4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
publication title Crystal structure of DNA ligase
rcsb
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
4PZ8A 1TAEA 1DGSA 4PZ7A 1IBLB 3NC0B 4JI6B 1V9PA 2ZM6B 1FVIA 2HVQA 5D1OB 2UUCB 4GLXA 4UCOA 3OTOB 5LMNB 4DR7B 1A0IA 1CKOA 4JI4B 1CKNA 2HVSA 1B04A 4JI0B 4UCRA 4CC5A 4LH6A 4YHHB 3RTXA 4DV7B 2HVRA 1ZAUA 4DV4B 1IBMB 4B3RB 3GB8B 4DV6B 4CC6A 1X9NA 4NXNB 1CKNB 2UXCB 4UCUA 4B3TB 2Q2TA 4LFAB 3NBYB 1N32B 5DISC 3BAAA 4DV3B 4LH7A 5IWAB 4EEQA 4DV0B 3GDEA 3S24A 4DR4B 3TY5A 3VNNA 4JI1B 2HIVA 3GJXB 4DUYB 5D1PA 1VS0A 3L2PA 4EFBA 5LMUB 4JI2B 4TOIA 1IBKB 4UFZA 4DR5B 3PN1A 5FPRA 1J5EB 4DV2B 3BABA 4PZ6A 4UCTA 3BA9A 1I94B 2UXDB 2HIXA 3BA8A 4AQYB 3JSLA 1HNWB 4LFBB 1XMQB 3W1GA 4UCSA 4JV5B 1HNXB 1P8LA 1N36B 3TY9A 2VQFB 1N33B 4LF5B 5BR8B 4YY3B 1N34B 2F4VB 2Q2UA 4JI8B 1XK5A 4DR1B 1XDNA 4X64B 4DR3B 4B3SB 3W5OA 2E5LB 2UXBB 3SGIA 4JI3B 4B3MB 5FPOA 2UU9B 4LF6B 1FJGB 4EQ5A 4GKJB 4EFEA 3T1HB 4DV5B 4X65B 1P16A 2HHHB 1CKMA 3JSNA 4DRFA 3QWUA 1XNQB 4X66B 3KYHC 1HNZB 4NXMB 4LFCB 2UUAB 4OX9B 4GKKB 2VUGA 1HR0B 3RR5A 4K0KB 1XMOB 3TY8A 4KHPB 1S68A 1XNRB 3NBZB 3W1BA 4LF4B 3T1YB 3UQ8A 4DR6B 2VQEB 4UCVA 4JI5B 4DR2B 2UUBB 2CFMA 4JI7B 1TA8A 4LF7B 4LF8B 5D1OA 4LF9B 2OWOA 4E6NA 4DUZB 4JYAB 4DV1B 4X62B
chains in the Genus database with same CATH superfamily
2QWRB 3VOTA 1GN2A 3R5XA 4IT5A 4X1IA 4YB8B 2IBZH 2HVQA 1OCCB 5KFVA 5I60A 5J2UB 1A0IA 1M93A 1SA0A 5L3DA 3TXSA 2R85A 4MTEA 1KJQA 4O4LA 1XILA 4JV5O 4K0KO 3TGUH 5KFXA 4XX0B 5LP6F 2VQFH 2HGSA 5LMUH 4B3SH 3OR7C 4JI5O 4IWYA 4Q8EA 4I4TB 1YITV 2BOCC 4EEQA 3M9OB 3C3TA 5CA1B 1MNGA 2H3OA 4NZNA 1RM1B 1H2GA 1TGOA 1S0VA 1K73W 3SYQA 4TVIA 3E8FA 2EILB 2ZIMA 3R5HA 1K3EA 2LJ2A 1BT8A 4I4TA 3G71V 4JV5H 1SQQH 1FS0G 3T1CA 1A9XA 4K0KH 4UCTA 2JEXA 3SYAA 4BIUA 3B4SA 1Q86W 3G6BA 3SJBC 3HOXG 4YR0A 1D2DA 2FK3A 2PTMA 2Q7GA 1JDEA 1DIKA 3JSLA 3JCUZ 4N23A 1SZTA 4O7YA 4JI5H 4A2AA 1EKFA 3JAWA 1N0NA 2CH7A 4RUCA 3RYIB 1P8LA 3UO3A 4O3PA 3BJYA 1GM8A 2GHYA 5BR8B 2OCCC 1VQ9V 4J9SA 4TQDA 3GV8B 5I5VA 2P90A 1YF2A 3R9RA 2MK3A 3FX7A 2Q0AA 2ZCEA 1HWYA 2PUSA 4O7RA 1IOWA 4C5AA 3T5HA 1BNCA 4ED8A 4ED3A 4FLYA 1E1QG 3RYIA 4O4HF 3LMLA 5KFIA 3L71H 1HNZB 2VR1A 1EKPA 3J81W 1VF6C 4GKKB 5I5XA 3AW8A 5AG2A 4PDVA 3NR7A 1BS3A 4GUNA 5GTHZ 5DEDA 3Q8QB 2HFEC 2EIMC 4DR2B 1G1XB 4TV9A 2W6IG 5LYJB 3GQCA 1I50A 3MR5A 3H1HH 4DK0A 2JRIA 5ITZB 4TUYB 1H2SB 1TWGA 1MG1A 3LNMB 3KAJA 3JD1A 5EBWC 3U0GA 5KFRA 3MR3A 3ZHQA 3E35A 2XC9A 3SR2C 2AGQA 3RAQA 3NXSA 4CH4A 1E4GT 4ECWA 5KT2A 2QM4A 2HEPA 1CXZB 1B3QA 3ZHTA 2YIBD 1N34O 1KB9F 1NS1A 2W57A 3UM7A 3SPHA 3GIMA 3ETEA 1Y76B 1DTOA 1QQCA 2WLHA 3ABMB 5BWXA 4RB0A 2ASDA 2XASA 3N2GB 1R3IC 4JI7O 4QWDA 3V6HA 1K1SA 3CCUV 4DV1O 1G8MA 5EC2C 1NVPD 5KFNA 4JV2A 4XYLB 2HJFC 1D5AA 2DOSA 1IBKB 1GH6A 4LWSB 2RMKB 1I2LA 2HJWA 3B09A 3UCSC 2QR4A 4ECTA 5IDJA 3I4NG 2HR3A 2K9PA 4TM5A 3PW7A 2R7ZA 3BFRA 4XBFA 4DQNA 2EIJC 2EZOA 1N34H 3I4MG 5KG7A 3CCLV 2B5UA 3OM3B 1KBHA 3OGCC 5KAFZ 1GO3F 4LF7O 2HKOA 4JI7H 1YEWA 3RUPA 4DL2A 2XAQA 4RNMA 1ROPA 4PD4F 4O4IB 3CXHF 1XK5A 1R1BA 1MSWD 1SESA 4DR3B 4DV1H 2K1EA 2BE3A 4KXRA 5IYCG 2LW1A 5LHIA 3OUUA 3L4KA 1S3JA 3THOA 5L1IA 4LF6B 5CA0F 5I5UA 5KFCA 4JGSA 3OHAA 2V9WA 5KG1A 4B08A 1BJTA 3MHHC 2HHHB 2PF4E 1CKMA 1SQVH 4O7TA 3Q2OA 4O2BF 2ZNJA 2BR0A 1E79G 1S10A 4FPPA 1UC8A 1SRYA 3ZRSA 4EBDA 4C5BA 2ZDIC 4LF7H 2RDJA 2UXCO 2CNVA 3L73H 3PW0A 3V6KA 1XNRB 1WPBA 2RN9A 4CMDA 3JATA 4AI8A 3RVZA 2YEVA 1NR7A 4O4HA 3H4DA 2FB9A 3G80A 5BR8O 3HBLA 4LR3A 2I87A 5JQWA 4J9PA 1M90W 2PYLA 1C3OA 4LCUC 4NTYA 1GTOA 4DUZB 4NYEA 2JEIA 1NTZH 4TV8F 5DAAA 3K3WA 4EGQA 5C3EG 4L8JA 1YZBA 2FPPB 4F4WA 1VQPV 1YCIA 1FXKB 1Y1WA 5LMNB 1K97A 2A7WA 3QF7A 1HNZO 2O57A 4JI4B 2UXCH 1B04A 3WWJA 4GKKO 2BSKB 4ED6A 1DLBA 3I56V 2NU6B 1ZAUA 3FYIB 3HKEB 5BR8H 3ASOB 4LNUB 1FXKA 2ZT9B 3ASNC 2NUAB 2FE3A 3P30A 5I47A 3H9VA 4QGPA 2YZLA 4I55F 4DR2O 2D3OW 5J2TA 1EN5A 4HR7A 2B63G 2WAMA 3VNNA 1K4DC 5HNEA 3AG7A 4D7TA 4DUYB 5IY5C 5I5TA 4A3FG 3HKEA 2XCPA 2M7WA 4TOIA 2C2DA 2EBOA 3ETQA 4OPHA 2UVVA 1ZL8A 3Q1KA 2XHBA 5FLXW 4PA3A 2DE0X 2XGQA 5FD5A 3JALB 4WCEV 4WFAV 2Y0SA 5GW7A 2UXDB 4O83A 5KFEA 1S0NA 1YJ9V 2I8CA 1IYEA 3ORRA 3APOA 4LFBB 4XDLA 3GWOA 3OUFA 4DR2H 1C30A 5KFBA 5I5YA 1X4TA 2CW7A 4RZRA 1YI2V 1AUXA 3U9TA 5KFQA 4DR1B 4O84A 3GTKA 1F51A 1PL0A 4HBNA 2Q7EA 5KX5F 2FK1A 4FLUA 3UKMA 4JI3B 1Q3EA 2DJVA 3RBZA 2JVDA 3B77A 3BG5A 1IBKO 2XAJA 4JYYA 2WTFA 2WLLA 1QLEB 1B6QA 1PM9A 1FFXB 4A3GG 3Q4HA 1NTKH 2XGPA 5LOVF 1IBMO 1S97A 1I7LA 3BY6A 3K9AA 3TY8A 2FJZA 3E83A 3N2KA 2CNUA 1VBHA 4GX0A 5LA6F 5JVLA 2Z04A 4LSXA 5KT6A 2Q4PA 4CZZA 2QB5A 5C1PA 1FFXA 1SFOA 2R7LA 2C2RA 3CPWU 1Y67A 1SQXH 5B3SB 1SQGA 2G38A 5KFOA 5D1OA 1MZEA 1XHZA 1IBKH 4L1KA 3Q8PB 4LF6O 1Q81W 2WYOA 3CCRV 1SERA 2V58A 3V4SA 5C44G 4NTWA 4G28B 2HHHO 2W9CB 1V9PA 1IBMH 1FAFA 4B7EA 3MR6A 5IE9A 2W6MA 1BQ0A 4U6PA 4RAYA 3L72H 2W70A 1N8RW 2Q0OC 2EJ0A 2ZJTA 2E2IA 3CX5F 1M56B 4CC5A 3MJFA 4QNHB 4L87A 3GLKA 1TWHA 3X2QB 4J11A 2WLNA 4EB6A 5KT3A 2IMWP 3GTMA 1RJPA 3L70H 3F8NA 1XNRO 4CC6A 2FB5A 1ZLZA 2QWNB 2PZSA 1Y1VG 3CCJV 1P84F 2JJ1G 5LL6Y 2DQ0A 4XDJA 2Y4TA 3PFFA 1BGWA 1CQIB 1OCOB 5K1XA 5DECA 3G8DA 3V6JA 4LF6H 2NNUA 5KFJA 4DR4B 3T54A 2OH2A 4N21A 4K35A 4DUZO 1N48A 2V7QG 3SI8A 2HHHH 1H2LA 1K9MW 5KHKA 3GTOA 3STLC 1WNSA 4ASUG 4QPKA 1S76D 1VAJA 4F4ZA 3RFCA 1JJOA 3ZX6A 2NVXA 4BR6A 5LMNO 4QSHA 2VPSA 2YI8A 4JI4O 4KHPO 2YL2A 3B2EE 1XNRH 1PPJH 3ORQA 4J41A 1KT8A 1AR1B 4JUZA 2PI5A 5FNVF 1AJPA 2QKSA 1H8EG 2Z02A 3AG1B 3W7WA 4Q6GA 2ZE7A 3EPGA 5L1JA 5EWFA 3HOUG 4MVQA 4RWUA 5D8DA 5C5JA 4C5CA 2Y69B 4YY3B 5BMVF 3CMEV 4DUZH 3RYHB 3B40A 4GZRB 1I08A 2P6JA 3SGIA 2ADQB 4DUYO 3QFFA 3ZCCA 4P9OA 5LMNH 5KFDA 1GM7A 4JI4H 4KHPH 4FS1A 2WLIB 1XL6A 4BIOA 1Z2GA 1G2WA 4X66B 1HDJA 1M0WA 3CHXA 2IU3A 4B3RO 1M57B 2UXDO 2XOKG 4QWAA 3GV7B 2XNDG 5KA5A 3GTGA 2QWOB 5C8YF 4LFBO 1I3QA 4JYCA 3ZHVA 3CCVV 3TIIA 4LF4B 2W6ZA 2IJKA 5A2QW 2WLIA 2WWWA 3IC9A 4PA7A 4B7KA 4Q45A 2YIBA 4DUYH 4DR1O 2N04A 1GYFA 3OW2U 3OEHG 1ZWIC 4QIWF 1NVPB 2IA6A 2Z0AA 4O7NA 2GTAA 4JI3O 2F93B 5LA6A 3GTJA 1S72V 4TWKA 4B3RH 1JJ2U 4JTCB 3ZMTA 2UXDH 3S3XA 1PL4A 3KXYT 3T5LA 1ZTEA 4PA9A 1YIJV 3OSNA 5E79Z 1FYJA 1I5XA 3KAKA 3OMNB 3PO2G 4LFBH 4YHHB 4R6ZA 3ZHSA 1JIHA 1KUQA 4LSAA 1VQ4V 3HR0A 2GTSA 3H40A 2ILMA 3F5TA 1WJZA 3VQVA 5J9PC 4WHXA 5EZYF 2VOBA 5KT5A 4DR1H 1BSMA 3KZIZ 4MTGA 3BPZA 2QEXV 1IXBA 1W0KG 3AEIA 3CRRA 2Y4RA 3HO8A 2FP4B 4JI3H 3L4JA 2AHYA 2YU9A 1WLEA 5H2FZ 3RB3A 3ZBHA 4TQSA 4YJ2B 4PDRA 4X8AA 2FMAA 3OGIB 2XD4A 3LNNA 4MV9A 4A3IG 2Y0IA 1R6TA 3DC5A 3CWBH 1AN7A 1F4MA 3N6XA 2YDEA 2WDTA 3CXCU 2R87A 3BACA 3T2MA 3BQ2A 4E2LA 1J5EB 3ABLC 3CS5A 1KU9A 3ML0A 3RGZA 2H94A 3GB7C 2N05A 4FK5C 1N0JA 2R72A 4YJ2A 4APMA 4C2MA 5H5NA 1S5LZ 2FL4A 3DAAA 5DQIA 2W8KA 4MTOA 2WE6A 3SPJA 4BBSG 4EBEA 1BQZA 3JD3A 5EBLC 5CM0A 1Z2NX 4QE9A 4LF5B 4F50A 2KG7B 4O2AB 4QW8A 4DL4A 2J6TA 4YJ3B 3P3PA 3TJTA 4FFLA 1Q7YW 5CB4B 5FPOA 2DPJA 1W59A 4EFEA 4YXWG 1EN6A 4YR2A 3EFFK 1N56A 4TQRA 2KG7A 3BQ0A 5CA1F 4O2AA 5GONB 1JCHA 3KYHC 5BMVA 3D8CA 1LUVA 3EXAA 4YJ3A 3RW0A 3PW5A 5LXTB 3RYCB 4D6TH 3EVKA 2EJ3A 3T9AA 3GIKA 1XMOB 1NBMG 2V4DA 2KSDA 3G8CA 4LF9H 1GGOA 1BXRA 5IT9W 3KHHA 4BWSC 1XDCA 3JAKB 5LGNA 4YY3O 2ZR3A 3VPDA 4IRDA 3RYCA 4MTXA 5L9XA 4F4XA 3FB7C 4A3MG 1R9TA 2HG8A 1TWCA 3LSUA 2JK5C 4OPAA 3LDEA 2QWPB 1EUDB 1MZFA 2CUGA 3OD4A 2GQSA 2R7ZG 2EIKC 5LGUA 5CMUA 3KKYA 4AILC 4X66O 3N8DA 5HFLA 5JQGB 2W9BB 4X1IB 2AGOA 4WFBV 5IP7G 1JLLB 1AI7A 4A3DG 3MFIA 1JR9A 4IRKA 4LF4O 1SA0B 1PV0A 4WBNB 1K1QA 4YY3H 4EBCA 3QVNA 2OTLV 4HQ6A 4O4LB 3RGBA 5B66Z 4CKEA 3K5IA 1V54B 1K34A 4IAJA 3J80N 3M9MB 3BHPA 2P06A 3KREA 1GO3E 1AROP 2W9BA 4MV1A 1Q43A 5EYPA 4H0LB 5IYDG 2A0LA 4Z1MG 4WBNA 4X1YA 4X66H 2YCHA 3H1LH 1SC5B 1G6UA 5F9LA 5LYJF 4DV2B 2YZMA 3UO2A 1VF6A 3AG2C 4YHHO 4TUYF 3JZFA 1EYZA 4LF4H 5KS8A 2P67A 2QSAA 3SJAC 1Z2OX 3U0ZA 5IYBG 3LDCA 