4YAKB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, acetyl-coenzyme a and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yakB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yakB02
3LP8A 4O7YA 1VBHA 4EGQA 1AUVA 3QFFA 2FPGB 3ORQA 3U9SA 2NUAB 2Z02A 2PBZA 1GLVA 3RV3A 3R5FA 3VA7A 3WO1A 3N8DA 2C00A 1OBDA 2ZDQA 1KEEA 4MAMA 5J2UF 2VR1A 5C1PA 4FE2A 3UFXB 3E5NA 2YYAA 5FNVF 3R5XA 3OUZA 4FFOA 3RFCA 4O81A 4O4JF 2QK4A 1IOVA 3G8CA 4C5CA 2W71A 2YZGA 5C8YF 4EG0A 2YZNA 4O83A 2YW2A 2SCUB 4FFPA 1WR2A 2ZDGA 2GQRA 4IZOA 5KX5F 1BXRA 3AX6A 5JVLA 4FFLA 4O4HF 1JLLB 1IOWA 5CB4F 1CE8A 5I47A 1PK8A 4MV9A 4ZHQF 5J2TF 1UC8A 2OLSA 1I7LA 2X0SA 2W6OA 3R23A 3KAKA 3NUAA 2GLTA 1M6VA 2Z04A 3R9RA 4O2BF 1EUCB 3MWDA 5BPHA 1Z2PX 4C5BA 1Z2OX 1PX2A 5JH7F 1KJIA 4MV7A 2YRWA 1I7NA 4WBNF 1ULZA 4FFMA 2CQYA 1GSHA 4L1KA 1B6RA 3KALA 2FB9A 2W70A 4O7WA 1KC7A 3VMMA 5LXTF 1VBGA 4O7SA 3WNZA 2DZDA 1DV2A 2V5AA 2NU9B 3DF7A 4YAJB 2W6ZA 3V4ZA 4O4LF 5LOVF 3ETJA 5EZYF 1W96A 1SCUB 5GONF 2YZMA 4HR7A 3G8DA 1KUTA 3GLKA 4FU0A 4HNVA 3KAJA 4Y8VB 5JQGF 3MJFA 2I80A 5KKNB 1AUXA 1C3OA 5BMVF 4MV1A 2V59A 2I87A 5LA6F 3TIIA 1B6SA 4MV8A 3VPCA 2HGSA 4I4TF 1JDEA 2YL2A 3SE7A 4XZ3B 4FFRA 2YZLA 1CS0A 4ME6A 4FGRA 2DLNA 3VPDA 5C1OA 2GQSA 3WO0A 4O4IF 1KJ9A 4O7TA 1BNCA 3VOTA 4RZQA 5BPFA 1KBLA 4O7ZA 5H80A 2R86A 2DWCA 4O7VA 4O7NA 4XYMB 2J9GA 4I55F 3U54A 3KREA 2W6NA 5JVDF 3AW8A 2CNUA 5HBRB 2R7KA 4IWXA 3HO8A 2XCLA 1OBGA 3I12A 3HB9A 1E4EA 5K2MA 4YB8B 5HV6A 5D8DA 1GSOA 1CQJB 4O7RA 4TV8F 3RV4A 4XX0B 3K5HA 2FP4B 4NYEA 4WD3A 5IYZF 3JZFA 4O2AF 2WYOA 5DMXA 3HBLA 2PN1A 2CZGA 2HJWA 3TIGA 1T36A 3TINA 1JKJB 4TV9F 2R82A 4IIJF 2ZDHA 3LWBA 1KJQA 2NU8B 1VKZA 1GSAA 4HQ6A 5LYJF 3ETHA 2R7NA 2CNVA 1E4EB 3Q1KA 4IWYA 1A9XA 2VPQA 1A48A 2YS7A 4MV4A 4MA5A 4XYLB 4ZQIA 3JRXA 1W93A 4FFNA 4ZOLF 2R87A 4QSHA 4EGJA 1DIKA 2NU6B 1GGOA 4M9UA 4O84A 2R84A 2R85A 5LP6F 4ZI7F 3TW6A 3TQTA 3V4SA 1KJ8A 1M0WA 2R7LA 4O82A 2R6FA 3OUUA 2VQDA 2R7MA 4I50F 3BG5A 5CAEB 3R5HA 2XD4A 4O7LA 4DLKA 2DIKA 4DIMA 2FPPB 4MA0A 4YJ2F 3RUPA 4HNTA 1C30A 1DV1A 3U9TA 2W6QA 2I8CA 3JRWA 2YRXA 5CA0F 2QF7A 3K3PA 3N6RA 4MV6A 1Z2NX 3Q2OA 3VPBA 2NU7B 2CNQA 3JZIA 2YS6A 3GIDA 1KJJA 2IP4A 4C5AA 1EHIA 1EZ1A 5JQWA 1CQIB 1UC9A 4YJ3F 4E4TA 2PVPA 4O86A 2W6PA 3MWEA 4IHJF 3ORRA 5CA1F 3U55A 3K5IA 1EUDB 2P0AA 1EYZA 4YBZB 2FPIB 2YWVA 4TUYF 2W6MA 1JDBB 2V58A 4HNUA 4MV3A 2GPWA 1M0TA 4YAKB 2GPSA
chains in the Genus database with same CATH superfamily
3NC0B 5I5YA 1Y1VA 1A0GA 4WHXA 4O3SA 4LF9H 3DTFA 1TAEA 3LP8A 3N6XA 4X62H 4O7YA 3SI8A 4EFEA 5KG6A 1VBHA 5L1LA 4EGQA 4LF8H 2W7OA 4RAZA 4A3CG 4PWQA 2RDIA 4J9SA 3G6VA 1AUVA 3T5HA 3QFFA 4RNNA 5CM0A 3HOVG 2FPGB 3ORQA 3U9SA 2NUAB 5DAAA 4IAJA 2R92G 2Z02A 2PBZA 1I94H 1CKNA 4JYAH 5KFDA 4U6PA 1GLVA 3RV3A 1X9NA 5DG8A 3Q8RB 4ED3A 4LFBH 3R5FA 1EKFA 3VA7A 3RIZA 5KFKA 3WO1A 3RB6A 3N8DA 4RB1A 2JEFA 2C00A 2KSWA 2VUMA 5KT7A 4EBEA 2IMWP 2OWOA 2WB1A 5KFYA 5CE8A 1M7JA 3JAMW 4LF6H 2J6TA 5IT9W 1OBDA 5F9LA 2J6SA 2ZDQA 3IG0A 2HVQA 3G6YA 3N42B 1UNNC 3T5JA 1N32H 1G2WA 1KEEA 1XNQH 4MAMA 2ASJA 3T9DA 2FLNA 5J2UF 3HKZE 2VR1A 5C1PA 4FE2A 2Y0SE 3UFXB 3E5NA 2YYAA 4DQNA 2M05A 5BWUA 4RNOA 5FNVF 3R5XA 3EPIA 1S0NA 1HR0H 2VUMG 1CKOA 3OUZA 4FFOA 2E2IA 3RFCA 5F9NA 4O81A 2JA6G 4ETSA 4DL5A 3GTKA 4DRFA 2BQRA 4YP3A 3C0FB 1I3QA 2IA6A 4O4JF 4LH6A 1DGSA 3KHRA 4DV3H 2R8JA 1ZETA 1Y1WG 2QK4A 1IOVA 3G8CA 3QQMA 4F4WA 2PMZA 1HNZH 1N34H 4JI5H 2UXBH 1O75A 3FKIG 4C5CA 5BWTA 4DL2A 2W71A 2ASDA 5KFRA 4J0MA 2YZGA 5C8YF 4EG0A 1XDNA 2YZNA 4O83A 2YW2A 2HGWA 4PZ8A 5KFUA 3M9MB 2W8LA 2AU0A 2SCUB 4FFPA 4JI2H 1WR2A 4ED7A 2AGPA 3MWMA 2ZDGA 3H20A 2GQRA 4IZOA 5C44G 4ED8A 2JA7A 4BBRG 5KX5F 4DV7H 1SFOA 1R9TA 1BXRA 2UVRA 4DL6A 3AX6A 4AYBE 4A3IG 4QIWE 3PO2G 5JVLA 5IP9G 5KG2A 2UXCH 4MTDA 4FFLA 2YCHA 4DUZH 3RBDA 4GLWA 3TEKA 5DG7A 