2YZLA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
239
structure length
238
Chain Sequence
KLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 77
structure length 238
sequence length 239
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yzlA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzlA02
3AD4A 3ATSA 5KHWA 4TT7A 4LQMA 4R1YA 3TL8A 4EI4A 2BRBA 3MSSA 2R87A 4EL9A 4O2AF 2NUAB 2UW9A 4J71A 3CTJA 4APCA 3MJFA 2ONLC 3AT2A 3O50A 4J1RA 3VUIA 3ZSIA 3TUBA 4PDPA 4YGAA 3VW8A 5E7RA 1J91A 1O6LA 3CIKA 3OFMA 3UTOA 5TO8A 3C4EA 3EYGA 4F6SA 3QL8A 2VNYA 4CZTA 2O3PA 3QQHA 4P90A 3NUSA 1W93A 4G16A 5DRBA 3D4QA 2JBPA 3NPCA 4MV8A 3VBQA 2R3RA 1JWHA 3HMMA 4XV9A 4DBXA 3O8UA 2IN6A 4O0XA 2FPPB 3OXTA 5E8TA 4IAYA 3QRUA 4O0SA 4EBWA 3EKKA 4FKPA 3D2KA 5IMXA 5LWNA 2JDRA 2VTSA 3A60A 5A4EA 2ETMA 4CQEA 2CGWA 3RNIA 3K5IA 4O22A 3OZ6A 5AUYA 1H1RA 3FL5A 3PLAE 1P4OA 3FZTA 2VWIA 4IAZA 5A14A 2DWCA 1JDBB 3HDNA 4FIHA 4BDHA 5B2LA 4I4TF 1ZOGA 1SMHA 1XBBA 4EHEA 2J0KA 4CXAA 2QOCA 5HU3A 5LQFA 2GMXA 4I3ZA 3EFWA 3R9RA 3FMHA 4DH1A 4IWOA 5E1EA 2PMOX 1XBAA 4EOLA 5EDRA 4F7JA 2X1NA 5HEZA 3W1FA 3HV7A 2QOLA 2BZJA 4FVQA 2V58A 4YTCA 3PJ1A 2VWBA 4F4PA 2XM8A 4ACDA 3HO8A 4YUQA 3O51A 3JVSA 4WKQA 5I9WA 4QMQA 5CX9A 2ETRA 4KSPA 2ZV2A 3G33A 5JFSA 4YPDA 2I8CA 5TF9A 5HBJA 4G1WA 1UU7A 4S33A 5CXHA 2BHHA 1FOTA 5AM6A 1NVSA 4AF3A 3TNHA 4CT2A 3NWWA 4CKJA 4EH2A 1FINA 2QO2A 3L8VA 3RPOA 5IQIA 1YQJA 3E3BX 3D15A 3JR1A 3AXWA 2IZTA 1M52A 2XIYA 4GYIA 3I4BA 2VN9A 4JRVA 2VU3A 3DLSA 4W4XA 4I0RA 4QYFA 2W1HA 5F4NA 4ZI7F 4UBAA 4EK8A 2A19B 1E4EA 4NSTA 2Z2WA 2UW6A 3TZ8A 2OXXA 3FC2A 4G6OA 5CNOA 1GLVA 3QQFA 4L7FA 5HGIA 1OKWA 1YOMA 3IW4A 3FKOA 3IW5A 2I7QA 3D83A 2CKPA 4HNFA 4HVSA 4TPTA 2VO7A 2W05A 5LOVF 5T3QA 2R7IA 3PPZA 4LL0A 2OLSA 4EK4A 4IVDA 3E8CA 1JOWB 2R3KA 4O27B 3ZZWA 2BRHA 4PX6A 4BGQA 1SCUB 4GH2A 4DCAA 2NRYA 4FUYA 3TNQB 4EQCA 2G15A 1YXUA 4G3CA 2YERA 3GU5A 4L8MA 2QODA 5GNKA 3UPXA 2W6NA 5EQYA 2J9MA 2OF2A 4OT5A 5AP6A 4FTOA 4YZNA 3ZLYA 4DG2E 3QWKA 3PVWA 3OY1A 5IUIA 3WBLA 3CKWA 3UZPA 3RCJA 3R9DA 4C2VA 3NNWA 3UO4A 4FYNA 3W2RA 2QR8A 3UIXA 4DEGA 3OS3A 1UWJA 2C3LA 4M0YA 5HG9A 3B2WA 1W83A 3PWDA 2FB8A 3EQCA 4I94A 2CKEA 2OU7A 3RK9A 4QTDA 1PX2A 1H28A 2YFXA 3NR9A 4FV1A 3BYSA 1CKIA 2PTKA 3BZ3A 4Y72A 4FU0A 5H9BA 3R9NA 1OBGA 3DXQA 4HVGA 1H4LA 3FHRA 4FZDB 4JIKA 4BHZA 1OL7A 5HNIX 5LCJA 3PWYA 1YOLA 2QU6A 3JY9A 4J97A 2X8IA 2W96B 5G6VA 2Q83A 5CI7A 4YZMA 3QQGA 3VRZA 4IB5A 5HCZA 5ETAA 4FG9A 2XNNA 3FQEA 2RFDA 3I5NA 3GVUA 4I5PA 3V8TA 5EH0A 5EYDA 2J5FA 4G31A 2GFSA 3I7BA 5AWMA 2PHKA 2BDFA 3PXYA 4Y5QA 4ZIMA 3V51A 3GXLA 4LM5A 3RV4A 3DAKA 4IE9A 2CN8A 3IECA 2V7AA 3HMNA 4XP3A 1XBCA 2QC6A 4FTRA 3FQHA 4NFNA 1WMKA 3WNZA 1SNXA 5DIAA 3R2YA 3SQQA 4RFYA 2BR1A 1DAWA 3UOHA 5GONF 3ZFXA 4JDJA 1NVQA 3Q96A 3DU8A 2B1PA 1CDKA 4USDA 3IDCA 4YHFA 4AFEA 4D5HA 4FICA 1H08A 2W06A 5ICPA 4EQMA 1IOWA 3U54A 4I4FA 4TWCA 3R7EA 4E1ZA 4XOYA 3V5LA 3SGCA 3R23A 3EL7A 5HO8A 4PDSA 5CU6A 1UNGA 4CG8A 4YR8A 3GUBA 4MQ2A 4OLIA 4ANLA 4XYLB 2ONLA 3KB7A 4X6RA 2NP8A 4ZTLA 2WQNA 4G6LA 1V0BA 3UNKA 1Q5KA 2H96A 5M57A 2OFUA 4G2FA 3Q9XA 4LUDA 4V0GB 5E90A 2YIQA 4IIRA 3BHUA 3UVPA 4RJ4A 5KMMA 1GOLA 3BHVA 3FI4A 4DITA 3WI6A 1M0TA 2C5VA 2F7XE 4HYHA 2W9ZB 4FNWA 4IC8A 4WBBB 4AZVA 4JI9A 3I81A 1IAJA 4JX3A 4C4GA 5C8KA 2AC3A 2J2IB 4Z55A 4EQUA 3SOCA 4RMZA 3LQ8A 4E26A 2GNIA 3GCVA 3NMUF 3KRWA 4MNFA 5C4LA 2ZAZA 5I0BA 3KULB 1SM2A 4CV8A 5M53A 3RALA 3EN6A 3IW7A 3WIKA 3P7AA 1TKIA 3TM0A 5HLPA 3FMMA 2GTMA 2V7OA 3IG7A 5AX9A 5FBNC 3R2BA 5E92A 4EH6A 2BCJA 4FZAB 4BTFA 5IQEA 3MWUA 4MYGA 1MQ4A 4MV3A 5DOSA 1KJQA 3LJ0A 3FBVA 3E87A 2YA9A 4WNKA 4ZTNA 4DGGA 2Y9QA 2HZ4A 2B53A 3NLBA 4X3FC 4X3FB 4IX6A 3R7VA 4AACA 3KK8A 2CNUA 3V04A 5IG1A 3K5HA 4TXCA 1Q8UA 3EN4A 1WR2A 3L9PA 5EK7A 3RM7A 3F3UA 3L9MA 3ORTA 3QWJA 4YNEA 2IG7A 5L6OA 5K3YA 4D58A 1VYZA 4UX9A 1X8BA 3BHTA 3KFAA 1H07A 4CV9A 4K33A 3DK7A 1KE6A 3O7LB 3QCXA 4JR7A 3RWQA 2IW6A 5I5ZA 2CNVA 3AT4A 2HELA 3EWHA 4R6VA 2GQSA 3SG9A 5CAOA 3PIYA 3ENMA 2OH4A 1R3CA 3D5XA 3GOKA 3R28A 4FL1A 2ZDQA 5DVRA 2BRGA 3ZXZA 3TZ7A 3V4SA 3I0QA 4FNZA 3WE8A 2A2AA 3MW1A 4IVBA 2PE0A 4LRMA 3UBDA 3CKXA 5DN3A 2OICA 4FTCA 3H0ZA 4XZ3B 4KNBA 4RZQA 5AAEA 3OEFX 4FZ6A 4J7BA 1L8TA 3F3VA 4UEUA 2IW8A 3AT3A 5KO1A 3AC3A 3L8PA 4JAIA 1ZY5A 3TKUA 4DLIA 4G5JA 2R3MA 1XJDA 2WMXA 2BHEA 3VBXA 5FM3A 3UODA 3HNGA 4M12A 3ZSHA 4Y83A 1GIJA 1Q8ZA 4I6QA 4U41A 4FSMA 1ZOEA 2R3QA 2YCSA 4AW5A 4X2FA 1R39A 1ZMUA 4FSRA 4A07A 2WZJA 3A7JA 3N8DA 3P0MA 1FVVA 5F9EA 3NYXA 2JAMA 5IEXA 3AMAA 3R0TA 3ORPA 3PJ3A 4YSJA 3FMKA 1H01A 2XB7A 3BYOA 1E1VA 5AAFA 3SXFA 4L7SA 4P2KA 3R5XA 4E93A 2OJJA 3AC5A 1DI9A 5AP1A 3VAPA 2R7KA 5CAVA 4L3LA 1FGIA 4D0XA 3RPYA 1BI8A 5E8SA 3TV6A 4BC6A 2UVZA 3WF5A 4C5AA 4HCVA 3QA0A 4DINA 3FZRA 1U5RA 4QTAA 3UVRA 2YDIA 4DE4A 1GSOA 3LCSA 2YM4A 5AUUA 3C5IA 3O23A 1PMEA 3PIXA 3MY1A 3DB8A 4NU1A 2YM7A 5DEYA 3TNIA 4MD7E 4AW2A 3QXOA 4WHZA 5L8LA 4M13A 2E2BA 1WBPA 1Q8TA 2HZNA 4NL0A 5KKNB 5JK3A 4ZHQF 4YZCA 2WTJA 3OBJA 4C4EA 3F61A 4V04A 3RUPA 4IM2A 5AJQA 3NYVA 5FTQA 1DS5A 3VS4A 4G3EA 4WBNF 1ZYDA 4F0GA 2C3KA 4XH6A 