1I7NA

Crystal structure analysis of the c domain of synapsin ii from rat brain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
b'KAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPSIN II
molecule tags Neuropeptide
source organism Rattus norvegicus
publication title ATP Binding Independent of Metal Cations in Synapsin II
rcsb
total genus 87
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1i7nA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1i7nA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i7nA02
4M99A 4HNUA 2CNQA 3TIGA 4O4HF 5KKNB 2V59A 1BXRA 5BPFA 4O4LF 1E4EA 4EABA 4O7WA 4TUYF 3N8DA 3U9SA 1E4EB 3VOTA 2W70A 2X0SA 4XYLB 5LA6F 2HGSA 4MV1A 2P0AA 2R7NA 4IIJF 4MV4A 3R23A 2FB9A 1GSAA 4EGJA 1GSOA 1Z2NX 4ZQIA 2VR1A 2CQYA 5CA0F 2W6MA 3ETJA 1WR2A 4HNTA 4RZQA 1JDBB 4IWYA 3BSSA 4DIMA 2FPIB 3K5HA 1IOWA 2PN1A 3G8CA 1KJ9A 1A9XA 2YS7A 5LOVF 4ZI7F 5LP6F 3K3PA 3RFCA 3WO0A 2Z04A 4HNVA 4FE2A 2R7MA 5BPHA 4M9CA 3HO8A 3VPDA 3BSYA 2CNUA 2YRXA 3TIIA 5LYJF 5J2UF 4MA0A 4O7YA 4O7RA 3R9RA 4DLKA 4Y8VB 4XYMB 5JH7F 4EA8A 2WYOA 2R87A 2YZLA 1KJQA 3JRWA 3KALA 3TQTA 1DIKA 3RV4A 1PK8A 4FFRA 4O7LA 3K5IA 3VA7A 3RUPA 3V4SA 3BSWA 3RV3A 3ETHA 4O81A 3OUUA 4O84A 4TV9F 3AX6A 1GLVA 1VBHA 2XCLA 4WD3A 1EYZA 4MV7A 1AUXA 4YAKB 1VBGA 3GIDA 2CNVA 3ORQA 2V58A 4ZHQF 3R5XA 5IYZF 4WBNF 4MV6A 4EG0A 3JZFA 5DMXA 1CQJB 1CS0A 4O7VA 2YL2A 4EA7A 1W93A 2GQSA 1CE8A 2YZNA 4MV3A 4FFNA 4O4IF 1CQIB 5JQWA 1A48A 2PBZA 3GLKA 1Z2OX 1JLLB 4MAMA 3TW6A 3U54A 2GPWA 3OUZA 5CA1F 2R6FA 4J6EA 3U55A 4MV9A 2DZDA 2XD4A 1GSHA 3AW8A 3G8DA 1BNCA 2PVPA 2R7LA 3KAKA 4IHJF 1KC7A 2FPGB 1M0TA 4C5CA 5HV6A 2YW2A 4YJ3F 1ULZA 5C8YF 1Z2PX 4FFPA 1M0WA 1M6VA 2W6ZA 2NUAB 3MJFA 2YS6A 4GGMX 1JDEA 4ME6A 4XX0B 2ZDGA 1UC9A 2CZGA 4EAAA 4O86A 1KJ8A 5HBRB 3Q2OA 4I55F 2VQDA 1EUCB 4O2BF 4YJ2F 1AUVA 2VHEA 2NU8B 1C30A 1B6SA 1SCUB 3LP8A 4XZ3B 4MV8A 4O83A 2W6OA 2SCUB 3SE7A 5GONF 3BFPA 5C1PA 2J9GA 1EUDB 3KAJA 3DF7A 3HB9A 4FGRA 5LXTF 2YZGA 4FFMA 2NU7B 3R5FA 5C1OA 4EA9A 4QSHA 4C5AA 3TINA 2OLSA 5J2TF 3VPCA 4O2AF 2V5AA 1EHIA 5JQGF 4YBZB 5H80A 2YYAA 1W96A 5JVLA 2YRWA 4M98A 2R82A 5JVDF 4O7ZA 3WO1A 2HJWA 3ORRA 4O7TA 4YAJB 1PX2A 2R85A 1I7NA 4I4TF 2ZDQA 1IOVA 3UFXB 4C5BA 4O7NA 1I7LA 2GLTA 3VMMA 2I80A 4O7SA 1KBLA 3I12A 2I87A 2QF7A 3JRXA 2YZMA 3U9TA 2YWVA 1KUTA 2QK4A 2W6PA 1KJJA 3MWEA 2FPPB 2IP4A 2R84A 4IZOA 4EGQA 4I50F 5BMVF 5CB4F 3Q1KA 2Z02A 2VPQA 2FP4B 4TV8F 4IWXA 2NU6B 1UC8A 3WNZA 4M9UA 2GQRA 2W71A 4L1KA 4MA5A 4E4TA 3HBLA 2NPOA 3LWBA 4YB8B 1OBDA 5CAEB 1B6RA 1EZ1A 4FFLA 2W6NA 3MWDA 1GGOA 3V4ZA 3NUAA 5EZYF 2I8CA 2W6QA 4NYEA 4FFOA 5I47A 1T36A 3R5HA 2GPSA 2DWCA 2R86A 1DV2A 4O82A 5D8DA 5K2MA 3BG5A 1VKZA 1JKJB 4HR7A 2C00A 1DV1A 3E5NA 1KJIA 4O4JF 3VPBA 2DIKA 2ZDHA 5FNVF 3QFFA 3N6RA 2DLNA 1OBGA 2R7KA 4HQ6A 1KEEA 2NU9B 4FU0A 3JZIA 1C3OA 3KREA 4ZOLF 5KX5F
chains in the Genus database with same CATH superfamily
1XDSA 4M99A 5FFNA 3DMFA 1XAGA 1NVVQ 1YQ9A 2X77A 2XVYA 1KI8A 2HT6A 1N57A 4DZRA 5IUNC 4POOA 4ZQEA 4A26A 4E3ZA 5TDHA 1KRWA 1TWAA 3A1WA 5GMOA 3U7HB 2I8LA 2YWGA 1AQJA 2FWMX 1S3IA 3NR2A 2FMTA 3AVTA 4RIIA 3HFRA 2V59A 1DZ3A 5D3QA 4G4SP 3A70A 4AM8A 2Y1EA 3LVQE 1A98A 4J7AA 1O6BA 2P1RA 2ZAGA 2CLKB 5LQMA 1RAHA 3C0KA 3JQ6A 1TTPB 4O33A 1QZUA 4MV5A 1RCTE 4ETMA 1Z0JA 1HDEA 2FHPA 1SG0A 3SR3A 1Q0RA 2BTOA 1NI4A 5JZVA 5LB2A 3WJAA 4X7RA 3NTQA 5EGNA 5JDIA 3IVXA 3OT1A 5I5YA 3PO2G 4RULA 3RJMA 4PLFA 3RIZA 3UPUA 1QBGA 1SCUA 3FPCA 4NS1A 4ON9A 4Z0PA 3TBKA 4A3SA 3IERA 3U16A 1CRWG 1Z4OA 4B17A 5KQLA 3THWB 1EWTA 4C3VA 1TAHA 5C7IO 4FX5A 2R6DA 4L5BA 3H9QA 2XTAA 4QJ4A 3IVMA 1PJ3A 2GCOB 4JP1A 4TTJA 3EOAI 5T6MA 1FU8A 4GM1A 2V4MA 1SCDA 1ZCZA 3QUBA 3CUVA 1GG2A 3R20A 4JXXA 1A1VA 4IDAA 1V8OA 3BB1A 1A9QA 3PQ4A 1WSAA 2H1IA 2WAOA 3MTAA 1ZK0A 3FLEA 3PW5A 3HUEA 1J06A 1P60A 2JI8A 2WIBA 2WJ3A 2X0JA 4RA9B 3TIXB 4BRUA 3GPDG 4U3JA 3O4VA 3GIQA 4FGWA 4YJ3A 3H1GA 1Q11A 2FW0A 3GZNA 4JUFA 3RK4A 4YALA 4F4DA 3RBZA 2CJWB 4I1PA 1RRMA 3KVRA 3P20A 1SBNE 4NZPA 2BEUA 3NONA 3SHOA 3ANMA 2PWBA 1W5EA 3QNUA 3W8EA 1NATA 4CUZA 1KE2A 2P6UA 2CF6A 2H0RA 2YCBA 2PBFA 4JU9A 2FFAA 4ED7A 1DOHA 2VDRB 5JV5A 3CPHA 4EAQA 4LG1A 4BFTA 4ZI7B 5I6DA 4CLDA 3ZKWA 5M29A 3VV2A 3H8WA 4W9MC 5FPYA 1E2DA 3ENZA 3VUFA 2CY0A 1BX1A 5GV8A 1ZJ4A 5HF6A 3P9QA 4UQPA 5KT2A 3HYRA 3USES 5LYJA 2J3EA 4OQ4A 4RQBA 5JSHA 1ZLYA 4BU0A 4ALLA 1X2EA 2G7ZA 4MKXA 4NMHA 2FDXA 2SECE 2ZI7A 4C4AA 5NLLA 3DCJA 3LA6A 4UAVA 3CEPB 1AG9A 3HCCA 1X0XA 4OHKA 4TVOA 3UH0A 4EI2A 1JN0A 5C5CA 2JL1A 2CEKA 2VP9A 3LNTA 4MWEA 3FF4A 3M3HA 4LF7B 3EUWA 4ZVLA 1S89A 1VHLA 3DAHA 4R9SA 1X1SA 3M33A 1DRKA 1R9NA 5C31A 4BNFA 5T7BA 5H1YA 2RIRA 2QG4A 2UVRA 4UHJA 4BEBA 5DLYA 5DCLA 1YWGO 5DCUA 4EBBA 4V39A 2A0XA 2VI5A 1MAUA 3BB3A 3PC8A 4FJ2A 4IFTA 3K6JA 3L7CA 4LHWA 4OHPA 3WLRA 5IKEA 1E2EA 3REGA 2KQUA 2RH9B 1TUEA 2XUQA 3Q0TA 4EYIB 1W9HA 2JHCA 3EHEA 4RPIA 2C77A 2XECA 1X7YB 5KC8A 3A1VA 3DBHA 1U5BB 4DZTA 5IM5A 5K0LA 3O0TA 1EJBA 3G6VA 1R4MA 2JGIA 2VFAA 3C8DA 4BVKA 2B3DA 1IQRA 3D1JA 4ADSG 4BJ6A 3CU5A 1P4GA 5A7GA 5KFDA 3DG9A 2QVGA 2PX8A 2FUEA 3BDIA 5DHRA 5IJ9A 5ITZA 4QVIA 1HL3A 3P9ZA 