3R5XA

Crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
306
structure length
302
Chain Sequence
SNAMRIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNEKMDLIEKAKDIDFALLALHGKYGEDGTVQGTLESLGIPYSGSNMLSSGICMDKNISKKILRYEGIETPDWIELTKMEDLNFDELDKLGFPLVVKPNSVGVKIVYDKDELISMLETVFEWDSEVVIEKYIKGEEITCSIFDGKQLPIISIRHAAEFFDYNAKYDDASTIEEVIELPAELKERVNKASLACYKALKCSVYARVDMMVKDGIPYVMEVNTLPGMTQASLLPKSADAAGIHYSKLLDMIIETSLRVRKEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis complexed with ATP
rcsb
source organism Bacillus anthracis
total genus 84
structure length 302
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3r5xA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3r5xA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r5xA01
4DIMA 4HR7A 1WR2A 4O7SA 4C5CA 1CQJB 4O86A 3TW6A 1B6RA 4O84A 2HGSA 2YRWA 3WNZA 3TIIA 2GQRA 2YS6A 4MV3A 4XX0B 2YZGA 5D8DA 2VR1A 4C5BA 1E4EB 4Y8VB 5LYJF 1C3OA 4FFMA 1M6VA 5CAEB 3BSYA 5JVDF 2P0AA 3N6RA 1KJJA 2XD4A 2GLTA 2W6OA 5LA6F 2W71A 1VBHA 4M9UA 4O7VA 4ME6A 3ORQA 2R7KA 4M9CA 4EGQA 4O83A 2NUAB 5I47A 4IWYA 2OLSA 1GSOA 1KJQA 4YBZB 4O7TA 1B6SA 4YB8B 2NPOA 4TUYF 5J2TF 4YJ2F 4RZQA 4EA9A 2V59A 1CS0A 1OBDA 4EAAA 3JZIA 1C30A 3WO1A 3KAKA 2R6FA 2NU8B 1AUVA 4EA8A 5IYZF 4O4JF 1A9XA 3TINA 3R5XA 5BMVF 5HBRB 1I7LA 1BXRA 1IOVA 2Z04A 2W6QA 1EHIA 5KX5F 2R84A 1DIKA 4O4LF 1PK8A 2VQDA 1SCUB 4IHJF 5H80A 3K3PA 4O4IF 4FFLA 3MWEA 4O7ZA 1VKZA 1I7NA 2PVPA 2C00A 5LOVF 2IP4A 5J2UF 3JRWA 3R5FA 1EZ1A 3LWBA 4O7RA 5JQWA 3U54A 1Z2PX 4NYEA 1KJ8A 3VA7A 3Q2OA 2ZDQA 4O81A 3K5IA 1JKJB 2NU9B 3JZFA 1KJ9A 2GQSA 5C8YF 2R85A 3HB9A 5BPHA 1CE8A 2GPWA 2FB9A 5CB4F 3NUAA 3OUZA 5FNVF 2QK4A 5BPFA 5HV6A 1EYZA 2QF7A 4IIJF 2NU6B 3WO0A 3RUPA 1PX2A 2R82A 5JVLA 4XYMB 4M98A 2DLNA 1KJIA 3R23A 2I87A 2X0SA 4IZOA 3RV3A 4I50F 2R7NA 4WD3A 1Z2OX 3HO8A 1GLVA 5C1PA 4O2BF 1KC7A 4L1KA 2YZMA 3TIGA 4EGJA 2PBZA 3LP8A 1DV1A 4MA0A 5CA1F 4HNVA 4ZHQF 2CNQA 2PN1A 4MV6A 1JDBB 2SCUB 3ETHA 4DLKA 4YAKB 2GPSA 2W6NA 3E5NA 4WBNF 4O7LA 3BFPA 2YRXA 5JH7F 2FPIB 3Q1KA 3R9RA 1EUDB 2ZDGA 3TQTA 1ULZA 2CQYA 1UC8A 3KALA 4C5AA 5CA0F 3VPDA 1M0TA 2ZDHA 4EABA 4MV8A 1W93A 1BNCA 5JQGF 4FGRA 4MV4A 3VOTA 3OUUA 2FPGB 2W6MA 1EUCB 1OBGA 2YZNA 3G8DA 1KUTA 3JRXA 1KEEA 1E4EA 2YS7A 1Z2NX 3VPCA 4O4HF 2R7MA 5EZYF 2Z02A 4E4TA 4ZQIA 4HNTA 4FE2A 2CNVA 4M99A 4FFOA 2I80A 2R86A 3GLKA 3N8DA 4XZ3B 1JLLB 2YWVA 4TV8F 5LXTF 3AW8A 3U9TA 2WYOA 3HBLA 2W6ZA 2VPQA 4ZOLF 2DZDA 4YJ3F 3KAJA 4HNUA 1KBLA 3KREA 5KKNB 2DIKA 3G8CA 3MWDA 4O2AF 1GSHA 1GGOA 1GSAA 4TV9F 5GONF 3ETJA 2YW2A 2V58A 1AUXA 4O7WA 3RV4A 2VHEA 1W96A 2NU7B 2J9GA 3DF7A 4FFNA 3BG5A 4FFPA 1DV2A 2XCLA 4ZI7F 4EA7A 4MV1A 4O82A 3MJFA 4IWXA 2R7LA 4MA5A 5C1OA 3I12A 1T36A 3BSWA 3U9SA 3VMMA 1VBGA 1UC9A 2R87A 3AX6A 4J6EA 2FPPB 2YYAA 2CZGA 4EG0A 4QSHA 1A48A 1IOWA 1M0WA 2DWCA 3V4SA 2W70A 2YL2A 4O7NA 3GIDA 4GGMX 4MAMA 3K5HA 5K2MA 4HQ6A 2I8CA 1JDEA 2CNUA 5DMXA 3VPBA 4I4TF 4I55F 3ORRA 3QFFA 3U55A 3R5HA 4FFRA 4MV9A 2W6PA 2FP4B 4O7YA 3UFXB 3V4ZA 3SE7A 2YZLA 5LP6F 2HJWA 2V5AA 3BSSA 1CQIB 4FU0A 4XYLB 4YAJB 3RFCA 4MV7A
chains in the Genus database with same CATH superfamily
2XCRB 4FYYA 3BMQB 3IKLA 1HE5A 1KHTA 3HNRA 3TTXA 4KL8S 4Z4HA 3NHJA 3O7MA 3O38A 1U28C 4ZO4A 2WAQE 1HE3A 4D6YA 4D0GA 4DLPA 4NJMA 4OMDA 4IGKA 3KKOA 3A37A 1NL3A 3F9CA 4MWBA 2OE2A 4W9NA 4NU6A 1U9IA 4F1KA 4UQPA 2VHVA 1K6EA 3NB0A 2CXUA 3T61A 3RIZA 2A1TS 2QXYA 4ZREA 4D41A 1J2RA 4HB2A 3RTXA 5CEEA 4ZCQA 3KM0A 4BN5A 4GHWA 4TRJA 1UR5A 1B3BA 3QHPA 2OBNA 4ZGBA 1JG2A 1I50A 5KFQA 3DT8A 4IZ6A 2B94A 3ZIAA 4BGVA 1QH1B 1R9NA 1FUIA 2ZUTA 4MMXB 1C8BA 4CQLA 3LDAA 4KNYA 2UUPA 3RVBA 5BMVA 5IJ0B 2ZSKA 4OO3A 4R2HA 4NG4A 4ZEWA 2J6CA 1U2DA 3UWDA 2ALJA 2OWEA 4YRNA 4L72A 1XRRA 1PD0A 3O73A 1GWNA 2JL1A 1I2CA 3AHGA 2O2DA 1GU7A 4REQA 2IH5A 2ALZA 1HMPA 4K3UA 1T1RA 4CPDA 1E1QA 4HH0A 3EZ7A 3SHTA 3BXXA 4OK3A 1P33A 3THOA 4TZTA 5E0KB 3RADC 4NFSA 3TEKA 4OSEA 1KBQA 5HMMA 1PDOA 5CXQA 5C8ZA 2VPIA 4MKRA 1OXUA 1KKLA 4RXUA 3ZS9A 2IUSA 1B6TA 1GO3E 1M6VB 1L2TA 1TUGA 3ZLTA 2PO7A 2OVBA 1SU4A 2AMLA 3BFJA 1JIJA 3N8HA 4ERNA 3ETEA 1W6UA 4TXNA 1MLDA 3FOBA 4DKXA 3VH4A 2W48A 2W2XA 4ENWA 3BF7A 3OQJA 3P52A 2WP8J 1JE0A 4GXNA 3R3HA 3HUFA 1P4GA 1ACMA 4YS6A 3CUUA 3P9ZA 4R2KA 5FOSA 4BVFA 2ZVPX 1JQLB 3JQPA 3QJ5A 2BKXA 3A27A 5EP3A 5JHHB 1PR6A 3C41J 2EL7A 4OM8A 2XMPA 4IJVA 1UXHA 4PZLA 4CHTA 3QUCA 5LLDA 2XTNA 4M22A 1NY6A 4NMXB 2VJBA 5A2QA 3LQQA 1S5PA 1CUCA 3K0SA 2E48A 3S2UA 1ZHHA 4A27A 5ULLA 4QUAA 4YALA 1E0JA 1XZEA 1ZSYA 3IEIA 4GF5A 1AU9A 5HOEA 3M5CA 4DA4A 4Q15A 1H94A 4YRAA 3FHOA 2WIAA 5JSHA 5EFZA 1KI9A 2Y4OA 3WK6A 5K5EA 1NYQA 4BV2A 4FN4A 1T34A 2CWWA 3TEMA 2ISCA 4OL0A 1JEOA 3PJFA 4QFBA 2FOXA 3CNNA 3T1NA 1QP8A 3DPIA 1Z63A 2WF9A 3SICE 1S2DA 1XN1A 4H0NA 1BW9B 2MYTA 4HMQA 2IT1A 4FWIB 1FTNA 4U63A 1QK5A 2BKAA 3WWOA 4GPBA 4S05A 2CD7A 2ZUUA 4RPGA 1JJVA 4O5AA 3A3OA 2PZFA 5TPZD 3ESRA 4RXMA 4X1YB 1OAOA 3FM9A 2IZ0A 3K6SB 4DYVA 1XZLA 2YR0A 3T4EA 2PSDA 3T54A 3B78A 1U5AA 1VM6A 4XJTA 2CLEB 1N2GA 3MQ2A 1V39A 3DEIA 4EW3A 3UH1A 5ALVA 1WMBA 3H0KA 2G4LA 4ZP1A 3Q8SB 3DW1X 5ECGC 4RJLA 4B31A 1WF6A 4R84A 2QM7A 3HVIA 2Z1MA 