4YAKB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, acetyl-coenzyme a and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yakB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yakB02
1PK8A 2R82A 3WO0A 3MJFA 5FNVF 3U54A 2DZDA 1JDEA 4O7ZA 2I8CA 2FP4B 2W6OA 4XYLB 4IZOA 1E4EA 4O7RA 5CA0F 2ZDQA 3HBLA 4EG0A 1EHIA 1KUTA 4O86A 2NU8B 5C8YF 5I47A 4FFOA 2CZGA 2YZMA 1CQIB 3U9SA 1GSOA 3R5HA 3K5HA 2W6MA 1W93A 3WO1A 2R85A 3OUUA 5CA1F 2R87A 5JVDF 4C5AA 3LWBA 1BXRA 4MV4A 4WBNF 4FFLA 4ZOLF 2R7LA 2ZDGA 2CNVA 4FFNA 2CQYA 2ZDHA 4ZI7F 3NUAA 3G8CA 4IHJF 3RV3A 1A48A 1KJIA 1UC8A 2YZGA 5HBRB 4I4TF 4M9UA 4HNVA 3N6RA 4O4LF 3TQTA 2GQRA 4Y8VB 2HJWA 1UC9A 2W6QA 1B6SA 5HV6A 2PBZA 2DWCA 3JZFA 3R5FA 2VR1A 3TIGA 4FFRA 2J9GA 1GGOA 4O7YA 5LYJF 5LP6F 4XZ3B 2YZNA 5JQGF 2FPGB 5H80A 1OBDA 3V4ZA 1AUXA 5JVLA 4FE2A 2PVPA 1KC7A 3R9RA 5J2UF 4MA0A 2R86A 5KKNB 3K5IA 1EUCB 3TW6A 4QSHA 2HGSA 4O7LA 4O7NA 2GQSA 4O4IF 2SCUB 1A9XA 1CS0A 3ETHA 4C5BA 2W6PA 3AW8A 1KEEA 5JQWA 2DLNA 5J2TF 5CB4F 2C00A 2QF7A 3K3PA 5C1PA 2OLSA 4O7SA 2NU9B 4IWYA 2X0SA 1EZ1A 1E4EB 3DF7A 4MV3A 2I80A 2FPPB 5LOVF 4FGRA 5D8DA 1IOWA 2Z04A 1DV1A 3R5XA 2VPQA 4YB8B 1AUVA 3TINA 4MV7A 1EYZA 4XX0B 4EGJA 2FB9A 3AX6A 4TV8F 1IOVA 1BNCA 3BG5A 2NUAB 1JKJB 5IYZF 2P0AA 3KAJA 4L1KA 1CE8A 1B6RA 1C30A 4FFPA 5BPFA 1CQJB 2V59A 4MV8A 3QFFA 5CAEB 4YAJB 2PN1A 5DMXA 5C1OA 2QK4A 3VPBA 2R7KA 4DLKA 2W6NA 2YS7A 3LP8A 3KALA 4FU0A 3V4SA 3HO8A 1VBGA 4TV9F 4O4HF 5LXTF 4YAKB 1KJJA 3RV4A 1GSHA 1Z2OX 2W6ZA 1Z2PX 2Z02A 2YZLA 2GPSA 3VMMA 4IIJF 2GLTA 3GIDA 4O7TA 4WD3A 5K2MA 4MV6A 2YWVA 2GPWA 3ETJA 1W96A 4O7VA 3WNZA 3MWDA 4NYEA 2V58A 4MV9A 5GONF 4IWXA 3I12A 3OUZA 1I7LA 4E4TA 2NU7B 4RZQA 3JRWA 1JDBB 4YJ3F 2YRXA 4O4JF 1M0WA 3RFCA 3GLKA 4DIMA 4O7WA 2R84A 3ORRA 2V5AA 1DV2A 2FPIB 3TIIA 2W71A 3VPCA 2XCLA 4ME6A 3VOTA 3RUPA 2YW2A 3Q2OA 5LA6F 2WYOA 2YS6A 1WR2A 4I55F 1KJ8A 1M6VA 2XD4A 3KAKA 4HNUA 5JH7F 4O81A 4MV1A 1T36A 2W70A 3R23A 3G8DA 1KJQA 1VKZA 1JLLB 1PX2A 5BPHA 3UFXB 3ORQA 1M0TA 1VBHA 3SE7A 3E5NA 4O84A 3N8DA 2R7NA 1GSAA 2YRWA 2R7MA 3JRXA 5KX5F 4ZQIA 4O82A 4FFMA 4C5CA 3HB9A 2R6FA 3JZIA 4MAMA 1SCUB 1GLVA 4I50F 4TUYF 1KJ9A 3MWEA 4YBZB 2YL2A 2VQDA 1OBGA 5EZYF 3Q1KA 2IP4A 1I7NA 4HR7A 2I87A 1KBLA 2CNUA 4O83A 4O2BF 3U9TA 1Z2NX 2YYAA 4XYMB 3VPDA 1DIKA 1C3OA 4MA5A 4ZHQF 1ULZA 5BMVF 4EGQA 3KREA 2DIKA 2NU6B 1EUDB 4YJ2F 3U55A 3VA7A 4O2AF 2CNQA 4HQ6A 4HNTA
chains in the Genus database with same CATH superfamily
1PK8A 3RB0A 2DPJA 3Q8SB 4B3SH 2YU9A 2R82A 3WO0A 4QIWE 3MJFA 5FLXW 4NZNA 5FNVF 3U54A 2DZDA 4ETSA 1JDEA 4TQRA 4O7ZA 5K3WA 2I8CA 4QIWA 4QWEA 4ED1A 2FP4B 4DR6H 4QWBA 5I5TA 5KFYA 3LULA 3RB4A 4DRFA 4IAJA 2W6OA 3H20A 2W8KA 4J9MA 2UVVA 5BWRA 1BGWA 4UCVA 2C35B 4XYLB 4IZOA 1IBLH 1E4EA 4O7RA 1K1QA 2ABJA 3RB3A 2FLLA 3GTQA 5CA0F 5L1IA 4A3MG 1BJTA 2FLPA 4RZRA 2ZDQA 2RF4A 4Q8FA 4CHIA 3HBLA 4FS2A 4DL2A 2M05A 3PO2G 2UUAH 2FLNA 4GLXA 5KG4A 4EG0A 1EHIA 2ZJTA 1KUTA 3KTMA 4O86A 2NU8B 5C8YF 5BWVA 5I47A 4EYIB 2R93G 2IA6A 4FFOA 2CZGA 4JUZA 2YZMA 1CQIB 5BYAA 2JEJA 3U9SA 1ZHSA 1FVIA 1GSOA 3BJYA 4KHPH 3R5HA 3K5HA 4X62H 1WSCA 2R8HA 5L1LA 4NZMA 2W6MA 2WB1A 1W93A 4J9PA 3WO1A 2R85A 3OUUA 4PZ7A 3W1BA 5CA1F 5DG9A 4J9SA 2R87A 5JVDF 4F50A 2Y4RA 4C5AA 4O3QA 3LWBA 3T54A 1BXRA 4MV4A 4WBNF 5I5VA 4J9OA 4FFLA 4ZOLF 1K83A 3Q8RB 4JI4H 2R7LA 4Q45A 2E2HA 2ZDGA 2R7ZA 3HOVG 2CNVA 4FFNA 2CQYA 3EYYA 5L9XA 3H4BA 1JX4A 1N33H 1CKNA 5IYBG 1J5EH 1CKMA 2Y0SE 3GIQA 1S0NA 2ZDHA 4ZI7F 3HOXG 4A2AA 3OSPA 4PDBA 2Y0SA 1P8LA 3NUAA 2R92A 4UCSA 1O75A 3G8CA 4IHJF 3RV3A 4ED6A 1A48A 1KJIA 3C0FB 3H4DA 5I5WA 3I4NG 1VS0A 2W9BA 1TA8A 2VUMA 3BABA 1UC8A 2FK1A 3TEKA 2YZGA 3RF2A 2J6TA 3HOYG 5HBRB 4I4TF 2ASDA 4JYAH 3J80W 4M9UA 3RTXA 4HNVA 2W9CA 3N6RA 5EDWA 4O4LF 3TQTA 2GQRA 3S24A 3JSNA 5C5JA 5KG0A 5DG8A 4J9RA 3PZPA 3T9CA 3JZ6A 