4YAKB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, acetyl-coenzyme a and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yakB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yakB02
1B6SA 1KJ9A 2XCLA 4HQ6A 3TIGA 5D8DA 2GQSA 1E4EA 2ZDHA 1AUXA 2FP4B 3HO8A 1JDEA 2IP4A 5DMXA 2W6OA 1DV1A 2ZDGA 3TINA 3MJFA 1B6RA 4YAKB 3DF7A 5FNVF 2NU7B 3JRXA 4O82A 5LP6F 3OUUA 2YZNA 5KKNB 3ETHA 5CA0F 2GPSA 4NYEA 3QFFA 4MA5A 1IOVA 3VPCA 3MWEA 2YL2A 3RV3A 1DIKA 5BMVF 3OUZA 5JVDF 3R23A 3V4SA 1EHIA 3TW6A 2QF7A 3KALA 2PBZA 4O7NA 2R87A 3SE7A 1KJ8A 4ME6A 2R82A 2YYAA 3E5NA 2GLTA 4HNTA 5H80A 1ULZA 4YBZB 2DIKA 4O83A 4TV9F 2FB9A 1GSOA 3GLKA 2YZMA 4O2BF 3TIIA 1E4EB 4TUYF 3JZIA 2OLSA 3U54A 3N8DA 4FFPA 1M0WA 4XYLB 4FFRA 4XYMB 2CNVA 4FGRA 3R9RA 1W96A 5BPFA 1EUCB 1CQIB 2YS7A 3ETJA 2I87A 4O7VA 4XZ3B 5GONF 2VR1A 4O4LF 4HNVA 2CNUA 1KBLA 1M0TA 3MWDA 3RUPA 2X0SA 1KC7A 1I7LA 1JKJB 4O4HF 1EZ1A 2NUAB 3Q1KA 4XX0B 3RFCA 3WNZA 2PVPA 2W6PA 4EGQA 3VOTA 5JVLA 1JLLB 2NU8B 2XD4A 2DLNA 4Y8VB 4C5BA 2PN1A 4O84A 4O7SA 1PX2A 2W70A 1UC8A 4MA0A 4IWXA 1KJJA 1Z2PX 2GQRA 4MV8A 4IWYA 4MV1A 2FPPB 3Q2OA 1SCUB 3G8DA 1DV2A 2FPIB 3BG5A 1M6VA 3GIDA 4FFMA 3U9TA 2W6NA 1GSHA 1CE8A 2R7LA 4MAMA 4EG0A 2C00A 3K5HA 2FPGB 4O4IF 2I80A 4YAJB 2DWCA 3TQTA 2WYOA 1UC9A 1EUDB 3KAJA 3JRWA 1AUVA 4O4JF 5C1PA 3ORQA 3NUAA 5LYJF 3AX6A 4O7WA 4O7LA 3LWBA 2QK4A 2V5AA 3U9SA 3K3PA 4O2AF 5LA6F 3VMMA 5JQGF 2V59A 1PK8A 1T36A 1Z2OX 3U55A 2SCUB 4ZQIA 2R86A 1A9XA 2YRWA 2ZDQA 3KAKA 4MV7A 1GLVA 2Z04A 3R5HA 1JDBB 2R85A 5IYZF 4WD3A 2R7NA 1GGOA 3AW8A 2YWVA 4IIJF 1C30A 3VPBA 4FE2A 4YJ3F 2YZGA 3R5FA 3JZFA 1VKZA 5HBRB 5K2MA 3I12A 4O7TA 2V58A 5CB4F 5C8YF 3VPDA 1OBGA 1CS0A 5LXTF 1GSAA 1W93A 5BPHA 1CQJB 2W6ZA 5EZYF 4L1KA 4C5AA 4I55F 4ZI7F 2W71A 5CAEB 5JH7F 5J2UF 4HR7A 2NU6B 4DLKA 2R6FA 2R84A 1C3OA 2W6MA 4YJ2F 1KEEA 4QSHA 4C5CA 5KX5F 4M9UA 1EYZA 3KREA 3RV4A 4MV3A 1I7NA 4I50F 3WO0A 5C1OA 2Z02A 1WR2A 3HB9A 3VA7A 3HBLA 4RZQA 1VBHA 2HJWA 2NU9B 3R5XA 5I47A 4TV8F 1BNCA 1BXRA 2J9GA 2P0AA 4FU0A 2CZGA 4FFOA 4DIMA 4FFNA 5LOVF 4YB8B 1KJIA 3V4ZA 4FFLA 2YZLA 5JQWA 4MV6A 1OBDA 4IHJF 4IZOA 5J2TF 4O81A 4ZHQF 5HV6A 4O7ZA 2CNQA 2VQDA 3LP8A 1IOWA 1A48A 3UFXB 4MV4A 2I8CA 4I4TF 4O7YA 4MV9A 2GPWA 4EGJA 2YW2A 2CQYA 2YRXA 1KUTA 2HGSA 2YS6A 3G8CA 4E4TA 4O86A 5CA1F 2W6QA 2R7KA 4WBNF 4HNUA 2R7MA 3K5IA 3N6RA 1Z2NX 2VPQA 4ZOLF 2DZDA 1KJQA 1VBGA 3ORRA 4O7RA 3WO1A
chains in the Genus database with same CATH superfamily
1B6SA 1KJ9A 4A2AA 2HHHH 2B63G 2XCLA 4HQ6A 5KG2A 3TIGA 2HDKA 5I5UA 1X9NA 2V4QA 4BXXG 4J9QA 3H40A 5D8DA 2GQSA 1E4EA 4UCUA 2ZDHA 4UCVA 5KT7A 1AUXA 3T99A 1CKMA 4LSAA 3KHGA 4A3CG 2FP4B 3HO8A 3OHBA 1JDEA 2IP4A 5DMXA 2C35B 1ZAUA 2KSWA 2W6OA 5F9NA 4U6PA 1DV1A 1WCMA 3GILA 3G6VA 4DV4H 4DL7A 2ZDGA 1Y1VA 4B3RH 5FPOA 3TINA 4O3QA 3MJFA 4LMYA 1Y1WG 4RUAA 4JI6H 5EOYA 1B6RA 4YAKB 5IYDG 5DAAA 2OWOA 3DF7A 5KFAA 4PZ6A 4GLXA 5KFYA 5FNVF 4U7CA 4YP3A 4TVIA 2NU7B 3JRXA 5KT5A 5KT3A 5T14A 4O82A 4A3FG 2E5LH 4IR1A 5CR5A 3GJXB 5L1LA 5LP6F 3HT5A 3OUUA 5F9LA 2ATLA 1ZETA 5KT2A 2YZNA 5KKNB 4RB3C 4DUYH 5DGAA 4APMA 3T9EA 3ETHA 4EEQA 2W57A 1AN7A 5CA0F 2UXCH 3C0FB 3G6XA 2GPSA 3IG0A 4MTDA 4NYEA 3QFFA 4LF7H 3GTQA 4MA5A 1IOVA 3VPCA 3T9DA 3MWEA 2J6SA 2W8LA 4A93G 1S0OA 2JA6A 2YL2A 1I1LA 3H0GA 1A0GA 5KFPA 5IWAH 4ECVA 3RV3A 2JEJA 1DIKA 3RR5A 5BMVF 3RAQA 4PZ7A 3OUZA 3RAXA 4LFCH 4K6NA 5JVDF 3R23A 3V4SA 2BR0A 1EHIA 1V51A 4FM9A 4WHXA 1XDNA 2R8GA 3TW6A 5DG8A 3BQ2A 1S0MA 2QF7A 3GV7B 2HIXA 3KALA 3DAAA 2FJZA 2PMZA 5FR9A 1XMOH 4DV7H 2UUAH 4JV1A 4Q8FA 3FKIG 3KTMA 2PBZA 4O7NA 1A3GA 3DTGA 2R87A 3SE7A 1O75A 5DQGA 2XCPA 4QWCA 5E25A 1KJ8A 5KFSA 2W9BA 5KFHA 5L1JA 4DR1H 4G3IA 4ME6A 4O3NA 1CKOA 3RB4A 2R82A 2YYAA 2PMZE 4O3OA 2R8IA 1MZBA 3E5NA 3PO3G 4LF6H 2GLTA 3SGIA 4LSXA 4HNTA 4DV6H 3BJYA 3BQ1A 2VUMA 5H80A 3K3VA 