2YZLA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
239
structure length
238
Chain Sequence
KLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 77
structure length 238
sequence length 239
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yzlA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzlA02
2UW4A 5AAFA 2H8HA 3HYHA 4F7LA 4GUBA 3SA0A 3K54A 3I1AA 4GCJA 2NU9B 3GP0A 2WTKB 2R7NA 4FG7A 4BDDA 4ZY4A 4FVRA 2QO2A 3TKIA 2JKQA 4F0FA 2X0GA 4YU2A 2H9VA 2PZPA 4UX9A 3MTLA 2YZNA 3HB9A 4MNEB 2QC6A 3ETAA 3F3UA 3RMFA 4BY9E 5LVLA 2BDJA 2X39A 5J9ZA 4U40A 3E8CA 3G33A 3DK7A 5M55A 2NUAB 5D1JA 4FKWA 2BZJA 2BFXA 1H1RA 4YUQA 5AUTA 4EC9A 2UVYA 4B8LA 1JPAA 2QNJA 2NPQA 3OCGA 4AQCA 1Q8WA 2VWWA 2XK8A 5D8DA 2FSMX 4U44A 1C30A 2E9VA 3OTVA 4AT4A 2EVAA 4FFOA 2CLXA 2CMWA 3BQRA 4K33A 3QD0A 5B7VA 3VJNA 5A4EA 4MAMA 5GJGA 3HVCA 4X6RA 4QNAA 2XIZA 4FBXA 3A8XA 3HUCA 3MB7A 4DN5A 3LLTA 5K5NA 1WMKA 4R1VA 3R9NA 3QLFA 4NM5A 3T9IA 2GPHA 2R84A 1CM8A 2ZMDA 3QHRA 1OL2A 3PVUA 4FNWA 1TQIA 1YWNA 4CFWA 4YSJA 5BNJA 2ITTA 2R3JA 3R7UA 5IQFA 4S2ZA 2XIRA 5M56A 3O0GA 5J1VA 1KBLA 4ZJVA 1GZNA 1GIJA 1JLUE 1Q3WA 4NTSA 4O7SA 4YZNA 5ANEA 3CGOA 3RAWA 4DGMA 2A2AA 2WQOA 3DK6A 5EYDA 4K6ZA 5HNGA 3RWPA 3UGCA 3ULZA 1J7IA 3C13A 2I40A 4R3RA 3QQJA 3UMWA 5JRQA 5L2SA 3RVGA 4PY1A 5FDPA 5AADA 2C6KA 4FTUA 3AC4A 3OT8A 4IX6A 4GIHA 3EWHA 3QHWA 1WBWA 2GHGA 5LMKC 4WNPA 3U4UA 4G3FA 4NJDA 4IHPA 5CZIA 2W06A 3AC5A 4X3FB 1KE5A 2PUIA 1MRYA 4D2RA 3RJCA 4CTCA 3G5DA 4L68A 4XOYA 3I7BA 3QL8A 4WSYA 5CYIA 1H26A 5HBEA 1DS5A 4DT9A 2X81A 2BILB 3FZSA 3UIBA 4N0SA 4JT3A 3DB6A 3EFLA 4TYJA 3LCTA 2R3FA 3PJ3A 3DTWA 3R1QA 2ZDHA 4NW5A 4O38A 5J1WA 4EQMA 3F3TA 1R39A 3EZRA 4U3YA 2C6DA 2CHLA 3I0OA 4FV5A 2WMSA 4FTJA 4RFZA 2JKOA 1PK8A 4O4IF 5JVLA 2O5KA 3R7YA 3THBA 4WNMA 5FDXA 3KEXA 5KNJA 5M07A 3BCEA 5F94A 4DC2A 4IVAA 3N9XA 2JIIA 5L3AA 2PE2A 2PTKA 4UN0C 2H96A 2QKRA 4O0VA 4UYAA 4PWNA 5IU2A 3V4SA 2A1AB 5J95A 2OJIA 3B8QA 4IEBA 3QGWA 5EDQA 3P79A 2IVTA 1OVEA 5AV3A 4TN6A 3RK5A 2PVPA 4II5A 4L8MA 3OG7A 3TT0A 5L8LA 4RJ5A 3ATTA 4WUAA 2X7FA 4BVUA 3K3PA 3GU6A 1UKIA 4RVKA 2W6ZA 4XG9A 4M84A 4EH4A 5CF4A 2PWLA 1P4FA 3ERKA 3NNXA 4AUAA 5KX5F 3GCPA 4GT3A 4I1ZA 3OBJA 4HPUE 4I41A 1PXIA 3PJ2A 4R5YA 5EI2A 5AUXA 5HICA 4E20A 4BBEA 3Q2MA 2R0IA 3PXRA 4UYNA 3IGGA 4G1WA 1FBNA 4GMYA 4NM7A 3RK9A 4B0GA 2WMWA 4CG9A 2VO7A 3COHA 4IW0A 2JFMA 4FSYA 4FKLA 5I9UA 4JDHA 4HVGA 4J8MA 3EKNA 4ITJA 4A9RA 4ERWA 1ZWSA 5FTOA 4PNIA 3QZFA 2IZUA 3E87A 2R3RA 2YIYA 3C5IA 4Y73A 2E9UA 1JAMA 5FP5A 3V5PA 2BTSA 4EOOA 2P0AA 2YRWA 4HNVA 4F1OA 5C03A 2VX1A 3PDTA 3PZEA 4O7WA 3IGOA 2ITYA 5CI6A 4ZIMA 2I7QA 4BTMA 2C0IA 5CVGA 2I80A 4XBRA 4YTIA 1KE6A 3RAIA 1OITA 4ANQA 4X3JA 2X2KA 5DEYA 2ZDGA 1YOJA 3EN9A 3LFEA 4Z9LA 5K4IA 4V05A 3COIA 4IAIA 2QOHA 1XO2B 3DJ5A 4GVJA 4CEGA 3CC6A 2WMTA 4I0TA 2GMXA 3DQXA 3NAXA 4FV7A 3ACJA 4B9DA 3OY1A 4ZK5A 4FG9A 5JKGA 3UBDA 3VF9A 3D5UA 5HD4A 3MY5A 5AIKA 3UZRA 2OICA 1CKIA 1OL5A 3FYJX 4X6QC 4DLJA 1Q8UA 1M2PA 4FTNA 4U8ZA 5ANIA 5FTQA 5HO7A 2W5HA 2XCKA 3EN4A 5C1PA 5HG8A 3VUHA 5BVFA 5HBJA 3ZRLA 4APCA 4FODA 4ZXTA 5IPJA 2CNUA 4PTCA 2R3IA 3BRBA 3NZ0A 4S30A 3LE6A 2C3LA 4G34A 4NK9A 4USDA 2P3GX 3O50A 2CNQA 3DAEA 5CU4A 5F20A 3VS4A 3FLWA 5EK7A 4EKKA 1OPKA 2Z2WA 4FZFB 4L3JA 4QQ5A 5TOZA 3B8RA 5JGDA 4CCBA 4ZTHA 4JR7A 3H30A 2W17A 5FG8A 4DFBA 4CKIA 4YLKA 4HCUA 3R8UA 4I5MA 4YLLA 3AD5A 4GK2A 3P7BA 1FMOE 4MTAA 3FXZA 3TKUA 1M0WA 3OBGA 4N57A 4DFNA 2YDJA 4EH2A 4KA3A 3N8DA 5CAEB 4RC2A 2O64A 2J2IB 2X4FA 4FEQA 1YXSA 5GONF 3K3JA 5E7RA 5J87A 2HY0A 2V7OA 4ARKA 3U9SA 3IW7A 3EN5A 4O2PA 2QO9A 4Q2AA 4L53A 5E90A 2PVKA 1KJIA 4XYMB 4QYYA 4J52A 4EQCA 4O96A 4MQ2A 5IF1A 4ZJJA 4HVIA 2BUJA 3QZGA 4K2RA 2NP8A 3IOKA 3LMHA 5EM5A 3UOLA 4F7SA 3UPZA 2VWBA 4QMNA 4JG7A 5A4TA 1BNCA 5EI8A 2XIKA 3CEKA 3GCSA 4EHVA 3TW6A 2BIYA 2J0IA 1ZAOA 3W1FA 5D9HA 2P2IA 2ONLA 2PUPA 4RWKA 4AZTA 4YJ3F 2REIA 4IWPA 4H1JA 4MK0A 1W0XC 2CLQA 3ENHA 3LFSA 2GNGA 4X2FA 5CT0A 4DEHA 4O0YA 1M7QA 3OCSA 4AN9A 4M0YA 1M52A 2PMLX 3NUPA 3ZC5A 3VRYA 3R02A 4FTQA 3A62A 2VTNA 3WF6A 3SRVB 2YJRA 5HIDA 5AEPA 4OUCA 4BCPA 4MXXA 2QOCA 4BYJA 3MDYA 4ZZOA 2G2IA 4O7NA 3UG2A 2XNGA 1ZZ2A 2WQMA 4I5PA 3QUDA 3GC7A 3R01A 5FGKA 4DYMA 3DGKA 1FMKA 4OTFA 2C5XA 2LGCA 4ZSLA 3TUDA 3JRXA 5IUIA 4M8TA 2W1CA 5C4KA 5CAOA 2VWUA 4NYEA 2YIWA 2R7BA 3CPCA 4KNBA 5HX8A 1OL6A 2GPSA 3OD6X 3EMGA 4FOBA 4YTHA 3PE1A 3D7ZA 1ZMUA 2ACXA 4M68A 1JKLA 3KGAA 3VPCA 4IZYA 3PWDA 3BI6A 4CQEA 4R5SA 2I8CA 1HCKA 4BDEA 3D5WA 5EKOA 3UIUA 4DH1A 2YZMA 4ANLA 3C7QA 4FVPA 4IMYA 1OBDA 1J7LA 3IW4A 5KZIA 3WIKA 5B2MA 2W9ZB 3A7GA 3Q9XA 2YWVA 5AP2A 4RX8A 1YI3A 3A61A 2QKWB 4TXCA 3LMGA 1YW2A 5EW3A 1H27A 4MD9E 1LUFA 3FQHA 3N4UA 4IBMA 4D55A 3VUKA 4AA5A 4JIAA 5IH6A 3EQIA 2YA9A 3QQGA 3R9OA 3K5VA 2Q0NA 3I5NA 1NT2A 4EOJA 2OJGA 3ODZX 5L8JA 2HZIA 2Q0BA 4J53A 5I9WA 3DNDA 4D1XA 3VW6A 4AA4A 5FEDA 1KJ8A 3NNVA 2J0LA 4JXFA 4A4OA 5CXHA 4UZHA 3TINA 3ZH8A 2WTVA 4M15A 3FE3A 3Q4CA 3SAYA 3UO6A 2P2HA 3VUIA 4EKLA 4FIEA 4I6QA 1G8SA 4ANMA 3L8SA 5C8KA 2OJ9A 3UG1A 5LP6F 5ETAA 1ZYJA 3FLQA 5ITAA 3AGMA 1WCCA 3JVSA 3QXPA 4OT5A 2ITNA 