3NBYB

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
361
structure length
272
Chain Sequence
GSLNELALKLAGLDISQDLNSTAAPHPRLSQYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGHSPDHPGCLMEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding protein/transport protein
total genus 57
structure length 272
sequence length 361
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3nbyB00
1V9PA 2HIXA 3BA9A 3QWUA 5DISC 3NBZB 4UCTA 3JSLA 3VNNA 4PZ7A 1S68A 3W5OA 3L2PA 3W1BA 3NBYB 4E6NA 3NC0B 1TA8A 3JSNA 3GDEA 1TAEA 5D1OB 4PZ8A 3S24A 1CKNA 1VS0A 2VUGA 4PZ6A 3BABA 2HVSA 3W1GA 3PN1A 1P8LA 5D1OA 3RR5A 2HVQA 3BAAA 4GLXA 1A0IA 1P16A 4DRFA 1CKMA 4UCUA 1CKOA 4UCVA 4EFEA 2OWOA 4EFBA 5FPRA 2HIVA 3RTXA 2HVRA 3TY8A 1XDNA 4LH6A 5FPOA 1DGSA 4UCOA 4UCRA 3GB8B 4LH7A 4EQ5A 3BA8A 1B04A 4CC5A 1X9NA 4UCSA 4UFZA 3TY9A 1XK5A 2CFMA 3TY5A 1FVIA 2Q2UA 3UQ8A 4CC6A 2Q2TA 1CKNB 5D1PA 3KYHC 3GJXB 4EEQA
chains in the Genus database with same CATH superfamily
1V9PA 5DGIA 4ZHQF 2DIKA 5I5TA 3JRWA 2FPIB 5K3WA 3SNOA 2W6PA 3R5FA 1E4EA 4PZ7A 3AW8A 3WNZA 4E4TA 2XCLA 1KJJA 4E6NA 4O7RA 2R7KA 5CR5A 4TUYF 3RFCA 2YS6A 3UZOA 1CQIB 1TA8A 3T9AA 1DV2A 2GQSA 1I1KA 4C5BA 4MV4A 5LXTF 3S24A 3T54A 3JZ6A 1VBHA 3NUAA 4NYEA 3VOTA 2DABA 2PN1A 4YJ3F 1VS0A 2GPSA 1KUTA 4PZ6A 2YZGA 4O2AF 4I4TF 3HO8A 4CKBA 4NZNA 3R9RA 1ULZA 4M0JA 4CMDA 4GLXA 3E5NA 3DTGA 4GLWA 2W6QA 4UCUA 3I12A 1CKOA 1IOWA 2DWCA 2W6OA 4M9UA 4EFBA 2HIVA 4CE5A 3TY8A 1E4EB 2CNQA 5JQGF 5CB4F 4EG0A 3QFFA 4UCOA 3LULA 3GB8B 4LH7A 5BWUA 3TIGA 1B04A 4L1KA 2CNVA 4O83A 3RV4A 3N8DA 5LP6F 2PBZA 1I2LA 1FVIA 4FFOA 4FFLA 1I1MA 1SCUB 2I8CA 2I87A 4QSHA 4FFNA 2YW2A 5KS8A 2Q2TA 4YJ2F 4IHJF 4MAMA 5D1PA 2YL2A 4O81A 1A9XA 3RUPA 4DAAA 4O7TA 2NU8B 3ORRA 1A3GA 2ZDHA 4WBNF 4EEQA 2HIXA 4IZOA 3QWUA 4CKEA 5C1PA 5CE8A 4O4LF 5LA6F 5BPFA 3NBZB 4NZMA 3K3PA 5C8YF 3WWHA 2COGA 2R7MA 2ABJA 1EUDB 1A48A 2HGXA 3K5HA 3LQSA 3L2PA 4YBZB 5H80A 4O2BF 2Z02A 2QF7A 1WRVA 4O7SA 3T9EA 2V59A 1B6RA 3CEBA 3BG5A 4O4IF 