2HVSA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 2'-deoxyribonucleotide at the nick
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/dna/rna
total genus 91
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvsA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvsA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvsA01
3W1GA 4EEQA 1A0IA 3RTXA 2HVQA 1V9PA 3NBYB 1CKNB 2VUGA 2OWOA 3TY8A 1XDNA 1XK5A 3NBZB 4UCOA 4PZ6A 3VNNA 4EFEA 3BAAA 3JSNA 4DRFA 4PZ7A 2HIVA 1CKOA 4PZ8A 3GJXB 3NC0B 1CKNA 3PN1A 3S24A 3W5OA 3UQ8A 5FPOA 5D1OA 3GB8B 2CFMA 5D1OB 4UCTA 1X9NA 1B04A 1FVIA 2HVRA 3W1BA 1DGSA 3TY5A 4UCUA 1S68A 1P8LA 1TAEA 4LH6A 1CKMA 5FPRA 4LH7A 5D1PA 5DISC 2HVSA 4CC5A 4UCRA 3GDEA 3BA8A 3KYHC 3JSLA 4EQ5A 2Q2UA 4UFZA 4GLXA 4CC6A 3TY9A 3L2PA 2Q2TA 4EFBA 3RR5A 1VS0A 1P16A 1TA8A 3QWUA 4E6NA 3BABA 3BA9A 4UCVA 4UCSA 2HIXA
chains in the Genus database with same CATH superfamily
1XMAA 3I55I 1LDJA 4IHYA 4YJ3F 4MTDA 3IWZA 2EK5A 3LL7A 2X6OA 2FU4A 1P7JA 1A35A 2XD4A 3MJFA 5IYCJ 4YR0A 1MKMA 4ZC3A 3MEXA 2ESHA 1EA3A 1S10A 1RNLA 1VBGA 3CMEI 2W71A 5E25A 5ED4A 2GA1A 2I8CA 4UY8I 2P7VB 2QQ8A 5FFXA 3IH4A 2IBDA 4J9QA 4A3IG 1M0TA 2X1EA 4ON0A 1OYIA 5DV5A 2GLTA 4AQYH 4PZ6A 1LVAA 2DTZA 4A3KJ 1S0MA 2L0KA 2DMPA 3AG3H 4CCOA 2R93J 4XBFA 5IYZF 3TQNA 4A3MG 3WG7H 4RLQA 2IW5A 3M9AA 4BH9A 1VQLI 2PX9A 4LIUA 4HF2A 3H5NA 4RUCA 1UC9A 3HTUA 5GPCA 3JRCA 4IRGA 1RK5A 2EJ0A 4NC6A 4LG0A 3QRFF 2KMUA 1U78A 1SC7A 4B3RH 2UUZA 1WJBA 3LSJA 2NU6B 1IO2A 1P2FA 3CMAI 1R22A 4HR7A 4O2AF 2E5LH 1DPRA 2RNJA 2Z2SB 1X1BA 2K9MA 3AFHA 3GZ6A 3GTJA 2R92A 4J9OA 4ECVA 1YX3A 4O3RA 4OINF 4RDUA 1YFHA 1BR4A 3G1OA 3GB8B 5BWRA 2L9NA 5E1WA 2CQKA 2DAAA 3ZMUA 2P8TA 4HOBA 2OTJI 1A3GA 3RB3A 5TGTA 3F8FA 3O8HA 1IRGA 4G6QA 2PMZE 4ECQA 2ELHA 5D5XB 2OV7A 3H9QA 3V7SA 1HLVA 2W6QA 4CMFA 5BPFA 1S68A 2JRTA 4JBAA 1T0FC 5F0CA 3HRTA 4LF6H 1VQ7I 1FX7A 2FMYA 1IDYA 1LB2A 2F4IA 3CO6C 4NC7A 4LH6A 2DI3A 4HPQA 3WODF 1C3OA 2COJA 4Q48A 1D0XA 1FIPA 1HC8A 1UC8A 3B02A 1K79A 1WSCA 3RV3A 5KFHA 1HDPA 2EPFA 4J01A 3K4KA 2FJZA 2KDZA 2R92G 3QZ7A 4ECYA 3HSFA 1T2KA 4JQFA 3J7AK 2DIKA 2CRGA 3DTEA 1AWCA 2NVXJ 4O4JF 3QAHA 4KMUX 4RCNA 3GTLA 4YIFA 2W9BA 3FISA 2FXAA 3OYHA 2IA1A 2KZVA 2GBYA 3SE7A 1ZHFA 3CF5F 2ICWG 1O7FA 2LSOA 3S15J 4XYLB 2F4VH 3RPUA 1X1CA 4WX9A 2RAEA 2YZNA 4C3IJ 5ERIA 5L3DA 4FFOA 5DGHA 1LUJB 1H88C 2YS6A 1KC7A 2G9WA 1SYXB 2HEOA 2VE9A 2M34A 2XF5A 4QWQA 4XICA 5KFKA 3H5RA 4I6ZA 2PI0A 3LSHA 5HDKA 5I5XA 5EWEA 3EUHA 3F8CA 1IXCA 1JKJB 5LD2C 4IQ4A 3WTVC 2V5AA 2VKDA 2EIYA 3H1CA 4UVBA 4APMA 4DL5A 1JE8A 2DMTA 1B8IA 1D1BA 3D1NI 3ML6A 2R5YA 3DXJF 1S9FA 1NG7A 4A3EG 4O3QA 1IF1A 1ZH5A 1J9IA 5LHGA 4XZ3B 2P4WA 4QPQA 3BQZA 5KFAA 4IRKA 2FE3A 3GZNB 2WC2A 1OFCX 2C00A 4DR2H 2EBIA 2LG4A 3FXQA 5CVIA 3AL0B 1HNWH 4IJAA 1I50A 5LOVF 4O83A 1LDDA 1L0OC 4YFXF 3H0GJ 3UNGC 3OYDA 2AQEA 2OCCH 3MR2A 2HPMA 5I5TA 3QOPA 2DA5A 1VF9A 3UKGA 2MBFA 3HGGA 4AYBN 3FDSA 4CCLA 4D0PA 3B6AA 1S8NA 2W84A 4A69C 4JI0H 2MFZA 1WH7A 1CQIB 3CDLA 2KISA 2R7UA 3EPGA 5C44G 4OAYA 5I5VA 2HNHA 1P92A 1PDNC 4RA2A 1BN5A 4WCGA 3KETA 4V19K 3ZN1A 3WO1A 4A93G 4M9UA 2CSOA 1K61A 3OHAA 2F5FA 4DR7H 1XDSA 1ONVA 4IHVA 2GQRA 2DOEA 4XLFA 1Z67A 1L2ZA 4BHCA 3OYEA 2M05A 3QQMA 4ZH4F 1ETQA 2L02A 1D1CA 5M5XJ 1XCVA 1HDDC 4JI3H 1YRNA 4EJOA 1BBYA 3F8MA 2LD5A 3W1BA 1B9NA 2PG4A 3TW7A 1DGSA 3K9TA 3Q5FA 4O81A 2CG4A 2FPIB 1IW7F 3HKZN 1KONA 2V1NA 5K5RA 2YU3A 1OPCA 2F4OB 4I98B 9ANTA 2W6PA 3VMMA 3C1DA 3ERMA 3WWIA 3RGXA 3BG7A 2HGCA 2CUEA 1Q1HA 1R5ID 4NQWB 4YIRX 4PJNA 4TUYF 2P5KA 2GPWA 1H9TA 3L2WA 1K6YA 1K78B 1I7NA 2HHFA 3JRXA 4YBZB 4O3MA 2DYRH 4O6JA 1WJAA 1I3QJ 1OCRH 3HG9A 2D5VA 2KPMA 2W4SA 2FUG2 5BR8H 2WB1N 4EJWA 5KKNB 1MMDA 3QPHA 4C3JJ 4RB1A 3PUFA 5ICCA 2KT0A 1WR2A 2X1CA 1HR0H 3FF5A 3V8KA 5J6XA 2DA3A 4CA0A 2PJRA 4XIDA 4HV6A 5HLTA 1YW7A 1T98A 2TDXA 3OYFA 3CMMA 5LRRA 1HW1A 5A2QK 1I6UA 2OPTA 3L9FA 4UUVA 3U9SA 5DG8A 3MR5A 1BA5A 4Q8FA 2V59A 5C8YF 4K0KH 1YS6A 1I1LA 4S04A 4XSXF 2YUSA 2NVYA 3VYRB 4E4HA 4LFCH 1ZK8A 3N43B 5FGMA 4GKJH 3HPGA 2CV0A 4QWDA 5HDNA 5FLVA 2UWMA 2X9DA 3OYKA 2RVCA 2ASDA 2R8HA 2PQ8A 4XMYA 2YRXA 1MZBA 5DUKA 2ZXWH 1T39A 2Q1ZB 5C1PA 2NS7A 2R3SA 2F48A 3LP8A 4UHTA 2HDDA 2Q2EB 1FEXA 2L7KA 1N77A 1FTTA 4CKCA 5E8GA 2K9NA 1XNQH 1T8IA 4O7NA 5KG6A 2W24A 1LKXA 2GAUA 3WGHA 1MNMC 2MW8A 5TRDA 5HNEA 2M5WA 3JCUC 2GLOA 2VBWA 1Z3XA 4FHTA 3PIOF 3GTKA 4IVNA 1V3FA 2LKSA 1KGSA 3Q1KA 2A5WA 5HS8A 2Y0MA 1WJDA 4A6EA 1IOWA 3PFIA 1ZN2A 4CHIA 5KFYA 3VPDA 3P9CA 2EJ3A 4JI4H 3FBIB 3FXRA 3GTGA 3RBEA 2TCTA 4UB8C 5D5UB 2OQGA 2EV6A 2W48A 4A3DJ 5JQWA 3G6XA 3RAXA 3F0CA 3MR3A 3F3XA 2JVGA 3M1CA 3ABLH 1Y0UA 1O4XA 3DEWA 2E1MB 3WGIA 1ZGJA 2P6TA 2QCOA 3KYLA 4Y17A 4IZZA 1BXRA 2W7PA 1XMXA 3S2DJ 3BJ6A 3MFIA 4AUXA 1UCRA 2MH9A 1IZ1A 1ULYA 2BQUA 1EKEA 1N33H 2FOKA 3KCCA 5J2UF 2GWRA 4M3DA 3WTWC 2H94A 4R7RA 3W2VA 4YAJB 5BS6A 2HVRA 3RI4A 1VZ0A 1JKOC 5KT6A 4D7NA 1EHIA 2JPBA 1WH5A 2CS3A 3MQ0A 4O7ZA 5KFVA 3GIJA 4F3QA 3Q8SB 5H80A 2F5CA 1KJIA 4B47A 4MAMA 4LSXA 3BPVA 4KITB 4M9XA 3HOWJ 4BY7J 3A01B 5A2QW 1OBGA 1W7PD 3F72A 3FM5A 3ZGKA 2DPJA 2QGUA 4CSWA 1CKMA 4ZZLA 3R6SA 4LH7A 3BZCA 4AIHA 4DR1H 4B43A 2W9CA 2P81A 3BP8A 2KHMA 2FBKA 1JKQC 3ZOBA 4IOCF 1B6AA 2EV5A 4ED6A 3L09A 3TBIA 1X1AA 2Y75A 1CF7B 3M9MB 1FYLA 3LULA 1GXPA 5F08A 1Q1VA 4IXAA 1OMIA 4O7RA 3T9CA 4EYHB 1X3ZB 1QZEA 5DYMA 3OHBA 2V79A 3WTXC 4BUPA 2HYFA 2O03A 3TQ1A 2RV8A 3CCVI 4J00A 5IP7G 4I4TF 3GIQA 1LJ9A 3N6RA 2QUFA 2WY8Q 3BR6A 3ELKA 5GTHC 4CC6A 1LDKB 1MGTA 3RZDJ 4WXCA 5M3FJ 1HKQA 3WU1B 1ON2A 1JDEA 3N8DA 3TY9A 5CA1F 4XN3A 5EZGA 2XCPA 3CP8A 3K4NA 2GQSA 1JXLA 2OU2A 5K1YA 1FLIA 2J6SA 3VFZA 1JGGA 4DR3H 5C4JJ 3HSEA 4N9IA 3BQ0A 3M9NB 2DA6A 2E2HA 2DFEA 5L3CA 1B6RA 1FIAA 3K4LA 1O3QA 3RJ0A 2QEXI 1MBFA 1R1UA 2R7QA 1XC5A 4KHPH 1D3YA 3SZPA 2R93A 1OLTA 2HWVA 2MD5A 2VQGA 3HTSB 2R82A 4HYEA 2HU9A 4L0YB 4D5FA 2CUJA 2CQQA 3S3MA 3R0AA 1BC7C 5CAEB 3K4BA 4DOZA 3Q9SA 2OWOA 1IG7A 3GYHX 2JN6A 3JAMK 2WAEA 5EWFA 4Q8EA 4AVZA 4RNMA 5FRNA 1FYKA 2XPVA 5BPIA 3H3VK 1WI9A 4RAYA 4O7LA 3DTFA 4ECXA 3CMYA 1B72A 1ZRCA 1RJQA 3LFKA 3OYLA 3C18A 2ZGIA 4A3KG 1D5YA 3ZMDA 3O8GA 3TOBA 3RSNA 4A2AA 1RESA 2R93G 3M7GA 3CUQB 2AQFA 5K5OA 5JHFA 1XSDA 1WJCA 2K27A 4MV1A 3HDDA 4N4NB 2RDIA 2V1UA 1ETXA 3TEDA 3Q0UA 4AM3A 1R5HA 2HI3A 3FMQA 3IUOA 1Y1VA 5FRMA 2KSWA 4QPOA 2R7LA 5KFMA 3TDZC 3KLNA 3HOYJ 2E2IJ 1QGPA 1GXQA 3JRFA 1G2HA 5K3WA 2JA6A 3LMMA 1IC8A 1NK2P 4X62H 1ZYRF 3JW4A 1RETA 5E3OA 1RJPA 3FMSA 3NRVA 3AKZA 4CGZA 2N8GA 1XMKA 3R5FA 3T1YH 2A6TA 3RIRA 4F50A 1FC3A 1VQKI 2EFPA 5LP6F 4RU9A 2E19A 4O3SA 1V5FA 2JA5J 1TAEA 5JVLA 3T5HA 3NAUA 5D4RA 2O0YA 1QBJA 3LWBA 1BM9A 2OQRA 2EZHA 3A2KA 5C4XG 4PFPA 4B3MH 4CO8A 3HRSA 3MKYB 1SAUA 2M87A 3KHRA 2M4KA 5CE8A 4CKBA 1Y1VG 1SFEA 2FBIA 3ZMTA 1WGXA 1BR1A 3D5SC 4GO1A 4E7HA 2Z02A 3S1QJ 2RF4A 4FQGA 5CVJA 4AIDA 4AYBE 4CC5A 2O61A 3K5IA 5JVTA 4IZOA 3K1PA 3LSGA 1EH7A 3GDEA 4K6NA 2RKHA 1X4OA 2I5UA 2PEXA 3ZCOA 1IXSB 2Y9ZA 2ODTX 5KT2A 4ED7A 1BJZA 1YE9A 2BQ3A 1FZPB 4II3A 4AIJA 4LLNA 1FOKA 2ESNA 1KJ9A 2HZTA 3OTOH 5FNVF 4HAMA 3WHBA 4O2BF 1U5TB 1RIOH 2DODA 2C2RA 1OCPA 2R7ZJ 4TM5A 3CQZJ 1KU3A 1Z6TA 2BVLA 4YG2F 1VQOI 5E1ZB 1KJJA 3S8PA 1TWCJ 3DV8A 2DDBA 1UZCA 4BBSJ 5EDWA 4XKBA 1P16A 1SMTA 2KDOA 3T1BA 2R8KA 2XCAA 5BNGA 5IP6A 5EZHA 3HKZE 2COMA 1WI3A 3LSKA 2A6EF 5FKOA 1V51A 4U7CA 1XN7A 3NEUA 3HOXG 4A3JG 2I8DA 5H20A 5AIQA 3AG4H 5KFFA 1A0IA 5I5YA 1KU9A 4MHGA 1PJRA 5IP9J 4DR4H 2CW7A 2AGPA 5L1KA 2L9SA 2WAQN 3PSFA 4BACA 3JRDA 1REPC 4O4LF 5LBQA 1SAXA 3K5HA 3EPIA 1B33N 1R49A 2I80A 2WB1E 2ISZA 4A3BJ 3BJAA 4BE1A 1MMSA 3O6BB 4LF9H 3KEYA 2MYSA 1XGMA 1YS7A 4A6DA 2VKHA 4BQOA 4J19A 3DU5A 2FOWA 2V4JC 1VI0A 3TL4X 2CQNA 4DUYH 2L9RA 1KJQA 4MV9A 1XGSA 4EYIB 4CZZA 2HQAA 3WTYC 3RJPA 4ECZA 2VQDA 4PGGA 1BNCA 3K1MA 4BGDA 2Z3YA 4RUAA 4XKWA 2JEJA 2L4MA 2D45A 4N4OB 3IG0A 1R00A 1W4MA 4EJUA 5KFLA 1YQAA 2PFBA 1RPWA 1W0TA 4XN0A 3WU2C 3BOQA 1GDTA 2XASA 1TNSA 4LD5A 3CC4I 1SD6A 3C2HA 3H92A 4J9SA 2X6YA 2ALZA 4BEHB 1PK8A 2V9VA 1ZGWA 5J4VA 3OYCA 2UXCH 5KHDA 2B7EA 3DTIA 5D8KB 4U7BA 3L4JA 4IR9A 1SVOA 3BT9A 2J5OA 2CFMA 1NHAA 1I3QA 4IPAA 2JPCA 4FASD 3LSRA 5KFNA 3RZOJ 2TRTA 3GFLA 4I50F 5KFWA 4E7SA 3CCLI 2OUMA 1B04A 5LL6b 1TW3A 3CVZA 2DT5A 1SVLA 1VFCA 2DTRA 4JYKA 4LITA 5KAIC 5BOXA 3TY5A 3GV5B 3CCEI 2E1OA 2LH9A 3CCQI 5B66C 2R7MA 1KQ0A 2FK2A 4QWBA 2ZFWA 3E5XA 1ZLJA 3S1MJ 3G4SI 4J9PA 1MD0A 2EZKA 3T1HH 1WWXA 5EWGA 4R1HA 4J0MA 3I71A 1ZAUA 2DMUA 4EBEA 2J9GA 4ED0A 2DK8A 3UYYA 4G6DA 3PNVA 1SFOA 2XROA 3L2CA 4HX8A 1S72I 2LR8A 2BHZA 2EZIA 2ME0A 3GLXA 2YX4A 3BCBA 3SGIA 3K3VA 3RKYA 4O3PA 2K3PA 2W9CB 4LFBH 3RQIA 3DKWA 3TOAA 1M0WA 2BQRA 5CYVA 2AQ4A 4J9MA 3ZXSA 2L3DA 1ZR4A 4JI7H 1MBKA 3JREA 1K6OA 1N78A 4CDGA 4QSHA 2FLNA 4GLXA 2VQEH 2EV0A 3F23A 3Q0VA 4RZRA 3HZJA 3PR4A 3DBLB 2YS7A 1YJWI 5E20A 5KG7A 4AWXB 4RS8A 1F9NA 5E17F 2H6CA 3HC7A 2IEKA 1K4SA 1Z2OX 1VQPI 2HDKA 2XHKA 3BTLA 4E4TA 2M30A 5IYBJ 2JSCA 1F36A 4M3FA 4EBDA 3BJOA 2CFXA 1J0RA 5F9LA 3GBGA 1TWAJ 2XAHA 1ACIA 3SZGA 4A2BA 2ZMEB 2GM4A 4V2FA 3FKJA 1RRJA 2JJ7A 4TV7A 3GF2A 5DD4A 3KX2A 1R9TJ 3EUKL 4PJMA 4OIQF 3RTXA 2IRFG 1G4DA 5HOOA 3HUGB 5GAEJ 5D5VB 3GIIA 2WV1A 5LGNA 3FX3A 3H9GA 1HQCA 1QZYA 3DKYA 3H5AA 1LNWA 1BOBA 3KE2A 5DEQA 1U9NA 4JOMA 1JI8A 3RDIA 3CZ6A 3HM5A 2EA2A 4P5OA 1PP7U 1XMOH 1YIOA 4K2EA 2WTFA 3ABUA 1QRYA 3H3UA 2KIFA 4A3LG 3U9TA 5L3BA 4CYCB 5L1IA 4I02A 2IGNA 3RAQA 3OYAA 1M1EB 3M1EA 5BMVF 3J81K 5DG9A 3EYYA 2QK4A 2VA2A 2L7MP 2R7DA 4HF1A 2CGPA 4ECTA 3T5JA 2CQ7A 5B1BH 2YSRA 4FM9A 3PW0A 4DL7A 3MKWB 3CCMI 2O8KA 3OIQA 4O82A 1X2MA 1JHHA 2HKXA 1RUNA 3WWJA 2LF8A 2PMUA 2Z1DA 4MV6A 5JVDF 5KFZA 4O3OA 3NC0B 2KZGA 3PIPF 2Q2EA 1SD5A 5F6FA 2EJ2A 3R5XA 1YI2I 4RBOA 2QSFX 2K9LA 2Y0SA 2HGSA 4HDVA 4M72A 5KFEA 1I1GA 4A3DG 4KMFA 1Z05A 4NC8A 1AKHB 5I5SA 3BR5A 3FHNA 4CMDA 2W7OA 1Z9CA 2J6UA 3ZQIA 5KFPA 2OAZA 1HF0A 3JZIA 3RIZA 3TP3A 4HV5A 4ZYAA 1SMYF 1HNZH 1IBMH 1WQ2A 3U21A 2HQNA 4MNUA 5HDGA 1VQ8I 2KKOA 1FVIA 2PBIA 3MMYB 5EEHA 5CA0F 1O3TA 2NVTJ 2DFFA 4XLCA 5JI6A 3I58A 3G3ZA 5FKKA 5M5YJ 1WJ5A 2VA3A 4X1EA 2K86A 3OUUA 1JUMA 1JLLB 1FP2A 3BQYA 3DP7A 5BWXA 1XS9A 4P96A 1TWGA 3RF2A 4F91B 4QWCA 1WCMJ 3FKIJ 4DGWB 2O5RA 3MZYA 5BYBA 2CQYA 2X48A 4G7ZF 3WNZA 3JAMZ 3BWGA 2GQQA 1U3EM 4G7HF 2CNVA 2GPSA 4ED2A 3IKTA 4C5CA 3VYSB 3L2UA 2CNQA 1MJBA 2CMPA 3OYMA 4X64H 1PVEA 3W6JB 1YHQI 1F43A 3LA3A 4EEYA 3C0FB 4L5IA 3RPQA 3HL2A 2VPLA 4FFPA 1MSEC 3CCRI 1OCOH 2W9AA 3JRIA 3R0JA 4CUGA 4XORA 1DIKA 2XGPA 1KA8A 3F9KA 4EQ5A 1O75A 3L00A 3VOTA 