1J90A 1AM4D 5JH7F 4AN4A 2C84A 4FBUA 1TLTA 3ILHA 3OWHA 3A3NA 3WBKA 2XCSB 4UOZA 2WG1A 1ET0A 3PNPA 5F9FA 2C2KA 3FYUA 3OETA 4R8MA 5KFKA 4QD3A 1E62A 1U9CA 5FL7A 1SVUA 4IHJB 3HHPA 1T2DA 3WMEA 4R41A 3UJDA 3LQ2A 2QZ4A 1D5CA 5EINA 4LH7A 1TU0A 1YS4A 3B60A 1HE1C 4M9ZA 1LI5A 1A9YA 1MN6A 1ZS9A 1OMOA 2VUIB 4IH9A 3VU1A 3LECA 3K5IA 1T8YA 2WT4A 3P19A 1KL7A 4TTVA 4B3RB 1CZOA 3DVLA 3SJCA 1FRQA 1IC6A 2PWYA 3GP3A 4EZEA 4W8HA 1CY1A 3QZ8A 1QS0B 3AFMA 1G8FA 2H7YA 3FNBA 2ONYA 4MS1A 3FPBA 5B1SA 3FYHA 4DCMA 4O81A 2ZEJA 3HU2A 1DCMA 4OHWA 2IBKA 1VHJA 2NM0A 1CBUA 4R71A 4WCFB 1HG1A 1ZGJA 4NJEA 2BF7A 1NIPA 3SFTA 1XFAA 4HC4A 3URMA 3RSOA 4HRYA 5HKKA 4LVNA 4G41A 4FONA 4NU6A 3PLAE 4G01B 4L9RA 4KSBA 5TQJA 2JLCA 3VV3A 4JV1A 4BQOA 1E9RA 3K9NA 3ROMA 3R5JA 4LRSB 4A0HA 5KC9A 2XCQA 4CHIA 2HU8A 3FDZB 4TTQA 1N6NA 4CCSA 1IONA 2XKKA 3DWFA 3KRTA 2ZM5A 5BN1A 4DR5H 1Y3IA 5EWJB 4QWCA 3OQBA 1Y4SA 3WOHA 3ORQA 1EFPA 3IUBA 2V58A 1JZQA 2VAMA 2FWJA 2VDKB 3M1LA 4PRYA 1XQ6A 3QBJA 4C7JA 5C5IA 1K3FA 4HNGA 4BKOA 4Z7OB 4DV1B 4ZYTA 1K0FA 1WSCA 4QFMA 4BC1A 2X15A 4JC5A 1FS6A 3KSRA 4L5IA 5B4TA 4GI1A 1NVTA 4L4RA 4ZO4A 1JKMA 1N1MA 1W47A 2QV7A 3G88A 1LSOA 3LC2O 3NI2A 4PG4A 3DEFA 1IM8A 4ZQCB 2PZ8A 2J3DA 2WMNB 5IAOA 2ZJ1A 4GVLA 1DHRA 1OCEA 4ECRA 1TW2A 2B83A 2CMDA 3H2BA 4XJTA 5EJFA 5DM2A 1NQUA 1W93A 1AQIA 2H0QA 2FN3A 1SQ5A 2JD2A 2AFHB 4DVGA 2XNDA 3RREA 4EPVA 1BMQA 2EU8A 2BVNA 3LPCA 2CKZB 5G4KA 1DAAA 4F2GA 3PUVA 3WAGA 1JQAA 2JCVA 5HKAA 3H9BA 1WRBA 2YNMA 3LE8A 4JXZA 5AM4A 1L7QA 1XZMA 5LXTA 5AR1A 3LRTA 3MT0A 3EYYA 2PZEA 3OT4A 5JSYA 1L2TA 4KN9S 3U0GA 1QYRA 2PPVA 3E22B 3HOYG 2RHRA 1JJIA 3GQBB 4DT1A 3K1TA 3VXKA 4XQCA 1E7WA 1H69A 4QVKA 5LUAA 5EKXA 3PL5A 4K0KB 2OC9A 1ZJ5A 3I01M 3MZ0A 5DCYA 2VH1A 4RETA 5DXAA 1Y6ZA 4YJGA 4EB8A 4XFJA 3SZMA 1ZD8A 1YQUA 3JQEA 4GE3A 2F90A 1FCJA 5KKAA 4L4XA 1PFVA 1Y3AA 2K87A 4RTPA 3TVTA 4YPOA 2ZB2A 3BXPA 4Z8YA 3V42A 1NBME 3SM3A 1RXCA 2G4VA 5H4GA 4B6RA 2X7XA 1GZ3A 1ZKDA 3F3YA 2Q5IA 3KTDA 4NCHA 3I30X 4Z99A 1HZJA 4J2OA 1N34B 3PNKA 1SEVA 3IDOA 2F48A 3NGLA 1OXSC 3A36A 1W36B 3ZDDA 2G72A 4U0JA 3V1TC 2XUKA 1K5PA 2NACA 3F90A 1EI9A 1PR1A 4LE0A 1R6VA 4G1MB 3RAXA 1E9EA 3KZNA 3PRHA 3KTFA 4IIUA 5E4JA 2GD2A 4OHYA 3SGLA 1ULZA 2HXSA 3C7CB 3LQRA 3PFCA 4WXYB 5D3MA 2DT5A 5HBRA 4NPAA 2XDQB 2ZB8A 3VISA 1GM5A 5H4HA 2A14A 3OPYI 4HAIA 4K05A 4QLOA 3PHGA 2I6QA 2QPTA 4JAVC 2EZ4A 4Z86A 3LQYA 1XJQA 3W3AA 2F6RA 1S9FA 2IEBA 3TXYA 2O5EA 1KJNA 4Z9XA 1MRZA 1ZNXA 2YJ3A 5B58T 3RC7A 2CLLB 5IHXA 1TUBB 3KXDA 4OK6A 4XX0B 3DCIA 4IOJA 4PR3A 3U4GA 4YP5A 1USWA 3R9WA 4C1NA 1C0KA 3QMPA 1J0CA 1KJ8A 1C0LA 1TUBA 5LMNB 2DUNA 1G17A 3GLSA 2D00A 4PX3A 4N0EA 3FCSB 5A2QA 3X1ZA 3N0VA 1DCFA 1XK5A 2IPXA 4GMGA 2WW8A 3SF0A 1HFJA 3E3AA 4GC6A 5I5UA 1RIFA 2X1LA 2ZJ7A 4C6RA 3VNNA 2Q8NA 3WHIA 3EVDA 1QR2A 5HKOA 1EDOA 1XJWA 2GN0A 2RCYA 3BERA 2J0SA 4RVHA 4EG6A 5EQJB 1VYVA 5GONF 4HWRA 2ZUDA 3BUSA 5AKEA 1R0CA 3QK7A 4AP5A 1UDWA 1G9SA 1JU4A 2PH5A 4Z9FA 3HP1A 1G7RA 2C3PA 4QUIA 5L1JA 3L7DA 1I3LA 4E7PA 3ITKA 2JFQA 4A6DA 3VNSA 2BHLA 2K2WA 2WJ4A 3BMNB 2FEMA 4D9CA 4DDHA 3EIQA 1DFHA 2I6FA 5KJEA 4KLZA 3PRKE 5DNVA 4EGAA 1NKSA 2J5BA 4MUFA 3X2EA 1CUYA 5KFRA 4ECZA 2FUG6 5JD5A 4MDYA 1DG3A 1SZDA 2ZFUA 1VB3A 1KTVA 3N3BC 4TV9B 4B33A 4C3ZA 3K2IA 3N87A 3PFWO 3SDZA 5EG5A 5FI5A 2NO9A 5DYNA 5DP1A 4TWJA 2PH7A 1F2UB 1N2CE 3LA8A 1X19A 1JDZA 3IMFA 3LSYA 3V7YA 1JNYA 4D3DA 4YUAA 5BN3B 1FZQA 3UJNA 1OB5A 3FCAA 4XM0A 5IUKC 4A6EA 2JCXA 1RS0A 5CVDA 1N2BA 2QW1A 3KK0A 1AD2A 1GCAA 1Q74A 4JWKA 1UK9A 5EXTA 4GBJA 3RYFA 1BDBA 1P3JA 1ISHA 1TRHA 4JQYA 1TMYA 2A4KA 2ZK7A 1QCCA 2ZI6A 4TVBA 4X97A 5FLXW 4BEWA 1SOMA 2QWXA 2CMGA 4DL2A 3BGIA 1C3VA 5JYBA 1L4KA 1MV8A 5CX1B 4YMUA 2OC4A 3BWMA 1AXRA 4TTPA 2IV7A 1PLKA 2J48A 3OFKA 1FDWA 3QMMA 1X7XB 5SZJA 3KQNA 1PFGA 2G76A 2W9BB 2Y6VA 2ZRCA 3HDYA 1KAMA 3KOUA 5FR1A 1CUCA 1P81A 3BWDD 3GRUA 2QR2A 5CIQA 4US0R 1UOEA 3O92A 3UAXA 5AUPB 5DULA 2R00A 1DWPA 4TQSA 2Q4BA 3MQ2A 4JIMA 2YWEA 5JIBA 1KEWA 1J42A 3O38A 4BFCA 1QH1B 5BWXA 1TJ3A 2PUVA 2BKUA 3FCOA 1BFUA 3QSYA 5F1KA 1E7RA 4UHEA 2NZVG 4R8VA 4LDQA 1DI0A 2R1UA 2XNSA 4QNRA 5BMOA 4P82A 1D09A 4M7PA 3IT3A 1Q0UA 3OJXA 2NO5A 3IUYA 1DPFA 4WNAB 2GK3A 5J43A 3ROGA 4O63O 2BN4A 5KYVA 3BQ1A 3WL8A 1MQ9A 1SVKA 3HR8A 1S10A 2COKA 1P5JA 4LJ8A 4URWR 5C46F 1LDMA 1Q95A 4DREA 5FXMA 4DA8A 1IN5A 1Z5NA 4AZ3B 4KWTA 3MWEA 1MB3A 1I9GA 1M5RA 4HDNA 1CX9B 1V43A 1U3VA 2F3UA 3E9CA 4LDAA 1T25A 1ODCA 2JGMA 1T0BA 3M34A 2CHGA 3B2EA 3QVUA 4QARA 3N74A 2JIBA 3RC1A 1UXGA 1HMPA 2QN1A 1BQ3A 3BX1A 4GZMA 4HBGA 4BUZA 2OB1A 1ODTC 5DHPA 5C7OO 1PE0A 4LRWA 3KKOA 3JD1A 3O31A 3WNCA 5CBKA 3HFJA 1ADGA 3E9DA 2ZPAA 5C8YB 1E1MA 3O2QB 3QSGA 3E8XA 2QM0A 3PCRB 4IW3B 3ESRA 4ITVA 3KSBC 1DGQA 3FPGA 2FUCA 1NXQA 3SN6A 4TSFD 4FBLA 1WHSA 1V7PC 3OP1A 3AEZA 3E23A 2BIFA 3NWPA 3WYEA 1JZSA 1BS1A 3PBKA 4FQ7A 4QG3A 3EZ2A 1CQPA 1DUVG 2BFFA 4YPFA 5MN6A 2RGBA 1GO3E 4OXNA 5IM4A 5KYGA 4F9FA 2QQ5A 4BBSG 2VJYA 3BF7A 3K0HA 1VPVA 2R11A 4G37A 3MWDA 3FPSA 4A3FG 3R44A 1CR4A 4OLJA 4GPIB 3MAJA 3DGFC 1OT3A 4EYOA 1DC8A 4MW9A 3K4PA 4G1CA 1E7YA 2PFGA 2Q5FA 1I7QB 2F3QA 3QJGA 4GG1A 3GDWA 4NBSA 3ANYB 2P5YA 