1I7NA

Crystal structure analysis of the c domain of synapsin ii from rat brain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
b'KAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPSIN II
publication title ATP Binding Independent of Metal Cations in Synapsin II
rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide
total genus 87
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1i7nA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1i7nA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i7nA02
2R86A 2I87A 1E4EB 1BXRA 2YZMA 3KREA 5C1OA 4MV4A 1KEEA 3MWDA 1GLVA 3KALA 1CE8A 2I8CA 3N6RA 3UFXB 2YYAA 3QFFA 1JLLB 4EAAA 5J2UF 4O81A 3KAKA 5LYJF 3LWBA 2DIKA 1EUCB 3Q1KA 1EYZA 4O2AF 2XD4A 2VQDA 4HQ6A 2P0AA 5HBRB 2R85A 1CQJB 1M0WA 1W93A 4EA8A 2R7MA 2YZLA 1B6SA 3NUAA 2CZGA 2HGSA 3R9RA 4IIJF 1IOVA 4MV7A 5CB4F 1ULZA 4O7YA 2PVPA 5IYZF 3WNZA 4ZQIA 4M9UA 4Y8VB 4M99A 2GPSA 2FB9A 5BPFA 4FFPA 4TV9F 5D8DA 3E5NA 2CNQA 2QK4A 3VPDA 4I50F 2R7LA 2FPPB 1EUDB 3WO0A 4J6EA 3AW8A 5BMVF 5JH7F 3WO1A 1KBLA 2CNVA 4YAKB 3BSYA 1W96A 2YS6A 5JQWA 4O7VA 4EGQA 4FFRA 4FFOA 4I4TF 1OBDA 1KJQA 4EA7A 4NYEA 4FGRA 4ZHQF 2W71A 4ZOLF 1UC9A 4XX0B 2IP4A 1C30A 3ETHA 3HB9A 3RFCA 3TIGA 3U55A 2R7NA 2V5AA 1KJ9A 2YW2A 5CA1F 3RV4A 2YRXA 3G8CA 1VKZA 1KC7A 3R5XA 3KAJA 4MV8A 2Z02A 4O7LA 3VMMA 1GSOA 4L1KA 3JZIA 3OUZA 3V4SA 2Z04A 1EZ1A 4O2BF 2W6QA 1I7NA 2CNUA 2HJWA 2GLTA 2DLNA 5H80A 4MV3A 4QSHA 1JDBB 3I12A 3V4ZA 4YJ2F 1I7LA 1SCUB 2VR1A 3R5FA 4FFNA 2OLSA 2SCUB 2NU8B 2NU7B 4O86A 1CQIB 5JQGF 4WBNF 1E4EA 2ZDGA 4FFLA 4O84A 1DV1A 1M6VA 5C1PA 3K5HA 2ZDQA 2W6ZA 3OUUA 3N8DA 5CA0F 4YJ3F 3ORRA 4EGJA 3GIDA 5LXTF 1KUTA 3VPCA 3VA7A 2ZDHA 2W6MA 2QF7A 3BSSA 1DIKA 2YRWA 3TINA 5FNVF 1Z2OX 2V58A 4O4IF 2WYOA 2C00A 1WR2A 4EG0A 4ME6A 3TQTA 2NPOA 1PX2A 4IWYA 2X0SA 3HBLA 4MA0A 5LP6F 3U9TA 4FE2A 2PBZA 3R23A 4O7NA 2CQYA 4GGMX 1GGOA 5J2TF 3SE7A 2FPGB 2PN1A 3MJFA 2YZNA 4O7ZA 2YWVA 2W70A 4MAMA 5EZYF 1CS0A 1VBGA 3U54A 4C5BA 1JDEA 3K3PA 1Z2NX 3AX6A 3GLKA 2DWCA 1C3OA 4IHJF 5LOVF 4M98A 2R7KA 5KKNB 3ETJA 3R5HA 4HR7A 5I47A 5K2MA 4HNUA 1M0TA 2FP4B 3DF7A 3HO8A 3BSWA 3U9SA 2V59A 5CAEB 4O4JF 3TIIA 4I55F 3VPBA 4M9CA 4TUYF 3RV3A 4E4TA 4O82A 5GONF 2YL2A 3JZFA 4DIMA 5JVLA 4O83A 5HV6A 3ORQA 4IZOA 4EABA 1JKJB 4TV8F 2NU6B 3BFPA 4YAJB 4O7SA 2VPQA 2W6PA 4RZQA 2VHEA 3BG5A 4IWXA 4MV9A 4MV1A 2J9GA 3MWEA 3RUPA 2GQRA 2XCLA 4C5AA 5DMXA 2W6NA 4MA5A 3G8DA 1EHIA 4MV6A 1KJJA 5JVDF 3JRXA 1DV2A 3VOTA 1UC8A 2FPIB 2YZGA 2R82A 4HNTA 4EA9A 1IOWA 3JRWA 4O7TA 4HNVA 2W6OA 4C5CA 1KJ8A 4FFMA 5KX5F 2GQSA 2GPWA 4O4HF 2R84A 2YS7A 2R87A 2DZDA 1B6RA 1BNCA 1OBGA 1GSAA 1T36A 1AUXA 4XZ3B 5LA6F 4O4LF 4FU0A 2NU9B 1Z2PX 4O7WA 4DLKA 1A48A 5BPHA 2R6FA 1A9XA 4YBZB 3LP8A 4YB8B 1AUVA 2I80A 4XYMB 3TW6A 1GSHA 4XYLB 4O7RA 4ZI7F 2NUAB 4WD3A 1KJIA 1VBHA 5C8YF 3K5IA 3Q2OA 1PK8A
chains in the Genus database with same CATH superfamily
1GLGA 4XUCA 3FYUA 2LPMA 5C3EG 2P62A 3RARA 4B17A 4E5NA 1PT5A 2K7ZA 3UFXB 1SD2A 4D6PA 4MYUA 2AZXA 3NASA 4R1LA 4IH9A 4M86A 3GJRA 5F9HA 3NI2A 2O8DA 3EQ6A 3D0RA 1LSSA 4OHYA 3ZTYA 4B7UA 3OZXA 2ZIZA 4EFLA 2AG0A 3O3CA 1DPFA 1QO9A 5HKOA 1Z5VA 4GP9A 2QNIA 4F8YA 3FI9A 1ZSYA 1CQJB 5THQA 2E49A 4QIWE 3SEAA 3H84A 5C7LO 5EHGA 3EW9A 2IU3A 1MCZA 3OAAA 1FVOA 3MA0A 1PTKA 2P2SA 2C2GA 4XIFA 1D0SA 3T1NA 2POQX 2H5LA 2RHLA 3ASUA 2N3ZA 4IDHA 2BMDA 1WJGA 1HOXA 5J2UA 4QW9A 3LCJA 3C7CB 1AG9A 3DXXA 4U63A 3QE9Y 1S1CA 3ZCTA 4NBLA 1G21A 1Q95A 3DDCA 2IBKA 2OMEA 2HA0A 3VNAA 3MRVA 4DDTA 2J45A 2Q0QA 1UKEA 1E7RA 3BZUA 2OCKA 3FN4A 4KOEC 3DWEX 3FVQA 4L8FA 3W2GA 3H5AA 2Z9CA 4XZ3A 4TQRA 1GAXA 4JI8H 4MQUA 5K6AA 3VYRB 1ZK3A 2B8NA 1UWKA 3E4DA 1U3VA 3M1LA 1H8HD 4F1WA 4LH7A 2EJUA 5ALTA 3UCFA 3WL6A 5BYKA 3S28A 3M6XA 5CPBA 3PLRA 3REGA 2W6QA 1VMAA 2D0DA 3V9PA 3DM9B 4DA6A 3SZOA 1BDMA 3UWKA 1K27A 4ZU6X 1P18A 1YVDA 2RBEA 2FWBA 1N2BA 4JQCA 1N6KA 4TVSA 1IBCA 3JQ7A 5F52A 2VXOA 1DWPA 1M6WA 3E9CA 1ST2A 3C3AA 2W6ZA 1U9ZA 1H3FA 2HRZA 2I1WA 1P2BA 4UEJA 4WOKA 1K88A 2W2MA 3SWWA 3R7WA 2OCDA 4O4IF 1K8RA 3PD7A 4OHFA 1AMNA 4WESA 2VJOA 2DOKA 1RPZA 2XMPA 2F6RA 4KUEA 2FEAA 1JDNA 1Z25A 2VHUA 5EYPB 3H2GA 5AW0A 1CDOA 4ECQA 1SAYA 1C1YA 4DV7H 2ZTHA 2TS1A 4I5FA 5JMTA 3WGKA 2VTVA 5SY9A 3A4IA 3T7AA 4D0RA 1JFFA 1M2JA 1HM5A 4PZEA 4TXJA 5A4KA 2ZRDA 3BS4A 1XEFA 5K6AC 4TM7A 1KS9A 1PI3A 1LDEA 1XTVA 1KQOA 4HNHA 2ENWA 1VIYA 1EUDA 4F4IA 4GXQA 3ZY5A 4W5TA 3WWEA 1YB1A 5DNWA 4EW6A 1FDIA 3SN6A 1SC4A 3DL4A 4REOA 4MCJA 1JG4A 4D97A 4QLBA 5BSFA 2QD3A 2PZAA 2V3VA 1VL1A 1K63A 4BMNA 2ZUUA 1OXTA 5GOZA 2HPAA 1C41A 5GIPE 5DLGA 1SEPA 3UW3A 5AKKA 4Q4DA 1XWFA 2EFJA 4YRQA 3L6BA 3OX3A 3E18A 3HEMA 3X1DA 5D86A 2LRHA 1PKXA 4DNPA 1L4NA 4HQNA 5HOQA 5JJIA 1R6UA 4ACBA 1A9XA 3F9RA 1VG0B 3NUZA 3QVGA 4XDHA 1XJ5A 4X00A 5KTOA 4GVPA 4Q7MB 3E84A 1V2HE 4FHZA 4ZI7F 1R4MA 3D31A 1MB2A 3FWPA 3RSCA 4WHMA 2V7QD 3VXKA 1UR5A 3RYHA 2AF4C 1UPBA 1G9XA 5ARBA 4ZXPA 4PYIA 2DKNA 2W90A 4KIWA 1KFKB 3RJ5A 5IT9W 1U2EA 2B35A 4YDHB 1U7UA 2G7ZA 2YV3A 3DFIA 4YMHA 2AI3A 3R0ZA 4JI4H 4RK0A 4RE6A 4ZQHA 5CX4A 5L4LA 3RUEA 1QQTA 1KPIA 1AQ6A 3EA4A 3MLEA 5J47A 5F3RA 3TCXB 3UJAA 