4I0TA 2XCHA 4O7TA 5KBQA 3GFEA 4QMMA 2ERZE 3OWPA 1OL5A 2UV2A 4U97A 4AP7A 4CSVA 5JH6A 1CQIB 2VQDA 4J8NA 2F2CB 4RX5A 2HYYA 3CQUA 3U9TA 5HBHA 3EHAA 4KS7A 2FSOX 5CB4F 1NVRA 1P14A 1XH5A 3MJ1A 5J2TF 4BDCA 3UP2A 1YHWA 4GVJA 5BUIA 4TWOA 4HPTE 3LXLA 4FFOA 2PUIA 3QCYA 5CALA 4F09A 5DT3A 1GSHA 2OLCA 2QO9A 2YDJA 1JSTA 4AA5A 2BDJA 3GCQA 2GQGA 5HVYA 3VO3A 2UZVA 4BN1A 2C68A 2UZWE 2F9GA 1WVWA 4FI1A 1QL6A 3KMUA 3Q52A 5JMSA 5K5XA 2GNFA 4BHNA 5HX8A 3AMBA 3TW6A 4I0SA 2GS6A 2XS0A 4FK3A 4QYYA 2BKKA 5CF5A 2OO8X 4O0RA 4V0GA 2ZM1A 2C30A 3PRIA 2C0OA 1TVOA 4JOAA 5BPYA 4IX5A 2XCKA 5D8DA 1H27A 2XK8A 1PXJA 4JBQA 3V5QA 5HNBA 3N4TA 5KMKA 3IDPA 4JR3A 4QP7A 5FXQA 2E9VA 3KKVA 4QTEA 3O8PA 3RGFA 3DTCA 1YHSA 1A48A 2P4IA 3KRXA 5E4HA 4B99A 5IA2A 2FPIB 4DH5A 2W6ZA 4XYMB 4ZOLF 2CNQA 1JQHA 3VJNA 5LJJA 1OITA 2FP4B 4Q5EA 3MBLA 3JRXA 3CJFA 3QUPA 2O65A 3NUAA 4CMUA 3WZUA 4QMSA 4FTUA 3SW7A 3RK7A 2IZUA 3MPMA 1OL6A 3OF0A 2CGVA 1JAMA 3PY0A 4FKIA 5EM6A 3AC4A 2XK4A 5J9LA 2H34A 4OTQA 3UC3A 3VS6A 2ZV7A 1U54B 3JZFA 2EB2A 3MFTA 3NNXA 3KXGA 4HYSA 3SKCA 4GSBA 3VS2A 1UU3A 4QMVA 4QP9A 4UXQA 5CVHA 4B4LA 4BY9E 4UZDA 3F2RA 2Z7RA 3HKOA 4L43A 3R8ZA 5D11A 4I1ZA 4KRCA 5C27A 2YZNA 1PKGA 3TDVA 1GSAA 3MI9A 1URCA 4E6CA 3EN5A 4A7CA 4O2BF 2X6EA 4Y46A 4AGWA 3THBA 4APPA 2W70A 3PXZA 3VS0A 4BDAA 1G5SA 1ZOHA 4XV3A 3ETAA 3ORNA 4Q2AA 3HA8A 4QP4A 2R2PA 3FLQA 4L01A 4MNEB 1IASA 2YRWA 3VQHA 4F1MA 1J7UA 1JSVA 4QMYA 3OWJA 2VTQA 4XG8A 2BKZA 4R5SA 4OTWA 3QD4A 3OC1A 3PZEA 4U80A 3R9HA 4W4VA 4TL0A 3LFEA 2W1IA 4NTTA 5DA3A 2CSNA 3R7YA 3DNDA 4C02A 5CEOA 2C5YA 3FZ1A 4L3PA 1UKHA 1CM8A 4G3FA 4YC3A 1NW1A 3SXSA 2G2IA 2ZM3A 4WUAA 4B8LA 3VPBA 2PUNA 4EHVA 5IQFA 2ZMDA 3R1SA 3DPKA 1R1WA 3LFSA 4EWHA 3DKFA 5EI2A 1H1PA 2NNWB 3R8PA 4U0IA 2ITZA 3H0YA 3JY0A 4FSWA 4U42A 5ANGA 1NXKA 2DWBA 3FLZA 2P2HA 2XK3A 3FAAA 3QKKA 3UNJA 2CJMA 3EN7A 3VUKA 3WYYA 3T8OA 1UWHA 5LVNA 2AYPA 3CQWA 2QI8A 4DEIA 3UG1A 2PVKA 4TYGA 2B52A 5CI6A 3T9IA 2GU8A 2C5OA 4TYIA 4EKKA 2WEIA 4E4NA 3EQBA 3I0OA 2DS1A 3D94A 3QYZA 4AN3A 4C4FA 1CKJA 4LI5A 4EORA 5ETCA 3MPAA 3FL4A 3P7CA 2PVRA 3TTIA 2RG5A 3BIZA 4BGGA 4GW8A 3U4WA 3U6IA 3LCOA 2OF4A 3R63A 2QOHA 3P08A 2XNEA 3FY2A 5AUZA 5CA1F 2JDOA 4RPVA 3HDMA 4FTLA 5A4LA 3PXRA 2C5NA 2OFVA 3QZIA 4LOOA 4BDDA 4F7LA 2VWXA 5C26A 4EJ7A 5M56A 1FMOE 3F7ZA 4F7SA 4FKLA 2W0JA 4DTKA 3BBWA 3TZMA 3RI1A 5CQWA 4FR4A 4ZJVA 2WQBA 5EI8A 5IMEA 5M4FA 4RGJA 3HRFA 3CY3A 3ZRLA 4AE6A 3TT0A 4GFMA 3PP0A 4R7IA 4RWKA 1EYZA 1K9AA 3HECA 4O91A 3BV2A 4MA5A 1CQJB 2IZRA 3WO0A 4D4VA 4L68A 5C1PA 4AW0A 3W2OA 4EUUA 4H58A 4GT5A 2ZDUA 4K18A 3VIDA 3KRJA 1OUYA 4ARKA 4FFPA 5IUGA 5CEQA 4BGHA 1AUVA 3QRIA 5IA0A 5EOBA 2RL5A 3FXWA 1M0WA 1HCLA 4K1BA 2YHVA 4II5A 4CFXA 2J5EA 2OJ9A 2WMWA 4RQVA 4K6ZA 4U6RA 5IA4A 5M4CA 3D7TA 4BB4A 4D0WA 5A4TA 2QU5A 3AOXA 3BHYA 3G0EA 4UWBA 2W17A 3FLSA 2GQRA 5CSXA 3QA8A 2NU6B 1T45A 1R0PA 1JKJB 3RFCA 4FT3A 4UV0A 5AP0A 2WMUA 3ORIA 5KMOA 4F99A 1KBLA 2J0JA 2RG6A 3GC7A 1JLLB 1XH4A 2IW9A 2X7GA 1M2QA 4MXOA 3R02A 4JRNA 4YPSA 4FIEA 3DY7A 3AC2A 3EQDA 3H3CA 4N6YA 3GQLA 1KEEA 5BUJA 4JQEA 3BU3A 3E8EA 2YZMA 5FRIA 4JBOA 2UW0A 1Q3WA 5JEBA 2XYNA 4DIMA 3ZLSA 4JG6A 3WO1A 3R00A 4C61A 4DT9A 1K2PA 2PYWA 5BVFA 4DGNA 4RA4A 2C6TA 1V1KA 1WBTA 4BCJA 5GIOE 2XKEA 2R3OA 3ZXTA 1CSNA 4QMUA 3VUDA 3VUMA 4EOOA 5LWMA 2VTOA 5EYKA 1DV2A 5FUTA 4K2RA 4K8AA 2WHBA 2W1EA 2W1GA 1JBPE 2B0QA 3N51A 3P9JA 3NEWA 4RIWB 3W2QA 2IJMA 3HAMA 4KBCA 4M84A 5C8YF 5AUVA 4JDHA 3FQSA 3NCZA 4IADA 2OZOA 3EQFA 3VBVA 3BGZA 3B8RA 3ACKA 2QOOA 3D7ZA 5A46A 5CU0A 5DRDA 4FEUA 4QYHA 4NJDA 3RAHA 4QQTA 4IVAA 4U44A 2H6DA 3AD5A 4QP6A 3WARA 1KE8A 1U54A 1PYXA 2VUWA 4KIQA 3EIDA 1Q97A 2RFEA 2W1FA 4WNOA 1OMWA 2PVFA 3FI3A 4U79A 3F88A 3TDWA 3G8CA 4MV4A 4CMOA 2GS7A 5CVGA 4ZY6A 2C6MA 2R0UA 3ITZA 4FSUA 4ASDA 2YYAA 4XRLA 2REIA 2JKKA 4TRLA 4ANMA 2OH0E 3FYJX 2C6EA 4NM5A 4KKHA 4XLVA 2UZDA 3W2PA 1YDTE 2V22A 1J3HA 5L8KA 3ETHA 2ITYA 3LQ3A 4FV2A 3OD6X 4AGUA 5JFXA 4PQNA 1KC7A 3NRMA 5CAUA 4JX7A 2JEDA 1RQQA 2HZ0A 5CT0A 5HHWA 5K5NA 4I92A 2G1TA 4QPSA 4FV8A 4X0MA 3D2IA 3NVMB 3B8QA 4FODA 4N6ZA 1QPCA 4LMNA 5BVEA 2X39A 1ZY4A 4FSQA 3U6HA 3KU2A 4C37A 1UNLA 3C7QA 2XH5A 1YHVA 3CTQA 3KN5A 3UQCA 1SVHA 3H10A 4NW6A 1PXNA 1S9JA 3IPHA 4H3QA 2WO6A 4N70A 2OI4X 2BZHB 2ITUA 3DAJA 3GI3A 3QZFA 3FMEA 4FTJA 4AZSA 4D55A 4ORKA 5I9YA 1REJA 1W84A 4DFLA 4GRBA 4JJRA 3ZHPC 4EH9A 4FVRA 4AW1A 4S30A 1DM2A 4ZTSA 2PY3A 2RGPA 2Y6OA 1PXPA 4FKVA 2VTIA 3PXQA 5IQGA 3KCKA 3EFKA 1OVEA 2B9HA 4WG4A 1W82A 3LCKA 3OT8A 4XCUA 2E9OA 4HJOA 4UB7A 2BFYA 2WQOA 1F0QA 2X6DA 4O7ZA 5EHLA 3PP1A 4HNIA 2C47A 4FT5A 3KXHA 3ODZX 3Q04A 2ZOQA 4ZK5A 3G9NA 3VHKA 3NVKI 2JAVA 2GNHA 4PMMA 3ZUTA 3LFNA 2WTVA 3QAME 4ZLOA 1Q8YA 5A6OA 2YS7A 1B38A 3DOGA 5BMMA 4P7EA 3BU6A 1OKYA 4F7NA 2X2MA 3UIBA 5DYJA 3MDYA 4QTBA 4YTIA 5TT7A 4E5WA 4IIJF 3ZUVA 4B6LA 5L2IA 3R83A 3ZTXA 3WZJA 2XIKA 4FKSA 3DK3A 3QCQA 4TYEA 3TWJA 5JGAA 4GU6A 4RC4A 3EQHA 5FGKA 5H8GA 2XJ1A 3V4ZA 3DJ7A 4O0VA 1VJYA 3LMHA 4S34A 1W98A 1W96A 1U4DA 4QQ5A 3FMJA 2BMCA 2GHLA 3EB0A 2YISA 3LXKA 4FZ7A 3W8LA 5HTCA 3DT1A 4ENYA 3S95A 5BYYA 4C33A 5AUWA 5JQ5A 2PVLA 