3NBYB

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
361
structure length
272
Chain Sequence
GSLNELALKLAGLDISQDLNSTAAPHPRLSQYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGHSPDHPGCLMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding protein/transport protein
molecule keywords Snurportin-1
total genus 57
structure length 272
sequence length 361
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3nbyB00
2HIVA 3GJXB 3JSNA 3GB8B 2CFMA 1S68A 3VNNA 4EFEA 3BABA 2OWOA 3NBYB 1X9NA 2VUGA 3QWUA 1CKOA 3GDEA 3TY5A 3NBZB 3W5OA 3L2PA 4GLXA 4UCTA 3BA8A 1B04A 4UCRA 1FVIA 1P16A 3BAAA 3TY9A 3RTXA 4CC5A 1CKNB 1XDNA 3RR5A 3W1BA 5D1PA 5D1OB 4DRFA 1XK5A 4UCUA 4UCSA 4LH7A 1VS0A 2Q2TA 3S24A 2HVQA 4PZ8A 4PZ7A 4LH6A 4UCVA 3BA9A 1DGSA 4UFZA 4EQ5A 2Q2UA 3TY8A 3JSLA 1CKNA 3W1GA 2HIXA 3NC0B 5FPOA 4PZ6A 1TA8A 3PN1A 5D1OA 4E6NA 1P8LA 2HVSA 3KYHC 5DISC 1CKMA 4CC6A 4EEQA 4EFBA 5FPRA 4UCOA 3UQ8A 1A0IA 1V9PA 1TAEA 2HVRA
chains in the Genus database with same CATH superfamily
1EKFA 3K5HA 4NZOA 4O7TA 2PN1A 1X9NA 2HGSA 3CSWA 3GLKA 4ZQIA 3NBZB 1GGOA 4O7NA 2VR1A 3R5HA 5I60A 2IP4A 3RTXA 3T9FA 5D1OB 2WYOA 3LP8A 1KJJA 4GLWA 5E25A 1EZ1A 4HR7A 3NC0B 4MA0A 3ETHA 5D1OA 4MV1A 2QB5A 3KYHC 5JQWA 1EYZA 4CC6A 4O7LA 3RV3A 1V9PA 1A3GA 2W6PA 3LQSA 4DLKA 2X0SA 4ZOLF 1VBHA 3NBYB 2R7MA 1ULZA 2HGWA 2R7NA 5I5WA 1M0WA 2FPGB 5BWUA 2VPQA 4CKEA 1FVIA 5I5SA 4O4HF 4NZNA 4RZQA 3HBLA 3RR5A 2NU9B 1GLVA 2R7LA 1ET0A 1GSAA 5DMXA 5BMVF 5DGHA 2J9GA 1I2LA 4HNTA 2CNUA 2YRXA 2HHFB 2FB9A 4EGQA 4TV8F 4WBNF 2HVSA 2CNVA 1A0IA 1EHIA 4CKCA 2ZDHA 3WNZA 5IYZF 4MV6A 2CFMA 1CE8A 3VNNA 2ABJA 5BWVA 2PBZA 3QWUA 3GDEA 3RV4A 1I1KA 3TY9A 5CAEB 3WO1A 5BWWA 5LYJF 3NUAA 1WR2A 1KJIA 2Y4RA 5BYAA 5BWXA 5D8DA 4HNUA 3BA9A 4UFZA 5BYBA 4FFNA 3UFXB 1AUXA 4O82A 3T99A 3WWJA 2YS7A 4IHJF 5JVDF 5KS8A 2VUGA 4FFMA 3E5NA 1IYEA 3W5OA 3U0GA 4HQ6A 3JZ6A 2XD4A 1G2WA 3BAAA 4IZOA 1KTAA 1ZAUA 1XDNA 2PVPA 1DV2A 4YJ3F 4TVIA 4UCUA 4UCSA 4YJ2F 3LULA 3OUUA 5LOVF 2Q2UA 3VMMA 1JDEA 