2ESRA 3VOSA 1NG1A 4TVKA 4GNKA 1AKYA 3PNYA 1TJYA 4JLVA 3E9QA 4NULA 3NVDA 1FDSA 3MUNA 4X20A 5F2NA 3O3NB 1CEYA 4PSKA 3IEMA 5K2MA 3FH0A 3UTCA 2VSQA 1F2DA 4RNNA 3TY8A 3IMCA 4LMYA 2GYVA 4O4IB 3H86A 1P8LA 3NEYA 3QPCA 1BROA 3NCTA 2Z6VA 2FSFA 4NYIR 1O3YA 1C8BA 5K7SA 3ZI0A 4C2UA 3L79A 3I4MG 4L9AA 2QE6A 5ERYA 5FI3A 5CDHA 5EJIA 1YGYA 3ND9A 1Y3BE 5BWRA 4RY2A 5TY0A 5CXQA 3WISA 4RKYA 4TYMA 1MABA 1ZM4A 2QTTA 1YRLA 3ADKA 3DKRA 1QK3A 4QFBA 3LS2A 4U7HA 5SZKB 4XLZA 4PX9A 1N6IA 3VKWA 3RSCA 3C3CA 4HDNB 4B4UA 1KA9H 1G3IA 3DDNA 4BOYA 1JKXA 1KXJA 1REQA 4Z54A 5I9LA 2VDNB 3HS3A 5ALVA 1M1UA 4XEUA 1X1EA 2J6SA 1N0IA 1OAAA 2XQIA 4OXXA 5F3WB 5FOVA 3U56A 3DC7A 1F4LA 5E2BA 2B30A 1N1DA 4QU9A 5DU2A 2NVOA 3UWSA 4TZ0A 1MOPA 5AMXA 3GEIA 4RH3A 2KMLA 4P3PA 4C6SA 5L3ZA 3C8UA 2VTBA 4LC0A 4KWHA 3L6OO 2PR2A 3B5IA 1RI4A 2E0IA 4D6YA 1XXLA 4LJLA 2B6NA 1WBDA 4HXGA 2MCTA 1YFKA 3F4KA 1XG5A 4HNUA 3SMVA 3CEJA 3SNOA 2JFFA 3UXMA 3LX4A 4N0DA 4BLVA 1UQUA 1U0RA 4UEOA 4BGVA 4BCDA 3I4NG 3UMFA 1E3JA 4WFJA 5EZQA 3ZU4A 3W1EA 3DOIA 1P33A 2GEFA 4O2BA 4AAYA 1CVRA 4O1IA 4F6LA 4BTLA 2OCPA 1QH1A 1Q1GA 4CMFA 1TJPB 2Q0QA 3ESBA 4YCJA 2VA2A 3OY2A 4V02A 2O03A 1WMSA 3JQGB 4HPWA 4DS3A 5JUMA 3V4LA 1KJWA 3MFIA 3NWBA 4FXPA 2Q5EA 4HS4A 4KQFA 3UG6A 3NHRA 1GPAA 4PRLA 4DG9A 1CUWA 5KDOA 1E89A 1BFDA 2AG6A 3IPCA 3NORA 2X6QA 3LQ4A 4FT2A 1I4LD 1RWBA 3DZFA 3U9SA 3KTMA 1RHMA 2GZ3A 1R9TA 2ST1A 3BDVA 3I39X 1SXGA 1RM0A 2ZYAA 5G0UA 5FTLA 1WEHA 3JVEA 3CNNA 1JBEA 2IYRA 2QU8A 1K5GA 4PYKA 4X84A 3W78A 4D4LA 3HEMA 1R6BX 3EF1A 2WUEA 5KNDD 3DKPA 4LFAH 2FN9A 3HVRA 4DQDA 2JBAA 2PTGA 2A9OA 2R8YA 3RFFA 3H1BA 3ZWAA 1XO1A 2ZJ3A 2C92A 1GPJA 4UD2A 1NVMB 1XMXA 1A4XA 5KKCA 2GYWA 2WQ6A 3MCVA 4FE3A 3RTGA 5HX7A 2O7RA 5K0TA 3UY4A 4Q3KA 2VC2B 2GM9A 1L1EA 3C1OA 4AYBA 1KNXA 4HNRA 2I4TA 2IU4A 4BE4A 1QLJA 1ZH6A 2A0KA 2YY6A 2D4HA 3W2EA 4KIWA 3K1ZA 1WSWA 3HB1A 4UARA 2C20A 4XGKA 3VR1A 1D07A 4BMNA 3ZJVA 1Q7BA 3G0CA 3DKKA 3B7WA 2PL1A 3MIIA 1H4QA 1PYOA 5E6RA 3GFQA 4GU5A 2I0FA 2JGAA 2PRJA 4PLCA 4AS2A 3O8BA 4O4IA 2GBLA 2B0CA 5LP6B 1JR3D 2AI2A 1CY0A 1T8UA 3U62A 1VXRA 1NXWA 3AIOA 2HJHA 2GAOA 4D3SA 4CMCA 2XODA 2O7VA 5EUQB 4FE7A 5F7OA 1M8JA 2HGWA 1HMYA 5GZ3A 3TLZA 1O95C 1F06A 3T7IA 4BYGA 1N32B 3DE3X 4AO8A 3TDNA 1AKNA 4FGLA 3TZEA 4BMVA 1I3NA 1GDDA 1TB4A 5TR9A 3C3DA 3PRYA 2XVZA 5EMHA 4KXNA 2ZT6A 1U0LA 3BWCA 4ZT4A 1TEXA 1L6IA 4CV1A 5A4FS 2IHVA 2UZ3A 3JQAA 1D2CA 4PSCA 1QTNA 5DO9A 3DDSA 2NVUB 3MWDB 1ORIA 1BDJA 5ADHA 6YASA 4IAJA 3HO8A 4HDSB 3QH4A 2GHTA 5AI6A 2CNUA 4BNTA 1EEHA 2BMEA 1EM6A 1LRKA 3O9MA 5JSFA 4FDLA 2FMIA 5DSZA 2QX8A 2B37A 4NU0A 4WZ6A 1PUIA 2OG2A 3IQIX 1SCIA 2Q8PA 4GPZA 1XYVA 4RMIA 5DT9A 4ZKDA 3HOUG 1Z4NA 4Q18A 1EFRA 1K8YB 3NANA 1NNUA 3UYYA 2AR0A 4EBDA 2P3SA 3IL2A 3PFBA 1PNRA 4A73A 4U2FA 3OKAA 1R5JA 2VXCA 1OSNA 3G02A 4E5PA 5A5DA 4IKPA 1PS0A 4DV3H 2MR5A 3H3FA 4KWCA 5DSXA 3REOA 5CCEA 3JCZA 1FP1D 1RZUA 3K94A 1KYWA 3FDIA 1KEPA 1YTUA 4DOMA 2YZLA 1G21A 1SR8A 1KJQA 4WKOA 2BR0A 4CQMD 4EG1A 1JDBC 1TUGA 4XVUA 3RAFC 5FFFA 2XQGA 1USIA 1A77A 2VJNA 2PZAA 3CZ4A 1THTA 3GVIA 3L7LA 4HH4A 3TE7A 3UK0A 1CEQA 1Z4PX 4HGZA 4V3CA 1ZRHA 5TB5A 1OAKA 1TE2A 3A9VA 3CRRA 3CPEA 3T52A 3ZKWB 3NHFA 4QIWE 1V8FA 2ZSJA 3HMQA 4GBGA 4GYWA 4JJ4A 5JTTA 3FOZA 1QV6A 1YS9A 4AT1A 1ADJA 1OY1A 3SS9X 3A9UA 1BWPA 4G0ZA 3PC8C 2DWOA 3HLYA 3V4SA 3QKWA 1IQPA 2GCEA 3I37X 3IBYA 3OM0A 4JR0A 3SBXA 2QRMA 5I9NA 3WR5A 1QONA 2CJFA 1P2SA 1JQEA 1LBQA 1YZVA 5A5FA 5F3DA 5KHAA 1U8XX 4LF6B 2QJOA 1VL1A 2PVCA 4LRTB 2AVNA 2QVYX 5AHKA 4RMNA 4D6XA 3IEPA 3P2KA 3JAWB 1VJ5A 1XRSB 2JRCA 1Y80A 3B6IA 5AW9A 1QHHA 10MHA 3TZKA 4ZJUA 3NWEA 4JVMA 3FAZA 2GBIA 3EDOA 4IHKA 5CR9A 2MSNA 1KSGA 1L4NA 1H4VB 2QN6A 4LF9H 2OV6A 2ZIXB 2X40A 3PX3A 2UVDA 2WUFA 4OA5A 1OBHA 1T1EA 2G36A 3BQMB 4OX9B 1ZVVA 3ERCA 3K2QA 3LYAA 4RV5A 1T3SA 1H0KA 3RDPA 1WMBA 4ZQBA 1YVEI 5I48A 3HUTA 3Q7PA 1V25A 4MUAA 1U2TA 5IP5A 5LD2C 1JAXA 2HHHB 4I4TB 1XVLA 1CULC 1EUZA 1LBTA 2YRFA 2DFVA 3D2BA 4GICA 4IJUA 4J94A 5E4TA 3QKSB 5FL7D 2FN8A 2HJGA 2XT0A 1VG9B 4B5KA 1Q77A 2ABJA 5HA5A 1OV6A 2WWGA 4ARZB 2JFPA 3HCPA 3O9VA 4IDNA 4CR8A 4QELA 1WR8A 2D74A 5FOXA 4Q12A 1IZZA 4CWAA 1V96A 5JC8A 2P3OA 1CU1A 2EZ9A 4DDMA 2F8TA 1IJEA 1B93A 3TI7A 7ADHA 4PDBA 5AW3A 5CD1A 1ZSYA 3H1TA 2C4UA 2E89A 4IQFA 3GN1A 1P5ZB 2A5LA 3WXMA 5JFTA 1TMGE 2Z4SA 1SA0A 3KU1A 1B8OA 3NIFB 3P9CA 5HFJA 1OBVA 3OCYA 4Q02A 4ESHA 2IZ5A 3D2LA 4GC9A 3PQ6A 2EFHB 4FIDA 4FM9A 4OVKA 1P5RA 4NL4H 1YRBA 1T6BY 4H35A 1QVWA 2PBZA 2OWEA 3QEOA 3K32A 5C4MA 2FW1A 1U3WA 2BGGA 3QLJA 4RYLA 1R4ZA 5EJEA 3AV0B 3UCFA 3JALB 1FDTA 1HURA 5FTWA 3AR8A 3DSRA 3QVKA 1G8SA 5K3FB 1KVSA 4AFNA 2DAAA 1S2GA 3I2JA 5AK3A 1CUEA 4UHKA 2FWAA 2CV2A 1ULTA 2OB2A 4LJ4A 4S1OA 1DS6A 2VH2A 4XX0A 3UIEA 4A10A 2OUKA 3SYNA 4OUDB 4LJ7A 3L93A 5SYNA 3VDXA 1AUOA 3TEKA 1DO8A 1JHDA 1N8KA 4MQEB 4NESA 3RUHA 3AM1A 2IXGA 4OBEA 1G6KA 2OCBA 3L0OA 4CV3A 5I8PA 4DWWA 4F5DA 5E38A 2WWRA 2O14A 4YRBA 3NOQA 4BP3A 1JMVA 3G2MA 3L2OB 4G0PA 3IE0A 3UN1A 3MTQA 1QHFA 5JH7B 3QFRA 1KC7A 2HK8A 4TZTA 5I5GA 4AULA 3I6YA 4B85A 3Q3VA 1KDVA 3KQVA 4IZHA 4G5HA 2C95A 1QGED 4Y1EA 1Y89A 1I1OA 4K6NA 1EINA 4RDXA 1I80A 