1I7NA

Crystal structure analysis of the c domain of synapsin ii from rat brain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
308
Chain Sequence
KAKVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTLGGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQTYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDACSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPSIN II
publication title ATP Binding Independent of Metal Cations in Synapsin II
rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide
total genus 87
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1i7nA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1i7nA01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i7nA02
5DMXA 3KAKA 4IHJF 2YW2A 4YAKB 2W71A 3AX6A 3U54A 2HGSA 5K2MA 3G8DA 1OBGA 3VPDA 3KAJA 2NUAB 2R7KA 1DIKA 3SE7A 2YZLA 3RV3A 3I12A 3TINA 4C5CA 1DV2A 1JDEA 1VBGA 2R7LA 4TV9F 4EA7A 1KJIA 5JQWA 3OUUA 5BPFA 2DLNA 4E4TA 2GQSA 2R6FA 5LA6F 4EGJA 3ETJA 3TIIA 4RZQA 1A48A 4MV9A 2R7MA 4MV3A 2W6OA 3K5HA 1B6SA 2FP4B 3R5HA 4FFNA 5GONF 4EA8A 2IP4A 1A9XA 2PN1A 3U55A 1M0WA 2FB9A 1GSHA 1VKZA 3JRXA 3LWBA 1I7LA 3WO0A 4C5BA 1E4EA 2W6PA 3ETHA 5H80A 4QSHA 2VQDA 1Z2NX 1EYZA 3HB9A 4YBZB 2CNUA 3VOTA 4XX0B 4XYLB 4MV6A 3BSWA 1EZ1A 5FNVF 3VPCA 1W93A 4O2BF 4M98A 4HNVA 1JDBB 4YB8B 1VBHA 2NU9B 2FPGB 2FPIB 4L1KA 2V5AA 1KUTA 1OBDA 1GSOA 2PBZA 4O82A 3N8DA 1I7NA 3Q1KA 2R85A 4FFRA 4EA9A 2YS7A 2NU8B 3KREA 3V4SA 4DLKA 1KEEA 4IWYA 3DF7A 3BSYA 2QK4A 1IOVA 3RFCA 3JZFA 5CA0F 2XD4A 4O7LA 2DWCA 4M99A 2R7NA 3KALA 4HNTA 4FU0A 4O86A 1CE8A 4O7YA 2V59A 4GGMX 3VA7A 4O4IF 1JLLB 4IWXA 2YRWA 4HR7A 3ORQA 3NUAA 4O7NA 2YYAA 5KX5F 5CB4F 5D8DA 4MV7A 3K3PA 5C8YF 2NU6B 4XYMB 3K5IA 4ZHQF 2CZGA 3VPBA 4I50F 5JH7F 5JVDF 5LP6F 5IYZF 1BXRA 4IIJF 2WYOA 4O7VA 4O84A 2ZDGA 2Z02A 2P0AA 2R86A 3Q2OA 4FFOA 2J9GA 1E4EB 1KC7A 2XCLA 1KBLA 2NU7B 3HO8A 2YS6A 5C1OA 1C30A 4M9UA 4O7TA 4ME6A 1Z2PX 4O2AF 1JKJB 3VMMA 4FE2A 4HQ6A 3N6RA 1KJ8A 4J6EA 1DV1A 4TV8F 2YRXA 1T36A 2ZDHA 2W6MA 1WR2A 1CQIB 3R23A 2GPSA 4O83A 3U9SA 2YL2A 1AUXA 2W70A 4Y8VB 2HJWA 2VPQA 2I87A 4ZI7F 1AUVA 1IOWA 2W6QA 3UFXB 3G8CA 5LYJF 3RV4A 2W6ZA 1EHIA 4YAJB 4EABA 4MV8A 4MA5A 5I47A 1M0TA 4MAMA 3U9TA 4DIMA 1W96A 3OUZA 1EUCB 3TQTA 5LXTF 1UC9A 2YWVA 2NPOA 1ULZA 4NYEA 1CQJB 4I55F 2YZMA 4ZOLF 1GGOA 4XZ3B 4FFLA 3TW6A 5EZYF 2CNVA 4O4JF 3MJFA 3AW8A 3R5XA 2V58A 4YJ3F 2DZDA 3JRWA 2I8CA 4FFPA 5KKNB 3R5FA 2FPPB 2GQRA 3WO1A 2ZDQA 4MA0A 3LP8A 1GSAA 1KJJA 1BNCA 5LOVF 3QFFA 4O7ZA 4C5AA 1GLVA 4O4HF 2Z04A 3BSSA 4WBNF 2GLTA 5HBRB 4EAAA 1UC8A 5JQGF 3R9RA 3GLKA 1EUDB 3HBLA 2PVPA 2R82A 3E5NA 5JVLA 1M6VA 1KJ9A 3JZIA 4WD3A 1B6RA 2QF7A 3WNZA 2YZGA 2SCUB 2YZNA 4O7RA 3BG5A 3RUPA 5J2TF 1SCUB 4M9CA 4FFMA 2OLSA 2VHEA 5CAEB 1PK8A 5BPHA 1CS0A 4ZQIA 2I80A 4MV4A 1KJQA 3MWEA 4MV1A 4HNUA 4FGRA 4EGQA 4YJ2F 5J2UF 5C1PA 2W6NA 3MWDA 3ORRA 4IZOA 5CA1F 4O7SA 5BMVF 2C00A 4EG0A 4TUYF 3TIGA 5HV6A 2DIKA 3GIDA 2X0SA 3BFPA 1PX2A 2R87A 1C3OA 4I4TF 4O4LF 2CNQA 2VR1A 2CQYA 2GPWA 4O81A 1Z2OX 4O7WA 2R84A 3V4ZA
chains in the Genus database with same CATH superfamily
3HCRA 8ABPA 3R44A 4RIIA 2Q7XA 3A70A 3FKJA 2VWQA 4R2LA 1CJBA 4B75A 1AQLA 4ENTA 4DQLA 3OEEA 3RV3A 5H7XA 4NZYA 2H6EA 4OO3A 5DULA 4GGPA 3G79A 3T99A 1QRDA 2R6FA 4IO1A 4TV8A 1GPUA 5K3SA 1H0HA 1EXNA 2V7GA 2ZIXA 4YP6A 2H29A 4LUCA 3WGOA 5DX1A 4AKTA 5ALNA 1T6XA 4TOIA 3WMXA 1MO2A 1RJPA 4QIHA 3HNRA 3OY7A 4MWOA 4GFDA 1YC2A 2QTGA 3OJCA 3R5KA 1Z38A 1INLA 1Y3FE 2A1TR 4JQCA 2YZ2A 3F5FA 1S2IA 2XKBA 1UBMS 1W2GA 3LQKA 1ZM9A 3W7VA 3ELYA 2ZSJA 3HCBA 3IH5A 3AKDA 2GPAA 3ZKWA 1KSGA 2FN8A 3CLRD 1NKSA 3FPJA 1YNOA 3IDOA 3FPKA 4KAFA 5TMDA 4G0ZA 2AW3A 4Y2JA 3VJLA 3OUTA 3C3PA 2J9RA 3OTGA 3LCCA 5E1DA 1K1EA 3L0ZA 3PHBE 1KK0A 3SKVA 3VR2D 4JL6A 4UDOA 4RADA 3ORFA 3H4IA 1IXSB 2YNMD 3KHLA 5LFAA 2C4UA 4F0JA 1ZHOA 4LIPD 1WNTA 2QZZA 4DEVA 4AF8A 2Q2QA 2VUMG 1NW5A 1DPFA 5CVDA 1D2EA 4FYMA 4IH4A 3RHTA 2VDWB 1SEIA 1SZJG 2XYGA 3R0QA 4HVAA 1A5ZA 3GMIA 2WJWA 3U56A 4EKEA 4P22A 3WK8A 1E9DA 2CUTA 3OI7A 5HBRA 3INGA 3GRRA 2SECE 4BJ1A 4YJDA 1M6YA 1SVKA 3NHWA 1DT3A 3R3UA 2JIBA 2QLBA 3HXPA 1X8KA 4HG2A 4FE2A 4NMLA 2VCEA 4R1TA 3FJ1A 4CL3A 4L50A 4Z9YA 1VE3A 2IHBA 1XMSA 2HL6A 3MWLA 3NHUA 2VP6A 3SDSA 3SQWA 2NYVA 4O8CA 3LQRA 5A03A 2OYSA 4JU8A 4J0JA 3RV4A 2VL7A 3L05A 3W3AD 5KQPA 4BO0A 4MS4A 3VI3B 5D5PA 1IVYA 1S8NA 4ER3A 4RNNA 5BN3B 1GU0A 5B6PA 1S3FA 2V6MA 1ZNXA 2JEGA 2VDVE 4M9SA 3FLMA 3CQZA 3KV3O 2XIGA 5I5SA 3PL5A 3ET4A 1SCQA 4MWBA 1RADA 1F48A 4J90A 1GD1O 2WOJA 1UPTA 5KFSA 3ICWA 3RYCA 4QRDA 1OLUA 3OQVA 4RVNA 3B9BA 4TGLA 4EYGA 4YQFA 2PVCA 4RS3A 3CLSC 3GV7B 4PRYA 3UUFA 4BZXA 2HC9A 5U1PA 3FCUB 1H1TA 5EIBC 3A0RB 2CW8A 3ZDBA 4F8EA 3NEAA 8MHTA 1WA5A 4B8YA 1T36B 4I9FA 1NVMB 1I0IA 4ZQIA 1AVTA 3L7LA 4XYLA 3Q3IA 1JHDA 3RROA 2ZB4A 5BVHA 3AYXB 5EMHA 1VE9A 2OG2A 1X92A 4LJ9A 4M37A 1WZNA 2FRDA 2WTFA 2DIKA 2YMLA 3BFPA 3WGIA 2GAJA 1ICIA 1UT6A 4YIHA 2ONCA 1OX4B 3EYWA 2R5FA 1WPQA 1TUEA 4DPMA 2B7LA 3P2EA 1OAAA 4RGQA 1V9PA 3WXBA 1F38A 2JCYA 3HGMA 3QU9A 4UFPA 3KSDO 2MR5A 5JCXA 1RRFA 1NUTA 3RUCA 4M0CA 1DIKA 2GDZA 4MDHA 3R6GA 4I7EA 1JHQA 1QIEA 4IDFA 