2HVSA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 2'-deoxyribonucleotide at the nick
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/dna/rna
total genus 91
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvsA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvsA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvsA01
1FVIA 3NBZB 3W1BA 1VS0A 4GLXA 4PZ6A 3W5OA 4LH7A 1CKNB 5D1OB 4EQ5A 2HVQA 1P8LA 3TY9A 3UQ8A 4UFZA 3BA8A 3JSLA 2OWOA 4UCOA 3BA9A 5DISC 4UCSA 3W1GA 4UCUA 3QWUA 1XDNA 1TAEA 1TA8A 1A0IA 2CFMA 1X9NA 4LH6A 2Q2TA 2Q2UA 3S24A 3RR5A 5FPRA 4CC5A 4UCRA 2VUGA 3VNNA 2HIVA 4PZ8A 3GB8B 3L2PA 1CKNA 4EEQA 3BAAA 3KYHC 5D1OA 4DRFA 3TY5A 4UCVA 3TY8A 5FPOA 3NBYB 4PZ7A 3PN1A 1B04A 4EFEA 4CC6A 3NC0B 1XK5A 2HVSA 1CKMA 3GDEA 1S68A 3GJXB 1DGSA 2HVRA 2HIXA 4E6NA 4UCTA 3RTXA 1V9PA 3BABA 1CKOA 5D1PA 3JSNA 1P16A 4EFBA
chains in the Genus database with same CATH superfamily
2P7VB 3I56I 2VQCA 3DAAA 1K6YA 3LQQA 5HLHA 2HGWA 2W6ZA 1MGTA 5LFAA 4RNOA 2E5ZA 3GTLJ 3H3ZA 1LKXA 4IOAF 3L00A 5D5WB 2I8CA 1EHIA 5DV5A 3I64A 5IY5H 1JUMA 3UYYA 1YJWI 2XD4A 3LA3A 3SFZA 4HR7A 1G4DA 3KEYA 2M05A 3KYLA 1Z3YA 2HQAA 1OCTC 5BQTA 1K83J 4J9LA 4HF2A 3BA9A 1DP3A 3AW8A 4DIMA 1TT0A 1MJAA 3WGIA 4B3TH 4O3SA 5LGUA 3S17J 2GZWA 3DTGA 5DGHA 3BG6A 1KU9A 4UCUA 4BEHA 5DD8A 5HVQC 2IXSA 4NXNH 2FX0A 3HIFA 4H0EA 2B7EA 3C1DA 3CC7I 1S7AA 4EEFG 1RUOA 1F5TA 5L3EA 5KAFC 5L1LA 4R8UA 2FLPA 2RVCA 3CP2A 3HHGA 5E8GA 3D1NI 2P6TA 4TQSA 2EIKH 5CVUA 2DTRA 2Z9OA 4NQWB 2LOOA 1JIHA 5FLXW 4X66H 1FT9A 3C18A 3BG5A 4IHJF 3DF7A 4JUZA 3GTOA 4GKKH 4QWDA 1FYMA 4QWQA 3M8FA 5CAEB 1WCMG 4F4XA 1IV6A 2R7FA 4U87A 5IP7J 2ZDGA 3CJTB 4KN7X 5JR3A 2KIFA 4BXXG 4ZC3A 3GIDA 1SMYF 2ZSHB 1KBLA 3U2RA 1Z77A 3K3PA 3IWFA 5DAAA 4HF1A 5GAEJ 2EPFA 1MNDA 5DTDA 1GYFA 4PJLA 1W93A 2QVOA 1S7OA 1XMOH 4TV7A 2FQ4A 4UCVA 3K69A 4NNJA 4Q0YA 4ECZA 2E2IA 1N75A 3DTIA 3SFIA 2KHMA 3N40P 2R85A 2VBWA 3GIJA 3ETJA 1S6LA 5CYVA 3CCEI 3GV7B 2FMAA 1MJ9A 3L4KA 1RYRA 5J8FA 4HNVA 2WE6A 1TWCA 2FK1A 3OR1C 4E7ZA 2VBYA 4Y7NJ 2QSFX 2V9VA 3TOBA 5EDWA 1LDDA 1U78A 1SVLA 5K1YA 3H36A 4RA2A 2GXGA 3RPUD 3MKWB 2W71A 2B63G 3SGIA 2PBIA 5F0CA 2RDPA 2LNBA 4ETSA 3LA2A 5E8IA 2R7TA 5M3FJ 3GIMA 1S8NA 5J2UF 4JX5A 2ZXWH 4PJMA 2COMA 3H0GG 2F4OB 3R5FA 1CE8A 4WXDA 1DPRA 2CQ7A 3VYSB 2QQBA 4J19A 3V7RA 1M6VA 4IHTA 1U0JA 3HOXG 2GOXB 2PMZA 4WWCA 3W2AA 4Q8EA 2R7ZG 2VB6A 2MH9A 1G3YA 1XPXA 2O03A 1E17A 3BACA 3WTXC 2CJJA 1BOAA 3RKQA 1AKHB 2FOKA 4XKWA 4NXMH 1MH3A 4I7HA 2CUZA 4CYCB 2CFOA 2OU2A 4BH9A 3DU6A 1YX5A 1Y1VG 1JKPC 3KALA 4IX7A 5JQGF 4FT8A 3ABKH 3ASNH 2K27A 4BHCA 3PW5A 2HI3A 5GPAA 1Y56A 2XRNA 3WHCA 5D6FA 2VONA 2C00A 4PZ6A 3W5OA 5TRDA 5HLTA 1HF0A 2L9VA 1N36H 4UXNA 3HOVG 2E1MB 4LLNA 2PLYA 1M0TA 3LWBA 3H5RA 2V79A 4WXHA 2DZDA 4U0VA 2Z33A 1EKEA 3BA8A 5D8LB 4NYEA 3BR3A 4IRIA 3ELKA 2VASA 4BY7J 2XGPA 3ZRGA 3A01B 3U1KA 1I94H 1VQOI 5KFWA 1UG0A 3KPHA 4NBQA 2B0LA 2VQGA 3H3VK 3J81K 4MAMA 2XSJC 1W36C 4HYEA 3RI4A 1G2WA 3FMSA 5KVRA 4K0KH 1PP8F 4B3MH 4O2AF 2UUCH 3H9GA 4GCVA 1IYEA 3LMLA 4RDUA 1QO0D 4ZOLF 4M9UA 4DV2H 3OYHA 3BDDA 2MCTA 4BXUA 4A3CG 2CFMA 1T0FC 4OINF 1SMTA 2FP4B 1JHFA 1GV2A 3HRUA 2V59A 2ISZA 1UHSA 2KRHA 2OBPA 5DG9A 4D1QA 3GF2A 1YYVA 3I9V2 2L9NA 1UC8A 2KKOA 1MDMA 1Z2OX 3U9TA 3WE2A 1LVAA 2VBZA 3J81Z 4YHHH 3VPRA 4W97A 2W7NA 2R86A 1BIBA 1TL8A 4FBTA 2HIVA 2JPCA 1EH8A 4M7EA 1RNLA 1I1KA 2ZJ2A 2ASJA 1RK5A 1BJZA 5ICCA 3K4KA 3ZMZA 2DMQA 4MV1A 1XCVA 2W24A 4F52A 1DU6A 1PX2A 2C2DA 1GXQA 1H9TA 4XOTA 4DGWB 5L3DA 5F6FA 1K61A 3TO7A 2KJBA 2KSWA 5TGTA 3RZOJ 5KFLA 1SFXA 3JCUC 3F3XA 1LFUP 1JUSA 2A5WA 5F08A 4S0HB 1J2XA 4XLNF 2RV8A 1GSHA 1U8BA 3FHZA 2X0SA 2W9AA 4F4ZA 3T1BA 1TBXA 4BE0A 4BJ6C 3GZ6A 2QBYA 3WTWC 4V2GA 2O61A 4A0XA 3JAMZ 1OLTA 3DEWA 2L4MA 3L2CA 4PWQA 4MV9A 3PO2J 1TWGA 3BJAA 1G8XA 1SVOA 1D1BA 1FC3A 4RM2A 1TWAJ 3ZQ7A 2FSWA 4XK4A 1SANA 4FS1A 2KMUA 2G7HA 1ITYA 2DDBA 2MC4A 2OTLI 2W7PA 5M5WJ 4XYLB 3TDZC 1MBJA 1A31A 4DYRA 4U88A 3UKGA 2K3PA 3GTKA 1CF7A 2YS6A 1BGWA 1SFKA 3PVXA 3PFYA 1RPWA 2IS1A 3CJRB 2R84A 4A3EJ 3ZQQA 1JTYA 4RS8A 5EGOB 1ZTRA 1Z2NX 1K4SA 2VOPA 2JA2A 2J6SA 5B3SH 1HKSA 1H88C 4QJFA 1PDNC 3ULQB 4CE5A 5I5VA 1Z67A 5EEGA 3M9MB 1DQUA 4NLGA 1XGSA 4ZYGA 1KYZA 3BTJA 4EQQA 3Q8SB 1JKOC 3S1MJ 4HOBA 3GTGJ 1U5TB 3K4CA 3MVPA 1FEXA 4GRIA 2K9LA 1J0RA 2V9PA 4A3MG 2O5RA 2FF4A 2J5PA 1C30A 1BA5A 3E5XA 1SD5A 3RCOA 4JI1H 4ON0A 1Z05A 3OYAA 3N8DA 4JV1A 3KZYA 4UVAA 1ZAUA 2BQUA 4LMYA 3WHBA 2M3AA 5HDGA 3UZOA 1VAJA 5KHDA 2X1CA 3B6CA 2MYSA 3GTOJ 3EQLF 3S8PA 2UVWA 1VQ6I 2VC0A 4PGGA 4RB2C 2HGXA 2ZXIA 4MV6A 4QW8A 2FJ1A 3LL7A 4KICA 5I5UA 4ABZA 2VA2A 1OR7C 5JLWA 3V6HA 4M9ZA 1XGOA 4AC0A 3ABTA 2KISA 3CTAA 3BZKA 2ZBKA 5K7HA 3VB2A 4X62H 4LF8H 4RAGA 4FCYA 4CICA 2LG4A 2EZHA 4P5OA 3DV8A 4F93B 4IAJA 3RF2A 3ZCOA 3WTSC 2W25A 3SNOA 3WTZA 2K9MA 3HO8A 2NAZA 4AWXB 2I80A 4IEJA 4IZOA 6PAXA 4AIJA 5E3MA 1WCMJ 4PCQA 1NK2P 3QQMA 2UVRA 4ESJA 2K4JA 2A69F 4JQFA 3K70C 3WTUC 2LY2A 1A0GA 2ELKA 4NC8A 1WI9A 1KU7A 4BXXJ 4JI4H 1TWCJ 1RJRA 5M3MJ 4HPQA 3MFIA 3M4OJ 1X4PA 3JRXA 3WGGA 4PZ8A 2K7LA 1R9TJ 4JI3H 5BWWA 5I5XA 2M2EA 4QPOA 4EEQA 3KYHC 3QODA 4KIGA 1IC8A 2W85A 4G7OF 4DW6A 3G71I 4O4IF 1TTYA 1W1WE 3DQVC 3PIOF 2XASA 3CCLI 4IOCF 2CS3A 5L9XA 3CUQB 1IF1A 5E1WA 4KUMA 2P0WA 3OV8A 4CA0A 1ZKGA 2WAQN 5IT9W 3M7GA 4BU2A 2ELJA 5GADJ 3QZ7A 1W7PA 2M45A 2XAFA 4MQ9F 3T5HA 2HVSA 3J80W 3CMYA 2WV1A 3JSOA 2GIZA 4UUSA 4U0WA 1WVRA 1ON2A 5F0FA 2LTPA 2IT0A 3U54A 4L9NA 3R5XA 3L09A 3U21A 1RIOH 3RB6A 2BHYA 3CJQB 3TDUC 4E70A 2DMUA 4RZQA 5CVRA 2B63J 2VR1A 3PJRA 4HZFA 3MWEA 2QYZA 2VQHA 3DKYA 3QOEA 4I4TF 4E6KG 3MFHA 5KFIA 5L1KA 5C4XG 3H0GJ 3JRFA 4F4YA 2F4VH 3RQIA 5JQWA 3HOXJ 1JXLA 3CO6C 2CQXA 2YSRA 2WBMA 2NOJB 2DLNA 2K9NA 1W5SA 4MGRA 2R7RA 2R7WA 2R7ZJ 1P16A 3M1CA 4A3IG 1R36A 4XLEA 1ORKA 1WSCA 5BNGA 1Y8QB 5KG0A 2G7UA 3FHNA 4O3OA 2EFOA 2LREA 3C7JA 5GP9A 3ZMDA 1T36A 1Y1VJ 2LY9A 4EV0A 4Q5SF 1NG6A 2DMNA 2E1MC 5E25A 3ZMSA 2L0KA 1BW5A 3EUHA 5E79C 1OFCX 2KIQA 2WAFA 2ATLA 3HL2A 4UV9A 2A1HA 4IRCA 3FF5A 4QTRA 2R7VA 4B09A 2SCUB 4C2MA 1Z7LA 1EJ9A 2BE5F 4IKFA 2ZDHA 3Q8RB 2W8LA 1S9HA 2F2EA 2DMPA 2LDUA 2PN6A 1JKRC 4PJNA 2KL4A 5CQGA 4DOZA 3I4PA 4FE2A 3LAJA 3G73A 1SFOA 4A0ZA 1S29A 2ME0A 3FMQA 3HUGA 3WTTC 4OIQF 1DGRM 1B1BA 2HWVA 2BQ3A 3AG2H 2W7OA 3S2HJ 4F55A 2JA7G 1XDNA 2VJJA 5FKMA 2ADUA 3RB4A 1WJAA 4IWXA 2EA2A 4C30A 4YFNF 1TAEA 5EEAA 5FLMG 4B43A 3K3VA 4RAYA 1YS6A 1XMXA 1FOKA 4JV0A 1H89C 1YRNA 2Q2TA 3QP5A 3N44B 4DL2A 2F48A 2CZGA 4O3RA 3LSHA 2BR0A 1XSVA 4A93J 5KT3A 2C35B 1X3UA 1MBFA 5FROA 1MW7A 4D7MA 4Y8VB 4GDFA 4XONA 5D8KB 3I58A 3NEUA 2ESNA 4UCRA 3K1NA 4HNUA 2ZJTA 3K6GA 1N48A 1TP4A 5EZHA 3WODF 2E5NA 1CKNA 5JVGF 1I7LA 2XIGA 1LFPA 2DLLA 5JLXA 4E4HA 2WA0A 4CXFA 1UC9A 4EEYA 2Q8KA 2ABJA 1RI7A 1O7FA 1Z9CA 1R5HA 3I3LA 3PN1A 4R8HA 3CD6I 5ICFA 1YW7A 3DPLC 1F4KA 1I2LA 1AN7A 2V58A 3ZXSA 2KDZA 1XMQH 5LLQA 1B6RA 2BY3A 2QKLB 4A3GG 4CYDA 3L2WA 5IYZF 2XGEA 4HQMA 4MV8A 2FEZA 3DBHB 2VIXA 3REOA 3RBDA 2LRDA 4LB5A 3GTKJ 2JVHA 4A3LG 1ETOA 2YPRA 4Y52J 1ZHQA 5EOYA 2Z16A 1QQIA 2KLOA 5JVDF 2E19A 2FK2A 1W0TA 1KYWA 3T9FA 2BEOA 3UR3C 4D5CA 4EJUA 2F5EA 1T3NA 2V4JC 3PO3G 3PW7A 2KZVA 1N25A 3ASOH 4LFUA 1VQ5I 1I6XA 5JHUA 5LD2C 1JTXA 3DEEA 3L2VA 4YFXF 1BXRA 4HX4A 4DR2H 3DKWA 2WADA 1BR2A 2CO5A 1ETYA 4AIDA 3K5IA 3V6KA 4BL0B 5K7ZA 2HGSA 1KONA 4S04A 5FLXZ 1F36A 1TZLA 2JA6G 2FRHA 5A2QK 3T7AA 2R7NA 5CVJA 1FNNA 4LG0B 2CW0F 4NC6A 3MR2A 4O3NA 5GTHC 1S0NA 5LHHA 2HQ5A 3S32A 3G1LA 4XLAA 1MIJA 1QHGA 2HR3A 3U1DA 5CJ9A 5DM6F 3OYNA 2QEXI 1GXPA 2MFZA 1DDNA 3E3VA 1IJWC 4A3BG 4II3A 2Y48A 3KP2A 1U5TC 2ALZA 4J9NA 1GVJA 4GLWA 4EQ5A 5AIQA 2NVYA 2PBZA 4Q4ZF 2H09A 1T2KA 3ZR8X 1STZA 5TISC 2MBFA 3S3MA 1OCRH 2DABA 1SD4A 1OWTA 3FXLA 5M5XJ 3G6XA 4GGGA 2NVXA 2I10A 4HQEA 3GLLA 2ME6A 5A2QZ 1EH7A 2O7OA 2XPVA 3DPTA 1HBXG 2HJWA 3J7AK 3T9DA 1MSEC 4HV5A 3T5LA 1IN4A 1LDKB 2P7CB 2V1UA 2R5ZB 2NVTJ 2CQNA 4HSRA 1E3HA 4BUPA 2ZGIA 4FBUA 2P6SA 3GBGA 3JSPA 3LSGA 4A6EA 3AFHA 3O8GA 3QP6A 4AD9A 4RCNA 3RSNA 5J8CA 1IXRC 1QZZA 3DTEA 4RGSA 3SEZA 3H5AA 5H6RA 4AIHA 3RQ4A 2VQLA 3PR5B 4BE1A 1U9OA 4C3JJ 1YG2A 1LEBA 2R87A 1JLLB 1RETA 2HHFB 5BMVF 4Q8FA 4HLYA 5E17F 1YW8A 4B44A 1D0XA 3FISA 3MWMA 4CCNA 2WV0A 2RDIA 2L02A 4C2UA 4O4JF 4RLQA 2NU8B 5FFZA 3ZMVA 3JTGA 1JDEA 2DU9A 4MIMA 3DLLF 1OPCA 4WXCA 4ESFA 2FD5A 5F04A 3ISPA 1VQLI 3KFWX 4I76A 5DCFA 1O57A 4DZPA 3OYCA 3QQAA 2HZDA 2YS7A 4O84A 3FDSA 4ECWA 3M8JA 4BBSG 1P2FA 5LA6F 3BG7A 4FFOA 3F8BA 3CUQC 4Y13A 1QVTA 2N8GA 4FS2A 3H0DA 2IP2A 1SYXB 3QWLA 4ZZLA 4AYBN 4CSWA 1KJIA 3I71A 4QPQA 3FK7A 2OJED 3BJ6A 3KLOA 5KFAA 3EPZA 2JEJA 3OR2C 5KT7A 4YRVA 2K86A 3OS2A 4BEHB 4O3MA 5DD4A 4O7YA 3ZMUA 3GJXB 4G7ZF 5CR5A 1N78A 3TIGA 3HXLA 3SZGA 3KX2A 5ILSA 3F8MA 2RF4A 1HQCA 2G0EA 1UJ8A 2YX7A 3K1PA 3QYEA 3BPXA 4FX0A 3SDGA 3BPVA 1PP7U 1WQ2A 2K40A 5CKTA 2R8JA 1MBKA 2R5YA 3VFZA 4CO8A 4P9UA 4D0PA 3I4NG 2UXCH 1A04A 1ZQ7A 3ZMTA 5HNEA 5D6EA 2LKPA 4OAZA 1HLVA 2IRFG 3WWIA 3HM5A 4HEA2 3M07A 5B5EC 1N77A 1U3EM 1J75A 4YJ2F 5J3LA 1J09A 5C4XJ 2IEKA 3LQSA 3IH3A 4LF5H 4DL7A 2X6WA 4TV9F 1CQJB 4F3QA 4XRSA 3N41B 1FOYA 3EDPA 2GQSA 2GLTA 3FMRA 1VF9A 4M9SA 1LE8A 4O86A 5H6QA 4A3IJ 3ORQA 1FJGH 2JWTA 1IBLH 5DUIA 1SFOJ 5FD5A 1VBHA 4ESBA 1BI2A 1KTAA 4IHWA 4LFBH 1IUYA 3GTMJ 1REPC 4P9FA 5KFZA 5KFEA 2D1HA 2GWRA 3LSTA 5HV6A 3DBLB 3G4SI 2MH2A 3U0GA 4ED7A 3LSKA 2F6CA 3HSEA 5FB2A 2HPMA 2VKDA 2KDOA 2VE9A 2FA5A 1K4TA 1Y6IA 3LMMA 3FM5A 1BW6A 5HLGA 4YR3A 3OYDA 1P6RA 4PFOA 1VBGA 1YI2I 3HOZG 3FKIG 2L5QA 4GKJH 2L7KA 4FFRA 3DP7A 1SD7A 1BI0A 3U9SA 2JEFA 2X0LA 3MR3A 4YB8B 2VKEA 3DXJF 1ZGWA 3OOPA 3Q0VA 4LJZF 4EM0B 1K78A 3RKYA 5KT6A 1VNDA 4XNFA 2FLLA 2JA7J 4G3IA 2ZJPF 3JRIA 2KP6A 1SCUB 3N97A 1FMWA 2OZUA 1TNSA 4Y3OA 5FLMJ 2VJIA 3QRFF 1FBUA 2XKOA 1C3OA 4JV2A 1CQIB 4XMYA 2VKVA 4DR4H 3LSJA 5HNHA 1HDPA 1JI8A 4PK4A 3IG0A 3CDHA 4WX9A 3FKIA 4KDPA 2NU6B 2STTA 4IIJF 2JSPA 3PW4A 1JX4A 4Z2YA 1I7NA 1D1AA 1S97A 4DAAA 3TBIA 4D7NA 4GXOA 1FKAH 4CCKA 4MA5A 3FBNB 4PSWA 1XDSA 2E1OA 4CUGA 3QAHA 2HOSA 4O3PA 4B48A 1V4YA 2O3FA 2H8WA 1VFCA 1BJAA 3BAAA 5I5SA 5KFDA 1YTYA 4DYCA 5KFNA 4J9KA 2JQ7A 3KHGA 3TY8A 2CMPA 2R8GA 2JVGA 3NBYB 5F1JA 4LG3A 4PDBA 4UV8A 4DUYH 1FP2A 1KA8A 3OYBA 1I1LA 2WAQE 1R58A 3L4JA 1G2HA 3TW6A 2FU4A 3HGGA 3LA7A 3BOQA 1ETVA 4ZDLA 5JI6A 2KZGA 4UUVA 5K5QA 3QYBA 2XROA 1QBJA 1DGWY 3G2BA 3QYFA 4A5MA 3DTFA 1IV8A 4A3GJ 4CZZA 3OOUA 3BG9A 3RFCA 2IMWP 3X2QH 3SJMA 2OUMA 3HHHA 1GV5A 3IP4B 2ZJQF 1NH3A 4A3LJ 5KFGA 5C5JA 3GEZA 5BWRA 3S1NJ 2EFNA 3HRSA 2CUJA 