5J2TF 3U54A 4E6NA 5CE8A 1E4EA 2HHFA 3TIGA 3W1BA 2HVRA 4CMDA 4XYMB 3RUPA 2NUAB 2NU8B 1IOVA 3UZOA 1CKOA 3MWDA 4GLXA 3WWHA 5DGIA 2YZNA 1KEEA 1JDBB 2Z04A 5I5TA 4XZ3B 5HBRB 2SCUB 1CKNB 4FFOA 1KC7A 4FFLA 3U55A 3ETJA 4Q4DA 5I5VA 1VS0A 4MA5A 4O7ZA 1A48A 1C30A 3OUZA 2DAAA 3PN1A 4O7VA 3DAAA 4CHIA 3JSNA 4EGJA 1OBGA 5J2UF 3K5IA 4NYEA 2DZDA 2FPIB 1CS0A 2W6NA 4HN2A 3HB9A 5HNEA 3VOTA 5BPHA 4O7RA 2W70A 2W71A 3QQMA 1DIKA 3TIIA 3BG5A 4LH7A 1GSOA 2YZLA 4PZ8A 1GSHA 3I12A 3JRXA 4C5BA 3SE7A 5DISC 1KJQA 2W6ZA 4C5CA 1E4EB 2DWCA 4YAKB 3VPBA 1S68A 1PK8A 2W6QA 2OWOA 3ORRA 4O4JF 4UCTA 4DQNA 2GPWA 2QF7A 1B6SA 2A1HA 4MV3A 4L1KA 4FGRA 1W96A 4TM5A 2ZGIA 2I80A 2OLSA 4FFPA 4MAMA 2X5RA 3V4SA 5C1PA 2GLTA 4O4LF 4IIJF 2R82A 2HGXA 4HNVA 3BACA 2HJWA 4O7YA 2HG8A 1B6RA 4UCRA 3UZBA 2XCLA 2ODTX 3UYYA 5KKNB 4CKBA 2V5AA 1IYDA 3K3PA 1I7NA 2V59A 5FPOA 4YB8B 2NU7B 1A0GA 3SNOA 5LA6F 2EJ0A 4O84A 3WWIA 1EKPA 5LXTF 5JH7F 3DTFA 5HV6A 3BA8A 1VKZA 2YRWA 2R87A 5I5XA 1XK5A 3T9CA 2FPPB 4FU0A 2COIA 4IWXA 4O7WA 3TW7A 1Z2OX 2FP4B 5H80A 3JZFA 4UCOA 5C1OA 4FFRA 2HIVA 4M0JA 1A9XA 1W93A 4O4IF 2GPSA 4CE5A 4O83A 1BNCA 1EUCB 1M6VA 3T54A 4MV8A 4IWYA 1JLLB 3R5FA 5LP6F 3S24A 5FNVF 1SCUB 3T7AA 1DGSA 2C00A 1C3OA 3HO8A 4ME6A 4E4TA 1TA8A 3R9RA 4RCNA 4EEQA 2V58A 3U9SA 2EJ2A 1DV1A 3N8DA 3DTGA 1AUVA 5CM0A 5CB4F 1KUTA 2COJA 2Q7DA 2R7KA 3CEBA 3AW8A 5D1PA 3GIDA 1I2KA 2YZGA 3MWEA 1Z2NX 3G8DA 4EQ5A 2GQSA 2YS6A 2YZMA 4DIMA 1I1LA 2QK4A 3R5XA 4NZMA 3VPDA 3AX6A 4I4TF 4DAAA 3MJFA 4K6NA 1I7LA 1KBLA 4QSHA 3TINA 3TY5A 1UC8A 5BPFA 1B04A 2R84A 4PBCA 5KX5F 3HT5A 4Y8VB 2DABA 2R85A 2VQDA 4ZHQF 2W6MA 2HDKA 3JSLA 1VBGA 1OBDA 2ZDQA 3LWBA 4JXUA 5I5YA 5FPRA 3KAKA 5EZYF 4O2AF 2DIKA 2Z02A 4YBZB 4EFEA 5CA1F 3T9BA 1WRVA 2P0AA 3Q2OA 3KAJA 3JRWA 2W6OA 3VA7A 1P16A 5K3WA 4YAJB 4XYLB 2YL2A 4UCVA 4M9UA 4FE2A 4MV7A 1P8LA 3G8CA 2I8CA 4O7SA 3VPCA 4MV4A 1JKJB 3R23A 3GB8B 1Z2PX 4I55F 5I5UA 3Q1KA 3RFCA 3L2PA 2DLNA 4CC5A 4EG0A 2R86A 1UC9A 4PZ7A 4TV9F 4LH6A 3PFFA 4MV9A 5BWRA 3TY8A 1CKNA 2HIXA 