4FTLA 3MESA 3M2WA 3ZUUA 4TUYF 1QL6A 3MFTA 3VBWA 4PL4A 5H8GA 1SZMA 3OMVA 1OPLA 3DKGA 4JI9A 4QP4A 4IFCA 3BGZA 1H24A 4RFMA 4RIOA 4U79A 2FVDA 5IA1A 4FTMA 2W4JA 2YM5A 2Z02A 2EU9A 4M97A 5AV2A 2ETMA 4J71A 3F2RA 2QR8A 4L7SA 5CT7A 1EYZA 2HGSA 1W83A 2ITUA 3OWPA 3ZZWA 5JRSA 3F3VA 2G9XA 3EQDA 5FXQA 4ZY6A 3ALOA 3SVVA 1B38A 4NTTA 4OBOA 4I5CA 2XJ0A 5AA8A 4JBOA 2W1ZA 4ACDA 5A4CA 2R3MA 1QCFA 2YABA 4FKIA 5HEZA 5HE2A 3QX4A 5JVDF 1Z5MA 5CNNA 3H9FA 5JEBA 3L9MA 2YITA 4PP7A 4WT6A 3P5KA 4QMWA 2B9JA 1OKVA 4QP8A 4J8NA 5J7HA 2UZDA 5AAEA 5CEKA 2FB9A 3O2MA 2HZ0A 1XBCA 5M57A 2WTJA 2X6DA 4EWHA 2UW5A 1ZMVA 5KMMA 4QTBA 3HAVA 4IWDA 4FV1A 1FPUA 4YC6A 3TM0A 2ONLC 3BBWA 1PXJA 2B53A 1H00A 5AV0A 5H3QA 4BTKA 3HECA 3KY2A 5C01A 4BTJA 1EUCB 3ZLXA 4M12A 4MBJA 4X7QA 4YC3A 1UA2A 2YFXA 4MWHA 5LCKA 3ORIA 2JAVA 3VS3A 4FK3A 2YHVA 3NIEA 4LMNA 5CEOA 4O2BF 2X1NA 3AG9A 3HV3A 4YBJA 5JFXA 4EGJA 4ZAUA 2WZJA 4E5WA 2ZB1A 1OPJA 3OOMA 1ERKA 2VTJA 3NUUA 4RJ7A 2OLSA 2YAKA 4NKSA 4L52A 4BR3A 2PMNX 3R9DA 2R7MA 5HE0A 3ZFXA 5K9IA 3Q6WA 5EH0A 4F6UA 4RIYB 5HQ0A 4D5KA 5CXZA 4Y8VB 3PG3A 4F9YA 5F1ZA 4C5BA 4YJSA 4ANSA 4EEVA 3WE8A 3NVKI 2NRYA 4OTRA 3BE9A 3TV7A 4ZLYA 4Y5HA 1NW1A 4BGGA 2FSOX 3LLAA 2Y4PA 4G6NA 5BQ0A 3QA8A 1YI6A 1PXOA 3KCFA 4O4HF 5FD2A 4O0XA 5EDRA 5GNKA 3TWJA 3UNZA 4AZVA 2OSCA 4E4LA 5HLPA 5KHWA 2VX3A 3MH3A 4O22A 4F09A 3NGAA 4AE6A 4IIJF 1ZRZA 4UWBA 4RQKA 1E9HA 4AU8A 3LCKA 1GZ8A 1ZOGA 3HAMA 4MXAA 2C47A 3F88A 4E5BA 2ZB0A 3UE4A 1WVWA 2PUUA 2ZAZA 3MVJA 2F2CB 4RA5A 3GB2A 3KCKA 1XH4A 4O91A 4LOPA 4XEYA 4XBUA 3VMMA 4LMUA 1OI9A 5FQDC 2VNWA 3QWJA 3DLSA 4R3CA 2R64A 5AV1A 2OZAB 3QXOA 3W2QA 4FFLA 3KN5A 3WF8A 4G17A 3O96A 2GSFA 4XRJA 2ITPA 4FFPA 3NW6A 5L2TA 2PUNA 3ZDUA 4HGSA 3Q3BA 1GZKA 5CEIA 4DTBA 2ERKA 5AMNA 4E8AA 2W1IA 2B0QA 4H3BA 4YLJA 4MV3A 3VNTA 3RTPA 1M14A 4Q9ZA 4I94A 2A4LA 3MA6A 4M3QA 4CZUA 3NDMA 3KF4A 5H2UA 2CJMA 2C5VA 3K3IA 4G9RA 3UVRA 2BVAA 3FZRA 3PPKA 3CTHA 3DBQA 4LG4A 2X2LA 4KS8A 1YVJA 4FEUA 1OM1A 4FC0A 4CXAA 2OZAA 4BI0A 3VS2A 2HY81 3BG5A 4YAJB 5JZJA 5EM7A 1RJBA 3KVXA 4X21A 2R85A 4FX3A 2JDTA 3OXIA 4U7ZA 3EYGA 5IEVA 2C3JA 3WF5A 1BMKA 2IZTA 4WRSA 1F3MC 1T46A 2R3KA 2W1FA 2ZM3A 3O7LB 5BUIA 1Z9XA 3BLHA 3LFNA 3OW3A 4WIHA 4L00A 1SVHA 3QTRA 4K18A 3MJFA 2P33A 4ZSJA 3FPQA 3QKLA 3QWKA 4QQJA 3G2FA 5DT3A 5EI6A 3BLRA 3F7WA 5TR6A 4C4IA 4E4NA 1R1WA 4K9YA 3R5HA 1NVRA 5HVJA 2UZNA 2VO0A 3LQ5A 3LXKA 4FUYA 4WG4A 2J5FA 3AC8A 3RI1A 4BICA 4Z55A 2DLNA 4FKQA 2JC6A 4MV8A 3QAME 4Y83A 2GFCA 2E9PA 4YJTA 5EDPA 3FQSA 3V5WA 3UOJA 3QYZA 1Y91A 4L3PA 1Y8GA 2OO8X 4AOIA 1DAYA 3QTSA 2RKUA 3OUKA 4BHNA 2PBZA 3LPBA 5IQIA 4DHFA 4MYGA 1Y6BA 3E8DA 1V1KA 5DHJA 4ALUA 4HYHA 4Q5EA 1GJOA 5IQDA 5CY3A 3MI9A 2DYLA 4KS7A 3DXNA 2I0VA 3OY3A 4FKRA 5AIRA 3F66A 3ORQA 1PMVA 3WZUA 4J95A 1G3NA 2WOTA 4FTAA 4U5JA 5C26A 3VN9A 4L43A 5ANOA 4GH2A 2FA2A 2XK6A 3WARA 2CDZA 2HXQA 3DDPA 2PYWA 3Q9WA 4O0UA 5D7VA 3II5A 2IW9A 1PYXA 4LRKA 4YZ9A 2OIBA 4IQ6A 4XV1A 4NFNA 4AF3A 2VO3A 4DA5A 3CPBA 2UZBA 4ZTQA 3FZOA 5CS6A 2PZIA 2XNBA 3O51A 1ZYSA 4ITIA 4Z7HA 1DI9A 4O7RA 2YISA 3HBLA 2OZOA 4BTFA 4I21A 4CLIA 2WQBA 4QPAA 4LQMA 5LVOA 4ID7A 3SOAA 4DGLC 1VKZA 3S4QA 3K2LA 3U87A 5DR6A 2BDWA 3MJ2A 4C35A 2PZYA 1GAGA 2BHHA 3CJGA 1WBTA 3CTQA 3I6UA 4WBBB 4C58A 5KMIA 3TIIA 4DEIA 3V5TA 3F6XA 3TNPC 4BDGA 5I9XA 4EHGA 3KALA 2YCSA 2OU7A 5JH6A 3AT2A 3EOCA 3UQGA 4WO5A 3TZ8A 3DZQA 1AUXA 2FPPB 3GXLA 4I4TF 4FEXA 2BRBA 4UWCA 4NM3A 2HK5A 2O65A 3UZPA 3ZTXA 3EQFA 3D2IA 4P5QA 3PWYA 5GHVA 3GLKA 3U6IA 4LOOA 4FNZA 4JRNA 4TYGA 4BHZA 3C0IA 1UWHA 2O63A 3MW1A 4U81A 2GU8A 5BPHA 2V0DA 5CALA 5IH5A 2PVHA 4HJOA 4ZTRA 3D5XA 3DY7A 2RFSA 4H39A 1O6KA 4QP1A 3PLSA 4KAOA 2NRUA 4NSTA 3UVPA 4UZDA 3ULIA 1H1SA 5L2IA 4OBQA 4DGOA 1EUDB 2ERZE 2QO7A 2VX0A 3ZBXA 4GU9A 3G6GA 3RALA 4F0IA 2B52A 3FY0A 3MVMA 1XH8A 2XKCA 4G6OA 2F7XE 4JBQA 5CVHA 1H8FA 4E1ZA 3ACKA 5BPFA 2IVVA 4S32A 5K3YA 1RDQE 3OS3A 4MBLA 1XKKA 2NNWB 4YC8A 4IAYA 3V6RA 1BI7A 3A60A 3R83A 2I0YA 3ZM4A 5EYMA 4EH9A 3H10A 4JVGA 3WO1A 4JX7A 3UYTA 3QA0A 3R00A 4NFMA 3AC3A 4K77A 3W2RA 4DFYA 3V01A 4TT7A 3BGPA 2B54A 3ORMA 3UQCA 4BIDA 4A7CA 2VTRA 1W93A 4HVSA 2IVSA 4FNXA 4EBVA 2C0TA 4XYFA 4FTIA 3GOKA 4U45A 1OMWA 2XMYA 4ZZMA 2PVFA 3WZEA 3W2PA 4YNEA 4YO4A 4H05A 3AC1A 3KFAA 2XEYA 3LFCA 2C5OA 4GFMA 3PXFA 3TDWA 4Z3VA 4MKCA 2Z04A 4D0XA 3ALNA 4RG0A 1XJDA 1QPEA 3QTXA 3IW8A 3F7ZA 3ZHPC 2YEXA 2WD1A 3SC1A 3FHRA 3H0YA 4L45A 4ACCA 5CEPA 3HP5A 3QD3A 4BIEA 4C59A 4RJ3A 3ZBFA 3SXFA 5HVYA 1ZMWA 2V7AA 3MY1A 1GSAA 3R63A 3QZIA 5HBHA 3QQLA 5DFPA 2X6EA 2HCKA 1PMEA 4EL9A 5CX9A 2A19B 1URCA 4JQ8A 3V6SA 5EOBA 3IECA 2B9HA 2RL5A 4V0GA 5EM6A 3T3UA 4ANBA 4XX0B 4BDHA 1MRUA 1YOMA 2R4BA 3QALE 5BVKA 3VF8A 4PRJA 4C3FA 3KMUA 2WB8A 4EOPA 4NW6A 5FNVF 3QBNA 1Y6AA 4UWYA 5LMAA 1JVPP 4BF2A 3AOXA 4RC4A 3W10A 3DCVA 3ZDIA 1URWA 5ANGA 3RNIA 2Y7JA 3OEFX 3ZXZA 3ZMMA 4Z16A 3TUBA 1JSTA 3KK8A 4O6EA 2J50A 3BPRA 4I20A 1H0WA 5J8IA 2JIUA 4EZ3A 1P14A 2VTAA 4QP9A 3RV3A 2YM8A 5HG5A 5IEYA 3HO8A 4EI4A 4L44A 4X2GA 3V8WA 3W16A 1H08A 4I22A 2PVJA 1YOLA 2WIPA 3EFKA 4AZWA 5LWNA 2XUUA 4IB0A 3VUDA 2W6MA 2EUFB 4D5HA 3QTIA 3VBYA 