4Y8VB 5JUMA 4ECSA 2RGRA 2AGQA 2NVXA 3VNNA 3HT5A 4WHXA 4MTDA 2JA6A 5DLGA 1UC9A 2HJWA 3NC0B 4A3IG 2Q7DA 1A0GA 2W6QA 5I5SA 3HOZG 1Y1WA 4OX9H 5D1OB 4CKBA 1B6SA 5HV6A 2PBZA 2DWCA 3WWJA 3JZFA 4TVIA 1UNNC 3R5FA 2V4QA 2VR1A 5C4XG 4IRKA 5KFMA 3MWMA 2CW7A 3TIGA 4FFRA 1E4GT 2O03A 2J9GA 4RAZA 2JA5A 3CEBA 5KFQA 4A3GG 4DR5H 5DQHA 4YR2A 3L4KA 4DV7H 2EJ2A 4QJFA 1GGOA 4APMA 2HIXA 4O7YA 5LYJF 4J9NA 5LP6F 1EKVA 5IP7G 1R9TA 3RB6A 2DAAA 4F4ZA 4CKEA 4XZ3B 4ED8A 4K0KH 4DL5A 2YZNA 5KFTA 3J7AK 5JQGF 2W7PA 2FPGB 5H80A 5FJ8G 4CC6A 2HDKA 1OBDA 3T1YH 3V4ZA 5KG6A 4CMFA 3N6XA 1RJPA 5KG1A 4RB3C 4JI6H 2E2IA 2VUGA 1AUXA 5JVLA 1CKOA 5IWAH 4A3JG 3TQ1A 4FE2A 4DV6H 2PVPA 1EKPA 4A93G 1HNXH 4J0MA 1HNWH 1KC7A 4RB1A 3V6KA 4A3FG 3NGDA 3R9RA 1I94H 3PFFA 3GJXB 3GIKA 1IBMH 4Q4CA 3RJ0A 5J2UF 2E5LH 4MA0A 5F9LA 4LH6A 2AQ4A 1XK5A 2C2RA 3SGIA 4ECQA 3GTOA 2MCTA 2JEIA 3M9OB 2R86A 5DAAA 5KKNB 2WE6A 5KG3A 4LF7H 5KFAA 4QW8A 1XNQH 4LFBH 3K5IA 3H0GA 2HIVA 1EUCB 4ECYA 1S0MA 1WCMG 2PMZE 4ECWA 3GV5B 4CC5A 1S10A 3TW6A 4Q8EA 5DGHA 4U7CA 4QSHA 5IP9G 1N48A 2PMZA 1Y1VA 2HGSA 3W5OA 3OTOH 2HHFB 5IYCG 3JSLA 4DV4H 2HHHH 3QZ7A 3L2PA 5BWUA 4O7LA 4ECUA 4A3EG 4LSAA 5KFWA 4O7NA 2GQSA 4O4IF 4RUAA 3GV8B 2SCUB 5KFSA 3BQ1A 5LMNH 1XNRH 1A9XA 2R92G 2FJZA 1CS0A 3H3VH 3ETHA 4C5BA 2W6PA 4EFEA 3AW8A 2EJ3A 1K1SA 3N42B 5KFEA 4ED0A 1KT8A 1KEEA 2VUMG 4E6NA 4ECTA 5JQWA 2DLNA 4UCTA 5J2TF 3FDSA 3EPGA 5CB4F 2C00A 3N44B 1VAJA 2QF7A 3K3PA 3MFHA 2HVSA 4R8UB 4EYHB 1SYXB 2RDJA 5C1PA 2OLSA 4O7SA 5KS8A 4BBRG 2BQRA 4QWAA 4PWQA 5KFCA 2NU9B 3N43B 4IWYA 3M9NB 1HR0H 2VA2A 5KG2A 1G2WA 5KFDA 4DV2H 2X0SA 1S68A 1TAEA 3BA8A 1EZ1A 1TWHA 1E4EB 3PO3G 3FKIA 4DL4A 3T5HA 5KT2A 4PBCA 2WB1E 3T9DA 1HNZH 3PR5B 2UVWA 5BR8H 3DF7A 5HNEA 4MTEA 4UCUA 3PW0A 1RYSA 2DABA 5FR9A 4YR3A 3M4IA 3OHBA 4RNNA 2A1HA 4Q0YA 5KG5A 4EEQA 4MV3A 2UXCH 2I80A 4J9QA 2VA3A 1RK6A 4BXXG 4F4YA 2FPPB 5CR5A 5LOVF 4FGRA 3BACA 3CQZA 5FD5A 5D8DA 1IOWA 2Z04A 4A3DG 1DV1A 3R5XA 2ALZA 1T3NA 3N40P 2VPQA 4YB8B 1AUVA 2WTFA 3TINA 4MV7A 3GIJA 3MR5A 1EYZA 4UCRA 4XX0B 4J9LA 3L4JA 4EGJA 2FB9A 1FKAH 3AX6A 4TV8F 1IOVA 2AU0A 3T9EA 1BNCA 4RB0A 3QZ8A 4A3LG 3BG5A 1B04A 2NUAB 1JKJB 3DTGA 1I2LA 5IYZF 4J9KA 2P0AA 1SFOA 4YP3A 1ET0A 2Q2TA 4DL3A 1S0OA 4JV1A 4DR2H 2HGWA 3KAJA 5I5YA 4O3NA 1CKNB 4O3RA 1X9NA 1TWGA 4L1KA 2KSWA 4I7HA 4X66H 1CE8A 1B6RA 1DGSA 1I1KA 3Q8QB 3GTPA 1XMQH 2OH2A 1C30A 4RNOA 4FFPA 3DTFA 5BPFA 3GTGA 1CQJB 2V59A 4DAAA 1TWCA 4RU9A 4ECRA 5KT6A 4GLWA 2VOBA 4AYBE 3Q8PB 2W9BB 2HGXA 2HVQA 3V6HA 4MV8A 3HKZE 4AYBA 3QFFA 4CKCA 4IRCA 5CAEB 1ZAUA 3HKZA 3RAXA 1Y14B 2W9CB 4YAJB 2UVRA 4NXNH 2PN1A 5DMXA 3QWUA 4DQNA 2AGPA 5C1OA 1ZHQA 1OWTA 2QK4A 4A3CG 4IRDA 3VPBA 3N41B 3MR6A 3KYHC 4X65H 2EIYA 2R7KA 4O3SA 3CSWA 2R93A 4F4WA 2IBKA 3IG0A 2ATLA 2R8JA 4K6NA 4QWDA 4TM5A 3WWHA 1IYEA 4DLKA 4FBTA 2W6NA 4LF8H 2YS7A 3LP8A 3NBZB 1N56A 5FD6A 1XMOH 3J81W 1M7JA 3KALA 4FU0A 3V4SA 5KFJA 3HO8A 2JEFA 3GTKA 1VBGA 2X5RA 4TV9F 1EKFA 5FPOA 3QQMA 5BWXA 5KFBA 4O4HF 2WAQE 3T5KA 4JI1H 4CE5A 5LXTF 5CE8A 2CW8A 2XC9A 2XGPA 1T94A 4YAKB 2WAQA 1KJJA 3RV4A 2JA7A 2Q2UA 4YR0A 1IYDA 1GSHA 3BA9A 1Z2OX 3HOWG 2W6ZA 1Z2PX 4ED3A 1WH2A 5DLFA 4LF4H 2Z02A 2YZLA 3FKIG 2GPSA 3SI8A 5KFNA 2ZGIA 3RGXA 3VMMA 2WDTA 4IIJF 4EBDA 5F9NA 4LFAH 4F4XA 1WRVA 2GLTA 3GIDA 2YCHA 4EQ5A 3KHHA 4B3TH 4O7TA 2C2DA 4NZOA 4Q4DA 5D1PA 3GDEA 4ED2A 4WD3A 5K2MA 3RAQA 1MZBA 4LF6H 1V9PA 4MV6A 4JI8H 2YWVA 2W7OA 2FE3A 2GPWA 3ETJA 4JI3H 3UYYA 2R7ZG 1GO3E 1B33N 5KFXA 1I50A 3GQCA 5A2QW 2JA8G 3PN1A 5FPRA 3UQ8A 1W96A 5IT9W 1S03G 2C22A 2J6UA 4EFBA 2C2EA 4O7VA 3WNZA 3MWDA 3GIIA 2XCPA 1ZETA 2UUCH 4NYEA 2V58A 4HN2A 4MV9A 5GONF 3PW4A 4IWXA 3I12A 5KFZA 1GYFA 5KFGA 1I1LA 3T9AA 1TWFA 4RAYA 2BQ3A 3NBYB 3OUZA 4O3PA 1I7LA 4RCNA 4UUGA 3KHLA 4E4TA 5KT3A 3PW7A 2NU7B 2VQEH 4RZQA 3JRWA 3MFIA 1JDBB 3UZBA 1FJGH 4YJ3F 