2YZLA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
239
structure length
238
Chain Sequence
KLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 77
structure length 238
sequence length 239
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yzlA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzlA02
1QPDA 4DEGA 3E7OA 4LOPA 3R9NA 3PE1A 2ZV9A 3IW6A 2GNFA 3WZUA 3RGFA 5L2SA 5BUIA 3KN5A 4C5CA 4AOJA 4BGQA 4EHZA 5DFPA 4QSHA 4FKGA 2C3IB 4C3PA 3HV7A 4L45A 4C34A 3W1FA 4LL0A 4FEVA 1XR1A 2ACXA 4ZY6A 1YHSA 3IDPA 3VC4A 4CGAA 5TKDA 3GCUA 4BRXA 4A07A 3AT3A 5AAEA 1ZMVA 3O50A 2VTSA 5AA9A 5C1PA 4IZYA 2XNMA 4K77A 3R71A 3PJ3A 4G17A 5HO8A 3VUIA 4IAIA 4QP7A 4C61A 4RLKA 1DM2A 1G3NA 3PXYA 4EHVA 1OKZA 1KE5A 2UW6A 4YR8A 3V8WA 3CGOA 2XNBA 3FL5A 1Y57A 4GG5A 4RSSA 3L8PA 3NVKI 2J0LA 5M56A 2C6KA 3SW4A 4MXOA 3MVJA 4AP7A 2YEXA 5KO1A 5EG3A 3WO1A 4ZTQA 3DK3A 5EOLA 2IW9A 4G9CA 3THBA 2X0GA 4DH7A 5FBOA 5CXZA 2W6NA 3BYMA 3C13A 3DBDA 2PU8A 2C30A 3NDMA 3OTVA 4BI0A 1LEZA 1NY3A 4FV7A 2W9FB 4ONAA 1TQMA 1U54A 2OXXA 4LUEA 2WTWA 5LCKA 5IF1A 3V4ZA 2IJMA 3B8RA 4YURA 2WTJA 3FHRA 3TKUA 2B55A 3UBDA 3E8CA 4FL2A 3MB6A 1UU7A 5CXHA 1Y6AA 2R3PA 3AOXA 1H27A 1H25A 1NT2A 3DBFA 3Q2JA 1Z5MA 4F0IA 3BU6A 3NUXA 4ZTNA 4BCQA 4PMTA 4E4MA 2ONLC 3P08A 3RKBA 3H0ZA 4O4JF 2BAQA 4K18A 5FXQA 2W96B 4DG3E 3AMYA 4ACGA 3POZA 3KXNA 3U9CA 3RFCA 4M3QA 2UZEA 4R1YA 3NNWA 2VWIA 3KEXA 3OMVA 3QZHA 3RK5A 1J7LA 3DBCA 4OBOA 3RAKA 1WCCA 1OITA 4FSTA 3OUUA 2W5AA 5DHJA 3EQBA 4B4LA 4HQ6A 1PMNA 4GU6A 2C6LA 3BELA 3I7BA 3LWBA 1IR3A 3SA0A 5IH4A 3LXLA 3PG3A 5HU3A 3A62A 3KN6A 3MFUA 2ITYA 1WVYA 1ZXEA 4QP8A 3EB0A 1CKJA 5E8ZA 3R2BA 3PE2A 3CP9A 5HVKA 3FLSA 2FP4B 3QGYA 1JQHA 1W98A 1H0WA 2FSLX 3FSFA 3MB7A 4TXCA 5FEDA 3DKGA 4BCPA 4YTCA 2C00A 3AW8A 3RPRA 3GCPA 3AMAA 3GCVA 3OS3A 3EL7A 4FG7A 2GHLA 1V0OA 4EEVA 3MA3A 3PVWA 2B9JA 4QMWA 4YTHA 3S00A 3K3PA 3EN5A 4B8MA 4DEHA 1NXKA 3RWQA 5LVLA 4MV3A 1O6YA 2BPMA 4X2FA 4G5JA 1M14A 4NT4A 4E8AA 2WTVA 3BQCA 1YQJA 3PJ8A 5AV4A 4BDGA 5EI6A 4Z7GA 5EKNA 4IZOA 1PYEA 4EH8A 4DEEA 4L3JA 2VWBA 5AUUA 2FPGB 1E1VA 3LMGA 2W6MA 4E5WA 4HYIA 1M52A 2Y6OA 3PY3A 2O64A 5I4NA 3ZEPA 3QQGA 5DT3A 3D9VA 5EM8A 3W18A 2ITPA 3IGOA 3ZXZA 1E9HA 4F63A 2YIWA 4GFGA 3F5XA 2UZOA 3NZ0A 4I92A 5H2UA 3ODYX 3GQIA 2CNUA 1BXRA 2VX0A 5E4HA 4HOKA 3W2CA 4BI2A 2ITXA 1ZYDA 1F5QA 3QD4A 4PTGA 2PL0A 2J50A 1SVHA 2WB8A 2XM8A 4IE9A 4J53A 4EOQA 5JQWA 4OTDA 3WBLA 2GHMA 4KRCA 2FSOX 4H3BA 3RCDA 3R8ZA 3EQRA 2OH0E 2BR1A 3LFEA 4JG7A 2RGPA 3HA8A 4WSYA 5AAFA 5TF9A 3OBJA 4MYGA 3LPBA 1IOVA 5EFQA 4I5PA 3IDBA 5FQDC 4DEIA 4AW1A 3QA8A 2HZNA 5A4LA 3L9LA 2ZDQA 4FFNA 4Y5QA 5DBXA 4WNKA 4EH2A 1PMVA 2J5FA 4B99A 5JQ5A 4ZY4A 3VS0A 4O6EA 3QHWA 4O83A 4UWCA 5IUIA 4YLLA 4F7JA 5LXMA 4AZEA 4HW7A 5EW9A 2E9UA 2QR8A 2JKKA 3U6HA 4EONA 4QP6A 4OW8A 1OB3A 3IOPA 4B0GA 4DFBA 4EOSA 1CQIB 3U4UA 2IWIA 4AN9A 2CHLA 2CPKE 3A7JA 4HGEA 3OWJA 3UNJA 1Y91A 4FKTA 4MD9E 4MVFA 3RNIA 2BHEA 4E4NA 3GEQA 3EFKA 3GU4A 3Q6UA 3RV4A 5JK3A 2CKOA 2OLCA 4C62A 3LP8A 4WBNF 3UC4A 3V5TA 1Z2OX 1W96A 2OWBA 5DNRA 3ZRMA 2VWXA 2YHVA 1F0QA 1JLLB 2X7OA 2H8HA 4DG0E 4EJ7A 2C4GA 5DE2A 4QYEA 1UKHA 3VHKA 3NW5A 3KRJA 2XK4A 4EOMA 3LFSA 2CLQA 2A0CX 2VN9A 4BCFA 3HECA 4WT6A 5CI6A 4CLJA 2PULA 1PXOA 2YWVA 5KMNA 3F3VA 4G16A 3BE9A 4CT2A 4FNYA 4JAIA 1WBWA 2RG5A 3GC0A 4EHGA 2OSCA 4YJPA 4D4VA 4JDJA 4UYAA 3ZS5A 3ODZX 4FTJA 2Z7RA 3LAUA 1JBPE 4B9DA 4DLIA 4GU9A 2CGVA 2X4FA 5ANGA 4FMQA 4FTIA 2O2UA 3UTOA 3A4PA 3MJFA 1PRYA 3D83A 4KD1A 5LXTF 3F5GA 4FZ6A 5EH0A 4FIFA 4FTAA 1O9UA 4LGGA 1W84A 3H30A 4I24A 4EH6A 4DFNA 4AU8A 3I4BA 1M2PA 1YHWA 1W82A 3OOMA 3FMEA 2QNJA 3LFNA 4YZDA 5L8JA 4AFJA 3A4OX 4MQ2A 5FEEA 1XH5A 4BYIA 4MBLA 2CGWA 2XNNA 3ORPA 3OWLA 3HDMA 1RQQA 1XJDA 4I6BA 1DV2A 1PY5A 4QQ5A 4H39A 4AGWA 2Z2WA 3KMUA 4RJ6A 4XX9A 5FXRA 3DXNA 2P0AA 5IU2A 1OBGA 5I9ZA 3ETJA 3TDVA 4C5AA 3D7TA 4WBBB 1ZYSA 5CU0A 2QHMA 3DLSA 3JR1A 4EQMA 3KAKA 1HCKA 2W17A 5IQFA 5AUTA 4NM7A 1WVWA 2ETKA 1OIQA 3RWPA 5M55A 3VUKA 4ZS0A 4RX5A 2A4LA 2V5QA 2UVXA 5AP0A 4MF1A 2I1MA 3TWJA 4F9BA 3W2PA 1O6LA 2XK9A 3FYKX 5HV6A 3FDNA 2F9GA 1EUCB 2QURA 4FKVA 4IHPA 1W0XC 4PMMA 2YIYA 3V04A 4AZVA 4DFUA 4O96A 1MUOA 3UZPA 1L8TA 5GNKA 2VNWA 3QQKA 3TTIA 3BLHA 2UZBA 4IWDA 4N57A 3G9NA 5TR6A 3I81A 1ULZA 5CF8A 3SE7A 3HP5A 3V5PA 2BDWA 3GNIB 3U6IA 4D28A 4UWYA 3NEWA 4XEYA 5DA3A 3PIYA 3LFCA 4KBKA 5BYLA 3VQHA 2FA2A 2ETMA 4FEUA 2UV2A 4X3FB 4IAZA 4YC6A 4D4SA 2VO3A 1Q8YA 1HCLA 1OGUA 2C3KA 2PWLA 1A48A 4F4PA 1VBGA 3P0MA 4Q5HA 2C5OA 2V7AA 2WQNA 3BQRA 1KJQA 3DJ5A 5F95A 4FNZA 2FSTX 3KK8A 4GK3A 4ZOGA 3SG8A 4ASXA 1JSUA 3O8TA 3SOAA 5JH6A 3KF7A 5EM6A 5I9YA 4PP7A 2WTKB 5HHWA 2PVRA 4YHFA 4S32A 3MJ1A 4XUFA 3E93A 2WQEA 4RIOA 4MHAA 4BIEA 5CEIA 2CGUA 4YAJB 3R02A 3W10A 2V0DA 3E92A 3QQHA 2PUNA 2PVYA 3UPZA 3NMUF 4GFMA 4P5ZA 5FTGA 2YN8A 3NYNA 4O7ZA 1FPUA 2WQOA 3L9MA 2DS1A 3EJ1A 4J71A 1URCA 3PIXA 3TI1A 4IIJF 1Q8WA 1GLVA 3VUMA 4L8MA 5HE3A 5EQYA 3L8SA 4G9RA 2VO7A 4EC9A 3NAXA 1JWHA 2WMSA 3Q6WA 4PY1A 4U6RA 3V01A 5CENA 4YZBA 2WU7A 3BU3A 4MTAA 3O2MA 2ITWA 2C0TA 4X2JA 5ANJA 4AN2A 4FSYA 4O0XA 1AUXA 2PZIA 3FC2A 