1TI7A 4XM2A 2GF9A 3AR3A 2FCRA 4RIFA 3QVSA 5E1OA 3ZH9B 3WLHA 1LV8A 3V55A 3RYCA 2HGZA 4YBRA 3OE1A 2COKA 1RI2A 3WL6A 2VF2A 1J0XO 1RQXA 2YNMC 5DHPA 4EFMA 1KJJA 4UVDA 2W6OA 3EFEA 1FQOA 4LOJA 3ZKWB 3PPIA 5BP7A 3LVBA 1NW7A 3K72B 2FPWA 4F6LA 1EFCA 1P62B 4KBYA 1GUFA 3ZDYB 1M2WA 3I45A 2NXJA 2AVNA 5C4GB 3NWPA 3DYBA 1U5BB 4OQQA 1X7WB 1JWLA 4DSUA 2W11A 1SBHA 5EWEA 5EKTA 1QGAA 2EBWA 5BYKA 4TMKA 3UC9A 3RUDA 3HJNA 1CULC 4CCWA 4TWBA 2IYSA 1THZA 3R5XA 3N07A 4DNOA 1RCUA 1CEEA 3U09A 4W8GA 4JA0A 2GD1O 4WZZA 1SRRA 2ZAOA 4G8JA 3JSXA 1IFXA 3OQOA 4JI2H 4QIWA 3VR6A 2DEUA 3DNMA 4RK7A 4O4IA 4LSMA 2CMHA 2XGQA 4BO0A 4G3IA 3Q7SA 3JZFA 2GYWA 2EHJA 4RJ2A 3R3WA 2PTGA 3IURA 2K2QB 3GCWA 5AW8A 3S27A 5FNVF 1IQUA 3LCMA 4QWAA 1CF9A 5B7PA 3TIXB 4J2TA 2ZB7A 3KTMA 4EKEA 4Q18A 5J4LA 3C1TA 3B8HA 3BJIC 2B4AA 4QGFA 3IAS6 3RS7A 4NONA 4C6RA 4CV0A 3V97A 4DNXA 3HKDA 3PNKA 4OFZA 4J9VA 4JI8B 3FFTA 1ORVA 5EJ8A 2NSJA 3JQCA 4KC0A 2YOGA 3WGIA 4NS1A 3GTOA 4L4RA 3K0CC 1KVTA 4LZOA 3LZ6A 3HCFA 3LUBA 1UQRA 5EOVA 4FGKA 5I6DA 1XZAA 4GL2A 1R5BA 2WWIA 2D4AA 3RVNA 2QU8A 4TQAA 3W0LB 5K3CA 3PJDA 4H18A 3COJA 3AI3A 1BU5A 1I2KA 3LY5A 4NK4A 2EJUA 4MUKA 2OORA 1PF7E 3GLGA 1NBEA 3KE8A 2WWXA 3RVMA 4US2R 1NJ2A 1J8VA 2AQIA 3KNZA 3PFBA 4YMHA 4M55A 1U1GA 1Z5ZA 1C9KA 2OZLB 3ONVA 4YDQA 1PNQA 4HQFA 1E1RD 4IOJA 3FUTA 3ZDXB 1EE1A 1OREA 2YOHA 5HQTA 3M0EA 4JJ6A 2QT9A 2DB3A 1YOBA 3A9RA 4DSOA 3S1LA 1QYDA 5K9ZA 5KNBD 2VNKA 2DWPA 1UXJA 2H3EA 3RVJA 1YS1X 3UF0A 4V1CI 2XOEA 2E5LH 2AE1A 3D3WB 3CX4A 3RFTA 2HNAA 2BFOA 2FOLA 5A9TA 1C0LA 1N36H 5KNDD 3TOCA 4BFZA 4IIDA 2ZBUA 4BRZA 1GSHA 1JIKA 1WV0A 2C42A 4R5MA 2Z83A 5AKHA 1ZW6A 2YTZA 4UZEA 1EHYA 1B6GA 3ZWQA 1MJHA 1AQUA 3CRQA 5MGBA 4RF5A 3UH0A 3LIPA 4P81A 2PYDA 2C5BA 2GRJA 1JW9B 2QSYA 4W5WA 4I1YA 3T7KA 1MEOA 3LUGA 4PG4A 4P5DA 4D1YA 4EELA 4HPJB 2IXDA 2Q5LA 4LQ4A 4BN0A 1ISJA 1HQDA 1IEVA 3V1UA 5C34B 3TLAA 5EFOA 1Z6QA 3H4IA 3U3XA 3KKNA 2IS2A 2XMSA 4LOLA 3L7MA 3KHLA 1G5PA 4RXTA 3UOGA 3BRQA 2QQ0A 4N9QA 1ORDA 3RS4A 5K2MA 3JYNA 2PS3A 1GLNA 3T9DA 1K89A 4O25A 1GPH1 1BU8A 1LSOA 5BN3B 2O3JA 4L4UA 4KQXA 4GLBA 3WIBA 4ZVRA 3MC1A 5GJWC 2HJWA 1NKSA 2ZW9A 2HCTA 1UBUS 3JVDA 3AHCA 3B6EA 1G5FA 3PS9A 1PDVA 2IXEA 1NC3A 3O7WA 4MUEA 1UFRA 4PC1A 3RVDA 1M72A 3LK6A 1GPKA 2R48A 1RXUA 1GZDA 4GNRA 2ROQA 3G1TA 1TKCA 2OBYA 4PC2A 1RBZA 5KWSA 1P2UA 1G5TA 3ETDA 3FF4A 2JARA 4O4HB 4QIWE 1C7QA 3RDPA 5CVJA 1FFWA 5C5DA 1A4RA 2C84A 3MWJA 4MS1B 3EZGA 1D1QA 3I5UA 7GPBA 3ABIA 4CCYB 5B57C 4MVYA 4E5UA 5IZCA 5FQOA 1IBCA 2NYAA 2JBAB 5B2FA 1L4GA 4DLBA 3F5QA 2UVWA 1HDXA 3LUFA 4W1SA 4KR3A 4WMLA 2ORED 4Q4AB 4IGAA 2UVPA 5JD3A 1YAJA 4Y3UA 3RIXA 4LY3A 4JH0A 1MAHA 2H5JA 3W2IA 1LBIA 5H3CA 2WYUA 4L3OA 4B32A 1JAYA 1RIFA 3FZQA 4ND7A 1OH8A 3O31A 2QJTA 4D3ZA 3OU6A 3G9QA 3V2IA 4B4DA 4KGVA 3HR4A 5CHEA 2CCKA 3OBIA 1NMEA 3E9ZA 4LGVA 4E12A 1AXGA 1Z47A 5IANA 4Q9NA 4Q0MA 3QIVA 2J33A 1XIVA 3KE9A 5D5HA 3GVXA 1RJ9A 1Q1GA 3D3EA 3LQKA 4XCVA 3HDGA 4JI0B 2V4MA 3GLGE 4D8VA 3BB4A 1A7UA 2PV7A 2Y1FA 1GFWA 4L74A 4NFLA 2ERXA 4N3AA 3DLAA 4ID9A 3ZW7A 2BONA 4P54A 5IKPA 3L0BA 4NJMB 3WP0A 4Y0NA 4RO0A 1JQDA 4RZIA 1V71A 3OLXA 2QGZA 4IFIA 4QOFA 4Y2GA 4YAEA 4RUKA 1Y48E 3UXYA 4XM1A 1FP2A 4WKNA 2Y1XA 2N9UA 1W2GA 3ETHA 3F97A 2PD3A 2WNIA 3CF6R 2J0EA 4EG8A 3ESDA 3CNHA 2WPNA 3WA7A 4C2UA 3KWMA 3FHCB 1FJ2A 4W9NC 2J9XB 1U9IC 4Y9TA 2ONKA 1GZSA 3HJFA 4NPCA 1IIBA 1RKQA 4NG5A 2VFAA 2X0KA 2JA8G 2RHWA 1UJBA 2ZWAA 5L6MB 2FLPA 4GPEA 5K05A 4FGRA 2F8SA 4NCHA 4IF6A 3O0DA 4CQLB 3IODA 4MUBA 4K0KB 4EVSA 5BMVB 1QYWA 3KQMA 4IRKA 3DZCA 2C97A 1L5YA 2H00A 6ABPA 4G5XA 3N8KA 4GKVA 4R1UA 2NUAA 4BJ1A 1HM5A 4REQB 5KQPA 1GG8A 3CUWA 2GWRA 3TZLA 1B0UA 4X61A 1BE1A 4XIFA 1O77A 2AOTA 4MMZB 4QGSA 3WWPA 1JALA 4RU1A 1NF2A 3H4VA 5EI5A 5ITZA 4QPDA 4RJIA 1N8TA 3KTFA 1Z0ZA 1GVHA 1ATIA 3HGQA 4DDUA 4CDGA 2GHIA 4MRNA 4Q12A 1OYWA 4G37A 1D3AA 3T0IA 2CUNA 5IABA 3CNQS 3Q6IA 2EZTA 3ISVA 4AF8A 3EPKA 1WP9A 3W5UA 3FNGA 2XOKD 3TB4A 1P9OA 4QW8A 4HL6A 4LWOA 2RDJA 3TZ6A 3INNA 4ZAVA 5J40A 2VXOA 3TWOA 3MFIA 1SWVA 2V6MA 4LC1A 3FFWA 1VIAA 1QPGA 5AVRA 5EUCA 3PQ2A 4FE7A 2XNKA 1PK9A 1T2CA 1KDRA 4KQKA 1K1SA 3C8MA 2VDOB 3I1JA 5BWBA 2QOEA 2MOKA 2GXSA 4UNIA 3SKYA 4Z0HO 1H9AA 1A7JA 2JI9A 2GN8A 1JFVA 2PMCA 2XKAA 5K0GA 2VDNB 4GPTA 2WOOA 1KYVA 2AKYA 3WDMA 5KMGA 1KQFA 2GEUA 3OF2A 5HJEA 2QLJA 4V03A 2VCEA 3DUFA 4YRPA 3EEIA 1AKTA 4G4GA 1RJFA 1ZY2A 4G23A 3ZQJA 4R1OA 1KFCB 4A3CG 4KSBA 4DCOA 1COZA 2D3TA 2Y05A 3E05A 3GFBA 5JXGA 1ET0A 2Z56A 3JU3A 1ADYA 1ECGA 4RTOA 3UMYA 1SQSA 4TUYA 3O03A 1A4XA 1Y4UA 4FZRA 1NAHA 4JV0A 4JI3B 1AUQA 1F12A 3Q40A 5A4FS 1VG1A 3CBQA 1GNVA 3TJRA 2CDBA 1RXWA 3MTJA 2PGLA 4WRRA 3KD3A 5BWXA 4P6VF 4REMA 2WOJA 4BP9A 1ZD8A 1MXHA 3RVKA 4FMPA 3U5ZB 2XUQA 3BERA 3JQAD 1AY0A 3S68A 4ZV4A 2DT5A 4X0EA 1ARZA 4N54A 3ESZA 3BCHA 2X7XA 1JZTA 2P2LA 3AGPA 1MF7A 4YMSA 1G0OA 4ACAA 4D0LB 5JS8A 4HNGA 3T7DA 4YR9A 1EVLA 1Z82A 1UIMA 5H02A 1NJ8A 1OAOC 2XRMA 4WXMA 1K92A 1Y98A 5KT2A 1ZLXA 1A8IA 2VPWA 3PC8A 3Q85A 4M0CA 5AXCA 2YMMA 3T1VA 4DZRA 1L7XA 4UE6A 6REQA 2YWRA 3MOIA 5BQXA 3RYCB 2YBDA 1UAGA 1O03A 4JVNA 1FK8A 3V8MA 3KSAC 5IC6A 4GE3A 3K7EA 5CE8A 1MRNA 1KC7A 4GR9A 4Q3AA 2ZSAA 