4O4HF 1JLLB 2W9CA 3GTQA 3BAAA 5DGHA 5DGIA 1IOWA 3BA8A 2DABA 5CB4F 1CE8A 5I47A 1GO3E 5DGAA 3GB8B 3RTXA 1PK8A 4MV9A 4ZHQF 3UQ8A 4LFAH 5J2TF 3H3VH 4ECXA 4LFCH 5EWEA 1UC8A 5BYAA 1JIHA 2FJZA 5IP7G 5KG4A 4DV4H 2OLSA 4X65H 1I7LA 4DR5H 4YR3A 5IYCG 4ECVA 2X0SA 5KG3A 2W6OA 4M0JA 3R23A 5KG5A 3GV5B 3KAKA 3NUAA 4RB3C 3OHBA 3EPGA 3T1YH 4FM9A 1WSCA 2GLTA 2DPIA 4A3LG 1M6VA 2Z04A 3R9RA 3CSWA 1RJPA 1JXLA 4RZRA 1P16A 5BR8H 3HXLA 3GJXB 3J81W 4DV6H 4EYHB 3GTMA 2W8KA 4O2BF 1EUCB 3MWDA 5BPHA 3N43B 3OSPA 4R8UA 2DPJA 1Z2PX 4C5BA 1Z2OX 1PX2A 5JH7F 1KJIA 4Q4DA 1XMQH 3NGDA 1N56A 4MV7A 2YRWA 4RB0A 5LL6b 1I7NA 4WBNF 1SEIA 3PO3G 4YQWA 3M9NB 3M9OB 3N44B 1ULZA 4FS1A 2ZJTA 3V6KA 5KFMA 4LSAA 2BQ3A 2MCTA 4J9KA 4FFMA 2NVYA 2R93G 4DR2H 3T54A 2FK3A 1BGWA 3H0GG 4DV2H 2X5RA 2CQYA 4X64H 4EYIB 1IYEA 2VOBA 3N40P 5FJ8G 3GIIA 2C35B 1GSHA 4HYKA 4L1KA 1T3NA 1I1LA 1V51A 5KFTA 1K1QA 3QWUA 1B6RA 3KALA 2Q2UA 3KXYT 4A3GG 2FB9A 2W70A 4ED1A 2C22A 3GTLA 4O7WA 1KC7A 3VMMA 4YR0A 3GIPA 2ABJA 1FJGH 5LXTF 1RJRA 3PW5A 4LF5H 3HOXG 1RK6A 5EDWA 1VBGA 1Y1VG 2FLLA 4RCNA 4O7SA 3WNZA 5KFQA 2DZDA 1WRVA 3NBZB 3RB0A 1DV2A 2V5AA 1SYXB 4RUAA 2NU9B 2V4QA 4A3JG 4B3MH 3T99A 2WB1E 2HHHH 3T9AA 5KFZA 1E4FT 3DF7A 4BBSG 4YAJB 3OSNA 1DAAA 3WWHA 2W6ZA 5DISC 4J9LA 5BYBA 3V4ZA 5A2QW 5KT3A 4EFBA 4O4LF 3GDEA 5LOVF 1TWGA 3ETJA 3L4JA 5EZYF 4TM5A 2UVWA 1V9PA 4LH7A 4UCUA 4Q44A 1W96A 3CEBA 1K83A 3GTJA 4R8UB 5HNEA 4J9NA 4JI3H 2AGQA 2XGPA 4K6NA 1SCUB 4Q45A 3J80W 3GILA 4EBDA 1I2LA 4TQSA 2C2RA 5GONF 1MZBA 2YZMA 3RF2A 5KG1A 2AGOA 3JSLA 4J9QA 3PW2A 4HR7A 3G8DA 1KUTA 2FK2A 2HHFB 3PN1A 3GLKA 2UXDH 1N48A 4E6NA 4O3OA 2BR0A 1IBLH 2VA2A 4FU0A 4BY1G 4CMFA 3GTGA 1TWCA 4HNVA 3MR6A 3KAJA 3TY9A 3UZOA 3UYYA 4Y8VB 4Q4CA 2E5LH 1N33H 4F4YA 3T9CA 5JQGF 3BJYA 1S0MA 3RAQA 2VA3A 3MJFA 1S97A 2CKZB 2I80A 5KKNB 4O3QA 3AYHB 4ECWA 2FE3A 1AUXA 1HNWH 1C3OA 3Q8QB 3N41B 5BMVF 5FR9A 4MV1A 5EWFA 1TWFA 1ET0A 4OX9H 4ED2A 2V59A 3DAAA 2I87A 5KFNA 3HOYG 5LA6F 3TIIA 4IR9A 1B6SA 4MV8A 4QWAA 4UFZA 3VPCA 2HGSA 2JA6A 2UVUA 4I4TF 3T5KA 4A3DG 3J7AK 1JDEA 2YL2A 3SE7A 2ODTX 4XZ3B 2UUAH 3HOZG 3BABA 4JXUA 3HKZA 4ECZA 4AQYH 4ECQA 1IBMH 1Y14B 4FFRA 2YZLA 1N36H 1CKNB 1CS0A 1I1KA 4O3NA 5KFVA 4LF4H 2JA7G 4M7EA 4ME6A 4C2MA 2R7ZA 1CKMA 2COIA 4FGRA 2DLNA 3TY5A 3VPDA 5KFLA 5KT4A 3GQCA 5KFBA 5DQHA 5C1OA 2GQSA 3WO0A 4RU9A 5KFPA 4O4IF 3T5LA 1KJ9A 1HNXH 4B3TH 5D1PA 4RB2C 5KFIA 4O7TA 2HIXA 4CC5A 1B04A 1RJQA 4O3PA 4YHHH 2ASLA 2B63A 1BNCA 5I5VA 5C5JA 1L2ZA 2EJ3A 2QYZA 5D1OA 5DQGA 5C3EG 3RBEA 4K0KH 3VOTA 3FDSA 4RZQA 5BPFA 1KBLA 5L1KA 2R8KA 2ATLA 1RK5A 5IYDG 1FVIA 4O7ZA 5FPRA 5H80A 2R86A 4F50A 2DWCA 4O7VA 4O7NA 5KFAA 5KT2A 3GIJA 1IYDA 3LMLA 2HDKA 2FKLA 1ZQ7A 3WWIA 4XYMB 3CVZA 4BXXG 2J9GA 1JX4A 2R8IA 2ZGIA 3RGXA 3MFHA 2WTFA 1WCMA 4I55F 3T9EA 4DR1H 2OH2A 4NZMA 4UCSA 2WAQA 3U54A 5KFEA 3KREA 3L4KA 2FK1A 2VQEH 3PZPA 2W6NA 5JVDF 1IBKH 4LF7H 2E2HA 3KHLA 5E25A 2DAAA 3AW8A 4I7HA 4DR6H 3H4DA 2CNUA 4F4ZA 5HBRB 2R7KA 4IWXA 1VAJA 3HO8A 1TWHA 3K3VA 5JUMA 5L9XA 5FLXW 2V4RA 4JV1A 5KFGA 1K1SA 1ZHQA 2RDJA 2WDTA 4JI7H 3H40A 3HB9A 2XCLA 1OBGA 3I12A 2Q7DA 1E4EA 2COGA 5K2MA 1GYFA 4YB8B 4PZ7A 5KG7A 4PBCA 3MR3A 2VPSA 3RAXA 1S9FA 5HV6A 2RF4A 3OHAA 2FLPA 5D8DA 1GSOA 1I1MA 5I5UA 1CQJB 5BWRA 4O7RA 4EEYA 4IRKA 4DR7H 2JEIA 4TV8F 2ZM6H 2W9AA 5DLFA 4DV5H 3RV4A 4XX0B 4B3RH 3CQZA 4QW9A 3K5HA 2RGRA 3L2PA 4A3BG 3PW0A 4CE5A 2FP4B 3QZ7A 4B3SH 2W9CB 3TW7A 4UCTA 4NYEA 5IWAH 2W57A 4ECSA 4WD3A 1T94A 3IN5A 4DL3A 1KT8A 5IYZF 4J9OA 3TQ1A 2R93A 3BA9A 4HN2A 3BQ0A 3W1GA 4JI0H 3JZFA 5KFWA 4O2AF 2WYOA 5DMXA 5I5WA 5EOYA 5KT6A 3I4MG 1E4GT 5KFHA 4X66H 3HBLA 2PN1A 3PW4A 2XCAA 2CW8A 4EQ5A 2COJA 2CZGA 1A0IA 5BWXA 1ZHSA 3M4IA 2NVXA 1TWAA 4BWSC 2HJWA 3KYHC 1T36A 3TIGA 1J5EH 5C4XG 3TINA 5KFFA 1JKJB 2W7PA 3GV7B 5KFOA 4TV9F 5LMUH 2R82A 1B33N 2EIYA 2ZDHA 3LWBA 