2V6EA 4J01A 2YRWA 4LSXA 1RC9A 4KMFA 2C22A 3I0TA 3V42A 4OIOF 3D5SC 3NAUA 2RAEA 5F1RA 3PO3J 2XRLA 1WH2A 1KJ9A 1XNRH 1VQ4I 1LJ9A 3LSMA 3LULA 4MEXF 2ZNYA 2KT0A 3GTJA 1S72I 2FK3A 5L1JA 4A2AA 2LYCA 3IAS2 4D5FA 5F0HA 1IUFA 5J1YA 3R23A 5F27A 3QU3A 1MNMC 2OCEA 2F4MB 4M73A 5IT9K 2D2WA 3RGXA 3N42B 4O7LA 4C5CA 1MDMB 3E5QA 2JA6J 3G1OA 1S0OA 1FWZA 4H4KC 2NVXJ 3R5HA 3J80K 2NVQJ 3TQNA 1T33A 2YWVA 3CLQA 4XBFA 2F5VA 3F8FA 3MEXA 1AWCA 3SQNA 5JHFA 5DM7F 1EZ1A 3S3NA 2EQRA 3JRAA 4DV0H 1MJBA 3COAC 1RR8C 4OMZA 3S2WA 3OHBA 1WPKA 2PX9A 1T6SA 2Z02A 2HVQA 2CGPA 4XKCA 4FGRA 4A3BJ 2AXLA 2UXBH 1FIAA 3OUUA 2CFXA 1IRFA 4JYKA 4XSXF 1SC7A 4ZQIA 1FIPA 1GGOA 4O81A 3OHAA 4PSXA 2P5LC 4ED8A 2EFQA 2XDVA 2TRTA 3WTVC 2PN1A 2DYRH 3KIOA 1HR0H 3BTIA 4M6VA 4J0MA 4C5AA 1O75A 2RDJA 2VUMA 3KAKA 4UB6C 3I4MG 5IT9Z 1TWFJ 4L0ZB 3FZVA 2VT2A 2VJ5A 1A5JA 4MHGA 1I39A 5CM0A 3Q8QB 3LQRA 3J80Z 2QBYB 4MV4A 3MKYB 2MC3A 3MKZA 2EJ3A 5KG4A 4N4OB 2HDDA 5KG6A 1GLVA 2DAAA 2H8RA 2DO7A 1RKWA 4HAMA 5D5UB 2F5CA 3E97A 5IP9G 4KA4A 2LC2A 5ERIA 2HQNA 5LMUH 5EG0A 4ZTFA 3NRVA 5HDKA 1W7PD 2C28A 3MJFA 2UWMA 2UXDH 1X1PA 1CF7B 2ETHA 1J7KA 3C3WA 3CC4I 1SD6A 4GLXA 2PI0A 1E4GT 2BVLA 2QA4I 1KGSA 1DUXC 3RTRA 1IDZA 2GIVA 1V54H 1I50A 3JRDA 1B72A 2RNGA 4A6DA 5I5WA 2CNVA 1R4NB 3H20A 1PVEA 2OAZA 4HW0A 2AGPA 4O7SA 2JT1A 3OYFA 4NQWA 4TV8F 4IHXA 4DL3A 2FPGB 4XRMA 2DI3A 3WTYC 1G3WA 3GZNB 3R60A 3GTQA 5FFXA 3RV3A 4A93G 4ASNA 1MD0A 2KIMA 5IPAA 3I55I 1Y14B 1SVMA 2IS6A 2B9SA 1T95A 1HNWH 3HJEA 3QOPA 3HBLA 4BBSJ 4EBDA 4A69C 3HKZN 5J4YA 2XCAA 3B6AA 1IAWA 1DV1A 2A6TA 5KFMA 4G9YA 2P0AA 2BBYA 4DR7H 3OS1A 2QWWA 3V7CA 2VODA 2LVSA 1FSEA 3OIPA 2L01A 3JAMK 2LF7A 3CMEI 4XL9A 1BNCA 2HXOA 4B3SH 2DOFA 1FBQA 2DA3A 4APMA 1KT8A 2X4HA 4A3DG 4G12A 4QW9A 3BCBA 1YITI 3C2BA 5BPHA 4AVZA 1XN7A 2YS9A 2W00A 1E3OC 2Z99A 1CGPA 2VQFH 5CLSA 1S10A 4OOIA 2ZNZA 4R1HA 2AO9A 1O3TA 4PJ0C 2BXYA 2DK5A 3MAJA 2W6QA 2R93G 2A05A 3I4NJ 3HT5A 1DPUA 1V9PA 1R1UA 4LSAA 4UNOA 2EB7A 2CWEA 2Y69H 2PJRB 3Q2OA 2ASLA 2DOAA 5LRRA 1FSHA 3FKJA 5HS9A 1ZYRF 4O2BF 5C8YF 2NS8A 1FJLA 2DDAA 4IRDA 2P4WA 2A6HF 3QPLA 1KJ8A 4HQ6A 2LK2A 4DQNA 3BZCA 3KZZA 2XHKA 5TJJA 3E6DA 4IF4A 4DV5H 1ONVA 4JYAH 1ZLJA 2K3FA 2EJ2A 4DR6H 1ETKA 1SFUA 3PZPA 3IRRA 3F6VA 1PUFA 3CMMA 3SYTA 4YIFA 2HTJA 5EWFA 3TEKA 2R93A 4OAYA 1YLFA 4MA0A 2HNHA 3OL4A 1ZG3A 2VKHA 3R6SA 2Q7DA 2E34A 2A07F 4ZHQF 4ECRA 3H3VH 1X4OA 3FXKA 2CRGA 2E35A 5AIPA 2AGQA 1U2WA 4Y4RA 3BP8A 5ICEA 4KYWA 2WTFA 1W7PB 1N32H 3SZPA 4XKBA 1GSOA 3V8KA 3OYEA 5BR8H 2V4QA 2W9BA 3VOEA 2L7FP 4UUSB 1ZELA 3GFMA 2COIA 3BR2A 3QZ8A 1GUUA 4A12A 4DYQA 3HOZJ 1GSAA 3G8CA 3O8HA 3GFIA 3FKIJ 4MTEA 2YRXA 3LSPA 4XLFA 4A5NA 1ULYA 5DMXA 3GIQA 2ECCA 3AYHB 3BWGA 5C3EJ 4KISA 1TNTA 3OYKA 3HSRA 2EINH 2X6OA 1IRGA 4BQQA 2XAUA 3HC7A 1A0IA 4W1UA 1YHQI 1X1DA 3T99A 1D0YA 4KT6A 4IVNA 1JGGA 1QGPA 1XCBA 4ECYA 5KG5A 5T14A 2J5OA 2ID3A 1T8IA 4HA8A 1G59A 1HCRA 4L9TA 1S0MA 2ZMEA 3M9AA 3G6EI 2OTJI 2GM4A 4P1WA 4JI6H 2HOAA 2TCTA 4LLGF 5EZGA 1D3YA 3GTPA 3MD2A 3GILA 2JRTA 1ZR4A 1WI3A 1BM9A 2QKMB 3SEQA 3HB9A 5JVTA 3DF8A 5L3CA 4BY1G 4YIRX 2Y0SN 4XZ3B 4M0JA 5FR9A 2E71A 4YAJB 2XPWA 3V8JA 1I3QA 2ZB9A 2MD5A 2WAQA 3KXYT 3OSNA 2W9CA 1F43A 2GPWA 1TQMA 2VXDA 3LFKA 2LKXA 5JH7F 1JHHA 2W84A 1WJBA 3W2VA 2ECBA 2ZDQA 3DFGA 4ZH4F 3R9RA 4M3BA 3B73A 1B04A 4YFKF 2Y31A 3OWTA 5BYBA 2IAIA 3K0LA 4AYBE 2RQPA 2GLOA 3NC0B 3PFFA 2E2IJ 3E6MA 2CG4A 3K4JA 2FKLA 1EUDB 5E1ZB 1FPQA 1V55H 3FM3A 2DA6A 3E0JB 1ETXA 1UZCA 3OTOH 1P4WA 2JEIA 1Y0NA 1UELB 1E4FT 2JA8G 2X85A 3WG7H 3TGNA 1MH4A 1FMVA 3PL8A 4Y17A 2JMWA 2BZTA 2FBKA 1E3PA 2EFWA 2KQRA 2FBHA 4B1RA 4FU0A 2DFEA 4IR1A 5J1UA 3T5XA 3L2QA 1JKQC 1YRNB 3GXOA 1E0EA 4Q4CA 4CMDA 1RKTA 2XCPA 5HDNA 1O4XA 3S15J 2YX4A 4K6NA 1I1SA 3IWZA 3Q9SA 3R0JA 1IG7A 4U7DA 1UG2A 1Z7UA 4LK0F 3BY6A 5KFUA 5KG2A 1TLHB 2BHZA 2GA1A 2GA2A 4J9OA 4O7ZA 4ITVA 3TQ1A 1QPIA 2QLZA 5KFVA 2VLAA 5CA1F 4HN2A 1UCRA 1CKNB 2DJNA 3HOWG 3GWZA 5DCMA 3KHHA 1N33H 2EIJH 1QHHD 3ZQFA 2CV2A 4B4CA 5LP6F 1V5GA 1YFHA 1ZHFA 3K10A 3AG1H 3PNYA 4MFEA 1JT6A 1R6RA 3PSIA 2P5KA 4RGXA 1HNZH 2WWYA 5DQIA 1P7IA 2ODTX 2TDXA 3RZDJ 1GDTA 4DBRA 1CS0A 3TL4X 2R7UA 2V6CA 3W1GA 2WB1N 4QWCA 4ED3A 1RR7A 2HXIA 1R7JA 1IBMH 2QK4A 5KS8A 1OJLA 4N4NB 3KP5A 3MZYA 1U8RA 3I4MJ 1IOVA 2AQ4A 4ZYDA 3J7YJ 3ML6A 3CLOA 1XTAA 4JK1X 3ECHA 2R7DA 1WFXA 3SE7A 1KEEA 3HRMA 4M6YA 1ACIA 2VQDA 3OSPA 4J9QA 2PMUA 1R5ID 4IR9A 4LH6A 1R1TA 2X1EA 2EV0A 2YU9A 5IP9J 3C2HA 3AL0B 1ZR2A 3GZ5A 2R4GA 1NK3P 2DFHA 2JSCA 2L9SA 3BROA 4X6AJ 2DYSH 3GLXA 5FPRA 3RR5A 4BAYA 3E6CC 4U6PA 2E2HA 1XB4A 4QLCU 4GYGA 5JFRA 3DBRB 2PJPA 1MBEA 2VUGA 3H4BA 2FNAA 2GQRA 1ZRCA 2XF6A 2IA0A 1HXDA 2FOWA 2LH9A 3OS0A 3K5HA 4DL4A 4QIWN 3CCSI 3HZJA 1K6OA 2O0YA 3KYCB 2W1OA 2XGDA 5KNLA 2LR8A 3FXOA 3N6RA 4PDKA 3FK6A 2XSDC 4FE7A 3I12A 3J81W 5FD6A 2A61A 4HF0A 4KT5C 3RYPA 3O2PE 4I2OA 1OQYA 4B3RH 4BDYA 5EWEA 1AU7A 5LEKA 1Y1WA 3CF2A 4WCGA 2HYFA 3L1PA 1VQKI 1RJQA 1Q1HA 1FOXA 5FKNA 2O8XA 1G3SA 5L1IA 5ILUA 1M0WA 2OF7A 3F23A 4KIFA 3VODA 1E4EA 4OX9H 4II2A 5KCMA 3HYIA 1UHMA 3TEDA 3N4MA 3ERED 2FMYA 2HQRA 4TQRA 5C1PA 1W5CC 2M0CA 2QQAA 4G6TB 5E1XA 1ZRDA 3RAQA 5J40A 1X1BA 4A3DJ 1TWHA 1TWGJ 3Q3SA 1VQPI 4RUCA 3DLAA 2XF7A 2EZLA 3DEUA 4RB1A 3H9JA 3G6YA 5FLXK 3CMAI 4RB3C 2BY0A 2XC7A 4C3HJ 1AOYA 2H27A 5D1PA 5KFCA 2R93J 1D8JA 1VQ8I 3P9KA 1XNQH 3T1YH 4OIRF 5M5YJ 1FVIA 3W1BA 1KZHA 4DV3H 2JA5G 2BY2A 3KEOA 5E3LA 2X6XA 3SZTA 4ECXA 4ENKA 3VSLA 5K3WA 2LF8A 5BWVA 1SAUA 3AG4H 3I54A 1B6AA 1HSJA 2AQFA 1HDDC 1HOMA 4LH7A 5LXTF 4PZJA 1K83A 1HSTA 4ENMA 1SEIA 2HDWA 4G6QA 5E3OA 2ELHA 4UY8I 4X64H 2WC2A 1C0WA 4ED2A 3WO0A 2DMTA 1MKMA 1XX5A 2ZKZA 3HRTA 4ED1A 5DDGA 3F21A 2DA5A 1AHDP 4NHJA 1JDBB 1IDYA 2ESHA 2Y9YA 2I5UA 2GPSA 4G94A 1GHCA 4O4HF 2JA5A 5KFPA 2IA2A 4RGRA 4CHUA 2LBFA 3Q1KA 5BPIA 3TQTA 4WBNF 3OSGA 1USSA 2DK8A 4RM3A 2M8GX 1ZH5A 1EYZA 5KT2A 4YQWA 1BL0A 3I5UA 2ICWG 3IH4A 4L9VA 2AS5F 1TT5B 3BTLA 1Z6TA 2PFBA 2HTSA 2VT3A 3DU5A 4Q43A 1IN5A 2VPSA 1Z0XA 3N43B 2R5YB 4XKVA 4LD5A 3MMYB 1A3GA 2R6FA 2MLGA 2QGUA 2Q2UA 2VN2A 3NWSA 3HOYG 2X5RA 3R61A 5FKOA 3MWDA 3VSKA 4R7RA 2H1LA 4L5JA 3HOUG 4YIIA 3GIIA 4FFMA 4IWYA 1QNTA 3BR5A 3PSFA 1FP1D 1X3ZB 1YX3A 2JTVA 4CH7A 3ZQLA 4IQJA 2Y9ZA 1KQ9A 2QF7A 1B8IA 2RN7A 3P9IA 4D9JA 1J9IA 4XOPA 1IN6A 1BR1A 3RKXA 2NU9B 3C0FB 2EZKA 1ON1A 2DT5A 3GCMA 2IGNA 3ONQA 2CNQA 1LE8B 1BJTA 4I0BA 3I53A 5KFBA 3CUOA 1QZYA 4FTHA 3PFIA 4BY1J 5D1OA 1IGNA 3KZIC 3TY5A 3H4DA 4L9JA 1X1AA 1N34H 4AYBA 5FPOA 5KKNB 3LAPA 1YE9A 3EUHC 4U7BA 5KFRA 3JZFA 4A2BA 4B3XA 1KJJA 5H2FC 4ECUA 5FLVA 2OCCH 3JW4A 3HKZE 3WU0A 4EGQA 2KIUA 1JGSA 5HS8A 4XYMB 1T39A 1MMGA 1CKMA 2DPJA 3GDEA 3S14J 4XLHA 2V7FA 1S68A 4YP3A 4C3IJ 2HU9A 4XN0A 3VMMA 4RBOA 4HV6A 5K5RA 3H35A 4YY3H 3D5LA 3L7WA 2GXAA 2X1DA 3M9NB 5DLFA 2LY1A 5IYCG 4LF6H 4JI8H 1FX7A 2JA8J 2DW4A 3FXRA 2R3SA 4BQOA 2COBA 1K78B 1USTA 2Y0MA 3WG9A 4O7VA 2XAGA 4UCTA 4HYKA 1G6NA 4AIKA 2F5FA 2J9GA 2KRCA 4N9HA 4NC7A 4M3DA 3ORRA 4CCJA 4L0YB 5ED4A 1UHWA 1KC7A 2HHHH 2CU7A 3NBZB 1F9NA 2FNPA 5I47A 2M7AA 4XRSG 4ANJA 4I50F 2YCHA 1TW3A 4FETA 3VOTA 1NTCA 2QQ8A 3J7ZI 3H9QA 4O6JA 5C44J 1I6UA 1FLIA 5B1AH 2VL8A 4L5EA 3ESWB 1EKPA 3MR6A 2XUBA 3EUAA 4BNCA 2ZXJA 3F8CA 3TY9A 3UQ8A 1OBGA 1RESA 2VQEH 4KIBA 4N0BA 3BC8A 4EYHB 4QWEA 4PJJA 4EATA 5D4RA 3RUPA 3HOWJ 1LB2A 4P96A 3RIZA 2OWOA 1A35A 3ABMH 3U9GA 4LFAH 4EMSA 4J9RA 4DL5A 3JREA 3MZ8A 4DQ2A 2Y4RA 4RMNA 1D1CA 4ZJZA 5FKKA 3BJOA 3S93A 1OYWA 5KK1A 1D0ZA 4B47A 4IHSA 3E6BA 4UB8C 4C2MJ 4EJOA 1LUJB 2OV7A 1VKZA 4MNUA 2FMLA 3L9FA 5KX5F 2ZO4A 5F9NA 5KT4A 5IYDG 1MBHA 1RUNA 3LNQA 4CCLA 1P4XA 2E2HJ 1VQNI 5CA0F 1OCCH 4NZOA 1ZHSA 4BWSC 1IN8A 4LGWA 4BE2A 5KFYA 2M1BA 5IT3A 4BKXA 3CQZA 1EUCB 4ECSA 1X9NA 1BIAA 3T54A 1POGA 3TP3A 4NZNA 4G6DA 1K79A 4PGHA 5IYBG 4TM5A 3IUOA 1R4MB 1ETWA 2QM3A 3ECOA 3TO9A 2LMDA 3AL0C 1RK6A 3BJYA 2RQQA 2IW5A 1Z91A 4LIVA 3DPUA 1R49A 1JT0A 3GIKA 2ZXHA 3BR6A 3MKLA 5KFOA 2PQ8A 4EGJA 4G7HF 2M4GA 2R7QA 3ZP5A 1J5YA 5D5VB 3IH2A 2R8KA 4DNCA 2BYVE 2Y0SE 1Y1WJ 2DPIA 4FE4A 2OD5A 3FXUA 4CCMA 5EYRA 5C3EG 3TP0A 2E2JJ 1R5GA 1FYLA 5LGTA 1V3FA 1PK8A 2AU0A 1X58A 2OQGA 2EJRA 4YELA 3KYDB 4MLOA 3H5NA 5D5XB 2YZLA 4E7SA 1X1CA 4A0YA 1FZPB 3OSFA 3PR4A 1W0UA 2R8IA 2L7ZA 2DA7A 3T8RA 4E7IA 3F6OA 3VPDA 1TWHJ 4M71A 1MSFC 4PUSA 1LFBA 2WDTA 1WH5A 1O3QA 1Z2PX 2BY1A 1WH7A 3Q9VA 5BYAA 2IP4A 4EGYA 1TWAA 1MBGA 1TW2A 4L18B 4OIPF 1MMSA 5KFQA 3CCRI 1TQPA 5D4SA 2HFHA 4GFBA 4B8XA 3J7AO 1OCZH 3L2UA 4JBAA 3LSRA 3LSIA 1I6HJ 5I5TA 4Q44A 5FJ8G 1R22A 4K2EA 2HVRA 5HODA 3EPIA 1T0FA 2GXBA 4PFPA 3M1EA 1B4AA 1XDUA 2NS0A 5J6XA 2NS7A 2H6BA 2DPDA 5EG0B 3SDBA 2E7XA 2MG4A 1KUTA 2W6MA 1VI0A 1YIOA 3K4MA 4A3FG 3M8EA 2Y75A 5L3FA 3JRGA 2CQQA 4HDVA 1W4MA 2EK5A 3KAJA 4XORA 2BOLA 2JRMA 3KE2A 1Y39A 5J1RA 2UUZA 3GTGA 2KRFA 2Q2EA 2NNYA 1EKVA 1WJFA 1VS0A 3I59A 2E5LH 1BR4A 1B72B 2DPUA 4JI7H 2IJLA 2DA4A 2XC9A 4ZI7F 2K9SA 4EBCA 2E7WA 4AUXA 2JA5J 2X6YA 3CZ6A 3QPSA 5LGNA 4E7JA 1O7LA 4X1EA 1RZ4A 3CCUI 3G6VA 5IP6A 2V4RA 3TKYA 1J5EH 1SEUA 2DODA 4UFZA 3CCYA 3IN5A 3BR1A 2X51A 2L4AA 2BW3A 3OY9A 2LKSA 3ABUA 1WR2A 4MV3A 2GBYA 2V9KA 5J4VA 1A36A 4F91B 4GO1A 3RV4A 3ZOBA 2NVYJ 5CVVA 4O5VA 2WB1E 2EV6A 2AGOA 2VUMG 4QWBA 2AHQA 2K4BA 3J7AY 2WAEA 3M9OB 3S16J 3ZQGA 3WU2C 4M3FA 2Y2ZA 3GVAA 4YG2F 2FQ3A 3BLYA 2PG4A 4IZZA 4BACA 1D5VA 1RJPA 2DXIA 3A0HC 2ZFUA 1ZG5A 4LLLA 2R7KA 1S7EA 2Z04A 1TA8A 1WCMA 1WZ2A 1RRJA 3CC2I 3E5NA 5A2QW 2ISYA 5F64A 4FFNA 2JUCA 2XGXA 4JOMA 5K5OA 3TINA 4DBQA 1XMAA 5CVIA 2FBIA 3IHUA 3S24A 1YQAA 1KQ8A 4A3JG 2YZNA 1MMDA 4IHYA 2P8TA 4XQFA 3K1MA 3ZQCA 2E1CA 1S3JA 1UMQA 2MA3A 3A03A 3HOYJ 4ME6A 2QCOA 2DT6A 3OYIA 4O7WA 3HOUJ 1R9TA 3NWTA 3K2AA 2CNUA 1P92A 2EIMH 4DIQA 1GT0C 3JZ6A 2NNNA 1XGMA 4AU7A 4LITA 1T08B 2UXXA 3Q0UA 3RDIA 3ZN1A 2YYAA 5KG7A 2UUAH 1VTNC 4QIWE 1HW2A 2V1XA 2NRAC 3VYTB 1YW9A 3RYRA 4Y33A 4AM3A 2M9HA 2A6EF 3C2GA 3HKZA 3O6BB 1PUFB 5F9LA 2A68F 2KJCA 3Q8PB 3Q0WA 3KP3A 4E7KA 4CGZA 3AG3H 1BI1A 1LDJA 4RNNA 2XGQA 3P5JA 2MD0A 4BJTA 1ZGAA 1XGNA 2NOGA 2IPQX 1XK5A 3T9BA 3V7SA 1WKMA 2DBBA 3F0CA 1A48A 4RNMA 3HTSB 2FPPB 4V19K 2B63A 1OR7A 2JEGA 2OH2A 1ET0A 3CCJI 5B1BH 5IWAH 5IOYA 2H6CA 2W9BB 2QUFA 3QFFA 4ZYHA 4MV7A 4HLXA 4O7TA 2MGQA 1SAXA 1TQIA 1DGSA 3H0GA 1WJCA 1Z3XA 4BGDA 4O7NA 4L5IA 2O8KA 1XSDA 2IA1A 5CE8A 3MR5A 2C2EA 1LVKA 3PQKA 2R7ZA 5IYCJ 1EKFA 5LRSA 2NU7B 3HTUA 3LWFA 1U9NA 3O3KA 2KFDA 4CKCA 2BV6A 3VEPA 2PEXA 3DKXA 3RJ0A 4M9XA 1MNEA 4HSTA 2IGMA 2DWCA 3BQ1A 2L3DA 2ZMEB 1GVDA 2BXZA 2PMZN 3KCCA 4KMUX 4X0GA 1Y1VA 5LHIA 1M7JA 2NXNB 