5CAEB

Succinate bound to pig gtp-specific succinyl-coa synthetase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
publication title Structural basis for the binding of succinate to succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 135
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5caeB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5caeB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5caeB03
4XYLB 5D8DA 4YB8A 1JDBB 1B6RA 3LP8A 1OBDA 1VKZA 3K3PA 3K5HA 1KJ8A 1ULZA 2J9GA 4HQ6A 2R82A 4IWXA 1AUXA 3V4SA 4XYMA 3GIDA 4ZHQF 1I7LA 3TIGA 1GSOA 1JKJA 4DIMA 3PFFA 2HJWA 5J2TF 1W96A 2FP4B 2DWCA 5K2MA 1B6SA 2W6MA 2XCLA 4I50F 3Q2OA 4YAKA 4HR7A 1JLLA 5HBRA 2NUAB 2OLSA 2R86A 2WYOA 4I4TF 4XZ3A 2NU6B 2YV1A 4XX0A 2PBZA 2DZDA 4FFRA 3Q1KA 3JRWA 3OUZA 3UFXB 1AUVA 4O4JF 4QSHA 1KUTA 5JQWA 4O82A 5LOVF 1VBHA 3MWEB 4MAMA 2YZNA 2I8CA 1EUCB 2GQSA 4M9UA 2NU7A 1GGOA 1EYZA 2R6FA 2YYAA 1KEEA 2XD4A 2R85A 4O7SA 4FGRA 3SE7A 2FPIA 4C5CA 3DF7A 1DV2A 5DMXA 4TV8F 4YBZA 2V58A 2YL2A 4MV8A 2CSUA 4IWYA 2NU9B 2P0AA 4YJ3F 4O7RA 2SCUA 1I7NA 5JQGF 4EG0A 4TV9F 5CAEA 5CA0F 3TW6A 4HNTA 2FPGA 3RUPA 2V5AA 2R84A 4HNVA 1KJIA 3KREA 2W6QA 3U9SA 1UC9A 5C8YF 3TINA 4O7WA 3RV4A 1PK8A 5GONF 4O2AF 2FPPA 3R5HA 3R5FA 3VMMA 1SCUB 1OBGA 3MJFA 3R5XA 2YV2A 3TIIA 1CQJA 3JZFA 5LYJF 4IIJF 2ZDGA 2W6OA 5EZYF 1BNCA 5LXTF 2FB9A 4FFMA 5CB4F 4XYMB 3WNZA 1KBLA 3KAKA 1KJJA 1EUDA 4XYLA 4O7YA 4Y8VB 1A9XA 4FFLA 3HB9A 4YAJA 2I87A 2VPQA 4MV7A 2VQDA 3ORRA 2YZGA 2QK4A 3VOTA 1M0TA 5BMVF 5BPHA 3G8DA 2W6ZA 4YAKB 1E4EB 1JLLB 5HBRB 4FFPA 5C1OA 1OI7A 3MWDB 4XZ3B 3E5NA 2X0SA 2C00A 3WO1A 3K5IA 4O86A 2FP4A 3GLKA 4WBNF 5H80A 5IYZF 2YS7A 3R9RA 4EGJA 5BPFA 2R7KA 3VA7A 4DLKA 2NUAA 3N8DA 2NU7B 1UC8A 2Z02A 1GSAA 3ETJA 3HBLA 4I55F 4HNUA 3VPCA 4WD3A 4ZOLF 4O2BF 5JVLA 1GSHA 3QFFA 4O84A 5KX5F 3NUAA 1DIKA 4YJ2F 2SCUB 2GPSA 5HV6A 1KJQA 1EZ1A 2QF7A 5JH7F 2R7LA 5CAEB 3RFCA 2NU8B 4IZOA 1CQIA 3RV3A 4IHJF 4FFNA 5LA6F 2CZGA 5JVDF 3LWBA 3DMYA 3VPBA 3G8CA 1KJ9A 2FPPB 2W6PA 1VBGA 4FU0A 4YB8B 2PN1A 5J2UF 4C5BA 4MA0A 3TQTA 3U54A 2IP4A 2HGSA 5C1PA 1DV1A 4ZI7F 1EUDB 1WR2A 5FNVF 1JKJB 4O7TA 4MV6A 1SCUA 1CS0A 4YAJB 3ORQA 4L1KA 3AX6A 4TUYF 5LP6F 2ZDHA 2DIKA 3I12A 2PVPA 1Z2OX 4ME6A 2YS6A 1Z2PX 3OUUA 1IOVA 3BG5A 1T36A 2R7NA 1C30A 4Y8VA 1JDEA 1IOWA 3N6RA 3R23A 3WO0A 4O7VA 4O7LA 5CA1F 4XX0B 2W70A 1CE8A 5I47A 4EGQA 4ZQIA 2I80A 2CNQA 1EHIA 4O81A 1E4EA 2YZLA 2ZDQA 4C5AA 2YZMA 2YRWA 3MWDA 2NU6A 4O4LF 4O83A 4MV4A 4MV1A 2FPIB 4FFOA 5KKNB 3UFXA 4O7ZA 4YBZB 1BXRA 3MWEA 1W93A 1EUCA 4E4TA 4FE2A 4O7NA 2YWVA 4MV9A 2GPWA 2VR1A 2GQRA 2CQYA 3HO8A 4RZQA 3U9TA 2W6NA 3JZIA 2CNUA 3U55A 3AW8A 3ETHA 2YRXA 2FPGB 3VPDA 1CQIB 2CNVA 2R87A 2V59A 2DLNA 2R7MA 2NU9A 1GLVA 2Z04A 3JRXA 3V4ZA 1KC7A 1C3OA 2NU8A 1Z2NX 1M6VA 4MA5A 4MV3A 1A48A 2W71A 1PX2A 4O4IF 1CQJB 1M0WA 2GLTA 2YW2A 3KAJA 4NYEA 3KALA 4O4HF
chains in the Genus database with same CATH superfamily
3AR7A 3WAKA 4Z1MD 3CURA 3IILA 3ROGA 2WTBA 3GLHB 5I7AA 4DV5H 2ESRA 2B98A 2BC9A 2Y9PB 2E18A 2JJ1D 3KZOA 4B3TH 5CDGA 2QE7A 4HXFB 4N9QA 3VZRA 4UVHA 4F7DA 2J67A 3SQNA 5BYKA 1ORDA 3OFNA 1P3JA 3PPWA 1Z6TA 2WT9A 4JI2H 2VT6A 3ANXA 3BFJA 3QFCA 2VUSA 4IOJA 1EWKA 1U9IA 4BO7A 3O2QB 4U5XA 5JNWA 1V7PC 2AW5A 4PBSA 3SXUB 3JYHA 4MHTA 1G42A 5I9IA 3OPXA 2DBYA 2ACVA 2ZVQX 4KGDA 1RJFA 2ISCA 1L3BA 1IM5A 2P79A 3PC7A 3U4GA 3T38A 4F6RB 1RR6A 4HLQB 4O7SA 1G5TA 2O2HA 2F1RA 2YY5A 3KOXA 1L1EA 3G49A 2VUGA 1IJKA 1O6ZA 1SXHA 2EZUA 3TPZA 1Q5PA 2QX7A 3ZD8A 2ZJ1A 2O5EA 4XGQA 4Z0HO 4QWDA 2QL6A 3WWDA 5DHQA 5HOEA 4KV9A 4EVIA 3PQ3A 3K1JA 3KR2A 1JIXA 3ELBA 3FTDA 4NZNA 3MELA 3IO5A 4BVGA 3R5FA 1U1FA 3MJFA 3F4LA 3JSLA 4BNTA 3RANA 1L8AA 4RNDB 4X20B 2ZXUA 4J2TA 5AVWA 5JIBA 3DQPA 2VF5X 4UCVA 5K3FA 3X1WA 1P44A 4M7PA 3CPSA 4EJSA 3PUZA 1ABEA 3NATA 1U7DA 2XYHA 2PL9A 4MQFB 1V1MB 3HCDA 1PJAA 4M1TA 4Q39A 5TJ9A 3EN0A 4U7GA 4YCBA 5KFOA 3LOUA 5BOVA 4WUTA 2BYTA 3I1IA 1CRQA 2VJAA 2HMSA 1ZYUA 3A6JA 5TV2A 1XVUA 1A8QA 3VPSA 1NAIA 1A0OA 4ZOBA 5IVHA 4M9CA 5DBEX 3QUAA 2IHJA 1QHEA 4BEJA 3OECA 4IRDA 3DG9A 2WD8A 3W7VA 3UMJA 3I61A 3T06B 2VOEA 5JVDA 1V39A 4AVYA 3A6KA 3TQSA 1IPHA 3RYHA 3BIWA 3ETEA 2C4NA 2OSBA 3PK0A 3G2OA 1K7YA 3QVJA 1NXQA 1M33A 3I9NA 1ONPA 3R4VA 1XZDA 4V0OA 4KHPB 5FPKA 3TTSA 2AN9A 4DLNA 3ICWA 4OQ4A 2X23A 2Y0PA 4TQSA 2Q2OA 1T4GA 2ATEA 1YIOA 2RK4A 2HIMA 3TIVA 2B6HA 5SY4A 2A0YA 3CZ4A 4AS1A 4HG2A 1W5BA 2X13A 3DE5X 5DHRA 3ADCA 5HYVA 5H9VA 3Q8SB 4FBGA 3GP8A 3DULA 1D6SA 3IV6A 5CYOA 3O0TA 1R5OA 3DEAA 1NJ1A 1Z08A 5LZ7A 4C7JA 1T9DA 4P83A 4CEIA 4BFVA 1WNTA 2A0WA 4UCSA 2ZZKA 3CLUC 5FYDA 3R7LA 4EYSA 1Y3FE 2PMZA 5E8RA 1SKBA 1Y9AA 1YUBA 3TIFA 1XNHA 5KREA 2P9CA 3LHDA 5TS3A 4PWYA 1V11B 1JQ3A 3F74A 4IQ0A 1XEXB 2W2TA 2W2NA 1BE0A 1WVMA 4CMEA 4QJ4A 2HGWA 3H2ZA 1DWOA 2W6ID 1WWKA 5H59A 5K8VA 1O75A 5EN4A 3RS9A 1R9TA 1H8HD 3ECAA 3ZV5A 3OCCA 3ZQ4A 3E9CA 2HXGA 1OSNA 3WJ2A 3EVTA 3KYHC 4QW8A 2O5RA 5C4XG 3CVUA 3DTVA 1LS6A 1V5GA 4E2YA 4PRYA 3I04A 3I72A 1ZXLA 2AJBA 4RD0A 4ETWA 2B99A 2QN1A 5F7XA 4B3RH 2XQIA 3NIBA 5D51S 1EE9A 3FF1A 3ENQA 1URPA 2QR5A 1NPYA 3PNMA 1V8ZA 