2NU6B 2W6NA 2W6ZA 3ETHA 4O4HF 4RZQA 4O7ZA 4TM5A 1W96A 2YYAA 2PVPA 2ZGIA 4C5CA 1Z2OX 1EKVA 1CKNA 3U9SA 2R87A 2HGSA 4FFPA 2R82A 3MWDA 5FNVF 4RCNA 2GPWA 2WYOA 3GIDA 3WWJA 2W71A 3BABA 3GLKA 4DIMA 4CMFA 4UUGA 1A0GA 1ZAUA 5D1OA 2QK4A 2HVQA 1A0IA 3V4ZA 4DRFA 4HQ6A 3T7AA 2QB5A 4ME6A 5KX5F 4CKCA 3WWIA 3VPBA 4CHIA 5BWVA 4NZOA 5FPRA 3U55A 2HVRA 1AUXA 5BPHA 1JLLB 4MV3A 2R86A 1DIKA 2YWVA 3DAAA 2ZDGA 2EJ0A 5JQWA 2FPPB 4ZI7F 2HJWA 4O82A 2V5AA 5JVDF 1X9NA 5J2UF 1JDBB 4EGJA 1XK5A 3LWBA 3TY5A 1C30A 4EGQA 1Z2PX 2YZLA 2EJ2A 4O7NA 3TW7A 2DZDA 2J9GA 1CKNB 1OBDA 1I1LA 2NU7B 2YRXA 4K6NA 5HV6A 3VPDA 4DLKA 4YAKB 3JRXA 2HHFA 4HN2A 3KYHC 1KT8A 4XYLB 4O7YA 1AUVA 5BWRA 4XZ3B 3RV3A 2R85A 1PX2A 3VNNA 3DF7A 3R5HA 1S68A 2DLNA 1VKZA 2VR1A 5EZYF 3W5OA 3TQTA 3MWEA 3NBYB 3W1BA 5I5YA 3ETJA 2R7NA 2R84A 2XD4A 1DV1A 2V58A 3DTFA 3TINA 5D8DA 3R5XA 3BACA 1IYEA 1VBGA 5IYZF 4MV7A 1DAAA 4IIJF 3UZBA 2Z04A 4WHXA 1TAEA 4PZ8A 5CA1F 4YAJB 1BNCA 4FE2A 3OUZA 1GSAA 5K2MA 2FPGB 2CZGA 1EZ1A 5E25A 3V4SA 4HNUA 2A1HA 4ZQIA 2HVSA 1EHIA 3OUUA 1P8LA 1C3OA 2W6MA 5I5WA 4HR7A 2FP4B 4MV1A 5I60A 3RR5A 3JZFA 3KAKA 1CQJB 4IWYA 5C1OA 2EIYA 1CKMA 2HHFB 4XX0B 3VMMA 5CA0F 2OLSA 2OWOA 4ZOLF 5I5SA 1W93A 5LYJF 5J2TF 1KEEA 2YZMA 3Q2OA 2HGWA 4DQNA 1XDNA 5JH7F 5I5XA 4LH6A 5BWWA 2YZNA 1UC9A 4Q4CA 1EKPA 5BWTA 1DGSA 3TW6A 4UCRA 4EQ5A 3BA8A 4UCSA 5I5UA 4FGRA 1KBLA 4I55F 3TY9A 3N6RA 3KAJA 1I7NA 4MV8A 2X0SA 1Z2NX 2CFMA 2SCUB 2GLTA 1GGOA 5CAEB 1GLVA 2HG8A 4Y8VB 1IYDA 3U54A 2ZDQA 4FU0A 3ORQA 2VQDA 1PK8A 2Y4RA 5HNEA 1GSHA 5I47A 4PBCA 3SGIA 2X5RA 1IOVA 3GJXB 1KC7A 5GONF 3UYYA 2VPQA 3G8DA 3R23A 3PFFA 3BA9A 4FFMA 5DISC 2YRWA 3LP8A 4FFRA 1JKJB 5LOVF 4TVIA 4YB8B 4IWXA 4UCTA 3JSLA 4O7WA 3SE7A 1KJ8A 2DAAA 2GQRA 3T9BA 1KJIA 2I80A 4TV8F 3U0GA 2Q7DA 4XYMB 4JXUA 4O7LA 3VA7A 1GSOA 4MA5A 3T9FA 1B6SA 3VPCA 1EYZA 4Q4DA 3KALA 3JSNA 3CSWA 3GDEA 3WO1A 5BYAA 2YS7A 2FB9A 5D1OB 4O86A 3T9CA 2CNUA 3WO0A 3G8CA 5DGHA 3AX6A 3Q1KA 2VUGA 3JZIA 4MA0A 4I50F 3T99A 4O4JF 3W1GA 1OBGA 1WR2A 3PN1A 