4IIJF 4Q8EA 2V9WA 1KJQA 3PFFA 5EWGA 2NU8B 5KFSA 3SNOA 1VKZA 3MFIA 1A3GA 2JA5A 2O03A 1GSAA 4QWDA 3W1BA 1RYRA 4PZ6A 3SGIA 4HQ6A 5LYJF 4PDBA 3ETHA 5LMNH 2R92A 3NBYB 4Q43A 3H4BA 1S0OA 2R7NA 1VS0A 5FLMG 4A3FG 2CNVA 4JV2A 4APMA 3LULA 1P8LA 4LSXA 1E4EB 1BJTA 3Q1KA 2PMZE 2HGXA 4IWYA 3HOUG 4G3IA 3OTOH 1A9XA 2UVVA 2JA8G 4DR4H 2VPQA 3LQSA 4UCRA 3HT5A 2Q2TA 5DG9A 1A48A 4GC7A 2YS7A 2JEGA 4MV4A 5KFJA 2YU9A 3TY8A 4MA5A 4XYLB 4GLXA 4DV1H 4ZQIA 3JRXA 1W93A 2QB5A 3JZ6A 4FFNA 4YY3H 4ZOLF 5L1JA 2R87A 4A3EG 4IRDA 5I5XA 5DLGA 4QSHA 3BQ2A 3RB4A 3RJ0A 4EGJA 3V6JA 1DIKA 1KTAA 3U0GA 2NU6B 1GGOA 4M9UA 4O84A 4NXMH 2WE6A 2R84A 4CKBA 4JI8H 3UZBA 4U7CA 2R85A 2Y4RA 3Q8PB 3KHHA 2CFMA 5LP6F 4ZI7F 4NZOA 4A3MG 2IBKA 3GTPA 4F4XA 2R8GA 3W5OA 1XK5A 3TW6A 3TQTA 3QZ8A 3V4SA 2EJ0A 4JUZA 1KJ8A 3EYYA 5T14A 3BQ1A 4ECUA 4BY7G 3JSNA 1Y1WA 4DR3H 3DTGA 5CR5A 2FMAA 1M0WA 2R7LA 4O82A 1EKVA 3RB3A 1S03G 2Y0SA 4ED6A 3MR5A 5L1IA 1RYSA 3FKIA 4A3KG 2JA5G 2R6FA 3OUUA 4EEQA 5BWWA 2VQDA 5KT5A 2R7MA 1ZAUA 5I5SA 5KS8A 2R7ZG 4A2BA 4UCOA 2VUGA 4I50F 4RUCA 3KHGA 3BG5A 5CAEB 3R5HA 5KFXA 4RAYA 5DGBA 2W9BA 2BQUA 2C2EA 4TVIA 5I5TA 4CKCA 5I60A 2XD4A 4O7LA 2UU9H 4DLKA 4O3RA 4UCVA 2B63G 4DV0H 3FMAA 2DIKA 2F4VH 3GIKA 4MTEA 4QWBA 4DIMA 2FPPB 3GIMA 4RNMA 4MA0A 2R8HA 4CHIA 5FD6A 2EJ2A 5DQIA 4J9PA 4DL7A 1XMOH 4YJ2F 4NLGA 4DUYH 3T9BA 2WAQE 4FBUA 4GC6A 3RUPA 4HNTA 1C30A 3BACA 5FPOA 1DV1A 3U9TA 4FBTA 2W6QA 2I8CA 5K3WA 3JRWA 3T7AA 4A93G 4ED0A 2XCPA 3RGZA 2YRXA 3KTMA 3PR4A 5CA0F 2QF7A 3K3PA 3N6RA 3Q8SB 4MV6A 1WCMG 3PR5B 4AYBA 2XIGA 4QIWA 3I4NG 1WH2A 1Z2NX 2RGVA 3Q2OA 4J9MA 2ALZA 1EKPA 3S24A 2NU7B 3VPBA 2CNQA 4LMYA 2UUCH 2HVSA 3PW7A 1I6UA 1I50A 2HG8A 3JZIA 3VNNA 3RR5A 2C28A 2YS6A 2CW7A 2XGQA 4Q0YA 5KFCA 3GIDA 2UUBH 5BWVA 1KJJA 2IP4A 1OWTA 4ECTA 4ECRA 4GKKH 4QWEA 4UUGA 4C5AA 2JEJA 2HVRA 3GTOA 3MR2A 1I2KA 1EHIA 4CKEA 4TQRA 1EZ1A 1V4YA 5JQWA 5KG0A 4QWCA 1CQIB 1UC9A 4IR1A 3T9FA 3GV8B 4QJFA 4ECYA 1S68A 3T1HH 4YJ3F 1TA8A 4QW8A 4NZNA 3PVXA 4JI1H 5FD5A 1AN7A 3G6XA 4E4TA 3F8NA 4GKJH 2PVPA 4DL4A 4CMDA 4O86A 2W6PA 3MWEA 4IHJF 3ORRA 4R7RA 3HOWG 2HHFA 2XC9A 2W9BB 2A1HA 5CA1F 4CC6A 4KHPH 4NXNH 3U55A 3H0GA 1FKAH 3K5IA 2J6UA 5D1OB 3GIQA 1EUDB 2P0AA 1EYZA 2VQFH 4YBZB 4DAAA 3WWJA 2FPIB 2YWVA 4YR2A 4TUYF 2HIVA 5IYBG 3V6HA 2W6MA 1S10A 4Q8FA 4JI4H 1JDBB 2V58A 4HNUA 4JI6H 4JV5H 1XNRH 2AQ4A 4FS2A 4EBCA 4MV3A 2GPWA 4JV0A 1M0TA 4A2AA 4IRCA 4YAKB 2C2DA 4J9RA 2GPSA
chains in the Genus database with same CATH topology
3LP8A 4O7YA 1VBHA 4EGQA 1AUVA 3QFFA 2FPGB 3ORQA 3U9SA 2NUAB 2Z02A 2PBZA 1GLVA 3RV3A 3R5FA 3VA7A 3WO1A 3N8DA 2C00A 1OBDA 2ZDQA 1KEEA 4MAMA 5J2UF 2VR1A 5C1PA 4FE2A 3UFXB 3E5NA 2YYAA 5FNVF 3R5XA 3OUZA 4FFOA 3RFCA 4O81A 4O4JF 2QK4A 1IOVA 3G8CA 4C5CA 2W71A 2YZGA 5C8YF 4EG0A 2YZNA 4O83A 2YW2A 2SCUB 4FFPA 1WR2A 2ZDGA 2GQRA 4IZOA 5KX5F 1BXRA 3AX6A 5JVLA 4FFLA 4O4HF 1JLLB 1IOWA 5CB4F 1CE8A 5I47A 1PK8A 4MV9A 4ZHQF 5J2TF 1UC8A 2OLSA 1I7LA 2X0SA 2W6OA 3R23A 3KAKA 3NUAA 2GLTA 1M6VA 2Z04A 3R9RA 4O2BF 1EUCB 3MWDA 5BPHA 1Z2PX 4C5BA 1Z2OX 1PX2A 5JH7F 1KJIA 4MV7A 2YRWA 1I7NA 4WBNF 1ULZA 4FFMA 2CQYA 1GSHA 4L1KA 1B6RA 3KALA 2FB9A 2W70A 4O7WA 1KC7A 3VMMA 5LXTF 1VBGA 4O7SA 3WNZA 2DZDA 1DV2A 2V5AA 2NU9B 3DF7A 4YAJB 2W6ZA 3V4ZA 4O4LF 5LOVF 3ETJA 5EZYF 1W96A 1SCUB 5GONF 2YZMA 4HR7A 3G8DA 1KUTA 3GLKA 4FU0A 4HNVA 3KAJA 4Y8VB 5JQGF 3MJFA 2I80A 5KKNB 1AUXA 1C3OA 5BMVF 4MV1A 2V59A 2I87A 5LA6F 3TIIA 1B6SA 4MV8A 3VPCA 2HGSA 4I4TF 1JDEA 2YL2A 3SE7A 4XZ3B 4FFRA 2YZLA 1CS0A 4ME6A 4FGRA 2DLNA 3VPDA 5C1OA 2GQSA 3WO0A 4O4IF 1KJ9A 4O7TA 1BNCA 3VOTA 4RZQA 5BPFA 1KBLA 4O7ZA 5H80A 2R86A 2DWCA 4O7VA 4O7NA 4XYMB 2J9GA 4I55F 3U54A 3KREA 2W6NA 5JVDF 3AW8A 2CNUA 5HBRB 2R7KA 4IWXA 3HO8A 2XCLA 1OBGA 3I12A 3HB9A 1E4EA 5K2MA 4YB8B 5HV6A 5D8DA 1GSOA 1CQJB 4O7RA 4TV8F 3RV4A 4XX0B 3K5HA 