2HVSA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 2'-deoxyribonucleotide at the nick
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/dna/rna
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 91
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvsA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvsA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvsA01
2CFMA 3L2PA 2Q2UA 1DGSA 3W5OA 3KYHC 2HIVA 5FPRA 4LH6A 4UCRA 4PZ6A 1TAEA 1CKNB 5D1OA 3NBYB 3QWUA 4EQ5A 1A0IA 1XDNA 4E6NA 3TY5A 5DISC 4PZ7A 3VNNA 3GDEA 1CKOA 3GJXB 4UCOA 4UCSA 4PZ8A 2HIXA 3BAAA 5FPOA 2VUGA 3RR5A 3JSNA 2HVQA 1TA8A 1B04A 1VS0A 4EEQA 1P16A 1P8LA 1CKNA 3JSLA 3BA9A 4EFEA 4UCVA 4CC5A 3NC0B 3GB8B 2Q2TA 1XK5A 4UFZA 2HVSA 4GLXA 4UCUA 3UQ8A 1CKMA 5D1PA 4EFBA 1V9PA 4LH7A 3PN1A 1S68A 3W1GA 5D1OB 3W1BA 3RTXA 4DRFA 3BABA 3TY9A 3NBZB 2OWOA 3S24A 3BA8A 2HVRA 1FVIA 3TY8A 4UCTA 4CC6A 1X9NA
chains in the Genus database with same CATH superfamily
2JQ7A 4IRIA 3QQMA 1Y1VJ 4B3XA 4BGDA 2BVLA 2FMYA 2M0CA 3SFIA 2PJPA 2CYYA 2EINH 4HG2A 2IA6A 3P9CA 4U0VA 2HGSA 4L9VA 5F6FA 3QQAA 5FPRA 4UUSA 5L1LA 5D5XB 1IZ1A 3BR6A 3ZQGA 4TQRA 4U7BA 4UUGA 5CVJA 5CVUA 2W9BA 3MKLA 1A5JA 2JUGA 1WKMA 4LG0A 4BU2A 2KRCA 2KRFA 3Q3SA 2RN7A 1ZRFA 2LG4A 5GPAA 1T8IA 1YW7A 2A68F 2LF8A 5DDGA 4Y3OA 5E8GA 1SMYF 3I59A 4Y52J 3VPBA 5AONA 2XAJA 3IH4A 1WJAA 2DFIA 5DCFA 3RPUA 1X4OA 1VQ6I 3PFFA 3CDLA 3Q2OA 2ZB9A 2HKXA 4XSXF 5HLHA 3H92A 5FLVA 1BJZA 1X3WB 4O84A 1XGOA 3KHLA 4Y4RA 3QPTA 3AFHA 1IRXA 4UCOA 3DPLC 2KSWA 3FKIG 2NVXA 3KPHA 1R49A 2E1CA 4BEHB 4D7NA 4NYEA 1J9IA 3BCAA 3E6BA 3JR9A 4C3IJ 4OIPF 2CNVA 3QAHA 4FX0A 3IL2A 5E1XA 4A5NA 2VR1A 2IA0A 2H1KA 4YRVA 4EJVA 2YRXA 2KT0A 4ME6A 3CTAA 3OUZA 2VKEA 3KZYA 2H94A 4IXAA 5C1OA 1MMSA 3I4MJ 4LITA 5H6QA 3PNYA 5DCMB 3H36A 1TWHJ 4HNTA 3FKIA 5C5JA 2JEFA 3BA9A 3S3OA 4O7YA 4X62H 5EZYF 2CFXA 2HXIA 4KIFA 2PI0A 1F9NA 2CMPA 2LP0A 3GBGA 3NC0B 4N4OB 4ZQIA 5J1RA 4O4HF 1XK5A 5JFRA 4UFZA 2HVSA 4DAAA 3RIZA 3MEXA 2X48A 1HSTA 1Y8QB 3LQSA 1QU3A 3JZFA 2QYZA 2EFWA 2WV1A 4UUVA 2ZDGA 1JHFA 5LXTF 3ZMDA 4WBNF 3MZ8A 4BDZA 3K5HA 3HOVG 2NAZA 3UQ8A 2CO5A 2LY1A 3O6BB 2VC0A 4GCVA 1IF1A 3BQZA 2JEJA 2P6SA 4RGRA 3HPHA 3FF5A 4WXCA 4LH7A 5FJ8G 2EILH 4RB0A 2FBKA 1IRZA 3IAS2 2Z5UA 4AIDA 2GBYA 2YS6A 4XLPF 4BJTA 1ZTRA 2L3DA 3CVZA 1LNWA 3R0JA 1KONA 4UB6C 4NXMH 3R5FA 5BNGA 5IYCJ 2MA3A 1EKFA 2GPWA 2R85A 1EKVA 2KHMA 3HSRA 3Q5FA 2L2OA 4XKWA 4Y17A 2G7UA 4B8XA 1HF0A 4UNOA 2ZC2A 3CO6C 4M9SA 2VKHA 2LY9A 1ZN2A 4FASD 2B7EA 3PW5A 2CKZB 2H27A 3V4GA 3Q8SB 4OU0A 2UVRA 1XMKA 2FOKA 2BY0A 1U0JA 2NS7A 2V6EA 1B72A 3GFJA 1ZAOA 3WE3A 4I50F 1OCOH 3DKXA 2Z33A 2JA7J 2RF4A 2KIFA 5EEAA 2VN2A 3QYEA 4JI8H 2R7WA 5KFUA 1VI0A 4RAGA 2A5WA 1X1AA 4GYGA 1LVAA 4IJAA 2V9WA 2HIVA 1X1DA 3F23A 2DOEA 4I2OA 3DPTA 1UG0A 4AVZA 1VQ4I 5E17F 4PZ6A 2LKPA 1H8AC 4E4TA 1WH7A 5KFJA 1ZK8A 3OS0A 2WAFA 2Y31A 5CE8A 4PJNA 2M7AA 4EQ5A 2E2IA 3Q8RB 3G8CA 5E3NA 5K1YA 4FU0A 1I1LA 3A4CA 4KICA 1B9NA 1U9OA 2VA3A 4AU7A 4Q45A 2PFBA 3GLKA 2V1DA 4TQSA 1E4EB 1EJ9A 1M1EB 2HYFA 2L4AA 2KDOA 2CZGA 3LSGA 2QYOA 1NK3P 4YP3A 2GPSA 2EJRA 2XC7A 2HIXA 1UHWA 1P4WA 5FB2A 3WHBA 3WNZA 4BACA 3IHUA 2FA5A 2PQ8A 2VC1A 1UB9A 2NOGA 5BS6A 2JA5G 2V9PA 5GONF 3AW8A 4WWCA 6PAXA 1B6SA 4MAMA 3CP2A 1GVDA 5BPIA 3GTLA 2EZHA 1DGWY 2R7TA 1SC7A 2DYSH 1BW5A 2IRFG 3C3WA 5LEKA 1WRVA 2UVWA 4X6AJ 4CYCB 3K4KA 4FFPA 3D5LA 4IEJA 5FLMG 1PYVA 1W7PD 1JE8A 3GTMJ 3WWHA 4FFRA 4XORA 4ENNA 4QWDA 1KU2A 3C1DA 5C3EJ 4Q4ZF 4CE5A 3C2HA 1OYYA 2GA1A 2HGCA 5LRRA 1WPKA 1A04A 2DMQA 4BBRJ 2R93G 5FD6A 2RGVA 3SDBA 2FB9A 5ILUA 2Z04A 5I5UA 2YPRA 3GUDA 2RDPA 2L7KA 3CF2A 4LLGF 3I58A 2LC2A 1WRJA 3OR1C 5EWEA 3V7SA 4XL9A 4S0HB 1L0OC 4N9HA 4BNCA 4DV5H 4HQ6A 3IRRA 5CA0F 1NHAA 2K7LA 2UVVA 2Q2EA 3GO5A 3PM1A 3HTUA 2X6OA 3F8MA 4FTHA 1JIHA 1RIOH 2HOAA 2HOSA 4ECXA 2EV5A 2VJ5A 1VBHA 5J1YA 1KU3A 2HQ5A 3RIRA 2ZMEA 3WHCA 3A0BC 5E79C 4GDFA 1VQLI 3F8FA 2B0LA 5LD2C 3NWSA 4DGWB 2YS9A 2LY2A 3IH2A 1VQ9I 4QIWE 3OIPA 4C3JJ 2FP4B 2K9SA 4P96A 3M8JA 1W36C 4BXFA 3A01B 4DL3A 3WTVC 1LVKA 1OLTA 1Z2NX 2L02A 1WSUA 1O4XA 4DV6H 2OZ6A 3PFIA 5HDKA 2Y9ZA 3G71I 1I6XA 2EZIA 3R61A 1S3JA 4KUMA 2IS6A 3WGGA 2LR8A 1JLLB 4HAMA 1CS0A 3FMAA 4BEHA 2ZGIA 3ASNH 5BYAA 3NUAA 5IP7G 1YJWI 4ZZDA 3A2KA 1Y0NA 3UFXB 4A3LG 2OF7A 2ZXHA 4CKBA 2DOFA 4KFCA 1OYIA 2Q1ZB 3RQ4A 3SYTA 4EM1A 2GXBA 3S1RJ 3IAM2 1U5TC 4EGYA 3GIDA 4KDPA 2JA6J 1YO5C 3QYBA 1Z7UA 2NU6B 1V5EA 5LGUA 2ID6A 2ZJRF 1TT0A 3LP8A 2F4MB 3AG4H 2JMWA 3K4JA 1BI3A 1AKHB 1JHHA 4RM3A 1NTCA 2XB0X 5B1BH 3WTSC 4CKCA 5BWWA 2COBA 4UB8C 5F1RA 1J5EH 1QPIA 1TTYA 2YRWA 4L1KA 2DN0A 3LSHA 1WJ5A 3QPLA 5L3BA 3KHHA 4KN4X 2AXLA 1HKQA 4O4JF 1QVTA 4BQQA 1B8IB 4X64H 2G9WA 2IGMA 4M3FA 1L2ZA 4O7TA 1DP3A 3ZQCA 2HXOA 2HEOA 4LJZF 1GXPA 2P5VA 3E0JB 2WE6A 2R5ZB 4EGJA 2H6BA 5DEQA 1T94A 5L3GA 3K3PA 5BQTA 1K7AA 1FYKA 3HOTA 2BHZA 3VSLA 3MR5A 4ZYDA 1BI1A 3QPHA 3T9AA 5M5WJ 5FLXW 2COIA 4YHHH 3SDGA 1K6OA 1FIPA 1SANA 2NVXJ 1B04A 1IOVA 2QCOA 2C2DA 5LMNH 5FLXK 4YB8B 1JX4A 5EJCA 4O81A 2QSHX 2W6ZA 2CQKA 3ULQB 5ILVA 3BTIA 4WF2A 4MV4A 2IGOA 2IT0A 2AQEA 5L3DA 3TQTA 1GYFA 4NNJA 3ASOH 2CQ7A 3HOUG 4QWCA 3FKIJ 1ODDA 2EZKA 5F9LA 1W7PB 3FZVA 1J59A 2ZBKA 1ZGWA 2QBYA 2FQ3A 4KJZA 4LK1F 1EUCB 4EV0A 2WAQE 1HNXH 3KE2A 3VMMA 4OOIA 4DOZA 5KT2A 4Q8FA 1XDSA 3OYBA 2R7ZG 4MO7A 1JI8A 3OTOH 1Q1HA 4IO9F 3M7GA 3TO9A 1BR1A 4BUPA 4Q47A 2TDXA 2MBFA 2ZNYA 2Y9YA 2HDDA 5ICCA 1YOVB 1LPQA 1YJNI 3VYUB 3LSRA 3WGHA 4JI3H 3RCOA 5DGHA 3U0GA 3DCFA 2BBYA 4RUAA 4A0ZA 4EJOA 2HU9A 2GIZA 1GLVA 4EVIA 3DKWA 4J9QA 3H3ZA 4DR7H 1SEIA 1V3FA 4A3FJ 5DGIA 1SAUA 2VJIA 5LMUH 3HKZN 5CLSA 3IRQA 5KFRA 3IH3A 2QM3A 1E4EA 2DMUA 1CF7A 2RVCA 4CMDA 2MGQA 2CUJA 1IN4A 1K4SA 3QP5A 4QLCU 1T6SA 3KEYA 1BW6A 3HSFA 1XSDA 3BWGA 4V19K 1XMOH 5C8YF 2Y69H 1R23A 2LREA 2RKHA 1D8JA 1YX5A 2FUG2 3TW6A 3I12A 3U9TA 1Y1VG 2XCPA 1T3NA 4A12A 3PR5B 3DP7A 2XCLA 2CFMA 5J3LA 1N32H 3MKZA 2ZFWA 3GFMA 4NDLA 3L2PA 4XLEA 3I56I 5KG6A 3GYHX 4L9TA 1SD5A 3MWDA 2FMLA 1K78B 2CG4A 2KPMA 3HPGA 3H3VK 4FETA 3DEEA 1YW9A 4DYQA 5GTIC 3LSMA 1YTYA 5DMXA 3DKYA 2XGXA 5JUMA 5ICFA 2K86A 3MQ0A 4CZCA 5C44G 4PJJA 4G3IA 3PFYA 5ILSA 2M7BA 2P7CB 4DR6H 1I1MA 1Y39A 3CUQB 4XX0B 1V54H 4DYCA 4XYMB 1F36A 3H4DA 2AXTC 3GMEA 2OH2A 4F4ZA 1QQIA 3KXYT 4XLNF 4FE2A 1XMQH 5IWAH 4XONA 4DBRA 5DQIA 1ET0A 3GTPA 2X5RA 4A3MJ 3MD2A 5KFTA 4CMFA 3T99A 4AD9A 4PGHA 4BE1A 4A3CJ 3HZJA 3SE7A 4I0AA 4UCSA 3ZOBA 2E2IJ 3LULA 3R5HA 1XCVA 2ELHA 3EETA 2HZDA 4A6EA 1HXDA 2IGKA 2PG4A 3E5UA 3GCMA 3PSIA 3QODA 2LK2A 3G1LA 4CCMA 5GAEJ 1QZEA 2A6TA 4K0KH 3S8PA 2W9AA 4I4TF 2NVUB 3I4MG 1OCPA 4BQNA 3EUHC 1YQAA 1VQKI 1IGNA 5H80A 3MR2A 2E2JJ 1RYRA 1P8LA 3E5NA 3BZCA 4EG0A 1KJJA 2FOWA 3HKZA 1RK5A 3EDPA 3N05A 1TT5B 3QU6A 1IBMH 1V51A 2X9DA 4XR6A 5KX5F 3GTLJ 3E3VA 2IPQX 3K1NA 1ZQ3P 3OYAA 2EWNA 3GZ6A 2V6CA 2GLTA 2YUSA 2GQSA 4BY1J 3L7WA 3K3VA 2FMAA 1D5VA 3NARA 4KT5C 4RGUA 5CR5A 1AHDP 1CKMA 2IP4A 2H6CA 2EJ3A 3KAJA 4MA5A 3H35A 1RJPA 2PJRB 5H2FC 1BI2A 1FY7A 4QWAA 2G7HA 4UUSB 2UWMA 2NNNA 3J80Z 3DPUA 3SNOA 4MA0A 4A3IJ 1S7EA 1ZELA 2ISZA 3GQCA 2W9BB 5J40A 5IYCG 2EV6A 5FLMJ 2DMPA 5KVRA 4LG0B 3BABA 4P9UA 4DR3H 3I59B 2G0EA 2STWA 5HODA 3DV8A 3CCRI 3V42A 3RTRA 5JI6A 1JUMA 4JX6A 1T2KA 3OYHA 2HVRA 4XLFA 1WCMA 3F22A 1USTA 4MQVA 3OL4A 2RNGA 2YX4A 2JA7G 3K4CA 2M2EA 1MZBA 1VQOI 3H9JA 5KFWA 3EQLF 4HQMA 1QA6A 5IP9J 4U6PA 3BQ1A 1KJIA 1WH2A 2R7DA 3F0CA 4I55F 4DR1H 2BR0A 1KJ9A 4QJFA 5JR3A 4E7SA 1DIKA 2DTZA 3RDIA 3T1HH 4V2GA 1TP4A 1YLFA 4XN0A 4WCGA 3L2CA 1IXSB 1LUJB 1VZ0A 3AYHB 1AA7A 2BHYA 1ON2A 4MIMA 5CKTA 5CVRA 4O3MA 4ECVA 2F2EA 2GXGA 3F8NA 2YS7A 1V55H 4OAYA 3BG9A 2YZLA 4YJ3F 4ECQA 4JI7H 4NB5A 2P6TA 2EIYA 2PBZA 1KBLA 2I87A 2ISYA 2ESHA 1MJBA 3A02A 2WTEA 3NRVA 2IBDA 3U1KA 3K70D 4UY8I 2DYRH 1UHSA 1G6NA 4ECUA 2EFQA 3BZKA 3SZPA 2YZMA 3OSFA 2LLKA 3OOUA 3K4MA 1RETA 4N4NB 2L7MP 2M4GA 1LFUP 2CGPA 1HC8A 1I7NA 5HOOA 1CQTA 1W7PA 2L01A 4GXOA 2VPQA 1KQ9A 3M1EA 3G3ZA 5F0CA 3ZR8X 1E2XA 3KEQA 3OS1A 4S04A 2W7NA 1LDKB 1IOWA 3CCYA 5B66C 1WI3A 5KNLA 1RUOA 4FE7A 3QZ8A 3PZPA 1WJEA 3ZQQA 2ZFUA 2DFHA 4CGZA 2FK1A 4BKXA 4JV0A 1FJGH 4O7WA 2VQCA 4I01A 4WXDA 2R7QA 2XHKA 2HVQA 3PVXA 3LSJA 1AWCA 3TKYA 2RREA 2JVGA 1ACIA 3RFCA 1SFKA 4MFDA 5C3EG 2V1UA 1B6RA 4XSZF 5I60A 2R8GA 3VOTA 4M6VA 2R7RA 1DPUA 4DV2H 2CQNA 4B43A 4IX7A 3JSLA 2V4QA 3V6KA 4BBRG 4LF7H 3HL2A 5F08A 1STZA 3OYFA 3K2AA 1I7LA 3G6EI 4A3JJ 3L2VA 3FKJA 2FKLA 2FEZA 2WYOA 3JAMZ 4U7DA 3CZ6A 1IXRC 4ZYEA 1B72B 1D1AA 2W7OA 1OFCX 5M5YJ 1QZZA 1OQYA 1MD0A 3DEWA 4C30A 4PCQA 1ZRDA 1AUXA 2W9CA 3B6CA 2W71A 1TLHB 4O86A 5JVDF 1SFEA 2Z9OA 4FBUA 2JWTA 3DWLE 2Y0SE 1LKXA 2R3SA 1ZYRF 3FMRA 4CA0A 4DZJA 2H1LA 1HDPA 3HC7A 5FFZA 4IWXA 1S68A 3H5NA 4B4CA 1IC8A 5KG3A 4LF5H 1HOMA 2GQRA 4E7ZA 2FE3A 3CP8A 4BAYA 4HF2A 3IG0A 5DYMA 1MBHA 1XPXA 3L2UA 4A3EJ 1TWFA 1ZETA 2JT1A 4FX4A 4MEXF 3JRXA 3GF2A 4AWXB 1VNDA 1RNLA 4ENJA 1LB2A 1FYLA 3MCZA 4A6DA 1Z77A 3REOA 4U88A 5DG9A 4IZZA 2OC6A 1B1BA 1V5GA 4IR1A 4HV6A 4AIHA 4G7HF 3C18A 3ONQA 1N75A 1SD7A 1GV5A 2DA3A 5EGOA 2JSPA 3KP2A 2A6EF 1FTTA 5KT3A 4BHBA 1UC8A 4G7ZF 3K7AJ 2XGDA 2PMHA 4E4HA 4B09A 1T38A 1IUYA 3U1DA 4TVIA 2M3AA 1MBKA 1ETVA 2O6GE 5D8KB 2KJBA 4O7RA 4YG2F 1ZR4A 5TRDA 2V1XA 3WWIA 1IUFA 2JA6G 4J9RA 5BPFA 3W6VA 2Q2UA 4UV8A 2OD5A 2ZXJA 1E3OC 4J0MA 2A5YB 4M9XA 3W5OA 1WJBA 3KZIC 1S9FA 1MGTA 1IN5A 2UXBH 4G6DA 4ZDOA 2HFHA 4O3RA 3B02A 3K10A 3ZCOA 3VWBA 4RBOA 4BDYA 3N4MA 3U9GA 1WWXA 4NUBA 3PO2J 1H0MA 2EZLA 3BT9A 5E1WA 4EJWA 1Z21A 3Q8PB 4A5MA 1UG2A 4G6QA 3BY6A 1Z1DA 1T98A 2NU8B 2CNQA 1FZPB 1XCBA 3S1MJ 1REPC 1A36A 4KMUX 2B9SA 5F04A 4HPQA 3DTFA 2HHHH 5JVLA 3JRAA 3ZQIA 2XF5A 4XOPA 3OYDA 2BEOA 3HIFA 2F5CA 4EYHB 2Q2EB 3PW2A 1S29A 1MH4A 5LGNA 2PJRA 5TGTA 2C00A 2K85A 2CNUA 3BAAA 1VQNI 2YL2A 4JI6H 4AYBE 1Z7LA 2R87A 5CVVA 3GTPJ 2L9RA 3COAC 1AOYA 2I8DA 2WDTA 4DUZH 2ZMEB 1Y1WA 2DA5A 1HSJA 2DMTA 1C0WA 1QGPA 4UHTA 2DA6A 3GWZA 5C44J 1EH6A 1K6YA 2FSWA 3LA2A 4GO1A 4LOCA 3IUOA 1VKZA 3QU3A 4CHIA 2QQ8A 3N6XA 4I0BA 3OWTA 2XROA 2W6NA 4CDGA 3MVPA 1ZG1A 2DFFA 2Q2TA 1WSCA 3AX6A 2C6YA 3SXYA 3HM5A 3HSEA 3OS2A 4Q4DA 2TRTA 1Z91A 1SEUA 1T36A 3GVAA 4WX9A 3I4NJ 2ASDA 2O9LA 4IHVA 3Q8QB 2ZCWA 5KT4A 1FBSA 2DQRA 3RB0A 4X0GA 5KHDA 1FPQA 3FHZA 3J7AY 5KFNA 2J6TA 2JA8J 4IRHA 5KFOA 3R60A 2W25A 2LYCA 4OIQF 5KFVA 5C4XJ 2R84A 2WADA 3PN1A 2R6FA 4MTEA 3ECHA 2J5OA 4O82A 3PJRA 2KLOA 3IKVA 1R1TA 1PDNC 2YWVA 2FPIB 5FFXA 2VPRA 5EDNA 1G3WA 2DPJA 4DRFA 4UUTA 4XKBA 1DV2A 4EM0B 4A3FG 3ETJA 5KFXA 3BTLA 3KHGA 3L4JA 5L3FA 3CUQC 