2YZLA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
239
structure length
238
Chain Sequence
b'KLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 77
structure length 238
sequence length 239
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yzlA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzlA02
2VQDA 1SVGA 3QCSA 2YCSA 2GNHA 1BLXA 1REJA 1ZRZA 2J51A 4M97A 3MVJA 5E8UA 1CM8A 2ZDUA 2PE0A 2PZPA 5KBQA 5M51A 3VBTA 3IPHA 2BMCA 1KJQA 2Z7LA 4P2KA 4EJ7A 2W6PA 1XJDA 1CE8A 4XP2A 3FXWA 4XG4A 1PXIA 4USDA 5J9YA 3ZLXA 3DNDA 2BAQA 4F64A 3ZLSA 2R84A 4BDEA 2B9FA 2YCQA 4J53A 2PMNX 3OY3A 3I1AA 3DS6A 4Z55A 3G33A 3U4UA 1IA8A 3OUZA 3AT4A 3E93A 4RA4A 2YIRA 3AT3A 4IBMA 4NFNA 4CFFA 1W8CA 1A9XA 1U5RA 3ZS5A 1GIHA 3CPCA 4G3DA 4EUTA 1VJYA 3LVPA 4JS8A 1ULZA 3QTZA 5CSXA 5HEZA 3JVSA 2FPPB 3EQGA 4DYMA 4XV3A 3FI3A 5JH6A 2VWYA 4QMOA 4ZHQF 2XNEA 3RAWA 5KMIA 1JSVA 4RWJA 4AZVA 4ZTMA 2C4GA 4FV8A 1H28A 4XLVA 5AWMA 5HZNA 2BTSA 3KXXA 4YHTA 3ZBFA 5BVFA 2I0EA 1PXPA 4MX9A 4EH2A 5HLNA 4FKOA 3S00A 4A9RA 3D2KA 1SCUB 2QNJA 2OXXA 4V05A 5IQFA 4AN2A 3HAMA 3MFTA 4TWCA 3SXRA 4R7HA 3FUPA 1E9HA 2PZYA 5FM2A 5HU3A 5JQ5A 2JKKA 3CKXA 3GUBA 3HZTA 3PA4A 5FLFA 3V4SA 4QOXA 3SLSA 2XK8A 5CVFA 5IA3A 4CQEA 3FI4A 4O21A 1ZY4A 3NEWA 3H30A 4ITIA 2J9GA 4YLKA 3QWJA 2QOFA 5LJJA 4MD8E 3S1HA 4RIXB 2XD4A 1RQQA 2BRBA 3P9JA 5JN2A 3FPMA 4ZTNA 2R85A 4IVCA 4MF1A 2OJ9A 4QQ5A 2XF0A 3H0ZA 2PUIA 1YDTE 2B52A 5DFPA 5DR9A 4DH7A 3Q96A 3HUBA 5D7AA 2R7LA 1M14A 3C4CA 3MDYA 3VOTA 2UW9A 2VTTA 3HO8A 4L53A 4I22A 3W2OA 4YUQA 3QXOA 1JKKA 1AGWA 3PIYA 2YWVA 4EOMA 3HNGA 4C5BA 3KXHA 4TZRA 2CKOA 4F7LA 3EYGA 3QTSA 4JI9A 4TRLA 1ZOGA 2R4BA 3A2CA 4YJOA 5B0XA 1BL7A 2XNPA 3OG7A 4AUAA 5CU0A 4YAKB 4LYNA 4FT7A 2QO2A 3Q4CA 4YBZB 1FGKA 1OECA 2E9OA 3PUPA 3MWUA 2WAJA 3C5UA 3LFEA 4F9YA 5J2TF 4IAZA 3BZ3A 2PVRA 3NDMA 3MTFA 4CNHA 3PJ8A 4TYEA 2QO9A 2C5XA 4USEA 3GI3A 5CYIA 5CZIA 3N6RA 3OD6X 4FIIA 2UW3A 1U54B 2X9EA 3Q6WA 3R30A 1F5QA 3BBTB 5H2UA 4FTTA 5HBHA 5K4IA 3WBLA 4F4PA 2J0KA 3R00A 3U54A 5AADA 2JEDA 3DTCA 5CEQA 5BVDA 3VBYA 4AZSA 1O6LA 4A9YA 5E92A 1NVSA 2YJSA 4O7WA 4IZ7A 2H6DA 4FV5A 4I6BA 3ZO4A 3OEZA 3R8ZA 4CKRA 4FC0A 4BCOA 4G5JA 3KXGA 3ORXA 4FFRA 4FZAB 4FEQA 3Q5ZA 5D7VA 3R9NA 4B99A 3PE2A 5FG8A 5IDPA 2YYAA 3MPAA 3U6IA 1V0BA 4DLIA 5ANGA 3FHRA 4LI5A 3W2RA 3I0OA 2R82A 2FB8A 3DLSA 4ID7A 4C38A 3I5ZA 2O0UA 3NUAA 4QPSA 5EK7A 1YHWA 2HW7A 3CP9A 3NR9A 4NJ3A 4BB4A 4D55A 2W70A 5FTGA 2KULA 2XBAA 3DTWA 1W7HA 3CGFA 2C5NA 4M14A 4FSTA 2FSMX 4JBQA 5C4LA 5CEMA 3C4EA 5J1VA 3BGPA 3CD8A 3UODA 3SXFA 4KBCA 2HWPA 3OBGA 1PJKA 4S30A 1R3CA 1XR1A 3E64A 5FTQA 4ZY5A 5HIEA 2QC6A 1VBGA 2W9ZB 3PSBA 2ETMA 3BYSA 3EL8A 3NAYA 3AT2A 4LM5A 3FXZA 4BDHA 2C6IA 1FOTA 3MPMA 3ZSGA 2I87A 4L3PA 2XUUA 4YTHA 3CY2A 4G5PA 4A9SA 2C0TA 5CAVA 1BUHA 1YI6A 2JIUA 4HZSA 3KL8A 4QTAA 2XBJA 4IFGA 3QQHA 4BDBA 4O2ZA 4FT0A 1HCLA 5JH7F 1ZMUA 5AP6A 3GC0A 4M8TA 2QKRA 4R5SA 3KAKA 5T6KA 5DE2A 4XRLA 2WU6A 1XH4A 1KE7A 4FV4A 3P1AA 3WE4A 2HELA 4DGLC 2E9NA 3JRWA 3SW4A 1WBVA 3ORKA 4KUJA 4ZAUA 4R3CA 2X2KA 3BYMA 4HCVA 3I5NA 4F99A 4IACA 4N4SA 1PXLA 5BUIA 5HICA 3BV2A 4FFPA 4KRCA 3PVBA 3U8WA 4ANQA 1KJJA 1M2QA 2HZ0A 4L44A 5DMXA 5F1ZA 3KRWA 2H9VA 5CF4A 5CXHA 1SZMA 3EKNA 4H1MA 2QOHA 5L8JA 2OWBA 4EWQA 3MV5A 4FV9A 4RFZA 4FTUA 4IIRA 3R7YA 4WBBB 3R5HA 2PUNA 3MBLA 3F5XA 3POZA 4AOIA 3TJDA 1M2PA 2HK5A 3CR0A 2J2IB 3TV6A 5AUZA 3FZTA 5TKDA 3HA6A 4JAIA 4I41A 1ZXEA 3OWPA 3L1SA 3ROCA 2WZJA 3FBVA 3Q9YA 2W1GA 5JFVA 4ZI7F 4UXQA 2RL5A 3R2BA 2J6MA 3WOWA 3WZUA 4GVJA 4U44A 4M68A 3W18A 4ZEGA 3V51A 4F08A 1Y57A 4NZWB 3R83A 3UVRA 3BI6A 3BBWA 3F7WA 3PWYA 2C1BA 2HIWA 5EOLA 4FOBA 3VS3A 4FKRA 4WG5A 4YC3A 4L3LA 3BHUA 5CEKA 2XIZA 2CPKE 2O3PA 4YAJB 2YCRA 3W8LA 4AW1A 1NY3A 4L01A 3V04A 5F20A 5HG7A 5AV0A 3SRVB 2UZTA 4BI0A 4PMMA 3BG5A 2CZGA 2XK6A 1WVYA 1O9UA 3REPA 4RX9A 2FO0A 4RQVA 4U80A 2YJRA 2CKPA 1M17A 4L00A 3LQ5A 4FKQA 5H8EA 5BNJA 1PX2A 5IEXA 5AM7A 3CTJA 2XEZA 4TTHB 1FVVA 4EH4A 4MBIA 1Y8GA 1KV2A 4WA9A 2B55A 4TYGA 3RK5A 5EH0A 1U5QA 2XIXA 4I92A 4DH1A 1HCKA 5EDRA 2P2IA 4BBEA 2BDFA 2WQOA 2UZBA 1NA7A 2UZUE 2BKZA 4RRVA 3R8LA 1FVTA 4A4OA 2WIPA 4W8DA 3PPJA 2XJ1A 5CX9A 3QGWA 3PZEA 3NMUF 4DCEA 3C4WA 4E6QA 4F9WA 4F7NA 4FV6A 1OZ1A 4M3QA 1ZARA 5IH5A 3R63A 4TYJA 4ARKA 4QNYA 2QHMA 1QPEA 4UX9A 3CTHA 1AQ1A 1AUVA 2QOBA 2CGWA 5JMSA 5J95A 2GCDA 4F0GA 2P55A 1PYEA 2VX0A 3UIMA 3BIZA 2OG8A 3BGZA 3OXTA 4XZ3B 3FL5A 1IAJA 4WT6A 3H10A 4FTMA 1J7IA 3RAIA 5DLSA 5ACKA 3ZO1A 1ZZLA 3ITZA 3MB6A 4XYMB 3UFXB 3TG1A 3QTUA 4KINA 4QSHA 3WYYA 2R2PA 4I0TA 2B7AA 5CAUA 1OUKA 3AXWA 4XBUA 4AW2A 3RALA 3BHYA 2XIRA 4LMNA 4I4FA 1H25A 4J95A 4ONAA 1M0TA 3BYOA 1S9IA 4R5YA 4FSUA 3VJNA 2J0MB 4E4LA 2H8HA 4GK3A 3TTIA 2W1ZA 3R21A 3W10A 2CGVA 3II5A 4DE4A 4X0MA 1PF8A 3TINA 3RFCA 3BLQA 2W4KA 1FMKA 2IZSA 3KVXA 4IX6A 4MHAA 3C1XA 3NWWA 3LFAA 2WEIA 1MRYA 4KKGA 4LV5A 3RHKA 3ULIA 1WZYA 1YHSA 5CSPA 4GW8A 1OL7A 4MH7A 5E8YA 3ZFMA 4FL2A 1GJOA 3CD3A 4I5CA 4CEGA 5LQFA 4GFOA 3C0IA 1KJ8A 3OW3A 3CQUA 2YAAA 1LEZA 2C6KA 3QQUA 4NKAA 2X4ZA 3WIGA 1WCCA 3ZFXA 3A8WA 3R7EA 4R1YA 3WZDA 5AUWA 5IG1A 