4D3FA 2IPAB 3AUAA 4OIMA 2IODA 4XFKA 1U3UA 3FI9A 3O84A 4B3GA 3EVTA 3VZPA 3OWXA 3FPLA 3DHYA 1NQAO 2YJTD 4FOSA 1ZEJA 3G3EA 3ZWDA 4HF7A 1G19A 1DCFA 1CJBA 5IX8A 1QM5A 4MQBA 1KP9A 3Q7QA 2FFQA 1SY7A 5BSFA 2ORWA 3TZBA 3ZZMA 5D1HA 4YAFA 3D3JA 4LYDA 3EXG2 2SNIE 2R5WA 4RVFA 3BE4A 1L7RA 4X64B 1RP7A 1RAGA 4Z4CA 5DPMA 1NJSA 1N5KA 3W77A 1D7AA 1GQRA 4O4IB 2R8ZA 2QL5A 4L6IA 5EJEA 1MAUA 5JARA 4NV3A 4DUYH 3GYGA 1C8LA 1VSVA 3KB6A 4IF4A 2YFYA 3SSMA 4L8LA 5CB8A 3BQ9A 1QC5A 3CC8A 5DLQC 1CUIA 4OQFA 1RM3A 1JDTA 3HKEA 1TVMA 4HLUA 3HKDB 1XAIA 3BJEA 3I2GA 3MBKA 1GEEA 4Q7LA 1E79A 4CE5A 1E0AA 2I67A 4PYMA 4G4IA 4F9TA 2JD1A 3DZIA 1Z0IA 1ZAKA 3E1GA 4BQPA 1JYFA 1T2DA 4JUZA 5JDCA 3OI7A 4ZZIA 4LQCA 1TU4A 5HX7A 4XSVA 5DM70 3UB4A 2G0NA 3G2OA 4QJ3A 2EXXA 3IMGA 3GLGB 1H2XA 1RIIA 2LRHA 1EX6A 1FFYA 1C7JA 2HMAA 3R3JA 3BGOS 2AK2A 3LQ4A 3K2QA 3UN1A 3GVIA 2ZR9A 2AB0A 4CDNA 1WJGA 4DQKA 1KO7A 3OCCA 2ZJ8A 3U4MA 4C7KA 1MG0A 3H99A 3WKAA 2BPOA 3PUVA 2OORC 5HIMA 4YH1A 2JRLA 4A1OA 3CLVA 2GJ9A 1H8HA 5BYBA 2Q5JA 1X80A 1Z88A 2IUFA 2XDQA 3UK7A 1IM2A 5LLSA 4R16A 2YV5A 2O20A 1XAJA 2R92G 5DYGA 2ZTLA 3I53A 1AKUA 2ZWIA 4R2WA 5MF6A 2OBFA 4ASUD 4U3JA 9MHTA 1HORA 2P41A 3IP9A 1XWFA 1RE0A 1XX6A 1U7UA 2OCXA 2BM0A 2P27A 2OZKA 2F00A 1EEXB 1DFHA 5EJ9A 2WA1A 5EOYA 4BRWA 4DQUA 2QM8A 2B5WA 1O6GA 3B5EA 1F17A 5BOSA 3NNDA 1ZNXA 3OCJA 1JFFA 2ZYWX 4ABTA 1O08A 3V4OA 2Q3EA 1MVLA 3D6AA 1E6WA 5DQGA 1XU4A 4RLSA 4OHUA 3UWPA 5JZMA 1AKRA 1HH4A 2YIDA 1SBZA 3AVXA 3J7TA 2HUNA 4RV9A 2PRIA 4A16A 1JZQA 4ZT5A 4DAEA 4JYBA 3T7RA 2XLBA 4NYEA 2OP0A 4H6WA 3M9LA 4JT4A 4MUYA 4CETA 3RIHA 1TM4E 5K0LA 3HPQA 1CUHA 5AKXA 3OUZA 1K75A 4JBWA 3O2SB 4UMVA 1CRWG 4AMZA 2RGVA 3AETA 3EVFA 3AUYA 3QBJA 4O3SA 3IBSA 5D1PA 5CFNA 5K3WA 6PFKA 2HHJA 1KQNA 2X0SA 1ZJYA 2JFBA 4E5PA 1D8TA 1P0IA 4C9BA 3IHTA 2AN5A 4B3IA 1PGOA 1BFKA 3GJSA 3AF2A 4D81A 1JGTA 5CEFA 2ZT5A 5HKBA 4EFBA 1GL7A 3I6MA 5JYEA 2V6BA 1O5OA 2IDJA 2G17A 1HLPA 3DCYA 4IIHA 5FLYA 1ENPA 4M0LA 3WJ2A 2KQUA 4DL4A 4ECXA 3BMXA 4IICA 4LYJA 6AT1A 2EFYA 4OBBA 4DM3A 2IHZA 1XNRB 1JTFA 4Y2PA 1AS3A 2WDZA 3DXYA 4GI7A 1JAXA 2R6CA 3UWMA 1NE7A 4RAOA 1RSZA 4IS2A 4GG1A 1UPCA 4BEWA 3HL4A 1KU0A 3T9AA 3C4JA 5AVSA 1U2GA 3EYYA 3GCGA 1QLHA 2QIPA 2IKQA 3UK1A 1FRNA 5IZCC 3BA1A 3AKYA 2Q4BA 1V48A 1RZ3A 2O4CA 2R79A 1DG9A 2D2VA 3LOUA 1G8KA 4DWOA 3P8ZA 3JQ6A 4JMLA 3SR4A 1EVKA 3U9TA 1H2RS 3HBLA 1E8DA 4Q9LA 4LZNA 1P0CA 3ZI4A 3NP9A 1CY8A 4FDMA 1JYEA 4RPIA 3CNLA 4G9EA 3NKLA 1Q11A 4QECA 1RJ9B 4E5MA 2OQRA 1TYDE 3OMLA 3VKWA 1WXIA 1SU7A 1YB1A 2I78A 1LFAA 2A9RA 5HILA 3OTWA 1VHJA 2DHRA 4RHCA 4G63A 3H9QA 1Y1RA 4MPJA 1Y34E 3H2HA 4CTNA 1NDHA 1PBTA 2J07A 2F3PA 4A2AA 3TQCA 3QX9A 4EUNA 2CJYA 4UPEA 2RMKA 3PGLA 4PHCA 3P26A 1CUAA 2GTHA 5DISB 4D42A 4PEVA 4JV2A 3GCZA 2G25A 4J75A 1JLRA 3ITKA 2CNUA 2D5AA 3ORRA 1S2NA 2ERYA 4RY8A 1KQ3A 5HCNA 3A06A 4PQGA 3SDBA 5FYDA 3KUDA 3LGXA 4AJNA 2HRRA 3TLYA 2PUAA 2LKCA 5JO9A 4GX2A 5DISC 5D7BA 2FMIA 2VQSA 5JV5A 1E0KA 4MPRA 2VRBA 1ZR4A 3LL4A 3LIIA 1PL7A 5FD5A 2NUBA 1XU7A 1C3XA 3BWVA 1ZI8A 3GROA 3ANLA 1MU0A 1T2VA 2B25A 2QKYA 4D4GA 2GK7A 1J97A 1NLMA 1Z25A 4O02B 4CMAA 3MJTA 2OCBA 2NUAB 4ENQA 6NULA 1GSOA 2QMOA 3EGIA 4RFLA 1U1IA 3OICA 4MLZA 1WHSA 2AOTB 3ICWA 2F4VB 4EI8A 1KTIA 1JBKA 2K6GA 4OXYA 2Y3IA 5ITZB 3PCXA 2G0TA 3WP1B 2QPTA 2RI1A 2YVLA 2UXDH 2JLBA 1N92A 3DD5A 3ICQB 3OHPA 2B20A 4MIYA 3J80W 1RMYA 2NUPA 5H16A 5HIJA 3BC1A 1P45A 2FEOA 2QJWA 1Q21A 1CVRA 2I4TA 3O9ZA 2KSWA 4W9MC 2JGLA 3X0DA 2AUTA 4HPWA 2O9JA 2YHIA 3OX2A 5I7HA 1F3OA 4DWVA 1PFUA 2G83A 4RCZA 2JAQA 1NMQA 4FDLA 4A3LG 4I8DA 1ZD1A 2BZGA 3VNVA 4X41A 1UAAA 1H4VB 3C16C 4ZVKA 3O4RA 1M0SA 4DV5B 4AG3A 3JAWA 5IKEA 1CE8A 1BO6A 2V0GA 3E27A 4OQNA 2VQ3A 4WGGA 1QHGA 4MYSA 4N7MA 4BDTA 2P5SA 3B9BA 4YRLA 1T0HB 4DJFC 2WFLA 3WO0A 5GWXA 5ILQA 1G64A 5CW2A 1ZHQA 2PX8A 1IUNA 1XJCA 2YZ2A 8GPBA 3ONEA 1U7OA 4EBEA 5J3JA 2Q0QA 2AHOA 3KYBA 3PUKA 4PM4A 2XWJI 2NVUA 5KMGB 1A04A 5F2KA 1OXTA 5B7NA 3DUFB 1NC1A 4F4UA 2BHSA 1MJNA 1IEXA 4EGJA 5K1ZA 4QEZA 3RBXA 3G0GA 2OHJA 3F0TA 3T4UA 2R44A 4IH4A 3F71A 3HZRA 3G7UA 4V0LA 4MVWA 1HEYA 3ELUA 4RK6A 3TLEA 3ECAA 1WTAA 4HYKA 4TUYB 1L1RA 4A2CA 1RYSA 1PRYA 1LW6E 1N0VC 3PPWA 4Z86A 4D92A 4MAFA 1F1JA 1UC8A 3GTLA 3M9XA 1UBLS 2WZDA 5KSZA 3STYA 2R8YA 1QP0A 2V0NA 3SVTA 3JYPA 3ID6C 1ENZA 3NDRA 1YQEA 1WXFA 1Z38A 3D4OA 3OMWA 4FMBB 2W6MA 1BXGA 5EE3A 4V2UA 3ABSB 1V3UA 4KWEA 3PQDA 2OA0A 1D9ZA 2XQJA 4G85A 3MFYA 3OZIA 1SWWA 3RUIA 1RYFA 2K4MA 2HDNB 2JCBA 4MGYR 1D2CA 2V8BA 4YJ3F 2Q62A 3UY4A 3DVRX 4IVPA 1T4MA 3MWDA 3N5CA 4Q1BA 2GQ0A 4PLHA 2F6RA 3B6ZA 3Q9UA 1X3LA 1J5PA 2P35A 2HVRA 2NT3A 3KAPA 4OFXA 5T4FA 1FMTA 3MGBA 1JDZA 4BO7A 4DNQA 3DEAA 2FR1A 4JENA 2OHGA 6REQB 1Y80A 1L5HA 2F4NA 3GBSA 1OWNA 3TOZA 3DAPA 1CZLA 2ZSUA 5JIBA 1E4FT 1B14A 4DB4A 1HNZB 2QLNA 4HRAA 1UXGA 5CM8B 2HDKA 1F0NA 1TX4B 4WX2B 2NNWB 1ISMA 1IOWA 1Y7IA 2FP3A 3PC8C 3NDJA 1Q50A 3WNDA 1SR8A 5ALOA 2ESRA 4B5KA 4P80A 5AW9A 1XZFA 4BZWA 2QRMA 1GR0A 2WILA 4YQWA 3GPDG 1C7FA 4DTCA 1W73A 3U9LA 3EODA 4DWJA 4EUSA 2V7QD 3KD2A 1L4BA 1M67A 3H3XA 3QE0A 5TNXA 3JQ9A 1G8SA 1IEQA 3JTEA 3FG9A 4G0WA 3AU8A 3RS0A 1ZWLA 1M66A 3HXLA 2NTEA 4FW9A 3SIPA 2P4QA 3DONA 