5CAEB

Succinate bound to pig gtp-specific succinyl-coa synthetase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
393
structure length
392
Chain Sequence
MNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the binding of succinate to succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitocho
total genus 135
structure length 392
sequence length 393
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2015-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5caeB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5caeB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 5caeB03
2NU7B 2GPWA 4YBZB 5JVDF 4O84A 1SCUA 4XZ3A 3VMMA 3VA7A 3JZIA 5JQGF 2W6QA 1EZ1A 2V5AA 1M0TA 4XYMB 4WD3A 3NUAA 3KALA 4M9UA 2W70A 4I55F 3JZFA 1KJJA 4WBNF 4HNUA 2FPIB 5KKNB 3E5NA 4I4TF 4MV9A 4E4TA 1CS0A 3OUUA 4O82A 1EYZA 3KAJA 1CE8A 2I87A 1DV1A 1JDEA 3VPBA 3MWDA 4EG0A 5CAEB 3MWEB 4O7RA 4MV7A 4MA5A 3KREA 5CA1F 3JRXA 4Y8VA 1W96A 4O2BF 1T36A 4IZOA 4ZOLF 1EUCB 1UC9A 3V4SA 1B6SA 1GGOA 2NU8B 4O7ZA 2ZDQA 5LP6F 1JKJB 4XX0B 4O7TA 3U9SA 4ME6A 1JLLA 3DF7A 1BNCA 5J2UF 1E4EA 2W6NA 3HB9A 2W71A 3VPDA 4XYMA 5CB4F 2NU9A 3VOTA 4O4IF 2R82A 2GLTA 2NU9B 1BXRA 4MV8A 3R5XA 2OLSA 3K5IA 2C00A 3G8DA 3Q1KA 3U54A 1I7LA 2YV2A 2YZNA 4O7YA 5H80A 4IIJF 4YBZA 5K2MA 2R6FA 2Z04A 2YRXA 3G8CA 1VBHA 2NU8A 2Z02A 4EGJA 5D8DA 5FNVF 1DV2A 3AW8A 1KJIA 1Z2OX 2QK4A 3LWBA 2VQDA 4FE2A 2PN1A 2ZDHA 1WR2A 3R5FA 5EZYF 5CA0F 1OBGA 5DMXA 5CAEA 2R7LA 3RV3A 2DZDA 4IWXA 4FFPA 1EUDA 4L1KA 1A48A 4DIMA 2R7KA 2R7NA 1PK8A 2NU6B 1GSOA 4O4JF 2YYAA 1Z2NX 3I12A 1M0WA 2XCLA 1UC8A 4XYLB 3Q2OA 1OI7A 4I50F 4FFOA 3KAKA 2R84A 4RZQA 2CNUA 3ETHA 4FFNA 5BMVF 4ZQIA 4ZI7F 2R87A 2NUAB 1GSHA 3ORRA 4YB8A 1AUXA 4QSHA 2YL2A 3WO1A 5C8YF 4NYEA 3R9RA 3UFXB 3WNZA 4O81A 2FPPB 2PVPA 4O83A 2QF7A 5GONF 4TV8F 3SE7A 3GIDA 1EHIA 4MA0A 3RFCA 4C5BA 2SCUA 5KX5F 2R85A 5I47A 2SCUB 2X0SA 4YAJB 4C5CA 2W6OA 1VKZA 4HR7A 4ZHQF 2CZGA 3K5HA 1B6RA 2I8CA 1Z2PX 2WYOA 1I7NA 4O2AF 2FPPA 3MJFA 5BPFA 2R7MA 2W6MA 5J2TF 3TINA 2HGSA 3TIIA 3TIGA 5IYZF 4HNVA 3LP8A 3TW6A 2CNQA 2FPIA 5JVLA 2GPSA 4DLKA 3N6RA 2YS7A 1CQIA 4FFRA 3HO8A 1KJ9A 1M6VA 5LOVF 1PX2A 2W6PA 5C1PA 4MAMA 1KJQA 1A9XA 2IP4A 2NU7A 5HBRA 3HBLA 3WO0A 2CQYA 2YZLA 2YZGA 4YAKB 2XD4A 3U9TA 4O7LA 3AX6A 1GSAA 1IOWA 2FPGB 4TV9F 4HNTA 1OBDA 3QFFA 4C5AA 2DIKA 4IWYA 2YRWA 4XX0A 2YWVA 4XYLA 3RUPA 2HJWA 1IOVA 2I80A 4Y8VB 2ZDGA 5LYJF 1JLLB 3RV4A 3N8DA 4O7SA 4O86A 3MWEA 1JKJA 2GQRA 4FGRA 5HV6A 1CQJB 5LXTF 2YW2A 1EUDB 1W93A 1VBGA 4YAJA 4O7NA 4FU0A 4HQ6A 2FP4A 4FFMA 1KJ8A 1KC7A 2VPQA 2FPGA 2FB9A 1GLVA 3VPCA 3ORQA 3R5HA 3JRWA 2V59A 1KUTA 3V4ZA 3OUZA 2CNVA 3K3PA 5HBRB 4MV4A 2W6ZA 1JDBB 4FFLA 4YAKA 4YB8B 3UFXA 4EGQA 1DIKA 2DWCA 2NUAA 1SCUB 4XZ3B 2YS6A 1C30A 5BPHA 2PBZA 2R86A 4MV1A 4O7WA 1KBLA 2P0AA 1CQIB 1AUVA 1C3OA 1E4EB 2V58A 1EUCA 2CSUA 2NU6A 3DMYA 4YJ2F 2J9GA 4MV6A 2YV1A 2YZMA 3R23A 3PFFA 2DLNA 2FP4B 1KEEA 4O4HF 2GQSA 4MV3A 3TQTA 3MWDB 1ULZA 2VR1A 4O7VA 1CQJA 4YJ3F 3ETJA 3GLKA 4IHJF 4O4LF 5LA6F 5C1OA 3BG5A 5JQWA 5JH7F 4TUYF 3U55A
chains in the Genus database with same CATH superfamily
3R6GA 3AEXA 1K88A 1K4KA 3HU3A 1WD5A 3KLBA 1KO8A 4RF5A 4DQUA 1GGHA 3MR2A 2H1HA 2J9RA 1E1KA 1SUAA 3BXXA 2PJZA 1G1MA 3D3NA 4V2IA 2VEOA 3QUAA 4XZ3A 2PEYA 2M05A 2RHDA 1XK5A 2UVPA 2H4YA 2MINA 2OSBA 3PD7A 2XEDA 3LKVA 4LXUA 4HDSA 2I7CA 5DW3A 4QGBA 2AKEA 2IEDA 2IHNA 4DCCA 3UA4A 3DT6A 1I1HA 1E1RD 2GAIA 2PV0A 4A3FG 5KG5A 3L84A 2JAHA 2YMQA 4FNMA 4LC0A 4RELA 1SVIA 2X3FA 5LN1A 1QFMA 4E22A 5F1KA 4G0NA 3MCZA 3NDIA 1IUOA 2FN3A 2R66A 2WKSA 4B7CA 1QF7A 3NUAA 2AR0A 2V7PA 5I4BA 1ET0A 2XUJA 5E2AA 4QWDA 1CUSA 4NJEB 1H6DA 1GUAA 2XECA 4HLCA 821PA 4JB8A 3OPVA 2H5LA 3U26A 5JAOA 4MHTA 5B1DA 2D59A 1MW9X 1PU2A 4RM2A 2WE7A 3VPXA 4N5LA 1U98A 4IIJB 4QUJA 4IJUA 4HGOA 1P0MA 4Q34A 2O23A 1UJCA 2EW2A 1QV9A 5JYDA 4KAAA 1T9GS 2XCSB 1QU3A 4JVLA 4K86A 5EJFA 3K4PA 4ZAFA 4RABA 1EB8A 4JXXA 1SM4A 2EHDA 1EVZA 3RD5A 3R7AA 1TAQA 3H1GA 1GQYA 4GZ5A 2W6ID 3C70A 3D0KA 4P83A 1L5LA 5FD6A 4JYAH 1QIIA 3KVVA 3FOBA 2PSSA 4MV7A 1T2AA 2J7PA 1KT8A 1N3LA 1T9GR 1N2SA 4JI2H 4UVDA 2AIRA 3STYA 1C9MA 1BVHA 3QKSA 3RHTA 4TZ0A 5EIFA 3LFHA 2KBEA 3I6ZA 3ZXUB 1YB6A 2WWTA 4OUKX 4QL3A 2PSHA 2G88A 1H69A 3HM9A 1JPNA 1VL2A 3T1HH 2VCHA 2QP4A 2Y92A 4Z0HO 4P3OA 3BXOA 1O5OA 2I33A 1UAAA 1OGJA 2M6KA 3FOFC 4C0JA 4LJ8A 4WESB 1XTVA 2F1OA 1QHHA 4D44A 3LECA 2AU0A 3KYJB 4X54A 5JYCA 4RHUA 3KTAB 5LP6F 4NOJA 4EKNB 4O2LA 2A33A 3K2QA 1T3NA 1O03A 4PLWA 3O3CA 2INGX 2COIA 4QYMA 3EYWA 3JS5A 4NBRA 1JLLA 2OK8A 4YRRA 3FPSA 3RVOA 1TUEA 1K5DA 1D2HA 3FPLA 1EGMB 1ZGGA 1CIJA 1TM4E 3QOYA 2Z30A 2EKZA 3AK4A 4CG0A 1QOPB 1OKKD 2J0VA 1ZNYA 4FBMA 3WWDA 1WZEA 5AOBA 2YWHA 2ZWOA 3COWA 5KQRA 1DUVG 2O2CA 1USWA 2A4KA 2W93A 3EOAI 3CW8X 4DCTA 4EFKA 2DX7A 3C7TA 5FXMA 5DM1A 1H1LB 2OLSA 4DL5A 2BFDB 2JJYA 3CWZA 2JCSA 1EXMA 3NXKA 1BXRB 1JHYA 1OHHA 2A1IA 1Z2EA 2E4UA 2WWRA 3GL9A 1B74A 1RHKA 2XKBA 1EX6A 3AJDA 4IJKA 1YDEA 2WWXA 4UXHA 4H6XA 1Y8ZA 1UDRA 3RH0A 3MJEA 4P81A 4AY5A 1AC5A 5JMOA 4BO9A 3GFPA 4EIWA 5EE9A 2OXRA 3SEAA 1P8AA 4UNNA 4MQEB 4YJ3B 4ARZB 4YPVA 1LCIA 