5CAEB

Succinate bound to pig gtp-specific succinyl-coa synthetase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structural basis for the binding of succinate to succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
total genus 135
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5caeB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5caeB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5caeB03
1EUDB 2CNVA 3KAJA 1M6VA 2HJWA 5JVLA 2NU6A 4YJ3F 3ETJA 1W93A 2YZMA 4O7WA 3TW6A 5LXTF 3VPBA 2VPQA 4O2BF 4FFLA 3G8CA 1GSAA 1A9XA 1CQIB 2GQSA 3OUZA 2IP4A 3ORRA 2WYOA 2FP4B 2NU7B 3E5NA 3RV4A 4XX0B 3WO1A 4IHJF 2Z02A 4EGJA 1EZ1A 4O86A 1KC7A 4O2AF 2W6NA 4O7YA 4ZQIA 1JLLA 2R85A 2GPWA 4MA5A 5CAEB 4M9UA 4ZOLF 1EUCA 2FPPA 2DZDA 1SCUA 4YAKA 3RV3A 1Z2NX 5D8DA 4XYMA 4O4LF 1IOVA 3BG5A 4FU0A 2FB9A 1JDBB 2R86A 3K3PA 2YZLA 4MV4A 1IOWA 1VBGA 3RFCA 3MWEB 4Y8VA 2CNUA 1UC9A 3N6RA 4HQ6A 5C1PA 3AW8A 1CQJA 2C00A 1GSOA 4ME6A 1EUCB 3SE7A 2VR1A 4FFRA 2CSUA 2R7MA 4YBZA 3R5XA 1Z2PX 2FPIB 3R5FA 4XZ3A 2Z04A 4HR7A 2R6FA 1UC8A 4O83A 2YL2A 4XYLB 2R7KA 1BNCA 5HV6A 1B6RA 2X0SA 1B6SA 4O84A 2GLTA 4L1KA 1A48A 5KKNB 3V4ZA 1ULZA 2I87A 4O7VA 1CS0A 3MWDB 4IWXA 1E4EB 4O4HF 2XCLA 5DMXA 4FGRA 2YYAA 3HB9A 4YB8A 3JRWA 4C5BA 2YRXA 2R84A 3TINA 3UFXB 2SCUA 2PBZA 3TIIA 1KJIA 4FFPA 3K5IA 4HNUA 5JVDF 1KEEA 2ZDQA 2NU6B 1VBHA 3WNZA 5IYZF 5EZYF 2ZDGA 4RZQA 4TUYF 4E4TA 4MV7A 3U9SA 5JQWA 1W96A 2SCUB 1DV1A 3I12A 1GGOA 2HGSA 1T36A 1M0TA 4MV9A 2YV1A 4O82A 1DV2A 2GQRA 3MJFA 4MAMA 5LYJF 1C30A 4QSHA 2W6MA 1EYZA 5JQGF 2YW2A 1PK8A 4FE2A 2W6OA 2GPSA 4MV6A 4HNVA 4MV1A 2W6ZA 1OBGA 2OLSA 1JLLB 5LP6F 2YRWA 2FPPB 3ORQA 1SCUB 4YAKB 3LWBA 3KAKA 4FFNA 2NUAA 4O7RA 3VOTA 4XYMB 1KBLA 2V58A 2QK4A 3JZIA 4ZHQF 1JKJA 2CQYA 4C5CA 5LA6F 4NYEA 3DF7A 4Y8VB 2NU8A 2NU9A 2FPGA 3HBLA 2YV2A 1KJ8A 1CQJB 1PX2A 2YWVA 4YAJA 1EUDA 5CA0F 5H80A 5JH7F 4IZOA 3DMYA 3R5HA 4YBZB 2YZGA 1DIKA 4XZ3B 4WD3A 5J2TF 1EHIA 1CQIA 1AUXA 3KALA 3G8DA 4O7LA 1WR2A 2XD4A 2FP4A 3KREA 1OI7A 4XX0A 3U55A 3WO0A 2VQDA 4MA0A 4C5AA 3V4SA 3OUUA 5I47A 3AX6A 3Q2OA 4EGQA 4I55F 1GLVA 5BPHA 4O4IF 1KUTA 3Q1KA 4O81A 2YZNA 1I7LA 4O7NA 5CAEA 3VPCA 3U54A 5BMVF 3LP8A 3VMMA 5BPFA 4YB8B 2QF7A 4O7TA 4O4JF 1KJ9A 2ZDHA 2PVPA 3R23A 3JRXA 3VA7A 2R7NA 3JZFA 4I4TF 2W70A 1KJQA 3TIGA 3ETHA 3MWEA 2YS6A 2J9GA 4FFOA 4TV8F 2DLNA 2DIKA 5LOVF 5K2MA 1GSHA 4DIMA 2W71A 2P0AA 5CA1F 3QFFA 1JDEA 2V5AA 2R87A 5FNVF 2PN1A 3U9TA 3VPDA 2FPIA 2R7LA 1CE8A 1KJJA 3HO8A 3TQTA 1Z2OX 3NUAA 5J2UF 2I8CA 1BXRA 4YJ2F 4WBNF 4XYLA 5C1OA 4MV8A 4DLKA 2YS7A 2R82A 3N8DA 1AUVA 4ZI7F 3RUPA 1VKZA 2CNQA 2CZGA 5HBRA 4FFMA 3MWDA 4HNTA 1E4EA 5GONF 2NUAB 5KX5F 3GLKA 5C8YF 3PFFA 2W6QA 5CB4F 1JKJB 1C3OA 3R9RA 4EG0A 4I50F 1I7NA 1M0WA 4MV3A 4IWYA 2NU8B 2NU9B 3UFXA 2FPGB 1OBDA 2W6PA 2V59A 4O7SA 5HBRB 4TV9F 3GIDA 2NU7A 3K5HA 2I80A 4O7ZA 2DWCA 4IIJF 4YAJB
chains in the Genus database with same CATH superfamily
3CLSD 2IVZA 1E0AA 4CF3A 5TT1A 5KTNA 1U1EA 2Z2XA 3KYDA 3VAZA 5AM1A 2KE5A 1Z45A 1W76A 4HKTA 3O1HB 3MAGA 4RDXA 3CVXA 4JL5A 2XYVA 1AGPA 4JLDA 1VXRA 3A3PA 5DVZA 3WWHA 4DSZA 5CVCA 2ASVA 1RBQA 4I81A 1RC0A 4TQAA 5MN5A 2Z8XA 4NXMH 2F3UA 3T95A 1QE5A 4OFBA 1GP2A 4D3ZA 4QIHA 3UPUA 1E3IA 3WIBA 1UPFA 1KJNA 3VC2A 2AE1A 5KG3A 2ZB2A 5CDTA 4K86A 2JHCA 1X14A 1YZTA 1MGPA 1SR8A 1RVV1 4AXBA 2MU1A 1DOZA 1I1HA 4MICA 1RQXA 3A6GA 3PI7A 5J23A 4JIGA 3H4BA 221PA 1VAJA 1EGVB 1ORWA 1SC4A 1CQZA 4OGLA 4F96A 3TXXA 1HTTA 4NCXA 2BFCB 1ZUWA 1BVHA 2F64A 2XY4A 4EPTA 2ZQ5A 3UOGA 1WOYA 4XDHA 3H2SA 4IV0A 5EWMA 4F5YA 2GRAA 5GJBA 1VTKA 1QIIA 2Y0SE 2X8JA 2JFOA 2WAOA 2R60A 2ARKA 4AZSA 4ABYA 2VHYA 5HF5A 1DBRA 3DAPA 3AUSA 1G20B 5BNTA 5BSKA 2CMDA 2IJGX 3ET4A 3QXXA 4FVTA 1U90A 3A3NA 3OF3A 2W11A 1FFDA 2VAXA 3KPVA 1HDIA 1PBTA 2M9MA 4BP1A 4NDZA 2RK3A 1GPJA 3OQVA 4E12A 4FE3A 2M1XA 2QK4A 2HSZA 1J56A 2DOKA 3GP5A 2YV2A 3KBBA 2HYIC 4Q44A 3DVRX 3O82A 3G0DA 4F85A 4IW3B 5ISMA 1HDEA 3N0WA 5CA0F 1KI6B 1ULUA 1QJ4A 4AI6A 2IS4A 1OF1A 1YOVA 4KIJA 1LQUA 2NM0A 2ZAYA 2R8RA 3NVDA 3G49A 1RKVA 4HAUA 4U6SA 2XD4A 3WWOA 4OREX 1PD0A 2GGSA 3NCHA 5FWYA 9MHTA 3AX6A 3EIQA 3EW9A 1LI7A 2KB0A 1E1RA 2UVVA 2WM2A 2CKDA 1JFLA 3E84A 3SE0A 1P8AA 2PLNA 5J2TB 3SLGA 5E2BA 4QGBA 2WINI 3CEAA 3VKWA 3THWB 2XGJA 4XTCS 3Q8QB 2XE4A 3G6VA 5BWOA 4ED0A 1T10A 2KQUA 3ISJA 4IDNA 1PT8A 5JUMA 1FVOA 4NSNA 3PW2A 1S0OA 1YR7A 2YRFA 2WUDA 3ADPA 4F9TA 3ENNA 3IEMA 3FBTA 2H29A 4G1VA 3STTA 3L4KA 1OAAA 1T36B 2FSGA 2Z9DA 3TI9A 4HNGA 1OV4A 1HQKA 4GNKA 1VL0A 3INRA 3BH6A 4ZAXA 5D1HA 1W1WA 2J09A 3BWCA 1OB2A 2KX7A 1M10A 3R74A 2VQEB 5HUJA 5HUHA 3MWLA 1JEDA 1TA4A 4A2WA 1S1MA 2HLHA 4DDHA 3G0GA 1PJ4A 3E1SA 2NVBA 1QF7A 3E3LA 4FP9A 4IWYA 3RUAA 2BHRA 3SYKA 4O3MA 3IV7A 1ARZA 1E9VA 4APMA 1H9BA 1QR2A 3A1FA 3FYUA 2ZJ4A 3OJLA 4RZHA 1JALA 3HXOA 1MAWA 5E3HA 3K1ZA 3A26A 4J1TC 3I4MG 3D3JA 3ESBA 5DHFA 3ORRA 4EW2A 3SEAA 3ZDRA 4GOXA 4E0BA 4O86A 3RD5A 1JE0A 3NAQA 1NW5A 4S0ZA 4R5HA 2F9LA 1MP0A 1YVEI 1L5RA 4OK6A 2C77A 2EZ8A 3TW7A 1I2KA 1JFFA 4DANA 4MMXB 1PK7A 3D3EA 3HHPA 4MVWA 3W5OA 3O8RA 6PFKA 3AFNA 4Q1BA 4HLQB 1WDMA 3OCZA 3U7FB 