4YAKB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, acetyl-coenzyme a and with phosphorylated phosphohistidine segment (site i orientation)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Ligase
total genus 64
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4yakB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4yakB02
2YZMA 3LP8A 4HNUA 1E4EB 1CE8A 2FB9A 1KC7A 3MWDA 1W93A 1M0TA 4RZQA 2R7KA 2IP4A 3VPBA 4O84A 1UC8A 4IIJF 1E4EA 2NU6B 5LXTF 4O81A 4ZQIA 1M6VA 2XCLA 2VQDA 4IHJF 3DF7A 3TQTA 3SE7A 3HO8A 2FPPB 2R6FA 4O7TA 1KUTA 1C30A 5K2MA 4MA0A 2NU9B 5CB4F 4FFOA 4O82A 2NUAB 4O7LA 4XYMB 4MV9A 1Z2PX 1EHIA 3K5HA 3TINA 3V4SA 4I50F 3N6RA 3ETJA 3MJFA 2DZDA 3ORQA 1IOVA 2R82A 3JRXA 3WO1A 1IOWA 4FFMA 4YJ2F 5J2TF 2FPGB 2W6OA 3R23A 1AUXA 1ULZA 4IWXA 3U9TA 3KALA 2I80A 3U55A 2W6MA 2GQSA 1JDEA 4EGQA 5JQGF 2QK4A 2R86A 1DV2A 3ETHA 2YZGA 1OBGA 2OLSA 1KJIA 2R7NA 5HV6A 1KJJA 2FP4B 4MV4A 5CA0F 2R87A 4O7SA 4FFLA 5H80A 5C1OA 1M0WA 1JKJB 4C5BA 4FFRA 1BNCA 2WYOA 4YJ3F 2C00A 1DV1A 1A9XA 1AUVA 2W70A 1SCUB 5D8DA 1C3OA 2ZDHA 4DIMA 3OUUA 3TIGA 4O86A 4FU0A 4TV9F 4NYEA 2R7LA 2R7MA 3HBLA 2Z02A 1GSOA 3R9RA 4EGJA 5JH7F 4O7RA 4DLKA 2CQYA 2PN1A 3G8CA 4O4LF 5LP6F 2CZGA 1EZ1A 3I12A 5J2UF 1GGOA 2YS6A 2VPQA 2YW2A 3KAJA 4O7VA 1EUDB 4HQ6A 1WR2A 2W6QA 3VPDA 5LYJF 5FNVF 5C1PA 3R5FA 3JZIA 5KKNB 2YZNA 4FFNA 4O4HF 2GQRA 4MA5A 2XD4A 2HGSA 5GONF 1Z2OX 3OUZA 2YZLA 1KEEA 3G8DA 1A48A 5JQWA 1T36A 2VR1A 1W96A 4O7ZA 1CQIB 5BPHA 2YRXA 4I55F 3VA7A 2DWCA 3E5NA 3AW8A 2W6PA 5C8YF 2GPWA 2Z04A 4O7YA 3V4ZA 1VKZA 4O7NA 3JZFA 1KJQA 3HB9A 4WBNF 5DMXA 4QSHA 3MWEA 2W6NA 2P0AA 4FFPA 3UFXB 3ORRA 3VOTA 1KBLA 4O83A 3RUPA 4FE2A 4ZI7F 5KX5F 3WO0A 1VBGA 2V59A 2NU7B 4WD3A 2QF7A 1CS0A 5HBRB 3QFFA 4EG0A 4C5AA 1UC9A 4XYLB 4FGRA 4M9UA 4HNTA 1JDBB 1KJ8A 4YAKB 3RV4A 2FPIB 3RFCA 2ZDQA 2HJWA 1KJ9A 4ZOLF 4HR7A 2I87A 4IZOA 1B6RA 2V58A 1EYZA 2YWVA 1VBHA 2GLTA 3KREA 4MV1A 2R84A 4XX0B 3U9SA 3BG5A 2YL2A 5LA6F 1GSAA 1EUCB 5EZYF 5IYZF 4ME6A 3K3PA 4O4JF 1PX2A 2SCUB 3GLKA 4MAMA 2X0SA 2GPSA 4XZ3B 5CAEB 3TIIA 2YRWA 3R5HA 2W71A 2CNQA 1GLVA 2R85A 5LOVF 4O4IF 2YYAA 2ZDGA 2CNUA 3KAKA 5I47A 5JVLA 3U54A 4I4TF 2PBZA 4Y8VB 4TV8F 5BPFA 5JVDF 3Q2OA 3N8DA 4IWYA 1CQJB 1OBDA 4MV7A 4MV6A 4TUYF 2YS7A 4HNVA 3AX6A 4YAJB 4C5CA 4YB8B 3K5IA 2NU8B 3WNZA 3VPCA 2J9GA 2CNVA 4E4TA 4O7WA 3VMMA 3NUAA 1B6SA 2V5AA 3JRWA 4O2AF 1DIKA 1PK8A 2I8CA 3RV3A 4O2BF 1I7NA 2PVPA 1JLLB 1Z2NX 1I7LA 2DIKA 1GSHA 2DLNA 5CA1F 4YBZB 4MV8A 4L1KA 5BMVF 3Q1KA 2W6ZA 1BXRA 3R5XA 4MV3A 3TW6A 4ZHQF 3LWBA 3GIDA
chains in the Genus database with same CATH superfamily
3H4DA 1GYFA 2YZMA 2FKLA 4CMFA 2HHHH 3LP8A 4DR1H 5KFCA 5EDWA 3M9OB 2W9AA 5KFJA 3GIKA 2UVWA 4JI5H 4HNUA 5KFOA 2C22A 2JEFA 3HT5A 4A3GG 4UCTA 2DPJA 1E4EB 3M4IA 4F4ZA 1CE8A 3J80W 2W9BB 4DV6H 2FB9A 1KC7A 3MWDA 2WB1E 4DR2H 1S10A 5KFKA 2WAQE 5KS8A 1W93A 1M0TA 1S0OA 2OH2A 4RZQA 5DAAA 5IP7G 3WWJA 4LF5H 4NLGA 1WCMG 2R7KA 4EFBA 2HHFB 1I2LA 2IP4A 4CKEA 3GV7B 1S97A 1B04A 3VPBA 2UVRA 2BQRA 1UNNC 3QZ7A 4DL3A 2ASLA 3JSLA 4O84A 1B33N 1UC8A 4PBCA 2BQUA 4IIJF 1E4EA 2NU6B 5LXTF 4O81A 5EWGA 1MZBA 2W9BA 4PZ6A 4YR0A 3PR4A 4ZQIA 5BWVA 3H20A 3IG0A 4PWQA 3M9NB 3IN5A 2W9CB 1N34H 1M6VA 4RB0A 5KG1A 4DUYH 5FJ8G 4RNNA 4YY3H 2VQFH 2XCLA 3JZ6A 2R8GA 4MTEA 2VQDA 5DGIA 3HOUG 4IHJF 3DF7A 3NBZB 3FKIA 2QB5A 4QIWA 5L1LA 3TQTA 2HG8A 3SE7A 3BACA 3HO8A 5HNEA 5KFGA 2WTFA 2FPPB 4IAJA 4X66H 3KHGA 2W9CA 5K3WA 2R6FA 4F4WA 4RCNA 4ECSA 4O7TA 3DTGA 1KUTA 2R7ZA 1I2KA 4RNOA 4CC6A 3FDSA 3MR2A 3GTQA 5T14A 4BXXG 3V6HA 5JUMA 5FLMG 2EJ2A 4QWCA 2W7OA 3T9FA 3NGDA 4ECZA 5KFFA 1C30A 5K2MA 2XCPA 4ED2A 3QQMA 2Y4RA 3RB4A 3GTKA 4MA0A 5FLXW 2NU9B 5CB4F 5LMNH 4FFOA 4FS1A 2JA7A 4Q4CA 3I4MG 3UZBA 4O82A 3UZOA 1RYSA 3MWMA 2OWOA 3RBDA 4GKKH 4FBTA 3CSWA 2NUAB 1RK6A 4J9PA 5L1KA 3OSNA 1Y1WG 3GB8B 1A0GA 4O7LA 