1I13A 2HIAA 4WGFA 3M3HA 3OJEA 4ALMA 1FEZA 3KB2A 4R8MA 5KDLA 4KN8A 1OA1A 4GKJH 3ZNQA 4DM4A 5DEOA 4DLTA 4E46A 1GTSA 3O47A 2ZSDA 3IAUA 4PLGA 4L3OA 3L7AA 5JCJA 2C9CA 3LLVA 5JZSA 3IIEA 3VYRB 5D85A 1W9HA 4ECQA 1YZGA 3LT0A 4L9SA 4M1KA 4P4LA 3JQDA 1L1FA 3WLOA 4BVHA 1CUCA 4WSOA 5AVYA 4QTTB 1XL1A 2QG4A 4C6HA 2KW5A 1Y98A 3IPLA 4YQWA 2GRAA 1E3WB 4N12A 2WNHA 5ALXA 2CJYA 3PGA1 4FFSA 1FJGB 3PF8A 3PYLA 2IY8A 1F6BA 3KXLA 1L6RA 4W1QA 4N8DA 1SCBA 4LTNA 5CVJA 3N8IA 2QD2A 4J0KA 5ALIA 5HUQA 4L95C 2PANA 4BUZA 5BMOA 4R9NA 3E7FA 2E4XA 2YCLA 4YT4A 4RB0A 2Z2XA 1RXCA 1RRVA 4G3IA 4PO9A 5MN6A 3A4LA 2IH4A 3BH0A 2VBIA 3EVAA 1PYDA 3LPDA 3PEVA 1YRAA 4IDOA 4RY9A 5JALA 2G04A 3ND5A 2MWMA 4M0MA 2DQYA 3A14A 4RTJA 3SS8A 3C7DB 1GGFA 1K9VF 1NDQA 1X1TA 2GWHA 3I34X 1QO0D 3UUFA 3CMCO 5CFZA 5I3ZA 2ATIA 3T3MB 1B8VA 1L5SA 2IW1A 2ZXFA 3KOXA 5E9WA 4CL0A 2R8KA 1UJ5A 1XMPA 3RAGA 3VPAA 3BGIA 4WV3A 3G1TA 4OXXA 1HFJA 2EERA 2J33A 1J9ZA 2CNNA 4UE2A 3FFBA 2JEFA 2J9XB 3RBEA 3OLCX 2CFIA 2O8BA 4UZFA 2Q6IA 3PQDA 4KXQA 3GFVA 1C0EA 1Z35A 1KEUA 1IB0A 3KYDA 1K08A 3UQ8A 3DO5A 3W6OA 4ZAZA 1U0LA 4IQ0A 2F1HA 2G4CA 3P94A 2YINC 1TADA 1PE0A 3SXJA 1BVRA 4KIWA 3RU3A 4U63A 3IQFA 3P2OA 6AT1A 4BX0A 5M29A 2ZJFA 1S10A 3LT1A 5HWSA 2QRNA 2VQFH 2VN8A 2CJWA 2XVMA 5TF4A 4PSKA 2FPRA 1ZC4A 3A6EA 1GSHA 1P39A 4Q18A 1EXDA 1V2HE 2WD7A 3BFPA 3G7NA 3SWWA 2UXCH 3CX8A 5IP5A 1T4BA 1G8AA 4N3AA 4XDHA 3R5TA 5I5SA 4CPDA 4D5EA 2GRUA 3DDWA 5DXAA 3Q9SA 1MO6A 1MT3A 1KYIA 2NVUA 3DZKA 4AN1A 5KC8A 1B4DA 1WM1A 3WLEA 3O3NB 4BN4A 5F7OA 3E48A 2GN2A 3P9RA 3BL8A 4RUCA 2ZPUA 4N01A 4O5OA 3EULA 3S2SA 5LZ8A 4LY9A 4TLEA 5C46F 4E5UA 4A36A 5D01A 4QIWE 3WGZA 4BFLA 4NZMA 2MCFA 3RSCA 2PXHA 2O6LA 2YXBA 3ITNA 3UM9A 4YRJA 2AJDA 2R11A 3K2BA 3EPHA 2QEQA 2BFWA 1WDMA 3A1CA 4Q66C 2NMVA 2D7CA 2EIHA 4MPTA 4XEHA 5KFWA 1L8LA 5DRYA 3OY2A 2DLCX 1KORA 3I39X 4QUHA 3RFCA 3JWIA 3KCQA 3BSWA 3V8QA 3MRXA 2K4MA 3NDBB 5TMBA 1E2HA 1LPPA 1CYEA 3HC7A 4OJQA 3GZNB 2BKEA 1DOAA 4Y2GA 4MICA 3QY9A 2C2RA 2X0SA 4RNMA 1DKUA 2AL7A 5LQDA 1LK7A 1WP9A 3H84A 4HSEA 1L7QA 4C5CA 1U2DA 2JAXA 3CUKA 2E1PA 4A16A 4B32A 4DXAA 5EJ9A 2W6OA 3HDQA 4H6WA 4PO3X 2GBCA 3L41A 4A3SA 3E0XA 3EOZA 4U9IS 5TR9A 1T3SA 4GWGA 2I6TA 2Q4EA 3K5HA 2E5LH 4N5HX 4CTOA 4F86A 5C5JA 2ONYA 2A1TS 4PZEA 3KZOA 1N7GA 2ERXA 4M9ZA 3HBFA 3D6MA 1B6RA 3IP7A 4ZOAA 5GV8A 5TEWA 1ZI9A 1IDOA 5CB4B 5BSRA 2P77A 2PRZA 4MWCA 1BDMA 3N2KB 2E18A 1R2QA 5DNVA 1R4MA 3T6KA 4LF7H 1LVGA 2OV4A 1C1XB 1H85A 2AG5A 2FW7A 4ZIRA 1LA2A 5FH9A 1V1MB 4NU6A 2OPBA 2GS9A 2FPOA 4OOFA 3TIIA 2Z8YM 3LPNA 3SZGA 4MEBA 3D6AA 4BJ3A 2DCUA 1IZ8A 2R8YA 4ND1A 3SVTA 1MA0A 1UIRA 4P3XA 4RHCA 2DFVA 4DR2B 1A3CA 1A4UA 1IEXA 1R6TA 3DZBA 3MFIA 2H2FA 4BBZA 3I8OA 3RYFB 2E4VA 1UQUA 3G17A 4FX5A 3NTQA 1WSAA 1JAXA 3T7CA 2QD1A 1T2DA 5KWJA 2JC3A 4DJDC 5LYJB 4J0GA 3NWBA 3KXPA 4KW7A 5IC5A 2IYTA 2XADA 3SM3A 3C0KA 4YUYA 3OKFA 3I73A 2J6SA 1J2YA 1ZGZA 2WG0A 3FI0A 2DWOA 2J5RA 1GA4A 5H83A 5C1PA 3S28A 4DNFA 4LV8B 4O4JB 2UXDB 4HWRA 1F0KA 2GF0A 3LQ1A 2B98A 4MQFB 4BP1A 2BCEA 1PZGA 1J39A 1CR0A 3P0FA 5F7XA 1ODSA 2HDOA 2QE7D 3A3YA 3HB4X 1TT7A 4W9NA 4Q9JA 3HXOA 2P75A 3W1BA 4F6RA 2VRNA 2X8JA 3IP5A 3ZQUA 3PRHA 1G66A 3L6OO 4C3OB 4Z9AA 1YO6A 1GTMA 3A3NA 1E6LA 3LXMA 1G6Q1 3QFFA 4X1KB 4OHWA 4YYZA 2UYQA 3HKCB 3JQ7A 1M1UA 3L7IA 4OVKA 1ZYUA 2PYDA 3HCDA 4N40A 1VP9A 4DCJA 4F4FA 2YRWA 5C8YA 1F4VA 2HNBA 2XQIA 2P4HX 3M3DA 5IAOA 1BMQA 5U4XA 2PKRA 2RHBA 1E3LA 1IOVA 1HO3A 2FYTA 3H83A 4K6GA 1K8XB 1TCCA 1WB6A 3G0DA 4I99A 5HF8A 1YD7A 3HM2A 3QOWA 3OFND 1FFXA 1A3GA 1EX1A 3H8VA 3SHQA 4X65H 2Z4RA 1KSGA 1NUUA 2D8AA 4JBNA 5DN9A 4DHEA 3JAWA 2G70A 5AH0A 1CQJB 1REQB 1TW3A 4M99A 2KWIA 4PYQA 4XA8A 3MWJA 2E5FA 2Q8PA 3LUCA 4OHKA 2WTBA 4WXHA 3ZHZA 1THGA 2WRZA 1EUDB 1FTYA 1RAIA 2Q2VA 3ZWPA 4C4YA 1LGYA 2V6MA 2XB2A 2BFEB 1E9SA 1UWCA 4HEQA 4QJ3A 3KKQA 2ODAA 4WVFA 2WTUA 1MW8X 1DEXA 1PCXA 3DBHA 5ALFA 4A8TA 2R4TA 4FU0A 2G08A 4KYTA 3GG2A 5LQSA 4BLSA 1CFZA 1WD7A 3PKJA 2Y93A 4WLEA 3PLAE 1CBUA 3P9YA 3G9ZA 1NUHA 1M2WA 1Q83A 1U94A 3EFOA 3NBMA 4ND3A 1BXGA 5KREA 1A2KC 3FTFA 1DCKA 1FQWA 3ER9A 4W8OA 2JRLA 1JILA 3OQVA 3P19A 3OZCA 1MC8A 2GKOA 4RCYA 1EFVA 4TVBA 3SHFA 1BFKA 1R9MA 4ZODA 2VLIA 2CLLB 4OAPA 3SHOA 2CHUA 3IIJA 4UW9A 2OYCA 1RQRA 3QU9A 4P4UA 4EX6A 3IMKA 4RHYA 3TGLA 4D3YA 2SKEA 3RTCA 5J58A 3E61A 2VXCA 4RMNA 1IMJA 1KAOA 2HRDA 2PLWA 3OX2A 4LV5B 3UIEA 2CYBA 2OR3A 1KDPA 1VCIA 2B4AA 2CKZB 3DBLA 2YC4C 4JROA 4NPHA 5EVCA 2EZUA 2DSTA 3ILHA 1Q16A 1KI2A 4LZOA 3C8DA 3OZGA 4G2NA 4NE2A 4P4TA 1PR9A 1T94A 3UAZA 2P6NA 4BN0A 2Q9BA 4H7FA 3RUFA 1LDGA 1XSEA 3U7GA 1FJ2A 1ZR2A 4PLCA 1ZH4A 3QVGB 1DEAA 4E88A 5E1BA 3RU9A 1XEAA 4BVEA 5E2BA 1AKQA 2ZWPA 4N9QA 4HBGA 1TIBA 3RB8A 4ZDIA 5JAMA 4RD2A 3AL0C 1G0NA 2RF4A 3RBXA 2J59A 1N57A 2QVBA 5CHEA 3K2EA 3QE2A 2A9FA 2HF9A 3R7DA 5KFQA 2OQ2A 3U48A 1N2XA 4O6VA 4QSMA 5KG3A 1X1AA 4A3IG 3EF1A 3V3KA 1E0DA 1PR5A 1ZD8A 2QSUA 3DDCA 4YQZA 3DNPA 3SLGA 4L4ZA 1A7UA 3QXXA 4F97A 1XVVA 5ARBA 3I53A 3NONA 1XHEA 2FWAA 4EW6A 2I6FA 3H1PA 4O2BB 4PYMA 1Q1NA 2X1VA 3EHDA 4EEZA 2VPTA 1SZDA 3UA3A 2QN8A 5ADWA 5KVSA 3PBKA 2EZTA 5TQ0A 1PD0A 2ZCUA 3BWCA 4OQNA 5IJ9B 4A3KG 