2PX8A 3RFFA 4D02A 4TXHA 1GQQA 2G6BA 5E9JA 3ASVA 2PUFA 5LYYA 3ZVNA 1JVNA 4NHEA 3PLAE 1LLDA 1IYZA 1XTUA 5KNBD 4UUGA 2YWCA 4EG6A 3EC7A 4M21A 4OGLA 4Q6WA 2PSFA 5KWVA 1OXTA 2WHQA 1VIAA 1ZUWA 2VSQA 4CKBA 3K1TA 3ENNA 3UV6A 2H1FA 2FK7A 1M8PA 5IABA 1TFRA 5DP2A 5T8KA 4G26A 4HLQB 5HTOA 1EWRA 1N32B 5FWNA 3SJUA 3U7GA 5JMOA 3JQCA 1OMOA 2R3SA 5BW6B 2IGBA 4RHCA 1NOJA 3DAFA 3TQRA 4XJVA 3T7CA 3GARA 2XUOA 4FNAA 4KSBA 1JXQA 4X97A 3RC3A 5DBOA 2OCGA 3DDWA 2P4UA 2DWCA 2C7QA 4OM7A 2YYSA 3LBHA 3HXMA 1ULTA 4QYXA 3T54A 5D3MA 2V59A 2P5UA 1U9IC 3ASZA 4B7UA 1EEHA 3EWAA 5BOSB 1QDLB 3DQZA 4H08A 1A7AA 3VH4A 1WB5A 1NULA 2BFOA 5CM8B 2N42A 4HF7A 1G5HA 2GESA 3PUZA 3UWPA 2Z5VA 3SZMA 5A6SA 5GJBA 1Y3AA 3PHHA 5EFOA 1TTTA 1PQWA 4UHHA 1D2RA 4DW8A 3DO8A 2GM5A 2D7DA 4JZYA 2O5RA 1T9GR 2PZKA 1LFDB 3FYHA 4DM3A 2QG9A 3PW0A 1NVUQ 5AICA 3TDKA 3RRYA 5DM2A 2O8EA 1VL8A 1HRDA 1YXMA 4Y18A 3GMTA 3R09A 5B30A 2BZGA 3DR5A 2AX3A 1JKJB 1UMCB 2HPVA 1G5QA 3EGDA 3KCNA 3BB4A 2ECQA 1DP4A 5K3BA 1DOAA 1Q12A 1GOTA 3WLTA 1BXKA 4WQMA 3U9SA 2ZU0C 4BU0A 1KO8A 1QAQA 2BKXA 3G5AA 3F90A 5ICSA 4CDMA 3SHQA 1CZHA 3ESAA 4EW1A 4JBXA 1P4SA 3O6VA 4GECA 5IYBG 4TWRA 5KTNA 3OIFA 5AOCA 5E3IA 1QKKA 1DC4A 2DULA 3IE1A 5BQFA 3QFSA 1EFAA 2Q9CA 1LTHR 3H05A 4H18A 1SQ5A 4L85A 3TQQA 3E9MA 1EFRA 5LP1A 5FJIA 2B5WA 3D3KA 3PYXA 3Q0IA 4QJ4A 3ZDXB 3RQIA 2OBMA 1NP7A 2OUIA 1EBUA 2PZGA 1N9ZA 3RADC 3IKLA 3EVEA 4BB0A 1VQ1A 3WO1A 3JQQA 1SURA 3GJRA 3A05A 3VYSB 1O0SA 3AR5A 2EW1A 3CEPB 5DT9A 4ER0A 2DHRA 1RQ2A 2ETXA 1D9XA 2ASDA 5FL7D 4F6LA 4DMKA 3PUIA 2NXEA 4OXYA 2OSBA 5F3DA 4HSEA 5G02A 3KK0A 3G49A 3GL9A 3SBXA 3WDMA 1D1TA 5F5NA 1KS2A 3F4BA 1GZSA 3QH4A 3FI9A 1HYEA 2CWDA 1RWBA 4PPGA 2GM4A 5CRIA 3ORRA 2G4VA 3GHHA 1J0XO 3ZIUA 1ULAA 1T5OA 3BL6A 4TYMA 4Y3UA 3MTAA 2QN7A 3OU7A 1A0GA 3DH0A 4IEIA 7ADHA 4JYCA 4DAAA 1ZD5A 3T5DA 4RB1A 1FLNA 2BKAA 5JDCC 1E2BA 1F8FA 2QPLA 5HKBA 4DM4A 1SUDA 3L6BA 2QEQA 1DTEA 1OASA 1Z2OX 4LQ4A 4V0OA 4M54A 3M89A 3DJFA 2I0FA 4D9JA 2ZSFA 1L9XA 2VATA 1K2WA 5EXSA 2OLJA 4HY3A 4GI2A 5KC8A 4CLOA 1MVNA 2P2DA 2XNDD 4BKQA 3MJDA 2JJ8A 2WNIA 3BTUA 3IT3A 1R3UA 3C5CA 1RC1A 1Y4DE 1M2NA 2FFJA 3QENA 4ZMBA 4F6RB 4HAYA 1SAYA 2VOBA 4O3MA 1EX6A 3IP5A 1ISHA 2QL6A 2C0QA 3REGA 3DPIA 4OQPA 3EIXA 2PGJA 1I80A 1V8DA 2C9YA 2BGIA 2H11A 1A0IA 4Z0PA 5IBPA 1AZSC 5FUMA 3KVRA 2IITA 1I7QB 4I1PA 4EB6B 3D7NA 4KLRA 5BSFA 1JDBB 4B7AA 4YB8B 2D1TA 1PS9A 4HS9A 2YQ5A 1NL3A 2WQZA 2JI7A 2VDLB 1NIPA 3NFYA 3ZVRA 3KKZA 3FMVA 2XCUA 4Y2XA 3T52A 2HADA 4L4UA 3ZXXA 4CU2A 3WL6A 4JI3B 1T4CA 4RQUA 3VU9B 4MYCA 5A0FA 5JWRA 2V7BA 5HF6A 2QB5A 4ERXA 2Q27A 1PO7A 4XWKA 4UHCA 4BVEA 4KG7A 4C2UA 3EXHA 4IIDA 4KX3A 4CKEB 5H02A 3PEYA 5BNWA 3KB1A 1FTSA 2FZVA 3HKEB 2IYOA 1S03G 5EKSA 4R41A 4KYUA 4LTMA 4HUJA 1XNRH 2GETA 2HRCA 5U9CA 3GFGA 4BEJA 2BCEA 3NHBA 4CKWB 5K51A 2EP8A 2C92A 1FZTA 1WXXA 3SC6A 2V3CC 2HCFA 5T6MA 4RD1A 5FLEX 3MB5A 1ORRA 3AR8A 5B58T 3U0GA 2GSDA 3TCKA 4Q9KA 4ZYTA 5FPPA 4QUKA 4RABA 2H8GA 3QYJA 2HUPA 5EINA 4PZDA 5KTRA 3I2JA 1H9BA 3INTA 2ATXA 1V5GA 3G6KA 2WD8A 1QFZA 2OXEA 2JFVA 3SC3A 1QV9A 3OSPA 1OGJA 2ZDHA 4UBMA 2Q21A 2CKDA 5CR5A 4OK3A 2OP1A 1NPYA 4ZN6A 2VHVA 1ZJZA 3JQ8B 1YB7A 3ESDA 4HCJA 1GO3E 4ZI7F 2ZANA 5SV2A 4BNGA 4QYTA 1VCNA 2JGEA 2H1RA 1NF8A 1OV4A 3COVA 4O3NA 3OX2A 2KWIA 3HUDA 4YI3A 3AUSA 1Z6QA 3RRFA 1QHHB 1YJXA 1OBVA 2EKBA 2PH7A 4PIMA 1D04A 3QWBA 4FFPA 1QS0B 2P6MA 4BOYA 4UAUA 1WBJB 1LNSA 2CLOB 5JPDA 5EUMA 4JUDX 5IF3A 3F5DA 1NRWA 3VYVA 4O7ZA 1FXWF 5DSTA 4EEXA 2Y0BA 5H81A 3O83A 4FPXA 4EQ6A 3P9ZA 1G8HA 4LF7H 2JVJA 5KJFA 3QHAA 1HKHA 4X20B 1XALA 4MUMA 3QY9A 4P38A 1ESDA 5FO1A 1G5RA 1XT6A 4A8JB 2E48A 3HWRA 3D3WB 4TMYA 1SIUA 3SR4A 3PQ5A 3VTAA 4NEGA 1N1GA 4RMIA 2ZKLA 1WCMA 3P2MA 4O4JB 3RDPA 2H4WA 2IUUA 1FBTA 4RMNA 2RHBA 2XWQA 1CERA 2VBFA 1ZUNB 5I4KA 4EW6A 1RHMA 4DXHA 4TSRA 1XCLA 3F6YA 4DR1H 4HRYA 2HLPA 1I5RA 2CNQA 3QQ5A 5CYOA 5LBIA 1K5GA 1PAUA 1OKKD 2QM0A 4M76B 1FYXA 3GW8A 4ENPA 3ZDDA 1ZW6A 1PYDA 1GV0A 1Z2EA 3DL7A 4DR6H 4OQFA 4TLEA 5A02A 1RT9A 3ONWA 2B35A 1OT3A 2X2EA 1NXXA 1XQYA 2ZB7A 2R7KA 3U4MA 3HOUG 3EPJA 3NBFA 4ZO9A 4DUYB 4AF6A 1GN8A 3F7OA 2VZ0A 1YDMA 2WWTA 5BPFA 2GQSA 1M1UA 4LG1A 3PGLA 1OIVA 2X9QA 1DQSA 5TF4A 6Q21A 4QARA 5CX1B 2IS6A 4G5OA 2OLEA 1L3IA 1BMFA 1CC1S 3AH8A 2UUCB 3EXG2 1Q1GA 3TW0A 2HQOA 3M83A 4Z2AA 4KQIA 3WWZA 1OFVA 3IURA 4UTNA 3ZLVA 3U3JA 4R81A 3E22B 1JQ3A 5EMLA 4ZZ1A 4EO9A 4XWTA 2QMYA 1SCAA 4MQ6A 2QAGC 4G86A 4DIFA 1P19A 3UWKA 2PYIA 3E9EA 4EJSB 5IT4A 4QXQA 1N6IA 4O25A 3BSYA 3BMXA 4MROA 5AM3A 3RJTA 1C9EA 5JJIA 4O7LA 3AHDA 3OFJA 1O9GA 4J0FA 1GRVA 3OM8A 2RHOA 4LOLA 2Q5OA 3DLCA 3HI6A 2XYRA 2AG1A 3MINB 4TL6A 5FA6A 4YREA 3J81k 3REQA 3ROGA 3TEJA 1CTQA 2HD4A 4A3MG 3W05A 3ULKA 3NBYB 2UVPB 1K75A 2RHHA 1X74A 4DY4A 2VXYA 3H2SA 4MUFA 3RT9A 2O1EA 3HFRA 2A4KA 5L3RA 4BNLA 1BXZA 1PR1A 2JFUA 1YA8A 3HWWA 1I4TD 1ZBQA 2Q6KA 2X1LA 3QVMA 3I8OA 4DIEA 2G72A 1DAMA 2XXAB 4Q93A 2XWSA 1TECE 1U7TA 3T7SA 3SZOA 5G41A 5JCOA 3ORSA 4PANA 5LMCA 4FWTA 4IHJA 2NNWB 2RHTA 1U3GA 1C9JA 1R50A 1UBKS 5KHLB 4GUDA 1CQIB 4PAQA 2FZWA 3DAAA 3N9IA 5KB3A 2WE8A 4BASA 4BY9E 3DGEC 1HFEL 4HYKA 3RABA 3R3ZA 2JIOA 2J3EA 4NLGA 3CR8A 3Q6NA 4YMWA 