5CAEB

Succinate bound to pig gtp-specific succinyl-coa synthetase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structural basis for the binding of succinate to succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 135
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5caeB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5caeB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5caeB03
3PFFA 3WO1A 4TV8F 3R5XA 2YV1A 5BMVF 4XX0B 1KJQA 2I80A 1AUVA 1CE8A 1GSAA 1CS0A 2Z04A 2YZMA 4FE2A 1I7LA 2YW2A 1T36A 4O84A 2VR1A 1EUCA 4O4HF 3MJFA 4YB8B 2NU6A 1JLLA 1JKJB 5C1PA 1GSHA 4YJ3F 4O83A 3R5HA 2ZDGA 1BNCA 4MV1A 1EZ1A 2SCUB 2NU9A 4DLKA 4I50F 3N6RA 2R87A 3Q1KA 3RV4A 3JRXA 4O7YA 5LOVF 4O7ZA 1VBHA 5FNVF 3TINA 4O4LF 4EGQA 2YL2A 1EUDB 1Z2PX 2GQRA 2YS6A 2FPIA 3G8DA 2IP4A 3UFXB 3U9TA 4XX0A 2ZDQA 2NU8B 2VQDA 4XYLA 2R7NA 2GQSA 2PBZA 3AW8A 4HQ6A 1E4EA 2PVPA 2NUAB 4MV8A 4O7LA 1OBDA 2NU6B 4TUYF 4MAMA 2YZGA 1JLLB 4I55F 1Z2OX 3E5NA 3V4SA 5KX5F 3MWDB 2V58A 4DIMA 2R85A 3LWBA 4XZ3B 4HNVA 2HJWA 5CAEB 4C5AA 3WO0A 2OLSA 2V59A 4O82A 2NU9B 2CNQA 4MV3A 2SCUA 1KC7A 2R7MA 3RUPA 5IYZF 3TIIA 5CA1F 4MV9A 4QSHA 4O7RA 3BG5A 3SE7A 2FPIB 2WYOA 5D8DA 4MV7A 1EUDA 3JZIA 3GIDA 2YV2A 2R7KA 4XYLB 5H80A 3UFXA 2PN1A 1C3OA 2NU8A 1WR2A 3HO8A 4Y8VB 2W6OA 5EZYF 1E4EB 2YRWA 5C8YF 3OUUA 2CQYA 3U9SA 5LP6F 2NUAA 3DF7A 4O81A 1DV2A 4FFMA 1KUTA 1CQIB 4WBNF 3MWDA 5DMXA 5CB4F 2X0SA 4XZ3A 3LP8A 3OUZA 5CAEA 5JQWA 2R86A 2FPPB 3VMMA 3GLKA 2R6FA 1PX2A 1PK8A 2W6QA 3K5HA 4ZOLF 1DIKA 4FGRA 2DZDA 2YRXA 1KJ9A 2W70A 2XD4A 3RV3A 4ZI7F 5I47A 4EGJA 4YAJA 5CA0F 5HBRA 3VOTA 2DIKA 5JVLA 2R84A 1VBGA 4Y8VA 1OBGA 4O7WA 4MA5A 1KJ8A 1KJJA 1C30A 2XCLA 1CQIA 3MWEB 2CNVA 1CQJB 5LXTF 4FFRA 3V4ZA 2HGSA 5JH7F 5BPFA 3JZFA 1B6SA 2FPPA 1ULZA 4L1KA 2J9GA 4MV4A 2R7LA 2CZGA 4MV6A 1EHIA 2YWVA 3R5FA 3KREA 2FP4B 4RZQA 1EYZA 1KJIA 4NYEA 2NU7A 1M0WA 1BXRA 4YAJB 3TIGA 5HBRB 3KAKA 2YZNA 2YYAA 3NUAA 4IWXA 1JDBB 4O2AF 4IWYA 1SCUB 2P0AA 3VA7A 4YBZA 1I7NA 2W71A 4ZQIA 2GPWA 1A9XA 3ORQA 1Z2NX 4HNUA 4ZHQF 3KAJA 2YS7A 4O7TA 2FPGB 1UC9A 4FFOA 4WD3A 4E4TA 2DWCA 3K5IA 2QF7A 2I8CA 4O86A 2GLTA 3VPBA 1B6RA 4O7VA 4HR7A 2R82A 4O7SA 4IZOA 2GPSA 4FFNA 3MWEA 1CQJA 5K2MA 5GONF 4ME6A 3K3PA 1JDEA 4XYMA 5JVDF 3JRWA 1UC8A 4O4JF 5C1OA 2W6PA 4O2BF 1AUXA 3Q2OA 5BPHA 2V5AA 3WNZA 4FFPA 2NU7B 3R9RA 4IHJF 3N8DA 4YAKA 2FP4A 4FFLA 2C00A 4EG0A 1M0TA 1M6VA 1KBLA 3ETJA 4I4TF 5J2TF 2YZLA 4YBZB 3G8CA 4M9UA 4C5CA 3VPDA 1SCUA 4IIJF 4MA0A 3KALA 3QFFA 2VPQA 2CSUA 3AX6A 2FPGA 1GSOA 3ETHA 5LA6F 5J2UF 4C5BA 5JQGF 3TW6A 3I12A 1OI7A 1W93A 4YJ2F 1DV1A 4XYMB 4TV9F 1GLVA 1EUCB 1IOWA 5HV6A 2ZDHA 3U55A 3TQTA 1W96A 3DMYA 1GGOA 3HB9A 4YB8A 1IOVA 4O7NA 3ORRA 1JKJA 1A48A 1VKZA 1KEEA 4FU0A 2DLNA 3R23A 4YAKB 2CNUA 3U54A 3RFCA 2FB9A 2QK4A 5LYJF 2Z02A 3VPCA 2W6MA 3HBLA 4O4IF 5KKNB 4HNTA 2W6NA 2I87A 2W6ZA
chains in the Genus database with same CATH superfamily
1T9ZA 4DA4A 3B89A 4UAGA 3RWBA 1JIQA 4M9RA 4KX5A 2YV1A 3OF2A 4NYIR 1N2GA 1KFBB 2MR6A 4D4IA 1AU9A 1BA3A 4RCVA 3RAPR 3RYCA 4GVLA 1YBHA 4XASA 1DP4A 5IC4A 4I99A 3A2KA 1CJBA 5AKKA 3P0IA 4QSMA 2BP7B 1Y9EA 2X5JO 5B6PA 1YL7A 1QORA 3RFVA 2NV2B 4QL3A 3RC1A 1WUJS 4MNTA 4TQUS 3MCTA 3FDZA 2QDXA 5GM2A 3KQOA 3D0QA 5JY6A 4H0FA 1Y6FA 2CDRA 4RNNA 1MAAA 5FUVA 2Q62A 4WKBA 3E03A 3URMA 2CJWA 3ZLVA 3PNYA 1NUTA 4CQMB 4Z9XA 4PZAA 3VBCA 2EJTA 4C7OA 3ETNA 1AZTA 2Y1DA 1QHEA 3T5CA 4I0WB 4IDNA 3KVNA 2A67A 3UUFA 4MV8A 1QK5A 4XDHA 5JPCA 3JZAA 4LSXA 4C30A 1J22A 3WV5A 4IW3B 2WJ3A 1JJIA 4MITA 4LFAB 2BFWA 4JR2A 4LBWA 1PSZA 4F3RA 1Z6XA 1GNPA 1M2EA 4BO3A 2HKIA 3QTLA 2TMGA 5EINA 4I1RA 4WOBA 4PICA 4D9EA 3IT0A 5JADA 3RADC 1DIGA 2M05A 4ZN6A 1VZ3A 3SKVA 5CE8A 1XLUA 2X58A 1M8FA 3WC4A 5B57C 4EHLA 1XRPA 5FEMA 2MINB 2X9LA 1RRGA 3TAXA 3L04A 4D92A 4HLQB 5G0WA 2WWXA 3H19A 3C1TA 4Q02A 1R8YA 1B33N 2O1SA 1AH2A 3R9IA 4EDHA 5G4KB 2VAPA 1W1IA 5IKMA 2DTXA 2JJMA 3IURA 2C88A 4GKJH 1H0HA 1XD8A 1XLTA 2AFHE 5LR6A 1KJ9A 1YZLA 4ZAGA 1EVIA 1Y7HA 2C9YA 2IIBA 2CVQA 4JYAB 2X6QA 1Q7RA 3KD2A 4P3PA 3U4DA 4BN5A 1WH2A 5JZBA 3CN7A 5LMUH 1H5NA 1ND5A 2Y9PB 4EPVA 3WWYA 2C2GA 1TKRA 2ZXFA 3RUAA 2V65A 1I9GA 3TR6A 2BC9A 2GZHA 2QLNA 3KS9A 4M99A 5ER6A 4EUFA 3PW7A 1XTTA 1CEXA 2OZPA 5FUYA 5A3RA 5DQGA 4R5HA 3V8PA 3GV0A 5DFAA 3RYTC 5JSKA 3X44A 1U8EA 3VR6A 3VR3D 5DAAA 4DSAA 1DI0A 1CY1A 2G17A 4YUZA 1J8VA 1NY6A 5LFAA 4BKMA 3G59A 1GT91 3AKEA 3E8SA 4I8XA 1I4EB 1IZ9A 2UVQA 4PYRA 4QUHA 2VUUA 3MGKA 4FEAA 4V0KA 1XVTA 1GYQA 2DPMA 4KN9S 1YSCA 5CLQA 4UEQA 3DL0A 2I3BA 3VNSA 1KETA 3EVAA 3H65A 2G3YA 4B84A 5A9RA 2YJ3A 2JAQA 3PHHA 2JAOA 4K28A 1TLLA 4JJGA 1GNLA 4MB0A 4IRDA 5IM4A 2QLFA 1QCYA 4ZVRA 2RKOA 5IM4F 3WYBA 4YREA 4TVBA 2RIRA 3SZGA 2GYYA 1RWMA 1OU0A 4WZAA 3DDHA 4C5CA 2OBBA 2Z8YM 2V54A 5T67A 1GGNA 3EZ7A 3CLHA 2FF7A 1L4NA 1V16A 4C04A 4TVKA 2JEFA 4C2UA 2GN1A 5BW6B 2E5FA 2FN8A 3NNNA 3E9DA 2A4KA 2HVSA 1XD2B 4DM3A 2IXAA 1N2CB 3QKTA 4RCYA 4YB8A 3WGNA 1UM9A 4FS2A 1XZJA 3JQ9C 1WD5A 4BJ5A 4YAKB 2PA3A 4P82A 3KVOA 5ITSA 3AEQB 1D3AA 1M6VB 5JECA 3IYLW 4LF5B 3VZBA 3IR7A 3ZW8A 1BCSA 3KQLA 2DWUA 3HCBA 2DJIA 1ZW6A 