5CAEB

Succinate bound to pig gtp-specific succinyl-coa synthetase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the binding of succinate to succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
total genus 135
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5caeB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5caeB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5caeB03
5BPHA 3N6RA 2NU6A 2NUAA 5H80A 1CQIA 4XX0B 1EYZA 3UFXA 1A9XA 4YBZB 3KALA 1KEEA 2ZDQA 2GQSA 3MWEA 1I7NA 2GPSA 4DLKA 3R5HA 3TINA 2CSUA 4O7RA 2W6QA 2FPPB 2V59A 1DV2A 5CB4F 5IYZF 3TIIA 4O7YA 2FB9A 2NU8A 3HBLA 2GQRA 4HQ6A 3R23A 4QSHA 3OUZA 4HNTA 5KKNB 3QFFA 1EUDA 4IZOA 4Y8VA 4NYEA 2NU9B 2DLNA 3RUPA 1SCUA 3RFCA 3PFFA 2PBZA 2GPWA 1KBLA 3MWDB 4ZHQF 3K5HA 1JKJB 2ZDGA 4TUYF 1KJIA 5C8YF 5BMVF 4FFNA 1EUCB 2W6MA 3ORQA 1GGOA 4E4TA 4O4LF 4FFPA 2FPIA 2OLSA 3HB9A 2R86A 2SCUB 2CZGA 1AUVA 1M0WA 1AUXA 3AW8A 1CQJB 3GIDA 5HBRB 5JQGF 2QK4A 3ETJA 2YL2A 1T36A 4O81A 4TV8F 4ZI7F 2YRXA 4XZ3A 4EG0A 3Q1KA 5C1OA 2I8CA 2VR1A 1IOWA 3N8DA 2R7NA 2CQYA 3VMMA 1B6RA 3R9RA 3KAKA 4O4IF 4IIJF 5J2TF 1PK8A 3K3PA 2YZLA 5LYJF 5J2UF 4YAKA 3R5FA 1EZ1A 2QF7A 3HO8A 5FNVF 3GLKA 3JZFA 3TQTA 1KJQA 5LA6F 2FP4B 1M6VA 3ORRA 3Q2OA 3U54A 1Z2PX 4YAJB 2R7LA 1C30A 1CQIB 2I87A 1ULZA 4IHJF 2YYAA 1KC7A 1GSAA 4YBZA 2CNVA 4FU0A 1DV1A 1I7LA 2NUAB 5KX5F 3JRWA 4WBNF 4FFLA 2VQDA 4YJ2F 2YS6A 3WNZA 2NU6B 4RZQA 2YS7A 2W6PA 2YWVA 2PVPA 5JQWA 1CS0A 2NU7B 2R85A 5K2MA 4FFRA 2C00A 4TV9F 2R7MA 2HJWA 1KJJA 1A48A 5CA0F 5LOVF 3VPDA 4XYLA 2HGSA 1JDBB 4C5AA 2P0AA 3MWDA 5JH7F 2R84A 3AX6A 4L1KA 4O4HF 1BNCA 3WO1A 1OI7A 3I12A 1EUDB 2ZDHA 2R87A 2W6OA 5CAEA 3SE7A 3LP8A 2J9GA 4MV8A 1JLLB 2FPGB 2VPQA 4ZOLF 4C5CA 3DMYA 1CQJA 1DIKA 4MV3A 1PX2A 2WYOA 5HBRA 4O84A 3K5IA 4O7VA 2SCUA 5I47A 3MJFA 1CE8A 3TIGA 3UFXB 2CNQA 2YV1A 4FE2A 2DZDA 3WO0A 4MV1A 3V4SA 5LP6F 4IWXA 4XX0A 2DIKA 4O2BF 4O7NA 1W93A 2YRWA 1E4EB 2W6NA 3V4ZA 3VPCA 1KJ9A 3LWBA 4YAKB 4I55F 2NU8B 4FFOA 4FGRA 3U55A 1VBGA 3MWEB 2FP4A 2IP4A 2NU9A 2XCLA 5BPFA 1GSHA 4O7ZA 3E5NA 1SCUB 4MV9A 4ME6A 5D8DA 4HNUA 1JLLA 4YAJA 3JZIA 5EZYF 2CNUA 2Z04A 2XD4A 1JDEA 2YW2A 4DIMA 4MAMA 4I4TF 4M9UA 5LXTF 4HR7A 3U9TA 3JRXA 3OUUA 1EUCA 4Y8VB 5C1PA 2YZMA 1KJ8A 2FPIB 1JKJA 2PN1A 1WR2A 2R7KA 1EHIA 3ETHA 2V5AA 4YJ3F 1M0TA 4EGQA 4ZQIA 4O7SA 2R6FA 5JVDF 2R82A 4YB8B 4MA5A 3TW6A 4O83A 4MA0A 2NU7A 4O4JF 5CA1F 1E4EA 4MV4A 2W70A 3VPBA 3DF7A 4XYMB 5GONF 4EGJA 4XZ3B 4MV6A 4O82A 2X0SA 2V58A 2GLTA 3G8DA 1UC9A 1UC8A 1W96A 3KAJA 4O2AF 4O7TA 1BXRA 1Z2OX 3VA7A 4XYLB 4O7WA 1GLVA 2FPPA 3NUAA 5JVLA 1VKZA 2YZNA 1OBDA 4FFMA 1B6SA 2Z02A 3KREA 5HV6A 1IOVA 4HNVA 2W6ZA 5CAEB 4WD3A 3R5XA 4IWYA 4O7LA 3G8CA 4I50F 3BG5A 4MV7A 1VBHA 4O86A 5DMXA 1GSOA 4C5BA 1C3OA 4YB8A 3VOTA 1KUTA 2FPGA 2YV2A 1OBGA 2W71A 3RV3A 2I80A 2DWCA 1Z2NX 3RV4A 2YZGA 3U9SA 4XYMA
chains in the Genus database with same CATH superfamily
3OY7A 2PA0A 5JCXA 2EFCB 3AL0C 2H6EA 5CLQA 1IN8A 2L19A 3S2ZA 3PGXA 2ZIVB 3VBCA 4A91A 3OF3A 5I8WA 2Q7OE 5F2KA 4LCJA 4X62H 4LH6A 1W6RA 1ZK3A 2DFVA 3PNLA 1WABA 1H93A 2PD3A 4HWKA 1S0MA 1BRTA 3TLCA 2JA7G 1XALA 3ET5A 4A3EG 3H5AA 2F4NA 3RSGA 3SU8A 1GU1A 3NBQA 5DW0A 3WYDA 1FYFA 4Q47A 3QEOA 1A9XA 4YBZB 4RWEA 3FTFA 1NPYA 4Y9UA 3FWYA 4KQFA 3L49A 1IVSA 2ZYGA 4U3JA 421PA 2CDBA 3OJCA 4G4JA 4RD2A 4I5EA 4DLKA 1KQGA 3N40P 2LPMA 2QG6A 3A06A 1W6UA 4GZ6A 1Y42X 2CSUA 3DFIA 3ZY6A 4Z1OA 2ZCJA 1FE8A 1YR7A 2OO5A 3GLFE 4F2WA 2P2DA 4DNXA 4UUGA 3DT9A 3W1EA 2GSDA 4RY0A 1F4VA 1Y8QA 4IJUA 4MQ6A 3PDIB 3RRBA 3ZZUA 1J1UA 3T06B 5ER6A 4CPDA 3PW5A 2QMQA 3HJGA 1WPXA 2POCA 5FNVB 3GQCA 2QPAA 5C5JA 1P31A 4J1SA 5LA6B 1SU4A 3HBLA 5BN5B 2YQ4A 1T1GA 4I3GA 1NHGA 1AKMA 4YI5A 4TL7A 4AURA 2H1OA 3OUZA 1YJBA 1ACLA 1V8FA 1TX4B 2DX7A 5GM2A 3OFNA 3ZTWA 5CDSA 1HR0B 2HIXA 1EEXB 1UXGA 5BRNA 3R7WA 3ZI0A 2PZ8A 1GCAA 1MORA 2VDNB 3O31A 1M2FA 3THWA 2UUAB 3MRXA 3H0GA 4KHPH 1X42A 2JDID 4LNUA 2OCIA 2B83A 3ZS8A 2B8NA 1BQ4A 5KEIA 4R51A 4IINA 5KSPA 3N1UA 1OWMA 4D9MA 5LCXA 2QTLA 1WY5A 1G20A 2Q49A 3S2EA 4P0QB 1KSFX 1X19A 4MIKA 3RTBA 3S5JA 3W06A 2HVSA 1O75A 3WRWA 2FUNB 3MWDB 3TMAA 5E7MA 1GQ2A 3A9CA 2ZJZA 3ZZ1A 1OJLA 1T8RA 3KE8A 1ZD3A 1ZK2A 3Q0TA 3A8TA 3DOOA 9ABPA 1NVBA 3AU8A 5JDCA 3L0CA 4R8MA 6CHYA 4DABA 4LZJA 2AOTA 2LCQA 2NMVA 1GGOA 2H51A 4MTLA 4OUKX 5MGNA 2GCNA 5AM4A 3WDMA 3MLBA 3ZVLA 4F0JA 1VZ3A 2X4LA 3Q8XB 4GOMD 1DZ3A 3R7DA 3D4PA 1V8ZA 3AIIA 2WKQA 4KFTA 2NVOA 3AB7A 4DLLA 4UVEA 3N41B 4QO7A 1E3DA 4QDUA 4ENUA 1RXIA 1YVEI 1QZTA 1RKUA 3KAQA 2F1JA 1PLJA 4P4SB 1A77A 1HDRA 1PJRA 2BUAA 2O7RA 4ZQBA 5IAOA 2UZ4A 3DJYA 1KI4A 2HVRA 1UBTS 2DHDA 2PFGA 2Z6VA 3F6EX 3WLHA 3AEYA 3RBZA 4KUHA 4MUXA 4PNHA 4RVFA 1H8EA 1ZX1A 4DIDA 2IL1A 4BNFA 1YDMA 3IVAA 5AIAA 4WFQA 2DTXA 4RZXA 4JJ6A 1TTPB 1WMBA 4KO4S 1TJ5A 1VPWA 2CBXA 1REQB 2OKCA 2VJBA 1SBIA 1DADA 1WCXA 4QUDA 5CFPA 7AT1A 2BJVA 3AEQB 4BMVA 3EXG2 5F4ZA 1A7AA 4ZEMA 3T7AA 2EG9A 5HTOA 3OQMA 4K9SA 3IA2A 2FMAA 3HXPA 2IPLA 1E8MA 4O25A 4DCMA 2O0HA 2BM8A 2AFIB 2QRZA 3PLRA 4LHEA 2IY7A 4KB5A 3D7MA 3B53X 4F50A 3A4TA 1EVQA 3PF8A 4UZEA 5ARCA 4D8VA 3FTEA 5C8XA 