1QA 3VR1A 3QELB 4XGIA 4DCMA 3L8CA 1R4ZA 2NSYA 2QAGC 3BQMB 1S2OA 4RD6A 4TUYB 5I9MA 1ZH0A 3DUFB 3PR1A 4LY3A 4H7KA 4YGYA 5AK0A 1VXOA 5EZSA 5J5AA 3RV3A 3L9WA 4JENA 4OB6A 2W8KA 4P81A 4XUDA 1MXFA 1SB9A 1TZKA 1XC7A 2VDRB 3K0AB 1IWBB 1NVGA 4J1TC 4JUDX 3RFUA 4DJFC 1W35A 4GX2A 1QH1B 5ALVA 4MVJM 1VM6A 2N42A 1XLUA 3KETA 5J2UB 4BFYA 3DKIA 1B6SA 5BSUA 5IWCA 2B4KA 1XKXA 1O1YA 4TS4A 4NYMQ 1G0NA 4K6HA 1P8LA 4HAYA 2GJ8A 2QRGA 4K1XA 1H05A 4MRMB 4XASA 3IXMA 2XUZA 1QPZA 3F9CA 4FYIA 2QTCA 4HN2A 3KCNA 3EFHA 3IMCA 3BIOA 4WBXC 2XIQA 3T5GA 2WWYA 2OB1A 2EBWA 1OU0A 4PGFA 3VYVA 1JHYA 2QD1A 3PEYA 5LQNA 1HZJA 2PDAA 4DY4A 4JJ6A 4P2GA 2ILTA 2ZDQA 1XCBA 2O1SA 3EVZA 4EY7A 5CB4F 3NC0B 2J5BA 3P52A 3WO1A 3CR7A 3NP7A 4REOA 4YJ3B 3ZZNA 5EERA 4WZBE 2ZUEA 3EA5A 2NACA 2AR9A 3KXLA 1YVDA 5EKDA 3QLVA 4Z3OA 5D86A 1KOGA 4PO3X 4RKYA 4M6WB 3OKFA 4UCVA 4YRCA 5FBRB 1CK4A 4Q02A 1SKAA 4DV3B 3C4QA 3JD3A 3R44A 1PL8A 5BPHA 1PQPA 3MSCA 3R3ZA 4JSTA 2IPOA 4RBNA 1LS1A 5C1BA 3B6ZA 3VNRA 1N5OX 1PBTA 2EP8A 2L0XA 2YTZA 2YN4A 3NTRA 4YAJA 4XOIA 4EX7A 1ZBQA 1HEUA 2X14A 4W5JA 1FNDA 4K03A 2UZ1A 4ZOLA 2ZJ2A 1U9YA 5DYTA 4UHBA 3SXUA 4L6CA 4Q4HA 3OZAA 1R0ZA 4NQRA 2KI5A 1KQPA 2BMEA 5CT5A 5BN3A 4JV5B 1A04A 1J0EA 2D0IA 3HNRA 5THKA 4RTNA 4TQUS 1AQLA 3CEBA 4ZQBA 3RFCA 1NHGA 2YHIA 3RAQA 1E5QA 3E18A 2QRUA 4KMRA 2R82A 3L4KA 3ULKA 2D0OB 4A91A 4C7MA 2P30A 1KC3A 4XRRA 3LKDA 4MGYR 5BSHA 1VPWA 1T1JA 3SFZA 2HTEA 1XP8A 2G1KA 4BNNA 1ZEJA 2JGAA 3L77A 2GARA 3UANA 3SPXA 4RAZA 4OVKA 2WAAA 4QREA 1S2DA 4X00A 1G5FA 4ALMA 2EL7A 2IIBA 3T38A 4YT2A 3CVUA 5AVYA 4JI7B 3RTXA 3RHTA 1YK0A 2BGTA 5TNXA 3STXA 1NVMB 3U44A 3N6VA 3LJKA 5KOJA 3KYJB 1ZOIA 3OF2A 5AJXA 1CQXA 5JDIC 1FFXA 1FY2A 4K9NA 4GI2A 1BHSA 1HDYA 3FPJA 2ZPTX 3QQ5A 3K71B 1QX4A 3CTMA 1SAYA 1GKIA 2C3UA 4JOCA 3GEMA 4JI4B 2H0QA 4CGZA 3K2QA 4J0GA 1H2BA 4ZU6X 1KORA 2RGNC 2YXNA 4PYLA 4AKTA 2QVXX 3DF7A 4NE7A 2BH2A 1RJ9B 4HQRA 5CYOA 4KKXB 3UMMA 3RC7A 1JMKC 1L5SA 1Z0IA 4PF1A 4QQKA 3VO8A 1TM2A 3MWJA 1ML4A 3PFHA 1DBPA 1YZGA 3T7DA 4HD8A 4N03A 3FPKA 1L5FA 3N2KB 3Q10A 4FJ0A 4Q16A 