4Y33A 1VQNI 3FDYA 5K7HA 3A01A 1FPQA 3GFJA 4MQVA 2I87A 5GONF 2XVCA 3LSPA 4DUZH 1A9XA 1Z77A 3E7LA 3W3CA 3GXOA 3KHHA 4DR6H 4FE2A 3S2WA 4FFMA 4ZDLA 1SEIA 1BIBA 1RI7A 3DKXA 2V9PA 2DOFA 2FRHA 4OMZA 4LB5A 3RB0A 1V4RA 1YJNI 5CPRB 2VB6A 4RAFA 2XGXA 2JA8J 1RKWA 1S3JA 4RM2A 2ELKA 2OH2A 4CYDA 1Z3YA 1CF7A 4UCSA 4PCQA 2B63J 3R61A 1MDMB 4RMNA 2R84A 3HOZJ 1VTNC 5FKMA 5KT4A 5ICFA 4F52A 4MV4A 2UVWA 2M2EA 4ZZDA 1FBQA 2QSHX 4QW8A 2ZXIA 2A1HA 4IRIA 4A3GG 5J1YA 4GYGA 4O7WA 4A0ZA 4GKKH 2VUGA 3KHGA 5EEGA 3HOUJ 4U87A 1RR7A 1GYFA 4IEJA 2DA1A 2CJJA 3I56I 1FOYA 4I7HA 1IDZA 1GO3E 1XK5A 3BG9A 5FD5A 3HRMA 3NBZB 3OUZA 3E97A 4EEFG 2XF6A 3A02A 4X66H 3OMYA 5HVQC 2V26A 2VLAA 2CO5A 2PMZA 1DQUA 1K7AA 3FXKA 4O86A 3HBLA 3DWLE 2ZDGA 3LQSA 2NRAC 3N6XA 2L2OA 2IA0A 2K40A 4M73A 2M8EA 3HB9A 2L9VA 2P5VA 2W6MA 3JZFA 3Q3SA 4LK1F 4U7DA 4WXHA 3G8CA 1X3UA 2CWEA 2QYZA 4G7OF 1DAAA 1S0OA 3BJYA 4FFNA 1TBXA 2VT3A 2DK5A 2EINH 4YJ2F 2HDCA 2VUMJ 4GRIA 4BHPA 1R7JA 3BDDA 1MJ9A 3ZP5A 3DLAA 1AHDP 1GSAA 5D1OA 3AX6A 2DJNA 5I5UA 1TWFA 3GW2A 2W8LA 1G59A 3LNQA 3F22A 2ABJA 3OSPA 4ZHQF 2LOOA 1YITI 3LOCA 4HQEA 4UCTA 1IBLH 3G1LA 2WAQE 4Z2YA 2UXNA 3TIGA 1HKSA 2JZYA 2RGVA 2ZSIB 3FWEA 3TDUC 3HOVJ 1ETYA 4ZJZA 2KJBA 3MKZA 3KZIC 3MWEA 3CUQA 2EIJH 2X0SA 2JEGA 2XAFA 3MWMA 2EIKH 4Q4ZF 2EH3A 3L7WA 3OSGA 4ZTJA 2X0LA 3T9AA 4A3CG 4IF4A 3PO2G 3CJQB 3VWBA 2R7ZA 1S7AA 1EH8A 3CQZA 4OIOF 2XSJC 1SFUA 2QKLB 1E4GT 1ZREA 4E7KA 4ESBA 2JEFA 4M7EA 4M6VA 2VODA 3BROA 2BVMA 1ZAOA 5KFTA 4B3AA 3SZTA 2MCTA 1P9QC 5DM6F 1C0WA 4GLWA 2RREA 1KUTA 1Z6RA 1E3PA 4P9FA 5KAFC 4D7MA 3IRQA 2E5NA 3L2VA 4Y7NJ 4ESJA 3WTUC 2UUCH 5J4YA 1IN7A 2BOLA 1RUOA 5KFJA 2HFHA 4ZDPA 2Z9OA 4YHHH 5L1LA 1RC9A 3BPXA 4BKXA 3KYHC 4KJZA 3OSFA 2UVRA 1XCBA 1TTYA 4M6YA 5J1RA 1FKAH 3OL4A 3BY6A 1ZHQA 4FFRA 2LP0A 4A3FJ 3I5UA 3IV5A 1MMNA 2IS6A 1CE8A 4LLGF 2IS4A 3RKQA 2JA7A 2JA6G 2MLKA 1W7PB 1Z21A 2KFDA 1ET0A 4MTEA 3T5XA 2C28A 5E1XA 2R7ZG 3FMAA 5ILVA 4NDLA 1DUXC 4WBNF 1ZHSA 3CCJI 1X4PA 2XC9A 3I4MG 3TGNA 3T8RA 2XF7A 2PMHA 5BPDA 5LLQA 5FFZA 3GEZA 4KN7X 4BBSG 3FIWA 5DCMB 4HG2A 5D6EA 4LSAA 3G1MA 3VYUB 4O7TA 3AG1H 2D1HA 4L0ZB 1UJ8A 1X1DA 2WA0A 5FLMJ 3W1GA 3F21A 2IXSA 4HRIA 4NZNA 2V6EA 1U5TA 4D5CA 5HNFA 1FMWA 4FBTA 2GIVA 3OWTA 3ECOA 5C3EJ 5D5WB 3F6VA 2H1LA 4OMYA 3PW5A 2YS9A 2PBZA 1I94H 5CKTA 5F04A 2JA7G 4DIMA 1ETOA 3K2AA 4DR5H 1RZ4A 2EFOA 1E4EB 4E70A 1QZZA 5H6RA 1WH2A 3CUOA 4ENKA 3GV7B 3I53A 3KLOA 4O4HF 5JH7F 2NS0A 4CCJA 2IGKA 1ZETA 3NWSA 3MN2A 1DGWY 1E4FT 5TISC 3BC8A 1Z91A 3Q2OA 3VA7A 5J8FA 2LYCA 1R4NB 4PGHA 3EETA 4RZQA 2QF7A 5HLIA 2IA6A 2Q8KA 3V8LA 1GLVA 4BJ6C 5LEJA 3A0HC 4FT8A 2P6SA 1XB4A 2R4GA 3DU6A 1GT0C 4DV5H 1MH4A 1JX4A 2B9SA 4L1KA 5L9XA 1KYZA 2X6XA 3REOA 3DPLC 1XMQH 3KP5A 4L9JA 3BTCA 4D1QA 2ZXHA 4BHBA 2Y48A 3MZ8A 3DAAA 2XSDC 2QZ8A 1TT5B 3M8JA 2W8KA 2DA7A 2MD0A 3PVXA 3QZ8A 2IMWP 1A48A 3JR9A 4TQSA 2AO9A 2GXGA 2UV1A 3CLOA 2E7XA 2QQ9A 2ZSHB 2YPRA 4HX7A 5F27A 3GTOJ 3KHLA 3VODA 5LFAA 2DLLA 1AN7A 2BR0A 2VXZA 3W2WA 5IYDG 2NOGA 3T9EA 4F93B 2YCHA 3GUDA 2NVUB 1MIJA 4BEHA 2D1VA 4A5MA 1UHMA 1JGSA 5GPAA 2AGQA 3WTTC 1MBHA 1PYVA 2VBZA 2VXDA 1EZ1A 1T0FA 3BG5A 2IS2A 2GOMA 1P4WA 3SQNA 5LGTA 4ZYDA 4HW0A 1ZG3A 2CW8A 4CCMA 2DT6A 3BR1A 3C2GA 4MGRA 5M3MJ 1BW5A 1HOMA 4PDKA 3RYRA 4EGZA 3PJRA 4GYIA 1G3TA 4Q5SF 1TWAA 4C2MA 3GCMA 1KEEA 3G6VA 2VT2A 3ZQFA 3GTPJ 3WO0A 2HXIA 3BG3A 5GAGJ 4BNCA 1BI2A 1W5TA 4EM1A 4C9YA 1K1SA 2VN2A 3V7CA 2VOOA 1Y0NA 3IHUA 3OS1A 1TT0A 3NGDA 4HLYA 1TLHB 4RB0A 2FBHA 1P7IA 2GIZA 2DW4A 2QQBA 1E3HA 4HSTA 4A3MJ 1VS0A 3RR5A 3COAC 1KQ9A 2M4GA 3QPTA 1TA8A 4J9RA 1LEAA 3N05A 5D4SA 4IAJA 2ATLA 2A61A 2CUFA 2R87A 1MBJA 4BBRG 1HNXH 4KNYA 4IWYA 1SFKA 2Y0SN 3H3VH 1U8BA 1N48A 2R7KA 1KYWA 1J59A 4Y8VB 3AL0C 4YR2A 3W6KB 3S93A 1DV1A 5CQEA 4IRHA 3IAS2 4ZDOA 3JRWA 3V4ZA 4JI6H 3PQJA 2M8GX 2XRNA 2ZJPF 5J8CA 4LB6B 2Y9YA 3H3ZA 1T38A 4XLAA 2HOEA 3K3PA 1QO0D 2BV6A 1F4KA 4EBCA 5DQIA 3E5UA 3M4IA 2DFIA 3ABMH 3KEQA 5FLMG 3J7YJ 3S2HJ 4ASNA 2KP6A 5DDGA 1ON1A 4KA4A 1FOXA 4MV7A 2A07F 2XKOA 2OCEA 4RGRA 1HKTA 3BAAA 3JSNA 1R6RA 4XRSA 1XGNA 1CGPA 2VIXA 2IAIA 1NTCA 2M45A 2ZMEA 5EDNA 4FS2A 1OBDA 2Z04A 2JUCA 2OA4A 3OYGA 3CSWA 3E6CC 5FLXK 2DQLA 3CO7C 1I1KA 1I5ZA 3HUGA 3K4MA 1OKRA 5F1RA 1TC3C 3IP4B 4DQ2A 4ZYHA 1I39A 2MC4A 4DAAA 2KIQA 5AONA 2MABA 1CKNA 3RKXA 3GTJJ 2V1XA 5IT3A 2R92J 4KISA 4ECWA 4D9JA 2HTSA 2G7UA 3IL2A 1IUFA 1Z1DA 4X0GA 2JK3A 5M5WJ 5IYCG 4M74A 3EQLF 1GLNA 3PQKA 3QOEA 4EVIA 4CYCA 1C30A 1B9MA 3I9V2 3S1RJ 4FGRA 2IA2A 4L9TA 3CP2A 5D1OB 4QLCU 5E18F 1N36H 4DL6A 2ECBA 4UUTA 4XRSG 1A31A 1KJ8A 2K9QA 1A6QA 3ETJA 1X9NA 4BAYA 3V6HA 2VPQA 1GVDA 1IJWC 1WJEA 1YX5A 3W6VA 4DL4A 2YZLA 1P6RA 3ONQA 1HW2A 4WHXA 2XAGA 3H35A 4RGUA 2CV1A 1ENHA 2EA4A 3IKVA 4YEJA 2KLOA 4LMYA 1ZRFA 1IRFA 2UU9H 2IGMA 2NYXA 5GP9A 3DCFA 1AKHA 4GFBA 4ED3A 4BY1J 4UVAA 3BG6A 3V8JA 2E35A 3KP7A 4Y15A 1H0MA 1FT9A 2W6ZA 4HYKA 2LK2A 1STZA 4CKEA 4WF2A 4EQQA 5DLFA 1S5LC 2ZJ2A 3P9KA 3VPRA 1N75A 3GTLJ 3M3YJ 2WTEA 4G9YA 2STTA 1QPMA 4ECRA 1AOYA 4R79A 1JT0A 5IPAA 1KT8A 2UUBH 2B63A 2IT0A 2NVXA 1BGWA 3FK6A 1WZ2A 1NG6A 4WXDA 2Z33A 5KVRA 2W6NA 4I99C 2MH2A 2OF7A 4JX4A 5FKLA 1VQMI 3HOTA 1JKRC 2IJLA 2VKVA 4UNOA 4J9NA 4WD3A 1U0JA 1S03G 1YO5C 1VBHA 2VOBA 4DL3A 4IQJA 5DQGA 2DA2A 5EGOB 1W5SA 4CZCA 1DU0A 4PZJA 1USSA 4OX9H 2A3SA 1UG2A 2L5QA 2DAOA 3S14J 4F4ZA 1P4AA 4AU7A 4L5JA 1F1ZA 4CH7A 5L3EA 5KFGA 4FBUA 2HIXA 4XM3A 5T14A 1ZQ7A 4KUMA 4HLXA 1MJAA 1XSVA 5C44J 1QU3A 3ABKH 4EGJA 3GX4X 2VR1A 2NNNA 3BR0A 3CTAA 2EWNA 4A93J 3H20A 2B63G 2YL2A 1Z2NX 3K69A 4CE5A 5BPHA 4EMSA 1DP3A 4KFCA 1D1AA 3JAMW 1EF4A 4QWEA 1MBGA 1B59A 1I50J 1R1TA 4EV0A 1XDNA 2UUAH 3HIFA 1FWZA 2E2JJ 2R8GA 2LBFA 2RQPA 2CQXA 4RLFA 2ZDQA 3B6CA 3HOUG 4O4IF 2P5LC 2VUMA 2ETHA 1DU6A 5F64A 2MC3A 2E1MC 2KL4A 3IWFA 5BWTA 2FB9A 2AHQA 4O7VA 1MDMA 4PBCA 2F4MB 2UXXA 2YYAA 3H0GA 2R85A 2E71A 5KNLA 5LRSA 2A6HF 3H4DA 2NVQJ 3S3OA 1YYVA 1VAJA 1LE8B 3ECHA 1DV2A 2MA3A 5DM7F 3E6BA 3S24A 4LG3A 3LMLA 4O3NA 5L3GA 3RB6A 4MIMA 3OYIA 2C2DA 2GOXB 3MAJA 2L4AA 3FM3A 2QSGX 2WADA 3OS2A 4PJLA 5IT9K 4QIWA 4AYBA 1JUPA 2FA5A 2P0AA 4LF5H 5BQTA 3U9GA 4LJZF 3T5KA 4JI1H 1D8JA 3TINA 2ZM6H 5AIPA 1OCZH 2VUMG 2G7HA 3KZZA 3D0SA 4WK8F 2E36A 4I55F 2R7FA 2CFOA 4BDZA 2F5VA 2X51A 3H0GG 1LPQA 1K1QA 5LMNH 2K7LA 2IS1A 2QB5A 1Y39A 3GO5A 3E5NA 2HOSA 3LAJA 5KFUA 3HOVG 5KX5F 4XR6A 2VJ5A 4MV8A 2V4RA 3WG9A 3FHZA 1QHGA 3GWZA 4RGSA 1GV5A 3Q9VA 5E3MA 2ISYA 2ZJRF 1WPKA 3HKZA 3JRHA 1Z7LA 3HT5A 2V9KA 2NAZA 4EG0A 3NUAA 3KFWX 3VOEA 2VPSA 5KT7A 4Q4DA 3KP3A 2L7ZA 2HQ5A 4HF0A 3FXJA 3VSKA 3ZQ7A 1L3LA 2M7BA 4KYWA 1A5JA 3CC2I 2E34A 1J5YA 2BEOA 2GXBA 1JJ8C 4QWAA 4B3XA 4LF7H 5FKNA 1POGA 4IO9F 1FOWA 2ZKZA 2BHYA 3DF7A 1D8KA 4I09A 3QPSA 2HYGD 3EUHC 3IH3A 5KS8A 4JP0A 2O3FA 4PJJA 3GLLA 3T9FA 3KYCB 3F8NA 4RB3C 3L2PA 1IXRC 4E7ZA 3TQTA 3MZHA 4MO7A 2NVYJ 3LSTA 5ILUA 1UHSA 3FXMA 4CCKA 4XNFA 3QWUA 3I59B 4DV6H 2OC6A 5EG0B 1W5CC 2VONA 5L1JA 2HGWA 1W36D 4OU0A 4DLKA 3RV4A 4QJFA 2LFBA 2FF4A 1IBKH 5E79C 2YW2A 3ZMZA 2ME6A 3VB2A 2X4HA 4DYQA 1Y1WJ 2Q7DA 3H4BA 3G73A 3BLYA 4IHJF 3RTRA 3GIKA 3T9BA 4RB2C 1W7PA 1WHUA 4ED8A 2RQQA 4A0XA 1WRJA 2R0QC 1GSHA 3SXYA 6PAXA 3GTKJ 5C3EG 3CUQC 2K3FA 1OR7A 1I3AA 3D5LA 3EDPA 2W1OA 1JT6A 4F4YA 2J5PA 5TJJA 4LF8H 4NLGA 1QQIA 4BL0B 3FK7A 3BTJA 5DCMA 2H1KA 2LNBA 2BY0A 1EH6A 4BXFA 3RB4A 2V9WA 1X1PA 4G8XA 1W0UA 3GTGJ 1FBUA 3I4NJ 1T56A 5FB2A 2HIVA 3ZMSA 3IN5A 3E6MA 4NB5A 3ORRA 2LF7A 1ORKA 3V4SA 4KN4X 4TV9F 2Q0OA 1S29A 3H36A 2ZDHA 2C6YA 4GGGA 5LA6F 2R7TA 5KFIA 1W36C 2P0WA 3NWTA 1HXDA 3GFIA 3PW2A 1S97A 2LKPA 2HS5A 2HYJA 2DT7B 2CH0A 3C3WA 4GCVA 4BJTA 3O2PE 4M3EA 1E4EA 2Y0SE 1OQYA 2YU9J 3QP5A 2O6GE 3Q8PB 1UELB 4XOPA 3SHFA 1SEUA 3N4MA 3CLQA 1E3OC 2DBBA 3J80Z 1IN6A 2FPGB 4TVIA 2HHHH 2L01A 5K5QA 4EGQA 2YR2A 5IP7J 3VPCA 2BYVE 5KK1A 1BI3A 5K7ZA 3CCUI 3EYIA 5HBRB 4Q43A 5HLHA 4BU2A 3IC7A 3MD2A 1Z7UA 2COIA 3HSRA 2XDVA 5LHIA 2R7XA 2W25A 3HHGA 3ASOH 1P8LA 5IOYA 2V4QA 2BY3A 3M8EA 2RDPA 3SEZA 2JQ7A 4IRDA 3KPHA 3LSIA 4C2UA 2MLGA 1UB9A 3ZN0A 2CV2A 1U5TC 3RCOA 2VC0A 5D1PA 1IRXA 1G3WA 4QTRA 2C2EA 5H2FC 3PFFA 3O3KA 1KTAA 5DAAA 1B1BA 2V1DA 2FLPA 3GTQJ 3SI8A 2HVSA 3HEFA 2LMDA 1R58A 4DW6A 3GLKA 1J7KA 2QLZA 2NU7B 3ZQGA 2X85A 4UCRA 4C2TA 2PJPA 3J7ZI 2KRFA 1IYDA 2RNGA 3J7AY 1ZKGA 4YY3H 4Y3OA 3R5HA 2HOAA 2IGOA 1N25A 2HZDA 5FLXZ 2VJJA 1UNNC 4F4XA 4IHSA 1GSOA 4UFZA 1VQ6I 1PP8F 4PK4A 1AA7A 3OS0A 2IP2A 3S17J 1GVJA 3VEPA 4AD9A 5EF6A 4XKCA 5I60A 3DBRB 3QFFA 4MFDA 3PO3J 3AW8A 3E5QA 2BE5F 4GXOA 4UUSB 1F5TA 4GDFA 4IIJF 1Y56A 3Q8RB 2LLKA 3HOWG 1S6LA 1WSUA 3U55A 1XSXA 2E2HJ 4BY7G 5HODA 1GUUA 2R7NA 3BABA 1G6NA 1XGOA 3RFCA 3BQ2A 5B1AH 3J7AO 5BWVA 4U0VA 3M8FA 2VE8A 4L5EA 4G6TB 2QENA 3TP0A 2F2EA 3CJTB 1HBXG 3HXLA 1WRVA 4R8UB 1J75A 3N42B 5C5JA 5D8LB 1IAWA 4CICA 3VYTB 2EJRA 2KIUA 2YZGA 1H89C 3HJEA 2CU7A 1XPXA 1X58A 3A03A 3ROUA 3CC7I 2F6CA 2ZJTA 4HNTA 1V9PA 4O7YA 5KFCA 3AAFA 3GIMA 1K4TA 3BR2A 4EJVA 3Q8QB 1CQJB 1U6GA 1I6XA 1IUYA 2JRMA 4Q47A 2F5EA 2LBFB 2HOTA 2QBYA 1W96A 2ZCWA 4Q45A 1WFXA 4B09A 3U1DA 3J81W 3H40A 2LC2A 4JX5A 3LAPA 1RYSA 4XRMA 4DRFA 2VQCA 2ZJQF 2LTPA 4MEXF 4PZ7A 1AU7A 1IV6A 4C3HJ 1SCUB 4UUGA 5KG4A 2OJED 4XLNF 4X65H 1S0NA 4U6PA 2IVMA 4L18B 2VC1A 5BWUA 2WDTA 4BDYA 1ITYA 5C4XJ 4BXUA 2DLNA 3TO6A 2A69F 1TQPA 4E7JA 4Q0YA 1Y1VJ 5IY5H 4DV0H 2JEIA 1N56A 1DDNA 2VPRA 4FU0A 3ULQB 2JVHA 4A0YA 4AC0A 3JRBA 1T6SA 1DP7P 4MA0A 3T0YA 1ETWA 5CJ9A 4XLPF 3ZQCA 2JA6J 3LA2A 3D5RC 3I64A 1ZG1A 4HN2A 5DLGA 2NXNB 3T99A 4J9LA 3FXLA 2ID3A 4FCYA 2DXIA 2NS8A 4LK0F 2EZLA 1LVKA 2E2IA 2X1DA 2RDJA 1LFBA 3DPUA 3SDBA 3KXYT 3ASNH 3I0TA 3ZRGA 1IV8A 3V6JA 4Y52J 3DTGA 4UCUA 2ECCA 1WJFA 2OZ6A 3UZOA 2ZB9A 1K83J 2DCEA 4LIVA 4BQNA 5KG2A 2VASA 3LQRA 1BC8C 3VPBA 1UAAA 1YLFA 2JA2A 2G0EA 3ESWB 2EIMH 2BY1A 2QKMB 4M71A 1T36A 3H0DA 1WVRA 5FPRA 2O9LA 3K4CA 2JA5A 1YW9A 4OOIA 3WGGA 3HOXJ 3SJMA 4A3JJ 2DPDA 3KREA 1BI1A 2AXLA 4BY1G 1R36A 3R9RA 5J40A 3SFZA 4ENJA 1CQTA 4IL6C 1ETVA 2BW3A 2W7NA 2XB5A 1UMQA 3DEUA 2BY2A 4A5NA 3G71I 2J6TA 3UR3C 2Y2ZA 5GTIC 3HOYG 4DV4H 5I47A 4FX4A 4BS9A 1Z2PX 3TIIA 1FYMA 1XG1A 2OZUA 1QHHD 2ZMEC 5JLWA 1V54H 2DMQA 2VBYA 1KQ8A 5LYJF 2C35B 2XPWA 4BJ5C 5FJ8J 1EKPA 2CW0F 2SCUB 5IOZA 5GADJ 4IRCA 3FMRA 3QU3A 2XUBA 4CXFA 2VQFH 3KP2A 1SVMA 2GXAA 3OR1C 1TWCA 4B3SH 5IT9Z 2RC4A 2HDWA 3HPHA 2XRLA 4JI2H 5KG3A 2JA5G 3PFYA 2UXBH 2CUZA 5DGIA 4LOCA 3GIPA 3L2RA 1E2XA 4KDPA 1T3NA 2QQAA 3HGYA 1GV2A 1RKTA 3P5JA 3JSOA 4JV1A 1T94A 2VKEA 2NNYA 3G2BA 4QIWN 1I7LA 4JV5H 4FE4A 4KT6A 2HXOA 1J5EH 1TQIA 5KG1A 