1TQHA 2V3VA 3LUFA 1U1CA 3O3OB 4H7PA 1S7GA 1KQ3A 1G5TA 1SA0B 3IIJA 2KX7A 2MSEB 4IFTA 3GG2A 1X9HA 1BXRB 2WIBA 5C4XG 3F9IA 1VZ3A 2VJMB 5CJPA 4Q47A 1KI6B 3NC0C 5DYYA 1Q77A 4P7FA 3JSNA 3LF2A 3Q8LA 3H1AA 3NBAA 5DT2A 3DDUA 1C30B 5ULLA 3CONA 5C1DA 2WUEA 3HP1A 1WO8A 5BO5A 4P81A 1BRTA 1W25A 4QYIB 3GQBB 1L4YA 4OHKA 3L9WA 1K6XA 3RVOA 1PV4A 4FEAA 1UDXA 1PEDA 3PB3A 4NR0A 1RHJA 3OIUA 1UZLA 5GMOA 4X7RA 2AZTA 1H0KA 4CL8A 2NMVA 2REBA 1DBQA 3HU2A 1U3CA 1GFSA 4KTVE 3L6CA 5F12A 4I4TF 4BBPA 3RF6A 1BHJA 5JH7A 2DH5A 1LRKA 1NY5A 5CT5A 1H2ZA 3BA1A 2FZGA 2AQHA 3V8BA 3SEFA 5G53C 3V00A 4C0XA 5EP3A 3K0HA 4JXJA 3B1FA 3MRSA 2ZT8A 3AEXA 2ZRJA 4KVZA 5KT3A 5FNZA 2B36A 4HDQB 3CB2A 2PXXA 2XTNA 2YDYA 4QRIA 4D8VA 3ZS8A 3RVNA 1X70A 4X7MA 4O2BB 1W5EA 3V8VA 1RAIA 1TA4A 4KSYA 2JCGA 3F9CA 1XMIA 3QV2A 3AJ9A 4EJ6A 5EHZA 3EFOA 2R7MA 2XA9A 1YJ5A 2MINB 3RTBA 2CXQA 2M32A 2PCLA 1T24A 2OHHA 3VX4A 1OU4A 1HYGA 2FPMA 1TKCA 3STVA 2O0KA 3CSUA 2AMYA 1MC1A 1IVSA 2IU0A 1PT7A 4QGFA 3ETHA 3B1JA 2PANA 4QSHA 4P0QB 1W88B 1SJ9A 4PO1A 1QTIA 2G6TA 3FZEA 2FLNA 3QKTA 3FBWA 4FBTA 3TBFA 4M0JA 5KYGA 4GOKA 3C43A 4W99A 5JJBA 4G4SP 1ES9A 2Z1NA 3P32A 3CNBA 4ZQEA 4ARBA 4M0PA 1T8RA 5IANA 4ZARA 2CDBA 3J7AC 3VUFA 1A1VA 1T4MA 4Y6OA 3A6LA 1RQXA 2VDJA 3DW1X 5H8WA 1RJFA 4AYWA 4NH4A 3HVJA 4E33A 3WZMA 1H42A 2A1UA 4OFBA 2ILVA 1SOWA 4M1TA 3NEPX 3DEIA 4ZZ3A 4C3OB 2Q49A 1SU6A 5I7RA 2LDBA 5DNCA 4K9KA 4PZEA 2WIKA 1H4VB 4HADA 1QCZA 3R8FA 4WN3A 1ZQ9A 5ED4A 1AQYA 4V24A 1NYRA 4MJ3A 3NH9A 5FI0B 1KRWA 3G82C 4PS1A 3FYUA 1P5JA 4TWBA 3EAGA 4Q16A 2IYPA 4RWEA 3FH0A 3FWYA 4B2IA 4E1VA 3V5NA 5J58A 2RH5A 1M8KA 5KG1A 3Q10A 2XRYA 4RNCA 3ILSA 4X54A 4BX8A 5ITWA 1NZDA 2IC5A 5DW0A 4MB2A 5H82A 2R47A 2OMKA 2R8GA 1T2DA 4AY4A 4MEAA 4NONA 1N6OA 1U2PA 3CUVA 4DR3B 4C7KA 5EUCA 2IYQA 2DRIA 3BKWA 5KOHB 3TB6A 4CMHA 3AVPA 3GGGA 4C6RA 4BJ3A 4HPWA 3PUVA 2C2YA 4PPFA 4YMTA 4JUZA 2AMFA 4XDHA 1HNZH 5T14A 2OG1A 4L4RA 1EKXA 1WCIB 1XHLA 5BSMA 3E27A 4ZDJA 2E4VA 2HHAA 3OLCX 3G13A 4F8YA 5E6SA 2QGFA 1JJ7A 4RH0A 4ZODA 4DJ5X 2WEKA 5AHOA 1QGAA 4N76A 4RA6A 1JFRA 3ZJYA 2W8ZA 3FR8A 3KM0A 4BMXA 2QR3A 4BVAA 2XQKA 5K09A 3U16A 1ZJ5A 4WZBA 1WXGA 3CT4A 4LGYA 2ESRA 3C3BA 4B47A 4PPNA 1X7HA 5BV0A 3WL8A 2K4MA 3M4JA 1EJBA 4LSMA 2H08A 3W9UA 1XNRB 3UOWA 1P1HA 4W5WA 3L0CA 2F1IA 3WMGA 3R7NA 3QVOA 1WTAA 4U39A 3RUPA 4ZEWA 1D2NA 4BNZA 1NVBA 1H8EA 3AK4A 2A9JA 1VPTA 1NGSA 4KQXA 3IAS1 5LB4A 2ZIVB 5JD4A 1T2UA 1JDTA 3H40A 5EVJA 2Y1FA 3TIGA 1W4RA 2PSEA 2PTGA 1DMRA 4QL3A 3SYTA 5L1IA 4OXRA 5CLFA 3LY7A 4W8GA 3QX9A 2IV2X 1KYXA 5BNZA 2CQYA 4B3FX 3LDHA 4TQGA 1TU3A 1J2UA 3QWFA 3UN1A 2X7HA 2ZROA 3IHLA 4M0EA 3JZ6A 1UEIA 3BPSA 4Y0AA 2W4IA 1VIMA 4A15A 3UJDA 3W2GA 4CF5A 5KCMA 3TINA 5FD5A 3ZDQA 2XDQA 1KJIA 1OZHA 2DU8A 4W7SA 4C88A 3BK7A 4ZVOA 4OHYA 3TZLA 2GCEA 5JBNA 4A91A 2FP4B 2PVSA 2CW5A 4OQZA 4OBEA 5DTIA 1WB4A 4DUPA 2G0TA 3LHFA 4GM1A 1P1FA 3RJZA 3T5AA 5EHIA 4ZOCA 3TSCA 4FB5A 4OFWA 2VRCD 5LQCA 1N7HA 4AX8A 1EBFA 4MV6A 3GOHA 2EAUA 5J9FA 3S2EA 4WOJA 4RC9A 1LPSA 1RIFA 1HE3A 3DFMA 3PGMA 2ZBDA 4P7GA 1MABA 1JI0A 3ZEAA 1G9TA 3AEYA 2YWRA 2XVMA 1E6MA 5JR3A 4O02B 2J6IA 3WYAA 2QPAA 3FSGA 1E32A 5GPBA 1RAGA 3MAGA 1V7PC 5HPYB 2WTXA 4NS1A 3IELA 5H3CA 2O2CA 3QF7A 1UF9A 4CMEC 2A5YB 2LCQA 4DR1B 1YKGA 2XGQA 4XWOA 1OA1A 3WB2A 3RWBA 4E09A 3UVEA 3ZZNA 2C9ZA 4QYSA 3BACA 4R3UC 4FE3A 3VR4D 4CKXA 4DR6B 2QX6A 3K9BA 3JYPA 4UZEA 5JVDF 2P68A 4E15A 3SDBA 3GEIA 2VH5R 3I4LA 2VPPA 4HZUA 1ML3A 4EHFA 2EHDA 4AQYH 4MCHA 2YXNA 2HW8A 4PNZA 3J80W 1Z28A 3LC1O 1LNZA 2GT1A 3LQFA 4I8DA 2IYVA 4EITA 5SICE 2G1AA 4BV2A 2O7NA 3F73A 1RRKA 4BTEA 1J7JA 1GDHA 2P9TA 1N32H 4KOAA 4HYTA 3IEXA 3QVSA 2ZJ8A 2QKYA 2HKIA 4POAA 5KYVA 4J0CA 1GXSB 5DBFA 2JHFA 5C0OE 2QTMA 2W2OA 1YV9A 2YL2A 4ALLA 4YDHB 4CEIA 4JI2H 3EBLA 2VPQA 3BWXA 2ZJZA 2UVRA 2QVYX 3JR3A 4OXIA 3KT0A 5I4CA 1C1YA 4HWTA 1RYRA 1EK0A 3GDOA 4RD0A 4OD0A 1DO0A 2R4UA 4B46A 2XXJA 1WXEA 4GO1A 2IJGX 3OOHA 4CW7A 4UOQA 3PZBA 4MWSA 5K99A 1T29A 1ZJ6A 3J81W 1CHDA 1A04A 4NMMA 3U4AA 3N8IA 1R18A 3TD9A 1L5FA 2I9PA 4I3GA 3L0DA 1T15A 1G1AA 3QKIA 4YXFA 2WKRA 4C0WA 3JQFC 1HG1A 4REQB 3JQGA 4UUBA 1HBJA 2XPCA 2Q2UA 2EW8A 5CFRA 2O3UA 1CG6A 1NTOA 1SB9A 3LYAA 2IF2A 5IH3A 4BXOB 1GLVA 5CA1B 1J6UA 2FW1A 3CVJA 4YJHB 5CXSA 1ABBA 2FEOA 3VKVA 4PSDA 4YUZA 1EX7A 1Z8NA 2C9MA 1YK1A 2I4OA 1S2DA 4P80A 5EE3A 4F4JA 4IDOA 3HP7A 2AFIA 5KTYA 4NNPA 3G5MA 1HURA 3LCRA 3H7IA 2ZGIA 5EQDA 2B83A 4F4DA 4LV5B 3F2VA 4XCXA 3K1AB 5JW6A 1T2AA 1J06A 3BXXA 1C2YA 2GEVA 1YS9A 1UXGA 1MJGM 4KO2S 5KYWA 1JSCA 4TKVA 1IEQA 1NFRA 4UC0A 1X6VA 5ECYA 3IAM6 1Z8DA 3OQMA 4MHTA 5JYCA 4G5RA 5FRDA 2P5TB 4O7WA 4IIJA 4GRIA 1GAEO 5ALFA 4JV0A 1Y3HA 2HGSA 4YLEA 2H5JA 5EI5A 3UHJA 1PD0A 1JDVA 1DWUA 7REQA 4AO6A 5FFNA 4DLVA 1WSBA 3OEWA 3KQQA 1S0UA 1U80A 1OBCA 1NXOA 3H1FA 1Q1ZA 4M9QA 2R7LA 2R4TA 3VHRA 4EA7A 3F1KA 4MEJA 5YASA 5BSUA 4FWBA 3CRNA 1L5OA 3EH2A 3BMCB 2QN3A 4UM9D 4CCWA 2FSPA 4MVWA 4ZT5A 3CYFA 5CH5A 4C87A 3KXPA 3TSWA 2PFSA 1O89A 1YASA 3RVPA 1O6GA 4PYKA 3U2QA 3BJMA 2Y4RA 4CT5A 2WMOB 3IEKA 2OKGA 4P2BA 1KARA 3EUWA 4CCSA 4JC8A 2G06A 1L7OA 3VU0A 4HO1X 2YN0A 3ZJTA 3TW8A 3DOJA 1QJ4A 2NTEA 2C1ZA 5DJ5A 3AJDA 1KYTA 