2QW8A 5TARA 3LULA 3UK0A 1KAEA 1XNJA 4EAAA 3KOMA 1Y37A 3WWPA 3HSKA 3B89A 1NBMD 2JA8G 3HU2A 1K83A 4ZEVA 3B5IA 1UZAA 8GPBA 4W63A 2VHVA 4C21A 1D2NA 3HVUA 1GVHA 4NFYA 4CGYA 1XPJA 4OLHA 2GN4A 1JPUA 3D1VA 4HPXB 2ABJA 4J0HA 5CB6A 3QMWA 4TVBA 5C4IA 3OX1A 5LBUA 1IBLB 2PLRA 5AK5A 3N0RA 5L1LA 1CDZA 4B4UA 3LGXA 2IUEA 5IULC 1OW3B 2EW1A 1RQLA 1SN7A 3EXG2 1WG8A 5ILGA 5H59A 1TKBA 4U7DA 4IMJB 1JYSA 3KVYA 4CG1A 5IYZF 4MJLA 1QONA 4DV5H 1NT2A 3N8KA 4XAQA 5LDGA 3SZLA 4MRVA 3KHRA 3VO1A 1DARA 3QVJA 5EE0A 4ND8B 3AB7A 2H0AA 4DMKA 4JP1A 2EJUA 3JVDA 4RPLA 3CGGA 3ZV4A 1I2AA 3K72B 4ZOBA 3GTGA 4MS3A 4HQLA 5L7WA 1PG2A 3NNDA 1ZI6A 4IDFA 5AJHA 4OU5A 3DMDA 3KVNA 4RX1A 4G5FA 4DJFC 4E11A 4GXTA 4WNYA 1QIFA 4X93A 4XJVA 2QIOA 2QMOA 2DP4E 4D9FA 1BCSB 1AY0A 4RVFA 3VU9A 4LDNA 3P9QA 3HDTA 4FZ3A 1HG1A 4B83A 3T1HB 1EKPA 1WZNA 4QYXA 1L9XA 2C3UA 1JPJA 3HABA 2BR3A 3NHRA 3GRCA 1OH8A 4LHSA 1XMXA 2VH2A 2BFAA 3T5PA 5HOQA 5HIJA 1N9KA 3EDMA 4KLCA 3Q6MA 4C4XA 5HILA 2R11A 2WKPA 1T5LA 5SZKB 4ZAFA 1UWVA 3NIWA 4EL5A 3ANNA 2ODBA 3MJHA 4DMLA 4X62B 3M81A 3ONDA 4MPRA 2FJZA 1YDGA 3NDIA 4AG3A 5FJJA 1W0CA 3BX1A 4YRCA 2EFYA 1Q1QA 1PVOA 3THYA 1HORA 4YK7A 4BJ5A 4WJLA 3TI7A 1OGYA 5D00A 4C6TA 3DE5X 4N76A 1O1YA 1D2RA 2H1VA 1XQ1A 1BXRA 4YJ2F 5KG4A 1U0EA 3W06A 3RRMA 3VTAA 1GG9A 2HCFA 2P78A 5T3UA 3R8FA 2QRHA 2L69A 3BRCA 1MXHA 3I8XA 7MDHA 4IR1A 3OSUA 2Z9BA 1W5EA 2MCFA 3AHFA 3WYNA 4B45A 2R25B 3WLMA 1X1DA 4UBJA 3K4QA 4AW9A 3CSSA 4GP6A 3MWMA 5I8WA 3TAHA 1CEEA 1YIOA 3AHGA 1HT1E 2C42A 5AVUA 5CE8A 1BQ4A 5EE3A 4D79A 1KDTA 3CZ5A 3UHFA 2R65A 5F2OA 5JJCA 1KR2A 1IAQA 2JAQA 5CFRA 1CY1A 1RZ3A 1TYAE 1V9LA 1GGHA 5FLXA 4HO1X 4RF5A 4JWKA 1KC7A 2PZEA 2RGUA 2YXEA 3S8EA 5HR5A 4QBKA 4D26A 2IUTA 3VR6D 5LUAA 3P0FA 1PTKA 4M9UA 1EUCA 3HMQA 4LFCH 2W8BB 3PHHA 4HH4A 1LTHR 4NCJA 1QK3A 3JZDA 4NF2A 3RH0A 2IZ6A 4IO0A 3EXIA 4YVFA 2HMUA 3QQ5A 5FD5A 1RYFA 2GB4A 2DMRA 3HJGA 1PR9A 4TLBA 3BA8A 1YTLA 3ZHRA 1SK9A 3GV8B 4N0MA 4OMUA 2QP3A 3PLNA 3NOOA 5ALRA 4TGLA 2P5YA 1YS4A 4ZT2A 1QS0B 1XLTC 2FY8A 3RU3A 1SPXA 2QVBA 3WYGA 3WDKA 4O84A 1O2DA 1ESDA 1BRMA 3EARA 4NONA 2X86A 1BWPA 3HACA 4K6HA 4LV8B 4BKMA 2YYAA 3W5AA 1V95A 5GAJA 5CM9C 3O26A 1JN0A 3LBNA 2VI5A 2D7CA 1CF4A 1N78A 3DC2A 4IDEA 4H15A 1LCIA 2W6ID 3GJ0A 4G07A 1X7DA 4B79A 3VPFA 3WGMA 1KVQA 3ZWVA 2VHXA 1FFSA 2FKLA 1XVLA 1IM8A 2II6A 1NW8A 3HNRA 4MMYB 4ACAA 2O7VA 3FLEA 3GROA 4V0QA 3GDHA 2GFHA 3BVPA 3UMCA 2YZ7A 2DWPA 3CQ9A 4I9GA 2GKGA 1X3SA 4GSKA 4FE2A 1EFPA 4HNVA 3H9QA 2H2AA 4BNGA 1IN6A 5FPTA 2ID7A 5E4YA 2H4YA 1Q3KA 3R7DA 4ZIRB 3AB3A 1DC5A 4OSEA 3N8GA 4GVPA 5GMOA 3VHXA 1GTZA 1RI3A 2P2SA 4TZ0A 1UANA 4XUEA 1U4SA 1Z6ZA 5DG8A 2O03A 5JDCA 3UUGA 3GZJA 1KSJA 1ID8A 1YUNA 5K3FB 5LP6B 2CN1A 1LLDA 5D01A 2R8XA 1TC1A 2VQ6A 4K9OA 3MB8A 1PS8A 3U61B 2VSYA 5FLXW 1FS4A 1VPWA 2TECE 3FCAA 5T41A 5K09A 1BS9A 2JEZA 3KB1A 1D1PA 4JBIA 4ZICA 3PFBA 2BE9A 2VZLA 4I1VA 4L76A 4I5FA 3HKBB 2YXBA 2OO5A 2NVUA 3GH3A 4MVJH 2FJUA 2AHOA 1Y1VA 5T4EA 4KU4A 4UARA 3B1FA 3NV7A 1TEZA 4X6XA 1D2EA 2BYTA 5HJ5A 1KYTA 4MQEB 1NQWA 6Q21A 4HRYA 5LDDC 5IUKC 2G06A 2JANA 3OOWA 2NPOA 2O57A 2PUEA 4N48A 1XZDA 2EBUA 2H5IA 5A0VA 1VHQA 1JU3A 2NXEA 2VDRB 3P45A 3G6XA 1E3LA 1DAMA 4LUCA 5HF9A 1GTRA 1F2DA 3NH6A 3VX3A 1FYEA 3LECA 4J0IA 2FVXA 4D02A 5F1YA 2QM3A 2FFRA 1WB9A 2VAMA 2AX3A 2RMKA 4A8JC 1WKVA 2WC1A 4FW8A 4HUTA 2BTQB 1KFEB 4TMWA 4LZPA 3E15A 3U48A 3VR6H 1W5AA 3DBIA 5H1YA 4ZU6X 4M1MA 1E4GT 1YZ3A 3UCFA 4Q02A 1CYDA 2R7AA 1M6VA 4J03A 4KB5A 1SEPA 3BM5A 3HJNA 5I7UA 1FDTA 2QD2A 3WK5A 2IP1A 1N5LA 2EIXA 4BVEA 4GKKB 1CSEE 4J76A 1T3SA 2IEZA 3RFVA 2HI0A 1NKVA 1T91A 4U7WA 4EA9A 1XDBA 4TX1A 1V9SA 2WIBA 5J5VA 5FI5A 2MCTA 4NENB 1BS2A 3PQ4A 1X7YA 3CSUA 1YB4A 2B30A 3NC4A 4H0NA 2OAQ1 5D6OA 3GWGA 3KSUA 1PFQA 2XUIA 1N3BA 5LJIA 1D6JA 1JTVA 2XUQA 2XAUA 2JGAA 3UV7A 2QSZA 3W5JA 4YMVA 2ECQA 2JJ2D 1HNZH 4C14A 3QFCA 2P4HX 2VR1A 2ID9A 3DKIA 1GZ3A 4UULA 4RMHA 1J00A 3R5FA 4CFZA 4HB3A 4FZRA 4PGMA 3LCRA 2C0QA 4JUIA 5IYCG 1X87A 2AXNA 5FBRB 2GEVA 2JIBA 2AF3C 4TMFA 3NTOA 2EZTA 4KQGA 4LYEA 4QECA 2EDCA 3X2FA 1K3TA 1JZTA 2JGFA 2ZWOA 2GTIA 1QOPB 2UZ3A 2HLDA 1NVBA 1N5JA 3K05A 4IIHA 1Z34A 2XRZA 1G3IA 3GTLA 3WOHA 4GYJA 4C05A 3HJHA 1HNWB 4RTJA 4AURA 4REOA 2QXUA 2YMPA 4LISA 1L5NA 1Q92A 3E1KA 3ED5A 4W5TA 4B8YA 4DUPA 2PX4A 3ULKA 3J80A 3C3JA 1K5HA 4GVXA 4PG5A 2C92A 4DLAA 1EZZA 2W2VA 3I72A 5A3RA 5JSZB 1QIHA 3LRXA 3GO4A 2JVKA 3O1IC 2YNMA 4ZVUA 1A4RA 3L02A 3QELA 5KOHA 1DKUA 1ZHQA 2OQIA 3CMMA 2X2OA 4D5GA 4MR7B 5EIBD 4BO2A 4QGSA 4MCAA 2XKJE 1UBTS 4XGNA 2X0RA 4F71A 4LIPD 1W0KD 4UDXX 2XGMA 2IDKA 1KAQA 2NZ8A 5IDYA 4RZ3A 2XTNA 4F21A 1P6QA 4B43A 1UM9B 1Q19A 2D7JA 1AS3A 2R1TA 3SC4A 2FJPA 1DKQA 1CW2B 4MCHA 1UBRS 5IWAB 2E4UA 4IGKA 2PQ0A 2ZJZA 1U28C 4QNMA 3E22A 2WE6A 3DCIA 1FVIA 1A9YA 3P9RA 2C04A 3S81A 3OSPA 2B4TO 2I33A 1Q95A 1ORHA 1K7EB 1T24A 4OJYA 4TXMA 4KR6A 4HUQB 3TUZC 4Q48A 1VSQA 2I99A 5TXGA 5KPJA 1CRLA 1ORIA 3FWHA 3EA5A 1X13A 4O4JF 2ZE7A 3LQ4A 1NW3A 5C80A 2BM9A 4B87A 1ZI9A 2XMPA 3EG9A 3MT8A 5BVGA 5F23A 3ZTWA 1G0OA 1XV5A 1YUMA 3GBPA 4MPPA 3EXEA 3KSRA 1Y6JA 1W48A 5L3ZA 2NVYA 4CGZA 4DPLA 3F4LA 