1VAJA 4X64H 4GC6A 4XYMB 4DL6A 3GILA 4A3FG 5KT3A 3PW0A 1FKAH 2JEJA 4YQWA 4MV9A 5EWEA 1Z2PX 4HN2A 1EHIA 3K5HA 3TINA 5I5TA 3V4SA 4IRCA 4DL5A 1JIHA 2ZJTA 4I50F 4ECQA 3RAQA 3N6RA 3ETJA 2XGPA 3OSPA 3MJFA 5KG2A 5I5YA 3ORQA 2DZDA 1IOVA 4ED1A 2JA6G 3W1GA 1E4FT 1FVIA 2R92A 1XMQH 2ODTX 2R82A 3MR3A 3JRXA 2J6TA 5E25A 1ZHSA 2UUBH 2IBKA 3WO1A 1IOWA 4FFMA 4YJ2F 3PFFA 2COGA 2FPGB 5J2TF 4O3PA 4J9NA 1N36H 2W6OA 3R23A 1AUXA 1ULZA 4IWXA 5D1OB 3KALA 3U9TA 2I80A 3U55A 2WE6A 5DLFA 5KG5A 3RAXA 3L4KA 5KFYA 2JA5A 4NZOA 2W6MA 2GQSA 1JDEA 4EGQA 4J9SA 1P16A 3RTXA 4Q45A 2JA6A 5JQGF 1E4GT 4JI6H 5BWUA 1KT8A 3S24A 3T7AA 5CE8A 5DG9A 2ZM6H 4RUAA 4J9OA 4DV1H 3W5OA 2DPIA 4B3MH 2QK4A 2X5RA 5BYBA 2AGPA 1RYRA 4RAZA 2EIYA 3HXLA 4R8UB 2R86A 1L2ZA 5D1OA 4ECTA 1DV2A 3ETHA 1TWAA 4DV0H 5DG7A 2ABJA 2YZGA 4F50A 1I1KA 3TY9A 4DL4A 4IRDA 1OBGA 3GJXB 3C0FB 4PZ8A 2OLSA 3GIIA 3Q8SB 3N40P 1KJIA 1IBKH 3H40A 2R7NA 2W8LA 3GIQA 4OX9H 3TQ1A 3HKZE 5C4XG 4LF9H 5HV6A 5BWRA 1KJJA 2R8JA 3QWUA 3CQZA 2FP4B 4MV4A 2Y0SE 1ZQ7A 4R8UA 5CA0F 4EYIB 2FLNA 1AN7A 4TQSA 3MFIA 3T9BA 5BYAA 2R87A 5KFVA 5KT7A 2NVXA 2E2IA 1TWFA 4AYBA 4O7SA 5KFWA 4FFLA 1Y1VG 3G6VA 4RU9A 2ZGIA 5DGHA 3KXYT 2C2DA 5H80A 5C1OA 1M0WA 3T5KA 2NVYA 3N44B 2BQ3A 5DISC 3U0GA 1WH2A 3VNNA 2EJ0A 1EKPA 1JKJB 4C5BA 4FFRA 2M05A 1TA8A 2ATLA 2UXDH 2DAAA 1IYEA 2FLPA 1HR0H 1BNCA 5CR5A 3T1YH 1N56A 2WYOA 2R8KA 4YJ3F 4RZRA 4G3IA 4QJFA 2C00A 1DV1A 5KFHA 1EKFA 1A9XA 3GV5B 1AUVA 2W70A 1SCUB 3BQ0A 4J0MA 4B3RH 4UCOA 3K3VA 4CKBA 2B63G 3V6JA 4UCRA 5D8DA 4JI8H 1C3OA 2ZDHA 1DGSA 2DABA 3RR5A 3TY5A 4DIMA 2O03A 1P8LA 4J9MA 3OUUA 4LH6A 5BWTA 3TIGA 5I5XA 1ET0A 4O86A 5KFTA 2FK2A 3BAAA 4FU0A 4TV9F 4LMYA 4NYEA 2RGRA 4EYHB 3AYHB 2VOBA 3T5JA 2R7LA 2R7MA 3HBLA 2COJA 2W57A 2Z02A 1M7JA 1ZAUA 4DV2H 1GSOA 3R9RA 3JSNA 3T9AA 4Q44A 4LSAA 1V51A 2HHFA 4EGJA 2Q2TA 5I5VA 4EBDA 3PW5A 5KG7A 5JH7F 4O7RA 1WCMA 4DLKA 3HOWG 4JV5H 4JV1A 4A3BG 4QW8A 4ECRA 2CQYA 2JEIA 2PN1A 4EQ5A 4YR2A 3G8CA 4UCSA 4O4LF 1OWTA 2R8IA 5KT5A 5LP6F 5KFMA 2CZGA 3MR6A 1EZ1A 2UXCH 3I12A 1S68A 2WB1A 3RB3A 2ASJA 2WAQA 4EBCA 2UVVA 2FJZA 4GLWA 3TEKA 4ED7A 5J2UF 5L1IA 4DUZH 3WWHA 3N6XA 1GGOA 3KAJA 2YS6A 2VPQA 2YW2A 2RGVA 1I1LA 4O7VA 3EYYA 4QWBA 4APMA 3RJ0A 2V9WA 4UUGA 1EUDB 4HQ6A 4QWAA 3MFHA 1WR2A 4DQNA 3T5HA 3PW7A 4LF7H 1XK5A 4RB3C 2W6QA 3VPDA 4ECYA 5KFQA 5IWAH 4DL2A 2UUAH 5LYJF 4FBUA 2E5LH 5FNVF 1ZHQA 3H0GG 5KT2A 4TQRA 4UFZA 5C1PA 3R5FA 4DV7H 4PZ7A 3JZIA 5KFBA 4YHHH 5KKNB 2YZNA 4FFNA 5L1JA 4E6NA 4LFAH 4O4HF 3RF2A 5LMUH 3GTJA 2GQRA 4MA5A 3CVZA 5F9LA 2XD4A 3MR5A 3PW4A 3RB0A 2FLLA 4A3CG 3GTGA 2HGSA 4RUCA 3LULA 4HYKA 3GDEA 3GQCA 5GONF 4JI2H 1Z2OX 2C28A 5FR9A 1S9FA 3EPGA 3OUZA 3J7AK 4I7HA 2R93A 2YZLA 3T99A 5KFNA 5FPRA 3WWIA 1KEEA 1I3QA 5KFUA 5KFZA 2XIGA 5IYCG 4ED3A 5C44G 5KT6A 1HNZH 3G8DA 1A48A 3N43B 1TAEA 2RDJA 4FS2A 1Y1WA 3Q8PB 3SGIA 4CE5A 4ED0A 5JQWA 1T36A 4JI4H 4LFCH 4ED6A 2C2EA 1XDNA 3GTOA 4CHIA 2VR1A 3G6YA 5BWWA 1W96A 4NZNA 4O7ZA 1CQIB 5BPHA 2YRXA 4I55F 1TWHA 2VUMG 3VA7A 5KFSA 2DWCA 3M9MB 4BBRG 5I5SA 4AQYH 1FJGH 2F4VH 1WRVA 5KFIA 3E5NA 3AW8A 1S0MA 1V9PA 2UXBH 3JAMW 4RB1A 4M7EA 2W6PA 4QWEA 3SI8A 5C8YF 2GPWA 2Z04A 4O7YA 2C35B 3V4ZA 5KT4A 3KHHA 1VKZA 4O7NA 2Q7DA 3JZFA 1KJQA 3HB9A 4WBNF 5DMXA 1X9NA 4QSHA 2PMZE 1T94A 2VPSA 4UCVA 1BGWA 3MWEA 4Q8EA 2HDKA 4BY1G 4DAAA 4LF6H 4JI3H 1I50A 4TVIA 3PO2G 2W6NA 2P0AA 3KYHC 2HVSA 4FFPA 1HNWH 4J9QA 1JXLA 3HOXG 4Q0YA 3T5LA 1CKOA 4O3NA 5A2QW 5F9NA 3UFXB 3ORRA 4CMDA 3VOTA 4C2MA 4EBEA 1KBLA 4O83A 1N33H 4PDBA 4DV5H 3RUPA 3W1BA 2EJ3A 4FE2A 4IR1A 2COIA 4ZI7F 2XC9A 3PZPA 2IA6A 2HGXA 4JI1H 3H3VH 4J9KA 4Q43A 5KX5F 2R8HA 4BY7G 3TY8A 2XGQA 4LFBH 3WO0A 1VBGA 2V59A 4BBSG 1SEIA 1I1MA 5KG3A 4QW9A 2NU7B 1EKVA 4WD3A 4X65H 2VA2A 3N41B 2QF7A 3Q8QB 2QYZA 1CS0A 2V4RA 5I5WA 2JEGA 3T9DA 4A2BA 2FK3A 5HBRB 1I94H 2UUCH 3QFFA 4EG0A 2YU9A 