3BLQA 3ZBXA 3OUNB 2I0EA 4Z3VA 3C50A 4LGHA 4X21A 4RIXA 2RKUA 3ZUUA 4C35A 1ZXEA 4A9UA 1OECA 1PMVA 3A61A 2ZJWA 3NNUA 5AUXA 4YC8A 3QLGA 1YXSA 4NCTC 3PVGA 2F4JA 2JDSA 4V05A 2SRCA 4DG0E 1H24A 1CS0A 1Y8YA 4PV0A 2P3GX 3ETJA 3UOKA 2XNPA 2NPQA 3V5PA 1BI7A 2Z04A 1Z9XA 3O96A 4QOXA 4R3PA 1JSUA 3MH3A 4M69B 3ANQA 2QF7A 1ZZ2A 5J2UF 1KWPA 3ZLXA 2HXQA 2ITTA 3G2FA 4M68A 4NH1A 4XHKB 3TTJA 3MJ2A 2BZIB 4XUFA 4C2WA 4ZTMA 4ENXA 3VQUA 2QLUA 4U3ZA 5KHXA 3GCUA 2F7EE 2UZTA 3LVPA 4IBMA 5BVWA 5IQDA 2BAQA 2JGZA 3D5UA 3Q53A 3H9FA 2G2HA 5DG5A 3KMWA 5CANA 4USFA 2R7MA 4BYJA 5TOZA 3LMGA 4WG3A 4WRGA 3KMMA 3R73A 2GTNA 3E8NA 3AMYA 4GU9A 2YZLA 4RX8A 4DT8A 2C5XA 2HENA 3MVHA 3F3ZA 3V5TA 2YRXA 3R5FA 3FXXA 4HZRA 3KF7A 5DT4A 4CRLA 2QLQA 4D2RA 2CGUA 2YL2A 3M1SA 2VNWA 3G8DA 5JVLA 5HICA 4IX4A 4XS2A 2LAVA 4BDFA 4M67A 3F3WA 4M7IA 2W9FB 3SVVA 1H1QA 3WE4A 4BBMA 3HZTA 4ACHA 5LA6F 1ZMVA 2X81A 4RVKA 4XOZA 5KE0A 4WO5A 2I6LA 3NIZA 3MESA 2FGIA 1H26A 1M17A 4KIPA 3QHRA 4YJNA 2WTDA 4GJ3A 4QQJA 3PLSA 4O0YA 1TQMA 1GAGA 2VD5A 3KGAA 4FKJA 3ZFYA 5LOHA 5IDPA 3DBCA 4E4TA 4XRJA 4CFMA 3QRJA 2WMTA 3P4KA 3W55A 5CTPA 5F20A 2ERKA 4DFXE 4PMPA 3PY1A 4ACGA 4RIWA 4XX0B 4NM0A 4WUNA 5LCKA 5M06A 3FC1X 2HCKA 2I40A 4FT9A 4CNHA 4E5AX 2UW7A 5C8MA 4FUXA 4UYNA 4AE9A 2PE2A 4D5KA 2CLQA 3ACJA 1OUKA 1JKSA 3I79A 3DS6A 3MY5A 4TNBA 5E91A 5L6WL 5LMAA 4GUEA 2R5TA 3EOCA 4KKEA 3FPQA 4YBZB 3QD2B 4MXYA 4YJQA 1KV1A 1WBVA 3OWLA 1J1CA 2H9VA 3GEQA 1WVXA 4GYGA 3RKBA 3COMA 4W8EA 3IONA 4IDTA 3SD0A 3V6RA 2FO0A 4DBNA 3TIIA 2CCHA 4W8DA 4RVTA 3FY0A 2YCFA 3OUKA 3VRYA 5FXRA 4XJ0A 3A4OX 4BCHA 1BL6A 1W7HA 1WVYA 4M9UA 4DGOA 3C51A 4XG9A 2RFSA 2WU7A 5J8IA 4USEA 5FNVF 1I7NA 3IOPA 3SRVA 4TWPA 4WRSA 4AXAA 1Z2NX 1ZYCA 2JDVA 3FLWA 4FOCA 3E5NA 3K5VA 4Q9SA 2EB3A 4U40A 5ANJA 3WOWA 2QOIA 3RAWA 3OCSA 4JT3A 3A7HA 3CBLA 4NKSA 1R0EA 4FE2A 3AW8A 4FFMA 2R0IA 1G8AA 5IQBA 3KREA 4ZS0A 5BYLA 3EQIA 2VWWA 3LP8A 1IEPA 3G15A 5HIDA 4F9AA 1FPUA 2OIQA 5I9ZA 2F57A 2XK6A 1BNCA 1H0VA 4RZVA 4OUCA 3UJGA 4ZTRA 3A7GA 4BYIA 5HIEA 2YW2A 4RA5A 3QTXA 4DA5A 1ZWSA 2QG7A 3Q32A 3R01A 4GKHA 2RF9A 4GJ2A 5HG7A 2ZB1A 4ALUA 4BCGA 3ODYX 4KBKA 5FTGA 5JGDA 1LPUA 2R3FA 4E4LA 4EOIA 4RLLA 4F9WA 5IU2A 4RSSA 4KB8A 3RMFA 1BX6A 4EH5A 3ULZA 3I5ZA 5A6NA 5HZNA 3KEXA 2ITVA 3VS1A 5LMKC 3ULIA 5FD2A 1KV2A 3OT3A 5F1ZA 3PA3A 2NU8B 3D9VA 5IPJA 2WMVA 3NGAA 4RJ6A 3FLNC 4LYNA 2RIOA 4MXAA 2HIWA 1ZZLA 3SE7A 2Z02A 2EXMA 3G90X 3MPTA 4ANBA 4DTAA 1KJ8A 3C0IA 1IA8A 2Z8CA 2VWVA 2XKCA 3DGKA 3M2WA 3PE1A 3GENA 4NWMA 4QYEA 2KULA 4RJ3A 5D9HA 3W18A 3DFCB 4JXFA 4A9RA 1Q8WA 3EKNA 3CD8A 3EZVA 1BMKA 2IZSA 4QP2A 3SX9A 1GZ8A 4TV9F 4J8MA 3RWPA 3MA6A 2FYSA 5KCVA 4BCPA 4MD8E 3RZBA 3K2LA 3BQCA 4RVLA 2P33A 3QX4A 2NU9B 3Q4UA 4DHFA 3RHXA 1PXOA 4S31A 3FZOA 4EOJA 5CEPA 1Q61A 3VJOA 2R7NA 3ORLA 3W8QA 4Z7GA 4ZQIA 4C4JA 2R3GA 3SC1A 4MK0A 4XG4A 4TZRA 2VX1A 2O0UA 3R9OA 2PVHA 4FNYA 5GIPE 4TV8F 4JS8A 4NCTA 3DXNA 3UMWA 4ZMEA 1DIKA 4EKLA 3I7CA 4PUZA 3NUPA 1MP8A 3MFUA 2WTIA 5CU4A 4NZWB 4MV7A 5BPHA 4M14A 4MCVA 3RPVA 3QU0A 4FEWA 2OJIA 2EU9A 4PMSA 1W8CA 2YM5A 3Q4TA 2X2KA 4ZSJA 4C4IA 4D28A 2J0MB 2VO3A 2W6MA 2YAKA 3TG1A 4NT4A 4W4WA 5IH4A 3Q4ZA 3W2CA 2VWUA 4JQ7A 3IQ7A 5BPFA 4AGCA 5J7HA 4O7LA 1GZNA 3CGFA 5LVLA 4FVPA 4IHPA 2O2UA 3WF9A 4E4MA 4FIFA 1Y8GA 1GIHA 3E92A 3HGKA 4L67A 2EXCX 4ITJA 4ITHA 4CZUA 3QALE 3NYOA 4GUBA 2IVUA 1WBOA 4HOKA 3EQPA 2BFXA 2I1MA 4B7TA 3CY2A 2E9UA 3NDMA 4XBUA 4BCIA 1TQIA 3QTUA 4FEXA 5HBEA 3VW6A 5L2SA 4IZYA 2J0LA 2QHMA 1Q62A 3CTHA 3PZHA 4F0IA 2XCLA 3H30A 2AC5A 4RJ5A 4E73A 4O4LF 4GVAA 5JFWA 3UIMA 1VR2A 1J7LA 3AGLA 3DA6A 4F6WA 5B2KA 1B6CB 1Z5MA 2FA2A 3BEAA 4K11A 4AA0A 3SLSA 1YXTA 2C6OA 2ZMCA 4O2ZA 4H36A 4Y8DA 4HVIA 5CASA 4KAOA 2XMYA 2YABA 3ZM9A 3PVUA 3CE3A 4QT1A 2O8YA 5E8WA 4C5CA 4IWDA 3VULA 3S00A 1IAHA 4IZ5A 4UALA 5HIBA 4ZXTA 3TNPC 4PP7A 3SXRA 4FV4A 3N4VA 4NFMA 2VR1A 3F5XA 5JH7F 3TJCA 1YXVA 3MVLA 5DLSA 4HQ6A 3PJCA 1H8FA 1ZYJA 3S1HA 4JLCA 2I87A 4LL5A 2XNGA 3DV3A 3F2NA 3LZBA 3CS9A 3RP9A 3ZMMA 4H05A 4RZWA 3QZHA 1EHIA 4EK3A 1YI6A 3OTUA 1SZMA 4KRDA 4TKSA 3QGYA 3OP5A 3HV5A 4FGBA 4HZSA 4IM3A 4O0UA 4IW0A 3G0FA 5L8JA 4C3PA 2W6PA 1FVTA 3DQXA 5IEVA 3KA0A 3LXNA 5CVFA 3LFAA 1LEWA 3F5GA 3MIYA 3GT8A 2WELA 3KXMA 4RWLA 4NIFB 1CKPA 2OXYA 4IH8A 3V5JA 1YW2A 4FTNA 2VTMA 3I6UA 4HGLA 4QRCA 4MH7A 1PYEA 3C4FA 4O7WA 4D1SA 2ITXA 4F9CA 2CN5A 4FTIA 2IVVA 5EM5A 3N9XA 4XNEA 4WT6A 5AX3A 2ZV9A 2P0AA 4EOPA 2X4FA 4OT6A 3RM6A 5M4IA 5IH6A 4V01A 4AX8A 4BKJA 3DF7A 4Z7HA 1Q24A 1Z57A 4IAFA 2OSCA 2XK9A 2BUJA 4FSYA 5GHVA 3D7TB 1L3RE 4BI1A 4ERKA 3F5PA 2CZGA 1OB3A 2HWOA 2Z60A 4FKTA 4R78A 4PDYA 3ZO1A 5K9IA 2CMWA 3TV7A 3I12A 2A0CX 3ORZA 5HVKA 3TUCA 3CCNA 4PP9A 1GIIA 4KSQA 2QOBA 4IX3A 3UYTA 2FUMA 5LYJF 2GNJA 4OW8A 3LQ5A 4MXZA 2PBZA 4CCUA 3GC8A 3OXZA 4AAAA 4IWQA 3ZO3A 5FM2A 1IR3A 4FZFB 4PTEA 5JT2A 5LMKA 4X6QC 3DKOA 3ZU7A 3FXZA 1YOJA 3NAYA 3Q5ZA 5IH5A 4PF4A 4BBEA 2QK4A 4DFYA 3D14A 4DN5A 5ANOA 4GFGA 4U81A 1EUCB 1AGWA 2F49A 2XNOA 3BRBA 4IFGA 4RIOA 5KNJA 3Q6UA 1XH8A 2NRUA 2WMAA 3DLZA 4BZNA 4CRSA 4YZDA 4CVAA 4YJTA 4OTDA 5DEWA 4EK5A 4YLLA 1VKZA 3BE9A 1JKKA 3PRFA 