4YAKB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, acetyl-coenzyme a and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yakB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yakB02
5I47A 4IWXA 3ORQA 3TINA 2HJWA 1ULZA 2YL2A 2PVPA 2ZDHA 5K2MA 3KAKA 2HGSA 2R7NA 4I4TF 3VPBA 4O4JF 4MV8A 2C00A 4XX0B 5JVLA 2FP4B 3RFCA 2QK4A 1OBDA 2R87A 4HR7A 3U9TA 3WO0A 4O4HF 2V5AA 4C5BA 2CNVA 4EGQA 1C30A 2CNUA 3WNZA 1Z2OX 3AW8A 5CA1F 3TIIA 3GLKA 5C8YF 4O83A 5LP6F 4O7RA 1W96A 4HNTA 5CAEB 3RUPA 2XCLA 4TUYF 4XYLB 3VMMA 2I80A 4EGJA 4EG0A 3N6RA 2GPSA 2GLTA 4ME6A 5KKNB 2W6QA 1E4EB 4IIJF 2WYOA 3HBLA 4HQ6A 2P0AA 2R84A 1CQJB 3U9SA 1A9XA 5LYJF 2SCUB 4FFMA 2YS7A 2FPIB 3HB9A 2FB9A 3BG5A 3Q1KA 2CZGA 3RV3A 5BPFA 4O4IF 2YZMA 4QSHA 4I50F 3GIDA 1JKJB 4YAJB 1Z2PX 2YS6A 4O84A 2FPGB 1KJ9A 2V58A 2YZGA 1EHIA 3WO1A 4O7VA 2I8CA 4WBNF 1GGOA 1BNCA 3R5XA 1KJ8A 4YJ2F 2PN1A 4HNVA 2ZDQA 1EUDB 4IZOA 5D8DA 4FE2A 1DIKA 1KUTA 3QFFA 3Q2OA 3ETJA 4HNUA 2ZDGA 4O7SA 1UC8A 2R7MA 2R82A 3SE7A 2YWVA 1CQIB 3DF7A 1M0WA 2YZNA 4MV6A 4RZQA 2W6MA 4DLKA 4XZ3B 2GQRA 4ZI7F 2NU9B 2NU8B 4TV8F 1AUVA 5JQGF 1DV2A 1I7LA 2FPPB 1KBLA 1W93A 3MWEA 3AX6A 4O7YA 1DV1A 3R9RA 4O81A 1IOWA 3JZIA 3R5FA 4MV4A 4NYEA 5LA6F 2DIKA 3LWBA 2YW2A 5JQWA 3KREA 1B6RA 3E5NA 2DZDA 4C5CA 4O7NA 4YAKB 3NUAA 3VPDA 3VA7A 1I7NA 5C1OA 5JH7F 1WR2A 3I12A 3VOTA 1GSHA 3HO8A 3TIGA 5HBRB 3R23A 3U54A 2GPWA 4O4LF 2VPQA 4FGRA 2YRXA 3N8DA 5H80A 1C3OA 1GSAA 1JDBB 5GONF 2V59A 1KJIA 3V4ZA 5CA0F 1KJQA 4O2AF 4YBZB 4O7ZA 3K3PA 3V4SA 4WD3A 4FFRA 4M9UA 5BPHA 5EZYF 1VKZA 5J2UF 3KALA 4MV1A 1VBHA 3JZFA 1EUCB 1SCUB 5HV6A 1KJJA 1PX2A 1A48A 3K5IA 5C1PA 4O7LA 4FFNA 1CE8A 3LP8A 5JVDF 4O7TA 3ETHA 5IYZF 4IWYA 1JLLB 2VR1A 1T36A 4FFLA 5DMXA 3G8DA 4MV9A 2XD4A 4MV3A 2W6ZA 5LOVF 5FNVF 1CS0A 2R86A 2I87A 4Y8VB 2NUAB 1EYZA 3MWDA 4IHJF 4YB8B 2VQDA 1B6SA 4MV7A 1E4EA 2NU7B 3ORRA 4ZHQF 1IOVA 1KEEA 3OUUA 4I55F 2W6NA 4FU0A 2R7LA 5CB4F 2DLNA 2Z02A 3VPCA 3RV4A 3JRXA 4ZQIA 3TQTA 4XYMB 1BXRA 3JRWA 5LXTF 2IP4A 4MAMA 2R6FA 4MA0A 2OLSA 4E4TA 4FFOA 5J2TF 1Z2NX 4MA5A 2YYAA 2CNQA 4DIMA 4O7WA 2QF7A 4O82A 1UC9A 1EZ1A 2PBZA 4C5AA 1KC7A 2DWCA 2R7KA 1AUXA 1M6VA 4O86A 2YZLA 4O2BF 2X0SA 2W6PA 3R5HA 3UFXB 3TW6A 3MJFA 1VBGA 4ZOLF 1GSOA 2NU6B 5BMVF 1OBGA 5KX5F 2W6OA 2W70A 1JDEA 1M0TA 3U55A 1GLVA 4L1KA 2YRWA 1PK8A 2W71A 2CQYA 3OUZA 4YJ3F 2R85A 3KAJA 2J9GA 4TV9F 3G8CA 2Z04A 2GQSA 4FFPA 3K5HA
chains in the Genus database with same CATH superfamily
1E4GT 4IRKA 5E25A 4Q8EA 4NXNH 1RYRA 5I47A 4IWXA 3ORQA 4RUCA 2AGPA 3TINA 4DR1H 2HJWA 2QB5A 3TEKA 3GQCA 1RJPA 3U0GA 4DV7H 3GTQA 1ULZA 2YL2A 2PVPA 2ZDHA 3GTKA 1L2ZA 3T99A 2DABA 5K2MA 4O3QA 4AQYH 3RAQA 4RNOA 4APMA 3RB0A 5KG7A 5KFEA 4A3BG 5I5YA 1RJQA 4J9QA 2R92G 3KAKA 3HOUG 2JA7A 2HGSA 2R7NA 3Q8PB 4ED6A 1XNQH 4I4TF 5KFYA 2R8JA 3DTGA 3VPBA 2UXBH 5FR9A 3NBYB 2OWOA 4JI8H 2OH2A 4QW8A 2FK1A 5KFZA 3H4BA 5EDWA 4O4JF 3IG0A 4MV8A 2HGXA 5KFUA 3PZPA 2C00A 5DQIA 2R8IA 5KFHA 2WAQA 4JI7H 5DGBA 4XX0B 5JVLA 4BWSC 5FJ8G 2ZM6H 3T5LA 4DL7A 3GV5B 2FP4B 2RGRA 1N32H 2HG8A 3RFCA 2QK4A 1JIHA 4ED2A 4LMYA 1OBDA 4CC6A 2R87A 4HR7A 2COGA 2EJ0A 3F8NA 4DR6H 4X66H 2FJZA 3N43B 3U9TA 3WO0A 4O4HF 2V5AA 1P8LA 3GJXB 2CNVA 3S24A 4C5BA 4RAZA 3MFHA 4EGQA 4Q0YA 3PO3G 3LQSA 1C30A 1JXLA 2CNUA 4GC6A 3WNZA 1Z2OX 3AW8A 4JI2H 2HHFA 5CA1F 1HNWH 3TIIA 3GILA 5LMNH 3GLKA 4FM9A 2F4VH 5C8YF 4O83A 4HNTA 4O7RA 1W96A 5BWTA 5I5UA 5LP6F 1TWFA 2FKLA 5KFPA 4U6PA 4EEYA 3RBDA 2R8KA 4EFBA 5CAEB 3T9EA 4IAJA 4M7EA 3RUPA 2XCLA 4TUYF 3L4KA 3HOXG 3BQ2A 4EYHB 4EBCA 4XYLB 4O3RA 5IP7G 3VMMA 2I80A 3L4JA 3PW0A 2HHHH 2JEGA 4LFBH 3FKIA 2ZJTA 4EGJA 4BBSG 3N42B 1N56A 4LSXA 4ECQA 3MR3A 3AYHB 4A3GG 4EEQA 5BWXA 4EG0A 2QYZA 3OHBA 3N6RA 2GPSA 4RB1A 3EPIA 2GLTA 4ME6A 5I5SA 3PFFA 4NLGA 3K3VA 5KKNB 2W6QA 1E4EB 1ZHQA 4AYBA 4UCVA 1E4FT 1I94H 