2XBJA 4FTRA 4K1BA 5I5ZA 5I4NA 5E8YA 1UU7A 3GOPA 3W18A 3RINA 4DEDA 1EH4A 1JNKA 1MQBA 1ZARA 5CU0A 4O0TA 4DCEA 2W6PA 1YKRA 2IW6A 1M2RA 4DH8A 2X8DA 4EYJA 2XJ2A 3GVUA 3BWFA 4BBMA 3HV4A 4H36A 3RPOA 1KWPA 5FBNC 4DAWA 5CAQA 3DS6A 4BDBA 3ZO4A 4ZLOA 5AUVA 4YJUA 4TY1A 3R9RA 2W6NA 4AZFA 1G8AA 2VRXA 4D9TA 5BVOA 5GIPE 2OF2A 3Q60A 2HW6A 4IACA 5CAVA 1PYEA 3K5UA 4BCNA 5IZFA 5HX6A 3ZO3A 2JITA 4XOZA 2J9GA 3A7FA 5DG5A 1KE7A 3ITZA 2H6DA 4D1ZA 1DI8A 2R87A 4MXZA 5LCJA 4ENXA 1XHAA 3R1SA 3DA6A 4DLIA 2J7TA 4E6AA 3LJ0A 4WNOA 4MEDA 4F7JA 4FSRA 5IUGA 2R3HA 2X7GA 3TL8A 4ZOGA 1CTPE 2WOUA 4ENYA 3OCTA 1PMUA 3DQWA 3GUBA 2X9EA 4ZEGA 2VTQA 2WU6A 4YAKB 5B2LA 2C6LA 5DA3A 3LCOA 2GS7A 4QMVA 3ORLA 1JDEA 4HNTA 4QMTA 2YIXA 1WBOA 2OW3A 5C27A 5CSWA 1GOLA 1JBPE 2YAAA 3F69A 3UC4A 2I6LA 5J2UF 2YM4A 3Q1KA 3P08A 3LW0A 4CSVA 3L8PA 3C1XA 4FIFA 4I6FA 3ZXTA 2VTPA 3KRRA 2R7LA 3PUPA 1Q4LA 2QCSA 3BU5A 2V5QA 3FLZA 4FSWA 3KXHA 3FY2A 5BUJA 2W9FB 4YJ2F 4NKAA 5DBXA 3RWQA 4ZLZA 3CXWA 4FZ6A 4U6RA 2YERA 2QOBA 3IKAA 3WYXA 3NR9A 4IAKA 3U6JA 4PV0A 3E64A 4IANA 3NEWA 3FZTA 1LEWA 5HKMA 2C69A 3PFQA 3P23A 5DE2A 2IP4A 5LARA 4G6LA 2IVUA 3CP9A 3NAYA 4FGRA 4YTCA 4GL9A 4QOXA 4FKGA 4GSBA 2RG6A 4H58A 3CY2A 3DFCB 3FHIA 4HPTE 4J1RA 3M42A 4Y5QA 5TO8A 3VHEA 2WMAA 3AXWA 3CQWA 3QC9A 4C62A 2JKKA 2W71A 4JAJA 2Y4IC 2J6MA 3RAHA 4GT5A 4EONA 4PMSA 2XCHA 4EZ5A 4IX5A 4CKRA 4HCTA 4QQTA 3PY3A 4FTKA 4YZMA 2JFLA 4MXCA 1CDKA 1G5SA 4OTWA 5ACKA 2XIYA 1YXTA 2QLQA 4F9AA 2JEDA 4EQUA 1GZOA 3TG1A 4O7ZA 4GK3A 1UVRA 4CLJA 2ZV9A 4NIFB 4RBLA 2VO6A 4FL2A 1A9UA 4AA0A 1K2PA 4BRXA 2PPQA 3U9CA 5JN2A 3F5PA 5DWRA 1YRPA 1XR1A 3KA0A 3FI8A 1FVVA 3A99A 3PZHA 4MD7E 2OKRA 5C8MA 2CKQA 3QQFA 1Q8ZA 3B2WA 4XV3A 3NW7A 2J0MB 4AGDA 2R82A 5C1OA 2HW7A 2YDIA 2BR1A 4O83A 3PE2A 2WEIA 1U4DA 5KKNB 4E7WA 3DZOA 5DGZA 4EBWA 3G15A 4O4LF 1IASA 1L3RE 2O8YA 3UDBA 2BMCA 3O71A 1Q62A 3EJ1A 1LEZA 4RX5A 2YCRA 2AC3A 1MUOA 3SXRA 3R2YA 4QMSA 2VPQA 2HWPA 1VBHA 5JH7F 5IQHA 3QRIA 3HP2A 3NWWA 5E1EA 4EUTA 4OGRA 1E1XA 4DEEA 3V5QA 5M4FA 4G16A 4LL0A 4CMOA 2XS0A 2GCDA 3IG7A 4O0WA 2VWIA 3JYAA 2EB2A 3JY0A 2IG7A 3C4WA 1REJA 2ITXA 3L1SA 3N4TA 3WI6A 1NVQA 3PJCA 2C1AA 3QCXA 4LYNA 4R7BA 3LFBA 4HZSA 5LVPA 4BDKA 4ZTLA 5KMKA 3N6RA 5LMBA 2VUWA 2OG8A 2GNJA 3DLZA 4KBAA 5FUTA 4A4LA 3UQFA 2W05A 3WZDA 3OCBA 3T8OA 5CEMA 3DB8A 3DAKA 2V59A 3VOTA 3NYVA 3ZLWA 2UZTA 3IDPA 3PA3A 4AZSA 3LIJA 4BCJA 2NU8B 3ZCLA 4V0GB 5LA6F 2PY3A 3EH9A 4IJPA 3R7EA 3WBLA 2XNPA 4R1YA 4MVFA 3NCZA 2VR1A 2AUHA 3QF9A 3AD6A 4JDIA 3AMAA 1RE8A 5D12A 1EHIA 2R7KA 3F61A 4FTTA 4C4GA 4CD0A 3FL4A 4FYOA 2ZYBA 3WF7A 4NWMA 3R8PA 4B8MA 2EXCX 3KREA 4L3LA 2WTCA 4CRLA 5GIOE 1UNHA 3KL8A 4F70A 3TI1A 5JFWA 4KRDA 3RCDA 2VZ6A 5HG7A 4CV8A 3GFEA 2ITQA 3ORPA 2J5EA 3ORXA 2PN1A 3TDVA 2FSLX 5J9LA 3QCQA 2YIQA 3MPAA 3VULA 2VWZA 3DT1A 4ACHA 3QGYA 3A8WA 3M11A 4H3QA 1YHSA 3Q53A 2CPKE 3CIKA 3DAJA 4GEOA 1IA8A 2QLUA 3D5VA 5CQWA 3ETHA 2WEVA 3FWQA 2OIQA 4U9AA 3HRBA 1R3CA 2BCJA 4FGBA 3KVWA 4AGUA 3QCYA 4C4HA 4TKSA 4ASEA 2PK9A 1B6RA 1XH5A 2JD5A 5ETCA 3T3VA 5CVFA 5T3QA 1YHVA 4BIBA 1A48A 1BI8A 4A06A 1IEPA 1PF8A 3FI2A 1XBBA 4IZOA 1H07A 2C3KA 5B0XA 5JT2A 3CE3A 1GY3A 3R71A 3LJ1A 1J1BA 2QD9A 3DDQA 3OXZA 4JIKA 1FINA 3IPHA 3BHYA 1I7NA 1WVYA 2UVZA 2UW8A 4AW1A 1SMHA 2VGPA 2C4GA 3SW4A 3AX6A 2XKEA 2W4OA 1GIIA 4HNFA 3VS6A 5CENA 4YHTA 3DBDA 1DM2A 2C6OA 1WBPA 2QONA 4H3PA 4ONAA 4WG5A 2X7OA 2YDKA 5E4HA 3VIDA 2BAJA 1OECA 4PP9A 4MV7A 4TZRA 2YW2A 3ZFMA 5HCYA 4BDJA 3BU3A 4MAOA 3NVMB 4IWQA 2P55A 4O82A 4RFYA 3JUHA 4A9YA 3G8DA 4F6SA 5IH4A 5LOVF 1ZY5A 5BMMA 3C4EA 1CE8A 3C0HA 3QUPA 4RIWA 4BZOA 5EG3A 2Y9QA 2RGPA 2VWVA 4YGAA 5DEWA 3DXQA 4DLKA 3CBLA 4IB1A 4QMLA 4CMTA 2ZV8A 3TTJA 1OUKA 4NM0A 4TPTA 3QLGA 4FKOA 4FSZA 1I09A 2X8IA 4FSNA 1KC7A 3REPA 3WZJA 3TCPA 4S31A 4F0GA 1QPDA 2QOKA 1OIRA 2IO6A 3KC3A 4WRGA 1U59A 2ZM4A 4YSMA 5A46A 4YB8B 2J0JA 3SRVA 2YS7A 2RFNA 2ZVAA 5JZNA 4BCHA 1PRYA 4YPSA 2IN6A 4D0WA 2FH9A 4ZOLF 3UJGA 4C34A 4CVAA 2P4IA 4L6QA 3AMBA 3RPRA 3WYYA 2FGIA 4OBPA 2BRMA 4BDIA 3IS5A 3MFUA 4G3GA 4GYGA 5A9UA 4M67A 3HEGA 4PMTA 3EQCA 2A27A 1YDRE 3FZPA 4OW8A 5IG1A 4FIGA 4MV1A 4I24A 1WBNA 2DIKA 2R3PA 3Q2JA 1Q8TA 5M4UA 1I44A 1ZYDA 3COMA 2UW0A 3LOKA 3ZRMA 4K0YA 4GS6A 3AD4A 4UXLA 4JBVA 4B99A 2ZDTA 3ZUVA 4BC6A 3WF9A 2P0CA 4FFRA 3PPJA 3IONA 4JX3A 4GIIA 2KULA 3P78A 3EKKA 4W8EA 3RZBA 2NU6B 3BKBA 4QRCA 3NUYA 4WOVA 2YCQA 5F4NA 3HNGA 3P86A 3TEIA 2GLTA 4QMQA 3GC9A 3TTIA 2QR7A 4B6LA 4BCOA 5J2TF 1BYGA 5JFSA 2QU5A 3MA3A 3P0MA 4L01A 4RVLA 4IAZA 3TNQB 2CN8A 3FDNA 4FKJA 4I0RA 4MHAA 4C0TA 5EZYF 3F5XA 4RJ8A 4D4VA 4AACA 2PHKA 2PZ5A 1AUVA 2JAMA 1FQ1B 5A6OA 1VEBA 3E3BX 3RKBA 5AX9A 3PP1A 4I5HA 3BHUA 4FI1A 3FPMA 4DF3A 4E4XA 3GFWA 4KD1A 2VN9A 4RPVA 4NT4A 2OI4X 1H1WA 1NA7A 4N70A 4I50F 4FEWA 4ACMA 5K5XA 3VUGA 2QOIA 1REKA 3CD3A 1XH6A 4WHZA 4WBOA 3U51A 1SM2A 3DF7A 1Z2PX 4XG4A 2RF9A 2VTTA 2QU6A 3PVGA 4BI2A 3QUEA 2C1BA 3COKA 3L8XA 4C4JA 2F49A 2QHMA 2VNYA 3FKOA 4GG5A 4KIQA 3ZYAA 4AXAA 4DFUA 5A14A 5IMEA 3R23A 4DIMA 4NJ3A 4U0IA 2Z7QA 1VYZA 3TV4A 5C4LA 1Q24A 5JGBA 3JPVA 1ZXEA 2Z7LA 4YJRA 4F99A 5M4IA 4ZI7F 1OKZA 