5J3JA 4JB3A 1QQ6A 1U9IC 3PD7A 5HGXA 3RVMA 4YRJA 3N1UA 5A03A 1JE0A 1UDXA 4JUBA 5FWXB 1CE8B 2L2QA 3RYHA 4WN9A 3ANSA 2BZ0A 3DVQX 1NW7A 3GYGA 4R16A 4WFIA 2Q1TA 4B74A 4E08A 4ENPA 4JGIA 2A9KA 4IOMA 2XBMA 4GQAA 3AL3A 4H3SA 421PA 2ID9A 2DHQA 3R77A 3V55A 2B4TO 1K86A 2C00A 2HH9A 3ASZA 5F4BA 5HQJA 4C06A 3RB0A 3O73A 4EAQA 3COJA 2WMDA 3FGOA 4JP2A 2YVQA 3ZTWA 4BFTA 4JU8A 1NR5A 1NG9A 1BDHA 4RD4A 3T1QA 3SX4A 4EZBA 1XTBA 4EKDA 4YAOA 2PKQO 3E8SA 4BVFA 5LD2C 2Q8PA 2Z04A 2O8VA 2GFQA 3GLKA 3E1GA 1USIA 4FFSA 3PWTA 4QUBA 3ZUPA 2J48A 3FKQA 3DVAA 2Q21A 3D6UA 3WIUA 5IJ9B 5E2IA 5LP1A 1L3IA 1QIDA 1BQ3A 5IC4A 1PCXA 3MIIA 2W48A 2QRVB 3KVRA 3DM5A 3NHFA 1S0NA 5I6DA 2PUHA 4EGJA 3BFXA 1NYTA 1M34E 1UMCB 1SJ9A 4C0KA 4O81A 1RYMA 2F43A 3DZIA 3I1IA 4ZCPA 4NR0A 4OOFA 3IT0A 4TLMB 3R7AA 4E2WA 4OFWA 2GM4A 4CBVA 4N0QA 1PR1A 4QDUA 3UM9A 3L4BC 3GRZA 5LJIA 4JNKA 5A06A 1I2MA 1YR6A 1F5NA 3ONNA 3F5MA 3TE7A 3WGMA 2H7XA 3JS5A 2D5BA 4ARCA 5ECWA 5J1TB 4IZHA 1VL1A 1J0DA 1JHQA 1K2VN 1NBEA 2O0HA 2WV9A 2XE6A 3DHEA 4TUYF 1KZYC 4KREA 3F2VA 4NXNH 1EE1A 3F1KA 3I2HA 4WMLA 3S2EA 1Y8ZA 1X1TA 2VL7A 1D2AA 3A4VA 1JHMA 5U4QA 1GSAA 2GXQA 3H65A 4OGLA 3TO5A 3CH5A 3JSAA 4MKIA 1CUIA 1IAQA 1FVXA 4NCBA 1F7UA 1PT6A 2ZYWX 3SFVA 1YBVA 2XGMA 4GMKA 4I1UA 4DCUA 2YH2A 4GU5A 4H18A 2GLTA 1XEXA 2DFNA 4OBXA 4QJ4A 4C20A 4YCMA 1N92A 4L9SA 3KQHA 1QO0D 2I99A 3DZHA 5LMZA 5BW8A 4BPBA 3JAMW 1OA1A 1MFZA 5I5GA 3TL2A 5GVSA 4CEJA 2C58A 4HVCA 1L4UA 3IVAA 5EP2A 2V45A 1PNOA 2NZ8A 1UWLA 4INZA 2FFAA 2PU7A 1S6YA 3CH6A 3Q0EA 2WFLB 1O5TA 3DZJA 2P0EA 4PN7A 2NO9A 5H70A 1M2EA 4GWGA 2FNAA 3KPVA 3IUJA 1OASA 4C29A 4D6XA 3TZEA 4D9HA 4E14A 4HPJB 3FOWA 4C1NA 5KNBA 4B3MB 2HCBA 2ID7A 4ISCA 2DRIA 4OM8A 4UZEA 4EP1A 1GNQA 2MSEB 2CDAA 4HFJA 4ZOCA 5IDVA 4MVJD 5D3ZA 2YYAA 2HQSA 2ZE8A 4YH1A 2GR9A 3ZIDA 1OXVA 1XI2A 1U8CB 1HC7A 1V16B 4YR9A 4I46A 4X61A 1AK2A 4AQYH 4Q3EA 1GKLA 1YGYA 3LHIA 5T14A 5AVJA 5JJBA 5KJEA 3C6BA 1RRGA 4NMMA 4XPIA 3WA6A 4G0UA 1TRHA 5JVDB 1Q0TA 1NT4A 3G1WA 4AMZA 1L4KA 1DQSA 2Y92A 3LXXA 4CVNA 4YAEA 4DV4B 1ZD1A 1RRMA 4RE6A 