5CAEB

Succinate bound to pig gtp-specific succinyl-coa synthetase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
392
Chain Sequence
b'MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structural basis for the binding of succinate to succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 135
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5caeB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5caeB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5caeB03
3R9RA 4FFNA 2NU6B 5CA0F 4YBZA 2VPQA 2W6MA 2C00A 3OUUA 4IHJF 2PVPA 1KEEA 3U54A 2YW2A 1UC8A 2FPPB 1KJ9A 2V59A 2ZDQA 3JZIA 3UFXB 3VMMA 1W96A 2W6ZA 4O83A 4FFLA 4O4HF 2NU9B 4IIJF 1GSOA 1M0WA 1CQIB 5KKNB 3TIGA 4O82A 2SCUA 2X0SA 3LWBA 3HO8A 4YB8A 1IOWA 1I7NA 1Z2NX 4IWYA 4FFMA 2R7LA 2VR1A 3N6RA 2YRWA 1C30A 4M9UA 1SCUA 1KJJA 4O4IF 3V4ZA 1E4EA 3E5NA 5I47A 3KAKA 1EUCB 1KJQA 1JDEA 4I4TF 1KJIA 3ORRA 1VBHA 2QK4A 1A9XA 3RFCA 2R7NA 4FFPA 4MV7A 4MV6A 1EUDA 2CNUA 4Y8VA 4O7YA 4O7ZA 2NU7B 2GQRA 2FP4A 4O4LF 4MA0A 2NU6A 5D8DA 2ZDGA 2QF7A 4EG0A 5HBRB 5LP6F 2YS7A 4NYEA 2FPPA 1M6VA 5LXTF 3TINA 1IOVA 1B6SA 3VA7A 1B6RA 3UFXA 1Z2OX 4O7NA 5BPHA 3U9TA 2FPGB 3G8CA 3Q1KA 1JLLB 3JRXA 5K2MA 2CNVA 2NU9A 2GPWA 4I50F 1CE8A 2OLSA 1BXRA 3RUPA 1CQIA 3ORQA 4O2BF 3R5XA 4ZOLF 5CAEB 1KUTA 2GLTA 4XYMB 2PN1A 2XCLA 1DIKA 3HBLA 1JDBB 3KAJA 3R5HA 4MV9A 3ETHA 3U55A 2YZMA 1WR2A 2YV2A 2R84A 2W71A 4WD3A 3VPDA 4O2AF 3K3PA 3V4SA 5FNVF 4MAMA 4WBNF 2J9GA 1CS0A 3WO0A 4IZOA 3DMYA 1EUCA 2R6FA 2YZNA 4DLKA 2NU8B 2V5AA 4O4JF 2HGSA 5C1OA 1BNCA 1GGOA 2YZGA 2CNQA 2NU7A 3WO1A 4MV4A 1VKZA 2R87A 4TV8F 5HBRA 4FU0A 1DV1A 2FPIA 1I7LA 2ZDHA 4ZHQF 2YV1A 5LYJF 5J2TF 2W70A 3MWEA 2R7KA 4RZQA 4EGJA 5LOVF 4O7RA 4XYLB 4DIMA 2DIKA 2FPGA 2I8CA 1CQJB 4YBZB 4ZQIA 2DLNA 2W6NA 1C3OA 4O7WA 4HNTA 1M0TA 4L1KA 4O7TA 5CB4F 5CAEA 5HV6A 1EYZA 3WNZA 5KX5F 4ME6A 4O86A 4FE2A 3VPBA 5CA1F 2VQDA 5DMXA 3JZFA 3I12A 2CQYA 4FGRA 4C5AA 4YJ3F 3QFFA 3SE7A 1ULZA 4MV8A 3TQTA 4O84A 3TW6A 1KC7A 1DV2A 1GSAA 2GQSA 2NU8A 4HNVA 2R7MA 2CZGA 5LA6F 5IYZF 3GLKA 1KBLA 3PFFA 2PBZA 1PX2A 4YAKB 1E4EB 4O81A 1OBGA 2YZLA 5EZYF 4HR7A 3R23A 1PK8A 3K5HA 2Z04A 1OBDA 3HB9A 2GPSA 3ETJA 5JQWA 4QSHA 1W93A 4EGQA 3AX6A 2P0AA 3VPCA 4MA5A 4IWXA 1VBGA 4MV3A 3MWDB 4XYLA 4XX0B 4YAJB 3VOTA 2FP4B 2WYOA 1CQJA 5BPFA 2NUAB 5C1PA 4ZI7F 1JKJB 1Z2PX 1EZ1A 2R86A 2YRXA 2HJWA 4XZ3B 5JVDF 4HQ6A 3OUZA 3GIDA 3JRWA 2W6OA 3RV4A 3U9SA 5C8YF 2YWVA 4I55F 3N8DA 2I87A 4HNUA 2R82A 3K5IA 3BG5A 2W6PA 4FFOA 4O7SA 3KREA 2I80A 2YS6A 1OI7A 3LP8A 1JLLA 5JH7F 2FB9A 2V58A 2IP4A 4C5BA 4YAKA 5H80A 3R5FA 5JVLA 4XYMA 3AW8A 4YJ2F 4MV1A 2XD4A 4E4TA 1GLVA 2DWCA 1A48A 5BMVF 1KJ8A 4TUYF 3Q2OA 3MWDA 4XX0A 4YAJA 5GONF 2SCUB 4YB8B 3TIIA 2NUAA 1T36A 1JKJA 4XZ3A 2FPIB 4C5CA 3G8DA 1SCUB 1EHIA 4FFRA 5JQGF 3MJFA 1GSHA 4TV9F 3MWEB 2DZDA 1AUVA 3RV3A 2CSUA 3KALA 2YL2A 3NUAA 3DF7A 2Z02A 1UC9A 1AUXA 5J2UF 4O7VA 2W6QA 4O7LA 1EUDB 4Y8VB 2R85A 2YYAA
chains in the Genus database with same CATH superfamily
2EP8A 2C96A 4Z0PA 2XXAA 1I2MA 2CHVA 1ZM4A 1AUQA 2P6NA 2ZJ1A 3RDPA 1X15A 4S1NA 1T9BA 2GBIA 2ZUSA 1EE9A 3NDPA 5FPQA 3EEFA 4AY4A 3UY4A 3V8EA 1C2TA 2PQ6A 1T2UA 2DTDA 4YR2A 3QVLA 2FN3A 1P9NA 1DC8A 2Z57A 3QE3A 4ITVA 3HOWG 3WLLA 2O20A 1J8FA 1N75A 4W9RA 5KNBA 3D1JA 1EA7A 2DJIA 2QT0A 3KZNA 1DAHA 4A9AA 3QKSA 4EMBA 4R71A 1JIVA 2LV8A 5CH8A 1XL1A 1WNFA 1AQUA 5LMCA 1CWUA 1V47A 3THRA 2IYRA 5CBKA 2OXRA 1SWWA 3WLJA 4IICA 1X19A 1OGYA 4W5TA 3VPAA 3EGDA 5HBRB 4D3ZA 4PFKA 2B35A 5J43A 3SS8A 3C8HA 2SNIE 4WNAA 1HOXA 4CM8B 1KQOA 2C98A 5HJ2A 3I61A 1DTSA 2BGJA 3EEIA 3OE7A 3C85A 5HIMA 3VNQA 3SR0A 4P7BA 4JI1B 3FFWA 4LEIA 4RXTA 4BP3A 2AQHA 4P3OA 1AQYA 3T3MB 1K4YA 4LF8B 1I9GA 5EQDA 4RD4A 1K6IA 2FW1A 2AC7A 3ETHA 3IEKA 2JA8G 4HNAA 3QVOA 1H5UA 3VPDA 3PK0A 2PEZA 3SZOA 2OR3A 1QG4A 3CTPA 4Q8EA 3BYZA 3GH1A 1UT5A 2CHFA 5C8YA 1I32A 2C0PA 1LBEA 1C9YA 2QE7A 4N82A 4JI7H 3KSDO 2H52A 3IUYA 3SXUA 1WCXA 4P3XA 3KEMA 2JHFA 3MPUA 3NEAA 2K2QB 4DNOA 3OFSA 3GMSA 5I4IA 2C97A 3WK6A 2OO5C 2V7VA 1A1SA 2JFQA 2H63A 4ZQIA 4UJ5A 1YA4A 5MHTA 4RQTA 5ARCA 4I4IA 3CF4G 4OPMA 7GPBA 2HQBA 4FBLA 3DV0B 1T4CA 3ZBQA 4A93G 2NO5A 4BO0A 3I01M 2P2SA 2ZS7A 4E70A 3B13B 5DNWA 3EIOA 2AT1A 2EEPA 4IDAA 1DC5A 4DOMA 3HLTA 4TN1A 3CF2A 1KT8A 1UKVY 3I62A 4D42A 5HEKA 1GUYA 1LNSA 1YRYE 2WYUA 4DV4B 4CRWB 1TWHA 4DA9A 1XXHE 2GCOB 2OUKA 1JKXA 3TPFA 3DYBA 3GARA 4KAFA 4MZXA 3GC6A 2YYSA 1D8AA 1DT3A 1HDYA 4GZMA 4WLNA 1HE8B 1QZTA 1UINA 5KO2A 1GZ5A 3IA7A 3ID6C 4C7JA 4MYTA 1RYHA 4H4CA 1LCIA 1W581 3X1KA 4O08A 4MTLA 4RGYA 5AJWA 5SZKB 1NVGA 1Z2AA 3N2YA 1W85B 4PV7A 4IQ0A 1JLRA 3SBEA 1C0LA 1CDDA 4XM2A 1DWUA 2QM0A 4L5YA 2IEGA 4Y9DA 5BSKA 5DTJA 3OFND 1LTQA 2FB9A 3S2UA 4BEWA 1PJCA 2WUDA 1H2FA 4RY2A 2OFFA 1JQ5A 4N7MA 5BR7A 3RABA 3ZV5A 1ZJ4A 2Y2VA 4BY9E 2A5FA 3L7LA 2OFXA 1H6BA 5BW5A 1C7QA 2XGMA 4BL5A 4X91A 4PZCA 3WA7A 1U0RA 3ADBA 3GLGE 3TF5A 1Q1EA 2PKRA 1EHIA 4H7KA 3MWEB 1SCDA 2IZ7A 2C8VA 1SZPA 1AKMA 7AT1A 5G3ZA 4DQUA 1CD5A 3SNKA 2OCKA 3KJNA 1BRMA 2Z58A 3M49A 3UYLA 3L93A 1SBHA 1ZKDA 1ESDA 2BGLA 1MORA 4L0CA 2AKYA 1ZHSA 2CHEA 4YBZA 1EBBA 1DO2A 