1I7NA

Crystal structure analysis of the c domain of synapsin ii from rat brain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
KAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neuropeptide
molecule keywords SYNAPSIN II
publication title ATP Binding Independent of Metal Cations in Synapsin II
rcsb
source organism Rattus norvegicus
total genus 87
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1i7nA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1i7nA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i7nA02
1Z2PX 3V4SA 4M9CA 3RFCA 1DIKA 1KJ8A 3DF7A 2VR1A 3OUZA 3JRWA 1I7LA 1VBHA 2GQRA 1IOWA 4IWYA 2VPQA 3LWBA 4DIMA 1GSHA 4MA0A 5J2TF 1UC8A 2FB9A 4WD3A 3ETHA 4DLKA 2YYAA 2V5AA 4O82A 3OUUA 2IP4A 2WYOA 2W6QA 4FFPA 3VPBA 4FFNA 1W93A 2X0SA 2NU9B 2NU8B 3U54A 2V58A 2FP4B 1EUCB 3BG5A 1C3OA 2YS6A 2R7LA 1Z2NX 4C5BA 1EZ1A 3N6RA 1VBGA 2GQSA 2CZGA 2OLSA 4RZQA 5H80A 3I12A 3HB9A 5JVLA 4O7RA 1CE8A 2HJWA 3R5HA 2FPIB 3VMMA 5CB4F 3ORRA 5GONF 3GLKA 3Q2OA 2DWCA 2YZMA 4M9UA 4TV8F 4O7SA 3JZFA 1KC7A 3K3PA 1KJ9A 2R7MA 4O2BF 4XYLB 2R82A 4YAKB 1I7NA 1IOVA 2YW2A 1M0TA 2ZDGA 3VPDA 4MV9A 2I87A 4O7YA 4ZHQF 1A9XA 3MWEA 4O4LF 5JH7F 4I55F 3WO1A 4HNUA 2V59A 2W70A 5LXTF 4EG0A 5D8DA 2PBZA 4O7TA 2NPOA 4YB8B 4IWXA 3K5HA 3UFXB 5CA0F 3ORQA 5KKNB 3Q1KA 3HO8A 3AX6A 2W6NA 3RUPA 4GGMX 4FFLA 2R84A 5K2MA 3HBLA 1AUXA 4MV4A 4TV9F 3BFPA 4MV7A 4NYEA 2NUAB 1C30A 4IZOA 3KAJA 1GLVA 4O4IF 2XCLA 5LA6F 3ETJA 4FE2A 3R9RA 4YBZB 4YAJB 5KX5F 2VHEA 2W6PA 3G8DA 2W6MA 1SCUB 1GGOA 1CQJB 5LP6F 2YRXA 1B6SA 3NUAA 4O2AF 4L1KA 2PN1A 1W96A 3KAKA 1KBLA 5EZYF 3WO0A 2YZNA 4HQ6A 4O7WA 3VA7A 2YZLA 3WNZA 3TIIA 1EHIA 3JRXA 4EA8A 2Z02A 4TUYF 3E5NA 1EUDB 1OBGA 4MA5A 3R5XA 3R5FA 5I47A 1EYZA 1M0WA 2YS7A 4I4TF 4IHJF 2R87A 4IIJF 3KREA 5DMXA 2CQYA 4YJ3F 2R85A 4O7LA 2W71A 2FPPB 4FFOA 2GPSA 5CAEB 4FU0A 2VQDA 3BSYA 3K5IA 4O84A 4FGRA 5CA1F 2J9GA 2ZDQA 1T36A 2PVPA 1JDEA 1KUTA 1KJJA 3RV3A 4C5CA 5JQWA 1KEEA 4C5AA 4E4TA 2CNQA 4O86A 1JDBB 2QK4A 2YL2A 2YRWA 1BNCA 2R6FA 4O81A 2DLNA 1DV2A 4XZ3B 4EA7A 4WBNF 4MV6A 4O7ZA 1AUVA 5HBRB 1OBDA 4MAMA 4O4HF 5FNVF 4FFMA 3TW6A 4MV8A 5BPHA 4MV1A 4ZQIA 5JVDF 5LOVF 1E4EA 2W6OA 2FPGB 1A48A 1JKJB 1PX2A 4Y8VB 3RV4A 5JQGF 1CQIB 3JZIA 1PK8A 1KJIA 2YZGA 3MWDA 3GIDA 5BMVF 4O7VA 4ZOLF 1GSAA 4EAAA 4FFRA 3G8CA 2I8CA 1KJQA 2CNVA 4XYMB 4EGQA 3SE7A 4ZI7F 1B6RA 4O7NA 3VOTA 4YJ2F 3BSSA 1CS0A 2GPWA 3U9SA 2NU7B 4J6EA 4MV3A 3V4ZA 3TQTA 2DIKA 5C8YF 5IYZF 2DZDA 4EABA 5BPFA 2R86A 4I50F 1GSOA 3MJFA 3TINA 1DV1A 2CNUA 5C1PA 2P0AA 1UC9A 5C1OA 4O83A 1Z2OX 3U55A 4HR7A 3R23A 5LYJF 2YWVA 3VPCA 4M99A 3LP8A 1VKZA 1M6VA 4M98A 2HGSA 5J2UF 2QF7A 3TIGA 2I80A 4HNVA 2Z04A 4EA9A 2SCUB 4HNTA 2W6ZA 1E4EB 2C00A 3N8DA 2R7KA 4ME6A 3U9TA 4XX0B 1WR2A 1JLLB 3AW8A 3BSWA 4EGJA 2NU6B 2GLTA 1ULZA 2XD4A 2ZDHA 2R7NA 1BXRA 3KALA 4QSHA 4O4JF 3QFFA 5HV6A
chains in the Genus database with same CATH superfamily
4RH3A 2OWEA 1F38A 3RLFA 2NSLA 1Q0RA 4G0WA 1VBHA 3DFUA 3OJXA 2GYVA 2WJJA 1FQKA 1O87A 2R6HA 1H1TA 1V5FA 3OHSX 1ORVA 4BP3A 4R84A 5CR9A 1I6UA 2C94A 2X15A 1M2EA 1I3LA 3N0RA 1UKCA 3AWDA 5JZVA 1E99A 3FDXA 1UK9A 1YI8A 3C2QA 2GN6A 1U8EA 1ZK3A 3SYKA 1E6UA 3FNQA 4TSKA 4I7EA 4B3RB 2BSQA 3HB9A 4IDAA 2V9CA 2WFZA 4ZJYA 5IAKA 3CSSA 3G9UA 4BQFA 3L8GA 1E63A 5SZJA 2WUGA 5KNBH 4QWWA 5ULLA 3RVOA 4TV8F 1PSDA 1BYIA 1XLTA 4BNUA 2FW9A 5CURA 1R00A 3T4XA 3ZEIA 4DS3A 2D4HA 2VWHA 2IZ5A 1Y9ZA 4F3CA 1Q44A 2IGBA 4LMPA 3WDSA 4ASUD 3ADDA 2N75A 4C0BA 1EKPA 3ZU6A 2AMLA 1D2HA 1ZRMA 1B0AA 2JDIA 1KY5A 1A7UA 2O1XA 2WTEA 2Q2WA 5T7BA 3ZGVA 1VSBA 1BH2A 2GBCA 1RWNA 3F90A 3KJGA 2DG2A 1F8FA 3MTGA 1E5TA 4GH5A 4DV3H 5E7JA 4V3CA 4KZKA 5IT5A 3U5TA 1LTHR 9ATCA 3OM8A 1U3FA 2YV3A 3Q41A 3LDFA 1DAHA 1GNTA 2FSUA 4HN4B 3THXB 3DBVO 3FNFA 3L6UA 2IYXA 1OBOA 3S7ZA 4KQFA 1PQ4A 2F1OA 3PEWA 5LQRA 4J2OA 1VI5A 1UANA 2QTVA 4DKXA 5EHGA 1GDHA 2QN1A 3WHLA 4WFQA 4BVGA 1YASA 4R8LA 1A8IA 4QDXA 4GUAA 3ANNA 1JBQA 2XRMA 1VE6A 3BDIA 3N41B 1NURA 5BN3A 3O6VA 2EW8A 3I9FA 3EGDB 1R8YA 4YUWA 2VHYA 2R6R1 2OG1A 2VYVD 1TKAA 1N9ZA 4AU1A 2HWWA 1E9EA 4P6VF 4JX9A 5JJIA 4ZC8A 5FUBA 1QUFA 4MAMA 4NBKA 4KMMA 1B74A 1GT91 2XTMA 5A4JA 1KY4A 2QX4A 2VQSA 5I5UA 5ECDA 4FYKA 1KR2A 1YBFA 2QLNA 1T4DA 1MTOA 2H7VA 4C2BA 4US0R 5D5HA 3W4IA 1CS0B 3OX1A 2VCEA 5EINA 1UZAA 4TKZA 4D9JA 4MUIA 3HKZA 1K66A 2WHEA 5BYJA 3K70C 3ZJUA 1Y5MA 3B82A 2YYSA 2E87A 3E0XA 3GLSA 4RFLA 3EMVA 5B7GA 2C0CA 3CFYA 3JD0A 3R20A 4OUKX 1E1DA 3OZIA 1H1LB 3I4NG 3Q72A 4TYNA 2GZMA 4NV0A 4I55A 3O4IA 1WPQA 3OZGA 2FZCA 5F5XA 2WSLA 4GL2A 3EQZA 5CX1B 4BO0A 2IUUA 3AM5A 6AT1A 2ZSFA 3QU2A 10MHA 1B73A 4GBMA 4DGSA 5LYJF 4LTMA 3Q7IA 2P7HA 1XDSA 3VPCA 1AV6A 2AVNA 2HWKA 5TPWB 5B58C 2QTFA 3WGUA 3VGPA 2F1RA 3TMAA 1Z6QA 1A5SB 1MO5A 3F6EX 3UMMA 4KMRA 2C00A 2HSEA 3BSWA 3I04A 3RRZA 1A2BA 2QTLA 1YDHA 4MLZA 2Q5LA 4QICA 5EZYB 4V1CI 3GNTA 1VSUA 3OFNA 3V4PB 5MFPA 2RAVA 4MR8B 3HOUG 3DOJA 4ZVSA 3SFZA 2Q3JA 3AYHB 1I2KA 2QE7A 4DV4B 3HDVA 5JZSA 3KQWA 2RHMA 1TTPB 1A8HA 3IUMA 3M6FA 2LIPA 4RS3A 4MULA 4ZVTA 4KQEA 4Z4HA 1BU5A 3B1VA 3RSQA 5FAXA 1W4CA 1XK7A 1A4IA 1GGMA 2UYGA 1U1EA 2B8JA 3HYRA 