2EJ2A

Crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
294
Chain Sequence
b'QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Branched-chain amino acid aminotransferase
publication title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with N-(5'-Phosphopyridoxyl)-L-Glutamate
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 98
structure length 294
sequence length 305
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.42: Branched-chain-amino-acid transaminase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 2ej2A02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2ej2A01
4M0JA 3SNOA 3U0GA 2COIA 4CMFA 5CE8A 3QQMA 5BWWA 2EJ0A 5BWXA 2HG8A 5DAAA 1A3GA 4CHIA 2COGA 4DQNA 3WWHA 2HHFB 5I5TA 1KT8A 5BWRA 5BWVA 3HT5A 4PBCA 2ZGIA 3CSWA 5I5XA 1G2WA 1WRVA 2Y4RA 5BWTA 1I1MA 2DABA 5CR5A 3UZBA 4DAAA 5I60A 3JZ6A 3LULA 5BWUA 4TM5A 1EKFA 2A1HA 3DAAA 3UYYA 1I1LA 3LQSA 2DAAA 1I2KA 2ABJA 1ET0A 5I5WA 5I5VA 3WWIA 2HGXA 1IYEA 1I2LA 2EJ3A 4TVIA 4CE5A 4WHXA 1IYDA 2HGWA 1I1KA 4UUGA 3DTGA 3WWJA 2HHFA 2COJA 2EJ2A 4CMDA 1EKPA 4JXUA 2HDKA 1DAAA 5HNEA 5FR9A 5CM0A 5I5SA 5I5YA 2EIYA 4K6NA 3DTFA 3UZOA 5E25A 1EKVA 5I5UA 1KTAA 5K3WA 1A0GA 3CEBA
chains in the Genus database with same CATH superfamily
1UC9A 3U0GA 2YWVA 5C8YF 4GLXA 5D1PA 3RFCA 3AX6A 4CC6A 2EJ0A 4I4TF 1C30A 2HG8A 4XX0B 4O7SA 1CQIB 4MV8A 4DQNA 4PZ6A 4EG0A 5KKNB 1KT8A 1VS0A 5HBRB 3HO8A 3ETHA 4QSHA 1JLLB 4UCOA 2ZGIA 3L2PA 2Y4RA 2PBZA 1KC7A 3RTXA 5BPFA 3K3PA 4NZNA 4O7RA 2IP4A 3WO1A 4LH6A 5FPRA 2Q2TA 2CNVA 4HR7A 4E6NA 1KJJA 2X0SA 3VOTA 5BWUA 1FVIA 4TM5A 3VNNA 2GQRA 2A1HA 3OUZA 4ZI7F 1XDNA 2HVQA 1ET0A 5I5VA 4UCVA 1BXRA 5FNVF 3PFFA 3GJXB 3LWBA 1DGSA 4RZQA 4TVIA 2ZDHA 2C00A 1VBGA 4WHXA 1W93A 4FFPA 2YZLA 4TUYF 5CA1F 3VPDA 5IYZF 4O2AF 1M0WA 4MA5A 2YRWA 2YYAA 5I47A 2EJ2A 4FU0A 1VKZA 2X5RA 4WBNF 4MV1A 1EKPA 3NBZB 3NUAA 4JXUA 4ZHQF 4IIJF 1B6SA 4DLKA 3G8DA 1A0IA 5D8DA 5I5SA 5LA6F 2R7KA 1VBHA 3BA9A 2GPWA 1E4EA 1EKVA 5I5UA 4CKCA 5KX5F 3UQ8A 4YAJB 3ORQA 4O4IF 3GLKA 5GONF 3CEBA 4MV4A 4PZ8A 2HVRA 2COIA 4CMFA 3Q1KA 5BWWA 3KREA 5FPOA 1Z2PX 5K2MA 2NU6B 3JZFA 3PN1A 3T9EA 4O7VA 4DIMA 4UCSA 3WWHA 5I5TA 5CA0F 2R7LA 2HVSA 1SCUB 