3E5NA 1XMQB 4NB5A 4UVBA 2JEFA 4UCSA 1OWTA 4I50B 5JVDA 2RDCA 2A06H 4NZMA 3BVOA 2YS6A 1QBZA 4DAAA 5JUMA 4JYBA 1RK6A 3JAWB 2CH7B 2OIGA 3IN5A 2RNBA 2R92A 3RF2A 1Y1WG 1K83A 4I50A 1A0GA 4I9QA 4BIZA 4IHJF 1J5EO 5DQGA 5KFHA 4MVZA 4GT1A 2YUAA 4O81A 4J9NA 2FKLA 1KBLA 3LWBA 4KL1A 3RAXA 2E74B 3ABUA 5JH7F 4WFFA 3BQ1A 3ZMUA 4MA0A 2EJ2A 3W1BA 1W2BU 3UZOA 5KFWA 4ZQIA 3IG0A 2ABJA 1BZKA 2PBZA 2DWDC 3VOUA 2ZE8A 4MVSA 3OHBA 2YI9A 1L0NH 1V55C 2DZDA 1M6VA 1OHHG 1AR4A 4O3RA 4ED2A 1A3GA 4E6NA 4RUFA 1WR2A 1BHAA 5B5EZ 4CHIA 5H9CA 1J5EH 3LSQA 4GCZA 4CH6A 1WA8A 2M6YA 4J80A 4TV9B 3K3VA 3CVZA 3C90A 3DXRB 3N42B 3U11A 3SYCA 2XT9A 4BW5A 5EIBD 3NUAA 1CKNA 1THZA 4BAYA 4YR3A 4X89A 2CDYA 3GIDA 1SETA 1XMOO 3HOVG 1H2KA 4DV6B 5HV6A 3DXRA 2JEJA 1A32A 3FAVA 3K58A 2Q2TA 2E5LO 2W0FC 3WO0A 2NLJC 2YIAA 3RT3C 3BAAA 1B6SA 4I7ZB 3ETHA 3GDEA 3JZ6A 1Q6IA 3K06A 4JI1B 1VQKV 4MV8A 2HIVA 1EN4A 1OCZB 1OCCC 4LMYA 1G4YB 2X6BA 2DMXA 4JF3A 1IOVA 3UFXB 1ZUQA 4ZOLF 5KKNB 4JV0A 2Q67A 2ODTX 1XMOH 2ZDIA 4CS3A 5LP6B 4FZ1A 1DK1A 2CQYA 1VQOV 1PP9H 2FLPA 1CE8A 4HNAA 1HNWB 2E5LH 1DV1A 3W1GA 1ENVA 4NR1A 2AU0A 1HNXB 2XUMA 3GIPA 2YW2A 1P7GA 1TUBB 1SKVA 2C35B 1RM1C 4GX2A 4JYAO 2ZIOA 3RV3A 2HLDG 4RU9A 1XDNA 5CBHA 5LP6A 1GSAA 4J9OA 3JASA 3OSPA 2NN4A 3M8AA 2EILC 2R93A 2EULA 4R7RA 1AUVA 4FFOA 5KFFA 4A3LG 4X65B 1KJIA 4QJFB 4FLXA 2XCAA 3R5FA 3RB4A 2C28A 4DV2O 2HGXA 1TUBA 4BXXG 4JXUA 4JTAB 4DK1A 2A3QA 1HR0B 4O7SA 3DTGA 1OZ0A 1XMQO 3HOZG 2VWKA 5BPHA 2VUMA 2JGUA 2GQRA 1Z5WA 4QJFA 4JYAH 3ABKB 4DR6B 4IHJA 1NQTA 3G6YA 1Y74A 1ZX3A 1QR9A 5D5QA 2UUBB 2JS3A 3KALA 3QZ7A 1YVWA 2N74A 4J9LA 1TA8A 4MA5A 2QWQB 1GSHA 2QE7G 2Y48A 2KQXA 3JATB 4IZOA 5LGTA 1XREA 1I0HA 1IXMA 2YEVB 4O4HB 3H4BA 3K5NA 1R3KC 3R23A 1HW7A 2PI4A 4DV2H 4PZ7A 4FE2A 3SPGA 4A3KG 4ED7A 2QTOA 3A8TA 2RDIA 2DWCA 4ECUA 3VQXA 3CJHA 4CKBA 4FMTA 4X20B 1XUQA 5FD6A 3APQA 1XMQH 2UVRA 1BL8A 2JA6G 2Q8VA 2WLMA 3RYFA 4EGJA 5GTIZ 3SYPA 3QG5A 5L3BA 1X59A 1S5JA 2R8GA 3K03A 1T5EA 4Q43A 2OT5A 3AX6A 4J7JA 1DAAA 1PK8A 4IYHA 2COJA 1J95A 4MSWC 4X20A 4X88A 4A2BA 4RNOA 3J7AK 2ALZA 4BW9A 3E89A 4EFBA 3CP1A 1ET0A 4QW9A 1XOUA 4DL6A 2GPWA 2UVWA 5J2TB 2UXXA 4UFZA 4XDKA 1Q90D 2R7NA 2C2EA 2FYUH 1SYXB 3EPIA 3HB3B 5JWPA 1EFRG 2LO1A 3H1KH 3UYYA 2V1DA 1Y66A 4UUJC 1H38A 3W7UA 2WPDG 2R8IA 2J6SA 1SZXA 3ABMC 3HKDA 2XAFA 1ZL8B 5D5PA 4GLWA 4DV6O 4MV6A 3K5MA 4UUGA 1K8AW 4HYKA 3WU2Z 1WPXA 4HNTA 5DGAA 2E76B 4ZOLA 1E1RG 1P7BA 1N33B 1Q8IA 4TSFG 3H0GA 1GN3A 2JDIG 2AZ0A 4JI1O 1NT2B 2BTOA 3RIZA 1HNZH 3ZN1A 4FFRA 4FLTA 3TCUA 3V4ZA 4EQ5A 2FK2A 2RGVA 4GKKH 2A9HA 5EDWA 2R8JA 4ECYA 4FJCC 4JAVA 5KFMA 1SQFA 4QIWE 4FIPC 4YBZB 3AG4B 5KG6A 3JSNA 2I80A 2QKAA 2FKXA 1AI5A 4ZHQF 4OX9B 4DV6H 4YAJB 3H1IH 4O3NA 1T94A 5JCOA 3SE7A 2WLLB 1HNWO 4FLWA 5L3FA 3Q4HB 1YTFD 3CC2V 2E3CA 3JAMN 5B1NA 1MMMA 1HNXO 4IIJF 2YXYA 4JI1H 2IJJA 5L1KA 1Z2PX 1VQ8V 2XTAA 3N2KB 1PD3A 5CA0B 4ECZA 4IGGA 3OE7G 5DLGA 3GTPA 5IJ9B 3JZIA 5DGIA 4O2BB 3J7AU 3HKZA 1DGSA 1NTMH 1L1FA 3E8HA 4X65O 3KHLA 1NKDA 5D1OB 2YZGA 3OTOB 3P3NA 3T9DA 5IYZF 4ED1A 1S5HC 5CA0A 4JI0B 2CNQA 1HNWH 4FLZA 3H3VH 4EKWA 4J9QA 5IJ9A 4O2BA 1HNXH 3GIJA 2FMLA 5CN0A 1XI1A 3HT5A 1RYSA 1IURA 4DR3O 3M7MX 4DR6O 2R9RB 2YYAA 2FLLA 1WRVA 1S9FA 4J0MA 4J9KA 1T3NA 2UUBO 3WG7C 3O9OA 4EB6B 4PV1B 1U97A 2CE4A 4DV0B 4J9ZB 4ZI7F 2W9AA 5DLFA 1EKVA 2COGA 2YWVA 5B1BB 2VA2A 4X65H 1FXKC 4O7LA 3L2PA 1TVKA 3K08A 4DRXA 2EINC 1I2KA 1R6KA 3OFNG 3FB6C 1OCRB 2JA5A 2LP7A 3E2EA 1Y6XA 4TV8A 2DYRB 4I0XB 2JIZG 1QHTA 1YDXA 1K5SA 4MVOA 4O4JF 3ASOC 2IH1C 4DR3H 4DR6H 4C7UA 1BCCH 4F6EA 3OUZA 3HOYG 4I55B 2UUBH 1TWFA 2E2HA 1PNLA 1VQMV 4DL7A 1IYDA 1YSCA 2W6NA 5KHIA 1GLVA 2HGWA 2F4VB 5CA3A 4I0XA 4X64B 1NU1H 3GV5B 3OR6C 2Z3YA 5KT7A 2BQ3A 2JA7G 3HKBA 3ABTA 5E25A 4I55A 2W6OA 4FU0A 5KFSA 1P16A 2DLNA 4MVRA 3K57A 4O82A 2RCVA 4RCNA 5EBMC 1XNQB 1JVMA 2X0LA 2IM9A 3ZIAG 5C4XG 2JA6A 4RAIA 5CR5A 4UVAA 3T9BA 3HPLC 1FXVA 3TQ1A 2R8KA 2NU9B 4RNNA 3K5OA 4ECVA 3IGAC 2SCUB 2XIGA 1N33O 4GYCB 3CEBA 1NJIW 5BWUA 4EG0A 2YRXA 3MWDA 1VIBA 3N41B 1GKFA 1KTAA 2ASJA 1TWAA 4M0JA 2JA8G 2DWEC 1JPXA 1R3LC 3QWUA 2CTRA 2HG5C 3D36C 2PMZE 2VS0A 3T9FA 5KG0A 1IBLB 3JARA 3SJCC 5LOVB 4MV4A 4ECSA 5KX5A 1KUTA 4UCOA 4M9UA 4NVPA 3JRWA 4GX5A 2Q73A 2BTQA 3W7XA 4OX9O 3ICXA 5LA6B 3RFRA 4O3QA 3TINA 2GV9A 2PGGA 4FVMA 2ZDHA 1U96A 4KUMA 3E8GA 1WB7A 3GB8B 2M05A 5B3SC 1N33H 4CH5A 1RPRA 2CTWA 5LOVA 4FM0A 5GONF 2DYSB 3CC4V 4EYIB 1GM9A 5KMGA 3C0FB 2B1IA 5LXTF 5KUKA 1N32B 2YS8A 2YIDA 3AG3C 4DV3B 4ECQA 2R92G 2OCHA 1WB8A 3DSQA 2P4KA 5JJNB 4XZ3B 1O9GA 4R8UB 2YICA 1TUEB 2PYJA 5LMUB 5BY1A 2OTJV 4QWBA 4YP3A 2Q7HA 4P9PA 3RJ0A 1M56C 4KP4A 3T4ZA 4OX9H 3X2QC 3OTOO 4HZ3A 1AI4A 3ETJA 2AGAA 4JI0O 4ZBMA 4PWQA 2VA3A 4O3OA 4ZI7A 3R66A 1E4FT 1N4CA 3VA7A 1MSDA 4R8UA 2ZXWB 3QNEA 3ZMSA 3PR5B 1OCOC 1O9HA 4ECXA 4JV5B 2EIKB 3OTFA 1EBOA 4ED0A 3K79A 5JQGF 3TY9A 2R82A 5KAIZ 3FKIG 3DF7A 1UC9A 4DV0O 5BWTA 3JCZA 1E4EB 4O3SA 1FPOA 5H80A 2UU9B 1Y4MA 4O4LF 1RJRA 3ZMVA 3OTOH 4DV5B 2FTKA 4KFMA 5KFUA 4RAZA 3DC6A 2B1GA 4JI0H 5IYCO 3PJSK 5CAEB 1Q6UA 2C2AA 1M0TA 4NXMB 5EC1C 1WH2A 3AG1C 3TW7A 1NH2D 5J2UF 3T7AA 1E4EA 5FR9A 2OLSA 2IH3C 2WA3A 1ZHSA 4MW3A 2Y69C 3I5DA 4PA6A 1KD1W 1L0LH 5BMVB 2VQEB 4DR4O 1B06A 1WCMA 4DV0H 1ZETA 4WFGA 2CGOA 4MV3A 3FB5C 2F4VO 2AZ2A 3VPCA 4X64O 3QQMA 4J10A 5FNVA 3UT5B 4CKCA 4IR1A 2R9IA 5BWVA 4I4TF 3U9SA 3SPCA 4X62B 2LQTA 3TW6A 1JOYA 3EYYA 3MWEA 1M57C 3UZBA 4MTFA 3CRQA 4RB1A 4IR9A 3VPBA 2H8PC 3TQTA 1R6NA 2C00A 3UT5A 5C8YB 4RQFA 1M4UA 4H37A 3K3PA 2ITDC 2YXHA 3K0DA 4DR4H 3E22A 5L1LA 1V51A 2CZGA 4JAAA 3ZHUA 2F4VH 2WAQA 5B1AC 4X64H 3ZJZA 4B3TB 3CQZA 2AHZA 3N6RA 1W96A 4FBTA 5C8YA 1KP2A 2R93G 4F4YA 3MDSA 2ZDQA 2F95B 3J80W 5K2MA 1AVMA 3T5JA 2ZINA 2OCCB 1EZ1A 5T14A 1OJHA 3EHBB 3K9SA 4PA4A 2GLTA 1ZSPA 1VMGA 3CRCA 1VQ6V 2JA7A 3LSSA 1IBLO 2YXLA 5BYBA 4WF9V 4QIWA 3PN1A 4Q20A 1V55B 1UJWB 5EYPB 1VF5B 4FFPA 2NU7B 5KFZA 3VQYA 4HAMA 3CSWA 1YTFB 3N43B 2VUMG 3B8MA 4X1YB 3MFHA 3CSXA 3HB9A 2V4RA 4TV9F 1EZVH 2X0SA 2KKWA 2P22C 4UV8A 1ZHQA 4BBRG 3WWIA 3RN4A 2CTPA 2VWJA 4K8XA 2W71A 3GTQA 1N34B 1N32O 2YSUB 4DV3O 2QDOA 3HKZE 2QTSA 2Q9LA 1XQ8A 2GBOA 1PKXA 5EZYA 3ZN0A 5DN6G 4IRCA 5A9GA 3U54A 4Q4CA 3N40P 1IBLH 5JVDB 1K33A 2EIMB 3D3QA 2Q7DA 4U7NA 5LMUO 1PX2A 2FPIB 1NR1A 3OT7A 1RSOB 1CS0A 1OBDA 1VQNV 2ZKOA 3AK3A 2QF7A 3CMAV 1JA8A 2Q6AA 5H6RA 4J9RA 5LHHA 2VUGA 1K92A 3OMIB 3RBEA 4RZQA 1SQPH 4FGRA 2LGQA 1RSOA 2Q69A 3W7TA 3D3IA 3RB6A 3RVYA 3CD6V 1N32H 3Q8SB 4DV3H 1H2NA 2J6UA 3NGDA 5K1PA 1FFTB 3RBDA 3SNOA 4LF7B 2ZDGA 4YIOA 4ICGA 1WP8A 4ZIBA 4A3JG 1PNKA 5J2UA 4FLVA 4NZOA 3GTLA 2OWOA 3ZHRA 2UU9O 3KCXA 3OAAG 2IP4A 4YHHH 1SQBH 5DG8A 4DV5O 2YRWA 2QGNA 3NC0B 4TT3G 3WB1A 2ZM6B 1RP3B 3A0HZ 1F4NA 4DO2A 4GLXA 2E75B 1CKOA 5KG4A 4NXMO 3G6EV 4MVMA 1WA8B 4LH6A 3CCEV 2ATLA 4CMFA 4UXNA 2HVRA 4PELA 4LF5O 3KHRA 3O65A 2P5OA 1FD9A 5CA1A 3H0GG 2EIJB 3U10A 2WA4A 4NXNB 2R84A 2VQEO 1CKNB 2UXCB 3R65A 3FKIA 2ZD9A 2HVJC 4H33A 2UU9H 3ETDA 1P49A 3CE2A 4O4IF 5JJEB 4DV5H 4W4LA 5KFKA 3CEIA 2ARHA 3FAVB 4X62O 4G27B 5KA6A 3F5WC 3IC7A 1H8HG 3HKCB 2RQ6A 4DR5B 3VQWA 4NXMH 5FPRA 4O7VA 2WLJA 5BZBA 1XL4A 1UNNC 1K5QA 2EX3A 1I94B 1KEEA 4LF5H 2ITCC 1QVFU 2J9GA 1LNQA 4AQYB 1BE3H 2VQEH 1JDBB 1V54C 2F23A 2EJ7A 4FZ0A 3HKCA 2ZE6A 3AYHB 2W8LA 4B3TO 1N36B 3JRXA 2MCTA 4DL3A 5F2VO 2VPQA 3M9NB 3WB2A 2GSMB 3G6VA 3ZRWB 4R50A 4JI8B 2D2CB 5HFMA 5LHGA 4HNAB 4X62H 4WFHA 2ZGIA 1M9NA 4PJ0Z 3JD4A 2V59A 5K3WA 4CS4A 2W6QA 1VEWA 2PMZA 3I12A 3T1HB 3IAYA 1SF9A 2JJ2G 2EIYA 1BGYH 3JASB 1DF5A 4PI0A 3ZRWA 3J81N 3L74H 2QM7A 2RGRA 4I5SA 1LR1A 1GSOA 4NKGB 3ZRVA 3RR5A 5EWEA 1KKCA 4WFEA 4J7ZA 4MAMA 5J2TF 5F9NA 5LYJA 1EM1A 1IVSA 4B3TH 2KSWA 1KJ8A 3UQ8A 3TETA 2Y0PA 1COWG 4UCVA 5ITZA 4TUYA 2BCCH 1VARA 4QWCA 4YQWA 2DABA 3CCMV 2DPIA 1AJNA 3AK1A 2R6FA 2CKZB 3ASNB 2IJIA 5EOYA 1GMGA 2W7OA 1FXHA 5CBGA 3FKSG 1O75A 4IHJB 3M4IA 4UVCA 1Y74B 4PZ8A 2JA5G 1TAEA 1EUCB 3DGEA 