3FGPA 1DFGA 4ZCSA 4IRCA 1EDBA 4HXGA 4R81A 3S2ZA 3LV8A 3V1LA 3RJZA 2RHTA 3CGGA 4NP6A 3H7AA 3U3DA 4E0BA 3RS2A 3WHPA 1OAOA 4UBOA 2E82A 2FWRA 3GFPA 2ZYWX 1TCVA 3G2PA 5C32A 1LPAB 3IODA 4MWBA 3HVJA 3IBCA 3N2ZB 3IE1A 2R7AA 4XM2A 1UMBB 1T3NA 5HQJA 1L9KA 1HETA 4IFBA 3E3LA 3PP8A 3S2FA 4C22A 2JI9A 5CNIA 1NYTA 5BMVB 3LECA 2WNIA 1GLNA 2BGMA 3D7KA 4ZI7B 1P4AA 4MCIA 1PD0A 1XZCA 2IA5A 1TQ8A 2H57A 4JI5H 2A6PA 1I24A 5DCLA 1KJNA 1XRJA 3T7DA 1D0IA 4G4SO 5LZ9A 3PUKA 3HI6A 5IJAA 4GLXA 2A86A 5KQMA 5TLSA 4DR3B 3BWEA 3PI6A 4DFDA 3KQTA 1MG0A 2ZVJA 3LT0A 3ICWA 3PD0A 1NR7A 4ZCRA 2HLDA 5DYTA 1Y1PA 5H7XA 2FZEA 2PGIA 4WH0A 4L57A 1Y7HA 1W88A 3V6HA 1XDZA 5CTJA 3ZU5A 4BQQA 4QDKA 5FKJA 2NZWA 3ZLBA 4RADA 1WXFA 3B5JA 2GFHA 4QECA 3H04A 3VH3A 4TL6A 2O4CA 3GLGE 4OI2A 1I14A 4JASB 4K7JA 1T5LA 3VBCA 1AKWA 4HRVA 5EL0A 2QM8A 3SS7X 5A0FA 2XRFA 3DD1A 3CA8A 1J9EA 1D4ZA 4QGBA 4Q19A 5JY6A 5DYIA 2PPVA 3P4UA 2RH5A 3SX4A 5EPEA 3EH1A 4YGYA 4BQSA 3MHPA 3E84A 1Z37A 3ZXXA 1S97A 4OK6A 4H27A 4PSDA 4XJTA 3CRMA 3GL9A 4RHCA 3MR5A 4G0PA 2CLFB 2EX1A 2OBMA 2PA3A 2HBYA 3L0SA 4LDJA 3ZWWA 4F3YA 3EZLA 5ICSA 1GSAA 2WQ6A 5TMBA 5I6DA 1ABFA 3MTIA 1WHTB 1FLAA 2GN8A 4OSOA 3W79A 4H6XA 3BJIC 9LDBA 3ZCTA 4CMDA 4CODB 3ZS8A 2ET6A 3ER6A 4IQ8A 3SS8A 3PICA 1OIWA 2EATA 3CLTD 4JSRA 4PG7A 1FQWA 2IDMA 1N5MA 4Z4FA 1EFRA 3DZKA 3H11A 3M6VA 1FQJA 2R8PA 2PE5A 2ASVA 2J3KA 5K09A 3NGXA 3T06B 4OPMA 1LBIA 1ADJA 2V6JA 1TMOA 4WLFA 4DR1H 4I50F 1RJPA 1XZPA 3GJ5A 1BHO1 1CFZA 5I9TA 4A5OA 2VDRB 4AI6A 1U1GA 1R8JA 1J0BA 5JO9A 1NXTA 4HR7A 3X1MA 4M99A 2MSWA 2AN5A 4DJFC 1SB9A 4ZALA 2J7PA 4UJ3A 4N8SA 1Y6GA 4R1PA 3OQHA 1DADA 5KYVA 1RQ7A 3VNAA 1XMIA 4TTRA 3X43A 2IIQA 3R4VA 4XX0B 3CRZA 2ZT8A 4QVKA 1ZINA 2VT2A 2JVIA 4LWQA 5CLLA 2P9EA 1BXRA 4PO3X 1HZZC 4PN7A 1W29A 3ZUPA 3V4SA 3LX4A 2WTBA 5CEJA 3OF3A 4HDKA 3LRXA 5CW2A 4D9NA 4ARCA 4JYPA 4Q0MA 1F0KA 3LWBA 4YP9A 2B99A 3GT0A 1XN4A 1TAQA 4AJ1A 1RM5A 4MPJA 2PJUA 4AAYA 3P20A 2FZLA 3CY6A 4UBLA 1W36B 1R6TA 1PU2A 1YL6A 5B6IA 3P45A 4C5BA 2Y0BA 1ZK4A 3SHFA 5AI8A 4CMBA 4ECEA 3PYMA 1KHHA 4P81A 1S9DA 5A7GA 4RC9A 1KO5A 1R4AA 5KYGA 4WSOA 1QFXA 5DDIP 1DS6A 4R1OA 3PWKA 3S4YA 1KZ9A 2IYNA 2VPTA 3ZXUB 2Y93A 4PHTA 4YO7A 3GFBA 4L4YA 4WXYB 4N76A 5HE8A 1SG6A 1IM5A 4NZ9A 3L7DA 2QD4A 1IRXA 4M0LA 2PIAA 2GXSA 4AO8A 2ZJZA 4LCBA 4D3YA 4IMJB 1IU9A 4R3WA 1A88A 4A5SA 3TS1A 2XF8A 5BNZA 3H97A 1X3LA 4ZAWA 1GG8A 5E0OA 2EXXA 2ZUUA 1TKBA 2GF0A 1GPH1 4V0RA 1E94E 1SC9A 3CLHA 4LVCA 1RMQA 1UP4A 1VE3A 5CYFA 4G67A 5D3ZA 1MV5A 1PSZA 2H0QA 4ND8B 4JVSB 4HXFB 3J7AK 1TEZA 16PKA 2I5PO 2X6TA 2P9QA 2IA6A 2WW8A 3S68A 4EY4A 4YY3H 2MIIA 2WZBA 1GWNA 2VNJA 1QCDA 4N0EA 1HE4A 4HQ6A 4MV5A 1D3AA 4FYVA 2VYQA 4KSYA 2IYLD 2VRWA 4PS1A 3U44B 4C0SA 2A1UB 3QBEA 1OBHA 3JWHA 3HFRA 3FDIA 1G3RA 2Y77A 4IDCA 1IYEA 4F04A 1A96A 1LPSA 4D56A 1KVSA 1JG4A 2ONKA 3I8OA 3F5SA 1MENA 1QFJA 1Q84A 2X9VA 1JYFA 1B76A 4UXIA 4RYDA 4ZT2A 4WI1A 3JR3A 3F5MA 3VR6A 4LJKA 2ZRFA 1ZA1A 3V6JA 3CX3A 4R8VA 1POXA 5JC8A 1SZPA 1BCRB 3A1UA 4P7KA 3OLZA 3KSUA 3VKUA 4WBNF 1CQZA 1DKQA 4B4VA 5TQ2B 4DNQA 1UZUA 2G5TA 3EZGA 1YV9A 1RQPA 2RB5A 2GQ0A 2YNMC 1UODA 2KHZA 1IBKH 5AHWA 5L1KA 3UT6A 4WCDA 2A9KA 5J59A 2QZJA 4GZLA 1TYCA 4HLCA 3B9BA 3JQ7A 3I3SR 4IV5A 4CQJA 5D1OB 2JKVA 2QX6A 5BNTA 1EZ4A 4MCAA 1I4DD 2A0WA 2GHTA 4WOBA 4BO3A 1II8A 1GFWA 3BEDA 3K4PA 1W5TA 2WYHA 5C3UA 2KPOA 4QA9A 4AY5A 2W2KA 1T8PA 4C9BA 3EPKA 1TZ2A 3GO4A 5C8YF 5IH7A 4O8CA 1QHIA 3FCCA 2EJBA 4EYIB 4PIMA 4JNKA 2I34A 2QMUA 3EQ8A 4G41A 3A9CA 4XDZA 2OBXA 1EVKA 4BBSG 4JI8H 1NSYA 3PXGA 3OJFA 2JRCA 1K6IA 3DOOA 1V43A 1VS0A 3BGVA 2WJGA 5GJWC 1R0WA 1RPTA 3DV0B 5KX5B 1YS9A 1EEXB 2BV3A 1H1DA 3QE4A 4UTRA 1X9NA 3SD7A 4CYMA 1LU9A 1NNEA 2X19A 4IXNA 2FN4A 5ALPA 5KEIA 2C2XA 2OHOA 4MUHA 3QA3E 2IXFA 4ON9A 4UD2A 2P41A 3DL0A 4H1WA 4BFXA 2CJWA 2YY5A 1Y8CA 4LVNA 3Q8QB 2AOUA 3CH5A 4YRBA 2CLCX 2HIVA 2G9ZA 3BAAA 1DEAA 1GZ3A 5IBPA 4XX1A 2NU9B 3PS9A 4C07A 3FZNA 4KQKA 3CEMA 2XJ4A 3AF1A 2H7YA 3ZH2A 4FZ5A 1S6YA 1JEQB 2AT1A 1NYLA 1C3XA 1T1GA 1FFGA 4M7RA 1Z5ZA 1PFYA 4KR3A 2E21A 1GPJA 2IPOA 2E7ZA 3MCVA 3N07A 1ULTA 2Y99A 1SH7A 3HZZA 3AKEA 3GLKA 5J4LA 4JLVA 2FUNB 4QDUA 4HG2A 4XQ0A 1CC1S 2NUPB 2IOHA 5A03A 5JDCA 4P34A 4Y6OA 1XHFA 3OICA 4MO2A 4HGRA 4JLWA 2COGA 1GAEO 1K6MA 3FW1A 3PYXA 4KQHA 4E5VA 2ODEA 1IATA 1JEDA 4UNIA 3ROKA 4Q3EA 3CRRA 1LS6A 1KTIA 221PA 1HLPA 2D8AA 2QGZA 2Y1KA 4Z9FA 2FVYA 1K1EA 2J9XB 3SC3A 3N6XA 3RVKA 4J4BA 5J1TB 1KZHA 1ECPA 3ND9A 4L7QA 2BQUA 4QBIA 4RDHA 1AN7A 3H8VA 3HRIA 5ESRA 2B8TA 3D4LA 5D2CA 3SXUA 4PX9A 4TMTA 5DCYA 2XADA 4PZ7A 4EHLA 3PCXA 3MSXA 4C2UA 5REQA 4PNEA 1T8WA 4R54A 5HTKA 2XGOA 2XNDD 4Z7JA 2QLBA 1Q7GA 4EZBA 4GVXA 1NJ8A 3ZWAA 3GCDA 3NWJA 1P62B 2OESA 1T5SA 5DMXA 2QMQA 2JGIA 1W2WB 1RU3A 4XD2A 2R8EA 3RSOA 3OCVA 3DVSX 4XIJA 4O25A 3SOZA 2N47A 4IG9A 1U2GC 4D79A 4IAJA 2PVPA 2C29D 4QG7A 2J6UA 4X63A 1OXTA 2QN8A 2AI2A 5BN4A 3D8SA 4CV0A 1XEXA 1WZ2A 4MVYA 1IDOA 1G16A 2CL0X 4IEFB 4XPIB 2WVGA 3ZJYA 2OO5C 3EPHA 2P30A 4TMKA 2O7NA 5BPHA 1GRVA 2DPHA 1Y89A 3NORA 1UKAA 3DGFC 3AI7A 4QUKA 2D62A 2E55A 3KQYA 2HVSA 1QG4A 3LIPA 4Y0VA 3MJVA 4KI7A 4DMGA 4X1YA 4BFLA 1WSWA 2NU6A 