5CE8A

Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
296
structure length
296
Chain Sequence
b'SMKVWLDGRLVDEEEAKVTVLSPSLNYGFGVFEGIRAYWNGENLYVFRLRDHMERLLRSAKIIGLDVPYTAEELSKAVVETVRANGFKEDLYIRPVAYISKPQISLDVRGLQASVAIAAIPFGKYLKVEGVRAAVVSWRRVHTSMMPVMAKATGIYLNSIMAAVEARARGYDEAIMLNAEGKVVEGSGENIFIVRRGVLMTPPLEDGILEGITRETVISIAGDLGIPLLEKSITREELYAADEAFFVGTAAEITPIIEIDGRVLQRGPITQKIAETYRRIVLGKEEKYLPWLTPVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Branched-chain amino acid aminotransferase
publication title First structure of archaeal branched-chain amino acid aminotransferase from Thermoproteus uzoniensis specific for L-amino acids and R-amines.
pubmed doi rcsb
source organism Thermoproteus uzoniensis (strain 768-20)
molecule tags Transferase
total genus 94
structure length 296
sequence length 296
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 5ce8A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 5ce8A01
4CE5A 1G2WA 5HNEA 2COIA 1I2LA 5I5XA 5BWWA 3CEBA 2HHFA 1KT8A 3LQSA 2EIYA 5CR5A 1A3GA 2HHFB 5I5WA 4CMFA 5DAAA 4DQNA 5I5YA 2A1HA 1IYEA 2EJ2A 1IYDA 3LULA 2COJA 4TM5A 5BWTA 2HGWA 1I1KA 3JZ6A 5I60A 5BWRA 2COGA 1KTAA 3UZOA 4K6NA 1EKPA 4CMDA 4JXUA 2HDKA 4M0JA 4WHXA 3SNOA 5I5TA 3QQMA 1EKVA 4CHIA 5CE8A 3UYYA 3UZBA 1WRVA 3U0GA 2ZGIA 4UUGA 3WWJA 5I5VA 1ET0A 1DAAA 1I2KA 2HG8A 5BWUA 3DTFA 5E25A 1I1LA 4TVIA 5CM0A 4DAAA 2DABA 2ABJA 2Y4RA 5BWXA 2EJ3A 3DTGA 3WWHA 5BWVA 5K3WA 2EJ0A 1I1MA 1EKFA 5I5SA 2HGXA 3CSWA 2DAAA 1A0GA 3WWIA 5I5UA 4PBCA 3HT5A 5FR9A 3DAAA
chains in the Genus database with same CATH superfamily
1I2LA 2J9GA 4YJ2F 3KAKA 2NU6B 1OBGA 1AUVA 4HNVA 5J2TF 1A0IA 1EUCB 1JDEA 5LA6F 4C5BA 2GQRA 3HB9A 2DZDA 2PVPA 5BPHA 1KUTA 1XDNA 4YAKB 4NYEA 2GPWA 5JVLA 2A1HA 1V9PA 3L2PA 4O4IF 2EJ2A 1PK8A 3NC0B 2NUAB 3NBZB 2COJA 1EHIA 1B04A 2YL2A 5BWTA 5I60A 3U54A 4XYLB 5BMVF 1KTAA 2HVQA 4RCNA 3R5XA 2Q2TA 4ME6A 4O7VA 4O7YA 