4HVTA 4G01B 3OT4A 2K4MA 3VV2A 3S1SA 3H4TA 4D8TA 4H1HA 4NYJQ 2V7GA 1ML3A 2JCGA 4ZC1A 4X8MA 2ATCA 4MUIA 4ZARA 2GFQA 2VP6A 1BH2A 4UDYX 1PV1A 3VO8A 2A57A 3P9XA 5LQDA 4DTIA 1TCVA 1K7EB 4D43A 2ZU6A 1RSZA 1Y1KE 3STVA 1H66A 2GXAA 2DF8A 1LLCA 3QPBA 1JIIA 1FU7A 4B6QA 3TIXB 4XPZA 4JI0H 1RMYA 3QZ8A 4J91A 2BR0A 4KWCA 2PBZA 2A1UA 3BIXA 3UQZA 5F5LA 2IYVA 3NDPA 5TJHA 5DLPA 2WKRA 4C4TA 1U1FA 1UMBB 2RHRA 4TLBA 1M2OB 3L7YA 4RANA 3BXEA 1T9GS 1BFUA 4MKHA 4BRUA 5I51A 3W8EA 1L5WA 4LYGA 1OQAA 4QNNA 4ZOLB 3S1AA 4ZQEA 1USKA 3PD0A 4HNQA 4DEXA 3MW8A 2Z4SA 3SZMA 2Z9CA 4LTNA 4BIMA 5E3IA 3JSAA 3MCAA 4LAFA 4DN6A 4HH1A 3DZFA 4BCCA 3OHPA 1T9GR 1GPAA 3ELBA 1XTSA 3P4UA 2XXBA 3MJCA 4CEHA 4BVHA 3A27A 3DF7A 3U7RA 3C6ZA 3T3HA 3IIEA 3IXLA 4Z4QA 1NXTA 3FWPA 3L43A 1G5FA 3T12A 3WYNA 1HEYA 5HZHA 4G0NA 4RIIA 4R2WA 4G0UA 3LTNC 1YL6A 3MBOA 3ILVA 3FR7A 2QZ4A 5K05A 4JQZA 1Z2EA 4R6WA 2E21A 4S04A 3EOAI 2P5TB 3DO6A 2Y1EA 1B6TA 3VR3A 1JNXX 4OOEA 3PD1A 2FDCA 4H08A 4LWQA 5CDSA 3KR1A 1A3GA 4ZJYA 1RZUA 3L79A 1P6XA 1Z5PA 3MMNA 2AEFA 3TJMA 5BYJA 4A1FA 3UT6A 1K1EA 4ZEOA 1Z82A 2REBA 3EQ8A 2EF1A 3GVPA 1GQSA 5HEKA 1GGKA 2WSMA 4BX2A 2WV9A 4B83A 5JG7A 4RGVA 2V96A 5FQNA 3ANNA 2R8RA 4CG3A 5MF6A 3WYEA 3EW7A 1GITA 4GI2A 4CM6A 5ALKA 2C20A 4EYHB 4OHBA 1N8SA 4GPBA 4ES6A 2BEUA 5KG0A 5TPWB 5FWYA 1EFCA 4GHWA 4BTVA 1BXRA 4JVMA 4DQDA 1N5LA 4XUDA 1D4ZA 2IYEA 4X93A 2H31A 3T4PA 3KVVA 3NEAA 1Y4DE 2PNFA 2Z30A 4PVCA 2C92A 4FOPA 3WHLA 4E3WA 4TV9B 4WFJA 3O21A 4FE3A 2BD0A 3EUWA 2PX5A 1WCIA 2YYYA 3AF2A 4ACAA 3YASA 3AEZA 4RULA 3ZY3A 3AI3A 2AL7A 2G36A 3OTIA 3ZY6A 3LVQE 5G3ZA 2HCFA 5HNKA 1RKBA 5THXA 5B7PA 3QPDA 2X77A 1PJ4A 1T9AA 3TSCA 2AMLA 1C7RA 2RMKA 2VJPA 2ZI3A 4OIFA 3IKJA 4X8OA 2XUOA 1GPBA 2IZ1A 3REQA 2J3MA 3R9WA 1NFFA 3TSOA 4IY1A 3K2IA 1LI5A 2F1HA 5CTJA 3G2LA 1E4GT 2JEOA 4FS8A 2H7VA 1SK9A 3HB9A 3SX4A 3CLTC 3THWB 2YXNA 1Q6YA 2PGAA 1HDZA 2JVKA 1R2QA 3OIFA 1ZK1A 3MINB 3RBAA 3I1YA 3B7PA 4G1EB 1N4AA 4FJ1A 3IO5A 4F4XA 4GGOA 1TZCA 5HJEA 1DAMA 3EN0A 1NN5A 1N75A 3OCJA 1QIIA 4ZEWA 3HYSA 2AXNA 2X5OA 3SR4A 5KYWA 3WAKA 4S12A 1SHZA 3WHIA 4KRXA 4RK4A 4QD3A 3E81A 3FBWA 4ED7A 1GRQA 3PW2A 2ZM6B 2O2EA 2CXUA 1ZGBA 1HT1E 4ER5A 2LCFA 2PMZE 1WETA 2ECFA 4J3FA 3D81A 2OHIA 3GGGA 5HUQA 1GFZA 2FWIA 3PFGA 1M76A 3C5HA 4R84A 4IDOA 1C0EA 3GOQA 1DKUA 1MMFB 4PRZA 4RD6A 2BGNA 3PC8C 3VZPA 1F4LA 3DL7A 4D9BA 1CE8B 3GLHA 5EJ2A 1TXGA 3W5BA 1MRSA 3RS4A 3DBHB 5KVSA 3M5WA 4W5NA 3PW0A 1S2MA 2WF8A 3HCCA 1BWPA 4DAEA 2NPOA 2B83A 2MOKA 2C3MA 3SLKA 3G1WA 1HYHA 4XM0A 4E4RA 3L1HA 3W9SA 4D4LA 4J4HA 4Z4HA 1SCDA 2ETVA 5J4KA 1LPSA 3REFA 1Q14A 2JF0A 2FWJA 2DTEA 4U2BA 1F6WA 3Q6NA 3RT9A 1NZFA 1B8VA 3SZUA 1QIGA 2ORWA 2F9MA 2YZ7A 3L01A 5BRJA 4BNHA 721PA 4TZ0A 1PL7A 3K96A 5LJIA 3IPCA 1VG8A 4E2WA 1PR6A 1TA8A 2ZBRA 1JAYA 4HB2A 1HDRA 3H18A 4PYJA 2VOBA 4JAVC 5CFQA 3GCZA 4N12A 2BLNA 4YR2A 5KFYA 1L3BA 3M6AA 1JSXA 3RBDA 2WPNA 4J0QA 2X1MA 1T6NA 5KT3A 4CIDA 4Y2PA 4A6DA 4DQVA 4AWAA 1NVGA 4N6NA 2ZS8A 5FLMG 3IEIA 1R8XA 1OGIA 3GGPA 5JZVA 1W0KA 4CTMA 5G1NA 4WE3A 4A3BG 2QZSA 1Z7EA 4L07A 4K6GA 4ZYZA 2XVAA 5EIOA 1SC4A 3RAJA 1IJFA 1T1SA 2GXQA 4XRRA 4U9HS 4NI5A 3LCVB 4O5AA 4B17A 1S0UA 3HRIA 3KOOA 4C76A 3WGJA 5FUBA 4HEJA 4B4VA 4LUCA 4TVSA 1ATIA 3I2YX 3LPDA 3C74A 3T9FA 3CF4G 1OXMA 3TY5A 3X1ZA 1Q20A 2QT1A 3CQ9A 4YCSA 3N59A 4E4TA 1JKFA 4NCKA 2FWMX 1KNQA 3O9MA 2WMDA 3BAAA 2QL5A 5T4BA 1C0KA 3DKKA 1CRPA 5KWIA 5CB0A 1EFKA 4C78A 1LGYA 4N18A 3WKCA 3TM5A 1BXGB 1ISJA 4Q1BA 1P2UA 2V5AA 5AIBA 4I5EA 3TG8A 5LZ9A 5A5GA 4KQ1A 1QTIA 4EG0A 5JEDA 3FMAA 3GFGA 3H40A 4OYHA 3GG9A 4I7EA 4M7WA 1LVGA 4HFNA 1Y5MA 5L51A 3OQ1A 4FJ2A 5B53A 1CZNA 4DA0A 3GDWA 4OK3A 2GUWA 4Q4CA 3STYA 121PA 3TEJA 1R9JA 2GM4A 3FYHA 1N33B 3CRW1 2X1LA 1IOWA 4DV7B 5IKPA 3DTVB 3D8NA 5CM2Z 1E59A 5DGCA 1WUIS 1JI0A 1ESMA 1WHSA 3I9V1 4X6XA 5A5DA 4DCOA 1W7AA 3RFCA 2XKAA 5DTMA 4O4IA 2GVZC 3BAZA 2XMBA 1QQTA 4O4IF 2IXTA 1O57A 3RAEC 4I9NA 1QKJA 4U6QA 4MQ4A 3FUVA 2IXFA 3T61A 4GXQA 1WKVA 2ANBA 3GR6A 1QLWA 1S3FA 4FYYA 5EXDA 2HK6A 3U4AA 2ZJAA 4ZZ1A 2KB0A 2CFRA 1LRKA 2YZMA 1JHQA 5LZ8A 4TT3A 4C03A 3MEQA 4AJEA 4PPQA 1TQ8A 2VA3A 3IALA 1LDMA 4MMYB 1EUCA 2GAOA 5CB4A 1QH8B 4FGJA 3FWKA 2ZI6A 1FFAA 1K1QA 3ZYZA 2ZU0C 2VHJA 2P4SA 3NT2A 2HLHA 3AF4A 1F51E 3BTUA 3U1VA 2XA2A 4IDAA 1ZXLA 2VUMA 5B36A 1IY8A 1NVFA 5IASA 3QE0A 4CN9A 2GJSA 3L7DA 2J85A 2IBTA 8LDHA 1OJ7A 2GQRA 1KOJA 2ZDQA 2G5TA 4GP6A 4OXNA 1DAIA 3SEFA 2GNOA 1Z8HA 1B0PA 3TW7A 4ANFA 8OHMA 5IBCA 4JENA 4JEIA 2ZRDA 4ZAVA 4PG4A 3WA7A 2B5OA 5ALJA 2FGJA 4LGCA 2ORED 3LCMA 4OYRA 4D82A 4NC9A 1KZ1A 1M1ZA 4CDNA 3TRKA 4NOJA 3QEOA 2QX9A 2XX3A 3DF9A 4C4SA 1NN0A 5K8VA 3RGZA 3T0GA 4D9HA 4U4AA 2FPIB 3LQQA 4BFZA 3PENA 1QCDA 5TQVA 4PZUA 1QF9A 1O95A 1H4QA 4A03A 2NZUG 3CURA 1M33A 3E9EA 4OSPA 3PC4A 2Y6VA 2WB2A 4C4XA 1VHDA 2JCBA 2Q9CA 2GUGA 2FZWA 4B71A 1WP4A 2I33A 3C97A 3LP8A 1R0XA 3H8SA 1Y3HA 1Q57A 1KQOA 2OG2A 1ECGA 3OG9A 4LF7H 3K5HA 16PKA 2WYUA 3KOYA 3L0ZA 3THYB 4XCXA 4EWLA 4LHWA 1J0DA 4Z9YA 4FMCB 2FK7A 1X38A 3R3JA 4OB7A 2BMFA 4DXAA 1C0IA 4QIWE 1UJBA 1NIJA 2AMYA 1IXZA 3F5QA 1H93A 1O75A 3I5YA 1SHTX 3D3QA 3UUWA 2PX6A 