3PV0A 2Z3ZA 4PCLA 3FOEC 4DV3B 3HNOA 5HMMA 4EUEA 3GZNB 5GZ1A 1XPUA 2CSXA 4UCFA 2XE6A 3PUIA 2XB4A 4CMKA 1QGUA 1Z35A 3AONB 3H1EA 2CL6X 1R2QA 3LX4A 2AFHA 3AC0A 4LTMA 1ZJ4A 4ZHQB 5FTKA 4MARA 3H5RA 1EFVB 1MT0A 3M1AA 1JHAA 3R8CA 1KYWA 4RMNA 2O3RA 4D9GA 4OB8A 2O2YA 4MLPA 3HUDA 5FULA 2GEFA 4CR6A 3W2HA 1MC1A 2EX4A 4US1R 1OH6A 4RAYA 3WYEA 1CTQA 3CUVA 4G2TA 3NVMB 2A1UB 4JCOA 1SXHA 3TY9A 3AETB 1VDMA 1E8MA 4WXMA 5JAQA 4B84A 4YPFA 1AXRA 1DOAA 1N0VC 5KNCH 4L7VA 3LT5A 2CLMB 4N5DA 3UAXA 5A9SA 5I5VA 2J9XB 3T52A 1EVZA 1JIHA 4L78A 2QQFA 4XYMA 3TEKA 4WERA 4JLMA 4XI9A 4J9SA 5BSRA 3ZIUA 1L8OA 3E1GA 1T2NA 1NVVR 4DL6A 2BHNA 1A2QA 1E1LA 1CR0A 1VCIA 4LGVA 3HCRA 2QX9A 2VRCA 2GKOA 2GN1A 2BTEA 3OIDA 2X2FA 1B8VA 4RE5A 5AK6A 2CMHA 3BGDA 1VB3A 2ONKA 4H77A 2HA4A 2BFCA 4P0PB 2OB1A 3V7WA 4JI4B 4NJOA 3ZWQA 3LBAA 1RR6A 4G0ZA 3P2YA 2Q5EA 1BJRE 1JXAA 1P0PA 1CULC 4Z0PA 3OTWA 4RSRA 4G85A 1DB3A 1GA4A 3FNRA 5C5IA 2WY2D 2VF8A 1V5GA 1ACMA 5CFZA 3X1WA 1Z3IX 2HLPA 2PKRA 5BYJA 4Q4AB 3DOIA 3FH0A 1P31A 2IGBA 1RLJA 5BURA 3IDAA 5BN5A 1KJIA 3PX2A 4WA7A 1ZETA 3R7BA 4LA4A 3SFVA 3Q72A 3L06A 3O93A 4R3NA 3ETEA 2BR0A 3ZV5A 2W8LA 2AZMA 2JBHA 4KL8S 5AXBA 1XLWA 3REGA 5FBHA 1QG0A 2H2IA 2ZWVA 3S44A 1ZH0A 4GPBA 1RE0A 3NHYA 5D3MB 1XTBA 1YA4A 4BVHA 1OFUX 2GA8A 4M9RA 4CLXA 3WGTA 5IT0A 4FFWA 3CPSA 3TLBA 2VDMB 3KSZO 3KT0A 1V6AA 1JLLB 2YKGA 1BDJA 3PR1A 4YI3A 4IP0A 1Y8RB 4NTZA 4JT9A 4CDNA 3V55A 4BAGA 1XRQA 1T5HX 1C0LA 4BGDA 4D42A 3CKKA 5EPUA 4KH1A 4PZ6A 2WJ4A 2QPAA 5D3KA 4ND4A 1IHPA 5JJLA 2QNRA 1ZEMA 3UPDA 3UW3A 4MUEA 1KARA 4A10A 4RMJA 2R8EA 2ST1A 2EJ0A 2CHQA 2BTOA 5J2TA 3HPRA 2BAGA 5HTKA 2C5FA 2VCEA 4HYYA 1J2UA 4IINA 4N03A 3DL2A 4K7JA 4MO2A 5FFMA 5I47A 5LFAA 4YJ3A 2UVRA 3SR0A 1AXGA 4GOOD 4A3SA 1X38A 4PR0A 4QYSA 1KY4A 1VSBA 1IXKA 2IBKA 3BMCB 1RJFA 2WAMA 4BUCA 3ZD9A 2OVBA 5AHKA 2CK3A 4G2NA 2R7NA 2EFCB 5H3HA 4MS4B 4UAGA 4I55B 2ZI4A 4BNDB 4C3ZA 2POCA 5IBQA 3K70C 2KJQA 4NE2A 3L2PA 5LOVF 3EPLA 1G2QA 2QSUA 1Z0JA 1SHJA 2IYRA 3QFFA 4UE6A 1RXIA 2CE2X 2XGQA 3TSCA 4AC9A 1RI5A 4TS9A 1VIYA 2PNFA 3FPBA 3TQ1A 4ZO6A 4HAWA 3SLRA 3VR1A 2D4AA 2H5LA 5AM4A 5JNRA 1T5TA 2Z5FA 2YYSA 4CM7A 1G9TA 2BJWA 4IFEA 1IHOA 3OD5A 4M1EA 4ZQCB 4XD2A 4Y2QA 1T6YA 3BWXA 3G5AA 1YKFA 1R8YA 3TNFA 2OM2A 2AD1A 2P4QA 4LI3X 4MWZA 5K0ZA 1I5RA 4RESA 4XX1A 4WKNA 1ESEA 3QZ8A 4Z51A 1CY8A 5DNYB 1X1CA 1M67A 1Q77A 4WECA 1CQWA 1TE2A 4E5PA 4NFHA 1MH9A 3ESAA 5EQFA 2XF2A 5E9JA 2HT6A 3PSAA 2BDTA 2RBKA 1COWA 3Q8LA 2H1SA 5I5UA 2LVBA 1QVWA 4KXQA 4GMHA 4M8SA 1N36H 4QYMA 4NJEB 1RLUA 2AJDA 5KWJA 4WXYB 2XECA 3D2CA 4EJFA 1ZLXA 3I04M 5KYVA 2OV2A 2ZAGA 3QLEA 1EFTA 1CCWA 4CM9A 3LBFA 2EHDA 3JCZA 1MA0A 2X22A 5FA8A 3K3PA 5JNVA 4J94A 1YB2A 4B3HA 1J8QA 2XB8A 4D0LB 5TPZA 4YXFA 3MWEB 1P16A 3QEOA 4BRZA 3OFVA 2A59A 3CRZA 3ZHYA 2BHLA 5DGBA 4A3FG 1ZK3A 2J48A 1J22A 2R6FA 5B5SA 3QMVA 2PYIA 5FIUA 3VVCA 3KLBA 1I2ZA 2I29A 2HBQA 3HUTA 2GZDA 5I60A 5H0IA 1WW2A 3X44A 2VPSA 1QQBA 2XMDA 2HB6A 1RK5A 1OU0A 3ZCUA 2O3SA 3ADBA 5K0LA 1MZPA 2QG6A 2IHJA 1D04A 3PX7A 5EJEA 3EVFA 2DQYA 1ORRA 1BWQA 4C22A 1V4YA 3AZOA 5JZ9A 3ZWYA 1H42A 2EF0A 4LBZA 3INYA 3TD2A 4BKOA 4K9LA 1I80A 1XU7A 5DSZA 3L8MA 3ABRB 2D1SA 4G4IA 4Z0NA 1GUAA 1NJ1A 1HQDA 5F5NA 3CX3A 1EKXA 1YVPA 4KK3A 4Y6OA 3L7IA 3L43A 4U7TB 3MSCA 4MXDA 1EBUA 2XCQA 4Q6WA 1CHDA 2PSHA 4CIAA 3X1DA 1E3QA 3AILA 3BD7A 1M1NB 4PTYA 3DCJA 3CH4B 1VCMA 3AF5A 4DMCA 5F12A 5L1KA 1X1RA 2AHRA 1ZK2A 2ASJA 3MFYA 4HDSA 5KJEA 5LA6F 3ZWOA 4NYJQ 3SG0A 4YT4A 1T8RA 2FZWA 1RACA 3KUXA 1X7HA 1KMCA 2XDQA 2VSFA 5BWXA 2WTMA 4ENUA 3WMWA 5CB4A 2J46A 3GAFA 1FMJA 5G1NA 3ZV3A 5LMUB 3G6KA 3N3BC 1CQIA 4RUAA 3K94A 4PLYA 1XPOA 3DLCA 2HK9A 2C35B 3DOCA 3C24A 4WXEA 4JB3A 1CY0A 3TAXA 4AJPA 1ND5A 4AU1A 2FSVC 2B21A 3W4IA 1MORA 5LVAA 2Z6AA 3T5HA 1UZUA 1AMUA 2EKPA 5FKJA 4DWVA 3TOVA 1E5DA 4LSMA 5KSYA 3EIUA 1KU0A 4L4RA 1NHGA 1RE1A 4P86A 1HA3A 2EJTA 3ELBA 1LC0A 4QQ8A 2MT9A 2IZ0A 2K7FA 4NPAA 1A9RA 3N59A 1NXOA 1DAHA 5H82A 4TQGA 1UT8A 4J90A 1U2QA 2NPIA 4G1BA 1QTRA 4DNFA 4V1CB 1LVUA 5HM8A 1T1JA 4DLZA 2PMWB 4ZJUA 3BMOA 1N1MA 5K0NA 4KI0A 5IAEA 1WKCA 5CA1B 2I6SA 2H1OA 4EGCB 3QBEA 1AGXA 1DCFA 4W1QA 1OYYA 5KHLB 3DF9A 4MR8A 2J5BA 4BNFA 3UZBA 2FX2A 4XSVA 4TXHA 4JI1H 3NTXA 1NVWQ 1MO6A 2GK6A 2W0SA 4IIJF 4EUHA 1BS1A 5KFLA 3AEUB 4U0KA 3ZHVA 1FQOA 1JQEA 4TL8A 4PRLA 3RYHB 4QPPA 1JP7A 3AINA 2WYOA 3D5QA 5CW1A 2UU9B 1X39A 1QH0A 2IPXA 2QAIA 1SC6A 2NYRA 2GASA 2J67A 1Q17A 3DAGA 2G7MC 3UMFA 5FI0B 4JI2H 1ZRSA 3GLQA 4OU4A 1M2HA 2REXB 2RCNA 3T5GA 1YAHA 5LU9A 2EKZA 3A4YA 1MF7A 3CNOA 5IKXA 1IVYA 1KO4A 5HFAA 5JARA 2BDUA 4LYFA 5F9FA 3G2HA 3DTVD 2JPDA 3AW8A 2CLLB 3F5SA 4G5RA 4FFSA 2Z4TA 2FVYA 1RHQA 1HV8A 2CL0X 4A5OA 1WS6A 4GLJA 2WAYA 1B93A 1Z4PX 3A2MA 2LD4A 1UWKA 1PYGA 3ZGXA 3GLFE 1HLPA 4ZT4A 4F56A 4OQNA 2HJRA 4QDOA 4CV0A 3EOBI 1Z37A 2VAWA 1MH1A 2JJYA 5KI6A 3IPLA 2X0SA 5JW6A 3SJ7A 2IDMA 3ZCTA 4IRCA 2OCAA 1SKAA 1GTJ1 4R6WA 2OXCA 1FNSA 2MR6A 1ZBDA 3E5MA 1KS9A 4B0PA 4QWDA 1GYPA 3OEYA 2FR1A 4KUGA 1E94E 4UM8B 5E8JA 1YNSA 3BAFA 2WW8A 3MYYA 1Z74A 3LLUA 4FYMA 1WNTA 1PGQA 2WAAA 3WWCA 1SBYA 1Y3HA 4IDOA 4RFSA 1WUTA 5EZYF 3O0TA 1KGSA 