1V9PA 2VR1A 4UCRA 2CFMA 1TA8A 3MJFA 3S24A 4O83A 3HT5A 5JH7F 1CKNA 3QWUA 4PBCA 3R5HA 4IWXA 1T36A 2R7MA 1C3OA 2R86A 3N6RA 2GQSA 1I1MA 3LP8A 3U54A 2QB5A 4UCUA 1DIKA 5CR5A 3UZBA 3W1GA 4O7LA 4YJ2F 3WNZA 3T9FA 3LULA 1GSOA 5LYJF 2GLTA 4IZOA 3NBYB 5BYBA 4EGQA 1EKFA 1M0TA 2CNQA 3T9BA 3MWEA 1I1LA 2DAAA 2ABJA 4M9UA 4C5AA 4NYEA 4PZ7A 4TV8F 1EYZA 3T7AA 5J2UF 3AW8A 3G8CA 4I50F 5D1OA 2OLSA 1I2LA 4MV6A 3TQTA 1CKMA 4EFEA 4CE5A 1OBGA 1GSAA 2XD4A 3TY8A 2DZDA 3KYHC 5BPHA 3DTGA 4FFLA 2FP4B 4UFZA 1W96A 4O7NA 2HHFA 2R7NA 5H80A 3VA7A 3I12A 1I7LA 4CMDA 2QF7A 4FFNA 4O7ZA 2NU8B 1ZAUA 2Q7DA 3JSNA 1PK8A 3T54A 2HDKA 2I8CA 4O7WA 3JSLA 4Q4CA 5HNEA 2PVPA 1EUDB 2FPGB 3BA8A 1DV1A 4O86A 1X9NA 3MWDA 3UZOA 5E25A 2R84A 5DISC 3BACA 2NUAB 3V4SA 2R85A 1M6VA 3KAJA 5KS8A 5J2TF 4M0JA 3SNOA 1DV2A 1P8LA 2W71A 5CE8A 1B04A 1WR2A 2Z02A 2VPQA 5BWXA 4O81A 1IOWA 3R23A 1EZ1A 1AUVA 4FFOA 2W6NA 2YS7A 1Z2NX 2W70A 4CHIA 2VQDA 4ZOLF 3TEKA 1EHIA 3RV4A 3JRXA 4ME6A 4XYLB 3GIDA 3K5HA 5BWRA 1I7NA 4L1KA 1A48A 2YZNA 4MAMA 5BWVA 2HGSA 4XYMB 3T99A 3TW7A 3WO0A 2GPSA 3CSWA 4IHJF 3V4ZA 1G2WA 4CC5A 1WRVA 3TY5A 2V59A 4FFRA 4O7YA 5LOVF 2CNUA 1XK5A 1KEEA 4DAAA 5I60A 3JZ6A 1E4EB 2FB9A 4XZ3B 5DGHA 2DWCA 4E4TA 4DRFA 5JQWA 4EGJA 2ZDQA 1CE8A 4MV7A 2YZGA 1OBDA 3UYYA 3R5FA 4GLWA 5LXTF 3LQSA 1I2KA 1KJ9A 3OUUA 3QFFA 3ETJA 4HNVA 3NC0B 4O2BF 3W5OA 2YL2A 1CQJB 3DF7A 4O4JF 4CKBA 4NZMA 3SGIA 5BMVF 4FE2A 1IYEA 4C5BA 3KAKA 1ULZA 1TAEA 2YW2A 1GSHA 4EQ5A 1IYDA 2WYOA 4UUGA 2VUGA 3GB8B 5HV6A 1CKNB 4EEQA 1JDEA 3U55A 2NU7B 3U9SA 2OWOA 2HJWA 1BNCA 3UFXB 5C1OA 1KJ8A 3TIIA 1S68A 4O7TA 4HNUA 1JDBB 2PN1A 5CM0A 5I5YA 2W6PA 4K6NA 3DTFA 5JQGF 3RR5A 4O82A 3RUPA 3SE7A 5JVLA 2ODTX 5K3WA 3T9DA 2V58A 3QQMA 5D1OB 4IWYA 4YBZB 4HN2A 2QK4A 5DAAA 1KJQA 1A3GA 4CKEA 2Q2UA 1JKJB 2YZMA 3E5NA 2NU9B 3RV3A 4TV9F 4MV3A 3HBLA 2COGA 4ZQIA 5C1PA 2HHFB 4HNTA 5LP6F 2HIVA 3BABA 1EUCB 1KBLA 2I87A 5EZYF 3VPBA 1P16A 4C5CA 3VMMA 5I5XA 5JVDF 4EFBA 1A9XA 3N8DA 4RCNA 4YB8B 2W6ZA 3TW6A 4YAKB 2XCLA 5BWTA 2DABA 5CAEB 3KALA 2FPPB 2W6OA 4O84A 3Q2OA 2Z04A 2R82A 4FFMA 1CS0A 1KJIA 4UCTA 1CKOA 2J9GA 2R87A 3DAAA 4LH7A 3HB9A 3BG5A 5I5WA 1UC8A 3WWIA 1Z2OX 1GGOA 5DGIA 2HGXA 2ZDGA 2DLNA 3TINA 4Q4DA 5CB4F 