1E0AA 2VDPB 5C8YF 2QPAA 4RMHA 4ZVKA 3B1KA 5BSEA 3E7XA 4LHSA 3L1KA 1HLPA 4RTRA 1T10A 3N8KA 3QU7A 4Y1FA 1O8BA 3G6WA 4DIOA 3W4KA 1W0JA 4YJHB 3MJFA 1JT2A 1BEZA 5J4LA 1J0BA 2XKBA 5HE9A 2Q7OE 5CFQA 1ZUD1 4MW7A 3AKCA 1R4NB 2WG2A 3F1KA 2Q50A 5DGCA 1AKQA 1XTQA 2D0IA 4UEQA 3EH1A 3K73O 2YMMA 3AF4A 1UINA 1ID8A 1JKJA 2NO1A 3L7JA 3PJGA 1JE0A 2UZ1B 3G0GA 4GVPA 4H3KB 3LPLA 5LNK1 4WZZA 2MSDB 1UM8A 4LWQA 3VPSA 3WYDA 2AU0A 1FRNA 1PSZA 3Q2OA 4I55F 2HI0A 2XRMA 3HDHA 4YRRA 5G1OA 3RSGA 3E61A 3EC2A 5L3RA 3JS5A 4QZVA 4YJ2F 3AB3A 2EARA 1JR4A 3G3EA 3OEYA 4FXOA 4XM1A 3HJTA 5EXEA 3ER8A 5DGBA 3L0CA 5TS2A 4EG7A 3JTMA 1QFXA 1EP3B 1H4TA 2AIRA 2ISSD 4J9VA 4RFSB 1K4YA 4F71A 2MYNA 4X41A 1GZHB 2GBFA 3HY3A 1U94A 2X9NA 3HXPA 3OCUA 4GKVA 4N39A 1Y0BA 1M2OA 4NR0A 1YV9A 4ATNA 1BOFA 3HP7A 4BP8A 5DMHA 5EXPA 1LZLA 2WP8J 4I4IA 2J0UA 2R8GA 5H83A 5IBRA 3SF8B 2BTQA 4AJ4A 2JD0A 3AINA 3AZQA 1W6RA 4KLAA 3WRXA 6LDHA 2ZYIA 3TJZA 2DHQA 5KG7A 3JQBA 1EVYA 5PGMA 2W22A 3DF7A 3RE1A 5HM8A 3RUEA 1U1GA 2ROQA 4JWTA 1A9SA 4OAOA 3ANXA 5I9BA 3QF4A 4ZMRA 1V1JA 3ZNOA 4JBGA 1PWZA 3OX1A 4O8CA 2I99A 1VIVA 4XRGA 2XF2A 4QSHA 4RTSA 3P96A 3FBTA 4LE2A 1LWNA 1F2UA 2O6LA 3LLMA 5BXYA 3WIOA 2AXPA 2GGSA 2FK8A 4OJYA 1KVUA 2J3MA 2IYLD 2HSEA 1QIJA 2RCNA 3T1VA 3T5CA 3VTAA 1C9DB 2A0FA 4CCAA 4CMBA 1VPWA 1T9BA 1NR5A 2FMUA 2PKQP 2Z9CA 4CDMA 1DQZA 1E2FA 1TQ4A 5AOVA 4QWBA 1BCSB 3T5HA 1HQYE 1QB8A 1U0JA 2GYUA 4W1QA 1XRPA 4YTEA 3UHPA 5IC6A 3PFGA 2P7IA 3VTKA 3CTPA 4CL0A 2II6A 3Q5EA 3HDGA 1E0JA 1UKVY 3I42A 4ML3A 2XA1A 4O7ZA 4O1HA 2A8YA 1AQYA 4BQQA 4CNQA 2HSJA 1RK5A 4WH0A 1EBFA 1IB0A 2HFJA 2G9NA 5CYGA 2HD4A 1TCCA 1NW9B 2QL7A 2ABWA 3ZS9A 2G5GX 3WQHA 3QYJA 4OQLA 1LJ8A 2MIIA 3TW0A 4C04A 4ZANA 3N5CA 3KUCA 5JI3E 4H1WA 4NU5A 1Y63A 1W94A 3TFQA 3TOZA 1XAJA 1N33H 3CZPA 2J85A 3O8OA 4RF2A 2BGLA 4RYDA 5K3CA 4XIIA 1BHSA 3B7GA 5KJ1A 2WNIA 4YNBA 5LMUB 4E2ZA 1F8XA 2JLVA 4Y1RA 3X1JA 2BZ0A 2DR2A 1KBLA 3IN5A 4NPHA 3B52X 3DTTA 3E18A 4TXLA 4HDMA 5K4AA 3WK6A 4IOKA 3ZTTA 5JCOC 5JNTA 3UPTA 1DT5A 3KFVA 1M7GA 5GPBA 3BBPA 5LSAA 2I87A 4OJNA 1IBKB 1U7PA 3RJ0A 2FLLA 1JHXA 3CT4A 3ZU5A 4FKBA 2UVPA 4D02A 4UZSA 3NATA 4HAUA 4OQNA 5EA2A 2IGBA 2R4QA 1QCYA 3VHQA 4ZICA 1UFVA 3ASYA 2HY7A 2Z8YA 5K0ZA 3ZD7A 2W2VA 5D5HA 2YCHA 1JL3A 1PFYA 1RACA 2IY9A 3BGOS 3ORHA 1FFWA 1R15A 2QL9A 4X61A 4Y7CA 5F2EA 3RODA 2I9KA 3ZPXA 5B7QA 1W2GA 2RGNA 3V4PB 5ALOA 1NW6A 1E2LA 4JB3A 3N75A 4KN5A 3OZBA 4JP3A 4LWZA 3GVPA 1R8YA 2FEXA 2FSHA 4EEQA 4DA9A 4DLAA 2DBVO 1JSLA 1NDHA 4KGXA 4L22A 2FZKA 2GPJA 1FMFA 1TGYA 2PKQO 5JCOA 2CHQA 3O4IA 2VPXA 2NU6B 3CJTA 3KWJA 4ZVOA 1G2IA 3RLIA 2EJTA 3V3TA 1WDMA 3D6FA 4HAZA 4IMPA 3NTXA 4PPGA 5U4XA 4C88A 1Z0SA 3EN0A 2KS6A 4ZQFA 4PLHA 4B6QA 4E4TA 1HR0H 1CLEA 5DLQC 2R8RA 1DC3A 3LWBA 1V9CA 5EL0A 3P0RA 1CVIA 5KQRA 1OBDA 3IP3A 3AI3A 2EKBA 3GC6A 4H3HB 1JYEA 7YASA 2IU0A 4L27A 2VDMB 3TLXA 2OILA 2PL5A 4XDZA 2OXTA 2RK3A 4B87A 4EH1A 3KKZA 3MWEB 4PN7A 4ZZIA 1V9PA 4R40A 3ZDRA 4ERNA 4AQYB 2J1LA 3G89A 3BQ0A 1DQSA 1HTTA 3K3VA 3L4SO 2R66A 3OIDA 4G1FA 1VSQA 2WAQE 4TWZA 3IQXA 2CNBA 1YS1X 2QN9A 4G4SO 2OGTA 5AK6A 3BGDA 3HYCA 2WKRA 3EPPA 3NHUA 5CLGA 4O82A 1DV2A 5EAIA 1YBVA 1NURA 1B15A 3IP7A 1ORDA 1QCZA 4U6QA 4Y8VA 1RK6A 1PBTA 2F2TA 2CNWA 3HCBA 2D62A 4QUAA 3U81A 3VAAA 4NAVA 2D2XA 5H7XA 5JZBA 4O2AB 4CXMA 4DCCA 4RPJA 4Q4LA 2JZNA 3H2GA 1GT91 2MWMA 3IMGA 1QWOA 1M8KA 1I33A 4JI4H 1UBEA 3CYFA 3IC5A 3L1IA 2RKWA 5AXCA 5JALA 1I1KA 2CXPA 2BV3A 2QMQA 2WZBA 2YNMC 4PFKA 4F1KA 5CHEA 3WFJA 2FF7A 2QN8A 3L18A 7GPBA 1ODJA 2Y4RA 3EY9A 4JYCA 3JATA 1Z26A 3C5CA 5JNRA 4YT2A 4KIFA 1LF5A 1U7HA 1U80A 3BA6A 3T9CA 4KGVA 1QGUA 3AI7A 3JD0A 4UJ3A 1M2WA 2DECA 2Q9AA 3BGSA 1AGYA 1TCBA 4OOEA 2IU3A 3I61A 3PSHA 3P2MA 1ADYA 4CKBB 2PXXA 4BO5A 4FU0A 1CUZA 3EXFB 1JYFA 3Q0IA 3FI9A 2P65A 2J09A 3EEYA 2HHCA 1I51A 1E2HA 3KREA 3WK7A 4JLDA 2JLQA 1RQ7A 3CVUA 4TS3A 4ZAFA 5BXQC 1NVVR 3OQIB 3RVNA 4RTMA 3TECE 5BWCA 3AFGA 3OTIA 3UYKA 2AN3A 1EGQA 1Z25A 1AKMA 2ON6A 1VCHA 1H8ED 1KEEB 3JQAD 1QHIA 4PTZA 4Z9BA 1E6MA 2GVZC 1KVRA 3VYSB 3NT4A 5D1OB 4NE2A 4P0QB 4MPJA 3AR5A 1W4BA 1Z2DA 4HVAA 2Y99A 2DUJA 2X5RA 3IODA 4RTQA 1A7AA 3WLMA 4DR4B 3LUCA 4FZ5A 5KIAA 1WB9A 4UVHA 3EEBA 2GA9A 4G0OA 5EP2A 5BPFA 2CBXA 2ZB3A 1ZOOA 3EGXB 4HQRA 4HWOA 3ZWXA 2NZWA 4EDHA 4ZGWA 4OXKA 2VAPA 3QLUC 3NNSA 1CS0B 1T3TA 2AHRA 3SXUA 3H1AA 4GPEA 5A9TA 1YT5A 2OPHA 2WF7A 1Z13A 3P9SA 4JEMA 3K0FB 5JDIC 3GLGA 1Z9BA 4DR2H 4IEEA 3RYTC 2I3GA 3NAQA 3AL2A 4CYMA 2P8SA 3AKEA 2I8AA 2ISQA 2OFOA 3DD1A 1OFIA 3E7PA 2I1LA 3LNCA 4GYKA 4KR0A 4RNDB 1S2NA 3DNPA 1YONA 3B9QA 3OZTA 4GI2A 2QX4A 4UUQA 4AKSA 4EHHA 5KFOA 1CUDA 3B1FA 1SEIA 3NYWA 5J1TB 1NW8A 1QG6A 2R7NA 4EY4A 1WAMA 1GPH1 2YXPX 5K8UA 3R23A 3DT6A 3IDQA 1XKTA 3FYDA 3VO8A 3J7AC 2C4KA 2Y93A 4D8UA 5JW6A 4HQOA 2J6TA 3EOZA 4FFDA 2M32A 1X7WB 4LYEA 4OB7A 1IWPB 2EZUA 1YVPA 1PI3A 3KVVA 3G79A 3R8CA 2OKCA 1SU6A 1GSOA 3MCTA 2D1YA 3QG5A 2OFFA 1P3Y1 1YASA 1PEAA 2HWXA 4BB6A 4C0XA 1RJEA 4DV2B 4OX9H 1SVWA 2X2EA 3FIUA 3HU1A 4ZAVA 1ZHOA 1O6ZA 1XTRA 1QF9A 2QDKA 4NZ9A 3H11A 1M2VB 5L51A 2HIVA 2CYCA 4JFRA 1DDGA 1EHCA 4F9TA 5DNWA 3DBOB 1XQXA 3DDUA 2XCUA 2HHHH 4MVCA 