3NBYB

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
361
structure length
272
Chain Sequence
GSLNELALKLAGLDISQDLNSTAAPHPRLSQYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGHSPDHPGCLMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding protein/transport protein
molecule keywords Snurportin-1
total genus 57
structure length 272
sequence length 361
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3nbyB00
3QWUA 5DISC 3W1BA 1V9PA 2HIXA 3GB8B 4EFBA 1DGSA 4EFEA 2OWOA 4UCSA 4PZ8A 3W5OA 3RR5A 3BA8A 2HVRA 3UQ8A 4UCRA 1XK5A 1CKMA 4UCOA 3VNNA 1P8LA 1TA8A 5FPOA 5FPRA 3NBYB 1S68A 5D1OB 3GDEA 3L2PA 1XDNA 4UCUA 4GLXA 4LH6A 2HVSA 3NBZB 4EQ5A 3GJXB 1CKNB 1P16A 2CFMA 3JSNA 4PZ6A 4UCVA 4UCTA 5D1OA 1FVIA 1A0IA 4CC5A 2Q2UA 2HIVA 3BA9A 4EEQA 3NC0B 3TY8A 4UFZA 4E6NA 2Q2TA 4DRFA 3S24A 3TY5A 2HVQA 1VS0A 4PZ7A 3W1GA 3RTXA 3KYHC 1TAEA 3BAAA 1B04A 3PN1A 4CC6A 4LH7A 5D1PA 3JSLA 1X9NA 3BABA 1CKNA 1CKOA 3TY9A 2VUGA
chains in the Genus database with same CATH superfamily
3T7AA 2OWOA 1I2KA 1BNCA 3RUPA 4DIMA 2GQRA 1XK5A 1DV1A 3KAKA 3LWBA 5BWXA 3HB9A 4MV8A 1EKPA 4UCTA 2Q2UA 3K5HA 2YZLA 2A1HA 4O84A 4ME6A 3SGIA 1ET0A 2V58A 3JSLA 4O7SA 3T9CA 2W6MA 4HNVA 4FFLA 4O7WA 2ZDQA 4ZHQF 2DABA 4UCRA 1VKZA 2R86A 1CS0A 3R5FA 1IOVA 3NBZB 4YJ2F 4RZQA 4HNUA 4EQ5A 3GJXB 5CAEB 3T9FA 2HJWA 4CMDA 5BWTA 1Z2OX 1GSHA 2ZGIA 1JDBB 1CKNA 2HIXA 4O81A 4EFBA 2SCUB 5CE8A 4EG0A 3UQ8A 1B6RA 3GIDA 2X0SA 2EJ2A 3Q2OA 5FPOA 2CNVA 1C30A 2HGWA 4GLXA 1OBDA 2YWVA 4TV8F 3HO8A 4MA5A 3E5NA 1EKFA 4I55F 1Z2NX 4GLWA 5DMXA 3UZBA 1CQJB 2HG8A 2FPIB 3TY5A 2VR1A 3DTGA 2EIYA 1DAAA 1TAEA 3JZFA 3TEKA 4XZ3B 4ZOLF 2R82A 5CA1F 3BABA 5DISC 3W1BA 2X5RA 2COIA 2I80A 2XD4A 5DGHA 2PN1A 3ORRA 1ZAUA 4YAJB 4EGQA 1M0TA 1B6SA 1IOWA 5CR5A 5BWWA 1JKJB 1VS0A 3T9DA 3OUUA 2HHFA 4YAKB 4LH7A 4NZOA 2QK4A 5D1OB 2NU8B 4Q4DA 5FNVF 5BPFA 1E4EA 4TVIA 5I5XA 2DWCA 1E4EB 3KREA 1OBGA 5DAAA 2HVRA 5CM0A 2GPWA 3ORQA 1P8LA 2YW2A 2J9GA 1AUXA 4MV7A 4HR7A 2HVSA 3JZ6A 1KC7A 4UCVA 4I4TF 