4BP9A 1GNLA 1MTOA 5HRUA 4MRMA 1TF2A 3AMVA 3TTUA 4XTCS 1I30A 1EH5A 1TW3A 4E1AA 5KJCA 3VYRB 3HO6A 3N6XA 1V7QA 3B3AA 3LTEA 4F3KA 2E21A 4WNIA 5GY7A 1AGYA 5F33A 2VDNB 3EUEA 3LLMA 1SXHA 2GYUA 5B2ZA 4XAQA 1FJ2A 1AHIA 1DJOA 1P17A 1UZAA 3CCFA 2O8FB 4KX5A 4B83A 4AJJA 1TU0A 4DYVA 1V11A 1V5WA 5TQ2A 4LKOA 3OKCA 4YRPA 4FMCF 4M9RA 3TLXA 1H4SA 1XJQA 1YOBA 1HYBA 5AJYA 2JHGA 3O8BA 4DMFA 4DUZH 2FV8A 2NXCA 2TS1A 2E7ZA 3UC5A 1QGYA 4O84A 1KPHA 3AU8A 5AVXA 4HVLA 3EZYA 2JBWA 4YPFA 1WOYA 3I72A 1LWNA 4ZU1X 4BEWA 4Z53A 1E9AA 3CKLA 3D4NA 1TUGA 2DX7A 5HVNA 4X7BA 5COQA 2FUG1 4IIUA 5A4KA 3D8SA 3OZXA 5HG0A 4G23A 3ND5A 1S2MA 2NSYA 2W48A 2Y0EA 1SG6A 4JASB 2Z4SA 4FFBA 3RU3A 3PNSA 5DBIA 4WNCA 3IAFA 4MH0R 4JI3H 2UZIR 1KYIA 3G2NA 1O75A 5DHPA 2CBGA 3O91A 1ZD3A 1JHXA 3KJZA 1S96A 2YWEA 1GWNA 3WK5A 2GEKA 4B2LA 2CL5A 3LQ1A 2D1YA 4YC7A 1JALA 4F4FA 3BZWA 3IT0A 2V7QA 4EG3A 4PPQA 3DTFA 1R8YA 3G8BA 4D5EA 1TF7A 1VSQA 1KQOA 2ZSBA 3RBXA 1JR3A 1G20E 2WTNA 4F9TA 5ES4B 3Q3VA 2NVUA 1YFLA 1UJNA 1ONPA 5KNLA 3ZLBA 4P53A 2XW6A 4PRLA 5IWAH 1K9SA 5L1JA 4M89A 5E0KB 1NBOA 1QKJA 5J4HA 2HMWA 5CLQA 2DUNA 1WDKA 3VAYA 4NATA 2AFHB 1KR5A 2WVAA 1ESZA 4HDRA 2DETA 4FGJA 2O1WA 3OQ6A 4OKIA 3FLAA 1I3OA 3FMFA 2QTWB 1FOEB 1VCHA 4O4LB 3L93A 4JCCA 1YTUA 4X1KB 3A36A 4EG8A 4BLQA 2RC6A 2YCLA 6LDHA 5CA0A 4Q1DA 1U2DC 1QH1A 2Q5CA 4XB1A 5H16A 3ES9A 8ATCA 1BDMA 2YC2C 4DV6H 3FPAA 4U7CA 4RIFA 1U6KA 1GGNA 3FHJA 3NGMA 3EZNA 3IUNA 2YC4C 3E9RA 4Q43A 3OX1A 4UQPA 1QHNA 1XUOA 3GVIA 4ZAWA 2DQSA 1V8PA 5TR9A 5JS6A 2P9HA 4FBMA 3S2YA 3PW7A 2JA1A 2PRKA 5I5YA 4G1UC 3P4UA 3GTPA 3G5UA 5LP6A 4U7DA 3PHCA 2ONZA 5IP5A 1VCOA 4G1EB 3BKXA 3KJEA 2H1WA 1OVMA 4X8OA 5LZ2A 1HNZB 2OXIA 3ETEA 4EQZA 2YWBA 1VBMA 2WHRA 4GMXA 4ASUD 1WZEA 3T9FA 1JKXA 4PO9A 1WB6A 2WPDA 3EMVA 2NO1A 2Q50A 4J16C 4UNIA 1DQZA 4AY3A 4A6EA 1F6DA 2IYSA 5GGXA 4XVRA 1I3QA 3OTHA 3QKUA 2PG3A 3L1UA 4HRVA 4KODA 4EAQA 4K6FA 4JUAA 4IJ6A 5C4GB 5T3UA 2XODA 1WMAA 3H97A 4HEA6 2OCPA 3CUTA 5JWHA 2ZVQX 2Z09A 3ZXIA 4EGSA 5EE5B 5CVJA 4KGVA 3LUJA 2II6A 4WBXC 1D2CA 1TAQA 4FFRA 2V55B 3VZSA 3VPXA 5ITVA 3FCYA 1WSCA 3MJVA 5BYBA 3W1VA 5IT5A 1W73A 1R9TA 1WLYA 1P73A 3BS4A 4DUYH 3F74A 4A1FA 5BN5A 3MTGA 1BWPA 4LSAA 3U3KA 2JA7A 3LPDA 3OBIA 3WGYA 4QOSA 5B4UA 3PQ8A 3Q7QA 5IC5A 4BBSG 3TFQA 3NHPA 5C8YF 3A3PA 2JPDA 3KZKA 1SD1A 1US8B 5LBTA 5CG2A 1U2EA 1DVRA 2UUCH 1XZCA 2J07A 4GBED 3O8OA 4J1TC 3RYIB 3E9YA 1O6FA 4RULA 5DXAA 2X76A 4U3JB 2J9GA 3PXUA 1GNPA 1SOVA 1Z3IX 2J41A 4OSPA 3K6KA 5JADA 4LRXA 3Q8MA 1HEIA 4ZRMA 2NSHA 2JAWA 4I55B 4KR9A 4EUEA 2IYZA 4KTTE 2HSDA 1C4OA 1DAGA 2QZJA 1TJNA 2CZCA 3U62A 2GGSA 2VBIA 5TC4A 1XN4A 3UA3A 3WYFA 1S0MA 3N8GA 2I87A 2COJA 1I8TA 1SKYB 5IARA 1YQEA 1U3TA 1EX1A 1ZC4A 5LA6A 2GXUA 1ZIYA 1R15A 2K5UA 1HY3A 1P7PA 3FFXA 1JTVA 1VGQA 4JBIA 4TYNA 2FMFA 4ED6A 1WW3A 4YMIA 4HGPA 1PWYE 1SNYA 4Q7JB 4MUEA 4AP9A 4MW6A 1T6NA 5DQGA 4X1YB 3IDFA 4BTLA 1PNOA 3CLRC 3UYKA 1AHHA 3DZCA 2CN1A 1M66A 2XMCA 5JROA 3V3TA 2FSSA 3GIPA 4P4UA 4WASA 4Z9BA 5GVSA 4PPYA 5DISB 1U8XX 3WRYC 5CW2A 5FOUA 1PEAA 5E25A 3KSBC 4RTNA 3OA2A 3MS4A 2P0YA 3LX6A 2HIAA 2YNMC 1T3TA 3U6BA 2J31A 5JSYA 4O29A 5AK6A 4AQYB 2XLCA 4UAGA 3M9NB 3JSAA 5EWJB 1T1EA 1W48A 4Q7QA 4B35A 3MIIA 3AR7A 3PNVA 2KPOA 5BWOA 2I6FA 3HXKA 3IULA 4ETIA 4M0DA 1U4NA 2CD9A 2F8TA 2C98A 3L0BA 5BV1A 1L6RA 1EE2A 4F8JA 1JG7A 3HZRA 1HQYE 3AOEC 4XTRA 1RACA 4YDRA 3C3KA 3PENA 4JI2B 4PXYA 3CKKA 2V0GA 2MCFA 4KO3S 3L1VA 1VRCA 3AX6A 2XVXA 4K0RA 4G8CA 3NBQA 3H20A 4MVJF 4Z3KA 3KZ1E 5AM1A 4RKEA 4JI0H 5FPKA 1UJ2A 1J2TA 3NGXA 5FNVB 4AYBA 4QD3A 5AP9A 2VDPB 4LJ4A 1A27A 1SXJD 1CHNA 2ORIA 4HP8A 5JPIA 5AW9A 1JXOA 2Q29A 3QWAA 2GB4A 4XYMA 3KHRA 3D7LA 3FJYA 2EGHA 1NVEA 1PVOA 5B4TA 5JMPA 1KBOA 1SQFA 2CFIA 2KQUA 4ZKDA 3LHDA 1YS2X 4HX2A 3S81A 2VUHB 3F67A 5T4HA 2Z2IA 3UPDA 2N1MA 2VT2A 4URWR 4F1JA 4ZV4A 1BW9A 4MS3A 3ZR4B 2O20A 1RS0A 3KQSA 4DOMA 1Z7EA 1VSTA 5KFDA 4N39A 2ST1A 1P7WA 5I7FA 1L5HB 2RBGA 4YRFA 1F2TA 1NI5A 3HO1A 4I50B 3TL6A 3KQWA 1NW3A 1NXWA 4X8LA 3UHAA 1JXAA 2N75A 1C29B 4MUJA 3D5EA 1Y48E 3O47A 3STHA 3KEMA 1RKBA 2I62A 5EJAA 2D5LA 2IXDA 5T41A 2HYIC 4G0PA 3IV7A 3AGPA 2IFTA 5G0TA 3HDJA 3T3HA 4LV6A 3NBZB 4ZYXA 3VGPA 4Q24A 2GDJA 3GUUA 4ZC8A 2F4VH 1NJFA 3GEDA 3DWIA 1CB0A 4B76A 3IPAA 2QIPA 1PSZA 4HN9A 2YASA 1N2XA 3H3JA 1TM3E 4Z9XA 2D0OB 4Q5IA 4QDUA 4YR9A 5BSWA 5T7BA 3H83A 2O3SA 1CIPA 4FYXA 3TMYA 1PBNA 2YFQA 2AGPA 4GGOA 4C30A 4XD7D 4JJZA 1XNJA 5F78A 2R8JA 3ILVA 5LQNA 3I9FA 3SU8A 3H3FA 2P6PA 1PCXA 3N53A 5ITZB 3JZAA 5G0VA 1ZR4A 2ZM6H 1PP4A 221PA 3LGAA 5CJJA 4UBOA 1QRAA 2C2MA 1AUXA 1E98A 5CBPA 4AZ0B 3V3KA 4ED3A 1RQLA 1H2RS 3A11A 4AW9A 2P0EA 3ZNNA 1XKQA 2BVNA 4C4XA 1AY0A 4XCVA 1FC0A 2LCIA 4J7AA 4WHXA 5DM70 4A23A 4FGLA 1XPOA 3TJMA 1NFFA 1ZCAA 3T1VA 3W3ZB 5TY0A 3DVSX 2YMMA 4AJ2A 3K0KA 3AFOA 4JR0A 4HNSA 1IN8A 3R6LA 1O6CA 3W5CA 1FJXA 2Z2JA 2ZRDA 2ATLA 3NLLA 4CQMA 4BIMA 1QIFA 5LOVF 4Q4LA 3W7AA 2Q6LA 5FLMG 3AHEA 3L92A 1F6BA 5GJVC 1ADJA 3KTDA 2EZ9A 5IT0A 1O4WA 4GWGA 1CT9A 4RO0A 4JJAA 4JP2A 5AFSA 2V4UA 2I4TA 1KT8A 2Z95A 3AO0B 3OVMA 3HKCB 4DUZB 3TZEA 1I10A 1DWOA 5K05A 3ZHRA 4ENRA 2ANBA 3KQNA 1H23A 2QF7A 4D8XA 4KDEA 1QHYA 1Y7TA 