1ULZA 1TA8A 4Q4CA 4CKEA 4FBUA 5IT9W 4A3IG 1WH2A 4YBZB 3V6JA 2BQUA 3I4NG 2DIKA 4O83A 2R7ZG 4JI3H 4ED8A 4JXUA 4TV9F 4ECQA 5FJ8G 2FB9A 1GSOA 4CKCA 3GLKA 4LF5H 2YZMA 4O2BF 5BWVA 4M7EA 2ZM6H 1RYRA 1I1MA 5KFTA 3TIIA 2UUCH 2M05A 1E4EB 2WB1A 4ECSA 1S03G 1M7JA 1EKPA 5BYBA 5DG9A 5KFXA 3L2PA 4R7RA 5C3EG 4YQWA 3GIJA 4YR3A 2HGWA 4HN2A 2XCAA 2WE6A 2DPIA 4TUYF 4GLWA 3T54A 5C4XG 3NGDA 1IBKH 1WSCA 3JZIA 2OLSA 4B3MH 4DUZH 3U54A 2RGRA 5D1OA 4O3RA 3N8DA 1XMQH 2R92G 1TWGA 3CSWA 1V9PA 4FFPA 5KG7A 3QZ7A 3IN5A 1S9FA 1UNNC 4LFAH 5BWUA 1M0WA 2COGA 4XYLB 3KHLA 4FFRA 4LH7A 2HVQA 3GB8B 4XYMB 1XK5A 2JA6G 3CQZA 2CNVA 4ED1A 4FGRA 5DLGA 3R9RA 3H20A 4Q0YA 1E4GT 4RUCA 5FD5A 4DL6A 1W96A 2O03A 5BPFA 3T9CA 2RF4A 2COJA 3RB6A 1N33H 3TY5A 4IRKA 1E4FT 1N48A 4J9SA 1EUCB 4NLGA 1RJPA 4JUZA 1CQIB 2AGPA 2YS7A 3ETJA 1I2KA 2I87A 3OSNA 4O7VA 1IBLH 5KG3A 1CKNA 4XZ3B 5GONF 1G2WA 2JA7G 2VR1A 3WWHA 5KFKA 2UVWA 1Y1WA 3N44B 3GTLA 5DQHA 4A2BA 4ETSA 5EWEA 2R93A 3PN1A 4O4LF 4HNVA 4YR0A 5EWFA 5JUMA 4BWSC 2CNUA 3J80W 5KFGA 5I5SA 1M0TA 1KBLA 3FMAA 5KFFA 4CMFA 5FLXW 4A3DG 5FLMG 5C44G 3MWDA 2RDJA 3RUPA 4R8UA 5KFIA 3JAMW 3J81W 1RK5A 2FE3A 2X0SA 1KC7A 4A3KG 4K0KH 2W9BB 1I7LA 3W1BA 2F4VH 1P8LA 3VNNA 5I5TA 3EYYA 4X64H 1JKJB 1RYSA 2HIVA 2IBKA 4O4HF 1EZ1A 3JSNA 3T9BA 2HVSA 3PFFA 2W8KA 1JIHA 5BYAA 2NUAB 4NZOA 4J0MA 1HR0H 3Q1KA 4XX0B 3RFCA 3WNZA 3RGZA 2PVPA 1XNQH 2DAAA 2W6PA 4J9MA 1JXLA 3L4JA 4EGQA 4BY7G 3VOTA 5JVLA 4DL4A 1JLLB 3V6KA 2V4RA 4FS1A 5KFDA 4A3LG 1A0IA 3GV8B 2NU8B 2XD4A 4X66H 1R9TA 5KFEA 4I7HA 2DLNA 4Y8VB 3M9NB 5L9XA 4C5BA 4ECWA 4Q8EA 2PN1A 2UXDH 4A3BG 4O84A 2AQ4A 3PVXA 2X5RA 5KFOA 4UFZA 2W9CA 4ECRA 4O7SA 2ABJA 1PX2A 5KFMA 2COIA 4ED3A 1FJGH 2ZJTA 2FLLA 5D1OB 2W70A 1UC8A 3EPIA 4MA0A 2R7ZA 4FBTA 5I5WA 5CM0A 3MFHA 2UVUA 3MWMA 5DQIA 3LMLA 4UCSA 4B3TH 4NXNH 1HNWH 4IWXA 5KFBA 4DRFA 4MTEA 1IBMH 3MR2A 4LF8H 1KJJA 1RJQA 1Z2PX 3T5HA 2GQRA 4J9KA 3QWUA 4MV8A 3Q8QB 1I1KA 3RBEA 2YU9A 2EJ3A 3PW7A 2C2RA 2CFMA 2DABA 4IWYA 4MV1A 3HOXG 2V9WA 2XIGA 2C22A 4J9RA 4E6NA 4RNNA 1SEIA 3GTGA 2FPPB 3Q2OA 4ED0A 5EDWA 2AGOA 1SCUB 2HHFA 5BWTA 4AYBA 4F4YA 1CKNB 2WDTA 2R92A 2FK3A 5KG1A 3G8DA 2CKZB 3RBDA 1DV2A 2ODTX 3HOVG 4PBCA 5LL6b 4F4XA 1TAEA 1B04A 4AYBE 4IAJA 2FPIB 3BG5A 1M6VA 3GIDA 4FFMA 4M0JA 3U9TA 3UZOA 3WWIA 5BWWA 2W6NA 1Y1VG 1GSHA 4RAZA 5KFVA 5DGBA 2VA3A 4IRDA 5LMNH 1CE8A 4R8UB 2DPJA 3T9AA 2UU9H 3QZ8A 4B3SH 3I4MG 2UVVA 3RTXA 3TY9A 2XC9A 3N43B 2R7LA 3J7AK 3LULA 4MAMA 4EG0A 3G6YA 2C00A 3S24A 2VUGA 5L1KA 3K5HA 2FPGB 2JA7A 4X62H 2BQRA 4O4IF 2I80A 3CVZA 3RGXA 3T5JA 4DL3A 1P16A 3KXYT 4YAJB 2DWCA 5FPRA 2FLPA 4BY1G 4J9PA 5I60A 1J5EH 5KS8A 4JI5H 3HOYG 4JV5H 2YCHA 4DV3H 3BACA 3TQTA 2WYOA 2MCTA 1UC9A 2W9AA 4QWEA 1EUDB 3KAJA 3OSPA 3JRWA 5KG6A 1BJTA 4TQSA 4LF4H 2ZGIA 1AUVA 2IMWP 2B63A 3OHAA 4O4JF 5BR8H 4Q4DA 4EFEA 1DGSA 5KFCA 3QQMA 4EQ5A 4DL5A 2AU0A 5C1PA 4GC6A 3ORQA 1N32H 4NZMA 1I50A 4DR2H 3TEKA 2HVRA 4EYHB 2C2EA 3BABA 3MR3A 3NUAA 2HGXA 3HOZG 1I3QA 4Q44A 3GIPA 3GTKA 4J9NA 5LYJF 2W9CB 3PO2G 1L2ZA 2J6UA 3AX6A 4O7WA 3Q8PB 4O7LA 3LWBA 5DGIA 2QK4A 1TWFA 2NVYA 2V5AA 3CEBA 3K3PA 4O2AF 3U9SA 5LA6F 4DR6H 2JA5G 3VMMA 4UCRA 4RB0A 2UXBH 5IP9G 5JQGF 1I94H 4JYAH 4A3MG 2V59A 3W1GA 1PK8A 1T36A 1Z2OX 3NBZB 3U55A 1TWAA 2SCUB 4QW8A 4ZQIA 2BQ3A 2R86A 1A9XA 3W5OA 3L4KA 2YRWA 3M9OB 1N36H 2R8JA 2ZDQA 3JSLA 3UZBA 4DAAA 4EBCA 3KAKA 4MV7A 1GLVA 4CHIA 2Z04A 3R5HA 4ECZA 3RB3A 4PZ8A 4C2MA 1JDBB 2R85A 4RZRA 5IYZF 3TW7A 2AGQA 2UVRA 4JI1H 4Q43A 4WD3A 5BWXA 5KFLA 2HHFB 2R8HA 1SFOA 2R7NA 2JEIA 1B33N 1GGOA 3AW8A 4X65H 4IR9A 2YWVA 4UUGA 2NVXA 5BWRA 2WAQE 1ET0A 3LQSA 4IIJF 4QIWA 3HXLA 3T1YH 1V4YA 1C30A 3VPBA 3SNOA 4J9OA 3FKIA 4FE2A 4LH6A 4JI7H 4PDBA 3WWJA 4YJ3F 1SYXB 5DG7A 1RK6A 5HNEA 4F4WA 1N34H 4QIWE 5KFWA 3HOUG 2YZGA 3DTFA 3R5FA 2Q2UA 4RAYA 3JZFA 4F50A 4AQYH 4RNOA 3PW2A 