1OFVA 4GOMD 4OHVA 2QHXA 4JVMA 3A14A 3WNZA 4QWMA 2G9UA 4G4IA 5JY1A 5BN4B 3IQFA 2FB9A 1FP6A 4F72A 2XA1A 1XTRA 4OXQA 3RASA 2O3QA 3HBAA 3CZQA 3I9OA 3HJUA 2OC4A 3HVHA 3C3PA 2IEZA 1P7ZA 1J2JA 3ONFA 1E9SA 3MFIA 1TD1A 1IONA 4EA7A 4GBJA 2PNFA 1ZAYA 3E53A 5AW1A 4TKVA 3DMRA 2JA5G 2JA6A 2B4YA 2Z09A 1NQXA 1RABA 5K8TA 4KL8S 1QZZA 2O8FA 1XGKA 3KYDA 1YBMA 1POWA 1W48A 4CLHA 5KEIA 2PX3A 2WM8A 1LY1A 2CT8A 2GRUA 4TZTA 2BMJA 1F8GA 5JTTA 1TLFA 5CX1A 4QTZA 1XTKA 2ZW9A 3A6ZA 1G7RA 4BMCA 1U1FA 3FWNA 3RVPA 4RNNA 4RTJA 4LTNA 4M1ZA 4CIDA 3GBPA 4TUYB 3ZHZA 3ZJYA 4DE5A 1HT1E 1JMVA 4JBWA 3OKAA 1O94A 4KW7A 1D7AA 3K70B 2G28A 4L22A 1USUA 4A3JG 3WIDA 5DG8A 5EJGA 4E21A 1CYDA 3I52A 4OBXA 1CS0B 3LCCA 2Y27A 2UZIR 1IM8A 2PEZA 4J49A 4DJAA 2GK6A 1G8PA 4EG3A 1N2GA 3H3JA 1KFEB 4A3BG 1GRQA 1X7DA 3NKVA 5DGBA 4PNEA 5HS6A 1IWOA 2C2BA 1JA0A 2YOGA 2FR1A 3SDSA 4NG5A 4B4DA 2A5LA 2BIFA 3PS9A 1HLPA 3WK7A 4BOYA 4MS4B 4GPIB 4KQ1A 3PQCA 5KPJA 1N8TA 1N0IA 2FPPA 3PI6A 1E59A 4ERNA 2PWYA 4KXFB 1XRRA 2HYDA 2WSSD 5EJ9A 3UK0A 1TTTA 1GL3A 2BMEA 7GPBA 5KYGA 2OGUA 3EPHA 1YJ8A 4MO9A 3LC2O 2WKRA 4YYEA 1NNI1 3O9MA 3JQAA 2DHRA 1NQOA 3A27A 2AZMA 5ITZB 1D2GA 5IWAB 2PBRA 2YWGA 2OYRA 2D2FA 5KVSA 3CRW1 3G6KA 4QUHA 5EKTA 2GJ8A 3LDGA 4DL3A 4HMPA 5B30A 3C3YA 1EHIA 3IVGA 3PU6A 5JYBA 4W5HA 2HIVA 4OJYA 5DIFA 3UAGA 4RHUA 1KAOA 1ZM2A 4JT8A 2HCBA 1SC9A 3O0DA 3QUTA 2CY0A 4B73A 2JGDA 1D5WA 3WGVA 1YACA 4KXMA 4XFKA 1QTIA 3QTTA 1IK6A 1Q7BA 2GH1A 3AEUA 3MMSA 4ZJZA 1OLSA 5E6SB 2N75A 4RZUA 4X6UA 2VZ9A 2DUMA 1XVAA 1JWBB 3IHKA 1F7UA 4ARZA 1Y14B 1ULSA 3P0JA 2I4NA 4QECA 2W9CB 3L93A 2R751 3EIEA 3DBRB 1PYDA 1ZD2P 2XLBA 1NW8A 2GO1A 2OKCA 1YDGA 2X58A 4AX8A 4BQEA 3I39X 3ZE6A 1CBUA 3A1TA 3CKMA 4XWKA 3LHKA 3IVCA 1MAVA 2IY9A 3EGXA 2ZRPA 4RB3C 4PBRA 3P0FA 3VKGA 2K87A 3L1JA 1EBUA 3T9CA 4ID9A 3P97A 4ABYA 1EGQA 1ATIA 2DIKA 1P33A 4RPLA 2K2WA 3QU5A 1M8GA 3FUVA 3L1KA 5AOBA 4DL7A 1JSCA 3NEAA 3FNGA 4RZHA 5BOSA 1HYHA 3M6IA 2BOVA 1TEHA 1Y7IA 2A4MA 3FMIA 4JB8A 3QEJA 1LTKA 2CWDA 2WE8A 4HAVA 5JXGA 5IVKA 4FW8A 1DKNA 4NXNH 2BGTA 5I5VA 3ADDA 1E1YA 1PNTA 3UMMA 3Q5DA 4R69A 4CIXA 4X8MA 1DAHA 4E3WA 3NHFA 4DDHA 1GZDA 2QSUA 5GJBA 3PG5A 4G8JA 3UOAB 4CWAA 1NOKA 3S2IA 2QM7A 2C7GA 1K3FA 1IMJA 4O3NA 3WHPA 3LQSA 4BN4A 4LOLA 2Z8YA 1U94A 4OAQA 4Q9AA 3UJ6A 4A8JA 1Y9JA 3E3LA 4LDPA 3AIKA 3LUAA 3GH1A 4IHJB 2RARA 3UTCA 2AHOA 2WB2A 2HEGA 4NE7A 2Q28A 3H1GA 4PQEA 4NMWA 1U2DA 4G3XA 4JLPA 4OI0A 3FOZA 3KKKA 2RHRA 1MA0A 3RUCA 3VZRA 3AUXA 2Q45A 3L1IA 2C5GA 1BFKA 5FD6A 1KT8A 1NDQA 2I3DA 3A06A 2RDMA 1Z18A 4PX5A 5EHXA 1OE0A 4CCAA 5K99A 4DL4A 2ARKA 4LISA 2I22A 1DB3A 4UBKA 4H6PA 4RHEA 5FLMG 1GOTA 1UQRA 3HFJA 3LQQA 2XZPA 3G6WA 4Q0MA 4ND8B 1S5PA 3ZEAA 3NAMA 3MT7A 1K89A 3SVTA 3WMWA 3WLHA 4TSRA 3PPVA 1MW9X 4YJ2A 3ZGVA 3F5QA 1B04A 2R4TA 2XB9A 2XC9A 4DWOA 4AFNA 3EB9A 1OLXA 5H4GA 4R2LA 3QVVA 5E4TA 4BRWA 3FA2A 2HHAA 3BSFA 2HQRA 2JCXA 4Q3EA 5C51B 3W5UA 1ZUNA 2BI4A 2G67A 4UJ5A 2FE3A 1ULTA 4TTAA 1QMPA 2DHEA 3L8FA 3LTNC 3OCCA 1T5LA 1PGOA 3T5AA 1U2DC 1QLJA 1QCZA 1U8CB 4TL6A 1UFKA 5JO9A 2DYKA 3NO4A 4Q9DA 2IX9A 5I4BA 4YJHB 3LAWA 3DB1A 3ZHBA 5HUHA 3GLHA 5I9SA 1Q3TA 2VDPB 2AFHE 1O3YA 3PGLA 3UJ3X 1B4DA 1XZGA 3JWPA 3AWIA 4NEHB 4GOND 4MTCA 2VBGA 1NW6A 2D2IA 2IITA 5LYJB 1X7WB 1FQKA 2WJPA 2HOQA 3W8NA 2C84A 4EFKA 1SQ5A 3O03A 1KMHA 3MWKA 3SJZA 1MOPA 1UPFA 2W6OA 4P7GA 1KQ3A 1WULS 4BEBA 1AE1A 4Z4EA 4ZO4A 2Z8YM 3C3BA 4J1SA 4BTVA 1HG0A 4ECVA 2ZRIA 2P1RA 1F2TA 4RTLA 2J1LA 1EVIA 3TY8A 2AMLA 3D3KA 5EWJA 3MR6A 2OFFA 3KP1A 4GOKA 2GD0A 1ZGAA 3HVKA 3ZZMA 3A3NA 3NIBA 1ODLA 4JQSA 1RAHA 4DMRA 4LHVA 2XMSA 2FDRA 2J3JA 2X9LA 9LDTA 2H9AA 3GNSA 1NUTA 5LZ8A 5KQLA 3J7AK 3ETCA 3LT4A 1J2TA 5F78A 3T8YA 1D7OA 3TYXA 4S1PA 3DOJA 3U31A 3MILA 4G26A 4EMTA 2YY7A 1Q0HA 4JYZA 1ZUIA 3KYBA 1J25A 2FWMX 3QFFA 1JLLB 3AR8A 5AHWA 2ZE7A 4LK2A 1Z45A 1CZHA 4CC5A 2QGFA 2JLBA 3SXUA 1JH8A 2ZIFA 5E1DA 4OGWA 3D3NA 4XSGA 8ADHA 1JKMA 3PCRB 2A86A 4IGIA 2L19A 1JLSA 2VYVA 4Q1BA 4EJ0A 1GL6A 1ULZA 1XZDA 2FFAA 4MVWA 1RMTA 3HS3A 3DFKA 1N2CA 4ZHSA 2ODPA 4BQRA 3MAJA 3CH4B 2Q9AA 1OX6A 1KP3A 3WAKA 2B4TO 2D5IA 3B6KA 4DLZA 1DJPA 1WW2A 3QY9A 3RKSA 1W96A 3EZLA 3HACA 2AI2A 4DIFA 2X6QA 3OEWA 1BGVA 5LP6B 3RUHA 3WWZA 4AQYB 3G82C 4DB2A 1F2VA 5JANA 1FXWF 2HWKA 2IDJA 3OT1A 3O2SB 4QJIA 4WXMA 3AJEA 1I4LD 3AKDA 3KAJA 3H4MA 4KX5A 2FX3A 3ZWMA 3AERA 5JUWA 9ABPA 4NCXA 2BE9A 4LGMA 3L7LA 4LYAA 1K3UB 1C80A 2XE7A 2H1LA 3T38A 4BIMA 2D59A 5D85A 1NC1A 2QLNA 3HO1A 3KVYA 4LGCA 3BWCA 3HG7A 1LV7A 3VO2A 3ZW7A 5JE8A 3UOGA 2Y6VA 3VPGA 4GIBA 4ERXA 1XRSB 5KYYA 2A1HA 3ZDRA 2XSZA 1OR8A 3IL2A 3PVXA 4FB4A 4GMKA 1EUCA 2DPMA 2GBPA 3ML1A 2FLNA 4DV1B 3E9ZA 4B6EA 3Q3IA 4YO8A 1RHKA 1VPDA 1RXSA 2JANA 2VPWA 4C01A 1SULA 2ZM6B 1E63A 1VDZA 3LIIA 1WNFA 4UD2A 4GGMX 1GGOA 1NOJA 1RHQA 2JNWA 2X76A 4HDAA 4LKRA 5TC4A 2XXBA 4N65A 4YCNA 1KZ6A 2QGNA 2ZOSA 5LD2B 3T5HA 3VBCA 1TMOA 3OWOA 3K3PA 1Y5NA 1MN6A 4Q05A 5A02A 3H1AA 1H6BA 4QYSA 4CF7A 4M8IA 3ROZA 5ICFA 2AKAB 2XRYA 4KGDA 4J2TA 2OD9A 1ISPA 1XFAA 1VE9A 4RKYA 3WAGA 1U2GC 4P53A 1U0HC 5EUBA 2W0SA 3H5IA 4R31A 5G0UA 1JHMA 3M6AA 5FLKA 1WSAA 2ZSUA 4DR7B 3PT9A 2RHTA 1SIBE 