3NX8A 5M07A 2CCIA 4IEBA 5I4NA 5AV2A 4XYFA 4A4LA 4MQ1A 4PNKA 3ATTA 4FG7A 2J51A 4N0SA 4ACMA 2PZ5A 3PE2A 2BRNA 2ZDHA 3FI2A 5LP6F 3VF9A 4PL4A 5CZHA 1OIYA 1REKA 3JPVA 4G17A 5FQDC 5D1JA 4BDBA 3QTZA 3W16A 2R3IA 2XF0A 4H39A 4GG5A 2UZEA 2Y8OA 1XH6A 4WSYA 4YAKB 2V55A 1O6YA 5EI6A 5JGBA 5AFVA 4EK6A 5HD4A 4RJ8A 5HI2A 5DHJA 5IF1A 3IKAA 3TIZA 3LFBA 4PMTA 3KAKA 3Q9YA 5I9XA 1S9IA 2BROA 5C1QB 3F2AA 2PVPA 3F82A 3QC4A 1VZOA 4XG6A 2VX3A 3QRTA 3QD0A 4OBQA 4Q5HA 3R8LA 3OW4A 3SG8A 3TACA 4AOIA 3Q9WA 4OTHA 3L8XA 2X7OA 4I20A 1P4FA 4YJVA 3C1XA 4NTSA 4ZLYA 1R78A 4NM7A 2QR7A 2WQMA 4C0TA 4D4SA 4MVFA 5ANDA 2AUHA 3DKGA 3SV0A 2C4GA 3JUHA 3DTWA 4NK9A 4CFUA 4KD1A 1XWSA 2WXVA 4P5ZA 1AUXA 4NJ3A 5LVOA 5J1WA 2BVAA 3H9OA 3II5A 4O96A 3R7OA 3ENHA 4IJ9A 4PDOA 3QGWA 4C5BA 3ROCA 3UZTA 2WYOA 1ATPE 3UP7A 2Y4IC 2HWPA 2CPKE 2Y4IB 3FSFA 3O71A 4MBIA 1I7LA 4QMTA 2OKRA 3LM0A 2UW8A 4ASEA 4AZTA 2KTYA 3KVXA 3L1SA 5HQ0A 4FV6A 4ASXA 3WYXA 4LOQA 1OKZA 1XH7A 3VWAA 3QTQA 5CU2A 1IG1A 5EW3A 1OIQA 3C4XA 3KXZA 2YJSA 3WZEA 4GFOA 1BL7A 2W71A 4YJ3F 5HCYA 4DLJA 4AQCA 4ALVA 4F70A 2B7AA 3V8WA 4IB3A 1BUHA 4C34A 4YZ9A 2ACXA 2UW5A 2OXDA 2F7ZE 2QOQA 4KABA 2XJ0A 4MEDA 4IMYA 3MH0A 5HE0A 4EHGA 1GZOA 3P79A 3Q60A 3QF9A 4IZOA 4CG9A 3F6XA 4K9YA 2WTCA 4MXXA 4WBOA 3SDJA 4FIIA 4O7YA 4I6FA 4O83A 3BYMA 4PWNA 2IPXA 2GFCA 3O8TA 2VO0A 4DYMA 1M6VA 3HBLA 2PL0A 3H9RA 4UWYA 4BTJA 4C59A 2QVSE 3F5UA 2JITA 3PYYA 4M8TA 1RJBA 3KY2A 1YWNA 5L2WA 1PK8A 3R8UA 3GU4A 4FV3A 5JKGA 3ZDUA 3OWKA 3RAIA 2W5HA 3HV3A 4PTGA 4X3JA 3TJDA 2QCSA 2JD5A 2BIYA 3OOMA 4ZY4A 4RIXB 3GBZA 2VPQA 3FSKA 5AV4A 1Y6AA 2QOFA 3LPBA 5KZ0A 3GLKA 4HNTA 4QMZA 4N57A 5EQPA 3KVWA 3LFDA 4AUAA 5JN2A 2Z7QA 5HX6A 5CF6A 2HGSA 2YIWA 2J6MA 1J7IA 3PFQA 3QD3A 3W2SA 2VGPA 4FV7A 3LAUA 5CT7A 4WG5A 3OUZA 1V0OA 1LUFA 2XBAA 5J1VA 4ANSA 4RG0A 3VOTA 4N4SA 4FL2A 4GS6A 4U43A 3P1AA 5KMIA 5A9UA 4O21A 1A9UA 3MVMA 2B55A 4GKIA 2UUEA 3DNEA 4J53A 4OTFA 3R8MA 5ACBC 2XYUA 5JQGF 4NKAA 5HD7A 5DBXA 5KMJA 2R9SA 2JIUA 3LW0A 2C3JA 1E1XA 2UZOA 3E7VA 4BZOA 4E4XA 2BDWA 4EH8A 1WFCA 3W10A 5LVPA 1PXLA 3JS2A 3OXIA 1B6RA 3VPCA 4JAJA 3E88A 4X2GA 4I24A 2UW3A 2YM8A 1UKIA 2VTTA 4DF3A 2XJ2A 3D0EA 4ITIA 3Q2OA 3QTWA 4R1VA 2PULA 4TY1A 5AV1A 4U5JA 2J7TA 4D4YA 4F64A 1I09A 3K3IA 5F94A 4FT7A 3ORMA 2VTRA 3KQ7A 4FSTA 4M97A 4NM3A 5FXSA 4A9TA 2OIBA 2PK9A 3HYHA 3LLTA 4F9YA 1M2RA 3LM5A 4BCOA 4UWCA 3FKNA 4BBFA 2VTNA 4IZ7A 1PXIA 1Q3DA 1Y57A 3OROA 3SAYA 2HJWA 2OG8A 2I0VA 3UVQA 2WNTA 1VEBA 5CEMA 4WIHA 4L45A 3DBQA 2ITQA 4I22A 2W5AA 2WU6A 3G9LX 3RPSA 3VBYA 4FTMA 2PMIA 2GDOA 1NT2A 3FV8A 4GK3A 5EYMA 4QQCA 4BIBA 3BGQA 4D9UA 1YI3A 3E7OA 4HPUE 4L42A 4FV9A 4FG8A 2X8EA 4BIDA 4BTMA 3PTGA 2Y7JA 4RQKA 1YXXA 3AGMA 5BMSA 3IGGA 3KC3A 4QMPA 4E6AA 1VBGA 1GJOA 3COIA 4RFZA 4U45A 4UXLA 4BDJA 1BYGA 3DBDA 4R77A 4CEGA 3QTIA 3PY3A 1QPDA 3UZRA 2R3PA 2X4ZA 3GGFA 5DH3A 3ZZEA 3TIGA 3F66A 4FGRA 1LR4A 3AG9A 1BKXA 3W32A 4CFWA 4PRJA 5CF8A 5FEEA 3FEGA 3HB9A 4LFIA 4M15A 3TIYA 4IAKA 1OI9A 1KJJA 4XG3A 5E8YA 3IW6A 3POOA 4CLIA 2V59A 4HVDA 1WZYA 2Y6MA 4AT5A 4I6BA 5CF4A 5BNJA 3ZH8A 3DCVA 4QSHA 2GPWA 5FEDA 2H8HA 2WPAA 4EH3A 2W5BA 2JKOA 4RIYA 3C4ZA 3BI6A 3OCTA 2UW4A 5EFQA 3SRVB 4FFNA 5KX8A 3BEGA 3NCGA 4MD9E 4MHAA 4RWIA 3GFWA 4LGGA 3RVGA 2XEZA 1G3NA 2CLXA 1FBNA 4F6UA 4PNIA 4XV1A 2OW3A 3BYVA 4O38A 5D41A 3FLYA 3ROYA 5C1OA 1VYWA 4RC2A 4EH4A 5JSMA 4D9TA 5FLFA 1MUOA 1JKLA 3RHKA 4AGDA 3W33A 2IWIA 2LGCA 4LRJA 5EW8A 2XVDA 3ERKA 3FUPA 4TYJA 5FP5A 3UDBA 2A4LA 4JL9A 2C0TA 3IS5A 2ZDGA 4HNVA 3R5HA 3BWJA 5JZJA 5LVMA 4I23A 3JZIA 2C0IA 2DIKA 4AOTA 4I93A 3FYKX 3PDTA 3O2MA 3EZRA 3U9SA 3OTVA 1DAYA 2JLDA 4MV9A 2X2LA 4LMUA 2Y0AA 4YJOA 2W1DA 3OHTA 4FFLA 3R1NA 3LJ2A 1GY3A 3HUBA 2R7BA 4S2ZA 3WF7A 4L3JA 4Y8VB 5DMXA 5AIRA 3Q9ZA 4FEVA 4YC6A 1KOAA 4ID7A 4FTTA 2PUPA 2Q0BA 4B9DA 3DZOA 4AZWA 2R84A 4BICA 4DFUA 3GIDA 5HE3A 4HNUA 2R86A 4I55F 2CKQA 3R21A 2YZGA 3GP0A 3GU7A 3A8XA 2B9FA 3C0GA 5E8VA 4ZAUA 4EGQA 2OGVA 2YACA 4HCUA 4GK2A 1FVRA 1P2AA 1PXKA 4PL5A 1ZMWA 4Z9LA 3U6JA 4YJUA 4IHJF 3Q2MA 3FJQE 3IK3A 2G01A 2X9EA 4DEHA 2V5QA 3RJCA 3PG1A 4WNMA 4QNYA 4I5HA 3KK9A 4CFFA 1APME 2A1AB 3LCTA 4EZ7A 5EKNA 4D1ZA 3D5VA 4O7SA 4QMWA 2WMSA 2XZSA 4IAIA 1XQZA 3HRBA 1WBNA 3NIEA 1XKKA 2YDKA 3QKLA 2ZVAA 4ONAA 5M51A 2GHMA 3UPZA 4EGJA 3OUUA 2HAKA 5BUEA 4YJSA 3QFFA 2YM3A 1KE7A 5DNRA 2WB8A 3JYAA 4ALWA 1ERKA 3HMPA 2FPGB 3V8SA 4DAWA 3BGPA 2WTKC 2B4SB 2ETKA 2WTKB 3ZM4A 3O0GA 1M7NA 2YIYA 4QP1A 4RJ7A 1EH4A 4CKIA 3V5WA 1Y91A 3BBTB 2XRWA 2E9PA 2WTWA 4EONA 2C3IB 3QLFA 4MV6A 3OEZA 4MKCA 4O84A 2F2UA 2GPHA 3MB7A 4ZY5A 2CHLA 3FZPA 5D7VA 4FMQA 4QTCA 3TCPA 4P5QA 4YTFA 5HTBA 3NUUA 1UV5A 4H3BA 2FSTX 4C38A 4G9RA 3EQRA 5B0XA 5DR9A 3GNIB 4G9CA 3MB6A 3PSDA 3Q4CA 3KALA 3CEKA 3V6SA 3VBTA 2C1BA 2PE1A 4DEAA 4Q9ZA 5HU9A 1H00A 4NW5A 3N6RA 2QKRA 1YKRA 2XA4A 1DI8A 3ALNA 2JC6A 3GU8A 3ZLWA 5IQHA 5LXMA 1P5EA 5CS6A 2R82A 3G6HA 4I5MA 4EYMA 5E8XA 1HOWA 4QNAA 1XH9A 2WGJA 3P23A 4TNDA 2YN8A 3ZS5A 4LRKA 4JBPA 2HY0A 5IDNA 4J96A 4A4XA 4JG8A 2JIIA 3ANRA 5EG3A 3S3IA 4GIIA 5IA3A 4OBPA 3CSVA 3LCDA 4C7TA 2XRUA 3VNTA 4JG7A 1KJ9A 4JBVA 3HP2A 2DZDA 