2YZLA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
239
structure length
238
Chain Sequence
KLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 77
structure length 238
sequence length 239
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yzlA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzlA02
5J9ZA 1KJQA 2OU7A 3EFKA 1YOJA 4WHZA 4ZIMA 5A4QA 3QRKA 3OG7A 4H05A 4FIEA 3R7OA 3DKGA 1B6RA 5LXTF 4PX6A 1O9UA 4FEXA 2QQ7A 2OSCA 2HW6A 2VO3A 4OTRA 3QTIA 3IO7A 4B8LA 1Z9XA 1H08A 3VBXA 5JQGF 1UV5A 3N8DA 2W1CA 3SG8A 4BTFA 5BMVF 4IHPA 5CVFA 3BWJA 3AMYA 5JFVA 1OKWA 2J0KA 2YM6A 4G3CA 5JH7F 5HX8A 2GNGA 4LOQA 3W2OA 4ASXA 4I55F 3E8DA 2YA9A 3UIBA 3UC4A 2XRUA 2O65A 2JKQA 3FLYA 3FQSA 4N0SA 4RJ7A 4U43A 3W1FA 5JFXA 4PDYA 3ORRA 2SCUB 3TKUA 3IW6A 4KRCA 4QP9A 1H8FA 4JRNA 4DLJA 4FVRA 4G6OA 2WOTA 4E4XA 4IB3A 4YJ3F 2UW7A 2HENA 2CLQA 4P2KA 1OMWA 4MXCA 3FMHA 5CU0A 3BG5A 3AC2A 3DK7A 4FTTA 4ZJIA 3EIDA 5C4KA 5CAVA 3EN9A 1R1WA 2Z7SA 3OXIA 3UC3A 3UE4A 3LFEA 4DFLA 4EC9A 5AAEA 5IA1A 4BCJA 3NAYA 5IEYA 4ZHQF 3AC5A 4C5CA 2C47A 3K5HA 3RPSA 4I6HA 4IJPA 3QGYA 1SYKA 1WBTA 5I9VA 2PVKA 1L8TA 4ZP5A 5KO1A 2QOHA 1PMVA 3AT3A 3ORTA 5BVWA 3QTXA 4DEAA 4AA0A 2VTTA 1E4EA 2PVFA 4AFEA 3QKLA 2BRNA 4NYEA 2OI4X 3LCDA 1SVGA 3G9LX 4XG8A 4OR5A 4BCKA 5M44A 4QRCA 5FLFA 3QD2B 5KMJA 2H96A 4UXLA 1HCLA 3FMLA 2OXDA 4BDKA 1W93A 3OMVA 3PUPA 3VUGA 3QC4A 2F2CB 5E8YA 3UVPA 1OB3A 4M12A 3P4KA 3QBNA 3DJ5A 4BF2A 2CKQA 1OECA 4I5MA 4D4RA 4G3GA 4L44A 3OEZA 1JLUE 2VO0A 2XCKA 3BRBA 4IFCA 4XEYA 5DH3A 4EI4A 5CF6A 2DWCA 3Q4ZA 4HVIA 1WCCA 3DAJA 4YZBA 4MNEA 4MF1A 1IASA 1KV1A 4QMXA 5A4LA 2J9GA 4OBPA 2XNNA 4QMMA 1YXSA 3CKWA 3G0EA 4RC2A 1PMUA 1KE5A 3QRUA 4ZS4A 1VYWA 5AUVA 2JITA 2QR8A 4FKJA 3PRIA 3U6HA 4FV6A 4IWQA 3IW5A 3SA0A 4YBZB 2X2LA 2J5EA 3HUBA 1ZOHA 3QZHA 4IM3A 1ZYJA 5D9HA 3R9DA 3U54A 3RFCA 3EQIA 2VTOA 5E8ZA 3ZUUA 5I0BA 1XH7A 3RPYA 2P0AA 2NNWB 5EI6A 3COMA 4C35A 4CKIA 4QMLA 1KJ8A 3NNUA 5M56A 2YZAA 2FVDA 4G3FA 2Y9QA 3K5VA 4C34A 2R3MA 1Q99A 4FV5A 1YDSE 3MWEA 4F0FA 1JPAA 2NU6B 3R7VA 3PIZA 2XVDA 2GNFA 4RWKA 4AT4A 3KFAA 4FKVA 2BMCA 2W1DA 5CEPA 4EK5A 2V0DA 3QL8A 3RAHA 3DBQA 2Z02A 5EM8A 3SW4A 4CFXA 5IMEA 3JZFA 4U6RA 2VWUA 3GQIA 4PUZA 4K18A 4YTFA 3BHUA 5L6PA 3MIYA 3VUDA 3V5QA 2C5NA 4FFPA 5CLPA 5KMLA 1F5QA 5J9YA 4IX5A 4BCPA 4ZLZA 3TQTA 1OIQA 3EZRA 3E5AA 3FI2A 3UYTA 3DK6A 1VKZA 4MTAA 2XKCA 4FV0A 4OT6A 1OM1A 4DITA 2R7LA 5D12A 2OLSA 1ZYDA 4HCTA 4I5CA 4E7WA 3PIYA 4YLJA 3R5HA 2XNBA 1GIIA 3SXRA 2OK1A 4KSPA 2XIRA 5IA3A 4H39A 1RJBA 3OW4A 4C4IA 4JG8A 5IQDA 3DF7A 1U54B 2V62A 1L3RE 3E88A 2C69A 2XNGA 1FGKA 4JX7A 1IOWA 1M17A 3G51A 3P7AA 2BTSA 3F88A 4YPSA 4ZLYA 4WG3A 2ZDQA 4F1OA 4GU9A 2OXYA 3F3ZA 4GEOA 4LI5A 4F9CA 4XS2A 1Q24A 4NJDA 4I4EA 3EMGA 3QLGA 1OKZA 3G0FA 3D5WA 4D0WA 2VTNA 1Q8WA 2R3IA 2F49A 3K3JA 1JSUA 3WF7A 4KB8A 1VBHA 2Q0BA 2GHMA 3BBWA 3E3BX 3ET7A 4CZTA 4TYHA 3NX8A 2H8HA 4AZSA 4GIHA 2J0IA 3E3PA 3KXXA 5ANIA 3I79A 2Z7QA 4FV1A 4EZ3A 2JDVA 3A7IA 4MH7A 5F9EA 4JDHA 2Y6OA 5TR6A 4AACA 4QQJA 3GI3A 3OXTA 1CDKA 2XZSA 4TNDA 4MV4A 1A48A 4I93A 4J8MA 5EOLA 4ZEGA 3RI1A 3QCQA 1GIHA 1ND4A 4JX3A 4FSNA 5K5XA 3DT1A 4CG9A 4TWNA 3EL8A 4KS7A 3Q9XA 3RPVA 4BDAA 4O7ZA 3D0EA 2GLTA 3TZ8A 2XKFA 4YJPA 4Y83A 4NT4A 2ZDHA 3H30A 4O22A 2O8YA 4ACMA 2BROA 3E93A 5M53A 4UBAA 4EHGA 3F7ZA 3QTUA 4FTNA 4GUBA 2CCIA 3P7BA 2W5BA 5AX3A 3BELA 5FEDA 1PRYA 3ZC6A 2Z7LA 3TXOA 3ZCLA 2HZIA 5F94A 4EH2A 3KMMA 4ZAUA 1JSTA 3WIGA 4MD8E 4E6AA 3KEXA 4XV1A 5HIBA 3U6JA 4RZQA 3BV2A 3W16A 2PZPA 2FA2A 2GDOA 4FKQA 3TT0A 2CGWA 3M11A 4I6FA 5F4NA 3LM0A 4BHZA 3WYYA 2DZDA 3R02A 3Q5ZA 1PXJA 5CF5A 4FGBA 2W05A 2YJSA 4ZZNA 3R8UA 2EU9A 4XCUA 3COKA 2C68A 2J5FA 2R7IA 4G1WA 4IB0A 4UZHA 3LIJA 4NFNA 3OY1A 2WTDA 3TW6A 3RGFA 4B8MA 3SOAA 1Y57A 3E62A 3DK3A 3M2WA 3VW6A 4MKCA 1ULZA 4EOLA 3AC4A 3D7ZA 1GZOA 2ETKA 2UW4A 4FSMA 4RC3A 3PXKA 4O81A 1YDTE 4NFMA 3KY2A 4MV1A 3SE7A 3DAEA 3FZTA 3ZRKA 5H3QA 4FKGA 3EFLA 3V5LA 4IIRA 3TJDA 4PP9A 2YABA 4EOIA 4RA5A 2P0CA 4G17A 5ANOA 4QYYA 3MTLA 3BQRA 3IGOA 3TCPA 4C4HA 4K9YA 4IZ5A 2W9FB 1GAGA 2C30A 1R3CA 3H4JA 3HRFA 3MVMA 3LAUA 4G2FA 4B6LA 1DM2A 2BAQA 3FMNA 5IQEA 5IQFA 2B1PA 1Y8GA 4WUAA 4QP4A 4HGEA 3GU8A 1REKA 5JH6A 2HY0A 4M15A 3B2TA 4X2NA 2XCHA 2YWVA 1AUVA 4BDBA 2OF4A 2JBOA 1PK8A 2W71A 2ZOQA 4I24A 4F99A 3RUPA 2XKEA 4S31A 3MN3A 3Q96A 1OKVA 2WU6A 3C4WA 5JZJA 5HCZA 2GU8A 3UTOA 5JGAA 4NW5A 5LCJA 2V59A 5HV6A 5LMBA 3DY7A 2CMWA 2VGOA 2R7NA 3RTPA 4CFMA 2QLUA 3MPTA 3EJ1A 3PJCA 4PTGA 1FMOE 2ITYA 3H3CA 3OCBA 3OVVA 4U3ZA 5CEIA 3BPRA 4MV3A 4G9CA 1KJ9A 5BVKA 3UP2A 5CVHA 3GCUA 4YPDA 3T3VA 3A7JA 5EFQA 5HU3A 2X81A 4CKJA 4B99A 2CGVA 2O5KA 4WA9A 1XH8A 5HHWA 3ZBFA 2QI8A 5F95A 2X7GA 2ZV2A 3UODA 4F9YA 4DEBA 2Q0NA 4ZMFA 2VR1A 3D5VA 3KXHA 3P1AA 3TN8A 5JRQA 3LOKA 4FOCA 2PVMA 3SC1A 2QVSE 5J1VA 3F5UA 3GC9A 2A0CX 3ETJA 4BGHA 3Q52A 4X2JA 4RIYB 1CKPA 4FK6A 2YS7A 5IQCA 1H1WA 3KGAA 2GSFA 4FKSA 4FNXA 2HWPA 4IM2A 1Q8TA 3JY0A 3SLSA 3VBYA 4GK3A 1E9HA 2OGVA 3O17A 4C4EA 4EHZA 4EONA 4CVAA 5FXQA 5AV1A 3OD6X 5BPHA 1XH6A 4O83A 4GCJA 4OT5A 1REJA 4O4JF 1UU7A 1BYGA 1MP8A 3V4ZA 3AMAA 3Q9WA 