3I12A 2GPSA 4DRFA 2QB5A 3G8CA 3VPBA 2VUGA 3JSNA 3Q1KA 4CKBA 5CA0F 1KJ9A 4IHJF 4JXUA 2HDKA 4CC5A 4UCTA 4MV4A 3R23A 2X0SA 3S24A 5FNVF 5FPRA 2CNUA 1Z2PX 5CE8A 1CQJB 3UYYA 4MV1A 3NBYB 4O82A 3T9AA 2DLNA 1AUXA 4O81A 2ZGIA 5I5VA 2ODTX 1CQIB 5H80A 3U9SA 5JQWA 1ET0A 1I7NA 2W6QA 2YZNA 4Q4DA 2Q7DA 5E25A 3VOTA 1I1LA 3U9TA 1JDBB 4DAAA 2DABA 2NU9B 5LP6F 3OUUA 2ZDQA 2I80A 1E4EA 2Q2UA 4O4JF 3T7AA 4Q4CA 2FB9A 5BWVA 5K3WA 1CKNA 4NZOA 1A0GA 3WWIA 5EZYF 5CA1F 2CNQA 4O7ZA 3K5IA 4DLKA 3UFXB 4IIJF 5JQGF 1UC9A 4CKEA 5HNEA 2COIA 5I5XA 1BNCA 1XK5A 3CEBA 2ZDGA 4XZ3B 3R9RA 1KT8A 3LQSA 2W6MA 4EGQA 2EIYA 1B6SA 3T99A 2HHFB 3QWUA 5BPFA 2V59A 4CMFA 2I87A 4QSHA 4NZMA 1KBLA 4EEQA 1KJIA 4GLXA 3W5OA 1C3OA 3JRXA 5IYZF 4FFOA 1IYEA 4O2BF 2OWOA 4CKCA 2X5RA 5KS8A 4TM5A 3MWEA 3K3PA 4I55F 4ZI7F 3KYHC 4RZQA 2V5AA 4FFPA 5K2MA 2VPQA 3PN1A 1X9NA 2YZLA 1B6RA 3WNZA 3RR5A 3JZ6A 5DGIA 2WYOA 3Q2OA 2YRXA 5BYBA 1KEEA 3BA8A 3R5FA 3TQTA 4M0JA 3HBLA 4FFNA 2HIXA 5I5TA 1KC7A 3QQMA 3GJXB 2XD4A 1M0TA 2QK4A 5CAEB 3T54A 1VBHA 5JH7F 3UZBA 1WRVA 3U0GA 4FFRA 4EGJA 4UUGA 3WO0A 1DAAA 1I2KA 2HG8A 3AW8A 3UQ8A 1BXRA 5D1OB 4WBNF 1S68A 2PBZA 4YBZB 3KAJA 4LH7A 1ULZA 4IZOA 1GLVA 5DGHA 3SE7A 5KKNB 4MA0A 5I47A 3RTXA 5JVDF 3TY5A 2ABJA 2R7LA 5C8YF 4MV6A 2I8CA 3RV4A 2Z02A 1EYZA 3T9CA 4FGRA 4YB8B 2Y4RA 4Y8VB 4FFLA 3DF7A 3MJFA 3HO8A 2W6ZA 1PX2A 5GONF 3WO1A 1EKFA 5FPOA 1DV2A 1KJQA 2FPGB 3JZFA 4O7SA 5C1OA 3R5HA 4YJ3F 1CKOA 4MV8A 1DV1A 3HT5A 3RFCA 2FPPB 4MV7A 4IWXA 1JKJB 4LH6A 4CE5A 3N6RA 1TA8A 4E6NA 5BWWA 3JSLA 2CZGA 3T9BA 1T36A 1Z2NX 2SCUB 1TAEA 3TIIA 3BA9A 1FVIA 5CR5A 1CS0A 4NZNA 5I5WA 1P8LA 3T9EA 1M0WA 4I50F 4DQNA 5I5YA 4FE2A 4FU0A 4HQ6A 4ZOLF 5DISC 4O7TA 3TINA 3BAAA 5LXTF 1IYDA 3LULA 1A9XA 4I4TF 2HVRA 3TY8A 3VNNA 4PZ7A 2CFMA 1SCUB 2HVSA 3TY9A 2HGWA 1I1KA 1GSHA 5D1PA 1ZAUA 2COGA 4O2AF 3UZOA 4TV8F 4O84A 1EKPA 2FPIB 1DGSA 5C1PA 3W1BA 3LP8A 1WR2A 5LYJF 4CMDA 3MWDA 4WHXA 1GGOA 4O4HF 4TUYF 3U55A 