1Y1WA 3HKZA 3T5KA 4O3NA 4IIJF 2XGPA 1RK6A 3OHAA 2W9BB 2WYOA 3L2PA 4JI3H 3KTMA 4ECWA 1SYXB 3HBLA 4HQ6A 5FD5A 2P0AA 2R7ZG 2R84A 1CQJB 2CKZB 4UCUA 3U9SA 2W57A 4NZOA 1A9XA 2UU9H 5LYJF 2SCUB 4FFMA 2Y0SE 4JI6H 4F4ZA 2R93G 3UYYA 2IA6A 5KT7A 4J0MA 2YS7A 5A2QW 4DUYH 3T9CA 2FPIB 3HB9A 2FB9A 1FVIA 2ODTX 4RAYA 5DQHA 3RF2A 3BG5A 3Q1KA 2HVSA 2M05A 3H4DA 2CZGA 4J9MA 2W9CA 2UVWA 2O03A 3RV3A 5BPFA 2JA6G 4O4IF 3BACA 3J7AK 5T14A 3BA9A 2YZMA 4QSHA 4QIWA 4R8UB 4F4YA 4I50F 4PBCA 3GIDA 4IR9A 1DAAA 1JKJB 2AU0A 4GLWA 5C44G 4YAJB 5DGIA 1WCMG 2E5LH 5IT9W 4DL6A 1IYDA 1V9PA 3J81W 1Z2PX 1ZAUA 2YS6A 1V51A 4O84A 2KSWA 5IYDG 3T1YH 2FPGB 1KJ9A 3T9FA 2XCAA 3H3VH 3OSNA 2V58A 1V4YA 3I4MG 5KT5A 1BGWA 2YZGA 1EHIA 5I5TA 3QQMA 3WO1A 1BJTA 1S0MA 4O7VA 2VA3A 2I8CA 4WBNF 1GYFA 1GGOA 1BNCA 1FKAH 2VUGA 3R5XA 3RB4A 1HR0H 1KJ8A 1T94A 2WTFA 4YJ2F 3W1BA 2PN1A 3BQ0A 4HNVA 4LF5H 4BY7G 5CE8A 1N36H 1ZETA 4OX9H 2R7ZA 2ZDQA 1EUDB 4IZOA 5D8DA 3T9BA 2W9BA 3JAMW 3W5OA 4GC7A 2ABJA 4LFCH 5KFFA 5DLGA 4Q43A 4DR2H 4DR3H 2UVUA 4FE2A 1DIKA 5C3EG 4DR7H 1KUTA 3DTFA 3QFFA 3Q2OA 3WWHA 4E6NA 3ETJA 4HNUA 2ZDGA 4B3MH 3UQ8A 4O7SA 4MTDA 4FS2A 3TW7A 2ASLA 2HVQA 4UCTA 3HT5A 3M9NB 4DV6H 1UC8A 3JZ6A 4TQSA 3G6VA 4DV3H 2R7MA 4RU9A 1VS0A 4ECXA 3T1HH 2R82A 4FS1A 4GKJH 2JEIA 3SE7A 4EFEA 4A2AA 2YWVA 2RDJA 4UFZA 1CQIB 3DF7A 4FBUA 1M0WA 2YZNA 1TWCA 2WE6A 3H20A 4J9LA 4MV6A 4DV1H 4ED0A 1S68A 3GTJA 2XCPA 4A3IG 4RB0A 3GIQA 1EKVA 3SI8A 3RB6A 4JI4H 4RZQA 3H40A 1KT8A 2W6MA 4DLKA 4A3LG 4XZ3B 2GQRA 3KHRA 4ZI7F 2NU9B 2JA6A 2RGVA 2AQ4A 3MR6A 4CHIA 5KFCA 4O3PA 3TY8A 3BAAA 4DQNA 3OSPA 5KT4A 1Y14B 2NU8B 5KFKA 2HIVA 1K83A 5D1OB 2R92A 4A3EG 4M0JA 4TV8F 3LMLA 5DG8A 4RZRA 5L1JA 3CEBA 4UCOA 2YU9A 1S0NA 4U7CA 1AUVA 5JQGF 1DV2A 3RBEA 1I7LA 2FPPB 3KHLA 2C2DA 1KBLA 1W93A 4ED3A 5CM0A 5KFLA 3GDEA 2IMWP 3MWEA 3IN5A 5KFGA 3AX6A 2JA5G 4O7YA 4RNNA 2B63A 4Q4DA 1DV1A 3N40P 3KHGA 2WDTA 3R9RA 4ED8A 3GTMA 2NVXA 4O81A 2UUCH 1IOWA 2CFMA 2E2HA 3JZIA 3R5FA 1R9TA 4MV4A 5KFXA 4NYEA 5KFQA 3QZ8A 1A0GA 5LA6F 2DIKA 3LWBA 1O75A 4O3OA 4IR1A 3FDSA 2YW2A 5JQWA 1WCMA 5FLMG 2R8HA 4ECVA 2Q7DA 2FMAA 3KREA 4ED1A 3EYYA 4X62H 5KG0A 4MTEA 2FE3A 1B6RA 5KT2A 3E5NA 2DZDA 4C5CA 2WB1A 4BY1G 3GV8B 3PVXA 3PW7A 1S9FA 4O7NA 4YAKB 3NUAA 3VPDA 3VA7A 4J9KA 4IRCA 1I7NA 4DR4H 4Q4CA 4C2MA 5C1OA 5JH7F 3T7AA 3KXYT 3T5HA 5FD6A 1WR2A 3SGIA 3I12A 3GIKA 3GV7B 2Y0SA 3VOTA 2UVRA 1GSHA 1I2LA 3HO8A 1X9NA 5IYBG 5HBRB 3TIGA 3R23A 3U54A 4Q8FA 2GPWA 4O4LF 4JV1A 2VPQA 1XNRH 4F4XA 3FMAA 4FGRA 1I50A 2YRXA 3N8DA 5DAAA 1TA8A 5H80A 1C3OA 4A3MG 4TVIA 2AGOA 1GSAA 1EKPA 5KG2A 4FBTA 1JDBB 4DL3A 2RF4A 5C4XG 3RGXA 1ET0A 5GONF 4PZ6A 4DV2H 2V59A 1KJIA 1JX4A 4O3SA 2EJ3A 3V4ZA 3G6YA 5DGAA 5CA0F 3M9MB 1TAEA 4CKEA 1KJQA 2MCTA 3PN1A 4O2AF 2EJ2A 5KT6A 4YBZB 3PR5B 4O7ZA 2HIXA 4LH6A 5KFTA 3K3PA 3V4SA 4WD3A 4BBRG 5FLXW 4FFRA 2C2EA 3NBZB 4YY3H 5KFDA 4M9UA 5DLFA 5BPHA 4A2BA 1CKNA 2VQFH 5BWUA 5EZYF 1VKZA 5J2UF 4LF6H 1RK5A 5BYAA 3KALA 4MV1A 3GTOA 4LF7H 1VBHA 3JZFA 5KFMA 5DG9A 4EBDA 3V6HA 2J6SA 3WWIA 1EUCB 2C28A 4LSAA 2UXCH 1SCUB 2ZGIA 4TQRA 3M4IA 4JI1H 1S10A 5HV6A 3RB3A 3JSLA 5I5VA 1KJJA 5EWFA 4JYAH 1PX2A 4QW9A 3T5JA 2X5RA 4B3RH 5KG3A 3C0FB 4DR5H 1A48A 3K5IA 5C1PA 4YHHH 2ATLA 4DV4H 4O7LA 4QWAA 5LMUH 4LFAH 2B63G 2Q2UA 2XIGA 1ZQ7A 4FFNA 5K3WA 5DGHA 1CE8A 3LP8A 4ED7A 3CSWA 5JVDF 1XMOH 1IBKH 4O7TA 3ETHA 5EWGA 1CKOA 5I5XA 5DG7A 5KFVA 2DAAA 4IRDA 5IYZF 1KTAA 3PR4A 2BQ3A 4IWYA 1JLLB 2VR1A 5KG5A 2BQRA 1I1MA 3W1GA 2HDKA 3KHHA 1XK5A 3QWUA 1WSCA 1VAJA 4J9RA 1T36A 4UCSA 5KS8A 1RJRA 3EPGA 1S0OA 1HNZH 2UUBH 3Q8RB 4FFLA 3WWJA 1I1KA 5DMXA 2W8LA 3G8DA 4MV9A 4CKBA 3I4NG 2XD4A 3VNNA 4MV3A 5KFAA 4RB2C 1IYEA 3GIIA 2W6ZA 5L1LA 4RCNA 5LOVF 2J6UA 5FNVF 2CW7A 1CS0A 2W8KA 3HOWG 3MR2A 2R86A 3G6XA 2ALZA 2YCHA 5DISC 1RYSA 3BJYA 2I87A 5HNEA 2FK2A 3UZOA 4HN2A 4Y8VB 