2Y0BA 2OQIA 2YX1A 4GC5A 1RXUA 1YBFA 1E4EB 1QBKC 1NMYA 5SV2A 3ZR4B 1P7VA 1UAGA 1QZUA 1WS6A 2WDZA 4CKZA 1HT1E 2OVBA 4YJGA 2QY6A 1KJYA 2BIFA 2IYOA 2ZBGA 3I01M 1JIKA 3B5IA 3AI2A 3Q8XB 2A1HA 2QXYA 4WOCA 3TZLA 3WB9A 2YU9A 4JWKA 5TMDA 4ZOCA 2W98A 1OW3B 1SBQA 1SZCA 5BSMA 3LZDA 1C3LA 2WMOB 2QRHA 3DE2X 2Y0DA 4JMPA 3G9QA 3NV7A 5HMMA 4YQEA 1RWXA 1Y82A 2ORWA 3AM1A 1NOJA 2D6FA 3MPOA 4B6OA 1CUDA 2L69A 1OYVA 1LQ2A 2XE6A 3PO3G 1THMA 1Y6QA 2ZYUX 3O1JC 5IJ0B 3CQZA 3OA2A 2P9GA 2DPIA 4HN9A 1TMKA 1ECFA 2N75A 1KWGA 1DX9A 4OM7A 1AKNA 3KKNA 3QKTA 4IFBA 1JFTA 1SHZA 2F90A 2G72A 4CM8B 4HATA 4JNKA 1A9TA 2UKDA 1QVZA 4IDGA 1W85A 1ZJ5A 1N6HA 4ARUA 2IWRA 2J85A 3SYKA 5JLJA 1QF6A 3L4KA 3AVQA 3LM8A 2H1CA 4G4SO 3P2YA 4J7XA 4Y98A 3SOZA 3M9NB 4DV4H 3F1LA 1RZRD 2A9OA 1ZL2A 2ZYAA 3BTUA 4TV9A 4PSVA 1SVSA 3ADBA 1CUZA 2IS2A 3BG5A 1T0PA 5E1DA 2H0QA 2O0JA 1CT9A 3Q6MA 3HCFA 4FHZA 4QAJA 1GV0A 1KNQA 1Q2UA 1TYZA 1BHSA 1ZX1A 2P27A 4BYMA 2I91A 4X94A 1YZQA 2YWBA 3CBQA 1GPWB 1K6EA 1I6MA 4FXPA 1Z5OA 1GUFA 1UXGA 3KZKA 4Q4LA 5DNWA 2ETVA 4OU5A 5KFNA 1YQXA 1P45A 1DGQA 2V9WA 4UDXX 3WTBA 4A8JA 3PFWO 2VP4A 4EUEA 1KOGA 3U3KA 1M6VB 1NHWA 1G6OA 1PG2A 1RMYA 1TO6A 3M9WA 4NEQA 2JI4A 1QG2A 3K8ZA 4TL6A 4XIFA 4Y7CA 1U5BA 2D7JA 1R27A 3QVVA 3G2QA 3DSRA 4YJHB 4H7IA 1ZMOA 4AZ0B 4BKPA 1UEJA 2Y4OA 2H17A 3O73A 4N9WA 4GR9A 3ELBA 3A6KA 4QXOA 2A4MA 3PNVA 2VYVD 1YCGA 1EFRD 2W70A 3DOIA 3N2ZB 4GDFA 3USCS 3BK7A 4B83A 1GNTA 1V48A 2JBWA 2L18A 2R6GA 2BEWA 4NDNE 1RJ9A 2O0MA 1DO0A 4EAAA 2QPLA 4GOND 3PDUA 1GPUA 3U3ZA 1NRWA 3IAHA 2RFLA 3L7CA 4OJTA 3IJRA 4Z54A 5EIWA 2Q50A 4E4TA 1Y42X 4RA6B 1CS0A 1S0MA 3IULA 5EMNA 2WU0A 1MQSA 2MOKA 5J2TA 1SVNA 3IUBA 3OC0A 1K7XB 2WUDA 3A6PC 4IX1A 3VPBA 3P2IA 1G6KA 2F64A 3K9GA 2DQKA 3SX2A 1E1NA 3MWDA 5CFNA 5LMNH 2PV7A 3FJYA 4UHKA 2R9VA 4EUKA 1QIDA 4TTSA 4EYQA 3M4YA 1Z3CA 2CFTA 4IKEA 4QPPA 1GZ6A 3T52A 2GK7A 4GI3A 4N03A 4LGYA 4DYVA 3DYBA 5CA1F 4IR1A 4NKRA 2AHRA 1QK5A 3NTVA 3MGKA 2AI2A 2C83A 4O2BF 3M9LA 1IJEA 1RYFA 2ZUTA 3GP8A 3HN2A 1T36A 4BO3A 1B1AA 1N1DA 3MXOA 2EGUA 3RSQA 2FFAA 3GA7A 4PAMA 3DLCA 2ZYTX 4UEWA 1NA5A 2AR9A 1K4YA 4ZOLF 4P9NA 3T5GA 3TO5A 1N92A 3VYSB 1RT9A 3GBSA 3KT3A 3L4EA 3RYHA 1E2KA 2IUFA 4J03A 5C5CA 3EVCA 2PH5A 1N3IA 2G07A 1XG5A 4RPHA 4QW8A 5IUNC 1LWOA 4DR6B 3JZ6A 2XCUA 1XV5A 1EVQA 2FLVA 2P4EA 4R9RA 4YHHH 1CC1S 4PQEA 3W3ZB 3ZK7A 5JS8A 3ZVNA 3CURA 2TMKA 1I51A 1HQDA 1ZEJA 2QIOA 3KAQA 3QMWA 4NU8X 4U3JA 4AQDA 3V8EA 3SFTA 3NYQA 3DOHA 3PTZA 4CLHA 1VLZA 2PSDA 2Y66A 3CEJA 1XNQH 1BNCA 3OOSA 4X8HA 5CEFA 2YQZA 5KUTA 3N75A 3WAGA 1TDJA 4QOEA 4B71A 3X2SA 4AKEA 5F51A 4ZT2A 1N8TA 1UZLA 1PNTA 3OAAD 4NCKA 3KKKA 1XA0A 4MA4A 1QS0A 3A1TA 1BXRA 2RGAA 4AJKA 3H0GG 1VYHA 1X3SA 4FYPA 1N2EA 3LF1A 4O8CA 1DTWB 2W2MA 5K7SA 4AYTA 4RCNA 4CMIB 3GEEA 2J3IA 3EXHC 3RT9A 3KZ1E 1J24A 6CHYA 3E23A 1KEVA 5AVZA 1U28A 3AERA 3ZC3A 4F4ZA 2J7KA 4K9KA 5JDCA 3BAZA 1R8SA 1OROA 3VXKA 5HCUA 2ZRLA 2IY9A 3MD9A 721PA 4PBTA 2BGLA 3EWSA 2UYYA 2Z4SA 1IBLH 1DAOA 3CR7A 4URHA 3N7TA 3I64A 3TIVA 3VSDA 5HM6A 1QKIA 2CMHA 1XCPA 3EXHB 2X1MA 2JH3A 3P9XA 2A0KA 5T8KC 5KFPA 4MGYR 3CUWA 4X24A 2FGJA 4P54A 3HI6A 3VBCA 3DW3X 1KOJA 2VRBA 4DHWA 1XZHA 1GOTA 1WMSA 2FEOA 2JASA 2GVZC 2KHZA 4XH9B 3T0FA 4G4SP 1N5JA 1V3TA 1RWMA 2ASLA 5H3CA 2HRQA 3LT5A 1A98A 5C0OE 3C3MA 3IAS1 2VHCA 2FFBA 4LVNA 1UFRA 5LQCA 2K2WA 1MVLA 2PRYA 5AM4A 4BXOB 5C3EG 4FZVA 3ZCRA 1ZK1A 3JXEA 1O96A 3IVGA 1UT8A 3KKEA 1ZVMA 2FA9A 1P1IA 2FSSA 1EVIA 2OCDA 1GGJA 3KWLA 3OEHA 4O2AA 4A8HA 2E55A 3L4BC 4AMGA 4PWYA 5IFKA 2NOAA 1U9IA 2O3SA 4LXYA 5GONA 3IEIA 3GMIA 4QVKA 4NY1A 2V5UA 1GNPA 3A4IA 5FUMA 2R7KA 2Y77A 1ESZA 3WGOA 3EPPA 3W77A 2BHRA 3GLGB 2MSEB 3N6XA 2PG3A 2BJWA 5L3QA 2DLDA 1Q57A 1FX0B 3AKEA 2ZS8A 3EASA 1E2EA 5HKBA 3KQYA 2O8FB 4ARSA 5HZKA 1Z2NX 1MAAA 2WWWA 1ECBA 1U9ZA 4F50A 4KIGA 1DKOA 3PDWA 1G2WA 3EYYA 4PTYA 3VNRA 5F9NA 1UWVA 3TIFA 3DEFA 4W9MC 2IH2A 3NYIA 4FFOA 3ENNA 3IIKA 4LHZA 5KFFA 1P2TA 4FNOA 4UMFA 1VYVA 1QH8A 1RLIA 5ER6A 1KRWA 2Q9UA 1G5PA 3G6XA 5F1OA 1XRLA 5FPOA 2PIAA 4CM3A 1KY3A 1PTJA 1VGRA 1ATZA 3TM5A 1XRNA 1U2RA 3AKCA 1KMMA 4A4DA 4UUQA 5H81A 2A67A 3DBOB 3ZY2A 3H40A 4US1R 4UOEA 1N0HA 1N0VC 4FOTA 1Y8RA 1GZ3A 4FXOA 3TL3A 5C1DA 1H9CA 3WNCA 5BQFA 3EAGA 3EE6A 2XUDA 2BEUB 1JQLB 4UHFA 3V6HA 1H0HA 2IP2A 5U1PA 4CCSA 2G82A 3CN7A 2WE6A 2D2EA 1QGUB 4PO8A 4RDHA 1O97D 4NYEA 3GO4A 1D9ZA 1CUUA 5EQJB 4BQNA 2HIXA 3FIUA 5GM2A 1IONA 1BN6A 3HR4A 1T2CA 4O81A 1XF9A 4LTMA 1N2HA 5FOQA 4V39A 1G8KA 3EIOA 1YR9A 1RPTA 4G26A 1FFAA 3ZI4A 1Y4AE 3NPMA 1U8XX 1V7CA 5CURA 4J16A 1OBFO 4O4LB 1TAEA 3RVQA 1DAGA 2FDRA 4D9IA 1XQYA 4EYOA 4MJLA 2GNOA 2XE7A 3FNEA 1XPRA 5IWAH 1QBGA 2XUPA 8LDHA 2GSDA 1DC5A 3MR5A 1QHYA 1Y1KE 5AK0A 1Q77A 3FRIA 3SHVA 1EHIA 1J1ZA 1VTKA 2XDQB 1MABA 3DVAB 4I46A 3LY9A 1PL6A 3IDAA 3BEOA 5EESA 3KFLA 4ED3A 4CFZA 2HDWA 1Z47A 4QIHA 4B2IA 1JEYA 5PNTA 4DAAA 4IDPA 1WIWA 2NM0A 3DR5A 3FZYA 2BI4A 2IPOA 4AMBA 3FWYA 3QE3A 4UTNA 2TMYA 4X1KA 2R85A 4PSCA 2EJ2A 3HNPA 2X77A 3PCRB 4JASB 2NQ8A 1B2LA 2AJ8A 1Q3TA 1JEAA 4X90A 2X13A 1QKJA 1ZSVA 3FUXA 3AXTA 2HJHA 3LL7A 4J76A 2TMDA 4Q9AA 2OM6A 4R2MA 1JQKA 2XXJA 4ZT6A 2H2WA 3HCRA 