2PH1A 3BB1A 1N34B 1GPJA 5FL7A 3WLTA 10MHA 4YHBA 4R8SA 2BMFA 2GLUA 4X7PA 4U2GA 3SYRA 2PQMA 1UBHS 4ETSA 1DGSA 1QKKA 5CIWA 2XA9A 3QVLA 3V1LA 3GAMA 3IQDB 5GOTA 4ZT5A 4JS0A 4HLCA 2O57A 5HKLA 3GGJA 4K0KH 2A9OA 3DBHA 3N76A 1QYDA 5JJBA 5CTJA 4TXLA 1JS1X 2ZT6A 1E3LA 1UQUA 1MU0A 4YRKA 1YIAA 2QDKA 1I2BA 2WF8A 4B2PA 1SQSA 1MJHA 4NFYA 2A3RA 2QY6A 1SZJG 1Y7LA 4DYVA 3C85A 4HH4A 3NJRA 4B3SH 3ZXIA 3MEQA 4O7RA 1E6MA 5D3QA 1LBSA 4WNYA 4DSOA 4D9BA 4PAMA 4N9QA 3STHA 4HGPA 3ZDXB 2Y1OA 3L2OB 3MS7A 3W05A 1PV4A 1S3GA 4RF5A 3DCNA 1PSDA 4Q4AA 5K3FB 3QVUA 4AO8A 2BTQA 1H85A 3U2QA 3D1LA 1VBNA 5LQMA 1IZYA 2WW8A 2IUUA 4DWVA 3TJZA 2CFIA 2G09A 3A6GA 5LA6A 3PRHA 3EMVA 2W37A 2FEOA 4B6FA 1LA2A 4CL8A 3JAKA 1KEUA 1JQBA 1WEKA 5E8RA 1CT9A 4YUXA 2DKOA 3SYLA 4HVLA 1OBOA 1AN7A 2IGTA 4NF2A 5FOQA 2XCAA 1FJ2A 2Y9MB 3NYIA 4KACA 3AFOA 4KQEA 1DO0A 1O0CA 2BMWA 4PC2A 3WNVA 5EGSA 4N8EA 3LVFO 2HQOA 4JQZA 4AMUA 3QF7A 5HDQA 4MYCA 3WO0A 3FSEA 4J6FA 1Z0UA 1FNCA 5DBOA 3LUBA 5FNVB 2PZKA 4X93A 2BWJA 1WCV1 2BFFA 3VSAA 5JADA 3QLJA 5DNEA 2NVWA 1Z7GA 5KYXA 4NWIA 3NHLA 3L8MA 1I30A 4NONA 4FMCB 2A1UB 4P58A 4MJXA 1R5NA 4MTDA 3EOBI 5J2TB 3C1TA 3CUSA 1IG3A 1FYEA 4YQZA 5CB4A 5AXDA 3VBEA 4D0GA 3O3MB 5JROA 3OY2A 3WGLA 5IUJC 1G2WA 5BWNA 2OZLA 3LX5A 1NVFA 3ZQ6A 5KFZA 3CNQS 1MJGM 5F7XA 3FCYA 5AK6A 4YBRA 4G67A 1ETHA 5BRNA 3MG9A 5C5JA 4CMFA 2G88A 5SICE 5CJJA 4KR9A 3HWRA 2A5GA 2XUJA 5AVRA 3DL7A 5IU6A 1VYUA 1IZZA 2I4RA 2CHQA 3NVAA 4GXNA 3IUYA 4WLOA 1N3BA 3PQ2A 3CMCO 1M75A 5KYWA 5EXDA 3DE7X 3ZK9A 5FD5A 5ULLA 4M55A 1KUTA 1REQA 1VLLA 4ZVNA 2ZDHA 3OWHA 5HK9A 5FEMA 1N2JA 2C00A 2YXNA 2B9EA 1Z15A 1T91A 4QRHA 1QE3A 2CD9A 2CE2X 2X0SA 3FMAA 4BQFA 1EFTA 2FRXA 4C0XA 1W94A 1FFBA 4NYMQ 4Y30A 4MA0A 3QOXA 1NMXA 1YHYA 3JR3A 4TMYA 1ZICA 4CQLB 3D4IA 3M70A 4DV3B 3W6NA 1IYEA 3REFA 2XZOA 1IN8A 3U7EB 3GFVA 3QOYA 4HZGA 3PPYA 2HDOA 2X7JA 3R24A 5KKNB 4DIOA 3Q3VA 3WYBA 3HLTA 3EEYA 1TXGA 2J3QA 2JI8A 5LC1A 1RWWA 3HJNA 5EP4A 1WVIA 2WTBA 2B61A 1MT3A 3LYUA 3D2CA 2WRZA 2A7QA 2IW3A 2Y4NA 1M8JA 1MIOA 3JASA 3RSSA 3EGCA 1WS6A 1PGPA 1H4TA 5P21A 3GTPA 5DASA 1HXHA 1YS9A 4E08A 2QRZA 4CR7A 1BD4A 1NQWA 8GPBA 4E7OA 4RHTA 2WIFA 5DGIA 3RU9A 1RI2A 3BA8A 2XYRA 4BQSA 2PL3A 4A6EA 4LEIA 1A50B 1BDIA 3ASZA 4I1PA 5A4FS 1XXLA 1IQRA 4RPGA 3MTJA 4ECXA 1M72A 4D92A 3W5CA 2WJ6A 3KPJA 4JB2A 2AGPA 2QM8A 5FX2A 4JMPA 2P3OA 1IY1A 1ZAKA 2B37A 4HN9A 4A0FA 1X1DA 2WOOA 1X80B 3UT0A 1B8UA 4TV9B 3PNQA 1ML4A 1BVHA 4N6NA 4OK3A 3V6KA 3HJBA 2F3RA 5TGZA 4DMCA 5LN1A 1ELOA 1VIMA 1P0IA 1NRJB 4J9SA 2H5JA 1XZKA 5BR7A 2OK7A 4LSXA 3H9QA 4TRRA 2E48A 2OL4A 3PA6A 4JCCA 2IT1A 1J9GA 2AE2A 1FRFS 3C5CA 4ETMA 3KKNA 3U3KA 1TA9A 3KREA 1LVHA 3WA6A 2FW6A 4RYDA 4HDNA 2H07A 1AS0A 1OV6A 2DR3A 2O3SA 3IMKA 3LECA 1NIPA 2Y1WA 5H59A 5LL6P 1V71A 3KAKA 2ZJFA 5DNDA 2VPIA 2HV9A 4IEIA 1CNMA 2C2HA 3N2YA 4HT3B 4CG0A 1KDZA 1N57A 1CKNB 5KT3A 4ZJUA 3TZ6A 3TAHA 3D7LA 2BTOA 2HADA 1R66A 4ZAFA 1I50A 1AZTA 3AY6A 1UJ2A 2KWIA 4W6QA 2JJ8A 3BTUA 1K8QA 3JY6A 5I5WA 4MWEA 4D80A 1GTRA 2OO3A 3BK2A 2ZANA 2FHSA 1M1NB 2CNQA 3VPDA 4KQ6A 3W8DA 1APBA 4OXKA 1XC7A 4DL2A 4TN1A 4C7VA 4Q3NA 4JLSA 1XT6A 4RVOA 3P96A 4CV0A 4BEVA 3QELA 1IN6A 4WBSA 3ZZ0A 3EA5A 3VDXA 4LXXA 1Q0QA 2RCNA 4XM2A 3ZV7A 1YJCA 4ZOLF 2QW0X 1DKQA 1E9DA 1X0VA 1R88A 1YZUA 1P45A 1GU7A 5CGQB 1AHIA 5ALRA 1OH8A 3CTMA 2BHNA 3ADPA 3P20A 4NJMA 1B3BA 3BL8A 3FDFA 4KQHA 1RWNA 1L4EA 4CU5A 4P08A 3FTCA 3ZBTA 3G5LA 1MW8X 2VSFA 4ZQBA 3GFFA 2ZJYA 3ICPA 5GADl 5HNKA 3OWXA 2C9ZA 1CNFA 3OZ7A 2JBAA 2Q50A 2E4WA 3FRIA 3Q7EA 5FYQA 4Z0HO 4KO4S 1JR6A 1VCNA 3PJFA 1U11A 3EJWA 4AKIA 3PL5A 1CUAA 3DE4X 1NQAO 2QJWA 2VBIA 1DIKA 5DU2A 2VJMB 2E1RA 4PYRA 4MQMA 1VFNA 1LLQA 1DE0A 5JZVA 4YRBA 3EXIA 2QL6A 1GO2A 1FFAA 2IOHA 3ASVA 4IVPA 4G0PA 4DQUA 1E64A 4PBTA 4H2DA 2XUPA 2IPOA 2X4LA 2XECA 2A84A 4IHAA 1IBMB 1YOVA 4XVQA 1VSQA 2D5LA 4CCYB 4DCCA 2HHHB 4BNNA 4F8JA 3L02A 2H4JA 4LJRA 1DKPA 1NBME 5IMSA 4UHKA 3I6ZA 3AQIA 3ONEA 3KT6A 3C1AA 3T5DA 2ZE6A 4CMCA 5B4TA 5ALMA 5EJ6A 1EXNA 3AEZA 1RNLA 2BEUB 2VPPA 4XRGA 1KEVA 1GUFA 4B46A 3ANLA 4L5AA 4PC3A 3GRCA 2QBYA 3TX6A 1E2MA 1YBHA 1VP9A 1S0NA 4DLWA 1ZC4A 1NMQA 1G9TA 4CNQA 3P52A 3HRIA 1EMDA 1QVAA 4S1NA 4ZDKA 4J0FA 5TQ2B 1IHDA 2BEVB 2P2DA 3IPYA 2C7OA 3H20A 3GFTA 2O5RA 2PWPA 4R68A 4PZPA 3BQ1A 5DLDA 1UC4B 2C35B 2LE0A 2CVFA 4GRAA 4UCTA 1TJ3A 4B2IA 2ZSHA 3KRTA 3WGHA 3SF8A 3ZY6A 3CO0S 3I04M 5FFMA 3OZWA 3OIGA 3WYDA 2VYND 1PF7E 4O4LF 4ONEA 4O7WA 4AZWA 3INYA 1OMOA 4IIBA 1QV6A 3R41A 4PSKA 2OCIA 4QYMA 1UBSB 4L9RA 3RJMA 2RK6A 1DAFA 4UBMA 4C88A 1Y6FA 3NORA 1Z0JA 2JRLA 3DB2A 5H82A 1IJFA 4Q1VA 2BJHA 1BROA 4G86A 1HDOA 3OPYI 2W4QA 1H8HA 2CV2A 1VJGA 3Q9NA 4YY3H 1PR1A 1Q44A 2QZZA 3GUZA 1II0A 1H93A 2PMWB 1Z5UA 3QA9A 3U7RA 3PFFA 2A1TR 2JHCA 2COUA 2F4VB 1T5HX 2OV4A 2RB5A 1Z47A 1KF0A 4J9KA 3K6KA 2DPHA 5GWXA 4Y1RA 3IFSA 1Q6YA 4RGBA 2ODBA 1ODCA 2XGJA 4DV0B 3KUXA 3BM5A 5JAOA 2J6BA 3MWGA 2NV6A 5JWHA 1QHFA 5EJ2A 2R7LA 1SC6A 3O0TA 5JH7F 3AJ8A 5GTDA 5TS3A 1KBLA 2RIPA 5E8JA 4BO0A 1O87A 1Y7PA 1WCXA 3H4VA 3OICA 2C7VA 3I2IA 2GFIA 3IBSA 4IRDA 4O2RA 4G97A 1PX0A 3V8EA 3ER6A 2IA5A 1T9ZA 2OD7A 3CVWA 1CVIA 2OHGA 