2V7OA 4HNTA 5G1XA 4WUAA 1YRPA 5EI6A 3SX9A 4D9UA 4ZIMA 3HX4A 4RJ7A 3KB7A 4TW9A 5CSHA 2R3GA 4A4LA 2B53A 4DEHA 2NU6B 3Q2OA 4C36A 4XLIA 1WBTA 2V55A 5HI2A 4IM3A 4BVUA 4F1TA 1PHKA 2GSFA 4I4EA 3R1SA 4ANSA 4BZNA 3PLAE 3KFAA 2O8YA 2BHHA 1ZLTA 3S4QA 3FZRA 2I40A 3UOLA 4IB0A 4CMTA 5ITAA 1KWPA 1G8AA 5KMNA 4MV1A 5BYZA 3LFNA 4YC6A 5HG5A 3KXZA 3COKA 3DB8A 3LQ8A 3R8PA 4XOZA 5HVJA 1WBSA 3ORPA 5D9HA 3JYAA 2OKRA 2DUVA 3O50A 3LMGA 3ORMA 1DV1A 3QTIA 3QQFA 2C30A 2EU9A 2X6DA 3AG9A 2CSNA 2BFXA 3K5UA 4U0IA 4XMOA 5LP6F 2UZOA 2ZVAA 3NUNA 4DTBA 4FTNA 4Y8DA 2VWZA 3U87A 2R3NA 4WRGA 4ZQIA 4PNKA 5DR6A 3R6XA 5LMKC 2VD5A 2Y4PA 2OXYA 1E1VA 2UZLA 2VGPA 3EN7A 2Y8OA 4PDYA 4WIHA 4IX4A 4K11A 4PWNA 2PVFA 1SYKA 4DBNA 5FQDC 1LEWA 4F70A 4N6YA 4GS6A 3VQHA 3ZZEA 2R0IA 3K3IA 5AUTA 4B8MA 4AZFA 1REKA 5BUJA 4QMLA 4BCKA 2XVDA 2IPXA 4GUBA 4RVMA 5E91A 2HOGA 2CDZA 3UP7A 2YDIA 1J91A 3DFAA 4JQ8A 4RJ5A 1ZOHA 3R9OA 3NX8A 1VKZA 2UW8A 3QKKA 3E3PA 4FKGA 4C35A 3F2RA 3VF9A 2OICA 5DR2A 4Z7GA 4IIJF 2WMWA 2XKFA 4FZFB 4FE2A 4UWCA 4C4FA 5IUHA 2I0YA 1HOWA 2V62A 4IAKA 4MNEB 4RFMA 4U41A 2QOCA 1JSTA 5EHYA 3VRYA 4JG8A 1U59A 3UG2A 1OIYA 5IYZF 3C0GA 3MVHA 3MSSA 5AV2A 1OB3A 4O0VA 2I8CA 4ASZA 1GSHA 5FDXA 4QP7A 3UIXA 2VTOA 2I0VA 4BGQA 4BTMA 3O71A 2H96A 3MY1A 5I9XA 3KQ7A 2KTYA 3RVGA 5CNOA 5EOBA 2IW9A 3L8XA 4FTLA 2GFSA 2GNIA 3HP2A 4QTCA 4EZ7A 1H1RA 2DWBA 3LWBA 2QF7A 4UYNA 3EQBA 1W84A 5C1OA 2JDOA 3VA7A 3NUYA 2NUAB 3S3IA 3ZUUA 3KN6A 2YRWA 4Z9LA 2R3OA 2WMAA 5HU9A 5I9YA 3NYXA 5IA0A 4M13A 3EKKA 5A4LA 1KJ9A 1WBWA 4HGEA 2HY0A 2ZM1A 2BROA 2I80A 2WTKC 3JVRA 4R1VA 2W1FA 4RZWA 5CWZA 4EC9A 2HXLA 3UQCA 2X7OA 1EH4A 2JAVA 5ETIA 4EOQA 3I6WA 4BBFA 4EH3A 3Q53A 1PKDA 4LRMA 4IX5A 5EDPA 3SG8A 1KOBA 2PMLX 5FP6A 3V01A 3SG9A 4FSYA 1S9JA 2E9PA 2VV9A 4L1KA 3DOGA 4O7ZA 2BKKA 4LQMA 4A4XA 4IFCA 1IEPA 2IZRA 4FG7A 4U7ZA 2CNUA 3DGKA 4YNOA 3GU8A 5F95A 2GU8A 3R7UA 5IA2A 4DTAA 1ZAOA 3WI6A 5L8LA 4CFXA 2BAJA 5HD4A 1QCFA 5BVOA 2QR8A 4FZ7A 4DH5A 4FSRA 2OIBA 4RWKA 5IISA 3E5AA 3GQLA 3TUCA 3LFDA 4EH7A 2GTNA 3E7OA 4U81A 4ALVA 2QLQA 4EK6A 1Q4LA 2FGIA 3O8UA 2PUPA 4IDTA 2GS7A 4YZDA 4EKLA 4CG9A 3N4VA 5H8BA 1FPUA 2ZV7A 4OLIA 1M7QA 4GYIA 4O0WA 4J1RA 4BDAA 5CA1F 4AFEA 4E73A 2BVAA 4RIYB 4DCAA 5EYCA 3OUUA 4ZSEA 4G6NA 1ZY5A 4TPTA 3V5QA 4XBRA 2GS6A 2YAKA 1QPJA 4BI1A 3ZEPA 5BX0A 4AW5A 4X2JA 4D28A 3MA3A 3OFMA 4Y8VB 4FKUA 4RIOA 2VTNA 5C4KA 4OR5A 4ZTHA 1UU8A 4G3GA 5CU6A 4G16A 5DT3A 2UZDA 3N4UA 4FK3A 5LOHA 3TDVA 4ACGA 1QL6A 5AAFA 2XNBA 2G15A 5KHXA 1OKVA 1W0XC 3UIBA 4QRCA 5DRDA 2CMWA 5BVEA 3WZEA 4QT1A 3NNVA 4RIXA 1UKHA 4CRLA 4R7BA 4BC6A 5JFWA 2AUHA 2O65A 2P33A 5IDNA 3KREA 4X6RA 3LJ1A 4EK8A 3FWQA 3TNQB 4C2VA 3QFVA 2OSCA 1SNUA 2JGZA 4Q9SA 5IH4A 4I0RA 4HYHA 5J2UF 5AP5A 4YJ2F 4JG7A 4DG0E 4EQUA 5IMXA 3GC8A 4PF4A 4CLJA 4OUCA 2HZIA 4H3BA 4PL4A 2GLTA 3GQIA 3EQCA 4GJ3A 1FINA 2WQBA 2B4SB 4E8AA 3PG1A 4C4EA 3VUMA 3QCYA 5IQCA 3ZZWA 2FSLX 4UXLA 1H1QA 3PE1A 4E6AA 4YZ9A 2EXMA 5GIOE 4DFBA 2VUWA 2YHVA 3EHAA 1CTPE 2WQNA 3W32A 1OBGA 2BRNA 4HYSA 4F6WA 4UBAA 4ALUA 1XH9A 3WF8A 3GOPA 4YSJA 3ZXZA 1Q97A 2WTJA 1Y6AA 4RX8A 1ZYJA 4RG0A 4BHNA 2A4LA 3V8TA 2VO3A 1YXTA 3BQCA 3FMEA 3RCDA 4AGCA 3I0QA 3EMGA 5AV3A 4G34A 4AS0A 4E4XA 2R87A 3TXOA 2RFDA 5EI8A 3FLSA 5EW9A 4J97A 4O82A 4X3JA 4AFJA 3R73A 4AWIA 4TL0A 2XEYA 2YS7A 5IEYA 4FGRA 4PX6A 2CKQA 3UPZA 5DNRA 2Y6OA 4WNKA 5BPYA 4WSYA 5BPFA 4WHZA 2PL0A 3AD6A 4PL3A 2DIKA 3P7AA 5TF9A 2J5FA 3COMA 2QQ7A 3AC4A 3GCQA 5ANJA 4BKJA 3G15A 2W1HA 3OHTA 2YWPA 4UB7A 3Q60A 1UWHA 3KKVA 4G2FA 3SAYA 2V58A 5K5XA 1URCA 2DQ7X 3BYUA 3FE3A 3OWKA 4ENYA 2OO8X 4O7VA 3HMIA 5ACBC 3LW0A 3U9NA 4RQKA 4QMNA 2CN5A 4IVAA 3U9TA 1K3AA 3FKOA 5KMLA 4I20A 4FKSA 3ETJA 4DGGA 4Y73A 2J50A 2B54A 2Y6MA 2YIYA 5JRQA 1P5EA 5IU2A 1YXXA 5FM3A 3POOA 4GMYA 3RCJA 4HGTA 4X3FB 4V0GA 1Z9XA 3EQFA 4JBPA 3EQDA 3SD0A 4D58A 4DFNA 5IA5A 4LL5A 3A4OX 2DLNA 2W6ZA 1OUYA 2YM3A 2GHLA 2FB9A 3IDPA 3G0EA 2I0HA 3NLBA 5HD7A 3DKGA 3ODYX 3AX6A 1SVHA 3K54A 4PP9A 5L6WL 4EOLA 1UWJA 3AMAA 2WGJA 3ATSA 2HZNA 2WO6A 4RC2A 4FTAA 5DYJA 1GZKA 3D5UA 4CMOA 3QD3A 4CRSA 2JC6A 2RG6A 1WBOA 4GIIA 4RBLA 3R8UA 3JR1A 4YJQA 5L8KA 3ZSIA 3ENMA 2ITQA 4WO5A 4YBKA 5AMNA 4AOJA 4C4JA 4O86A 5JQWA 3TUDA 3PVWA 4AP7A 5BVKA 3F82A 4ERWA 4YTFA 5HX6A 1TQIA 2CJMA 4ACCA 2V59A 3IW6A 1TVOA 2F57A 3Q52A 2OF2A 1Z57A 3DZOA 4GH2A 4IDVA 4F0IA 5FRIA 2V7AA 4O38A 5JVDF 3CS9A 2ZDGA 5KX5F 2RKUA 3GU4A 1CKJA 4K18A 4U3ZA 4TY1A 5DN3A 5JZNA 3IKAA 1PK8A 3KULB 2NU8B 1A06A 1YVJA 2YCFA 1OL5A 5CNNA 3R9HA 1RJBA 3ZCLA 3QD0A 3RJCA 3D4QA 3FJQE 4OTIA 2ITTA 3GCVA 4XG6A 5A4EA 3E92A 3TIYA 4TYIA 5AAGA 2OI4X 4E7WA 1EHIA 2OFVA 4MVFA 1CDKA 3K2LA 5FUTA 4AF3A 4LG4A 1MRUA 3QGYA 4X21A 3ORZA 4JIKA 2Z7QA 3H4JA 2PVMA 5JT2A 1A48A 4LUDA 3L9NA 4O91A 3FI2A 3U9CA 2YZNA 4J7BA 3GVUA 4PDPA 2R3PA 4C4HA 3H0YA 2JIIA 4CV8A 1ZZ2A 3UO5A 2C6LA 1CQJB 1Z2PX 4F9BA 1YQJA 1XBCA 4GKHA 1JNKA 2X1NA 1P4OA 3NIEA 4DFXE 4EORA 5FBNC 2YM8A 3TZMA 3QKLA 3ROYA 4A07A 2C3JA 5EM6A 5ETAA 2ITZA 3VS1A 4FT5A 5AEPA 3SRVA 4EYMA 3ERKA 3FL4A 3OROA 4IC8A 1H07A 4IWPA 2R3FA 2J0LA 3WO0A 3HMNA 4RJ6A 3JY9A 4M12A 5IEVA 3M1SA 3W2PA 