1I7LA 3TEKA 3BAAA 1P16A 1KJ9A 3MJFA 4C5AA 2R7LA 3QQMA 2ODTX 2EJ3A 3T9DA 4UCVA 3U9TA 4EFEA 1EKFA 1M0TA 1BXRA 2W70A 1UC8A 5BWXA 5I5VA 3RTXA 2COIA 2HDKA 1EUCB 1CS0A 1T36A 5FR9A 1M0WA 5DAAA 3HBLA 1JDEA 1CE8A 5FPOA 3KREA 5DMXA 4O7VA 2NUAB 1I2KA 5BMVF 5CM0A 4CC5A 5BYBA 4TV9F 3UFXB 4UFZA 4HNTA 2COJA 3HT5A 4MV6A 2Q2UA 3K5IA 1G2WA 4MV9A 3UQ8A 5KKNB 2P0AA 1KTAA 4HNVA 3HB9A 1M6VA 4CC6A 1KJQA 3TIIA 2C00A 2IP4A 1ET0A 2NU9B 5JVLA 4O84A 5HBRB 3NC0B
chains in the Genus database with same CATH topology
1V9PA 2HIXA 3BA9A 3QWUA 5DISC 3NBZB 4UCTA 3JSLA 3VNNA 4PZ7A 1S68A 3W5OA 3L2PA 3W1BA 3NBYB 4E6NA 3NC0B 1TA8A 3JSNA 3GDEA 1TAEA 5D1OB 4PZ8A 3S24A 1CKNA 1VS0A 2VUGA 4PZ6A 3BABA 2HVSA 3W1GA 3PN1A 1P8LA 5D1OA 3RR5A 2HVQA 3BAAA 4GLXA 1A0IA 1P16A 4DRFA 1CKMA 4UCUA 1CKOA 4UCVA 4EFEA 2OWOA 4EFBA 5FPRA 2HIVA 3RTXA 2HVRA 3TY8A 1XDNA 4LH6A 5FPOA 1DGSA 4UCOA 4UCRA 3GB8B 4LH7A 4EQ5A 3BA8A 1B04A 4CC5A 1X9NA 4UCSA 4UFZA 3TY9A 1XK5A 2CFMA 3TY5A 1FVIA 2Q2UA 3UQ8A 4CC6A 2Q2TA 1CKNB 5D1PA 3KYHC 3GJXB 4EEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9P A;  2HIX A;  3BA9 A;  3QWU A;  5DIS C;  3NBZ B;  4UCT A;  3JSL A;  3VNN A;  4PZ7 A;  1S68 A;  3W5O A;  3L2P A;  3W1B A;  3NBY B;  4E6N A;  3NC0 B;  1TA8 A;  3JSN A;  3GDE A;  1TAE A;  5D1O B;  4PZ8 A;  3S24 A;  1CKN A;  1VS0 A;  2VUG A;  4PZ6 A;  3BAB A;  2HVS A;  3W1G A;  3PN1 A;  1P8L A;  5D1O A;  3RR5 A;  2HVQ A;  3BAA A;  4GLX A;  1A0I A;  1P16 A;  4DRF A;  1CKM A;  4UCU A;  1CKO A;  4UCV A;  4EFE A;  2OWO A;  4EFB A;  5FPR A;  2HIV A;  3RTX A;  2HVR A;  3TY8 A;  1XDN A;  4LH6 A;  5FPO A;  1DGS A;  4UCO A;  4UCR A;  3GB8 B;  4LH7 A;  4EQ5 A;  3BA8 A;  1B04 A;  4CC5 A;  1X9N A;  4UCS A;  4UFZ A;  3TY9 A;  1XK5 A;  2CFM A;  3TY5 A;  1FVI A;  2Q2U A;  3UQ8 A;  4CC6 A;  2Q2T A;  1CKN B;  5D1P A;  3KYH C;  3GJX B;  4EEQ A; 
#chains in the Genus database with same CATH topology
