2YZLA

Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
239
structure length
238
Chain Sequence
KLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGGAKHDVKQGKGYLNALISSKLFEALEENGVKTHYIKYIEPRYMIAKKVEIIPIEVIVRNIAAGSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALKVNEVLKKLFDEKGIILVDFKIEIGKDREGNLLVADEISPDTMRLWDKETRDVLDKDVFRKDLGDVIAKYRIVAERLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 77
structure length 238
sequence length 239
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yzlA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2yzlA02
4AXAA 5KZIA 2AC3A 4EH5A 3MH1A 1M7QA 4C34A 3VW8A 2VTRA 4HYIA 2YZAA 2XNOA 4BICA 3ENMA 1VKZA 3MH3A 4HOKA 5CY3A 4FG7A 4IDTA 3NUAA 3KRRA 5HV6A 2UW0A 3ZLXA 1B39A 5HG5A 3OS3A 5IH6A 1M17A 1OBGA 3QTZA 2YEXA 3B8RA 3FQSA 1OZ1A 2VTAA 3L9MA 4YZNA 5KKRB 5LWMA 5BQ0A 3R5HA 2BRBA 4JDHA 4MV1A 3W33A 4UWCA 3QWKA 4DLJA 2QO2A 3VQHA 2HGSA 1BL6A 3POOA 2BR1A 5IQIA 4YZ9A 1PY5A 3ZOSA 2XRUA 1KE8A 3OWPA 4UYAA 4LV8A 5CXHA 2UUEA 2XNPA 4D1XA 4CG8A 5ETCA 3EFJA 4S33A 2G2IA 1KWPA 5CT7A 5BMMA 4CT2A 4EZ3A 2QU6A 4BHNA 4CV9A 2WTCA 2Z2WA 3MH2A 3Q04A 2I80A 3G0EA 3RTPA 2ZDGA 3AC2A 1QPCA 3LIJA 4QYFA 2VN9A 2HWOA 3BWJA 3AOXA 2XA4A 1ZYCA 2YITA 4FVRA 4JBVA 4RIWB 4ZTNA 2HZNA 3R9NA 5C8KA 2O63A 3FQHA 3ZO3A 3F3VA 4L8MA 4Y95A 1OIYA 3D9VA 3S3IA 5CLPA 5AX9A 4A4XA 4PNIA 2O65A 2WEIA 5HO8A 4FSZA 4YJNA 2YDIA 2XCHA 3ZZEA 1WZYA 2ITPA 3QTXA 4FKPA 4QMYA 2X0SA 2BIYA 3GFWA 4J7BA 4EOJA 1URCA 3QUEA 1KC7A 2BVAA 2XMYA 4R77A 2NU9B 3TNPC 3QRUA 5HBEA 2A19B 3WYYA 1F3MC 4W4XA 3GC0A 1YXUA 1BUHA 5AUUA 1M14A 3QALE 4N57A 4EOQA 5TO8A 5A4TA 2VR1A 2XCLA 3PFQA 1Y6AA 3NUUA 3QKMA 4XNEA 5JQWA 3N4UA 4Z3VA 5JFSA 4TWCA 4O84A 3LPBA 3H9OA 5B0XA 1PXKA 1OITA 2JDOA 4G3GA 5HICA 1U5RA 2JAVA 3VS3A 4CG9A 3LQ5A 5IU2A 3D2KA 4FT7A 3F5UA 3WZJA 4YO4A 2C6EA 3C4XA 5M55A 4LUDA 3V8TA 4IMYA 4BBFA 4DEEA 2J51A 4KS8A 4XEYA 5I9WA 4I50F 4MV4A 1PF8A 2Y9QA 3NYOA 4FSYA 2R7IA 3VUHA 4I93A 3BLHA 4BDDA 4EH4A 4XG8A 4IM3A 5HX8A 4F08A 3DJ6A 1OKZA 4JR7A 5D7VA 3V4SA 4BR3A 2A2AA 4RBLA 5ANKA 3DDPA 4RJ8A 1Q99A 4FK6A 4AW5A 4R3PA 3HLLA 4ITHA 2PZPA 3A7JA 3QZFA 2Q83A 4RX9A 5C26A 2E2BA 3NVKI 1ZYSA 3KXNA 4CCBA 4XCUA 3SRVB 2C5NA 4KSQA 5IMEA 3FLYA 3NNUA 4PMMA 2V7OA 2F57A 1UU7A 2GNJA 4U41A 3TIIA 4I6HA 4YHFA 5M57A 4FKVA 4G5JA 4L53A 4XV3A 3NIEA 4FE2A 4RPVA 4RQKA 5HG7A 3FSFA 3GVUA 5DPVA 4NM3A 4BDFA 1KE9A 2Z7SA 5HBJA 5J2TF 3R7EA 3R71A 1FMKA 1B6CB 3A4OX 3NW7A 4FV2A 2VTHA 2VTMA 3BV3A 4O27B 3PXQA 5FEDA 3VS7A 1G8AA 2I0HA 4E4LA 3TZ9A 1YHVA 3DK6A 4I24A 4F1TA 5LQFA 4HJOA 3PA5A 2DWCA 5KO1A 3FY2A 2WMTA 3PIYA 1JLLB 2ITZA 5DRDA 1A9XA 4XBRA 3BI6A 4HNIA 1KV1A 2JKQA 5I5ZA 4YJ3F 2QD9A 4Z7HA 4FGRA 5CENA 1SNUA 4FIIA 5GIPE 4DBXA 3BPRA 4DLKA 2FO0A 1B6SA 3UP2A 4ZJVA 4E26A 3K54A 4QQJA 3SAYA 4JRVA 3R73A 3S1HA 2I6LA 4ZI7F 4R7HA 1IR3A 2HY81 1NVSA 2QOQA 4DLIA 2B55A 3ET7A 2V22A 3NUYA 3S4QA 3BV2A 5EK7A 2CNVA 2G2HA 2R3KA 4BN1A 2VWBA 2YL2A 3UZTA 4MX9A 2IZSA 1OIUA 5M07A 3Q6UA 3LMGA 3DK7A 2RIOA 2X1NA 3BYMA 3MVMA 4HYUA 4IB5A 3AGLA 2H34A 4OW8A 4ZJJA 1O9UA 1SNXA 2J0LA 4IE9A 4GJ3A 5IQHA 4U7ZA 2BCJA 2UZDA 3K5HA 4FNXA 3EQPA 4EK5A 2DZDA 1LR4A 4G2FA 3DBDA 3F82A 3DF7A 3TUBA 4O7SA 4EOLA 4TNBA 5CAEB 3ZXZA 3NNWA 4G3DA 4W4VA 4WA9A 3RV3A 3A7GA 3HV7A 3D4QA 4M13A 2XM9A 2W70A 4USFA 2EU9A 4LRKA 5KMJA 4F6WA 4Z55A 3NAYA 2XS0A 2PE1A 4H1MA 3IDCA 3UYTA 3D5WA 4PRJA 4BCJA 3FY0A 4O4HF 1OL2A 4FNYA 3VBQA 5H9BA 3DK3A 3CGFA 3GCPA 4GK4A 4RIYB 5F95A 4QMZA 3HAMA 4X0MA 1YQJA 1KE5A 3CQEA 1YXSA 3II5A 1E1XA 3U54A 3NR9A 4HGSA 4LM5A 5AM7A 5AM6A 3MYGA 5B7VA 5FQDC 2P4IA 3FL5A 1P5EA 3V8SA 2IG7A 3BHUA 5EW3A 3ZSGA 3F5XA 4GSBA 2XK4A 5L2SA 4R7BA 3DBFA 3LJ0A 4WT6A 1OL1A 5M09A 3SGCA 5ANGA 2F7ZE 3ZXTA 2BRHA 4TXCA 5DH3A 2ACXA 5CVGA 4PV0A 2VX0A 4FT5A 4BC6A 1UU3A 4G3FA 4HVIA 4RIXB 4BKJA 2W6QA 4PQNA 1W82A 3FBVA 4H36A 3R8UA 3VRYA 4TL0A 5CB4F 5AP1A 4JT3A 4MV9A 1KJ8A 4YC3A 3MB7A 3IQ7A 3U9TA 1FMOE 5ETAA 3SVVA 3VPBA 4IANA 2XJ0A 4AGWA 2DQ7X 1OECA 5E8VA 4BGHA 1I7LA 2FB9A 2R3FA 1Y8YA 2ZV2A 1DM2A 2J4ZA 4LL5A 2XIYA 5CU2A 2QR8A 2C4GA 2BILB 1KBLA 4Z16A 1CMKE 5D11A 4AACA 4IWDA 4AFJA 3VRZA 2V0DA 4TTHB 4GT5A 4M68A 4EKKA 3LP8A 2RF9A 4QP3A 4IZAA 4F1MA 2OLCA 2GQGA 3R23A 4C5AA 3ULIA 4BB4A 3OY3A 2V55A 3I1AA 4X6QC 4F09A 4RZVA 3EZVA 5HQ0A 5BUJA 3OT3A 1LEWA 3LJ1A 4RWLA 3ZCLA 1JSVA 1RDQE 3FWQA 5F20A 3HA6A 1LPUA 2RFDA 4F4PA 4NJ3A 2WU6A 5ANDA 4C2VA 3VUIA 2ERZE 4O21A 2PK9A 4XOYA 1EH4A 4CNHA 4ZS0A 2WQOA 1MRUA 3OROA 4GH2A 4O7YA 4J52A 3AW8A 2C3IB 3P0MA 3HECA 3SXRA 2PVMA 3VS0A 4ZOGA 5I9YA 3KREA 2WQNA 3G5DA 3FZRA 5HLPA 5AUVA 4B99A 2ZAZA 5E1SA 3C5UA 5IQBA 4MBLA 4F7SA 4IJ9A 4QNAA 2ZMDA 4XBUA 5DA3A 3SG9A 2YDKA 3EQFA 4RVLA 4I94A 3PJ8A 4ACGA 4XRJA 4RFZA 4BCPA 5B2KA 2OXYA 4BRXA 2WYOA 1JWHA 4O7LA 4BCOA 2YJRA 4DBNA 5DG5A 2W1EA 2XF0A 2XIZA 3C4FA 5ANEA 5EM5A 5CAUA 4B7TA 4D1ZA 4A9UA 4CFMA 3R9OA 3WILA 3JVRA 3LCDA 4DH7A 2BAJA 4E73A 3COHA 3VUMA 3ZLSA 4MNFA 3MS9A 4AZSA 2BROA 3E8CA 2AYPA 4PDPA 3QX2A 4WD5A 1EYZA 3EJ1A 4H39A 4AZEA 4XV2A 5FLFA 1DAYA 3UQFA 4GFGA 3RGFA 4DTBA 2A27A 3ZHPC 2JIIA 4WRSA 2HXQA 3OCSA 3QTUA 3T8OA 3FMKA 1UU8A 3ZMMA 3UVRA 