2HW7A 4FIHA 5CVGA 4WA9A 3TIZA 4EK6A 5BYYA 2VWZA 4RFZA 4UXLA 4I6FA 2XNGA 4NCTC 3WYXA 5E92A 2ZOQA 4HPTE 2X8DA 3H3CA 4FU0A 5AX3A 4DT8A 2YS7A 3FZRA 5IUGA 4CFVA 4KKHA 3OY3A 5AV2A 4TWPA 4FSMA 4J98A 2WOUA 3C51A 1ZRZA 3P5KA 4MV4A 4DIMA 1CTPE 2QONA 3N8DA 5ANOA 5HX6A 4FVPA 4IBMA 4CNHA 3D5XA 5H9BA 5C1OA 3R2YA 1B38A 5HLWA 5GONF 1KOAA 4LQMA 4QOXA 2R0IA 3LJ1A 3WZKA 2Q0NA 5AP7A 4CFUA 2JDTA 3DF7A 4F7NA 3POOA 3MWDA 3EFLA 3U6JA 4FKOA 3TIGA 2BROA 3AD4A 1YOLA 2REIA 2VTJA 5GJDA 1VEBA 4WG5A 4OTQA 2Y4IB 4JNWA 4O81A 4YBJA 4RIWB 2ZDHA 4FFLA 3R8MA 4XYFA 4IB1A 2R3HA 2IN6A 4QP9A 3ZFYA 3LM5A 3QCQA 1H0VA 1KOBA 3ZSIA 1IOWA 5F4NA 4JX3A 3A99A 5H8GA 3TIYA 3PP0A 4CSVA 3SDJA 4D2RA 3LQ5A 2UW8A 3I5ZA 2W6OA 4OT5A 2PZPA 5AAGA 1VBHA 4HYUA 3JRXA 4O22A 4WUNA 5AM6A 3W16A 3ZOSA 4BHNA 4RVLA 1E4EA 5ETAA 4QP3A 4FT9A 4HZRA 3C7QA 3LIJA 3VS6A 3WF5A 3RALA 4XG8A 1GOLA 2IW6A 5AP1A 3N4VA 3LVPA 2VO0A 4QMLA 5DI1A 3C4FA 4A9RA 4AXAA 5AP2A 4II5A 4L6QA 4BGGA 4DGNA 3KULA 3FI4A 4O6LA 4LRKA 5JZJA 4OR5A 5AX9A 5GIPE 1JDBB 5D11A 2EB3A 4YB8B 4E93A 3OF0A 4LYNA 5IA2A 2LAVA 3ZTXA 4FZ7A 3P78A 2J2IB 4M7IA 3DOGA 3K3IA 3UMXA 2WNTA 2QVSE 2XNPA 3ROCA 3FPMA 3HUCA 4MXCA 3MI9A 4N0SA 3W55A 5EI8A 1RJBA 4DCEA 4O0YA 4R3RA 4C3FA 3SG9A 3CQEA 5E8TA 4YNEA 2DQ7X 4PMPA 3P79A 3LMIA 4JG6A 2ZB1A 4K2RA 4C58A 2W1DA 2XNOA 3SXRA 4FG9A 3VPCA 4TYIA 2HY81 3PZHA 4MBIA 3FZTA 1BI8A 3QTIA 4V0GB 5TOZA 1H1PA 2G1TA 2R3OA 2VTPA 4H3PA 5ACKA 3ZO1A 3I1AA 2R86A 4FTMA 2YITA 4WG4A 2V7OA 4APPA 2PVHA 1FOTA 4ENXA 5HE2A 2JBOA 3R28A 1L3RE 4MKCA 4RQKA 4CQEA 2QO7A 5IMXA 4NUSA 3GU8A 4YBKA 5HI2A 5HVYA 4O0WA 3LMHA 4QPSA 4WKQA 5ANEA 3OXZA 3CQWA 3WZJA 4BDHA 5D1JA 3OP5A 5BVWA 1EH4A 2BMCA 4APCA 4EH7A 3MY5A 1JKLA 3GFEA 4QYHA 3OUNB 1C30A 1WBSA 4FOCA 4C4GA 1CM8A 3DDPA 3ZDUA 4RVKA 1R3CA 3ZH8A 3RM6A 1FMOE 4RVTA 5CSXA 3F88A 4I5CA 3T3UA 4AZTA 3AXWA 2Z7SA 4TZRA 4I6QA 4AN3A 5C4KA 4F65A 2C6DA 3NYOA 2XZSA 3UZRA 4U80A 4EOJA 3U9NA 4ZSGA 4K6ZA 4TWOA 5KKRC 4O0VA 2QF7A 4ZTLA 3E3PA 3GBZA 3QTSA 4U0IA 2J5EA 2PYWA 2IW8A 3D5UA 1OM1A 3TG1A 5JKGA 5ANDA 2X2MA 2XEZA 3UVRA 3GQLA 3U4WA 3O17A 4UEUA 2QI8A 3AT4A 5J5SA 3HBLA 4WRGA 4JL9A 1M7QA 3LFFA 3NGAA 5FEQA 3UP7A 1MQBA 2PVKA 4PUZA 4DGMA 3OCTA 3PY0A 4U45A 2VTQA 4YMJA 4Z3VA 4RWIA 2HZIA 3OZ6A 5ANIA 4F99A 1T45A 3LFDA 1OBDA 5EHLA 2F2UA 2OFVA 4F9AA 2BCJA 3ANRA 5B2KA 1P2AA 3Q4UA 4UV0A 4B6LA 3DXPA 3KFAA 3Q2MA 4O2AF 4O82A 1JAMA 2R3RA 3DV3A 3TUCA 4JT3A 2OJGA 3ALOA 1ZAOA 4BCGA 2E9VA 5FBNC 2BTSA 3QZFA 2HOGA 2QC6A 1OKVA 5EW8A 5IEYA 4IDTA 2Y4IC 4X3FA 3VW6A 1JKKA 2W1FA 2YABA 3AC3A 4BDDA 4PDYA 4ALUA 3DGKA 3VAPA 4R7BA 5IQBA 2F7XE 4X21A 3U55A 3VF9A 3BHTA 4AW0A 3FV8A 3HLLA 2X9EA 3DK6A 1UV5A 4LFIA 2GNLA 5DR9A 3ALNA 3D2KA 5M4IA 4JBVA 5M4CA 4A9YA 2YCFA 2JGZA 2J0KA 4FZDB 1PXMA 2J0MB 4QPAA 5JN2A 4C7TA 3FQEA 4L46A 2UVZA 2GPHA 4GL9A 4YZ9A 5DYJA 4GK2A 2PVPA 4QMTA 5AMNA 3BI6A 4ZJJA 5E8VA 4ANBA 3KB7A 5IA1A 4D4RA 2BZKB 5EW3A 3LOKA 2VPQA 1IEPA 4OTHA 3BV2A 4QP1A 4ZSAA 3G6GA 2NO3A 2AUHA 1X8BA 2DWBA 3KREA 3MS9A 4DHFA 5CAQA 3TUDA 2I87A 4Z7HA 3BPRA 4F08A 4L43A 2ZJWA 3A7HA 4NJDA 1I7NA 3F3ZA 2QR7A 4V05A 5E90A 4PDPA 5CS6A 4BCHA 2YCSA 4Y73A 5IISA 2RIOA 3F7ZA 2C6OA 4UZDA 3CTQA 4A9TA 2OU7A 4O0SA 4MA5A 2IVUA 3ZRKA 4KRDA 4ZZMA 1YXSA 4YLKA 4OBPA 4F1OA 3QCYA 2VX1A 4QT1A 4ZLOA 3EWHA 4TNBA 3SC1A 5JGDA 4YJRA 3OROA 3QKKA 2F49A 5DOSA 1OUKA 2VZ6A 3EFJA 1NVSA 3Q53A 4P4CA 4RWJA 4AW2A 4AGDA 3HRFA 1YWVA 3FLWA 2UW5A 4FIIA 1U5RA 2XIXA 4TTHB 3IKAA 4RQVA 3EN4A 4DG2E 1GIIA 2XM9A 3W8LA 4DGOA 4XP0A 2WPAA 4GCJA 3ZMMA 3FBVA 2XBAA 4O4IF 1VKZA 2GLTA 3OFMA 3RM7A 3K3JA 2W1CA 4FEWA 2B7AA 5KHWA 5CTPA 1YI4A 4U41A 2QODA 2WTIA 4ITHA 3QTZA 1KWPA 4XLIA 1B6RA 3WF8A 3EQHA 4CG8A 2OG8A 1GZ8A 4JDIA 2QOQA 4QMYA 4QMUA 1VJYA 3WF6A 3SHEA 2HWPA 1YW2A 2W06A 5CALA 2UVYA 3R7IA 3QLFA 3EN9A 4RBLA 1WAKA 4ZQIA 2YM5A 1H07A 3FY0A 4CG9A 5LOHA 5AM7A 2WMVA 1Z2NX 3KAJA 4FTLA 1Z57A 4BZOA 1XO2B 3QTUA 3II5A 4E6CA 4IB3A 3V5LA 1YOMA 3ORIA 4QMQA 3AC5A 1WBNA 2JFMA 3PXFA 2R0UA 2QQ7A 3FMMA 3Q04A 4ITJA 2QOCA 4FV6A 1IRKA 4XV9A 3VJNA 4BBFA 4TKSA 3W2OA 5EM5A 2NPQA 5E8WA 4O0TA 2PE0A 5CU2A 2JDRA 3JVRA 2R3QA 4ALVA 4D0XA 3WZEA 2W4JA 1UKIA 1H08A 3PDTA 4I0TA 2R3LA 3UDBA 3M1SA 2OF4A 3LLTA 1REKA 2YFXA 5J87A 1IAJA 3VRZA 3W8QA 5BVOA 4R6VA 1SYKA 4H36A 4EHEA 2UW4A 4FUXA 1PK8A 2PN1A 4M9UA 4MAOA 3QXPA 3RUPA 1DAYA 2YERA 3I6UA 5HKMA 3KXXA 2BKKA 3PXQA 4M13A 4TT7A 3CD3A 1PKDA 5FP5A 4NTSA 5HIBA 3TNWA 3ZFXA 5L3AA 3D5VA 1ZARA 4D1SA 5F94A 3SW7A 4IVCA 3CLYA 2XMYA 3LFBA 3NR9A 3HP2A 1DI8A 3R7VA 4RGJA 4QYYA 3UP2A 4D0WA 4O86A 3OG7A 3WE8A 4KWPA 4O7RA 4PTCA 1IASA 3KF4A 4CZUA 4Q9ZA 4EWQA 5HE0A 4QTBA 3N6RA 3AC1A 5BPHA 4AQCA 4PRJA 3W2SA 3QD2B 3F3WA 2C3LA 2UZWE 2YIXA 4PL3A 2QOHA 2XIYA 2PVJA 3ZONA 3HA6A 2GFCA 3R1NA 3NYVA 1EUDB 4DCAA 4K8AA 2UZNA 4RG0A 3GXLA 1PW2A 2OJFE 5IDNA 3F2RA 4O27B 4EQCA 4XYLB 3C0GA 4IJPA 1KJIA 2GQRA 3LXPA 2B1PA 3V4SA 4IZAA 4FIEA 5LJJA 4I4FA 3QQFA 1EYZA 4BIDA 3ERKA 3MWUA 4F09A 5F9EA 2DWCA 4CEGA 4QMOA 4CMTA 4IANA 3BU5A 4GJ3A 4GUEA 4C36A 4KS8A 4WBOA 5IMEA 4IWQA 2XKFA 2FPPB 4M8TA 2CN8A 4S31A 3ZC5A 1KBLA 4F64A 3Q9XA 2Y7JA 3PSCA 