1TL8A 5B3SH 1KBLA 3WE2A 3A4CA 3HRUA 2HG8A 1H8AC 1FP1D 3R4KA 1OCTC 1VNDA 2HR3A 2KQRA 4NBQA 1R23A 1S9HA 2ZXJA 2QA4I 3PL8A 5DS9A 2PLYA 2XIGA 3TY8A 4PSWA 3K7AJ 2ZO4A 5EGOA 2VL8A 4BQAA 1MMGA 2R7WA 3OIOA 5D8DA 2Z99A 3VNNA 2A5YB 2WAQA 2XGDA 2FK3A 2JUGA 2M7AA 2YX7A 4M6XA 1FTZA 2IP4A 4BWSC 3NARA 2FNPA 4B8XA 3B73A 5LXTF 2FLLA 4XLEA 4DNCA 3JSPA 1I2LA 1HCRA 2H8WA 2R5ZB 3EPZA 2DMNA 1MNDA 1ZARA 4PZ8A 4JV0A 2WY7Q 1RR8C 3M9OB 3K2ZA 1IOVA 3J81Z 5CLSA 3ZR8X 1B4AA 3RQ4A 4EGYA 5DUIA 1FSHA 1I2KA 2X5RA 5BWWA 2XAUA 4UVCA 5I5WA 3KTMA 5KFQA 3SYTA 2IBKA 2RGRA 2ZNZA 5ILSA 4IHXA 4P9UA 3A0BC 4UXNA 5IP9G 2H8RA 1YJ9I 5ICEA 1OCCH 3T8TA 3N41B 3MFHA 4HNUA 2C22A 2CZGA 4OAZA 2O8XA 1XNRH 1R9TA 3FZVA 4UV9A 4BXXJ 3M4OJ 2Y30A 4A3BG 1FMVA 1MMAA 4IX7A 5FO5A 1R4MB 4JXUA 2ADUA 2XGCA 3JRGA 4YP3A 4I0AA 5DCFA 3CEBA 1PUEE 3PZPA 4LLLA 4DJAA 5HV6A 1LE8A 2H27A 4DV2H 3BR3A 4DZJA 3C7JA 3HYIA 2L54A 2Y31A 1OJLA 1JTYA 2E7WA 2LY1A 5F9NA 4DYRA 1SFOJ 2CNUA 2PN6A 2MGQA 1N32H 3K4JA 2F5DA 3OIPA 5J3LA 3QODA 4YELA 4F4WA 1O7LA 3HHHA 2NU9B 4JI8H 5B5EC 4J9KA 4HZFA 3ISPA 4BYYA 3PW4A 4V2GA 4YFNF 1FNNA 1IN4A 2WBMA 2DJIA 3UZBA 4HNVA 4C5BA 3U0GA 4E7IA 5BYAA 1PUFB 1XX5A 2GA2A 4A3EJ 1N34H 2W00A 1QVTA 5E8IA 4MV3A 1GHCA 2EFWA 3C2BA 3QP6A 4B1RA 4HSRA 2IPQX 1Y1WA 4A3LJ 2WAFA 5EOYA 4FISA 2DABA 2R7OA 2DPIA 5DTDA 5JVGF 4TQRA 1X19A 3CDHA 2M0CA 2JMWA 4HX4A 3K10A 2DO7A 3N97A 1BJTA 1T08B 5DG7A 2WWYA 3T5LA 4N0BA 5LEKA 3QYBA 2HGXA 1RK6A 3ZPLA 4CCNA 1QA6A 4NHJA 3U54A 3Q0WA 3S32A 4CHUA 2DDAA 5J1UA 4IHTA 5GAHJ 4B3TH 4EEQA 3TKYA 2EFQA 2NOJB 3OV8A 2HVQA 3GZ5A 4LG0B 4XOTA 1BJAA 4KICA 1RJRA 4A3IJ 3NBYB 2XAQA 4M3BA 1TWHJ 4KIFA 4AVPA 2E5ZA 1ERDA 4NZOA 1XTAA 5KFBA 1HW5A 3EUAA 2D2WA 2FNAA 2A68F 3DPTA 4ABZA 1VKZA 1S7EA 2JWTA 2DFHA 2OTLI 3TO7A 1U2WA 3OYNA 1LEBA 3MCZA 1JHFA 3I59A 2VBXA 3HO8A 5DGBA 1Y8QB 2GZWA 5EG0A 3J80K 3GTMJ 2QBYB 2YU9A 1KZHA 5LHHA 1DPUA 1D5VA 3OR2C 2K9SA 3X2QH 4M9SA 4HQ6A 5CVUA 1EJ9A 5IYBG 3A1YA 3CDIA 2LDUA 1G2WA 3K70D 3F6OA 4N9HA 5E3LA 3OY9A 2KIMA 3I4NG 3OOPA 3FBNB 2O7OA 1I6HJ 3PN1A 3K6GA 4YIIA 2BBYA 2RN7A 3KP6A 3JZ6A 3I54A 2OBPA 1IN8A 3KP4A 5FD6A 4U0YA 3UQ8A 4BE0A 5CM0A 4EATA 4I01A 1JJ6C 2L7FP 3PUBA 4IWXA 1WKMA 1R1VA 4OIRF 4DQNA 2W85A 3QYFA 2H6BA 2R6FA 4MA5A 4IOAF 4YR3A 2M1BA 4PUSA 2P7CB 2DPUA 3GTQA 4NUBA 4G94A 3L1PA 3MVPA 3JTHA 1YW8A 2E1CA 2VJ4A 2PN1A 2W9BB 4DL2A 2FEZA 3I4PA 1V55H 3DTKA 4MFEA 1TWGJ 2COBA 3BZKA 4B4CA 1ZGAA 4LFUA 1LQ1A 4PWQA 2EFNA 4JK1X 4G3IA 2VJIA 1G8XA 1CS0A 1FBSA 1E17A 4DIQA 4PSXA 3MFKA 2ELJA 3SFIA 3WTZA 1HSJA 4YQWA 4ZYGA 1HA8A 3JRAA 2W6OA 5FROA 2DWCA 3K70C 4GC7A 4H4KC 2K5CA 1WCMA 4YB8B 5C1OA 5EJCA 3CJNA 3FKIA 3P7NA 1SFXA 2FKLA 3K0LA 2WV0A 3CCSI 3KAJA 2E60A 4F55A 2FK1A 2Y69H 3E0JB 4A3GJ 2CKZB 4M0JA 4RNNA 1UHWA 4Y4RA 5H6QA 4C30A 3V7RA 2BW3B 2W57A 1B8IB 3PNYA 4I76A 1OR7C 1ODDA 3JSLA 2W70A 3LA7A 1LFUP 1JXSA 2R5YB 5ICGA 1ULZA 3TEKA 3BCAA 2NU8B 3KEOA 4LFAH 4MQ9F 3OYJA 4ENNA 3FXUA 4ANJA 4ME6A 3BTIA 4KIBA 3RYPA 4ETSA 1IGNA 1MSFC 1I1MA 3R23A 5K2MA 4YAKB 3GILA 3T7AA 1VQ9I 1BIAA 2XKPA 3CCYA 2XGQA 5HLGA 1XD7A 4EFBA 4RAZA 4ITVA 2Q2TA 4ENMA 1KU2A 4XONA 3IH2A 2ZFUA 3IRRA 3DQVC 1U8RA 4Y13A 2XGEA 3J80W 2AU0A 4F92B 4UV8A 4RNOA 2YRWA 2COGA 3PO3G 2R7SA 1WCMG 3FKIG 3WE3A 3LQQA 4JX6A 4FE7A 4UCVA 2LY9A 2JT1A 3G6YA 5JHUA 1OISA 2MSYA 2V7FA 4QW9A 3GV8B 2R8IA 3SDGA 1O3SA 1O3RA 2YZMA 1Z0XA 2HTJA 1R71A 2FQ4A 3BZ6A 3BQ1A 4ECUA 5JR3A 1JKPC 4PDBA 5DGAA 4C5AA 4NXNH 2E1NA 2PMZN 3U1KA 1E0EA 1EV7A 1GGOA 4JI5H 3AYHB 4UUSA 1U9OA 4Z6YA 1O57A 2ZC2A 1I1SA 5JUMA 4UCOA 1ZRDA 1X3WB 4M9ZA 1S7OA 4F7ZA 2W82A 5HS9A 1KU7A 3DLLF 4FETA 2K85A 4R8UA 1IRZA 2M3AA 1YRNB 1P4XA 4AIKA 1UG0A 4IKFA 4A3CJ 5FLXW 1AUXA 1BL0A 2JA8G 3PO2J 2LKXA 3GJXB 3MR6A 3I12A 2XC7A 3JTGA 4TV8F 3VSLA 4XK4A 3NQOA 1EKFA 3HOZG 1K83A 2DQRA 5F1JA 4R8HA 1MW7A 4W1UA 4RAGA 2BXZA 1TWFJ 4S05A 2HHFB 3DF8A 1QVUA 4XKVA 1G3YA 4QIWE 2VOPA 4GC6A 3ZQHA 2ASJA 4DV1H 3ERED 1JDBB 3UFXB 3WTSC 2V58A 3E1SA 3HOSA 4L9VA 4M3GA 1ZELA 2BXYA 3CD6I 5L3FA 1OWTA 2BGCA 3R60A 4LGWA 3VDXA 5KFXA 4P1WA 2DOAA 2PJRB 3TMOA 2XB0X 2QWWA 1EUDB 4WWCA 2XCLA 1Y1WG 1IN5A 5KFOA 4BE2A 3QQAA 5KT3A 3QWLA 3I4MJ 3RPUD 2XAJA 4ED1A 4XYMB 1LFPA 1TW2A 4RGXA 4S0HB 5CR5A 3PR5B 1B6SA 5KG5A 1YOVB 2FQ3A 2LREA 2KRHA 4U88A 3GIDA 3W2AA 2UXDH 1R5GA 2AS5F 1EUCB 1MBEA 1M6VA 2OD5A 4NZMA 5HS7A 4DV3H 1I27A 2JTVA 2YWVA 3PM1A 5EYRA 4IHWA 1JTXA 5HNHA 5KT5A 2FSWA 5JQGF 3FXOA 2KJCA 2ASLA 4O5VA 4ESFA 1J2XA 3QU6A 2Y4RA 2ACJA 4A2UA 2PVPA 4PFOA 1ZG5A 3V6KA 4MEYF 2Q2UA 2JA7J 4W97A 1FY7A 4OIPF 2LY2A 1A36A 2EQRA 2KRCA 3G6EI 1DGRM 1W1WE 1X2NA 4RM3A 2R7RA 2R7VA 2R86A 2H09A 2JSPA 4DZPA 5CQGA 1QNTA 3N44B 4JV2A 1T95A 4ZTFA 4DYCA 1V5GA 1FJGH 1PX2A 2WYOA 1A6IA 4I0BA 5FJ8G 2AXTC 3RKWA 1IYEA 2M9HA 2R8JA 3P9IA 3CJRB 3SEQA 3DEEA 3PSIA 4HBLA 3ORQA 2FMLA 1HSTA 1Y8RB 4U0WA 3RGZA 4XSZF 2DA4A 5D6FA 3T54A 4O84A 1TNTA 2BZTA 5LMUH 3S1NJ 2K4BA 4XL9A 4FTHA 5EZYF 5IWAH 4DBQA 2WB1A 3CF2A 1OYYA 2QYOA 2FMAA 3KALA 1ZLKA 4FS1A 1Y14B 3RUPA 2HQRA 5A2QZ 1MNEA 4G12A 2HKOA 1MH3A 4NNJA 5F0HA 1ZTRA 2Z16A 4A3FG 3G8DA 3MKLA 5CVRA 4JYAH 3S16J 2HJWA 4EFEA 2UVUA 4NXMH 2A05A 3M07A 1FJLA 4ZOLF 2ID6A 1VQ5I 3MWDA 1T33A 2VQHA 3V4GA 4P55A 5KFDA 1ZR2A 2CYYA 2Z5UA 4B44A 4LF4H 4FX0A 5E3NA 2DN0A 3PNTA 5KCMA 1APLC 1TP4A 3T9DA 4Q4CA 1CKOA 2M0MA 5IYDJ 1V5EA 4PJ0C 1BOAA 2I10A 1SD4A 1W93A 4XQFA 2ZNYA 3F8BA 1EKVA 4I2OA 4ZYEA 4ZQIA 1SANA 1TZLA 2MG4A 1OYWA 5KG0A 1JUSA 3IAM2 3I3LA 4B48A 3W5OA 2EILH 2XPUA 4HEA2 4O7SA 5IT9W 3KZYA 4E6KG 1ZQ3P 4HDUA 3TO9A 4DBRA 4A12A 5FPOA 3ZMVA 3OSNA 4IR1A 1BR2A 3L2QA 4EJTA 4KT5C 3LSMA 5DQHA 4EM2A 4II2A 4EM0B 4Q44A 3RBDA 4XRFA 4UB6C 3GVAA 3DFGA 2AGOA 1QPIA 3K1NA 3AG2H 2X6WA 3ZQQA 3GFMA 5FR9A 5CB4F 1RYRA 4BXXG 2R5ZA 5EEAA 1ETKA 1J09A 1BW6A 5J47A 5JLXA 3QPLA 3U2RA 1VQ4I 4ZI7F 2B0LA 2VI6A 2FX0A 2FPPB 1FSEA 2FJ1A 1UFMA 5DMXA 1CKNB 3WWHA 3GQCA 3GMEA 1A04A 2UVVA 4FFLA 4NQWA 2HPIA 4E7LA 3OL3A 4H0EA 4X6AJ 1A0GA 4NYEA 4DV7H 1D0YA 2OLSA 1D0ZA 3ABTA 4XLHA 1G3SA 3WHCA 3QYEA 1K78A 3GTOA 2UZKA 2NUAB 1TQMA 3N40P 4BBRJ 3PW7A 2V6CA 5JFRA 3WU0A 1BI0A 4HA8A 2K02A 3KAKA 1V4YA 3E3VA 3ZQLA 5DISC 2WE6A 4C2MJ 1AUVA 1EYZA 5K7FA 3DBHB 1XDUA 4HQMA 3S3NA 1YTYA 5CVVA 2VQLA 3H9JA 4KIGA 3CESA 4L9NA 2K4JA 1YG2A 3LFUA 3BA8A 2ZBKA 3LWFA 3ETHA 4JUZA 2LRDA 4YRVA 2XV4S 1H9GA 2FP4B 2DZDA 3KIOA 3BACA 2STWA 1M7JA 3KYDB 3SNOA 3L4KA 2QVOA 3TW6A 5J2TF 3GTPA 5F0FA 1NK3P 5KFRA 3OOUA 2LVSA 4OWRB 5LGUA 4BQQA 5BMZA 1TWHA 4YFKF 1Y6IA 1NH3A 4XX0B 3V42A 2FD5A 4ECSA 2EB7A 4E6NA 4MLOA 2QM3A 2DU9A 5DD8A 1YIJI 5KFSA 1JIHA 3BA9A 1SD7A 1B72B 1USTA 3E6DA 3GTMA 1PUFA 3OYBA 2DYSH
chains in the Genus database with same CATH topology
3G2BA 2I8DA 4MTDA 3AL0C 3S93A 3LL7A 1A0IA 4JV5H 4KT6A 4DR4H 1PJRA 1J5EH 2CW7A 5CQEA 4ZDOA 3IAS2 4JI6H 3A4CA 2L9SA 4ZC3A 3PSFA 4BACA 1EA3A 4XLAA 2KQRA 4IQJA 1S9HA 3PL8A 3TY8A 2XIGA 4PSWA 4BE1A 3M4IA 2VL8A 2KP6A 1M0TA 2X1EA 4LF9H 3KEYA 1MMGA 2MYSA 4BQOA 2R7WA 4MV7A 2VKHA 4AQYH 4PZ6A 3VNNA 2WAQA 3DU5A 2V4JC 3BAAA 1R6RA 2JUGA 2M7AA 3TL4X 3JSNA 4DUYH 4BWSC 2VIXA 4MV9A 4CCOA 2HQAA 4XLEA 4RLQA 3OYGA 4LIUA 3H5NA 3EPZA 1MNDA 4BGDA 4PZ8A 2WY7Q 3K4MA 4XKWA 3IP4B 3ZR8X 3RQ4A 2KMUA 2MC4A 4N4OB 3IG0A 2XAUA 4B3RH 2UUZA 1WJBA 2MABA 3SYTA 1CKNA 2RGRA 4KISA 4XN0A 2E5LH 4D9JA 2Z2SB 4X0GA 1X1BA 2K9MA 3AFHA 3C2HA 3N41B 1GLNA 2X6YA 3QOEA 4BEHB 4HNUA 1YX3A 3OYCA 2UXCH 4OAZA 1BR4A 3I9V2 3DTIA 5KHDA 3GB8B 4U7BA 3L4JA 1XNRH 2L9NA 3CP2A 2CFMA 5D1OB 1FMVA 1MMAA 4IX7A 1N36H 4FASD 4E7SA 1X9NA 2OUMA 1B04A 5TGTA 5LL6b 3CVZA 3TY5A 4LITA 1WJEA 1YX5A 2OV7A 2LH9A 3H9QA 3ONQA 4DJAA 4DV2H 1S68A 3H35A 1T0FC 2CV1A 4LF6H 4YEJA 2KLOA 4LMYA 2LY1A 2F4IA 4LH6A 4NC7A 3T1HH 4HPQA 2UU9H 1D0XA 2IGMA 4J0MA 1N32H 3K4JA 3OIPA 3BG6A 3QODA 3K4KA 4YELA 4J01A 4JI8H 3PNVA 3K3VA 3BCBA 4JQFA 2K3PA 4LFBH 1N75A 2WBMA 2DJIA 3J7AK 1M0WA 3DTEA 4E7IA 4R79A 3ZXSA 1N34H 2W00A 2UUBH 4JI7H 1BGWA 1NG6A 3OYHA 4HSRA 1N78A 2KZVA 2WAFA 5EOYA 2F4VH 3HOTA 4GLXA 2VQEH 1X1CA 2R7OA 1U0JA 1S03G 1X19A 2VOBA 3K10A 1BJTA 1SYXB 4CZCA 3HC7A 2XF5A 1Z2OX 3H5RA 3QYBA 4OX9H 3LSHA 2L5QA 4AU7A 3GBGA 4CH7A 5LD2C 4IQ4A 3SZGA 4CCNA 2HIXA 2VKDA 4XM3A 3S32A 4A2BA 3FKJA 1D1BA 3KX2A 1QU3A 4B3TH 4EEQA 3EUKL 4PJMA 3RTXA 2NOJB 5HOOA 3HUGB 3H20A 1NG7A 2HVQA 1Z2NX 4XOTA 3H9GA 3DKYA 3H5AA 1CKNB 3NBYB 1JI8A 1BOBA 1ERDA 2E5ZA 4JOMA 4GKKH 3CZ6A 3EUAA 4P5OA 4QPQA 1DP3A 1XMOH 1D1AA 3JAMW 2UUAH 3DPTA 1XDNA 2FE3A 2LBFA 3OYNA 4DR2H 4RLFA 2IGNA 2LG4A 3OYAA 3AL0B 1HNWH 3EYYA 3UNGC 3OYDA 2E1MC 2AQEA 2KL4A 2HPMA 3OR2C 4FM9A 3MKWB 3A1YA 3OIQA 5KNLA 3K70D 4CCLA 3S3OA 2Z1DA 4JI0H 2MFZA 3OY9A 3NC0B 3FBNB 4LG3A 3PN1A 3S24A 3LMLA 3K6GA 2R7UA 3OYIA 4OAYA 2GOXB 2HNHA 2K9LA 2Y0SA 2HGSA 2WADA 3OS2A 4PJLA 4NC8A 3UQ8A 5FD6A 4AYBA 4DR7H 4BE0A 3FHNA 4XLFA 4EATA 4LF5H 3PUBA 1L2ZA 3OYEA 4JI1H 3RIZA 1D1CA 2ZM6H 4ZYAA 4JI3H 1HNZH 1IBMH 3QYFA 3U21A 4PUSA 1FVIA 3W1BA 1DGSA 2CFOA 3MMYB 4NUBA 4BDZA 2F5VA 4XLCA 2VJ4A 2X51A 5LMNH 1WJ5A 1KONA 2V1NA 2IS1A 3DTKA 3RGXA 2VJIA 3BG7A 1G8XA 2VJ5A 4XR6A 4NQWB 4PJNA 3RF2A 4F91B 4DIQA 4PSXA 1K6YA 4DGWB 2O5RA 3L2WA 2ELJA 4APMA 1QHGA 1HA8A 5FROA 3K70C 1WJAA 3HKZA 4H4KC 3HG9A 1Z7LA 2K5CA 2KPMA 2FUG2 2V9KA 2W4SA 5BR8H 3VYSB 2VPSA 1MMDA 3L2UA 3KAJA 2CMPA 2E60A 3VSKA 4F55A 2M7BA 3OYMA 4X64H 4RB1A 3E0JB 2X1CA 3C0FB 3HL2A 2VPLA 1HR0H 4Y4RA 4C30A 2BW3B 2W57A 3PNYA 4CUGA 1OR7C 3JSLA 4XORA 4B3XA 4CA0A 2PJRA 3F9KA 4EQ5A 1O75A 4LF7H 3BCAA 4Y33A 5HLTA 3FDYA 4LFAH 3DF7A 3OYJA 4ANJA 3EUHC 3OYFA 3CMMA 4ETSA 4PJJA 4DUZH 3F8NA 1I6UA 4RB3C 3L2PA 3W3CA 4E7ZA 2Q2TA 4EFBA 4RAZA 4ITVA 4DR6H 1SEIA 4ZDLA 4XONA 2ZFUA 4K0KH 3DKXA 3DQVC 4CCKA 4XNFA 3QWUA 3J80W 4DV6H 4F92B 4LFCH 2OC6A 5CPRB 2VB6A 3VYRB 4E4HA 3N43B 2R7SA 4RM2A 4GKJH 1Z3YA 3HPGA 1W36D 2CV0A 4UCVA 4UCSA 2UWMA 1IBKH 3OYKA 2V7FA 4RMNA 4XMYA 4F52A 1MZBA 3BLYA 4PDBA 2Q1ZB 2ZXIA 4NXNH 2Q2EB 3RTRA 2L7KA 1N77A 2VUGA 4RB2C 4U87A 1XNQH 1E0EA 2RQQA 1GYFA 1LKXA 4JI5H 4I7HA 1XK5A 5FD5A 3NBZB 3D5LA 2W1OA 4UCOA 2XF6A 1Z3XA 4X66H 3OMYA 5HVQC 2V26A 2VLAA 4LF8H 4BL0B 2PMZA 2W82A 1DQUA 4FETA 4BXFA 3DWLE 2M3AA 2A5WA 1UG0A 4IKFA 3N6XA 1WJDA 5FLXW 2HIVA 2L2OA 3GJXB 4JI4H 3FBIB 2XC7A 3VSLA 2R7TA 1W36C 2P0WA 2JVGA 3M1CA 3NWTA 1MW7A 2E1MB 3KYLA 4IZZA 2DT7B 2CH0A 4BJTA 4GRIA 4XKVA 3DLAA 5D1OA 1UELB 4XOPA 1G59A 4DV1H 1N33H 2HHHH 2LOOA 4UCTA 1IBLH 3E1SA 3HOSA 4R7RA 3W2VA 1ZELA 2HVRA 2RGVA 2ZSIB 1VZ0A 3VDXA 4BU2A 2CS3A 2DOAA 3MD2A 4P1WA 4ZJZA 3TMOA 3MKZA 4F3QA 2PJRB 2XDVA 2R7XA 4BE2A 4LSXA 4B47A 4KITB 3MWMA 1P8LA 