2YRXA 4O4JF 4R8UA 1M0WA 4DV5H 3BAAA 3RFCA 3U0GA 1AN7A 1E4FT 3GLKA 3GIMA 4DIMA 4DUYH 4O7WA 4JV5H 4AQYH 2R84A 2JA6G 3AYHB 3MR2A 5C44G 3T1HH 3ORRA 2V5AA 1DV2A 1RJQA 1Y1WG 3T5LA 5KFLA 2FPIB 2CKZB 4JI7H 2B63A 3T99A 3TIIA 2R8IA 3RGZA 5I5UA 4YHHH 2W71A 2XCAA 3GILA 4DR4H 2UVUA 3VPCA 4EBCA 3UZOA 5T14A 2XCLA 5EWFA 5KG7A 5LMUH 4PZ6A 2JA5G 4LF5H 4BY7G 2NVYA 4ME6A 4UCOA 4U6PA 1A3GA 3VOTA 4JV0A 4X64H 5DQGA 3PR4A 4IR1A 5KFIA 1V51A 4DR7H 3RUPA 1JIHA 5DGBA 5KFUA 3I4MG 2YW2A 3Q2OA 3KHGA 5LA6F 4DV0H 1S97A 3GTLA 2WYOA 3FMAA 3HXLA 4ECZA 2YS6A 1WR2A 3RBEA 4UFZA 2W9AA 4I55F 3F8NA 2FMAA 2F4VH 4A2BA 3BQ0A 1A0IA 1KJ8A 3PW2A 2IMWP 4Q44A 1IBKH 3MR3A 2C28A 4A3BG 4GKJH 1I1MA 5DQIA 4DV1H 1RJRA 4HYKA 4QWCA 4DR1H 4ED7A 1M6VA 2XD4A 5EWGA 3KAKA 4HNUA 3KXYT 4BY1G 5JH7F 5EOYA 5DGAA 2UUBH 5IYDG 2R8GA 4O81A 4JI0H 4MV1A 4B3MH 1T36A 3TW7A 2R8KA 1WCMA 1SEIA 3JAMW 3OSNA 4EBEA 2W70A 3PVXA 1RYRA 2UXDH 2CFMA 3R23A 3T7AA 4Q43A 3G8DA 2V4RA 1KJQA 1VKZA 1JLLB 3TY5A 5KFPA 1PX2A 5KFHA 3GTJA 2JA7G 2FK3A 3H40A 2V9WA 2DPIA 5BPHA 5E25A 5KT4A 3UFXB 2RDIA 4FBUA 2VQFH 3ORQA 2ZM6H 3KHRA 3T5JA 2BR0A 1M0TA 1I6UA 5BWWA 3GV7B 3G6YA 1VBHA 3SE7A 4DR3H 3E5NA 4FM9A 3H0GG 1N34H 4O84A 3V6JA 3W1GA 1L2ZA 5D1OA 3WWIA 4BWSC 3N8DA 3GB8B 4RB2C 4DL6A 2R7NA 1GSAA 5BYBA 2YRWA 2R7MA 3JRXA 4PZ8A 3TY9A 1I3QA 3BQ2A 5KX5F 1Y1VG 4ZQIA 1RK5A 4O82A 3T9FA 3TY8A 4FFMA 4C5CA 3HB9A 2R6FA 4RUCA 3RR5A 4BBSG 1N32H 1P16A 4NLGA 4JV2A 3DAAA 3JZIA 2RGVA 3PW5A 1N36H 1ZQ7A 4MAMA 3GTMA 2JEGA 1SCUB 1DAAA 1GLVA 2QYZA 4I50F 4B3RH 3SNOA 4CMDA 4TUYF 1KJ9A 3MWEA 4JI2H 1S9FA 2COIA 5L1KA 1XDNA 4YBZB 2YL2A 4G3IA 5I5XA 2FK2A 3RIZA 5KFFA 5KT5A 3IN5A 5L1JA 4DUZH 2VQDA 5DISC 4ECXA 1OBGA 5KT7A 5EZYF 3Q1KA 3G6XA 2IP4A 3T9BA 2BQUA 4O3OA 1I7NA 5LL6b 5CM0A 4HR7A 4DV3H 2ASLA 2W57A 2I87A 1KBLA 4FS1A 2J6SA 2CNUA 4O83A 4O2BF 5KFOA 4R7RA 4A3KG 2ODTX 4IR9A 2XGQA 3HOUG 5EWEA 3U9TA 4LFCH 1Z2NX 5DGIA 2B63G 4YQWA 2YYAA 2COJA 5C3EG 4LH7A 4XYMB 4JXUA 2EJ0A 3VPDA 4C2MA 1TWAA 1DIKA 3EPIA 3RBDA 1C3OA 2VPSA 4QW9A 2UU9H 4JI5H 4MA5A 2AGOA 4ZHQF 1JXLA 1I2KA 5FLMG 3OHAA 4GC7A 1ULZA 2OWOA 5BMVF 4ECVA 4TQSA 4EGQA 5KFRA 3KREA 4GC6A 3LQSA 2HHFA 1KTAA 2HG8A 2DIKA 4LF9H 4RNMA 3GIPA 2NU6B 2UXBH 3M9MB 5KFVA 1EUDB 4NXMH 4YJ2F 5DG7A 5KFKA 3U55A 3VA7A 2HVRA 4LMYA 4O2AF 5BWTA 2QB5A 3G6VA 4GKKH 1V4YA 4M0JA 2XIGA 4DL7A 2CNQA 4EEYA 4M7EA 2ASJA 4HQ6A 4HNTA 4YY3H 2W8LA 2COGA 3K3VA 3LMLA 5I60A 2FKLA 4LSXA 3CVZA
chains in the Genus database with same CATH topology
1PK8A 2R82A 3WO0A 3MJFA 5FNVF 3U54A 2DZDA 1JDEA 4O7ZA 2I8CA 2FP4B 2W6OA 4XYLB 4IZOA 1E4EA 4O7RA 5CA0F 2ZDQA 3HBLA 4EG0A 1EHIA 1KUTA 4O86A 2NU8B 5C8YF 5I47A 4FFOA 2CZGA 2YZMA 1CQIB 3U9SA 1GSOA 3R5HA 3K5HA 2W6MA 1W93A 3WO1A 2R85A 3OUUA 5CA1F 2R87A 5JVDF 4C5AA 3LWBA 1BXRA 4MV4A 4WBNF 4FFLA 4ZOLF 2R7LA 2ZDGA 2CNVA 4FFNA 2CQYA 2ZDHA 4ZI7F 3NUAA 3G8CA 4IHJF 3RV3A 1A48A 1KJIA 1UC8A 2YZGA 5HBRB 4I4TF 4M9UA 4HNVA 3N6RA 4O4LF 3TQTA 2GQRA 4Y8VB 2HJWA 1UC9A 2W6QA 1B6SA 5HV6A 2PBZA 2DWCA 3JZFA 3R5FA 2VR1A 3TIGA 4FFRA 2J9GA 1GGOA 4O7YA 5LYJF 5LP6F 4XZ3B 2YZNA 5JQGF 2FPGB 5H80A 1OBDA 3V4ZA 1AUXA 5JVLA 4FE2A 2PVPA 1KC7A 3R9RA 5J2UF 4MA0A 2R86A 5KKNB 3K5IA 1EUCB 3TW6A 4QSHA 2HGSA 4O7LA 4O7NA 2GQSA 4O4IF 2SCUB 1A9XA 1CS0A 3ETHA 4C5BA 2W6PA 3AW8A 1KEEA 5JQWA 2DLNA 5J2TF 5CB4F 2C00A 2QF7A 3K3PA 5C1PA 2OLSA 4O7SA 2NU9B 4IWYA 2X0SA 1EZ1A 1E4EB 3DF7A 4MV3A 2I80A 2FPPB 5LOVF 4FGRA 5D8DA 1IOWA 2Z04A 1DV1A 3R5XA 2VPQA 4YB8B 1AUVA 3TINA 4MV7A 1EYZA 4XX0B 4EGJA 2FB9A 3AX6A 4TV8F 1IOVA 1BNCA 3BG5A 2NUAB 1JKJB 5IYZF 2P0AA 3KAJA 4L1KA 1CE8A 1B6RA 1C30A 4FFPA 5BPFA 1CQJB 2V59A 4MV8A 3QFFA 5CAEB 4YAJB 2PN1A 5DMXA 5C1OA 2QK4A 3VPBA 2R7KA 4DLKA 2W6NA 2YS7A 3LP8A 3KALA 4FU0A 3V4SA 3HO8A 1VBGA 4TV9F 4O4HF 5LXTF 4YAKB 1KJJA 3RV4A 1GSHA 1Z2OX 2W6ZA 1Z2PX 2Z02A 2YZLA 2GPSA 