1ZYCA 1BL6A 3SGCA 1CQIB 5HIBA 5IQEA 3HMNA 4HVDA 4DG3E 5HCZA 4HNUA 3TN8A 2PZRA 4WA9A 3VS7A 2PVYA 3LM0A 3LQ8A 1QMZA 3HV7A 1J1CA 3S0OA 2QODA 2C5YA 4V01A 4XH6A 3S2PA 1J7UA 4IX3A 3GC8A 4BCQA 1YI4A 2WTWA 4TNDA 5FTGA 5AP3A 4R7HA 2XB7A 3VBVA 4PL3A 5DH3A 4QSHA 2BAKA 1Q61A 2HOGA 5CSXA 1JQHA 2YCFA 3OTUA 4HGEA 4F63A 4FT7A 3FMHA 3KN6A 3D7TA 3KULB 3O23A 1Z2NX 2QG7A 4EOMA 1Y57A 1NXKA 3LP8A 4RLLA 4CV9A 2XRUA 4IE9A 4RIYA 4FMQA 3GNIB 2YJSA 2B9FA 2HJWA 3PVBA 2W0JA 1GNGA 2WMBA 5AM7A 5IMXA 2R3OA 1BLXA 4ZSGA 2QVSE 5CAPA 2HIWA 2W5BA 3AQVA 5ETFA 2XNNA 3MPMA 3GU5A 4X2NA 4AP7A 3ZEPA 5D10A 4BGQA 4EZ7A 1YDSE 2C6MA 4HQ6A 2ZDUA 4RJ4A 5JK3A 3PA4A 1V0BA 4O21A 2BZHB 2WMXA 2RFEA 3E7OA 3QQHA 4I0SA 1UKHA 4RZVA 3W2OA 5AAGA 2YACA 1XQZA 5EM8A 3OWLA 5IA4A 1O6YA 4EH5A 4YHFA 2R3GA 4F64A 2GQGA 4G5PA 2VU3A 1T45A 3K5IA 4FV2A 3FSFA 3L9NA 5BYYA 4E26A 2GHMA 2PULA 2W1HA 3DPKA 3R8ZA 4HCVA 2CGXA 3M1SA 4X2KA 3VO3A 1IOWA 2WMRA 3FMMA 4CNHA 4TV9F 3Q9ZA 4YZCA 5BYZA 4O7LA 3PSCA 3VC4A 4MH7A 3A4OX 4FG8A 1JWHA 1NY3A 5ANKA 2QOQA 3P7AA 4FUXA 4DGNA 2Z7RA 5CSPA 2JKMA 2PVRA 4OTQA 5EHYA 3TACA 1DV2A 5C1QB 4CT1A 2CNVA 2B7AA 4QMUA 4KUJA 4I55F 3UVQA 5DMXA 2WMVA 2I0EA 4IC7A 3MFRA 4FV3A 4I93A 3ORNA 4JG8A 4P5ZA 5AP4A 3ZC6A 4DT8A 4EORA 1U54B 1ZOHA 4QPSA 1PXLA 2W99B 4YTFA 3NYXA 3EN7A 5TT7A 3LM5A 5CNOA 2F9GA 4EG0A 3FMJA 3MYGA 3Q04A 2XM9A 3BX5A 5FBOA 1CSNA 2W1EA 4ZSEA 4O84A 4O86A 5D11A 3WILA 3LFQA 4Y46A 4A9TA 4HYUA 3UOHA 4HYSA 1FVTA 3DU8A 4MBIA 3UO5A 4EK8A 3EL7A 4BB4A 1OBGA 3TJDA 3ORTA 2CGWA 2XCLA 2W70A 2ETRA 4YHJA 3MN3A 2QK4A 3V4ZA 2ITZA 2BROA 5KUPA 2GNLA 4RX9A 5JGAA 4ZMFA 1KE8A 2QQ7A 3O8TA 3PY0A 4JBPA 3G0EA 4IM3A 3UFXB 2C00A 2BIKB 4AW5A 2O2UA 3CGFA 5ETIA 4GKHA 4R3PA 1GLVA 1OKWA 4LUEA 1UU8A 1XH7A 2OGVA 4D4YA 4DCAA 2OWBA 2R0UA 4F6WA 4F08A 4PNKA 4OT6A 4EC8A 4XV9A 4F9CA 4QYFA 1OB3A 3SD0A 3LAUA 4FEVA 3NLBA 4WBNF 3SX9A 3UC3A 4D4SA 4CFVA 3GT8A 4PL5A 4F9BA 4L7FA 4J97A 3QC4A 4LRMA 4LV8A 5CSHA 3ORKA 3JS2A 5BMVF 3HDMA 4MXYA 3SDJA 1O9UA 5DT0A 2R5TA 4UXQA 4D2SA 4AOTA 2WHBA 4U43A 2IW8A 1P2AA 3ZSIA 3ET7A 4XUFA 2PE0A 4P4CA 5I9YA 1UU9A 4UBAA 3PPZA 5AFVA 4ZHQF 2ITVA 5A4QA 3IOPA 2B4SB 4EJ7A 3DBCA 1FGKA 2O0UA 3OFMA 1YDTE 3OUUA 1KV2A 1W84A 1JKKA 4QMXA 3D83A 1KJQA 2Y4IB 4GFOA 2WELA 5CA1F 2XNEA 1J3HA 2JDSA 2QOFA 3HX4A 4WG3A 5JMSA 2QF7A 2PU8A 2YWPA 3PSBA 2CGVA 1CMKE 2WNTA 3LXLA 4FT0A 2WMUA 2QI8A 2CSNA 3KXZA 1CKPA 1KOBA 3HRCA 5C8NA 3BEGA 2FP4B 4QTDA 5AP6A 3ZRKA 4PDOA 4AGWA 5LQFA 1CQJB 4GU6A 1JKJB 5CU2A 4BN1A 4LGHA 4MNFA 4XZ3B 2PE1A 2W6QA 4RIXA 3ZU7A 4FKUA 4RVMA 5EW9A 4YURA 4FL1A 2XM8A 2FUMA 4AN3A 2FPIB 5IUHA 2W6OA 4I4FA 4BI1A 5IQBA 3DV3A 3G90X 2V5AA 4FFMA 4FIJA 5IQCA 2SCUB 2V22A 1APME 3R2BA 4FKPA 3RHKA 5DN3A 4L42A 4ZS4A 3R04A 3W8LA 3O7LD 4BGHA 2I1MA 2F7ZE 1U5RA 3I60A 3BYOA 3POOA 4XMOA 2XKFA 2OJJA 3UIXA 3BV3A 4W4VA 1GGOA 4MA0A 2HZ4A 3RV4A 2QOOA 2R7IA 4GK4A 5DRBA 1UNGA 4JL9A 4X0MA 3SW7A 4MA5A 1QPJA 3Q52A 3IDCA 2HENA 5CF8A 4BYIA 1AGWA 2FYSA 4FV4A 3JZIA 2KTYA 4PMPA 4TW9A 3C4XA 3HUBA 4DGGA 5LVMA 1F5QA 4QMMA 5CF5A 1YXUA 3HMIA 4AX8A 3U6HA 5HBRB 1ULZA 4FKSA 1M0TA 1BXRA 3OF0A 2FPGB 3W2SA 3LFAA 4YMJA 4OLIA 2ETKA 3DBEA 2VD5A 3DOGA 2OXYA 2YRXA 3I6WA 2YZGA 5KKRC 4HVHA 5E8SA 4R77A 3ZLSA 3EYHA 4MWIA 3RCJA 5BVDA 3G6HA 3VA7A 4XP2A 2WO6A 4WKQA 5HO8A 5HE1A 3KF7A 4O2ZA 3U54A 2QG5A 1OUYA 4FT3A 2WTDA 2FB8A 4BDCA 2BALA 1M2QA 3I7CA 2JIVA 1OL1A 4O27B 4A9UA 3ZS5A 4D9UA 4PDSA 3NNUA 3UIMA 5DR2A 2ZDQA 3VAPA 3FLNC 4DFXE 4XX9A 4QMOA 4FZ7A 5GINE 3CD8A 3DNEA 3MB6A 5ANJA 1HCLA 4HNIA 3FQEA 4IB5A 2ESMA 4FL3A 3SKCA 4ALVA 3DKCA 3VW8A 2I0HA 5AV4A 1BX6A 3E8EA 4JS8A 2UZEA 4QT1A 1YHWA 3TV6A 3BLQA 5AP7A 4U80A 5E9EA 3EZVA 2CKOA 2QHNA 3NYOA 3EB0A 1PMNA 5FRIA 3TNIA 4KSQA 4M14A 4ASDA 4MCVA 3MY0A 4D28A 2WAJA 4DINA 5HLNA 2C5NA 1TQPA 3A7HA 2I87A 5M51A 5EFQA 5IEXA 2BKKA 5HZNA 1ZLTA 1WBVA 4XG6A 4YJPA 3HLLA 2G2HA 3WO0A 3UYSA 3QX2A 5FP6A 1PHKA 4FVQA 3KMMA 4XG8A 3TQTA 1E1VA 3LXPA 3UP2A 5HVKA 4QTAA 4XHKB 3CQUA 2OF4A 3HMMA 5HNBA 3VS0A 4JLCA 4XCUA 5H8BA 4EYMA 3BZ3A 3U8WA 5CQUA 2G2FA 2VTHA 4QTCA 4L67A 3FZ1A 4J98A 3UTOA 3HKOA 4LM5A 4DEAA 5KMOA 5LMKA 3IO7A 3QCSA 3VHKA 4CZTA 1L8TA 3LVPA 1EZ1A 2GS6A 3G9LX 3LFFA 4N6YA 2R3LA 3BWJA 3VUMA 4NH1A 3SHEA 4Q5HA 5LXTF 2CN5A 2PVNA 3TNHA 3UNKA 4OR5A 5CZHA 2XF0A 4LI5A 4XS2A 2BKZA 3ZSHA 1E4EA 2ZM1A 3KRXA 3OW4A 3NW5A 4PTEA 3RPSA 5IYZF 3QU0A 4C5AA 3DK3A 3H9RA 2Y6MA 3SXSA 4E5AX 4QMYA 3SV0A 5EOLA 5L2WA 3BV2A 1UWJA 4GG7A 4FNYA 5CU6A 4CFXA 4DBNA 5I0BA 5E8XA 4RWIA 3OROA 4AFJA 1C3OA 4AW2A 3E92A 3D9VA 3V04A 3BEAA 3R1YA 4ZTNA 3BYUA 2WPAA 4Y95A 4EHEA 3ZEWA 5IDNA 2PMOX 2BAQA 3NUNA 3KKVA 5DVRA 3I12A 5DOSA 4WNKA 4YP8A 2X8EA 2EWAA 4XG3A 3ELJA 5M44A 4DEGA 5A6NA 4MF1A 2DQ7X 3PG1A 4RSSA 3DJ6A 5HE3A 3U4WA 2GDOA 5I9ZA 2C0OA 5AA9A 4FTCA 4C4EA 3I81A 5JFVA 4N6ZA 4X3FA 5E92A 2XJ1A 3BU6A 4QNYA 4NCTC 3TIYA 5IA3A 4KKHA 3VQHA 4LFIA 4U3ZA 4ZY5A 4YZBA 4FIHA 3A2CA 4C3RA 3LKMA 5KMNA 5DRDA 3G51A 1H0VA 3CSVA 3MJ1A 3FMEA 5CASA 2X2MA 2GQRA 3BBTB 2GTNA 2WXVA 3FMDA 2VAGA 4FOCA 3O17A 4GFGA 2IZSA 4IX4A 4JQ7A 3R8VA 4AG8A 4E93A 3QTUA 4OTIA 5C9CA 2WIHA 5AUYA 4KSPA 