3KALA 4O86A 1BXRA 4O81A 2YW2A 4O2BF 2CNQA 1DAAA 1I1MA 5I47A 3UQ8A 3U9TA 3JZIA 4XX0B 2NU6B 3ORQA 5K2MA 4ZI7F 1T36A 1M0TA 3TW6A 1CQIB 3WO0A 2EJ3A 4DRFA 5CR5A 5CA0F 3DF7A 5C8YF 4CMFA 3TEKA 5FR9A 2YYAA 5GONF 1KJ9A 3QFFA 3KREA 3T9DA 1KJ8A 5JQGF 2ZDGA 4UUGA 1CKMA 3T9EA 1TAEA 3GJXB 3BABA 5JVLA 1CQJB 4TUYF 4WHXA 3T9AA 3SGIA 3TQTA 4Q4CA 1IOWA 2CZGA 2I87A 2Q2TA 2HVQA 3V4ZA 2YWVA 1EKVA 1KT8A 3W1GA 3N6RA 4PZ6A 1PX2A 2COGA 1EUDB 2EIYA 4I50F 2GQRA 4EFBA 5BWTA 4C5AA 5DAAA
chains in the Genus database with same CATH topology
2HIVA 3GJXB 3JSNA 3GB8B 2CFMA 1S68A 3VNNA 4EFEA 3BABA 2OWOA 3NBYB 1X9NA 2VUGA 3QWUA 1CKOA 3GDEA 3TY5A 3NBZB 3W5OA 3L2PA 4GLXA 4UCTA 3BA8A 1B04A 4UCRA 1FVIA 1P16A 3BAAA 3TY9A 3RTXA 4CC5A 1CKNB 1XDNA 3RR5A 3W1BA 5D1PA 5D1OB 4DRFA 1XK5A 4UCUA 4UCSA 4LH7A 1VS0A 2Q2TA 3S24A 2HVQA 4PZ8A 4PZ7A 4LH6A 4UCVA 3BA9A 1DGSA 4UFZA 4EQ5A 2Q2UA 3TY8A 3JSLA 1CKNA 3W1GA 2HIXA 3NC0B 5FPOA 4PZ6A 1TA8A 3PN1A 5D1OA 4E6NA 1P8LA 2HVSA 3KYHC 5DISC 1CKMA 4CC6A 4EEQA 4EFBA 5FPRA 4UCOA 3UQ8A 1A0IA 1V9PA 1TAEA 2HVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIV A;  3GJX B;  3JSN A;  3GB8 B;  2CFM A;  1S68 A;  3VNN A;  4EFE A;  3BAB A;  2OWO A;  3NBY B;  1X9N A;  2VUG A;  3QWU A;  1CKO A;  3GDE A;  3TY5 A;  3NBZ B;  3W5O A;  3L2P A;  4GLX A;  4UCT A;  3BA8 A;  1B04 A;  4UCR A;  1FVI A;  1P16 A;  3BAA A;  3TY9 A;  3RTX A;  4CC5 A;  1CKN B;  1XDN A;  3RR5 A;  3W1B A;  5D1P A;  5D1O B;  4DRF A;  1XK5 A;  4UCU A;  4UCS A;  4LH7 A;  1VS0 A;  2Q2T A;  3S24 A;  2HVQ A;  4PZ8 A;  4PZ7 A;  4LH6 A;  4UCV A;  3BA9 A;  1DGS A;  4UFZ A;  4EQ5 A;  2Q2U A;  3TY8 A;  3JSL A;  1CKN A;  3W1G A;  2HIX A;  3NC0 B;  5FPO A;  4PZ6 A;  1TA8 A;  3PN1 A;  5D1O A;  4E6N A;  1P8L A;  2HVS A;  3KYH C;  5DIS C;  1CKM A;  4CC6 A;  4EEQ A;  4EFB A;  5FPR A;  4UCO A;  3UQ8 A;  1A0I A;  1V9P A;  1TAE A;  2HVR A; 
#chains in the Genus database with same CATH topology