1E3SA 1IY2A 4MQ6A 5FAKA 5JCJA 1KDRA 2W8BA 4LH6A 1Z0IA 4K9OA 5SYMA 3FYCA 2PN1A 3I76A 3F7MA 3SEQA 1Z8NA 2FETA 3Q7SA 4Y9DA 1YQWA 4DGSA 5JSUA 2XE8A 1Z6GA 3K1JA 3RBVA 4FCWA 1BZYA 2EEZA 3R7WA 1K66A 1IB6A 2NTYC 2BHTA 2P9BA 4JUIA 1EVLA 4ODIA 2JEJA 1Y8RA 1WV0A 1OWMA 3G5MA 4H7KA 5K6AA 3C98A 3LPDA 2XYPA 4XWYA 3TDKA 5HJ7A 2UYHA 1QCDA 2FUKA 2J3JA 1P4SA 3BHJA 2E9SA 1NKTA 2A9PA 2EWVA 2VF4X 3GQBA 3R6WA 4FR2A 1OGIA 2YFKA 3EDCA 3HG7A 4QOIA 3EE6A 4KO2S 4AIRA 4GI5A 5JNSA 2ZATA 4GX5A 4ROSA 2UUCH 3PWZA 1HKHA 4YJ3B 3VPDA 1Y37A 1GG5A 3E1SA 3H17A 4CL2A 1C41A 1EJ6A 1NOKA 2IYSA 3MGAA 1U1CA 3AYZB 4XYEA 1BGVA 1JFFA 1B8NA 2FN7A 4JY7A 5TNXA 5KT4A 1RYMA 3E1GA 1UXHA 3TSYA 4L8FA 1JQDA 1NLZA 3PEEA 3L5KA 4PVDA 4GLJA 2GM3A 4BVAA 3BCHA 4DF3A 1E60A 2V7XA 5I60A 2QZ9A 4CM4B 3EXIA 1U9ZA 4OO3A 3CBGA 1EXWA 2GPAA 4D9GA 1Q0HA 4CETA 4ZYXA 4LJRA 3DM5A 5JECA 5LA6B 2XVMA 3DT9A 3ZWOA 4EHKA 1HDOA 4DDWA 1YCDA 3ELYA 4CKBA 3I52A 4I4CA 3IT2A 4BX8A 1V1RB 1CJCA 5A71A 4HYYA 2CB0A 3GJXB 4EA8A 1BYIA 4FDTA 1RHJA 2WYHA 4NP6A 4B35A 2QB5A 1FEZA 5CVCA 4ZEXA 2Q3FA 3B38A 4U8GA 2NZJA 4X6XA 3RU2A 3T6KA 5AVTA 4JNKA 1M83A 3W1GA 2M05A 1T8RA 4AG6A 1PK8A 1E2GA 2GX6A 1I4TD 2FMAA 1EE1A 3PDUA 3WLSA 1VDZA 2Q9BA 2VTKA 4DV7H 2F1KA 1P39A 3PYMA 3T9FA 3LQKA 4JOBA 4PLGA 4WXMA 4CFYA 3I3OA 1W25A 1ZU5A 1ZA1A 1FMCA 1NVUQ 3ROKA 4YMSA 3X0DA 2HNBA 2ENWA 1XNQH 4UVIA 3EA0A 4EJSC 4YXFA 3WWZA 821PA 2P9CA 1ZO8A 3THSA 1XZCA 1Z6ZA 3GTKA 5CH5A 1U2RA 3ROZA 2HWWA 2VJBA 4RIGA 4C0JA 5IJ0A 4B3RH 3K0CC 4J3FA 4BASA 3FBGA 4OHUA 4P3KA 4ZD6A 2Y0EA 4A0QA 1WNFA 2ZYSA 3R8FA 4TMKA 3EIFA 4BGUA 1TA0A 1QORA 1SKMA 4CV0A 3UMGA 4BKMA 1TYZA 3HK2A 2QTHA 2XXJA 1U8UA 1UWKA 1VKNA 4QEZA 1RP7A 1DMRA 4R2KA 4FOPA 1X7ZB 2XWBF 1T0PA 3QLEA 3HXTA 5FTNA 2I7VA 1FX0A 1ZK3A 3FROA 3OM9A 3OBBA 4UHBA 3CSWA 4LDNA 1Z6XA 4WW0A 3FPFA 2DWPA 3LPAA 2IOFK 1O95A 4JGGA 3WOVA 4WLNA 1U8AA 5IXJA 3E9NA 1K3TA 3TB4A 1YU6A 3ZNPA 1UM9B 4WDRA 3ITNA 3DW1X 5LQUA 2F62A 4ZHQF 4EGFA 2BOVA 4CLRA 1WETA 3DTVA 4B8YA 4D8YA 4MYCA 3TM4A 1YSCA 4G09A 2EGGA 1X3SA 4KE9A 1PJAA 4DPLA 4IEFB 4W99A 5BVHB 4D98A 1D3AA 2ZETA 3DPSA 5ITSA 1D0IA 1UANA 3R7LA 4QYXA 5A03A 3D6HA 1S1MA 4BZWA 1VYTA 4Q66C 4XOIA 2ZRGA 3U0VA 2JARA 3JV7A 5ALQA 1BH2A 1PJ4A 3CT6A 1IZ8A 4TS4A 2GRAA 4R2XA 3MS2A 3ZGOA 1FLVA 3P9KA 2NNWB 2Q3CA 4OQFA 3X1MA 1N9ZA 2G88A 1I4EB 2FUG1 1JR6A 1AHHA 5DNUA 3T0FA 2UXCH 4N3CA 4AMZA 4M0JA 2R93A 3CPJB 3CZ9A 5DNAA 3R7NA 4DLTA 4QREA 4MVWA 2O50A 3IRVA 3WLAA 3FMPB 3WYNA 2VJMB 3T0GA 4PSUA 5DHAA 1AQLA 1HWYA 2IA5A 1S0OA 4GEGA 3TJMA 3G9TA 3VYRB 1P4HA 3N2ZB 3I0NA 4H4CA 2ZRNA 4AF6A 3MELA 1GAJA 4AF8A 1MBZA 5DT2A 1SUWA 2C9BA 2NXEA 4G4GA 2AUMA 3TQSA 1CK4A 1X7ZA 2ADFA 3V4VB 4BMXA 3S6JA 2CUZA 3V6MA 2F3PA 3IV6A 1RXVA 1A9ZA 1CUXA 3SU8A 1IBLB 1GR1A 4CF6A 1PZGA 4B7UA 4ECSA 4S1NA 1I6UA 5JNWA 5AKZA 2UZ4A 3FLAA 3GRAA 5KMGA 3B48A 1KZ4A 1NASA 5AP9A 1A72A 3VR5A 3AJ8A 5DNEA 2IHUA 3P45A 4D44A 2ZUEA 4ED8A 4KYUA 4ARCA 3ZWDA 3MJVA 5C1BA 3LCRA 1HKUA 3EVAA 2F9FA 2KLHA 2I2WA 3I34X 4JA0A 1VJGA 2EIXA 2X0NA 3F8WA 3OO0A 2WLTA 1EESA 4MGYR 3LYHA 2A3RA 2OLEA 1N2SA 1AKEA 1N3BA 4N41A 3WZLA 1PVOA 1P8JA 1VRWA 5GADl 3BWEA 3GV7B 4HDAA 1P18A 2OQIA 2WA2A 2GFQA 3WLTA 5BV1A 4S05A 3BWXA 1GGHA 3S55A 1HY3A 2YXEA 3UJBA 3KNZA 1YB5A 1ECJA 4RH1A 1JIXA 1JHZA 4BMSA 2PMKA 3RT1A 1W34A 1HE3A 2QSUA 4A0FA 2J32A 4EARA 3CGWA 5JLAA 6CHYA 1R4AA 1RJFA 5FBWB 5F5XA 5EJAA 5IT9W 1R88A 2HWUA 3PRJA 1ZXBA 5HIIA 3UHFA 5FH9A 1P7PA 3M2TA 3L0BA 3D4LA 3GGSA 2PEYA 3A7DA 1XL0A 1GA6A 4RSHA 5J40A 5JAIA 3T5PA 1W36D 2BM8A 2ZSFA 2YV3A 3UKJA 4YFVA 3K4QA 3KCNA 3IBSA 4O3MA 1QZTA 3BA1A 4PZ7A 3FDFA 3WGYA 2UU9B 1A3CA 5TQ0B 2FLNA 4NZOA 2P6RA 1CVLA 1RSZA 2POQX 3H2ZA 3NP9A 4BP9A 2C58A 3BC1A 4PZAA 3MT9A 4P7GA 1RCFA 1DX6A 1WPQA 2GM4A 3KJIA 5K5EA 5K03A 3QXHA 2QN7A 1FRZA 2WD9A 1FF9A 2FQXA 1VM6A 1BCRA 1G5FA 1AUVA 2OESA 1R8XA 2QLNA 2YDYA 4YIKA 3TNJA 1H9CA 3ZQ6A 4ZOCA 3L4JA 1PSDA 3ZC3A 1KMIY 1U2SA 3EBPA 3NHBA 1RHRA 2AFRA 4QOHA 2VCEA 5LUBA 1NIJA 4L5AA 2LCQA 2IYNA 1JR3E 1RVV1 5HDBB 4E5NA 3R4CA 2Q3MA 2ZYVX 5IF3A 3L8GA 4IH4A 4KPYA 2YOHA 4H7IA 4J9QA 3RYHA 5ICGA 4ZYUA 1OAOC 1RDFA 3JRNA 2JGFA 1DMSA 5K0BA 2ORIA 4RS3A 3FKSA 1JFVA 3RWMB 5A6VA 2AZMA 4X64H 4L5YA 1AVTA 4LZNA 4ZIRB 2NVWA 1EDEA 3THXB 2VRCA 3I73A 4BCBA 5LL6P 4ACAA 1LLCA 4FFMA 4F2PA 1IZYA 2BQRA 2XH8A 5E9JA 2ODQA 2P9GA 1X8JA 2XCIA 4C5AA 3LZCA 4K9LA 3HMKA 2EQBA 4U9IS 3G2IA 2W8BB 1NVWQ 3MRXA 4XYLA 4YR7A 4QO8A 4UE2A 2XCPA 2ZUVA 1QO7A 3UT5B 4AUNA 3EVEA 1DAGA 5HYVA 1ZEMA 3KUUA 3SC6A 3P0HA 5I8WA 3Q3IA 1Z0FA 2Y0CA 3BQ9A 1AMNA 3I6MA 4YBZB 2XA2A 3BD7A 4PAOA 4POAA 4JI4B 4TLLB 2O5RA 1N0HA 5KFTA 2HIGA 3BIXA 2UXDB 1R6DA 4JI6H 1D04A 1YULA 1VG0B 2PUWA 2M6SA 5CR5A 3GZJA 1CUUA 3JX9A 4JLPA 5AKHA 4M98A 2WTFA 4FR0A 1J6UA 1GKLA 1P0PA 3I53A 4KAJA 5CVVA 2NOAA 4DR3H 1L7OA 4BNNA 1V6AA 1A88A 1L7MA 2CL6X 2QN3A 2GH1A 4CF7A 4YHBA 4JI7B 2JH9A 4QJ3A 2G63A 3I6QA 4XQ9A 1V45E 5KOYA 4F4FA 2DLCX 1ZQ7A 2VWPA 5CX4A 3WI7A 3CNOA 4IJ5A 2FZEA 5TGZA 1D2GA 4CMAA 1IXSB 2HA2A 4PPNA 2XWQA 1BMTA 2EATA 2RK6A 4X8OA 3B70A 2GLTA 4BNDB 2JRLA 5FBKA 1EFVB 2IXDA 4I36A 2ORWA 4C14A 1VKHA 1HV8A 5KBYA 2BEJA 4WL0A 