3F73A 1YXMA 1JQJC 3KZXA 4KO3S 3EF1A 3TG8A 2V8OA 3GN2A 4DV0B 3ILVA 4FX2A 1T6YA 4AO8A 1SBNE 1G6Q1 3PHLA 3SSNA 4EYKA 2XD9A 3J81k 1K5GA 2GVDC 3SC2A 3QMMA 4LJ7A 2QAGB 1V8PA 4OH7A 3ROXA 4UMDA 1KO4A 3OCZA 4XDHA 4X7MA 2PUGA 1A7JA 4YQYA 3L79A 1YQUA 1IN6A 2C0PA 4NRDA 1SOAA 2C2GA 3GB9A 1QFYA 2W6ID 3CPSA 4M38A 1K86A 5BQXA 1JQDA 1KR2A 4WHXA 5CLJA 1E2PA 3GO4A 4ARCA 2GZDA 1XAHA 3V1LA 4FBUA 4D0GA 5JQGA 4ZCIA 1DMSA 2C28A 1OOEA 1X9HA 2G77B 2Z5LA 4LHZA 3HXOA 4HNSA 5D1PA 1OWTA 3OZIA 3R9XA 3R3ZA 2D6FA 2VDKB 3K09A 1BVRA 3JSAA 3M2TA 3QH4A 1Q1AA 1T8YA 1KQOA 4R1SA 5HQJA 4BIIA 2OFXA 4DLRA 3ORRA 2ERYA 4OBBA 4DMFA 2ZREA 5JUWA 1T15A 5EI5A 4DMRA 3OQJA 1O94C 4UHBA 2QXYA 3T7TA 3VOBA 5I9LA 4A3SA 1II0A 1LBEA 4ZCTA 2R3SA 3V1NA 2HSZA 4N1AA 4MVXA 1PWXA 1QRDA 1XU9A 5ALPA 4OHFA 3WL4A 1QSGA 3R8XA 4HH1A 5JPCA 1NLMA 3PL5A 1JECA 1I2DA 3P19A 4IHJF 4XTRA 5ERGB 5A4MS 1FP2A 2V98A 4BQFA 3DONA 3CISA 1GSAA 1RQLA 2FCAA 3HWRA 1ADBA 2XQFA 3GIIA 2JFWA 2WIKA 3K0AB 4H60A 1UWKA 4QPPA 3V7FA 4A1FA 4M55A 4BNTA 1I7DA 3PC2A 3ZCSA 1ADCA 1I7LA 5E9WA 1N5KA 2CZCA 3BBPA 3UJBA 3WJ2A 4OQDA 1K7CA 1Z6YA 5JJLA 1BMFA 4IQ8A 2EHDA 1Y9AA 3A70A 3EEFA 3RTAA 3CLKA 3M34A 4G4GA 1V4YA 2QD4A 1EJ0A 1SHUX 4EWLA 5KYKA 2CLKB 5ALMA 2N75A 2WA1A 4HFMA 3GGDA 1LVUA 3DMTA 2B98A 3DTVA 1S6YA 3O93A 1HFKA 3O1LA 4KQJA 4NU0A 5AJUA 5K0NA 3SSAA 3K9HA 1GTRA 3I8XA 2IEBA 3WZMA 2YWVA 1O6BA 1T2EA 4UEQA 1PUJA 4GOXA 4IILA 3W5UA 2NW6A 2RAFA 5IT9W 1VYUA 1H5QA 4OL9A 4XOUA 4DJTA 5JS1A 2Q6TA 1C14A 2QX8A 4I8IA 3KKZA 3AG6A 5K2MA 1DXOA 3GROA 4GWGA 3V2UA 5BWLA 4KH0A 2V97A 4BX2A 4NZOA 2BBWA 1LF0A 1VB3A 2R6GA 4G09A 1E4OA 4QOHA 4JT2A 1JHAA 4X65H 3VPGA 1SMKA 4H0CA 4Z0PA 4AYWA 1EXNA 3Q1LA 2D1SA 1W4AA 1FP4B 1RZ3A 3MTIA 2R7MA 1XMOB 4NJEB 1IBMB 3HR7A 5G0WA 1FRZA 5B7NA 5JNRA 5M5BA 4R31A 1UAGA 3QE2A 3R40A 2PUWA 2EZ8A 2Q8QA 3QFTA 3WLOA 1QV7A 1R66A 4A6PA 3FYUC 1N1MA 1KZ1A 1N1EA 2VEOA 5C4MA 1H8ED 3GA0A 9LDTA 1X0XA 3EPKA 3A1UA 3CN9A 3AX6A 1GGJA 5HIJA 3V6JA 1L6IA 2CVOA 3W0LB 4R81A 1SQSA 2BEJA 3GU3A 2AEMA 4NU8X 3GCDA 3KIPA 5EWMA 2X0FA 4IVQA 2JAWA 3I12A 4J6FA 2J0UA 2WF7A 4JP5A 4XDZA 4S2EA 2VIIA 3RD5A 4V1CI 2PUDA 3GEBA 5E6SA 3GW8A 3BC1A 3TVTA 5KFRA 3HC7A 1U9IA 1J1ZA 1EVLA 4RW0A 3UMBA 4R2IA 1V26A 1H4VB 1L7RA 4DLWA 3RTCA 2PXXA 3SZLA 1D03A 5JAHA 1KARA 1YKFA 3GGGA 2Z6UA 2AI1A 3PXBA 4WCFA 2HCFA 3OFND 3IKMB 3IJ5A 1LU9A 3AM5A 4I0WB 1NW9B 2MHCA 1XDDA 5HM8A 2YV4A 2BONA 1ENPA 3FMVA 2RKBA 4ZYYA 4WINA 1USUA 3HKCA 4GEKA 6Q21A 5CBKA 5GZ6A 2OAQ1 1E4FT 3MT9A 3OZSA 3F8SA 4OKIA 1A50B 3GZNA 4MRAA 2Q6OA 4YTEA 4DTIA 5FBHA 2FMTA 4PPNA 4LJ4A 5LYYA 3WMXA 3AUKA 5CLHA 3LM8A 1A04A 1EPUA 3LWNA 3RIMA 3DR3A 1U3DA 3CBQA 2XUDA 1ZLXA 5KG2A 4RTMA 3B5EA 1FFCA 3CSDA 3H8VA 3I53A 4P9NA 1QRSA 1NKTA 3HP1A 3MQ4A 2J4FA 4MRMB 3S99A 3ZCTA 5BV1A 2D1RA 3KSAC 1RQ7A 3BACA 2NO1A 2O07A 2WFLA 4OYYA 3VO9A 2L2QA 1RQGA 3BXOA 3JAKB 4D8TA 1HO3A 2J0SA 5I5SA 3K9WA 5JPDA 3RADC 2GBLC 3OQIA 4QXPA 2I4LA 5G02A 1GPWB 1DAAA 1GXSA 1KXZA 1Q1QA 4XWTA 4XFKA 3G2NA 2AJLI 5KFXA 4QIWA 5CD9A 2OEPA 1U3VA 1IN1A 3PJFA 1H65A 4IOKA 2IPAB 3GAMA 3VJKA 1PNTA 5I01A 2ZM5A 4HNAB 1IN4A 1IZZA 4LMRA 4C7KA 2XGQA 4FW8A 1XPUA 3N39C 1DAGA 2X4DA 3EE6A 2FEWB 4K3VA 1NOIA 3L0IB 3U0VA 1R50A 3VPCA 4JLDA 3LQQA 3MBOA 1A72A 2VHXA 5HF5A 2VT2A 1U4SA 2QUIA 1B8UA 2WUFA 4LZAA 4W9NC 3W3ZB 3ZN2A 5HQ3B 3AJAA 4MDYA 1A4XA 3PRHA 3OWXA 1IBCA 2CHVA 3ZDQA 1KEUA 1RI1A 2P9HA 2XYQA 1TWHA 3L4EA 3OIYA 5CT8A 1TQ6A 3GJ0A 2FK3A 3UFBA 1O97D 2DKOA 2WTBA 1FC0A 4W4TA 3KETA 4R54A 1WTAA 1IUNA 1FQWA 3GLIB 1XQ6A 2OFPA 1H6CA 5MN4A 2ZVDA 3VZCA 2P27A 2IA6A 2BISA 1G66A 3AVOA 3GNSA 5DLEA 5DI3B 4CW7A 2XWBF 1ZSVA 3E05A 1P45A 4GXQA 3RU3A 4F11A 3OTWA 1HDZA 3CONA 4L8FA 2I7DA 4YT8A 2FJUA 2IXAA 3TRJA 1RNLA 4R7GA 4J1TA 4DLSA 1FX1A 1VL6A 3NHYA 2GJKA 3T4UA 3RYIA 1HXHA 3KKPA 4GPAA 5BYJA 5EWLA 4HP8A 4D8WA 3LQFA 1LD3A 3GRVA 4IVRA 4PXYA 4B2YA 2YW2A 1KEVA 1THZA 5IP5A 3VPXA 3V8BA 4XQGA 4GX1A 4QXMA 1PQYA 1ZVKA 5DOZA 1Y6ZA 3O82A 1EDZA 1IPFA 4MMXB 4YREA 1U6JA 1E2EA 1P6UA 2Z2IA 4M7RA 4FGUA 2PLRA 3MR5A 1EX1A 1X77A 4AY4A 5G40A 2LIPA 3FUWA 5EMKA 2RJNA 2ZRCA 3AL2A 2PN1A 1OFHA 4K6OA 1QIGA 2EFEB 3EGOA 3V6LA 721PA 1LLFA 2NZWA 4WNAB 3W8DA 4B6RA 4YJ3F 5HF8A 5HKBA 2E82A 5ICCA 2IS2A 3Q11A 3ME5A 1G21E 3A6HA 3KS9A 1PS0A 3IDSA 4H08A 5BR7A 5CR5A 5LMZA 1QB8A 2GO1A 4OAQA 4J9SA 4DW8A 1TCVA 3S27A 3OZFA 4RZ2A 4HAYA 4MIYA 4N5NA 3I6BA 5IF9A 5LDHA 1QANA 1PL7A 2XKAA 3DE2X 1G2PA 2LE0A 2LKCA 4NV0A 4D42A 4GBMA 3VDMA 5MHTA 3D4LA 1GKLA 1AN7A 1NLYA 3KUXA 2XQVA 3HYCA 3OX1A 5EAIA 1SOWA 2JZNA 4YLGA 1A5AB 3P32A 4G24A 1U8AA 1W44A 2X8LA 4HEA6 1X8XA 4A5OA 3TW4A 1U6KA 3AKDA 4LYGA 2HNBA 2JA7A 4Q4JB 3IUEA 4PLPA 2DUMA 5K8JB 4A23A 4ARSA 1HBJA 1VHLA 2QM0A 5HIIA 1DQNA 1EBUA 5IVIA 4O08A 4C08A 4ESOA 4WUTA 1JF8A 2AFIE 2IYXA 2WABA 4LVUA 5B57C 1U7UA 1LBIA 4EECA 2G67A 1GGVA 4UUAA 5KNLA 4A6DA 2PKCA 3FDJA 5EHXA 1N2CB 3HM2A 4XYLB 3NHBA 4IFEA 1QIKA 3DW1X 5DTJA 2R68A 4P4UA 5AW2A 4WFIA 4NMXB 3SQMA 4BOYA 2Y1XA 4TQGA 1RC8A 5JMWA 4GPD1 2IPOA 2Q3HA 4TX1A 1NVFA 3FTDA 2JLQA 1P3DA 4K05A 4M0UA 4QVKA 5DHTA 3ZCXA 1XTJA 5BV7A 5IHPA 1JA1A 1JEQB 1QHXA 1S02A 