2HVSA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 2'-deoxyribonucleotide at the nick
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/dna/rna
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
total genus 91
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvsA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvsA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvsA01
4PZ7A 3JSNA 1CKNA 3KYHC 4PZ8A 4UCSA 3NC0B 4CC5A 3QWUA 4UCVA 3BA9A 5DISC 3JSLA 4UCOA 2Q2TA 4UCRA 2Q2UA 3W5OA 5D1PA 2HVSA 2HIXA 5FPRA 1CKNB 4PZ6A 4CC6A 4DRFA 3L2PA 3GJXB 1A0IA 5FPOA 1V9PA 2OWOA 2HVQA 1TAEA 3TY8A 3GDEA 3RTXA 1VS0A 1XK5A 4LH7A 3GB8B 2VUGA 3TY5A 1B04A 2CFMA 2HIVA 4UCUA 5D1OA 3RR5A 1S68A 3PN1A 3BA8A 4UCTA 3W1BA 3W1GA 4EFBA 3VNNA 4EQ5A 2HVRA 4LH6A 3BAAA 3NBZB 4EEQA 4GLXA 3BABA 4UFZA 1P16A 5D1OB 3S24A 1CKOA 1X9NA 3UQ8A 1TA8A 3TY9A 1P8LA 4EFEA 4E6NA 1DGSA 1FVIA 1XDNA 3NBYB 1CKMA
chains in the Genus database with same CATH superfamily
4KITB 2A07F 3H9GA 1LFPA 3GFIA 2NOJB 3WTXC 2FNAA 5DD4A 2E36A 3T9AA 1IDYA 2AU0A 5KFLA 3A01B 3GTKA 2R7UA 4XQFA 1YHQI 2VXDA 4MA5A 5IYCG 3OHAA 1O57A 1OCRH 3I9V2 3JSOA 4CUGA 4U0YA 1X58A 2IS1A 2HKXA 5CQEA 4XRSG 3BG6A 3W1GA 3M9OB 3G1MA 3T5LA 2QK4A 3BP8A 4MV7A 3BQZA 3GTMJ 4CZZA 3DEWA 1Z2NX 1YX5A 4DIQA 2OV7A 1QO0D 5DDGA 3WHCA 3DBRB 1TL8A 2AS5F 4UB8C 5ED4A 3OS1A 4R79A 1APLC 3GXOA 4NQWB 3KETA 1W7PB 4YR3A 1ETOA 3RGZA 3HL2A 1I3QA 4AYBA 1LB2A 3FXMA 1IXRC 1GLVA 2EIKH 1K1QA 2DT7B 4XKWA 1TBXA 2NVXJ 3KHLA 4H0EA 2P4WA 1NG6A 3OYHA 2IBKA 4A3MG 1J59A 2A5YB 1MBKA 2AXTC 5CR5A 1GUUA 3KFWX 4LFAH 4ETSA 3H35A 2MABA 2RN7A 5D5UB 2COMA 2DLNA 1K4TA 1X9NA 4JYAH 3T1BA 1Y6IA 5AONA 4ED0A 1BM9A 1SVLA 4LFBH 1A0GA 1VQKI 4YAKB 1KGSA 1IF1A 1A9XA 3BPXA 3L7WA 2FPGB 3OYCA 3FXRA 3DKYA 2BE5F 5BQTA 1YIJI 1JXSA 3VMMA 2PQ8A 4BBSG 3HTSB 3PFFA 2Z5UA 2EV6A 5A2QW 5IT3A 5KFCA 2HYFA 5ICGA 2Z04A 1ZARA 2GWRA 1G6NA 3HIFA 4HF0A 5D8KB 1K78B 2VJIA 4QIWA 3BR6A 3F22A 4Y13A 2VOOA 1HSTA 3H0GJ 4TV7A 4HRIA 1WZ2A 3GTKJ 2J9GA 2NVTJ 4ECQA 3HJEA 2Q8KA 4CZCA 3I4NG 4XKCA 1EUDB 2EWNA 1KJIA 2FEZA 2KFDA 3Q5FA 1TWHJ 1WGXA 2FLPA 3ORRA 4ZYDA 2LFBA 4IWYA 5E25A 3KREA 3GX4X 1ZRFA 4M3FA 4PUSA 4U87A 4O7LA 2Z1DA 1D1CA 3LULA 2N8GA 4HQ6A 5J1YA 2P5KA 4KIFA 3OS2A 2UXNA 5LMUH 3IH4A 3BJAA 4FGRA 4DR7H 2W6PA 3RF2A 3VFZA 2DMQA 1ZLJA 3A03A 3QPHA 4BJTA 1W0TA 3G6YA 1RI7A 1A31A 1TWAJ 4BS9A 3PIOF 3OV8A 2VUMJ 2EFPA 2YCHA 4M72A 3GVAA 5I60A 1M7JA 2JPBA 2ME0A 2O3FA 2XC7A 3DV8A 3CC7I 3S24A 3GTJA 4A5NA 2P5VA 4E7HA 3BACA 4J9SA 1A6IA 1TW3A 1WJBA 1WRJA 4RA2A 1KYZA 1FEXA 4BACA 1YFHA 3R60A 2EJ0A 5LOVF 4RUCA 1T39A 2COIA 1UAAA 4O81A 3RGXA 2DJIA 1CE8A 3H4DA 4DV6H 1BJZA 4XM3A 3HO8A 2HDWA 4LIUA 3TOBA 4BAYA 4XICA 3EYIA 1J75A 5DISC 4GFBA 4UUSA 4UV8A 4CCJA 2W6ZA 2BGCA 1I5ZA 2ZSHB 2R7FA 3MKWB 2VBZA 1V55H 1R1VA 4N9HA 5L3BA 4JV1A 3OOUA 3GTGA 4XLPF 2DT5A 1T8IA 3WG7H 2FBKA 5CJ9A 2WWYA 2A6EF 2KMUA 1P4WA 4DV5H 1SAXA 2FLLA 4U88A 2H1KA 3WTZA 5DD8A 1ULZA 3W2AA 4O82A 2F4VH 1N34H 4Q0YA 4EG0A 2K9NA 1SAUA 1I50J 3FXLA 4J9PA 4E70A 1VFCA 2YZNA 2NU9B 4G6DA 4BQQA 3WGGA 3TBIA 2KLOA 4G8XA 3V8JA 2E1CA 2D1VA 4YR2A 1RUNA 1X4PA 4Z2YA 3RIRA 3JZIA 4L5IA 4JV5H 3TOAA 5KFRA 5KG0A 4EGQA 3GJXB 5DLFA 2UXCH 1B9NA 1NG7A 4FTHA 2LY9A 1Z2PX 2R86A 4R8HA 2AO9A 2MBFA 2VQLA 4AQYH 2PJPA 4YJ3F 2LK2A 3HHHA 1TT5B 2LP0A 3F9KA 4HYKA 3LL7A 1K6OA 5C4XG 3WGIA 5L1JA 3KLNA 4EEYA 1X1CA 2LLKA 2JA2A 5KFXA 2O03A 2HR3A 3R5HA 3NWTA 3CCUI 2JA8J 5JVLA 1E2XA 2HGSA 4C2UA 2EV0A 5K2MA 1UFMA 4RM3A 4EFEA 3DP7A 2YUSA 3C3WA 2EZIA 5LRSA 5GTHC 4BH9A 4M9XA 1Z91A 1DGRM 3EPIA 5JHUA 1HNWH 1ZQ3P 3HOUG 1FWZA 1J5YA 2V7FA 2QEXI 1D0YA 3HM5A 1C30A 4DRFA 4ECYA 1XNRH 2ISYA 3PO3J 3DWLE 2QYZA 2GXGA 2HHFB 3KHRA 2HXOA 2PN6A 3CF2A 3JRWA 4QWEA 5J8FA 5KFJA 1WJEA 4M3DA 3LWBA 4O6JA 4MTDA 4A2AA 5KX5F 1K79A 3KYDB 2OCEA 3T5XA 4HSTA 2FSWA 4PJNA 1SD7A 2R5YB 2W9AA 3HYIA 4LLGF 5FRNA 2W9BA 4HX4A 4MFDA 5ILVA 4O2AF 1XGMA 3OWTA 3LP8A 4U7CA 4OIPF 1D3YA 4RB0A 3FMSA 2JRMA 3A02A 1Y0NA 2CUEA 2HQRA 4XLNF 3M3YJ 4FFLA 4O7SA 2BQ3A 4O2BF 1DP7P 3S15J 3Q0WA 1RUOA 4K6NA 1TZLA 4M6YA 1S8NA 5LEKA 1FSHA 3ZRGA 1ZAUA 1G2HA 2JT1A 1VNDA 1EH8A 3JW4A 4ZH4F 2Y30A 3C1DA 1PUFB 1H88C 2H27A 3SFZA 1KJJA 5H80A 4R8UB 2ZFUA 1U8BA 3CDLA 1I2KA 2M9HA 4BEHA 2V4QA 5EZHA 1B72B 1T94A 3BZ6A 3GFLA 3EUKL 2V1DA 4XMYA 4QWAA 3FHNA 4HSRA 3ORQA 4KISA 3GTOJ 4MV6A 3GLLA 3ABLH 4LK0F 3AW8A 2NVYA 2IA2A 2JEJA 2R8KA 3AX6A 4B3TH 1OR7A 1R1UA 2LVSA 1MSFC 4JX6A 1JKOC 1N75A 2YR2A 4QIWN 3TINA 4HX8A 1R5ID 3HOZG 2JUCA 2OTLI 1A5JA 1K4SA 3KE2A 1YS7A 4GC6A 1A3GA 2FRHA 2W8KA 3DKWA 3DTEA 3B6AA 1FMVA 2KDOA 3SEZA 5F1RA 1W7PD 3H9JA 3FZVA 1ZYRF 3QU6A 1TAEA 3LFKA 1U9OA 2GIZA 3G8DA 4ZOLF 3ULQB 2R7ZA 4O4JF 2FU4A 2YZGA 2DIKA 4IZZA 2NVUB 1S0OA 4GKJH 4JI0H 4TV8F 3U21A 2YYAA 5BPFA 1RNLA 1YOVB 1P7JA 5EZGA 2WV1A 4IHYA 2VUMG 1CQJB 5FGMA 4R7RA 2JSPA 1L0OC 3CF5F 1MNDA 2UXBH 1N33H 3K6GA 1SVOA 5TISC 2MA3A 1ERDA 5K5QA 4BE2A 3NEUA 5I47A 2BW3A 2K85A 5HNEA 3LSMA 2ZCWA 1IN4A 2I8CA 1JX4A 2I87A 2FK2A 2DA3A 2WV0A 4E7ZA 2CUZA 4RAZA 4JI6H 5KFSA 2CFMA 5C44G 3FM3A 3P7NA 1DAAA 2I80A 3PVXA 3FX3A 3PNVA 3S3MA 4RGRA 3ZMZA 1HW5A 3LWFA 9ANTA 1XMKA 2BY2A 1P16A 4XZ3B 4FS2A 5E8IA 3C18A 4FT8A 4I0AA 5C1PA 3PZPA 4MV3A 3HSFA 3OYDA 2ID6A 3KZYA 4Y33A 2L7ZA 5K7FA 2EIMH 3SYTA 1X4OA 2AHQA 2GBYA 2M5WA 5KFZA 3HBLA 4RGXA 1H0MA 2LOOA 3SE7A 1WJDA 4ON0A 4PSXA 4G7ZF 4LF6H 3I4MG 4RU9A 2G0EA 1YI2I 4A3KJ 4LOCA 1JDBB 3Q2OA 2D5VA 5KG3A 4I09A 1PJRA 1OJLA 2RAEA 4E4TA 3QYBA 1AOYA 4ESBA 3JAMK 5D1OB 5BWRA 3V6HA 4BUPA 4Y17A 3RAQA 3MJFA 2QA4I 1LDDA 4BJ5C 1USSA 5M3FJ 4WCGA 3JSPA 1QPIA 3I4PA 3QQMA 3CLOA 3H5RA 4XK4A 4Y4RA 1SCUB 5J8CA 2OZUA 3ZQ7A 4P9FA 4XOPA 4DBRA 5JQWA 5AIQA 1A0IA 1SVMA 4DR4H 2VKDA 2ME6A 4LH6A 4B3XA 3N41B 2G9WA 5KFQA 4EYIB 1OISA 3VEPA 5E1WA 2YS6A 3HOYJ 4DV4H 1R9TA 5BPIA 3P5JA 1J2XA 2F48A 3ZXSA 4X6AJ 3GIMA 2E2HA 2HTSA 2ASLA 4IHWA 2ASJA 1JDEA 2B63A 1EA3A 3K2AA 1ZAOA 3AAFA 1YS6A 2EFWA 2IMWP 1WCMG 3MKLA 5FROA 3R5FA 1QU3A 5FPRA 4ED3A 2K7LA 3TP3A 1I6UA 3ETHA 5DGBA 4J9RA 2RGVA 3GQCA 1QQIA 1TWGJ 5IYDG 1DGWY 2JVGA 3N05A 3WGHA 3BR2A 4XBFA 5I5VA 3S17J 2ZXJA 4W1UA 4BBSJ 3FISA 5KK1A 1I2LA 4O4HF 4RB2C 3QWLA 4LG0B 1MDMA 1EKPA 4JI7H 3GEZA 5KT3A 4Y7NJ 3MR5A 2R7MA 1GV5A 3JR9A 3DXJF 3RYRA 1AKHA 1VBHA 4CA0A 3A1YA 4RMNA 3MQ0A 4GYIA 4MEYF 2WTEA 2OD5A 3I4MJ 4EQ5A 3GIKA 2L9NA 4MA0A 3G1LA 1T38A 2AQ4A 5FKMA 4ZYAA 3GTQA 3PSFA 1R71A 3DBHB 3LA7A 1POGA 5F9LA 4TM5A 4IEJA 3WE2A 4M74A 4OIOF 3ZP5A 5EWGA 3DKXA 2M30A 1JT6A 3C0FB 5DG9A 4IRCA 1J9IA 3ML6A 2RKHA 3SFIA 1B9MA 5EF6A 5J4VA 3DLAA 4C2TA 4KYWA 1ZG3A 4O3NA 2UV1A 4A3JG 4ITVA 3TY5A 3HOWG 2GQRA 2ECBA 4YB8B 2W48A 3QZ7A 5B5EC 4F92B 1IXCA 5JH7F 2ECCA 2GOXB 1KZHA 1X1AA 2IA0A 1IDZA 5LHGA 2BZTA 2L7KA 5HBRB 1XTAA 3WNZA 1A36A 2VPRA 4LIVA 1V5EA 2ZJTA 3IWZA 3NUAA 1YLFA 1BW5A 1W5SA 5K5RA 4A6DA 3SDGA 5F1JA 2IP2A 3GTGJ 2V1NA 1XMOH 1U2WA 3S2WA 1FBUA 1P92A 3CCVI 5FLXW 3OSPA 2JA5G 3PM1A 3KX2A 1RETA 5BPDA 2W9CB 2HQNA 3HRMA 4QWQA 4S0HB 4QTRA 4A3DJ 2XSDC 4PSWA 2ZMEB 1FT9A 1W7PA 2BY0A 1G3YA 2LDUA 2QBYA 2OLSA 2JZYA 2JWTA 3PR4A 1S03G 2ADUA 5DCFA 4CO8A 2HPIA 2QKMB 2K9QA 5E3NA 2VQDA 4MO7A 4JOMA 4QPQA 1GHCA 2DBBA 2RC4A 4A3FJ 2FE3A 3GYHX 2E71A 2K02A 3QPSA 4I7HA 2CW8A 3E7LA 4LITA 4OAZA 4EMSA 5LLQA 3IV5A 1F4KA 2VN2A 4UXNA 3CC2I 2EFQA 3TO9A 3GV7B 1QZZA 2DK8A 3G4SI 1HKSA 2PMZE 2DOEA 5KCMA 2VQHA 2CO5A 4ZC3A 2DMPA 3EUHA 2BVMA 4IAJA 2L5QA 3BC8A 1G8XA 4BHPA 3CCMI 5GP9A 2FQ4A 2NRAC 1OYYA 2H09A 4Z6YA 3HOZJ 3W6KB 2GLOA 2DW4A 5H2FC 3ZQQA 2IS6A 3U9TA 1MBGA 3FXKA 3RKWA 1LFBA 3N40P 3WWIA 1G59A 1BIBA 4NZNA 4J9OA 1SD5A 1YQAA 2HOTA 3M4OJ 3K4JA 3BQ2A 2QLZA 2BV6A 4PJ0C 3HOWJ 4HR7A 3EYYA 5FD5A 2GIVA 2W7NA 3AYHB 2E19A 2DOFA 3ABMH 3LSTA 2CV0A 3BR1A 1Z05A 5DGIA 3TY9A 1XCBA 3K7AJ 5BOXA 4A3CG 3E5UA 1U0JA 2J6UA 2R8JA 1W36D 3S32A 3A4CA 1XGNA 4UVBA 3GLXA 1WVRA 2DU9A 1BR4A 3SQNA 3HKZN 2F4OB 1JKRC 1NK2P 3HOUJ 5ICEA 5C4JJ 4IWXA 3SZGA 4F93B 2JA5A 5FFZA 5T14A 2ELJA 5CA1F 2UVVA 2V9KA 2DQLA 1S68A 4CH7A 2WYOA 5C3EG 3B6CA 2VPLA 3F8NA 2CV1A 5J2TF 4Q45A 3CQZJ 4R1HA 3HZJA 2IS2A 2CFXA 3N42B 4ECRA 1WFXA 3V42A 3GV5B 5TJJA 4YEJA 4YR0A 3UNGC 4D5CA 1IG7A 2KZGA 3DBLB 2PFBA 1O3SA 1QHHD 4A5MA 4MV4A 1BR1A 1BBYA 4X64H 1U5TB 4M3BA 4UVAA 3JRAA 1ZTRA 5H6RA 5KG5A 3CZ6A 3HUGA 4PK4A 3HG9A 5FKOA 3SEQA 1N56A 4HW0A 3JAMZ 4NZMA 2O5RA 1IBLH 3BY6A 1X1BA 3CCRI 3SXYA 2HPMA 1BXRA 1N48A 2I5UA 5E3OA 4L0YB 3TDUC 1BR2A 1V9PA 3RV4A 3E97A 2BHYA 1BC7C 1WJ5A 4LH7A 5K3WA 3QOEA 2O9LA 3KP2A 3J81W 2L02A 4G6QA 1IBKH 5E3LA 4L9NA 1IC8A 2MYSA 3GZ6A 1IYEA 4XX0B 3S14J 2VT2A 4QWDA 4EJWA 4AVPA 3HOVG 3GZNB 2XGEA 1HSJA 1EKFA 5D6EA 1Z21A 2CU7A 2GQQA 3WE3A 2FA5A 2QYOA 4Q43A 2IRFG 3N6XA 4A3BJ 1MJBA 3BT9A 1G3TA 3KZZA 5F27A 1OLTA 2XAUA 2L01A 3V6KA 4LFCH 3OL3A 4N4NB 2R7VA 3M9NB 3SHFA 4HQEA 2ZC2A 3RB3A 5F64A 4EATA 3FK7A 2CQKA 1QBJA 1R58A 3MR6A 4UB6C 2VQCA 3IUOA 2VKVA 5F0FA 1FBSA 5DYMA 4DL2A 1Y1WA 1VI0A 2F6CA 2F5FA 2SCUB 2XVCA 1UC9A 3QZ8A 2BXYA 4IPAA 3EPGA 1W93A 1JTXA 2X0LA 4XKVA 3AL0C 3BG3A 2JPCA 4MQVA 3KP4A 1Z0XA 2MLKA 4C3JJ 2VA2A 1WCMJ 2BVLA 3F21A 1Y8RB 5LRRA 5KT7A 3GTPA 4KA4A 2X1EA 1PUEE 2XGPA 4EYHB 2PJRA 3PW0A 1B1BA 5DCMA 2M05A 2ATLA 2CQQA 3TO7A 4HDUA 3BG5A 3M1EA 1S3JA 2LG4A 4MQ9F 1Z2OX 4YAJB 3DTKA 2W7PA 3A01A 1XMAA 2A1HA 4WD3A 4CHIA 3OL4A 1L2ZA 1YRNB 3ZQFA 3J80K 2WAFA 1HDPA 2YSRA 3G1OA 4D7MA 2DFIA 3L2UA 1S29A 3AFHA 4L9VA 4IKFA 4O3RA 3PNYA 2QQBA 1H9TA 3MVPA 2R7RA 5IYBG 2LKSA 3HKZE 4PGGA 2R5YA 3W3CA 4A3FG 3PUFA 2W9BB 1IRGA 2DPIA 3OYGA 2C2EA 2E34A 2LF8A 3H3UA 4XRSA 5J3LA 2WAQN 4E4HA 3U1KA 1XDUA 4I98B 4UUTA 4P9UA 3OYAA 3JREA 3F23A 2VE9A 5C5JA 1LNWA 5K7HA 1QZEA 2OAZA 5M5WJ 4BL0B 1H89C 1LE8B 1E4EA 2DA7A 2FUG2 2HJWA 5DAAA 3G2BA 5I5SA 3D5SC 3LA2A 2AGQA 3HB9A 4AU7A 1RK6A 2AQEA 2EFNA 2KPMA 1IJWC 1S7OA 1PUFA 2A69F 1N36H 5KFWA 4LLNA 2KIQA 2VKEA 2P6TA 3GTPJ 3CJTB 5FLMJ 3F6VA 1I1GA 1Y1VG 2JMWA 1DIKA 1T08B 4ZHQF 1RRJA 5CKTA 2O8KA 4JUZA 3T5JA 4JV2A 3P9KA 1P6RA 2Y0SA 2E2IJ 2CWEA 1KUTA 3Q8SB 3Q9VA 4IZOA 2XC9A 5E79C 3GTLJ 1KBLA 1SFOA 4XLCA 1X2MA 1XB4A 2FD5A 4DQ2A 3QWUA 2MFZA 5EZYF 5BR8H 5KFEA 3DPLC 4CC6A 5KFGA 1H9GA 1OR7C 3HRSA 2AQFA 1WSCA 4YQWA 3FMAA 2UWMA 2BQUA 2LMDA 3FK6A 1K83J 2ZB9A 3G3ZA 3RCOA 5E18F 2ESNA 1ETWA 1MBFA 4RAYA 4GDFA 3J7AO 4FISA 2QQ9A 4G94A 1BL0A 1VQ8I 3K3PA 3K1MA 4W97A 3HRUA 1GT0C 3HOXG 2R7ZG 3WG9A 3OS0A 1UB9A 3GFMA 5K7ZA 4PZ8A 2E7XA 2CSOA 5HVQC 5JVDF 3E6MA 1UHSA 1JE8A 3AG2H 2UUCH 2W24A 1MNEA 3FXUA 1FYMA 4ZTJA 4X65H 5FPOA 3U54A 4M73A 5LHIA 3S16J 4NC6A 4YHHH 5IPAA 