4NQRA 4LSGA 1M33A 4LOIA 2NUTB 1C2TA 2CDBA 2I4OA 2W6JA 1L4UA 2AKYA 4Q5IA 3WBJA 4YJFB 4AY5A 3M4NA 1A1SA 1HDGO 3PKIA 2V98A 4FZ3A 1Q3TA 1S0UA 3TVDA 4LV6A 2QP4A 3EGXA 1JFSA 4RGBA 1QGDA 2WIJA 3V6JA 1WOMA 2B6HA 1YR1A 3OE7A 5T14A 3MGCA 5P21A 3G2NA 3T1OA 3ZHXA 4D4IA 4D4HA 4DKJA 4NBWA 1E2JA 2Z3ZA 2XWSA 4F0JA 4HLQB 1PEYA 4KQHA 1K83A 1WUHS 2WUWE 3CE6A 4HEJA 5JJCA 5AHRA 5GAJA 1VL2A 4IDHA 3Q1KA 2OV3A 3O1IC 3VPFA 3WLJA 3VDQA 1L1RA 2PUTA 3MGGA 1FNDA 1WW2A 3D43A 4Q4JA 3UAWA 2WJPA 1VBNA 1PLJA 4TLMB 3WL6A 2FP4B 3WNVA 2JI9A 4DNPA 3GEEA 4FMBB 1JFLA 1QB7A 3CUUA 3FOEC 4XVCA 3T9BA 5AUQA 1DQYA 4H2DA 4U7GA 3K8YA 5EXXA 4I4LA 4IIGA 1K88A 2FMKA 4YRFA 3OMXA 4UPDA 1C30B 4BXOB 1EWQA 4NFHA 4RCYA 2QTFA 1MT0A 4G5XA 3EWSA 3L5OA 5JWHA 2ODTX 4YROA 1JG3A 3O4FA 3KYJB 4KI0A 1D8TA 1R3UA 1W8IA 1ZAUA 2ZITA 4OP3A 1N2EA 2BHRA 4DRFA 2DT8A 2P11A 4E09A 4CQNA 3HB5X 1AN0A 3AVYA 1U28C 3NUAA 4KACA 1OGYA 1E9CA 1FNNA 2DP4E 3KXPA 3ZU3A 4AXBA 3PNLA 1KK3A 2C5GA 5I47A 4J9MA 1XV5A 2CK3D 5K09A 2JS7A 3ROPA 3TZBA 1QIDA 5KT3A 1ADBA 1MQ8B 3ETDA 3IAHA 4Q1EA 3NVKI 1SNYA 3ZWNA 5BV0A 5B6IA 4LXGA 3BZWA 2WJJA 1A04A 4LDRA 2C3MA 5EZSA 2ZI4A 3LLCA 1MG0A 1YJXA 2C4NA 2GMWA 2RH4A 3AEKB 3F3MA 3QX7A 5A3RA 1PT6A 3SM9A 5JQGB 2H2IA 1XCBA 4MQLA 2HX1A 4H15A 1JKJB 3RF2A 1Y1LA 2IEZA 3NDPA 1O6FA 5F3RA 4LA4A 3SXJA 1K7EB 3H40A 4D43A 5DM0A 4L9SA 3DR5A 1TKRA 2PZMA 3EGDB 4XASA 1UIRA 1CRLA 3TKLA 3IR6A 1A2BA 4Q9NA 3OLYA 4EYKA 3N28A 2DQKA 3Q40A 4FQ5A 1UF9A 4H6XA 4II3A 3AL3A 4M0PA 4EPTA 3TX6A 4WKBA 1CHDA 4RJLA 5E7JA 2VZ9A 5HILA 4L7QA 3EXHA 4K7JA 4CODB 2P90A 4DA4A 2RC6A 3E4DA 2R7KA 4LK3A 5EE5B 1L5SA 3R40A 4E21A 3IQZA 1IFXA 5BNWA 1C9JA 2P67A 2ATXA 1ANKA 2ZJAA 3RKUA 3HWWA 2XPCA 4L02A 1PZXA 2VNHA 2ZS7A 5HGXA 4B3MH 1PCXA 2B9EA 3HYNA 1UC5B 4OGLA 3I83A 3PIDA 5HS4A 5MHTA 1T9GR 5AUOB 1NJ1A 2PT5A 4ZI3A 2W2TA 3E3LA 2XTZA 2C31A 4ZOEA 1IHOA 2HTEA 4I3HA 5BSGA 3BCRA 5HZHA 2EC5A 2F17A 3SSAA 1P1FA 1Z8HA 2V4ZA 4R05A 4Y2QA 4P7KA 4HEA1 1ZGHA 2QPLA 1FFXB 4CQMA 1GHTA 2ID7A 4OJQA 1DAOA 3R3HA 1YL6A 2AVDA 4UPEA 3GFSA 4EWLA 2DPJA 1YJ5A 4G5GA 4UPVA 5K0EA 4AO6A 4BGEA 2NP6A 1FY2A 2E4AA 4WK6A 3HDQA 3SPXA 4A0RA 4PYLA 4K9PA 5K3DA 3PW0A 1AO0A 4PNZA 1CHNA 2QMZA 4ZTBA 3U3OA 1NJ6A 2ERCA 4IIHA 5KYYA 4P53A 3C7AA 3II6X 4E70A 2IZ0A 2YYYA 4WZBB 3OJCA 4OIFA 3CH5A 1WXIA 4JSTA 3U7QB 4EKGA 4M0CA 2AG0A 4XW2A 1XZIA 3H87A 5JCJD 1HT0A 2C98A 1A8IA 1RAEA 1E4EA 1RWQA 4MQ4A 3HN6A 4Q00A 4RPGA 3A6DA 1E0KA 4QWWA 3DV0A 4LHVA 4RQUA 4TXHA 5AESA 1H2ZA 1VA4A 1ZI8A 2VPTA 1W0CA 1XVUA 1ZH0A 3EISA 2H2GA 2JD1A 3B1ZA 3MLEA 3N40P 3RRFA 4PQYA 1D2RA 2OHXA 4N7MA 3C3KA 4LJSA 1P7YA 4MP6A 3FOCA 1MAHA 4ZYZA 2V7EA 3Q9SA 3ZDXB 1J5XA 1E77A 1UK7A 2BLLA 2PS1A 5FBHA 2PMFA 3TW8A 5EWLB 5I4IA 3KDPA 3D7LA 2IBTA 3LY7A 5GWXA 4UBOA 2QX7A 2R8KA 4HV4A 1I1NA 5K6TA 2YASA 4WHMA 2LDXA 2W2PA 3IE2A 3ADBA 4GYJA 3IEVA 3M0EA 2HMSA 2FEPA 4IRDA 3EEQA 5BT8A 1GXSB 4FHDA 4CMGA 1U1EA 1XHFA 3OJ0A 3EQ8A 4Z6KA 2QE7D 4H0CA 2CXXA 2FVXA 2JGJA 3OPMA 5FA8A 3VTFA 4E22A 2WFAA 2WWXA 3PNQA 4GL2A 3LVRE 4Y2YA 1SB8A 1NXSA 4UUAA 4ZYWA 4JKIA 4XI9A 1KO5A 1QANA 3Q2IA 3S2EA 1TWFA 4G89A 1L8XA 4K88A 3H4DA 4PS1A 2ZS9A 1II8B 4HH1A 4PQEA 4RBNA 4R0VA 5AOAA 1JXLA 2HBRA 2P1DA 4KN8A 4L0DA 3QA3E 1TWCA 1VGRA 2OO7A 4HGQA 1XDZA 5D86A 4DAOA 1T2VA 3MTGA 1R18A 2PKCA 2VZ8A 3FRHA 4LNAA 4A2QA 3ML1A 4HL6A 2BFCB 1CUFA 4M9CA 4XWAA 3VVBA 2GXUA 2QLTA 4FFBA 5JAMA 3C3WA 3DMPA 2XITA 5YASA 4GF5A 5F1PA 3HNOA 3PFFA 1V3UA 1WCIA 1ZH8A 3AQIA 4F38A 5LOVA 2YRXA 5DQGA 2R8ZA 4MQFB 4BX9A 4Y0AA 5ALFA 1G9TA 1RAGA 3G0OA 4M0FA 3KP1A 5I9TA 4NH0A 3T0IA 1VP9A 1XNRH 3GV0A 1TM5E 4DCOA 3AVVA 1XZHA 3GD7A 2J07A 3RANA 5TMPA 3DLBA 2BJVA 2O52A 2I2AA 4C4YA 2R751 2YY5A 3GRRA 5FPSA 4DEVA 2JLRA 3RC3A 4G0WA 2PRKA 4DMHA 1ZOLA 5A5EA 1EAMA 2O0MA 1X70A 1Q57A 3TZQA 5DNCA 1Z74A 4DQKA 2D5IA 1Q2UA 2J3QA 4KZKA 3WWHA 1IE3A 2DU8A 2FFJA 3QLVA 4L74A 5U9CA 2GEJA 5GIPE 2ZZKA 1HBJA 1NU8A 3GRVA 2C7GA 3C2QA 4MGEA 2HO5A 2BKXA 3S2SA 1YRQA 4JI1B 4GMHA 4BLTA 4R1OA 3RFVA 4CCYB 4TMWA 2Q0SA 2F00A 4EFEA 4ZO6A 1DKOA 5NULA 4FFRA 1VLZA 3DTVD 3ZWWA 3YASA 1P72A 3N2EA 4NNJA 1RM3A 4D41A 5I7WA 1SC1A 1S4MA 3OA0A 4GP9A 2W6ID 3KL4A 4JOQA 4C0BA 4LI3X 4W7HA 1XQVA 5AVRA 1SIOA 1OILA 3COVA 3P4YA 2E5WA 2XCAA 3DMTC 3SZRA 5MGBA 1H2AS 1VHDA 2QRJA 1XMJA 2E48A 1T4GA 1H3FA 1WQ1R 4IXTA 4KXFB 3W5BA 5FD8A 2EJWA 5K8CA 3DEIA 3V6KA 3M83A 4R2WA 3AR3A 4IHJA 2FK2A 1FC0A 2VNIA 4UCUA 4EATA 5JS2A 1VBMA 4BPBA 5FADA 1Q5PA 2RB4A 3QMVA 4KYIB 4C0LA 4M86A 3LY8A 4MRNA 4GBED 4RZXA 3AX6A 1P2UA 2MSCB 4RFVA 1VFNA 4WPGA 3DHVA 3W8RA 4S0XA 3WTBA 4BJ5A 1L5RA 3G9ZA 1GUAA 3B1WA 5LVAA 4E5MA 3G2HA 4L6IA 4N49A 5HKKD 1WXXA 3SBDA 3ZLTA 1V51A 2VHJA 5MN5A 5JMOA 4L4SA 4YAKB 2G4LA 1I2AA 2EDCA 2EHJA 1E6CA 2BGRA 1RLOA 2OHVA 4PRZA 3OAAA 4DY4A 3MG9A 1N78A 3DXZA 3L7MA 4DAAA 1FYVA 3PDIB 4Q37A 1VPEA 1WXQA 4REOA 3E15A 2Z56A 4FINA 3G59A 1N3IA 1T9GS 2R8XA 3IQFA 2VYND 3PC4A 4F4HA 4I9FA 3TY9A 1J0DA 2C8JA 3MINB 1Z7GA 2XZTA 5FEUA 1HNWH 4MKZA 2QTCA 2PE5A 1G291 3ZV4A 3KQMA 1V37A 2AJ8A 3PXBA 5AT1A 5HCIA 5EP4A 3O8DA 1RPTA 1FX1A 1Z38A 1SD5A 2FLKA 2LDBA 4YUWA 5IDVA 4CM7A 3WQQA 4WBSA 4AZ3A 1DAIA 3UMVA 