1EHIA 3VN9A 2VO3A 2B9JA 3CKXA 3NYXA 3V04A 5EDQA 4RZWA 2J5EA 5LCKA 4UXQA 3F88A 4IWPA 5CNOA 5HI2A 5AV4A 4FFMA 3UPXA 3OXTA 5GNKA 5CSXA 4E7WA 4J99A 3OW3A 3EZRA 3A60A 4LG4A 3AG9A 4GCJA 3Q9WA 1E4EA 1Z2PX 3DAKA 4YJ2F 3HEGA 1KE7A 2GMXA 4MXYA 3CTJA 3WF8A 4FEWA 2Z7RA 3GI3A 1Q61A 2WHBA 3WIGA 4IDVA 3C4CA 1JQHA 2WMVA 1PXPA 4K2RA 4BDJA 4BCMA 4IVCA 5BVEA 4CLIA 4P5ZA 4QNYA 1IA8A 1WBVA 2PHKA 3RP9A 3TINA 3C51A 5IUGA 1R1WA 2R7LA 4M69B 3FMLA 3F3WA 3GC9A 3ORLA 3M11A 4H3QA 5AUYA 3VS2A 4AN9A 2PMLX 3KULA 3R8MA 5K4JA 2XH5A 2ESMA 4XYMB 4QTBA 4YZDA 5F9EA 2FPPB 3NUPA 2UZEA 4O7WA 3PZHA 1MP8A 3RAKA 4C61A 1OBDA 2AUHA 3PTGA 1CKJA 1BMKA 2CN5A 3R1NA 4BI1A 2LAVA 2ITOA 4IFGA 4O7VA 4DT8A 5J5SA 4TYEA 2X6DA 4S2ZA 4W8DA 3TNQB 4IHPA 3V5LA 4XP0A 2YFXA 4FZ7A 4TRLA 3R6XA 3AMAA 1Q3WA 4RJ3A 5E91A 4DINA 2W6MA 3M1SA 5D10A 1Q8YA 4PDOA 3E8DA 4L45A 4GV1A 2CGUA 5HEZA 4F7JA 5LMBA 3AQVA 4XG2A 2WB8A 3Q4ZA 2OFVA 3EIDA 1SVHA 2P3GX 3TV4A 4A9TA 4M14A 4CEGA 3E3BX 5AUXA 4ZSAA 1L8TA 1ZOGA 2Y4PA 4DEGA 4NUSA 1KOBA 4FUYA 4XS2A 3ZO1A 2OZAB 4L3JA 2VTQA 5JSMA 5CA0F 3PA3A 4R1YA 4S32A 4ANMA 3I4BA 3TL8A 5GONF 1YOJA 4ZLOA 3JYAA 3TEIA 3UTOA 5A6NA 2GQRA 4H58A 3CTQA 1CDKA 2BDWA 2XKEA 4YBJA 2CGXA 5E8TA 1PK8A 3GXLA 2GNFA 4IAFA 3FMMA 4XV1A 2JKOA 5LXMA 4BBEA 1EUDB 2XD4A 2XKDA 5DMXA 3CE3A 3DS6A 4TZRA 2WMAA 4AN2A 3T3UA 3G6HA 3F66A 4LV5A 3RCDA 3GIDA 5KNJA 3GQIA 3FE3A 4DTAA 4IVAA 2AC5A 3ZBXA 3QBNA 3HVCA 1ZOEA 3OT8A 1O6LA 3TTJA 2W1FA 1W8CA 2YDJA 3DGKA 4NCTC 5EKNA 4FZ6A 1JNKA 1ULZA 2ITUA 4S34A 4Z9LA 1YI6A 3FZOA 3ZBFA 5HTBA 3ZM9A 5FTQA 5E8XA 4ZMFA 4AAAA 2QOBA 4YU2A 2ONLC 4OR5A 2BDFA 4Y8DA 3FLWA 4YLKA 3TZMA 4AU8A 3OF0A 2HAKA 4JR3A 3IW7A 4I1ZA 2X4ZA 3E87A 2PZIA 5L6OA 4CCUA 5JH6A 3FXWA 3MWDA 3R02A 5BYYA 3RMFA 2H9VA 5LWNA 4QPSA 2C6IA 4N4SA 3HO8A 4EHGA 3SV0A 1FBNA 4U80A 4PNKA 2GQSA 4J8NA 4CKRA 3LFCA 4QMPA 4R7IA 5KCVA 3MJ1A 3DT1A 3VWAA 1K2PA 3KALA 3BU3A 3MPAA 4RLLA 4MBIA 2RL5A 3RHKA 3QU0A 4KBKA 3T9TA 3SD0A 4Q2AA 4X2GA 3WF7A 3WOWA 3HB9A 2NU8B 4FNZA 2C1AA 2OICA 1K3AA 3R63A 4C35A 3W8LA 1YVJA 1OL7A 5BMSA 4M15A 3LE6A 5C4KA 1G3NA 4ASEA 4BYJA 2HZIA 4B6LA 4BTJA 3ID6C 1U46A 3NLBA 4QMWA 4Y5HA 3I5ZA 4ANSA 1WCCA 4UV0A 4FZFB 3GC7A 3DV3A 4NJDA 4FFNA 3ZFXA 3OMVA 2BPMA 4MD9E 3KA0A 2WTKB 3K5UA 3QQFA 2OK1A 4MXAA 4A9SA 4KBAA 1UV5A 3DLZA 1JBPE 5C1OA 2JEDA 4JL9A 4U42A 2BFXA 3W2PA 5HVKA 3BGPA 1Q8UA 4GUBA 3VA7A 5CANA 4K77A 3ZH8A 3P23A 4XX0B 3FLQA 2Z02A 4ZHQF 2XYNA 5AP2A 3VF8A 3P7CA 4FIHA 4GG5A 4BI0A 3RUPA 3P1AA 1H4LA 1U54A 3LVPA 1B6RA 2BALA 2XUUA 1OPLA 2UW9A 3OUKA 2OGVA 4X2JA 4BIEA 3C0GA 3R8LA 4RQVA 1H01A 1VBHA 4KKEA 4K18A 3LCTA 4KIPA 3F2NA 3DCVA 3FQEA 4A07A 4QTDA 5BVDA 5FXSA 2PPQA 1OL5A 5IQCA 2OFUA 2VNYA 3PUPA 2YCSA 4DFLA 2W71A 4FFRA 4YJVA 2OIBA 3FZ1A 3LFSA 4RWJA 4FL3A 2UZNA 5HTCA 5JFXA 2O64A 3BE9A 3MA6A 4GU6A 4QYYA 3KRJA 4ZZOA 5AP5A 4YZMA 4NW6A 4WKQA 3QXOA 1WBNA 1OIQA 2B53A 4YNEA 2GHGA 1YWVA 3R8PA 4MKCA 3ZM4A 4FEVA 3RHXA 2DYLA 3ITZA 3RPRA 3QD2B 1PXLA 4D4VA 1JKKA 3MFRA 4D9TA 3LFDA 3A62A 3BIZA 5JN2A 2ITVA 3O23A 4I23A 3U9CA 3DJ7A 3KULB 3PLAE 2W6PA 3QZGA 5K3YA 4DG2E 4F65A 5LVPA 2A4LA 5HHWA 1YW2A 1JDBB 4U44A 4U8ZA 4WUNA 2JIUA 2IVTA 4YR8A 2FUMA 4JG8A 4O2AF 2H96A 2CLQA 4WSYA 5FXQA 3JVSA 3LXLA 4AA4A 5IQFA 1YXXA 2OG8A 3H3CA 3OEZA 3TZ8A 1TKIA 2BHHA 1IEPA 2Z04A 3H10A 3P5KA 2VTIA 4ANBA 3I79A 4BZNA 4RJ7A 1ZWSA 4R3CA 4YJRA 4C2WA 4WO5A 3V5WA 4PMPA 1JKTA 4UXLA 2R7MA 1I09A 2XBAA 4FKWA 3FMEA 4DCEA 5J7HA 4MNEA 4H1JA 4X6RA 5CU3A 2PSQA 1MQ4A 4YPDA 4O91A 4F6UA 3ZFYA 3L1SA 4FTQA 4P90A 5E8SA 2EWAA 2QHNA 2YM4A 4JG6A 5AAGA 5IYZF 4TT7A 4YBKA 3MTFA 4MHAA 4QP8A 4KRCA 4I41A 4XZ3B 3QHWA 4FSWA 4FV1A 3R30A 5CAOA 5CF4A 4RFYA 3C4EA 1ZRZA 4YTHA 2PUPA 5BMVF 3WO0A 4NW5A 1AUXA 4FMQA 4OTIA 5LP6F 2W96B 5EW9A 3W2OA 4CKIA 5HZNA 1WBWA 2CGWA 5K5XA 4RJ6A 5B2MA 3EH9A 1GOLA 4K1BA 1IASA 3TTIA 2R7KA 5EHYA 3UE4A 4B4LA 4CMTA 1W96A 3OCTA 2I1MA 3H4JA 3UODA 1W0XC 4HNFA 1GZ8A 2IZTA 1R0EA 3OOMA 3F9NA 4TWNA 4CD0A 1YOLA 4EH3A 3TKHA 3QHRA 5HVJA 2BAKA 4FSMA 3WE8A 5I9XA 4FTUA 3JS2A 1CS0A 4PL3A 3FMHA 3NCGA 1OI9A 2G01A 2BTSA 4WOVA 3SC1A 4YTFA 4MYGA 5TT7A 1H0WA 2GS7A 3OXZA 4TYJA 1SYKA 3RPOA 3UIXA 3EKNA 2YABA 4G34A 4JX3A 5AIKA 2GDOA 2PBZA 4BCGA 3ETHA 3G2FA 2J0MB 5A9UA 4FT3A 4HCTA 4N6YA 3GU7A 5JZNA 4E5BA 4IHJF 1QPJA 2P2HA 5CU4A 4D9UA 5EQYA 2B4SB 4JDIA 4IX3A 4E6DA 3F2RA 3HAVA 3QKLA 4GL9A 5BPHA 4ZTSA 3IG7A 4CT1A 4EONA 2BUJA 4Y85A 2VWVA 1A06A 5LJJA 3U9NA 2JDTA 4NTTA 4DEDA 3R1SA 3EQHA 4J95A 1CQIB 3PRFA 3QCYA 1XH4A 5EM6A 3QWJA 2C3JA 3HL7A 4FA2A 2VUWA 3FZSA 3BE2A 3HKOA 4C3RA 2F2UA 3U87A 2H8HA 2ETKA 1T36A 5CT0A 4LRJA 3PA4A 3LMIA 3QQJA 4ZTQA 3F3TA 5FTGA 2I8CA 5HNBA 5EH0A 5I0BA 4AT4A 2BDJA 3DB8A 3E92A 4NKSA 1Z2OX 4L1KA 3WIKA 3BYVA 4XP2A 4C4HA 4F9AA 1TQPA 2P0CA 1BLXA 3NW5A 5E4HA 2J7TA 3PZEA 4G17A 2WTKC 2DS1A 2FSTX 4G9RA 2F2CB 4MV8A 3UMWA 3ZS5A 3L8SA 3LFFA 4FOBA 4AZFA 3EQCA 4ZOLF 3G0FA 3OUNB 5HG8A 1U54B 3NPCA 2R3JA 3V51A 2CCIA 4CTCA 3MVJA 4ZLZA 3VOTA 1V0OA 4F1OA 3O8UA 2C0IA 4KABA 3UO6A 1FGIA 3JRWA 2NRUA 2OSCA 3R22A 4YSJA 2W6OA 3C1XA 3BWFA 4MXCA 3TUDA 3HA8A 3FHRA 4GFMA 2V7AA 3R9DA 2Y6MA 1C3OA 2UZOA 2X4FA 2XYUA 3LJ2A 