1RPAA 3FYCA 3QYAA 3WWIA 1YVRA 4Z1OA 4XYGA 2HGZA 3L8FA 2EKQA 3RUAA 1F48A 1RMQA 1UK7A 1ZU4A 2FG7C 3RI3A 5KYTA 2JBWA 5KWIA 2ZRMA 2O7SA 3QKUA 1EK0A 3EDYA 3Q8KA 1AMUA 2HWXA 2QZ4A 2WHQA 5CHEA 3ZY3A 3GOHA 5DBOA 1C30A 5DG8A 1KF0A 2ZCVA 4N18A 2VQFB 5KFJA 5IK2A 2W7PA 3HHEA 3ZWCA 1Z6XA 1H8HD 3EDOA 1WPQA 2O6LA 5H68A 1WBJB 2AI2A 1Y6GA 1YGPA 1L2TA 4I5DA 1RWWA 4S05A 1QH8B 2M98A 4IOMA 3ZCTA 5KNCA 5CEFA 4MUHA 1KK2A 2X0KA 2A78A 2JIZD 4O5OA 2B83A 1EVQA 3VC3A 4NENA 1E5TA 2B1JA 1P60A 1WDWB 3I4CA 2A9PA 2WG0A 4BZZA 3C5EA 7ADHA 1N9ZA 2CMHA 4RK4A 3MS2A 4WUTA 3AJRA 4DT1A 5JMPA 4D3DA 4B4OA 3PL5A 5EUMA 4R2HA 5ECDA 2Y1WA 2CV1A 4REOA 3PFHA 1FMFA 1DRVA 4NPCA 3QVGB 3BFPA 2J07A 3B3GA 3DFKA 2WE7A 3AGPA 1GQ2A 4L9SA 3UPUA 3I64A 2FMAA 2XYRA 2OMKA 4L74A 1Q20A 4P3KA 1O6BA 3A31A 1A96A 1MMFB 3OIGA 3VKUA 1VPWA 3RBAA 1JR3E 1JZTA 4RSRA 1J0BA 5LQSA 1XDUA 3OZTA 4LOJA 2DRIA 3BKXA 3ZI4A 1XC7A 4IXTA 3V1NA 4A82A 4XE5A 4YRJA 3B6MA 4QBFA 5CFRA 2FF5A 2A3RA 1GU1A 3N2GB 4CKCB 1RC1A 2PMEA 2R6DA 3UK1A 4DB4A 1RC0A 4H1TA 1FYDA 1LZLA 1S8FA 1MEEA 3KQOA 2R1TB 3DBOB 2JIDA 4A8JA 4TS4A 1EWYA 2AV6A 2DQSA 1KFBB 5KQSA 3N6VA 1EYZA 1FJHA 1NKVA 3K4PA 4QLBA 3O83A 3A1DA 3FJYA 1PZHA 2YKGA 1WE2A 2ZWPA 1IYEA 4PYQA 1TYEB 3GWGA 3MCWA 2H9AA 3EGCA 1U3GA 4QFMA 3OEWA 2AR9A 5CH5A 4IJMA 2Z98A 2ATVA 4MSUA 4H4EA 3HUEA 4AD8A 2C42A 3L4BA 3QSGA 4P6VF 1AO0A 2XZOA 4KYUA 3F71A 2E6UX 3T9EA 1G8KA 3DHNA 3FLBA 1PK8A 2DSNA 3U7IA 4KGVA 1WOYA 1IZYA 3L7OA 2EZUA 3SC2A 1T6ZA 1Q15A 1TVKA 3URMA 3CZMA 3VOTA 4KI7A 2E9SA 1P3Y1 1RQGA 1O3YA 1NIJA 4ZU3A 3EJWA 3L7IA 5AK5A 3M6IA 4GMFA 3I23A 1IY0A 3UPDA 2WWRA 3WNDA 2XCRB 4V02A 2QN3A 5DHRA 3LNTA 1PJZA 2Q8NA 4PINA 4FC7A 2PUCA 3QFRA 1II8B 2GQ0A 1O95A 4YMIA 2NOAA 4BJHB 4MDEA 4DSZA 5JUMA 1EAYA 1YFKA 3T3NA 1ZNYA 3OEHD 4KN5A 1ZN2A 4BFYA 4TWZA 2J6BA 4E5UA 4IMJB 2H7CA 1FUEA 4JJFA 1KEVA 3DSRA 1G38A 1V0JA 2Q3EA 3JSNA 5K4HA 4TV9F 2CSUA 3PZRA 2VZEA 3REQA 2GKSA 4R31A 5DLQC 3ZD9A 3LKBA 3OFVA 5LQAA 4BCDA 5KFIA 4C3OB 5DGCA 5HUQA 2QZPA 4JBLA 4IIVA 1DMRA 1EQUA 5CLLA 3F5MA 4HAUA 4FINA 4LHXA 3T38A 1V3UA 1GZSA 4Q7QA 3PLNA 2BTQA 3F2VA 5IJ9A 2P9ZA 4N3BA 2WWIA 1YQQA 3GIPA 2MSEB 2WF9A 2O0HA 1YHYA 3HHPA 3K5PA 5JNRA 1IL0A 8ABPA 3PIIA 4YN3A 1B41A 5GJVC 2JBAB 2FNAA 5EY5B 1E6EA 5G41A 4QUEA 1Y3DE 5HIAA 1TCAA 2OESA 4WZAE 1Y7PA 3AWIA 3RGZA 5JG7A 2P35A 1M67A 1KJIA 1U7ZA 1IVYA 2QRUA 1T9DA 3GJXB 3MGKA 1KI1A 5FWYB 2QSYA 3AU8A 4P38A 4F38A 3E27A 4NSNA 4Q37A 4IQ4A 3SK0A 5IKPA 3TSCA 4XQ9A 4CMIB 1M54A 4IIDA 4CEIB 3DE5X 4WUVA 1FTQA 1O9HA 3ZNQA 2XWJI 3BHIA 3EUWA 5AOVA 5EWEA 2GCEA 3OY2A 3RWMB 3A4VA 1TAGA 3IJRA 4GU5A 4KJXA 4TLEA 2OHIA 5JFOA 1KYXA 3HV2A 1CYDA 3DQPA 3U7QB 4LJKA 4QNMA 3O3CA 4Z99A 2JHAA 5JW6A 1TAEA 3Q9SA 1ELOA 2R5NA 4PIVA 3UMGA 1NJ2A 5IBCA 5JUWA 3EIEA 4KK3A 3JAKA 4KQXA 3UA3A 4D9BA 2PRYA 2IH5A 3OOSA 4A3KG 3RK1A 3O9ZA 1GPYA 3L6DA 1ZMRA 3AEZA 3PNQA 4HSEA 5NLLA 4XR4A 4IHAA 4QDZA 3ZY5A 4LZAA 5IP9G 3HUUA 3LCVB 5J4VA 3LT1A 3V1KA 4TTVA 3STTA 1Y6JA 2FPGA 3AEYA 4OHOA 5KX5A 1F38A 1OU0A 4DR4H 5L95A 2GD1O 3RHZA 4Z4HA 4HGOA 4OQPA 2AIRA 3WDMA 4LV5B 1NI4B 4C2TA 2IV3A 1W47A 1DXQA 2ILVA 4KQ9A 1CRLA 3DE1X 3H19A 3HI6A 1EFLA 2H4FA 2NAPA 2A5DA 5DULA 4LFBH 5DZSA 1GJRA 4FYPA 4YY3H 3JXEA 1VTKA 1JHDA 3NHZA 1E7YA 5HP4A 4E6NA 1JHQA 4K9PA 4JIGA 5JSYA 4BNGA 3OSNA 3OBIA 3V1YA 2AW5A 2IOHA 3U19A 1JYEA 2V4UA 3F74A 3ICPA 1CZUA 2IKQA 2WQ7A 3M4ZA 3SZRA 5G1PA 1E7RA 4BV3A 4UASA 4R81A 1Z2PX 4U9IS 1M0EA 4GLXA 4PGFA 2F9LA 3R1IA 4OHFA 5IVPA 1TJYA 4QDTA 4Y2QA 1CQZA 2F1JA 3ZLUA 2JLZA 3OOYA 2HSDA 3TVYA 3A04A 4BLOA 3AUYA 3PUZA 3TNLA 4QUHA 3IEUA 1GCOA 4W63A 4K0KH 4HH1A 3I04A 4KQCA 2FWIA 1XNQB 3GVIA 2XYGA 2YHIB 3HYLA 5MFZA 2XOXA 1J90A 4L5CA 3BB1A 3C7AA 5JVLA 1FA9A 1A76A 5C3MA 1TCVA 2WLSA 3THWB 4M1KA 4HRXA 2G9ZA 3AZOA 5JQGA 4Z86A 3GAMA 4D4MA 3O1HB 5AKLA 4URUR 2EZ9A 3WNVA 4AJIA 1R15A 1X9NA 5J5AA 4YREA 2OBNA 3WKEA 3MJFA 4FJ2A 4NCHA 3A6HA 1M7BA 1SZCA 4RESA 3AKDA 2Q3DA 3P52A 3AJ9A 3BXFA 3CEJA 2J45A 1DWOA 2VEDA 1E9CA 1W36C 1DELA 1N6OA 3NEYA 4F6CA 4GOJA 5C4IA 4YHHH 1PNVA 4U5QA 5JASA 5F12A 2C88A 2IU0A 4E09A 3RGXA 3TDNA 2GPBA 4LBWA 1XX6A 2VYVD 2PKCA 1N2CB 1SCAA 2WABA 4DQVA 2HF2A 4UU0A 3OC6A 1SC1A 3N5CA 5D1PA 4LJYA 3G2PA 3CNLA 5F4BA 2DWUA 5AOAA 4L8GA 1X7YA 3CZQA 4DCTA 1CHDA 2VPZA 4BRUA 1W1UA 2WDTA 2FI1A 4KQ2A 3IP5A 1VGVA 4AW9A 4F4FA 1HYHA 2G08A 5FBRB 1ZD9A 5ARBA 1Y5IA 1X1RA 2RDMA 1XJQA 4FCWA 4DLBA 1KE2A 3RFCA 1XZBA 2F64A 3QV2A 4R2IA 3OT1A 3HP7A 1CUDA 3X44A 3KZXA 2D6FA 3QPCA 1TB4A 1ZDMA 2EW1A 1DIRA 4KGXA 1CQXA 4ZIRA 2TYSB 1OFHA 3RODA 4ZMSA 2BJWA 3N2IA 3MCTA 3HEMA 2Z5FA 2NVXA 2Z4TA 2AFHB 5C3EG 3HGTA 4BNMA 4YUWA 5A1TA 1XWIA 2ZZKA 2BF7A 1SUFA 1JFFA 3RSQA 3GLHE 3F7MA 3CBQA 3O84A 2I7VA 4F4YA 3MA0A 2V5AA 1ESEA 1QIDA 3X1ZA 2VRBA 3EQ6A 2NU7A 4YRRA 1FFHA 1Q50A 4DV6B 4MVJI 1TAUA 1I5OA 1XD9A 2PMCA 3EZ6A 4G1UC 2G40A 2CEAA 1XK7A 3LVBA 2C9BA 4OATA 4UFZA 5FDFA 5B2FA 5H9VA 2B21A 2J3LA 3N05A 3SMVA 5CVTA 4NABA 4OQXA 4I55B 4BE4A 5BWCA 1BMFD 1RWPA 5AVKA 3AIOA 4JKOA 2FJUA 4PYLA 1WU7A 3NBXX 5ULLA 4PTZA 4MW2A 5GJCA 4D5GA 3EUAA 2HX1A 4S24A 3PN1A 3KUCA 3SC4A 2I2FA 1DXYA 2HPVA 1X1AA 2RHBA 