2WG2A 2RONA 1DXYA 1XTJA 1KDZA 4C7JA 4W82A 1C30A 5DM0A 4QE3A 1ZMXA 1SRRA 4BU0A 3JD2A 1S0NA 3KSBC 4PZ7A 4QOFA 3HS3A 1TQDA 2F90A 5F2KA 2JF0A 4Q8EA 3PKZA 5LP6A 3WB1A 3DE2X 4PGFA 4HSEA 5DHQA 4E46A 1DCTA 2O2CA 3MR5A 1MJGA 2ET6A 2FPLA 2VHCA 2DHDA 1WXIA 2C2DA 2ERXA 1PGPA 4JYAH 4R4JA 5GONA 5B6PA 1WXEA 1ZAUA 1USUA 3I05A 4NE9A 4JA2A 3PA6A 3H83A 5HIMA 4I8XA 3BGVA 4LJ4A 1PRYA 4ZHSA 1P74A 1U6KA 1GXSA 3MUNA 2WHQA 3GLHB 1ZW6A 4UUNA 1QF6A 4A3EG 3WMRA 4YHHH 2DHCA 5CPFA 2IE0A 4Q3OA 4MQEA 4OBXA 1DKNA 2OAEA 2VT7A 4HX2A 2YZNA 5ITVA 3HWSA 2OCXA 3QWHA 1XBTA 4DL7A 1GHTA 1KFCB 1H66A 2PR2A 3IRVA 2XCAA 3OTQA 3OEED 2EW8A 1E9FA 2OK7A 4MYCA 4N7BA 2PWAA 1S4QA 5HOEA 3LAWA 3OE7D 3C8MA 5BWNA 5ETJA 2GJ9A 4B2PA 4RVDA 2P9QA 2J9GA 2HRCA 3DEIA 1ZXLA 2N0SA 3CLRD 3SMVA 2PGJA 4FCCA 4Q1FA 4IYRA 4NFLA 1Q1BA 2DECA 1NA5A 5K3SA 5I7AA 3PHIA 3OZFA 1AM4D 5FNVF 2H1RA 3T9DA 1FB5A 2OP1A 4KQ2A 4PY2A 4R81A 1SUCA 4YNBA 4YHBA 3QZ7A 4GX0A 3Q5GA 3HO8A 3KHSA 3GUVA 4UPVA 1W0JA 2RI0A 4MQ4A 4AXXA 4YP7A 5EHQA 2OO3A 1SK8A 3OZGA 3GRRA 3Q8KA 2QTVB 2VYQA 3Q7SA 5AXAA 3WLTA 4DR4H 2VHTA 3V00A 3RUCA 1RFGE 2HF7A 1UMBA 4NYMR 4FD3A 3WL8A 2ZI9A 1XD9A 1XCOA 4WNCA 2ZUDA 1WRBA 3EBLA 3GLKA 4DA9A 1F38A 1M7HA 3MD9A 1IZ7A 4I50F 4KO8A 1P73A 1M0WA 2VTBA 2GPNA 3Q9NA 4R8MA 2XQGA 1JIQA 3IQGX 1PTJC 2C5AA 4A3LG 1HYBA 3M2TA 1MB4A 4PHTA 2ZB7A 4UEKA 1CY2A 4NZOA 2AQ4A 3B3GA 5E6UB 1WMDA 1KNQA 2VK8A 1BN7A 3NEYA 1TNDA 3SIRA 1P3Y1 2DT5A 4DWOA 4QDXA 4QOGA 9ABPA 3ZI7A 4NZNA 1TM4E 1NF3A 1GU7A 4R2KA 4NOMA 3ZNNA 4G25A 1ZIXA 2D2FA 3FYDA 1TFUA 4MYTA 2FNAA 3L7JA 4B6EA 2AXEA 3IEVA 4HGYA 1NW4A 4G5SA 5DYGA 2C2MA 2IXEA 3W1VA 3EZ6A 4MTDA 2RHMA 4FLFA 2MTBA 1L5VA 1H0KA 3TR6A 3D6JA 4D4KA 1WCWA 1AQLA 3KYCB 2PH3A 1MJNA 2AFIB 3CV3A 4NX2A 4RETA 4N54A 4ZYZA 1CQXA 1Z5UA 3ZI4A 5CDSA 4BO1A 1ZICA 4ZCRA 4PQFA 2N42A 4GBMA 4N5NA 3DONA 4BQSA 4L9AA 3GQBA 3I4NG 2NTEA 1XWFA 3HWWA 5DK6A 3BK7A 3FUWA 4JR1A 2B4YA 1Z7WA 4ZOCA 5JMOA 1VHJA 2ERYA 3LKVA 1J23A 3L4JA 1P6XA 1MFZA 3V6KA 2A8YA 4FYHA 4TWIA 1CT9A 5AHRA 4RB0A 4TRJA 3HI4A 1AGRA 2NUBA 2Q3HA 4X1KA 1NV9A 1A8UA 4EARA 3H1BA 4RZQA 4UVDA 1L1RA 1IBKH 4K2HA 2AMJA 3ZD8A 3BULA 2VF7A 3I92A 3A05A 1U3WA 4DV1H 4IFIA 2J59A 3PNQA 1SNYA 3QVSA 1I50A 5EP1A 2I8AA 2BKUA 3BREA 3EDCA 3LQFA 5C52B 2C7BA 1H1LB 5LQSA 4UCWA 1AS0A 4Q7EA 2OL4A 3ELWA 3ZHOA 5T14A 5A05A 1NN0A 4YR2A 1PJZA 1QNLA 2I67A 3H8SA 1JQ5A 2QNBA 4QYWA 1JMVA 5EIHA 5AXCA 3QPAA 1KNXA 1MB0A 3VX4A 3ST7A 4KSBA 3EWIA 1VJTA 1CKNA 2JH3A 2XA2A 5L1IA 3BRSA 1VMDA 3WMFA 1HRKA 5KG5A 4HAZA 1JA0A 3IUEA 4MUXA 3WBKA 1U3VA 3JVIA 4WQMA 1L8LA 1P1BA 1NIJA 3NHUA 5K6TA 4PLWA 1NOIA 1FJXA 1XHLA 3TOSA 2HHCA 2DPXA 3RBDA 1F7UA 3L8CA 4RZUA 4IG9A 3E9NA 5HNKA 3R4CA 2OYSA 1XAHA 3IQZA 3H11A 3AHJA 1T4GA 2GZRA 1YU9A 4BLRA 2IT1A 1XEAA 1W6RA 2F1KA 2MSEB 2DULA 2IW3A 3CF4A 4KPYA 2Z6VA 2OHVA 5C5EA 1F5SA 2VA2A 3AL3A 2INGX 2GPTA 3DMTA 4P92A 3HOXG 1GPH1 5BYBA 4UTXA 2FUG6 2YZKA 4EY5A 4EEQA 2XRMA 1N2IA 2BSAA 2QJOA 3TGPA 3H8WA 3L8DA 3WLOA 4W5HA 1S2MA 2KYRA 4G0QA 3QG1A 3VPSA 4BXOA 4GZ5A 4ZQEA 1S68A 4G8CA 4MV0A 4EELA 3G2OA 2J0QA 2J7KA 1P0IA 3HOWG 4AKSA 4JOSA 2IELA 3ZE6A 3IJRA 4C01A 4DJAA 4JLKA 3JXEA 3OEHA 4H7IA 5EJ7A 2EZ4A 1QGYA 3TZHA 1B43A 3NTUA 2QR5A 2XGGA 3IAS6 4HDRB 4DN6A 1WCYA 5IAAA 2YR0A 2BY4A 3UJHA 5CNIA 5DGXA 5A06A 2W7PA 2XGSA 2QL6A 3QJ5A 1SUEA 1VL6A 4R3WA 3U37A 4LVCA 4CQLA 4BLOA 3ASVA 3D7MA 4F2WA 2R1VA 5G0TA 1PIWA 4Q3CA 1IHUA 1Y4UA 1RRFA 1DXHA 1XAIA 2NSLA 1J99A 1ZNYA 1N7IA 4O2BB 3V4VB 3CRW1 1Y5IA 3EDYA 2HA0A 3TLGA 2GYUA 3VM6A 2GEKA 2E0IA 3RUEA 4X66B 5EE5B 1JDZA 2QJTA 1K6MA 1TAGA 4LG1A 3LPAA 3MTDA 1DU4A 2C07A 1CQJA 3JWPA 2IOFA 3AM3A 4KUHA 3C85A 4ME6A 3U56A 1UPTA 5E0OA 3ZE9A 4ASUA 4PNEA 1A5BB 1DTWB 2EBWA 2VPYA 1OXUA 5B7QA 1M2WA 5I4CA 3NM4A 3KKKA 3MOIA 5CLFA 1J2RA 4EM6A 3LDHA 5L7YA 4O7VA 2GN8A 2PGOA 3T34A 3AYZB 5J59A 1T3HA 3VR5D 1T3GA 4XDYA 2WICA 2B4KA 1FFXB 4QWBA 2YFYA 4DSTA 5FI1B 2FKNA 4NVRA 4OM7A 2GM3A 1JAYA 2H65A 4Q3EA 5JVDF 5LPNA 3UT5A 5IH7A 5JBIA 1AGYA 5C8ZA 1B14A 3DHYA 5MHTA 1NJ5A 5KFYA 2R5WA 4RWZA 5LLDA 3UATA 2IPAB 1HLDA 2OHXA 3DPSA 4FUTA 4DV0B 3L8YA 4H7EA 4UAVA 2C94A 4BO3A 2AG1A 1NJSA 4AZWA 1QHSA 3TUIC 1K9VF 1E0DA 2R44A 3PGA1 4TKMA 2XMGA 3RVRA 1QRSA 5ED4A 4KV7A 4YMTA 4LXUA 4CMBA 3TZKA 5EDWA 2GF9A 3JZIA 3AFMA 3R7WB 3AKZA 1RYDA 5FPKA 3IP7A 3RLFA 3H6GA 3R9KA 3M6VA 4HAOA 4YAEA 7AT1A 4M1OA 5IXJA 2OZPA 2FX5A 1XK5A 2ZREA 2HFKA 5DWQA 1X42A 3KSDO 3M5DA 4XRGA 2YZ2A 2ZWMA 3CLUD 4UNPA 3ZDFA 4EJ6A 4RSGA 1AU9A 4TYPA 3CUWA 3QTTA 4ZYXA 2DRIA 1FX1A 1EHIA 2FSFA 1OLUA 2VYVD 2FFHA 2H8KA 1XHFA 4XYGA 3H4TA 2I78A 5EG5A 4A27A 1YGYA 5C7IO 3RIGA 4OLJA 3OUUA 1O6ZA 2CFOA 4CDMA 4I55A 4BNDA 3ZWAA 1HOXA 1UL1X 1QQAA 2WU3A 2OFXA 1E3WB 5IYBG 3HRKA 1HRDA 2JZCA 3ESCA 5D3ZA 3D8SA 4IVQA 4G0PA 4LDZA 2YS6A 4QT4A 4TV8F 1VP3A 4REMA 3AVPA 1B74A 3QUSA 3DDCA 2X4IA 4H6VA 2YXNA 1LPOA 4EL0A 3KTOA 1FJ2A 2QROA 2WJJA 1BHO1 2O2GA 3CE9A 2ZPTX 5MGBA 1I24A 4UTNA 1N2OA 2FSHA 1H65A 3TNLA 2CXXA 2EJ3A 1BX1A 1ZHFA 1VC2A 3LZCA 3OZWA 4O0MA 3ADOA 3RSGA 4R83A 1RHKA 1HXHA 4FBUA 1JHRA 1GKUB 1MXFA 4EYQA 1XTVA 3LF1A 5SY4A 3TLAA 4RQUA 1T4MA 3IUJA 4LBVA 1TMOA 3QKRB 3KHHA 2NU9B 4XA8A 1G4AE 3BIOA 3A4NA 4PHGA 4WACA 1W47A 2GJSA 2CNLA 2QRNA 4K9QA 4AUNA 4P4GA 3IHTA 1A7AA 3TNJA 2DSNA 2WF5A 3I6BA 3G8CA 4RTOA 3C2QA 1XT6A 1P1CA 4AAYA 3GMTA 4CKEA 3KQHA 3KXKA 4D0SA 3FOBA 4ICIA 3KZOA 1VQ1A 2GD6A 2G25A 1M0SA 1NYQA 5AJZA 2V1UA 1NY6A 2V0GA 4RGBA 5D8DA 1L7RA 4A2CA 2DXIA 3VR5H 2O8FB 5CNMA 1T8UA 2HXSA 5IHPA 1VG1A 2EL7A 3V32A 3VH2A 5KJ1A 1JHVA 2XHZA 5LMNH 3FTNA 1NZFA 3VDNB 2YFQA 3N7UA 5IAJA 3UMSA 4G56A 2IIPA 1DWOA 4ZC8A 5EJAA 4CUZA 4OK3A 2QAGA 4KAAA 3CF6R 3GCGA 3ZY5A 2WJWA 4FNMA 4IJWA 4DLTA 1U9ZA 5FYDA 3KFLA 3TAUA 4F3RA 3RRYA 2XUHA 4IJ6A 1N36B 2RHOA 3AEKB 2JLUA 4N3GA 3M5CA 3N2GB 3HH8A 2VA8A 3QOWA 4B7XA 2HADA 2QWXA 1DZIA 3EK2A 1PS0A 4H7KA 2QSJA 2V7WA 1Y42X 4RXTA 5CLQA 3DDOA 3AEQB 3TZBA 4KWIA 1E60A 3VJLA 4Z3KA 2HHAA 3E3NA 5WRFA 1GN9A 1DFHA 1U8YA 1DTEA 4BNXA 5F3DA 1H2FA 1DQYA 4HP8A 3W77A 4UAUA 4PRKA 3CVOA 1XZKA 3G6YA 4X00A 3A25A 5ERXA 1CY6A 4L75A 4GX1A 5FTMA 1PZFA 1F17A 1L1FA 3GTQA 4TKVB 2PX8A 1HE1C 4JP3A 4EYEA 5EKDA 2X0IA 4WDRA 3RFFA 2A4KA 5I9MA 5L6LB 3CVUA 1K0FA 3VR2A 1E7QA 2WQZA 5JOQA 2AD5A 1C9DB 2H4FA 4LF6B 2Q7OE 1TM3E 2ZRMA 1YT5A 5CFNA 4G3XA 2EU8A 2ACKA 2IOYA 1Z2EA 1O95C 1FUEA 5TF4A 2JVIA 4D9EA 4I99A 1O75A 3HBLA 4HTAA 2ZYUX 1OCEA 3FDFA 1UINA 3V1NA 1D6SA 4I1UA 4JODA 3JARB 2GJAA 1JI0A 1DQZA 4LWZA 1KK2A 1DBVO 4QRHA 3RGWS 3N41B 1HT2E 4K03A 4XZ3B 4WD3A 3O75A 3HDJA 2QRPA 1AUXA 4TWAA 1UAAA 1F9EA 2RHCA 3GCZA 2VBFA 3N2ZB 3I2GA 2C95A 4GI3A 1KFBB 3E03A 4JI6B 2FFAA 2A94A 2YV5A 5AVRA 1IUNA 1JI3A 5JHHB 4DG9A 2BC9A 5AFSA 3MJCA 3SD7A 4MZDA 2G0NA 1CYEA 3VZDA 1K8QA 2MINA 5B58C 3OY7A 1N2CE 4JR2A 1Z0UA 521PA 3KKOA 1NWCA 4L2IA 2PVPA 4CIVA 3Q3EA 5L3VA 2QZJA 4CCWA 1LRKA 4FE4A 5ED0A 3AP1A 3MR2A 5LYYA 5C7LO 5JI2E 1VE6A 2Q1SA 3QEMA 3BORA 3CVVA 2NO6A 2J6UA 1QH8B 5JISA 5FWNA 1A77A 3O1JC 1TO6A 2ZITA 4YIKA 3K4PA 5LCXA 3R9XA 2R8JA 4CN9A 1SVNA 2PUCA 1Y7PA 3LPLA 4WBNF 3KFXA 5KYYA 2OHJA 4FIDA 3EFOB 1TM5E 4DLLA 2DAPA 3QW4B 4UMDA 2ATVA 1XF1A 1TZCA 1OGJA 4LAFA 1K89A 5E8RA 1WZIA 4W8HA 5CX1B 3HVIA 1A8HA 3JQAA 5ADVA 5DNDA 3EG5A 2W2KA 3RYHA 3ZY6A 4F5WA 3TNYA 1IWPB 1LLUA 1TM2A 1KSFX 1BA2A 1E2QA 3JYNA 2PKWA 4TWJA 2WU4A 1CFJA 2HJWA 4C07A 3U17A 2CW5A 2BELA 3DYIA 1TJ5A 2ZB4A 5DGTA 2IU4A 3OUZA 4OA5A 4TTRA 1E6LA 2LXNA 3QLTA 2C9OA 3NG1A 5LL6P 2Q62A 3LC0A 2YWCA 5BQFA 4PC1A 1G8FA 2XXAB 4DCMA 5BRAA 1AQ6A 4R2MA 3OH8A 4GS5A 5BQ3A 3USES 4WESB 4AJ1A 3NC0B 2GBIA 2PUVA 4MGZR 2A6PA 1SIBE 4FU0A 4IH4A 4CN8A 3N6XA 5HKKA 2CF5A 1XAGA 3CVYA 1YVRA 2PRKA 5IMBA 2GXAA 1D5WA 4H9GA 2OWDA 2X0JA 2JHFA 1U0TA 3AO0B 3QUQA 1ZL0A 4TZ6A 4JI1B 3CR8A 2R7MA 4P81A 1BYUA 5JXIA 3H7IA 4DS3A 3F9RA 4TS1A 3BEOA 2C5EA 4YJFA 1J2EA 3F96A 5ARCA 3SR3A 4F1KA 2ZS9A 1V51A 3LLSA 1W581 4UVGA 1CDDA 1P33A 3K1AB 1AKRA 2BMDA 3TZ6A 2G9QA 2PWYA 3ZBTA 5ALDA 2O1WA 4DA6A 3FGOA 4TPKA 1WCXA 5FQOA 2RDMA 2VZ0A 3GUUA 1E2MA 3WMGA 2VNIA 3ZCQA 1L9KA 4C7BA 2O9JA 4ZZ0A 3Q87B 1TF5A 5DP2A 1W25A 4AY3A 2RG7A 1Y8QA 4Z54A 2V4QA 3HOYG 4V24A 1JMKC 1MKYA 2P5SA 1A9XB 1JEYA 3MRSA 1FNDA 1HQYE 3GNTA 3OX4A 1E3DA 4JX8A 4BASA 3MQ2A 4RF3A 4BV9A 4TMVA 1RPTA 2WUEA 3K9CA 4E2FA 3QE2A 2KLHA 2RIPA 4QWEA 4FYYA 3ZZ0A 2NO1A 4QEDA 2VXOA 2NV0A 3LW7A 3BFVA 5DNWA 4EH1A 5AHXA 5CM8B 2FLPA 1EM8B 4BVGA 4C5CA 1BE1A 1EDBA 3PNBA 3PI6A 2V7BA 2AEFA 1Q14A 4ENTA 5DYIA 4ABTA 3PYLA 4LI0A 1M9NA 1M74A 3D4PA 3IR5A 3V2HA 3M8KA 1UBOS 1E6EA 3MMSA 4EB8A 4GDFA 1UMCB 4CMIB 5KFMA 3COJA 3CZQA 2APJA 3OQJA 3B1JA 3FNGA 1A96A 2UUBH 4O7LA 4E1BA 5IFLA 5EYPB 4UM9B 3FI9A 4F4DA 4GO1A 5EXEA 3GHHA 3VU0A 4E5VA 2B8NA 3E05A 1JFRA 3UWDA 3NBMA 3J80W 1EKVA 1FFYA 4YRNA 2V4MA 3AUUA 4PR3A 1PSDA 5CG2A 4KITB 1I3KA 5LZ2A 2WI8A 2DVMA 1U0FA 1Z12A 3O31A 1KZ1A 2JRLA 4ZZ3A 1Z2DA 2YV3A 4RO0A 3A0RB 3KPJA 2EDAA 1COZA 1E3TA 3NX4A 1UXIA 4RDIA 2QTVA 1ZMBA 2HU2A 4L73A 1SY7A 3IAM6 4CTNA 3UWSA 5TGZA 4ZXPA 1JU4A 2ACWA 4CTJA 1PQUA 3C4QA 2IEGA 5GWXA 3D0OA 3ZHCA 2IEIA 4DY6A 4GM1A 2CW8A 1YFJA 1KFJB 1SCAA 5IVKA 1MLDA 4PG6A 3HN6A 3GPCA 4KHPH 1F8XA 2JA7A 2NGRA 4QUAA 2O48X 4QLBA 4LH7A 3ND8A 1XEFA 8ATCA 1OXBB 3D4OA 5JS8A 2R92A 4MI1A 3RIEA 2ZBQA 3EVEA 4YECA 2O5RA 1FP6A 3W8RA 2A0YA 1G20A 5JPIA 4I36A 2HK7A 4P2BA 1Y6RA 3HUUA 4MGKR 4NXMB 3ZNOA 1H8HD 4WLVA 4YCSA 1F8UA 1KC1A 3K9NA 1DWPA 2NNLD 4AMUA 3UMGA 3QOXA 5L95A 1WXQA 5ERGB 1E79A 2Q0SA 1WVMA 3JQFC 1MEJA 4LOIA 3NBYC 1Q91A 4Q3DA 1IOVA 1NP7A 2JLXA 3I1YA 4BO9A 2R1UA 5CX4A 3LVFO 4BY1G 4XARA 4XGRA 4M99A 4HDMB 1KWKA 1WZ2A 3CG4A 5CDGA 1KI6A 3S70A 3N0VA 3UTDA 3D8RA 4JI0H 1KP3A 1W34A 2YIMA 2WVJA 4N1AA 5DWVA 2HTFA 4FN5A 1SZJG 2ORIA 4TMZA 5KINB 4S3MA 2JGKA 1L8QA 4D9IA 4ZRNA 2FI1A 4PAGA 2JJ1A 4OPMA 1SXJE 4P7GA 2XODA 4UNSA 1P81A 2Q3FA 1X9GA 3THWA 1EK0A 2YH2A 5T8KA 3WBFA 1OHHA 3NT4A 1B0PA 3PUHA 2DX7A 1PF7E 5DOZA 2VXYA 2PH7A 4BKPA 1QE0A 3OHBA 4B6JA 4TTAA 1VL5A 4X9XA 3JQBC 3KV3O 3E18A 1YJ8A 4BLUA 2GEDA 2YJGA 3PNMA 5JO0A 2A78A 1N75A 3MCAA 3QX9A 5CD1A 4CEJB 3FHOA 4U9UA 2FMTA 3MS4A 5A0TA 4E7PA 3KR0A 1T36A 3K20A 3I34X 1G8KA 3ZV6A 1SVSA 1E1QA 2UVDA 1NXXA 4QJ4A 1LWOA 2VDJA 2FOIA 1N0WA 1UWCA 2VK2A 1KKUA 4XM0A 4L8WB 2IYFA 1SQGA 4Y2YA 1W5BA 1UXHA 3LKBA 1CRPA 