3NUQA 4CLRA 2JJ1D 4EHHA 1YCGA 3VTFA 2DSTA 4AWXA 5CNKA 2FXVA 2G6TA 3WBKA 2JAHA 1GAJA 1ZH8A 2X9QA 3BX1A 1Y48E 5ES4B 2O3TA 3EVEA 1M1NB 1H0RA 2GCEA 5K0JA 5KOJA 3H8WA 2B4AA 3RFXA 3CZ9A 3I9KA 2XQGA 1T3NA 3TZCA 3V3TA 1MIHA 3IDQA 1XDWA 1SRQA 2GXUA 4GKVA 5BSTA 3UH0A 2CVHA 1D1QA 4KIWA 3GR6A 3P2OA 3BG5A 3PC8C 3E9DA 4GT1A 3GGPA 3DWEX 4MEBA 2NVUB 1PKXA 4LK2A 3K1AB 1Z38A 5A62A 1UPFA 3A4IA 3FFTA 4M8KA 2GX6A 3ZD9A 4B40A 2R92G 1SIBE 4UZFA 4DJAA 4H2DA 2YIDA 3SD7A 3LDFA 1OBGA 1SXJB 1C2YA 4QNRA 1QP4A 2I80A 4YUZA 5IFKA 4YUAA 4EY5A 3DTGA 1FXUA 1T9GR 3FJYA 4J0CA 2VXBA 2JLCA 5ER9A 3WRVA 5CIYA 7GPBA 3V1TC 1BH2A 4A3MG 1CY6A 3DGEC 4HQNA 1A8PA 1ECGA 2Z08A 1QAMA 2ZUDA 2AEJA 2G17A 3B6JA 5C5EA 1AXGA 4DNFA 5JRJA 3GRUA 4LYFA 2EKLA 4E6EA 3OZ7A 2ZB7A 2EJVA 2LCFA 3V1KA 3UKOA 1U2QA 1IQUA 3CVZA 3DD5A 2OHVA 4PNZA 1RZVA 4CI9A 3P0IA 4XX0B 2VQFH 1YZYA 4DN6A 1ABBA 4XUGB 4LDQA 3E15A 2OL4A 4LHXA 5AUPB 2WD7A 1IG3A 1S68A 2YQZA 1MJNA 1RFLA 3IX7A 1CUGA 1YBAA 4MI1A 4XIGS 1OFGA 3KKKA 5CX4A 2J3KA 5CM0A 2OBFA 3KPJA 3WS7A 4RZ3A 4F8EA 6LDHA 3AVUA 2G8LA 3L1HA 2CLDX 1E5LA 3CNNA 4LW8A 2HK7A 4B9AA 5JZBA 3RB8A 1AMUA 2V7GA 4CN8A 5DGBA 1JT2A 5ESDA 1U8YA 2DM6A 1DJMA 3WAJA 4F7DA 5JHHB 4U7JA 1NRIA 1V7PC 1WXIA 3PR3A 4LWOA 1T3TA 2HD4A 3NHWA 3ZZTA 2G1AA 2KSWA 2LDXA 4Z4IA 3FB4A 5AOBA 4HWTA 4F2DA 3G89A 5G0UA 3QHAA 1UWVA 3NCTA 2HI0A 3W2HA 4OQFA 2QMYA 2NYRA 2JARA 3AUFA 4OQMA 3KUUA 4S2UA 1UP4A 3NWJA 4HN2A 2BDEA 1OE0A 5KI6A 3EEBA 4E2WA 4QPZA 2QENA 1KK1A 2FE3A 3L6CA 3VYVA 3ZQ6A 4OHYA 3U48A 1ZUIA 3PGVA 1MRNA 1P0MA 5JXGA 3A1DA 3D1JA 3FD8A 4XPIA 5H4HA 2HU2A 4JA2A 5FWYB 1JXLA 3MJ4A 4H16A 4HDAA 4O3NA 1G1AA 1O54A 1VSUA 2O59A 2FXIA 2XKJE 2FPSA 3G59A 3I92A 1HLFA 4NENB 4A0GA 3C6MA 2R00A 4EG8A 3THYA 5HK9A 4TKVA 3C5VA 2Q1XA 5F9LA 3AETA 3SBXA 1DAFA 4QBGB 4DL7A 1E9VA 4F92B 1KYQA 3S2SA 4FOLA 1P61B 1KBOA 4HGRA 4GC7A 4ZAZA 4EHIA 1E92A 1XZNA 1DAHA 4H3KB 4Y0VA 3S29A 3VR3A 5JCOC 1PZHA 1WG8A 3QPWA 4G8CA 1NBME 4KVAA 5DCLA 2C2DA 1QIDA 2CHQA 4MRVA 3JVEA 2A59A 1VXRA 1A96A 1VMEA 1P4SA 3HKZA 1D4FA 2EEPA 3C6KA 3DMFA 4PG5A 3ZDFA 5AVTA 5LXTA 1HG0A 4ZCSA 4I6EA 4US1R 1TQ2A 2A86A 3ORQA 4E4TA 3D4OA 4JJIA 1PZNA 5M3BA 3TEMA 1ISIA 2AT1A 4FCVA 3WLSA 1NMSA 3STVA 4YV1A 4QWCA 1VJ0A 2UVQA 1MV8A 1E9DA 3SKXA 4CVNA 1YFLA 1DFHA 5ALKA 2HRCA 1GQRA 3RF6A 5AW8A 2FFJA 1AH2A 2E5FA 4YR0A 1C3LA 3T1VA 5ERYA 3H2BA 3TQFA 1PJ2A 1F5NA 2WPDA 3C3WA 4A82A 4YP9A 1PD0A 1I4DD 1Z36A 3FZQA 3G6YA 2EV9A 1MRZA 1KBZA 4QTUB 4C43A 4GL2A 5J59A 3PFNA 3TLKA 1I7QB 3G0HA 2A84A 4JJZA 4WY2A 3FGOA 3NASA 3LY9A 5H0IA 1QYRA 5HBRB 5H59A 5COQA 4ZPXA 4EG1A 4GMKA 4O4JA 2YN0A 1ZIOA 3K8YA 1F7VA 4RO0A 1UBGA 5EG5A 2Y9PB 5JJKA 2YL2A 2IK8A 3GLGB 5JSKA 4DIOA 1GNVA 1UWCA 1EMDA 3AY6A 5KFHA 3VU3A 4JYAH 2PQMA 1YB2A 4TS3A 3QX3A 2PYZA 1F12A 4JX8A 2ZITA 4XZ3A 1ZUWA 3RVPA 4IIGA 2ECFA 2PYIA 2VS1A 3D6AA 3KPVA 4LSWA 3EX7C 3ZDXB 1XJCA 3SSMA 5M34A 4HNGA 4Q1FA 3VNAA 4GI2A 3EDQA 1KZGB 4MS1A 5KQSA 4MQEB 5K3WA 3ECCA 1K08A 4QGAA 3WFZA 1N2CE 4A2CA 1PV2A 1EA5A 1IUOA 2JEJA 3LBFA 4MQFA 4RXTA 3ZVKA 1NMXA 3AR3A 3AEKA 4DSTA 1J90A 1FS4A 1AHPA 1D0VA 2J0VA 4LXQA 2HVQA 1V7QA 3K3PA 4H3HB 2XVXA 3UHJA 1Y37A 4QXAA 1R4NB 2B8JA 1PWEA 2W2KA 1L5WA 3OFVA 1D0SA 4GYWA 4PZEA 4WGFA 5AHXA 3CMCO 2J8ZA 3G2LA 4HATA 4HKTA 5AKLA 4UAGA 4C07A 2C42A 1XRJA 4PC2A 5DSXA 5I8PA 3SNHA 4A7PA 2J31A 3WMEA 4Q00A 2XWQA 1J42A 5IJAA 2TMGA 3GBPA 1MZVA 4KVGA 4HMQA 4YN3A 5IT5A 5KSZA 3O2JA 2CXXA 1X9GA 3K9BA 1KZ9A 1UF9A 2FPLA 3IYLW 4CL2A 4E4RA 2VH1A 2VJYA 3H0GG 3NHFA 3D02A 1Z0SA 5KHLB 1R0ZA 2XAAA 2PL9A 4MDHA 3WV4A 3DAFA 4URHA 1FTQA 3U54A 4RDXA 3CUYA 2E1PA 4U2CA 1K27A 5FIUA 3E0QA 1NSTA 3U81A 4JXKA 3VZBA 1UOEA 4QL3A 2I87A 1SUCA 1H2BA 2BEUA 1R0WA 3BIWA 1NBEA 1UM9B 2OMEA 2YY6A 3I6IA 3KPYA 3QEMA 2HU8A 3UPDA 4E88A 3SVTA 4DBLC 2PZFA 1U9YA 3MMXA 4XDGA 5IJZA 4RAYA 3O4RA 1ZU4A 2H08A 1M72A 2WHRA 1NFRA 2YC2C 3SHTA 3F9RA 2C31A 3A4VA 1KC3A 2QW8A 4CC6A 4D46A 4UHCA 1EHCA 2FCRA 3PHCA 1J1IA 3UJ7A 1PT7A 5L3SB 2E4YA 4MLDA 1JSZA 5BMVB 2B5WA 5JZVA 1N33H 2PLFA 2FPXA 4IXDA 4TRRA 4CR6A 2YDXA 3RRFA 1PT9A 3JX9A 3CGGA 4M9XA 1C9YA 2RJ3A 2JAOA 3FCOA 1RYNA 5DNWA 1YI1A 1C0LA 2GM9A 2PQ6A 1O94D 3RTEA 3WB9A 2OO3A 4G56A 5CXUA 4LV6A 1T5LA 5JQWA 3ENWA 3IILA 1L7XA 2XIQA 3I30X 4JC5A 4LF4H 1GOTA 1PW7A 3L77A 3KJXA 5CW1A 4XE5A 3RLIA 1M2NA 4ZYVA 4P3PA 5T7BA 2E21A 4D41A 1V11A 4LFBB 1FFXA 1ESEA 2WFZA 1ESDA 1SBCA 5E8JA 4TROA 4PTLA 3EVFA 2EKZA 2QQ0A 1O3YA 1OXBB 1QTRA 2QGFA 3B8HA 3ABZA 3WL3A 1VL0A 4ENRA 2DHEA 1L5RA 1U28C 5LPNA 3OEYA 4IP0A 3SHQA 4CHIA 4TV8B 3DPIA 2PGLA 4HS4A 4F84A 1P4JA 5I51A 1KKLA 4X1KA 4Y1FA 2A88A 1ZM9A 3IUYA 3R3JA 1F9EA 3KG2A 4UUMA 2HM7A 2XADA 3CUEF 4UFPA 4ASUA 4GKKH 4YRRA 1R8SA 4JLAA 3O95A 1IY2A 1L5KA 4LYAA 3QOWA 2NSHA 4JC8A 5AVSA 3IODA 4E5VA 1MN6A 4W6QA 4NCHA 3PW0A 1OIXA 1XUOA 3EUFA 3WKCA 1X8KA 3LUKA 4RTNA 2Z2JA 3KQLA 2X14A 4UBOA 4EGSA 2ICAA 4IDFA 1RC0A 3FPJA 4P80A 3SBDA 2WD8A 3KLOA 2P1DA 2C9BA 3O3MB 4NG5A 3DUWA 5DNVA 5LWHA 4UU8A 3ST7A 1S96A 2VPQA 2OWOA 2GEDA 4OOFA 4C5CA 5ECYA 3FSJX 4CV2A 3C5WP 3TSCA 3DMYA 2VK4A 2C2WA 5TGTA 4LZZA 1PS8A 2BM0A 3B12A 2OGSA 5GADl 3HP4A 