2FP4B 4NYEA 4WD3A 5IYZF 3JZFA 4O2AF 2WYOA 5DMXA 3HBLA 2PN1A 2CZGA 2HJWA 3TIGA 1T36A 3TINA 1JKJB 4TV9F 2R82A 4IIJF 2ZDHA 3LWBA 1KJQA 2NU8B 1VKZA 1GSAA 4HQ6A 5LYJF 3ETHA 2R7NA 2CNVA 1E4EB 3Q1KA 4IWYA 1A9XA 2VPQA 1A48A 2YS7A 4MV4A 4MA5A 4XYLB 4ZQIA 3JRXA 1W93A 4FFNA 4ZOLF 2R87A 4QSHA 4EGJA 1DIKA 2NU6B 1GGOA 4M9UA 4O84A 2R84A 2R85A 5LP6F 4ZI7F 3TW6A 3TQTA 3V4SA 1KJ8A 1M0WA 2R7LA 4O82A 2R6FA 3OUUA 2VQDA 2R7MA 4I50F 3BG5A 5CAEB 3R5HA 2XD4A 4O7LA 4DLKA 2DIKA 4DIMA 2FPPB 4MA0A 4YJ2F 3RUPA 4HNTA 1C30A 1DV1A 3U9TA 2W6QA 2I8CA 3JRWA 2YRXA 5CA0F 2QF7A 3K3PA 3N6RA 4MV6A 1Z2NX 3Q2OA 3VPBA 2NU7B 2CNQA 3JZIA 2YS6A 3GIDA 1KJJA 2IP4A 4C5AA 1EHIA 1EZ1A 5JQWA 1CQIB 1UC9A 4YJ3F 4E4TA 2PVPA 4O86A 2W6PA 3MWEA 4IHJF 3ORRA 5CA1F 3U55A 3K5IA 1EUDB 2P0AA 1EYZA 4YBZB 2FPIB 2YWVA 4TUYF 2W6MA 1JDBB 2V58A 4HNUA 4MV3A 2GPWA 1M0TA 4YAKB 2GPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP8 A;  4O7Y A;  1VBH A;  4EGQ A;  1AUV A;  3QFF A;  2FPG B;  3ORQ A;  3U9S A;  2NUA B;  2Z02 A;  2PBZ A;  1GLV A;  3RV3 A;  3R5F A;  3VA7 A;  3WO1 A;  3N8D A;  2C00 A;  1OBD A;  2ZDQ A;  1KEE A;  4MAM A;  5J2U F;  2VR1 A;  5C1P A;  4FE2 A;  3UFX B;  3E5N A;  2YYA A;  5FNV F;  3R5X A;  3OUZ A;  4FFO A;  3RFC A;  4O81 A;  4O4J F;  2QK4 A;  1IOV A;  3G8C A;  4C5C A;  2W71 A;  2YZG A;  5C8Y F;  4EG0 A;  2YZN A;  4O83 A;  2YW2 A;  2SCU B;  4FFP A;  1WR2 A;  2ZDG A;  2GQR A;  4IZO A;  5KX5 F;  1BXR A;  3AX6 A;  5JVL A;  4FFL A;  4O4H F;  1JLL B;  1IOW A;  5CB4 F;  1CE8 A;  5I47 A;  1PK8 A;  4MV9 A;  4ZHQ F;  5J2T F;  1UC8 A;  2OLS A;  1I7L A;  2X0S A;  2W6O A;  3R23 A;  3KAK A;  3NUA A;  2GLT A;  1M6V A;  2Z04 A;  3R9R A;  4O2B F;  1EUC B;  3MWD A;  5BPH A;  1Z2P X;  4C5B A;  1Z2O X;  1PX2 A;  5JH7 F;  1KJI A;  4MV7 A;  2YRW A;  1I7N A;  4WBN F;  1ULZ A;  4FFM A;  2CQY A;  1GSH A;  4L1K A;  1B6R A;  3KAL A;  2FB9 A;  2W70 A;  4O7W A;  1KC7 A;  3VMM A;  5LXT F;  1VBG A;  4O7S A;  3WNZ A;  2DZD A;  1DV2 A;  2V5A A;  2NU9 B;  3DF7 A;  4YAJ B;  2W6Z A;  3V4Z A;  4O4L F;  5LOV F;  3ETJ A;  5EZY F;  1W96 A;  1SCU B;  5GON F;  2YZM A;  4HR7 A;  3G8D A;  1KUT A;  3GLK A;  4FU0 A;  4HNV A;  3KAJ A;  4Y8V B;  5JQG F;  3MJF A;  2I80 A;  5KKN B;  1AUX A;  1C3O A;  5BMV F;  4MV1 A;  2V59 A;  2I87 A;  5LA6 F;  3TII A;  1B6S A;  4MV8 A;  3VPC A;  2HGS A;  4I4T F;  1JDE A;  2YL2 A;  3SE7 A;  4XZ3 B;  4FFR A;  2YZL A;  1CS0 A;  4ME6 A;  4FGR A;  2DLN A;  3VPD A;  5C1O A;  2GQS A;  3WO0 A;  4O4I F;  1KJ9 A;  4O7T A;  1BNC A;  3VOT A;  4RZQ A;  5BPF A;  1KBL A;  4O7Z A;  5H80 A;  2R86 A;  2DWC A;  4O7V A;  4O7N A;  4XYM B;  2J9G A;  4I55 F;  3U54 A;  3KRE A;  2W6N A;  5JVD F;  3AW8 A;  2CNU A;  5HBR B;  2R7K A;  4IWX A;  3HO8 A;  2XCL A;  1OBG A;  3I12 A;  3HB9 A;  1E4E A;  5K2M A;  4YB8 B;  5HV6 A;  5D8D A;  1GSO A;  1CQJ B;  4O7R A;  4TV8 F;  3RV4 A;  4XX0 B;  3K5H A;  2FP4 B;  4NYE A;  4WD3 A;  5IYZ F;  3JZF A;  4O2A F;  2WYO A;  5DMX A;  3HBL A;  2PN1 A;  2CZG A;  2HJW A;  3TIG A;  1T36 A;  3TIN A;  1JKJ B;  4TV9 F;  2R82 A;  4IIJ F;  2ZDH A;  3LWB A;  1KJQ A;  2NU8 B;  1VKZ A;  1GSA A;  4HQ6 A;  5LYJ F;  3ETH A;  2R7N A;  2CNV A;  1E4E B;  3Q1K A;  4IWY A;  1A9X A;  2VPQ A;  1A48 A;  2YS7 A;  4MV4 A;  4MA5 A;  4XYL B;  4ZQI A;  3JRX A;  1W93 A;  4FFN A;  4ZOL F;  2R87 A;  4QSH A;  4EGJ A;  1DIK A;  2NU6 B;  1GGO A;  4M9U A;  4O84 A;  2R84 A;  2R85 A;  5LP6 F;  4ZI7 F;  3TW6 A;  3TQT A;  3V4S A;  1KJ8 A;  1M0W A;  2R7L A;  4O82 A;  2R6F A;  3OUU A;  2VQD A;  2R7M A;  4I50 F;  3BG5 A;  5CAE B;  3R5H A;  2XD4 A;  4O7L A;  4DLK A;  2DIK A;  4DIM A;  2FPP B;  4MA0 A;  4YJ2 F;  3RUP A;  4HNT A;  1C30 A;  1DV1 A;  3U9T A;  2W6Q A;  2I8C A;  3JRW A;  2YRX A;  5CA0 F;  2QF7 A;  3K3P A;  3N6R A;  4MV6 A;  1Z2N X;  3Q2O A;  3VPB A;  2NU7 B;  2CNQ A;  3JZI A;  2YS6 A;  3GID A;  1KJJ A;  2IP4 A;  4C5A A;  1EHI A;  1EZ1 A;  5JQW A;  1CQI B;  1UC9 A;  4YJ3 F;  4E4T A;  2PVP A;  4O86 A;  2W6P A;  3MWE A;  4IHJ F;  3ORR A;  5CA1 F;  3U55 A;  3K5I A;  1EUD B;  2P0A A;  1EYZ A;  4YBZ B;  2FPI B;  2YWV A;  4TUY F;  2W6M A;  1JDB B;  2V58 A;  4HNU A;  4MV3 A;  2GPW A;  1M0T A;  4YAK B;  2GPS A; 