1Z4OA 2FWBA 2JGMA 3KLOA 3NH6A 1CHDA 4PLTA 5CT8A 3JX9A 4YV1A 2F8TA 3FYUC 1LWNA 2CWWA 4E1VA 1JPVA 4EBFA 3KPJA 1JG6A 4EEXA 5LR6A 1IATA 1XRPA 4Q37A 2C5SA 4OXIA 4WA8A 4YP3A 4OHYA 2FWMX 3MJFA 2Z0MA 3CRRA 4PFKA 4EYEA 5HR5A 5IKPA 1KDVA 4E2XA 4RACA 5B37A 5IMBA 1WMEA 3LRXA 3P9KA 2C7BA 4RA6A 3BXZA 4BXXG 3U0VA 3ICWA 1IN4A 1QDEA 4RLQA 1FFHA 5A6VA 4XSHA 4HNVA 2IYZA 3UZBA 1TFUA 3DEAA 1R4NB 3EDQA 1LK0A 5COQA 3IV7A 3AKZA 1ID8A 3MMZA 1M8KA 3E9CA 3FPEA 4DV6B 4Q4HB 5T4EA 3EVTA 1VHWA 3HVHA 3UV7A 2QN2A 3AYXB 2E82A 3JAKB 3DPIA 2V98A 4UTRA 1GTZA 1S3FA 3WADA 4BY1G 1BJRE 1Y34E 1TX4B 2DQ4A 1G5FA 3HKBA 3INRA 3OMLA 2Q3MA 2UYCA 4UCXA 3VYTB 4QM6A 3T9BA 4IRXA 5J4LA 4IMJB 3VPFA 4BQSA 3C74A 4IW3B 2IA5A 1EAYA 2B7CA 2J9FA 3CX4A 3MNFA 2AG8A 3NALA 3WDSA 3WSVA 3ZWDA 3GPIA 2GJ4A 1FVOA 5C3UA 4QYTA 1JIUA 1BEEA 5T4FA 3UCXA 3UC9A 3CYFA 1SRQA 3JZDA 3K1TA 4MVJP 1XD8A 2R25B 4KKVA 1OR8A 2OGSA 4ZVTA 1SOMA 2FEMA 4CV1A 1CZHA 1PT8A 1FX1A 3FD8A 4TV9F 2H2AA 3NM6B 1JGTA 3PPXA 1LQUA 1TLTA 1YZLA 5KFGA 4QM7A 1YXMA 1BJKA 2FWIA 2KJQA 4RZ2A 4RV4A 4TYMA 4JC8A 5HF5A 1WL8A 5JRDS 2B5WA 4G2TA 1XDUA 2Z8YA 1BHO1 2LUOA 3KM0A 5TRTA 3HLYA 2ST1A 2VUMG 3AWDA 3L92A 1A8SA 3LUJA 4R31A 3BH6A 4UEJA 4UM8B 1E1RA 2FVYA 1SIOA 3TQRA 2W00A 1P73A 1I3KA 1RU3A 1NIJA 3J81A 3BIJA 3L0PA 1P2VA 1ZP6A 3DZ8A 4GHWA 4HDCA 4XOIA 2QL7A 2PU7A 4ZRNA 2VP0A 5LC1A 3WL6A 2N46A 1AH2A 1GNLA 2PPLA 3AV3A 1WKVA 1GZ4A 4L5AA 1TJ5A 1T3ZA 4J2OA 2OZEA 4L9RA 5EWEA 1S7CA 2PA0A 3IH5A 5IHXA 2R5FA 2BEJA 4LFAB 2GWRA 1L3CA 5EHNA 3REGA 1CEQA 1NNLA 2WF9A 4MVCA 3V7WA 1YACA 1PG0A 4HFMA 2O3JA 5BYBA 2FG7C 1N5IA 3LHFA 4P22A 1K6JA 4OI4A 4LDQA 4BBAA 1WUIS 5DHFA 4C22A 1FNCA 4N0QA 3L02A 3Q8LA 1RXSA 4EHNA 4CGZA 4P86A 1PLKA 2RHCA 4O0MA 1HNZB 1U7OA 1QHEA 2AKYA 1WXXA 4EGCB 4MCIA 4XVUA 5F2NA 4INJA 3GV5B 3LIPA 1Z5PA 1KSFX 3C3CA 3CNEA 3W4KA 1VKNA 2Q1UA 1OXUA 3AF4A 4DUGA 2AB0A 3FHCB 3JQQA 1O0BA 3LHSA 4PG6A 2V7BA 3HA3A 4ND4A 3DS8A 2NIPA 5DHUA 3ZE7A 5LP6C 5HUHA 3NXSA 5HRAA 4EKDA 1TZKA 1P9NA 3ZD8A 1NI3A 2A59A 2QKYA 4RE5A 1P8JA 4FKBA 4ZHQB 1SCUB 1P5ZB 5DK4A 3FJ1A 3ESYA 4HAXA 1AS3A 3JQ6A 4HUQB 5CXSA 2XCTB 4QBKA 3ED5A 4N3NA 2XDAA 1DP4A 2H4JA 3JD1A 1LK5A 3I0ZA 4W63A 1KQGA 2QUAA 3VTZA 1LNQA 2I4LA 4NOLA 4URZR 5GWXA 3SIRA 3VQTA 4BVJA 3B9BA 2AOTB 3ZD7A 2Q3CA 4YVFA 2D0DA 2JKVA 3W04A 5C8VA 2B8NA 4WEQA 4AXXA 4NCJA 3LLSA 1NRXA 4A3CG 4RO0A 2PUWA 3CLRD 2H4XA 5B6JA 1Z5NA 1GKYA 1RRCA 4X91A 3C8HA 5KHLB 3HV2A 4Q7KA 1XX6A 3I9V1 3MR6A 1NVWQ 2OKCA 3NTXA 1AO0A 4WLOA 2DBQA 1JL3A 2OWOA 4X71A 1P60A 2A9JA 4NAVA 2YR0A 3EGEA 4EA7A 5TQ2B 4YMGA 3UHJA 3I8XA 3PI6A 1FUEA 2IHYA 3QHQA 3K31A 1YL7A 4MQ4A 5TSDA 3GDWA 3K92A 4X7PA 3IR5A 3OCVA 5CLGA 3RRBA 4Y9UA 3A3PA 5EI5A 4DV5H 3KQPA 5HS6A 1OASA 1NR5A 2ZREA 2H0AA 2XNDA 1GGVA 3Q7RA 4JI3H 2I4RA 3RYHB 3IBGA 2A0UA 1B0UA 2YV1A 3PQ3A 2ZRHA 4BZWA 3H1TA 3JVVA 3KC2A 4CHTA 5HKOA 1GG8A 4D82A 3IQXA 1T1GA 1SU4A 4PYIA 1FRNA 2V65A 1SZJG 4YP9A 3KQHA 1UDXA 1UJ6A 2XODA 2W7TA 4MKFA 3MWFA 3PJGA 4P7GA 4CIBA 3VOSA 2VOJA 3H3JA 1ULBA 2R8EA 3NU1A 3O26A 4J2HA 3W6PA 2VR1A 4DS3A 2IX3A 5M7EA 1GYPA 2DWQA 1MORA 1RCFA 2L17A 3ETDA 5L3ZA 1TWAA 1U7HA 1KE1A 4NYJQ 1DO8A 3F78A 3FB1A 3N2LA 2WJVA 4ZV4A 1ZI6A 3H4BA 2SKCA 5JS6A 1B2RA 1L4MA 3KQKA 2BFDA 4R01A 3G0OA 3GCXA 2G9VA 4RM3A 4DL3A 2K6GA 2W48A 2WAOA 3BKXA 4BFUA 3SMQA 4NCAA 4OX9H 1WKBA 1KVQA 2PMKA 4S1OA 4OI1A 4DJ5X 2EQ5A 2FQYA 1F2TA 1XP8A 2CBXA 3GB9A 3ANXA 3H2BA 3OPYA 4NBVA 4D3SA 3LIIA 1ZICA 1H22A 4JFRA 2CLHB 1Z6PA 3HYLA 4OKNA 4WHXA 2R93G 1ZMTA 3NJRA 2WQZA 4HYEA 4UZSA 4Y9TA 3T4PA 4U0JA 3AR7A 4QXMA 2JFVA 3OLWA 5HFJA 3REQB 1QMGA 1BSVA 4DR2H 4FTWA 1FB5A 2ZSJA 4ZVPA 3VA7A 3RAXA 4O59O 4PWZA 5JAQA 2VQSA 4BLWA 1F3OA 5AXAA 5ALNA 4LF7B 3OT4A 2PMWB 4MPPA 4Q1VA 4URXR 1WLSA 1L1QA 3K96A 5JBIA 3B3GA 4RY0A 5HK8A 4UDYX 3KUCA 3SY8A 3QVMA 2OHHA 3L6CA 1Z25A 1NKTA 1U3CA 2FP3A 2WR8A 4G1FA 5L3QB 2A1TR 1SCDA 2PR7A 5E9AA 1S2MA 2I4OA 1C1YA 3LSYA 5ICGA 3UV3A 1SXJE 1ZKMA 3VUFA 2Z6UA 1BE1A 1PGPA 1U2EA 2Q07A 4B4KA 1V1RA 3PT9A 3DULA 2QI9C 1VXRA 4J6EA 4BHTA 2ZXEA 3E7PA 5DBGA 2GXAA 1N5MA 3T35A 1EYZA 1TB4A 2C5HA 2JZOA 3NVMB 3UNXA 2AN3A 2B3DA 1Q44A 2VRCD 1D2MA 2ZBDA 2W8BB 4EBBA 3TFQA 3I52A 1JQAA 1O4WA 3RIZA 2ZI3A 5IKOA 3U4MA 2JD0A 2VDLB 3QXGA 3CO0S 1U3UA 4M38A 5EIXA 1G20E 1J42A 5BNZA 1GJRA 1U9JA 3INTA 1KARA 5U4QA 3VDMA 4CM9A 1MR3F 4KQ1A 4EJ0A 1GEGA 1IBMH 4L8VA 2HNAA 5BSEA 3P20A 4O3SA 2HHFA 3D6JA 3KLMX 3OOYA 5EYPB 4B3FX 2HXYA 2PX0A 2JGLA 4QEZA 2Z6AA 1SPXA 4QJ5A 1E2GA 5DQHA 3FZQA 2QX8A 2C5GA 2XLBA 2ACKA 4I3HA 2B36A 4ZYVA 4NMLA 1EWKA 2RGWA 1QF9A 2AMVA 2PUHA 4U4AA 5TXGA 4EF5A 4Q05A 3J7AK 1ZWKA 1Y6RA 1ZVKA 3EG9A 4MEJA 4A0FA 3REOA 1N7HA 2YH2A 4CF5A 2O8DA 3G8BA 3SE0A 3DD5A 1WNTA 1QHXA 1YIAA 2KQUA 3RYTC 4HQKA 2JGJA 3ZK9A 2C1XA 4JI4H 2IPXA 1WUJS 4QELA 2Q2UA 1W0JA 1UPBA 1LW6E 3DC2A 3EGIA 1KS2A 1Y1QA 3ROZA 1Z82A 1SULA 2X58A 2XUOA 2C78A 2R96A 2PGDA 2G63A 4HUQA 4TT3A 4X8MA 4YXFA 3WWOA 4ME6A 2BR3A 2Q6VA 4PTLA 3NCTA 1M2OA 3VR0A 5CYGA 4YRZA 1XRSB 4D97A 1LUAA 2P78A 5DHPA 3IMEA 1PR6A 2WWHA 2W2KB 4HN2A 4J1TA 2VP2A 3PT5A 4LSWA 3UENA 1ISHA 1Q84A 3QITA 1T4MA 1P0CA 4ZU3A 1S8NA 3VOTA 3PVZA 4U7GA 2BLLA 