5KU1A 3CVWA 1JEEA 4LC0A 3PSAA 4OB8A 1KBLA 2HA3A 3ENNA 2WSYB 1P75A 4C08A 4K6MA 4HXYA 5BOSA 3UQ8A 2F1RA 3QEAZ 3B8HA 3C5CA 5J40A 4AKIA 1UQRA 3GRAA 1FDVA 4PRYA 4GLLA 1Z06A 1F51E 4JLBA 3LQ1A 2Y0BA 1B7GO 2HYDA 1IMJA 4II3A 3KXLA 3ORSA 3AR2A 3QZ8A 2BR3A 1UP7A 3IJEB 4V0NA 4TRMA 3TD6A 4Z3KA 2EQAA 4I55F 1Q0LA 3SJCA 4DQXA 4UTZA 1CNEA 3D8SA 4K8OA 1SIBE 4DCMA 3MSCA 3U3KA 1YKFA 3GTKA 1K7XB 3N0WA 4RU9A 1TZMA 1IJKA 2ES4A 4I1IA 4JEIA 3ZWMA 4KHZA 3LLMA 2AS0A 3PZBA 4Z54A 5EVCA 2BLNA 2A9OA 4IIJB 2C2EA 2MCFA 1JIKA 1E2GA 2YXLA 1IXZA 3I53A 2R6AA 1I0LA 4UTNA 4BGDA 4K0RA 4EYOA 3A9RA 4Q9NA 4AZ3A 5BYAA 2O6HA 3TOXA 1ODJA 4ED0A 3CFYA 4YAJA 2LWIA 4YB8B 4X62B 5LL6b 3Q7PA 3UWKA 2XRFA 2I4OA 2QTTA 1RYEA 2C7GA 1LBHA 1Y3FE 3E8SA 2QPTA 3GJXC 2N1MA 3I1JA 2DF8A 2PS9A 5G0UA 4ZI5A 4B9AA 3NC4A 5AHXA 2Q9BA 1TKCA 4KQEA 1OJ7A 1I94B 1C4WA 1DINA 2RGXA 3C0KA 4EZBA 5LC1A 2BEUA 5FHRA 3RUCA 1AB6A 3TLYA 1OT5A 2QQEA 3HP1A 4Q6BA 2E2HA 1V95A 4XIYA 2JANA 4FSDA 1R6VA 1FK8A 4KAJA 2A9KA 4PGMA 1RYFA 3H97A 3QU2A 4PX9A 1FTSA 4IIJF 2CWWA 2VOJA 1ZONA 5KMGA 3WR5A 2QA5A 4CQMA 1NG1A 2P67A 2PLAA 2C4KA 4YA6A 1KJJA 2RSLA 2X86A 1QGOA 4CHTA 3E1KA 4RU1A 1PTKA 3TCKA 1R4NA 1A9XA 1IB0A 5FI5A 2BL4A 3LDHA 4B6EA 4OVKA 2B6NA 2VFAA 3CLTD 1WTAA 3A6KA 3UT5A 3WLNA 3ILYA 4IH9A 1MFZA 3E9QA 4K1XA 3G9ZA 4M4SA 3GIQA 1KIMA 3R4VA 4HJRA 2VUUA 5A03A 1J5EB 4F5YA 4WQMA 1P7VA 2JEYA 3M2TA 4C4PA 2GVNA 1NQ5A 3ZDEA 2QD4A 3MD9A 1V8BA 3FYUA 5B5SA 1GZ6A 3P0EA 4BB5A 3ZZ0A 1AXEA 2QLLA 1GEEA 4MV9A 2X7XA 5ALZA 5IKOA 4BTLA 3RQIA 3STXA 2A9QA 1ZUNA 3AZPA 4KH0A 5KFVA 3AWDA 1SU7A 1CVLA 3N2LA 2AG5A 1SEPA 1YB5A 4WHMA 1YCDA 1P9RA 2LP4Y 1JG6A 3THXB 2QQGA 1NXWA 3PYXA 1ZD3A 3U39A 4RZQA 3H8JA 4YQFA 1X7XB 3O74A 3VOBA 3U1TA 1PTJC 1BWQA 2BFCB 3AI1A 1KXJA 4R1OA 2Z95A 2B7CA 2NYVA 3GFQA 1C14A 4N03A 4ED3A 2HLDD 2ZJ5A 3U7JA 4HLUA 3DM9B 1UUFA 3VPBA 2B4YA 4NMLA 3RVQA 4RTQA 5EA2A 1DO8A 4ILKA 2CLEB 1ZN8A 2C9OA 5JBNA 3GLGB 3ONWA 3TAUA 3U4GA 1Q3HA 3NX4A 4A8PA 1ZM7A 2VDJA 3E9MA 3WK5A 4ROTA 4LY0A 1M5UA 3GFBA 3TW4A 4UBIA 1SU8A 2AXPA 3RNOA 4O81A 4YMVA 4L4RA 1T6YA 3G6YA 1FPQA 1JS1X 1RMTA 2RG1A 1DX9A 2GAIA 1QCZA 4DHWA 1FY2A 4MS3B 4MV3A 4K6GA 3FH0A 4Q7MB 3UK2A 5HZGA 3SYLA 4OI2A 4M0UA 1PT8A 1G5PA 1JYSA 4DV5B 1Z34A 5JPIA 2ZYWX 4I1VA 1VE7A 3HEBA 4NESA 2HA0A 4NX2A 4OUDA 4JGIA 1X80B 4EGSA 3A2LA 4DKJA 1U7PA 3LUGA 3BKWA 3FLEA 3RJ9A 1G8GA 3H0KA 1NNEA 3EHDA 4X8OA 4P86A 1R50A 4P0PB 3GD7A 3ZGOA 3C5HA 3WNBA 1QGED 1A9TA 2WWTA 4CU5A 5D3MB 2VAXA 1GTRA 4H0NA 1M34E 2EP7A 3V6JA 1E6MA 5A2GA 2O8DB 3CUYA 3I4MG 2HEGA 4HT3B 4C5CA 4ZDWA 1PFUA 1YTUA 4UUQA 2R8ZA 1S03G 4LHYA 4Y1RA 2DB3A 2ZJ2A 3SYTA 2WIJA 2X58A 4LC9A 1AUXA 4WK2B 3W1VA 2O8CA 3CCFA 3CUVA 1GUFA 1RBMA 3EYWA 2ZBGA 5TF4A 3R7BA 1T9CA 2NU6B 3MWYW 1WR8A 4DR2B 1U0HC 4V24A 5IRCD 1AG9A 3LPDA 1E98A 4ZCQA 2W0MA 2QL7A 1QOPB 1KOLA 5FPHA 4XPIB 4EFMA 1T34A 4OXQA 1V7PC 2O8FA 4F1WA 4FEAA 3DVLA 1Z2NX 4NXNH 1V26A 3DZGA 4RHXA 4Y6OA 2LUOA 2W37A 3WB9A 1U11A 1FNDA 4MJ7A 5YASA 3ROMA 5LN1A 3ABRB 4YUVA 3N2KA 3C1AA 4B6RA 2XWQA 4KR2A 1E5DA 4TMTA 2IE8A 4RD3A 3QG5A 4MR9A 4WJLA 1Y8AA 1EDDA 5LZ8A 1THGA 1PT7A 4G36A 4QUGA 5A3QA 5KQMA 2OH2A 1O2DA 2YXNA 1IBRA 1QAQA 2ARKA 2COJA 4CHIA 1FXSA 2C31A 2GXQA 4K9LA 1XD2B 4FX5A 3HJUA 2O54A 1CU1A 3IOCA 2IPNA 4GLJA 1YZHA 1NC1A 2Q41A 2V45A 2C3YA 4JC8A 1BS1A 3VNVA 2RHWA 2OCAA 1M6EX 4ZDIA 4OV6B 3Q8LA 1XZDA 1R8XA 1DIKA 4MTDA 1U1CA 4II7A 3QBDA 1OAKA 4XDZA 3WGNA 5FTWA 1Y8RA 3BJZA 5HYVA 1ZG3A 3S2GA 2GKGA 3P9IA 2Z2JA 1JIXA 1YR7A 2CJWB 4M0MA 1U2DC 2P5SA 4JI5B 1ORVA 2QZZA 4WK4B 1XPRA 5J2UB 1V3VA 1YH3A 2AMLA 3T3DA 1DV1A 4RB1A 2QJFA 2ZU6A 5JH7A 3RE1A 3HXOA 3W6NA 4X24A 3JQ8B 3T1YB 1EFHA 4NIMA 1GYPA 4XJVA 1NJ1A 4F9EA 1B14A 3EXG2 3BK1A 4FTWA 1WUJS 1M1NA 1X77A 5E1DA 2NV0A 4L0MA 1NW8A 1R8JA 1R37A 4D4GA 1B0PA 2OV8A 4JP1A 2H5IA 5KYXA 1Z45A 2VKQA 4BEVA 2BONA 3FLAA 1I0ZA 1GAXA 1DX6A 2ECPA 5ALYA 1BYIA 3LYHA 2OLEA 4UPEA 1W75A 3D0QA 4HNVA 4YQEA 1TMGE 2CYAA 3NYQA 2ALZA 1R18A 1M1UA 5ICSA 1Z6GA 3X2FA 4HGRA 2CEKA 4E33A 3MMSA 1DO0A 2P3OA 1W19A 1Y9AA 1DIHA 1N4AA 1U2EA 3F8TA 2NVWA 1LY1A 5DGTA 3FVVA 2JVJA 2ZSKA 4OA5A 2V4QA 3PDIA 3URKA 3FWYA 1KKLA 1Q2XA 3N28A 4UQOA 3GGGA 4UD6A 3D2AA 1LV8A 1WW3A 2GXSA 2WUEA 2A1UA 3EF0A 1GV0A 3V6MA 3EBOA 3VUFA 2J3HA 3JSLA 4NAVA 2CD7A 4OSOA 1FFAA 4OFWA 5E1BA 5HUHA 3VZRA 1K6EA 4WZAB 4ZAXA 3UJDA 5KQGA 4OHBA 1V4YA 4ZZ3A 5JAHA 3ZVMA 1XN4A 1IG0A 1YCHA 2Z6AA 3GCWA 2XKKA 4TYWA 4M49A 3DLIA 3GUYA 2VSNA 1EH5A 4BQOA 1NP7A 2HHCA 2I67A 3H40A 1B2RA 3GPIA 4W1PA 4NCNA 1VRWA 1QGUA 2CBXA 1XA4A 2HU7A 3ASVA 4JENA 3HRKA 1SC4A 4ECYA 3BHNA 2H9YA 4BVJA 2QZSA 2CVZA 4ZP1A 3WGVA 2H59A 5CP8A 1IDN1 5IMBA 5EKXA 4BX0A 5ESWA 5BSVA 3FMPB 2ID7A 2Z09A 4RSMA 4CT5A 3OU7A 4UBNA 3LUAA 1Y6ZA 4P4SA 4DV3H 4JV5H 1JHYA 3MRVA 3TPCA 5E1MA 1QHSA 1VLJA 5KCMA 2N1BA 4ZEWA 3DWIA 4NH4A 4MP3A 3HACA 1SKMA 2CLKB 4ASUD 4O02B 1QAMA 2ZRKA 5CVEA 3LBIA 1OOEA 1QIKA 2CL0X 5A06A 3ZLBA 3B1XA 5L3VA 3W9YA 1SBNE 5F7JA 1XTZA 4ERNA 1SGWA 3V1LA 2PUAA 5C5EA 5AKZA 4MJ3A 4JITA 3F90A 4C78A 4CYMA 3GGPA 4WY8A 1WNTA 3DBVO 1KRWA 1TW2A 4MKIA 3UKOA 3DT9A 5IWCA 2WYHA 2BFFB 2AFIE 3MNFA 4FYWA 1QH0A 