1R9GA 2WOOA 1GPLA 5GJCA 2R1TB 1N25A 4JC5A 2OQ2A 3ZIUA 2ZJ8A 3QOFA 5BWBA 2G80A 2Q1UA 1XYGA 1KP2A 1Y37A 3EN0A 4LZWA 4MUMA 4EGQA 1KOJA 2AN4A 3F46A 1XFDA 2I2BA 3RC1A 1A9QA 3VSAA 1PVVA 1U8ZA 3ZJVA 5JH7B 2VSXA 3NBYC 5HVNA 1KWGA 3TCKA 4D98A 1S2OA 1MW9X 2ZSBA 2C3OA 3PNOA 1Z4OA 2PDAA 3VUFA 3GIQA 4FNOA 2IUTA 1T2FA 3K94A 3RJMA 4GI5A 4R7RA 1TU4A 1ZVKA 5F7ZA 1FLDA 2BD0A 1NMQA 1WDMA 4CR8A 1JMVA 1AGPA 1R27A 3D2CA 3LHIA 3BIWA 3GCGA 1HDZA 3TIGA 1ZNXA 4GMFA 2NZ2A 3OA2A 4HEA6 3NT2A 1NJ5A 4ZPJA 2R5NA 3C7TA 2Q8NA 2QPLA 2ZRAA 3GLIB 1O5OA 4I9NA 3O90A 3V80A 1Z83A 4G56A 3TTVA 1KDZA 1SBYA 2Y9MB 2XUAA 3X1ZA 4RZHA 1TNDA 2XIQA 2W98A 4A8PA 2RCNA 4DTIA 1Z74A 4HV4A 1T5HX 3SE0A 2OHHA 3C3JA 3BRSA 4Z9AA 3TE7A 3ETHA 1EHYA 3KUUA 2GVZC 4S04A 4OI1A 4ZJUA 5E9QA 1OYVA 5L6LB 2EJ0A 3PDJA 4RVSA 3N5CA 5D5QA 1BAPA 5JZ9A 3OTIA 1Q1EA 1A8QA 3CNBA 2XGSA 2XB9A 1DP4A 2ZCVA 2JG3A 3N74A 1EFUA 1U0BB 3F5DA 5BSRA 4KO8A 3TJZA 4B75A 3IQGX 4LZNA 4Q4DA 1TU0A 3GPLA 4JI1B 4M1OA 3EC2A 2WWGA 1RRMA 1IOZA 4OX9Y 1QDLB 1FP6A 4UM9D 5L4SA 3NT4A 1QLHA 3UWSA 3AJ9A 2DH5A 1VYTA 3IT2A 1ZCJA 2O3UA 4Y6RA 1TM5E 3ME5A 3M9LA 1X8XA 2ONYA 4GBJA 1O3YA 4PINA 1Y6QA 1EFPA 1T3HA 3E18A 5EMHA 3HQ4O 2HG8A 1FFAA 4IDHA 1G5TA 1F2TB 2RGRA 2VBGA 1RR6A 2P1ZA 5GZ3A 1WTCA 4LGVA 5AO9A 1JH8A 4IWXA 3C24A 3I73A 2QE6A 3B7GA 3VKHA 1M2HA 2IEBA 3LVBA 5D1HA 2CXXA 1JFFB 2PKYX 3Q9UA 1NF2A 4GUDA 5FD8A 1W76A 3RSSA 4YMLA 4Q4JB 2OKGA 3J81k 2G9RA 3HP1A 3NVDA 3R9RA 4YALA 3T34A 1LDYA 3AFHA 2XA1A 4NOJA 2OB1A 4G1BA 4GLFA 1RMYA 3B2EA 4QW8A 1UPBA 4NYJQ 2HHHH 1HPLA 3A0UA 2QX7A 1VM6A 3GLVA 1RCFA 2YZLA 4S0ZA 3GJ4A 3MRTA 3ZWCA 4N9WA 4JCCA 3ZHOA 4PPFA 1KT8A 4LXYA 5ALLA 2J4CA 3I6QA 5AK6A 5KNDH 3B70A 2R8ZA 2Q29A 3AR6A 5IAAA 5K0FA 4EVIA 2FF5A 3IMFA 2ZT5A 5A3RA 4QE3A 5JUWA 1O97C 1Z5GA 1BROA 5ALXA 4FU0A 4R7TA 1PSWA 1Q0TA 2CWDA 3MJEA 1T4BA 2J9GA 1A4UA 2OD9A 2WU4A 3CX4A 1QUEA 3G6YA 2ZI5A 1DRKA 3PNKA 4MVJI 1YOVA 3HHPA 2ETVA 5LZ7A 3MWYW 4DRYA 5JU6A 3TY8A 2PUVA 1FUIA 1IQ0A 4PR3A 2V7UA 4M1EA 2Q4EA 3O92A 3HKDB 3CBGA 4KN9S 4KITB 4RD0A 1JHZA 1I1HA 1X8LA 3P26A 5EE5B 2AQIA 2OGUA 5ELXA 4UNRA 6ABPA 1VCOA 1KS9A 3HMKA 2P62A 3BFVA 1NLMA 3U56A 3RRFA 3MB5A 1F4PA 3ZHZA 4QREA 1X7DA 1OX4A 3DVAA 1ECFA 3DE0X 4JITA 4PYIA 4Y9SA 3QF7A 3A7EA 1CDDA 2DR0A 1XPUA 4MDEA 2WWTA 521PA 1V8OA 5IYDG 5CGQB 1FDTA 4DEXA 2HSDA 3W5BA 2N0SA 3KDPA 1KAQA 2BWJA 2JDID 4FR2A 1L7RA 3RVLA 5BR7A 1ZUNA 3GUZA 3GJXC 1KEEB 1I5OA 1G7TA 4KNWA 2MSDB 3ZS9A 2UUCH 5E3JA 2GH1A 2VL7A 3R23A 3QG5A 3U9LA 4JH0A 4HRAA 3UTDA 1VG9B 1YUNA 2PLRA 1XB2A 1QC5B 1LKZA 5D01A 5BV8A 1OFUX 4O4JF 3ANMA 1ZESA 4IOJA 2CV1A 3X2FA 1RVV1 4JT9A 3EH2A 4CT4B 2EYQA 4QOIA 5K8IA 1DMSA 2OBYA 4DC9A 1DBQA 2FSVA 2OLJA 3D6VA 2B3DA 5TGTA 5DXJA 2FB9A 4YUZA 1VHWA 4ND6A 2FUG6 2JHFA 2UYOA 1EE1A 3JQQA 3T94A 4FIDA 5CT5A 1OA0A 2W11A 5C5EA 4J0CA 3DNMA 2FZ5A 3MCTA 3GUYA 4LMAA 3KR0A 1EM8A 3DBIA 3TTXA 5F76A 2BFFA 3WIUA 5K0NA 3QLJA 2AU0A 2ZBVA 2YBEA 1TM3E 2PO5A 1G8MA 1TJ3A 1TGYA 3HZOA 3VVLA 1DARA 4AN0A 2PL5A 4BZQA 5K7SA 5K0ZA 3FAZA 1UPXA 3QLVC 3AR2A 3HCRA 2YWFA 5EDWA 4Y6LA 2C9CA 1XRSB 2Q7OE 3D5EA 4JXXA 2OGWA 2E4AA 4AVYA 2R1ZA 3RK0A 2N46A 2OB2A 1G5FA 4XYLB 1CX9B 4KV7A 1NM5A 2F59A 1CUVA 3QPWA 3FNGA 4BJ5A 1Z6GA 2Q3MA 3ND5A 3TXXA 2EX0A 4CG2A 3QX3A 2RFLA 1ADGA 5D85A 1HTTA 4DRXA 2IXDA 3GUUA 5FHQA 3O82A 1AQIA 3HDYA 4RNOA 4IQGA 3DEZA 4F45A 1SUSA 1HYGA 1XKQA 1PZEA 2YFQA 2PUEA 5FHRA 1RW4A 5CR5A 3O83A 5D3MA 4PRYA 4DCOA 2P3OA 1KAOA 1GKIA 3ZLVA 4R2JA 5IS2A 2YQ4A 3HR7A 3ZYZA 3K20A 1VPLA 5BN1A 3WICA 3IHKA 4RMNA 2A67A 1Z62A 2QP3A 1SUIA 4LYHA 3U17A 4BN4A 5LFAA 3N28A 4WUTA 1XEWX 3F6CA 4EDFA 3LYAA 5BNFA 2JLUA 5LQSA 2OXFA 2VUIB 2AN1A 1ZX1A 4Q9LA 2VWGA 5K0GA 1XNJA 1DIBA 1R5JA 4RDIA 3L7BA 4LDPA 5KHOC 3FCOA 2FKAA 2OV3A 1OJ7A 3IB6A 3OFND 3RYCA 4YJ3F 1GPWB 2R85A 4B87A 1QQ7A 1NV8A 3AP2A 5AVVA 5KYYB 3FPKA 4YJFA 2QE7D 4CKXA 1BOFA 3VI4B 4A8JC 1E7RA 1PT7A 3PCRB 4DM7A 3KQHA 4FGLA 1OB5A 2Q7XA 3DL7A 4Y9TA 3TFWA 4Q82A 4EJSC 4BKUA 4GU5A 4JQOA 4CR7A 4HS9A 4LOKA 1H2FA 1PK9A 3TRIA 5AUQA 2O23A 4TKUA 2QJFA 2AJBA 1JSCA 1I6WA 4I8DA 3C6QA 2C9BA 3L8EA 4WIAA 3SJAA 4LRQA 1UR5A 2YR0A 5DULA 2FXVA 4CEIB 1OLXA 3IUPA 1OBFO 1P8LA 3EE6A 2ZBPA 4RY0A 1C1YA 1YRLA 3N9IA 4R1NA 4C05A 2ZRQA 1XTQA 4EHDA 4C88A 3AY3A 3IAFA 2NT4A 1GTJ1 1R9NA 1M66A 4DIDA 2FSIA 1JXMA 3SBXA 2IOFA 2GPTA 2YJ5A 5HF9A 1X19A 4G5YA 3FFAA 4FDMA 1G0OA 3E15A 1H2WA 4A3DG 1N77A 1Y9EA 1V35A 1U8UA 1Y6JA 4AJHA 2XLCA 4DR7H 2X9NA 4XIIA 4BAUA 4QDZA 5DH9A 2F64A 1ODCA 4REOA 4NJOA 1GXSA 4LFAH 2X4GA 4GXRA 1NSTA 3ZWMA 2AXQA 4GPTA 2O0JA 4BJ6A 4B85A 3WBJA 4M86A 2XW6A 3W5CA 5J5VA 3LDGA 4XB2A 2CN1A 2PL9A 4LF7B 1R50A 2PT5A 1OH7A 4RGQA 4QRHA 3P9QA 4JIGA 4OCZA 5IJ0A 5FNVA 1QJ4A 1WMAA 1E62A 3WJ1A 3THRA 3CX7A 5JISA 4OMUA 1F14A 2Q4DA 1U8FO 4LYFA 3UH1A 3ZKWA 1GZUA 2HLDD 2OR3A 2WM8A 4BVHA 5KTPA 2CBGA 2EW1A 3I1FA 3D8BA 2GO1A 2RDIA 5PNTA 3OPYA 1H8HA 3BXGA 2ZU6A 4BWFB 2HIMA 4ITRC 3NYWA 4ZEMA 3EXIA 1HY3A 4KUEA 2OAGA 3QPDA 4YRNA 3DLHA 4UW9A 4HJRA 1NP7A 4IY1A 4LX0A 1PV2A 4EP1A 2UXDB 3RG2A 4UTOA 1HL7A 1S2IA 2VHZA 1U0RA 4N3GA 4JJZA 4OOFA 4D3FA 2FWAA 1ZI9A 3DHVA 4BVJA 4TL9A 3NJ4A 4QLAA 