3BLRA 4MQ1A 2UW5A 3MTFA 3BGPA 3O51A 3EN7A 3FY2A 2JDSA 3RK7A 2WD1A 3ZUVA 3AT2A 5HZNA 4M69B 5CSWA 3AC3A 5I5ZA 5ANGA 3RCDA 4L67A 2G2IA 3NUYA 3R9HA 5ANEA 3DOGA 3C5IA 3FHIA 3IGGA 4OGRA 5IQGA 4AS0A 3TIIA 2X8IA 4J99A 3D4QA 2R86A 3MY1A 4O7LA 4JBQA 2ZMCA 3IG7A 4QQ5A 4YJRA 2WQBA 4RFZA 2GTNA 4RX7A 3FSFA 1M0TA 3C7QA 3HV3A 4L53A 5HIEA 3IOKA 4I21A 3QX4A 3MPAA 3JRXA 2RFNA 4FFMA 1ZMUA 2Z60A 4F08A 4TL0A 3G8DA 4EYMA 1CKJA 5D7AA 4YMJA 1Y6AA 4RG0A 4CV8A 1H28A 2C6MA 1PJKA 1JWHA 2F2UA 2PE1A 3VQHA 4A9TA 4F63A 3W55A 1PYXA 2BFXA 4O86A 5TO8A 3TUCA 4YJTA 3UQCA 2PZRA 4GL9A 4OLIA 4CTBA 2AYPA 4GFGA 2O64A 2HGSA 5HI2A 2QOIA 4YTCA 1F3MC 4A07A 2QC6A 5LWNA 4AXAA 3K5UA 4IAKA 4ERKA 4HVDA 2BUJA 4AFJA 4IEBA 1FGIA 4UZDA 4BN1A 4ASDA 1XH9A 3OWLA 5CY3A 5M06A 5K4IA 3TJCA 1FVRA 3LFAA 3V51A 1VYZA 4EJNA 4PP7A 4U42A 4MA0A 5M4IA 4QMYA 4XLIA 4AN9A 4PDSA 1PF8A 4DE4A 4DIMA 3FYKX 2BRBA 4DGNA 4F7LA 2W6QA 1BNCA 5GIPE 3R1SA 4XG7A 4XUFA 4GH2A 5EDQA 3W2RA 5B7VA 4ZMEA 4FSUA 3ANQA 3ENHA 4GT4A 2YL2A 3LXLA 1Q8YA 3QF9A 2YWPA 4MWIA 4PY1A 4FODA 3G90X 3W8LA 4DT9A 4EHEA 4RQVA 4U8ZA 3FWQA 2IWIA 4WNOA 4TWPA 2W99B 5FEQA 5AMNA 2J0MB 3QTSA 3KRJA 4PV0A 3UPXA 5IDNA 5KBRA 2J9MA 4ITJA 4V0GB 2YM3A 4NTTA 5DT4A 2HYYA 3KKVA 3ORPA 3PZHA 5LP6F 5HVYA 5AM7A 4EKLA 5EZYF 4J7BA 4UYAA 4DGMA 1UA2A 4G9RA 4CT1A 3WE8A 4FNWA 1UU9A 1U5RA 3T8OA 1C30A 4F7NA 1UNGA 5DN3A 4FEVA 3DFCB 5JMSA 2B52A 2GFSA 3Q32A 4CFUA 1J91A 2W5HA 2C00A 4J95A 3MW1A 4TYIA 3R9RA 5IPJA 1KC7A 5HQ0A 5DWRA 4MV7A 4NWMA 3FZSA 4X21A 3RK9A 1Z57A 1T45A 3FMJA 3PRFA 4X3FA 4MHAA 2I80A 1NW1A 4FTQA 2C0IA 3CPCA 2XM8A 2R3OA 3DKOA 3KQ7A 3MVLA 4K6ZA 4KABA 5GJDA 3UYSA 3V01A 2XYUA 5LOHA 4HQ6A 3VOTA 4XBUA 2WMVA 2CKEA 5DI1A 4IX6A 3UIUA 2P4IA 2BTRA 3S2PA 5K5NA 1M7QA 2GNIA 3C0IA 3ALNA 5I9XA 4BI2A 3UFXB 1AGWA 4LOOA 1T36A 4O4HF 5CT0A 5AV4A 2VZ6A 2PVHA 4HVSA 3NWWA 1WVYA 4M14A 4QMNA 4FV2A 4BIDA 1QCFA 2X7OA 4NW6A 3DA6A 3KMUA 3GT8A 2C5XA 2C6OA 2OO8X 4C37A 3LHJA 3VS0A 3RV3A 4YO4A 4KIQA 5C01A 5HLNA 3KMWA 2UUEA 4YSMA 1Z2NX 5AEPA 4EOKA 3P5KA 5HX6A 4XRJA 4HGLA 5KMNA 3CC6A 5IQHA 4LV5A 4RJ6A 5M57A 3KALA 4IFGA 4NJ3A 3AT4A 5E8UA 2XBJA 3QQKA 3REPA 3HMMA 4O6LA 4Y73A 2DIKA 2W9ZB 1R0PA 5FD2A 4L01A 4ZOLF 4RJ3A 3KVXA 3HYHA 5JK3A 5LCKA 1I09A 3VBTA 3VS5A 4QMSA 2F7EE 5K4JA 3PXZA 2OJGA 4FTCA 4YP8A 2WMWA 4XV2A 5DHJA 3GU7A 3A2CA 4AA5A 4RWLA 4YGAA 4W4XA 1KEEA 2BVAA 3UVRA 3U8WA 2J50A 4YBKA 3PPJA 5JRSA 4CRLA 4O2AF 1OZ1A 3S3IA 2XUUA 3ZSIA 5HO8A 3MPMA 4M9UA 3R04A 1YXVA 2WIPA 3PIXA 3V8SA 2V7AA 4OTWA 2O3PA 3W2CA 4G3EA 3HGKA 4O7TA 4MV9A 4E93A 4S34A 1TQMA 4XG2A 1H00A 3W2SA 2R0IA 3JY9A 3NRMA 4BHNA 3QALE 4HR7A 5C8YF 3EYHA 3O23A 1DV1A 4FEUA 5AAFA 1LEWA 3CQWA 3WZEA 4E5AX 2XIZA 2B9FA 2QU6A 2XK8A 3CQEA 3EQBA 4FYOA 4XOZA 4OUCA 5CU2A 4BCIA 2DUVA 2DYLA 2HXLA 2XK4A 5C8KA 3F3UA 4GYGA 4QMOA 4RJ4A 4FKTA 3GCVA 2WO6A 4XRLA 1EYZA 3UMXA 1CS0A 5CI7A 4XV3A 3FMEA 3RHXA 3QZIA 1QPDA 2I8CA 3DU8A 5IISA 3R5FA 5ETFA 5CEMA 3E92A 3MA6A 4FI1A 4XBRA 2PN1A 2QKRA 2ITOA 4D2RA 4Y8VB 4ENXA 5AA8A 1J1CA 2VWBA 4FIHA 4X2FA 5HLPA 4YB8B 1NVQA 4AZEA 2PL0A 1CMKE 2B9JA 2Y7JA 4L1KA 4UXQA 3I7CA 4QTAA 4ANMA 2R7KA 3P7CA 3ZLSA 3EHAA 1LR4A 4WNMA 2C3JA 3OY3A 1A06A 3B8RA 3D9VA 5A9UA 3H0ZA 5BNJA 4IAZA 2JAMA 3NCGA 3KCKA 1IRKA 3AOXA 5KZ0A 3VHKA 5LMKC 3FXZA 3BYSA 4BBEA 3NZ0A 4YJUA 4AZTA 5A14A 3FZ1A 3QHWA 4JAIA 2ETMA 4FTKA 1ZYCA 3TZ9A 4AGCA 3MJFA 3UZRA 2WMUA 2VO6A 3BCEA 1FQ1B 2IVUA 3SRVA 5HBEA 4O91A 1GLVA 5GJFA 1SNUA 4IAAA 2CNQA 2UW8A 1SNXA 4WNKA 2PMOX 3KA0A 3LLTA 5EM6A 3JYAA 2XB7A 2YCSA 3LMIA 4M0YA 4EEVA 2X2KA 2I6LA 3V3VA 4ASEA 3L9PA 5J9LA 2HXQA 2Y8OA 4IZYA 2RFEA 5D1JA 2PUPA 4ZY6A 5HNBA 3TTJA 3F2AA 2R3PA 2WTIA 4USDA 2W4JA 4E6QA 4ZJJA 4AN2A 4UWBA 2FSOX 2XRWA 4DG2E 4IVCA 3L9NA 4G6NA 4I6QA 2W6PA 2J2IB 3PG3A 4N70A 2QD9A 3VS4A 3SW7A 4ITIA 1FMKA 1EH4A 2PK9A 5CEOA 4ZJVA 4NCTA 2YN8A 2UVZA 3K2LA 5D10A 2I40A 4DGOA 5FXSA 4ZY5A 3Q2JA 2FUMA 3OTUA 4BZOA 4QQCA 2JDOA 2C4GA 1GOLA 5KMOA 5M07A 1JAMA 3M42A 4FSQA 3R8MA 4PL3A 2P33A 1TVOA 4MBJA 2R3RA 1R0EA 1XKKA 4IB5A 5JQ5A 3ZXTA 4KKHA 3GOPA 4JDKA 4C4GA 5GNKA 4ZXTA 1QPJA 3PJ8A 3R2YA 4FKRA 4D1XA 4FU0A 4H3PA 4DTBA 3MH1A 3FMKA 4TYGA 2HELA 2VNYA 4GRBA 4DH8A 2PUIA 4UN0C 3BHTA 5AIRA 2IVTA 4M0ZA 4ZTLA 3ZLYA 2YFXA 4RMZA 3VUIA 2Q83A 1CKIA 4XYFA 3MS9A 1YI3A 4WG4A 1JKLA 2YIYA 4MAMA 1M7NA 5K9IA 3NUXA 4K2RA 1YRPA 1GZKA 3CCNA 4OW8A 4KBKA 4BCQA 4FYNA 4E1ZA 4YHTA 5AP2A 5HE1A 2EXCX 2J4ZA 4UYNA 5EKNA 1FVTA 4LG4A 3PA4A 2FGIA 2VWXA 4I23A 4Y95A 4IVDA 4JQEA 3KULA 3UBDA 4CFVA 5BUIA 1E1XA 2DS1A 3R8PA 3SGCA 4NKAA 4FX3A 3TINA 3F5XA 4WD5A 2UZWE 2JIUA 3EN5A 2FPGB 3VPBA 3V8WA 3N4TA 1H0VA 5E4HA 1ATPE 3UQFA 1YOMA 4FKPA 3EB0A 4Z7GA 1H1RA 4I92A 2QU5A 4JRVA 3GBZA 2VRXA 2B9HA 4LGHA 3QQJA 5KMKA 5LQFA 1R39A 4YJNA 5CZHA 3EQFA 4I1ZA 3DXNA 4YO6A 2BPMA 5IH4A 5KUPA 4F65A 1QPCA 3MVHA 4ANSA 4YR8A 4HYHA 2ZDTA 2WZJA 4QYGA 2ITUA 2R2PA 1SMHA 3FI3A 1W96A 1G3NA 4M3QA 4U44A 5EHYA 2C3IB 3QC9A 4AGUA 5DEWA 3Q1KA 3PWYA 3KRRA 3U51A 3JXWA 2UZBA 3CE3A 2ZYBA 3O8UA 3QZGA 4MWHA 3DPKA 4DA5A 4EJ7A 1Q3DA 4C62A 4IH8A 1ERKA 4D2SA 4L42A 3I6WA 4V04A 3N9XA 4M8TA 5A54A 3R7YA 