4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
4GKKB 4DR7B 3GDEA 4TOIA 4DR6B 4JI5B 2UUBB 5D1OA 4DV1B 4B3TB 1XK5A 1N32B 1X9NA 1FJGB 1P8LA 1HNXB 1VS0A 4LH6A 4X62B 1XMOB 1ZAUA 4DV6B 1S68A 3NBZB 4JI6B 2OWOA 5D1PA 5FPOA 5DISC 3TY8A 2HVRA 4PZ7A 4LF5B 4DR2B 5IWAB 3SGIA 4EFBA 4X65B 4X64B 4LF9B 1J5EB 4CC5A 2HVSA 4LF8B 4NXMB 3RR5A 1V9PA 4UCTA 4JV5B 4JI3B 2UXDB 4KHPB 1FVIA 3RTXA 2CFMA 4CC6A 4NXNB 4DR4B 1N36B 1CKMA 1CKOA 4EEQA 2VUGA 1XNQB 1HR0B 1CKNA 1N33B 1IBLB 4X66B 2Q2UA 3NC0B 4JI0B 4DUZB 4OX9B 4LFCB 1N34B 3T1HB 1A0IA 3VNNA 4K0KB 4GKJB 1DGSA 2HIVA 2UUCB 4LFBB 3BAAA 4UCSA 4UCOA 4YY3B 4DR3B 4PZ6A 4EQ5A 3BA9A 2UXBB 3S24A 1IBMB 4B3SB 3TY5A 4GLXA 5LMUB 4UCRA 1XNRB 2HIXA 3W1BA 4LF7B 4JI4B 2UU9B 1HNWB 3UQ8A 1I94B 4DR1B 2F4VB 4UCVA 4DRFA 2VQFB 4JI8B 2VQEB 4LFAB 4EFEA 4JYAB 4DV4B 5LMNB 4DUYB 4DR5B 1XMQB 3T1YB 3QWUA 5BR8B 3L2PA 3JSLA 4AQYB 3JSNA 3TY9A 4E6NA 4B3MB 1B04A 4DV5B 4JI1B 4LF6B 3NBYB 4LH7A 3W5OA 1IBKB 4UCUA 4B3RB 4PZ8A 4DV2B 1TAEA 3PN1A 1TA8A 5D1OB 1XDNA 1HNZB 4YHHB 4DV0B 3KYHC 3BA8A 4DV3B 3W1GA 5FPRA 4LF4B 3GB8B 2UUAB 3BABA 3OTOB 1P16A 4JI7B 3GJXB 1CKNB 4JI2B 2UXCB 2Q2TA 2ZM6B 4DV7B 2HHHB 2HVQA 2E5LB 4UFZA
chains in the Genus database with same CATH superfamily
1GYFA 3HOWG 2VQDA 2EIMC 4E4EA 3FKSG 4F6EA 1C30A 3EHBB 3RYHB 3CRMA 1G1XB 4Q43A 3LUTB 1WLEA 1N32B 1BS3A 3LMLA 3ICXA 3IGAC 1FFXB 5JCOA 4JI2H 3I4NG 3BHPA 2YYAA 1FD9A 1O75A 1AI6A 2UXBO 3N2KA 4BBRG 4DV7H 5IWAB 2XIGA 2YZMA 3D8CA 2VQEH 4X64B 3HO8A 1J5EB 2HVSA 2OTLV 1TUBB 4A5UB 4RQFA 1V9PA 2JGUA 4FGRA 4X64O 4DAAA 4B3TO 4JI3B 1Q43A 4J9OA 1SQBH 4X1YB 4BY1G 4MA0A 4TUYB 2OIEA 2CFMA 5BWXA 2FL4A 2EJ2A 2DYRB 4PWQA 1R3LC 4QWDA 4U7NA 1SERA 1IXMA 1NS1A 2WLIB 4MV9A 4F4YA 5LA6A 2FLPA 4J9LA 5BWWA 5KAFZ 1XDCA 4OX9B 3R65A 2WAQA 1YSCA 4IR1A 3V4ZA 1Q86W 4UV9A 5DN6G 4G27B 5H5NA 4P9OA 2DABA 2OYQA 3I12A 3G8DA 5DMXA 2CGOA 3AG1B 1VKZA 3GIQA 2QWNB 1B6QA 4GLXA 4WFGA 1XNRB 1KUQA 4LF7B 4LMYA 2EILB 1ZETA 1TWHA 2ADPA 4JI4H 3CC4V 1MG1A 2EBOA 4BIZA 5EZYF 2UUAO 4EEYA 4LFAB 4W4KA 5JJNB 4A3FG 4JI8H 3W7XA 5EBWC 2HG8A 4CKBA 1PNKA 3L2PA 4AQYB 4CKEA 2PBZA 4ED3A 1GGOA 2J6UA 2R6FA 2CH7A 1B04A 4MAMA 2DJVA 4KXRA 5IJ9A 3JRXA 4LF6O 2Q0AA 1I5YA 4RCNA 4O82A 4JI3H 2Q68A 1H2KA 3MHSC 5KFTA 4KL1A 3CX5F 2VWJA 4QWCA 4DV3O 2A9HA 1XUQA 3CE2A 4YHHO 2CE4A 2CNUA 2IJHA 1DV1A 2YS6A 3I56V 3RB6A 4DV3B 3SI8A 3BABA 1J5EH 1KD1W 2R7LA 2PN1A 4YR0A 4G2KA 1OCCC 1I1MA 2YW2A 4TQRA 4I55A 3PR4A 1AP6A 1I7FA 1H8HG 4GKKB 1IYDA 2WLLA 