4QBIA 1UBUS 4A3BG 1FNSA 4ZO4A 3ZZUA 2J3LA 3HUDA 2I8CA 3IP6A 2E37A 4IH1A 4YGXB 1V5WA 2I7TA 2D00A 5DULA 4B6SA 2H9YA 5HIJA 3ZE7A 1H94A 2IHYA 3NUAA 2OM2A 4EABA 1ZA2A 1DV1A 1NW5A 4N0DA 3H6KA 3TJRA 2XCTB 1E64A 2BRUA 1F1BA 1K7FB 3SSNA 4N3CA 1QGDA 2GZSA 2BGGA 1X8KA 3KTAA 4GXRA 3V33A 1Q19A 2MR6A 2WYUA 1T13A 4K9OA 4G8JA 5ALDA 4BE4A 4NMLA 3KHRA 4GSKA 3AUJB 5DB4A 4KP7A 1L5MA 1N6RA 2PUAA 2CDBA 2R87A 5AK4A 5C44G 2F00A 3G2NA 1BTOA 2PPVA 4U2CA 4CKYA 3K4PA 4AJNA 5SY9A 4H0CA 2ETXA 1XEAA 1OZ0A 3K3PA 5EKSA 2GEFA 1OT5A 1FE8A 3FPAA 4WBSA 3REQB 4E46A 5FBQB 4A36A 3KB1A 3Q3JB 3TZHA 1MLDA 1LWNA 2ZUUA 1Y4DE 1SU6A 3DEZA 5CX1A 1ZQ1A 1WM1A 2E4AA 1N48A 3G8CA 2FOXA 1I2LA 4FP9A 3I5AA 4F50A 3PUVA 1N2JA 5E6SB 4YBZB 4EVRA 1GGEA 2JIMA 2QLFA 1V1RB 1IMJA 1HY3A 4LVCA 3IA7A 2ZB8A 5LP6C 4POOA 3FOEC 4RD1A 2FLKA 2E89A 4UPDA 2YWVA 2GZ1A 4RSMA 4CN9A 1BRMA 1X9GA 4YRLA 4AKSA 3EQ9A 1N3YA 1A88A 3MMZA 2HK9A 3O2SB 4HH3C 5DSTA 4ZU1X 1TCUA 3TS1A 2O0JA 4WFKA 1GP2A 3SS9X 1QPBA 2WIKA 3DE7X 1SCDA 2GDZA 2GJSA 3IQEA 2H92A 3R41A 1T24A 4HLUA 4R0NA 4RORA 3HPRA 3UK0A 2GCIA 3ZZMA 4ASUA 1E9FA 3QSGA 5F77A 2B99A 1MAVA 2XNKA 1EFRD 3P9YA 1SXGA 1OBHA 4PZ6A 5CNMA 5EE1A 5F5LA 1W49A 3PHGA 1SIWA 3FUVA 5KTKA 2VYCA 1UJ5A 2KE5A 1K9VF 3PKIA 5KC8A 3UJNA 4TVSA 1JN0A 3O1HB 2O7VA 5CTJA 2CNNA 3DF9A 5AJYA 5AM3A 4WHXA 2E6UX 2J6BA 3DJFA 3USES 1T3NA 1XCOA 4JGGA 4IDCA 5ICMA 3VKHA 1DG3A 3WWOA 4K8RB 4LXUA 2MOKA 3B5EA 2XTAA 1OI4A 3AF3A 3ETLA 1NR1A 3L0IB 2BJWA 1IY9A 2EJVA 4S2UA 4W4TA 5EEGA 4E5NA 3G13A 3IE2A 1T0JB 4K6CA 1BRTA 2AXQA 2A1HA 2QL7A 4PXYA 3Q9NA 3IEUA 3P71T 1EA7A 5AK6A 5HHTA 3WL4A 3WLHA 1DC3A 1T43A 3AFMA 3LG2A 4OLJA 5ESWA 3W2HA 3ZE8A 1GAXA 3KT0A 2JLBA 4EB6B 2UXBH 5E3IA 2AUMA 4LTNA 4PYMA 4F2GA 4PCAA 1LTKA 3W5OA 2NVXA 3KALA 4EUKA 1X3LA 3BTSA 3WRWA 1TYEB 2OG2A 4CDRA 2P9HA 3I6IA 5IAEA 4OHRA 1DDGA 3GILA 2RH8A 3Q7QA 4DCPA 2OILA 1Z45A 5B36A 1CB0A 5L1KA 2F3UA 5LPNA 4GMFA 3IIEA 4O2LA 1FVOA 3PNPA 1WZCA 4Z4FA 2YQ4A 4LZAA 4U7WA 1F12A 1UXIA 3PC2A 4AAYA 1A5BB 4O4JA 2A9VA 3G1UA 4GP7A 4LHZA 2PS1A 3GLVA 2G8NA 4ZMSA 