#chains in the Genus database with same CATH topology
 3NC0 B;  5I5Y A;  1Y1V A;  1A0G A;  4WHX A;  4O3S A;  4LF9 H;  3DTF A;  1TAE A;  3LP8 A;  3N6X A;  4X62 H;  4O7Y A;  3SI8 A;  4EFE A;  5KG6 A;  1VBH A;  5L1L A;  4EGQ A;  4LF8 H;  2W7O A;  4RAZ A;  4A3C G;  4PWQ A;  2RDI A;  4J9S A;  3G6V A;  1AUV A;  3T5H A;  3QFF A;  4RNN A;  5CM0 A;  3HOV G;  2FPG B;  3ORQ A;  3U9S A;  2NUA B;  5DAA A;  4IAJ A;  2R92 G;  2Z02 A;  2PBZ A;  1I94 H;  1CKN A;  4JYA H;  5KFD A;  4U6P A;  1GLV A;  3RV3 A;  1X9N A;  5DG8 A;  3Q8R B;  4ED3 A;  4LFB H;  3R5F A;  1EKF A;  3VA7 A;  3RIZ A;  5KFK A;  3WO1 A;  3RB6 A;  3N8D A;  4RB1 A;  2JEF A;  2C00 A;  2KSW A;  2VUM A;  5KT7 A;  4EBE A;  2IMW P;  2OWO A;  2WB1 A;  5KFY A;  5CE8 A;  1M7J A;  3JAM W;  4LF6 H;  2J6T A;  5IT9 W;  1OBD A;  5F9L A;  2J6S A;  2ZDQ A;  3IG0 A;  2HVQ A;  3G6Y A;  3N42 B;  1UNN C;  3T5J A;  1N32 H;  1G2W A;  1KEE A;  1XNQ H;  4MAM A;  2ASJ A;  3T9D A;  2FLN A;  5J2U F;  3HKZ E;  2VR1 A;  5C1P A;  4FE2 A;  2Y0S E;  3UFX B;  3E5N A;  2YYA A;  4DQN A;  2M05 A;  5BWU A;  4RNO A;  5FNV F;  3R5X A;  3EPI A;  1S0N A;  1HR0 H;  2VUM G;  1CKO A;  3OUZ A;  4FFO A;  2E2I A;  3RFC A;  5F9N A;  4O81 A;  2JA6 G;  4ETS A;  4DL5 A;  3GTK A;  4DRF A;  2BQR A;  4YP3 A;  3C0F B;  1I3Q A;  2IA6 A;  4O4J F;  4LH6 A;  1DGS A;  3KHR A;  4DV3 H;  2R8J A;  1ZET A;  1Y1W G;  2QK4 A;  1IOV A;  3G8C A;  3QQM A;  4F4W A;  2PMZ A;  1HNZ H;  1N34 H;  4JI5 H;  2UXB H;  1O75 A;  3FKI G;  4C5C A;  5BWT A;  4DL2 A;  2W71 A;  2ASD A;  5KFR A;  4J0M A;  2YZG A;  5C8Y F;  4EG0 A;  1XDN A;  2YZN A;  4O83 A;  2YW2 A;  2HGW A;  4PZ8 A;  5KFU A;  3M9M B;  2W8L A;  2AU0 A;  2SCU B;  4FFP A;  4JI2 H;  1WR2 A;  4ED7 A;  2AGP A;  3MWM A;  2ZDG A;  3H20 A;  2GQR A;  4IZO A;  5C44 G;  4ED8 A;  2JA7 A;  4BBR G;  5KX5 F;  4DV7 H;  1SFO A;  1R9T A;  1BXR A;  2UVR A;  4DL6 A;  3AX6 A;  4AYB E;  4A3I G;  4QIW E;  3PO2 G;  5JVL A;  5IP9 G;  5KG2 A;  2UXC H;  4MTD A;  4FFL A;  2YCH A;  4DUZ H;  3RBD A;  4GLW A;  3TEK A;  5DG7 A;  4O4H F;  1JLL B;  2W9C A;  3GTQ A;  3BAA A;  5DGH A;  5DGI A;  1IOW A;  3BA8 A;  2DAB A;  5CB4 F;  1CE8 A;  5I47 A;  1GO3 E;  5DGA A;  3GB8 B;  3RTX A;  1PK8 A;  4MV9 A;  4ZHQ F;  3UQ8 A;  4LFA H;  5J2T F;  3H3V H;  4ECX A;  4LFC H;  5EWE A;  1UC8 A;  5BYA A;  1JIH A;  2FJZ A;  5IP7 G;  5KG4 A;  4DV4 H;  2OLS A;  4X65 H;  1I7L A;  4DR5 H;  4YR3 A;  5IYC G;  4ECV A;  2X0S A;  5KG3 A;  2W6O A;  4M0J A;  3R23 A;  5KG5 A;  3GV5 B;  3KAK A;  3NUA A;  4RB3 C;  3OHB A;  3EPG A;  3T1Y H;  4FM9 A;  1WSC A;  2GLT A;  2DPI A;  4A3L G;  1M6V A;  2Z04 A;  3R9R A;  3CSW A;  1RJP A;  1JXL A;  4RZR A;  1P16 A;  5BR8 H;  3HXL A;  3GJX B;  3J81 W;  4DV6 H;  4EYH B;  3GTM A;  2W8K A;  4O2B F;  1EUC B;  3MWD A;  5BPH A;  3N43 B;  3OSP A;  4R8U A;  2DPJ A;  1Z2P X;  4C5B A;  1Z2O X;  1PX2 A;  5JH7 F;  1KJI A;  4Q4D A;  1XMQ H;  3NGD A;  1N56 A;  4MV7 A;  2YRW A;  4RB0 A;  5LL6 b;  1I7N A;  4WBN F;  1SEI A;  3PO3 G;  4YQW A;  3M9N B;  3M9O B;  3N44 B;  1ULZ A;  4FS1 A;  2ZJT A;  3V6K A;  5KFM A;  4LSA A;  2BQ3 A;  2MCT A;  4J9K A;  4FFM A;  2NVY A;  2R93 G;  4DR2 H;  3T54 A;  2FK3 A;  1BGW A;  3H0G G;  4DV2 H;  2X5R A;  2CQY A;  4X64 H;  4EYI B;  1IYE A;  2VOB A;  3N40 P;  5FJ8 G;  3GII A;  2C35 B;  1GSH A;  4HYK A;  4L1K A;  1T3N A;  1I1L A;  1V51 A;  5KFT A;  