4DPKA 1AKRA 4V03A 4FCWA 5DGXA 1EP1B 5FPYA 4JJGA 3DVAB 5EOYA 4DR1B 3AJEA 1L3CA 4C2BA 1SKYB 1G5RA 1GRRA 2AOTB 1XXLA 2QT1A 4XIFA 4UNIA 2ADMA 5CUQA 5AQ1A 3IT2A 5IMSA 2Q7XA 2TMDA 2W9XA 3H0KA 1M8JA 1YDGA 1OCEA 3N7AA 4I1SA 4J76A 1S2NA 1KAQA 4KI7A 1RYRA 4C3OB 3DL0A 4ED8A 1TT5B 2GH1A 3RJ5A 1E6WA 1XTVA 2RCNA 2VHJA 3GJQA 4QHSA 3QVSA 1EKPA 5EMHA 5JUMA 1BXGA 2EW8A 1QP0A 1D4OA 1OAOC 1Q0SA 1AKTA 3KQYA 3MC1A 4RXMA 4B3FX 1DL5A 4PG8A 5I7UA 4OXRA 4UTNA 3AC0A 1UFKA 6PFKA 4RCZA 1ADJA 1UK8A 4NBWA 5CX1A 1NVVR 3NH6A 4RA6A 4U2DA 4CR7A 1PRYA 4L5IA 3TIFA 3SXPA 3E7DA 3W5CA 4BVLA 2PMDA 2W6NA 3V4ZA 2HDNB 3FHOA 2FRDA 3I39X 4B75A 3GIPA 4TN1A 3GLHE 3P97A 1KGSA 2DFLA 2COJA 1X1EA 4DV2H 3WQSB 4CDGA 1V0JA 4Q4DA 5TQ0B 2UU9H 1YRAA 5EN4A 3AGPA 5EIXA 1XELA 1MC8A 2HR1A 4D25A 2GVNA 4I55F 4GLBA 3H9CA 3PDWA 3ML1A 1YVPA 2R8BA 3PXUA 5JPIA 3BMOA 4NCAA 4K9OA 4KO1S 3NAQA 5BR1A 5HMMA 4PZ7A 4UCTA 3RW9A 4GMGA 4DXHA 2GSWA 3ZHRA 1CNFA 2PKEA 3DXFA 3LE8A 4LQLA 1GAWA 1CKMA 1M74A 2ODBA 1CEQA 5K05A 4CIVA 2A14A 3ADPA 4JUCA 3ZJ4A 2FV8A 1TK2A 2XSZA 2NU9A 1E9BA 2VCYA 3WWJA 5J2UA 2ESRA 5K0LA 2P68A 3V80A 2BGTA 3STXA 1GNQA 5AT1A 5D8DA 2EF1A 1JHRA 4L5AA 1EAMA 2H85A 1EX6A 4YCBA 1TPZA 4OX9Y 4FT4A 3QSGA 1YSCA 1UDBA 3SFZA 3TSYA 4DCGA 4QBIA 3T5GA 4ENVA 5EIEA 4D4MA 2Q0HA 1JDEA 2C0QA 3TQHA 4P81A 5J2TA 4R69A 1ICEA 1GZDA 4EF6A 2X22A 1JWLA 2Y1EA 1G8PA 3AF3A 5EFZA 5WRFA 1L1FA 1NW3A 1Z12A 2A0KA 1N3IA 1UDWA 3T5LA 2Y76A 4I55A 5A2GA 4NF2A 2GCIA 3H3FA 5TV2A 4CKYA 2XDQB 4HZIA 3OUUA 4GPBA 2ATEA 2D1YA 1P60A 3INRA 3T0FA 5DNCA 3QVOA 3QUSA 3RWMB 1YIDA 2IYEA 1NKSA 4DIFA 3U7QB 1M2WA 3L7JA 1EHIA 2QDXA 2XWPA 4QWDA 3WMFA 3SG0A 4DUYH 3O0TA 3A1VA 5TQJA 3OFKA 1GEGA 4M1YA 5FCDA 5IK2A 1JI0A 4TS9A 4ZYWA 2J6HA 4ZAWA 3UOWA 4YCMA 1CS4C 2V9WA 4J49A 3V4OA 4DR4H 3WIOA 3WRYC 4RORA 2JIZA 5F7ZA 2JHPA 5LJIA 2VDRB 4MV4A 2K2WA 1DEHA 2W70A 1QFZA 2P9FA 3VPBA 1A82A 1L3BA 1V11B 2X2FA 3DSRA 1J00A 1L5HA 1KAOA 4M89A 2MWMA 3L0OA 4YMIA 2EJ0A 4XYMB 4JI3H 1Q22A 2GT1A 3FH0A 1AO0A 1ZVVA 3W5SA 3C3PA 2LWIA 4M8SA 3GLFA 3FNIA 4G84A 5FBVB 5EXXA 4DV3H 2X0SA 1V4VA 1JDUA 3ZWCA 5AVZA 1PDOA 1ZITA 2OLEA 1G5IA 4RGVA 3S6JA 3UY4A 3BEDA 3FMOB 3WGOA 4DCSA 1R18A 2OK8A 3NX4A 4ENTA 4MB0A 1E2KA 1ESZA 1MG5A 3GGOA 3HMKA 4QYXA 4WQMA 5AVXA 4DKXA 1GPKA 5I7HA 1Z8NA 1PNRA 3LZDA 2BJWA 1NG1A 1QONA 1LDNA 4MJ7A 4EO7A 3A2KA 1RQNA 4IH1A 1NV9A 2OSVA 5TXGA 3SSOA 3ROPA 2ZKLA 2JGAA 1W52X 5TLSA 1XZPA 2Z56A 1OXKB 2E4XA 5DISC 3P2MA 2GKSA 4HX5A 3K0FA 1HDCA 5JBQA 5DCYA 5JXIA 5L4SA 4O7WA 3PEUA 3QJ5A 2O23A 4BCCA 5DGHA 3PJRA 1GP2A 4OHKA 4NAVA 1P2VA 3L05A 4NEHB 3FLMA 3GLVA 4HYKA 3AZOA 4BFLA 3RB6A 2JKVA 3NR2A 3U31A 1FFHA 1QCCA 4H1VA 1W94A 3DO5A 5DT2A 2R93A 1V51A 1R74A 5FI1B 4I3FA 1L9KA 3Q6MA 4DREA 2W2KB 3IBFA 3QU5A 4HRAA 1TM4E 3OSZA 1P7CA 2AIRA 1SC4A 3QJGA 4S1TA 3NBYC 3PFHA 1K2VN 3NHKA 3X43A 3SE0A 1GL9B 3OU6A 4AY2A 4UPVA 5K3SA 2ILTA 2NGRA 1FTNA 4IWYA 2GRJA 4W8HA 2VL7A 4UUPA 5E7QA 2PX0A 2Q21A 3HNRA 1NI4B 3THSA 2HUNA 4AN1A 1CUEA 1WO8A 4YC7A 1MJGM 2BCJQ 4DC0A 4Z5XA 5ICFA 4MV7A 1XZMA 2RHDA 4JOQA 5DXAA 1ECCA 2QNRA 2VTBB 1T4GA 2Q27A 1V5GA 4ZV4A 2OHFA 4JA0A 4MH0R 1EK0A 2BM1A 5HR5A 4IRMA 2JI9A 1NXWA 2M05A 1PLKA 2JH3A 2DUNA 4M4SA 3RT9A 3SS8A 4TYWA 2HA7A 1GPBA 2FG7C 2Q1TA 2Y92A 3BE8A 4UZSA 4E15A 5IJ9B 5DWDA 4AXBA 1P33A 5F7OA 1TEZA 1Y80A 3QW2A 1GITA 3QEMB 2OVBA 3BILA 3PW2A 2WUWE 2J67A 5AR1A 3D0KA 3U9SA 3S8EA 1CVLA 3R44A 3OOHA 2WT8A 3DC2A 1QOZA 3G7NA 1JWBB 2FEPA 5L9XA 4MB2A 2GUGA 4IOLA 3ZBQA 1LLDA 2NUAA 2H0AA 1H1TA 3BJZA 3SCZA 5EE1A 3B7WA 5EP3A 3TEJA 4DDKA 4PM4A 5CCBA 4YGYA 2AEEA 1QHGA 4B7AA 2PZJA 4WZBB 5E3HA 4C9BA 1ZK1A 4EAAA 5IUNC 1X8LA 3KHSA 4WKGA 3C1AA 4EOGA 1QS0B 2EGGA 3GI1A 4F4ZA 3MF4A 4OJYA 4P53A 1MOQA 1KI8A 3V7WA 2IBKA 1W9HA 3A32A 3R5HA 2UYCA 2BI8A 2RI0A 3LX4A 1P7PA 1YMVA 1L4YA 3JS5A 1UMCB 4LIPD 4O4JB 1XJQA 4PHGA 2BGMA 2H48A 3UMYA 3WGMA 1OBVA 2NAPA 1K63A 1MP0A 2QI9C 4KPEC 1R6DA 4N47A 1FDUA 1TU4A 4AD8A 3QHPA 1AKWA 2C9OA 1G5PA 1U9ZA 5IYZF 1XNHA 4DR1H 3JD2A 4DRXA 4NS4A 4DR5H 2OCKA 4HXFB 4PRLA 4RYDA 3TIIA 3LOUA 1MH9A 4RGBA 1FMLA 2X4GA 4OU5A 5IAGA 4QHYA 3SS7X 4CQMD 5LMUB 2Q5OA 4QPJC 4XUDA 5HILA 1MUUA 4X66B 3VHRA 4PXSA 1ZJ4A 1KERA 1O5IA 3WICA 2QZ4A 1CG6A 4AJ1A 1MV5A 3PUXA 2F59A 4RA9B 4TXJA 2DBYA 3DYBA 5FJ8G 5FNZA 4BMNA 4JWTA 4XLTA 3IQWA 3DTTA 3LA8A 2P4HX 3AR6A 3H4IA 5FV4A 1FIUA 4UVGA 2VVTA 1DUIA 1Q0QA 1UOOA 3N8NA 5B7GA 5BSFA 5IC4A 1RADA 2RC5A 3IULA 3QU4A 4OV6B 3H18A 4OB6A 1DDGA 1KF0A 2WNIA 2ZIWB 1M6HA 1OFIA 4TLBA 3KQKA 3ZVNA 2GPWA 1PFQA 1YT5A 3AW9A 2DWOA 3N07A 4YUVA 5FH9A 4AY5A 3WP1B 5KTYA 2VA2A 4ZICA 1CUSA 1XU7A 3TDMA 2SHKA 1VG8A 3DZHA 1JPUA 1U1GA 2I8LA 3I5UA 3OFJA 5IABA 5DHUA 5DULA 3GUZA 3IN5A 1JFVA 3BRQA 3OZRA 1WOYA 4NU5A 2HWKA 1CJSA 3ELYA 3H9EO 3M9XA 1J2JA 4HGPA 5T4EA 4DMLA 4I4IA 2GBFA 2BLNA 2X0IA 3NBUA 5AKZA 4BPRA 1A7KA 1TZMA 3JSLA 2GYVA 3DTYA 4HV4A 5B7PA 4BFYA 2B4TO 4W7SA 5LLSA 2WTUA 1OQAA 2WSYB 3UH1A 2XUJA 1N32B 3VH4A 1RBZA 3SI7A 4QDOA 2Y9MB 4LJ6A 4C78A 1QHIA 4H59A 1WZNA 3HB4X 4G5RA 2OLSA 2C4HA 3HB9A 2AN5A 2OCXA 2HGXA 2VTDA 3G02A 3I0NA 1SHLA 4N49A 4ESHA 1QV6A 2XCPA 4O63O 3A1FA 