3SNOA 2R87A 3VMMA 1EKVA 4CHIA 1DIKA 3VPDA 4C5CA 2HIVA 1IOVA 4PZ8A 1VKZA 2R7KA 4GLWA 4ZHQF 1W96A 3GDEA 4O83A 2HGSA 2R85A 4HR7A 2R86A 1W93A 1C30A 3ORQA 3TIGA 2FP4B 3KALA 3QFFA 1GSOA 3DTGA 3WWHA 1E4EB 3N8DA 3BABA 2EJ0A 1I1MA 5LOVF 5I5SA 5KX5F 2HGXA 1JLLB 3TW6A 4C5AA 3TEKA 5I5UA 1CKNB 4DIMA 4PBCA 5FR9A 3V4ZA 2R82A 2Z04A 2P0AA 3PFFA 2W71A 1G2WA 2XCLA 2HJWA 2C00A 2HHFA 2VQDA 3AX6A 2YZGA 3JZIA 2R7MA 4PZ6A 1A3GA 1EZ1A 4XYMB 3TW7A 5BYAA 5CB4F 1VS0A 4MA5A 4MAMA 3GLKA 4UCVA 5DAAA 4ZQIA 2W70A 2PN1A 1Z2OX 2YRWA 5HBRB 2R7NA 2CNVA 2VR1A 2R84A 1KJ8A 3BACA 4UCRA 3VPCA 4HNUA 2NU7B 4O86A 1M6VA 3KREA 2YWVA 4XX0B 4TV9F 5D8DA 2OLSA 3G8DA 1UC8A 3RV3A 3T9FA 4IWYA 1CKMA 1OBDA 4EFBA 3LWBA 4CC6A 5BWRA 2DIKA 2YS6A 4YAJB 3JRWA 1KJJA 2NU8B 4K6NA 3OUZA 5J2UF 3W1GA 1I7LA 3GIDA 4UCSA 2YYAA 4UFZA 2DWCA 3ORRA 3V4SA 4MV9A 3SGIA 4EG0A 4O7RA 2GLTA 2W6NA 1A48A 2GQSA 1EUDB 2IP4A 3ETHA 5D1OA 3WWJA 3T9DA 4O7WA 2YW2A 3K5HA 4L1KA 5BWUA 3DTFA 1VBGA 4UCOA 3VA7A 2YZMA 5HV6A 2ZDHA 3BG5A 5DMXA 4TVIA 2W6OA 4HNTA 4O7LA 5CM0A 3ETJA 3NUAA 4HN2A 4MV3A 2W6PA 4EQ5A 1P16A 1CE8A 1GSAA 5BWXA 2EJ3A 3GB8B 4FFMA 3RUPA 4EFEA 4E4TA 4O4LF 2QF7A 3CSWA 2DAAA 1IOWA 4M9UA 4O7NA 2V58A 3DAAA 4UCUA 3E5NA 2YS7A
chains in the Genus database with same CATH topology
4CKEA 4CE5A 1G2WA 5HNEA 2COIA 1I2LA 5I5XA 5BWWA 3CEBA 3T9BA 2HHFA 1KT8A 3LQSA 2EIYA 5CR5A 1A3GA 4NZNA 3T99A 2HHFB 5I5WA 3T9EA 3TW7A 5BYAA 4CMFA 4NZMA 5DAAA 4DQNA 5I5YA 2A1HA 3BACA 1IYEA 2EJ2A 1IYDA 4CKCA 3LULA 2X5RA 5KS8A 2COJA 4TM5A 1UC8A 5BWTA 3T9FA 4IWYA 5K2MA 2HGWA 1I1KA 3JZ6A 5I60A 1ZAUA 5BWRA 2COGA 1KTAA 5DGIA 3UZOA 4K6NA 4RCNA 1EKPA 2QB5A 4CKBA 5BYBA 4CMDA 4JXUA 2HDKA 4M0JA 4WHXA 3SGIA 3SNOA 5I5TA 3QQMA 1EKVA 4CHIA 3VPDA 3T54A 5CE8A 3UYYA 4GLWA 3UZBA 3T9AA 1WRVA 3U0GA 2ZGIA 4UUGA 3WWJA 5I5VA 2ODTX 3T9DA 1ET0A 1DAAA 1I2KA 2HG8A 4Q4DA 2Q7DA 5BWUA 3DTFA 5E25A 1I1LA 4TVIA 5DGHA 5I47A 5CM0A 4DAAA 2DABA 2ABJA 4HN2A 