1B33N 3Q8SB 4K0KH 2CW8A 1ZHSA 4CE5A 4YR0A 1XMQH 2NUAB 2DPJA 1K1QA 1EYZA 3MWDA 4IHJF 4YB8B 2ASDA 2XGQA 2VQDA 1HNXH 1P16A 3RGZA 4RUAA 1B6SA 3FKIG 4MV7A 3SNOA 1E4EA 4DAAA 2NU7B 4R7RA 2IBKA 4Q45A 2RDIA 3GTPA 4RB3C 4QWCA 3GIJA 1K1SA 4A93G 3ORRA 4ZHQF 2UUAH 4YQWA 1M7JA 3BQ1A 1IOVA 1KEEA 3NC0B 5KFIA 1AN7A 2VUMA 5FPOA 3OUUA 2JA7G 2COJA 4DV5H 4JI0H 4I55F 1Y1WG 1IBLH 2W6NA 5L1IA 1IBMH 3Q8QB 4A3JG 5CR5A 1N33H 4FU0A 2R7LA 5CB4F 5KG4A 5KFOA 4R8UA 3UZBA 5KT3A 4ECYA 2DLNA 1S03G 3T9AA 3HOVG 5F9LA 3CVZA 2EIYA 2Z02A 1G2WA 3RV4A 3VPCA 4JUZA 3T54A 2W7OA 3JRXA 4B3SH 4X64H 2HHFB 2WB1E 5LL6b 4ZQIA 3TQTA 4QWDA 4XYMB 1BXRA 3BABA 3JRWA 4LH7A 4GLXA 3N6XA 3DAAA 4I7HA 3M9OB 4LF9H 3RAXA 4EYIB 1I6UA 5LXTF 3TY9A 2AGQA 4QJFA 1Y1VA 2IP4A 5I5WA 1A0IA 4NZMA 4MAMA 2R6FA 4MA0A 2OLSA 5JUMA 4UUGA 5BR8H 4ETSA 1I2KA 2R8GA 4NXMH 4A3DG 4LF8H 2V4QA 3CQZA 4E4TA 4DUZH 4JV2A 4K6NA 3TY5A 1I3QA 1EKFA 4FFOA 5D1OA 2R93A 5J2TF 3TQ1A 1Z2NX 5BWWA 3H0GA 4DL5A 1S97A 4J9NA 4MA5A 5BWVA 4PWQA 2YYAA 2JA8G 2UXDH 4X65H 4CMDA 2CNQA 5KG6A 5KFBA 3PW4A 4YR2A 3PW2A 4Q44A 4LF4H 3HOYG 4DIMA 4O7WA 5KG1A 4JV0A 4GKKH 1WH2A 2QF7A 5EOYA 4O82A 4ECZA 3PW5A 3RTXA 2C35B 4J9OA 4HYKA 1WRVA 5KFWA 2PMZA 2C22A 1UC9A 3OTOH 5FPRA 1EZ1A 3V6KA 4ECRA 3RR5A 4B3TH 1B04A 4AYBE 1T3NA 3N44B 2PBZA 4CC5A 3RIZA 5IP9G 5BYBA 4C5AA 4DRFA 4J9SA 4F50A 4EQ5A 1KC7A 3MR5A 3V6JA 3MWMA 2JA5A 1I1LA 2DWCA 3QZ7A 3BA8A 4TM5A 2FLLA 2R7KA 1AUXA 1M6VA 4DL4A 3KYHC 4O86A 4UCRA 1SEIA 4A3FG 2WAQE 3NGDA 2YZLA 4O2BF 1OWTA 3HKZE 5KFSA 1N48A 4QWBA 2C2RA 5F9NA 2COIA 2E2IA 4JI5H 2X0SA 1UNNC 4J9PA 2W6PA 1SFOA 2VA2A 2VOBA 2W7PA 5IWAH 3GIMA 4ECSA 2Q2TA 3R5HA 1TWGA 3UFXB 3J80W 3TW6A 4YP3A 4DV0H 3MJFA 2HVRA 2ASJA 1N34H 4NZNA 2DPIA 5L9XA 5EWEA 2V9WA 4PZ8A 5C5JA 2Y4RA 4WHXA 1CKMA 5KFRA 4DL2A 2FLPA 4YR3A 3GB8B 2HGWA 1Y1VG 4A3KG 1GO3E 3GIPA 2PMZE 2A1HA 4ECTA 1VBGA 2VUMG 4KHPH 3H0GG 4ZOLF 5DQGA 5D1PA 1GSOA 1CKNB 4BXXG 2NU6B 2BR0A 2JEFA 4PZ7A 1MZBA 4F4WA 1XDNA 2J6TA 4CKCA 2FLNA 5BMVF 4ECUA 3GTLA 3HXLA 1OBGA 5KX5F 5L1KA 2W6OA 2W9AA 2JEJA 3JSNA 1JDEA 1M0TA 5I60A 2W70A 1TWHA 5KFJA 1A3GA 3U55A 1TWAA 2W9CB 4RNMA 2V4RA 4A3CG 1GLVA 4L1KA 4PDBA 5BWRA 2UVVA 2VPSA 4G3IA 2YRWA 1PK8A 2W71A 3T9DA 2CQYA 2XC9A 3OUZA 2NVYA 4CMFA 4QWEA 5IYCG 4YJ3F 2BQUA 1FJGH 3HOZG 2R85A 3KAJA 4JXUA 2J9GA 4TV9F 5KFNA 2FK3A 1J5EH 3GTGA 3G8CA 4QIWE 2VQEH 3N41B 1DGSA 3MFIA 4JV5H 2Z04A 4EBEA 2GQSA 3PO2G 4FFPA 3RJ0A 3K5HA 3LULA
chains in the Genus database with same CATH topology
5I47A 4IWXA 3ORQA 3TINA 2HJWA 1ULZA 2YL2A 2PVPA 2ZDHA 5K2MA 3KAKA 2HGSA 2R7NA 4I4TF 3VPBA 4O4JF 4MV8A 2C00A 4XX0B 5JVLA 2FP4B 3RFCA 2QK4A 1OBDA 2R87A 4HR7A 3U9TA 3WO0A 4O4HF 2V5AA 4C5BA 2CNVA 4EGQA 1C30A 2CNUA 3WNZA 1Z2OX 3AW8A 5CA1F 3TIIA 3GLKA 5C8YF 4O83A 5LP6F 4O7RA 1W96A 4HNTA 5CAEB 3RUPA 2XCLA 4TUYF 4XYLB 3VMMA 2I80A 4EGJA 4EG0A 3N6RA 2GPSA 2GLTA 4ME6A 5KKNB 2W6QA 1E4EB 4IIJF 2WYOA 3HBLA 4HQ6A 2P0AA 2R84A 1CQJB 3U9SA 1A9XA 5LYJF 2SCUB 4FFMA 2YS7A 2FPIB 3HB9A 2FB9A 3BG5A 3Q1KA 2CZGA 3RV3A 5BPFA 4O4IF 2YZMA 4QSHA 4I50F 3GIDA 1JKJB 4YAJB 1Z2PX 2YS6A 4O84A 2FPGB 1KJ9A 2V58A 2YZGA 1EHIA 3WO1A 4O7VA 2I8CA 4WBNF 1GGOA 1BNCA 3R5XA 1KJ8A 4YJ2F 2PN1A 4HNVA 2ZDQA 1EUDB 4IZOA 5D8DA 4FE2A 1DIKA 1KUTA 3QFFA 3Q2OA 3ETJA 4HNUA 2ZDGA 4O7SA 1UC8A 2R7MA 2R82A 3SE7A 2YWVA 1CQIB 3DF7A 1M0WA 2YZNA 4MV6A 4RZQA 2W6MA 4DLKA 4XZ3B 2GQRA 4ZI7F 2NU9B 2NU8B 4TV8F 1AUVA 5JQGF 1DV2A 1I7LA 2FPPB 1KBLA 1W93A 3MWEA 3AX6A 4O7YA 1DV1A 3R9RA 4O81A 1IOWA 3JZIA 3R5FA 4MV4A 4NYEA 5LA6F 2DIKA 3LWBA 2YW2A 5JQWA 3KREA 1B6RA 3E5NA 2DZDA 4C5CA 4O7NA 4YAKB 3NUAA 3VPDA 3VA7A 1I7NA 5C1OA 5JH7F 1WR2A 3I12A 3VOTA 1GSHA 3HO8A 3TIGA 5HBRB 3R23A 3U54A 2GPWA 4O4LF 2VPQA 4FGRA 2YRXA 3N8DA 5H80A 1C3OA 1GSAA 1JDBB 5GONF 2V59A 1KJIA 3V4ZA 5CA0F 1KJQA 4O2AF 4YBZB 4O7ZA 3K3PA 3V4SA 4WD3A 