5EG3A 2R3GA 2SRCA 2HELA 1PMNA 5AA9A 1NXKA 3EOCA 3MESA 4I5MA 3ZZWA 3AX6A 1SZMA 1GJOA 3ORTA 4CFNA 4HVGA 4JJRA 3P9JA 4RC3A 3GFEA 2ZOQA 4IX4A 4JQ8A 3KXXA 5FM2A 4EH6A 2BFYA 3C0HA 5EYMA 4RJ4A 1HCKA 4QYHA 2YM7A 2YRWA 4R3RA 4CFFA 1KE6A 3E7OA 2YHVA 3L9LA 3RAWA 4J8MA 5C1PA 3FHIA 4QTCA 4YP8A 4CTBA 4C4GA 5HD7A 3IW4A 5IA1A 1WMKA 3JXWA 3IO7A 3QKKA 4IZOA 1OGUA 5LYJF 3F5GA 4NFMA 4FKRA 3N6RA 3DTCA 3KMUA 3NAXA 4JLCA 2XB7A 5GJGA 5AP0A 1GZKA 4I6QA 2OJIA 3LFBA 1J7LA 2E9PA 3Q3BA 1VYZA 4M7IA 2WMRA 3DBQA 4EHZA 3FC1X 2X2KA 3OOGA 4L7FA 4AP7A 4C5BA 3QA8A 5FD2A 3F7WA 1ZMWA 1VR2A 2XK6A 3CSVA 2X2MA 4NM0A 3N4TA 4BCIA 3I7CA 4TYIA 2QKWB 3WI6A 2CKEA 4X3FC 2WTDA 4AGCA 1P14A 4DFZE 5BVKA 3NUXA 2VV9A 4YAKB 3HRBA 3NVMB 5HO7A 2X0GA 3MTLA 5CS6A 3R01A 3ZUTA 3I60A 3KAJA 4GKIA 4FSRA 4ZZNA 5EHLA 1JVPP 4QMMA 3RV4A 1WVWA 2WMXA 3C7QA 3MB6A 3D94A 4KNBA 4M84A 3GT8A 4MNEB 4Q5HA 4FEXA 3O71A 3TDVA 5J1WA 2B9FA 1UNGA 2PVHA 2UZWE 3KK8A 5DIAA 4L42A 2FH9A 2B1PA 5J9ZA 5L8JA 3D7TA 3SXFA 1GGOA 3RAIA 2WTJA 3QTRA 2IZRA 2ZB0A 3MW1A 4IIRA 4AE9A 3KN5A 4DEAA 5JFWA 2G9XA 1Q8WA 1QCFA 4FTCA 5AV2A 2YM8A 4QPAA 5HE3A 4AT3A 3MV5A 3QUDA 4TYGA 2XKFA 4MVFA 3GGFA 4AX8A 4F0FA 2DIKA 4PMTA 3KY2A 3D5UA 4GMYA 4I6FA 3W2CA 2QK4A 5DR6A 5DR9A 5EFQA 3B2TA 2R5TA 3UOJA 4L7SA 3BYUA 2YZNA 4RX7A 5ANOA 4XRLA 5LMKC 2R3RA 1WBSA 4KD1A 2X7FA 3KEXA 2IPXA 2CDZA 3JY0A 5IPJA 3MFTA 4RIOA 2VTJA 3DDQA 3EL8A 4NK9A 4MV7A 2WMSA 3QC4A 4D2RA 4QQTA 3PIXA 4HZSA 2J9MA 3GLKA 5J87A 2VRXA 3FZTA 1UVRA 1QL6A 3TNIA 1H24A 3VMMA 4RLKA 4WG4A 5JKGA 3BU5A 5CF8A 3QQHA 5K4IA 4E4TA 2R3LA 1SMHA 3JPVA 2JBPA 4RWIA 4ACHA 4FFOA 3NMUF 2QU5A 3MY5A 4V04A 5C9CA 1BI7A 5JGBA 4GT4A 2NU6B 1KJIA 4RZQA 3TJCA 5KMIA 2XNNA 4EG0A 4MWIA 2P55A 3ACJA 5AIRA 5H2UA 1FVRA 5DRBA 1I7NA 3RWPA 4KKHA 2RFEA 3D14A 2CPKE 3CPBA 3DKCA 3NSZA 4IC8A 4WNOA 1YXVA 3ZEWA 3WO1A 3FAAA 3OEFX 3OTUA 2G1TA 4Q5EA 5JEBA 4O0WA 2B0QA 2YISA 4NL0A 1J1CA 3LKMA 5HE2A 3UQGA 3LWBA 1NVQA 3FL4A 3JY9A 2UW3A 3RK7A 3TWJA 3C13A 5EYKA 4O6LA 5HBRB 4DAWA 3CC6A 3VS1A 4APPA 3GBZA 3DOGA 5HX6A 4PTCA 3IOKA 3DAJA 4Y83A 4UZDA 3REPA 4AZWA 4XLVA 4OBPA 5EM8A 5KKRC 1PKDA 3W18A 4ZY6A 3ORXA 3HYHA 5ANJA 3PSCA 5AV3A 4I55F 2ZDQA 4EH2A 2NUAB 3V5TA 5HLNA 4HCVA 4G5PA 3IGOA 4R1VA 5IQEA 3VUGA 5AEPA 4ZLYA 4DH3A 4EOPA 3JZIA 2C0TA 4GRBA 5HIBA 5DFPA 4AFEA 4Y5QA 3LXPA 3NUSA 5A46A 1OKVA 1QPDA 3GU8A 2XK9A 3ORZA 2QG5A 4ASZA 4GK3A 5CF5A 4AZVA 2BZHB 3UNKA 4C62A 1VJYA 2CMWA 3LFAA 3SE7A 5CEIA 2QURA 2C3KA 4YGAA 3WBLA 3BHTA 4P2KA 1V0PA 3ANRA 4OTGA 5CQUA 3EL7A 4DFBA 5KBRA 4FVQA 4JIAA 4ALWA 2VAGA 2DUVA 5GJDA 4O7NA 2NPQA 4OGRA 5CF6A 4O0UA 4OBQA 2J0KA 3HMIA 3PXRA 4PL4A 2Y0AA 3KVWA 3AT3A 4E4XA 2PVJA 1ZMVA 3QRKA 3QZIA 5E8WA 4O4IF 2VO0A 3PVGA 5M08A 5CU6A 4OUCA 4D0WA 3O17A 4I92A 4ASDA 4O22A 3D7ZA 2W6ZA 3C9WA 2CLXA 4BDIA 3L9PA 3UIBA 3DJ5A 4FZAB 3G9LX 4JBOA 3BQRA 2ZYBA 5EZYF 5KMMA 4QOXA 5C4LA 1GLVA 1PXOA 1IA9A 3NNVA 2IW8A 1WR2A 3DQWA 4QP1A 3LFEA 2VWXA 4E6AA 5JRQA 4CFUA 3R7VA 3A2CA 3W2QA 4ZP5A 4AGUA 5IDPA 2EB3A 4IAAA 4GIIA 1NY3A 3ORMA 4E8AA 3QFFA 5LXTF 4WBNF 4TY1A 4L46A 3BLQA 2WIPA 1E9HA 4OT5A 4DIMA 3OWKA 4C38A 2JFMA 4UB7A 2BKZA 4FFPA 4AN3A 3KXZA 1M2RA 4O0XA 1Q24A 2C68A 5M56A 2IW9A 2HJWA 3T9IA 3P7BA 5BVWA 5IF1A 3Q5IA 1R78A 3D7TB 3ZLWA 5DE2A 3RNIA 2ZV9A 3R1QA 5TOZA 5LMAA 2CHLA 3WF5A 3MVHA 1W98A 2W7XA 2ZV7A 4X2NA 4KS7A 2FP4B 4WRGA 4UWBA 4AOIA 3DKOA 4DCAA 1XBBA 1PXIA 3UJGA 2IP4A 3PY1A 5DGZA 4DFNA 3G8CA 2YM3A 2YAKA 1WBTA 3IOPA 3TZ7A 2XCKA 3FI4A 4MBJA 4XV9A 3RK5A 3KC3A 3UOHA 2OH4A 4PMSA 5JH7F 4D5KA 1UNHA 4C58A 4BIDA 3UPZA 1GY3A 3V01A 3OY1A 1Z57A 5DEWA 4DC2A 2FPIB 3IW5A 3P08A 3WF9A 2BZKB 3FDNA 2XK7A 3VBYA 5EDRA 1G5SA 5K5NA 5IA4A 4S31A 1OUKA 2GFSA 2VWIA 3HRCA 4HGLA 3Q2JA 3AC5A 4DT9A 3D5XA 3P7AA 5CQWA 4D55A 4BCQA 2CNQA 3KQ7A 2W5BA 3M2WA 4FTNA 3GQLA 4FR4A 3QQKA 1PX2A 2WIHA 4ZS4A 3LZBA 3WNZA 2BZIB 3TV7A 3QL8A 4ENXA 4O0TA 2YZGA 3IDPA 4UN0C 5D9HA 2R85A 2QONA 2J6MA 4LOOA 2KULA 4G16A 2ZDHA 2IVSA 4CFXA 4MCVA 1JSTA 3VVHA 2FB8A 2J50A 1ZLTA 3UVQA 4HVSA 3KCFA 3FXZA 1FGKA 3PXKA 5KX5F 2E9OA 4IB1A 2Z7LA 5C27A 3A4PA 3QTWA 2GS6A 3LAUA 3PVWA 4F0IA 3OUZA 1FPUA 4PTEA 2ZM1A 4K9YA 4YJUA 2XIRA 2WPAA 4YJOA 3UOLA 4DH8A 3R2YA 3KF4A 4BDKA 4BDCA 5HCZA 4EI4A 4IACA 5EQEA 4IBMA 2X2LA 1XH5A 4HYSA 4FFLA 2YCQA 3RK9A 2HIWA 2ZB1A 3CQUA 5FP6A 3SOAA 4EOIA 4PP7A 3DKGA 3SW7A 3A8WA 4IFCA 4WNMA 3VS4A 3VJNA 3TG1A 2C30A 2EVAA 2UZBA 5JGDA 4IAKA 2BZJA 1YWNA 2WTVA 4HW7A 3KMWA 2Y4IB 3FYKX 2PVNA 3OTVA 3R2BA 4FKLA 4CVAA 2PWLA 3IONA 3F69A 4D58A 2B9IA 3U4UA 4EK6A 2WU7A 4NH1A 3UNZA 3ZRKA 5EI2A 2UW6A 2HW6A 2P2IA 5DBXA 3BHHA 4O82A 3DKFA 3W1FA 3ZSHA 2ETRA 3A7HA 5ICPA 4V0GA 5L2WA 3Q9XA 4DTKA 1UU9A 3QLFA 3U55A 2XIKA 2J0IA 3OCBA 4FL2A 4U43A 2O8YA 5KHWA 2V59A 2YZMA 2WEVA 3RM6A 3HBLA 3U9SA 4G6LA 5I4NA 4IX6A 1M7NA 2YJSA 4BZDA 5GJFA 3U6HA 3QRJA 3AD4A 5DT3A 4IB3A 4KBCA 2W05A 2WAJA 4NU1A 4L6QA 4DH5A 4O2PA 1H08A 5H8GA 3ZO2A 1KOAA 3CPCA 4L9IA 2NU7B 1ZZ2A 3L9NA 5BYLA 4EH8A 5HU3A 2QHMA 2C5YA 3SLSA 2WGJA 1K9AA 3H9FA 4TYHA 4QT1A 4D0XA 4OTHA 5HGIA 2PUIA 2WELA 5HE0A 3RZBA 3UO5A 4GIHA 3H0YA 4IZ7A 5HORA 2VTTA 4EK4A 3SA0A 4NKAA 4XOZA 5JVLA 3I5NA 