3N44B 1BMFD 5TIIA 3TMYA 2ZYDA 3UHFA 1AHNA 1WULS 4EBDA 5A4AA 4R2IA 3MOGA 5KYTA 4C4AA 4BGIA 1BVRA 1QYIA 3BAAA 4Q3CA 4US0R 1VB5A 2FLKA 1O5IA 1N2IA 2O8DA 1DKPA 1H42A 4LDNA 5LA6A 3CS3A 3UUWA 4RQBA 2BE9A 1V95A 3G2MA 1T3TA 3QLUA 4C4XA 5JSUA 4LXQA 1QC5B 3RTEA 4C4OA 4MKIA 3TKLA 3T41A 5AKIA 3HWX1 1XLUA 5KTNA 3HKEB 4NYMR 1OAKA 4PZPA 3SBEA 4UOEA 3S7TA 4A0SA 1ZD2P 3E5RA 2HF8A 3GT0A 4Z9BA 3PTAA 5B5SA 1WRVA 4B3MH 3DMNA 1YZKA 2G71A 4C2BA 3TQ1A 2G7ZA 4M54A 2X7HA 1YL5A 1E20A 1ODJA 4H31A 1J8MF 2YQ4A 3G8YA 4MUGA 3UYYA 2C2DA 4HLUC 4IHKA 5BORA 1DX4A 3IDSA 2V3CC 4IMJB 1IRIA 2AMVA 1LV7A 1Q7EA 2ZWOA 4JHXA 3NT4A 4DL9A 5JY1A 4MW5A 2ZTMA 1PR3A 2XGPA 5JDCC 4UM5A 2JCXA 4HEA6 1YFJA 4X97A 2REBA 1VIVA 2ZIWB 3AEUA 1UP7A 2YJGA 1RADA 3DCJA 1SFOA 1Z18A 4UHCA 2BTOA 4B0PA 4D9CA 4IZOA 2Q29A 5FOWA 1X80B 5EJ7A 1IQPA 2XDQB 3W90A 4YR3A 4LNAA 1ZL0A 1ZI6A 1NXVA 1SXIA 3K0EA 4NE7A 1XC7A 5E6SA 4CVNA 2ES4A 3NI2A 4U3JB 4S0ZA 3MJDA 3KOZA 3E53A 3USZA 4TL9A 4MKHA 1YA8A 1P29A 4GVLA 4KGXA 2HGWA 3B1JA 2X19A 1SOUA 3LGSA 2EEZA 2J46A 4ND6A 3VC3A 4HV4A 2Q3JA 2YJ5A 2DOKA 4HAZA 2PPLA 1KEVA 1JFFB 4D9EA 1B26A 3SQDA 4BO6A 3CKYA 2FN4A 5F73A 3F2VA 5EP2A 1ZC4A 4FQ8A 1JZSA 2ZQZA 1MB9A 1P2FA 3L7JA 1FRVA 2QY9A 2A58A 2XCQA 2E4WA 3ET4A 2YZNA 3PR1A 4TWJA 5LM3A 2GYVA 1GV1A 3K94A 2G88A 1XTRA 2VUTA 1JECA 2ENUA 3T3EA 4BRUA 4MCJA 4NU0A 1DAGA 1GZVA 2HYIC 4JXZA 3D43A 5NLLA 3QV2A 3OFSA 4Q16A 4YB8A 3VZQA 3BT7A 4P35A 3M2TA 1J06A 2P6RA 4J9MA 3AETB 3SKXA 2J5QA 3FDZA 2WUVA 1L7NA 3VPGA 3ND8A 4NVRA 5T67A 3VKFA 5EIBC 5FTKA 1MOQA 2B63A 4NATA 3DTNA 4HQ0A 3IPXA 1B41A 3ND7A 5A5VA 4BNVA 1P17A 2D2XA 3C43A 1I9CA 5KFJA 3AX6A 1BMQA 1N5JA 1OIXA 3MCZA 1HT0A 3PT9A 1KH2A 3OEED 1QWSA 3W8EA 2RGCA 5DM60 4INJA 1DUIA 2AMYA 5CDGA 4FFSA 5F9MA 1N6KA 4AW9A 4QTUB 3RIMA 4H1WA 3PUXA 3KHKA 3OM9A 5IAKA 4AMVA 4RIGA 5AVWA 1ZQ9A 1SO8A 1NOJA 2XRZA 2GERA 1WDTA 1JHOA 3AZPA 1O57A 3STTA 3GRPA 1LC0A 1ZHSA 1DP4A 4NNOA 4HRXA 4P4SA 2X8BA 4LRQA 4LJ4A 4FWTA 1C3OA 4A93G 4CR6A 3IUSA 4F04A 5DT9A 3UJ9A 3UQ8A 3EAQA 1U2GC 5ADHA 4D98A 2WR8A 3I5AA 2A6PA 3MD0A 4GP7A 4EG6A 3MLBA 4RNMA 1K4KA 3JR3A 3CVYA 3NOVA 3V7FA 1H9CA 1KZ4A 3HDQA 5KSPA 4QVGA 1R0WA 1E9VA 2ZRJA 1Y4SA 3O90A 4HFNA 1KDVA 4R9VA 1EUDA 4TQ9A 1T3NA 1AUVA 1E2PA 1E9RA 4OREX 1KK1A 1E1CA 1VHWA 3B7WA 4EPYA 1FNCA 2AF3C 4V39A 4KYTA 1QV7A 1C0EA 1C7IA 1CR4A 2AUNA 4AYWA 1CY0A 3P2JA 3GIKA 2G7MC 1E2MA 2NZ2A 2XBUA 5K0EA 2A9OA 1BSVA 3O3OB 4BJ3A 3FETA 2EP5A 3DLIA 4JUAA 3CCFA 3RRYA 4PPQA 3JVUA 3MTEA 1U2RA 3C70A 3RUPA 1IG3A 1XPRA 2QYHA 3HCOA 3WLLA 4UJ5A 3QX3A 3SFTA 1IXRC 3V1NA 4UZFA 1N8SA 1EAMA 5IC4A 1M54A 1IYDA 1AE1A 1S0UA 4ZZ0A 3K4PA 2PZBA 4Q4DA 1OW3B 3AF5A 4YP9A 5CPFA 3RQSA 3LPLA 2W2MA 1ZFNA 3Q1LA 4B33A 3A11A 1DJMA 3H04A 3LPMA 3M5DA 3ABOB 2CKMA 3TY8A 1YD7A 3H5NA 3I9LA 4QIHA 4RNOA 2HC9A 1WHSB 4DLKA 1XJWA 3MWMA 2G9ZA 4ZHSA 4QOGA 3LFTA 3MTAA 4KO1S 4D6XA 1XQWA 4OQPA 3QFTA 2I91A 2GUGA 4KHPB 3FYDA 1F51E 4HYYA 1DJLA 3TQTA 5LQAA 4RZ3A 5EWGA 5I7OA 5EEHA 5FPSA 2NUPB 3VPXA 3KR0A 3CSWA 1SIWA 1OMOA 2ODPA 3E0XA 3SQMA 3QBDA 5A1TA 4JYMA 1IL0A 1NU8A 5CA0A 2YHIB 2HSWA 1JUDA 2BFFA 2P2GA 2JVKA 4DSTA 4BUJA 2O7SA 3FI0A 3QWUA 3OY7A 3J7AK 1P9LA 5ARCA 2GT1A 3VPHA 1ORTA 2QZSA 5KFXA 3NYWA 2RB5A 5GINE 4C76A 3N76A 5JHGB 3T5BA 1O6ZA 1LBEA 2IHBA 3BB3A 2AC2A 5FOQA 3JAWB 4IIVA 3NM5A 1CE8B 4W5QA 2OR3A 4JSRA 3ANMA 4M0DA 4UPDA 3A9CA 2OV4A 4ZYTA 4ZOLA 4MW1A 4NBNA 2C77A 2WFLB 3O74A 4LH6A 4BY9E 1GPBA 4KWTA 1U4SA 5CT6A 4ZA2A 4UUPA 1JQAA 3RFFA 1SGWA 4P3PA 3MJFA 1KNXA 1YDHA 2XR1A 3HO1A 2NVUB 3ZHSA 1EBUA 2NXWA 1XCBA 3K2IA 3LC0A 2GXUA 2ID9A 4NXMH 3WQBA 4D4MA 4IG9A 2WC1A 1YONA 1KPGA 4O7NA 2ECPA 3L0SA 4JEUA 3PVSA 4J9UE 3P20A 5JCZA 3GEPA 4UOQA 1YV9A 4FFWA 4OSOA 1OXBB 1JIXA 2AFVA 2LNDA 4U6SA 5ABPA 1YJXA 5KTKA 3OX4A 2ZRAA 3GNSA 1XZDA 2JIZA 4W5JA 1TXGA 2PL3A 1G8PA 3CE6A 2DTXA 1P19A 4PO1A 2I6SA 4Q4CA 4JI6B 2VNSA 3B20A 1I4OA 1JQBA 1WMSA 1CUUA 4DA8A 1BXGB 1O95A 4FGWA 2X2EA 3V8VA 4AS3A 1NBMA 1TF5A 4A3GG 2WV7A 4B6QA 1KY5A 5A0FA 1PWHA 5FJJA 2LV8A 4QC2A 3N3AC 2X7JA 2XZLA 2D1QA 5JAIA 2NG1A 4RFSA 1ZH2A 3SZLA 3PPXA 1TWFA 2PBLA 5ICCA 3PCRB 2C4WA 5IKMA 3HJAA 2HHHB 3UK0A 3MWDB 2XNSA 3RB6A 3LBAA 1XZIA 4UAUA 2JEOA 3SYRA 1J5EB 3PTZA 3OQBA 3H2YA 1AMOA 1SVMA 2QJFA 2RKWA 2WVHA 3ACBA 5AR1A 2Z9CA 1L5HB 5FPRA 2WKPA 4NBTA 3PP8A 1Y5NA 4KPGA 1NQXA 1EUZA 4AY4A 5IUJC 4RENA 4QQKA 3DR3A 2XA9A 1PCXA 3LUJA 1KWKA 3DBHA 3K09A 1HTTA 1VRWA 2NQ8A 1FRFS 1ILEA 4FR0A 2A9FA 2PZKA 1CBUA 4YT5A 3IRUA 2XB2A 2C0PA 3KL2A 3PI7A 5ICMA 5E9WA 4YIKA 2ASLA 1OX4A 2OYRA 2PYIA 4O7RA 5LYYA 3LHKA 4ED8A 4G65A 1KRXA 5K0FA 4QQNA 3VYRB 1B00A 2FA9A 1ESNA 3K9BA 2YVUA 3JYQA 5DK6A 2J09A 4KRGA 4DA9A 3I01A 3R6DA 3SFZA 4NHEA 3FAZA 2VPSA 3GJ8A 4BO2A 4A2PA 4D82A 1T1GA 2PX2A 4M1ZA 4NZPA 4CLXA 4HEJA 3BXPA 2IYEA 1ULHA 5B1YA 1Y37A 3QVTA 3REGA 1PT7A 3JQ9C 1PZMA 2W90A 4BFWA 3AR7A 2L17A 1R74A 3LX4A 4YJDA 3KDSE 1AH2A 4YAIA 3AF3A 5HP4A 3H1AA 1I4TD 1N1EA 2O8DB 4GP9A 4TSRA 1Y4ZA 4KXVA 3QP9A 1A0GA 5LA6B 4YMGA 4HGRA 3AIKA 3BVPA 4KEAA 1PVDA 3BA9A 1J9ZA 5AVJA 3RREA 1D09A 5HFNA 2PKQP 4CF4A 3F1KA 1W4AA 4KLCA 3WTCA 421PA 3LC7O 3ZQUA 1PWXA 1R12A 3HA3A 3BB1A 1IPFA 1C9MA 4G36A 