1AZWA 1GTZA 3ETCA 2VRBA 2CCGA 5TRTA 4A0RA 2HA5A 4ZV4A 3DFMA 3UAOA 4HUQA 3EGXA 4YJHA 5JVDB 2G77B 4J0EA 5FWXA 1ID8A 3P5BA 3NHLA 4RKRA 5CYGA 3FF4A 1JW9B 1KJ9A 5JMOA 1HE5A 4GYKA 1NXSA 1IXZA 3TTUA 3OHBA 2GZSA 1Z17A 3DEJA 3SIWA 3T7SA 1FP4B 3IPRA 2ODNA 1ML4A 2VJCA 3KM0A 1K98A 3ESXA 1VPWA 5LXTF 1B8PA 1XZDA 3P9IA 4QO7A 4URFA 4F4YA 1A69A 4FYXA 1BEUB 2E3JA 1QS0B 4BMXA 2WILA 2F4VB 3EIWA 1E2QA 3H1AA 3W1WA 3WKCA 3K0CA 2O7QA 2P2NA 1EFRD 2NW6A 1USGA 4TLEA 4MV7A 1OBCA 2FMKA 4UTXA 5T6BA 2AYXA 5E2BA 2LCQA 1IWBB 2RH9B 4UCRA 3MMXA 2I29A 3FVRA 1TVEA 4BNKA 4LNUA 1FFBA 4INZA 3PQ5A 1PGOA 1X8KA 2B69A 1LSOA 2BKEA 2IDZA 3BMCB 1B8OA 2FPLA 3MT7A 1G8PA 2AHRA 4PAOA 3OE1A 1M74A 3HDJA 4OQLA 4HQKA 1AG9A 1JHQA 1PJAA 2PTHA 2J7PD 1GFIA 4TQSA 3I64A 4C04A 1RJ9B 4KQMA 4BNMA 1RPJA 5IT9A 2PUFA 4X94A 4DL6A 1Z0FA 4ZAFA 2JFPA 4YCMA 4X1OA 5T41A 2PKEA 3ZV7A 5CE8A 3EG9A 4MWDA 4YRQA 1TQ2A 2PKQO 5AVOA 2AIRA 1J97A 4MQUA 3QY0A 2CQYA 4RVUA 3PIDA 4N12A 4DLPA 3KCQA 3NUZA 1PS0A 2AEMA 2VF2A 1V2GA 5J40A 1S8FA 1YF3A 2EDAA 1I9CA 3AP1A 5IWAB 3TSWA 3QOWA 2Y1FA 3LGAA 2SBTA 3N2NA 1EUYA 1Q5PA 3PR5B 2A57A 2CLDX 4G4GA 3ELUA 1E4FT 5KFQA 2Q9CA 1D9XA 1Z4QA 2VP6A 4NLLA 4MROA 2WHRA 5LP6B 1Y3HA 6REQA 1T6XA 3OQVA 5I7HA 3D6NB 2IH5A 1PLJA 1P6UA 3AHFA 2WY2D 2XYPA 1GG2A 4PZDA 1K0UA 3BBPA 1OLSA 5JQGF 2KLBA 4QOGA 2PX4A 4J0DA 1S8AA 1Z5WA 3RO7A 5JBNA 3DMTA 4UUQA 1B14A 3GIPA 2QA5A 5CYOA 3UKOA 1XF1A 2DTDA 1CJTC 5B7PA 4N01A 2XMCA 5LJLA 4Q3CA 3AEQA 1NIJA 4RUAA 4XOIA 4FI3C 3UQZA 4F4FA 3KUXA 2OY0A 5IG2A 1WZCA 1EP9A 2AGPA 2HY7A 2QVBA 5CA0B 3NBQA 2B21A 5BXYA 4FKMA 1SQ5A 3GVHA 1T43A 4JCOA 2BGUA 3KSAC 3S2UA 5A0VA 1PZNA 1T91A 3GZTB 5DNYB 3P0HA 3AU9A 4OBBA 1N48A 3ED5A 3GYGA 4F1KA 3HY4A 2ZB4A 5HF5A 4WNCA 4IZIA 3ULKA 3IL2A 1R5NA 3JQPA 2GEJA 5TQ0A 3W2IA 1MQSA 3CH4B 1ZKDA 4AYWA 2BFEB 4EX6A 3GLHA 3QFFA 4LY3A 3KXPA 5BN5A 1V8FA 5H3LA 1M1YA 4G9GA 3IJEB 4EKEA 1ZGGA 1SKBA 2VA2A 4ZVPA 2GQRA 3KSZO 4Y2TA 1T5BA 3C7CB 2HM7A 1VI2A 1UAYA 5B1IA 3MTQA 1GVHA 2FHSA 4AJPA 1UC8A 5J23A 1O9GA 4LF8H 3M6MD 1Z6ZA 3Q3CA 3NCHA 3U0VA 4XCQA 3AUFA 3LUDA 4REQA 4WXMA 3IS3A 1SVUA 1Y3CE 4GPAA 2GTHA 4MVJP 3VR6D 4I14A 1I4EB 1YVUA 4YHHB 2HA3A 1H4VB 4DBLE 2F8SA 3AONB 1SVOA 4DLBA 1G38A 2ZWIA 1U3WA 1U9CA 3UOAB 1EUCA 5IYBG 2G4VA 1A2OA 3OMWA 1T9GR 4KWCA 3N76A 2ZBUA 2GX6A 4ZANA 3IEKA 3TNFA 3RI3A 3G2IA 5KOHB 1OTYA 1P2TA 4BLTA 2FFJA 3FNHA 2AGVA 1P7PA 1Y82A 4QTXA 2GSDA 2FN8A 4KJXA 4PC7A 5AHRA 2J1LA 4P1ZA 3STYA 5JFTA 3P2YA 2GAOA 3KTAA 3QWFA 4BQRA 1QH9A 5BURA 1CY0A 3AETA 1QVVA 3HEBA 3BPSA 1SVSA 4NG5A 1OX6A 2W2LA 4GP7A 5TEWA 3L6DA 3CZPA 1Z6XA 2YWCA 2PUCA 3HXOA 4LZJA 4B6QA 2BI8A 4AG3A 5IARA 1PZFA 3GPCA 2G17A 1Z18A 4EY3A 4KNYA 2FG6C 3GRUA 2CEAA 5EN4A 1YVDA 5I7AA 2Q4BA 4O3NA 4MVXA 2AFIE 1CQJB 1THGA 4CCAA 3FLBA 3ND7A 4O2BB 5TJHA 2C8KA 4LN1A 3C3BA 1FDWA 4JGBA 4D42A 4RL4A 3RAJA 3LKZA 3D3EA 4FS1A 2HNAA 3X1JA 2LR0A 3JQFC 4MS4A 1YC5A 3AIKA 1J07A 2NNLD 3BXFA 4JDUA 1GA4A 3K70B 3EC1A 1AN9A 4EQZA 4HLUC 3H1EA 5BT9A 4D9CA 1NOJA 1JLRA 1IE3A 2B4TO 5I9MA 5F2OA 5LD2C 4A8TA 4MS1B 3KFLA 2WJ4A 4FEYA 1H0SA 3OT1B 4P84A 4EGSA 1RJWA 2VK8A 4WFJA 1TYAE 1TA0A 1U2DA 1E9SA 2NV0A 3FYDA 5KTNA 3H6HA 3TAUA 2J0VA 1IOLA 2NVBA 5KFBA 4ZXPA 2DUJA 1OI3A 2PRIA 1DCKA 4QC2A 4IM7A 4X61A 4LXUA 2VAMA 3IO3A 1PLLA 1XHEA 3PEVA 4R40A 4F2GA 1NTRA 2C8JA 4NIMA 4A2PA 1L5HA 2FWJA 1K75A 4O7VA 3M6UA 2CLKB 2I8CA 4REMA 5KQGA 3B6EA 4ILKA 1EWTA 1TIKA 1IBLH 1KP3A 5AXAA 2J08A 2AF3C 3QVOA 4EKDA 2UZ3A 3RRYA 4QXPA 5K0JA 4FBTA 3HJBA 2JAQA 3W06A 3A1CA 1T5OA 3A2KA 4EVSA 1JHOA 3RTAA 1IUOA 2O8EA 3PXXA 3L0ZA 5DNWA 2I91A 4BGEA 3M3DA 3U7FB 2UVQA 3IC5A 3KQUA 2BFCA 4R8MA 1B0UA 2AE1A 1D5WA 4QTUB 2DBQA 1E3WB 5K8UA 4I5DA 5MFZA 1R6VA 2I22A 2C2KA 4LQCA 4HPWA 1KKMA 3SQDA 2Q1YA 1Y14B 1FUUA 5KOIA 1LK5A 4URZR 5CH8A 1RQGA 3DFFA 1JVSA 5ALNA 1ZJ5A 3RPEA 4WY2A 4HRYA 1P2FA 3R3ZA 4G37A 5I4IA 1XD2B 2IYVA 4WZZA 4B4DA 1YJ5A 2VDMB 3P52A 5D1NA 4ARBA 3R9XB 2Q6IA 4TTIA 4I4LA 3DOCA 1RRFA 4ZPXA 3AKCA 4XOUA 3BF7A 4U7GA 4BMYA 3ROGA 5CLIA 2XLBA 4XWGA 3AVUA 5BVHA 1Y48E 4ML3A 1O94C 1ZM9A 2XGPA 5T14A 1IUNA 1X7XB 1RWOA 1RQRA 3W1EA 3RF7A 4RK0A 4MKFA 1NY5A 3N05A 1JWAB 1FX1A 1STOA 1M3SA 1VHDA 2II6A 1Y63A 2OZLA 2OMEA 5BSEA 1BEEA 2I55A 3CZRA 3SR0A 4P0QB 2JIRA 1ESNA 1YFJA 2EQ5A 3FF1A 4WNYA 1A77A 2WHQA 1NQOA 4OSEA 4MWSA 3IP5A 1F6DA 4W7IA 2W2NA 1TIPA 3AU8A 3M7IA 3G7SA 4FSXA 1M2WA 1EM6A 1TC1A 2CXRA 1KC7A 2ORIA 3E1SA 3KPJA 1DB3A 4TMYA 3N2GB 2IXEA 1WUHS 2ZGIA 3AGQA 2G0NA 3ETDA 4IVQA 4Y9RA 2UUOA 4MDHA 1YZQA 1BYUA 3I8XA 3HKZE 4RKEA 2ZAOA 1N36H 2ZJ0A 2CMFA 5FTMA 5K2MA 4DIFA 3PR2B 1L1EA 4UOZA 1XDNA 4QOHA 4GG1A 3NFYA 4PFQA 1HYBA 4H7PA 3DTYA 3UFXA 1P77A 4RPGA 3VTZA 1GR1A 2XMZA 5LA6F 3OTWA 3TBKA 1VE7A 3UK0A 1P0MA 1IZYA 1OMOA 3WMWA 4Z54A 3KLMX 4NKRA 2JFWA 4YT8A 4XD7A 5ALOA 3IBTA 4Q3KA 5F9NA 4V2IA 4J29A 3P9ZA 2VEDA 3R3XA 5AKGA 1FJ2A 1OT3A 5I9IA 4M76B 3ZCQA 2K6GA 4P4SA 2DQZA 4BKRA 1PFWA 2JGLA 2A5GA 1Z0SA 1R0YA 4EJ2A 3I4LA 3IYLW 2W7OA 3IAM6 5G53C 3DBRA 1UAGA 3RUIA 3WL3A 4QWBA 5P8WA 2EG5A 3W5SA 4F5WA 4Q24A 2GN9A 1YFKA 1M1XB 1UL1X 2UVRA 2PKQP 3WA7A 2GWRA 3WVNA 2GN2A 1REQA 2LCIA 2PR7A 3AFMA 1RYZA 