5IJ9B 5BWUA 2RGRA 1QLEB 3SYOA 5L1KA 1RPOA 2YSUB 2UVUA 1P4RA 2I80A 3GV5B 4YY3O 3J80W 4NZMA 3HB9A 5LA6F 4Q20A 4R8UB 1HWYA 3ZHTA 3RF2A 2DN9A 3MR3A 4BWSC 1OCOC 3HKCA 5IWAO 1I0HA 3OR6C 1JOYA 2HKOA 4RB2C 4TQFA 4ME6A 3LWBA 1XHZA 5JQWA 3HKDB 1LUWA 3BRCA 3TK1A 2R9IA 3VQXA 5LXTA 1AR4A 2UXDO 5KFSA 4DK1A 1PP9H 2HLDG 5B1BC 4FM2A 5DQGA 2AGPA 4IHJA 3PW0A 5LL6b 2GTAA 1O9GA 3TXSA 2UVWA 2M6YA 3G80A 5FJ8G 3CCLV 1VAJA 4GZRB 3WO0A 1VMGA 3CB2A 1XNQB 2BR0A 4O84A 4X66B 3KAJA 4DUZB 4JYCA 3CD6V 2QF7A 1M57B 4UVBA 2A0LA 1K4DC 4XYMB 5KFVA 4B3RH 3TEKA 1HNWO 1F23A 5EC1C 3E8BA 1P49A 2W70A 2YU9A 1AI4A 4B3SB 4K35A 2F4VO 3AG4C 3G6XA 4UCVA 1Q6IA 5IYCG 3PW5A 2FP4B 1ET0A 4NTWA 1AI5A 4F6RA 2CGNA 2Y69B 1Y66A 4JYYA 4LFCO 3DC6A 3K08A 2NR5A 5JVLA 4LFAO 5ITZB 1R3KC 2XAQA 5E25A 2LP7A 2ZDIC 3JSNA 4CS3A 3TY9A 1WP8A 5KUMA 3MDSA 4DV5B 3MR2A 3MD0A 5D5PA 1CS0A 1MNGA 1IBKB 4Q8EA 1ZHQA 3FB6C 3WWHA 4FLTA 2GDSA 4RB1A 1R3JC 2UU9H 3QZ7A 2ZGIA 2WE6A 2OLSA 4IT5A 3OUZA 4QSHA 5IYBO 5FNVF 1PM9A 2BE3A 1FKAO 2F23A 1NJIW 2R9RB 1EN5A 3FMAA 2IA6A 3WB0A 2QM4A 4A3KG 4A3DG 1FAFA 2R84A 5FD6A 5KHJA 3GJXB 1KU9A 2DZDA 5KLVH 5KFKA 1N36H 1WA8B 3K58A 1JJOA 4DR2H 3BVOA 2H8PC 3CRCA 1T94A 2Q7DA 2HJFC 4D7SA 5J2TF 2CUGA 1JX9A 2F93B 1EN4A 5CA0F 3WWIA 1FJGB 1VF6A 3TCUA 2BSKA 2Y0PA 1N33O 3L9DA 1IOVA 1M93A 4FZ0A 2LW7A 1E4EA 1L0LH 4JI6B 3AW8A 3ZHSA 1MZFA 1IOWA 3T9EA 5KG6A 4IIJA 1ROPA 3G67A 2QTSA 2Q67A 4MTXA 2QKCA 3RYFA 5KX5F 2HHFA 1Y1VA 2HHHH 4A3BG 3TJTA 2WB1E 1K9MW 2UXDB 4ED2A 1ENVA 4O2BB 4NYKA 5IYZB 4NXNB 4YB8B 3RYIB 2K9PA 2R82A 3UYYA 2YIBD 1Y1WG 3ZIAG 2YEVA 4RUAA 4DL3A 1SA0A 2QWQB 4ECRA 2H94A 3JZ6A 4CS2A 2R8GA 2ASLA 1VQPV 3K3PA 2X6BA 4XDLA 5JQGA 5A2QW 4OX9H 4PDMA 4FLVA 1GLVA 2EIKB 2R93A 3VOUA 1KJ9A 1YTFB 2HGXA 3DTGA 2Z04A 4PZ6A 5KFLA 4PV1B 1EZ1A 1VF7A 1D2DA 2J6SA 4WD3A 1SQXH 3GWKC 4BWAA 3L4JA 5LHHA 2F4VB 3L4KA 2FMAA 5C93A 3WB1A 4JYAB 3JYCA 2AHYA 3OAAG 4DYLA 1TWFA 3QO7A 2AZ0A 1VP7A 1PX2A 4RUCA 2AXTZ 5LYJB 4JI8O 3RBZA 1VQMV 4E6NA 3ZRXA 4ICGA 3UT5B 4XDKA 3OTFA 5H2FZ 3KCXA 2DIKA 3CSWA 2EINB 4FK5C 4RNMA 1HNWH 1Y1VG 4FFLA 2BSKB 4DL4A 2IJIA 1RP3B 3AK3A 3Q8PB 1P7BA 2OCHA 1XMOH 4CKCA 1Y74B 3NR7A 4CHIA 4JI7B 1MMMA 5EZYB 3KHGA 1QVGU 5IT9W 5LP6F 2FYUH 3ABLC 2ODTX 3N41B 1EBOA 3L71H 1E79G 2L35A 4MVMA 3ZHVA 4B3MO 2JA7G 4DL5A 1AJQA 5IYDG 4X1YA 4TUYA 3EFFK 5B66Z 4C7UA 5JJJB 2R93G 1V51A 1NR1A 5JH7F 3DXRA 1Y74A 4EGJA 1K5SA 4WHXA 1W2BU 3GV7B 3ABMB 1K33A 4P9PA 1S03G 1J95A 1GRJA 2W7PA 4ED6A 5L3EA 5K1XA 3SJCC 2E5LO 