1K1Q A;  3QWU A;  1B6R A;  3KAL A;  2Q2U A;  3KXY T;  4A3G G;  2FB9 A;  2W70 A;  4ED1 A;  2C22 A;  3GTL A;  4O7W A;  1KC7 A;  3VMM A;  4YR0 A;  3GIP A;  2ABJ A;  1FJG H;  5LXT F;  1RJR A;  3PW5 A;  4LF5 H;  3HOX G;  1RK6 A;  5EDW A;  1VBG A;  1Y1V G;  2FLL A;  4RCN A;  4O7S A;  3WNZ A;  5KFQ A;  2DZD A;  1WRV A;  3NBZ B;  3RB0 A;  1DV2 A;  2V5A A;  1SYX B;  4RUA A;  2NU9 B;  2V4Q A;  4A3J G;  4B3M H;  3T99 A;  2WB1 E;  2HHH H;  3T9A A;  5KFZ A;  1E4F T;  3DF7 A;  4BBS G;  4YAJ B;  3OSN A;  1DAA A;  3WWH A;  2W6Z A;  5DIS C;  4J9L A;  5BYB A;  3V4Z A;  5A2Q W;  5KT3 A;  4EFB A;  4O4L F;  3GDE A;  5LOV F;  1TWG A;  3ETJ A;  3L4J A;  5EZY F;  4TM5 A;  2UVW A;  1V9P A;  4LH7 A;  4UCU A;  4Q44 A;  1W96 A;  3CEB A;  1K83 A;  3GTJ A;  4R8U B;  5HNE A;  4J9N A;  4JI3 H;  2AGQ A;  2XGP A;  4K6N A;  1SCU B;  4Q45 A;  3J80 W;  3GIL A;  4EBD A;  1I2L A;  4TQS A;  2C2R A;  5GON F;  1MZB A;  2YZM A;  3RF2 A;  5KG1 A;  2AGO A;  3JSL A;  4J9Q A;  3PW2 A;  4HR7 A;  3G8D A;  1KUT A;  2FK2 A;  2HHF B;  3PN1 A;  3GLK A;  2UXD H;  1N48 A;  4E6N A;  4O3O A;  2BR0 A;  1IBL H;  2VA2 A;  4FU0 A;  4BY1 G;  4CMF A;  3GTG A;  1TWC A;  4HNV A;  3MR6 A;  3KAJ A;  3TY9 A;  3UZO A;  3UYY A;  4Y8V B;  4Q4C A;  2E5L H;  1N33 H;  4F4Y A;  3T9C A;  5JQG F;  3BJY A;  1S0M A;  3RAQ A;  2VA3 A;  3MJF A;  1S97 A;  2CKZ B;  2I80 A;  5KKN B;  4O3Q A;  3AYH B;  4ECW A;  2FE3 A;  1AUX A;  1HNW H;  1C3O A;  3Q8Q B;  3N41 B;  5BMV F;  5FR9 A;  4MV1 A;  5EWF A;  1TWF A;  1ET0 A;  4OX9 H;  4ED2 A;  2V59 A;  3DAA A;  2I87 A;  5KFN A;  3HOY G;  5LA6 F;  3TII A;  4IR9 A;  1B6S A;  4MV8 A;  4QWA A;  4UFZ A;  3VPC A;  2HGS A;  2JA6 A;  2UVU A;  4I4T F;  3T5K A;  4A3D G;  3J7A K;  1JDE A;  2YL2 A;  3SE7 A;  2ODT X;  4XZ3 B;  2UUA H;  3HOZ G;  3BAB A;  4JXU A;  3HKZ A;  4ECZ A;  4AQY H;  4ECQ A;  1IBM H;  1Y14 B;  4FFR A;  2YZL A;  1N36 H;  1CKN B;  1CS0 A;  1I1K A;  4O3N A;  5KFV A;  4LF4 H;  2JA7 G;  4M7E A;  4ME6 A;  4C2M A;  2R7Z A;  1CKM A;  2COI A;  4FGR A;  2DLN A;  3TY5 A;  3VPD A;  5KFL A;  5KT4 A;  3GQC A;  5KFB A;  5DQH A;  5C1O A;  2GQS A;  3WO0 A;  4RU9 A;  5KFP A;  4O4I F;  3T5L A;  1KJ9 A;  1HNX H;  4B3T H;  5D1P A;  4RB2 C;  5KFI A;  4O7T A;  2HIX A;  4CC5 A;  1B04 A;  1RJQ A;  4O3P A;  4YHH H;  2ASL A;  2B63 A;  1BNC A;  5I5V A;  5C5J A;  1L2Z A;  2EJ3 A;  2QYZ A;  5D1O A;  5DQG A;  5C3E G;  3RBE A;  4K0K H;  3VOT A;  3FDS A;  4RZQ A;  5BPF A;  1KBL A;  5L1K A;  2R8K A;  2ATL A;  1RK5 A;  5IYD G;  1FVI A;  4O7Z A;  5FPR A;  5H80 A;  2R86 A;  4F50 A;  2DWC A;  4O7V A;  4O7N A;  5KFA A;  5KT2 A;  3GIJ A;  1IYD A;  3LML A;  2HDK A;  2FKL A;  1ZQ7 A;  3WWI A;  4XYM B;  3CVZ A;  4BXX G;  2J9G A;  1JX4 A;  2R8I A;  2ZGI A;  3RGX A;  3MFH A;  2WTF A;  1WCM A;  4I55 F;  3T9E A;  4DR1 H;  2OH2 A;  4NZM A;  4UCS A;  2WAQ A;  3U54 A;  5KFE A;  3KRE A;  3L4K A;  2FK1 A;  2VQE H;  3PZP A;  2W6N A;  5JVD F;  1IBK H;  4LF7 H;  2E2H A;  3KHL A;  5E25 A;  2DAA A;  3AW8 A;  4I7H A;  4DR6 H;  3H4D A;  2CNU A;  4F4Z A;  5HBR B;  2R7K A;  4IWX A;  1VAJ A;  3HO8 A;  1TWH A;  3K3V A;  5JUM A;  5L9X A;  5FLX W;  2V4R A;  4JV1 A;  5KFG A;  1K1S A;  1ZHQ A;  2RDJ A;  2WDT A;  4JI7 H;  3H40 A;  3HB9 A;  2XCL A;  1OBG A;  3I12 A;  2Q7D A;  1E4E A;  2COG A;  5K2M A;  1GYF A;  4YB8 B;  4PZ7 A;  5KG7 A;  4PBC A;  3MR3 A;  2VPS A;  3RAX A;  1S9F A;  5HV6 A;  2RF4 A;  3OHA A;  2FLP A;  5D8D A;  1GSO A;  1I1M A;  5I5U A;  1CQJ B;  5BWR A;  4O7R A;  4EEY A;  4IRK A;  4DR7 H;  2JEI A;  4TV8 F;  2ZM6 H;  2W9A A;  5DLF A;  4DV5 H;  3RV4 A;  4XX0 B;  4B3R H;  3CQZ A;  4QW9 A;  3K5H A;  2RGR A;  3L2P A;  4A3B G;  3PW0 A;  4CE5 A;  2FP4 B;  3QZ7 A;  4B3S H;  2W9C B;  3TW7 A;  4UCT A;  4NYE A;  5IWA H;  2W57 A;  4ECS