2EJ3A 3BAAA 4YJ3F 3GDEA 2HGWA 1I1KA 2YS6A 3TY9A 3WWJA 4MV9A 5DMXA 4NZOA 2COJA 4O4LF 2W6QA 3TIGA 2P0AA 3JRWA 3R9RA 3ORRA 4O4HF 1GLVA 4MA0A 5BYAA 4I55F 2HIXA 3T9AA 3K5IA 1AUXA 1DAAA 2YRXA 5FR9A 1KUTA 2I80A 2FPIB 2W6MA 3T9CA 2EIYA 1B6RA 2DIKA 1IOVA 4Y8VB 2SCUB 3JZIA 1PX2A 3R5XA 2V5AA 1KTAA 3W1BA 2CZGA 3U9TA 4HQ6A 1A0GA 3VPCA 4FGRA
chains in the Genus database with same CATH topology
4M0JA 3SNOA 1UC9A 3U0GA 2COIA 4CMFA 5CE8A 3QQMA 5BWWA 2EJ0A 5BWXA 4IWYA 4HN2A 2HG8A 5DAAA 5K2MA 1A3GA 4CKEA 4CHIA 3T9EA 3TEKA 2COGA 4DQNA 3WWHA 2HHFB 5I5TA 3T9DA 1KT8A 5BWRA 5BWVA 3HT5A 3T99A 3TW7A 4PBCA 2ZGIA 4IWXA 3CSWA 5I5XA 4RCNA 1G2WA 1WRVA 2Y4RA 5BWTA 1I1MA 2DABA 4NZNA 2QB5A 5CR5A 3UZBA 4DAAA 5I60A 3JZ6A 3T9FA 3LULA 2ODTX 5BWUA 5DGHA 4TM5A 5BYBA 1EKFA 3T9BA 2A1HA 3DAAA 3UYYA 4GLWA 1I1LA 3LQSA 2DAAA 1I2KA 2ABJA 1ET0A 5I5WA 3T7AA 5I5VA 1UC8A 3WWIA 5DGIA 2HGXA 3PFFA 4CKBA 4Q4DA 4NZMA 3SGIA 1IYEA 1I2LA 2EJ3A 4TVIA 4CE5A 4WHXA 1IYDA 2HGWA 1I1KA 4UUGA 3DTGA 3WWJA 3VPDA 4NZOA 2HHFA 2COJA 5I47A 2EJ2A 4CMDA 2X5RA 1EKPA 1ZAUA 2Q7DA 4JXUA 3T54A 2HDKA 5BYAA 3T9AA 4Q4CA 1DAAA 5HNEA 5FR9A 5CM0A 5I5SA 3T9CA 5I5YA 2EIYA 4K6NA 3DTFA 3UZOA 5E25A 1EKVA 5I5UA 3BACA 4CKCA 1KTAA 5K3WA 1A0GA 5KS8A 3CEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0J A;  3SNO A;  3U0G A;  2COI A;  4CMF A;  5CE8 A;  3QQM A;  5BWW A;  2EJ0 A;  5BWX A;  2HG8 A;  5DAA A;  1A3G A;  4CHI A;  2COG A;  4DQN A;  3WWH A;  2HHF B;  5I5T A;  1KT8 A;  5BWR A;  5BWV A;  3HT5 A;  4PBC A;  2ZGI A;  3CSW A;  5I5X A;  1G2W A;  1WRV A;  2Y4R A;  5BWT A;  1I1M A;  2DAB A;  5CR5 A;  3UZB A;  4DAA A;  5I60 A;  3JZ6 A;  3LUL A;  5BWU A;  4TM5 A;  1EKF A;  2A1H A;  3DAA A;  3UYY A;  1I1L A;  3LQS A;  2DAA A;  1I2K A;  2ABJ A;  1ET0 A;  5I5W A;  5I5V A;  3WWI A;  2HGX A;  1IYE A;  1I2L A;  2EJ3 A;  4TVI A;  4CE5 A;  4WHX A;  1IYD A;  2HGW A;  1I1K A;  4UUG A;  3DTG A;  3WWJ A;  2HHF A;  2COJ A;  2EJ2 A;  4CMD A;  1EKP A;  4JXU A;  2HDK A;  1DAA A;  5HNE A;  5FR9 A;  5CM0 A;  5I5S A;  5I5Y A;  2EIY A;  4K6N A;  3DTF A;  3UZO A;  5E25 A;  1EKV A;  5I5U A;  1KTA A;  5K3W A;  1A0G A;  3CEB A; 
#chains in the Genus database with same CATH topology