4RVGA 4LOLA 1RACA 3Q8MA 1Q12A 4UXHA 2BUBA 2PZAA 4NWIA 3A1DA 5AW6A 2IX9A 4CMIB 3HJUA 4F6RA 5CAEA 1YZHA 1QR2A 5BQPA 2NUTA 4HDCA 4UD6A 2JK1A 4BNFA 1N2HA 1QBKC 4WZAB 3IA2A 1PS9A 3TVTA 1T2NA 3MILA 2IE0A 5KMGB 1X74A 2C7BA 3QWAA 1QYIA 3RS0A 1D8TA 3QZUA 4JUZA 4IR7A 1ZNQO 2DFPA 5BWMA 5FOVA 2P6NA 3CWZA 3WR5A 2O48X 3QF4A 4RVOA 3LDHA 4GKJB 3NRCA 3LLMA 3WIOA 2ZBGA 4RPHA 1P4HA 2YXPX 1E2EA 2R8OA 3UKDA 4I6GA 5G02A 5MGNA 3ISVA 4FC7A 4J9RA 2OGTA 2XNKA 4GGPA 3JWGA 1TZJA 3CLTC 4EUEA 2DC1A 4A4DA 2FUCA 1W94A 5F1KA 2VSNA 3NHMA 2G0AA 1AC5A 3ITDA 1YBVA 1H2BA 1FKAH 4NICA 1UKZA 2XDWA 4WX2B 2RGAA 1M6VB 2ZTVA 4DRZA 4E33A 5DBEX 4JYAB 3KXIA 2C04A 1NVEA 3FYUC 2A0XA 2J6IA 4C0HA 3NVMB 4P3OA 4JHXA 3UJPA 5GV7A 3B3FA 5LPNA 2DHQA 1Z28A 3TQHA 3WDKA 2NXNA 2X6RA 1DGSA 3F0TA 2ISCA 2WHPB 3O3MB 3FYUB 3R9WA 3D8UA 2JD0A 5EWJA 4R0MA 4AJOA 1H93A 3IUSA 2VG8A 5AI5A 3HYLA 2I2WA 5G4KA 1M73E 5KFGA 4M9CA 3UJNA 1G6KA 4PLPA 3HJGA 2ZWMA 5IJ9A 3AL3A 2Q2UA 3RC7A 3NJRA 1TMKA 1T9ZA 5IVDA 4M7EA 3JYLA 2EV9A 3UAZA 1W34A 4U7JA 4YJDA 1HT3A 2W2OA 2CYAA 4X62B 1MEOA 5JS7A 3MM4A 5DYWA 1SWVA 4JBNA 3ACCA 2XECA 4C0AC 3AJAA 3N0TA 2C4NA 4XQCA 1FL9A 3I62A 3V8RA 4HL6A 5FA6A 4RMHA 1KF0A 3WJ2A 3DCJA 4KBGA 1ESEA 1AIPA 2OLKA 5P21A 4FDLA 3HB4X 4Q4HA 2YJTD 1JJVA 4HBZA 4KR6A 5C3EG 4K2AA 4KSBA 2EX4A 4OHKA 3AEKB 4W5RA 4IDGA 4RSMA 3WYFA 3SU8A 9MHTA 1H42A 2F3SA 3GT3A 4JQZA 1E0KA 4BN5A 4K1LA 2HIHA 5EJFA 4JI1H 4TN5A 3ICOA 4L6IA 3QKUA 4HYQA 1VBFA 2HMYB 2B2XA 3UOGA 1DC6A 3OECA 1K7EB 3NAGA 2C5LA 4X1IA 1W1IA 5KKAA 3HO8A 4PYLA 2W6NA 1GRCA 2W2QA 2BR5A 1VIAA 1Y8QB 3TY9A 5AH0A 5DU2A 4QASA 5CDYA 4TMVA 2V7TA 1TM2A 2PSHA 3KFXA 3DZJA 1CDZA 3B60A 3CEJA 1I94B 5IDYA 4AMVA 1DWUA 1N57A 3R5JA 2Q62A 4MP3A 2Z1NA 1MQAA 2G70A 3K6SB 1QIJA 1V96A 2PQ6A 5EXDA 4GC6A 1ZGBA 1GNPA 4MMYB 5IWCA 1B6SA 3FNIA 3QMMA 2OVFA 3SZMA 4PE5B 2C95A 1NXWA 4IJKA 1E6LA 4TTQA 3HCAA 1NXXA 1KBLA 3SKYA 4W9NC 4P53A 1IM2A 1EQAA 4N3NA 5DIFA 2FLLA 4YJGA 1K63A 5CBPB 3OESA 3PDCA 5BSHA 1HR0B 4CKEB 1SWWA 2NSDA 2HZ7A 4L16A 4FS3A 4Q4AA 2GRUA 3LRPA 3JCZA 4RU9A 2GBLC 4Q1CA 5A6SA 4TV9B 1SB8A 4GC9A 1FU4A 4E2YA 2VQDA 3F3MA 3KOMA 1X1CA 1LK7A 3RAPR 2PX5A 4GOJA 4FONA 4B40A 4KTVE 3FOEC 5M5BA 1J24A 4Y6GB 1VCMA 4LF9H 3F4KA 2JBHA 2P9GA 3GRZA 1LLQA 3T12A 3OBIA 4TZ0A 4UUOA 4EA7A 5JEEA 4YQEA 4NBWA 4TVSA 1TVCA 4EECA 3EIFA 3PQDA 4IDOA 4BP8A 3GDEA 4JEIA 4JV5H 4WADA 3L46A 1MOPA 4XSGA 1JU9A 2C07A 4V1CA 3U1TA 3OWHA 4MQMA 1ZGJA 4GZMA 1I5RA 5E1BA 4R1SA 4RQAA 5ED0A 3IP9A 5K3BA 1SXQA 1MDBA 4CM4A 3RIHA 2QVGA 3ZD8A 4P4UA 1MIOB 4KIUA 4EI2A 4TLDA 1GRNA 3C5CA 2XGMA 4R16A 3WWPA 4EO9A 5JAHA 4C3OB 3MAJA 2JIZA 3FMPB 2C5AA 2IY7A 2P4HX 4BNDB 2OAQ1 3ZWDA 2CXPA 2OV2A 4ZAZA 4C2TA 2ZRPA 4W82A 4N0QA 1F0YA 5CDHA 1LNZA 1WOYA 3OP1A 1OAAA 5IBCA 4FZJA 4ZVQA 3WGMA 2CNUA 1Z5UA 1L7OA 2L42A 4ZGGA 3CUVA 2HTFA 3VJMA 3GIWA 3L79A 4LSAA 1KYIA 4OFXA 1J0XO 1DHRA 1L2TA 4WBSA 4F6LA 1ZCAA 4D99A 3ICEA 1GYRA 2YVKA 3HWRA 3GRCA 2D1TA 4ED6A 4L5BA 1M1NB 4R2KA 4ERXA 1EXMA 2B78A 3JRWA 2V65A 1ESZA 5THQA 2Z08A 4GR5A 2RHCA 2VPQA 4RA6B 2C35B 4CM6A 4DL2A 5DM1A 4QPCA 5FLYA 1PR2A 3O2JA 2PLFA 4M0CA 1JDSA 2QN9A 4G4SP 3TLBA 3BMNB 3D7RA 5EE0A 3RB6A 2X0SA 1QQ5A 3VC2A 1E2UA 5IUKC 4FMPA 5DBHX 3MIIA 1ZM4A 5L3QB 1TRKA 1QMPA 5JBQA 5ES4B 3A25A 2GN4A 1CY7A 5TMEA 1P1CA 2OLSA 4M7OA 1PJCA 5I45A 1QIFA 4RK6A 4M1QA 2F1IA 3CXRA 2XAUA 3RAFC 1FU7A 1T2CA 4RZUA 1ZZEA 1Q2UA 1EB9A 2JAOA 5TT0A 2QU7A 2B5WA 3TZEA 3OC6A 4RCVA 5E8RA 3DBHB 1KVRA 2XDQA 3Q1LA 2H7CA 1Z4IA 4ZAGA 2L82A 1PNVA 5D8DA 1NJSA 2PBZA 2ZSHA 4IH1A 2V7QA 3KYIB 1SKAA 4JQYA 2I33A 5DISC 2R93A 4IDEA 3BIFA 2BMVA 4NZOA 3MUNA 1KU0A 3IBFA 4XLLA 5B58T 3IQXA 1XTPA 4HP8A 5IVPA 3H84A 5DRYA 4OQDA 1P74A 1RI4A 5EXPA 1TI7A 2VH2A 4FX2A 4CN8A 3I6BA 1NUPA 2VHEA 5GONB 4EITA 1G2IA 3G89A 4LCEA 2BW0A 4MRNA 1LB1B 1J2JA 2D74A 3SFTA 1X80B 4OTZA 5FF9A 4MKXA 3U7RA 5JLAA 4LOAA 3AQIA 3QSYA 1AXRA 3R9KA 3LDAA 1CIPA 3WWOA 1K5HA 3PNPA 1ZD3A 4GPD1 1E3TA 1L8XA 4MMZB 1L5NA 5KSPA 4ECRA 1YRHA 2HMWA 4CHGA 2EGUA 2I7CA 5HKAA 1I33A 4FFOA 1RYDA 3NBYB 1MB9A 1R4MA 2IGTA 3CSDA 2IYRA 1CR2A 1H8HD 4C43A 4F85A 4GE0A 1W9HA 3QLUA 4DUZB 3O1HB 1JG3A 4RXMA 3RV3A 1GDTA 4E4TA 3UYKA 2YMPA 2EEZA 3RJTA 721PA 1TT7A 5GV8A 4RQTA 1R7RA 3L0PA 3GH3A 5LL6b 4O2AB 1E66A 2WI8A 3K8ZA 5DNVA 2ECFA 5E6RA 4PO9A 5DNCA 1D2GA 2HJHA 2Y1OA 3QE0A 3G02A 1L4FA 4RULA 3HSSA 3D3KA 5ENDA 1QRTA 1F2UB 1OILA 1CZRA 4YUVA 3BL6A 1AURA 5ERXA 4PG8A 5B55A 3ESAA 4DC1A 4ETSA 1R12A 4FC6A 3E8XA 1H4SA 1P61B 3TG2A 3M4IA 1AXGA 4B3SB 4CEHB 2LPMA 1KH1A 2EFDB 4A92A 3G8AA 4YCCA 3D3WB 5KNLA 1NQWA 4AULA 4EEQA 5C34B 3RIXA 2V0GA 1FC0A 4IAOA 1DT3A 5FUMA 2ERXA 1PJQA 1VG8A 3QE2A 4KKXB 1LV8A 1B33N 2WJ6A 1H2HA 4AC9A 1EP1B 4EA6A 4PHCA 3PQ3A 4P5PA 4E6EA 1UZMA 2J6CA 2VXOA 5CW1A 2PVCA 5FUXA 4H1TA 5KFKA 1ES9A 1C7ZA 4HGNA 1WABA 2JI8A 1U3GA 3LPDA 1TB4A 3RS4A 3NEPX 4P82A 3N53A 1TF5A 2OXRA 1J39A 1FF9A 4JJFA 4C6TA 3LXMA 1NRIA 4RVNA 4D9MA 3H19A 2YV2A 2XUGA 4GYYA 1NQUA 1UAAA 4QSHA 4HWGA 3BHNA 4LF7H 4LGCA 3DHNA 1GUAA 1TKCA 3NWEA 1UBMS 3CT6A 3HI4A 4L4SA 1N0WA 4EBDA 4LSGA 2G4CA 1BCSA 4ETNA 4RDCA 3KK0A 4J07A 1XDGA 3UN1A 3THWB 3GT4A 1E1RA 