2JEGA 5IYCG 3GTJA 3RJ0A 1VKZA 3Q8SB 3SI8A 2XGQA 4O3SA 2EJ2A 3Q8RB 3GTPA 1GYFA 4A3EG 2ASJA 1KTAA 5HBRB 5K2MA 3RF2A 3I12A 3T9FA 1S97A 4O7TA 5I5XA 3UYYA 2V58A 4JI8H 5CB4F 5C8YF 2QB5A 2Y4RA 3VPDA 2C28A 3HOWG 1IYEA 3BA9A 4RU9A 1OBGA 3T1HH 1CS0A 2VQEH 3RB0A 2EIYA 2Y0SA 4DV0H 5LXTF 4CC5A 4JV2A 5KFRA 4FS2A 3F8NA 4ECUA 1GSAA 1W93A 2R93G 5BPHA 1CQJB 3GTOA 3PZPA 4IRCA 1VS0A 4EYIB 3PW5A 2W6ZA 4CC6A 4LF9H 5EZYF 3H3VH 2Y0SE 1FVIA 4L1KA 3HKZA 2OH2A 4EBEA 5EWGA 4C5AA 2VPSA 4YHHH 4BBRG 2ALZA 4DL2A 4NZNA 5IYBG 4DV2H 4I55F 1K1QA 4ZI7F 2W71A 5DGHA 1Y14B 5CAEB 3BA8A 5JH7F 3NC0B 5J2UF 1ZQ7A 5KFZA 5KT6A 4UCOA 3BAAA 2WTFA 4HR7A 4GKKH 1S68A 2NU6B 3HKZE 2ASLA 3H4DA 2JA8G 4DLKA 2R6FA 1TWHA 2R84A 5FD6A 3RIZA 4QWDA 3KYHC 2HG8A 1C3OA 2W6MA 4YJ2F 5CE8A 5C5JA 2VQFH 2E2IA 1KEEA 1K83A 4QSHA 4C5CA 5KX5F 4M9UA 3AYHB 1EYZA 3KREA 3N40P 4GKJH 1WCMG 1ZHSA 3N6XA 2CW8A 4TQRA 3MFIA 3GIQA 3V6HA 3RV4A 5L1IA 2VA2A 1EKFA 4GC7A 4RB1A 2XGPA 4BBSG 4MV3A 2Q2TA 3KHRA 1FKAH 4DQNA 4Q45A 1WRVA 1I7NA 4I50F 3MR5A 1RJRA 4QJFA 4YR2A 1XNRH 3WO0A 5KFNA 4RNMA 4QWAA 3PR4A 5C1OA 2Z02A 1WR2A 3HB9A 3FDSA 1EKVA 4PWQA 5KFJA 5A2QW 2JA5A 3VA7A 2R8KA 3HBLA 4JV0A 4F4ZA 4RZQA 2FKLA 1VAJA 3N42B 1VBHA 2HJWA 2NU9B 5KG5A 3TY8A 3R5XA 5I47A 2ASDA 4QW9A 4LFBH 3T5LA 4TV8F 2Q7DA 1BNCA 2W7PA 1BXRA 2A1HA 4O3PA 3GDEA 5K3WA 2J9GA 2P0AA 3UQ8A 3H0GG 2RGVA 5KT4A 3GIIA 4FU0A 2FK1A 3BQ0A 3TQ1A 2CZGA 4FFOA 2VOBA 4JI0H 2JEFA 4DIMA 3H4BA 4FFNA 5LOVF 4DV1H 4HYKA 4YB8B 3GIMA 1KJIA 3V4ZA 4EFBA 4J9LA 4FFLA 3GIKA 2UUBH 2YZLA 5JQWA 4MV6A 1BGWA 4A3GG 3KHHA 1OBDA 4IHJF 2C2DA 4IZOA 4ECTA 5J2TF 3JZ6A 4ECYA 1S0NA 1S10A 3T5KA 2RDIA 4O81A 5I5VA 4EEYA 1N56A 1TWCA 4ZHQF 5HV6A 2QYZA 4O7ZA 2WB1E 1K1SA 3GQCA 5LMUH 2CNQA 1KT8A 3MR6A 1DAAA 2VQDA 3LP8A 2CW7A 1IOWA 1IYDA 1A48A 3UFXB 2E2HA 3NBYB 4ED2A 4MV4A 5DLFA 2VUMG 2I8CA 4I4TF 4O7YA 1JX4A 1HNZH 5DISC 4MV9A 3PR5B 3U0GA 2GPWA 1I2LA 4EGJA 2FMAA 4JI2H 4ECXA 2YW2A 4DR4H 2EJ0A 4EBDA 2CQYA 1T3NA 2W7OA 2YRXA 4RCNA 5D1PA 4OX9H 4DR3H 1KUTA 5KFUA 1I6UA 2FK2A 2HGSA 2FLNA 2YS6A 3G8CA 4TM5A 4CMDA 4E4TA 3M4IA 4O86A 5CA1F 3N41B 5KG4A 2W6QA 2R7KA 4UCTA 4WBNF 4HNUA 3T7AA 4QWBA 2WAQA 4RB2C 3OTOH 4DR5H 2R7MA 3PW4A 4DV5H 3PW0A 4CKBA 1GO3E 2J6TA 4YY3H 3GV5B 4ED6A 4NXMH 4DR7H 3K5IA 5KFQA 4KHPH 4A3JG 1OWTA 5I5YA 2IA6A 3N6RA 1ZHQA 4ED7A 1Z2NX 2VPQA 3EPGA 4ZOLF 1HNXH 5KG0A 4CE5A 2DZDA 4JI4H 3GTMA 1T94A 1KJQA 5IP7G 1VBGA 3M9MB 3ORRA 4O7RA 3WO1A
chains in the Genus database with same CATH topology
1B6SA 1KJ9A 2XCLA 4HQ6A 3TIGA 5D8DA 2GQSA 1E4EA 2ZDHA 1AUXA 2FP4B 3HO8A 1JDEA 2IP4A 5DMXA 2W6OA 1DV1A 2ZDGA 3TINA 3MJFA 1B6RA 4YAKB 3DF7A 5FNVF 2NU7B 3JRXA 4O82A 5LP6F 3OUUA 2YZNA 5KKNB 3ETHA 5CA0F 2GPSA 4NYEA 3QFFA 4MA5A 1IOVA 3VPCA 3MWEA 2YL2A 3RV3A 1DIKA 5BMVF 3OUZA 5JVDF 3R23A 3V4SA 1EHIA 3TW6A 2QF7A 3KALA 2PBZA 4O7NA 2R87A 3SE7A 1KJ8A 4ME6A 2R82A 2YYAA 3E5NA 2GLTA 4HNTA 5H80A 1ULZA 4YBZB 2DIKA 4O83A 4TV9F 2FB9A 1GSOA 3GLKA 2YZMA 4O2BF 3TIIA 1E4EB 4TUYF 3JZIA 2OLSA 3U54A 3N8DA 4FFPA 1M0WA 4XYLB 4FFRA 4XYMB 2CNVA 4FGRA 3R9RA 1W96A 5BPFA 1EUCB 1CQIB 2YS7A 3ETJA 2I87A 4O7VA 4XZ3B 5GONF 2VR1A 4O4LF 4HNVA 2CNUA 1KBLA 1M0TA 3MWDA 3RUPA 2X0SA 1KC7A 1I7LA 1JKJB 4O4HF 1EZ1A 2NUAB 3Q1KA 4XX0B 3RFCA 3WNZA 2PVPA 2W6PA 4EGQA 3VOTA 5JVLA 1JLLB 2NU8B 2XD4A 2DLNA 4Y8VB 4C5BA 2PN1A 4O84A 4O7SA 1PX2A 2W70A 1UC8A 4MA0A 4IWXA 1KJJA 1Z2PX 2GQRA 4MV8A 4IWYA 4MV1A 2FPPB 3Q2OA 1SCUB 3G8DA 1DV2A 2FPIB 3BG5A 1M6VA 3GIDA 4FFMA 3U9TA 2W6NA 1GSHA 1CE8A 2R7LA 4MAMA 4EG0A 2C00A 3K5HA 2FPGB 4O4IF 2I80A 4YAJB 2DWCA 3TQTA 2WYOA 1UC9A 1EUDB 3KAJA 3JRWA 1AUVA 4O4JF 5C1PA 3ORQA 3NUAA 5LYJF 3AX6A 4O7WA 4O7LA 3LWBA 2QK4A 2V5AA 3U9SA 3K3PA 4O2AF 5LA6F 3VMMA 5JQGF 2V59A 1PK8A 1T36A 1Z2OX 3U55A 2SCUB 4ZQIA 2R86A 1A9XA 2YRWA 2ZDQA 3KAKA 4MV7A 1GLVA 2Z04A 3R5HA 1JDBB 2R85A 