2C78A 3T7RA 2ERCA 5K05A 2W2TA 4NBRA 3T5KA 3L6EA 4IYJA 1V9SA 5L45A 1W2HA 1E58A 3G82C 3H18A 3NH9A 4AX8A 4Q21A 4RYDA 4MV7A 3O4VA 4OLAA 2WUVA 4Q34A 3L0PA 2QX6A 1F4PA 3A11A 1ZITA 2HU5A 4CM8A 1E1NA 3BD7A 4CIAA 3I05A 3C7TA 3K9WA 1R8QA 3GZTB 4N0PA 5JROA 2OFWA 1PZFA 4LJ6A 3S29A 4ZTBA 4ETSA 2GN1A 2O07A 2FFRA 4R2JA 3N42B 1Q0UA 1EXMA 1YFKA 4N8EA 1HYHA 3BSSA 3IHKA 2NSLA 4YASA 3GT4A 3BA9A 2QZSA 4V38A 1IK6A 3ON5A 4MS3B 3QE2A 4YQZA 1VJ1A 4CU2A 1XELA 4ZDKA 2PVSA 3VC7A 2HGSA 3NORA 2ATVA 2YHBA 2ODTX 3PW0A 2A3RA 5ALKA 2FW9A 3MPUA 3QK7A 2W6JA 1C30A 4NYJQ 2CJWA 3EIXA 4BNYA 5C81A 3JAWB 4ZQIA 1YCHA 3F5DA 3VYUB 5IHPA 2W9AA 1UQUA 4GH5A 4LNAA 4Q7JB 1J24A 3V6HA 1VDMA 1KQNA 3V1NA 4EARA 2EWVA 5JSKA 4DMKA 2HC9A 3DHWC 3CVVA 3RIGA 3HR8A 4RMGA 3K30A 5EL0A 5BRNA 2W6OA 5LOVF 2HJWA 1G2OA 2EERA 2GYUA 3GRAA 1XFAA 3GJ5A 2CWWA 3OX3A 5IBPA 2PH3A 4YRKA 3H9GA 2BMVA 1Q0SA 3N5KA 4HYEA 4NPHA 2XF8A 5GJBA 1H66A 3LQ2A 4N3NA 1HZZA 4BAZA 4F6CA 5KWIA 3RF2A 1QGZA 4DC1A 3H16A 4F2PA 1NKVA 1FNCA 2A0KA 3BS4A 1G8HA 1G64A 5TLSA 5IJWA 1DJLA 3AEXA 1CJVC 1QBGA 4MQ5A 3SY8A 4H1HA 2QRQA 2RH9B 1E9VA 1OYYA 2I2DA 5JR3A 3M6LA 4ZI5A 5TX7A 4QFMA 4YJHB 3NV7A 1S1MA 1U94A 1SOMA 2O8FB 1Z5UA 3RD5A 3A05A 3ROQA 4UTRA 1SQ6A 3ITNA 1YWGO 4ZIRA 1QAMA 2QL6A 2QMZA 3N7UA 2RJ3A 1Z7WA 4WZ6A 3MGCA 2Q7OE 3TTSA 1O0CA 1I0LA 2D2FA 3ND8A 3KQKA 2O19A 2DHRA 4WESA 4G9BA 3CLTC 3E9ZA 2SKEA 2QNRA 1UPUA 3NBKA 4ZEXA 4DKXA 3I0NA 4KYTA 5D87A 3FNBA 4PINA 1DEKA 1A97A 4U7HA 1E3EA 1HURA 5K20A 1WWKA 4JXZA 1F2DA 2RBGA 2IU4A 5IKXA 4F4YA 4CZ2A 1UZNA 3QM1A 3MW8A 1IYDA 2VHUA 2ZRFA 2H9IA 5HK9A 1LD3A 1C2TA 3M5DA 2CVPA 3HCFA 3ZLUA 5EHNA 2PZGA 3WYEA 2ZB7A 3O1LA 1UODA 3N8HA 2Z56A 3OZRA 4YQEA 4WXPA 2I6XA 4R41A 5EKTA 3A6FA 3OM8A 2WF9A 1PWXA 3NCHA 3PHBE 3CIFA 3EIWA 1S0OA 1K98A 1RPTA 4PLFA 5FAKA 1UMCA 4URZR 3ORHA 3D6VA 5FWXA 2W43A 4Y8VB 3BRQA 4YMTA 3HDQA 5E8JA 4I9HA 4BCCA 5J47A 1BE6A 3M4XA 3I5UA 1O2DA 3B1YA 3GLIA 2JLQA 2R2GA 2JK0A 2QVCA 3D1VA 4C7OB 1RKVA 2YASA 1Y7LA 5A7HA 1J1ZA 1S02A 2G40A 3JYOA 3DPSA 2NO1A 4LK2A 4UNRA 1Y3AA 1WO8A 4V3BA 4R2IA 