2ITUA 3IECA 4XG3A 4G6LA 4E20A 1UVRA 4NWMA 2VTRA 4AX8A 3HRCA 2OKRA 2X81A 3UOLA 4MD8E 3NNXA 2QD9A 3H9OA 1YXTA 1CKPA 2P3GX 3P9JA 5C26A 3SXFA 3E5AA 1Z9XA 3TN8A 3TIIA 4I20A 4DH3A 4YUQA 2ZMCA 3BRBA 2JBPA 1YDTE 4IMYA 5D10A 4HNUA 2CCIA 4YJQA 5CNNA 3HV5A 4P7EA 2YZGA 3FMJA 1GZNA 2C5YA 3QAME 2IP4A 2R7LA 4FTQA 4G6OA 2IO6A 4PTEA 1OL2A 4A06A 1B6SA 1YRPA 4GSBA 1YXXA 3HKOA 3E64A 3EN6A 1R39A 3CGFA 1KE6A 4I93A 4NM3A 3EN7A 4MBJA 3TV6A 1AUVA 4BY9E 3RK7A 1A9XA 4U5JA 5JVDF 1YWNA 2Z8CA 3C50A 5KE0A 4BTFA 5BPYA 2BKZA 4FT7A 1PXKA 1OL1A 2YISA 4NKAA 4HNTA 1UA2A 4EZ7A 4YHTA 2RFDA 2YM3A 2JFLA 3K5VA 2FYSA 2OIQA 3EFWA 3I7CA 1YWRA 4GKHA 4QQCA 4TYHA 1KSWA 4DINA 3FL4A 2X9FA 3KU2A 5HU9A 5CA0F 3V5JA 1Q61A 4XG6A 1JKJB 1RDQE 4FI1A 4FK3A 4XRLA 1PMUA 3RPYA 4BCJA 3BBWA 4EZ3A 1UWJA 5HBJA 4NJ3A 2R3FA 5E8XA 3CTJA 5HGIA 5HLNA 4O4LF 5A6NA 3KC3A 5CI7A 5GJFA 3QFFA 4ORKA 1KE7A 2I0HA 1SNXA 4EZ5A 2UZVA 1JLUE 4IX5A 4CTBA 2OZOA 1UNHA 4HNFA 3DJ7A 3FYJX 4TNDA 3AX6A 4W4YA 1U5QA 3JPVA 4DEAA 2EWAA 4AW5A 4EH9A 3OC1A 2BFXA 4XP2A 1CS0A 3Q4ZA 2DIKA 3K5IA 5EYDA 2O8YA 3EZRA 4FTUA 4DFLA 4C4FA 3L9NA 3Q32A 1W93A 1QCFA 2C1BA 2W4OA 2W1GA 2P4IA 3NUAA 3KK9A 2GTMA 4AE9A 3LHJA 1W83A 1M7NA 5IQHA 3KXGA 2IZSA 4DC2A 4R3CA 3GOKA 3OVVA 2EXMA 5AUWA 2XJ0A 4U8ZA 4FG8A 4YJOA 3VBXA 4GUBA 5GINE 1UNGA 4FKLA 4MCVA 1IA9A 2FB9A 2UZLA 5CT0A 4EH5A 3OEZA 3OT8A 1M6VA 4M68A 3EL8A 2JKOA 4ZTRA 5EOBA 4JBQA 2XK7A 3JRWA 4GG7A 2E9PA 5M53A 4IQ6A 2JKQA 3VVHA 3EQCA 3TKHA 3HV3A 5LVOA 3QX4A 1U46A 1J7IA 4AA0A 4DFYA 1OUYA 4FTNA 3JY9A 2R85A 4HZSA 2R3JA 2X7FA 2XK3A 5C1QB 5AADA 1Q3DA 2BHHA 3R04A 4DH1A 4I0SA 4O38A 3KRXA 3VS3A 4D1ZA 5AUVA 4YO4A 4XJ0A 4FGRA 4AACA 3MDYA 2XBJA 4KIPA 2R9SA 5ETFA 4EK3A 4MD7E 4AGCA 3PXZA 5DT4A 2QLUA 3V8SA 4B7TA 2B53A 4QTDA 4DTBA 2YAAA 5CEKA 1WMKA 3QUEA 4JAJA 4RX9A 1XKKA 3PP1A 5CZIA 1JNKA 4JRVA 3MIAA 2WHBA 3QRJA 3GC7A 1CKIA 2FVDA 3R6XA 2B54A 2CZGA 4RZQA 3OUZA 3ORTA 4TWCA 2NU8B 3G0FA 3BYOA 3EQIA 5A3XA 4FODA 2HGSA 1ZZ2A 2JAVA 3V6RA 3MSSA 1P4OA 4FE2A 3ORLA 4P2KA 1KV2A 2C47A 4XV2A 3KA0A 2IVVA 1WZYA 4FT3A 4X6RA 5FM2A 5CSPA 2G01A 2G9XA 3EKKA 3QD3A 3VRYA 5HICA 4F0GA 3EQGA 4TPTA 3D7ZA 1H4LA 1JDEA 4OLIA 3TM0A 2VD5A 3CPBA 2VRXA 3CBLA 4MNFA 3VIDA 3TINA 2PMIA 3UYTA 2ITQA 3C5UA 3KGAA 4ASDA 2F4JA 5HX8A 1OKWA 4CMUA 4FTCA 2W6QA 4FFPA 4JLCA 5LVNA 4R78A 1K3AA 2HELA 4PNKA 4S30A 5IQCA 3RHKA 3W33A 4U43A 4BVUA 2PPQA 4CD0A 4XCUA 3VS1A 5CF6A 4I3ZA 3R5HA 4FFMA 1FVTA 3ZSGA 3T8OA 4ZLYA 1H1SA 3PA5A 5H8EA 1KE9A 2OH4A 2EVAA 3OXIA 5B0XA 2VGOA 4Y8VB 3MPTA 4ACHA 5B2MA 5JGAA 2NU7B 1TQIA 2GNGA 2FPIB 5BVNA 1BLXA 3KVXA 3U87A 5AIRA 4G6NA 4QTCA 3DNDA 3IOKA 3WZDA 2VGPA 4U97A 1Q4LA 2O65A 5CF5A 2XF0A 1KUTA 2VTIA 2G2HA 2QOLA 2VV9A 4L7FA 5KMKA 5FNVF 4E6QA 5A54A 4ZSJA 3C1XA 3ZC6A 4TV9F 2HAKA 4IW0A 1CMKE 2B9FA 1JSTA 4IM0A 3TT0A 4BBMA 5KKRB 1CDKA 3ID6C 4O84A 3KCKA 5IZFA 5LVMA 3G15A 2WQBA 4HGLA 5L6PA 4BCKA 3MH2A 2PVMA 3FLYA 4RIYA 3ZYAA 1H28A 4KNBA 1PMEA 3VQUA 1FMKA 4J97A 4MXZA 2FO0A 3W2RA 2GNIA 2J6MA 1PYXA 2XCHA 3G9LX 3HV6A 2HJWA 5HCZA 4BZNA 3OCBA 3N9XA 1IAHA 4FYOA 3MY1A 4I55F 3HMNA 3T3VA 1JVPP 3NX8A 2XIRA 4NM0A 2OIBA 4O7VA 4RIYB 2IVTA 5AUZA 2E9OA 3FPQA 4E6AA 2Q0BA 3DCVA 4EI4A 5EDPA 3HRBA 2X7GA 5CLPA 5J9YA 2CKEA 2XK8A 2R84A 4FZFB 4CRSA 1OIYA 1K9AA 4WNPA 5M4FA 4RJ7A 5HNIX 3R7OA 3I6WA 3MH3A 4PX6A 5H8BA 2OLSA 3GI3A 3ULZA 2WO6A 3ZLSA 1OL6A 3MIYA 4I6HA 3PJCA 2HENA 5D41A 4EYJA 5IA3A 2I80A 2R7BA 1PHKA 3IS5A 4PQNA 5DWRA 4IC7A 3BHUA 3D15A 4JR7A 3BG5A 5HBHA 3EMGA 3VUGA 3FZOA 3UG1A 4BDIA 1SM2A 4FV9A 3V3VA 1YI3A 2CCHA 1KJ9A 1LUFA 3W2QA 1WFCA 1YXUA 3COHA 2AYPA 4IACA 4YJ3F 1BX6A 2VR1A 3F69A 2X2LA 3QRUA 4BICA 3WIGA 4F9YA 3VBWA 3OD6X 2XK6A 4O7YA 5BUJA 2OJJA 2KTYA 5HE1A 3VNTA 4L01A 3TV4A 2BRNA 1ZMUA 2C6EA 2ITZA 4RIWA 1KV1A 3FWQA 5AP6A 2YW2A 4F9CA 1OI9A 3KMMA 5AEPA 4E4TA 1IG1A 2BALA 5EZYF 4FVQA 4O4HF 3MFTA 4RWKA 5C8NA 4JX7A 5J7HA 4JG8A 4OTGA 4FV5A 3U8WA 2PUIA 2GS7A 1XH4A 2ESMA 2I6LA 2WU6A 5KZIA 4LI5A 3UIBA 2VTAA 3DJ6A 3DTWA 4D4YA 5J1WA 4H1JA 3FZ1A 5IH5A 3QA0A 2PY3A 1JOWB 4ZJIA 2A2AA 3R1QA 3TEIA 4AG8A 4J1RA 3NS9A 1QPCA 3ZUVA 3GENA 5HIDA 3FXWA 2VX3A 3O8PA 4NFNA 4G34A 3LCTA 4BCIA 4MA0A 3JY0A 3NWWA 5LVPA 1ZOGA 1S9JA 2UW3A 4DN5A 4UN0C 5L2WA 3HDNA 3OW4A 4FVRA 4IJ9A 1B6CB 1CSNA 3OBGA 5CA1F 2W1ZA 2R64A 2W05A 2XJ2A 3KMWA 2C68A 2PMNX 3MESA 1W7HA 3JYAA 3O0GA 1G8AA 3B2TA 3NW7A 2JC6A 4O91A 4QQJA 5CT7A 4BTKA 4ACMA 3FZPA 2GPWA 1PXLA 3OXTA 1E1XA 1Y6BA 4I5HA 3A60A 3Q5ZA 4YPSA 5K5XA 4PNIA 5FG8A 4FZAB 3RPOA 1EZ1A 4U42A 2XKEA 5A4QA 5IG1A 3ORKA 3LCSA 3CJGA 4KIQA 1H8FA 1B39A 2B9IA 3HZTA 3R8LA 2HY0A 3VF8A 4LUDA 2HXLA 3PWYA 4IH8A 3RVGA 4J96A 4G3EA 1REJA 3A7FA 2JD5A 5IQAA 1DV1A 2PBZA 1SZMA 2BDJA 1DI9A 1S9IA 2UUEA 4M69B 4FKIA 2XKDA 3MH0A 4HPUE 5D9HA 5IA5A 4F1TA 2WEVA 3G6HA 2CGXA 4KAOA 1LR4A 4FL3A 4IAKA 5BVKA 3VBQA 3VS2A 5LCJA 3TQTA 4C02A 3HYHA 3O96A 3WOWA 2YA9A 3HMIA 4J95A 3D7TB 3I12A 5DN3A 2RFEA 5AP5A 4ZSLA 4FIGA 1T36A 5GJGA 3JUHA 4X6QC 3GP0A 2A27A 1TQPA 5EQPA 3VULA 3ZLYA 2ZDGA 3FE3A 5JEBA 2B52A 2OW3A 3OHTA 4L7SA 5DRDA 4A9SA 3V51A 5JH7F 4ANSA 2YJRA 2EXCX 1G8SA 1MQ4A 3PRIA 