2CXNA 3Q5EA 2XWSA 1ACMA 3A1SA 3QNWA 5REQB 2P69A 3DHYA 3B2EA 4DV1H 1V16A 2WAQA 1N5RA 2LKCA 2WVGA 3N9IA 1N2XA 1IY9A 5BVHA 1I1HA 2FUKA 4N49A 2V7UA 4G9GA 1DX4A 4PBTA 2DBQA 3FNQA 3JYOA 2JC3A 5JATA 1NKTA 4PQGA 3EGXB 2HV9A 3G9XA 3GDGA 2RF4A 2OGSA 4UARA 4MDHA 2KPOA 5LR6A 3BE6A 1C81A 4TM8A 1SWVA 2UVVA 2XCQA 3UG6A 1ZH6A 3QQMA 3O8LA 2D74A 1SHKA 4RMIA 4NI5A 2OZVA 2OHJA 2O52A 1H8EA 3ISVA 1ZK0A 4GKKH 1I2BA 3CH5A 3PJRA 3CIOA 1PZGA 5JCZA 1E2NA 3EW7A 3V1MA 2GN0A 3CJTA 1DBQA 2HLHA 4F71A 1E3MA 4MPJA 5IUKC 3HXLA 4I1OA 1OREA 2X4LA 4HCJA 1S9HA 2OECA 2H1LA 2W22A 2DLNA 2Q1UA 3VZPA 4URYR 2VUHB 1FYVA 3UMRA 3NPAA 5DNYB 2X3UA 4TTQA 1N3BA 4TRNA 3CB2A 3KBOA 3L1HA 1EFTA 1AHIA 4JQCA 3WIVA 3F7TA 2X0JA 1DRUA 4G3IA 3G79A 1ZAUA 5BNIA 3OWHA 3P9CA 4CEJA 5F3RA 3ZCSA 5HNEA 3OCYA 2ZBDA 5IM5A 1QPBA 3HCOA 5I6DA 1OBGA 3QV1A 1XQVA 4LWOA 2XUFA 1CEQA 5I5YA 3F5QA 1VJGA 4PC7A 2FZKA 4FGJA 2PX2A 5TARA 2COUA 2JLQA 3N0TA 2X9QA 2X4DA 5D5QA 2EFHB 1UBSB 2ZT6A 4MXDA 5GVSA 4KP7A 4BEJA 5AI5A 4DA4A 1XZKA 4PZLA 4PU0A 2QLTA 3EZ9A 3I58A 4B6PA 2VSXA 2YY6A 2BT4A 3PUKA 1PCXA 1NL3A 4TKVB 1PLJA 3PRKE 3ZHRA 4RCVA 4AL4A 5M04A 3CEHA 1ETHA 4QELA 3PE4A 2OXIA 2ERYA 5HE9A 4IR7A 1GTZA 4J2OA 2FVXA 1DHRA 4EKYA 1X1TA 2PAAA 3GD5A 4JYAH 4EVIA 2PL1A 3MYRA 5T6BA 1N5MA 4BNVA 4QWCA 3J81A 4AZWA 1G20E 5EHIA 3MJCA 4CFYA 2DU8A 5JSZA 4HUTA 1ISFA 1XKXA 3DQQA 2XVAA 5K3AA 1S4MA 4ZKEA 5DW3A 4BAGA 3WK9A 1W4LA 2I91A 4AJKA 3VNNA 3C39A 3G2KA 3DLAA 1ZGHA 3MW8A 4CLOB 3PYLA 3BORA 2YYAA 1H2AS 3PD7A 4LXGA 1KYQA 3N8NA 4HAWA 4N6GA 2YQZA 2PVPA 1KEEA 1ORIA 3NBZC 1KOFA 2INGX 4AJ2A 3JZIA 2C4WA 3ND9A 2FG5A 4MARA 2P9JA 4ZRMA 1WB5A 3UHOA 2C99A 4LRWA 4QASA 3HB0A 2BJHA 5I7WA 4RX1A 4HWRA 2Q3BA 3AO0B 3UAVA 1QE0A 1W0CA 2B4TO 2IEBA 4NS1A 1UDWA 5IDYA 2PMWB 1MLDA 3KQWA 3KQHA 1X9GA 4UREA 5C1DA 2COKA 5AW5A 1ISGA 1TVCA 4WFKA 1DIAA 4U2DA 3AG6A 1V7ZA 4EEQA 1S2LA 1LX6A 4PF1A 4YT5A 4EB8A 1BW9A 5TPZD 4J16A 3I92A 1R12A 5F3WB 1F06A 1MW8X 2B6HA 1AMNA 3D3WA 5JSKA 1NVVQ 3W2HA 2HJVA 1S3IA 1GADO 3A36A 4K8RB 4RZ3A 3TRJA 1M6VA 2AXQA 1NF2A 5TRTA 4MQ6A 2D2IA 5E1OA 1U5AA 4OI0A 2WUVA 1XTBA 2GPNA 2IH4A 5DHQA 1K97A 5JTTA 4GRAA 3C48A 2UVUA 4ZGGA 2L18A 1XTQA 2MSCB 1OLXB 5FOWA 4Z1MD 3UH0A 5EXSA 2V7QA 1NMSA 2IF0A 2R6R1 2BQRA 4A4DA 3QVUA 1G21B 3MELA 1A1VA 3Q8RB 5FAKA 5C8VA 2OC4A 4C1NA 2RJ3A 1NUPA 2PD4A 4B5LA 3PXAA 1ODKA 2BMEA 4MYRA 2IBTA 5E2BA 2W70A 5DHPA 3AKCA 1BDJA 1DOHA 1LI7A 3HBJA 2Y1CA 3HFGA 3JVUA 2PMFA 2J6CA 5HCNA 5CW1A 1ZW6A 1B15A 4N4AA 3BHMA 4RQBA 2JGRA 3HVHA 2YJNA 3L7DA 1DCFA 5LMNH 2AOUA 4DZTA 2FXVA 2B1RA 3IFSA 4MUBA 2FN9A 1VYUA 2FZCA 4JYMA 2JL1A 2CB9A 4EKEA 2WYVA 3EIQA 3KS9A 4WXHA 3IP8A 4O84A 1XQ9A 2WFAA 3LCCA 2WHYA 4YP7A 3AQIA 4KRYA 1C1XB 1XZJA 1IBLB 1ZOSA 3LA6A 4BP1A 1L4NA 3DWGA 1Y34E 4RL4A 2AQIA 1GTG1 4D56A 4J0GA 5A7GA 4LXQA 2AOWA 2J59A 3T7SA 1VCOA 2OILA 5JVDA 1WXXA 3CN7A 3H5RA 3ODPA 1JXOA 3W5UA 1QDEA 4ZI7F 3G0GA 1EX6A 3UBMA 1ZA2A 4F3CA 1OXUA 1XUOA 3SEAA 3G8AA 3V2IA 1JZSA 3E9EA 5LLTA 3MTBA 3GCZA 3FLMA 3WLRA 4QT0A 4NLLA 2YWVA 2FEPA 3PUVA 5C44G 3I2YX 2C2RA 2AOTA 3A25A 2UZ3A 4HZGA 4O5AA 1X7WB 4PVDA 3ZX5A 4M22A 3WYGA 4IQ8A 1J5PA 4FR2A 3IVXA 5GINE 4B8ZA 1WULS 4G1FA 3U62A 5CFQA 5HTKA 3JYQA 4JT4A 1SEVA 3ZDYB 4LX0A 5KNDH 1YU9A 1K68A 4LSMA 1ZMTA 1YIOA 4GMXA 1R0RE 2QBYA 2GNOA 2GARA 4CNQA 1G8JA 1NVVR 2Q46A 1D6SA 3PPIA 1J09A 3PIRA 4XZ3A 2FPIB 4TWBA 3T12A 1I4DD 1JMYA 4QVKA 1XZNA 3QUAA 4FFRA 2JHGA 4CIXA 3TRIA 4PN7A 1K27A 2V7BA 3LVQE 1W36B 1D7AA 3HT5A 3AF6A 3KAQA 3LLVA 3VR0A 3F4LA 1NBAA 5ED4A 1U28C 3QXCA 3CGWA 2NZUG 4CM4B 4JB0A 2PKEA 3KSBC 1TJ3A 3TJRA 1U0LA 2ENUA 1DBWA 1ZLXA 2G17A 4F96A 4D2IA 1ZAYA 4A27A 1A2QA 4YGXB 1NFFA 4WN3A 5FUXA 1S3FA 3GBSA 4AM8A 2IA6A 3CPHA 3UO8B 4LF7H 2GN2A 2BSAA 4M7WA 4Q8FA 1ULSA 4DREA 5FFFA 3I6YA 3O8DA 1R4AA 5F1OA 3EVNA 5KG5A 5DPMA 3LPAA 5LZ2A 3Q8MA 1DKUA 2R7NA 1I51A 4K6KA 3HYSA 4J8PA 5CDHA 4U2FA 4N7BA 2RGUA 3CX3A 4OKIA 2NYAA 3OBBA 3T7AA 1O96A 5MDHA 2WQ6A 3LTNC 1B6SA 5TQJA 2M1ZA 4DILA 4O7NA 4RXUA 3U56A 1D7OA 2BFEA 5BWRA 3K20A 3KOMA 3RUPA 2HSJA 4WXMA 1E79D 2MSDB 3ZXIA 1Z0UA 2EDAA 3KLPX 3ZKWB 1KTVA 1TYDE 2QNBA 1ISRA 3ZHBA 1E9DA 1Q92A 4IQGA 4BX9A 4KVZA 3VGJA 3WRYA 5EJIA 3WP1B 5EJ2A 4G01B 1U8AA 5K3EA 1D5CA 4O1IA 4TV9B 4IZOA 3MUNA 5JDCA 4ML3A 5D1HA 3KYDB 4ZVKA 1VJCA 4R54A 4XVRA 2I8AA 4GWLA 1RI2A 3NAQA 1I4LD 3ZWKA 4L2IB 4A2PA 2ESRA 4LZZA 4JLUA 3W79A 2J6SA 4GGPA 2JI8A 2CB0A 1L7PA 1TPZA 4E12A 5ILGA 4DABA 3AUAA 1KZYC 1SK9A 3UGJA 3DEZA 4F50A 5KTRA 3KYCA 1ZNQO 1M1YB 4C76A 3L04A 4UU7A 4INOA 3QVJA 1M34B 3NHUA 3DE3X 4CEHA 3P9NA 2PBFA 1TK3A 4HNSA 5GOTA 3K09C 5BSMA 2VDUE 1YRQA 1RHMA 3VU9B 1BKSB 2ZYVX 3ELUA 4HLCA 4KSBA 4NJMB 1JPNA 3IR5A 3F4BA 3MT0A 3IJ5A 3IUJA 1V41E 1DIOB 3O21A 2CNOA 2OZPA 2GM5A 1QB7A 2OP0A 2VOBA 3CSWA 3JQ9A 4R2XA 2IQIA 2XF2A 5EWMB 2I54A 1TEVA 3ZYCA 2HA2A 4BLVA 3I6ZA 4AF7A 3T95A 3A1UA 1YQWA 2Z6QA 1RHJA 3SZGA 3W1WA 2Q1YA 3EIHA 1RI4A 4CL8A 3EVZA 4AJOA 1L7NA 1S97A 1QIEA 4JC4A 1K86A 3Q72A 4F6RB 1QFXA 3OY7A 1ZL0A 4AJ4A 4AG3A 4BZPA 4OOFA 2B63A 4MUFA 1T5TA 5JAOA 1XALA 4IGAA 5DE3A 4HAXA 1F2UA 4DJEC 4EKIA 1GLGA 3QU9A 2V7WA 4GRIA 1NQOA 5DYIA 