4TV8B 2W6OA 3D36A 1JDBB 3ABTA 3ASOC 2XTAA 2NU8B 2ZCEA 1JVMA 4HNAB 2CW8A 4EYIB 3ML0A 3H1KH 2ITCC 4GCZA 5JQGF 2YCHA 2RDIA 1XBLA 3L73H 2R72A 1NR7A 4O3NA 3CMAV 2JEFA 4LF7O 4XZ3B 3ABLB 2JK5C 4PDVA 5C1PA 1XILA 4ZI7A 3JZFA 1CKNA 2WLIA 5LYJA 4RB0A 5CR5A 3K59A 2R92G 3TIIA 4O3OA 1S77D 4A2AA 4A3CG 2WLHA 5GW7A 4R8CA 1DAAA 3GIIA 2VPQA 3P32A 4EQ5A 5BPHA 1OCCB 3LDDA 3W7WA 2C2DA 4MVUA 4LF7H 1S3JA 3P3PA 1B6SA 5LMUB 1U96A 4MTOA 5TISZ 1M4UA 3ASOB 3VQYA 1FJGO 4JI8B 2ZDIA 1WNSA 5CBGA 4FLXA 3VPBA 3JASB 1SCUB 2DYSB 1BNCA 4H44B 1O9HA 2YIDA 3BG5A 2PI4A 4IL6Z 3CHXA 4MW8A 4H0LB 5BR8B 4I50A 4FM0A 3RWRD 3HKDA 4FS1A 3Q8QB 3DTUB 3UO3A 1BJTA 2RMKB 1KBHA 5DAAA 5LP6A 3WG7B 3CCUV 5IYBG 1URFA 3PN1A 4APMA 5B1BB 4K0KH 5I5SA 4EGQA 3E83A 3HKBB 4DW0A 5KFHA 4GUNA 4AI8A 3TIGA 3IG0A 2UUAB 4LF5O 1P16A 3HOZG 3HOYG 2UUCH 4RZQA 5GONB 2QA4V 3RN4A 4GC6A 2UXCB 3H4DA 4DV7B 4RNOA 2G38A 2FPIB 4I55B 3L74H 4U3JB 1THZA 3LSSA 4K8XA 2Z5UA 4ZI7F 5HFMA 4EKWA 3EPGA 1X9NA 1Q5OA 2R8JA 4X8AA 4O4LA 5LHIA 3T1HO 5LOVF 1FS0G 4CH4A 4EBCA 2ALZA 2OT5A 1BGYH 1XQ8A 5DEDA 4YBZB 5J2TB 3JAKA 4O4IB 5C8YB 3SJBC 1WB7A 1F4MA 1S5HC 3RYCA 3SGIA 5F9NA 1KJJA 1Y6XA 1S9FA 4GX1A 1SS3A 2Z3YA 4O7VA 4A2BA 2JA5A 1FVIA 3MFHA 4CC6A 1EZVH 2HGWA 4O4JF 1HR0O 4CMFA 1E4EB 1JXLA 2DWDC 4EB6B 2VUGA 1K92A 5EBLC 3AG3B 3IAYA 1D5NA 3ZRWA 3FKIG 2RQ6A 4TV8F 3OUUA 1TVKB 2UXCH 1K73W 2YXLA 3BQ2A 5KFDA 1GAXA 4J9MA 2UUCB 5BY1A 4JAVA 1GM8A 3JD0A 5FLMG 4Z1VA 3RGXA 5FLXW 1K7DA 5EC2C 4UCSA 4LR3A 1XNQH 2Y4TA 4DR3B 4E4TA 2J9GA 3T1CA 2JS3A 3CPWU 2DWEC 4ZOLF 1FKAH 3TY5A 2E2IA 1VARA 4MT8A 4Q8FA 3ORQA 1JMKC 1IBKO 1GSOA 3DC5A 5A9GA 2F4VH 1I94B 2RJZA 3ZHRA 3WNZA 5GONA 2RNBA 4TV9A 4RB3C 2VUMG 2P0AA 3HPLC 2W0XA 2YDEA 3N44B 2VPSA 4YP3A 3N40P 3FFQA 3SJAC 3RW0A 3GTOA 1N34O 2ZR2A 3N2KB 1D5AA 3QQMA 1SRYA 3JAMN 1H38A 4O4LF 4IAJA 1ORQC 2MCTA 2YS7A 4B7KA 1ZHSA 1WPBA 3QTCA 2E3CA 1XMOO 2C22A 2JA8G 5IYCO 3K5NA 1QR8A 3C0FB 3GTLA 4U6PA 3SPIA 5KFMA 2KQXA 4DV0B 3ZN0A 4FM9A 3GTGA 3BACA 5BZBA 2UUCO 1XREA 1M6VA 1I6UA 4X9QA 1SA0B 1GKFA 2PMZE 4M0JA 2QWRB 4ZBMA 4ZOLB 4U7CA 4NYEA 3GDEA 3K04A 2HFEC 5LGUA 1IDSA 1SQPH 4JI5B 3ZRSA 4PA3A 4HR7A 2XOKG 2FMLA 4DXWA 4B3TB 3VOTA 1YDXA 1EZJA 1FXHA 3CMEV 2P22C 4H33A 4FFKA 1NT2B 4LH6A 2AZ2A 2N74A 1ZQ7A 1H8EG 1W0JG 4IYIA 4C5AA 4M7EA 1VQLV 1S68A 3CCRV 4EBEA 2MK3A 2Z0AA 4JZ2A 2LGQA 2XD4A 5D1PA 4ZOLA 1SZXA 4L1KA 4CZZA 1FJGH 4N21A 2QK4A 1QVFU 2QTOA 1IXBA 2YIAA 5CA1B 2W9AA 1YVWA 3OTOH 4B08A 3GIMA 3CYOA 3IFXA 1W96A 3CJHB 