2R84A 1KJJA 3BA9A 1T36A 5LP6F 2YL2A 1I7LA 2CNQA 2HGSA 3UZOA 3NUAA 3V4SA 5JVLA 3U9TA 3T9AA 4TUYF 3DTFA 2PBZA 3ETHA 1DGSA 2WYOA 4L1KA 4O86A 2W6QA 2XCLA 4O7LA 3AX6A 2W6ZA 2YS7A 1A0GA 4C5CA 1CKNB 3WWHA 2HIVA 3U9SA 5H80A 3LP8A 4IIJF 5I5SA 2R7LA 3BAAA 2W6PA 1WR2A 5BYBA 3TW6A 1G2WA 4C5AA 4HQ6A 3SNOA 3LQSA 3RR5A 4O7RA 1CE8A 1ULZA 4TM5A 1GSAA 1I1MA 2ABJA 4CE5A 1EHIA 1PX2A 3R23A 3WO0A 5BWRA 1FVIA 2NU9B 4DRFA 4YBZB 2Z04A 5BYAA 3TIIA 3BG5A 2NU7B 3T9BA 5D1PA 2HGXA 5I5TA 1JLLB 2COGA 4CKCA 3ETJA 1IYEA 4DLKA 3T99A 4EFEA 2V5AA 3WNZA 5C1OA 1EZ1A 4O2BF 1BXRA 4MV6A 5D1OA 1P16A 2CFMA 1GGOA 1SCUB 4EGJA 4CC5A 1A48A 4E6NA 4ZQIA 4UFZA 3VOTA 4O7TA 4PZ7A 3RFCA 4NYEA 5KKNB 4CHIA 1DV2A 1KJ8A 4FU0A 3HT5A 2Q2TA 2VUGA 2Q7DA 3AW8A 2CNUA 1KT8A 4XX0B 3GB8B 1VBGA 5KX5F 1EUDB 2FP4B 2PVPA 5I47A 3DF7A 4IHJF 2QF7A 3QQMA 5DGIA 1KJQA 3U54A 2Z02A 5I60A 3R5HA 4MAMA 3TW7A 2W70A 1A9XA 3WWIA 2ZDHA 2HHFB 4ZI7F 3K5IA 3KYHC 1B04A 2C00A 5GONF 3RV3A 3QFFA 4FE2A 1V9PA 2YZGA 3BA8A 5CA0F 3U0GA 1I2LA 3HBLA 2DZDA 3V4ZA 4JXUA 5JQGF 1KJIA 2Y4RA 4TV9F 3JSNA 4O4LF 4MV9A 1A0IA 2I8CA 3TY8A 3N8DA 4O4HF 4E4TA 2R7MA 4M0JA 2R85A 1CQIB 2V59A 3G8DA 1A3GA 3JZIA 3QWUA 2OLSA 3OUZA 5JH7F 4PZ8A 5HNEA 3K3PA 4YB8B 2CZGA 1CKMA 5BMVF 2YS6A 4O7VA 3MWEA 2HDKA 3Q1KA 2YRWA 4FFOA 4XYLB 5I5UA 1W93A 4UCUA 3L2PA 4PBCA 2I87A 2FPPB 3CEBA 5BPHA 3G8CA 1Z2PX 4EEQA 3TINA 2QB5A 2W6NA 4K6NA 1EKVA 2HVQA 3UYYA 1KBLA 4O7ZA 5BWVA 1X9NA 3PFFA 1JDEA 2GQSA 5K2MA 1CKOA 3TY9A 2P0AA 4O4IF 3W5OA 1AUVA 3MWDA 1TA8A 3MJFA 5FPRA 1UC9A 3VA7A 1EYZA 1XDNA 4O7NA 5CB4F 4FFRA 1GSOA 5FR9A 4M9UA 2FB9A 3KAJA 5E25A 3LULA 3S24A 2YRXA 4MV3A 3R9RA 3W1GA 2ODTX 5C1PA 2NUAB 5KS8A 5K3WA 4CC6A 4DQNA 5EZYF 5LXTF 5J2UF 5D8DA 2DLNA 3BACA 4Y8VB 1C3OA 1KJ9A 2GLTA 5I5YA 5LOVF 4NZNA 1I1LA 5LA6F 3RTXA 4CKBA 4DAAA 1VBHA 3I12A 4XYMB 3RV4A 3TQTA 4C5BA 3CSWA 4IZOA 2R7NA 5I5VA 2DAAA 4IWYA 4YJ3F 3WWJA 5C8YF 4UUGA 1DIKA 4FFMA 3GDEA 1EUCB 4LH6A 4MV1A 3KALA 2R87A 1W96A 3NC0B 3N6RA 2FPGB 3WO1A 4MA0A 4CMFA 1I1KA 4RCNA 