3VMMA 4IIJF 2GLTA 3GIDA 4O7TA 4WD3A 5K2MA 4MV6A 2YWVA 2GPWA 3ETJA 1W96A 4O7VA 3WNZA 3MWDA 4NYEA 2V58A 4MV9A 5GONF 4IWXA 3I12A 3OUZA 1I7LA 4E4TA 2NU7B 4RZQA 3JRWA 1JDBB 4YJ3F 2YRXA 4O4JF 1M0WA 3RFCA 3GLKA 4DIMA 4O7WA 2R84A 3ORRA 2V5AA 1DV2A 2FPIB 3TIIA 2W71A 3VPCA 2XCLA 4ME6A 3VOTA 3RUPA 2YW2A 3Q2OA 5LA6F 2WYOA 2YS6A 1WR2A 4I55F 1KJ8A 1M6VA 2XD4A 3KAKA 4HNUA 5JH7F 4O81A 4MV1A 1T36A 2W70A 3R23A 3G8DA 1KJQA 1VKZA 1JLLB 1PX2A 5BPHA 3UFXB 3ORQA 1M0TA 1VBHA 3SE7A 3E5NA 4O84A 3N8DA 2R7NA 1GSAA 2YRWA 2R7MA 3JRXA 5KX5F 4ZQIA 4O82A 4FFMA 4C5CA 3HB9A 2R6FA 3JZIA 4MAMA 1SCUB 1GLVA 4I50F 4TUYF 1KJ9A 3MWEA 4YBZB 2YL2A 2VQDA 1OBGA 5EZYF 3Q1KA 2IP4A 1I7NA 4HR7A 2I87A 1KBLA 2CNUA 4O83A 4O2BF 3U9TA 1Z2NX 2YYAA 4XYMB 3VPDA 1DIKA 1C3OA 4MA5A 4ZHQF 1ULZA 5BMVF 4EGQA 3KREA 2DIKA 2NU6B 1EUDB 4YJ2F 3U55A 3VA7A 4O2AF 2CNQA 4HQ6A 4HNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK8 A;  2R82 A;  3WO0 A;  3MJF A;  5FNV F;  3U54 A;  2DZD A;  1JDE A;  4O7Z A;  2I8C A;  2FP4 B;  2W6O A;  4XYL B;  4IZO A;  1E4E A;  4O7R A;  5CA0 F;  2ZDQ A;  3HBL A;  4EG0 A;  1EHI A;  1KUT A;  4O86 A;  2NU8 B;  5C8Y F;  5I47 A;  4FFO A;  2CZG A;  2YZM A;  1CQI B;  3U9S A;  1GSO A;  3R5H A;  3K5H A;  2W6M A;  1W93 A;  3WO1 A;  2R85 A;  3OUU A;  5CA1 F;  2R87 A;  5JVD F;  4C5A A;  3LWB A;  1BXR A;  4MV4 A;  4WBN F;  4FFL A;  4ZOL F;  2R7L A;  2ZDG A;  2CNV A;  4FFN A;  2CQY A;  2ZDH A;  4ZI7 F;  3NUA A;  3G8C A;  4IHJ F;  3RV3 A;  1A48 A;  1KJI A;  1UC8 A;  2YZG A;  5HBR B;  4I4T F;  4M9U A;  4HNV A;  3N6R A;  4O4L F;  3TQT A;  2GQR A;  4Y8V B;  2HJW A;  1UC9 A;  2W6Q A;  1B6S A;  5HV6 A;  2PBZ A;  2DWC A;  3JZF A;  3R5F A;  2VR1 A;  3TIG A;  4FFR A;  2J9G A;  1GGO A;  4O7Y A;  5LYJ F;  5LP6 F;  4XZ3 B;  2YZN A;  5JQG F;  2FPG B;  5H80 A;  1OBD A;  3V4Z A;  1AUX A;  5JVL A;  4FE2 A;  2PVP A;  1KC7 A;  3R9R A;  5J2U F;  4MA0 A;  2R86 A;  5KKN B;  3K5I A;  1EUC B;  3TW6 A;  4QSH A;  2HGS A;  4O7L A;  4O7N A;  2GQS A;  4O4I F;  2SCU B;  1A9X A;  1CS0 A;  3ETH A;  4C5B A;  2W6P A;  3AW8 A;  1KEE A;  5JQW A;  2DLN A;  5J2T F;  5CB4 F;  2C00 A;  2QF7 A;  3K3P A;  5C1P A;  2OLS A;  4O7S A;  2NU9 B;  4IWY A;  2X0S A;  1EZ1 A;  1E4E B;  3DF7 A;  4MV3 A;  2I80 A;  2FPP B;  5LOV F;  4FGR A;  5D8D A;  1IOW A;  2Z04 A;  1DV1 A;  3R5X A;  2VPQ A;  4YB8 B;  1AUV A;  3TIN A;  4MV7 A;  1EYZ A;  4XX0 B;  4EGJ A;  2FB9 A;  3AX6 A;  4TV8 F;  1IOV A;  1BNC A;  3BG5 A;  2NUA B;  1JKJ B;  5IYZ F;  2P0A A;  3KAJ A;  4L1K A;  1CE8 A;  1B6R A;  1C30 A;  4FFP A;  5BPF A;  1CQJ B;  2V59 A;  4MV8 A;  3QFF A;  5CAE B;  4YAJ B;  2PN1 A;  5DMX A;  5C1O A;  2QK4 A;  3VPB A;  2R7K A;  4DLK A;  2W6N A;  2YS7 A;  3LP8 A;  3KAL A;  4FU0 A;  3V4S A;  3HO8 A;  1VBG A;  4TV9 F;  4O4H F;  5LXT F;  4YAK B;  1KJJ A;  3RV4 A;  1GSH A;  1Z2O X;  2W6Z A;  1Z2P X;  2Z02 A;  2YZL A;  2GPS A;  3VMM A;  4IIJ F;  2GLT A;  3GID A;  4O7T A;  4WD3 A;  5K2M A;  4MV6 A;  2YWV A;  2GPW A;  3ETJ A;  1W96 A;  4O7V A;  3WNZ A;  3MWD A;  4NYE A;  2V58 A;  4MV9 A;  5GON F;  4IWX A;  3I12 A;  3OUZ A;  1I7L A;  4E4T A;  2NU7 B;  4RZQ A;  3JRW A;  1JDB B;  4YJ3 F;  2YRX A;  4O4J F;  1M0W A;  3RFC A;  3GLK A;  4DIM A;  4O7W A;  2R84 A;  3ORR A;  2V5A A;  1DV2 A;  2FPI B;  3TII A;  2W71 A;  3VPC A;  2XCL A;  4ME6 A;  3VOT A;  3RUP A;  2YW2 A;  3Q2O A;  5LA6 F;  2WYO A;  2YS6 A;  1WR2 A;  4I55 F;  1KJ8 A;  1M6V A;  2XD4 A;  3KAK A;  4HNU A;  5JH7 F;  4O81 A;  4MV1 A;  1T36 A;  2W70 A;  3R23 A;  3G8D A;  1KJQ A;  1VKZ A;  1JLL B;  1PX2 A;  5BPH A;  3UFX B;  3ORQ A;  1M0T A;  1VBH A;  3SE7 A;  3E5N A;  4O84 A;  3N8D A;  2R7N A;  1GSA A;  2YRW A;  2R7M A;  3JRX A;  5KX5 F;  4ZQI A;  4O82 A;  4FFM A;  4C5C A;  3HB9 A;  2R6F A;  3JZI A;  4MAM A;  1SCU B;  1GLV A;  4I50 F;  4TUY F;  1KJ9 A;  3MWE A;  4YBZ B;  2YL2 A;  2VQD A;  1OBG A;  5EZY F;  3Q1K A;  2IP4 A;  1I7N A;  4HR7 A;  2I87 A;  1KBL A;  2CNU A;  4O83 A;  4O2B F;  3U9T A;  1Z2N X;  2YYA A;  4XYM B;  3VPD A;  1DIK A;  1C3O A;  4MA5 A;  4ZHQ F;  1ULZ A;  5BMV F;  4EGQ A;  3KRE A;  2DIK A;  2NU6 B;  1EUD B;  4YJ2 F;  3U55 A;  3VA7 A;  4O2A F;  2CNQ A;  4HQ6 A;  4HNT A; 