5A2QW 4ZTJA 3RPUD 3CJQB 3ZGKA 3SEZA 1LFPA 3VWBA 4CSWA 2XSJC 3LSIA 2QKLB 1CKMA 1E4GT 4C2UA 2LREA 4E7KA 2KRHA 3W2AA 2UXDH 2CV2A 3RCOA 4LH7A 5D1PA 4M7EA 1IRXA 4DR1H 4B43A 2BVMA 2MCTA 4DV3H 1P9QC 2KHMA 2RREA 2HVSA 2UUCH 3L2VA 2E5NA 5HNHA 3TBIA 1X1AA 2X85A 4UCRA 4C2TA 2BOLA 4ZDPA 4YHHH 2RNGA 3J7AY 3KYHC 4KJZA 4Y3OA 4YY3H 4PFOA 2IGOA 2HZDA 4BUPA 2Q2UA 2VJJA 3OL4A 2O03A 1FKAH 4J00A 2LY2A 4UFZA 2KRCA 1ZHQA 1DGRM 4RM3A 4PK4A 2R7RA 2R7VA 1AA7A 1MMNA 2IS6A 2JSPA 2WY8Q 3OS0A 2IS4A 4CC6A 5CQGA 1LDKB 1Z21A 3N44B 4XKCA 1T95A 3TY9A 4MTEA 4ZTFA 4XN3A 1V5GA 3CP8A 3K4NA 3FMAA 1FJGH 1ZHSA 1Y56A 2WYOA 1X4PA 4DR3H 2XF7A 3BABA 3CJRB 3SEQA 3DEEA 3PSIA 4G6TB 3HXLA 4HG2A 4LSAA 3K4LA 3VYUB 3RGZA 3N42B 3RJ0A 3VYTB 1X1DA 2WA0A 2R7QA 3W1GA 4KHPH 1OLTA 2IXSA 4HRIA 5LMUH 2V6EA 2VQGA 4XL9A 5HNFA 1FMWA 5IWAH 4DBQA 2HU9A 2WB1A 2CUJA 2F6CA 3CF2A 3OWTA 4HNTA 3S3MA 1V9PA 2ZJTA 3KALA 3K4BA 4DOZA 2OWOA 1I94H 5CKTA 1MNEA 2WAEA 4DR5H 4NNJA 4AVZA 5FRNA 2Z16A 1WH2A 4JYAH 2LBFB 4EFEA 4NXMH 3J81W 4CCJA 1WFXA 2IGKA 2LC2A 2VQHA 4RAYA 3NWSA 4DRFA 2VQCA 4B44A 4LF4H 4PZ7A 3PNTA 1DGWY 5KCMA 3OYLA 1E4FT 1CKOA 4X65H 3BC8A 2M0MA 1V5EA 3RSNA 4A2AA 2LYCA 4XQFA 2AQFA 4RZQA 5JHFA 2WDTA 4BDYA 1WJCA 1TZLA 4BJ6C 4N4NB 4E7JA 4Q0YA 3DU6A 2R4GA 4DV0H 3IAM2 3I3LA 4B48A 4DV5H 3W5OA 2JVHA 4HEA2 5IT9W 4E6KG 4DBRA 3IUOA 5FPOA 5FRMA 2X6XA 2KSWA 1BR2A 3DPLC 4QPOA 3L2QA 1XMQH 3LSMA 3D5RC 4II2A 4D1QA 2ZXHA 2DXIA 3LMMA 2X6WA 3M8JA 3ZQQA 1LVKA 2MD0A 4X62H 2X1DA 1J09A 3DPUA 3SDBA 3KXYT 2UV1A 3ZRGA 3AKZA 2ZSHB 3T1YH 2A6TA 4UCUA 1WJFA 2DCEA 4LIVA 4BQNA 5LFAA 2VASA 2HPIA 4E7LA 3OL3A 1UAAA 2VXZA 1AN7A 4DV7H 1D0YA 1V5FA 1D0ZA 2JA2A 4XLHA 3W2WA 4F93B 3QYEA 2QKMB 1TAEA 3H0DA 2YCHA 3N40P 5FPRA 3K4CA 4BEHA 3A2KA 4PFPA 4B3MH 3MKYB 1SAUA 2M4KA 1PYVA 3KAKA 5DISC 2WE6A 2VXDA 2IS2A 1BR1A 3D5SC 4E7HA 2GOMA 2CW8A 4CC5A 4CCMA 2DT6A 3C2GA 3S3NA 2W7NA 2BW3A 2VQLA 3H9JA 3PJRA 3CESA 3LSGA 3LFUA 3GDEA 3BA8A 1X4OA 3ZCOA 3UR3C 2LRDA 4YRVA 1YE9A 4II3A 4DV4H 3OTOH 4BS9A 1Z2PX 4C9YA 3L4KA 1QHHD 2BVLA 3OS1A 1TT0A 3OOUA 4BJ5C 3S8PA 4OWRB 4BQQA 4RB0A 1Y6IA 3V42A 4HSTA 3RR5A 1VS0A 2VQFH 4XKBA 1P16A 2KDOA 2M4GA 3OR1C 1TA8A 4B3SH 4E6NA 4MLOA 2UXBH 2HDWA 3HPHA 3N05A 4JI2H 3PFYA 4IAJA 2CUZA 3BA9A 3L2RA 1HNXH 1SFKA 3LSKA 3OYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1G A;  4EEQ A;  1A0I A;  3RTX A;  2HVQ A;  1V9P A;  3NBY B;  1CKN B;  2VUG A;  2OWO A;  3TY8 A;  1XDN A;  1XK5 A;  3NBZ B;  4UCO A;  4PZ6 A;  3VNN A;  4EFE A;  3BAA A;  3JSN A;  4DRF A;  4PZ7 A;  2HIV A;  1CKO A;  4PZ8 A;  3GJX B;  3NC0 B;  1CKN A;  3PN1 A;  3S24 A;  3W5O A;  3UQ8 A;  5FPO A;  5D1O A;  3GB8 B;  2CFM A;  5D1O B;  4UCT A;  1X9N A;  1B04 A;  1FVI A;  2HVR A;  3W1B A;  1DGS A;  3TY5 A;  4UCU A;  1S68 A;  1P8L A;  1TAE A;  4LH6 A;  1CKM A;  5FPR A;  4LH7 A;  5D1P A;  5DIS C;  2HVS A;  4CC5 A;  4UCR A;  3GDE A;  3BA8 A;  3KYH C;  3JSL A;  4EQ5 A;  2Q2U A;  4UFZ A;  4GLX A;  4CC6 A;  3TY9 A;  3L2P A;  2Q2T A;  4EFB A;  3RR5 A;  1VS0 A;  1P16 A;  1TA8 A;  3QWU A;  4E6N A;  3BAB A;  3BA9 A;  4UCV A;  4UCS A;  2HIX A; 
#chains in the Genus database with same CATH topology
 1XMA A;  3I55 I;  1LDJ A;  4IHY A;  4YJ3 F;  4MTD A;  3IWZ A;  2EK5 A;  3LL7 A;  2X6O A;  2FU4 A;  1P7J A;  1A35 A;  2XD4 A;  3MJF A;  5IYC J;  4YR0 A;  1MKM A;  4ZC3 A;  3MEX A;  2ESH A;  1EA3 A;  1S10 A;  1RNL A;  1VBG A;  3CME I;  2W71 A;  5E25 A;  5ED4 A;  2GA1 A;  2I8C A;  4UY8 I;  2P7V B;  2QQ8 A;  5FFX A;  3IH4 A;  2IBD A;  4J9Q A;  4A3I G;  1M0T A;  2X1E A;  4ON0 A;  1OYI A;  5DV5 A;  2GLT A;  4AQY H;  4PZ6 A;  1LVA A;  2DTZ A;  4A3K J;  1S0M A;  2L0K A;  2DMP A;  3AG3 H;  4CCO A;  2R93 J;  4XBF A;  5IYZ F;  3TQN A;  4A3M G;  3WG7 H;  4RLQ A;  2IW5 A;  3M9A A;  4BH9 A;  1VQL I;  2PX9 A;  4LIU A;  4HF2 A;  3H5N A;  4RUC A;  1UC9 A;  3HTU A;  5GPC A;  3JRC A;  4IRG A;  1RK5 A;  2EJ0 A;  4NC6 A;  4LG0 A;  3QRF F;  2KMU A;  1U78 A;  1SC7 A;  4B3R H;  2UUZ A;  1WJB A;  3LSJ A;  2NU6 B;  1IO2 A;  1P2F A;  3CMA I;  1R22 A;  4HR7 A;  4O2A F;  2E5L H;  1DPR A;  2RNJ A;  2Z2S B;  1X1B A;  2K9M A;  3AFH A;  3GZ6 A;  3GTJ A;  2R92 A;  4J9O A;  4ECV A;  1YX3 A;  4O3R A;  4OIN F;  4RDU A;  1YFH A;  1BR4 A;  3G1O A;  3GB8 B;  5BWR A;  2L9N A;  5E1W A;  2CQK A;  2DAA A;  3ZMU A;  2P8T A;  4HOB A;  2OTJ I;  1A3G A;  3RB3 A;  5TGT A;  3F8F A;  3O8H A;  1IRG A;  4G6Q A;  2PMZ E;  4ECQ A;  2ELH A;  5D5X B;  2OV7 A;  3H9Q A;  3V7S A;  1HLV A;  2W6Q A;  4CMF A;  5BPF A;  1S68 A;  2JRT A;  4JBA A;  1T0F C;  5F0C A;  3HRT A;  4LF6 H;  1VQ7 I;  1FX7 A;  2FMY A;  1IDY A;  1LB2 A;  2F4I A;  3CO6 C;  4NC7 A;  4LH6 A;  2DI3 A;  4HPQ A;  3WOD F;  1C3O A;  2COJ A;  4Q48 A;  1D0X A;  1FIP A;  1HC8 A;  1UC8 A;  3B02 A;  1K79 A;  1WSC A;  3RV3 A;  5KFH A;  1HDP A;  2EPF A;  4J01 A;  3K4K A;  2FJZ A;  2KDZ A;  2R92 G;  3QZ7 A;  4ECY A;  3HSF A;  1T2K A;  4JQF A;  3J7A K;  2DIK A;  2CRG A;  3DTE A;  1AWC A;  2NVX J;  4O4J F;  3QAH A;  4KMU X;  4RCN A;  3GTL A;  4YIF A;  2W9B A;  3FIS A;  2FXA A;  3OYH A;  2IA1 A;  2KZV A;  2GBY A;  3SE7 A;  1ZHF A;  3CF5 F;  2ICW G;  1O7F A;  2LSO A;  3S15 J;  4XYL B;  2F4V H;  3RPU A;  1X1C A;  4WX9 A;  2RAE A;  2YZN A;  4C3I J;  5ERI A;  5L3D A;  4FFO A;  5DGH A;  1LUJ B;  1H88 C;  2YS6 A;  1KC7 A;  2G9W A;  1SYX B;  2HEO A;  2VE9 A;  2M34 A;  2XF5 A;  4QWQ A;  4XIC A;  5KFK A;  3H5R A;  4I6Z A;  2PI0 A;  3LSH A;  5HDK A;  5I5X A;  5EWE A;  3EUH A;  3F8C A;  1IXC A;  1JKJ B;  5LD2 C;  4IQ4 A;  3WTV C;  2V5A A;  2VKD A;  2EIY A;  3H1C A;  4UVB A;  4APM A;  4DL5 A;  1JE8 A;  2DMT A;  1B8I A;  1D1B A;  3D1N I;  3ML6 A;  2R5Y A;  3DXJ F;  1S9F A;  1NG7 A;  4A3E G;  4O3Q A;  1IF1 A;  1ZH5 A;  1J9I A;  5LHG A;  4XZ3 B;  2P4W A;  4QPQ A;  3BQZ A;  5KFA A;  4IRK A;  2FE3 A;  3GZN B;  2WC2 A;  1OFC X;  2C00 A;  4DR2 H;  2EBI A;  2LG4 A;  3FXQ A;  5CVI A;  3AL0 B;  1HNW H;  4IJA A;  1I50 A;  5LOV F;  4O83 A;  1LDD A;  1L0O C;  4YFX F;  3H0G J;  3UNG C;  3OYD A;  2AQE A;  2OCC H;  3MR2 A;  2HPM A;  5I5T A;  3QOP A;  2DA5 A;  1VF9 A;  3UKG A;  2MBF A;  3HGG A;  4AYB N;  3FDS A;  4CCL A;  4D0P A;  3B6A A;  1S8N A;  2W84 A;  4A69 C;  4JI0 H;  2MFZ A;  1WH7 A;  1CQI B;  3CDL A;  2KIS A;  2R7U A;  3EPG A;  5C44 G;  4OAY A;  5I5V A;  2HNH A;  1P92 A;  1PDN C;  4RA2 A;  1BN5 A;  4WCG A;  3KET A;  4V19 K;  3ZN1 A;  3WO1 A;  4A93 G;  4M9U A;  2CSO A;  1K61 A;  3OHA A;  2F5F A;  4DR7 H;  1XDS A;  1ONV A;  4IHV A;  2GQR A;  2DOE A;  4XLF A;  1Z67 A;  1L2Z A;  4BHC A;  3OYE A;  2M05 A;  3QQM A;  4ZH4 F;  1ETQ A;  2L02 A;  1D1C A;  5M5X J;  1XCV A;  1HDD C;  4JI3 H;  1YRN A;  4EJO A;  1BBY A;  3F8M A;  2LD5 A;  3W1B A;  1B9N A;  2PG4 A;  3TW7 A;  1DGS A;  3K9T A;  3Q5F A;  4O81 A;  2CG4 A;  2FPI B;  1IW7 F;  3HKZ N;  1KON A;  2V1N A;  5K5R A;  2YU3 A;  1OPC A;  2F4O B;  4I98 B;  9ANT A;  2W6P A;  3VMM A;  3C1D A;  3ERM A;  3WWI A;  3RGX A;  3BG7 A;  2HGC A;  2CUE A;  1Q1H A;  1R5I D;  4NQW B;  4YIR X;  4PJN A;  4TUY F;  2P5K A;  2GPW A;  1H9T A;  3L2W A;  1K6Y A;  1K78 B;  1I7N A;  2HHF A;  3JRX A;  4YBZ B;  4O3M A;  2DYR H;  4O6J A;  1WJA A;  1I3Q J;  1OCR H;  3HG9 A;  2D5V A;  2KPM A;  2W4S A;  2FUG 2;  5BR8 H;  2WB1 N;  4EJW A;  5KKN B;  1MMD A;  3QPH A;  4C3J J;  4RB1 A;  3PUF A;  5ICC A;  2KT0 A;  1WR2 A;  2X1C A;  1HR0 H;  3FF5 A;  3V8K A;  5J6X A;  2DA3 A;  4CA0 A;  2PJR A;  4XID A;  4HV6 A;  5HLT A;  1YW7 A;  1T98 A;  2TDX A;  3OYF A;  3CMM A;  5LRR A;  1HW1 A;  5A2Q K;  1I6U A;  2OPT A;  3L9F A;  4UUV A;  3U9S A;  5DG8 A;  3MR5 A;  1BA5 A;  4Q8F A;  2V59 A;  5C8Y F;  4K0K H;  1YS6 A;  1I1L A;  4S04 A;  4XSX F;  2YUS A;  2NVY A;  3VYR B;  4E4H A;  4LFC H;  1ZK8 A;  3N43 B;  5FGM A;  4GKJ H;  3HPG A;  2CV0 A;  4QWD A;  5HDN A;  5FLV A;  2UWM A;  2X9D A;  3OYK A;  2RVC A;  2ASD A;  2R8H A;  2PQ8 A;  4XMY A;  2YRX A;  1MZB A;  5DUK A;  2ZXW H;  1T39 A;  2Q1Z B;  5C1P A;  2NS7 A;  2R3S A;  2F48 A;  3LP8 A;  4UHT A;  2HDD A;  2Q2E B;  1FEX A;  2L7K A;  1N77 A;  1FTT A;  4CKC A;  5E8G A;  2K9N A;  1XNQ H;  1T8I A;  4O7N A;  5KG6 A;  2W24 A;  1LKX A;  2GAU A;  3WGH A;  1MNM C;  2MW8 A;  5TRD A;  5HNE A;  2M5W A;  3JCU C;  2GLO A;  2VBW A;  1Z3X A;  4FHT A;  3PIO F;  3GTK A;  4IVN A;  1V3F A;  2LKS A;  1KGS A;  3Q1K A;  2A5W A;  5HS8 A;  2Y0M A;  1WJD A;  4A6E A;  1IOW A;  3PFI A;  1ZN2 A;  4CHI A;  5KFY A;  3VPD A;  3P9C A;  2EJ3 A;  4JI4 H;  3FBI B;  3FXR A;  3GTG A;  3RBE A;  2TCT A;  4UB8 C;  5D5U B;  2OQG A;  2EV6 A;  2W48 A;  4A3D J;  5JQW A;  3G6X A;  3RAX A;  3F0C A;  3MR3 A;  3F3X A;  2JVG A;  3M1C A;  3ABL H;  1Y0U A;  1O4X A;  3DEW A;  2E1M B;  3WGI A;  1ZGJ A;  2P6T A;  2QCO A;  3KYL A;  4Y17 A;  4IZZ A;  1BXR A;  2W7P A;  1XMX A;  3S2D J;  3BJ6 A;  3MFI A;  4AUX A;  1UCR A;  2MH9 A;  1IZ1 A;  1ULY A;  2BQU A;  1EKE A;  1N33 H;  2FOK A;  3KCC A;  5J2U F;  2GWR A;  4M3D A;  3WTW C;  2H94 A;  4R7R A;  3W2V A;  4YAJ B;  5BS6 A;  2HVR A;  3RI4 A;  1VZ0 A;  1JKO C;  5KT6 A;  4D7N A;  1EHI A;  2JPB A;  1WH5 A;  2CS3 A;  3MQ0 A;  4O7Z A;  5KFV A;  3GIJ A;  4F3Q A;  3Q8S B;  5H80 A;  2F5C A;  1KJI A;  4B47 A;  4MAM A;  4LSX A;  3BPV A;  4KIT B;  4M9X A;  3HOW J;  4BY7 J;  3A01 B;  5A2Q W;  1OBG A;  1W7P D;  3F72 A;  3FM5 A;  3ZGK A;  2DPJ A;  2QGU A;  4CSW A;  1CKM A;  4ZZL A;  3R6S A;  4LH7 A;  3BZC A;  4AIH A;  4DR1 H;  4B43 A;  2W9C A;  2P81 A;  3BP8 A;  2KHM A;  2FBK A;  1JKQ C;  3ZOB A;  4IOC F;  1B6A A;  2EV5 A;  4ED6 A;  3L09 A;  3TBI A;  1X1A A;  2Y75 A;  1CF7 B;  3M9M B;  1FYL A;  3LUL A;  1GXP A;  5F08 A;  1Q1V A;  4IXA A;  1OMI A;  4O7R A;  3T9C A;  4EYH B;  1X3Z B;  1QZE A;  5DYM A;  3OHB A;  2V79 A;  3WTX C;  4BUP A;  2HYF A;  2O03 A;  3TQ1 A;  2RV8 A;  3CCV I;  4J00 A;  5IP7 G;  4I4T F;  3GIQ A;  1LJ9 A;  3N6R A;  2QUF A;  2WY8 Q;  3BR6 A;  3ELK A;  5GTH C;  4CC6 A;  1LDK B;  1MGT A;  3RZD J;  4WXC A;  5M3F J;  1HKQ A;  3WU1 B;  1ON2 A;  1JDE A;  3N8D A;  3TY9 A;  5CA1 F;  4XN3 A;  5EZG A;  2XCP A;  3CP8 A;  3K4N A;  2GQS A;  1JXL A;  2OU2 A;  5K1Y A;  1FLI A;  2J6S A;  3VFZ A;  1JGG A;  4DR3 H;  5C4J J;  3HSE A;  4N9I A;  3BQ0 A;  3M9N B;  2DA6 A;  2E2H A;  2DFE A;  5L3C A;  1B6R A;  1FIA A;  3K4L A;  1O3Q A;  3RJ0 A;  2QEX I;  1MBF A;  1R1U A;  2R7Q A;  1XC5 A;  4KHP H;  1D3Y A;  3SZP A;  2R93 A;  1OLT