2WF6A 3A7EA 2AG1A 3B78A 3PX2A 1IB6A 4Q1CA 4UHKA 2XVMA 4I66A 4C4PA 3BTSA 3D7RA 4MUBA 2XWJI 5IFLA 1X7XA 1PE0A 2CUZA 2J5RA 5LQKA 2J33A 5KNBA 3GDGA 4F5DA 2RSLA 3FMAA 4QD3A 2QX4A 5KU7A 4GGMX 3K2EA 3MAGA 5D3KA 5K8TA 2YINC 2JIMA 4OMDA 3WLKX 3DOUA 2GPBA 2QSZA 4EB0A 1NNSA 1L4UA 1N3BA 2X3YA 3AL3A 3NJ4A 4OGFA 4WOJA 2D2EA 2XKKA 3BVPA 5FPHA 1SVNA 4GMDA 3VZPA 4AJOA 1VHDA 3CVJA 1UUFA 2WG2A 1OAKA 4CEJA 3UJ8A 3BGVA 1DOHA 4A3DG 3ONNA 1TVKB 3OAAA 4IBOA 3NT5A 2WG1A 2AG5A 3PX3A 2C9ZA 1DBRA 2VR1A 5KYWA 1F8UA 3WIVA 1IOWA 2FSFA 2Y05A 4G9BA 1YJXA 4ZI3A 4CETA 2C35B 3CNHA 2B4YA 3GDEA 1IY1A 2GEBA 2GN6A 3DCIA 4L57A 4S24A 3KUDA 5ALNA 5E0OA 1XQWA 2W42A 1KOFA 2I03A 2CBZA 3OF5A 2IBTA 1WVIA 2DTEA 3B20A 3C39A 5HK8A 2BFPA 1QK4A 4F5EA 1B4DA 2D5CA 1WPRA 1GVHA 3N75A 3NB0A 2BGLA 4CMKA 3NYIA 4O2BA 4MP8A 1F1BA 2CDNA 3L6EA 3EAQA 1IWOA 5HBRA 4F5WA 3K9NA 2IBSA 1BC5A 1GRNA 2VF5X 4U00A 3TX2A 4KHPB 5AVVA 2VDWA 3S55A 3PD0A 3X1YA 1O87A 3C3BA 1ZU5A 1CHNA 4PZ8A 3I0ZA 3ODGA 4FFBB 1NY5A 4FZVA 4LTDA 4U9HS 3QXHA 2P6NA 4CV0A 5BMOA 3FOFC 1TAGA 2V0NA 5TR9A 2PKQP 3AUUA 3K0CA 4IR7A 4RHXA 3CH4B 3KHUA 4POOA 5A1TA 4LRXA 2K87A 2HDHA 1WSCA 5JWOA 2EQBA 3F1KA 3WYGA 4B3GA 4LY9A 1JYSA 3O1HB 4FDMA 1HQKA 4ZZ2A 4X1IA 5HMLA 1KO7A 4US0R 3K70D 3HL4A 5JMOA 5IH3A 3RU9A 4UCWA 2H9YA 3UK6A 3II6X 1M1XB 4CRWB 3UBTA 2J9ZB 4ECEA 4HPWA 1BKDR 5HF9A 1WW2A 2RHCA 1X1QA 2LVBA 1AY0A 3UW3A 5LP6B 2GN4A 3A26A 2ETVA 3CF4A 2CHEA 3CRMA 4OXNA 2P9BA 3OJOA 1E1MA 1I0LA 3D6JA 3H2JA 3KSUA 4JHLA 3QBDA 1TA4A 4JUIA 4YBZA 4OHZA 3WDKA 3G88A 4JEMA 2DC1A 4FE7A 4ZO4A 5F5NA 2JATA 3UAXA 5IJ0B 3ZJUA 4V2IA 3OQVA 2OGWA 2FLPA 3CM0A 1QHNA 2IZZA 3C7CB 3P96A 2WKPA 1JVNA 1XCMA 1KH2A 2XOKA 1EB8A 3OJLA 3G23A 5DJ5A 3C3DA 4NFSA 4Z86A 3D4NA 2CF6A 5JECA 1ZH0A 4K0RA 1P8LA 1LSSA 4E4YA 3B6MA 4ZYXA 4RB0A 1PHRA 3BKWA 1HZZC 3M70A 2FZ5A 4FCCA 3ZE6A 4RZQA 3O21A 4YO7A 1J7KA 2C03A 5EWEA 1LX7A 4QXOA 1P1KA 2Q4BA 3ZV4A 1W35A 2DPMA 4CMEC 4RD6A 1VCOA 4N5IX 1P1RA 2YHIA 2GTPA 3CUKA 2H5EA 4KNVA 5DIFA 4ZRDA 2VDVE 3C6QA 4EX6A 4UUBA 1KPHA 2OBBA 3MEQA 2OBLA 1TQHA 2OM6A 4RA9A 5ALLA 2QRVB 5FRDA 1U1FA 3QUTA 1HNWB 5CG1A 2WTAA 3BS4A 1P6XA 4G6ZA 3T5DA 3ZTTA 3K9LA 5J58A 1SU6A 3GFOA 3KHGA 1LS1A 1C41A 3FF4A 4UTVA 5KYGA 3JASA 4M87A 3DMRA 3OZCA 2D59A 2CFMA 4IQGA 5J4HA 3W2GA 2C88A 4N8EA 1M76A 4D4HA 1WMAA 2I6UA 1R15A 2ISSD 3MD9A 4G81A 4TS1A 4FGKA 2Q3MA 3GJTA 1YS9A 2NPOA 3CC8A 2Q9BA 4X94A 3V34A 3SJBA 1G20B 1VL5A 2WEKA 5KFUA 1VCNA 4NL4H 2G9ZA 1HC7A 1XSEA 5JNTA 4YRMA 4D4JA 4HYEA 4R01A 3AEUA 5IP7G 4YRGA 2BCGY 3A3KA 1BNCA 2FSHA 4LNUB 2C83A 5H8WA 3GPLA 2H59A 3IV6A 4KFSA 1EQ2A 1OASA 4O8ZA 4BYGA 4DA6A 5A3QA 3OCWA 1U0NA 1VE9A 4YXWD 3T1YB 4R2MA 2M1ZA 4BNHA 3OURA 3LPCA 4O0LA 2NSDA 4EGCB 1OFUX 3VZQA 4H7JA 3GH1A 5CM2Z 1BFKA 1U31A 1TC1A 3GWZA 2KLHA 1VIDA 1SOUA 2F1OA 3CJQA 2M1XA 5KVSA 3PEVA 5I45A 2BLLA 1P5ZB 3ESBA 1X7WB 3K6SB 3U7FB 2JB9A 5JROA 4GNRA 1JEDA 4WY5A 4ZT5A 3HCFA 1UKBA 3AI3A 5EKSA 2VTBA 1E1RA 3G8YA 5JV5A 4ZREA 4YMLA 1V3UA 2ORYA 3EH1A 3WSWA 3FAZA 3BFVA 4EPWA 2H92A 2FKLA 3L6BA 4MRSA 5ADVA 3UHFA 2VPZA 5IJ9A 2HU5A 2PD4A 2X19A 1K4MA 1I5RA 5E2BA 3T3MB 5A9TA 3LSYA 3WSVA 1G6KA 2RGVA 3GNLA 3LC7O 3RYFA 1ZMOA 2Q0XA 3LCCA 4HFRA 1X7ZA 2EIYA 2ZG6A 4KVFA 4DUYB 1VLLA 2QTMA 2O2HA 4JSTA 3WX0A 1XZKA 3OF2A 3IAS6 1H66A 1LNZA 1NWHA 3B7PA 3HS3A 3PUJA 4PZ0A 1HM5A 1KK0A 1EJ2A 2HOQA 3TXAA 2VHVA 4RK0A 1XAJA 2QTVB 2X5KO 1CP2A 1QTIA 3ASZA 4DEVA 5BSWA 1C8KA 1SUSA 2XMSA 2VQSA 3E3MA 3QELA 4JT9A 2F3UA 3WNVA 2VZ0A 1P0QA 4Y9RA 2WWXA 2EJ2A 2EWMA 3FKSD 4QBKA 1OV6A 1XLVA 3OKPA 2CYCA 3QBVA 4LYEA 1F7UA 3N3BC 4FMPA 3IP3A 4DSUA 3OM1A 4B5KA 4HLDA 1DJOA 1LPPA 1HDOA 3DUFB 3NVKI 4ND4A 1EE1A 1MW8X 4MKIA 3LWBA 3K05A 1NMEA 4Y2PA 1Y7HA 3I34X 3BB3A 3A4MA 4YI3A 1JQ5A 1UDXA 3KB6A 3T3HA 4CMBA 4A3KG 4AROA 1CKEA 1L5GB 3T8YA 3WKEA 5AUNB 3CY6A 4OHMA 3VTAA 5KYWB 2GTIA 1T6BY 4FBGA 4ZT2A 4BJ1A 4TWRA 2BH2A 2YWFA 3HDVA 3WA7A 2NPIA 4FZ5A 4PFKA 4EHJA 4ZKEA 4Y1RB 3B9BA 1TAEA 2FP4A 5HUHA 2QV7A 2X7JA 4HADA 1TK9A 2X0KA 3OIGA 4KKVA 4CIDA 3FA2A 4DRZA 4D0SA 3ER8A 2F1HA 1C4OA 2ZJ5A 1YS1X 4INJA 4YRKA 5CYGA 3LHIA 3LC2O 2OBMA 3PNQA 1W4LA 4J0EA 4LS3A 1QIFA 4B3CA 5BUSA 3N2NA 4JLWA 1M6EX 1ND5A 2ZBUA 3EZ9A 3K73O 2R8ZA 2REOA 3MNFA 4IO1A 4J4HA 4KQWA 4EUSA 3HRKA 3PPYA 3O2QB 3ZDBA 4QNMA 4P32A 1J5EH 3QTLA 4EARA 1AMNA 1G0OA 1N6HA 1SBHA 1GNLA 3OO1A 1DKOA 2R93G 5LMNH 1F4LA 2CVQA 5F9MA 3K9QO 2JKZA 2AG6A 3GUVA 3KSZO 5HGJA 4YDSA 4AY3A 5B1HA 3EWAA 3QBJA 1JEYB 3TY5A 4H7IA 1G4AE 2WDZA 1LBSA 3U9TA 1P7WA 1ZM7A 1ZXBA 1T3HA 3GNQA 3IXQA 1LNQA 3DDUA 3MCUA 3RYFB 4EMUA 4KITB 1RI4A 4UCXA 5BWUA 3OZXA 1G8FA 2XBMA 2HMTA 4Q19A 4V2UA 4FJ0A 2MSDB 7YASA 1N7GA 5T5QA 3UK2A 3MQFA 2AKYA 1NVEA 2F3PA 2WSSA 4BZQA 1CB0A 2VH2A 4WMLA 1MC1A 4EHNA 5JSFA 3BE4A 4WLOA 4EGQA 5G53C 5DO9A 10MHA 4CMHA 3MMPA 2FR8A 4PDBA 4IJ6A 4J0DA 3ZKWB 4EG6A 2AD5A 1K7EB 3W5VA 1WAMA 5JY6A 4DV3B 3GGCA 2P9JA 4MA0A 3H0CA 5JXWA 3GLSA 3E5RA 4RF5A 1NQ5A 3KWMA 1KJYA 2H5JA 4F71A 1PG2A 4B7XA 1EG7A 2OCBA 2H06A 4ED6A 3LHDA 2JJQA 3QVGA 1JG7A 2IFTA 4M0MA 2X77A 4EMSA 1RLJA 3A9WA 5GONF 1N2ZA 1NMYA 4GMXA 1CY2A 2X9VA 3D3JA 