4C5AA 5IYDG 1UC9A 2VUGA 5FD6A 4XYLB 1A3GA 4FGRA 4O3SA 2V4QA 4M9UA 4HNTA 5BR8H 1S0NA 1R9TA 1JDBB 1JX4A 2J6SA 3T9EA 1Y1VA 1IBLH 4JV2A 1KJ8A 4DV3H 4YAKB 2AGOA 3L4JA 3DAAA 4Q4DA 3PN1A 5BWXA 3DTFA 3RV4A 2FPIB 3RFCA 3T9CA 4QIWE 2ZDQA 3RIZA 3HKZA 4RB2C 1IBMH 4DL7A 2HJWA 4NXMH 1KJ9A 4K6NA 4ZOLF 4HR7A 5LL6b 2I87A 4IZOA 1B6RA 2Y0SA 2V58A 5KFXA 4JUZA 4X62H 4A3MG 1EYZA 2YWVA 4RNMA 1VBHA 2GLTA 3KREA 2WDTA 1Y14B 4J9LA 4DR4H 4O3OA 4MV1A 2B63A 1J5EH 2R84A 4XX0B 3UYYA 3U9SA 1O75A 2HVRA 3FKIG 3BG5A 4JYAH 2YL2A 5LA6F 1GSAA 5C5JA 2FMAA 4U7CA 2MCTA 3OHAA 2W8KA 5KFLA 3NBYB 1EUCB 4LH7A 3BQ2A 3BJYA 2R7ZG 2HGWA 5EZYF 5IYZF 2E2HA 3G6XA 4WHXA 4ME6A 4B3TH 2ASDA 3K3PA 4O4JF 5FD5A 1PX2A 2SCUB 3GLKA 3N42B 3RB6A 4MAMA 3H4BA 4A3EG 1HNXH 2VA3A 2X0SA 4NZMA 4GLXA 3T1HH 3GTMA 2GPSA 4YR3A 3GIJA 2JA7G 4EEYA 3KTMA 4IR9A 4BWSC 2UVUA 3PVXA 4XZ3B 5CAEB 3TIIA 1DAAA 2YRWA 3R5HA 3TW7A 4O3QA 5KG4A 2HIXA 2W71A 2CNQA 3GIPA 3RGZA 2R93G 3BABA 2KSWA 4TM5A 4A3KG 4F4XA 1GLVA 2R85A 3CEBA 1RK5A 2CW7A 5KFRA 5LOVF 2FE3A 4O4IF 4LF4H 3PO3G 5DQHA 2YYAA 1RJQA 2J6UA 4A3LG 2C2RA 3QZ8A 2ZDGA 2CNUA 3KAKA 3PW2A 2JA8G 4UCUA 3GTLA 5I47A 4ECVA 1N48A 5EOYA 3RBEA 5JVLA 3U54A 5DQIA 2YCHA 4JXUA 4I4TF 4DR7H 2PBZA 5DGAA 4KHPH 5I60A 3H0GA 2HIVA 4Y8VB 4J9RA 4DRFA 3PR5B 2R92G 4FM9A 4GKJH 3BA9A 1BJTA 4TV8F 1RJRA 4DR3H 5BPFA 1K1QA 5JVDF 3KHRA 3I4NG 3Q2OA 1IYDA 3N8DA 3FMAA 2VQEH 1SYXB 3BA8A 4IWYA 3EPIA 3Q8RB 1CKNB 5KFEA 1CQJB 4ECWA 1OBDA 4ETSA 1K83A 2UU9H 4MV7A 4MV6A 4TUYF 4U6PA 2YS7A 4HNVA 3LMLA 2JA5G 3AX6A 4YAJB 4CKCA 4A3DG 3NC0B 4C5CA 5CM0A 3T54A 4YB8B 4JV0A 5DG8A 3K5IA 1XNQH 2NU8B 3WNZA 3RGXA 3VPCA 4A2AA 4K0KH 5KFAA 2IMWP 4A3IG 4Q8FA 2J9GA 1CKNA 1ZETA 1KTAA 5IYBG 5L9XA 2CNVA 5KG0A 4A3JG 1N32H 3GV8B 3GIMA 5IT9W 4AYBE 1K1SA 4DR6H 4ECUA 2VUMA 4EEQA 2AQ4A 4E4TA 4MTDA 4DV4H 2CW8A 5DGBA 4M0JA 1VS0A 2ALZA 4O7WA 4YP3A 3VMMA 3NUAA 1B6SA 4GC7A 1TWCA 3V6KA 4CC5A 4ECXA 5I5UA 3HOVG 3OHBA 1GO3E 4LF8H 2CKZB 2CFMA 4JI0H 3UQ8A 4JI7H 2FK1A 2V5AA 3JRWA 1WSCA 4O2AF 2Q2UA 2AGQA 1DIKA 1PK8A 2XCAA 4O3RA 2W7PA 1XNRH 4A93G 2I8CA 4DR5H 3RV3A 3J81W 3GTPA 4O2BF 3F8NA 5EWFA 1I7NA 1CKMA 2PVPA 3BQ1A 2BR0A 4NXNH 5DQGA 3HOZG 1T3NA 4IRKA 1A0IA 1JLLB 1Z2NX 1I7LA 2DIKA 1TWGA 4RAYA 1GSHA 1V4YA 2RF4A 4QWDA 4F4YA 3L2PA 1S03G 4LSXA 2DLNA 5CA1F 5C3EG 3HOYG 4YBZB 2HVQA 1G2WA 4MV8A 4EFEA 4L1KA 3SNOA 2AU0A 2A1HA 5IP9G 5KG6A 5KFPA 5BMVF 3KHLA 3Q1KA 2PMZA 4R7RA 3LQSA 4ED8A 1I6UA 4B3SH 2W6ZA 1SFOA 2RDIA 1XMOH 1RJPA 3OTOH 5DLGA 1BXRA 3R5XA 4MV3A 5D1PA 3TW6A 4ZHQF 5KFDA 5FPOA 3LWBA 3GIDA
chains in the Genus database with same CATH topology
2YZMA 3LP8A 4HNUA 1E4EB 1CE8A 2FB9A 1KC7A 3MWDA 1W93A 1M0TA 4RZQA 2R7KA 2IP4A 3VPBA 4O84A 1UC8A 4IIJF 1E4EA 2NU6B 5LXTF 4O81A 4ZQIA 1M6VA 2XCLA 2VQDA 4IHJF 3DF7A 3TQTA 3SE7A 3HO8A 2FPPB 2R6FA 4O7TA 1KUTA 1C30A 5K2MA 4MA0A 2NU9B 5CB4F 4FFOA 4O82A 2NUAB 4O7LA 4XYMB 4MV9A 1Z2PX 1EHIA 3K5HA 3TINA 3V4SA 4I50F 3N6RA 3ETJA 3MJFA 2DZDA 3ORQA 1IOVA 2R82A 3JRXA 3WO1A 1IOWA 4FFMA 4YJ2F 5J2TF 2FPGB 2W6OA 3R23A 1AUXA 1ULZA 4IWXA 3U9TA 3KALA 2I80A 3U55A 2W6MA 2GQSA 1JDEA 4EGQA 5JQGF 2QK4A 2R86A 1DV2A 3ETHA 2YZGA 1OBGA 2OLSA 1KJIA 2R7NA 5HV6A 1KJJA 2FP4B 4MV4A 5CA0F 2R87A 4O7SA 4FFLA 5H80A 5C1OA 1M0WA 1JKJB 4C5BA 4FFRA 1BNCA 2WYOA 4YJ3F 2C00A 1DV1A 1A9XA 1AUVA 2W70A 1SCUB 5D8DA 1C3OA 2ZDHA 4DIMA 3OUUA 3TIGA 4O86A 4FU0A 4TV9F 4NYEA 2R7LA 2R7MA 3HBLA 2Z02A 1GSOA 3R9RA 4EGJA 5JH7F 4O7RA 4DLKA 2CQYA 2PN1A 3G8CA 4O4LF 5LP6F 2CZGA 1EZ1A 3I12A 5J2UF 1GGOA 2YS6A 2VPQA 2YW2A 3KAJA 4O7VA 1EUDB 4HQ6A 1WR2A 2W6QA 3VPDA 5LYJF 5FNVF 5C1PA 3R5FA 3JZIA 5KKNB 2YZNA 4FFNA 4O4HF 2GQRA 4MA5A 2XD4A 2HGSA 5GONF 1Z2OX 3OUZA 2YZLA 1KEEA 3G8DA 1A48A 5JQWA 1T36A 2VR1A 1W96A 4O7ZA 1CQIB 5BPHA 2YRXA 4I55F 3VA7A 2DWCA 3E5NA 3AW8A 2W6PA 5C8YF 2GPWA 2Z04A 4O7YA 3V4ZA 1VKZA 4O7NA 3JZFA 1KJQA 