3TIXB 2FGKA 3GVIA 3IV9A 3FNIA 3PQ3A 3TYXA 3TY5A 1YB1A 1K3FA 2EG9A 4HGNA 1UWLA 3HJBA 1NJ2A 1CJSA 1SQ0A 3L7NA 1DBSA 4HJXA 5BSEA 4EEZA 3UVEA 2OTCA 4IPTA 2HHFB 4LHYA 1U99A 4O3QA 5IYDG 4HRAA 2IA5A 4GG1A 3TE6A 3QQPA 5BSFA 4R8RA 3L7OA 1A0IA 3HHEA 4A3GG 1JX6A 1T9CA 3MBKA 1LLQA 4M86A 2HGXA 2O8NA 3RJ9A 1RJPA 2NXJA 1NKSA 2B8EA 1QFXA 2I7VA 3RFTA 5BPHA 4LC0A 4OF4A 4P4TA 1JT9A 4DV1B 2JAWA 3TTXA 4CEHB 1F7VA 2MYTA 3AL2A 3ASUA 2VRBA 1C3VA 4NNOA 2R8BA 2ZBUA 4A3DG 5JAUA 3NUQA 2PKEA 5LD2C 1O9HA 3R23A 4G9EA 3WS7A 1N56A 3KUUA 4I4TF 2P11A 2GHQA 1UFQA 3CTMA 4E15A 3E7FA 2NZJA 1ZY2A 3WL6A 1VMKA 2ZYWX 4GPD1 1GSHA 1DXQA 4WE3A 4CJXA 3CHYA 3D6AA 1XJCA 3V2IA 3IV6A 1XNGA 2WWYA 2ZKLA 3RYFB 3SFTA 3EBOA 1T9DA 3FDSA 3WP0A 4YLEA 3GN2A 5BQ5A 1S2LA 4D9JA 3SHVA 3OG9A 3LFTA 4TS3A 5LQDA 4PN3A 3E0QA 5AK3A 2LZ0A 1GFWA 4HDRA 4Y6RA 1Y9DA 2R751 3X1YA 4U6NA 4EI8A 4YRKA 2PT7A 4N0QA 1SC3A 2QX6A 4MUNA 2VP5A 1LW7A 3KQWA 2GPYA 1J24A 1PQWA 4AMZA 2DBZA 1LB1B 2W6PA 3V8RA 2F8TA 3GIDA 1TFRA 4URYR 5IRCD 2EQAA 1CV2A 4JOCA 1YRHA 3TVDA 2CE7A 3G1TA 1UT6A 5A6VA 4PZEA 3R44A 1P1JA 7GPBA 3UGKA 4MIOA 4QPNA 5K03A 1G3QA 3LI2A 2FP4B 1Y1VG 1CX9B 3FVRA 4ND8A 4O2AF 3OWOA 4KO1S 4E51A 3L01A 3OFJA 5H4HA 4D74A 2JLVA 1O97C 1BTOA 2CFIA 3WB9A 1GPBA 1P2UA 4B34A 3EPPA 1L5SA 1WXHA 4ZK6A 1OX5A 2IYZA 2CXHA 4CM4B 4IDCA 4QU5A 2PD4A 3FIUA 4DLWA 3C5CA 4PDBA 2Z1NA 3ETCA 2PV0A 1EVKA 3RFCA 2QN1A 3AKDA 4J2OA 2H6EA 1TWAA 2EW2A 3I42A 1C3JA 3NVKI 1Y4AE 2Q3BA 1TT5B 1TJYA 3MT7A 3GGPA 1W85B 4G9GA 2O8DB 1BCSA 4E31A 3ZWNA 5IC5A 1MC4A 4DC0A 4HZGA 4ZRDA 2Z04A 3TLEA 3LPMA 3MS7A 3JQ7B 4X84A 1FTGA 1KYQA 5KT4A 4C3OB 4S05A 2B35A 4KQ9A 1ZZEA 1EUQA 4BDSA 1B2LA 4ZFNA 1GGKA 1T15A 3GDWA 4B3CA 1KO7A 2H52A 4EVRA 1N0UA 4KXVA 3OQNA 1Z5GA 3UH0A 4DV5B 4AZ3B 3FXAA 1TZBA 3PB3A 4IRKA 4G5GA 4TV9B 3TB6A 2WTBA 1PVDA 4RUCA 3TW0A 1HMYA 2IBTA 2BRUA 1Q0ZA 5JV5A 3WGYA 3TX2A 2ZIGA 1E61A 2FPSA 3G7NA 1OZAA 3PUYA 1CVRA 3IT0A 3KWLA 3GV7B 3RANA 1G8HA 2QTAA 2ZKIA 4PSAA 3PGMA 2ZRBA 2GPSA 1ZW1A 1HEUA 1EQ2A 2MSLA 5KUTA 4F9FA 1ZJJA 3DLPX 1E7MA 3LA6A 2JVJA 4G0VA 2ZBRA 1SCUB 4BPBA 3QVOA 3ABOB 3L0PA 2QZ9A 1AZSC 3QEAZ 1TT7A 1YA6A 3D8HA 3RK4A 3I39X 4BC0A 3PFCA 1MV8A 3PF8A 3LUJA 3KUKA 5F5LA 3D2LA 5FOXA 3FYUC 2QJWA 3QLJA 3IUBA 4NZMA 1KI1A 4TSFA 1JFVA 2QZZA 4GLXA 2P0EA 4QWMA 1GUYA 5TEVA 5C4XG 3PD7A 4JBLA 1FTWA 1G8PA 3R3XA 4UCSA 5SZIA 1F8FA 2W2TA 2Z0MA 4JLBA 2Q7XA 5IS2A 4UXIA 5ADWA 3VO9A 3K0AB 1IY8A 3I2YX 4MW9A 1H4VB 3UHPA 1ODLA 2BGLA 1BFUA 4Q18A 4EPRA 5TGDA 2W8BA 4RKRA 4ES6A 3IOBA 5GM1A 3PRHA 4G97A 3ER8A 2XE7A 3WYDA 1QF9A 1OUMA 4M9QA 2B98A 1NP3A 1ZWKA 4QNRA 1F0YA 4EUFA 1V8BA 5JSHA 2BQ3A 3JVVA 1XCPA 3PE3A 3ASYA 4TT3D 4WXRA 3TQTA 1Z06A 4YLYA 1WMSA 1ZVVA 2YWJA 2P69A 3RIMA 2QQ0A 1QS0A 1KPGA 4TRNA 4U7GA 3ZLTA 4JVMA 4ZAZA 4AL4A 3FMVA 3CRNA 1H2XA 4RELA 4NMHA 2HO5A 2BGRA 5K0EA 1LZLA 3WHLA 4E6NA 4ID9A 1YQUA 2HIAA 2BVNA 1U7TA 5CD9A 3RVNA 5DBGA 1Y48E 2IOQA 4XH9B 2JKYA 1WV0A 1M7BA 4J9LA 4J07A 4AS2A 5AT1A 2GCNA 1QVVA 3F4KA 1LV7A 2QTHA 3AF4A 4MV5A 3RRNA 2OPBA 4TXJA 1GCIA 3AZQA 3B6KA 5E2IA 5TDHA 3TIFA 1U0HC 2XVAA 3NS7A 5C3MA 1FS6A 1NGSA 2F59A 2CZQA 4I2NA 5C9ZA 4POOA 4LFCB 2AOVA 2C8JA 3MZ0A 4ERXA 3K09A 2FCRA 3M83A 5HE8A 3QVKA 1J9GA 5CPBA 1VECA 1A5ZA 4QEZA 4MVCA 1NP6A 4PG8A 2EEPA 4ZIRA 1GV0A 4CQNA 3QU4A 1JQKA 5TQ2B 2RSLA 2XUJA 3DOJA 3LS2A 1X3LA 4QM6A 1DRJA 1G8YA 1UEJA 1UJ2A 4BMPB 5K3FA 1CVLA 1NPDA 3A2KA 2EG5A 3STHA 2GRJA 2ZUTA 2D5IA 3UJ8A 4XJXA 1R66A 5JZBA 3CJRA 4ND3A 1WZUA 1ZR4A 4HR7A 2BGNA 4XLTA 3W8NA 5GINE 3FFBA 2O0MA 3IUSA 1WUYA 2GILA 1GNSA 4NU6A 3Q5DA 1PW5A 1SIOA 4LXQA 1Z0ZA 3WZ2A 4J7CA 3HKBA 1H23A 3RAPR 2XCIA 5HQJA 3HFRA 2J5RA 1DFIA 1C9MA 2O52A 2J30A 3J81A 5ES3A 1UXKA 5U9CA 5F7JA 3RYCB 3NNNA 3QENA 1F0KA 1R0CA 1U3CA 3RO7A 1PEAA 2ZUUA 3VKUA 3QX3A 1KI7A 5LMNB 3W2TA 2E2HA 3EIXA 3H3FA 3LDAA 3SZOA 2PMBA 1JIIA 2FN3A 3IBSA 1X2EA 4DW8A 5AW8A 1R5BA 4F7WA 5EXXA 2WWFA 3QRWA 5AI0A 4PXSA 3TLJA 3HWX1 4QVKA 4URFA 1MVNA 1DZ3A 4NMLA 5A9RA 2BTQA 1VBNA 4GLLA 3JARA 3KK0A 3RHSA 3AF2A 4OHPA 5KFSA 1A9TA 4BFYA 4Q9KA 4LPKA 4UNRA 1O5OA 4LNHA 4AD8A 1JLRA 3W2IA 2XUOA 1Q2XA 4YQWA 3VI4B 1MGOA 4OY3A 5JNUA 3KD2A 4EENA 3CZRA 4KLAA 4UCUA 3TVYA 4M9SA 3LLCA 1EVYA 1QTIA 2YUTA 5KFAA 2O5EA 1AHIA 3VYRB 3ES9A 1HFWA 1YGPA 2C2WA 4WX2B 3Q2IA 4RHXA 1NLFA 2F8MA 4NENA 5L8VA 3LT4A 5EIAA 1Y3CE 1VRWA 4RPHA 4TM8A 1FUKA 4X6UA 1ATIA 2PZ8A 4KPEC 3NATA 1SHTX 2PM8A 4DTIA 4BCBA 4G4JA 3DNMA 3S24A 4A0HA 4YP5A 1JEQB 2PFKA 1IUOA 2Y05A 2C82A 2EJ2A 1ZD2P 1G8AA 3QY0A 4OFXA 1XGKA 1KETA 5JZVA 3MHPA 2OZEA 2ANCA 2C97A 1E63A 4R8UB 4QX6A 4RV5A 3FZYA 1GG8A 3NIBA 2GVZC 3SMQA 1MX9A 2FK7A 2D5LA 5K8UA 3SEQA 1Z2OX 1YI1A 5TPWB 1AKVA 1S2IA 5A4DA 2WJYA 2ZRQA 1UPXA 5I7EA 1SXJD 2IUYA 4MW1A 1PW7A 2JDIA 3H4IA 1UJNA 2DHRA 2C0CA 4IAOA 2Y4RA 2P79A 4KYTA 2JD2A 4P36A 3C7DB 3TSAA 4OJKA 4AO7A 1AB6A 4H4EA 4KMSA 3J81W 1PSZA 5HM6A 3CUUA 1KK3A 4QASA 4L5JA 1MOZA 3W1BA 4OP1A 4ARIA 1A1VA 3P0JA 3WSWA 5HGJA 1VDZA 3HLYA 1I0LA 4RJJA 1BN6A 2BM8A 4ND6A 4P8RA 4FB4A 2RDJA 4D4IA 1TA9A 1KEWA 3BGOS 4X5OA 5FA6A 2MHCA 5D87A 2YWFA 2ZYRA 2WWRA 4TOIA 5FBQB 4UVEA 2ZJOA 4RD3A 