1CQPA 3U7RA 3PUXA 4DR3H 4F4WA 3WVNA 1RLUA 4UXJA 2DB3A 2DUMA 4J9PA 4RD3A 5LL6b 4JV2A 3OCWA 4O4IA 2B0JA 4LWPA 3JD2A 4ITRC 2Y76A 4LF9B 3H8VA 2IQIA 1II0A 1AZWA 1F4PA 3Q8SB 3N2LA 2P67A 2AE1A 4C05A 1BE8A 1VG0B 1WBDA 5FBHA 2P1RA 2Z56A 4LXTA 3OJEA 5LQRA 3M3PA 3CTPA 3MR5A 4R4JA 3N8NA 3P9KA 1UMDA 3ROKA 4N03A 4ZDKA 4L8FA 4J9KA 2I7VA 3MCWA 1IWPB 2A0UA 3WB1A 5C5IA 1T2FA 5KTMA 4JLJA 4AF7A 4TV9F 4P92A 1VYTA 3A7EA 1XQ6A 3LIPA 4QWWA 2FQWA 2JLSA 1Z73A 4MRVA 3Q7IA 1OYYA 1QAMA 3UA4A 4TWJA 3OT1B 3WSWA 4RYLA 1T43A 2ZWAA 2HV9A 5IWAB 4B6FA 3CX3A 1MT0A 3ITDA 1YRYE 2V74B 2A58A 2OHVA 4C5BA 3WWYA 1E4EA 4FC7A 1YQ9A 4HBZA 3PA6A 1R74A 1GFWA 4JGGA 1O03A 3VOTA 3IHWA 3JAKB 3H6HA 1OI2A 4BO6A 3GMSA 3EF3A 1TAGA 3NIFB 2BFDB 5DNEA 1H8HD 1A5TA 2MSDB 1L7EA 4L3OA 3PJFA 2DPYA 5ALRA 4E5SA 1EFUA 2ACKA 1L5NA 3WLIA 2ZE7A 3TGLA 3FNGA 4DV6B 3D81A 2UDPA 4NCHA 3DF7A 5DLYA 5M5BA 2W2NA 4G8BA 1P9LA 3ZWWA 1TUBA 4TTAA 2QRPA 3L8EA 4ZA2A 3DP9A 4RK5A 3CCBA 1WY7A 3B5JA 3SHWA 7AT1A 4F38A 3N0VA 2Z9DA 1VB5A 3DL0A 2CSXA 5T4FA 4A0HA 4RA9A 4GPEA 1NNEA 3PNKA 2AEEA 3GUVA 1MAVA 2XIQA 4D6PA 5INTA 4D9MA 1QZXA 5KNDD 4A0GA 3ND8A 5G2OA 1I4DD 1QYVA 3R1IA 1DG1G 2J3JA 3NI2A 1T9DA 1G21B 2F3SA 2ZRQA 3KR9A 2Y68A 2AIRA 4X90A 4EBDA 3LIIA 4ALNA 1XXHA 1BKDR 1MOZA 4OB8A 1E79D 4AQDA 4J0EA 3T38A 3HMKA 3TGPA 4CI9A 2A0WA 2RBEA 1FSGA 4CDNA 3WK9A 2LWIA 4LDQA 3SF8B 1E3IA 1BA2A 1I1HA 2PO5A 4BHTA 4XVCA 4N47A 1MJHA 3CA8A 4TV8F 2YRXA 1PUIA 4R9UC 2W6MA 3KDSE 4AMVA 3ZE7A 3RUFA 4M1KA 4H1WA 1GG9A 2J4FA 5CW1A 1W29A 2FY8A 1FVOA 2O7QA 3KRTA 1Q3TA 4YAEA 2ZYIA 1L5YA 3HHPA 4DZZA 2IIQA 3IE2A 3RANA 2I4IA 2IYWA 4V03A 4ZT3A 2NO9A 2P2YA 4PZ9A 5AW3A 1WF6A 2GFHA 2FPLA 5TS3A 5EHNA 3NVDA 2PMBA 1J8DA 4YAKA 4PICA 1H65A 2W9CB 4PYQA 3T7TA 4FHZA 4HI0E 3JV7A 1LVGA 4M46A 4EL5A 3EZ7A 2FOLA 3CJRA 4LMYA 3F8TA 2I8CA 4CQLA 4JB2A 1E7YA 2Q2WA 4G0VA 1P0MA 5CLIA 1KY4A 2FJPA 3LKZA 3S1SA 4YP3A 2YOFA 3TKAA 3MN1A 2QYTA 2Y2VA 5C44G 4URHA 4LPSA 3WLPA 1S9HA 3QPCA 3AI1A 1ZINA 3LVBA 2H0AA 2GHIA 3N8KA 3A1FA 2VAVA 3EXAA 4DCMA 2H54A 1AXGA 4WD3A 1B6RA 4M1EA 1V7CA 1BXGA 4Z9FA 5HUHA 1KMQA 5IU6A 2WB1A 3H4TA 2C4WA 1EE1A 2JI8A 2V7XA 1W8IA 1WCWA 2D4AA 4R2KA 2W42A 4HWPA 3EZXA 2PKXA 1QQ5A 1TFUA 3WWJA 3GRPA 4BFSA 2C03A 4Z4CA 4RVDA 3RVRA 2GPWA 3VDXA 4BXXG 2FE4A 2OCBA 5AKHA 2NSLA 2G5TA 3B85A 2ZIAA 1N6LA 4FR0A 2QE7D 5HNEA 1A4IA 1XEXA 3EAFA 4CPDA 2OL4A 5I5VA 3CVVA 3G1TA 4OQ4A 4WKPA 3QVVA 5G1PA 5ALEA 1Z4LA 1KI2A 4Y2TA 5J2TB 2NT4A 3BE6A 4BFLA 3DT9A 4COKA 3E58A 5SZIA 4OHBA 4O63O 2DF8A 1C7IA 1I1NA 1C8LA 2RK6A 1B26A 1M34B 1WPGA 3WYEA 3ANMA 4HXFB 4DEXA 4KR3A 1M2OA 3KKPA 1UKEA 1D6NA 2WSSA 3CVWA 1DDOA 3IXQA 5D6NA 3L8YA 2BTOA 4BFTA 3K53A 1Z5WA 2HZBA 1SBYA 5F76A 5JSQA 3QVWA 4HFNA 3HJGA 4N82A 2A3RA 2E4ZA 1QVAA 2ODAA 3CPJB 1UMBA 3VBCA 1HGXA 1CY7A 4CMBA 3AESA 4QATA 4PU0A 4P5DA 2FZKA 3BFVA 1B2LA 3HKZE 1CK4A 1TYCA 2ORED 3ETLA 2EFGA 1LVUA 5E6RB 1RJRA 4X0EA 5JFGA 3RRJA 3OP4A 1BD4A 1HQCA 1PJBA 2Q3DA 4KDCA 2GN1A 5IAKA 5DNUA 5HZMA 2FDCA 3MW8A 2OZLA 3QI2A 3PD1A 3K96A 4O86A 2AWOA 1UBJS 3PUJA 3LBFA 4Y6QA 3TUJC 4NENB 2OE2A 4UCXA 1J23A 1KH1A 1TO1E 4NCNA 3GG9A 2A0YA 4WN9B 4DQXA 4FYPA 2WWWA 1SYXB 1XAJA 2JKYA 1I2AA 3DTVD 2GYYA 4AUMA 4RJ2A 4JLBA 4JGBA 1RYDA 1V6SA 4JI0B 1JLSA 2ZDGA 3E15A 4ANFA 2R86A 4BWVA 1OLXB 4JQOA 4DWJA 2CHUA 4C3VA 4EX7A 5KYXB 5IT9A 3REOA 4J7UA 4WLOA 2FEWB 3AEKA 4HVCA 3BD6A 3N1UA 2R1VA 2Q7DA 1NXQA 3KKKA 4X6XA 4OY3A 1YDEA 4MRPA 2O3TA 3I3OA 1QVRA 3P2YA 3IXMA 1KEEB 3HK2A 1RSZA 3ELBA 4BKRA 5THQA 3UY4A 4JBGA 3RRXA 4YAJB 1L8QA 4H2DA 1QTQA 4YYZA 3PF9A 2E82A 3Q15C 1G17A 3IKVA 1ZHFA 1ONOA 5ARCA 5LR6A 2ANCA 4CIYA 2WJAA 3U5ZB 2HA5A 1MAHA 4U8HA 5AWFC 2PMFA 2QMEA 4MGYR 4J9OA 5FUYA 2PZMA 4H7IA 4AZWA 1FNNA 5JNSA 3Q1LA 2V58A 1O5TA 1QWOA 3U1BA 1ZH2A 1ZJYA 4ZJYA 3KKEA 5LU8A 1R0YA 1T5HX 4IJQA 1ORVA 5KEIA 1HNWH 1XFAA 3HYTA 4EAAA 2BGLA 2UZ3A 2F4VB 4C4YA 3TLGB 2WF7A 3COSA 4QIWE 1JQDA 2Y9PB 3FWKA 2G4CA 3FY4A 2B92A 5A7GA 2NU7A 3MWJA 4G09A 1I3LA 2IEDA 1TLLA 4DCVA 4HNUA 5BOVA 1YBHA 4TS3A 3BCSA 2VTVA 1ODJA 2XWBF 5CURA 5AVJA 3PFBA 2V1XA 4QPCA 3RVSA 1FMLA 2YXDA 3QLVA 5I51A 4BY7G 4LOJA 2ZM6B 2RGXA 1OH8A 1DRVA 3WQHA 1IUKA 1R64A 4JITA 5CFQA 3P0EA 2WAXA 3UPUA 1VHJA 1Z4KA 1RC8A 1JSZA 4UEJA 1P4GA 1HLPA 1O8CA 1G38A 2YBEA 3IOCA 2BMWA 1B42A 3RVDA 3UXEA 2B1QA 1SRRA 3EOAI 1SOUA 3T9DA 4QREA 9MHTA 2DM6A 1TK9A 3SKXA 1D6MA 3C8HA 2QA5A 1WHSB 1IHOA 2H51A 5B3LA 1IZ8A 1WMEA 2REXB 4P7BA 1VBKA 3RAXA 2PQ6A 3L8DA 1YI8A 5FTJA 2PBRA 3ROZA 4H6WA 3KLPX 3EGOA 3CG0A 2OV6A 2VDWA 2A5GA 1N57A 1A9RA 1Y8QB 2RAPA 1C0KA 2A5JA 2XRMA 5BV8A 3GYGA 3WGZA 3S99A 2ZBUA 2VKQA 2RI6A 2RB4A 2HX1A 2BH9A 2ODTX 1G8FA 2WPNA 5I01A 1H9AA 3MWMA 3QMMA 1C0EA 3MWDB 1OI7A 2AEMA 2JARA 1I2LA 3WNBA 2VUSA 4RQTA 2JATA 2L42A 4GWKA 4EFKA 4MZDA 4Q9NA 1ZK0A 4QWEA 4RPCA 4O82A 1G55A 2OV4A 5BQOA 1SMKA 3ZPXA 3M5PA 3BXPA 1PQ4A 3AQ4A 3GZNB 3LFTA 3QYAA 4A1OA 2QK4A 1FVIA 2ZFUA 4O0LA 2WJ4A 1QE5A 3NZEA 4IDQA 4IIBA 3VA7A 1A7UA 3N43B 4IICA 2Q1XA 5DOVA 1NP6A 2YXBA 1W0JD 3IR5A 1XMXA 4A8TA 4AX4A 5BN3A 1J00A 1ZDMA 1KP2A 4UTRA 1XVLA 3JWIA 1E2MA 1TO6A 5JS1A 4B5LA 1D2HA 2Q1WA 4W1QA 3ZD7A 1G0OA 4QBTA 4GKAA 621PA 3FPEA 4FGUA 