4FFRA 4M9UA 5BPHA 5EZYF 1VKZA 5J2UF 3KALA 4MV1A 1VBHA 3JZFA 1EUCB 1SCUB 5HV6A 1KJJA 1PX2A 1A48A 3K5IA 5C1PA 4O7LA 4FFNA 1CE8A 3LP8A 5JVDF 4O7TA 3ETHA 5IYZF 4IWYA 1JLLB 2VR1A 1T36A 4FFLA 5DMXA 3G8DA 4MV9A 2XD4A 4MV3A 2W6ZA 5LOVF 5FNVF 1CS0A 2R86A 2I87A 4Y8VB 2NUAB 1EYZA 3MWDA 4IHJF 4YB8B 2VQDA 1B6SA 4MV7A 1E4EA 2NU7B 3ORRA 4ZHQF 1IOVA 1KEEA 3OUUA 4I55F 2W6NA 4FU0A 2R7LA 5CB4F 2DLNA 2Z02A 3VPCA 3RV4A 3JRXA 4ZQIA 3TQTA 4XYMB 1BXRA 3JRWA 5LXTF 2IP4A 4MAMA 2R6FA 4MA0A 2OLSA 4E4TA 4FFOA 5J2TF 1Z2NX 4MA5A 2YYAA 2CNQA 4DIMA 4O7WA 2QF7A 4O82A 1UC9A 1EZ1A 2PBZA 4C5AA 1KC7A 2DWCA 2R7KA 1AUXA 1M6VA 4O86A 2YZLA 4O2BF 2X0SA 2W6PA 3R5HA 3UFXB 3TW6A 3MJFA 1VBGA 4ZOLF 1GSOA 2NU6B 5BMVF 1OBGA 5KX5F 2W6OA 2W70A 1JDEA 1M0TA 3U55A 1GLVA 4L1KA 2YRWA 1PK8A 2W71A 2CQYA 3OUZA 4YJ3F 2R85A 3KAJA 2J9GA 4TV9F 3G8CA 2Z04A 2GQSA 4FFPA 3K5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I47 A;  4IWX A;  3ORQ A;  3TIN A;  2HJW A;  1ULZ A;  2YL2 A;  2PVP A;  2ZDH A;  5K2M A;  3KAK A;  2HGS A;  2R7N A;  4I4T F;  3VPB A;  4O4J F;  4MV8 A;  2C00 A;  4XX0 B;  5JVL A;  2FP4 B;  3RFC A;  2QK4 A;  1OBD A;  2R87 A;  4HR7 A;  3U9T A;  3WO0 A;  4O4H F;  2V5A A;  4C5B A;  2CNV A;  4EGQ A;  1C30 A;  2CNU A;  3WNZ A;  1Z2O X;  3AW8 A;  5CA1 F;  3TII A;  3GLK A;  5C8Y F;  4O83 A;  5LP6 F;  4O7R A;  1W96 A;  4HNT A;  5CAE B;  3RUP A;  2XCL A;  4TUY F;  4XYL B;  3VMM A;  2I80 A;  4EGJ A;  4EG0 A;  3N6R A;  2GPS A;  2GLT A;  4ME6 A;  5KKN B;  2W6Q A;  1E4E B;  4IIJ F;  2WYO A;  3HBL A;  4HQ6 A;  2P0A A;  2R84 A;  1CQJ B;  3U9S A;  1A9X A;  5LYJ F;  2SCU B;  4FFM A;  2YS7 A;  2FPI B;  3HB9 A;  2FB9 A;  3BG5 A;  3Q1K A;  2CZG A;  3RV3 A;  5BPF A;  4O4I F;  2YZM A;  4QSH A;  4I50 F;  3GID A;  1JKJ B;  4YAJ B;  1Z2P X;  2YS6 A;  4O84 A;  2FPG B;  1KJ9 A;  2V58 A;  2YZG A;  1EHI A;  3WO1 A;  4O7V A;  2I8C A;  4WBN F;  1GGO A;  1BNC A;  3R5X A;  1KJ8 A;  4YJ2 F;  2PN1 A;  4HNV A;  2ZDQ A;  1EUD B;  4IZO A;  5D8D A;  4FE2 A;  1DIK A;  1KUT A;  3QFF A;  3Q2O A;  3ETJ A;  4HNU A;  2ZDG A;  4O7S A;  1UC8 A;  2R7M A;  2R82 A;  3SE7 A;  2YWV A;  1CQI B;  3DF7 A;  1M0W A;  2YZN A;  4MV6 A;  4RZQ A;  2W6M A;  4DLK A;  4XZ3 B;  2GQR A;  4ZI7 F;  2NU9 B;  2NU8 B;  4TV8 F;  1AUV A;  5JQG F;  1DV2 A;  1I7L A;  2FPP B;  1KBL A;  1W93 A;  3MWE A;  3AX6 A;  4O7Y A;  1DV1 A;  3R9R A;  4O81 A;  1IOW A;  3JZI A;  3R5F A;  4MV4 A;  4NYE A;  5LA6 F;  2DIK A;  3LWB A;  2YW2 A;  5JQW A;  3KRE A;  1B6R A;  3E5N A;  2DZD A;  4C5C A;  4O7N A;  4YAK B;  3NUA A;  3VPD A;  3VA7 A;  1I7N A;  5C1O A;  5JH7 F;  1WR2 A;  3I12 A;  3VOT A;  1GSH A;  3HO8 A;  3TIG A;  5HBR B;  3R23 A;  3U54 A;  2GPW A;  4O4L F;  2VPQ A;  4FGR A;  2YRX A;  3N8D A;  5H80 A;  1C3O A;  1GSA A;  1JDB B;  5GON F;  2V59 A;  1KJI A;  3V4Z A;  5CA0 F;  1KJQ A;  4O2A F;  4YBZ B;  4O7Z A;  3K3P A;  3V4S A;  4WD3 A;  4FFR A;  4M9U A;  5BPH A;  5EZY F;  1VKZ A;  5J2U F;  3KAL A;  4MV1 A;  1VBH A;  3JZF A;  1EUC B;  1SCU B;  5HV6 A;  1KJJ A;  1PX2 A;  1A48 A;  3K5I A;  5C1P A;  4O7L A;  4FFN A;  1CE8 A;  3LP8 A;  5JVD F;  4O7T A;  3ETH A;  5IYZ F;  4IWY A;  1JLL B;  2VR1 A;  1T36 A;  4FFL A;  5DMX A;  3G8D A;  4MV9 A;  2XD4 A;  4MV3 A;  2W6Z A;  5LOV F;  5FNV F;  1CS0 A;  2R86 A;  2I87 A;  4Y8V B;  2NUA B;  1EYZ A;  3MWD A;  4IHJ F;  4YB8 B;  2VQD A;  1B6S A;  4MV7 A;  1E4E A;  2NU7 B;  3ORR A;  4ZHQ F;  1IOV A;  1KEE A;  3OUU A;  4I55 F;  2W6N A;  4FU0 A;  2R7L A;  5CB4 F;  2DLN A;  2Z02 A;  3VPC A;  3RV4 A;  3JRX A;  4ZQI A;  3TQT A;  4XYM B;  1BXR A;  3JRW A;  5LXT F;  2IP4 A;  4MAM A;  2R6F A;  4MA0 A;  2OLS A;  4E4T A;  4FFO A;  5J2T F;  1Z2N X;  4MA5 A;  2YYA A;  2CNQ A;  4DIM A;  4O7W A;  2QF7 A;  4O82 A;  1UC9 A;  1EZ1 A;  2PBZ A;  4C5A A;  1KC7 A;  2DWC A;  2R7K A;  1AUX A;  1M6V A;  4O86 A;  2YZL A;  4O2B F;  2X0S A;  2W6P A;  3R5H A;  3UFX B;  3TW6 A;  3MJF A;  1VBG A;  4ZOL F;  1GSO A;  2NU6 B;  5BMV F;  1OBG A;  5KX5 F;  2W6O A;  2W70 A;  1JDE A;  1M0T A;  3U55 A;  1GLV A;  4L1K A;  2YRW A;  1PK8 A;  2W71 A;  2CQY A;  3OUZ A;  4YJ3 F;  2R85 A;  3KAJ A;  2J9G A;  4TV9 F;  3G8C A;  2Z04 A;  2GQS A;  4FFP A;  3K5H A; 