2BJVA 2CJPA 2X9QA 5TQ0A 1J20A 2H9IA 4DQNA 1RAIA 1SCBA 3GV8B 1Y63A 2AU0A 3C3WA 1GPH1 4PLPA 1GNRA 1KAQA 1Y1WA 4TT8A 2XVZA 3GMTA 3CUTA 4YCJA 1JZTA 4LVNA 3PJRA 3LMLA 4ML3A 4GPZA 5KFAA 2JI6A 1DC4A 2R1VB 4G37A 4YP9A 4MHOA 2XIGA 1OZFA 5H4HA 4HWPA 3MTBA 2O05A 4CM7A 2UUCH 1VRCA 4V3BA 4C0SA 3N7TA 4CMIA 2HR1A 1U65A 3JQGB 3RAJA 5KFRA 1L8LA 4L9SA 4ZCRA 1O9HA 1VHDA 2V0GA 4N48A 3VR2D 3G9TA 1IZ0A 3FF4A 6ADHA 5K3SA 2BFDB 3ESYA 3UMVA 1XDWA 2Z5GA 5EJ8A 5BSTA 3EWNA 2F17A 4PWZA 4RFSB 4ZQEA 4Y9DA 2FN4A 5FWAA 3TPCA 5AUNB 3OE7D 4R8MA 2WYOA 1H0RA 4V39A 2ADMA 3SI7A 1T6BY 4O5AA 1PJRA 2FLWA 3Q8XB 3ZH9B 2ERXA 3DZ8A 5CXQA 2XPCA 1M54A 3RFFA 4IXTA 3K30A 2RH4A 1X7XA 2OLKA 2WM3A 5I5YA 1E7QA 3OJCA 2QYHA 2I7DA 2W42A 2E7ZA 1FVHA 1DT3A 4ZEOA 1NIJA 2O7RA 3OJWA 1JQJC 1M2KA 4I4NA 2RI0A 4WCFA 4EYIB 2I0FA 4FOOA 4R2MA 3OBBA 5LQDA 5JXJA 1UNNC 3DGFC 2YY6A 4TMFA 4LN1A 4J3JA 4EHIA 2J5QA 2V7QA 2G1UA 1JR3D 1B16A 2GMWA 3FMGA 3SHVA 1H05A 3RV3A 5REQA 4DRXA 4H31A 5TNXA 5EIFA 1JEEA 1STOA 2Q7DA 5KNCH 1RK5A 1PKEA 4CE5A 4OEHA 1ZHFA 4B48A 1E6EA 2XYVA 2BT4A 4BV2A 3MT9A 3ORSA 1QP4A 3GMIA 1LVGA 5A7HA 4DQKA 1KK1A 3ZV5A 4C0AC 4G1UC 4K6HA 3DLBA 2O07A 3BIXA 4XUGB 4D57A 1EU1A 1MABA 4N01A 3IKJA 4BCDA 3ICOA 5D3KA 4BVAA 1U8FO 4CEJA 4AKTA 5FOTA 3W7AA 2C4TA 1CUUA 1GQ2A 1ZXXA 3KAQA 2YQZA 4XB1A 2WE6A 3HJFA 2YN0A 2A57A 1H94A 2IHBA 3NDJA 1AKQA 1ZVVA 3NTVA 3FROA 2P8JA 2PCLA 2VTEA 3BDAA 3CNBA 2R6HA 2RJOA 4EFBA 4WCFC 4IFEA 2FGKA 3AW9A 4LOKA 2HHJA 2GYVA 1M67A 2GETA 4RV5A 1S10A 1T3TA 2RHDA 2IGBA 4YGYA 1MPXA 3F6RA 2GM5A 5G4KA 1Z62A 2LIVA 3DVRX 2IE0A 2MIIA 1GQOA 3RAPR 4CMEA 3BH7A 1R8JA 1TJ5A 3B7PA 4LI0A 4J0HA 3A9SA 4LJSA 2EKZA 4ON9A 4FOPA 1N2HA 3I53A 1YQEA 3NWEA 3HWWA 3U80A 3X1ZA 4DOMA 4TLMB 4AJKA 4H60A 3IYLW 4X20B 2B1GA 1PSWA 4MUFA 4IDBA 1W93A 5CNJA 1WV0A 2X14A 4EGSA 1A5BB 1KNQA 4N03A 4C0JA 4E30A 3GVIA 5L4NA 1QAMA 5BR8H 2OAQ1 1KYVA 3D8SA 4GC6A 3TI9A 4BQIA 5JSHA 1FZTA 2VHWA 1VJ0A 4JGIA 1ZW6A 3EOZA 3C6ZA 4KSBA 2MINB 2ZBGA 3QEMB 1KIFA 3L4JA 1XX6A 4UM5A 2P27A 1NMSA 1NVXQ 4U8HA 1VB5A 3PICA 4O3OA 2GAAA 4UM7A 4Y2XA 2ZRMA 1EKPA 4DWJA 4ARCA 2XCUA 3V4LA 1OJLA 2XGOA 3A1SA 3RUDA 1W49A 2WUGA 1NQUA 5DISC 1TUBA 4J9QA 4Q3CA 3ER8A 1K4MA 1RP7A 2X5KO 2WD8A 2EL7A 4CMEC 2XUGA 2QVCA 2WSSA 1YJQA 1HOTA 4FHEA 2HX1A 4Q9IA 1G38A 2A7XA 5E3IA 2UZ0A 2ECFA 1JXOA 3CXRA 1U1GA 2OKGA 4CKBA 3P0HA 1JYEA 4K26A 1GM5A 4EPVA 2DVMA 2Q62A 1JSRA 1A9YA 3PNBA 2XB4A 3ET4A 3GDOA 5LMZA 3ORRA 2PIDA 4JV2A 3TR0A 1YZYA 4PDBA 1N7HA 3ZWNA 4A9AA 5A4JA 4MYDA 1XE3A 3FOFC 5IASA 3HYSA 4ZU3A 1F14A 5F64A 3QG1A 2I67A 821PA 1T1SA 1WHSA 3HNOA 3DFFA 3LCRA 1KAGA 3MUOA 1ZITA 2ZJ6A 5MGNA 1E2HA 4FHCA 1X19A 1DTEA 4J9OA 4MQFB 3RB8A 3HDJA 3HU3A 4A23A 2ZZMA 5BSHA 3N8IA 1VBGA 2LIPA 1SGWA 1W85B 3BRSA 2BCJQ 3AX6A 1C3OA 4WK2B 1CKOA 3FAZA 1CR1A 3AR7A 4JUAA 4R6WA 3BXOA 1TFUA 2R6JA 1RQ7A 3BL5A 1NQVA 1ZWLA 1XAIA 2WIJA 3CNEA 4AX4A 4DVGA 4X7MA 2C4VA 3TE6A 3ISJA 1I5RA 3FJ1A 3CINA 3NIWA 2WVHA 2ZI4A 1MVOA 3GLTA 3ZHQA 3SHFA 4QTTB 4E32A 4ZT7A 1CJTC 4Q7KA 1T4CA 4JAVC 1O6GA 4EOGA 4X65B 1OHHD 2VPQA 1BX3A 4B3TB 2JHGA 5KQRA 1D4OA 1B74A 1ADJA 1ISIA 2HJGA 3AUAA 3IT3A 1KJJA 4DUZB 3AL3A 2JAUA 4QPPA 3CPEA 1NULA 4TMTA 4ETNA 4JLOA 1YOBA 4UHBA 1LLDA 4GYJA 2VF2A 1C7RA 1NBIA 1LGYA 4I9UA 1BJKA 4QTXA 2UXDH 2EAUA 4RJKA 2R6AA 1CY8A 4JELA 4ZZ3A 2VDJA 4HC4A 1T9DA 4DY4A 1OUMA 4JP1A 4YASA 3SGIA 4IXWA 1V95A 5H8WA 3HMKA 3QMWA 2EYQA 4YV0A 1K1SA 3EIOA 4U2KA 1TDJA 5ILQA 4JI2B 2F43B 1RWBA 2EFCB 4QPNA 2C54A 4NJEA 3GO4A 5B1EA 4Z7OB 1F5NA 2I87A 5EMNA 4W1PA 1ZOLA 1AQIA 4ZEWA 1CE8A 4M6WA 5KFGA 5DQIA 1K8XB 1KO5A 1NMYA 2I3BA 3RBXA 1XPOA 2REQA 1Q74A 3NTRA 2H51A 4ND1A 3W2IA 1Z4IA 3G2JA 1G8SA 5LNK1 2XUIA 3ZYCA 3LC7O 1LS6A 4Q8FA 2YZLA 1E1RD 4U3JB 5GAJA 2ATXA 3CWCA 2D3WA 2HK9A 2WWTA 2UUOA 3OOWA 2OHFA 2VHQA 2O8EB 3QW2A 4LCBA 4A03A 3RR2A 2W6ID 1LCIA 5KG7A 2FSIA 1HSOA 4BGDA 4JLVA 2ZUEA 1SQFA 4QD3A 5A7GA 3AW8A 5K7SA 3BKWA 3OTHA 1FDUA 2IDZA 1GG9A 2WA2A 3TQRA 5CB0A 2GILA 1NJ8A 2XMQA 3H83A 3O8RA 2PUJA 4J07A 1SKBA 1I14A 5DWQA 3PUHA 2NXWA 2PVCA 1DDGA 1JEQB 4UE3S 4LRYA 4ZVOA 5FBZA 4ENWA 4OU5A 1C4WA 1HZZC 2ID8A 3O8DA 3RF7A 2JA2A 5KTTA 4CM5A 1ZGZA 3G7UA 4LFBH 1MQ9A 2O6HA 3ESBA 5FCDA 4OSPA 2CJWB 4I3FA 4DZTA 5KFXA 3KEGA 4XYLA 3LQKA 3PB3A 2QN3A 1BWQA 1XZIA 1WDKA 3MJ4A 3SKXA 1C5KA 2J6IA 2IUTA 3B52X 1Y81A 1Z29A 3IDFA 4JJ4A 1FUUA 4D8VA 4MWDA 5EXXA 1U3GA 3K32A 2OMKA 5CA0F 4E2ZA 4JUBA 4I1VA 3H1PA 3VYVA 4ITUA 1WETA 4UTXA 2IPLA 3U39A 3VH1A 4EHLA 4I6JA 5CGZA 3BHJA 4HVCA 1L1RA 3RT7A 1ZJ6A 2C96A 5DCLA 4G4SO 3PGXA 3UJHA 2NACA 1OXBB 3AVXA 1CJKC 1TD9A 1W87A 3S2FA 4M9ZA 1EWYA 2D8MA 3PHLA 4KZKA 4BDSA 5DULA 4YIKA 4J7XA 2VIIA 1DU4A 3F6EX 4G4GA 5KTPA 1FEZA 5KMGB 1A5ZA 1IVYA 2BTEA 2FPOA 2NYUA 4YJGA 1FYWA 1ZD4A 1QPBA 1T3NA 2AJLI 4DMLA 3DD5A 2OSBA 1PRYA 1Q77A 2X8JA 1B2LA 3O4GA 3PWKA 3LKDA 4WBXC 1P16A 5F2EA 4AICA 3EA0A 1H1LA 4N5HX 2ATCA 4NV1A 2ZK7A 4IYJA 3GNQA 1XZAA 1TM4E 1UIMA 4G6ZA 2EERA 2VA9A 3U7QB 2NZVG 3MSCA 5I7SA 3MRXA 1SKYB 3NLLA 3UT6A 2Q0XA 3M2TA 1J5EH 1DQPA 3UGQA 4G3IA 3L3BA 4LE2A 2I78A 1R0LA 2AD1A 1E92A 1PT8A 2BM9A 1ONBA 1XQ9A 1T8SA 1DV2A 5JXHA 2IH2A 1WAMA 