2IP4A 5HBRB 5IYZF 3JRXA 3UFXB 2R7KA 5I5WA 4UCSA 5JVDF 1WRVA 5LYJF 2DIKA 2YYAA 2NU6B 4UCOA 4WHXA 4HNTA 3VMMA 1S68A 5HV6A 2VPQA 2COJA 4O7YA 5BWUA 3T9EA 4FFPA 4FGRA 3VPBA 2W6OA 4QSHA 4IWXA 1I7NA 3GLKA 4O4JF 1PK8A 4MV4A 3PN1A 5J2TF 2W71A 3U55A 4FFNA 1M0WA 1GLVA 2VQDA 5JQWA 3VPDA 3VNNA 1UC8A 3NBYB 3JRWA 4CKEA 4HN2A 4O83A 4I50F 1KUTA 2YZNA 2YZMA 4NZMA 4PZ6A 3R5XA 1M6VA 4O82A 1KTAA 3TIGA 3T54A 3SE7A 4O2AF 1KEEA 1IYDA 2EJ0A 4WBNF 3VPCA 3DAAA 2GPSA 2EJ3A 2ZDGA 4Q4CA
chains in the Genus database with same CATH topology
3QWUA 5DISC 3W1BA 1V9PA 2HIXA 3GB8B 4EFBA 1DGSA 4EFEA 2OWOA 4UCSA 4PZ8A 3W5OA 3RR5A 3BA8A 2HVRA 3UQ8A 4UCRA 1XK5A 1CKMA 4UCOA 3VNNA 1P8LA 1TA8A 5FPOA 5FPRA 3NBYB 1S68A 5D1OB 3GDEA 3L2PA 1XDNA 4UCUA 4GLXA 4LH6A 2HVSA 3NBZB 4EQ5A 3GJXB 1CKNB 1P16A 2CFMA 3JSNA 4PZ6A 4UCVA 4UCTA 5D1OA 1FVIA 1A0IA 4CC5A 2Q2UA 2HIVA 3BA9A 4EEQA 3NC0B 3TY8A 4UFZA 4E6NA 2Q2TA 4DRFA 3S24A 3TY5A 2HVQA 1VS0A 4PZ7A 3W1GA 3RTXA 3KYHC 1TAEA 3BAAA 1B04A 3PN1A 4CC6A 4LH7A 5D1PA 3JSLA 1X9NA 3BABA 1CKNA 1CKOA 3TY9A 2VUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWU A;  5DIS C;  3W1B A;  1V9P A;  2HIX A;  3GB8 B;  4EFB A;  1DGS A;  4EFE A;  2OWO A;  4UCS A;  4PZ8 A;  3W5O A;  3RR5 A;  3BA8 A;  2HVR A;  3UQ8 A;  4UCR A;  1XK5 A;  1CKM A;  4UCO A;  3VNN A;  1P8L A;  1TA8 A;  5FPO A;  5FPR A;  3NBY B;  1S68 A;  5D1O B;  3GDE A;  3L2P A;  1XDN A;  4UCU A;  4GLX A;  4LH6 A;  2HVS A;  3NBZ B;  4EQ5 A;  3GJX B;  1CKN B;  1P16 A;  2CFM A;  3JSN A;  4PZ6 A;  4UCV A;  4UCT A;  5D1O A;  1FVI A;  1A0I A;  4CC5 A;  2Q2U A;  2HIV A;  3BA9 A;  4EEQ A;  3NC0 B;  3TY8 A;  4UFZ A;  4E6N A;  2Q2T A;  4DRF A;  3S24 A;  3TY5 A;  2HVQ A;  1VS0 A;  4PZ7 A;  3W1G A;  3RTX A;  3KYH C;  1TAE A;  3BAA A;  1B04 A;  3PN1 A;  4CC6 A;  4LH7 A;  5D1P A;  3JSL A;  1X9N A;  3BAB A;  1CKN A;  1CKO A;  3TY9 A;  2VUG A; 
#chains in the Genus database with same CATH topology