4I4TF 2W9FB 4G3EA 4MQ2A 5CI6A 2XB7A 1I7NA 1PRYA 4JDJA 3IOKA 4IWOA 3QKMA 3C4ZA 5E8WA 5HBJA 3GU7A 4HGLA 1MP8A 5AUUA 3B8QA 2X7FA 3N51A 3NNUA 2UV2A 4NCTA 3B2WA 5HHWA 2QU5A 3FV8A 2PTKA 4PNIA 5AP2A 4FV1A 3JPVA 3NUSA 4RX5A 5CB4F 2RGPA 4DA5A 5EM5A 4E6CA 5KZ0A 5J87A 5E8TA 4H58A 4QP1A 2VPQA 3LZBA 4D1ZA 3I12A 5DGZA 2EXCX 3DKCA 2P0CA 4ANBA 2IZUA 3NSZA 3PA5A 3PYYA 3R0TA 4H3QA 3PSCA 4GK4A 4QMTA 2HYYA 2P3GX 4KBAA 5A14A 3I6UA 5GJGA 1UNGA 3QC4A 3V5LA 4DN5A 4MAMA 4O81A 2YZGA 4IQ6A 4AGUA 3TWJA 4K9YA 4MWHA 4IW0A 3ZMMA 1YWNA 5L2TA 2BILB 4G3FA 2ZOQA 5LXMA 1ZMWA 3OXIA 2UVXA 1OITA 3QQGA 1CSNA 3DJ5A 3MVMA 4JVGA 3W2CA 2UVZA 1PYXA 1Q5KA 4FKLA 4XS2A 4V01A 2BDJA 4OTFA 3TV7A 4BCMA 4FFOA 4BTJA 4MV3A 3COHA 3BELA 3IECA 1IRKA 4X2GA 5LA6F 3MFSA 4RC4A 1H27A 3LFBA 4DGOA 4O7RA 4EH9A 3FLNC 4J96A 5E1SA 4HQ6A 3W55A 4PTEA 1QMZA 4MA5A 5BVNA 4JIAA 4ZOLF 4Q5EA 1WFCA 2GDOA 5E90A 4DAWA 3AQVA 1OPJA 1UV5A 5A4CA 5EFQA 2YW2A 5LCKA 3G0FA 3R28A 3V6RA 3QBNA 2XA4A 3HMMA 4JOAA 4ZZNA 3TIZA 4YR8A 3RPVA 2XRUA 2PZIA 3LOKA 3O7LD 4QYYA 4HR7A 5HO7A 3D5WA 5I0BA 3B8RA 2QR7A 3KA0A 4G31A 3TW6A 3RP9A 3MA6A 1PXNA 4WUNA 4TYHA 3V4ZA 2C6OA 5M56A 3G9NA 1O6KA 4FNZA 5AP3A 4BDFA 5DVRA 3D2IA 3EQRA 2WMBA 4EC8A 3UOJA 2LGCA 3D83A 3QF9A 3F6XA 3VULA 4KAOA 3DNEA 4HZRA 4I93A 3JZIA 3GFEA 4E5BA 4QO9A 3FLQA 4YZCA 2QHNA 4BCIA 1KOAA 2PVKA 3ACKA 3QXPA 4I23A 4X6QC 1H01A 2OJIA 3NZ0A 5C8KA 4FVQA 3QD4A 1WVXA 5FXSA 2JBPA 3PFQA 3ZXTA 1GLVA 1Q24A 4GG7A 2GS2A 3A99A 4HVDA 4YURA 4L46A 1EUDB 2ZV8A 3LXNA 4Y5HA 4YJVA 2C00A 3OC1A 2WOUA 3ORNA 2X0SA 5J9LA 2JFMA 4PMPA 1OI9A 4MCVA 3OCBA 5GNKA 2CNVA 4FL1A 5CVHA 3R5XA 4GFGA 4V0GB 1P2AA 1JPAA 4I24A 5FXRA 4BDIA 3ZTXA 2R7IA 3NGAA 2W06A 3EFJA 3DJ6A 4XNEA 1OMWA 4I1ZA 2REIA 4GU9A 2ETRA 4H36A 4JRVA 4C2WA 3RV3A 4O84A 2UW7A 4RVKA 4C34A 2ITWA 5CTPA 4F6UA 4CTCA 4MXOA 3RPSA 3D7ZA 4PMTA 3R7IA 3DA6A 3FMLA 4XG9A 4RPVA 4EG0A 1Q3WA 3UGCA 4D0WA 2ESMA 3M11A 3V5TA 3MWEA 4EUUA 3LPBA 4IHJF 2BTRA 1CKIA 2NPQA 3C7QA 3CSVA 2EB3A 5FGKA 5I9UA 3UOKA 1V0OA 2VTAA 3VPCA 5HG8A 1VEBA 3SOAA 4K2RA 4FEXA 2GNLA 3AW8A 4QYHA 4CZUA 4DITA 5FP5A 3TZ9A 2GQRA 5DT0A 2C6TA 5JFSA 4FKVA 2QOOA 3SHEA 4FG9A 4RT7A 4KS8A 5L2SA 1KV1A 3UJGA 1PW2A 3QRJA 3E8NA 2HZ4A 5DOSA 3KMWA 5AUVA 3NNXA 5KMOA 4Z3VA 4J52A 3GB2A 3HECA 1KE9A 1XBBA 4E20A 1M7NA 4EOOA 4MBJA 4NYEA 4R7IA 5FEQA 3UNJA 3MN3A 2J0IA 4MNEA 3TKIA 2QOLA 1BI8A 2WYOA 3AD5A 3DB6A 4XX9A 3KRRA 4JL9A 4MEDA 4XRJA 1A9UA 3VS7A 4PTGA 3ZUVA 5B2LA 5EQYA 5BYYA 5JZJA 4GT3A 4PY1A 2W1EA 3E63A 3OUNB 1EUCB 4QMSA 2DZDA 3V6SA 3TIGA 3CXWA 4MNFA 4TWOA 3VO3A 4F1MA 2J9MA 4JBVA 3AD4A 4FIGA 3T8OA 4BDKA 3D7TB 2WKMA 3DXPA 4MD9E 4HCUA 3OUKA 4X2KA 5GJDA 4EGQA 4MYGA 1VYZA 3UVQA 1YOMA 3F69A 4R77A 4U5JA 3THBA 3RAKA 3CKWA 4PP7A 3DF7A 1CKPA 1R78A 2BR1A 5C1QB 3Q9XA 2R3KA 2ZB1A 3R7VA 3R23A 2ERKA 4YB8B 4QYGA 1K9AA 4M7IA 1MRVA 1OPLA 1OM1A 4FV0A 2FP4B 3KK9A 2GMXA 1YOLA 4QPAA 5AV1A 3WILA 3H3CA 4F09A 4A06A 2VR1A 3UVPA 4WOVA 3ALNA 1PXKA 3EWHA 4FSWA 2G01A 3FLZA 1U46A 4FTIA 4G9RA 2ZJWA 2VTHA 4EEVA 1XWSA 2A2AA 1RDQE 4CSVA 3QTWA 2ETKA 2Y4IB 4I6HA 4OGRA 4YJPA 4O2BF 3KRXA 3GLKA 5M44A 1Q8UA 2W5AA 4PRJA 3B2TA 5JEBA 2Q0BA 1H0WA 1KE8A 1XBAA 3F7ZA 4OTDA 1ZYCA 3QQKA 2WB8A 3ZH8A 5I5ZA 5IQDA 4W4YA 4WNPA 2C6DA 3BYVA 1L8TA 3PVGA 3PY3A 2C68A 3F2AA 4IC7A 4QMWA 3CGOA 5GINE 2Z04A 3DV3A 4O7NA 3DBFA 2DYLA 4EQCA 3GCPA 2R3RA 4IH8A 3EJ1A 3PPKA 4D2SA 4M84A 5ANDA 2B0QA 4FTQA 4XCUA 2XM9A 4H39A 5EHOA 2VWIA 4LFIA 3DAKA 4GRBA 1VZOA 4R3RA 4RIYA 2AC3A 1BI7A 2VO6A 3EN4A 5BMMA 2PVNA 4FUYA 3CY3A 3Q9WA 3C50A 4XP0A 4DFYA 2XCHA 3DQXA 1KJIA 3FMHA 5HVKA 4FK6A 4FBXA 3O8TA 4G3CA 1MQBA 3QC9A 4I94A 5T68A 3TJCA 3F3UA 4CLIA 2YRXA 3IW4A 2SCUB 3E5NA 3T9IA 2UW6A 3P79A 3A7JA 3OWJA 4BCHA 3QRKA 3U55A 1UA2A 2HW6A 4FFMA 2GQGA 3G6GA 4IWQA 4UALA 3UNKA 5KKRB 3N4TA 3PZHA 4QMYA 5AFVA 3VUIA 2VWWA 3PXKA 2VTJA 2X9FA 4QQTA 4QMVA 1RW8A 5K9IA 4BIBA 5CALA 2BCJA 2IZTA 2YZLA 2ZMDA 3OBJA 4FV7A 1Q8ZA 5M4UA 5AUYA 2B9JA 4YC8A 5DBXA 2VU3A 4YNEA 5CAQA 3NVMB 4TYHB 3NUUA 5M4CA 4FFLA 3FXXA 5DHJA 3BHVA 4FKPA 3ACJA 3MH0A 3DBEA 3V5PA 2HWOA 3BCEA 3E3BX 3KVWA 2FYSA 1H26A 3LXPA 5CEOA 4FV3A 2R3HA 4ZK5A 4DGMA 5ANOA 5DA3A 3ZRKA 5CZHA 4UY9A 3PP1A 1UU9A 2XP2A 2Z02A 4HJOA 4ANMA 4BCGA 4QTEA 5JKGA 2QK4A 2PZRA 1PKGA 3KC3A 3RGFA 4I55F 3EQHA 3M2WA 3RWQA 4B8LA 3DDQA 3ZBXA 1XO2B 3R04A 3I7BA 3QZHA 3ORRA 5JGAA 4AT5A 3CIKA 3AGMA 3FYKX 4DBXA 2PUUA 2RFSA 4U8ZA 5K3YA 2P0AA 3DJ7A 3CQEA 3QFFA 3ANQA 4FVRA 3ZM4A 4D0XA 4S33A 4EI4A 5BMSA 4ERKA 3OOMA 3FC2A 1JKTA 4ACDA 3PWDA 4E1ZA 2VO0A 4EL9A 3QTXA 4RJ8A 3ATTA 4YLJA 4B4LA 3TL8A 4JDHA 2X8EA 3PXFA 4K33A 3FSKA 4YLLA 5EYMA 3KALA 1YOJA 5IF1A 5CU2A 3QQLA 3RAHA 3EFKA 3FZ1A 3R71A 1W82A 4OBQA 3VBQA 3QX2A 4FNYA 1GSAA 4OBPA 3NYNA 4E4MA 2FVDA 1KC7A 5D8DA 3F3ZA 4JAJA 4W4XA 4O7YA 2PE2A 5T3QA 2ZV9A 4P4CA 2JLDA 4C5AA 1I09A 1VR2A 3G5DA 5C27A 2VNWA 2W0JA 4U42A 1Z5MA 4EHEA 4YHJA 2YDKA 2UZNA 2OH4A 4YP8A 4PMSA 2R86A 3QZGA 4MXZA 5GHVA 4BRXA 3HGKA 4TV9F 2PN1A 2JAMA 1E4EB 1YI3A 3C4FA 1GZOA 2AYPA 4TWPA 5EQEA 3FMKA 4J8MA 2C47A 3U6JA 1X8BA 3E88A 4NK9A 4C3RA 2VNYA 2WU7A 2XKDA 5LCJA 4G6LA 3IG7A 