3VWAA 4EGJA 2HIWA 4J71A 4RGJA 5ANKA 4BGQA 3GOKA 5CAOA 2C1BA 2YIRA 5D7VA 1PXLA 3R1YA 3TM0A 4AZFA 5BYYA 3E8NA 5AV2A 2WNTA 3VMMA 4RVMA 4O0TA 4F1MA 3LFDA 3ORXA 1XBAA 4FC0A 2PVYA 4ZY4A 5K3YA 3R28A 3HV5A 3C51A 4ANQA 4WNPA 4WSYA 4G16A 1OGUA 3QD3A 1GSHA 2UW9A 2JKKA 2A19B 2QKWB 3LMHA 3G8CA 1RQQA 3FL5A 3DQXA 4FMQA 4O0XA 5LJJA 1OUKA 4K8AA 1GSAA 3RVGA 1KSWA 2RIOA 4IIJF 2BZJA 2IZTA 4M84A 2GS2A 3MH2A 2QURA 3FQEA 4FSYA 3UG2A 4CFFA 4NSTA 4FTRA 1ZARA 3FZRA 4TW9A 3LFCA 3KB7A 5CANA 5J2UF 4MEDA 4MD9E 3ATSA 5L6OA 1YI4A 3BEAA 3OHTA 2ZJWA 4U0IA 2JGZA 4DBXA 3FPMA 4XLVA 2H9VA 4AAAA 4O82A 3LFFA 5M51A 2YISA 4OBQA 4WT6A 4IANA 4BTKA 5KE0A 5IUGA 3II5A 3U4UA 3ZUTA 5AUUA 3QRIA 3ZM9A 3SDJA 2FP4B 2OWBA 3FJQE 3SV0A 1SVEA 4L45A 3UNKA 2R7MA 5LOVF 2I0EA 4GMYA 4MXXA 1H1QA 2BAKA 3AD4A 2IZSA 4YZ9A 4Z3VA 4XYMB 4ZTRA 3PY0A 3R5XA 4ZTQA 2ZDGA 3R2BA 5LXMA 3UZTA 4QTBA 3UG1A 3MIAA 4DH5A 4XHKB 3QUPA 5CXZA 5FDPA 2RG5A 3VS1A 3D2KA 3EFWA 3IW8A 4KIOA 4UY9A 3PZEA 3V04A 4DC2A 5KX5F 3O8PA 2GHGA 2RKUA 3PE2A 4XG4A 5I9ZA 4IDTA 1OITA 2VX0A 2UW3A 3IPHA 2C6TA 4FTUA 4EK6A 4NKSA 2R82A 2G9XA 3CGOA 3C50A 5KCVA 4F7JA 2XNEA 3P86A 4EHVA 4F0GA 3ZC5A 2GNJA 3PVGA 4JBVA 2GQRA 2NRYA 4DINA 5HEZA 3MB7A 4F7SA 3AC8A 3NLBA 3VUKA 3ZMMA 4Y5HA 3AD6A 4O7WA 4D28A 2PTKA 4FICA 4E26A 2ONLA 2UW6A 4LGGA 4NUSA 3GXLA 3ZO1A 1OIYA 3I5ZA 2W4KA 4LUEA 3EYGA 4P5ZA 4B4LA 4JL9A 2VWVA 4QTEA 3A7GA 3DFAA 5HD4A 3R21A 4RJ8A 5F20A 4XH6A 4FTMA 3DDPA 1UKHA 3FXXA 3KXNA 4D58A 3WZKA 4DEIA 4HVHA 3L9LA 3RWQA 5C1OA 3HVCA 3BX5A 1Q41A 2ZMDA 3E63A 3FAAA 3LFSA 4Y5QA 3A60A 2IP4A 3PXQA 4Z9LA 2UW0A 3G5DA 1M52A 4M97A 3KRXA 4QT1A 1PW2A 2Y6MA 3Q53A 5TKDA 5EI2A 3RZBA 2W1HA 2F4JA 3FV8A 2UZDA 1BX6A 5ETIA 3VO3A 2R84A 1FOTA 3DV3A 4HYIA 5DG5A 4ID7A 3GP0A 3ID6C 1XH5A 4U80A 3T9IA 2ZV8A 2QODA 1EHIA 2VQDA 5GHVA 4WOVA 3TTIA 3D94A 4O4IF 1YDRE 4IDVA 5CSHA 2WB8A 4E4NA 3ORZA 3DNDA 2BILB 5FTGA 4BCNA 5HORA 4W4WA 4CRSA 2PZIA 1PXKA 2ERKA 3KN6A 5C1QB 2NU8B 1BMKA 5JFSA 3BKBA 3UO5A 4J96A 2QCSA 2C3LA 1Y6BA 4X6QC 2VX3A 3A8WA 3PVUA 3RM7A 2WTVA 1WBOA 3RK5A 4R78A 3C4ZA 3MI9A 5AV0A 3HRBA 3HL7A 3GU5A 1URCA 2FYSA 3LFBA 3Q2MA 3R9NA 5E9EA 4CXAA 5E8XA 2ZAZA 5FG8A 4A9SA 2WMSA 4RIOA 5JKGA 4O7YA 3BQCA 4FFOA 3LCTA 1YXTA 1CQIB 2HZ0A 5IA4A 5FGKA 4AQCA 2GNHA 4FL3A 3BWFA 1B38A 2WMTA 3SQQA 1BL7A 3HMPA 2JKOA 5HG5A 5DIAA 3VS7A 4DTKA 4H3QA 5DMXA 4BZDA 3PJ1A 2YERA 4Y46A 4AW1A 4IJ9A 3BU5A 5L2SA 3VUHA 1M2PA 3QRTA 5AP4A 2WTKC 3QCXA 2RGPA 4S33A 4F6WA 1E4EB 3GU6A 3NUSA 4OTFA 3PTGA 5L8KA 3DTCA 4HCVA 3FSKA 4IZAA 4E5WA 3FHRA 4RLLA 4ZSJA 2PPQA 2WQEA 5BMSA 3HO8A 1GJOA 2GFCA 2QF7A 2QHNA 3LFQA 1JQHA 3NAXA 5E1SA 2X6DA 5IZFA 3HB9A 1PXPA 1UWJA 3QA0A 4RWIA 4WIHA 4IWOA 3W2PA 2IJMA 4PMTA 5E8WA 3MDYA 4PQNA 4U7ZA 3TG1A 1U5QA 3EQDA 4YJQA 2QHMA 3FMMA 4ZS0A 1DS5A 3P9JA 1KV2A 2AC3A 4V0GA 4F6UA 1BKXA 5CVGA 2UZOA 3ENMA 3JVRA 4DEEA 3ZSHA 4MNEB 3QXOA 4BDDA 2CHLA 3PYYA 4I0TA 3SOCA 2W1FA 2GMXA 3ZFXA 3CTJA 1BUHA 4KBAA 4RT7A 4CTCA 4BYJA 4D5HA 3EQPA 3TV7A 3QQFA 3L8VA 3OBGA 4K11A 4BCMA 4IZ7A 5CSVA 3ATTA 3E5NA 3UOLA 4AZWA 3R00A 4AT5A 5LA6F 2IZUA 2YCFA 2XK3A 3AC1A 5JGDA 2W4OA 2WMBA 5CYIA 4DH7A 5CQWA 1VR2A 3KL8A 3MH3A 4DCAA 2OZAB 3P08A 5ANJA 2CJMA 5EG3A 4FZ6A 5A4CA 2VTMA 2WMQA 5HBHA 2JFLA 4R3RA 1ZZ2A 4TTHB 2WTCA 4DF3A 4Q2AA 3KXZA 5TOZA 4WRGA 4YNEA 2SRCA 5JEBA 4XZ3B 1H27A 4RFMA 5DVRA 4FEWA 3V8TA 4DH1A 3ULZA 5A6NA 4FIFA 1W84A 2YDJA 1CSNA 2YDKA 4PMSA 4KD1A 1M0WA 3DDQA 3VULA 3EOCA 4YURA 4H58A 3HRCA 3QFVA 4MK0A 5G6VA 4I0SA 4UWYA 5CX9A 4IBMA 1H26A 1OPLA 4NM0A 2YITA 1WBNA 4L3PA 4KRDA 2HOGA 3A62A 5E91A 2YS6A 5EDRA 3D14A 3EWHA 4X6RA 1YXXA 3ANRA 3JRWA 3BU3A 3PE1A 2Y4IC 2OJJA 4BKJA 1M2RA 2B9IA 3MBLA 2NRUA 5DT3A 5LVOA 4RWJA 3VNTA 1JBPE 2QOBA 4EK4A 4WBOA 4BZNA 3CD8A 1B6CB 1XH4A 4YAJB 3LE6A 1YWRA 3RMFA 2YZGA 3TNHA 1GIJA 1Q97A 2QNJA 2RFSA 4DG0E 4MXOA 3LM5A 4QO9A 5JZNA 2V22A 2IPXA 4OTGA 4KSQA 4ORKA 3G6HA 5E7RA 5BYZA 4XOYA 1IAHA 4X3JA 2VV9A 5BPYA 4MYGA 2HY81 4C58A 5CA1F 4O96A 5IA5A 5A6OA 2XNMA 4M13A 2YAAA 4XG6A 3MFUA 4O0SA 5FBNC 4GUEA 3WF8A 4A06A 4TYHB 4JAJA 1KJIA 3G6GA 3N51A 2I7QA 1DAWA 2G01A 3BGZA 3R73A 4II5A 1K3AA 3L9MA 1E1VA 3A61A 2GQGA 2VTPA 2PVJA 2OZOA 3UGCA 3VJNA 3ZBXA 2PE0A 3ZS5A 4F0IA 4ZLOA 2YZNA 1KUTA 3KN5A 4H36A 5GONF 3WE4A 1PXNA 3I81A 3R1NA 2EB3A 2GS7A 3EFJA 4G5PA 3E8EA 3D7TB 3FKNA 3HV6A 4HYSA 3OCGA 5EK7A 3RKBA 4Y85A 5CAPA 3HP5A 4QTDA 1H1PA 1ZOEA 2QOOA 4CQEA 2VTIA 2R5TA 3TNQB 3NNXA 4ZSLA 2VTRA 4ZTHA 3G15A 3ZH8A 2CKPA 5CF4A 4QYEA 2QOQA 3UOHA 4LRJA 5AV3A 3PG1A 3DCVA 3QZFA 3CEKA 4F9AA 5B2LA 4KWPA 3RHKA 2W70A 3LWBA 4DLKA 4YC6A 5IEVA 3GFEA 3QX2A 3BEGA 3QUDA 3NYVA 2PBZA 1KOBA 2PMLX 3F82A 3MV5A 4O0UA 5CT7A 3ZO3A 4AZVA 2W1IA 4C3RA 3G33A 2QOCA 1PKDA 5C4LA 3NYOA 4EOSA 4D1ZA 5JQ8A 5CNNA 3S95A 4GVAA 4RLKA 3K3PA 1JKSA 3FL4A 4ARKA 1OIRA 1YWNA 2YDIA 5HG7A 4GV1A 4HCUA 4K0YA 4RIWA 3B2WA 5CU4A 3F2NA 1W0XC 2IW6A 4MD7E 3ZDIA 5CSPA 5IDPA 2GPWA 4MV8A 5C9CA 4EH8A 1SCUB 1IEPA 4YLLA 4FVPA 3VS6A 3FQHA 3GENA 1WBVA 2WTKB 4X2KA 2I0VA 1LPUA 1QPEA 5HBRB 3N4UA 3MESA 4O7VA 3MA3A 3C0HA 5AFVA 4CLJA 3GGFA 3QQUA 4DTAA 4C7TA 2P2HA 2W7XA 3ZEWA 