1BDHA 4DE5A 1P39A 4QXQA 4DRYA 1MJFA 4MYRA 2R48A 3K96A 4KACA 1J8VA 1RPJA 3GVPA 3OPYA 1Y8ZA 4IW3B 4DR4B 1U2ZA 1PGNA 1TA9A 2Q2UA 4M8LA 3E9QA 5H83A 5FAKA 4LFAB 1S3SA 3KLBA 4B9EA 4TVOA 4IRUB 1GKYA 3AU9A 1G7SA 3C5EA 3PXCX 4P0TA 4EG5A 4IJKA 4WA8A 4X20B 3K5PA 4NBKA 1JIIA 3OHSX 1S9HA 1HX7A 4PR3A 1TF5A 1XIVA 4M9RA 1WSAA 3MTJA 4PXAA 3USES 3MINA 4DQLA 4DUPA 5EERA 1TYAE 3Q3JB 1NN3A 3VO1A 5JCZA 4DOMA 2PUVA 3VFDA 3WL5A 3LXXA 4CNBA 3TMYA 4ZK2A 4QTTB 5CYFA 4AF6A 2D74A 1Z7WA 4COOA 2PG3A 2WUDA 3HU2A 3GJ4A 2P4UA 4J6EA 1HT1E 1U65A 3HDHA 3N5CA 2Z02A 2I65A 2R1TB 1U2GA 3LL7A 3ZU4A 2RAPA 2B7BA 1JJFA 1XXHE 2IHJA 4K26A 2PCJA 4N5MA 3DM9B 3PEWA 1RP7A 4TOIA 5BN3A 1T5TA 2C78A 3EVGA 3HG7A 5JISA 5JW6A 4ZO7A 3MHTA 3ORYA 2V0CA 5AI5A 2P9ZA 1NMZA 3L7BA 3AVPA 4FPXA 3QVVA 4ILKA 2G70A 2EOAA 2P3SA 4LV8B 3EIUA 4DHEA 5AW7A 3K70C 1C9DB 1JUDA 1P19A 2OXEA 2YXLA 4O5AA 1DIAA 3OH8A 4C3UA 4JEIA 1VKJA 4PFQA 1UMDB 4YB8A 5BWRA 3AHIA 4EHFA 3O8LA 4NBTA 2IEDA 5FP0A 1R00A 2Q29A 1SVMA 1QE5A 4V0LA 4GP6A 3T1OA 1Z2NX 1SVOA 3FOBA 4EZIA 2PLNA 2VQFB 4J4BA 1Y33E 3EGCA 4MUHA 5IDWA 1VE6A 4BYMA 5SYMA 4CI0B 3O91A 3G2PA 2P6MA 3L6OO 2WF9A 3RKSA 3FZNA 2Z5VA 3E35A 3GEHA 4M1MA 1JG3A 4P5PA 5FO1A 5AO9A 1EP3B 3FDXA 4PINA 4RK7A 4ZCLA 4F3RA 3TY9A 2JLSA 5HP4A 3BSFA 5DIZA 2PO5A 3OE5A 2QTGA 3Q8QB 3T95A 1AKYA 2E48A 4M2LA 5KX5A 2H4HA 2D54A 1FUKA 4NFLA 4PPYA 5KFCA 5T3UA 3AF0A 3TE6A 1MAVA 5IJWA 3INNA 4WBXC 3UFXA 1XRLA 2OHXA 4GAEA 3HOUG 2PM8A 3LCRA 4AKGA 3M4ZA 2XE7A 5LQDA 1FXWA 4XWAA 1AGYA 4HLUA 4JNKA 3KALA 1YQ9A 2JI4A 3I5MA 3PC3A 4TM8A 2Q62A 2QNIA 4FOPA 4AN0A 1ZCBA 3ANXA 4OHBA 3BQ9A 1W36D 1XZEA 2A9VA 3DMPA 1HNZB 3WBBA 3ZWQA 3FYUB 1NLZA 2ZTSA 1OKKD 4N54A 3U1VA 1U7ZA 4QKQA 4ZDKA 5CB6A 1D5WA 3CE6A 2V59A 1QFJA 2C59A 1C81A 4XASA 4NBRA 3VQTA 1LPNA 1M83A 1V4NA 1XMXA 3ZGZA 3RS8A 1N56A 4JSYA 1C1YA 5C8YA 1KH3A 4CLDA 4D98A 3HHPA 1BQEA 3JQFC 3LDAA 1U7TA 4G1CA 4MUKA 2NU8A 1X80B 3ED1A 3W4IA 4PBTA 4MQ4A 1CQPA 4AUKA 2D1TA 1DAPA 2LBPA 4NYIQ 2H1WA 2IHYA 4L6IA 3SR4A 3BXXA 3NVDA 2GQRA 2XYPA 1JB1A 3UGKA 2AFIA 4NK5A 4B0PA 4BAUA 3OKAA 4AS1A 3W8NA 4QG7A 3TGWA 1S8AA 3FZGA 3E9YA 3N74A 2BFBB 2QYTA 2C29D 2ZE5A 5FOWA 5JNWA 5IXJA 1NX9A 3Q8LA 3MILA 3KD3A 5EWLB 1I9GA 2DKFA 3DVRX 4MWEA 1E58A 5IVDA 4AK9A 4B79A 4JFRA 2O3QA 3NTRA 5DH9A 3SC2B 1UCFA 3Q3VA 5KSOA 3EF3A 3G2MA 1TRKA 2QRPA 3HJBA 4KDCA 2CB9A 2DH6A 4AKTA 2PGXA 4YO8A 5DRTA 1T0PA 4R41A 3EGDA 1W29A 3TSZA 5KDDA 3ZDCA 4Q93A 3U5TA 2CCKA 1XVIA 3PUWA 3K5HA 3BQ1A 4UEWA 3KYDA 5BWTA 2XB9A 4CKZA 5LD2B 2FSUA 5C8YF 2Y0EA 4QRHA 4E0BA 3OCVA 4LOLA 4L5CA 2QTZA 4G1VA 4AJ4A 1L8OA 2AB0A 2NM0A 4UAVA 3LVBA 4XUCA 3EEOA 5LKRA 2QGNA 1YS7A 3C6YA 3E70C 4LFBH 2UXDH 1R2QA 4MX8A 4WNCA 1H5NA 1X7YA 2O3RA 2OTCA 3FMFA 3OIFA 5L4LA 1ULUA 3AERB 5K03A 1SCQA 3PCRB 3IPAA 2D1FA 1PIWA 2O8CA 3X1KA 2B21A 1RJRA 1IAQA 4YMSA 1PEAA 4CL0A 5EZQA 1Y9ZA 1J2UA 1SBTA 3SQLA 1Z08A 4QU5A 5JWRA 3CINA 2FQXA 4L0DA 3MGAA 2EWVA 4X71A 4JT8A 1T5SA 2WWRA 4C7BA 4EFNA 1JIKA 5KYXB 4WV3A 5LMCA 5CLLA 5C51B 2NUBA 1U9CA 2FA9A 4K28A 3RU2A 5LD2C 3K0CC 4MR8A 5BUZA 4B7CA 1QRUA 1EG2A 3ZGNA 4KQIA 1AF7A 1Z6AA 4FFDA 3ANNA 3QY0A 1V9LA 4JI3B 2FW1A 1L1QA 4TV8F 4MVJM 1CEXA 3DDNA 3RS4A 5E95A 2IT1A 1MW9X 4Y0AA 4LKOA 2O5EA 1T5DX 2VF4X 3AJ8A 4GW3A 4OJNA 4QFBA 1WF3A 5FKJA 5FLEX 3AJ9A 3ZWKA 1KBQA 3AR2A 3O3CA 1ET0A 3BGIA 3P9YA 4ZD6A 2XCSB 4DUZB 4IEFB 1IRXA 3TLAA 2PUCA 1PAUA 1JQ3A 1MPTA 1F3LA 3ASVA 3QBTA 2XJ4A 1K3TA 4QWBA 2XF8A 3R9RA 4JENA 3ZE1B 4DCCA 4YFVA 4GDFA 3ULKA 1V1RA 4BAZA 2PSJA 1DX9A 2I66A 2ZUTA 3UGTA 2P4EA 4BFTA 2FK8A 1QWOA 1GL6A 1E6EA 2ARKA 5J2TF 1JVSA 4EJFA 1BXRB 3BRWA 1GLNA 2CUNA 2HIGA 4TTSA 4EJ6A 5IWAH 2F3RA 4R0VA 4DQ0A 1HDEA 3AO0B 1QHFA 1ZW6A 3CF4G 3H83A 5B2EA 3PNYA 5EUBA 1FBTA 4YHHB 1UBNA 1GD1O 1VPVA 3C43A 3F5MA 3FJOA 3IJEB 3PZPA 4Y9DA 3T94A 1JR3D 3ESRA 3TQTA 2ZYIA 3AUSA 1NQXA 4L0CA 2IGTA 5HUQA 3FNQA 1WVMA 3RAEC 1G9XA 1ZQ9A 2C57A 3IOBA 4LC0A 2KYRA 4LXTA 1XCGB 5I4IA 2WLTA 2XHEA 2QU8A 5C32A 2R6HA 3ZK8A 5M2QA 1N2HA 2CLSA 3X2EA 3ZCUA 4KRFA 2EQAA 3N0WA 2ZJBA 3NFRA 4BNJA 5DEOA 4DB2A 3EA5A 1UZAA 5DM1A 4YAJB 1OMOA 1DJQA 4Q45A 4O2RA 3WLFA 4HOYA 2XF2A 5TQ2A 4QU8A 3UWOA 2V4QA 1MH1A 3DEKA 1JYFA 4GG1A 4F21A 1DTEA 3UHAA 3CCCA 5DTRA 1VJ5A 1GGHA 4UOQA 4X24A 2JJ2A 4JB2A 3ZOKA 1A9TA 4JJKA 1Q1ZA 3F7OA 1U2TA 3O7WA 3T5KA 5KFFA 4QQFA 5AK4A 1VHWA 3HUEA 4QVIA 4I6JA 2IDKA 2PKYX 4LZNA 4IDCA 3N59A 4QICA 5KX5F 4U2KA 3UB3A 3W8EA 1QE3A 1MEEA 2HWWA 4HEQA 1RJQA 1ZGAA 3OX4A 3STWA 2RH8A 4CF5A 4OQEA 3ZW7A 1YHZA 1DO8A 2OD7A 4RS4A 2R79A 4BP1A 2IYFA 3R3WA 4XEUA 1EX7A 3WHLA 4GKJH 2AVNA 2L17A 2O3JA 2JC3A 4NLGA 2YS7A 1KFEB 1XV5A 5CNMA 2JEGA 3DGFC 1USWA 3TBFA 1WCMG 1WPQA 2XVYA 4WA7A 4HB0A 5DG8A 1QVAA 1TPYA 2MYPA 5D3MA 2LW7A 1SZPA 4BO8A 3NKLA 5HGXA 2NU7B 3RFFA 4ZVRA 4AJ9A 4Q4HB 3L8GA 1TCBA 2WJVA 5DYYA 5K6AC 4ZU3A 4D9NA 4OJMX 1CNEA 1GXSB 5U4XA 4LJAA 5K20A 1ZIXA 4LC9A 3RC8A 3HJHA 2IWRA 1GPUA 4UDXX 1LS6A 3PLNA 4GZ5A 4TV9F 4TN5A 4A0QA 1NPTO 1Y1RA 3IEMA 1JN0A 3NVAA 3EG5A 1GYPA 4QQNA 5KSWB 4ECUA 1KK3A 2B78A 2A1IA 2ZTHA 3EXIB 4OG2A 1JDBC 4YDHB 2D06A 3PPWA 1A48A 4RMNA 5AM5A 1J2YA 2JGFA 5IKMA 