4UUGA 1XTUA 2C31A 5JTTA 5JY1A 1H4VB 1DKLA 2O2JA 4U02A 4R8UA 3SKXA 3TLKA 5DGXA 3G9XA 1Z18A 1ZGZA 1V2HE 1SVKA 2D2EA 3HSSA 2W4QA 3SC6A 4UMDA 4FQ5A 3RVMA 3OQ1A 5ITZA 1YCFA 3PVCA 4JJ6A 2UUAH 3TZLA 3HDJA 7GPBA 1Y4SA 2C29D 1ULTA 4QGGA 1G98A 1XNRB 1WXFA 2APJA 1BKDR 5AJXA 4AQDA 1NX6A 4TZ6A 4QO7A 2NV0A 1N2GA 4XDYA 3V4VB 3NYRA 1EB9A 1OE0A 3AWIA 3EIQA 4C0AC 3LA8A 4UD2A 2OPHA 2M9MA 2ALZA 3NGLA 3ZV7A 2BDUA 3FWHA 2I66A 4X7PA 3R6LA 3BVPA 4XSGA 4TMFA 3ZE8A 2PRJA 4GXNA 4FYPA 4K9QA 2YWJA 4R98A 2WYHA 3ZBQA 3A9WA 3AR8A 5EDWA 3K9WA 2Z6QA 4MP8A 4KDEA 4E15A 3VMMA 4LE1A 4PY2A 3BOSA 5EWMA 1EFRD 5BR8H 1PR6A 4ZALA 4QBHA 2ZYRA 2WP0A 3DE4X 4ARVA 4I50B 3HOWG 4CIXA 3WGIA 2QLFA 2H2WA 2OXEA 4G4GA 4MYSA 1EMDA 1EZ4A 4OFWA 1O08A 2ICAA 1E8NA 3GJXB 4DQKA 2OLJA 3PHBE 1IVYA 4ID9A 3GQBA 4RDHA 4JT2A 2IZ1A 1DZ3A 1JG4A 3D7LA 2XLBA 1Z29A 2AG6A 4EGJA 3ESRA 1QG6A 5DLYA 2ILVA 4YRDA 3M6MD 2IMWP 3BQ9A 4DKXA 2HPZA 3VTFA 4TSRA 4B6RA 4C6HA 2QN2A 1W8IA 3U6BA 1P2TA 3HUTA 4A3GG 2JD2A 2AMVA 1XMQB 2ZRFA 1R37A 4Z9FA 3IERA 6LDHA 1V71A 5F78A 4CR8A 4EX7A 4DWJA 4M7WA 5JSZB 5D1OB 5EE3A 3PDIA 5DV9A 3VNSA 3EPHA 2CWDA 1NBMA 2PYIA 5PNTA 4WTOA 2ZRBA 4G26A 4JV0A 2O3TA 3DYBA 1ZCBA 2H1SA 1ZR2A 2DPGA 4Y6OA 2J3MA 4CMKA 4OOFA 1MOSA 4MA0A 1CJCA 2V7WA 2Z43A 3L9XA 4TRNA 1JPNA 1UXGA 1UJCA 1E5XA 1P2SA 5IHXA 4YONB 1Q92A 4FNGA 1OYOA 1L3CA 4MPDA 4Q4LA 1KH1A 3EAFA 3ZYZA 1E32A 4EFMA 3CUTA 4BE7B 2W6JA 2R7AA 3DE2X 5JCZA 3ADKA 5HP4A 3DZDA 4D02A 2DY0A 2W00A 2PS0A 3VH2A 1NVMB 1D2HA 1LSSA 3RS4A 4DC1A 1MVNA 4TYYA 3FJ1A 2YZMA 1YL6A 2ECQA 2HK7A 4B75A 2FMKA 1MFPA 2J7KA 3G3EA 3NPAA 2X0NA 4EO9A 2QLJA 5EQJB 3KJXA 1LVHA 1CJMA 3X1YA 1T2NA 4LHZA 1AV6A 1Y1RA 4BKPA 1M1ZA 4R2LA 1ZI8A 1CC1S 3PW7A 2Y6UA 3PD0A 1P6QA 1I0ZA 1CBUA 2MYUA 2V97A 3GT7A 5LQNA 2Y1DA 5TEWA 3BK7A 3DNMA 1H65A 5F98A 3AF3A 2C4MA 3L6CA 2AH5A 2DMRA 4QVGA 4UPVA 2C22A 2AR7A 3N2GB 4OBXA 1QPBA 4BN0A 2ASEA 4OUDA 2GF0A 2HUNA 3LPAA 3BT7A 2ZJYA 5KFEA 2VK1A 1C3VA 4DCJA 3H05A 2JIZA 4C0HA 2QW0X 1ZWLA 3I8XA 3G2IA 1I10A 1J99A 4LSMA 5IP7G 2TYSB 5JMOA 1BHQ1 3WYDA 1VCNA 3GWZA 5BV7A 1P7ZA 3WMWA 1E1QA 1UBHS 2YHBA 3AY0A 1Z12A 2H6EA 3ZCXA 1N33B 1JAIA 4A0QA 4G1UC 3B6ZA 5BSKA 3AK4A 1IBKB 3O2SB 1KEZA 3PYMA 3T3GA 2H5IA 1DC4A 2WT4A 1U4SA 3TKLA 1LW6E 2ZLBA 3VU0A 2V9ZA 3SBDA 3WLLA 1T9KA 1BXRB 2BTQA 1RKBA 4ZCLA 4KLCA 1Y4ZA 4RAQA 3S81A 5DNCA 1X77A 4EHHA 2H0RA 4UREA 4GLXA 3AF4A 1LLDA 1HDXA 2INGX 4KC0A 2OB2A 4Q6BA 2QAIA 4O33A 2I2WA 2ORWA 3ZHRA 4G4SP 4X8MA 2H1WA 2OGWA 2EJ2A 1TUEA 1CRPA 1RP1A 3ET5A 1EFPA 2SICE 4Q1FA 2IU0A 4DTIA 4EB6A 5ENVA 4GR5A 1VPTA 4L0QA 3JU3A 4ZVUA 5HE9A 4CMBA 3UXHA 1FP7A 2E4ZA 3MMXA 4L51A 1U9YA 2ZKLA 3R6WA 3E8SA 1BU5A 1BW9A 4N7BA 4RCZA 2I6TA 2XEXA 4ODIA 3BQ0A 2E21A 4QG3A 1Y89A 1ZCFA 4NBTA 2QSUA 3FLMA 1HDCA 3MJVA 4Z7JA 3K71B 3E58A 2QR2A 1F7UA 4GL2A 1GN9A 1GCAA 1RIIA 4ZVVA 3AEQA 2NXJA 4KXLA 1ZWKA 4FT2A 9LDBA 5AVRA 4D8WA 3DFMA 2W6ZA 1LSOA 4F71A 2HEGA 3GT0A 2Q45A 4GQBA 2VBGA 1RWQA 2PQ6A 3IUPA 2R8RA 1W4BA 4L5IA 1QFJA 3QVTA 3ZW9A 4K9RA 3F67A 1FQKA 3A6ZA 4UJ5A 3N6XA 4P4GA 1B4DA 3E1GA 1AUOA 5ICCA 1M2GA 1WUIS 3QOXA 1V3VA 1WXXA 3K0CA 5A0TA 1F2VA 4IEIA 1UK7A 4L8LA 2DUNA 1OBFO 3ENZA 1NQAO 4KAAA 2HT1A 221PA 5BWRA 3T9BA 1RI4A 3LWBA 2QTCA 1INLA 1AC5A 2WKQA 3QLVC 2ZTHA 3V80A 5B7GA 1U8YA 5H16A 2CYCA 1TC2A 4DR2H 5GJVC 2OBYA 5M29A 3WADA 5IJXA 2X2EA 1R0XA 2ZI6A 1WPGA 4RSRA 4WJKB 5BN1A 2QL9A 2OV2A 4LTDA 4QPZA 2OILA 4YWJA 4LX8A 1A4RA 3MR3A 1PHRA 3KTOA 1FU7A 2VRCD 4HCJA 1HNXB 4JV1A 1L5LA 2VJMB 3RB0A 2PGJA 1PFWA 4I3GA 5ALVA 3GZTB 2D1TA 4C2TA 2ZAIA 5JUMA 4OYYA 4F3KA 3PVSA 2NSDA 1P74A 3QKIA 1Z5WA 1T2EA 4GMHA 3O3CA 5B57C 1TRHA 1TJPB 1PL0A 3R0VA 1DTSA 4FOSA 1KK1A 1M8KA 1QU2A 2CKDA 1HZZA 3AQIA 1WW8A 3ABSB 1D0IA 1KMMA 4LF6B 1DAHA 5TQ0B 5I7FA 4FLFA 1R0CA 4XI9A 1LX6A 4GKBA 3M1YA 3D3KA 1IZYA 3IXMA 2I7XA 3WK5A 5E7IA 2J4CA 4KQCA 3GYBA 3QF7A 4UCOA 3DOFA 3W90A 4MAFA 2PZJA 2PRSA 4DMGA 1UPCA 1B76A 5CH8A 2E1RA 3QZ7A 3LBFA 4NBUA 3HWSA 3ZYCA 1MF7A 5EUBA 4U7WA 1GKKA 2XGGA 2QJOA 3IT1A 1SNYA 1KJ8A 1XD8A 1SB9A 4HQ6A 3IP1A 2C7QA 5D6OA 3RVKA 3ABRB 2XWPA 4WHXA 2W48A 5HJ7A 4MB2A 2ZUVA 3FTFA 1JYFA 3EG9B 4TRMA 4HOYA 4YRSA 3LHIA 4DR5H 4YCMA 5TNXA 2GAAA 1XVTA 2A5JA 4MW1A 1TT7A 3KEGA 2BZ0A 2PSSA 5AQEA 1RYHA 2ZGVA 4JKIA 1YBAA 3DNPA 5IPFA 3LHSA 1R4ZA 2AC7A 2A9VA 4MUGA 2GYUA 4OXIA 5B12A 3MWKA 4LV8B 4GYYA 4A93G 2ZCVA 3TTUA 1VC2A 1PWYE 4D9NA 5AKLA 3FFTA 3TZQA 4DAOA 1NE7A 2CSUA 2G0TA 1L6RA 1QNFA 4YJHB 4NTZA 4WXRA 3T7DA 2HMAA 1ZX1A 4EOGA 4DQUA 3W5UA 2VSXA 5NLLA 4Y18A 1NM5A 1MX1A 3EXG1 3QU9A 3NX4A 5HXAA 5JAMA 2MMGA 1LV7A 5BUQA 3SZOA 3MCWA 1BN7A 3DZFA 3E53A 4GPZA 1NNLA 1X9GA 3ZDBA 4A3BG 5CFPA 2GNAA 2AHRA 2IJGX 4PZLA 4PONA 1GAXA 3LUKA 3P0JA 2Q0SA 2A3RA 1HSZA 4A8HA 2A33A 2IPAB 4EY3A 4AM8A 2FN8A 2NO1A 3U61B 3P4UA 4RHEA 1XB2A 1Z0DA 1LBEA 4BX0A 5GM2A 4CM1A 5DPMA 3QVKA 4HUJA 4H7KA 1GVNB 4ZVTA 2UYGA 3PNPA 4O3SA 1UIMA 2AXQA 1D04A 1N3YA 4MTDA 2ZUCA 4C6TA 3ZJTA 2NTNA 1L4BA 3EOBI 3OCWA 4ZVRA 5K0CA 1OZ0A 4TTJA 4Z86A 1SEPA 4LXXA 5GADl 3FYDA 2XSZD 3ZVNA 4V24A 3VSCA 1ADYA 3O8NA 1XNGA 2B7BA 1RZRD 3INYA 1N1DA 4OYLA 3DT6A 3AUTA 1H8ED 