2ZV2A 3ZCLA 4BN1A 5EQEA 1UU8A 2F7ZE 2I40A 4HNIA 4A4LA 5EKOA 1OIUA 3FLQA 3GC8A 3REPA 4IM3A 4NCTA 2JDSA 2BZJA 4UY9A 3KXMA 1VYWA 1ZYCA 4NIFB 4HCVA 2P2IA 2W1EA 2ZAZA 3C0IA 3EH9A 3WF7A 4ANMA 3A8WA 3I0QA 5FD2A 3VPBA 3WNZA 5BMVF 4J52A 2V62A 2NNWB 1J1CA 5GIOE 2BIYA 3CR0A 3RMFA 1KJ8A 4LMNA 3DXQA 2C6TA 1M17A 2R82A 2GHGA 5JZNA 2YZMA 3QKLA 5JFXA 3UFXB 3ZBXA 3SAYA 4H1MA 3M2WA 2OICA 4X3JA 4FK6A 2W1IA 5KX8A 3HL7A 4PDOA 2E9NA 4U40A 5TT7A 4W8EA 1V1KA 4N4SA 5CF4A 1ERKA 5E8YA 3IK3A 4FR4A 3EYGA 2C6MA 2I7QA 4ZS4A 2J9MA 3TNIA 1QPJA 2HWOA 3S0OA 3JXWA 3QRTA 3F7WA 3R30A 4FSQA 3PG1A 3UE4A 4JDHA 5LOVF 4M0ZA 3R0TA 5IQIA 2PVNA 4S33A 1ATPE 3OOGA 4K0YA 4P90A 4WD5A 4KUJA 4OBQA 3ORZA 5CQUA 3ZO4A 4UXQA 3TCPA 4M0YA 2JITA 2X4ZA 4JQEA 2WMTA 4N6YA 3UIMA 5I9VA 1KC7A 1V0BA 5ANKA 3I0OA 3BHHA 5L6WL 5I9XA 4ZAUA 5LP6F 4RPVA 1OZ1A 4UWBA 3MJ2A 2YCQA 5JT2A 2ZDUA 2GU8A 4J8MA 4D55A 4Y95A 1BI7A 4J7BA 5HEZA 3ZUUA 3UMWA 1PXPA 3PPZA 4W4WA 2X6DA 2RF9A 3BLRA 3PSBA 1WBVA 4FTRA 3FLZA 2W0JA 1PF8A 2XCLA 4OT6A 4BC6A 2XRUA 4IVDA 1U59A 3IW7A 3IW5A 3JS2A 2I8CA 4FYNA 4EKKA 3SGCA 4FSRA 4XG7A 2O63A 4TYEA 3H9FA 5HG9A 1OPJA 3GGFA 3PY1A 4BCNA 1GSHA 2YDKA 2CJMA 3NSZA 5LWMA 5DMXA 4DH8A 2GS2A 3F3TA 3MPMA 3KALA 2EUFB 2O3PA 4GS6A 3PZEA 5DPVA 3NNVA 4MWIA 5D7VA 3EZVA 3FJQE 3OT3A 5EI2A 4C2VA 2AC3A 2Z60A 3QCXA 4NK9A 4AA5A 3LKMA 2J0JA 3SKCA 3L8XA 3B2WA 4N70A 4A4OA 3D0EA 4FIJA 2GDOA 3UZTA 2HZ0A 1YDSE 3AGMA 3CD8A 4MXYA 4TRLA 4QMXA 3A8XA 2R4BA 4PDSA 3F5PA 4XBUA 3PA4A 3MFRA 4EBVA 3FMHA 4W4VA 4E4XA 3R21A 1R0EA 4D9UA 4U3YA 4S34A 2ETRA 3BE2A 2A1AB 3KRRA 2YDIA 5FDXA 3WARA 3B8QA 2PZYA 4FV2A 5CEMA 1J7UA 1BMKA 1FGIA 4FKQA 4GV1A 3KVWA 4KKEA 3MBLA 3LCOA 2QU6A 3FQHA 3ETAA 1MRVA 4XLVA 3E5NA 4AE6A 1H1QA 3JZIA 4LV5A 3BYUA 2W5BA 5FUTA 3UOKA 1AQ1A 2WTDA 4G3DA 5CSVA 4BGHA 2PTKA 3ETHA 4QO9A 4YAKB 3N4TA 4EOLA 3H10A 2CLXA 4F0FA 4X2GA 4IZ5A 3QRKA 5CVHA 4EGQA 1Q8UA 4Y46A 4DH5A 5IYZF 2ITTA 4QYGA 3CQUA 4QP2A 2OI4X 2ITNA 3DAEA 1YI6A 2VTOA 4IVBA 3DS6A 2I0YA 1P5EA 2YCRA 5CZHA 1U4DA 3UIUA 5IH6A 5AUYA 3PLSA 2CKQA 2FGIA 4IZ7A 4YGAA 4CCBA 4ANQA 3H0YA 1XBCA 4JI9A 3S1HA 3WO0A 2BRMA 1ZOHA 4LV8A 3GU5A 4X0MA 1BL6A 5HG8A 2PZ5A 5J9LA 4KABA 2JIIA 3KXHA 4EJNA 2XA4A 4GW8A 2YM8A 3LJ2A 1BKXA 1R78A 4LOQA 3KCFA 2FH9A 2JEDA 3DTCA 5HZNA 1I09A 3IONA 5K5NA 2IPXA 2V22A 4IWOA 3GUBA 3HAVA 4FTOA 3A7GA 3ZZEA 3DKCA 4X3FC 3Q4CA 3QU0A 4ZMEA 5CASA 4EGJA 1YDRE 2HK5A 3QTWA 4CV9A 4FV4A 3L9PA 5A6OA 4C4EA 4ERWA 4EL9A 2BDFA 5I5ZA 3MH1A 3EQFA 1EHIA 3SLSA 1TKIA 3TACA 3DAJA 3NUPA 2W6PA 5M44A 3DQXA 3FUPA 5H3QA 5KZ0A 3TDWA 4YTIA 3NCZA 2WTKC 4FFRA 2R7KA 2YM7A 3F9NA 3CXWA 4M12A 4RFYA 4U9AA 3IGGA 4A4XA 1GNGA 3LQ3A 3UGCA 3Q5IA 3WYYA 3F6XA 5BQ0A 3COKA 4O7NA 2C0OA 5C01A 4JRNA 4F9WA 5DVRA 2YAKA 4XOYA 3RTPA 3ULIA 3VUDA 4XV3A 5C8MA 4RZVA 4F7SA 1H26A 1Q3WA 4ZLZA 3DZOA 2XP2A 1QMZA 3UQCA 2W9ZB 3BZ3A 3A61A 4ZHQF 1R0PA 4AOIA 4BCOA 3FI8A 3QUPA 3UOJA 5E9EA 3QL8A 4FSNA 2V55A 5KNJA 4IFGA 5BNJA 3E8DA 3LCKA 3RK9A 4FV8A 3MPAA 4PP9A 4YJUA 5M57A 4NTTA 4FUYA 3TW6A 2P2HA 3P7BA 4IC8A 5AUXA 1UU9A 3A7IA 5DR2A 5E1SA 3V5QA 5ITAA 4BR3A 2W71A 3LW0A 4RC2A 4AT3A 2Y6MA 4CFNA 3DT1A 3FQSA 4EOKA 3FMDA 3OEFX 4YP8A 2NUAB 4BKJA 2X2KA 1FINA 4H05A 3Q4TA 4O7LA 4PMSA 4FFOA 1M2QA 4BDJA 1OVEA 3ZLWA 2W4KA 4KBAA 4V01A 2PE1A 5AP3A 5CSHA 1FQ1B 3K2LA 4TYGA 1M0TA 4H58A 3QFVA 4G31A 5F1ZA 3VJOA 4MV7A 2YRXA 2LGCA 2PK9A 3L1SA 2BTRA 3ATSA 3RI1A 3BBTB 4Y83A 4RJ4A 3NLBA 4R7IA 2W1HA 5FGKA 1CE8A 4L67A 2OBJA 4HCUA 2YL2A 4BDFA 5CWZA 4TV8F 4EYMA 3SRVA 3LZBA 4WO5A 3ZZWA 4JVGA 4GK4A 4I5MA 4X2NA 3R8VA 4EUTA 2DYLA 3LFQA 1H01A 2C5VA 4IVAA 5L8LA 5A9UA 4ZMFA 2YZLA 5HQ0A 3SD0A 2WIPA 3NUYA 4ZEGA 1SNUA 5JFVA 4TN6A 2J7TA 3GB2A 3HVCA 3T9TA 2JLDA 4O0UA 1A9UA 5FM3A 4XNEA 3V8TA 4HR7A 3M42A 3VMMA 2CNVA 4W4XA 4EOOA 4LMUA 3F5UA 4RA4A 4L3LA 4XG9A 1XWSA 3E8NA 3ORRA 2X8IA 2IG7A 4G5PA 4BDKA 3U9TA 4LOOA 5EYMA 4KSPA 4XMOA 4CFMA 2PSQA 5DRBA 4Z9LA 4OTIA 4M84A 3WILA 1WBOA 2GCDA 3CIKA 4Y72A 1F3MC 3CE3A 3PVUA 4CMOA 3FLNC 5L2IA 2Z02A 4YZCA 2OF2A 5HLPA 3RAHA 3EQDA 3I60A 4ID7A 2ZVAA 2Y9QA 3TNHA 1K2PA 4YSMA 4E26A 1YXVA 2HZ4A 4RRVA 4IHJF 3AQVA 3KRWA 3QBNA 5AFVA 1VR2A 5KBQA 2W70A 4E73A 1YKRA 3ACJA 3NUSA 1APME 4L9IA 4R77A 3UNZA 2DLNA 3ORQA 1P4FA 1KE8A 1Q41A 5AV1A 3ZHPC 4AZWA 3QWJA 4GKIA 4Q2AA 3TZ8A 5LYJF 4ZIMA 3GCSA 1FVVA 2VO6A 3DA6A 3PWDA 3QTQA 5EM7A 4ASZA 4YU2A 3R5FA 4XX0B 3CCNA 3PYYA 1LEWA 2UW0A 3D14A 4F6WA 2P33A 3QZGA 2ZM4A 4GIHA 3PJ2A 2QK4A 2Q83A 1JPAA 4GFOA 4JIAA 3ROYA 3PXRA 4LGHA 4NFMA 4BI1A 2HXQA 4CCUA 5C9CA 4EH4A 3V6SA 1ZYJA 3BEGA 2QOOA 2XB7A 3F2AA 4HYHA 5KMLA 2R87A 3R9OA 5IEXA 4RZWA 4XBRA 4RX8A 1XBAA 3VW8A 3Q9WA 2C69A 4U79A 4YJTA 4YNOA 4ZXTA 4QQTA 4JS8A 3HO8A 4G1WA 2Z7LA 2PE2A 3HGKA 5F20A 4CTCA 1M0WA 1SVEA 3MFSA 2BVAA 3MW1A 3UVQA 5CAPA 3MV5A 4Y85A 3BYSA 4MAMA 2GQGA 2UZDA 3Q9YA 1WBPA 3QX2A 3QZIA 3FXZA 2O5KA 3FSKA 3BWFA 4BTMA 4HVHA 3DK7A 4NZWB 3S4QA 4O2PA 4C0TA 4MEDA 3P23A 3PFQA 4NYEA 4HVIA 3W32A 5CB4F 1PXJA 3PPJA 3DAKA 4I94A 2BZIB 4I41A 3NW6A 1ZWSA 4FX3A 4XOZA 3TZ7A 5KHXA 4MWHA 4G3CA 3Q96A 3O23A 4UBAA 3SOCA 2R2PA 3QD0A 1O6KA 4KINA 1AD5A 