3CC2V 4DRXA 1R73A 2PGGA 2WLMA 4TV9F 1KJIA 4WF9V 2B63A 1JIHA 1B33N 2XCPA 3WFVA 1CKOA 4BR6A 1X4TA 3K06A 2EINC 1N36O 4ZKIA 3H1IH 1HR0B 2W6NA 5DQIA 3OMIB 1N33B 5EWFA 5KFYA 2YEVB 2Q2UA 3NC0B 3Q4HB 1SESA 3F5TA 3ZMSA 1PPJH 1CXZB 3OGCC 5KFCA 1S0MA 3JCUZ 4FVMA 2W71A 3KKYA 2M05A 5L1IA 2YZGA 2WLLB 3ZJZA 4DV0H 5BWRA 1YTFD 4FM1A 1NBMG 4W4LA 4X89A 1QU7A 4KUMA 3NXSA 4ZI7B 2SCUB 4TQDA 4I4TF 2L6LA 4J7JA 1K97A 1RK6A 3T1YH 1WCMA 4UUJC 2R7KA 2P6JA 4LC1A 5LHGA 4DRFA 1F51A 2W7OA 3JALA 2XCLA 4JI0H 4ECSA 1L8DA 1S76D 2R7NA 5CB4F 3D3IA 5LBQA 2ABJA 3ABMC 2K1EA 4O7TA 1NVPB 1GO3F 1M56C 3C3SA 3RUPA 2C28A 3B40A 3UO2A 4GKKO 1EKPA 3MJFA 2XAHA 3U0ZA 1B06A 1V4YA 3VMMA 4A93G 1COWG 1H2GA 4B3RB 4XX0B 5IP9G 5KFXA 4QPJA 1AR5A 1EKFA 4YJ3B 4NXNO 3U54A 2Q0OC 1HNZB 2F1MA 4X64H 3ABKB 4X1IA 5EYPA 2DPIA 1AR1B 1Q81W 4C2MA 3PW7A 4FIPC 1SQVH 4RAIA 1I2LA 1UNNC 2W6MA 5DQHA 5LXTB 3CEBA 5BXZA 3K5OA 4P30A 4FE2A 4JI2B 2YI9A 2OH2A 1QQCA 5EZYA 4XYLB 2WAQE 1GK9A 5KT4A 1M0TA 3AK2A 4JI2O 1N56A 5K1PA 4DR7B 1RJRA 5H6QA 1MOFA 1MZEA 2CTPA 1KMIZ 4KP4A 2RDJA 3ETDA 4LNUA 4MVRA 2WLNA 4JI5H 5GTIZ 3GLKA 3ZMUA 5L3DA 1UPGA 1EUDB 3OSPA 1S10A 5BPFA 4MTEA 1SF9A 2JA5G 4ZIBA 1S72V 2ZT9B 5KFEA 3T9CA 1B3QA 3HKEB 4U3FH 5I5UA 2QKAA 2ZINA 2W9BB 2P90A 1XNQO 1K4CC 1EUCB 3RT3C 3U10A 4GX0A 2YL2A 3KHRA 5H9CA 4J7KA 5IYDO 5DGHA 5L3GA 4LF5B 3GV8B 2J6TA 5ITZA 2XGPA 1PK8A 3KALA 2EIJC 1M9NA 5FLXN 3WWJA 2GQSA 1Z5VA 4I55F 1Z2PX 5FNVB 3K3WA 3T9DA 4FFPA 2UUBO 4CE5A 5KT3A 1N4CA 2QM8A 4A3JG 1SQGA 3N27A 4O7RA 2R87A 2IBZH 4AQYH 2COJA 3JAKB 4DV7O 1W59A 1WH2A 1Y67A 2W6ZA 4I4TA 2ZD9A 3VNNA 4K0KB 2HIVA 4LF4O 3BAAA 4N23A 3FAVB 4FZ1A 3F7VC 3SYCA 5KFBA 1JLLB 3DSQA 3JATA 4JF3A 4I9QA 1G6UA 3A0HZ 4DR1H 1GN3A 3STZC 2HP8A 2RF4A 4HN2A 3O65A 3ZRVA 2UXBB 4P2ZA 4RAYA 3OR7C 3MHHC 5KG1A 4I5SA 3Q8SB 4PA6A 3DGEA 2HIXA 5LXTF 3R23A 4FLYA 5EWGA 3VQWA 5DGAA 2EIMB 4YY3H 2XC9A 1SZTA 4JTDB 4JI3O 3JD4A 3CXHF 1N34H 1ZUQA 4F4XA 2P4VA 3BQ0A 2RCVA 4DR6O 1YITV 3AYHB 4JTCB 2JEXA 1YIJV 4ZHQB 2Y0SE 1PKXA 1CPYA 1QHTA 4I50B 2JEIA 4Q44A 2I8CA 5KKNB 2ZQMA 4A3LG 4LF8H 2W0FC 2JGDA 4NZNA 1YF2A 4QWBA 3GTQA 3K57A 1XMQO 1BHBA 2HVKC 3E5NA 5KX5B 1T3NA 3UFXB 1R9TA 4FPPA 3FB7C 4LF4B 3GB8B 3OTOB 3AK1A 4LSAA 5CA1F 3U55A 1IBLO 2ZNIA 5FR9A 5IWAH 1NH2B 2HGSA 3OD4A 1NU1H 3GIJA 2EILC 2N04A 3CCQV 1EHIA 2CNVA 5DLGA 4PDLA 4FFBA 3E35A 1TGOA 5CM0A 5LMNO 1PL0A 5KT7A 5JWPA 3N43B 3RV4A 3BQ1A 4DIMA 3T9BA 1XEQA 5B1OA 2DW4A 3AG4B 4DL2A 1FFXA 4O81A 1GM9A 4JI7O 5F9LA 2DWCA 2GPWA 