1HR0H 4MVJF 2FMIA 3ROTA 2XJ9A 3FCEA 5CB4B 4NXMH 1DO8A 1FRNA 2ATXA 5D3QA 5MDHA 4Y2XA 4MSUA 5HIJA 5AHXA 1J21A 4TLLB 4ECRA 1RBZA 3ND9A 5KT4A 2WHQA 5IYZB 2E5LB 3ZTTA 3NTLA 4NV0A 1T3NA 3P9XA 1JG1A 2KMLA 4IW3B 4RIFA 1TVMA 1FTNA 1O77A 4K87A 1P5FA 1UP6A 1M5UA 4MQ5A 1KOLA 5AOVA 3C3CA 1KAMA 4YGXB 2W93A 3H9EO 3T94A 3CZ9A 3EQZA 2AWNA 4Y9TA 5DFAA 4OP3A 1HORA 5EPOA 1MJGA 5KFTA 3KNZA 5DCYA 3FRJA 4QQKA 4Q3DA 5GWXA 4JI8B 2JS7A 2RHHA 1Z4PX 4AKSA 1EFTA 1IHXA 4IZ6A 5BWVA 1ZD4A 2G1AA 3PE4A 1WZIA 4DGQA 1OC2A 5HKOA 1QOQB 2HF8A 3VNQA 2YX1A 4FFWA 1XV5A 3PQCA 4JP2A 1GNTA 3LOPA 1JEOA 1YCHA 5A4KA 5EJAA 3GTOA 4QDKA 5CX4A 3PC8C 3WRXC 4IIYA 2QWXA 1QH1A 5ALPA 2R8EA 3N3AC 2CEAA 4HB0A 3NG1A 2BCGY 3MAJA 1K7XB 4F2DA 4S1OA 2D59A 3B6EA 3I32A 4X8LA 1L5OA 1SXJC 2YW2A 3SDBA 3A25A 1C0KA 1SIWA 2DEUA 2MINA 4Q1DA 3VKHA 1KAOA 1PGOA 2FNAA 2OO7A 4HRXA 1R4MB 4J90A 4MVJP 4QOSA 4ER0A 2C9BA 3DQZA 1PBNA 4EKDA 2AFHB 3F2VA 3RC9A 3DLIA 4I4TA 3IVMA 2UXBH 4H17A 2BW0A 2ZSKA 3M0EA 4EB0A 2I62A 3H5AA 4Q1EA 2QTFA 4FFBA 5BQ3A 4GFDA 4CNQA 3WGJA 5LVAA 4A15A 4DLWA 3PCRB 5P8WA 4GS5A 5L7YA 3HDQA 3W1WA 3VYTB 4R05A 1RLTA 3N76A 1SC1A 2X8AA 4AZVA 2IS6A 2Y2VA 4KWCA 4QL3A 2HZ7A 2A9PA 3GGGA 1E1YA 4I1SA 1PSZA 4OU4A 1PT5A 5JQGA 4NENB 1U0SY 1JWAB 1DIOB 2W2VA 5ALJA 4R2IA 5ETJA 3RABA 5L7TA 3RC8A 4LWQA 5FR9A 1XJWA 1U7WA 3IS3A 2EJBA 3I5UA 1ONNA 3ELWA 5FORA 2BMJA 1YQGA 5LU8A 5KJEA 1W34A 1R9NA 4YQEA 4MWGA 1U1DA 1L5YA 1XTQA 3KPWA 1PK8A 5HZKA 1RABA 1RXSA 2GESA 2F1KA 4KDFA 1GILA 5KTOA 1ZO8A 1A4XA 3H1PA 3NTQA 4JBLA 1MTZA 3G85A 1NW8A 2C7GA 4XIGS 5CMLA 2O1WA 1MGPA 1TK2A 3V8BA 4J0QA 1CVLA 1SBIA 1VE6A 2XMQA 4MUMA 1XTSA 1FX0A 5TEVA 1FQOA 3SVLA 3CE6A 3RUIA 3ADBA 5L1JA 2NSJA 2C9ZA 2Y1OA 5D3MB 4PG6A 4B2YA 5HBRB 3C3BA 4RY8A 3FPSA 4HD8A 1UCFA 5FQOA 3IEIA 3KQNA 5SY6A 5IT0A 4HLUA 1IXRC 1V3QE 5FAXA 1QCZA 5J1SB 1JDJA 2F9FA 3B7WA 5DTIA 4M8IA 2DQYA 3X44A 1SZDA 3M9NB 2IU3A 4J0GA 1WCIB 3LC7O 4NBRA 2FR8C 3IODA 3AF2A 4RZ2A 4G65A 4LDAA 2QTMA 2ZZNA 2CDNA 2AN5A 4F72A 4N1AA 4WCVA 1D5CA 1IK6A 1WP4A 1RMTA 3ER6A 1NLZA 2FZLA 1GPNA 2RGYA 2OCYC 2KBEA 1EU1A 1PL8A 1UM9B 3UFBA 5BSMA 1Z2EA 4JELA 3BDVA 1CERA 3MR2A 4O2RA 3DDSA 5G0UA 2GJAA 2Z5FA 2OV4A 4QYSA 1K3FA 2G9NA 4DADA 3OPYI 2DBZA 4C5BA 2OFFA 3WBFA 3Q5GA 3FJOA 1Y3IA 5IBCA 5JAZA 2IP4A 4L6IA 1VGRA 4M9XA 5L1IA 4PZ9A 3K9CA 1QZXA 3E3LA 4WECA 1L5HB 2A1HA 4ZZ1A 2WF6A 3ORQA 2EL9A 3CSUA 1U9ZA 4G84A 2Z8YA 1EWRA 2YS6A 2Q46A 5HNEA 3QPAA 2IP2A 3K05A 4JBIA 4NDZA 4RFSA 4MCJA 3WK7A 2W9CB 2L18A 2HY7A 3BWDD 1O0SA 1HY3A 1NW3A 1WW3A 2TSYB 5HHTA 5BWLA 4KP7A 1LPMA 4JOBA 3QU4A 4IUCS 4UXJA 4QNRA 3IB3A 1NGSA 2Q6LA 4YR0A 4ZYTA 1JKFA 2QJRA 5SYNA 3NTXA 2FJPA 2J7PD 3DSRA 3MIIA 1EHCA 3MCVA 2EGGA 2F48A 2AF3C 4C30A 3SS8A 2I4IA 2G9UA 1U8EA 4TKUA 4JP5A 4LZNA 1G7SA 2PZBA 5MGNA 3F97A 1L7PA 1DDIA 4RA6B 3ZI7A 3QEOA 3UOGA 3JQAD 4EYIB 2BDTA 1ZGJA 3F3SA 4C4PA 4BWSC 3EX7C 3BZUA 3HABA 4ZRDA 2OC4A 2X22A 4UJ3A 3KL2A 1SURA 3ZGVA 4MWSA 1H93A 4DS3A 4WNCA 4IUDS 1YFJA 1ULSA 3MJHA 1M2OB 5ES3A 5B6PA 3LUFA 4ZHQF 1CUHA 1HUQA 1JI3A 1DZIA 3Q40A 4F9GA 2ZRCA 4TM8A 1II8B 4YAKA 1YKGA 1SGWA 4YRLA 3R9KA 1YJQA 5GM1A 3TJRA 5KOYA 3H65A 5A9SA 4NAVA 2BVNA 3U7EB 4DDKA 2WQ6A 4IR7A 3EMBA 2QVXX 1I7SB 1YQUA 2WB1E 1ZM7A 1UWKA 4WOKA 2VF2A 1V43A 2BZGA 4N5MA 4EIWA 1G8YA 4DIBA 2V5UA 2BEWB 5K3SA 4AUMA 2HA5A 4R9NA 1VBMA 3LECA 3U40A 5DSZA 2NU9B 4B85A 5IT9W 3UOAB 1XRRA 5LN1A 3O4JA 4BXOB 1E2FA 2ZPAA 1QF7A 4B3DA 4UKDA 3I2KA 1JB9A 2FQXA 4KE7A 2Q99A 1P0CA 3AL0C 1HPLA 4IUBS 1E5VA 3L8CA 3PV0A 5LZ8A 5EWFA 3RV4A 3ZGOA 4X1KB 2ACEA 3PXAA 5FI5A 1A76A 1SCUB 3D3QA 1NMEA 4RDCA 4UMFA 3HNOA 3KE9A 1ZP6A 5HK9A 3BMNB 5JSQA 3I5XA 1U8XX 1KJJA 3O92A 1KI9A 1G21E 4OATA 5LNK6 4IR9A 4AS3A 4V2IA 2WDTA 2CLOB 3SNOA 1NURA 5BWBA 1EX9A 3TE7A 1NV8A 1UMDA 1MA0A 1KO8A 2L19A 2QAJA 2DKNA 4PIVA 2UZ0A 4C0QC 5HJ5A 2PG3A 2V1XA 5KTSA 3ZU5A 2LZ0A 5F33A 4OX9H 4QX6A 3ROEA 1D3AA 1KHTA 4NHOA 3AO0B 3C70A 1U8UA 2P9HA 3VRHA 1XQ1A 3RJMA 3COJA 5LA6A 2AV6A 3KT0A 4ESHA 1DCMA 1NVAA 4M7OA 2NV6A 3OP4A 3ZCUA 4XDGA 5K6AA 2JIPA 3TW8A 2I3DA 3BB1A 5JR3A 1NXPA 1O3YA 1VZ2A 3U7RA 4X97A 5E3IA 1BX1A 3RFFA 2XYGA 2WY2D 1M67A 1SIBE 2M6LA 1G2OA 4E5DA 2JLYA 1RVV1 5BW5A 5EEGA 1KDZA 4DRYA 3QEKA 3B12A 2J41A 2Q4OA 3NH6A 2FWRA 1F3OA 3F8SA 3QVXA 2O2XA 3GJ6A 4YLEA 1VKJA 3MC1A 4PLFA 4KVZA 2Q7OE 2OO5C 3A1NA 3SZGA 3IUYA 3K2IA 4D3ZA 3PEYA 2CZQA 1T6YA 4YPFA 5KVCA 5BP7A 4G36A 1QRDA 1ECGA 5CH5A 4JAVC 3BA1A 2P9QA 4QPCA 1H0RA 3UMGA 1SCQA 1T8PA 1BOOA 3EZ2A 2ZW9A 1THGA 3L6BA 1Q15A 2XOKD 4Q0MA 3KSDO 1W36C 3ANSA 3NQ41 4FUQA 4EA9A 1P1FA 4Y2GA 5FPOA 3V4OA 4DF3A 3VUFA 1E3JA 1T3SA 4IIEA 4U2CA 3DWGA 4MQEB 3HOYG 2C8KA 4XR9A 5KG6A 1ZVMA 1ICEA 4J9NA 1HFKA 2IZ5A 3GPCA 4D4JA 3OX4A 3KUKA 1F1JA 2QX6A 3CPHA 1P2BA 3I30X 1KSJA 1ZGAA 2PH7A 4MWCA 1S4QA 5M2QA 1LGYA 3N8NA 4G5SA 5J40A 4O4HF 1I80A 1E7RA 4Q93A 4B3GA 1CZNA 2GCIA 4JQSA 3PGJA 3HRIA 1VE1A 5CG1A 5KFIA 1GT6A 1DP4A 5I9BA 5IT5A 5JU6A 2QTHA 2QX4A 4YUVA 2R6JA 3T3OA 1H9AA 5CVCA 4BKQA 3UJ8A 4XYMA 4ZVQA 1KY4A 1QGDA 2PO5A 1V4NA 3WYEA 4YT8A 2RGBA 1QCDA 2WTMA 4HWSA 3AHHA 5GOTA 4I9HA 3GTPA 2VF7A 4QHSA 5KOHA 1PSWA 3OJEA 