1LDKB 4P5OA 4BXXJ 4YP3A 4Q8EA 2IBDA 3IRQA 3PL8A 2ICWG 3D5RC 1JGGA 1IRFA 2MGQA 2W57A 4II2A 4IO9F 3RR5A 3P9IA 3H3VK 1UG0A 3GWZA 2KL4A 5JUMA 5EGOB 4D5FA 1VQOI 3K0LA 1B33N 3MZHA 4AYBE 1F36A 2EB7A 3CJQB 2QB5A 4E6NA 2V9VA 5DS9A 4MFEA 2HHHH 1V4RA 5KG1A 3VDXA 3ECOA 3F8FA 4ASNA 3RBEA 1E4FT 1S7EA 2BY3A 2M7AA 2EA2A 2W1OA 3LSGA 2DABA 1WH2A 3CO6C 4DUYH 4FBTA 3T5KA 4O86A 1RESA 1WSUA 1JKQC 2HDCA 4M0JA 2FOWA 4RB1A 4F4YA 5FNVF 3TY8A 2C2RA 1IRZA 2JA7J 4A3EJ 1MKMA 5CVUA 2XCAA 3RQ4A 3H9QA 4Y15A 3ASOH 1O7FA 1IOWA 5C3EJ 3AG3H 1QGPA 2DMNA 3UQ8A 4CYCA 5BWWA 3I3LA 2P5LC 4IJAA 4Q48A 3L2RA 1HBXG 5I5YA 1BI3A 4AD9A 2TRTA 1I3QJ 3OY9A 1ZETA 2P6SA 3KP6A 5FLXZ 2FB9A 2OQRA 2GLTA 2FK3A 4AM3A 3BA9A 1HQCA 2YU3A 2NS0A 3LQQA 3GUDA 1Y1WJ 1D0XA 2WBMA 2GPSA 3KALA 3GFJA 1HXDA 1U6GA 1IN5A 1W5TA 4RGSA 3QYEA 1WR2A 2XGCA 4DV2H 1VS0A 1LEBA 3TGNA 2DI3A 1ZKGA 5E17F 3V8LA 4I4TF 3NWSA 4O7WA 1VZ0A 3C2GA 4BXXG 1N32H 5FD6A 1JKJB 4BXUA 4CMFA 4BY7J 3ZMSA 5F08A 1HKQA 1QVUA 3BTJA 2HGWA 2Q2EA 5IP7J 5LGNA 2HZDA 1G4DA 2XPUA 2V1UA 1M0TA 4O83A 3T7AA 2KHMA 2VJ5A 2FPIB 1XGOA 3UZBA 2BQRA 3TO6A 5JI6A 3MKYB 3OYJA 3BJYA 2JVHA 3I0TA 2DTZA 1EJ9A 5B66C 3L4KA 3IKTA 3L4JA 2UVWA 2FBIA 2UUBH 2HVSA 2HIXA 3H40A 4G7OF 4MIMA 2HFHA 3PR5B 1E0EA 4BKXA 3IWFA 3JTHA 3LFUA 1O3QA 5HLTA 4KMFA 1T36A 4XOTA 1E4GT 2EZHA 4NUBA 3I5UA 1OCTC 2R87A 2C22A 1X1PA 3E6BA 5L1IA 4JI3H 1X19A 2E60A 4HPQA 3OOPA 4EFBA 2UUZA 4IX7A 5HNHA 2NNYA 3KYCB 2CQXA 5EG0B 3ROUA 3VYRB 4EBEA 2ID3A 1D5YA 4IQJA 1HF0A 2RGRA 5K1YA 3J7YJ 2H8WA 2FK1A 2FMAA 3BCAA 1IUYA 1RJRA 5KNLA 1YJNI 2ZGIA 3ASNH 4O3MA 2OBPA 4ED8A 2R93G 1UHMA 3GO5A 3KXYT 4NQWA 4E7KA 3I54A 5IY5H 1FJGH 2DPDA 1YW8A 2VUMA 3DU6A 1U9NA 3WU1B 1Y1WG 5FLVA 1SEUA 4ZYGA 1ULYA 1LDJA 2DPUA 2XAFA 2COBA 4N0BA 4ZYHA 4RS8A 2R5ZA 2YX4A 1WJAA 2FP4B 3FKIA 4TQRA 2FBHA 1MMAA 4OIRF 5BNGA 4UY8I 1I1LA 3HSEA 2Z16A 1RJPA 2HGXA 4UFZA 4AIHA 2V9PA 5DG7A 4EGZA 1QRYA 1B72A 4BU2A 2ZDGA 4HDVA 2Z99A 5FR9A 2NVXA 4HF2A 1CF7B 2DWCA 4HG2A 2HTJA 4A2UA 2IT0A 3RB4A 5JQGF 2CRGA 5FLXK 2CJJA 2UZKA 3COAC 1JJ6C 3TKYA 2XPWA 4KDPA 1T33A 1MBJA 1HW1A 6PAXA 5BWTA 5D8DA 4BY1G 1HNZH 2RNJA 2DA1A 4JX5A 2BR0A 5KFFA 5ERIA 3W6JB 3WTWC 3BQ1A 3CUQC 1I39A 2H6BA 1J5EH 2OCCH 4L9TA 3SZTA 1K78A 1REPC 2JSCA 4D1QA 5GPAA 1J7KA 1TWGA 3KTMA 3QQAA 3PIPF 5F0CA 2I10A 3KYLA 2QSGX 5KG6A 2UU9H 1V51A 1RYRA 3NGDA 3NRVA 2O7OA 5E3MA 1AUVA 2M87A 1GGOA 3RFCA 2RDJA 5I5WA 4X66H 5LYJF 1JUMA 2D1HA 1O7LA 4XR6A 4LF5H 4B43A 1FP1D 3RYPA 2ZJPF 3QP6A 5L3FA 2PBZA 4KHPH 5DEQA 3VPRA 5IOZA 1XK5A 3I53A 2DLLA 3WHBA 2R7WA 1BJAA 4I02A 2R93A 3BTLA 4CCMA 2KIUA 4IOCF 2Y0MA 4XLAA 5IOYA 1OYIA 1AA7A 2IVMA 1LVAA 1C3OA 4DL5A 1UMQA 1U8RA 5KFOA 1XG1A 2OUMA 4JX4A 4BE0A 2C2DA 2L3DA 2MG4A 1EKVA 4ECXA 3G71I 1P9QC 3H92A 4J9MA 2K4BA 2WA0A 1I1SA 4LF4H 2PBIA 2X85A 2ABJA 3MN2A 4QIWE 1KQ9A 5BWVA 3MFKA 1Z6TA 4JI1H 2AXLA 2M1BA 4PDBA 3IH3A 4IRKA 1A04A 1Y1VA 1PYVA 2R7TA 2QGUA 4NNJA 4NB5A 4RAFA 2R7XA 2X1CA 4RUAA 1ZK8A 1JLLB 2DQRA 4IVNA 4P96A 4ZJZA 3IG0A 3WODF 1G3SA 4CCNA 3JZFA 4YRVA 1Q1VA 1JUPA 4JI2H 3BABA 3BJ6A 3KHHA 5DMXA 2LY2A 1KU3A 4WXHA 4CHUA 3V7CA 1KEEA 4O7TA 2DA6A 4DV0H 2HGCA 4GGGA 2HU9A 3U9GA 3LQRA 4RLQA 1D1AA 3GTQJ 1FMWA 2DJNA 3V4ZA 5IYBJ 4E7LA 2W25A 2TDXA 1BI0A 1ETYA 1I27A 3S1NJ 1LEAA 2GQSA 3QRFF 2E5ZA 1O75A 3JTGA 2KJCA 2W8LA 3E5NA 3SI8A 1S9HA 2R0QC 3WU0A 3CCSI 4BE1A 2X6WA 2WC2A 5LP6F 3E1SA 4ED2A 4ME6A 3TW7A 3J80W 2L0KA 4MTEA 3NBZB 3LAJA 4ENMA 1GVDA 4MV1A 2ZM6H 4EBDA 1FYLA 4PZJA 2VR1A 2CH0A 1FVIA 4Q47A 2F2EA 4IXAA 4M9SA 4P1WA 4CYDA 2XKPA 4LLLA 1IOVA 2ZXHA 2HDDA 2QQAA 1LKXA 4HOBA 3RV3A 3PW5A 2V4JC 2O0YA 1TNTA 2IXSA 3P9CA 3X2QH 2DFHA 1XX5A 4WHXA 1I7LA 4LF9H 4XRFA 4D9JA 2P8TA 1ZQ7A 4YFXF 3M8EA 5J1RA 3LOCA 2X48A 3PUBA 4IR1A 2KZVA 2HHFA 4U0WA 2Z33A 2CMPA 2YX7A 2UUAH 2CS3A 2Q0OA 1UCRA 5D4RA 3ABKH 3CMMA 3JRCA 2ACJA 4BGDA 5JLWA 1AKHB 1B6SA 4O7NA 1TWFA 4IRDA 2LREA 1GSOA 3IRRA 4ABZA 4C5AA 4MHGA 4LSAA 2IP4A 5A2QZ 2R8HA 1P8LA 4ED1A 2ZJQF 4BY7G 3VNNA 4XL9A 1K6YA 1PDNC 1PX2A 2VPQA 1I7NA 4B3MH 1E17A 1RIOH 2ZNYA 1D5VA 4EGYA 2OC6A 2R3SA 1ZH5A 4QWCA 2VIXA 2V79A 4ED7A 3ABTA 5DCMB 4EEFG 1UNNC 2KSWA 1IZ1A 2NOGA 1IV8A 2EIJH 3M4IA 5KG2A 3GB8B 1ENHA 1A48A 1I3AA 1J0RA 4IHVA 4BY1J 5KFIA 2KIMA 2RREA 4DR3H 4FX0A 2VBYA 4O5VA 3OYIA 3BAAA 1XCVA 2FMYA 4BEHB 4F50A 4GCVA 3GIJA 3CP8A 3L9FA 3K70D 1VQMI 4NXNH 2VT3A 1B6AA 4D7NA 2R7OA 1NTCA 1EZ1A 3TL4X 4PDKA 2MC4A 1AN7A 5KVRA 4DL3A 3FBNB 3ESWB 4CKBA 5C1OA 1GV2A 3RJPA 5GPCA 2CV2A 4ENJA 3I12A 1EH7A 4XRMA 3GW2A 1ZN2A 4HNVA 3WO1A 2J6TA 2FXAA 1UZCA 2ZDHA 4A3LJ 3ZOBA 2A5WA 2DA2A 2R93J 3G73A 4LB6B 4OMYA 3HOYG 4FE2A 5LL6b 2PMZN 4J9QA 2IPQX 2MH9A 3V8KA 1F1ZA 4MV9A 4A3EG 3K4BA 4RZQA 4ZZDA 1MW7A 2DTRA 5KFPA 5DGHA 3KP3A 2JA7A 2K4JA 3HGGA 2Y0SN 4GXOA 5CVVA 5L3CA 5IT9W 2HQAA 3O8GA 4FASD 5E20A 4B44A 1HCRA 3S93A 3NC0B 2CNUA 4HBLA 4ESJA 1N78A 1M1EB 2YL2A 3E3VA 5D8LB 3LSKA 2Z9OA 2Y0SE 4DYRA 1XMQH 5AIPA 2EH3A 4ENKA 2DFFA 3N43B 4O7YA 2FJZA 4RZRA 2KRHA 2DAOA 4U6PA 2K27A 1SD6A 4APMA 5IP9G 5DLGA 2G7HA 3J7AY 1XSVA 4HA8A 1Z3YA 4IF4A 5CLSA 1KTAA 3ZQLA 5ICFA 2Y48A 1XSDA 3NBYB 3BDDA 1YE9A 2IS4A 4DL7A 3DQVC 3W2VA 4EJVA 3JRGA 1BW6A 3R61A 3TW6A 1ETVA 4CICA 1ETXA 1I1KA 2VI6A 1T95A 1Z7UA 3F8MA 2JA8G 2BY1A 3M7GA 5C8YF 3CCJI 3CUQB 2F5DA 3IAS2 1YIOA 4IOAF 1KONA 2XF7A 4RCNA 3Q8RB 4J01A 3MFHA 2WE6A 2EZLA 1FOWA 1QNTA 1LPQA 2Y75A 2H6CA 4C3IJ 1SD4A 1T56A 5LMNH 5BWUA 2DAAA 3BQ0A 4HNTA 3BCBA 1P7IA 5GONF 4JQFA 2XD4A 3V4SA 1BOAA 1B8IB 1IN7A 5GAHJ 4LK1F 5EWEA 1N77A 1X1DA 1TTYA 1MGTA 3JRIA 3MKZA 2R84A 4PZ7A 4AIJA 1JXLA 3MR3A 3LSJA 3PO3G 3BR3A 3ISPA 1U78A 4KUMA 4O4IF 2ASDA 1FNNA 2VQGA 4PGHA 4GLWA 1RK5A 5HOOA 4AC0A 4DUZH 2J5OA 2JA6A 1BIAA 2E1NA 2KKOA 1ZGJA 4NZOA 4RM2A 4HLXA 3U0GA 1S0MA 4PJLA 3V7RA 4F4ZA 4C2MA 2HS5A 2PMZA 4ECVA 4LFUA 3WTSC 1C0WA 4F52A 5JHFA 4B1RA 3M9AA 4MGRA 5HLHA 5JVGF 4PJJA 5IP9J 4UUSB 3K1NA 1ETQA 3T9FA 2W7OA 1MMDA 3RSNA 5KFNA 4BDYA 2EILH 2YS9A 2B7EA 2MW8A 4ECUA 3WO0A 4G9YA 4PZ6A 1UHWA 3RB6A 2K86A 1DP3A 2E5LH 3ZMVA 2KIFA 3LSRA 2HVQA 3FXQA 2K40A 1VKZA 4NLGA 1ZGAA 3M07A 2QCOA 3R0AA 1S5LC 4J00A 5KHDA 5JFRA 5LEJA 1DPUA 4M9ZA 3RB0A 1TLHB 1MMSA 5BWXA 4XSZF 3H20A 2YU9A 1K7AA 2YRWA 2ZDQA 1KJQA 5BYBA 3GTOA 4FFRA 1WRVA 3KIOA 4J9NA 5EEAA 4YJ2F 2GXBA 1IYDA 3B73A 2Q2EB 4MLOA 4UCSA 1XDSA 1YW9A 3LQSA 2M0MA 4UCRA 5EYRA 1S72I 4DL6A 2EIYA 1IW7F 5DGAA 2MH2A 4M71A 3FXOA 3CCEI 5CAEB 2R85A 2NXNB 1WJFA 2OQGA 1P4AA 2VXZA 2NUAB 1FY7A 3SJMA 2V26A 3A0BC 1FIAA 3MD2A 1UC8A 3NARA 1ZG1A 3PW2A 3CP2A 4A3MJ 3J7AK 3VPDA 2FF4A 3DPUA 3OIQA 4ZYEA 3ERED 3QAHA 5IYDJ 4FBUA 2CQNA 3D1NI 3RKXA 2W6OA 3OIPA 1V3FA 5E1ZB 2HG8A 4RDUA 3I59A 3GTLA 1B4AA 2X1DA 4HX7A 2E2JJ 2FKLA 4I99C 5KFKA 4RBOA 3BQYA 3RKQA 4CKCA 4JK1X 5ILSA 1SYXB 5KFYA 5KT5A 1FZPB 3H0DA 4F4XA 2JUGA 5C44J 2E2IA 4S04A 4DIMA 1TT0A 1DV2A 2DODA 2XB5A 4IL6C 1LE8A 3S3NA 3BJOA 2ZMEA 2HIVA 2VC1A 2E7WA 1W4MA 2HI3A 3BA8A 2C35B 4H4KC 2COJA 4E6KG 4DR2H 2VBXA 5HLIA 2CG4A 4DV3H 3LA3A 3ZMTA 3CMYA 5KS8A 1V5FA 1Q1HA 4KN7X 2V4RA 2QSHX 3O6BB 3S2HJ 1OWTA 2YWVA 2PMHA 2RQPA 1YJWI 4MV8A 4A3KG 1ZRDA 1O3TA 4R8UA 4I50F 1RKTA 2DYRH 3RDIA 5B3SH 4DYCA 3N6RA 1CS0A 3DTGA 1SC7A 2Z02A 3TQNA 3CQZA 1JTYA 4DGWB 3H3VH 1NHAA 2A05A 1UG2A 4KT5C 4RNNA 3PN1A 1B59A 4Q4ZF 1MZBA 2NNNA 5KT6A 2LNBA 3TEDA 4A0YA 3OTOH 3RAXA 2ZO4A 3MFIA 4I0BA 5KFDA 1CQIB 3S3OA 4DYQA 2GXAA 2JA5J 3L2QA 4CSWA 3ECHA 1GXQA 1MH3A 3EUHC 4F7ZA 4MAMA 3LMMA 2W70A 4M7EA 4EM1A 2Y9YA 3CSWA 1OCZH 3VB2A 2A61A 3FHZA 3HRTA 1Y39A 1MMGA 3QFFA 5F9NA 5KG7A 3K1PA 5D1PA 2MCTA 3GILA 2XGDA 1EV7A 4BBRJ 4BJ6C 1XN7A 5M3MJ 2LYCA 3RPUD 5DUKA 5KFVA 4X62H 2LY1A 3HC7A 4LGWA 1ODDA 5L3EA 5HLGA 3EPZA 4ZDLA 2Y4RA 5E8GA 5FKNA 4UCUA 4XSXF 3GLKA 1M6VA 3OYNA 4EEQA 2R7LA 4EM0B 2W82A 2PX9A 3JRBA 5CQGA 3GTJJ 1BI1A 4OOIA 2M0CA 5CVRA 2PLYA 3UYYA 1K1SA 2W4SA 5L1KA 2W6NA 3I4NJ 1I94H 3PFIA 1GSHA 3T9CA 2LBFB 2BW3B 4CGZA 2Z2SB 3DEUA 2L7MP 5FKLA 2QQ8A 3VWBA 4KFCA 2XAJA 3F6OA 4A0ZA 4IHTA 1KA8A 3PQKA 4XN0A 1U3EM 4O3PA 3HUGB 4MNUA 4YBZB 2L9SA 3GCMA 4O7RA 1U5TC 2C6YA 1ETKA 4M3EA 3ZR8X 2A3SA 4BQNA 5LA6F 5IYCJ 1EKEA 1AUXA 1HOMA 1E3PA 1S7AA 3S1RJ 5I5UA 1W1WE 1TC3C 1WH5A 3EQLF 2OZ6A 4A3CJ 3KZIC 4K0KH 3FM5A 4M6VA 1X2NA 3OR1C 4V2FA 4L9JA 4RAGA 1ZRCA 2H94A 1F9NA 4XYMB 4B3RH 2XF6A 1WCMA 4JI4H 4J19A 2ZKZA 3K5IA 2E35A 4CYCB 1CKNA 4HNUA 5J6XA 2QVOA 2B63G 2WADA 3IL2A 4Y3OA 1X3WB 3L2WA 3Q9SA 3G6EI 4A3GG 2VB6A 1YO5C 4C5CA 5J1UA 1R5HA 2M4KA 5I5XA 1JIHA 1R49A 2H8RA 4FQGA 2LD5A 4UNOA 4A2BA 2LKXA 1QHGA 4XKBA 2HXIA 3CMAI 3LSHA 1IV6A 2EZKA 4DQNA 5HNFA 2R7ZJ 3KLOA 4ZQIA 5JR3A 3FF5A 3FMRA 2E1OA 5IYZF 3GF2A 4ZI7F 3I71A 1UJ8A 2DK5A 1VF9A 2WY8Q 2YW2A 2MD0A 3IH2A 4CC5A 2WAQA 3N97A 4V19K 2HOSA 3R23A 2F4IA 4I6ZA 4OIQF 3TP0A 5KT4A 4LD5A 4C30A 5TRDA 3AG4H 3CTAA 4I01A 1WI3A 3ZGKA 4NXMH 1MJAA 3VYSB 2XKOA 4RB3C 2PI0A 3V7SA 2PJRB 4FE7A 5CB4F 4NDLA 2EV5A 3OR2C 1IUFA 2W6QA 3OUZA 2DT6A 2FOKA 5KFHA 5J47A 1RR8C 1TWHA 2VOBA 3H5NA 3KEOA 2W84A 2IGMA 1YRNA 2OF7A 1SFKA 3JCUC 4IQ4A 3CC4I 1FOYA 1W5CC 1WI9A 2RV8A 4OINF 5DM7F 4PJMA 4LSXA 4ECZA 4NHJA 1MBHA 1RC9A 3MCZA 1OCOH 3ZQHA 4EVIA 1VQPI 1XPXA 3GIDA 2KISA 3ONQA 1CKMA 3CVZA 5DQIA 2A6HF 2LTPA 1BJTA 2EPFA 2KJBA 3HXLA 4L5EA 2E5NA 3JSLA 2LC2A 3K10A 1EF4A 3QPTA 2DCEA 2B63J 3UFXB 1WWXA 1FPQA 2V6CA 3K4MA 3M1CA 4B48A 4M9UA 4RNOA 3N8DA 1F43A 2R7NA 4DBQA 1HNXH 4A3GJ 1TW2A 1WKMA 2OJED 3FWEA 2H1LA 5FO5A 2JRTA 2QBYB 4KICA 4KMUX 1LFUP 4WXDA 1Z7LA 4O7ZA 1DDNA 2NU8B 3K3VA 1SFXA 4WWCA 1KU7A 3G8CA 3OSNA 4HYEA 3L2VA 3T8RA 3KHGA 2VBWA 3BZKA 1AWCA 1KJ9A 1RYSA 2JEIA 2GPWA 2DMUA 5JLXA 3VPCA 4TUYF 3CUOA 4DNCA 1MIJA 1SMTA 3LSPA 3L2PA 2M45A 5LBQA 3EETA 3GBGA 4TQSA 1HR0H 1FIPA 3VPBA 3BROA 1EUCB 4BBRG 3HKZA 5KAFC 2WAQE 4UHTA 3AL0B 2Y9ZA 1LJ9A 4UUGA 2VL8A 3R6SA 3ZN0A 4WBNF 4A12A 2RNGA 4GLXA 4A3IG 4PFOA 2Q7DA 2XDVA 3PSIA 4YY3H 4AIKA 3RQIA 1R23A 4G12A 1ZG5A 1S97A 2V58A 5IT9K 4LJZF 5HDGA 1XDNA 2CW7A 5FJ8G 4YG2F 1WJCA 2ZBKA 4O4LF 3Q3SA 4UUVA 2P0WA 4E7JA 5E1XA 3T9EA 4HEA2 3BG9A 4HF1A 1IAWA 3JZ6A 2RF4A 4XLEA 4GC7A 1O3RA 1B6RA 2QKLB 1JKPC 1HW2A 4HZFA 2PVPA 4A93G 3E6CC 2OTJI 3FDSA 4DLKA 3HOVJ 1FTTA 2DN0A 4G6TB 3GIIA 4BWSC 2LRDA 2V1XA 3C2HA 3WTUC 1DUXC 3U55A 1IXSB 4BDZA 1ZR2A 1JT0A 4I55F 1GXPA 2COGA 3PO2G 5BPHA 4IIJF 3BOQA 2FQ3A 3S1MJ 5DM6F 4O7VA 4BHBA 1ZHSA 2ALZA 4GRIA 2R8IA 2VOPA 5DTDA 3H0GA 4DAAA 3K4NA 3KCCA 1WPKA 4ECWA 2IAIA 4DR6H 3CJNA 2JA6J 2OU2A 3UZOA 3VSLA 2GA1A 4IR9A 2UXDH 4UCVA 2XRNA 3LNQA 2HQ5A 2ZSIB 4KIGA 1VQLI 2XV4S 3FKJA 3HHGA 4QSHA 4HQMA 3F0CA 2FJ1A 1KU2A 2YZLA 