A;  4WD3 A;  1T94 A;  3IN5 A;  4DL3 A;  1KT8 A;  5IYZ F;  4J9O A;  3TQ1 A;  2R93 A;  3BA9 A;  4HN2 A;  3BQ0 A;  3W1G A;  4JI0 H;  3JZF A;  5KFW A;  4O2A F;  2WYO A;  5DMX A;  5I5W A;  5EOY A;  5KT6 A;  3I4M G;  1E4G T;  5KFH A;  4X66 H;  3HBL A;  2PN1 A;  3PW4 A;  2XCA A;  2CW8 A;  4EQ5 A;  2COJ A;  2CZG A;  1A0I A;  5BWX A;  1ZHS A;  3M4I A;  2NVX A;  1TWA A;  4BWS C;  2HJW A;  3KYH C;  1T36 A;  3TIG A;  1J5E H;  5C4X G;  3TIN A;  5KFF A;  1JKJ B;  2W7P A;  3GV7 B;  5KFO A;  4TV9 F;  5LMU H;  2R82 A;  1B33 N;  2EIY A;  2ZDH A;  3LWB A;  4IIJ F;  4Q8E A;  2V9W A;  1KJQ A;  3PFF A;  5EWG A;  2NU8 B;  5KFS A;  3SNO A;  1VKZ A;  3MFI A;  1A3G A;  2JA5 A;  2O03 A;  1GSA A;  4QWD A;  3W1B A;  1RYR A;  4PZ6 A;  3SGI A;  4HQ6 A;  5LYJ F;  4PDB A;  3ETH A;  5LMN H;  2R92 A;  3NBY B;  4Q43 A;  3H4B A;  1S0O A;  2R7N A;  1VS0 A;  5FLM G;  4A3F G;  2CNV A;  4JV2 A;  4APM A;  3LUL A;  1P8L A;  4LSX A;  1E4E B;  1BJT A;  3Q1K A;  2PMZ E;  2HGX A;  4IWY A;  3HOU G;  4G3I A;  3OTO H;  1A9X A;  2UVV A;  2JA8 G;  4DR4 H;  2VPQ A;  3LQS A;  4UCR A;  3HT5 A;  2Q2T A;  5DG9 A;  1A48 A;  4GC7 A;  2YS7 A;  2JEG A;  4MV4 A;  5KFJ A;  2YU9 A;  3TY8 A;  4MA5 A;  4XYL B;  4GLX A;  4DV1 H;  4ZQI A;  3JRX A;  1W93 A;  2QB5 A;  3JZ6 A;  4FFN A;  4YY3 H;  4ZOL F;  5L1J A;  2R87 A;  4A3E G;  4IRD A;  5I5X A;  5DLG A;  4QSH A;  3BQ2 A;  3RB4 A;  3RJ0 A;  4EGJ A;  3V6J A;  1DIK A;  1KTA A;  3U0G A;  2NU6 B;  1GGO A;  4M9U A;  4O84 A;  4NXM H;  2WE6 A;  2R84 A;  4CKB A;  4JI8 H;  3UZB A;  4U7C A;  2R85 A;  2Y4R A;  3Q8P B;  3KHH A;  2CFM A;  5LP6 F;  4ZI7 F;  4NZO A;  4A3M G;  2IBK A;  3GTP A;  4F4X A;  2R8G A;  3W5O A;  1XK5 A;  3TW6 A;  3TQT A;  3QZ8 A;  3V4S A;  2EJ0 A;  4JUZ A;  1KJ8 A;  3EYY A;  5T14 A;  3BQ1 A;  4ECU A;  4BY7 G;  3JSN A;  1Y1W A;  4DR3 H;  3DTG A;  5CR5 A;  2FMA A;  1M0W A;  2R7L A;  4O82 A;  1EKV A;  3RB3 A;  1S03 G;  2Y0S A;  4ED6 A;  3MR5 A;  5L1I A;  1RYS A;  3FKI A;  4A3K G;  2JA5 G;  2R6F A;  3OUU A;  4EEQ A;  5BWW A;  2VQD A;  5KT5 A;  2R7M A;  1ZAU A;  5I5S A;  5KS8 A;  2R7Z G;  4A2B A;  4UCO A;  2VUG A;  4I50 F;  4RUC A;  3KHG A;  3BG5 A;  5CAE B;  3R5H A;  5KFX A;  4RAY A;  5DGB A;  2W9B A;  2BQU A;  2C2E A;  4TVI A;  5I5T A;  4CKC A;  5I60 A;  2XD4 A;  4O7L A;  2UU9 H;  4DLK A;  4O3R A;  4UCV A;  2B63 G;  4DV0 H;  3FMA A;  2DIK A;  2F4V H;  3GIK A;  4MTE A;  4QWB A;  4DIM A;  2FPP B;  3GIM A;  4RNM A;  4MA0 A;  2R8H A;  4CHI A;  5FD6 A;  2EJ2 A;  5DQI A;  4J9P A;  4DL7 A;  1XMO H;  4YJ2 F;  4NLG A;  4DUY H;  3T9B A;  2WAQ E;  4FBU A;  4GC6 A;  3RUP A;  4HNT A;  1C30 A;  3BAC A;  5FPO A;  1DV1 A;  3U9T A;  4FBT A;  2W6Q A;  2I8C A;  5K3W A;  3JRW A;  3T7A A;  4A93 G;  4ED0 A;  2XCP A;  3RGZ A;  2YRX A;  3KTM A;  3PR4 A;  5CA0 F;  2QF7 A;  3K3P A;  3N6R A;  3Q8S B;  4MV6 A;  1WCM G;  3PR5 B;  4AYB A;  2XIG A;  4QIW A;  3I4N G;  1WH2 A;  1Z2N X;  2RGV A;  3Q2O A;  4J9M A;  2ALZ A;  1EKP A;  3S24 A;  2NU7 B;  3VPB A;  2CNQ A;  4LMY A;  2UUC H;  2HVS A;  3PW7 A;  1I6U A;  1I50 A;  2HG8 A;  3JZI A;  3VNN A;  3RR5 A;  2C28 A;  2YS6 A;  2CW7 A;  2XGQ A;  4Q0Y A;  5KFC A;  3GID A;  2UUB H;  5BWV A;  1KJJ A;  2IP4 A;  1OWT A;  4ECT A;  4ECR A;  4GKK H;  4QWE A;  4UUG A;  4C5A A;  2JEJ A;  2HVR A;  3GTO A;  3MR2 A;  1I2K A;  1EHI A;  4CKE A;  4TQR A;  1EZ1 A;  1V4Y A;  5JQW A;  5KG0 A;  4QWC A;  1CQI B;  1UC9 A;  4IR1 A;  3T9F A;  3GV8 B;  4QJF A;  4ECY A;  1S68 A;  3T1H H;  4YJ3 F;  1TA8 A;  4QW8 A;  4NZN A;  3PVX A;  4JI1 H;  5FD5 A;  1AN7 A;  3G6X A;  4E4T A;  3F8N A;  4GKJ H;  2PVP A;  4DL4 A;  4CMD A;  4O86 A;  2W6P A;  3MWE A;  4IHJ F;  3ORR A;  4R7R A;  3HOW G;  2HHF A;  2XC9 A;  2W9B B;  2A1H A;  5CA1 F;  4CC6 A;  4KHP H;  4NXN H;  3U55 A;  3H0G A;  1FKA H;  3K5I A;  2J6U A;  5D1O B;  3GIQ A;  1EUD B;  2P0A A;  1EYZ A;  2VQF H;  4YBZ B;  4DAA A;  3WWJ A;  2FPI B;  2YWV A;  4YR2 A;  4TUY F;  2HIV A;  5IYB G;  3V6H A;  2W6M A;  1S10 A;  4Q8F A;  4JI4 H;  1JDB B;  2V58 A;  4HNU A;  4JI6 H;  4JV5 H;  1XNR H;  2AQ4 A;  4FS2 A;  4EBC A;  4MV3 A;  2GPW A;  4JV0 A;  1M0T A;  4A2A A;  4IRC A;  4YAK B;  2C2D A;  4J9R A;  2GPS A; 