4GSKA 3K20A 3NLLA 1XAIA 3G49A 2JBHA 3LSYA 2PMCA 4B3FX 3CB4A 1J2RA 2W58A 4CEJA 1EVYA 2IHKA 4KR2A 2IH2A 3II6X 3SIXA 2FEKA 4REMA 2XY4A 4A3EG 4ZCTA 2UXDH 2C35B 3KPJA 1PLJA 1FX1A 1XVIA 1THZA 3I34X 1WD7A 5DNYB 1NWCA 5KG4A 4UM7A 3UJAA 1XT6A 1L3IA 1SKUA 3AV0B 3NUAA 1A5AB 4H4EA 1AB5A 1SHKA 2N3ZA 2HF2A 2WJAA 4YMGA 3RU7A 2PL1A 5TVKA 5K51A 4BC1A 5BVHA 1XMQB 4DR6B 1ZIYA 3KEGA 4KO3S 3OPQA 3X43A 3TUIC 4DG9A 2OKGA 4EVRA 4AYTA 3B53X 3H2JA 3JQGA 2FSHA 4MQBA 2OV8A 3TGLA 1DQYA 1L5MA 3O8LA 1P1BA 3QZ7A 4RTQA 2NUTB 5FI1B 5AVTA 3OPNA 4BX8A 2HHCA 2BMEA 3WLLA 4LA4A 3LPNA 1WB5A 1BZYA 5DG8A 4F5ZA 2GZMA 4DFDA 3OSNA 4MVJD 3QA3E 3BEDA 1WXXA 3GJQA 4ZCIA 3KL2A 3ZS9A 3FCUB 1O58A 5AVUA 1VPDA 2VA8A 1G9XA 2PRYA 5K0LA 5KG5A 5DO9A 1VHJA 4UU0A 2XUAA 3UJCA 1FSZA 1I5OA 4J2OA 5JWOA 4YAIA 2Y1CA 3FPEA 1VFNA 5ADVA 4KQMA 4Y6OA 3LOPA 2BFOA 2K2QB 5A1JA 3JQ9A 2AW3A 2Y1XA 2P35A 4WASA 1L4KA 2J87A 4WRRA 2YXPX 5BYKA 1DKQA 5FAKA 4GOKA 1DAGA 4G0VA 2OHHA 5CYFA 4ND8B 1E9DA 3UWOA 1S8AA 3TR0A 2Q4TA 4UTRA 2QX6A 4UD6A 1TLTA 3VNQA 4WAUA 1X15A 1G21A 1L7XA 2IXGA 2OGSA 3ADKA 2BEJA 2E2IA 2BM9A 2V6IA 2JIPA 1DQSA 2XGOA 3IQFA 1E69A 4L15A 3BJRA 4ENRA 1Z4NA 4Q1AA 4WLNA 3VYRB 2Z98A 2ZT8A 3L6UA 1XLTC 3OOWA 3DOUA 2WLTA 1K27A 4MQMA 1V7CA 3DR3A 1MGPA 3MJVA 1JFVA 2AFIA 4L6AA 4BV2A 1EUDB 4OATA 2OBLA 3AU8A 4OEHA 3AVWA 4Z2AA 4IS3A 4JGIA 1NYRA 4ZVTA 2QQ0A 4G8CA 3R76A 1SU6A 4R6XA 1GOTA 4XD7D 2BY4A 3FCYA 3HJRA 1Y14B 4DIMA 4A3IG 4NBKA 4YEDA 1PUXA 5AM3A 1J21A 3HL0A 4JA2A 3G9ZA 3P0RA 1LFDB 4JYZA 3EYYA 3U4MA 1VIYA 1OZGA 1CUHA 5DNCA 1E1CB 2QV0A 4GM1A 4LF6B 1RQXA 1FNMA 2OTCA 5C1DA 2DY0A 2O3RA 4UZEA 1PQYA 4D0NA 3OVMA 4Y8VB 4MO2A 5LA6B 2AMVA 4IJ6A 2D1YA 4E5PA 4WGFA 3RW9A 5AXDA 2EARA 3RU2A 4RTOA 3IILA 1YC2A 4BVGA 1BQ4A 4RZXA 2MJLA 1F14A 1TW2A 1ZWKA 3O2QB 3IV6A 4ZMBA 3HEBA 3AILA 3C3BA 2XYHA 2DVMA 3T5GA 1GZUA 2HF7A 2XQGA 3KKLA 5LDGA 2W22A 2A5LA 1QHFA 1PNTA 4BRSA 2H1IA 4B3IA 1YA4A 4OHKA 4B6PA 1E4OA 4F7WA 1SCBA 3ZHVA 2OZLA 3BK1A 4XIIA 5MN6A 3PFWO 4M0MA 5FL7A 4DDMA 4CW7A 3ENZA 1VPVA 4I3GA 1GYRA 1K83A 4WVFA 3E22B 4KE7A 1WB6A 4ADSG 1KWKA 3EQ7A 2EWWA 4BFVA 5E6SA 3IKVA 2BDUA 3MFYA 3G13A 4MV4A 4BWVA 5CFOA 5K0CA 1LW7A 5K7SA 5EMMA 1YS9A 2OCKA 3T7RA 2W2KB 4J9SA 3PVCA 3B5JA 1SULA 4GR9A 1GYFA 1R9TA 1G42A 2SKEA 4LXYA 3D6VA 2R7AA 2IP2A 5LBUA 1QKIA 3C3JA 2Q28A 4Y0NA 1EWKA 5BSWA 2JGNA 1BHJA 1CLUA 4MVJF 2VHEA 3MAAC 3WE7A 3LT1A 1FLAA 1B41A 1AO0A 3HFJA 1DXOA 1O0CA 4BAGA 1KRWA 4X85A 2O8VA 2R6AA 3MELA 3HM2A 4XWOA 3MMZA 5CEEA 4DR1B 5F3WB 2FJPA 4QU0A 3KYBA 1V4YA 1FRVA 1N0UA 2GZAA 2AKYA 1HSZA 5BQ5A 2BKXA 1H1DA 4J07A 2WMNB 1DWPA 5HF5A 1RAAA 1J33A 3BXZA 4UEJA 2UVPB 1Y5LA 3DJYA 1QPGA 1BVYF 2RGNA 3HR4A 3TZHA 4EJFA 1R3DA 1FW8A 3F4BA 4LNUB 3NPAA 4XCVA 2PMBA 4J9PA 1JDNA 1OKKD 2UUOA 3ZDFA 3CZRA 2C94A 3UB3A 1L5YA 2IDJA 1SD2A 1AGRA 3PDIA 2XVMA 3DB1A 3DQPA 4MYRA 4OU4A 4MVYA 3A1EA 2R1TA 2YMLA 1IQRA 5DQIA 1P1IA 1V9CA 4P0QB 4DQUA 4JJIA 5BN4B 3R41A 4WLUA 1XTVA 1EK2A 4X6UA 5JD6A 4F06A 3NEPX 1DBPA 5LP6A 5H0IA 2RGVA 4XD7A 5TY0A 3U3OA 2BFBA 3C39A 5GJVC 5H9VA 3ZOKA 2G1AA 5E7IA 3TRHA 1JLLA 5NULA 2EHJA 2EQ5A 1MX9A 2WSSD 1HWYA 5AJVB 4L4YA 3M6WA 1DADA 1U0TA 1I6LA 3D6MA 2J32A 1I5RA 3B1VA 1D2NA 3GNSA 1CP3A 4B3DA 1SZJG 4F46A 2NP6A 2HA3A 1QTNA 2YBEA 1OJLA 3BSWA 1Y37A 3UM9A 2CF6A 4DCUA 1UJ5A 5HKAA 5E25A 5FKJA 1OAAA 4TLCA 2P65A 4GZ6A 4F71A 2AIRA 5KFFA 2Q7OE 4B46A 4CFZA 1YU9A 2P9BA 3IVAA 1IBLH 2PJUA 4X66B 3O26A 1KZ6A 2HPVA 3TD9A 3ROGA 2QAGB 3B9RA 3RUPA 1UDCA 1ZHSA 4MCHA 1KO8A 3OZIA 3GP3A 1X80B 3PQ8A 3AHFA 5CNMA 3TCKA 5CLJA 3HL4A 2G40A 2JBAB 4RTKA 2FPLA 2D2EA 1C7ZA 5F3DA 1E7SA 4P36A 2HJGA 4Q5IA 1ZXXA 1BSVA 3F1LA 2QLLA 3NHKA 5FPHA 5F1YA 2HBQA 4BNNA 3NTQA 2RKWA 1V2GA 1FW6A 3SHFA 4B1FA 3ZDRA 4V0RA 4UFZA 2OA0A 2LV8A 3A1DA 3ORSA 3OLXA 4KNWA 3TLAA 4O25A 1R0ZA 1Y1QA 4MUXA 2Z56A 1F06A 3U17A 3R7WA 1OBFO 1JEJA 4H3SA 2O52A 4IUBS 4JI7H 1J8YF 3QTBA 1CZRA 3EIQA 1E94E 4M7PA 2ZR9A 3EGDB 3AGQA 1K6JA 1A5BB 5LKRA 3CSUA 5LZ5A 1V39A 5AW7A 4DJAA 2E4WA 3DWFA 1V4NA 3FOEC 1R0RE 1VL0A 3H86A 2B61A 4MTDA 1E3TA 2BSQA 4B7XA 2BISA 3ESXA 3HY4A 2QL9A 1TWCA 4BNGA 2V5UA 4DUZH 4CC6A 1N3LA 2JFFA 3KFXA 3QKIA 2INGX 5FV7A 1IIRA 4BB6A 4HYEA 3P19A 5KFZA 2HR1A 2VA2A 2C4MA 2DHQA 4M8NE 2JFQA 5MGBA 3AZQA 3RSGA 1OXTA 1SB8A 4FB4A 1XP8A 4CKEB 2FP4B 3B6MA 4HGZA 2VHXA 3D5TA 1NVKA 1M7HA 3P4YA 2GF9A 3W7AA 2FTKE 5KS8A 4AJLA 1M83A 1WVGA 3FNFA 2TS1A 2FE4A 2BEKA 3ON5A 5H83A 1OZHA 1TGYA 2EX4A 1SIBE 2JLVA 1SOMA 1U1DA 2I71A 4ZVSA 3A32A 5B55A 4EW3A 4BQFA 1OKKA 1I3CA 5G41A 1WJGA 4XYMA 4JI1H 1AQYA 2GNPA 2QR2A 2B36A 1Z5OA 1ZL2A 4Q45A 2AK3A 3WLIA 3HA7A 1UK7A 4YUAA 3F8SA 1GCAA 4JIMA 1TEXA 2NM0A 5DEOA 3IKTA 3E6AA 4YMIA 5DISB 1YMVA 1GNRA 2PKWA 4ZDWA 2ZJ5A 3W8RA 3FCSB 5EJ5A 5C3UA 5T4FA 5C1IA 3JZDA 1D2EA 4MLZA 2JGJA 4GO1A 3WK7A 1F8YA 1IN4A 1PGNA 3V32A 2FKNA 1QR6A 3LQFA 1MOSA 2XGPA 2OYCA 2JATA 3A8TA 4JI3B 3WSTA 3EPPA 3PJFA 3P32A 2VBCA 4B3SH 2V6FA 4LOKA 4M7EA 1Z6TA 6GPBA 3V4LA 3L8HA 1N36B 2VUMG 4O8CA 2G83A 3NHSA 3MWYW 1RPAA 4DEYA 2JEJA 3KJZA 5BXQC 2VXOA 3G89A 4QUKA 2Q4BA 3GQBB 3HMKA 5ABPA 2BBOA 2I4LA 1U3CA 1F8XA 3J80W 3R8CA 