2W6JG 2ZNIA 1RK5A 4JI6B 1AR5A 4IWXA 1ULZA 2PN1A 3KHGA 5IY5B 2LFSA 4FFNA 4TQFA 5JH7B 1Y76A 4GX1A 3RTXA 3FMAA 3N2GA 5KFAA 2JGDB 3TK1A 2QK4A 1IBMB 1JFFB 3CJHB 3QO8A 5FL7G 4UCUA 4U3JB 5KT4A 4LFAB 2GUZB 3RYFB 5JH7A 1ZQ7A 4A3BG 2CGNA 3SJQC 4LWSA 5B1OA 5IWAB 3IFXA 3S24A 3M99B 1IX9A 3FYEB 2LGWA 2JGDA 3CCQV 1F7YA 3L75H 1SCUB 1AB3A 4EEYA 4O7ZA 1UPGA 4K3AA 1JFFA 4J42A 4DIMA 1UFIA 2EJRA 1YJNV 2ZM6O 1NH2B 3N44B 4U3JA 4PI2A 4YIPA 5FJ8G 2COIA 2AXTZ 3QO5A 2GUZA 3BABA 4PZ6A 1RFYA 4HNVA 3BA8A 1YXBA 4O4IA 2A79B 4FM1A 1M1KW 3PW2A 1M7JA 4O86A 4X1KB 2ADPA 3GVMA 4DL5A 3G4SV 4NXNO 2HJDA 4A5UB 4AYBE 2DIKA 4Q44A 1OCZC 5CE8A 1V4YA 5FLMG 5KG3A 1GAXA 3HKDB 4MV7A 3PVXA 2NVYA 3W5OA 4Z2WA 3MAQA 5BWRA 2UVUA 4JPRA 2UXBB 4X1KA 1FJGB 4ZOLB 2ZM6H 4GKJB 5L3GA 3OEEG 1I1KA 4Z1VA 5LP6C 4DR5O 3WG7B 2CAZC 1SEIA 1JX4A 4R8CA 4HN2A 2OIEA 1I94O 1Q6HA 4J7KA 4LFCB 2UUAB 5TISZ 3ETGA 4QWEA 2WAQE 2R8HA 2A1HA 4AQYO 2ODMA 4NXNH 1I1LA 4UB6Z 4KHPB 1KKDA 1S68A 4WD3A 2EINB 4DLKA 5DG9A 3T1YB 4U7CA 2DAAA 1LUWA 2Q5ZA 2R7KA 1N36O 2WB1E 1M5IA 5KG2A 2ZE5A 3TEKA 3JAMW 2B9ZA 3PZPA 4JI8O 1EZJA 2AQ4A 1S0OA 1MABG 4K8ZA 2YZNA 3N27A 1JQ0A 1F23A 4BWAA 4DR5H 1YHQV 5C1OA 2Z5UA 2BSKA 1KC8W 2NU8B 3T1HO 1B33N 4W4KA 5EK0A 3LDDA 4IYIA 5IJ0B 1Z5VA 4JZGA 2BQUA 1I94H 3A0RA 2GDSA 2R9AA 2UUCB 4D7SA 4CE5A 1H2MA 3MWMA 1R73A 4AQYH 1WP7A 4LNUA 3FB8C 5KHJA 4UCRA 1VBGA 3PO3G 2NR5A 4FFMA 3BEHA 3ABKC 1K7DA 1XHXA 4F6RB 4DV4B 3FD9A 4B3RB 1N36H 5BPFA 1OBGA 1I1MA 3H1JH 5IJ0A 4Q0YA 4JI8H 1L8DA 2P0AA 1Q82W 5E1AC 3BRCA 4E4TA 4CH3A 1Q5OA 3NBYB 4LH7A 5DGHA 1XBLA 2YC0A 4BY7G 4RB3C 1W0JG 1MA1A 4LBEC 2CTQA 3T1HH 2F1MA 1P4RA 3JALA 4F6RA 4DYLA 4DW1A 5DG7A 5FLXN 4JI6O 1AJQA 2IU0A 1HR0O 2CK3G 5IYDO 2FLNA 2X5RA 1MZBA 1S77D 1JXLA 2OYQA 1FKAO 1TVKB 3FDSA 4HYOA 4A3CG 4A93G 4O7WA 2HDKA 1Y14B 5IP9G 4DRXB 4F4LA 1BMFG 1VP7A 2L35A 2FPGB 1WCMG 1ORQC 2R7MA 1QVGU 1NZ6A 4FS2A 2QKCA 4JV1A 4TV8B 4CBCA 2HHFB 1KECA 2O03A 4LFAO 5KFGA 4CS2A 2AGPA 1HP8A 3WWHA 5KFLA 5IYBO 5IWAO 1JKJB 3PR4A 2VRZA 3D36A 4B3MB 4JI6H 1HR0H 3VBBA 2LW7A 1VKZA 4K6NA 2HHFA 4U3FH 3QZ8A 4RQEA 1FKAH 3AG3B 3JYCA 4DRFA 2V4QA 1L2ZA 2GPSA 2XCLA 1XEQA 4H13B 2YS7A 2F66C 2ATKC 3HKBB 3DTFA 4GC7A 3QO7A 3H01A 1WSCA 5H6QA 5DM6V 3B8NA 4I9WA 1GN6A 2PY5A 4LFAH 3JD0A 5KLVH 1MOFA 1QCEA 5IWAH 2KB1A 3E8BA 2IBKA 5JCOC 5CBFA 4YAKB 2W9CA 4UV9A 5BWWA 2LFRA 4DV1B 4LF8B 2DW4A 3MD0A 2UXBO 4RUAA 4ZKIA 4LF9B 5LL6b 3H20A 3AG4C 5KFTA 1FJGO 1QU7A 4GKJO 3ZRXA 4YJ2F 2ASLA 3TXQA 3F7VC 1FVIA 3C3SA 2ETNA 2QM8A 2Y4UA 4ZHQB 2DN9A 4FBUA 1QR8A 4DR7B 4DW0A 3A0BZ 2UUAO 4LFCO 2HVSA 2ZR2A 1DV2A 4MTDA 3JARB 5DMXA 3G6XA 3ABLB 4DV7B 2QYZA 3GWKC 4IIJB 5KX5B 2CW8A 3Q8RB 5I5WA 4IL6Z 1SS3A 4JASA 3T1YO 4P2ZA 3CRMA 2BTQB 4Y8VB 4ZHQA 4MT8A 4P30A 3U55A 3ZMZA 4UB8Z 4JZ2A 1QLEC 5DISC 1URFA 2UXBH 1FJGH 2QJ1A 3RB0A 1WAZA 3WO1A 3RGXA 3W7SA 4GKJH 1GK9A 4O2AF 4MVUA 4IIJA 5D1PA 1VS0A 5KMGB 4YJ3F 4JI2B 1KYOF 5JJJB 4ETSA 5IYZB 5BYAA 2MW2B 5CB4F 2JEUA 2UUAH 4LFCH 3KCYA 2UUCO 4H44B 3LUTB 1PNMA 3OMAB 3K59A 1KC7A 1VF7A 3LQSA 3BA9A 4PDLA 2RF4A 3HXLA 1VQ7V 2HIXA 5L3EA 3LULA 3KG2A 3T1YH 2EZPA 1QLNA 4DV4O 2W7PA 3RYHA 3KTMA 1KJJA 5IYZA 2ZQMA 1US6A 5KUMA 4XYMB 4ZI7B 2VQFB 1IZ3A 3K04A 5B1BC 2RJZA 3FFQA 3TIGA 2JS5A 3CC7V 4B3SB 3WB0A 5EWGA 1I7FA 3MHSC 3T9EA 5KFPA 2DQ3A 2L6LA 3GIQA 1OCRC 1CPYA 1I5YA 5HBRB 2UUCH 4RO2A 5B1AB 2B63A 4NYKA 4PDMA 2DYRC 1RYRA 3GILA 2F43G 1KQSU 2QA4V 4ME6A 5DQHA 4O4JB 4RB2C 2HVKC 4DV4H 4AHCA 1AP5A 1KP3A 4K0KB 4DXWA 2P4VA 5A2QN 3NBZB 2R86A 3S3WA 2UXNA 5L3CA 1NI8A 4J9YB 4M7EA 4J9MA 4O4JA 4JI5B 3WFVA 1B6RA 4WBNF 1W93A 2C22A 3MR2A 3ZEDA 1S03G 5EIBC 5KHHA 3P32A 1GN4A 1AP6A 3CRAA 1CP9A 3CYOA 4ABMA 4OGQB 4B3MO 5KFYA 1KMIZ 3L9DA 1AILA 5BXZA 3K5HA 1QNMA 3ZS8C 4ECRA 3K0GA 5FNVB 1GRJA 2WLKA 2X6CA 5JVDF 4FM9A 4Q4DA 2W0XA 5C93A 1BHBA 1D5NA 3VMMA 3AG2B 1AI6A 4NTXA 1X9NA 4MW8A 1DF4A 3QTCA 4Q8FA 4AYBA 1I7NA 1R3JC 2P7TC 2BQRA 4I50F 2JEGA 1EHIA 1VQLV 4B3MH 3SDLA 2W6PA 4FM2A 1OV9A 3E22B 4LF8O 3TY5A 2VQDA 1KJ9A 2IJHA 4LF9O 1T36A 2IW5A 3GJXB 4EYHB 3CB2A 5LBQA 4NLGA 1XNQO 3T5KA 2HP8A 3T9CA 4FFKA 4X9QA 2X7RB 4PBCA 3A2FA 4HNUA 3I55V 2XAGA 4QE7A 1A48A 4DR7O 1CEZA 3G67A 4JTDB 4I7HA 2Q68A 4DV7O 2DYSC 4G3IA 4LP8A 1JX9A 3DTUB 3PW4A 4FFBB 3GIIA 3JD2A 5CB4A 3IJ4A 2WB1A 4LF8H 3CCSV 4MS2A 3WNZA 2Q2UA 4A3EG 2R70A 4U7OA 1I6UA 4RUEA 1Y1VA 1XNQH 3SPIA 5I5SA 1VQ5V 4LC1A 4JAUA 4E4EA 2E5LB 5KHGA 3T4DA 5GONA 2V5AA 1YJWV 5DGBA 5LXTA 3OUSA 4JI2O 4FFBA 4DR7H 5KG5A 3T99A 2AW9A 1RPOA 2WSSG 2XAHA 2BOBC 3AK2A 5EZYB 3RWRD 4PDBA 1WN7A 2ZXWC 3BCCH 4G2KA 4DV7H 4PHZA 3RV4A 2Y0SE 1IDSA 4GC6A 3JAKA 3SYOA 4R7CA 3STZC 3E86A 5IT9N 4QPJA 1S0MA 2PVPA 2X6AA 1CQJB 2VQFO 1K4CC 4BY1G 3K5LA 2CFMA 4JI7B 3LP8A 1JMKC 4B3SO 3F7YC 4JI2H 3HOWG 1RJQA 4JYAB 4OXSA 5JQGA
chains in the Genus database with same CATH topology
2F93B 4O2BB 4PZ8A 1TAEA 1DGSA 5LA6A 4X1IA 2ZNIA 4JI6B 4B3RH 2HVQA 2UXDH 5D1OB 5J2UB 1A0IA 3OTOB 4TQFA 1M93A 1SA0A 3KXYT 4MTEA 5JH7B 4O4LA 5CA0A 4JI0B 1HNWH 3KAKA 4FLZA 4LFBH 4YHHB 3RTXA 3FMAA 3N2GA 4LSAA 5IJ9A 4O2BA 1HNXH 1IBMB 1XI1A 2VQFH 3VQVA 2VOBA 1JFFB 3M7MX 4DR1H 2HGSA 5LMUH 3BPZA 4U3JB 4UCUA 4J0MA 4B3SH 4LFAB 4I4TB 3RYFB 4EB6B 5JH7A 4JI3H 3L4JA 5IWAB 4EEQA 4DV0B 3S24A 5CA1B 4YJ2B 4X65H 3L2PA 3LNNA 1TVKA 1TGOA 4MV9A 1JFFA 1AN7A 3N6XA 4DRXA 2WDTA 3N44B 4U3JA 4PI2A 2ZIMA 1J5EB 4I4TA 1KU9A 4JV5H 3BABA 4K0KH 4PZ6A 4UCTA 3RGZA 4TV8A 1QHTA 2R72A 4YJ2A 4APMA 3SJBC 3BA8A 4O4IA 2PTMA 4FM1A 4DR3H 2Q7GA 4DR6H 3JSLA 4X1KB 2WE6A 4JI5H 4I55B 4A2AA 2UUBH 3JAWA 3RYIB 1P8LA 1Z2NX 4LF5B 5BR8B 5KHIA 3HKDB 2F4VB 4O2AB 4MV7A 4X64B 4YJ3B 3W5OA 4TQDA 3MAQA 2UXBB 2Q0AA 4X1KA 5FPOA 4ZOLB 2ZCEA 5CB4B 2PUSA 3HKBA 1FJGB 2ZM6H 4GKJB 4I55A 4EFEA 4FLYA 1P16A 3RYIA 5LP6C 3K57A 2CAZC 3LMLA 1SEIA 1XNQB 4O2AA 5GONB 3KYHC 1HNZB 5BMVA 4YJ3A 4LFCB 2UUAB 3J81W 5LXTB 2IM9A 3RYCB 4GKKB 4NXNH 1XMOB 2V4DA 4KHPB 1S68A 4LF9H 3K5OA 5IT9W 3T1YB 2XIGA 4BWSC 1M5IA 4GYCB 3JAKB 3JAMW 4DR2B 4TV9A 5LYJB 3N41B 3RYCA 4K8ZA 4BWAA 4DK0A 3QWUA 4DR5H 5ITZB 4TUYB 1H2SB 1IBLB 3JARA 3KAJA 3SJCC 5LOVB 5IJ0B 1Z5VA 1I94H 5KX5A 2UUCB 2R9AA 4D7SA 4UCOA 4AILC 3SR2C 3MWMA 4NVPA 4AQYH 2BTQA 4LNUA 5JQGB 4CH4A 4UCRA 5KHJA 3ICXA 5LA6B 3RFRA 1E4GT 2GV9A 4X1IB 2QM4A 2HEPA 2PGGA 4FVMA 1XHXA 4F6RB 2YIBD 4DV4B 4B3RB 2W57A 3GB8B 1N36H 1N33H 1SA0B 4CH5A 4WBNB 5LOVA 4YY3H 4FM0A 5IJ0A 4Q0YA 4JI8H 1L8DA 1QQCA 4O4LB 3RGBA 4RB0A 5KMGA 3C0FB 3BRCA 4IAJA 3N2GB 4CH3A 1Q5OA 3NBYB 1N32B 3BHPA 4LH7A 4DV3B 3DSQA 5JJNB 4RB3C 1Q43A 1O9GA 5EYPA 3T1HH 2F1MA 3JALA 4F6RA 2PYJA 5LMUB 4WBNA 1IBKB 1D5AA 2Q7HA 4X1YA 4X66H 2YCHA 3RJ0A 1G6UA 4DV2B 4OX9H 1MZBA 2OYQA 1TVKB 4ZI7A 1E4FT 1N34H 4LF4H 3SJAC 4DRXB 1Z2OX 3U0ZA 1O9HA 1XMQB 4UCSA 4JV5B 4I50B 3OTFA 5JVDA 4JI7H 1YEWA 4TV8B 3TY9A 2O03A 4CS2A 4O4IB 1XK5A 3DF7A 4DR3B 4DV1H 3JAWB 3L4KA 4B3MB 3THOA 4JI6H 2UU9B 4LF6B 1HR0H 3RF2A 3OTOH 4I50A 4DV5B 4I9QA 4B08A 1BJTA 4RAZA 2HHHB 1CKMA 4JI0H 1FKAH 4DRFA 1L2ZA 2ZNJA 1M0TA 4NXMB 2F66C 1WH2A 3HKBB 4KL1A 4LF7H 1ZHSA 1XNRB 2PY5A 1WPBA 3W1BA 4LFAH 3JATA 5BMVB 3IG0A 2VQEB 4O4HA 5IWAH 4DV0H 2YI9A 4LR3A 5JCOC 5FNVA 3UT5B 2PYLA 4DV1B 4LF8B 4LF9B 4E6NA 5LL6b 4DUZB 3H20A 4X62B 1J5EH 4CH6A 3EYYA 4TV9B 4L8JA 3K3VA 3CVZA 3N42B 3U11A 1FVIA 4RB1A 4ZHQB 5LMNB 4DR7B 5EIBD 3QF7A 4JI4B 3UT5A 2UXCH 1CKNA 2HVSA 5C8YB 1B04A 1M4UA 4MTDA 3JARB 4DV7B 5KX5B 1ZAUA 4IIJB 2CW8A 3E22A 4DR4H 3HKEB 4DV6B 5BR8H 2F4VH 2BTQB 4LNUB 2FE3A 4X64H 4ZHQA 3K58A 4B3TB 2Q2TA 5DISC 2UXBH 2YIAA 3BAAA 5J2TA 5C8YA 1FJGH 2F95B 2QJ1A 3GDEA 3J80W 3VNNA 3RGXA 4JI1B 4GKJH 4D7TA 2HIVA 2ZINA 4DUYB 4IIJA 5D1PA 1VS0A 3HKEA 5KMGB 4LMYA 4JI2B 4TOIA 2YXLA 5JJJB 4ETSA 5IYZB 3ETQA 3PN1A 2UUAH 4LFCH 2XHBA 5FLXW 5EYPB 3K59A 1VF7A 5FD5A 3VQYA 3BA9A 3JALB 1XMOH 4CS3A 3HXLA 2UXDB 5LP6B 3N43B 2HIXA 4X1YB 3CSXA 3T1YH 2KKWA 2P22C 4HNAA 3RYHA 1HNWB 4LFBB 1ZHQA 2E5LH 3W1GA 4DR2H 5IYZA 2VWJA 1HNXB 1X4TA 