2I87A 1IOWA 4FFLA 4IQ4A 2ZM6H 3JZIA 2XGCA 3OIQA 2H94A 3TO6A 3F72A 4PBCA 4IRKA 1Q1VA 2EZIA 1T98A 3HPHA 5GONF 2BQRA 4EYIB 4RAZA 4XM3A 1IXCA 1S9FA 4IHVA 3N05A 4HRIA 3HDDA 3ZQIA 1AUVA 2W9CB 3ZQHA 1P8LA 2XB5A 2PMHA 4I0AA 1HKTA 2CW8A 1WJEA 2HYJA 2R7XA 3E5UA 2P5VA 3A4CA 3CQZJ 4MO7A 3RIRA 1TC3C 3UFXB 4I99C 3GQCA 1ZARA 3GFLA 2CV0A 3F8NA 4EBEA 3BT9A 2YUSA 3A2KA 2UU9H 4MQVA 4G8XA 3T9EA 2MW8A 5C4JJ 2MSYA 2XVCA 5EJCA 1ODDA 3R0AA 3IKTA 3CEBA 2R92G 3ZPLA 2R7SA 3SI8A 3GLKA 5B66C 2W70A 2UZKA 2WY8Q 1PJRA 2STWA 2EWNA 4GYIA 1HNXH 1MMAA 2EFPA 2VC1A 2O9LA 5IYDJ 5H20A 4BHBA 3PW2A 3WWHA 4LF7H 5JVLA 3VPCA 1DAAA 4UVBA 2HZTA 4YEJA 1J59A 3NGDA 1AA7A 5C1OA 2UV1A 5BWUA 3HSFA 3W6JB 4CCOA 1AKHA 3T8TA 5IYBJ 3CCVI 4CYCA 2PVPA 2Y0SA 3KHLA 3V4SA 3GIPA 4HX7A 2R92A 1UFMA 3BTCA 4L1KA 2IGKA 2K02A 2V5AA 2K9QA 1T94A 2OC6A 2Z3YA 1R1VA 1K7AA 4XRFA 1I2KA 3L2PA 2XAHA 5CB4F 1ZREA 1OBDA 5BWXA 3BG3A 1T56A 3OYJA 3W3CA 4BJ5C 5FKLA 3K4LA 4MTDA 4WHXA 3RB0A 5DCMB 1S5LC 3KP7A 4EM2A 1CQTA 3GV8B 5KG3A 1I27A 1BN5A 2VXZA 3VDXA 3A01A 3FXJA 1FOWA 5ILVA 3W2WA 1WJDA 3OL3A 1UAAA 4EFEA 4Z6YA 3KREA 4ZDPA 2AQEA 1OKRA 4EM1A 3TW7A 4XLCA 4ZTJA 2JN6A 3JRHA 3U55A 3H1CA 2IGOA 1NHAA 2W48A 2ZFWA 3HOTA 1B6SA 1L2ZA 2WTEA 1ZG1A 4Q48A 4TUYF 1UB9A 5ICGA 1ZRFA 4XX0B 5I5YA 3QPTA 2Z1DA 2D5VA 4A3KG 3CP8A 2G9WA 4J9MA 4XLPF 1R71A 4Q4DA 4IPAA 1SFEA 4F92B 4XN3A 4FQGA 2ZC2A 4FM9A 5FJ8J 1F1ZA 2E1NA 3W6KB 3NUAA 4E6NA 4DV6H 1FBSA 3PNVA 4GC6A 4OWRB 1LQ1A 4J9PA 4LF9H 3RBEA 1XS9A 1WRJA 2IS4A 4NB5A 4M74A 4IXAA 5BOXA 1CKOA 5BMZA 4EJTA 3JSNA 4BYYA 4EFBA 3E7LA 2ASDA 2K5CA 2FPIB 3KHRA 3TOAA 5K7FA 1Z21A 3PUFA 2MLKA 3GW2A 3GTJJ 3GO5A 4A3FJ 2M30A 3FWEA 1X2NA 1E2XA 4FX4A 3HUGB 2R7LA 4MFDA 4ENNA 1IYDA 2DCEA 1W96A 2GOMA 4C5BA 4XSZF 5HS7A 3RPUA 4EJVA 4NUBA 3V6JA 2JJ7A 4FHTA 1QA6A 1XC5A 3PIPF 4EGZA 4JI2H 3F22A 3OIOA 4EJWA 2CQYA 1M1EB 4ECQA 4DR5H 2OQRA 4M72A 3WE3A 4I6ZA 1I1GA 1R00A 2V1NA 3MZHA 3JSLA 4I55F 2WB1A 2Z5UA 4BHPA 2YZMA 3FXMA 1P4AA 4CMFA 2PJRA 2FE3A 3BCAA 4MEYF 1QU3A 5J47A 5DG8A 3JTHA 2R8HA 3GV5B 3K4NA 4P55A 5DISC 1Y0UA 1OCOH 2E36A 4ECVA 3A02A 4DUZH 4ZYEA 3PQJA 2CH0A 1ZLKA 3CJNA 3KLNA 1X2MA 4UCSA 1Z6RA 2CYYA 5LOVF 3OYMA 3BQZA 5FO5A 3L2RA 2QSHX 3VPBA 4DLKA 3QWUA 3H92A 2XAQA 2OZ6A 2DJIA 2XPUA 4ZYAA 4NZMA 4YAKB 5C44G 2FLNA 2VUMJ 2M5WA 1QRYA 1E4EB 1G3TA 1FTZA 5KAIC 2FJZA 3PW0A 1ZK8A 1Y8RB 2L2OA 5KFHA 5FNVF 3P7NA 1IW7F 3SXYA 4E7LA 3JRBA 5DGAA 2IBDA 4I01A 3LP8A 4U0YA 3FBIB 2L9RA 4IRHA 4CKEA 1ENHA 2YU3A 1Z1DA 2QQ9A 4RUAA 3P9CA 4ZDOA 4YR0A 2M4KA 3S3OA 3BQ2A 3LFUA 4RAFA 5CPRB 5EGOA 1YJ9I 2BGCA 4LF4H 1DU0A 5KFJA 2HKXA 2DQLA 4E7HA 4QIWA 4A3JJ 4Q45A 3H3UA 1L3LA 4C2TA 3G3ZA 1B9MA 3VWBA 2W82A 1DP7P 5DLGA 2J6UA 4WF2A 1U5TA 1R23A 3K7AJ 5GAGJ 3VYRB 5I60A 5K2MA 1BI3A 2W8KA 2WY7Q 2M8EA 1I50J 5KFXA 2Q0OA 4E4TA 2DQRA 4C9YA 3BZ6A 3RKWA 2NUAB 4LFCH 4EG0A 2UXNA 3ERMA 1NG7A 1V5EA 4ED6A 5L3BA 1VQMI 1ZGJA 2V1DA 3CDIA 3GTQJ 4R79A 2GQQA 3CF5F 9ANTA 3AAFA 3EYYA 4FASD 1FYKA 1X19A 4ECTA 4XR6A 4CDGA 4BBRG 4Q47A 5BPDA 2HYGD 1Y1WG 2L54A 4KITB 4HBLA 3T9AA 3KTMA 2C2RA 4F50A 1IO2A 1EV7A 2LP0A 2LBFB 4RZRA 3IV5A 2ACJA 4LOCA 3WNZA 3D0SA 4BQNA 1H8AC 5E3NA 4KFCA 2HIXA 1ETQA 4DV4H 3CESA 3MN2A 3HOVJ 4CHIA 1WGXA 2JK3A 3Q5FA 3MCZA 1QVUA 2M34A 3HG9A 3PUBA 1ZQ3P 3ABLH 1OISA 4GC7A 2EA4A 3R4KA 4UVCA 3T9CA 3WO1A 4RU9A 2CW7A 2RGVA 2XAJA 1IRZA 4Y15A 2ZMEC 5KFSA 2VOOA 1WWXA 2JUGA 2CSOA 2M0MA 2HG8A 3BR0A 5BS6A 2LSOA 3QPHA 1W5TA 4DV1H 1B8IB 5E20A 2QYOA 5DGBA 3GTMA 3GMEA 4O4LF 1D8KA 4OU0A 1K1SA 4RGUA 4JX4A 1H9GA 3BQ0A 2X9DA 2CQKA 4J9SA 3IRQA 2OPTA 1BOBA 1ZAOA 2R82A 2YL2A 5D1OB 2VPQA 2DA1A 1RYSA 3GFJA 3CUQA 4DR3H 1KJQA 4IJAA 5EEHA 3G1MA 3RGZA 5EDNA 1L0OC 4A3CJ 1QPMA 1X3WB 1V51A 3GYHX 5LL6b 2LD5A 3TMOA 5HBRB 3JAMW 1GO3E 1ERDA 2LFBA 3PNTA 1GLNA 3WGHA 4DR1H 4BXFA 2VBXA 3GTLA 3IC7A 3WU1B 2M87A 3W6VA 2UVUA 1V5FA 1VQ7I 2H1KA 4YR2A 2HGCA 2HOEA 4M3GA 1XSXA 1VQ9I 4U7CA 2QENA 2JA7A 3JR9A 2A5YB 2M7BA 1HKQA 1IRXA 1OMIA 4O3QA 3T1HH 5JUMA 1P9QC 2R92J 4IRGA 1FY7A 1A6QA 3MQ0A 5GTIC 1JUPA 2HKOA 2VPLA 3KETA 5IP7G 3A1YA 2BVMA 4KNYA 2R7MA 1A9XA 2DT7B 1YJNI 3HGYA 3UNGC 3M4IA 5LMNH 2CUFA 1XMKA 5DUKA 1W36D 1BC7C 1H0MA 1OYIA 2YR2A 4O7RA 2V9WA 2IBKA 1PYVA 2OA4A 5HNFA 3IKVA 5J2TF 3OMYA 4J00A 1DIKA 3KEQA 4A3MJ 3AX6A 3G8DA 4BQAA 2EILH 2EIYA 1YS7A 1VZ0A 2F5DA 2DIKA 3CO7C 5EZYF 1WHUA 2EBIA 2X48A 5DGIA 5FRMA 4KN4X 2VE8A 3CDLA 3H40A 4ZZDA 4BDZA 3GTPJ 5LEJA 3CVZA 2NVUB 3OUZA 1IN7A 2L7MP 5IOZA 2VA3A 4FISA 1T38A 3FX3A 5BWTA 2W57A 3T5KA 2EV5A 2XB0X 3DCFA 4M6XA 4YJ3F 2D1VA 1I3QJ 2E60A 2FXAA 3ETHA 1HW5A 1KU2A 2DFFA 3CSWA 2FUG2 5KFTA 1XD7A 1HW1A 3ZN0A 3RJPA 4M3EA 3B02A 4V2FA 3EUKL 4KHPH 3E1SA 2DN0A 2HDCA 2Z2SB 2XF5A 2WYOA 1JXSA 4DV7H 2KPMA 4LB6B 3T5JA 2DA2A 2RNJA 2IS2A 3AKZA 1K1QA 3LOCA 2COGA 1S03G 2VOBA 2AXTC 1B33N 2YW2A 4A2UA 2HS5A 2ZCWA 4I09A 1EF4A 5KFFA 4XICA 1IBKH 4A3KJ 1DV2A 2RKHA 3RTXA 4UHTA 2JA6A 2MABA 2Q1ZB 5DYMA 3VYUB 1D5YA 2Y30A 2DFIA 2PMZE 3FMAA 4JX6A 1PUEE 3F9KA 4RLFA 3IL2A 3FDYA 5DEQA 2DAOA 4RB0A 4HX8A 1QZEA 3QU6A 3ROUA 3S1QJ 5BPFA 1FTTA 3NARA 1B59A 5DQGA 1LPQA 1YOVB 1I1MA 5KT5A 3S2DJ 2FB9A 3K9TA 4JP0A 3T0YA 3RAXA 3JRCA 1BC8C 1BBYA 3S1RJ 2P81A 2EJ0A 3BQYA 5EF6A 3V8LA 5GPCA 4OMYA 3N6XA 1KQ0A 2F4IA 5CQEA 5LBQA 2RC4A 2CKZB 4XIDA 1ZETA 4BY7G 1JE8A 4DZJA 1TWFA 2ID6A 4X65H 4AVPA 1YO5C 4UCOA 3KP4A 2K85A 3VA7A 1EA3A 4HDUA 1ZN2A 3TIIA 3ZGKA 2R0QC 2YZGA 2A3SA 3GX4X 1APLC 3HEFA 4CZCA 2D45A 1UNNC 1MMNA 3PM1A 3IAM2 2QSGX 4JI5H 4DL6A 2XKPA 5E18F 3NQOA 2JZYA 4LIUA 4CKBA 4QWAA 4TVIA 2O6GE 3K2ZA 3UZBA 5HOOA 3GUDA 4HG2A 1XG1A 2VI6A 1I5ZA 2IVMA 3EETA 4QSHA 4IO9F 1YIJI 1N56A 2DTZA 2IA6A 1JJ6C 1U6GA 3RPQA 3JRWA 1AUXA 2QZ8A 2EH3A 2OLSA 4R8UB 3RB3A 3K4BA 3KP6A 2HDKA 4S05A 4LG0A 2YU9J 3WWJA 1I3AA 3CCMI 2JPBA 2ZSIB 5FRNA 4CC5A 1LNWA 2VPRA 2UUBH 4ENJA 3M3YJ 4O82A 5D8DA 4KJZA 3VNNA 2Q2EB 3OYLA 4IL6C 3MFKA 2VJ4A 3HOSA 3I59B 5H80A 5HLIA 2I8DA 2ZJRF 3GB8B 3DWLE 1HC8A 4F4WA 4HNTA 2CV1A 1IZ1A 5EWGA 3EPGA 4O83A 1IXSB 1EH6A 1P7JA 2R7OA 5GAHJ 4DRFA 4UUTA 2C6YA 2W6NA 2W6OA 5DQHA 4AQYH 2DOEA 4NDLA 3SHFA 2LLKA 1O3RA 4PZ7A 5LYJF 5KFKA 2UVVA 4N9IA 1V4RA 3D5RC 1WJ5A 3K70D 1LEAA 2BW3B 4CC6A 4B3AA 1O3SA 2XCLA 2COJA 4LK1F 1WRVA 4I02A 5KG1A 1OCPA 5FGMA 2XV4S 4FFPA 3PO2G 1KU3A 2R5ZA 4F7ZA 1WSUA 2HEOA 2QB5A 3OYGA 2V26A 2J6TA 4EVIA 4BBRJ 3FXQA 4WK8F 1A6IA 4JXUA 3V4ZA 1OYYA 4I98B 2CUEA 3EYIA 4WD3A 2W6PA 3V4GA 3CCQI 1MZBA 4JV5H 4YBZB 3FIWA 5L3GA 4JI0H 2RGRA 1ULZA 2GAUA 2HOTA 3A0BC 2HPIA 1HA8A 1JKJB 5LHGA 5DG7A 3HPGA 2NYXA 4A3EG 2HHFA 1JJ8C 4ED0A 3BABA 4UUGA 1B9NA 4BS9A 2W4SA 4DJAA 5AONA 2RREA 3DTKA 5DS9A
chains in the Genus database with same CATH topology
2VQCA 1K6YA 4IQ4A 2ZM6H 3S32A 3OIQA 4XLAA 1QHGA 5LFAA 4ITVA 3OYNA 4GLXA 2E5ZA 2MFZA 2VLAA 3HPHA 4II3A 1LKXA 4XM3A 4RAZA 1CKNB 3N05A 4HRIA 4EQ5A 1P8LA 1N33H 1QHHD 2CV2A 3KEYA 3ZR8X 2CW8A 1WJEA 1Z3YA 1V5GA 2HQAA 3KYLA 3S3MA 3K10A 3PNYA 2R7XA 3A4CA 3BA9A 1R6RA 3PSIA 1DP3A 1HNZH 3J7AK 3DPTA 1TT0A 2CV0A 3F8NA 3A2KA 4DBRA 4B3TH 3TL4X 2R7UA 2UU9H 3W1GA 3BG6A 1LDKB 4BEHA 5HVQC 4UCUA 2IXSA 4NXNH 1IBMH 4N4NB 4HSRA 2R7SA 4BUPA 3GBGA 3LSGA 2WY8Q 1PJRA 3AFHA 1MMAA 3CP2A 1WFXA 3RSNA 3DTEA 4LF7H 3SEZA 4NQWB 2LOOA 3H5AA 5FLXW 3RQ4A 4LH6A 4YEJA 4X66H 2VQLA 1AA7A 2X1EA 3DF7A 4GKKH 4BE1A 2UV1A 3C2HA 3AL0B 2R4GA 4U87A 4CCOA 2L9SA 4ZC3A 2Y0SA 2ZSHB 3RR5A 5FPRA 4B44A 1D0XA 4CCNA 3MWMA 4C2UA 4RLQA 2VUGA 1MNDA 2IGKA 1GYFA 4PJLA 2OC6A 2XF6A 3L2PA 2LH9A 3OS0A 1XMOH 3OYJA 3OYCA 3W3CA 4BJ5C 3K4LA 4MTDA 4UCVA 2HZDA 2W1OA 4NNJA 4Q0YA 5KNLA 3M8JA 1N75A 3DTIA 2KHMA 3BG7A 3N40P 2VXZA 3VDXA 3L4KA 3H0DA 5FD6A 3J81W 4B3RH 3W2WA 1WJDA 3OL3A 1UAAA 4EFEA 1SYXB 2WE6A 4CSWA 3OR1C 4BDYA 4QPQA 4E7ZA 3CF2A 4ZDPA 2AQEA 3EPZA 4XLCA 4ZTJA 3OR2C 4YRVA 1M0WA 2IGOA 3RPUD 3OS2A 3MKWB 4BEHB 4OX9H 4II2A 3HOTA 5KCMA 2R7TA 3GJXB 4ETSA 1L2ZA 1N78A 3HXLA 3SZGA 3KX2A 2Z1DA 4PJMA 3CP8A 3QYEA 4G6TB 4F92B 4XN3A 5CKTA 3VYSB 4FM9A 1X1BA 1U0JA 2UXCH 4DV6H 2GOXB 4E6NA 3DLAA 2PMZA 2XF7A 3PNVA 4OWRB 4RB1A 3W2AA 4LF9H 3H9JA 2VB6A 4OAZA 2IS4A 4HEA2 2O03A 1N77A 4RB3C 2XC7A 1J09A 1CKOA 5D1PA 4XKWA 4NXMH 4LF5H 2X6WA 3JSNA 4F3QA 2CUZA 4EFBA 2CFOA 4I7HA 3T1YH 2K5CA 1XNQH 3N41B 3DU6A 1YX5A 1Z21A 1FVIA 3KALA 4IX7A 3W1BA 4DV3H 3HUGB 1Y56A 2DCEA 2GOMA 2X6XA 1IBLH 3VSLA 4PZ6A 3W5OA 5HLTA 1SAUA 5FD5A 1N36H 2AQFA 2E1MB 4NUBA 4LH7A 4LFBH 1M0TA 4JI2H 3H5RA 1SEIA 4DR5H 2HDWA 2V1NA 3LSKA 2F6CA 3BA8A 3JSLA 4X64H 2WB1A 2HPMA 2VKDA 2PJRA 2KDOA 2VASA 3BCAA 1QU3A 1Y6IA 3ZRGA 2FE3A 3LMMA 1I94H 3K4NA 5DISC 1UG0A 3OYDA 4PFOA 4DUZH 2VQGA 2CH0A 4UCSA 2XSJC 3OYMA 1W36C 2L5QA 3L2RA 2L7KA 4GKJH 3QWUA 2LBFA 4K0KH 2DJIA 4ZYAA 4B3MH 4RM3A 2UUCH 3H9GA 3LMLA 2L2OA 4DV2H 4XNFA 3OYHA 3DU5A 2MCTA 3N43B 2CFMA 1T0FC 4E7LA 2KP6A 2VPSA 4XKVA 3MMYB 1FMWA 4Y3OA 2Q2UA 2VJIA 3NWSA 3FBIB 4R7RA 4XMYA 2KRHA 3VSKA 4ZDOA 4D1QA 2M4KA 3I9V2 3S3OA 4DR4H 3LFUA 2L9NA 5CPRB 5HNHA 3PSFA 1Z2OX 1YX3A 4CH7A 1JI8A 4PK4A 4IQJA 3IG0A 4LF4H 4E7HA 4D9JA 2JSPA 4YHHH 2W7NA 4XOPA 3C0FB 1BR1A 4C2TA 1D1AA 3TBIA 3ONQA 2IGNA 3VWBA 2HIVA 2W82A 1BJTA 4CCKA 1FKAH 3FBNB 4PSWA 4M7EA 4CUGA 3VYRB 4B48A 2WY7Q 3BAAA 5D1OA 3K4KA 3TY5A 3TY8A 2CMPA 1X1AA 4F52A 1N34H 4AYBA 2JVGA 3NBYB 5FPOA 4LG3A 4C9YA 4PDBA 4DUYH 1YE9A 4XOTA 3EUHC 4DGWB 4U7BA 3OYBA 4A2BA 4LFCH 3L4JA 4B3XA 1NG7A 1V5EA 5TGTA 2KSWA 4ZDLA 2A5WA 4R79A 3QYBA 4FASD 3EYYA 1DGWY 1X19A 3G2BA 1MMGA 3QYFA 4XR6A 1CKMA 3GDEA 4XLHA 2V7FA 4BE0A 4BJ6C 1S68A 4KITB 3OOUA 2HU9A 4XN0A 1OLTA 4YY3H 3H35A 3D5LA 2OUMA 4MV9A 2LBFB 3IP4B 1G8XA 1D1BA 4RM2A 2X1DA 2LY1A 4BQNA 2V6EA 2CUJA 4LF6H 4JI8H 4J01A 2HIXA 4LSXA 4BQOA 2KMUA 3V42A 3D5SC 4DV4H 3CESA 2MC4A 1WH2A 1XNRH 4UCTA 3HG9A 3LSMA 3PUBA 2K3PA 1BGWA 1SFKA 4A2AA 2CW7A 2LYCA 3IAS2 3PFYA 2IS1A 2KRCA 3CJRB 4NC7A 2RGVA 4CCJA 2HHHH 3RGXA 2JUGA 3ZQQA 3N42B 2M0MA 1Z2NX 2JA2A 3NBZB 4H4KC 2M7AA 4ANJA 4DV1H 2YCHA 2F5VA 4FETA 5JHFA 1DQUA 3H9QA 3S3NA 4DV0H 1I6UA 3K4CA 2VL8A 4GRIA 3EUAA 1BOBA 2K9LA 5D1OB 2HVQA 4XKCA 2O5RA 3TY9A 3UQ8A 2VQEH 4DR3H 3BC8A 2UXBH 3RGZA 4PJJA 4EATA 3RCOA 4JI1H 3RIZA 2OWOA 4PSXA 3OYAA 5LL6b 2XDVA 3TMOA 4LMYA 4LFAH 2M3AA 1HR0H 5KHDA 2X1CA 4J0MA 2MYSA 4RMNA 1D1CA 3S8PA 4ZJZA 1ERDA 1O75A 3PNTA 3KAKA 3JAMW 1GLNA 3S93A 4DR1H 4RB2C 1HNXH 4BXFA 1D0ZA 2ZXIA 4B47A 3LL7A 2VJ5A 1V5FA 1OR7C 2OV7A 2M7BA 3MKYB 1IRXA 3MKZA 4CCLA 1ZHSA 3T1HH 4BWSC 4N4OB 1P9QC 4X62H 4LF8H 4BE2A 2LG4A 4P5OA 2VPLA 4F93B 3RF2A 4IAJA 2LC2A 3ZCOA 3A1YA 2BVMA 1X9NA 5LMUH 4ZTFA 2DT7B 3IUOA 2K9MA 3UNGC 3AL0C 