1FX7A 2JEGA 1YITI 2R6FA 2A68F 4X1EA 4KNYA 1KJ8A 2VQEH 2ZMEC 1JI8A 3JRDA 1MD0A 5FFXA 4DZPA 3L2CA 3RI4A 4Q4DA 4JI8H 4WK8F 3DCFA 2CYYA 3Q8PB 1W0UA 4DL4A 4II3A 2IGOA 1WHUA 2F5VA 3EDPA 4CCOA 4FU0A 4N9IA 1VAJA 3IP4B 1TWCJ 1G2WA 3O3KA 1HLVA 1I1MA 3RJ0A 3Q0UA 1VQ9I 3ETJA 1FJLA 4V2GA 4JI5H 4ECTA 4UCOA 1YW7A 2LH9A 2GOMA 2CKZB 2M34A 4F91B 1ZHFA 2DO7A 4S05A 3I64A 5BYAA 1GYFA 3H1CA 2L4AA 4QW8A 3SGIA 2IEKA 2QENA 4ESFA 1YJ9I 4FX4A 2EJ2A 1V54H 2EQRA 4UVCA 3GDEA 2RDIA 4ECSA 1SMYF 1WH7A 2NVYJ 2FMLA 1EYZA 1W96A 4FFMA 3RIZA 5H6QA 5BMZA 3R0JA 5L9XA 3T8TA 4U7BA 2MD5A 2O6GE 3CCLI 3GMEA 3CDHA 2HOAA 2WY7Q 2BXZA 2K9LA 2KRCA 1R1TA 3MMYB 1L3LA 4ZDPA 3NAUA 3R4KA 3SZPA 3A0HC 1TP4A 4AYBN 5B1AH 3FMQA 3J81K 3OUUA 2DDBA 2HDKA 1R4NB 1VQ5I 1MH4A 3L00A 2Q2TA 4ZZLA 1UELB 2YS7A 4KJZA 3OHBA 1RKWA 4OWRB 4ED6A 5EDNA 3ZN1A 2NS8A 4BYYA 4TV9F 5L1LA 3HTUA 2R7KA 3PW7A 2BHZA 4O3OA 4HAMA 2KT0A 3QP5A 2LR8A 1B04A 3D5LA 4RNMA 1HKTA 2ZXIA 4Q8FA 1T0FA 2FLNA 3SDBA 1ORKA 4WXCA 4AIDA 4IRHA 5M5XJ 3VOEA 3J7ZI 1W36C 5DQGA 3WWJA 2DA4A 4KIBA 1XS9A 1VTNC 2LKPA 2G7UA 2XGXA 2DFEA 2HOEA 2HKOA 3BR0A 3RPUA 3ELKA 3BTIA 2R92J 4CCLA 3C7JA 3DU5A 3KYHC 5FB2A 5IP6A 4EQQA 2BBYA 2STWA 4CKEA 1MDMB 1F5TA 1DU6A 2L7FP 4L1KA 5LGUA 1ET0A 3W6VA 4OMZA 4TVIA 2YU9J 3T5HA 1SANA 1ACIA 3T9BA 4M6XA 2OWOA 5GTIC 3DFGA 1NK3P 2D2WA 3TIIA 1FKAH 2HYJA 4A3DG 2NAZA 5IP7G 3K9TA 4LMYA 3REOA 1R5GA 2QF7A 3HPGA 4M3GA 4XLFA 5ILUA 3TQTA 3MZ8A 2DPJA 2VODA 4B09A 4QWBA 3CESA 1PP8F 3BPVA 1R00A 2X9DA 1Z67A 3K2ZA 1S10A 4BQOA 4BQAA 1OKRA 4A3IJ 1NH3A 2M2EA 4XONA 3JSNA 1QZYA 2JJ7A 2IJLA 2STTA 3OYLA 3OMYA 5F04A 1I50A 4QLCU 1Z1DA 3FXJA 5HS8A 1VQ7I 1JHFA 3I59B 4FHTA 3CJRB 1QPMA 3L09A 2V5AA 1KQ0A 5HS7A 5J2UF 3I58A 3VOTA 4F3QA 1FOKA 3E5XA 2EBIA 1S6LA 2QM3A 2XAQA 2W00A 5KAIC 2R7SA 3RTXA 2WDTA 5EJCA 1OCPA 3ERMA 1T0FC 2KRFA 2IGKA 1YYVA 2JTVA 3U1DA 4A3JJ 3K69A 1R36A 4U7DA 5GAGJ 2D45A 4MEXF 3DPTA 1AHDP 4J9LA 4C2MJ 2W85A 4FETA 2MC3A 4GO1A 4ZDOA 3WWHA 5I5TA 2ISZA 1D8KA 1IGNA 3JAMW 4CDGA 5K5OA 3TIGA 3DEEA 3PO2J 5J40A 2Y31A 3TDZC 2KQRA 1GLNA 4JBAA 4C9YA 2M8GX 3UKGA 2B9SA 2W9CA 2PEXA 2XAHA 3LMLA 1IN6A 3KAKA 1K83A 4IRIA 4XORA 1E4EB 4YIIA 3J81Z 2R8GA 1ONVA 1XD7A 3V4GA 3W5OA 1GSAA 2R92G 2GA2A 3JRFA 4DV7H 3U9SA 3K70C 4A6EA 3F72A 2K9MA 3PQJA 2XCLA 3N44B 4LB5A 4AUXA 2BEOA 3M8JA 2F4MB 3OYEA 1SFOJ 2BYVE 3WTVC 5BS6A 2DXIA 3F8CA 1DQUA 1Y14B 1Z6RA 4G3IA 5EOYA 5CM0A 3Q8QB 2IW5A 1CKOA 2IGNA 5CE8A 4P55A 2E1MC 3U2RA 1FOXA 2XROA 3KP5A 1T2KA 5DG8A 3OSGA 3T1YH 1N25A 1CGPA 2DOAA 1PK8A 4OX9H 2MLGA 4HLYA 3H3ZA 1BGWA 5D5VB 2M7BA 4E7IA 3KPHA 5HDKA 4CXFA 4FS1A 2DYSH 1ZHQA 3Q1KA 3MZYA 4EBCA 1BI2A 3TEKA 3NQOA 2VKHA 1WQ2A 4KT6A 3V6JA 3LSIA 1KT8A 2GAUA 3ABUA 1P4XA 3VYUB 3CO7C 2UVUA 4QPOA 1AU7A 2CW0F 2RDPA 2P81A 3F3XA 2CNQA 2X5RA 3BR5A 3HPHA 1MJ9A 2HVRA 3RKYA 3HSRA 4BHCA 3L1PA 3T54A 5KT2A 2VQFH 4YFNF 2QSFX 2K3PA 2I8DA 1STZA 1TA8A 4FE4A 4IHJF 3K5HA 2HYGD 2CNVA 1G3WA 4GKKH 3ZMUA 3MEXA 3S1QJ 1B8IA 4D0PA 2R7QA 1ZREA 2PG4A 2GM4A 1A6QA 2LBFA 2FX0A 1J09A 4OU0A 2FPPB 4LF7H 5H20A 2O8XA 1JGSA 3RUPA 5A2QK 2LSOA 2Y69H 3I55I 1E3OC 1ZGWA 2CZGA 2M4GA 1V4YA 2AGPA 1TQPA 1D8JA 1GDTA 2ESHA 5KFBA 5IWAH 4L5JA 1IBMH 3CEBA 2YRXA 5HV6A 4B47A 1R4MB 4EV0A 2CQYA 3QODA 4DOZA 1A35A 4ZTFA 1HDDC 2W71A 2R92A 1U5TA 3FKIJ 2HEOA 4XYLB 1OFCX 2V9WA 4O3QA 4Q4CA 5HODA 2JK3A 2L2OA 2CUFA 3GV8B 1DPRA 3C2BA 5EEGA 3QU3A 1ZLKA 2XCPA 4U0VA 2VPSA 1ITYA 3ZMDA 2VE8A 1OBDA 2HWVA 1XC5A 3OYFA 1IRXA 3ZQGA 2ODTX 1MBEA 3MWDA 3TQ1A 1V5GA 2VUGA 3H0GG 2XB0X 3PW4A 4L18B 4BNCA 5L3GA 4JXUA 5D5WB 2ELHA 2Y2ZA 2EK5A 4Y52J 2TCTA 3S8PA 2XASA 1T98A 5J4YA 4EGJA 1HA8A 2VONA 1TWAA 3K4CA 3H36A 1BOBA 1R22A 4RGUA 1BC8C 2VJJA 1OQYA 2WAEA 3T1HH 2L9RA 2CQ7A 2EJRA 5EG0A 1Z77A 1JUSA 3MR2A 1MMNA 4NBQA 3ZPLA 1GVJA 3CLQA 4A3BG 2JN6A 1SEIA 3E6DA 5F0HA 1QVTA 5FJ8J 3HGYA 1JHHA 3M8FA 1E3HA 4EM2A 4Q5SF 4LG0A 2HNHA 2ZJRF 4WF2A 5B1BH 4X0GA 1OCCH 4LG3A 3N4MA 3DTFA 3T0YA 5KFTA 3RBDA 2VA3A 4B8XA 3O8HA 4I76A 3OYBA 2Z3YA 2CGPA 1TNSA 2WTFA 5CA0F 4A93J 1VQNI 1RZ4A 2P7VB 2R4GA 3HOSA 5LGTA 4GYGA 1LQ1A 3AG1H 1YX3A 2WB1A 1VQ6I 3GIPA 2OA4A 4B3AA 4NC7A 2L9VA 3S2DJ 3SNOA 1USTA 4KN4X 2B0LA 1X3UA 3VODA 4I2OA 1ZELA 2OPTA 4FFNA 3FKIG 3H5AA 2A6TA 1RR7A 2DA5A 3ZCOA 3ZQCA 4HN2A 2F5CA 1CF7A 5KKNB 2JA6G 2EJ3A 5CPRB 2X6OA 2VC0A 3WU2C 1LVKA 1LUJB 2E1MB 3VYTB 1ON2A 2EA4A 1SFEA 2NYXA 1R9TJ 4FFPA 3TMOA 3T99A 1T3NA 4G7HF 5EWFA 3OYKA 2P7CB 4ENNA 4YELA 5LFAA 2YPRA 3CD6I 1BN5A 2NU7B 2J6SA 4XLHA 5LD2C 3QYFA 2F5EA 2UXXA 3JRXA 3BLYA 4UCTA 5KFAA 3G6XA 1S9FA 4B3SH 3D0SA 3O2PE 1Z9CA 3ZQIA 1ON1A 3G6VA 4DR5H 2O61A 2ELKA 4O3SA 4EJTA 3HDDA 5GADJ 1Y8QB 1YG2A 2L4MA 2R82A 4XN3A 3DAAA 5BMVF 2NS7A 3WTYC 3HOXJ 1CQTA 2Q2UA 4J9KA 2VASA 2ZJ2A 3BWGA 4CMDA 2MSYA 4A0XA 1FTZA 4YIRX 2R5ZB 3IHUA 2VJ4A 4F4WA 5M5YJ 2DZDA 1DU0A 3BTCA 5D6FA 1GO3E 1D0ZA 2JQ7A 4YFKF 4QJFA 1XMXA 1FSEA 1R6RA 2X6YA 3E5QA 1R7JA 2X51A 2LF7A 2QUFA 2RQQA 2X0SA 2M3AA 2NVQJ 4PWQA 2J5PA 1PP7U 2X4HA 1MSEC 1P2FA 5FLMG 2XPVA 3FIWA 3CMEI 4B4CA 5HS9A 5D4SA 3MWEA 3K4LA 1T6SA 2E2HJ 4C3HJ 3J80Z 4EJOA 3IAM2 4IHXA 4DJAA 2KP6A 1X3ZB 2PN1A 1KC7A 4LF8H 3IC7A 3QOPA 5CVIA 5D5XB 5FRMA 3CUQA 2V6EA 3IKVA 2XSJC 4UV9A 2DMTA 1TWFJ 3E0JB 5LHHA 4Y8VB 4AVZA 5KG4A 4PCQA 2K5CA 1RJQA 4DR1H 1TWCA 2JEFA 4A69C 2YZMA 2JA7G 1OMIA 2IA1A 1XSXA 1TQIA 4F55A 5DV5A 1VBGA 4FFOA 1D1BA 3PFYA 2WB1N 3KEQA 2OH2A 2QZ8A 1OYWA 3K4KA 5HDNA 3IN5A 4JYKA 4K2EA 2C00A 3RZDJ 1Z3XA 4PBCA 3RZOJ 2XHKA 4FM9A 3GTMA 2GZWA 4HV5A 3DF7A 1ZR4A 2BOLA 2QWWA 1YTYA 2K9SA 1H8AC 3B02A 3HEFA 3HT5A 5KFMA 2WB1E 3PJRA 4E7SA 2HZTA 1HC8A 1BNCA 3KEYA 1TQMA 4ANJA 4L0ZB 5EGOA 1RPWA 2RVCA 5D1OA 2FNPA 3JRHA 1SFUA 4AWXB 1DV1A 1OBGA 4DZJA 2L54A 3DTIA 3BG7A 4YIFA 3CCYA 2XRLA 2ZFWA 2M8EA 3EUAA 3RTRA 2ZXWH 2DDAA 4Q44A 5L3DA 4NC8A 3KP7A 5TGTA 2P0AA 1IO2A 3KAJA 1EH6A 2CUJA 5CVJA 1O4XA 1CKNB 3QPLA 1EHIA 5F6FA 4DW6A 3OYMA 2R7DA 3OSFA 1VQ4I 1IN8A 1OPCA 1XGSA 2ETHA 3WTTC 1QA6A 5C4XJ 4CE5A 2IA6A 4RLFA 3DF8A 1KQ8A 4IRGA 5CYVA 4CCKA 4C5BA 4EJUA 3W1BA 1PVEA 5EEHA 3FDYA 4HV6A 1XNQH 3W2WA 1JJ8C 2AGOA 1FC3A 2V59A 5LXTF 3VA7A 1K61A 3F8BA 3T9DA 3R5XA 3OIOA 2W6MA 2XF5A 5DUIA 2KDZA 5EDWA 3GIQA 1Y1VJ 2XIGA 1I6XA 3Q0VA 3LAPA 4N4OB 3MAJA 1DGSA 2ZNZA 5KFUA 5FKKA 3GZ5A 4BXFA 3M9MB 2XAGA 2X6XA 3H4BA 3UR3C 4A3LG 2C28A 3I56I 3FBIB 4JP0A 4QW9A 4PFPA 3VSKA 4OAYA 1S0NA 3BZCA 1KU9A 2K3FA 2NU6B 1MNMC 3DLLF 4WX9A 2VLAA 2CFOA 1M0WA 4XIDA 3CCQI 3R9RA 5IT9Z 1FP2A 2EFOA 2XUBA 3MWMA 3A2KA 3AKZA 1FBQA 1KYWA 4IHSA 2XGQA 2EINH 3CDIA 1I6HJ 4J0MA 4O84A 1FLIA 2PMUA 2UVRA 3HOTA 5GAEJ 1Y56A 3RPQA 5JVTA 1Y0UA 1BA5A 4NYEA 5DQHA 5ICCA 4FCYA 1FYKA 4JV0A 2Q1ZB 3PNTA 4XNFA 4DV1H
chains in the Genus database with same CATH topology
4DR6H 4KITB 3H9GA 1LFPA 1U0JA 2NOJB 3VSLA 3S32A 1W36D 3A4CA 2UXDH 4UCVA 1BR4A 2OC6A 2ZSIB 2R7UA 4XQFA 2VIXA 3FKJA 2VXDA 3SZGA 2KSWA 4F93B 3M4IA 3I9V2 2ELJA 3GB8B 4CUGA 2VQEH 2IS1A 2V9KA 5CQEA 3W1GA 1JI8A 3BG6A 4CH7A 2RREA 1S68A 2VPLA 2WYOA 3F8NA 4DR3H 4JI8H 2CV1A 3OYIA 3BAAA 2IS2A 4BEHB 3N42B 4MV7A 1WFXA 3V42A 4II3A 3CP8A 4YEJA 2IGOA 3K70D 1YX5A 2F5VA 3UNGC 2OV7A 4CCOA 4DIQA 1Z2NX 4NXNH 2R7OA 3IP4B 1QHHD 1BR1A 3TL4X 4X64H 2MC4A 1AN7A 3RJ0A 3OS1A 3FBNB 4R79A 3CZ6A 4NQWB 4PK4A 3HG9A 3SEQA 4UCOA 4JI5H 2LH9A 2CV2A 2GOMA 4F91B 3RGZA 2O5RA 3HL2A 1IBLH 4AYBA 1X1BA 2HPMA 1GYFA 2DT7B 4XKWA 1V9PA 1BR2A 2A5WA 3OYHA 1NG6A 3GDEA 4LH7A 1WJ5A 5LL6b 3QOEA 3J81W 3RIZA 1IBKH 2MYSA 4MV9A 4LFAH 4ETSA 3K4BA 4RZQA 4U7BA 1MW7A 3H35A 2MABA 2WY7Q 2K9LA 1Z21A 1X9NA 4JYAH 2KRCA 1Y6IA 3MMYB 4LFBH 5IT9W 4ZDPA 2HQAA 4FASD 3N6XA 4IAJA 3OYCA 3DKYA 4B44A 3S93A 3NC0B 1OLTA 2XAUA 1N78A 4LFCH 3OL3A 4N4NB 2R7VA 2Q2TA 1UELB 4KJZA 4OWRB 3LSKA 5A2QW 4EATA 1XMQH 2VQCA 3IUOA 3N43B 1B04A 3D5LA 2VJIA 2ZXIA 2KRHA 3SDBA 4HRIA 2F6CA 4APMA 1W36C 4CZCA 4XKCA 3J7AY 1Z3YA 3AL0C 4XKVA 3NBYB 2BVLA 1YE9A 4CCLA 2IS4A 3DQVC 3DU5A 3W2VA 3KYHC 2X1EA 4PUSA 4U87A 2Z1DA 1D1CA 1T95A 2PJRA 3OS2A 5LMUH 3IAS2 1KONA 2LG4A 2XF7A 1Z2OX 4DR7H 4J01A 2WE6A 3RF2A 3DTKA 2OWOA 4BJTA 3OL4A 1FKAH 5LMNH 1L2ZA 4BS9A 4HNTA 2YCHA 3BCBA 2WAFA 4LMYA 3HPGA 4XLFA 4JQFA 3L2UA 3AFHA 2XC7A 3CESA 3S24A 4IKFA 3PNYA 4E7HA 2R7RA 1WJBA 4BQOA 4BACA 3W3CA 1X1DA 3MKZA 1N77A 4PZ7A 4XONA 3JSNA 1UAAA 4DV6H 3RGXA 2DJIA 3OYGA 3OYLA 3OMYA 4XM3A 2HDWA 4LIUA 5DISC 4E4HA 3OYAA 4CCJA 3CJRB 2VQGA 5HOOA 2ZSHB 4BL0B 3MKWB 2FUG2 4F3QA 4DUZH 3G2BA 3D5SC 3OOUA 2W00A 2R7SA 4AU7A 3RTXA 2WDTA 2AQEA 2KPMA 1T0FC 2IGKA 4RM2A 4PJLA 2KMUA 1N36H 4DV5H 2PMZA 3DPTA 4FETA 1K6YA 3W2AA 4ZDOA 2F4VH 3JAMW 4F52A 5JHFA 1N34H 5CKTA 4Q0YA 3DEEA 2Y0SA 1SAUA 2KQRA 1GLNA 4C9YA 4PJJA 4BQQA 3TBIA 2KLOA 3LMLA 1MMDA 4XLCA 3KAKA 3RSNA 4XORA 4BDYA 3QWUA 2MFZA 5BR8H 4JV5H 1X4PA 3W5OA 4PZ6A 3DPLC 4CC6A 2UXCH 1DP3A 3GJXB 1OR7C 1NG7A 1Z2PX 3K70C 2AQFA 4DV7H 2E5LH 4AQYH 2HVQA 2K9MA 2VQLA 3FMAA 3N44B 2UWMA 3M8JA 3F9KA 3OYEA 3LL7A 3RCOA 2DXIA 4J00A 5KHDA 1X1CA 2JA2A 1DQUA 2O03A 3H20A 5EOYA 3NWTA 4RAYA 2HGSA 4C2UA 2IGNA 1CKOA 2E1MC 4EFEA 4RM3A 3T1YH 3OS0A 2DOAA 4OX9H 2Q2EB 4MLOA 4UCSA 4PZ8A 1BGWA 1DGRM 2M7BA 5HVQC 4E7IA 2M0MA 1HNWH 4UCRA 1ZHQA 2UUCH 2V7FA 1MNEA 1D0YA 4DRFA 4ZTJA 4X65H 1XNRH 5FPOA 2VKHA 3DWLE 4KT6A 3LSIA 3CF2A 4YHHH 1LDKB 4P5OA 3VYUB 1WJFA 4QPOA 2VXZA 3PL8A 1WJEA 3D5RC 3RR5A 4A2AA 4II2A 2V26A 2W57A 4MTDA 1UG0A 3HPHA 2HVRA 2KL4A 3MD2A 4B3MH 4HSTA 4PJNA 3CP2A 5FRNA 3J7AK 2VQFH 3DPUA 2K3PA 3OIQA 2I8DA 1TA8A 3CJQB 4E6NA 3OIPA 3OWTA 4GKKH 2HHHH 3VDXA 2X1DA 2R7QA 4RB0A 1E4FT 3LSGA 2W1OA 2M7AA 1WH2A 4DUYH 2LBFA 1J09A 4LF7H 1SYXB 1TZLA 3H0DA 2JUGA 3ZRGA 1TT0A 2M4GA 4RB1A 3TY8A 2ZFUA 3S3NA 5IWAH 2HIVA 4BEHA 1IBMH 3BA8A 3RQ4A 4B47A 4H4KC 3H9QA 4XMYA 3EUKL 4E6KG 3FHNA 3QODA 4HSRA 4DOZA 4ZTFA 4KISA 4DR2H 3UQ8A 3I3LA 4DV3H 3L2RA 4B3TH 1V5FA 2L2OA 1N75A 3OY9A 3BA9A 2VPSA 1D0XA 2WBMA 3KALA 3DTEA 1FMVA 2KDOA 3SEZA 3QYEA 3H9JA 3OYFA 4DV2H 1IRXA 1TAEA 1VS0A 4DGWB 1V5GA 2VUGA 3PN1A 3NWSA 1MZBA 4IZZA 4GKJH 1VZ0A 3C2GA 3S8PA 3OTOH 3U21A 4JI0H 5FD6A 1N32H 1HA8A 3K4CA 1BOBA 2VJJA 3S3OA 2HZDA 1M0TA 3L2QA 4CSWA 4R7RA 2JSPA 2KHMA 2VJ5A 2WAEA 1MNDA 3EUHC 3T1HH 2UXBH 1N33H 3K6GA 3MKYB 3LMMA 1MMNA 3OYJA 4M7EA 2JVHA 3L4JA 3L4KA 1ERDA 1MMGA 1SEIA 4BE2A 2UUBH 2BW3A 2HVSA 2HIXA 5D1PA 4BJ6C 2MCTA 2HNHA 3LSMA 4X0GA 4LG3A 2LYCA 3RPUD 4X62H 2LY1A 1E0EA 3HC7A 3LFUA 5HLTA 4E7ZA 1E4GT 4XOTA 3OYBA 3EPZA 4ZDLA 4NUBA 2CUZA 4RAZA 4JI6H 2CFMA 4UCUA 4JI3H 1X19A 2E60A 4HPQA 4EFBA 3PNVA 2UUZA 4IX7A 5HNHA 3OYNA 3S3MA 4EEQA 2R4GA 3HOSA 2W82A 1P16A 1YX3A 2WB1A 5CQGA 