4KPYA 4H60A 1VE7A 3SR4A 4W8OA 2Y0PA 2YDYA 3EVEA 2O0MA 1GPUA 2ZCVA 4ML3A 5EOVA 5LC1A 4YRGA 1YMVA 2BSQA 2XGPA 1NF3A 4LF5B 3F47A 3KZKA 2JGFA 4BO7A 4CM1A 1YA6A 3V1KA 3NOVA 4W63A 3LPMA 2P2SA 1E9DA 3DDOA 3HJTA 4R8RA 1IBMB 4UQOA 4MJLA 4POAA 1HR0H 4MW7A 4KQJA 3S2YA 3K1JA 3VJKA 1ZIDA 4EKYA 5FPHA 4PBSA 1ODSA 1W44A 2PX3A 3KG2A 3QEOA 1Y34E 3QPCA 4FILA 3H9QA 2V6BA 1MX1A 4S0XA 2I65A 2Q7XA 3SR3A 4P4GA 4HX5A 5JAMA 3GDEA 1Y0BA 2X4GA 2ZVPX 2WI8A 1FTNA 3GJXC 1PV4A 1I94B 3DA8A 4EJSB 2XTNA 2GZ2A 4RKWA 2Q5LA 3QFSA 3PW2A 1LLFA 4AJJA 3E9NA 5ERXA 3KOWA 4LZWA 3VC2A 4YRIA 4JC5A 4F0JA 2ZSHA 2GA8A 2FG5A 3FTQA 1VMKA 4TT3D 4M7OA 1FRFS 3ESDA 4Y6LA 4R7RA 4AT1A 4B5KA 2AJDA 5J59A 1PX0A 4HJXA 3IIKA 4K0KB 2BFBB 3G0CA 4I6EA 3PDJA 3B6JA 3W6UA 5KNBD 5FR1A 4CT4B 1J5EB 2NYVA 3NP9A 4RPIA 3W6ZA 4OP2A 1IE3A 3Q7IA 3QLTA 3HSKA 1DE0A 1JEYB 4TM5A 1E8DA 1NG1A 1AG9A 2Z4TA 3ZE1B 3R3SA 1B4DA 5KPJA 1GRRA 1XNJA 3IT2A 4FXPA 1PQYA 1THTA 4KN6A 1C9MA 2ES4A 2XUDA 5HCUA 4M6WA 1WP9A 2RHMA 3PTZA 4MO9A 4LXYA 4BYMA 5T64A 4BNHA 1XZEA 1B3BA 1P0QA 1ZUIA 3I6MA 2CXOA 3U3RA 3K70D 2HHHB 2B1GA 3KC2A 2PUWA 3G85A 4IIDA 4QOSA 2BP7B 1P1CA 4G0YA 4FS1A 1ZGGA 3ZJTA 1DRJA 4RPJA 2UVPA 2X5RA 2LR0A 3RIYA 2R8YA 5ALIA 4B44A 2V59A 3M7IA 5I5EA 5C7OO 2PEYA 2NU7B 2QYOA 2CLOB 1WB9A 1FFWA 1TM3E 3DAOA 4JHXA 3SI7A 4UQPA 4B3FX 5HS6A 1ZONA 4M86A 2NXCA 1DG1G 4ZREA 4CMJA 3T54A 2PZLA 1E62A 1TJPB 2Y1WA 3H4VA 2Q4TA 4KVAA 4G5XA 1E79A 3I45A 2FW6A 3OHPA 5DTEA 1KXJA 3HNPA 4MQFB 1GZ4A 2NU8B 1J2UA 1G3IA 4NKRA 2W6PA 4QPNA 4GSLA 3IB6A 2O5RA 3KOZA 2NUAB 1BG6A 1YL5A 2O2SA 3ET5A 3IPLA 4IDHA 3T3EA 3RWMB 3H17A 4MVJH 3RTBA 3WKDA 1P1KA 1CZNA 4BNZA 3ZD6A 5TJHA 3ZEAA 1OHHD 1X9NA 4P3PA 2RH4A 4MRNA 4RTMA 3UJAA 4GL2A 4PZZA 3K8OE 2HF7A 2CMGA 3T3PB 3V4LA 3U4QB 2W2OA 3BCSA 2HR1A 3SIPA 3ZTTA 2WWXA 3R4VA 4HWSA 4CFZA 1R5OA 1T5IA 2AH5A 2XNDA 5CIQA 2ZDHA 3KE8A 2UUAH 5JVLA 1D03A 3DCYA 1J97A 4LQ4A 5KVCA 1EXVA 3WGIA 1IBMH 3NX4A 4I5FA 4BVLA 3TMKA 3TXYA 2ZRQA 3LSYA 1CUCA 2AN5A 1H3FA 3ZQ6A 2Z2XA 4H6XA 4LYHA 2IA5A 3WNCA 1UZLA 4KAJA 5EIOA 1P72A 3UG7A 