4RFMA 3E64A 3DBEA 4P7EA 2UV2A 3EQBA 2W99B 1TQIA 1XWSA 3EN7A 3Q4TA 4L44A 4WBBB 2WMWA 4WNPA 3TI1A 2E9UA 2PYWA 3RPVA 5LVOA 1OM1A 2VU3A 2X9FA 3EQIA 3L8XA 4YHJA 3V5PA 3ZU7A 4Z7GA 3ZC6A 4WBOA 5CEOA 3EFWA 1F0QA 1LP4A 2Z60A 3K2LA 4YSMA 5GIOE 3V5QA 2JLDA 3VUDA 5FRIA 2BAQA 2W1DA 3BKBA 4IWOA 4RX5A 3UYSA 4QP9A 4AWIA 5FBOA 3WARA 3BHYA 3RINA 5IEYA 4ZSJA 4BY9E 4FKOA 2OH0E 5BVOA 2O0UA 3DZQA 5JZJA 1Q5KA 4LFIA 3KXGA 3PSBA 3UIMA 3TT0A 4CMUA 4IAZA 2W1IA 2R3NA 2XNEA 1H25A 4DFXE 5FGKA 3OW4A 3HP2A 1CKPA 2BTRA 2GTNA 2WKMA 2B52A 3E7VA 4FG9A 2OIQA 4FG8A 3SW4A 4CQEA 5C8NA 5DI1A 4EBVA 4C5CA 4M0YA 1YDRE 2W1GA 1J7UA 1MUOA 3FEGA 4OTWA 3VF9A 3UGCA 4MV6A 1DIKA 4HNTA 1RQQA 3EN9A 4DGLC 4RWKA 2JDVA 4RT7A 2OXDA 1GZNA 2UZTA 4XG6A 1SVEA 5LVLA 4ZK5A 5ACKA 3RKBA 3Q4UA 4M8TA 5CVHA 3SOCA 3SQQA 4BGQA 4USEA 2Y8OA 3JUHA 2JITA 2GHLA 2YZLA 3MGYA 4L00A 1J7IA 2X8IA 3ORIA 2XNBA 3OZ6A 3W8QA 3QQGA 3ROCA 4JG7A 3LM5A 5AP7A 3FV8A 2PVYA 3FUPA 3T3VA 5M44A 1KJQA 3CY3A 4ONAA 5T6KA 4F7LA 4RVTA 3PPKA 3E3PA 5HBHA 2PZRA 3ERKA 4AZTA 2I7QA 4I21A 5HCYA 4R6VA 5AJQA 1E1VA 2OJ9A 3W10A 3WE4A 4AW1A 4AW0A 4BDEA 4PDYA 2PMIA 4N70A 5GHVA 4FIGA 4ACCA 3GENA 4EBWA 4CLJA 5KZ0A 1AUVA 5FXRA 4G9CA 2IN6A 3P78A 4QYGA 2QOFA 3Q6WA 5JGAA 2WQMA 3CIKA 3LXNA 3NIZA 2VWUA 3UZPA 4A9RA 5FTOA 4E1ZA 4EJ7A 1PMUA 2FSOX 3R5FA 1O6YA 5E7RA 5IQAA 4FT0A 1JAMA 2I0EA 1PYEA 4YC6A 2YIYA 3BGZA 3DNEA 3GOPA 4LMUA 2YWVA 4MH7A 4FICA 3N51A 4O0YA 3OVVA 4LOPA 4O83A 4KIQA 2H6DA 1ATPE 3ATSA 5AAFA 5HD4A 2VTPA 3LXKA 4K8AA 4U40A 5M4IA 5TR6A 2XBJA 4ZTLA 5ETFA 4GK2A 4NM7A 4JIKA 4BI2A 1CKIA 4M97A 1E4EB 2BHEA 2R86A 1LUFA 4FL1A 1Q3DA 2QOOA 4RG0A 5CEQA 4YLJA 3EQRA 4CKJA 2W1CA 3PXYA 4FSNA 5HE1A 1XH6A 4R78A 3E5NA 4CGAA 2PY3A 2Q0NA 3LW0A 4QQ5A 4C4IA 2YACA 3EFKA 3Q96A 3PRIA 3C5IA 3VIDA 2R82A 3W55A 4FIFA 3EKKA 2F9GA 3CJGA 4IX5A 3V3VA 3ZRMA 3S0OA 3ODZX 3ZUVA 4EKLA 4U45A 3QYWA 4XUFA 5IUIA 3A7FA 3KK9A 3V5JA 5B2LA 3R28A 4YNOA 4EGJA 1ZY5A 4DGNA 5CEMA 4J1RA 4BVUA 2R2PA 3QCSA 4A06A 4CZUA 3DB6A 1YI4A 3R5XA 3CR0A 1FVTA 3GB2A 2QOCA 3MN3A 4QP7A 5IA0A 2OZOA 2X39A 3GU6A 3QGWA 2G2FA 4HYHA 5IMXA 4AQCA 3DFCB 4ZIMA 3R9HA 4L01A 3FI3A 3GUBA 3ETAA 3R04A 4EC9A 1CQJB 3CKWA 2Y4IC 4TW9A 4KB8A 2XP2A 5HNIX 4HQ6A 3KMMA 3OHTA 4MF1A 2W0JA 3EN5A 5FEEA 4EZ7A 4M0ZA 2W4OA 3OBJA 4JDJA 4JS8A 4YTIA 3LCOA 4EZ5A 4HGTA 3DAEA 3EN6A 2QOLA 3RVGA 5AAEA 3THBA 4G31A 4HGEA 4FNWA 4D4YA 1MQBA 3VW6A 3L8PA 2YIQA 1Y57A 4QRCA 3LMHA 4RVMA 3K3PA 5A4QA 2IW6A 1URWA 3GCSA 3FMNA 4YUQA 5M06A 3MA3A 3HP5A 4W8EA 3RJCA 2ZM3A 3E93A 1Z2NX 3CXWA 3OWLA 3TQTA 2BRGA 1H00A 4E93A 2VQDA 4YZCA 2YAAA 2R64A 4ID7A 4ZTHA 2GFCA 2J5FA 2J2IB 2CJMA 3GC8A 2QODA 1OPJA 1RJBA 3QD0A 5J8IA 5A6OA 5J1VA 2VGOA 1PW2A 2HXLA 5BVFA 3KU2A 4NYEA 3UZRA 2NNWB 4YB8B 4C33A 5BPFA 1HCLA 3KL8A 3QGYA 2WTWA 4LGHA 2W5AA 4X3JA 4X2KA 5HCXA 1OKYA 3RPYA 4DYMA 3TCPA 1A48A 1XH7A 4IB0A 1PXJA 3C50A 1PMEA 3SRVA 4AG8A 4C4FA 4TWOA 2PE2A 2VTLA 3UMXA 4M12A 4QP6A 3R83A 3NCZA 4YJSA 3UIUA 5C8MA 4QMTA 5EOBA 2WNTA 3EB0A 1H26A 1J1BA 3KFAA 4DGGA 4I0SA 3JR1A 4EK8A 2I0YA 1OVEA 3HMMA 4AW2A 4UX9A 3LOKA 4EGQA 3GEQA 1IAHA 5H3QA 3SG8A 4JAJA 3FPMA 5F1ZA 3PVBA 2NRYA 1Q41A 3FYJX 1XKKA 3HZTA 3Q9ZA 3NS9A 4EH7A 3RM7A 3RFCA 4PY1A 2VGPA 3O8TA 4K0YA 3GCUA 4ZQIA 4DFYA 4Q9ZA 1Q8ZA 4WNKA 5FNVF 4FV6A 3KKVA 2I40A 2PVLA 4FTOA 4F7NA 1BNCA 4QMUA 4A4OA 4APCA 4PUZA 3R7UA 4BDGA 2XK8A 5LVNA 5GINE 1H1RA 2EXCX 2FVDA 3D5VA 4MXOA 3S95A 4FYNA 3KAKA 3UDBA 4RJ5A 4I5PA 1IG1A 4NWMA 5E8UA 1RE8A 3MVLA 4EUUA 1C30A 1W84A 4FKJA 3QTIA 3ORPA 4HVDA 1UWHA 1NVRA 2GU8A 3N9XA 4QMOA 4ZY5A 1JKSA 2J0JA 3KN6A 4A4LA 5CALA 4O2BF 5H80A 3MDYA 3EMGA 3HNGA 4I22A 1JPAA 4NM5A 4QMXA 5F4NA 5AWMA 4QP4A 2C6KA 4ZAUA 1DV2A 3C0IA 4WUAA 4FK3A 5AA8A 2WXVA 5G6VA 3ZSIA 5CAQA 2WMQA 3ACKA 5KMLA 4YMJA 1WVYA 4IM0A 3AD6A 4USDA 3C4ZA 4FUXA 1R3CA 2VD5A 3QA0A 2VNWA 3ORQA 1H28A 4MTAA 1UWJA 2R0IA 4DH1A 3R1YA 4EYMA 3KRLA 3COMA 4FKQA 1UNLA 3OBGA 2W06A 3DBCA 4QMVA 4RC4A 2OF4A 5I9UA 3ORRA 1PJKA 4YLLA 4W4WA 3VBXA 4XHKB 3HV5A 4BF2A 5DNRA 1XQZA 5H8EA 3DXQA 4MAMA 5FEQA 2ITNA 2E9NA 1REKA 4I20A 1AQ1A 1BYGA 1WBPA 3QYZA 4BCFA 4B0GA 1OUYA 3CGOA 2UW5A 3LCKA 3MFUA 4YTCA 5IA3A 4OT6A 3N4VA 4GFOA 5HG9A 1JLUE 2IWIA 4RIYA 4WG3A 5LOVF 5FM3A 4F99A 2PMOX 3G51A 2HENA 3VHKA 4GYGA 2HYYA 2GTMA 4PL5A 1YDTE 4FEUA 3W16A 3ZDUA 1J3HA 3IW6A 3WZEA 1KSWA 5C8YF 4F9CA 3QTQA 4S30A 2BRMA 4E20A 5JK3A 2C69A 5CI7A 3WF6A 2DLNA 2YN8A 4L68A 3FLSA 5CZHA 2PULA 1QMZA 3UBDA 5AUZA 3BBWA 3AC4A 3QRTA 2R3MA 3QFVA 4I4EA 5BX0A 3TW6A 4H3BA 5FBNC 3TDWA 3ZRLA 3HMNA 5L2TA 4RIXA 4OBOA 4P5QA 4RX8A 2YW2A 4M67A 5I9VA 2VO7A 2UZLA 1R39A 3AMBA 4ALVA 2IVUA 4CZTA 5ACBC 3FI8A 1RW8A 2YIXA 3PG3A 1T46A 2PU8A 4H3PA 1XH9A 4MA0A 4TUYF 3V4ZA 1X8BA 3ATTA 3AT4A 3IS5A 2YM5A 4JBPA 4F9WA 2Z8CA 2IJMA 2RGPA 5JT2A 1BL7A 4FV4A 4DN5A 5JFVA 4NTSA 2JC6A 1FQ1B 1M0WA 4C02A 2GSFA 4G6NA 3ZFMA 2YCFA 4EORA 3G33A 4NCTA 4RC2A 5J95A 3HMPA 1YHWA 3TIYA 5IEVA 2F7XE 3HRFA 3LQ3A 3V8WA 3DTWA 3RPSA 5CX9A 1H07A 4R5YA 5EW8A 4UEUA 5AUTA 2YIWA 1KJ9A 3LCSA 3HX4A 4E5WA 4C0TA 2WOTA 3EQGA 3PJ3A 2ONLA 5D8DA 4N0SA 4QP2A 4U3YA 3EYGA 4MXXA 4QTAA 4EH9A 3PPJA 3I6WA 4JNWA 3QC9A 4JQ7A 