4K8XA 2CW7A 4ZI7B 2VQFB 1TUBB 1SKVA 2RJZA 1N34B 2ZIOA 3FFQA 4DR1B 1XDNA 2JS5A 5LP6A 1XQ8A 4B3SB 4HBNA 5EZYA 2Q7EA 3JASA 3WB0A 3N40P 4FLUA 1IBLH 1I7FA 5JVDB 4JI3B 1Q3EA 2UUCH 2JVDA 4R7RA 4X65B 4FLXA 1TUBA 1FFXB 4O4JB 4RB2C 4DK1A 4DV4H 4AHCA 2VUGA 1HR0B 4K0KB 4RZQA 3TY8A 3N2KA 1RSOA 3NBZB 2VWKA 2JGUA 4LSXA 1Z5WA 4JYAH 1N32H 4M7EA 4DV3H 4DR6B 4IHJA 1FFXA 4O4JA 4JI5B 5D5QA 5K1PA 2UUBB 3KALA 1TA8A 4LF7B 3ZEDA 1SQGA 5EIBC 5KHHA 4ZIBA 1S03G 5D1OA 5J2UA 4FLVA 3JATB 1XHZA 1IBKH 2OWOA 4O4HB 2WYOA 3K5NA 1KMIZ 4YHHH 1HW7A 4DV2H 4PZ7A 3ZS8C 3NC0B 5FNVB 1IBMH 1V9PA 3WB1A 2ZM6B 4GLXA 1CKOA 4RAYA 3VQXA 4X20B 4FM9A 2ZJTA 5FD6A 4CC5A 4LH6A 1XMQH 3RYFA 4EB6A 2HVRA 2P5OA 3F8NA 3QG5A 5CA1A 1S5JA 4CC6A 3U10A 1X9NA 4NXNB 1T5EA 2PZSA 1CKNB 3QTCA 2UXCB 1BGWA 5K1XA 4X20A 4A2BA 4B3MH 4FM2A 2UU9H 4LF6H 3E22B 4DR4B 3TY5A 1P49A 3J7AK 5JJEB 4BW9A 3GJXB 4DV5H 3CB2A 2HHHH 4EFBA 5KHKA 5J2TB 1WNSA 3HKCB 4UFZA 3A2FA 2RQ6A 4DR5B 3VQWA 4NXMH 5FPRA 1JJOA 1SYXB 2VPSA 2YI8A 2EX3A 3B2EE 1I94B 4LF5H 4I7HA 1XNRH 3HKDA 4AQYB 2VQEH 5D5PA 3K5MA 4Q6GA 3HKCA 4FFBB 5CB4A 4ZOLA 2MCTA 1N36B 1N33B 1Q8IA 4LF8H 3WB2A 4YY3B 2Q2UA 2R70A 4JI8B 4DUZH 1I6UA 4HNAB 3RYHB 4X62H 1XNQH 3RIZA 1NT2B 2BTOA 1HNZH 2E5LB 3SGIA 5KHGA 5GONA 4FLTA 4CS4A 4EQ5A 4GKKH 2RGVA 5LXTA 4FFBA 3T1HB 3IAYA 5LMNH 4DR7H 1SQFA 4JI4H 4KHPH 5EZYB 3RWRD 3JSNA 3JASB 4PDBA 1WN7A 4PI0A 4X66B 1M0WA 4DV7H 4PHZA 2RGRA 3CHXA 4OX9B 4DV6H 3RR5A 3JAKA 5JCOA 5LYJA 3M4IA 4FLWA 4B3TH 2KSWA 4LF4B 5A2QW 2E3CA 3UQ8A 4UCVA 5ITZA 4TUYA 4JI1H 3K5LA 2CFMA 2YIBA 1Z2PX 4JI7B 4DUYH 1GYFA 1JMKC 3N2KB 5CA0B 5EOYA 4JI2H 1O75A 4JYAB 4IHJB 5JQGA 5IJ9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ8 A;  1TAE A;  1DGS A;  4PZ7 A;  1IBL B;  3NC0 B;  4JI6 B;  1V9P A;  2ZM6 B;  1FVI A;  2HVQ A;  5D1O B;  2UUC B;  4GLX A;  4UCO A;  3OTO B;  5LMN B;  4DR7 B;  1A0I A;  1CKO A;  4JI4 B;  1CKN A;  2HVS A;  1B04 A;  4JI0 B;  4UCR A;  4CC5 A;  4LH6 A;  4YHH B;  3RTX A;  4DV7 B;  2HVR A;  1ZAU A;  4DV4 B;  1IBM B;  4B3R B;  3GB8 B;  4DV6 B;  4CC6 A;  1X9N A;  4NXN B;  1CKN B;  2UXC B;  4UCU A;  4B3T B;  2Q2T A;  4LFA B;  3NBY B;  1N32 B;  5DIS C;  3BAA A;  4DV3 B;  4LH7 A;  5IWA B;  4EEQ A;  4DV0 B;  3GDE A;  3S24 A;  4DR4 B;  3TY5 A;  3VNN A;  4JI1 B;  2HIV A;  3GJX B;  4DUY B;  5D1P A;  1VS0 A;  3L2P A;  4EFB A;  5LMU B;  4JI2 B;  4TOI A;  1IBK B;  4UFZ A;  4DR5 B;  3PN1 A;  5FPR A;  1J5E B;  4DV2 B;  3BAB A;  4PZ6 A;  4UCT A;  3BA9 A;  1I94 B;  2UXD B;  2HIX A;  3BA8 A;  4AQY B;  3JSL A;  1HNW B;  4LFB B;  1XMQ B;  3W1G A;  4UCS A;  4JV5 B;  1HNX B;  1P8L A;  1N36 B;  3TY9 A;  2VQF B;  1N33 B;  4LF5 B;  5BR8 B;  4YY3 B;  1N34 B;  2F4V B;  2Q2U A;  4JI8 B;  1XK5 A;  4DR1 B;  1XDN A;  4X64 B;  4DR3 B;  4B3S B;  3W5O A;  2E5L B;  2UXB B;  3SGI A;  4JI3 B;  4B3M B;  5FPO A;  2UU9 B;  4LF6 B;  1FJG B;  4EQ5 A;  4GKJ B;  4EFE A;  3T1H B;  4DV5 B;  4X65 B;  1P16 A;  2HHH B;  1CKM A;  3JSN A;  4DRF A;  3QWU A;  1XNQ B;  4X66 B;  3KYH C;  1HNZ B;  4NXM B;  4LFC B;  2UUA B;  4OX9 B;  4GKK B;  2VUG A;  1HR0 B;  3RR5 A;  4K0K B;  1XMO B;  3TY8 A;  4KHP B;  1S68 A;  1XNR B;  3NBZ B;  3W1B A;  4LF4 B;  3T1Y B;  3UQ8 A;  4DR6 B;  2VQE B;  4UCV A;  4JI5 B;  4DR2 B;  2UUB B;  2CFM A;  4JI7 B;  1TA8 A;  4LF7 B;  4LF8 B;  5D1O A;  4LF9 B;  2OWO A;  4E6N A;  4DUZ B;  4JYA B;  4DV1 B;  4X62 B; 
#chains in the Genus database with same CATH topology
 2QWR B;  3VOT A;  1GN2 A;  3R5X A;  4IT5 A;  4X1I A;  4YB8 B;  2IBZ H;  2HVQ A;  1OCC B;  5KFV A;  5I60 A;  5J2U B;  1A0I A;  1M93 A;  1SA0 A;  5L3D A;  3TXS A;  2R85 A;  4MTE A;  1KJQ A;  4O4L A;  1XIL A;  4JV5 O;  4K0K O;  3TGU H;  5KFX A;  4XX0 B;  5LP6 F;  2VQF H;  2HGS A;  5LMU H;  4B3S H;  3OR7 C;  4JI5 O;  4IWY A;  4Q8E A;  4I4T B;  1YIT V;  2BOC C;  4EEQ A;  3M9O B;  3C3T A;  5CA1 B;  1MNG A;  2H3O A;  4NZN A;  1RM1 B;  1H2G A;  1TGO A;  1S0V A;  1K73 W;  3SYQ A;  4TVI A;  3E8F A;  2EIL B;  2ZIM A;  3R5H A;  1K3E A;  2LJ2 A;  1BT8 A;  4I4T A;  3G71 V;  4JV5 H;  1SQQ H;  1FS0 G;  3T1C A;  1A9X A;  4K0K H;  4UCT A;  2JEX A;  3SYA A;  4BIU A;  3B4S A;  1Q86 W;  3G6B A;  3SJB C;  3HOX G;  4YR0 A;  1D2D A;  2FK3 A;  2PTM A;  2Q7G A;  1JDE A;  1DIK A;  3JSL A;  3JCU Z;  4N23 A;  1SZT A;  4O7Y A;  4JI5 H;  4A2A A;  1EKF A;  3JAW A;  1N0N A;  2CH7 A;  4RUC A;  3RYI B;  1P8L A;  3UO3 A;  4O3P A;  3BJY A;  1GM8 A;  2GHY A;  5BR8 B;  2OCC C;  1VQ9 V;  4J9S A;  4TQD A;  3GV8 B;  5I5V A;  2P90 A;  1YF2 A;  3R9R A;  2MK3 A;  3FX7 A;  2Q0A A;  2ZCE A;  1HWY A;  2PUS A;  4O7R A;  1IOW A;  4C5A A;  3T5H A;  1BNC A;  4ED8 A;  4ED3 A;  4FLY A;  1E1Q G;  3RYI A;  4O4H F;  3LML A;  5KFI A;  3L71 H;  1HNZ B;  2VR1 A;  1EKP A;  3J81 W;  1VF6 C;  4GKK B;  5I5X A;  3AW8 A;  5AG2 A;  4PDV A;  3NR7 A;  1BS3 A;  4GUN A;  5GTH Z;  5DED A;  3Q8Q B;  2HFE C;  2EIM C;  4DR2 B;  1G1X B;  4TV9 A;  2W6I G;  5LYJ B;  3GQC A;  1I50 A;  3MR5 A;  3H1H H;  4DK0 A;  2JRI A;  5ITZ B;  4TUY B;  1H2S B;  1TWG A;  1MG1 A;  3LNM B;  3KAJ A;  3JD1 A;  5EBW C;  3U0G A;  5KFR A;  3MR3 A;  3ZHQ A;  3E35 A;  2XC9 A;  3SR2 C;  2AGQ A;  3RAQ A;  3NXS A;  4CH4 A;  1E4G T;  4ECW A;  5KT2 A;  2QM4 A;  2HEP A;  1CXZ B;  1B3Q A;  3ZHT A;  2YIB D;  1N34 O;  1KB9 F;  1NS1 A;  2W57 A;  3UM7 A;  3SPH A;  3GIM A;  3ETE A;  1Y76 B;  1DTO A;  1QQC A;  2WLH A;  3ABM B;  5BWX A;  4RB0 A;  2ASD A;  2XAS A;  3N2G B;  1R3I C;  4JI7 O;  4QWD A;  3V6H A;  1K1S A;  3CCU V;  4DV1 O;  1G8M A;  5EC2 C;  1NVP D;  5KFN A;  4JV2 A;  4XYL B;  2HJF C;  1D5A A;  2DOS A;  1IBK B;  1GH6 A;  4LWS B;  2RMK B;  1I2L A;  2HJW A;  3B09 A;  3UCS C;  2QR4 A;  4ECT A;  5IDJ A;  3I4N G;  2HR3 A;  2K9P A;  4TM5 A;  3PW7 A;  2R7Z A;  3BFR A;  4XBF A;  4DQN A;  2EIJ C;  2EZO A;  1N34 H;  3I4M G;  5KG7 A;  3CCL V;  2B5U A;  3OM3 B;  1KBH A;  3OGC C;  5KAF Z;  1GO3 F;  4LF7 O;  2HKO A;  4JI7 H;  1YEW A;  3RUP A;  4DL2 A;  2XAQ A;  4RNM A;  1ROP A;  4PD4 F;  4O4I B;  3CXH F;  1XK5 A;  1R1B A;  1MSW D;  1SES A;  4DR3 B;  4DV1 H;  2K1E A;  2BE3 A;  4KXR A;  5IYC G;  2LW1 A;  5LHI A;  3OUU A;  3L4K A;  1S3J A;  3THO A;  5L1I A;  4LF6 B;  5CA0 F;  5I5U A;  5KFC A;  4JGS A;  3OHA A;  2V9W A;  5KG1 A;  4B08 A;  1BJT A;  3MHH C;  2HHH B;  2PF4 E;  1CKM A;  1SQV H;  4O7T A;  3Q2O A;  4O2B F;  2ZNJ A;  2BR0 A;  1E79 G;  1S10 A;  4FPP A;  1UC8 A;  1SRY A;  3ZRS A;  4EBD A;  4C5B A;  2ZDI C;  4LF7 H;  2RDJ A;  2UXC O;  2CNV A;  3L73 H;  3PW0 A;  3V6K A;  1XNR B;  1WPB A;  2RN9 A;  4CMD A;  3JAT A;  4AI8 A;  3RVZ A;  2YEV A;  1NR7 A;  4O4H A;  3H4D A;  2FB9 A;  3G80 A;  5BR8 O;  3HBL A;  4LR3 A;  2I87 A;  5JQW A;  4J9P A;  1M90 W;  2PYL A;  1C3O A;  4LCU C;  4NTY A;  1GTO A;  4DUZ B;  4NYE A;  2JEI A;  1NTZ H;  4TV8 F;  5DAA A;  3K3W A;  4EGQ A;  5C3E G;  4L8J A;  1YZB A;  2FPP B;  4F4W A;  1VQP V;  1YCI A;  1FXK B;  1Y1W A;  5LMN B;  1K97 A;  2A7W A;  3QF7 A;  1HNZ O;  2O57 A;  4JI4 B;  2UXC H;  1B04 A;  3WWJ A;  4GKK O;  2BSK B;  4ED6 A;  1DLB A;  3I56 V;  2NU6 B;  1ZAU A;  3FYI B;  3HKE B;  5BR8 H;  3ASO B;  4LNU B;  1FXK A;  2ZT9 B;  3ASN C;  2NUA B;  2FE3 A;  3P30 A;  5I47 A;  3H9V A;  4QGP A;  2YZL A;  4I55 F;  4DR2 O;  2D3O W;  5J2T A;  1EN5 A;  4HR7 A;  2B63 G;  2WAM A;  3VNN A;  1K4D C;  5HNE A;  3AG7 A;  4D7T A;  4DUY B;  5IY5 C;  5I5T A;  4A3F G;  3HKE A;  2XCP A;  2M7W A;  4TOI A;  2C2D A;  2EBO A;  3ETQ A;  4OPH A;  2UVV A;  1ZL8 A;  3Q1K A;  2XHB A;  5FLX W;  4PA3 A;  2DE0 X;  2XGQ A;  5FD5 A;  3JAL B;  4WCE V;  4WFA V;  2Y0S A;  5GW7 A;  2UXD B;  4O83 A;  5KFE A;  1S0N A;  1YJ9 V;  2I8C A;  1IYE A;  3ORR A;  3APO A;  4LFB B;  4XDL A;  3GWO A;  3OUF A;  4DR2 H;  1C30 A;  5KFB A;  5I5Y A;  1X4T A;  2CW7 A;  4RZR A;  1YI2 V;  1AUX A;  3U9T A;  5KFQ A;  