 1UC9 A;  3U0G A;  2YWV A;  5C8Y F;  4GLX A;  5D1P A;  3RFC A;  3AX6 A;  4CC6 A;  2EJ0 A;  4I4T F;  1C30 A;  2HG8 A;  4XX0 B;  4O7S A;  1CQI B;  4MV8 A;  4DQN A;  4PZ6 A;  4EG0 A;  5KKN B;  1KT8 A;  1VS0 A;  5HBR B;  3HO8 A;  3ETH A;  4QSH A;  1JLL B;  4UCO A;  2ZGI A;  3L2P A;  2Y4R A;  2PBZ A;  1KC7 A;  3RTX A;  5BPF A;  3K3P A;  4NZN A;  4O7R A;  2IP4 A;  3WO1 A;  4LH6 A;  5FPR A;  2Q2T A;  2CNV A;  4HR7 A;  4E6N A;  1KJJ A;  2X0S A;  3VOT A;  5BWU A;  1FVI A;  4TM5 A;  3VNN A;  2GQR A;  2A1H A;  3OUZ A;  4ZI7 F;  1XDN A;  2HVQ A;  1ET0 A;  5I5V A;  4UCV A;  1BXR A;  5FNV F;  3PFF A;  3GJX B;  3LWB A;  1DGS A;  4RZQ A;  4TVI A;  2ZDH A;  2C00 A;  1VBG A;  4WHX A;  1W93 A;  4FFP A;  2YZL A;  4TUY F;  5CA1 F;  3VPD A;  5IYZ F;  4O2A F;  1M0W A;  4MA5 A;  2YRW A;  2YYA A;  5I47 A;  2EJ2 A;  4FU0 A;  1VKZ A;  2X5R A;  4WBN F;  4MV1 A;  1EKP A;  3NBZ B;  3NUA A;  4JXU A;  4ZHQ F;  4IIJ F;  1B6S A;  4DLK A;  3G8D A;  1A0I A;  5D8D A;  5I5S A;  5LA6 F;  2R7K A;  1VBH A;  3BA9 A;  2GPW A;  1E4E A;  1EKV A;  5I5U A;  4CKC A;  5KX5 F;  3UQ8 A;  4YAJ B;  3ORQ A;  4O4I F;  3GLK A;  5GON F;  3CEB A;  4MV4 A;  4PZ8 A;  2HVR A;  2COI A;  4CMF A;  3Q1K A;  5BWW A;  3KRE A;  5FPO A;  1Z2P X;  5K2M A;  2NU6 B;  3JZF A;  3PN1 A;  3T9E A;  4O7V A;  4DIM A;  4UCS A;  3WWH A;  5I5T A;  5CA0 F;  2R7L A;  2HVS A;  1SCU B;  1V9P A;  2VR1 A;  4UCR A;  2CFM A;  1TA8 A;  3MJF A;  3S24 A;  4O83 A;  3HT5 A;  5JH7 F;  1CKN A;  3QWU A;  4PBC A;  3R5H A;  4IWX A;  1T36 A;  2R7M A;  1C3O A;  2R86 A;  3N6R A;  2GQS A;  1I1M A;  3LP8 A;  3U54 A;  2QB5 A;  4UCU A;  1DIK A;  5CR5 A;  3UZB A;  3W1G A;  4O7L A;  4YJ2 F;  3WNZ A;  3T9F A;  3LUL A;  1GSO A;  5LYJ F;  2GLT A;  4IZO A;  3NBY B;  5BYB A;  4EGQ A;  1EKF A;  1M0T A;  2CNQ A;  3T9B A;  3MWE A;  1I1L A;  2DAA A;  2ABJ A;  4M9U A;  4C5A A;  4NYE A;  4PZ7 A;  4TV8 F;  1EYZ A;  3T7A A;  5J2U F;  3AW8 A;  3G8C A;  4I50 F;  5D1O A;  2OLS A;  1I2L A;  4MV6 A;  3TQT A;  1CKM A;  4EFE A;  4CE5 A;  1OBG A;  1GSA A;  2XD4 A;  3TY8 A;  2DZD A;  3KYH C;  5BPH A;  3DTG A;  4FFL A;  2FP4 B;  4UFZ A;  1W96 A;  4O7N A;  2HHF A;  2R7N A;  