3VYRB 4NC7A 4IQJA 2W4SA 2RGRA 1I94H 3OYDA 4Y33A 2LBFB 2BW3B 3SYTA 1ZELA 2Z2SB 1X4OA 3BCAA 3VWBA 3H5AA 2A6TA 3ZCOA 2LOOA 5KNLA 5CPRB 1LVKA 4XN0A 1WJDA 2E1MB 3VYTB 3KXYT 4PSXA 3HUGB 4E7KA 1FJGH 4LF6H 2L9SA 3TMOA 3DU6A 3ZR8X 3OYKA 4BQNA 4YELA 5LFAA 4XLHA 5LD2C 3QYFA 4UCTA 3BLYA 1PJRA 1WJAA 4B3SH 1MMAA 2Z16A 4K0KH 4UFZA 3QYBA 5D1OB 4BUPA 3OR1C 4BU2A 4DR5H 4B3RH 4BJ5C 2XF6A 4JI4H 4HG2A 3H5RA 1CKNA 4HNUA 4Y4RA 4XN3A 2WADA 2Q2UA 4XOPA 4Y3OA 4DBRA 3L2WA 2VASA 1A0IA 1HNZH 2VB6A 2VKDA 4DR4H 3N41B 4B3XA 2VJ4A 2M4KA 4DV4H 1D0ZA 4A2BA 1QHGA 1R6RA 4XKBA 2X6YA 3ZXSA 1J5EH 2RQQA 2X51A 3LSHA 4D1QA 1EA3A 2M3AA 5HNFA 3KYLA 2UU9H 5FROA 1QU3A 5FPRA 1I6UA 2WY8Q 2MD0A 4CC5A 3K4LA 2RGVA 2WAQA 1DGWY 4X66H 2F4IA 2JVGA 3N05A 3IAM2 4C30A 4DJAA 2KP6A 4NXMH 3ZGKA 4LF8H 4XR6A 3VYSB 4RB3C 2PJRB 4B43A 4LF5H 4RB2C 4KHPH 5FRMA 3OR2C 2V6EA 4JI7H 1XK5A 2XSJC 2DT6A 3E0JB 2R7WA 4AVZA 4DR1H 4CA0A 2K5CA 3A1YA 4RMNA 4CCMA 4EQ5A 3H5NA 2VOBA 2L9NA 4XLAA 2IGMA 1AA7A 4IQ4A 1SFKA 4ZYAA 2OUMA 3PSFA 4F55A 4BE0A 4PJMA 4LSXA 1D1BA 3PFYA 1P9QC 3ONQA 1CKMA 3CVZA 3DKXA 3K4KA 3C0FB 2WA0A 1BJTA 4LF4H 3HXLA 2X85A 2E5NA 3JSLA 1Z3XA 2LC2A 4FM9A 3K10A 4JI1H 3DF7A 4PDBA 2BOLA 2DCEA 3DLAA 4C2TA 1PYVA 2UV1A 3K4MA 3M1CA 4B48A 4NNJA 4ITVA 4E7SA 3PJRA 3KEYA 4ANJA 2R7TA 3TY5A 2R7XA 2X1CA 4DBQA 1HNXH 4F92B 3IG0A 5D1OA 4ZJZA 4CCNA 2GOXB 4YRVA 1X1AA 4JI2H 3BABA 1Z7LA 3DTIA 2LY2A 2L7KA 3K3VA 3BG7A 4LIVA 4DV0H 1V5EA 3EUAA 2ZJTA 2HU9A 3RTRA 4RLQA 1D1AA 3L2VA 1FMWA 1XMOH 2V1NA 4NC8A 5FLXW 5TGTA 4E7LA 3KAJA 3KX2A 2CUJA 2E5ZA 1CKNB 1O75A 3OYMA 3L2PA 1S9HA 4PSWA 3GBGA 1HR0H 4RLFA 4BE1A 4CCKA 2X6WA 3HKZA 1S03G 3E1SA 3AL0B 3J80W 3W1BA 2HPIA 2QKMB 2VL8A 3FDYA 1XNQH 3W2WA 2RNGA 4JOMA 4QPQA 3NBZB 4GLXA 4MTEA 4PFOA 2FE3A 2ZM6H 4OAZA 2XDVA 3PSIA 4LITA 2CW8A 4I7HA 4YY3H 2XF5A 2CH0A 1FVIA 2XIGA 1XDNA 2CW7A 4N4OB 4P1WA 1DGSA 5KCMA 4BXFA 2VQHA 1WJCA 2X6XA 2ZXHA 4ZC3A 1LKXA 2BVMA 3UR3C 2L5QA 2V4JC 2P0WA 3BC8A 4E7JA 1G8XA 3FBIB 2IXSA 4HEA2 4PFPA 3VSKA 4OAYA 4XLEA 2QKLB 3ZQQA 2IS6A 4LF9H 3N40P 2VLAA 2CFOA 4D9JA 1M0WA 1G59A 4G6TB 3MWMA 4BWSC 3PUBA 2LRDA 2KZVA 3C2HA 3AKZA 3A2KA 4BDZA 2CMPA 3K4JA 2UUAH 2CS3A 4LH6A 4J0MA 1ZHSA 3CMMA 3EYYA 5FD5A 4BGDA 3HOTA 4GRIA 2LREA 2W7NA 1Y56A 4LSAA 2CV0A 3TY9A 1P8LA 3VNNA 4XL9A 3K4NA 2Q1ZB 3PNTA 4XNFA 4DV1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ7 A;  3JSN A;  1CKN A;  3KYH C;  4PZ8 A;  4UCS A;  3NC0 B;  4CC5 A;  3QWU A;  4UCV A;  3BA9 A;  5DIS C;  3JSL A;  4UCO A;  2Q2T A;  4UCR A;  2Q2U A;  3W5O A;  5D1P A;  2HVS A;  2HIX A;  5FPR A;  1CKN B;  4PZ6 A;  4CC6 A;  4DRF A;  3L2P A;  3GJX B;  1A0I A;  5FPO A;  1V9P A;  2OWO A;  2HVQ A;  1TAE A;  3TY8 A;  3GDE A;  3RTX A;  1VS0 A;  1XK5 A;  4LH7 A;  3GB8 B;  2VUG A;  3TY5 A;  1B04 A;  2CFM A;  2HIV A;  4UCU A;  5D1O A;  3RR5 A;  1S68 A;  3PN1 A;  3BA8 A;  4UCT A;  3W1B A;  3W1G A;  4EFB A;  3VNN A;  4EQ5 A;  2HVR A;  4LH6 A;  3BAA A;  3NBZ B;  4EEQ A;  4GLX A;  3BAB A;  4UFZ A;  1P16 A;  5D1O B;  3S24 A;  1CKO A;  1X9N A;  3UQ8 A;  1TA8 A;  3TY9 A;  1P8L A;  4EFE A;  4E6N A;  1DGS A;  1FVI A;  1XDN A;  3NBY B;  1CKM A; 
#chains in the Genus database with same CATH topology
 4KIT B;  2A07 F;  3H9G A;  1LFP A;  3GFI A;  2NOJ B;  3WTX C;  2FNA A;  5DD4 A;  2E36 A;  3T9A A;  1IDY A;  2AU0 A;  5KFL A;  3A01 B;  3GTK A;  2R7U A;  4XQF A;  1YHQ I;  2VXD A;  4MA5 A;  5IYC G;  3OHA A;  1O57 A;  1OCR H;  3I9V 2;  3JSO A;  4CUG A;  4U0Y A;  1X58 A;  2IS1 A;  2HKX A;  5CQE A;  4XRS G;  3BG6 A;  3W1G A;  3M9O B;  3G1M A;  3T5L A;  2QK4 A;  3BP8 A;  4MV7 A;  3BQZ A;  3GTM J;  4CZZ A;  3DEW A;  1Z2N X;  1YX5 A;  4DIQ A;  2OV7 A;  1QO0 D;  5DDG A;  3WHC A;  3DBR B;  1TL8 A;  2AS5 F;  4UB8 C;  5ED4 A;  3OS1 A;  4R79 A;  1APL C;  3GXO A;  4NQW B;  3KET A;  1W7P B;  4YR3 A;  1ETO A;  3RGZ A;  3HL2 A;  1I3Q A;  4AYB A;  1LB2 A;  3FXM A;  1IXR C;  1GLV A;  2EIK H;  1K1Q A;  2DT7 B;  4XKW A;  1TBX A;  2NVX J;  3KHL A;  4H0E A;  2P4W A;  1NG6 A;  3OYH A;  2IBK A;  4A3M G;  1J59 A;  2A5Y B;  1MBK A;  2AXT C;  5CR5 A;  1GUU A;  3KFW X;  4LFA H;  4ETS A;  3H35 A;  2MAB A;  2RN7 A;  5D5U B;  2COM A;  2DLN A;  1K4T A;  1X9N A;  4JYA H;  3T1B A;  1Y6I A;  5AON A;  4ED0 A;  1BM9 A;  1SVL A;  4LFB H;  1A0G A;  1VQK I;  4YAK B;  1KGS A;  1IF1 A;  1A9X A;  3BPX A;  3L7W A;  2FPG B;  3OYC A;  3FXR A;  3DKY A;  2BE5 F;  5BQT A;  1YIJ I;  1JXS A;  3VMM A;  2PQ8 A;  4BBS G;  3HTS B;  3PFF A;  2Z5U A;  2EV6 A;  5A2Q W;  5IT3 A;  5KFC A;  2HYF A;  5ICG A;  2Z04 A;  1ZAR A;  2GWR A;  1G6N A;  3HIF A;  4HF0 A;  5D8K B;  1K78 B;  2VJI A;  4QIW A;  3BR6 A;  3F22 A;  4Y13 A;  2VOO A;  1HST A;  3H0G J;  4TV7 A;  4HRI A;  1WZ2 A;  3GTK J;  2J9G A;  2NVT J;  4ECQ A;  3HJE A;  2Q8K A;  4CZC A;  3I4N G;  4XKC A;  1EUD B;  2EWN A;  1KJI A;  2FEZ A;  2KFD A;  3Q5F A;  1TWH J;  1WGX A;  2FLP A;  3ORR A;  4ZYD A;  2LFB A;  4IWY A;  5E25 A;  3KRE A;  3GX4 X;  1ZRF A;  4M3F A;  4PUS A;  4U87 A;  4O7L A;  2Z1D A;  1D1C A;  3LUL A;  2N8G A;  4HQ6 A;  5J1Y A;  2P5K A;  4KIF A;  3OS2 A;  2UXN A;  5LMU H;  3IH4 A;  3BJA A;  4FGR A;  4DR7 H;  2W6P A;  3RF2 A;  3VFZ A;  2DMQ A;  1ZLJ A;  3A03 A;  3QPH A;  4BJT A;  1W0T A;  3G6Y A;  1RI7 A;  1A31 A;  1TWA J;  4BS9 A;  3PIO F;  3OV8 A;  2VUM J;  2EFP A;  2YCH A;  4M72 A;  3GVA A;  5I60 A;  1M7J A;  2JPB A;  2ME0 A;  2O3F A;  2XC7 A;  3DV8 A;  3CC7 I;  3S24 A;  3GTJ A;  4A5N A;  2P5V A;  4E7H A;  3BAC A;  4J9S A;  1A6I A;  1TW3 A;  1WJB A;  1WRJ A;  4RA2 A;  1KYZ A;  1FEX A;  4BAC A;  1YFH A;  3R60 A;  2EJ0 A;  5LOV F;  4RUC A;  1T39 A;  2COI A;  1UAA A;  4O81 A;  3RGX A;  2DJI A;  1CE8 A;  3H4D A;  4DV6 H;  1BJZ A;  4XM3 A;  3HO8 A;  2HDW A;  4LIU A;  3TOB A;  4BAY A;  4XIC A;  3EYI A;  1J75 A;  5DIS C;  4GFB A;  4UUS A;  4UV8 A;  4CCJ A;  2W6Z A;  2BGC A;  1I5Z A;  2ZSH B;  2R7F A;  3MKW B;  2VBZ A;  1V55 H;  1R1V A;  4N9H A;  5L3B A;  4JV1 A;  3OOU A;  3GTG A;  4XLP F;  2DT5 A;  1T8I A;  3WG7 H;  2FBK A;  5CJ9 A;  2WWY A;  2A6E F;  2KMU A;  1P4W A;  4DV5 H;  1SAX A;  2FLL A;  4U88 A;  2H1K A;  3WTZ A;  5DD8 A;  1ULZ A;  3W2A A;  4O82 A;  2F4V H;  1N34 H;  4Q0Y A;  4EG0 A;  2K9N A;  1SAU A;  1I50 J;  3FXL A;  4J9P A;  4E70 A;  1VFC A;  2YZN A;  2NU9 B;  4G6D A;  4BQQ A;  3WGG A;  3TBI A;  2KLO A;  4G8X A;  3V8J A;  2E1C A;  2D1V A;  4YR2 A;  1RUN A;  1X4P A;  4Z2Y A;  3RIR A;  3JZI A;  4L5I A;  4JV5 H;  3TOA A;  5KFR A;  5KG0 A;  4EGQ A;  3GJX B;  5DLF A;  2UXC H;  1B9N A;  1NG7 A;  4FTH A;  2LY9 A;  1Z2P X;  2R86 A;  4R8H A;  2AO9 A;  2MBF A;  2VQL A;  4AQY H;  2PJP A;  4YJ3 F;  2LK2 A;  3HHH A;  1TT5 B;  2LP0 A;  3F9K A;  4HYK A;  3LL7 A;  1K6O A;  5C4X G;  3WGI A;  5L1J A;  3KLN A;  4EEY A;  1X1C A;  2LLK A;  2JA2 A;  5KFX A;  2O03 A;  2HR3 A;  3R5H A;  3NWT A;  3CCU I;  2JA8 J;  5JVL A;  1E2X A;  2HGS A;  4C2U A;  2EV0 A;  5K2M A;  1UFM A;  4RM3 A;  4EFE A;  3DP7 A;  2YUS A;  3C3W A;  2EZI A;  5LRS A;  5GTH C;  4BH9 A;  4M9X A;  1Z91 A;  1DGR M;  3EPI A;  5JHU A;  1HNW H;  1ZQ3 P;  3HOU G;  1FWZ A;  1J5Y A;  2V7F A;  2QEX I;  1D0Y A;  3HM5 A;  1C30 A;  4DRF A;  4ECY A;  1XNR H;  2ISY A;  3PO3 J;  3DWL E;  2QYZ A;  2GXG A;  2HHF B;  3KHR A;  2HXO A;  2PN6 A;  3CF2 A;  3JRW A;  4QWE A;  5J8F A;  5KFJ A;  1WJE A;  4M3D A;  3LWB A;  4O6J A;  4MTD A;  4A2A A;  5KX5 F;  1K79 A;  3KYD B;  2OCE A;  3T5X A;  4HST A;  2FSW A;  4PJN A;  1SD7 A;  2R5Y B;  2W9A A;  3HYI A;  4LLG F;  5FRN A;  2W9B A;  4HX4 A;  4MFD A;  5ILV A;  4O2A F;  1XGM A;  3OWT A;  3LP8 A;  4U7C A;  4OIP F;  1D3Y A;  4RB0 A;  3FMS A;  2JRM A;  3A02 A;  1Y0N A;  2CUE A;  2HQR A;  4XLN F;  3M3Y J;  4FFL A;  4O7S A;  2BQ3 A;  4O2B F;  1DP7 P;  3S15 J;  3Q0W A;  1RUO A;  4K6N A;  1TZL A;  4M6Y A;  1S8N A;  5LEK A;  1FSH A;  3ZRG A;  1ZAU A;  1G2H A;  2JT1 A;  1VND A;  1EH8 A;  3JW4 A;  4ZH4 F;  2Y30 A;  3C1D A;  1PUF B;  1H88 C;  2H27 A;  3SFZ A;  1KJJ A;  5H80 A;  4R8U B;  2ZFU A;  1U8B A;  3CDL A;  1I2K A;  2M9H A;  4BEH A;  2V4Q A;  5EZH A;  1B72 B;  1T94 A;  3BZ6 A;  3GFL A;  3EUK L;  2V1D A;  4XMY A;  4QWA A;  3FHN A;  4HSR A;  3ORQ A;  4KIS A;  3GTO J;  4MV6 A;  3GLL A;  3ABL H;  4LK0 F;  3AW8 A;  2NVY A;  2IA2 A;  2JEJ A;  2R8K A;  3AX6 A;  4B3T H;  1OR7 A;  1R1U A;  2LVS A;  1MSF C;  4JX6 A;  1JKO C;  1N75 A;  2YR2 A;  4QIW N;  3TIN A;  4HX8 A;  1R5I D;  3HOZ G;  2JUC A;  2OTL I;  1A5J A;  1K4S A;  3KE2 A;  1YS7 A;  4GC6 A;  1A3G A;  2FRH A;  2W8K A;  3DKW A;  3DTE A;  3B6A A;  1FMV A;  2KDO A;  3SEZ A;  5F1R A;  1W7P D;  3H9J A;  3FZV A;  1ZYR F;  3QU6 A;  1TAE A;  3LFK A;  1U9O A;  2GIZ A;  3G8D A;  4ZOL F;  3ULQ B;  2R7Z A;  4O4J F;  2FU4 A;  2YZG A;  2DIK A;  4IZZ A;  2NVU B;  1S0O A;  4GKJ H;  4JI0 H;  4TV8 F;  3U21 A;  2YYA A;  5BPF A;  1RNL A;  1YOV B;  1P7J A;  5EZG A;  2WV1 A;  4IHY A;  2VUM G;  1CQJ B;  5FGM A;  4R7R A;  2JSP A;  1L0O C;  3CF5 F;  1MND A;  2UXB H;  1N33 H;  3K6G A;  1SVO A;  5TIS C;  2MA3 A;  1ERD A;  5K5Q A;  4BE2 A;  3NEU A;  5I47 A;  2BW3 A;  2K85 A;  5HNE A;  3LSM A;  2ZCW A;  1IN4 A;  2I8C A;  1JX4 A;  2I87 A;  2FK2 A;  2DA3 A;  2WV0 A;  4E7Z A;  2CUZ A;  4RAZ A;  4JI6 H;  5KFS A;  2CFM A;  5C44 G;  3FM3 A;  3P7N A;  1DAA A;  2I80 A;  3PVX A;  3FX3 A;  3PNV A;  3S3M A;  4RGR A;  3ZMZ A;  1HW5 A;  3LWF A;  9ANT A;  1XMK A;  2BY2 A;  1P16 A;  4XZ3 B;  4FS2 A;  5E8I A;  3C18 A;  4FT8 A;  4I0A A;  5C1P A;  3PZP A;  4MV3 A;  3HSF A;  3OYD A;  2ID6 A;  3KZY A;  4Y33 A;  2L7Z A;  5K7F A;  2EIM H;  3SYT A;  1X4O A;  2AHQ A;  2GBY A;  2M5W A;  5KFZ A;  3HBL A;  4RGX A;  1H0M A;  2LOO A;  3SE7 A;  1WJD A;  4ON0 A;  4PSX A;  4G7Z F;  4LF6 H;  3I4M G;  4RU9 A;  2G0E A;  1YI2 I;  4A3K J;  4LOC A;  1JDB B;  3Q2O A;  2D5V A;  5KG3 A;  4I09 A;  1PJR A;  1OJL A;  2RAE A;  4E4T A;  3QYB A;  1AOY A;  4ESB A;  3JAM K;  5D1O B;  5BWR A;  3V6H A;  4BUP A;  4Y17 A;  3RAQ A;  3MJF A;  2QA4 I;  1LDD A;  4BJ5 C;  1USS A;  5M3F J;  4WCG A;  3JSP A;  1QPI A;  3I4P A;  3QQM A;  3CLO A;  3H5R A;  4XK4 A;  4Y4R A;  1SCU B;  5J8C A;  2OZU A;  3ZQ7 A;  4P9F A;  4XOP A;  4DBR A;  5JQW A;  5AIQ A;  1A0I A;  1SVM A;  4DR4 H;  2VKD A;  2ME6 A;  4LH6 A;  4B3X A;  3N41 B;  2G9W A;  5KFQ A;  4EYI B;  1OIS A;  3VEP A;  5E1W A;  2YS6 A;  3HOY J;  4DV4 H;  1R9T A;  5BPI A;  3P5J A;  1J2X A;  2F48 A;  3ZXS