3HB9A 4WBNF 5DMXA 4QSHA 3MWEA 2W6NA 2P0AA 4FFPA 3UFXB 3ORRA 3VOTA 1KBLA 4O83A 3RUPA 4FE2A 4ZI7F 5KX5F 3WO0A 1VBGA 2V59A 2NU7B 4WD3A 2QF7A 1CS0A 5HBRB 3QFFA 4EG0A 4C5AA 1UC9A 4XYLB 4FGRA 4M9UA 4HNTA 1JDBB 1KJ8A 4YAKB 3RV4A 2FPIB 3RFCA 2ZDQA 2HJWA 1KJ9A 4ZOLF 4HR7A 2I87A 4IZOA 1B6RA 2V58A 1EYZA 2YWVA 1VBHA 2GLTA 3KREA 4MV1A 2R84A 4XX0B 3U9SA 3BG5A 2YL2A 5LA6F 1GSAA 1EUCB 5EZYF 5IYZF 4ME6A 3K3PA 4O4JF 1PX2A 2SCUB 3GLKA 4MAMA 2X0SA 2GPSA 4XZ3B 5CAEB 3TIIA 2YRWA 3R5HA 2W71A 2CNQA 1GLVA 2R85A 5LOVF 4O4IF 2YYAA 2ZDGA 2CNUA 3KAKA 5I47A 5JVLA 3U54A 4I4TF 2PBZA 4Y8VB 4TV8F 5BPFA 5JVDF 3Q2OA 3N8DA 4IWYA 1CQJB 1OBDA 4MV7A 4MV6A 4TUYF 2YS7A 4HNVA 3AX6A 4YAJB 4C5CA 4YB8B 3K5IA 2NU8B 3WNZA 3VPCA 2J9GA 2CNVA 4E4TA 4O7WA 3VMMA 3NUAA 1B6SA 2V5AA 3JRWA 4O2AF 1DIKA 1PK8A 2I8CA 3RV3A 4O2BF 1I7NA 2PVPA 1JLLB 1Z2NX 1I7LA 2DIKA 1GSHA 2DLNA 5CA1F 4YBZB 4MV8A 4L1KA 5BMVF 3Q1KA 2W6ZA 1BXRA 3R5XA 4MV3A 3TW6A 4ZHQF 3LWBA 3GIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZM A;  3LP8 A;  4HNU A;  1E4E B;  1CE8 A;  2FB9 A;  1KC7 A;  3MWD A;  1W93 A;  1M0T A;  4RZQ A;  2R7K A;  2IP4 A;  3VPB A;  4O84 A;  1UC8 A;  4IIJ F;  1E4E A;  2NU6 B;  5LXT F;  4O81 A;  4ZQI A;  1M6V A;  2XCL A;  2VQD A;  4IHJ F;  3DF7 A;  3TQT A;  3SE7 A;  3HO8 A;  2FPP B;  2R6F A;  4O7T A;  1KUT A;  1C30 A;  5K2M A;  4MA0 A;  2NU9 B;  5CB4 F;  4FFO A;  4O82 A;  2NUA B;  4O7L A;  4XYM B;  4MV9 A;  1Z2P X;  1EHI A;  3K5H A;  3TIN A;  3V4S A;  4I50 F;  3N6R A;  3ETJ A;  3MJF A;  2DZD A;  3ORQ A;  1IOV A;  2R82 A;  3JRX A;  3WO1 A;  1IOW A;  4FFM A;  4YJ2 F;  5J2T F;  2FPG B;  2W6O A;  3R23 A;  1AUX A;  1ULZ A;  4IWX A;  3U9T A;  3KAL A;  2I80 A;  3U55 A;  2W6M A;  2GQS A;  1JDE A;  4EGQ A;  5JQG F;  2QK4 A;  2R86 A;  1DV2 A;  3ETH A;  2YZG A;  1OBG A;  2OLS A;  1KJI A;  2R7N A;  5HV6 A;  1KJJ A;  2FP4 B;  4MV4 A;  5CA0 F;  2R87 A;  4O7S A;  4FFL A;  5H80 A;  5C1O A;  1M0W A;  1JKJ B;  4C5B A;  4FFR A;  1BNC A;  2WYO A;  4YJ3 F;  2C00 A;  1DV1 A;  1A9X A;  1AUV A;  2W70 A;  1SCU B;  5D8D A;  1C3O A;  2ZDH A;  4DIM A;  3OUU A;  3TIG A;  4O86 A;  4FU0 A;  4TV9 F;  4NYE A;  2R7L A;  2R7M A;  3HBL A;  2Z02 A;  1GSO A;  3R9R A;  4EGJ A;  5JH7 F;  4O7R A;  4DLK A;  2CQY A;  2PN1 A;  3G8C A;  4O4L F;  5LP6 F;  2CZG A;  1EZ1 A;  3I12 A;  5J2U F;  1GGO A;  2YS6 A;  2VPQ A;  2YW2 A;  3KAJ A;  4O7V A;  1EUD B;  4HQ6 A;  1WR2 A;  2W6Q A;  3VPD A;  5LYJ F;  5FNV F;  5C1P A;  3R5F A;  3JZI A;  5KKN B;  2YZN A;  4FFN A;  4O4H F;  2GQR A;  4MA5 A;  2XD4 A;  2HGS A;  5GON F;  1Z2O X;  3OUZ A;  2YZL A;  1KEE A;  3G8D A;  1A48 A;  5JQW A;  1T36 A;  2VR1 A;  1W96 A;  4O7Z A;  1CQI B;  5BPH A;  2YRX A;  4I55 F;  3VA7 A;  2DWC A;  3E5N A;  3AW8 A;  2W6P A;  5C8Y F;  2GPW A;  2Z04 A;  4O7Y A;  3V4Z A;  1VKZ A;  4O7N A;  3JZF A;  1KJQ A;  3HB9 A;  4WBN F;  5DMX A;  4QSH A;  3MWE A;  2W6N A;  2P0A A;  4FFP A;  3UFX B;  3ORR A;  3VOT A;  1KBL A;  4O83 A;  3RUP A;  4FE2 A;  4ZI7 F;  5KX5 F;  3WO0 A;  1VBG A;  2V59 A;  2NU7 B;  4WD3 A;  2QF7 A;  1CS0 A;  5HBR B;  3QFF A;  4EG0 A;  4C5A A;  1UC9 A;  4XYL B;  4FGR A;  4M9U A;  4HNT A;  1JDB B;  1KJ8 A;  4YAK B;  3RV4 A;  2FPI B;  3RFC A;  2ZDQ A;  2HJW A;  1KJ9 A;  4ZOL F;  4HR7 A;  2I87 A;  4IZO A;  1B6R A;  2V58 A;  1EYZ A;  2YWV A;  1VBH A;  2GLT A;  3KRE A;  4MV1 A;  2R84 A;  4XX0 B;  3U9S A;  3BG5 A;  2YL2 A;  5LA6 F;  1GSA A;  1EUC B;  5EZY F;  5IYZ F;  4ME6 A;  3K3P A;  4O4J F;  1PX2 A;  2SCU B;  3GLK A;  4MAM A;  2X0S A;  2GPS A;  4XZ3 B;  5CAE B;  3TII A;  2YRW A;  3R5H A;  2W71 A;  2CNQ A;  1GLV A;  2R85 A;  5LOV F;  4O4I F;  2YYA A;  2ZDG A;  2CNU A;  3KAK A;  5I47 A;  5JVL A;  3U54 A;  4I4T F;  2PBZ A;  4Y8V B;  4TV8 F;  5BPF A;  5JVD F;  3Q2O A;  3N8D A;  4IWY A;  1CQJ B;  1OBD A;  4MV7 A;  4MV6 A;  4TUY F;  2YS7 A;  4HNV A;  3AX6 A;  4YAJ B;  4C5C A;  4YB8 B;  3K5I A;  2NU8 B;  3WNZ A;  3VPC A;  2J9G A;  2CNV A;  4E4T A;  4O7W A;  3VMM A;  3NUA A;  1B6S A;  2V5A A;  3JRW A;  4O2A F;  1DIK A;  1PK8 A;  2I8C A;  3RV3 A;  4O2B F;  1I7N A;  2PVP A;  1JLL B;  1Z2N X;  1I7L A;  2DIK A;  1GSH A;  2DLN A;  5CA1 F;  4YBZ B;  4MV8 A;  4L1K A;  5BMV F;  3Q1K A;  2W6Z A;  1BXR A;  3R5X A;  4MV3 A;  3TW6 A;  4ZHQ F;  3LWB A;  3GID A; 