3S3WA 2DQ3A 5B1AC 4FFMA 4O4HF 2Q8VA 2VR1A 4BY7G 4LF8B 4NKGB 1YZBA 3HBLA 4NZOA 5DG7A 1WN7A 1R6KA 4O7WA 5EWEA 4B3RO 1Q6HA 1LUVA 3APQA 4JI1O 2QEXV 4ZHQF 2FK1A 4JI7H 4HNVA 1F7YA 4DUYH 4ECUA 4ECQA 3X2QC 3EPIA 1AJNA 2ZJTA 4GKJB 1BT8A 3ZBHA 1KKCA 3VA7A 3ABUA 4IHJB 2NVYA 3G6VA 2CTRA 2CNQA 3PR5B 5IJ0A 3CSXA 2PI5A 3MWDA 3ZHUA 4IIJF 1WPXA 5JH7B 2ZE7A 2IW5A 2EJRA 3ORRA 3E8GA 2DPJA 2QE7G 1CP9A 3F8NA 3QVNA 4R6ZA 1V54C 4D7TA 4HZ3A 3K5LA 1YCIA 4X65H 3BY6A 2H3OA 4EFEA 4DR3H 5LL6Y 2KSWA 2AGOA 3TINA 5KG3A 4MV1A 1G4YB 2VQFO 2W6QA 4WBNB 4UVAA 1BSMA 1H2NA 2AHZA 3W7SA 5T14A 4O3QA 3ETGA 3QNEA 1I50A 3H4BA 5L1LA 3AG3C 4KHPO 5KFRA 3OTOO 1ZX3A 4G28B 3NUAA 3CXCU 1BGWA 3K0DA 4F6RB 3SPJA 4DRXB 3APOA 3MR5A 4QJFA 1KP2A 1E4GT 3RVYA 4MVSA 3OE7G 3KYHC 3N6XA 3P30A 4QW8A 4JYAO 5HFLA 2UXDH 2IH3C 3B8NA 1I7LA 3HOVG 5I5VA 1CKNB 1P84F 4LFBH 4KFMA 4RWUA 1JKJB 4JV1A 1AJPA 1U97A 4J41A 4J10A 3ZMTA 5DLFA 4ZHQA 4YAJB 1Y4MA 3RB4A 3CS5A 1MABG 4IR9A 1XK5A 4YJ2A 5KHHA 4DW1A 4O4HA 3QO5A 4GKKH 1K1SA 4IHJF 3MR6A 3BJYA 4DV6B 1I2KA 1KT8A 2ZDHA 1L0NH 1KQSU 2LW1A 2ASDA 2PMZA 1TUEB 2V4DA 1V54B 3RVZA 3J7AU 4PZ7A 3TXQA 2CH7B 4DR2B 2X0LA 1OBDA 1VBHA 4LF9B 1FYJA 1VQ9V 2UUBH 1NI8A 2WA3A 3LNNA 4K0KO 4MV8A 3RYCB 4LF9O 2R8HA 1JFFB 2ASJA 3IJ4A 2XAGA 3E8HA 5CB4B 1N32H 2COIA 2V58A 2IJJA 2EJ7A 4X66O 2FPGB 3SE7A 1KTAA 4O2AA 1RM1C 3T5LA 2Q5ZA 5IT9N 3FDSA 3E8FA 3RAXA 1ZLZA 1CEZA 4JASA 2Z02A 2WPDG 5EYPB 1E4FT 1DGSA 4LFBB 3ABKC 1GN4A 2BOCC 2XASA 4ABMA 4CH3A 1RSOB 5KUKA 2KB1A 2X6AA 3DTFA 2JIZG 1IBKH 4ED7A 3RB0A 1R6NA 3U0GA 4PELA 3GVMA 3K03A 1P7GA 2YWVA 2EIYA 3OHBA 1EFRG 1RPRA 2ZIMA 5DGIA 1DF4A 2CTWA 3JCZA 3CC7V 4J0MA 3U9SA 2VA3A 3HKZA 4FFNA 5IDJA 4X1KB 5DGBA 4PDRA 4DUYO 1XMQB 3QWUA 3MAQA 4YJ2F 3K5MA 3H1JH 4O7LA 3M7MX 1IBMH 4IRKA 5HBRB 3CRRA 5I5TA 2EZOA 4O4JB 4YXWG 2BTOA 3OHAA 2YXYA 2NUAB 1TWAA 2UXXA 4ECWA 3AG2B 3R5HA 4DV0O 3ZMVA 5C4XG 3GIPA 4MTGA 1S0VA 5CAEB 2FLNA 1Y76A 3VPCA 4LFBO 3A0RA 2HDKA 3RJ0A 1BCCH 5CA0A 4FS2A 1XOUA 1RM1B 4LFCH 1TVKA 4RU9A 4HBNA 2KKWA 3I55V 1IVSA 4O2AF 2B1IA 3MWMA 4X20B 4WFHA 4AILC 3J81N 3FX7A 2M7WA 5KX5A 1F4NA 3ZRWB 1UJWB 1P8LA 2IH1C 4NVPA 2B63G 3BCCH 5LGTA 5KT2A 2O03A 1S5JA 5KMGB 3J81W 5I5YA 2OWOA 5FPOA 2QDOA 2JVDA 4LF5H 3GIDA 4DV6O 3JATB 4YJ3F 3G6EV 2GV9A 4QIWE 3PW4A 2DAAA 3SPGA 2FLLA 5BYAA 4X88A 4EFBA 1TUBA 2GUZA 3GTPA 4PA4A 1L2ZA 1NTMH 1N32O 2X6CA 3RV3A 3CRQA 2GHYA 4X65O 3RTXA 2E2HA 1A3GA 2P7TC 2IU3A 2ILMA 3CEIA 3O9OA 2Q7EA 3LP8A 3CWBH 3AX6A 4DR6H 2X7RB 