2WIHA 2OJIA 1J7LA 4U79A 4BBMA 5J8IA 3FI8A 4C38A 3OCTA 2YEXA 3UP7A 4U5JA 4EWQA 3PDTA 4U3YA 4JBOA 5CWZA 2X8DA 4PMMA 3MJ2A 4ZZOA 4KUJA 4WBNF 1FPUA 2FPIB 2QOKA 5FM2A 4EKKA 2RG6A 3BHHA 4RIXB 3IDBA 4L52A 5BVDA 1B6SA 2G15A 4RVTA 1OL2A 4ITHA 4OTIA 4AW0A 1FVVA 4CCUA 1SZMA 2R87A 4YJSA 4FFRA 4M7IA 4HOKA 2XK7A 4JS8A 4ZTSA 4GT3A 5T3QA 4EYJA 2XJ0A 4FG9A 4EH6A 4W4YA 4Q9ZA 4AOIA 2C0OA 2PVLA 4I3ZA 4GT5A 4TNBA 2YRXA 1YHWA 4D0XA 5IMXA 4C3PA 4X3FC 3W33A 4DFBA 3UJGA 3KAKA 3TIYA 4EK8A 4M68A 2IZRA 4RX9A 4UB7A 2PVNA 4FTJA 5CA0F 4EL9A 2OJFE 5DE2A 3QCSA 3PPZA 3GC8A 4QMVA 4Y72A 3TDVA 2UVYA 3HX4A 3F3TA 3ITZA 3OROA 3QQGA 2BRMA 5FQDC 5DR2A 1ZLTA 2P3GX 1JDEA 2C1AA 4HPUE 1XBBA 3KVWA 1OL1A 3F5GA 3HLLA 4IW0A 3GCQA 2HCKA 4O0RA 3HDMA 2UZNA 3Q4CA 4AU8A 2W1GA 5HBJA 5IU2A 2VWZA 3VJOA 5AWMA 3NDMA 1IAJA 1H24A 2YRWA 4PMPA 5HE3A 1P4FA 4W4VA 1WFCA 4BRXA 2LGCA 2IN6A 5JSMA 5CXHA 2XM9A 3QHRA 3DB8A 4YC3A 4Y8DA 4JIAA 1YHVA 3KXMA 4DGGA 2Z04A 2Y4IB 3IK3A 2BHEA 3A4PA 4AW2A 1ZY4A 4BIEA 5TF9A 4YSJA 4U97A 4YHFA 4IQ6A 4XG9A 4JDIA 5GIOE 3I60A 1CTPE 1PKGA 3F3VA 2XP2A 2XEZA 4O7NA 4FZFB 4DH3A 4QMTA 3F66A 3NR9A 5CI6A 4ANBA 3CQUA 4EH4A 2B55A 3TI1A 1M2QA 4EH5A 5J7HA 2IW8A 3PY3A 4FNYA 3NUPA 5B0XA 2Z7RA 3KREA 4QOXA 5F1ZA 4F64A 4J52A 2NU9B 3R7IA 3R01A 4BDFA 3KF4A 1Y91A 2OG8A 4IAFA 3R8VA 4KKEA 2J0JA 1KWPA 2EVAA 4DFUA 3Q4UA 3OUUA 2GHLA 4IE9A 4EOQA 1STCE 4EK3A 1NVRA 3NVKI 4I4TF 2BHHA 3BHVA 4O84A 3OWKA 3Q5IA 4AOTA 3EKNA 2VPQA 3ZFYA 2VTHA 1OBDA 2EUFB 2BAJA 4R7HA 4QNAA 3GEQA 3RALA 2CN5A 2RFDA 5EOBA 5IA2A 4GG5A 4CMUA 4Z16A 1GZNA 5ITAA 3JVSA 2G1TA 3CJGA 3OTVA 4YBJA 3Q6WA 1DIKA 5KHWA 3QLFA 3AGMA 3ZZWA 3TKIA 1VZOA 4LM5A 4I20A 4CZUA 1UU3A 2ITTA 2PSQA 4FUYA 4I94A 3V6RA 4AGDA 3NNWA 4R7BA 4APPA 5EW3A 5ANDA 1H25A 2NO3A 2VUWA 4KNBA 5KKNB 2ITZA 1XQZA 1RW8A 3P0MA 4GW8A 4ERWA 2FSTX 4YUQA 3VPCA 5KKRC 2YYAA 4HNTA 2XK6A 4FV7A 3A7FA 5HU9A 3LVPA 4FKWA 3ZO4A 3OS3A 3DB6A 4P4CA 3F6XA 3QTQA 2H6DA 4N6ZA 2E9UA 4IADA 2J0LA 3ORIA 3QTZA 5CS6A 2B0QA 4R77A 2V7OA 3BHYA 4CMOA 3EN4A 2GNLA 4EG0A 4ZSAA 5AP0A 4GK4A 1PY5A 3ELJA 1XJDA 3HKOA 3Q4TA 5CENA 2XIXA 2R3NA 2OXXA 4KA3A 3UQGA 4CGAA 4C61A 3DAKA 4JLCA 4AN3A 4E5BA 2REIA 2ZM4A 2BZHB 3VF9A 3N6RA 3SAYA 4MXAA 5ACKA 5LVMA 4E6CA 4A9YA 1IA8A 1BXRA 5L2WA 3JZIA 1KE6A 5CAEB 2WYOA 4BBFA 1Q62A 4O6EA 2BDJA 2IG7A 2W17A 2YCRA 3KK8A 4FNZA 4IX4A 4TWOA 4DEGA 5EW8A 4NL0A 1BI8A 3Q6UA 5J95A 3COIA 3I7BA 4UALA 5E1EA 1GGOA 3UVQA 5AUTA 1W98A 2R0UA 3OWJA 4QYFA 3P79A 3OOMA 4AP7A 4RC4A 4CSVA 2QG7A 3R30A 5AP1A 5L8JA 4JQ7A 2VWWA 1H01A 2R3HA 4O0WA 3GCSA 5GINE 2HK5A 1JKTA 1APME 3O96A 3OEFX 3PFQA 3R23A 3BU6A 4X3FB 4XNEA 2WEVA 4KINA 3FZPA 4MX9A 3RPRA 2IO6A 3L8PA 1ZWSA 2ZDUA 4B0GA 3FY0A 2R9SA 5E8TA 1JOWB 5EM5A 1XR1A 3JUHA 3RWPA 1J3HA 3HA8A 3FUPA 4K33A 2G2HA 3TKHA 4D4VA 2NU7B 2HJWA 3LCSA 3ZSGA 2ZV7A 2UZUE 2R3LA 4ZSGA 4BYIA 4FA2A 2VTJA 2YM8A 4L8MA 2AC5A 5J87A 3U55A 3Q9ZA 1JDBB 2X4FA 3O7LD 1KE9A 3PJ2A 4FUXA 1RDQE 4LRKA 3EN6A 5EDPA 3VIDA 4GFOA 4BCFA 4U81A 5AAGA 4HW7A 3QRJA 2GPHA 5DR6A 3KXGA 3LXNA 2E9NA 5DGZA 3GC7A 1KE7A 5CAQA 3DZOA 1YI6A 2J90A 2UZVA 1SM2A 5T6KA 1J1BA 3BE2A 5ETAA 3WOWA 4F4PA 3R8ZA 1NVSA 1S9IA 3DKFA 4U41A 4R3CA 3OUZA 4GJ2A 3ZEPA 5CU6A 3V4SA 4S32A 4U40A 2ZM3A 3FE3A 2W5AA 2WMXA 4AT3A 5LARA 5E90A 3OFMA 2YHVA 3BE9A 4IX3A 4FTLA 2QR7A 3R9OA 4IVBA 1G8SA 1V0OA 1WMKA 2QLQA 3TUDA 1LP4A 4ENYA 2C6IA 3T3UA 3NW7A 1QMZA 3VAPA 3V6SA 4FTAA 3ROCA 2XS0A 1OVEA 3HA6A 4CEGA 4O21A 3U6IA 1ZXEA 4QMUA 1XBCA 4DAWA 2JAVA 1MQBA 1U54A 4TV8F 2FPPB 1YWVA 2R3JA 2OIDA 2W96B 3W2QA 4ZSEA 4EWHA 3CIKA 3R6XA 3SX9A 3WF9A 4F09A 4DG3E 5CSXA 5J1WA 5IYZF 3ZTXA 3C4EA 5LVLA 3R7UA 4EZ7A 4QPAA 2QK4A 1F0QA 1DAYA 5EYMA 4FTIA 3KAJA 4WRSA 3ZFMA 3NIZA 3IDCA 3KRLA 2A2AA 3TV6A 4KAOA 1W8CA 3ZOSA 2OW3A 3R1QA 3UZPA 4L9IA 5IUHA 2PUNA 3VBQA 3C9WA 3QCYA 3FEGA 4TT7A 3R83A 2H34A 4QQTA 5L6WL 4YU2A 2ZB1A 5HESA 4FIGA 1S9JA 4FK3A 4AW5A 3JS2A 2XIYA 4P5QA 3VBVA 4QP6A 2PMNX 4BDCA 4C3FA 1RE8A 5HVJA 1PMEA 1ZMVA 2OICA 5A4TA 2UZLA 3CR0A 4L46A 4JQ8A 1H4LA 1MRVA 4QP2A 3PVWA 3OP5A 4R6VA 3QYWA 5A3XA 3UMWA 2X8EA 4RX5A 3FKLA 4AE6A 5HTCA 1W83A 3IOPA 3S0OA 3I5NA 3NCZA 1OI9A 2O0UA 2XA4A 1NA7A 4BB4A 4QMQA 3GC0A 3JPVA 5C03A 3A7HA 1UU8A 4TV9F 4FV4A 4PWNA 3H10A 5HD7A 5T68A 4A4XA 2KULA 2PVRA 3E87A 4O38A 4PDPA 4MA5A 4V01A 3HECA 3VF8A 4QNYA 3PXFA 1V1KA 3PA3A 4GKHA 2XK9A 5CASA 5KKRB 1JKJB 4FKUA 4JOAA 2XF0A 1WAKA 4FL2A 2R64A 2QOFA 4XMOA 5BMMA 1EUCB 1UWHA 4O7RA 3AXWA 1H1SA 4QPSA 4J53A 5IEXA 3RV4A 2CKOA 3ORMA 4L00A 5H80A 3ZLXA 2B54A 1H0WA 4U9AA 2Z8CA 3GNIB 5EQYA 4G34A 1WBSA 2J6MA 3QTWA 3L8SA 1PXMA 3CD3A 2HWOA 4HVGA 2V5AA 1W7HA 2BZKB 3VRYA 3U4WA 4CCBA 3L1SA 3OOGA 4IACA 3FXWA 4FZAB 4R5SA 2ZB0A 5HIDA 2XEYA 3LZBA 4NU1A 5HICA 2CDZA 1TQPA 4IB1A 5LVNA 3UNZA 4PTEA 4E4TA 4E8AA 1PYEA 3E7VA 3PA5A 5AP6A 3SRVB 3CTQA 4GKIA 2BIKB 4MCVA 1URWA 3ORKA 1WVWA 3BIZA 5LWMA 4BDHA 5HE2A 2OJ9A 4CT2A 2O2UA 5I9UA 1GNGA 3MSSA 5IQBA 1H07A 3UDBA 3FYJX 2AUHA 1A9UA 3DTWA 5FRIA 4AG8A 2XKDA 1GSOA 3E7OA 5DRBA 2YIXA 4K1BA 4LMNA 3K3IA 4LYNA 4RPVA 4YHJA 2W1ZA 2W6NA 2ZVAA 3MFRA 3EQCA 4RFYA 1KOAA 4CMTA 1O6LA 