#chains in the Genus database with same CATH topology
 1E4G T;  4IRK A;  5E25 A;  4Q8E A;  4NXN H;  1RYR A;  5I47 A;  4IWX A;  3ORQ A;  4RUC A;  2AGP A;  3TIN A;  4DR1 H;  2HJW A;  2QB5 A;  3TEK A;  3GQC A;  1RJP A;  3U0G A;  4DV7 H;  3GTQ A;  1ULZ A;  2YL2 A;  2PVP A;  2ZDH A;  3GTK A;  1L2Z A;  3T99 A;  2DAB A;  5K2M A;  4O3Q A;  4AQY H;  3RAQ A;  4RNO A;  4APM A;  3RB0 A;  5KG7 A;  5KFE A;  4A3B G;  5I5Y A;  1RJQ A;  4J9Q A;  2R92 G;  3KAK A;  3HOU G;  2JA7 A;  2HGS A;  2R7N A;  3Q8P B;  4ED6 A;  1XNQ H;  4I4T F;  5KFY A;  2R8J A;  3DTG A;  3VPB A;  2UXB H;  5FR9 A;  3NBY B;  2OWO A;  4JI8 H;  2OH2 A;  4QW8 A;  2FK1 A;  5KFZ A;  3H4B A;  5EDW A;  4O4J F;  3IG0 A;  4MV8 A;  2HGX A;  5KFU A;  3PZP A;  2C00 A;  5DQI A;  2R8I A;  5KFH A;  2WAQ A;  4JI7 H;  5DGB A;  4XX0 B;  5JVL A;  4BWS C;  5FJ8 G;  2ZM6 H;  3T5L A;  4DL7 A;  3GV5 B;  2FP4 B;  2RGR A;  1N32 H;  2HG8 A;  3RFC A;  2QK4 A;  1JIH A;  4ED2 A;  4LMY A;  1OBD A;  4CC6 A;  2R87 A;  4HR7 A;  2COG A;  2EJ0 A;  3F8N A;  4DR6 H;  4X66 H;  2FJZ A;  3N43 B;  3U9T A;  3WO0 A;  4O4H F;  2V5A A;  1P8L A;  3GJX B;  2CNV A;  3S24 A;  4C5B A;  4RAZ A;  3MFH A;  4EGQ A;  4Q0Y A;  3PO3 G;  3LQS A;  1C30 A;  1JXL A;  2CNU A;  4GC6 A;  3WNZ A;  1Z2O X;  3AW8 A;  4JI2 H;  2HHF A;  5CA1 F;  1HNW H;  3TII A;  3GIL A;  5LMN H;  3GLK A;  4FM9 A;  2F4V H;  5C8Y F;  4O83 A;  4HNT A;  4O7R A;  1W96 A;  5BWT A;  5I5U A;  5LP6 F;  1TWF A;  2FKL A;  5KFP A;  4U6P A;  4EEY A;  3RBD A;  2R8K A;  4EFB A;  5CAE B;  3T9E A;  4IAJ A;  4M7E A;  3RUP A;  2XCL A;  4TUY F;  3L4K A;  3HOX G;  3BQ2 A;  4EYH B;  4EBC A;  4XYL B;  4O3R A;  5IP7 G;  3VMM A;  2I80 A;  3L4J A;  3PW0 A;  2HHH H;  2JEG A;  4LFB H;  3FKI A;  2ZJT A;  4EGJ A;  4BBS G;  3N42 B;  1N56 A;  4LSX A;  4ECQ A;  3MR3 A;  3AYH B;  4A3G G;  4EEQ A;  5BWX A;  4EG0 A;  2QYZ A;  3OHB A;  3N6R A;  2GPS A;  4RB1 A;  3EPI A;  2GLT A;  4ME6 A;  5I5S A;  3PFF A;  4NLG A;  3K3V A;  5KKN B;  2W6Q A;  1E4E B;  1ZHQ A;  4AYB A;  4UCV A;  1E4F T;  1I94 H;  1Y1W A;  3HKZ A;  3T5K A;  4O3N A;  4IIJ F;  2XGP A;  1RK6 A;  3OHA A;  2W9B B;  2WYO A;  3L2P A;  4JI3 H;  3KTM A;  4ECW A;  1SYX B;  3HBL A;  4HQ6 A;  5FD5 A;  2P0A A;  2R7Z G;  2R84 A;  1CQJ B;  2CKZ B;  4UCU A;  3U9S A;  2W57 A;  4NZO A;  1A9X A;  2UU9 H;  5LYJ F;  2SCU B;  4FFM A;  2Y0S E;  4JI6 H;  4F4Z A;  2R93 G;  3UYY A;  2IA6 A;  5KT7 A;  4J0M A;  2YS7 A;  5A2Q W;  4DUY H;  3T9C A;  2FPI B;  3HB9 A;  2FB9 A;  1FVI A;  2ODT X;  4RAY A;  5DQH A;  3RF2 A;  3BG5 A;  3Q1K A;  2HVS A;  2M05 A;  3H4D A;  2CZG A;  4J9M A;  2W9C A;  2UVW A;  2O03 A;  3RV3 A;  5BPF A;  2JA6 G;  4O4I F;  3BAC A;  3J7A K;  5T14 A;  3BA9 A;  2YZM A;  4QSH A;  4QIW A;  4R8U B;  4F4Y A;  4I50 F;  4PBC A;  3GID A;  4IR9 A;  1DAA A;  1JKJ B;  2AU0 A;  4GLW A;  5C44 G;  4YAJ B;  5DGI A;  1WCM G;  2E5L H;  5IT9 W;  4DL6 A;  1IYD A;  1V9P A;  3J81 W;  1Z2P X;  1ZAU A;  2YS6 A;  1V51 A;  4O84 A;  2KSW A;  5IYD G;  3T1Y H;  2FPG B;  1KJ9 A;  3T9F A;  2XCA A;  3H3V H;  3OSN A;  2V58 A;  1V4Y A;  3I4M G;  5KT5 A;  1BGW A;  2YZG A;  1EHI A;  5I5T A;  3QQM A;  3WO1 A;  1BJT A;  1S0M A;  4O7V A;  2VA3 A;  2I8C A;  4WBN F;  1GYF A;  1GGO A;  1BNC A;  1FKA H;  2VUG A;  3R5X A;  3RB4 A;  1HR0 H;  1KJ8 A;  1T94 A;  2WTF A;  4YJ2 F;  3W1B A;  2PN1 A;  3BQ0 A;  4HNV A;  4LF5 H;  