4DR1 B;  4O84 A;  3GTK A;  1F51 A;  1PL0 A;  4HBN A;  2Q7E A;  5KX5 F;  2FK1 A;  4FLU A;  3UKM A;  4JI3 B;  1Q3E A;  2DJV A;  3RBZ A;  2JVD A;  3B77 A;  3BG5 A;  1IBK O;  2XAJ A;  4JYY A;  2WTF A;  2WLL A;  1QLE B;  1B6Q A;  1PM9 A;  1FFX B;  4A3G G;  3Q4H A;  1NTK H;  2XGP A;  5LOV F;  1IBM O;  1S97 A;  1I7L A;  3BY6 A;  3K9A A;  3TY8 A;  2FJZ A;  3E83 A;  3N2K A;  2CNU A;  1VBH A;  4GX0 A;  5LA6 F;  5JVL A;  2Z04 A;  4LSX A;  5KT6 A;  2Q4P A;  4CZZ A;  2QB5 A;  5C1P A;  1FFX A;  1SFO A;  2R7L A;  2C2R A;  3CPW U;  1Y67 A;  1SQX H;  5B3S B;  1SQG A;  2G38 A;  5KFO A;  5D1O A;  1MZE A;  1XHZ A;  1IBK H;  4L1K A;  3Q8P B;  4LF6 O;  1Q81 W;  2WYO A;  3CCR V;  1SER A;  2V58 A;  3V4S A;  5C44 G;  4NTW A;  4G28 B;  2HHH O;  2W9C B;  1V9P A;  1IBM H;  1FAF A;  4B7E A;  3MR6 A;  5IE9 A;  2W6M A;  1BQ0 A;  4U6P A;  4RAY A;  3L72 H;  2W70 A;  1N8R W;  2Q0O C;  2EJ0 A;  2ZJT A;  2E2I A;  3CX5 F;  1M56 B;  4CC5 A;  3MJF A;  4QNH B;  4L87 A;  3GLK A;  1TWH A;  3X2Q B;  4J11 A;  2WLN A;  4EB6 A;  5KT3 A;  2IMW P;  3GTM A;  1RJP A;  3L70 H;  3F8N A;  1XNR O;  4CC6 A;  2FB5 A;  1ZLZ A;  2QWN B;  2PZS A;  1Y1V G;  3CCJ V;  1P84 F;  2JJ1 G;  5LL6 Y;  2DQ0 A;  4XDJ A;  2Y4T A;  3PFF A;  1BGW A;  1CQI B;  1OCO B;  5K1X A;  5DEC A;  3G8D A;  3V6J A;  4LF6 H;  2NNU A;  5KFJ A;  4DR4 B;  3T54 A;  2OH2 A;  4N21 A;  4K35 A;  4DUZ O;  1N48 A;  2V7Q G;  3SI8 A;  2HHH H;  1H2L A;  1K9M W;  5KHK A;  3GTO A;  3STL C;  1WNS A;  4ASU G;  4QPK A;  1S76 D;  1VAJ A;  4F4Z A;  3RFC A;  1JJO A;  3ZX6 A;  2NVX A;  4BR6 A;  5LMN O;  4QSH A;  2VPS A;  2YI8 A;  4JI4 O;  4KHP O;  2YL2 A;  3B2E E;  1XNR H;  1PPJ H;  3ORQ A;  4J41 A;  1KT8 A;  1AR1 B;  4JUZ A;  2PI5 A;  5FNV F;  1AJP A;  2QKS A;  1H8E G;  2Z02 A;  3AG1 B;  3W7W A;  4Q6G A;  2ZE7 A;  3EPG A;  5L1J A;  5EWF A;  3HOU G;  4MVQ A;  4RWU A;  5D8D A;  5C5J A;  4C5C A;  2Y69 B;  4YY3 B;  5BMV F;  3CME V;  4DUZ H;  3RYH B;  3B40 A;  4GZR B;  1I08 A;  2P6J A;  3SGI A;  2ADQ B;  4DUY O;  3QFF A;  3ZCC A;  4P9O A;  5LMN H;  5KFD A;  1GM7 A;  4JI4 H;  4KHP H;  4FS1 A;  2WLI B;  1XL6 A;  4BIO A;  1Z2G A;  1G2W A;  4X66 B;  1HDJ A;  1M0W A;  3CHX A;  2IU3 A;  4B3R O;  1M57 B;  2UXD O;  2XOK G;  4QWA A;  3GV7 B;  2XND G;  5KA5 A;  3GTG A;  2QWO B;  5C8Y F;  4LFB O;  1I3Q A;  4JYC A;  3ZHV A;  3CCV V;  3TII A;  4LF4 B;  2W6Z A;  2IJK A;  5A2Q W;  2WLI A;  2WWW A;  3IC9 A;  4PA7 A;  4B7K A;  4Q45 A;  2YIB A;  4DUY H;  4DR1 O;  2N04 A;  1GYF A;  3OW2 U;  3OEH G;  1ZWI C;  4QIW F;  1NVP B;  2IA6 A;  2Z0A A;  4O7N A;  2GTA A;  4JI3 O;  2F93 B;  5LA6 A;  3GTJ A;  1S72 V;  4TWK A;  4B3R H;  1JJ2 U;  4JTC B;  3ZMT A;  2UXD H;  3S3X A;  1PL4 A;  3KXY T;  3T5L A;  1ZTE A;  4PA9 A;  1YIJ V;  3OSN A;  5E79 Z;  1FYJ A;  1I5X A;  3KAK A;  3OMN B;  3PO2 G;  4LFB H;  4YHH B;  4R6Z A;  3ZHS A;  1JIH A;  1KUQ A;  4LSA A;  1VQ4 V;  3HR0 A;  2GTS A;  3H40 A;  2ILM A;  3F5T A;  1WJZ A;  3VQV A;  5J9P C;  4WHX A;  5EZY F;  2VOB A;  5KT5 A;  4DR1 H;  1BSM A;  3KZI Z;  4MTG A;  3BPZ A;  2QEX V;  1IXB A;  1W0K G;  3AEI A;  3CRR A;  2Y4R A;  3HO8 A;  2FP4 B;  4JI3 H;  3L4J A;  2AHY A;  2YU9 A;  1WLE A;  5H2F Z;  3RB3 A;  3ZBH A;  4TQS A;  4YJ2 B;  4PDR A;  4X8A A;  2FMA A;  3OGI B;  2XD4 A;  3LNN A;  4MV9 A;  4A3I G;  2Y0I A;  1R6T A;  3DC5 A;  3CWB H;  1AN7 A;  1F4M A;  3N6X A;  2YDE A;  2WDT A;  3CXC U;  2R87 A;  3BAC A;  3T2M A;  3BQ2 A;  4E2L A;  1J5E B;  3ABL C;  3CS5 A;  1KU9 A;  3ML0 A;  3RGZ A;  2H94 A;  3GB7 C;  2N05 A;  4FK5 C;  1N0J A;  2R72 A;  4YJ2 A;  4APM A;  4C2M A;  5H5N A;  1S5L Z;  2FL4 A;  3DAA A;  5DQI A;  2W8K A;  4MTO A;  2WE6 A;  3SPJ A;  4BBS G;  4EBE A;  1BQZ A;  3JD3 A;  5EBL C;  5CM0 A;  1Z2N X;  4QE9 A;  4LF5 B;  4F50 A;  2KG7 B;  4O2A B;  4QW8 A;  4DL4 A;  2J6T A;  4YJ3 B;  3P3P A;  3TJT A;  4FFL A;  1Q7Y W;  5CB4 B;  5FPO A;  2DPJ A;  1W59 A;  4EFE A;  4YXW G;  1EN6 A;  4YR2 A;  3EFF K;  1N56 A;  4TQR A;  2KG7 A;  3BQ0 A;  5CA1 F;  4O2A A;  5GON B;  1JCH A;  3KYH C;  5BMV A;  3D8C A;  1LUV A;  3EXA A;  4YJ3 A;  3RW0 A;  3PW5 A;  5LXT B;  3RYC B;  4D6T H;  3EVK A;  2EJ3 A;  3T9A A;  3GIK A;  1XMO B;  1NBM G;  2V4D A;  2KSD A;  3G8C A;  4LF9 H;  1GGO A;  1BXR A;  5IT9 W;  3KHH A;  4BWS C;  1XDC A;  3JAK B;  5LGN A;  4YY3 O;  2ZR3 A;  3VPD A;  4IRD A;  3RYC A;  4MTX A;  5L9X A;  4F4X A;  3FB7 C;  4A3M G;  1R9T A;  2HG8 A;  1TWC A;  3LSU A;  2JK5 C;  4OPA A;  3LDE A;  2QWP B;  1EUD B;  1MZF A;  2CUG A;  3OD4 A;  2GQS A;  2R7Z G;  2EIK C;  5LGU A;  5CMU A;  3KKY A;  4AIL C;  4X66 O;  3N8D A;  5HFL A;  5JQG B;  2W9B B;  4X1I B;  2AGO A;  4WFB V;  5IP7 G;  1JLL B;  1AI7 A;  4A3D G;  3MFI A;  1JR9 A;  4IRK A;  4LF4 O;  1SA0 B;  1PV0 A;  4WBN B;  1K1Q A;  4YY3 H;  4EBC A;  3QVN A;  2OTL V;  4HQ6 A;  4O4L B;  3RGB A;  5B66 Z;  4CKE A;  3K5I A;  1V54 B;  1K34 A;  4IAJ A;  3J80 N;  3M9M B;  3BHP A;  2P06 A;  3KRE A;  1GO3 E;  1ARO P;  2W9B A;  4MV1 A;  1Q43 A;  5EYP A;  4H0L B;  5IYD G;  2A0L A;  4Z1M G;  4WBN A;  4X1Y A;  4X66 H;  2YCH A;  3H1L H;  1SC5 B;  1G6U A;  5F9L A;  5LYJ F;  4DV2 B;  2YZM A;  3UO2 A;  1VF6 A;  3AG2 C;  4YHH O;  4TUY F;  3JZF A;  1EYZ A;  4LF4 H;  5KS8 A;  2P67 A;  2QSA A;  3SJA C;  1Z2O X;  3U0Z A;  5IYB G;  3LDC A;  3E5N A;  1XMQ B;  4NB5 A;  4UVB A;  2JEF A;  4UCS A;  1OWT A;  4I50 B;  5JVD A;  2RDC A;  2A06 H;  4NZM A;  3BVO A;  2YS6 A;  1QBZ A;  4DAA A;  5JUM A;  4JYB A;  1RK6 A;  3JAW B;  2CH7 B;  2OIG A;  3IN5 A;  2RNB A;  2R92 A;  3RF2 A;  1Y1W G;  1K83 A;  4I50 A;  1A0G A;  4I9Q A;  4BIZ A;  4IHJ F;  1J5E O;  5DQG A;  5KFH A;  4MVZ A;  4GT1 A;  2YUA A;  4O81 A;  4J9N A;  2FKL A;  1KBL A;  3LWB A;  4KL1 A;  3RAX A;  2E74 B;  3ABU A;  5JH7 F;  4WFF A;  3BQ1 A;  3ZMU A;  4MA0 A;  2EJ2 A;  3W1B A;  1W2B U;  3UZO A;  5KFW A;  4ZQI A;  3IG0 A;  2ABJ A;  1BZK A;  2PBZ A;  2DWD C;  3VOU A;  2ZE8 A;  4MVS A;  3OHB A;  2YI9 A;  1L0N H;  1V55 C;  2DZD A;  1M6V A;  1OHH G;  1AR4 A;  4O3R A;  4ED2 A;  1A3G A;  4E6N A;  4RUF A;  1WR2 A;  1BHA A;  5B5E Z;  4CHI A;  5H9C A;  1J5E H;  3LSQ A;  4GCZ A;  4CH6 A;  1WA8 A;  2M6Y A;  4J80 A;  4TV9 B;  3K3V A;  3CVZ A;  3C90 A;  3DXR B;  3N42 B;  3U11 A;  3SYC A;  2XT9 A;  4BW5 A;  5EIB D;  3NUA A;  1CKN A;  1THZ A;  4BAY A;  4YR3 A;  4X89 A;  2CDY A;  3GID A;  1SET A;  1XMO O;  3HOV G;  1H2K A;  4DV6 B;  5HV6 A;  3DXR A;  2JEJ A;  1A32 A;  3FAV A;  3K58 A;  2Q2T A;  2E5L O;  2W0F C;  3WO0 A;  2NLJ C;  2YIA A;  3RT3 C;  3BAA A;  1B6S A;  4I7Z B;  3ETH A;  3GDE A;  3JZ6 A;  1Q6I A;  3K06 A;  4JI1 B;  1VQK V;  4MV8 A;  2HIV A;  1EN4 A;  1OCZ B;  1OCC C;  4LMY A;  1G4Y B;  2X6B A;  2DMX A;  4JF3 A;  1IOV A;  3UFX B;  1ZUQ A;  4ZOL F;  5KKN B;  4JV0 A;  2Q67 A;  2ODT X;  1XMO H;  2ZDI A;  4CS3 A;  5LP6 B;  4FZ1 A;  1DK1 A;  2CQY A;  1VQO V;  1PP9 H;  2FLP A;  1CE8 A;  4HNA A;  1HNW B;  2E5L H;  1DV1 A;  3W1G A;  1ENV A;  4NR1 A;  2AU0 A;  1HNX B;  2XUM A;  3GIP A;  2YW2 A;  1P7G A;  1TUB B;  1SKV A;  2C35 B;  1RM1 C;  4GX2 A;  4JYA O;  2ZIO A;  3RV3 A;  2HLD G;  4RU9 A;  1XDN A;  5CBH A;  5LP6 A;  1GSA A;  4J9O A;  3JAS A;  3OSP A;  2NN4 A;  3M8A A;  2EIL C;  2R93 A;  2EUL A;  4R7R A;  1AUV A;  4FFO A;  5KFF A;  4A3L G;  4X65 B;  1KJI A;  4QJF B;  4FLX A;  2XCA A;  3R5F A;  3RB4 A;  2C28 A;  4DV2 O;  2HGX A;  1TUB A;  4BXX G;  4JXU A;  4JTA B;  4DK1 A;  2A3Q A;  1HR0 B;  4O7S A;  3DTG A;  1OZ0 A;  1XMQ O;  3HOZ G;  2VWK A;  5BPH A;  2VUM A;  2JGU A;  2GQR A;  1Z5W A;  4QJF A;  4JYA H;  3ABK B;  4DR6 B;  4IHJ A;  1NQT A;  3G6Y A;  1Y74 A;  1ZX3 A;  1QR9 A;  5D5Q A;  2UUB B;  2JS3 A;  3KAL A;  3QZ7 A;  1YVW A;  2N74 A;  4J9L A;  1TA8 A;  4MA5 A;  2QWQ B;  1GSH A;  2QE7 G;  2Y48 A;  2KQX A;  3JAT B;  4IZO A;  5LGT