3M4IA 5LMNH 2UWMA 1W36D 2RQQA 2UXDH 4LIVA 3DPUA 2ZXHA 1PYVA 5HNFA 1E4GT 2BVLA 3OMYA 2M4GA 1FJGH 4J00A 4JQFA 2R7QA 3K70C 2LY2A 3RTRA 4NC8A 4JI4H 1VZ0A 2RNGA 4HPQA 3H20A 1X4PA 5FRMA 4CCMA 4PZ8A 4JI3H 4EEQA 4QPOA 4BDZA 3OYFA 3CVZA 3KYHC 3QODA 3DQVC 4YELA 2W57A 4MLOA 3H5NA 2CS3A 4E7SA 1X1CA 2IS6A 2P0WA 1T95A 4CA0A 4E7IA 2E60A 1HNWH 5IT9W 2FUG2 4BU2A 2ELJA 4PUSA 2WDTA 1Z2PX 2HVSA 2A6TA 3J80W 3EUKL 4KHPH 3E1SA 4DR7H 3OS1A 2Z2SB 2XF5A 2WYOA 4DV7H 2KPMA 3OIPA 3L2UA 4B3SH 4XL9A 3U21A 2IS2A 3LSIA 3AKZA 4APMA 2HVRA 3CJQB 4RZQA 1S03G 2VOBA 3BCBA 3PJRA 4PFPA 4AVZA 2VQHA 2W00A 3DKYA 3QOEA 2VQFH 1IBKH 4E6KG 3RTXA 2F4VH 2MABA 3SDBA 2Q1ZB 1V9PA 3VYUB 4LSAA 2WBMA 2NOJB 3K4MA 2PJRB 3FMAA 2R7RA 2DOAA 2R7WA 1P16A 3KAJA 3M1CA 3FKJA 3F9KA 4RLFA 2BOLA 4XORA 3FDYA 4XLEA 2UUZA 4RB0A 1WJFA 3FHNA 1VS0A 2LREA 2E5LH 1BR4A 4JI7H 4DV5H 4JYAH 4DR6H 2X6YA 3CZ6A 1NG6A 2E1MC 4E7JA 3N6XA 3CMMA 3SYTA 2F4IA 5CQEA 1J5EH 2WAFA 4UFZA 3HL2A 2X51A 4OAYA 2R7VA 2HNHA 2BW3A 3OL4A 2VKHA 3OY9A 4X65H 1Z7LA 4IKFA 4UCOA 1X4OA 2V9KA 4F91B 1S9HA 1EA3A 4Y4RA 3ZGKA 4PJNA 2KL4A 5CQGA 4DOZA 1N32H 4XKBA 3OYEA 5BR8H 4CZCA 3J7AY 2WAEA 1MMNA 1DGRM 1ZELA 3IAM2 4JI5H 3BLYA 4F55A 4IZZA 4BACA 2DXIA 4LIUA 1XDNA 4MTEA 2ZFUA 2VJJA 4XLFA 1WJAA 4C30A 1TAEA 4KISA 3OYKA 5HOOA 1TA8A 4B43A 3K3VA 4HG2A 2XAUA 3HC7A 4BQQA 1A0IA 4RAYA 1X1DA 5A2QW 2Q2TA 1D0YA 4KT6A 3N44B 4JOMA 3LSHA 4DBQA 1G59A 3K4BA 3S24A 1MMDA 5FROA 1MW7A 4XQFA 4P1WA 4JI6H 4XONA 2DT6A 2ZSIB 3OYIA 5FRNA 4CC5A 3MD2A 3NWTA 4UCRA 2UUBH 2QKMB 3SEQA 4DIQA 4KJZA 3VNNA 4HNUA 2Q2EB 4AU7A 4LITA 3OYLA 2VJ4A 3HOSA 3K6GA 2ZJTA 2I8DA 3GB8B 3DWLE 2UUAH 4HNTA 2E5NA 1CKNA 2CV1A 3VYTB 3KXYT 2WAQA 2R7OA 1LFPA 2XIGA 4E4HA 4DRFA 2WA0A 4Y33A 3C2GA 3HKZA 2VXDA 4AQYH 4PZ7A 3PN1A 3I3LA 1WJBA 3W2VA 3DPLC 3D5RC 3K70D 1WJ5A 1AN7A 4E7KA 3ZXSA 1B04A 1XMQH 3OWTA 2QKLB 2BW3B 4CC6A 3L2WA 3NC0B 2MD0A 4BJTA 1XK5A 3K4JA 2VIXA 2LRDA 2JVHA 3E0JB 1ZHQA 5EOYA 3OYGA 3OTOH 2V26A 2Z16A 2KLOA 5IWAH 1UELB 1E4FT 2X85A 3UR3C 4MV7A 1DGSA 1FMVA 3PL8A 1WJCA 2V4JC 2KZVA 1Z3XA 4BGDA 1MZBA 5LD2C 4JV5H 2KQRA 4JI0H 2RGRA 3DEEA 3L2VA 1LVKA 4DR2H 2HPIA 2WADA 3L2QA 1HA8A 1BR2A 3HPGA 4BL0B 2HGSA 1E0EA 1KONA 1TZLA 3BABA 3DKXA 4BS9A 2W4SA 1MNEA 4HSTA 2IGMA 4DJAA 2RREA 3RJ0A 3DTKA 4X0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FVI A;  3NBZ B;  3W1B A;  1VS0 A;  4GLX A;  4PZ6 A;  3W5O A;  4LH7 A;  1CKN B;  5D1O B;  4EQ5 A;  2HVQ A;  1P8L A;  3TY9 A;  3UQ8 A;  4UFZ A;  3BA8 A;  3JSL A;  2OWO A;  4UCO A;  3BA9 A;  5DIS C;  4UCS A;  3W1G A;  4UCU A;  3QWU A;  1XDN A;  1TAE A;  1TA8 A;  1A0I A;  2CFM A;  1X9N A;  4LH6 A;  2Q2T A;  2Q2U A;  3S24 A;  3RR5 A;  5FPR A;  4CC5 A;  4UCR A;  2VUG A;  3VNN A;  2HIV A;  4PZ8 A;  3GB8 B;  3L2P A;  1CKN A;  4EEQ A;  3BAA A;  3KYH C;  5D1O A;  4DRF A;  3TY5 A;  4UCV A;  3TY8 A;  5FPO A;  3NBY B;  4PZ7 A;  3PN1 A;  1B04 A;  4EFE A;  4CC6 A;  3NC0 B;  1XK5 A;  2HVS A;  1CKM A;  3GDE A;  1S68 A;  3GJX B;  1DGS A;  2HVR A;  2HIX A;  4E6N A;  4UCT A;  3RTX A;  1V9P A;  3BAB A;  1CKO A;  5D1P A;  3JSN A;  1P16 A;  4EFB A; 
#chains in the Genus database with same CATH topology
 2P7V B;  3I56 I;  2VQC A;  3DAA A;  1K6Y A;  3LQQ A;  5HLH A;  2HGW A;  2W6Z A;  1MGT A;  5LFA A;  4RNO A;  2E5Z A;  3GTL J;  3H3Z A;  1LKX A;  4IOA F;  3L00 A;  5D5W B;  2I8C A;  1EHI A;  5DV5 A;  3I64 A;  5IY5 H;  1JUM A;  3UYY A;  1YJW I;  2XD4 A;  3LA3 A;  3SFZ A;  4HR7 A;  1G4D A;  3KEY A;  2M05 A;  3KYL A;  1Z3Y A;  2HQA A;  1OCT C;  5BQT A;  1K83 J;  4J9L A;  4HF2 A;  3BA9 A;  1DP3 A;  3AW8 A;  4DIM A;  1TT0 A;  1MJA A;  3WGI A;  4B3T H;  4O3S A;  5LGU A;  3S17 J;  2GZW A;  3DTG A;  5DGH A;  3BG6 A;  1KU9 A;  4UCU A;  4BEH A;  5DD8 A;  5HVQ C;  2IXS A;  4NXN H;  2FX0 A;  3HIF A;  4H0E A;  2B7E A;  3C1D A;  3CC7 I;  1S7A A;  4EEF G;  1RUO A;  1F5T A;  5L3E A;  5KAF C;  5L1L A;  4R8U A;  2FLP A;  2RVC A;  3CP2 A;  3HHG A;  5E8G A;  3D1N I;  2P6T A;  4TQS A;  2EIK H;  5CVU A;  2DTR A;  2Z9O A;  4NQW B;  2LOO A;  1JIH A;  5FLX W;  4X66 H;  1FT9 A;  3C18 A;  3BG5 A;  4IHJ F;  3DF7 A;  4JUZ A;  3GTO A;  4GKK H;  4QWD A;  1FYM A;  4QWQ A;  3M8F A;  5CAE B;  1WCM G;  4F4X A;  1IV6 A;  2R7F A;  4U87 A;  5IP7 J;  2ZDG A;  3CJT B;  4KN7 X;  5JR3 A;  2KIF A;  4BXX G;  4ZC3 A;  3GID A;  1SMY F;  2ZSH B;  1KBL A;  3U2R A;  1Z77 A;  3K3P A;  3IWF A;  5DAA A;  4HF1 A;  5GAE J;  2EPF A;  1MND A;  5DTD A;  1GYF A;  4PJL A;  1W93 A;  2QVO A;  1S7O A;  1XMO H;  4TV7 A;  2FQ4 A;  4UCV A;  3K69 A;  4NNJ A;  4Q0Y A;  4ECZ A;  2E2I A;  1N75 A;  3DTI A;  3SFI A;  2KHM A;  3N40 P;  2R85 A;  2VBW A;  3GIJ A;  3ETJ A;  1S6L A;  5CYV A;  3CCE I;  3GV7 B;  2FMA A;  1MJ9 A;  3L4K A;  1RYR A;  5J8F A;  4HNV A;  2WE6 A;  1TWC A;  2FK1 A;  3OR1 C;  4E7Z A;  2VBY A;  4Y7N J;  2QSF X;  2V9V A;  3TOB A;  5EDW A;  1LDD A;  1U78 A;  1SVL A;  5K1Y A;  3H36 A;  4RA2 A;  2GXG A;  3RPU D;  3MKW B;  2W71 A;  2B63 G;  3SGI A;  2PBI A;  5F0C A;  2RDP A;  2LNB A;  4ETS A;  3LA2 A;  5E8I A;  2R7T A;  5M3F J;  3GIM A;  1S8N A;  5J2U F;  4JX5 A;  2ZXW H;  4PJM A;  2COM A;  3H0G G;  2F4O B;  3R5F A;  1CE8 A;  4WXD A;  1DPR A;  2CQ7 A;  3VYS B;  2QQB A;  4J19 A;  3V7R A;  1M6V A;  4IHT A;  1U0J A;  3HOX G;  2GOX B;  2PMZ A;  4WWC A;  3W2A A;  4Q8E A;  2R7Z G;  2VB6 A;  2MH9 A;  1G3Y A;  1XPX A;  2O03 A;  1E17 A;  3BAC A;  3WTX C;  2CJJ A;  1BOA A;  3RKQ A;  1AKH B;  2FOK A;  4XKW A;  4NXM H;  1MH3 A;  4I7H A;  2CUZ A;  4CYC B;  2CFO A;  2OU2 A;  4BH9 A;  3DU6 A;  1YX5 A;  1Y1V G;  1JKP C;  3KAL A;  4IX7 A;  5JQG F;  4FT8 A;  3ABK H;  3ASN H;  2K27 A;  4BHC A;  3PW5 A;  2HI3 A;  5GPA A;  1Y56 A;  2XRN A;  3WHC A;  5D6F A;  2VON A;  2C00 A;  4PZ6 A;  3W5O A;  5TRD A;  5HLT A;  1HF0 A;  2L9V A;  1N36 H;  4UXN A;  3HOV G;  2E1M B;  4LLN A;  2PLY A;  1M0T A;  3LWB A;  3H5R A;  2V79 A;  4WXH A;  2DZD A;  4U0V A;  2Z33 A;  1EKE A;  3BA8 A;  5D8L B;  4NYE A;  3BR3 A;  4IRI A;  3ELK A;  2VAS A;  4BY7 J;  2XGP A;  3ZRG A;  3A01 B;  3U1K A;  1I94 H;  1VQO I;  5KFW A;  1UG0 A;  3KPH A;  4NBQ A;  2B0L A;  2VQG A;  3H3V K;  3J81 K;  4MAM A;  2XSJ C;  1W36 C;  4HYE A;  3RI4 A;  1G2W A;  3FMS A;  5KVR A;  4K0K H;  1PP8 F;  4B3M H;  4O2A F;  2UUC H;  3H9G A;  4GCV A;  1IYE A;  3LML A;  4RDU A;  1QO0 D;  4ZOL F;  4M9U A;  4DV2 H;  3OYH A;  3BDD A;  2MCT A;  4BXU A;  4A3C G;  2CFM A;  1T0F C;  4OIN F;  1SMT A;  2FP4 B;  1JHF A;  1GV2 A;  3HRU A;  2V59 A;  2ISZ A;  1UHS A;  2KRH A;  2OBP A;  5DG9 A;  4D1Q A;  3GF2 A;  1YYV A;  3I9V 2;  2L9N A;  1UC8 A;  2KKO A;  1MDM A;  1Z2O X;  3U9T A;  3WE2 A;  1LVA A;  2VBZ A;  3J81 Z;  4YHH H;  3VPR A;  4W97 A;  2W7N A;  2R86 A;  1BIB A;  1TL8 A;  4FBT A;  2HIV A;  2JPC A;  1EH8 A;  4M7E A;  1RNL A;  1I1K A;  2ZJ2 A;  2ASJ A;  1RK5 A;  1BJZ A;  5ICC A;  3K4K A;  3ZMZ A;  2DMQ A;  4MV1 A;  1XCV A;  2W24 A;  4F52 A;  1DU6 A;  1PX2 A;  2C2D A;  1GXQ A;  1H9T A;  4XOT A;  4DGW B;  5L3D A;  5F6F A;  1K61 A;  3TO7 A;  2KJB A;  2KSW A;  5TGT A;  3RZO J;  5KFL A;  1SFX A;  3JCU C;  3F3X A;  1LFU P;  1JUS A;  2A5W A;  5F08 A;  4S0H B;  1J2X A;  4XLN F;  2RV8 A;  1GSH A;  1U8B A;  3FHZ A;  2X0S A;  2W9A A;  4F4Z A;  3T1B A;  1TBX A;  4BE0 A;  4BJ6 C;  3GZ6 A;  2QBY A;  3WTW C;  4V2G A;  2O61 A;  4A0X A;  3JAM Z;  1OLT A;  3DEW A;  2L4M A;  3L2C A;  4PWQ A;  4MV9 A;  3PO2 J;  1TWG A;  3BJA A;  1G8X A;  1SVO A;  1D1B A;  1FC3 A;  4RM2 A;  1TWA J;  3ZQ7 A;  2FSW A;  4XK4 A;  1SAN A;  4FS1 A;  2KMU A;  2G7H A;  1ITY A;  2DDB A;  2MC4 A;  2OTL I;  2W7P A;  5M5W J;  4XYL B;  3TDZ C;  1MBJ A;  1A31 A;  4DYR A;  4U88 A;  3UKG A;  2K3P A;  3GTK A;  1CF7 A;  2YS6 A;  1BGW A;  1SFK A;  3PVX A;  3PFY A;  1RPW A;  2IS1 A;  3CJR B;  2R84 A;  4A3E J;  3ZQQ A;  1JTY A;  4RS8 A;  5EGO B;  1ZTR A;  1Z2N X;  1K4S A;  2VOP A;  2JA2 A;  2J6S A;  5B3S H;  1HKS A;  1H88 C;  4QJF A;  1PDN C;  3ULQ B;  4CE5 A;  5I5V A;  1Z67 A;  5EEG A;  3M9M B;  1DQU A;  4NLG A;  1XGS A;  4ZYG A;  1KYZ A;  3BTJ A;  4EQQ A;  3Q8S B;  1JKO C;  3S1M J;  4HOB A;  3GTG J;  1U5T B;  3K4C A;  3MVP A;  1FEX A;  4GRI A;  2K9L A;  1J0R A;  2V9P A;  4A3M G;  2O5R A;  2FF4 A;  2J5P A;  1C30 A;  1BA5 A;  3E5X A;  1SD5 A;  3RCO A;  4JI1 H;  4ON0 A;  1Z05 A;  3OYA A;  3N8D A;  4JV1 A;  3KZY A;  4UVA A;  1ZAU A;  2BQU A;  4LMY A;  3WHB A;  2M3A A;  5HDG A;  3UZO A;  1VAJ A;  5KHD A;  2X1C A;  3B6C A;  2MYS A;  3GTO J;  3EQL F;  3S8P A;  2UVW A;  1VQ6 I;  2VC0 A;  4PGG A;  4RB2 C;  2HGX A;  2ZXI A;  4MV6 A;  4QW8 A;  2FJ1 A;  3LL7 A;  4KIC A;  5I5U A;  4ABZ A;  2VA2 A;  1OR7 C;  5JLW A;  3V6H A;  4M9Z A;  1XGO A;  4AC0 A;  3ABT A;  2KIS A;  3CTA A;  3BZK A;  2ZBK A;  5K7H A;  3VB2 A;  4X62 H;  4LF8 H;  4RAG A;  4FCY A;  4CIC A;  2LG4 A;  2EZH A;  4P5O A;  3DV8 A;  4F93 B;  4IAJ A;  3RF2 A;  3ZCO A;  3WTS C;  2W25 A;  3SNO A;  3WTZ A;  2K9M A;  3HO8 A;  2NAZ A;  4AWX B;  2I80 A;  4IEJ A;  4IZO A;  6PAX A;  4AIJ A;  5E3M A;  1WCM J;  4PCQ A;  1NK2 P;  3QQM A;  2UVR A;  4ESJ A;  2K4J A;  2A69 F;  4JQF A;  3K70 C;  3WTU C;  2LY2 A;  1A0G A;  2ELK A;  4NC8 A;  1WI9 A;  1KU7 A;  4BXX J;  4JI4 H;  1TWC J;  1RJR A;  5M3M J;  4HPQ A;  3MFI A;  3M4O J;  1X4P A;  3JRX A;  3WGG A;  4PZ8 A;  2K7L A;  1R9T J;  4JI3 H;  5BWW A;  5I5X A;  2M2E A;  4QPO A;  4EEQ A;  3KYH C;  3QOD A;  4KIG A;  1IC8 A;  2W85 A;  4G7O F;  4DW6 A;  3G71 I;  4O4I F;  1TTY A;  1W1W E;  3DQV C;  3PIO F;  2XAS A;  3CCL I;  4IOC F;  2CS3 A;  5L9X A;  3CUQ B;  1IF1 A;  5E1W A;  4KUM A;  2P0W A;  3OV8 A;  4CA0 A;  1ZKG A;  2WAQ N;  5IT9 W;  3M7G A;  4BU2 A;  2ELJ A;  5GAD J;  3QZ7 A;  1W7P A;  2M45 A;  2XAF A;  4MQ9 F;  3T5H A;  2HVS A;  3J80 W;  3CMY A;  2WV1 A;  3JSO A;  2GIZ A;  4UUS A;  4U0W A;  1WVR A;  1ON2 A;  5F0F A;  2LTP A;  2IT0 A;  3U54 A;  4L9N A;  3R5X A;  3L09 A;  3U21 A;  1RIO H;  3RB6 A;  2BHY A;  3CJQ B;  3TDU C;  4E70 A;  2DMU A;  4RZQ A;  5CVR A;  2B63 J;  2VR1 A;  3PJR A;  4HZF A;  3MWE A;  2QYZ A;  2VQH A;  3DKY A;  3QOE A;  4I4T F;  4E6K G;  3MFH A;  5KFI A;  5L1K A;  5C4X G;  3H0G J;  3JRF A;  4F4Y A;  2F4V H;  3RQI A;  5JQW A;  3HOX J;  1JXL A;  3CO6 C;  2CQX A;  2YSR A;  2WBM A;  2NOJ B;  2DLN A;  2K9N A;  1W5S A;  4MGR A;  2R7R A;  2R7W A;  2R7Z J;  1P16 A;  3M1C A;  4A3I G;  1R36 A;  4XLE A;  1ORK A;  1WSC A;  5BNG