A;  2HWV A;  2MD5 A;  2VQG A;  3HTS B;  2R82 A;  4HYE A;  2HU9 A;  4L0Y B;  4D5F A;  2CUJ A;  2CQQ A;  3S3M A;  3R0A A;  1BC7 C;  5CAE B;  3K4B A;  4DOZ A;  3Q9S A;  2OWO A;  1IG7 A;  3GYH X;  2JN6 A;  3JAM K;  2WAE A;  5EWF A;  4Q8E A;  4AVZ A;  4RNM A;  5FRN A;  1FYK A;  2XPV A;  5BPI A;  3H3V K;  1WI9 A;  4RAY A;  4O7L A;  3DTF A;  4ECX A;  3CMY A;  1B72 A;  1ZRC A;  1RJQ A;  3LFK A;  3OYL A;  3C18 A;  2ZGI A;  4A3K G;  1D5Y A;  3ZMD A;  3O8G A;  3TOB A;  3RSN A;  4A2A A;  1RES A;  2R93 G;  3M7G A;  3CUQ B;  2AQF A;  5K5O A;  5JHF A;  1XSD A;  1WJC A;  2K27 A;  4MV1 A;  3HDD A;  4N4N B;  2RDI A;  2V1U A;  1ETX A;  3TED A;  3Q0U A;  4AM3 A;  1R5H A;  2HI3 A;  3FMQ A;  3IUO A;  1Y1V A;  5FRM A;  2KSW A;  4QPO A;  2R7L A;  5KFM A;  3TDZ C;  3KLN A;  3HOY J;  2E2I J;  1QGP A;  1GXQ A;  3JRF A;  1G2H A;  5K3W A;  2JA6 A;  3LMM A;  1IC8 A;  1NK2 P;  4X62 H;  1ZYR F;  3JW4 A;  1RET A;  5E3O A;  1RJP A;  3FMS A;  3NRV A;  3AKZ A;  4CGZ A;  2N8G A;  1XMK A;  3R5F A;  3T1Y H;  2A6T A;  3RIR A;  4F50 A;  1FC3 A;  1VQK I;  2EFP A;  5LP6 F;  4RU9 A;  2E19 A;  4O3S A;  1V5F A;  2JA5 J;  1TAE A;  5JVL A;  3T5H A;  3NAU A;  5D4R A;  2O0Y A;  1QBJ A;  3LWB A;  1BM9 A;  2OQR A;  2EZH A;  3A2K A;  5C4X G;  4PFP A;  4B3M H;  4CO8 A;  3HRS A;  3MKY B;  1SAU A;  2M87 A;  3KHR A;  2M4K A;  5CE8 A;  4CKB A;  1Y1V G;  1SFE A;  2FBI A;  3ZMT A;  1WGX A;  1BR1 A;  3D5S C;  4GO1 A;  4E7H A;  2Z02 A;  3S1Q J;  2RF4 A;  4FQG A;  5CVJ A;  4AID A;  4AYB E;  4CC5 A;  2O61 A;  3K5I A;  5JVT A;  4IZO A;  3K1P A;  3LSG A;  1EH7 A;  3GDE A;  4K6N A;  2RKH A;  1X4O A;  2I5U A;  2PEX A;  3ZCO A;  1IXS B;  2Y9Z A;  2ODT X;  5KT2 A;  4ED7 A;  1BJZ A;  1YE9 A;  2BQ3 A;  1FZP B;  4II3 A;  4AIJ A;  4LLN A;  1FOK A;  2ESN A;  1KJ9 A;  2HZT A;  3OTO H;  5FNV F;  4HAM A;  3WHB A;  4O2B F;  1U5T B;  1RIO H;  2DOD A;  2C2R A;  1OCP A;  2R7Z J;  4TM5 A;  3CQZ J;  1KU3 A;  1Z6T A;  2BVL A;  4YG2 F;  1VQO I;  5E1Z B;  1KJJ A;  3S8P A;  1TWC J;  3DV8 A;  2DDB A;  1UZC A;  4BBS J;  5EDW A;  4XKB A;  1P16 A;  1SMT A;  2KDO A;  3T1B A;  2R8K A;  2XCA A;  5BNG A;  5IP6 A;  5EZH A;  3HKZ E;  2COM A;  1WI3 A;  3LSK A;  2A6E F;  5FKO A;  1V51 A;  4U7C A;  1XN7 A;  3NEU A;  3HOX G;  4A3J G;  2I8D A;  5H20 A;  5AIQ A;  3AG4 H;  5KFF A;  1A0I A;  5I5Y A;  1KU9 A;  4MHG A;  1PJR A;  5IP9 J;  4DR4 H;  2CW7 A;  2AGP A;  5L1K A;  2L9S A;  2WAQ N;  3PSF A;  4BAC A;  3JRD A;  1REP C;  4O4L F;  5LBQ A;  1SAX A;  3K5H A;  3EPI A;  1B33 N;  1R49 A;  2I80 A;  2WB1 E;  2ISZ A;  4A3B J;  3BJA A;  4BE1 A;  1MMS A;  3O6B B;  4LF9 H;  3KEY A;  2MYS A;  1XGM A;  1YS7 A;  4A6D A;  2VKH A;  4BQO A;  4J19 A;  3DU5 A;  2FOW A;  2V4J C;  1VI0 A;  3TL4 X;  2CQN A;  4DUY H;  2L9R A;  1KJQ A;  4MV9 A;  1XGS A;  4EYI B;  4CZZ A;  2HQA A;  3WTY C;  3RJP A;  4ECZ A;  2VQD A;  4PGG A;  1BNC A;  3K1M A;  4BGD A;  2Z3Y A;  4RUA A;  4XKW A;  2JEJ A;  2L4M A;  2D45 A;  4N4O B;  3IG0 A;  1R00 A;  1W4M A;  4EJU A;  5KFL A;  1YQA A;  2PFB A;  1RPW A;  1W0T A;  4XN0 A;  3WU2 C;  3BOQ A;  1GDT A;  2XAS A;  1TNS A;  4LD5 A;  3CC4 I;  1SD6 A;  3C2H A;  3H92 A;  4J9S A;  2X6Y A;  2ALZ A;  4BEH B;  1PK8 A;  2V9V A;  1ZGW A;  5J4V A;  3OYC A;  2UXC H;  5KHD A;  2B7E A;  3DTI A;  5D8K B;  4U7B A;  3L4J A;  4IR9 A;  1SVO A;  3BT9 A;  2J5O A;  2CFM A;  1NHA A;  1I3Q A;  4IPA A;  2JPC A;  4FAS D;  3LSR A;  5KFN A;  3RZO J;  2TRT A;  3GFL A;  4I50 F;  5KFW A;  4E7S A;  3CCL I;  2OUM A;  1B04 A;  5LL6 b;  1TW3 A;  3CVZ A;  2DT5 A;  1SVL A;  1VFC A;  2DTR A;  4JYK A;  4LIT A;  5KAI C;  5BOX A;  3TY5 A;  3GV5 B;  3CCE I;  2E1O A;  2LH9 A;  3CCQ I;  5B66 C;  2R7M A;  1KQ0 A;  2FK2 A;  4QWB A;  2ZFW A;  3E5X A;  1ZLJ A;  3S1M J;  3G4S I;  4J9P A;  1MD0 A;  2EZK A;  3T1H H;  1WWX A;  5EWG A;  4R1H A;  4J0M A;  3I71 A;  1ZAU A;  2DMU A;  4EBE A;  2J9G A;  4ED0 A;  2DK8 A;  3UYY A;  4G6D A;  3PNV A;  1SFO A;  2XRO A;  3L2C A;  4HX8 A;  1S72 I;  2LR8 A;  2BHZ A;  2EZI A;  2ME0 A;  3GLX A;  2YX4 A;  3BCB A;  3SGI A;  3K3V A;  3RKY A;  4O3P A;  2K3P A;  2W9C B;  4LFB H;  3RQI A;  3DKW A;  3TOA A;  1M0W A;  2BQR A;  5CYV A;  2AQ4 A;  4J9M A;  3ZXS A;  2L3D A;  1ZR4 A;  4JI7 H;  1MBK A;  3JRE A;  1K6O A;  1N78 A;  4CDG A;  4QSH A;  2FLN A;  4GLX A;  2VQE H;  2EV0 A;  3F23 A;  3Q0V A;  4RZR A;  3HZJ A;  3PR4 A;  3DBL B;  2YS7 A;  1YJW I;  5E20 A;  5KG7 A;  4AWX B;  4RS8 A;  1F9N A;  5E17 F;  2H6C A;  3HC7 A;  2IEK A;  1K4S A;  1Z2O X;  1VQP I;  2HDK A;  2XHK A;  3BTL A;  4E4T A;  2M30 A;  5IYB J;  2JSC A;  1F36 A;  4M3F A;  4EBD A;  3BJO A;  2CFX A;  1J0R A;  5F9L A;  3GBG A;  1TWA J;  2XAH A;  1ACI A;  3SZG A;  4A2B A;  2ZME B;  2GM4 A;  4V2F A;  3FKJ A;  1RRJ A;  2JJ7 A;  4TV7 A;  3GF2 A;  5DD4 A;  3KX2 A;  1R9T J;  3EUK L;  4PJM A;  4OIQ F;  3RTX A;  2IRF G;  1G4D A;  5HOO A;  3HUG B;  5GAE J;  5D5V B;  3GII A;  2WV1 A;  5LGN A;  3FX3 A;  3H9G A;  1HQC A;  1QZY A;  3DKY A;  3H5A A;  1LNW A;  1BOB A;  3KE2 A;  5DEQ A;  1U9N A;  4JOM A;  1JI8 A;  3RDI A;  3CZ6 A;  3HM5 A;  2EA2 A;  4P5O A;  1PP7 U;  1XMO H;  1YIO A;  4K2E A;  2WTF A;  3ABU A;  1QRY A;  3H3U A;  2KIF A;  4A3L G;  3U9T A;  5L3B A;  4CYC B;  5L1I A;  4I02 A;  2IGN A;  3RAQ A;  3OYA A;  1M1E B;  3M1E A;  5BMV F;  3J81 K;  5DG9 A;  3EYY A;  2QK4 A;  2VA2 A;  2L7M P;  2R7D A;  4HF1 A;  2CGP A;  4ECT A;  3T5J A;  2CQ7 A;  5B1B H;  2YSR A;  4FM9 A;  3PW0 A;  4DL7 A;  3MKW B;  3CCM I;  2O8K A;  3OIQ A;  4O82 A;  1X2M A;  1JHH A;  2HKX A;  1RUN A;  3WWJ A;  2LF8 A;  2PMU A;  2Z1D A;  4MV6 A;  5JVD F;  5KFZ A;  4O3O A;  3NC0 B;  2KZG A;  3PIP F;  2Q2E A;  1SD5 A;  5F6F A;  2EJ2 A;  3R5X A;  1YI2 I;  4RBO A;  2QSF X;  2K9L A;  2Y0S A;  2HGS A;  4HDV A;  4M72 A;  5KFE A;  1I1G A;  4A3D G;  4KMF A;  1Z05 A;  4NC8 A;  1AKH B;  5I5S A;  3BR5 A;  3FHN A;  4CMD A;  2W7O A;  1Z9C A;  2J6U A;  3ZQI A;  5KFP A;  2OAZ A;  1HF0 A;  3JZI A;  3RIZ A;  3TP3 A;  4HV5 A;  4ZYA A;  1SMY F;  1HNZ H;  1IBM H;  1WQ2 A;  3U21 A;  2HQN A;  4MNU A;  5HDG A;  1VQ8 I;  2KKO A;  1FVI A;  2PBI A;  3MMY B;  5EEH A;  5CA0 F;  1O3T A;  2NVT J;  2DFF A;  4XLC A;  5JI6 A;  3I58 A;  3G3Z A;  5FKK A;  5M5Y J;  1WJ5 A;  2VA3 A;  4X1E A;  2K86 A;  3OUU A;  1JUM A;  1JLL B;  1FP2 A;  3BQY A;  3DP7 A;  5BWX A;  1XS9 A;  4P96 A;  1TWG A;  3RF2 A;  4F91 B;  4QWC A;  1WCM J;  3FKI J;  4DGW B;  2O5R A;  3MZY A;  5BYB A;  2CQY A;  2X48 A;  4G7Z F;  3WNZ A;  3JAM Z;  3BWG A;  2GQQ A;  1U3E M;  4G7H F;  2CNV A;  2GPS A;  4ED2 A;  3IKT A;  4C5C A;  3VYS B;  3L2U A;  2CNQ A;  1MJB A;  2CMP A;  3OYM A;  4X64 H;  1PVE A;  3W6J B;  1YHQ I;  1F43 A;  3LA3 A;  4EEY A;  3C0F B;  4L5I A;  3RPQ A;  3HL2 A;  2VPL A;  4FFP A;  1MSE C;  3CCR I;  1OCO H;  2W9A A;  3JRI A;  3R0J A;  4CUG A;  4XOR A;  1DIK A;  2XGP A;  1KA8 A;  3F9K A;  4EQ5 A;  1O75 A;  3L00 A;  3VOT A;  4Y33 A;  1VQN I;  3FDY A;  5K7H A;  3A01 A;  1FPQ A;  3GFJ A;  4MQV A;  2I87 A;  5GON F;  2XVC A;  3LSP A;  4DUZ H;  1A9X A;  1Z77 A;  3E7L A;  3W3C A;  3GXO A;  3KHH A;  4DR6 H;  4FE2 A;  3S2W A;  4FFM A;  4ZDL A;  1SEI A;  1BIB A;  1RI7 A;  3DKX A;  2V9P A;  2DOF A;  2FRH A;  4OMZ A;  4LB5 A;  3RB0 A;  1V4R A;  1YJN I;  5CPR B;  2VB6 A;  4RAF A;  2XGX A;  2JA8 J;  1RKW A;  1S3J A;  4RM2 A;  2ELK A;  2OH2 A;  4CYD A;  1Z3Y A;  1CF7 A;  4UCS A;  4PCQ A;  2B63 J;  3R61 A;  1MDM B;  4RMN A;  2R84 A;  3HOZ J;  1VTN C;  5FKM A;  5KT4 A;  5ICF A;  4F52 A;  4MV4 A;  2UVW A;  2M2E A;  4ZZD A;  1FBQ A;  2QSH X;  4QW8 A;  2ZXI A;  2A1H A;  4IRI A;  4A3G G;  5J1Y A;  4GYG A;  4O7W A;  4A0Z A;  4GKK H;  2VUG A;  3KHG A;  5EEG A;  3HOU J;  4U87 A;  1RR7 A;  1GYF A;  4IEJ A;  2DA1 A;  2CJJ A;  3I56 I;  1FOY A;  4I7H A;  1IDZ A;  1GO3 E;  1XK5 A;  3BG9 A;  5FD5 A;  3HRM A;  3NBZ B;  3OUZ A;  3E97 A;  4EEF G;  2XF6 A;  3A02 A;  4X66 H;  3OMY A;  5HVQ C;  2V26 A;  2VLA A;  2CO5 A;  2PMZ A;  1DQU A;  1K7A A;  3FXK A;  4O86 A;  3HBL A;  3DWL E;  2ZDG A;  3LQS A;  2NRA C;  3N6X A;  2L2O A;  2IA0 A;  2K40 A;  4M73 A;  2M8E A;  3HB9 A;  2L9V A;  2P5V A;  2W6M A;  3JZF A;  3Q3S A;  4LK1 F;  4U7D A;  4WXH A;  3G8C A;  1X3U A;  2CWE A;  2QYZ A;  4G7O F;  1DAA A;  1S0O A;  3BJY A;  4FFN A;  1TBX A;  2VT3 A;  2DK5 A;  2EIN H;  4YJ2 F;  2HDC A;  2VUM J;  4GRI A;  4BHP A;  1R7J A;  3BDD A;  1MJ9 A;  3ZP5 A;  3DLA A;  1AHD P;  1GSA A;  5D1O A;  3AX6 A;  2DJN A;  5I5U A;  1TWF A;  3GW2 A;  2W8L A;  1G59 A;  3LNQ A;  3F22 A;  2ABJ A;  3OSP A;  4ZHQ F;  2LOO A;  1YIT I;  3LOC A;  4HQE A;  4UCT A;  1IBL H;  3G1L A;  2WAQ E;  4Z2Y A;  2UXN A;  3TIG A;  1HKS A;  2JZY A;  2RGV A;  2ZSI B;  3FWE A;  3TDU C;  3HOV J;  1ETY A;  4ZJZ A;  2KJB A;  3MKZ A;  3KZI C;  3MWE A;  3CUQ A;  2EIJ H;  2X0S A;  2JEG A;  2XAF A;  3MWM A;  2EIK H;  4Q4Z F;  2EH3 A;  3L7W A;  3OSG A;  4ZTJ A;  2X0L A;  3T9A A;  4A3C G;  4IF4 A;  3PO2 G;  3CJQ B;  3VWB A;  2R7Z A;  1S7A A;  1EH8 A;  3CQZ A;  4OIO F;  2XSJ C;  1SFU A;  2QKL B;  1E4G T;  1ZRE A;  4E7K A;  4ESB A;  2JEF A;  4M7E A;  4M6V A;  2VOD A;  3BRO A;  2BVM A;  1ZAO A;  5KFT A;  4B3A A;  3SZT A;  2MCT A;  1P9Q C;  5DM6 F;  1C0W A;  4GLW A;  2RRE A;  1KUT A;  1Z6R A;  1E3P A;  4P9F A;  5KAF C;  4D7M A;  3IRQ A;  2E5N A;  3L2V A;  4Y7N J;  4ESJ A;  3WTU C;  2UUC H;  5J4Y A;  1IN7 A;  2BOL A;  1RUO A;  5KFJ A;  2HFH A;  4ZDP A;  2Z9O A;  4YHH H;  5L1L A;  1RC9 A;  3BPX A;  4BKX A;  3KYH C;  4KJZ A;  3OSF A;  2UVR A;  1XCB A;  1TTY A;  4M6Y A;  5J1R A;  1FKA H;  3OL4 A;  3BY6 A;  1ZHQ A;  4FFR A;  2LP0 A;  4A3F J;  3I5U A;  3IV5 A;  1MMN A;  2IS6 A;  1CE8 A;  4LLG F;  2IS4 A;  3RKQ A;  2JA7 A;  2JA6 G;  2MLK A;  1W7P B;  1Z21 A;  2KFD A;  1ET0 A;  4MTE A;  3T5X A;  2C28 A;  5E1X A;  2R7Z G;  3FMA A;  5ILV A;  4NDL A;  1DUX C;  4WBN F;  1ZHS A;  3CCJ I;  1X4P A;  2XC9 A;  3I4M G;  3TGN A;  3T8R A;  2XF7 A;  2PMH A;  5BPD A;  5LLQ A;  5FFZ A;  3GEZ A;  4KN7 X;  4BBS G;  3FIW A;  5DCM B;  4HG2 A;  5D6E A;  4LSA A;  3G1M A;  3VYU B;  4O7T A;  3AG1 H;  2D1H A;  4L0Z B;  1UJ8 A;  1X1D A;  2WA0 A;  5FLM J;  3W1G A;  3F21 A;  2IXS A;  4HRI A;  4NZN A;  2V6E A;  1U5T A;  4D5C A;  5HNF A;  1FMW A;  4FBT A;  2GIV A;  3OWT A;  3ECO A;  5C3E J;  5D5W B;  3F6V A;  2H1L A;  4OMY A;  3PW5 A;  2YS9 A;  2PBZ A;  1I94 H;  