A;  1XRE A;  1I0H A;  1IXM A;  2YEV B;  4O4H B;  3H4B A;  3K5N A;  1R3K C;  3R23 A;  1HW7 A;  2PI4 A;  4DV2 H;  4PZ7 A;  4FE2 A;  3SPG A;  4A3K G;  4ED7 A;  2QTO A;  3A8T A;  2RDI A;  2DWC A;  4ECU A;  3VQX A;  3CJH A;  4CKB A;  4FMT A;  4X20 B;  1XUQ A;  5FD6 A;  3APQ A;  1XMQ H;  2UVR A;  1BL8 A;  2JA6 G;  2Q8V A;  2WLM A;  3RYF A;  4EGJ A;  5GTI Z;  3SYP A;  3QG5 A;  5L3B A;  1X59 A;  1S5J A;  2R8G A;  3K03 A;  1T5E A;  4Q43 A;  2OT5 A;  3AX6 A;  4J7J A;  1DAA A;  1PK8 A;  4IYH A;  2COJ A;  1J95 A;  4MSW C;  4X20 A;  4X88 A;  4A2B A;  4RNO A;  3J7A K;  2ALZ A;  4BW9 A;  3E89 A;  4EFB A;  3CP1 A;  1ET0 A;  4QW9 A;  1XOU A;  4DL6 A;  2GPW A;  2UVW A;  5J2T B;  2UXX A;  4UFZ A;  4XDK A;  1Q90 D;  2R7N A;  2C2E A;  2FYU H;  1SYX B;  3EPI A;  3HB3 B;  5JWP A;  1EFR G;  2LO1 A;  3H1K H;  3UYY A;  2V1D A;  1Y66 A;  4UUJ C;  1H38 A;  3W7U A;  2WPD G;  2R8I A;  2J6S A;  1SZX A;  3ABM C;  3HKD A;  2XAF A;  1ZL8 B;  5D5P A;  4GLW A;  4DV6 O;  4MV6 A;  3K5M A;  4UUG A;  1K8A W;  4HYK A;  3WU2 Z;  1WPX A;  4HNT A;  5DGA A;  2E76 B;  4ZOL A;  1E1R G;  1P7B A;  1N33 B;  1Q8I A;  4TSF G;  3H0G A;  1GN3 A;  2JDI G;  2AZ0 A;  4JI1 O;  1NT2 B;  2BTO A;  3RIZ A;  1HNZ H;  3ZN1 A;  4FFR A;  4FLT A;  3TCU A;  3V4Z A;  4EQ5 A;  2FK2 A;  2RGV A;  4GKK H;  2A9H A;  5EDW A;  2R8J A;  4ECY A;  4FJC C;  4JAV A;  5KFM A;  1SQF A;  4QIW E;  4FIP C;  4YBZ B;  3AG4 B;  5KG6 A;  3JSN A;  2I80 A;  2QKA A;  2FKX A;  1AI5 A;  4ZHQ F;  4OX9 B;  4DV6 H;  4YAJ B;  3H1I H;  4O3N A;  1T94 A;  5JCO A;  3SE7 A;  2WLL B;  1HNW O;  4FLW A;  5L3F A;  3Q4H B;  1YTF D;  3CC2 V;  2E3C A;  3JAM N;  5B1N A;  1MMM A;  1HNX O;  4IIJ F;  2YXY A;  4JI1 H;  2IJJ A;  5L1K A;  1Z2P X;  1VQ8 V;  2XTA A;  3N2K B;  1PD3 A;  5CA0 B;  4ECZ A;  4IGG A;  3OE7 G;  5DLG A;  3GTP A;  5IJ9 B;  3JZI A;  5DGI A;  4O2B B;  3J7A U;  3HKZ A;  1DGS A;  1NTM H;  1L1F A;  3E8H A;  4X65 O;  3KHL A;  1NKD A;  5D1O B;  2YZG A;  3OTO B;  3P3N A;  3T9D A;  5IYZ F;  4ED1 A;  1S5H C;  5CA0 A;  4JI0 B;  2CNQ A;  1HNW H;  4FLZ A;  3H3V H;  4EKW A;  4J9Q A;  5IJ9 A;  4O2B A;  1HNX H;  3GIJ A;  2FML A;  5CN0 A;  1XI1 A;  3HT5 A;  1RYS A;  1IUR A;  4DR3 O;  3M7M X;  4DR6 O;  2R9R B;  2YYA A;  2FLL A;  1WRV A;  1S9F A;  4J0M A;  4J9K A;  1T3N A;  2UUB O;  3WG7 C;  3O9O A;  4EB6 B;  4PV1 B;  1U97 A;  2CE4 A;  4DV0 B;  4J9Z B;  4ZI7 F;  2W9A A;  5DLF A;  1EKV A;  2COG A;  2YWV A;  5B1B B;  2VA2 A;  4X65 H;  1FXK C;  4O7L A;  3L2P A;  1TVK A;  3K08 A;  4DRX A;  2EIN C;  1I2K A;  1R6K A;  3OFN G;  3FB6 C;  1OCR B;  2JA5 A;  2LP7 A;  3E2E A;  1Y6X A;  4TV8 A;  2DYR B;  4I0X B;  2JIZ G;  1QHT A;  1YDX A;  1K5S A;  4MVO A;  4O4J F;  3ASO C;  2IH1 C;  4DR3 H;  4DR6 H;  4C7U A;  1BCC H;  4F6E A;  3OUZ A;  3HOY G;  4I55 B;  2UUB H;  1TWF A;  2E2H A;  1PNL A;  1VQM V;  4DL7 A;  1IYD A;  1YSC A;  2W6N A;  5KHI A;  1GLV A;  2HGW A;  2F4V B;  5CA3 A;  4I0X A;  4X64 B;  1NU1 H;  3GV5 B;  3OR6 C;  2Z3Y A;  5KT7 A;  2BQ3 A;  2JA7 G;  3HKB A;  3ABT A;  5E25 A;  4I55 A;  2W6O A;  4FU0 A;  5KFS A;  1P16 A;  2DLN A;  4MVR A;  3K57 A;  4O82 A;  2RCV A;  4RCN A;  5EBM C;  1XNQ B;  1JVM A;  2X0L A;  2IM9 A;  3ZIA G;  5C4X G;  2JA6 A;  4RAI A;  5CR5 A;  4UVA A;  3T9B A;  3HPL C;  1FXV A;  3TQ1 A;  2R8K A;  2NU9 B;  4RNN A;  3K5O A;  4ECV A;  3IGA C;  2SCU B;  2XIG A;  1N33 O;  4GYC B;  3CEB A;  1NJI W;  5BWU A;  4EG0 A;  2YRX A;  3MWD A;  1VIB A;  3N41 B;  1GKF A;  1KTA A;  2ASJ A;  1TWA A;  4M0J A;  2JA8 G;  2DWE C;  1JPX A;  1R3L C;  3QWU A;  2CTR A;  2HG5 C;  3D36 C;  2PMZ E;  2VS0 A;  3T9F A;  5KG0 A;  1IBL B;  3JAR A;  3SJC C;  5LOV B;  4MV4 A;  4ECS A;  5KX5 A;  1KUT A;  4UCO A;  4M9U A;  4NVP A;  3JRW A;  4GX5 A;  2Q73 A;  2BTQ A;  3W7X A;  4OX9 O;  3ICX A;  5LA6 B;  3RFR A;  4O3Q A;  3TIN A;  2GV9 A;  2PGG A;  4FVM A;  2ZDH A;  1U96 A;  4KUM A;  3E8G A;  1WB7 A;  3GB8 B;  2M05 A;  5B3S C;  1N33 H;  4CH5 A;  1RPR A;  2CTW A;  5LOV A;  4FM0 A;  5GON F;  2DYS B;  3CC4 V;  4EYI B;  1GM9 A;  5KMG A;  3C0F B;  2B1I A;  5LXT F;  5KUK A;  1N32 B;  2YS8 A;  2YID A;  3AG3 C;  4DV3 B;  4ECQ A;  2R92 G;  2OCH A;  1WB8 A;  3DSQ A;  2P4K A;  5JJN B;  4XZ3 B;  1O9G A;  4R8U B;  2YIC A;  1TUE B;  2PYJ A;  5LMU B;  5BY1 A;  2OTJ V;  4QWB A;  4YP3 A;  2Q7H A;  4P9P A;  3RJ0 A;  1M56 C;  4KP4 A;  3T4Z A;  4OX9 H;  3X2Q C;  3OTO O;  4HZ3 A;  1AI4 A;  3ETJ A;  2AGA A;  4JI0 O;  4ZBM A;  4PWQ A;  2VA3 A;  4O3O A;  4ZI7 A;  3R66 A;  1E4F T;  1N4C A;  3VA7 A;  1MSD A;  4R8U A;  2ZXW B;  3QNE A;  3ZMS A;  3PR5 B;  1OCO C;  1O9H A;  4ECX A;  4JV5 B;  2EIK B;  3OTF A;  1EBO A;  4ED0 A;  3K79 A;  5JQG F;  3TY9 A;  2R82 A;  5KAI Z;  3FKI G;  3DF7 A;  1UC9 A;  4DV0 O;  5BWT A;  3JCZ A;  1E4E B;  4O3S A;  1FPO A;  5H80 A;  2UU9 B;  1Y4M A;  4O4L F;  1RJR A;  3ZMV A;  3OTO H;  4DV5 B;  2FTK A;  4KFM A;  5KFU A;  4RAZ A;  3DC6 A;  2B1G A;  4JI0 H;  5IYC O;  3PJS K;  5CAE B;  1Q6U A;  2C2A A;  1M0T A;  4NXM B;  5EC1 C;  1WH2 A;  3AG1 C;  3TW7 A;  1NH2 D;  5J2U F;  3T7A A;  1E4E A;  5FR9 A;  2OLS A;  2IH3 C;  2WA3 A;  1ZHS A;  4MW3 A;  2Y69 C;  3I5D A;  4PA6 A;  1KD1 W;  1L0L H;  5BMV B;  2VQE B;  4DR4 O;  1B06 A;  1WCM A;  4DV0 H;  1ZET A;  4WFG A;  2CGO A;  4MV3 A;  3FB5 C;  2F4V O;  2AZ2 A;  3VPC A;  4X64 O;  3QQM A;  4J10 A;  5FNV A;  3UT5 B;  4CKC A;  4IR1 A;  2R9I A;  5BWV A;  4I4T F;  3U9S A;  3SPC A;  4X62 B;  2LQT A;  3TW6 A;  1JOY A;  3EYY A;  3MWE A;  1M57 C;  3UZB A;  4MTF A;  3CRQ A;  4RB1 A;  4IR9 A;  3VPB A;  2H8P C;  3TQT A;  1R6N A;  2C00 A;  3UT5 A;  5C8Y B;  4RQF A;  1M4U A;  4H37 A;  3K3P A;  2ITD C;  2YXH A;  3K0D A;  4DR4 H;  3E22 A;  5L1L A;  1V51 A;  2CZG A;  4JAA A;  3ZHU A;  2F4V H;  2WAQ A;  5B1A C;  4X64 H;  3ZJZ A;  4B3T B;  3CQZ A;  2AHZ A;  3N6R A;  1W96 A;  4FBT A;  5C8Y A;  1KP2 A;  2R93 G;  4F4Y A;  3MDS A;  2ZDQ A;  2F95 B;  3J80 W;  5K2M A;  1AVM A;  3T5J A;  2ZIN A;  2OCC B;  1EZ1 A;  5T14 A;  1OJH A;  3EHB B;  3K9S A;  4PA4 A;  2GLT A;  1ZSP A;  1VMG A;  3CRC A;  1VQ6 V;  2JA7 A;  3LSS A;  1IBL O;  2YXL A;  5BYB A;  4WF9 V;  4QIW A;  3PN1 A;  4Q20 A;  1V55 B;  1UJW B;  5EYP B;  1VF5 B;  4FFP A;  2NU7 B;  5KFZ A;  3VQY A;  4HAM A;  3CSW A;  1YTF B;  3N43 B;  2VUM G;  3B8M A;  4X1Y B;  3MFH A;  3CSX A;  3HB9 A;  2V4R A;  4TV9 F;  1EZV H;  2X0S A;  2KKW A;  2P22 C;  4UV8 A;  1ZHQ A;  4BBR G;  3WWI A;  3RN4 A;  2CTP A;  2VWJ A;  4K8X A;  2W71 A;  3GTQ A;  1N34 B;  1N32 O;  2YSU B;  4DV3 O;  2QDO A;  3HKZ E;  2QTS A;  2Q9L A;  1XQ8 A;  2GBO A;  1PKX A;  5EZY A;  3ZN0 A;  5DN6 G;  4IRC A;  5A9G A;  3U54 A;  4Q4C A;  3N40 P;  1IBL H;  5JVD B;  1K33 A;  2EIM B;  3D3Q A;  2Q7D A;  4U7N A;  5LMU O;  1PX2 A;  2FPI B;  1NR1 A;  3OT7 A;  1RSO B;  1CS0 A;  1OBD A;  1VQN V;  2ZKO A;  3AK3 A;  2QF7 A;  3CMA V;  1JA8 A;  2Q6A A;  5H6R A;  4J9R A;  5LHH A;  2VUG A;  1K92 A;  3OMI B;  3RBE A;  4RZQ A;  1SQP H;  4FGR A;  2LGQ A;  1RSO A;  2Q69 A;  3W7T A;  3D3I A;  3RB6 A;  3RVY A;  3CD6 V;  1N32 H;  3Q8S B;  4DV3 H;  1H2N A;  2J6U A;  3NGD A;  5K1P A;  1FFT B;  3RBD A;  3SNO A;  4LF7 B;  2ZDG A;  4YIO A;  4ICG A;  1WP8 A;  4ZIB A;  4A3J G;  1PNK A;  5J2U A;  4FLV A;  4NZO A;  3GTL A;  2OWO A;  3ZHR A;  2UU9 O;  3KCX A;  3OAA G;  2IP4 A;  4YHH H;  1SQB H;  5DG8 A;  4DV5 O;  2YRW A;  2QGN A;  3NC0 B;  4TT3 G;  3WB1 A;  2ZM6 B;  1RP3 B;  3A0H Z;  1F4N A;  4DO2 A;  4GLX A;  2E75 B;  1CKO A;  5KG4 A;  4NXM O;  3G6E V;  4MVM A;  1WA8 B;  4LH6 A;  3CCE V;  2ATL A;  4CMF A;  4UXN A;  2HVR A;  4PEL A;  4LF5 O;  3KHR A;  3O65 A;  2P5O A;  1FD9 A;  5CA1 A;  3H0G G;  2EIJ B;  3U10 A;  2WA4 A;  4NXN B;  2R84 A;  2VQE O;  1CKN B;  2UXC B;  3R65 A;  3FKI A;  2ZD9 A;  2HVJ C;  4H33 A;  2UU9 H;  3ETD