2C4VA 1MKYA 1ECJA 3LUAA 3KWLA 5CDUA 1PS0A 3QLUC 5FPOA 5HMLA 5B1HA 4DLYA 2C4MA 4ALJA 3T5AA 5AI8A 3ICEA 2MCFA 3OD1A 2QNIA 3QPWA 5A4JA 1RI3A 2UUOA 1NVMB 2YCLA 1JSLA 3VI3B 5BSEA 3EGCA 3WKBA 1XI2A 2BGNA 3P97A 4I1OA 3L8HA 5FPKA 3WGKA 4LSGA 2BGRA 4K9KA 2HMYB 4KDRA 1YRWA 3T5TA 4KVZA 4UM9B 4YBZA 4P7FA 1KGSA 5GONF 3QFHA 4DR6H 3N0TA 4FOLA 1N1MA 5CNJA 5EJ4A 5I7WA 3AEUB 1J42A 3G1WA 1ML4A 1KZHA 3HXPA 3NIGB 2Q1TA 4AWAA 3EVAA 3NRCA 4LF4B 1RU3A 4G24A 3MTDA 5AP9A 3CRZA 5L7WA 3W2GA 1XD9A 2VH2A 5E6SB 1QFMA 5FXMA 2Y4RA 3D6HA 2WHPA 3KUKA 1WL8A 4Z9YA 1WB4A 2WJGA 5LL6b 1NBME 4GU5A 4RDIA 4XD7D 1ZXLA 3D8RA 2UZ3A 2EOAA 1AJEA 4B3CA 3FLMA 1GADO 2AG0A 2IYNA 1N6PA 3QBTA 1Z4KA 1ORWA 3MSXA 4CXMA 3VNQA 1NTOA 2HA5A 1RE1A 3T1HB 4O3NA 3KX2A 4KVGA 3ZGXA 2HU2A 3KLBA 1JG4A 4IZHA 2Q46A 2UZIR 2W2PA 1U11A 3RIGA 4IOKA 1JB1A 4QO7A 4ZQFA 1KAOA 4KFTA 3PXAA 4UEKA 1F1BA 3UT0A 3SYLA 2EZ8A 4X1IA 1NU6A 1R4NA 3E3OA 2G09A 4RB0A 1M7JA 1IMJA 3G2NA 3M83A 4EJSA 1J8DA 4TYYA 2EX4A 4Z4IA 5F7OA 2IV3A 3CF0A 1BXKA 1XEWY 3SAJA 3NBYB 3KEOA 1OYOA 3PUZA 2WIBA 3D6NB 4YB8B 3LHFA 3T15A 4YCMA 2PH3A 2W6CX 2DRIA 3UNXA 2Q2TA 1NONA 2XVAA 1VBKA 4EF4A 2XCUA 4PZ9A 5C7LO 2ACKA 4PU0A 3JZIA 3FDZB 1XDNA 2UVDA 1JIVA 3NBYC 4EKDA 3F6EX 4LYYA 5G02A 3EIXA 2JI7A 3N2KA 1XDDA 3VAYA 3OLVA 1FNBA 1SBQA 3OP4A 3UG7A 3CMCO 4RADA 4ZT4A 5LU9A 1RLTA 1AV7A 3IESA 2QY6A 4DKJA 5JI3E 3FKSA 3STXA 1TO1E 3ZE9A 4URWR 3RSOA 3SJ7A 2FPRA 2ZDQA 4HDSA 4TYPA 5DSTA 1XCPA 2IYUA 4YMLA 4ECAA 4UC0A 4B2IA 3ZJVA 3E7PA 4ZYXA 2QL6A 4JUBA 3E2PA 3LWDA 2AWOA 3OC6A 3E7XA 5IDQA 2FRXA 4YMUA 2R82A 3IYLW 2O1WA 4UBMA 4DQDA 1RWWA 3SDSA 5L1LA 2WTAA 4P4SB 4ZVMA 3H1GA 2P4EA 2QT1A 2JLRA 1C3OB 3C3XA 3CUVA 3A6JA 1JG1A 4OH1A 4XOIA 1AGNA 4NQZA 4CMHA 4E11A 3Q3CA 4FILA 3GJTA 2JJ8A 4YFVA 1LW7A 2RHLA 2CDAA 4K05A 3B1KA 2H06A 3WAGA 4U7HA 4NV0A 1GXSA 3AK4A 3EJ6A 4KR2A 2WJIA 3PB3A 2PPVA 1GZUA 3WQHA 2BC9A 2IYZA 3Q87B 4LG1A 2RCNA 1EUDB 3ABZA 1H5QA 1RHKA 5LP1A 3EWIA 5G4LA 1XT6A 2D7CA 3A6PC 5HYVA 1E5VA 2Y0EA 1E1CB 4XCQA 4QELA 1W93A 3KV1A 1T9DA 2JA2A 3WQSB 3TFOA 1XFAA 3BJMA 4MIKA 1GPMA 5JPDA 3DNFA 1RWOA 2VRCD 5CFMA 3OZBA 4LI3X 5A5FA 3H65A 2JFZA 4QPNA 3KRTA 1T0BA 3Q7RA 4MI6A 2CB0A 1MX3A 4Q6BA 2R86A 5K8VA 1IHYA 3AP2A 2IW1A 3H13A 5DI3A 2AU0A 4QQRA 3K9QO 3GT4A 4FZ3A 1V8OA 2Z30A 4GPD1 2CNWD 4CIBA 1J0BA 1S4QA 3EDYA 1M9NA 2EC5A 3LO8A 3RHSA 1UOPA 1T4CA 5LUBA 3DAAA 3GGCA 1KJWA 4XPIA 4EYEA 1TYBE 1ZRMA 2P1ZA 4PG7A 4O1MA 4R6WA 4O08A 3CEMA 1H65A 4D9BA 2ZYVX 4P4LA 4CIVA 1IN7A 1IAVA 2E6KA 1BX0A 2XT9A 1V1RA 5FPHA 3RC3A 3QYPA 3PFHA 4ZI5A 1PFGA 3MPUA 4EA6A 3LC1O 1WG8A 3MS4A 3GIIA 4AS2A 1NLYA 3PFWO 1YTLA 3Q5EA 3HXOA 3QVOA 1FL9A 2UXCB 4BE9A 4NBSA 1OAAA 1E1LA 4N3CA 2X0EA 3FAKA 3QG1A 4GOXA 2WVGA 3VSCA 3IOMA 1C7RA 1PJAA 1NNI1 2HHFA 3VZRA 4Y2QA 3WYBA 5BSGA 2PYZA 4X66H 5CA0B 3SF8A 2Y0SA 2VL7A 2BFFB 3OM8A 3M6MD 1LCIA 4Y1FA 4OH7A 2YZGA 4XQGA 4L85A 3K0BA 2FK3A 4DJDC 5ALJA 4K9NA 3BSFA 3EFBA 3CVJA 1KK3A 2GPBA 1WH2A 3G6KA 3R0JA 1DAAA 3R09A 3L04A 5JVDA 3MVEA 4YIHA 4NDZA 4MK4A 3CLSD 4YAKA 4ZOLB 2VOBA 3PNMA 5EQJB 2UUAH 1GCAA 3PGXA 2JFPA 3B13B 1C30A 3U62A 1E9CA 3NJ8A 4YCLA 4QKQA 3OQVA 3EYWA 3X1JA 4RCNA 2W7TA 1XEAA 2ZIUB 1SHZA 2BR0A 3TBFA 4DL2A 1MB3A 3TW8A 3LQFA 5IYZA 1FE8A 4NCJA 3U40A 3CGWA 4RF3A 2B4YA 2FJ0A 2FKAA 2WB1A 1CY2A 5DTMA 4HDRA 5B30A 1EK5A 3PI6A 1ZVJA 4IHJA 3OT5A 4WLNA 3H3VH 2WIKA 1ACLA 4DQXA 2ORIA 4M7OA 2YY6A 2AKEA 5E3JA 1ODKA 4BWYA 3PNVA 2NYVA 4KQ1A 2VG8A 4IIUA 1E8MA 4MPDA 1UEJA 2PCLA 1DFIA 4JQYA 4S24A 4Q24A 2XNCA 2XCPA 4QPZA 2HA2A 5CYFA 3CEAA 3PZRA 4P1ZA 5EE0A 1AD2A 1OGJA 3O5AA 3FYHA 2XBMA 1AXRA 3HE3A 4RESA 4YY3B 1KJIA 5A03A 1TB4A 1NG1A 5JPCA 4LXGA 3UWKA 4A73A 5F5XA 1JWBB 1WD7A 4S1WA 5ALDA 4NAUA 1JAIA 1VXOA 1AN9A 3QEKA 3V3KA 3UFBA 4RFSB 4ZK2A 4EFKA 2W2QA 1Z0SA 5LQUA 2AZTA 4PSVA 5KUTA 4G67A 4YT2A 1Z0JA 2NZ8A 1O95C 3Q15C 4GLFA 3CTPA 5DIFA 2RJNA 5BUSA 4NH4A 3R8CA 1UBHS 4C7OA 4YO8A 4WXHA 3FH0A 5KG5A 2VZLA 1IDOA 4YUVA 2OK8A 1XO1A 3P9SA 2ZR7A 4DMLA 5DWDA 4HSGA 2ZIEA 1HE1C 3WXBA 1GV0A 3DBHB 3DE6X 3KYJB 5E7QA 4D9MA 4WA8A 1Q15A 1Z4JA 1RZRD 1L8AA 2V4UA 4AMBA 5E1MA 4LV8B 1UDCA 3WL3A 2F43A 2IZ7A 4QNRA 1FPQA 4R8KA 3GFSA 1OX4B 5HQJA 4HFRA 4D2IA 3OETA 4DCMA 4YHHB 2RIRA 1NVXQ 5DIZA 2VA3A 4UD6A 4QWCA 4UHEA 5FTNA 4B3TB 2F1IA 3K09C 1VJRA 2W2TA 1DRWA 4Y6GB 2HCRA 2WZCA 4QL3A 1WZCA 1HZZA 3DE2X 4OXKA 2EKPA 3PSHA 5JD4A 4QXPA 4JJIA 1Z26A 1KKMA 3LTEA 4OIFA 4GEKA 4K5QA 3VYVA 1K7EB 1GARA 3NORA 2YXLA 1I1NA 2EEPA 4BCDA 1EUQA 2CFRA 4JV5H 3ZGOA 2QGFA 3WLTA 3WB1A 2ANCA 2IBSA 2IH2A 4Q1CA 3LX8A 3TRHA 1NQVA 1JG3A 2BLNA 1G18A 1K6IA 4JITA 3NUQA 3PEYA 4X7MA 4RVSA 3S3TA 2POQX 5KEIA 7ADHA 2EKZA 1E9DA 1B8PA 5I5SA 4TQSA 1IBMH 1KEUA 1O75A 4BWSC 1EDBA 1ZD3A 2XI4A 5G1PA 5KYXA 4I5EA 5KVCA 3U3MA 1F8UA 1ZK0A 4D3YA 3WG9A 4D97A 3HCWA 1HYQA 3OTOB 2VNAA 1NMZA 4H1TA 4PNHA 3NIBA 1SQ6A 2NSDA 1I1KA 2DPXA 3BORA 4ZPJA 3PJEA 1XZGA 3A6FA 3O47A 4YBZB 3ROMA 2EYUA 3EMVA 1E5TA 4RDXA 5LKAA 4C6HA 4LF8H 4CI9A 2EQAA 3CISA 2YV4A 4LSXA 5BV2P 1FFGA 5KT6A 1FJGB 1KYTA 4ENUA 1DBIA 1YZTA 3ZD7A 4F3YA 3R4VA 1N3LA 4N18A 1L3BA 5HCIA 3G88A 1V26A 2AEEA 3DWFA 1AKWA 2AEMA 2WHPB 3X44A 1ICEA 1EJ0A 4JYAB 