5IYZF 4WD3A 2R7NA 1GGOA 3AW8A 2YWVA 4IIJF 1C30A 3VPBA 4FE2A 4YJ3F 2YZGA 3R5FA 3JZFA 1VKZA 5HBRB 5K2MA 3I12A 4O7TA 2V58A 5CB4F 5C8YF 3VPDA 1OBGA 1CS0A 5LXTF 1GSAA 1W93A 5BPHA 1CQJB 2W6ZA 5EZYF 4L1KA 4C5AA 4I55F 4ZI7F 2W71A 5CAEB 5JH7F 5J2UF 4HR7A 2NU6B 4DLKA 2R6FA 2R84A 1C3OA 2W6MA 4YJ2F 1KEEA 4QSHA 4C5CA 5KX5F 4M9UA 1EYZA 3KREA 3RV4A 4MV3A 1I7NA 4I50F 3WO0A 5C1OA 2Z02A 1WR2A 3HB9A 3VA7A 3HBLA 4RZQA 1VBHA 2HJWA 2NU9B 3R5XA 5I47A 4TV8F 1BNCA 1BXRA 2J9GA 2P0AA 4FU0A 2CZGA 4FFOA 4DIMA 4FFNA 5LOVF 4YB8B 1KJIA 3V4ZA 4FFLA 2YZLA 5JQWA 4MV6A 1OBDA 4IHJF 4IZOA 5J2TF 4O81A 4ZHQF 5HV6A 4O7ZA 2CNQA 2VQDA 3LP8A 1IOWA 1A48A 3UFXB 4MV4A 2I8CA 4I4TF 4O7YA 4MV9A 2GPWA 4EGJA 2YW2A 2CQYA 2YRXA 1KUTA 2HGSA 2YS6A 3G8CA 4E4TA 4O86A 5CA1F 2W6QA 2R7KA 4WBNF 4HNUA 2R7MA 3K5IA 3N6RA 1Z2NX 2VPQA 4ZOLF 2DZDA 1KJQA 1VBGA 3ORRA 4O7RA 3WO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6S A;  1KJ9 A;  2XCL A;  4HQ6 A;  3TIG A;  5D8D A;  2GQS A;  1E4E A;  2ZDH A;  1AUX A;  2FP4 B;  3HO8 A;  1JDE A;  2IP4 A;  5DMX A;  2W6O A;  1DV1 A;  2ZDG A;  3TIN A;  3MJF A;  1B6R A;  4YAK B;  3DF7 A;  5FNV F;  2NU7 B;  3JRX A;  4O82 A;  5LP6 F;  3OUU A;  2YZN A;  5KKN B;  3ETH A;  5CA0 F;  2GPS A;  4NYE A;  3QFF A;  4MA5 A;  1IOV A;  3VPC A;  3MWE A;  2YL2 A;  3RV3 A;  1DIK A;  5BMV F;  3OUZ A;  5JVD F;  3R23 A;  3V4S A;  1EHI A;  3TW6 A;  2QF7 A;  3KAL A;  2PBZ A;  4O7N A;  2R87 A;  3SE7 A;  1KJ8 A;  4ME6 A;  2R82 A;  2YYA A;  3E5N A;  2GLT A;  4HNT A;  5H80 A;  1ULZ A;  4YBZ B;  2DIK A;  4O83 A;  4TV9 F;  2FB9 A;  1GSO A;  3GLK A;  2YZM A;  4O2B F;  3TII A;  1E4E B;  4TUY F;  3JZI A;  2OLS A;  3U54 A;  3N8D A;  4FFP A;  1M0W A;  4XYL B;  4FFR A;  4XYM B;  2CNV A;  4FGR A;  3R9R A;  1W96 A;  5BPF A;  1EUC B;  1CQI B;  2YS7 A;  3ETJ A;  2I87 A;  4O7V A;  4XZ3 B;  5GON F;  2VR1 A;  4O4L F;  4HNV A;  2CNU A;  1KBL A;  1M0T A;  3MWD A;  3RUP A;  2X0S A;  1KC7 A;  1I7L A;  1JKJ B;  4O4H F;  1EZ1 A;  2NUA B;  3Q1K A;  4XX0 B;  3RFC A;  3WNZ A;  2PVP A;  2W6P A;  4EGQ A;  3VOT A;  5JVL A;  1JLL B;  2NU8 B;  2XD4 A;  2DLN A;  4Y8V B;  4C5B A;  2PN1 A;  4O84 A;  4O7S A;  1PX2 A;  2W70 A;  1UC8 A;  4MA0 A;  4IWX A;  1KJJ A;  1Z2P X;  2GQR A;  4MV8 A;  4IWY A;  4MV1 A;  2FPP B;  3Q2O A;  1SCU B;  3G8D A;  1DV2 A;  2FPI B;  3BG5 A;  1M6V A;  3GID A;  4FFM A;  3U9T A;  2W6N A;  1GSH A;  1CE8 A;  2R7L A;  4MAM A;  4EG0 A;  2C00 A;  3K5H A;  2FPG B;  4O4I F;  2I80 A;  4YAJ B;  2DWC A;  3TQT A;  2WYO A;  1UC9 A;  1EUD B;  3KAJ A;  3JRW A;  1AUV A;  4O4J F;  5C1P A;  3ORQ A;  3NUA A;  5LYJ F;  3AX6 A;  4O7W A;  4O7L A;  3LWB A;  2QK4 A;  2V5A A;  3U9S A;  3K3P A;  4O2A F;  5LA6 F;  3VMM A;  5JQG F;  2V59 A;  1PK8 A;  1T36 A;  1Z2O X;  3U55 A;  2SCU B;  4ZQI A;  2R86 A;  1A9X A;  2YRW A;  2ZDQ A;  3KAK A;  4MV7 A;  1GLV A;  2Z04 A;  3R5H A;  1JDB B;  2R85 A;  5IYZ F;  4WD3 A;  2R7N A;  1GGO A;  3AW8 A;  2YWV A;  4IIJ F;  1C30 A;  3VPB A;  4FE2 A;  4YJ3 F;  2YZG A;  3R5F A;  3JZF A;  1VKZ A;  5HBR B;  5K2M A;  3I12 A;  4O7T A;  2V58 A;  5CB4 F;  5C8Y F;  3VPD A;  1OBG A;  1CS0 A;  5LXT F;  1GSA A;  1W93 A;  5BPH A;  1CQJ B;  2W6Z A;  5EZY F;  4L1K A;  4C5A A;  4I55 F;  4ZI7 F;  2W71 A;  5CAE B;  5JH7 F;  5J2U F;  4HR7 A;  2NU6 B;  4DLK A;  2R6F A;  2R84 A;  1C3O A;  2W6M A;  4YJ2 F;  1KEE A;  4QSH A;  4C5C A;  5KX5 F;  4M9U A;  1EYZ A;  3KRE A;  3RV4 A;  4MV3 A;  1I7N A;  4I50 F;  3WO0 A;  5C1O A;  2Z02 A;  1WR2 A;  3HB9 A;  3VA7 A;  3HBL A;  4RZQ A;  1VBH A;  2HJW A;  2NU9 B;  3R5X A;  5I47 A;  4TV8 F;  1BNC A;  1BXR A;  2J9G A;  2P0A A;  4FU0 A;  2CZG A;  4FFO A;  4DIM A;  4FFN A;  5LOV F;  4YB8 B;  1KJI A;  3V4Z A;  4FFL A;  2YZL A;  5JQW A;  4MV6 A;  1OBD A;  4IHJ F;  4IZO A;  5J2T F;  4O81 A;  4ZHQ F;  5HV6 A;  4O7Z A;  2CNQ A;  2VQD A;  3LP8 A;  1IOW A;  1A48 A;  3UFX B;  4MV4 A;  2I8C A;  4I4T F;  4O7Y A;  4MV9 A;  2GPW A;  4EGJ A;  2YW2 A;  2CQY A;  2YRX A;  1KUT A;  2HGS A;  2YS6 A;  3G8C A;  4E4T A;  4O86 A;  5CA1 F;  2W6Q A;  2R7K A;  4WBN F;  4HNU A;  2R7M A;  3K5I A;  3N6R A;  1Z2N X;  2VPQ A;  4ZOL F;  2DZD A;  1KJQ A;  1VBG A;  3ORR A;  4O7R A;  3WO1 A; 