5C8NA 2WD1A 3OY1A 5EDQA 2YM4A 4QYFA 4ZXTA 3SGCA 5M53A 4LV8A 1BKXA 1QPCA 3MH2A 4B6LA 3IW5A 3L8PA 3EN9A 4BHZA 4FIHA 2YFXA 4DT9A 2OFUA 3Q6UA 4X3FA 1WR2A 3IK3A 2QKWB 4KKHA 3CJFA 1UNHA 2IVVA 3MIAA 2NNWB 5EKNA 3DXQA 1JAMA 4JXFA 1DV2A 4DEDA 2O64A 1WBPA 5C01A 2C0IA 3C0HA 5HORA 2WTWA 4JRNA 5EW3A 1YXSA 1AD5A 2UW4A 4FYOA 5HE0A 3DK6A 4L42A 3WYXA 3O17A 4RGJA 2GPHA 2WXVA 2YERA 5DEWA 2XNOA 2PWLA 4XHKB 4CG8A 2XRWA 2NU9B 5I4NA 4CKIA 2WTDA 4C5CA 4MXYA 1FVRA 4YJTA 1Q8YA 5I9ZA 3RZBA 4XUFA 4J71A 5EKOA 5JQGF 4YJRA 2OK1A 2R3MA 4NWMA 1OIRA 3SC1A 2PY3A 3R5FA 2FSOX 3RINA 3DKFA 3GC9A 3FKNA 2VWXA 4MXAA 4NH1A 5F94A 3HMOA 4YPSA 4KRDA 3FSFA 3KU2A 5A54A 4G6OA 4W4VA 3RM7A 1BXRA 1YW2A 5ICPA 3S2PA 2NP8A 3KULA 3OVVA 4QP3A 2BALA 3UOHA 3VUKA 4D4RA 3IW8A 5M55A 4FIJA 3R9RA 4L3JA 4B9DA 2JKOA 2JDVA 5LMBA 3DBDA 3HVCA 5GJFA 2NRYA 2SRCA 4U43A 3NRMA 5LVPA 1EZ1A 1DS5A 2ZM4A 3BEGA 2XIYA 3SW7A 3ORLA 4YJUA 2IW8A 1BX6A 3D15A 2YEXA 2ITPA 3COIA 4Y46A 3F66A 4ZTSA 2WMRA 3G9LX 5DT4A 2QLUA 3OCGA 2X4FA 4V04A 3QL8A 2PPQA 4AG8A 4FR4A 5AJQA 1H1SA 2R7BA 3OOGA 3DCVA 4FTCA 4FMQA 1JBPE 4RA5A 5IQBA 5KZIA 5CT7A 5H8GA 3MH1A 4EH6A 4D5HA 3ZHPC 3RPYA 5IQGA 2YIWA 3D14A 1M0WA 5D41A 5ETFA 5E9EA 4EYJA 1WVWA 5IUGA 3KXNA 4XV2A 4BCNA 4GYGA 5F9EA 5IZFA 3R8VA 3T3UA 3ZDUA 1W83A 5DPVA 5AM6A 1CQIB 3RI1A 4QQJA 1J7UA 2R64A 5HCYA 5IUIA 4A7CA 3NW7A 4CFUA 3OT8A 2FPIB 4OT5A 5DG5A 4BTKA 4EONA 2Z7RA 3UBDA 5KO1A 3QZFA 2W05A 1TKIA 3EFWA 4ZTLA 3R1QA 4BZOA 3C5IA 2ZYBA 4C62A 5BUEA 5LVMA 3TCPA 1JKSA 1FGIA 4C3FA 3GU5A 2X39A 1GZNA 2A0CX 2PMIA 4JNWA 5C26A 3K5IA 4QYEA 4F9CA 3UNZA 4TNBA 4U79A 1OL2A 3GU6A 4L8MA 5HE2A 2F9GA 2WTCA 3AGLA 4I3ZA 3F88A 1DM2A 2X0GA 3MS9A 3WF6A 2WMQA 2C1AA 2VTMA 3UQFA 2W71A 4ZOGA 4QMPA 4O0TA 3G90X 3K3PA 3DQWA 4RSSA 4M0YA 3L8SA 3VC4A 4M9UA 3RKBA 2WQEA 3GT8A 5ANKA 3W8QA 2HAKA 3MVLA 3Q9ZA 3HRBA 2YDJA 3QUPA 5D12A 4GV1A 4EK3A 2GTMA 1NXKA 3OZ6A 3TIIA 4D1SA 2XYUA 1IOVA 4QMUA 5EW8A 4EH5A 5JFXA 2C5YA 3I60A 3OCSA 4JBOA 4TXCA 3HDNA 4NCTC 5C9CA 3UQGA 4L68A 3V5JA 3FY0A 3RMFA 4KWPA 2BZHB 5IQAA 4IJ9A 4C02A 3BWJA 4O6EA 3NYOA 2VX3A 2ONLA 3MW1A 4IM0A 4O0YA 4O83A 4IM2A 5LARA 2YA9A 4FZ6A 3RWPA 4XOYA 4AE9A 2XM8A 3K5VA 1F0QA 2IVTA 2X7GA 5I9WA 2Y4IC 5BVWA 3IONA 4O7LA 5HNBA 2I6LA 4LGHA 1EYZA 4MD7E 3UO4A 4DFZE 4BI2A 1Z2NX 3T9TA 3KEXA 2J0JA 3LCOA 4FNXA 1BNCA 5CA0F 4DIMA 2C3KA 3PRIA 4RZVA 4DEGA 4CFWA 3BU6A 4AE6A 3AMYA 4E4TA 5HX8A 2O63A 2B9HA 3F5GA 3BE2A 4PQNA 1GOLA 4NM0A 3ZFYA 4D4YA 3HV6A 2W5HA 2J5EA 4HNFA 3I4BA 4DEEA 3ZDIA 3NYVA 1GZ8A 4FGBA 4YBJA 4QP2A 1H08A 2YM5A 4EZ5A 1R1WA 3PXZA 2HJWA 2YL2A 5LYJF 3QD2B 5CU4A 1K2PA 1YDSE 3DKOA 4JR3A 4HVHA 2B1PA 4LOPA 3HEGA 3LAUA 5TOZA 3R02A 2ITVA 4FV2A 3UMWA 4CT1A 4O7SA 4CV9A 4OTRA 2IO6A 4I0SA 2IVSA 3KXMA 5KHWA 1PXOA 3R2YA 4S32A 5AX9A 5JK3A 3HRFA 4ZJJA 2ZDHA 2IJMA 4JDKA 2HXQA 3CLYA 4CXAA 2CN8A 4YO6A 2BAKA 4QP9A 4J98A 1UU7A 4LRKA 1H8FA 5A6OA 3P0MA 5C8MA 4AA5A 5HLPA 1G3NA 3HLLA 4MV4A 4NT4A 3LJ0A 4FTOA 3R1NA 2VN9A 4HYIA 4NW6A 2RF9A 3QA8A 1PMUA 4XV9A 5C1PA 3TKHA 4ZMFA 3VJOA 3E8EA 4QP6A 2B9IA 2A1AB 3P4KA 4NTSA 1PXJA 5J7HA 4HCTA 4F63A 2E9UA 1LR4A 2PVYA 2FSTX 2WMTA 4MWIA 3ALOA 4ZTQA 4CZTA 2XZSA 2CLXA 4GL9A 5JSMA 4X2FA 3ZOSA 3ZC6A 2CGUA 4FG8A 3L8VA 2YISA 2JITA 4I5HA 2FA2A 3KK8A 4FA2A 3PG3A 3FQHA 4DH3A 2QG5A 1Y6BA 2I1MA 2VWVA 3A8XA 3FMMA 4O0UA 3NUPA 4O0RA 3OW4A 2CGXA 4FICA 4O4IF 1W93A 3E8CA 5M07A 3VS2A 1SVEA 2RFNA 3F3TA 2X8DA 1W98A 3OMVA 4E4NA 2R3JA 5CSWA 3Q4ZA 5HBRB 3IO7A 5CSVA 3LXLA 3MFUA 4ITHA 3NVKI 3N8DA 4JX3A 1H4LA 4ZSAA 2GHMA 2YM6A 4IB1A 3ORTA 4IVBA 5H80A 3C4XA 1E1XA 4ZJIA 1U4DA 2C6EA 3BHHA 2WFYA 4IZOA 4HNUA 3HA8A 5AA9A 5HGIA 4AA0A 4I5MA 4F7JA 2ZAZA 4QNAA 5CY3A 2OJFE 4L52A 3VS5A 5M4IA 4FSZA 1Q61A 3D7TA 2VWBA 3MI9A 4RIWB 1CMKE 4YGAA 1B6RA 4NM5A 5ANIA 5J1WA 4WBNF 2R5TA 3CPBA 4FZDB 4S2ZA 3OTVA 4Y5QA 4AZTA 4E5AX 5CF5A 3DAJA 3VHKA 3PDTA 1OIQA 1GGOA 3QA0A 3UZTA 4FSQA 2XJ0A 2OF4A 5B2KA 2JDRA 1H00A 1ND4A 3CE3A 3QZIA 4E93A 4EH8A 2R7MA 1BYGA 2W4OA 4XH6A 3QUDA 3SOCA 5FEEA 2C3IB 3PSDA 5JGDA 3DK3A 3O8PA 3SV0A 2Z2WA 4M67A 4Y83A 4E6DA 4XV1A 3VN9A 5M57A 3E87A 2WTIA 3QUEA 4IVDA 3GXLA 1SM2A 3VS0A 5DH3A 1I44A 4NJDA 4F1OA 2UZEA 5IQEA 5A46A 2BRGA 4XP3A 3HMPA 2UZVA 2X2MA 3MYGA 4KB8A 4HPTE 3MFRA 4B0GA 2BUJA 4C58A 3LP8A 4FEVA 3A7IA 2W6OA 5AAEA 3RHXA 4ZSLA 1H1WA 3FAAA 3OP5A 3QYZA 4DT8A 5CQUA 3NNWA 4K1BA 2VGOA 3ZU7A 4KD1A 5KX8A 1CS0A 3HB9A 2BIKB 3UP2A 5L2IA 4ORKA 3AC5A 2W99B 3WZKA 3Q4TA 4AT4A 3P08A 1B39A 2QURA 5E8ZA 1IA9A 3RPOA 4HOKA 3RUPA 4MQ1A 3UTOA 3NUXA 2BZIB 3A60A 3LM5A 3MH3A 4IEBA 4AACA 3K5HA 3LQ3A 4C59A 4KA3A 4X2NA 3DBCA 3W2SA 2WOTA 5AIRA 2G1TA 5D11A 4W8EA 5HE1A 2XK9A 3BGQA 4FKTA 3ZSHA 2W1IA 3GFWA 3TNPC 2ZB0A 1L3RE 2XH5A 3AMBA 3DBQA 2UW0A 3TACA 4YTIA 4EHZA 1GSOA 3UYTA 2P4IA 2F49A 4KS7A 3IOPA 4RWIA 1DIKA 4IAFA 3P78A 4IWDA 4FNWA 4NTTA 3GC7A 1V1KA 5EHLA 4AOTA 3QRTA 4WBOA 5E8SA 2X6EA 3ZRMA 4C3PA 1R39A 3P5KA 2C69A 3Q2JA 5IA1A 4B7TA 2VAGA 3FI8A 1J3HA 5BQ0A 5CEPA 3LFCA 3QTRA 5CF8A 4CKJA 1NW1A 2UUEA 2YN8A 1ERKA 4GJ2A 2WELA 2OZAA 2PVJA 2VTQA 3ZC5A 2V22A 2C6MA 4MK0A 5DWRA 3C51A 5HCXA 3ZO2A 5HTBA 