3N6RA 2MH9A 2VXDA 1O3SA 4QW9A 1DU6A 3WTTC 3BDDA 4PJMA 4UVCA 1RUNA 2IS2A 3HEFA 2NU9B 2LH9A 1T33A 5FO5A 4BH9A 4A3BJ 2EFOA 3OMYA 4LSAA 2XAFA 5IPAA 5D5VB 4IL6C 5KFBA 3I5UA 3TBIA 1C3OA 2COGA 3TIGA 3GXOA 4A69C 1ENHA 3KTMA 3NGDA 4ZZLA 1V5FA 3OSPA 1GUUA 2QWWA 4HX8A 1D5YA 3M9NB 3RAXA 4J9KA 4QTRA 1X9NA 4BXXG 2EIKH 3V4SA 2OJED 1OMIA 1DDNA 4HNUA 1MBGA 4BBSJ 1I6UA 1WCMJ 4CSWA 1HW1A 5KFFA 2HHFA 4R8UA 2GZWA 2JPBA 1D1CA 3CCMI 1PJRA 1I1GA 3M8FA 1R9TA 3GTJA 2A07F 4Q48A 3KP6A 2X6WA 2VE9A 3HOYJ 4R79A 2Y30A 2OCEA 3RPQA 5KS8A 2XAUA 3KCCA 4LMYA 3RQIA 5H6RA 3CC4I 2P0WA 4JXUA 1K1SA 2F4VH 2SCUB 2LF7A 1JT6A 4JK1X 4IRCA 1FOYA 2VODA 4DUYH 2F5FA 4EMSA 4A3MG 2XKOA 1ETOA 1BC8C 1LFBA 2QENA 4S05A 1EA3A 4PK4A 4A3CG 2XRLA 1HKTA 4ECZA 4C5CA 3V6HA 5J2UF 3TDUC 3GTQA 2QBYB 2UU9H 5I5WA 4DV7H 2MYSA 1R22A 1ETQA 1NG6A 4UV9A 1BGWA 3ELKA 4RNNA 4JV5H 3C0FB 3AAFA 1B33N 2L9NA 4D7MA 4CUGA 1ERDA 1MMGA 2IP2A 1KQ8A 2EH3A 2OQGA 2VPLA 4LF6H 1IXCA 4JQFA 3BPVA 3CMMA 5F64A 3SQNA 1PP7U 1K83A 2DW4A 2XB5A 1IAWA 1U9NA 4TV9F 2XPVA 4XRFA 2MABA 3LQQA 2ZSHB 2K9NA 3VPRA 2PN1A 1K61A 4WHXA 1TW2A 3HRMA 1U5TA 2Q7DA 2OA4A 1BNCA 4C3HJ 2FLPA 3PW4A 4DZPA 1JKQC 2ASLA 2V79A 5K7ZA 1CF7B 1A6QA 3GB8B 2DLNA 1I2LA 2BW3A 5KFGA 2XKPA 4BY1G 3TGNA 3MKYB 3LOCA 3ABLH 2NS0A 2NVYA 2KKOA 4EEFG 3QWLA 2M8GX 3TOAA 2KDZA 4DL4A 1A3GA 4EBCA 3JSPA 3AL0B 2ZJTA 4KHPH 1ZG3A 2C2RA 4HN2A 1Y6IA 2CQXA 2W6OA 2RDJA 1O3TA 5D1PA 2R4GA 4FT8A 1KTAA 2XGQA 3I55I 2ZJPF 4QWQA 2CRGA 2E1NA 3JSOA 4L18B 4RNOA 3HG9A 1KA8A 1F4KA 4A3IG 3JAMW 4QPQA 1I94H 2ZNZA 3O8GA 2CUZA 2C22A 2Q8KA 4ECRA 3W1BA 3GTGA 1YRNA 3R6SA 4M7EA 1Z3YA 3JAMK 2DJIA 1BIAA 5B1AH 2VONA 2R7XA 2KMUA 2L7FP 3BG6A 3IKTA 2ZSIB 3RUPA 3H40A 4CCLA 4XLCA 1HDDC 2E1MB 4RAYA 1JJ6C 5JVGF 2K3FA 1JXSA 3A1YA 3C7JA 3KP3A 1YX3A 2F5VA 1B4AA 2HPIA 3LSPA 1A9XA 5IP9G 1Z05A 3CJRB 3TEDA 1TWFJ 2E7XA 3KP7A 4PFPA 1EYZA 3M4IA 4EBDA 3OYMA 4DL7A 1FVIA 4A0YA 4XIDA 5KFSA 4E7IA 2CUFA 4EM2A 4OAZA 2W8LA 2OBPA 1UC9A 3ISPA 2VXZA 3WWJA 3RAQA 2JVHA 1FJLA 5IT9Z 5BWVA 1GSHA 4XK4A 2CQQA 1JXLA 1YIJI 3WGIA 2ZJQF 3A0HC 3KLOA 1ZKGA 3DTIA 4HV5A 4B48A 3LNQA 2HDCA 5BMZA 3RKWA 1JGGA 2XAGA 5LHIA 1EHIA 5KG2A 4EBEA 2AQFA 4C5AA 4NZOA 4GFBA 4NHJA 5E25A 4M6XA 1BC7C 2HDKA 5KT6A 2P0AA 4LFUA 3VSKA 2PX9A 4ANJA 2D45A 3T9EA 4ED1A 3P7NA 1XNQH 1Z0XA 4F3QA 4ASNA 3NWTA 3OYNA 1PUFA 4I7HA 1I3QA 5BR8H 1E3HA 2A05A 3B73A 4A3GJ 2C28A 2O61A 3HXLA 4YQWA 3HB9A 3VNNA 4MHGA 5LBQA 3J81W 2M4KA 1BI0A 5KFEA 1IO2A 4LLNA 2O3FA 2WB1N 2R86A 2YSRA 4RAFA 2OLSA 4KN7X 1WJDA 1JKRC 4L0YB 3S17J 3NQOA 2WY7Q 2AO9A 2AGQA 3KP5A 3K1PA 4ECSA 1FNNA 3J81K 2KIQA 2GIVA 4OIRF 2J6UA 2VUGA 2JPCA 4Q8EA 1RPWA 1FMWA 1SMTA 1W5CC 1E17A 3H20A 1Z9CA 1EKPA 3CMEI 1A35A 1R7JA 1X2NA 3VODA 2PLYA 1T08B 1HQCA 3F21A 2UXDH 4ZI7F 2ZKZA 4WK8F 4ED2A 4M74A 5CYVA 5I5YA 3U55A 1JTXA 2Z02A 3GIIA 3EPGA 2R8HA 3PO3G 2W00A 5KKNB 4CC5A 2WV0A 4A3JG 1P92A 2DAOA 2V7FA 4E7JA 4M72A 1ITYA 1GGOA 5EF6A 2LNBA 4Q5SF 3W2VA 3PW7A 1VQ5I 2BOLA 3PNTA 1Y1WJ 1JKPC 2VB6A 1KGSA 4A3KJ 3BQ2A 2C35B 3BG3A 2GWRA 3U2RA 4G12A 5KT5A 3E1SA 2VT2A 5D5WB 2VQGA 3CLOA 2P7VB 1ETWA 3BTJA 3M4OJ 1FC3A 4GKKH 2DJNA 1FIAA 3WTYC 2X6YA 3K1MA 5I5XA 4PDBA 3DLAA 2W7PA 3JW4A 3G6VA 3G8DA 5CQEA 2H09A 2FXAA 1FLIA 1WFXA 1N78A 2HKOA 3HHHA 5FR9A 2UXCH 2DT5A 3T5HA 4NQWA 2HPMA 2Z2SB 4CO8A 1H9TA 3N8DA 3U54A 4A3EG 2J9GA 1R4NB 4JV1A 4A93G 3RTXA 3L00A 4HQEA 1JUPA 3M8EA 4G6TB 4JP0A 3TL4X 3N41B 1P4AA 2O8KA 4LB5A 5DLGA 3AG1H 4R1HA 4RGXA 1N77A 4NC6A 3CCUI 2XPWA 1P6RA 3ZRGA 3WG7H 4KT6A 2VPSA 1OCZH 2A61A 2CS3A 2CWEA 3G4SI 2NVTJ 2UV1A 4XBFA 5BWUA 4GC7A 1WJCA 3L4KA 3PQJA 3FX3A 1HW2A 2WB1A 2W6PA 1PUEE 2ZO4A 3BG7A 4YIFA 2VQLA 3JRWA 1SAXA 1T0FA 2EJ2A 5L3CA 4EATA 1TNTA 5EZHA 5DM6F 3N40P 4CCOA 4E7KA 3TIIA 2V9VA 4A2BA 4FFLA 4IVNA 3I9V2 3CF5F 4PJ0C 2VI6A 2PMZN 4FFMA 3GFIA 1YJ9I 2ZMEC 2QA4I 4Q0YA 4DYRA 2Y2ZA 1RC9A 1X4PA 2EA4A 1XTAA 2VQHA 4E70A 2DAAA 3PO2G 4DR4H 5D1OA 5K5OA 5D6EA 5GPCA 5M3FJ 1MMAA 3R0AA 1O57A 3E97A 1R1VA 4MFEA 3CCLI 2AS5F 1M0TA 1I50A 2R7NA 4YR0A 3UKGA 3CDIA 3VA7A 4RB2C 4M9ZA 2FF4A 1DV1A 4NLGA 4RB3C 4AQYH 4JI1H 4IAJA 3KYCB 5I47A 2OZUA 1R9TJ 3GTJJ 1IV8A 5HS7A 5JVTA 4PZ7A 2W9CB 2BV6A 1MBEA 2R7FA 1HKSA 3BTCA 1G3YA 2FNAA 1GT0C 3MZHA 1CKOA 4BXXJ 2BY1A 4BHCA 4HX4A 3FXKA 3OYKA 3VPCA 4B3SH 5LLQA 1S8NA 3JRDA 3N97A 1E0EA 1ZQ7A 1P9QC 5E8IA 2X1CA 1UHMA 2DK5A 3FM5A 1QHHD 3ZPLA 1EZ1A 4YY3H 5KFIA 2P8TA 3GTQJ 1FSHA 3L2QA 2RNJA 4Q43A 4LF4H 3MJFA 2F4IA 2JUCA 4L9NA 4JX5A 5A2QZ 2YU9A 3H9QA 2VJJA 3L09A 2EV0A 2RAEA 4M9UA 3G6XA 1KEEA 1JTYA 3HKZE 2KISA 5BPDA 2C2EA 1S7AA 1ZH5A 4X66H 4AVPA 4NZMA 4HZFA 4ENMA 5EGOB 4D5FA 4TV8F 2E2HA 1K83J 5DGAA 3I4NG 4ETSA 5LFAA 2W48A 2HYJA 3LMLA 2QSFX 5LRSA 3JZIA 1M0WA 3F8CA 1HA8A 4Q4CA 2FNPA 4YJ2F 1E4FT 3I4PA 2JA8G 5CPRB 4J01A 1OR7A 2K27A 2O7OA 2Q0OA 3P9IA 5J6XA 2Y4RA 1K1QA 4W97A 5KG0A 1J75A 5C4XG 3K4NA 1MKMA 3V8LA 3T8TA 1R5HA 3GEZA 3HO8A 2ADUA 2COMA 2FBHA 2PMZA 1EKEA 4M71A 2NVYJ 3OY9A 2HGXA 5C1PA 3C2GA 2YU3A 2L54A 2L0KA 5KCMA 3R9RA 2WTFA 3RSNA 2A1HA 1M7JA 3JRIA 4APMA 1R00A 2DMNA 2QKLB 3GV8B 1VQPI 1W36D 2X51A 4BJ6C 2DFEA 2R8KA 1AU7A 3JZ6A 1H9GA 3ZMSA 2COJA 1ETXA 1KYWA 4XRSA 1IYEA 3NBZB 2LSOA 2QLZA 4CKEA 4CCNA 2CW0F 4EGZA 5I5VA 3S24A 5HLGA 2QKMB 2VT3A 2YR2A 3B6AA 3WODF 2K9LA 2JRTA 1ETKA 1A0GA 3D1NI 4J9NA 4A3BG 5EYRA 1KJ8A 4ED8A 3GTGJ 2ZDHA 4AIJA 2N8GA 1I2KA 5KK1A 1GVJA 4P55A 5B5EC 1OBDA 4DNCA 2DQLA 2XPUA 3TY8A 3DBLB 3DTGA 3E7LA 1YS7A 2W82A 5KG5A 4BBSG 5JH7F 1ZGAA 1S0MA 3W1GA 1WCMG 3F8BA 2E19A 4C9YA 4QW8A 1GHCA 3S2DJ 4A2UA 1YFHA 5DD4A 3E6CC 2WA0A 4X65H 2ELJA 3M1CA 2V1NA 4HBLA 3SEZA 3W6KB 2XF7A 1TNSA 2XAQA 3HOYG 1RKWA 2ME6A 3SZGA 4ESFA 3Q0VA 4ZDPA 2ZDQA 1Y56A 2HR3A 5JLWA 5F9NA 3CO7C 3EPIA 1BOAA 4XICA 3NBYB 2VOOA 3QWUA 3FMQA 5FKLA 1WR2A 1BN5A 1VQ8I 2GXAA 5FKMA 3V8JA 4IOAF 4DLKA 4IOCF 1A0IA 2ATLA 3BQYA 5BPHA 2UZKA 4HNVA 3K69A 3ZQFA 5LOVF 4QWEA 4G9YA 2QB5A 1R1UA 2HZTA 3RBDA 4XYLB 3FK6A 3AL0C 3BJAA 3RZDJ 3OYIA 1G3TA 3MKWB 2MG4A 5FKKA 2JK3A 4MV1A 5AIPA 4RNMA 3S2WA 4PZ8A 4IF4A 5HVQC 3ML6A 1D1BA 2KL4A 1HBXG 5LL6b 3GIKA 2BQRA 1I3QJ 2MD5A 4RGSA 4DIQA 3RR5A 2V4RA 5ED4A 4NZNA 4BQOA 1FKAH 2VKVA 1TA8A 1I39A 4EQQA 3GW2A 1YG2A 1KUTA 2QF7A 1WQ2A 4PGGA 2E1MC 1HW5A 5J8FA 1F5TA 2WAEA 3GTKA 1KT8A 3QYFA 1RR8C 5D8LB 2R8IA 1LEBA 2ODTX 4II3A 4XRMA 5DD8A 3QOPA 1A31A 1DQUA 1MSEC 3TO6A 3M9AA 1U8RA 2VOBA 4LGWA 4P5OA 4B3AA 2B63A 1TC3C 4FBTA 2X6XA 4DIMA 2VBZA 3LQRA 1S72I 3UR3C 4M0JA 3RKXA 2HHFB 2IAIA 4EFBA 1XSXA 1RKTA 2ID3A 3DXJF 3M07A 3V8KA 1WVRA 3VDXA 4R8UB 3SI8A 2FQ4A 2HQRA 2IEKA 3H3VH 2HTJA 4MTDA 1AUVA 3G1OA 1FOXA 4Y7NJ 2HDWA 3ZN0A 3TW7A 1TQIA 3BOQA 2JEGA 5GAHJ 1FSEA 1VQ7I 3FWEA 3O2PE 5J47A 2NVQJ 3Q9VA 3T5JA 3H3UA 1CGPA 2Y75A 2A69F 2JEIA 2Z99A 2Y0SN 3CUOA 3PO3J 1Y14B 3OSNA 4R7RA 1XSVA 2M9HA 4ZH4F 3LA7A 2AGOA 1U78A 1W5SA 2OWOA 4L9JA 4GKJH 2IXSA 2BXYA 3H0GA 2PN6A 1J2XA 3LMMA 3ZGKA 5GTHC 1ZREA 1E4GT 1EH8A 4B3MH 2EB7A 2KRHA 4IHXA 1RR7A 1FOWA 2E35A 1G2WA 2DDBA 5BYBA 3RV4A 1U6GA 2HG8A 4UCTA 4E7LA 3T54A 2FJZA 2IMWP 4ABZA 4BQAA 2OTJI 4BXUA 2V59A 2XCAA 3HOZG 1ZHFA 3ESWB 4IHJF 5J4VA 1Q1VA 5IY5H 4W1UA 4I09A 4ENKA 1RJQA 3KP4A 3KYHC 3MFIA 1UCRA 4A93J 3KX2A 4Q44A 4UCRA 3F6VA 2FLNA 2AHQA 3U21A 5JHFA 2KIMA 1U5TB 2X85A 3V7RA 1W0UA 1IW7F 2QVOA 1JKJB 2R7KA 4U87A 4ECWA 4HX7A 1NK2P 4XM3A 2D1VA 3V7CA 4I98B 4BWSC 2BW3B 3ZXSA 3HDDA 4A3GG 4L0ZB 3VYRB 5E18F 2HQAA 5K7FA 2DA7A 3WU1B 3S3MA 3FK7A 5EDWA 1R36A 3FXQA 2XGPA 5FROA 1I6HJ 3HRTA 3P9KA 2VASA 4Z2YA 2DT6A 4M3GA 5ICEA 4ZDLA 3HT5A 4H4KC 2XV4S 3HJEA 4MLOA 1R6RA 1QPMA 2MW8A 3FHNA 4KA4A 1I50J 3S15J 3I3LA 4ITVA 1BM9A 3ECOA 1S9HA 1GLNA 3BJOA 4O7ZA 1WI9A 2E5LH 3T5XA 3W2WA 3I53A 3J7ZI 3ROUA 3ERED 1Z67A 4RS8A 3OL3A 3GIPA 4OWRB 4R8HA 1TZLA 4B3TH 4FS1A 1JDEA 1N36H 2R7OA 4XQFA 5M5XJ 5BOXA 3RB4A 2R92G 3PNVA 3IV5A 4K6NA 1YRNB 1GDTA 2IA2A 4YELA 5HDGA 4EYIB 3GFLA 4YIIA 5KFQA 1SD4A 2JN6A 2Y0SA 3VFZA 3MWMA 3ORRA 2GOMA 4U0WA 2W85A 3ZQ7A 1HR0H 2UUBH 1ZHQA 4A3DJ 1P16A 2F6CA 5HLTA 1GO3E 1O3QA 4AYBN 2DU9A 4N9IA 1Y1WG 2EK5A 5E20A 2GOXB 1FBQA 2KJCA 4O7NA 3H4BA 4A3KG 2JSCA 1D8KA 1MMNA 3LSTA 3TP3A 3KETA 2VUMA 3T0YA 3LAPA 3H1CA 3MFHA 3LWFA 2M5WA 4IPAA 4C2MA 4JI2H 3KHRA 4UVBA 2XSDC 3ZMTA 2R92A 3A03A 4MV6A 5A2QW 2YU9J 4HA8A 4KIGA 1MMDA 4NC7A 2HGWA 1OISA 2RDIA 2E36A 4TV7A 5HS9A 3E6DA 3FXJA 4FFOA 3QOEA 3W6JB 4UXNA 4LB6B 4PSWA 3CJQB 5A2QK 2HOTA 2E2HJ 3UZBA 4FGRA 2GQQA 3IN5A 3OHAA 3WO0A 2LBFB 2ACJA 4RB1A 4EEYA 2VBYA 3CJTB 4HF1A 4DQ2A 3PR4A 1OKRA 5F27A 3GLXA 4IZOA 4RM2A 4ED3A 3DTKA 2X0LA 3DQVC 5L1JA 1Z3XA 4FS2A 4O7VA 4YR2A 2FU4A 4J9MA 2M30A 3Q0UA 1SFUA 2DPIA 2ME0A 3K4BA 4RA2A 4CZZA 4GLWA 2DI3A 2M45A 2FBIA 3SEQA 5J4YA 1G59A 1SFXA 2LDUA 4MNUA 2BY3A 1MW7A 1PUFB 2UUCH 2R5YA 1RK6A 1LJ9A 4ESJA 1R58A 3ZQHA 4L5JA 3JREA 1FT9A 5LA6F 4D1QA 1GSOA 2UXXA 3S3NA 3QZ7A 1S0OA 2KFDA 3OYJA 3DU5A 1OCTC 2D2WA 3KEOA 1MNMC 4TUYF 3E5XA 2NXNB 2XSJC 5FLXZ 1A48A 4DV4H 1FMVA 1X2MA 2VA2A 2BVMA 2AU0A 1RZ4A 3V4ZA 2O03A 1Z2PX 4DL2A 1B9MA 1HNZH 4BY7J 1W93A 4B44A 2L7ZA 2K40A 4EJTA 2JRMA 4IQJA 2NU7B 2V5AA 2CV1A 2R82A 4O3QA 3WE2A 2VQFH 4ZYAA 5E3OA 4UVAA 1B6AA 2VKDA 3J80W 4AYBA 3E6MA 5F1JA 2MC4A 2LKSA 3DEUA 4DV1H 2P4WA 1E3PA 3LA3A 5HV6A 1J09A 4PZJA 4JYAH 2DA4A 1MSFC 4F4WA 3T9BA 2OPTA 5HBRB 4U7CA 2VQEH 2HTSA 3J80K 2VQDA 3GV7B 1VF9A 4M3BA 2Z3YA 5KAIC 1LE8A 3FM3A 2KQRA 1S10A 1S7OA 4CCKA 2EIMH 2YZGA 3DF7A 2IW5A 2KIUA 4XOTA 4XKVA 4RAZA 2PMUA 2O0YA 4M73A 2IJLA 5KG4A 4YFNF 3GILA 3F9KA 1WJFA 5EWFA 2RV8A 4WD3A 4NQWB 3ABUA 1DP7P 1UFMA 1FP2A 1R4MB 3SJMA 2D1HA 3UZOA 3RGXA 5I5TA 4ED0A 2PEXA 4FFNA 4JYKA 3OYEA 4KMFA 5FRMA 1X1BA 3ORQA 1I3AA 3DBRB 4DL5A 3ZMZA 3HOWJ 4DR5H 3S1QJ 3BP8A 3RB3A 3N43B 2NS8A 3PIOF 4XZ3B 5F0HA 1CKNA 1JT0A 3TEKA 3DAAA 1YIOA 2VJ4A 4ZYGA 2TCTA 1KZHA 2F4OB 5IOYA 3AKZA 4RU9A 2WC2A 5D6FA 2ABJA 4F93B 1JKOC 2CH0A 5KFKA 4RCNA 1QVUA 2E60A 3KIOA 5KAFC 3T9CA 1H88C 5EEHA 2R7VA 3Q9SA 2L5QA 4IHTA 1OBGA 5E1ZB 1VAJA 1XD7A 4F4XA 2MLKA 1IRFA 1G3SA 4RLFA 3BQ0A 3DTEA 1SCUB 5EG0A 3VYTB 1OWTA 3GTKJ 5J2TF 2DDAA 4Y33A 3QFFA 4IWYA 4LF9H 2E1OA 2JZYA 3X2QH 3MZYA 1OJLA 3BC8A 1S03G 4IRKA 3RV3A 2DT7B 4ZTJA 5D1OB 2GLOA 3IP4B 2B63J 5KFZA 1X58A 4RMNA 3CC2I 5LYJF 4KITB 1HLVA 3MMYB 1C30A 3OUUA 3HHGA 2XC9A 1XGMA 4A2AA 3DF8A 1KJQA 1YW8A 1S6LA 2XGCA 4Z6YA 3ZQLA 1BXRA 3BA8A 5CAEB 1IBLH 3H5RA 5EOYA 1D0ZA 4XKCA 3NAUA 1X3UA 3HOXJ 2ZJ2A 1DPRA 1O7FA 3CQZA 5HNEA 5DQHA 4MEYF 2CJJA 5BWTA 1LDDA 3R23A 1RJRA 4DV0H 3CC7I 2JJ7A 5JHUA 1QNTA 1UMQA 2IGNA 3JRCA 4PDKA 3H0GJ 4GRIA 4LLLA 5BWXA 2PVPA 1FX7A 2V26A 