1UBEA 2Z8ZA 3WDLA 2XHEA 1IIBA 5GY7A 4YJ3F 3HT5A 3VOBA 4KYVA 2UUAB 3LDUA 2VTDA 3OMLA 3L1UA 1IY1A 5LBIA 4C7BA 1E1YA 2PM8A 5ALGA 4QGBA 1JTFA 3S1LA 4WJKB 5JCJD 4V24A 1MEOA 1T26A 4LZZA 4Z8YA 3EAFA 5FEUA 4UM5A 3MBIA 1B8UA 3CX8A 3HEAA 4U0JA 3DUFB 1EX1A 4FUTA 4RA6B 5K9ZA 2VRCD 2C0CA 1M3SA 2C9MA 3CW9A 2FY8A 1QP7A 2CK3A 2ID7A 2I9KA 4TRNA 3A1CA 3K2QA 4TKUB 4L5BA 5EHXA 2JFHA 2DOKA 1S9DA 5ALUA 3F8WA 5KBYA 1II8B 5CA1F 2CBZA 4OYLA 2OBNA 5BWTA 5EWJA 3BG5A 1ZUNA 2QTTA 3EF0A 5JAUA 1U3GA 2FSUA 3W5CA 5BUZA 5AUNB 4DUGA 4B81A 2VUSA 5CM0A 1ZD4A 1PT8A 2XRMA 3TN7A 3W5JA 2R9VA 1F0YA 1IPEA 3W2GA 3OTWA 2IPAB 4IEIA 2AOUB 4J0EA 2W6QA 2XRZA 4Z0NA 4UZSA 3NBZC 2X5KO 3AL0C 5AI9A 3KHGA 3ZTTA 4Y2UA 4LCJA 1K98A 3RV3A 3GGSA 5IFKA 2GZRA 4I4TA 3MTAA 1UPBA 4DWVA 4QQNA 3BQ9A 3QJ5A 3SD7A 1FDIA 4CI0B 4BQEA 5LP1A 1L3CA 3VPHA 3G2NA 1YZQA 1TF2A 3H13A 3UENA 5CK4A 5BURA 4IHQA 4QDZA 4EG7A 3FNBA 4AT1A 2RBGA 1P7ZA 2Q3MA 2ZIXB 4O4JB 5HWSA 1YE3A 3GCDA 3R0QA 1HDGO 4GWGA 3UC9A 4KV7A 1O6FA 1U5BA 1FP1D 1DC8A 4S0ZA 2JI6A 1FS4A 1TTTA 3HU2A 4DV5B 4QDJA 3GPCA 3PHGA 4YBZA 4FCTA 1J8QA 3ZQKA 4AZ3B 3D0RA 1TOAA 1P4RA 5BV0A 3K5IA 5BYAA 4CMDA 4HAOA 3ROTA 1U9JA 2PFGA 3IBCA 3SYTA 1K5HA 2KJQA 4NNOA 4QG7A 5A05A 4KRGA 1NMEA 1D9XA 4PZ9A 5A0FA 1SBTA 3KFLA 5LD2C 4PG5A 1DJPA 5AJTA 5FT9A 5KYUB 2Q49A 5AJZA 3SM3A 3RFTA 3GC6A 5J9FA 5EN4A 1N2HA 3SICE 1C1DB 5JS2A 2FG5A 3QX3A 1MTOA 4YUVA 4FQ5A 2H2HA 1WEHA 3PQ6A 2ZTLA 5TT1A 3BM5A 2WVJA 3P0EA 5CHEA 5BNFA 1DO2A 1E1RD 1OILA 1EXVA 1V1JA 5EHNA 4DQ0A 5IVHA 2CL7X 1OGYA 2FR8A 4DPKA 4F93B 3LIPA 1R4MA 3HOWG 5LC1A 2VTBB 1J9GA 4B2IA 1UH5A 4C0QC 4QHTA 1WIWA 4ECWA 2N9UA 4HDKB 7ABPA 1YV9A 4MS3A 1E3MA 2FG6C 3OT1A 4RFVA 3PEVA 1O95C 1KI6A 1Y9DA 1IK6A 3VDXA 1P2GA 3M6LA 4KCGA 1IBKB 1HTBA 4GWKA 1N2IA 1CZHA 3QLUA 4HBZA 4RSGA 2JI9A 4RF2A 4YJFA 4D26A 1GO3E 2VYVD 4Z54A 2VRCA 1XZHA 4C2BA 3ND9A 4ZZ3A 2WTAA 2X9VA 2ZJ0A 3QKRB 1JHAA 2K5UA 3VJKA 1UJ2A 2WYHA 2O5RA 2V7QA 1Q7CA 5BOSA 4PGMA 2VHWA 1P45A 2H63A 2PT7A 1JG6A 1WZEA 3GFVA 5FPRA 4B8WA 4CM8A 1D04A 2OK8A 4IP0A 2R8BA 2UUBB 3M3PA 4LTMA 2R5NA 5JT1A 5EQTA 3PWSA 1TA0A 2VT2A 3EZ6A 2KWIA 4FDAA 1MX1A 3OCZA 2OUIA 2BM8A 4EELA 2I2CA 5CK5A 2PUJA 5DYGA 4RXTA 1WZ2A 3ZHUA 1AD2A 4KJZA 1EK6A 3IUBA 5D3MB 3ZXYA 2EX1A 2C5LA 1J70A 3JYQA 1MP0A 2P3QA 2BGMA 4IUYA 4YHBA 5JWHA 3VV3A 3T7DA 2Z4RA 1IRIA 3HY6A 1GIAA 3EXG1 2NLOA 1R4AA 1NZDA 3V8EA 4I81A 2FQWA 3DHEA 3I4NG 2XEXA 4UHCA 3FNIA 3COSA 3LYLA 2R8ZA 2O8CA 3VMMA 1AURA 5JS6A 1I50A 5AI4A 1WXHA 4Q9LA 4UUBA 4EFLA 1N6PA 1KQ3A 5LQMA 5BSGA 4J49A 1U90A 3BZBA 3JATA 2OOKA 4F9GA 5HCUA 4GP7A 1UMDB 1CF4A 1M0SA 4R1QA 2D0PB 4NOLA 2GEUA 4OUKX 7YASA 4HATA 3RK0A 2FETA 4XWWA 3VYVA 1KJ8A 2JFVA 1G2PA 2XIQA 3HH8A 4K9SA 4OQ4A 1Z4QA 2PX2A 5M7EA 3E4DA 4TL6A 3PXXA 1WQ3A 2PZJA 3VC1A 1F2VA 1FU4A 5EE5B 4CCWA 1KEZA 1EHIA 4ZC8A 3NVKI 1K1SA 4EKEA 4GBMA 2I54A 2A5YB 3T6KA 3GV8B 2G5GX 4H77A 2W2LD 4R3UC 3LK7A 3U7QB 1DFHA 1N2ZA 2L2QA 2X0EA 2QWXA 2GPWA 2B8JA 3GJTA 4EQ5A 1J1UA 4R1PA 3C3KA 2LPMA 4EB6A 1F0PA 3PXEA 1E1RA 4CE6A 4CU2A 2R82A 1GILA 2OFPA 1QRSA 3D0KA 4PF1A 3BSFA 4K03A 3K3PA 5FBZA 3EGWA 3OIVA 3UYKA 4D44A 3NMUF 1QMGA 2X15A 1NXXA 4O2BA 1WL8A 1MC8A 4O2BF 1JLKA 3ZV4A 1UBLS 4YAOA 3GCGA 2CEAA 2QE7D 3OQPA 5A1TA 5JANA 4U6SA 1MB9A 3A31A 1LPAB 2YZLA 2Q7DA 3CPEA 3CXUA 4C0LA 1M2NA 1XUOA 2VCYA 3QU5A 3TLMA 4YH1A 5GV8A 3RTXA 1VBMA 1CB7A 4ZPXA 4PHFA 3LCRA 6ABPA 1L5HB 2BKAA 4Q9AA 5FTKA 3MTQA 1DOZA 4IVQA 1FFCA 3NKVA 2FVXA 4L78A 1WRBA 4GYWA 2C2DA 5DIFA 4F2GA 3KB6A 2EQAA 1CTQA 3I5MA 2HHAA 2X9NA 3SDBA 1VI2A 2LDXA 1P9NA 4X90A 1LTQA 1L5ZA 5LYJF 2AR9A 3DEKA 5HQTA 4TSKA 3MYRA 1P72A 2Y71A 4P7GA 3NOXA 3LO5A 2HRZA 3KDPA 4G9EA 1LV8A 4UM9B 1FP2A 2FHPA 1FDOA 4FS1A 1FBTA 4XX0B 4NPCA 4RGQA 2PJZA 1KZYC 1WO8A 4HF7A 4KGXA 1J6UA 3TSAA 1VJGA 1JDSA 5TV2A 1EM6A 1U6KA 1FP4A 5LYYA 2YXEA 4EYIB 3JQBA 1RBQA 3V2HA 3BHJA 2OG1A 1TADA 1TIPA 1H2AS 3VKHA 2R11A 1MT3A 4HPXB 4G9BA 1OLUB 4LXIA 4JP3A 4CG2A 4TM5A 4PYKA 2DHDA 1PD0A 5FNVA 1ZC3A 3RS8A 4F4CA 4TOIA 3FNGA 5FNVF 1YGYA 2E85A 5KFSA 1JHPA 5MGNA 3HB0A 1G20B 2IZ0A 3C16C 3F2VA 2JA6A 3HJGA 1T3NA 4G8JA 4QC2A 1JSCA 1KMQA 1BH6A 4ML3A 2AYYA 1Y8QA 4RXMA 3EG9B 4HH0A 4BJ3A 4BZPA 4A8JA 2W5UA 3E5NA 1GGEA 1IHOA 5CFLA 3E27A 4HVAA 2UYHA 3A3KA 3NZEA 2FZKA 1PT7A 1IZ8A 1QTQA 1PS9A 4AAYA 1GCUA 1SUDA 4MV3A 2XCSB 3O3NB 1IM2A 2GCNA 3WQRA 3X1MA 4COKA 4Q1CA 1CQZA 2PMEA 3G2QA 4JUZA 4HDOB 1ZR2A 5CA0B 1DGSA 3TX2A 2IIVA 3OZBA 3DTNA 3F47A 3QRWA 3EC7A 4JZKA 3OMXA 4C14A 4HI0E 5ICEA 4BLRA 5LKAA 3L4SO 3GIMA 1LX7A 1ZNYA 3HWRA 3AEYA 2Q50A 1SG0A 2RH9B 4R9VA 5IJ0A 4YP3A 2XMPA 1DC5A 2G9NA 4EO7A 2HWYA 2MSKA 2G80A 3DVRX 3C8UA 1VSQA 4TRJA 5IBQA 2YRXA 4UE3S 3VU0A 2W2LA 1BHSA 3MVEA 4J43A 2G09A 1L4YA 2W6JD 4BNJA 4OVKA 1KSFX 3A6GA 2CLCX 2H1VA 3LLSA 2ZUDA 1PKEA 1PGJA 3P9PA 4DC0A 1V8BA 1WUYA 4P4NA 4NABA 2RGNC 4AY4A 3UGTA 3ABSB 3R6LA 4C22A 1Y6RA 3QF4A 3IT1A 3KE9A 1QSGA 2LNDA 1XZAA 3G17A 1OAKA 4M9CA 1G6Q1 3MWMA 1X8XA 4JDPA 4L5CA 4XFKA 4GOJA 4KPFC 2HCJB 5JBNA 4Q0YA 1M34E 2CBGA 5HQ3A 4XYBA 5B1YA 1G2WA 1JX4A 2QE7A 4ENQA 2GZ3A 4XSVA 2V7EA 4KK4A 2KBFA 4EKNB 5C8XA 2X5XA 3BXHA 