#chains in the Genus database with same CATH topology
 1PK8 A;  3RB0 A;  2DPJ A;  3Q8S B;  4B3S H;  2YU9 A;  2R82 A;  3WO0 A;  4QIW E;  3MJF A;  5FLX W;  4NZN A;  5FNV F;  3U54 A;  2DZD A;  4ETS A;  1JDE A;  4TQR A;  4O7Z A;  5K3W A;  2I8C A;  4QIW A;  4QWE A;  4ED1 A;  2FP4 B;  4DR6 H;  4QWB A;  5I5T A;  5KFY A;  3LUL A;  3RB4 A;  4DRF A;  4IAJ A;  2W6O A;  3H20 A;  2W8K A;  4J9M A;  2UVV A;  5BWR A;  1BGW A;  4UCV A;  2C35 B;  4XYL B;  4IZO A;  1IBL H;  1E4E A;  4O7R A;  1K1Q A;  2ABJ A;  3RB3 A;  2FLL A;  3GTQ A;  5CA0 F;  5L1I A;  4A3M G;  1BJT A;  2FLP A;  4RZR A;  2ZDQ A;  2RF4 A;  4Q8F A;  4CHI A;  3HBL A;  4FS2 A;  4DL2 A;  2M05 A;  3PO2 G;  2UUA H;  2FLN A;  4GLX A;  5KG4 A;  4EG0 A;  1EHI A;  2ZJT A;  1KUT A;  3KTM A;  4O86 A;  2NU8 B;  5C8Y F;  5BWV A;  5I47 A;  4EYI B;  2R93 G;  2IA6 A;  4FFO A;  2CZG A;  4JUZ A;  2YZM A;  1CQI B;  5BYA A;  2JEJ A;  3U9S A;  1ZHS A;  1FVI A;  1GSO A;  3BJY A;  4KHP H;  3R5H A;  3K5H A;  4X62 H;  1WSC A;  2R8H A;  5L1L A;  4NZM A;  2W6M A;  2WB1 A;  1W93 A;  4J9P A;  3WO1 A;  2R85 A;  3OUU A;  4PZ7 A;  3W1B A;  5CA1 F;  5DG9 A;  4J9S A;  2R87 A;  5JVD F;  4F50 A;  2Y4R A;  4C5A A;  4O3Q A;  3LWB A;  3T54 A;  1BXR A;  4MV4 A;  4WBN F;  5I5V A;  4J9O A;  4FFL A;  4ZOL F;  1K83 A;  3Q8R B;  4JI4 H;  2R7L A;  4Q45 A;  2E2H A;  2ZDG A;  2R7Z A;  3HOV G;  2CNV A;  4FFN A;  2CQY A;  3EYY A;  5L9X A;  3H4B A;  1JX4 A;  1N33 H;  1CKN A;  5IYB G;  1J5E H;  1CKM A;  2Y0S E;  3GIQ A;  1S0N A;  2ZDH A;  4ZI7 F;  3HOX G;  4A2A A;  3OSP A;  4PDB A;  2Y0S A;  1P8L A;  3NUA A;  2R92 A;  4UCS A;  1O75 A;  3G8C A;  4IHJ F;  3RV3 A;  4ED6 A;  1A48 A;  1KJI A;  3C0F B;  3H4D A;  5I5W A;  3I4N G;  1VS0 A;  2W9B A;  1TA8 A;  2VUM A;  3BAB A;  1UC8 A;  2FK1 A;  3TEK A;  2YZG A;  3RF2 A;  2J6T A;  3HOY G;  5HBR B;  4I4T F;  2ASD A;  4JYA H;  3J80 W;  4M9U A;  3RTX A;  4HNV A;  2W9C A;  3N6R A;  5EDW A;  4O4L F;  3TQT A;  2GQR A;  3S24 A;  3JSN A;  5C5J A;  5KG0 A;  5DG8 A;  4J9R A;  3PZP A;  3T9C A;  3JZ6 A;  4Y8V B;  5JUM A;  4ECS A;  2RGR A;  2AGQ A;  2NVX A;  3VNN A;  3HT5 A;  4WHX A;  4MTD A;  2JA6 A;  5DLG A;  1UC9 A;  2HJW A;  3NC0 B;  4A3I G;  2Q7D A;  1A0G A;  2W6Q A;  5I5S A;  3HOZ G;  1Y1W A;  4OX9 H;  5D1O B;  4CKB A;  1B6S A;  5HV6 A;  2PBZ A;  2DWC A;  3WWJ A;  3JZF A;  4TVI A;  1UNN C;  3R5F A;  2V4Q A;  2VR1 A;  5C4X G;  4IRK A;  5KFM A;  3MWM A;  2CW7 A;  3TIG A;  4FFR A;  1E4G T;  2O03 A;  2J9G A;  4RAZ A;  2JA5 A;  3CEB A;  5KFQ A;  4A3G G;  4DR5 H;  5DQH A;  4YR2 A;  3L4K A;  4DV7 H;  2EJ2 A;  4QJF A;  1GGO A;  4APM A;  2HIX A;  4O7Y A;  5LYJ F;  4J9N A;  5LP6 F;  1EKV A;  5IP7 G;  1R9T A;  3RB6 A;  2DAA A;  4F4Z A;  4CKE A;  4XZ3 B;  4ED8 A;  4K0K H;  4DL5 A;  2YZN A;  5KFT A;  3J7A K;  5JQG F;  2W7P A;  2FPG B;  5H80 A;  5FJ8 G;  4CC6 A;  2HDK A;  1OBD A;  3T1Y H;  3V4Z A;  5KG6 A;  4CMF A;  3N6X A;  1RJP A;  5KG1 A;  4RB3 C;  4JI6 H;  2E2I A;  2VUG A;  1AUX A;  5JVL A;  1CKO A;  5IWA H;  4A3J G;  3TQ1 A;  4FE2 A;  4DV6 H;  2PVP A;  1EKP A;  4A93 G;  1HNX H;  4J0M A;  1HNW H;  1KC7 A;  4RB1 A;  3V6K A;  4A3F G;  3NGD A;  3R9R A;  1I94 H;  3PFF A;  3GJX B;  3GIK A;  1IBM H;  4Q4C A;  3RJ0 A;  5J2U F;  2E5L H;  4MA0 A;  5F9L A;  4LH6 A;  2AQ4 A;  1XK5 A;  2C2R A;  3SGI A;  4ECQ A;  3GTO A;  2MCT A;  2JEI A;  3M9O B;  2R86 A;  