 1V9P A;  5DGI A;  4ZHQ F;  2DIK A;  5I5T A;  3JRW A;  2FPI B;  5K3W A;  3SNO A;  2W6P A;  3R5F A;  1E4E A;  4PZ7 A;  3AW8 A;  3WNZ A;  4E4T A;  2XCL A;  1KJJ A;  4E6N A;  4O7R A;  2R7K A;  5CR5 A;  4TUY F;  3RFC A;  2YS6 A;  3UZO A;  1CQI B;  1TA8 A;  3T9A A;  1DV2 A;  2GQS A;  1I1K A;  4C5B A;  4MV4 A;  5LXT F;  3S24 A;  3T54 A;  3JZ6 A;  1VBH A;  3NUA A;  4NYE A;  3VOT A;  2DAB A;  2PN1 A;  4YJ3 F;  1VS0 A;  2GPS A;  1KUT A;  4PZ6 A;  2YZG A;  4O2A F;  4I4T F;  3HO8 A;  4CKB A;  4NZN A;  3R9R A;  1ULZ A;  4M0J A;  4CMD A;  4GLX A;  3E5N A;  3DTG A;  4GLW A;  2W6Q A;  4UCU A;  3I12 A;  1CKO A;  1IOW A;  2DWC A;  2W6O A;  4M9U A;  4EFB A;  2HIV A;  4CE5 A;  3TY8 A;  1E4E B;  2CNQ A;  5JQG F;  5CB4 F;  4EG0 A;  3QFF A;  4UCO A;  3LUL A;  3GB8 B;  4LH7 A;  5BWU A;  3TIG A;  1B04 A;  4L1K A;  2CNV A;  4O83 A;  3RV4 A;  3N8D A;  5LP6 F;  2PBZ A;  1I2L A;  1FVI A;  4FFO A;  4FFL A;  1I1M A;  1SCU B;  2I8C A;  2I87 A;  4QSH A;  4FFN A;  2YW2 A;  5KS8 A;  2Q2T A;  4YJ2 F;  4IHJ F;  4MAM A;  5D1P A;  2YL2 A;  4O81 A;  1A9X A;  3RUP A;  4DAA A;  4O7T A;  2NU8 B;  3ORR A;  1A3G A;  2ZDH A;  4WBN F;  4EEQ A;  2HIX A;  4IZO A;  3QWU A;  4CKE A;  5C1P A;  5CE8 A;  4O4L F;  5LA6 F;  5BPF A;  3NBZ B;  4NZM A;  3K3P A;  5C8Y F;  3WWH A;  2COG A;  2R7M A;  2ABJ A;  1EUD B;  1A48 A;  2HGX A;  3K5H A;  3LQS A;  3L2P A;  4YBZ B;  5H80 A;  4O2B F;  2Z02 A;  2QF7 A;  1WRV A;  4O7S A;  3T9E A;  2V59 A;  1B6R A;  3CEB A;  3BG5 A;  4O4I F;  2NU6 B;  2W6N A;  2W6Z A;  3ETH A;  4O4H F;  4RZQ A;  4O7Z A;  4TM5 A;  1W96 A;  2YYA A;  2PVP A;  2ZGI A;  4C5C A;  1Z2O X;  1EKV A;  1CKN A;  3U9S A;  2R87 A;  2HGS A;  4FFP A;  2R82 A;  3MWD A;  5FNV F;  4RCN A;  2GPW A;  2WYO A;  3GID A;  3WWJ A;  2W71 A;  3BAB A;  3GLK A;  4DIM A;  4CMF A;  4UUG A;  1A0G A;  1ZAU A;  5D1O A;  2QK4 A;  2HVQ A;  1A0I A;  3V4Z A;  4DRF A;  4HQ6 A;  3T7A A;  2QB5 A;  4ME6 A;  5KX5 F;  4CKC A;  3WWI A;  3VPB A;  4CHI A;  5BWV A;  4NZO A;  5FPR A;  3U55 A;  2HVR A;  1AUX A;  5BPH A;  1JLL B;  4MV3 A;  2R86 A;  