2GAJA 1BDJA 2XT9A 4OG2A 1LVUA 4IXWA 4PHCA 3KEFA 4ZQIA 1D1PA 1R0CA 3SG0A 1QYXA 3DFMA 3KSUA 1I24A 1KS9A 5LP6C 3HKZA 2NTYC 2OHFA 2WF6A 5BUQA 5EJ6A 1ISRA 3KBBA 1VYUA 3OO1A 4FFBB 1PGQA 2C4UA 5AVXA 2F1OA 3NBFA 4J16A 1QC5A 2I4IA 4YHHB 3HTXA 4DMLA 3PCTA 3VZCA 4RIHA 4RLQA 5DBIA 3WWEA 3E2PA 5L53A 1R4ZA 5IYZB 3ETJA 3AI2A 4AG3A 4C4ZA 4COOA 2GD1O 2Q4DA 4MRAA 1E9VA 2P7HA 4FP9A 4M0JA 2H9YA 4E30A 2ZCUA 4LZJA 3K9LA 4C5BA 1QP0A 5LMZA 2DUUA 3HXTA 3U0VA 2GXSA 5F1KA 5CG1A 5J5CA 2VJDA 1C1XA 4NG5A 1PZNA 3MS7A 3MK31 2GPAA 3QMPA 2HIMA 4P9NA 4NY1A 3EOZA 2VBFA 4LZNA 1Q0HA 5EJFA 1P1FA 5D00A 2YHIA 5LLSA 2YVLA 4LJLA 3U80A 4UUNA 3D43A 5J58A 3NBUA 2TMKA 2R5WA 3EVNA 2O8FA 1RPJA 1SVKA 1GU1A 3EA5A 3KOZA 2WIBA 4K26A 2H4WA 3RIGA 3AVUA 3Q8WA 2BR3A 4P5PA 5B1SA 4BQRA 1L8OA 3D7SA 2O4CA 4KXVA 4Y0AA 5IDYA 4DV6H 2HA0A 2O6LA 4KDFA 5EXEA 1Z0JA 2YVQA 4CTKA 3L0IB 4RDHA 3KLOA 4N5NA 2NTVA 3FTFA 2IIPA 4DLKA 4Y6LA 2J7PD 4OUDB 4N4AA 4E5UA 1NBAA 3LQ4A 4PSDA 3BL6A 4DSZA 2V4UA 1C0LA 1PE0A 5EZYB 2VP4A 1KVSA 4LMRA 5TGDA 4DR5B 4N0EA 5AR1A 1C9JA 5D51S 1E4EA 3UXYA 3ONFA 2XHZA 2J5KA 3Q85A 4YASA 1FDRA 2CDBA 1H65A 3RYIB 1JG7A 2B94A 4ZTZB 2G1PA 4O82A 4Q3AA 3M9NB 1T29A 4Q4JB 2F1JA 3GPLA 2O4UX 4G41A 3AVQA 4OB6A 5HYVA 3H5TA 5ECYA 3SZ3A 2W6JA 2FQQA 4UCFA 5BWWA 2IYXA 2ZBFA 2FSFA 2R7KA 4EUNA 4QOHA 2NU8A 4HX9A 2JIQA 3PJRA 5B7QA 4XPIB 1USUA 3NIFB 1GNSA 1DBIA 4LJ7A 4J9UE 4QAQA 3DWEX 1VXRA 1XRSB 2H08A 4CV2A 3QJYA 4BNTA 1AE1A 4J0MA 3EVTA 2PFKA 1SK8A 1QO9A 1Q1BA 2WY2D 1G98A 5AXBA 5CW2A 2AH5A 5DLFA 3NGMA 1SOAA 4O1MA 4XUEA 2WAYA 4AK9A 3O0DA 4BNYA 2EJ0A 1K06A 1E9SA 3O4JA 4E2XA 4EKYA 5H68A 4TYYA 1TPZA 4LFCH 2PKEA 3MF4A 1WDTA 4JI2B 3IQHX 4ITVA 1VAJA 3ASUA 4ZRNA 5EIEA 3OX2A 1A4UA 2ZYWX 3OZCA 3U09A 5HPYB 2WE8A 2QD2A 1Z07A 1XMXA 4EECA 3AF6A 3AUAA 2K6GA 3K2EA 5CU7A 1G5TA 5E2AA 4PGHA 4JBWA 2PUFA 1YZYA 2QTWB 2BGRA 4OX9Y 1QO0D 3ZUPA 2DEUA 3ENWA 1GRRA 3A1UA 2PS9A 4RKYA 5JCZA 4P93A 5K8UA 4CJXA 3A10A 2XUHA 1RABA 4U02A 3WYCA 4RVCA 2FKLA 1CU1A 3DMTA 3KKEA 4K6OA 4Q66C 3H8JA 4IRXA 1YWGO 3CINA 5C5JA 5DNVA 3MWEA 2VZEA 2PH7A 4OGGA 2V98A 4TXJA 1ONSA 4BZZA 4KQ2A 5GIOE 3BCRA 3ZY2A 3SC3A 1BD3A 3SXUA 2H54A 2I7VA 2IPXA 3WNZA 1EH5A 3ADCA 1NLMA 3K1TA 1TT7A 4RZSA 2J3IA 1OH6A 5BSRA 4JBXA 3R09A 2IHNA 3D6FA 4Q3BA 5A5EA 4RB1A 4G97A 4E08A 4YWJA 4Y18A 4OMCA 2WD8A 1ORIA 2I99A 2ZUEA 4RWZA 2ZPAA 3I6MA 3ZOZA 2A2ZA 3OIGA 1ZG3A 4Q4AB 1U2EA 5DCLA 1OROA 1YRAA 4FU0A 3OEHD 2I6QA 3DTTA 1D2RA 3MR3A 5ALZA 2NO7A 3DAAA 4KXYA 1RBZA 2QB5A 1WZNA 4Z9FA 3X0DA 3F8NA 1P60A 4LOJA 1KOGA 1L7RA 5JYCA 3VR4D 2P2CA 1J2EA 1KEUA 1G9TA 5COAA 2IPMA 1M0EA 3H17A 3U44A 3A3YA 4IV8A 5GIPE 5JUMA 4XEHA 1C9MA 3MJTA 2AA3A 3W34A 3WYFA 5FFNA 3KHLA 3PHLA 4Z53A 3ASVA 3F7OA 4DR4B 2VPPA 4DABA 1G8AA 1WMSA 1RWKA 3GVHA 5AKLA 3AIIA 4XH9B 3JQ7B 3OSZA 1TQ6A 2D3WA 5A71A 2A9PA 2VS1A 1O08A 4RD0A 1YIAA 3KZNA 3NT4A 1A0OA 3MTDA 4K3VA 2A1TS 2J0QA 3GBPA 4MEBA 3N8IA 1ENOA 4B87A 3OHAA 4G0ZA 3GZJA 4ZT5A 3EH1A 3ZKWA 1BU8A 5EEGA 4AJKA 2QTBA 4YY3H 1SVUA 3V8QA 1ZFNA 2G04A 5ERXA 1RLJA 1H2XA 4JUAA 1XA3A 1U8FO 1JTVA 3D8HA 2R1VB 3O8OA 1SKAA 2A1TR 4XKJA 3W1BA 4BZQA 5ER9A 2WA2A 3BH7A 1ZI8A 2Z2JA 1WXGA 2P9FA 4TLLB 4HMPA 4NCXA 1J2TA 3N0VA 1B43A 2QN3A 4TSRA 4FSDA 4G1FA 3OOHA 3JZIA 2WRZA 4LRTB 4ZAYA 4FGLA 4RY9A 4BUCA 1OV6A 2J46A 5KYXA 2OPBA 1OVMA 1PFYA 5EKUA 3E48A 4GPTA 2V74B 3ABOB 2R6GA 3BJIC 1MN6A 3H5WA 3PT9A 4R9SA 5DHUA 4C3VA 4GFDA 5ITVA 5JQWA 2DUMA 1LLQA 1YRYE 4B48A 1JS1X 2J3KA 1Y82A 4ZEVA 2QXTA 2PLNA 3H7AA 2HM7A 2OBXA 2HQBA 1VCNA 1ESDA 3LRTA 4J2TA 2IA6A 3EPHA 3HU1A 1QO0A 4X64B 3VR6H 5GJCA 4KMMA 5KNCH 1M1YA 2VPTA 1U0EA 1ORVA 2CB9A 4D9JA 3UAVA 5IWAB 3F1KA 3WXMA 2H07A 2FR8C 1JT9A 5I4KA 1NNEA 4RUCA 4G2NA 5IHXA 1D2AA 3QF7A 3BMCB 5LVAA 5HS6A 1NW5A 3GEEA 1RFGE 1NR5A 4ARIA 1UODA 2WZBA 4Q3EA 4F3TA 4OHOA 4OKIA 1AQUA 3CH4B 4M8LA 5L1IA 5DHFA 5KSOA 2CLIB 2QUBA 1Q15A 1CNMA 3IO3A 1NJ5A 4DTCA 5IVKA 3RUFA 1IQUA 1HYEA 4DADA 3QLUC 3ZE9A 1I94B 1ZNXA 3C0KA 3EISA 4GH5A 5HCNA 2HHHH 1QHHB 4JC5A 2HIXA 4ZI3A 4JL8A 5AVKA 5KVVA 3K0AA 3SHVA 4F8YA 3A9UA 1OA0A 3OEHA 3G88A 3VYUB 1D5WA 5E7MA 1T3ZA 4O2LA 4P2GA 3TVTA 4I9UA 1KQFA 4IDBA 4Y2RA 3O7WA 4KXNA 4LXUA 4MQ6A 4F5DA 1EVKA 2CT8A 2OMEA 1H3NA 4QUDA 3NBYC 1AK2A 3VR4A 4TS4A 3VUFA 3PTZA 3KWFA 3EGIA 3MUOA 2B7LA 2IYPA 4PO1A 1A71A 2DLDA 3BYZA 2EW1A 4QBTA 4BNVA 3IE1A 3WX0A 4JLOA 3F4LA 1N8KA 2OWOA 3WSWA 1Q0RA 1EWYA 1E6CA 4RAQA 2OK7A 2O57A 4YDSA 1N0IA 4GECA 4FM9A 3B12A 4HZIA 3K6SB 2IBSA 5ENZA 3RLIA 5FTMA 2DABA 3CCCA 4BO8A 1NI4A 2PH5A 3WQSB 2VOJA 2VSQA 2JA6G 3TQRA 3HB1A 1CX9B 3CH6A 4PLWA 5JI2E 2ZR7A 9ATCA 5IF9A 2JVIA 3OD1A 1MJGM 5C7YA 5DULA 3RUHA 5BN3B 3V4PB 4A5OA 3T9DA 4DNFA 2J1LA 1SY7A 3WLEA 1YCFA 3NIWA 5HBGA 3PNBA 4YCMA 2OLJA 2WJIA 3J81W 3RKUA 5K3FA 3OEWA 1YZUA 3EQZA 4IV0A 3DLCA 1A0GA 4R81A 3HOZG 5L1KA 1CUVA 4CKBB 2YICA 3AVOA 2GBGA 3K0FB 2FMTA 1Q21A 3ZE1B 3CO0S 2ACVA 4YRRA 4EGQA 4KXQA 3E8MA 1B74A 3ZDXB 2YY7A 1V96A 2DR0A 4O2RA 4Y1RA 3VX3A 1KGSA 1RJPA 2HG8A 3TDNA 2HWUA 5FWAA 1JEEA 1A9PA 1HDEA 2AJBA 2DUNA 1KKMA 4J6FA 2ZPUA 3TW8B 2HCRA 5F77A 3I9FA 4ENPA 4GMDA 1IE3A 1M7GA 4FMPA 2CKDA 