5H80 A;  3VA7 A;  3I12 A;  1I7L A;  4CMD A;  2QF7 A;  4FFN A;  4O7Z A;  2NU8 B;  1ZAU A;  2Q7D A;  3JSN A;  1PK8 A;  3T54 A;  2HDK A;  2I8C A;  4O7W A;  3JSL A;  4Q4C A;  5HNE A;  2PVP A;  1EUD B;  2FPG B;  3BA8 A;  1DV1 A;  4O86 A;  1X9N A;  3MWD A;  3UZO A;  5E25 A;  2R84 A;  5DIS C;  3BAC A;  2NUA B;  3V4S A;  2R85 A;  1M6V A;  3KAJ A;  5KS8 A;  5J2T F;  4M0J A;  3SNO A;  1DV2 A;  1P8L A;  2W71 A;  5CE8 A;  1B04 A;  1WR2 A;  2Z02 A;  2VPQ A;  5BWX A;  4O81 A;  1IOW A;  3R23 A;  1EZ1 A;  1AUV A;  4FFO A;  2W6N A;  2YS7 A;  1Z2N X;  2W70 A;  4CHI A;  2VQD A;  4ZOL F;  3TEK A;  1EHI A;  3RV4 A;  3JRX A;  4ME6 A;  4XYL B;  3GID A;  3K5H A;  5BWR A;  1I7N A;  4L1K A;  1A48 A;  2YZN A;  4MAM A;  5BWV A;  2HGS A;  4XYM B;  3T99 A;  3TW7 A;  3WO0 A;  2GPS A;  3CSW A;  4IHJ F;  3V4Z A;  1G2W A;  4CC5 A;  1WRV A;  3TY5 A;  2V59 A;  4FFR A;  4O7Y A;  5LOV F;  2CNU A;  1XK5 A;  1KEE A;  4DAA A;  5I60 A;  3JZ6 A;  1E4E B;  2FB9 A;  4XZ3 B;  5DGH A;  2DWC A;  4E4T A;  4DRF A;  5JQW A;  4EGJ A;  2ZDQ A;  1CE8 A;  4MV7 A;  2YZG A;  1OBD A;  3UYY A;  3R5F A;  4GLW A;  5LXT F;  3LQS A;  1I2K A;  1KJ9 A;  3OUU A;  3QFF A;  3ETJ A;  4HNV A;  3NC0 B;  4O2B F;  3W5O A;  2YL2 A;  1CQJ B;  3DF7 A;  4O4J F;  4CKB A;  4NZM A;  3SGI A;  5BMV F;  4FE2 A;  1IYE A;  4C5B A;  3KAK A;  1ULZ A;  1TAE A;  2YW2 A;  1GSH A;  4EQ5 A;  1IYD A;  2WYO A;  4UUG A;  2VUG A;  3GB8 B;  5HV6 A;  1CKN B;  4EEQ A;  1JDE A;  3U55 A;  2NU7 B;  3U9S A;  2OWO A;  2HJW A;  1BNC A;  3UFX B;  5C1O A;  1KJ8 A;  3TII A;  1S68 A;  4O7T A;  4HNU A;  1JDB B;  2PN1 A;  5CM0 A;  5I5Y A;  2W6P A;  4K6N A;  3DTF A;  5JQG F;  3RR5 A;  4O82 A;  3RUP A;  3SE7 A;  5JVL A;  2ODT X;  5K3W A;  3T9D A;  2V58 A;  3QQM A;  5D1O B;  4IWY A;  4YBZ B;  4HN2 A;  2QK4 A;  5DAA A;  1KJQ A;  1A3G A;  4CKE A;  2Q2U A;  1JKJ B;  2YZM A;  3E5N A;  2NU9 B;  3RV3 A;  4TV9 F;  4MV3 A;  3HBL A;  2COG A;  4ZQI A;  5C1P A;  2HHF B;  4HNT A;  5LP6 F;  2HIV A;  3BAB A;  1EUC B;  1KBL A;  2I87 A;  5EZY F;  3VPB A;  1P16 A;  4C5C A;  3VMM A;  5I5X A;  5JVD F;  4EFB A;  1A9X A;  3N8D A;  4RCN A;  4YB8 B;  2W6Z A;  3TW6 A;  4YAK B;  2XCL A;  