1DIK A;  2YWV A;  3DAA A;  2ZDG A;  2EJ0 A;  5JQW A;  2FPP B;  4ZI7 F;  2HJW A;  4O82 A;  2V5A A;  5JVD F;  1X9N A;  5J2U F;  1JDB B;  4EGJ A;  1XK5 A;  3LWB A;  3TY5 A;  1C30 A;  4EGQ A;  1Z2P X;  2YZL A;  2EJ2 A;  4O7N A;  3TW7 A;  2DZD A;  2J9G A;  1CKN B;  1OBD A;  1I1L A;  2NU7 B;  2YRX A;  4K6N A;  5HV6 A;  3VPD A;  4DLK A;  4YAK B;  3JRX A;  2HHF A;  4HN2 A;  3KYH C;  1KT8 A;  4XYL B;  4O7Y A;  1AUV A;  5BWR A;  4XZ3 B;  3RV3 A;  2R85 A;  1PX2 A;  3VNN A;  3DF7 A;  3R5H A;  1S68 A;  2DLN A;  1VKZ A;  2VR1 A;  5EZY F;  3W5O A;  3TQT A;  3MWE A;  3NBY B;  3W1B A;  5I5Y A;  3ETJ A;  2R7N A;  2R84 A;  2XD4 A;  1DV1 A;  2V58 A;  3DTF A;  3TIN A;  5D8D A;  3R5X A;  3BAC A;  1IYE A;  1VBG A;  5IYZ F;  4MV7 A;  1DAA A;  4IIJ F;  3UZB A;  2Z04 A;  4WHX A;  1TAE A;  4PZ8 A;  5CA1 F;  4YAJ B;  1BNC A;  4FE2 A;  3OUZ A;  1GSA A;  5K2M A;  2FPG B;  2CZG A;  1EZ1 A;  5E25 A;  3V4S A;  4HNU A;  2A1H A;  4ZQI A;  2HVS A;  1EHI A;  3OUU A;  1P8L A;  1C3O A;  2W6M A;  5I5W A;  4HR7 A;  2FP4 B;  4MV1 A;  5I60 A;  3RR5 A;  3JZF A;  3KAK A;  1CQJ B;  4IWY A;  5C1O A;  2EIY A;  1CKM A;  2HHF B;  4XX0 B;  3VMM A;  5CA0 F;  2OLS A;  2OWO A;  4ZOL F;  5I5S A;  1W93 A;  5LYJ F;  5J2T F;  1KEE A;  2YZM A;  3Q2O A;  2HGW A;  4DQN A;  1XDN A;  5JH7 F;  5I5X A;  4LH6 A;  5BWW A;  2YZN A;  1UC9 A;  4Q4C A;  1EKP A;  5BWT A;  1DGS A;  3TW6 A;  4UCR A;  4EQ5 A;  3BA8 A;  4UCS A;  5I5U A;  4FGR A;  1KBL A;  4I55 F;  3TY9 A;  3N6R A;  3KAJ A;  1I7N A;  4MV8 A;  2X0S A;  1Z2N X;  2CFM A;  2SCU B;  2GLT A;  1GGO A;  5CAE B;  1GLV A;  2HG8 A;  4Y8V B;  1IYD A;  3U54 A;  2ZDQ A;  4FU0 A;  3ORQ A;  2VQD A;  1PK8 A;  2Y4R A;  5HNE A;  1GSH A;  5I47 A;  4PBC A;  3SGI A;  2X5R A;  1IOV A;  3GJX B;  1KC7 A;  5GON F;  3UYY A;  2VPQ A;  3G8D A;  3R23 A;  3PFF A;  3BA9 A;  4FFM A;  5DIS C;  2YRW A;  3LP8 A;  4FFR A;  1JKJ B;  5LOV F;  4TVI A;  4YB8 B;  4IWX A;  4UCT A;  3JSL A;  4O7W A;  3SE7 A;  1KJ8 A;  2DAA A;  