1L1RA 1FS6A 1V7QA 1MIHA 3Q9UA 2P4UA 5EP4A 2JG3A 4QLOA 5CLIA 3LPAA 2ONYA 5ESDA 2YWHA 2JGLA 2IZZA 3S6JA 1U0LA 1ZRSA 4WOKA 3ROEA 3PL1A 3PS9A 4CLRB 4WW0A 5D3QA 4UMEA 2CLSA 3UV6A 1QRAA 3RVPA 1TK3A 1F2TA 3RYFA 3LK6A 1RADA 2FJZA 2JLZA 1OLXA 3WRXA 2IVFA 4MVJA 1O89A 3RUCA 2J3DA 4JX9A 3BHIA 2Z95A 3UGQA 1SOUA 1LKZA 1T5DX 3HE3A 1XCBA 3ZHBA 4DWOA 3ZTYA 9LDTA 1MJHA 3V8NA 1RRPA 1IN7A 4XZ3A 13PKA 2XMRA 2FJUA 2JA8G 2GF2A 4YP0A 1OXSC 5GGXA 2R6FA 4EY3A 1TU4A 1AGPA 1FNNA 1YVEI 4LDRA 3HY3A 5T8KC 3H04A 3TE6A 1WY5A 3NBMA 4HB0A 3ZZUA 3UF0A 3QYPA 5KNDD 3OURA 2YJ6A 1GGHA 2X4LA 2D4HA 5DNEA 3UG7A 4NH4A 1G2QA 4TXLA 1XPJA 4LSZA 3IVRA 3CLKA 4LE2A 3GV7B 5DF1A 2PLRA 4PLTA 4ZCSA 4DMMA 2A3RA 2Q6KA 2W8BB 4BO6A 1XEWY 1BROA 5B1HA 3U3XA 3C85A 2GBIA 1EQUA 1KAQA 3FGPA 5HKKD 1O5TA 1YRBA 1RZVA 1H4VB 3EEYA 3WDKA 4DB2A 5BT8A 1ADYA 1N1EA 4ZCQA 5C8ZA 3JQCA 1Z2NX 2DETA 3CZMA 3FD8A 2V3WA 1ZM7A 2XWSA 3RAXA 3ZZ0A 2WTNA 1XVLA 5L9AA 3QQPA 4NS1A 2I1VB 2GPSA 1L7PA 1Z8FA 3JQBC 1K97A 3TTYA 1ZEJA 4J4BA 2VI5A 4CMCA 1EP2B 4AWBA 5KTYA 3E7DA 1U8TA 4AB1A 4RTMA 4JB0A 2IUUA 1G7SA 3SOZA 3RT1A 4Q7EA 9GPBA 3BICA 3D3KA 1X13A 1M66A 4FT4A 3Q12A 3GRFA 4YAWA 4APMA 2DQZA 4LEIA 1IAVA 2YC4C 3GJ0A 3ZDDA 2FSIA 2Q5LA 3CLSD 1YK0A 2I2BA 2FPGA 4NU0A 3JYHA 2FLVA 4ZOAA 1O9HA 2DBQA 4QXQA 2NUBA 4A8JC 4NBVA 2JGKA 5ALNA 3A9VA 1R0KA 2ZATA 4RNOA 2B9EA 3WAJA 1N7GA 2OXTA 2PHZA 3EUAA 1IOVA 1P2TA 2CNWD 3JVIA 1XXLA 3AETB 4JP1A 4N7RA 4NOMA 5CLFA 3KHHA 1S89A 5AT1A 1TQDA 4WKPA 4QZVA 3DDSA 2GERA 4BWGA 1SIUA 5AJHA 5JMWA 2HEGA 3IMGA 1I9CA 2QRQA 4NU6A 4QGFA 4D45A 3P2EA 3BSSA 2PDAA 2V9CA 1Z0ZA 4L08A 3RS7A 2QRKA 5HCIA 3KQTA 3TQIA 4I55B 4YCNA 2XRYA 1KU0A 1XZCA 1OX6A 4NKRA 4P83A 4P4TA 3SGIA 2R60A 2M6KA 4GLJA 5JJBA 3GGJA 4UUQA 2XE6A 3RWMB 1X19A 1ZGAA 1Z63A 3O8NA 1FFYA 3OZ7A 2E82A 1SBQA 1X7ZA 4L9WA 2D7DA 4OQFA 1WU8A 4ED3A 4O7YA 2FJ0A 2E4AA 3ZIAD 4UXHA 2FEXA 3ROXA 2H6EA 3VSDA 5JZMA 4MOWA 3D6NB 4CIAA 4LN1A 4QX6A 1UXHA 2X8WA 4KAAA 1DAKA 2BIFA 3Q8MA 5FPTA 3THRA 4B3TB 2HJHA 4K87A 2UYQA 1MV5A 5DTQA 2HJSA 3PTAA 3OOEA 2WIDA 2R85A 3DE3X 2FZ4A 1XMOB 1Y1VA 3JW8A 3U7EB 5CJPA 1LWNA 3IPRA 3P9RA 1TEHA 1YBVA 2YWJA 3T5TA 2O14A 3ZLBA 4L4XA 2QTVA 4TTTS 3ZNQA 2OBMA 3RR5A 1ADJA 5D8DA 1ONNA 4GMFA 1QFMA 2JHAA 3D7RA 2ZGIA 1ZK4A 1Q0TA 4ZZ2A 4DQKA 4DNXA 3J80A 5KNDA 4QHSA 1BKYA 3HCNA 4RYLA 3L7JA 2Q07A 3W79A 1XTPA 3GTOA 3COJA 4QQRA 1IG3A 1JVNA 4OGWA 3OJXA 2B6NA 3WLJA 1OH8A 2G28A 4BU1A 3A9WA 5EKXA 1BYIA 3SXJA 2EIHA 5TQ2A 1F17A 4J16C 2H92A 2QMYA 1WCMA 2HF9A 3WKDA 2PO5A 3LPCA 4U7FA 4EA9A 5BQXA 1QV6A 2YJ5A 1SXJE 2DH6A 2PL5A 4ECTA 3S24A 5HKKA 1V1RB 1MV8A 2DFPA 4EGJA 1P4GA 1O5OA 3TMKA 5E1BA 4NENA 2IQ5A 4HDSB 3AKYA 3DOCA 4WJLA 2ZSHA 1X7HA 4WDRA 1E66A 3QBJA 2X8AA 3OTQA 1KDYA 1BD4A 4I7HA 4FYIA 3PUYA 4AO8A 4HGPA 4O3FA 1ZMOA 4GZLA 4IOKA 5JNTA 2WSSA 3GLUA 3UJHA 3RSLA 4EBDA 3W1GA 3PXBA 4M83A 3BBLA 4YMTA 4EBEA 5COBA 1E77A 3TZEA 1I2BA 1XQ1A 4G65A 2VHZA 1JJAA 1E1NA 3ZR4B 2BJWA 1QOQB 3M83A 1E2NA 1BXZA 1KHHA 5JQGB 1I2MA 2NAFA 4I1YA 5IXSA 4A27A 4D81A 2XOXA 4JUBA 4C4PA 1N8TA 3DQQA 4DV3B 5B4TA 4TWRA 4DVJA 1MVOA 3PO3G 4U6PA 1DBVO 1UWVA 5SICE 2I1WA 4YJ3A 5B1DA 3CNOA 2CNWA 3NKFA 4Q16A 3SJBA 2VJYA 3LF1A 1ZP6A 2GPJA 3L2OB 4PZCA 3QA9A 3PQ4A 1GAWA 3SQXA 3GQVA 4NRDA 5F9FA 5A9TA 2VF2A 2WVGA 4X62B 3HDTA 2WF7A 5EEHA 2JZOA 4MQFB 1Y80A 3GLIE 5EZ6B 1JFRA 1LC0A 3ZE8A 2WU0A 5C8DA 3DPUA 3WL5A 1G2IA 1COZA 2E6UX 3F71A 5JXHA 4B3MH 2CUZA 1VSTA 4OSOA 1J4AA 3JYNA 3AIOA 1QVWA 1ZUIA 1W73A 5EZSA 2LRHA 1R5OA 3PIDA 3GI1A 2I4NA 4DLUA 3SSAA 2YFKA 4LMBA 3HACA 5LOVB 5CA1A 4B47A 3MCVA 3ZIAA 1SUAA 2C04A 1AZLA 3BJYA 3IBSA 2F9FA 3ZGXA 4LVUA 4W1QA 1TTHA 4Q3CA 4R1NA 4D56A 1GPMA 4KE6A 3DWIA 3LDHA 3JQQA 4N65A 4AY6A 4X0EA 3IAAA 3IQZA 5ICFA 4R05A 3PUHA 5I4CA 1BW9A 4R9UC 1A4XA 4E15A 1X1CA 4O4HF 1K7XB 2EZ8A 3CZ9A 5KJFA 2JB9A 4N1AA 1U9IA 4DDHA 5ALTA 5IRCD 2HMTA 5B5SA 4TX1A 1R6BX 3PZBA 2BFDB 2ZUBA 3B8HA 3HR7A 3V1KA 5IUJC 3AUFA 4RF3A 1QVRA 3Q4GA 1KPIA 1ZM2A 4YUXA 1HDXA 4LYFA 3EPRA 5CIYA 4FYWA 3QMMA 4JK3A 5LIRA 3S2IA 5AESA 4CV3A 2D7CA 1RU3A 4CMBA 4QEZA 3JV7A 2P69A 5BQFA 3H2IA 3C3PA 4AL4A 2PVPA 4BJ6A 2ZJTA 5KDOA 4HUQA 4JH0A 3KJNA 5C2JB 2J3EA 1KZ7B 3IESA 1NOIA 1GD1O 3FPCA 1U7PA 4QYSA 1DTWB 1P0QA 3TLXA 4BFWA 3OWOA 3EG5A 4L4ZA 1Y8RB 1XTJA 1YCHA 3DDCA 2JFNA 2IOQA 3IT3A 1PAUA 2RI1A 1ZAKA 3T7TA 1R4NA 4JASB 3GIDA 1ZJZA 3C6BA 1XFAA 1KAMA 2G72A 4WX2B 2G9ZA 3BTVA 1NL3A 3V34A 2EWMA 4C0KA 4YJGB 4EQ6B 4NZNA 2J4DA 3DMTC 3RHFA 3JR3A 1NM5A 1L5LA 4NZMA 3MT0A 1NLZA 5H1YA 3R1IA 4MZDA 3LAWA 4B3JA 2CCJA 4XSGA 2YYZA 4GC5A 4F2PA 2A0KA 1J24A 1JI3A 2PL3A 5BSHA 2O23A 2NVBA 3LUFA 1ZIXA 1TVKB 4M7RA 3BIWA 3FHJA 3MMPA 4FLMA 2QYSA 2BELA 4AICA 4DCMA 2J48A 4BO7A 4G36A 3SSMA 3B1JA 2CW5A 3GDHA 1N32H 1FBNA 3RTBA 1FL9A 2ES4A 3AXSA 1TFRA 1U5CA 3ESBA 2W83A 2CLHB 1K7FB 1EKPA 1P18A 1Q74A 2HJVA 5C34B 3EODA 3TY8A 3X1KA 2OGUA 1VM6A 1Y1SA 4ZZIA 5KEIA 2AFHB 2ZT5A 3TEMA 4TTQA 3TIFA 5BXYA 1W30A 4US0R 2VPYA 3QEMA 1MD9A 4RBNA 1GCGA 3PSAA 2CZGA 4J03A 1BJRE 3RQSA 1RJQA 1CZOA 1SCIA 4OXYA 3SIWA 4EMSA 1IUNA 2JIMA 1KKLA 3HCWA 4D4JA 2XXJA 4IWXA 2N1BA 2IH4A 4J0IA 