 1EKF A;  3K5H A;  4NZO A;  4O7T A;  2PN1 A;  1X9N A;  2HGS A;  3CSW A;  3GLK A;  4ZQI A;  3NBZ B;  1GGO A;  4O7N A;  2VR1 A;  3R5H A;  5I60 A;  2IP4 A;  3RTX A;  3T9F A;  5D1O B;  2WYO A;  3LP8 A;  1KJJ A;  4GLW A;  5E25 A;  1EZ1 A;  4HR7 A;  3NC0 B;  4MA0 A;  3ETH A;  5D1O A;  4MV1 A;  2QB5 A;  3KYH C;  5JQW A;  1EYZ A;  4CC6 A;  4O7L A;  3RV3 A;  1V9P A;  1A3G A;  2W6P A;  3LQS A;  4DLK A;  2X0S A;  4ZOL F;  1VBH A;  3NBY B;  2R7M A;  1ULZ A;  2HGW A;  2R7N A;  5I5W A;  1M0W A;  2FPG B;  5BWU A;  2VPQ A;  4CKE A;  1FVI A;  5I5S A;  4O4H F;  4NZN A;  4RZQ A;  3HBL A;  3RR5 A;  2NU9 B;  1GLV A;  2R7L A;  1ET0 A;  1GSA A;  5DMX A;  5BMV F;  5DGH A;  2J9G A;  1I2L A;  4HNT A;  2CNU A;  2YRX A;  2HHF B;  2FB9 A;  4EGQ A;  4TV8 F;  4WBN F;  2HVS A;  2CNV A;  1A0I A;  1EHI A;  4CKC A;  2ZDH A;  3WNZ A;  5IYZ F;  4MV6 A;  2CFM A;  1CE8 A;  3VNN A;  2ABJ A;  5BWV A;  2PBZ A;  3QWU A;  3GDE A;  3RV4 A;  1I1K A;  3TY9 A;  5CAE B;  3WO1 A;  5BWW A;  5LYJ F;  3NUA A;  1WR2 A;  1KJI A;  2Y4R A;  5BYA A;  5BWX A;  5D8D A;  4HNU A;  3BA9 A;  4UFZ A;  5BYB A;  4FFN A;  3UFX B;  1AUX A;  4O82 A;  3T99 A;  3WWJ A;  2YS7 A;  4IHJ F;  5JVD F;  5KS8 A;  2VUG A;  4FFM A;  3E5N A;  1IYE A;  3W5O A;  3U0G A;  4HQ6 A;  3JZ6 A;  2XD4 A;  1G2W A;  3BAA A;  4IZO A;  1KTA A;  1ZAU A;  1XDN A;  2PVP A;  1DV2 A;  4YJ3 F;  4TVI A;  4UCU A;  4UCS A;  4YJ2 F;  3LUL A;  3OUU A;  5LOV F;  2Q2U A;  3VMM A;  1JDE A;  5J2T F;  3U54 A;  4E6N A;  5CE8 A;  1E4E A;  2HHF A;  3TIG A;  3W1B A;  2HVR A;  4CMD A;  4XYM B;  3RUP A;  2NUA B;  2NU8 B;  1IOV A;  3UZO A;  1CKO A;  3MWD A;  4GLX A;  3WWH A;  5DGI A;  2YZN A;  1KEE A;  1JDB B;  2Z04 A;  5I5T A;  4XZ3 B;  5HBR B;  2SCU B;  1CKN B;  4FFO A;  1KC7 A;  4FFL A;  3U55 A;  3ETJ A;  4Q4D A;  5I5V A;  1VS0 A;  4MA5 A;  4O7Z A;  1A48 A;  1C30 A;  3OUZ A;  2DAA A;  3PN1 A;  4O7V A;  3DAA A;  4CHI A;  3JSN A;  4EGJ A;  1OBG A;  5J2U F;  3K5I A;  4NYE A;  2DZD A;  2FPI B;  1CS0 A;  2W6N A;  4HN2 A;  3HB9 A;  5HNE A;  3VOT A;  5BPH A;  4O7R A;  