3NBYB

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
361
structure length
272
Chain Sequence
b'GSLNELALKLAGLDISQDLNSTAAPHPRLSQYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGHSPDHPGCLMEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding protein/transport protein
total genus 57
structure length 272
sequence length 361
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3nbyB00
3UQ8A 3NBZB 5DISC 3TY8A 4LH7A 1CKNA 4EEQA 1X9NA 1FVIA 4EFBA 4LH6A 2HVQA 1DGSA 3BA9A 5FPOA 4PZ6A 1CKNB 1TAEA 1XDNA 4PZ8A 1A0IA 4UCSA 4UFZA 3RTXA 3S24A 3JSNA 3BA8A 3QWUA 4DRFA 4EQ5A 1CKMA 3KYHC 2HVSA 3W5OA 3BABA 2OWOA 3GJXB 3JSLA 2VUGA 4E6NA 1XK5A 2CFMA 4CC6A 4EFEA 3NC0B 3W1BA 2HIXA 5D1OA 3GDEA 3L2PA 4UCTA 1VS0A 4UCOA 3TY5A 1P16A 1S68A 3RR5A 2Q2TA 3BAAA 3PN1A 2HVRA 4CC5A 5FPRA 4GLXA 1P8LA 4UCVA 5D1OB 4UCRA 3W1GA 4UCUA 1V9PA 2HIVA 1TA8A 3TY9A 2Q2UA 1B04A 3GB8B 3VNNA 1CKOA 4PZ7A 5D1PA 3NBYB
chains in the Genus database with same CATH superfamily
5HBRB 3T9DA 4O86A 4I55F 3NBZB 3VOTA 3K5HA 4YAJB 1C30A 1I1MA 5KKNB 3T9BA 2QK4A 1CKNA 2R82A 1EKFA 4EGJA 1A0GA 1KJJA 4M9UA 5BWTA 3T7AA 1IYDA 3GLKA 2DABA 3UZOA 5BMVF 3BA9A 3TIIA 3G8DA 3LQSA 4CKBA 1Z2OX 1CS0A 4O4JF 2FPIB 3LP8A 3V4SA 1A0IA 4CKEA 1DV1A 4UFZA 4FFMA 3S24A 1KJQA 2FP4B 4MA5A 1UC9A 2YZMA 4Q4CA 1KBLA 1I2KA 5C1PA 2W6QA 4DLKA 2Z04A 2CNUA 5LP6F 4L1KA 1A48A 2ZGIA 2NU9B 3VPCA 2R7NA 2R85A 3R23A 2HVSA 2DWCA 3W5OA 3JSLA 1M6VA 4E6NA 5LYJF 1ET0A 4YB8B 1AUXA 5C1OA 2HJWA 4O7NA 5J2TF 3W1BA 3CSWA 1JLLB 2HIXA 4NYEA 2FPPB 3G8CA 3L2PA 4YAKB 1DAAA 5BWWA 3TW6A 4FFRA 4O7WA 2V58A 3RV4A 2VQDA 4HNUA 4CMDA 4NZOA 3VA7A 3TQTA 2YYAA 3TY5A 1GSOA 4TV9F 5CE8A 2YZNA 1P16A 1S68A 3AW8A 3BAAA 3PN1A 5CAEB 5I60A 3ETJA 5D1OB 3VMMA 1SCUB 5I5TA 4UCUA 5DAAA 3RUPA 1UC8A 4MV9A 1TA8A 3TY9A 2Q2UA 2YZGA 3K5IA 4JXUA 2HGWA 1GSHA 4RZQA 5I5XA 1DV2A 4YJ3F 3OUZA 2YS7A 1WR2A 2V5AA 3UQ8A 5I5YA 1IOVA 4O83A 2Q7DA 2R84A 4XYMB 3R9RA 4O82A 2YL2A 4LH7A 1W93A 5DGHA 2C00A 3KALA 5JQGF 4MV3A 2PBZA 4FGRA 