A;  1Y8Q B;  5KG0 A;  2G7U A;  3FHN A;  4O3O A;  2EFO A;  2LRE A;  3C7J A;  5GP9 A;  3ZMD A;  1T36 A;  1Y1V J;  2LY9 A;  4EV0 A;  4Q5S F;  1NG6 A;  2DMN A;  2E1M C;  5E25 A;  3ZMS A;  2L0K A;  1BW5 A;  3EUH A;  5E79 C;  1OFC X;  2KIQ A;  2WAF A;  2ATL A;  3HL2 A;  4UV9 A;  2A1H A;  4IRC A;  3FF5 A;  4QTR A;  2R7V A;  4B09 A;  2SCU B;  4C2M A;  1Z7L A;  1EJ9 A;  2BE5 F;  4IKF A;  2ZDH A;  3Q8R B;  2W8L A;  1S9H A;  2F2E A;  2DMP A;  2LDU A;  2PN6 A;  1JKR C;  4PJN A;  2KL4 A;  5CQG A;  4DOZ A;  3I4P A;  4FE2 A;  3LAJ A;  3G73 A;  1SFO A;  4A0Z A;  1S29 A;  2ME0 A;  3FMQ A;  3HUG A;  3WTT C;  4OIQ F;  1DGR M;  1B1B A;  2HWV A;  2BQ3 A;  3AG2 H;  2W7O A;  3S2H J;  4F55 A;  2JA7 G;  1XDN A;  2VJJ A;  5FKM A;  2ADU A;  3RB4 A;  1WJA A;  4IWX A;  2EA2 A;  4C30 A;  4YFN F;  1TAE A;  5EEA A;  5FLM G;  4B43 A;  3K3V A;  4RAY A;  1YS6 A;  1XMX A;  1FOK A;  4JV0 A;  1H89 C;  1YRN A;  2Q2T A;  3QP5 A;  3N44 B;  4DL2 A;  2F48 A;  2CZG A;  4O3R A;  3LSH A;  2BR0 A;  1XSV A;  4A93 J;  5KT3 A;  2C35 B;  1X3U A;  1MBF A;  5FRO A;  1MW7 A;  4D7M A;  4Y8V B;  4GDF A;  4XON A;  5D8K B;  3I58 A;  3NEU A;  2ESN A;  4UCR A;  3K1N A;  4HNU A;  2ZJT A;  3K6G A;  1N48 A;  1TP4 A;  5EZH A;  3WOD F;  2E5N A;  1CKN A;  5JVG F;  1I7L A;  2XIG A;  1LFP A;  2DLL A;  5JLX A;  4E4H A;  2WA0 A;  4CXF A;  1UC9 A;  4EEY A;  2Q8K A;  2ABJ A;  1RI7 A;  1O7F A;  1Z9C A;  1R5H A;  3I3L A;  3PN1 A;  4R8H A;  3CD6 I;  5ICF A;  1YW7 A;  3DPL C;  1F4K A;  1I2L A;  1AN7 A;  2V58 A;  3ZXS A;  2KDZ A;  1XMQ H;  5LLQ A;  1B6R A;  2BY3 A;  2QKL B;  4A3G G;  4CYD A;  3L2W A;  5IYZ F;  2XGE A;  4HQM A;  4MV8 A;  2FEZ A;  3DBH B;  2VIX A;  3REO A;  3RBD A;  2LRD A;  4LB5 A;  3GTK J;  2JVH A;  4A3L G;  1ETO A;  2YPR A;  4Y52 J;  1ZHQ A;  5EOY A;  2Z16 A;  1QQI A;  2KLO A;  5JVD F;  2E19 A;  2FK2 A;  1W0T A;  1KYW A;  3T9F A;  2BEO A;  3UR3 C;  4D5C A;  4EJU A;  2F5E A;  1T3N A;  2V4J C;  3PO3 G;  3PW7 A;  2KZV A;  1N25 A;  3ASO H;  4LFU A;  1VQ5 I;  1I6X A;  5JHU A;  5LD2 C;  1JTX A;  3DEE A;  3L2V A;  4YFX F;  1BXR A;  4HX4 A;  4DR2 H;  3DKW A;  2WAD A;  1BR2 A;  2CO5 A;  1ETY A;  4AID A;  3K5I A;  3V6K A;  4BL0 B;  5K7Z A;  2HGS A;  1KON A;  4S04 A;  5FLX Z;  1F36 A;  1TZL A;  2JA6 G;  2FRH A;  5A2Q K;  3T7A A;  2R7N A;  5CVJ A;  1FNN A;  4LG0 B;  2CW0 F;  4NC6 A;  3MR2 A;  4O3N A;  5GTH C;  1S0N A;  5LHH A;  2HQ5 A;  3S32 A;  3G1L A;  4XLA A;  1MIJ A;  1QHG A;  2HR3 A;  3U1D A;  5CJ9 A;  5DM6 F;  3OYN A;  2QEX I;  1GXP A;  2MFZ A;  1DDN A;  3E3V A;  1IJW C;  4A3B G;  4II3 A;  2Y48 A;  3KP2 A;  1U5T C;  2ALZ A;  4J9N A;  1GVJ A;  4GLW A;  4EQ5 A;  5AIQ A;  2NVY A;  2PBZ A;  4Q4Z F;  2H09 A;  1T2K A;  3ZR8 X;  1STZ A;  5TIS C;  2MBF A;  3S3M A;  1OCR H;  2DAB A;  1SD4 A;  1OWT A;  3FXL A;  5M5X J;  3G6X A;  4GGG A;  2NVX A;  2I10 A;  4HQE A;  3GLL A;  2ME6 A;  5A2Q Z;  1EH7 A;  2O7O A;  2XPV A;  3DPT A;  1HBX G;  2HJW A;  3J7A K;  3T9D A;  1MSE C;  4HV5 A;  3T5L A;  1IN4 A;  1LDK B;  2P7C B;  2V1U A;  2R5Z B;  2NVT J;  2CQN A;  4HSR A;  1E3H A;  4BUP A;  2ZGI A;  4FBU A;  2P6S A;  3GBG A;  3JSP A;  3LSG A;  4A6E A;  3AFH A;  3O8G A;  3QP6 A;  4AD9 A;  4RCN A;  3RSN A;  5J8C A;  1IXR C;  1QZZ A;  3DTE A;  4RGS A;  3SEZ A;  3H5A A;  5H6R A;  4AIH A;  3RQ4 A;  2VQL A;  3PR5 B;  4BE1 A;  1U9O A;  4C3J J;  1YG2 A;  1LEB A;  2R87 A;  1JLL B;  1RET A;  2HHF B;  5BMV F;  4Q8F A;  4HLY A;  5E17 F;  1YW8 A;  4B44 A;  1D0X A;  3FIS A;  3MWM A;  4CCN A;  2WV0 A;  2RDI A;  2L02 A;  4C2U A;  4O4J F;  4RLQ A;  2NU8 B;  5FFZ A;  3ZMV A;  3JTG A;  1JDE A;  2DU9 A;  4MIM A;  3DLL F;  1OPC A;  4WXC A;  4ESF A;  2FD5 A;  5F04 A;  3ISP A;  1VQL I;  3KFW X;  4I76 A;  5DCF A;  1O57 A;  4DZP A;  3OYC A;  3QQA A;  2HZD A;  2YS7 A;  4O84 A;  3FDS A;  4ECW A;  3M8J A;  4BBS G;  1P2F A;  5LA6 F;  3BG7 A;  4FFO A;  3F8B A;  3CUQ C;  4Y13 A;  1QVT A;  2N8G A;  4FS2 A;  3H0D A;  2IP2 A;  1SYX B;  3QWL A;  4ZZL A;  4AYB N;  4CSW A;  1KJI A;  3I71 A;  4QPQ A;  3FK7 A;  2OJE D;  3BJ6 A;  3KLO A;  5KFA A;  3EPZ A;  2JEJ A;  3OR2 C;  5KT7 A;  4YRV A;  2K86 A;  3OS2 A;  4BEH B;  4O3M A;  5DD4 A;  4O7Y A;  3ZMU A;  3GJX B;  4G7Z F;  5CR5 A;  1N78 A;  3TIG A;  3HXL A;  3SZG A;  3KX2 A;  5ILS A;  3F8M A;  2RF4 A;  1HQC A;  2G0E A;  1UJ8 A;  2YX7 A;  3K1P A;  3QYE A;  3BPX A;  4FX0 A;  3SDG A;  3BPV A;  1PP7 U;  1WQ2 A;  2K40 A;  5CKT A;  2R8J A;  1MBK A;  2R5Y A;  3VFZ A;  4CO8 A;  4P9U A;  4D0P A;  3I4N G;  2UXC H;  1A04 A;  1ZQ7 A;  3ZMT A;  5HNE A;  5D6E A;  2LKP A;  4OAZ A;  1HLV A;  2IRF G;  3WWI A;  3HM5 A;  4HEA 2;  3M07 A;  5B5E C;  1N77 A;  1U3E M;  1J75 A;  4YJ2 F;  5J3L A;  1J09 A;  5C4X J;  2IEK A;  3LQS A;  3IH3 A;  4LF5 H;  4DL7 A;  2X6W A;  4TV9 F;  1CQJ B;  4F3Q A;  4XRS A;  3N41 B;  1FOY A;  3EDP A;  2GQS A;  2GLT A;  3FMR A;  1VF9 A;  4M9S A;  1LE8 A;  4O86 A;  5H6Q A;  4A3I J;  3ORQ A;  1FJG H;  2JWT A;  1IBL H;  5DUI A;  1SFO J;  5FD5 A;  1VBH A;  4ESB A;  1BI2 A;  1KTA A;  4IHW A;  4LFB H;  1IUY A;  3GTM J;  1REP C;  4P9F A;  5KFZ A;  5KFE A;  2D1H A;  2GWR A;  3LST A;  5HV6 A;  3DBL B;  3G4S I;  2MH2 A;  3U0G A;  4ED7 A;  3LSK A;  2F6C A;  3HSE A;  5FB2 A;  2HPM A;  2VKD A;  2KDO A;  2VE9 A;  2FA5 A;  1K4T A;  1Y6I A;  3LMM A;  3FM5 A;  1BW6 A;  5HLG A;  4YR3 A;  3OYD A;  1P6R A;  4PFO A;  1VBG A;  1YI2 I;  3HOZ G;  3FKI G;  2L5Q A;  4GKJ H;  2L7K A;  4FFR A;  3DP7 A;  1SD7 A;  1BI0 A;  3U9S A;  2JEF A;  2X0L A;  3MR3 A;  4YB8 B;  2VKE A;  3DXJ F;  1ZGW A;  3OOP A;  3Q0V A;  4LJZ F;  4EM0 B;  1K78 A;  3RKY A;  5KT6 A;  1VND A;  4XNF A;  2FLL A;  2JA7 J;  4G3I A;  2ZJP F;  3JRI A;  2KP6 A;  1SCU B;  3N97 A;  1FMW A;  2OZU A;  1TNS A;  4Y3O A;  5FLM J;  2VJI A;  3QRF F;  1FBU A;  2XKO A;  1C3O A;  4JV2 A;  1CQI B;  4XMY A;  2VKV A;  4DR4 H;  3LSJ A;  5HNH A;  1HDP A;  1JI8 A;  4PK4 A;  3IG0 A;  3CDH A;  4WX9 A;  3FKI A;  4KDP A;  2NU6 B;  2STT A;  4IIJ F;  2JSP A;  3PW4 A;  1JX4 A;  4Z2Y A;  1I7N A;  1D1A A;  1S97 A;  4DAA A;  3TBI A;  4D7N A;  4GXO A;  1FKA H;  4CCK A;  4MA5 A;  3FBN B;  4PSW A;  1XDS A;  2E1O A;  4CUG A;  3QAH A;  2HOS A;  4O3P A;  4B48 A;  1V4Y A;  2O3F A;  2H8W A;  1VFC A;  1BJA A;  3BAA A;  5I5S A;  5KFD A;  1YTY A;  4DYC A;  5KFN A;  4J9K A;  2JQ7 A;  3KHG A;  3TY8 A;  2CMP A;  2R8G A;  2JVG A;  3NBY B;  5F1J A;  4LG3 A;  4PDB A;  4UV8 A;  4DUY H;  1FP2 A;  1KA8 A;  3OYB A;  1I1L A;  2WAQ E;  1R58 A;  3L4J A;  1G2H A;  3TW6 A;  2FU4 A;  3HGG A;  3LA7 A;  3BOQ A;  1ETV A;  4ZDL A;  5JI6 A;  2KZG A;  4UUV A;  5K5Q A;  3QYB A;  2XRO A;  1QBJ A;  1DGW Y;  3G2B A;  3QYF A;  4A5M A;  3DTF A;  1IV8 A;  4A3G J;  4CZZ A;  3OOU A;  3BG9 A;  3RFC A;  2IMW P;  3X2Q H;  3SJM A;  2OUM A;  3HHH A;  1GV5 A;  3IP4 B;  2ZJQ F;  1NH3 A;  4A3L J;  5KFG A;  5C5J A;  3GEZ A;  5BWR A;  3S1N J;  2EFN A;  3HRS A;  2CUJ A;  2V6E A;  4J01 A;  2YRW A;  4LSX A;  1RC9 A;  4KMF A;  2C22 A;  3I0T A;  3V42 A;  4OIO F;  3D5S C;  3NAU A;  2RAE A;  5F1R A;  3PO3 J;  2XRL A;  1WH2 A;  1KJ9 A;  1XNR H;  1VQ4 I;  1LJ9 A;  3LSM A;  3LUL A;  4MEX F;  2ZNY A;  2KT0 A;  3GTJ A;  1S72 I;  2FK3 A;  5L1J A;  4A2A A;  2LYC A;  3IAS 2;  4D5F A;  5F0H A;  1IUF A;  5J1Y A;  3R23 A;  5F27 A;  3QU3 A;  1MNM C;  2OCE A;  2F4M B;  4M73 A;  5IT9 K;  2D2W A;  3RGX A;  3N42 B;  4O7L A;  4C5C A;  1MDM B;  3E5Q A;  2JA6 J;  3G1O A;  1S0O A;  1FWZ A;  4H4K C;  2NVX J;  3R5H A;  3J80 K;  2NVQ J;  3TQN A;  1T33 A;  2YWV A;  3CLQ A;  4XBF A;  2F5V A;  3F8F A;  3MEX A;  1AWC A;  3SQN A;  5JHF A;  5DM7 F;  1EZ1 A;  3S3N A;  2EQR A;  3JRA A;  4DV0 H;  1MJB A;  3COA C;  1RR8 C;  4OMZ A;  3S2W A;  3OHB A;  1WPK A;  2PX9 A;  1T6S A;  2Z02 A;  2HVQ A;  2CGP A;  4XKC A;  4FGR A;  4A3B J;  2AXL A;  2UXB H;  1FIA A;  3OUU A;  2CFX A;  1IRF A;  4JYK A;  4XSX F;  1SC7 A;  4ZQI A;  1FIP A;  1GGO A;  4O81 A;  3OHA A;  4PSX A;  2P5L C;  4ED8 A;  2EFQ A;  2XDV A;  2TRT A;  3WTV C;  2PN1 A;  2DYR H;  3KIO A;  1HR0 H;  3BTI A;  4M6V A;  4J0M A;  4C5A A;  1O75 A;  2RDJ A;  2VUM A;  3KAK A;  4UB6 C;  3I4M G;  5IT9 Z;  1TWF J;  4L0Z B;  3FZV A;  2VT2 A;  2VJ5 A;  1A5J A;  4MHG A;  1I39 A;  5CM0 A;  3Q8Q B;  3LQR A;  3J80 Z;  2QBY B;  4MV4 A;  3MKY B;  2MC3 A;  3MKZ A;  2EJ3 A;  5KG4 A;  4N4O B;  2HDD A;  5KG6 A;  1GLV A;  2DAA A;  2H8R A;  2DO7 A;  1RKW A;  4HAM A;  5D5U B;  2F5C A;  3E97 A;  5IP9 G;  4KA4 A;  2LC2 A;  5ERI A;  2HQN A;  5LMU H;  5EG0 A;  4ZTF A;  3NRV A;  5HDK A;  1W7P D;  2C28 A;  3MJF A;  2UWM A;  2UXD H;  1X1P A;  1CF7 B;  2ETH A;  1J7K A;  3C3W A;  3CC4 I;  1SD6 A;  4GLX A;  2PI0 A;  1E4G T;  2BVL A;  2QA4 I;  1KGS A;  1DUX C;  3RTR A;  1IDZ A;  2GIV A;  1V54 H;  1I50 A;  3JRD A;  1B72 A;  2RNG A;  4A6D A;  5I5W A;  2CNV A;  1R4N B;  3H20 A;  1PVE A;  2OAZ A;  4HW0 A;  2AGP A;  4O7S A;  2JT1 A;  3OYF A;  4NQW A;  4TV8 F;  4IHX A;  4DL3 A;  2FPG B;  4XRM A;  2DI3 A;  3WTY C;  1G3W A;  3GZN B;  3R60 A;  3GTQ A;  5FFX A;  3RV3 A;  4A93 G;  4ASN A;  1MD0 A;  2KIM A;  5IPA A;  3I55 I;  1Y14 B;  1SVM A;  2IS6 A;  2B9S A;  1T95 A;  1HNW H;  3HJE A;  3QOP A;  3HBL A;  4BBS J;  4EBD A;  4A69 C;  3HKZ N;  5J4Y A;  2XCA A;  3B6A A;  1IAW A;  1DV1 A;  2A6T A;  5KFM A;  4G9Y A;  2P0A A;  2BBY A;  4DR7 H;  3OS1 A;  2QWW A;  3V7C A;  2VOD A;  2LVS A;  1FSE A;  3OIP A;  2L01 A;  3JAM K;  2LF7 A;  3CME I;  4XL9 A;  1BNC A;  2HXO A;  4B3S H;  2DOF A;  1FBQ A;  2DA3 A;  4APM A;  1KT8 A;  2X4H A;  4A3D G;  4G12 A;  4QW9 A;  3BCB A;  1YIT I;  3C2B A;  5BPH A;  4AVZ A;  1XN7 A;  2YS9 A;  2W00 A;  1E3O C;  2Z99 A;  1CGP A;  2VQF H;  5CLS A;  1S10 A;  4OOI A;  2ZNZ A;  4R1H A;  2AO9 A;  1O3T A;  4PJ0 C;  2BXY A;  2DK5 A;  3MAJ A;  2W6Q A;  2R93 G;  2A05 A;  3I4N J;  3HT5 A;  1DPU A;  1V9P A;  1R1U A;  4LSA A;  4UNO A;  2EB7 A;  2CWE A;  2Y69 H;  2PJR B;  3Q2O A;  2ASL A;  2DOA A;  5LRR A;  1FSH A;  3FKJ A;  5HS9 A;  1ZYR F;  4O2B F;  5C8Y F;  2NS8 A;  1FJL A;  2DDA A;  4IRD A;  2P4W A;  2A6H F;  3QPL A;  1KJ8 A;  4HQ6 A;  2LK2 A;  4DQN A;  3BZC A;  3KZZ A;  2XHK A;  5TJJ A;  3E6D A;  4IF4 A;  4DV5 H;  1ONV A;  4JYA H;  1ZLJ A;  2K3F A;  2EJ2 A;  4DR6 H;  1ETK A;  1SFU A;  3PZP A;  3IRR A;  3F6V A;  1PUF A;  3CMM A;  3SYT A;  4YIF A;  2HTJ A;  5EWF A;  3TEK A;  2R93 A;  4OAY A;  