2W70 A;  2W71 A;  3QQM A;  1DIK A;  3TII A;  3BG5 A;  4LH7 A;  1GSO A;  2YZL A;  4PZ8 A;  1GSH A;  3I12 A;  3JRX A;  4C5B A;  3SE7 A;  5DIS C;  1KJQ A;  2W6Z A;  4C5C A;  1E4E B;  2DWC A;  4YAK B;  3VPB A;  1S68 A;  1PK8 A;  2W6Q A;  2OWO A;  3ORR A;  4O4J F;  4UCT A;  4DQN A;  2GPW A;  2QF7 A;  1B6S A;  2A1H A;  4MV3 A;  4L1K A;  4FGR A;  1W96 A;  4TM5 A;  2ZGI A;  2I80 A;  2OLS A;  4FFP A;  4MAM A;  2X5R A;  3V4S A;  5C1P A;  2GLT A;  4O4L F;  4IIJ F;  2R82 A;  2HGX A;  4HNV A;  3BAC A;  2HJW A;  4O7Y A;  2HG8 A;  1B6R A;  4UCR A;  3UZB A;  2XCL A;  2ODT X;  3UYY A;  5KKN B;  4CKB A;  2V5A A;  1IYD A;  3K3P A;  1I7N A;  2V59 A;  5FPO A;  4YB8 B;  2NU7 B;  1A0G A;  3SNO A;  5LA6 F;  2EJ0 A;  4O84 A;  3WWI A;  1EKP A;  5LXT F;  5JH7 F;  3DTF A;  5HV6 A;  3BA8 A;  1VKZ A;  2YRW A;  2R87 A;  5I5X A;  1XK5 A;  3T9C A;  2FPP B;  4FU0 A;  2COI A;  4IWX A;  4O7W A;  3TW7 A;  1Z2O X;  2FP4 B;  5H80 A;  3JZF A;  4UCO A;  5C1O A;  4FFR A;  2HIV A;  4M0J A;  1A9X A;  1W93 A;  4O4I F;  2GPS A;  4CE5 A;  4O83 A;  1BNC A;  1EUC B;  1M6V A;  3T54 A;  4MV8 A;  4IWY A;  1JLL B;  3R5F A;  5LP6 F;  3S24 A;  5FNV F;  1SCU B;  3T7A A;  1DGS A;  2C00 A;  1C3O A;  3HO8 A;  4ME6 A;  4E4T A;  1TA8 A;  3R9R A;  4RCN A;  4EEQ A;  2V58 A;  3U9S A;  2EJ2 A;  1DV1 A;  3N8D A;  3DTG A;  1AUV A;  5CM0 A;  5CB4 F;  1KUT A;  2COJ A;  2Q7D A;  2R7K A;  3CEB A;  3AW8 A;  5D1P A;  3GID A;  1I2K A;  2YZG A;  3MWE A;  1Z2N X;  3G8D A;  4EQ5 A;  2GQS A;  2YS6 A;  2YZM A;  4DIM A;  1I1L A;  2QK4 A;  3R5X A;  4NZM A;  3VPD A;  3AX6 A;  4I4T F;  4DAA A;  3MJF A;  4K6N A;  1I7L A;  1KBL A;  4QSH A;  3TIN A;  3TY5 A;  1UC8 A;  5BPF A;  1B04 A;  2R84 A;  4PBC A;  5KX5 F;  3HT5 A;  4Y8V B;  2DAB A;  2R85 A;  2VQD A;  4ZHQ F;  2W6M A;  2HDK A;  3JSL A;  1VBG A;  1OBD A;  2ZDQ A;  3LWB A;  4JXU A;  5I5Y A;  5FPR A;  3KAK A;  5EZY F;  4O2A F;  2DIK A;  2Z02 A;  4YBZ B;  4EFE A;  5CA1 F;  3T9B A;  1WRV A;  2P0A A;  3Q2O A;  