 3T7A A;  2OWO A;  1I2K A;  1BNC A;  3RUP A;  4DIM A;  2GQR A;  1XK5 A;  1DV1 A;  3KAK A;  3LWB A;  5BWX A;  3HB9 A;  4MV8 A;  1EKP A;  4UCT A;  2Q2U A;  3K5H A;  2YZL A;  2A1H A;  4O84 A;  4ME6 A;  3SGI A;  1ET0 A;  2V58 A;  3JSL A;  4O7S A;  3T9C A;  2W6M A;  4HNV A;  4FFL A;  4O7W A;  2ZDQ A;  4ZHQ F;  2DAB A;  4UCR A;  1VKZ A;  2R86 A;  1CS0 A;  3R5F A;  1IOV A;  3NBZ B;  4YJ2 F;  4RZQ A;  4HNU A;  4EQ5 A;  3GJX B;  5CAE B;  3T9F A;  2HJW A;  4CMD A;  5BWT A;  1Z2O X;  1GSH A;  2ZGI A;  1JDB B;  1CKN A;  2HIX A;  4O81 A;  4EFB A;  2SCU B;  5CE8 A;  4EG0 A;  3UQ8 A;  1B6R A;  3GID A;  2X0S A;  2EJ2 A;  3Q2O A;  5FPO A;  2CNV A;  1C30 A;  2HGW A;  4GLX A;  1OBD A;  2YWV A;  4TV8 F;  3HO8 A;  4MA5 A;  3E5N A;  1EKF A;  4I55 F;  1Z2N X;  4GLW A;  5DMX A;  3UZB A;  1CQJ B;  2HG8 A;  2FPI B;  3TY5 A;  2VR1 A;  3DTG A;  2EIY A;  1DAA A;  1TAE A;  3JZF A;  3TEK A;  4XZ3 B;  4ZOL F;  2R82 A;  5CA1 F;  3BAB A;  5DIS C;  3W1B A;  2X5R A;  2COI A;  2I80 A;  2XD4 A;  5DGH A;  2PN1 A;  3ORR A;  1ZAU A;  4YAJ B;  4EGQ A;  1M0T A;  1B6S A;  1IOW A;  5CR5 A;  5BWW A;  1JKJ B;  1VS0 A;  3T9D A;  3OUU A;  2HHF A;  4YAK B;  4LH7 A;  4NZO A;  2QK4 A;  5D1O B;  2NU8 B;  4Q4D A;  5FNV F;  5BPF A;  1E4E A;  4TVI A;  5I5X A;  2DWC A;  1E4E B;  3KRE A;  1OBG A;  5DAA A;  2HVR A;  5CM0 A;  2GPW A;  3ORQ A;  1P8L A;  2YW2 A;  2J9G A;  1AUX A;  4MV7 A;  4HR7 A;  2HVS A;  3JZ6 A;  1KC7 A;  4UCV A;  4I4T F;  2R84 A;  1KJJ A;  3BA9 A;  1T36 A;  5LP6 F;  2YL2 A;  1I7L A;  2CNQ A;  2HGS A;  3UZO A;  3NUA A;  3V4S A;  5JVL A;  3U9T A;  3T9A A;  4TUY F;  3DTF A;  2PBZ A;  3ETH A;  1DGS A;  2WYO A;  4L1K A;  4O86 A;  2W6Q A;  2XCL A;  4O7L A;  3AX6 A;  2W6Z A;  2YS7 A;  1A0G A;  4C5C A;  1CKN B;  3WWH A;  2HIV A;  3U9S A;  5H80 A;  3LP8 A;  4IIJ F;  5I5S A;  2R7L A;  3BAA A;  2W6P A;  1WR2 A;  5BYB A;  3TW6 A;  1G2W A;  4C5A A;  4HQ6 A;  3SNO A;  3LQS A;  3RR5 A;  4O7R A;  1CE8 A;  1ULZ A;  4TM5 A;  1GSA A;  1I1M A;  2ABJ A;  4CE5 A;  1EHI A;  1PX2 A;  3R23 A;  3WO0 A;  5BWR A;  