2HK5A 3NUYA 3GC9A 2Y4PA 3DFAA 3HRCA 4O0WA 4YNOA 4YTHA 4XG2A 5F95A 4AT4A 2YJRA 3EQGA 4MA0A 3ZC6A 5KUPA 2B9JA 3FDNA 1PRYA 3FE3A 5HV6A 4X2KA 1M2PA 5EOLA 1IA9A 4O7RA 4CCBA 4EOKA 4KIOA 5AM7A 4I6HA 4BCMA 5CSPA 2A27A 3L9LA 4GV1A 3HV4A 4G6NA 2QQ7A 4R7HA 3RV3A 5BX0A 4GMYA 3DQWA 3NS9A 2W7XA 4KUJA 4A06A 1YDRE 3PSBA 1C3OA 4CTCA 5KMLA 3QQUA 3JXWA 3NUXA 4FK6A 4O4IF 2YITA 5CQUA 4FIJA 4ZSAA 4RWJA 3FI8A 5EW9A 4JIAA 1OIRA 2XM9A 4MTAA 4QMXA 1TQPA 1B6SA 3QUEA 3VN9A 4BCQA 4AG8A 1BLXA 3ZOSA 2YCRA 4AN2A 3BWFA 3UFXB 5HE2A 4FKRA 1CTPE 2UVYA 2WMRA 3UIUA 3GOPA 1OL2A 3NW7A 2EWAA 4D2SA 2C00A 5AP2A 2YCQA 2X7FA 4Y73A 4AT3A 4HGSA 5AIKA 3ZO2A 4YLJA 2PZIA 3ELJA 2XIZA 3G5DA 3MTLA 5H8BA 5CAPA 5DE2A 2UZNA 3BE2A 1ZAOA 3QTRA 4D1XA 1Z2PX 4P4CA 3FMNA 4PTCA 4HR7A 1NA7A 5T6KA 2P55A 3DDQA 4FIGA 4GT4A 4LG4A 4XG7A 3IO7A 5CSWA 4AZFA 4RBLA 4ZEGA 3FMDA 3LOKA 5CWZA 3UNZA 4MF1A 4YSMA 4GEOA 4YBJA 5HESA 4O4JF 2PUUA 3TXOA 1A06A 5L6PA 4BDKA 3OCGA 3OVVA 3SA0A 3HP5A 5GJGA 4IJPA 5FTOA 3VBWA 5AUTA 4L1KA 2PU8A 3RPRA 3ALOA 4G34A 1OM1A 1PF8A 4JDIA 2PVNA 4AN9A 4E8AA 1H25A 4DH3A 2ZM4A 2XKFA 3LFFA 3PVBA 1AD5A 2YAAA 3ZRMA 3WILA 4BIEA 3DK6A 3EN9A 2QHNA 4BRXA 1CE8A 4IQ6A 3CP9A 5ETIA 4DEBA 2WEVA 4LUEA 4UY9A 3CD3A 2PZRA 2SCUB 4TWNA 4FTKA 4I5CA 2GHGA 3ZO4A 3EL8A 2VWYA 4HYIA 4X7QA 5AMNA 4E7WA 3I6WA 3B2TA 3E5AA 3QFVA 4FKWA 3HL7A 3R1QA 2PZPA 5KX5F 3E8DA 5D10A 5FEQA 5HO7A 3UMXA 2QO7A 3QBNA 1Q4LA 4I21A 3A62A 3KXXA 1OPJA 3CGOA 3UQFA 3CLYA 3WF8A 3DDPA 2PVMA 4XEYA 1MQBA 3HAVA 4B8MA 2YIRA 1YWVA 4FT0A 3R04A 4I50F 3PSCA 4Y95A 2QONA 5J5SA 2DLNA 4MBJA 5C8NA 4L00A 4XLIA 3ORQA 3CPBA 4TUYF 3CQEA 4YZBA 3ZSGA 1KE9A 3PA5A 4BDGA 2P0CA 4FC0A 2HW7A 4CT1A 3P7BA 1JDEA 5BVDA 3IGOA 5HVJA 5AV0A 3SOAA 3T3UA 3DAEA 3QUDA 3OCBA 2UZUE 3NW5A 2ITPA 4H3PA 4D4RA 2R3HA 4GG7A 5A54A 1Y6BA 1J1BA 2R3JA 3E93A 4O7NA 3HVCA 4EC8A 4S32A 5CZIA 1YI4A 5J87A 4AOJA 4O2PA 3UE4A 4BCNA 4L9IA 5FDPA 3MVJA 3VMMA 1UU9A 4BCKA 4OTGA 4U8ZA 5CA0F 5GJDA 5CEKA 5TKDA 2WIHA 2FSLX 4BR3A 4QMNA 2W1CA 2I0HA 3IOKA 1STCE 4HYUA 4EWQA 5HBRB 5AAGA 2C6LA 4X2NA 4EJNA 5M09A 1I44A 3GU6A 3EH9A 3DJ5A 2BRMA 5AV3A 2I0YA 5LMBA 3UG2A 2GLTA 1Q41A 5FBOA 5B7VA 5CAQA 3P78A 4ME6A 2YEXA 3BPRA 3QQKA 2XKDA 4EHZA 3UC4A 2XK7A 2VO6A 2VV9A 2O63A 4JDKA 3FPMA 3MYGA 4IFCA 1C30A 1QPJA 3A99A 3QHWA 3K3JA 4FKQA 5AP4A 5EM8A 1KJIA 1U5QA 4MX9A 4E6DA 4AZEA 2XIRA 4O0TA 3TI1A 2R64A 2OK1A 1EUDB 2I80A 3MWEA 3DB6A 3D5WA 4IZAA 4EYJA 3F9NA 1JNKA 2JKQA 2PVJA 2PZYA 2ZYBA 5DGZA 2ITOA 5M55A 3ZFMA 5LXTF 4EUTA 3DKCA 3CXWA 5M08A 2BTSA 5CSHA 5EHYA 4BI2A 4C62A 3BYUA 3MFSA 2IP4A 3OG7A 3BX5A 3V01A 4A9SA 4W4YA 1QPEA 5EDPA 3K54A 5B2MA 1JVPP 3HX4A 2GNGA 2W1ZA 4L6QA 4WA9A 3TEIA 4DGLC 2BIKB 3NUNA 4YP8A 4TYHB 2VZ6A 1PXMA 3TUDA 2DUVA 3WIGA 5H2UA 5HLNA 4DEEA 4YO4A 3PPKA 1O6KA 2X0GA 3QTSA 4IACA 4RFMA 4EOQA 3HMIA 4UYAA 3LMIA 4RLKA 2PPQA 3DJ6A 5IISA 2OWBA 5IQCA 3K3PA 1PKDA 2XEYA 3EJ1A 2VAGA 4J95A 2ZV8A 4FA2A 2BPMA 4KS8A 1RDQE 3LJ1A 4FSNA 2R3LA 4XV2A 4FSZA 5JZNA 2C6KA 3KN6A 3NZ0A 4M0ZA 3PPJA 3E64A 2JKMA 4KKGA 1JPAA 4DH8A 4EBVA 5IA1A 4O7VA 1OZ1A 2W6QA 3BLHA 4TTHB 1QCFA 2WOTA 4PY1A 3T9TA 4ANQA 3C4WA 5KZIA 2V62A 2XD4A 4AS0A 4YU2A 3PJ8A 3WF6A 2CKOA 4KBAA 4NYEA 4XP0A 5H80A 4FNXA 4GT3A 4J52A 3ZONA 1LEZA 3QKMA 3TV4A 1UU8A 3A2CA 3EYHA 3OMVA 4IC7A 3MN3A 5JRSA 2IVSA 3IW8A 3UYSA 2WMQA 4YBKA 3F3TA 5AP3A 5LARA 2W4OA 4G5PA 2C6DA 3RCDA 3S0OA 1VBHA 1AQ1A 3P86A 4R3CA 4ZS4A 2YS6A 4C58A 3RK5A 2HXLA 2R3NA 3OY3A 4YURA 5E9EA 4M3QA 3JRWA 3I1AA 5EZYF 2PMNX 3F7WA 4R7BA 5EM7A 3VS3A 2VRXA 3L9NA 3RTPA 3S2PA 3IDBA 5EYCA 4F08A 5GJFA 3QZGA 2Q0NA 3VS5A 4GL9A 1IRKA 3NSZA 4EZ3A 4B0GA 3JVRA 5D12A 4H1MA 2GNLA 4YAJB 4LV8A 1OKVA 3LFQA 4ZZMA 1YRPA 3V3VA 3MV5A 4QP3A 1EZ1A 4QMLA 5IUHA 4FEQA 1UVRA 3RAKA 4HGEA 1W0XC 3MFRA 2J9GA 4U3YA 4FKOA 2VTAA 5K4IA 2XNBA 3BV3A 5EKOA 3OW3A 3BHHA 2C1AA 4CFVA 2X0SA 4YJ2F 4L46A 1HCKA 2YWVA 3BQRA 4WNPA 1GZKA 1F5QA 3KAJA 4WOVA 4CLJA 3TN8A 5J95A 3BELA 3EMGA 5L3AA 3U87A 4G3DA 5IYZF 1ZLTA 2QG5A 3Q5IA 4CFNA 3FZSA 3UOLA 3Q1KA 5BQ0A 4FV0A 2VX0A 5GINE 2UZLA 4O81A 2P2IA 2WOUA 4L53A 2R85A 3M11A 3VVHA 5HLWA 5AP7A 4BCFA 3VHEA 1V0PA 3I60A 2X9FA 3C4CA 2EUFB 2W4JA 3A4PA 4XMOA 4C36A 3UO6A 2B54A 5BYZA 1PJKA 3C0HA 2W4KA 2BAKA 2ESMA 3G51A 3O17A 4ZTQA 3ZDIA 2YWPA 4EC9A 5H3QA 2FVDA 5KMNA 4E20A 3GCPA 3R1YA 4ZJJA 5KBRA 1WBWA 5HCXA 3KULA 4F1TA 3R22A 4RIYB 4UZHA 2R7LA 5ANIA 3UQGA 5L2TA 5AEPA 3ZBFA 2XP2A 3ORXA 2RFNA 4F9BA 3R71A 2YM6A 3HEGA 4MXCA 4YMJA 3GCSA 4ZSLA 4O6EA 3KF4A 4FBXA 2YIXA 3L8SA 4I41A 3EFJA 5CXZA 3AX6A 2XIXA 1PY5A 3DZQA 3TQTA 1SYKA 2OZAB 4X3FA 4AU8A 4BDIA 5IA5A 4CMTA 3FMLA 3E62A 5A4CA 4AA4A 5J9ZA 4FV5A 1MRYA 4J98A 3U55A 4R5YA 2J4ZA 1KOBA 2CGXA 4FOBA 4QYGA 4RX7A 5K4JA 4FX3A 5HORA 5EHOA 3R8VA 1PW2A 1NY3A 1JLUE 2XUUA 3EFLA 4FTQA 3PA4A 3Q3BA 4C4HA 2DYLA 2GSFA 5H8EA 4ASZA 3U51A 1WCCA 3WZKA 5HG8A 3BKBA 3CR0A 3WZDA 1JKTA 1G8SA 4F65A 3COKA 3QXPA 1IOVA 3PUPA 3KCFA 4LOPA 4HVHA 3KXNA 1GGOA 4GIHA 2W6OA 2WAJA 4K77A 2PVYA 2UVXA 1XO2B 4QP8A 3S4QA 1CMKE 3C13A 4EZ5A 5CAEB 3SW4A 2BAJA 3QC9A 3VUHA 4DG3E 3HV6A 3HLLA 4HCTA 4YHJA 4ZJIA 3MTFA 2HY81 