5LOVF 4CE5A 4O4IF 1BXRA 4EFBA 2I80A 3BG5A 5GONF 2I87A 3N6RA 4QSHA 1IYEA 2R7MA 1PK8A 4WHXA 4HNVA 3ORQA 1XDNA 2CNQA 4PZ8A 2R7LA 3RTXA 2NUAB 4C5AA 1BNCA 1PX2A 2YZLA 2W70A 4FU0A 3T9FA 3TINA 1GLVA 3U9TA 3VPBA 3VPDA 4IWYA 1KC7A 4MAMA 2YS6A 4IHJF 4O7VA 2YRWA 3JRXA 1EUCB 5HNEA 1JDBB 3U0GA 3K3PA 4Q4DA 1G2WA 3T9CA 5C8YF 4C5BA 5I5WA 2CZGA 2HHFB 5K2MA 3WO1A 2HGSA 1XK5A 2CFMA 4CC6A 2FB9A 2GPWA 3WNZA 4EFEA 5I5UA 2PN1A 2FPGB 4FFNA 5D1OA 4NZNA 2GQRA 3UFXB 4O2AF 2QB5A 2Z02A 3WO0A 4I50F 3RV3A 2YRXA 2GQSA 4UCOA 5CM0A 5HV6A 2R86A 2R7KA 5CA1F 3TIGA 4O7ZA 3AX6A 3OUUA 4IZOA 4O2BF 3LULA 4ZOLF 3R5FA 4WBNF 5I5VA 5BPHA 2HIVA 3PFFA 3Q1KA 3R5HA 4O7TA 4XYLB 5KX5F 4TUYF 4PZ7A 1GSAA 2NU7B 5D1PA 3DTGA 3NBYB 3UYYA 4K6NA 1JDEA 4O7SA 4MV6A 2EJ0A 2HDKA 3DAAA 2EJ2A 2X0SA 4HQ6A 1C3OA 1E4EB 3KREA 5EZYF 3WWJA 1I2LA 3T99A 4C5CA 3JZIA 1GGOA 1KJ8A 2VPQA 4IWXA 2P0AA 4LH6A 2HVQA 4FFLA 3HBLA 4O7RA 4Y8VB 1DGSA 3HO8A 1ULZA 4PZ6A 4CKCA 3GIDA 3T9EA 1TAEA 3RFCA 2GPSA 2A1HA 3MWDA 3JZ6A 5CA0F 3JSNA 4DAAA 4ZI7F 5K3WA 5JQWA 3N8DA 5BYAA 4FE2A 4DRFA 5E25A 4MV7A 4TVIA 1CKMA 2J9GA 1KEEA 5D8DA 3T9AA 2V59A 3BABA 2X5RA 1EZ1A 3SNOA 2R87A 2XD4A 2VR1A 2CNVA 4EG0A 5FR9A 1CQJB 4O4HF 2DAAA 3MWEA 3NC0B 3Q2OA 3DTFA 1EKPA 5BPFA 4O81A 4CHIA 5H80A 4MV8A 3ETHA 3NUAA 1VS0A 4MV4A 2ABJA 2QF7A 1KUTA 2W6OA 3QFFA 5J2UF 1CQIB 5BWRA 2Q2TA 1EHIA 5JH7F 3SE7A 2GLTA 5FPRA 1B6SA 1P8LA 1OBGA 4UCRA 4UUGA 1VBGA 2HG8A 4RCNA 3W1GA 1V9PA 1IOWA 3TW7A 5CR5A 1B04A 3TEKA 2NU8B 1E4EA 4ME6A 1WRVA 3GB8B 3VNNA 3LWBA 1CKOA 3I12A 2DZDA 4HN2A 4ZHQF 4XZ3B 5BWXA 4M0JA 3U55A 3CEBA 3KAJA 5DISC 3TY8A 5BWUA 5JVDF 1I1LA 1VBHA 2I8CA 2PVPA 2YW2A 4XX0B 4EEQA 1X9NA 3HB9A 1FVIA 5JVLA 2W6MA 1B6RA 3BACA 5I47A 1T36A 2ZDGA 4CMFA 2Y4RA 5FPOA 1OBDA 2ZDQA 4HR7A 2IP4A 5LA6F 2COJA 1A3GA 1CKNB 4O7YA 2W6PA 4GLWA 4EGQA 2EJ3A 5IYZF 4YJ2F 4DIMA 4UCSA 5DGIA 2W6NA 2COIA 1EUDB 1KT8A 3BA8A 5FNVF 4FFOA 1EYZA 2YWVA 3QWUA 1A9XA 3U54A 4YBZB 2W71A 3DF7A 4NZMA 2ZDHA 4EQ5A 1I7LA 4E4TA 3KYHC 3U9SA 5BWVA 4MA0A 2SCUB 