4C0XA 2VUUA 3DQQA 1FSFA 1W59A 3VR2A 4Q6WA 5EWJB 2CZCA 1JMVA 2R92A 4QBFA 2UXDB 4LYEA 4DBZA 3EPJA 3UKJA 1WTAA 5L3ZA 5I45A 1DE0A 1ENYA 5DBHX 3U0VA 3HBNA 4INOA 4LNHA 5CP8A 4QLBA 3DKVA 1CVRA 2VZ8A 1QDEA 2FQ1A 4BV9A 3T9DA 4Y6QA 2VYCA 4JI6B 4B3SB 3F49S 3S5JA 4ZRMA 4LZJA 2RIRA 5KT3A 3IX7A 5JZSA 3U16A 1XJ0A 3Q5DA 1NY6A 1W73A 2HVRA 4I1OA 2UUCB 1SXJB 4AJKA 1ZHQA 3NMUF 2RBKA 1I3NA 1KK0A 1E9BA 1MTOA 3RS7A 2ZEJA 4EFKA 4RE5A 4F11A 4AKGA 2VJDA 4LYDA 3U3OA 1CUUA 4YDHB 2KPOA 1EE1A 3AKZA 4PAOA 3QJ5A 1BWQA 5ELXA 4TXMA 2BEUA 1CP2A 4IDOA 4OK6A 3C2QA 1RRPA 1IWOA 5B30A 4HGRA 4POAA 3SMVA 4BVFA 3VVBA 5JNVA 1WCYA 3VNUA 1JAHA 5CGQB 2BKUA 2FP4A 1NN3A 4AIRA 1B04A 5EJEA 1GPBA 2DERA 3PJRA 4TSFA 4D5GA 5IJ0B 2HCRA 3RHFA 5HOQA 3RF2A 3U3RA 3RM3A 1YZ3A 2BMEA 1C4KA 4R7GA 2HOQA 2X42A 3EA0A 1CUBA 3NHWA 4EYEA 2WYWA 1T0UA 4NYIR 3MWFA 4XFKA 1DPFA 3JPWA 3RTBA 5FO1A 1JH8A 2B21A 2O7VA 4I5EA 3BERA 3FSGA 9LDTA 4K3VA 1MLDA 5H0IA 4PCAA 4AQYB 4G3IA 1VKNA 5K8JB 4H7PA 1BJKA 5FR2A 3WP1B 4KXYA 4UHKA 3IB6A 2R8OA 5IFKA 5FTKA 4G0YA 4D4HA 3OPYA 5CLQA 1DBPA 4JWKA 2HF7A 2W7OA 5B3JA 4CM7A 3GA5A 2P9FA 3KHTA 1L6IA 5D86A 2MIIA 4FCCA 5KFKA 3GELA 1VYUA 2CHVA 2W8ZA 3I1YA 2WWHA 1Z3IX 5BY2A 1D2EA 2Q2UA 2GKGA 1V8BA 5IKPA 1Y6FA 2ZETA 2O3SA 1SWVA 2H1IA 4HNAB 2JG3A 5EIEA 1VBFA 3WWZA 5GOZA 1Y8QB 3CWCA 3SIRA 3OLZA 3HL4A 1V5WA 3Q3GE 1BSVA 3FCAA 2W42A 3D4OA 4J1QA 3CLVA 4MV4A 3CTMA 1WPQA 4ZEOA 5JPCA 5FOTA 2EZ9A 4BMCA 1CCWA 2NVUB 5A4DA 4EM6A 4EUHA 3IEXA 1XMPA 3JQQA 3V6LA 3JWGA 1XXLA 2P1ZA 2AMFA 1B43A 1IEWA 1C9YA 3J81W 4V3BA 3KTMA 1W44A 3M49A 4XE5A 5EYPA 1M6WA 1N7JA 5AYVA 3QJYA 2HHHH 1ZJZA 1RE0A 4OREX 1TEZA 5DU2A 2OB1A 2Q5QA 2XIGA 1V7ZA 2H63A 4RSHA 4DUGD 3ANYB 2J6BA 2ZIVB 1FSZA 3KJIA 5THXA 5KYWA 3JR7A 2QYHA 1G8PA 1COWD 4I9NA 2H2FA 3AJEA 1ZSNA 2GEJA 4UBMA 2VRBA 3KETA 1AS3A 1RQ2A 4EO4A 3B6KA 4RLQA 1XMIA 3ZWOA 4FEGA 2OZEA 2ZYSA 1Z82A 1QYVA 4WJZA 3ICCA 4LXTA 1S89A 3JQBA 5IK2D 3TB6A 4UU0A 3GA7A 2X41A 1JP7A 3R75A 4JJZA 3LT0A 4BFTA 2GKSA 4G1VA 4DY4A 1HDRA 3THXB 3O8BA 3SSAA 3NU1A 3OU2A 1JW9B 3MD9A 4DV7B 2PA0A 1EBUA 3ENKA 1R6TA 1PFUA 3AOGA 1HE3A 4FW9A 5J23A 2HM7A 3PQ8A 5A7GA 4PHTA 2EKQA 1WUTA 2V03A 2R85A 4WH0A 3SM3A 9ATCA 3OBBA 1CIJA 1F4LA 1KXJA 3U48A 1EFAA 2ADFA 3VR6D 1CXZA 3QPCA 3A2KA 4PAGA 3L1VA 3JVDA 3U4HA 3CRNA 4WX2B 4OH1A 3D8RA 4RK5A 4A3KG 4LI0A 5I7OA 1EJBA 2QW8A 4WSOA 2QR3A 4MWZA 3EB9A 1WABA 4D46A 4TYNA 3EQ2A 5FUXA 1H6BA 5DGBA 2BZSA 2WTXA 4DA9A 2JGEA 1ZH0A 4MRRA 5BORA 2G8NA 4ITRC 4ZK6A 1R5JA 2FU5C 1MA3A 2IC5A 2G0NA 4OHPA 1JHMA 1J2JA 2Z6AA 4FFLA 1IYDA 1QU3A 4LN1A 2JA6A 3AEUA 1SC3A 1SUPA 3GLQA 2QUBA 3UG7A 5G3ZA 5AJTA 3FKSD 2JAPA 3EGVA 3U4CA 4LRYA 1K6EA 1MQ9A 4UAUA 1QAQA 2DULA 5JYBA 1Z4KA 2CVQA 3DMTC 3N0TA 2H3HA 1G5PA 3CVZA 4BP3A 4DC9A 3L5OA 1GFIA 3OWOA 1AV7A 4JXXA 3NUAA 1LC3A 1PT9A 2Y8EA 1HOTA 5TR9A 2VHZA 3M9XA 1WSCA 1FB5A 3DOIA 2GT1A 3U1TA 2Q9CA 4L4YA 1I32A 4DUYB 1AGXA 5HWSA 3FUWA 3PHHA 4IILA 2W4MA 1LSJA 2WYUA 1KRWA 3PR4A 1TLTA 1X7YA 4IKOA 4GX0A 2R1TB 3PC4A 3MT0A 2RI0A 3NVKI 1EJ6A 3H9GA 4NMWA 4R2JA 1E7YA 1RAGA 5CG2A 4MTEA 3G9ZA 4PSKA 3ZHCA 1QIGA 1TUIA 3TQOA 4C0SA 1BOFA 4NVRA 3C1AA 3OQOA 2GBCA 2XMZA 1PD1A 3CWZA 3LLUA 5I5YA 1JBKA 1W5TA 2OA0A 2ECPA 3WLTA 4EPYA 1QGED 1TLFA 4CLOB 1YHZA 2JHFA 5KFGA 3KQOA 4XD7D 4EQ6B 4OUKX 4YPOA 1Z63A 4HYEA 5AICA 3LP6A 4ESVA 1TC1A 2NU6A 3H3FA 1G7CA 5BN5A 2WRZA 4GAEA 4XWWA 2PUVA 3GCZA 3BMQB 4UOQA 4KZKA 4E7PA 5BWWA 5ALGA 4MRPA 2FLLA 1LVGA 1E2MA 2EFJA 4G8CA 1NNI1 3WIEA 5EJ4A 3K0FB 3UMBA 3WQRA 2B63A 2Z1NA 5FEUA 4G1EB 3R0QA 1KI2A 2V7QD 1LI7A 1N6KA 1YOVA 2WAAA 3FRIA 2YJZA 2RAPA 1TMGE 1ZH8A 1P0MA 1B8VA 2AJ8A 2AD5A 5EKTA 4EHJA 5DNYB 4LNAA 2H54A 1AIPA 5IF3A 3K94A 2UUBB 3RT1A 4MUAA 1UFKA 2H8GA 2KSWA 4OH7A 1PS8A 3CSWA 4CKZA 3EOAI 4E5MA 1HC7A 4AL4A 3QX9A 1JQ5A 4UAVA 1CLUA 3LPDA 2ECKA 5G2OA 2EDAA 2F8LA 2BH9A 1IFXA 3CX7A 2GAIA 4CLEA 4QWWA 4EABA 1KSGA 5C80A 4KMMA 4RVHA 4S1VA 3AW9A 2OT3B 5JC8A 1RNLA 2NMVA 5J5VA 1RIFA 4HX5A 3W6NA 4G8DA 5DHPA 3WYNA 2WMOB 1W36B 3U17A 1MP0A 1A5ZA 1RJ9B 4UUBA 4XEHA 4MAAA 4L9SA 1YRQA 4M0EA 1I3CA 2JRCA 4EL5A 4CIBA 4X3OA 3GVCA 3SI7A 2WWYA 2GWHA 1BYUA 1C3OB 2R8IA 2ZJBA 1IULA 1GT91 4N76A 1DWUA 2JKVA 2OFXA 3CJRA 1T0BA 5EZYA 4TTVA 1EK2A 1DQPA 3WGYA 2B9EA 2QQ0A 3PI6A 1WDKA 2RHBA 1Q2XA 5KTTA 1IJBA 4ARZA 4JQCA 3ZNQA 2Q29A 3C6MA 2Q1YA 4EJ0A 4LF7H 3B38A 3O94A 4L4RA 4BBRG 3ZHTA 4ECWA 4PFKA 3UH1A 3ED5A 1E62A 3SBEA 1GSIA 13PKA 1PGQA 1HEUA 3V46A 4H35A 2R6ZA 3T7CA 4C6RA 3CVJA 1XZMA 2V5VA 2VNJA 2W2MA 4X71A 2O0HA 3V7FA 3ASVA 3U7QA 5AW9A 1U5BB 5CH3A 2CDBA 3HXLA 1MOQA 5F9HA 3N8GA 3O1JC 2IS2A 4JYZA 3HU5A 4EEYA 4C06A 1OLSA 1H1LB 3LF2A 4WD3A 3ISTA 5A7HA 3BORA 3IUEA 4JYAH 1Z9BA 5AM4A 2RKBA 3RBDA 2FRXA 3ENVA 3FMIA 3NBYC 4OGFA 2EJTA 4B44A 2VQ6A 4PHCA 1MX3A 3F47A 4UPEA 2C3UA 3QVMA 4F06A 4U5QA 1YB1A 4M99A 4IJUA 2FSGA 2FQWA 1GZ5A 5TQJA 4OFXA 1ZZEA 1THZA 2Z08A 1DEHA 3RARA 3LRPA 1XXHB 4M0DA 1DAPA 1WEHA 3QFSA 5BW4A 4EBCA 4FSDA 4BN4A 1PFYA 5K4HA 4M22A 1ZITA 1UXHA 2VH5R 3HU2A 4YAJB 5L9AA 5DYIA 1ESDA 5LC1A 2ISQA 1A8IA 3WA7A 3EGDB 4BDTA 4YV0A 1NP3A 1OU4A 1NI5A 5G1OA 4UUQA 4MP6A 3SBXA 