#chains in the Genus database with same CATH topology
 3H4D A;  1GYF A;  2YZM A;  2FKL A;  4CMF A;  2HHH H;  3LP8 A;  4DR1 H;  5KFC A;  5EDW A;  3M9O B;  2W9A A;  5KFJ A;  3GIK A;  2UVW A;  4JI5 H;  4HNU A;  5KFO A;  2C22 A;  2JEF A;  3HT5 A;  4A3G G;  4UCT A;  2DPJ A;  1E4E B;  3M4I A;  4F4Z A;  1CE8 A;  3J80 W;  2W9B B;  4DV6 H;  2FB9 A;  1KC7 A;  3MWD A;  2WB1 E;  4DR2 H;  1S10 A;  5KFK A;  2WAQ E;  5KS8 A;  1W93 A;  1M0T A;  1S0O A;  2OH2 A;  4RZQ A;  5DAA A;  5IP7 G;  3WWJ A;  4LF5 H;  4NLG A;  1WCM G;  2R7K A;  4EFB A;  2HHF B;  1I2L A;  2IP4 A;  4CKE A;  3GV7 B;  1S97 A;  1B04 A;  3VPB A;  2UVR A;  2BQR A;  1UNN C;  3QZ7 A;  4DL3 A;  2ASL A;  3JSL A;  4O84 A;  1B33 N;  1UC8 A;  4PBC A;  2BQU A;  4IIJ F;  1E4E A;  2NU6 B;  5LXT F;  4O81 A;  5EWG A;  1MZB A;  2W9B A;  4PZ6 A;  4YR0 A;  3PR4 A;  4ZQI A;  5BWV A;  3H20 A;  3IG0 A;  4PWQ A;  3M9N B;  3IN5 A;  2W9C B;  1N34 H;  1M6V A;  4RB0 A;  5KG1 A;  4DUY H;  5FJ8 G;  4RNN A;  4YY3 H;  2VQF H;  2XCL A;  3JZ6 A;  2R8G A;  4MTE A;  2VQD A;  5DGI A;  3HOU G;  4IHJ F;  3DF7 A;  3NBZ B;  3FKI A;  2QB5 A;  4QIW A;  5L1L A;  3TQT A;  2HG8 A;  3SE7 A;  3BAC A;  3HO8 A;  5HNE A;  5KFG A;  2WTF A;  2FPP B;  4IAJ A;  4X66 H;  3KHG A;  2W9C A;  5K3W A;  2R6F A;  4F4W A;  4RCN A;  4ECS A;  4O7T A;  3DTG A;  1KUT A;  2R7Z A;  1I2K A;  4RNO A;  4CC6 A;  3FDS A;  3MR2 A;  3GTQ A;  5T14 A;  4BXX G;  3V6H A;  5JUM A;  5FLM G;  2EJ2 A;  4QWC A;  2W7O A;  3T9F A;  3NGD A;  4ECZ A;  5KFF A;  1C30 A;  5K2M A;  2XCP A;  4ED2 A;  3QQM A;  2Y4R A;  3RB4 A;  3GTK A;  4MA0 A;  5FLX W;  2NU9 B;  5CB4 F;  5LMN H;  4FFO A;  4FS1 A;  2JA7 A;  4Q4C A;  3I4M G;  3UZB A;  4O82 A;  3UZO A;  1RYS A;  3MWM A;  2OWO A;  3RBD A;  4GKK H;  4FBT A;  3CSW A;  2NUA B;  1RK6 A;  4J9P A;  5L1K A;  3OSN A;  1Y1W G;  3GB8 B;  1A0G A;  4O7L A;  1VAJ A;  4X64 H;  4GC6 A;  4XYM B;  4DL6 A;  3GIL A;  4A3F G;  5KT3 A;  3PW0 A;  1FKA H;  2JEJ A;  4YQW A;  4MV9 A;  5EWE A;  1Z2P X;  4HN2 A;  1EHI A;  3K5H A;  3TIN A;  5I5T A;  3V4S A;  4IRC A;  4DL5 A;  1JIH A;  2ZJT A;  4I50 F;  4ECQ A;  3RAQ A;  3N6R A;  3ETJ A;  2XGP A;  3OSP A;  3MJF A;  5KG2 A;  5I5Y A;  3ORQ A;  2DZD A;  1IOV A;  4ED1 A;  2JA6 G;  3W1G A;  1E4F T;  1FVI A;  2R92 A;  1XMQ H;  2ODT X;  2R82 A;  3MR3 A;  3JRX A;  2J6T A;  5E25 A;  1ZHS A;  2UUB H;  2IBK A;  3WO1 A;  1IOW A;  4FFM A;  4YJ2 F;  3PFF A;  2COG A;  2FPG B;  5J2T F;  4O3P A;  4J9N A;  1N36 H;  2W6O A;  3R23 A;  1AUX A;  1ULZ A;  4IWX A;  5D1O B;  3KAL A;  3U9T A;  2I80 A;  3U55 A;  2WE6 A;  5DLF A;  5KG5 A;  3RAX A;  3L4K A;  5KFY A;  2JA5 A;  4NZO A;  2W6M A;  2GQS A;  1JDE A;  4EGQ A;  4J9S A;  1P16 A;  3RTX A;  4Q45 A;  2JA6 A;  5JQG F;  1E4G T;  4JI6 H;  5BWU A;  1KT8 A;  3S24 A;  3T7A A;  5CE8 A;  5DG9 A;  2ZM6 H;  4RUA A;  4J9O A;  4DV1 H;  3W5O A;  2DPI A;  4B3M H;  2QK4 A;  2X5R A;  5BYB A;  2AGP A;  1RYR A;  4RAZ A;  2EIY A;  3HXL A;  4R8U B;  2R86 A;  1L2Z A;  5D1O A;  4ECT A;  1DV2 A;  3ETH A;  1TWA A;  4DV0 H;  5DG7 A;  2ABJ A;  2YZG A;  4F50 A;  1I1K A;  3TY9 A;  4DL4 A;  4IRD A;  1OBG A;  3GJX B;  3C0F B;  4PZ8 A;  2OLS A;  3GII A;  3Q8S B;  3N40 P;  1KJI A;  1IBK H;  3H40 A;  2R7N A;  2W8L A;  3GIQ A;  4OX9 H;  3TQ1 A;  3HKZ E;  5C4X G;  4LF9 H;  5HV6 A;  5BWR A;  1KJJ A;  2R8J A;  3QWU A;  3CQZ A;  2FP4 B;  4MV4 A;  2Y0S E;  1ZQ7 A;  4R8U A;  5CA0 F;  4EYI B;  2FLN A;  1AN7 A;  4TQS A;  3MFI A;  3T9B A;  5BYA A;  2R87 A;  5KFV A;  5KT7 A;  2NVX A;  2E2I A;  1TWF A;  4AYB A;  4O7S A;  5KFW A;  4FFL A;  1Y1V G;  3G6V A;  4RU9 A;  2ZGI A;  5DGH A;  3KXY T;  2C2D A;  5H80 A;  5C1O A;  1M0W A;  3T5K A;  2NVY A;  3N44 B;  2BQ3 A;  5DIS C;  3U0G A;  1WH2 A;  3VNN A;  2EJ0 A;  1EKP A;  1JKJ B;  4C5B A;  4FFR A;  2M05 A;  1TA8 A;  2ATL A;  2UXD H;  2DAA A;  1IYE A;  2FLP A;  1HR0 H;  1BNC A;  5CR5 A;  3T1Y H;  1N56 A;  2WYO A;  2R8K A;  4YJ3 F;  4RZR A;  4G3I A;  4QJF A;  2C00 A;  1DV1 A;  5KFH A;  1EKF A;  1A9X A;  3GV5 B;  1AUV A;  2W70 A;  1SCU B;  3BQ0 A;  4J0M A;  4B3R H;  4UCO A;  3K3V A;  4CKB A;  2B63 G;  3V6J A;  4UCR A;  5D8D A;  4JI8 H;  1C3O A;  2ZDH A;  1DGS A;  2DAB A;  3RR5 A;  3TY5 A;  4DIM A;  2O03 A;  1P8L A;  4J9M A;  3OUU A;  4LH6 A;  5BWT A;  3TIG A;  5I5X A;  1ET0 A;  4O86 A;  5KFT A;  2FK2 A;  3BAA A;  4FU0 A;  4TV9 F;  4LMY A;  4NYE A;  2RGR A;  4EYH B;  3AYH B;  2VOB A;  3T5J A;  2R7L A;  2R7M A;  3HBL A;  2COJ A;  2W57 A;  2Z02 A;  1M7J A;  1ZAU A;  4DV2 H;  1GSO A;  3R9R A;  3JSN A;  3T9A A;  4Q44 A;  4LSA A;  1V51 A;  2HHF A;  4EGJ A;  2Q2T A;  5I5V A;  4EBD A;  3PW5 A;  5KG7 A;  5JH7 F;  4O7R A;  1WCM A;  4DLK A;  3HOW G;  4JV5 H;  4JV1 A;  4A3B G;  4QW8 A;  4ECR A;  2CQY A;  2JEI A;  2PN1 A;  4EQ5 A;  4YR2 A;  3G8C A;  4UCS A;  4O4L F;  1OWT A;  2R8I A;  5KT5 A;  5LP6 F;  5KFM A;  2CZG A;  3MR6 A;  1EZ1 A;  2UXC H;  3I12 A;  1S68 A;  2WB1 A;  3RB3 A;  2ASJ A;  2WAQ A;  4EBC A;  2UVV A;  2FJZ A;  4GLW A;  3TEK A;  4ED7 A;  5J2U F;  5L1I A;  4DUZ H;  3WWH A;  3N6X A;  1GGO A;  3KAJ A;  2YS6 A;  2VPQ A;  2YW2 A;  2RGV A;  1I1L A;  4O7V A;  3EYY A;  4QWB A;  4APM A;  3RJ0 A;  2V9W A;  4UUG A;  1EUD B;  4HQ6 A;  4QWA A;  3MFH A;  1WR2 A;  4DQN A;  3T5H A;  3PW7 A;  4LF7 H;  1XK5 A;  4RB3 C;  2W6Q A;  3VPD A;  4ECY A;  5KFQ A;  5IWA H;  4DL2 A;  2UUA H;  5LYJ F;  4FBU A;  2E5L H;  5FNV F;  1ZHQ A;  3H0G G;  5KT2 A;  4TQR A;  4UFZ A;  5C1P A;  3R5F A;  4DV7 H;  4PZ7 A;  3JZI A;  5KFB A;  4YHH H;  5KKN B;  2YZN A;  4FFN A;  5L1J A;  4E6N A;  4LFA H;  4O4H F;  3RF2 A;  5LMU H;  3GTJ A;  2GQR A;  4MA5 A;  3CVZ A;  5F9L A;  2XD4 A;  3MR5 A;  3PW4 A;  3RB0 A;  2FLL A;  4A3C G;  3GTG A;  2HGS A;  4RUC A;  3LUL A;  4HYK A;  3GDE A;  3GQC A;  5GON F;  4JI2 H;  1Z2O X;  2C28 A;  5FR9 A;  1S9F A;  3EPG A;  3OUZ A;  3J7A K;  4I7H A;  2R93 A;  2YZL A;  3T99 A;  5KFN A;  5FPR A;  3WWI A;  1KEE A;  1I3Q A;  5KFU A;  5KFZ A;  2XIG A;  5IYC G;  4ED3 A;  5C44 G;  5KT6 A;  1HNZ H;  3G8D A;  1A48 A;  3N43 B;  1TAE A;  2RDJ A;  4FS2 A;  1Y1W A;  3Q8P B;  3SGI A;  4CE5 A;  4ED0 A;  5JQW A;  1T36 A;  4JI4 H;  4LFC H;  4ED6 A;  2C2E A;  1XDN A;  3GTO A;  4CHI A;  2VR1 A;  3G6Y A;  5BWW A;  1W96 A;  4NZN A;  4O7Z A;  1CQI B;  5BPH A;  2YRX A;  4I55 F;  1TWH A;  2VUM G;  3VA7 A;  5KFS A;  2DWC A;  3M9M B;  4BBR G;  5I5S A;  4AQY H;  1FJG H;  2F4V H;  1WRV A;  5KFI A;  3E5N A;  3AW8 A;  1S0M A;  1V9P A;  2UXB H;  3JAM W;  4RB1 A;  4M7E A;  2W6P A;  4QWE A;  3SI8 A;  5C8Y F;  2GPW A;  2Z04 A;  4O7Y A;  2C35 B;  3V4Z A;  5KT4 A;  3KHH A;  1VKZ A;  4O7N A;  2Q7D A;  3JZF A;  1KJQ A;  3HB9 A;  4WBN F;  5DMX A;  1X9N A;  4QSH A;  2PMZ E;  1T94 A;  2VPS A;  4UCV A;  1BGW A;  3MWE A;  4Q8E A;  2HDK A;  4BY1 G;  4DAA A;  4LF6 H;  4JI3 H;  1I50 A;  4TVI A;  3PO2 G;  2W6N A;  2P0A A;  3KYH C;  2HVS A;  4FFP A;  1HNW H;  4J9Q A;  1JXL A;  3HOX G;  4Q0Y A;  3T5L A;  1CKO A;  4O3N A;  5A2Q W;  5F9N A;  3UFX B;  3ORR A;  4CMD A;  3VOT A;  4C2M A;  4EBE A;  1KBL A;  4O83 A;  1N33 H;  4PDB A;  4DV5 H;  3RUP A;  3W1B A;  2EJ3 A;  4FE2 A;  4IR1 A;  