3T9CA 2Y4RA 5BWXA 2EJ3A 3T7AA 4Q4CA 3DTGA 3WWHA 5BWVA 5K3WA 2EJ0A 1I1MA 1EKFA 5I5SA 2HGXA 3CSWA 2DAAA 4NZOA 1A0GA 3WWIA 3TEKA 5I5UA 4PBCA 3HT5A 5FR9A 3DAAA 1UC9A 3PFFA 4IWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE5 A;  1G2W A;  5HNE A;  2COI A;  1I2L A;  5I5X A;  5BWW A;  3CEB A;  2HHF A;  1KT8 A;  3LQS A;  2EIY A;  5CR5 A;  1A3G A;  2HHF B;  5I5W A;  4CMF A;  5DAA A;  4DQN A;  5I5Y A;  2A1H A;  1IYE A;  2EJ2 A;  1IYD A;  3LUL A;  2COJ A;  4TM5 A;  5BWT A;  2HGW A;  1I1K A;  3JZ6 A;  5I60 A;  5BWR A;  2COG A;  1KTA A;  3UZO A;  4K6N A;  1EKP A;  4CMD A;  4JXU A;  2HDK A;  4M0J A;  4WHX A;  3SNO A;  5I5T A;  3QQM A;  1EKV A;  4CHI A;  5CE8 A;  3UYY A;  3UZB A;  1WRV A;  3U0G A;  2ZGI A;  4UUG A;  3WWJ A;  5I5V A;  1ET0 A;  1DAA A;  1I2K A;  2HG8 A;  5BWU A;  3DTF A;  5E25 A;  1I1L A;  4TVI A;  5CM0 A;  4DAA A;  2DAB A;  2ABJ A;  2Y4R A;  5BWX A;  2EJ3 A;  3DTG A;  3WWH A;  5BWV A;  5K3W A;  2EJ0 A;  1I1M A;  1EKF A;  5I5S A;  2HGX A;  3CSW A;  2DAA A;  1A0G A;  3WWI A;  5I5U A;  4PBC A;  3HT5 A;  5FR9 A;  3DAA A; 
#chains in the Genus database with same CATH topology
 1I2L A;  2J9G A;  4YJ2 F;  3KAK A;  2NU6 B;  1OBG A;  1AUV A;  4HNV A;  5J2T F;  1A0I A;  1EUC B;  1JDE A;  5LA6 F;  4C5B A;  2GQR A;  3HB9 A;  2DZD A;  2PVP A;  5BPH A;  1KUT A;  1XDN A;  4YAK B;  4NYE A;  2GPW A;  5JVL A;  2A1H A;  1V9P A;  3L2P A;  4O4I F;  2EJ2 A;  1PK8 A;  3NC0 B;  2NUA B;  3NBZ B;  2COJ A;  1EHI A;  1B04 A;  2YL2 A;  5BWT A;  5I60 A;  3U54 A;  4XYL B;  5BMV F;  1KTA A;  2HVQ A;  4RCN A;  3R5X A;  2Q2T A;  4ME6 A;  4O7V A;  4O7Y A;  3I12 A;  2GPS A;  4DRF A;  2QB5 A;  3G8C A;  3VPB A;  2VUG A;  3JSN A;  3Q1K A;  4CKB A;  5CA0 F;  1KJ9 A;  4IHJ F;  4JXU A;  2HDK A;  4CC5 A;  4UCT A;  4MV4 A;  3R23 A;  2X0S A;  3S24 A;  5FNV F;  5FPR A;  2CNU A;  1Z2P X;  5CE8 A;  1CQJ B;  3UYY A;  4MV1 A;  3NBY B;  4O82 A;  3T9A