5E0OA 2OP0A 1JHAA 3L6CA 1Y7IA 3LCMA 1AIPA 3HHEA 4IIBA 2G9VA 4UJ5A 1JVSA 4LFBH 4W9NA 4GOKA 5K0SA 1OT5A 2PX5A 4FFBB 1CQIB 2SICE 4NARA 1RZRA 2NZ8A 1XZPA 2H1LA 3CTMA 2BP7B 4LDZA 1BHO1 3CW9A 3P27A 521PA 3WV5A 3OQMA 4RK7A 2JLWA 1NYLA 2UYCA 3TNDA 4EJSA 4I6JA 2PUEA 3LO8A 4Q3EA 1X94A 3AJRA 3HJHA 3HSKA 4CIVA 2HKIA 5KZMB 3U4QA 5GJWC 2XADA 1PX0A 3M6LA 2GBGA 5BR4A 3IPRA 2X3YA 3TW6A 4NMMA 4J0MA 4RF3A 5EVCA 5HP4A 1X7XA 4HHEA 2GPWA 4KR2A 5JQGA 4F5ZA 3OFJA 4NEHB 3G2QA 1XNJA 3VFDA 4K87A 4LMRA 5TJHA 1KVQA 1PR4A 4L95C 3U3JA 4C06A 4D8XA 1QIIA 4YRMA 2OBNA 2O7QA 5DK4A 4F93B 4OQDA 3WMFA 3G8DA 1EQUA 3SQDA 5JAUA 1B00A 2VPIA 1NF2A 4OGGA 4PX2A 5CA1B 2L0XA 2QGZA 2FZCA 5CM0A 3AK4A 1U8CB 3A3PA 2B1JA 3NKVA 5KFXA 1WUJS 1L9KA 1K6MA 1S8FA 1KYIA 1MB4A 1O54A 2WICA 4LI0A 4F45A 1CDZA 2HHAA 2XGGA 2IYXA 1ZVMA 5IYBG 5KDLA 6NULA 3ZVLA 1JQ3A 3IUEA 3LGAA 4WAUA 2QRNA 5J2UB 3VDNB 1RYDA 1NHWA 1UBLS 3ITDA 4WTOA 3L0PA 3GFPA 3PQ8A 2O8VA 3HCWA 1Q7GA 3RS9A 3STTA 2IRWA 5DX8A 4EY7A 4O3SA 1Q7TA 3G49A 4MUMA 3LUKA 1NI4B 2XT9A 1M76A 1ST3A 2COUA 2IKSA 3G6YA 2QZSA 1FUYB 4HKTA 2MSWA 1GRRA 1WY7A 2W2XA 2W37A 2Y27A 2Z09A 3H5WA 2PMDA 3HUDA 5DLEA 5FYQA 3H0KA 1XZNA 1RC8A 2D2VA 5FPQA 4OU5A 5KX5A 5L3QA 3DE1X 4MV0A 5DBIA 2Z4TA 1MZPA 2NO4A 1BXZA 3B82A 3KYBA 4RKFA 5CLLA 4YC7A 4N47A 1H1LB 4XGIA 3K09A 3PYXA 5KDDA 4N9QA 4Y6OA 4YAKA 1KKMA 3J80A 2XOEA 1TPYA 3COPA 4XDHA 2IYZA 4XDYA 2ZRKA 4JGBA 4FDAA 1Y5RA 2IYWA 4GKAA 3A6PC 3L6EA 3CLTD 2HLNA 2XUPA 1GFZA 1YU9A 4CI9A 3IEIA 3IP1A 3F67A 2BMDA 5FLYA 4MP8A 3GA0A 3U7QA 3VSEA 5C8XA 1H8HD 3VSAA 4E3WA 3ESDA 4ASUA 1Y1VG 3LK6A 3NKFA 2LIVA 3PKZA 3HB9A 3THOA 1K6IA 2L2QA 4ARAA 4A0GA 4JL8A 1R9MA 3CEHA 2G0NA 2NNLD 1AUQA 2HYDA 3GR6A 3HWSA 1H1TA 4ALIA 1ZMXA 1EWVA 1Z15A 3MTIA 2ECQA 2PZJA 4MPRA 2XBMA 1A95A 3C14C 4X1IB 4ENRA 2UXCB 4DUYH 2VQ6A 2XE4A 1A0GA 3BFKA 4HSEA 4B3GA 5T4FA 1MLDA 4GGPA 1G2OA 1YQEA 2AEFA 1SC6A 1TFRA 1NAIA 4O4LB 5JQGF 3DVRX 2IW3A 3G6XA 1E7SA 3CIFA 3A2MA 5CFNA 1A0OA 4A92A 3KQTA 1MGPA 4HDRB 3HA5A 3VJRA 4KQMA 2HEIA 1SC3A 1UFKA 2QR5A 5B1DA 4MUNA 2TMDA 4I5FA 3BXZA 1Z6QA 4C7XA 3CN9A 2PGLA 3H13A 3UH1A 2BDTA 1DUSA 1W35A 3LBNA 3PEVA 5AJVB 4QRDA 4YXWA 1FW8A 4LUCA 1GRVA 3D7NA 1VI2A 1JQJC 2OHGA 1IOVA 1VC2A 4FUTA 1C8KA 1NV9A 5EJMA 4DG5A 4KVFA 3GPIA 1WCWA 3OLVA 3WMXA 4LFCH 1B1CA 4JLSA 1OIWA 2IY8A 1ZN7A 4OMCA 3QELA 2NAFA 4DLYA 1A0IA 5HF8A 1Y5NA 4JEHA 3IJPA 4FP9A 5AKKA 3R6DA 2PXCA 3KOWA 1SIUA 1RCUA 1HLFA 4WJZA 1XCLA 2QW8A 4L07A 4P3YA 3U5TA 4YHHB 3RJTA 2J31A 2WYWA 4LC1A 4MUGA 4OKIA 2I2DA 1YZ3A 4P32A 3CUSA 4LJAA 2P69A 2YZMA 4Q4DA 3RM3A 4YRSA 5BSHA 1X6VA 2YWVA 5CVEA 4BBAA 4FGSA 1F4VA 3O21A 2RKOA 2IZOA 2Q5OA 1UNNC 2FLWA 3G2JA 3NNNA 1TM3E 1WP4A 2FPPB 4M87A 2R84A 3UK6A 8MHTA 1UMBA 4EGQA 4I50F 1QO0A 2EJCA 2V9ZA 3Q3JB 4QG7A 3TRDA 1KTIA 1TECE 2VATA 4DUGD 2NZ2A 4M2LA 1E6LA 3GMSA 1G7SA 1L7PA 3HBMA 4JUAA 3VNUA 4OSPA 1G3QA 2P6PA 3T7CA 3HJRA 2CDRA 4QOGA 2VJDA 2YV1A 2WKWA 3IHKA 1C7FA 2C2YA 4HGOA 4H1HA 3RF7A 9MHTA 2AUTA 2JA1A 2G9QA 3M6VA 2JEGA 1GA1A 3Q7IA 3TQOA 1V95A 1N0VC 1KZGB 3ILVA 4N7JA 4C7KA 3S1SA 1C3OB 1Z47A 4L1KA 4NENA 2HK7A 3MFQA 1B4DA 2QN2A 3AWIA 3K1AB 2ZYHA 3D8RA 2XYRA 3DAGA 1CDDA 1PW5A 4HJRA 4N54A 1FJGB 3O2SB 2X8WA 3R0VA 2Z5VA 1JTVA 3I23A 4Y2UA 5GOTA 4UTVA 2Y1WA 4IXWA 1B6RA 4LPKA 4URYR 3SKYA 1P6XA 4QJFA 1FDVA 1HF3A 3AB8A 4FHEA 3SHQA 2HC9A 3C1AA 5ELLA 1I4DD 5E95A 3E7FA 5C4GB 2DFPA 2G83A 3C24A 2J4FA 3W06A 2ZRDA 3I1YA 3K0AA 2P1ZA 3D81A 3E2PA 5KAPA 1LFAA 1EM8A 2O5VA 1AO3A 4YV1A 5KQSA 3UV3A 1YOBA 1COZA 1P2TA 1IU9A 4A91A 4DWJA 5LU9A 1DINA 2FSIA 5G0VA 4KPFC 3ZH9B 3IOCA 2NVUA 1JAZA 4II7A 1DQNA 1NNSA 2BI8A 1QO0D 4OG2A 2EG9A 4F2WA 4ZK2A 1N9GA 4WINA 3I72A 4PIMA 5CLIA 1X8LA 5AHOA 5IAGA 5TT0A 3VPAA 2VJMA 3MEQA 4MVJM 3N44B 3S8YA 1IXRC 1RPAA 3BIWA 1ENOA 2JIZD 2Z2ZA 3IUPA 3QIAA 3GMIA 4HNAA 4MX8A 4HH0A 5CT9A 4C9BA 3QTLA 5AQ1A 1YJCA 1ENYA 2Q2QA 3FHCB 2X76A 1CUBA 3OCJA 3UANA 3U44B 1TZ2A 1OOEA 3CRMA 2ZDHA 1XRJA 2FX5A 3UJCA 5FNVF 3G7NA 4UTZA 5IKXA 3D2CA 4ND4A 3QFFA 1RM4A 5TT1A 4G0XA 3ASUA 3OZUA 3NMUF 2B2XA 4P0TA 5AW2A 2BFFB 1GCOA 1WMAA 4B48A 1JALA 3TLKA 2Y68A 1U0EA 1QFSA 2O20A 2V65A 3K70C 4X1YB 3MXTA 3RSFA 3QZ7A 4B3IA 3CUKA 2D1TA 4RIHA 4OQMA 4FFVA 4FEEA 4JUCA 3EPKA 3C74A 3ADCA 5IYDG 1YDGA 3PVSA 2BMAA 4G8DA 4NONA 4X1YA 2CKDA 5A06A 4MUYA 2E7ZA 4RPCA 4UXIA 1LDEA 2NZXA 3I2HA 2GJ4A 1WZCA 4RK1A 5B36A 3VYVA 5J2TA 3CVXA 5AO9A 3DL0A 2H57A 2O2XA 1GKUB 1MRNA 1XVIA 3WWOA 3BCUA 4UCWA 5JXWA 2P91A 2XRZA 2C4HA 2PUGA 2HWKA 1JEJA 3H6HA 3I9OA 3IVRA 3VZCA 2XYGA 3UFXA 1B0PA 5DTRA 1OFUA 1BJRE 1U1DA 2W9XA 3Q6IA 4GWGA 4DLLA 4YN3A 3OSUA 3SFVA 1HI9A 4JI8H 4DV4H 1KMCA 4DABA 4QUEA 3GIMA 4C03A 4Q4CA 3WQSB 4IGAA 4QU8A 3UO8B 3ZHSA 3GDEA 3FTDA 3B6JA 2ZUBA 3DFIA 5IYZA 5C8ZA 1WZ2A 2IH4A 3A9RA 4GO1A 4F3YA 3GYGA 4K40A 1A4IA 2R8BA 1SO8A 1K3UB 2V7QA 4Q1VA 4ZVRA 1PNVA 1AX9A 2CCKA 3PV0A 3I62A 1GKYA 1M5UA 3OLCX 1RI2A 4G2TA 2G67A 1NQTA 5DISB 3UOWA 4JJFA 5F77A 3KKNA 1P61B 5KFUA 4AY2A 3ZIAD 2O2YA 2CL0X 5F9MA 2W8LA 3WADA 1V71A 3G7UA 2DB3A 2HXGA 1T2UA 5E6SB 1LSSA 5BW8A 2JA5G 1Z7YA 2JHFA 3ENVA 4KUGA 4MW0A 1YR8A 5KOJA 1PGQA 1V6CA 5BWMA 2YMLA 