A;  1P49 A;  3CE2 A;  4O4I F;  5JJE B;  4DV5 H;  4W4L A;  5KFK A;  3CEI A;  2ARH A;  3FAV B;  4X62 O;  4G27 B;  5KA6 A;  3F5W C;  3IC7 A;  1H8H G;  3HKC B;  2RQ6 A;  4DR5 B;  3VQW A;  4NXM H;  5FPR A;  4O7V A;  2WLJ A;  5BZB A;  1XL4 A;  1UNN C;  1K5Q A;  2EX3 A;  1I94 B;  1KEE A;  4LF5 H;  2ITC C;  1QVF U;  2J9G A;  1LNQ A;  4AQY B;  1BE3 H;  2VQE H;  1JDB B;  1V54 C;  2F23 A;  2EJ7 A;  4FZ0 A;  3HKC A;  2ZE6 A;  3AYH B;  2W8L A;  4B3T O;  1N36 B;  3JRX A;  2MCT A;  4DL3 A;  5F2V O;  2VPQ A;  3M9N B;  3WB2 A;  2GSM B;  3G6V A;  3ZRW B;  4R50 A;  4JI8 B;  2D2C B;  5HFM A;  5LHG A;  4HNA B;  4X62 H;  4WFH A;  2ZGI A;  1M9N A;  4PJ0 Z;  3JD4 A;  2V59 A;  5K3W A;  4CS4 A;  2W6Q A;  1VEW A;  2PMZ A;  3I12 A;  3T1H B;  3IAY A;  1SF9 A;  2JJ2 G;  2EIY A;  1BGY H;  3JAS B;  1DF5 A;  4PI0 A;  3ZRW A;  3J81 N;  3L74 H;  2QM7 A;  2RGR A;  4I5S A;  1LR1 A;  1GSO A;  4NKG B;  3ZRV A;  3RR5 A;  5EWE A;  1KKC A;  4WFE A;  4J7Z A;  4MAM A;  5J2T F;  5F9N A;  5LYJ A;  1EM1 A;  1IVS A;  4B3T H;  2KSW A;  1KJ8 A;  3UQ8 A;  3TET A;  2Y0P A;  1COW G;  4UCV A;  5ITZ A;  4TUY A;  2BCC H;  1VAR A;  4QWC A;  4YQW A;  2DAB A;  3CCM V;  2DPI A;  1AJN A;  3AK1 A;  2R6F A;  2CKZ B;  3ASN B;  2IJI A;  5EOY A;  1GMG A;  2W7O A;  1FXH A;  5CBG A;  3FKS G;  1O75 A;  4IHJ B;  3M4I A;  4UVC A;  1Y74 B;  4PZ8 A;  2JA5 G;  1TAE A;  1EUC B;  3DGE A;  2W6J G;  2ZNI A;  1RK5 A;  4JI6 B;  1AR5 A;  4IWX A;  1ULZ A;  2PN1 A;  3KHG A;  5IY5 B;  2LFS A;  4FFN A;  4TQF A;  5JH7 B;  1Y76 A;  4GX1 A;  3RTX A;  3FMA A;  3N2G A;  5KFA A;  2JGD B;  3TK1 A;  2QK4 A;  1IBM B;  1JFF B;  3CJH B;  3QO8 A;  5FL7 G;  4UCU A;  4U3J B;  5KT4 A;  4LFA B;  2GUZ B;  3RYF B;  5JH7 A;  1ZQ7 A;  4A3B G;  2CGN A;  3SJQ C;  4LWS A;  5B1O A;  5IWA B;  3IFX A;  3S24 A;  3M99 B;  1IX9 A;  3FYE B;  2LGW A;  2JGD A;  3CCQ V;  1F7Y A;  3L75 H;  1SCU B;  1AB3 A;  4EEY A;  4O7Z A;  1UPG A;  4K3A A;  1JFF A;  4J42 A;  4DIM A;  1UFI A;  2EJR A;  1YJN V;  2ZM6 O;  1NH2 B;  3N44 B;  4U3J A;  4PI2 A;  4YIP A;  5FJ8 G;  2COI A;  2AXT Z;  3QO5 A;  2GUZ A;  3BAB A;  4PZ6 A;  1RFY A;  4HNV A;  3BA8 A;  1YXB A;  4O4I A;  2A79 B;  4FM1 A;  1M1K W;  3PW2 A;  1M7J A;  4O86 A;  4X1K B;  2ADP A;  3GVM A;  4DL5 A;  3G4S V;  4NXN O;  2HJD A;  4A5U B;  4AYB E;  2DIK A;  4Q44 A;  1OCZ C;  5CE8 A;  1V4Y A;  5FLM G;  5KG3 A;  1GAX A;  3HKD B;  4MV7 A;  3PVX A;  2NVY A;  3W5O A;  4Z2W A;  3MAQ A;  5BWR A;  2UVU A;  4JPR A;  2UXB B;  4X1K A;  1FJG B;  4ZOL B;  2ZM6 H;  4GKJ B;  5L3G A;  3OEE G;  1I1K A;  4Z1V A;  5LP6 C;  4DR5 O;  3WG7 B;  2CAZ C;  1SEI A;  1JX4 A;  4R8C A;  4HN2 A;  2OIE A;  1I94 O;  1Q6H A;  4J7K A;  4LFC B;  2UUA B;  5TIS Z;  3ETG A;  4QWE A;  2WAQ E;  2R8H A;  2A1H A;  4AQY O;  2ODM A;  4NXN H;  1I1L A;  4UB6 Z;  4KHP B;  1KKD A;  1S68 A;  4WD3 A;  2EIN B;  4DLK A;  5DG9 A;  3T1Y B;  4U7C A;  2DAA A;  1LUW A;  2Q5Z A;  2R7K A;  1N36 O;  2WB1 E;  1M5I A;  5KG2 A;  2ZE5 A;  3TEK A;  3JAM W;  2B9Z A;  3PZP A;  4JI8 O;  1EZJ A;  2AQ4 A;  1S0O A;  1MAB G;  4K8Z A;  2YZN A;  3N27 A;  1JQ0 A;  1F23 A;  4BWA A;  4DR5 H;  1YHQ V;  5C1O A;  2Z5U A;  2BSK A;  1KC8 W;  2NU8 B;  3T1H O;  1B33 N;  4W4K A;  5EK0 A;  3LDD A;  4IYI A;  5IJ0 B;  1Z5V A;  4JZG A;  2BQU A;  1I94 H;  3A0R A;  2GDS A;  2R9A A;  2UUC B;  4D7S A;  4CE5 A;  1H2M A;  3MWM A;  1R73 A;  4AQY H;  1WP7 A;  4LNU A;  3FB8 C;  5KHJ A;  4UCR A;  1VBG A;  3PO3 G;  2NR5 A;  4FFM A;  3BEH A;  3ABK C;  1K7D A;  1XHX A;  4F6R B;  4DV4 B;  3FD9 A;  4B3R B;  1N36 H;  5BPF A;  1OBG A;  1I1M A;  3H1J H;  5IJ0 A;  4Q0Y A;  4JI8 H;  1L8D A;  2P0A A;  1Q82 W;  5E1A C;  3BRC A;  4E4T A;  4CH3 A;  1Q5O A;  3NBY B;  4LH7 A;  5DGH A;  1XBL A;  2YC0 A;  4BY7 G;  4RB3 C;  1W0J G;  1MA1 A;  4LBE C;  2CTQ A;  3T1H H;  2F1M A;  1P4R A;  3JAL A;  4F6R A;  4DYL A;  4DW1 A;  5DG7 A;  5FLX N;  4JI6 O;  1AJQ A;  2IU0 A;  1HR0 O;  2CK3 G;  5IYD O;  2FLN A;  2X5R A;  1MZB A;  1S77 D;  1JXL A;  2OYQ A;  1FKA O;  1TVK B;  3FDS A;  4HYO A;  4A3C G;  4A93 G;  4O7W A;  2HDK A;  1Y14 B;  5IP9 G;  4DRX B;  4F4L A;  1BMF G;  1VP7 A;  2L35 A;  2FPG B;  1WCM G;  1ORQ C;  2R7M A;  1QVG U;  1NZ6 A;  4FS2 A;  2QKC A;  4JV1 A;  4TV8 B;  4CBC A;  2HHF B;  1KEC A;  2O03 A;  4LFA O;  5KFG A;  4CS2 A;  2AGP A;  1HP8 A;  3WWH A;  5KFL A;  5IYB O;  5IWA O;  1JKJ B;  3PR4 A;  2VRZ A;  3D36 A;  4B3M B;  4JI6 H;  1HR0 H;  3VBB A;  2LW7 A;  1VKZ A;  4K6N A;  2HHF A;  4U3F H;  3QZ8 A;  4RQE A;  1FKA H;  3AG3 B;  3JYC A;  4DRF A;  2V4Q A;  1L2Z A;  2GPS A;  2XCL A;  1XEQ A;  4H13 B;  2YS7 A;  2F66 C;  2ATK C;  3HKB B;  3DTF A;  4GC7 A;  3QO7 A;  3H01 A;  1WSC A;  5H6Q A;  5DM6 V;  3B8N A;  4I9W A;  1GN6 A;  2PY5 A;  4LFA H;  3JD0 A;  5KLV H;  1MOF A;  1QCE A;  5IWA H;  2KB1 A;  3E8B A;  2IBK A;  5JCO C;  5CBF A;  4YAK B;  2W9C A;  4UV9 A;  5BWW A;  2LFR A;  4DV1 B;  4LF8 B;  2DW4 A;  3MD0 A;  2UXB O;  4RUA A;  4ZKI A;  4LF9 B;  5LL6 b;  3H20 A;  3AG4 C;  5KFT A;  1FJG O;  1QU7 A;  4GKJ O;  3ZRX A;  4YJ2 F;  2ASL A;  3TXQ A;  3F7V C;  1FVI A;  3C3S A;  2ETN A;  2QM8 A;  2Y4U A;  4ZHQ B;  2DN9 A;  4FBU A;  1QR8 A;  4DR7 B;  4DW0 A;  3A0B Z;  2UUA O;  4LFC O;  2HVS A;  2ZR2 A;  1DV2 A;  4MTD A;  3JAR B;  5DMX A;  3G6X A;  3ABL B;  4DV7 B;  2QYZ A;  3GWK C;  4IIJ B;  5KX5 B;  2CW8 A;  3Q8R B;  5I5W A;  4IL6 Z;  1SS3 A;  4JAS A;  3T1Y O;  4P2Z A;  3CRM A;  2BTQ B;  4Y8V B;  4ZHQ A;  4MT8 A;  4P30 A;  3U55 A;  3ZMZ A;  4UB8 Z;  4JZ2 A;  1QLE C;  5DIS C;  1URF A;  2UXB H;  1FJG H;  2QJ1 A;  3RB0 A;  1WAZ A;  3WO1 A;  3RGX A;  3W7S A;  4GKJ H;  1GK9 A;  4O2A F;  4MVU A;  4IIJ A;  5D1P A;  1VS0 A;  5KMG B;  4YJ3 F;  4JI2 B;  1KYO F;  5JJJ B;  4ETS A;  5IYZ B;  5BYA A;  2MW2 B;  5CB4 F;  2JEU A;  2UUA H;  4LFC H;  3KCY A;  2UUC O;  4H44 B;  3LUT B;  1PNM A;  3OMA B;  3K59 A;  1KC7 A;  1VF7 A;  3LQS A;  3BA9 A;  4PDL A;  2RF4 A;  3HXL A;  1VQ7 V;  2HIX A;  5L3E A;  3LUL A;  3KG2 A;  3T1Y H;  2EZP A;  1QLN A;  4DV4 O;  2W7P A;  3RYH A;  3KTM A;  1KJJ A;  5IYZ A;  2ZQM A;  1US6 A;  5KUM A;  4XYM B;  4ZI7 B;  2VQF B;  1IZ3 A;  3K04 A;  5B1B C;  2RJZ A;  3FFQ A;  3TIG A;  2JS5 A;  3CC7 V;  4B3S B;  3WB0 A;  5EWG A;  1I7F A;  3MHS C;  3T9E A;  5KFP A;  2DQ3 A;  2L6L A;  3GIQ A;  1OCR C;  1CPY A;  1I5Y A;  5HBR B;  2UUC H;  4RO2 A;  5B1A B;  2B63 A;  4NYK A;  4PDM A;  2DYR C;  1RYR A;  3GIL A;  2F43 G;  1KQS U;  2QA4 V;  4ME6 A;  5DQH A;  4O4J B;  4RB2 C;  2HVK C;  4DV4 H;  4AHC A;  1AP5 A;  1KP3 A;  4K0K B;  4DXW A;  2P4V A;  5A2Q N;  3NBZ B;  2R86 A;  3S3W A;  2UXN A;  5L3C A;  1NI8 A;  4J9Y B;  4M7E A;  4J9M A;  4O4J A;  4JI5 B;  3WFV A;  1B6R A;  4WBN F;  1W93 A;  2C22 A;  3MR2 A;  3ZED A;  1S03 G;  5EIB C;  5KHH A;  3P32 A;  1GN4 A;  1AP6 A;  3CRA A;  1CP9 A;  3CYO A;  4ABM A;  4OGQ B;  4B3M O;  5KFY A;  1KMI Z;  3L9D A;  1AIL A;  5BXZ A;  3K5H A;  1QNM A;  3ZS8 C;  4ECR A;  3K0G A;  5FNV B;  1GRJ A;  2WLK A;  2X6C A;  5JVD F;  4FM9 A;  4Q4D A;  2W0X A;  5C93 A;  1BHB A;  1D5N A;  3VMM A;  3AG2 B;  1AI6 A;  4NTX A;  1X9N A;  4MW8 A;  1DF4 A;  3QTC A;  4Q8F A;  4AYB A;  1I7N A;  1R3J C;  2P7T C;  2BQR A;  4I50 F;  2JEG A;  1EHI A;  1VQL V;  4B3M H;  3SDL A;  2W6P A;  4FM2 A;  1OV9 A;  3E22 B;  4LF8 O;  3TY5 A;  2VQD A;  1KJ9 A;  2IJH A;  4LF9 O;  1T36 A;  2IW5 A;  3GJX B;  4EYH B;  3CB2 A;  5LBQ A;  4NLG A;  1XNQ O;  3T5K A;  2HP8 A;  3T9C A;  4FFK A;  4X9Q A;  2X7R B;  4PBC A;  3A2F A;  4HNU A;  3I55 V;  2XAG A;  4QE7 A;  1A48 A;  4DR7 O;  1CEZ A;  3G67 A;  4JTD B;  4I7H A;  2Q68 A;  4DV7 O;  2DYS C;  4G3I A;  4LP8 A;  1JX9 A;  3DTU B;  3PW4 A;  4FFB B;  3GII A;  3JD2 A;  5CB4 A;  3IJ4 A;  2WB1 A;  4LF8 H;  3CCS V;  4MS2 A;  3WNZ A;  2Q2U A;  4A3E G;  2R70 A;  4U7O A;  1I6U A;  4RUE A;  1Y1V A;  1XNQ H;  3SPI A;  5I5S A;  1VQ5 V;  4LC1 A;  4JAU A;  4E4E A;  2E5L B;  5KHG A;  3T4D A;  5GON A;  2V5A A;  1YJW V;  5DGB A;  5LXT A;  3OUS A;  4JI2 O;  4FFB A;  4DR7 H;  5KG5 A;  3T99 A;  2AW9 A;  1RPO A;  2WSS G;  2XAH A;  2BOB C;  3AK2 A;  5EZY B;  3RWR D;  4PDB A;  1WN7 A;  2ZXW C;  3BCC H;  4G2K A;  4DV7 H;  4PHZ A;  3RV4 A;  2Y0S E;  1IDS A;  4GC6 A;  3JAK A;  3SYO A;  4R7C A;  3STZ C;  3E86 A;  5IT9 N;  4QPJ A;  1S0M A;  2PVP A;  2X6A A;  1CQJ B;  2VQF O;  1K4C C;  4BY1 G;  3K5L A;  2CFM A;  4JI7 B;  3LP8 A;  1JMK C;  4B3S O;  3F7Y C;  4JI2 H;  3HOW G;  1RJQ A;  4JYA B;  4OXS A;  5JQG A; 