A;  2DLN A;  1AUX A;  4O81 A;  2ZGI A;  5I5V A;  2ODT X;  1CQI B;  5H80 A;  3U9S A;  5JQW A;  1ET0 A;  1I7N A;  2W6Q A;  2YZN A;  4Q4D A;  2Q7D A;  5E25 A;  3VOT A;  1I1L A;  3U9T A;  1JDB B;  4DAA A;  2DAB A;  2NU9 B;  5LP6 F;  3OUU A;  2ZDQ A;  2I80 A;  1E4E A;  2Q2U A;  4O4J F;  3T7A A;  4Q4C A;  2FB9 A;  5BWV A;  5K3W A;  1CKN A;  4NZO A;  1A0G A;  3WWI A;  5EZY F;  5CA1 F;  2CNQ A;  4O7Z A;  3K5I A;  4DLK A;  3UFX B;  4IIJ F;  5JQG F;  1UC9 A;  4CKE A;  5HNE A;  2COI A;  5I5X A;  1BNC A;  1XK5 A;  3CEB A;  2ZDG A;  4XZ3 B;  3R9R A;  1KT8 A;  3LQS A;  2W6M A;  4EGQ A;  2EIY A;  1B6S A;  3T99 A;  2HHF B;  3QWU A;  5BPF A;  2V59 A;  4CMF A;  2I87 A;  4QSH A;  4NZM A;  1KBL A;  4EEQ A;  1KJI A;  4GLX A;  3W5O A;  1C3O A;  3JRX A;  5IYZ F;  4FFO A;  1IYE A;  4O2B F;  2OWO A;  4CKC A;  2X5R A;  5KS8 A;  4TM5 A;  3MWE A;  3K3P A;  4I55 F;  4ZI7 F;  3KYH C;  4RZQ A;  2V5A A;  4FFP A;  5K2M A;  2VPQ A;  3PN1 A;  1X9N A;  2YZL A;  1B6R A;  3WNZ A;  3RR5 A;  3JZ6 A;  5DGI A;  2WYO A;  3Q2O A;  2YRX A;  5BYB A;  1KEE A;  3BA8 A;  3R5F A;  3TQT A;  4M0J A;  3HBL A;  4FFN A;  2HIX A;  5I5T A;  1KC7 A;  3QQM A;  3GJX B;  2XD4 A;  1M0T A;  2QK4 A;  5CAE B;  3T54 A;  1VBH A;  5JH7 F;  3UZB A;  1WRV A;  3U0G A;  4FFR A;  4EGJ A;  4UUG A;  3WO0 A;  1DAA A;  1I2K A;  2HG8 A;  3AW8 A;  3UQ8 A;  1BXR A;  5D1O B;  4WBN F;  1S68 A;  2PBZ A;  4YBZ B;  3KAJ A;  4LH7 A;  1ULZ A;  4IZO A;  1GLV A;  5DGH A;  3SE7 A;  5KKN B;  4MA0 A;  5I47 A;  3RTX A;  5JVD F;  3TY5 A;  2ABJ A;  2R7L A;  5C8Y F;  4MV6 A;  2I8C A;  3RV4 A;  2Z02 A;  1EYZ A;  3T9C A;  4FGR A;  4YB8 B;  2Y4R A;  4Y8V B;  4FFL A;  3DF7 A;  3MJF A;  3HO8 A;  2W6Z A;  1PX2 A;  5GON F;  3WO1 A;  1EKF A;  5FPO A;  1DV2 A;  1KJQ A;  2FPG B;  3JZF A;  4O7S A;  5C1O A;  3R5H A;  4YJ3 F;  1CKO A;  4MV8 A;  1DV1 A;  3HT5 A;  3RFC A;  2FPP B;  4MV7 A;  4IWX A;  1JKJ B;  4LH6 A;  