3KFVA 3GMSA 1JDZA 3ROXA 1BEUB 1L3BA 5D6NA 2UYOA 3V2UA 1R15A 2E48A 4CIAA 1WSDA 2H85A 4P84A 1XCOA 3PYMA 4HEA1 3ZDAA 3Q2IA 1CKNB 3I4CA 5AJTA 3AGQA 5D3MA 3VZSA 1SUWA 1FLAA 3NOXA 2R5NA 4MI9A 3ORHA 4GE0A 4Q9DA 2PX8A 4H0FA 1WHSB 5EZYB 2Z98A 1S3GA 2RGNA 1TYBE 3D5QA 3FN4A 4MGKR 1G2QA 4E6PA 2EJTA 1F6WA 2NVXA 4RK1A 1KMNA 2XNCA 1RQLA 2QVXX 2JLRA 4RNNA 4XB1A 2NU8A 5JCZA 4TPKA 5D8DA 3H5RA 4KWEA 1H8EA 3ND9A 5FNVF 3PW4A 1I6WA 1YJCA 4J29A 4ABYA 4G5OA 4ECZA 4UHBA 4X45A 5D5QA 4QOSA 1CS4C 1UBUS 5ERXA 4PIPA 4AVYA 3C5CA 3GCDA 3PR5B 2Z5LA 1H93A 5FWDA 4D0NA 2C2XA 3H20A 3B9QA 3UQYS 1RWBA 2D54A 5A03A 1Y1SA 1P0QA 4FOSA 3R7WA 4UREA 1JSXA 1L4KA 1WR2A 3GPDG 5D7BA 5FPPA 1ABBA 3EIWA 1G5RA 3PL5A 5EZYF 1DZ3A 3V00A 3LQSA 1X7WB 3O8LA 2FQXA 3IAS6 2RHWA 2BBSA 3KWJA 4RFSA 2NYUA 1LDYA 3H65A 3KQWA 3RVRA 3F6CA 4M1WA 4A2CA 4KQKA 4NFLA 4BO1A 1NJ5A 4O4IB 4DC9A 3V1LA 4PBCA 3DWGA 1YL5A 1N8SA 1CP2A 1ZNWA 2YOGA 3RFUA 4C05A 5ADVA 3TLMA 2ANCA 1MB3A 1Z8HA 3NM5A 2XRMA 3GCGA 4MUIA 5J3JA 1PK8A 5K3WA 2Z5GA 2NAFA 4JY7A 4YNBA 3IQDB 4J0JA 2CLOB 4Q3LA 1N36B 1NJFA 1QB7A 5A3JA 5K0LA 1PYOA 4JLPA 3SHWA 1CR6A 1MQ9A 3Q9LA 1M2GA 3ABZA 1J7JA 1KQOA 2A9QA 1LBQA 1HR0B 4M9QA 4PLFA 4LFCH 1K8ZB 1E9BA 1V4VA 1WMBA 3FWPA 3IEUA 3AR8A 2XYRA 3MCTA 1W8DA 2EIYA 1Z0KA 2G77B 2J6HA 4GUAA 2IRWA 3OI7A 5KTNA 2G9ZA 1YF3A 3AVWA 1K7YA 1BFDA 1P7YA 1J5EB 3ZU4A 2BDTA 3RJ9A 2FSVA 1D4OA 5G0TA 4FFNA 4QLAA 4IXMA 3KSMA 1VJ5A 2ZB3A 3UK0A 1QANA 3NC0B 1GP2A 3T3OA 5IG2A 1T0HB 2Q45A 4TQUS 2BEUA 4GZ6A 4HH4A 4I19A 5G4LA 2D0PB 3IMFA 4US0R 3L7KA 3LX4A 5K0FA 1II9A 1G7SA 2HH9A 4IRDA 1AURA 4GL2A 2P67A 3HOZG 1UBJS 4KAXA 2REQB 2CZQA 1X7XA 1LXCA 3IEXA 4HDNA 2AJCA 4ESVA 1GKIA 1OXVA 1QQTA 4ZGWA 3IE2A 1SEPA 1EQAA 2WKWA 1IUPA 2F3QA 4C0WA 3R9RA 3TVDA 4DCPA 3PC2A 4OMDA 3WYAA 4B3TH 1QTRA 4ZVLA 1UFKA 4IZHA 2JFWA 5AW5A 3SFVA 3M70A 2QNBA 4DLAA 3HO1A 5JAPA 1AZLA 4GX0A 5I8WA 4NWIA 4UNPA 4UU0A 3VR4D 2RGNC 3KRTA 3AB3A 3FTPA 4LSAA 4RTPA 7ABPA 1SVUA 1V95A 2A5FA 3PGMA 3TG2A 3V4OA 3WWJA 2Y1FA 2NZ2A 4G1CA 5FA6A 3S4YA 4HDKB 3PFBA 5A4IS 2X5NA 3M33A 4I1SA 1AS0A 3KHTA 3GIDA 1JJVA 4LS3A 1X7ZA 1PTJC 4MA0A 3O94A 5KFJA 3VKUA 4MKIA 1W5BA 2ZJBA 3LHIA 4D3ZA 1K27A 4YMVA 4ZCTA 2AW5A 5M34A 3FLBA 4CIDA 4CLEA 1BU8A 2CFRA 5TX7A 2R7AA 1S2LA 1L7BA 1FLDA 2Y05A 5KX5F 2NVYA 1IYDA 2CVQA 3A4TA 4UKDA 2SCUB 2QLBA 4BX9A 5IKMA 4GPD1 2A14A 4FDLA 3ESXA 2OWEA 4F71A 1MH1A 2OFFA 2SECE 1NYTA 2YWGA 1QIMA 4ABTA 4LWOA 1HNXH 3IKTA 2QY9A 1A1VA 3KQNA 4HR7A 1MIOA 1M3SA 3C3XA 1XZLA 2HB6A 4ZHQF 4RJLA 4O1IA 2V4QA 1QC5B 4KXWA 4AWBA 4PZUA 2E6KA 4RL6A 4V03A 3IEPA 5I5GA 3I9LA 1L5FA 3F6BX 2G5GX 2XA1A 5E7MA 1XNGA 4OQDA 1I7NA 4TOIA 4A1FA 1Z18A 4DIDA 4DIOA 1GY8A 2OV8A 4MS4A 5F7ZA 4GMFA 1CY1A 2FPPA 2QMYA 4P4GA 3BOSA 4TTAA 2NTYC 3O1LA 3KYIB 4EH1A 3FNFA 1CZNA 3HUDA 4JI7B 1L4EA 5I9TA 2FZGA 3VR5A 3BFKA 2XI4A 3JWHA 2HGSA 4KDRA 3ICOA 1EE2A 3TEMA 1PZHA 5IYZF 1UAYA 2YN2A 4QKQA 3PQ7A 4TM7A 4B2YA 4I6JA 3ZZMA 3R3HA 2W9BA 3TW6A 3K70B 2ZSUA 1CY7A 2DJIA 1AU9A 2BFAA 1WHTA 1UEXC 2NXNA 1ECCA 5COBA 2YS7A 3C3YA 1M1YA 3OZFA 4PLZA 3HO8A 1N2GA 2VQ3A 1JG1A 3PHIA 4JQSA 4NV0A 3UJ9A 1N32B 2D2VA 3R6LA 1L8XA 3B1ZA 3O0TA 5G0SA 4E15A 4EHLA 1YBVA 5GGXA 2W9BB 3W2IA 2OY0A 1UR5A 1Y8CA 2Y9MB 4LSMA 5DYIA 2NU7A 3KKOA 5CR5A 4D45A 3T5PA 4RKQA 4E4YA 2CKDA 4OSEA 1SKBA 6GPBA 4MV0A 3KTDA 1PFWA 2NGRA 1C4OA 2BSXA 1SXJC 4DSUA 4L08A 4MR8A 2VATA 2A92A 4CM9D 1ECGA 1F14A 1L5ZA 1ZK3A 4O1HA 5HIJA 4HNTA 3IMCA 5DF1A 1PW5A 2DPLA 2J3QA 1U99A 2EWVA 1ENOA 1I30A 3PTLA 5HQJA 4DPLA 4YAIA 4J0QA 2BBTA 4IHAA 1SELA 3D4PA 3VHRA 3GJ8A 2P9EA 3WI7A 1KY5A 3G6VA 4J9LA 3ZK8A 4BB0A 4ECUA 3JQPA 5DYGA 4KI0A 4QPJC 5TB5A 4EG1A 3GPBA 4LE0A 2QUBA 2ZTVA 3OEHD 4PGAA 3UMFA 2CBZA 1BO6A 4ECVA 3DAYA 1TA4A 4JIGA 5DBIA 1WZUA 3KVNA 5EQFA 5GM1A 2GH1A 4B6SA 3Q7EA 4ER5A 4YASA 2I34A 1RXWA 1OLOA 2AYZA 2Q1WA 4TYWA 3MWEA 4NZ9A 2HMAA 1FDVA 1JKJA 1NFRA 4O8ZA 2ZWMA 3WE7A 4V0RA 4P4SB 3IVAA 3GP3A 4GOKA 4O3QA 4MTLA 4M1EA 1JR3A 2DB3A 2PSFA 3QMVA 1W93A 5KO2A 2VQEH 5KFOA 5A2GA 2JD1A 4GYYA 4Q3DA 5A3RA 2IU4A 2I6SA 3MCWA 2E4AA 1J8MF 1P44A 1T8WA 3PHHA 3Q4GA 3QUQA 5L7TA 4REMA 3UANA 1O0SA 2QTCA 5CVVA 1AX9A 2NXWA 3KP1A 1NXQA 3CUVA 3K9QO 3RPEA 5KTMA 1XEFA 4OKSA 3I58A 2YN4A 1G2PA 3AUKA 3GV0A 4OBWA 4XQ0A 4QLOA 4I14A 3LWDA 1P5JA 4EMBA 2NO4A 2NUTB 2Z57A 2XMPA 3WRXC 5MN4A 4YRAA 2VP6A 2E85A 1LX6A 2PNJA 1LPNA 2AVNA 1C3EA 1M5RA 5C44G 3JV7A 3QLUC 3DB2A 2WHYA 4QBGB 3WMXA 2Q0SA 4OHMA 1F2UA 2P68A 1CZKA 3DDOA 2UVDA 3D2AA 1QIKA 3HDYA 5C53B 1JDBB 3FDJA 1GG5A 5A71A 3S7ZA 1UXJA 3RNLA 3UMSA 1RKBA 1RI4A 2VDQB 3GIWA 2B1JA 3QEMA 4XIJA 3OTOH 5KZMB 1GADO 5JV5A 1TTHA 2C42A 3HADA 3K0EA 3MEQA 5IBRA 2HHLA 1BEZA 4WT7A 3K4QA 1FU8A 1Q11A 1Q7RA 2VJBA 4GP6A 5E2IA 2NVBA 4BO6A 3WIVA 4R5MA 1S0NA 1MGOA 1VBKA 4CQMB 4QO8A 3B3AA 1USGA 2D7DA 3PQEA 2OAP1 4C7XA 2B94A 2AZXA 5FT9A 4OU4A 5DDIP 1CZLA 3M1LA 1U9CA 4GX1A 3ZXSA 5AJUA 1RYZA 2D5LA 1SU6A 2X15A 7GPBA 4IIYA 3D8NA 4UTXA 4I55A 5DNEA 4YUVA 4X64B 2QJRA 3UY4A 2PGAA 1AUQA 4GI5A 1VECA 2ZOSA 1KBQA 3NEPX 1RYHA 5AT1A 3L7JA 3W7AA 4L16A 4ECAA 2H8KA 1JHAA 3COSA 1KU0A 2JIPA 1XB2A 3H9BA 4F91B 3GBPA 3GH1A 1D5WA 4F2DA 2QL5A 