1XH7A 3ZO2A 3UPXA 1H1WA 3T9IA 3ENHA 4BDAA 3BX5A 5L6OA 4XG2A 5LMKC 3K5HA 3E8EA 5M08A 1LP4A 4YJSA 2JIUA 5AV3A 4C4HA 4BYJA 3EIDA 3AD6A 1DS5A 2VUWA 3R01A 5CEQA 4RC4A 4DT9A 3RV3A 2GS6A 3Q52A 2I0EA 4D9TA 4LM5A 1FGKA 1GSOA 4ZSEA 3HAMA 3NYXA 3VS7A 4JBOA 2VU3A 1P14A 4EKLA 2ZM3A 3K5UA 3QCSA 2JDVA 4OTWA 2CN5A 4YJVA 3QF9A 4Q9SA 4C2WA 4MNEA 1DAWA 3VUHA 5CEPA 3TZ9A 4L3PA 5HTBA 4PF4A 4FV3A 5E91A 2WIHA 2YRWA 4HVGA 5AWMA 3DB8A 4E5BA 3DPKA 3VOTA 3F3UA 4G2FA 4MV1A 2X0SA 4DTKA 1E4EB 2QOKA 1XH6A 3GC9A 1WBTA 4IB5A 4EBWA 3R7UA 1BNCA 4IADA 3MA6A 3UJGA 4AAAA 2WMUA 5G1XA 5LQFA 5M51A 3E7VA 5IA4A 4O7WA 3C0HA 3FAAA 2B0QA 1H24A 5J9ZA 3BGPA 3FKNA 3RCJA 4YHJA 5JGBA 3Q2OA 4DGLC 2WEIA 4C5BA 2ITOA 2JKMA 2PHKA 3EHAA 2R3GA 4YC3A 3Q3BA 5HBEA 3SRVB 3C4WA 1OKYA 5HCYA 2WGJA 4GYIA 4QNYA 2XRWA 3ORXA 3PSDA 5EK7A 2YM4A 4M97A 4HYSA 4UB7A 5C03A 4CFFA 1U54B 3MN3A 4IB0A 5AIKA 5FLFA 5JQ8A 4MQ1A 4RLLA 2RL5A 5LMAA 4FT5A 3U51A 4AS0A 3R7EA 1M2RA 3GFWA 2OJIA 4JQ8A 3BEAA 1UWHA 4MXAA 3ZSHA 5IUHA 5KCVA 4XYMB 2ONLA 1IA8A 1C3OA 2QOFA 2JAMA 2C0IA 4FKUA 4TW9A 3VWAA 4D58A 4ZY5A 4IDVA 4U7ZA 2R5TA 2R7IA 4USFA 4AT5A 5C27A 4DF3A 5AA8A 3BKBA 3GU6A 3O7LD 4MK0A 3C9WA 2IZUA 2XIKA 4IX3A 1UU3A 4WUAA 4IAFA 3SXSA 4O2BF 2OJ9A 3RP9A 4EK8A 2HCKA 5HVJA 3S3IA 3RHXA 2WYOA 3NCGA 5A4TA 3ANQA 4KA3A 5J95A 2OIDA 3E87A 3NPCA 4I4EA 5ETCA 5KUPA 1XQZA 2PUPA 5HD4A 3OUKA 4RJ8A 1GGOA 1OMWA 2ZMDA 3C4ZA 4I22A 4FSWA 2SRCA 3C5IA 4M67A 1GIJA 3ORMA 5ICPA 1ZY5A 3JVSA 5M09A 3SQQA 4E1ZA 2P55A 4EQUA 4CKJA 3KKVA 2WAJA 4WIHA 4ZK5A 4ERKA 2J0IA 4W8DA 1GZOA 2XH5A 4YZNA 4BZDA 3QTRA 3RZBA 4O0RA 5FP6A 2H6DA 4G3FA 5EYCA 2WMQA 3Q1KA 1ZOEA 4K1BA 3R5XA 2X1NA 3LXNA 4JBPA 2OZAB 3IW4A 4WHZA 5D7AA 2DZDA 4BTJA 3OY1A 2C5NA 2Z7QA 2J51A 3ENMA 2YYAA 1PXIA 1RW8A 4OTFA 2WMWA 4UALA 4XG4A 4YC8A 2V59A 3RPSA 2QCSA 3TV7A 5BVEA 3DBEA 2WMRA 5KMOA 3HNGA 3QUDA 3D5WA 3FI3A 3KY2A 3DU8A 2R3MA 5DH3A 4C59A 3VBTA 2F57A 2GNHA 3OWPA 4TYJA 4IFCA 3KQ7A 4LL5A 4P5QA 5J8IA 5KMMA 4KBCA 5DEWA 3QWKA 3DY7A 3TXOA 5I0BA 2W6ZA 4RC3A 5CYIA 3QXOA 2NU6B 2NRUA 2OGVA 5HORA 2CMWA 3UQFA 3UO4A 5FRIA 4GMYA 4U81A 3RAIA 5D12A 4I4TF 3MY0A 4F6SA 5AP4A 1ZMWA 3DLZA 2VWYA 5CEOA 2YZNA 4F1MA 2ZB0A 4FNWA 5IQDA 3QLGA 2VWVA 4R3PA 4GIIA 3PJ1A 4C33A 1PJKA 1TVOA 4ACCA 1H00A 4YJNA 4RIXA 3HMPA 1WVXA 3HEGA 5JRQA 4C38A 4DEBA 4EH3A 5JVLA 5BVDA 2WTCA 1MRYA 3SVVA 3TUBA 5BPFA 2XIZA 4PV0A 2JIVA 4Z55A 5J2TF 4OGRA 1H1RA 4WG3A 3UVPA 1T46A 3OWKA 5HD7A 3RJCA 1Q97A 3WIKA 4ZZOA 4C4JA 4F7LA 3DKOA 4MX9A 2QG5A 3K54A 4V0GA 2NP8A 4FSUA 4YO6A 3R8PA 2YDJA 3CKXA 4CZTA 2HW6A 4GJ2A 4RJ5A 4NU1A 4USEA 1LPUA 2BRGA 2W5HA 3G33A 3R9RA 3ZXTA 4DBXA 2GFSA 2BRHA 3F66A 1ND4A 4GVJA 3P86A 4AGUA 2BRBA 4GYGA 4Z16A 2XJ1A 2XYNA 1Q99A 2WELA 5IEVA 1VYZA 4FKJA 3QALE 4QNAA 4CRLA 4NM5A 4FKSA 4XZ3B 4QMPA 3RINA 3DKFA 4NW6A 4AWIA 2HYYA 1PX2A 5T68A 4WRSA 4DYMA 2O0UA 3UODA 2QU5A 5G6VA 3UYSA 4DLJA 3AG9A 3QGWA 1Q5KA 4FEQA 4GRBA 3DNEA 3KULB 4QMNA 2FB8A 2R3IA 2RG6A 4M14A 4IX6A 2UZTA 4EK5A 5K4IA 3VS5A 1FVRA 2RFNA 4UYNA 5CANA 1ZZLA 3DDQA 2BIKB 3QC9A 4RX7A 4L53A 2NU9B 2WKMA 1Y8YA 2GPSA 3AGLA 1UNLA 4ZP5A 3VHEA 3VO3A 2RKUA 5E7RA 4RWLA 4E7WA 5LA6F 3IG7A 2YJSA 2YZAA 3D2IA 3NUNA 4MNEB 4FBXA 3KL8A 3OCSA 5D8DA 5H80A 1BL7A 2YIRA 3EKNA 3OW3A 2ZV8A 1PKGA 2ITVA 3CC6A 3LQ8A 3O71A 4FGBA 4B8LA 4BBEA 5KKNB 5JQGF 4RMZA 3EYHA 4WNMA 4USDA 3AT2A 3G8CA 3ET7A 5K3YA 2WOTA 5I9UA 2AC5A 4X7QA 3SX9A 4NSTA 5LMBA 3DZQA 2XS0A 2ZM1A 3FMKA 3WF9A 3P1AA 4BDCA 4R5SA 2YS6A 1KEEA 4EUUA 3CSVA 3MVHA 5IA0A 5M07A 2ZV7A 3ZBFA 1J1BA 3FI2A 5DIAA 2QKWB 2G2IA 2VTLA 2ERZE 2YIQA 3PUPA 4I21A 4IX4A 5BMMA 2PVFA 4BDBA 3GCQA 3LXKA 5FDPA 5L2TA 3D94A 4EWHA 5C8YF 5HNBA 3AC4A 2YACA 2VNYA 4XHKB 3MWEA 4EG0A 2NRYA 5CU6A 5IDPA 2BAKA 3CS9A 3IPHA 5FTQA 1GJOA 4AFEA 3ZLXA 2R7MA 2J4ZA 3ORNA 5HNGA 3BCEA 3R22A 1XHAA 1URWA 5A46A 3CY2A 1BYGA 4HGTA 2YWPA 2VTTA 5IQEA 1VZOA 4O2ZA 3IDCA 4CT1A 4WNOA 1Q62A 3FEGA 4BF2A 1ZLTA 4E6DA 2H9VA 4OUCA 3UOHA 4D2SA 3NIEA 2QG7A 2QKRA 4FKPA 5BMSA 2VWUA 4D5KA 2WZJA 3OTUA 3R23A 1Q8ZA 4FSZA 4D5HA 4JJRA 3BLQA 4G3GA 2V5AA 4EC8A 5J2UF 4YSJA 2H96A 2W99B 3TNPC 3PA3A 4NL0A 4K33A 2R7NA 3QRIA 1XH8A 5CY3A 3BGQA 3PVGA 5DLSA 2C1AA 2J90A 2UW9A 4JDKA 4L52A 4AF3A 1I7LA 4BIBA 3GLKA 4JOAA 3VA7A 2FSMX 5HBRB 3C4EA 3QHRA 2QHNA 4HGSA 4QMMA 4ASEA 2Y0AA 4JQ7A 3R7YA 2OXDA 4AZFA 3DFCB 3FMNA 3MTLA 1OPLA 3MVLA 2VTHA 3R63A 1YVJA 3MVMA 4X2KA 5ACBC 2OXYA 3TTJA 4ALWA 1OECA 3WI6A 3ZM4A 4CKIA 3R73A 5CAUA 3R1SA 4I0RA 4DLKA 3GU7A 4KS7A 4ZTMA 4ZZNA 1OL5A 2IZTA 1OPKA 5M4UA 3UO6A 5JMSA 3L8VA 3NIZA 4YZMA 4AUAA 1V0PA 2BUJA 3QQJA 4R7HA 3ZM9A 4FV1A 4NW5A 3R9DA 4I50F 1KJJA 5FXSA 2V58A 5DT0A 3Q9ZA 4YPDA 3P4KA 4O7TA 4F6UA 5IPJA 4ZOLF 2CSNA 4GT3A 5BYZA 3SV0A 1BUHA 5HO7A 4PL5A 2JDOA 1Y8GA 1I44A 3QKMA 4HJOA 4IM2A 4PL4A 4U44A 4XRJA 4QMZA 4HVDA 1WR2A 4MV6A 5A4CA 1JSVA 3BYVA 3GT8A 3R1YA 5IQGA 5JFWA 2QOIA 3NUUA 4IIRA 4R5YA 3FC1X 4RIXB 5EYKA 4CLIA 5K9IA 5LWNA 4BB4A 3ACKA 2EB2A 4C35A 2WMAA 4EOPA 4XH6A 4YBZB 3VBVA 5C8KA 4C3RA 4QP4A 5B2LA 2RFSA 2BZHB 5E1EA 4GT5A 3FHIA 2UW7A 3E63A 2F7EE 5HCXA 4BCMA 3LLAA 2VQDA 4TUYF 1J3HA 3HV4A 