4CE5 A;  3N6R A;  1TA8 A;  4E6N A;  5BWW A;  3JSL A;  2CZG A;  3T9B A;  1T36 A;  1Z2N X;  2SCU B;  1TAE A;  3TII A;  3BA9 A;  1FVI A;  5CR5 A;  1CS0 A;  4NZN A;  5I5W A;  1P8L A;  3T9E A;  1M0W A;  4I50 F;  4DQN A;  5I5Y A;  4FE2 A;  4FU0 A;  4HQ6 A;  4ZOL F;  5DIS C;  4O7T A;  3TIN A;  3BAA A;  5LXT F;  1IYD A;  3LUL A;  1A9X A;  4I4T F;  2HVR A;  3TY8 A;  3VNN A;  4PZ7 A;  2CFM A;  1SCU B;  2HVS A;  3TY9 A;  2HGW A;  1I1K A;  1GSH A;  5D1P A;  1ZAU A;  2COG A;  4O2A F;  3UZO A;  4TV8 F;  4O84 A;  1EKP A;  2FPI B;  1DGS A;  5C1P A;  3W1B A;  3LP8 A;  1WR2 A;  5LYJ F;  4CMD A;  3MWD A;  4WHX A;  1GGO A;  4O4H F;  4TUY F;  3U55 A;  3SNO A;  2R87 A;  3VMM A;  1EKV A;  4CHI A;  1DIK A;  3VPD A;  4C5C A;  2HIV A;  1IOV A;  4PZ8 A;  1VKZ A;  2R7K A;  4GLW A;  4ZHQ F;  1W96 A;  3GDE A;  4O83 A;  2HGS A;  2R85 A;  4HR7 A;  2R86 A;  1W93 A;  1C30 A;  3ORQ A;  3TIG A;  2FP4 B;  3KAL A;  3QFF A;  1GSO A;  3DTG A;  3WWH A;  1E4E B;  3N8D A;  3BAB A;  2EJ0 A;  1I1M A;  5LOV F;  5I5S A;  5KX5 F;  2HGX A;  1JLL B;  3TW6 A;  4C5A A;  3TEK A;  5I5U A;  1CKN B;  4DIM A;  4PBC A;  5FR9 A;  3V4Z A;  2R82 A;  2Z04 A;  2P0A A;  3PFF A;  2W71 A;  1G2W A;  2XCL A;  2HJW A;  2C00 A;  2HHF A;  2VQD A;  3AX6 A;  2YZG A;  3JZI A;  2R7M A;  4PZ6 A;  1A3G A;  1EZ1 A;  4XYM B;  3TW7 A;  5BYA A;  5CB4 F;  1VS0 A;  4MA5 A;  4MAM A;  3GLK A;  4UCV A;  5DAA A;  4ZQI A;  2W70 A;  2PN1 A;  1Z2O X;  2YRW A;  5HBR B;  2R7N A;  2CNV A;  2VR1 A;  2R84 A;  1KJ8 A;  3BAC A;  4UCR A;  3VPC A;  4HNU A;  2NU7 B;  4O86 A;  1M6V A;  3KRE A;  2YWV A;  4XX0 B;  4TV9 F;  5D8D A;  2OLS A;  3G8D A;  1UC8 A;  3RV3 A;  3T9F A;  4IWY A;  1CKM A;  1OBD A;  4EFB A;  3LWB A;  4CC6 A;  5BWR A;  2DIK A;  2YS6 A;  4YAJ B;  3JRW A;  1KJJ A;  2NU8 B;  4K6N A;  3OUZ A;  5J2U F;  3W1G A;  1I7L A;  3GID A;  4UCS A;  2YYA A;  4UFZ A;  2DWC A;  3ORR A;  3V4S A;  4MV9 A;  3SGI