2R82A 2XWSA 1ECPA 4ZCPA 5EN4A 2XX3A 1BH6A 1Z5NA 5KWVA 5L9XA 3SR0A 1DTWB 1AUXA 2VT7A 4MWGA 1QGYA 2QD5A 4A6DA 2DTEA 3KVRA 2ZPAA 5EWGA 2VUMA 4X8LA 4YWJA 3PHCA 4F9TA 5LSAA 2XXAB 4RDHA 1EDDA 2QMYA 5FTWA 1TAEA 2TMGA 3GRPA 1GT91 2KS6A 4D9MA 1QTQA 2WTXA 4TMKA 1LJUA 2AXPA 2WJZB 2BF4A 1CJBA 1NQTA 5JCPA 1DS6A 3HZZA 4PG6A 1A8IA 3OQNA 4Z9FA 1CF2O 4UDXX 3GG2A 1LV8A 4BNHA 3ANXA 3C74A 1OH5A 1DTSA 2I8CA 1XQVA 2PA3A 1Y8ZA 3X1MA 4UE6A 3CS3A 5CDTA 3IEIA 1YR8A 4O81A 3U44A 4FYWA 1E2KA 5DT9A 2XNCA 5JAZA 5JWOA 2BDTA 4DCJA 2OHVA 2YHIB 3WWIA 3JQCA 4EVSA 2Q27A 5EWLA 4OFBA 1PWHA 2OZVA 1NMZA 2I4OA 2BUBA 3DHVA 3W5DA 4QEDA 3STVA 4BBZA 3TKYA 4RY0A 4OB7A 4M0MA 1V3VA 1DL5A 2ESRA 4V0ME 3RWMB 3T5MA 2E4YA 2MR6A 5L7WA 4WA8A 2YRFA 1L6IA 2CEKA 2G0AA 3BZWA 3QA3E 1CIJA 1WSDA 5BWWA 3ZY2A 4YH1A 4BFUA 1XA4A 3VYSB 1JLKA 1JJVA 5IDWA 3BIJA 1UODA 2Q0SA 3PQ6A 4MMZB 1Q50A 2ZR7A 5CT6A 3QUAA 3EWIA 6AT1A 4YXWD 1WBDA 1SQ0A 4KZPA 3RB4A 2Y77A 4OH1A 2AKEA 3OKCA 1M1YA 3CZ9A 1H2XA 1QZXA 1ZA1A 4ZZIA 1KL7A 1UUFA 2I76A 5FV4A 5AKLA 1KZYC 1TEXA 4R1NA 1NFRA 1LPOA 4RPHA 1YDFA 3M33A 1M6VB 3M49A 1LQUA 2A9RA 3OTIA 2VJKA 4WFJA 2XVMA 3BRWD 4BP8A 1DQSA 2VP6A 4I5IA 3I23A 1OROA 4JBXA 1WXFA 5EIOA 1AJEA 2O14A 1R4NB 4LJ8A 1LWNA 4YRRA 1GZ6A 3B53X 2I2BA 4HZUA 1YASA 3GUHA 4EHFA 3UUWA 3C24A 4V0NA 3HXKA 5EZYA 1OJ7A 4HY3A 1VIDA 4LJKA 4ZDWA 5A03A 3S2YA 1I6UA 2OD2A 2PWAA 5K0BA 2NMVA 3MBKA 2YRWA 3TINA 1Z2OX 2CDBA 4Z7NB 4N3CA 4BVLA 4OLJA 3WRWA 4GXTA 2OYCA 2G63A 4DR6B 4K9PA 5LU8A 4CNBA 3NIFB 4EUHA 2B3DA 3RFUA 6REQB 4JWKA 4BJ3A 4LNUB 3GIMA 1BGWA 4HNGA 1X1QA 2DAAA 2YZNA 3AIIA 2VBFA 3GJXC 3BWDD 4KQ2A 4LOJA 2NX2A 4D4MA 2CN1A 3IP9A 1X74A 4W7IA 5LOVF 2R7KA 2DULA 4IVNA 2VBCA 3UJ8A 4Q9KA 2ERCA 2EWMA 2YFQA 3A9VA 4L85A 4TWZA 4ZFNA 5EAIA 2AQ4A 2V59A 1T4DA 1LZKA 6NULA 1TU3A 2FE4A 1TECE 1UP4A 2GDZA 3PGVA 4Q7JB 4P4LA 1VRVA 4PFJA 3E48A 5LDHA 2XUAA 2X9GA 5DF1A 2PUTA 3GDWA 4HB4A 4JUCA 3UHOA 2A1IA 1P9NA 2C7RA 2QTFA 3AJRA 2Q21A 3RIZA 1SZDA 1IK4A 5CM0A 1NV9A 1YBVA 3ZI4A 4P81A 2HVQA 5EJFA 1IOWA 4INZA 1WMSA 1JT9A 2PGDA 3H16A 2ZUCA 3I4CA 4BTLA 1P9OA 5H5JA 5I6DA 5C44G 4CV2A 3KBBA 3GGCA 3QKSB 4Y2TA 5DK4A 1ZQ9A 4LF4B 3IVRA 3PWTA 5D84A 4YI3A 3GNTA 3GFRA 3NBAA 2CXPA 2KBFA 2EZ4A 5FBRB 4DMFA 5AVUA 1DBQA 3P32A 5BNTA 4CIYA 2HK8A 5BQFA 1QC5A 1H6CA 1TQHA 1SHJA 2B1JA 2YXEA 1SBTA 1VCMA 3RRJA 5KBYA 5HF5A 4CC6A 4AC9A 1H66A 3H5VA 4HO1X 5TPZD 3DAHA 5DN6D 4BO6A 4NPCA 2WAQE 3AY3A 3HCPA 3PQ4A 3PYMA 4CR6A 4IZHA 4HFJA 1TK3A 2M32A 1QO0A 3MWDA 1JVSA 3N0TA 4LF5B 2YYAA 3C6BA 1EQUA 1O0BA 1CKEA 2FY8A 3IEUA 3TOVA 2IC5A 3RNOA 1KFBB 3PUZA 3JWEA 3F49S 1U2GA 2QU7A 5ETJA 1CD5A 1YJXA 5JRDS 3DONA 2UVVA 4X66B 1QHNA 1R7RA 1UJ6A 1RM5A 1D1PA 3THYB 2ZIXA 3IKTA 3EUFA 3VPFA 4MQBA 5L7TA 2FNAA 4H0NA 2PYDA 4ZRDA 1PDWA 2CMHA 2AJCA 1QCDA 5B58C 4B4OA 3W2FA 1QX4A 1E2JA 2PR2A 4D3YA 3ZLVA 1Z33A 3EPRA 4HEJA 5ANRB 4U00A 3JWJA 5CH5A 5ICEA 2BQUA 1E61A 1RYYA 2ATEA 4TQ9A 4DQXA 3RYFA 1U5BA 1H5QA 3RFCA 1F6BA 4FCWA 1SC3A 1SKAA 2PUDA 2XT9A 5LXTA 5GQSA 2KMLA 3IDAA 3IX7A 4KNWA 3EWAA 3MQ2A 1G20A 3QYFA 1AS3A 3H9BA 3CJQA 3WGOA 5ER9A 4OLAA 2HZ7A 5FKJA 1NN1A 3CLHA 3PQ5A 4LY9A 3TQ1A 1WRBA 1ZHQA 3P5BA 3V4SA 4HBGA 5K05A 4G5GA 3L6UA 3D3EA 1KSGA 4J9VA 2R2AA 3MF4A 4RACA 3J7AC 4EP1A 1I80A 3B8EA 1JMYA 5JS6A 2I34A 2OWOA 3FUCA 3G49A 2AJTA 1KOJA 4RHXA 3I6IA 4YGXB 2NO4A 5TE9A 1NVVQ 3RLIA 3BERA 3ZWXA 4B3RB 1NASA 1NUUA 1QFSA 1WDMA 3DZDA 4I3HA 5K2OA 3IAUA 3JATA 2XTZA 5E6RA 5AI8A 2P9GA 1UKAA 4B47A 1RYRA 1MQ8B 3NWOA 3DVAB 3AVVA 3DR3A 1O6ZA 4G56A 5EIBD 3NWJA 2OBMA 2JGJA 1Z3IX 4QAQA 2ADOA 3VGPA 4NPHA 2IZ0A 2FG6C 3UMRA 2BGRA 1I2ZA 1IVNA 2YJGA 2IDMA 1ESCA 4RPJA 2KE5A 2QSJA 2FOLA 4GPAA 3IJEB 2ZJ4A 2IOYA 3LXMA 1JYFA 1ILEA 5EPOA 3UQYS 4BN0A 1JAHA 4X60A 5IF3A 3OIWA 2WIGA 3FVTA 1S7CA 3GDFA 1YKSA 3I9NA 4R2XA 2FLVA 3AXSA 3ZWWA 1OBHA 4FHDA 1EFDN 1H9CA 2XHEA 4GKAA 3SYMA 4HATA 1XK5A 2W7PA 4BUZA 3L41A 2XVXA 1WXXA 2Z1MA 1GQQA 1WXEA 2BAGA 1WB6A 1G5PA 5EI5A 1TX4B 3LSTA 1NG1A 3FLBA 3GUUA 4FOTA 4LYEA 2YIDA 1LPAB 4M0UA 1P6XA 8LDHA 3QG5A 3GL9A 3IAHA 1PJ8A 1SR8A 1X1SA 1PEYA 1AIPA 1T8PA 4OSOA 3ZGXA 3UB3A 4P84A 2VRWA 1Z7BA 3OQ6A 1Q6ZA 4LVCA 2R4UA 1YZVA 4WN9B 5KX5F 2C4NA 2PFSA 2R1TA 4Z0TA 3I01A 3VSBA 1TWGA 3G88A 1KORA 5E9WA 2X0JA 3LT2A 2ZPTX 4IGFA 4JBYA 4MV0A 1G3UA 1T3SA 1Q92A 1ZJ4A 4EMSA 5TPWA 4EK9A 3PZRA 4R6XA 1RLJA 1XYVA 4MYTA 2G5TA 1Y8RB 2Q7OE 3PW4A 4XYGA 2XH8A 2IY8A 1W0KD 5HG0A 3NKFA 3CLSC 2NUTB 1WLYA 3H97A 3C6YA 4IUCS 3HZHA 4XX1A 1NYLA 3KOOA 3KDAA 1KBOA 4PG5A 3N41B 2HHFA 3A4MA 1TIBA 1DZ3A 4QGGA 2KM1A 2ERYA 2PRIA 3YASA 1Y6RA 3GLIB 5BXYA 4LZNA 5C5EA 2C98A 4R2KA 3ST7A 1AQJA 3VI3B 2DQSA 2CLEB 1YB7A 5HHTA 4LFCH 4MINA 4BY7G 4D0LB 1TT5B 1UBFA 5FLXA 2EX1A 1UT8A 2ZUTA 4IIJF 3C3KA 1G3MA 2WT9A 3R6GA 3FYCA 4KFCA 1J00A 2OCYC 1OH7A 1XTTA 1XTUA 3QXJA 2QRVB 4RQTA 1JSLA 1OLUB 2PK3A 3O3NB 3GZNB 2A4KA 1KH3A 1EKVA 4KQFA 1BE6A 4DMGA 1OKKD 5ALJA 2WPNA 5J4LA 3KL2A 1HQCA 1EFKA 3REQB 1YU6A 3B70A 2C57A 1WUJS 2BI7A 2VPYA 4I36A 4YRPA 2OGWA 4XD7D 5BWOA 4E7PA 3O9VA 3B7GA 3NHSA 4TRNA 2WF5A 1DDIA 1HX7A 4JYPA 5EKXA 2PM8A 3HJTA 3LPDA 4BQQA 5L95A 1XNQH 3CTPA 3E15A 3JARA 