3KAJ A;  3JRW A;  2W6O A;  3VA7 A;  1P16 A;  5K3W A;  4YAJ B;  4XYL B;  2YL2 A;  4UCV A;  4M9U A;  4FE2 A;  4MV7 A;  1P8L A;  3G8C A;  2I8C A;  4O7S A;  3VPC A;  4MV4 A;  1JKJ B;  3R23 A;  3GB8 B;  1Z2P X;  4I55 F;  5I5U A;  3Q1K A;  3RFC A;  3L2P A;  2DLN A;  4CC5 A;  4EG0 A;  2R86 A;  1UC9 A;  4PZ7 A;  4TV9 F;  4LH6 A;  3PFF A;  4MV9 A;  5BWR A;  3TY8 A;  1CKN A;  2HIX A;  3KAL A;  4O86 A;  1BXR A;  4O81 A;  2YW2 A;  4O2B F;  2CNQ A;  1DAA A;  1I1M A;  5I47 A;  3UQ8 A;  3U9T A;  3JZI A;  4XX0 B;  2NU6 B;  3ORQ A;  5K2M A;  4ZI7 F;  1T36 A;  1M0T A;  3TW6 A;  1CQI B;  3WO0 A;  2EJ3 A;  4DRF A;  5CR5 A;  5CA0 F;  3DF7 A;  5C8Y F;  4CMF A;  3TEK A;  5FR9 A;  2YYA A;  5GON F;  1KJ9 A;  3QFF A;  3KRE A;  3T9D A;  1KJ8 A;  5JQG F;  2ZDG A;  4UUG A;  1CKM A;  3T9E A;  1TAE A;  3GJX B;  3BAB A;  5JVL A;  1CQJ B;  4TUY F;  4WHX A;  3T9A A;  3SGI A;  3TQT A;  4Q4C A;  1IOW A;  2CZG A;  2I87 A;  2Q2T A;  2HVQ A;  3V4Z A;  2YWV A;  1EKV A;  1KT8 A;  3W1G A;  3N6R A;  4PZ6 A;  1PX2 A;  2COG A;  1EUD B;  2EIY A;  4I50 F;  2GQR A;  4EFB A;  5BWT A;  4C5A A;  5DAA A; 
#chains in the Genus database with same CATH homology
 2HIV A;  3GJX B;  3JSN A;  3GB8 B;  2CFM A;  1S68 A;  3VNN A;  4EFE A;  3BAB A;  2OWO A;  3NBY B;  1X9N A;  2VUG A;  3QWU A;  1CKO A;  3GDE A;  3TY5 A;  3NBZ B;  3W5O A;  3L2P A;  4GLX A;  4UCT A;  3BA8 A;  1B04 A;  4UCR A;  1FVI A;  1P16 A;  3BAA A;  3TY9 A;  3RTX A;  4CC5 A;  1CKN B;  1XDN A;  3RR5 A;  3W1B A;  5D1P A;  5D1O B;  4DRF A;  1XK5 A;  4UCU A;  4UCS A;  4LH7 A;  1VS0 A;  2Q2T A;  3S24 A;  2HVQ A;  4PZ8 A;  4PZ7 A;  4LH6 A;  4UCV A;  3BA9 A;  1DGS A;  4UFZ A;  4EQ5 A;  2Q2U A;  3TY8 A;  3JSL A;  1CKN A;  3W1G A;  2HIX A;  3NC0 B;  5FPO A;  4PZ6 A;  1TA8 A;  3PN1 A;  5D1O A;  4E6N A;  1P8L A;  2HVS A;  3KYH C;  5DIS C;  1CKM A;  4CC6 A;  4EEQ A;  4EFB A;  5FPR A;  4UCO A;  3UQ8 A;  1A0I A;  1V9P A;  1TAE A;  2HVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...