5DAA A;  5KKN B;  2WE6 A;  5KG3 A;  4LF7 H;  5KFA A;  4QW8 A;  1XNQ H;  4LFB H;  3K5I A;  3H0G A;  2HIV A;  1EUC B;  4ECY A;  1S0M A;  1WCM G;  2PMZ E;  4ECW A;  3GV5 B;  4CC5 A;  1S10 A;  3TW6 A;  4Q8E A;  5DGH A;  4U7C A;  4QSH A;  5IP9 G;  1N48 A;  2PMZ A;  1Y1V A;  2HGS A;  3W5O A;  3OTO H;  2HHF B;  5IYC G;  3JSL A;  4DV4 H;  2HHH H;  3QZ7 A;  3L2P A;  5BWU A;  4O7L A;  4ECU A;  4A3E G;  4LSA A;  5KFW A;  4O7N A;  2GQS A;  4O4I F;  4RUA A;  3GV8 B;  2SCU B;  5KFS A;  3BQ1 A;  5LMN H;  1XNR H;  1A9X A;  2R92 G;  2FJZ A;  1CS0 A;  3H3V H;  3ETH A;  4C5B A;  2W6P A;  4EFE A;  3AW8 A;  2EJ3 A;  1K1S A;  3N42 B;  5KFE A;  4ED0 A;  1KT8 A;  1KEE A;  2VUM G;  4E6N A;  4ECT A;  5JQW A;  2DLN A;  4UCT A;  5J2T F;  3FDS A;  3EPG A;  5CB4 F;  2C00 A;  3N44 B;  1VAJ A;  2QF7 A;  3K3P A;  3MFH A;  2HVS A;  4R8U B;  4EYH B;  1SYX B;  2RDJ A;  5C1P A;  2OLS A;  4O7S A;  5KS8 A;  4BBR G;  2BQR A;  4QWA A;  4PWQ A;  5KFC A;  2NU9 B;  3N43 B;  4IWY A;  3M9N B;  1HR0 H;  2VA2 A;  5KG2 A;  1G2W A;  5KFD A;  4DV2 H;  2X0S A;  1S68 A;  1TAE A;  3BA8 A;  1EZ1 A;  1TWH A;  1E4E B;  3PO3 G;  3FKI A;  4DL4 A;  3T5H A;  5KT2 A;  4PBC A;  2WB1 E;  3T9D A;  1HNZ H;  3PR5 B;  2UVW A;  5BR8 H;  3DF7 A;  5HNE A;  4MTE A;  4UCU A;  3PW0 A;  1RYS A;  2DAB A;  5FR9 A;  4YR3 A;  3M4I A;  3OHB A;  4RNN A;  2A1H A;  4Q0Y A;  5KG5 A;  4EEQ A;  4MV3 A;  2UXC H;  2I80 A;  4J9Q A;  2VA3 A;  1RK6 A;  4BXX G;  4F4Y A;  2FPP B;  5CR5 A;  5LOV F;  4FGR A;  3BAC A;  3CQZ A;  5FD5 A;  5D8D A;  1IOW A;  2Z04 A;  4A3D G;  1DV1 A;  3R5X A;  2ALZ A;  1T3N A;  3N40 P;  2VPQ A;  4YB8 B;  1AUV A;  2WTF A;  3TIN A;  4MV7 A;  3GIJ A;  3MR5 A;  1EYZ A;  4UCR A;  4XX0 B;  4J9L A;  3L4J A;  4EGJ A;  2FB9 A;  1FKA H;  3AX6 A;  4TV8 F;  1IOV A;  2AU0 A;  3T9E A;  1BNC A;  4RB0 A;  3QZ8 A;  4A3L G;  3BG5 A;  1B04 A;  2NUA B;  1JKJ B;  3DTG A;  1I2L A;  5IYZ F;  4J9K A;  2P0A A;  1SFO A;  4YP3 A;  1ET0 A;  2Q2T A;  4DL3 A;  1S0O A;  4JV1 A;  4DR2 H;  2HGW A;  3KAJ A;  5I5Y A;  4O3N A;  1CKN B;  4O3R A;  1X9N A;  1TWG A;  4L1K A;  2KSW A;  4I7H A;  4X66 H;  1CE8 A;  1B6R A;  1DGS A;  1I1K A;  3Q8Q B;  3GTP A;  1XMQ H;  2OH2 A;  1C30 A;  4RNO A;  4FFP A;  3DTF A;  5BPF A;  3GTG A;  1CQJ B;  2V59 A;  4DAA A;  1TWC A;  4RU9 A;  4ECR A;  5KT6 A;  4GLW A;  2VOB A;  4AYB E;  3Q8P B;  2W9B B;  2HGX A;  2HVQ A;  3V6H A;  4MV8 A;  3HKZ E;  4AYB A;  3QFF A;  4CKC A;  4IRC A;  5CAE B;  1ZAU A;  3HKZ A;  3RAX A;  1Y14 B;  2W9C B;  4YAJ B;  2UVR A;  4NXN H;  2PN1 A;  5DMX A;  3QWU A;  4DQN A;  2AGP A;  5C1O A;  1ZHQ A;  1OWT A;  2QK4 A;  4A3C G;  4IRD A;  3VPB A;  3N41 B;  3MR6 A;  3KYH C;  4X65 H;  2EIY A;  2R7K A;  4O3S A;  3CSW A;  2R93 A;  4F4W A;  2IBK A;  3IG0 A;  2ATL A;  2R8J A;  4K6N A;  4QWD A;  4TM5 A;  3WWH A;  1IYE A;  4DLK A;  4FBT A;  2W6N A;  4LF8 H;  2YS7 A;  3LP8 A;  3NBZ B;  1N56 A;  5FD6 A;  1XMO H;  3J81 W;  1M7J A;  3KAL A;  4FU0 A;  3V4S A;  5KFJ A;  3HO8 A;  2JEF A;  3GTK A;  1VBG A;  2X5R A;  4TV9 F;  1EKF A;  5FPO A;  3QQM A;  5BWX A;  5KFB A;  4O4H F;  2WAQ E;  3T5K A;  4JI1 H;  4CE5 A;  5LXT F;  5CE8 A;  2CW8 A;  2XC9 A;  2XGP A;  1T94 A;  4YAK B;  2WAQ A;  1KJJ A;  3RV4 A;  2JA7 A;  2Q2U A;  4YR0 A;  1IYD A;  1GSH A;  3BA9 A;  1Z2O X;  3HOW G;  2W6Z A;  1Z2P X;  4ED3 A;  1WH2 A;  5DLF A;  4LF4 H;  2Z02 A;  2YZL A;  3FKI G;  2GPS A;  3SI8 A;  5KFN A;  2ZGI A;  3RGX A;  3VMM A;  2WDT A;  4IIJ F;  4EBD A;  5F9N A;  4LFA H;  4F4X A;  1WRV A;  2GLT A;  3GID A;  2YCH A;  4EQ5 A;  3KHH A;  4B3T H;  4O7T A;  2C2D A;  4NZO A;  4Q4D A;  5D1P A;  3GDE A;  4ED2 A;  4WD3 A;  5K2M A;  3RAQ A;  1MZB A;  4LF6 H;  1V9P A;  4MV6 A;  4JI8 H;  2YWV A;  2W7O A;  2FE3 A;  2GPW A;  3ETJ A;  4JI3 H;  3UYY