2JEJA 1MEEA 3ZU6A 1PFGA 1TKRA 4DIDA 3TI7A 2XKJE 1P17A 3IIJA 4V0OA 1U8AA 5C46F 3I01M 1SHLA 1BHO1 4WUTA 4G8CA 5ALLA 2XRFA 1CR2A 2FSVC 3K0AB 3BMQB 3BAAA 4B7CA 3WY9A 3W06A 1SA0B 1J8MF 4FMDF 1E18A 4O84A 1FSFA 1QHGA 1U0SY 3LL4A 1ILWA 4WZAB 5IC5A 4X1KB 5KPDA 2BYTA 2ECPA 7REQB 2Q6LA 2PKQP 2XQJA 1JT2A 3EE6A 1YHZA 1OGJA 2QQFA 2OAGA 4JQOA 4R2IA 1AZLA 3TQTA 2HF2A 1LKZA 1QFMA 3H3XA 4QHYA 1K8YB 5KFTA 4DV5H 4F4YA 1NNSA 3Q72A 2Z3ZA 3QZ7A 3ZHVA 3ZU4A 1R6BX 1I94H 2VYNA 2HGWA 4PYKA 3H0GA 2C3UA 1XTIA 2FCAA 5FULA 3NAQA 1W47A 3H05A 5JAHA 3BGOS 1Y1VA 5HRUA 5CHYA 1WZIA 1TZBA 3KUKA 2SKCA 3KL4A 5FHRA 2A78A 1SOAA 2ZRNA 2XVAA 3FYSA 3IB6A 2O5EA 2B63A 3CLSD 2BPOA 1N77A 3EWSA 3C7TA 1O54A 3H7IA 4RPIA 1NHGA 5JRZA 5BP7A 1I0ZA 2PX0A 1KAEA 3GCDA 1PS8A 1BXZA 3L0OA 1NVDA 2FN8A 3KV1A 4MYSA 1GZ4A 5HJ7A 2MDTA 1Q15A 2PFGA 4X1IB 5SYMA 1L7BA 2FLKA 2P5UA 3VR5D 2FWAA 3GELA 3ZNPA 9MHTA 2D54A 1F8FA 5CR9A 3E3OA 2CKMA 4KN8A 1U0FA 3VO1A 1F4LA 4QUGA 1A2QA 2AZTA 1TJNA 5AVVA 2WUEA 1E8DA 3K73O 5KFBA 2BGLA 1E1CA 3VDRA 2EV9A 3LPNA 1C9NA 3CZ4A 2O48X 4D0NA 1MT0A 3NM6B 2HCJB 5EGNA 1KU6A 1Z8NA 3L0IB 2VAVA 4MK4A 1A0GA 3DNFA 3M9XA 4JA0A 3KLMX 4A92A 4IG4A 4OG2A 1UBEA 1WPQA 3C0FB 4ER0A 4I50B 3JS5A 1Y3HA 3LF2A 3UK7A 4ND2A 1NN3A 4FZ5A 3HKEA 3CVZA 1I36A 2HEIA 5ECYA 4U2DA 1I24A 2NGRA 3WOVA 2WF7A 2E5LB 3NV9A 3Q9SA 1T4BA 3OCXA 1DADA 2O5CA 2Y71A 1AZWA 4MUYA 4U9UA 2YZMA 3ZVLA 2PWBA 1I2MA 2V4RA 2GM9A 5KQMA 3WLQA 3RE1A 5EUQB 2HC9A 3ZU2A 3SQOA 4FCTA 3PENA 1PWXA 3EVDA 5DZSA 5JNWA 4HUTA 3EDOA 1XU7A 2J7PD 3T1YH 2AXNA 3JYLA 3A31A 2VWHA 3CG4A 1A77A 2NZJA 4CW7A 3UYLA 4BCBA 3QI2A 4PGHA 3UICA 3KEQA 3D3WA 1B00A 3BA1A 1GZSA 3LW8A 4LY0A 4R1QA 2G82A 3RC9A 3BH0A 1XYYA 4ETWA 3AETB 4DL5A 2CFCA 3RVKA 3C43A 4WJLA 3VR2A 4YNBA 1R16A 3DMYA 2ST1A 5JPDA 3OU6A 3GRRA 2YBDA 2PUHA 3OE7A 1PZXA 2XYQA 5JV5A 4QODA 1EJBA 4BTEA 4CKCB 3JZMA 1WZ2A 3I2FA 2FPXA 1SBZA 3WWYA 1Q22A 3W6OA 4B3FX 1H69A 2CZQA 3OIYA 4F4JA 1TW2A 3HI6A 4BNDA 5F9MA 1UT5A 2BMAA 2YQ5A 1Z38A 3I9JA 4G1FA 1JQDA 3ZNQA 1RI3A 4A3IG 3CNOA 1UDBA 4TTIA 4DF3A 2QG4A 2PMEA 3EQZA 2ZXUA 5NULA 4MLPA 2HSWA 1JPVA 3EVAA 1JR3A 1Z6GA 4BV9A 2CVZA 4GM0A 4KAJA 2IEAA 1H22A 3S6JA 4WZBA 3GNLA 5KOJA 2EVWX 1VLHA 4XB2A 4E94A 4Z4IA 1DEAA 3CIOA 1PNQA 3NAGA 3UAYA 4MP3A 2WOJA 3MGGA 1US8A 2P5SA 3ECCA 1H2RS 2QIOA 4XIGS 1TVEA 1WZNA 1DV1A 2CSUA 2ZTSA 3PNPA 5G40A 2HLHA 1QVZA 5BT8A 4R5MA 4D3ZA 5JSFA 3HOXG 3VV3A 4ED9A 3JSXA 1VGQA 4TZKA 4XGQA 2F3UA 4UEWA 3D3QA 3B3QA 1JAZA 1J99A 3FNHA 5G3ZA 5JPIA 1PX2A 1UXHA 4QOSA 2M6LA 4G5FA 3RC3A 2IJGX 4WNAB 2ZI9A 4E4RA 1QS0A 1SC1A 1MFPA 2WU3A 2BELA 3OE5A 1RYSA 4D46A 5A3JA 3K0EA 3ZQ4A 1DG1G 2XUHA 1XCPA 4KRGA 5A3RA 1PDVA 4BFCA 2UZAA 1E7YA 5LQRA 2AVDA 4EUKA 4GX0A 3V4FA 1IH8A 2VP5A 1UKYA 1W30A 4IZIA 2I6UA 2AEMA 1NUPA 2V3WA 3U9SA 2PGNA 3M1IA 1ESDA 3VYUB 3USCS 2HK7A 1OVGA 4KQXA 4E31A 4RZXA 1KFCB 5K3CA 3LLSA 4BIIA 1KKUA 4RSHA 3ETEA 2RB4A 5I9LA 3R76A 3PYXA 4K3VA 2OG1A 3I5AA 3IRVA 3AF0A 3PNSA 2IXAA 3FGOA 4FZJA 4R0MA 4HUJA 2IF0A 1KTIA 2ATIA 3THOA 1O57A 3SFVA 4AG5A 2WDPA 3BMCB 2WB4A 4XVCA 3ZD7A 3O7WA 4R40A 1RAFA 3F96A 4X62B 4ZJYA 1HR0B 3HGTA 4QUBA 3UGJA 1QRSA 5KFQA 2V9ZA 1Y1SA 4OBBA 3TAUA 4LXYA 1JJBA 3UM9A 1SYXB 1UXIA 1L5HA 4MR8B 2C2DA 2H2DA 2VHVA 3URMA 4XH9B 4EB6B 4UBJA 4GI7A 4RVGA 2DT8A 1NPDA 3WA7A 2NU8A 3RGWS 3JSLA 1B1AA 4XWOA 3LPMA 4RVCA 4IPTA 3BC1A 4XOUA 2Q3DA 2P6MA 1QHIA 2JIDA 4IMIB 5ADVA 4LSMA 4WKOA 1CP3A 4PC6A 1SD5A 4ED3A 4L6IA 1RYEA 4YMVA 4XCXA 3QEAZ 4AN1A 2SBTA 3R3UA 3D8HA 1I2AA 1D2RA 4GOJA 4PZUA 5K6TA 1IATA 1UWLA 1DKMA 1C1DB 4ECEA 1A76A 2C8LA 3M5CA 1U5CA 3ET5A 2XUKA 3PVSA 2QR3A 3H5RA 2A9FA 4RGVA 4ZQFA 1CULC 2VZ0A 3QWBA 4L2IB 4EYHB 3T7SA 3HOZG 3EIHA 1T3ZA 1ZYUA 4ZREA 4X6XA 1MF7A 3REOA 1QKIA 1D4AA 3HE3A 5BMVA 4PY2A 1RW4A 5HR5A 3U7HB 3GDEA 3SDZA 1KZ1A 5FWYA 3KR1A 3JQBC 4EBFA 3PW7A 1LX7A 3I2JA 4UHCA 4MKZA 2YV2A 1A8UA 4LAFA 2X0RA 5B7QA 3KOUA 1H8ED 1RCTE 5EE9A 3RS9A 4O0LA 1Q17A 2EHJA 1HY3A 4CL2A 4ED0A 1ZVMA 5CH3A 4W99A 1C3JA 2P4QA 4CMBA 4LHWA 3R75A 1D0IA 3F8NA 3ZHTA 3FPBA 1PVOA 5AOCA 2P7HA 4XARA 4ZYVA 1HRDA 2UVUA 2QD4A 4L75A 1B76A 4I8XA 2WM2A 4FFVA 4FS8A 3EIFA 4TTSA 4WBNA 5HIAA 4B0OA 1JHDA 2C2OA 1KJ9A 3D6HA 4DL6A 4UASA 2P6RA 5SY4A 4NAHA 2DRIA 3CH7A 1NHWA 5H3HA 1SQGA 1FBTA 2AJDA 1VL8A 1OI7A 2X4DA 1WY7A 3CUWA 2HSJA 1ZIOA 1PT6A 4YR7A 3U3DA 3IO5A 1OB2A 1GPAA 5HW0A 2P41A 1I7LA 4ZGWA 1YB6A 3A1EA 3NBZB 3EZYA 3NGXA 3P2KA 1OHHA 1FXUA 5IJ9A 1EBFA 1V8PA 2H11A 3GRVA 4ZICA 4BKOA 2JL1A 4A2PA 3FSJX 5BSMA 3EXG2 5CA1A 5LL6b 2JLXA 3GLGB 5KT5A 3CKLA 2FUCA 3QX3A 1WKCA 4KI0A 1E3TA 2XJ4A 3PNOA 1E4VA 4LYJA 5FL3A 1KAHA 4O25A 3ME5A 3GCWA 4Q6WA 2CDCA 3EVBA 1YULA 4DR2B 1HZJA 1W46A 3DW1X 2R8KA 4GX2A 1H0SA 4QVGA 5C5CA 3H5NA 3C45A 3QUSA 3PD0A 3WMGA 4JNCA 3TCNA 5BWBA 4PCLA 1Q3HA 3V8QA 3AVUA 2PUFA 4FFBA 4ZZ0A 2FP4B 5BR1A 5AQEA 3TBFA 4M49A 2RHBA 4MA4A 4Q66C 4MUJA 2J5KA 4HOYA 4XM0A 4B6RA 2WFLA 1KTVA 3K2IA 4REQB 1DIHA 1V47A 2EARA 3KHGA 3A1NA 5ISMA 2JDID 3T12A 2O3TA 1JAYA 1I32A 2R0QC 4LZWA 2WP8J 4AKSA 3NPMA 1JDVA 1P8AA 1FTSA 3VZCA 2TYSB 3IQEA 5L9AA 3I1JA 1V11A 4RYLA 1M2VB 4AT1A 4C6HA 3F7NA 4R51A 5MDHA 2RAFA 