1YLF A;  4MA0 A;  2HNH A;  3OL4 A;  1ZG3 A;  2VKH A;  3R6S A;  2Q7D A;  2E34 A;  2A07 F;  4ZHQ F;  4ECR A;  3H3V H;  1X4O A;  3FXK A;  2CRG A;  2E35 A;  5AIP A;  2AGQ A;  1U2W A;  4Y4R A;  3BP8 A;  5ICE A;  4KYW A;  2WTF A;  1W7P B;  1N32 H;  3SZP A;  4XKB A;  1GSO A;  3V8K A;  3OYE A;  5BR8 H;  2V4Q A;  2W9B A;  3VOE A;  2L7F P;  4UUS B;  1ZEL A;  3GFM A;  2COI A;  3BR2 A;  3QZ8 A;  1GUU A;  4A12 A;  4DYQ A;  3HOZ J;  1GSA A;  3G8C A;  3O8H A;  3GFI A;  3FKI J;  4MTE A;  2YRX A;  3LSP A;  4XLF A;  4A5N A;  1ULY A;  5DMX A;  3GIQ A;  2ECC A;  3AYH B;  3BWG A;  5C3E J;  4KIS A;  1TNT A;  3OYK A;  3HSR A;  2EIN H;  2X6O A;  1IRG A;  4BQQ A;  2XAU A;  3HC7 A;  1A0I A;  4W1U A;  1YHQ I;  1X1D A;  3T99 A;  1D0Y A;  4KT6 A;  4IVN A;  1JGG A;  1QGP A;  1XCB A;  4ECY A;  5KG5 A;  5T14 A;  2J5O A;  2ID3 A;  1T8I A;  4HA8 A;  1G59 A;  1HCR A;  4L9T A;  1S0M A;  2ZME A;  3M9A A;  3G6E I;  2OTJ I;  2GM4 A;  4P1W A;  4JI6 H;  2HOA A;  2TCT A;  4LLG F;  5EZG A;  1D3Y A;  3GTP A;  3MD2 A;  3GIL A;  2JRT A;  1ZR4 A;  1WI3 A;  1BM9 A;  2QKM B;  3SEQ A;  3HB9 A;  5JVT A;  3DF8 A;  5L3C A;  4BY1 G;  4YIR X;  2Y0S N;  4XZ3 B;  4M0J A;  5FR9 A;  2E71 A;  4YAJ B;  2XPW A;  3V8J A;  1I3Q A;  2ZB9 A;  2MD5 A;  2WAQ A;  3KXY T;  3OSN A;  2W9C A;  1F43 A;  2GPW A;  1TQM A;  2VXD A;  3LFK A;  2LKX A;  5JH7 F;  1JHH A;  2W84 A;  1WJB A;  3W2V A;  2ECB A;  2ZDQ A;  3DFG A;  4ZH4 F;  3R9R A;  4M3B A;  3B73 A;  1B04 A;  4YFK F;  2Y31 A;  3OWT A;  5BYB A;  2IAI A;  3K0L A;  4AYB E;  2RQP A;  2GLO A;  3NC0 B;  3PFF A;  2E2I J;  3E6M A;  2CG4 A;  3K4J A;  2FKL A;  1EUD B;  5E1Z B;  1FPQ A;  1V55 H;  3FM3 A;  2DA6 A;  3E0J B;  1ETX A;  1UZC A;  3OTO H;  1P4W A;  2JEI A;  1Y0N A;  1UEL B;  1E4F T;  2JA8 G;  2X85 A;  3WG7 H;  3TGN A;  1MH4 A;  1FMV A;  3PL8 A;  4Y17 A;  2JMW A;  2BZT A;  2FBK A;  1E3P A;  2EFW A;  2KQR A;  2FBH A;  4B1R A;  4FU0 A;  2DFE A;  4IR1 A;  5J1U A;  3T5X A;  3L2Q A;  1JKQ C;  1YRN B;  3GXO A;  1E0E A;  4Q4C A;  4CMD A;  1RKT A;  2XCP A;  5HDN A;  1O4X A;  3S15 J;  2YX4 A;  4K6N A;  1I1S A;  3IWZ A;  3Q9S A;  3R0J A;  1IG7 A;  4U7D A;  1UG2 A;  1Z7U A;  4LK0 F;  3BY6 A;  5KFU A;  5KG2 A;  1TLH B;  2BHZ A;  2GA1 A;  2GA2 A;  4J9O A;  4O7Z A;  4ITV A;  3TQ1 A;  1QPI A;  2QLZ A;  5KFV A;  2VLA A;  5CA1 F;  4HN2 A;  1UCR A;  1CKN B;  2DJN A;  3HOW G;  3GWZ A;  5DCM A;  3KHH A;  1N33 H;  2EIJ H;  1QHH D;  3ZQF A;  2CV2 A;  4B4C A;  5LP6 F;  1V5G A;  1YFH A;  1ZHF A;  3K10 A;  3AG1 H;  3PNY A;  4MFE A;  1JT6 A;  1R6R A;  3PSI A;  2P5K A;  4RGX A;  1HNZ H;  2WWY A;  5DQI A;  1P7I A;  2ODT X;  2TDX A;  3RZD J;  1GDT A;  4DBR A;  1CS0 A;  3TL4 X;  2R7U A;  2V6C A;  3W1G A;  2WB1 N;  4QWC A;  4ED3 A;  1RR7 A;  2HXI A;  1R7J A;  1IBM H;  2QK4 A;  5KS8 A;  1OJL A;  4N4N B;  3KP5 A;  3MZY A;  1U8R A;  3I4M J;  1IOV A;  2AQ4 A;  4ZYD A;  3J7Y J;  3ML6 A;  3CLO A;  1XTA A;  4JK1 X;  3ECH A;  2R7D A;  1WFX A;  3SE7 A;  1KEE A;  3HRM A;  4M6Y A;  1ACI A;  2VQD A;  3OSP A;  4J9Q A;  2PMU A;  1R5I D;  4IR9 A;  4LH6 A;  1R1T A;  2X1E A;  2EV0 A;  2YU9 A;  5IP9 J;  3C2H A;  3AL0 B;  1ZR2 A;  3GZ5 A;  2R4G A;  1NK3 P;  2DFH A;  2JSC A;  2L9S A;  3BRO A;  4X6A J;  2DYS H;  3GLX A;  5FPR A;  3RR5 A;  4BAY A;  3E6C C;  4U6P A;  2E2H A;  1XB4 A;  4QLC U;  4GYG A;  5JFR A;  3DBR B;  2PJP A;  1MBE A;  2VUG A;  3H4B A;  2FNA A;  2GQR A;  1ZRC A;  2XF6 A;  2IA0 A;  1HXD A;  2FOW A;  2LH9 A;  3OS0 A;  3K5H A;  4DL4 A;  4QIW N;  3CCS I;  3HZJ A;  1K6O A;  2O0Y A;  3KYC B;  2W1O A;  2XGD A;  5KNL A;  2LR8 A;  3FXO A;  3N6R A;  4PDK A;  3FK6 A;  2XSD C;  4FE7 A;  3I12 A;  3J81 W;  5FD6 A;  2A61 A;  4HF0 A;  4KT5 C;  3RYP A;  3O2P E;  4I2O A;  1OQY A;  4B3R H;  4BDY A;  5EWE A;  1AU7 A;  5LEK A;  1Y1W A;  3CF2 A;  4WCG A;  2HYF A;  3L1P A;  1VQK I;  1RJQ A;  1Q1H A;  1FOX A;  5FKN A;  2O8X A;  1G3S A;  5L1I A;  5ILU A;  1M0W A;  2OF7 A;  3F23 A;  4KIF A;  3VOD A;  1E4E A;  4OX9 H;  4II2 A;  5KCM A;  3HYI A;  1UHM A;  3TED A;  3N4M A;  3ERE D;  2FMY A;  2HQR A;  4TQR A;  5C1P A;  1W5C C;  2M0C A;  2QQA A;  4G6T B;  5E1X A;  1ZRD A;  3RAQ A;  5J40 A;  1X1B A;  4A3D J;  1TWH A;  1TWG J;  3Q3S A;  1VQP I;  4RUC A;  3DLA A;  2XF7 A;  2EZL A;  3DEU A;  4RB1 A;  3H9J A;  3G6Y A;  5FLX K;  3CMA I;  4RB3 C;  2BY0 A;  2XC7 A;  4C3H J;  1AOY A;  2H27 A;  5D1P A;  5KFC A;  2R93 J;  1D8J A;  1VQ8 I;  3P9K A;  1XNQ H;  3T1Y H;  4OIR F;  5M5Y J;  1FVI A;  3W1B A;  1KZH A;  4DV3 H;  2JA5 G;  2BY2 A;  3KEO A;  5E3L A;  2X6X A;  3SZT A;  4ECX A;  4ENK A;  3VSL A;  5K3W A;  2LF8 A;  5BWV A;  1SAU A;  3AG4 H;  3I54 A;  1B6A A;  1HSJ A;  2AQF A;  1HDD C;  1HOM A;  4LH7 A;  5LXT F;  4PZJ A;  1K83 A;  1HST A;  4ENM A;  1SEI A;  2HDW A;  4G6Q A;  5E3O A;  2ELH A;  4UY8 I;  4X64 H;  2WC2 A;  1C0W A;  4ED2 A;  3WO0 A;  2DMT A;  1MKM A;  1XX5 A;  2ZKZ A;  3HRT A;  4ED1 A;  5DDG A;  3F21 A;  2DA5 A;  1AHD P;  4NHJ A;  1JDB B;  1IDY A;  2ESH A;  2Y9Y A;  2I5U A;  2GPS A;  4G94 A;  1GHC A;  4O4H F;  2JA5 A;  5KFP A;  2IA2 A;  4RGR A;  4CHU A;  2LBF A;  3Q1K A;  5BPI A;  3TQT A;  4WBN F;  3OSG A;  1USS A;  2DK8 A;  4RM3 A;  2M8G X;  1ZH5 A;  1EYZ A;  5KT2 A;  4YQW A;  1BL0 A;  3I5U A;  2ICW G;  3IH4 A;  4L9V A;  2AS5 F;  1TT5 B;  3BTL A;  1Z6T A;  2PFB A;  2HTS A;  2VT3 A;  3DU5 A;  4Q43 A;  1IN5 A;  2VPS A;  1Z0X A;  3N43 B;  2R5Y B;  4XKV A;  4LD5 A;  3MMY B;  1A3G A;  2R6F A;  2MLG A;  2QGU A;  2Q2U A;  2VN2 A;  3NWS A;  3HOY G;  2X5R A;  3R61 A;  5FKO A;  3MWD A;  3VSK A;  4R7R A;  2H1L A;  4L5J A;  3HOU G;  4YII A;  3GII A;  4FFM A;  4IWY A;  1QNT A;  3BR5 A;  3PSF A;  1FP1 D;  1X3Z B;  1YX3 A;  2JTV A;  4CH7 A;  3ZQL A;  4IQJ A;  2Y9Z A;  1KQ9 A;  2QF7 A;  1B8I A;  2RN7 A;  3P9I A;  4D9J A;  1J9I A;  4XOP A;  1IN6 A;  1BR1 A;  3RKX A;  2NU9 B;  3C0F B;  2EZK A;  1ON1 A;  2DT5 A;  3GCM A;  2IGN A;  3ONQ A;  2CNQ A;  1LE8 B;  1BJT A;  4I0B A;  3I53 A;  5KFB A;  3CUO A;  1QZY A;  4FTH A;  3PFI A;  4BY1 J;  5D1O A;  1IGN A;  3KZI C;  3TY5 A;  3H4D A;  4L9J A;  1X1A A;  1N34 H;  4AYB A;  5FPO A;  5KKN B;  3LAP A;  1YE9 A;  3EUH C;  4U7B A;  5KFR A;  3JZF A;  4A2B A;  4B3X A;  1KJJ A;  5H2F C;  4ECU A;  5FLV A;  2OCC H;  3JW4 A;  3HKZ E;  3WU0 A;  4EGQ A;  2KIU A;  1JGS A;  5HS8 A;  4XYM B;  1T39 A;  1MMG A;  1CKM A;  2DPJ A;  3GDE A;  3S14 J;  4XLH A;  2V7F A;  1S68 A;  4YP3 A;  4C3I J;  2HU9 A;  4XN0 A;  3VMM A;  4RBO A;  4HV6 A;  5K5R A;  3H35 A;  4YY3 H;  3D5L A;  3L7W A;  2GXA A;  2X1D A;  3M9N B;  5DLF A;  2LY1 A;  5IYC G;  4LF6 H;  4JI8 H;  1FX7 A;  2JA8 J;  2DW4 A;  3FXR A;  2R3S A;  4BQO A;  2COB A;  1K78 B;  1UST A;  2Y0M A;  3WG9 A;  4O7V A;  2XAG A;  4UCT A;  4HYK A;  1G6N A;  4AIK A;  2F5F A;  2J9G A;  2KRC A;  4N9H A;  4NC7 A;  4M3D A;  3ORR A;  4CCJ A;  4L0Y B;  5ED4 A;  1UHW A;  1KC7 A;  2HHH H;  2CU7 A;  3NBZ B;  1F9N A;  2FNP A;  5I47 A;  2M7A A;  4XRS G;  4ANJ A;  4I50 F;  2YCH A;  1TW3 A;  4FET A;  3VOT A;  1NTC A;  2QQ8 A;  3J7Z I;  3H9Q A;  4O6J A;  5C44 J;  1I6U A;  1FLI A;  5B1A H;  2VL8 A;  4L5E A;  3ESW B;  1EKP A;  3MR6 A;  2XUB A;  3EUA A;  4BNC A;  2ZXJ A;  3F8C A;  3TY9 A;  3UQ8 A;  1OBG A;  1RES A;  2VQE H;  4KIB A;  4N0B A;  3BC8 A;  4EYH B;  4QWE A;  4PJJ A;  4EAT A;  5D4R A;  3RUP A;  3HOW J;  1LB2 A;  4P96 A;  3RIZ A;  2OWO A;  1A35 A;  3ABM H;  3U9G A;  4LFA H;  4EMS A;  4J9R A;  4DL5 A;  3JRE A;  3MZ8 A;  4DQ2 A;  2Y4R A;  4RMN A;  1D1C A;  4ZJZ A;  5FKK A;  3BJO A;  3S93 A;  1OYW A;  5KK1 A;  1D0Z A;  4B47 A;  4IHS A;  3E6B A;  4UB8 C;  4C2M J;  4EJO A;  1LUJ B;  2OV7 A;  1VKZ A;  4MNU A;  2FML A;  3L9F A;  5KX5 F;  2ZO4 A;  5F9N A;  5KT4 A;  5IYD G;  1MBH A;  1RUN A;  3LNQ A;  4CCL A;  1P4X A;  2E2H J;  1VQN I;  5CA0 F;  1OCC H;  4NZO A;  1ZHS A;  4BWS C;  1IN8 A;  4LGW A;  4BE2 A;  5KFY A;  2M1B A;  5IT3 A;  4BKX A;  3CQZ A;  1EUC B;  4ECS A;  1X9N A;  1BIA A;  3T54 A;  1POG A;  3TP3 A;  4NZN A;  4G6D A;  1K79 A;  4PGH A;  5IYB G;  4TM5 A;  3IUO A;  1R4M B;  1ETW A;  2QM3 A;  3ECO A;  3TO9 A;  2LMD A;  3AL0 C;  1RK6 A;  3BJY A;  2RQQ A;  2IW5 A;  1Z91 A;  4LIV A;  3DPU A;  1R49 A;  1JT0 A;  3GIK A;  2ZXH A;  3BR6 A;  3MKL A;  5KFO A;  2PQ8 A;  4EGJ A;  4G7H F;  2M4G A;  2R7Q A;  3ZP5 A;  1J5Y A;  5D5V B;  3IH2 A;  2R8K A;  4DNC A;  2BYV E;  2Y0S E;  1Y1W J;  2DPI A;  4FE4 A;  2OD5 A;  3FXU A;  4CCM A;  5EYR A;  5C3E G;  3TP0 A;  2E2J J;  1R5G A;  1FYL A;  5LGT A;  1V3F A;  1PK8 A;  2AU0 A;  1X58 A;  2OQG A;  2EJR A;  4YEL A;  3KYD B;  4MLO A;  3H5N A;  5D5X B;  2YZL A;  4E7S A;  1X1C A;  4A0Y A;  1FZP B;  3OSF A;  3PR4 A;  1W0U A;  2R8I A;  2L7Z A;  2DA7 A;  3T8R A;  4E7I A;  3F6O A;  3VPD A;  1TWH J;  4M71 A;  1MSF C;  4PUS A;  1LFB A;  2WDT A;  1WH5 A;  1O3Q A;  1Z2P X;  2BY1 A;  1WH7 A;  3Q9V A;  5BYA A;  2IP4 A;  4EGY A;  1TWA A;  1MBG A;  1TW2 A;  4L18 B;  4OIP F;  1MMS A;  5KFQ A;  3CCR I;  1TQP A;  5D4S A;  2HFH A;  4GFB A;  4B8X A;  3J7A O;  1OCZ H;  3L2U A;  4JBA A;  3LSR A;  3LSI A;  1I6H J;  5I5T A;  4Q44 A;  5FJ8 G;  1R22 A;  4K2E A;  2HVR A;  5HOD A;  3EPI A;  1T0F A;  2GXB A;  4PFP A;  3M1E A;  1B4A A;  1XDU A;  2NS0 A;  5J6X A;  2NS7 A;  2H6B A;  2DPD A;  5EG0 B;  3SDB A;  2E7X A;  2MG4 A;  1KUT A;  2W6M A;  1VI0 A;  1YIO A;  3K4M A;  4A3F G;  3M8E A;  2Y75 A;  5L3F A;  3JRG A;  2CQQ A;  4HDV A;  1W4M A;  2EK5 A;  3KAJ A;  4XOR A;  2BOL A;  2JRM A;  3KE2 A;  1Y39 A;  5J1R A;  2UUZ A;  3GTG A;  2KRF A;  2Q2E A;  2NNY A;  1EKV A;  1WJF A;  1VS0 A;  3I59 A;  2E5L H;  1BR4 A;  1B72 B;  2DPU A;  4JI7 H;  2IJL A;  2DA4 A;  2XC9 A;  4ZI7 F;  2K9S A;  4EBC A;  2E7W A;  4AUX A;  2JA5 J;  2X6Y A;  3CZ6 A;  3QPS A;  5LGN A;  4E7J A;  1O7L A;  4X1E A;  1RZ4 A;  3CCU I;  3G6V A;  5IP6 A;  2V4R A;  3TKY A;  1J5E H;  1SEU A;  2DOD A;  4UFZ A;  3CCY A;  3IN5 A;  3BR1 A;  2X51 A;  2L4A A;  2BW3 A;  3OY9 A;  2LKS A;  3ABU A;  1WR2 A;  4MV3 A;  2GBY A;  2V9K A;  5J4V A;  1A36 A;  4F91 B;  4GO1 A;  3RV4 A;  3ZOB A;  2NVY J;  5CVV A;  4O5V A;  2WB1 E;  2EV6 A;  2AGO A;  2VUM G;  4QWB A;  2AHQ A;  2K4B A;  3J7A Y;  2WAE A;  3M9O B;  3S16 J;  3ZQG A;  3WU2 C;  4M3F A;  2Y2Z A;  3GVA A;  4YG2 F;  2FQ3 A;  3BLY A;  2PG4 A;  4IZZ A;  4BAC A;  1D5V A;  1RJP A;  2DXI A;  3A0H C;  2ZFU A;  1ZG5 