2Q50A 2BGJA 3CLRD 2XKKA 4R8LA 3W8NA 1A8HA 2B20A 3ZW9A 2BI4A 1NZDA 4GS5A 4FN4A 5EJ2A 2PD3A 4XDZA 2ZIGA 2ZSFA 3D0QA 4GDMA 4GUAA 1B3RA 3RASA 1KI7A 4JX8A 2WA1A 4X84A 5L6LB 2ZRIA 2QU7A 1ID1A 2XRYA 4BWFB 1PR9A 3NIDB 1TB4A 1LK0A 2BDEA 3HI6A 3SF0A 1OX6A 2IYPA 3C74A 3GRVA 1ZIYA 2BWJA 4KHZA 4M8SA 4W8HA 1M2GA 2GJKA 4ECYA 1C5KA 2JLYA 1ESZA 3PE6A 3F90A 4D9KA 4F9TA 2ETVA 4F5EA 1X8LA 5F2KA 5LA6A 1X15A 2OLEA 4DYHA 5I5UA 4JV5H 4MZDA 5HKOA 5AD1A 2NZXA 3YASA 2H59A 2I4RA 3EEIA 2Z43A 2YQ5A 1XP5A 5DMHA 5FNVA 2R1VB 1L2ZA 4OLHA 3O8DA 1Y5MA 2RHHA 4NAHA 4AWXA 3U26A 3KQNA 5DNWA 3RM3A 2BGRA 4RS3A 2FK3A 4AO6A 1SK9A 1VIVA 2R8GA 3E9EA 1DB3A 4NHEA 2IPXA 2FN3A 2XZOA 4Q1AA 2C4VA 4B2LA 2ZJ4A 1QV6A 4GYWA 3WOVA 1JGTA 5HDQA 3S68A 1AUOA 1F0YA 1DBIA 3OQVA 2J3KA 2PX6A 4V0LA 3OAAD 1UZUA 4X60A 3OPYI 3EUWA 1D2CA 4FKMA 1H85A 5CCBA 1F6DA 3VXKA 1E1CB 2N75A 1NMQA 3T0GA 1H22A 1O6BA 1R12A 2XDAA 2PZBA 4IZOA 3VPDA 4ZOLB 3UOWA 1PV2A 4ZYVA 1Y6FA 5T4BA 1JU3A 3QY9A 4PGMA 4WK4B 3TSWA 1ZW1A 2BV3A 3PRJA 5EZYB 1JZTA 4OXQA 4YQWA 3THWA 3HU3A 3DQQA 4E5MA 1O3YA 3FPLA 3PUJA 1BWQA 1KO1A 4ZCLA 1F48A 1G8AA 2G80A 4A3KG 1A9ZA 3O03A 4I5EA 3Q7EA 4QE3A 4WZAE 5ESXA 3TQRA 1E0KA 2J8ZA 2R7ZA 1HETA 3GZJA 1B42A 1AKRA 2FN4A 4NBWA 2DUNA 3ZGOA 1J0AA 1QK5A 2PSDA 5ALUA 2CHQA 1U28A 1YRHA 2GNOA 3KKOA 1S96A 2B4YA 3LGAA 2EL9A 3WYCA 2VUGA 1ZSVA 2WSMA 1QO7A 1UKZA 2AFHA 3VZDA 1BH6A 2M98A 3LUGA 3G9ZA 5HP4A 2UZ0A 3FA2A 3WLFA 5KX5B 4P7GA 1BW9B 1KRHA 2ATCA 2UZ3A 1KJYA 1USVA 2VHWA 3EFOB 4IJ5A 3WL7A 3MWKA 2XCSB 2CD7A 3IFSA 1ZSNA 1L8QA 3LM8A 3OH8A 3PLNA 1PJLA 1WSAA 1LSJA 2IELA 2SKCA 5GJCA 3RFFA 4RHTA 2CL7X 5EE3A 2XMZA 4CCYB 3L02A 4D80A 1YB7A 5C3MA 1V51A 2W9XA 3KHUA 5D1OA 2C7RA 2CT8A 3U1TA 3AVXA 4IO0A 4WWHA 1PZMA 3QOYA 2AI3A 4DJJA 3TCKA 4UUMA 1GCAA 3E23A 4RLQA 7ADHA 3TLGB 3IAEA 1CFZA 4AZTA 2Z2KA 2JD1A 4MV3A 1C80A 2HBZA 4HLDA 4NNPA 5I9TA 4A73A 2WKSA 5LZ4A 1EBUA 4XVQA 5GOZA 2JI7A 3T3NA 1ZWKA 4MVCA 3L8YA 3PC3A 1VBKA 5JZVA 4JIMA 3OQMA 3A70A 4DSOA 3BJIC 3DT6A 4GM1A 4GPEA 4XVHA 2OAEA 3N75A 1KMQA 2JH9A 4O4HA 4PNHA 2A88A 