3VZBA 5LZ5A 1HRKA 2HHFA 4QUJA 1ISRA 2QZSA 4TUYA 2VDWA 3CTMA 2RK4A 5LNK6 4MR7B 4M21A 4E4RA 3NHYA 1AUQA 2XVXA 4C7JA 1R1DA 3NTUA 4L8GA 3BC1A 3EWAA 2CBZA 2I6TA 1P81A 1J06A 2X2PA 3TQCA 4GAEA 2Z3WA 1QXSA 5ERYA 1TZCA 2AFHB 1MXHA 1F17A 4GMDA 3H99A 1AKVA 4B35A 4BFYA 3K8YA 3IH5A 3O75A 1ADYA 1QKKA 3RBVA 1E60A 3UMFA 3ETNA 3B38A 2VDKB 1K1SA 1NKTA 4LXQA 3QWHA 4MGZR 2FSGA 2R7MA 1SQFA 4ZOCA 1RYMA 1PVDA 3BZUA 2HK7A 4DQXA 5HTOA 3FMAA 4KVFA 1PCXA 4EG8A 4CC6A 4DSNA 1C8LA 5F21A 2QTZA 4X64H 2IEYA 5B64A 4HFJA 1NXPA 2IODA 3CSUA 2ZUFA 1FMTA 3VO8A 5KFJA 2VJYA 3EY9A 5HDBB 5C35A 3DZBA 2D3WA 4D81A 5TF0A 4QRIA 5IYZB 1IN6A 3ETJA 1TZKA 4Q7QA 1CKNA 2HRCA 4JXUA 1DQSA 4UATA 2L19A 1RJRA 3PDUA 4L2IA 2F4VH 4X44A 4CG3A 1WEKA 4Q21A 3U4MA 3FKJA 3CLKA 2YQ5A 3ES9A 2PN1A 3BMOA 4JEMA 4K03A 3WGIA 1BDJA 5TVGA 4P3XA 3B5IA 1YDMA 1C3LA 3M6XA 1EHIA 1KVTA 3UTCA 3LS2A 3VU9A 3RC8A 2IHJA 4JLSA 2CVFA 5F7XA 5AW1A 4KXFB 3LPCA 1VKHA 3EDOA 3ROEA 3IP6A 2V5VA 2TRSB 2C78A 5C2JB 4DL7A 2R93G 1X9HA 3FFBA 4FGRA 4K6FA 4WOKA 3GFQA 8ADHA 2Z95A 1PZGA 2CXOA 1YS6A 3V1YA 2KJQA 4RZSA 3LXXA 2X4IA 3GJXB 4LF6B 3P2OA 3GB9A 3AVOA 3O3NB 2PGOA 4J03A 4LJ4A 4MUBA 5AK5A 4GWKA 5IM4A 4O4IA 1RXCA 5JADA 4I6JA 3HCBA 4C1BA 4RKYA 4FKBA 1G20A 3M6WA 4KGZA 2OUIA 1PW7A 3KEFA 1A48A 4JJ4A 3PNMA 3KE9A 2ZB8A 3UBTA 1T3LA 4NAHA 1P17A 2Q5FA 3L84A 1PJTA 2WYWA 4HAYA 3MUOA 3ZNPA 4KIJA 4MW6A 2J45A 2EW2A 5KOYA 3KV3O 5AESA 3JQ8B 2ZS9A 1BW9B 4U2BA 2HL6A 1ZWLA 3PNSA 3INNA 1HYHA 3QJGA 2AMJA 1X7ZB 3OC0A 4A15A 4AN4A 1T1SA 1WF6A 3A6PC 2DERA 5AKKA 2OO7A 3UJ8A 2W2LD 4GIBA 1ZRSA 4V24A 5TEVA 4TRNA 3KWLA 3ZY2A 2HCFA 4BO2A 2D54A 1UXIA 2RI0A 5JRZA 3T38A 2YFHA 4R01A 3GNQA 1G8HA 4B3RH 3O4GA 3LWDA 2OFOA 3AEXA 1NAIA 4ESVA 3TD9A 3L7JA 2PGLA 5BYKA 5CD1A 1S1CA 5K3FA 3VTKA 1MMFB 4PANA 4OKNA 2VZLA 1KXJA 3BKWA 5C53B 1ISHA 1ZIOA 5KTSA 3IFSA 4GOMD 1U0TA 4HEHA 3A6KA 4TZTA 4F4UA 1T5TA 5JR3A 2P6UA 3PUVA 3NHSA 1YS1X 2NVUA 4KHZA 2YCHA 1LJUA 5CA1B 3H5IA 2C7GA 1RI2A 3NTQA 4XVUA 3COWA 3L0OA 3L7NA 1VBGA 1DUIA 4K05A 2LWIA 2ZFUA 3AESB 1XA0A 4DWVA 2COUA 5KU7A 3VV2A 2HJWA 3RIZA 1O6CA 2EWWA 5DI3B 3BE8A 3W2EA 4LRYA 3FDJA 1JFTA 5AW8A 2YV1A 4N8EA 1DINA 5K05A 4N7RA 1RXUA 2NZUG 3V2GA 1XLWA 1JNYA 4BNIA 1EVJA 3BQ2A 2YUIA 2BMJA 3JQ9C 1N33B 1DAAA 3EPPA 1S9FA 1VB5A 3W9BA 2FKLA 1YJAA 3M9WA 4R9VA 1DG9A 3SQWA 4TTSA 4ZOLB 2QRVB 5F1OA 4PZ6A 3OKPA 5T57A 1SVWA 3M33A 2WTNA 5KKNB 4PF1A 4KK4A 2JJ8A 4YV7A 2KSQA 4FKZA 5J2TA 1VSQA 1JQEA 1LW7A 3KLPX 1J1ZA 2VJPA 4A8JB 4UZFA 2ZAIA 2CFTA 5D87A 2A9QA 5COQA 4EJSB 3FPGA 2R8KA 4YJ2A 2MJLA 3TZLA 4JB2A 3H1GA 2PYZA 1GCIA 3W4JA 3V8QA 3O2QB 2HTEA 1XTJA 1CIJA 2RGNC 2PUTA 3BJEA 1KI6A 4MI6A 5K8LA 4Z0HO 5AKHA 5BNIA 1E1MA 3ONVA 1YQ9A 4CCYA 4XKJA 1TAGA 3OJOA 1ST2A 5DLGA 2UZ1B 4JU9A 2XYHA 4DG8A 1W0KA 5FXMA 3LYLA 4E51A 1M0WA 1W5AA 3L1VA 4NENB 2XTNA 3GJQA 4UCWA 3KR2A 4ER6A 3BD7A 3ESZA 2J9ZB 1SCNE 3CM0A 3HRHA 5KWIA 5I60A 5A02A 1HK7A 4XWAA 4FEGA 2Q5EA 4K2HA 3PHGA 5FA8A 5F77A 3R7LA 4HTFB 4MUXA 5CFOA 4EF4A 4BNWA 3A6DA 4IGKA 5E9WA 1Z5PA 1NNUA 2RIRA 4CKCB 5K0BA 3NIDB 2ZE6A 3L4EA 4E4YA 5DG9A 3BXHA 3VTAA 2BIFA 3SFVA 3B1ZA 1AGYA 4H3HB 1USKA 5GM2A 3M83A 4L8VA 4ES6A 2P9HA 5DYYA 4A3GG 1W0JA 2B2CA 2RKBA 4U8GA 2PA0A 4EUKA 1PK8A 2Q2VA 2PGDA 3OY2A 1A1SA 5EHQA 1SVMA 4FFBB 4EKIA 3NXSA 5I5XA 3E3NA 4PZZA 5GIOE 2IOYA 3AQ4A 1Z82A 4JS0A 4NMXB 5H02A 1B6RA 3DLCA 2BY4A 3GROA 4GWGA 2YJ3A 4F3KA 3G49A 4C4AA 3BSSA 4US1R 2Y4RA 3T5MA 3JR7A 4DLLA 4EMUA 1PG5A 2VJMA 3R3WA 1GTRA 3WKBA 4DV4H 3X2SA 2W7PA 4MQ6A 3BWBA 2WAXA 5HG0A 3ELDA 4L0DA 4GVPA 1VCIA 3OTOB 1I4WA 1QGAA 3VO2A 2BH2A 4L27A 1MU0A 5JSQA 3MMPA 3HPQA 4HDMA 3GX1A 4IIYA 4UU1A 2EC5A 2FWBA 4F4IA 5B1YA 1U5BB 2A84A 5BQXA 4YQFA 5E7MA 3WZMA 2YOGA 3FCXA 3KO8A 3WRYA 4XD7D 4HFRA 1TU3A 1P75A 4EENA 3W7VA 2FMXA 4ME6A 4ARZA 1A5BB 1G3UA 1P7CA 5FR1A 1WR2A 4C0LA 1S3FA 4MIEA 2EJ2A 4YJKA 4LJ9A 4PZCA 1IN1A 3MINA 5KCMA 5DBFA 5I5TA 4HWSA 3GTOA 1KC1A 1I7LA 2CFCA 3FG9A 1XV5A 4OQFA 3PUZA 2QORA 4EJ0A 4BO7A 1X92A 3CLUC 4RTJA 2B1JA 2OLEA 4MHTA 2I65A 4DCPA 3S24A 1NBOA 3KVVA 1SUDA 1ZJWA 4YRDA 1V3TA 3F6BX 1IYDA 3PC6A 4QODA 2JLQA 4AMBA 2GD2A 2XTJA 1I01A 1V16A 1MVOA 4UEWA 1MRZA 3LKDA 5JTTA 4DR3H 1K3TA 3OQ1A 1T9GS 4IRUB 1MEJA 1A9XB 3Q87B 2YZMA 3C16C 2W2XA 4A2WA 1FDIA 4NVRA 4Z1OA 4A6PA 3T7KA 4C7BA 3KKKA 2BQRA 3GGOA 4A6XA 1E9BA 4MV9A 1KYXA 1N2CB 3CC8A 5BR4A 4Q39A 1P8JA 3DCYA 3CG0A 5IULC 2I3DA 1ZN7A 4C20A 4DABA 1AX9A 2OTCA 3I9V1 1R0CA 5AIBA 3STUA 1DC7A 2XNHA 1YZFA 2R00C 2IZ0A 2Y92A 4CQMB 4O3SA 1YZUA 1NL3A 4EPVA 1XXHA 4XFJA 4GWLA 4KK3A 2JHAA 3EZYA 2C2MA 2QYZA 1RWVA 5EWGA 2VH5R 2GPNA 2IP1A 4KODA 3BJYA 4DLVA 2W6PA 4YI5A 1FIUA 2UVPA 4BFCA 4K1XA 5AVJA 4LZAA 1QVWA 2NQ8A 2GXAA 1YU6A 1XRPA 2QXTA 4BIIA 2H11A 2D5CA 2KMLA 1ZKMA 5AOBA 3UICA 1BGVA 1TUIA 3UK2A 4WESA 5COAA 4I99A 1CULC 1JKIA 1QG2A 2Z5LA 4AKSA 3KEOA 3VPAA 2H3EA 4M1SA 2W9CA 3Q6NA 4O84A 2PFSA 3HK2A 4Z8XA 3N7TA 3DAAA 3M2PA 2Q5QA 1ICIA 4L02A 3EBPA 2B0JA 2EU8A 4Q4CA 4MX8A 3TXAA 3SSOA 2HT1A 4RA9B 2QRLA 4RJIA 3I76A 1YC2A 2ECQA 3MWGA 4KZPA 3T1YB 1T1RA 2Q50A 4BRZA 3COPA 2CLOB 4HSGA 2ZYHA 3OLQA 1HT2E 5DHUA 3PW5A 2BBTA 4GDFA 2YTZA 1P0IA 