2BPMA 3PPZA 4IZYA 5LXTF 4HGSA 4U3YA 4U97A 5LWMA 2Q0NA 3OF0A 1UKIA 3LCTA 3W2QA 3HBLA 3EH9A 2R3IA 2QCSA 4WNOA 2VZ6A 4EOKA 3BEAA 4NL0A 5LVNA 3G6HA 2UW5A 4LUEA 2OLCA 1PMEA 1F3MC 4AZWA 4BBMA 2W17A 3SVVA 5LVOA 5E7RA 3UC4A 3S0OA 3U6HA 3VWAA 4GEOA 4YHFA 1OIUA 2F4JA 3D94A 3ZLYA 4BTFA 3NPCA 3QCQA 4F7SA 1DAWA 2EB2A 1XH8A 4YMJA 3DPKA 5ETCA 4KNBA 3G8CA 3SXSA 4BICA 2OJJA 2XK7A 4MV6A 4WRSA 4PDSA 3EIDA 5E8VA 2FPGB 1IG1A 1OGUA 2CNQA 3ZEWA 2GPWA 5HNGA 2A19B 3NS9A 2I7QA 1GIJA 4RVLA 3BU5A 4RC3A 3L9PA 3FPQA 3HAVA 1QPDA 3I81A 4G17A 3VBVA 4BCPA 4Q9ZA 2YM7A 4JX7A 1JWHA 4GT5A 4RJ3A 3KRJA 4EOSA 5GIPE 2R7KA 3CEKA 3PJ3A 2X2LA 5CAOA 3TT0A 3DT1A 4ASXA 4PV0A 4AU8A 4CFMA 3TQTA 3IGOA 4JQ7A 3UIUA 4BYJA 4CFNA 3NW6A 3D0EA 3GEQA 4Q2AA 5M08A 2ZDTA 3G8DA 4BYIA 4D4SA 4RVTA 1XH5A 3FHIA 3ZUTA 1V0PA 2OLSA 1NVQA 4O7TA 2QD9A 3TDWA 3NCZA 3QHWA 3F2NA 3MJ1A 5D1JA 3UZPA 4CCBA 4MTAA 3AOXA 5HNIX 4H1JA 4I50F 2PK9A 2WTKB 4Y95A 4MV9A 3QHRA 4IAAA 3LFQA 4BGHA 1IOWA 3NCGA 3R01A 1YXVA 2QG7A 2XK4A 3UPXA 3TV4A 4C4GA 2IW6A 3H9FA 3KRLA 3NW5A 3QRUA 1XH6A 1XKKA 3O96A 4U40A 4AT3A 3L9LA 1E4EA 4ENXA 3R7OA 3EQIA 3EQPA 3E8DA 5B2MA 2C5OA 2XNNA 5FTOA 3EN6A 4N57A 4E26A 1XHAA 2NU7B 2GQSA 4EOJA 1NVRA 3NAXA 5L3AA 4JR7A 4KKEA 4YSMA 4ZY4A 4NM3A 4QTDA 3MIYA 5TR6A 1C3OA 2IWIA 4IB5A 2YZMA 4I21A 3KCKA 2WEVA 2XMYA 4KSPA 4APPA 3CCNA 4AZEA 3ZRLA 4AN3A 4DEBA 4MA0A 4ME6A 1Y8YA 4EGJA 3VF8A 2XCKA 5KUPA 3FLWA 2GNFA 2G2FA 2ZV2A 3TUBA 2RIOA 3VPBA 5EYDA 2YABA 3CTQA 3F61A 3QU0A 3FKLA 2H34A 2Z7SA 4FL3A 4DFUA 4IMYA 4EK5A 1UNLA 2R9SA 4CT2A 4EQMA 5AA8A 2BIYA 4LOQA 4BF2A 5LWNA 4I6QA 2XNMA 3SKCA 3E62A 4FI1A 4CTBA 4YU2A 3Q1KA 3GCSA 2W7XA 3VS6A 4WG3A 3SE7A 2QI8A 4FU0A 1YWVA 3SA0A 3TZ7A 2PSQA 3MB7A 4D9TA 2QOQA 2W6MA 4ZTRA 4OBOA 3BHTA 3TNIA 4GG5A 1Z2OX 3C9WA 4L7SA 2YIQA 4P7EA 3P86A 2BRMA 4OW8A 4AX8A 5KBRA 1KE6A 5JVLA 3A61A 1JKLA 4FKJA 2WIHA 5E4HA 3F5PA 2GNGA 5FDPA 4EWHA 3AC1A 4ZSJA 3JUHA 3TM0A 4C61A 3W33A 2JBOA 3A7HA 4J8NA 4NKSA 1KSWA 3VRZA 4ALWA 1JOWB 3FZOA 3LJ2A 2JFLA 3LHJA 4NM7A 4XEYA 1ZYDA 2WHBA 2IP4A 4WKQA 4X3FC 4EBWA 3UMXA 2WMXA 2CCIA 4JT3A 2C5VA 2ITOA 3O23A 1UVRA 4RX7A 3W1FA 5I9VA 3BLHA 4QP4A 3WO1A 2YACA 5HG9A 1Q8TA 3CJGA 2O5KA 4IZ5A 1STCE 4CFVA 5HQ0A 2CHLA 4GUEA 3QWKA 4EKKA 1H0VA 4QQCA 3KF7A 3LIJA 5A9UA 3F5UA 2XYNA 2QONA 4K0YA 4AN9A 1SMHA 4BCQA 4HW7A 3FMJA 4UWBA 4BIDA 3GNIB 2WTVA 2W6NA 3BE9A 4TWNA 5D10A 3QTQA 4BDGA 3JZFA 3V8SA 4M15A 2OW3A 4PUZA 4ZS4A 5FXQA 4O4LF 4U6RA 4USFA 3P23A 2OZOA 3HV4A 3GBZA 4YZMA 5AP0A 4TT7A 3D9VA 5A4QA 3EOCA 2F7EE 1IASA 2YZAA 2GHGA 2C0OA 2E9VA 1ZWSA 1APME 1URWA 2VTSA 2YIXA 3PJ1A 3Q4UA 4FTJA 3VW8A 4HNIA 1PMNA 3GCUA 2WMVA 2X81A 5DRBA 4OT6A 5FBOA 3LLAA 5HKMA 4O27B 2G9XA 5CEIA 2FH9A 5JQ8A 4NSTA 2F2CB 4EBVA 5CAPA 3SQQA 2OIDA 3BQRA 5HCZA 1KUTA 2AC5A 2J4ZA 3DK7A 1Q3DA 1OKZA 4TKSA 5FD2A 2F7ZE 1ZMVA 2JIVA 3FZSA 1PY5A 5J8IA 1JDBB 1JKJB 2UVYA 4RJ4A 3P7BA 4Z16A 4D1XA 2E2BA 2QO7A 3PY0A 4GU6A 3KMUA 4UV0A 3S95A 5CENA 2EWAA 2OZAB 4KIPA 4A9TA 4AGWA 4L9IA 1LP4A 5EI2A 4KIQA 5M4FA 2XIKA 4XG8A 3LFSA 3LFFA 5AUXA 2F2UA 3FEGA 5G6VA 1P14A 2VTIA 3VMMA 1R0PA 2BHEA 3ZYAA 1XH7A 3ZONA 4FSNA 4EZ3A 3TN8A 4I5PA 3MGYA 3PJCA 2PULA 4WG4A 5E1EA 4RLKA 4IHPA 4FSMA 3V8WA 4C7TA 3LKMA 3N9XA 3TNWA 1P4FA 3HKOA 3SDJA 5KMJA 4AA4A 4K8AA 3VS4A 2VWUA 1WBNA 2BDWA 2HGSA 4FFNA 3O51A 2OGVA 4UZDA 4O4HF 5CAEB 3GP0A 3I79A 4P90A 2R0UA 4TN6A 4C4IA 2YS6A 3QCXA 3BLRA 5KE0A 3HP5A 2BZKB 4MXCA 3F9NA 3VUGA 1GNGA 1SNXA 1VYWA 5IPJA 5K4JA 3DZQA 5IMEA 2HCKA 2VX1A 4DLJA 3BV3A 4MBLA 3HV5A 1AUXA 4DG2E 3DY7A 3GENA 3QLGA 4D4VA 2Z8CA 4IAIA 4WD5A 3GIDA 2W96B 5KCVA 2VRXA 2IN6A 2G2HA 4N70A 4OTGA 4QMXA 5EM8A 5A4TA 1M6VA 3WNZA 3A62A 2W6QA 1BL6A 2ZDQA 5EM7A 2OJGA 2PZ5A 3OCTA 3VIDA 4NFMA 3A4PA 3HL7A 5FEDA 4R6VA 1OPKA 4GKIA 1G5SA 4HYUA 4JQEA 4BN1A 4QMQA 1BMKA 5IQHA 3UO6A 3C13A 2PVHA 3K3JA 4NU1A 4P5QA 4FEUA 3A7GA 1OVEA 4ZLOA 4DG3E 3BWFA 1OKWA 4M0ZA 4ZP5A 3DDPA 4II5A 3G2FA 4NIFB 1I7LA 1WAKA 4FEWA 2XKCA 4KIOA 1T45A 1JQHA 4ZZOA 4HVIA 4H3PA 2ITXA 1FQ1B 3RTPA 2P2HA 4FKIA 5HESA 4DEIA 3F3WA 5J9ZA 3A7FA 3MJFA 4O2PA 4YO4A 5ANEA 5EG3A 4L45A 3CC6A 4AAAA 4BCJA 4PL5A 5AV4A 2GPSA 4CD0A 3TNHA 3KN5A 3OTUA 4XG3A 5BYLA 2ONLC 4CGAA 1VBHA 4D2RA 2VTPA 3Q2MA 3ZO3A 4EOIA 3PIXA 4RZQA 5B7VA 4FYNA 5CXZA 1LPUA 2C3LA 2J90A 5M09A 1ATPE 3EYHA 3Q3BA 2ITNA 3AC3A 4C33A 3HV7A 3PLSA 3MPTA 4UWYA 1YWRA 2W5BA 4PDOA 2IVUA 3VUDA 4DC2A 2RG5A 3EB0A 2PHKA 4MKCA 4ASEA 1Q99A 4YPDA 4L6QA 4XX0B 3CBLA 3G51A 4IZAA 4ZY6A 3VAPA 4ZJVA 4UEUA 5CQWA 4G1WA 5AP1A 2BRHA 4W4WA 3ZLWA 4BIEA 4U45A 5AIKA 1MQ4A 1OKYA 3AC8A 5CF6A 4ZSGA 3VVHA 4LGGA 4F6SA 4FX3A 3CQWA 4BGGA 2HY81 3VHEA 4K77A 2EVAA 2G2IA 1LUFA 1Y91A 4JG6A 3L9MA 3OWLA 3LCSA 3BX5A 3EN5A 4IADA 4O4JF 1KEEA 3ANRA 4DEAA 4E5WA 4FUXA 1PXMA 4GVAA 4Z7HA 3WF5A 4BZDA 5A3XA 5K5NA 3MY0A 2XK3A 4S31A 1DI8A 4JLCA 4KABA 4KSQA 3OEFX 4JDIA 5HO8A 3UDBA 2NRUA 4OTHA 4EHVA 3NIZA 3TTJA 3DU8A 5A6NA 1Q8WA 4K6ZA 2Y9QA 5M06A 1NT2A 1T36A 1J1CA 3PXYA 4XYFA 3LLTA 4GIHA 5DI1A 4XG2A 3W16A 4F9AA 2A27A 3PY1A 2XNGA 3ORIA 1B6SA 3WF9A 3RV4A 3IGGA 3O7LB 3VBXA 1MUOA 2Y0AA 2OU7A 4DTKA 4MXXA 