1FVI A;  2NU9 B;  4DRF A;  4YBZ B;  2Z04 A;  5BYA A;  3TII A;  3BG5 A;  2NU7 B;  3T9B A;  5D1P A;  2HGX A;  5I5T A;  1JLL B;  2COG A;  4CKC A;  3ETJ A;  1IYE A;  4DLK A;  3T99 A;  4EFE A;  2V5A A;  3WNZ A;  5C1O A;  1EZ1 A;  4O2B F;  1BXR A;  4MV6 A;  5D1O A;  1P16 A;  2CFM A;  1GGO A;  1SCU B;  4EGJ A;  4CC5 A;  1A48 A;  4E6N A;  4ZQI A;  4UFZ A;  3VOT A;  4O7T A;  4PZ7 A;  3RFC A;  4NYE A;  5KKN B;  4CHI A;  1DV2 A;  1KJ8 A;  4FU0 A;  3HT5 A;  2Q2T A;  2VUG A;  2Q7D A;  3AW8 A;  2CNU A;  1KT8 A;  4XX0 B;  3GB8 B;  1VBG A;  5KX5 F;  1EUD B;  2FP4 B;  2PVP A;  5I47 A;  3DF7 A;  4IHJ F;  2QF7 A;  3QQM A;  5DGI A;  1KJQ A;  3U54 A;  2Z02 A;  5I60 A;  3R5H A;  4MAM A;  3TW7 A;  2W70 A;  1A9X A;  3WWI A;  2ZDH A;  2HHF B;  4ZI7 F;  3K5I A;  3KYH C;  1B04 A;  2C00 A;  5GON F;  3RV3 A;  3QFF A;  4FE2 A;  1V9P A;  2YZG A;  3BA8 A;  5CA0 F;  3U0G A;  1I2L A;  3HBL A;  2DZD A;  3V4Z A;  4JXU A;  5JQG F;  1KJI A;  2Y4R A;  4TV9 F;  3JSN A;  4O4L F;  4MV9 A;  1A0I A;  2I8C A;  3TY8 A;  3N8D A;  4O4H F;  4E4T A;  2R7M A;  4M0J A;  2R85 A;  1CQI B;  2V59 A;  3G8D A;  1A3G A;  3JZI A;  3QWU A;  2OLS A;  3OUZ A;  5JH7 F;  4PZ8 A;  5HNE A;  3K3P A;  4YB8 B;  2CZG A;  1CKM A;  5BMV F;  2YS6 A;  4O7V A;  3MWE A;  2HDK A;  3Q1K A;  2YRW A;  4FFO A;  4XYL B;  5I5U A;  1W93 A;  4UCU A;  3L2P A;  4PBC A;  2I87 A;  2FPP B;  3CEB A;  5BPH A;  3G8C A;  1Z2P X;  4EEQ A;  3TIN A;  2QB5 A;  2W6N A;  4K6N A;  1EKV A;  2HVQ A;  3UYY A;  1KBL A;  4O7Z A;  5BWV A;  1X9N A;  3PFF A;  1JDE A;  2GQS A;  5K2M A;  1CKO A;  3TY9 A;  2P0A A;  4O4I F;  3W5O A;  1AUV A;  3MWD A;  1TA8 A;  3MJF A;  5FPR A;  1UC9 A;  3VA7 A;  1EYZ A;  1XDN A;  4O7N A;  5CB4 F;  4FFR A;  1GSO A;  5FR9 A;  4M9U A;  2FB9 A;  3KAJ A;  5E25 A;  3LUL A;  3S24 A;  2YRX A;  4MV3 A;  3R9R A;  3W1G A;  2ODT X;  5C1P A;  2NUA B;  5KS8 A;  5K3W A;  4CC6 A;  4DQN A;  5EZY F;  5LXT F;  5J2U F;  5D8D A;  2DLN A;  3BAC A;  4Y8V B;  1C3O A;  1KJ9 A;  