4ZU3A 4H60A 1WLSA 1MOPA 1UDCA 3SJZA 3KSRA 4XDZA 2P6UA 2Q6TA 2R4TA 1JXMA 4DXDA 3D5QA 1NE2A 3ESCA 4IIVA 5KHAA 3F96A 1E3WB 4DRFA 4BNWA 1F6BA 4XSVA 3FJYA 1YB6A 1SY7A 1BVUA 3NHRA 1RYFA 4J9MA 1SVIA 2XXAB 1Y7HA 1KIMA 3R7SA 3RB8A 1X42A 4YP7A 1R0ZA 4E30A 2RSLA 3LOQA 5IASA 1DBSA 1TZ2A 3LX5A 4B43A 1FLAA 1U63A 2J85A 3EGIA 2JLUA 5E4FA 4KPYA 1ICIA 2BFEA 2FOXA 1TD1A 3MF4A 1AU9A 3H6HA 2WSIA 1H2WA 3M6XA 3R7WA 1PR5A 2QUAA 1U0TA 1UPTA 3JZDA 4NZPA 3U09A 3GEDA 4H2DA 2KE5A 3L4KA 5EKDA 2P67A 3TSCA 4QGAA 2QQEA 1JA9A 2Y1GA 3PLAE 2OBLA 2V6IA 3WFZA 2Y4NA 3E9NA 1ISJA 5EOVA 2PX6A 3FKIA 4O4JA 5KYYB 3PW2A 2OD2A 1X80B 3GMIA 1A7KA 5G0VA 3E3OA 2J31A 2YFKA 1SKAA 1QTQA 4DREA 4J75A 2PCJA 5AHKA 1OLOA 5JZBA 4IY1A 2WJ4A 2VCEA 2FH5B 2R6FA 2M6KA 3AVWA 3KG2A 3WB1A 1SU7A 3A4MA 1KQFA 3SSNA 4CTKA 1R12A 2RGGA 2VRNA 1HKHA 5FBLB 1B0ZA 1L7QA 4KI7A 2IYFA 2QX8A 2XEDA 3A2NA 1QANA 4HADA 3KKMA 1YJBA 5DEOA 4R1PA 3FCSB 1FDSA 4CLDA 2JA8G 3OE7A 3W3AD 3FHOA 4GX5A 3A1TA 3DAGA 2P2DA 4MP3A 3HGMA 4PR3A 4QWCA 5I7RA 2NQ2C 4FK8A 1KI4A 2A9JA 1HNWH 3FDFA 1MAAA 1U90A 3W79A 4QULA 3GJ5A 4Y8VB 1I1QB 1VAJA 3DBRA 4NNOA 2DHQA 1YVEI 4WUVA 4RHTA 2UZ4A 1ZJYA 3OUTA 1Z4JA 1QOPB 1ECJA 2YVLA 1GRNA 4NCNA 4BNGA 3JR3A 3TPFA 1IHUA 2FLNA 2WVAA 3MW8A 2VCHA 4IMPA 2GTIA 3NUQA 2R7KA 4R6WA 5JATA 2GASA 2PRIA 3GJYA 3G6VA 3P0IA 2YR0A 3T61A 1VJ0A 1PI3A 5IJWA 4YRGA 5EXEA 3ZY4A 5MGBA 4WKNA 4HC4A 4ZOLF 1F5SA 4UTRA 2CHUA 3QXGA 5A1JA 5KTYA 3H97A 4Q1BA 3H4MA 2J9FA 5F35A 4MJXA 1MAWA 4LMRA 5THKA 3DP9A 2ABWA 4TWIA 2BP7A 4Z2AA 3O1LA 2B92A 4REOA 3TJZA 2JHGA 2UYQA 1G21A 3HKEB 3M6AA 4YECA 1UBJS 3BSSA 3MWLA 1KNQA 1QLJA 4KXQA 3W2EA 2X6RA 3KZ1E 1MB3A 5HCIA 1WJGA 3SFTA 2WKWA 3MWYW 1F5NA 2P2SA 2HH9A 3BMOA 2PMEA 4MEBA 1R50A 3HKBA 5EJIA 4TUYF 4HL6A 5DSTA 5TQVA 3KJZA 3MAGA 1U3GA 4RZXA 2VDNB 1Y6RA 1XVLA 1VMIA 3OJLA 4EG6A 4LRSB 2ZRDA 5DW0A 1EINA 1IONA 2BGNA 4I3FA 4NZZA 4IYRA 1VPWA 1F06A 1ZH6A 3B1KA 2I3BA 2Y99A 1DX6A 3IA7A 4Q12A 5F51A 2I1VB 1SD1A 1HMPA 2XECA 3DBHB 4ILEA 5KQGA 1BWPA 2WIKA 4X64B 1EUYA 2M05A 4F3CA 2HHAA 4F92B 1YO6A 1YGPA 4BBAA 4F1JA 3G7SA 5K0NA 1O94A 4BO5A 4IP0A 2CLMB 3NOVA 2XR1A 3GRYA 5DAAA 4LHWA 4Q9HA 1Q95A 3TK1A 4B6EA 3RTCA 5KG7A 1LQTA 3G13A 1YK0A 2W83A 4QFBA 1XRLA 5COAA 3A70A 3L04A 3KEFA 1R10A 4PYJA 1SQ0A 2PZAA 1C3JA 4JYPA 1ODJA 3I9KA 3KTDA 2ZSAA 3R6GA 1T0PA 4BPBA 4ENUA 4OP1A 4WBXC 1OBDA 4BJ6A 4YRCA 5AJYA 3ZV4A 3UHPA 3GH3A 2A9FA 4PIPA 3QUSA 1IY8A 2CXNA 5B4VA 1GZ4A 3R0ZA 1AHPA 2W90A 4N5DA 2JFHA 4ETNA 3NT2A 4K6GA 1CNEA 4IV0A 2JASA 3BE4A 1YH3A 4ARIA 1A96A 2VYVA 3WMGA 2IIVA 4L76A 2QY6A 1CFJA 4XPZA 3T3PB 3KXDA 1AUVA 3GV0A 3T7SA 1QQ6A 1PJ8A 2XCUA 3UHFA 5JMPA 2YKGA 4PC1A 1GGOA 1PG2A 1U9JA 1KEEA 1T9AA 5TGDA 1MV8A 2C2MA 2CVFA 4L78A 4V0NA 2PZLA 1VG0B 3AVYA 1FDOA 1NWHA 1AM4D 2QAGC 3I2YX 4OLFA 1V35A 1XP8A 4P5DA 2C2KA 4MR8A 3WHIA 3RFVA 4X66H 3D43A 2EP5A 3BK2A 1XKLA 2D74A 5LR6A 1STOA 5KTNA 4N8EA 1UKVY 2PO7A 4Y0VA 1EGMB 3GN2A 4DG5A 3DVAB 3EPLA 1BA3A 1YAHA 4BASA 4ZV4A 1E58A 2BE7A 2HLDA 1VBKA 1QIFA 5B1HA 2E1PA 3TGWA 1A1SA 2QRLA 4PNPA 2AE1A 4DNXA 1G4AE 1NWCA 2HTEA 2ADOA 2J0SA 5GMOA 5K5EA 2I6QA 2OGZA 3A27A 5BMVF 3NCTA 5BV8A 2BJHA 1ECPA 1E4EB 3IEKA 5CHEA 4IHQA 4XZ3B 4BBPA 4BNHA 3AI7A 1U1GA 3HACA 4LBYA 3ZHQA 3I9JA 2H08A 1XDNA 3V1LA 4GI1A 3RVOA 1LD3A 2FX5A 3DW1X 3EWIA 1GR0A 1NI4B 3IESA 1WB6A 5BN3A 3M4JA 3BMXA 3OCJA 3T7KA 1TUBA 1R6BX 1GXSA 3KR0A 1VCMA 4G5XA 4OI0A 4P3KA 4KPEC 4CL3A 1WPRA 3GLFE 3P9CA 1ZLYA 5SZHB 3VU8A 4JITA 1O57A 2FEAA 2GMWA 4C08A 2P4EA 1XLWA 1E0JA 4KWEA 4EK9A 5H82A 1UPUA 3CW9A 4ZHQB 1AN9A 5J2UF 4C76A 2DBVO 1VB3A 3EDOA 4WJLA 1KJWA 2IKSA 4FS1A 2XB8A 3DOEA 4WXMA 1YRWA 4WKGA 2SECE 2XUJA 5AVXA 2ST1A 1Z8DA 3VQTA 4JI4B 2YUTA 2Z2XA 1RCUA 2XVZA 4AT1A 4IJKA 4FS3A 4G1FA 3B20A 2N46A 3T1QA 4NMLA 3ORHA 4FHEA 1ZRSA 2OORA 1ZC3A 3N3BC 5K03A 3QY0A 3UK7A 5E7MA 2H7VA 4KOAA 2XMBA 3JWHA 1DL5A 1SBCA 2J4DA 4JI7B 1XP5A 2IZOA 4RU9A 5H83A 4G89A 2FPKA 4PG4A 1UC5B 3AR5A 2N3ZA 2H9AA 3QPUA 2IE8A 5L3RA 2UU9H 4GE3A 3WL4A 3SZ3A 2Q5CA 3DMPA 3NBYB 2G76A 3C16C 2FHSA 2G4CA 3K4HA 3OJCA 1Z5UA 3FBWA 1YBHA 2MYPA 4BNNA 3F1KA 4ZANA 3OJFA 2PD4A 2RGEA 2OR3A 2XE6A 1OA1A 4LQDA 2WF8A 3GEIA 2QD5A 3DDHA 5KG4A 3WZLA 4P82A 3FFWA 2CMHA 1WQ3A 2ERYA 2DSNA 2BJWA 2P9JA 3BQNB 5KFWA 2C61A 4ZWNA 4OXXA 5KFUA 2W9BB 4HQOA 3EF0A 2CNOA 1J6UA 3WXBA 4ZO9A 3RIGA 1WH2A 4J1TA 3NM6B 5LZ4A 5JEDA 2JJ8A 3CTPA 1B15A 4AUKA 1UDXA 2G9RA 3CGWA 1C9JA 2HV8A 1FRQA 1TE2A 2PMWB 2JLRA 4CN9A 3RREA 3SG0A 2C4HA 1NLMA 5F5NA 4DXHA 1P4HA 1YJAA 3MUOA 4RD4A 8ATCA 1RAFA 3R3WA 3GGDA 3SIPA 4C7XA 3FUUA 3MJCA 4QFDA 5E6RB 1UEJA 4RC9A 1T5TA 3QELB 2BI8A 3TQHA 5HM6A 1OX4B 3KJQA 2BY4A 2AMLA 3RO7A 4PTZA 1N34H 3BD8A 4FB5A 4WNIA 1T2DA 1WV0A 3WDMA 3ZDQA 3GJ0A 3IQXA 4EDFA 1CUYA 3OM1A 4DCSA 4YJ3F 3CCBA 1Z5VA 2ZTSA 1BMFA 2RBEA 4PPQA 1DX9A 3QU2A 1X70A 1Q3KA 2C2YA 4TLAA 3WMRA 3U13A 4M49A 3VTZA 1R3UA 4QPPA 1Q1NA 4DLLA 3CKMA 2RGRA 3OLCX 1VYHA 2B7CA 2XNSA 3WDSA 2GZHA 5LYJF 1OWPA 3GFOA 4J9PA 4W63A 4AZ0B 5MHTA 5JARA 4DEXA 5JS8A 3GU3A 5JSKA 3W9SA 3NVMB 4ZKDA 4FVTA 1VLVA 2CJFA 1EXNA 1K97A 1DAAA 2WUVA 1NOIA 4MZDA 4AO7A 3M1AA 2GWRA 3M7IA 