1NUQA 3A1FA 3U7HB 1GQQA 2GCNA 1Z8DA 4LK3A 1JB9A 2AQ8A 2E49A 4WADA 1ICEA 1PP4A 5TJHA 3TXYA 4AJIA 4JLBA 3I2YX 3H3XA 4Z4HA 2ZI7A 1JDSA 2JFNA 2VUSA 4RIHA 3UWMA 2VH5R 2RGRA 1MAHA 4L7QA 1JFVA 1OFIA 1V16B 5T3UA 5I48A 1L9KA 1EQUA 1XZAA 1ZZGA 5EL0A 5IABA 5MGNA 2Y68A 1YJBA 3C6ZA 3TNFA 4UD2A 5C37A 4U6QA 1VYUA 1YR7A 3N44B 2WABA 3UG6A 3HCCA 3UT6A 4EK9A 2GERA 2TS1A 3KD2A 1J0XO 2V55B 3QVLA 4LHXA 4BFWA 1VRVA 5CD9A 3T9DA 1VFPA 1P2UA 3NZEA 3S5UA 5TPWB 3C3KA 4RLSA 1NULA 4ECSA 2ZRNA 2UZ3A 3BSSA 3MFHA 1LSUA 2W43A 2GTIA 2VJLA 3QOFA 2J48A 1A2BA 2WIAA 2R48A 2BGTA 2PWAA 1CF4A 4WFKA 3AY3A 2CDNA 2W6CX 4YT5A 3WYFA 3HA5A 3JSAA 2VAMA 5CH5A 1M67A 1KI8A 1BA2A 4MMYB 3W0LB 3WGLA 4NXMH 1W44A 3G23A 4O4LF 2PUCA 4UNRA 4RHEA 5J9FA 2WYVA 2FPWA 5LA6F 4I1VA 2BM1A 4RZHA 1JEYB 3NTLA 3UB4A 5B58C 1FLNA 3JASA 2BMDA 2AK3A 1NC1A 3E7WA 2GB4A 3VU9A 3N39C 4AUEA 1A8IA 2P1RA 4IJ6A 1ULUA 4XTCS 4RMJA 3DHVA 3WK7A 2GPWA 5JEEA 4WZBE 4ASUD 1DG9A 3N7AA 5DLEA 4Y2PA 2GJSA 4O2BA 4O3NA 3PW5A 4JOSA 4PLHA 1M6YA 3IELA 1RYEA 1L7XA 3U44A 4CF3A 3EC7A 3G7UA 4FYXA 1SN7A 4FQ8A 1R5BA 1ZD3A 3T1OA 2Y1WA 2ABJA 1YIDA 4CM4A 4ZI7A 3M4ZA 3DDUA 2J6CA 1N4DA 1RDFA 2PSJA 1II8B 4KLZA 3G79A 3VSEA 1C7EA 1E20A 3H05A 2Z8ZA 3V7NA 4MTEA 3GDGA 1C81A 1E58A 1OX4B 3I3OA 2GR9A 1K89A 2HADA 1RI5A 1HQYE 2XA9A 4WKBA 4Z0PA 3ESBA 1HNWB 3NMUF 3QEKA 3QQMA 1UC5B 4YP6A 1VMDA 5LCXA 3ZIAD 4MRVA 3K73O 7AT1A 1OXBB 1UBGA 2O20A 2C9OA 3HBJA 4QDKA 1YTLA 3F6SA 5FKJA 3CTPA 2GZRA 4LK2A 1TQDA 2Y1OA 4KIUA 1NTRA 1W30A 3MUNA 1UJMA 5AW0A 2CJFA 5JAIA 5LQMA 2FFRA 3S44A 4QU5A 2V6IA 1CCWA 3KOOA 5A4FS 3V4VB 1C8BA 3RW9A 1XZQA 5D5PA 1I2BA 2PS0A 2Z9CA 3U0GA 3MFYA 3VVCA 2GO1A 2KB0A 3OOEA 2OBXA 4IGFA 4M6WA 3ABSB 3M1AA 4QUDA 1TMYA 1N5DA 3LVBA 4DGSA 2WUFA 4B48A 4P31A 3L79A 5CTJA 3SNHA 1J8YF 1DRWA 4FDVA 1E3TA 1UKEA 1Y3DE 3AJEA 2QB5A 5J5VA 1AKYA 1ZRHA 1J0EA 4EG5A 2W58A 3DE3X 2BR4A 3NAGA 3AXSA 1NVKA 3HOVG 3VH2A 4AX4A 5B4VA 5BN5A 1AMOA 3T7RA 2YHBA 3NPAA 1K63A 4MITA 1NRJB 2JBAB 4HXFB 4R3WA 4ED2A 1ACJA 2FMXA 1CUXA 1ORDA 3RWMB 4NEHB 1HT3A 3T0GA 4R1NA 4CMKA 4YCSA 1W52X 3A2MA 2AMJA 2Q4DA 2X22A 3TNYA 3FTDA 1SBCA 1II0A 1I4DD 1GKUB 1HORA 4I5IA 5FNZA 4J9SA 2XSZA 5JR3A 1ETUA 3T94A 2O06A 3B52X 1U1CA 3BMOA 4MULA 1XCMA 3OECA 3QI7A 4X92A 5H70A 2JKZA 4V0SA 3H99A 3VKVA 3AP3A 2VXYA 2WFMA 2CE7A 5E1OA 8GPBA 1X42A 9LDBA 2P1DA 3KJNA 1JTFA 1L5RA 5A6SA 1NGSA 4O3RA 2VK4A 2XOKD 4XPZA 4MVJE 4IEEA 3VX4A 4QTUB 4CV0A 4XX0B 5JAHA 3UAXA 4HEHA 5F5XA 3UZUA 4GMDA 5AUNB 1M2VB 4PZ8A 4CMGA 1R00A 1LDBA 3BE5A 4IAOA 4MRRA 4XGRA 1AQNA 3O91A 2Y4RA 1KKMA 5JD5A 2VP3A 3AR9A 4W5TA 5DX0A 3KU4A 1FYVA 4DDKA 5DG9A 2GGSA 1YU6A 2P3QA 3F8SA 3OZEA 3TAXA 3UB3A 3U6KA 3EPKA 1E0AA 4I5GA 2FEAA 3MWYW 3OU6A 4ADSG 1S2IA 4MV8A 1HOXA 2AGVA 3UBMA 4BRZA 4JP3A 3RTXA 2YYSA 4JJ4A 3EAQA 3WZ2A 2QT9A 3V3TA 1ULAA 5GGYA 4CFSA 2A5JA 3FPKA 3O2NA 5KWVA 3KTMA 3DC7A 4HQRA 1G6HA 1TA9A 4ZHQA 4X93A 3P0HA 4Z7JA 1R6XA 4YROA 3AERB 4PG7A 5ESXA 1JR6A 4FQ7A 1EUZA 4E6EA 5H59A 3QBVA 2PQ0A 1ZH8A 4UCFA 4X85A 1N48A 1TQ4A 5J2UB 1RKUA 2DTEA 1I5OA 2GO7A 4C2AA 4CMIA 5AVVA 2Q7XA 1NYQA 1XJ5A 5IZ4A 2I2AA 1NSYA 1IY0A 3V1KA 3T7TA 2OOKA 1DHRA 4ENWA 1J8FA 4HFJA 4MUGA 3HBAA 4MR7A 3NANA 4E70A 1XNRB 5IWCA 4DZTA 1TC1A 2WVAA 3AM5A 2X7JA 3AR4A 5AXDA 4KR9A 4CKCB 1XZDA 2GYUA 3BE8A 4Z4GA 1QHSA 3GN2A 3D6TB 3R0IA 4ACBA 3Q40A 3ZXXA 2Z3ZA 2C22A 5CITA 3A6ZA 1COWA 2FR8C 3DLPX 2R7LA 4NV3A 3O7MA 3MSXA 1HNXB 1O0CA 2BFCA 3PNLA 4D79A 3E05A 4DMUB 1JHXA 5CA1B 5ESWA 1L8OA 3IPYA 4U7DA 1X87A 4DG5A 1KI7A 3QSYA 3A9RA 1KY2A 4ND8A 3LDAA 1OREA 3DTVA 4AP9A 4UBOA 3RREA 1BGXT 3RG8A 1PLLA 1LPSA 3LNTA 5CYPA 4RGBA 5DLPA 1QGZA 5GZ6A 4JT4A 2P5UA 1J0DA 1XLWA 4PYRA 3OOHA 1WW8A 4BATA 4W7IA 2WTFA 3IHWA 1ACMA 5IW8A 2HGXA 3LBHA 4DMHA 3L1JA 2WAXA 3FF1A 5GVSA 3BE6A 2EL9A 3FJOA 3IAM1 3NHBA 4JC0A 2IV7A 1EVKA 5AJZA 1E1DA 4WJLA 5TPWA 2QLTA 4P36A 3CRMA 3GN1A 1XCLA 2R6R1 2XMCA 1TCBA 3OU2A 4OLHA 5JO9A 3FNIA 1PJ2A 4LFCB 3ROMA 2EG5A 5CLJA 2NAPA 1IHYA 3V6KA 4GBMA 4IJMA 4E0BA 1SUIA 1MX5A 3PHCA 4EQ6B 2V8OA 2I6UA 4I50F 2Z08A 4DM3A 5DH9A 5ES4B 1M2KA 2P2LA 1DIHA 1TU3A 4CZ2A 3N8KA 3TAUA 2GK3A 1CUAA 1UH5A 1JEDA 3M6AA 2JVIA 3E70C 2GZ1A 4JL6A 1EIWA 4B1FA 3ND6A 2FSUA 1NQVA 1PBNA 1ZL0A 3L01A 3MTDA 3OF5A 2CW7A 3S2EA 1NG9A 2Q21A 3HJFA 4MHSA 4BDSA 4YCDA 3C6KA 1QH9A 4D8WA 4N7RA 3TLCA 1XPOA 1PD1A 1V8PA 2O2DA 3PWTA 3RAEC 2AUNA 2ZQZA 4ED0A 3CU5A 1TRHA 5JCOA 2B0JA 3HFGA 3GRAA 1YV9A 2WFLA 3GW8A 5CB8A 3DD1A 4JYAB 2FSVC 2DWPA 3HKEA 3K35A 4YAEA 3IP3A 3A9TA 3K9BA 5E7QA 3Q3IA 1LTKA 5I7HA 2KBFA 1IN7A 1U0TA 1XVAA 2ZRJA 3WAJA 1KXJA 2JI6A 3BXFA 3QIVA 1DMSA 4L6AA 3PE6A 5BMVB 3WGGA 4G1UC 3PQCA 4JZKA 4X97A 3JVUA 5JBQA 2I9KA 2L19A 1IUKA 5KDOA 4JEMA 3F4BA 3R3WA 4LRTB 3PGKA 3PNYA 3N2IA 3LQRA 2JEOA 2XUAA 1E7YA 1NWHA 1IHUA 3GPCA 3OPYI 3TW0A 5C4XG 1FY2A 2MU1A 2I55A 5JFOA 3LC0A 5HCNA 3AF5A 1G5IA 4IXWA 3IJPA 4U1RA 1SURA 1CR1A 1ZJJA 5D1OB 1NF8A 2A5DA 1KZ7B 3X2FA 1HZZC 3L0BA 1XT6A 1S89A 2ZE5A 3TQOA 4W4TA 2WD9A 4MB0A 3UCFA 1BKSB 2BT4A 1KGSA 2QNIA 3UAOA 5LXTB 5BP7A 1JLSA 4OHRA 5GOZA 3FDZB 2IBKA 4KXYA 5HIKA 2BR5A 3FOCA 2O3RA 2VYND 4MJXA 3BBPA 2IUUA 1C1HA 3TKAA 3O2SB 