4XN3A 2QGUA 2XUBA 4E6KG 1V4YA 4PWQA 3N42B 2R7MA 5IYDJ 1GXQA 4TM5A 2W4SA 4DJAA 3TDZC 3WU2C 4QWBA 2ELKA 4GC6A 4DR2H 3ABMH 1S97A 4LF8H 2GM4A 1XN7A 1W4MA 1ZHSA 1G4DA 1T39A 3WTXC 2STTA 4QIWN 3OOPA 4XLAA 2LKXA 3SHFA 1WZ2A 4E6NA 1IYDA 2VLAA 3FDYA 1UAAA 1YYVA 1HCRA 5GP9A 1DUXC 3AG3H 3UYYA 2M8EA 3SZTA 1MDMA 4BYYA 2XD4A 5I5SA 5KG7A 2RQQA 2IVMA 2JA5A 1QZYA 2DLLA 3MR3A 3HOZJ 3CD6I 3CEBA 2L4MA 2Z1DA 4FISA 2ASJA 5L1IA 2LBFA 5CA1F 2RC4A 2L9SA 1P2FA 5GADJ 2MC3A 2XF6A 3CESA 3ZN1A 2QEXI 5KFPA 3BJYA 1W96A 1O75A 2I10A 5D4SA 5F0FA 4HDUA 4I76A 1CQJB 2K4BA 1P7JA 3FBIB 4B1RA 3J7YJ 4U0YA 2R93A 4EEQA 1ULZA 4ECYA 3V6JA 2FLLA 4BE2A 1ZLKA 2JA2A 1D3YA 4I02A 2FJ1A 4HW0A 2XVCA 3CCEI 4M3EA 4O7SA 4ECTA 3ABTA 2BQUA 4KISA 2IS1A 1FEXA 4LK0F 5LGTA 2UUAH 4E7HA 2YX7A 2K9QA 1IN8A 5C4JJ 5IYBJ 3GV5B 4J9OA 1N48A 4CICA 1U2WA 3ZMUA 3RF2A 1MNDA 1RYSA 3BROA 2M0MA 2EFPA 4YFXF 3PUBA 3PSFA 1KU7A 1BL0A 4DL6A 2IA1A 2P5LC 5KFLA 3IWZA 3CLQA 2CV2A 2VUMJ 4C2MJ 4HSRA 3BPXA 4J19A 2K4JA 4MV3A 2R92J 1F43A 1X1PA 3LSKA 4BL0B 4KYWA 1TWCA 1R5ID 3W2AA 3Q1KA 1UZCA 2XGEA 4C2UA 2F5DA 2NYXA 3OHBA 3JCUC 1MBJA 4Y8VB 2E71A 3CCVI 4RZRA 2DABA 5FKOA 1XB4A 5TISC 3GIQA 4OX9H 3KYLA 1YE9A 1QO0D 3LWBA 1SFOA 2KP6A 2VL8A 3K2ZA 2DTRA 5DCMA 4QIWA 5J8CA 4F7ZA 1KYZA 4PSXA 1W0TA 1MBFA 1ZRCA 3BACA 5CJ9A 4JI0H 4IIJF 3ABKH 1VQMI 2WB1E 3BJ6A 2FX0A 3CCJI 3WO1A 4FE4A 4CXFA 1BIBA 1ON1A 1LFPA 3JRGA 1KQ0A 2V9KA 4PBCA 3OIQA 2R7UA 1A6IA 4C5BA 5HNFA 2ALZA 4MV7A 1O3RA 4F4YA 1S0NA 5AIQA 4HSTA 1B59A 1ULYA 3KREA 5FRNA 2BGCA 3HRUA 2H8RA 2HOEA 3S32A 1XGNA 4YBZB 5DTDA 1I27A 4CH7A 2LTPA 4QPOA 1W5TA 1BBYA 2E34A 1DGSA 2WAQN 2CW8A 2FD5A 1AN7A 1M6VA 3T7AA 2BE5F 3WTWC 2ZXIA 3W3CA 4AC0A 3RI4A 5DAAA 3K4LA 5EEGA 1TWAA 2QQAA 1CQIB 5CB4F 5D4RA 3OIOA 4HLYA 4N0BA 5DS9A 2EIJH 4YEJA 2GAUA 3EUHA 2R0QC 2X4HA 1XC5A 2X1DA 1U8BA 5DQGA 4P1WA 1NH3A 2LVSA 4PFOA 2CUEA 2LMDA 2R7SA 2KZGA 5K3WA 1SVOA 1CE8A 2EQRA 5FNVF 2M05A 1N34H 1TWGA 3CDHA 4RUCA 2E5ZA 2LRDA 3G73A 2MCTA 4M6YA 2DBBA 3DLLF 4OMYA 1KU9A 2YZNA 3K70C 4JI4H 3RGZA 1PVEA 3BLYA 3KLNA 2CFOA 5DUKA 2E7WA 2Z16A 3BR5A 3WG9A 3S2HJ 2DIKA 4D0PA 4YAJB 1K79A 2Y0MA 4KNYA 2HS5A 4IQ4A 4ESBA 5KFYA 2LOOA 3FBNB 1PP8F 3S14J 2BYVE 1R71A 4BE0A 4RDUA 2HYGD 2FK3A 5HNHA 2WWYA 1P4XA 4O4IF 1RI7A 4A3DG 2FPPB 2QQ9A 1BR4A 5IOZA 3T9FA 3M9MB 3D5SC 1VS0A 3RPUD 2HJWA 1FWZA 3VEPA 4CYDA 3QRFF 1DAAA 3BR3A 1WHUA 4A0XA 5JQGF 5B3SH 3VB2A 3OYCA 1P7IA 5CM0A 5EWGA 2DOAA 4QSHA 3OR2C 4GYIA 2DWCA 1BJAA 1XX5A 4Y15A 2VE8A 4V2FA 3R5XA 2NOJB 1FYMA 1Z6RA 1XGSA 4JI5H 1WGXA 2Y48A 1FTZA 3HUGB 3QPSA 1SYXB 1J5YA 3VPDA 4IRGA 1RRJA 3L2RA 4K2EA 2OU2A 3GIJA 4ZTFA 2R7ZA 5DLFA 3LSIA 1X3ZB 3L1PA 4B47A 4HDVA 4LG3A 4DV3H 3HGGA 2WY8Q 3RYRA 3JRBA 4G8XA 3OYGA 2UVUA 4LIUA 3HOVJ 2PMZE 3R4KA 4O4LF 3FXOA 2WAQA 3BR0A 5FD5A 2I80A 2O5RA 1V9PA 2ZXWH 5JQWA 1GV2A 1G2HA 1QBJA 1O7LA 1ONVA 2ESNA 4C2TA 3J7AO 3JTHA 3MWEA 2V58A 2K5CA 1POGA 4HLXA 5FJ8J 2HQNA 5L9XA 3FDSA 4O3NA 1VTNC 1YITI 3NEUA 1BR2A 2W24A 1T95A 2MD0A 3DBHB 4L5EA 3GTOA 3E5QA 4G94A 5HS8A 3TY9A 2EJ0A 1UNNC 4J9SA 2H8WA 1UJ8A 3GZ5A 1T56A 4CYCA 4DW6A 5M3MJ 2X0SA 2DZDA 3BZ6A 3I54A 4HOBA 2OCCH 5D5UB 3T9DA 2YW2A 2UUZA 3WTZA 2BQ3A 2LD5A 1Y1VA 4FHTA 3GLLA 1PX2A 1N56A 1JGSA 2V4JC 4XRSG 1QRYA 4CCJA 3O8HA 1TBXA 4NC8A 1IN7A 3QP6A 4CHUA 3L2WA 1VBGA 3PQKA 1IRGA 1SVMA 3WU0A 4O3OA 5DG7A 4D5CA 4AM3A 1LEAA 1LQ1A 4BY7G 4ZOLF 2HI3A 3KAKA 5HLIA 4I99C 4HYEA 1BOBA 2K3PA 3T1BA 4ZJZA 4WXHA 4LFBH 5L3EA 3PW0A 3CQZJ 4M3DA 4LH6A 2HWVA 4B3RH 1I1KA 1OYWA 2HNHA 2FRHA 3K9TA 1FOKA 2F48A 4XLHA 5KG1A 2BXZA 5DUIA 1S5LC 1MJAA 1IJWC 4BHPA 4O2AF 2EFNA 5IP6A 4AIKA 1D0YA 4IRDA 4O3PA 2ETHA 3A01A 5EZGA 5DISC 5KFCA 3Q0WA 3GZNB 4F91B 3GDEA 1T0FC 2IBKA 3HTSB 4XNFA 3G1MA 3F72A 1H89C 1ZR2A 1KC7A 1ZGJA 2J5PA 4EGQA 3GJXB 3KALA 3RJ0A 1YS6A 1IDYA 2E5NA 3F3XA 4ED6A 5KFHA 5FPOA 1L3LA 1TWHA 2YCHA 2FK2A 3RBEA 3EUAA 4JUZA 2P5KA 4O6JA 4OINF 2DPUA 2OAZA 1PK8A 3HOWG 4LFCH 2OV7A 2DK8A 4IHYA 2JA5J 1OPCA 5IT9W 1FP1D 4JBAA 4O83A 1R5GA 3KZZA 3PUFA 3RB6A 4IR9A 1UELB 3BR1A 1Y8RB 2JTVA 4NXNH 1EUDB 2WBMA 4EFEA 5IT9K 4UCVA 2R5YB 4F55A 2X1EA 1AKHA 3C2BA 1IBKH 3P5JA 2QQBA 4EJUA 3MR6A 3GIMA 3ZMVA 1HNWH 1Z2OX 3M9OB 4J9PA 3D0SA 2PBIA 3JRHA 4F50A 1DGRM 1MJ9A 3TQNA 2R93J 1J0RA 2O8XA 3RKQA 4HR7A 4DBQA 1K4TA 1B8IA 4OIOF 4MV8A 5D8DA 3G6YA 3I71A 4RLQA 3FMSA 1EV7A 3FXRA 4ON0A 5BWRA 2W1OA 2R5ZA 3PL8A 2NNYA 2M1BA 5HDNA 2L9VA 4BJ5C 2B63G 5E3MA 3HYIA 1XMAA 2EPFA 4FQGA 1W1WE 2QK4A 4MV9A 4J00A 5KFMA 5DV5A 1FBUA 3TO7A 1N33H 3ERMA 3CMYA 2RQPA 2XDVA 3UNGC 2RGRA 1IG7A 1U3EM 4PJLA 3EYIA 3JTGA 1NG7A 2AQ4A 3M3YJ 2JA7A 4JX4A 1TWCJ 3AG2H 1BA5A 2KZVA 3HOXG 3CCQI 3T5KA 3JRFA 3MFKA 2DA1A 1LE8B 3DFGA 3FIWA 3O3KA 5IT3A 4L5IA 1G8XA 1LDJA 1N25A 2IS4A 1OR7C 3DU6A 2W84A 3D5RC 4O3SA 3IWFA 3MAJA 2I5UA 2NRAC 3LFKA 3T8RA 3KFWX 1SFOJ 3H0GG 2P81A 2K9MA 4F92B 2D5VA 4CC6A 3FXMA 2W6MA 3S16J 4RZQA 1J7KA 5IP7J 4IKFA 1MIJA 2OQRA 1YI2I 1TQMA 4IHWA 5IYDG 5CVIA 4A3LJ 2ECCA 1Y0UA 3LAJA 2CSOA 2MLGA 1TW3A 3FXUA 3OYLA 2DA2A 2OUMA 1IDZA 4YAKB 1EF4A 1V4RA 4F52A 3MN2A 4NBQA 4YIRX 1VFCA 5K5QA 1TAEA 4LIVA 1CKNB 2W8KA 4J9LA 3EPZA 4IHSA 4LSXA 3HGYA 3HBLA 4MGRA 3U9SA 4HRIA 3WTUC 5GAGJ 3RYPA 1XDNA 3GX4X 4II2A 3TY5A 3EUKL 3HUGA 1TWAJ 2I8CA 1TL8A 2UXNA 2XASA 5H20A 4PUSA 3FISA 3TP0A 3VYSB 4H0EA 1DU0A 4O2BF 3TQ1A 1ZLJA 2DODA 3TOBA 5L1KA 2CU7A 2DCEA 4HF0A 4LD5A 4XMYA 3ETHA 1USSA 5DG8A 1I5ZA 3J7AK 1WH5A 1XNRH 1ORKA 1QHGA 2J6SA 5EG0B 2QSGX 1GSAA 4FM9A 3N44B 2W57A 1ZAUA 5ERIA 5LP6F 3GTMA 1TWGJ 2YYAA 3HOSA 2CQYA 3RKYA 4AUXA 3OSGA 5FGMA 2K02A 3S93A 2R7LA 2DXIA 1XS9A 3JSNA 3SGIA 1IV6A 3RJPA 3T1YH 2EBIA 3I64A 3CSWA 3TINA 1Z6TA 4KIBA 5TJJA 1K78A 1SD6A 4X1EA 1YHQI 2BZTA 4OMZA 3S1NJ 5IYZF 3IC7A 2MFZA 1I1SA 4HYKA 4YR3A 1XDUA 2ECBA 4ED7A 3T5LA 1SVLA 2MSYA 2GA2A 3CCSI 5IYBG 2XRNA 3BR2A 1MNEA 2VOPA 4O7LA 2F5EA 4ZC3A 5DGBA 3CUQA 5J1UA 2OTLI 2BY2A 4GLXA 1JJ8C 2VIXA 4UCUA 5CQGA 5LHHA 3H5AA 1BJTA 2QZ8A 3CJNA 5T14A 3F6OA 1F1ZA 1EH7A 2A3SA 4FCYA 1X1CA 2VUMG 3CMAI 3L9FA 5K5RA 5LEJA 3HOUJ 5BMVF 3TMOA 2W6QA 4MQ9F 3HRSA 4Y13A 4YFKF 4DQNA 1JDBB 1RESA 3BCBA 3VOEA 4BS9A 4I6ZA 4G7OF 2FPGB 4ZHQF 3RZOJ 2W70A 3I0TA 1JUSA 3H9GA 1MH3A 3EYYA 5KFDA 1X19A 5E3LA 3FXLA 4HEA2 3G2BA 3LL7A 5ICGA 2DO7A 1ZG5A 2R7ZJ 1XG1A 3KYDB 4GGGA 5LHGA 5K7HA 4P9FA 1IN6A 5JLXA 3K0LA 2NUAB 4O5VA 3H0DA 2QUFA 1TQPA 5KT7A 4JOMA 2AGPA 2R8JA 5KFAA 2EA2A 3PIPF 3BG5A 4JV2A 1D0XA 3J81Z 4ZYHA 2VBWA 1ETYA 2M87A 1ZARA 1XMXA 1APLC 2XIGA 2CV0A 2XAHA 2MH2A 3LFUA 1MDMB 2A6HF 3OV8A 1OCRH 2CW7A 3SFZA 4D9JA 2VBXA 5DM7F 2DPDA 3GTOJ 2JA6A 3K5IA 5K2MA 9ANTA 2ZM6H 2LFBA 3ZP5A 5FKNA 1OCCH 2M34A 2ICWG 3K6GA 4LFAH
chains in the Genus database with same CATH topology
2IGNA 3N40P 4CCOA 4E7KA 4B3XA 4E7SA 4BGDA 4A2BA 2BVLA 3I9V2 4GRIA 3T1HH 2V26A 4XN3A 4HG2A 4E6KG 4XN0A 1VZ0A 3N42B 2HGSA 1AA7A 5CKTA 5FPRA 4Q0YA 2W4SA 3F8NA 4DJAA 1X4PA 2VQHA 4U7BA 4OAYA 4DR4H 5D1OA 4JI7H 4DR2H 2JUGA 1MMAA 4BU2A 2KRCA 4LF8H 1M0TA 2LG4A 4RB2C 1ZHSA 3K70D 4Y3OA 4RB3C 4E6NA 4AQYH 4XLAA 4JI1H 1WJAA 4IAJA 2VLAA 3FDYA 1X4OA 3K4MA 3OOUA 4N4NB 2M4GA 1UAAA 4PZ7A 5HOOA 3ZR8X 2RQQA 4Y4RA 3OS1A 1CKOA 2W7NA 3AFHA 1L2ZA 1IRXA 2Z1DA 3DPLC 3OYKA 1LDKB 4UCOA 2KSWA 1E0EA 4B3SH 2LBFA 4BEHB 1P9QC 2L9SA 5KNLA 2XF6A 3CESA 2X1CA 3BCAA 1O75A 1WJEA 3ZQQA 1QHHD 2ZFUA 1FJGH 4YY3H 2VQCA 3FBIB 4YRVA 2R7QA 3L2QA 4LF4H 2HVQA 2F4IA 2RREA 2JVGA 3H9QA 1SFKA 2VJJA 4EEQA 4LITA 4BE2A 2JA2A 3PNYA 4HNTA 2R7RA 4DV2H 4IX7A 4B43A 3JSLA 3BA9A 4LF7H 3S3OA 4X66H 3HL2A 4X62H 4KISA 2IS1A 3OYFA 3NC0B 2CMPA 3GBGA 2UUAH 4E7HA 4N4OB 4ETSA 5LFAA 3L2VA 3FKJA 1XK5A 4UFZA 2HVSA 3LMLA 2WYOA 3RIZA 3CZ6A 1QU3A 3RF2A 1MNDA 1D1AA 1M0WA 1HA8A 1E4FT 4C30A 2M0MA 3PUBA 3PSFA 5CPRB 4J01A 4BDZA 3UQ8A 2LY1A 3K4NA 3DWLE 2CV2A 3HPHA 1LKXA 4HSRA 4CA0A 4LH7A 3HC7A 4RB0A 2PMZA 3LSKA 4BL0B 3OY9A 1S68A 3H5NA 3C2GA 3IAS2 5KCMA 4LF5H 3W2AA 3RSNA 4C2UA 4APMA 4E7ZA 3CP8A 4BJTA 2QKLB 2FE3A 3CVZA 1W36D 2X51A 4BJ6C 1KONA 3IG0A 3L2UA 4NXMH 3KYLA 4OX9H 1YE9A 2KP6A 2KHMA 3NBZB 2L2OA 2VL8A 4XKWA 4CCNA 3S24A 4IZZA 2OC6A 4PSXA 2QKMB 1V5GA 4JI0H 2K9LA 2VKHA 4FASD 3ONQA 1N75A 2JSPA 1LFPA 1U0JA 2V6EA 4E4HA 2V9KA 3OIQA 2R7UA 5HNFA 4MV7A 3TY8A 2M3AA 2W82A 3DKXA 4HSTA 5FRNA 3QYEA 3W1GA 4JI8H 3S32A 2R7WA 4C9YA 4CH7A 4QPOA 2Q2UA 1DGSA 4J0MA 2WA0A 2A5WA 1X1AA 2CW8A 2ELJA 3M1CA 1WJBA 2V1NA 3SEZA 3W5OA 2XF7A 1AN7A 2ZXIA 3W3CA 2HIVA 1X1DA 3K4LA 2UXBH 3SZGA 4ZDOA 4ZDPA 3K10A 3ZCOA 3DPTA 1UG0A 4AVZA 3VWBA 1Y56A 4PZ6A 4YEJA 4BDYA 3NBYB 3OS0A 3QWUA 2WAFA 2X1DA 4NUBA 4PJNA 4P1WA 2M7AA 4EQ5A 4PFOA 1A0IA 1Z21A 2R7SA 3A4CA 1N34H 2E5ZA 2LRDA 2MCTA 4AU7A 4HPQA 2HHHH 3K70C 4JI4H 3RGZA 3AL0C 2XF5A 4XOPA 3BLYA 3OYDA 3OYIA 3MKWB 2CFOA 2Z16A 2KDOA 3LSGA 2Q2EB 4PZ8A 2XC7A 2HIXA 4IQ4A 2PJRA 5TGTA 5HVQC 3BAAA 2LOOA 1D1BA 2KL4A 4BACA 3FBNB 5LL6b 4JI6H 4DIQA 1Z7LA 4BE0A 3RR5A 4BQOA 5HNHA 2I8DA 2WDTA 3CP2A 1FKAH 4DUZH 2R7TA 1DGWY 1BR4A 1TA8A 3D5SC 1VS0A 3RPUD 3K4KA 3D5LA 1K6YA 1PYVA 3IUOA 4X65H 4XORA 3OYCA 3N6XA 2E1MC 3OWTA 2DOAA 3OR2C 3C2HA 2Q2TA 2NOJB 5FD6A 2WAEA 2RGVA 3SDBA 3OS2A 4JI5H 3QYFA 3HUGB 1SYXB 4II3A 2L7KA 3CF2A 3L2RA 1DQUA 2LC2A 3OR1C 4ZTFA 2VOBA 3LSIA 4XL9A 4P5OA 4B47A 4LG3A 2X6XA 4X0GA 5KHDA 4DV3H 2WY8Q 3J7AY 3OYGA 4DV5H 4LIUA 3UR3C 2WAQA 5FD5A 4EFBA 2LYCA 2O5RA 1V9PA 3EYYA 3VDXA 2WADA 3PN1A 4MTEA 4C2TA 4MTDA 3PJRA 2VJ5A 2K5CA 2HDWA 2KLOA 1BR2A 1T95A 2MD0A 5LD2C 3NWSA 4DGWB 4DRFA 2LY2A 4XKBA 3TY9A 4R7RA 3OIPA 3L4JA 2OWOA 3M8JA 1W36C 4GKJH 2VXDA 2UUZA 2IXSA 4BXFA 1LVKA 1OLTA 1Z2NX 4PJMA 2IS2A 4DV6H 3LMMA 3ZGKA 1E4GT 2V4JC 2LH9A 4CCJA 4B3MH 2KRHA 3OMYA 4LSAA 4NC8A 2IS6A 3L2WA 3TBIA 3FMAA 4BEHA 4UCTA 4E7LA 1V5FA 3A2KA 1X9NA 2ZXHA 2Q1ZB 3RQ4A 3SYTA 4HNUA 3KAKA 1I6UA 3IAM2 1BOBA 2K3PA 4ZJZA 4CSWA 4LFBH 3KYHC 3KX2A 4LH6A 1D1CA 3QYBA 1PJRA 4UCRA 4B3RH 3U21A 5JHFA 2HNHA 1V5EA 2X85A 2X6WA 4R79A 4XLHA 1TT0A 4U87A 3K4JA 2XAUA 4LMYA 4XM3A 4RM3A 2P0WA 4BWSC 2F4VH 2BW3B 3ZXSA 3VYRB 4DUYH 1J5EH 2HQAA 3S3MA 1D0YA 3LSHA 5FROA 1WJ5A 2VASA 1EA3A 5DISC 4PK4A 2DT6A 4BQQA 4F91B 3GDEA 1T0FC 4XNFA 4X64H 4ZDLA 2IGMA 4H4KC 4MLOA 2UU9H 1R6RA 1DP3A 3FHNA 2MYSA 4DV7H 1NG6A 3I3LA 4ITVA 3GJXB 1BGWA 1S9HA 1GLNA 3E0JB 3KALA 3C0FB 3RJ0A 2E5NA 4JV5H 2WE6A 2E5LH 2L9NA 4CUGA 1ERDA 5FPOA 1MMGA 3W2WA 2YCHA 3EUAA 3OL3A 3HOTA 4OWRB 2VPLA 1TZLA 3VSLA 4B3TH 4LF6H 4JQFA 1N36H 2R7OA 3CMMA 4XQFA 3PNVA 4LFCH 2OV7A 5FLXW 4YELA 4YHHH 5IT9W 5LMNH 2MABA 2Y0SA 1HR0H 3MWMA 2GOMA 2ZSHB 1B04A 2UUBH 1UELB 1P16A 1ZHQA 2F6CA 5HLTA 4NXNH 2WBMA 