4EOPA 5EZYF 5LOVF 4O6LA 4RMZA 3PIZA 4RWLA 3EL7A 3HRCA 3P7CA 2XKEA 2IG7A 4BR3A 5HV6A 5AP7A 3VW6A 3VBWA 3BU3A 3FC1X 4R3PA 4F65A 2ZMCA 4UN0C 4FVPA 3H9OA 4FT3A 1FMOE 3DXNA 3IDBA 3KAJA 5AX3A 2EUFB 3R9DA 1Q41A 4OTWA 4YZBA 3RPRA 3HUCA 5HBEA 4DFLA 3RM6A 4Y72A 4LOOA 4RIWA 4F0FA 3PA3A 3PVUA 1C30A 4TNDA 4ACMA 3UZRA 2ITUA 3EZRA 5CVGA 5LVLA 1B38A 3EFLA 3ULZA 2Z60A 5EQPA 4L7FA 5JRSA 4DGNA 4RFYA 3TZ8A 2VTLA 5HVYA 2F7XE 2V0DA 4FOCA 3WF7A 4QMMA 4QTBA 3JXWA 3GGFA 4JJRA 5L6PA 4MV7A 4O2AF 4TV8F 3OS3A 5C8YF 4BDDA 4ASDA 4HVSA 5CT0A 1R0EA 1RE8A 3ENHA 4LRJA 4PTCA 1TQPA 4LMUA 3ID6C 2XJ2A 3LMHA 4XJ0A 4M69B 2RFEA 1FBNA 3Q5IA 4J99A 3R8MA 4ACHA 4LL0A 4ANLA 2YITA 1OL6A 4I6FA 3AC2A 5KKNB 2WMSA 2W1CA 5TT7A 1M2RA 4ZZMA 1OL1A 3PXQA 3KGAA 1GAGA 3FMNA 5IA4A 3HDMA 3WIKA 5F4NA 3OT3A 3PRFA 1UU3A 1PMVA 3MY5A 4KBKA 3JRXA 3T3VA 1Q62A 2W1DA 3MWDA 2OXDA 4UZHA 5LMAA 3ET7A 1OBDA 3V5WA 1M52A 1JLLB 4YJ3F 3R22A 2PYWA 2ERZE 2ZM3A 2DWCA 1J7LA 3IDCA 4FT9A 2R3QA 3MJ2A 3RNIA 3UYSA 3LE6A 3UC3A 4CVAA 3FMDA 3TI1A 3U51A 2NO3A 2CCHA 3ELJA 4U9AA 4N0SA 2QOKA 4NUSA 4APCA 1GY3A 3U9SA 3ETHA 2WNTA 1YKRA 4NW5A 5HTCA 4DINA 5J5SA 5IH6A 1JDEA 4GCJA 2PVPA 4DH8A 2Q83A 5CI7A 3HV3A 1JLUE 3R1YA 4FODA 4ITJA 5HIDA 1H24A 5BMVF 3BKBA 5LMKA 3VQUA 3KCFA 4FKWA 2PE1A 4EK4A 4DF3A 4FIFA 5HE3A 3IS5A 5EYKA 5GONF 5BPHA 3GOKA 4O0SA 5TO8A 3ZM9A 4ZS0A 3DFCB 3LMIA 4XYLB 4GFMA 4L67A 2XCLA 3QLFA 5KNJA 5CANA 5E8XA 4C0TA 4YJNA 4FTKA 4IB3A 5AP4A 3QALE 4TUYF 4Q5HA 3H9RA 2FUMA 3LXKA 1DI9A 2X8IA 3E7VA 2V5AA 1U54A 3MESA 4IJPA 3JY0A 5H3QA 3WE8A 3FYJX 1YXUA 4S34A 5L2WA 3LM0A 3V3VA 3Q32A 3TKUA 4BDCA 4CMUA 4DLKA 4GT4A 1B6CB 3O0GA 4IE9A 2DS1A 4HNVA 1YI4A 4CCUA 2QODA 1T46A 3ETAA 3ODZX 4X7QA 5HIBA 3IW7A 5C03A 4QMZA 5IQIA 4GSBA 2OH0E 3KF4A 3BPRA 2GFCA 1YDRE 1ZOEA 2QU6A 3FZPA 3PP0A 4HPUE 3OXZA 2ACXA 3WARA 5KMMA 1KBLA 4IANA 5HLWA 5KKRC 3JS2A 4BY9E 2O2UA 4ZLYA 2XS0A 4AGDA 2W4JA 3RK7A 2R3LA 1KE5A 2JDTA 4OTQA 4P5ZA 4YJSA 3PTGA 3QQJA 2JKMA 4O0XA 1DAYA 1JVPP 4AXAA 2JKQA 2WQMA 4XG7A 1H1PA 2OBJA 4L43A 4MAOA 4A9UA 4Y85A 4ZMEA 3KMMA 2ITYA 2QVSE 2VO7A 1IAHA 3EZVA 3QRIA 4UYAA 5CLPA 4G9CA 5H9BA 1XQZA 2GNJA 4FTRA 3Q04A 4O96A 4C37A 1G8SA 2BZJA 2CLQA 3IQ7A 4WNMA 4YZNA 3I7CA 4AW0A 4QP8A 4YTCA 4RLLA 2OIQA 5L6OA 2WPAA 3UG1A 3PJ2A 2J7TA 2PVLA 5CS6A 1IR3A 2V5QA 3O2MA 3TEIA 3QYWA 3QX4A 2HENA 3FQEA 2CKEA 3BRBA 5DIAA 3M42A 1W96A 1WMKA 3UE4A 1TQMA 4H05A 4ZLZA 3FQSA 2JD5A 1J1BA 3D5XA 2VTRA 4AQCA 3DLZA 1GIIA 1YHVA 5FNVF 2WMUA 4GK2A 4O22A 3LCDA 3F3VA 4FIEA 4R78A 5CU3A 4MV8A 3U4WA 2JDSA 2PMOX 2UZWE 3RK9A 4DHFA 2BFYA 3QAME 2QOIA 3VNTA 3MTLA 3HYHA 3D5VA 5CASA 3FY2A 4IX3A 1JSUA 3PXRA 4BDJA 4HVGA 4EJNA 2Y7JA 1ZYSA 1O6YA 3FDNA 2PBZA 3FLYA 2PU8A 3LCKA 3WZJA 3VUHA 3DAEA 3ORQA 4IAYA 2R7NA 4BCFA 3KY2A 5JGBA 5KMKA 4EHGA 4N6ZA 2LAVA 4D5KA 5DEYA
chains in the Genus database with same CATH superfamily
2VQDA 1SVGA 3QCSA 2YCSA 2GNHA 1BLXA 1REJA 1ZRZA 2J51A 4M97A 3MVJA 5E8UA 1CM8A 2ZDUA 2PE0A 2PZPA 5KBQA 5M51A 3VBTA 3IPHA 2BMCA 1KJQA 2Z7LA 4P2KA 4EJ7A 2W6PA 1XJDA 1CE8A 4XP2A 3FXWA 4XG4A 1PXIA 4USDA 1ST0A 5J9YA 3ZLXA 3DNDA 2BAQA 5DISC 4F64A 3ZLSA 2R84A 4BDEA 2B9FA 2YCQA 4J53A 1EKPA 2PMNX 3OY3A 3I1AA 3DS6A 4Z55A 3G33A 3U4UA 1IA8A 3OUZA 3AT4A 3E93A 4RA4A 2YIRA 3AT3A 4IBMA 4NFNA 4CFFA 1W8CA 1A9XA 1U5RA 3ZS5A 1GIHA 3CPCA 4G3DA 4EUTA 1VJYA 3LVPA 4JS8A 1ULZA 3QTZA 5CSXA 5HEZA 3JVSA 2FPPB 3EQGA 4DYMA 4XV3A 3FI3A 5JH6A 2VWYA 4QMOA 4ZHQF 2XNEA 3RAWA 5KMIA 1JSVA 4RWJA 4AZVA 4ZTMA 2C4GA 4FV8A 1H28A 4XLVA 5AWMA 5HZNA 2BTSA 3KXXA 4YHTA 3ZBFA 5BVFA 2I0EA 1PXPA 4MX9A 4EH2A 5HLNA 1G8JA 4FKOA 4A9RA 3D2KA 3S00A 1SCUB 2QNJA 2OXXA 4V05A 5IQFA 4AN2A 3HAMA 3KIOC 3MFTA 4TWCA 3SXRA 4R7HA 3FUPA 1E9HA 2PZYA 5FM2A 5HU3A 5JQ5A 2JKKA 3CKXA 3GUBA 3HZTA 3PA4A 5FLFA 3V4SA 4QOXA 3SLSA 2XK8A 5CVFA 5IA3A 4CQEA 3FI4A 4O21A 1ZY4A 3NEWA 3H30A 4ITIA 2J9GA 4YLKA 3QWJA 2QOFA 5LJJA 4MD8E 3S1HA 4RIXB 2XD4A 1RQQA 2BRBA 3P9JA 5JN2A 3FPMA 4ZTNA 2R85A 4IVCA 4MF1A 2OJ9A 4QQ5A 2XF0A 3H0ZA 2PUIA 1YDTE 2B52A 5DFPA 5DR9A 4DH7A 1XK5A 3Q96A 3HUBA 5D7AA 2R7LA 1M14A 3C4CA 3MDYA 3VOTA 2UW9A 2VTTA 3HO8A 4L53A 4I22A 3W2OA 4YUQA 3QXOA 4WHXA 1JKKA 1AGWA 3PIYA 2YWVA 4EOMA 3HNGA 4C5BA 3KXHA 4TZRA 2CKOA 4F7LA 3EYGA 3QTSA 4JI9A 4TRLA 1ZOGA 2R4BA 3A2CA 4YJOA 5B0XA 1BL7A 2XNPA 3OG7A 4AUAA 5CU0A 4YAKB 4NZNA 4LYNA 4FT7A 2QO2A 3Q4CA 4YBZB 1FGKA 1OECA 2E9OA 3PUPA 3MWUA 2WAJA 3C5UA 3LFEA 4F9YA 5J2TF 4IAZA 3BZ3A 2PVRA 3NDMA 3MTFA 4JXUA 4CNHA 3PJ8A 4TYEA 2QO9A 2C5XA 4USEA 3GI3A 5CYIA 5CZIA 3N6RA 3OD6X 4FIIA 2UW3A 1U54B 2X9EA 3Q6WA 3R30A 1F5QA 3BBTB 5H2UA 4FTTA 5HBHA 5K4IA 3WBLA 4F4PA 2J0KA 3R00A 3U54A 5AADA 2JEDA 3DTCA 5CEQA 5BVDA 3VBYA 4AZSA 1O6LA 4A9YA 5E92A 1NVSA 2YJSA 4O7WA 4IZ7A 2H6DA 4FV5A 4I6BA 3ZO4A 3OEZA 3R8ZA 4CKRA 4FC0A 4BCOA 4G5JA 3KXGA 3ORXA 4FFRA 4FZAB 4FEQA 3Q5ZA 5D7VA 3R9NA 4B99A 3PE2A 5FG8A 5IDPA 2YYAA 3MPAA 3U6IA 1V0BA 4DLIA 5ANGA 3FHRA 4LI5A 3W2RA 3I0OA 2R82A 2FB8A 3DLSA 4ID7A 4C38A 3I5ZA 2O0UA 3NUAA 4QPSA 5EK7A 1YHWA 2HW7A 3CP9A 3NR9A 4NJ3A 4BB4A 4D55A 2W70A 5FTGA 2KULA 2XBAA 3DTWA 1W7HA 3CGFA 2C5NA 4M14A 