4YR9A 2QJFA 4M2LA 3S55A 2HRQA 4TQRA 3DMHA 1UF9A 1LWOA 5JCJA 1HH4A 3U26A 4NXNB 4AVYA 2GLTA 4L5IA 1MQAA 3R7DA 4RVFA 2BMAA 4W6ZA 3CUSA 3NWOA 1CQJA 2YHUA 2YMMA 3IIKA 1OBHA 5TNXA 1YQEA 3GMTA 1RPTA 4IMPA 4LCEA 3L1VA 2BFEA 1TJYA 2W4IA 1Z37A 4EW6A 1ZRHA 4MDYA 2NPFA 3OTOB 1NUQA 2BYTA 3VYSB 1YI8A 2ZTHA 2VH1A 3HKDA 3OZWA 3F78A 4EJSA 2G1UA 2D74A 3QVKA 3CX7A 2EW8A 4V1CI 3QUTA 1SD1A 4PFQA 3WIDA 1VL5A 2AYXA 4K46A 3C3MA 3I62A 2R6HA 4DL9A 5FPYA 1V35A 4ARBA 5C81A 3ZBQA 1RM0A 3IBTA 1DJOA 1DCTA 3AR4A 1JXAA 2NVOA 4P0TA 4QLBA 3S2SA 3FI9A 5B58C 1JSLA 5KKNB 4Z4FA 2RK4A 1ULAA 4RUKA 2XOKD 1NJ8A 2QTFA 4PNZA 4ZQCB 3ER8A 4QPNA 2IEBA 4BQSA 5LSAA 1WXFA 4TLAA 1UFRA 1YULA 3FPHA 1A8UA 5AQ1A 3WL6A 2PGXA 3TB6A 3DAHA 5G3YA 3KKZA 4UCTA 1N5RA 4OQYA 3NYQA 5ALPA 3QMVA 1PZFA 2FXIA 4RLHA 2A0WA 1O0BA 2JJYA 3KE8A 2OSBA 1WPGA 1D6MA 5LLDA 2J3JA 1UKEA 2QUIA 4TSFD 2YV3A 1SH7A 2EW2A 5IKOA 4CT5A 1XNGA 3GUYA 3VFDA 2E5LB 1IOLA 1XTRA 4JKIA 2GDZA 3WBJA 3ESDA 5JW6A 2NSHA 1XNQH 3GJ4A 3FG9A 4FE4A 2NYUA 1YBAA 4MVJG 3CEJA 1UUFA 4KQXA 2F3UA 4NHEA 4O3MA 2M32A 2O3JA 4CM4B 3T7CA 2ZJ6A 1Y1LA 3LSTA 3TLKA 1R8JA 4HLUA 4JLJA 3LHSA 4CDGA 1U2QA 5KAMA 4OQEA 4CE5A 5EVCA 5KTPA 4UE2A 1QG0A 1F4VA 1DMRA 4B82A 2X1VA 2CLLB 2WAQA 3M9OB 3IQDB 2IF2A 3THOA 3OF5A 4OPMA 4NFSA 5K0JA 1F2UA 4JLNA 4X9XA 5I9BA 5L3QB 4AI6A 1XF1A 1FFEA 5LDHA 5F7ZA 1X0XA 4ZYLA 4B33A 4URHA 3OSUA 4UTZA 1CQIB 1CZUA 2WWIA 4DKJA 5DCUA 2GZ1A 4JOSA 3KJFA 2Q3DA 3FUTA 3PPWA 1XAHA 1U2RA 2FU5C 1MC5A 4G89A 4KHZA 3VAYA 4FJ0A 4X3OA 3SR0A 4IM7A 4K9DA 5T8KA 4AZ0A 5DG7A 3CUVA 5HNEA 3OM8A 3WK6A 1MW9X 4NG4A 3U3MA 4DL6A 3NWBA 1VE1A 1Q84A 1HDYA 1BE6A 1Q0PA 5G2OA 2CGEA 4EO4A 4B3GA 3ZGOA 1AXGA 2JCSA 1SZCA 1BDIA 4BPRA 1GQYA 1GPH1 3RSZA 3EH2A 2QTNA 4UTVA 4KXMA 3QFHA 4YQZA 1P9RA 2NZJA 2VYVA 2F6RA 4QW9A 4DXHA 3PPVA 4Q4LA 4URZR 4DM7A 2ZS7A 4D97A 4G3XA 5CB6A 2CEKA 2BEWA 4PLGA 4XQGA 3QVUA 3E3NA 4N5IX 1PJCA 5LYJA 3G0IA 4I4LA 2J59A 1RQPA 4Q1VA 3TIGA 5C18A 4L27A 3EXAA 4V39A 1SCUB 1ZMXA 4KQEA 2RJ3A 1Z4LA 2CXPA 3S2UA 5F5NA 2QD1A 1COWD 1TQ4A 5JRDS 1IHPA 4NCHA 3TEFA 4YT4A 3QVGA 3K05A 1X7YA 2PXHA 1I30A 3F3SA 4X41A 2JAXA 3B5EA 3P52A 3KOWA 4F12A 4HDQB 2RK6A 4BLVA 2PUDA 2Z43A 4ALMA 2JLWA 1U28A 2WTFA 4MRNA 4CU5A 5FCDA 4DL5A 2OEPA 2PGDA 1O96B 3BWMA 3E7PA 2AJ8A 3LGAA 4M1OA 1NVXQ 5BMVB 2XOKA 4OMUA 5LL6b 4A8PA 3A11A 4OO3A 3ECAA 1BEUB 1FPMA 4URYR 3EOBI 1T2EA 4ALNA 5H3HA 1PR0A 4H1UA 3S3TA 2FEWB 1A9SA 3VTKA 3GCXA 3L49A 3M34A 4GI1A 4QJ4A 2G88A 2WU1A 3E05A 4B6RA 4TSFA 4ZIRB 4NMLA 2COIA 4C0SA 3TNLA 3RF2A 3G9TA 5ADUS 5KVAA 2P9YA 1K8XB 2WG1A 5JNLA 3ECSA 2O5EA 1RYZA 1VKNA 3T3MB 1EDBA 5D6NA 5AMXA 4MIYA 3RAGA 4TRRA 3WRXC 2X86A 2E89A 1CEYA 1MNAA 2GCIA 2WM3A 3RR2A 2CC2A 4ER0A 4DV1H 3ZWDA 1I1QB 2F1KA 1R74A 2WJPA 1MB2A 4IDQA 3LLMA 2GRJA 5L4LA 3Q9NA 4G0QA 1CJKC 2ACKA 1Y1VG 1UM8A 4ND7A 3ROPA 2C57A 1I3NA 5DBHX 2AG6A 1EKXA 4F21A 2OO7A 1BCRB 2ZRBA 4IH1A 2V4RA 3UAGA 4UAJA 3NBKA 4AMBA 1GZDA 4E09A 3UJNA 4RV5A 1Q3KA 4ED1A 4FYPA 1YXMA 3TIVA 2J6TA 4M53A 3E7FA 3ODGA 1P16A 4ZPJA 5AVOA 1GFIA 1NBHA 3GTQA 1G6HA 3D2AA 2Y0PA 5AKZA 4OI1A 1E3WA 1J7JA 3LKVA 2E4ZA 4J90A 1OUMA 3LGSA 5LWHA 1WCMG 4OA5A 4PC3A 3VTZA 1V26A 4ZI7B 3ZIDA 3P9KA 1NNLA 3COWA 1Y3CE 2JFWA 4IR7A 4DKXA 3AL2A 5KFWA 1L5SA 4MVWA 3HWX1 2VAVA 1AMOA 3M6FA 4IL5A 1AZSC 3T0FA 3DZIA 4URFA 3SQNA 3L6RA 3FCOA 3QI7A 3QITA 2X0SA 3LUKA 1X8KA 1GZ7A 3MC1A 2AJCA 3SSOA 4KPUB 1NXWA 3IMKA 4LQCA 5E1OA 5CB8A 3DBLA 2CXNA 4KR9A 3C4JA 1NONA 4L2IA 5AI8A 1DJNA 2Q6TA 5C8VA 4D3FA 2VPZA 3WLRA 2CCGA 4J76A 3ZVLA 1WPQA 2IQIA 3KYDA 3Q5DA 4BC0A 2OV6A 2B4TO 4EITA 1EDOA 1COWA 1K86A 3QKUA 4I66A 1JYEA 5KJCA 3JQ8B 3BL8A 1L7DA 4M7OA 5CX1A 3QEJA 4D57A 1XHEA 3UKOA 1JBEA 1T4CA 3DD1A 4EYSA 5AKJA 3EA4A 2WMYA 4UAVA 4IHJB 5E6UB 4F1KA 4KUEA 3UQYS 4M0UA 2VNJA 2YFHA 3KO8A 3RBEA 2DP4E 4Y2TA 1Q12A 5EWLB 5KFMA 1GZSA 2VO1A 1AT1A 4DEVA 3BSYA 3IVMA 4IKEA 3HV2A 3HNRA 3HGMA 3LFTA 2VJMA 4EMBA 1U8ZA 1ACLA 5THKA 5GJWC 3QXGA 2JH3A 3MTIA 4E5MA 4ETMA 2AR0A 2CYCA 3DT8A 3UMGA 1SC9A 2RE8A 4YCDA 4DCGA 1T9BA 3E35A 2GN0A 4PPNA 1N1MA 1AA9A 2HV8A 3ZWXA 2ZSBA 1JDEA 5DV9A 2HGXA 3RIZA 2WABA 1V7PC 2SNIE 3N28A 2V0GA 4M21A 2QJWA 4I14A 4K05A 3WLQA 2H1FA 4XAQA 5JSUA 4FC6A 4NU8X 5JASA 5E1MA 2ZRNA 2QTZA 4BKOA 4KMRA 1NVVR 1VC2A 2EDAA 4PC6A 1PK7A 4QTUB 5BV2P 1IWOA 4WL0A 4IQ4A 5JHHB 4X5OA 3O0TA 5IUNC 3ADOA 3BRSA 1Z4KA 4LNAA 2BHSA 7ADHA 1DKOA 3FKSD 1Z25A 1UT8A 1SUFA 1M1NA 1YVUA 2X4DA 1TCCA 4DIDA 3CZCA 4MGEA 1NX6A 4K9QA 2X4GA 4IIXA 3ZD6A 4WK6A 4QYMA 2AMFA 2G1KA 5IT5A 1KIFA 1H0SA 1FYXA 3OQIA 3G2HA 2ZT6A 3HSKA 2Q5JA 1NVTA 2FZGA 2WOJA 1NMZA 4JI6B 3TPFA 4Z49A 1QQ7A 2A9FA 1URPA 1Y81A 4MH0R 3UATA 3AHJA 2XT6A 3B2QA 4KLAA 3PUKA 4MGZR 2QM0A 4DG5A 3MHTA 4OF4A 3WKBA 1CS0A 2PS3A 3DOEA 3H87A 3Q3CA 2IHJA 3QU7A 2IZ5A 3CUWA 1H1LB 4Y6PA 3M9XA 3P9CA 3DTFA 3UHAA 2QVXX 3FRJA 3I64A 5IMBA 1VL1A 5EKTA 1R27A 1GRCA 4ECAA 2BPOA 4CRWB 4XA8A 2DHEA 1UAAA 1ZMBA 2VJNA 4ER3A 4KHPH 5KFXA 2MSWA 4DAOA 2IPOA 4MP3A 3EPJA 4O4LF 5LB4A 4P7KA 2ZVQX 3VZSA 2WYIA 3PRJA 1HLFA 2FX2A 3A9CA 4NXMB 1E1MA 1ZJ4A 1JHZA 3WYGA 3RJ0A 1DELA 5BW8A 1ULBA 4RV4A 4MWSA 1GT6A 