5BWT A;  2DAB A;  5CAE B;  3KAL A;  2FPP B;  2W6O A;  4O84 A;  3Q2O A;  2Z04 A;  2R82 A;  4FFM A;  1CS0 A;  1KJI A;  4UCT A;  1CKO A;  2J9G A;  2R87 A;  3DAA A;  4LH7 A;  3HB9 A;  3BG5 A;  5I5W A;  1UC8 A;  3WWI A;  1Z2O X;  1GGO A;  5DGI A;  2HGX A;  2ZDG A;  2DLN A;  3TIN A;  4Q4D A;  5CB4 F;  2EJ3 A;  3BAA A;  4YJ3 F;  3GDE A;  2HGW A;  1I1K A;  2YS6 A;  3TY9 A;  3WWJ A;  4MV9 A;  5DMX A;  4NZO A;  2COJ A;  4O4L F;  2W6Q A;  3TIG A;  2P0A A;  3JRW A;  3R9R A;  3ORR A;  4O4H F;  1GLV A;  4MA0 A;  5BYA A;  4I55 F;  2HIX A;  3T9A A;  3K5I A;  1AUX A;  1DAA A;  2YRX A;  5FR9 A;  1KUT A;  2I80 A;  2FPI B;  2W6M A;  3T9C A;  2EIY A;  1B6R A;  2DIK A;  1IOV A;  4Y8V B;  2SCU B;  3JZI A;  1PX2 A;  3R5X A;  2V5A A;  1KTA A;  3W1B A;  2CZG A;  3U9T A;  4HQ6 A;  1A0G A;  3VPC A;  4FGR A; 
#chains in the Genus database with same CATH homology
 4M0J A;  3SNO A;  1UC9 A;  3U0G A;  2COI A;  4CMF A;  5CE8 A;  3QQM A;  5BWW A;  2EJ0 A;  5BWX A;  4IWY A;  4HN2 A;  2HG8 A;  5DAA A;  5K2M A;  1A3G A;  4CKE A;  4CHI A;  3T9E A;  3TEK A;  2COG A;  4DQN A;  3WWH A;  2HHF B;  5I5T A;  3T9D A;  1KT8 A;  5BWR A;  5BWV A;  3HT5 A;  3T99 A;  3TW7 A;  4PBC A;  2ZGI A;  4IWX A;  3CSW A;  5I5X A;  4RCN A;  1G2W A;  1WRV A;  2Y4R A;  5BWT A;  1I1M A;  2DAB A;  4NZN A;  2QB5 A;  5CR5 A;  3UZB A;  4DAA A;  5I60 A;  3JZ6 A;  3T9F A;  3LUL A;  2ODT X;  5BWU A;  5DGH A;  4TM5 A;  5BYB A;  1EKF A;  3T9B A;  2A1H A;  3DAA A;  3UYY A;  4GLW A;  1I1L A;  3LQS A;  2DAA A;  1I2K A;  2ABJ A;  1ET0 A;  5I5W A;  3T7A A;  5I5V A;  1UC8 A;  3WWI A;  5DGI A;  2HGX A;  3PFF A;  4CKB A;  4Q4D A;  4NZM A;  3SGI A;  1IYE A;  1I2L A;  2EJ3 A;  4TVI A;  4CE5 A;  4WHX A;  1IYD A;  2HGW A;  1I1K A;  4UUG A;  3DTG A;  3WWJ A;  3VPD A;  4NZO A;  2HHF A;  2COJ A;  5I47 A;  2EJ2 A;  4CMD A;  2X5R A;  1EKP A;  1ZAU A;  2Q7D A;  4JXU A;  3T54 A;  2HDK A;  5BYA A;  3T9A A;  4Q4C A;  1DAA A;  5HNE A;  5FR9 A;  5CM0 A;  5I5S A;  3T9C A;  5I5Y A;  2EIY A;  4K6N A;  3DTF A;  3UZO A;  5E25 A;  1EKV A;  5I5U A;  3BAC A;  4CKC A;  1KTA A;  5K3W A;  1A0G A;  5KS8 A;  3CEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...