4IH8A 2PZYA 4QMSA 4CRSA 3BEAA 2IVVA 3UG1A 2YYAA 4JXFA 2OO8X 3BG5A 2FYSA 2PL0A 3MPTA 4LI5A 4UY9A 3VHEA 4UBAA 4F70A 2J90A 3QXPA 2CKPA 2HK5A 4BCHA 2GNHA 2ITXA 2W17A 2OXXA 3AXWA 3QX4A 3VBWA 3FMJA 3H9RA 4C59A 2PVKA 2W4JA 4EL9A 4X2FA 4D4RA 3F7ZA 2LGCA 3HV4A 2A1AB 4YHTA 3HUCA 2V62A 3UNJA 2GNGA 2RFSA 3O96A 3CTHA 4JBQA 2QOKA 3U51A 4NT4A 2VTNA 3MI9A 3FI2A 4AOTA 3UO4A 1ZYDA 2JDRA 2XEZA 4O2ZA 5DHJA 3VO3A 4ITIA 3DA6A 3F3ZA 1Q4LA 2B7AA 4PDSA 4AT5A 4TV9F 4MD8E 2QG7A 4TV8F 4CXAA 4U97A 4O0SA 4OTDA 1OB3A 3PE1A 5AX3A 4D28A 4L3PA 4LQMA 4D5HA 2C3LA 2W6NA 2W5HA 4F0GA 3H30A 2R3PA 4ZXTA 2JGZA 2QR7A 3O2MA 2WO6A 3PP1A 4HZRA 5HIDA 3R9RA 3GU5A 3QF9A 4EHEA 1FOTA 2VPQA 5AP4A 4NIFB 3ANQA 4AOJA 2BKKA 4GU9A 2W4KA 4M3QA 4AUAA 3MY0A 5L2IA 2YS7A 5IH4A 3KF7A 5D7AA 2PUNA 4FKTA 1H0VA 2WD1A 3FJQE 1CE8A 4EQUA 2P33A 2F7EE 3BQCA 5A54A 4FEQA 5HESA 3PWYA 3Q1KA 5JVDF 2UVZA 3D0EA 3FKNA 3ZC5A 1APME 5I9ZA 3NNXA 3VBTA 1WVXA 2VX1A 5CNNA 2XK3A 2XJ1A 3NYNA 2C6LA 4DG3E 4HPUE 1WAKA 3QAME 4IVDA 2WZJA 4EUTA 3EN4A 3LQ8A 1H1SA 3PG1A 4FTMA 3DXNA 4GUEA 4O7ZA 3LLAA 4J98A 3PYYA 3UC4A 3VBVA 3C4WA 4QTEA 4U79A 4QMNA 1P4OA 3F5PA 2C6TA 1GAGA 4QMQA 4ZTMA 5KKNB 3CY2A 3MJFA 1AD5A 3NYVA 4U81A 3FMDA 3FXXA 3OP5A 4J96A 5A3XA 1Q62A 3ZTXA 4EOMA 1TQMA 3H0ZA 5IUHA 4LMNA 4XJ0A 2ZJWA 4HPTE 3BBTB 1T45A 4X7QA 4ENYA 4Y72A 4WIHA 4OLIA 1GIIA 1FVVA 5IISA 5FUTA 2R7BA 1Y91A 2VWYA 4MWHA 1BXRA 2W9FB 3I12A 5E90A 4EEVA 5CU0A 1VBGA 3TV6A 2OBJA 2XRWA 4JOAA 4KAOA 4Y46A 2HWPA 1UKIA 3FC2A 2W1HA 3PLSA 3IKAA 4G1WA 2REIA 1Y8GA 3BLRA 4FC0A 4ZSLA 4OTRA 3AC1A 5JQ8A 2Q0BA 3IPHA 3JRXA 3MH0A 3P79A 4EOSA 5CSPA 3O51A 5JRSA 3GP0A 4IADA 2OLSA 2G15A 2W9ZB 5H8BA 5BUEA 3PDTA 4FOCA 2HZ4A 4O4LF 3B2WA 4FTKA 4BDHA 2ZDTA 5DLSA 5KE0A 5CVFA 3PPZA 1U4DA 4XG7A 1W93A 2YERA 4XH6A 1YDSE 3E62A 4QO9A 3AT2A 3ZLYA 3HUBA 4I0RA 5AFVA 5DR2A 5TF9A 2Z7QA 3OD6X 5EYDA 1GZOA 4C4JA 4FVPA 3VS5A 2C6MA 2OZAA 4EHVA 2UW4A 3JZFA 4L67A 4HNVA 3ALOA 4PX6A 4D2SA 5LCJA 4E4NA 5L3AA 5JMSA 2PE0A 4FTJA 5FP5A 2WMUA 5CEKA 3ZUUA 3AD5A 2YWPA 1AGWA 3NRMA 5DT0A 3PP0A 1M0TA 5KMKA 1JKJB 4DEHA 5CEPA 2QO7A 1ZYJA 1GIJA 2GNLA 2UW7A 4U0IA 4EC8A 1OL6A 4MD7E 4O7RA 3CCNA 2FA2A 3BZ3A 4FTIA 4FTRA 3BU6A 3I0QA 4AS0A 2B9HA 4DITA 4TYHB 2RKUA 2WTIA 4CFWA 4U3ZA 2A0CX 5A4CA 3A7IA 1H8FA 5KHXA 4RMZA 5KBQA 2GS2A 1XJDA 5IA2A 4RVKA 3OC1A 4C36A 5FDPA 5J2UF 1LEZA 1OMWA 3PY3A 4JDKA 1SCUB 1REJA 1ZZLA 4P4CA 2SCUB 1DAWA 3U4WA 3VNTA 1H1QA 3KCKA 4JAIA 5FG8A 1ND4A 2FGIA 3OFMA 3ULZA 3VUKA 4AGDA 1OKWA 4ORKA 4FBXA 3MIYA 5CXZA 4FKSA 3UP7A 4E4MA 3U6JA 3UQCA 1J91A 3CQWA 1WFCA 1VZOA 4J53A 2VX3A 3QTSA 5AADA 2I87A 1JOWB 3N8DA 1JKLA 2KTYA 3ETJA 4KSPA 5M4CA 2ERKA 4FV9A 3K3IA 2PTKA 5L6WL 3PE2A 1MRVA 2JKKA 5DEYA 1NA7A 2JIVA 2CKOA 3HDNA 5D41A 3EQDA 5KMNA 4KRDA 1ZAOA 3MFSA 3ZEPA 1U5QA 2XJ2A 3EWHA 3ROYA 3PJ2A 3BGQA 2IZUA 4OTQA 4RSSA 3CEKA 4L43A 2QOHA 1YI3A 2NP8A 4DA5A 5CASA 1XR1A 2CCHA 4O0VA 5L8LA 4KIOA 2GPWA 2QLQA 3KRXA 4LOQA 4YJTA 1VYWA 1XH8A 1ZARA 2WOUA 4JRNA 5A4LA 1DI9A 5EI8A 4YZBA 4O4JF 3A99A 4XG4A 2PVRA 5DOSA 3IK3A 4IZ5A 4E6CA 3E8EA 4ACDA 3RCJA 2YM6A 3PJ1A 4N6ZA 1F5QA 5HNGA 3FKOA 2X81A 3DZOA 3PWDA 1OIRA 1XO2B 3I0OA 2FSLX 4I0TA 4OTFA 3CLYA 3NW6A 2GHMA 2HW7A 4H05A 5T68A 2E9VA 4AA5A 3CJFA 3MJ2A 3TIGA 3HMOA 3DNDA 3A8XA 3DXPA 1S9JA 3GCVA 4FODA 4AA0A 5KUPA 3G9NA 4I5CA 2QC6A 5M4FA 5HU9A 3NUNA 3V6SA 3HDMA 1M2QA 1B38A 4K6ZA 4BTKA 1HOWA 3ELJA 4ACMA 2QQ7A 5DT4A 4C3FA 5IH5A 4ZEGA 2VO6A 2O3PA 3OCGA 3R0TA 2WMBA 2IO6A 1BX6A 4MXZA 4I6BA 4BDAA 2ITWA 2QOIA 5CSWA 3GOKA 5EI6A 1UKHA 3LHJA 4JI9A 1PKGA 2V5QA 2XVDA 2PUUA 2ETMA 3LFQA 4O86A 4HVHA 4RA5A 5M51A 3V6RA 4DE4A 1IAJA 4BTFA 3QQLA 3UG2A 2PVFA 2R4BA 4J97A 4AE6A 4E5AX 3Q32A 4B9DA 4PTGA 2X7OA 2VTSA 5AV0A 5IQGA 3IECA 2RFNA 3EFLA 4IZYA 4EK3A 3AMYA 3SX9A 3QD4A 3W32A 5L8KA 1CTPE 1ERKA 3BCEA 4RA4A 3VPCA 2OJGA 4QQCA 4QYEA 1ZMUA 1TVOA 4E6QA 4EJNA 4DG0E 4KUJA 2YRXA 2C00A 4C4EA 3G8DA 2P0AA 2GLTA 4BGGA 3R7YA 3UFXB 3O50A 3PSDA 3SDJA 5CAVA 1XBAA 4KKGA 3HGKA 2WFYA 4GS6A 5A14A 5J9YA 3O0GA 4O96A 3UOKA 3TIZA 4O7TA 2VTOA 3KGAA 4NZWB 1DS5A 3OXIA 4GYIA 1M6VA 3TM0A 3LLTA 4D1SA 3D83A 3PJCA 3KVXA 3ZYAA 1V1KA 4CSVA 3MSSA 4IAYA 3TUCA 1GIHA 1PRYA 5HIEA 5CI6A 3Q5ZA 5AUWA 4DGMA 1IRKA 4WG5A 1CSNA 3D15A 4X3FA 4ZSEA 5IZFA 5JQGF 3FPQA 2OIDA 3SKCA 4M9UA 2HOGA 3KB7A 4JQEA 3TN8A 3PVUA 4ALUA 4RGJA 5HLWA 3E63A 4CMOA 4GJ2A 1MRYA 1BI8A 4F9BA 2BRNA 1YKRA 2R0UA 4IWQA 4XG3A 1P2AA 4FV5A 4EWQA 4DEIA 4IC7A 4RRVA 1ZY4A 2X6EA 3BRBA 3QLGA 1Z5MA 4IQ6A 3NDMA 5EHOA 4ERWA 1Z9XA 3AGMA 1H1PA 1PHKA 3CS9A 4QMLA 3TNWA 3VAPA 1O6KA 3MWUA 2Y7JA 3Q2OA 1KJJA 5C01A 5JQ5A 2EB2A 3EYHA 4FV7A 3FLNC 3VQUA 3B8QA 5IDNA 4LYNA 3COKA 3NWWA 4DEBA 3K5VA 3MWEA 5DWRA 4X21A 3CP9A 4V01A 4FTTA 2ZVAA 2EUFB 2B54A 2O2UA 3Q4CA 4NFNA 4K11A 4W4YA 5DN3A 3VS6A 3WZUA 3ALNA 2GPSA 5AP3A 4FKIA 1ZOHA 3D2IA 4XG9A 1UA2A 3LM0A 1EUCB 4GG7A 4QSHA 3BEGA 3EHAA 2OJFE 4YBZB 1A9UA 2HZ0A 4LL0A 2XNMA 3Q2MA 4TPTA 3RAHA 2ZV8A 3E5AA 1IOWA 4TKSA 5D1JA 3MY1A 4FKGA 1FINA 4XLIA 2PZ5A 5LMKA 1CM8A 3ORKA 4FV8A 5TKDA 5M53A 4BHZA 2V5AA 4I4FA 4ZMEA 2QCSA 5EM7A 1GSHA 5CA1F 3UC3A 2BMCA 3MBLA 5DYJA 2XM8A 4GVAA 4C7TA 