A;  2R7Z G;  1GO3 E;  1B33 N;  5KFX A;  1I50 A;  3GQC A;  5A2Q W;  2JA8 G;  3PN1 A;  5FPR A;  3UQ8 A;  1W96 A;  5IT9 W;  1S03 G;  2C22 A;  2J6U A;  4EFB A;  2C2E A;  4O7V A;  3WNZ A;  3MWD A;  3GII A;  2XCP A;  1ZET A;  2UUC H;  4NYE A;  2V58 A;  4HN2 A;  4MV9 A;  5GON F;  3PW4 A;  4IWX A;  3I12 A;  5KFZ A;  1GYF A;  5KFG A;  1I1L A;  3T9A A;  1TWF A;  4RAY A;  2BQ3 A;  3NBY B;  3OUZ A;  4O3P A;  1I7L A;  4RCN A;  4UUG A;  3KHL A;  4E4T A;  5KT3 A;  3PW7 A;  2NU7 B;  2VQE H;  4RZQ A;  3JRW A;  3MFI A;  1JDB B;  3UZB A;  1FJG H;  4YJ3 F;  2YRX A;  4O4J F;  4R8U A;  1M0W A;  4DV5 H;  3BAA A;  3RFC A;  3U0G A;  1AN7 A;  1E4F T;  3GLK A;  3GIM A;  4DIM A;  4DUY H;  4O7W A;  4JV5 H;  4AQY H;  2R84 A;  2JA6 G;  3AYH B;  3MR2 A;  5C44 G;  3T1H H;  3ORR A;  2V5A A;  1DV2 A;  1RJQ A;  1Y1W G;  3T5L A;  5KFL A;  2FPI B;  2CKZ B;  4JI7 H;  2B63 A;  3T99 A;  3TII A;  2R8I A;  3RGZ A;  5I5U A;  4YHH H;  2W71 A;  2XCA A;  3GIL A;  4DR4 H;  2UVU A;  3VPC A;  4EBC A;  3UZO A;  5T14 A;  2XCL A;  5EWF A;  5KG7 A;  5LMU H;  4PZ6 A;  2JA5 G;  4LF5 H;  4BY7 G;  2NVY A;  4ME6 A;  4UCO A;  4U6P A;  1A3G A;  3VOT A;  4JV0 A;  4X64 H;  5DQG A;  3PR4 A;  4IR1 A;  5KFI A;  1V51 A;  4DR7 H;  3RUP A;  1JIH A;  5DGB A;  5KFU A;  3I4M G;  2YW2 A;  3Q2O A;  3KHG A;  5LA6 F;  4DV0 H;  1S97 A;  3GTL A;  2WYO A;  3FMA A;  3HXL A;  4ECZ A;  2YS6 A;  1WR2 A;  3RBE A;  4UFZ A;  2W9A A;  4I55 F;  3F8N A;  2FMA A;  2F4V H;  4A2B A;  3BQ0 A;  1A0I A;  1KJ8 A;  3PW2 A;  2IMW P;  4Q44 A;  1IBK H;  3MR3 A;  2C28 A;  4A3B G;  4GKJ H;  1I1M A;  5DQI A;  4DV1 H;  1RJR A;  4HYK A;  4QWC A;  4DR1 H;  4ED7 A;  1M6V A;  2XD4 A;  5EWG A;  3KAK A;  4HNU A;  3KXY T;  4BY1 G;  5JH7 F;  5EOY A;  5DGA A;  2UUB H;  5IYD G;  2R8G A;  4O81 A;  4JI0 H;  4MV1 A;  4B3M H;  1T36 A;  3TW7 A;  2R8K A;  1WCM A;  1SEI A;  3JAM W;  3OSN A;  4EBE A;  2W70 A;  3PVX A;  1RYR A;  2UXD H;  2CFM A;  3R23 A;  3T7A A;  4Q43 A;  3G8D A;  2V4R A;  1KJQ A;  1VKZ A;  1JLL B;  3TY5 A;  5KFP A;  1PX2 A;  5KFH A;  3GTJ A;  2JA7 G;  2FK3 A;  3H40 A;  2V9W A;  2DPI A;  5BPH A;  5E25 A;  5KT4 A;  3UFX B;  2RDI A;  4FBU A;  2VQF H;  3ORQ A;  2ZM6 H;  3KHR A;  3T5J A;  2BR0 A;  1M0T A;  1I6U A;  5BWW A;  3GV7 B;  3G6Y A;  1VBH A;  3SE7 A;  4DR3 H;  3E5N A;  4FM9 A;  3H0G G;  1N34 H;  4O84 A;  3V6J A;  3W1G A;  1L2Z A;  5D1O A;  3WWI A;  4BWS C;  3N8D A;  3GB8 B;  4RB2 C;  4DL6 A;  2R7N A;  1GSA A;  5BYB A;  2YRW A;  2R7M A;  3JRX A;  4PZ8 A;  3TY9 A;  1I3Q A;  3BQ2 A;  5KX5 F;  1Y1V G;  4ZQI A;  1RK5 A;  4O82 A;  3T9F A;  3TY8 A;  4FFM A;  4C5C A;  3HB9 A;  2R6F A;  4RUC A;  3RR5 A;  4BBS G;  1N32 H;  1P16 A;  4NLG A;  4JV2 A;  3DAA A;  3JZI A;  2RGV A;  3PW5 A;  1N36 H;  1ZQ7 A;  4MAM A;  3GTM A;  2JEG A;  1SCU B;  1DAA A;  1GLV A;  2QYZ A;  4I50 F;  4B3R H;  3SNO A;  4CMD A;  4TUY F;  1KJ9 A;  3MWE A;  4JI2 H;  1S9F A;  2COI A;  5L1K A;  1XDN A;  4YBZ B;  2YL2 A;  4G3I A;  5I5X A;  2FK2 A;  3RIZ A;  5KFF A;  5KT5 A;  3IN5 A;  5L1J A;  4DUZ H;  2VQD A;  5DIS C;  4ECX A;  1OBG A;  5KT7 A;  5EZY F;  3Q1K A;  3G6X A;  2IP4 A;  3T9B A;  2BQU A;  4O3O A;  1I7N A;  5LL6 b;  5CM0 A;  4HR7 A;  4DV3 H;  2ASL A;  2W57 A;  2I87 A;  1KBL A;  4FS1 A;  2J6S A;  2CNU A;  4O83 A;  4O2B F;  5KFO A;  4R7R A;  4A3K G;  2ODT X;  4IR9 A;  2XGQ A;  3HOU G;  5EWE A;  3U9T A;  4LFC H;  1Z2N X;  5DGI A;  2B63 G;  4YQW A;  2YYA A;  2COJ A;  5C3E G;  4LH7 A;  4XYM B;  4JXU A;  2EJ0 A;  3VPD A;  4C2M A;  1TWA A;  1DIK A;  3EPI A;  3RBD A;  1C3O A;  2VPS A;  4QW9 A;  2UU9 H;  4JI5 H;  4MA5 A;  2AGO A;  4ZHQ F;  1JXL A;  1I2K A;  5FLM G;  3OHA A;  4GC7 A;  1ULZ A;  2OWO A;  5BMV F;  4ECV A;  4TQS A;  4EGQ A;  5KFR A;  3KRE A;  4GC6 A;  3LQS A;  2HHF A;  1KTA A;  2HG8 A;  2DIK A;  4LF9 H;  4RNM A;  3GIP A;  2NU6 B;  2UXB H;  3M9M B;  5KFV A;  1EUD B;  4NXM H;  4YJ2 F;  5DG7 A;  5KFK A;  3U55 A;  3VA7 A;  2HVR A;  4LMY A;  4O2A F;  5BWT A;  2QB5 A;  3G6V A;  4GKK H;  1V4Y A;  4M0J A;  2XIG A;  4DL7 A;  2CNQ A;  4EEY A;  4M7E A;  2ASJ A;  4HQ6 A;  4HNT A;  4YY3 H;  2W8L A;  2COG A;  3K3V A;  3LML A;  5I60 A;  2FKL A;  4LSX A;  3CVZ A; 