4BY7 G;  5CE8 A;  1N36 H;  1ZET A;  4OX9 H;  2R7Z A;  2ZDQ A;  1EUD B;  4IZO A;  5D8D A;  3T9B A;  2W9B A;  3JAM W;  3W5O A;  4GC7 A;  2ABJ A;  4LFC H;  5KFF A;  5DLG A;  4Q43 A;  4DR2 H;  4DR3 H;  2UVU A;  4FE2 A;  1DIK A;  5C3E G;  4DR7 H;  1KUT A;  3DTF A;  3QFF A;  3Q2O A;  3WWH A;  4E6N A;  3ETJ A;  4HNU A;  2ZDG A;  4B3M H;  3UQ8 A;  4O7S A;  4MTD A;  4FS2 A;  3TW7 A;  2ASL A;  2HVQ A;  4UCT A;  3HT5 A;  3M9N B;  4DV6 H;  1UC8 A;  3JZ6 A;  4TQS A;  3G6V A;  4DV3 H;  2R7M A;  4RU9 A;  1VS0 A;  4ECX A;  3T1H H;  2R82 A;  4FS1 A;  4GKJ H;  2JEI A;  3SE7 A;  4EFE A;  4A2A A;  2YWV A;  2RDJ A;  4UFZ A;  1CQI B;  3DF7 A;  4FBU A;  1M0W A;  2YZN A;  1TWC A;  2WE6 A;  3H20 A;  4J9L A;  4MV6 A;  4DV1 H;  4ED0 A;  1S68 A;  3GTJ A;  2XCP A;  4A3I G;  4RB0 A;  3GIQ A;  1EKV A;  3SI8 A;  3RB6 A;  4JI4 H;  4RZQ A;  3H40 A;  1KT8 A;  2W6M A;  4DLK A;  4A3L G;  4XZ3 B;  2GQR A;  3KHR A;  4ZI7 F;  2NU9 B;  2JA6 A;  2RGV A;  2AQ4 A;  3MR6 A;  4CHI A;  5KFC A;  4O3P A;  3TY8 A;  3BAA A;  4DQN A;  3OSP A;  5KT4 A;  1Y14 B;  2NU8 B;  5KFK A;  2HIV A;  1K83 A;  5D1O B;  2R92 A;  4A3E G;  4M0J A;  4TV8 F;  3LML A;  5DG8 A;  4RZR A;  5L1J A;  3CEB A;  4UCO A;  2YU9 A;  1S0N A;  4U7C A;  1AUV A;  5JQG F;  1DV2 A;  3RBE A;  1I7L A;  2FPP B;  3KHL A;  2C2D A;  1KBL A;  1W93 A;  4ED3 A;  5CM0 A;  5KFL A;  3GDE A;  2IMW P;  3MWE A;  3IN5 A;  5KFG A;  3AX6 A;  2JA5 G;  4O7Y A;  4RNN A;  2B63 A;  4Q4D A;  1DV1 A;  3N40 P;  3KHG A;  2WDT A;  3R9R A;  4ED8 A;  3GTM A;  2NVX A;  4O81 A;  2UUC H;  1IOW A;  2CFM A;  2E2H A;  3JZI A;  3R5F A;  1R9T A;  4MV4 A;  5KFX A;  4NYE A;  5KFQ A;  3QZ8 A;  1A0G A;  5LA6 F;  2DIK A;  3LWB A;  1O75 A;  4O3O A;  4IR1 A;  3FDS A;  2YW2 A;  5JQW A;  1WCM A;  5FLM G;  2R8H A;  4ECV A;  2Q7D A;  2FMA A;  3KRE A;  4ED1 A;  3EYY A;  4X62 H;  5KG0 A;  4MTE A;  2FE3 A;  1B6R A;  5KT2 A;  3E5N A;  2DZD A;  4C5C A;  2WB1 A;  4BY1 G;  3GV8 B;  3PVX A;  3PW7 A;  1S9F A;  4O7N A;  4YAK B;  3NUA A;  3VPD A;  3VA7 A;  4J9K A;  4IRC A;  1I7N A;  4DR4 H;  4Q4C A;  4C2M A;  5C1O A;  5JH7 F;  3T7A A;  3KXY T;  3T5H A;  5FD6 A;  1WR2 A;  3SGI A;  3I12 A;  3GIK A;  3GV7 B;  2Y0S A;  3VOT A;  2UVR A;  1GSH A;  1I2L A;  3HO8 A;  1X9N A;  5IYB G;  5HBR B;  3TIG A;  3R23 A;  3U54 A;  4Q8F A;  2GPW A;  4O4L F;  4JV1 A;  2VPQ A;  1XNR H;  4F4X A;  3FMA A;  4FGR A;  1I50 A;  2YRX A;  3N8D A;  5DAA A;  1TA8 A;  5H80 A;  1C3O A;  4A3M G;  4TVI A;  2AGO A;  1GSA A;  1EKP A;  5KG2 A;  4FBT A;  1JDB B;  4DL3 A;  2RF4 A;  5C4X G;  3RGX A;  1ET0 A;  5GON F;  4PZ6 A;  4DV2 H;  2V59 A;  1KJI A;  1JX4 A;  4O3S A;  2EJ3 A;  3V4Z A;  3G6Y A;  5DGA A;  5CA0 F;  3M9M B;  1TAE A;  4CKE A;  1KJQ A;  2MCT A;  3PN1 A;  4O2A F;  2EJ2 A;  5KT6 A;  4YBZ B;  3PR5 B;  4O7Z A;  2HIX A;  4LH6 A;  5KFT A;  3K3P A;  3V4S A;  4WD3 A;  4BBR G;  5FLX W;  4FFR A;  2C2E A;  3NBZ B;  4YY3 H;  5KFD A;  4M9U A;  5DLF A;  5BPH A;  4A2B A;  1CKN A;  2VQF H;  5BWU A;  5EZY F;  1VKZ A;  5J2U F;  4LF6 H;  1RK5 A;  5BYA A;  3KAL A;  4MV1 A;  3GTO A;  4LF7 H;  1VBH A;  3JZF A;  5KFM A;  5DG9 A;  4EBD A;  3V6H A;  2J6S A;  3WWI A;  1EUC B;  2C28 A;  4LSA A;  2UXC H;  1SCU B;  2ZGI A;  4TQR A;  3M4I A;  4JI1 H;  1S10 A;  5HV6 A;  3RB3 A;  3JSL A;  5I5V A;  1KJJ A;  5EWF A;  4JYA H;  1PX2 A;  4QW9 A;  3T5J A;  2X5R A;  4B3R H;  5KG3 A;  3C0F B;  4DR5 H;  1A48 A;  3K5I A;  5C1P A;  4YHH H;  2ATL A;  4DV4 H;  4O7L A;  4QWA A;  5LMU H;  4LFA H;  2B63 G;  2Q2U A;  2XIG A;  1ZQ7 A;  4FFN A;  5K3W A;  5DGH A;  1CE8 A;  3LP8 A;  4ED7 A;  3CSW A;  5JVD F;  1XMO H;  1IBK H;  4O7T A;  3ETH A;  5EWG A;  1CKO A;  5I5X A;  5DG7 A;  5KFV A;  2DAA A;  4IRD A;  5IYZ F;  1KTA A;  3PR4 A;  2BQ3 A;  4IWY A;  1JLL B;  2VR1 