4RVNA 5K0EA 2ZUTA 4CMBA 3PFNA 2PZEA 4EARA 4BXOB 2W9CB 3OOHA 2C4HA 2AN1A 3PQ7A 3KR1A 2ZRIA 2FMFA 1HFJA 5C4XG 5DNCA 4CMCA 1N2OA 2C2KA 4MRVA 4M21A 4PQRA 1QFJA 3TW8B 2VOEA 4HI0E 3OJCA 1ZSNA 2PKWA 1CF9A 5A4JA 1L7MA 5ICMA 1TF7A 2J7PA 3N3BC 9ABPA 3PPXA 4UDYX 4HBGA 3ANTA 1BO6A 1YL7A 1PZNA 3TBHA 4YONB 1T3SA 3GNLA 3C43A 2I66A 3NWJA 4YP1A 2EERA 1ITZA 1CS4C 3R3HA 3V7UA 1NAIA 2UVRA 1R5NA 4NV0A 4O4JA 1QF7A 2ZBEA 2ZUEA 2C9YA 1KP2A 3TXYA 3KLOA 1RRKA 4O2BB 3IV7A 1ZEMA 2QTWB 5KFFA 4AO8A 5HJ7A 1NAHA 2PGLA 1SBTA 1WETA 2VHVA 1BHSA 5BNZA 4NY1A 2J41A 8LDHA 4KTTE 4EBDA 2GLUA 2D7DA 4YRSA 1N57A 4HXGA 1ND6A 1IRXA 5J59A 4ZQFA 3LNCA 2MR5A 1WDTA 1W9HA 4EP1A 2XWBF 1VHJA 1UPUA 1FS6A 2Q6KA 2JAWA 1Z5GA 1HSOA 5AI6A 3IBSA 4RH3A 4EHDA 1MRZA 1U65A 3NUGA 4J4HA 1E66A 3WYEA 1EBUA 1NVAA 4KN9S 1MVNA 4ZPJA 4Y7CA 4A0GA 4G5XA 5I8PA 4LDJA 3UK0A 1TWFA 1RK6A 1NJ5A 1P0QA 4WESB 1HK7A 4PGHA 5KHAA 3GB8B 3G85A 1TU4A 2VZ0A 2IWHA 1Y82A 1QBGA 4DGQA 3BCUA 1BKYA 3PWSA 1MABA 2A88A 2WIBA 3B7PA 1L8LA 3DAPA 4OHMA 4JBWA 1EDZA 4WY2A 3ZBTA 4O2BF 4YJHB 3QZUA 4AKHA 5TT1A 2XCLA 3IBFA 2BI7A 1EFKA 4HB2A 4D6XA 3L1VA 4Q9IA 5DHFA 3W6PA 1HYEA 3V80A 2R84A 3Q5GA 3BWEA 1IEXA 3OZBA 1UMBA 1Z0JA 4U9UA 5DGXA 2HAEA 4UXJA 1ZA1A 3L8GA 4MJLA 3U7GA 1NBIA 4N5NA 3WQHA 1RLTA 3VKFA 4AP6A 4B32A 2R6JA 2FDXA 5D5HA 5HSGA 2EBWA 5HWSA 5CBPA 2BSQA 2G25A 4HFRA 4CM1A 4F2GA 4QUKA 1R5JA 1ZSYA 3KXDA 1KXZA 1F5NA 4RFSA 3I9FA 1UP4A 3HBFA 4IDEA 3BVPA 2H5JA 2KM1A 5ITVA 4PSVA 2AUNA 4K6OA 3RVSA 1BE1A 3MHTA 5G4KB 1G9XA 3W9UA 1L1FA 1NVTA 4QYXA 4OYHA 3WDSA 2A59A 3Q0IA 1J70A 4MWCA 3T1TA 2ZB2A 1I1QB 4OM8A 2BKXA 1A5ZA 1PS0A 3H1FA 4OXYA 3C1UA 4BPRA 2VPXA 3ZDDA 2IL1A 4R1QA 4P1ZA 4DV2B 1EVLA 3QIVA 4QYSA 4M1YA 2ZBPA 1X6VA 3SBDA 2HHFA 3DAYA 3P0IA 4M1EA 1XJWA 1YXMA 2GZAA 4EW3A 2A5LA 2VRWA 4WV3A 1PQ4A 2GM3A 2EJWA 5C8ZA 2QTAA 4OBWA 1VL0A 1ARZA 4CIDA 2OHXA 3D7MA 4XOUA 1YGYA 5KYUB 1BA3A 5CDGA 1W8DA 4M6WB 3DUWA 3IILA 3MJRA 2FSIA 1KK1A 1RYBA 5CJJA 5BN4A 2FMHA 4ETNA 3VHXA 1EFPA 4HWPA 2R62A 2PT6A 2A9FA 2C8KA 3JD2A 1NLFA 5DX1A 3E4CA 3KZVA 2YJ3A 3IVGA 3PQCA 2O1EA 1IUKA 3M1LA 1ZJ6A 4HTFB 2E4VA 3IHLA 3MT9A 4XVQA 5CCDA 2QJOA 2R8OA 5J4KA 1PKXA 4MQ5A 3Q87B 1AVTA 2ZIWB 2Q8PA 3GJ3A 3GR6A 3USZA 1KVTA 3L2PA 1PU2A 4DZZA 4J0FA 3WGMA 2OGUA 3A70A 1DEHA 4C7OA 4X66B 1SMKA 3BOSA 3NHJA 4FIZA 3FZNA 2QLBA 2D5LA 1WB9A 3W1EA 3PG5A 2Y1XA 2ZYRA 4JLAA 3HL4A 2ZJBA 1PVOA 3H6KA 4HQRA 1Z15A 1EE1A 3I0MA 4U6PA 2BMFA 1YDGA 3HM9A 5F2NA 3PYMA 5IS2A 2ORIA 1CEYA 1S4QA 4E1BA 2R96A 4UEJA 2O2HA 4KQJA 1CERA 3PL1A 1VRCA 3A4MA 3BJIC 5FLYA 4Y6RA 3O2NA 1S0UA 1VIAA 3OPVA 3M6XA 1ZRNA 5SYNA 1NW7A 4JJAA 1BJKA 2JGDB 4QU9A 1Z5NA 4KNYA 5C4GB 1RZRD 1QXSA 4HDMB 2WMDA 1M5TA 2Z5GA 4EB6A 4UUOA 1NATA 1VIMA 2O50A 3S5JA 1I7NA 1TCBA 3PNKA 3VSEA 3MPOA 5T4HA 1Q0SA 4LVOA 3PC4A 1PR1A 2PRKA 1T0UA 4CCYA 4POOA 2B63G 2XSZD 4KHPB 2Q6IA 1E4YA 3GFOA 4YVFA 4FFPA 5CG2A 3TZQA 3H2KA 2ZROA 3CKMA 2AZXA 3QELB 3E84A 5F1PA 5FTKA 5LP6F 4UHFA 3AEKA 2CJXA 3GEBA 1PVVA 2JVKA 4MUYA 1NDQA 2N9UA 4X6UA 1N6LA 3QGMA 2Z2KA 1JQJC 3F6YA 2I4LA 2OBFA 2XUAA 4NFYA 2MHCA 3GVCA 2FSVA 3AY7A 4RSHA 3RWOA 3EARA 1Y5LA 3SNHA 4H17A 2WJ4A 3SDBA 4R2WA 3NDRA 3QXHA 2IXEA 3WQQA 3VKHA 3PU6A 2QUJA 4B34A 3I09A 3RFUA 4IFBA 2XUGA 2Y93A 4RTMA 4MQUA 4NMWA 4RPGA 2H11A 3SQNA 3ONDA 3PIDA 5KNDD 3EVEA 1SBZA 2X4GA 1T3HA 5LOVA 1N6PA 2DABA 4J76A 2BFNA 2DJ5A 4EB3A 4ZHQF 3DCNA 1KYWA 4JXXA 4KQ1A 1V2HE 4P81A 1NOJA 1QHFA 1P9LA 4PIMA 2W9XA 1DBIA 3ACBA 1V4VA 5KZMB 4P34A 4OBBA 4OHWA 3KDAA 1LLFA 1XMIA 2PXAA 3EQ8A 5JJ5A 4RZHA 1QGZA 1FNNA 4EBBA 4KXUA 3QMMA 1WHTB 3RW9A 2EJ2A 4HZUA 3M9MB 4TWIA 3T4UA 4GMDA 2XUQA 3QXGA 3CSSA 1L4UA 1W48A 4HP8A 4C2AA 4K2HA 1H2XA 2GT1A 3T06B 3VO1A 3RYHA 3V97A 5BT8A 4NCKA 6AT1A 1XKLA 2OV3A 2VP6A 2P9TA 4FOPA 4FEYA 4V2UA 3QE4A 4PAQA 5HKKA 3RG2A 2DETA 1ZHFA 2P6OA 3DLHA 4B3JA 4YCNA 4KXNA 1KYIA 3SYRA 1WP4A 1IZ0A 1G41A 3WSTA 5AVXA 3NT5A 5DBHX 1XCOA 2Q0QA 3HKZE 2IUSA 5LL6P 2XJ4A 3ANNA 1E3SA 2YMPA 2VHJA 3FGOA 3LHFA 4ZCRA 1J6UA 2H18A 1Q22A 3CUWA 4AJ9A 4TGLA 2HMVA 2R6GA 4NCBA 4X7PA 3MHPA 1NIPA 1Q1NA 2W6OA 1QYVA 1TFRA 4CQLB 3LWDA 2NLOA 4PX5A 3PB3A 4C4ZA 3BG5A 2AB0A 2GF9A 2FEAA 4JC5A 2OWOA 2P6RA 4LJRA 2QRMA 2PGIA 3ZVKA 4DL2A 4NU0A 1F6DA 4JLWA 1DRKA 1FUKA 1G5HA 1IQUA 3KOUA 1UXKA 4BVFA 1DJMA 2VBIA 1UPBA 2BR0A 1YT5A 3DP7A 5BQXA 4GXTA 3MR2A 2O5RA 2IY8A 2QRVA 3QQPA 3P2JA 2YFKA 1T9GR 2CHQA 5H16A 4BOYA 2B0CA 1FLVA 2IP1A 2W2XA 4QYIB 1Z12A 3PO2G 3K31A 1XXHB 3N7TA 1JB1A 3TZKA 2JZOA 2XMZA 3H4TA 1MKYA 3KK0A 1S2OA 1USIA 2NT4A 3G0OA 2UUBH 2C58A 1QONA 3HCCA 3H3VH 4R0MA 3GLTA 3VH4A 3VPFA 2VDNB 1XP5A 2C2OA 3DXZA 4LHWA 4KLZA 1QHHA 1JEOA 1P8JA 1W88A 3RAQA 2XQFA 3QBEA 3DMGA 2F00A 1HNWH 3PJFA 2FVYA 4TV8A 1QP0A 3AYZB 1RQNA 1KFCB 3L0CA 1DJQA 1S7CA 3GCGA 1XT6A 2R00A 5F5LA 1XU9A 1SBYA 1TLTA 3E9NA 3GN2A 3T3GA 4E31A 3QW2A 1GZ4A 2IYXA 4O4IF 2A86A 2VAVA 2MSWA 3KPYA 5I01A 4CT4B 4XGIA 3JR3A 1L9XA 1W0KD 1H1LA 3V6KA 5JISA 3L2OB 3EG9A 4DA0A 1CP3A 1G4HA 3GVHA 3AV0B 1N7HA 2DR0A 3GI1A 4GI2A 2EZTA 2P9GA 4XD7A 2FK1A 1CZKA 1NR1A 1UADA 5CB4B 2VUGA 1QCCA 4MUAA 4BLRA 2H08A 3QEJA 2H1OA 5TE9A 5B58C 2H57A 1N32B 