A;  4X6A J;  3GIM A;  2E2H A;  2HTS A;  2ASL A;  4IHW A;  2ASJ A;  1JDE A;  2B63 A;  1EA3 A;  3K2A A;  1ZAO A;  3AAF A;  1YS6 A;  2EFW A;  2IMW P;  1WCM G;  3MKL A;  5FRO A;  3R5F A;  1QU3 A;  5FPR A;  4ED3 A;  2K7L A;  3TP3 A;  1I6U A;  3ETH A;  5DGB A;  4J9R A;  2RGV A;  3GQC A;  1QQI A;  1TWG J;  5IYD G;  1DGW Y;  2JVG A;  3N05 A;  3WGH A;  3BR2 A;  4XBF A;  5I5V A;  3S17 J;  2ZXJ A;  4W1U A;  4BBS J;  3FIS A;  5KK1 A;  1I2L A;  4O4H F;  4RB2 C;  3QWL A;  4LG0 B;  1MDM A;  1EKP A;  4JI7 H;  3GEZ A;  5KT3 A;  4Y7N J;  3MR5 A;  2R7M A;  1GV5 A;  3JR9 A;  3DXJ F;  3RYR A;  1AKH A;  1VBH A;  4CA0 A;  3A1Y A;  4RMN A;  3MQ0 A;  4GYI A;  4MEY F;  2WTE A;  2OD5 A;  3I4M J;  4EQ5 A;  3GIK A;  2L9N A;  4MA0 A;  3G1L A;  1T38 A;  2AQ4 A;  5FKM A;  4ZYA A;  3GTQ A;  3PSF A;  1R71 A;  3DBH B;  3LA7 A;  1POG A;  5F9L A;  4TM5 A;  4IEJ A;  3WE2 A;  4M74 A;  4OIO F;  3ZP5 A;  5EWG A;  3DKX A;  2M30 A;  1JT6 A;  3C0F B;  5DG9 A;  4IRC A;  1J9I A;  3ML6 A;  2RKH A;  3SFI A;  1B9M A;  5EF6 A;  5J4V A;  3DLA A;  4C2T A;  4KYW A;  1ZG3 A;  4O3N A;  2UV1 A;  4A3J G;  4ITV A;  3TY5 A;  3HOW G;  2GQR A;  2ECB A;  4YB8 B;  2W48 A;  3QZ7 A;  5B5E C;  4F92 B;  1IXC A;  5JH7 F;  2ECC A;  2GOX B;  1KZH A;  1X1A A;  2IA0 A;  1IDZ A;  5LHG A;  2BZT A;  2L7K A;  5HBR B;  1XTA A;  3WNZ A;  1A36 A;  2VPR A;  4LIV A;  1V5E A;  2ZJT A;  3IWZ A;  3NUA A;  1YLF A;  1BW5 A;  1W5S A;  5K5R A;  4A6D A;  3SDG A;  5F1J A;  2IP2 A;  3GTG J;  2V1N A;  1XMO H;  1U2W A;  3S2W A;  1FBU A;  1P92 A;  3CCV I;  5FLX W;  3OSP A;  2JA5 G;  3PM1 A;  3KX2 A;  1RET A;  5BPD A;  2W9C B;  2HQN A;  3HRM A;  4QWQ A;  4S0H B;  4QTR A;  4A3D J;  2XSD C;  4PSW A;  2ZME B;  1FT9 A;  1W7P A;  2BY0 A;  1G3Y A;  2LDU A;  2QBY A;  2OLS A;  2JZY A;  2JWT A;  3PR4 A;  1S03 G;  2ADU A;  5DCF A;  4CO8 A;  2HPI A;  2QKM B;  2K9Q A;  5E3N A;  2VQD A;  4MO7 A;  4JOM A;  4QPQ A;  1GHC A;  2DBB A;  2RC4 A;  4A3F J;  2FE3 A;  3GYH X;  2E71 A;  2K02 A;  3QPS A;  4I7H A;  2CW8 A;  3E7L A;  4LIT A;  4OAZ A;  4EMS A;  5LLQ A;  3IV5 A;  1F4K A;  2VN2 A;  4UXN A;  3CC2 I;  2EFQ A;  3TO9 A;  3GV7 B;  1QZZ A;  2DK8 A;  3G4S I;  1HKS A;  2PMZ E;  2DOE A;  5KCM A;  2VQH A;  2CO5 A;  4ZC3 A;  2DMP A;  3EUH A;  2BVM A;  4IAJ A;  2L5Q A;  3BC8 A;  1G8X A;  4BHP A;  3CCM I;  5GP9 A;  2FQ4 A;  2NRA C;  1OYY A;  2H09 A;  4Z6Y A;  3HOZ J;  3W6K B;  2GLO A;  2DW4 A;  5H2F C;  3ZQQ A;  2IS6 A;  3U9T A;  1MBG A;  3FXK A;  3RKW A;  1LFB A;  3N40 P;  3WWI A;  1G59 A;  1BIB A;  4NZN A;  4J9O A;  1SD5 A;  1YQA A;  2HOT A;  3M4O J;  3K4J A;  3BQ2 A;  2QLZ A;  2BV6 A;  4PJ0 C;  3HOW J;  4HR7 A;  3EYY A;  5FD5 A;  2GIV A;  2W7N A;  3AYH B;  2E19 A;  2DOF A;  3ABM H;  3LST A;  2CV0 A;  3BR1 A;  1Z05 A;  5DGI A;  3TY9 A;  1XCB A;  3K7A J;  5BOX A;  4A3C G;  3E5U A;  1U0J A;  2J6U A;  2R8J A;  1W36 D;  3S32 A;  3A4C A;  1XGN A;  4UVB A;  3GLX A;  1WVR A;  2DU9 A;  1BR4 A;  3SQN A;  3HKZ N;  2F4O B;  1JKR C;  1NK2 P;  3HOU J;  5ICE A;  5C4J J;  4IWX A;  3SZG A;  4F93 B;  2JA5 A;  5FFZ A;  5T14 A;  2ELJ A;  5CA1 F;  2UVV A;  2V9K A;  2DQL A;  1S68 A;  4CH7 A;  2WYO A;  5C3E G;  3B6C A;  2VPL A;  3F8N A;  2CV1 A;  5J2T F;  4Q45 A;  3CQZ J;  4R1H A;  3HZJ A;  2IS2 A;  2CFX A;  3N42 B;  4ECR A;  1WFX A;  3V42 A;  3GV5 B;  5TJJ A;  4YEJ A;  4YR0 A;  3UNG C;  4D5C A;  1IG7 A;  2KZG A;  3DBL B;  2PFB A;  1O3S A;  1QHH D;  4A5M A;  4MV4 A;  1BR1 A;  1BBY A;  4X64 H;  1U5T B;  4M3B A;  4UVA A;  3JRA A;  1ZTR A;  5H6R A;  5KG5 A;  3CZ6 A;  3HUG A;  4PK4 A;  3HG9 A;  5FKO A;  3SEQ A;  1N56 A;  4HW0 A;  3JAM Z;  4NZM A;  2O5R A;  1IBL H;  3BY6 A;  1X1B A;  3CCR I;  3SXY A;  2HPM A;  1BXR A;  1N48 A;  2I5U A;  5E3O A;  4L0Y B;  3TDU C;  1BR2 A;  1V9P A;  3RV4 A;  3E97 A;  2BHY A;  1BC7 C;  1WJ5 A;  4LH7 A;  5K3W A;  3QOE A;  2O9L A;  3KP2 A;  3J81 W;  2L02 A;  4G6Q A;  1IBK H;  5E3L A;  4L9N A;  1IC8 A;  2MYS A;  3GZ6 A;  1IYE A;  4XX0 B;  3S14 J;  2VT2 A;  4QWD A;  4EJW A;  4AVP A;  3HOV G;  3GZN B;  2XGE A;  1HSJ A;  1EKF A;  5D6E A;  1Z21 A;  2CU7 A;  2GQQ A;  3WE3 A;  2FA5 A;  2QYO A;  4Q43 A;  2IRF G;  3N6X A;  4A3B J;  1MJB A;  3BT9 A;  1G3T A;  3KZZ A;  5F27 A;  1OLT A;  2XAU A;  2L01 A;  3V6K A;  4LFC H;  3OL3 A;  4N4N B;  2R7V A;  3M9N B;  3SHF A;  4HQE A;  2ZC2 A;  3RB3 A;  5F64 A;  4EAT A;  3FK7 A;  2CQK A;  1QBJ A;  1R58 A;  3MR6 A;  4UB6 C;  2VQC A;  3IUO A;  2VKV A;  5F0F A;  1FBS A;  5DYM A;  4DL2 A;  1Y1W A;  1VI0 A;  2F6C A;  2F5F A;  2SCU B;  2XVC A;  1UC9 A;  3QZ8 A;  2BXY A;  4IPA A;  3EPG A;  1W93 A;  1JTX A;  2X0L A;  4XKV A;  3AL0 C;  3BG3 A;  2JPC A;  4MQV A;  3KP4 A;  1Z0X A;  2MLK A;  4C3J J;  2VA2 A;  1WCM J;  2BVL A;  3F21 A;  1Y8R B;  5LRR A;  5KT7 A;  3GTP A;  4KA4 A;  2X1E A;  1PUE E;  2XGP A;  4EYH B;  2PJR A;  3PW0 A;  1B1B A;  5DCM A;  2M05 A;  2ATL A;  2CQQ A;  3TO7 A;  4HDU A;  3BG5 A;  3M1E A;  1S3J A;  2LG4 A;  4MQ9 F;  1Z2O X;  4YAJ B;  3DTK A;  2W7P A;  3A01 A;  1XMA A;  2A1H A;  4WD3 A;  4CHI A;  3OL4 A;  1L2Z A;  1YRN B;  3ZQF A;  3J80 K;  2WAF A;  1HDP A;  2YSR A;  3G1O A;  4D7M A;  2DFI A;  3L2U A;  1S29 A;  3AFH A;  4L9V A;  4IKF A;  4O3R A;  3PNY A;  2QQB A;  1H9T A;  3MVP A;  2R7R A;  5IYB G;  2LKS A;  3HKZ E;  4PGG A;  2R5Y A;  3W3C A;  4A3F G;  3PUF A;  2W9B B;  1IRG A;  2DPI A;  3OYG A;  2C2E A;  2E34 A;  2LF8 A;  3H3U A;  4XRS A;  5J3L A;  2WAQ N;  4E4H A;  3U1K A;  1XDU A;  4I98 B;  4UUT A;  4P9U A;  3OYA A;  3JRE A;  3F23 A;  2VE9 A;  5C5J A;  1LNW A;  5K7H A;  1QZE A;  2OAZ A;  5M5W J;  4BL0 B;  1H89 C;  1LE8 B;  1E4E A;  2DA7 A;  2FUG 2;  2HJW A;  5DAA A;  3G2B A;  5I5S A;  3D5S C;  3LA2 A;  2AGQ A;  3HB9 A;  4AU7 A;  1RK6 A;  2AQE A;  2EFN A;  2KPM A;  1IJW C;  1S7O A;  1PUF A;  2A69 F;  1N36 H;  5KFW A;  4LLN A;  2KIQ A;  2VKE A;  2P6T A;  3GTP J;  3CJT B;  5FLM J;  3F6V A;  1I1G A;  1Y1V G;  2JMW A;  1DIK A;  1T08 B;  4ZHQ F;  1RRJ A;  5CKT A;  2O8K A;  4JUZ A;  3T5J A;  4JV2 A;  3P9K A;  1P6R A;  2Y0S A;  2E2I J;  2CWE A;  1KUT A;  3Q8S B;  3Q9V A;  4IZO A;  2XC9 A;  5E79 C;  3GTL J;  1KBL A;  1SFO A;  4XLC A;  1X2M A;  1XB4 A;  2FD5 A;  4DQ2 A;  3QWU A;  2MFZ A;  5EZY F;  5BR8 H;  5KFE A;  3DPL C;  4CC6 A;  5KFG A;  1H9G A;  1OR7 C;  3HRS A;  2AQF A;  1WSC A;  4YQW A;  3FMA A;  2UWM A;  2BQU A;  2LMD A;  3FK6 A;  1K83 J;  2ZB9 A;  3G3Z A;  3RCO A;  5E18 F;  2ESN A;  1ETW A;  1MBF A;  4RAY A;  4GDF A;  3J7A O;  4FIS A;  2QQ9 A;  4G94 A;  1BL0 A;  1VQ8 I;  3K3P A;  3K1M A;  4W97 A;  3HRU A;  1GT0 C;  3HOX G;  2R7Z G;  3WG9 A;  3OS0 A;  1UB9 A;  3GFM A;  5K7Z A;  4PZ8 A;  2E7X A;  2CSO A;  5HVQ C;  5JVD F;  3E6M A;  1UHS A;  1JE8 A;  3AG2 H;  2UUC H;  2W24 A;  1MNE A;  3FXU A;  1FYM A;  4ZTJ A;  4X65 H;  5FPO A;  3U54 A;  4M73 A;  5LHI A;  3S16 J;  4NC6 A;  4YHH H;  5IPA A;  1LDK B;  4P5O A;  4BXX J;  4YP3 A;  4Q8E A;  2IBD A;  3IRQ A;  3PL8 A;  2ICW G;  3D5R C;  1JGG A;  1IRF A;  2MGQ A;  2W57 A;  4II2 A;  4IO9 F;  3RR5 A;  3P9I A;  3H3V K;  1UG0 A;  3GWZ A;  2KL4 A;  5JUM A;  5EGO B;  4D5F A;  1VQO I;  3K0L A;  1B33 N;  3MZH A;  4AYB E;  1F36 A;  2EB7 A;  3CJQ B;  2QB5 A;  4E6N A;  2V9V A;  5DS9 A;  4MFE A;  2HHH H;  1V4R A;  5KG1 A;  3VDX A;  3ECO A;  3F8F A;  4ASN A;  3RBE A;  1E4F T;  1S7E A;  2BY3 A;  2M7A A;  2EA2 A;  2W1O A;  3LSG A;  2DAB A;  1WH2 A;  3CO6 C;  4DUY H;  4FBT A;  3T5K A;  4O86 A;  1RES A;  1WSU A;  1JKQ C;  2HDC A;  4M0J A;  2FOW A;  4RB1 A;  4F4Y A;  5FNV F;  3TY8 A;  2C2R A;  1IRZ A;  2JA7 J;  4A3E J;  1MKM A;  5CVU A;  2XCA A;  3RQ4 A;  3H9Q A;  4Y15 A;  3ASO H;  1O7F A;  1IOW A;  5C3E J;  3AG3 H;  1QGP A;  2DMN A;  3UQ8 A;  4CYC A;  5BWW A;  3I3L A;  2P5L C;  4IJA A;  4Q48 A;  3L2R A;  1HBX G;  5I5Y A;  1BI3 A;  4AD9 A;  2TRT A;  1I3Q J;  3OY9 A;  1ZET A;  2P6S A;  3KP6 A;  5FLX Z;  2FB9 A;  2OQR A;  2GLT A;  2FK3 A;  4AM3 A;  3BA9 A;  1HQC A;  2YU3 A;  2NS0 A;  3LQQ A;  3GUD A;  1Y1W J;  1D0X A;  2WBM A;  2GPS A;  3KAL A;  3GFJ A;  1HXD A;  1U6G A;  1IN5 A;  1W5T A;  4RGS A;  3QYE A;  1WR2 A;  2XGC A;  4DV2 H;  1VS0 A;  1LEB A;  3TGN A;  2DI3 A;  1ZKG A;  5E17 F;  3V8L A;  4I4T F;  3NWS A;  4O7W A;  1VZ0 A;  3C2G A;  4BXX G;  1N32 H;  5FD6 A;  1JKJ B;  4BXU A;  4CMF A;  4BY7 J;  3ZMS A;  5F08 A;  1HKQ A;  1QVU A;  3BTJ A;  2HGW A;  2Q2E A;  5IP7 J;  5LGN A;  2HZD A;  1G4D A;  2XPU A;  2V1U A;  1M0T A;  4O83 A;  3T7A A;  2KHM A;  2VJ5 A;  2FPI B;  1XGO A;  3UZB A;  2BQR A;  3TO6 A;  5JI6 A;  3MKY B;  3OYJ A;  3BJY A;  2JVH A;  3I0T A;  2DTZ A;  1EJ9 A;  5B66 C;  3L4K A;  3IKT A;  3L4J A;  2UVW A;  2FBI A;  2UUB H;  2HVS A;  2HIX A;  3H40 A;  4G7O F;  4MIM A;  2HFH A;  3PR5 B;  1E0E A;  4BKX A;  3IWF A;  3JTH A;  3LFU A;  1O3Q A;  5HLT A;  4KMF A;  1T36 A;  4XOT A;  1E4G T;  2EZH A;  4NUB A;  3I5U A;  1OCT C;  2R87 A;  2C22 A;  1X1P A;  3E6B A;  5L1I A;  4JI3 H;  1X19 A;  2E60 A;  4HPQ A;  3OOP A;  4EFB A;  2UUZ A;  4IX7 A;  5HNH A;  2NNY A;  3KYC B;  2CQX A;  5EG0 B;  3ROU A;  3VYR B;  4EBE A;  2ID3 A;  1D5Y A;  4IQJ A;  1HF0 A;  2RGR A;  5K1Y A;  3J7Y J;  2H8W A;  2FK1 A;  2FMA A;  3BCA A;  1IUY A;  1RJR A;  5KNL A;  1YJN I;  2ZGI A;  3ASN H;  4O3M A;  2OBP A;  4ED8 A;  2R93 G;  1UHM A;  3GO5 A;  3KXY T;  4NQW A;  4E7K A;  3I54 A;  5IY5 H;  1FJG H;  2DPD A;  1YW8 A;  2VUM A;  3DU6 A;  1U9N A;  3WU1 B;  1Y1W G;  5FLV A;  1SEU A;  4ZYG A;  1ULY A;  1LDJ A;  2DPU A;  2XAF A;  2COB A;  4N0B A;  4ZYH A;  4RS8 A;  2R5Z A;  2YX4 A;  1WJA A;  2FP4 B;  3FKI A;  4TQR A;  2FBH A;  1MMA A;  4OIR F;  5BNG A;  4UY8 I;  1I1L A;  3HSE A;  2Z16 A;  1RJP A;  2HGX A;  4UFZ A;  4AIH A;  2V9P A;  5DG7 A;  4EGZ A;  1QRY A;  1B72 A;  4BU2 A;  2ZDG A;  4HDV A;  2Z99 A;  5FR9 A;  2NVX A;  4HF2 A;  1CF7 B;  2DWC A;  4HG2 A;  2HTJ A;  4A2U A;  2IT0 A;  3RB4 A;  5JQG F;  2CRG A;  5FLX K;  2CJJ A;  2UZK A;  3COA C;  1JJ6 C;  3TKY A;  2XPW A;  4KDP A;  1T33 A;  1MBJ A;  1HW1 A;  6PAX A;  5BWT A;  5D8D A;  4BY1 G;  1HNZ H;  2RNJ A;  2DA1 A;  4JX5 A;  2BR0 A;  5KFF A;  5ERI A;  3W6J B;  3WTW C;  3BQ1 A;  3CUQ C;  1I39 A;  2H6B A;  1J5E H;  2OCC H;  4L9T A;  3SZT A;  1K78 A;  1REP C;  2JSC A;  4D1Q A;  5GPA A;  1J7K A;  1TWG A;  3KTM A;  3QQA A;  3PIP F;  5F0C A;  2I10 A;  3KYL A;  2QSG X;  5KG6 A;  2UU9 H;  1V51 A;  