4GIBA 5KWSA 4FGSA 3Q8MA 4AJIA 1NKTA 5JSZA 4U7JA 2QL9A 4V2IA 3WFZA 1JKFA 1SOWA 3HJRA 3W5HA 3VR4D 1DG3A 1HNZB 3SPXA 2GNOA 1I10A 4MR7A 1YB6A 5GJWC 2Z57A 1WR8A 2V0CA 3TFWA 1XTUA 4RY0A 5JDCC 3I2JA 2X4GA 4Y9UA 4LBWA 1J2YA 1JDPA 4TLAA 4IOMA 1G17A 4M22A 4NDNE 5IKMA 3F73A 1E1NA 1UM9A 4YT2A 3E53A 3CPJB 4UDOA 5K4HA 1Z2PX 1PWEA 1DSSG 1US8B 1WXDA 5KWIA 1ZGAA 5TV2A 2RBEA 5MFPA 4L8LA 3HSYA 3WLHA 3V8EA 3LQYA 1RWBA 4Q93A 1I7PA 3EDOA 1QSGA 3R3HA 1S3GA 3HLKA 1RWPA 4HUQA 2OO5C 3UWPA 2D59A 2AFRA 1ZXBA 1H4SA 1KBZA 1JDBC 1QU2A 1DEHA 5BNFA 4QUBA 3BE4A 4LF5H 3TKAA 3DGFC 4M9ZA 4AJLA 1Z29A 5AW0A 3SJBA 1TCUA 2PSFA 2REBA 3ZHQA 4LGMA 4FX5A 4G0WA 2QX7A 1RI2A 4B09A 1CJTC 3GRPA 3G9ZA 1HNXH 3RG8A 4QPDA 1G5HA 4GI2A 1ESNA 3AR5A 2I4RA 3FPJA 1AE1A 3GZNA 3Q3VA 3T7EA 4DQ0A 1IVNA 4XQ0A 5AKEA 1REQB 1FW8A 3V4LA 5AD1A 1VLQA 3DZKA 3WLQA 3H2KA 4NICA 3ZJYA 1V3UA 1VZ2A 3L7DA 5FTWA 1WV1A 3GELA 3QVUA 3H6KA 1GITA 3ICOA 5M3BA 1GARA 2WWXA 4ZHQA 1OPXA 4LY6A 3JQPA 1ABEA 1EFVA 1RQ7A 4R0VA 1X7GA 3AL0C 2PZJA 4CCYB 1UDWA 4BP8A 1KQNA 5AIBA 1ISRA 4MRSA 3NOXA 5T5QA 4RK5A 4YBZB 5CCDA 4B7AA 2WJAA 4M0KA 3A11A 1N5IA 1KTIA 4CV3A 3AB8A 4IIGA 5BN3B 5C5CA 2A1UA 4J0DA 1VKOA 3NRJA 3CB2A 3AETA 4Q12A 4UM7A 3OQ6A 3O4RA 4JJGA 1IONA 1X9NA 2O06A 4OI4A 3BB3A 1Z62A 4JUDX 3RHZA 5JH7B 2FUCA 4G1CA 2NO0A 4O4IF 2XADA 3G9UA 3IQIX 3G0BA 4M0DA 3U1TA 1M5RA 1PWHA 2IYSA 4NBRA 3O3NB 2G07A 2XXBA 3PS9A 3CKYA 1KAOA 2O50A 4Z5XA 1AKWA 1EVQA 1I3QA 2HDHA 1Z26A 4DV2H 3DOHA 4OHCA 1YTUA 1AA6A 4DRZA 2M32A 1A98A 2CDCA 2QAJA 1RXYA 3CLTC 2TMGA 3PGXA 3HDVA 3BDAA 2WU8A 2G40A 3JYLA 3MJEA 1IY1A 4OMDA 3I53A 5YASA 4WY5A 1H9AA 1W87A 1FNCA 3UHOA 1ENYA 1IY0A 4JNKA 1VE3A 3O2QB 3UC5A 1HMPA 2UUBB 1KMIY 4TL9A 5JG7A 4PAWA 4YJKA 5T64A 1OKKD 4AF6A 1DI0A 4BNWA 4OTZA 4AO6A 1T6NA 3VR4H 4HWTA 3GRZA 4Q4AA 2FPGB 2QBYB 3UEOA 2X0KA 2QQEA 5EMJA 2ZIZA 5KDLA 4C78A 3AR9A 4JYCA 3EHEA 4G84A 4CF6A 2H2DA 3K35A 4KAFA 4NZZA 4XIGS 2P6NA 3PT9A 3KWMA 1KI8A 3PO3G 4OLBA 1UFKA 1AKEA 1RXWA 2CHUA 4EJSB 3FW1A 1D7AA 3W6ZA 3UYYA 1HFKA 5D3MA 1DJLA 2Q9UA 1WQ3A 4TM7A 3ZNQA 1XPRA 3OLXA 2YNMC 1WHTB 3NKLA 5A3VA 1RJDA 3GIWA 3TBFA 1BCRB 5K4AA 3NJRA 1JLLA 2GPWA 4HXYA 3GGSA 2WWGA 4QDZA 1Y8RA 4M38A 1J07A 5I8PA 1GRQA 2GAIA 2ZVDA 1KMNA 3PCTA 5DW3A 1X7XB 4KHPB 4A91A 2VSQA 4Z1MA 5ALMA 1YIDA 3OU7A 2NOAA 1DLJA 4LCJA 4GYWA 2YQZA 4H59A 3R7FA 2B5WA 1G59A 1EB9A 1D03A 5EP4A 3I30X 3ZGZA 5KFNA 4NWIA 5BWVA 3WKBA 2HIVA 5K3BA 4A6DA 1NRXA 3T1VA 2V7UA 3AR7A 3LNCA 4I1IA 1Y4DE 4EEYA 2DETA 1TJPB 4WOBA 1WB6A 3HCCA 3T5TA 3M9WA 1GAJA 1G0NA 1G8GA 1OPRA 3K0CA 1L5LA 3BMCA 3WC4A 4YUZA 3ESDA 4CEIB 1NRWA 1RSZA 3IDFA 2OZKA 1NRJB 4MS4A 1T2EA 2PU5A 2P3LA 1Q1NA 4DQVA 1P7ZA 1ABBA 1UBCA 4FIZA 3EPGA 5JAZA 4TYQA 1E7SA 5J43A 3HVRA 4DKJA 1B41A 5JROA 4RBNA 4KW7A 4IJ5A 1SKYE 4JI0B 2AOUB 2QT0A 3KJQA 2XDAA 1I94H 3KEMA 3FR7A 1U0LA 3HYLA 4DBZA 1QTQA 3QEKA 4LJ5A 3RRJA 3DFZA 4F86A 4FR5A 2VXBA 1CFZA 3JZ6A 5JQGB 1OA1A 1OE0A 3HCWA 2XNDD 4DYHA 4DIBA 4OKIA 4EHNA 3KJNA 1DAPA 2V45A 4F7DA 2ZYAA 4CLDA 3LHIA 5ESWA 2ENWA 2ZRGA 1YE5A 3LT0A 1GM5A 3BE6A 4IXNA 2GK3A 1G21E 5A5GA 3BSFA 2C59A 4Q9AA 2AZDA 1YQGA 4IJVA 2QV7A 3IPRA 4NJEA 3OOEA 3HFJA 1WX1A 2R8IA 2EWWA 4LMYA 3V4SA 2OWOA 5DN6D 5AKXA 1SUBA 1V16B 2RK4A 2JI8A 4QYTA 4EHBA 4M1KA 3RAGA 2B3DA 3U6KA 4BNZA 3KJHA 5DYWA 1E7WA 2XT0A 3EQ2A 1SRQA 4ETIA 4OO3A 3OT4A 2B1IA 4X24A 2YVLA 4R2HA 1Z15A 1EGHA 3ZE0B 1TC2A 1VJ5A 3RYFA 3PL5A 1PLJA 3MWEA 3C6XA 4N9WA 4HFJA 1DJOA 4JC5A 4I9NA 2Q7DA 3UKOA 1DXOA 1TF2A 3AWDA 2G4CA 1VIDA 3NXKA 3LY8A 2FOXA 4DXAA 5BWRA 4ND2A 3DOFA 3IOYA 5LWHA 3PT5A 3IP1A 5JCJD 1E5TA 4ZVLA 5LMZA 4C4OA 3PVXA 1GZ7A 5EQJB 1WSWA 9GPBA 9LDTA 3U4MA 1X94A 1ZCAA 2E5WA 4NQZA 4PO8A 1GNQA 5GOZA 3ONNA 3GLTA 1UP6A 4N8SA 4O8ZA 5EUCA 5DM4A 3HB0A 4G6ZA 1RJ9B 3IP8A 1PEDA 3VVBA 1NBWB 5F3WB 1USKA 5JWRA 3GLIE 2WVHA 1RPAA 2CJPA 2BT4A 5FT9A 1M8JA 4CIBA 1IN4A 4JP5A 1IY9A 1M2OB 1MW8X 1I2LA 4CKZA 2XXJA 1KZHA 2P2GA 4OIFA 4ATNA 1CB0A 5JD4A 1NN3A 2IKQA 5ENZA 5KNDD 1DPGA 3K32A 3ZVNA 4AIIA 5K0CA 2IYUA 4EO9A 2UUAH 4OXIA 1VFPA 5L40A 5A02A 3LWZA 1ZCZA 5AESA 1J49A 1X7WB 5TJ9A 1EBFA 2BBSA 1R4MB 2A3RA 3WLPA 3VSEA 4GMFA 1DBQA 1M1NA 1ZA1A 2J3KA 1LBEA 3D1LA 3JYOA 4DR1H 4NAVA 3GG9A 4P5PA 2B8WA 3M89A 1MRNA 3IHLA 4K9PA 3DTYA 1GKYA 2DQ4A 4N12A 3LYUA 1C29B 2Q1WA 2XNCA 1PGJA 2QTTA 2HIMA 2ZRCA 5CVEA 4OHXA 4JGBA 1G7CA 4M8LA 4V0KA 1ZI8A 3RAEC 1JGTA 2PZAA 2Y0DA 1IMOA 1E66A 1DO8A 3RWBA 2OO7A 1QGOA 2ANBA 2A1HA 1IFXA 4YRIA 4YR3A 4NMWA 4K81B 1CR1A 2M98A 2RHDA 3A8TA 3O2JA 4K1XA 2H59A 4PFQA 1C9EA 4G4SO 5DJ5A 4QUJA 3M5PA 3MWDB 5IKPA 4Q19A 1E4EB 3OVMA 2VBCA 5B3LA 1JEOA 5FR2A 1FNNA 2C83A 4TWZA 4I1YA 1HL3A 3TINA 3RRZA 4F5ZA 4BQIA 3BUSA 2R62A 3FUUA 3AF1A 3L92A 2QTBA 4EG4A 2ZR7A 2MR5A 3DZCA 1POXA 5JFGA 3RIHA 3QE9Y 3DTNA 2OVFA 4M0CA 5GJCA 2IU6A 3GQVA 2OCLA 3T1OA 5L4SA 1ADJA 3OHMA 1GGEA 3OZIA 2G8NA 2CNKA 5KFUA 1SBHA 2J9FB 1FUIA 4BZWA 1YBAA 3KETA 2J08A 4V1CA 2UXDH 3D3NA 3OM9A 4TXLA 1R0RE 2P4SA 2PMEA 2JIDA 3BFKA 5B6IA 3S8YA 5DLQC 3ZLVA 4TUYB 1CB7A 3H16A 5CA1A 1W19A 4MUMA 1TIPA 4NDAA 1E0KA 4X45A 2F3SA 1O94A 5HZMA 3QWAA 4Q9DA 4AQDA 4HYTA 4C06A 