5CKT A;  5F04 A;  2JA7 G;  4DIM A;  1ETO A;  3K2A A;  4DR5 H;  1RZ4 A;  2EFO A;  1E4E B;  4E70 A;  1QZZ A;  5H6R A;  1WH2 A;  3CUO A;  4ENK A;  3GV7 B;  3I53 A;  3KLO A;  4O4H F;  5JH7 F;  2NS0 A;  4CCJ A;  2IGK A;  1ZET A;  3NWS A;  3MN2 A;  1DGW Y;  1E4F T;  5TIS C;  3BC8 A;  1Z91 A;  3Q2O A;  3VA7 A;  5J8F A;  2LYC A;  1R4N B;  4PGH A;  3EET A;  4RZQ A;  2QF7 A;  5HLI A;  2IA6 A;  2Q8K A;  3V8L A;  1GLV A;  4BJ6 C;  5LEJ A;  3A0H C;  4FT8 A;  2P6S A;  1XB4 A;  2R4G A;  3DU6 A;  1GT0 C;  4DV5 H;  1MH4 A;  1JX4 A;  2B9S A;  4L1K A;  5L9X A;  1KYZ A;  2X6X A;  3REO A;  3DPL C;  1XMQ H;  3KP5 A;  4L9J A;  3BTC A;  4D1Q A;  2ZXH A;  4BHB A;  2Y48 A;  3MZ8 A;  3DAA A;  2XSD C;  2QZ8 A;  1TT5 B;  3M8J A;  2W8K A;  2DA7 A;  2MD0 A;  3PVX A;  3QZ8 A;  2IMW P;  1A48 A;  3JR9 A;  4TQS A;  2AO9 A;  2GXG A;  2UV1 A;  3CLO A;  2E7X A;  2QQ9 A;  2ZSH B;  2YPR A;  4HX7 A;  5F27 A;  3GTO J;  3KHL A;  3VOD A;  5LFA A;  2DLL A;  1AN7 A;  2BR0 A;  2VXZ A;  3W2W A;  5IYD G;  2NOG A;  3T9E A;  4F93 B;  2YCH A;  3GUD A;  2NVU B;  1MIJ A;  4BEH A;  2D1V A;  4A5M A;  1UHM A;  1JGS A;  5GPA A;  2AGQ A;  3WTT C;  1MBH A;  1PYV A;  2VBZ A;  2VXD A;  1EZ1 A;  1T0F A;  3BG5 A;  2IS2 A;  2GOM A;  1P4W A;  3SQN A;  5LGT A;  4ZYD A;  4HW0 A;  1ZG3 A;  2CW8 A;  4CCM A;  2DT6 A;  3BR1 A;  3C2G A;  4MGR A;  5M3M J;  1BW5 A;  1HOM A;  4PDK A;  3RYR A;  4EGZ A;  3PJR A;  4GYI A;  1G3T A;  4Q5S F;  1TWA A;  4C2M A;  3GCM A;  1KEE A;  3G6V A;  2VT2 A;  3ZQF A;  3GTP J;  3WO0 A;  2HXI A;  3BG3 A;  5GAG J;  4BNC A;  1BI2 A;  1W5T A;  4EM1 A;  4C9Y A;  1K1S A;  2VN2 A;  3V7C A;  2VOO A;  1Y0N A;  3IHU A;  3OS1 A;  1TT0 A;  3NGD A;  4HLY A;  1TLH B;  4RB0 A;  2FBH A;  1P7I A;  2GIZ A;  2DW4 A;  2QQB A;  1E3H A;  4HST A;  4A3M J;  1VS0 A;  3RR5 A;  3COA C;  1KQ9 A;  2M4G A;  3QPT A;  1TA8 A;  4J9R A;  1LEA A;  3N05 A;  5D4S A;  4IAJ A;  2ATL A;  2A61 A;  2CUF A;  2R87 A;  1MBJ A;  4BBR G;  1HNX H;  4KNY A;  4IWY A;  1SFK A;  2Y0S N;  3H3V H;  1U8B A;  1N48 A;  2R7K A;  1KYW A;  1J59 A;  4Y8V B;  3AL0 C;  4YR2 A;  3W6K B;  3S93 A;  1DV1 A;  5CQE A;  4IRH A;  3IAS 2;  4ZDO A;  3JRW A;  3V4Z A;  4JI6 H;  3PQJ A;  2M8G X;  2XRN A;  2ZJP F;  5J8C A;  4LB6 B;  2Y9Y A;  3H3Z A;  1T38 A;  4XLA A;  2HOE A;  3K3P A;  1QO0 D;  2BV6 A;  1F4K A;  4EBC A;  5DQI A;  3E5U A;  3M4I A;  2DFI A;  3ABM H;  3KEQ A;  5FLM G;  3J7Y J;  3S2H J;  4ASN A;  2KP6 A;  5DDG A;  1ON1 A;  4KA4 A;  1FOX A;  4MV7 A;  2A07 F;  2XKO A;  2OCE A;  4RGR A;  1HKT A;  3BAA A;  3JSN A;  1R6R A;  4XRS A;  1XGN A;  1CGP A;  2VIX A;  2IAI A;  1NTC A;  2M45 A;  2ZME A;  5EDN A;  4FS2 A;  1OBD A;  2Z04 A;  2JUC A;  2OA4 A;  3OYG A;  3CSW A;  3E6C C;  5FLX K;  2DQL A;  3CO7 C;  1I1K A;  1I5Z A;  3HUG A;  3K4M A;  1OKR A;  5F1R A;  1TC3 C;  3IP4 B;  4DQ2 A;  4ZYH A;  1I39 A;  2MC4 A;  4DAA A;  2KIQ A;  5AON A;  2MAB A;  1CKN A;  3RKX A;  3GTJ J;  2V1X A;  5IT3 A;  2R92 J;  4KIS A;  4ECW A;  4D9J A;  2HTS A;  2G7U A;  3IL2 A;  1IUF A;  1Z1D A;  4X0G A;  2JK3 A;  5M5W J;  5IYC G;  4M74 A;  3EQL F;  1GLN A;  3PQK A;  3QOE A;  4EVI A;  4CYC A;  1C30 A;  1B9M A;  3I9V 2;  3S1R J;  4FGR A;  2IA2 A;  4L9T A;  3CP2 A;  5D1O B;  4QLC U;  5E18 F;  1N36 H;  4DL6 A;  2ECB A;  4UUT A;  4XRS G;  1A31 A;  1KJ8 A;  2K9Q A;  1A6Q A;  3ETJ A;  1X9N A;  4BAY A;  3V6H A;  2VPQ A;  1GVD A;  1IJW C;  1WJE A;  1YX5 A;  3W6V A;  4DL4 A;  2YZL A;  1P6R A;  3ONQ A;  1HW2 A;  4WHX A;  2XAG A;  3H35 A;  4RGU A;  2CV1 A;  1ENH A;  2EA4 A;  3IKV A;  4YEJ A;  2KLO A;  4LMY A;  1ZRF A;  1IRF A;  2UU9 H;  2IGM A;  2NYX A;  5GP9 A;  3DCF A;  1AKH A;  4GFB A;  4ED3 A;  4BY1 J;  4UVA A;  3BG6 A;  3V8J A;  2E35 A;  3KP7 A;  4Y15 A;  1H0M A;  1FT9 A;  2W6Z A;  4HYK A;  2LK2 A;  1STZ A;  4CKE A;  4WF2 A;  4EQQ A;  5DLF A;  1S5L C;  2ZJ2 A;  3P9K A;  3VPR A;  1N75 A;  3GTL J;  3M3Y J;  2WTE A;  4G9Y A;  2STT A;  1QPM A;  4ECR A;  1AOY A;  4R79 A;  1JT0 A;  5IPA A;  1KT8 A;  2UUB H;  2B63 A;  2IT0 A;  2NVX A;  1BGW A;  3FK6 A;  1WZ2 A;  1NG6 A;  4WXD A;  2Z33 A;  5KVR A;  2W6N A;  4I99 C;  2MH2 A;  2OF7 A;  4JX4 A;  5FKL A;  1VQM I;  3HOT A;  1JKR C;  2IJL A;  2VKV A;  4UNO A;  4J9N A;  4WD3 A;  1U0J A;  1S03 G;  1YO5 C;  1VBH A;  2VOB A;  4DL3 A;  4IQJ A;  5DQG A;  2DA2 A;  5EGO B;  1W5S A;  4CZC A;  1DU0 A;  4PZJ A;  1USS A;  4OX9 H;  2A3S A;  1UG2 A;  2L5Q A;  2DAO A;  3S14 J;  4F4Z A;  1P4A A;  4AU7 A;  4L5J A;  1F1Z A;  4CH7 A;  5L3E A;  5KFG A;  4FBU A;  2HIX A;  4XM3 A;  5T14 A;  1ZQ7 A;  4KUM A;  4HLX A;  1MJA A;  1XSV A;  5C44 J;  1QU3 A;  3ABK H;  4EGJ A;  3GX4 X;  2VR1 A;  2NNN A;  3BR0 A;  3CTA A;  2EWN A;  4A93 J;  3H20 A;  2B63 G;  2YL2 A;  1Z2N X;  3K69 A;  4CE5 A;  5BPH A;  4EMS A;  1DP3 A;  4KFC A;  1D1A A;  3JAM W;  1EF4 A;  4QWE A;  1MBG A;  1B59 A;  1I50 J;  1R1T A;  4EV0 A;  1XDN A;  2UUA H;  3HIF A;  1FWZ A;  2E2J J;  2R8G A;  2LBF A;  2RQP A;  2CQX A;  4RLF A;  2ZDQ A;  3B6C A;  3HOU G;  4O4I F;  2P5L C;  2VUM A;  2ETH A;  1DU6 A;  5F64 A;  2MC3 A;  2E1M C;  2KL4 A;  3IWF A;  5BWT A;  2FB9 A;  2AHQ A;  4O7V A;  1MDM A;  4PBC A;  2F4M B;  2UXX A;  2YYA A;  3H0G A;  2R85 A;  2E71 A;  5KNL A;  5LRS A;  2A6H F;  3H4D A;  2NVQ J;  3S3O A;  1YYV A;  1VAJ A;  1LE8 B;  3ECH A;  1DV2 A;  2MA3 A;  5DM7 F;  3E6B A;  3S24 A;  4LG3 A;  3LML A;  4O3N A;  5L3G A;  3RB6 A;  4MIM A;  3OYI A;  2C2D A;  2GOX B;  3MAJ A;  2L4A A;  3FM3 A;  2QSG X;  2WAD A;  3OS2 A;  4PJL A;  5IT9 K;  4QIW A;  4AYB A;  1JUP A;  2FA5 A;  2P0A A;  4LF5 H;  5BQT A;  3U9G A;  4LJZ F;  3T5K A;  4JI1 H;  1D8J A;  3TIN A;  2ZM6 H;  5AIP A;  1OCZ H;  2VUM G;  2G7H A;  3KZZ A;  3D0S A;  4WK8 F;  2E36 A;  4I55 F;  2R7F A;  2CFO A;  4BDZ A;  2F5V A;  2X51 A;  3H0G G;  1LPQ A;  1K1Q A;  5LMN H;  2K7L A;  2IS1 A;  2QB5 A;  1Y39 A;  3GO5 A;  3E5N A;  2HOS A;  3LAJ A;  5KFU A;  3HOV G;  5KX5 F;  4XR6 A;  2VJ5 A;  4MV8 A;  2V4R A;  3WG9 A;  3FHZ A;  1QHG A;  3GWZ A;  4RGS A;  1GV5 A;  3Q9V A;  5E3M A;  2ISY A;  2ZJR F;  1WPK A;  3HKZ A;  3JRH A;  1Z7L A;  3HT5 A;  2V9K A;  2NAZ A;  4EG0 A;  3NUA A;  3KFW X;  3VOE A;  2VPS A;  5KT7 A;  4Q4D A;  3KP3 A;  2L7Z A;  2HQ5 A;  4HF0 A;  3FXJ A;  3VSK A;  3ZQ7 A;  1L3L A;  2M7B A;  4KYW A;  1A5J A;  3CC2 I;  2E34 A;  1J5Y A;  2BEO A;  2GXB A;  1JJ8 C;  4QWA A;  4B3X A;  4LF7 H;  5FKN A;  1POG A;  4IO9 F;  1FOW A;  2ZKZ A;  2BHY A;  3DF7 A;  1D8K A;  4I09 A;  3QPS A;  2HYG D;  3EUH C;  3IH3 A;  5KS8 A;  4JP0 A;  2O3F A;  4PJJ A;  3GLL A;  3T9F A;  3KYC B;  3F8N A;  4RB3 C;  3L2P A;  1IXR C;  4E7Z A;  3TQT A;  3MZH A;  4MO7 A;  2NVY J;  3LST A;  5ILU A;  1UHS A;  3FXM A;  4CCK A;  4XNF A;  3QWU A;  3I59 B;  4DV6 H;  2OC6 A;  5EG0 B;  1W5C C;  2VON A;  5L1J A;  2HGW A;  1W36 D;  4OU0 A;  4DLK A;  3RV4 A;  4QJF A;  2LFB A;  2FF4 A;  1IBK H;  5E79 C;  2YW2 A;  3ZMZ A;  2ME6 A;  3VB2 A;  2X4H A;  4DYQ A;  1Y1W J;  2Q7D A;  3H4B A;  3G73 A;  3BLY A;  4IHJ F;  3RTR A;  3GIK A;  3T9B A;  4RB2 C;  1W7P A;  1WHU A;  4ED8 A;  2RQQ A;  4A0X A;  1WRJ A;  2R0Q C;  1GSH A;  3SXY A;  6PAX A;  3GTK J;  5C3E G;  3CUQ C;  2K3F A;  1OR7 A;  1I3A A;  3D5L A;  3EDP A;  2W1O A;  1JT6 A;  4F4Y A;  2J5P A;  5TJJ A;  4LF8 H;  4NLG A;  1QQI A;  4BL0 B;  3FK7 A;  3BTJ A;  5DCM A;  2H1K A;  2LNB A;  2BY0 A;  1EH6 A;  4BXF A;  3RB4 A;  2V9W A;  1X1P A;  4G8X A;  1W0U A;  3GTG J;  1FBU A;  3I4N J;  1T56 A;  5FB2 A;  2HIV A;  3ZMS A;  3IN5 A;  3E6M A;  4NB5 A;  3ORR A;  2LF7 A;  1ORK A;  3V4S A;  4KN4 X;  4TV9 F;  2Q0O A;  1S29 A;  3H36 A;  2ZDH A;  2C6Y A;  4GGG A;  5LA6 F;  2R7T A;  5KFI A;  1W36 C;  2P0W A;  3NWT A;  1HXD A;  3GFI A;  3PW2 A;  1S97 A;  2LKP A;  2HS5 A;  2HYJ A;  2DT7 B;  2CH0 A;  3C3W A;  4GCV A;  4BJT A;  3O2P E;  4M3E A;  1E4E A;  2Y0S E;  1OQY A;  2YU9 J;  3QP5 A;  2O6G E;  3Q8P B;  1UEL B;  4XOP A;  3SHF A;  1SEU A;  3N4M A;  3CLQ A;  1E3O C;  2DBB A;  3J80 Z;  1IN6 A;  2FPG B;  4TVI A;  2HHH H;  2L01 A;  5K5Q A;  4EGQ A;  2YR2 A;  5IP7 J;  3VPC A;  2BYV E;  5KK1 A;  1BI3 A;  5K7Z A;  3CCU I;  3EYI A;  5HBR B;  4Q43 A;  5HLH A;  4BU2 A;  3IC7 A;  3MD2 A;  1Z7U A;  2COI A;  3HSR A;  2XDV A;  5LHI A;  2R7X A;  2W25 A;  3HHG A;  3ASO H;  1P8L A;  5IOY A;  2V4Q A;  2BY3 A;  3M8E A;  2RDP A;  3SEZ A;  2JQ7 A;  4IRD A;  3KPH A;  3LSI A;  4C2U A;  2MLG A;  1UB9 A;  3ZN0 A;  2CV2 A;  1U5T C;  3RCO A;  2VC0 A;  5D1P A;  1IRX A;  1G3W A;  4QTR A;  2C2E A;  5H2F C;  3PFF A;  3O3K A;  1KTA A;  5DAA A;  1B1B A;  2V1D A;  2FLP A;  3GTQ J;  3SI8 A;  2HVS A;  3HEF A;  2LMD A;  1R58 A;  4DW6 A;  3GLK A;  1J7K A;  2QLZ A;  2NU7 B;  3ZQG A;  2X85 A;  4UCR A;  4C2T A;  2PJP A;  3J7Z I;  2KRF A;  1IYD A;  2RNG A;  3J7A Y;  1ZKG A;  4YY3 H;  4Y3O A;  3R5H A;  2HOA A;  2IGO A;  1N25 A;  2HZD A;  5FLX Z;  2VJJ A;  1UNN C;  4F4X A;  4IHS A;  1GSO A;  4UFZ A;  1VQ6 I;  1PP8 F;  4PK4 A;  1AA7 A;  3OS0 A;  2IP2 A;  3S17 J;  1GVJ A;  3VEP A;  4AD9 A;  5EF6 A;  4XKC A;  5I60 A;  3DBR B;  3QFF A;  4MFD A;  3PO3 J;  3AW8 A;  3E5Q A;  2BE5 F;  4GXO A;  4UUS B;  1F5T A;  4GDF A;  4IIJ F;  1Y56 A;  3Q8R B;  2LLK A;  3HOW G;  1S6L A;  1WSU A;  3U55 A;  1XSX A;  2E2H J;  4BY7 G;  5HOD A;  1GUU A;  2R7N A;  3BAB A;  1G6N A;  1XGO A;  3RFC A;  3BQ2 A;  5B1A H;  3J7A O;  5BWV A;  4U0V A;  3M8F A;  2VE8 A;  4L5E A;  4G6T B;  2QEN A;  3TP0 A;  2F2E A;  3CJT B;  1HBX G;  3HXL A;  1WRV A;  4R8U B;  1J75 A;  3N42 B;  5C5J A;  5D8L B;  1IAW A;  4CIC A;  3VYT B;  2EJR A;  2KIU A;  2YZG A;  1H89 C;  3HJE A;  2CU7 A;  1XPX A;  1X58 A;  3A03 A;  3ROU A;  3CC7 I;  2F6C A;  2ZJT A;  4HNT A;  1V9P A;  4O7Y A;  5KFC A;  3AAF A;  3GIM A;  1K4T A;  3BR2 A;  4EJV A;  3Q8Q B;  1CQJ B;  1U6G A;  1I6X A;  1IUY A;  2JRM A;  4Q47 A;  2F5E A;  2LBF B;  2HOT A;  2QBY A;  1W96 A;  2ZCW A;  4Q45 A;  1WFX A;  4B09 A;  3U1D A;  3J81 W;  3H40 A;  2LC2 A;  4JX5 A;  3LAP A;  1RYS A;  4XRM A;  4DRF A;  2VQC A;  2ZJQ F;  2LTP A;  4MEX F;  4PZ7 A;  1AU7 A;  1IV6 A;  4C3H J;  1SCU B;  4UUG A;  5KG4 A;  2OJE D;  4XLN F;  4X65 H;  1S0N A;  4U6P A;  2IVM A;  4L18 B;  2VC1 A;  5BWU A;  2WDT A;  4BDY A;  1ITY A;  5C4X J;  4BXU A;  2DLN A;  3TO6 A;  2A69 F;  1TQP A;  4E7J A;  4Q0Y A;  1Y1V J;  5IY5 H;  4DV0 H;  2JEI A;  1N56 A;  1DDN A;  2VPR A;  4FU0 