1RYR A;  3NGD A;  3NRV A;  2O7O A;  5E3M A;  1AUV A;  2M87 A;  1GGO A;  3RFC A;  2RDJ A;  5I5W A;  4X66 H;  5LYJ F;  1JUM A;  2D1H A;  1O7L A;  4XR6 A;  4LF5 H;  4B43 A;  1FP1 D;  3RYP A;  2ZJP F;  3QP6 A;  5L3F A;  2PBZ A;  4KHP H;  5DEQ A;  3VPR A;  5IOZ A;  1XK5 A;  3I53 A;  2DLL A;  3WHB A;  2R7W A;  1BJA A;  4I02 A;  2R93 A;  3BTL A;  4CCM A;  2KIU A;  4IOC F;  2Y0M A;  4XLA A;  5IOY A;  1OYI A;  1AA7 A;  2IVM A;  1LVA A;  1C3O A;  4DL5 A;  1UMQ A;  1U8R A;  5KFO A;  1XG1 A;  2OUM A;  4JX4 A;  4BE0 A;  2C2D A;  2L3D A;  2MG4 A;  1EKV A;  4ECX A;  3G71 I;  1P9Q C;  3H92 A;  4J9M A;  2K4B A;  2WA0 A;  1I1S A;  4LF4 H;  2PBI A;  2X85 A;  2ABJ A;  3MN2 A;  4QIW E;  1KQ9 A;  5BWV A;  3MFK A;  1Z6T A;  4JI1 H;  2AXL A;  2M1B A;  4PDB A;  3IH3 A;  4IRK A;  1A04 A;  1Y1V A;  1PYV A;  2R7T A;  2QGU A;  4NNJ A;  4NB5 A;  4RAF A;  2R7X A;  2X1C A;  4RUA A;  1ZK8 A;  1JLL B;  2DQR A;  4IVN A;  4P96 A;  4ZJZ A;  3IG0 A;  3WOD F;  1G3S A;  4CCN A;  3JZF A;  4YRV A;  1Q1V A;  1JUP A;  4JI2 H;  3BAB A;  3BJ6 A;  3KHH A;  5DMX A;  2LY2 A;  1KU3 A;  4WXH A;  4CHU A;  3V7C A;  1KEE A;  4O7T A;  2DA6 A;  4DV0 H;  2HGC A;  4GGG A;  2HU9 A;  3U9G A;  3LQR A;  4RLQ A;  1D1A A;  3GTQ J;  1FMW A;  2DJN A;  3V4Z A;  5IYB J;  4E7L A;  2W25 A;  2TDX A;  1BI0 A;  1ETY A;  1I27 A;  3S1N J;  1LEA A;  2GQS A;  3QRF F;  2E5Z A;  1O75 A;  3JTG A;  2KJC A;  2W8L A;  3E5N A;  3SI8 A;  1S9H A;  2R0Q C;  3WU0 A;  3CCS I;  4BE1 A;  2X6W A;  2WC2 A;  5LP6 F;  3E1S A;  4ED2 A;  4ME6 A;  3TW7 A;  3J80 W;  2L0K A;  4MTE A;  3NBZ B;  3LAJ A;  4ENM A;  1GVD A;  4MV1 A;  2ZM6 H;  4EBD A;  1FYL A;  4PZJ A;  2VR1 A;  2CH0 A;  1FVI A;  4Q47 A;  2F2E A;  4IXA A;  4M9S A;  4P1W A;  4CYD A;  2XKP A;  4LLL A;  1IOV A;  2ZXH A;  2HDD A;  2QQA A;  1LKX A;  4HOB A;  3RV3 A;  3PW5 A;  2V4J C;  2O0Y A;  1TNT A;  2IXS A;  3P9C A;  3X2Q H;  2DFH A;  1XX5 A;  4WHX A;  1I7L A;  4LF9 H;  4XRF A;  4D9J A;  2P8T A;  1ZQ7 A;  4YFX F;  3M8E A;  5J1R A;  3LOC A;  2X48 A;  3PUB A;  4IR1 A;  2KZV A;  2HHF A;  4U0W A;  2Z33 A;  2CMP A;  2YX7 A;  2UUA H;  2CS3 A;  2Q0O A;  1UCR A;  5D4R A;  3ABK H;  3CMM A;  3JRC A;  2ACJ A;  4BGD A;  5JLW A;  1AKH B;  1B6S A;  4O7N A;  1TWF A;  4IRD A;  2LRE A;  1GSO A;  3IRR A;  4ABZ A;  4C5A A;  4MHG A;  4LSA A;  2IP4 A;  5A2Q Z;  2R8H A;  1P8L A;  4ED1 A;  2ZJQ F;  4BY7 G;  3VNN A;  4XL9 A;  1K6Y A;  1PDN C;  1PX2 A;  2VPQ A;  1I7N A;  4B3M H;  1E17 A;  1RIO H;  2ZNY A;  1D5V A;  4EGY A;  2OC6 A;  2R3S A;  1ZH5 A;  4QWC A;  2VIX A;  2V79 A;  4ED7 A;  3ABT A;  5DCM B;  4EEF G;  1UNN C;  2KSW A;  1IZ1 A;  2NOG A;  1IV8 A;  2EIJ H;  3M4I A;  5KG2 A;  3GB8 B;  1ENH A;  1A48 A;  1I3A A;  1J0R A;  4IHV A;  4BY1 J;  5KFI A;  2KIM A;  2RRE A;  4DR3 H;  4FX0 A;  2VBY A;  4O5V A;  3OYI A;  3BAA A;  1XCV A;  2FMY A;  4BEH B;  4F50 A;  4GCV A;  3GIJ A;  3CP8 A;  3L9F A;  3K70 D;  1VQM I;  4NXN H;  2VT3 A;  1B6A A;  4D7N A;  2R7O A;  1NTC A;  1EZ1 A;  3TL4 X;  4PDK A;  2MC4 A;  1AN7 A;  5KVR A;  4DL3 A;  3FBN B;  3ESW B;  4CKB A;  5C1O A;  1GV2 A;  3RJP A;  5GPC A;  2CV2 A;  4ENJ A;  3I12 A;  1EH7 A;  4XRM A;  3GW2 A;  1ZN2 A;  4HNV A;  3WO1 A;  2J6T A;  2FXA A;  1UZC A;  2ZDH A;  4A3L J;  3ZOB A;  2A5W A;  2DA2 A;  2R93 J;  3G73 A;  4LB6 B;  4OMY A;  3HOY G;  4FE2 A;  5LL6 b;  2PMZ N;  4J9Q A;  2IPQ X;  2MH9 A;  3V8K A;  1F1Z A;  4MV9 A;  4A3E G;  3K4B A;  4RZQ A;  4ZZD A;  1MW7 A;  2DTR A;  5KFP A;  5DGH A;  3KP3 A;  2JA7 A;  2K4J A;  3HGG A;  2Y0S N;  4GXO A;  5CVV A;  5L3C A;  5IT9 W;  2HQA A;  3O8G A;  4FAS D;  5E20 A;  4B44 A;  1HCR A;  3S93 A;  3NC0 B;  2CNU A;  4HBL A;  4ESJ A;  1N78 A;  1M1E B;  2YL2 A;  3E3V A;  5D8L B;  3LSK A;  2Z9O A;  2Y0S E;  4DYR A;  1XMQ H;  5AIP A;  2EH3 A;  4ENK A;  2DFF A;  3N43 B;  4O7Y A;  2FJZ A;  4RZR A;  2KRH A;  2DAO A;  4U6P A;  2K27 A;  1SD6 A;  4APM A;  5IP9 G;  5DLG A;  2G7H A;  3J7A Y;  1XSV A;  4HA8 A;  1Z3Y A;  4IF4 A;  5CLS A;  1KTA A;  3ZQL A;  5ICF A;  2Y48 A;  1XSD A;  3NBY B;  3BDD A;  1YE9 A;  2IS4 A;  4DL7 A;  3DQV C;  3W2V A;  4EJV A;  3JRG A;  1BW6 A;  3R61 A;  3TW6 A;  1ETV A;  4CIC A;  1ETX A;  1I1K A;  2VI6 A;  1T95 A;  1Z7U A;  3F8M A;  2JA8 G;  2BY1 A;  3M7G A;  5C8Y F;  3CCJ I;  3CUQ B;  2F5D A;  3IAS 2;  1YIO A;  4IOA F;  1KON A;  2XF7 A;  4RCN A;  3Q8R B;  4J01 A;  3MFH A;  2WE6 A;  2EZL A;  1FOW A;  1QNT A;  1LPQ A;  2Y75 A;  2H6C A;  4C3I J;  1SD4 A;  1T56 A;  5LMN H;  5BWU A;  2DAA A;  3BQ0 A;  4HNT A;  3BCB A;  1P7I A;  5GON F;  4JQF A;  2XD4 A;  3V4S A;  1BOA A;  1B8I B;  1IN7 A;  5GAH J;  4LK1 F;  5EWE A;  1N77 A;  1X1D A;  1TTY A;  1MGT A;  3JRI A;  3MKZ A;  2R84 A;  4PZ7 A;  4AIJ A;  1JXL A;  3MR3 A;  3LSJ A;  3PO3 G;  3BR3 A;  3ISP A;  1U78 A;  4KUM A;  4O4I F;  2ASD A;  1FNN A;  2VQG A;  4PGH A;  4GLW A;  1RK5 A;  5HOO A;  4AC0 A;  4DUZ H;  2J5O A;  2JA6 A;  1BIA A;  2E1N A;  2KKO A;  1ZGJ A;  4NZO A;  4RM2 A;  4HLX A;  3U0G A;  1S0M A;  4PJL A;  3V7R A;  4F4Z A;  4C2M A;  2HS5 A;  2PMZ A;  4ECV A;  4LFU A;  3WTS C;  1C0W A;  4F52 A;  5JHF A;  4B1R A;  3M9A A;  4MGR A;  5HLH A;  5JVG F;  4PJJ A;  5IP9 J;  4UUS B;  3K1N A;  1ETQ A;  3T9F A;  2W7O A;  1MMD A;  3RSN A;  5KFN A;  4BDY A;  2EIL H;  2YS9 A;  2B7E A;  2MW8 A;  4ECU A;  3WO0 A;  4G9Y A;  4PZ6 A;  1UHW A;  3RB6 A;  2K86 A;  1DP3 A;  2E5L H;  3ZMV A;  2KIF A;  3LSR A;  2HVQ A;  3FXQ A;  2K40 A;  1VKZ A;  4NLG A;  1ZGA A;  3M07 A;  2QCO A;  3R0A A;  1S5L C;  4J00 A;  5KHD A;  5JFR A;  5LEJ A;  1DPU A;  4M9Z A;  3RB0 A;  1TLH B;  1MMS A;  5BWX A;  4XSZ F;  3H20 A;  2YU9 A;  1K7A A;  2YRW A;  2ZDQ A;  1KJQ A;  5BYB A;  3GTO A;  4FFR A;  1WRV A;  3KIO A;  4J9N A;  5EEA A;  4YJ2 F;  2GXB A;  1IYD A;  3B73 A;  2Q2E B;  4MLO A;  4UCS A;  1XDS A;  1YW9 A;  3LQS A;  2M0M A;  4UCR A;  5EYR A;  1S72 I;  4DL6 A;  2EIY A;  1IW7 F;  5DGA A;  2MH2 A;  4M71 A;  3FXO A;  3CCE I;  5CAE B;  2R85 A;  2NXN B;  1WJF A;  2OQG A;  1P4A A;  2VXZ A;  2NUA B;  1FY7 A;  3SJM A;  2V26 A;  3A0B C;  1FIA A;  3MD2 A;  1UC8 A;  3NAR A;  1ZG1 A;  3PW2 A;  3CP2 A;  4A3M J;  3J7A K;  3VPD A;  2FF4 A;  3DPU A;  3OIQ A;  4ZYE A;  3ERE D;  3QAH A;  5IYD J;  4FBU A;  2CQN A;  3D1N I;  3RKX A;  2W6O A;  3OIP A;  1V3F A;  5E1Z B;  2HG8 A;  4RDU A;  3I59 A;  3GTL A;  1B4A A;  2X1D A;  4HX7 A;  2E2J J;  2FKL A;  4I99 C;  5KFK A;  4RBO A;  3BQY A;  3RKQ A;  4CKC A;  4JK1 X;  5ILS A;  1SYX B;  5KFY A;  5KT5 A;  1FZP B;  3H0D A;  4F4X A;  2JUG A;  5C44 J;  2E2I A;  4S04 A;  4DIM A;  1TT0 A;  1DV2 A;  2DOD A;  2XB5 A;  4IL6 C;  1LE8 A;  3S3N A;  3BJO A;  2ZME A;  2HIV A;  2VC1 A;  2E7W A;  1W4M A;  2HI3 A;  3BA8 A;  2C35 B;  4H4K C;  2COJ A;  4E6K G;  4DR2 H;  2VBX A;  5HLI A;  2CG4 A;  4DV3 H;  3LA3 A;  3ZMT A;  3CMY A;  5KS8 A;  1V5F A;  1Q1H A;  4KN7 X;  2V4R A;  2QSH X;  3O6B B;  3S2H J;  1OWT A;  2YWV A;  2PMH A;  2RQP A;  1YJW I;  4MV8 A;  4A3K G;  1ZRD A;  1O3T A;  4R8U A;  4I50 F;  1RKT A;  2DYR H;  3RDI A;  5B3S H;  4DYC A;  3N6R A;  1CS0 A;  3DTG A;  1SC7 A;  2Z02 A;  3TQN A;  3CQZ A;  1JTY A;  4DGW B;  3H3V H;  1NHA A;  2A05 A;  1UG2 A;  4KT5 C;  4RNN A;  3PN1 A;  1B59 A;  4Q4Z F;  1MZB A;  2NNN A;  5KT6 A;  2LNB A;  3TED A;  4A0Y A;  3OTO H;  3RAX A;  2ZO4 A;  3MFI A;  4I0B A;  5KFD A;  1CQI B;  3S3O A;  4DYQ A;  2GXA A;  2JA5 J;  3L2Q A;  4CSW A;  3ECH A;  1GXQ A;  1MH3 A;  3EUH C;  4F7Z A;  4MAM A;  3LMM A;  2W70 A;  4M7E A;  4EM1 A;  2Y9Y A;  3CSW A;  1OCZ H;  3VB2 A;  2A61 A;  3FHZ A;  3HRT A;  1Y39 A;  1MMG A;  3QFF A;  5F9N A;  5KG7 A;  3K1P A;  5D1P A;  2MCT A;  3GIL A;  2XGD A;  1EV7 A;  4BBR J;  4BJ6 C;  1XN7 A;  5M3M J;  2LYC A;  3RPU D;  5DUK A;  5KFV A;  4X62 H;  2LY1 A;  3HC7 A;  4LGW A;  1ODD A;  5L3E A;  5HLG A;  3EPZ A;  4ZDL A;  2Y4R A;  5E8G A;  5FKN A;  4UCU A;  4XSX F;  3GLK A;  1M6V A;  3OYN A;  4EEQ A;  2R7L A;  4EM0 B;  2W82 A;  2PX9 A;  3JRB A;  5CQG A;  3GTJ J;  1BI1 A;  4OOI A;  2M0C A;  5CVR A;  2PLY A;  3UYY A;  1K1S A;  2W4S A;  5L1K A;  2W6N A;  3I4N J;  1I94 H;  3PFI A;  1GSH A;  3T9C A;  2LBF B;  2BW3 B;  4CGZ A;  2Z2S B;  3DEU A;  2L7M P;  5FKL A;  2QQ8 A;  3VWB A;  4KFC A;  2XAJ A;  3F6O A;  4A0Z A;  4IHT A;  1KA8 A;  3PQK A;  4XN0 A;  1U3E M;  4O3P A;  3HUG B;  4MNU A;  4YBZ B;  2L9S A;  3GCM A;  4O7R A;  1U5T C;  2C6Y A;  1ETK A;  4M3E A;  3ZR8 X;  2A3S A;  4BQN A;  5LA6 F;  5IYC J;  1EKE A;  1AUX A;  1HOM A;  1E3P A;  1S7A A;  3S1R J;  5I5U A;  1W1W E;  1TC3 C;  1WH5 A;  3EQL F;  2OZ6 A;  4A3C J;  3KZI C;  4K0K H;  3FM5 A;  4M6V A;  1X2N A;  3OR1 C;  4V2F A;  4L9J A;  4RAG A;  1ZRC A;  2H94 A;  1F9N A;  4XYM B;  4B3R H;  2XF6 A;  1WCM A;  4JI4 H;  4J19 A;  2ZKZ A;  3K5I A;  2E35 A;  4CYC B;  1CKN A;  4HNU A;  5J6X A;  2QVO A;  2B63 G;  2WAD A;  3IL2 A;  4Y3O A;  1X3W B;  3L2W A;  3Q9S A;  3G6E I;  4A3G G;  2VB6 A;  1YO5 C;  4C5C A;  5J1U A;  1R5H A;  2M4K A;  5I5X A;  1JIH A;  1R49 A;  2H8R A;  4FQG A;  2LD5 A;  4UNO A;  4A2B A;  2LKX A;  1QHG A;  4XKB A;  2HXI A;  3CMA I;  3LSH A;  1IV6 A;  2EZK A;  4DQN A;  5HNF A;  2R7Z J;  3KLO A;  4ZQI A;  5JR3 A;  3FF5 A;  3FMR A;  2E1O A;  5IYZ F;  3GF2 A;  4ZI7 F;  3I71 A;  1UJ8 A;  2DK5 A;  1VF9 A;  2WY8 Q;  2YW2 A;  2MD0 A;  3IH2 A;  4CC5 A;  2WAQ A;  3N97 A;  4V19 K;  2HOS A;  3R23 A;  2F4I A;  4I6Z A;  4OIQ F;  3TP0 A;  5KT4 A;  4LD5 A;  4C30 A;  5TRD A;  3AG4 H;  3CTA A;  4I01 A;  1WI3 A;  3ZGK A;  4NXM H;  1MJA A;  3VYS B;  2XKO A;  4RB3 C;  2PI0 A;  3V7S A;  2PJR B;  4FE7 A;  5CB4 F;  4NDL A;  2EV5 A;  3OR2 C;  1IUF A;  2W6Q A;  3OUZ A;  2DT6 A;  2FOK A;  5KFH A;  5J47 A;  1RR8 C;  1TWH A;  2VOB A;  3H5N A;  3KEO A;  2W84 A;  2IGM A;  1YRN A;  2OF7 A;  1SFK A;  3JCU C;  4IQ4 A;  3CC4 I;  1FOY A;  1W5C C;  1WI9 A;  2RV8 A;  4OIN F;  5DM7 F;  4PJM A;  4LSX A;  4ECZ A;  4NHJ A;  1MBH A;  1RC9 A;  3MCZ A;  1OCO H;  3ZQH A;  4EVI A;  1VQP I;  1XPX A;  3GID A;  2KIS A;  3ONQ A;  1CKM A;  3CVZ A;  5DQI A;  2A6H F;  2LTP A;  1BJT A;  2EPF A;  2KJB A;  3HXL A;  4L5E A;  2E5N A;  3JSL A;  2LC2 A;  3K10 A;  1EF4 A;  3QPT A;  2DCE A;  2B63 J;  3UFX B;  1WWX A;  1FPQ A;  2V6C A;  3K4M A;  3M1C A;  4B48 A;  4M9U A;  4RNO A;  3N8D A;  1F43 A;  2R7N A;  4DBQ A;  1HNX H;  4A3G J;  1TW2 A;  1WKM A;  2OJE D;  3FWE A;  2H1L A;  