5BQ0A 3DLSA 3FKOA 4C36A 2R3QA 4CV9A 3HZTA 4QMPA 2I0YA 3I6UA 4AX8A 5HCXA 1GY3A 1Q5KA 3FBVA 3NW6A 2WTWA 3VUMA 4B9DA 3TZ7A 2RF9A 4DN5A 1Z2OX 4I6BA 1JLLB 1OPKA 4JI9A 3Q9YA 4QTCA 3NUUA 4RZWA 2UVXA 4JJRA 4TWCA 3NYXA 4EH3A 3GCPA 1OPJA 2IW9A 2ITWA 3DLZA 3VC4A 4KIPA 4YNOA 2OZAA 3S00A 4W8DA 5BVFA 1Q3WA 5AP3A 1ZOGA 3WI6A 2A1AB 2C3KA 3W32A 2VO7A 4XP3A 1VJYA 5H8BA 3PXYA 1LUFA 3KRWA 4O2BF 3F7WA 3VVHA 5I4NA 2VWIA 4DBNA 3GQLA 2XCLA 3O7LB 3OT8A 1OL6A 4D9UA 1I7NA 2VWYA 3IONA 5C8MA 4EQUA 5A4EA 4YZNA 4YJ2F 4BR3A 3FLZA 4BDGA 3TEIA 2PZYA 2J7TA 2F57A 3BBTB 3HAMA 4F9BA 4JVGA 4FVQA 3RM6A 3W10A 2I87A 2JD5A 4BDIA 3U9TA 2ONLC 5BVNA 1T46A 4FV8A 4RIYA 3NMUF 2XJ1A 1YKRA 4ACGA 4FT5A 5LVPA 3ZO2A 5AADA 3MYGA 4AE9A 3TZMA 4ASZA 2W6ZA 2OH0E 2RL5A 3VHEA 4ONAA 3G2FA 3KULB 3DS6A 2HW7A 3SXSA 2V58A 4YZCA 2F7ZE 4LL0A 4DHFA 5CEQA 4J1RA 4ACDA 2X4ZA 4BI1A 4AGWA 4EQCA 1U4DA 5EKOA 4ZZMA 2PHKA 3MFTA 4A9UA 1GZ8A 2BZIB 1P14A 2E9VA 3MY0A 4YZDA 5EHOA 3BYUA 4G6LA 4DYMA 3D5UA 4GVJA 3LCOA 2BDWA 4G31A 3HNGA 3DZQA 4QYHA 5EHLA 4XX9A 4EUTA 1KJJA 5JVDF 3CTHA 4FTOA 3QKMA 4DFXE 3GIDA 3OC1A 2R7BA 3NIEA 2WFYA 2F7XE 4L7FA 5CF8A 3E64A 4DEDA 4ALVA 1BLXA 4HZSA 1KE8A 4FSZA 2XIKA 4C59A 1Y8YA 2W06A 4JR7A 4OTHA 5AX9A 4L7SA 4FT9A 4OTQA 4FFLA 5BVEA 3WBLA 3TDWA 3Q3BA 2PWLA 3QUEA 5AUWA 4AA4A 2GCDA 1JNKA 4YJOA 4I50F 3WARA 5HO7A 5E8VA 4TYEA 2OIQA 2ITPA 4QP8A 4YTHA 2VN9A 2B7AA 2ZM1A 3EQRA 5H8EA 3SHEA 3OUNB 3ULIA 2VD5A 2XD4A 4MV6A 3QA8A 1WBPA 3DXQA 3LP8A 4MBIA 4ZI7F 3D7TA 2C6DA 2QO2A 4C2WA 2HZ4A 3H9FA 3KC3A 3ZU7A 4C02A 4D1SA 4RSSA 4NIFB 3ROYA 2QO9A 3NGAA 1MRYA 5FXRA 2CZGA 2PE2A 3C1XA 3HDNA 5DT0A 4DCEA 3NUAA 3WYXA 4RX8A 2R4BA 1VEBA 2WEIA 1W82A 4IWDA 4YAKB 4A7CA 4NM5A 3I0OA 1O6KA 2UZTA 4K77A 2CPKE 3HMIA 1MRUA 2GQSA 5HCYA 4GJ3A 3R7EA 2J51A 4NK9A 4V05A 2WQMA 5FP5A 2GS6A 1P5EA 5L3AA 4DFYA 4I0RA 4FKLA 3AQVA 2JC6A 1NT2A 5J2TF 3LFNA 3PP1A 3PWDA 4YJVA 3ZM4A 1CM8A 5CALA 4LOPA 5JFWA 3CP9A 3F69A 2FH9A 2BDFA 4MVFA 5DR9A 5EW9A 3NEWA 1J7UA 5AP5A 2WMRA 4QP3A 5IUIA 3ORLA 1LEZA 2JFMA 2IVVA 3DKCA 3DQWA 3QGWA 4LMUA 4LRMA 4O2PA 2IVSA 3ALOA 4FL1A 4ANLA 5L2TA 3TUBA 4FKOA 1WR2A 2X7FA 2LAVA 5LYJF 1O6YA 5KMIA 4FKIA 1YQJA 3A4OX 4CNHA 4QSHA 3ACKA 2GTMA 2Z2WA 3QD0A 4GYIA 4UX9A 1I7LA 4UV0A 2QO7A 3TNWA 3HBLA 1UNLA 3AW8A 3VA7A 5DPVA 2KTYA 2OFVA 2E9OA 2XYNA 3IW7A 3QYZA 3QTRA 1XWSA 3OXZA 4E20A 2NUAB 4TYJA 5CTPA 4HPTE 4NTSA 3CLYA 3FI4A 5H9BA 3V5PA 1CQJB 3TIZA 4WUNA 4O0VA 3O2MA 4RIXA 2EWAA 4MAOA 2QONA 3IKAA 1X8BA 3QKKA 5AUXA 2E2BA 4FV9A 4EOPA 3KK9A 3NW5A 2VTAA 3H0YA 2BALA 2P2IA 1ZRZA 4P7EA 3FLQA 5I9YA 3LXPA 4DFNA 3PY1A 3NSZA 1ZZLA 3D15A 1IR3A 4GIIA 1UNHA 2I0HA 3TACA 3JR1A 4BI0A 4R3PA 2YM5A 3WZJA 4FGRA 5EYKA 2DLNA 2VTLA 4IMYA 5C26A 4TY1A 4N6YA 2Y4PA 4MXZA 5FM3A 4C0TA 2Y0AA 3C0GA 3BZ3A 4PL4A 4DFZE 5EI8A 5IQIA 4FE2A 1JVPP 3PJ3A 4RZVA 5M09A 5M4CA 3CY3A 3OUKA 3POOA 3MVJA 5IA0A 3OBJA 2WOUA 3CSVA 3BYVA 5HKMA 5AUYA 2ITXA 1PX2A 4JDJA 2OBJA 4D4YA 5KBQA 4EH7A 2JBPA 2P55A 2B53A 5JT2A 3LJ1A 5B2KA 2R3GA 2YM7A 3PSBA 2W6OA 4IAYA 2BCJA 5M4FA 1CE8A 1PMNA 1TKIA 4IVAA 3H9RA 4S2ZA 4DGLC 2OFUA 2PUUA 2WAJA 4WKQA 2R85A 3PP0A 3WF5A 4DT8A 2ITQA 4L43A 5AM6A 3UOJA 1G5SA 3CPBA 4E73A 5CEKA 2XBAA 2X0GA 2JIIA 2YW2A 5HNGA 1AD5A 4BTJA 4N57A 2FB9A 3THBA 4EORA 5AA9A 3GLKA 3ZRMA 4QMZA 4A4OA 2VTQA 5CAUA 2PY3A 4Q5EA 3QAME 4O27B 4CFNA 3EH9A 2BFYA 2DQ7X 3MB6A 1IOVA 2YZMA 3VS3A 5BPFA 4LL5A 3HV4A 4FOBA 2UV2A 3D5XA 3FMDA 4TZRA 3H9OA 5FTOA 4B7TA 3I0QA 3P23A 5D8DA 4JG6A 1YVJA 3T9TA 4EOJA 2VGPA 3UO6A 4C5AA 3GU4A 3RAWA 2YAKA 3I12A 1C3OA 3AMBA 3C4XA 3EQGA 2FSMX 3PVBA 4WO5A 3OW3A 4EH9A 4A9RA 2PZ5A 4G3DA 3C4CA 4TKSA 5H2UA 4JG7A 3CXWA 3SD0A 3WILA 1DI8A 4L6QA 1ZAOA 3MGYA 5LMAA 3U9CA 2VU3A 4M67A 3IDPA 2VNWA 4J98A 4HNFA 1IG1A 4RQKA 5AIKA 3ZHPC 4E6DA 3AGLA 3TV4A 3W8QA 1Q61A 2YACA 5HG9A 3PLAE 2JDTA 3QXPA 5EH0A 4F9WA 2BR1A 3R71A 1UVRA 2A4LA 3W18A 4EQMA 5EYDA 4R7IA 3EL7A 2PYWA 3UO4A 3MH0A 3VBWA 4KS8A 1HOWA 4ACCA 5A46A 4O0YA 1WVXA 3BLHA 4RJ5A 4FIIA 5JVLA 1OL5A 2WTJA 3LKMA 4KBCA 2WPAA 3POZA 3UPZA 2VAGA 3LQ5A 5FNVF 1Q4LA 3WO0A 4C5BA 2X1NA 4R5YA 3F5PA 2PULA 2YCQA 4FIJA 5KMMA 3ETAA 3PSDA 4MNFA 1U59A 3FPQA 3I1AA 4WBBB 3ORQA 3O50A 1OUYA 1UKIA 2HAKA 4ALWA 3O71A 1OL7A 1AUXA 4JR3A 3WZUA 2WU7A 4AUAA 4TXCA 3QQLA 2ACXA 3BYMA 3HUCA 2WQOA 3PLSA 2A27A 3C4FA 3F61A 3NPCA 4FEQA 3TWJA 5CQUA 4I41A 4BVUA 4HZRA 5L2IA 4CLIA 3OCSA 1M6VA 1Z5MA 3ZXZA 5FBOA 3RCJA 2C6LA 1V0PA 4BTMA 3IQ7A 5E92A 3FDNA 1YW2A 3KF7A 4D4SA 1JSVA 3ERKA 5BYLA 4Q5HA 4TRLA 3IS5A 4CD0A 1NXKA 5BX0A 4EGQA 2WELA 3QWJA 2QG5A 4S30A 4L3JA 5D41A 3VRZA 4I22A 4CG8A 2X9EA 1Z2PX 4LUDA 3I4BA 2E9PA 4FZ7A 4N4SA 3P78A 3Q04A 5BUEA 4BGGA 2OIBA 3QWKA 2YIWA 3KU2A 3BGQA 3AG9A 4BCHA 2ZV9A 4FT0A 3RAIA 5G1XA 3WO1A 4MBLA 3MWDA 4C33A 3ZONA 5GJGA 5FDXA 4I5PA 3E8CA 4HNIA 4Q9SA 4XP0A 4EC8A 1IA9A 2CGUA 5DOSA 3VQUA 1TQIA 2WGJA 4C2VA 4IC8A 5C27A 1JKKA 2ETRA 2CNVA 2R3FA 2V55A 3A8XA 4PDOA 3FC1X 2EB2A 4J8NA 5DYJA 5EQEA 4BDJA 4CKRA 3C5UA 3OF0A 2BKKA 2B4SB 5L8LA 3K5IA 4AOJA 2CLXA 3U9NA 1XO2B 5HNIX 2C6EA 2I1MA 3MFSA 3CY2A 2PU8A 2XH5A 3D83A 4PF4A 3ETHA 3MWUA 4H3BA 