4TWJA 4A9AA 3PRYA 1M75A 4MW7A 2P2DA 2BR0A 2H0RA 3OQ6A 1OPRA 2RAUA 1TM7E 3B3AA 3RVBA 1NYRA 4C4ZA 1LDNA 1GAXA 2H00A 3FUWA 3SEZA 4ZHQB 3DFIA 4WUVA 3WKDA 4UPVA 1G291 2HMTA 3CO0S 5DRTA 4EATA 3WQQA 2FJPA 4FQ7A 3RRXA 1LCIA 3BA6A 1YAHA 2WFLB 5EJMA 4JMLA 2R4TA 3MERA 3CH7A 4NXNB 1IEWA 1XTUA 5HGJA 1RSZA 3G6VA 1NY6A 1DKMA 2FETA 1N5OX 2MSEB 4KACA 2HH9A 3Q8KA 5G0WA 3LUGA 3EXFA 2WMOB 1PNQA 1Q6ZA 4MITA 1WY5A 4JENA 3QBJA 4UDXX 4OATA 4DB2A 1O75A 1Y3DE 4IHQA 2GM4A 1CQWA 2VDVE 3LFTA 3MD9A 4PYMA 4OX9B 3EWNA 4J9KA 4QEZA 4OXXA 1BMTA 3KLBA 2VQEB 1Y9DA 5LVAA 2WD8A 4BKOA 2WAYA 2YXDA 5JANA 3Q2KA 2YIDA 4DLYA 1N1MA 2E48A 3O2SB 1G5HA 3GT7A 4GGOA 4IDQA 3TYXA 3MK31 1NXVA 1CPYA 1MNQA 5KG1A 3HBAA 4TN1A 1R66A 1G66A 1G8KA 4Z86A 4JT4A 4MRRA 4HNAB 5CM9C 4RUCA 1N8TA 3GPDG 4AX4A 3ZZ1A 4C7KA 1WXDA 3AWIA 4OHFA 1A3CA 1NBMA 2OHJA 3EYYA 3C6KA 3P27A 3GVXA 3AG5A 1SUAA 1PGNA 4PQEA 1GYQA 2JGFA 1VJ1A 4BCBA 1LRJA 3Q8WA 5KFPA 5JDIA 3HGTA 2Q3EA 4MYRA 1QV7A 2D13A 3O7WA 1BSVA 1CUYA 4OUDA 1P4JA 3AFOA 3LQ4A 4ARIA 1X8JA 3V2IA 5H80A 2ZYDA 1ODKA 3SMVA 1E1CB 4X3CA 4DKJA 3RYHB 1ZHOA 3GIIA 1FVOA 5F9FA 3O31A 3RSHA 2JBWA 1PFVA 5EUCA 1CUXA 4CFZA 1IY0A 3TLCA 3NYQA 4KH0A 1T6ZA 1IHXA 1B0ZA 1L1RA 2BHSA 1NSFA 3AVVA 1DWPA 1SUCA 2IUSA 5HOQA 1MAUA 5LOVA 2RGDA 4TTPA 1LF0A 2ATEA 2OCGA 1KO1A 5JFGA 1RBMA 3C3DA 2CFRA 2R79A 3EQ2A 3GTLA 4AJ4A 2AI1A 2JIZD 2AOTB 1BS1A 1SHZA 1XPOA 1UOQA 4YAUA 3W2GA 3W3ZB 2YWGA 5LD2B 1RHQA 2YX1A 4LHVA 1XMQB 2OCLA 3UGQA 3H9JA 2FRVA 2C2HA 1CR0A 4ETIA 3C41J 3KJNA 2XCOA 4D4GA 2V4QA 1DPGA 2EARA 2PT6A 4DC0A 1SU8A 2QLFA 1W5BA 4AICA 5JNLA 1ZK1A 4BO4A 1LH0A 5J2UB 1U04A 2I2DA 1TJPB 2EZ4A 3WMRA 2QG9A 4O7WA 1QIIA 1OREA 1BDMA 3IR7A 2ANBA 5AW2A 4TWIA 1D2AA 3VPGA 2BT4A 1ONSA 3AEUB 1EYZA 3GLHE 3S1LA 3PJRA 4W1RA 1PFKA 1BGXT 1M1YE 3ICPA 4G2NA 2ZRKA 2CZCA 4YPOA 4CFSA 2W71A 4L85A 3VPXA 1KP9A 5DT2A 2REQB 4OM8A 3WL6A 1UJMA 3ZY6A 1HR0H 4C7OB 3C5HA 2GHRA 2FMIA 4EYHB 4B4UA 1X7YA 1XR3A 4F9FA 5HXAA 1P16A 2AW5A 3B36A 2JJ1A 4MK4A 1UUFA 1ZLXA 1CUCA 2W6OA 2QJTA 2UVWA 3GOQA 1Y5RA 3IOBA 2WHXA 2VDOB 4OHRA 4CDMA 4QJ3A 2HC9A 4GI3A 3IUYA 4UZSA 4G5RA 1KJIA 3MWDA 3U81A 3ZDFA 5JDCC 5HIJA 4TYQA 1ABEA 4GEGA 2BQ3A 3GV5B 3JQBA 3P19A 3GAAA 4O4LB 3C15C 5KC8A 4DM3A 2QTGA 2WV9A 2V7QD 1SXGA 1QPBA 3FX2A 3IURA 3TW8A 4PFJA 1UKVY 4JLOA 4HWKA 4S1PA 1JR2A 5JD6A 4ZVRA 5FO0A 4BBPA 3VGJA 1H94A 2P0AA 2Q8PA 1ZOSA 3MTDA 2QGFA 1SR8A 2GPBA 4F11A 4P86A 4OHUA 1VL0A 1NBME 4LUCA 2HGSA 2ACWA 3TW4A 4HJXA 1AHNA 3U49A 1SIBE 1ZLYA 1XRLA 4UBJA 1B26A 3TRJA 3D4IA 3V46A 1UJ5A 1H9BA 3J80A 3A4LA 3RTBA 5F3DA 4OXRA 5C8ZA 5I5YA 4B74A 1D1TA 2R7NA 3PHJA 1FVFA 4H3SA 5IDVA 1UT6A 1C50A 5AJVB 2H16A 3KL2A 1NYQA 3TOSA 1P45A 3LKVA 1TO1E 4WZBA 1E4OA 1A5AB 1R4ZA 4UQLA 1XQ1A 1P2UA 3VJLA 4DXDA 3R3YA 4QLOA 4UHEA 3DNPA 1G2WA 2Y0DA 2XT9A 4CLEA 3H0KA 1ZCBA 2WJPA 1Z5VA 3NTLA 3I92A 3L8HA 3HKBB 4BV3A 5BR1A 3N3AC 3KAPA 1B6TA 1UPFA 5CNMA 3ZZ0A 4LRTB 4XIYA 5DHPA 4BC1A 1TEHA 2W48A 3ZKAA 4IILA 4GLWA 3A11A 4PQRA 4G1EB 3LE8A 4MWOA 3IRVA 5BY2A 2BFNA 1XEAA 4RPJA 4FD3A 4KQGA 2WSSA 4WMLA 2B8WA 5ADHA 4LVUA 4C06A 4L8LA 5B4VA 5GADl 3IA7A 4YR3A 1D07A 4NONA 3RABA 8OHMA 1GQOA 3WY9A 1CD5A 1E3DA 3MQ4A 4Q1AA 5AVWA 1CT9A 3Q85A 4NATA 2EFEB 3L0DA 1YXMA 3UJ9A 5FX2A 4CWAA 3T7AA 1KOGA 3RDPA 5BV0A 2J0UA 1XPJA 3K9FC 5EWLA 1OXKB 2HF8A 3VZPA 1E7YA 3ZDQA 4W8HA 1K86A 4DDVA 3RBZA 3UENA 1A9SA 1T3ZA 1H2RS 4D4LA 5EYPA 1GR0A 3TWOA 5IMSA 2OAP1 5ALYA 3P97A 3CRNA 3R4CA 1H2XA 1NMZA 4CHIA 1JSZA 5FWYA 3ZEAA 2LUOA 2CVPA 1FNNA 2C9ZA 2W6MA 1GGOA 1S2GA 1XL0A 4R51A 3TGWA 2WM9B 4KR2A 3I01A 3ESDA 5DM70 2JEFA 4MI3A 4YAJA 4M2LA 6ADHA 4KHPB 3EOAI 1QYWA 3KQVA 2HGZA 1JGTA 1EAMA 3TMYA 4CMEC 1RP1A 2BLLA 1IHOA 5D3QA 1QQBA 1TQ6A 2FCAA 3IESA 5EGSA 4YRMA 4C7MA 3IX7A 1FNSA 3H4DA 2DHDA 2E9SA 3PNQA 1P1HA 2Z4SA 4FP9A 1FRQA 1A5ZA 2DSNA 3ILVA 4NEQA 1E1RD 1OYYA 3NNNA 2L0XA 3LX5A 1GT6A 4DDUA 1LVUA 4LQ4A 5FNZA 1NRXA 5HUJA 1NU8A 4KUGA 3OIFA 5K2OA 3SR4A 2IYQA 4Z0TA 3IUJA 2RAPA 2Q9BA 3JYOA 4RJLA 4B48A 3ZBQA 1M2KA 4FFSA 2RC6A 2PXXA 1K3FA 1W19A 1MFZA 2AOXA 2J3JA 1NVTA 4U1RA 1P91A 1DZ3A 2G09A 1N56A 1IXKA 2N3ZA 1DX6A 3A8TA 4J9UE 1GFSA 1I0ZA 4MQ5A 3T5JA 1E0JA 1JPNA 1YE3A 1ZGCA 2JBAA 3PNVA 2W2VA 1W73A 3GEIA 1RM3A 3WFJA 3DZFA 5BUCA 1A04A 3OE5A 5JJBA 3EXG1 3ZQ4A 2YC2C 5L6MB 4GLLA 4OP3A 2FWIA 3U6KA 3IHLA 3I09A 5IXSA 1XTSA 3UFBA 3L01A 4I1IA 1OTXA 2XQGA 4AZVA 3WNDA 1RADA 3A6GA 2C9YA 4ZGBA 3V4FA 5ICEA 5IAJA 3D64A 3PR4A 1M34A 1A76A 5CT6A 3ILSA 4RU1A 3TZCA 4E6NA 4IQ0A 4JKIA 3BEOA 4PR0A 3PLNA 2NP6A 4ZP1A 2ZRJA 3KOOA 4DR6B 1FFXB 1E9RA 4OQXA 4DANA 1XQYA 3T9CA 4MYSA 2XCUA 4KXQA 5AVYA 5EUBA 3EUFA 2A88A 4EGJA 4IKPA 4RMGA 1SUEA 1I8TA 1Z4MA 2WTAA 3U3KA 3H8JA 4XTCS 1Z36A 1WSAA 4JB0A 3OUZA 4X8OA 2EJVA 3SSNA 2YC4C 1UEIA 1PL0A 1GM5A 4X90A 2H48A 4X00A 3UHAA 4PYRA 3S2YA 3I9NA 4MWTA 1EDZA 3TG8A 3DAHA 3DH0A 3OLWA 5JCJA 3PFIA 2C03A 2YOHA 2CB9A 4TROA 2RCYA 5L7WA 2C5GA 3P9KA 1NVAA 5THXA 1RK6A 2VH1A 3WK9A 1U7OA 2R6CA 1OXMA 1AUPA 4EGFA 1B43A 4PPYA 4RANA 4TKVB 4ND7A 4M3NA 5LLTA 2H5IA 1K6XA 3N8HA 3G85A 5KFFA 2SKDA 1PR6A 3BQNB 4Z9BA 1Y8ZA 2QRMA 3HC7A 5EESA 3ZZTA 5LC1A 2W2MA 4J2TA 4UEKA 