1SNUA 4O2AF 3KB7A 1TQMA 1JSVA 3PIZA 4XJ0A 3TUCA 5HI2A 2DWBA 4EOIA 3DTCA 2GNFA 2XEZA 3MH0A 1PXPA 1ZOEA 3PIXA 4EWQA 5IISA 3W33A 4BDFA 2B9IA 3NCGA 3OZ6A 5EHLA 3TZMA 1VBGA 2NO3A 5G6VA 1PXKA 2ZMCA 4NL0A 4RMZA 3UZTA 1JSUA 3KQ7A 4CGAA 2OH4A 3AW8A 3GQIA 3S95A 4IH8A 3LWBA 4RT7A 3DJ7A 4DITA 4JRVA 3CKWA 3OT3A 2YS6A 3U9TA 1W7HA 1A9XA 3GU7A 2ZV7A 1K3AA 4KWPA 5DI1A 4XP3A 2O3PA 3O8PA 1OKYA 4RC3A 3OUNB 4C2VA 3KAJA 4C3PA 3R6XA 2VV9A 3EQHA 4I6BA 3QQKA 4EK3A 4QMPA 5HCXA 4EGQA 3HL7A 4CTBA 4D1SA 3NS9A 4GUEA 1WAKA 4JDJA 4PDPA 2FO0A 3EIDA 3FKLA 4C7TA 3TZ7A 2CCHA 3CR0A 3OWKA 1KJJA 3QFFA 3ZSGA 2UZUE 2CCIA 2YN8A 3KMWA 4JDKA 3I0QA 3V8SA 3PVWA 3SOCA 5KMLA 4IAAA 3EFWA 2PVMA 3Q32A 4CG8A 3L8VA 5L6PA 4YJOA 2DWCA 3NPCA 5F9EA 3N51A 4MNEA 2UUEA 5DT4A 4LOQA 1W96A 5H80A 5M08A 2WYOA 4O81A 1BUHA 5CF6A 1XBAA 3D15A 4JOAA 2OJFE 3D2KA 3WE4A 3LJ2A 2BRHA 3Q4UA 2IWIA 3IQ7A 3MV5A 4IJ9A 2UW7A 3R7OA 5BX0A 2BHEA 2OFVA 4C36A 3W8QA 5FXRA 5HNIX 3QRJA 2GHLA 4L46A 3EN6A 5T68A 1W82A 2G15A 4W8DA 2WFYA 2XK3A 2Z60A 3PXQA 3FMLA 3Q96A 3C50A 1WZYA 3ZUTA 5M09A 5HGIA 3MPTA 3P4KA 4CKJA 3D7TB 3ID6C 3KULA 2PSQA 5EYCA 1Q5KA 4O7TA 3JY9A 3R5XA 1OIQA 3G0FA 4TWCA 3C51A 4FT9A 2YL2A 4BCGA 4S34A 4ZTMA 5HTBA 4RGJA 2W5AA 1AD5A 1RW8A 5HHWA 5DNRA 3JXWA 3NX8A 2C6TA 1TKIA 3R1NA 3ORRA 3F5GA 2YM3A 5CB4F 2JDRA 4IDVA 4NZWB 4RLKA 3U9NA 3QTQA 3BYSA 3E7VA 3O8UA 5IA2A 2CKPA 3HV5A 3KRJA 5J5SA 5KCVA 2X4ZA 1R0EA 5HV6A 4ALWA 3KRLA 3GBZA 3RM6A 1MP8A 2F2UA 4G5JA 3RPYA 4C2WA 4FSQA 3DXPA 5LJJA 3R22A 4XG2A 4CFNA 5EQEA 5A4LA 3QKMA 2BFYA 4F1MA 2SRCA 4DH3A 1H1PA 3QRTA 3HGKA 4O0RA 5F95A 4AN2A 4ERKA 4OTDA 4ASXA 4LUDA 1T36A 5CWZA 3ZZEA 4IM2A 1LR4A 1IR3A 4Y85A 2JLDA 3ODYX 3F5UA 3UODA 1AQ1A 3EQRA 1SVGA 4KKGA 2Z8CA 4TYHB 5BPYA 2XRWA 4Z7GA 3QQUA 1PKGA 2XP2A 3PJ1A 5IA5A 3VS5A 4E4MA 1SCUB 2OBJA 4QP2A 3Q2OA 1VYWA 2WU7A 1UU3A 4IIRA 4JAIA 4W4YA 5ANDA 3OP5A 3GEQA 4GV1A 3GCVA 3AC2A 3Q4TA 3A7IA 3DFAA 4IFGA 2LAVA 4QP6A 4EOQA 1W8CA 3BQCA 3CS9A 2BTRA 3OC1A 3E93A 3JVRA 1Q8YA 4FE2A 2VTSA 4EH6A 4F4PA 5HLWA 2BDFA 1V0OA 2XK9A 3UMXA 4IWOA 3S1HA 1SYKA 3GENA 4CFUA 3CJFA 5CLPA 2F57A 3BELA 3SG9A 4HGLA 4U97A 4TWPA 2W7XA 3ETJA 2XD4A 1NVSA 1SVEA 4YNOA 4JNWA 4EK4A 4L9IA 3NUXA 4TV8F 5GJDA 1O6LA 1OIYA 2VTIA 2VQDA 3DKOA 3HV6A 3I79A 4M13A 3QFVA 3HA8A 4P7EA 5EQPA 1HOWA 2WGJA 4PUZA 3LFDA 3PA5A 3SE7A 1PJKA 2OIDA 1B6SA 1CS0A 3FUPA 3ZM9A 4FSUA 3AT4A 3FJQE 3GU8A 2WMQA 3GQLA 2X0SA 3HRFA 4TWOA 4RX7A 3E62A 2R3NA 5G1XA 2DUVA 2HXLA 3WIGA 1STCE 4J7BA 3PXYA 3VVHA 3PJ8A 1X8BA 4YZDA 3BYMA 2OH0E 2G01A 4N4SA 4HR7A 4E73A 4QQCA 4GKIA 3GI3A 1H4LA 3FLSA 5E1SA 3DBFA 4EK5A 3QZHA 4GT4A 5CANA 5C8YF 3GC0A 2C6IA 1KJ9A 1IRKA 2QURA 5HESA 5L6OA 3EL8A 2GQSA 2QOLA 1SNXA 3RGFA 4IDTA 4UV0A 3HZTA 3RM7A 4M9UA 4G2FA 5T6KA 3FMNA 1FVRA 2GTMA 3BGQA 3OWJA 4IB3A 5EW8A 4TWNA 3D94A 5L6WL 3ANRA 5I9VA 1PXMA 4GW8A 1R0PA 4G3DA 3FV8A 3SQQA 3NMUF 4OTGA 4EOSA 3A7JA 4I6HA 4AT5A 4A4XA 4G3CA 4RA4A 1ZZLA 3QRKA 5LOHA 5KX8A 1MQ4A 3U55A 2B1PA 4XRLA 2JBOA 2YIRA 4RIWB 5DYJA 5HTCA 1Q97A 4O6LA 4QP3A 3P9JA 3PRFA 3MH2A 4XNEA 1M6VA 2CGUA 3G9NA 3FBVA 5H8EA 3FXXA 2YM7A 4BDAA 4QMZA 4CFMA 1XWSA 4DBXA 4W4WA 2W1GA 4NU1A 5FM2A 3F2AA 4R78A 2RFDA 1LP4A 2JDVA 2Q83A 5TF9A 4QTEA 3BYVA 5DR9A 1QPCA 2GNIA 3FKNA 5HG9A 5DIAA 4BCFA 1U46A 3FSKA 4DFLA 1KV1A 3DKFA 1Q3DA 4DH7A 4G31A 5JQ8A 5M06A 1J91A 2E9OA 3KXMA 3MIAA 1Z57A 4IADA 4M69B 4PQNA 4AE9A 4W4XA 3LCDA 4BCKA 2UW9A 3R73A 4DG0E 4PF4A 5KBRA 4CCUA 3MGYA 2UZLA 4YJVA 4EOLA 1YWRA 2UZVA 3PSDA 5JQ5A 2XVDA 1B39A 1PW2A 2Y0AA 3FXWA 3PXKA 4ORKA 3QD2B 4BCIA 3W2CA 4EH3A 3AMYA 1A06A 2XBAA 3BHHA 3S00A 3EFJA 2VGOA 1JDBB 4DTAA 4I3ZA 5M53A 4RQVA 4EOKA 3F3WA 3R21A 4Y72A 4EJNA 2HZNA 5CEQA 3FAAA 4DTKA 3G8CA 4C5CA 2C30A 2C68A 1MRVA 2ITWA 2UW3A 3C4CA 4KRCA 2J4ZA 3KK9A 2ZOQA 5EHOA 1IAJA 5KO1A 1WR2A 3GCUA 4GJ2A 4ASZA 2XA4A 4I23A 3OOGA 2R9SA 3H3CA 4OTHA 3LXNA 4HGTA 4IAFA 2VWYA 3K5HA 1S9JA 3IK3A 4G9CA 4QP7A 5FLFA 3P1AA 3WNZA 4XV2A 1ATPE 4D58A 2IPXA 5IQAA 2OXXA 3C0GA 3PXZA 4FYNA 3PY1A 2A0CX 4FKTA 4I4EA 3Q9YA 3T9TA 4BZDA 4IZAA 3L9PA 4AGCA 2GS2A 5CSVA 4LL5A 3C4ZA 3MS9A 3HA6A 4LGGA 3VRZA 4MXOA 4C02A 2HAKA 3F3ZA 5CTPA 2Y6OA 3L9LA 4IC8A 3V51A 5AP1A 5IQGA 1RQQA 5H9BA 1YXVA 3IW5A 2F7EE 3KXXA 4C38A 3LMIA 5AUZA 2BRNA 5BMSA 5J9YA 3F2NA 4ZTSA 3MWDA 3VBTA 3ATSA 2W96B 4MV6A 4TTHB 2C6EA 3OHTA 2ZV2A 2UV2A 1KSWA 4H1MA 4IVCA 1H01A 2W1DA 4GYIA 5GJFA 4FR4A 4UALA 4IM0A 4TYIA 2J90A 3H0ZA 3H9OA 1CKJA 1KUTA 2XNMA 4P90A 2RIOA 1U54A 4EUUA 3LZBA 3V5JA 5FEQA 4QO9A 4U41A 4DH5A 5AJQA 5AP0A 1W98A 4IVBA 1FGIA 2BPMA 3PTGA 3WZKA 3KAKA 1LPUA 3MFSA 4KBKA 3W32A 4DE4A 4GVAA 4F65A 4D4RA 3CTJA 3NUSA 2C3IB 3CY3A 4E6DA 1DIKA 3MVHA 3E5AA 3QTWA 4ZJIA 3ZOSA 4AS0A 5AUWA 5CAUA 2UVXA 2ZJWA 2IJMA 3E88A 4HZRA 4PMMA 3D14A 4TRLA 1OIUA 5KKRB 2XK7A 4M7IA 4ACGA 3PRIA 4ITHA 5FM3A 4Q9SA 4E4TA 5IA0A 3LCSA 1DAWA 3FMKA 3EQPA 2Z7SA 1JKSA 3V3VA 3C4FA 2JDOA 3VBQA 3MH1A 4USEA 4USFA 4C61A 1Q41A 3N4VA 4J96A 3RK7A 4HYIA 5AM6A 4APPA 5JQGF 4CT2A 4K11A 1JKTA 3OVVA 4KB8A 4AT3A 3HMOA 1E4EB 4J99A 3JZFA 4FSTA 1UNLA 4FK6A 4S33A 4NUSA 1PXNA 1WVXA 1OGUA 1PY5A 4FV0A 