3RGXA 3QOFA 1VGVA 1F38A 2M98A 1E1RA 4XWWA 4ALJA 2QTAA 3G8AA 3R0XA 4XQ0A 1UEXC 4JHXA 2W6IA 2WZBA 5KTRA 4M8NE 1IDN1 1FJGH 1EVLA 5DGHA 5E25A 2JFYA 1FFEA 5AXCA 1RVV1 1HMPA 1MAUA 4M0PA 1DJOA 3TIXB 1SKYE 2HV8A 4BXOB 3LO5A 1AB5A 1L3CA 3SHTA 3Q2OA 1R5JA 2GJAA 4QQ8A 4RB0A 2DJIA 3O47A 2QR5A 3O5AA 4FE7A 5K3OA 1E4EB 3LU1A 4UAGA 4JCOA 4DR5B 3CF6R 3HDQA 2Q07A 3B89A 3KJXA 2C7BA 4M7RA 2NADA 4MQEB 4DNOA 1A9OA 2R5WA 3NM5A 4BVJA 5IM4A 5EE1A 4MVJE 3RUIA 2JEIA 2DFKB 3ERCA 4MYHA 4MGZR 5EJ7A 3WZ2A 4B3IA 3PO3G 3GA7A 4C08A 1P73A 2X0EA 3TW8A 3FPEA 4XWYA 1PK9A 1YZHA 3TTWA 5C8YA 3NHYA 4RB2C 4C2MA 2JFXA 4RQBA 3ZLJA 1CSEE 1EGAA 1TLLA 2YHAA 4U5XA 5ALWA 4JLAA 1QFJA 2ZKLA 5B36A 3WZMA 1KRHA 1GHTA 2YY5A 1ISFA 4EVQA 5JCOC 3JD4A 4DMMA 1ZIXA 4JJAA 1F8UA 1NBMD 5L3QB 4NG4A 4K7JA 4GFDA 3EG9A 5C8ZA 3O74A 3UT5A 1RPNA 4NZMA 3KOZA 4YLYA 4UPEA 1IXRC 3Q8LA 1QRDA 5ILGA 3VUFA 6Q21A 1JZQA 4R1MA 3DZFA 4QEZA 1XEXB 3WK4A 3QPWA 4DABA 5HIJA 3B2QA 2WKPA 5D3ZA 3P7MA 1YR7A 4G0MA 5HIKA 5IPFA 1UIRA 2OCAA 4QQFA 2GWRA 3E7PA 4KFRA 1MB3A 3R1IA 4QIWA 1L4BA 2E9SA 1RI5A 3D8UA 2RFLA 4V1CI 3JQPA 2IBSA 2D0OB 3I9KA 5DSZA 4KE7A 3A3OA 4OU4A 1CDEA 1XP8A 5DQGA 3DXYA 3VNVA 2ZYSA 5A0FA 1NN0A 2PLAA 5BSVA 4KK4A 1GN9A 4ZOAA 4CGYA 1H65A 4NPAA 2IPNA 3ZCVA 4MLCA 4EUEA 2PO7A 4J4BA 1C9YA 4P3KA 3KQTA 4R1UA 1QDEA 3RVNA 1ZH2A 3DF9A 1EVEA 4A1OA 1V4YA 5K0TA 3PC4A 3RREA 5JO0A 2R93G 1OOEA 2PBZA 4BLSA 5DP1A 4HADA 4N3GA 5CIYA 5BY2A 2XDYA 3SEQA 2J9FA 3R09A 2O1EA 3U49A 5A5DA 5IXSA 1HQYE 5AJXA 4TTRA 2DWCA 2GN0A 1HE3A 4ZPXA 1MO4A 3HA2A 4FYJA 2Q9UA 1FP4A 2V8OA 3DAOA 4G07A 4YAKA 4BBJA 4F4XA 1HZZA 4WNIA 2J9YB 1ZS9A 2P9JA 4EB0A 2C5BA 3QFTA 2NZYA 4GAEA 1A4XA 4HD8A 2K4MA 5JSKA 2I2FA 1QORA 1UFRA 2WD7A 4NX2A 2MSEB 2D1YA 2YWEA 3GBVA 2R92A 3UK1A 5GZ3A 2CLHB 1U6KA 3DTVD 3T0FA 1B8PA 4IKOA 3H4BA 5TVKA 5JXWA 1FSSA 4NDZA 5U4QA 4HNTA 3GILA 2RH8A 1ZK2A 3HMQA 1HFKA 2ZP1A 3LFUA 2Q5EA 2NU6A 2OM6A 3UXHA 5HFJA 2WVJA 1XVLA 1Q0RA 2EYUA 2GT1A 4HB3A 1XO1A 3PRKE 2J4CA 4LJYA 5F2OA 2Z4RA 3I64A 3D0KA 4HWGA 2XGGA 3FHJA 1RFGE 4FLFA 4YBZB 2RSLA 1SM4A 4PX9A 4YXWA 3S0JA 2IYAA 3H86A 3VH4A 1HT3A 4D9JA 2CJYA 2YJTD 1SHUX 4OIFA 1WL8A 2QRJA 3FI0A 4JBLA 4QGFA 5ECGC 4XSVA 3WIOA 2XB6A 2Q6KA 4D79A 5EOYA 4A15A 1TEZA 1Y9EA 3MAAC 2H1HA 3H0EA 3N05A 2I4MA 3Q40A 1P7PA 5DYTA 1CRQA 3BRWA 5KSWB 4AM8A 1JQAA 2AN3A 2JFGA 1QYRA 4UTPA 5BVGB 3RSFA 5JUMA 1FP1D 3AOEA 2D5AA 2Y0BA 3Q3JB 2RMKA 2ODEA 1WCMA 4O2BB 3BXXA 1A97A 1RJWA 3COYA 4RELA 1U3CA 3KZVA 3U4IA 4OQPA 1AU9A 5AW6A 4OHRA 4GEGA 1YS4A 2C2XA 1ENZA 4M0KA 1DRUA 1OWLA 1M1XB 1LK7A 1K83A 4P0QB 2QW8A 4GT1A 5E7IA 3BQNB 4RKFA 2O8CB 1A4RA 4G9EA 3BJEA 3RU2A 4DXHA 4CTKA 4E22A 4RENA 4AN0A 4YONB 1VMEA 4FN4A 1USVA 1R00A 3DV0A 2WAAA 3IGFA 3VZDA 4BWGA 4EEKA 1JHUA 5KAPA 2QTGA 4JJIA 4D3XA 1UZLA 3VR6D 2IIBA 1L7RA 4P7FA 2CKDA 2Q2NA 2QPTA 2ID7A 2P75A 2P79A 3N2LA 4B3MB 5DHSA 2V7GA 3ABSB 3RS3A 2CFMA 3VQTA 2A9VA 2LD4A 1E89A 3GVPA 5K8UA 4DQLA 3W78A 4PSUA 1FP7A 5BNZA 4TKZA 1GZ7A 3AONB 2XQIA 3BA9A 5DGDA 4MW6A 3AOEC 4WIAA 5EIWA 4ZO6A 1ENYA 3G1UA 1NY5A 2J31A 1IWPB 5DEOA 3WXMA 1YQGA 1PVVA 4O86A 4D74A 1VJRA 4QDKA 4BFVA 4F86A 3BAFA 4F38A 1C1XB 1SXHA 5TGTA 1HNNA 1P9RA 2VPSA 1ZR4A 2YN2A 1Y3IA 4P8RA 1V6CA 2PANA 3DKIA 2W8KA 2WP0A 1JN0A 2QX9A 3SK0A 4FEYA 2VDWA 3CSDA 1L5SA 2C4WA 1B43A 1XHEA 1T9CA 3MINA 4PIMA 4RIHA 1ONPA 3ROPA 1MX3A 2VTBA 4EKDA 3GI1A 1R10A 1Z0SA 2FZLA 2I66A 4QOJA 4QFDA 4FE2A 1EFVA 2GNOA 2ZJ3A 4ZIRB 3SIPA 2BUAA 3M89A 4ZO7A 3NVKI 5AVKA 5JMPA 2BM1A 3FFAA 3P9PA 2HWUA 4D25A 2X8AA 2I9PA 4H6VA 1YRQA 5TARA 4EO7A 1P81A 5TPZA 1FW8A 5DN6A 2VAWA 3EXG1 4MDHA 4OXXA 1KYWA 2AHRA 2QE6A 5FA8A 3T7EA 3KZCA 4I55F 3C8DA 2CXOA 2J07A 3L6EA 1S2OA 1Z4MA 5AIAA 2ZRAA 1S0UA 1KRWA 1Z28A 2IMWP 3E8SA 2L0XA 1ZM3A 2MJLA 1KRXA 4WGGA 4NMLA 1GZ3A 3QLEA 1T25A 1N5KA 4QNNA 2IP2A 2CUKA 3ZDCA 5HJ2A 5JVDF 1AOXA 4KXYA 1G4UR 4H08A 4JLWA 5A62A 4K6KA 3RSHA 3DOFA 5CEJA 5AW7A 5IT5A 2MHCA 2IYXA 1CRLA 4MNTA 3BCHA 1M2OA 2H29A 1RXEA 4L9WA 4DM4A 2K7FA 4YRZA 5B1DA 1TVCA 2B34A 4OHWA 3FW1A 4GI2A 1DIBA 5DBIA 1HT0A 4DG5A 1VZ2A 3EFBA 1PJZA 4HL6A 5IVDA 4ZQGA 5B1YA 3HCEA 1RWPA 4R2JA 3DDZX 1GGEA 5JAPA 2PGLA 3AVPA 4NU8X 1DMSA 3PNVA 4ZT6A 1QH8A 4OXIA 1CY1A 1VE1A 3C1UA 4BB5A 5LDDC 4DSNA 2JGFA 3EN0A 5HFAA 4AZVA 4Z0PA 1W4BA 1H3NA 4L4SA 2QXUA 4DBVO 1XDSA 4G5QA 4MUAA 1QRRA 1J0CA 1Y3BE 5IS2A 1N33H 2JJ2D 2QRNA 5FXMA 7ABPA 1KEWA 1GRCA 4IEEA 1PW5A 1Z8FA 4O2AF 4JC5A 4L15A 1PAUA 3VH2A 2CE7A 5LMNH 3EIWA 1SRQA 3KWFA 2F1JA 1N6IA 3E22B 1E79D 3DTYA 3V9AA 4R4JA 2J0UA 2M6SA 2XMBA 2HGZA 5IYZF 2DLCX 4KR2A 2MR5A 5L7YA 2FSSA 1WH2A 4N0QA 3ZDFA 4AWBA 1KMCA 4YAJA 4FQ5A 5TQVA 4YQEA 5TY0A 3KJNA 4CT4B 3RAFC 1OV4A 4M1YA 2CNWD 4RESA 1K4KA 2QTVB 2F59A 2V4QA 3IKLA 4UNSA 4CDMA 2EQ5A 3F5MA 2JLZA 5AVJA 4IBOA 1A7AA 2UVWA 5JASA 1V1RA 4B74A 1VL2A 5AKXA 3JQDA 5D1OA 1JHOA 2COKA 5IKOA 1N75A 2JLSA 3O8OA 4KXLA 2IIVA 3RDPA 3IR7A 1EGMB 3PLAE 3T34A 3HB9A 4O2LA 1FP2A 3QPBA 4TYQA 2HPZA 3HN7A 3BMOA 2Q5QA 4BYGA 2R9VA 1GUYA 3FKJA 3I6BA 5I7EA 5A9SB 1A9RA 1VLVA 4G24A 4E2XA 2CXQA 2CLMB 1FSGA 4CIAA 1ZL0A 2CYBA 4JI5H 3SSMA 2ID4A 3PWSA 5KQPA 2CNUA 1ZVQA 4IX9A 1XDBA 