4EFEA 4UCVA 2GOXB 4F55A 2X1EA 1MMNA 3GB8B 1IBKH 2BW3A 1HNWH 1Z2OX 4JI2H 3MKYB 1DGRM 2IGOA 5A2QW 1S03G 2AQEA 1GYFA 1MMDA 4NC7A 4NNJA 4DBQA 3AL0B 2ZJTA 4KHPH 4RLQA 3QOEA 1Y6IA 4KJZA 1HNXH 4PSWA 3CJQB 5D1PA 2R4GA 4DOZA 2W1OA 3OYBA 3PL8A 2LBFB 3HG9A 4RB1A 1JI8A 3JAMW 3OTOH 4BJ5C 4QPQA 1I94H 1BR1A 4BUPA 4RM2A 2CUZA 3DTKA 3W1BA 3DQVC 4MV9A 1Z3XA 4J00A 1N33H 3VYUB 1Z3YA 4M7EA 2DJIA 2XDVA 3RCOA 3UNGC 2RGRA 4JI3H 2R7XA 2HU9A 3K4BA 2KMUA 3BG6A 4PJLA 2ZSIB 1NG7A 3SEQA 1G59A 4CCLA 4DR7H 4XLCA 1SEIA 2E1MB 4RAYA 1MW7A 5LMUH 2VJIA 1SAUA 2KZVA 2UUCH 3A1YA 2CUJA 1YX3A 2F5VA 2HPIA 1G8XA 3CJRB 2IS4A 1OR7C 3DU6A 3KEYA 4D1QA 3S3NA 4PFPA 3D5RC 3DU5A 3OYJA 3M4IA 1XMOH 3OYMA 1FVIA 2LREA 1YX5A 2FUG2 4E7IA 2K9MA 4F92B 4CC6A 4OAZA 2XSJC 2CFMA 2VXZA 4RZQA 4DV4H 1N32H 1FMVA 3MKZA 4IKFA 2JVHA 2BVMA 3L2PA 4XLEA 2O03A 1Z2PX 1HNZH 4B44A 2KPMA 3HPGA 3OYLA 4IQJA 3DTIA 3DEEA 4FETA 2OUMA 4B48A 2CV1A 2VQFH 3LSMA 4ZYAA 4F52A 3DKYA 1TAEA 4LIVA 1CKNB 2AQFA 3EPZA 2VKDA 4LSXA 4AYBA 3J80W 4CZCA 2MC4A 4PJJA 4DV1H 3PFYA 4HRIA 2M7BA 4DR6H 1J09A 3VSKA 4JYAH 4ANJA 1XDNA 4II2A 3TY5A 3EUKL 2VQEH 4F3QA 3KXYT 1XNQH 3NWTA 3OYNA 5BR8H 4I7HA 4PUSA 5IWAH 4XONA 3HXLA 3VYSB 4DBRA 3VNNA 1XMQH 2KQRA 3J81W 3MD2A 2M4KA 4CCKA 2DCEA 4XMYA 4BE1A 3DF7A 3J7AK 1WJDA 1XNRH 4UCSA 1QHGA 2WY7Q 4XKVA 4XOTA 4RAZA 4FM9A 2HZDA 3N44B 2W57A 2IGKA 3PSIA 3QODA 3HOSA 2VUGA 3F9KA 1WJFA 1FMWA 4CCMA 4NQWB 3S93A 3H20A 2DXIA 3JSNA 3RGXA 2A6TA 4K0KH 3S8PA 3T1YH 3OYEA 5FRMA 1X1BA 4BQNA 3EUHC 4DR5H 2UXDH 2MFZA 1P8LA 3N43B 1CKNA 2W00A 4CC5A 2V7FA 3HKZA 2VJ4A 4E7JA 3N05A 1IBMH 1MNEA 4ZC3A 3AKZA 3W2VA 2BOLA 3PNTA 4XR6A 2VB6A 4F93B 4GLXA 2VIXA 4UCUA 2CH0A 3OYAA 3E1SA 5CQGA 3H5AA 1BJTA 2E60A 2VQGA 3K3VA 1X1CA 2R7VA 4GKKH 2L5QA 2X6YA 4RLFA 1CKMA 4PDBA 3DLAA 3TMOA 3KAJA 3DTEA 5CQEA 3VYTB 3H35A 1WFXA 3BCBA 1N78A 4Y33A 4BS9A 2PJRB 4LF9H 2UXCH 2UWMA 3H9GA 3BC8A 2HPMA 1X19A 2Z2SB 3DPUA 4HEA2 2DT7B 1ZELA 3G2BA 3LL7A 4ZTJA 5D1OB 3IP4B 3RTXA 4G6TB 3TL4X 3N41B 4RMNA 3BABA 1N77A 4DR3H 4KITB 3MMYB 3H0DA 4JOMA 4A2AA 3V42A 3ZRGA 2VPSA 4KT6A 1D0XA 3RTRA 3BA8A 2CS3A 2UV1A 1IBLH 1WJCA 2CV0A 3H5RA 3OYHA 2HVRA 2XIGA 1D0ZA 3LFUA 4XKCA 4XLFA 5EOYA 3L4KA 2CW7A 4D9JA 3OL4A 2RNGA 2WB1A 3K4CA 2ZM6H 1MZBA 3BG7A 3H9JA 2VQLA 1WH2A 4DV0H 4DR1H 3K6GA 4EATA 4LFAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFM A;  3L2P A;  2Q2U A;  1DGS A;  3W5O A;  3KYH C;  2HIV A;  5FPR A;  4LH6 A;  4UCR A;  4PZ6 A;  1TAE A;  1CKN B;  5D1O A;  3NBY B;  3QWU A;  4EQ5 A;  1A0I A;  1XDN A;  4E6N A;  3TY5 A;  5DIS C;  4PZ7 A;  3VNN A;  3GDE A;  1CKO A;  3GJX B;  4UCO A;  4UCS A;  4PZ8 A;  2HIX A;  3BAA A;  5FPO A;  2VUG A;  3RR5 A;  3JSN A;  2HVQ A;  1TA8 A;  1B04 A;  1VS0 A;  4EEQ A;  1P16 A;  1P8L A;  1CKN A;  3JSL A;  3BA9 A;  4EFE A;  4UCV A;  4CC5 A;  3NC0 B;  3GB8 B;  2Q2T A;  1XK5 A;  4UFZ A;  2HVS A;  4GLX A;  4UCU A;  3UQ8 A;  1CKM A;  5D1P A;  4EFB A;  1V9P A;  4LH7 A;  3PN1 A;  1S68 A;  3W1G A;  5D1O B;  3W1B A;  3RTX A;  4DRF A;  3BAB A;  3TY9 A;  3NBZ B;  2OWO A;  3S24 A;  3BA8 A;  2HVR A;  1FVI A;  3TY8 A;  4UCT A;  4CC6 A;  1X9N A; 
#chains in the Genus database with same CATH topology
 2JQ7 A;  4IRI A;  3QQM A;  1Y1V J;  4B3X A;  4BGD A;  2BVL A;  2FMY A;  2M0C A;  3SFI A;  2PJP A;  2CYY A;  2EIN H;  4HG2 A;  2IA6 A;  3P9C A;  4U0V A;  2HGS A;  4L9V A;  5F6F A;  3QQA A;  5FPR A;  4UUS A;  5L1L A;  5D5X B;  1IZ1 A;  3BR6 A;  3ZQG A;  4TQR A;  4U7B A;  4UUG A;  5CVJ A;  5CVU A;  2W9B A;  3MKL A;  1A5J A;  2JUG A;  1WKM A;  4LG0 A;  4BU2 A;  2KRC A;  2KRF A;  3Q3S A;  2RN7 A;  1ZRF A;  2LG4 A;  5GPA A;  1T8I A;  1YW7 A;  2A68 F;  2LF8 A;  5DDG A;  4Y3O A;  5E8G A;  1SMY F;  3I59 A;  4Y52 J;  3VPB A;  5AON A;  2XAJ A;  3IH4 A;  1WJA A;  2DFI A;  5DCF A;  3RPU A;  1X4O A;  1VQ6 I;  3PFF A;  3CDL A;  3Q2O A;  2ZB9 A;  2HKX A;  4XSX F;  5HLH A;  3H92 A;  5FLV A;  1BJZ A;  1X3W B;  4O84 A;  1XGO A;  3KHL A;  4Y4R A;  3QPT A;  3AFH A;  1IRX A;  4UCO A;  3DPL C;  2KSW A;  3FKI G;  2NVX A;  3KPH A;  1R49 A;  2E1C A;  4BEH B;  4D7N A;  4NYE A;  1J9I A;  3BCA A;  3E6B A;  3JR9 A;  4C3I J;  4OIP F;  2CNV A;  3QAH A;  4FX0 A;  3IL2 A;  5E1X A;  4A5N A;  2VR1 A;  2IA0 A;  2H1K A;  4YRV A;  4EJV A;  2YRX A;  2KT0 A;  4ME6 A;  3CTA A;  3OUZ A;  2VKE A;  3KZY A;  2H94 A;  4IXA A;  5C1O A;  1MMS A;  3I4M J;  4LIT A;  5H6Q A;  3PNY A;  5DCM B;  3H36 A;  1TWH J;  4HNT A;  3FKI A;  5C5J A;  2JEF A;  3BA9 A;  3S3O A;  4O7Y A;  4X62 H;  5EZY F;  2CFX A;  2HXI A;  4KIF A;  2PI0 A;  1F9N A;  2CMP A;  2LP0 A;  3GBG A;  3NC0 B;  4N4O B;  4ZQI A;  5J1R A;  4O4H F;  1XK5 A;  5JFR A;  4UFZ A;  2HVS A;  4DAA A;  3RIZ A;  3MEX A;  2X48 A;  1HST A;  1Y8Q B;  3LQS A;  1QU3 A;  3JZF A;  2QYZ A;  2EFW A;  2WV1 A;  4UUV A;  2ZDG A;  1JHF A;  5LXT F;  3ZMD A;  4WBN F;  3MZ8 A;  4BDZ A;  3K5H A;  3HOV G;  2NAZ A;  3UQ8 A;  2CO5 A;  2LY1 A;  3O6B B;  2VC0 A;  4GCV A;  1IF1 A;  3BQZ A;  2JEJ A;  2P6S A;  4RGR A;  3HPH A;  3FF5 A;  4WXC A;  4LH7 A;  5FJ8 G;  2EIL H;  4RB0 A;  2FBK A;  1IRZ A;  3IAS 2;  2Z5U A;  4AID A;  2GBY A;  2YS6 A;  4XLP F;  4BJT A;  1ZTR A;  2L3D A;  3CVZ A;  1LNW A;  3R0J A;  1KON A;  4UB6 C;  4NXM H;  3R5F A;  5BNG A;  5IYC J;  2MA3 A;  1EKF A;  2GPW A;  2R85 A;  1EKV A;  2KHM A;  3HSR A;  3Q5F A;  2L2O A;  4XKW A;  4Y17 A;  2G7U A;  4B8X A;  1HF0 A;  4UNO A;  2ZC2 A;  3CO6 C;  4M9S A;  2VKH A;  2LY9 A;  1ZN2 A;  4FAS D;  2B7E A;  3PW5 A;  2CKZ B;  2H27 A;  3V4G A;  3Q8S B;  4OU0 A;  2UVR A;  1XMK A;  2FOK A;  2BY0 A;  1U0J A;  2NS7 A;  2V6E A;  1B72 A;  3GFJ A;  1ZAO A;  3WE3 A;  4I50 F;  1OCO H;  3DKX A;  2Z33 A;  2JA7 J;  2RF4 A;  2KIF A;  5EEA A;  2VN2 A;  3QYE A;  4JI8 H;  2R7W A;  5KFU A;  1VI0 A;  4RAG A;  2A5W A;  1X1A A;  4GYG A;  1LVA A;  4IJA A;  2V9W A;  2HIV A;  1X1D A;  3F23 A;  2DOE A;  4I2O A;  3DPT A;  1UG0 A;  4AVZ A;  1VQ4 I;  5E17 F;  4PZ6 A;  2LKP A;  1H8A C;  4E4T A;  1WH7 A;  5KFJ A;  1ZK8 A;  3OS0 A;  2WAF A;  2Y31 A;  5CE8 A;  4PJN A;  2M7A A;  4EQ5 A;  2E2I A;  3Q8R B;  3G8C A;  5E3N A;  5K1Y A;  4FU0 A;  1I1L A;  3A4C A;  4KIC A;  1B9N A;  1U9O A;  2VA3 A;  4AU7 A;  4Q45 A;  2PFB A;  3GLK A;  2V1D A;  4TQS A;  1E4E B;  1EJ9 A;  1M1E B;  2HYF A;  2L4A A;  2KDO A;  2CZG A;  3LSG A;  2QYO A;  1NK3 P;  4YP3 A;  2GPS A;  2EJR A;  2XC7 A;  2HIX A;  1UHW A;  1P4W A;  5FB2 A;  3WHB A;  3WNZ A;  4BAC A;  3IHU A;  2FA5 A;  2PQ8 A;  2VC1 A;  1UB9 A;  2NOG A;  5BS6 A;  2JA5 G;  2V9P A;  5GON F;  3AW8 A;  4WWC A;  6PAX A;  1B6S A;  4MAM A;  3CP2 A;  1GVD A;  5BPI A;  3GTL A;  2EZH A;  1DGW Y;  2R7T A;  1SC7 A;  2DYS H;  1BW5 A;  2IRF G;  3C3W A;  5LEK A;  1WRV A;  2UVW A;  4X6A J;  4CYC B;  3K4K A;  4FFP A;  3D5L A;  4IEJ A;  5FLM G;  1PYV A;  1W7P D;  1JE8 A;  3GTM J;  3WWH A;  4FFR A;  4XOR A;  4ENN A;  4QWD A;  1KU2 A;  3C1D A;  5C3E J;  4Q4Z F;  4CE5 A;  3C2H A;  1OYY A;  2GA1 A;  2HGC A;  5LRR A;  1WPK A;  1A04 A;  2DMQ A;  4BBR J;  2R93 G;  5FD6 A;  2RGV A;  3SDB A;  2FB9 A;  5ILU A;  2Z04 A;  5I5U A;  2YPR A;  3GUD A;  2RDP A;  2L7K A;  3CF2 A;  4LLG F;  3I58 A;  2LC2 A;  1WRJ A;  3OR1 C;  5EWE A;  3V7S A;  4XL9 A;  4S0H B;  1L0O C;  4N9H A;  4BNC A;  4DV5 H;  4HQ6 A;  3IRR A;  5CA0 F;  1NHA A;  2K7L A;  2UVV A;  2Q2E A;  3GO5 A;  3PM1 A;  3HTU A;  2X6O A;  3F8M A;  4FTH A;  1JIH A;  1RIO H;  2HOA A;  2HOS A;  4ECX A;  2EV5 A;  2VJ5 A;  1VBH A;  5J1Y A;  1KU3 A;  2HQ5 A;  3RIR A;  2ZME A;  3WHC A;  3A0B C;  5E79 C;  4GDF A;  1VQL I;  3F8F A;  2B0L A;  5LD2 C;  3NWS A;  4DGW B;  2YS9 A;  2LY2 A;  3IH2 A;  1VQ9 I;  4QIW E;  3OIP A;  4C3J J;  2FP4 B;  2K9S A;  4P96 A;  3M8J A;  1W36 C;  4BXF A;  3A01 B;  4DL3 A;  3WTV C;  1LVK A;  1OLT A;  1Z2N X;  2L02 A;  1WSU A;  1O4X A;  4DV6 H;  2OZ6 A;  3PFI A;  5HDK A;  2Y9Z A;  3G71 I;  1I6X A;  2EZI A;  3R61 A;  1S3J A;  4KUM A;  2IS6 A;  3WGG A;  2LR8 A;  1JLL B;  4HAM A;  1CS0 A;  3FMA A;  4BEH A;  2ZGI A;  3ASN H;  5BYA A;  3NUA A;  5IP7 G;  1YJW I;  4ZZD A;  3A2K A;  1Y0N A;  3UFX B;  4A3L G;  2OF7 A;  2ZXH A;  4CKB A;  2DOF A;  4KFC A;  1OYI A;  2Q1Z B;  3RQ4 A;  3SYT A;  4EM1 A;  2GXB A;  3S1R J;  3IAM 2;  1U5T C;  4EGY A;  3GID A;  4KDP A;  2JA6 J;  1YO5 C;  3QYB A;  1Z7U A;  2NU6 B;  1V5E A;  5LGU A;  2ID6 A;  2ZJR F;  1TT0 A;  3LP8 A;  2F4M B;  3AG4 H;  2JMW A;  3K4J A;  1BI3 A;  1AKH B;  1JHH A;  4RM3 A;  1NTC A;  2XB0 X;  5B1B H;  3WTS C;  4CKC A;  5BWW A;  2COB A;  4UB8 C;  5F1R A;  1J5E H;  1QPI A;  1TTY A;  2YRW A;  4L1K A;  2DN0 A;  3LSH A;  1WJ5 A;  3QPL A;  5L3B A;  3KHH A;  4KN4 X;  2AXL A;  1HKQ A;  4O4J F;  1QVT A;  4BQQ A;  1B8I B;  4X64 H;  2G9W A;  2IGM A;  4M3F A;  1L2Z A;  4O7T A;  1DP3 A;  3ZQC A;  2HXO A;  2HEO A;  4LJZ F;  1GXP A;  2P5V A;  3E0J B;  2WE6 A;  2R5Z B;  4EGJ A;  2H6B A;  5DEQ A;  1T94 A;  5L3G A;  3K3P A;  5BQT A;  1K7A A;  1FYK A;  3HOT A;  2BHZ A;  3VSL A;  3MR5 A;  4ZYD A;  1BI1 A;  3QPH A;  3T9A A;  5M5W J;  5FLX W;  2COI A;  4YHH H;  3SDG A;  1K6O A;  1FIP A;  1SAN A;  2NVX J;  1B04 A;  1IOV A;  2QCO A;  2C2D A;  5LMN H;  5FLX K;  4YB8 B;  1JX4 A;  5EJC A;  4O81 A;  2QSH X;  2W6Z A;  2CQK A;  3ULQ B;  5ILV A;  3BTI A;  4WF2 A;  4MV4 A;  2IGO A;  2IT0 A;  2AQE A;  5L3D A;  3TQT A;  1GYF A;  4NNJ A;  3ASO H;  2CQ7 A;  3HOU G;  4QWC A;  3FKI J;  1ODD A;  2EZK A;  5F9L A;  1W7P B;  3FZV A;  1J59 A;  2ZBK A;  1ZGW A;  2QBY A;  2FQ3 A;  4KJZ A;  4LK1 F;  1EUC B;  4EV0 A;  2WAQ E;  1HNX H;  3KE2 A;  3VMM A;  4OOI A;  4DOZ A;  5KT2 A;  4Q8F A;  1XDS A;  3OYB A;  2R7Z G;  4MO7 A;  1JI8 A;  3OTO H;  1Q1H A;  4IO9 F;  3M7G A;  3TO9 A;  1BR1 A;  4BUP A;  4Q47 A;  2TDX A;  2MBF A;  2ZNY A;  2Y9Y A;  2HDD A;  5ICC A;  1YOV B;  1LPQ A;  1YJN I;  3VYU B;  3LSR A;  3WGH A;  4JI3 H;  3RCO A;  5DGH A;  3U0G A;  3DCF A;  2BBY A;  4RUA A;  4A0Z A;  4EJO A;  2HU9 A;  2GIZ A;  1GLV A;  4EVI A;  3DKW A;  4J9Q A;  3H3Z A;  4DR7 H;  1SEI A;  1V3F A;  4A3F J;  5DGI A;  1SAU A;  2VJI A;  5LMU H;  3HKZ N;  5CLS A;  3IRQ A;  5KFR A;  3IH3 A;  2QM3 A;  1E4E A;  2DMU A;  1CF7 A;  2RVC A;  4CMD A;  2MGQ A;  2CUJ A;  1IN4 A;  1K4S A;  3QP5 A;  4QLC U;  1T6S A;  3KEY A;  1BW6 A;  3HSF A;  1XSD A;  3BWG A;  4V19 K;  1XMO H;  5C8Y F;  2Y69 H;  1R23 A;  2LRE A;  2RKH A;  1D8J A;  1YX5 A;  2FUG 2;  3TW6 A;  3I12 A;  3U9T