4B3SO 2ARHA 3OMAB 1Q82W 1DV2A 4GT1A 3T2MA 3F5WC 1W93A 4DQNA 1SKVA 2W6PA 5B3SB 1Y14B 3VPDA 4FLUA 3AG2C 5LOVA 1NKDA 4I4TB 2Y4RA 2HG5C 2ZE6A 5DM6V 2FKXA 3ZX6A 1TWGA 3RBEA 2R8KA 4PBCA 4U7OA 3TQ1A 3B09A 2XT9A 5CE8A 4K8ZA 1ZL8A 4QE7A 1DTOA 4JV0A 1BZKA 2FKLA 2BQUA 3T5KA 1JR9A 3JAMW 3H0GG 5JJEB 5EIBD 4DV4O 3L75H 3JAWB 4RAZA 2Q7GA 4L8JA 2DMXA 2DYRC 4DUZO 2AW9A 4TM5A 2NU7B 4TV8A 1OHHG 4FLWA 4JI1B 1AUXA 3ZCCA 1I1KA 3OUFA 2PTMA 4AHCA 3RYIA 2F66C 1OJHA 4AQYO 1GO3E 1FFTB 1PD3A 4J42A 5HV6A 1KKDA 3JASA 5D1OB 1H2MA 2ZE5A 1XDNA 3JALB 3STLC 5KG0A 4DR4H 5KFPA 2WYOA 4J11A 3BPZA 3ETHA 3QG5A 3K9SA 1NZ6A 1KC7A 1DLBA 3IC9A 4MTFA 1AB3A 3RIZA 5KFJA 4CBCA 1ULZA 2HVQA 2Q4PA 2QKSA 2WLKA 3GB7C 1Q7YW 4JI6O 3T9FA 4JUZA 3CP1A 5B3SC 4ED1A 5L1JA 4O3RA 4YJ3A 4TWKA 4DV1B 4BIUA 2R9AA 5KT5A 1KB9F 2R7MA 3T99A 2RN9A 4FFBB 1GN2A 5C1OA 4TSFG 5E79Z 4JGSA 3JRWA 2YS8A 2CZGA 2I87A 3RAQA 4IYHA 1M7JA 4O2BF 5JCOC 2W9BA 3E2EA 4O7NA 1N0NA 4DR3O 1A48A 1VQ7V 3NGDA 5EDWA 5KA6A 4IRCA 4YJ2B 3RGZA 1SC5B 1XHXA 2V7QG 1TWCA 1XMQH 2FTKA 2NU6B 4KHPB 2EZPA 4X20A 1QR9A 2FJZA 3MFIA 2Y48A 1YJWV 1I94O 1KEEA 3E22A 1Z5WA 2OCCB 4DR4B 5JUMA 2JJ2G 4OGQB 3OGIB 4RUFA 1YI2V 1V55B 4LSXA 3GTMA 4OPHA 5IYZA 1G8MA 3TW7A 4YR3A 2JA7A 2JA6A 3AG7A 4HYOA 4LFAH 1JA8A 5KMGA 2NLJC 3HXLA 2LFSA 3T1HB 1N34B 4A3MG 2RDCA 2NVXA 1I7NA 4MV7A 4NXMO 3KHLA 2ETNA 4CH5A 1I3QA 2LGWA 4EYHB 4ECXA 2GUZB 3RFRA 2UU9O 3LSUA 2R7ZA 4O2AB 3GIKA 2ZXWC 3UCSC 4F4ZA 4NXNH 1VQKV 4PI0A 4J9KA 4I7HA 2W8KA 2XAFA 3A2FA 1QNMA 4PI2A 4MVZA 3ZMZA 1XNRO 2GLTA 3K5HA 3TQTA 2PVPA 1FXKA 2Q69A 4R50A 2VQEB 4O3PA 5C44G 4B3MH 2WLJA 4UUGA 2QWOB 5KFAA 4RNNA 3KXYT 4CMDA 3OT7A 1CE8A 4YAKB 3I4MG 2GPSA 2YRWA 3VQVA 3E86A 4DR7O 2Y0SA 1AN7A 2W6JG 2ATLA 1S97A 2QJ1A 4O4HB 4DV2B 1A9XA 4MV3A 1BMFG 1OV9A 1B6RA 2YRXA 5B1AB 4O2BA 4TV9B 4WFEA 4ECYA 2QM7A 2CKZB 4GX2A 2QWPB 4R7RA 2F95B 1S5LZ 3W1GA 3HKBA 4TQSA 3HB3B 3AG1C 1XL4A 4WBNF 1CQIB 3ASNB 2HHHO 1WJZA 3G6YA 3N2GA 3OEEG 4YIPA 3PO3G 1NTKH 3SYPA 4J9RA 1HR0H 4TOIA 5FNVA 3LNMB 5L3CA 5KG2A 3E22B 3I5DA 3G4SV 3PFFA 5CB4A 1KJ8A 1RSOA 3LSQA 1KP3A 3ZS8C 3OMNB 4WFFA 4FBTA 1G2WA 4YIOA 3LQSA 1PV0A 3H01A 1XMOB 1ZAUA 2ZXWB 1KJQA 3CVZA 2ITDC 3D36C 2W8LA 3G71V 1VQNV 1K8AW 2PYLA 1IX9A 5C3EG 5K2MA 5J2TA 3SPHA 2YZNA 3KG2A 5DECA 4RQEA 4BBSG 3PO2G 2DE0X 2V4RA 4GC7A 3K79A 4BAYA 1VF6C 4CC5A 2A1HA 1OCRB 4DV2H 4NXMB 4X62H 4DV3H 3MWEA 3H1HH 2V5AA 1HW7A 1AVMA 1SQFA 2C35B 3V6JA 3SYAA 1N48A 5B1NA 4J9QA 1M56B 4HQ6A 1I1LA 1WSCA 3FD9A 4PHZA 