2OJFE 3MWDA 4MAMA 1H1SA 4IB1A 3ORRA 3VC4A 5M44A 3TINA 3LHJA 5ANEA 4C3RA 1BXRA 1LP4A 5BMVF 5T68A 3SHEA 2V0DA 3ZYAA 3GC0A 5JVDF 3LIJA 5C03A 2BTRA 2G9XA 4MAOA 4TYHA 3NYNA 1F3MC 2J90A 4DFBA 3PXKA 4DFZE 5AA9A 4IDVA 2QD9A 2IO6A 1SVGA 3K5UA 4FFRA 2O5KA 1OGUA 5A4QA 1GNGA 3G6GA 5DPVA 4RX9A 1XR1A 4KWPA 4BF2A 4CD0A 2X8DA 2FB9A 1WBSA 2PWLA 2ITWA 3R30A 1ZARA 3PG3A 4F1OA 3P5KA 5JFVA 1T36A 1U46A 4O86A 5I9VA 4ZZOA 1SNUA 4QMOA 3BG5A 2WD1A 4CTBA 4ZSGA 1QMZA 5CENA 5M4UA 3R7UA 1FMKA 3AC8A 4JNWA 1WAKA 5C4KA 3ZCLA 2OBJA 5KKRC 5AA8A 4ZZNA 5KKRB 4O4HF 3VA7A 3A8WA 1FGKA 3COHA 5E1SA 3ZEWA 4DFNA 4A4OA 3TKIA 3NAXA 4U7ZA 1RE8A 1XHAA 3T3VA 1H0WA 1YDSE 2FSMX 3BCEA 2Z7LA 3CPCA 3QX2A 1A9XA 1OL1A 4ZP5A 3PJ2A 2HW6A 4ZOGA 1M7QA 3A7FA 2GCDA 5CY3A 3GQIA 4U9AA 2IVTA 4OTIA 4OBOA 5DR2A 3UO5A 5D7AA 2PN1A 1PHKA 4DLKA 5HKMA 3A7IA 3C9WA 2YZAA 4OR5A 1FQ1B 2WMBA 5JQ8A 5E8UA 5JRQA 3LXPA 3GB2A 4FKGA 5CNNA 5IQAA 3ET7A 3ZEPA 3VUGA 3BU5A 4XX9A 1PMNA 1UNHA 3MGYA 3MH1A 4FTAA 1MRUA 4Z16A 5EQEA 2O64A 4BTKA 4EOMA 3QQLA 4J99A 2NU7B 4WD5A 5EDQA 3BLRA 4FL3A 3LKMA 4AWIA 2V5AA 2JFLA 2VTLA 4IAAA 3AC1A 4DCEA 2WFYA 4HW7A 4MV1A 1DV1A 4IVCA 5BVKA 3M42A 4L52A 1OPLA 4O6LA 4DTBA 3QQJA 5DR6A 3E63A 3LE6A 3OBGA 2J0IA 3Q6WA 3U9CA 3VF8A 1O9UA 4ACCA 3ID6C 4F0FA 5CYIA 4QPAA 5CSVA 5J9YA 2JBOA 2WQEA 3HA6A 3MIAA 5FG8A 4BI0A 3LWBA 5CU3A 1Q99A 4Y85A 5DI1A 4PL3A 4DEDA 2VTHA 3U4UA 4XBRA 1B39A 3CC6A 3QCSA 3NW6A 4Y5HA 1ND4A 4EEVA 2C6IA 3QYWA 4G3GA 2QOKA 4LV5A 1KUTA 5DFPA 1E4EB 4ERWA 4XP2A 4IWPA 2UZBA 4YHTA 4IANA 2EVAA 4EG0A 4TN6A 4RRVA 4NUSA 3VS7A 5CEIA 3DBFA 1OIUA 4HGTA 2QKWB 2VGOA 5BVNA 1ZRZA 3AD6A 4X2JA 2PSQA 4E5BA 4MWHA 3FKLA 3R6XA 3C5UA 4JQ8A 4JVGA 2FH9A 2VTJA 4MBLA 5FDXA 1H1WA 3UGCA 1T46A 4UN0C 1ZYSA 3ORKA 4AFJA 2OIDA 4L44A 4GK4A 2E9NA 2HZIA 3O7LD 2JDTA 2W99B 5ACKA 4CGAA 4EH7A 3HMOA 2VTPA 4KA3A 4BVUA 2GPSA 3REPA 4FYOA 4K0YA 5AADA 3RINA 3U8WA 1KE5A 3LFCA 5CLPA 2G2FA 2HOGA 2DQ7X 3AQVA 2C69A 4C3FA 3H4JA 5A3XA 5IEYA 2WKMA 2XBJA 3FHIA 4IM0A 3POZA 3KL8A 1KSWA 3Q2JA 4YO6A 4YLKA 5DWRA 5DT0A 5ETFA 5G1XA 5HE1A 2ZDTA 3KRLA 2ZB0A 3MS9A 5ITAA 2GS2A 3ZRKA 2NO3A 3U9NA 4I4EA 2ITNA 2PMLX 4ZSEA 1PMUA 5TR6A 3MH2A 2QNJA 4OGRA 5FP6A 4TW9A 5HNGA 2OZAA 4BDEA 4QO9A 4E6QA 4YB8B 3PIZA 1K3AA 1U59A 2B9IA 1UA2A 2OJGA 4DH7A 4CKRA 1Z2OX 4IB0A 4YJRA 5C9CA 4ZLZA 4MWIA 3OOGA 1M14A 5AP5A 4ZTHA 4F63A 3F69A 4H1JA 2QURA 3ZC5A 1SVEA 3MA3A 5BVOA 3TZ9A 2XNMA 4R3RA 2BALA 1OBDA 5HG5A 4EOSA 3QRKA 2R4BA 3DXPA 4MNEA 3R7IA 2BILB 4O82A 4YJPA 3UOJA 5JQWA 4RC3A 3MY0A 3NNVA 5C01A 4DC2A 3KRRA 3PXFA 3TNWA 2VWZA 3CJGA 5E8ZA 1ULZA 1URWA 2BZKB 3N4UA 2Z7SA 4GCJA 2WIPA 4RVMA 5ANKA 4A9YA 4BZDA 4DGMA 4OTRA 4RT7A 2J50A 4KINA 5IZFA 1MRVA 4ZMFA 2JFMA 3DBEA 1YVJA 1OPKA 4FKUA 5I9UA 2JIVA 3FWQA 3HUCA 3TKHA 3E3PA 3LLAA 2CDZA 1E9HA 1RW8A 1YWRA
chains in the Genus database with same CATH superfamily
3AD4A 3ATSA 5KHWA 4TT7A 4LQMA 4R1YA 3TL8A 4EI4A 2BRBA 3MSSA 2R87A 4EL9A 4O2AF 4PBCA 2NUAB 2UW9A 4J71A 3CTJA 4APCA 3MJFA 2ONLC 3AT2A 3O50A 4J1RA 3VUIA 3ZSIA 3TUBA 4PDPA 4YGAA 3VW8A 5E7RA 4K6NA 1J91A 1O6LA 3CIKA 3OFMA 3UTOA 5TO8A 3C4EA 3EYGA 4DDIA 3QL8A 4F6SA 2VNYA 4CZTA 2O3PA 3QQHA 4P90A 3NUSA 1W93A 4G16A 5DRBA 3D4QA 2JBPA 3NPCA 4MV8A 3VBQA 2R3RA 1JWHA 3HMMA 4XV9A 4DBXA 3O8UA 2IN6A 4O0XA 2FPPB 3OXTA 5E8TA 4IAYA 3QRUA 4O0SA 2A1HA 4EBWA 3EKKA 4FKPA 3D2KA 5IMXA 5LWNA 2JDRA 3T54A 2VTSA 3A60A 5A4EA 3T9BA 2ETMA 4CQEA 2CGWA 3RNIA 3K5IA 4O22A 3OZ6A 5AUYA 1H1RA 3FL5A 3PLAE 1P4OA 4TM5A 3FZTA 2VWIA 4IAZA 5A14A 2DWCA 1JDBB 3HDNA 4FIHA 4BDHA 5B2LA 4I4TF 1ZOGA 1SMHA 5FPRA 1XBBA 4EHEA 2J0KA 4CXAA 2QOCA 5HU3A 5LQFA 2GMXA 4I3ZA 3EFWA 3R9RA 3FMHA 4DH1A 4IWOA 5E1EA 2PMOX 1XBAA 4EOLA 5EDRA 4F7JA 2X1NA 5HEZA 3W1FA 3HV7A 2QOLA 2BZJA 4FVQA 2V58A 2HVSA 4YTCA 3PJ1A 2VWBA 4F4PA 2XM8A 4ACDA 3HO8A 5I60A 4YUQA 3O51A 3JVSA 4WKQA 5I9WA 4QMQA 5CX9A 3QWUA 2ETRA 4KSPA 2ZV2A 3G33A 5JFSA 4YPDA 2I8CA 5TF9A 5HBJA 4G1WA 1UU7A 4S33A 5CXHA 2BHHA 1FOTA 5AM6A 1NVSA 5BYBA 3TY9A 4AF3A 3TNHA 4CT2A 3NWWA 4CKJA 4EH2A 1FINA 2QO2A 3L8VA 3RPOA 5IQIA 1YQJA 3E3BX 3D15A 3JR1A 3AXWA 2IZTA 1M52A 2XIYA 4GYIA 3I4BA 2VN9A 4JRVA 2VU3A 5I5UA 3DLSA 4W4XA 4I0RA 4QYFA 2W1HA 5F4NA 4ZI7F 4UBAA 4EK8A 2A19B 1E4EA 4NSTA 2Z2WA 2UW6A 3TZ8A 2OXXA 3FC2A 4G6OA 5CNOA 1GLVA 3QQFA 4L7FA 5HGIA 1OKWA 1YOMA 3IW4A 3FKOA 3IW5A 2I7QA 3D83A 2CKPA 4HNFA 4HVSA 4TPTA 2VO7A 2W05A 5LOVF 5T3QA 2R7IA 3PPZA 4LL0A 2OLSA 4EK4A 4IVDA 3E8CA 1JOWB 2R3KA 4O27B 3ZZWA 2BRHA 4PX6A 4BGQA 1SCUB 2ZFYA 4GH2A 4DCAA 2NRYA 4FUYA 3TNQB 4EQCA 4NZOA 2HGXA 2G15A 1YXUA 4G3CA 2YERA 3GU5A 4L8MA 2QODA 5GNKA 3UPXA 2W6NA 5EQYA 2J9MA 2OF2A 4OT5A 5AP6A 4FTOA 4YZNA 3ZLYA 5BYAA 4DG2E 3QWKA 3PVWA 3OY1A 5IUIA 3WBLA 3CKWA 3UZPA 3RCJA 3R9DA 4C2VA 3NNWA 3UO4A 4FYNA 2COGA 3W2RA 2QR8A 3UIXA 4DEGA 3OS3A 1UWJA 2C3LA 3VONA 4M0YA 5HG9A 3B2WA 1W83A 3PWDA 2FB8A 3EQCA 4I94A 2HIVA 2CKEA 2OU7A 3RK9A 4CMDA 4QTDA 3WWIA 4M0JA 1PX2A 1H28A 2YFXA 3NR9A 4FV1A 3BYSA 1CKIA 2PTKA 3BZ3A 4Y72A 4FU0A 5H9BA 3R9NA 1OBGA 3DXQA 4F78A 1H4LA 3FHRA 4HVGA 4FZDB 5E25A 4JIKA 4BHZA 1OL7A 5HNIX 5LCJA 3PWYA 1YOLA 