4MV9A 1H28A 1VJYA 2XKDA 5E91A 4WUNA 2W4KA 3QYWA 3TXOA 4A9SA 3PYYA 4ZQIA 1IG1A 2YM6A 3FI3A 1OL7A 3OUZA 2BZIB 2XH5A 4O0SA 2PL0A 3EQGA 5EYKA 1WFCA 1WBSA 3R9HA 1FOTA 4F9WA 2WQEA 3D0EA 3R7VA 4HW7A 4RZQA 5TKDA 2VTLA 3E63A 4KIOA 2FSTX 2XYNA 4PTGA 3V5LA 1JLLB 3IDBA 4XYLB 3LQ3A 3ZO1A 2HELA 1GIHA 2ITOA 3TIGA 3Q6UA 5ACBC 5HU9A 2VWXA 3CKXA 3FC2A 3ORZA 5BVWA 2HYYA 2AC5A 5E8VA 5FXSA 3FYKX 2YZAA 4X2JA 5D7AA 3MTFA 1K9AA 4B4LA 4TL0A 3VS1A 4GJ3A 5KE0A 2V58A 3H4JA 1OZ1A 1U5QA 3NIZA 3QKKA 1DV1A 3E5NA 4O7YA 4FV6A 2OK1A 4BBFA 3TIZA 2V62A 1GSHA 2J0KA 3CLYA 2E9NA 3E8NA 3KXNA 4P2KA 2VTOA 1F0QA 4I92A 1M17A 2J9MA 3KU2A 5BUEA 1BL7A 4NCTA 5CU3A 1B6CB 4EHZA 1H25A 5KHXA 3R5FA 4ZZNA 5LWMA 3NRMA 3MSSA 2DS1A 5BVNA 1BKXA 4YJQA 4CMUA 2XYUA 2R3QA 4HOKA 4V04A 5AX3A 5DLSA 4FSMA 3C9WA 3AGLA 3FI4A 4ZMEA 3F82A 3UO4A 4YJNA 4L1KA 2WQNA 3MBLA 4KINA 5FEEA 1Y8YA 5E8TA 4F1TA 4K8AA 1IA9A 5LVNA 3R28A 4AZEA 2PMIA 4YO6A 5EQYA 4FA2A 5IDPA 3RUPA 1M7NA 1VR2A 1JOWB 2GNHA 3NYNA 5AWMA 1I7LA 4CRSA 3HMPA 3RFCA 3R8LA 3PLAE 5JQWA 2EXMA 3ZLYA 4RWLA 5BYLA 3TJCA 3BHTA 1Z2OX 2B55A 3BHVA 3F9NA 4FT5A 3TNWA 3POZA 3Q5IA 3V8TA 5E8ZA 1H1QA 3ZONA 3ENMA 3ZFYA 1KOAA 3NSZA 3I4BA 3R8MA 4EH7A 1Q99A 4DFZE 3QTZA 1GSOA 5E8WA 2EB3A 4XP0A 4FFNA 3BE2A 2F4JA 2J51A 4KABA 4FV9A 5A3XA 3MWUA 1YQJA 3FEGA 3NUAA 3MVLA 2X9FA 4JJRA 3CQEA 2XIXA 5D41A 4ZS0A 2XNOA 5CI7A 5KZ0A 4C37A 4AW0A 3OXTA 3TKHA 2OLCA 4O7VA 3QRUA 1TVOA 4FZAB 1R78A 4E6QA 3ROYA 3QD4A 3P7CA 4R7IA 4YBKA 4DG2E 4YR8A 2CKEA 2RG5A 4A07A 3UPXA 3KXGA 4RWJA 4TNBA 1IOVA 3C5UA 4FU0A 5DPVA 2WKMA 4F7NA 4PDYA 5B2KA 4AAAA 4FICA 4IZ5A 3ANQA 4KBCA 5ICPA 3B2TA 3EHAA 5HD7A 3VPBA 3S3IA 3PIYA 4BKJA 4BZNA 1UV5A 5A54A 2OFUA 4E6CA 2G1TA 2VTMA 2GFSA 3BIZA 4ZP5A 3CCNA 3WOWA 3VBXA 4BCMA 4ZSAA 3FC1X 3GIDA 2UW6A 3ZO2A 3Q5ZA 3UNJA 3R7IA 2GPWA 3GCQA 4MQ1A 3UP7A 5JSMA 3R30A 1XH9A 5KBQA 1KE9A 4RIXB 4JG6A 1PX2A 3SG8A 1YXXA 5HORA 4EK6A 4G3EA 3MWEA 1S9IA 2E2BA 3IW6A 3NNWA 2HWOA 4TYHA 4AFEA 2OXDA 3D4QA 3MIYA 3ROCA 3OEZA 5LYJF 3UOKA 4B7TA 2AYPA 3PP0A 2BZKB 3GGFA 2XZSA 3RHXA 5K4JA 2IZRA 4U42A 3RPVA 4IHJF 3FLYA 4YBZB 3GU4A 1P5EA 1ZY4A 2R2PA 4MD8E 4QYHA 4LRJA 2JBPA 4UY9A 5KMJA 2YZLA 3JR1A 4JQEA 2V55A 4IZ7A 5AP5A 5L8KA 1KEEA 2R86A 3TZ9A 5E8UA 5LXMA 3I5ZA 3A4PA 4FZDB 4FIIA 4AOJA 1P4OA 3LHJA 4FTOA 3VJOA 2H34A 2UZWE 4XG7A 4WD5A 5HU3A 4Y8DA 4QYGA 4RVTA 4UEUA 2CZGA 4PX6A 4KIPA 3HDNA 4RJ6A 3R0TA 1V0PA 2WTIA 4DEBA 3KRWA 1VZOA 4MV4A 3RAKA 4AWIA 3Q4ZA 5BVEA 2PVLA 1IAHA 3SLSA 3FL5A 2NU7B 4XLVA 4EH8A 2WTKC 4UB7A 1YWVA 5EKNA 2XK4A 4RRVA 4O4JF 4XLIA 2BRGA 2DZDA 4R6VA 1ND4A 4FV8A 3VWAA 4CFFA 5HIEA 5CA0F 4IVDA 3RP9A 1PKDA 4JR3A 4C33A 4FKVA 5M4CA 4QYEA 2YYAA 3JRWA 5AUUA 4M0ZA 4MX9A 4LV5A 3EQBA 3AT3A 4GRBA 4X3FC 2UZOA 4YPDA 3VQUA 2JGZA 4KKEA 4TYEA 4C4FA 4ME6A 3W55A 4RZWA 3E3PA 2Y8OA
chains in the Genus database with same CATH superfamily
2UW4A 5AAFA 2H8HA 3HYHA 4F7LA 4GUBA 3SA0A 3K54A 3I1AA 4GCJA 2NU9B 3GP0A 2WTKB 2R7NA 4FG7A 4BDDA 4ZY4A 4FVRA 2QO2A 3TKIA 2JKQA 4F0FA 2X0GA 4YU2A 2H9VA 2PZPA 4UX9A 3MTLA 2YZNA 3HB9A 4MNEB 2QC6A 3ETAA 3F3UA 3RMFA 4BY9E 5LVLA 2BDJA 2X39A 5J9ZA 4U40A 3E8CA 3G33A 3DK7A 5M55A 2NUAB 5D1JA 4FKWA 2BZJA 2BFXA 1H1RA 4YUQA 5AUTA 4EC9A 2UVYA 4B8LA 1JPAA 2QNJA 2NPQA 3OCGA 4AQCA 1Q8WA 2VWWA 2XK8A 5D8DA 3VNNA 2FSMX 4U44A 1C30A 2E9VA 3OTVA 4AT4A 2EVAA 4FFOA 2CLXA 2CMWA 3BQRA 4K33A 3QD0A 5B7VA 3VJNA 5A4EA 4MAMA 5GJGA 3HVCA 4X6RA 4QNAA 2XIZA 4FBXA 3A8XA 3HUCA 3MB7A 4DN5A 3LLTA 5K5NA 4UCTA 1WMKA 4R1VA 3R9NA 3QLFA 4NM5A 3T9IA 2GPHA 2R84A 1CM8A 2ZMDA 3QHRA 1OL2A 3PVUA 4FNWA 1TQIA 1YWNA 4CFWA 4YSJA 5BNJA 2ITTA 2R3JA 3R7UA 5IQFA 4S2ZA 2XIRA 5M56A 3O0GA 5J1VA 1KBLA 4ZJVA 1GZNA 1GIJA 1JLUE 1Q3WA 4NTSA 4O7SA 4YZNA 5ANEA 3CGOA 3RAWA 4DGMA 5FR9A 2A2AA 2WQOA 3DK6A 5EYDA 2NYAA 4K6ZA 5HNGA 3RWPA 3UGCA 3ULZA 1J7IA 3C13A 2I40A 4R3RA 3QQJA 3UMWA 5JRQA 4CMFA 5L2SA 3RVGA 4PY1A 5FDPA 5AADA 2C6KA 4FTUA 4PBCA 3AC4A 3OT8A 4IX6A 4GIHA 3EWHA 3QHWA 1WBWA 2GHGA 5LMKC 4WNPA 3U4UA 4G3FA 4NJDA 4IHPA 5CZIA 2W06A 3AC5A 4X3FB 1KE5A 2PUIA 1MRYA 4D2RA 3RJCA 4CTCA 3G5DA 3T54A 4L68A 4XOYA 3I7BA 3QL8A 4WSYA 5CYIA 1H26A 5HBEA 1DS5A 4DT9A 2X81A 2BILB 3FZSA 3UIBA 1KTAA 4N0SA 4JT3A 3DB6A 3EFLA 4TYJA 3LCTA 2R3FA 3PJ3A 3DTWA 3R1QA 2ZDHA 4NW5A 4O38A 5J1WA 4EQMA 3F3TA 1R39A 3EZRA 4U3YA 2C6DA 2CHLA 3I0OA 4FV5A 2WMSA 4FTJA 4RFZA 2JKOA 1PK8A 4O4IF 5I5VA 5JVLA 2O5KA 3R7YA 3THBA 4WNMA 5FDXA 3KEXA 5KNJA 5M07A 3BCEA 5F94A 4DC2A 4IVAA 3N9XA 2JIIA 5L3AA 2PE2A 2PTKA 4UN0C 2H96A 5BWTA 1A0GA 2QKRA 4O0VA 4UYAA 4PWNA 5IU2A 1B04A 2A1AB 5J95A 1XMLA 2OJIA 3B8QA 3QGWA 4IEBA 3P79A 2IVTA 1OVEA 5EDQA 4TN6A 3RK5A 2PVPA 4II5A 4L8MA 3OG7A 3TT0A 5L8LA 4RJ5A 3ATTA 4WUAA 2X7FA 4BVUA 3K3PA 3GU6A 1UKIA 4RVKA 2HHFA 4XG9A 4M84A 4EH4A 5CF4A 2PWLA 1P4FA 3ERKA 3NNXA 4AUAA 4IWYA 3GCPA 4GT3A 4I1ZA 2NU8B 5KX5F 3OBJA 4HPUE 4I41A 1PXIA 3PJ2A 4R5YA 5EI2A 5AUXA 5HICA 4E20A 4BBEA 3Q2MA 4FJVA 2R0IA 3PXRA 4UYNA 3IGGA 4G1WA 1FBNA 4GMYA 4NM7A 3RK9A 4B0GA 2WMWA 4CG9A 2VO7A 3COHA 4IW0A 2JFMA 4FSYA 4FKLA 5I9UA 4JDHA 4HVGA 4J8MA 3EKNA 4ITJA 4A9RA 4ERWA 1ZWSA 5FTOA 