A;  1Y1V G;  2XCP A;  1T3N A;  4A12 A;  3PR5 B;  3DP7 A;  2XCL A;  2CFM A;  5J3L A;  1N32 H;  3MKZ A;  2ZFW A;  3GFM A;  4NDL A;  3L2P A;  4XLE A;  3I56 I;  5KG6 A;  3GYH X;  4L9T A;  1SD5 A;  3MWD A;  2FML A;  1K78 B;  2CG4 A;  2KPM A;  3HPG A;  3H3V K;  4FET A;  3DEE A;  1YW9 A;  4DYQ A;  5GTI C;  3LSM A;  1YTY A;  5DMX A;  3DKY A;  2XGX A;  5JUM A;  5ICF A;  2K86 A;  3MQ0 A;  4CZC A;  5C44 G;  4PJJ A;  4G3I A;  3PFY A;  5ILS A;  2M7B A;  2P7C B;  4DR6 H;  1I1M A;  1Y39 A;  3CUQ B;  4XX0 B;  1V54 H;  4DYC A;  4XYM B;  1F36 A;  3H4D A;  2AXT C;  3GME A;  2OH2 A;  4F4Z A;  1QQI A;  3KXY T;  4XLN F;  4FE2 A;  1XMQ H;  5IWA H;  4XON A;  4DBR A;  5DQI A;  1ET0 A;  3GTP A;  2X5R A;  4A3M J;  3MD2 A;  5KFT A;  4CMF A;  3T99 A;  4AD9 A;  4PGH A;  4BE1 A;  4A3C J;  3HZJ A;  3SE7 A;  4I0A A;  4UCS A;  3ZOB A;  2E2I J;  3LUL A;  3R5H A;  1XCV A;  2ELH A;  3EET A;  2HZD A;  4A6E A;  1HXD A;  2IGK A;  2PG4 A;  3E5U A;  3GCM A;  3PSI A;  3QOD A;  2LK2 A;  3G1L A;  4CCM A;  5GAE J;  1QZE A;  2A6T A;  4K0K H;  3S8P A;  2W9A A;  4I4T F;  2NVU B;  3I4M G;  1OCP A;  4BQN A;  3EUH C;  1YQA A;  1VQK I;  1IGN A;  5H80 A;  3MR2 A;  2E2J J;  1RYR A;  1P8L A;  3E5N A;  3BZC A;  4EG0 A;  1KJJ A;  2FOW A;  3HKZ A;  1RK5 A;  3EDP A;  3N05 A;  1TT5 B;  3QU6 A;  1IBM H;  1V51 A;  2X9D A;  4XR6 A;  5KX5 F;  3GTL J;  3E3V A;  2IPQ X;  3K1N A;  1ZQ3 P;  3OYA A;  2EWN A;  3GZ6 A;  2V6C A;  2GLT A;  2YUS A;  2GQS A;  4BY1 J;  3L7W A;  3K3V A;  2FMA A;  1D5V A;  3NAR A;  4KT5 C;  4RGU A;  5CR5 A;  1AHD P;  1CKM A;  2IP4 A;  2H6C A;  2EJ3 A;  3KAJ A;  4MA5 A;  3H35 A;  1RJP A;  2PJR B;  5H2F C;  1BI2 A;  1FY7 A;  4QWA A;  2G7H A;  4UUS B;  2UWM A;  2NNN A;  3J80 Z;  3DPU A;  3SNO A;  4MA0 A;  4A3I J;  1S7E A;  1ZEL A;  2ISZ A;  3GQC A;  2W9B B;  5J40 A;  5IYC G;  2EV6 A;  5FLM J;  2DMP A;  5KVR A;  4LG0 B;  3BAB A;  4P9U A;  4DR3 H;  3I59 B;  2G0E A;  2STW A;  5HOD A;  3DV8 A;  3CCR I;  3V42 A;  3RTR A;  5JI6 A;  1JUM A;  4JX6 A;  1T2K A;  3OYH A;  2HVR A;  4XLF A;  1WCM A;  3F22 A;  1UST A;  4MQV A;  3OL4 A;  2RNG A;  2YX4 A;  2JA7 G;  3K4C A;  2M2E A;  1MZB A;  1VQO I;  3H9J A;  5KFW A;  3EQL F;  4HQM A;  1QA6 A;  5IP9 J;  4U6P A;  3BQ1 A;  1KJI A;  1WH2 A;  2R7D A;  3F0C A;  4I55 F;  4DR1 H;  2BR0 A;  1KJ9 A;  4QJF A;  5JR3 A;  4E7S A;  1DIK A;  2DTZ A;  3RDI A;  3T1H H;  4V2G A;  1TP4 A;  1YLF A;  4XN0 A;  4WCG A;  3L2C A;  1IXS B;  1LUJ B;  1VZ0 A;  3AYH B;  1AA7 A;  2BHY A;  1ON2 A;  4MIM A;  5CKT A;  5CVR A;  4O3M A;  4ECV A;  2F2E A;  2GXG A;  3F8N A;  2YS7 A;  1V55 H;  4OAY A;  3BG9 A;  2YZL A;  4YJ3 F;  4ECQ A;  4JI7 H;  4NB5 A;  2P6T A;  2EIY A;  2PBZ A;  1KBL A;  2I87 A;  2ISY A;  2ESH A;  1MJB A;  3A02 A;  2WTE A;  3NRV A;  2IBD A;  3U1K A;  3K70 D;  4UY8 I;  2DYR H;  1UHS A;  1G6N A;  4ECU A;  2EFQ A;  3BZK A;  3SZP A;  2YZM A;  3OSF A;  2LLK A;  3OOU A;  3K4M A;  1RET A;  4N4N B;  2L7M P;  2M4G A;  1LFU P;  2CGP A;  1HC8 A;  1I7N A;  5HOO A;  1CQT A;  1W7P A;  2L01 A;  4GXO A;  2VPQ A;  1KQ9 A;  3M1E A;  3G3Z A;  5F0C A;  3ZR8 X;  1E2X A;  3KEQ A;  3OS1 A;  4S04 A;  2W7N A;  1LDK B;  1IOW A;  3CCY A;  5B66 C;  1WI3 A;  5KNL A;  1RUO A;  4FE7 A;  3QZ8 A;  3PZP A;  1WJE A;  3ZQQ A;  2ZFU A;  2DFH A;  4CGZ A;  2FK1 A;  4BKX A;  4JV0 A;  1FJG H;  4O7W A;  2VQC A;  4I01 A;  4WXD A;  2R7Q A;  2XHK A;  2HVQ A;  3PVX A;  3LSJ A;  1AWC A;  3TKY A;  2RRE A;  2JVG A;  1ACI A;  3RFC A;  1SFK A;  4MFD A;  5C3E G;  2V1U A;  1B6R A;  4XSZ F;  5I60 A;  2R8G A;  3VOT A;  4M6V A;  2R7R A;  1DPU A;  4DV2 H;  2CQN A;  4B43 A;  4IX7 A;  3JSL A;  2V4Q A;  3V6K A;  4BBR G;  4LF7 H;  3HL2 A;  5F08 A;  1STZ A;  3OYF A;  3K2A A;  1I7L A;  3G6E I;  4A3J J;  3L2V A;  3FKJ A;  2FKL A;  2FEZ A;  2WYO A;  3JAM Z;  4U7D A;  3CZ6 A;  1IXR C;  4ZYE A;  1B72 B;  1D1A A;  2W7O A;  1OFC X;  5M5Y J;  1QZZ A;  1OQY A;  1MD0 A;  3DEW A;  4C30 A;  4PCQ A;  1ZRD A;  1AUX A;  2W9C A;  3B6C A;  2W71 A;  1TLH B;  4O86 A;  5JVD F;  1SFE A;  2Z9O A;  4FBU A;  2JWT A;  3DWL E;  2Y0S E;  1LKX A;  2R3S A;  1ZYR F;  3FMR A;  4CA0 A;  4DZJ A;  2H1L A;  1HDP A;  3HC7 A;  5FFZ A;  4IWX A;  1S68 A;  3H5N A;  4B4C A;  1IC8 A;  5KG3 A;  4LF5 H;  1HOM A;  2GQR A;  4E7Z A;  2FE3 A;  3CP8 A;  4BAY A;  4HF2 A;  3IG0 A;  5DYM A;  1MBH A;  1XPX A;  3L2U A;  4A3E J;  1TWF A;  1ZET A;  2JT1 A;  4FX4 A;  4MEX F;  3JRX A;  3GF2 A;  4AWX B;  1VND A;  1RNL A;  4ENJ A;  1LB2 A;  1FYL A;  3MCZ A;  4A6D A;  1Z77 A;  3REO A;  4U88 A;  5DG9 A;  4IZZ A;  2OC6 A;  1B1B A;  1V5G A;  4IR1 A;  4HV6 A;  4AIH A;  4G7H F;  3C18 A;  3ONQ A;  1N75 A;  1SD7 A;  1GV5 A;  2DA3 A;  5EGO A;  2JSP A;  3KP2 A;  2A6E F;  1FTT A;  5KT3 A;  4BHB A;  1UC8 A;  4G7Z F;  3K7A J;  2XGD A;  2PMH A;  4E4H A;  4B09 A;  1T38 A;  1IUY A;  3U1D A;  4TVI A;  2M3A A;  1MBK A;  1ETV A;  2O6G E;  5D8K B;  2KJB A;  4O7R A;  4YG2 F;  1ZR4 A;  5TRD A;  2V1X A;  3WWI A;  1IUF A;  2JA6 G;  4J9R A;  5BPF A;  3W6V A;  2Q2U A;  4UV8 A;  2OD5 A;  2ZXJ A;  1E3O C;  4J0M A;  2A5Y B;  4M9X A;  3W5O A;  1WJB A;  3KZI C;  1S9F A;  1MGT A;  1IN5 A;  2UXB H;  4G6D A;  4ZDO A;  2HFH A;  4O3R A;  3B02 A;  3K10 A;  3ZCO A;  3VWB A;  4RBO A;  4BDY A;  3N4M A;  3U9G A;  1WWX A;  4NUB A;  3PO2 J;  1H0M A;  2EZL A;  3BT9 A;  5E1W A;  4EJW A;  1Z21 A;  3Q8P B;  4A5M A;  1UG2 A;  4G6Q A;  3BY6 A;  1Z1D A;  1T98 A;  2NU8 B;  2CNQ A;  1FZP B;  1XCB A;  3S1M J;  1REP C;  1A36 A;  4KMU X;  2B9S A;  5F04 A;  4HPQ A;  3DTF A;  2HHH H;  5JVL A;  3JRA A;  3ZQI A;  2XF5 A;  4XOP A;  3OYD A;  2BEO A;  3HIF A;  2F5C A;  4EYH B;  2Q2E B;  3PW2 A;  1S29 A;  1MH4 A;  5LGN A;  2PJR A;  5TGT A;  2C00 A;  2K85 A;  2CNU A;  3BAA A;  1VQN I;  2YL2 A;  4JI6 H;  4AYB E;  1Z7L A;  2R87 A;  5CVV A;  3GTP J;  2L9R A;  3COA C;  1AOY A;  2I8D A;  2WDT A;  4DUZ H;  2ZME B;  1Y1W A;  2DA5 A;  1HSJ A;  2DMT A;  1C0W A;  1QGP A;  4UHT A;  2DA6 A;  3GWZ A;  5C44 J;  1EH6 A;  1K6Y A;  2FSW A;  3LA2 A;  4GO1 A;  4LOC A;  3IUO A;  1VKZ A;  3QU3 A;  4CHI A;  2QQ8 A;  3N6X A;  4I0B A;  3OWT A;  2XRO A;  2W6N A;  4CDG A;  3MVP A;  1ZG1 A;  2DFF A;  2Q2T A;  1WSC A;  3AX6 A;  2C6Y A;  3SXY A;  3HM5 A;  3HSE A;  3OS2 A;  4Q4D A;  2TRT A;  1Z91 A;  1SEU A;  1T36 A;  3GVA A;  4WX9 A;  3I4N J;  2ASD A;  2O9L A;  4IHV A;  3Q8Q B;  2ZCW A;  5KT4 A;  1FBS A;  2DQR A;  3RB0 A;  4X0G A;  5KHD A;  1FPQ A;  3FHZ A;  3J7A Y;  5KFN A;  2J6T A;  2JA8 J;  4IRH A;  5KFO A;  3R60 A;  2W25 A;  2LYC A;  4OIQ F;  5KFV A;  5C4X J;  2R84 A;  2WAD A;  3PN1 A;  2R6F A;  4MTE A;  3ECH A;  2J5O A;  4O82 A;  3PJR A;  2KLO A;  3IKV A;  1R1T A;  1PDN C;  2YWV A;  2FPI B;  5FFX A;  2VPR A;  5EDN A;  1G3W A;  2DPJ A;  4DRF A;  4UUT A;  4XKB A;  1DV2 A;  4EM0 B;  4A3F G;  3ETJ A;  5KFX A;  3BTL A;  3KHG A;  3L4J A;  5L3F A;  3CUQ C;  3N6R A;  2MH9 A;  2VXD A;  1O3S A;  4QW9 A;  1DU6 A;  3WTT C;  3BDD A;  4PJM A;  4UVC A;  1RUN A;  2IS2 A;  3HEF A;  2NU9 B;  2LH9 A;  1T33 A;  5FO5 A;  4BH9 A;  4A3B J;  2EFO A;  3OMY A;  4LSA A;  2XAF A;  5IPA A;  5D5V B;  4IL6 C;  5KFB A;  3I5U A;  3TBI A;  1C3O A;  2COG A;  3TIG A;  3GXO A;  4A69 C;  1ENH A;  3KTM A;  3NGD A;  4ZZL A;  1V5F A;  3OSP A;  1GUU A;  2QWW A;  4HX8 A;  1D5Y A;  3M9N B;  3RAX A;  4J9K A;  4QTR A;  1X9N A;  4BXX G;  2EIK H;  3V4S A;  2OJE D;  1OMI A;  1DDN A;  4HNU A;  1MBG A;  4BBS J;  1I6U A;  1WCM J;  4CSW A;  1HW1 A;  5KFF A;  2HHF A;  4R8U A;  2GZW A;  2JPB A;  1D1C A;  3CCM I;  1PJR A;  1I1G A;  3M8F A;  1R9T A;  3GTJ A;  2A07 F;  4Q48 A;  3KP6 A;  2X6W A;  2VE9 A;  3HOY J;  4R79 A;  2Y30 A;  2OCE A;  3RPQ A;  5KS8 A;  2XAU A;  3KCC A;  4LMY A;  3RQI A;  5H6R A;  3CC4 I;  2P0W A;  4JXU A;  1K1S A;  2F4V H;  2SCU B;  2LF7 A;  1JT6 A;  4JK1 X;  4IRC A;  1FOY A;  2VOD A;  4DUY H;  2F5F A;  4EMS A;  4A3M G;  2XKO A;  1ETO A;  1BC8 C;  1LFB A;  2QEN A;  4S05 A;  1EA3 A;  4PK4 A;  4A3C G;  2XRL A;  1HKT A;  4ECZ A;  4C5C A;  3V6H A;  5J2U F;  3TDU C;  3GTQ A;  2QBY B;  2UU9 H;  5I5W A;  4DV7 H;  2MYS A;  1R22 A;  1ETQ A;  1NG6 A;  4UV9 A;  1BGW A;  3ELK A;  4RNN A;  4JV5 H;  3C0F B;  3AAF A;  1B33 N;  2L9N A;  4D7M A;  4CUG A;  1ERD A;  1MMG A;  2IP2 A;  1KQ8 A;  2EH3 A;  2OQG A;  2VPL A;  4LF6 H;  1IXC A;  4JQF A;  3BPV A;  3CMM A;  5F64 A;  3SQN A;  1PP7 U;  1K83 A;  2DW4 A;  2XB5 A;  1IAW A;  1U9N A;  4TV9 F;  2XPV A;  4XRF A;  2MAB A;  3LQQ A;  2ZSH B;  2K9N A;  3VPR A;  2PN1 A;  1K61 A;  4WHX A;  1TW2 A;  3HRM A;  1U5T A;  2Q7D A;  2OA4 A;  1BNC A;  4C3H J;  2FLP A;  3PW4 A;  4DZP A;  1JKQ C;  2ASL A;  2V79 A;  5K7Z A;  1CF7 B;  1A6Q A;  3GB8 B;  2DLN A;  1I2L A;  2BW3 A;  5KFG A;  2XKP A;  4BY1 G;  3TGN A;  3MKY B;  3LOC A;  3ABL H;  2NS0 A;  2NVY A;  2KKO A;  4EEF G;  3QWL A;  2M8G X;  3TOA A;  2KDZ A;  4DL4 A;  1A3G A;  4EBC A;  3JSP A;  3AL0 B;  2ZJT A;  4KHP H;  1ZG3 A;  2C2R A;  4HN2 A;  1Y6I A;  2CQX A;  2W6O A;  2RDJ A;  1O3T A;  5D1P A;  2R4G A;  4FT8 A;  1KTA A;  2XGQ A;  3I55 I;  2ZJP F;  4QWQ A;  2CRG A;  2E1N A;  3JSO A;  4L18 B;  4RNO A;  3HG9 A;  1KA8 A;  1F4K A;  4A3I G;  3JAM W;  4QPQ A;  1I94 H;  2ZNZ A;  3O8G A;  2CUZ A;  2C22 A;  2Q8K A;  4ECR A;  3W1B A;  3GTG A;  1YRN A;  3R6S A;  4M7E A;  1Z3Y A;  3JAM K;  2DJI A;  1BIA A;  5B1A H;  2VON A;  2R7X A;  2KMU A;  2L7F P;  3BG6 A;  3IKT A;  2ZSI B;  3RUP A;  3H40 A;  4CCL A;  4XLC A;  1HDD C;  2E1M B;  4RAY A;  1JJ6 C;  5JVG F;  2K3F A;  1JXS A;  3A1Y A;  3C7J A;  3KP3 A;  1YX3 A;  2F5V A;  1B4A A;  2HPI A;  3LSP A;  1A9X A;  5IP9 G;  1Z05 A;  3CJR B;  3TED A;  1TWF J;  2E7X A;  3KP7 A;  4PFP A;  1EYZ A;  3M4I A;  4EBD A;  3OYM A;  4DL7 A;  1FVI A;  4A0Y A;  4XID A;  5KFS A;  4E7I A;  2CUF A;  4EM2 A;  4OAZ A;  2W8L A;  2OBP A;  1UC9 A;  3ISP A;  2VXZ A;  3WWJ A;  3RAQ A;  2JVH A;  1FJL A;  5IT9 Z;  5BWV A;  1GSH A;  4XK4 A;  2CQQ A;  1JXL A;  1YIJ I;  3WGI A;  2ZJQ F;  3A0H C;  3KLO A;  1ZKG A;  3DTI A;  4HV5 A;  4B48 A;  3LNQ A;  2HDC A;  5BMZ A;  3RKW A;  1JGG A;  2XAG A;  5LHI A;  1EHI A;  5KG2 A;  4EBE A;  2AQF A;  4C5A A;  4NZO A;  4GFB A;  4NHJ A;  5E25 A;  4M6X A;  1BC7 C;  2HDK A;  5KT6 A;  2P0A A;  4LFU A;  3VSK A;  2PX9 A;  4ANJ A;  2D45 A;  3T9E A;  4ED1 A;  3P7N A;  1XNQ H;  1Z0X A;  4F3Q A;  4ASN A;  3NWT A;  3OYN A;  1PUF