3NKVA 3D6HA 3E84A 5AJWA 1U3UA 3WYFA 3G6XA 1Y7IA 4FKMA 3L7LA 2C2HA 5KJFA 1NQAO 2O3SA 3G17A 1RRCA 5AK6A 1C7JA 3FVRA 1Q7BA 4I1UA 1XTIA 3ZJVA 4Y30A 1M1NA 3AF6A 4HBZA 3OECA 3SVZA 2ZIUB 4OD0A 2LV8A 3NV9A 1JFRA 2VJAA 4QOFA 2O2YA 1Z6XA 5HNEA 4ND1A 1VPTA 2C5AA 2PRSA 2B6NA 1XMOH 1F6WA 3DXXA 4ZOEA 2JGEA 4FD3A 5DI3A 2UUBB 2A3RA 3QIVA 4FDLA 3OFSA 3FB1A 1E96A 3DMDA 5FOQA 2M2IA 2QUZA 4R68A 3UCEA 1KFJB 1AZWA 1PZEA 1MJ5A 3LP6A 3RKRA 1IRIA 4KLZA 4RK4A 2QD2A 4RBNA 4TV9A 4QM6A 1VIAA 2XUKA 3CH7A 2YC4C 1MB9A 3LO8A 5CA1B 5JMTA 2DPIA 4OMFG 3ZQJA 1P0CA 4P83A 3UMMA 3Q0IA 1CQJA 1W73A 3FMIA 1A0OA 1J8DA 1QO0D 1O9HA 4GVLA 3C45A 4ZGGA 1LX6A 2JI8A 4P4SA 5SICE 1GKIA 3GLRA 1Z5WA 1XHFA 4L4SA 3GJXB 3DOIA 4HTFA 4JEUA 1W5FA 4NOLA 4B2LA 1U2RA 1V1JA 2BE9A 2PWAA 1VZ2A 4CM4A 2ODPA 3J80W 1FP7A 4NC9A 3NDPA 5ALTA 3TEKA 3RASA 3K1JA 4N6GA 3P9KA 1XD2A 5B1SA 1P18A 2AI2A 1L8XA 5DK4A 3RBXA 5ADUS 1CJUC 1ZRHA 3SYLA 4CKWA 3EDCA 2XTAA 4CM1A 4U9IS 1GZ7A 1AUQA 1F48A 4EX7A 2HMYB 3OOYA 2FN4A 3TWOA 4S1VA 1UBRS 1DRJA 1JG1A 2HW8A 5H1YA 5FDFA 1K6IA 2G9RA 5KS2A 5I8ZA 5KC9A 1E0SA 2UZIR 4EB8A 2A5YB 1DHTA 2I2DA 3IIIA 3QU7A 1RZRA 1I3KA 3MWFA 5LYJA 2YRWA 3IHKA 1A4IA 5EJEA 1T8PA 3DF9A 4QE3A 5TS2A 1JE0A 3H11B 3VNSA 2N9UA 4MCHA 1TQDA 5DV9A 4JY7A 1FDWA 1U0JA 4DJDC 5KX5B 1N92A 1I30A 5EZSA 1R0CA 4TXHA 4WBNB 1J39A 4GOLD 2VWHA 4ZIRB 1QH0A 2C1ZA 4FGRA 3NDRA 4EL0A 2YMQA 4L4XA 2DHRA 3U19A 2OD2A 5HKKA 2DBQA 3RFVA 4MIOA 4CCSA 3QUCA 4DTCA 3SZGA 7MHTA 2ALJA 2X9NA 3HKDA 4L16A 4PCLA 1LGYA 3MWEB 1NVTA 2AC7A 2CVZA 3DDHA 4JDPA 4IDHA 3RVJA 4FC7A 3ABRB 3CO5A 1XMQH 1H2ZA 2KB0A 1SD5A 3DFUA 3GRFA 2QAGA 3EC2A 3IDFA 3R4VA 4R0NA 3S2YA 2P2LA 4JI1H 3W9BA 1SGWA 2IOFA 3U3KA 3H1TA 4HAXA 4H7EA 1MOPA 3G5AA 4WZAB 5DGDA 3DV2A 3WXBA 2YX1A 3KBOA 4MLZA 3ID6C 4B33A 1GZUA 1DFGA 4UATA 5LZ9A 1PJZA 3IKTA 3HXQA 3B36A 4CKBA 3I9JA 3V6HA 2Z04A 2FF5A 3DBHB 4PBSA 3OTOH 1O97C 2I7CA 3T5MA 5HCNA 4D9EA 2B3DA 1HETA 1KMCA 2ZCVA 1E1DA 2B34A 3QTTA 1SXQA 5L3VA 4KVZA 3OOWA 1N5DA 4LE2A 4Q3LA 1BKSB 3EIFA 2AVDA 1WQ1R 1PGOA 1MOZA 3QSYA 2RGGA 1FTSA 1V9CA 4IMJB 1X94A 3SYKA 2P2SA 1QJ4A 2VJDA 4NLLA 1M6VB 2OY0A 3LDUA 2JLBA 3QMWA 3SS9X 1QGOA 1FY2A 3HOXG 2ERCA 1AQ6A 3IVGA 4J3NA 1E2BA 3ETHA 2ZRAA 4TYNA 5CG2A 5AWFC 5HF6A 4XD2A 4B0OA 2YJ6A 3IKJA 4WJLA 3T3GA 1JIUA 1TKRA 5DLQC 2HTEA 4ZC8A 3PX7A 9MHTA 3K0KA 4AFNA 3NBKA 3RRNA 1KOGA 3R6TA 1P3JA 3M3DA 3DDOA 3H1FA 4GM4A 3RBEA 2AR0A 2N1MA 4JKYA 5K0EA 4LF5H 3B7GA 3OE7A 3UTDA 2VXOA 4R1TA 3IUQA 3FWHA 1JAYA 2YXBA 3OCCA 4PEVA 3W2TA 4D0RA 3I05A 1L5QA 4OBXA 4QU9A 1U4OA 1ZUNB 2Q07A 2K7ZA 1DCFA 1FFSA 2YVUA 1JMKC 4IWNA 2OFFA 2RB4A 4B7ZA 1U3FA 3IMEA 4ICIA 4DA9A 5FUQA 1X7YB 3U7RA 3GY0A 3BMNB 1NA5A 2FP3A 4LFCH 1HKHA 2PMCA 2VSOA 2I1WA 3VDQA 4EI7A 1KSJA 1KVUA 4JK3A 3URMA 1ZCAA 1QH1B 3C97A 1I1OA 3H9UA 3R0QA 4FNMA 5A4DA 4BPBA 1CEYA 2ATIA 1JSRA 3GP3A 4RU1A 4G0WA 2XECA 3CQ9A 2AFHE 2FFAA 1I7SB 3OCUA 5DGIA 3KHHA 2W2LD 4C0WA 3ZE2B 3DEAA 3TZ6A 2AQIA 3D2CA 4UBJA 1GADO 5FTNA 4OUDA 1C8VB 3RIGA 2WWIA 3B1YA 1DKUA 1QQ5A 4E3ZA 4RPLA 4I2NA 3HN6A 5TDHA 1R3UA 3M83A 3PSAA 3TTSA 3GN1A 3ND7A 4JI2B 3KDAA 1JG2A 4FS8A 1FX0B 3O3OB 2JL1A 5IKPA 1PU2A 3LQ4A 1V39A 1A3CA 4HFJA 3UCXA 4X64H 4J8PA 4AICA 1V1RB 3UEOA 5JRZA 1ZWKA 1PK9A 1BE6A 3FSGA 4V0KA 5FLYA 3SLRA 4IDQA 5KVVA 1OC2A 1QIIA 4OO3A 1NNEA 5BSVA 3DZGA 1XFAA 2EGUA 3IOYA 4ETIA 4XYMA 5U1PA 1UOPA 2XV1A 2CNDA 4K6FA 4LGMA 2HQRA 1IC6A 2QRMA 3KOZA 4ZYLA 1QIJA 1U8ZA 3QXCA 3VHXA 5F23A 1CUAA 4KGZA 4MA4A 4RSMA 5CAEB 4OGLA 4LGYA 5K2OA 1WMSA 1P8AA 2GF0A 2O1EA 1TADA 1CD5A 1BVUA 4ES6A 4XVCA 1V1MB 2J6TA 3QYAA 4KSYA 4FYYA 3GVIA 1TKAA 5AKJA 5DTIA 2A9KA 2EIHA 4I5GA 5I4BA 2R8OA 5EE3A 1Z73A 3RU7A 4ZJYA 5B6JA 1G5FA 1L7MA 2OGUA 1OX5A 1HMYA 3O84A 4INOA 4JI6H 1ZVQA 2YV2A 3UUFA 4QODA 4YYEA 4P4LA 4DT1A 4FYWA 4YAUA 1R0SA 5EZYB 1XTRA 2AYXA 2BZGA 3C7KA 4DR6H 4U5XA 3W8FA 1R0KA 3Q3EA 1IYDA 3UZUA 3YASA 4D3SA 3BF8A 4CQNA 3AVYA 1R9TA 2P5SA 1DJLA 2XRFA 3GEPA 4IDPA 4IQ0A 5DCUA 4UTXA 1EFVB 2GO7A 1M9NA 3ZZMA 3EMBA 2Q3EA 3X0DA 4E30A 3UQYS 1U04A 5FA6A 4QW9A 3H11A 2CEKA 3BGSA 3GEEA 5AUOB 3TCKA 3RJZA 2W90A 2PVSA 5DXFA 2O03A 3C4QA 2WICA 1I33A 4G1BA 1SBZA 5AJYA 2HZ7A 4CIBA 2H17A 2BVNA 2ILVA 4J0JA 1RLOA 1Y1TA 1JDZA 3KNZA 2ZAOA 3OAAD 3KQVA 3FGPA 3O5AA 5GWXA 3FY4A 2W2MA 2ODEA 3ILHA 3MRTA 1A9RA 3SHWA 1QTQA 2MTBA 3IBYA 2A78A 4LSMA 2GCOB 4C0JA 2FDCA 1YNSA 1FFXB 2W9CA 3GRAA 2RHBA 1DT3A 2FPUA 4O7RA 3R1IA 4F46A 1I36A 4N3CA 1B8NA 4OSPA 1GN8A 4PS0A 3VPFA 1XNQB 1V5FA 3AUYA 3VX3A 3SQWA 4KGDA 5EMMA 5F64A 3QU2A 1MC5A 5KHAA 1E7QA 3K8OE 3CSWA 1UKCA 2PQ2A 3MJVA 3ZHSA 4KYVA 1B1CA 4ZAVA 3P20A 4UTRA 5ICSA 4AS2A 2I6FA 4RELA 5EJ8A 4QEZA 1PZXA 4JV5H 1XI2A 1I3QA 3SBEA 4CMGA 5ENDA 3W5OA 1SHJA 2BEVA 3AEQA 1GGNA 3EK2A 1XX6A 4J7AA 5KNDH 4G3XA 4H6WA 5DOVA 1JTFA 4Z7OB 3THXA 3QWFA 2HPZA 4NYMQ 3MAJA 2XGPA 2H1RA 2FPOA 1QU2A 4E5PA 4HNTA 1RQXA 3ZX4A 1OVMA 3FPAA 1L7AA 4BNWA 2QLNA 3O8BA 4BGEA 2BRUC 1Y1PA 1BMDA 2ODQA 2WG0A 3ZWAA 3JYOA 2EXXA 4DEYA 2CD9A 5I6DA 1Z8DA 2ZE7A 3CXUA 3I1JA 3K1ZA 1J2TA 1MEJA 2HY7A 4BLVA 4HN4B 4XVRA 4Z99A 3S8YA 3EMVA 3IDZA 4QU0A 3TKYA 3QVTA 4MW4A 3DEFA 