4PNIA 3QZFA 2IZUA 3E87A 2R3RA 2YIYA 3C5IA 4Y73A 5KS8A 4UCRA 2E9UA 1JAMA 5FP5A 3V5PA 2BTSA 4EOOA 2P0AA 2YRWA 4HNVA 4F1OA 5C03A 2VX1A 3PDTA 3PZEA 4O7WA 3IGOA 1I1LA 2ITYA 5CI6A 4ZIMA 2I7QA 4BTMA 5CE8A 2C0IA 5CVGA 2I80A 4XBRA 4YTIA 1KE6A 3RAIA 1OITA 4ANQA 4X3JA 2X2KA 5DEYA 2ZDGA 1YOJA 3EN9A 3LFEA 4Z9LA 5BWWA 5K4IA 4V05A 3COIA 4IAIA 2QOHA 1XO2B 3DJ5A 4GVJA 4CEGA 3CC6A 2WMTA 4I0TA 2GMXA 3DQXA 3NAXA 4FV7A 3ACJA 4B9DA 3OY1A 4ZK5A 4FG9A 5JKGA 3UBDA 3VF9A 3D5UA 5HD4A 3MY5A 5AIKA 3UZRA 2OICA 1CKIA 1OL5A 3FYJX 4X6QC 4DLJA 1Q8UA 3SGIA 1M2PA 1TFFA 3BL7A 4FTNA 4U8ZA 5ANIA 5FTQA 1X9NA 5HO7A 2W5HA 2XCKA 3EN4A 5C1PA 5HG8A 3VUHA 5BVFA 5HBJA 3ZRLA 4APCA 4FODA 4ZXTA 5IPJA 2CNUA 4PTCA 2R3IA 3BRBA 3NZ0A 4S30A 3LE6A 2C3LA 4G34A 4NK9A 4USDA 2P3GX 3O50A 2CNQA 3DAEA 5CU4A 5F20A 3VS4A 3FLWA 5EK7A 4HN2A 4EKKA 1OPKA 2Z2WA 4FZFB 4L3JA 4QQ5A 5TOZA 3B8RA 5JGDA 4I6LA 4ZTHA 4CCBA 4JR7A 3H30A 2W17A 5FG8A 4DFBA 4CKIA 4YLKA 4HCUA 3R8UA 4I5MA 4YLLA 3AD5A 4GK2A 3P7BA 1FMOE 4MTAA 3T7AA 3FXZA 3TKUA 1M0WA 3OBGA 4N57A 4DFNA 2YDJA 4EH2A 4KA3A 3N8DA 5CAEB 4RC2A 2O64A 2J2IB 2X4FA 4FEQA 1YXSA 5GONF 3K3JA 5E7RA 5J87A 2HY0A 2V7OA 4ARKA 3U9SA 3IW7A 3EN5A 4O2PA 2QO9A 4Q2AA 4L53A 5E90A 2PVKA 1KJIA 4XYMB 4QYYA 4J52A 4EQCA 4O96A 4MQ2A 5IF1A 1IYDA 4ZJJA 4HVIA 2BUJA 3QZGA 4K2RA 2NP8A 3IOKA 3LMHA 5EM5A 3UOLA 4F7SA 3UPZA 2VWBA 4QMNA 4JG7A 5A4TA 1BNCA 5EI8A 2XIKA 3CEKA 3GCSA 4EHVA 3TW6A 2BIYA 2J0IA 1ZAOA 3W1FA 5D9HA 2P2IA 2ONLA 2PUPA 4RWKA 4AZTA 4YJ3F 4K6NA 2REIA 4IWPA 4H1JA 4MK0A 1W0XC 2CLQA 2EJ0A 3ENHA 3LFSA 1EKFA 2GNGA 4X2FA 5CT0A 1DGSA 4DEHA 4O0YA 1M7QA 3OCSA 4AN9A 4M0YA 1M52A 2PMLX 3NUPA 3ZC5A 3VRYA 3R02A 4FTQA 3A62A 2VTNA 3WF6A 3SRVB 2YJRA 5HIDA 2X5RA 5AEPA 4OUCA 4BCPA 4MXXA 2QOCA 4BYJA 3MDYA 4ZZOA 2G2IA 4O7NA 3UG2A 2XNGA 1ZZ2A 3JSNA 2WQMA 4I5PA 3QUDA 3GC7A 3R01A 5FGKA 4DYMA 3DGKA 1FMKA 4OTFA 2C5XA 2LGCA 4ZSLA 3TUDA 3JRXA 5IUIA 4M8TA 2W1CA 5C4KA 5CAOA 2VWUA 4NYEA 2YIWA 2R7BA 3CPCA 4KNBA 5HX8A 3T9BA 1OL6A 2GPSA 3OD6X 3EMGA 1CKOA 4FOBA 4YTHA 1I2LA 3PE1A 3D7ZA 1ZMUA 2ACXA 4M68A 1JKLA 3KGAA 1I1KA 4IZYA 3PWDA 3BI6A 4CQEA 4R5SA 2I8CA 1HCKA 4BDEA 5CM0A 3D5WA 5EKOA 3UIUA 4DH1A 2YZMA 4ANLA 3C7QA 4FVPA 4IMYA 3QWUA 1OBDA 1J7LA 3IW4A 5KZIA 3WIKA 5B2MA 4CKBA 2W9ZB 3A7GA 3Q9XA 2YWVA 5AP2A 4RX8A 1YI3A 3A61A 2QKWB 4TXCA 3LMGA 1YW2A 5EW3A 1H27A 4MD9E 1LUFA 3FQHA 3N4UA 4IBMA 4D55A 3VUKA 4AA5A 4JIAA 5IH6A 3S24A 3EQIA 2YA9A 3QQGA 3R9OA 3K5VA 2Q0NA 3I5NA 1NT2A 4EOJA 2OJGA 3ODZX 5L8JA 2HZIA 2Q0BA 4J53A 5I9WA 3DNDA 4D1XA 3VW6A 4AA4A 5FEDA 1KJ8A 3NNVA 2J0LA 4JXFA 4A4OA 5CXHA 4UZHA 3TINA 3ZH8A 2WTVA 4M15A 3FE3A 3Q4CA 3SAYA 3UO6A 2P2HA 3VUIA 4EKLA 4FIEA 4I6QA 1G8SA 4ANMA 3L8SA 5C8KA 2OJ9A 3UG1A 5LP6F 5ETAA 1ZYJA 3FLQA 5ITAA 4EQ5A 3AGMA 1WCCA 3JVSA 3QXPA 4OT5A 2ITNA 4FTLA 3MESA 1G8KA 3M2WA 3ZUUA 4TUYF 1QL6A 3MFTA 3VBWA 4PL4A 5H8GA 1SZMA 3OMVA 1OPLA 3DKGA 4JI9A 4QP4A 4IFCA 3BGZA 1H24A 4RFMA 4RIOA 4U79A 2FVDA 5IA1A 4FTMA 2W4JA 2YM5A 2Z02A 2EU9A 4M97A 5AV2A 2ETMA 4J71A 3F2RA 2QR8A 4L7SA 5CT7A 1EYZA 2HGSA 1W83A 2ITUA 3OWPA 3ZZWA 3TEKA 5JRSA 3F3VA 2G9XA 3EQDA 5FXQA 4ZY6A 3ALOA 3SVVA 1B38A 3AKJA 4NTTA 4OBOA 4I5CA 2XJ0A 5AA8A 4JBOA 2W1ZA 4ACDA 5A4CA 2R3MA 1QCFA 2YABA 4FKIA 5HEZA 5HE2A 3QX4A 4CMDA 5JVDF 1Z5MA 5CNNA 3H9FA 5JEBA 3L9MA 2COIA 3BLAA 2YITA 4PP7A 4WT6A 3P5KA 4QMWA 2B9JA 1OKVA 4QP8A 4J8NA 5J7HA 2UZDA 5AAEA 5CEKA 2FB9A 3O2MA 2HZ0A 1XBCA 5M57A 2WTJA 4RCNA 2X6DA 4EWHA 2UW5A 1ZMVA 5KMMA 4QTBA 3HAVA 4IWDA 4FV1A 1FPUA 4YC6A 3TM0A 2ONLC 3BBWA 1PXJA 2B53A 1H00A 5AV0A 5H3QA 4BTKA 3HECA 3KY2A 5C01A 4BTJA 1EUCB 3ZLXA 4M12A 4MBJA 4X7QA 4YC3A 1UA2A 2YFXA 4MWHA 5LCKA 3ORIA 2JAVA 3VS3A 4FK3A 2YHVA 3NIEA 4LMNA 5CEOA 4O2BF 2X1NA 3AG9A 3HV3A 4YBJA 5JFXA 1CKNB 4ZAUA 4EGJA 2WZJA 4E5WA 2ZB1A 1OPJA 3OOMA 1ERKA 2VTJA 3NUUA 4RJ7A 2OLSA 2YAKA 4NKSA 4L52A 4BR3A 2PMNX 3R9DA 2R7MA 5HE0A 3ZFXA 5K9IA 3Q6WA 3W0MA 5EH0A 4F6UA 4RIYB 5HQ0A 4D5KA 5CXZA 4Y8VB 3PG3A 4F9YA 5F1ZA 4C5BA 4YJSA 4ANSA 4EEVA 3WE8A 3NVKI 2NRYA 1G8JA 3BE9A 4OTRA 3TV7A 4ZLYA 4Y5HA 1NW1A 4BGGA 2FSOX 3LLAA 2Y4PA 4G6NA 5BQ0A 3QA8A 1YI6A 3TYKA 1PXOA 3KCFA 4O4HF 5FD2A 4O0XA 5EDRA 5GNKA 3TWJA 3UNZA 4AZVA 2OSCA 4E4LA 5HLPA 5KHWA 2VX3A 3MH3A 4O22A 4F09A 3NGAA 4AE6A 4IIJF 1ZRZA 4UWBA 4RQKA 1E9HA 4AU8A 3LCKA 1GZ8A 1ZOGA 3HAMA 4MXAA 2C47A 3F88A 4E5BA 2ZB0A 3UE4A 3HT5A 1WVWA 2PUUA 2ZAZA 3MVJA 2F2CB 4RA5A 3GB2A 3KCKA 1XH4A 4O91A 4LOPA 4XEYA 4XBUA 3VMMA 4LMUA 1OI9A 5FQDC 2VNWA 3QWJA 3DLSA 4R3CA 2R64A 5AV1A 2OZAB 3QXOA 3W2QA 4FFLA 3KN5A 3WF8A 4G17A 3O96A 2GSFA 4XRJA 3VONA 2ITPA 4FFPA 3NW6A 5L2TA 2PUNA 3ZDUA 4HGSA 4DDIA 3Q3BA 1GZKA 5CEIA 5BWXA 4DTBA 2ERKA 5AMNA 4E8AA 2W1IA 2B0QA 4H3BA 4YLJA 4MV3A 3VNTA 3RTPA 1M14A 4Q9ZA 4I94A 2A4LA 3MA6A 4M3QA 4CZUA 3NDMA 3KF4A 5H2UA 2CJMA 2C5VA 3K3IA 4G9RA 3UVRA 5AV3A 2BVAA 3FZRA 3PPKA 2AEGA 3CTHA 3DBQA 4LG4A 2X2LA 4KS8A 1YVJA 4FEUA 2HVQA 1OM1A 4FC0A 4CXAA 2OZAA 4BI0A 3VS2A 2HY81 3BG5A 4YAJB 5JZJA 5EM7A 1RJBA 3KVXA 4X21A 2R85A 3TW7A 4FX3A 2JDTA 3OXIA 4U7ZA 3EYGA 5IEVA 2C3JA 3WF5A 1BMKA 2IZTA 4WRSA 1F3MC 1T46A 2R3KA 2W1FA 