4B8ZA 2RBGA 4JI5B 1ODIA 3JQ8B 4KPUB 2H4WA 2VF7A 4Q93A 2O2GA 1RACA 4KV9A 1CYDA 1V4BA 4E3WA 2HR1A 2GBFA 3WBBA 1ZCAA 4HDMB 4MUKA 2BKAA 1RQ2A 1GU0A 2ZUVA 3Q0EA 1UBKS 4OXYA 2B1GA 4FDUA 4XWGA 4ZICA 3THRA 1NF3A 1E69A 1NOKA 3D6FA 3KT6A 4Z9FA 3S1AA 4GVXA 3R9XB 2DM6A 5LZ5A 1GT91 2PMZE 5LD2C 3CLHA 4NRDA 4PXSA 2FHPA 2I7VA 5T4BA 2BP7A 3R0ZA 2F1JA 3WK6A 4KBFA 4DT1B 1F38A 4WDQA 2FN8A 5I9MA 5JVDA 5K8TA 5BSUA 4MUNA 2EFEB 4DBVO 1HDYA 2FXIA 3A4YA 2CCGA 2X6RA 5DT2A 3CR3C 3R74A 2A9RA 1N2OA 4QHTA 4A0RA 2HVQA 3PX7A 1NIPA 1VL5A 1JU3A 1WZCA 1H2BA 2AXEA 1JDBC 3AQIA 3DMTA 3HMKA 4Q7JB 2RH8A 1GYRA 3WMEA 1TM1E 1BOFA 4OB7A 4WNCA 3WICA 1X14A 2XWJI 3GCWA 2IOHA 5LJLA 4S1TA 2P9JA 5CU7A 4LMBA 1OQAA 4RD3A 4IQ8A 1EM8B 1NE7A 4QPZA 3AR2A 5EJ2A 1PX2A 4MUAA 3B85A 1Y8QA 2YXNA 4WLNA 3LTEA 1ECJA 3GQBA 3CVJA 1QUFA 4HPXB 5THXA 3T3HA 3DLHA 2BCJQ 3UFBA 3MOGA 2AC4A 3WO0A 2PSEA 2XTNA 4RK7A 3EGDB 1I2MA 2QROA 3H4IA 4GC6A 4NK5A 4XJTA 3RARA 4G0QA 5H9VA 4PX2A 2Z5VA 1YCDA 4XWAA 1B00A 3DTFA 2HTFA 1HF3A 2KS6A 3IT2A 4GG1A 4HF7A 4OHZA 4DANA 1DQZA 2XDWA 3A4NA 2FPGB 3I9NA 3QWFA 1N34H 3GD7A 4BV3A 1E5QA 4JLKA 4DNPA 1HX7A 3HI4A 4PR3A 4S1NA 3RE1A 3L8EA 4HHEA 3K6RA 3N0XA 3U3MA 4TN1A 4HRAA 4TS4A 2VHUA 2Q1SA 3L0IB 4PRZA 1XYYA 1BDJA 4FFBA 4GMGA 4WOJA 2WIGA 3JSXA 4W6ZA 2DQSA 5EUMA 4BRSA 3I4FA 5DYWA 4YACA 2BI7A 1IN8A 3DKPA 4Z4FA 1KJZA 4IIEA 1H1TA 4GOMD 2B61A 2WB4A 3NC1C 4XCQA 5ADHA 1UPUA 3AESA 3EIXA 3O8QB 3PHLA 4QU0A 3BJZA 1CB7A 3INYA 4MP8A 4OUDA 1RJGA 3QENA 3VR3D 3PUWA 5ALKA 5GADl 1DVRA 2Q5HA 5BV8A 1SXQA 2HDHA 4GKJB 4JI7H 4XDYA 1TXGA 2V9CA 3MUOA 1KQFA 2FWRA 2G09A 4YAJA 4UTOA 4ZQGA 1MPXA 5CCXA 2V7XA 4AB1A 5D3KA 4CF6A 4OP1A 4XPIB 5K9ZA 4EO4A 2JJ1D 5AKGA 2OMKA 3IO3A 5H0IA 4EYKA 1DKNA 5BQXA 4RPCA 2JAUA 4TQSA 3D7NA 1DKRA 3H5IA 1N4AA 1FFXB 4LG1A 5FL7D 4DY6A 4HNSA 4YJ3A 4ARZA 2HFJA 5CW2A 2PYZA 4DL7A 5ECYA 1JJAA 2PGXA 5JPCA 3LCMA 3R41A 1GLVA 3ORQA 1LDNA 1OV4A 2Y1KA 3AWIA 3B5EA 1V1JA 4NNJA 5F64A 1AZWA 1DS6A 1E6MA 1P6QA 3N2YA 1M8GA 4L8GA 2VYFA 4OLFA 1CD5A 1HKUA 2W8LA 5DRTA 2HUNA 2YHAA 3E8SA 2A5YB 4IMRA 5D1NA 1H3EA 4TTTS 5J2UA 1XDDA 3HQ4O 4WCFC 2XYVA 4YB8B 10MHA 1ECPA 5FAKA 5LU8A 3KT0A 5KVQA 4F5DA 1SHUX 1L7AA 2F2TA 2PAFA 4MQFA 5FLYA 1I5RA 2PVCA 5H4GA 5E0OA 2Q0QA 2DWCA 2GQ0A 4Y9DA 4G5SA 3W1VA 4GLWA 1MDFA 3WKDA 3WLIA 3S2GA 4HUTA 2XCAA 3GH3A 1SWWA 4B75A 4YY3H 4U6PA 1EP2B 2WPDD 4EJMA 1YS1X 5JSQA 5I7VA 4WCVA 2YFHA 3CHYA 4PEVA 4LUCA 3ZHYA 1U7DA 4Z4QA 1XZJA 1COWD 1WPRA 4IJWA 4PRKA 3QE9Y 1W5EA 1O8CA 2XTJA 2FMFA 1JW9B 3H8SA 1QG0A 1IC6A 2ZQ5A 3ZQJA 4PPQA 4UCRA 2VUIB 1KQPA 1MX9A 4KWCA 4PQGA 1TJYA 3WA7A 3U61B 2IU3A 3PPYA 4A92A 2RGDA 4YALA 4KMRA 3SVLA 4L02A 4JXJA 5EJAA 1D2EA 4NHOA 2WZBA 4IOKA 4KQCA 3QLUA 1JXOA 1O94A 1FNDA 3P0RA 3GTQA 3MTGA 4EHHA 2R8JA 3D81A 3KQTA 4DREA 4ETWA 4IG4A 1XPUA 1QYVA 2Y3IA 3NBXX 2QHXA 5AM1A 1Z5GA 1C1DA 5AXCA 4XVQA 4DC0A 4PBSA 3EGXB 1E0SA 3VUEA 4E5KA 2WK1A 4B33A 1OT3A 4KVAA 3RG2A 3IILA 1L4UA 4R84A 4ANFA 2HLDA 2QU8A 2DT8A 3M89A 4BKRA 4IS3A 1WDLA 3T95A 1PZEA 4DLWA 3OLQA 1E3QA 4LF5B 4ZCLA 1GGKA 2DTXA 4I4TB 3ZGNA 4EELA 3JQ9A 5TQJA 4KPFC 2JHFA 4Z53A 1V9PA 3UHAA 2WG2A 1RYNA 2P2NA 3V48A 3VSAA 3QHAA 2YZMA 4YMUA 5ALVA 1KEEA 4LC9A 2HSJA 3COPA 3K30A 1OHHD 5AJWA 1QYDA 3TMKA 4QULA 3TQTA 1Z6QA 4G0ZA 4X3PA 2Q6OA 3B1XA 4ENUA 4B2PA 2WD8A 3TTWA 4JT2A 1H3NA 4FN4A 4WKOA 1QXSA 1R0WA 4IDAA 4MTDA 4D8UA 1YL6A 1UL1X 2VF4X 3PEYA 3N5CA 3ENVA 1AZTA 1X15A 3E3AA 2OWDA 3WFJA 4RD4A 3GOQA 3GZNA 4HWOA 4M7PA 4N3GA 3G6KA 4IHJF 2Q4TA 4YLEA 4B6RA 5TIIA 3L9XA 4RVOA 3MC1A 4GW3A 4J9NA 1NL3A 3B6EA 4C0HA 5C1OA 2VUMA 4LF9B 2R8RA 5EIBD 4L6IA 2VJMB 2ZIZA 1R0BA 1JYEA 1Q0LA 3D64A 4LY6A 4OL0A 1X7DA 4DA8A 3HLTA 5IS2A 4LPSA 3EUWA 3H6HA 2FN7A 1TU0A 2BC9A 4MKZA 2AC7A 5DWQA 2AFHE 1W0JD 1PN3A 4DR5H 3IXMA 2YOHA 5BWVA 1FF9A 3B6KA 4Y2XA 1NBOA 2I2XB 1IN1A 1MZPA 2BEVA 3M6XA 1ORVA 2H2GA 3VMMA 1FYWA 5EPEA 3ZN2A 2J46A 2XMZA 1HR0H 2FHSA 4ETMA 5BUZA 5JZOA 2XZOA 4DCOA 4OATA 1QVRA 4KKXB 3L0DA 4BZQA 1JA0A 3FIJA 3GIPA 1MVOA 1UWLA 2VFAA 4AZ0A 1JA9A 5DYYA 5CFQA 1LDMA 3F47A 3VBEA 3ZS8A 1JR3E 3VX3A 3ZIDA 4Q3EA 3I9V6 4AD8A 1XNQB 1RZVA 3VR5H 3NWEA 3N53A 4CL3A 2ZE7A 4R40A 3VJMA 3JZFA 2OZLB 4XQGA 5AKHA 3UXHA 4WBNF 1A9OA 1LLQA 4MW9A 3SIXA 1H8ED 3KL2A 3VC1A 3AFOA 3QKRB 4J0MA 1R64A 3L0SA 5JC1A 4A8PA 2BCGY 4N8EA 4LRQA 3SJ7A 2JZCA 1N6KA 2W9CA 3PIDA 4JI1B 3WP1B 2XBMA 2VT2A 2CLMB 1LNZA 4LJ5A 4Q1DA 2B1IA 4DYHA 1FTSA 1QAMA 2OC9A 5INTA 1GRCA 1HE8B 2W2KA 4PG4A 3NRCA 1X6VA 2A78A 4LSZA 1JDEA 4Y6PA 1YDWA 3ZS9A 4EA9A 5EAIA 1E6EA 3WC4A 2JF0A 2HM7A 3IALA 4HKTA 2ZT8A 5DHTA 1AN9A 2QW8A 1OJLA 1ACLA 5DHAA 2G0TA 3T1TA 2HWKA 3OTOB 3SC3A 4O7RA 5DOZA 4F4HA 1PKEA 3THYB 1UFOA 3DWEX 3JD4A 4EJSC 2B82A 4F3RA 3AP2A 3OX1A 5JSZB 4RV9A 5KFHA 2W11A 3KR9A 4M7OA 4P32A 4C0XA 4EOGA 7REQA 3RF2A 2P9CA 5F4ZA 4Q45A 2NADA 2ZUCA 1FP7A 3CS3A 4X00A 1R5OA 2I03A 1VPWA 3D4BA 1Q6YA 3KEMA 1ZINA 5L4NA 4IZOA 1OC4A 1R4ZA 4IHQA 3TRHA 1YRHA 2X8AA 5M04A 2H9AA 2DFKB 1UINA 3MTIA 4MOWA 1UPTA 4DL6A 7MHTA 4GOLD 4ISCA 1NNEA 4C04A 4UE3S 3OD1A 3P8ZA 4D0LB 5CA1A 4DB2A 2IEAA 4GR4A 4PNHA 2XRZA 2VNSA 3H4VA 4K9DA 1M1NB 4PG8A 2R751 1JN0A 4H4DA 