1G6HA 3ESDA 3OZWA 5KI6A 4PFQA 2WTAA 1XTSA 1RPJA 3GRKA 5ENZA 1VPTA 2AX3A 2J0SA 3NGXA 4DCSA 2LCQA 5K3BA 5LA6B 2O8BA 2GRJA 5TJHA 5A62A 1NU6A 4ND5A 1G3QA 3GJ7A 2WMYA 4OIMA 1Y4ZA 4LDNA 4BWYA 3E7DA 2JEGA 1T3TA 5F77A 5CM0A 5FADA 1IXSB 5E6SA 1SUSA 3B3JA 1G64A 3K6JA 4G5RA 5KTMA 4U7FA 5DNDA 5AJHA 2JCXA 1QVWA 5INTA 5EAIA 4OBXA 4MMYB 3WYAA 1OBCA 1AZSC 1I6KA 4JN6B 5EFOA 1A9ZA 1SC3A 1WXEA 3G2JA 2AWOA 1K4MA 3EXFA 2AQ8A 5KTYA 4G5HA 2GOYA 3OCWA 4ED6A 5CB4F 5ESRA 4HGQA 5HV6A 3IS3A 1ZD5A 1QPZA 2IYZA 1GGEA 2VAMA 1MJGA 3ELDA 4ZMBA 1KWGA 3AL0C 1NSTA 3ZZMA 2WAXA 1O0SA 4JB3A 3QUSA 3MGBA 5IYZA 4NZOA 1P0IA 3CTMA 3I0NA 5JROA 1J2UA 4V1CI 3PGVA 2CNNA 4QTXA 2AEFA 2IGBA 4L08A 4AWAA 2R7MA 5P21A 4M7OA 5LA6F 3I8XA 4Q1CA 4BMXA 4AFNA 3COSA 3ML1A 3SWWA 4IIFA 4BJ1A 4ZREA 1T4BA 3HCNA 4QNRA 3ETLA 2GPSA 1EFRD 3G2HA 3TY9A 3NATA 1IIRA 2WTNA 1PJRA 2MWMA 4BKOA 4TSKA 4LZOA 2J0EA 2G06A 4Y6GB 4V1CB 4UATA 2ST1A 2WYOA 3PXCX 3B60A 4EJSC 3NGMA 1AQLA 4J1QA 2WKRA 3K8OE 2PD3A 5LP6C 2VHQA 1DQSA 1DEAA 2VF8A 1HLFA 3ZCUA 1I13A 2O8NA 2HRBA 1E2UA 1F9AA 3QFTA 3TM4A 3X1WA 2EFEB 3KHGA 5K4AA 2JAXA 3TJMA 3IBYA 1ZJYA 1P0FA 4IG9A 4JT8A 3ZHQA 5K0GA 4KQFA 3P9SA 4Z51A 3U4DA 1N34H 4LPKA 3A4TA 4YJ2F 3ZWVA 2HMWA 5C0OE 1ZU5A 4YRGA 3N8GA 4YJGA 3AK4A 4FT2A 1UK6A 1NP6A 3NT4A 3ABZA 5KFUA 3AM1A 3UVEA 1KS2A 1N25A 2AVNA 1KBQA 1Q95A 4A6EA 3LVRE 1YR2A 3T99A 4RIEA 4BEBA 4B6JA 2DY1A 1HQDA 4J9UE 5K3DA 1HRDA 1JJFA 3D7NA 4NZ9A 1D2HA 2VBCA 3WXBA 2PVCA 3QVTA 4F3TA 4B3MB 4P80A 1HE1C 1LI4A 1XTVA 1WBDA 3CX8A 2ZJ6A 5IX8A 1QUFA 2HHHH 1LS1A 1C3OB 3SSAA 3NBZB 2Y67A 4I19A 3ZDAA 5FL7D 4LGMA 4TMFA 2PH5A 1O03A 4OP2A 2GHRA 1LQUA 1U98A 1EHYA 5JXJA 1PLLA 2WKWA 3RHTA 1R0SA 5A5VA 2W8BB 3TOZA 2A4MA 4EBCA 4XWKA 1D2MA 2E7ZA 4C04A 1L3BA 1K6XA 5COAA 1CQIB 2F48A 4DUZH 1DKMA 2F43A 5H7XA 1GPDG 5CLGA 3ZGXA 1QOZA 1SQ5A 2VHEA 5JAIA 2OSVA 2Q5JA 5FTNA 1T8YA 3TBFA 3WKCA 1GR1A 2G80A 5IM4F 1IHPA 2YY7A 3UWDA 4Y0NA 4ZKDA 5BRJA 2PSSA 5DX0A 3HVJA 5D8DA 4LCBA 2ZSEA 5EMHA 2B78A 1JI0A 3T54A 3OFNA 1ZCBA 4PZ7A 4EGFA 2O5CA 3CKYA 4BFXA 3L5KA 3BZUA 2FJ0A 2A30A 2IGTA 1CUBA 2AMVA 2XCOA 1J39A 1EK2A 1YVEI 3MCAA 2Q0XA 4YJKA 1WB6A 1OFIA 1UBJS 3R09A 2X41A 3F3KA 3OHPA 1VCHA 2WJPA 1RE1A 5DHSA 4WXPA 3AG5A 1V5IA 2VH1A 1C0EA 3P2KA 1NUHA 4REQA 5BSUA 4EPRA 4QRDA 2JGNA 5FNVF 3AEUB 1ZUD1 1CS0A 2QR3A 4GKAA 2KJQA 4AJ1A 4YECA 4GAEA 2IXFA 2H00A 4RV4A 5BV8A 1E60A 3BXHA 5BUZA 3C6QA 5IDQA 2PKQP 2A0FA 2EIHA 2PK3A 1DTWA 4M38A 4DQDA 3CG0A 4D8XA 4WFJA 2VXCA 3M34A 2D0PB 1FOEB 2QM8A 4YJ3A 1RI1A 2QN9A 4A92A 4PCUA 1R66A 1COWD 1BJRE 3H84A 3E23A 4G4SO 3OPXA 1MNQA 2FRDC 4P7FA 3T34A 4DN6A 4V0QA 3M4XA 1H8HA 4CF7A 3LPCA 2PUVA 3T7DA 1IN1A 2MIIA 4NP6A 4GXNA 1YZVA 3HJTA 3QG1A 3SSNA 1HNZB 3IDFA 1C4XA 1XTKA 3KCNA 3R41A 5LQKA 3RYTC 2NZ2A 4CUJA 2R48A 3L0PA 2NPIA 4IDBA 2J9FB 4BKMA 2ASLA 5ALQA 3K6KA 3HK2A 3NB0A 1KMHA 4HQ6A 2FMIA 3OPYI 1TEZA 1G4AE 1OIWA 1A9PA 1ULTA 5C18A 3CRQA 5C7LO 3ROKA 1JEAA 3MTQA 3GDOA 4KXFB 1JQDA 1OXMA 4ANFA 2I80A 3EK2A 4AQYB 1J99A 1XVUA 3COVA 5IT9W 4JI8H 3L6RA 5FF9A 4RHFA 3OPYB 4JVLA 1QSGA 4B5KA 3T61A 1DI0A 2MSNA 4TMWA 1M8FA 4INAA 5H83A 2NNWB 3Q3HA 5AW8A 5HF6A 4M8KA 3WGIA 2X0DA 1XO1A 3CBGA 1DFIA 2LIVA 2YWGA 4R98A 5ALSA 2R8HA 4QD3A 2F90A 3AEXA 4HYYA 3THOA 2C2MA 1IN8A 1BQ3A 1EX1A 3AESA 4KV9A 4G81A 5C5DA 5C8DA 1BWPA 1T0JB 6GPBA 2QMZA 3UAXA 2QD5A 4X97A 4CG1A 4BJ6A 1CYEA 3PDCA 4NBKA 4UCOA 3DE2X 2EKPA 4U2BA 3BBLA 1K83A 4ZAFA 2CD9A 4YPVA 1QORA 2W6QA 1RXCA 1Y1SA 4J29A 4WN9B 4MKHA 4RAQA 1ZEJA 2HXGA 3PC3A 4K86A 4NZPA 4GYYA 1BDMA 1RJWA 1C7EA 1DQZA 3OE1A 2UVPB 4KXXA 4JHLA 1X94A 2E4WA 3F0TA 3ONFA 2YHAA 4DTIA 3CZCA 1JLKA 5AM4A 5JC8A 4MV0A 4WSOA 1Z37A 5DCUA 2GCNA 1ULAA 1J2EA 3IB3A 3SZUA 1MXHA 3QVSA 3GZNA 3N6RA 2R8YA 4MUGA 1QZ3A 1GAEO 2ZRCA 4BNZA 3O4FA 3MXTA 4AZSA 3LF2A 1H0HA 1GFSA 3K4HA 1QMPA 4L8YA 3H05A 4ETMA 1WO8A 4O4LA 4U63A 2XTMA 2C3PA 1XKQA 4YLGA 3AILA 4QAQA 2ZRNA 4MQEA 4ENSA 5UKDA 1BVHA 3GLFE 2F2TA 3OJOA 1KEKA 1SH7A 1ABBA 1K88A 2WEKA 3HPQA 4QFDA 4CMJA 1W5AA 4C6TB 1DGSA 1IM8A 4QODA 4GOKA 2JI7A 1SRQA 2GJ4A 2M2IA 4KUEA 2CXXA 3SE0A 3RVBA 4DGSA 4CZ2A 3QX7A 3HKBB 3AY3A 3AIMA 5ALEA 1Q12A 1FDIA 1OFGA 3K16A 2AG1A 1D4ZA 3TK1A 4AYBA 4BVLA 3IYLW 3GH3A 4GX0A 4M1MA 1Z7BA 4QGAA 4E51A 4ZEXA 2W71A 5JZOA 3SQOA 1UPXA 1MRSA 3C3PA 1JIHA 4BLQA 3RC3A 2NO4A 2OCBA 3JQPA 2YMMA 5EMNA 3VXKA 3QX8A 5B1HA 3IURA 4BGEA 1ORTA 2PUHA 3SBXA 2DTXA 2G1JA 1X7HA 1HLPA 1QIIA 2R8PA 4ZOEA 2HIVA 1E6KA 2OAEA 1DXOA 4DJJA 2E6KA 1E0DA 3H99A 3ZCQA 3EG5A 4B4WA 3KFLA 3HLYA 5LB2A 3MLBA 3D7RA 3SS9X 5AKKA 1GNVA 4UTVA 2BKVA 1BXKA 1NWCA 2ISSD 4AIRA 1I50A 3SZLA 5HDBB 4TKLA 4KUHA 4U7WA 4ER0A 4JIMA 3GPCA 3AR5A 4MRSA 1GGKA 4AYWA 1ES9A 1FXWA 4NKRA 2VJLA 2QYOA 4UBLA 1PZFA 4RZUA 4DWOA 3PQEA 4J9OA 1IY2A 1S2IA 4JUBA 4YMUA 4B75A 4DMCA 3NGDA 3OTQA 1WOMA 4KEAA 2QAIA 3HR7A 1YBMA 2FFBA 4GIBA 5CA0A 1O1YA 5EZ5A 2VXOA 2XNCA 1ZGAA 3BERA 5ALIA 2IX3A 1MZBA 3E2MA 1Z5VA 3EASA 2QMOA 2YNMA 3GLHB 1LPMA 1T36B 2JBHA 2R79A 2ODEA 1LK0A 1I4EB 3TE6A 5CNIA 3PD1A 2V9PA 3C1OA 1P9OA 1DQNA 5KOJA 2R82A 3R8CA 3U48A 2EZ8A 4P7JA 3ECAA 3CXUA 3LP8A 2C57A 2J3KA 1R9TA 3NYWA 1AU9A 