#chains in the Genus database with same CATH topology
 1B6S A;  1KJ9 A;  4A2A A;  2HHH H;  2B63 G;  2XCL A;  4HQ6 A;  5KG2 A;  3TIG A;  2HDK A;  5I5U A;  1X9N A;  2V4Q A;  4BXX G;  4J9Q A;  3H40 A;  5D8D A;  2GQS A;  1E4E A;  4UCU A;  2ZDH A;  4UCV A;  5KT7 A;  1AUX A;  3T99 A;  1CKM A;  4LSA A;  3KHG A;  4A3C G;  2FP4 B;  3HO8 A;  3OHB A;  1JDE A;  2IP4 A;  5DMX A;  2C35 B;  1ZAU A;  2KSW A;  2W6O A;  5F9N A;  4U6P A;  1DV1 A;  1WCM A;  3GIL A;  3G6V A;  4DV4 H;  4DL7 A;  2ZDG A;  1Y1V A;  4B3R H;  5FPO A;  3TIN A;  4O3Q A;  3MJF A;  4LMY A;  1Y1W G;  4RUA A;  4JI6 H;  5EOY A;  1B6R A;  4YAK B;  5IYD G;  5DAA A;  2OWO A;  3DF7 A;  5KFA A;  4PZ6 A;  4GLX A;  5KFY A;  5FNV F;  4U7C A;  4YP3 A;  4TVI A;  2NU7 B;  3JRX A;  5KT5 A;  5KT3 A;  5T14 A;  4O82 A;  4A3F G;  2E5L H;  4IR1 A;  5CR5 A;  3GJX B;  5L1L A;  5LP6 F;  3HT5 A;  3OUU A;  5F9L A;  2ATL A;  1ZET A;  5KT2 A;  2YZN A;  5KKN B;  4RB3 C;  4DUY H;  5DGA A;  4APM A;  3T9E A;  3ETH A;  4EEQ A;  2W57 A;  1AN7 A;  5CA0 F;  2UXC H;  3C0F B;  3G6X A;  2GPS A;  3IG0 A;  4MTD A;  4NYE A;  3QFF A;  4LF7 H;  3GTQ A;  4MA5 A;  1IOV A;  3VPC A;  3T9D A;  3MWE A;  2J6S A;  2W8L A;  4A93 G;  1S0O A;  2JA6 A;  2YL2 A;  1I1L A;  3H0G A;  1A0G A;  5KFP A;  5IWA H;  4ECV A;  3RV3 A;  2JEJ A;  1DIK A;  3RR5 A;  5BMV F;  3RAQ A;  4PZ7 A;  3OUZ A;  3RAX A;  4LFC H;  4K6N A;  5JVD F;  3R23 A;  3V4S A;  2BR0 A;  1EHI A;  1V51 A;  4FM9 A;  4WHX A;  1XDN A;  2R8G A;  3TW6 A;  5DG8 A;  3BQ2 A;  1S0M A;  2QF7 A;  3GV7 B;  2HIX A;  3KAL A;  3DAA A;  2FJZ A;  2PMZ A;  5FR9 A;  1XMO H;  4DV7 H;  2UUA H;  4JV1 A;  4Q8F A;  3FKI G;  3KTM A;  2PBZ A;  4O7N A;  1A3G A;  3DTG A;  2R87 A;  3SE7 A;  1O75 A;  5DQG A;  2XCP A;  4QWC A;  5E25 A;  1KJ8 A;  5KFS A;  2W9B A;  5KFH A;  5L1J A;  4DR1 H;  4G3I A;  4ME6 A;  4O3N A;  1CKO A;  3RB4 A;  2R82 A;  2YYA A;  2PMZ E;  4O3O A;  2R8I A;  1MZB A;  3E5N A;  3PO3 G;  4LF6 H;  2GLT A;  3SGI A;  4LSX A;  4HNT A;  4DV6 H;  3BJY A;  3BQ1 A;  2VUM A;  5H80 A;  3K3V A;  1ULZ A;  1TA8 A;  4Q4C A;  4CKE A;  4FBU A;  5IT9 W;  4A3I G;  1WH2 A;  4YBZ B;  3V6J A;  2BQU A;  3I4N G;  2DIK A;  4O83 A;  2R7Z G;  4JI3 H;  4ED8 A;  4JXU A;  4TV9 F;  4ECQ A;  5FJ8 G;  2FB9 A;  1GSO A;  4CKC A;  3GLK A;  4LF5 H;  2YZM A;  4O2B F;  5BWV A;  4M7E A;  2ZM6 H;  1RYR A;  1I1M A;  5KFT A;  3TII A;  2UUC H;  2M05 A;  1E4E B;  2WB1 A;  4ECS A;  1S03 G;  1M7J A;  1EKP A;  5BYB A;  5DG9 A;  5KFX A;  3L2P A;  4R7R A;  5C3E G;  4YQW A;  3GIJ A;  4YR3 A;  2HGW A;  4HN2 A;  2XCA A;  2WE6 A;  2DPI A;  4TUY F;  4GLW A;  3T54 A;  5C4X G;  3NGD A;  1IBK H;  1WSC A;  3JZI A;  2OLS A;  4B3M H;  4DUZ H;  3U54 A;  2RGR A;  5D1O A;  4O3R A;  3N8D A;  1XMQ H;  2R92 G;  1TWG A;  3CSW A;  1V9P A;  4FFP A;  5KG7 A;  3QZ7 A;  3IN5 A;  1S9F A;  1UNN C;  4LFA H;  5BWU A;  1M0W A;  2COG A;  4XYL B;  3KHL A;  4FFR A;  4LH7 A;  2HVQ A;  3GB8 B;  4XYM B;  1XK5 A;  2JA6 G;  3CQZ A;  2CNV A;  4ED1 A;  4FGR A;  5DLG A;  3R9R A;  3H20 A;  4Q0Y A;  1E4G T;  4RUC A;  5FD5 A;  4DL6 A;  1W96 A;  2O03 A;  5BPF A;  3T9C A;  2RF4 A;  2COJ A;  3RB6 A;  1N33 H;  3TY5 A;  4IRK A;  1E4F T;  1N48 A;  4J9S A;  1EUC B;  4NLG A;  1RJP A;  4JUZ A;  1CQI B;  2AGP A;  2YS7 A;  3ETJ A;  1I2K A;  2I87 A;  3OSN A;  4O7V A;  1IBL H;  5KG3 A;  1CKN A;  4XZ3 B;  5GON F;  1G2W A;  