1J91A 5A14A 4WOVA 3CKWA 2XCKA 4CFXA 3LE6A 1A06A 5CSWA 4E4LA 2DUVA 3A2CA 3R00A 2WXVA 3MTFA 1G5SA 4CKRA 4ZTHA 4AZSA 1MP8A 1PXNA 3BIZA 5EHYA 3CJFA 4FEXA 2G15A 4FKRA 4ITIA 5KBRA 4H3QA 2C5XA 4UX9A 4DTAA 3G5DA 3HMOA 4Y8DA 4KIOA 3G0EA 1YHVA 3F61A 3AC2A 4L42A 3IQ7A 3F2NA 4JIKA 2XKCA 5JRSA 5DEYA 5T3QA 1GAGA 3BV3A 5KMIA 3UO5A 2P0CA 2OFUA 2OZAA 3G51A 3TNQB 4I23A 3V5WA 3O8UA 1R1WA 3KXZA 3P7CA 5EHOA 5HG7A 2Y4PA 4BDEA 3AMBA 3MGYA 1STCE 3BWJA 4CFWA 3PLAE 4V04A 4FOBA 1SMHA 2PUUA 3QTXA 4DFZE 4AA4A 3R83A 3QYZA 4JXFA 3COMA 3IO7A 3DFAA 4DFXE 4ME6A 4L1KA 4AOTA 3ITZA 4XS2A 2J9GA 4J8NA 5CVFA 4O21A 2VTMA 4F70A 3QYWA 3BHVA 3C4CA 4KB8A 4QRCA 4R1VA 3LCDA 2ERKA 4KSQA 5C4LA 1MRUA 3LM0A 5EDQA 3VBYA 1NA7A 2GNJA 3E3BX 5DG5A 2X6EA 5CAVA 1XBBA 5CU4A 5CAEB 3S2PA 3CTHA 4TWNA 4NKSA 5DR6A 3HB9A 1YOJA 5E8UA 3PRFA 3NRMA 2PMOX 4RFMA 4TYHB 3DQWA 5CQWA 4HNVA 2Y8OA 3S95A 2B4SB 3COIA 4JR3A 2C6IA 5CX9A 1QPEA 2CNQA 5FTOA 4TL0A 2BILB 3TKIA 3TZMA 1NVQA 2R3NA 4L68A 3FKOA 3IW8A 1HOWA 2G2FA 3KRLA 4NH1A 5JSMA 3EQPA 5TO8A 3F82A 4CVAA 1Q24A 4A9UA 2GTNA 3GOPA 4FC0A 1JKTA 4Y5HA 4C4IA 3LJ0A 3AD5A 2E2BA 4YTFA 2BAJA 2CDZA 3FMLA 2IZRA 5HTCA 1NW1A 3N4UA 4AT4A 5I9WA 4IWPA 2GSFA 4J99A 4LRJA 4DA5A 2OO8X 2OK1A 4M15A 2VAGA 1SCUB 4ZI7F 2H34A 4Q5EA 4RJ3A 3FXXA 4GT4A 3RAWA 2EU9A 5T6KA 1Z2PX 3FY2A 5M06A 2I0VA 2YM6A 1OL7A 5AJQA 4ZTSA 1CQJB 2WQMA 1XH9A 4BHZA 3PTGA 4L00A 3R8UA 5BX0A 2HIWA 1Q8TA 2GMXA 3QC4A 2CKPA 3WE4A 3U54A 1ZY4A 5BUEA 3NNUA 2VWWA 3QQLA 4FL1A 4KKGA 4FTTA 4GH2A 2XNEA 3ZRLA 1RE8A 5BVFA 4RVMA 2VTNA 2IVSA 3UQGA 2X39A 4IAYA 5L8KA 4GEOA 3M11A 3ZFMA 4FICA 3ZO3A 1W8CA 3ZEWA 4CXAA 1QL6A 1NVRA 3EOCA 3O7LB 1GY3A 4IAAA 2XYUA 5HESA 5AV0A 4DITA 3BHYA 2BFYA 4FNXA 5ETIA 2SCUB 2XUUA 3I5NA 1GSAA 2FUMA 3OCGA 2KULA 4YJ2F 3ATTA 4RT7A 3MYGA 4ZJVA 5HIEA 4S2ZA 1DIKA 2W7XA 4FA2A 2R3KA 4QMSA 1AGWA 5HG5A 3DB6A 3LFAA 4EORA 4HVSA 1FBNA 2F2CB 2X8EA 4HCTA 3P7AA 3VS4A 2WD1A 1SVGA 3ZDIA 3HMMA 5CNOA 4MV8A 4U3ZA 3GVUA 3QQUA 5JFSA 2UZUE 4IEBA 5B7VA 3R9HA 3G2FA 3ZUTA 3E62A 4FV0A 3C4XA 4GVAA 2QO2A 2C3JA 4LRMA 4I1ZA 4MH7A 3VN9A 4RA5A 1GZKA 3H4JA 4PWNA 3H9RA 3TJCA 4XP3A 3UC3A 4C37A 5A4EA 3HX4A 5K4JA 4QYFA 3BGZA 3NAYA 2QOBA 5KMJA 4TY1A 5J1VA 3ELJA 3NVMB 4FT0A 5EDRA 2ZYBA 5CAOA 3UNKA 1OIRA 3AC8A 3Q60A 2QO9A 3GIDA 4D1XA 2WMBA 4ACDA 2GQSA 2A19B 3FZSA 4FKWA 3FKLA 4OTRA 5E8SA 3TJDA 3UIXA 4ARKA 3N51A 4DBNA 1GIHA 4UZHA 3E88A 3HUBA 4L44A 2WMXA 2XD4A 2XVDA 2XEYA 4N6ZA 4QTAA 3PVBA 4DE4A 4CV8A 3U9SA 4QTEA 3G90X 3PIZA 3RPVA 5DGZA 4DEDA 3I79A 4FTKA 4E5AX 4ENYA 4A7CA 2PZRA 4EOIA 3UG2A 2QLQA 2Z04A 4YLJA 4LG4A 3ZU7A 3CY3A 4DAWA 2WFYA 3PPKA 3CPCA 5CU3A 2B9HA 5KX5F 1JKSA 3PXKA 4XV1A 4K11A 4K9YA 3D4QA 2ZDTA 5GHVA 4QMVA 4ANLA 3DBQA 3O51A 4DGGA 4EK4A 5LMKA 3JZFA 3G8DA 5LARA 2PVLA 4MXXA 2PMLX 3CEKA 3TL8A 4MV9A 4O7SA
chains in the Genus database with same CATH superfamily
1QPDA 4DEGA 3E7OA 4LOPA 3R9NA 3PE1A 2ZV9A 3IW6A 2GNFA 3WZUA 3RGFA 5L2SA 5BUIA 3KN5A 4C5CA 4AOJA 4BGQA 4EHZA 4EFEA 5DFPA 4QSHA 4FKGA 2C3IB 4C3PA 3HV7A 4L45A 4C34A 3W1FA 4LL0A 4FEVA 1XR1A 2ACXA 4ZY6A 1YHSA 3IDPA 3VC4A 4CGAA 5TKDA 3GCUA 4BRXA 4A07A 3AT3A 5AAEA 1ZMVA 3O50A 2VTSA 5AA9A 2HGXA 4IZYA 2XNMA 4K77A 3R71A 3PJ3A 4G17A 5HO8A 3VUIA 4IAIA 4QP7A 4C61A 4RLKA 1DM2A 1G3NA 3PXYA 4EHVA 1OKZA 1KE5A 2UW6A 4YR8A 3V8WA 3CGOA 2XNBA 3FL5A 1Y57A 4GG5A 4RSSA 3L8PA 3NVKI 2J0LA 5M56A 2C6KA 3SW4A 4MXOA 3MVJA 4AP7A 2YEXA 4CC6A 5KO1A 5EG3A 4LH7A 3WO1A 4ZTQA 3DK3A 5EOLA 2IW9A 4HN2A 4G9CA 3THBA 2X0GA 4DH7A 5FBOA 5CXZA 2W6NA 4IWXA 3BYMA 3C13A 3DBDA 2PU8A 2C30A 3NDMA 3OTVA 4BI0A 1LEZA 1NY3A 3QQMA 4FV7A 2W9FB 4ONAA 1TQMA 1U54A 2OXXA 4LUEA 2WTWA 5LCKA 5IF1A 1V9PA 3V4ZA 2IJMA 3B8RA 4YURA 2WTJA 3FHRA 3TKUA 2B55A 3UBDA 3E8CA 4FL2A 3MB6A 1UU7A 5CXHA 1Y6AA 2R3PA 3AOXA 1H27A 1H25A 1NT2A 3DBFA 3Q2JA 1Z5MA 4F0IA 3BU6A 3NUXA 2XARA 4ZTNA 4BCQA 4PMTA 4E4MA 2ONLC 3P08A 3RKBA 3H0ZA 4O4JF 2BAQA 4K18A 5FXQA 2W96B 4DG3E 3AMYA 4ACGA 3POZA 3KXNA 3U9CA 3RFCA 4M3QA 1I1KA 2UZEA 4R1YA 4QDEA 3NNWA 2VWIA 3KEXA 3OMVA 3QZHA 3RK5A 1J7LA 3DBCA 4OBOA 3RAKA 1WCCA 1OITA 4FSTA 3OUUA 2W5AA 5DHJA 3EQBA 4B4LA 4HQ6A 1PMNA 4GU6A 2C6LA 3BELA 3I7BA 3LWBA 1IR3A 3SA0A 5IH4A 3LXLA 3PG3A 5HU3A 3A62A 3KN6A 3UYYA 3PN1A 3MFUA 2ITYA 1WVYA 1ZXEA 4QP8A 3EB0A 1CKJA 5E8ZA 3R2BA 3PE2A 3CP9A 5HVKA 3T9EA 3FLSA 1TAEA 2FP4B 3QGYA 1JQHA 1W98A 1H0WA 2FSLX 3FSFA 3MB7A 4TXCA 5FEDA 3DKGA 4BCPA 4YTCA 2C00A 3AW8A 3RPRA 3GCPA 3AMAA 3GCVA 3OS3A 3EL7A 4FG7A 2GHLA 1V0OA 4EEVA 3MA3A 3PVWA 2B9JA 4QMWA 4YTHA 3S00A 3K3PA 3EN5A 4B8MA 4DEHA 1NXKA 3RWQA 5LVLA 4MV3A 1O6YA 2BPMA 4X2FA 4G5JA 1M14A 5FPOA 4NT4A 4E8AA 2WTVA 3BQCA 1YQJA 3PJ8A 5AV4A 4BDGA 5EI6A 4Z7GA 5EKNA 4IZOA 1PYEA 4EH8A 4DEEA 4L3JA 2VWBA 5AUUA 2FPGB 1E1VA 3LMGA 2W6MA 4E5WA 4HYIA 1M52A 2Y6OA 3PY3A 2O64A 5I4NA 3ZEPA 3QQGA 4EEQA 5DT3A 3D9VA 5EM8A 3W18A 4UCRA 2ITPA 3IGOA 3ZXZA 1E9HA 4F63A 2YIWA 4GFGA 3F5XA 2UZOA 3NZ0A 4I92A 5H2UA 3ODYX 3GQIA 2CNUA 1BXRA 2VX0A 5E4HA 4HOKA 3W2CA 4BI2A 2ITXA 1ZYDA 1F5QA 3QD4A 4PTGA 4CC5A 2PL0A 2J50A 1SVHA 2WB8A 2XM8A 4IE9A 4J53A 4EOQA 5JQWA 4OTDA 3WBLA 2GHMA 4KRCA 2FSOX 4H3BA 3RCDA 3R8ZA 3EQRA 2OH0E 2BR1A 3LFEA 4JG7A 2RGPA 3HA8A 4WSYA 5AAFA 5TF9A 3OBJA 4MYGA 3LPBA 1IOVA 5EFQA 4I5PA 3IDBA 5FQDC 4DEIA 4AW1A 3QA8A 2HZNA 5A4LA 3L9LA 5BWWA 2ZDQA 4FFNA 4Y5QA 5DBXA 4WNKA 4EH2A 1PMVA 2J5FA 4B99A 5JQ5A 1I2KA 4ZY4A 3VS0A 4O6EA 3QHWA 4O83A 4UWCA 5IUIA 4YLLA 4F7JA 5LXMA 4AZEA 4HW7A 5EW9A 2E9UA 4CMFA 2QR8A 2JKKA 3U6HA 4EONA 1I1MA 4QP6A 4OW8A 1OB3A 3IOPA 4B0GA 4DFBA 4EOSA 1CQIB 3U4UA 2IWIA 4AN9A 2CHLA 2CPKE 3A7JA 4HGEA 3OWJA 3UNJA 2CFMA 1Y91A 4FKTA 4MD9E 4MVFA 3RNIA 2BHEA 4E4NA 3GEQA 3EFKA 3GU4A 3Q6UA 3RV4A 3T9AA 5JK3A 2CKOA 2OLCA 4C62A 3LP8A 4WBNF 3UC4A 3V5TA 1Z2OX 1W96A 2OWBA 5DNRA 3ZRMA 2VWXA 2YHVA 1F0QA 1JLLB 2X7OA 2H8HA 4DG0E 4EJ7A 2C4GA 5DE2A 4QYEA 1UKHA 3VHKA 3NW5A 3KRJA 2XK4A 4EOMA 3LFSA 2CLQA 1XK5A 2A0CX 2VN9A 4BCFA 3HECA 2EJ0A 4WT6A 5CI6A 4CLJA 2PULA 1PXOA 2YWVA 5KMNA 3F3VA 4G16A 3BE9A 4CT2A 4FNYA 4JAIA 1WBWA 2RG5A 3GC0A 4EHGA 2OSCA 4YJPA 4D4VA 4JDJA 4UYAA 3ZS5A 3ODZX 4FTJA 2Z7RA 3LAUA 1JBPE 4B9DA 4DLIA 4GU9A 2CGVA 2X4FA 5ANGA 4FMQA 4FTIA 2O2UA 3UTOA 3A4PA 3MJFA 1PRYA 3D83A 4KD1A 5LXTF 3F5GA 2X5RA 4FZ6A 5EH0A 4FIFA 4FTAA 1O9UA 4LGGA 1W84A 3H30A 4I24A 4DDGA 4EH6A 3SGIA 4DFNA 1KEEA 4AU8A 3I4BA 1M2PA 1YHWA 1W82A 3OOMA 3FMEA 2QNJA 3LFNA 4YZDA 5L8JA 4AFJA 3A4OX 4MQ2A 5FEEA 1XH5A 4BYIA 4MBLA 2CGWA 2XNNA 3ORPA 3OWLA 3HDMA 1RQQA 1XJDA 4I6BA 1DV2A 1PY5A 4QQ5A 4H39A 4AGWA 3RR5A 2Z2WA 3KMUA 4RJ6A 4XX9A 5FXRA 3DXNA 2HIXA 5IU2A 2P0AA 1OBGA 5I9ZA 3ETJA 3TDVA 4C5AA 3D7TA 3NFGB 4WBBB 1ZYSA 5CU0A 2QHMA 3DLSA 2HGWA 3JR1A 4EQMA 3KAKA 1HCKA 2W17A 5IQFA 4UCOA 5AUTA 4NM7A 1WVWA 2ETKA 1OIQA 3RWPA 5M55A 3VUKA 4ZS0A 4RX5A 2A4LA 2V5QA 2UVXA 5AP0A 4MF1A 2I1MA 3TWJA 1WRVA 4F9BA 5FPRA 3W2PA 1O6LA 2XK9A 3FYKX 5HV6A 3FDNA 2F9GA 1EUCB 2QURA 3T9DA 4FKVA 4IHPA 1W0XC 4PMMA 2YIYA 3V04A 4AZVA 4DFUA 4O96A 1MUOA 3UZPA 1L8TA 5GNKA 2VNWA 3QQKA 3TTIA 3BLHA 2UZBA 4IWDA 4N57A 3G9NA 5TR6A 3I81A 1ULZA 5CF8A 3SE7A 3HP5A 3V5PA 2BDWA 3GNIB 3U6IA 4D28A 4UWYA 3NEWA 4XEYA 5DA3A 3PIYA 3LFCA 4KBKA 5BYLA 3VQHA 2FA2A 2ETMA 4FEUA 2UV2A 4X3FB 4IAZA 4YC6A 4D4SA 2VO3A 1Q8YA 1HCLA 1OGUA 2C3KA 2PWLA 1A48A 4F4PA 1VBGA 3P0MA 4Q5HA 2C5OA 2V7AA 2WQNA 3BQRA 1KJQA 4LH6A 3DJ5A 5F95A 4FNZA 2FSTX 3KK8A 4GK3A 4ZOGA 3SG8A 4ASXA 1JSUA 3O8TA 3SOAA 5JH6A 3KF7A 5EM6A 5I9YA 4PP7A 3W0RA 2WTKB 5HHWA 2PVRA 4YHFA 4S32A 3MJ1A 4XUFA 3E93A 2WQEA 4RIOA 4MHAA 4BIEA 4JMQA 5CEIA 2CGUA 4YAJB 3R02A 3W10A 2V0DA 3E92A 3QQHA 2PUNA 2PVYA 3UPZA 3NMUF 4GFMA 4P5ZA 5FTGA 2YN8A 3NYNA 4O7ZA 1FPUA 2WQOA 3L9MA 2DS1A 3EJ1A 4J71A 1URCA 3PIXA 3TI1A 4IIJF 1Q8WA 1GLVA 3VUMA 4L8MA 5HE3A 5EQYA 3L8SA 4G9RA 2VO7A 1I2LA 4EC9A 3NAXA 1JWHA 2WMSA 3Q6WA 4PY1A 4U6RA 3V01A 5CENA 4YZBA 2WU7A 3BU3A 4MTAA 3O2MA 2ITWA 2C0TA 4X2JA 5ANJA 4AN2A 4FSYA 4O0XA 1AUXA 2PZIA 3FC2A 2HW7A 4FIHA 5CVGA 4WA9A 3TIZA 4EK6A 5BYYA 3PFFA 2VWZA 4RFZA 4UXLA 4I6FA 2XNGA 4NCTC 3WYXA 5E92A 2ZOQA 4HPTE 2X8DA 3H3CA 4FU0A 5AX3A 4DT8A 2YS7A 3FZRA 5IUGA 4CFVA 4KKHA 3OY3A 5AV2A 4TWPA 4FSMA 4J98A 2WOUA 3C51A 1ZRZA 3P5KA 4MV4A 4DIMA 1CTPE 2QONA 3N8DA 5ANOA 5HX6A 4FVPA 4IBMA 4CNHA 4GLWA 3D5XA 5H9BA 5C1OA 3R2YA 1B38A 5HLWA 5GONF 1KOAA 3W1BA 4LQMA 4QOXA 2R0IA 3LJ1A 3WZKA 2Q0NA 5AP7A 4CFUA 2JDTA 3DF7A 4F7NA 3POOA 3MWDA 3EFLA 3U6JA 4FKOA 1P8LA 2BROA 3AD4A 3TIGA 1YOLA 4CKCA 2REIA 2VTJA 5GJDA 1VEBA 4WG5A 4OTQA 4CHIA 2Y4IB 4JNWA 4O81A 4YBJA 4RIWB 2ZDHA 4FFLA 3R8MA 4XYFA 4IB1A 2R3HA 2IN6A 4QP9A 3ZFYA 3LM5A 3QCQA 1H0VA 1KOBA 3ZSIA 1IOWA 5F4NA 4JX3A 3A99A 5H8GA 3TIYA 3PP0A 4CSVA 3SDJA 4D2RA 3LQ5A 1ST0A 2UW8A 3I5ZA 2W6OA 4OT5A 2PZPA 5AAGA 1VBHA 4HYUA 3JRXA 4O22A 4WUNA 5AM6A 3W16A 3ZOSA 4BHNA 4RVLA 1E4EA 5ETAA 3UQ8A 4QP3A 4FT9A 4HZRA 3C7QA 3LIJA 3VS6A 3WF5A 3RALA 4XG8A 1GOLA 2IW6A 5AP1A 3N4VA 3LVPA 2VO0A 4QMLA 5DI1A 3C4FA 4A9RA 4AXAA 5AP2A 4II5A 4L6QA 4BGGA 4DGNA 3KULA 3FI4A 4O6LA 4LRKA 5JZJA 4OR5A 5AX9A 5GIPE 1JDBB 5D11A 2EB3A 4YB8B 4E93A 3OF0A 4LYNA 5IA2A 2LAVA 3ZTXA 4FZ7A 3NBYB 3P78A 2J2IB 4M7IA 3DOGA 3K3IA 3UMXA 2WNTA 2QVSE 2XNPA 3ROCA 3FPMA 3HUCA 4MXCA 3MI9A 4N0SA 3W55A 5EI8A 1RJBA 4DCEA 4O0YA 4R3RA 4C3FA 3SG9A 3CQEA 5E8TA 4YNEA 2DQ7X 4PMPA 3P79A 3LMIA 4JG6A 2ZB1A 4K2RA 4C58A 2W1DA 2XNOA 3SXRA 4FG9A 3VPCA 4TYIA 2HY81 3PZHA 4MBIA 1A0IA 3FZTA 1BI8A 3QTIA 4V0GB 5TOZA 3U0GA 1H1PA 2G1TA 2R3OA 2VTPA 4H3PA 5ACKA 3ZO1A 3I1AA 2R86A 4FTMA 2YITA 4WG4A 2V7OA 4APPA 2PVHA 1FOTA 4ENXA 2ODTX 5HE2A 2JBOA 3R28A 1L3RE 4MKCA 4RQKA 4CQEA 2QO7A 5IMXA 4NUSA 3GU8A 3RTXA 4E6NA 4YBKA 5HI2A 5HVYA 4O0WA 3LMHA 4QPSA 4WKQA 5ANEA 3OXZA 3CQWA 3WZJA 4BDHA 5D1JA 3OP5A 5BVWA 1EH4A 2BMCA 4APCA 4EH7A 3MY5A 1JKLA 3GFEA 4QYHA 1CKNB 3OUNB 1C30A 1WBSA 4FOCA 4C4GA 1CM8A 3DDPA 3ZDUA 4RVKA 1R3CA 3ZH8A 3RM6A 1FMOE 4RVTA 5CSXA 3F88A 4I5CA 3T3UA 4AZTA 3AXWA 3AKLA 2Z7SA 4TZRA 4I6QA 4AN3A 5C4KA 4F65A 2C6DA 3NYOA 2XZSA 3UZRA 4U80A 4EOJA 3U9NA 4ZSGA 4K6ZA 4TWOA 5KKRC 4O0VA 2QF7A 4ZTLA 3E3PA 3GBZA 3QTSA 4U0IA 2J5EA 2PYWA 2XALA 3D5UA 1OM1A 2IW8A 3TG1A 5JKGA 5ANDA 2X2MA 2XEZA 3UVRA 3GQLA 3U4WA 5FR9A 2HHFB 3O17A 4UEUA 2QI8A 3UDSA 3AT4A 5J5SA 3HBLA 4WRGA 4JL9A 3BL9A 1M7QA 