2P68A 3TX2A 1JF8A 5DTRA 5TRTA 4CG2A 3VR5D 4IXDA 4JBGA 1E0SA 3HXMA 5BNTA 4MRNA 4YPVA 1KNXA 5TARA 1WS6A 3IMEA 1TAUA 3RSGA 4JLKA 2ZJ7A 3JQFC 3MILA 2H2HA 1U7OA 3GK3A 3QUTA 4V0LA 4GQIA 2FUCA 3RYIB 1HO3A 1XBTA 3K4QA 5JPIA 3IAM1 4U2DA 3P27A 1X7XA 3MJRA 1JL3A 4O4HB 5FPPA 5DN6D 3D0RA 2GF2A 4Z9BA 3AUYA 4CLXA 5FPHA 4AY2A 2OGTA 1LA2A 1OI3A 3S2IA 5KCZA 3BFKA 2NQ8A 3ZWQA 1RM0A 1T2UA 3AZOA 1F0KA 3MJSA 2FMUA 3SZMA 1D0SA 4PZDA 2IL1A 3LUGA 3OESA 4MLPA 1R0SA 4N47A 4LY6A 3AHCA 1N6PA 6ADHA 5BR1A 5CDFE 1BS1A 1A9XB 3IQHX 3QXJA 5I7UA 3L7MA 4KQFA 3OZVA 3RR2A 3VJMA 2PQ2A 4RK7A 4QBKA 1IOVA 3HLTA 3A36A 4IXTA 1BDIA 2CN1A 1Z22A 3PD7A 2G0AA 1VPDA 5H68A 1QV6A 1WU8A 1S2IA 3L43A 5IXSA 1O89A 4FYWA 2HBZA 1N3LA 3EZGA 2GLUA 2PUCA 1Y1SA 5A2QA 3RAXA 4B3JA 2HA7A 2B8JA 4RULA 4N5NA 2CMDA 4O4LF 2ENUA 1JIUA 3M70A 2WWFA 5LBTA 2EFYA 5JDCA 2JFZA 3NUGA 1SD5A 3L9WA 2YMLA 1GNRA 3ISJA 3CWQA 2XGJA 4E4TA 4KQWA 1YQXA 2Y1WA 1NJFA 4EJ2A 5GV7A 1FNCA 2VNSA 5D85A 1UH5A 2HNBA 2YVKA 4R7ZA 4M8NE 4WADA 4R3NA 4FLMA 2C03A 1DELA 3U62A 2EP7A 1CY4A 3HY4A 5EJ8A 1KC7A 1W1WA 1S2GA 1Z4LA 4MA5A 3EMKA 4PSUA 3A1EA 3PKIA 3OSNA 4C9BA 3TUIC 1NIPA 3UYYA 3PHIA 5L95A 1DIBA 1ATIA 1X8XA 4C4RA 1XWFA 5AM2A 1WMFA 1M1NB 4HDKA 4QAQA 3ZGXA 4LK3A 2NZVG 2VBIA 2NOAA 3GZ4A 2X9NA 3INGA 1T43A 3DPSA 1Z5OA 5FJ8G 4H4EA 2PL3A 4PZAA 2R751 1T0IA 3HZOA 4KACA 3EIEA 1C7IA 4QPJC 3WKCA 3L07A 3ITEA 3TDKA 4AF6A 1NR7A 3V00A 4IDAA 3ZU3A 3CG0A 2A78A 3KT3A 1EG2A 3GRPA 2PBZA 3KLPX 3L8YA 1JYEA 3LWDA 1X7WB 3BDIA 1ULUA 1D7AA 2AJDA 3HCPA 2PKCA 4YN3A 2VCYA 2GFHA 2XD4A 3M3PA 5AVOA 4YCJA 3G5AA 3NOQA 3UO8B 4UE2A 1YVPA 4C4TA 1A69A 4FBLA 1WZCA 4NFHA 5JCXA 2R92G 3KV3O 4Q4AA 1RJWA 1KYXA 4RUAA 3HA5A 4HVLA 1T4CA 4PX5A 2A5GA 1U0BB 3CM0A 3HMKA 2QV0A 1H5QA 3CZQA 4COKA 3PQ5A 2FE4A 4A6XA 4JLBA 2B5OA 3D2BA 3NBZC 2WFLA 3H9JA 4JLSA 2QLTA 4ECQA 1TWFA 4REQB 4JB8A 3GJRA 4P0TA 4WY2A 1VSQA 1C4OA 3K09C 5IF9A 2V6MA 2EW8A 4MKHA 4BP9A 2QZ4A 4TN5A 2DWOA 3GHYA 3BQ2A 1U28C 1PR4A 2GCOB 2XB2A 2BONA 2ZJZA 1Y1PA 1FEZA 1KFKB 5L3QB 5C7YA 1IQUA 1FQWA 3P2KA 5HZMA 4XWKA 3K9FC 2J09A 5JALA 2BEKA 4MITA 3LLVA 5LKRA 1OV4A 4F3TA 2C04A 3G8DA 3EPPA 2FZEA 3AR3A 2QU8A 3TPCA 1VRVA 1GV1A 4FFPA 3BE8A 4N12A 3KEMA 3MWDB 5FBWB 4L8GA 2NPFA 2FFHA 2QQFA 4S0XA 4YXFA 2WU4A 4MS1B 2ZSFA 3M4XA 3BTSA 1AS0A 1X1RA 4CMIB 4B32A 4A6PA 4ZPXA 4LYHA 3C1OA 1SZJG 3RG8A 1IAQA 2QAGB 5GGXA 4ED2A 4YHHB 4OYHA 5KFJA 1AXRA 3SKYA 4HDSA 1IG0A 3KOYA 4XEUA 3D54D 3ZWWA 1QC5B 2WV7A 4AD8A 2C1XA 4Q02A 3OEED 1EVJA 4TL6A 1HTWA 2JFYA 4PFSA 3ZCPA 1QYIA 3OX1A 3ZE6A 4IRCA 1GRVA 4TS3A 2C2WA 4NWIA 3FROA 1KZHA 2QBYA 2IHYA 4LY9A 1N92A 1LPPA 1YIAA 1WR8A 1YU6A 4ZT5A 3T35A 5IBRA 1HFJA 1GPYA 2X4GA 3N2NA 3QVUA 1NY5A 3IV9A 2FCRA 1JHOA 3CN9A 3TQIA 4DV3B 1JPVA 1GY8A 1W49A 5JD6A 3H0CA 3JQ9A 4UPDA 1QTRA 4QQNA 2CK3D 3U44A 2VDMB 4LTMA 5EHQA 1WEKA 2F3PA 3N2LA 1Y6QA 4UM9B 1WMAA 4JXZA 2JJQA 2DECA 5KFFA 1Y8CA 2ZSHA 1ZCZA 4M1KA 4G9EA 3DW3X 1QG0A 5JFTA 3NOXA 4OPMA 2YVUA 4ZI5A 2J1LA 1ENZA 3NJRA 2VBCA 5K8IA 2JEGA 1QHFA 3UICA 5ALZA 4Y7CA 4ASUA 4PX9A 2BMWA 1YE3A 2HU2A 4J9UE 1KT8A 5HX7A 3T12A 4CYMA 4OGKA 3GJQA 2H4FA 2XT6A 4RKQA 3RAFC 3QWBA 3JZIA 1Z26A 2KLBA 3IOMA 2Q8PA 4R0VA 4M7RA 3MS4A 2ATLA 5DXFA 4JSYA 1X9NA 3MK31 1W4AA 2PH3A 3Q9UA 3CKLA 2VUIB 1YASA 4G63A 2COKA 1I6LA 1YRYE 4YH1A 2ASVA 3PHLA 4NV1A 2OZLA 1BU8A 2V96A 2B9VA 3BSFA 2OXFA 2ENWA 3FYCA 1YB7A 1SBZA 3UKOA 4MJLA 1BH6A 1RKXA 3B52X 4IG4A 3D6NB 1HE1C 3BFPA 4OSEA 1ZONA 4WFKA 3BM5A 1GAQA 3V7YA 5BVGB 3QP9A 1L4HA 1UWLA 3SZUA 2RDIA 5C8DA 3O4HA 4BFXA 4WDRA 2RC5A 5IZ4A 1TYBE 1BJRE 5CK5A 2QVLA 2YYSA 1Z4QA 4GBMA 1U2SA 2YYYA 4FC6A 1XRJA 3Q0EA 2BF7A 3CRVA 3UFXB 2XOXA 5I3ZA 4GM4A 5A2QW 1KIFA 2JCYA 3VXKA 3VHLB 3IEVA 4CQLB 4YT5A 3AOEC 3CNOA 3FPEA 4IMRA 4NS4A 1U6JA 2A30A 4MJ3A 2AXEA 4WA7A 1ND5A 3DS8A 3WRYA 4OCZA 3HXTA 4MYCA 1SBHA 5CJPA 2FG6C 3LW8A 1U31A 2XUZA 1KFJB 1IBLH 1ADCA 3V8QA 3ZPXA 4WKOA 4Q4DA 4L4UA 4KDCA 3AH8A 2Q28A 1M5RA 1NTRA 1WP9A 4JUCA 3H5WA 3UV3A 1FUKA 4DMUB 4D8YA 1NUQA 3C0KA 4F8JA 4L6AA 5I5EA 2IFTA 4XUCA 3G02A 3T9CA 2EFCB 4GL4A 4JJAA 5KKAA 4GBGA 4YLGA 3BCRA 1EM8A 4GPAA 5KMGB 4MV0A 4RVFA 3MMZA 4FIDA 4E6NA 5BYJA 3JQDA 1M1YB 1CE8B 4RB0A 2JFPA 4RK6A 5AKHA 3FZQA 4E09A 1SO8A 1OD6A 5HJEA 3TVDA 5REQA 5A6SA 2XYVA 3NAGA 2JA6G 1HH4A 1VE9A 1H9CA 3MQ2A 1E2QA 3ONFA 2C96A 4DV6B 3EC7A 4LA4A 1E2KA 5KS8A 2A57A 4I55A 5AKXA 2PSFA 4UM5A 2DH6A 3Q7RA 1PG0A 1KDVA 3C7CB 2M6SA 4O2BA 5TQ2A 3I9V6 2FRDA 3HBLA 2YWBA 4B3BA 5FWAA 4HNUA 2DSTA 5K0GA 1LBSA 5CA0A 3QKRA 3SCZA 1O97C 3W4KA 2ZXFA 3H2IA 5KYXA 3FI0A 1M76A 4RVUA 1DAKA 4D5EA 4YT4A 5DBIA 1KJQA 5IN4A 2OCAA 4NR0A 3WWHA 1SULA 1AK2A 5JYDA 2GKOA 3QU7A 2C0QA 4EYGA 3MG9A 5JSFA 4HN2A 3NHFA 1BTOA 3FUXA 1I0LA 5AI5A 5EI5A 3UA4A 2PJZA 4XIIA 2WA1A 2WHRA 4YMLA 3UWSA 4OM7A 1ST3A 1KBZA 2PV0A 3BA9A 3H1EA 3ZY2A 1DV1A 4CMFA 1T3LA 3ROZA 3HB4X 2HG8A 2C58A 4IR1A 1M54A 4V2UA 5EJ7A 4WXHA 3MEQA 1QIDA 4CUJA 2P8JA 2WZQA 1YF3A 1SKYE 2HCFA 3C24A 4YIHA 1LPSA 5A5EA 4KR9A 3HADA 4RAZA 4Y1FA 1TJYA 2OSVA 1LK5A 4BAZA 1X6VA 2DXIA 3ILYA 3ND6A 4EBDA 3SBOA 2R6AA 2AOXA 4MUJA 1NMQA 3LMLA 3QPVA 2RAUA 3DVLA 