3ZYAA 4F1TA 1XHAA 2ITVA 3MJ1A 5CB4F 1B39A 3S4QA 4R1VA 1M14A 4GFMA 3EQHA 2FSLX 3GB2A 4BY9E 4UWCA 3CJFA 3KCFA 4NZWB 4XG3A 4ZK5A 3ZLWA 3UNJA 3N4VA 5I9WA 2JDRA 3SXFA 4U45A 4JT3A 5HE0A 4FT7A 4D9TA 3GFWA 2BIYA 5J5SA 3BLQA 5IQAA 5EM7A 2BKZA 2JIVA 4BIBA 5FP6A 2WHBA 4TPTA 3V5TA 4BCOA 5HGIA 4E4MA 4HNUA 3WF6A 2BRGA 3PPKA 1P2AA 4QMWA 4O4LF 1ZY5A 3SG9A 4XV9A 3UIXA 2C5VA 4NM7A 1AQ1A 1G8AA 1I44A 2YZLA 3WZDA 5DLSA 2ERZE 4BDEA 3ODZX 3TL8A 3Q2OA 4I4FA 2W1EA 4X0MA 4BICA 3NNVA 3FLNC 4F6SA 5EYCA 3CBLA 4RRVA 2O63A 1J7IA 4LV8A 1K9AA 4YC8A 3V5JA 4APCA 3WNZA 1ZMWA 4LFIA 3CKXA 5CZIA 5DRDA 4I5HA 4QP7A 1NY3A 1OBGA 2C6KA 4GK2A 1BL6A 4GU6A 3L8XA 3SVVA 2EXMA 3WIKA 4JNWA 4KKGA 2UZEA 1YOLA 3HMOA 4FFNA 4YZMA 3VW8A 4PNIA 3BYOA 3O8TA 4EBVA 2C5OA 3DNEA 2CGXA 2WQNA 4ACHA 3ZDUA 1Q8UA 2OF2A 3LW0A 1DI9A 2WXVA 3QQHA 2JEDA 1WZYA 2YJRA 4L68A 4MQ2A 4RVKA 5H8GA 5KZIA 3HMNA 5IH5A 4X2GA 3TNIA 2VTSA 2XJ2A 3DBDA 3Q60A 4O7SA 4GG7A 2XMYA 1WBWA 3GUBA 5AP7A 5KNJA 1QL6A 2WMAA 2QOLA 3DBCA 3M1SA 5JGBA 4UEUA 2YIQA 2CCHA 3IECA 2V5QA 4IC7A 3NS9A 3ZRLA 5FEEA 1OIUA 3LJ0A 2XNPA 1PXIA 4RIWB 4JIKA 5M08A 3LQ3A 4O2ZA 2GPSA 4YTIA 1Q8ZA 3EKKA 3QFFA 4G5JA 2NP8A 2W0JA 2X39A 2C5YA 3G9NA 4EZ5A 1A9XA 4FSWA 4NM3A 3R8LA 4ME6A 4IAIA 5DA3A 5CU3A 4ZTMA 3PXRA 3ZZEA 3F9NA 4XP2A 3AD5A 3IW4A 4FR4A 4NH1A 5C8NA 4JXFA 4BC6A 4FG8A 1MQ4A 3OT3A 1ZYSA 5IF1A 3RAKA 4Z7HA 4JBPA 5LMKA 1YHSA 1V0BA 3HAVA 3QU0A 4FG7A 4FZDB 5E8SA 3R0TA 5EQPA 4FSRA 3U9SA 2X2MA 5BVOA 4H1MA 2OKRA 3B8QA 3FZOA 2ESMA 5HLWA 2X9FA 3RJCA 3TNPC 3F2RA 3PSCA 3V5WA 4J97A 5BUJA 5HTBA 3OZ6A 3HV7A 3HP2A 5ETCA 1EUDB 3DJ7A 4EOOA 4IHJF 3O0GA 5AJQA 4DEHA 5ACBC 4TN6A 4USEA 5FTQA 5M4UA 3LPBA 3TIGA 1R78A 3DXPA 3LLAA 3R22A 3CS9A 4ZTNA 4EBWA 4HNVA 4D5KA 2PMIA 4IM0A 1MUOA 2JLDA 2BRHA 3BV3A 3C13A 4MXYA 3UOKA 3RNIA 4BCGA 4NCTC 5HG8A 5DEYA 3U87A 4FT3A 5M55A 4XYLB 4A4LA 3NVMB 1SVHA 4F70A 5B2MA 2G2FA 3FLWA 4ZQIA 2OH4A 3ORNA 3OWPA 2ITNA 4FSTA 5JN2A 1OKYA 4D55A 1PHKA 2X0SA 4IWPA 3D2IA 4HGSA 1EZ1A 2FO0A 1BI7A 2CNUA 3DJ6A 3NUNA 4HGTA 4RBLA 3AX6A 3A99A 2HZNA 2VX1A 3SKCA 3DGKA 4PL5A 4GS6A 3R63A 4FV3A 3RINA 3RPOA 5C1PA 5CNOA 5DNRA 2WKMA 4XJ0A 4PNKA 2OLCA 2PVPA 4HJOA 5D11A 3LQ8A 4EUUA 4TUYF 1PXOA 4ZOGA 4E4LA 4Z55A 1KBLA 3LCKA 5JQWA 4YLKA 3NYNA 3DBEA 5TT7A 2R3KA 3FLSA 2JKMA 5HVKA 4RVLA 4LQMA 5FUTA 3F3WA 3FC2A 4PTCA 2W6MA 4IZOA 4HYUA 1VBGA 2DWBA 4OBOA 3GVUA 1FINA 3ACJA 3UIMA 2XNOA 3COHA 4R1YA 2YM4A 3RP9A 4CFWA 2NPQA 2C0TA 2CN8A 4USFA 1HCKA 2X6EA 5ICPA 5DBXA 5DFPA 5KX8A 3LMGA 4FBXA 4W8EA 1FBNA 4WG5A 4AWIA 4XX0B 5KHXA 3LJ2A 1P4OA 4EOMA 3LXKA 4P90A 2F9GA 3QD4A 4GSBA 2FB8A 3S1HA 4QP1A 3BI6A 2CSNA 3CGFA 4L3LA 3HEGA 3MY5A 4H1JA 5IG1A 5IH6A 3ODYX 4PRJA 4ALUA 1K2PA 4X7QA 3VN9A 4C4JA 1U46A 1DV2A 5AUZA 4DLIA 4RA4A 4C4FA 4AF3A 3EZVA 4OTDA 3DBFA 3VS2A 1YXUA 3K54A
chains in the Genus database with same CATH superfamily
5J9ZA 1KJQA 2OU7A 3EFKA 1YOJA 4WHZA 4ZIMA 5A4QA 3QRKA 3OG7A 4H05A 4FIEA 3R7OA 3DKGA 1B6RA 5LXTF 4PX6A 1O9UA 4FEXA 2QQ7A 2OSCA 2HW6A 2VO3A 4OTRA 3QTIA 3IO7A 4B8LA 1Z9XA 1H08A 3VBXA 4AXFA 5JQGF 1UV5A 5FR9A 1B04A 3N8DA 2W1CA 3SG8A 1TFFA 4BTFA 5BMVF 3BACA 4IHPA 5CVFA 3BWJA 3AMYA 5JFVA 1OKWA 2J0KA 2YM6A 4G3CA 5JH7F 5HX8A 2GNGA 4LOQA 3W2OA 4ASXA 4I55F 3E8DA 2YA9A 3UIBA 3UC4A 2XRUA 2O65A 2JKQA 3FLYA 3FQSA 2NYAA 3NFFB 4N0SA 4RJ7A 4U43A 5JFXA 1DGSA 4PDYA 3ORRA 2SCUB 3TKUA 3IW6A 4KRCA 4QP9A 1H8FA 4JRNA 4DLJA 4FVRA 4G6OA 2WOTA 4E4XA 4IB3A 4YJ3F 2UW7A 2HENA 2CLQA 4P2KA 1OMWA 4MXCA 3FMHA 5CU0A 3BG5A 3AC2A 3DK7A 4FTTA 4ZJIA 3EIDA 5C4KA 5CAVA 3EN9A 1R1WA 2Z7SA 3OXIA 3UC3A 3UE4A 3LFEA 4DFLA 4EC9A 5AAEA 5IA1A 4BCJA 3NAYA 5IEYA 3HBLA 4ZHQF 3AC5A 4C5CA 2C47A 3K5HA 3RPSA 4I6HA 4IJPA 3QGYA 1SYKA 1WBTA 3L2PA 5I9VA 2PVKA 1L8TA 4ZP5A 5KO1A 2QOHA 1PMVA 3AT3A 3ORTA 5BVWA 3QTXA 4DEAA 4AA0A 2VTTA 1E4EA 2PVFA 4AFEA 3QKLA 2BRNA 4NYEA 2OI4X 4PBCA 3LCDA 1SVGA 3G9LX 4XG8A 4OR5A 4BCKA 5M44A 4QRCA 5FLFA 3QD2B 5KMJA 2H96A 4UXLA 1HCLA 3FMLA 2OXDA 4BDKA 1W93A 3OMVA 3PUPA 3VUGA 3QC4A 2F2CB 5E8YA 3UVPA 1OB3A 4M12A 3P4KA 3QBNA 3DJ5A 4BF2A 2CKQA 1OECA 4I5MA 2HVRA 4D4RA 4G3GA 4L44A 3OEZA 1JLUE 2VO0A 2XCKA 3BRBA 4IFCA 4XEYA 5DH3A 4EI4A 5CF6A 2DWCA 3Q4ZA 4HVIA 1WCCA 3DAJA 4YZBA 4MNEA 4MF1A 1IASA 1KV1A 4QMXA 5A4LA 2J9GA 4OBPA 2XNNA 4QMMA 1YXSA 3CKWA 3G0EA 3UDTA 4RC2A 1PMUA 1KE5A 3QRUA 4ZS4A 1VYWA 5AUVA 4CHIA 2JITA 2QR8A 4FKJA 3PRIA 3U6HA 4FV6A 4IWQA 3IW5A 3SA0A 4YBZB 2X2LA 2J5EA 3HUBA 1ZOHA 3QZHA 4IM3A 1ZYJA 5D9HA 3R9DA 3U54A 3RFCA 3EQIA 2VTOA 5E8ZA 3ZUUA 5I0BA 2HVQA 1XH7A 3RPYA 2P0AA 5CE8A 2NNWB 5EI6A 3COMA 4C35A 4CKIA 4DDGA 4QMLA 1KJ8A 3NNUA 5M56A 2YZAA 2FVDA 4G3FA 2Y9QA 3K5VA 4C34A 2R3MA 1Q99A 4FV5A 1YDSE 3MWEA 4F0FA 1JPAA 2NU6B 3R7VA 3PIZA 2XVDA 2GNFA 4RWKA 4AT4A 3KFAA 4FKVA 2BMCA 2W1DA 5CEPA 4EK5A 2V0DA 3QL8A 3RAHA 3DBQA 2Z02A 5EM8A 3SW4A 4CFXA 5IMEA 3JZFA 4U6RA 2VWUA 3GQIA 4PUZA 4K18A 4YTFA 3BHUA 5L6PA 3MIYA 3VUDA 3V5QA 3P5JC 2C5NA 4FFPA 4AXDA 1IYDA 5CLPA 5KMLA 1F5QA 5J9YA 4IX5A 2HHFB 4BCPA 4ZLZA 3TQTA 1OIQA 3EZRA 3VPDA 3E5AA 3FI2A 3UYTA 3DK6A 1VKZA 4MTAA 2XKCA 4FV0A 4OT6A 1OM1A 4DITA 2R7LA 