A;  5KG5 A;  2BQR A;  1I1M A;  3W1G A;  2HDK A;  3KHH A;  1XK5 A;  3QWU A;  1WSC A;  1VAJ A;  4J9R A;  1T36 A;  4UCS A;  5KS8 A;  1RJR A;  3EPG A;  1S0O A;  1HNZ H;  2UUB H;  3Q8R B;  4FFL A;  3WWJ A;  1I1K A;  5DMX A;  2W8L A;  3G8D A;  4MV9 A;  4CKB A;  3I4N G;  2XD4 A;  3VNN A;  4MV3 A;  5KFA A;  4RB2 C;  1IYE A;  3GII A;  2W6Z A;  5L1L A;  4RCN A;  5LOV F;  2J6U A;  5FNV F;  2CW7 A;  1CS0 A;  2W8K A;  3HOW G;  3MR2 A;  2R86 A;  3G6X A;  2ALZ A;  2YCH A;  5DIS C;  1RYS A;  3BJY A;  2I87 A;  5HNE A;  2FK2 A;  3UZO A;  4HN2 A;  4Y8V B;  1B33 N;  3Q8S B;  4K0K H;  2CW8 A;  1ZHS A;  4CE5 A;  4YR0 A;  1XMQ H;  2NUA B;  2DPJ A;  1K1Q A;  1EYZ A;  3MWD A;  4IHJ F;  4YB8 B;  2ASD A;  2XGQ A;  2VQD A;  1HNX H;  1P16 A;  3RGZ A;  4RUA A;  1B6S A;  3FKI G;  4MV7 A;  3SNO A;  1E4E A;  4DAA A;  2NU7 B;  4R7R A;  2IBK A;  4Q45 A;  2RDI A;  3GTP A;  4RB3 C;  4QWC A;  3GIJ A;  1K1S A;  4A93 G;  3ORR A;  4ZHQ F;  2UUA H;  4YQW A;  1M7J A;  3BQ1 A;  1IOV A;  1KEE A;  3NC0 B;  5KFI A;  1AN7 A;  2VUM A;  5FPO A;  3OUU A;  2JA7 G;  2COJ A;  4DV5 H;  4JI0 H;  4I55 F;  1Y1W G;  1IBL H;  2W6N A;  5L1I A;  1IBM H;  3Q8Q B;  4A3J G;  5CR5 A;  1N33 H;  4FU0 A;  2R7L A;  5CB4 F;  5KG4 A;  5KFO A;  4R8U A;  3UZB A;  5KT3 A;  4ECY A;  2DLN A;  1S03 G;  3T9A A;  3HOV G;  5F9L A;  3CVZ A;  2EIY A;  2Z02 A;  1G2W A;  3RV4 A;  3VPC A;  4JUZ A;  3T54 A;  2W7O A;  3JRX A;  4B3S H;  4X64 H;  2HHF B;  2WB1 E;  5LL6 b;  4ZQI A;  3TQT A;  4QWD A;  4XYM B;  1BXR A;  3BAB A;  3JRW A;  4LH7 A;  4GLX A;  3N6X A;  3DAA A;  4I7H A;  3M9O B;  4LF9 H;  3RAX A;  4EYI B;  1I6U A;  5LXT F;  3TY9 A;  2AGQ A;  4QJF A;  1Y1V A;  2IP4 A;  5I5W A;  1A0I A;  4NZM A;  4MAM A;  2R6F A;  4MA0 A;  2OLS A;  5JUM A;  4UUG A;  5BR8 H;  4ETS A;  1I2K A;  2R8G A;  4NXM H;  4A3D G;  4LF8 H;  2V4Q A;  3CQZ A;  4E4T A;  4DUZ H;  4JV2 A;  4K6N A;  3TY5 A;  1I3Q A;  1EKF A;  4FFO A;  5D1O A;  2R93 A;  5J2T F;  3TQ1 A;  1Z2N X;  5BWW A;  3H0G A;  4DL5 A;  1S97 A;  4J9N A;  4MA5 A;  5BWV A;  4PWQ A;  2YYA A;  2JA8 G;  2UXD H;  4X65 H;  4CMD A;  2CNQ A;  5KG6 A;  5KFB A;  3PW4 A;  4YR2 A;  3PW2 A;  4Q44 A;  4LF4 H;  3HOY G;  4DIM A;  4O7W A;  5KG1 A;  4JV0 A;  4GKK H;  1WH2 A;  2QF7 A;  5EOY A;  4O82 A;  4ECZ A;  3PW5 A;  3RTX A;  2C35 B;  4J9O A;  4HYK A;  1WRV A;  5KFW A;  2PMZ A;  2C22 A;  1UC9 A;  3OTO H;  5FPR A;  1EZ1 A;  3V6K A;  4ECR A;  3RR5 A;  4B3T H;  1B04 A;  4AYB E;  1T3N A;  3N44 B;  2PBZ A;  4CC5 A;  3RIZ A;  5IP9 G;  5BYB A;  4C5A A;  4DRF A;  4J9S A;  4F50 A;  4EQ5 A;  1KC7 A;  3MR5 A;  3V6J A;  3MWM A;  2JA5 A;  1I1L A;  2DWC A;  3QZ7 A;  3BA8 A;  4TM5 A;  2FLL A;  2R7K A;  1AUX A;  1M6V A;  4DL4 A;  3KYH C;  4O86 A;  4UCR A;  1SEI A;  4A3F G;  2WAQ E;  3NGD A;  2YZL A;  4O2B F;  1OWT A;  3HKZ E;  5KFS A;  1N48 A;  4QWB A;  2C2R A;  5F9N A;  2COI A;  2E2I A;  4JI5 H;  2X0S A;  1UNN C;  4J9P A;  2W6P A;  1SFO A;  2VA2 A;  2VOB A;  2W7P A;  5IWA H;  3GIM A;  4ECS A;  2Q2T A;  3R5H A;  1TWG A;  3UFX B;  3J80 W;  3TW6 A;  4YP3 A;  4DV0 H;  3MJF A;  2HVR A;  2ASJ A;  1N34 H;  4NZN A;  2DPI A;  5L9X A;  5EWE A;  2V9W A;  4PZ8 A;  5C5J A;  2Y4R A;  4WHX A;  1CKM A;  5KFR A;  4DL2 A;  2FLP A;  4YR3 A;  3GB8 B;  2HGW A;  1Y1V G;  4A3K G;  1GO3 E;  3GIP A;  2PMZ E;  2A1H A;  4ECT A;  1VBG A;  2VUM G;  4KHP H;  3H0G G;  4ZOL F;  5DQG A;  5D1P A;  1GSO A;  1CKN B;  4BXX G;  2NU6 B;  2BR0 A;  2JEF A;  4PZ7 A;  1MZB A;  4F4W A;  1XDN A;  2J6T A;  4CKC A;  2FLN A;  5BMV F;  4ECU A;  3GTL A;  3HXL A;  1OBG A;  5KX5 F;  5L1K A;  2W6O A;  2W9A A;  2JEJ A;  3JSN A;  1JDE A;  1M0T A;  5I60 A;  2W70 A;  1TWH A;  5KFJ A;  1A3G A;  3U55 A;  1TWA A;  2W9C B;  4RNM A;  2V4R A;  4A3C G;  1GLV A;  4L1K A;  4PDB A;  5BWR A;  2UVV A;  2VPS A;  4G3I A;  2YRW A;  1PK8 A;  2W71 A;  3T9D A;  2CQY A;  2XC9 A;  3OUZ A;  2NVY A;  4CMF A;  4QWE A;  5IYC G;  4YJ3 F;  2BQU A;  1FJG H;  3HOZ G;  2R85 A;  3KAJ A;  4JXU A;  2J9G A;  4TV9 F;  5KFN A;  2FK3 A;  1J5E H;  3GTG A;  3G8C A;  4QIW E;  2VQE H;  3N41 B;  1DGS A;  3MFI A;  4JV5 H;  2Z04 A;  4EBE A;  2GQS A;  3PO2 G;  4FFP A;  3RJ0 A;  3K5H A;  3LUL A; 