A;  4I7H A;  1I3Q A;  5BR8 H;  1E3H A;  2A05 A;  3B73 A;  4A3G J;  2C28 A;  2O61 A;  3HXL A;  4YQW A;  3HB9 A;  3VNN A;  4MHG A;  5LBQ A;  3J81 W;  2M4K A;  1BI0 A;  5KFE A;  1IO2 A;  4LLN A;  2O3F A;  2WB1 N;  2R86 A;  2YSR A;  4RAF A;  2OLS A;  4KN7 X;  1WJD A;  1JKR C;  4L0Y B;  3S17 J;  3NQO A;  2WY7 Q;  2AO9 A;  2AGQ A;  3KP5 A;  3K1P A;  4ECS A;  1FNN A;  3J81 K;  2KIQ A;  2GIV A;  4OIR F;  2J6U A;  2VUG A;  2JPC A;  4Q8E A;  1RPW A;  1FMW A;  1SMT A;  1W5C C;  1E17 A;  3H20 A;  1Z9C A;  1EKP A;  3CME I;  1A35 A;  1R7J A;  1X2N A;  3VOD A;  2PLY A;  1T08 B;  1HQC A;  3F21 A;  2UXD H;  4ZI7 F;  2ZKZ A;  4WK8 F;  4ED2 A;  4M74 A;  5CYV A;  5I5Y A;  3U55 A;  1JTX A;  2Z02 A;  3GII A;  3EPG A;  2R8H A;  3PO3 G;  2W00 A;  5KKN B;  4CC5 A;  2WV0 A;  4A3J G;  1P92 A;  2DAO A;  2V7F A;  4E7J A;  4M72 A;  1ITY A;  1GGO A;  5EF6 A;  2LNB A;  4Q5S F;  3W2V A;  3PW7 A;  1VQ5 I;  2BOL A;  3PNT A;  1Y1W J;  1JKP C;  2VB6 A;  1KGS A;  4A3K J;  3BQ2 A;  2C35 B;  3BG3 A;  2GWR A;  3U2R A;  4G12 A;  5KT5 A;  3E1S A;  2VT2 A;  5D5W B;  2VQG A;  3CLO A;  2P7V B;  1ETW A;  3BTJ A;  3M4O J;  1FC3 A;  4GKK H;  2DJN A;  1FIA A;  3WTY C;  2X6Y A;  3K1M A;  5I5X A;  4PDB A;  3DLA A;  2W7P A;  3JW4 A;  3G6V A;  3G8D A;  5CQE A;  2H09 A;  2FXA A;  1FLI A;  1WFX A;  1N78 A;  2HKO A;  3HHH A;  5FR9 A;  2UXC H;  2DT5 A;  3T5H A;  4NQW A;  2HPM A;  2Z2S B;  4CO8 A;  1H9T A;  3N8D A;  3U54 A;  4A3E G;  2J9G A;  1R4N B;  4JV1 A;  4A93 G;  3RTX A;  3L00 A;  4HQE A;  1JUP A;  3M8E A;  4G6T B;  4JP0 A;  3TL4 X;  3N41 B;  1P4A A;  2O8K A;  4LB5 A;  5DLG A;  3AG1 H;  4R1H A;  4RGX A;  1N77 A;  4NC6 A;  3CCU I;  2XPW A;  1P6R A;  3ZRG A;  3WG7 H;  4KT6 A;  2VPS A;  1OCZ H;  2A61 A;  2CS3 A;  2CWE A;  3G4S I;  2NVT J;  2UV1 A;  4XBF A;  5BWU A;  4GC7 A;  1WJC A;  3L4K A;  3PQJ A;  3FX3 A;  1HW2 A;  2WB1 A;  2W6P A;  1PUE E;  2ZO4 A;  3BG7 A;  4YIF A;  2VQL A;  3JRW A;  1SAX A;  1T0F A;  2EJ2 A;  5L3C A;  4EAT A;  1TNT A;  5EZH A;  5DM6 F;  3N40 P;  4CCO A;  4E7K A;  3TII A;  2V9V A;  4A2B A;  4FFL A;  4IVN A;  3I9V 2;  3CF5 F;  4PJ0 C;  2VI6 A;  2PMZ N;  4FFM A;  3GFI A;  1YJ9 I;  2ZME C;  2QA4 I;  4Q0Y A;  4DYR A;  2Y2Z A;  1RC9 A;  1X4P A;  2EA4 A;  1XTA A;  2VQH A;  4E70 A;  2DAA A;  3PO2 G;  4DR4 H;  5D1O A;  5K5O A;  5D6E A;  5GPC A;  5M3F J;  1MMA A;  3R0A A;  1O57 A;  3E97 A;  1R1V A;  4MFE A;  3CCL I;  2AS5 F;  1M0T A;  1I50 A;  2R7N A;  4YR0 A;  3UKG A;  3CDI A;  3VA7 A;  4RB2 C;  4M9Z A;  2FF4 A;  1DV1 A;  4NLG A;  4RB3 C;  4AQY H;  4JI1 H;  4IAJ A;  3KYC B;  5I47 A;  2OZU A;  1R9T J;  3GTJ J;  1IV8 A;  5HS7 A;  5JVT A;  4PZ7 A;  2W9C B;  2BV6 A;  1MBE A;  2R7F A;  1HKS A;  3BTC A;  1G3Y A;  2FNA A;  1GT0 C;  3MZH A;  1CKO A;  4BXX J;  2BY1 A;  4BHC A;  4HX4 A;  3FXK A;  3OYK A;  3VPC A;  4B3S H;  5LLQ A;  1S8N A;  3JRD A;  3N97 A;  1E0E A;  1ZQ7 A;  1P9Q C;  5E8I A;  2X1C A;  1UHM A;  2DK5 A;  3FM5 A;  1QHH D;  3ZPL A;  1EZ1 A;  4YY3 H;  5KFI A;  2P8T A;  3GTQ J;  1FSH A;  3L2Q A;  2RNJ A;  4Q43 A;  4LF4 H;  3MJF A;  2F4I A;  2JUC A;  4L9N A;  4JX5 A;  5A2Q Z;  2YU9 A;  3H9Q A;  2VJJ A;  3L09 A;  2EV0 A;  2RAE A;  4M9U A;  3G6X A;  1KEE A;  1JTY A;  3HKZ E;  2KIS A;  5BPD A;  2C2E A;  1S7A A;  1ZH5 A;  4X66 H;  4AVP A;  4NZM A;  4HZF A;  4ENM A;  5EGO B;  4D5F A;  4TV8 F;  2E2H A;  1K83 J;  5DGA A;  3I4N G;  4ETS A;  5LFA A;  2W48 A;  2HYJ A;  3LML A;  2QSF X;  5LRS A;  3JZI A;  1M0W A;  3F8C A;  1HA8 A;  4Q4C A;  2FNP A;  4YJ2 F;  1E4F T;  3I4P A;  2JA8 G;  5CPR B;  4J01 A;  1OR7 A;  2K27 A;  2O7O A;  2Q0O A;  3P9I A;  5J6X A;  2Y4R A;  1K1Q A;  4W97 A;  5KG0 A;  1J75 A;  5C4X G;  3K4N A;  1MKM A;  3V8L A;  3T8T A;  1R5H A;  3GEZ A;  3HO8 A;  2ADU A;  2COM A;  2FBH A;  2PMZ A;  1EKE A;  4M71 A;  2NVY J;  3OY9 A;  2HGX A;  5C1P A;  3C2G A;  2YU3 A;  2L54 A;  2L0K A;  5KCM A;  3R9R A;  2WTF A;  3RSN A;  2A1H A;  1M7J A;  3JRI A;  4APM A;  1R00 A;  2DMN A;  2QKL B;  3GV8 B;  1VQP I;  1W36 D;  2X51 A;  4BJ6 C;  2DFE A;  2R8K A;  1AU7 A;  3JZ6 A;  1H9G A;  3ZMS A;  2COJ A;  1ETX A;  1KYW A;  4XRS A;  1IYE A;  3NBZ B;  2LSO A;  2QLZ A;  4CKE A;  4CCN A;  2CW0 F;  4EGZ A;  5I5V A;  3S24 A;  5HLG A;  2QKM B;  2VT3 A;  2YR2 A;  3B6A A;  3WOD F;  2K9L A;  2JRT A;  1ETK A;  1A0G A;  3D1N I;  4J9N A;  4A3B G;  5EYR A;  1KJ8 A;  4ED8 A;  3GTG J;  2ZDH A;  4AIJ A;  2N8G A;  1I2K A;  5KK1 A;  1GVJ A;  4P55 A;  5B5E C;  1OBD A;  4DNC A;  2DQL A;  2XPU A;  3TY8 A;  3DBL B;  3DTG A;  3E7L A;  1YS7 A;  2W82 A;  5KG5 A;  4BBS G;  5JH7 F;  1ZGA A;  1S0M A;  3W1G A;  1WCM G;  3F8B A;  2E19 A;  4C9Y A;  4QW8 A;  1GHC A;  3S2D J;  4A2U A;  1YFH A;  5DD4 A;  3E6C C;  2WA0 A;  4X65 H;  2ELJ A;  3M1C A;  2V1N A;  4HBL A;  3SEZ A;  3W6K B;  2XF7 A;  1TNS A;  2XAQ A;  3HOY G;  1RKW A;  2ME6 A;  3SZG A;  4ESF A;  3Q0V A;  4ZDP A;  2ZDQ A;  1Y56 A;  2HR3 A;  5JLW A;  5F9N A;  3CO7 C;  3EPI A;  1BOA A;  4XIC A;  3NBY B;  2VOO A;  3QWU A;  3FMQ A;  5FKL A;  1WR2 A;  1BN5 A;  1VQ8 I;  2GXA A;  5FKM A;  3V8J A;  4IOA F;  4DLK A;  4IOC F;  1A0I A;  2ATL A;  3BQY A;  5BPH A;  2UZK A;  4HNV A;  3K69 A;  3ZQF A;  5LOV F;  4QWE A;  4G9Y A;  2QB5 A;  1R1U A;  2HZT A;  3RBD A;  4XYL B;  3FK6 A;  3AL0 C;  3BJA A;  3RZD J;  3OYI A;  1G3T A;  3MKW B;  2MG4 A;  5FKK A;  2JK3 A;  4MV1 A;  5AIP A;  4RNM A;  3S2W A;  4PZ8 A;  4IF4 A;  5HVQ C;  3ML6 A;  1D1B A;  2KL4 A;  1HBX G;  5LL6 b;  3GIK A;  2BQR A;  1I3Q J;  2MD5 A;  4RGS A;  4DIQ A;  3RR5 A;  2V4R A;  5ED4 A;  4NZN A;  4BQO A;  1FKA H;  2VKV A;  1TA8 A;  1I39 A;  4EQQ A;  3GW2 A;  1YG2 A;  1KUT A;  2QF7 A;  1WQ2 A;  4PGG A;  2E1M C;  1HW5 A;  5J8F A;  1F5T A;  2WAE A;  3GTK A;  1KT8 A;  3QYF A;  1RR8 C;  5D8L B;  2R8I A;  1LEB A;  2ODT X;  4II3 A;  4XRM A;  5DD8 A;  3QOP A;  1A31 A;  1DQU A;  1MSE C;  3TO6 A;  3M9A A;  1U8R A;  2VOB A;  4LGW A;  4P5O A;  4B3A A;  2B63 A;  1TC3 C;  4FBT A;  2X6X A;  4DIM A;  2VBZ A;  3LQR A;  1S72 I;  3UR3 C;  4M0J A;  3RKX A;  2HHF B;  2IAI A;  4EFB A;  1XSX A;  1RKT A;  2ID3 A;  3DXJ F;  3M07 A;  3V8K A;  1WVR A;  3VDX A;  4R8U B;  3SI8 A;  2FQ4 A;  2HQR A;  2IEK A;  3H3V H;  2HTJ A;  4MTD A;  1AUV A;  3G1O A;  1FOX A;  4Y7N J;  2HDW A;  3ZN0 A;  3TW7 A;  1TQI A;  3BOQ A;  2JEG A;  5GAH J;  1FSE A;  1VQ7 I;  3FWE A;  3O2P E;  5J47 A;  2NVQ J;  3Q9V A;  3T5J A;  3H3U A;  1CGP A;  2Y75 A;  2A69 F;  2JEI A;  2Z99 A;  2Y0S N;  3CUO A;  3PO3 J;  1Y14 B;  3OSN A;  4R7R A;  1XSV A;  2M9H A;  4ZH4 F;  3LA7 A;  2AGO A;  1U78 A;  1W5S A;  2OWO A;  4L9J A;  4GKJ H;  2IXS A;  2BXY A;  3H0G A;  2PN6 A;  1J2X A;  3LMM A;  3ZGK A;  5GTH C;  1ZRE A;  1E4G T;  1EH8 A;  4B3M H;  2EB7 A;  2KRH A;  4IHX A;  1RR7 A;  1FOW A;  2E35 A;  1G2W A;  2DDB A;  5BYB A;  3RV4 A;  1U6G A;  2HG8 A;  4UCT A;  4E7L A;  3T54 A;  2FJZ A;  2IMW P;  4ABZ A;  4BQA A;  2OTJ I;  4BXU A;  2V59 A;  2XCA A;  3HOZ G;  1ZHF A;  3ESW B;  4IHJ F;  5J4V A;  1Q1V A;  5IY5 H;  4W1U A;  4I09 A;  4ENK A;  1RJQ A;  3KP4 A;  3KYH C;  3MFI A;  1UCR A;  4A93 J;  3KX2 A;  4Q44 A;  4UCR A;  3F6V A;  2FLN A;  2AHQ A;  3U21 A;  5JHF A;  2KIM A;  1U5T B;  2X85 A;  3V7R A;  1W0U A;  1IW7 F;  2QVO A;  1JKJ B;  2R7K A;  4U87 A;  4ECW A;  4HX7 A;  1NK2 P;  4XM3 A;  2D1V A;  3V7C A;  4I98 B;  4BWS C;  2BW3 B;  3ZXS A;  3HDD A;  4A3G G;  4L0Z B;  3VYR B;  5E18 F;  2HQA A;  5K7F A;  2DA7 A;  3WU1 B;  3S3M A;  3FK7 A;  5EDW A;  1R36 A;  3FXQ A;  2XGP A;  5FRO A;  1I6H J;  3HRT A;  3P9K A;  2VAS A;  4Z2Y A;  2DT6 A;  4M3G A;  5ICE A;  4ZDL A;  3HT5 A;  4H4K C;  2XV4 S;  3HJE A;  4MLO A;  1R6R A;  1QPM A;  2MW8 A;  3FHN A;  4KA4 A;  1I50 J;  3S15 J;  3I3L A;  4ITV A;  1BM9 A;  3ECO A;  1S9H A;  1GLN A;  3BJO A;  4O7Z A;  1WI9 A;  2E5L H;  3T5X A;  3W2W A;  3I53 A;  3J7Z I;  3ROU A;  3ERE D;  1Z67 A;  4RS8 A;  3OL3 A;  3GIP A;  4OWR B;  4R8H A;  1TZL A;  4B3T H;  4FS1 A;  1JDE A;  1N36 H;  2R7O A;  4XQF A;  5M5X J;  5BOX A;  3RB4 A;  2R92 G;  3PNV A;  3IV5 A;  4K6N A;  1YRN B;  1GDT A;  2IA2 A;  4YEL A;  5HDG A;  4EYI B;  3GFL A;  4YII A;  5KFQ A;  1SD4 A;  2JN6 A;  2Y0S A;  3VFZ A;  3MWM A;  3ORR A;  2GOM A;  4U0W A;  2W85 A;  3ZQ7 A;  1HR0 H;  2UUB H;  1ZHQ A;  4A3D J;  1P16 A;  2F6C A;  5HLT A;  1GO3 E;  1O3Q A;  4AYB N;  2DU9 A;  4N9I A;  1Y1W G;  2EK5 A;  5E20 A;  2GOX B;  1FBQ A;  2KJC A;  4O7N A;  3H4B A;  4A3K G;  2JSC A;  1D8K A;  1MMN A;  3LST A;  3TP3 A;  3KET A;  2VUM A;  3T0Y A;  3LAP A;  3H1C A;  3MFH A;  3LWF A;  2M5W A;  4IPA A;  4C2M A;  4JI2 H;  3KHR A;  4UVB A;  2XSD C;  3ZMT A;  2R92 A;  3A03 A;  4MV6 A;  5A2Q W;  2YU9 J;  4HA8 A;  4KIG A;  1MMD A;  4NC7 A;  2HGW A;  1OIS A;  2RDI A;  2E36 A;  4TV7 A;  5HS9 A;  3E6D A;  3FXJ A;  4FFO A;  3QOE A;  3W6J B;  4UXN A;  4LB6 B;  4PSW A;  3CJQ B;  5A2Q K;  2HOT A;  2E2H J;  3UZB A;  4FGR A;  2GQQ A;  3IN5 A;  3OHA A;  3WO0 A;  2LBF B;  2ACJ A;  4RB1 A;  4EEY A;  2VBY A;  3CJT B;  4HF1 A;  4DQ2 A;  3PR4 A;  1OKR A;  5F27 A;  3GLX A;  4IZO A;  4RM2 A;  4ED3 A;  3DTK A;  2X0L A;  3DQV C;  5L1J A;  1Z3X A;  4FS2 A;  4O7V A;  4YR2 A;  2FU4 A;  4J9M A;  2M30 A;  3Q0U A;  1SFU A;  2DPI A;  2ME0 A;  3K4B A;  4RA2 A;  4CZZ A;  4GLW A;  2DI3 A;  2M45 A;  2FBI A;  3SEQ A;  5J4Y A;  1G59 A;  1SFX A;  2LDU A;  4MNU A;  2BY3 A;  1MW7 A;  1PUF B;  2UUC H;  2R5Y A;  1RK6 A;  1LJ9 A;  4ESJ A;  1R58 A;  3ZQH A;  4L5J A;  3JRE A;  1FT9 A;  5LA6 F;  4D1Q A;  1GSO A;  2UXX A;  3S3N A;  3QZ7 A;  1S0O A;  2KFD A;  3OYJ A;  3DU5 A;  1OCT C;  2D2W A;  3KEO A;  1MNM C;  4TUY F;  3E5X A;  2NXN B;  2XSJ C;  5FLX Z;  1A48 A;  4DV4 H;  1FMV A;  1X2M A;  2VA2 A;  2BVM A;  2AU0 A;  1RZ4 A;  3V4Z A;  2O03 A;  1Z2P X;  4DL2 A;  1B9M A;  1HNZ H;  4BY7 J;  1W93 A;  4B44 A;  2L7Z A;  2K40 A;  4EJT A;  2JRM A;  4IQJ A;  2NU7 B;  2V5A A;  2CV1 A;  2R82 A;  4O3Q A;  3WE2 A;  2VQF H;  4ZYA A;  5E3O A;  4UVA A;  1B6A A;  2VKD A;  3J80 W;  4AYB A;  3E6M A;  5F1J A;  2MC4 A;  2LKS A;  3DEU A;  4DV1 H;  2P4W A;  1E3P A;  3LA3 A;  5HV6 A;  1J09 A;  4PZJ A;  4JYA H;  2DA4 A;  1MSF C;  4F4W A;  3T9B A;  2OPT A;  5HBR B;  4U7C A;  2VQE H;  2HTS A;  3J80 K;  2VQD A;  3GV7 B;  1VF9 A;  4M3B A;  2Z3Y A;  5KAI C;  1LE8 A;  3FM3 A;  2KQR A;  1S10 A;  1S7O A;  4CCK A;  2EIM H;  2YZG A;  3DF7 