1KJIA 2EIYA 2XCLA 3SGIA 3GJXB 2HGXA 2OWOA 2VUGA 2NU6B 1M0WA 1W96A 4O7LA 4IIJF 1Z2NX 5I5SA 1M0TA 4FFPA 3V4ZA 2HHFA 1I7NA 5KS8A 5DMXA 1KTAA 2WYOA 2DLNA 3E5NA 4PBCA 3WWIA 1I1KA 1CE8A 3GDEA 1ZAUA 4I4TF 4HNTA 5LXTF 4UCTA 2W6ZA 4O84A 1Z2PX 3KAKA 1AUVA 3RR5A 1EKVA 2HVRA 3WWHA 4CC5A 4TV8F 4DQNA 4GLXA 3JZFA 4UCVA 3JRWA 1VKZA 3QQMA 2COGA 1KJ9A 5BYBA 3T54A 4ZQIA 3R5XA 3UZBA 2OLSA 1DIKA 3MJFA 2DIKA 3ORRA 2ODTX 4O4LF 4TM5A 5CB4F 1JKJB 4MV1A 3HT5A
chains in the Genus database with same CATH topology
3UQ8A 3NBZB 5DISC 3TY8A 4LH7A 1CKNA 4EEQA 1X9NA 1FVIA 4EFBA 4LH6A 2HVQA 1DGSA 3BA9A 5FPOA 4PZ6A 1CKNB 1TAEA 1XDNA 4PZ8A 1A0IA 4UCSA 4UFZA 3RTXA 3S24A 3JSNA 3BA8A 3QWUA 4DRFA 4EQ5A 1CKMA 3KYHC 2HVSA 3W5OA 3BABA 2OWOA 3GJXB 3JSLA 2VUGA 4E6NA 1XK5A 2CFMA 4CC6A 4EFEA 3NC0B 3W1BA 2HIXA 5D1OA 3GDEA 3L2PA 4UCTA 1VS0A 4UCOA 3TY5A 1P16A 1S68A 3RR5A 2Q2TA 3BAAA 3PN1A 2HVRA 4CC5A 5FPRA 4GLXA 1P8LA 4UCVA 5D1OB 4UCRA 3W1GA 4UCUA 1V9PA 2HIVA 1TA8A 3TY9A 2Q2UA 1B04A 3GB8B 3VNNA 1CKOA 4PZ7A 5D1PA 3NBYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ8 A;  3NBZ B;  5DIS C;  3TY8 A;  4LH7 A;  1CKN A;  4EEQ A;  1X9N A;  1FVI A;  4EFB A;  4LH6 A;  2HVQ A;  1DGS A;  3BA9 A;  5FPO A;  4PZ6 A;  1CKN B;  1TAE A;  1XDN A;  4PZ8 A;  1A0I A;  4UCS A;  4UFZ A;  3RTX A;  3S24 A;  3JSN A;  3BA8 A;  3QWU A;  4DRF A;  4EQ5 A;  1CKM A;  3KYH C;  2HVS A;  3W5O A;  3BAB A;  2OWO A;  3GJX B;  3JSL A;  2VUG A;  4E6N A;  1XK5 A;  2CFM A;  4CC6 A;  4EFE A;  3NC0 B;  3W1B A;  2HIX A;  5D1O A;  3GDE A;  3L2P A;  4UCT A;  1VS0 A;  4UCO A;  3TY5 A;  1P16 A;  1S68 A;  3RR5 A;  2Q2T A;  3BAA A;  3PN1 A;  2HVR A;  4CC5 A;  5FPR A;  4GLX A;  1P8L A;  4UCV A;  5D1O B;  4UCR A;  3W1G A;  4UCU A;  1V9P A;  2HIV A;  1TA8 A;  3TY9 A;  2Q2U A;  1B04 A;  3GB8 B;  3VNN A;  1CKO A;  4PZ7 A;  5D1P A;  3NBY B; 
#chains in the Genus database with same CATH topology