1C0IA 1Q21A 4HGOA 2XVYA 1YR2A 3IILA 4EMTA 3QELB 3PQFA 1LH0A 2O8DB 3PL1A 1JEAA 4FP9A 2LKDA 5HE8A 4A73A 1G3UA 5D7BA 2PSDA 4WZAE 3P9QA 1Z88A 4EEZA 1LBQA 4ZP1A 4NF2A 2BGMA 2VDUE 1BQ3A 2GF9A 2C1XA 2WAQA 1MAAA 3SZLA 5I9LA 1T36A 5BQ3A 1MVLA 1XTJA 5DG7A 3F0TA 3N7UA 4G0MA 2AU0A 1NMSA 1JRLA 3W5IA 4QEDA 4V39A 1WQ3A 1OFUA 5FLKA 4ZK6A 1DKNA 1QK3A 4OSOA 1NLUA 1QYXA 3FPGA 1ACLA 1W35A 4IJKA 2PSSA 1OX4A 1OXSC 2XRFA 3JRNA 4I9NA 3LMLA 5JQGB 1Z68A 2OO7A 3LLCA 1XX6A 3FOEC 4UPVA 3CG4A 3AY0A 3HQ4O 3JQ7B 3MUNA 4MRRA 4QJ3A 4RXMA 1L4GA 3DBIA 4PG5A 4G3IA 1RJ9B 4KFUA 4PNHA 4EO7A 1TQ4A 3WHIA 1BNCA 2AEJA 1UM8A 2ZULA 4IUDS 1JG4A 1R0BA 1LFAA 3K9FC 4RHXA 1STOA 5IDQA 4O8ZA 1X7XB 1KFBB 1Y4AE 4BP8A 3R0IA 4DUGA 2W7PA 3ZE2B 1XJCA 2NOAA 4DBZA 3R9KA 3BG5A 2R2AA 1U1IA 2WF8A 4BS9A 1CCWA 4B7CA 3GGSA 2NWQA 2Y0DA 1QGDA 2O2EA 3GV8B 2ASLA 1QSGA 3RTCA 4S12A 1FY2A 2YIJA 4BNIA 5B55A 4YRJA 1OJLA 5FPOA 1MO4A 4MMZB 1YB2A 2X5JO 3BB3A 2FGJA 5KFWA 3ZHQA 1EBBA 1SC9A 4CM9D 2IX3A 2IWRA 2IYLD 2AEFA 4Z0HO 1DAKA 2QN9A 2AGQA 1I1KA 3WICA 3PR4A 4JVMA 3UIEA 3WNQA 2VTKA 3N3AC 5BOSA 1PFYA 1I36A 3ACDA 1KP9A 1E6UA 2V98A 3H9CA 4EVIA 4UM7A 3FMAA 4IVRA 1Q0LA 1Y5IA 3WB0A 2EFEB 4I5GA 4PSVA 4GX2A 1JS1X 4UE3S 4YYEA 1W581 1GSIA 4RGBA 1HE4A 4WINA 2QI9C 1TTHA 1KEZA 1IM2A 2CNUA 3FCEA 4J0KA 1P72A 4PLTA 2QSJA 4AYXA 4WKOA 1KJNA 4M9ZA 2D2XA 1JDJA 2E0IA 1VDZA 4CR6A 4X41A 1JKJA 3D3JA 1UMCA 1DX4A 4XW2A 5H1YA 1O97D 3CXUA 2MYPA 4PRZA 3HI4A 5K8JB 4AZVA 3QEAZ 3FUUA 3IOEA 4R8KA 4OFZA 3AY6A 1N0HA 2RG7A 2F1RA 4UMFA 1VHDA 3KP1A 1OAKA 3LVRE 1OI3A 3FDJA 3IBYA 1DIBA 3SZRA 1E0KA 1RRMA 1RWMA 2DSNA 4UATA 4RDIA 4PZZA 3SS9X 4MTEA 1RWPA 4KCGA 3GRUA 5FI5A 2QTZA 1U0LA 1MQSA 1VA4A 1ELOA 4UAVA 1W34A 2E18A 3CR7A 4MPTA 3O73A 1LDBA 1P91A 4Y0NA 2E49A 5EKTA 4RMGA 1GPBA 4D3ZA 3LLUA 4DLPA 1N5KA 2YVAA 1Q91A 2FMKA 4NAVA 5JRJA 3DO6A 1Q15A 1CJCA 5B1IA 2DR0A 3BAAA 3D8NA 2QBYB 1WB9A 1Y4UA 1H3NA 4XIYA 3QG1A 5TF0A 1W44A 2WAMA 1NQWA 1GDDA 3Q6MA 3UF0A 5LM3A 1MW9X 1J22A 4NMWA 3TUZC 3Q40A 2WZDA 3PDIB 3D8UA 3LUGA 4CGZA 1CNMA 1UDAA 2Y1XA 4Q7KA 3M1IA 3GA7A 2JLVA 3JATB 2OHGA 1PKXA 2IS1A 2RF4A 4NFYA 2W6ID 3KL2A 2QY9A 3OQHA 3OZUA 4N5DA 5HFAA 5CDGA 3DUFB 3NKFA 1RE0A 2HA4A 2IDMA 4NXNH 4RHEA 2X0FA 1XQ9A 3CPSA 3O1HB 2O19A 1H6AA 3IFSA 3BA6A 1GNTA 4RV5A 1XD8A 1IDOA 4LMBA 2PGXA 5H3HA 1IUPA 5JS8A 1X2EA 4RLHA 4TROA 1QLJA 2HLDD 2ZWVA 2JL1A 2PGLA 1N5IA 3MNFA 4PHGA 3G9UA 2PX2A 2NZWA 4A3CG 1UXOA 4O0MA 1SUBA 3JWPA 3FUCA 5KKNB 1HWYA 3OEHA 4OMCA 5JCJA 2FPPB 1SU8A 4XUDA 4EEKA 1G42A 1WZ2A 4N49A 4RVHA 4G0YA 4F6RA 4IJWA 2QMHA 2BM8A 3V1NA 1QIJA 4UHBA 1G64A 1ZN8A 1Y1KE 1SCIA 3WYDA 2GI4A 1ZQ1A 4GZ3A 3ZI4A 3AUKA 4QW8A 4QWDA 1NP3A 1B43A 1YJCA 2RG1A 1PI3A 4LXQA 4F3RA 4PW0A 1USGA 3WLNA 2NT3A 2H3EA 3MMXA 4I4NA 1H3FA 1PZNA 3TR5A 2QLNA 4TMZA 3N59A 4Q18A 4DMLA 3I92A 1B8NA 1OFHA 2QN1A 2JLXA 2ZQ5A 4UARA 4F46A 4NZNA 2A5FA 4EB6A 4EUKA 3I4FA 3A9RA 1CU1A 5I5XA 4K8OA 4YB8A 4EYSA 1SPXA 4HQRA 3R4CA 4GVPA 1PT9A 1YZLA 1ATIA 2H2HA 1IAQA 3E0XA 3DE0X 1VE1A 1K0FA 4PN3A 5DIFA 3JWHA 2JIDA 2CDNA 2O6LA 4DPKA 1QC5B 3VU9A 3OF2A 4IHJF 3PUYA 1IZ7A 1N9KA 1FTWA 2BCJQ 4MGZR 4JWKA 1D0IA 1CDEA 3T5PA 1ACJA 4B6PA 2H2AA 4EYHB 2HJGA 4CM3A 4DGSA 3MGGA 4WFKA 2WKWA 4CKEA 3KELA 3I12A 3ACBA 3RC8A 2HU7A 1THZA 3SFZA 1OU0A 10MHA 3HKEA 1DKOA 2B63A 1KEKA 1GEGA 4YDQA 3R6WA 3BB1A 2IHYA 1NSFA 2CJFA 1B33N 3EASA 4E13A 4N9QA 2YY7A 4CKWA 3UMGA 4R8MA 1V4YA 1IN6A 3R77A 2WYWA 1G2PA 4PGHA 1FNBA 4K9SA 2GD2A 3HVHA 2C3MA 2YVQA 2FLKA 3GJTA 2BV3A 1JQEA 3JCZA 3UICA 1UADA 5I9SA 4K9DA 2RKOA 1HNWB 4LF9H 1IN5A 4ND7A 3IAUA 4IRMA 3P45A 2Z8YA 2OQRA 3H2HA 3KO8A 5CIYA 1W87A 3LUHA 3QEMB 3R5SA 2WJ3A 2IPLA 1XZMA 1TT5B 1PFWA 4FX5A 4ZI3A 4C4SA 3JQ8A 4ND2A 3O0DA 4LY3A 1NFQA 3DLIA 3CUSA 1Z9BA 5KT7A 4H7KA 1ZVKA 1KKUA 5AOAA 4W9NC 4RACA 1GG2A 2EKLA 3WJAA 2ZE6A 4WMLA 3B3GA 4GOMD 4V3BA 5HUQA 4RB3C 4DG8A 1MB4A 5I7UA 5EY5B 2CB0A 3KQPA 3DXYA 5IDVA 1G8SA 3DWGA 1T2EA 1X14A 1YJ8A 4XDGA 4S2EA 1YL7A 1QHHA 5IVKA 4M22A 1TI7A 1E1QD 5FPTA 5LMUH 4INJA 2VH1A 2EVWX 3T1HH 3ER6A 2FF5A 5JH7F 1VMIA 1VKJA 3WE7A 4JU9A 1MUUA 3TDNA 4PE5B 3ZD8A 3CT6A 2OV2A 2IL1A 3B9PA 2QENA 5AVUA 4X20A 4KDFA 4PC6A 2QX7A 1GZVA 1KI9A 1Y81A 3OC0A 2BHNA 3RRNA 1PJZA 1QTRA 2R65A 4A8JA 3IVXA 2YFKA 3D3WA 3VYTB 2D5CA 3RK0A 3TRHA 4I1IA 4LX8A 5FKJA 4ZCPA 5F77A 5L7YA 3OESA 1WXWA 3UAWA 5AKLA 4F4UA 4O4JA 5F9LA 2VF5X 1ZUNA 1GZHB 2Q1TA 3VYWA 3O8CA 1XEFA 4EBBA 4ZAGA 1GA6A 1XJWA 4YMVA 3UFXB 2DVMA 2A30A 4U5XA 4OMFG 1XDDA 5AK0A 1OC4A 3BDVA 3FDIA 1K06A 2PTHA 3FN4A 1VG1A 4YRLA 2XMQA 3BM5A 1LPOA 3AF4A 4QDOA 1Q2UA 1C8BA 1B0UA 3I64A 1NY6A 2IHZA 3OY2A 2WVGA 4HYEA 4X61A 5H5JA 1QNLA 1PZFA 1NVVR 4CGYA 3DNFA 1Q17A 3LDAA 3CE6A 1RYYA 3LYHA 1TKRA 3EIQA 4P3KA 4PBRA 1FDUA 3A2KA 1K5HA 1XR3A 4ALJA 1MH9A 1KAQA 1XKTA 3O4VA 5HHTA 5KREA 1B4DA 2ARKA 3H9EO 1V47A 3Q7SA 1KAHA 4EVQA 3PLNA 2ZIFA 3NUQA 5AVZA 2X1VA 3VRHA 4AJPA 3WLKX 3C0FB 4ACAA 4I0WB 3BRWA 2YUTA 4EP1A 3ZE6A 3C6XA 1O96B 2FPWA 4BQRA 5IP7G 5CX1A 3WXMA 4TS1A 4NU5A 3GGDA 5DW3A 3U9LA 1JDUA 5ABPA 2H9AA 3ZY3A 4G07A 4EELA 3YASA 3HU5A 4F85A 3OAAA 3AR4A 3R0JA 3E22A 4GD3Q 4CV1A 5B6IA 3N70A 1F5NA 3G23A 1M8GA 1Q74A 1GGJA 