A;  2IW5 A;  2KIU A;  4XOT A;  4XKV A;  4RAZ A;  2PMU A;  2O0Y A;  4M73 A;  2IJL A;  5KG4 A;  4YFN F;  3GIL A;  3F9K A;  1WJF A;  5EWF A;  2RV8 A;  4WD3 A;  4NQW B;  3ABU A;  1DP7 P;  1UFM A;  1FP2 A;  1R4M B;  3SJM A;  2D1H A;  3UZO A;  3RGX A;  5I5T A;  4ED0 A;  2PEX A;  4FFN A;  4JYK A;  3OYE A;  4KMF A;  5FRM A;  1X1B A;  3ORQ A;  1I3A A;  3DBR B;  4DL5 A;  3ZMZ A;  3HOW J;  4DR5 H;  3S1Q J;  3BP8 A;  3RB3 A;  3N43 B;  2NS8 A;  3PIO F;  4XZ3 B;  5F0H A;  1CKN A;  1JT0 A;  3TEK A;  3DAA A;  1YIO A;  2VJ4 A;  4ZYG A;  2TCT A;  1KZH A;  2F4O B;  5IOY A;  3AKZ A;  4RU9 A;  2WC2 A;  5D6F A;  2ABJ A;  4F93 B;  1JKO C;  2CH0 A;  5KFK A;  4RCN A;  1QVU A;  2E60 A;  3KIO A;  5KAF C;  3T9C A;  1H88 C;  5EEH A;  2R7V A;  3Q9S A;  2L5Q A;  4IHT A;  1OBG A;  5E1Z B;  1VAJ A;  1XD7 A;  4F4X A;  2MLK A;  1IRF A;  1G3S A;  4RLF A;  3BQ0 A;  3DTE A;  1SCU B;  5EG0 A;  3VYT B;  1OWT A;  3GTK J;  5J2T F;  2DDA A;  4Y33 A;  3QFF A;  4IWY A;  4LF9 H;  2E1O A;  2JZY A;  3X2Q H;  3MZY A;  1OJL A;  3BC8 A;  1S03 G;  4IRK A;  3RV3 A;  2DT7 B;  4ZTJ A;  5D1O B;  2GLO A;  3IP4 B;  2B63 J;  5KFZ A;  1X58 A;  4RMN A;  3CC2 I;  5LYJ F;  4KIT B;  1HLV A;  3MMY B;  1C30 A;  3OUU A;  3HHG A;  2XC9 A;  1XGM A;  4A2A A;  3DF8 A;  1KJQ A;  1YW8 A;  1S6L A;  2XGC A;  4Z6Y A;  3ZQL A;  1BXR A;  3BA8 A;  5CAE B;  1IBL H;  3H5R A;  5EOY A;  1D0Z A;  4XKC A;  3NAU A;  1X3U A;  3HOX J;  2ZJ2 A;  1DPR A;  1O7F A;  3CQZ A;  5HNE A;  5DQH A;  4MEY F;  2CJJ A;  5BWT A;  1LDD A;  3R23 A;  1RJR A;  4DV0 H;  3CC7 I;  2JJ7 A;  5JHU A;  1QNT A;  1UMQ A;  2IGN A;  3JRC A;  4PDK A;  3H0G J;  4GRI A;  4LLL A;  5BWX A;  2PVP A;  1FX7 A;  2V26 A;  4XN3 A;  2QGU A;  2XUB A;  4E6K G;  1V4Y A;  4PWQ A;  3N42 B;  2R7M A;  5IYD J;  1GXQ A;  4TM5 A;  2W4S A;  4DJA A;  3TDZ C;  3WU2 C;  4QWB A;  2ELK A;  4GC6 A;  4DR2 H;  3ABM H;  1S97 A;  4LF8 H;  2GM4 A;  1XN7 A;  1W4M A;  1ZHS A;  1G4D A;  1T39 A;  3WTX C;  2STT A;  4QIW N;  3OOP A;  4XLA A;  2LKX A;  3SHF A;  1WZ2 A;  4E6N A;  1IYD A;  2VLA A;  3FDY A;  1UAA A;  1YYV A;  1HCR A;  5GP9 A;  1DUX C;  3AG3 H;  3UYY A;  2M8E A;  3SZT A;  1MDM A;  4BYY A;  2XD4 A;  5I5S A;  5KG7 A;  2RQQ A;  2IVM A;  2JA5 A;  1QZY A;  2DLL A;  3MR3 A;  3HOZ J;  3CD6 I;  3CEB A;  2L4M A;  2Z1D A;  4FIS A;  2ASJ A;  5L1I A;  2LBF A;  5CA1 F;  2RC4 A;  2L9S A;  1P2F A;  5GAD J;  2MC3 A;  2XF6 A;  3CES A;  3ZN1 A;  2QEX I;  5KFP A;  3BJY A;  1W96 A;  1O75 A;  2I10 A;  5D4S A;  5F0F A;  4HDU A;  4I76 A;  1CQJ B;  2K4B A;  1P7J A;  3FBI B;  4B1R A;  3J7Y J;  4U0Y A;  2R93 A;  4EEQ A;  1ULZ A;  4ECY A;  3V6J A;  2FLL A;  4BE2 A;  1ZLK A;  2JA2 A;  1D3Y A;  4I02 A;  2FJ1 A;  4HW0 A;  2XVC A;  3CCE I;  4M3E A;  4O7S A;  4ECT A;  3ABT A;  2BQU A;  4KIS A;  2IS1 A;  1FEX A;  4LK0 F;  5LGT A;  2UUA H;  4E7H A;  2YX7 A;  2K9Q A;  1IN8 A;  5C4J J;  5IYB J;  3GV5 B;  4J9O A;  1N48 A;  4CIC A;  1U2W A;  3ZMU A;  3RF2 A;  1MND A;  1RYS A;  3BRO A;  2M0M A;  2EFP A;  4YFX F;  3PUB A;  3PSF A;  1KU7 A;  1BL0 A;  4DL6 A;  2IA1 A;  2P5L C;  5KFL A;  3IWZ A;  3CLQ A;  2CV2 A;  2VUM J;  4C2M J;  4HSR A;  3BPX A;  4J19 A;  2K4J A;  4MV3 A;  2R92 J;  1F43 A;  1X1P A;  3LSK A;  4BL0 B;  4KYW A;  1TWC A;  1R5I D;  3W2A A;  3Q1K A;  1UZC A;  2XGE A;  4C2U A;  2F5D A;  2NYX A;  3OHB A;  3JCU C;  1MBJ A;  4Y8V B;  2E71 A;  3CCV I;  4RZR A;  2DAB A;  5FKO A;  1XB4 A;  5TIS C;  3GIQ A;  4OX9 H;  3KYL A;  1YE9 A;  1QO0 D;  3LWB A;  1SFO A;  2KP6 A;  2VL8 A;  3K2Z A;  2DTR A;  5DCM A;  4QIW A;  5J8C A;  4F7Z A;  1KYZ A;  4PSX A;  1W0T A;  1MBF A;  1ZRC A;  3BAC A;  5CJ9 A;  4JI0 H;  4IIJ F;  3ABK H;  1VQM I;  2WB1 E;  3BJ6 A;  2FX0 A;  3CCJ I;  3WO1 A;  4FE4 A;  4CXF A;  1BIB A;  1ON1 A;  1LFP A;  3JRG A;  1KQ0 A;  2V9K A;  4PBC A;  3OIQ A;  2R7U A;  1A6I A;  4C5B A;  5HNF A;  2ALZ A;  4MV7 A;  1O3R A;  4F4Y A;  1S0N A;  5AIQ A;  4HST A;  1B59 A;  1ULY A;  3KRE A;  5FRN A;  2BGC A;  3HRU A;  2H8R A;  2HOE A;  3S32 A;  1XGN A;  4YBZ B;  5DTD A;  1I27 A;  4CH7 A;  2LTP A;  4QPO A;  1W5T A;  1BBY A;  2E34 A;  1DGS A;  2WAQ N;  2CW8 A;  2FD5 A;  1AN7 A;  1M6V A;  3T7A A;  2BE5 F;  3WTW C;  2ZXI A;  3W3C A;  4AC0 A;  3RI4 A;  5DAA A;  3K4L A;  5EEG A;  1TWA A;  2QQA A;  1CQI B;  5CB4 F;  5D4R A;  3OIO A;  4HLY A;  4N0B A;  5DS9 A;  2EIJ H;  4YEJ A;  2GAU A;  3EUH A;  2R0Q C;  2X4H A;  1XC5 A;  2X1D A;  1U8B A;  5DQG A;  4P1W A;  1NH3 A;  2LVS A;  4PFO A;  2CUE A;  2LMD A;  2R7S A;  2KZG A;  5K3W A;  1SVO A;  1CE8 A;  2EQR A;  5FNV F;  2M05 A;  1N34 H;  1TWG A;  3CDH A;  4RUC A;  2E5Z A;  2LRD A;  3G73 A;  2MCT A;  4M6Y A;  2DBB A;  3DLL F;  4OMY A;  1KU9 A;  2YZN A;  3K70 C;  4JI4 H;  3RGZ A;  1PVE A;  3BLY A;  3KLN A;  2CFO A;  5DUK A;  2E7W A;  2Z16 A;  3BR5 A;  3WG9 A;  3S2H J;  2DIK A;  4D0P A;  4YAJ B;  1K79 A;  2Y0M A;  4KNY A;  2HS5 A;  4IQ4 A;  4ESB A;  5KFY A;  2LOO A;  3FBN B;  1PP8 F;  3S14 J;  2BYV E;  1R71 A;  4BE0 A;  4RDU A;  2HYG D;  2FK3 A;  5HNH A;  2WWY A;  1P4X A;  4O4I F;  1RI7 A;  4A3D G;  2FPP B;  2QQ9 A;  1BR4 A;  5IOZ A;  3T9F A;  3M9M B;  3D5S C;  1VS0 A;  3RPU D;  2HJW A;  1FWZ A;  3VEP A;  4CYD A;  3QRF F;  1DAA A;  3BR3 A;  1WHU A;  4A0X A;  5JQG F;  5B3S H;  3VB2 A;  3OYC A;  1P7I A;  5CM0 A;  5EWG A;  2DOA A;  4QSH A;  3OR2 C;  4GYI A;  2DWC A;  1BJA A;  1XX5 A;  4Y15 A;  2VE8 A;  4V2F A;  3R5X A;  2NOJ B;  1FYM A;  1Z6R A;  1XGS A;  4JI5 H;  1WGX A;  2Y48 A;  1FTZ A;  3HUG B;  3QPS A;  1SYX B;  1J5Y A;  3VPD A;  4IRG A;  1RRJ A;  3L2R A;  4K2E A;  2OU2 A;  3GIJ A;  4ZTF A;  2R7Z A;  5DLF A;  3LSI A;  1X3Z B;  3L1P A;  4B47 A;  4HDV A;  4LG3 A;  4DV3 H;  3HGG A;  2WY8 Q;  3RYR A;  3JRB A;  4G8X A;  3OYG A;  2UVU A;  4LIU A;  3HOV J;  2PMZ E;  3R4K A;  4O4L F;  3FXO A;  2WAQ A;  3BR0 A;  5FD5 A;  2I80 A;  2O5R A;  1V9P A;  2ZXW H;  5JQW A;  1GV2 A;  1G2H A;  1QBJ A;  1O7L A;  1ONV A;  2ESN A;  4C2T A;  3J7A O;  3JTH A;  3MWE A;  2V58 A;  2K5C A;  1POG A;  4HLX A;  5FJ8 J;  2HQN A;  5L9X A;  3FDS A;  4O3N A;  1VTN C;  1YIT I;  3NEU A;  1BR2 A;  2W24 A;  1T95 A;  2MD0 A;  3DBH B;  4L5E A;  3GTO A;  3E5Q A;  4G94 A;  5HS8 A;  3TY9 A;  2EJ0 A;  1UNN C;  4J9S A;  2H8W A;  1UJ8 A;  3GZ5 A;  1T56 A;  4CYC A;  4DW6 A;  5M3M J;  2X0S A;  2DZD A;  3BZ6 A;  3I54 A;  4HOB A;  2OCC H;  5D5U B;  3T9D A;  2YW2 A;  2UUZ A;  3WTZ A;  2BQ3 A;  2LD5 A;  1Y1V A;  4FHT A;  3GLL A;  1PX2 A;  1N56 A;  1JGS A;  2V4J C;  4XRS G;  1QRY A;  4CCJ A;  3O8H A;  1TBX A;  4NC8 A;  1IN7 A;  3QP6 A;  4CHU A;  3L2W A;  1VBG A;  3PQK A;  1IRG A;  1SVM A;  3WU0 A;  4O3O A;  5DG7 A;  4D5C A;  4AM3 A;  1LEA A;  1LQ1 A;  4BY7 G;  4ZOL F;  2HI3 A;  3KAK A;  5HLI A;  4I99 C;  4HYE A;  1BOB A;  2K3P A;  3T1B A;  4ZJZ A;  4WXH A;  4LFB H;  5L3E A;  3PW0 A;  3CQZ J;  4M3D A;  4LH6 A;  2HWV A;  4B3R H;  1I1K A;  1OYW A;  2HNH A;  2FRH A;  3K9T A;  1FOK A;  2F48 A;  4XLH A;  5KG1 A;  2BXZ A;  5DUI A;  1S5L C;  1MJA A;  1IJW C;  4BHP A;  4O2A F;  2EFN A;  5IP6 A;  4AIK A;  1D0Y A;  4IRD A;  4O3P A;  2ETH A;  3A01 A;  5EZG A;  5DIS C;  5KFC A;  3Q0W A;  3GZN B;  4F91 B;  3GDE A;  1T0F C;  2IBK A;  3HTS B;  4XNF A;  3G1M A;  3F72 A;  1H89 C;  1ZR2 A;  1KC7 A;  1ZGJ A;  2J5P A;  4EGQ A;  3GJX B;  3KAL A;  3RJ0 A;  1YS6 A;  1IDY A;  2E5N A;  3F3X A;  4ED6 A;  5KFH A;  5FPO A;  1L3L A;  1TWH A;  2YCH A;  2FK2 A;  3RBE A;  3EUA A;  4JUZ A;  2P5K A;  4O6J A;  4OIN F;  2DPU A;  2OAZ A;  1PK8 A;  3HOW G;  4LFC H;  2OV7 A;  2DK8 A;  4IHY A;  2JA5 J;  1OPC A;  5IT9 W;  1FP1 D;  4JBA A;  4O83 A;  1R5G A;  3KZZ A;  3PUF A;  3RB6 A;  4IR9 A;  1UEL B;  3BR1 A;  1Y8R B;  2JTV A;  4NXN H;  1EUD B;  2WBM A;  4EFE A;  5IT9 K;  4UCV A;  2R5Y B;  4F55 A;  2X1E A;  1AKH A;  3C2B A;  1IBK H;  3P5J A;  2QQB A;  4EJU A;  3MR6 A;  3GIM A;  3ZMV A;  1HNW H;  1Z2O X;  3M9O B;  4J9P A;  3D0S A;  2PBI A;  3JRH A;  4F50 A;  1DGR M;  1MJ9 A;  3TQN A;  2R93 J;  1J0R A;  2O8X A;  3RKQ A;  4HR7 A;  4DBQ A;  1K4T A;  1B8I A;  4OIO F;  4MV8 A;  5D8D A;  3G6Y A;  3I71 A;  4RLQ A;  3FMS A;  1EV7 A;  3FXR A;  4ON0 A;  5BWR A;  2W1O A;  2R5Z A;  3PL8 A;  2NNY A;  2M1B A;  5HDN A;  2L9V A;  4BJ5 C;  2B63 G;  5E3M A;  3HYI A;  1XMA A;  2EPF A;  4FQG A;  1W1W E;  2QK4 A;  4MV9 A;  4J00 A;  5KFM A;  5DV5 A;  1FBU A;  3TO7 A;  1N33 H;  3ERM A;  3CMY A;  2RQP A;  2XDV A;  3UNG C;  2RGR A;  1IG7 A;  1U3E M;  4PJL A;  3EYI A;  3JTG A;  1NG7 A;  2AQ4 A;  3M3Y J;  2JA7 A;  4JX4 A;  1TWC J;  3AG2 H;  1BA5 A;  2KZV A;  3HOX G;  3CCQ I;  3T5K A;  3JRF A;  3MFK A;  2DA1 A;  1LE8 B;  3DFG A;  3FIW A;  3O3K A;  5IT3 A;  4L5I A;  1G8X A;  1LDJ A;  1N25 A;  2IS4 A;  1OR7 C;  3DU6 A;  2W84 A;  3D5R C;  4O3S A;  3IWF A;  3MAJ A;  2I5U A;  2NRA C;  3LFK A;  3T8R A;  3KFW X;  1SFO J;  3H0G G;  2P81 A;  2K9M A;  4F92 B;  2D5V A;  4CC6 A;  3FXM A;  2W6M A;  3S16 J;  4RZQ A;  1J7K A;  5IP7 J;  4IKF A;  1MIJ A;  2OQR A;  1YI2 I;  1TQM A;  4IHW A;  5IYD G;  5CVI A;  4A3L J;  2ECC A;  1Y0U A;  3LAJ A;  2CSO A;  2MLG A;  1TW3 A;  3FXU A;  3OYL A;  2DA2 A;  2OUM A;  1IDZ A;  4YAK B;  1EF4 A;  1V4R A;  4F52 A;  3MN2 A;  4NBQ A;  4YIR X;  1VFC A;  5K5Q A;  1TAE A;  4LIV A;  1CKN B;  2W8K A;  4J9L A;  3EPZ A;  4IHS A;  4LSX A;  3HGY A;  3HBL A;  4MGR A;  3U9S A;  4HRI A;  3WTU C;  5GAG J;  3RYP A;  1XDN A;  3GX4 X;  4II2 A;  3TY5 A;  3EUK L;  3HUG A;  1TWA J;  2I8C A;  1TL8 A;  2UXN A;  2XAS A;  5H20 A;  4PUS A;  3FIS A;  3TP0 A;  3VYS B;  4H0E A;  1DU0 A;  4O2B F;  3TQ1 A;  1ZLJ A;  2DOD A;  3TOB A;  5L1K A;  2CU7 A;  2DCE A;  4HF0 A;  4LD5 A;  4XMY A;  3ETH A;  1USS A;  5DG8 A;  1I5Z A;  3J7A K;  1WH5 A;  1XNR H;  1ORK A;  1QHG A;  2J6S A;  5EG0 B;  2QSG X;  1GSA A;  4FM9 A;  3N44 B;  2W57 A;  1ZAU A;  5ERI A;  5LP6 F;  3GTM A;  1TWG J;  2YYA A;  3HOS A;  2CQY A;  3RKY A;  4AUX A;  3OSG A;  5FGM A;  2K02 A;  3S93 A;  2R7L A;  2DXI A;  1XS9 A;  3JSN A;  3SGI A;  1IV6 A;  3RJP A;  3T1Y H;  2EBI A;  3I64 A;  3CSW A;  3TIN A;  1Z6T A;  4KIB A;  5TJJ A;  1K78 A;  1SD6 A;  4X1E A;  1YHQ I;  2BZT A;  4OMZ A;  3S1N J;  5IYZ F;  3IC7 A;  2MFZ A;  1I1S A;  4HYK A;  4YR3 A;  1XDU A;  2ECB A;  4ED7 A;  3T5L A;  1SVL A;  2MSY A;  2GA2 A;  3CCS I;  5IYB G;  2XRN A;  3BR2 A;  1MNE A;  2VOP A;  4O7L A;  2F5E A;  4ZC3 A;  5DGB A;  3CUQ A;  5J1U A;  2OTL I;  2BY2 A;  4GLX A;  1JJ8 C;  2VIX A;  4UCU A;  5CQG A;  5LHH A;  3H5A A;  1BJT A;  2QZ8 A;  3CJN A;  5T14 A;  3F6O A;  1F1Z A;  1EH7 A;  2A3S A;  4FCY A;  1X1C A;  2VUM G;  3CMA I;  3L9F A;  5K5R A;  5LEJ A;  3HOU J;  5BMV F;  3TMO A;  2W6Q A;  4MQ9 F;  3HRS A;  4Y13 A;  4YFK F;  4DQN A;  1JDB B;  1RES A;  3BCB A;  3VOE A;  4BS9 A;  4I6Z A;  4G7O F;  2FPG B;  4ZHQ F;  3RZO J;  2W70 A;  3I0T A;  1JUS A;  3H9G A;  1MH3 A;  3EYY A;  5KFD A;  1X19 A;  5E3L A;  3FXL A;  4HEA 2;  3G2B A;  3LL7 A;  5ICG A;  2DO7 A;  1ZG5 A;  2R7Z J;  1XG1 A;  3KYD B;  4GGG A;  5LHG A;  5K7H A;  4P9F A;  1IN6 A;  5JLX A;  3K0L A;  2NUA B;  4O5V A;  3H0D A;  2QUF A;  1TQP A;  5KT7 A;  4JOM A;  2AGP A;  2R8J A;  5KFA A;  2EA2 A;  3PIP F;  3BG5 A;  4JV2 A;  1D0X A;  3J81 Z;  4ZYH A;  2VBW A;  1ETY A;  2M87 A;  1ZAR A;  1XMX A;  1APL C;  2XIG A;  2CV0 A;  2XAH A;  2MH2 A;  3LFU A;  1MDM B;  2A6H F;  3OV8 A;  1OCR H;  2CW7 A;  3SFZ A;  4D9J A;  2VBX A;  5DM7 F;  2DPD A;  3GTO J;  2JA6 A;  3K5I A;  5K2M A;  9ANT A;  2ZM6 H;  2LFB A;  3ZP5 A;  5FKN A;  1OCC H;  2M34 A;  2ICW G;  3K6G A;  4LFA H; 