2ZM3A 3O7LB 5BUIA 1Z9XA 3BLHA 3LFNA 3OW3A 4WIHA 4L00A 3RR5A 1SVHA 3QTRA 4K18A 3MJFA 2P33A 4ZSJA 3FPQA 3QKLA 3QWKA 4QQJA 3G2FA 5DT3A 5EI6A 3BLRA 3F7WA 5TR6A 4JMQA 4C4IA 4E4NA 1R1WA 4K9YA 3R5HA 1NVRA 5HVJA 2UZNA 2VO0A 3LQ5A 3LXKA 4FUYA 4WG4A 2J5FA 3AC8A 3RI1A 4BICA 4Z55A 2DLNA 4FKQA 2JC6A 4MV8A 3QAME 4Y83A 2GFCA 2E9PA 4YJTA 5EDPA 3FQSA 3V5WA 3UOJA 3QYZA 1Y91A 4L3PA 2HIXA 1Y8GA 2OO8X 4AOIA 1DAYA 3QTSA 2RKUA 3OUKA 4BHNA 2PBZA 3LPBA 5IQIA 4DHFA 4MYGA 1Y6BA 3E8DA 1V1KA 5DHJA 4ALUA 4HYHA 4Q5EA 1GJOA 5IQDA 5CY3A 3MI9A 3AKLA 2DYLA 4KS7A 3DXNA 2I0VA 3OY3A 4FKRA 5AIRA 3F66A 3ORQA 2ZFYA 1PMVA 3WZUA 2ZGIA 3ML1A 1G3NA 2WOTA 4J95A 4FTAA 4U5JA 5C26A 3VN9A 4L43A 5ANOA 4GH2A 2FA2A 2XK6A 3WARA 2CDZA 2HXQA 3DDPA 2PYWA 3Q9WA 4O0UA 5D7VA 3II5A 2IW9A 1PYXA 3PN1A 4LRKA 4YZ9A 2OIBA 4IQ6A 4XV1A 4NFNA 4AF3A 2VO3A 4DA5A 3CPBA 2UZBA 4ZTQA 3FZOA 5CS6A 2PZIA 2XNBA 3O51A 1ZYSA 4ITIA 3W0OA 4Z7HA 1DI9A 4O7RA 2YISA 1UC8A 2OZOA 4BTFA 4I21A 3HBLA 4CLIA 2WQBA 4QPAA 4DAAA 4LQMA 5LVOA 4ID7A 3SOAA 4DGLC 1VKZA 3S4QA 3K2LA 3U87A 5DR6A 2BDWA 3MJ2A 4C35A 2PZYA 1GAGA 2BHHA 3CJGA 1WBTA 3CTQA 3I6UA 4WBBB 4C58A 5KMIA 4PZ6A 4DEIA 3TIIA 3V5TA 3F6XA 3TNPC 4BDGA 5I9XA 4EHGA 3KALA 2YCSA 2OU7A 5JH6A 3AT2A 3EOCA 3UQGA 4WO5A 3TZ8A 3DZQA 1AUXA 2FPPB 3GXLA 4I4TF 4FEXA 2BRBA 4UWCA 4NM3A 2HK5A 2O65A 3UZPA 3ZTXA 3EQFA 3D2IA 4P5QA 3PWYA 5GHVA 3GLKA 3U6IA 4LOOA 4FNZA 4JRNA 4TYGA 4CHIA 4BHZA 3C0IA 1UWHA 2O63A 3MW1A 4U81A 2GU8A 2HG8A 5BPHA 2V0DA 5CALA 5IH5A 2PVHA 4HJOA 4ZTRA 3D5XA 3DY7A 2RFSA 4H39A 1O6KA 3SNOA 4QP1A 3PLSA 4KAOA 2NRUA 4NSTA 3UVPA 4UZDA 3ULIA 1H1SA 5L2IA 3W5OA 4OBQA 4DGOA 1EUDB 2ERZE 2QO7A 2VX0A 3ZBXA 3WWIA 4GU9A 3G6GA 3RALA 4F0IA 2B52A 3FY0A 3MVMA 1XH8A 2XKCA 4G6OA 2F7XE 4JBQA 5CVHA 1H8FA 4E1ZA 3ACKA 5BPFA 2IVVA 4S32A 5K3YA 1RDQE 3OS3A 4MBLA 1XKKA 2NNWB 4YC8A 4IAYA 3V6RA 1BI7A 3A60A 3R83A 2I0YA 3ZM4A 5EYMA 4EH9A 3H10A 4JVGA 3WO1A 4JX7A 3UYTA 3QA0A 3R00A 4NFMA 3AC3A 4K77A 3W2RA 4DFYA 3V01A 4TT7A 3BGPA 2B54A 3ORMA 3UQCA 4BIDA 4A7CA 2VTRA 1W93A 1ZYLA 4HVSA 2IVSA 4FNXA 4EBVA 2C0TA 4XYFA 4FTIA 3GOKA 4U45A 1OMWA 2XMYA 4ZZMA 2PVFA 3WZEA 3W2PA 4YNEA 4YO4A 4H05A 3AC1A 3KFAA 2XEYA 3LFCA 2C5OA 4GFMA 3PXFA 3TDWA 4Z3VA 4MKCA 2Z04A 4D0XA 3ALNA 4RG0A 3BACA 1XJDA 1QPEA 3QTXA 3IW8A 4DHIB 3F7ZA 3ZHPC 2YEXA 2WD1A 3SC1A 3FHRA 3H0YA 4L45A 4ACCA 5CEPA 3HP5A 3QD3A 4BIEA 1UC9A 4C59A 2ODTX 4RJ3A 3ZBFA 3SXFA 5HVYA 1ZMWA 2V7AA 3MY1A 1GSAA 3R63A 1S68A 3QZIA 5HBHA 3QQLA 5DFPA 2X6EA 2HCKA 1PMEA 4EL9A 5CX9A 2A19B 1URCA 4JQ8A 3V6SA 5EOBA 3IECA 2B9HA 2RL5A 4V0GA 5EM6A 3T3UA 4ANBA 4XX0B 4BDHA 1MRUA 1YOMA 2R4BA 3QALE 5BVKA 3VF8A 4PRJA 4C3FA 3KMUA 2WB8A 4EOPA 4NW6A 4UCSA 3QBNA 5FNVF 1Y6AA 4UWYA 5LMAA 1JVPP 4BF2A 3AOXA 4RC4A 3W10A 3DCVA 3ZDIA 1URWA 5ANGA 3RNIA 2Y7JA 2HVSA 3OEFX 3ZXZA 3ZMMA 4Z16A 3TUBA 1JSTA 3KK8A 3W0NA 4O6EA 2J50A 3BPRA 4I20A 1H0WA 5J8IA 2JIUA 4EZ3A 1P14A 2VTAA 4QP9A 3RV3A 2YM8A 5HG5A 5IEYA 3HO8A 4EI4A 4L44A 4X2GA 3V8WA 3W16A 1H08A 4I22A 2PVJA 2COGA 1YOLA 2WIPA 3EFKA 4AZWA 5LWNA 2XUUA 4IB0A 3VUDA 2W6MA 2EUFB 4D5HA 3QTIA 3VBYA 2XBJA 4FTRA 4K1BA 5I5ZA 5I4NA 5E8YA 1UU7A 3GOPA 3W18A 3RINA 4DEDA 1EH4A 1JNKA 1MQBA 1ZARA 5CU0A 4O0TA 4DCEA 2W6PA 1YKRA 2IW6A 3T9AA 1M2RA 4DH8A 2X8DA 4EYJA 2XJ2A 3GVUA 3BWFA 4BBMA 3HV4A 4H36A 3RPOA 1KWPA 5FBNC 4DAWA 5CAQA 3DS6A 4BDBA 3ZO4A 4ZLOA 5AUVA 4YJUA 4TY1A 3R9RA 2W6NA 4AZFA 1G8AA 2VRXA 4D9TA 5BVOA 5GIPE 2OF2A 3Q60A 2HW6A 4IACA 5CAVA 1PYEA 3K5UA 4BCNA 5IZFA 5HX6A 3ZO3A 2JITA 4XOZA 2J9GA 3A7FA 5DG5A 1KE7A 3ITZA 2H6DA 4D1ZA 1DI8A 3BA9A 2R87A 4MXZA 5LCJA 4ENXA 1XHAA 3R1SA 3DA6A 4DLIA 2J7TA 4E6AA 3LJ0A 2DABA 4WNOA 4MEDA 3WWJA 4F7JA 4FSRA 5IUGA 2R3HA 2X7GA 3TL8A 4ZOGA 1CTPE 2WOUA 4ENYA 2OWOA 3OCTA 1PMUA 3DQWA 3GUBA 2X9EA 4ZEGA 2VTQA 2WU6A 4YAKB 5B2LA 2C6LA 5DA3A 3LCOA 2GS7A 4QMVA 3ORLA 1JDEA 4HNTA 4QMTA 2YIXA 3U0GA 1WBOA 2OW3A 5C27A 5CSWA 1GOLA 1JBPE 2YAAA 3F69A 2EJ2A 1I2KA 3UC4A 2I6LA 5J2UF 2YM4A 3Q1KA 3P08A 3LW0A 4CSVA 3L8PA 3C1XA 4FIFA 4I6FA 3ZXTA 2VTPA 3KRRA 2R7LA 3PUPA 1Q4LA 2QCSA 3BU5A 2V5QA 3FLZA 3P5JC 3KXHA 3FY2A 4FSWA 2W9FB 5BUJA 4YJ2F 4NKAA 5DBXA 3RWQA 4ZLZA 3CXWA 4FZ6A 4U6RA 2YERA 2QOBA 3IKAA 3WYXA 3NR9A 4IAKA 3U6JA 4PV0A 3E64A 4UFZA 4IANA 3NEWA 3FZTA 1LEWA 5HKMA 2C69A 3PFQA 3P23A 5DE2A 2IP4A 5LARA 3RTXA 4G6LA 2IVUA 3CP9A 3NAYA 4FGRA 4YTCA 1TAEA 4GL9A 4QOXA 4FKGA 4GSBA 2RG6A 4H58A 3CY2A 3DFCB 3FHIA 4HPTE 4J1RA 3M42A 4Y5QA 5TO8A 3VHEA 2WMAA 3AXWA 3CQWA 3QC9A 4C62A 2JKKA 2W71A 4JAJA 2Y4IC 2J6MA 3RAHA 4GT5A 4EONA 4PMSA 2XCHA 4EZ5A 4IX5A 4CKRA 4HCTA 4QQTA 3PY3A 4FTKA 4YZMA 2JFLA 4MXCA 1CDKA 1G5SA 4OTWA 5ACKA 2XIYA 1YXTA 2QLQA 4F9AA 2JEDA 4EQUA 1GZOA 3TG1A 4O7ZA 4GK3A 1UVRA 4CLJA 2ZV9A 4NIFB 5BWRA 4RBLA 3JSLA 2VO6A 4FL2A 1A9UA 4AA0A 1K2PA 4BRXA 2PPQA 3U9CA 5JN2A 3F5PA 5DWRA 1YRPA 1XR1A 3KA0A 3FI8A 1FVVA 3A99A 3PZHA 4MD7E 2OKRA 5C8MA 2CKQA 3QQFA 1Q8ZA 3B2WA 4XV3A 3NW7A 2J0MB 4AGDA 2R82A 3TY9A 5C1OA 2HW7A 2YDIA 2BR1A 4O83A 5E25A 3PE2A 2WEIA 1U4DA 5KKNB 4E7WA 3DZOA 5DGZA 4EBWA 3G15A 4O4LF 1IASA 1L3RE 2O8YA 3UDBA 2BMCA 3O71A 1Q62A 3EJ1A 1LEZA