4FSTA 2FSMX 4JBQA 5C4LA 5CEMA 3C4EA 5J1VA 3BGPA 3CD8A 3UODA 3SXFA 4KBCA 2HWPA 3OBGA 1PJKA 4S30A 3NC0B 1R3CA 1XR1A 3E64A 5FTQA 3W0RA 4ZY5A 2QC6A 5HIEA 1VBGA 2W9ZB 3PSBA 2ETMA 3BYSA 3EL8A 3NAYA 3AT2A 4LM5A 3FXZA 4BDHA 2C6IA 1FOTA 3MPMA 3ZSGA 2I87A 4L3PA 2XUUA 4YTHA 3CY2A 4G5PA 4A9SA 2C0TA 5CAVA 1BUHA 1YI6A 2JIUA 4HZSA 3KL8A 4QTAA 2XBJA 4IFGA 3QQHA 4BDBA 4O2ZA 4FT0A 1HCLA 5JH7F 1TFFA 1ZMUA 5AP6A 3GC0A 4M8TA 2QKRA 4R5SA 3KAKA 5T6KA 1IYEA 5DE2A 4XRLA 3U0GA 2WU6A 1XH4A 1KE7A 4FV4A 3P1AA 3WE4A 4CMDA 2HELA 4DGLC 2E9NA 3JRWA 3SW4A 1WBVA 3ORKA 4KUJA 4ZAUA 4R3CA 2X2KA 3BYMA 4HCVA 3I5NA 4F99A 4IACA 4N4SA 1PXLA 5BUIA 5HICA 3BV2A 4FFPA 4KRCA 3PVBA 3U8WA 4ANQA 1KJJA 1M2QA 2HZ0A 4L44A 5DMXA 5F1ZA 3KRWA 2H9VA 5CF4A 5CXHA 1SZMA 3EKNA 4H1MA 2QOHA 5L8JA 4EEQA 2OWBA 4EWQA 3MV5A 4FV9A 4RFZA 4FTUA 4IIRA 4UCVA 3R7YA 4WBBB 3R5HA 2PUNA 3MBLA 3F5XA 3POZA 4AOIA 3TJDA 1M2PA 2HK5A 3CR0A 2J2IB 3TV6A 5AUZA 3FZTA 5TKDA 3HA6A 4JAIA 4I41A 1ZXEA 3OWPA 3L1SA 3ROCA 2WZJA 3FBVA 3Q9YA 3T9AA 2W1GA 5JFVA 4ZI7F 4UXQA 2RL5A 3R2BA 2J6MA 3WOWA 3WZUA 4GVJA 4U44A 4M68A 3W18A 4ZEGA 3V51A 4F08A 1Y57A 4NZWB 3R83A 3UVRA 3BI6A 3BBWA 3F7WA 3PWYA 2C1BA 2HIWA 5EOLA 4FOBA 3VS3A 4FKRA 4WG5A 4YC3A 4L3LA 3BHUA 5CEKA 2XIZA 2CPKE 2O3PA 4YAJB 2YCRA 3W8LA 4AW1A 1NY3A 4L01A 3V04A 5F20A 5HG7A 5AV0A 3SRVB 2UZTA 4BI0A 4PMMA 3BG5A 2CZGA 2XK6A 4AXDA 1WVYA 1O9UA 4GLWA 3REPA 4RX9A 2FO0A 4RQVA 4U80A 2YJRA 2CKPA 1M17A 4L00A 3LQ5A 4FKQA 5H8EA 5BNJA 1PX2A 5IEXA 5AM7A 3CTJA 2XEZA 4TTHB 1FVVA 4EH4A 4MBIA 1Y8GA 1KV2A 4WA9A 2B55A 4TYGA 3RK5A 5EH0A 1U5QA 2XIXA 4I92A 4DH1A 1HCKA 5EDRA 2P2IA 4BBEA 2BDFA 2WQOA 3NFFB 2UZBA 1NA7A 2UZUE 2BKZA 4RRVA 3R8LA 1FVTA 4A4OA 2WIPA 4PZ7A 4W8DA 3PPJA 4CKBA 2XJ1A 5CX9A 3QGWA 3PZEA 3NMUF 4DCEA 3C4WA 4E6QA 4F9WA 4F7NA 4FV6A 1OZ1A 4M3QA 1ZARA 5IH5A 3R63A 4TYJA 4ARKA 4QNYA 2QHMA 1QPEA 4UX9A 3CTHA 1AQ1A 1AUVA 2QOBA 2CGWA 5JMSA 5J95A 2GCDA 4F0GA 1V9PA 2P55A 1PYEA 2VX0A 3UIMA 3BIZA 2OG8A 3BGZA 3OXTA 4XZ3B 3FL5A 1IAJA 4WT6A 3H10A 4FTMA 2HHFB 1J7IA 3RAIA 5DLSA 5ACKA 3ZO1A 1ZZLA 3ITZA 3MB6A 4XYMB 3UFXB 3TG1A 3QTUA 4KINA 4QSHA 3WYYA 2R2PA 4I0TA 1G8KA 2B7AA 5CAUA 1OUKA 3AXWA 4XBUA 3T9BA 4AW2A 3RALA 3BHYA 2XIRA 4LMNA 4I4FA 1H25A 4J95A 4ONAA 1M0TA 3BYOA 1S9IA 4R5YA 4FSUA 3VJNA 2J0MB 4CC6A 4E4LA 2H8HA 4GK3A 3TTIA 2W1ZA 3R21A 3W10A 2CGVA 3II5A 4DE4A 4X0MA 1PF8A 3TINA 3RFCA 2ODTX 3BLQA 2W4KA 1FMKA 2IZSA 3KVXA 4IX6A 4MHAA 3C1XA 3NWWA 3LFAA 2WEIA 1MRYA 4KKGA 4LV5A 3RHKA 3ULIA 1WZYA 1YHSA 5CSPA 4GW8A 1OL7A 4MH7A 5E8YA 3ZFMA 4FL2A 1GJOA 3CD3A 4I5CA 4CEGA 5LQFA 4GFOA 3C0IA 1KJ8A 3OW3A 4DHIB 1EKVA 3CQUA 3W0OA 2YAAA 4GLXA 1LEZA 2C6KA 3QQUA 4NKAA 4DRFA 2X4ZA 3WIGA 1WCCA 3ZFXA 3A8WA 3R7EA 2NYAA 4R1YA 5AUWA 3WZDA 5IG1A 2V7OA 4HNTA 5G1XA 3BLAA 4WUAA 1YRPA 5EI6A 3SX9A 4D9UA 4ZIMA 3HX4A 4RJ7A 3KB7A 4TW9A 5CSHA 2R3GA 4A4LA 2B53A 4DEHA 2NU6B 3Q2OA 4C36A 4XLIA 1WBTA 2V55A 5HI2A 4IM3A 4BVUA 4F1TA 1PHKA 2GSFA 4I4EA 3R1SA 4ANSA 4BZNA 3PLAE 3KFAA 2O8YA 2BHHA 1ZLTA 3S4QA 3FZRA 2I40A 3UOLA 4IB0A 4CMTA 5ITAA 1KWPA 1G8AA 5KMNA 4MV1A 5BYZA 3LFNA 4YC6A 5HG5A 3KXZA 3COKA 3DB8A 3LQ8A 3R8PA 4XOZA 5HVJA 4NZOA 1WBSA 3ORPA 5D9HA 3JYAA 3DTGA 2OKRA 3T99A 2DUVA 3O50A 3LMGA 3ORMA 1DV1A 3QTIA 3QQFA 2C30A 2EU9A 2X6DA 3AG9A 2CSNA 2BFXA 3K5UA 4U0IA 4XMOA 5LP6F 2UZOA 2ZVAA 3NUNA 2HIVA 4DTBA 4FTNA 4Y8DA 2VWZA 3BABA 3U87A 2R3NA 4WRGA 4ZQIA 4PNKA 4PZ8A 5DR6A 3R6XA 5LMKC 2VD5A 2Y4PA 2OXYA 1E1VA 2UZLA 2VGPA 3EN7A 2Y8OA 4PDYA 4WIHA 4IX4A 4K11A 4PWNA 1EKFA 2PVFA 1SYKA 4DBNA 5FQDC 1LEWA 4F70A 4N6YA 4GS6A 3VQHA 3ZZEA 2R0IA 3K3IA 5AUTA 4B8MA 4AZFA 1REKA 5BUJA 4QMLA 4BCKA 2XVDA 2IPXA 4GUBA 4RVMA 5E91A 2HOGA 2CDZA 3UP7A 2YDIA 1J91A 3DFAA 4JQ8A 4RJ5A 1ZOHA 3R9OA 3NX8A 1VKZA 2UW8A 3QKKA 3E3PA 4FKGA 4C35A 3F2RA 3VF9A 4DDIA 2OICA 5DR2A 4Z7GA 4IIJF 2WMWA 2XKFA 4FZFB 4FE2A 4UWCA 4C4FA 5IUHA 2I0YA 1HOWA 2V62A 4IAKA 4MNEB 4RFMA 4U41A 2QOCA 1JSTA 5EHYA 3VRYA 4JG8A 1U59A 3UG2A 1OIYA 5FR9A 5IYZF 3C0GA 3MVHA 3MSSA 5AV2A 1OB3A 4O0VA 2I8CA 4ASZA 1GSHA 5FDXA 4QP7A 3UIXA 2VTOA 2I0VA 4DQNA 4BGQA 4BTMA 3O71A 2H96A 3MY1A 5I9XA 3KQ7A 2KTYA 3RVGA 5CNOA 5EOBA 2IW9A 3L8XA 4FTLA 2GFSA 2GNIA 3HP2A 4QTCA 4EZ7A 1H1RA 2DWBA 1FVIA 3LWBA 2QF7A 4UYNA 3EQBA 1W84A 5C1OA 5I5XA 1X9NA 2JDOA 3VA7A 3NUYA 2NUAB 3S3IA 3ZUUA 3KN6A 2YRWA 4Z9LA 2R3OA 2WMAA 5HU9A 5I9YA 3NYXA 5IA0A 4M13A 3EKKA 5A4LA 1KJ9A 1WBWA 4HGEA 2HY0A 2ZM1A 2BROA 2I80A 2WTKC 3JVRA 4R1VA 2W1FA 4RZWA 5CWZA 4EC9A 2HXLA 3UQCA 2X7OA 1EH4A 2JAVA 3QWUA 5ETIA 4EOQA 3I6WA 4BBFA 4EH3A 3Q53A 1PKDA 4LRMA 4IX5A 5EDPA 5BWUA 3SG8A 1KOBA 2PMLX 5FP6A 3V01A 3SG9A 4FSYA 1S9JA 2E9PA 2VV9A 4L1KA 3DOGA 1CKOA 4O7ZA 2BKKA 4LQMA 4A4XA 4CKEA 4IFCA 1IEPA 2IZRA 4FG7A 4U7ZA 2CNUA 3DGKA 4YNOA 3GU8A 5F95A 2GU8A 3R7UA 5IA2A 4DTAA 1ZAOA 3WI6A 5L8LA 4CFXA 2BAJA 1ET0A 5HD4A 1QCFA 5BVOA 2QR8A 4FZ7A 4DH5A 4FSRA 2OIBA 3TEKA 4RWKA 5IISA 3E5AA 3GQLA 3TUCA 3LFDA 4EH7A 2GTNA 3E7OA 4U81A 4ALVA 2QLQA 4EK6A 1Q4LA 4CC5A 2FGIA 3O8UA 2PUPA 4IDTA 3W5OA 2GS7A 4YZDA 4EKLA 4CG9A 3N4VA 5H8BA 1FPUA 2ZV7A 4OLIA 1M7QA 3NFGB 4GYIA 4O0WA 4J1RA 