#chains in the Genus database with same CATH homology
 2F93 B;  4O2B B;  4PZ8 A;  1TAE A;  1DGS A;  5LA6 A;  4X1I A;  2ZNI A;  4JI6 B;  4B3R H;  2HVQ A;  2UXD H;  5D1O B;  5J2U B;  1A0I A;  3OTO B;  4TQF A;  1M93 A;  1SA0 A;  3KXY T;  4MTE A;  5JH7 B;  4O4L A;  5CA0 A;  4JI0 B;  1HNW H;  3KAK A;  4FLZ A;  4LFB H;  4YHH B;  3RTX A;  3FMA A;  3N2G A;  4LSA A;  5IJ9 A;  4O2B A;  1HNX H;  1IBM B;  1XI1 A;  2VQF H;  3VQV A;  2VOB A;  1JFF B;  3M7M X;  4DR1 H;  2HGS A;  5LMU H;  3BPZ A;  4U3J B;  4UCU A;  4J0M A;  4B3S H;  4LFA B;  4I4T B;  3RYF B;  4EB6 B;  5JH7 A;  4JI3 H;  3L4J A;  5IWA B;  4EEQ A;  4DV0 B;  3S24 A;  5CA1 B;  4YJ2 B;  4X65 H;  3L2P A;  3LNN A;  1TVK A;  1TGO A;  4MV9 A;  1JFF A;  1AN7 A;  3N6X A;  4DRX A;  2WDT A;  3N44 B;  4U3J A;  4PI2 A;  2ZIM A;  1J5E B;  4I4T A;  1KU9 A;  4JV5 H;  3BAB A;  4K0K H;  4PZ6 A;  4UCT A;  3RGZ A;  4TV8 A;  1QHT A;  2R72 A;  4YJ2 A;  4APM A;  3SJB C;  3BA8 A;  4O4I A;  2PTM A;  4FM1 A;  4DR3 H;  2Q7G A;  4DR6 H;  3JSL A;  4X1K B;  2WE6 A;  4JI5 H;  4I55 B;  4A2A A;  2UUB H;  3JAW A;  3RYI B;  1P8L A;  1Z2N X;  4LF5 B;  5BR8 B;  5KHI A;  3HKD B;  2F4V B;  4O2A B;  4MV7 A;  4X64 B;  4YJ3 B;  3W5O A;  4TQD A;  3MAQ A;  2UXB B;  2Q0A A;  4X1K A;  5FPO A;  4ZOL B;  2ZCE A;  5CB4 B;  2PUS A;  3HKB A;  1FJG B;  2ZM6 H;  4GKJ B;  4I55 A;  4EFE A;  4FLY A;  1P16 A;  3RYI A;  5LP6 C;  3K57 A;  2CAZ C;  3LML A;  1SEI A;  1XNQ B;  4O2A A;  5GON B;  3KYH C;  1HNZ B;  5BMV A;  4YJ3 A;  4LFC B;  2UUA B;  3J81 W;  5LXT B;  2IM9 A;  3RYC B;  4GKK B;  4NXN H;  1XMO B;  2V4D A;  4KHP B;  1S68 A;  4LF9 H;  3K5O A;  5IT9 W;  3T1Y B;  2XIG A;  4BWS C;  1M5I A;  4GYC B;  3JAK B;  3JAM W;  4DR2 B;  4TV9 A;  5LYJ B;  3N41 B;  3RYC A;  4K8Z A;  4BWA A;  4DK0 A;  3QWU A;  4DR5 H;  5ITZ B;  4TUY B;  1H2S B;  1IBL B;  3JAR A;  3KAJ A;  3SJC C;  5LOV B;  5IJ0 B;  1Z5V A;  1I94 H;  5KX5 A;  2UUC B;  2R9A A;  4D7S A;  4UCO A;  4AIL C;  3SR2 C;  3MWM A;  4NVP A;  4AQY H;  2BTQ A;  4LNU A;  5JQG B;  4CH4 A;  4UCR A;  5KHJ A;  3ICX A;  5LA6 B;  3RFR A;  1E4G T;  2GV9 A;  4X1I B;  2QM4 A;  2HEP A;  2PGG A;  4FVM A;  1XHX A;  4F6R B;  2YIB D;  4DV4 B;  4B3R B;  2W57 A;  3GB8 B;  1N36 H;  1N33 H;  1SA0 B;  4CH5 A;  4WBN B;  5LOV A;  4YY3 H;  4FM0 A;  5IJ0 A;  4Q0Y A;  4JI8 H;  1L8D A;  1QQC A;  4O4L B;  3RGB A;  4RB0 A;  5KMG A;  3C0F B;  3BRC A;  4IAJ A;  3N2G B;  4CH3 A;  1Q5O A;  3NBY B;  1N32 B;  3BHP A;  4LH7 A;  4DV3 B;  3DSQ A;  5JJN B;  4RB3 C;  1Q43 A;  1O9G A;  5EYP A;  3T1H H;  2F1M A;  3JAL A;  4F6R A;  2PYJ A;  5LMU B;  4WBN A;  1IBK B;  1D5A A;  2Q7H A;  4X1Y A;  4X66 H;  2YCH A;  3RJ0 A;  1G6U A;  4DV2 B;  4OX9 H;  1MZB A;  2OYQ A;  1TVK B;  4ZI7 A;  1E4F T;  1N34 H;  4LF4 H;  3SJA C;  4DRX B;  1Z2O X;  3U0Z A;  1O9H A;  1XMQ B;  4UCS A;  4JV5 B;  4I50 B;  3OTF A;  5JVD A;  4JI7 H;  1YEW A;  4TV8 B;  3TY9 A;  2O03 A;  4CS2 A;  4O4I B;  1XK5 A;  3DF7 A;  4DR3 B;  4DV1 H;  3JAW B;  3L4K A;  4B3M B;  3THO A;  4JI6 H;  2UU9 B;  4LF6 B;  1HR0 H;  3RF2 A;  3OTO H;  4I50 A;  4DV5 B;  4I9Q A;  4B08 A;  1BJT A;  4RAZ A;  2HHH B;  1CKM A;  4JI0 H;  1FKA H;  4DRF A;  1L2Z A;  2ZNJ A;  1M0T A;  4NXM B;  2F66 C;  1WH2 A;  3HKB B;  4KL1 A;  4LF7 H;  1ZHS A;  1XNR B;  2PY5 A;  1WPB A;  3W1B A;  4LFA H;  3JAT A;  5BMV B;  3IG0 A;  2VQE B;  4O4H A;  5IWA H;  4DV0 H;  2YI9 A;  4LR3 A;  5JCO C;  5FNV A;  3UT5 B;  2PYL A;  4DV1 B;  4LF8 B;  4LF9 B;  4E6N A;  5LL6 b;  4DUZ B;  3H20 A;  4X62 B;  1J5E H;  4CH6 A;  3EYY A;  4TV9 B;  4L8J A;  3K3V A;  3CVZ A;  3N42 B;  3U11 A;  1FVI A;  4RB1 A;  4ZHQ B;  5LMN B;  4DR7 B;  5EIB D;  3QF7 A;  4JI4 B;  3UT5 A;  2UXC H;  1CKN A;  2HVS A;  5C8Y B;  1B04 A;  1M4U A;  4MTD A;  3JAR B;  4DV7 B;  5KX5 B;  1ZAU A;  4IIJ B;  2CW8 A;  3E22 A;  4DR4 H;  3HKE B;  4DV6 B;  5BR8 H;  2F4V H;  2BTQ B;  4LNU B;  2FE3 A;  4X64 H;  4ZHQ A;  3K58 A;  4B3T B;  2Q2T A;  5DIS C;  2UXB H;  2YIA A;  3BAA A;  5J2T A;  5C8Y A;  1FJG H;  2F95 B;  2QJ1 A;  3GDE A;  3J80 W;  3VNN A;  3RGX A;  4JI1 B;  4GKJ H;  4D7T A;  2HIV A;  2ZIN A;  4DUY B;  4IIJ A;  5D1P A;  1VS0 A;  3HKE A;  5KMG B;  4LMY A;  4JI2 B;  4TOI A;  2YXL A;  5JJJ B;  4ETS A;  5IYZ B;  3ETQ A;  3PN1 A;  2UUA H;  4LFC H;  2XHB A;  5FLX W;  5EYP B;  3K59 A;  1VF7 A;  5FD5 A;  3VQY A;  3BA9 A;  3JAL B;  1XMO H;  4CS3 A;  3HXL A;  2UXD B;  5LP6 B;  3N43 B;  2HIX A;  4X1Y B;  3CSX A;  3T1Y H;  2KKW A;  2P22 C;  4HNA A;  3RYH A;  1HNW B;  4LFB B;  1ZHQ A;  2E5L H;  3W1G A;  4DR2 H;  5IYZ A;  2VWJ A;  1HNX B;  1X4T A;  4K8X A;  2CW7 A;  4ZI7 B;  2VQF B;  1TUB B;  1SKV A;  2RJZ A;  1N34 B;  2ZIO A;  3FFQ A;  4DR1 B;  1XDN A;  2JS5 A;  5LP6 A;  1XQ8 A;  4B3S B;  4HBN A;  5EZY A;  2Q7E A;  3JAS A;  3WB0 A;  3N40 P;  4FLU A;  1IBL H;  1I7F A;  5JVD B;  4JI3 B;  1Q3E A;  2UUC H;  2JVD A;  4R7R A;  4X65 B;  4FLX A;  1TUB A;  1FFX B;  4O4J B;  4RB2 C;  4DK1 A;  4DV4 H;  4AHC A;  2VUG A;  1HR0 B;  4K0K B;  4RZQ A;  3TY8 A;  3N2K A;  1RSO A;  3NBZ B;  2VWK A;  2JGU A;  4LSX A;  1Z5W A;  4JYA H;  1N32 H;  4M7E A;  4DV3 H;  4DR6 B;  4IHJ A;  1FFX A;  4O4J A;  4JI5 B;  5D5Q A;  5K1P A;  2UUB B;  3KAL A;  1TA8 A;  4LF7 B;  3ZED A;  1SQG A;  5EIB C;  5KHH A;  4ZIB A;  1S03 G;  5D1O A;  5J2U A;  4FLV A;  3JAT B;  1XHZ A;  1IBK H;  2OWO A;  4O4H B;  2WYO A;  3K5N A;  1KMI Z;  4YHH H;  1HW7 A;  4DV2 H;  4PZ7 A;  3ZS8 C;  3NC0 B;  5FNV B;  1IBM H;  1V9P A;  3WB1 A;  2ZM6 B;  4GLX A;  1CKO A;  4RAY A;  3VQX A;  4X20 B;  4FM9 A;  2ZJT A;  5FD6 A;  4CC5 A;  4LH6 A;  1XMQ H;  3RYF A;  4EB6 A;  2HVR A;  2P5O A;  3F8N A;  3QG5 A;  5CA1 A;  1S5J A;  4CC6 A;  3U10 A;  1X9N A;  4NXN B;  1T5E A;  2PZS A;  1CKN B;  3QTC A;  2UXC B;  1BGW A;  5K1X A;  4X20 A;  4A2B A;  4B3M H;  4FM2 A;  2UU9 H;  4LF6 H;  3E22 B;  4DR4 B;  3TY5 A;  1P49 A;  3J7A K;  5JJE B;  4BW9 A;  3GJX B;  4DV5 H;  3CB2 A;  2HHH H;  4EFB A;  5KHK A;  5J2T B;  1WNS A;  3HKC B;  4UFZ A;  3A2F A;  2RQ6 A;  4DR5 B;  3VQW A;  4NXM H;  5FPR A;  1JJO A;  1SYX B;  2VPS A;  2YI8 A;  2EX3 A;  3B2E E;  1I94 B;  4LF5 H;  4I7H A;  1XNR H;  3HKD A;  4AQY B;  2VQE H;  5D5P A;  3K5M A;  4Q6G A;  3HKC A;  4FFB B;  5CB4 A;  4ZOL A;  2MCT A;  1N36 B;  1N33 B;  1Q8I A;  4LF8 H;  3WB2 A;  4YY3 B;  2Q2U A;  2R70 A;  4JI8 B;  4DUZ H;  1I6U A;  4HNA B;  3RYH B;  4X62 H;  1XNQ H;  3RIZ A;  1NT2 B;  2BTO A;  1HNZ H;  2E5L B;  3SGI A;  5KHG A;  5GON A;  4FLT A;  4CS4 A;  4EQ5 A;  4GKK H;  2RGV A;  5LXT A;  4FFB A;  3T1H B;  3IAY A;  5LMN H;  4DR7 H;  1SQF A;  4JI4 H;  4KHP H;  5EZY B;  3RWR D;  3JSN A;  3JAS B;  4PDB A;  1WN7 A;  4PI0 A;  4X66 B;  1M0W A;  4DV7 H;  4PHZ A;  2RGR A;  3CHX A;  4OX9 B;  4DV6 H;  3RR5 A;  3JAK A;  5JCO A;  5LYJ A;  3M4I A;  4FLW A;  4B3T H;  2KSW A;  4LF4 B;  5A2Q W;  2E3C A;  3UQ8 A;  4UCV A;  5ITZ A;  4TUY A;  4JI1 H;  3K5L A;  2CFM A;  2YIB A;  1Z2P X;  4JI7 B;  4DUY H;  1GYF A;  1JMK C;  3N2K B;  5CA0 B;  5EOY A;  4JI2 H;  1O75 A;  4JYA B;  4IHJ B;  5JQG A;  5IJ9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...