5FO5 A;  2JRT A;  2QBY B;  4KIC A;  4KMU X;  1LFU P;  4WXD A;  1Z7L A;  4O7Z A;  1DDN A;  2NU8 B;  3K3V A;  1SFX A;  4WWC A;  1KU7 A;  3G8C A;  3OSN A;  4HYE A;  3L2V A;  3T8R A;  3KHG A;  2VBW A;  3BZK A;  1AWC A;  1KJ9 A;  1RYS A;  2JEI A;  2GPW A;  2DMU A;  5JLX A;  3VPC A;  4TUY F;  3CUO A;  4DNC A;  1MIJ A;  1SMT A;  3LSP A;  3L2P A;  2M45 A;  5LBQ A;  3EET A;  3GBG A;  4TQS A;  1HR0 H;  1FIP A;  3VPB A;  3BRO A;  1EUC B;  4BBR G;  3HKZ A;  5KAF C;  2WAQ E;  4UHT A;  3AL0 B;  2Y9Z A;  1LJ9 A;  4UUG A;  2VL8 A;  3R6S A;  3ZN0 A;  4WBN F;  4A12 A;  2RNG A;  4GLX A;  4A3I G;  4PFO A;  2Q7D A;  2XDV A;  3PSI A;  4YY3 H;  4AIK A;  3RQI A;  1R23 A;  4G12 A;  1ZG5 A;  1S97 A;  2V58 A;  5IT9 K;  4LJZ F;  5HDG A;  1XDN A;  2CW7 A;  5FJ8 G;  4YG2 F;  1WJC A;  2ZBK A;  4O4L F;  3Q3S A;  4UUV A;  2P0W A;  4E7J A;  5E1X A;  3T9E A;  4HEA 2;  3BG9 A;  4HF1 A;  1IAW A;  3JZ6 A;  2RF4 A;  4XLE A;  4GC7 A;  1O3R A;  1B6R A;  2QKL B;  1JKP C;  1HW2 A;  4HZF A;  2PVP A;  4A93 G;  3E6C C;  2OTJ I;  3FDS A;  4DLK A;  3HOV J;  1FTT A;  2DN0 A;  4G6T B;  3GII A;  4BWS C;  2LRD A;  2V1X A;  3C2H A;  3WTU C;  1DUX C;  3U55 A;  1IXS B;  4BDZ A;  1ZR2 A;  1JT0 A;  4I55 F;  1GXP A;  2COG A;  3PO2 G;  5BPH A;  4IIJ F;  3BOQ A;  2FQ3 A;  3S1M J;  5DM6 F;  4O7V A;  4BHB A;  1ZHS A;  2ALZ A;  4GRI A;  2R8I A;  2VOP A;  5DTD A;  3H0G A;  4DAA A;  3K4N A;  3KCC A;  1WPK A;  4ECW A;  2IAI A;  4DR6 H;  3CJN A;  2JA6 J;  2OU2 A;  3UZO A;  3VSL A;  2GA1 A;  4IR9 A;  2UXD H;  4UCV A;  2XRN A;  3LNQ A;  2HQ5 A;  2ZSI B;  4KIG A;  1VQL I;  2XV4 S;  3FKJ A;  3HHG A;  4QSH A;  4HQM A;  3F0C A;  2FJ1 A;  1KU2 A;  2YZL A;  1FX7 A;  2JEG A;  1YIT I;  2R6F A;  2A68 F;  4X1E A;  4KNY A;  1KJ8 A;  2VQE H;  2ZME C;  1JI8 A;  3JRD A;  1MD0 A;  5FFX A;  4DZP A;  3L2C A;  3RI4 A;  4Q4D A;  4JI8 H;  4WK8 F;  3DCF A;  2CYY A;  3Q8P B;  1W0U A;  4DL4 A;  4II3 A;  2IGO A;  1WHU A;  2F5V A;  3EDP A;  4CCO A;  4FU0 A;  4N9I A;  1VAJ A;  3IP4 B;  1TWC J;  1G2W A;  3O3K A;  1HLV A;  1I1M A;  3RJ0 A;  3Q0U A;  1VQ9 I;  3ETJ A;  1FJL A;  4V2G A;  4JI5 H;  4ECT A;  4UCO A;  1YW7 A;  2LH9 A;  2GOM A;  2CKZ B;  2M34 A;  4F91 B;  1ZHF A;  2DO7 A;  4S05 A;  3I64 A;  5BYA A;  1GYF A;  3H1C A;  2L4A A;  4QW8 A;  3SGI A;  2IEK A;  2QEN A;  4ESF A;  1YJ9 I;  4FX4 A;  2EJ2 A;  1V54 H;  2EQR A;  4UVC A;  3GDE A;  2RDI A;  4ECS A;  1SMY F;  1WH7 A;  2NVY J;  2FML A;  1EYZ A;  1W96 A;  4FFM A;  3RIZ A;  5H6Q A;  5BMZ A;  3R0J A;  5L9X A;  3T8T A;  4U7B A;  2MD5 A;  2O6G E;  3CCL I;  3GME A;  3CDH A;  2HOA A;  2WY7 Q;  2BXZ A;  2K9L A;  2KRC A;  1R1T A;  3MMY B;  1L3L A;  4ZDP A;  3NAU A;  3R4K A;  3SZP A;  3A0H C;  1TP4 A;  4AYB N;  5B1A H;  3FMQ A;  3J81 K;  3OUU A;  2DDB A;  2HDK A;  1R4N B;  1VQ5 I;  1MH4 A;  3L00 A;  2Q2T A;  4ZZL A;  1UEL B;  2YS7 A;  4KJZ A;  3OHB A;  1RKW A;  4OWR B;  4ED6 A;  5EDN A;  3ZN1 A;  2NS8 A;  4BYY A;  4TV9 F;  5L1L A;  3HTU A;  2R7K A;  3PW7 A;  2BHZ A;  4O3O A;  4HAM A;  2KT0 A;  3QP5 A;  2LR8 A;  1B04 A;  3D5L A;  4RNM A;  1HKT A;  2ZXI A;  4Q8F A;  1T0F A;  2FLN A;  3SDB A;  1ORK A;  4WXC A;  4AID A;  4IRH A;  5M5X J;  3VOE A;  3J7Z I;  1W36 C;  5DQG A;  3WWJ A;  2DA4 A;  4KIB A;  1XS9 A;  1VTN C;  2LKP A;  2G7U A;  2XGX A;  2DFE A;  2HOE A;  2HKO A;  3BR0 A;  3RPU A;  3ELK A;  3BTI A;  2R92 J;  4CCL A;  3C7J A;  3DU5 A;  3KYH C;  5FB2 A;  5IP6 A;  4EQQ A;  2BBY A;  2STW A;  4CKE A;  1MDM B;  1F5T A;  1DU6 A;  2L7F P;  4L1K A;  5LGU A;  1ET0 A;  3W6V A;  4OMZ A;  4TVI A;  2YU9 J;  3T5H A;  1SAN A;  1ACI A;  3T9B A;  4M6X A;  2OWO A;  5GTI C;  3DFG A;  1NK3 P;  2D2W A;  3TII A;  1FKA H;  2HYJ A;  4A3D G;  2NAZ A;  5IP7 G;  3K9T A;  4LMY A;  3REO A;  1R5G A;  2QF7 A;  3HPG A;  4M3G A;  4XLF A;  5ILU A;  3TQT A;  3MZ8 A;  2DPJ A;  2VOD A;  4B09 A;  4QWB A;  3CES A;  1PP8 F;  3BPV A;  1R00 A;  2X9D A;  1Z67 A;  3K2Z A;  1S10 A;  4BQO A;  4BQA A;  1OKR A;  4A3I J;  1NH3 A;  2M2E A;  4XON A;  3JSN A;  1QZY A;  2JJ7 A;  2IJL A;  2STT A;  3OYL A;  3OMY A;  5F04 A;  1I50 A;  4QLC U;  1Z1D A;  3FXJ A;  5HS8 A;  1VQ7 I;  1JHF A;  3I59 B;  4FHT A;  3CJR B;  1QPM A;  3L09 A;  2V5A A;  1KQ0 A;  5HS7 A;  5J2U F;  3I58 A;  3VOT A;  4F3Q A;  1FOK A;  3E5X A;  2EBI A;  1S6L A;  2QM3 A;  2XAQ A;  2W00 A;  5KAI C;  2R7S A;  3RTX A;  2WDT A;  5EJC A;  1OCP A;  3ERM A;  1T0F C;  2KRF A;  2IGK A;  1YYV A;  2JTV A;  3U1D A;  4A3J J;  3K69 A;  1R36 A;  4U7D A;  5GAG J;  2D45 A;  4MEX F;  3DPT A;  1AHD P;  4J9L A;  4C2M J;  2W85 A;  4FET A;  2MC3 A;  4GO1 A;  4ZDO A;  3WWH A;  5I5T A;  2ISZ A;  1D8K A;  1IGN A;  3JAM W;  4CDG A;  5K5O A;  3TIG A;  3DEE A;  3PO2 J;  5J40 A;  2Y31 A;  3TDZ C;  2KQR A;  1GLN A;  4JBA A;  4C9Y A;  2M8G X;  3UKG A;  2B9S A;  2W9C A;  2PEX A;  2XAH A;  3LML A;  1IN6 A;  3KAK A;  1K83 A;  4IRI A;  4XOR A;  1E4E B;  4YII A;  3J81 Z;  2R8G A;  1ONV A;  1XD7 A;  3V4G A;  3W5O A;  1GSA A;  2R92 G;  2GA2 A;  3JRF A;  4DV7 H;  3U9S A;  3K70 C;  4A6E A;  3F72 A;  2K9M A;  3PQJ A;  2XCL A;  3N44 B;  4LB5 A;  4AUX A;  2BEO A;  3M8J A;  2F4M B;  3OYE A;  1SFO J;  2BYV E;  3WTV C;  5BS6 A;  2DXI A;  3F8C A;  1DQU A;  1Y14 B;  1Z6R A;  4G3I A;  5EOY A;  5CM0 A;  3Q8Q B;  2IW5 A;  1CKO A;  2IGN A;  5CE8 A;  4P55 A;  2E1M C;  3U2R A;  1FOX A;  2XRO A;  3KP5 A;  1T2K A;  5DG8 A;  3OSG A;  3T1Y H;  1N25 A;  1CGP A;  2DOA A;  1PK8 A;  4OX9 H;  2MLG A;  4HLY A;  3H3Z A;  1BGW A;  5D5V B;  2M7B A;  4E7I A;  3KPH A;  5HDK A;  4CXF A;  4FS1 A;  2DYS H;  1ZHQ A;  3Q1K A;  3MZY A;  4EBC A;  1BI2 A;  3TEK A;  3NQO A;  2VKH A;  1WQ2 A;  4KT6 A;  3V6J A;  3LSI A;  1KT8 A;  2GAU A;  3ABU A;  1P4X A;  3VYU B;  3CO7 C;  2UVU A;  4QPO A;  1AU7 A;  2CW0 F;  2RDP A;  2P81 A;  3F3X A;  2CNQ A;  2X5R A;  3BR5 A;  3HPH A;  1MJ9 A;  2HVR A;  3RKY A;  3HSR A;  4BHC A;  3L1P A;  3T54 A;  5KT2 A;  2VQF H;  4YFN F;  2QSF X;  2K3P A;  2I8D A;  1STZ A;  1TA8 A;  4FE4 A;  4IHJ F;  3K5H A;  2HYG D;  2CNV A;  1G3W A;  4GKK H;  3ZMU A;  3MEX A;  3S1Q J;  1B8I A;  4D0P A;  2R7Q A;  1ZRE A;  2PG4 A;  2GM4 A;  1A6Q A;  2LBF A;  2FX0 A;  1J09 A;  4OU0 A;  2FPP B;  4LF7 H;  5H20 A;  2O8X A;  1JGS A;  3RUP A;  5A2Q K;  2LSO A;  2Y69 H;  3I55 I;  1E3O C;  1ZGW A;  2CZG A;  2M4G A;  1V4Y A;  2AGP A;  1TQP A;  1D8J A;  1GDT A;  2ESH A;  5KFB A;  5IWA H;  4L5J A;  1IBM H;  3CEB A;  2YRX A;  5HV6 A;  4B47 A;  1R4M B;  4EV0 A;  2CQY A;  3QOD A;  4DOZ A;  1A35 A;  4ZTF A;  1HDD C;  2W71 A;  2R92 A;  1U5T A;  3FKI J;  2HEO A;  4XYL B;  1OFC X;  2V9W A;  4O3Q A;  4Q4C A;  5HOD A;  2JK3 A;  2L2O A;  2CUF A;  3GV8 B;  1DPR A;  3C2B A;  5EEG A;  3QU3 A;  1ZLK A;  2XCP A;  4U0V A;  2VPS A;  1ITY A;  3ZMD A;  2VE8 A;  1OBD A;  2HWV A;  1XC5 A;  3OYF A;  1IRX A;  3ZQG A;  2ODT X;  1MBE A;  3MWD A;  3TQ1 A;  1V5G A;  2VUG A;  3H0G G;  2XB0 X;  3PW4 A;  4L18 B;  4BNC A;  5L3G A;  4JXU A;  5D5W B;  2ELH A;  2Y2Z A;  2EK5 A;  4Y52 J;  2TCT A;  3S8P A;  2XAS A;  1T98 A;  5J4Y A;  4EGJ A;  1HA8 A;  2VON A;  1TWA A;  3K4C A;  3H36 A;  1BOB A;  1R22 A;  4RGU A;  1BC8 C;  2VJJ A;  1OQY A;  2WAE A;  3T1H H;  2L9R A;  2CQ7 A;  2EJR A;  5EG0 A;  1Z77 A;  1JUS A;  3MR2 A;  1MMN A;  4NBQ A;  3ZPL A;  1GVJ A;  3CLQ A;  4A3B G;  2JN6 A;  1SEI A;  3E6D A;  5F0H A;  1QVT A;  5FJ8 J;  3HGY A;  1JHH A;  3M8F A;  1E3H A;  4EM2 A;  4Q5S F;  4LG0 A;  2HNH A;  2ZJR F;  4WF2 A;  5B1B H;  4X0G A;  1OCC H;  4LG3 A;  3N4M A;  3DTF A;  3T0Y A;  5KFT A;  3RBD A;  2VA3 A;  4B8X A;  3O8H A;  4I76 A;  3OYB A;  2Z3Y A;  2CGP A;  1TNS A;  2WTF A;  5CA0 F;  4A93 J;  1VQN I;  1RZ4 A;  2P7V B;  2R4G A;  3HOS A;  5LGT A;  4GYG A;  1LQ1 A;  3AG1 H;  1YX3 A;  2WB1 A;  1VQ6 I;  3GIP A;  2OA4 A;  4B3A A;  4NC7 A;  2L9V A;  3S2D J;  3SNO A;  1UST A;  4KN4 X;  2B0L A;  1X3U A;  3VOD A;  4I2O A;  1ZEL A;  2OPT A;  4FFN A;  3FKI G;  3H5A A;  2A6T A;  1RR7 A;  2DA5 A;  3ZCO A;  3ZQC A;  4HN2 A;  2F5C A;  1CF7 A;  5KKN B;  2JA6 G;  2EJ3 A;  5CPR B;  2X6O A;  2VC0 A;  3WU2 C;  1LVK A;  1LUJ B;  2E1M B;  3VYT B;  1ON2 A;  2EA4 A;  1SFE A;  2NYX A;  1R9T J;  4FFP A;  3TMO A;  3T99 A;  1T3N A;  4G7H F;  5EWF A;  3OYK A;  2P7C B;  4ENN A;  4YEL A;  5LFA A;  2YPR A;  3CD6 I;  1BN5 A;  2NU7 B;  2J6S A;  4XLH A;  5LD2 C;  3QYF A;  2F5E A;  2UXX A;  3JRX A;  3BLY A;  4UCT A;  5KFA A;  3G6X A;  1S9F A;  4B3S H;  3D0S A;  3O2P E;  1Z9C A;  3ZQI A;  1ON1 A;  3G6V A;  4DR5 H;  2O61 A;  2ELK A;  4O3S A;  4EJT A;  3HDD A;  5GAD J;  1Y8Q B;  1YG2 A;  2L4M A;  2R82 A;  4XN3 A;  3DAA A;  5BMV F;  2NS7 A;  3WTY C;  3HOX J;  1CQT A;  2Q2U A;  4J9K A;  2VAS A;  2ZJ2 A;  3BWG A;  4CMD A;  2MSY A;  4A0X A;  1FTZ A;  4YIR X;  2R5Z B;  3IHU A;  2VJ4 A;  4F4W A;  5M5Y J;  2DZD A;  1DU0 A;  3BTC A;  5D6F A;  1GO3 E;  1D0Z A;  2JQ7 A;  4YFK F;  4QJF A;  1XMX A;  1FSE A;  1R6R A;  2X6Y A;  3E5Q A;  1R7J A;  2X51 A;  2LF7 A;  2QUF A;  2RQQ A;  2X0S A;  2M3A A;  2NVQ J;  4PWQ A;  2J5P A;  1PP7 U;  2X4H A;  1MSE C;  1P2F A;  5FLM G;  2XPV A;  3FIW A;  3CME I;  4B4C A;  5HS9 A;  5D4S A;  3MWE A;  3K4L A;  1T6S A;  2E2H J;  4C3H J;  3J80 Z;  4EJO A;  3IAM 2;  4IHX A;  4DJA A;  2KP6 A;  1X3Z B;  2PN1 A;  1KC7 A;  4LF8 H;  3IC7 A;  3QOP A;  5CVI A;  5D5X B;  5FRM A;  3CUQ A;  2V6E A;  3IKV A;  2XSJ C;  4UV9 A;  2DMT A;  1TWF J;  3E0J B;  5LHH A;  4Y8V B;  4AVZ A;  5KG4 A;  4PCQ A;  2K5C A;  1RJQ A;  4DR1 H;  1TWC A;  2JEF A;  4A69 C;  2YZM A;  2JA7 G;  1OMI A;  2IA1 A;  1XSX A;  1TQI A;  4F55 A;  5DV5 A;  1VBG A;  4FFO A;  1D1B A;  3PFY A;  2WB1 N;  3KEQ A;  2OH2 A;  2QZ8 A;  1OYW A;  3K4K A;  5HDN A;  3IN5 A;  4JYK A;  4K2E A;  2C00 A;  3RZD J;  1Z3X A;  4PBC A;  3RZO J;  2XHK A;  4FM9 A;  3GTM A;  2GZW A;  4HV5 A;  3DF7 A;  1ZR4 A;  2BOL A;  2QWW A;  1YTY A;  2K9S A;  1H8A C;  3B02 A;  3HEF A;  3HT5 A;  5KFM A;  2WB1 E;  3PJR A;  4E7S A;  2HZT A;  1HC8 A;  1BNC A;  3KEY A;  1TQM A;  4ANJ A;  4L0Z B;  5EGO A;  1RPW A;  2RVC A;  5D1O A;  2FNP A;  3JRH A;  1SFU A;  4AWX B;  1DV1 A;  1OBG A;  4DZJ A;  2L54 A;  3DTI A;  3BG7 A;  4YIF A;  3CCY A;  2XRL A;  2ZFW A;  2M8E A;  3EUA A;  3RTR A;  2ZXW H;  2DDA A;  4Q44 A;  5L3D A;  4NC8 A;  3KP7 A;  5TGT A;  2P0A A;  1IO2 A;  3KAJ A;  1EH6 A;  2CUJ A;  5CVJ A;  1O4X A;  1CKN B;  3QPL A;  1EHI A;  5F6F A;  4DW6 A;  3OYM A;  2R7D A;  3OSF A;  1VQ4 I;  1IN8 A;  1OPC A;  1XGS A;  2ETH A;  3WTT C;  1QA6 A;  5C4X J;  4CE5 A;  2IA6 A;  4RLF A;  3DF8 A;  1KQ8 A;  4IRG A;  5CYV A;  4CCK A;  4C5B A;  4EJU A;  3W1B A;  1PVE A;  5EEH A;  3FDY A;  4HV6 A;  1XNQ H;  3W2W A;  1JJ8 C;  2AGO A;  1FC3 A;  2V59 A;  5LXT F;  3VA7 A;  1K61 A;  3F8B A;  3T9D A;  3R5X A;  3OIO A;  2W6M A;  2XF5 A;  5DUI A;  2KDZ A;  5EDW A;  3GIQ A;  1Y1V J;  2XIG A;  1I6X A;  3Q0V A;  3LAP A;  4N4O B;  3MAJ A;  1DGS A;  2ZNZ A;  5KFU A;  5FKK A;  3GZ5 A;  4BXF A;  3M9M B;  2XAG A;  2X6X A;  3H4B A;  3UR3 C;  4A3L G;  2C28 A;  3I56 I;  3FBI B;  4JP0 A;  4QW9 A;  4PFP A;  3VSK A;  4OAY A;  1S0N A;  3BZC A;  1KU9 A;  2K3F A;  2NU6 B;  1MNM C;  3DLL F;  4WX9 A;  2VLA A;  2CFO A;  1M0W A;  4XID A;  3CCQ I;  3R9R A;  5IT9 Z;  1FP2 A;  2EFO A;  2XUB A;  3MWM A;  3A2K A;  3AKZ A;  1FBQ A;  1KYW A;  4IHS A;  2XGQ A;  2EIN H;  3CDI A;  1I6H J;  4J0M A;  4O84 A;  1FLI A;  2PMU A;  2UVR A;  3HOT A;  5GAE J;  1Y56 A;  3RPQ A;  5JVT A;  1Y0U A;  1BA5 A;  4NYE A;  5DQH A;  5ICC A;  4FCY A;  1FYK A;  4JV0 A;  2Q1Z B;  3PNT A;  4XNF A;  4DV1 H; 