#chains in the Genus database with same CATH homology
 2IGN A;  3N40 P;  4CCO A;  4E7K A;  4B3X A;  4E7S A;  4BGD A;  4A2B A;  2BVL A;  3I9V 2;  4GRI A;  3T1H H;  2V26 A;  4XN3 A;  4HG2 A;  4E6K G;  4XN0 A;  1VZ0 A;  3N42 B;  2HGS A;  1AA7 A;  5CKT A;  5FPR A;  4Q0Y A;  2W4S A;  3F8N A;  4DJA A;  1X4P A;  2VQH A;  4U7B A;  4OAY A;  4DR4 H;  5D1O A;  4JI7 H;  4DR2 H;  2JUG A;  1MMA A;  4BU2 A;  2KRC A;  4LF8 H;  1M0T A;  2LG4 A;  4RB2 C;  1ZHS A;  3K70 D;  4Y3O A;  4RB3 C;  4E6N A;  4AQY H;  4XLA A;  4JI1 H;  1WJA A;  4IAJ A;  2VLA A;  3FDY A;  1X4O A;  3K4M A;  3OOU A;  4N4N B;  2M4G A;  1UAA A;  4PZ7 A;  5HOO A;  3ZR8 X;  2RQQ A;  4Y4R A;  3OS1 A;  1CKO A;  2W7N A;  3AFH A;  1L2Z A;  1IRX A;  2Z1D A;  3DPL C;  3OYK A;  1LDK B;  4UCO A;  2KSW A;  1E0E A;  4B3S H;  2LBF A;  4BEH B;  1P9Q C;  2L9S A;  5KNL A;  2XF6 A;  3CES A;  2X1C A;  3BCA A;  1O75 A;  1WJE A;  3ZQQ A;  1QHH D;  2ZFU A;  1FJG H;  4YY3 H;  2VQC A;  3FBI B;  4YRV A;  2R7Q A;  3L2Q A;  4LF4 H;  2HVQ A;  2F4I A;  2RRE A;  2JVG A;  3H9Q A;  1SFK A;  2VJJ A;  4EEQ A;  4LIT A;  4BE2 A;  2JA2 A;  3PNY A;  4HNT A;  2R7R A;  4DV2 H;  4IX7 A;  4B43 A;  3JSL A;  3BA9 A;  4LF7 H;  3S3O A;  4X66 H;  3HL2 A;  4X62 H;  4KIS A;  2IS1 A;  3OYF A;  3NC0 B;  2CMP A;  3GBG A;  2UUA H;  4E7H A;  4N4O B;  4ETS A;  5LFA A;  3L2V A;  3FKJ A;  1XK5 A;  4UFZ A;  2HVS A;  3LML A;  2WYO A;  3RIZ A;  3CZ6 A;  1QU3 A;  3RF2 A;  1MND A;  1D1A A;  1M0W A;  1HA8 A;  1E4F T;  4C30 A;  2M0M A;  3PUB A;  3PSF A;  5CPR B;  4J01 A;  4BDZ A;  3UQ8 A;  2LY1 A;  3K4N A;  3DWL E;  2CV2 A;  3HPH A;  1LKX A;  4HSR A;  4CA0 A;  4LH7 A;  3HC7 A;  4RB0 A;  2PMZ A;  3LSK A;  4BL0 B;  3OY9 A;  1S68 A;  3H5N A;  3C2G A;  3IAS 2;  5KCM A;  4LF5 H;  3W2A A;  3RSN A;  4C2U A;  4APM A;  4E7Z A;  3CP8 A;  4BJT A;  2QKL B;  2FE3 A;  3CVZ A;  1W36 D;  2X51 A;  4BJ6 C;  1KON A;  3IG0 A;  3L2U A;  4NXM H;  3KYL A;  4OX9 H;  1YE9 A;  2KP6 A;  2KHM A;  3NBZ B;  2L2O A;  2VL8 A;  4XKW A;  4CCN A;  3S24 A;  4IZZ A;  2OC6 A;  4PSX A;  2QKM B;  1V5G A;  4JI0 H;  2K9L A;  2VKH A;  4FAS D;  3ONQ A;  1N75 A;  2JSP A;  1LFP A;  1U0J A;  2V6E A;  4E4H A;  2V9K A;  3OIQ A;  2R7U A;  5HNF A;  4MV7 A;  3TY8 A;  2M3A A;  2W82 A;  3DKX A;  4HST A;  5FRN A;  3QYE A;  3W1G A;  4JI8 H;  3S32 A;  2R7W A;  4C9Y A;  4CH7 A;  4QPO A;  2Q2U A;  1DGS A;  4J0M A;  2WA0 A;  2A5W A;  1X1A A;  2CW8 A;  2ELJ A;  3M1C A;  1WJB A;  2V1N A;  3SEZ A;  3W5O A;  2XF7 A;  1AN7 A;  2ZXI A;  3W3C A;  2HIV A;  1X1D A;  3K4L A;  2UXB H;  3SZG A;  4ZDO A;  4ZDP A;  3K10 A;  3ZCO A;  3DPT A;  1UG0 A;  4AVZ A;  3VWB A;  1Y56 A;  4PZ6 A;  4YEJ A;  4BDY A;  3NBY B;  3OS0 A;  3QWU A;  2WAF A;  2X1D A;  4NUB A;  4PJN A;  4P1W A;  2M7A A;  4EQ5 A;  4PFO A;  1A0I A;  1Z21 A;  2R7S A;  3A4C A;  1N34 H;  2E5Z A;  2LRD A;  2MCT A;  4AU7 A;  4HPQ A;  2HHH H;  3K70 C;  4JI4 H;  3RGZ A;  3AL0 C;  2XF5 A;  4XOP A;  3BLY A;  3OYD A;  3OYI A;  3MKW B;  2CFO A;  2Z16 A;  2KDO A;  3LSG A;  2Q2E B;  4PZ8 A;  2XC7 A;  2HIX A;  4IQ4 A;  2PJR A;  5TGT A;  5HVQ C;  3BAA A;  2LOO A;  1D1B A;  2KL4 A;  4BAC A;  3FBN B;  5LL6 b;  4JI6 H;  4DIQ A;  1Z7L A;  4BE0 A;  3RR5 A;  4BQO A;  5HNH A;  2I8D A;  2WDT A;  3CP2 A;  1FKA H;  4DUZ H;  2R7T A;  1DGW Y;  1BR4 A;  1TA8 A;  3D5S C;  1VS0 A;  3RPU D;  3K4K A;  3D5L A;  1K6Y A;  1PYV A;  3IUO A;  4X65 H;  4XOR A;  3OYC A;  3N6X A;  2E1M C;  3OWT A;  2DOA A;  3OR2 C;  3C2H A;  2Q2T A;  2NOJ B;  5FD6 A;  2WAE A;  2RGV A;  3SDB A;  3OS2 A;  4JI5 H;  3QYF A;  3HUG B;  1SYX B;  4II3 A;  2L7K A;  3CF2 A;  3L2R A;  1DQU A;  2LC2 A;  3OR1 C;  4ZTF A;  2VOB A;  3LSI A;  4XL9 A;  4P5O A;  4B47 A;  4LG3 A;  2X6X A;  4X0G A;  5KHD A;  4DV3 H;  2WY8 Q;  3J7A Y;  3OYG A;  4DV5 H;  4LIU A;  3UR3 C;  2WAQ A;  5FD5 A;  4EFB A;  2LYC A;  2O5R A;  1V9P A;  3EYY A;  3VDX A;  2WAD A;  3PN1 A;  4MTE A;  4C2T A;  4MTD A;  3PJR A;  2VJ5 A;  2K5C A;  2HDW A;  2KLO A;  1BR2 A;  1T95 A;  2MD0 A;  5LD2 C;  3NWS A;  4DGW B;  4DRF A;  2LY2 A;  4XKB A;  3TY9 A;  4R7R A;  3OIP A;  3L4J A;  2OWO A;  3M8J A;  1W36 C;  4GKJ H;  2VXD A;  2UUZ A;  2IXS A;  4BXF A;  1LVK A;  1OLT A;  1Z2N X;  4PJM A;  2IS2 A;  4DV6 H;  3LMM A;  3ZGK A;  1E4G T;  2V4J C;  2LH9 A;  4CCJ A;  4B3M H;  2KRH A;  3OMY A;  4LSA A;  4NC8 A;  2IS6 A;  3L2W A;  3TBI A;  3FMA A;  4BEH A;  4UCT A;  4E7L A;  1V5F A;  3A2K A;  1X9N A;  2ZXH A;  2Q1Z B;  3RQ4 A;  3SYT A;  4HNU A;  3KAK A;  1I6U A;  3IAM 2;  1BOB A;  2K3P A;  4ZJZ A;  4CSW A;  4LFB H;  3KYH C;  3KX2 A;  4LH6 A;  1D1C A;  3QYB A;  1PJR A;  4UCR A;  4B3R H;  3U21 A;  5JHF A;  2HNH A;  1V5E A;  2X85 A;  2X6W A;  4R79 A;  4XLH A;  1TT0 A;  4U87 A;  3K4J A;  2XAU A;  4LMY A;  4XM3 A;  4RM3 A;  2P0W A;  4BWS C;  2F4V H;  2BW3 B;  3ZXS A;  3VYR B;  4DUY H;  1J5E H;  2HQA A;  3S3M A;  1D0Y A;  3LSH A;  5FRO A;  1WJ5 A;  2VAS A;  1EA3 A;  5DIS C;  4PK4 A;  2DT6 A;  4BQQ A;  4F91 B;  3GDE A;  1T0F C;  4XNF A;  4X64 H;  4ZDL A;  2IGM A;  4H4K C;  4MLO A;  2UU9 H;  1R6R A;  1DP3 A;  3FHN A;  2MYS A;  4DV7 H;  1NG6 A;  3I3L A;  4ITV A;  3GJX B;  1BGW A;  1S9H A;  1GLN A;  3E0J B;  3KAL A;  3C0F B;  3RJ0 A;  2E5N A;  4JV5 H;  2WE6 A;  2E5L H;  2L9N A;  4CUG A;  1ERD A;  5FPO A;  1MMG A;  3W2W A;  2YCH A;  3EUA A;  3OL3 A;  3HOT A;  4OWR B;  2VPL A;  1TZL A;  3VSL A;  4B3T H;  4LF6 H;  4JQF A;  1N36 H;  2R7O A;  3CMM A;  4XQF A;  3PNV A;  4LFC H;  2OV7 A;  5FLX W;  4YEL A;  4YHH H;  5IT9 W;  5LMN H;  2MAB A;  2Y0S A;  1HR0 H;  3MWM A;  2GOM A;  2ZSH B;  1B04 A;  2UUB H;  1UEL B;  1P16 A;  1ZHQ A;  2F6C A;  5HLT A;  4NXN H;  2WBM A;  4EFE A;  4UCV A;  2GOX B;  4F55 A;  2X1E A;  1MMN A;  3GB8 B;  1IBK H;  2BW3 A;  1HNW H;  1Z2O X;  4JI2 H;  3MKY B;  1DGR M;  2IGO A;  5A2Q W;  1S03 G;  2AQE A;  1GYF A;  1MMD A;  4NC7 A;  4NNJ A;  4DBQ A;  3AL0 B;  2ZJT A;  4KHP H;  4RLQ A;  3QOE A;  1Y6I A;  4KJZ A;  1HNX H;  4PSW A;  3CJQ B;  5D1P A;  2R4G A;  4DOZ A;  2W1O A;  3OYB A;  3PL8 A;  2LBF B;  3HG9 A;  4RB1 A;  1JI8 A;  3JAM W;  3OTO H;  4BJ5 C;  4QPQ A;  1I94 H;  1BR1 A;  4BUP A;  4RM2 A;  2CUZ A;  3DTK A;  3W1B A;  3DQV C;  4MV9 A;  1Z3X A;  4J00 A;  1N33 H;  3VYU B;  1Z3Y A;  4M7E A;  2DJI A;  2XDV A;  3RCO A;  3UNG C;  2RGR A;  4JI3 H;  2R7X A;  2HU9 A;  3K4B A;  2KMU A;  3BG6 A;  4PJL A;  2ZSI B;  1NG7 A;  3SEQ A;  1G59 A;  4CCL A;  4DR7 H;  4XLC A;  1SEI A;  2E1M B;  4RAY A;  1MW7 A;  5LMU H;  2VJI A;  1SAU A;  2KZV A;  2UUC H;  3A1Y A;  2CUJ A;  1YX3 A;  2F5V A;  2HPI A;  1G8X A;  3CJR B;  2IS4 A;  1OR7 C;  3DU6 A;  3KEY A;  4D1Q A;  3S3N A;  4PFP A;  3D5R C;  3DU5 A;  3OYJ A;  3M4I A;  1XMO H;  3OYM A;  1FVI A;  2LRE A;  1YX5 A;  2FUG 2;  4E7I A;  2K9M A;  4F92 B;  4CC6 A;  4OAZ A;  2XSJ C;  2CFM A;  2VXZ A;  4RZQ A;  4DV4 H;  1N32 H;  1FMV A;  3MKZ A;  4IKF A;  2JVH A;  2BVM A;  3L2P A;  4XLE A;  2O03 A;  1Z2P X;  1HNZ H;  4B44 A;  2KPM A;  3HPG A;  3OYL A;  4IQJ A;  3DTI A;  3DEE A;  4FET A;  2OUM A;  4B48 A;  2CV1 A;  2VQF H;  3LSM A;  4ZYA A;  4F52 A;  3DKY A;  1TAE A;  4LIV A;  1CKN B;  2AQF A;  3EPZ A;  2VKD A;  4LSX A;  4AYB A;  3J80 W;  4CZC A;  2MC4 A;  4PJJ A;  4DV1 H;  3PFY A;  4HRI A;  2M7B A;  4DR6 H;  1J09 A;  3VSK A;  4JYA H;  4ANJ A;  1XDN A;  4II2 A;  3TY5 A;  3EUK L;  2VQE H;  4F3Q A;  3KXY T;  1XNQ H;  3NWT A;  3OYN A;  5BR8 H;  4I7H A;  4PUS A;  5IWA H;  4XON A;  3HXL A;  3VYS B;  4DBR A;  3VNN A;  1XMQ H;  2KQR A;  3J81 W;  3MD2 A;  2M4K A;  4CCK A;  2DCE A;  4XMY A;  4BE1 A;  3DF7 A;  3J7A K;  1WJD A;  1XNR H;  4UCS A;  1QHG A;  2WY7 Q;  4XKV A;  4XOT A;  4RAZ A;  4FM9 A;  2HZD A;  3N44 B;  2W57 A;  2IGK A;  3PSI A;  3QOD A;  3HOS A;  2VUG A;  3F9K A;  1WJF A;  1FMW A;  4CCM A;  4NQW B;  3S93 A;  3H20 A;  2DXI A;  3JSN A;  3RGX A;  2A6T A;  4K0K H;  3S8P A;  3T1Y H;  3OYE A;  5FRM A;  1X1B A;  4BQN A;  3EUH C;  4DR5 H;  2UXD H;  2MFZ A;  1P8L A;  3N43 B;  1CKN A;  2W00 A;  4CC5 A;  2V7F A;  3HKZ A;  2VJ4 A;  4E7J A;  3N05 A;  1IBM H;  1MNE A;  4ZC3 A;  3AKZ A;  3W2V A;  2BOL A;  3PNT A;  4XR6 A;  2VB6 A;  4F93 B;  4GLX A;  2VIX A;  4UCU A;  2CH0 A;  3OYA A;  3E1S A;  5CQG A;  3H5A A;  1BJT A;  2E60 A;  2VQG A;  3K3V A;  1X1C A;  2R7V A;  4GKK H;  2L5Q A;  2X6Y A;  4RLF A;  1CKM A;  4PDB A;  3DLA A;  3TMO A;  3KAJ A;  3DTE A;  5CQE A;  3VYT B;  3H35 A;  1WFX A;  3BCB A;  1N78 A;  4Y33 A;  4BS9 A;  2PJR B;  4LF9 H;  2UXC H;  2UWM A;  3H9G A;  3BC8 A;  2HPM A;  1X19 A;  2Z2S B;  3DPU A;  4HEA 2;  2DT7 B;  1ZEL A;  3G2B A;  3LL7 A;  4ZTJ A;  5D1O B;  3IP4 B;  3RTX A;  4G6T B;  3TL4 X;  3N41 B;  4RMN A;  3BAB A;  1N77 A;  4DR3 H;  4KIT B;  3MMY B;  3H0D A;  4JOM A;  4A2A A;  3V42 A;  3ZRG A;  2VPS A;  4KT6 A;  1D0X A;  3RTR A;  3BA8 A;  2CS3 A;  2UV1 A;  1IBL H;  1WJC A;  2CV0 A;  3H5R A;  3OYH A;  2HVR A;  2XIG A;  1D0Z A;  3LFU A;  4XKC A;  4XLF A;  5EOY A;  3L4K A;  2CW7 A;  4D9J A;  3OL4 A;  2RNG A;  2WB1 A;  3K4C A;  2ZM6 H;  1MZB A;  3BG7 A;  3H9J A;  2VQL A;  1WH2 A;  4DV0 H;  4DR1 H;  3K6G A;  4EAT A;  4LFA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...