1W7HA 2R3HA 2XIXA 2UVYA 4DHFA 5CTPA 1SM2A 5IQDA 3NEWA 2J9GA 1YHSA 4YJPA 3QUPA 2NO3A 4BCNA 2FPGB 3BYOA 4KA3A 3OG7A 4O81A 5DVRA 4EQCA 2UZVA 3NX8A 3S2PA 1H27A 3Q52A 3RWQA 3ORNA 3QQUA 4BIBA 2ITTA 3AC3A 5J9LA 4MA5A 4FTAA 2C0OA 4MAOA 3NZ0A 4MK0A 2QI8A 3Q53A 5CSHA 4DFUA 2BIKB 3ENHA 2JD5A 4YAJB 3SHEA 3KXMA 3BELA 3COIA 5CSVA 1VEBA 4O38A 3IW8A 4FKUA 1OPKA 4JX7A 5IA5A 3O7LB 4MQ1A 3MIAA 2QNJA 3OUUA 2ITQA 4GVJA 2PN1A 2GNIA 4IIJF 3R21A 5M4UA 1R0PA 5HVYA 3DU8A 5AP6A 3WYXA 2R3QA 3R00A 1QPEA 4DF3A 2V58A 2C6OA 2OU7A 2CSNA 4LUEA 4UALA 1KV2A 4FIEA 3R7IA 2R3OA 2OKRA 3AC8A 4YC8A 2QF7A 4ME6A 2OW3A 1GNGA 2OJJA 1NT2A 1U59A 3BX5A 3P4KA 3QD3A 4DGOA 4F64A 1Q8TA 1H1WA 2I0VA 3FSKA 5IEXA 2C5OA 2X8DA 4Y8VB 4XP3A 3F61A 3HV6A 3TNHA 3ZONA 2O5KA 4R5SA 4TNDA 4FSUA 5EQPA 3E88A 2VZ6A 4EYJA 3I6UA 3KXHA 4O6EA 4CFVA 4FZDB 3DQXA 3L8VA 4EOOA 2C5VA 4EOKA 2R3IA 3HV3A 5C1QB 3PY0A 2UVXA 4YPSA 4G3CA 5E9EA 2PVPA 3U8WA 5KX8A 2WQBA 4MQ2A 3G90X 3WZDA 1PMVA 3CBLA 3P86A 3SXSA 2R9SA 4BZOA 4FU0A 2QLUA 3PIZA 4A7CA 1PXMA 2JBOA 1YXTA 4FT9A 3WZKA 4B8LA 1IOVA 4RIWA 3VULA 3G15A 3TACA 3PXZA 5AV1A 5E92A 3VC4A 4IW0A 2VWZA 4XYFA 1M2PA 3O7LD 4WHZA 5C03A 1M52A 3R8VA 3TJDA 1ZXEA 3BYSA 3POZA 4FV3A 4U5JA 2ZMCA 4XMOA 4TN6A 4ANLA 3RALA 4HR7A 4ERKA 5BPYA 2ITYA 4G3EA 2F4JA 4ASXA 3S00A 2X8EA 5HKMA 4FTLA 2QKRA 5ITAA 4U6RA 4I4TF 1W83A 3M42A 5K9IA 4YJQA 4FX3A 4KINA 2C1BA 1YWRA 3W2RA 4ZY4A 2HCKA 3Q60A 4A9YA 5D12A 1BKXA 4XX9A 2GCDA 3QRIA 4PF4A 1WBOA 4V0GB 4K33A 4O0RA 5ETIA 4CV8A 3KRWA 2R84A 3QCXA 3F2AA 4FYOA 3A61A 4NSTA 2OF2A 3TKIA 4IAIA 2XKCA 5EKOA 3W2SA 2XEYA 4IJPA 2F49A 3FLZA 1V0BA 2C6DA 3I7BA 4PWNA 2QO9A 5LARA 3ZDIA 4LRMA 3CD3A 2CGVA 3GNIB 3GU4A 1I44A 5FDXA 3F3UA 5CYIA 4X3FB 4BCKA 1GSOA 3E8NA 3DPKA 5ANIA 5T3QA 1PYXA 2GPHA 5LA6F 1STCE 4C3PA 1DI8A 4G6OA 2CN8A 4F6SA 1G8SA 4ZSGA 1KUTA 3NGAA 5LVMA 4IVBA 4ZJIA 3FKLA 2UZUE 1KEEA 2RG6A 4FSQA 5E8ZA 3O8PA 4L52A 4BDBA 3I81A 4PP9A 5A4EA 2YCRA 2C47A 3TXOA 4D4SA 5BUIA 3R8ZA 5CAPA 4GKHA 2OWBA 2R7NA 3ODYX 4EWHA 4GW8A 4I3ZA 5E1EA 1NW1A 4V05A 1P4FA 4HNUA 2W1ZA 5F94A 1EZ1A 4BTMA 4U9AA 3UVPA 1JDEA 4II5A 1S9IA 4AF3A 3GCQA 2YA9A 3LFNA 3K5IA 2X9EA 3RI1A 4FSTA 2CZGA 4GEOA 3QZHA 4BYIA 5BNJA 2CKQA 4FI1A 2YS6A 4EQMA 3DFAA 4TWPA 4ITJA 4MEDA 1Q97A 5LOHA 3MPMA 4UZHA 4J71A 3IGGA 4ARKA 2XZSA 4Y73A 2OI4X 4BBMA 4HCUA 4L3LA 2DWBA 2QVSE 4YURA 1Y6BA 3CD8A 4Q9SA 3FZPA 2FSMX 4UWYA 4ANQA 1PXNA 2ZM4A 3QCQA 5E8YA 5IG1A 2R87A 3IDBA 5BYZA 2VWWA 5EYCA 3DLSA 4I5HA 4IM2A 4IEBA 2C5XA 2X7GA 1DV1A 4F63A 2JDSA 2WQEA 4ZZMA 1GSAA 5L6PA 4KWPA 3DY7A 2CNUA 3Q9YA 5KMOA 2UW8A 1JSUA 2JFLA 4FIJA 3R7OA 4FV0A 1SVGA 1YOMA 5G1XA 3U6IA 5EOLA 2PMNX 2HY0A 4ZTRA 2Y6OA 4LGGA 4MV3A 3BHVA 4GT3A 4C37A 2RG5A 3K3JA 5CZIA 3VJOA 4XYLB 4F9YA 3OWJA 3F6XA 2JAMA 2XNGA 5AMNA 3TKUA 4YO6A 3PXFA 1XBCA 2ZDUA 5BVNA 1L3RE 2YIRA 4JVGA 3ZO4A 5EDPA 4CRLA 2JKMA 5CWZA 3G6GA 1XHAA 4B8MA 1YRPA 2EXMA 4FGBA 4UYNA
chains in the Genus database with same CATH superfamily
4AXAA 5KZIA 2AC3A 4EH5A 3RNYA 3MH1A 1M7QA 4C34A 2ABJA 3VW8A 2VTRA 4HYIA 2YZAA 2XNOA 4BICA 3ENMA 1VKZA 3MH3A 4HOKA 5CY3A 2HG8A 4FG7A 4IDTA 3NUAA 3KRRA 5HV6A 2UW0A 3ZLXA 1B39A 3PUFC 5HG5A 3OS3A 5IH6A 1M17A 1OBGA 2DAAA 3QTZA 4UCSA 2YEXA 3B8RA 3FQSA 1OZ1A 2VTAA 3L9MA 4YZNA 5KKRB 5LWMA 5BQ0A 3T9FA 3R5HA 4CKBA 2BRBA 4JDHA 4MV1A 3W33A 4UWCA 3QWKA 4DLJA 1WRVA 2QO2A 3VQHA 2HGSA 2XAMA 1BL6A 3POOA 2BR1A 5IQIA 4YZ9A 1PY5A 3ZOSA 2XRUA 1KE8A 3OWPA 4UYAA 4LV8A 5CXHA 2UUEA 2XNPA 4D1XA 4CG8A 5ETCA 3EFJA 4S33A 2G2IA 1KWPA 5CT7A 5BMMA 4CT2A 4EZ3A 2QU6A 4BHNA 2Y4RA 4CV9A 2WTCA 2Z2WA 3MH2A 3Q04A 2I80A 5K3WA 3G0EA 3RTPA 2ZDGA 3AC2A 1QPCA 3LIJA 4QYFA 2VN9A 2HWOA 3AOXA 3BWJA 2XA4A 1ZYCA 2YITA 4FVRA 4JBVA 4RIWB 4ZTNA 3UQ8A 2HZNA 3R9NA 5C8KA 2O63A 3FQHA 3ZO3A 3F3VA 4L8MA 4Y95A 1OIYA 3AKJA 3D9VA 3S3IA 5CLPA 3ML1A 5AX9A 4PNIA 2O65A 2WEIA 4A4XA 5HO8A 4FSZA 4YJNA 2YDIA 2XCHA 3ZZEA 1WZYA 3O5AA 2Q2TA 2ITPA 3QTXA 4FKPA 4QMYA 2X0SA 2BIYA 3GFWA 4J7BA 4EOJA 1URCA 4E6NA 3QUEA 1KC7A 2BVAA 2XMYA 4R77A 2NU9B 3TNPC 3QRUA 5HBEA 2A19B 3WYYA 1F3MC 4W4XA 3GC0A 1YXUA 1BUHA 5AUUA 1M14A 3QALE 4N57A 4EOQA 5TO8A 5A4TA 2VR1A 2XCLA 3PFQA 4JXUA 1Y6AA 3NUUA 3QKMA 4XNEA 5JQWA 3N4UA 4Z3VA 5JFSA 4TWCA 4O84A 3LPBA 3H9OA 5B0XA 1PXKA 1OITA 2JDOA 4G3GA 5HICA 1U5RA 2JAVA 3VS3A 4CG9A 3LQ5A 5IU2A 3D2KA 4FT7A 3F5UA 3WZJA 4YO4A 2C6EA 3C4XA 5M55A 4LUDA 3V8TA 4IMYA 4BBFA 4DEEA 4UUGA 2J51A 4KS8A 4XEYA 5I9WA 1UC8A 4I50F 4MV4A 1PF8A 2Y9QA 3NYOA 4FSYA 2R7IA 3VUHA 4I93A 3BLHA 4BDDA 4EH4A 4XG8A 4IM3A 5HX8A 4F08A 3DJ6A 1OKZA 4JR7A 5D7VA 3V4SA 4BR3A 2A2AA 4RBLA 5ANKA 3DDPA 4RJ8A 1Q99A 1XK5A 4FK6A 4AW5A 4R3PA 3HLLA 4DHJA 4ITHA 2PZPA 3A7JA 3QZFA 2Q83A 4RX9A 5C26A 2E2BA 3UDSA 3NVKI 1ZYSA 3KXNA 4CCBA 4XCUA 3SRVB 2C5NA 4KSQA 5IMEA 4BJJB 3FLYA 3NNUA 4PMMA 2V7OA 2F57A 1UU7A 2GNJA 4U41A 1CKOA 3TIIA 4I6HA 4YHFA 5M57A 4FKVA 4G5JA 1VLRA 4L53A 4XV3A 3NIEA 4FE2A 4RPVA 4RQKA 5HG7A 3FSFA 3GVUA 5DPVA 4NM3A 4BDFA 1KE9A 2Z7SA 5HBJA 5J2TF 3R7EA 3R71A 1FMKA 1B6CB 3A4OX 3NW7A 4FV2A 2VTHA 2VTMA 3BV3A 4O27B 3PXQA 5FEDA 3VS7A 1G8AA 2I0HA 4E4LA 1EKPA 3TZ9A 5BWRA 1YHVA 3DK6A 4I24A 4F1TA 