4Q3OA 4C4ZA 2ROQA 2PN1A 4LGYA 5F2NA 1JHDA 3DQPA 4D44A 4AJ9A 4A1OA 1L5ZA 1E6KA 2WF6A 3QWIA 3NAQA 4EGSA 4TV9F 5KFMA 3JWHA 2FG7C 4MVYA 4OX9H 3KXDA 3N43B 4UM9D 1VZ2A 3ILXA 4EHAA 1KAGA 1RM5A 4YDQA 5IN4A 2HIAA 5KG1A 2G0AA 2VHEA 1Z4QA 3OFKA 1MQAA 2WT4A 3LU1A 1KNXA 1MO3A 3H0KA 3ISVA 5HMLA 2BLNA 3HMQA 5J5VA 1VA4A 4DVGA 3V42A 2V0CA 5F7JA 2YV2A 3F6PA 5HE8A 5AI0A 4L78A 1WCXA 2A59A 3TVDA 5HZKA 2WZDA 3VDRA 2Z2JA 3OLQA 3PGJA 4TMXA 3DG9A 3ZYZA 5IJZA 1S97A 1CUZA 3SD7A 2XCIA 4KNYA 5H5JA 4K3VA 3DC2A 5DLDA 2JZCA 1Y42X 2GYVA 1J2EA 1VL5A 3GTKA 4KFRA 1L5VA 3ELUA 2COEA 2H1WA 4CKEB 1OMOA 4O7NA 1I6KA 2PJZA 3FRHA 2E48A 5IARA 5TB5A 2C5HA 4LTMA 2FB9A 2GN2A 5FPRA 3CZMA 4BO5A 2VUUA 4WSOA 1DKLA 3QU4A 4DA9A 5BURA 2VK4A 3ZLVA 3TL6A 3NM5A 1JA1A 3IUPA 5EVJA 4YJFB 1JVNA 3D6JA 5LXTA 4MDYA 1SIOA 2V6GA 4X20A 1I2CA 4E5DA 2V4RA 5KT5A 1RAIA 1SUDA 1XRNA 2OENG 1B26A 1P5ZB 2YYYA 3DDNA 3NKVA 3SIWA 3VISA 2AOVA 4UUQA 3ZU4A 5MF6A 4JA2A 1G21A 4YREA 3FHJA 4OFBA 1JDEA 1S68A 4R5HA 10MHA 1J1IA 1TVKA 2QTAA 3SCZA 4O86A 4FONA 4F4CA 3MAGA 3WGQA 1YI8A 1M6VB 1XLTA 3INYA 5F7OA 5CIWA 1TZBA 3GUYA 2GZHA 1J8FA 2ZZKA 5FBVB 3COVA 5KVSA 3AUKA 1ONBA 3TZLA 1XD2A 3OQ6A 5ARCA 4GWLA 2BGWA 5ITZA 2CXUA 5C8VA 1T4MA 4M1OA 2GBCA 3HGQA 2ZR7A 5HA5A 3OTHA 1ZGAA 1F6BA 4KAAA 1C7QA 2XLBA 2ICAA 3CX7A 4EBFA 5JHGB 1QHHB 1IB0A 2IJGX 3QX9A 3UPUA 1OX4A 1U7WA 1GYQA 1EM6A 1FXWF 2A5GA 5L9XA 2EG9A 1H1LB 4FBGA 4RWEA 4RVOA 2IYUA 1JNXX 3H0EA 3VV2A 4ZIRB 2EX1A 2OV6A 4RB0A 1CQWA 3CRQA 2C8VA 2X3YA 3AF4A 2EC5A 3BWBA 2WABA 2VBGA 1F0PA 3E22B 1DX6A 1O8CA 2GBIA 2ZK7A 1I2DA 3D8HA 3DEKA 4OHZA 3AVYA 4BE7B 4I81A 1OH8A 2OCKA 4LQCA 1I6UA 1YT5A 2H00A 2YWDA 2ODAA 5J2UA 4LJAA 2JEGA 1YJCA 4DMFA 1W48A 1CZLA 2EGHA 3RBVA 1U7TA 2YL2A 1ONPA 4ZHQF 1YOVA 4YY3B 4PBRA 3V9AA 3AIIA 1AKVA 3WNBA 2YZNA 3W78A 4Z49A 4PR3A 3AM3A 4CLRA 3WWHA 1JYSA 5KNBH 2FH5B 4C3ZA 4UBNA 3FLBA 4G1FA 1HTWA 5F51A 2JF0A 2FEAA 2FN9A 2PVCA 1QR2A 3I34X 4I1YA 4DR1B 5AUOB 4EJSC 3H83A 1CY4A 4HDSB 5JDCC 1YS7A 3M6XA 4EATA 1EX7A 1O08A 3Q85A 2X0KA 2EFJA 3AUAA 1MD9A 1GAEO 3GPIA 4WLVA 