1AP5A 3QO8A 1N36B 1GM7A 4PJ0Z 1CKMA 1WR2A 5JVDF 4NTYA 5KG4A 3T5JA 4OXSA 3GTKA 4OPAA 5KFIA 5FD5A 1LNQA 2ZIOA 1IBLB 4JI0B 3N42B 4J9ZB 5BR8H 3KTMA 3BEHA 3KZIZ 1BHAA 5KFUA 4IWXA 2X5RA 2Y4UA 4OX9O 4I9WA 2NNUA 2A3QA 3BA9A 1L1FA 2AQ4A 1R1BA 3W7TA 2COGA 4AYBE 4A3EG 2RGVA 3IN5A 5FL7G 4QWEA 2UU9B 2FPPB 4FLZA 2A7WA 1Y76B 1JQ0A 3OSNA 4K3AA 3JARA 1QCEA 1H2SB 4QNHB 3DF7A 2VQFH 3EYYA 4O4IA 3M4IA 4QWAA 2UVRA 1VQ5V 3GILA 3WO1A 5EIBC 1N0JA 3JSLA 1M90W 3T4DA 1SEIA 4BIOA 3E89A 3ETJA 3SR2C 5KFNA 1OCZC 3PZPA 3NBYB 3W5OA 4BW5A 4WBNA 3FYIB 1IURA 1RYSA 4PZ8A 2B9ZA 1WCMG 4MV4A 1TAEA 3FB8C 1R3IC 2YI8A 1E1RG 5LMUH 1NTZH 1TA8A 1GSAA 1OCRC 4PDBA 1YXBA 2VOBA 2IBKA 5JQGB 3BA8A 4Q0YA 4YR2A 5FPRA 2EIKC 1AROP 4GX5A 5C8YF 3EVKA 2OTJV 3M9MB 4JV2A 4JI6H 4UV8A 2A79B 1DIKA 2ZDGA 4FFRA 2BQ3A 4J9YB 2E5LB 4UFZA 2BOBC 5BWVA 4GYCB 2R86A 4F50A 2R92A 1NQTA 1KYOF 5BWTA 1H2LA 3K0GA 2UUBB 5D1OA 3F7YC 1UC9A 5C5JA 1BE3H 2YIBA 1N8RW 4EG0A 2VUMA 3R5XA 2WA4A 4I0XB 4IRDA 3A0BZ 4X62B 4JXUA 5KHGA 4DV5H 1UFIA 4NXMH 2HJWA 4R7CA 2EULA 4Z1MG 4UXNA 2X0SA 2JEGA 1C3OA 5DISC 5H6RA 1KUTA 4J7ZA 5JVDA 4ECZA 5I60A 5JH7A 2LJ2A 4TVIA 3KREA 1AUVA 2YC0A 1KC8W 5CA1A 1W0KG 3RR5A 5KAIZ 2HEPA 4UCTA 1Q90D 4QGPA 1PNLA 3ETEA 5KHIA 5KFGA 4O4IF 4B7EA 2R7ZG 1DF5A 5BYBA 2VRZA 1I94H 4EEQA 1M1KW 4O3SA 2GBOA 4LFCB 5KG7A 1T5EA 1HNZH 2Q9LA 3JD1A 1OZ0A 1ZWIC 4DR5H 5IY5B 3KAKA 4K6NA 3UT5A 1BXRA 3CCEV 2JRIA 5DG8A 2WTFA 2LQTA 4HNTA 1HNWB 4IZOA 1A32A 3UQ8A 3GWOA 1Z2OX 4O7ZA 5CMUA 3JD3A 1RJQA 5KFWA 1AILA 4DUYB 2EIJB 3H9VA 2B5UA 3L72H 4X1KA 3U9TA 3T1YB 2O57A 4IGGA 3H20A 4GKJH 4A3GG 2KSDA 3FB5C 5C8YA 3R66A 5CA3A 2PY5A 4X66H 1GMGA 3QFFA 2V1DA 5F2VO 2IMWP 2UXNA 4I0XA 1JDEA 5A2QN 2VS0A 4NTXA 4F4WA 4DR4O 2V9WA 3CQZA 2MW2B 1JPXA 4UB8Z 4QPKA 4YHHB 4JV5O 4I50F 4YQWA 2QGNA 1VQ4V 3B77A 4X1IB 1VEWA 3JARB 1Q8IA 1YEWA 4I7ZB 4U3JA 2XHBA 2HHHB 3V6KA 1JCHA 3JZIA 2JJ1G 1VIBA 3THOA 2XNDG 2E5LH 2A06H 3X2QB 3T1YO 2Q6AA 1T36A 1ZSPA 2DYSC 3HOXG 1PNMA 5DG9A 4DL7A 2IU0A 1GH6A 2KG7A 4NB5A 1HNXB 2C00A 2WAMA 4ED8A 5EBMC 2UXCO 3N2GB 3NBZB 3OW2U 2WSSG 4LP8A 2QB5A 5E1AC 3ZHQA 1WP7A 3TETA 3V4SA 5L9XA 4O7SA 2FK3A 4JAAA 4F4LA 2CK3G 2VA2A 3UZBA 2WDTA 2LFRA 2YZLA 2UUAH 3M9OB 2IM9A 4PD4F 3HT5A 3SDLA 4JI5O 4EB6A 5H80A 4B3TH 4QE9A 1SETA 1Q6UA 3LDEA 3OM3B 3Q4HA 3WB2A 5B5EZ 5I5XA 5BR8O 3C3TA 2Q7HA 2GTSA 2ADQB 1WA8A 2BCCH 1R6TA 4MS2A 3LDCA 1HDJA 1A0IA 5K3WA 2P67A 1Q3EA 3QF7A 1J5EO 2Q73A 2P5OA 2ZKOA 3FAVA 3ZEDA 5LOVB 2BTQB 1GTOA 2WB1A 1FPOA 