3EDQA 5CIWA 4OYLA 3A1TA 4N3BA 3HKEA 3BT7A 3GTPA 1UBGA 1GAJA 3EFOA 1H2ZA 1FDOA 4CRWB 2RHOA 2EZTA 2YHIA 3EDMA 2IZZA 3EAQA 2HU7A 3BABA 2GEBA 1S3IA 4Q3NA 4G1FA 4LHEA 4BX3A 4JOQA 2QYSA 1ODLA 1VMDA 1ZHFA 1AKMA 3O03A 4KP7A 4LBWA 1W5FA 1Y4UA 3N44B 1R16A 2C20A 4COKA 1LRKA 2WD7A 3TH5A 1RAEA 2J4DA 1KK3A 4OJTA 1VBKA 4FE7A 2QQGA 4ATNA 3DBOB 4U4AA 4UM8B 1PHPA 4CL0A 3RBAA 3V6LA 3AR8A 4NCKA 1WR8A 3C3XA 4N9QA 1JU4A 5GQSA 4AZSA 2ID8A 4G0OA 1CSEE 4AM8A 4QM7A 1XZQA 5CTAA 4EMSA 3KRTA 3EVBA 1U7UA 4WOJA 4FDTA 2Y6UA 5I47A 3ECCA 5IW8A 1RD4A 3J7TA 4F4HA 3KHTA 1EWQA 2F9FA 2QTCA 2W93A 2B4RO 5A4AA 5KJEA 5E7QA 3LP5A 3ZTTA 4MS3B 4OIMA 2Q0SA 4OB6A 1UNNC 2DF8A 3PPWA 4RGBA 2F2TA 3I6YA 2YL2A 4NG4A 2IDJA 3IV7A 4K8RB 1Y3BE 3ONDA 1XCMA 4M49A 3C5WP 5MHTA 3QEAZ 3TZBA 5KPDA 5FPKA 4EPXA 3SJUA 4KN6A 2XZTA 1U2QA 3F49S 2K5UA 1D03A 4F4XA 3JAMA 2WTFA 5FULA 1P29A 4UE6A 4QEKA 4RX1A 3PE4A 4II7A 4LCJA 4UM5A 3QTTA 1LSSA 4AZ3A 4EM6A 3ABOB 2GK3A 2AYZA 3UBMA 3U3ZA 1SK9A 1AD2A 3TSCA 1NLZA 3W8RA 2MTBA 1ORRA 2O2JA 2B9VA 3IT3A 3GLTA 3G88A 1E3IA 3W5DA 5EQTA 3PA6A 5HNEA 3BDAA 1LQ2A 1Y4ZA 2H85A 1D4AA 3WTCA 1TUBA 1PE0A 3DFZA 1UDAA 1V71A 4CCWA 3BRWD 1RYSA 4QDOA 2R11A 1NV9A 2IXAA 4L51A 3WI7A 3AY6A 4G8JA 3AHIA 1NFFA 1IY1A 4BLQA 2RF4A 3D7LA 8GPBA 1F6WA 5DP1A 1RPNA 1N5DA 3U55A 3GGCA 1M7BA 4F60A 4RK5A 1V7PC 3AFGA 1WLYA 5T3YA 3KDAA 2JCBA 4TGLA 1C2TA 1EDDA 1XQWA 4L5JA 1XD8A 4YYZA 1IZ7A 3U7JA 2XWQA 1Z8NA 2EP5A 4Y2YA 5JECA 3EBLA 4DL5A 3M1LA 3X1YA 1T0BA 3W5AA 2XUKA 1J1UA 2B6HA 1GAWA 2FA9A 2OHVA 4AX8A 2QTNA 1UINA 1W0KD 1WY7A 2JRLA 4PO8A 3JTEA 3Q15C 2JCVA 4EKNB 4O82A 2JA5A 5DISB 1BWRA 5K4GA 2W6QA 2ZQYA 1PIWA 2O9JA 4FCWA 5FBZA 1YSCA 4DCGA 1E2KA 3NETA 3SJ7A 4ESHA 2VQ3A 1C41A 3GCZA 1Z2CA 2PWYA 3UZBA 1GCUA 1OVGA 1TCBA 4ZVOA 3R8XA 1FTQA 3JATB 4NJMB 4C4XA 2EJTA 2ZJOA 1YR2A 3ZHQA 4S3MA 3OIDA 3LJKA 1KRWA 4EG7A 2ASJA 1VTKA 2O8BA 3I2YX 3KKZA 1G21B 5KFLA 4KGVA 1GVNB 3B89A 4UTPA 1RIIA 1W0JD 2XWSA 3ZCPA 5A2GA 3WIEA 4IO1A 1C9NA 2WPDA 1C7EA 3FIUA 3SDZA 4YFYA 4MR9B 2Z2YA 4FFDA 4GSYA 3AW9A 2QTWB 2DM6A 3HBLA 1HQCA 1K6EA 5E3HA 1WVGA 2ZAYA 1N33H 4NU0A 1F2DA 3TX2A 5T4BA 4CI0B 4QVIA 1DAMA 3ZI0A 4DDHA 3T3MB 3AV0B 1A9YA 5TNXA 3M9NB 5IUJC 4DHWA 1YRWA 1L4BA 4U6QA 2ENUA 4AS2A 1M8JA 3WV5A 2R1VB 4OG2A 3TI9A 3TZ6A 1TT5B 1U4NA 4B43A 2VHXA 4A0QA 4U2KA 3JD4A 1B1CA 4YH1A 2CL5A 1NI4A 1APBA 3H6GA 5LDGA 2VUHB 4DLAA 4EL0A 5AW0A 3WLNA 1D1SA 1PJZA 4AF6A 1KH3A 4C4TA 3UATA 2PWZA 2QN3A 3UHPA 2O8DA 5BWUA 5AHKA 3QI2A 1EE2A 1XNGA 1GD1O 4QOSA 3SWWA 1TF2A 3L18A 4TS4A 2QVLA 2CFSA 2Z2IA 2ADFA 1M6EX 1BA2A 3RC9A 2AGOA 1BRTA 4WXPA 3MGKA 3CZMA 4ZVMA 2CCKA 5KYXA 4FMBB 1BHQ1 1OV4A 5IVKA 2C2BA 1RFLA 4GXQA 4JVMA 4OYHA 3FPLA 3RJ9A 1QF6A 5IJXA 2C0PA 4Q9HA 2BZGA 2BHRA 4ZYVA 4QDTA 4WKNA 3RVDA 3IVRA 3GJ0A 3F3YA 7AT1A 4LYGA 4ZGWA 4JL8A 4ANFA 2I1VB 4QXOA 3NWOA 1YNSA 1O0BA 1L4KA 4V38A 2A0KA 5CCBA 4URWR 4BRUA 4BY1G 2D1RA 2D2IA 3JQAB 2C7VA 3BM5A 1PNRA 4CDGA 3EIOA 3SJCA 1BFUA 5KWVA 4N0PA 3JARB 4WZ6A 1QV9A 5IMBA 3GCWA 1J2UA 2OECA 3AYZB 1L6IA 3IAS1 3RYFB 4DBLC 1I1OA 2R8IA 3CQ9A 2P9TA 2JEYA 1MC1A 3AJDA 1SCBA 4CQLA 4CHTA 5C8XA 2I99A 2W0SA 2DQ4A 1MRSA 2DB3A 1WXXA 4YXFA 1CP2A 5JWOA 1H0HA 1V1MB 1PWYE 1Q74A 1U63A 2VPXA 2IBTA 2UXDH 3CX8A 1GPNA 2ODPA 3LNCA 3ZE0B 3CLSD 4J90A 5CT9A 5CH5A 4FCCA 3HN2A 4G5GA 5HJ7A 2B2NA 1RAAA 3IQZA 2XGJA 2BHNA 2AJ8A 4O4HA 1M2OA 3A3KA 1Z15A 3P94A 3U9TA 1U1FA 4Q02A 4MI1A 5ALWA 3ZNQA 5B4TA 1KQPA 1JFLA 4PXAA 3UV7A 4L5AA 1L6RA 3C0FB 3H4BA 3CJRA 1Z0JA 5G0UA 3C8DA 1JLLA 4N4AA 2HCJB 4R6WA 3A3YA 1FXSA 4YRAA 1EGQA 3D6HA 4OU4A 1S5PA 1E7WA 4RS4A 4QOFA 3RKRA 3KUCA 1Q1QA 4YAOA 2UYQA 3E2IA 4JOSA 3H9UA 1C4WA 3TLYA 2M2IA 5FOXA 2AJDA 4QSMA 2BDTA 1NWHA 2FY8A 2WIAA 3T5KA 4WECA 1KXZA 1NAHA 4LV6A 1UZLA 1A82A 4GI2A 5JVLA 1VXRA 4H6PA 5KG5A 3UAGA 1T2DA 4JFAA 5EP4A 6PFKA 4J0IA 3T1HB 2QU8A 2QX9A 4GP6A 4W5JA 2JFYA 4AJEA 3D2BA 2LGJA 4QQNA 4R68A 3JPWA 3OY7A 2MCFA 3CR8A 1IEXA 4FMCF 5JAQA 1D2MA 3SS9X 2NSHA 4J1TA 1F7VA 3LAWA 3HVKA 5CFMA 3U62A 3EAGA 3ETGA 2X22A 4K46A 2G28A 3IAXA 1W8IA 2HB6A 1G8FA 1UJCA 2JA5G 2E18A 2GYWA 4ZMBA 1I3MA 2AR0A 5IZCA 2FR8A 1C8VB 3A6JA 3M5DA 2QG6A 5KFCA 1RI1A 4OJNA 5IWAH 5LQJA 5L3VA 2V4ZA 1Q50A 1QIHA 2W9XA 1QP8A 5LQCA 3RAGA 1R3UA 3MS7A 5D51S 2BTQA 1XLTC 4QATA 1YOBA 3H5VA 1LK0A 5DFAA 5GVRA 3TB4A 2Q6VA 5B2ZA 3UHJA 1LJLA 2XWPA 1SCIA 2CKDA 2HPZA 3TOZA 4GYWA 5LP1A 2XKKA 1Z0AA 1HDXA 2CHEA 1G60A 1HO3A 1O2DA 6CHYA 3KYDA 1ZFNA 2DFVA 4HI0E 3ZOKA 3Q5DA 1DTWB 4IIJF 4YLGA 3QTLA 1AZLA 1G55A 2YN2A 2GPSA 3TAXA 2CT8A 3GY0A 4MGIR 3FUXA 3ZVLA 1P4RA 2WC1A 1QZ3A 1H0KA 1H2EA 2H9AA 1CUIA 2QD5A 5LKAA 3ZW8A 3N8GA 3STWA 1KTAA 3GCXA 1NBMD 3OEYA 5K6AA 1I2ZA 1FFWA 4FEAA 1UFRA 4D82A 4QIHA 3HBNA 5KI6A 1V8ZA 1HOXA 1S03G 5C18A 4I3HA 3B20A 3PKIA 5ESXA 1O1YA 2WA1A 3QITA 2IE8A 1YRYE 2JI7A 2FPGB 3A4NA 5KVAA 1IM8A 1XEWY 3QA9A 2WF6A 4Y8VB 5BWTA 4JUCA 1CJMA 3CG4A 2O54A 2VAXA 1L7BA 1WLSA 2ZGVA 2G25A 2PUWA 3GIDA 4XYGA 2YKGA 3PUWA 3THYB 3O8QA 5IP9G 2QTVB 1NI5A 3TI7A 5J3JA 5F23A 2VA9A 1XQXA 2AR7A 4J94A 2M98A 3B7PA 4TV8A 4LE2A 5G1PA 3I42A 1F4LA 3KEQA 1VL8A 1K89A 5BN3B 3OQMA 4S1VA 3G0OA 4OB7A 2G36A