A;  4EG0 A;  4O7R A;  2GLT A;  2W6N A;  1A48 A;  2GQS A;  1EUD B;  2IP4 A;  3ETH A;  5D1O A;  3WWJ A;  3T9D A;  4O7W A;  2YW2 A;  3K5H A;  4L1K A;  5BWU A;  3DTF A;  1VBG A;  4UCO A;  3VA7 A;  2YZM A;  5HV6 A;  2ZDH A;  3BG5 A;  5DMX A;  4TVI A;  2W6O A;  4HNT A;  4O7L A;  5CM0 A;  3ETJ A;  3NUA A;  4HN2 A;  4MV3 A;  2W6P A;  4EQ5 A;  1P16 A;  1CE8 A;  1GSA A;  5BWX A;  2EJ3 A;  3GB8 B;  4FFM A;  3RUP A;  4EFE A;  4E4T A;  4O4L F;  2QF7 A;  3CSW A;  2DAA A;  1IOW A;  4M9U A;  4O7N A;  2V58 A;  3DAA A;  4UCU A;  3E5N A;  2YS7 A; 
#chains in the Genus database with same CATH homology
 4CKE A;  4CE5 A;  1G2W A;  5HNE A;  2COI A;  1I2L A;  5I5X A;  5BWW A;  3CEB A;  3T9B A;  2HHF A;  1KT8 A;  3LQS A;  2EIY A;  5CR5 A;  1A3G A;  4NZN A;  3T99 A;  2HHF B;  5I5W A;  3T9E A;  3TW7 A;  5BYA A;  4CMF A;  4NZM A;  5DAA A;  4DQN A;  5I5Y A;  2A1H A;  3BAC A;  1IYE A;  2EJ2 A;  1IYD A;  4CKC A;  3LUL A;  2X5R A;  5KS8 A;  2COJ A;  4TM5 A;  1UC8 A;  5BWT A;  3T9F A;  4IWY A;  5K2M A;  2HGW A;  1I1K A;  3JZ6 A;  5I60 A;  1ZAU A;  5BWR A;  2COG A;  1KTA A;  5DGI A;  3UZO A;  4K6N A;  4RCN A;  1EKP A;  2QB5 A;  4CKB A;  5BYB A;  4CMD A;  4JXU A;  2HDK A;  4M0J A;  4WHX A;  3SGI A;  3SNO A;  5I5T A;  3QQM A;  1EKV A;  4CHI A;  3VPD A;  3T54 A;  5CE8 A;  3UYY A;  4GLW A;  3UZB A;  3T9A A;  1WRV A;  3U0G A;  2ZGI A;  4UUG A;  3WWJ A;  5I5V A;  2ODT X;  3T9D A;  1ET0 A;  1DAA A;  1I2K A;  2HG8 A;  4Q4D A;  2Q7D A;  5BWU A;  3DTF A;  5E25 A;  1I1L A;  4TVI A;  5DGH A;  5I47 A;  5CM0 A;  4DAA A;  2DAB A;  2ABJ A;  4HN2 A;  3T9C A;  2Y4R A;  5BWX A;  2EJ3 A;  3T7A A;  4Q4C A;  3DTG A;  3WWH A;  5BWV A;  5K3W A;  2EJ0 A;  1I1M A;  1EKF A;  5I5S A;  2HGX A;  3CSW A;  2DAA A;  4NZO A;  1A0G A;  3WWI A;  3TEK A;  5I5U A;  4PBC A;  3HT5 A;  5FR9 A;  3DAA A;  1UC9 A;  3PFF A;  4IWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...