1MOZA 4EMTA 3AONB 4AWXA 4Z9FA 3G9QA 3ZW8A 2CSXA 2F7SA 5EHQA 4IDFA 5LBUA 1WKBA 3FNRA 5AVTA 4CMGA 1ABEA 4H7EA 3M3PA 2PJRA 1Y80A 5KTSA 4IR9A 2VQ6A 4LH6A 3DLCA 3JARA 3TIIA 2RGGA 4D96A 2BPOA 1DKNA 2OCLA 4FGUA 2IYQA 2XQGA 3C15C 2BH9A 3UJNA 5DSTA 3VQTA 3PF9A 1C1HA 2V55B 3ZLVA 1DAEA 2QTGA 1C1DB 1SUWA 2CKDA 5IN4A 2OAGA 1E1QA 3BWBA 4PTYA 1OHHD 2KLBA 3CKLA 4GH5A 1T9AA 5I48A 1O57A 3BL5A 1H2ZA 2CXSA 5DXJA 5KFNA 3DD5A 5JYDA 1NHGA 5BW6B 3T4EA 3V7NA 5G1OA 1KDOA 2BC9A 4PZ0A 1NSYA 1FNSA 4O4HF 4OSPA 3NV7A 4QUIA 4W8GA 2R8BA 4AY2A 1FC0A 1NDUA 1ND5A 2V5VA 5HJ5A 1D4OA 1T5IA 3CONA 4TQAA 4ZI7B 1EWTA 2WJGA 3IAXA 4RNDB 3GELA 2HOQA 1J8MF 1FE8A 4FQ5A 4TM7A 3O4JA 5CPBA 4J3FA 3RAJA 4U7TB 4KE9A 4N8SA 4IXWA 5AR1A 3WK4A 2RH8A 3UAGA 1M6YA 3JS5A 4URFA 1T5SA 3UB2A 2O1WA 2QYHA 3L4EA 3TUJC 3JSAA 2HSEA 2ZG6A 1IEVA 5CVJA 1GARA 5A5EA 1G7TA 4ZDJA 3INYA 4AIIA 3P9QA 2AR7A 1EA5A 5A1JA 1KHHA 2C4NA 3MG9A 2TS1A 2M6LA 1M6HA 1I24A 1BYUA 2OVFA 3ILVA 4RB0A 4XVUA 1A4XA 5KT2A 1E1RD 2PN1A 3MN1A 3N40P 2OORC 5EC8A 3K0FA 4RVHA 5B2ZA 1JX4A 1N6IA 2DFTA 3D8BA 2OPBA 3FZYA 1JHOA 2WINI 5GZ1A 4JSTA 1BFKA 2A94A 3FYDA 2NU8B 4RVUA 1NT4A 3KVYA 1TZCA 1DVRA 4C0BA 2AHOA 2VCHA 2QI9C 1BRTA 4BAZA 1UXIA 4W82A 3NANA 4BBAA 5KSOA 4OLFA 1XRQA 1YA6A 1WKVA 2F1KA 3B53X 2DIKA 1PS8A 3HDGA 1CY4A 1FNCA 2A0KA 3H1EA 3LL7A 4XDGA 4H3KB 3FR7A 1ORWA 621PA 2Z0MA 2CJYA 3TTSA 2NXEA 1F14A 2WF8A 1BWSA 3QKIA 2DT5A 2H1SA 1ZISA 2HK7A 4KO3S 1SHLA 1VB5A 3W4IA 4CKBB 2W8KA 1T0BA 5AVSA 3U7RA 1RYDA 2B5OA 2OD2A 4KSCA 4G5GA 1S1CA 3FN4A 1IJEA 3H0EA 1R0KA 4ID9A 5EZYF 4CR7A 2ECFA 1RAFA 2FDRA 4PSUA 2J3DA 4QSHA 4GWKA 1J9GA 2WHPB 3I9LA 3CVUA 5B1IA 2PFKA 4YRMA 4NQZA 3CPSA 5AI9A 5KFDA 2PCJA 1RD4A 4FR5A 2CXUA 2RJNA 1JEJA 3W2TA 1UK9A 1I33A 3ZCPA 4WDRA 4BQSA 3GBPA 3H4MA 4L4UA 1ONBA 1X9IA 5TNXA 3ENWA 1D2GA 1M6NA 1R6TA 4DL7A 4JLNA 4NEQA 3LFUA 2OD9A 2REQA 2E0IA 1I8TA 3RC9A 2G5CA 3GGSA 5GZ6A 1JEYB 3SGIA 3FVQA 4B76A 1C3VA 3A4YA 3EVFA 4C14A 1G7SA 4TOIA 4BGUA 5H80A 5BNTA 2XH8A 3FTDA 3ZWQA 4M76B 5C5JA 3RFVA 5I45A 4LRYA 4FGKA 3R7FA 2XLBA 1Z6QA 1Y1QA 4IKPA 1LH0A 3FDJA 3LT0A 1HL7A 2G6BA 4FBUA 2XNKA 4WVFA 4BMCA 2BFDB 1E3WA 2F59A 2WPNA 3S1AB 4XRRA 1X7DA 3W8EA 1EXWA 1BMFA 3HNPA 3V3KA 4D92A 2ZJ8A 1ATIA 4HDKA 3ELWA 1YDHA 4G89A 4KPYA 2BFPA 4OQEA 3C87A 3JATA 1ZH8A 4JDUA 3P19A 3N0RA 1F0YA 2CFTA 2HD4A 5TMPA 4FS1A 3MAJA 2IYYA 4G1EB 1M1XB 1NN1A 2WFLB 2DBVO 3EHEA 1Z3IX 4YP3A 3D5TA 3EN0A 1RZ3A 1Z4PX 4R4JA 3PI7A 4UFOA 5FWXA 4CHGA 2E1RA 3QLJA 3GTLA 2PS0A 1IQRA 4PCAA 3BX1A 4B3FX 3GFPA 3BWMA 2B98A 1XYGA 1TZJA 3JV7A 4AICA 4XQCA 2AUTA 3DZJA 4KO1S 3DJYA 2AYYA 3T7TA 3WFIA 4YXFA 1P2TA 2J0QA 5TC4A 3NALA 2XTNA 2CWDA 4XAQA 3RTGA 1VHTA 2E89A 2ZRLA 1MX3A 1N0UA 4IRXA 3AUFA 4EG4A 1A7JA 4R05A 3KKNA 2WP0A 5JXIA 1ODLA 1U9ZA 4E5MA 1ANKA 2FP4A 2N0SA 5MN4A 3H4IA 3H16A 1P16A 3G89A 4ZEMA 1IXYA 4CF4A 3LY9A 4RY8A 4RTJA 4QAJA 4KN8A 1JNXX 3D3NA 1T2DA 1KAOA 1ESMA 5GV8A 5FX2A 4HFJA 2Q3JA 4OM7A 3ZD6A 3HB7A 4X93A 2AEMA 4MKXA 5JPDA 2QRHA 4OU4A 4ECRA 4Q34A 4CLHA 3SQDA 4ZK2A 1MZVA 3ZHUA 4XB1A 3K70D 2WSLA 5FBWB 1CW2B 2CCJA 3ISTA 4GI5A 4CLEA 1SXJD 4MW1A 1ECLA 4PXAA 3MR3A 2GK7A 2I0FA 3AMVA 5DFAA 3BMNB 3WKAA 3BE5A 1VGRA 3U3RA 4RAYA 3VGPA 2G0AA 3HJHA 4Z4IA 2ZJYA 2VBGA 5JCOA 3TQCA 3N74A 3HABA 1VE5A 2NTNA 1RKQA 4CM6A 3KT3A 5ES4B 2W6NA 2V97A 1GPNA 5A9SA 5FI3A 4CKWA 1DWQA 4XIJA 2AI3A 3OCJA 2VJPA 4RVDA 4PRZA 3P9PA 4E1AA 4C4SA 5ADHA 2RHHA 2YYZA 2X8JA 2RH4A 4CKZA 3OESA 1MOSA 3JTEA 4TVKA 3V8VA 2P4QA 4AF6A 4KYVA 4UM9D 4AK9A 2FEXA 1BX0A 3KV1A 3HJCA 4N9QA 2VBFA 2O2ZA 3K0AA 1A27A 3DP9A 4GF5A 1DLIA 5FOXA 4HN2A 2GYVA 2GZRA 4H0CA 2X0FA 4HQKA 3J81k 1QX4A 3LUKA 1KGDA 3CSUA 1AA9A 2Q6TA 1Q1BA 2WIKA 2UXCH 4PANA 3AHDA 2AR0A 4LOLA 3PJEA 1NY6A 1ZD4A 4YDRA 4BRWA 1CUHA 1XMOH 3UT6A 5ITSA 4LNHA 2P2NA 4QIHA 5I7SA 1JL3A 4R01A 2HJSA 3IAHA 1UQTA 5ALFA 2RJOA 3HKDA 2OGZA 2NX2A 5D87A 1PG5A 3A3KA 2W6PA 2YQ4A 4JCOA 4FB4A 1I10A 4B79A 3STHA 4NK4A 1W94A 2V8OA 3F6PA 3ILSA 3QLUC 2GDJA 4HQ0A 1WG8A 1S8OA 2FUNB 4DV0B 3PCRB 1U31A 1W0JD 3D31A 5BSRA 3ENKA 1K0UA 2P68A 1YR6A 2OD7A 4QFBA 3TW7A 3ROXA 3PICA 3GLQA 1Q1QA 1UPAA 4U7HA 5CXSA 3WL4A 5CB6A 2HRCA 1TFUA 5KT7A 2HLDA 3VOSA 2VHCA 3WLHA 1TU0A 3V32A 3OMXA 1VKJA 1LKZA 1Z8NA 1S89A 1OU4A 3AOGA 3COZA 1L7AA 3VR2A 2RGNA 4Q1EA 5A6SB 1C4OA 2R11A 3BK2A 4O2AA 4UNNA 1DBSA 1BDBA 2JRLA 3O4RA 1AT1A 3TR6A 4LFAH 1JG4A 4H15A 3I28A 4F4DA 2RI6A 4ENRA 2IYVA 1KDZA 3P0FA 4Y2PA 4WLEA 3G0BA 4FFLA 4DHEA 2G5GX 4EYGA 5DEOA 1LRJA 5E6UB 2VSYA 3ZXXA 4L76A 4YV7A 2I4RA 2XA9A 1R0ZA 3GT3A 4PLPA 1D2RA 3VR3D 3U6KA 4X92A 4U6SA 1QQBA 3BIJA 4MUXA 3H8SA 5LQRA 4F3RA 1KJQA 2JFVA 5FA5A 2A14A 5CVCA 2YZKA 5BW8A 4OQ4A 1HNNA 1U3CA 2NG1A 3O31A 1MHPA 1CB0A 3PFIA 4PSDA 1IOVA 3DOEA 1XXLA 1G3UA 4RTRA 4QO8A 1NXPA 2HGWA 4GX1A 2PX3A 3E05A 5EYPA 4OAQA 1KI6B 2AMYA 1CJTC 2IT1A 4RB2C 1SC9A 3NCTA 2VPIA 1BXRA 2Q7XA 1XLTC 3BMOA 2D7CA 1YTLA 3BH6A 1XRPA 5LIPA 3HA7A 1A3CA 3DL2A 1JT9A 1MENA 1E2HA 4LF6B 3OZRA 4QPPA 4B7XA 2XBUA 3GZ4A 2PNJA 3N70A 4UDOA 1ADFA 2ZXFA 4LCEA 3PEUA 3W5JA 1JJVA 4J6EA 3O3MB 5CHYA 2PT9A 3B48A 3K9BA 3CWZA 4MWSA 4EFDA 4UEQA 1G3MA 4YJFA 