3PFFA 5LQFA 4HJOA 3PA5A 1A0GA 2DWCA 5KO1A 3FY2A 2WMTA 3PIYA 1JLLB 2ITZA 5DRDA 1A9XA 4XBRA 3BI6A 4HNIA 1KV1A 2JKQA 5I5ZA 4YJ3F 2QD9A 4Z7HA 4FGRA 5CENA 1SNUA 4FIIA 5GIPE 4DBXA 3BPRA 4DLKA 2FO0A 1B6SA 3UP2A 4ZJVA 4E26A 3K54A 4QQJA 3SAYA 4JRVA 3R73A 3S1HA 2I6LA 5FR9A 4ZI7F 4R7HA 1IR3A 2HY81 1NVSA 2QOQA 4DLIA 2B55A 3ET7A 2V22A 3NUYA 3S4QA 3BV2A 5EK7A 2CNVA 2G2HA 2R3KA 4BN1A 2VWBA 2YL2A 3UZTA 4MX9A 2IZSA 1OIUA 4UCRA 5M07A 1I1KA 3Q6UA 3LMGA 3DK7A 2RIOA 2X1NA 3BYMA 3MVMA 4HYUA 4IB5A 3AGLA 2H34A 4OW8A 4ZJJA 1O9UA 1SNXA 2J0LA 4IE9A 5D1PA 4GJ3A 5IQHA 4U7ZA 2BCJA 2UZDA 3K5HA 4FNXA 3EQPA 4EK5A 2DZDA 1LR4A 4G2FA 3DBDA 3F82A 3DF7A 3TUBA 4O7SA 4EOLA 4TNBA 5CAEB 3ZXZA 3UDZA 3NNWA 4G3DA 3T54A 4W4VA 4WA9A 3RV3A 3A7GA 3HV7A 3D4QA 4M13A 2XM9A 2W70A 4USFA 2EU9A 4LRKA 2NYAA 5KMJA 4F6WA 4Z55A 3NAYA 2COIA 2XS0A 2PE1A 4H1MA 3IDCA 3UYTA 3D5WA 4PRJA 4BCJA 3FY0A 4O4HF 1OL2A 4FNYA 3VBQA 5H9BA 3DK3A 3CGFA 3GCPA 4GK4A 4RIYB 5F95A 4QMZA 3HAMA 4X0MA 1YQJA 1KE5A 3CQEA 1YXSA 3II5A 1E1XA 3U54A 3NR9A 4HGSA 4LM5A 5AM7A 5AM6A 3MYGA 5B7VA 5FQDC 2P4IA 1S68A 3FL5A 1P5EA 3V8SA 2IG7A 3BHUA 5EW3A 3ZSGA 3F5XA 4GSBA 2XK4A 5L2SA 4R7BA 3DBFA 3LJ0A 4WT6A 1OL1A 3JSLA 5M09A 3SGCA 5ANGA 2F7ZE 3ZXTA 2BRHA 3SGIA 4TXCA 5DH3A 2ACXA 5CVGA 4PV0A 2VX0A 4FT5A 4BC6A 1UU3A 4G3FA 4HVIA 4RIXB 4BKJA 2W6QA 4PQNA 1W82A 3FBVA 4H36A 3R8UA 3VRYA 4TL0A 5CB4F 5AP1A 3TY9A 4JT3A 4MV9A 3P5JC 4RCNA 1KJ8A 4YC3A 3MB7A 3IQ7A 3U9TA 1FMOE 5ETAA 3SVVA 3VPBA 4IANA 2XJ0A 4AGWA 5DGHA 2DQ7X 1OECA 5E8VA 4BGHA 1I7LA 2FB9A 2R3FA 1Y8YA 2ZV2A 1DM2A 2J4ZA 4LL5A 2XIYA 5CU2A 2QR8A 2C4GA 2BILB 1KBLA 4Z16A 3W0OA 2ZGIA 1CMKE 5D11A 4AACA 4IWDA 4AFJA 3VRZA 2V0DA 4TTHB 4GT5A 4M68A 4EKKA 3LP8A 2RF9A 4QP3A 4IZAA 4F1MA 2OLCA 2GQGA 3R23A 4DQNA 4C5AA 3ULIA 4BB4A 3OY3A 2V55A 3I1AA 2EIYA 4X6QC 4F09A 4RZVA 3EZVA 5HQ0A 5BUJA 3OT3A 1LEWA 3LJ1A 4RWLA 3ZCLA 1JSVA 1RDQE 3FWQA 5F20A 3HA6A 1LPUA 2RFDA 4F4PA 4NJ3A 2WU6A 5ANDA 4C2VA 3VUIA 2ERZE 4O21A 2PK9A 2ZFYA 4XOYA 1EH4A 4CNHA 4ZS0A 2WQOA 1MRUA 3OROA 4GH2A 4O7YA 4J52A 3AW8A 2C3IB 3P0MA 3HECA 3SXRA 2PVMA 2XAOA 3VS0A 4ZOGA 5I9YA 3KREA 2WQNA 3G5DA 4M0JA 3FZRA 5HLPA 5AUVA 4B99A 2ZAZA 5E1SA 3C5UA 5IQBA 3BLAA 4MBLA 2DABA 5I5TA 4F7SA 4IJ9A 4QNAA 2ZMDA 4XBUA 5DA3A 3SG9A 2YDKA 3EQFA 4RVLA 4I94A 3PJ8A 4ACGA 4XRJA 4RFZA 4BCPA 5B2KA 2OXYA 4BRXA 2WYOA 1JWHA 4O7LA 4BCOA 2YJRA 4DBNA 5DG5A 2W1EA 2XF0A 2XARA 2XIZA 3C4FA 5ANEA 5EM5A 5CAUA 4B7TA 4D1ZA 4A9UA 4CFMA 3R9OA 3WILA 3JVRA 3LCDA 4DH7A 2BAJA 4E73A 3COHA 3VUMA 5I5WA 3ZLSA 1G2WA 4MNFA 3MS9A 4AZSA 2BROA 3E8CA 2AYPA 4PDPA 3QX2A 4WD5A 1EYZA 3EJ1A 4H39A 4AZEA 4XV2A 5FLFA 1DAYA 3UQFA 4GFGA 3RGFA 4DTBA 2A27A 3ZHPC 2JIIA 4WRSA 2HXQA 3OCSA 3QTUA 3T8OA 3FMKA 1UU8A 3ZMMA 3UVRA 1EHIA 3VN9A 2VO3A 2B9JA 3CKXA 3NYXA 3V04A 5EDQA 5BV3A 4RZWA 2J5EA 5LCKA 4UXQA 3F88A 4IWPA 5CNOA 5HI2A 5AV4A 4FFMA 3UPXA 3OXTA 5GNKA 5CSXA 4E7WA 4J99A 3OW3A 3EZRA 3A60A 1EKFA 4LG4A 3AG9A 4GCJA 3Q9WA 1E4EA 1Z2PX 3DAKA 4YJ2F 3HEGA 1KE7A 2GMXA 4MXYA 3CTJA 3WF8A 4FEWA 2Z7RA 3GI3A 1Q61A 2WHBA 1KTAA 3WIGA 4IDVA 3C4CA 1JQHA 2WMVA 1PXPA 4K2RA 4BDJA 4BCMA 4IVCA 5BVEA 4CLIA 5BWTA 4P5ZA 4QNYA 1IA8A 1WBVA 2PHKA 3RP9A 3TINA 3C51A 1XMLA 5IUGA 1R1WA 2R7LA 4M69B 3FMLA 3F3WA 3GC9A 3ORLA 3M11A 4H3QA 5AUYA 3VS2A 4AN9A 2PMLX 3KULA 3R8MA 5K4JA 2XH5A 2ESMA 4XYMB 4QTBA 4YZDA 5F9EA 2FPPB 3NUPA 2UZEA 4O7WA 3PZHA 1MP8A 3RAKA 4C61A 1OBDA 2AUHA 3PTGA 1CKJA 1BMKA 3WWHA 2CN5A 3R1NA 4BI1A 2LAVA 2ITOA 4IFGA 4O7VA 4DT8A 5J5SA 1G8JA 2X6DA 4S2ZA 4TYEA 4W8DA 3TNQB 4IHPA 3V5LA 4XP0A 2YFXA 4FZ7A 4TRLA 3R6XA 3AMAA 1Q3WA 4RJ3A 5E91A 4DINA 2W6MA 3M1SA 5D10A 1Q8YA 4PDOA 3E8DA 4L45A 4GV1A 2CGUA 5HEZA 4F7JA 5LMBA 1CKMA 3AQVA 4XG2A 2WB8A 3Q4ZA 2OFVA 3EIDA 1SVHA 2P3GX 3TV4A 4A9TA 4M14A 4CEGA 3E3BX 5AUXA 4ZSAA 1L8TA 1ZOGA 2Y4PA 4DEGA 4NUSA 1KOBA 4FUYA 4XS2A 3ZO1A 2OZAB 4L3JA 2VTQA 5JSMA 5CA0F 3PA3A 4R1YA 4S32A 4ANMA 3I4BA 3TL8A 5GONF 1YOJA 4ZLOA 3JYAA 3TEIA 3JZFA 3UTOA 5A6NA 2GQRA 4H58A 3CTQA 3BA9A 1CDKA 2BDWA 2XKEA 4YBJA 2CGXA 5E8TA 1PK8A 3GXLA 2GNFA 4IAFA 3FMMA 4XV1A 2JKOA 5LXMA 4BBEA 1EUDB 2XD4A 2XKDA 5DMXA 3CE3A 3DS6A 4TZRA 2WMAA 4AN2A 1I2LA 3T3UA 3G6HA 3F66A 4LV5A 3RCDA 3GIDA 5KNJA 1V9PA 3GQIA 3FE3A 4DTAA 4IVAA 2AC5A 3ZBXA 3QBNA 3HVCA 1ZOEA 3OT8A 1O6LA 3TTJA 2W1FA 1W8CA 2YDJA 3DGKA 4NCTC 1A3GA 5EKNA 4FZ6A 1JNKA 5KS8A 1ULZA 2ITUA 4S34A 4Z9LA 1YI6A 3FZOA 3ZBFA 5HTBA 4HN2A 3ZM9A 5FTQA 5E8XA 4ZMFA 4AAAA 2QOBA 4YU2A 2ONLC 4OR5A 2BDFA 4Y8DA 3FLWA 4YLKA 3TZMA 4AU8A 3OF0A 2HAKA 4JR3A 3IW7A 4I1ZA 2X4ZA 3AKLA 2PZIA 3E87A 5L6OA 4CCUA 2HVQA 5JH6A 3FXWA 3MWDA 3R02A 5BYYA 3RMFA 2H9VA 3W1GA 5LWNA 1CKNA 4QPSA 2C6IA 4N4SA 3HO8A 4EHGA 3SV0A 1FBNA 4U80A 4PNKA 2GQSA 4J8NA 4CKRA 3LFCA 4QMPA 4R7IA 5KCVA 3MJ1A 3DT1A 3VWAA 1K2PA 3KALA 3BU3A 3MPAA 4RLLA 4MBIA 2RL5A 3RHKA 3QU0A 4KBKA 3T9TA 3SD0A 4Q2AA 4X2GA 3WF7A 3WOWA 1I1LA 3HB9A 2NU8B 3T9CA 4FNZA 2C1AA 2OICA 1K3AA 3R63A 4C35A 3W8LA 1YVJA 1OL7A 5DISC 5BMSA 4M15A 3LE6A 5C4KA 1G3NA 4ASEA 4BYJA 2HZIA 4B6LA 4BTJA 3ID6C 1U46A 3NLBA 4PZ8A 4QMWA 4Y5HA 3I5ZA 4ANSA 1WCCA 3BA8A 4UV0A 4FZFB 3GC7A 3DV3A 4NJDA 4FFNA 3ZFXA 