5D12A 2OLSA 1ZYDA 4HCTA 4I5CA 4E7WA 3PIYA 4YLJA 1TA8A 2XNBA 3R5HA 1GIIA 3SXRA 2OK1A 4KSPA 2XIRA 5IA3A 4H39A 1RJBA 3OW4A 4C4IA 4JG8A 5IQDA 3DF7A 1U54B 2V62A 1L3RE 3E88A 5D1OB 2C69A 2XNGA 1FGKA 4JX7A 1IOWA 1M17A 3G51A 4CE5A 3P7AA 2BTSA 3F88A 4YPSA 4ZLYA 4WG3A 2ZDQA 4IWYA 4F1OA 4GU9A 2OXYA 3F3ZA 4GEOA 4LI5A 4F9CA 4XS2A 1Q24A 4NJDA 4I4EA 3EMGA 5DGIA 3QLGA 1OKZA 3G0FA 3D5WA 4D0WA 2VTNA 1Q8WA 2R3IA 2F49A 3K3JA 1JSUA 3WF7A 4KB8A 1VBHA 2Q0BA 2GHMA 3BBWA 3E3BX 3ET7A 4CZTA 4TYHA 3NX8A 2H8HA 5BWUA 4AZSA 4GIHA 2J0IA 3E3PA 3KXXA 5ANIA 3I79A 2Z7QA 4FV1A 4EZ3A 2JDVA 3A7IA 4MH7A 5F9EA 5BWXA 4JDHA 2Y6OA 5TR6A 4AACA 4QQJA 3GI3A 3OXTA 1CDKA 2XZSA 4TNDA 4MV4A 1A48A 4I93A 4J8MA 5EOLA 4ZEGA 3RI1A 3QCQA 1GIHA 1ND4A 4JX3A 4FSNA 5K5XA 3DT1A 3LQSA 4CG9A 4TWNA 3EL8A 4KS7A 3Q9XA 3RPVA 3BL7A 4BDAA 4O7ZA 3D0EA 3DAAA 2GLTA 3TZ8A 2XKFA 3AKLA 4YJPA 4Y83A 4NT4A 2ZDHA 3H30A 4O22A 2O8YA 4ACMA 2BROA 3E93A 5M53A 4UBAA 4EHGA 3F7ZA 3QTUA 4FTNA 4GUBA 2CCIA 3P7BA 2W5BA 5AX3A 3BELA 5FEDA 5DISC 1PRYA 3ZC6A 2Z7LA 3TXOA 3ZCLA 2HZIA 5F94A 4EH2A 3KMMA 4ZAUA 1JSTA 3WIGA 4MD8E 4E6AA 3KEXA 4XV1A 5HIBA 3U6JA 4RZQA 3BV2A 3W16A 2PZPA 2FA2A 2GDOA 4FKQA 3TT0A 2CGWA 3GB8B 3NBYB 3M11A 4I6FA 5K3WA 5F4NA 3LM0A 4BHZA 3WYYA 2DZDA 3R02A 3Q5ZA 1PXJA 5CF5A 4FGBA 2W05A 2YJSA 4ZZNA 3R8UA 2EU9A 4XCUA 3COKA 2C68A 2J5FA 2R7IA 4G1WA 4IB0A 4UZHA 3KYHC 3LIJA 4NFNA 3OY1A 2WTDA 3TW6A 3RGFA 4B8MA 3SOAA 1Y57A 3E62A 3DK3A 3M2WA 3VW6A 4MKCA 1ULZA 4EOLA 3AC4A 3D7ZA 1GZOA 2ETKA 2UW4A 4FSMA 4RC3A 3PXKA 4O81A 1YDTE 4NFMA 3AKJA 3KY2A 4MV1A 3SE7A 3DAEA 3FZTA 3ZRKA 5H3QA 4FKGA 3WWHA 3EFLA 3V5LA 4IIRA 3TJDA 4PP9A 2YABA 3UQ8A 4EOIA 4RA5A 2P0CA 4G17A 5ANOA 4QYYA 3MTLA 3BQRA 3IGOA 3TCPA 4C4HA 3WWJA 4K9YA 4IZ5A 2W9FB 1GAGA 2C30A 1R3CA 3H4JA 3HRFA 3MVMA 3LAUA 4G2FA 4B6LA 1DM2A 2BAQA 3FMNA 5IQEA 5IQFA 2B1PA 1Y8GA 4WUAA 4QP4A 5BWTA 4HGEA 3GU8A 3TY9A 1REKA 5JH6A 2HY0A 4M15A 3B2TA 4X2NA 3RR5A 2XCHA 2YWVA 1AUVA 4BDBA 2OF4A 2JBOA 1PK8A 2W71A 2ZOQA 4I24A 4F99A 3RUPA 2XKEA 4S31A 3MN3A 3Q96A 1OKVA 2WU6A 3C4WA 5JZJA 5HCZA 2GU8A 3UTOA 5JGAA 4NW5A 5LCJA 2V59A 4LH6A 5LMBA 3DY7A 2CMWA 2VGOA 5HV6A 2R7NA 3RTPA 4CFMA 2QLUA 3MPTA 3EJ1A 3PJCA 4PTGA 1FMOE 2ITYA 3H3CA 3OCBA 3OVVA 4U3ZA 5CEIA 3BPRA 4MV3A 4WHXA 4G9CA 1KJ9A 5BVKA 3UP2A 5CVHA 3GCUA 4YPDA 3T3VA 3A7JA 5EFQA 5HU3A 2X81A 4QEBA 4CKJA 4B99A 2CGVA 2O5KA 4WA9A 1XH8A 5HHWA 3ZBFA 2QI8A 5F95A 2X7GA 2ZV2A 3UODA 4F9YA 4DEBA 2Q0NA 4ZMFA 2VR1A 3CSWA 3D5VA 3W0MA 3KXHA 3P1AA 3TN8A 5JRQA 3LOKA 4FOCA 2PVMA 3SC1A 2QVSE 5J1VA 3F5UA 3GC9A 2A0CX 3ETJA 4BGHA 3Q52A 3UZOA 4X2JA 4RIYB 3BA8A 1CKPA 4FK6A 2YS7A 5IQCA 1H1WA 3KGAA 2GSFA 4FKSA 4FNXA 2HWPA 4IM2A 1Q8TA 3JY0A 3SLSA 3VBYA 4GK3A 1E9HA 2OGVA 3O17A 4C4EA 4EHZA 4EONA 4CVAA 5FXQA 5AV1A 3OD6X 2ODTX 5BPHA 1XH6A 4O83A 4GCJA 4OT5A 1REJA 4O4JF 1UU7A 1BYGA 1MP8A 3V4ZA 3AMAA 3Q9WA 3BLRA 4MQ1A 2UW5A 3MTFA 3BGPA 3O51A 3EN7A 3FY2A 2JDSA 3RK7A 2WD1A 3ZUVA 3AT2A 5HZNA 4M69B 5CSWA 3AC3A 5I5ZA 5ANGA 3RCDA 4L67A 2G2IA 3NUYA 3R9HA 5ANEA 3DOGA 3C5IA 3FHIA 3IGGA 4OGRA 5IQGA 4AS0A 3TIIA 2X8IA 4J99A 3D4QA 2R86A 3MY1A 4O7LA 4JBQA 2ZMCA 3IG7A 4QQ5A 4YJRA 2WQBA 4RFZA 2GTNA 4RX7A 3FSFA 1M0TA 3C7QA 3HV3A 3O5AA 4L53A 5HIEA 3IOKA 4I21A 3QX4A 3MPAA 3JRXA 2RFNA 4FFMA 1ZMUA 2Z60A 4F08A 4TL0A 3G8DA 4EYMA 1CKJA 5D7AA 4YMJA 1Y6AA 4RG0A 4CV8A 1H28A 3JSNA 2C6MA 1PJKA 4CC5A 1JWHA 2F2UA 2PE1A 3VQHA 4A9TA 4F63A 3W55A 1PYXA 2BFXA 4O86A 5TO8A 3TUCA 4YJTA 3UQCA 2PZRA 4GL9A 4OLIA 4CTBA 2AYPA 2XALA 4GFGA 2O64A 2HGSA 5HI2A 2QOIA 4YTCA 1F3MC 4A07A 3S24A 2QC6A 5LWNA 4AXAA 3K5UA 4IAKA 4ERKA 4EFBA 4HVDA 2BUJA 4AFJA 4IEBA 1FGIA 4UZDA 4BN1A 4ASDA 1XH9A 3OWLA 5CY3A 5M06A 5K4IA 3TJCA 1FVRA 3LFAA 3V51A 1VYZA 4EJNA 4PP7A 4U42A 4MA0A 5M4IA 4QMYA 4XLIA 4AN9A 4PDSA 1PF8A 4DE4A 4DIMA 3FYKX 2BRBA 3TMOA 4DGNA 4F7LA 2COJA 1BNCA 5GIPE 3R1SA 4XG7A 4XUFA 4GH2A 5EDQA 3W2RA 5B7VA 1IYEA 4ZMEA 4FSUA 3ANQA 3ENHA 4GT4A 2YL2A 3UZBA 3LXLA 1Q8YA 3QF9A 2YWPA 4MWIA 4PY1A 4FODA 3G90X 3W8LA 4DT9A 4EHEA 4RQVA 4U8ZA 3FWQA 2IWIA 4WNOA 4TWPA 2W99B 5FEQA 5AMNA 2J0MB 3QTSA 3KRJA 4PV0A 3UPXA 5IDNA 5KBRA 2J9MA 4ITJA 4LV7A 4V0GB 2YM3A 4NTTA 5DT4A 2HYYA 3KKVA 3ORPA 3PZHA 5LP6F 5HVYA 5AM7A 4EKLA 5EZYF 4J7BA 4UYAA 4MUQA 1UA2A 4G9RA 4CT1A 4DGMA 3WE8A 2OWOA 3NBZB 4FNWA 1UU9A 1U5RA 3T8OA 1C30A 4F7NA 1UNGA 3KIOC 5DN3A 4FEVA 3DFCB 5JMSA 2B52A 2GFSA 3Q32A 4CFUA 1J91A 2W5HA 2C00A 4J95A 3MW1A 4TYIA 3R9RA 5IPJA 1KC7A 5HQ0A 5DWRA 4MV7A 4NWMA 3FZSA 1WRVA 4X21A 3RK9A 1Z57A 1T45A 3FMJA 3PRFA 4X3FA 4MHAA 1CKOA 2I80A 1NW1A 4FTQA 1XDNA 2C0IA 3CPCA 2XM8A 2R3OA 3DKOA 3KQ7A 3MVLA 4K6ZA 4KABA 5GJDA 3UYSA 3V01A 2XYUA 5LOHA 4HQ6A 3VOTA 4XBUA 2WMVA 2CKEA 5DI1A 4IX6A 3UIUA 2P4IA 2BTRA 3S2PA 5K5NA 1M7QA 2GNIA 3C0IA 3ALNA 5I9XA 1S68A 4BI2A 3UFXB 1AGWA 4LOOA 1T36A 4I6LA 5CT0A 5AV4A 4O4HF 2VZ6A 2PVHA 4HVSA 3NWWA 1WVYA 4M14A 4QMNA 4FV2A 4BIDA 1QCFA 2X7OA 4NW6A 3DA6A 3KMUA 3GT8A 2C5XA 2C6OA 2OO8X 4C37A 3LHJA 3VS0A 3RV3A 4YO4A 4KIQA 5C01A 5HLNA 3KMWA 2UUEA 4YSMA 1Z2NX 5AEPA 4EOKA 3P5KA 5HX6A 2XARA 4HGLA 4XRJA 3CC6A 5IQHA 4LV5A 4RJ6A 5KMNA 