4YO8A 5FFFA 1CRPA 1JKJB 2LVBA 2QJOA 4QDJA 4YDSA 4OYLA 1A5BB 2C54A 2CL7X 3HXPA 3T5HA 1PS8A 4WACA 1J00A 3UKDA 3R24A 1Q14A 5B3KA 3V97A 1W581 1XXLA 2BMJA 2GCPA 2VIIA 3E7DA 4J4HA 3T5TA 3NBZC 1UBTS 3ADOA 3ESRA 5A1JA 3TOZA 1E2BA 2W71A 2FLPA 5J47A 1PNQA 4D9BA 3HYCA 2VJKA 2I7DA 2XWPA 1WCV1 3EEBA 4L5JA 4MYCA 3RYCA 1U5BB 4OGLA 1P2FA 2HA4A 3PFKA 1JDJA 4Q7EA 1N6IA 4FX2A 1IWPB 1V1RB 4QNRA 3GRKA 3L2PA 3NORA 5TPZD 5E3HA 4KAJA 3W3AH 5JJKA 2E89A 4XIYA 2C00A 2EFHB 1KFBB 4PNPA 1AQ6A 4P5EA 3TN7A 3WGIA 4C43A 1U63A 4UOQA 3IQGX 1KEKA 5GOTA 5DASA 3JQEA 1NMXA 1Q7BA 2HSEA 2NZXA 5AD1A 9ABPA 4DUZH 3IUMA 4B6FA 3S2YA 4B76A 3P52A 4QWWA 4Z4EA 3OM0A 3W9YA 4FBTA 4C4TA 5BYAA 4RK0A 1U28C 2GZ3A 1ZPDA 3PFCA 1QCDA 4AY4A 2QPOA 3NUGA 3SS7X 5C1BA 3N42B 1YR6A 3WLHA 3TJRA 1UK8A 1ZSNA 2EW1A 4IINA 1U0JA 2A7XA 4GECA 5K0ZA 5B55A 2YCBA 2IEBA 2IIPA 3CSDA 4H31A 3HCWA 3IL2A 3LXUX 4RNDB 1I6LA 2AS0A 1Z4LA 4UAUA 2H4FA 2FXVA 5IUKC 1OTYA 1RD4A 4DWJA 1PR2A 3H0KA 4WCDA 2ERCA 1NNI1 3GIMA 2PKXA 2HN9A 3J7AC 1BX3A 2FEWB 2X2OA 4MWBA 4YUWA 1AQLA 3RSGA 3HUUA 4RQBA 5JNRA 3EVFA 2X0EA 2HW8A 4XASA 5CA0F 1W49A 2Y1DA 4QJBA 4JI6B 5LZ2A 1GVNB 5CNIA 1XTJA 4EFDA 2GD1O 5ILGA 3PD1A 1E7SA 2PKQP 2ZPAA 3GVXA 3VDRA 1V5GA 3K3VA 1KQNA 3OSZA 2AD5A 3F9IA 3ZHUA 1BRTA 1FYXA 3ICVA 4FGZA 2BRUC 1TKCA 3U4QB 4TTRA 5EGNA 4RVSA 4A6PA 4JDPA 4BNLA 4EPTA 1AKWA 2Q8NA 1JWAB 4H3HB 1PNOA 3ZVMA 4JIMA 4ZMSA 2C2OA 3ODGA 4RHFA 2AFIE 2P5TB 1KYTA 2FZWA 5IM4A 2NU6B 1E6KA 3PXEA 3MWLA 4JP5A 4MQUA 1DUIA 3OPQA 2VK2A 4AF7A 5EKDA 1BVYF 2EJWA 3ZEIA 1XEXB 2FVXA 3D54D 1XCGB 4UFOA 5TQ0B 5FPKA 1WR8A 3PEUA 2V0NA 1ES9A 2QN3A 3F3MA 5DYNA 4EF6A 3GJ6A 4CR8A 5FTNA 4UMDA 4F45A 5YASA 1NW3A 4NECA 1CNEA 2XCLA 1QIJA 3EB9A 3E3NA 1UMBA 1WV0A 3DTGA 1KH3A 1ORRA 3IKVA 1QKKA 2ZRCA 1DX4A 2PUAA 5K6AA 2P91A 3THSA 2LKDA 2Z3VA 1WCYA 4DLLA 2P40A 2H9IA 2Q9CA 2EZ9A 3DA8A 4KWTA 4RZQA 3IR7A 2OV2A 2XUZA 4OP3A 5HK9A 4G37A 4G9BA 2Q6LA 4MYTA 1NLZA 5EXPA 3FTQA 3H75A 1TMGE 3OPMA 4GU5A 1R6UA 3LO8A 4FIZA 4MW1A 4G5FA 3K7EA 3ZX5A 4EP1A 4OLBA 3ZX4A 3OZ7A 1BGVA 2WE8A 4LGMA 1VJGA 2HLPA 2R8HA 1JBEA 3DXFA 5HX7A 4YIHA 1SK9A 4Q9NA 2DR0A 3QOXA 3B8HA 3HU5A 3HY3A 1V11B 2C98A 1DDOA 4YB8A 3VNUA 2O2YA 2UV8A 3ZDCA 1H0RA 2REQA 3U81A 3EGVA 3QU5A 4ZAGA 2D4HA 1EEXB 3ROQA 2I7XA 2XBLA 3FCEA 4B2LA 5C4MA 1H0SA 4QG3A 3IDQA 3VR3A 2O19A 1WF6A 1SG6A 1YJXA 2GZAA 5AESA 3WNZA 4CCWA 4N76A 3DVQX 2OESA 4LEIA 4P2GA 5L1JA 3TD9A 2J3HA 2Z56A 1C30B 2C97A 2PL1A 3L0CA 3FNHA 3LY7A 4IIXA 1N9GA 1ND6A 3AY7A 4YJFB 4C78A 3ZDXB 1P0PA 4BNZA 3O93A 3ILSA 1SAYA 4PU0A 5CDHA 1DLIA 5G0VA 5IRCD 1VMEA 3Q5DA 3V6JA 1U7ZA 2CJPA 3PEFA 3L43A 1K92A 3ZE1B 5GONF 4TM5A 4IR9A 2V5VA 3DNMA 3EW7A 4WZZA 3QUTA 5JSUA 1PGNA 2F00A 3ASYA 2NUPB 4C76A 3UT5B 1AHHA 2C31A 2XGGA 3AUTA 1X8JA 4MVJA 3VU9B 3H04A 1X9IA 4H27A 2X14A 5LQJA 5KQPA 1X7ZB 3TW8B 3PL1A 4MCJA 1DKLA 1BKDR 4FCWA 1EZZA 4A6EA 2DFLA 2HCFA 4NZZA 4QHSA 4N6GA 1HT0A 2YJ6A 2SCUA 3L40A 3OX4A 2OO5A 2A7QA 2ALZA 2FJZA 3HCBA 4H1HA 1BHQ1 2ZSAA 1U90A 1Y3FE 2IZ0A 2P2DA 4QNMA 1DTSA 1B8OA 1H9BA 1NVVQ 2JHCA 3WRVA 4MP3A 5AICA 3D7SA 1G38A 3JQGA 2VZ8A 1G4UR 1WAMA 1MTOA 4M6WB 3WHLA 3VO1A 3V80A 4YRPA 5FQNA 4M54A 3NWPA 3C4JA 4GKVA 5LQAA 4V2UA 1AY0A 1W0KA 3I4LA 1ZUIA 2QVYX 3E0QA 3RK4A 4CKBB 1YQ9A 2OFOA 2EWWA 2NX2A 3C8MA 2FU5C 3U60B 3PW0A 1HRDA 1Q95A 2VI5A 3LP5A 4V38A 3WYNA 2ZRKA 4QW9A 3VTAA 2CCKA 3ZE6A 4NYMR 4H7KA 3RYFA 3TWOA 3ZXYA 5IJXA 2AOXA 2R92A 4BWSC 1F9AA 4JFAA 3ILXA 4IIVA 5JVLA 3AFNA 2B63A 1H8HD 1AGNA 4PNZA 4R8RA 3DBIA 5KJ6A 1TWFA 5I5UA 4G85A 1GRQA 2ADFA 4HEA6 1Z7YA 5LOVF 3K6JA 1JJIA 4Q39A 5CNKA 5IKXA 4NLGA 4OXQA 3C3DA 4R98A 1NBWB 1OA0A 1QE5A 3OP1A 3Q87B 4DDHA 3WYEA 2OK7A 5E7IA 3OOJA 3PA6A 3CH7A 4UNSA 3M9OB 2HPHA 3A7DA 1HTBA 3FZEA 3QWIA 1DKQA 2VUUA 5DXJA 3TRKA 4ER6A 1U3WA 4LQDA 3HACA 2I2DA 1NLUA 3HZRA 1RRGA 3BA8A 2C4WA 3Q15C 4LSGA 4YAKB 4Q4HA 1RXYA 3FYDA 4W5HA 3SLKA 1JNYA 1CUIA 4EG3A 1Z29A 1K06A 3CWCA 1A7JA 2JGKA 5DXFA 3F8TA 2B20A 2QRVA 3KHHA 4L28A 4NPAA 4QBHA 3E03A 3O8BA 4LZJA 1CDOA 1RM5A 4AZWA 5HDQA 2PZEA 4IRUB 3TQHA 9ATCA 3CLVA 4HYQA 3CRW1 4IYRA 1FU4A 2XAUA 4KZKA 3WB2A 4GOJA 5HRCA 1IYZA 1J0AA 1DPFA 1ST2A 1VRWA 4KXXA 5C5IA 1SG0A 3IAAA 3EA5A 2KE5A 4JLNA 1ISMA 1A9ZA 1ZA2A 3WYDA 4DVGA 5BR4A 3LMLA 4EG6A 3MLBA 3N86A 1DC3A 4I36A 1UOQA 1W34A 4QYIB 1P7CA 3FAKA 4BV8A 1YBMA 4CQJA 1JSRA 2I6XA 3BMCB 1T9AA 4BNJA 5LXTF 1HYEA 3HABA 3KK0A 4ECXA 3A28A 3K1AB 5EOVA 3WYGA 5B4TA 4BBPA 2WF8A 5AK6A 4FCVA 4RTLA 4F4IA 1NHGA 5J2TB 2QVGA 2FSFA 3DHWC 1AE1A 1RWNA 1VHTA 2X40A 4WCFA 1T6YA 1D6JA 5EUQB 4I1RA 1DWPA 3SR0A 3DV9A 3A6GA 1ZD9A 4CBVA 5EZ6B 4FVTA 2J3JA 5TY0A 3LCVB 3FVWA 4PF1A 2X5XA 3D8SA 4LOIA 1JI0A 1OZAA 1NXXA 5D1PA 3DB1A 4FMDF 1TCVA 3AEUA 1GZ5A 4JB0A 2XGOA 5EP2A 1E3DA 2VAPA 2OGZA 4MLPA 3R09A 1A4XA 4IIFA 1OH8A 1TD9A 4MLZA 3KUUA 4ZO9A 1WO8A 3UH0A 3VNVA 4P34A 5DHQA 4EA8A 1LQTA 3FDFA 4DDMA 5AVRA 4MLCA 3OTQA 1VDZA 4K26A 2CLSA 2QTLA 1CJUC 2JAPA 5LKRA 4Z1MD 2HHHB 1VL1A 3FMPB 5KT6A 4KVZA 3FKIG 2X5OA 3AIKA 1OWMA 4MO2A 4OQ4A 1UJ2A 1RBZA 2G25A 2VDWA 5EE3A 2GJAA 2YYYA 4PN7A 2Q5CA 4BVAA 4F4YA 4MDEA 2XB8A 4WA7A 1SFOA 1FS5A 4H7JA 1LI5A 5CX1B 2WSSA