#chains in the Genus database with same CATH homology
 4DR6 H;  4KIT B;  3H9G A;  1LFP A;  1U0J A;  2NOJ B;  3VSL A;  3S32 A;  1W36 D;  3A4C A;  2UXD H;  4UCV A;  1BR4 A;  2OC6 A;  2ZSI B;  2R7U A;  4XQF A;  2VIX A;  3FKJ A;  2VXD A;  3SZG A;  2KSW A;  4F93 B;  3M4I A;  3I9V 2;  2ELJ A;  3GB8 B;  4CUG A;  2VQE H;  2IS1 A;  2V9K A;  5CQE A;  3W1G A;  1JI8 A;  3BG6 A;  4CH7 A;  2RRE A;  1S68 A;  2VPL A;  2WYO A;  3F8N A;  4DR3 H;  4JI8 H;  2CV1 A;  3OYI A;  3BAA A;  2IS2 A;  4BEH B;  3N42 B;  4MV7 A;  1WFX A;  3V42 A;  4II3 A;  3CP8 A;  4YEJ A;  2IGO A;  3K70 D;  1YX5 A;  2F5V A;  3UNG C;  2OV7 A;  4CCO A;  4DIQ A;  1Z2N X;  4NXN H;  2R7O A;  3IP4 B;  1QHH D;  1BR1 A;  3TL4 X;  4X64 H;  2MC4 A;  1AN7 A;  3RJ0 A;  3OS1 A;  3FBN B;  4R79 A;  3CZ6 A;  4NQW B;  4PK4 A;  3HG9 A;  3SEQ A;  4UCO A;  4JI5 H;  2LH9 A;  2CV2 A;  2GOM A;  4F91 B;  3RGZ A;  2O5R A;  3HL2 A;  1IBL H;  4AYB A;  1X1B A;  2HPM A;  1GYF A;  2DT7 B;  4XKW A;  1V9P A;  1BR2 A;  2A5W A;  3OYH A;  1NG6 A;  3GDE A;  4LH7 A;  1WJ5 A;  5LL6 b;  3QOE A;  3J81 W;  3RIZ A;  1IBK H;  2MYS A;  4MV9 A;  4LFA H;  4ETS A;  3K4B A;  4RZQ A;  4U7B A;  1MW7 A;  3H35 A;  2MAB A;  2WY7 Q;  2K9L A;  1Z21 A;  1X9N A;  4JYA H;  2KRC A;  1Y6I A;  3MMY B;  4LFB H;  5IT9 W;  4ZDP A;  2HQA A;  4FAS D;  3N6X A;  4IAJ A;  3OYC A;  3DKY A;  4B44 A;  3S93 A;  3NC0 B;  1OLT A;  2XAU A;  1N78 A;  4LFC H;  3OL3 A;  4N4N B;  2R7V A;  2Q2T A;  1UEL B;  4KJZ A;  4OWR B;  3LSK A;  5A2Q W;  4EAT A;  1XMQ H;  2VQC A;  3IUO A;  3N43 B;  1B04 A;  3D5L A;  2VJI A;  2ZXI A;  2KRH A;  3SDB A;  4HRI A;  2F6C A;  4APM A;  1W36 C;  4CZC A;  4XKC A;  3J7A Y;  1Z3Y A;  3AL0 C;  4XKV A;  3NBY B;  2BVL A;  1YE9 A;  4CCL A;  2IS4 A;  3DQV C;  3DU5 A;  3W2V A;  3KYH C;  2X1E A;  4PUS A;  4U87 A;  2Z1D A;  1D1C A;  1T95 A;  2PJR A;  3OS2 A;  5LMU H;  3IAS 2;  1KON A;  2LG4 A;  2XF7 A;  1Z2O X;  4DR7 H;  4J01 A;  2WE6 A;  3RF2 A;  3DTK A;  2OWO A;  4BJT A;  3OL4 A;  1FKA H;  5LMN H;  1L2Z A;  4BS9 A;  4HNT A;  2YCH A;  3BCB A;  2WAF A;  4LMY A;  3HPG A;  4XLF A;  4JQF A;  3L2U A;  3AFH A;  2XC7 A;  3CES A;  3S24 A;  4IKF A;  3PNY A;  4E7H A;  2R7R A;  1WJB A;  4BQO A;  4BAC A;  3W3C A;  1X1D A;  3MKZ A;  1N77 A;  4PZ7 A;  4XON A;  3JSN A;  1UAA A;  4DV6 H;  3RGX A;  2DJI A;  3OYG A;  3OYL A;  3OMY A;  4XM3 A;  2HDW A;  4LIU A;  5DIS C;  4E4H A;  3OYA A;  4CCJ A;  3CJR B;  2VQG A;  5HOO A;  2ZSH B;  4BL0 B;  3MKW B;  2FUG 2;  4F3Q A;  4DUZ H;  3G2B A;  3D5S C;  3OOU A;  2W00 A;  2R7S A;  4AU7 A;  3RTX A;  2WDT A;  2AQE A;  2KPM A;  1T0F C;  2IGK A;  4RM2 A;  4PJL A;  2KMU A;  1N36 H;  4DV5 H;  2PMZ A;  3DPT A;  4FET A;  1K6Y A;  3W2A A;  4ZDO A;  2F4V H;  3JAM W;  4F52 A;  5JHF A;  1N34 H;  5CKT A;  4Q0Y A;  3DEE A;  2Y0S A;  1SAU A;  2KQR A;  1GLN A;  4C9Y A;  4PJJ A;  4BQQ A;  3TBI A;  2KLO A;  3LML A;  1MMD A;  4XLC A;  3KAK A;  3RSN A;  4XOR A;  4BDY A;  3QWU A;  2MFZ A;  5BR8 H;  4JV5 H;  1X4P A;  3W5O A;  4PZ6 A;  3DPL C;  4CC6 A;  2UXC H;  1DP3 A;  3GJX B;  1OR7 C;  1NG7 A;  1Z2P X;  3K70 C;  2AQF A;  4DV7 H;  2E5L H;  4AQY H;  2HVQ A;  2K9M A;  2VQL A;  3FMA A;  3N44 B;  2UWM A;  3M8J A;  3F9K A;  3OYE A;  3LL7 A;  3RCO A;  2DXI A;  4J00 A;  5KHD A;  1X1C A;  2JA2 A;  1DQU A;  2O03 A;  3H20 A;  5EOY A;  3NWT A;  4RAY A;  2HGS A;  4C2U A;  2IGN A;  1CKO A;  2E1M C;  4EFE A;  4RM3 A;  3T1Y H;  3OS0 A;  2DOA A;  4OX9 H;  2Q2E B;  4MLO A;  4UCS A;  4PZ8 A;  1BGW A;  1DGR M;  2M7B A;  5HVQ C;  4E7I A;  2M0M A;  1HNW H;  4UCR A;  1ZHQ A;  2UUC H;  2V7F A;  1MNE A;  1D0Y A;  4DRF A;  4ZTJ A;  4X65 H;  1XNR H;  5FPO A;  2VKH A;  3DWL E;  4KT6 A;  3LSI A;  3CF2 A;  4YHH H;  1LDK B;  4P5O A;  3VYU B;  1WJF A;  4QPO A;  2VXZ A;  3PL8 A;  1WJE A;  3D5R C;  3RR5 A;  4A2A A;  4II2 A;  2V26 A;  2W57 A;  4MTD A;  1UG0 A;  3HPH A;  2HVR A;  2KL4 A;  3MD2 A;  4B3M H;  4HST A;  4PJN A;  3CP2 A;  5FRN A;  3J7A K;  2VQF H;  3DPU A;  2K3P A;  3OIQ A;  2I8D A;  1TA8 A;  3CJQ B;  4E6N A;  3OIP A;  3OWT A;  4GKK H;  2HHH H;  3VDX A;  2X1D A;  2R7Q A;  4RB0 A;  1E4F T;  3LSG A;  2W1O A;  2M7A A;  1WH2 A;  4DUY H;  2LBF A;  1J09 A;  4LF7 H;  1SYX B;  1TZL A;  3H0D A;  2JUG A;  3ZRG A;  1TT0 A;  2M4G A;  4RB1 A;  3TY8 A;  2ZFU A;  3S3N A;  5IWA H;  2HIV A;  4BEH A;  1IBM H;  3BA8 A;  3RQ4 A;  4B47 A;  4H4K C;  3H9Q A;  4XMY A;  3EUK L;  4E6K G;  3FHN A;  3QOD A;  4HSR A;  4DOZ A;  4ZTF A;  4KIS A;  4DR2 H;  3UQ8 A;  3I3L A;  4DV3 H;  3L2R A;  4B3T H;  1V5F A;  2L2O A;  1N75 A;  3OY9 A;  3BA9 A;  2VPS A;  1D0X A;  2WBM A;  3KAL A;  3DTE A;  1FMV A;  2KDO A;  3SEZ A;  3QYE A;  3H9J A;  3OYF A;  4DV2 H;  1IRX A;  1TAE A;  1VS0 A;  4DGW B;  1V5G A;  2VUG A;  3PN1 A;  3NWS A;  1MZB A;  4IZZ A;  4GKJ H;  1VZ0 A;  3C2G A;  3S8P A;  3OTO H;  3U21 A;  4JI0 H;  5FD6 A;  1N32 H;  1HA8 A;  3K4C A;  1BOB A;  2VJJ A;  3S3O A;  2HZD A;  1M0T A;  3L2Q A;  4CSW A;  4R7R A;  2JSP A;  2KHM A;  2VJ5 A;  2WAE A;  1MND A;  3EUH C;  3T1H H;  2UXB H;  1N33 H;  3K6G A;  3MKY B;  3LMM A;  1MMN A;  3OYJ A;  4M7E A;  2JVH A;  3L4J A;  3L4K A;  1ERD A;  1MMG A;  1SEI A;  4BE2 A;  2UUB H;  2BW3 A;  2HVS A;  2HIX A;  5D1P A;  4BJ6 C;  2MCT A;  2HNH A;  3LSM A;  4X0G A;  4LG3 A;  2LYC A;  3RPU D;  4X62 H;  2LY1 A;  1E0E A;  3HC7 A;  3LFU A;  5HLT A;  4E7Z A;  1E4G T;  4XOT A;  3OYB A;  3EPZ A;  4ZDL A;  4NUB A;  2CUZ A;  4RAZ A;  4JI6 H;  2CFM A;  4UCU A;  4JI3 H;  1X19 A;  2E60 A;  4HPQ A;  4EFB A;  3PNV A;  2UUZ A;  4IX7 A;  5HNH A;  3OYN A;  3S3M A;  4EEQ A;  2R4G A;  3HOS A;  2W82 A;  1P16 A;  1YX3 A;  2WB1 A;  5CQG A;  3VYR B;  4NC7 A;  4IQJ A;  2W4S A;  2RGR A;  1I94 H;  3OYD A;  4Y33 A;  2LBF B;  2BW3 B;  3SYT A;  1ZEL A;  2Z2S B;  1X4O A;  3BCA A;  3VWB A;  3H5A A;  2A6T A;  3ZCO A;  2LOO A;  5KNL A;  5CPR B;  1LVK A;  4XN0 A;  1WJD A;  2E1M B;  3VYT B;  3KXY T;  4PSX A;  3HUG B;  4E7K A;  1FJG H;  4LF6 H;  2L9S A;  3TMO A;  3DU6 A;  3ZR8 X;  3OYK A;  4BQN A;  4YEL A;  5LFA A;  4XLH A;  5LD2 C;  3QYF A;  4UCT A;  3BLY A;  1PJR A;  1WJA A;  4B3S H;  1MMA A;  2Z16 A;  4K0K H;  4UFZ A;  3QYB A;  5D1O B;  4BUP A;  3OR1 C;  4BU2 A;  4DR5 H;  4B3R H;  4BJ5 C;  2XF6 A;  4JI4 H;  4HG2 A;  3H5R A;  1CKN A;  4HNU A;  4Y4R A;  4XN3 A;  2WAD A;  2Q2U A;  4XOP A;  4Y3O A;  4DBR A;  3L2W A;  2VAS A;  1A0I A;  1HNZ H;  2VB6 A;  2VKD A;  4DR4 H;  3N41 B;  4B3X A;  2VJ4 A;  2M4K A;  4DV4 H;  1D0Z A;  4A2B A;  1QHG A;  1R6R A;  4XKB A;  2X6Y A;  3ZXS A;  1J5E H;  2RQQ A;  2X51 A;  3LSH A;  4D1Q A;  1EA3 A;  2M3A A;  5HNF A;  3KYL A;  2UU9 H;  5FRO A;  1QU3 A;  5FPR A;  1I6U A;  2WY8 Q;  2MD0 A;  4CC5 A;  3K4L A;  2RGV A;  2WAQ A;  1DGW Y;  4X66 H;  2F4I A;  2JVG A;  3N05 A;  3IAM 2;  4C30 A;  4DJA A;  2KP6 A;  4NXM H;  3ZGK A;  4LF8 H;  4XR6 A;  3VYS B;  4RB3 C;  2PJR B;  4B43 A;  4LF5 H;  4RB2 C;  4KHP H;  5FRM A;  3OR2 C;  2V6E A;  4JI7 H;  1XK5 A;  2XSJ C;  2DT6 A;  3E0J B;  2R7W A;  4AVZ A;  4DR1 H;  4CA0 A;  2K5C A;  3A1Y A;  4RMN A;  4CCM A;  4EQ5 A;  3H5N A;  2VOB A;  2L9N A;  4XLA A;  2IGM A;  1AA7 A;  4IQ4 A;  1SFK A;  4ZYA A;  2OUM A;  3PSF A;  4F55 A;  4BE0 A;  4PJM A;  4LSX A;  1D1B A;  3PFY A;  1P9Q C;  3ONQ A;  1CKM A;  3CVZ A;  3DKX A;  3K4K A;  3C0F B;  2WA0 A;  1BJT A;  4LF4 H;  3HXL A;  2X85 A;  2E5N A;  3JSL A;  1Z3X A;  2LC2 A;  4FM9 A;  3K10 A;  4JI1 H;  3DF7 A;  4PDB A;  2BOL A;  2DCE A;  3DLA A;  4C2T A;  1PYV A;  2UV1 A;  3K4M A;  3M1C A;  4B48 A;  4NNJ A;  4ITV A;  4E7S A;  3PJR A;  3KEY A;  4ANJ A;  2R7T A;  3TY5 A;  2R7X A;  2X1C A;  4DBQ A;  1HNX H;  4F92 B;  3IG0 A;  5D1O A;  4ZJZ A;  4CCN A;  2GOX B;  4YRV A;  1X1A A;  4JI2 H;  3BAB A;  1Z7L A;  3DTI A;  2LY2 A;  2L7K A;  3K3V A;  3BG7 A;  4LIV A;  4DV0 H;  1V5E A;  3EUA A;  2ZJT A;  2HU9 A;  3RTR A;  4RLQ A;  1D1A A;  3L2V A;  1FMW A;  1XMO H;  2V1N A;  4NC8 A;  5FLX W;  5TGT A;  4E7L A;  3KAJ A;  3KX2 A;  2CUJ A;  2E5Z A;  1CKN B;  1O75 A;  3OYM A;  3L2P A;  1S9H A;  4PSW A;  3GBG A;  1HR0 H;  4RLF A;  4BE1 A;  4CCK A;  2X6W A;  3HKZ A;  1S03 G;  3E1S A;  3AL0 B;  3J80 W;  3W1B A;  2HPI A;  2QKM B;  2VL8 A;  3FDY A;  1XNQ H;  3W2W A;  2RNG A;  4JOM A;  4QPQ A;  3NBZ B;  4GLX A;  4MTE A;  4PFO A;  2FE3 A;  2ZM6 H;  4OAZ A;  2XDV A;  3PSI A;  4LIT A;  2CW8 A;  4I7H A;  4YY3 H;  2XF5 A;  2CH0 A;  1FVI A;  2XIG A;  1XDN A;  2CW7 A;  4N4O B;  4P1W A;  1DGS A;  5KCM A;  4BXF A;  2VQH A;  1WJC A;  2X6X A;  2ZXH A;  4ZC3 A;  1LKX A;  2BVM A;  3UR3 C;  2L5Q A;  2V4J C;  2P0W A;  3BC8 A;  4E7J A;  1G8X A;  3FBI B;  2IXS A;  4HEA 2;  4PFP A;  3VSK A;  4OAY A;  4XLE A;  2QKL B;  3ZQQ A;  2IS6 A;  4LF9 H;  3N40 P;  2VLA A;  2CFO A;  4D9J A;  1M0W A;  1G59 A;  4G6T B;  3MWM A;  4BWS C;  3PUB A;  2LRD A;  2KZV A;  3C2H A;  3AKZ A;  3A2K A;  4BDZ A;  2CMP A;  3K4J A;  2UUA H;  2CS3 A;  4LH6 A;  4J0M A;  1ZHS A;  3CMM A;  3EYY A;  5FD5 A;  4BGD A;  3HOT A;  4GRI A;  2LRE A;  2W7N A;  1Y56 A;  4LSA A;  2CV0 A;  3TY9 A;  1P8L A;  3VNN A;  4XL9 A;  3K4N A;  2Q1Z B;  3PNT A;  4XNF A;  4DV1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...