5M57A 3KALA 3T9AA 4IFGA 4NJ3A 3AT4A 5E8UA 2XBJA 3QQKA 3REPA 3HMMA 4O6LA 4Y73A 2DIKA 2W9ZB 1R0PA 5FD2A 4L01A 4ZOLF 4RJ3A 3KVXA 3HYHA 5JK3A 5LCKA 1I09A 3VBTA 3VS5A 4QMSA 2F7EE 5K4JA 3PXZA 2OJGA 4FTCA 4YP8A 2WMWA 4XV2A 5DHJA 3GU7A 3A2CA 4AA5A 4RWLA 4YGAA 4W4XA 1KEEA 2BVAA 3UVRA 3U8WA 2J50A 4YBKA 3PPJA 5JRSA 4CRLA 4O2AF 1OZ1A 3S3IA 2XUUA 3ZSIA 5HO8A 3MPMA 4M9UA 3R04A 1YXVA 2WIPA 3PIXA 3V8SA 2V7AA 4OTWA 2O3PA 3W2CA 4G3EA 3HGKA 4O7TA 4MV9A 4E93A 5E25A 4S34A 5I5SA 1TQMA 4XG2A 1H00A 3W2SA 2R0IA 3JY9A 3NRMA 4BHNA 3QALE 4HR7A 5C8YF 3EYHA 3O23A 1DV1A 4FEUA 5AAFA 1LEWA 3CQWA 3WZEA 4E5AX 2XIZA 2B9FA 2QU6A 2XK8A 3CQEA 3EQBA 4FYOA 4XOZA 4OUCA 5CU2A 4BCIA 2DUVA 2DYLA 2HXLA 2XK4A 5C8KA 3F3UA 4GYGA 4UCUA 4QMOA 4RJ4A 4FKTA 3GCVA 2WO6A 3JZ6A 4XRLA 1EYZA 3UMXA 1CS0A 5CI7A 4XV3A 3FMEA 3RHXA 3QZIA 1QPDA 2I8CA 3DU8A 5IISA 3R5FA 5ETFA 5CEMA 3E92A 3MA6A 4FI1A 4XBRA 2PN1A 2QKRA 2ITOA 4D2RA 4Y8VB 4ENXA 5AA8A 1J1CA 2VWBA 4FIHA 4X2FA 5HLPA 4YB8B 1NVQA 4AZEA 2PL0A 1CMKE 2B9JA 3W1BA 2Y7JA 4L1KA 3W0SA 4Q4DA 4UXQA 3I7CA 4QTAA 4ANMA 2R7KA 3P7CA 3ZLSA 3EHAA 1LR4A 4WNMA 4AQKA 2C3JA 3OY3A 1A06A 3B8RA 3D9VA 5A9UA 3H0ZA 5BNJA 4IAZA 2JAMA 3NCGA 3KCKA 1IRKA 3AOXA 5KZ0A 3VHKA 5LMKC 3FXZA 3BYSA 4BBEA 3PUFC 3NZ0A 4YJUA 4AZTA 5A14A 3FZ1A 3QHWA 4JAIA 2ETMA 4FTKA 1OGYA 1ZYCA 3TYKA 3TZ9A 3UZRA 2WMUA 4AGCA 2VO6A 3BCEA 1FQ1B 2IVUA 3SRVA 3GJXB 5HBEA 4O91A 1GLVA 5GJFA 1SNUA 4IAAA 2CNQA 2UW8A 1SNXA 4WNKA 2PMOX 3KA0A 3LLTA 5EM6A 3JYAA 1A0IA 2XB7A 2YCSA 3LMIA 3PFYA 4M0YA 4EEVA 2X2KA 2I6LA 3V3VA 4ASEA 3L9PA 5J9LA 2HXQA 2Y8OA 2ABJA 4IZYA 2RFEA 5D1JA 2PUPA 4ZY6A 5HNBA 3TTJA 3F2AA 2R3PA 2WTIA 4USDA 2W4JA 4E6QA 4ZJJA 4AN2A 4UWBA 2FSOX 2XRWA 4DG2E 4IVCA 3L9NA 4G6NA 4I6QA 2W6PA 2J2IB 3PG3A 4N70A 2QD9A 3VS4A 3SW7A 4ITIA 1FMKA 1EH4A 2PK9A 5CEOA 4ZJVA 4NCTA 1I1KA 2YN8A 2UVZA 3K2LA 2ZGIA 1XK5A 5D10A 2I40A 4DGOA 5FXSA 4ZY5A 3Q2JA 2FUMA 3OTUA 4BZOA 4QQCA 2JDOA 2C4GA 1I2KA 1GOLA 5KMOA 5M07A 1JAMA 3M42A 4FSQA 3R8MA 4PL3A 2P33A 1TVOA 4MBJA 2R3RA 1R0EA 1XKKA 4IB5A 5JQ5A 3ZXTA 4KKHA 3GOPA 4JDKA 4C4GA 5GNKA 4ZXTA 1QPJA 3PJ8A 3R2YA 4FKRA 4D1XA 4FU0A 4H3PA 4DTBA 2HVSA 4AXCA 3MH1A 3FMKA 4TYGA 2HELA 2VNYA 4GRBA 4DH8A 2PUIA 4UN0C 3BHTA 5AIRA 2IVTA 4M0ZA 4ZTLA 3ZLYA 2YFXA 4RMZA 3VUIA 2Q83A 1CKIA 4XYFA 3MS9A 1YI3A 4WG4A 1JKLA 2YIYA 4MAMA 1M7NA 5K9IA 3NUXA 4K2RA 1YRPA 1GZKA 3CCNA 4OW8A 4KBKA 4BCQA 2HGWA 4FYNA 4E1ZA 4YHTA 5AP2A 5HE1A 2HHFA 2EXCX 2J4ZA 4UYNA 5EKNA 1FVTA 4LG4A 3PA4A 2FGIA 1G8KA 2VWXA 4I23A 4Y95A 4IVDA 4JQEA 3KULA 3UBDA 4CFVA 5BUIA 3WWIA 1E1XA 4LDTA 2DS1A 3R8PA 3SGCA 4NKAA 4FX3A 3TINA 3F5XA 4WD5A 2UZWE 2JIUA 3EN5A 2FPGB 3VPBA 3V8WA 4PZ6A 3N4TA 1H0VA 4QDVA 1ATPE 5E4HA 3UQFA 5D1OA 1YOMA 4FKPA 3EB0A 4Z7GA 1H1RA 4I92A 2QU5A 4JRVA 3GBZA 2VRXA 2B9HA 4LGHA 3QQJA 5KMKA 5LQFA 1R39A 4YJNA 5CZHA 3EQFA 4I1ZA 3DXNA 4YO6A 4IWXA 2BPMA 5IH4A 5KUPA 4EQ5A 4F65A 1QPCA 3MVHA 4ANSA 4YR8A 4HYHA 2ZDTA 2WZJA 1VLRA 4QYGA 2ITUA 2R2PA 1SMHA 3FI3A 1W96A 1G3NA 4M3QA 4U44A 5EHYA 2C3IB 3DTFA 3QC9A 4AGUA 5DEWA 3Q1KA 3PWYA 3KRRA 3U51A 3JXWA 2UZBA 3CE3A 2ZYBA 3O8UA 3QZGA 4MWHA 3DPKA 4DA5A 4EJ7A 1Q3DA 4C62A 4IH8A 1ERKA 4D2SA 4L42A 3I6WA 4V04A 3N9XA 4M8TA 5A54A 3R7YA 3VWAA 4EGJA 2HIWA 4J71A 4RGJA 5ANKA 4BGQA 3GOKA 5CAOA 2C1BA 2YIRA 5D7VA 1PXLA 3R1YA 3TM0A 4AZFA 5BYYA 4DAAA 3E8NA 5AV2A 2WNTA 3VMMA 4RVMA 4O0TA 4F1MA 3LFDA 3ORXA 1XBAA 4FC0A 2PVYA 4ZY4A 5K3YA 3R28A 3HV5A 3C51A 4ANQA 4WNPA 4WSYA 4G16A 1OGUA 3QD3A 1GSHA 2UW9A 2JKKA 2A19B 2QKWB 3LMHA 3G8CA 1RQQA 3JSLA 3FL5A 3DQXA 4FMQA 4O0XA 5LJJA 1OUKA 4K8AA 1GSAA 3RVGA 1KSWA 2RIOA 4IIJF 2BZJA 2IZTA 4M84A 2GS2A 3MH2A 2QURA 3FQEA 4FSYA 3UG2A 4CFFA 4NSTA 1KT8A 2VUGA 4FTRA 1ZARA 3FZRA 4TW9A 3LFCA 3KB7A 5CANA 5J2UF 4CMFA 4MEDA 4MD9E 3ATSA 5L6OA 1YI4A 3BEAA 3OHTA 5K2MA 2ZJWA 4U0IA 2JGZA 1X9NA 4DBXA 3FPMA 4XLVA 2H9VA 4AAAA 4O82A 3LFFA 5M51A 2YISA 4OBQA 4WT6A 4IANA 4BTKA 5KE0A 5IUGA 3II5A 5BV3A 3U4UA 3ZUTA 5AUUA 3QRIA 3ZM9A 3SDJA 2FP4B 2OWBA 3FJQE 3SV0A 1SVEA 4L45A 3UNKA 2R7MA 5LOVF 2I0EA 4GMYA 4MXXA 1H1QA 2BAKA 3AD4A 2IZSA 5BYBA 4YZ9A 1CKMA 4Z3VA 4XYMB 4ZTRA 3PY0A 3R5XA 4ZTQA 2ZDGA 3R2BA 5LXMA 3UZTA 2EJ0A 4QTBA 3UG1A 3MIAA 4DH5A 4XHKB 3QUPA 5CXZA 5FDPA 2RG5A 3VS1A 3D2KA 3EFWA 3IW8A 4KIOA 4UY9A 3PZEA 3V04A 4DC2A 5KX5F 3O8PA 2GHGA 2RKUA 3PE2A 4XG4A 5I9ZA 1UC9A 4IDTA 1OITA 2VX0A 2UW3A 3IPHA 5KS8A 2C6TA 4FTUA 4EK6A 4NKSA 2R82A 2G9XA 3CGOA 3C50A 5KCVA 4F7JA 2XNEA 3P86A 4EHVA 4F0GA 3ZC5A 2GNJA 3PVGA 4JBVA 2GQRA 2NRYA 3UYYA 4DINA 5HEZA 4DDIA 3MB7A 4F7SA 3AC8A 3NLBA 3VUKA 5CM0A 3ZMMA 4Y5HA 3AD6A 4O7WA 4D28A 2PTKA 4FICA 4E26A 2ONLA 2UW6A 4LGGA 4NUSA 3GXLA 3ZO1A 3NC0B 1OIYA 3I5ZA 2W4KA 4LUEA 3EYGA 4P5ZA 4B4LA 4JL9A 2VWVA 4QTEA 3A7GA 5BWVA 3DFAA 5HD4A 3R21A 4RJ8A 5F20A 4XH6A 4FTMA 3DDPA 1UKHA 3FXXA 3KXNA 4D58A 3WZKA 4DEIA 4HVHA 3L9LA 3GDEA 4NZMA 3RWQA 5C1OA 3HVCA 3BA9A 3BX5A 1Q41A 2ZMDA 3E63A 3FAAA 3LFSA 4Y5QA 3A60A 2IP4A 3PXQA 4NZOA 4Z9LA 2UW0A 3G5DA 1M52A 4CMDA 4M97A 3KRXA 4QT1A 1PW2A 2Y6MA 3Q53A 5TKDA 5EI2A 3RZBA 3W0OA 1P8LA 2W1HA 4JMQA 2F4JA 3FV8A 2UZDA 1BX6A 5ETIA 3VO3A