2QTRA 3Q8XB 5H1YA 3T9DA 4F45A 1YQDA 2QWXA 4XEUA 5HCIA 3V8VA 1MVOA 3TTTA 1GUAA 3UW1A 2YX1A 3HO1A 3UF0A 1MZPA 2G6TA 2PPLA 4JI1B 2VF7A 3I6QA 4Y2VA 1EUDB 2PD4A 2X0SA 2RDMA 3NRCA 4UNIA 3RRXA 2OCYC 5AJHA 2BELA 3EBLA 2DQSA 3RQIA 5ADWA 1AURA 4CMHA 1P9LA 5KWJA 1A0IA 1W5BA 3BMXA 4IIJA 4OJYA 4UBOA 1ICEA 2G63A 4LVOA 1IN8A 721PA 3OTIA 3DBRA 2ZS7A 1K6XA 4TV8A 5A2QA 2TS1A 1RXCA 2UYQA 4RZHA 5C5DA 4QM7A 1WD7A 1PJ3A 5BN5B 4YRMA 1L1EA 1QOZA 1WVIA 4LRTB 5DHAA 3M1YA 1W96A 3P4XA 4UHHA 1E2PA 3MWLA 2HG8A 2BEWB 1CCWA 1VJ5A 1DAGA 3EXHB 2COUA 3TNDA 4YLYA 3MCUA 3CWCA 3CXRA 4MPPA 3OOJA 2IZZA 3ITEA 1OBFO 4K26A 3OT5A 4A2CA 4CYMA 2JAPA 2PBLA 5JCZA 1GA1A 5IEJA 4UUAA 4WE3A 3H20A 2FK7A 1Q3KA 1VJCA 1E98A 2FWMX 2X2EA 4FFBB 4BC1A 1HLGA 1K5HA 3P5SA 4LF6H 3QPAA 4KRYA 3BILA 2QUBA 1H6BA 2C4KA 2YS6A 1J7KA 3VYRB 3DFMA 5GTDA 1AF7A 2XWBF 2WU8A 1HL7A 3DFKA 5M7EA 8MHTA 4Q9NA 1DCMA 4Q3NA 1A9XB 3BWVA 3LBAA 1QIGA 1NXVA 4PZ8A 4I4TB 2H29A 3DTVA 4MW9A 5K3FA 3ROXA 3W1VA 1QIFA 5A1JA 4KO8A 4TQGA 2QY6A 4QD3A 5AW0A 1TGYA 2R3SA 3NW9A 2NVUB 4LA4A 5KNDH 2WFZA 2REBA 4E4RA 2W6MA 3EQ2A 5EHIA 2I33A 2F90A 5CX1B 3SE0A 1OI3A 4ER7A 4HV4A 2FGJA 4DV6B 4B0OA 2DLNA 1GRNA 2JJMA 2JJ1D 3LIIA 5F35A 1MPTA 3PUWA 3GUUA 1FOEB 1QVZA 3ESXA 1ZP6A 5KOHA 3MQ2A 4URUR 2Y71A 4U9HS 1PK9A 1Z17A 3LKBA 4X1KA 1FJXA 5KFDA 1Q6YA 3LQFA 3A3PA 4BOYA 4YPVA 3TZ6A 5A04A 1TE2A 4DKJA 4CEIB 4U6QA 2F9FA 4B7UA 1DKOA 3E5NA 1QVWA 5BT9A 5JH7B 5E4JA 3OCXA 2IY7A 1FSZA 2UDPA 2HO5A 5IU6A 4ZOLF 5B7GA 2GEJA 4PNPA 4OJNA 4XZ3A 1AQYA 1JPVA 1IVYA 2V7GA 4CF5A 5L3QB 2JG3A 1KI6B 1N2BA 1T5SA 4KWCA 2AG6A 4NMWA 1RKXA 2ZRPA 3C7DB 1F0KA 1XTIA 1Y4SA 2Z1DA 4R71A 5FPQA 3DXYA 1X7GA 3FZYA 4L4SA 3D4BA 3ITKA 5LQAA 3INNA 1U0SY 3KOOA 4LFBH 3KSZO 3CO0S 3N86A 1N9KA 4V0MA 5A2QW 2B1QA 2I67A 4UC0A 3H4MA 1VCMA 3S40A 3UMFA 4GC9A 1AT1A 3ICOA 3UK7A 5BYKA 3EN0A 2PZMA 1MO4A 1KYIA 1EDZA 3GVXA 2WM9B 3B8HA 2CV2A 2VQFB 2ZRAA 2G09A 1QH8B 2OAGA 4J0JA 4PZ0A 4DAEA 2BUBA 4B71A 1KAMA 3QYPA 4JC8A 2HYDA 3IXQA 3UAGA 4ARSA 4CF3A 3GG2A 4YUWA 3ELBA 4OIMA 2C04A 1RHJA 2AHOA 4MS4A