3KDSE 2ZJ2A 4YR3A 4XWAA 1H5UA 5KKNB 1A7JA 2V74B 3FOWA 3OSUA 2XBLA 1E1CA 4MUKA 1Z75A 4GP7A 2B1QA 3HP7A 3C8DA 4YMWA 3D4LA 2IU6A 3PGXA 3LCJA 4Y9UA 2YQ4A 4YFYA 3KZMA 4RLHA 4GMDA 4W4TA 2C95A 5A62A 1FJXA 1BN6A 3UMRA 1XT6A 3ASZA 4MWOA 1AQYA 3HDYA 4IS2A 1HRKA 3MQFA 5H70A 1U8FO 2B63G 3RS0A 1P5RA 3WNBA 3BXOA 1RQGA 1ELOA 3I4MG 4MUFA 1X39A 3QQ5A 5LUAA 4GC5A 5ADWA 4WQMA 1OH8A 4V02A 1Z2DA 5BYAA 4G86A 1QLHA 4R4JA 3O31A 4XYBA 1PZGA 1PSDA 4A36A 4MS3A 4DUPA 4D98A 4HAWA 3OHBA 1JKJA 2YXEA 3JWEA 3AEKB 4KQMA 5DXAA 1NXTA 3K9BA 4DHWA 2FQQA 3SR0A 4NEQA 4KPUA 5EY5B 1V6SA 4PICA 2C2HA 3NWPA 4FN4A 4MKRA 5FOXA 4DM4A 4R01A 3X43A 4FGWA 2Q0HA 1N0WA 4BB5A 2WQ7A 2REBA 1T5OA 3H5NA 2GM9A 4IDNA 4XWTA 2R4QA 2FQYA 4OIMA 3EEFA 4UDYX 2VDWA 1B0PA 1XMJA 4Q9AA 1R64A 3HY6A 2I3ZA 4K0RA 4YMHA 4DMRA 4CMHA 3ESAA 2I8LA 3IKLA 3QF4A 5E6SA 2O2ZA 2JVKA 2K7FA 4MUBA 1Z17A 1ZIDA 3TXYA 2TMKA 3KU4A 1N9ZA 2C8LA 3LYUA 5DTEA 5FL3A 3I4NG 1I5RA 3L0CA 2C8JA 4ZQEA 2YHIB 4J0KA 3FMOB 1P91A 1KVQA 3C3EA 2PUFA 2FW1A 3QWAA 1YSCA 1ZW6A 3EFOA 3MN1A 1OCEA 1QZZA 1DRWA 4MCIA 1CKNA 2JA2A 2O59A 2O3JA 3RYCA 1YRLA 2I91A 4ZVOA 2AT1A 1QHGA 2E2HA 3UBMA 5CNIA 1POXA 4WGFA 1CR2A 1WXHA 4QDOA 3C8ZA 3IMGA 1CDEA 3WL5A 3PL1A 4B3FX 1BKSB 2ETXA 4E46A 4G9GA 2VPXA 1J1IA 2O8FB 2BEVA 4PYKA 2C92A 4M6WA 4KNYA 1MB2A 4PZ6A 5FI3A 1Y33E 1NVDA 1XU7A 4DLKA 3V2GA 1IOZA 2J0VA 4MR7A 1U2EA 3MJ4A 2IDKA 1OBCA 5DGTA 4JBXA 3DTGA 2PNJA 1XZEA 5EG5A 3MOSA 4B76A 4OSPA 3LA6A 1I13A 3OP1A 4R31A 3COWA 3ABIA 1IN7A 3QU5A 3NBZB 3HCBA 4YROA 2BRUA 2H5JA 3LQ1A 3QYAA 5DOZA 4D9BA 4W1RA 3UB4A 1O9GA 4DIDA 4R1MA 3CZCA 1GEGA 5JTUA 3MGKA 1LDGA 4H1VA 4G1BA 2QG4A 1I2BA 1IG3A 2X0EA 1WZEA 4F2PA 4P3XA 1LI4A 4Q15A 3O9VA 1PIWA 3GX1A 2P1DA 2RHDA 3DZGA 3KELA 4GVLA 5AI6A 1Q1GA 4KL8S 1GZUA 2NX2A 5FNVF 3UT5A 4O3NA 2IWHA 4C4XA 2Z09A 1CEXA 2VQFB 1T29A 4CM9A 1WBBA 5H7XA 3DEFA 3UWMA 3VU3A 3JQ7B 1PJQA 1TIKA 3A6FA 1ISRA 1GUDA 3BEDA 2XE8A 4GOOD 1G2WA 4FYXA 4KRGA 3AETB 1NU8A 2ANCA 2KI5A 1CEEA 3MINB 4E0BA 4Q37A 4OG2A 1XU9A 4ON9A 1TFRA 3TVTA 4OXNA 4U1RA 3GLFA 3VOAA 4LVNA 1RPNA 4LBZA 1VIAA 4R8KA 3HUDA 2V7UA 1K5HA 3UHJA 3I9LA 3VO9A 1JE0A 5F1KA 1XDSA 4MV9A 4TTQA 1R15A 3KOMA 2XWBF 4ECTA 2W6NA 5I5TA 4YMSA 4RHXA 2KLHA 4R40A 1JIHA 3HCFA 4G2NA 2DLNA 3WMFA 1N56A 3T54A 4ZU1X 1M34E 4B3CA 1G59A 4BMOB 2F64A 4LHSA 3DV2A 4Q34A 1IUKA 4GRAA 5CLHA 2HYIC 4KXVA 3FA2A 5HGXA 1N0HA 1QCYA 1ODFA 1L7DA 4OHZA 3FWZA 1VHDA 4F21A 2R8GA 1E8DA 3DE6X 2QRVA 1YS4A 4A8PA 4HAOA 1WAMA 1ZJ5A 1ZJ4A 3EVNA 3OT1B 2FZ5A 4WKPA 3PRHA 4AWBA 3NFRA 4ISCA 1U0HC 4ALLA 2UZAA 2JCVA 2O8NA 3KFVA 1QYWA 4QU9A 2WFMA 2EU8A 3BSYA 4ZOLB 3MTBA 4Y30A 1QP0A 4Q3EA 1YQEA 4RPLA 3SS7X 5J4VA 1I94B 2TECE 2MT9A 3VTKA 2PK3A 3ZWMA 1BGWA 3IG0A 3FKIG 1PS9A 2QGZA 3NHPA 4TV8A 1OPRA 3RBZA 3I76A 1O95D 3BXHA 3C7AA 2GPJA 3RC3A 1V3UA 3NIGB 1Y7LA 5ILOA 3SE7A 4M1EA 5J5CA 4A23A 5DMXA 4CGZA 5CRIA 1Z38A 2AVNA 5BV0A 1H0HA 1YMVA 5KAMA 2FV8A 1E2HA 2EV9A 3FB1A 4WK2B 3L49A 3L8DA 2OZPA 4EO7A 4G24A 4DBLE 2D0DA 2N1BA 1EUZA 4TUYB 4EAAA 1PEDA 5GONF 4QA9A 1NA5A 3K9NA 1N8NA 4OHMA 4Q05A 3PHCA 2HLPA 2A7QA 4C7KA 4HLCA 2IIBA 1JHVA 3UAVA 1MXFA 4F4ZA 4B0PA 1Z68A 2W6OA 1BC5A 5TMBA 4CKBB 1DAGA 3OQHA 3E82A 4NJMA 4UCRA 5LMUB 5C34B 5TPWB 2IY9A 2JFOA 1ENOA 3W5HA 3ETGA 3KHUA 2WQZA 3H2SA 5CFZA 1JKIA 1X2BA 5FWYB 1AUQA 3GILA 3GLTA 3ZN2A 1L4KA 1U0LA 4BNFA 1QGYA 1E4FT 4DPKA 3GTJA 4AF8A 4AF7A 3IP8A 4WT7A 1IJEA 3RROA 1KSHA 2JAXA 3PFHA 4LH6A 2VDOB 2PTHA 3EQ9A 1KIAA 2XTNA 4IF4A 1R2QA 4JU8A 3H5OA 5DCUA 5ALOA 3NIDB 2EJVA 4TLCA 2O8CB 5C4IA 3GLIB 1N2SA 2R11A 3L0YA 1ZN8A 3QSYA 1P0IA 2JA1A 3F9RA 3AF0A 2ZIEA 3IPRA 5C0OE 1RE1A 3RU7A 4E51A 3QTBA 3IE1A 4YS6A 5CEFA 1M6VB 3BXPA 4FKMA 3O83A 3PJFA 3RYTC 3ZDFA 4GLLA 4ZGGA 4MHSA 4PCLA 4BQRA 2AGQA 3FH0A 2BM0A 2OAP1 3P4YA 3LSYA 4PGGA 4V0SA 3W8FA 4FU0A 5JG7A 3Q8LA 3RBAA 1P1RA 3K1YA 4FZRA 2ZYVX 1UZMA 4BQFA 4OJNA 3RC7A 4JUZA 3WZ2A 2DTDA 2OFWA 1QS0B 1DHRA 2QN7A 3DDUA 2FEXA 4W7HA 1N9GB 1XTRA 1DAMA 4F4UA 4FR5A 1FNMA 2YMPA 4TWJA 4JOQA 1K68A 1X86B 3NOOA 4PFQA 4LBVA 4O29A 1YGYA 4WZBE 1SXJD 2ZJ8A 1CJTC 3OLQA 3MWMA 4HY3A 3TNFA 2WG1A 1LC0A 2Z2JA 4PDBA 3A9RA 3SQMA 2XDYA 1QUFA 1NXXA 3AI3A 3D8UA 1MABB 4Q48A 2YBDA 2QM8A 1NBAA 3UGQA 1X13A 4J0DA 4C2MA 1RWKA 2VQEH 1FDTA 1XALA 2GXUA 4GUDA 3LGSA 5AW2A 3ZQUA 4NABA 4NEHB 3FMAA 2FOLA 3L4BC 3NWEA 2QT1A 5IYBG 4BWVA 5D3KA 1X7ZB 5JZVA 2BKLA 3GNSA 5B7QA 3WLMA 5CLJA 5C7OO 5K3CA 5JJ5A 2RGVA 2G7ZA 5JI2E 2R7MA 4J9SA 2LD4A 2CYAA 4D82A 1W29A 2Q49A 5AMXA 3FWPA 3UK1A 4IVQA 3WYGA 2FY8A 4BZQA 4PG8A 1ZUIA 3KYCA 1J0EA 3DFIA 3E9EA 1DNPA 4PEVA 5KYUB 4DJTA 5IMBA 1B6RA 1G6Q1 2V3CC 3A3PA 1EVKA 2HR1A 1DBQA 1M2VB 4EGFA 3D3WB 4ZGBA 4P0QB 1M8FA 4BPRA 3HB0A 2V54A 3IAUA 1U2DA 1XAHA 3AFHA 3K9GA 2QTVB 4L8FA 3ADOA 1GDDA 2WB1A 4RIHA 1RXVA 4MEAA 3MS7A 5CFOA 3BJEA 3JYOA 3ZDCA 2YNMA 3OJXA 4W5NA 2DTEA 4BNYA 3K6SB 3SR4A 1YONA 5EZSA 4NCKA 1WSAA 5ITWA 1RRVA 5BT9A 4B6OA 4EQ5A 3S2ZA 2F8TA 1QONA 3JVUA 3V6JA 2XB9A 3EXIB 4AIIA 3E5MA 4TKVB 2ZR8A 3IPAA 5ECDA 5J2UB 2POQX 1NKTA 1PUXA 4DJEC 4QGFA 3FYSA 5IC5A 4DIUA 1FUEA 3TW6A 4W5JA 3RRMA 5JXWA 2JJ1A 3MTEA 3EASA 1RAAA 