4E5VA 4B0PA 1YVPA 1EM6A 3IT1A 4H7IA 4OKNA 2O7NA 2FW7A 3MSXA 2SCUB 3RVDA 3ABQB 4FNMA 3SMQA 2WJIA 2EEPA 3C2QA 1CZOA 2WHRA 3JYOA 2G1PA 2YX1A 1ZWKA 5ECWA 4G84A 1J06A 4WX2B 1ECGA 5T4FA 3NBYC 3PUIA 3DXZA 4EVRA 1PLKA 2HA4A 4HB0A 5EIBC 4D7AA 1CFZA 1U7PA 5KCMA 2VC2B 5B7GA 5IBCA 2ONZA 3UPUA 2UVQA 3V1UA 4E88A 3A0RB 4O7NA 4FSDA 3K53A 1G5QA 1XJQA 2ZBUA 3MJFA 2WA1A 1YRAA 4EY7A 2GBCA 3A9CA 4NFLA 3CZ5A 2I33A 2QSYA 3H0KA 5I5UA 1P0FA 5D3MB 5KJEA 4WZAE 4LZAA 3QBDA 1D6JA 4LMAA 3OT5A 3KJIA 1W0KA 3NOOA 3AVWA 2O0KA 4ZHQB 5LD2C 3ZV3A 4LOIA 4K6NA 2O2IA 1XV5A 3T3PB 1DWOA 3BWYA 4JWTA 3TECE 1JKJB 1SRRA 1HYQA 4AMGA 3DCYA 1J97A 3ZWDA 4FLMA 5I8WA 2SNIE 3LUKA 2BGWA 1KC1A 1Y1LA 2JFOA 2XWPA 1A2KC 4FDTA 1NNUA 1OTHA 3G8DA 4P2GA 3ETGA 2X5OA 5BN3A 4ZYYA 2IPXA 3ECAA 5CVTA 1KVRA 1P1FA 4FYMA 4Q12A 4AO6A 1ZR2A 2CL6X 1MGPA 3LH5A 2XJ9A 3HLYA 4E6NA 4P33A 1TJ4A 2JHPA 4JFAA 4O4HF 2ZI7A 3KFXA 2GZRA 2A9JA 2BR4A 4A3DG 5ITSA 1IN7A 3QVKA 2DWPA 4FT4A 4IS2A 4P32A 4TKUA 4YMSA 1SCAA 4MPDA 1FC0A 4U6QA 1W4LA 5KVAA 4AROA 1OKKA 2QRGA 1PHRA 3IJ5A 2ZRHA 2ZYIA 1AUVA 3GDHA 1JDZA 2ZSKA 1RQPA 3FJOA 4HN4B 4KE9A 4HGOA 4EGAA 4DDUA 2H8GA 4YK7A 3ODGA 4XD7A 2AFHA 4WEQA 3LL7A 1L3BA 1W4AA 1OGYA 4JI7B 4YCSA 4MI6A 1WCIB 1FDRA 2ZYTX 5CBPB 3O21A 2QMOA 4HLNA 3B78A 1K7SN 2I2XB 4ZAXA 2YWJA 3M1AA 1G2IA 5FJ8G 1N5JA 4F4HA 2CK3D 2DPIA 2JD2A 5DLQC 3DNPA 3PT5A 3ZXXA 2O59A 2EZTA 4BV8A 4IMRA 3LY8A 3GPDG 4R9RA 1QONA 3QIVA 4NVRA 4PPNA 3I4MG 4QARA 3U5TA 4IGAA 4UJ3A 4LF8H 5I51A 3WLPA 2C2WA 4IFBA 2GKOA 2GEKA 2VS1A 1VHJA 3O8BA 4G41A 3BEDA 1U0BB 3OPMA 4YRDA 4CUKA 1L4KA 1T9KA 1W88B 4W1SA 2I62A 4UAJA 1ZOSA 1OZ0A 2L2QA 4KQKA 2BI8A 1W5SA 1UDWA 1UXKA 2W71A 2GN2A 3I6MA 4XQGA 3SR4A 4LYHA 2JIPA 4EBCA 5AHKA 1J5PA 4PRLA 1GR1A 1C9MA 4RMHA 4OV6B 4O3QA 3R7LA 4CM4B 5KINB 4MH0R 2LTAA 1I3NA 3C7AA 1P62B 2BVNA 4R7ZA 2VI5A 4URFA 1E5DA 2YYZA 2ZAYA 3HYLA 4GL4A 4I19A 1UPXA 4J94A 2HHCA 3KJEA 5FTNA 4F3RA 4JOBA 1UBOS 3VR5A 4G5SA 1ZCFA 1EP1B 5L6MB 1VHWA 1QQ7A 2LCQA 3T52A 4QQRA 2H4ZA 2Q4OA 1R50A 3D6MA 1RVDA 3THWB 3PVZA 3WX0A 3W3ZB 5L1KA 2C82A 1A71A 1H4SA 3AUSA 2FMHA 1ID8A 5LB2A 3UMYA 5FPOA 5DBGA 4NBRA 3LMKA 1U7OA 3AEKB 1GZHB 1FYXA 1NE7A 1QHHB 3VPXA 1RLTA 1OFGA 3AHGA 1KKLA 4OGGA 5JQGA 3UMGA 2YCHA 4P36A 1BYIA 3QBJA 3WICA 2IF2A 2PUWA 2GDJA 1GEEA 3EZ7A 4MKHA 4U2BA 2P9EA 1GCOA 3QJYA 2P40A 1DQRA 4FOSA 2HWYA 2QTRA 1S2LA 3GWZA 5KO2A 5DBFA 1NVUQ 5K5EA 3ZLBA 3RQIA 1BS9A 2P3LA 3VC7A 2EWWA 1HMYA 2ZR9A 3MPOA 4S05A 3TVTA 3FH0A 2QT0A 2O2DA 2QMZA 4K3UA 3FPCA 3P71T 2ZAMA 1OA1A 3MUFA 2J7PA 4IJ6A 5A0TA 2BKUA 3THXA 4QT4A 1Z63A 4GC5A 4DY6A 3K1AA 1PZMA 3DVSX 2XNJA 4G0WA 4W8HA 1ZH0A 1DC6A 1D03A 4CIWA 4A3FG 2FSVA 4Z6KA 2DSNA 1EESA 1E20A 4EX7A 2C7QA 1PZEA 4PIPA 1VOTA 2WWHA 3WE7A 2XYGA 5KT2A 2P4UA 1C9DB 5KYVA 2PLWA 3C5EA 5J1SB 1T36A 3QPDA 2NTEA 5CK4A 5EZ5A 4U8GA 3LBYA 1S03G 2HT1A 1G7CA 4F9GA 1JG3A 2JGMA 2HNBA 2R25B 4FBUA 3LP8A 4ND4A 3CO5A 3EMBA 3HEBA 3KQMA 5DTQA 5FV7A 4B7XA 3TD6A 2FUG1 4NK5A 1NZFA 4C2UA 2BSXA 3PQDA 3ELWA 1ORDA 3IDZA 3OIUA 3E9DA 3C41J 1AXRA 5LB4A 2ZRCA 2ZB7A 4JUIA 4K1LA 3G85A 1H5NA 1PQPA 1HFJA 3KOMA 3OM0A 3R5TA 4O4JB 3W5VA 1QOPB 5A4IS 2M1XA 4CEIB 4LRUA 2CHEA 4AQDA 5DBHX 4NK4A 5IAKA 2X9VA 1X14A 3AUFA 2IE8A 1JJIA 5KFSA 4Z7JA 4ZRNA 4G0NA 4UU1A 1TUEA 1ACLA 3NC4A 1BCSB 4QUEA 2OHXA 2VRBA 4GBED 2VP4A 3I1IA 1LPMA 3BDIA 4M1QA 4D5EA 4J29A 4U0KA 3IJPA 2HSZA 3L0DA 4DFDA 1I6KA 2NVUA 5A1TA 2YJ3A 5HE8A 3I92A 3H11B 2OHIA 4PICA 1V9CA 3CZMA 1SVNA 2JBHA 2I91A 3PJGA 4OQNA 5G0TA 1UZAA 4WLUA 3WTBA 4B83A 1FDOA 4HDRA 3GCGA 2YV5A 3P9QA 5C81A 1F3OA 1KQPA 1O6CA 2OQIA 3JW8A 3A8TA 1I3LA 5BN5A 1UZNA 1E1QD 1KI7A 3NG1A 5LUBA 2IYTA 3AH8A 4IMJB 2PSFA 4EX6A 5E6UB 1A9SA 2QL9A 4Z9YA 2XRZA 3GLVA 3LW7A 2IZZA 5CFLA 3TTXA 3SS9X 4E09A 1LBHA 1VHLA 3A36A 3OC0A 2OBFA 4F96A 3BREA 4PN3A 1P5JA 4TMVA 5BUZA 4MCIA 4RD0A 3K71B 3FB4A 1K7YA 5DSTA 2AMJA 4P4UA 1TGVA 2F4NA 4B45A 1OPXA 2W6MA 2COJA 2B36A 4G2NA 3NDBB 1IJBA 2WNHA 1WTCA 3BILA 4XXHA 1QIKA 1ETUA 5L6LB 3M6FA 1KWGA 5K45A 4GP6A 3WQSB 1M6EX 2ZRLA 4BX9A 4BP3A 1BIFA 2PZ8A 4BKMA 3W8EA 1YZ3A 1G63A 4PANA 1CY7A 1R9NA 1MH1A 2WABA 4O7ZA 3JZAA 1E6CA 3AHEA 4ALNA 2VSQA 3C98A 3GROA 1A0IA 2EF1A 5IEJA 3GLKA 3DE2X 1P4AA 3D43A 3TSAA 3OQIB 4R1TA 1Z56C 3MIIA 1XMQH 4O8ZA 3QWHA 1HDIA 3ZIAD 3ADBA 4MUGA 1UMBA 3AF2A 1O9GA 3VHXB 3GLGE 2IYSA 3AG5A 2QRMA 4WY8A 4OBEA 4Q9LA 4IZOA 1NRIA 1D6MA 3RI3A 4PG7A 1NFFA 3NEPX 4I4CA 3DJYA 2GTIA 1EHCA 2HO4A 3Q41A 3CLUD 4YCBA 3R9IA 5FOSA 4Q45A 2PS3A 2YYSA 3NM4A 3AI2A 3S2UA 1GAWA 3VOBA 2ZUWA 2AW3A 4EYSA 3IOEA 3RB6A 4FR2A 3HVJA 3CX6A 1H0KA 4J7UA 2OLEA 3FHLA 3DMNA 4GGOA 1H8EA 4XJXA 2FX5A 1SVIA 3KXLA 5AVWA 2HYIC 1GNPA 3HXLA 1QUFA 4AY3A 1N78A 4P92A 3WL5A 1P2UA 3G2PA 4FU0A 1RLIA 3SICE 3DE6X 1P0CA 5BPHA 3NWPA 4EGCB 4NU6A 4H16A 1R8XA 1J9ZA 4BFXA 2OOSA 2X2EA 4NYIQ 1TQ6A 3VTAA 4C4OA 4TL7A 4F91B 3COJA 3M9OB 3PUXA 2P1DA 3CCCA 3C5WP 7AT1A 4I4TB 5ALIA 1PFUA 3NTLA 1IBLH 3ZD6A 4N0DA 2LDXA 4LRTB 3OZCA 4OXYA 5HJEA 4L0CA 3QU7A 3UG6A 4X92A 4ZRMA 3A6FA 4CFSA 1YVUA 2IEYA 4EHHA 3RYIB 2J3DA 3JQ8B 1NR1A 1NXVA 5F7OA 4GKKB 1JHYA 1FYDA 1AQYA 5K0LA 1EYZA 1T5OA 2P4EA 5KDLA