4BDAA 5CA1F 4AFEA 4E73A 2BVAA 4RIYB 2W6NA 4DCAA 5EYCA 3OUUA 4ZSEA 4G6NA 1ZY5A 4TPTA 3V5QA 4XBRA 2GS6A 2YAKA 1QPJA 4BI1A 3ZEPA 5BX0A 4AW5A 4X2JA 4D28A 3MA3A 3OFMA 4Y8VB 4FKUA 4RIOA 2VTNA 5C4KA 4OR5A 4ZTHA 1UU8A 4G3GA 5CU6A 4G16A 5DT3A 2UZDA 3N4UA 4FK3A 5LOHA 3TDVA 4ACGA 1QL6A 5AAFA 2XNBA 2G15A 5KHXA 1OKVA 1W0XC 3UIBA 4QRCA 5DRDA 2CMWA 5BVEA 3WZEA 4QT1A 3NNVA 4RIXA 1UKHA 4CRLA 4UCSA 4R7BA 4BC6A 5JFWA 2AUHA 5I47A 2O65A 2P33A 5IDNA 3KREA 4X6RA 3LJ1A 4EK8A 3FWQA 3TNQB 4C2VA 3QFVA 2OSCA 1SNUA 2JGZA 4Q9SA 5IH4A 4I0RA 4HYHA 5J2UF 5AP5A 4YJ2F 4JG7A 4DG0E 4EQUA 5IMXA 3GC8A 4PF4A 4CLJA 4OUCA 3T9FA 2HZIA 4H3BA 4PL4A 2GLTA 3GQIA 3EQCA 4GJ3A 1FINA 2WQBA 2B4SB 1XMMA 4E8AA 3PG1A 3PFFA 4C4EA 2Q2UA 3VUMA 3QCYA 3AKLA 5IQCA 3ZZWA 2FSLX 4UXLA 1H1QA 3PE1A 4E6AA 4YZ9A 2EXMA 5GIOE 4DFBA 2VUWA 2YHVA 3EHAA 1CTPE 2WQNA 3W32A 1OBGA 2BRNA 4HYSA 4F6WA 3VNNA 4UBAA 4ALUA 1XH9A 3WF8A 3GOPA 4YSJA 3ZXZA 1Q97A 2WTJA 1Y6AA 4RX8A 1ZYJA 4RG0A 4BHNA 2A4LA 3V8TA 2VO3A 1YXTA 3BQCA 3FMEA 3RCDA 4AGCA 3I0QA 3EMGA 5AV3A 4G34A 4AS0A 4E4XA 1I1LA 1UC9A 2R87A 3TXOA 2RFDA 5EI8A 3FLSA 5EW9A 4J97A 4O82A 4X3JA 4AFJA 3R73A 3VONA 4AWIA 4TL0A 2XEYA 2YS7A 5IEYA 4FGRA 4PX6A 2CKQA 3UPZA 5DNRA 2Y6OA 4WNKA 5BPYA 4WSYA 5BPFA 4WHZA 2PL0A 3AD6A 4PL3A 2DIKA 3P7AA 5TF9A 2J5FA 3COMA 2QQ7A 3AC4A 3GCQA 5ANJA 4BKJA 2CFMA 3UYYA 3G15A 2W1HA 3OHTA 2YWPA 2ZFYA 4UB7A 3Q60A 1UWHA 3KKVA 4G2FA 3SAYA 2V58A 5K5XA 1URCA 2DQ7X 3BYUA 3FE3A 3OWKA 4ENYA 2OO8X 4O7VA 3HMIA 5ACBC 3LW0A 5I5WA 3U9NA 4RQKA 4QMNA 3UZBA 2CN5A 4IVAA 3S24A 1K3AA 3U9TA 3FKOA 5KMLA 4I20A 5CM0A 3GDEA 4FKSA 3ETJA 4DGGA 4Y73A 2J50A 2B54A 2Y6MA 2YIYA 5JRQA 1P5EA 5IU2A 1YXXA 5FM3A 3POOA 4GMYA 3RCJA 4HGTA 3JZ6A 4X3FB 4V0GA 1Z9XA 3EQFA 4JBPA 3EQDA 3SD0A 4AXFA 4D58A 4DFNA 5IA5A 4LL5A 3A4OX 2DLNA 2W6ZA 1OUYA 2YM3A 2GHLA 2FB9A 3IDPA 3G0EA 2I0HA 3NLBA 5CE8A 5HD7A 3DKGA 3ODYX 3AX6A 1SVHA 3K54A 4PP9A 5L6WL 4EOLA 1UWJA 3AMAA 2WGJA 3ATSA 2HZNA 2WO6A 4RC2A 4FTAA 5DYJA 1GZKA 3D5UA 4CMOA 3QD3A 4CRSA 2JC6A 2RG6A 1WBOA 4GIIA 1I2LA 4RBLA 3R8UA 3JR1A 4YJQA 3W0SA 3ZSIA 3ENMA 2ITQA 4WO5A 4YBKA 5AMNA 5L8KA 4AOJA 4C4JA 4O86A 5JQWA 3TUDA 3PVWA 4AP7A 5BVKA 3F82A 4ERWA 4YTFA 5HX6A 3RTXA 1TQIA 2CJMA 3ML1A 4ACCA 2V59A 3IW6A 1TVOA 2F57A 3Q52A 2OF2A 1Z57A 3DZOA 4GH2A 4IDVA 4F0IA 5FRIA 2V7AA 4O38A 3AKJA 5JVDF 3CS9A 2ZDGA 5KX5F 2RKUA 3GU4A 1CKJA 4K18A 4U3ZA 4TY1A 5DN3A 5JZNA 2ZGIA 3IKAA 1PK8A 3KULB 2NU8B 1A06A 1YVJA 2YCFA 1OL5A 5CNNA 3R9HA 1RJBA 3ZCLA 3QD0A 3RJCA 3D4QA 3FJQE 4OTIA 3UZOA 2ITTA 3GCVA 4XG6A 5A4EA 3E92A 3TIYA 4TYIA 5AAGA 2OI4X 4E7WA 5I5TA 1EHIA 2OFVA 4MVFA 1CDKA 3K2LA 5FUTA 4AF3A 4LG4A 5I60A 1MRUA 3QGYA 4X21A 3ORZA 4JIKA 2Z7QA 3H4JA 2PVMA 5JT2A 1A48A 4LUDA 3L9NA 4O91A 3FI2A 3U9CA 2YZNA 4J7BA 3GVUA 4PDPA 2R3PA 4C4HA 3H0YA 2JIIA 4CV8A 1ZZ2A 3UO5A 2C6LA 1CQJB 1Z2PX 4F9BA 1YQJA 1XBCA 4GKHA 1JNKA 2X1NA 1P4OA 3NIEA 4DFXE 4EORA 5FBNC 2YM8A 3TZMA 3QKLA 3ROYA 4A07A 2C3JA 5EM6A 5ETAA 2ITZA 3VS1A 4FT5A 5AEPA 3SRVA 4EYMA 3ERKA 3FL4A 3OROA 4IC8A 1H07A 4IWPA 2R3FA 2J0LA 3WO0A 3HMNA 2XAOA 4RJ6A 3JY9A 4M12A 5IEVA 3M1SA 3W2PA 4I4TF 2W9FB 4G3EA 4MQ2A 5CI6A 2XB7A 1I7NA 1PRYA 4JDJA 3IOKA 4IWOA 3QKMA 3C4ZA 4JMQA 5E8WA 5HBJA 3GU7A 4HGLA 1MP8A 5AUUA 3B8QA 2X7FA 5D1OB 3N51A 3NNUA 2UV2A 4NCTA 3B2WA 5HHWA 2QU5A 3FV8A 2PTKA 4PNIA 5AP2A 4FV1A 3JPVA 3NUSA 4RX5A 5CB4F 2RGPA 4DA5A 5EM5A 4E6CA 5KZ0A 5J87A 5E8TA 4H58A 4QP1A 2VPQA 3LZBA 4D1ZA 3I12A 1CKNB 5DGZA 2EXCX 3DKCA 2P0CA 4ANBA 2IZUA 3NSZA 3PA5A 3PYYA 3R0TA 4H3QA 3PSCA 4GK4A 4QMTA 2HYYA 2P3GX 4KBAA 5A14A 3I6UA 5GJGA 1UNGA 3QC4A 3V5LA 4DN5A 4MAMA 4O81A 2YZGA 4IQ6A 4AGUA 3TWJA 4K9YA 4MWHA 4IW0A 3ZMMA 1YWNA 5L2TA 2BILB 4UCUA 4G3FA 2ZOQA 5LXMA 1ZMWA 3OXIA 2UVXA 4QDEA 1OITA 3QQGA 1CSNA 3DJ5A 3MVMA 4JVGA 3W2CA 2UVZA 1PYXA 1Q5KA 4FKLA 4XS2A 2HHFA 4V01A 2BDJA 4OTFA 3TV7A 3W1GA 4BCMA 4FFOA 4BTJA 4MV3A 3COHA 3BELA 3IECA 1IRKA 4X2GA 5LA6F 3MFSA 4EFEA 4RC4A 1H27A 3LFBA 4DGOA 4I6LA 4O7RA 4EH9A 5K2MA 3FLNC 4J96A 5E1SA 4HQ6A 3W55A 2EIYA 4PTEA 1QMZA 4MA5A 5BVNA 1G2WA 4JIAA 4F78A 4Q5EA 1WFCA 2GDOA 2EJ2A 4ZOLF 5E90A 4DAWA 3AQVA 1OPJA 1UV5A 5A4CA 5EFQA 2YW2A 5LCKA 3G0FA 3R28A 3V6RA 3QBNA 2XA4A 3HMMA 4JOAA 4ZZNA 3TIZA 4YR8A 3RPVA 2XRUA 2PZIA 3LOKA 3O7LD 4QYYA 4HR7A 5HO7A 3D5WA 5I0BA 3B8RA 2QR7A 3KA0A 4G31A 3TW6A 3RP9A 3MA6A 1PXNA 4WUNA 4TYHA 3V4ZA 2C6OA 5M56A 3G9NA 1O6KA 4FNZA 5AP3A 4BDFA 5DVRA 3D2IA 3EQRA 2WMBA 4EC8A 3UOJA 1UC8A 4EQ5A 2LGCA 3D83A 3QF9A 3F6XA 3VULA 4KAOA 3DNEA 4HZRA 4I93A 3JZIA 3GFEA 4E5BA 4QO9A 3UDZA 3FLQA 4LH7A 4YZCA 2QHNA 4BCIA 1KOAA 2PVKA 3ACKA 3QXPA 4I23A 4X6QC 1A0GA 1H01A 2OJIA 3NZ0A 3DTFA 5C8KA 4FVQA 3QD4A 1WVXA 5FXSA 2JBPA 3PFQA 3ZXTA 1GLVA 1Q24A 4GG7A 2GS2A 3A99A 4HVDA 4YURA 4L46A 1EUDB 2ZV8A 3LXNA 4Y5HA 4YJVA 2C00A 3OC1A 2WOUA 3ORNA 2X0SA 5J9LA 2JFMA 4PMPA 1OI9A 4MCVA 3OCBA 5GNKA 2CNVA 4FL1A 5CVHA 4AAYA 4GFGA 4V0GB 1P2AA 1JPAA 4I24A 5FXRA 4K6NA 4BDIA 3ZTXA 2R7IA 3NGAA 2W06A 3EFJA 3DJ6A 4XNEA 1OMWA 4I1ZA 2REIA 4GU9A 2ETRA 4H36A 4JRVA 4C2WA 3RV3A 4O84A 2UW7A 4RVKA 4C34A 2ITWA 5CTPA 4F6UA 4CTCA 4MXOA 3RPSA