3OMVA 2BPMA 4MD9E 3KA0A 2WTKB 3K5UA 3QQFA 2OK1A 4MXAA 4A9SA 4KBAA 1UV5A 3DLZA 1JBPE 4WHXA 2JEDA 4JL9A 4U42A 2BFXA 3W2PA 5HVKA 3BGPA 5C1OA 1Q8UA 4GUBA 3VA7A 5CANA 4K77A 3ZH8A 3P23A 4XX0B 3FLQA 2Z02A 4ZHQF 2XYNA 5AP2A 3VF8A 3P7CA 4FIHA 4GG5A 4BI0A 3RUPA 3P1AA 1H4LA 1U54A 3LVPA 1B6RA 2BALA 2XUUA 1OPLA 2UW9A 3OUKA 2OGVA 4X2JA 4BIEA 3C0GA 3R8LA 4RQVA 1H01A 1VBHA 4KKEA 4K18A 3LCTA 4KIPA 3F2NA 3DCVA 3FQEA 4A07A 4QTDA 5BVDA 5FXSA 2PPQA 1OL5A 5IQCA 2OFUA 2VNYA 3PUPA 2YCSA 4DFLA 2W71A 4GLXA 4FFRA 4YJVA 2OIBA 3FZ1A 3LFSA 4RWJA 4FL3A 2UZNA 5HTCA 5JFXA 2O64A 3BE9A 3MA6A 4GU6A 4QYYA 4AXDA 3KRJA 4ZZOA 5AP5A 4YZMA 4NW6A 4WKQA 3QXOA 1WBNA 1OIQA 2B53A 4YNEA 2GHGA 1YWVA 3R8PA 4MKCA 3ZM4A 4FEVA 3RHXA 2DYLA 3ITZA 3RPRA 3QD2B 1PXLA 4D4VA 1JKKA 3MFRA 4D9TA 4PBCA 3LFDA 3A62A 3BIZA 5JN2A 2ITVA 3O23A 4I23A 3U9CA 3DJ7A 3KULB 4QEBA 3PLAE 2W6PA 3QZGA 5K3YA 4DG2E 4F65A 5LVPA 2A4LA 5HHWA 1YW2A 1JDBB 4U44A 4U8ZA 4AXFA 2AEGA 4WUNA 2JIUA 2IVTA 4YR8A 2FUMA 3UZOA 4JG8A 4O2AF 2H96A 2CLQA 4WSYA 5FXQA 3JVSA 3LXLA 3AKKA 4AA4A 5IQFA 1YXXA 2OG8A 3H3CA 3OEZA 3TZ8A 1TKIA 2BHHA 1IEPA 2Z04A 3H10A 3P5KA 2VTIA 4ANBA 3I79A 4BZNA 4RJ7A 1ZWSA 4R3CA 4YJRA 4NZMA 4C2WA 4WO5A 3V5WA 4PMPA 1JKTA 4UXLA 2R7MA 1I09A 2XBAA 4FKWA 3FMEA 4EFBA 4DCEA 5J7HA 4MNEA 4H1JA 4X6RA 5CU3A 4AXEA 2PSQA 1MQ4A 4YPDA 4O91A 4F6UA 3ZFYA 2HGXA 3L1SA 4FTQA 4P90A 5E8SA 2EWAA 2QHNA 2YM4A 4JG6A 5AAGA 5IYZF 2HHFB 4TT7A 4YBKA 3MTFA 4MHAA 4QP8A 4KRCA 4I41A 4XZ3B 3QHWA 4FSWA 4FV1A 4DDIA 3R30A 5CAOA 5CF4A 4RFYA 3C4EA 1ZRZA 4YTHA 2PUPA 5BMVF 3WO0A 4NW5A 1AUXA 4FMQA 1EKVA 4OTIA 3JSNA 5LP6F 2W96B 5EW9A 3W2OA 5BWWA 4CKIA 3TY5A 5HZNA 1WBWA 2CGWA 5K5XA 2EJ2A 4RJ6A 5B2MA 3EH9A 1GOLA 4K1BA 1IASA 3TTIA 2R7KA 5EHYA 3UE4A 4B4LA 4CMTA 1W96A 3OCTA 2I1MA 3H4JA 3UODA 1W0XC 4HNFA 1GZ8A 2IZTA 1R0EA 3OOMA 3F9NA 4TWNA 4CD0A 1YOLA 4EH3A 3TKHA 3QHRA 5HVJA 2BAKA 4FSMA 3WE8A 5I9XA 4FTUA 3JS2A 1CS0A 4PL3A 3FMHA 3NCGA 1OI9A 2G01A 2BTSA 4WOVA 3SC1A 4YTFA 4MYGA 5TT7A 1H0WA 2GS7A 3OXZA 4TYJA 1SYKA 3RPOA 3UIXA 3EKNA 2YABA 4G34A 4JX3A 5AIKA 2GDOA 2PBZA 4BCGA 3ETHA 3G2FA 2CFMA 2J0MB 5A9UA 4FT3A 4HCTA 4N6YA 3GU7A 5JZNA 4E5BA 1CKNB 4IHJF 1QPJA 4CKCA 2P2HA 5CU4A 4D9UA 5EQYA 2B4SB 4JDIA 4IX3A 4E6DA 3F2RA 3HAVA 3QKLA 4GL9A 5BPHA 4ZTSA 3IG7A 4CT1A 4EONA 2BUJA 4Y85A 2VWVA 1A06A 5LJJA 3U9NA 2JDTA 4NTTA 4DEDA 3R1SA 3EQHA 4J95A 4DHZA 1CQIB 3PRFA 4CHIA 3QCYA 1XH4A 5EM6A 3QWJA 2C3JA 3HL7A 4FA2A 1X9NA 2VUWA 3FZSA 3BE2A 3HKOA 4C3RA 2F2UA 3U87A 2H8HA 2ETKA 1T36A 5CT0A 4LRJA 3PA4A 1XDNA 3LMIA 3QQJA 4ZTQA 3F3TA 5FTGA 2I8CA 5HNBA 5EH0A 5I0BA 4AT4A 2BDJA 3DB8A 3E92A 4NKSA 1Z2OX 4L1KA 3WIKA 3BYVA 4XP2A 4C4HA 4F9AA 3JZ6A 1TQPA 2P0CA 1BLXA 3NW5A 5E4HA 2J7TA 4CKEA 3PZEA 4G17A 2WTKC 2DS1A 2FSTX 4G9RA 2F2CB 4MV8A 3UMWA 3ZS5A 3L8SA 3LFFA 4FOBA 4AZFA 3EQCA 3UDTA 3G0FA 4ZOLF 3OUNB 5HG8A 1U54B 3NPCA 2R3JA 3V51A 2CCIA 4CTCA 3MVJA 4ZLZA 3VOTA 1V0OA 4F1OA 3O8UA 2C0IA 4KABA 3UO6A 4AQKA 1FGIA 3JRWA 2NRUA 2OSCA 3R22A 4YSJA 2W6OA 3C1XA 3BWFA 4MXCA 3TUDA 3HA8A 3FHRA 4GFMA 2V7AA 3R9DA 2Y6MA 1C3OA 2UZOA 2X4FA 2HIVA 2XYUA 3LJ2A 5EG3A 2R3GA 2SRCA 2HELA 1PMNA 1DAAA 5AA9A 1NXKA 3EOCA 3MESA 4I5MA 3ZZWA 3AX6A 5FPRA 1SZMA 1GJOA 1TFFA 3ORTA 4CFNA 4HVGA 4JJRA 3P9JA 4RC3A 3GFEA 2ZOQA 4IX4A 4JQ8A 3KXXA 5FM2A 4EH6A 2BFYA 3C0HA 5EYMA 4RJ4A 1HCKA 4QYHA 2YM7A 2YRWA 4R3RA 4CFFA 1KE6A 3E7OA 2YHVA 3L9LA 3RAWA 4J8MA 5C1PA 3FHIA 4QTCA 4YP8A 4CTBA 3TEKA 4C4GA 5HD7A 5I5SA 3IW4A 5IA1A 1WMKA 3JXWA 3IO7A 3QKKA 4IZOA 1OGUA 5LYJF 3F5GA 4NFMA 4FKRA 3N6RA 3DTCA 3KMUA 3NAXA 4JLCA 2XB7A 5GJGA 5AP0A 1GZKA 4I6QA 2OJIA 1FVIA 3LFBA 1J7LA 2E9PA 3Q3BA 1VYZA 4M7IA 2WMRA 3DBQA 3W1BA 4EHZA 3FC1X 2X2KA 3OOGA 4L7FA 4AP7A 4C5BA 3QA8A 5FD2A 3F7WA 1ZMWA 1VR2A 4FJVA 2XK6A 3CSVA 2X2MA 4NM0A 3N4TA 4BCIA 3I7CA 4TYIA 2QKWB 3WI6A 2CKEA 4X3FC 2WTDA 4AGCA 1P14A 4DFZE 5BVKA 3NUXA 2VV9A 1P16A 4YAKB 3HRBA 3NVMB 5HO7A 2X0GA 3MTLA 5CS6A 3R01A 3ZUTA 3I60A 3KAJA 4GKIA 4FSRA 4ZZNA 5EHLA 1JVPP 4QMMA 3RV4A 1WVWA 2WMXA 3C7QA 3MB6A 3D94A 4KNBA 4M84A 3GT8A 4MNEB 4Q5HA 4FEXA 3O71A 3TDVA 5J1WA 2B9FA 1UNGA 2PVHA 2UZWE 3KK8A 5DIAA 4L42A 2FH9A 2B1PA 5J9ZA 5L8JA 3D7TA 3SXFA 1GGOA 4EFEA 3RAIA 2WTJA 3QTRA 2IZRA 2ZB0A 3MW1A 4IIRA 4AE9A 3KN5A 4DEAA 5JFWA 2G9XA 1Q8WA 1QCFA 4FTCA 5AV2A 2YM8A 4QPAA 5HE3A 4AT3A 3MV5A 3QUDA 4TYGA 2XKFA 4MVFA 3GGFA 4AX8A 4F0FA 2DIKA 4AXCA 4PMTA 3KY2A 3D5UA 4GMYA 4I6FA 3W2CA 2QK4A 5DR6A 5DR9A 5EFQA 3B2TA 2R5TA 3UOJA 4L7SA 3BYUA 2YZNA 4RX7A 5ANOA 4XRLA 5LMKC 2R3RA 1WBSA 4KD1A 2X7FA 3KEXA 2IPXA 2CDZA 3JY0A 5BWXA 5IPJA 3MFTA 4RIOA 2VTJA 3DDQA 3EL8A 4NK9A 4MV7A 2WMSA 3QC4A 4DRFA 3T9BA 4D2RA 4LV7A 4QQTA 3PIXA 4HZSA 2J9MA 3GLKA 5J87A 2VRXA 3FZTA 1UVRA 1QL6A 3TNIA 1H24A 3VMMA 4RLKA 4WG4A 5JKGA 3BU5A 5CF8A 3QQHA 5K4IA 4E4TA 2R3LA 1SMHA 3JPVA 2JBPA 4RWIA 4ACHA 4FFOA 3NMUF 2QU5A 3MY5A 4V04A 5C9CA 1BI7A 5JGBA 4GT4A 2NU6B 1KJIA 4RZQA 3TJCA 5KMIA 2XNNA 4EG0A 4MWIA 2P55A 3ACJA 5AIRA 5H2UA 1FVRA 5DRBA 1I7NA 3BACA 3RWPA 4KKHA 2RFEA 3D14A 2CPKE 3CPBA 3DKCA 3NSZA 4IC8A 4WNOA 1YXVA 1ZYLA 3ZEWA 3WO1A 3FAAA 3OEFX 3OTUA 2G1TA 4Q5EA 5JEBA 4DAAA 4O0WA 2B0QA 1I1MA