1WVIA 4XR4A 5JHGB 3K8ZA 4MGKR 3HPRA 2GYYA 3COYA 4WZAB 3F8NA 4DV2H 3DHYA 2DR3A 3LKBA 5PNTA 1Z2NX 2H1SA 5IZCA 4GKKB 2Z8ZA 2TMKA 3ISJA 4QO7A 2ODNA 1TT7A 1ZVQA 3R4VA 4G2NA 4G9EA 1RPNA 4RGQA 5CPFA 4LF4H 3THWA 4RF5A 5EMNA 5ELXA 1JR3A 3TXXA 2ZUSA 1JLRA 2PDAA 1BKYA 2KX7A 2YINC 3PDHA 5AVUA 2QX6A 4QYSA 4TSKA 1Z7WA 3AEUA 2V6BA 4ZTUB 3DAAA 5FOTA 4IWYA 4F2DA 4YIHA 3OT1B 1P8AA 3ET5A 3FG9A 1YRHA 1UDBA 1B74A 3EG9A 1NYQA 1PNQA 3D7MA 5EWLA 3JWIA 1W1WA 2IDMA 4TT3A 3I9V1 1CZRA 4JBWA 3WFZA 5HNKA 3WK4A 1Y1WA 1JSCA 1V2GA 2WTAA 1KPGA 1TWHA 3IIEA 3PHBE 1VTKA 1S2LA 1TEHA 2W2KB 2NSHA 5LQJA 1YMUA 1JEEA 4P2GA 1QAOA 3BXEA 2YV5A 4QBFA 3ZG6A 3AXTA 3DYIA 4BVHA 3WO0A 4HDCA 5FWXB 4AUKA 4FE2A 1YJBA 1JHMA 2HNAA 4I1OA 5BYJA 1XK6A 1I7DA 3FNIA 1DLJA 3ZWKA 2VZ0A 4HGYA 4DJTA 3GNTA 4DMLA 5I4CA 1P6UA 2AEMA 4EHFA 3LKZA 3GTMA 3IAEA 4WKPA 3GNQA 3LULA 3UNXA 1XDGA 3H0GG 4GQIA 3GGOA 1DAHA 2YJ4A 5H3HA 4A3JG 2PZBA 1WU8A 3H75A 4NYJQ 3VVLA 1C3JA 2H5LA 1XTVA 1MX3A 5KJCA 4UM8B 4EYSA 2WSIA 4LX0A 3EASA 2EP7A 2P9EA 3DZ8A 4FNGA 4O7RA 5ECYA 3RTBA 4Z7JA 2B9VA 5FO1A 3FSJX 4QWAA 1NTOA 3FKSD 1LPSA 1WD7A 3TWOA 2P9YA 3GILA 3EIXA 3Q6NA 2DUWA 2HSWA 2FA9A 4S2EA 3NHZA 1QG0A 4X44A 2HMUA 1X7DA 1GARA 3EBLA 3TR6A 1Q1NA 4J0FA 4E2YA 3WGJA 3L2PA 4EQ5A 3FWNA 4Q6BA 2X6TA 1VIYA 2ONZA 4DEXA 5AVYA 3L7AA 1MC4A 4PGHA 2AMVA 3N8IA 1QGYA 3DLPX 4KPGA 4PSDA 1U5BA 2QYHA 1DZIA 4KQ2A 1RIIA 1DNPA 4R7GA 3D3KA 1I5RA 1NM5C 3GXBA 4GH5A 5DXFA 1N92A 5AM2A 3OZXA 4F96A 2VWGA 4G9GA 5IAAA 3GH3A 4CU5A 1FP2A 1VPLA 3HJNA 3DBVO 1QLWA 4MVYA 5T3UA 4EBFA 1UBMS 1WCMA 2AV6A 3HDJA 3HACA 2L19A 2BBWA 3VA7A 4M36A 1C0EA 2I6UA 1Y4ZA 3D4BA 3EGEA 1ND5A 3PXXA 1FDRA 1H6DA 1NBMA 5CT5A 3TZHA 2EJVA 1YR2A 3QOXA 5BR8H 3K0KA 1VYHA 3OUUA 3DDOA 4AZWA 1XU7A 3SX4A 2RGGA 5BWUA 3A9SA 3D8SA 3PGXA 3CS3A 1K1SA 4QX6A 2I3ZA 2CJXA 4RHYA 4EGSA 4UHHA 4C3UA 3CVWA 3SXUB 4V0ME 2BDEA 2LV8A 2NTVA 4OB8A 5FF9A 4BWYA 1V8BA 4B45A 3IHLA 3M9MB 4C6TB 1TU3A 5KREA 4MKGA 1J56A 1EVQA 1L4EA 5FCDA 2O8FA 3FCUB 3PD0A 1EFTA 2FYTA 3OWXA 1EGAA 2ZYGA 5IJZA 2PXAA 4Y2JA 1UAYA 3QEJA 5SYAA 5A4IS 4MV7A 2E5LH 2OUIA 1F51E 3S8MA 4CUJA 2OXRA 4E32A 3CKMA 4E31A 5ER9A 4ER5A 3C3MA 1DG9A 1MB0A 2D1RA 3FBWA 3LT5A 3OWOA 3OY7A 5T57A 3ZDFA 4EG3A 4X9XA 5KYWA 1NPYA 3A32A 2WE8A 1EFAA 2JHPA 3ROEA 3VO2A 3MWJA 3TTYA 4DLPA 3F9CA 2JVJA 1IM2A 5CEFA 4L75A 1G1MA 3P8ZA 5FLKA 4ARIA 2CFSA 4JC8A 3UK2A 4CIXA 4NZNA 3JZFA 1YNSA 2CKMA 3GRFA 4EB6B 1R0BA 2TMGA 3T4XA 3MLBA 4MW6A 3DBLA 2OD9A 1L7RA 1PFWA 3QE4A 1OR8A 3PNOA 5DM60 1KJYA 2PWZA 4EA7A 1GL7A 4WOCA 5E6UB 4CTKA 2V6MA 1CIPA 2IQ5A 3MQFA 4MRVA 4XUGB 4DTIA 1J8YF 3AILA 2HIXA 1H5QA 3QPWA 1L5OA 4JBNA 3NOXA 2OENG 3HZRA 1IBMH 1HLGA 1U28A 4MV3A 1VBKA 2A5YB 2C83A 3O0DA 3JVDA 3R0ZA 4K28A 4JBYA 2OFWA 3RYCB 4PZ0A 3FF1A 4TQ9A 4BNKA 2O1WA 3ABRB 4Q21A 4Y6RA 1NNEA 1F0YA 1U8FO 1IYZA 1AB5A 3CJQA 1XCOA 2B61A 2D5CA 1ZD2P 4WDQA 3ZHZA 2PO7A 4S04A 3PPYA 5AK5A 5B4UA 2VOJA 1Y6GA 3PTLA 4R5MA 4FS8A 1ILEA 4RTKA 5A9SA 4YAFA 2VZEA 3ZVNA 1N6HA 2ILVA 3GAAA 3VDRA 1BD4A 2ZIWB 2HK9A 5CFMA 3LD9A 1PD1A 3IAS1 3WRYA 4X94A 3UHAA 3U5ZB 4BPRA 2B35A 3UV7A 5LJIA 2CVQA 2IX9A 4JU8A 1NMEA 1CJKC 4WNIA 1EUDA 1TEVA 3G5TA 2ZE6A 2RHHA 2DZDA 1A50B 4G1EB 3Q10A 4OK3A 4R68A 5EJ6A 1SXIA 1J8VA 4OB6A 4EF6A 4L3OA 1X7HA 3GLFE 1YK0A 3RRXA 5GZ1A 1T6XA 3OQJA 3AFIA 4TVSA 1XALA 2AMLA 2OCXA 3L3BA 3ZBUA 3QFTA 5ES4B 1NRIA 3HLKA 4PCVA 5CGQB 3T1YH 5JAPA 4PXYA 3V2GA 2FK1A 2I2FA 4EA6A 1NUHA 1IATA 3C0FB 4YJ3F 2P9QA 3I8XA 4I1UA 3T1YB 1E4VA 2CVPA 3KVOA 3A3KA 1HETA 2FZLA 3U3DA 2B1QA 5H68A 1C3LA 1Z39A 1NBOA 2RGYA 2ZROA 3J81W 3CVJA 4RH0A 3EQ7A 4FDUA 4ZO8A 3FFTA 1E3MA 1GADO 4D8TA 2ARKA 1STOA 4RAZA 4CN9A 1JQ5A 1QKIA 1QQ5A 4MKRA 3N1UA 4MWBA 3U17A 4AZ0B 3MMPA 1VRCA 4PO9A 3PZBA 2HDKA 3DD5A 4TKUA 4BNGA 2J0QA 2CWWA 1SKYE 3MK31 4ZFNA 2B8WA 4ZVVA 3BAFA 1DWOA 3S1AB 4BJ1A 1FX0B 2XUGA 5JJLA 3GLGB 4YLEA 1OYWA 2VHEA 4QJIA 3P9PA 4XKJA 2XD9A 1PFUA 2YU9A 2YUIA 3S0JA 3W5IA 1HO3A 2W93A 3DBRB 3STHA 4LOAA 3WYCA 2WWVD 2FSVC 3DP9A 4MLDA 3MOIA 5THQA 1XELA 3ICVA 2AMYA 2FWIA 4N5DA 3ONDA 4D0LB 2W6OA 1VMDA 3EB9A 1H05A 1GVHA 4JMLA 4RVDA 1E5LA 2XNJA 4V0QA 3ELDA 3GEDA 1HTWA 1ORHA 2VK1A 3KPVA 3PT5A 1BA3A 4M55A 4D92A 1T2EA 5IX8A 1G8YA 2E1PA 5EIXA 3LJKA 1ZM7A 1ZUIA 4Y1RB 4QIHA 2K5UA 2OBYA 2OQ2A 3ED5A 1YGPA 4FYVA 2P5SA 1LXCA 4KXLA 2PUBA 1CXZA 4INJA 2OV2A 2O19A 1S0NA 1LD3A 5JS7A 2FFQA 4U7JA 2YOFA 1N36B 4NEGA 3BH7A 3SBOA 3VSBA 4AQDA 5LZ2A 2XB2A 4WCDA 1ZD5A 3V8QA 3DL2A 1UPFA 4XH9B 4I7HA 4BNJA 1UDXA 2PSHA 1RE1A 3R0IA 4G86A 4PS0A 3TGLA 1B8UA 4RUCA 3N41B 2CVOA 4O2AF 1RWMA 2HUNA 5L9XA 2QJRA 2VPZA 4LZWA 1VLLA 3EXFA 4I4TA 2H16A 1V1RA 5IF9A 4LZLA 4C7MA 5TQ2B 3U7EB 1XDBA 1E94E 3EXEB 3F6YA 4FDVA 4GM4A 2F3TA 2XMCA 4E33A 2FY8A 3U4IA 4X5OA 3W6OA 1TKBA 4OXIA 4OI2A 2UXDH 5JVDF 3KB8A 3KKQA 5FB3A 4RLHA 2PKRA 721PA 2XGJA 1N56A 1MNQA 3TG8A 3A4LA 2WF9A 2Y1LA 2ZWVA 2UUAH 3FYTA 3PWSA 2HBQA 3PGMA 5AI0A 1FLNA 3KJXA 4MYUA 3E3OA 4R1TA 4GR4A 2D0DA 4J16C 2XMGA 4KLNA 3EPGA 1T3GA 3RG8A 1A2KC 4ZRMA 1BU8A 2J67A 4B6OA 4JI7H 4L6AA 4P92A 1AK2A 1H6CA 3IIMA 4FLEA 1XX6A 4K6KA 3OD5A 4F7WA 3TUZC 4LMAA 1RQPA 4RZUA 5DI9A 3N2IA