2JA7 G;  2VR1 A;  3WWH A;  5KFK A;  2UVW A;  1Y1W A;  3N44 B;  3GTL A;  5DQH A;  4A2B A;  4ETS A;  5EWE A;  2R93 A;  3PN1 A;  4O4L F;  4HNV A;  4YR0 A;  5EWF A;  5JUM A;  4BWS C;  2CNU A;  3J80 W;  5KFG A;  5I5S A;  1M0T A;  1KBL A;  3FMA A;  5KFF A;  4CMF A;  5FLX W;  4A3D G;  5FLM G;  5C44 G;  3MWD A;  2RDJ A;  3RUP A;  4R8U A;  5KFI A;  3JAM W;  3J81 W;  1RK5 A;  2FE3 A;  2X0S A;  1KC7 A;  4A3K G;  4K0K H;  2W9B B;  1I7L A;  3W1B A;  2F4V H;  1P8L A;  3VNN A;  5I5T A;  3EYY A;  4X64 H;  1JKJ B;  1RYS A;  2HIV A;  2IBK A;  4O4H F;  1EZ1 A;  3JSN A;  3T9B A;  2HVS A;  3PFF A;  2W8K A;  1JIH A;  5BYA A;  2NUA B;  4NZO A;  4J0M A;  1HR0 H;  3Q1K A;  4XX0 B;  3RFC A;  3WNZ A;  3RGZ A;  2PVP A;  1XNQ H;  2DAA A;  2W6P A;  4J9M A;  1JXL A;  3L4J A;  4EGQ A;  4BY7 G;  3VOT A;  5JVL A;  4DL4 A;  1JLL B;  3V6K A;  2V4R A;  4FS1 A;  5KFD A;  4A3L G;  1A0I A;  3GV8 B;  2NU8 B;  2XD4 A;  4X66 H;  1R9T A;  5KFE A;  4I7H A;  2DLN A;  4Y8V B;  3M9N B;  5L9X A;  4C5B A;  4ECW A;  4Q8E A;  2PN1 A;  2UXD H;  4A3B G;  4O84 A;  2AQ4 A;  3PVX A;  2X5R A;  5KFO A;  4UFZ A;  2W9C A;  4ECR A;  4O7S A;  2ABJ A;  1PX2 A;  5KFM A;  2COI A;  4ED3 A;  1FJG H;  2ZJT A;  2FLL A;  5D1O B;  2W70 A;  1UC8 A;  3EPI A;  4MA0 A;  2R7Z A;  4FBT A;  5I5W A;  5CM0 A;  3MFH A;  2UVU A;  3MWM A;  5DQI A;  3LML A;  4UCS A;  4B3T H;  4NXN H;  1HNW H;  4IWX A;  5KFB A;  4DRF A;  4MTE A;  1IBM H;  3MR2 A;  4LF8 H;  1KJJ A;  1RJQ A;  1Z2P X;  3T5H A;  2GQR A;  4J9K A;  3QWU A;  4MV8 A;  3Q8Q B;  1I1K A;  3RBE A;  2YU9 A;  2EJ3 A;  3PW7 A;  2C2R A;  2CFM A;  2DAB A;  4IWY A;  4MV1 A;  3HOX G;  2V9W A;  2XIG A;  2C22 A;  4J9R A;  4E6N A;  4RNN A;  1SEI A;  3GTG A;  2FPP B;  3Q2O A;  4ED0 A;  5EDW A;  2AGO A;  1SCU B;  2HHF A;  5BWT A;  4AYB A;  4F4Y A;  1CKN B;  2WDT A;  2R92 A;  2FK3 A;  5KG1 A;  3G8D A;  2CKZ B;  3RBD A;  1DV2 A;  2ODT X;  3HOV G;  4PBC A;  5LL6 b;  4F4X A;  1TAE A;  1B04 A;  4AYB E;  4IAJ A;  2FPI B;  3BG5 A;  1M6V A;  3GID A;  4FFM A;  4M0J A;  3U9T A;  3UZO A;  3WWI A;  5BWW A;  2W6N A;  1Y1V G;  1GSH A;  4RAZ A;  5KFV A;  5DGB A;  2VA3 A;  4IRD A;  5LMN H;  1CE8 A;  4R8U B;  2DPJ A;  3T9A A;  2UU9 H;  3QZ8 A;  4B3S H;  3I4M G;  2UVV A;  3RTX A;  3TY9 A;  2XC9 A;  3N43 B;  2R7L A;  3J7A K;  3LUL A;  4MAM A;  4EG0 A;  3G6Y A;  2C00 A;  3S24 A;  2VUG A;  5L1K A;  3K5H A;  2FPG B;  2JA7 A;  4X62 H;  2BQR A;  4O4I F;  2I80 A;  3CVZ A;  3RGX A;  3T5J A;  4DL3 A;  1P16 A;  3KXY T;  4YAJ B;  2DWC A;  5FPR A;  2FLP A;  4BY1 G;  4J9P A;  5I60 A;  1J5E H;  5KS8 A;  4JI5 H;  3HOY G;  4JV5 H;  2YCH A;  4DV3 H;  3BAC A;  3TQT A;  2WYO A;  2MCT A;  1UC9 A;  2W9A A;  4QWE A;  1EUD B;  3KAJ A;  3OSP A;  3JRW A;  5KG6 A;  1BJT A;  4TQS A;  4LF4 H;  2ZGI A;  1AUV A;  2IMW P;  2B63 A;  3OHA A;  4O4J F;  5BR8 H;  4Q4D A;  4EFE A;  1DGS A;  5KFC A;  3QQM A;  4EQ5 A;  4DL5 A;  2AU0 A;  5C1P A;  4GC6 A;  3ORQ A;  1N32 H;  4NZM A;  1I50 A;  4DR2 H;  3TEK A;  2HVR A;  4EYH B;  2C2E A;  3BAB A;  3MR3 A;  3NUA A;  2HGX A;  3HOZ G;  1I3Q A;  4Q44 A;  3GIP A;  3GTK A;  4J9N A;  5LYJ F;  2W9C B;  3PO2 G;  1L2Z A;  2J6U A;  3AX6 A;  4O7W A;  3Q8P B;  4O7L A;  3LWB A;  5DGI A;  2QK4 A;  1TWF A;  2NVY A;  2V5A A;  3CEB A;  3K3P A;  4O2A F;  3U9S A;  5LA6 F;  4DR6 H;  2JA5 G;  3VMM A;  4UCR A;  4RB0 A;  2UXB H;  5IP9 G;  5JQG F;  1I94 H;  4JYA H;  4A3M G;  2V59 A;  3W1G A;  1PK8 A;  1T36 A;  1Z2O X;  3NBZ B;  3U55 A;  1TWA A;  2SCU B;  4QW8 A;  4ZQI A;  2BQ3 A;  2R86 A;  1A9X A;  3W5O A;  3L4K A;  2YRW A;  3M9O B;  1N36 H;  2R8J A;  2ZDQ A;  3JSL A;  3UZB A;  4DAA A;  4EBC A;  3KAK A;  4MV7 A;  1GLV A;  4CHI A;  2Z04 A;  3R5H A;  4ECZ A;  3RB3 A;  4PZ8 A;  4C2M A;  1JDB B;  2R85 A;  4RZR A;  5IYZ F;  3TW7 A;  2AGQ A;  2UVR A;  4JI1 H;  4Q43 A;  4WD3 A;  5BWX A;  5KFL A;  2HHF B;  2R8H A;  1SFO A;  2R7N A;  2JEI A;  1B33 N;  1GGO A;  3AW8 A;  4X65 H;  4IR9 A;  2YWV A;  4UUG A;  2NVX A;  5BWR A;  2WAQ E;  1ET0 A;  3LQS A;  4IIJ F;  4QIW A;  3HXL A;  3T1Y H;  1V4Y A;  1C30 A;  3VPB A;  3SNO A;  4J9O A;  3FKI A;  4FE2 A;  4LH6 A;  4JI7 H;  4PDB A;  3WWJ A;  4YJ3 F;  1SYX B;  5DG7 A;  1RK6 A;  5HNE A;  4F4W A;  1N34 H;  4QIW E;  5KFW A;  3HOU G;  2YZG A;  3DTF A;  3R5F A;  2Q2U A;  4RAY A;  3JZF A;  4F50 A;  4AQY H;  4RNO A;  3PW2 A;  2JEG A;  5IYC G;  3GTJ A;  3RJ0 A;  1VKZ A;  3Q8S B;  3SI8 A;  2XGQ A;  4O3S A;  2EJ2 A;  3Q8R B;  3GTP A;  1GYF A;  4A3E G;  2ASJ A;  1KTA A;  5HBR B;  5K2M A;  3RF2 A;  3I12 A;  3T9F A;  1S97 A;  4O7T A;  5I5X A;  3UYY A;  2V58 A;  4JI8 H;  5CB4 F;  5C8Y F;  2QB5 A;  2Y4R A;  3VPD A;  2C28 A;  3HOW G;  1IYE A;  3BA9 A;  4RU9 A;  1OBG A;  3T1H H;  1CS0 A;  2VQE H;  3RB0 A;  2EIY A;  2Y0S A;  4DV0 H;  5LXT F;  4CC5 A;  4JV2 A;  5KFR A;  4FS2 A;  3F8N A;  4ECU A;  1GSA A;  1W93 A;  2R93 G;  5BPH A;  1CQJ B;  3GTO A;  3PZP A;  4IRC A;  1VS0 A;  4EYI B;  3PW5 A;  2W6Z A;  4CC6 A;  4LF9 H;  5EZY F;  3H3V H;  2Y0S E;  1FVI A;  4L1K A;  3HKZ A;  2OH2 A;  4EBE A;  5EWG A;  4C5A A;  2VPS A;  4YHH H;  4BBR G;  2ALZ A;  4DL2 A;  4NZN A;  5IYB G;  4DV2 H;  4I55 F;  1K1Q A;  4ZI7 F;  2W71 A;  5DGH A;  1Y14 B;  5CAE B;  3BA8 A;  5JH7 F;  3NC0 B;  5J2U F;  1ZQ7 A;  5KFZ A;  5KT6 A;  4UCO A;  3BAA A;  2WTF A;  4HR7 A;  4GKK H;  1S68 A;  2NU6 B;  3HKZ E;  2ASL A;  3H4D A;  2JA8 G;  4DLK A;  2R6F A;  1TWH A;  2R84 A;  5FD6 A;  3RIZ A;  4QWD A;  3KYH C;  2HG8 A;  1C3O A;  2W6M A;  4YJ2 F;  5CE8 A;  5C5J A;  2VQF H;  2E2I A;  1KEE A;  1K83 A;  4QSH A;  4C5C A;  5KX5 F;  4M9U A;  3AYH B;  1EYZ A;  3KRE A;  3N40 P;  4GKJ H;  1WCM G;  1ZHS A;  3N6X A;  2CW8 A;  4TQR A;  3MFI A;  3GIQ A;  3V6H A;  3RV4 A;  5L1I A;  2VA2 A;  1EKF A;  4GC7 A;  4RB1 A;  2XGP A;  4BBS G;  4MV3 A;  2Q2T A;  3KHR A;  1FKA H;  4DQN A;  4Q45 A;  1WRV A;  1I7N A;  4I50 F;  3MR5 A;  1RJR A;  4QJF A;  4YR2 A;  1XNR H;  3WO0 A;  5KFN A;  4RNM A;  4QWA A;  3PR4 A;  5C1O A;  2Z02 A;  1WR2 A;  3HB9 A;  3FDS A;  1EKV A;  4PWQ A;  5KFJ A;  5A2Q W;  2JA5 A;  3VA7 A;  2R8K A;  3HBL A;  4JV0 A;  4F4Z A;  4RZQ A;  2FKL A;  1VAJ A;  3N42 B;  1VBH A;  2HJW A;  2NU9 B;  5KG5 A;  3TY8 A;  3R5X A;  5I47 A;  2ASD A;  4QW9 A;  4LFB H;  3T5L A;  4TV8 F;  2Q7D A;  1BNC A;  2W7P A;  1BXR A;  2A1H A;  4O3P A;  3GDE A;  5K3W A;  2J9G A;  2P0A A;  3UQ8 A;  3H0G G;  2RGV A;  5KT4 A;  3GII A;  4FU0 A;  2FK1 A;  3BQ0 A;  3TQ1 A;  2CZG A;  4FFO A;  2VOB A;  4JI0 H;  2JEF A;  4DIM A;  3H4B A;  4FFN A;  5LOV F;  4DV1 H;  4HYK A;  4YB8 B;  3GIM A;  1KJI A;  3V4Z A;  4EFB A;  4J9L A;  4FFL A;  3GIK A;  2UUB H;  2YZL A;  5JQW A;  4MV6 A;  1BGW A;  4A3G G;  3KHH A;  1OBD A;  4IHJ F;  2C2D A;  4IZO A;  4ECT A;  5J2T F;  3JZ6 A;  4ECY A;  1S0N A;  1S10 A;  3T5K A;  2RDI A;  4O81 A;  5I5V A;  4EEY A;  1N56 A;  1TWC A;  4ZHQ F;  5HV6 A;  2QYZ A;  4O7Z A;  2WB1 E;  1K1S A;  3GQC A;  5LMU H;  2CNQ A;  1KT8 A;  3MR6 A;  1DAA A;  2VQD A;  3LP8 A;  2CW7 A;  1IOW A;  1IYD A;  1A48 A;  3UFX B;  2E2H A;  3NBY B;  4ED2 A;  4MV4 A;  5DLF A;  2VUM G;  2I8C A;  4I4T F;  4O7Y A;  1JX4 A;  1HNZ H;  5DIS C;  4MV9 A;  3PR5 B;  3U0G A;  2GPW A;  1I2L A;  4EGJ A;  2FMA A;  4JI2 H;  4ECX A;  2YW2 A;  4DR4 H;  2EJ0 A;  4EBD A;  2CQY A;  1T3N A;  2W7O A;  2YRX A;  4RCN A;  5D1P A;  4OX9 H;  4DR3 H;  1KUT A;  5KFU A;  1I6U A;  2FK2 A;  2HGS A;  2FLN A;  2YS6 A;  3G8C A;  4TM5 A;  4CMD A;  4E4T A;  3M4I A;  4O86 A;  5CA1 F;  3N41 B;  5KG4 A;  2W6Q A;  2R7K A;  4UCT A;  4WBN F;  4HNU A;  3T7A A;  4QWB A;  2WAQ A;  4RB2 C;  3OTO H;  4DR5 H;  2R7M A;  3PW4 A;  4DV5 H;  3PW0 A;  4CKB A;  1GO3 E;  2J6T A;  4YY3 H;  3GV5 B;  4ED6 A;  4NXM H;  4DR7 H;  3K5I A;  5KFQ A;  4KHP H;  4A3J G;  1OWT A;  5I5Y A;  2IA6 A;  3N6R A;  1ZHQ A;  4ED7 A;  1Z2N X;  2VPQ A;  3EPG A;  4ZOL F;  1HNX H;  5KG0 A;  4CE5 A;  2DZD A;  4JI4 H;  3GTM A;  1T94 A;  1KJQ A;  5IP7 G;  1VBG A;  3M9M B;  3ORR A;  4O7R A;  3WO1 A; 