3P96A 4CF7A 3IEMA 2X6TA 2G70A 1CUHA 5EE9A 5MHTA 1DAOA 1PS8A 1SQGA 2AUTA 3K1YA 3KCQA 3F6PA 3IYLW 4ZVSA 1JIUA 4D3FA 3AM5A 1Z75A 4P83A 3W0LB 3EWNA 3FTDA 1U99A 1ZU5A 1DC6A 1JWBB 3KUUA 4ZKEA 1JAXA 1UBFA 5F7XA 3PDCA 1E1RD 5LDHA 4JP5A 3MINA 2PLRA 1T4BA 4JOQA 3OQIB 3RUEA 3FNEA 3O3MB 3NASA 2C2ZA 1AKQA 4FW9A 4S2UA 2UVPA 4PLWA 2OSVA 3W8RA 4N1AA 4EGCB 2HBRA 4NKRA 1XQWA 3GRAA 3TJZA 3GTQA 4FFNA 5ILGA 3GLQA 4ER6A 1XK7A 1UBOS 3U4DA 3NDPA 3L6EA 1L2TA 3N2GB 3PEUA 1A69A 3PYLA 1HT0A 2NVBA 1WDTA 2C31A 1H05A 4F7DA 1FMTA 3U48A 2XXAA 5CDSA 4FDTA 4GZMA 1UK9A 1CUWA 3BMNB 2V8BA 4LXGA 3CRRA 4G84A 4MUXA 4YBRA 3TXAA 2I7CA 3DHYA 1Z6PA 3WMRA 1E69A 4MR9B 3PEFA 3D43A 4URVR 1CQIA 1KH2A 1XZHA 3GLTA 1TZKA 4JDPA 5FV4A 3OLVA 3N7TA 2GLXA 5IJZA 1AMOA 4BNJA 4EG5A 4CL2A 5IDXA 2RJ3A 4UVGA 3HKDB 2XOKD 3SIXA 1SG9A 4MTCA 5EIEA 4MCAA 4O7YA 1VP9A 1XHFA 1T6BY 2PZJA 2MR6A 5TJ9A 4B43A 1SA0A 3QUSA 1F4LA 2O14A 4M49A 4PYRA 4BZPA 4ED0A 2XSZD 1ORTA 4GC7A 4PZLA 1UXKA 1E5XA 3G2OA 1X77A 4XJTA 5KFBA 1BXRA 2QQ5A 4YALA 3TGWA 2JFQA 3RNOA 3QE9Y 1KI6A 4LRQA 2CC2A 3GR6A 4UEKA 5AXAA 4PBCA 2ZPUA 5KJ1A 4U7JA 1C30A 5KYKA 1N4DA 5JZMA 3DE6X 4U2CA 3GB9A 4NK5A 5ALDA 3LGSA 5GWXA 3LOPA 4QYIA 3GQBA 2DBZA 3KXKA 3STXA 5EZYB 2XT6A 1MENA 3EPHA 3RYFB 1LVHA 3KJIA 2JA5A 1XYGA 1XYVA 2NV0A 2HF7A 5JAZA 2QYHA 4NFLA 3BRQA 1P4RA 4R5MA 4W7IA 1CUGA 1RQNA 4CF3A 1RM0A 2GMWA 4E5YA 4MW7A 2VA9A 4HEQA 2XAUA 2RHMA 2ZT7A 3L8CA 4RHYA 2QUHA 5B36A 4H3SA 1CP2A 3HYNA 2HH9A 4DNQA 3ZQUA 4XIGS 1X13A 2OP0A 1U5AA 4Z54A 4US0R 3NHKA 3JQBC 1GL6A 5IULC 1ZY2A 4B79A 1YGPA 3H6KA 2ZUTA 4YY3H 2X4GA 1TO2E 4GG1A 3EW9A 2F9FA 2CVZA 3T7IA 4QLAA 4A3BG 1HMPA 3NM5A 4AL4A 4O2BA 3MERA 4Z4GA 4C7JA 3NO4A 3O4GA 2MINA 4EUNA 4RK4A 2N9UA 1EUDB 4X6YA 4Q3BA 3KVOA 3C5HA 2VAMA 4YCCA 3DXFA 2Z3VA 1N1MA 4INOA 1L4NA 4HC4A 1K1SA 3EDQA 2PGNA 1FUIA 1SXPA 2J0UB 3IPCA 2HQSA 3B6EA 4P4NA 4ECEA 2CLDX 1Z5GA 2H1OA 1H85A 4TVIA 4GE3A 1W88A 1SVWA 1XI2A 1Q19A 1TKBA 3EC1A 2BIFA 1LDYA 5AUPB 1UJCA 1FFYA 1UKYA 1KKLA 2DECA 4YIKA 1Z47A 2H7XA 2DAPA 1ZAYA 4OB7A 4JLMA 1W7AA 4WCVA 3HDYA 5JY1A 5K0JA 2IHTA 3ODGA 2AOXA 4PZUA 2H0RA 1XRPA 4FS2A 2CLLB 4G4IA 1QGZA 4OGGA 1A77A 4NXNB 2VK4A 3ZU4A 3WX0A 4H6VA 5C51B 3IBCA 2VP9A 1A1SA 3X3HA 3NOQA 3CS3A 2CEAA 1RRPA 3HJHA 1RWVA 2VUMA 4G5HA 1UIMA 4JQYA 1M7JA 1DV2A 2OAP1 4KB5A 1I2BA 2VK8A 5CEEA 3M5CA 3A32A 1P6XA 1KC3A 3T06B 2R6HA 4TKUB 2BR0A 3ETJA 2WF5A 1KP3A 2MOKA 3FYDA 4MINA 4ND5A 1ZUD1 1ZH0A 4WXPA 2ZE5A 4D0SA 4Y9RA 3NCTA 4OKNA 4QGGA 2ORYA 2QAGB 3ZOKA 1T1SA 1ZBDA 6REQB 3ZV6A 1T3SA 1TU4A 5HFJA 1E77A 4HAOA 3MLAA 3GZ4A 5KTSA 1XDGA 1Y1RA 1Z62A 3ZCRA 4DQVA 5C53B 2RGVA 2HNKA 1S6YA 3GNLA 4HB3A 1COWD 3B7GA 2DUJA 4FHGA 3MJSA 4OXNA 2HU2A 2R6CA 5KOHA 1QFMA 4GSLA 2G76A 4TTQA 2QP4A 3IPYA 4L4ZA 4JJGA 4Y9TA 4BFZA 1WCIA 1J39A 3KR1A 3WLQA 3DMTC 5FEMA 3MB8A 2LD4A 5DM4A 3RUAA 4PDBA 2W90A 2PLAA 5HM8A 3EARA 3HBFA 5AIAA 2DLCX 3EHEA 4MV7A 3CURA 2FQYA 1V1RB 1I5EA 5A3QA 2MYNA 4EY6A 4IIJF 3QGMA 2ZBRA 5DCUA 3URMA 3EBOA 1QG2A 2EYUA 1MB0A 1E9VA 5EZ5A 3BD7A 1KFEB 1KO5A 1E5LA 4F3NA 1BVYF 2ZCUA 1MB9A 1XLVA 3AWIA 3RASA 3UK0A 2PMZA 2X8BA 3TJRA 4GDMA 2I1WA 1SXJC 3OMLA 4WECA 2PGIA 1T0JB 3KEFA 4NX2A 2J8ZA 3TFWA 2D3WA 2ONJA 4GHWA 3MF4A 3LLVA 2NLOA 3I01M 4MQMA 1VBFA 1MRSA 3ZLUA 4QPNA 2NXJA 1NX9A 4KXXA 3NU1A 4I6GA 1BEZA 4X3OA 1Q0SA 3EVCA 3ZJUA 3OX3A 4RZ3A 3I1IA 4OP1A 1R8QA 3I1YA 2LXNA 2C9BA 1QO9A 2ZPAA 1DEAA 2V9WA 2ZIEA 3TY5A 8GPBA 3PEEA 2NIPA 3IP1A 3DZBA 3OF5A 1Q1QA 1DB3A 2XE7A 4J4TA 5E1BA 2P9FA 1JG2A 3NC0B 3R7FA 1SVNA 1C81A 3PFHA 3P7MA 4WE3A 2C82A 1TEVA 3L6UA 4J0GA 3H4VA 1RWWA 3ELWA 4K40A 1QO7A 2Y1DA 4X60A 1JAHA 3STUA 4EYOA 3RS2A 3NHSA 2BMDA 4XWYA 2CXHA 2ZZMA 5LMUB 1E2JA 2QW8A 5C3UA 2F7SA 2FP4A 3K9CA 3A6EA 3T1HB 3ST7A 1ZW1A 2C9CA 1YMQA 1UAGA 2V4MA 3R8XA 3OLZA 4A3EG 4GOND 1MNAA 2QRGA 2WMNB 5FFFA 4V1CB 4KLCA 1M2JA 3TZ6A 4DREA 1P9WA 1A4UA 1VTKA 3N2ZB 2O05A 1FSSA 1XTTA 1HF3A 4FCWA 1CV2A 2H1VA 1IRIA 2QTBA 3AIOA 4G5GA 5BT9A 4G2NA 1E4VA 3OM0A 3GT7A 1FFDA 2WF6A 4ETWA 1U9JA 3QHPA 4DC1A 2B20A 2Q2OA 1UBCA 1TYBE 2CK3D 3EEBA 2C5AA 3MLEA 1I9GA 4V38A 5DX8A 1TD9A 1V26A 1ZZEA 1GRCA 4BNTA 3P9SA 4GZ5A 2Z30A 1DIHA 3GAZA 2FLPA 1VBGA 2AI2A 4GPZA 4L28A 1E3DA 3IUSA 1P45A 5J5VA 1UP7A 1LZLA 4FGZA 3FWHA 3CRVA 2JGLA 1TIBA 6YASA 1KNQA 3M4IA 4HMOA 3HA5A 1U28A 4FOOA 2ZYSA 2FAXA 2YQZA 4F2PA 1R3DA 3SGIA 2D1RA 1USWA 1HE5A 4N3GA 1TGVA 2EJVA 4X94A 5BW8A 1E9FA 5DCWA 3WBFA 3UK2A 4P31A 4TS4A 3TD6A 4DJFC 5IJAA 1DDGA 5JJ5A 3DOCA 3BBPA 4XX0B 1Q14A 3KQHA 4BP3A 5EJMA 4QAQA 2HF2A 2IU6A 4LZPA 2DG2A 1CUUA 3M9MB 1FJHA 3NTRA 2CVQA 3WJ2A 4D9NA 3OF3A 2NU9B 2FPGB 3DOUA 1OAOC 1P1KA 1PJ2A 1X7GA 5KX5B 1GXSA 4Q3DA 3PD0A 2CLIB 1ISGA 3M82A 4D5GA 3QYFA 1ZIOA 1CJUC 2KE5A 2C2DA 5DLGA 5CA0F 1Y9DA 1W8DA 4ZV9A 4K3UA 1BX3A 3A1VA 4PAWA 4BO1A 3SC2B 1IBCA 3ESQA 1WETA 4EY8A 2WQ6A 3I62A 4RXTA 4ZQGA 3E6AA 5KU1A 1SKUA 1Y8ZA 4QPDA 4MRSA 1U0JA 1CEQA 4UMEA 3GYBA 4QUIA 1U7HA 5HFNA 2GTIA 4PAGA 2ZWMA 3RB4A 1DJNA 4II2A 9ABPA 5D7NA 2A0XA 4XVQA 4XIIA 3VZBA 4TVSA 1X3LA 1RPJA 1JMVA 2ZUEA 3T1QA 2PH1A 3VR6D 3U40A 5LP6F 4UBJA 1VSBA 2ZJTA 4LSZA 1EP9A 1OF1A 3D6UA 4REQA 3KDPA 1XZNA 1KAOA 1X9GA 4AJIA 