3LFFA 3NGAA 5FEQA 3UP7A 1MQBA 2PVKA 4PUZA 4DGMA 3OCTA 2NYAA 3PY0A 2VTQA 4U45A 4YMJA 4Z3VA 4RWIA 2HZIA 3OZ6A 5ANIA 4F99A 1T45A 3LFDA 1OBDA 3T9CA 5EHLA 1TA8A 2F2UA 2OFVA 5D1PA 4F9AA 2BCJA 3ANRA 5B2KA 2DABA 1P2AA 3Q4UA 4UV0A 4B6LA 3DXPA 3KFAA 3Q2MA 4O2AF 4O82A 1JAMA 2R3RA 3DV3A 3TUCA 4JT3A 2OJGA 3ALOA 1ZAOA 4BCGA 2E9VA 5FBNC 2HG8A 2BTSA 3QZFA 2HOGA 2QC6A 1OKVA 5EW8A 5IEYA 4IDTA 4WHXA 2Y4IC 4X3FA 3VW6A 1JKKA 2W1FA 2YABA 3AC3A 4BDDA 4PDYA 4ALUA 3DGKA 3VAPA 4R7BA 5IQBA 2F7XE 4X21A 3U55A 3VF9A 3BHTA 4AW0A 3FV8A 3BABA 3HLLA 2X9EA 3DK6A 1UV5A 4LFIA 2GNLA 5DR9A 3ALNA 3D2KA 5M4IA 4LV7A 4JBVA 4MUQA 4AXEA 5M4CA 4A9YA 2YCFA 2JGZA 2J0KA 4FZDB 1PXMA 2J0MB 4QPAA 5JN2A 4C7TA 3FQEA 4L46A 4UCVA 2UVZA 2GPHA 4GL9A 4YZ9A 5DYJA 4GK2A 2PVPA 4QMTA 5AMNA 3BI6A 4ZJJA 5E8VA 4ANBA 1KTAA 3KB7A 5IA1A 4D4RA 2BZKB 5EW3A 3LOKA 2VPQA 1IEPA 4OTHA 3TMOA 3BV2A 4QP1A 4ZSAA 3G6GA 2NO3A 2AUHA 1X8BA 2DWBA 3KREA 3MS9A 4DHFA 5CAQA 3TUDA 2I87A 4Z7HA 3BPRA 4F08A 4L43A 2ZJWA 3A7HA 4NJDA 1I7NA 3TY9A 3F3ZA 2QR7A 4V05A 5E90A 4PDPA 5CS6A 4BCHA 2YCSA 4Y73A 5IISA 2RIOA 3F7ZA 2C6OA 4UZDA 3CTQA 4A9TA 2OU7A 4O0SA 4MA5A 2IVUA 3ZRKA 4KRDA 4ZZMA 1YXSA 4YLKA 4OBPA 4F1OA 3QCYA 2VX1A 4QT1A 4ZLOA 3EWHA 4TNBA 3SC1A 5BYBA 5JGDA 4YJRA 3OROA 3QKKA 2F49A 5DOSA 1OUKA 2VZ6A 3EFJA 1NVSA 3Q53A 4P4CA 4RWJA 4AW2A 4AGDA 3HRFA 1YWVA 3FLWA 2UW5A 4FIIA 1U5RA 2XIXA 4TTHB 3IKAA 4RQVA 3EN4A 4DG2E 1GIIA 2XM9A 5D1OB 3W8LA 4DGOA 4XP0A 2WPAA 4GCJA 3ZMMA 3FBVA 2XBAA 4O4IF 1VKZA 2GLTA 3OFMA 3RM7A 3K3JA 2W1CA 4FEWA 2B7AA 5KHWA 5CTPA 1YI4A 4U41A 2QODA 2WTIA 4ITHA 3QTZA 1KWPA 4XLIA 1B6RA 3WF8A 5BWTA 3EQHA 4CG8A 2OG8A 1GZ8A 4JDIA 2QOQA 4QMYA 4QMUA 1VJYA 3WF6A 3SHEA 2HWPA 1YW2A 2W06A 5CALA 2UVYA 3R7IA 3QLFA 3EN9A 4RBLA 1WAKA 4ZQIA 2YM5A 1H07A 3FY0A 4CG9A 5LOHA 5AM7A 2WMVA 1Z2NX 4PBCA 3KAJA 3SNOA 5KS8A 4FTLA 1Z57A 4BZOA 1XO2B 3QTUA 3II5A 4E6CA 4IB3A 3V5LA 5I5TA 1YOMA 3ORIA 4QMQA 3AC5A 1WBNA 2JFMA 3PXFA 2R0UA 2QQ7A 3FMMA 3Q04A 4ITJA 2QOCA 4FV6A 1IRKA 4XV9A 3VJNA 4BBFA 4UFZA 4TKSA 3W2OA 5EM5A 2NPQA 5E8WA 4O0TA 2PE0A 5CU2A 2JDRA 3JVRA 2R3QA 4ALVA 4D0XA 3WZEA 2W4JA 1UKIA 1H08A 3PDTA 4I0TA 2R3LA 3UDBA 3M1SA 2OF4A 3LLTA 1REKA 2YFXA 5J87A 1IAJA 3VRZA 3W8QA 5BVOA 4R6VA 1SYKA 4TVIA 4H36A 4EHEA 2UW4A 4FUXA 1PK8A 2PN1A 4M9UA 4MAOA 3QXPA 3RUPA 1DAYA 2YERA 3I6UA 5HKMA 3KXXA 2BKKA 3PXQA 4M13A 4TT7A 3CD3A 1PKDA 5FP5A 4NTSA 5HIBA 3TNWA 3ZFXA 5L3AA 4DAAA 3D5VA 1ZARA 4D1SA 5F94A 3SW7A 5K3WA 4IVCA 3CLYA 2XMYA 3LFBA 3NR9A 3HP2A 1DI8A 3R7VA 4RGJA 4BJJA 4QYYA 3UP2A 4D0WA 4O86A 3OG7A 3WE8A 4KWPA 4O7RA 4PTCA 1IASA 3KF4A 4CZUA 4Q9ZA 4EWQA 5HE0A 4QTBA 3N6RA 3AC1A 5BPHA 4AQCA 4PRJA 3W2SA 3QD2B 3F3WA 2C3LA 2UZWE 2YIXA 4PL3A 2QOHA 2XIYA 2PVJA 3ZONA 3HA6A 2GFCA 3R1NA 3NYVA 1EUDB 4DCAA 4K8AA 2UZNA 4RG0A 3GXLA 1PW2A 2OJFE 5IDNA 3F2RA 4O27B 4EQCA 4XYLB 3C0GA 3VONA 4IJPA 1KJIA 2GQRA 3LXPA 2B1PA 3V4SA 4IZAA 4FIEA 5LJJA 4I4FA 3QQFA 1EYZA 4BIDA 3ERKA 3MWUA 4F09A 5F9EA 2DWCA 4DRFA 3BAAA 4CEGA 4QMOA 4CMTA 4IANA 3BU5A 4GJ3A 4GUEA 4C36A 4KS8A 4WBOA 5IMEA 4IWQA 2XKFA 2FPPB 4M8TA 2CN8A 4S31A 3ZC5A 1KBLA 4F64A 3Q9XA 2Y7JA 5E25A 3PSCA 2ITUA 3IECA 4UCTA 4XG3A 4G6LA 4E20A 1UVRA 4NWMA 4I6LA 2VTRA 4AX8A 3HRCA 2OKRA 2X81A 3UOLA 4MD8E 3NNXA 2QD9A 3H9OA 1YXTA 1CKPA 2P3GX 3P9JA 5C26A 3SXFA 3E5AA 1Z9XA 3TN8A 3TIIA 5BYAA 4I20A 4DH3A 5I5WA 4YUQA 2ZMCA 3BRBA 2JBPA 1YDTE 4IMYA 5D10A 5I5VA 4HNUA 2CCIA 4YJQA 5CNNA 3HV5A 4P7EA 2YZGA 3FMJA 1GZNA 2C5YA 3QAME 2IP4A 2R7LA 4FTQA 4G6OA 2IO6A 4PTEA 1OL2A 4A06A 1B6SA 1YRPA 4GSBA 1YXXA 3HKOA 3E64A 3EN6A 1R39A 3CGFA 1KE6A 4I93A 4NM3A 3EN7A 4MBJA 3TV6A 1AUVA 4BY9E 3RK7A 1A9XA 4U5JA 5JVDF 1YWNA 2Z8CA 3C50A 5KE0A 4BTFA 5BPYA 2BKZA 4FT7A 1PXKA 1OL1A 2YISA 4NKAA 4HNTA 1UA2A 4EZ7A 4YHTA 2RFDA 2YM3A 2JFLA 3K5VA 2FYSA 2OIQA 3EFWA 3I7CA 1YWRA 4GKHA 4QQCA 4TYHA 1KSWA 4DINA 3FL4A 2X9FA 3KU2A 5HU9A 3JSLA 5CA0F 3V5JA 1Q61A 4XG6A 1JKJB 1RDQE 4FI1A 4FK3A 4XRLA 1PMUA 3RPYA 4BCJA 3BBWA 4EZ3A 1UWJA 5HBJA 4NJ3A 2R3FA 5E8XA 3CTJA 5D1OA 5HGIA 5HLNA 4O4LF 5A6NA 3KC3A 5CI7A 3BL7A 5GJFA 3QFFA 4ORKA 1KE7A 2I0HA 1SNXA 4EZ5A 2UZVA 1JLUE 4IX5A 5DGHA 2OWOA 4CTBA 2OZOA 1UNHA 4HNFA 3DJ7A 3FYJX 4TNDA 3AX6A 4W4YA 1U5QA 3JPVA 4DEAA 2EWAA 4AW5A 4EH9A 3OC1A 2BFXA 4XP2A 1CS0A 3Q4ZA 2DIKA 3K5IA 5EYDA 2O8YA 3EZRA 4FTUA 4DFLA 4C4FA 3L9NA 3Q32A 1W93A 1QCFA 2C1BA 2W4OA 2W1GA 2P4IA 3NUAA 3KK9A 2GTMA 4AE9A 3LHJA 1W83A 1M7NA 5IQHA 3KXGA 2IZSA 4DC2A 4R3CA 3GOKA 3OVVA 2EXMA 5AUWA 2XJ0A 4U8ZA 4FG8A 4YJOA 3VBXA 4GUBA 5GINE 1UNGA 4K6NA 4FKLA 4MCVA 1IA9A 2FB9A 2UZLA 5CT0A 4EH5A 3OEZA 3OT8A 1M6VA 4M68A 3EL8A 2JKOA 4ZTRA 5EOBA 4JBQA 2XK7A 3JRWA 4GG7A 2E9PA 5M53A 4IQ6A 2JKQA 3VVHA 3EQCA 3TKHA 3HV3A 5LVOA 3QX4A 1U46A 2Q2TA 1J7IA 3DAAA 4AA0A 4DFYA 1OUYA 4FTNA 3VPDA 3JY9A 2R85A 4HZSA 2R3JA 2X7FA 2XK3A 5C1QB 5AADA 1Q3DA 2BHHA 3R04A 4DH1A 4I0SA 4O38A 3KRXA 3VS3A 4D1ZA 5AUVA 4YO4A 4XJ0A 4FGRA 4AACA 3MDYA 2XBJA 4KIPA 2R9SA 5ETFA 4EK3A 1CKOA 4MD7E 3W5OA 4AGCA 3PXZA 5DT4A 2QLUA 3V8SA 4B7TA 2B53A 4QTDA 4DTBA 2YAAA 5CEKA 1WMKA 3QUEA 4JAJA 4RX9A 1XKKA 3PP1A 5CZIA 1JNKA 4JRVA