2QU6A 3JY9A 4J97A 2X8IA 1ST4A 2W96B 5G6VA 2Q83A 5CI7A 4YZMA 3QQGA 3VRZA 4IB5A 5HCZA 5ETAA 4FG9A 2XNNA 3FQEA 2RFDA 3I5NA 3GVUA 4I5PA 3V8TA 5EH0A 5EYDA 2J5FA 4G31A 2GFSA 3I7BA 5AWMA 2PHKA 2BDFA 3PXYA 4Y5QA 4ZIMA 3V51A 3GXLA 4LM5A 3RV4A 3DAKA 4IE9A 2CN8A 3IECA 2V7AA 3HMNA 4XP3A 1XBCA 2Q2TA 2QC6A 4FTRA 3FQHA 4NFNA 1WMKA 3WNZA 1SNXA 5DIAA 3R2YA 3SQQA 4RFYA 2BR1A 1DAWA 3UOHA 5GONF 2AEGA 3ZFXA 4JDJA 1NVQA 3Q96A 3DU8A 3DTGA 2B1PA 1CDKA 4USDA 3IDCA 4YHFA 4AFEA 4D5HA 4FICA 1H08A 2W06A 5ICPA 4EQMA 1IOWA 1EKFA 3U54A 4I4FA 4TWCA 3R7EA 4E1ZA 4XOYA 1X9NA 3V5LA 3SGCA 3R23A 3EL7A 5HO8A 4PDSA 5CU6A 1UNGA 4CG8A 4YR8A 3GUBA 4MQ2A 4OLIA 4ANLA 4XYLB 2ONLA 3KB7A 4X6RA 2NP8A 4ZTLA 2WQNA 4G6LA 4CC5A 1V0BA 3UNKA 1Q5KA 2H96A 5M57A 2OFUA 4G2FA 3Q9XA 4LUDA 4V0GB 1ST0A 5E90A 2YIQA 4IIRA 3BHUA 3UVPA 4RJ4A 5KMMA 1GOLA 3BHVA 3FI4A 2Q2UA 4DITA 3WI6A 3PUFC 1M0TA 2C5VA 2F7XE 4HYHA 2W9ZB 4FNWA 4IC8A 4WBBB 3W0PA 4JI9A 3I81A 1IAJA 4JX3A 4C4GA 5C8KA 3BA8A 2AC3A 2J2IB 4Z55A 4EQUA 3SOCA 4RMZA 3LQ8A 4E26A 2GNIA 3GCVA 3NMUF 3KRWA 4MNFA 5C4LA 2NYAA 2ZAZA 5I0BA 3KULB 1SM2A 4CV8A 5M53A 3O5AA 3RALA 3EN6A 3IW7A 3WIKA 3P7AA 1TKIA 3TM0A 5HLPA 3FMMA 2GTMA 2V7OA 3IG7A 5AX9A 5FBNC 3R2BA 5E92A 4EH6A 2BCJA 4FZAB 4BTFA 5IQEA 3MWUA 4MYGA 1MQ4A 4MV3A 5DOSA 1KJQA 3LJ0A 1WRVA 3FBVA 3E87A 2YA9A 4WNKA 4ZTNA 4DGGA 2Y9QA 2HZ4A 2B53A 3NLBA 4X3FC 4X3FB 4IX6A 3R7VA 4AACA 3KK8A 2CNUA 3V04A 5IG1A 3K5HA 4TXCA 1Q8UA 3EN4A 1WR2A 3L9PA 3WWHA 3HT5A 5EK7A 4EFEA 3W1BA 3RM7A 3F3UA 3L9MA 3ORTA 3QWJA 4YNEA 2IG7A 5L6OA 5K3YA 4D58A 1VYZA 4UX9A 1X8BA 3BHTA 3KFAA 1H07A 4CV9A 4K33A 3DK7A 1KE6A 3O7LB 3QCXA 4JR7A 3RWQA 2IW6A 5I5ZA 2CNVA 3AT4A 2HELA 3EWHA 4R6VA 2GQSA 3SG9A 3UDZA 5CAOA 3PIYA 3ENMA 2OH4A 1R3CA 3D5XA 3GOKA 3R28A 4FL1A 2ZDQA 5DVRA 2BRGA 3ZXZA 3TZ7A 3V4SA 3I0QA 5I5VA 4FNZA 3WE8A 2A2AA 3MW1A 4IVBA 2PE0A 4LRMA 3UBDA 3CKXA 5DN3A 2OICA 4FTCA 3H0ZA 4XZ3B 4KNBA 4RZQA 5AAEA 3OEFX 4FZ6A 4J7BA 1L8TA 4DHIB 3F3VA 4UEUA 2IW8A 3AT3A 3L2PA 5KO1A 3AC3A 3L8PA 4JAIA 1ZY5A 3TKUA 4DLIA 4G5JA 2R3MA 1XJDA 2WMXA 2BHEA 3VBXA 5FM3A 3UODA 3HNGA 4M12A 3ZSHA 4Y83A 1GIJA 1Q8ZA 4I6QA 4U41A 4FSMA 4UUGA 1ZOEA 2R3QA 2YCSA 4AW5A 4X2FA 1R39A 1ZMUA 4FSRA 4A07A 2WZJA 3A7JA 3N8DA 3P0MA 5I5YA 1FVVA 5F9EA 3NYXA 2JAMA 3W0RA 5IEXA 3AMAA 3R0TA 3ORPA 3PJ3A 4YSJA 3FMKA 1H01A 2XB7A 3BYOA 1E1VA 5AAFA 3SXFA 4L7SA 1I2KA 4P2KA 3R5XA 4E93A 2OJJA 3AC5A 1DI9A 5AP1A 3TYKA 3VAPA 2R7KA 5CAVA 4L3LA 1FGIA 4D0XA 3RPYA 1BI8A 5E8SA 3TV6A 4BC6A 2UVZA 3WF5A 4C5AA 5BWWA 4HCVA 3QA0A 4DINA 3FZRA 1U5RA 4QTAA 3UVRA 2YDIA 4DE4A 1GSOA 4UCSA 4EEQA 3LCSA 2YM4A 5AUUA 2XARA 3C5IA 1PMEA 3O23A 3MY1A 3DB8A 3PIXA 2YM7A 4NU1A 5DEYA 4MD7E 3TNIA 3QXOA 4WHZA 5L8LA 4M13A 2E2BA 1WBPA 1Q8TA 2HZNA 4NL0A 3DTFA 5JK3A 4ZHQF 4YZCA 5KKNB 2WTJA 3OBJA 4C4EA 3F61A 4V04A 3RUPA 1TFFA 4IM2A 5AJQA 3NYVA 5FTQA 1DS5A 3VS4A 4G3EA 4WBNF 1ZYDA 4F0GA 4IWYA 2C3KA 4XH6A 4I0TA 2XCHA 4O7TA 5KBQA 3GFEA 3UQ8A 4QMMA 2ERZE 3OWPA 1OL5A 2UV2A 4U97A 4AP7A 4CSVA 5JH6A 1CQIB 2VQDA 4J8NA 2F2CB 4RX5A 2HYYA 3CQUA 3U9TA 5HBHA 3EHAA 4KS7A 2FSOX 5CB4F 1NVRA 1P14A 1XH5A 3MJ1A 4DDGA 4CMFA 5J2TF 4BDCA 3UP2A 1YHWA 4GVJA 5BUIA 2Q7DA 1I1LA 4TWOA 4HPTE 3LXLA 2ODTX 2PUIA 4FFOA 4I6LA 3QCYA 3T7AA 3VNNA 5CALA 4F09A 5DT3A 1GSHA 2OLCA 2QO9A 2YDJA 1JSTA 4AA5A 4Q4CA 2BDJA 3GCQA 2GQGA 5HVYA 3VO3A 2UZVA 4BN1A 2C68A 2UZWE 2F9GA 1WVWA 4FI1A 1QL6A 3KMUA 3Q52A 5JMSA 5K5XA 2GNFA 4BHNA 5HX8A 3AMBA 3TW6A 4I0SA 2GS6A 2XS0A 4FK3A 4QYYA 2BKKA 5CF5A 2OO8X 4O0RA 4V0GA 2ZM1A 2C30A 3PRIA 2C0OA 1TVOA 4JOAA 5BPYA 4IX5A 2XCKA 5D8DA 1H27A 2XK8A 1PXJA 4JBQA 3V5QA 5HNBA 3N4TA 5KMKA 3IDPA 4JR3A 3S24A 4QP7A 5FXQA 2E9VA 3KKVA 3JSLA 4QTEA 3O8PA 3RGFA 3DTCA 1YHSA 1A48A 2P4IA 3KRXA 5E4HA 4B99A 5IA2A 2FPIB 4DH5A 2W6ZA 4XYMB 4ZOLF 4UFZA 2CNQA 1JQHA 3VJNA 5LJJA 1OITA 2FP4B 4Q5EA 3MBLA 3JRXA 3CJFA 3QUPA 2O65A 3NUAA 4CMUA 3WZUA 4QMSA 4FTUA 3SW7A 3RK7A 2IZUA 3PFYA 3MPMA 1OL6A 3OF0A 2CGVA 1JAMA 3PY0A 4FKIA 5EM6A 3AC4A 2XK4A 5J9LA 2H34A 4OTQA 3UC3A 4EFBA 3VS6A 2ZV7A 1U54B 3JZFA 2EB2A 3MFTA 3NNXA 3KXGA 4HYSA 3SKCA 4GSBA 3VS2A 1UU3A 4QMVA 4QP9A 4UXQA 5CVHA 4B4LA 4BY9E 4UZDA 3F2RA 4HN2A 2Z7RA 3HKOA 4L43A 3R8ZA 5D11A 4I1ZA 4KRCA 5C27A 2YZNA 1PKGA 3TDVA 1GSAA 3MI9A 1URCA 4E6CA 3JZ6A 3EN5A 4A7CA 4O2BF 2X6EA 4Y46A 4AGWA 3THBA 4APPA 2W70A 3PXZA 3VS0A 4BDAA 1G5SA 1ZOHA 4XV3A 3ETAA 3ORNA 4Q2AA 3HA8A 4QP4A 2R2PA 3FLQA 4L01A 4MNEB 1IASA 2YRWA 3VQHA 4F1MA 1J7UA 1JSVA 4QMYA 4LV7A 3OWJA 5DGIA 2VTQA 4XG8A 2BKZA 4R5SA 4OTWA 3QD4A 3OC1A 3PZEA 4U80A 3R9HA 4W4VA 4TL0A 3LFEA 2W1IA 4NTTA 5DA3A 2CSNA 3R7YA 3DNDA 4C02A 5CEOA 2C5YA 3FZ1A 4L3PA 1DGSA 1P16A 1UKHA 1CM8A 4G3FA 4YC3A 1NW1A 3SXSA 2G2IA 2ZM3A 4WUAA 4B8LA 3BACA 3VPBA 2PUNA 4EHVA 5IQFA 2ZMDA 3R1SA 3DPKA 1R1WA 3LFSA 4EWHA 3DKFA 5EI2A 1H1PA 2NNWB 3R8PA 4U0IA 2ITZA 3H0YA 3JY0A 4FSWA 4U42A 2COJA 5ANGA 1NXKA 2DWBA 3FLZA 2P2HA 2XK3A 3FAAA 3QKKA 3UNJA 2CJMA 3EN7A 3VUKA 3WYYA 1A3GA 3T8OA 1UWHA 4NZMA 5LVNA 2AYPA 3CQWA 2QI8A 4DEIA 3UG1A 2EIYA 2PVKA 4TYGA 2B52A 5CI6A 3T9IA 2GU8A 2C5OA 4TYIA 4EKKA 2WEIA 4E4NA 3EQBA 3I0OA 