2ZFUA 1Z16A 4Y2RA 1ZHHA 1JHZA 1H6BA 4LYHA 1W4RA 3QPVA 2OBBA 2UVQA 4DTCA 4P31A 4MOWA 4W6QA 3CCFA 1YQXA 2DSTA 3VR3D 4U4AA 4Q37A 3AEUA 3RS9A 3B2QA 3O4VA 1P1IA 1LPMA 1L7BA 3LGSA 2X9GA 1MDFA 3S2ZA 1WUHS 5DTEA 2O6HA 3FJOA 4WKGA 1YL6A 1ML3A 3ZGLA 5LQKA 2ZAIA 1P3JA 2IYYA 3EEQA 3Q2OA 3QBVA 1EWTA 4OATA 2XX3A 3PNVA 1TW2A 4D96A 4JSYA 1XJ5A 2NO7A 3D54D 2PMZE 3SVZA 4YASA 3PR4A 3EFBA 3ZGOA 5EHNA 4FW9A 5EXTA 3NBXX 3GDEA 3OJ0A 3A6KA 1E9RA 1YF3A 1N2GA 1WBJB 1KJ9A 3ZZMA 2REQB 2LW7A 4QUIA 5IZCA 3R3VA 1ET0A 3A06A 3K15A 1ZOLA 1KZ9A 1KEEB 1VA5A 1YZNA 4QVGA 1OJ7A 5IDWA 3K53A 2C0PA 3QWIA 4CLRB 3IVMA 3A2NA 2B7BA 2X1LA 3VKVA 1W4ZA 5TC4A 3R7SA 1LD3A 1R9MA 4W9MC 2I22A 3QEJA 4IRDA 2FXVA 4DNQA 1QB8A 1RBMA 4WOCA 1JWAB 5KNDH 4DR5H 3U1BA 4HNAB 1PNTA 3VH4A 2UUPA 1TA0A 5AJXA 3OSZA 2WKRA 3TJMA 4XD7D 2X58A 5HPYB 3NASA 4HVLA 2ZIFA 5A7FA 3L1IA 4FFVA 2A14A 3H0GA 3HE3A 3N7AA 3PFIA 4GL2A 3HQ4O 1WTCA 2JCBA 1PL7A 3TR0A 3AUYA 2Q1YA 1E1KA 1JQJC 3UT6A 2D5BA 2QJRA 2KM1A 2WABA 4QJBA 2RGBA 4CM3A 4LJ7A 5JYBA 2GDJA 3ANYB 1VM6A 4ZQHA 3UJCA 4HK4A 1PWYE 4A6EA 4D57A 4JI2B 2IU3A 4EJ2A 2AWNA 4U2CA 3EF1A 2GCOB 3NP7A 1HTWA 5TQ2A 3ERCA 1IB0A 2W22A 3OZRA 3CF4G 2E2WA 2D2VA 6GPBA 2JKZA 5H5JA 1S5PA 5HF6A 4ZO7A 4Q3LA 3NIDB 3FJYA 4EB0A 2X8LA 1QFZA 1NVGA 4ZYYA 5BMVB 3O9MA 1Q1EA 2QE6A 2B92A 2ETVA 2A0FA 3QKTA 2PFSA 2J3IA 5JLJA 2OG2A 3KU4A 3TQHA 2XUGA 2XW6A 4UCQA 1RAFA 3CWZA 4XYEA 1TZMA 1PSWA 5DLFA 2QMYA 5AKYA 1SULA 4RK0A 1YB7A 2FLLA 1V71A 2GTPA 5AKKA 2FE1A 3WV5A 1J8FA 3GUHA 1XRSB 3GJXB 3GD5A 5IUJC 2DY1A 4OLAA 1C7JA 5KQLA 4KXWA 3VTFA 3GLHA 1E5QA 1HE3A 3A1EA 4GGPA 1ZD4A 2P9EA 4OL0A 5TVKA 3IVGA 3RYCA 5CYPA 3WTBA 3ENKA 2NVOA 4BRWA 1RLMA 1ONSA 1M66A 2TMDA 2YN2A 4D2IA 3TL3A 4F72A 3KQPA 4BQRA 1KEKA 2UXCH 4M37A 2IWHA 4DWWA 1F0PA 5BMOA 3WL7A 2OGTA 1U5AA 4O4HB 4ED9A 1HR0H 1MU0A 1KXJA 3MXTA 1ODCA 4N49A 4O02B 1WCV1 4MW4A 2JS7A 3M4IA 2SCUB 2ZSKA 3KHTA 4OFZA 3CYFA 2GQRA 1Q5PA 2XUKA 1FNMA 5I5TA 3PZBA 3F67A 2Q4BA 3LZDA 4B73A 2ON6A 3L1HA 4JYAB 3QZUA 4J2HA 1MMFB 1U8FO 4GOJA 1E18A 3WIOA 3DNFA 1VGVA 1YC2A 3DT6A 2GS9A 2AKEA 5CHYA 2HR1A 2Q45A 1G7SA 2P3SA 4KLRA 2IXAA 3I5MA 2Y0CA 4MVJA 4C43A 2G8LA 4RXUA 3JSLA 3AG6A 3IEPA 3C3DA 3QPCA 3KYBA 4YHHB 3ZHBA 2X8WA 4Q24A 4ECEA 4DF3A 3MGKA 5E6UA 1DOHA 4FT4A 4PQEA 1W4CA 1I7DA 5L6MB 1S8FA 1EFRD 8ADHA 2D1FA 2P9FA 5TGTA 1OWTA 3JSNA 1GAEO 4DL9A 4AT1A 1T8TA 2IY9A 4DQNA 1E98A 3RTDA 3L07A 3HNPA 5FUXA 2GYVA 1H2RS 3KVVA 1PR6A 1EK2A 2M6LA 1V9PA 4O3PA 1TU4A 3BFJA 2VNHA 4X44A 4BEJA 4L5BA 4AX4A 3NOQA 2W71A 3A70A 1RWNA 4JELA 4ZT5A 2WFZA 4DR4B 4BP3A 3NONA 4P84A 1LDBA 1RRVA 3KYCA 1K75A 2AFIA 1NN1A 2JGLA 1CERA 1Z5OA 2X8BA 1OASA 2ZIXB 4GQBA 4QUDA 1FVXA 1VG0B 2AGOA 4BIMA 3I2HA 3GUYA 4BZXA 5B3KA 3V97A 5TB5A 4WCDA 1YQWA 4R0MA 1Q6YA 1QBGA 1O3YA 3SI8A 2GEBA 3DTVB 3VUFA 2YOGA 1EGAA 3W5CA 3KU1A 2J3LA 4RCYA 4EHIA 3IJEB 821PA 1CJMA 2BH2A 1PYOA 4D6YA 3OZ7A 3AUXA 4P1ZA 4AYBE 4G8DA 3HYTA 3QVTA 4G1EB 1GY8A 2WD7B 4J9QA 4D0GA 5H68A 5I4IA 4BVAA 4UXHA 2WU0A 4P32A 1N9GB 1XQYA 2WHPB 3L9XA 1O57A 4RVOA 3UKDA 4YUVA 4DUZH 1MUUA 3UG7A 5LP6C 4RIFA 1YVDA 3UB3A 1ST2A 1XNHA 1H1LA 1IYZA 1W9MA 2IY8A 4JBNA 1TRHA 3JR3A 4O4LF 4EBEA 1W29A 4BO8A 2FF7A 4E1AA 3II6X 1US8A 3LC1O 1AK9A 1QDLB 1KPIA 5EI5A 2X9VA 4MAAA 1E9SA 2DKOA 1N2BA 1U81A 4GM4A 3RJZA 4DC1A 3JAWB 5TSDA 5LC1A 4S04A 2IDJA 5IX8A 4FKZA 4MYRA 3HCBA 3KEQA 4QJ3A 3S2YA 1D7OA 3BA1A 1UBNA 2GHTA 3V5NA 3OD1A 2FK2A 2FE4A 1TYBE 2PGXA 4J9OA 3KAQA 4ENQA 1IZ8A 3VHLB 4IRMA 2BGTA 3KHGA 3Q41A 3LV8A 2GETA 3CEPB 4UTVA 3I52A 3VNNA 3E9MA 3ZJ5A 3TE7A 4O2RA 1M6NA 4V0RA 3IUMA 4FSXA 1IBKB 4CC5A 2EIHA 1U3DA 1KBQA 2QDKA 3PDJA 5CT6A 5DM70 2XZDA 4J0MA 4YO8A 1GQOA 3DHEA 3UN1A 3PC6A 1FIUA 2WP8J 1BWSA 1QQTA 3IKMB 3U7EB 4UCVA 1LI4A 5THXA 4FGUA 1RLTA 1REQA 5EJ6A 3AUKA 1D07A 1TU0A 3H8VA 1XROA 3CBQA 4BWGA 4RZRA 1P4AA 4PANA 1C9JA 2R79A 3VC3A 4P3PA 3HA2A 2R6JA 121PA 2BMJA 4M83A 3GT3A 4F4WA 2ZOSA 1FTSA 2VZEA 3AHHA 1Y9EA 1P7WA 2PUFA 5KT6A 3F6RA 1XLVA 2GOYA 3LWDA 4KQFA 1CNFA 2NVWA 1ENOA 1F1BA 2FPXA 4ZD6A 1N77A 3V7NA 1V8PA 1QO7A 3H9GA 1UPAA 3C8HA 1I3MA 4O63O 5I7VA 2G9UA 1GFZA 3DT9A 3M9NB 2AF4C 1ZK0A 4UBLA 3AHEA 2Y0SA 4BHTA 1TECE 5K0BA 1LS6A 4Y6PA 3C5WP 1TRKA 3SWWA 3R6GA 2FMAA 1WB5A 2JL1A 2FU5C 5KSPA 3D8TA 5H16A 1QXSA 1E96A 4DBLC 1GEGA 1G2PA 3RKSA 2I3GA 2WU1A 4J7XA 3QW2A 1HI9A 5K1ZA 1URPA 4O2BA 3Q7EA 3UK6A 1BRTA 1TQ8A 1WZEA 5AJWA 3CVJA 3M4XA 4R1UA 2NZUG 1EGMB 4G5XA 4BTLA 4WZAE 3WJ2A 5DGDA 1E5LA 3IVRA 1L7NA 1E2FA 3TQSA 1NLZA 3ND5A 4TZTA 1J7KA 3KYJB 3MXOA 3QHAA 3RKUA 1DTWA 1EG2A 1T1GA 1UBKS 2B7LA 3S1SA 4RTSA 3QV2A 4QKQA 2YINC 1W2WB 3HR8A 3DLAA 3NUAA 4NBNA 3ONEA 2GNAA 2V97A 3WWZA 1YZFA 2JZNA 1AKMA 3GJ5A 4INPA 1ISJA 2QBYA 4NLGA 1VMIA 2P1RA 3A9RA 3ZX4A 5KNCA 4F1WA 4LYGA 2VHEA 1FFXA 4ZVKA 2R6AA 3QXHA 2KI5A 3W8FA 3N39C 1ZD8A 4FGKA 2NU8B 1SWWA 3SFZA 4CG0A 1Y1KE 5KFRA 1JG7A 2BDEA 3ZVKA 3VJMA 3ETJA 1WHTA 1W93A 4QUEA 1W2GA 1D0IA 2GR9A 3BB4A 1Q1GA 2QPOA 4D9KA 5B37A 1UPUA 3GP8A 4BC1A 1CWUA 5CXXA 2BF7A 4Y2VA 4I5IA 1PHPA 4NG5A 5KU1A 2H1WA 4W8GA 2C7QA 3G5LA 2V98A 1KQPA 4MP8A 4RPIA 3RVQA 3MTEA 1JDTA 4WOJA 1TJ4A