3OQMA 1DXOA 1OA0A 4J03A 4N39A 3KZCA 3UVEA 2X0FA 1XZFA 4DOMA 1E2EA 1U3TA 3H04A 5CFMA 2IF2A 2GYVA 3TNJA 1UFRA 2FSVC 1QE3A 3AR4A 3VPFA 3BEOA 1CTQA 4N4AA 2LW7A 1CQJA 3Q8MA 2QNBA 1KERA 4FFMA 2C4WA 2MSNA 3T5GA 3ZXYA 4G09A 4BV3A 2X5XA 5L3VA 2I87A 4YHBA 2OWOA 1N5KA 3MR5A 1YDEA 3GFQA 4P98A 1SBNE 1DLJA 4DL9A 1UWVA 2Q2TA 5AK0A 2IX9A 2CGEA 3EPKA 4R51A 2WJPA 1Y82A 4G9BA 4Y9RA 1XVAA 2FMXA 2WV9A 5CFNA 2RGNA 1SU4A 4X6LA 2BGUA 1OH7A 4BOYA 2R1UA 3EIHA 2IKQA 3EC2A 1W5EA 1Q1AA 4GLOA 3G0GA 1RQNA 2QSYA 2WHPB 3KOOA 1BXZA 5EAIA 4CODB 1W0CA 2HLNA 4JGGA 1Q7RA 1LWOA 4G0ZA 4A8JA 3UJPA 2BM1A 4TZKA 3JQ6A 3PDWA 3W5DA 4D44A 4DQ0A 2FPPB 5C51B 1CYEA 2J6TA 1CQXA 4DTCA 2RB4A 5AW3A 5EIBC 1BEZA 3D81A 3QFHA 3QBDA 5LQCA 1WMBA 4WK4B 2X86A 2D5IA 3ELDA 3GFPA 4MV6A 5GIOE 5T4FA 2OD7A 3PR1A 2ZI5A 2GGSA 1RM3A 4XRRA 1N5MA 4B2LA 1I7DA 1ATZA 4YJFB 3A37A 1JDEA 4HB2A 3N6RA 5EJGA 1P2UA 4DNOA 2WI8A 4GSKA 3B1JA 2ZE8A 2R5NA 2Z83A 3WB9A 5JCPA 1B73A 3D3JA 4K0KH 1YZTA 3T5JA 5K4GA 1YS7A 1FRVA 4RE6A 4UAGA 4JHLA 4OXQA 1KR5A 3LXUX 3K3VA 4DR7B 2GJKA 1QIJA 1UT5A 1OV6A 1U0JA 5JLAA 1YBMA 4AAYA 3KYDB 3U4QB 1S02A 3OOHA 4JXKA 4MWTA 1J0CA 2WEKA 3QI7A 1ISGA 3BBPA 4DQLA 2WSSD 3X2FA 1T34A 1DTWB 3HR7A 1KY3A 1X1QA 1Y3BE 3ZE0B 4HH1A 5LYJB 3IUQA 2ID7A 4WAUA 4B82A 3LVQE 5KQSA 4J9RA 2EKPA 2VSFA 1M6EX 2H2IA 2JFUA 4P84A 3IRVA 3R74A 1U2RA 1MRSA 1I1OA 2BGGA 6REQA 2K87A 1Q74A 4B3MH 4BATA 4TMYA 1KPGA 2EJCA 4U6QA 4YB8A 2PHZA 1E4YA 3GPDG 1PNQA 3BREA 4OHXA 4J29A 4AY5A 1S4MA 4LOIA 3NW9A 1VKHA 2A3NA 2W6IA 5A3QA 3W5BA 5DG9A 5TMEA 4BKMA 4C7BA 1B8OA 3SZLA 1B74A 2HF9A 4KSCA 4JXJA 1H8HA 4X3PA 1NG9A 3UPTA 4IH1A 1E1RA 5AHRA 4C2AA 4DA4A 2JJ2D 1SVSA 5DGCA 1R4AA 2YICA 1TAGA 4QBTA 3VH1A 2OBMA 2W9XA 3RUHA 3EXHA 4NXNB 4N6GA 1F8XA 2Q1SA 1N4AA 5D5HA 4QICA 2R68A 4DNPA 2W8BA 3UT0A 4BX2A 2IU4A 3DEJA 1SOUA 1B7GO 5LMZA 4OSOA 5JO0A 3N70A 1J8MF 1ZN2A 3H0KA 3NYQA 5BWMA 2P2LA 3MTIA 1KYVA 2WD9A 3NRCA 1I7QB 5T41A 2ZBFA 3LH5A 1J49A 5E6UB 1GG5A 2XQKA 3E9RA 2R6CA 4EPVA 2FK2A 3ZWBA 4P4LA 1O4VA 1IZ9A 1J5EH 1NSYA 3VX4A 5GP1A 1P2DA 4HFJA 2C4KA 2HPVA 3QXHA 1W8DA 3Q3JB 3L0OA 1BCRB 3D59A 2OOSA 3KAKA 1CW2B 3OU7A 1JZTA 4Z9AA 3PUJA 3ENWA 1OH6A 3HYLA 1U3CA 4O1MA 2R1VA 4J9VA 4O4LB 3LLMA 5HFAA 1OQAA 2IW3A 1F8UA 5C1OA 3ZI4A 4P7BA 2V8OA 1MCZA 4R1LA 4RIIA 3UJ3X 5TGZA 3TDMA 1OAOA 3B6JA 1UOEA 1CZUA 1NFQA 4HWKA 3NHJA 5FLXA 3HY3A 4NYMR 1TWAA 1ECLA 4AN1A 3MVEA 4OXYA 1P4SA 3FBGA 3I58A 1XZPA 3WSVA 3BTOA 3M3DA 2PLRA 4FR0A 1G66A 4F86A 4QBIA 3C6BA 2IHVA 3PUIA 1T25A 1EFRA 1OFIA 2VA8A 1SMKA 3PC3A 5DOVA 4CM4A 1IEXA 3EWNA 3HTXA 3LYLA 3ILHA 4IJQA 3Q88A 1H2XA 1YJCA 2RGXA 2JRLA 4Z9YA 1W36D 4ESOA 4GZLA 1WVGA 2XBMA 2BHRA 4LVOA 2ZB7A 1U4OA 3VJLA 4QJ5A 1WQ1R 3TFOA 4XASA 1JMKC 3QKTA 2LE0A 4OA8A 3L7AA 1QP7A 1I6WA 3PRYA 1FPMA 1WKCA 2Q3CA 2I55A 2YIDA 4NFSA 4CLRA 3UJDA 1BH2A 4UU7A 1RD4A 3RSFA 1MMFB 4QOJA 1MU0A 2H0QA 4WZAB 2Q3MA 5AKIA 1ZD3A 1YL5A 3IHTA 1ZXXA 4RWZA 5JRZA 4XJXA 1L4LA 2G25A 4Y9SA 2NIPA 4DLBA 5MFZA 2AFIE 2P77A 2YWCA 1N2CE 4X1YB 1FOEB 2BKEA 2J3LA 3VVCA 2QL5A 5AVYA 2UVPB 2V4ZA 4RJ2A 2Q9UA 5DIZA 3ZJ4A 2PT6A 1C4XA 5EINA 1V95A 1LRLA 4XPIB 3Q6NA 4RS3A 2MJLA 2WWWA 4UDNA 4N65A 1W5SA 5DYTA 2B4AA 4Q7EA 4U2EA 1GITA 2QTZA 1X92A 4FEEA 4O4IF 1DXHA 3CF4A 1VHQA 1PFKA 4LJAA 3C3WA 3GQVA 1XMSA 4NBNA 3B2NA 2IT1A 1TQ6A 3WIBA 1CULC 2JFBA 3CFYA 1VA4A 5G41A 2HT6A 3A3YA 1IXZA 4LDPA 3VNVA 2WYIA 5JCOC 4WLUA 2OHXA 1NZDA 1GFSA 3MLEA 4G0OA 2PQMA 5KG3A 1TW2A 2WVJA 1WMEA 5LUBA 3B70A 5ALHA 1N3IA 3G79A 2R00C 4ZCMA 2B2NA 4MW4A 3K70C 1ZBQA 2OAEA 3SF0A 4NCAA 5KFAA 5AJUA 3QFRA 2NV2B 2QORA 2X1LA 1JHAA 4IIXA 5I6DA 1ZVQA 4GI5A 3QEMB 5CTJA 1I6UA 4U8HA 2G72A 2IYZA 3RC2A 2GQSA 4E5KA 1GNLA 1PQ4A 1M8JA 4IDGA 4M2LA 3TMAA 1T15A 3JASA 4ED0A 4B8WA 1YQ9A 4GMXA 3TCKA 1IQ0A 4YBZA 4KVFA 3UGTA 4Z0PA 2D2VA 2HPHA 5ITSA 1L5KA 4Y7DA 2H18A 3CXRA 3I53A 5F2KA 4F91B 4L85A 5C8YF 1S8NA 4BQEA 4JYBA 4OHFA 2I67A 4K6NA 5F3WB 3NDBB 2IYYA 2AX4A 1TM2A 2HGXA 5HKKD 1R8XA 5HJ2A 1KARA 3ZH2A 3OM8A 2CLSA 3INRA 5DGDA 2X8JB 1R3DA 1E2LA 2VAXA 3L0IB 4M9RA 1GKYA 2C98A 5KFRA 3ZIUA 4D3DA 1JDVA 4E2ZA 2FR0A 1GG9A 1ZUD1 3PHJA 4HUQA 1FSPA 4B48A 4RSGA 1X8LA 3M9LA 1WM1A 1CZOA 1FP4B 2FW7A 3OC6A 3NTRA 3DM5A 2ZKIA 4FLEA 4B4DA 3NT4A 3RUCA 4CI0B 2UXCH 4FC7A 2A1UB 3ODGA 3IR7A 1KMHA 1WXQA 1FDRA 1G5QA 1R88A 3QVGA 4CKEA 1PD0A 2NVWA 1VSVA 3I9MA 2NUPA 1E3LA 2H4XA 1B6TA 1HDOA 1QCCA 3M2TA 1L7XA 3AL2A 3RJZA 1PJBA 3ZK8A 2Q4TA 4HSEA 2CFSA 3RQSA 1Y3DE 4PLWA 1EA5A 4JEUA 2VTBA 3RTDA 2Z0MA 5KTRA 5COQA 1K7CA 4QHYA 4F50A 1MHTA 4DLZA 4EFLA 2IPOA 4XLZA 4GP9A 2RCYA 4DR6H 2WYVA 1YZYA 1U8ZA 2ZBGA 4NV3A 4DV2B 1G291 5HTKA 4ML3A 3O8QB 4MVJD 4S35A 4R5HA 2C3YA 3S1AA 3HB5X 2JBWA 2Q0XA 4OQYA 4JBWA 5C35A 4ME6A 4Y2VA 4L5AA 4P58A 3HKDA 1GDHA 3V4PB 3TWOA 1H9BA 2P9TA 2Z4SA 4R9RA 4F9FA 2CJWB 2CL6X 5CA1F 3C1UA 1XLTC 1QKKA 4W7SA 4OO3A 2OFPA 2HX1A 1JTEA 5C5JA 2ZDQA 3ZLTA 4W9MC 5KNBD 3L8FA 3UCEA 1L5GB 2D62A 1VL6A 3K9QO 2AOTB 3J7AK 3DUWA 2HQ1A 3I0NA 4BFYA 1UKEA 4HGOA 3CIOA 2LKDA 2G88A 4YRAA 1C1XB 3SYNA 3MT7A 3H2JA 4O02B 1T1EA 3ZJUA 5PGMA 5JZMA 5GV8A 4X84A 1FKAH 3H5IA 2X5RA 5FI1B 1KZ1A 1OGJA