 5HBR B;  3T9D A;  4O86 A;  4I55 F;  3NBZ B;  3VOT A;  3K5H A;  4YAJ B;  1C30 A;  1I1M A;  5KKN B;  3T9B A;  2QK4 A;  1CKN A;  2R82 A;  1EKF A;  4EGJ A;  1A0G A;  1KJJ A;  4M9U A;  5BWT A;  3T7A A;  1IYD A;  3GLK A;  2DAB A;  3UZO A;  5BMV F;  3BA9 A;  3TII A;  3G8D A;  3LQS A;  4CKB A;  1Z2O X;  1CS0 A;  4O4J F;  2FPI B;  3LP8 A;  3V4S A;  1A0I A;  4CKE A;  1DV1 A;  4UFZ A;  4FFM A;  3S24 A;  1KJQ A;  2FP4 B;  4MA5 A;  1UC9 A;  2YZM A;  4Q4C A;  1KBL A;  1I2K A;  5C1P A;  2W6Q A;  4DLK A;  2Z04 A;  2CNU A;  5LP6 F;  4L1K A;  1A48 A;  2ZGI A;  2NU9 B;  3VPC A;  2R7N A;  2R85 A;  3R23 A;  2HVS A;  2DWC A;  3W5O A;  3JSL A;  1M6V A;  4E6N A;  5LYJ F;  1ET0 A;  4YB8 B;  1AUX A;  5C1O A;  2HJW A;  4O7N A;  5J2T F;  3W1B A;  3CSW A;  1JLL B;  2HIX A;  4NYE A;  2FPP B;  3G8C A;  3L2P A;  4YAK B;  1DAA A;  5BWW A;  3TW6 A;  4FFR A;  4O7W A;  2V58 A;  3RV4 A;  2VQD A;  4HNU A;  4CMD A;  4NZO A;  3VA7 A;  3TQT A;  2YYA A;  3TY5 A;  1GSO A;  4TV9 F;  5CE8 A;  2YZN A;  1P16 A;  1S68 A;  3AW8 A;  3BAA A;  3PN1 A;  5CAE B;  5I60 A;  3ETJ A;  5D1O B;  3VMM A;  1SCU B;  5I5T A;  4UCU A;  5DAA A;  3RUP A;  1UC8 A;  4MV9 A;  1TA8 A;  3TY9 A;  2Q2U A;  2YZG A;  3K5I A;  4JXU A;  2HGW A;  1GSH A;  4RZQ A;  5I5X A;  1DV2 A;  4YJ3 F;  3OUZ A;  2YS7 A;  1WR2 A;  2V5A A;  3UQ8 A;  5I5Y A;  1IOV A;  4O83 A;  2Q7D A;  2R84 A;  4XYM B;  3R9R A;  4O82 A;  2YL2 A;  4LH7 A;  1W93 A;  5DGH A;  2C00 A;  3KAL A;  5JQG F;  4MV3 A;  2PBZ A;  4FGR A;  5LOV F;  4CE5 A;  4O4I F;  1BXR A;  4EFB A;  2I80 A;  3BG5 A;  5GON F;  2I87 A;  3N6R A;  4QSH A;  1IYE A;  2R7M A;  1PK8 A;  4WHX A;  4HNV A;  3ORQ A;  1XDN A;  2CNQ A;  4PZ8 A;  2R7L A;  3RTX A;  2NUA B;  4C5A A;  1BNC A;  1PX2 A;  2YZL A;  2W70 A;  4FU0 A;  3T9F A;  3TIN A;  1GLV A;  3U9T A;  3VPB A;  3VPD A;  4IWY A;  1KC7 A;  4MAM A;  2YS6 A;  4IHJ F;  4O7V A;  2YRW A;  3JRX A;  1EUC B;  5HNE A;  1JDB B;  3U0G A;  3K3P A;  4Q4D A;  1G2W A;  3T9C A;  5C8Y F;  4C5B A;  5I5W A;  2CZG A;  2HHF B;  5K2M A;  3WO1 A;  2HGS A;  1XK5 A;  2CFM A;  