A;  4LLL A;  2R7K A;  1S7E A;  2Z04 A;  1TA8 A;  1WCM A;  1WZ2 A;  1RRJ A;  3CC2 I;  3E5N A;  5A2Q W;  2ISY A;  5F64 A;  4FFN A;  2JUC A;  2XGX A;  4JOM A;  5K5O A;  3TIN A;  4DBQ A;  1XMA A;  5CVI A;  2FBI A;  3IHU A;  3S24 A;  1YQA A;  1KQ8 A;  4A3J G;  2YZN A;  1MMD A;  4IHY A;  2P8T A;  4XQF A;  3K1M A;  3ZQC A;  2E1C A;  1S3J A;  1UMQ A;  2MA3 A;  3A03 A;  3HOY J;  4ME6 A;  2QCO A;  2DT6 A;  3OYI A;  4O7W A;  3HOU J;  1R9T A;  3NWT A;  3K2A A;  2CNU A;  1P92 A;  2EIM H;  4DIQ A;  1GT0 C;  3JZ6 A;  2NNN A;  1XGM A;  4AU7 A;  4LIT A;  1T08 B;  2UXX A;  3Q0U A;  3RDI A;  3ZN1 A;  2YYA A;  5KG7 A;  2UUA H;  1VTN C;  4QIW E;  1HW2 A;  2V1X A;  2NRA C;  3VYT B;  1YW9 A;  3RYR A;  4Y33 A;  4AM3 A;  2M9H A;  2A6E F;  3C2G A;  3HKZ A;  3O6B B;  1PUF B;  5F9L A;  2A68 F;  2KJC A;  3Q8P B;  3Q0W A;  3KP3 A;  4E7K A;  4CGZ A;  3AG3 H;  1BI1 A;  1LDJ A;  4RNN A;  2XGQ A;  3P5J A;  2MD0 A;  4BJT A;  1ZGA A;  1XGN A;  2NOG A;  2IPQ X;  1XK5 A;  3T9B A;  3V7S A;  1WKM A;  2DBB A;  3F0C A;  1A48 A;  4RNM A;  3HTS B;  2FPP B;  4V19 K;  2B63 A;  1OR7 A;  2JEG A;  2OH2 A;  1ET0 A;  3CCJ I;  5B1B H;  5IWA H;  5IOY A;  2H6C A;  2W9B B;  2QUF A;  3QFF A;  4ZYH A;  4MV7 A;  4HLX A;  4O7T A;  2MGQ A;  1SAX A;  1TQI A;  1DGS A;  3H0G A;  1WJC A;  1Z3X A;  4BGD A;  4O7N A;  4L5I A;  2O8K A;  1XSD A;  2IA1 A;  5CE8 A;  3MR5 A;  2C2E A;  1LVK A;  3PQK A;  2R7Z A;  5IYC J;  1EKF A;  5LRS A;  2NU7 B;  3HTU A;  3LWF A;  1U9N A;  3O3K A;  2KFD A;  4CKC A;  2BV6 A;  3VEP A;  2PEX A;  3DKX A;  3RJ0 A;  4M9X A;  1MNE A;  4HST A;  2IGM A;  2DWC A;  3BQ1 A;  2L3D A;  2ZME B;  1GVD A;  2BXZ A;  2PMZ N;  3KCC A;  4KMU X;  4X0G A;  1Y1V A;  5LHI A;  1M7J A;  2NXN B;  2I87 A;  1IOW A;  4FFL A;  4IQ4 A;  2ZM6 H;  3JZI A;  2XGC A;  3OIQ A;  2H94 A;  3TO6 A;  3F72 A;  4PBC A;  4IRK A;  1Q1V A;  2EZI A;  1T98 A;  3HPH A;  5GON F;  2BQR A;  4EYI B;  4RAZ A;  4XM3 A;  1IXC A;  1S9F A;  4IHV A;  3N05 A;  4HRI A;  3HDD A;  3ZQI A;  1AUV A;  2W9C B;  3ZQH A;  1P8L A;  2XB5 A;  2PMH A;  4I0A A;  1HKT A;  2CW8 A;  1WJE A;  2HYJ A;  2R7X A;  3E5U A;  2P5V A;  3A4C A;  3CQZ J;  4MO7 A;  3RIR A;  1TC3 C;  3UFX B;  4I99 C;  3GQC A;  1ZAR A;  3GFL A;  2CV0 A;  3F8N A;  4EBE A;  3BT9 A;  2YUS A;  3A2K A;  2UU9 H;  4MQV A;  4G8X A;  3T9E A;  2MW8 A;  5C4J J;  2MSY A;  2XVC A;  5EJC A;  1ODD A;  3R0A A;  3IKT A;  3CEB A;  2R92 G;  3ZPL A;  2R7S A;  3SI8 A;  3GLK A;  5B66 C;  2W70 A;  2UZK A;  2WY8 Q;  1PJR A;  2STW A;  2EWN A;  4GYI A;  1HNX H;  1MMA A;  2EFP A;  2VC1 A;  2O9L A;  5IYD J;  5H20 A;  4BHB A;  3PW2 A;  3WWH A;  4LF7 H;  5JVL A;  3VPC A;  1DAA A;  4UVB A;  2HZT A;  4YEJ A;  1J59 A;  3NGD A;  1AA7 A;  5C1O A;  2UV1 A;  5BWU A;  3HSF A;  3W6J B;  4CCO A;  1AKH A;  3T8T A;  5IYB J;  3CCV I;  4CYC A;  2PVP A;  2Y0S A;  3KHL A;  3V4S A;  3GIP A;  4HX7 A;  2R92 A;  1UFM A;  3BTC A;  4L1K A;  2IGK A;  2K02 A;  2V5A A;  2K9Q A;  1T94 A;  2OC6 A;  2Z3Y A;  1R1V A;  1K7A A;  4XRF A;  1I2K A;  3L2P A;  2XAH A;  5CB4 F;  1ZRE A;  1OBD A;  5BWX A;  3BG3 A;  1T56 A;  3OYJ A;  3W3C A;  4BJ5 C;  5FKL A;  3K4L A;  4MTD A;  4WHX A;  3RB0 A;  5DCM B;  1S5L C;  3KP7 A;  4EM2 A;  1CQT A;  3GV8 B;  5KG3 A;  1I27 A;  1BN5 A;  2VXZ A;  3VDX A;  3A01 A;  3FXJ A;  1FOW A;  5ILV A;  3W2W A;  1WJD A;  3OL3 A;  1UAA A;  4EFE A;  4Z6Y A;  3KRE A;  4ZDP A;  2AQE A;  1OKR A;  4EM1 A;  3TW7 A;  4XLC A;  4ZTJ A;  2JN6 A;  3JRH A;  3U55 A;  3H1C A;  2IGO A;  1NHA A;  2W48 A;  2ZFW A;  3HOT A;  1B6S A;  1L2Z A;  2WTE A;  1ZG1 A;  4Q48 A;  4TUY F;  1UB9 A;  5ICG A;  1ZRF A;  4XX0 B;  5I5Y A;  3QPT A;  2Z1D A;  2D5V A;  4A3K G;  3CP8 A;  2G9W A;  4J9M A;  4XLP F;  1R71 A;  4Q4D A;  4IPA A;  1SFE A;  4F92 B;  4XN3 A;  4FQG A;  2ZC2 A;  4FM9 A;  5FJ8 J;  1F1Z A;  2E1N A;  3W6K B;  3NUA A;  4E6N A;  4DV6 H;  1FBS A;  3PNV A;  4GC6 A;  4OWR B;  1LQ1 A;  4J9P A;  4LF9 H;  3RBE A;  1XS9 A;  1WRJ A;  2IS4 A;  4NB5 A;  4M74 A;  4IXA A;  5BOX A;  1CKO A;  5BMZ A;  4EJT A;  3JSN A;  4BYY A;  4EFB A;  3E7L A;  2ASD A;  2K5C A;  2FPI B;  3KHR A;  3TOA A;  5K7F A;  1Z21 A;  3PUF A;  2MLK A;  3GW2 A;  3GTJ J;  3GO5 A;  4A3F J;  2M30 A;  3FWE A;  1X2N A;  1E2X A;  4FX4 A;  3HUG B;  2R7L A;  4MFD A;  4ENN A;  1IYD A;  2DCE A;  1W96 A;  2GOM A;  4C5B A;  4XSZ F;  5HS7 A;  3RPU A;  4EJV A;  4NUB A;  3V6J A;  2JJ7 A;  4FHT A;  1QA6 A;  1XC5 A;  3PIP F;  4EGZ A;  4JI2 H;  3F22 A;  3OIO A;  4EJW A;  2CQY A;  1M1E B;  4ECQ A;  4DR5 H;  2OQR A;  4M72 A;  3WE3 A;  4I6Z A;  1I1G A;  1R00 A;  2V1N A;  3MZH A;  3JSL A;  4I55 F;  2WB1 A;  2Z5U A;  4BHP A;  2YZM A;  3FXM A;  1P4A A;  4CMF A;  2PJR A;  2FE3 A;  3BCA A;  4MEY F;  1QU3 A;  5J47 A;  5DG8 A;  3JTH A;  2R8H A;  3GV5 B;  3K4N A;  4P55 A;  5DIS C;  1Y0U A;  1OCO H;  2E36 A;  4ECV A;  3A02 A;  4DUZ H;  4ZYE A;  3PQJ A;  2CH0 A;  1ZLK A;  3CJN A;  3KLN A;  1X2M A;  4UCS A;  1Z6R A;  2CYY A;  5LOV F;  3OYM A;  3BQZ A;  5FO5 A;  3L2R A;  2QSH X;  3VPB A;  4DLK A;  3QWU A;  3H92 A;  2XAQ A;  2OZ6 A;  2DJI A;  2XPU A;  4ZYA A;  4NZM A;  4YAK B;  5C44 G;  2FLN A;  2VUM J;  2M5W A;  1QRY A;  1E4E B;  1G3T A;  1FTZ A;  5KAI C;  2FJZ A;  3PW0 A;  1ZK8 A;  1Y8R B;  2L2O A;  5KFH A;  5FNV F;  3P7N A;  1IW7 F;  3SXY A;  4E7L A;  3JRB A;  5DGA A;  2IBD A;  4I01 A;  3LP8 A;  4U0Y A;  3FBI B;  2L9R A;  4IRH A;  4CKE A;  1ENH A;  2YU3 A;  1Z1D A;  2QQ9 A;  4RUA A;  3P9C A;  4ZDO A;  4YR0 A;  2M4K A;  3S3O A;  3BQ2 A;  3LFU A;  4RAF A;  5CPR B;  5EGO A;  1YJ9 I;  2BGC A;  4LF4 H;  1DU0 A;  5KFJ A;  2HKX A;  2DQL A;  4E7H A;  4QIW A;  4A3J J;  4Q45 A;  3H3U A;  1L3L A;  4C2T A;  3G3Z A;  1B9M A;  3VWB A;  2W82 A;  1DP7 P;  5DLG A;  2J6U A;  4WF2 A;  1U5T A;  1R23 A;  3K7A J;  5GAG J;  3VYR B;  5I60 A;  5K2M A;  1BI3 A;  2W8K A;  2WY7 Q;  2M8E A;  1I50 J;  5KFX A;  2Q0O A;  4E4T A;  2DQR A;  4C9Y A;  3BZ6 A;  3RKW A;  2NUA B;  4LFC H;  4EG0 A;  2UXN A;  3ERM A;  1NG7 A;  1V5E A;  4ED6 A;  5L3B A;  1VQM I;  1ZGJ A;  2V1D A;  3CDI A;  3GTQ J;  4R79 A;  2GQQ A;  3CF5 F;  9ANT A;  3AAF A;  3EYY A;  4FAS D;  1FYK A;  1X19 A;  4ECT A;  4XR6 A;  4CDG A;  4BBR G;  4Q47 A;  5BPD A;  2HYG D;  1Y1W G;  2L54 A;  4KIT B;  4HBL A;  3T9A A;  3KTM A;  2C2R A;  4F50 A;  1IO2 A;  1EV7 A;  2LP0 A;  2LBF B;  4RZR A;  3IV5 A;  2ACJ A;  4LOC A;  3WNZ A;  3D0S A;  4BQN A;  1H8A C;  5E3N A;  4KFC A;  2HIX A;  1ETQ A;  4DV4 H;  3CES A;  3MN2 A;  3HOV J;  4CHI A;  1WGX A;  2JK3 A;  3Q5F A;  3MCZ A;  1QVU A;  2M34 A;  3HG9 A;  3PUB A;  1ZQ3 P;  3ABL H;  1OIS A;  4GC7 A;  2EA4 A;  3R4K A;  4UVC A;  3T9C A;  3WO1 A;  4RU9 A;  2CW7 A;  2RGV A;  2XAJ A;  1IRZ A;  4Y15 A;  2ZME C;  5KFS A;  2VOO A;  1WWX A;  2JUG A;  2CSO A;  2M0M A;  2HG8 A;  3BR0 A;  5BS6 A;  2LSO A;  3QPH A;  1W5T A;  4DV1 H;  1B8I B;  5E20 A;  2QYO A;  5DGB A;  3GTM A;  3GME A;  4O4L F;  1D8K A;  4OU0 A;  1K1S A;  4RGU A;  4JX4 A;  1H9G A;  3BQ0 A;  2X9D A;  2CQK A;  4J9S A;  3IRQ A;  2OPT A;  1BOB A;  1ZAO A;  2R82 A;  2YL2 A;  5D1O B;  2VPQ A;  2DA1 A;  1RYS A;  3GFJ A;  3CUQ A;  4DR3 H;  1KJQ A;  4IJA A;  5EEH A;  3G1M A;  3RGZ A;  5EDN A;  1L0O C;  4A3C J;  1QPM A;  1X3W B;  1V51 A;  3GYH X;  5LL6 b;  2LD5 A;  3TMO A;  5HBR B;  3JAM W;  1GO3 E;  1ERD A;  2LFB A;  3PNT A;  1GLN A;  3WGH A;  4DR1 H;  4BXF A;  2VBX A;  3GTL A;  3IC7 A;  3WU1 B;  2M87 A;  3W6V A;  2UVU A;  1V5F A;  1VQ7 I;  2H1K A;  4YR2 A;  2HGC A;  2HOE A;  4M3G A;  1XSX A;  1VQ9 I;  4U7C A;  2QEN A;  2JA7 A;  3JR9 A;  2A5Y B;  2M7B A;  1HKQ A;  1IRX A;  1OMI A;  4O3Q A;  3T1H H;  5JUM A;  1P9Q C;  2R92 J;  4IRG A;  1FY7 A;  1A6Q A;  3MQ0 A;  5GTI C;  1JUP A;  2HKO A;  2VPL A;  3KET A;  5IP7 G;  3A1Y A;  2BVM A;  4KNY A;  2R7M A;  1A9X A;  2DT7 B;  1YJN I;  3HGY A;  3UNG C;  3M4I A;  5LMN H;  2CUF A;  1XMK A;  5DUK A;  1W36 D;  1BC7 C;  1H0M A;  1OYI A;  2YR2 A;  4O7R A;  2V9W A;  2IBK A;  1PYV A;  2OA4 A;  5HNF A;  3IKV A;  5J2T F;  3OMY A;  4J00 A;  1DIK A;  3KEQ A;  4A3M J;  3AX6 A;  3G8D A;  4BQA A;  2EIL H;  2EIY A;  1YS7 A;  1VZ0 A;  2F5D A;  2DIK A;  3CO7 C;  5EZY F;  1WHU A;  2EBI A;  2X48 A;  5DGI A;  5FRM A;  4KN4 X;  2VE8 A;  3CDL A;  3H40 A;  4ZZD A;  4BDZ A;  3GTP J;  5LEJ A;  3CVZ A;  2NVU B;  3OUZ A;  1IN7 A;  2L7M P;  5IOZ A;  2VA3 A;  4FIS A;  1T38 A;  3FX3 A;  5BWT A;  2W57 A;  3T5K A;  2EV5 A;  2XB0 X;  3DCF A;  4M6X A;  4YJ3 F;  2D1V A;  1I3Q J;  2E60 A;  2FXA A;  3ETH A;  1HW5 A;  1KU2 A;  2DFF A;  3CSW A;  2FUG 2;  5KFT A;  1XD7 A;  1HW1 A;  3ZN0 A;  3RJP A;  4M3E A;  3B02 A;  4V2F A;  3EUK L;  4KHP H;  3E1S A;  2DN0 A;  2HDC A;  2Z2S B;  2XF5 A;  2WYO A;  1JXS A;  4DV7 H;  2KPM A;  4LB6 B;  3T5J A;  2DA2 A;  2RNJ A;  2IS2 A;  3AKZ A;  1K1Q A;  3LOC A;  2COG A;  1S03 G;  2VOB A;  2AXT C;  1B33 N;  2YW2 A;  4A2U A;  2HS5 A;  2ZCW A;  4I09 A;  1EF4 A;  5KFF A;  4XIC A;  1IBK H;  4A3K J;  1DV2 A;  2RKH A;  3RTX A;  4UHT A;  2JA6 A;  2MAB A;  2Q1Z B;  5DYM A;  3VYU B;  1D5Y A;  2Y30 A;  2DFI A;  2PMZ E;  3FMA A;  4JX6 A;  1PUE E;  3F9K A;  4RLF A;  3IL2 A;  3FDY A;  5DEQ A;  2DAO A;  4RB0 A;  4HX8 A;  1QZE A;  3QU6 A;  3ROU A;  3S1Q J;  5BPF A;  1FTT A;  3NAR A;  1B59 A;  5DQG A;  1LPQ A;  1YOV B;  1I1M A;  5KT5 A;  3S2D J;  2FB9 A;  3K9T A;  4JP0 A;  3T0Y A;  3RAX A;  3JRC A;  1BC8 C;  1BBY A;  3S1R J;  2P81 A;  2EJ0 A;  3BQY A;  5EF6 A;  3V8L A;  5GPC A;  4OMY A;  3N6X A;  1KQ0 A;  2F4I A;  5CQE A;  5LBQ A;  2RC4 A;  2CKZ B;  4XID A;  1ZET A;  4BY7 G;  1JE8 A;  4DZJ A;  1TWF A;  2ID6 A;  4X65 H;  4AVP A;  1YO5 C;  4UCO A;  3KP4 A;  2K85 A;  3VA7 A;  1EA3 A;  4HDU A;  1ZN2 A;  3TII A;  3ZGK A;  2R0Q C;  2YZG A;  2A3S A;  3GX4 X;  1APL C;  3HEF A;  4CZC A;  2D45 A;  1UNN C;  1MMN A;  3PM1 A;  3IAM 2;  2QSG X;  4JI5 H;  4DL6 A;  2XKP A;  5E18 F;  3NQO A;  2JZY A;  4LIU A;  4CKB A;  4QWA A;  4TVI A;  2O6G E;  3K2Z A;  3UZB A;  5HOO A;  3GUD A;  4HG2 A;  1XG1 A;  2VI6 A;  1I5Z A;  2IVM A;  3EET A;  4QSH A;  4IO9 F;  1YIJ I;  1N56 A;  2DTZ A;  2IA6 A;  1JJ6 C;  1U6G A;  3RPQ A;  3JRW A;  1AUX A;  2QZ8 A;  2EH3 A;  2OLS A;  4R8U B;  3RB3 A;  3K4B A;  3KP6 A;  2HDK A;  4S05 A;  4LG0 A;  2YU9 J;  3WWJ A;  1I3A A;  3CCM I;  2JPB A;  2ZSI B;  5FRN A;  4CC5 A;  1LNW A;  2VPR A;  2UUB H;  4ENJ A;  3M3Y J;  4O82 A;  5D8D A;  4KJZ A;  3VNN A;  2Q2E B;  3OYL A;  4IL6 C;  3MFK A;  2VJ4 A;  3HOS A;  3I59 B;  5H80 A;  5HLI A;  2I8D A;  2ZJR F;  3GB8 B;  3DWL E;  1HC8 A;  4F4W A;  4HNT A;  2CV1 A;  1IZ1 A;  5EWG A;  3EPG A;  4O83 A;  1IXS B;  1EH6 A;  1P7J A;  2R7O A;  5GAH J;  4DRF A;  4UUT A;  2C6Y A;  2W6N A;  2W6O A;  5DQH A;  4AQY H;  2DOE A;  4NDL A;  3SHF A;  2LLK A;  1O3R A;  4PZ7 A;  5LYJ F;  5KFK A;  2UVV A;  4N9I A;  1V4R A;  3D5R C;  1WJ5 A;  3K70 D;  1LEA A;  2BW3 B;  4CC6 A;  4B3A A;  1O3S A;  2XCL A;  2COJ A;  4LK1 F;  1WRV A;  4I02 A;  5KG1 A;  1OCP A;  5FGM A;  2XV4 S;  4FFP A;  3PO2 G;  1KU3 A;  2R5Z A;  4F7Z A;  1WSU A;  2HEO A;  2QB5 A;  3OYG A;  2V26 A;  2J6T A;  4EVI A;  4BBR J;  3FXQ A;  4WK8 F;  1A6I A;  4JXU A;  3V4Z A;  1OYY A;  4I98 B;  2CUE A;  3EYI A;  4WD3 A;  2W6P A;  3V4G A;  3CCQ I;  1MZB A;  4JV5 H;  4YBZ B;  3FIW A;  5L3G A;  4JI0 H;  2RGR A;  1ULZ A;  2GAU A;  2HOT A;  3A0B C;  2HPI A;  1HA8 A;  1JKJ B;  5LHG A;  5DG7 A;  3HPG A;  2NYX A;  4A3E G;  2HHF A;  1JJ8 C;  4ED0 A;  3BAB A;  4UUG A;  1B9N A;  4BS9 A;  2W4S A;  4DJA A;  5AON A;  2RRE A;  3DTK A;  5DS9 A; 