2GQR A;  3T9B A;  1KJI A;  2I80 A;  4TV8 F;  3U0G A;  2Q7D A;  4XYM B;  4JXU A;  4O7L A;  3VA7 A;  1GSO A;  4MA5 A;  3T9F A;  1B6S A;  3VPC A;  1EYZ A;  4Q4D A;  3KAL A;  3JSN A;  3CSW A;  3GDE A;  3WO1 A;  5BYA A;  2YS7 A;  2FB9 A;  5D1O B;  4O86 A;  3T9C A;  2CNU A;  3WO0 A;  3G8C A;  5DGH A;  3AX6 A;  3Q1K A;  2VUG A;  3JZI A;  4MA0 A;  4I50 F;  3T99 A;  4O4J F;  3W1G A;  1OBG A;  1WR2 A;  3PN1 A;  1I7L A;  3TEK A;  3BAA A;  1P16 A;  1KJ9 A;  3MJF A;  4C5A A;  2R7L A;  3QQM A;  2ODT X;  2EJ3 A;  3T9D A;  4UCV A;  3U9T A;  4EFE A;  1EKF A;  1M0T A;  1BXR A;  2W70 A;  1UC8 A;  5BWX A;  5I5V A;  3RTX A;  2COI A;  2HDK A;  1EUC B;  1CS0 A;  1T36 A;  5FR9 A;  1M0W A;  5DAA A;  3HBL A;  1JDE A;  1CE8 A;  5FPO A;  3KRE A;  5DMX A;  4O7V A;  2NUA B;  1I2K A;  5BMV F;  5CM0 A;  4CC5 A;  5BYB A;  4TV9 F;  3UFX B;  4UFZ A;  4HNT A;  2COJ A;  3HT5 A;  4MV6 A;  2Q2U A;  3K5I A;  1G2W A;  4MV9 A;  3UQ8 A;  5KKN B;  2P0A A;  1KTA A;  4HNV A;  3HB9 A;  1M6V A;  4CC6 A;  1KJQ A;  3TII A;  2C00 A;  2IP4 A;  1ET0 A;  2NU9 B;  5JVL A;  4O84 A;  5HBR B;  3NC0 B; 
#chains in the Genus database with same CATH homology
 1V9P A;  2HIX A;  3BA9 A;  3QWU A;  5DIS C;  3NBZ B;  4UCT A;  3JSL A;  3VNN A;  4PZ7 A;  1S68 A;  3W5O A;  3L2P A;  3W1B A;  3NBY B;  4E6N A;  3NC0 B;  1TA8 A;  3JSN A;  3GDE A;  1TAE A;  5D1O B;  4PZ8 A;  3S24 A;  1CKN A;  1VS0 A;  2VUG A;  4PZ6 A;  3BAB A;  2HVS A;  3W1G A;  3PN1 A;  1P8L A;  5D1O A;  3RR5 A;  2HVQ A;  3BAA A;  4GLX A;  1A0I A;  1P16 A;  4DRF A;  1CKM A;  4UCU A;  1CKO A;  4UCV A;  4EFE A;  2OWO A;  4EFB A;  5FPR A;  2HIV A;  3RTX A;  2HVR A;  3TY8 A;  1XDN A;  4LH6 A;  5FPO A;  1DGS A;  4UCO A;  4UCR A;  3GB8 B;  4LH7 A;  4EQ5 A;  3BA8 A;  1B04 A;  4CC5 A;  1X9N A;  4UCS A;  4UFZ A;  3TY9 A;  1XK5 A;  2CFM A;  3TY5 A;  1FVI A;  2Q2U A;  3UQ8 A;  4CC6 A;  2Q2T A;  1CKN B;  5D1P A;  3KYH C;  3GJX B;  4EEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...