4CC6 A;  2FB9 A;  2GPW A;  3WNZ A;  4EFE A;  5I5U A;  2PN1 A;  2FPG B;  4FFN A;  5D1O A;  4NZN A;  2GQR A;  3UFX B;  4O2A F;  2QB5 A;  2Z02 A;  3WO0 A;  4I50 F;  3RV3 A;  2YRX A;  2GQS A;  4UCO A;  5CM0 A;  5HV6 A;  2R86 A;  2R7K A;  5CA1 F;  3TIG A;  4O7Z A;  3AX6 A;  3OUU A;  4IZO A;  4O2B F;  3LUL A;  4ZOL F;  3R5F A;  4WBN F;  5I5V A;  5BPH A;  2HIV A;  3PFF A;  3Q1K A;  3R5H A;  4O7T A;  4XYL B;  5KX5 F;  4TUY F;  4PZ7 A;  1GSA A;  2NU7 B;  5D1P A;  3DTG A;  3NBY B;  3UYY A;  4K6N A;  1JDE A;  4O7S A;  4MV6 A;  2EJ0 A;  2HDK A;  3DAA A;  2EJ2 A;  2X0S A;  4HQ6 A;  1C3O A;  1E4E B;  3KRE A;  5EZY F;  3WWJ A;  1I2L A;  3T99 A;  4C5C A;  3JZI A;  1GGO A;  1KJ8 A;  2VPQ A;  4IWX A;  2P0A A;  4LH6 A;  2HVQ A;  4FFL A;  3HBL A;  4O7R A;  4Y8V B;  1DGS A;  3HO8 A;  1ULZ A;  4PZ6 A;  4CKC A;  3GID A;  3T9E A;  1TAE A;  3RFC A;  2GPS A;  2A1H A;  3MWD A;  3JZ6 A;  5CA0 F;  3JSN A;  4DAA A;  4ZI7 F;  5K3W A;  5JQW A;  3N8D A;  5BYA A;  4FE2 A;  4DRF A;  5E25 A;  4MV7 A;  4TVI A;  1CKM A;  2J9G A;  1KEE A;  5D8D A;  3T9A A;  2V59 A;  3BAB A;  2X5R A;  1EZ1 A;  3SNO A;  2R87 A;  2XD4 A;  2VR1 A;  2CNV A;  4EG0 A;  5FR9 A;  1CQJ B;  4O4H F;  2DAA A;  3MWE A;  3NC0 B;  3Q2O A;  3DTF A;  1EKP A;  5BPF A;  4O81 A;  4CHI A;  5H80 A;  4MV8 A;  3ETH A;  3NUA A;  1VS0 A;  4MV4 A;  2ABJ A;  2QF7 A;  1KUT A;  2W6O A;  3QFF A;  5J2U F;  1CQI B;  5BWR A;  2Q2T A;  1EHI A;  5JH7 F;  3SE7 A;  2GLT A;  5FPR A;  1B6S A;  1P8L A;  1OBG A;  4UCR A;  4UUG A;  1VBG A;  2HG8 A;  4RCN A;  3W1G A;  1V9P A;  1IOW A;  3TW7 A;  5CR5 A;  1B04 A;  3TEK A;  2NU8 B;  1E4E A;  4ME6 A;  1WRV A;  3GB8 B;  3VNN A;  3LWB A;  1CKO A;  3I12 A;  2DZD A;  4HN2 A;  4ZHQ F;  4XZ3 B;  5BWX A;  4M0J A;  3U55 A;  3CEB A;  3KAJ A;  5DIS C;  3TY8 A;  5BWU A;  5JVD F;  1I1L A;  1VBH A;  2I8C A;  2PVP A;  2YW2 A;  4XX0 B;  4EEQ A;  1X9N A;  3HB9 A;  1FVI A;  5JVL A;  2W6M A;  1B6R A;  3BAC A;  5I47 A;  1T36 A;  2ZDG A;  4CMF A;  