#chains in the Genus database with same CATH homology
 3LP8 A;  4O7Y A;  1VBH A;  4EGQ A;  1AUV A;  3QFF A;  2FPG B;  3ORQ A;  3U9S A;  2NUA B;  2Z02 A;  2PBZ A;  1GLV A;  3RV3 A;  3R5F A;  3VA7 A;  3WO1 A;  3N8D A;  2C00 A;  1OBD A;  2ZDQ A;  1KEE A;  4MAM A;  5J2U F;  2VR1 A;  5C1P A;  4FE2 A;  3UFX B;  3E5N A;  2YYA A;  5FNV F;  3R5X A;  3OUZ A;  4FFO A;  3RFC A;  4O81 A;  4O4J F;  2QK4 A;  1IOV A;  3G8C A;  4C5C A;  2W71 A;  2YZG A;  5C8Y F;  4EG0 A;  2YZN A;  4O83 A;  2YW2 A;  2SCU B;  4FFP A;  1WR2 A;  2ZDG A;  2GQR A;  4IZO A;  5KX5 F;  1BXR A;  3AX6 A;  5JVL A;  4FFL A;  4O4H F;  1JLL B;  1IOW A;  5CB4 F;  1CE8 A;  5I47 A;  1PK8 A;  4MV9 A;  4ZHQ F;  5J2T F;  1UC8 A;  2OLS A;  1I7L A;  2X0S A;  2W6O A;  3R23 A;  3KAK A;  3NUA A;  2GLT A;  1M6V A;  2Z04 A;  3R9R A;  4O2B F;  1EUC B;  3MWD A;  5BPH A;  1Z2P X;  4C5B A;  1Z2O X;  1PX2 A;  5JH7 F;  1KJI A;  4MV7 A;  2YRW A;  1I7N A;  4WBN F;  1ULZ A;  4FFM A;  2CQY A;  1GSH A;  4L1K A;  1B6R A;  3KAL A;  2FB9 A;  2W70 A;  4O7W A;  1KC7 A;  3VMM A;  5LXT F;  1VBG A;  4O7S A;  3WNZ A;  2DZD A;  1DV2 A;  2V5A A;  2NU9 B;  3DF7 A;  4YAJ B;  2W6Z A;  3V4Z A;  4O4L F;  5LOV F;  3ETJ A;  5EZY F;  1W96 A;  1SCU B;  5GON F;  2YZM A;  4HR7 A;  3G8D A;  1KUT A;  3GLK A;  4FU0 A;  4HNV A;  3KAJ A;  4Y8V B;  5JQG F;  3MJF A;  2I80 A;  5KKN B;  1AUX A;  1C3O A;  5BMV F;  4MV1 A;  2V59 A;  2I87 A;  5LA6 F;  3TII A;  1B6S A;  4MV8 A;  3VPC A;  2HGS A;  4I4T F;  1JDE A;  2YL2 A;  3SE7 A;  4XZ3 B;  4FFR A;  2YZL A;  1CS0 A;  4ME6 A;  4FGR A;  2DLN A;  3VPD A;  5C1O A;  2GQS A;  3WO0 A;  4O4I F;  1KJ9 A;  4O7T A;  1BNC A;  3VOT A;  4RZQ A;  5BPF A;  1KBL A;  4O7Z A;  5H80 A;  2R86 A;  2DWC A;  4O7V A;  4O7N A;  4XYM B;  2J9G A;  4I55 F;  3U54 A;  3KRE A;  2W6N A;  5JVD F;  3AW8 A;  2CNU A;  5HBR B;  2R7K A;  4IWX A;  3HO8 A;  2XCL A;  1OBG A;  3I12 A;  3HB9 A;  1E4E A;  5K2M A;  4YB8 B;  5HV6 A;  5D8D A;  1GSO A;  1CQJ B;  4O7R A;  4TV8 F;  3RV4 A;  4XX0 B;  3K5H A;  2FP4 B;  4NYE A;  4WD3 A;  5IYZ F;  3JZF A;  4O2A F;  2WYO A;  5DMX A;  3HBL A;  2PN1 A;  2CZG A;  2HJW A;  3TIG A;  1T36 A;  3TIN A;  1JKJ B;  4TV9 F;  2R82 A;  4IIJ F;  2ZDH A;  3LWB A;  1KJQ A;  2NU8 B;  1VKZ A;  1GSA A;  4HQ6 A;  5LYJ F;  3ETH A;  2R7N A;  2CNV A;  1E4E B;  3Q1K A;  4IWY A;  1A9X A;  2VPQ A;  1A48 A;  2YS7 A;  4MV4 A;  4MA5 A;  4XYL B;  4ZQI A;  3JRX A;  1W93 A;  4FFN A;  4ZOL F;  2R87 A;  4QSH A;  4EGJ A;  1DIK A;  2NU6 B;  1GGO A;  4M9U A;  4O84 A;  2R84 A;  2R85 A;  5LP6 F;  4ZI7 F;  3TW6 A;  3TQT A;  3V4S A;  1KJ8 A;  1M0W A;  2R7L A;  4O82 A;  2R6F A;  3OUU A;  2VQD A;  2R7M A;  4I50 F;  3BG5 A;  5CAE B;  3R5H A;  2XD4 A;  4O7L A;  4DLK A;  2DIK A;  4DIM A;  2FPP B;  4MA0 A;  4YJ2 F;  3RUP A;  4HNT A;  1C30 A;  1DV1 A;  3U9T A;  2W6Q A;  2I8C A;  3JRW A;  2YRX A;  5CA0 F;  2QF7 A;  3K3P A;  3N6R A;  4MV6 A;  1Z2N X;  3Q2O A;  3VPB A;  2NU7 B;  2CNQ A;  3JZI A;  2YS6 A;  3GID A;  1KJJ A;  2IP4 A;  4C5A A;  1EHI A;  1EZ1 A;  5JQW A;  1CQI B;  1UC9 A;  4YJ3 F;  4E4T A;  2PVP A;  4O86 A;  2W6P A;  3MWE A;  4IHJ F;  3ORR A;  5CA1 F;  3U55 A;  3K5I A;  1EUD B;  2P0A A;  1EYZ A;  4YBZ B;  2FPI B;  2YWV A;  4TUY F;  2W6M A;  1JDB B;  2V58 A;  4HNU A;  4MV3 A;  2GPW A;  1M0T A;  4YAK B;  2GPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...