#chains in the Genus database with same CATH homology
 1PK8 A;  2R82 A;  3WO0 A;  3MJF A;  5FNV F;  3U54 A;  2DZD A;  1JDE A;  4O7Z A;  2I8C A;  2FP4 B;  2W6O A;  4XYL B;  4IZO A;  1E4E A;  4O7R A;  5CA0 F;  2ZDQ A;  3HBL A;  4EG0 A;  1EHI A;  1KUT A;  4O86 A;  2NU8 B;  5C8Y F;  5I47 A;  4FFO A;  2CZG A;  2YZM A;  1CQI B;  3U9S A;  1GSO A;  3R5H A;  3K5H A;  2W6M A;  1W93 A;  3WO1 A;  2R85 A;  3OUU A;  5CA1 F;  2R87 A;  5JVD F;  4C5A A;  3LWB A;  1BXR A;  4MV4 A;  4WBN F;  4FFL A;  4ZOL F;  2R7L A;  2ZDG A;  2CNV A;  4FFN A;  2CQY A;  2ZDH A;  4ZI7 F;  3NUA A;  3G8C A;  4IHJ F;  3RV3 A;  1A48 A;  1KJI A;  1UC8 A;  2YZG A;  5HBR B;  4I4T F;  4M9U A;  4HNV A;  3N6R A;  4O4L F;  3TQT A;  2GQR A;  4Y8V B;  2HJW A;  1UC9 A;  2W6Q A;  1B6S A;  5HV6 A;  2PBZ A;  2DWC A;  3JZF A;  3R5F A;  2VR1 A;  3TIG A;  4FFR A;  2J9G A;  1GGO A;  4O7Y A;  5LYJ F;  5LP6 F;  4XZ3 B;  2YZN A;  5JQG F;  2FPG B;  5H80 A;  1OBD A;  3V4Z A;  1AUX A;  5JVL A;  4FE2 A;  2PVP A;  1KC7 A;  3R9R A;  5J2U F;  4MA0 A;  2R86 A;  5KKN B;  3K5I A;  1EUC B;  3TW6 A;  4QSH A;  2HGS A;  4O7L A;  4O7N A;  2GQS A;  4O4I F;  2SCU B;  1A9X A;  1CS0 A;  3ETH A;  4C5B A;  2W6P A;  3AW8 A;  1KEE A;  5JQW A;  2DLN A;  5J2T F;  5CB4 F;  2C00 A;  2QF7 A;  3K3P A;  5C1P A;  2OLS A;  4O7S A;  2NU9 B;  4IWY A;  2X0S A;  1EZ1 A;  1E4E B;  3DF7 A;  4MV3 A;  2I80 A;  2FPP B;  5LOV F;  4FGR A;  5D8D A;  1IOW A;  2Z04 A;  1DV1 A;  3R5X A;  2VPQ A;  4YB8 B;  1AUV A;  3TIN A;  4MV7 A;  1EYZ A;  4XX0 B;  4EGJ A;  2FB9 A;  3AX6 A;  4TV8 F;  1IOV A;  1BNC A;  3BG5 A;  2NUA B;  1JKJ B;  5IYZ F;  2P0A A;  3KAJ A;  4L1K A;  1CE8 A;  1B6R A;  1C30 A;  4FFP A;  5BPF A;  1CQJ B;  2V59 A;  4MV8 A;  3QFF A;  5CAE B;  4YAJ B;  2PN1 A;  5DMX A;  5C1O A;  2QK4 A;  3VPB A;  2R7K A;  4DLK A;  2W6N A;  2YS7 A;  3LP8 A;  3KAL A;  4FU0 A;  3V4S A;  3HO8 A;  1VBG A;  4TV9 F;  4O4H F;  5LXT F;  4YAK B;  1KJJ A;  3RV4 A;  1GSH A;  1Z2O X;  2W6Z A;  1Z2P X;  2Z02 A;  2YZL A;  2GPS A;  3VMM A;  4IIJ F;  2GLT A;  3GID A;  4O7T A;  4WD3 A;  5K2M A;  4MV6 A;  2YWV A;  2GPW A;  3ETJ A;  1W96 A;  4O7V A;  3WNZ A;  3MWD A;  4NYE A;  2V58 A;  4MV9 A;  5GON F;  4IWX A;  3I12 A;  3OUZ A;  1I7L A;  4E4T A;  2NU7 B;  4RZQ A;  3JRW A;  1JDB B;  4YJ3 F;  2YRX A;  4O4J F;  1M0W A;  3RFC A;  3GLK A;  4DIM A;  4O7W A;  2R84 A;  3ORR A;  2V5A A;  1DV2 A;  2FPI B;  3TII A;  2W71 A;  3VPC A;  2XCL A;  4ME6 A;  3VOT A;  3RUP A;  2YW2 A;  3Q2O A;  5LA6 F;  2WYO A;  2YS6 A;  1WR2 A;  4I55 F;  1KJ8 A;  1M6V A;  2XD4 A;  3KAK A;  4HNU A;  5JH7 F;  4O81 A;  4MV1 A;  1T36 A;  2W70 A;  3R23 A;  3G8D A;  1KJQ A;  1VKZ A;  1JLL B;  1PX2 A;  5BPH A;  3UFX B;  3ORQ A;  1M0T A;  1VBH A;  3SE7 A;  3E5N A;  4O84 A;  3N8D A;  2R7N A;  1GSA A;  2YRW A;  2R7M A;  3JRX A;  5KX5 F;  4ZQI A;  4O82 A;  4FFM A;  4C5C A;  3HB9 A;  2R6F A;  3JZI A;  4MAM A;  1SCU B;  1GLV A;  4I50 F;  4TUY F;  1KJ9 A;  3MWE A;  4YBZ B;  2YL2 A;  2VQD A;  1OBG A;  5EZY F;  3Q1K A;  2IP4 A;  1I7N A;  4HR7 A;  2I87 A;  1KBL A;  2CNU A;  4O83 A;  4O2B F;  3U9T A;  1Z2N X;  2YYA A;  4XYM B;  3VPD A;  1DIK A;  1C3O A;  4MA5 A;  4ZHQ F;  1ULZ A;  5BMV F;  4EGQ A;  3KRE A;  2DIK A;  2NU6 B;  1EUD B;  4YJ2 F;  3U55 A;  3VA7 A;  4O2A F;  2CNQ A;  4HQ6 A;  4HNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...