2Y4R A;  5FPO A;  1OBD A;  2ZDQ A;  4HR7 A;  2IP4 A;  5LA6 F;  2COJ A;  1A3G A;  1CKN B;  4O7Y A;  2W6P A;  4GLW A;  4EGQ A;  2EJ3 A;  5IYZ F;  4YJ2 F;  4DIM A;  4UCS A;  5DGI A;  2W6N A;  2COI A;  1EUD B;  1KT8 A;  3BA8 A;  5FNV F;  4FFO A;  1EYZ A;  2YWV A;  3QWU A;  1A9X A;  3U54 A;  4YBZ B;  2W71 A;  3DF7 A;  4NZM A;  2ZDH A;  4EQ5 A;  1I7L A;  4E4T A;  3KYH C;  3U9S A;  5BWV A;  4MA0 A;  2SCU B;  1KJI A;  2EIY A;  2XCL A;  3SGI A;  3GJX B;  2HGX A;  2OWO A;  2VUG A;  2NU6 B;  1M0W A;  1W96 A;  4O7L A;  4IIJ F;  1Z2N X;  5I5S A;  1M0T A;  4FFP A;  3V4Z A;  2HHF A;  1I7N A;  5KS8 A;  5DMX A;  1KTA A;  2WYO A;  2DLN A;  3E5N A;  4PBC A;  3WWI A;  1I1K A;  1CE8 A;  3GDE A;  1ZAU A;  4I4T F;  4HNT A;  5LXT F;  4UCT A;  2W6Z A;  4O84 A;  1Z2P X;  3KAK A;  1AUV A;  3RR5 A;  1EKV A;  2HVR A;  3WWH A;  4CC5 A;  4TV8 F;  4DQN A;  4GLX A;  3JZF A;  4UCV A;  3JRW A;  1VKZ A;  3QQM A;  2COG A;  1KJ9 A;  5BYB A;  3T54 A;  4ZQI A;  3R5X A;  3UZB A;  2OLS A;  1DIK A;  3MJF A;  2DIK A;  3ORR A;  2ODT X;  4O4L F;  4TM5 A;  5CB4 F;  1JKJ B;  4MV1 A;  3HT5 A; 
#chains in the Genus database with same CATH homology
 3UQ8 A;  3NBZ B;  5DIS C;  3TY8 A;  4LH7 A;  1CKN A;  4EEQ A;  1X9N A;  1FVI A;  4EFB A;  4LH6 A;  2HVQ A;  1DGS A;  3BA9 A;  5FPO A;  4PZ6 A;  1CKN B;  1TAE A;  1XDN A;  4PZ8 A;  1A0I A;  4UCS A;  4UFZ A;  3RTX A;  3S24 A;  3JSN A;  3BA8 A;  3QWU A;  4DRF A;  4EQ5 A;  1CKM A;  3KYH C;  2HVS A;  3W5O A;  3BAB A;  2OWO A;  3GJX B;  3JSL A;  2VUG A;  4E6N A;  1XK5 A;  2CFM A;  4CC6 A;  4EFE A;  3NC0 B;  3W1B A;  2HIX A;  5D1O A;  3GDE A;  3L2P A;  4UCT A;  1VS0 A;  4UCO A;  3TY5 A;  1P16 A;  1S68 A;  3RR5 A;  2Q2T A;  3BAA A;  3PN1 A;  2HVR A;  4CC5 A;  5FPR A;  4GLX A;  1P8L A;  4UCV A;  5D1O B;  4UCR A;  3W1G A;  4UCU A;  1V9P A;  2HIV A;  1TA8 A;  3TY9 A;  2Q2U A;  1B04 A;  3GB8 B;  3VNN A;  1CKO A;  4PZ7 A;  5D1P A;  3NBY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...