4CMDA 1IN4A 4O1MA 3KPVA 1BN7A 4OAOA 2VRCD 2J0UB 4OMUA 2HMAA 5LJIA 1OVGA 3AFIA 3U44B 3UV6A 2E5FA 3SXJA 3DZDA 2JFBA 4IOLA 4TXNA 2NUBA 1I9CA 4G86A 1RXSA 1UBNA 3L7MA 4DDWA 2QYSA 4CDNA 2AFIB 4JT2A 4V0KA 1CF4A 4TKUB 4D0LB 3LYAA 4A3FG 2RGRA 4C5AA 3HDQA 2COIA 4IM7A 4RNCA 3F7OA 4J9QA 4LQDA 3V8RA 4I46A 3TW6A 2X13A 2XDYA 5GV7A 3FVWA 1Z39A 3OJWA 1XPJA 1EP9A 2KLHA 1JFVA 2EGGA 5IP5A 2YN2A 4GMGA 3GFSA 1HTBA 5KJEA 1U0JA 4EJSB 4ZOQI 4QC2A 4QBIA 2WPDD 3UJCA 1V5EA 3BL8A 1FJ2A 5LP6B 3KQQA 2WIGA 2HRQA 3KOXA 3W5OA 5KYWA 2AGVA 4OXRA 2NUAB 1IRIA 2ODBA 3EB9A 4D81A 3P9KA 1D09A 4P7GA 3V2GA 4ECUA 5BWLA 1UPFA 2W2MA 5C8YF 4PFSA 1VJ1A 5DM70 1GXSB 4IGKA 2REOA 5K3FB 4PNHA 2I2DA 2NW6A 4MKGA 4CIAA 5I7OA 3E6AA 2HSZA 4DIDA 3SKVA 4Q4DA 1QFYA 4EQ6B 2QE6A 2I1LA 1PYGA 2C9CA 2ZTSA 3K3VA 1EKVA 3KJIA 3NT2A 1PYDA 3FPFA 3JQAB 1CETA 3C8DA 5DXFA 2EW2A 3TZEA 5KDOA 2VDWA 4FFVA 3C3AA 1KKUA 1QS0A 4ZHQB 3PUJA 4XXHA 1R9MA 2M1XA 2WVJA 3X2SA 5EMKA 2YXEA 1YRLA 2JHCA 4WLUA 1DDOA 4W8OA 3RQSA 4GKJB 3FZGA 1RLUA 3LYUA 2OAP1 1PG0A 4NJOA 4CKXA 3PT5A 4IWNA 3PXDA 2QTVA 5K3SA 4CL0A 2HRZA 4JYPA 5CX4A 3HCWA 4GVXA 4TZ0A 2Y6UA 4TLBA 5D86A 2LTAA 2XDQB 3E7XA 2Q5QA 2IX9A 1VLQA 1RPNA 1BG6A 1HF3A 1QZZA 1EX7A 3RR5A 3ER6A 3WZ2A 2V0NA 4UQPA 4LTNA 1J0AA 2PL5A 4L3OA 3PUXA 2D1TA 4DDKA 5AVYA 1V1RB 3JQRA 3JQEA 1TUEA 4K5QA 4E46A 2RGCA 2EBHX 1HEYA 2HU8A 3OLXA 4XLLA 3ZDFA 4XWTA 3F49S 3GLIE 4YMGA 2D13A 3V4ZA 4UNSA 3I6MA 1MJHA 3HMQA 3DTVD 1VSBA 4CMFA 2P30A 5IZCC 5CVVA 1FYXA 2IYWA 3PNSA 3SQXA 2Y68A 1XVTA 1DU4A 3AP3A 4BKQA 1W5BA 1CRZA 3GCDA 2HQ1A 2XLCA 4HUQA 5F9LA 1U9IC 1XDSA 4JHXA 5CNJA 5EESA 1G20B 3QMVA 2PUTA 4MUMA 4CTNA 2FPPA 3QYFA 3GYGA 4LXIA 2GZDA 3AYXB 1YJ8A 5DN6D 3P2IA 4CXMA 2Y4NA 2WTUA 1ZVMA 1X1CA 3Q1KA 4ZFNA 5L51A 2OPHA 4DIEA 4UUBA 5FR1A 4XUEA 1FU7A 2JG3A 3HU5A 3RB0A 2EWMA 2OUIA 3BMQA 3PHLA 4ZYLA 2PPLA 1YJCA 5AO9A 4OLJA 3S4YA 2JK1A 1NLUA 3ZE7A 2O4CA 3K3PA 2MINB 2JFNA 13PKA 4DANA 5T7BA 2CL6X 3OM9A 4FPXA 2V6IA 5TIIA 1RXVA 3HU2A 2OV6A 3I04M 4LN1A 4Q16A 1KNQA 3NS7A 4A10A 4F4XA 4R3WA 4PLGA 4DM3A 3QWHA 1M7GA 5IT4A 3HXPA 3SDZA 2H1VA 4ZVNA 3I30X 1INLA 4JI4B 2WYWA 5DAAA 1QU2A 4DIMA 1JHRA 4GNRA 2HL6A 4RPHA 3EA4A 1P29A 3UJ8A 1L5LA 1DADA 4JT9A 1M75A 4PZUA 2PKYX 5CFLA 3RC7A 3C70A 3ZGNA 3WLFA 1WKCA 4EUSA 4OXNA 4WASA 2Z2XA 3IQIX 3ZQKA 1N92A 1BGWA 3DHEA 4O4IB 3ZS9A 2Z2YA 4H7DA 3TLCA 1QWOA 3PEVA 1KEPA 1ML3A 5GGYA 4DJAA 5AKGA 3JWJA 1WPXA 3PX7A 1OKKD 2BFWA 3K1YA 1OV6A 4A8HA 4EY4A 3ND5A 3GTMA 1QQTA 3IA2A 4KO8A 4D4KA 1XJCA 1NGSA 3MGCA 4EUEA 2GXAA 2QMHA 2TRSB 5E4FA 3DDWA 2P1ZA 3CEMA 5JCJA 4UCRA 5EXEA 3B9RA 3TEMA 2DQKA 1Z63A 4NBSA 5T8KA 4J0IA 3U6BA 1SQ0A 1RU3A 3I2JA 4QOEA 3LXXA 1IIBA 1VMAA 3L6OO 5TQ0B 2EYUA 2FMUA 5AK6A 1TTTA 3CIFA 4R1LA 1XRJA 4G24A 2IXAA 1TUGA 1ZI8A 4I4CA 2O0LA 2JGMA 4IIBA 1XNRH 1RQXA 3EVCA 2YOGA 1DE0A 1NV8A 4BFCA 3WAGA 3GAFA 5TT0A 3WVNA 3PCXA 4EEZA 4I4TA 4C2BA 3HSSA 2JCVA 5I3ZA 2BTOA 4J7AA 5D6OA 3LGAA 3RFTA 4BNNA 1MH9A 3KFVA 3L6BA 4PS1A 1K89A 3WWOA 2OQVA 3UCXA 3ESQA 2H54A 4Q0YA 5AVOA 4MVXA 4BN5A 1LF0A 3DOJA 3DB2A 2QRZA 4J03A 2XF8A 3C41J 2QW8A 4FMDB 4R6WA 4W1QA 3LECA 5DOVA 4GLFA 2HVRA 3DAHA 3DTGA 3CINA 1OAOA 3A6GA 2HF9A 5AIAA 4C05A 2CNBA 5LQMA 2Y92A 1EWQA 4YUXA 3W4JA 3L0IB 5C32A 3KZCA 1YUMA 4JXKA 5DYTA 2IU6A 5EJAA 3AF4A 1KSGA 3IB6A 4FNGA 4PZ6A 3O4IA 1E2JA 5ICEA 4CGYA 2O19A 2YWFA 2VQEB 2FSFA 1YVDA 2X14A 1Z7EA 2XQVA 1VJ0A 1B23P 4D0SA 2V1XA 2V7GA 3TQOA 1N8TA 2Q45A 3ACCA 4N3GA 3HXQA 3D8HA 1JKIA 2V0CA 3KLNA 4F5WA 4IWYA 1FPMA 3GTGA 1CKEA 1T5OA 2ZCUA 5E9QA 1CSEE 2OENG 5JWHA 4Z8XA 2K6GA 4E3WA 4JI2H 1WCIA 1QH1A 4RULA 1NYTA 1X70A 2ZYTX 5LQDA 1Z0ZA 3LUPA 2GBLA 4EO7A 4EZEA 1M2OB 4YK7A 2EC5A 5C4MA 2I6UA 4FMDF 4ZCIA 4B6GA 2Q0SA 4F4UA 2Y05A 4Y2SA 4HS9A 4MA0A 1JPUA 4LIPD 4BO6A 3GTQA 3AUUA 3ZJUA 1Z16A 2ZIXA 2UYOA 1JQKA 2R751 5JPCA 3NTXA 3U09A 1GQQA 1ZNXA 3K1AB 5JDIA 4YJ2B 2E5LH 4X63A 2VWQA 3AU9A 2CXRA 3R7LA 5KG4A 3N43B 1NXSA 4KQKA 2GLTA 1N5KA 1VXOA 2I7XA 1E92A 1G2OA 1Y1LA 1CDZA 3DPSA 4Q4AB 4BVEA 4HN4B 2QL5A 3PVCA 3OAAD 2PQ0A 1KY4A 1IOZA 3W78A 3JASB 1TQHA 2PQ2A 3SG0A 4DUYB 4P4LA 2DFDA 1ZS9A 1JXAA 1YFLA 3CJRA 4P8RA 5HZMA 1I80A 3WYCA 3BXEA 2NVUA 2AX4A 1XRNA 2G3YA 4IAJA 1NFQA 4UMEA 5FPRA 2ZE8A 3OETA 3QWFA 3NIWA 1IONA 2WDPA 2JLSA 3GMDA 3FUVA 2H65A 1KE1A 5AVJA 4WW0A 2FEKA 2D00A 4C7BA 4DLVA 2WUFA 1N4DA 4ZU1X 1YZ3A 2RGDA 4TXMA 5KDLA 1CBUA 3SF8B 4GDMA 4UFNA 3ZE6A 4W5OA 1S5PA 1ZRSA 2EFYA 3GPBA 2XMPA 5TVKA 2J6IA 3VDXA 5EUCA 1MT0A 1C0IA 5KJFA 3C74A 2IEAA 2YV3A 2GCGA 1IUNA 1UBHS 4DV7H 2XJ9A 2OBYA 3KYJB 4MRNA 3LIIA 2PEYA 2UV8A 3KKZA 3F1KA 4XYLA 3DZKA 3H2JA 3G88A 3ILXA 4JV2A 3MQFA 3G82C 2I6QA 2GTIA 3ZCXA 2XVYA 2W57A 3D7KA 1QO7A 3D3KA 3OOJA 2WTBA 1JVNA 4EG8A 3MOSA 1SUIA 4Y7DA 4JP5A 3RRNA 4CF6A 5FNVB 1FFXA 4NDNE 3FMVA 5K0FA 3CRRA 2WU8A 1RRVA 2PSEA 1SVNA 1JR6A 4KOEC 4EGCB 2R8RA 3FPLA 1VJDA 4JVSB 2HO5A 4O25A 8OHMA 4M46A 3RRBA 3OKCA 3BE8A 2JJ1D 3BXOA 1SCNE 1UJCA 4AUEA 3D6JA 5DSZA 1LV7A 5BQPA 3H3XA 2WZDA 3AF1A 1TC2A 4P2BA 2BOVA 3V5NA 2FXIA 5B1YA 4DQ0A 1D04A 3U4MA 3SVTA 1EWKA 4FYVA 3B70A 4LV6A 4YRNA 3OM1A 2O03A 3Q8XB 2P3LA 5FD8A 3UA4A 5GVRA