2GLT A;  5I5Y A;  5LOV F;  4NZN A;  1I1L A;  5LA6 F;  3RTX A;  4CKB A;  4DAA A;  1VBH A;  3I12 A;  4XYM B;  3RV4 A;  3TQT A;  4C5B A;  3CSW A;  4IZO A;  2R7N A;  5I5V A;  2DAA A;  4IWY A;  4YJ3 F;  3WWJ A;  5C8Y F;  4UUG A;  1DIK A;  4FFM A;  3GDE A;  1EUC B;  4LH6 A;  4MV1 A;  3KAL A;  2R87 A;  1W96 A;  3NC0 B;  3N6R A;  2FPG B;  3WO1 A;  4MA0 A;  4CMF A;  1I1K A;  4RCN A;  2IP4 A;  5HBR B;  5IYZ F;  3JRX A;  3UFX B;  2R7K A;  5I5W A;  4UCS A;  5JVD F;  1WRV A;  5LYJ F;  2DIK A;  2YYA A;  2NU6 B;  4UCO A;  4WHX A;  4HNT A;  3VMM A;  1S68 A;  5HV6 A;  2VPQ A;  2COJ A;  4O7Y A;  5BWU A;  3T9E A;  4FFP A;  4FGR A;  3VPB A;  2W6O A;  4QSH A;  4IWX A;  1I7N A;  3GLK A;  4O4J F;  1PK8 A;  4MV4 A;  3PN1 A;  5J2T F;  2W71 A;  3U55 A;  4FFN A;  1M0W A;  1GLV A;  2VQD A;  5JQW A;  3VPD A;  3VNN A;  1UC8 A;  3NBY B;  3JRW A;  4CKE A;  4HN2 A;  4O83 A;  4I50 F;  1KUT A;  2YZN A;  2YZM A;  4NZM A;  4PZ6 A;  3R5X A;  1M6V A;  4O82 A;  1KTA A;  3TIG A;  3T54 A;  3SE7 A;  4O2A F;  1KEE A;  1IYD A;  2EJ0 A;  4WBN F;  3VPC A;  3DAA A;  2GPS A;  2EJ3 A;  2ZDG A;  4Q4C A; 
#chains in the Genus database with same CATH homology
 3QWU A;  5DIS C;  3W1B A;  1V9P A;  2HIX A;  3GB8 B;  4EFB A;  1DGS A;  4EFE A;  2OWO A;  4UCS A;  4PZ8 A;  3W5O A;  3RR5 A;  3BA8 A;  2HVR A;  3UQ8 A;  4UCR A;  1XK5 A;  1CKM A;  4UCO A;  3VNN A;  1P8L A;  1TA8 A;  5FPO A;  5FPR A;  3NBY B;  1S68 A;  5D1O B;  3GDE A;  3L2P A;  1XDN A;  4UCU A;  4GLX A;  4LH6 A;  2HVS A;  3NBZ B;  4EQ5 A;  3GJX B;  1CKN B;  1P16 A;  2CFM A;  3JSN A;  4PZ6 A;  4UCV A;  4UCT A;  5D1O A;  1FVI A;  1A0I A;  4CC5 A;  2Q2U A;  2HIV A;  3BA9 A;  4EEQ A;  3NC0 B;  3TY8 A;  4UFZ A;  4E6N A;  2Q2T A;  4DRF A;  3S24 A;  3TY5 A;  2HVQ A;  1VS0 A;  4PZ7 A;  3W1G A;  3RTX A;  3KYH C;  1TAE A;  3BAA A;  1B04 A;  3PN1 A;  4CC6 A;  4LH7 A;  5D1P A;  3JSL A;  1X9N A;  3BAB A;  1CKN A;  1CKO A;  3TY9 A;  2VUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...