#chains in the Genus database with same CATH homology
 5I47 A;  4IWX A;  3ORQ A;  3TIN A;  2HJW A;  1ULZ A;  2YL2 A;  2PVP A;  2ZDH A;  5K2M A;  3KAK A;  2HGS A;  2R7N A;  4I4T F;  3VPB A;  4O4J F;  4MV8 A;  2C00 A;  4XX0 B;  5JVL A;  2FP4 B;  3RFC A;  2QK4 A;  1OBD A;  2R87 A;  4HR7 A;  3U9T A;  3WO0 A;  4O4H F;  2V5A A;  4C5B A;  2CNV A;  4EGQ A;  1C30 A;  2CNU A;  3WNZ A;  1Z2O X;  3AW8 A;  5CA1 F;  3TII A;  3GLK A;  5C8Y F;  4O83 A;  5LP6 F;  4O7R A;  1W96 A;  4HNT A;  5CAE B;  3RUP A;  2XCL A;  4TUY F;  4XYL B;  3VMM A;  2I80 A;  4EGJ A;  4EG0 A;  3N6R A;  2GPS A;  2GLT A;  4ME6 A;  5KKN B;  2W6Q A;  1E4E B;  4IIJ F;  2WYO A;  3HBL A;  4HQ6 A;  2P0A A;  2R84 A;  1CQJ B;  3U9S A;  1A9X A;  5LYJ F;  2SCU B;  4FFM A;  2YS7 A;  2FPI B;  3HB9 A;  2FB9 A;  3BG5 A;  3Q1K A;  2CZG A;  3RV3 A;  5BPF A;  4O4I F;  2YZM A;  4QSH A;  4I50 F;  3GID A;  1JKJ B;  4YAJ B;  1Z2P X;  2YS6 A;  4O84 A;  2FPG B;  1KJ9 A;  2V58 A;  2YZG A;  1EHI A;  3WO1 A;  4O7V A;  2I8C A;  4WBN F;  1GGO A;  1BNC A;  3R5X A;  1KJ8 A;  4YJ2 F;  2PN1 A;  4HNV A;  2ZDQ A;  1EUD B;  4IZO A;  5D8D A;  4FE2 A;  1DIK A;  1KUT A;  3QFF A;  3Q2O A;  3ETJ A;  4HNU A;  2ZDG A;  4O7S A;  1UC8 A;  2R7M A;  2R82 A;  3SE7 A;  2YWV A;  1CQI B;  3DF7 A;  1M0W A;  2YZN A;  4MV6 A;  4RZQ A;  2W6M A;  4DLK A;  4XZ3 B;  2GQR A;  4ZI7 F;  2NU9 B;  2NU8 B;  4TV8 F;  1AUV A;  5JQG F;  1DV2 A;  1I7L A;  2FPP B;  1KBL A;  1W93 A;  3MWE A;  3AX6 A;  4O7Y A;  1DV1 A;  3R9R A;  4O81 A;  1IOW A;  3JZI A;  3R5F A;  4MV4 A;  4NYE A;  5LA6 F;  2DIK A;  3LWB A;  2YW2 A;  5JQW A;  3KRE A;  1B6R A;  3E5N A;  2DZD A;  4C5C A;  4O7N A;  4YAK B;  3NUA A;  3VPD A;  3VA7 A;  1I7N A;  5C1O A;  5JH7 F;  1WR2 A;  3I12 A;  3VOT A;  1GSH A;  3HO8 A;  3TIG A;  5HBR B;  3R23 A;  3U54 A;  2GPW A;  4O4L F;  2VPQ A;  4FGR A;  2YRX A;  3N8D A;  5H80 A;  1C3O A;  1GSA A;  1JDB B;  5GON F;  2V59 A;  1KJI A;  3V4Z A;  5CA0 F;  1KJQ A;  4O2A F;  4YBZ B;  4O7Z A;  3K3P A;  3V4S A;  4WD3 A;  4FFR A;  4M9U A;  5BPH A;  5EZY F;  1VKZ A;  5J2U F;  3KAL A;  4MV1 A;  1VBH A;  3JZF A;  1EUC B;  1SCU B;  5HV6 A;  1KJJ A;  1PX2 A;  1A48 A;  3K5I A;  5C1P A;  4O7L A;  4FFN A;  1CE8 A;  3LP8 A;  5JVD F;  4O7T A;  3ETH A;  5IYZ F;  4IWY A;  1JLL B;  2VR1 A;  1T36 A;  4FFL A;  5DMX A;  3G8D A;  4MV9 A;  2XD4 A;  4MV3 A;  2W6Z A;  5LOV F;  5FNV F;  1CS0 A;  2R86 A;  2I87 A;  4Y8V B;  2NUA B;  1EYZ A;  3MWD A;  4IHJ F;  4YB8 B;  2VQD A;  1B6S A;  4MV7 A;  1E4E A;  2NU7 B;  3ORR A;  4ZHQ F;  1IOV A;  1KEE A;  3OUU A;  4I55 F;  2W6N A;  4FU0 A;  2R7L A;  5CB4 F;  2DLN A;  2Z02 A;  3VPC A;  3RV4 A;  3JRX A;  4ZQI A;  3TQT A;  4XYM B;  1BXR A;  3JRW A;  5LXT F;  2IP4 A;  4MAM A;  2R6F A;  4MA0 A;  2OLS A;  4E4T A;  4FFO A;  5J2T F;  1Z2N X;  4MA5 A;  2YYA A;  2CNQ A;  4DIM A;  4O7W A;  2QF7 A;  4O82 A;  1UC9 A;  1EZ1 A;  2PBZ A;  4C5A A;  1KC7 A;  2DWC A;  2R7K A;  1AUX A;  1M6V A;  4O86 A;  2YZL A;  4O2B F;  2X0S A;  2W6P A;  3R5H A;  3UFX B;  3TW6 A;  3MJF A;  1VBG A;  4ZOL F;  1GSO A;  2NU6 B;  5BMV F;  1OBG A;  5KX5 F;  2W6O A;  2W70 A;  1JDE A;  1M0T A;  3U55 A;  1GLV A;  4L1K A;  2YRW A;  1PK8 A;  2W71 A;  2CQY A;  3OUZ A;  4YJ3 F;  2R85 A;  3KAJ A;  2J9G A;  4TV9 F;  3G8C A;  2Z04 A;  2GQS A;  4FFP A;  3K5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...