#chains in the Genus database with same CATH homology
 1B6S A;  1KJ9 A;  2XCL A;  4HQ6 A;  3TIG A;  5D8D A;  2GQS A;  1E4E A;  2ZDH A;  1AUX A;  2FP4 B;  3HO8 A;  1JDE A;  2IP4 A;  5DMX A;  2W6O A;  1DV1 A;  2ZDG A;  3TIN A;  3MJF A;  1B6R A;  4YAK B;  3DF7 A;  5FNV F;  2NU7 B;  3JRX A;  4O82 A;  5LP6 F;  3OUU A;  2YZN A;  5KKN B;  3ETH A;  5CA0 F;  2GPS A;  4NYE A;  3QFF A;  4MA5 A;  1IOV A;  3VPC A;  3MWE A;  2YL2 A;  3RV3 A;  1DIK A;  5BMV F;  3OUZ A;  5JVD F;  3R23 A;  3V4S A;  1EHI A;  3TW6 A;  2QF7 A;  3KAL A;  2PBZ A;  4O7N A;  2R87 A;  3SE7 A;  1KJ8 A;  4ME6 A;  2R82 A;  2YYA A;  3E5N A;  2GLT A;  4HNT A;  5H80 A;  1ULZ A;  4YBZ B;  2DIK A;  4O83 A;  4TV9 F;  2FB9 A;  1GSO A;  3GLK A;  2YZM A;  4O2B F;  3TII A;  1E4E B;  4TUY F;  3JZI A;  2OLS A;  3U54 A;  3N8D A;  4FFP A;  1M0W A;  4XYL B;  4FFR A;  4XYM B;  2CNV A;  4FGR A;  3R9R A;  1W96 A;  5BPF A;  1EUC B;  1CQI B;  2YS7 A;  3ETJ A;  2I87 A;  4O7V A;  4XZ3 B;  5GON F;  2VR1 A;  4O4L F;  4HNV A;  2CNU A;  1KBL A;  1M0T A;  3MWD A;  3RUP A;  2X0S A;  1KC7 A;  1I7L A;  1JKJ B;  4O4H F;  1EZ1 A;  2NUA B;  3Q1K A;  4XX0 B;  3RFC A;  3WNZ A;  2PVP A;  2W6P A;  4EGQ A;  3VOT A;  5JVL A;  1JLL B;  2NU8 B;  2XD4 A;  2DLN A;  4Y8V B;  4C5B A;  2PN1 A;  4O84 A;  4O7S A;  1PX2 A;  2W70 A;  1UC8 A;  4MA0 A;  4IWX A;  1KJJ A;  1Z2P X;  2GQR A;  4MV8 A;  4IWY A;  4MV1 A;  2FPP B;  3Q2O A;  1SCU B;  3G8D A;  1DV2 A;  2FPI B;  3BG5 A;  1M6V A;  3GID A;  4FFM A;  3U9T A;  2W6N A;  1GSH A;  1CE8 A;  2R7L A;  4MAM A;  4EG0 A;  2C00 A;  3K5H A;  2FPG B;  4O4I F;  2I80 A;  4YAJ B;  2DWC A;  3TQT A;  2WYO A;  1UC9 A;  1EUD B;  3KAJ A;  3JRW A;  1AUV A;  4O4J F;  5C1P A;  3ORQ A;  3NUA A;  5LYJ F;  3AX6 A;  4O7W A;  4O7L A;  3LWB A;  2QK4 A;  2V5A A;  3U9S A;  3K3P A;  4O2A F;  5LA6 F;  3VMM A;  5JQG F;  2V59 A;  1PK8 A;  1T36 A;  1Z2O X;  3U55 A;  2SCU B;  4ZQI A;  2R86 A;  1A9X A;  2YRW A;  2ZDQ A;  3KAK A;  4MV7 A;  1GLV A;  2Z04 A;  3R5H A;  1JDB B;  2R85 A;  5IYZ F;  4WD3 A;  2R7N A;  1GGO A;  3AW8 A;  2YWV A;  4IIJ F;  1C30 A;  3VPB A;  4FE2 A;  4YJ3 F;  2YZG A;  3R5F A;  3JZF A;  1VKZ A;  5HBR B;  5K2M A;  3I12 A;  4O7T A;  2V58 A;  5CB4 F;  5C8Y F;  3VPD A;  1OBG A;  1CS0 A;  5LXT F;  1GSA A;  1W93 A;  5BPH A;  1CQJ B;  2W6Z A;  5EZY F;  4L1K A;  4C5A A;  4I55 F;  4ZI7 F;  2W71 A;  5CAE B;  5JH7 F;  5J2U F;  4HR7 A;  2NU6 B;  4DLK A;  2R6F A;  2R84 A;  1C3O A;  2W6M A;  4YJ2 F;  1KEE A;  4QSH A;  4C5C A;  5KX5 F;  4M9U A;  1EYZ A;  3KRE A;  3RV4 A;  4MV3 A;  1I7N A;  4I50 F;  3WO0 A;  5C1O A;  2Z02 A;  1WR2 A;  3HB9 A;  3VA7 A;  3HBL A;  4RZQ A;  1VBH A;  2HJW A;  2NU9 B;  3R5X A;  5I47 A;  4TV8 F;  1BNC A;  1BXR A;  2J9G A;  2P0A A;  4FU0 A;  2CZG A;  4FFO A;  4DIM A;  4FFN A;  5LOV F;  4YB8 B;  1KJI A;  3V4Z A;  4FFL A;  2YZL A;  5JQW A;  4MV6 A;  1OBD A;  4IHJ F;  4IZO A;  5J2T F;  4O81 A;  4ZHQ F;  5HV6 A;  4O7Z A;  2CNQ A;  2VQD A;  3LP8 A;  1IOW A;  1A48 A;  3UFX B;  4MV4 A;  2I8C A;  4I4T F;  4O7Y A;  4MV9 A;  2GPW A;  4EGJ A;  2YW2 A;  2CQY A;  2YRX A;  1KUT A;  2HGS A;  2YS6 A;  3G8C A;  4E4T A;  4O86 A;  5CA1 F;  2W6Q A;  2R7K A;  4WBN F;  4HNU A;  2R7M A;  3K5I A;  3N6R A;  1Z2N X;  2VPQ A;  4ZOL F;  2DZD A;  1KJQ A;  1VBG A;  3ORR A;  4O7R A;  3WO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...