1PBNA 4EA9A 2Y1DA 2YWHA 2AQHA 2O7VA 4UKDA 4P4NA 1KWGA 1DAKA 1OGIA 2F1RA 1JSCA 5JI2E 3A58B 1YE3A 1N4AA 2A30A 1P4AA 4Q02A 3VGJA 3WNQA 1MCZA 2WYWA 5BQOA 4ZDJA 2AA3A 5LFAA 1SC9A 4F3YA 1RRMA 2F3QA 2M9MA 3MAAC 3F4LA 5KT4A 2WJ4A 2ZVJA 4PV7A 3RBDA 3SPXA 1YR9A 2VZLA 3FPCA 5E6SB 1HSZA 4TVKA 1JU4A 2BKVA 1PR3A 2HLPA 4R5HA 1QQBA 3LLMA 4J1TC 2IH5A 4JLJA 3HXTA 1Z4MA 3RVOA 2HREA 1FXSA 4WNIA 2VAVA 3HO1A 4B3RH 1L1RA 1T3GA 4MINA 2WUEA 2QAIA 3FNHA 4B31A 3AK4A 1XD2B 5GJBA 4J9VA 1OA0A 4LQDA 3LULA 4DQNA 4LXUA 3H8SA 3VNBA 3QQMA 1EGMB 2ZUCA 3FZYA 3EQ7A 3R5KA 5HE8A 2X42A 1H5UA 1VLJA 4BVGA 4JI0H 3VDRA 2R1VB 1PKEA 4ZZ0A 3TJMA 3LZ6A 5DW3A 3U09A 1HYHA 3DNMA 2JAQA 3PNPA 5HX7A 2VK1A 2FOIA 3P5BA 4FGJA 3AVQA 2V74B 3A6DA 2QXUA 4O81A 3LYHA 3PNKA 1N8SA 1PQWA 4BNIA 2C61A 4E5DA 2PL1A 3PGLA 2FW7A 3NP7A 1JQBA 1GTMA 1V16A 2EP7A 3DQZA 1TZBA 2PGNA 2V03A 3E48A 3PGA1 4NYJR 1YL7A 4ROSA 2WT9A 3PRJA 4YNBA 4C89A 4D7AA 3N8DA 2ZBDA 1XNRH 1AZSC 1UXKA 4RM3A 1IUKA 1CETA 2FDXA 3T7EA 1KMIY 4LE0A 3S2IA 1B6RA 1OH7A 1VIVA 3PE3A 4B4WA 3T9EA 4MPDA 2NIPA 4EZEA 1JR6A 1QOQB 3HKDB 3F67A 3GV5B 3E8XA 2HXYA 1EKVA 1QGED 1M7JA 1OLSB 1QVZA 1WHSA 2EGHA 2JFBA 3DLIA 3LQ1A 3CXRA 1TOAA 2RJOA 4CV3A 5IC5A 4DCJA 2HN9A 4E7PA 3PRKE 4D45A 3IB3A 3EWSA 2WLSA 2X0DA 3UGJA 5G1PA 1EM8A 2QA5A 3EEYA 3L3BA 5LYJF 1ZNZA 4YY3B 3L8YA 1SURA 4FYXA 3E27A 2V7UA 3D3EA 2A9JA 1W8IA 3B3FA 4WESA 3ROQA 1JWAB 3NEJA 1ZWLA 4K6MA 2VWQA 3OTIA 1C1XA 5HZKA 1XKTA 4RTRA 4EY3A 2YWXA 4BZPA 4YV2A 1HL7A 4IUYA 1YR8A 3KBBA 2HDKA 5AW9A 5FEUA 1T9ZA 3IHTA 2PU7A 2YV3A 4A8JA 5JATA 1FU7A 4MQLA 1OB5A 2F8TA 2IQ5A 3WQQA 3T9CA 5BQFA 5KT3A 2YJGA 5KFYA 2A5LA 1DDIA 3F6YA 1L5NA 3KDPA 3AQ4A 1GU0A 3NNNA 4OP1A 3UQZA 1MAHA 3QQPA 4LRQA 5FOVA 1J2EA 2XMRA 4BRSA 4R0MA 5B12A 5B6IA 1E69A 3A7DA 1TA0A 1GNRA 3I52A 3V9PA 3AI7A 3D6UA 2C96A 2PDAA 4L8WB 2Z6QA 1SEIA 1ZD4A 2WY2D 3EUAA 3VC2A 2I2FA 2HCTA 1M5RA 4BJ6A 5AVYA 4YRZA 3NHPA 4FZ3A 2AXPA 2CJWA 1UMKA 2PGDA 3IQXA 1THMA 2G4VA 1S2GA 3F7TA 1O95C 2VFAA 1CZKA 2VP4A 1U7HA 3B2QA 2AMFA 2CHFA 4ZTZB 3G85A 3K0HA 4FYJA 3FTCA 2NP7A 4UHHA 4YGXB 1PTKA 3AZQA 3OA2A 1LV8A 3OKFA 4KE6A 2NACA 3JRWA 3R09A 5I9TA 2P5YA 3UZBA 1E9CA 1Z7YA 3LWDA 4N0MA 3DEHA 3LZCA 3HJCA 1EKXA 3GZNB 5L8VA 1N9ZA 4F1WA 1JXQA 1NZJA 1RYHA 3GAAA 4HX2A 1C3JA 3GJ5A 1T9KA 3RUDA 2GK6A 2DB3A 2WZQA 3PN1A 2A5JA 4LRWA 5I9BA 1A9OA 4UTPA 5I4KA 1TLTA 2VDMB 3S1AB 4N0PA 1NF2A 4F4DA 1SKUA 4DFDA 4E3WA 5KUTA 3OZDA 1RWVA 2D13A 3DHNA 3FSEA 4D9JA 5CDGA 4CMDA 1W5SA 2UUPA 3DD1A 3GCZA 1WLYA 2V7XA 3DVLA 2ZYTX 3EBOA 1PEDA 2IPXA 2Q6KA 5KG1A 3LFHA 2YN2A 2VNSA 5ED0A 3ZIDA 3RC3A 1E4GT 4RPKA 4FFRA 4MDEA 5ILQA 1EHYA 3ADBA 5KAMA 3EDMA 1I4LD 1T0UA 4Z7JA 3ZLTA 4J9OA 1WCIB 1QQTA 3DBOB 3EJWA 3QFHA 4FD2A 3NDJA 5I7RA 1ECFA 3K9CA 3H75A 4KIGA 5E4YA 5TQ0A 1XCBA 4BMDA 3LHSA 4Y18A 1QIEA 2Q3JA 2V9CA 2XTNA 4RZIA 4PYJA 1A9YA 4K0KH 3PITA 3H8JA 5BOSA 1BDBA 2C3MA 2Z8YA 3OLQA 3P9NA 4B48A 1K2WA 3G9XA 1N9GA 1WW3A 1C9NA 4UCSA 2HA5A 1G5HA 3C8DA 2P6PA 3CEMA 5KTPA 2NVWA 2WF5A 2AN9A 1QTNA 1NI4A 4UVIA 3MS4A 3U44B 3O4IA 4II2A 4HTAA 4IICA 4WY8A 2Q8NA 1Q7TA 4NPHA 3LP8A 1WMFA 3M6MD 4O4LA 5DT9A 4GSYA 3RK1A 3QVXA 4WFJA 4NULA 2O14A 5AW1A 2DJ5A 3AF5A 5EUCA 1CQXA 1FRVA 3L92A 5THXA 1V41E 5C7LO 3TBHA 3HVJA 1U3WA 3UJCA 1Z6TA 2AUMA 2RDIA 3C3YA 3FYSA 3NWEA 4G1FA 3CR3C 4RNCA 4ATNA 3CEAA 4ZCMA 1G7CA 5KFTA 3CPHA 3NS7A 1KQNA 1IL0A 3UBMA 1KVTA 4LSZA 3U16A 4Q8FA 1E99A 3RSLA 1X74A 3I04A 4KWCA 1SEPA 3UC9A 1TD1A 3MT8A 1TCUA 4YK7A 3HBFA 3E23A 3STUA 2VUMA 5ESXA 3MJHA 3PU6A 3B1XA 3VSCA 5JJCA 2GGSA 1KC1A 1LBTA 1TTQB 4V0QA 3T1YH 4YXFA 4ZARA 2V1UA 2GRUA 4KR7A 3HUFA 5H82A 5B1YA 1FP1D 4HO1X 2NLOA 4FMBB 2QJRA 2XQKA 3GVXA 4L2IB 3ZDZB 2Y4OA 5F3DA 2ZRIA 5AOCA 3ZE9A 1ZG3A 4ERNA 1YFZA 4JH0A 4FE2A 1N5MA 3OU2A 3VR4D 3AHJA 4GL4A 1E2GA 4FFSA 5HA5A 3VTKA 4CG3A 3MQ2A 4PQFA 1CJVC 1ULHA 2KQUA 1RXEA 2X3FA 4XQCA 2CL6X 2HMAA 2R6DA 3DHEA 3AR9A 2YR0A 3WIUA 3WKAA 3UHPA 4AULA 2B25A 5LZ5A 4E1AA 4YRNA 1BCRB 2GERA 5IP9G 5AKKA 1JJBA 2QN8A 3JZAA 5C5IA 4RSHA 3Q0EA 3RLFA 3MSCA 3JVIA 1NF3A 3PI6A 4JMPA 3ZHTA 1Y9JA 1WF6A 1Y5RA 1FLDA 3H5IA 3N2ZB 1E1CB 3I5YA 3DT8A 3GT4A 3Q3IA 5IKOA 2JK0A 5DM70 2IYVA 3Q7RA 4F97A 5GJVC 5CB4A 3Q8KA 1N6RA 5L6MB 3A1NA 3GA5A 1MZPA 4Y2SA 2VH5R 2IYOA 3R24A 1BCSB 1ML4A 1VLVA 2WE7A 2YDYA 4F1KA 5ERXA 4MVJF 4FFOA 1QO9A 1Q16A 1XAIA 2H57A 3D54D 3EAGA 4HEA1 4CE5A 4HAIA 4K46A 4Z3DA 4KPFC 5AK3A 4MRNA 1WSWA 3H2ZA 2XZTA 4GR9A 5HFJA 3G2JA 3E53A 3PQ7A 4LJ5A 5AVRA 1CKOA 1VBGA 1CSEE 1JHXA 3IP1A 3OX3A 3SNOA 1PN3A 3W5DA 1XDGA 1RK5A 2GN2A 3CVYA 4HAWA 2Z9CA 1Q17A 3QVLA 1FQKA 3H99A 4EW6A 3T41A 1U0GA 3G0OA 4O7ZA 1QLHA 2DEUA 1GKUB 2Y1WA 1OYYA 1Z8FA 4LOKA 4B74A 3AI2A 3HA2A 1TM3E 4GLXA 4FFBA 2G4LA 2JGDB 5KOHB 1GTL1 3JZIA 3OLVA 4PGHA 4AMZA 5IYZA 3JQ6A 5DLYA 4EY7A 2CNUA 1C7EA 1M34B 2OENG 3QTBA 2PPVA 4L9WA 1LZKA 4WKNA 5GP1A 3ZXUB 1WNTA 3O1IC 2Y4NA 2Y2VA 5INTA 3C4VA 2BT4A 4JUAA 1GRQA 1U0LA 2HPVA 5F98A 4PZPA 1HNWH 1DRKA 5C18A 3KYIB 5A04A 1K9SA 3GD7A 3A1TA 3NWBA 2XT6A 4MVJA 4B3MB 4F93B 2GEKA 5AXAA 4EQ6A 1ATZA 3PFIA 4LF8B 4JI5H 4EW2A 4FI3F 2D2VA 2A67A 3DEYX 4PYOA 2NXNA 4QHTA