2DS1A 3D94A 3QYZA 4AN3A 4C4FA 1CKJA 4LI5A 4EORA 5ETCA 3MPAA 3FL4A 3P7CA 2PVRA 3TTIA 2RG5A 3BIZA 4BGGA 2ZGIA 4GW8A 3U4WA 3U6IA 3LCOA 2OF4A 3R63A 2QOHA 3P08A 2XNEA 3FY2A 5AUZA 5CA1F 2JDOA 4RPVA 3HDMA 4FTLA 5A4LA 3PXRA 2C5NA 2OFVA 3QZIA 4LOOA 4BDDA 4F7LA 2VWXA 5C26A 4EJ7A 5M56A 1FMOE 3F7ZA 4F7SA 4FKLA 2W0JA 4DTKA 3BABA 3BBWA 3TZMA 3RI1A 5CQWA 4FR4A 4UCTA 4ZJVA 2WQBA 5EI8A 5IMEA 5M4FA 4RGJA 3HRFA 3CY3A 3ZRLA 4AE6A 3TT0A 4GFMA 3PP0A 4R7IA 4RWKA 1EYZA 1K9AA 3HECA 4O91A 3BV2A 4MA5A 1CQJB 2IZRA 3WO0A 1AUXA 4D4VA 4L68A 5C1PA 4AW0A 3W2OA 4EUUA 3AKJA 4H58A 4GT5A 2ZDUA 4K18A 3VIDA 1B04A 3KRJA 1OUYA 4ARKA 4FFPA 5IUGA 5CEQA 4BGHA 1AUVA 3QRIA 5IA0A 5EOBA 2RL5A 3FXWA 1M0WA 1HCLA 4K1BA 2YHVA 4II5A 4CFXA 2J5EA 2OJ9A 2WMWA 4RQVA 4K6ZA 4U6RA 5IA4A 5M4CA 3D7TA 4BB4A 4D0WA 5A4TA 2QU5A 3AOXA 3BHYA 3G0EA 4UWBA 2ABJA 5D1PA 2W17A 3FLSA 2GQRA 5CSXA 3QA8A 2NU6B 1T45A 1R0PA 1JKJB 3RFCA 4FT3A 4UV0A 5AP0A 2WMUA 3ORIA 5KMOA 3BL7A 4F99A 2J0JA 2RG6A 3GC7A 1JLLB 1KBLA 1XH4A 2IW9A 2X7GA 1M2QA 4MXOA 3R02A 4JRNA 4YPSA 4FIEA 3T9CA 3DY7A 3AC2A 3EQDA 4GLXA 3H3CA 4N6YA 3GQLA 1KEEA 5BUJA 4JQEA 3BU3A 3E8EA 2YZMA 5FRIA 4JBOA 2UW0A 1Q3WA 5JEBA 2XYNA 4DIMA 3ZLSA 4JG6A 3WO1A 3R00A 4C61A 2XANA 4DT9A 1K2PA 2PYWA 5BVFA 4DGNA 4RA4A 2C6TA 1V1KA 2VUGA 1WBTA 4BCJA 3NFGB 5GIOE 2XKEA 2R3OA 1G8JA 3ZXTA 1CSNA 4QMUA 3VUDA 3VUMA 4EOOA 5LWMA 2VTOA 5EYKA 1DV2A 5FUTA 4K2RA 4K8AA 2WHBA 2W1EA 2W1GA 1JBPE 2B0QA 3N51A 3P9JA 3NEWA 4RIWB 3W2QA 2IJMA 3HAMA 4KBCA 4M84A 5C8YF 5AUVA 4JDHA 3FQSA 3NCZA 4IADA 2OZOA 3EQFA 3VBVA 3BGZA 3B8RA 3ACKA 2QOOA 3D7ZA 5A46A 5CU0A 4CHIA 2HVQA 5DRDA 4FEUA 4QYHA 4NJDA 3RAHA 4QQTA 4IVAA 4U44A 2H6DA 3AD5A 4QP6A 3WARA 1KE8A 1U54A 1PYXA 2VUWA 4KIQA 3EIDA 1Q97A 2RFEA 2W1FA 4WNOA 1OMWA 2PVFA 3FI3A 4U79A 3F88A 3TDWA 3G8CA 4MV4A 5CE8A 4CMOA 2GS7A 5CVGA 4ZY6A 2C6MA 2R0UA 3ITZA 4FSUA 4ASDA 2YYAA 4XRLA 2REIA 2JKKA 4TRLA 4ANMA 2OH0E 3FYJX 2C6EA 4NM5A 4KKHA 4XLVA 2UZDA 3W2PA 1YDTE 2V22A 1J3HA 5L8KA 3ETHA 2ITYA 3LQ3A 4FV2A 3OD6X 4AGUA 5JFXA 4PQNA 1KC7A 3NRMA 5CAUA 4JX7A 2JEDA 1RQQA 2HZ0A 5CT0A 5HHWA 5K5NA 4I92A 2G1TA 4QPSA 1OGYA 4FV8A 4X0MA 3D2IA 5HNEA 3NVMB 3B8QA 4FODA 4N6ZA 1QPCA 4LMNA 5BVEA 2X39A 1ZY4A 4FSQA 3U6HA 3KU2A 4C37A 1UNLA 3C7QA 2XH5A 1YHVA 3CTQA 3KN5A 3UQCA 1SVHA 3H10A 4NW6A 4Q4DA 1PXNA 1S9JA 3IPHA 4H3QA 2WO6A 4N70A 2OI4X 2BZHB 2ITUA 3DAJA 3GI3A 3QZFA 3FMEA 4FTJA 4AZSA 4D55A 4ORKA 5I9YA 1REJA 1W84A 4DFLA 5D1OA 4GRBA 4JJRA 3ZHPC 4EH9A 4FVRA 4AW1A 3CEBA 4S30A 1DM2A 4ZTSA 2PY3A 2RGPA 2Y6OA 1PXPA 4FKVA 2VTIA 3PXQA 5IQGA 3KCKA 3EFKA 1OVEA 2B9HA 4WG4A 1W82A 3LCKA 3OT8A 4XCUA 2E9OA 4HJOA 4UB7A 2BFYA 2WQOA 1F0QA 2X6DA 4O7ZA 5EHLA 3PP1A 4HNIA 2C47A 4FT5A 3KXHA 3ODZX 3Q04A 2ZOQA 4ZK5A 3G9NA 3VHKA 3NVKI 2JAVA 2GNHA 4PMMA 3ZUTA 3LFNA 2WTVA 1S68A 3QAME 4ZLOA 1Q8YA 5A6OA 2YS7A 1B38A 3DOGA 5BMMA 4P7EA 3BU6A 1OKYA 4F7NA 2X2MA 3UIBA 5DYJA 3MDYA 4QTBA 4YTIA 5TT7A 2DABA 4E5WA 4IIJF 3ZUVA 3TW7A 4B6LA 5L2IA 3R83A 3ZTXA 3WZJA 2XIKA 4FKSA 3DK3A 3QCQA 4TYEA 3TWJA 5JGAA 4GU6A 4RC4A 3EQHA 5FGKA 5H8GA 2XJ1A 3V4ZA 3DJ7A 4O0VA 1VJYA 3LMHA 4S34A 1W98A 3RR5A 1W96A 1U4DA 4QQ5A 3FMJA 2BMCA 2GHLA 3EB0A 2YISA 3LXKA 4FZ7A 3W8LA 5HTCA 4CKCA 3DT1A 4ENYA 3S95A 5BYYA 4C33A 5AUWA 5JQ5A 2PVLA 5DAAA 4DRFA 3BLQA 3ZBXA 3OUNB 2I0EA 4Z3VA 3C50A 4LGHA 4X21A 4RIXA 2RKUA 3ZUUA 4C35A 1ZXEA 4A9UA 1OECA 1PMVA 3A61A 2ZJWA 3NNUA 5AUXA 4YC8A 3QLGA 1YXSA 4NCTC 3PVGA 2F4JA 2JDSA 2XAMA 4V05A 2SRCA 4BJJB 1H24A 4DG0E 1Y8YA 4PV0A 2P3GX 1IYDA 1CS0A 3UOKA 3ETJA 2XNPA 2NPQA 3V5PA 1BI7A 2Z04A 1Z9XA 3O96A 4QOXA 4R3PA 1JSUA 3MH3A 4M69B 3ANQA 2QF7A 1ZZ2A 5J2UF 1KWPA 3ZLXA 2HXQA 2ITTA 3G2FA 4M68A 4NH1A 4XHKB 3TTJA 3MJ2A 2BZIB 4XUFA 4C2WA 4ZTMA 4ENXA 3VQUA 5BWUA 2QLUA 4U3ZA 5KHXA 3GCUA 2F7EE 2UZTA 3LVPA 4IBMA 5BVWA 5IQDA 3TY5A 2BAQA 2JGZA 3D5UA 3Q53A 3H9FA 2G2HA 5DG5A 3KMWA 5CANA 4USFA 5DISC 2R7MA 5BWXA 4BYJA 5TOZA 3LMGA 4WG3A 4WRGA 3KMMA 3R73A 2GTNA 3E8NA 3AMYA 4GU9A 1EKVA 2YZLA 4RX8A 4DT8A 2C5XA 2HENA 3MVHA 3F3ZA 3V5TA 2YRXA 3R5FA 3FXXA 4HZRA 3KF7A 5DT4A 4CRLA 2QLQA 4D2RA 2CGUA 2YL2A 3M1SA 2VNWA 3G8DA 5JVLA 5HICA 4IX4A 4XS2A 2LAVA 4BDFA 4M67A 3F3WA 4M7IA 2W9FB 3SVVA 1H1QA 3WE4A 4BBMA 3HZTA 4ACHA 5LA6F 1ZMVA 2X81A 4RVKA 4XOZA 5KE0A 4WO5A 2I6LA 3NIZA 3MESA 2FGIA 1H26A 1M17A 4KIPA 3QHRA 4YJNA 2WTDA 4AXCA 4GJ3A 4QQJA 3PLSA 4O0YA 1TQMA 1GAGA 2VD5A 3KGAA 4FKJA 3ZFYA 5LOHA 1VLRA 3DBCA 5IDPA 4E4TA 4XRJA 4CFMA 3QRJA 2WMTA 3P4KA 3W55A 5CTPA 5F20A 2ERKA 4DFXE 4PMPA 3PY1A 4ACGA 4RIWA 4XX0B 3W1GA 4NM0A 4WUNA 5LCKA 5M06A 3FC1X 3CSWA 2HCKA 2I40A 4FT9A 4CNHA 4E5AX 2UW7A 5C8MA 4FUXA 4UYNA 4AE9A 2PE2A 4D5KA 2CLQA 3ACJA 1OUKA 1JKSA 3I79A 3DS6A 3MY5A 4QDEA 4TNBA 5E91A 5L6WL 5LMAA 4GUEA 2R5TA 3EOCA 4KKEA 3FPQA 4YBZB 3QD2B 4MXYA 4YJQA 1KV1A 1WBVA 3OWLA 1J1CA 2H9VA 3GEQA 1WVXA 4GYGA 3RKBA 3SGIA 3COMA 4W8EA 3IONA 4IDTA 3SD0A 3V6RA 2FO0A 4DBNA 3TIIA 2CCHA 4W8DA 3T99A 4RVTA 5I47A 3FY0A 2YCFA 3OUKA 3VRYA 5FXRA 4XJ0A 3A4OX 4BCHA 1BL6A 1W7HA 1WVYA 4M9UA 3NBYB 4DGOA 3C51A 1I1KA 4XG9A 2RFSA 1TAEA 2WU7A 5J8IA 4USEA 5FNVF 1I7NA 3IOPA 3SRVA