4EBFA 4MQ5A 1SD5A 2H6EA 4JN6B 4I6EA 2Z2XA 4CKXA 3N3BC 4Y9SA 3W05A 3BK7A 4GKJB 2UVPB 4BFCA 3A2KA 4LBZA 3CVZA 3ZH2A 5C4MA 3EPGA 2J67A 3V8PA 3VR2A 4NBRA 1SKUA 1IH8A 3V1LA 2VQ6A 2B3TA 3R0XA 3WK5A 1LLUA 2GCEA 3GU3A 4IIJF 1E64A 2VHTA 4GUAA 1N34H 3N43B 3HCPA 1G41A 2P77A 5K99A 2J5XA 1ZVMA 2OG2A 4X1IB 1R4NB 1JHVA 1KTVA 4XA8A 5EIOA 2FZLA 4YRGA 3MMXA 4EJSB 1HA3A 3BJZA 4M3NA 3R6GA 2HO4A 4CM8A 3QYAA 4PQEA 1COWD 3TH5A 4CGYA 2HLPA 3BXGA 4HVCA 4AP9A 1TJPB 2HPHA 4EJSC 2ZTVA 4WY2A 1I1QB 4JXJA 2IHUA 2QTZA 5DDIP 2PL5A 4FYKA 3N2KB 1FXSA 2RGYA 3QH4A 2VSYA 1F4LA 1H6DA 5AJYA 5AW2A 4ECQA 1CDOA 2W7OA 1PGJA 3F6RA 3N70A 4XEUA 3SLRA 4UCVA 5E9JA 2I34A 3I34X 1XRNA 1E62A 3MSCA 3N58A 4YCCA 3MQFA 3R3UA 1I2LA 4F72A 2XZDA 4BPRA 3T99A 3P4XA 4O5OA 4HDSB 3AW8A 1CUJA 1XEFA 4FPXA 1D4ZA 4OQXA 5EQTA 5JASA 2J6UA 1SUWA 5A3VA 3L4KA 1E9FA 3QQ5A 3OLCX 1ZGCA 1AF7A 5IWAH 4BY1G 3PWSA 2AX4A 3ICPA 1Y0BA 1XHFA 5HNKA 4U6NA 3IIKA 1UJ6A 3Q8WA 3U4IA 5KFVA 2Q9CA 2NXNA 4BX2A 4N5LA 4U6PA 3PVCA 3ZHZA 1W36C 1T36A 1PBNA 4A1FA 1J23A 4C4RA 2WP0A 2FKNA 3PX3A 4HVTA 5DOVA 4PLGA 3PF9A 3OECA 5K0NA 3L6DA 4WBNA 1PT5A 1EBBA 4WKGA 1PJLA 3JQ8A 2XQFA 3D0KA 3H5WA 5HF9A 1GXSB 3A4YA 2JD2A 2GS9A 4OVKA 4YONB 2C83A 3OEHD 1TAUA 3TM4A 1PG2A 3A4MA 1C9JA 2MMGA 4LVOA 1HNXB 4LQDA 5HZGA 4FUTA 3QVUA 4QYMA 1RQGA 3ILHA 3LZCA 3LA6A 4NE9A 5A5GA 3GRVA 1QIMA 1ZGAA 1FQWA 2YS6A 3F49S 1PV2A 3RE1A 2XAAA 3S70A 3QPVA 1FUEA 1Q5PA 2ZRGA 3V1MA 3OTGA 2X58A 1NR5A 3R20A 4TLBA 1NE2A 5AXBA 4DR5H 2D1TA 3F98A 3U3KA 4D79A 1DZ3A 5I47A 1ZK2A 5EUBA 3UPUA 2HGXA 4IMRA 5DI3B 1RRVA 1VYVA 1YHZA 4WOCA 2QMEA 2IHNA 5HBRA 3A32A 2O5VA 1K6JA 5AVTA 4GZ5A 1FVIA 1NT4A 1T4CB 3HXKA 2WWYA 4B8ZA 1TCBA 4XPIB 4J4HA 2C2EA 4Y2YA 4L7VA 4U2DA 1A9XA 3W1BA 1IBKH 1I7LA 2XF8A 4EYQA 4IFBA 3VU8A 4UCFA 1ZUIA 2WIGA 4HAIA 3W6OA 1H0HA 3GUCA 1MOSA 1V96A 4FFLA 4ZI2A 1V1RB 4JP2A 9LDBA 4XOUA 3SM9A 5A0VA 2COJA 5AJTA 1SPXA 4EG4A 5J2UF 5IDVA 1I3OA 4B2YA 1WPRA 1QCZA 4GYWA 1ZMTA 4HB0A 4YJGA 4OAOA 4B4KA 2E87A 2Z2IA 4Q8EA 1AZTA 3M81A 1TLTA 2AIRA 4GI1A 3ZKAA 1O54A 4RVCA 2W4IA 1KGDA 4WXEA 3VDXA 1B8OA 4P4GA 1WDWB 2HHFB 2ASDA 3J7AC 3LSTA 5HM6A 3SF8B 3ZI7A 3IFSA 3DVSX 3JALA 1VC2A 2BGLA 3U4GA 3HEBA 3DDCA 1Z2CA 4AO8A 5FL3A 3KJIA 1KK2A 3UAXA 1H2BA 3KQSA 3KXIA 3P9PA 2IK8A 3CFYA 3FBWA 3FDIA 5EWLA 1PSZA 1E2UA 3DE3X 3NVAA 2V4QA 3CIOA 4LHVA 4DL7A 3OIWA 4D9HA 4FGSA 2FG6C 5JVDB 1AF4A 3WLJA 1X74A 1U8YA 5BR7A 5I48A 1JDBB 6LDHA 4YAKB 3GJQA 2R25B 2Q1YA 2RAUA 4ER7A 1DTSA 5CR9A 1C30B 4BFUA 2C2MA 1AG9A 2VDMB 3C5CA 5JEEA 1YQGA 1ZGGA 1ZUWA 1JXLA 1JDBC 1PFQA 3TW8B 1P2GA 5IYZB 2VUGA 2X13A 2E37A 4Y9UA 1PGQA 3EQ2A 2I62A 4V0QA 5LQSA 4ZZ1A 1BQ4A 4B80A 3C8DA 3GG2A 1ITZA 1LFDB 4HDRB 4Q21A 1T2FA 3RGXA 4IHJB 2Q50A 4Z9XA 5E4JA 3T1YB 5FADA 2VHWA 2XMDA 4Q45A 5LFAA 1ZH0A 1XCGB 2JK0A 3HZHA 1T9KA 5HUHA 2OUIA 1E3MA 2J6HA 4RORA 1UWVA 1BTOA 4R7ZA 1W76A 1II9A 2LDXA 4G6ZA 1DDOA 3GJ7A 3RW9A 3H2KA 3RSSA 4AX8A 4O3FA 3AWDA 4JCOA 1E1NA 2JLAA 4P82A 3RUCA 2YUIA 2C03A 3T0GA 3BDIA 4OMCA 4CQNA 2ZQYA 3ZD8A 1VBGA 5JZSA 3U7EB 2Q49A 2GNPA 3ABQB 3EIWA 1O96A 4IZIA 2YL2A 2OV1A 1LPOA 2VRWA 5DQIA 1UT8A 1WVGA 4TS4A 1ORRA 4X90A 4BMCA 2FWBA 1HRDA 1KAHA 1RAFA 4K26A 2WWFA 1P31A 1VLJA 3ZE1B 2C2WA 4C7OB 4NX2A 1U0BB 1Z0FA 1UL1X 3E18A 1JLHA 4I55A 1BIFA 3FW1A 4G81A 1X8KA 1G6HA 1VKHA 4XJXA 4LDQA 3X2FA 3SIRA 3ZUPA 3AYZB 3BMCA 2HV8A 2ZAYA 2YJNA 3OT4A 4R2JA 5KU7A 2ECFA 4ZCMA 2PLWA 4EW1A 3X1XA 4WDRA 4Z0PA 3VV2A 1OC2A 2F43B 3A4TA 3DTYA 3OZDA 4GKKH 3RB3A 1W4ZA 1OE0A 2G36A 1V51A 3TRIA 1NSFA 3S44A 3MGKA 4AIIA 3GQCA 3O8DA 4IP0A 5JMOA 1AUPA 1F8YA 3GO4A 1X77A 3ZU2A 3R77A 1B6SA 2XDYA 4B6JA 2AOUA 3WSWA 1UC5B 3TS1A 5D5QA 2QUBA 4BP3A 1XK6A 1QRAA 3MAAC 3U37A 5LJIA 3FVWA 1DAMA 3KQYA 4IRDA 1Z4PX 4DIBA 1PJCA 4KO3S 2G1KA 3OFVA 4IH1A 2DUUA 1HE8B 1E0DA 5H68A 2FDRA 1CVIA 1JR3D 1P1IA 3QG5A 1IY2A 1HZZC 2CXXA 5BOSB 4E7OA 2GF0A 1MUUA 3DMFA 4DAOA 1QDLB 2C00A 2HIHA 1KFEB 1SKYE 2EARA 2Q4RA 5HNEA 3T9CA 5GVRA 4F12A 3WICA 4OQLA 3PQ4A 4UEOA 3PR2B 1QH8A 1D4OA 1SUDA 2XC9A 3VHXA 4GWGA 2ZAMA 5IUNC 4Q4LA 3SNOA 3RTBA 4PE5B 5KYXB 5IK2A 5DU2A 1GPNA 1CJCA 4FR5A 5BVHA 3SS7X 1J9GA 2FETA 4FKBA 1NXTA 2AYYA 4IKEA 2X6QA 3O2JA 3UYLA 5I4CA 1TIPA 2JG3A 5DBIA 1WKBA 3LE8A 3O4GA 3GIWA 5BR8H 4NMMA 1I94H 1QJ4A 1E9BA 3OAAA 5K51A 4QU5A 3UENA 4DBVO 4EJFA 4Z1MD 4OGFA 1SCDA 4C04A 3EXEA 3IT2A 4GC9A 3VTZA 2QRVA 3EN0A 4AY3A 3OPMA 4LY9A 1F5NA 5B3LA 5JYDA 2IUUA 4DMMA 2VN8A 1FVHA 3J81A 1MX5A 4FCTA 2Z6VA 2XKKA 3AGQA 2REXB 4FMDB 3R3ZA 3WFJA 4OLHA 3AM4A 5KWJA 3U26A 1K7CA 5B64A 3K1YA 1J90A 2YCBA 1TCVA 4MCIA 1YQWA 4CIYA 3PTLA 2CBZA 2F9LA 4X62B 3ZY4A 4FOTA 2EKBA 2GJ8A 4F50A 4W4TA 1TU0A 4N8SA 3RG8A 4B9EA 1GZ5A 1FDRA 3W5BA 1F6BA 4CM9D 3NGMA 4QHYA 3X2SA 1J24A 4AAYA 1CJUC 2VRNA 2P90A 4WCVA 1UFVA 1BS2A 1YK1A 2V97A 5GQSA 1C4OA 1UBNA 3NCHA 3IUJA 1RHQA 2VP5A 2XRYA 3TSAA 1VIMA 3KCNA 3ZDAA 1LBQA 2ODAA 4HGZA 2AEFA 2LGJA 4JLPA 1XHLA 4N7JA 1SRQA 2XYVA 2Z4SA 4XASA 2CLFB 1NW6A 2CJWA 2I2CA 1MB0A 5LXTA 3CUSA 4OKSA 1WMDA 3I92A 4OBEA 3EVDA 3VPAA 5I9TA 2P5YA 4QXMA 2BWJA 2AC7A 3GA5A 4XEHA 1TL7C 4FM9A 2IOQA 2QN6A 5LQCA 4PC7A 4LECA 4DPMA 4JI1B 1FYDA 1ORHA 2OQ2A 1SQFA 2JAOA 