#chains in the Genus database with same CATH homology
 2VQC A;  1K6Y A;  4IQ4 A;  2ZM6 H;  3S32 A;  3OIQ A;  4XLA A;  1QHG A;  5LFA A;  4ITV A;  3OYN A;  4GLX A;  2E5Z A;  2MFZ A;  2VLA A;  3HPH A;  4II3 A;  1LKX A;  4XM3 A;  4RAZ A;  1CKN B;  3N05 A;  4HRI A;  4EQ5 A;  1P8L A;  1N33 H;  1QHH D;  2CV2 A;  3KEY A;  3ZR8 X;  2CW8 A;  1WJE A;  1Z3Y A;  1V5G A;  2HQA A;  3KYL A;  3S3M A;  3K10 A;  3PNY A;  2R7X A;  3A4C A;  3BA9 A;  1R6R A;  3PSI A;  1DP3 A;  1HNZ H;  3J7A K;  3DPT A;  1TT0 A;  2CV0 A;  3F8N A;  3A2K A;  4DBR A;  4B3T H;  3TL4 X;  2R7U A;  2UU9 H;  3W1G A;  3BG6 A;  1LDK B;  4BEH A;  5HVQ C;  4UCU A;  2IXS A;  4NXN H;  1IBM H;  4N4N B;  4HSR A;  2R7S A;  4BUP A;  3GBG A;  3LSG A;  2WY8 Q;  1PJR A;  3AFH A;  1MMA A;  3CP2 A;  1WFX A;  3RSN A;  3DTE A;  4LF7 H;  3SEZ A;  4NQW B;  2LOO A;  3H5A A;  5FLX W;  3RQ4 A;  4LH6 A;  4YEJ A;  4X66 H;  2VQL A;  1AA7 A;  2X1E A;  3DF7 A;  4GKK H;  4BE1 A;  2UV1 A;  3C2H A;  3AL0 B;  2R4G A;  4U87 A;  4CCO A;  2L9S A;  4ZC3 A;  2Y0S A;  2ZSH B;  3RR5 A;  5FPR A;  4B44 A;  1D0X A;  4CCN A;  3MWM A;  4C2U A;  4RLQ A;  2VUG A;  1MND A;  2IGK A;  1GYF A;  4PJL A;  2OC6 A;  2XF6 A;  3L2P A;  2LH9 A;  3OS0 A;  1XMO H;  3OYJ A;  3OYC A;  3W3C A;  4BJ5 C;  3K4L A;  4MTD A;  4UCV A;  2HZD A;  2W1O A;  4NNJ A;  4Q0Y A;  5KNL A;  3M8J A;  1N75 A;  3DTI A;  2KHM A;  3BG7 A;  3N40 P;  2VXZ A;  3VDX A;  3L4K A;  3H0D A;  5FD6 A;  3J81 W;  4B3R H;  3W2W A;  1WJD A;  3OL3 A;  1UAA A;  4EFE A;  1SYX B;  2WE6 A;  4CSW A;  3OR1 C;  4BDY A;  4QPQ A;  4E7Z A;  3CF2 A;  4ZDP A;  2AQE A;  3EPZ A;  4XLC A;  4ZTJ A;  3OR2 C;  4YRV A;  1M0W A;  2IGO A;  3RPU D;  3OS2 A;  3MKW B;  4BEH B;  4OX9 H;  4II2 A;  3HOT A;  5KCM A;  2R7T A;  3GJX B;  4ETS A;  1L2Z A;  1N78 A;  3HXL A;  3SZG A;  3KX2 A;  2Z1D A;  4PJM A;  3CP8 A;  3QYE A;  4G6T B;  4F92 B;  4XN3 A;  5CKT A;  3VYS B;  4FM9 A;  1X1B A;  1U0J A;  2UXC H;  4DV6 H;  2GOX B;  4E6N A;  3DLA A;  2PMZ A;  2XF7 A;  3PNV A;  4OWR B;  4RB1 A;  3W2A A;  4LF9 H;  3H9J A;  2VB6 A;  4OAZ A;  2IS4 A;  4HEA 2;  2O03 A;  1N77 A;  4RB3 C;  2XC7 A;  1J09 A;  1CKO A;  5D1P A;  4XKW A;  4NXM H;  4LF5 H;  2X6W A;  3JSN A;  4F3Q A;  2CUZ A;  4EFB A;  2CFO A;  4I7H A;  3T1Y H;  2K5C A;  1XNQ H;  3N41 B;  3DU6 A;  1YX5 A;  1Z21 A;  1FVI A;  3KAL A;  4IX7 A;  3W1B A;  4DV3 H;  3HUG B;  1Y56 A;  2DCE A;  2GOM A;  2X6X A;  1IBL H;  3VSL A;  4PZ6 A;  3W5O A;  5HLT A;  1SAU A;  5FD5 A;  1N36 H;  2AQF A;  2E1M B;  4NUB A;  4LH7 A;  4LFB H;  1M0T A;  4JI2 H;  3H5R A;  1SEI A;  4DR5 H;  2HDW A;  2V1N A;  3LSK A;  2F6C A;  3BA8 A;  3JSL A;  4X64 H;  2WB1 A;  2HPM A;  2VKD A;  2PJR A;  2KDO A;  2VAS A;  3BCA A;  1QU3 A;  1Y6I A;  3ZRG A;  2FE3 A;  3LMM A;  1I94 H;  3K4N A;  5DIS C;  1UG0 A;  3OYD A;  4PFO A;  4DUZ H;  2VQG A;  2CH0 A;  4UCS A;  2XSJ C;  3OYM A;  1W36 C;  2L5Q A;  3L2R A;  2L7K A;  4GKJ H;  3QWU A;  2LBF A;  4K0K H;  2DJI A;  4ZYA A;  4B3M H;  4RM3 A;  2UUC H;  3H9G A;  3LML A;  2L2O A;  4DV2 H;  4XNF A;  3OYH A;  3DU5 A;  2MCT A;  3N43 B;  2CFM A;  1T0F C;  4E7L A;  2KP6 A;  2VPS A;  4XKV A;  3MMY B;  1FMW A;  4Y3O A;  2Q2U A;  2VJI A;  3NWS A;  3FBI B;  4R7R A;  4XMY A;  2KRH A;  3VSK A;  4ZDO A;  4D1Q A;  2M4K A;  3I9V 2;  3S3O A;  4DR4 H;  3LFU A;  2L9N A;  5CPR B;  5HNH A;  3PSF A;  1Z2O X;  1YX3 A;  4CH7 A;  1JI8 A;  4PK4 A;  4IQJ A;  3IG0 A;  4LF4 H;  4E7H A;  4D9J A;  2JSP A;  4YHH H;  2W7N A;  4XOP A;  3C0F B;  1BR1 A;  4C2T A;  1D1A A;  3TBI A;  3ONQ A;  2IGN A;  3VWB A;  2HIV A;  2W82 A;  1BJT A;  4CCK A;  1FKA H;  3FBN B;  4PSW A;  4M7E A;  4CUG A;  3VYR B;  4B48 A;  2WY7 Q;  3BAA A;  5D1O A;  3K4K A;  3TY5 A;  3TY8 A;  2CMP A;  1X1A A;  4F52 A;  1N34 H;  4AYB A;  2JVG A;  3NBY B;  5FPO A;  4LG3 A;  4C9Y A;  4PDB A;  4DUY H;  1YE9 A;  4XOT A;  3EUH C;  4DGW B;  4U7B A;  3OYB A;  4A2B A;  4LFC H;  3L4J A;  4B3X A;  1NG7 A;  1V5E A;  5TGT A;  2KSW A;  4ZDL A;  2A5W A;  4R79 A;  3QYB A;  4FAS D;  3EYY A;  1DGW Y;  1X19 A;  3G2B A;  1MMG A;  3QYF A;  4XR6 A;  1CKM A;  3GDE A;  4XLH A;  2V7F A;  4BE0 A;  4BJ6 C;  1S68 A;  4KIT B;  3OOU A;  2HU9 A;  4XN0 A;  1OLT A;  4YY3 H;  3H35 A;  3D5L A;  2OUM A;  4MV9 A;  2LBF B;  3IP4 B;  1G8X A;  1D1B A;  4RM2 A;  2X1D A;  2LY1 A;  4BQN A;  2V6E A;  2CUJ A;  4LF6 H;  4JI8 H;  4J01 A;  2HIX A;  4LSX A;  4BQO A;  2KMU A;  3V42 A;  3D5S C;  4DV4 H;  3CES A;  2MC4 A;  1WH2 A;  1XNR H;  4UCT A;  3HG9 A;  3LSM A;  3PUB A;  2K3P A;  1BGW A;  1SFK A;  4A2A A;  2CW7 A;  2LYC A;  3IAS 2;  3PFY A;  2IS1 A;  2KRC A;  3CJR B;  4NC7 A;  2RGV A;  4CCJ A;  2HHH H;  3RGX A;  2JUG A;  3ZQQ A;  3N42 B;  2M0M A;  1Z2N X;  2JA2 A;  3NBZ B;  4H4K C;  2M7A A;  4ANJ A;  4DV1 H;  2YCH A;  2F5V A;  4FET A;  5JHF A;  1DQU A;  3H9Q A;  3S3N A;  4DV0 H;  1I6U A;  3K4C A;  2VL8 A;  4GRI A;  3EUA A;  1BOB A;  2K9L A;  5D1O B;  2HVQ A;  4XKC A;  2O5R A;  3TY9 A;  3UQ8 A;  2VQE H;  4DR3 H;  3BC8 A;  2UXB H;  3RGZ A;  4PJJ A;  4EAT A;  3RCO A;  4JI1 H;  3RIZ A;  2OWO A;  4PSX A;  3OYA A;  5LL6 b;  2XDV A;  3TMO A;  4LMY A;  4LFA H;  2M3A A;  1HR0 H;  5KHD A;  2X1C A;  4J0M A;  2MYS A;  4RMN A;  1D1C A;  3S8P A;  4ZJZ A;  1ERD A;  1O75 A;  3PNT A;  3KAK A;  3JAM W;  1GLN A;  3S93 A;  4DR1 H;  4RB2 C;  1HNX H;  4BXF A;  1D0Z A;  2ZXI A;  4B47 A;  3LL7 A;  2VJ5 A;  1V5F A;  1OR7 C;  2OV7 A;  2M7B A;  3MKY B;  1IRX A;  3MKZ A;  4CCL A;  1ZHS A;  3T1H H;  4BWS C;  4N4O B;  1P9Q C;  4X62 H;  4LF8 H;  4BE2 A;  2LG4 A;  4P5O A;  2VPL A;  4F93 B;  3RF2 A;  4IAJ A;  2LC2 A;  3ZCO A;  3A1Y A;  2BVM A;  1X9N A;  5LMU H;  4ZTF A;  2DT7 B;  3IUO A;  2K9M A;  3UNG C;  3AL0 C;  3M4I A;  5LMN H;  2UWM A;  1W36 D;  2RQQ A;  2UXD H;  4LIV A;  3DPU A;  2ZXH A;  1PYV A;  5HNF A;  1E4G T;  2BVL A;  3OMY A;  2M4G A;  1FJG H;  4J00 A;  4JQF A;  2R7Q A;  3K70 C;  2LY2 A;  3RTR A;  4NC8 A;  4JI4 H;  1VZ0 A;  2RNG A;  4HPQ A;  3H20 A;  1X4P A;  5FRM A;  4CCM A;  4PZ8 A;  4JI3 H;  4EEQ A;  4QPO A;  4BDZ A;  3OYF A;  3CVZ A;  3KYH C;  3QOD A;  3DQV C;  4YEL A;  2W57 A;  4MLO A;  3H5N A;  2CS3 A;  4E7S A;  1X1C A;  2IS6 A;  2P0W A;  1T95 A;  4CA0 A;  4E7I A;  2E60 A;  1HNW H;  5IT9 W;  2FUG 2;  4BU2 A;  2ELJ A;  4PUS A;  2WDT A;  1Z2P X;  2HVS A;  2A6T A;  3J80 W;  3EUK L;  4KHP H;  3E1S A;  4DR7 H;  3OS1 A;  2Z2S B;  2XF5 A;  2WYO A;  4DV7 H;  2KPM A;  3OIP A;  3L2U A;  4B3S H;  4XL9 A;  3U21 A;  2IS2 A;  3LSI A;  3AKZ A;  4APM A;  2HVR A;  3CJQ B;  4RZQ A;  1S03 G;  2VOB A;  3BCB A;  3PJR A;  4PFP A;  4AVZ A;  2VQH A;  2W00 A;  3DKY A;  3QOE A;  2VQF H;  1IBK H;  4E6K G;  3RTX A;  2F4V H;  2MAB A;  3SDB A;  2Q1Z B;  1V9P A;  3VYU B;  4LSA A;  2WBM A;  2NOJ B;  3K4M A;  2PJR B;  3FMA A;  2R7R A;  2DOA A;  2R7W A;  1P16 A;  3KAJ A;  3M1C A;  3FKJ A;  3F9K A;  4RLF A;  2BOL A;  4XOR A;  3FDY A;  4XLE A;  2UUZ A;  4RB0 A;  1WJF A;  3FHN A;  1VS0 A;  2LRE A;  2E5L H;  1BR4 A;  4JI7 H;  4DV5 H;  4JYA H;  4DR6 H;  2X6Y A;  3CZ6 A;  1NG6 A;  2E1M C;  4E7J A;  3N6X A;  3CMM A;  3SYT A;  2F4I A;  5CQE A;  1J5E H;  2WAF A;  4UFZ A;  3HL2 A;  2X51 A;  4OAY A;  2R7V A;  2HNH A;  2BW3 A;  3OL4 A;  2VKH A;  3OY9 A;  4X65 H;  1Z7L A;  4IKF A;  4UCO A;  1X4O A;  2V9K A;  4F91 B;  1S9H A;  1EA3 A;  4Y4R A;  3ZGK A;  4PJN A;  2KL4 A;  5CQG A;  4DOZ A;  1N32 H;  4XKB A;  3OYE A;  5BR8 H;  4CZC A;  3J7A Y;  2WAE A;  1MMN A;  1DGR M;  1ZEL A;  3IAM 2;  4JI5 H;  3BLY A;  4F55 A;  4IZZ A;  4BAC A;  2DXI A;  4LIU A;  1XDN A;  4MTE A;  2ZFU A;  2VJJ A;  4XLF A;  1WJA A;  4C30 A;  1TAE A;  4KIS A;  3OYK A;  5HOO A;  1TA8 A;  4B43 A;  3K3V A;  4HG2 A;  2XAU A;  3HC7 A;  4BQQ A;  1A0I A;  4RAY A;  1X1D A;  5A2Q W;  2Q2T A;  1D0Y A;  4KT6 A;  3N44 B;  4JOM A;  3LSH A;  4DBQ A;  1G59 A;  3K4B A;  3S24 A;  1MMD A;  5FRO A;  1MW7 A;  4XQF A;  4P1W A;  4JI6 H;  4XON A;  2DT6 A;  2ZSI B;  3OYI A;  5FRN A;  4CC5 A;  3MD2 A;  3NWT A;  4UCR A;  2UUB H;  2QKM B;  3SEQ A;  4DIQ A;  4KJZ A;  3VNN A;  4HNU A;  2Q2E B;  4AU7 A;  4LIT A;  3OYL A;  2VJ4 A;  3HOS A;  3K6G A;  2ZJT A;  2I8D A;  3GB8 B;  3DWL E;  2UUA H;  4HNT A;  2E5N A;  1CKN A;  2CV1 A;  3VYT B;  3KXY T;  2WAQ A;  2R7O A;  1LFP A;  2XIG A;  4E4H A;  4DRF A;  2WA0 A;  4Y33 A;  3C2G A;  3HKZ A;  2VXD A;  4AQY H;  4PZ7 A;  3PN1 A;  3I3L A;  1WJB A;  3W2V A;  3DPL C;  3D5R C;  3K70 D;  1WJ5 A;  1AN7 A;  4E7K A;  3ZXS A;  1B04 A;  1XMQ H;  3OWT A;  2QKL B;  2BW3 B;  4CC6 A;  3L2W A;  3NC0 B;  2MD0 A;  4BJT A;  1XK5 A;  3K4J A;  2VIX A;  2LRD A;  2JVH A;  3E0J B;  1ZHQ A;  5EOY A;  3OYG A;  3OTO H;  2V26 A;  2Z16 A;  2KLO A;  5IWA H;  1UEL B;  1E4F T;  2X85 A;  3UR3 C;  4MV7 A;  1DGS A;  1FMV A;  3PL8 A;  1WJC A;  2V4J C;  2KZV A;  1Z3X A;  4BGD A;  1MZB A;  5LD2 C;  4JV5 H;  2KQR A;  4JI0 H;  2RGR A;  3DEE A;  3L2V A;  1LVK A;  4DR2 H;  2HPI A;  2WAD A;  3L2Q A;  1HA8 A;  1BR2 A;  3HPG A;  4BL0 B;  2HGS A;  1E0E A;  1KON A;  1TZL A;  3BAB A;  3DKX A;  4BS9 A;  2W4S A;  1MNE A;  4HST A;  2IGM A;  4DJA A;  2RRE A;  3RJ0 A;  3DTK A;  4X0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...