4EEKA 4XLLA 2C78A 1ZCBA 1J8DA 3ANMA 3VYWA 3CBQA 2J7KA 3B6EA 2J5RA 3PPIA 5A6SA 2A1HA 2D1SA 2HRBA 2J9FA 1G63A 4BRWA 3S5JA 4HNSA 5AICA 5CVCA 1BX1A 4P3YA 1ZONA 1I3KA 1NP7A 4K9MA 4N39A 4LVNA 1V8PA 3SF8A 1K75A 2Q3EA 3CLSC 1R6XA 3LX5A 3LC7O 1H23A 2XLBA 3BJEA 1KK1A 1FPQA 2AGOA 1PFQA 2O48X 3IXMA 1IONA 2IF0A 1AHPA 2HPZA 3AEUB 1UBMS 5ALIA 4A0HA 1SR8A 1X8JA 2R48A 2B4AA 1Z83A 4KDEA 3KHTA 3O84A 3P2JA 4OHXA 1RWNA 2ZAMA 1Y8ZA 5CTAA 2VHVA 4GSLA 6Q21A 1M7JA 2IJGX 4QLAA 1VJTA 4H35A 4TS9A 4PFSA 3B6JA 3WGUA 2B0CA 4YI5A 2G1JA 3OPYA 5K09A 1YIOA 5EESA 1HC7A 1D7AA 1HQKA 3ZV7A 4X44A 3M6XA 4OBEA 3MR2A 2MCTA 3IMCA 3H5OA 1PNQA 2BQ3A 1JH8A 5JRJA 5DHQA 3BDAA 1QG6A 1WABA 3J7TA 3D8TA 1BS2A 3MTJA 1MU0A 4ZP1A 4UM8B 4EJMA 1G3QA 3CRVA 3AO0B 4OXKA 4NPAA 1YB2A 1N2OA 2WUDA 2O8BA 3IBYA 4JI4B 4Q4HA 2A1IA 3HKCA 3WSVA 1XZLA 3OD5A 2J7PA 2WP0A 4M0LA 4TQ9A 4XFJA 2JIBA 2P68A 2V9ZA 2RONA 4D8XA 5HXAA 4FYKA 2H4HA 2CDCA 2Q7XA 1L7MA 4YBRA 4WSOA 3W1WA 3HGTA 2X7JA 2VDUE 4UHDA 2XDQA 2VUTA 1M2FA 3ANTA 2GYWA 3SC6A 2OHXA 3LBIA 3CV3A 3H11B 3RREA 1FRNA 3FKSA 4EB3A 1AHNA 5I6DA 1PG0A 4LMPA 2W42A 1U9IC 4IEEA 3HBNA 4RLFA 4RV9A 2P9TA 1EXDA 4QFCA 1ORWA 1KRHA 3GD5A 1VJ5A 5AM5A 2HU2A 2PTGA 4OXRA 4NQZA 2PBFA 4TS3A 2VXYA 3A7EA 3GPDG 5JHGB 1BHQ1 2MTBA 3COVA 4G56A 3ZNNA 4UU1A 1Z2DA 2A0XA 4AMGA 2VZ0A 4OX9H 1QS0A 3WMWA 3U1BA 2C5BA 2VQFB 3E3LA 2ZM5A 2AUTA 4WESB 1T36B 1SA0B 3NCHA 3EZ9A 4LC9A 1YIDA 1BOOA 2WIJA 3M89A 1RI3A 1O6CA 2R5FA 4Z0PA 4A8TA 5TS3A 3PPXA 3QHPA 3KR2A 3IAXA 2PR2A 3E9ZA 4ZQHA 4RY8A 3DBOB 1ESCA 2PKYX 1E9EA 4OHFA 4WH0A 1JU9A 3P0JA 5FPQA 4M9ZA 3DEYX 2F3RA 2B1IA 1KK3A 2FFQA 5F9HA 1OC2A 2Z6AA 3QMWA 3G2MA 3K6KA 5HMLA 2YNMD 1JJVA 1U81A 1ZC4A 5CD1A 1YUNA 2C5FA 3FGZA 5KKAA 3BRWD 2OHGA 4CLDA 1D4FA 2BWJA 1FVFA 3BULA 3PRKE 1A1VA 4ENWA 1T0UA 3LLVA 1UP4A 1NM5C 1QMPA 1C7IA 2NGRA 3F0TA 3CX3A 4GKVA 1OF1A 2VTKA 2ZJ3A 2C2HA 4PLVA 3TLBA 2PGOA 4YO8A 1G8HA 3W90A 2I91A 1NFQA 2NVYA 2FK8A 3PNKA 1M8JA 2WICA 3JWEA 2GD6A 1NBME 1NJFA 2GBPA 2A5DA 3HJHA 1NVDA 4Y2HA 3DVQX 4HEQA 4JV5H 3VC7A 1YR3A 2C7QA 3U61B 4QOEA 2P6UA 1V5IA 2QYOA 1CUFA 2I9PA 2VNSA 4UNPA 4A0GA 3IQIX 5D1OA 3MLBA 2PCLA 2XUPA 2F4VH 4O08A 1W88A 1Q17A 4FBMA 3R2JA 1XK6A 3CKLA 3PYLA 4DV2H 3ZI7A 1KH1A 1CR2A 1AN0A 1IUPA 3LZ6A 1X7WA 2EVWX 3LVFO 1DIOB 1RHJA 3ZV6A 2ZQYA 1E2GA 1DRKA 4X24A 2YJGA 4A2CA 4AXXA 4G67A 2V0CA 2PQMA 1BKSB 4BVKA 3IHLA 3OCVA 1HK7A 2G5PA 4ZRMA 1I1MA 2BGKA 3NIDB 1H6BA 4JHXA 1ECFA 5BNWA 1YFLA 4PO9A 4IGIA 3OFND 1KJYA 5JJKA 4AKIA 1EEXB 1VPWA 1NKSA 1ZN7A 3CJTA 1DKPA 3EEQA 1VZ2A 2YYSA 2BQUA 4IIYA 5I8WA 3UJ6A 4M8IA 2P62A 3J81A 4RVSA 3KT0A 4WBNA 1QOPB 4AKHA 4WBNF 2RG7A 2W48A 2ZJOA 1EXWA 5D85A 2UYCA 4X71A 4JMPA 3M6VA 1DRWA 4MI3A 3E9CA 4MKGA 3G9XA 3WNCA 1UXGA 5BR7A 4UUOA 2PUGA 4EENA 2XTZA 4EJSC 3U4QA 3LS2A 3EFOA 4NZOA 4MQUA 1CS4C 3ICEA 2FQ1A 1S68A 1J2YA 1UXKA 2ZXUA 1DJLA 1EFDN 5AI0A 3IIIA 3CNNA 4BO2A 4FFRA 4L28A 5FPOA 3IOBA 5K4HA 1XEFA 1QBGA 3JQAB 4LDZA 2FPPA 3BD9A 3FYUA 1K5GA 3IEMA 1HSOA 4H7IA 5IVDA 2GTIA 1H2HA 4WECA 2Q3LA 4DMKA 4E1AA 2FZVA 3H5IA 4FOTA 2XJ9A 4U2KA 2FZEA 3NOQA 4X1KB 5ALQA 5HFNA 2XIJA 1MXHA 1R88A 3NC0B 4BNUA 2X0IA 2NVUA 5C31A 5BOVA 3GX1A 5IDWA 4XDYA 4EG5A 4BIIA 4Y2QA 1EIWA 3L0BA 2BMJA 1TAGA 4OAPA 4ZDKA 3MERA 4E94A 4RWEA 2P4EA 1PZMA 3OLZA 3CKYA 2GXUA 5BSMA 3DKRA 4WY8A 3STTA 5BT9A 5BR4A 1GAEO 5T7BA 1ACMA 4CKCB 4EG1A 3PVZA 4ZI5A 4RD4A 4KSYA 1GTVA 5HFJA 1JFFB 1U8XX 1XCLA 2YNMA 3GARA 1RYNA 3BRWA 2J0UB 3ETHA 3V1YA 5LA6F 1U9YA 1N6IA 1UT6A 4AUEA 1GAXA 4QM6A 1NQXA 3NM5A 4AROA 3UBTA 2J3QA 4LGVA 2QW1A 2ENUA 2RHMA 4KAJA 3AC0A 2MMGA 1V9PA 2HMVA 2C5HA 3C5EA 2AT1A 2GFIA 4HLUC 4LI0A 3ZE6A 4HDRB 4ZAXA 1VKZA 1KEEA 2XZTA 1PX0A 3AW9A 1RCFA 4N5LA 5CURA 2P6NA 3E3MA 3SBEA 1NDUA 4K6HA 3HJNA 3JARB 3L7IA 2B78A 4OMDA 3ZCRA 3C3XA 2YY5A 4DR2H 4DL2A 4LFBB 3DAOA 4CUZA 1RE0A 3JZ6A 1GUZA 3UK1A 1CDDA 3GVXA 1N6NA 3H4BA 2OM6A 1XFDA 1JU4A 3N6VA 5HJ7A 1MA3A 1UEIA 5DHPA 1CY0A 4UDXX 1KQPA 4WEQA 4JB3A 3GJRA 1E6WA 3HG7A 1NW7A 3VNBA 4ZREA 2XMQA 1M2JA 2PPVA 3W5UA 3LXRA 3FSJX 2YWBA 3CZQA 1U98A 3OFNA 3H1FA 1RKUA 1NR7A 3MIIA 1VIAA 1X7XB 3S81A 4DIKA 2B3DA 1C3OB 4LX8A 1RQ7A 1Z0SA 4QJ5A 1VKOA 4YRIA 3GRKA 4PZLA 1SB9A 2LUOA 4P2BA 1JQAA 3A2MA 5TDHA 5TR9A 1T5TA 2WJJA 1MNQA 5ALXA 1B15A 3KR0A 3L1IA 2Y1KA 2DFNA 1RP1A 5A62A 4KWEA 4IIHA 3DPSA 5K0ZA 3W78A 1O4WA 2KS6A 3AWDA 1AKRA 1JBKA 4TMXA 2JAHA 1C1YA 1RI2A 5FUXA 3PKJA 1N5OX 4OQZA 1XWWA 1PR9A 4D0GA 4YPFA 4KBGA 3DFIA 4YROA 3KXKA 3B1KA 1TF5A 1G5PA 2FZCA 3PGVA 2HSDA 1M8KA 5E6RB 2EFCB 1GAQA 1RMQA 4DNPA 3WYDA 2PAAA 3TQ1A 5CPBA 1RXIA 2JNWA 3LNCA 1HEUA 2GN4A 5AM1A 3RSCA 3EZXA 1U28C 2OWEA 1TQ2A 1T5OA 4YRAA 4L0CA 1T0BA 3RVRA 3NWEA 1XZGA 4QXRA 4BLWA 5B7NA 1WBDA 4EHJA 4UARA 4WZBE 1KEPA 4G0YA 5HIAA 1N9GB 3ILSA 2JI7A 4K7JA 3O2NA 4YI3A 2IU6A 3FF4A 2O2SA 2Y3IA 2QD5A 3IAM6 2QRLA 3IEPA 3N44B 1FRQA 1P4JA 1ICEA 4BX3A 1C30A 3QLVC 1O94D 1HNNA 4YMWA 3K8OE 3FNEA 2R1ZA 3RFUA 2R92A 3UWPA 3PRHA 3T3OA 3UJ3X 1QIHA 1EK1A 2E9SA 4NE2A 2PMDA 2XTAA 3AYXB 2I0FA 4ND6A 5AVQA 2ZE5A 1ZUWA 1AS2A 2C58A 2Z1NA 4DARA 4DV0B 1EJ0A 1VJRA 2EU8A 1UNNC 3R0ZA 2HRCA 1DJMA