5FPSA 1AKYA 2Z57A 1ZGZA 4BXOA 5B3KA 5CA1A 3AETB 2EIHA 3QFTA 4DQKA 4YJHA 2TMKA 1L4KA 4RPGA 1RAAA 1KYZA 1L5GB 3BWEA 4EHJA 5KFEA 3ODPA 4RVCA 4B3TH 1WE2A 1D5WA 1QRSA 2ZR0A 5LXTB 1YS4A 1NW4A 5ALKA 3KS9A 1W36D 1L7QA 4C22A 2GX6A 4BN4A 3H4MA 3ZGNA 2J7KA 5DF1A 2C2BA 5DNDA 3WL4A 1JJFA 2C0CA 7MDHA 1ZM4A 5EWMB 2FK2A 3OLQA 4Z4QA 1T3NA 3K1AA 3QY0A 3I83A 4LSWA 1IULA 2QY6A 2B61A 5G4KB 2DHCA 3L3BA 1M83A 3V48A 1ZNYA 4CE6A 3CN7A 3J7AK 4FUQA 4RKQA 5H9VA 3DZHA 1L5VA 1U1GA 4HLDA 3B6JA 2QXUA 3IKJA 3FNFA 4KP7A 4KRYA 5HS4A 5DN6A 1RP1A 1RIIA 1TIKA 1FZQA 2NTJA 1PL6A 1AD2A 2MWMA 2I2DA 3ANYB 4P8RA 3KZOA 5JDIC 4ZT7A 3BMCA 4PC2A 3PXAA 1V9SA 2W0SA 3AEQB 3JAWB 5ALPA 1F0NA 5DLDA 1P8JA 4X8HA 4EKGA 3EK2A 5JYDA 3WAKA 1EJ6A 4PZAA 1ZESA 2QQ0A 2FX3A 3ML1A 5G0WA 4Q7MB 2CFTA 1TM4E 3QKWA 3H3VH 5JS2A 1EX9A 3IBFA 2BGTA 1E2GA 4AMZA 3K0FB 5D51S 4L0DA 2IYXA 4GX5A 4HZGA 4YQWA 1T9KA 2RONA 4DG5A 3JVUA 4RCZA 1UPAA 1A3CA 2B1IA 4MRAA 2AKEA 3H5NA 3JQAB 4GICA 3PNYA 2I7XA 3M6IA 1RJDA 3PE4A 3PPIA 4RD4A 1NBMA 5BWVA 3SNOA 1B3RA 1O54A 3A25A 5I7VA 1E3EA 5KYNA 2DFKB 2O8FA 1GCGA 2E4AA 4S1PA 4L9WA 1EGQA 4D9FA 4IDEA 4AICA 5PNTA 4LVNA 3TPFA 4KR6A 2O07A 3CVYA 4MUIA 4IH1A 3LF1A 5LA6F 3BGOS 4RFVA 1A48A 5C37A 3X43A 5KSPA 1AJEA 2I3BA 5CTAA 4YY3B 4H9GA 5C7OO 5K7SA 4GLXA 1M2WA 5DWVA 2H2FA 1C41A 3HP4A 3BQ0A 4B40A 3WAGA 3K2QA 1JFVA 1R9JA 4N6GA 2NAFA 5EFZA 4YXWA 5CXUA 3G1UA 5MGNA 5CK5A 4DRFA 1ATZA 1PD1A 4TTPA 4F5YA 1GKLA 2VUUA 4MAFA 4UBLA 3H17A 3IVGA 3TW4A 3FOAA 1LI5A 4XSGA 5TVKA 3GBVA 3LY5A 1IONA 2PBZA 2AG6A 1U8EA 3KD2A 4G85A 3DE5X 3HL4A 3HS3A 2NU8B 2PUCA 3QPDA 1N7JA 2XD4A 3CKMA 4E2WA 4PYJA 4A2QA 3KWMA 3D7SA 3KYCB 4QWMA 3WOHA 2ZVJA 3I04A 1CR0A 2VHZA 2C9OA 1S3SA 5IAOA 3FHLA 5IJXA 1KOLA 1OA0A 3IAEA 1QIGA 4Q4JB 2A6PA 4ER7A 3KV1A 2KYRA 4O2AB 4DYDA 3NDRA 3UH1A 4YNBA 1N0VC 1JPVA 3UJBA 2PGDA 3PCTA 4ED7A 3PQ3A 5FTLA 1PL8A 2EHJA 4R8UB 1AUQA 2AKAB 2ZI6A 2I66A 3EPKA 4B4DA 1LWOA 1UFQA 1J25A 2AFHA 3CEHA 1SC4A 1U4SA 3K0BA 1YIOA 5EQTA 5HP4A 3IDAA 4PQRA 2H00A 2JAUA 1H2BA 4O4LA 5COBA 1XYYA 4X1KA 1UJBA 3A3KA 3LWDA 3JARB 4ZGGA 2KHZA 2Y77A 4FHFA 4GOOD 1NRXA 1HLDA 1PK9A 1KSFX 5TMBA 3EYYA 5JNLA 1YU6A 4O3OA 4JJ4A 4H1HA 2NO4A 3IMEA 1UWLA 4ZVQA 1IY9A 1P3Y1 1XP5A 4FW8A 2JAHA 3M70A 2CLSA 3BWYA 3QBVA 4XGIA 4IUYA 3GAFA 2YOHA 3EZFA 5B1HA 1XMQH 1ZXXA 2I6QA 4BY1G 2FKNA 2FVYA 5CUQA 3MCUA 3L4BC 1U7DA 4PG7A 4XSVA 2PX4A 1CUBA 1TX4B 1XZLA 4ROTA 3THYB 3ZCPA 1VRVA 5FBWB 3QLUC 2SICE 4DZTA 2CW7A 4XGQA 4DB4A 5BWLA 3WG9A 2YHSA 4FYVA 1JT2A 1TMGE 4FYKA 1RYSA 2BFWA 1XZGA 2O6HA 3WRVA 4LPKA 3CUYA 4X84A 1JZQA 2J7PA 4MRNA 4EY7A 4G63A 5KAPA 2JAPA 2FSVC 4ZO8A 4IZHA 4TT3D 3KQVA 4EEQA 4L0MA 3WKAA 1VPWA 3SZGA 2ZKIA 3DV2A 1NONA 4KN8A 4FDMA 2VJBA 2Z8ZA 5IM5A 4BQIA 1MIOB 1PFUA 4P6VF 1NF2A 1SD2A 2INGX 1N3IA 3GV0A 5LN1A 1IXZA 4BVGA 4FGRA 3MJCA 4FMPA 2NO0A 3BERA 5K5EA 2I1VB 3GDGA 5A5DA 2ZUBA 5HS6A 1G2OA 2JGNA 1RJWA 4IIGA 1PSWA 3RK4A 5E4YA 5HIMA 5CYFA 4BFWA 3BYZA 5DV9A 4B3CA 4R51A 4C0AC 2FR0A 2QRLA 1K6JA 5FL3A 1RI2A 3IEPA 4BO8A 1T4DA 2J59A 1XFDA 3FYCA 3VNNA 3RIZA 1YONA 1UK7A 4B3DA 2XVAA 2IW1A 4UE2A 16PKA 5AJUA 5J47A 2IYFA 5DN9A 1WMSA 4E03A 2FN4A 3ZGLA 1B15A 2ERCA 3B6KA 5LNK6 2DEUA 5EP2A 2YV2A 3ZY4A 1UXJA 1W30A 3ZCTA 4ZVNA 3C6MA 2FZ4A 2QN2A 2OCLA 5AVWA 3D54D 1US8A 5BR1A 2GCIA 2QGZA 3CX6A 4DM7A 3KXLA 3RYIA 2ALZA 3ZE0B 5B7PA 4LH7A 3ISVA 4FOTA 3B51X 3UZUA 4U3JA 4MLCA 4OHCA 2VSNA 4YBZB 2CVHA 3N2KB 2D74A 3HJAA 4QBKA 4E0BA 3AFGA 2CJPA 2WE6A 1Q6ZA 3PNOA 4CHTA 3TVTA 4FHCA 3S44A 4I1RA 1KIAA 4L8GA 1GU7A 2XVZA 1UWVA 4I55A 1EUYA 4ZHSA 2JEYA 4ICIA 4JI4H 2R0QC 1L4UA 5F51A 4IPTA 3DKIA 3MGAA 1P7VA 4K1XA 3WMEA 3HOYG 1JQKA 3LI2A 2IRWA 1QU2A 1PS0A 1AB5A 3AONB 2I55A 3T35A 2DR3A 3R40A 4FLEA 2DPMA 1C9YA 3QXSA 3UMCA 2ID4A 4M99A 1XL1A 4AP5A 2W2MA 2XTJA 3Q0EA 2J9ZB 4O4IF 4QDTA 2J3QA 2BBWA 3IE0A 3PT5A 5AKIA 4MUYA 1W46A 1Z33A 4RU9A 1WS6A 3IUMA 4M8SA 4BQNA 4WX2B 3ENQA 3W1EA 1J70A 3DG9A 1PWHA 4GP7A 4TZTA 4UQOA 1O94A 4X1YA 3A4TA 5A1TA 4E4RA 1Y1SA 1JFSA 4R2WA 3OJWA 3VOBA 4F04A 2CNWA 3GP5A 1DXOA 5GV8A 1IHPA 4JT4A 3B89A 4P32A 2XCLA 1KYWA 4NIMA 5AQEA 5C1OA 4ZT2A 1ISSA 1FB5A 4I9GA 2VP2A 3BD9A 1CZNA 1CUVA 1WP9A 1V41E 1G63A 3N76A 3CLHA 4N0QA 3VDQA 1LI7A 2X0KA 1GAJA 2NTNA 1YQQA 1G16A 4IL5A 3BGIA 2EATA 1D1PA 1IATA 3H0GG 5EWJA 4CM6A 5A05A 4XQ0A 3A0UA 2ZI7A 3O4JA 1I0LA 4JGIA 2IKQA 3FVTA 4XARA 4EW2A 1IHUA 4F93B 4PHCA 4E88A 5KO2A 3IDZA 3A06A 2C22A 5KFFA 5FLYA 2VWPA 4ZQCB 2W6QA 1XEAA 1A2KC 4QEZA 1XDBA 1QQAA 2XUDA 1U5CA 4JI8B 2IX9A 1ZOIA 4O59O 1ZN7A 3FFTA 3TNFA 1GZ4A 3OQOA 1LK7A 2WA2A 2WM2A 4BMCA 4YRSA 2DHDA 4LY0A 4B4WA 3KJQA 1EDBA 3MTDA 3OKAA 3ZZTA 1NQXA 4YGYA 2I78A 2CNVA 3OQBA 4I6JA 1SBCA 1KYVA 1BDJA 1G6Q1 3TX2A 1A2OA 2X41A 5CCBA 3EX7C 2QX9A 4QLBA 5FNVA 1PBTA 4PTZA 1XWWA 3WISA 4F3CA 3T5JA 2D5AA 2XF2A 2JKVA 4UVEA 2G7ZA 5JD5A 3MGKA 4DCJA 4G5FA 3BMQB 3JD1A 4FFSA 3C7TA 1SKBA 1KZ6A 4XLZA 3O9MA 5HQTA 1CJSA 3JSXA 1HQDA 5AESA 4CIAA 1F6WA 4MAAA 3L0SA 4R1SA 1I3NA 2AX4A 4H3KB 5KIAA 3P19A 2FEPA 5CAEB 3HR4A 3N5CA 3VXKA 3W90A 1FPQA 4EARA 5EP1A 4XOUA 1P80A 5B58C 4EGQA 1Z0ZA 2WDTA 1J49A 4B3TB 4LVUA 3VZCA 1ZOSA 1A9TA 3L7JA 5ANRB 2GN9A 5JECA