A;  3ULQ B;  2JVH A;  4A0Y A;  4AC0 A;  3JRB A;  1T6S A;  1DP7 P;  4MA0 A;  3T0Y A;  1ETW A;  5CJ9 A;  4XLP F;  3ZQC A;  2JA6 J;  3LA2 A;  3D5R C;  3I64 A;  1ZG1 A;  4HN2 A;  5DLG A;  2NXN B;  3T99 A;  4J9L A;  3FXL A;  2ID3 A;  4FCY A;  2DXI A;  2NS8 A;  4LK0 F;  2EZL A;  1LVK A;  2E2I A;  2X1D A;  2RDJ A;  1LFB A;  3DPU A;  3SDB A;  3KXY T;  3ASN H;  3I0T A;  3ZRG A;  1IV8 A;  3V6J A;  4Y52 J;  3DTG A;  4UCU A;  2ECC A;  1WJF A;  2OZ6 A;  3UZO A;  2ZB9 A;  1K83 J;  2DCE A;  4LIV A;  4BQN A;  5KG2 A;  2VAS A;  3LQR A;  1BC8 C;  3VPB A;  1UAA A;  1YLF A;  2JA2 A;  2G0E A;  3ESW B;  2EIM H;  2BY1 A;  2QKM B;  4M71 A;  1T36 A;  3H0D A;  1WVR A;  5FPR A;  2O9L A;  3K4C A;  2JA5 A;  1YW9 A;  4OOI A;  3WGG A;  3HOX J;  3SJM A;  4A3J J;  2DPD A;  3KRE A;  1BI1 A;  2AXL A;  4BY1 G;  1R36 A;  3R9R A;  5J40 A;  3SFZ A;  4ENJ A;  1CQT A;  4IL6 C;  1ETV A;  2BW3 A;  2W7N A;  2XB5 A;  1UMQ A;  3DEU A;  2BY2 A;  4A5N A;  3G71 I;  2J6T A;  3UR3 C;  2Y2Z A;  5GTI C;  3HOY G;  4DV4 H;  5I47 A;  4FX4 A;  4BS9 A;  1Z2P X;  3TII A;  1FYM A;  1XG1 A;  2OZU A;  1QHH D;  2ZME C;  5JLW A;  1V54 H;  2DMQ A;  2VBY A;  1KQ8 A;  5LYJ F;  2C35 B;  2XPW A;  4BJ5 C;  5FJ8 J;  1EKP A;  2CW0 F;  2SCU B;  5IOZ A;  5GAD J;  4IRC A;  3FMR A;  3QU3 A;  2XUB A;  4CXF A;  2VQF H;  3KP2 A;  1SVM A;  2GXA A;  3OR1 C;  1TWC A;  4B3S H;  5IT9 Z;  2RC4 A;  2HDW A;  3HPH A;  2XRL A;  4JI2 H;  5KG3 A;  2JA5 G;  3PFY A;  2UXB H;  2CUZ A;  5DGI A;  4LOC A;  3GIP A;  3L2R A;  1E2X A;  4KDP A;  1T3N A;  2QQA A;  3HGY A;  1GV2 A;  1RKT A;  3P5J A;  3JSO A;  4JV1 A;  1T94 A;  2VKE A;  2NNY A;  3G2B A;  4QIW N;  1I7L A;  4JV5 H;  4FE4 A;  4KT6 A;  2HXO A;  1J5E H;  1TQI A;  5KG1 A;  1TL8 A;  5B3S H;  1KBL A;  3WE2 A;  3A4C A;  3HRU A;  2HG8 A;  1H8A C;  1FP1 D;  3R4K A;  1OCT C;  1VND A;  2HR3 A;  2KQR A;  4NBQ A;  1R23 A;  1S9H A;  2ZXJ A;  2QA4 I;  3PL8 A;  5DS9 A;  2PLY A;  2XIG A;  3TY8 A;  4PSW A;  3K7A J;  2ZO4 A;  5EGO A;  2VL8 A;  4BQA A;  1MMG A;  2R7W A;  3OIO A;  5D8D A;  2Z99 A;  3VNN A;  2A5Y B;  2WAQ A;  2XGD A;  2FK3 A;  2JUG A;  2M7A A;  2YX7 A;  4M6X A;  1FTZ A;  2IP4 A;  4BWS C;  3NAR A;  2FNP A;  4B8X A;  3B73 A;  5LXT F;  2FLL A;  4XLE A;  4DNC A;  3JSP A;  1I2L A;  1HCR A;  2H8W A;  2R5Z B;  3EPZ A;  2DMN A;  1MND A;  1ZAR A;  4PZ8 A;  4JV0 A;  2WY7 Q;  1RR8 C;  3M9O B;  3K2Z A;  1IOV A;  3J81 Z;  5CLS A;  3ZR8 X;  1B4A A;  3RQ4 A;  4EGY A;  5DUI A;  1FSH A;  1I2K A;  2X5R A;  5BWW A;  2XAU A;  4UVC A;  5I5W A;  3KTM A;  5KFQ A;  3SYT A;  2IBK A;  2RGR A;  2ZNZ A;  5ILS A;  4IHX A;  4P9U A;  3A0B C;  4UXN A;  5IP9 G;  2H8R A;  1YJ9 I;  5ICE A;  1OCC H;  3T8T A;  3N41 B;  3MFH A;  4HNU A;  2C22 A;  2CZG A;  4OAZ A;  2O8X A;  1XNR H;  1R9T A;  3FZV A;  4UV9 A;  4BXX J;  3M4O J;  2Y30 A;  4A3B G;  1FMV A;  1MMA A;  4IX7 A;  5FO5 A;  1R4M B;  4JXU A;  2ADU A;  2XGC A;  3JRG A;  4YP3 A;  4I0A A;  5DCF A;  3CEB A;  1PUE E;  3PZP A;  4LLL A;  4DJA A;  5HV6 A;  1LE8 A;  2H27 A;  4DV2 H;  3BR3 A;  4DZJ A;  3C7J A;  3HYI A;  2L54 A;  2Y31 A;  1OJL A;  1JTY A;  2E7W A;  2LY1 A;  5F9N A;  4DYR A;  1SFO J;  2CNU A;  2PN6 A;  2MGQ A;  1N32 H;  3K4J A;  2F5D A;  3OIP A;  5J3L A;  3QOD A;  4YEL A;  4F4W A;  1O7L A;  3HHH A;  2NU9 B;  4JI8 H;  5B5E C;  4J9K A;  4HZF A;  3ISP A;  4BYY A;  3PW4 A;  4V2G A;  4YFN F;  1FNN A;  1IN4 A;  2WBM A;  2DJI A;  3UZB A;  4HNV A;  4C5B A;  3U0G A;  4E7I A;  5BYA A;  1PUF B;  1XX5 A;  2GA2 A;  4A3E J;  1N34 H;  2W00 A;  1QVT A;  5E8I A;  4MV3 A;  1GHC A;  2EFW A;  3C2B A;  3QP6 A;  4B1R A;  4HSR A;  2IPQ X;  1Y1W A;  4A3L J;  2WAF A;  5EOY A;  4FIS A;  2DAB A;  2R7O A;  2DPI A;  5DTD A;  5JVG F;  4TQR A;  1X19 A;  3CDH A;  2M0C A;  2JMW A;  4HX4 A;  3K10 A;  2DO7 A;  3N97 A;  1BJT A;  1T08 B;  5DG7 A;  2WWY A;  3T5L A;  4N0B A;  5LEK A;  3QYB A;  2HGX A;  1RK6 A;  3ZPL A;  4CCN A;  1QA6 A;  4NHJ A;  3U54 A;  3Q0W A;  3S32 A;  4CHU A;  2DDA A;  5J1U A;  4IHT A;  5GAH J;  4B3T H;  4EEQ A;  3TKY A;  2EFQ A;  2NOJ B;  3OV8 A;  2HVQ A;  3GZ5 A;  4LG0 B;  4XOT A;  1BJA A;  4KIC A;  1RJR A;  4A3I J;  3NBY B;  2XAQ A;  4M3B A;  1TWH J;  4KIF A;  4AVP A;  2E5Z A;  1ERD A;  4NZO A;  1XTA A;  5KFB A;  1HW5 A;  3EUA A;  2D2W A;  2FNA A;  2A68 F;  3DPT A;  4ABZ A;  1VKZ A;  1S7E A;  2JWT A;  2DFH A;  2OTL I;  3TO7 A;  1U2W A;  3OYN A;  1LEB A;  3MCZ A;  1JHF A;  3I59 A;  2VBX A;  3HO8 A;  5DGB A;  1Y8Q B;  2GZW A;  5EG0 A;  3J80 K;  3GTM J;  2QBY B;  2YU9 A;  1KZH A;  5LHH A;  1DPU A;  1D5V A;  3OR2 C;  2K9S A;  3X2Q H;  4M9S A;  4HQ6 A;  5CVU A;  1EJ9 A;  5IYB G;  3A1Y A;  3CDI A;  2LDU A;  1G2W A;  3K70 D;  3F6O A;  4N9H A;  5E3L A;  3OY9 A;  2KIM A;  3I4N G;  3OOP A;  3FBN B;  2O7O A;  1I6H J;  3PN1 A;  3K6G A;  4YII A;  2BBY A;  2RN7 A;  3KP6 A;  3JZ6 A;  3I54 A;  2OBP A;  1IN8 A;  3KP4 A;  5FD6 A;  4U0Y A;  3UQ8 A;  4BE0 A;  5CM0 A;  4EAT A;  4I01 A;  1JJ6 C;  2L7F P;  3PUB A;  4IWX A;  1WKM A;  1R1V A;  4OIR F;  4DQN A;  2W85 A;  3QYF A;  2H6B A;  2R6F A;  4MA5 A;  4IOA F;  4YR3 A;  2M1B A;  4PUS A;  2P7C B;  2DPU A;  3GTQ A;  4NUB A;  4G94 A;  3L1P A;  3MVP A;  3JTH A;  1YW8 A;  2E1C A;  2VJ4 A;  2PN1 A;  2W9B B;  4DL2 A;  2FEZ A;  3I4P A;  1V55 H;  3DTK A;  4MFE A;  1TWG J;  2COB A;  3BZK A;  4B4C A;  1ZGA A;  4LFU A;  1LQ1 A;  4PWQ A;  2EFN A;  4JK1 X;  4G3I A;  2VJI A;  1G8X A;  1CS0 A;  1FBS A;  1E17 A;  4DIQ A;  4PSX A;  3MFK A;  2ELJ A;  3SFI A;  3WTZ A;  1HSJ A;  4YQW A;  4ZYG A;  1HA8 A;  3JRA A;  2W6O A;  5FRO A;  2DWC A;  3K70 C;  4GC7 A;  4H4K C;  2K5C A;  1WCM A;  4YB8 B;  5C1O A;  5EJC A;  3CJN A;  3FKI A;  3P7N A;  1SFX A;  2FKL A;  3K0L A;  2WV0 A;  3CCS I;  3KAJ A;  2E60 A;  4F55 A;  2FK1 A;  2Y69 H;  3E0J B;  4A3G J;  2CKZ B;  4M0J A;  4RNN A;  1UHW A;  4Y4R A;  5H6Q A;  4C30 A;  3V7R A;  2BW3 B;  2W57 A;  1B8I B;  3PNY A;  4I76 A;  1OR7 C;  1ODD A;  3JSL A;  2W70 A;  3LA7 A;  1LFU P;  1JXS A;  2R5Y B;  5ICG A;  1ULZ A;  3TEK A;  3BCA A;  2NU8 B;  3KEO A;  4LFA H;  4MQ9 F;  3OYJ A;  4ENN A;  3FXU A;  4ANJ A;  4ME6 A;  3BTI A;  4KIB A;  3RYP A;  4ETS A;  1IGN A;  1MSF C;  1I1M A;  3R23 A;  5K2M A;  4YAK B;  3GIL A;  3T7A A;  1VQ9 I;  1BIA A;  2XKP A;  3CCY A;  2XGQ A;  5HLG A;  1XD7 A;  4EFB A;  4RAZ A;  4ITV A;  2Q2T A;  4ENM A;  1KU2 A;  4XON A;  3IH2 A;  2ZFU A;  3IRR A;  3DQV C;  1U8R A;  4Y13 A;  2XGE A;  3J80 W;  2AU0 A;  4F92 B;  4UV8 A;  4RNO A;  2YRW A;  2COG A;  3PO3 G;  2R7S A;  1WCM G;  3FKI G;  3WE3 A;  3LQQ A;  4JX6 A;  4FE7 A;  4UCV A;  2LY9 A;  2JT1 A;  3G6Y A;  5JHU A;  1OIS A;  2MSY A;  2V7F A;  4QW9 A;  3GV8 B;  2R8I A;  3SDG A;  1O3S A;  1O3R A;  2YZM A;  1Z0X A;  2HTJ A;  1R71 A;  2FQ4 A;  3BZ6 A;  3BQ1 A;  4ECU A;  5JR3 A;  1JKP C;  4PDB A;  5DGA A;  4C5A A;  4NXN H;  2E1N A;  2PMZ N;  3U1K A;  1E0E A;  1EV7 A;  1GGO A;  4JI5 H;  3AYH B;  4UUS A;  1U9O A;  4Z6Y A;  1O57 A;  2ZC2 A;  1I1S A;  5JUM A;  4UCO A;  1ZRD A;  1X3W B;  4M9Z A;  1S7O A;  4F7Z A;  2W82 A;  5HS9 A;  1KU7 A;  3DLL F;  4FET A;  2K85 A;  4R8U A;  1IRZ A;  2M3A A;  1YRN B;  1P4X A;  4AIK A;  1UG0 A;  4IKF A;  4A3C J;  5FLX W;  1AUX A;  1BL0 A;  2JA8 G;  3PO2 J;  2LKX A;  3GJX B;  3MR6 A;  3I12 A;  2XC7 A;  3JTG A;  4TV8 F;  3VSL A;  4XK4 A;  3NQO A;  1EKF A;  3HOZ G;  1K83 A;  2DQR A;  5F1J A;  4R8H A;  1MW7 A;  4W1U A;  4RAG A;  2BXZ A;  1TWF J;  4S05 A;  2HHF B;  3DF8 A;  1QVU A;  4XKV A;  1G3Y A;  4QIW E;  2VOP A;  4GC6 A;  3ZQH A;  2ASJ A;  4DV1 H;  3ERE D;  1JDB B;  3UFX B;  3WTS C;  2V58 A;  3E1S A;  3HOS A;  4L9V A;  4M3G A;  1ZEL A;  2BXY A;  3CD6 I;  5L3F A;  1OWT A;  2BGC A;  3R60 A;  4LGW A;  3VDX A;  5KFX A;  4P1W A;  2DOA A;  2PJR B;  3TMO A;  2XB0 X;  2QWW A;  1EUD B;  4WWC A;  2XCL A;  1Y1W G;  1IN5 A;  5KFO A;  4BE2 A;  3QQA A;  5KT3 A;  3QWL A;  3I4M J;  3RPU D;  2XAJ A;  4ED1 A;  4XYM B;  1LFP A;  1TW2 A;  4RGX A;  4S0H B;  5CR5 A;  3PR5 B;  1B6S A;  5KG5 A;  1YOV B;  2FQ3 A;  2LRE A;  2KRH A;  4U88 A;  3GID A;  3W2A A;  2UXD H;  1R5G A;  2AS5 F;  1EUC B;  1MBE A;  1M6V A;  2OD5 A;  4NZM A;  5HS7 A;  4DV3 H;  1I27 A;  2JTV A;  2YWV A;  3PM1 A;  5EYR A;  4IHW A;  1JTX A;  5HNH A;  5KT5 A;  2FSW A;  5JQG F;  3FXO A;  2KJC A;  2ASL A;  4O5V A;  4ESF A;  1J2X A;  3QU6 A;  2Y4R A;  2ACJ A;  4A2U A;  2PVP A;  4PFO A;  1ZG5 A;  3V6K A;  4MEY F;  2Q2U A;  2JA7 J;  4W97 A;  1FY7 A;  4OIP F;  2LY2 A;  1A36 A;  2EQR A;  2KRC A;  3G6E I;  1DGR M;  1W1W E;  1X2N A;  4RM3 A;  2R7R A;  2R7V A;  2R86 A;  2H09 A;  2JSP A;  4DZP A;  5CQG A;  1QNT A;  3N44 B;  4JV2 A;  1T95 A;  4ZTF A;  4DYC A;  1V5G A;  1FJG H;  1PX2 A;  2WYO A;  1A6I A;  4I0B A;  5FJ8 G;  2AXT C;  3RKW A;  1IYE A;  2M9H A;  2R8J A;  3P9I A;  3CJR B;  3SEQ A;  3DEE A;  3PSI A;  4HBL A;  3ORQ A;  2FML A;  1HST A;  1Y8R B;  4U0W A;  3RGZ A;  4XSZ F;  2DA4 A;  5D6F A;  3T54 A;  4O84 A;  1TNT A;  2BZT A;  5LMU H;  3S1N J;  2K4B A;  4XL9 A;  4FTH A;  5EZY F;  5IWA H;  4DBQ A;  2WB1 A;  3CF2 A;  1OYY A;  2QYO A;  2FMA A;  3KAL A;  1ZLK A;  4FS1 A;  1Y14 B;  3RUP A;  2HQR A;  5A2Q Z;  1MNE A;  4G12 A;  2HKO A;  1MH3 A;  4NNJ A;  5F0H A;  1ZTR A;  2Z16 A;  4A3F G;  3G8D A;  3MKL A;  5CVR A;  4JYA H;  3S16 J;  2HJW A;  4EFE A;  2UVU A;  4NXM H;  2A05 A;  3M07 A;  1FJL A;  4ZOL F;  2ID6 A;  1VQ5 I;  3MWD A;  1T33 A;  2VQH A;  3V4G A;  4P55 A;  5KFD A;  1ZR2 A;  2CYY A;  2Z5U A;  4B44 A;  4LF4 H;  4FX0 A;  5E3N A;  2DN0 A;  3PNT A;  5KCM A;  1APL C;  1TP4 A;  3T9D A;  4Q4C A;  1CKO A;  2M0M A;  5IYD J;  1V5E A;  4PJ0 C;  1BOA A;  2I10 A;  1SD4 A;  1W93 A;  4XQF A;  2ZNY A;  3F8B A;  1EKV A;  4I2O A;  4ZYE A;  4ZQI A;  1SAN A;  1TZL A;  2MG4 A;  1OYW A;  5KG0 A;  1JUS A;  3IAM 2;  3I3L A;  4B48 A;  3W5O A;  2EIL H;  2XPU A;  4HEA 2;  4O7S A;  5IT9 W;  3KZY A;  4E6K G;  1ZQ3 P;  4HDU A;  3TO9 A;  4DBR A;  4A12 A;  5FPO A;  3ZMV A;  3OSN A;  4IR1 A;  1BR2 A;  3L2Q A;  4EJT A;  4KT5 C;  3LSM A;  5DQH A;  4EM2 A;  4II2 A;  4EM0 B;  4Q44 A;  3RBD A;  4XRF A;  4UB6 C;  3GVA A;  3DFG A;  2AGO A;  1QPI A;  3K1N A;  3AG2 H;  2X6W A;  3ZQQ A;  3GFM A;  5FR9 A;  5CB4 F;  1RYR A;  4BXX G;  2R5Z A;  5EEA A;  1ETK A;  1J09 A;  1BW6 A;  5J47 A;  5JLX A;  3QPL A;  3U2R A;  1VQ4 I;  4ZI7 F;  2B0L A;  2VI6 A;  2FX0 A;  2FPP B;  1FSE A;  2FJ1 A;  1UFM A;  5DMX A;  1CKN B;  3WWH A;  3GQC A;  3GME A;  1A04 A;  2UVV A;  4FFL A;  4NQW A;  2HPI A;  4E7L A;  3OL3 A;  4H0E A;  4X6A J;  1A0G A;  4NYE A;  4DV7 H;  1D0Y A;  2OLS A;  1D0Z A;  3ABT A;  4XLH A;  1G3S A;  3WHC A;  3QYE A;  1K78 A;  3GTO A;  2UZK A;  2NUA B;  1TQM A;  3N40 P;  4BBR J;  3PW7 A;  2V6C A;  5JFR A;  3WU0 A;  1BI0 A;  4HA8 A;  2K02 A;  3KAK A;  1V4Y A;  3E3V A;  3ZQL A;  5DIS C;  2WE6 A;  4C2M J;  1AUV A;  1EYZ A;  5K7F A;  3DBH B;  1XDU A;  4HQM A;  3S3N A;  1YTY A;  5CVV A;  2VQL A;  3H9J A;  4KIG A;  3CES A;  4L9N A;  2K4J A;  1YG2 A;  3LFU A;  3BA8 A;  2ZBK A;  3LWF A;  3ETH A;  4JUZ A;  2LRD A;  4YRV A;  2XV4 S;  1H9G A;  2FP4 B;  2DZD A;  3KIO A;  3BAC A;  2STW A;  1M7J A;  3KYD B;  3SNO A;  3L4K A;  2QVO A;  3TW6 A;  5J2T F;  3GTP A;  5F0F A;  1NK3 P;  5KFR A;  3OOU A;  2LVS A;  4OWR B;  5LGU A;  4BQQ A;  5BMZ A;  1TWH A;  4YFK F;  1Y6I A;  1NH3 A;  4XX0 B;  3V42 A;  2FD5 A;  4ECS A;  2EB7 A;  4E6N A;  4MLO A;  2QM3 A;  2DU9 A;  5DD8 A;  1YIJ I;  5KFS A;  1JIH A;  3BA9 A;  1SD7 A;  1B72 B;  1UST A;  3E6D A;  3GTM A;  1PUF A;  3OYB A;  2DYS H; 