2COI A;  4ZI7 F;  2XC9 A;  3PZP A;  2IA6 A;  2HGX A;  4JI1 H;  3H3V H;  4J9K A;  4Q43 A;  5KX5 F;  2R8H A;  4BY7 G;  3TY8 A;  2XGQ A;  4LFB H;  3WO0 A;  1VBG A;  2V59 A;  4BBS G;  1SEI A;  1I1M A;  5KG3 A;  4QW9 A;  2NU7 B;  1EKV A;  4WD3 A;  4X65 H;  2VA2 A;  3N41 B;  2QF7 A;  3Q8Q B;  2QYZ A;  1CS0 A;  2V4R A;  5I5W A;  2JEG A;  3T9D A;  4A2B A;  2FK3 A;  5HBR B;  1I94 H;  2UUC H;  3QFF A;  4EG0 A;  2YU9 A;  4C5A A;  5IYD G;  1UC9 A;  2VUG A;  5FD6 A;  4XYL B;  1A3G A;  4FGR A;  4O3S A;  2V4Q A;  4M9U A;  4HNT A;  5BR8 H;  1S0N A;  1R9T A;  1JDB B;  1JX4 A;  2J6S A;  3T9E A;  1Y1V A;  1IBL H;  4JV2 A;  1KJ8 A;  4DV3 H;  4YAK B;  2AGO A;  3L4J A;  3DAA A;  4Q4D A;  3PN1 A;  5BWX A;  3DTF A;  3RV4 A;  2FPI B;  3RFC A;  3T9C A;  4QIW E;  2ZDQ A;  3RIZ A;  3HKZ A;  4RB2 C;  1IBM H;  4DL7 A;  2HJW A;  4NXM H;  1KJ9 A;  4K6N A;  4ZOL F;  4HR7 A;  5LL6 b;  2I87 A;  4IZO A;  1B6R A;  2Y0S A;  2V58 A;  5KFX A;  4JUZ A;  4X62 H;  4A3M G;  1EYZ A;  2YWV A;  4RNM A;  1VBH A;  2GLT A;  3KRE A;  2WDT A;  1Y14 B;  4J9L A;  4DR4 H;  4O3O A;  4MV1 A;  2B63 A;  1J5E H;  2R84 A;  4XX0 B;  3UYY A;  3U9S A;  1O75 A;  2HVR A;  3FKI G;  3BG5 A;  4JYA H;  2YL2 A;  5LA6 F;  1GSA A;  5C5J A;  2FMA A;  4U7C A;  2MCT A;  3OHA A;  2W8K A;  5KFL A;  3NBY B;  1EUC B;  4LH7 A;  3BQ2 A;  3BJY A;  2R7Z G;  2HGW A;  5EZY F;  5IYZ F;  2E2H A;  3G6X A;  4WHX A;  4ME6 A;  4B3T H;  2ASD A;  3K3P A;  4O4J F;  5FD5 A;  1PX2 A;  2SCU B;  3GLK A;  3N42 B;  3RB6 A;  4MAM A;  3H4B A;  4A3E G;  1HNX H;  2VA3 A;  2X0S A;  4NZM A;  4GLX A;  3T1H H;  3GTM A;  2GPS A;  4YR3 A;  3GIJ A;  2JA7 G;  4EEY A;  3KTM A;  4IR9 A;  4BWS C;  2UVU A;  3PVX A;  4XZ3 B;  5CAE B;  3TII A;  1DAA A;  2YRW A;  3R5H A;  3TW7 A;  4O3Q A;  5KG4 A;  2HIX A;  2W71 A;  2CNQ A;  3GIP A;  3RGZ A;  2R93 G;  3BAB A;  2KSW A;  4TM5 A;  4A3K G;  4F4X A;  1GLV A;  2R85 A;  3CEB A;  1RK5 A;  2CW7 A;  5KFR A;  5LOV F;  2FE3 A;  4O4I F;  4LF4 H;  3PO3 G;  5DQH A;  2YYA A;  1RJQ A;  2J6U A;  4A3L G;  2C2R A;  3QZ8 A;  2ZDG A;  2CNU A;  3KAK A;  3PW2 A;  2JA8 G;  4UCU A;  3GTL A;  5I47 A;  4ECV A;  1N48 A;  5EOY A;  3RBE A;  5JVL A;  3U54 A;  5DQI A;  2YCH A;  4JXU A;  4I4T F;  4DR7 H;  2PBZ A;  5DGA A;  4KHP H;  5I60 A;  3H0G A;  2HIV A;  4Y8V B;  4J9R A;  4DRF A;  3PR5 B;  2R92 G;  4FM9 A;  4GKJ H;  3BA9 A;  1BJT A;  4TV8 F;  1RJR A;  4DR3 H;  5BPF A;  1K1Q A;  5JVD F;  3KHR A;  3I4N G;  3Q2O A;  1IYD A;  3N8D A;  3FMA A;  2VQE H;  1SYX B;  3BA8 A;  4IWY A;  3EPI A;  3Q8R B;  1CKN B;  5KFE A;  1CQJ B;  4ECW A;  1OBD A;  4ETS A;  1K83 A;  2UU9 H;  4MV7 A;  4MV6 A;  4TUY F;  4U6P A;  2YS7 A;  4HNV A;  3LML A;  2JA5 G;  3AX6 A;  4YAJ B;  4CKC A;  4A3D G;  3NC0 B;  4C5C A;  5CM0 A;  3T54 A;  4YB8 B;  4JV0 A;  5DG8 A;  3K5I A;  1XNQ H;  2NU8 B;  3WNZ A;  3RGX A;  3VPC A;  4A2A A;  4K0K H;  5KFA A;  2IMW P;  4A3I G;  4Q8F A;  2J9G A;  1CKN A;  1ZET A;  1KTA A;  5IYB G;  5L9X A;  2CNV A;  5KG0 A;  4A3J G;  1N32 H;  3GV8 B;  3GIM A;  5IT9 W;  4AYB E;  1K1S A;  4DR6 H;  4ECU A;  2VUM A;  4EEQ A;  2AQ4 A;  4E4T A;  4MTD A;  4DV4 H;  2CW8 A;  5DGB A;  4M0J A;  1VS0 A;  2ALZ A;  4O7W A;  4YP3 A;  3VMM A;  3NUA A;  1B6S A;  4GC7 A;  1TWC A;  3V6K A;  4CC5 A;  4ECX A;  5I5U A;  3HOV G;  3OHB A;  1GO3 E;  4LF8 H;  2CKZ B;  2CFM A;  4JI0 H;  3UQ8 A;  4JI7 H;  2FK1 A;  2V5A A;  3JRW A;  1WSC A;  4O2A F;  2Q2U A;  2AGQ A;  1DIK A;  1PK8 A;  2XCA A;  4O3R A;  2W7P A;  1XNR H;  4A93 G;  2I8C A;  4DR5 H;  3RV3 A;  3J81 W;  3GTP A;  4O2B F;  3F8N A;  5EWF A;  1I7N A;  1CKM A;  2PVP A;  3BQ1 A;  2BR0 A;  4NXN H;  5DQG A;  3HOZ G;  1T3N A;  4IRK A;  1A0I A;  1JLL B;  1Z2N X;  1I7L A;  2DIK A;  1TWG A;  4RAY A;  1GSH A;  1V4Y A;  2RF4 A;  4QWD A;  4F4Y A;  3L2P A;  1S03 G;  4LSX A;  2DLN A;  5CA1 F;  5C3E G;  3HOY G;  4YBZ B;  2HVQ A;  1G2W A;  4MV8 A;  4EFE A;  4L1K A;  3SNO A;  2AU0 A;  2A1H A;  5IP9 G;  5KG6 A;  5KFP A;  5BMV F;  3KHL A;  3Q1K A;  2PMZ A;  4R7R A;  3LQS A;  4ED8 A;  1I6U A;  4B3S H;  2W6Z A;  1SFO A;  2RDI A;  1XMO H;  1RJP A;  3OTO H;  5DLG A;  1BXR A;  3R5X A;  4MV3 A;  5D1P A;  3TW6 A;  4ZHQ F;  5KFD A;  5FPO A;  3LWB A;  3GID A; 