5CT4A 5ALUA 2D1YA 2HA6A 1CUDA 4XGKA 3U4AA 3EWNA 4CM8B 2QEQA 2C8KA 4DM7A 4G5HA 5I9MA 1GLGA 3N39C 3B1VA 2ATVA 3MRVA 3DNPA 2C9MA 1NLZA 4NYJQ 4RF4A 3Q72A 1QDUA 3ZY5A 2HQOA 1US8A 1ILWA 1RC8A 4UPVA 4GO1A 1ZU4A 2XMCA 4TXLA 2YZLA 1S0NA 2GN2A 2O0MA 3N2IA 4I4TA 1LPPA 5JJCA 4RDHA 4PWZA 2B30A 4J07A 1D5CA 4W5OA 1IXZA 3IHLA 4JI7H 1ZUNA 2AN4A 2QW8A 3AY0A 2W22A 4L4SA 3CRRA 4WJZA 8ABPA 3G9TA 5AH0A 3CU5A 2I2XB 3MGCA 3QM1A 1R6TA 5KTYA 2ERCA 1RBQA 4BMDA 1VG9B 3VGJA 1G3MA 1DXYA 3ZNNA 3U7HB 4J0KA 2DX7A 2OLSA 5JNWA 1P8JA 4NOMA 1XPUA 4GZLA 4DE5A 1G98A 2E9SA 4JBXA 2LW7A 4Y2HA 3MGGA 4EVIA 1QRSA 1NNLA 2E21A 5L8VA 4ND5A 4DEYA 1OBDA 1CJSA 5FX2A 3P9RA 4ECRA 3IEXA 3MCAA 4LE2A 1RACA 1TZJA 4C0SA 3IPAA 4QTXA 2BR4A 1QB8A 4TKLA 5EDWA 1SD1A 5B1EA 4PBCA 4RM2A 1CERA 1LPMA 1T36B 4PZ0A 4Q34A 3DV9A 1QGDA 4M83A 4CDMA 2XZTA 5H1YA 2O50A 1RVDA 3CX6A 2DFLA 1JTVA 3WWJA 1Q7RA 1YB6A 5DHRA 3NWJA 5AJHA 1I7NA 1EP1B 4WBNB 2HSJA 1TGVA 4MW9A 5KNCA 1USIA 4ZGGA 3JQ8B 1OH6A 3L0ZA 4CU2A 4RE5A 2UYGA 4H3KB 2QZPA 2EFJA 1KS2A 3GL9A 5HF6A 3VTFA 5DQHA 4LDZA 3QUAA 1YK0A 4RWZA 3I9V1 4K9OA 2Q5QA 2VBCA 1G8JA 5FCDA 4AZ0A 4DMKA 3IMFA 3LCUA 5IHXA 4KYUA 2YMQA 1OFHA 3EGDA 4L8FA 4DJJA 2CVZA 4ER5A 1EDEA 1PKXA 3KB2A 3NWOA 1XLTA 1ZEMA 3Q7TA 2J7PA 1AZLA 3RV3A 4G1EB 4UCSA 4N3GA 3FYTA 1YB7A 2WK1A 2FZEA 1N2CA 2PXCA 2IBMA 2AD5A 3OPXA 2GJKA 5A6SA 4Q3DA 3IA2A 1IBRA 1IPHA 2M6LA 1D6NA 2H59A 2PA0A 4U5QA 3P32A 4PZCA 1CYEA 5HRCA 4JBHA 2FLNA 3VX3A 2FTKE 3O75A 5LCXA 5MDHA 4BFTA 1ZETA 2B8EA 4PXYA 1ZO8A 3FKQA 3ZTTA 4ZHQA 4GYKA 5JH7F 5JW6A 4E88A 2N46A 5JADA 3C5HA 3N9IA 4YASA 3JZAA 2PEYA 2FN9A 3PLNA 5BW6B 5KT3A 1S2GA 2ATLA 1ULZA 2CQYA 1A9XB 4K0RA 3M6LA 4YV2A 3OEYA 4OG2A 1H85A 2C8LA 1G4HA 2EG9A 2BGMA 5K8IA 1YIOA 3HY6A 2BJHA 4KRFA 4ICIA 2XVYA 2FR0A 4UM7A 1QK3A 4F9GA 5F9NA 5CT5A 3JRXA 5ALFA 4BNUA 1UT6A 4FE4A 4AJ1A 2BKLA 2B83A 1A0IA 4YJGB 4BMSA 2GX6A 1A9OA 2FY8A 3JQ7A 1IN5A 4ND3A 1PZNA 2Y66A 1QBGA 1U8EA 2O3TA 2XVMA 4CFSA 1TT7A 1L9KA 2QXUA 3B89A 1ZJZA 4G0PA 2ZJ1A 1V5FA 1O4VA 1XL0A 1BKSB 4KRYA 4C2AA 4FFPA 3D1JA 4Z4FA 1RJRA 3GJ6A 2HRZA 3CSSA 3JALB 1SKYB 1X1SA 2JCYA 2AGOA 1MJGA 4ZI7A 5CYOA 5A02A 3RT9A 2O14A 3CPEA 4JWKA 5EWLB 4ZAWA 1EK6A 2ZYGA 1A9SA 4E07A 2CK3A 2DCMA 3VQTA 4A2QA 2HFJA 2W2KA 3ZCXA 1NMSA 3HBJA 5A9RA 1ZESA 2I3GA 2ISSD 5JROA 4EPVA 2EIHA 4DL5A 3O94A 1ZYUA 5FWYA 3CM0A 5L3RA 3K0FA 1I1MA 1DAFA 2AG6A 3TD9A 2WHYA 5E38A 1RJGA 1KEPA 1FQJA 1PFKA 4C5CA 3UT6A 2X2OA 4WLOA 3RJ0A 2XB9A 1NN5A 3BWBA 1RRFA 1KEKA 5KB3A 2G1JA 1AZWA 1YT5A 1H69A 4WNIA 1HMYA 4ZVUA 4LY6A 3ZU6A 4ZYUA 2XD4A 4EJ0A 1EJ2A 4OHVA 1ISSA 4W1RA 1K1QA 1NXPA 3EZ6A 1ZJJA 2P67A 5CVEA 4ECZA 3MW8A 1MX9A 3ACDA 4Y9DA 3Q7IA 2WI8A 4QUBA 4HX2A 3C8ZA 2IEZA 5F23A 4YCDA 1GAEO 2Y77A 3SLKA 4EI7A 3R74A 4S1NA 3WO1A 3EARA 1OROA 5DM2A 5AI5A 1E4OA 1L5LA 5IMSA 5ALRA 1P81A 1FP4A 3T0FA 1UJNA 5ITVA 4MRRA 3ZGZA 2IS6A 1YULA 2VF7A 4EYIB 2R93A 4K2AA 1O96B 3D64A 3KG2A 1JS1X 1KAGA 3PD0A 2FJZA 3TOSA 4ZDWA 1Y4AE 3BIXA 4F4DA 5L40A 3L6BA 5JWOA 3TTWA 5CLLA 5ES3A 2PNFA 2BZ1A 1N2CE 5GZ6A 4RGQA 2IYLD 2GPWA 4I55B 3T34A 3COPA 4FGZA 5AM5A 1IBSA 3TL3A 3OJCA 4DJ5X 3FJ1A 3KPUA 2ZG6A 2OFWA 2VLBA 3BMCB 1A9TA 4INOA 4MLDA 1B33N 1GTZA 3ZOZA 4F4HA 3U7RA 1ODIA 4HD8A 2FSFA 3WWZA 1WS6A 2PS1A 2ZB2A 3ZJTA 4UCXA 3HVHA 3LA8A 1XD2A 3QUBA 3NW9A 2OAGA 4AJPA 3Q0TA 1RC1A 1YVPA 4JI5H 4DUZH 4ZAYA 1T1SA 4LN1A 2AOUB 1AKVA 3RTCA 1SBCA 5DXAA 5KAMA 4PCUA 3QSGA 2IDMA 3T7JA 4WUVA 3JRNA 1VBNA 3W3AD 4C14A 4WI1A 5IASA 4N5HX 3E7FA 4KQGA 1BEEA 3U17A 1U3WA 2QR3A 5J5VA 2FP4A 3OE7D 5GOZA 2HVSA 3L49A 4Y9RA 1H4TA 4WADA 1RLIA 1FDWA 4FIZA 2B4TO 4C3UA 4MITA 1VECA 4KLAA 3INRA 2MSEB 5GJVC 3KPVA 4MHSA 1P2DA 7AT1A 3VR3D 3P0FA 4F6RA 3H6GA 3IO3A 2X15A 4XX0A 5DGXA 1ZUD1 4XVRA 5TT0A 4L0CA 5AI4A 3KJFA 3KZXA 4FE2A 1OXXK 1CP2A 2EZ4A 4WXPA 1QH8B 4BLTA 1LJ8A 1GGVA 4OFWA 4PLTA 4Y18A 1KBLA 3VHXB 2R2GA 1J70A 4XIGS 3ETJA 2YW2A 1C5KA 4BVLA 4RTNA 5I3CA 5BVHB 2LCIA 3VUEA 2HX1A 5THXA 4KB5A 1ZI9A 1Y1WA 4CT4B 3L7CA 1RHJA 3QTLA 5CFRA 4EFLA 3ZV3A 4EQ6A 1FUUA 1WVMA 1KETA 1K2VN 4A6DA 1YOVA 2C2GA 1UC9A 1TZKA 2WYIA 1G6OA 1I1LA 2WUFA 2BGGA 1SCUA 4GLJA 4H6PA 4J7CA 1JSZA 5KG7A 3V4RA 2JF0A 3HCNA 1FUYB 3HA5A 3P96A 1RCFA 1EDOA 2OD7A 2BLLA 2C07A 1FU4A 3EXEB 5JSQA 10MHA 2JH3A 1ULSA 2QRVB 2GBGA 3F4KA 1NXWA 4TOIA 1RXYA 2C4UA 2NU9A 4PZEA 2UXBH 5FUXA 4V2IA 4DT1A 1IONA 1K5HA 4HGYA 4XWYA 3C0KA 2WHEA 3OKCA 4F11A 5B53A 4O3PA 1MCZA 3HYNA 2J4FA 2O19A 2IYYA 5C44G 4OKNA 2GAJA 4BO9A 4KXYA 1UXOA 3GI1A 2IVFA 1M8JA 2YHAA 2G04A 2CV0A 1I6MA 4RGYA 3ZVKA 1N7JA 3HHPA 1SU8A 1D4AA 3ZXYA 1S68A 4UFOA 1YRBA 3UPTA 4QODA 4GP6A 4KO8A 1YQ9A 3PXCX 2V6IA 3I76A 4O7TA 1OI7A 2C8VA 5LXTB 1YZ3A 2WZBA 2OHIA 3D8BA 2BFEA 3DV0A 4WNCA 4B43A 1T9GR 3KPWA 5JUWA 2DWQA 1YI8A 1KSFX 2NAFA 2NVBA 1Q0SA 2ZFUA 1OT3A 1ZZEA 5BSVA 4EA8A 4K6HA 3DC7A 4KAJA 4TTAA 5EN4A 3G5LA 4PYIA 1ZSNA 4FGLA 1TM7E 1BDHA 1V3TA 3AXSA 2OGUA 2Y27A 4C87A 1OYYA 5DSXA 1LSUA 4YNBA 5G0SA 4DV4B 4IVRA 1OU0A 4KWHA 1VL1A 1YS7A 4Y2JA 5LOVA 1QYRA 3KQTA 1OZHA 4MVJA 4L8YA 3T5MA 1US8B 1E2BA 3N86A 1EK2A 4UU0A 3VNBA 4PZYA 1RPAA 4F5EA 4EHLA 2R8KA 1XPOA 1ZD9A 3HKBA 4JB3A 4I4TB 1PFVA 4LXUA 1OHHA 5K01A 