#chains in the Genus database with same CATH homology
 3G2B A;  2I8D A;  4MTD A;  3AL0 C;  3S93 A;  3LL7 A;  1A0I A;  4JV5 H;  4KT6 A;  4DR4 H;  1PJR A;  1J5E H;  2CW7 A;  5CQE A;  4ZDO A;  3IAS 2;  4JI6 H;  3A4C A;  2L9S A;  4ZC3 A;  3PSF A;  4BAC A;  1EA3 A;  4XLA A;  2KQR A;  4IQJ A;  1S9H A;  3PL8 A;  3TY8 A;  2XIG A;  4PSW A;  4BE1 A;  3M4I A;  2VL8 A;  2KP6 A;  1M0T A;  2X1E A;  4LF9 H;  3KEY A;  1MMG A;  2MYS A;  4BQO A;  2R7W A;  4MV7 A;  2VKH A;  4AQY H;  4PZ6 A;  3VNN A;  2WAQ A;  3DU5 A;  2V4J C;  3BAA A;  1R6R A;  2JUG A;  2M7A A;  3TL4 X;  3JSN A;  4DUY H;  4BWS C;  2VIX A;  4MV9 A;  4CCO A;  2HQA A;  4XLE A;  4RLQ A;  3OYG A;  4LIU A;  3H5N A;  3EPZ A;  1MND A;  4BGD A;  4PZ8 A;  2WY7 Q;  3K4M A;  4XKW A;  3IP4 B;  3ZR8 X;  3RQ4 A;  2KMU A;  2MC4 A;  4N4O B;  3IG0 A;  2XAU A;  4B3R H;  2UUZ A;  1WJB A;  2MAB A;  3SYT A;  1CKN A;  2RGR A;  4KIS A;  4XN0 A;  2E5L H;  4D9J A;  2Z2S B;  4X0G A;  1X1B A;  2K9M A;  3AFH A;  3C2H A;  3N41 B;  1GLN A;  2X6Y A;  3QOE A;  4BEH B;  4HNU A;  1YX3 A;  3OYC A;  2UXC H;  4OAZ A;  1BR4 A;  3I9V 2;  3DTI A;  5KHD A;  3GB8 B;  4U7B A;  3L4J A;  1XNR H;  2L9N A;  3CP2 A;  2CFM A;  5D1O B;  1FMV A;  1MMA A;  4IX7 A;  1N36 H;  4FAS D;  4E7S A;  1X9N A;  2OUM A;  1B04 A;  5TGT A;  5LL6 b;  3CVZ A;  3TY5 A;  4LIT A;  1WJE A;  1YX5 A;  2OV7 A;  2LH9 A;  3H9Q A;  3ONQ A;  4DJA A;  4DV2 H;  1S68 A;  3H35 A;  1T0F C;  2CV1 A;  4LF6 H;  4YEJ A;  2KLO A;  4LMY A;  2LY1 A;  2F4I A;  4LH6 A;  4NC7 A;  3T1H H;  4HPQ A;  2UU9 H;  1D0X A;  2IGM A;  4J0M A;  1N32 H;  3K4J A;  3OIP A;  3BG6 A;  3QOD A;  3K4K A;  4YEL A;  4J01 A;  4JI8 H;  3PNV A;  3K3V A;  3BCB A;  4JQF A;  2K3P A;  4LFB H;  1N75 A;  2WBM A;  2DJI A;  3J7A K;  1M0W A;  3DTE A;  4E7I A;  4R79 A;  3ZXS A;  1N34 H;  2W00 A;  2UUB H;  4JI7 H;  1BGW A;  1NG6 A;  3OYH A;  4HSR A;  1N78 A;  2KZV A;  2WAF A;  5EOY A;  2F4V H;  3HOT A;  4GLX A;  2VQE H;  1X1C A;  2R7O A;  1U0J A;  1S03 G;  1X19 A;  2VOB A;  3K10 A;  1BJT A;  1SYX B;  4CZC A;  3HC7 A;  2XF5 A;  1Z2O X;  3H5R A;  3QYB A;  4OX9 H;  3LSH A;  2L5Q A;  4AU7 A;  3GBG A;  4CH7 A;  5LD2 C;  4IQ4 A;  3SZG A;  4CCN A;  2HIX A;  2VKD A;  4XM3 A;  3S32 A;  4A2B A;  3FKJ A;  1D1B A;  3KX2 A;  1QU3 A;  4B3T H;  4EEQ A;  3EUK L;  4PJM A;  3RTX A;  2NOJ B;  5HOO A;  3HUG B;  3H20 A;  1NG7 A;  2HVQ A;  1Z2N X;  4XOT A;  3H9G A;  3DKY A;  3H5A A;  1CKN B;  3NBY B;  1JI8 A;  1BOB A;  1ERD A;  2E5Z A;  4JOM A;  4GKK H;  3CZ6 A;  3EUA A;  4P5O A;  4QPQ A;  1DP3 A;  1XMO H;  1D1A A;  3JAM W;  2UUA H;  3DPT A;  1XDN A;  2FE3 A;  2LBF A;  3OYN A;  4DR2 H;  4RLF A;  2IGN A;  2LG4 A;  3OYA A;  3AL0 B;  1HNW H;  3EYY A;  3UNG C;  3OYD A;  2E1M C;  2AQE A;  2KL4 A;  2HPM A;  3OR2 C;  4FM9 A;  3MKW B;  3A1Y A;  3OIQ A;  5KNL A;  3K70 D;  4CCL A;  3S3O A;  2Z1D A;  4JI0 H;  2MFZ A;  3OY9 A;  3NC0 B;  3FBN B;  4LG3 A;  3PN1 A;  3S24 A;  3LML A;  3K6G A;  2R7U A;  3OYI A;  4OAY A;  2GOX B;  2HNH A;  2K9L A;  2Y0S A;  2HGS A;  2WAD A;  3OS2 A;  4PJL A;  4NC8 A;  3UQ8 A;  5FD6 A;  4AYB A;  4DR7 H;  4BE0 A;  3FHN A;  4XLF A;  4EAT A;  4LF5 H;  3PUB A;  1L2Z A;  3OYE A;  4JI1 H;  3RIZ A;  1D1C A;  2ZM6 H;  4ZYA A;  4JI3 H;  1HNZ H;  1IBM H;  3QYF A;  3U21 A;  4PUS A;  1FVI A;  3W1B A;  1DGS A;  2CFO A;  3MMY B;  4NUB A;  4BDZ A;  2F5V A;  4XLC A;  2VJ4 A;  2X51 A;  5LMN H;  1WJ5 A;  1KON A;  2V1N A;  2IS1 A;  3DTK A;  3RGX A;  2VJI A;  3BG7 A;  1G8X A;  2VJ5 A;  4XR6 A;  4NQW B;  4PJN A;  3RF2 A;  4F91 B;  4DIQ A;  4PSX A;  1K6Y A;  4DGW B;  2O5R A;  3L2W A;  2ELJ A;  4APM A;  1QHG A;  1HA8 A;  5FRO A;  3K70 C;  1WJA A;  3HKZ A;  4H4K C;  3HG9 A;  1Z7L A;  2K5C A;  2KPM A;  2FUG 2;  2V9K A;  2W4S A;  5BR8 H;  3VYS B;  2VPS A;  1MMD A;  3L2U A;  3KAJ A;  2CMP A;  2E60 A;  3VSK A;  4F55 A;  2M7B A;  3OYM A;  4X64 H;  4RB1 A;  3E0J B;  2X1C A;  3C0F B;  3HL2 A;  2VPL A;  1HR0 H;  4Y4R A;  4C30 A;  2BW3 B;  2W57 A;  3PNY A;  4CUG A;  1OR7 C;  3JSL A;  4XOR A;  4B3X A;  4CA0 A;  2PJR A;  3F9K A;  4EQ5 A;  1O75 A;  4LF7 H;  3BCA A;  4Y33 A;  5HLT A;  3FDY A;  4LFA H;  3DF7 A;  3OYJ A;  4ANJ A;  3EUH C;  3OYF A;  3CMM A;  4ETS A;  4PJJ A;  4DUZ H;  3F8N A;  1I6U A;  4RB3 C;  3L2P A;  3W3C A;  4E7Z A;  2Q2T A;  4EFB A;  4RAZ A;  4ITV A;  4DR6 H;  1SEI A;  4ZDL A;  4XON A;  2ZFU A;  4K0K H;  3DKX A;  3DQV C;  4CCK A;  4XNF A;  3QWU A;  3J80 W;  4DV6 H;  4F92 B;  4LFC H;  2OC6 A;  5CPR B;  2VB6 A;  3VYR B;  4E4H A;  3N43 B;  2R7S A;  4RM2 A;  4GKJ H;  1Z3Y A;  3HPG A;  1W36 D;  2CV0 A;  4UCV A;  4UCS A;  2UWM A;  1IBK H;  3OYK A;  2V7F A;  4RMN A;  4XMY A;  4F52 A;  1MZB A;  3BLY A;  4PDB A;  2Q1Z B;  2ZXI A;  4NXN H;  2Q2E B;  3RTR A;  2L7K A;  1N77 A;  2VUG A;  4RB2 C;  4U87 A;  1XNQ H;  1E0E A;  2RQQ A;  1GYF A;  1LKX A;  4JI5 H;  4I7H A;  1XK5 A;  5FD5 A;  3NBZ B;  3D5L A;  2W1O A;  4UCO A;  2XF6 A;  1Z3X A;  4X66 H;  3OMY A;  5HVQ C;  2V26 A;  2VLA A;  4LF8 H;  4BL0 B;  2PMZ A;  2W82 A;  1DQU A;  4FET A;  4BXF A;  3DWL E;  2M3A A;  2A5W A;  1UG0 A;  4IKF A;  3N6X A;  1WJD A;  5FLX W;  2HIV A;  2L2O A;  3GJX B;  4JI4 H;  3FBI B;  2XC7 A;  3VSL A;  2R7T A;  1W36 C;  2P0W A;  2JVG A;  3M1C A;  3NWT A;  1MW7 A;  2E1M B;  3KYL A;  4IZZ A;  2DT7 B;  2CH0 A;  4BJT A;  4GRI A;  4XKV A;  3DLA A;  5D1O A;  1UEL B;  4XOP A;  1G59 A;  4DV1 H;  1N33 H;  2HHH H;  2LOO A;  4UCT A;  1IBL H;  3E1S A;  3HOS A;  4R7R A;  3W2V A;  1ZEL A;  2HVR A;  2RGV A;  2ZSI B;  1VZ0 A;  3VDX A;  4BU2 A;  2CS3 A;  2DOA A;  3MD2 A;  4P1W A;  4ZJZ A;  3TMO A;  3MKZ A;  4F3Q A;  2PJR B;  2XDV A;  2R7X A;  4BE2 A;  4LSX A;  4B47 A;  4KIT B;  3MWM A;  1P8L A;  5A2Q W;  4ZTJ A;  3RPU D;  3CJQ B;  3ZGK A;  3SEZ A;  1LFP A;  3VWB A;  4CSW A;  2XSJ C;  3LSI A;  2QKL B;  1CKM A;  1E4G T;  4C2U A;  2LRE A;  4E7K A;  2KRH A;  3W2A A;  2UXD H;  2CV2 A;  3RCO A;  4LH7 A;  5D1P A;  4M7E A;  1IRX A;  4DR1 H;  4B43 A;  2BVM A;  2MCT A;  4DV3 H;  1P9Q C;  2KHM A;  2RRE A;  2HVS A;  2UUC H;  3L2V A;  2E5N A;  5HNH A;  3TBI A;  1X1A A;  2X85 A;  4UCR A;  4C2T A;  2BOL A;  4ZDP A;  4YHH H;  2RNG A;  3J7A Y;  3KYH C;  4KJZ A;  4Y3O A;  4YY3 H;  4PFO A;  2IGO A;  2HZD A;  4BUP A;  2Q2U A;  2VJJ A;  3OL4 A;  2O03 A;  1FKA H;  4J00 A;  2LY2 A;  4UFZ A;  2KRC A;  1ZHQ A;  1DGR M;  4RM3 A;  4PK4 A;  2R7R A;  2R7V A;  1AA7 A;  1MMN A;  2IS6 A;  2JSP A;  2WY8 Q;  3OS0 A;  2IS4 A;  4CC6 A;  5CQG A;  1LDK B;  1Z21 A;  3N44 B;  4XKC A;  1T95 A;  3TY9 A;  4MTE A;  4ZTF A;  4XN3 A;  1V5G A;  3CP8 A;  3K4N A;  3FMA A;  1FJG H;  1ZHS A;  1Y56 A;  2WYO A;  1X4P A;  4DR3 H;  2XF7 A;  3BAB A;  3CJR B;  3SEQ A;  3DEE A;  3PSI A;  4G6T B;  3HXL A;  4HG2 A;  4LSA A;  3K4L A;  3VYU B;  3RGZ A;  3N42 B;  3RJ0 A;  3VYT B;  1X1D A;  2WA0 A;  2R7Q A;  3W1G A;  4KHP H;  1OLT A;  2IXS A;  4HRI A;  5LMU H;  2V6E A;  2VQG A;  4XL9 A;  5HNF A;  1FMW A;  5IWA H;  4DBQ A;  2HU9 A;  2WB1 A;  2CUJ A;  2F6C A;  3CF2 A;  3OWT A;  4HNT A;  3S3M A;  1V9P A;  2ZJT A;  3KAL A;  3K4B A;  4DOZ A;  2OWO A;  1I94 H;  5CKT A;  1MNE A;  2WAE A;  4DR5 H;  4NNJ A;  4AVZ A;  5FRN A;  2Z16 A;  1WH2 A;  4JYA H;  2LBF B;  4EFE A;  4NXM H;  3J81 W;  4CCJ A;  1WFX A;  2IGK A;  2LC2 A;  2VQH A;  4RAY A;  3NWS A;  4DRF A;  2VQC A;  4B44 A;  4LF4 H;  4PZ7 A;  3PNT A;  1DGW Y;  5KCM A;  3OYL A;  1E4F T;  1CKO A;  4X65 H;  3BC8 A;  2M0M A;  1V5E A;  3RSN A;  4A2A A;  2LYC A;  4XQF A;  2AQF A;  4RZQ A;  5JHF A;  2WDT A;  4BDY A;  1WJC A;  1TZL A;  4BJ6 C;  4N4N B;  4E7J A;  4Q0Y A;  3DU6 A;  2R4G A;  4DV0 H;  3IAM 2;  3I3L A;  4B48 A;  4DV5 H;  3W5O A;  2JVH A;  4HEA 2;  5IT9 W;  4E6K G;  4DBR A;  3IUO A;  5FPO A;  5FRM A;  2X6X A;  2KSW A;  1BR2 A;  3DPL C;  4QPO A;  3L2Q A;  1XMQ H;  3LSM A;  3D5R C;  4II2 A;  4D1Q A;  2ZXH A;  2DXI A;  3LMM A;  2X6W A;  3M8J A;  3ZQQ A;  1LVK A;  2MD0 A;  4X62 H;  2X1D A;  1J09 A;  3DPU A;  3SDB A;  3KXY T;  2UV1 A;  3ZRG A;  3AKZ A;  2ZSH B;  3T1Y H;  2A6T A;  4UCU A;  1WJF A;  2DCE A;  4LIV A;  4BQN A;  5LFA A;  2VAS A;  2HPI A;  4E7L A;  3OL3 A;  1UAA A;  2VXZ A;  1AN7 A;  4DV7 H;  1D0Y A;  1V5F A;  1D0Z A;  2JA2 A;  4XLH A;  3W2W A;  4F93 B;  3QYE A;  2QKM B;  1TAE A;  3H0D A;  2YCH A;  3N40 P;  5FPR A;  3K4C A;  4BEH A;  3A2K A;  4PFP A;  4B3M H;  3MKY B;  1SAU A;  2M4K A;  1PYV A;  3KAK A;  5DIS C;  2WE6 A;  2VXD A;  2IS2 A;  1BR1 A;  3D5S C;  4E7H A;  2GOM A;  2CW8 A;  4CC5 A;  4CCM A;  2DT6 A;  3C2G A;  3S3N A;  2W7N A;  2BW3 A;  2VQL A;  3H9J A;  3PJR A;  3CES A;  3LSG A;  3LFU A;  3GDE A;  3BA8 A;  1X4O A;  3ZCO A;  3UR3 C;  2LRD A;  4YRV A;  1YE9 A;  4II3 A;  4DV4 H;  3OTO H;  4BS9 A;  1Z2P X;  4C9Y A;  3L4K A;  1QHH D;  2BVL A;  3OS1 A;  1TT0 A;  3OOU A;  4BJ5 C;  3S8P A;  4OWR B;  4BQQ A;  4RB0 A;  1Y6I A;  3V42 A;  4HST A;  3RR5 A;  1VS0 A;  2VQF H;  4XKB A;  1P16 A;  2KDO A;  2M4G A;  3OR1 C;  1TA8 A;  4B3S H;  4E6N A;  4MLO A;  2UXB H;  2HDW A;  3HPH A;  3N05 A;  4JI2 H;  3PFY A;  4IAJ A;  2CUZ A;  3BA9 A;  3L2R A;  1HNX H;  1SFK A;  3LSK A;  3OYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...