#chains in the Genus database with same CATH homology
 2YZM A;  3LP8 A;  4HNU A;  1E4E B;  1CE8 A;  2FB9 A;  1KC7 A;  3MWD A;  1W93 A;  1M0T A;  4RZQ A;  2R7K A;  2IP4 A;  3VPB A;  4O84 A;  1UC8 A;  4IIJ F;  1E4E A;  2NU6 B;  5LXT F;  4O81 A;  4ZQI A;  1M6V A;  2XCL A;  2VQD A;  4IHJ F;  3DF7 A;  3TQT A;  3SE7 A;  3HO8 A;  2FPP B;  2R6F A;  4O7T A;  1KUT A;  1C30 A;  5K2M A;  4MA0 A;  2NU9 B;  5CB4 F;  4FFO A;  4O82 A;  2NUA B;  4O7L A;  4XYM B;  4MV9 A;  1Z2P X;  1EHI A;  3K5H A;  3TIN A;  3V4S A;  4I50 F;  3N6R A;  3ETJ A;  3MJF A;  2DZD A;  3ORQ A;  1IOV A;  2R82 A;  3JRX A;  3WO1 A;  1IOW A;  4FFM A;  4YJ2 F;  5J2T F;  2FPG B;  2W6O A;  3R23 A;  1AUX A;  1ULZ A;  4IWX A;  3U9T A;  3KAL A;  2I80 A;  3U55 A;  2W6M A;  2GQS A;  1JDE A;  4EGQ A;  5JQG F;  2QK4 A;  2R86 A;  1DV2 A;  3ETH A;  2YZG A;  1OBG A;  2OLS A;  1KJI A;  2R7N A;  5HV6 A;  1KJJ A;  2FP4 B;  4MV4 A;  5CA0 F;  2R87 A;  4O7S A;  4FFL A;  5H80 A;  5C1O A;  1M0W A;  1JKJ B;  4C5B A;  4FFR A;  1BNC A;  2WYO A;  4YJ3 F;  2C00 A;  1DV1 A;  1A9X A;  1AUV A;  2W70 A;  1SCU B;  5D8D A;  1C3O A;  2ZDH A;  4DIM A;  3OUU A;  3TIG A;  4O86 A;  4FU0 A;  4TV9 F;  4NYE A;  2R7L A;  2R7M A;  3HBL A;  2Z02 A;  1GSO A;  3R9R A;  4EGJ A;  5JH7 F;  4O7R A;  4DLK A;  2CQY A;  2PN1 A;  3G8C A;  4O4L F;  5LP6 F;  2CZG A;  1EZ1 A;  3I12 A;  5J2U F;  1GGO A;  2YS6 A;  2VPQ A;  2YW2 A;  3KAJ A;  4O7V A;  1EUD B;  4HQ6 A;  1WR2 A;  2W6Q A;  3VPD A;  5LYJ F;  5FNV F;  5C1P A;  3R5F A;  3JZI A;  5KKN B;  2YZN A;  4FFN A;  4O4H F;  2GQR A;  4MA5 A;  2XD4 A;  2HGS A;  5GON F;  1Z2O X;  3OUZ A;  2YZL A;  1KEE A;  3G8D A;  1A48 A;  5JQW A;  1T36 A;  2VR1 A;  1W96 A;  4O7Z A;  1CQI B;  5BPH A;  2YRX A;  4I55 F;  3VA7 A;  2DWC A;  3E5N A;  3AW8 A;  2W6P A;  5C8Y F;  2GPW A;  2Z04 A;  4O7Y A;  3V4Z A;  1VKZ A;  4O7N A;  3JZF A;  1KJQ A;  3HB9 A;  4WBN F;  5DMX A;  4QSH A;  3MWE A;  2W6N A;  2P0A A;  4FFP A;  3UFX B;  3ORR A;  3VOT A;  1KBL A;  4O83 A;  3RUP A;  4FE2 A;  4ZI7 F;  5KX5 F;  3WO0 A;  1VBG A;  2V59 A;  2NU7 B;  4WD3 A;  2QF7 A;  1CS0 A;  5HBR B;  3QFF A;  4EG0 A;  4C5A A;  1UC9 A;  4XYL B;  4FGR A;  4M9U A;  4HNT A;  1JDB B;  1KJ8 A;  4YAK B;  3RV4 A;  2FPI B;  3RFC A;  2ZDQ A;  2HJW A;  1KJ9 A;  4ZOL F;  4HR7 A;  2I87 A;  4IZO A;  1B6R A;  2V58 A;  1EYZ A;  2YWV A;  1VBH A;  2GLT A;  3KRE A;  4MV1 A;  2R84 A;  4XX0 B;  3U9S A;  3BG5 A;  2YL2 A;  5LA6 F;  1GSA A;  1EUC B;  5EZY F;  5IYZ F;  4ME6 A;  3K3P A;  4O4J F;  1PX2 A;  2SCU B;  3GLK A;  4MAM A;  2X0S A;  2GPS A;  4XZ3 B;  5CAE B;  3TII A;  2YRW A;  3R5H A;  2W71 A;  2CNQ A;  1GLV A;  2R85 A;  5LOV F;  4O4I F;  2YYA A;  2ZDG A;  2CNU A;  3KAK A;  5I47 A;  5JVL A;  3U54 A;  4I4T F;  2PBZ A;  4Y8V B;  4TV8 F;  5BPF A;  5JVD F;  3Q2O A;  3N8D A;  4IWY A;  1CQJ B;  1OBD A;  4MV7 A;  4MV6 A;  4TUY F;  2YS7 A;  4HNV A;  3AX6 A;  4YAJ B;  4C5C A;  4YB8 B;  3K5I A;  2NU8 B;  3WNZ A;  3VPC A;  2J9G A;  2CNV A;  4E4T A;  4O7W A;  3VMM A;  3NUA A;  1B6S A;  2V5A A;  3JRW A;  4O2A F;  1DIK A;  1PK8 A;  2I8C A;  3RV3 A;  4O2B F;  1I7N A;  2PVP A;  1JLL B;  1Z2N X;  1I7L A;  2DIK A;  1GSH A;  2DLN A;  5CA1 F;  4YBZ B;  4MV8 A;  4L1K A;  5BMV F;  3Q1K A;  2W6Z A;  1BXR A;  3R5X A;  4MV3 A;  3TW6 A;  4ZHQ F;  3LWB A;  3GID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...