2ZYUX 4ZVLA 2QQ5A 3OPVA 1XA0A 1Y3IA 3SPXA 4MZXA 1ZUNB 4NU5A 4BLPA 3PW4A 1JVBA 3FZNA 1U0NA 4BBPA 1G21A 4IXDA 2G5TA 5KFSA 1N25A 2NWQA 3GGPA 3H40A 4UTPA 2HYDA 1HYGA 1Q83A 3KSRA 2AI3A 4WFKA 4NR0A 1ZUHA 2IHVA 1XMPA 1E7WA 4MGIR 2E5LB 1Z7YA 2R8PA 5EPEA 4LYHA 3BHMA 3RS5A 1E0SA 4F9EA 1DXQA 1QCYA 3IB6A 2WRZA 1WIWA 2FG7C 2RSLA 3UZBA 1RKVA 3EPHA 1QQAA 1BRTA 2X40A 4AN4A 1MTOA 3EIOA 2OAP1 2V96A 3ZV4A 2ACVA 3KHSA 4R31A 1PQ4A 4YAJA 2NO5A 3HV0A 3AFMA 3NT2A 5B6PA 4LVUA 4KN9S 3DQQA 1JILA 4ECUA 1GG5A 1XKTA 1Z0UA 4NSNA 2E4UA 4BHTA 1IN4A 5AMXA 2Q6KA 4KKVA 4HNTA 4IKOA 4TMFA 4JKYA 2GTPA 1LTQA 1XTVA 1TEZA 4G8CA 4IR9A 2Q28A 2ZUFA 4AZ0B 3G8CA 2ZCUA 2P3LA 3RK4A 5GMOA 1JA0A 2B7BA 2OBXA 5HE9A 3EGDB 2CKZB 3OZEA 3K20A 2GZDA 1WZIA 5B6IA 5K8UA 4IXNA 4X20A 1VCOA 1Y9EA 1ADCA 4ZWNA 4B6FA 5DHFA 5DGHA 3WRVA 2I6GA 2BJWA 4ZJYA 3QFRA 4K8RB 1K98A 3L02A 1N2CB 4PPGA 1QYVA 4O59O 5FBHA 4QUGA 5A6SB 2A8YA 4H4CA 3C14C 1XLTC 4DLTA 2IF2A 2JLCA 4JLBA 3FCCA 2ZJYA 3VZCA 1YIAA 1P1JA 4ZHQB 4U2BA 2B5OA 3GN1A 4CG3A 1QMGA 2VLIA 1IHDA 4TGLA 3OZSA 3MFHA 3KR1A 5KFYA 4BFXA 4XGRA 3LQ2A 3WFIA 1RJEA 2VBIA 3S8EA 5T5QA 1ZSVA 1O97D 4ZXPA 4YRIA 4N03A 4E6PA 2Q4TA 1XTQA 3IT1A 4HQRA 3OTHA 2C98A 3FIJA 1T25A 1INLA 4BUZA 3UMJA 2UYQA 5EYPA 1I6LA 1A2OA 1I10A 2QUIA 5C3UA 3WMFA 2A92A 4P3OA 3PNLA 3CF4A 4CKWA 5H8WA 5LYJA 4C0JA 3F6SA 4KWCA 5FHQA 3JQ7B 4EUKA 4NPHA 4IVNA 5EIHA 4C89A 1G8GA 3K05A 4NS4A 1P72A 1IYZA 4BAUA 4LJKA 4BRSA 1Y81A 1TVCA 3GGOA 3FKIA 2WJVA 4NQRA 2KWIA 2CLHB 5ARBA 1Q0PA 3WYGA 1ZL2A 4B74A 4H6XA 4KUHA 4J1QA 5BRNA 3OLWA 4RQUA 1JMKC 4F5DA 5MFZA 4ZI7B 3QUSA 2DFTA 1A72A 1V35A 2R62A 1QRRA 3MUNA 3L93A 3KFXA 5IJAA 2VQDA 3MJHA 3TLJA 5FR2A 5I5GA 1FMFA 3W5DA 1G21E 2HQ1A 4Z49A 2W2KB 3RR2A 4Z4QA 5JMPA 1RWPA 2AC4A 4B2LA 2RHJA 3NCTA 1LNSA 1MB4A 3H9JA 4CEIA 1HFWA 3SZMA 3E70C 2VSNA 1S6YA 1UNNC 5FWYB 1X14A 1VPEA 3KXKA 3K0FB 3HU2A 3JY6A 4ZALA 4FKMA 2FHSA 2V54A 3BRWA 3BXFA 4L6AA 1J2JA 1HV8A 5IZ4A 2HVQA 1V6CA 4PHTA 3WRYA 2QTTA 3QKIA 2PUCA 2J45A 5KIAA 3PDWA 3NTXA 9GPBA 5C2JB 3WRXA 1GILA 2WLTA 4JJKA 5BQPA 2I76A 3QXXA 1AKNA 5KYKA 4G5SA 2AXPA 5EP1A 4X84A 1N6IA 2IPOA 4TWZA 4YAGA 2Q2WA 2QN3A 4EY5A 1J2TA 2X8AA 2NSLA 4KFRA 4UBOA 2NM0A 4FCCA 5JZBA 2LKDA 5HJ7A 3GJ0A 1MZBA 3LUPA 3A4LA 4WPGA 5L4NA 3LY7A 4DFDA 2VSQA 2Y0SE 4LJSA 3MFQA 2ONJA 3MF4A 4RNCA 1JFRA 4EEYA 4EB8A 1G38A 3QWFA 5KX5A 4V0OA 1UOOA 4L8VA 1EWQA 1ULBA 4P4TA 1EFRA 1FP4B 4MO9A 1HXHA 2FSUA 1XTIA 3U2QA 1WSAA 2FNAA 1PQYA 1KI3A 5KHOC 4F4JA 3EAFA 1OASA 3P2MA 2PZLA 3OPNA 3QEMA 4YGYA 1K27A 4QWDA 3RVLA 3H20A 3PE6A 1Y6RA 1II8A 4Q1VA 2I80A 1IBLH 2CVQA 1JRLA 4C4YA 1QOPB 2YIJA 1LZLA 4RF2A 1QVRA 2ZSIA 1HR0B 2CZCA 4DHEA 4OHKA 1O8CA 4C7MA 1EFPA 5CJPA 2CSXA 1Q1EA 5DN9A 2IQ5A 3KQVA 2SKCA 5FWDA 5KFDA 5G40A 3BM5A 3LHIA 5TY0A 3LTNC 4IDCA 2WB1E 5JAUA 1JQEA 2SKDA 3KSMA 3W4JA 3HM9A 1VLMA 4GYYA 1QU2A 1BD4A 1EZZA 1MP0A 4EZBA 4JC8A 3RHZA 2I99A 3B9QA 4C07A 1XD2B 2QTHA 4EI9A 1T10A 1KZYC 4LTMA 4GC7A 3MTBA 1PO7A 2AN9A 1P7CA 1YBHA 3KV3O 2AS0A 2PRSA 4RU9A 2CLCX 2XLCA 1RMQA 5KQMA 3EMDA 2Y0PA 2F64A 4KXWA 2OXEA 1XJQA 2VWPA 2C3YA 1SB8A 2R8GA 2Z8YA 4M46A 2OXTA 2X3FA 1NW3A 1XNQB 3KQOA 3NHUA 3IOBA 4R2XA 2FP4B 4HGOA 3QXHA 3BSSA 4K3VA 2GEJA 3LBHA 2G9QA 3IV7A 1DWOA 1RBMA 1ZDMA 3NDPA 1YQDA 1LK5A 4U1RA 1A9YA 3PEVA 1AXEA 3OO0A 1Q0RA 5IAOA 5FI1B 4AQYH 4F6RB 4XX0B 2NV6A 1G6KA 3SZUA 2JBHA 1K9SA 1FYWA 1V16A 3O8BA 3BSYA 3RROA 1DS6A 2GDZA 4XCXA 2GEVA 1EX9A 5EL0A 2QS9A 1Y3FE 1RXEA 4LCBA 1FNDA 4K8OA 2ZPTX 1DC4A 2N1BA 3U0GA 1JR2A 4EHKA 3JSNA 3JWIA 2ODNA 5KYUA 3ITDA 5LQKA 1TK9A 3VPSA 4EQ6B 1GQSA 3NPAA 2GJAA 1LEHA 3O9VA 3U7FB 1YOVB 4KO2S 3TQRA 2R5FA 4F92B 2BW0A 4KMMA 1SCUB 1C4XA 3BMOA 3FZEA 3GCDA 5I8WA 4J3JA 2HA0A 2UZ1A 2LDBA 4RB1A 4LK3A 4LFAB 3KHRA 2IGTA 1D0SA 1RFLA 2FZCA 2ETXA 3RKUA 1AC5A 5DLFA 3ANTA 2NU9B 3T4XA 3QNUA 4OUDA 4DT1B 1BFUA 2W0MA 5ENDA 3TDKA 1USUA 1W2HA 3RLFA 4LRWA 2G1PA 5K8LA 2FRVA 2GOYA 5D3MA 3L0CA 2ZGIA 2H1FA 2YFQA 4LX8A 1Y1LA 4LI0A 3ZC3A 1W36B 1U4OA 1OLOA 1K66A 2I1QA 5TX7A 4Q6WA 4Z7QB 4P8RA 3MT8A 3GTKA 2DUJA 4JK3A 2FPPA 1EA5A 3VR5A 1QG2A 5EIXA 1MC1A 3E7DA 2VOJA 1PR5A 2P6MA 4EENA 3V33A 1FDSA 4J9KA 2IYXA 2OFFA 2BFEB 3DV0B 2IY9A 3SE0A 4MYDA 4TMYA 3DOIA 3CLUD 2ZIVB 1OFGA 1I1HA 4O3OA 2XSZD 2H48A 3W8FA 4P98A 3R76A 3ENVA 3P0IA 3F4LA 2IZ6A 1WHTA 1RVV1 2X9QA 4TXMA 3VX4A 1NSTA 3HYTA 3DDUA 2Q7XA 4Y7DA 1TKRA 4OHMA 5FV4A 1P4SA 3V00A 3H8SA 4M0JA 3IS3A 2D1SA 4QRHA 2FSSA 3RAGA 1P6UA 4GD3Q 2J3KA 1UANA 1WSCA 1QQBA 3FA2A 5DGIA 5LR6A 5AHXA 2IPNA 2HU8A 3VYUB 1WKVA 4ECYA 5EUQB 3NAQA 5LOVB 2QUHA 1NI5A 3SOPA 1OPXA 1Z6ZA 2X9VA 4RHXA 4HMPA 4PRYA 1M2JA 1BHSA 5IS2A 1P9WA 3GOQA 2HF9A 3HKBB 5JC1A 1AUXA 1PZFA 3R3XA 3EB9A 3QKUA 3B2NA 4GFDA 2P91A 3H42B 3A3PA 4EA7A 1G2IA 2ZB3A 2P2YA 1G21B 4BQSA 3FUCA 1H4SA 3R75A 3WAJA 3WNVA 3U9SA 2W43A 3KTDA 4H7PA 4N3NA 3SHVA 4N6GA 4RKFA 1NAIA 3M6AA 3NH9A 3IAM1 5A6VA 1NVUQ 1J1ZA 5JYCA 1GZ3A 3W6NA 1ZCAA 1J1IA 2X77A 4NP6A 4MWTA 2RBGA 1SK9A 3JD3A 1LVUA 2EG5A 5D85A 2PLAA 2IXBA 1VPTA 1MZPA 1IK4A 4Z7NB 4HVLA 3G89A 1TEHA 1WCIA 3TX6A 4BQNA 4YAJB 1A88A 4IX1A 3FLAA 1PJZA 4KN5A 3V4LA 1BC5A 2VJYA 5A05A 2HHLA 2JGFA 3EG9A 1LK7A 2ZJZA