4YHHH 5KHKA 1OCOB 2C2AA 3FYEB 4BW9A 2FK2A 1LR1A 4JI1H 3TW6A 2W9CB 3W1BA 4ED0A 4O86A 2IP4A 3OFNG 4PA7A 1QLEC 3CCVV 4DR1B 2HVJC 3T9AA 3M9NB 2UXBH 4DV4H 3M99B 1K34A 2GQRA 4FJCC 4TUYF 4MSWC 2V59A 3RYFB 5HNEA 2ZNJA 3ZN1A 3T5HA 2DQ0A 1EKVA 3K9AA 2OCCC 3PW2A 5D8DA 1MA1A 4B3MB 1HNXH 4LH7A 4DV5O 4A3IG 2NU9B 1K1QA 1PL4A 4HNUA 2GSMB 4J9SA 4LF9H 1VF5B 4H13B 4Q45A 2JGDB 1M57C 2XAJA 2VQEO 4UVCA 2R70A 3N6RA 5KG5A 4DV6H 5L3FA 4FU0A 5J2UB 5BMVF 4Y8VB 4DR1O 3J80N 1V55C 3B4SA 4DO2A 4NR1A 4HYKA 3UKMA 2ZM6B 4LWSA 2ZDQA 2ATKC 1E1QG 1WB8A 1ZTEA 4NLGA 3VBBA 2CTQA 4C5CA 4XDJA 3QZ8A 4CS4A 1A0GA 5LYJF 5IJ0B 3RBDA 1VQ6V 4LF8O 3JD2A 4DR7H 1M5IA 2QSAA 3LULA 2ZM6H 4FBUA 4LF6H 4IIJB 4JTAB 1VQOV 2CAZC 2XUMA 3KCYA 4L87A 2EJ3A 4ZQIA 2WWWA 4WCEV 4LWSB 3HKEA 4WFBV 1YJ9V 3M8AA 2HVRA 2P4KA 3WG7C 1MSDA 2JA6G 5KS8A 1RYRA 3CRAA 4X65B 3JAWA 2C2RA 2AU0A 4JYBA 2QR4A 2Y69C 3GTJA 2W6IG 5D5QA 1ZL8B 2JEUA 4DV2O 3UM7A 4DV1H 2D3OW 3SYQA 3EXAA 3ASNC 4QIWF 2IJKA 4BXXG 2KG7B 4RO2A 2V4QA 2PZSA 4MVQA 2ZR3A 1GSHA 4DUZH 2DOSA 4Q4DA 4UCOA 4DLKA 1NH2D 1US6A 3S24A 3T1HH 1IBMB 4JI4O 1XNRH 4PA9A 2R8IA 1AI7A 1FXVA 2E76B 4UCRA 2VWKA 3SPCA 5BMVB 5J2UF 3HKCB 1Y1WA 1IBMO 4JI4B 2LO1A 1IYEA 1IZ3A 3H40A 1XL6A 4X62O 3CCMV 2HJDA 4GLWA 3OUSA 2QYZA 3HKZE 2VQFB 3PVXA 2JEJA 1MSWD 4EBDA 5LMNB 3PJSK 4GKJO 1Z2GA 4JI0O 4Q6GA 5J9PC 1NVPD 4J9PA 4RZRA 4HNAA 4LCUC 4TT3G 1RJPA 2FE3A 1K3EA 5I47A 1S0NA 3SNOA 5LGNA 4LF6B 4KHPH 2ZM6O 5BMVA 4AYBA 2JS5A 5GTHZ 2YXHA 3IC7A 5LMUO 2BTQA 1K83A 1N33H 1BQ0A 4JV5H 3HR0A 3K5IA 4E2LA 2W9CA 3DAAA 1JJ2U 1JFFA 3T54A 2CDYA 3DXRB 4DR5O 4R8UA 4ETSA 1IBLH 3B8MA 4QJFB 3HOUG 1Z2NX 2AGAA 1EN6A 2EX3A 5JVDB 4D6TH 5L3BA 3W7UA 1MZBA 4G3IA 4HAMA 3R5FA 1S0OA 4ASUG 4DR2O 1EM1A 2Q2TA 4LBEC 1OBGA 4O4JA 3FKIA 3D3QA 3KHHA 4MV6A 3K3VA 4ECTA 4DR6B 3RB3A 2XCAA 1SQQH 3RGBA 3C90A 4ECVA 3CJHA 3Q2OA 2D2CB 1VS0A 4MVOA 5LP6C 1QLNA 1FXKB 2JDIG 2N05A 2YUAA 1M0WA 2XGQA 2FB9A 1OCZB 4LF4H 2BQRA 2CW7A 1RK5A 2F43G 2Y0IA 3TY8A 4QIWA 1DK1A 4DK0A 1SFOA 5J2UA 5CBHA 4JZGA 3ETQA 1WAZA 4MA5A 5KFZA 5CN0A 3U11A 1SYXB 2PUSA 3S3XA 3J7AK 4JV5B 5GONF 4DV1O 4Z2WA 4O7YA 5KFFA 1EYZA 1BL8A 2E74B 5AG2A 1OWTA 1HP8A 4QW9A 1YJNV 3Q8RB 1QBZA 4XBFA 4H37A 1CQJB 5KFOA 1JX4A 1VBGA 4C5BA 4J9NA 2DLNA 4J80A 4O4LB 1BQZA 3P3NA 1HNXO 4JPRA 3CCJV 2CQYA 1X59A 5KT6A 3GQCA 3T4ZA 2B1GA 2EJ0A 3B2EE 5I5WA 5KFQA 1RFYA 4LNUB 3L70H 4IWYA 4YY3B 3G8CA 5LMNH 2PF4E 1UC8A 2HHFB 1KECA 4UB6Z 5IP7G 3UZOA 1YHQV 4JYAH 3CCSV 5CBFA 4RUEA 4B3SH 2HR3A 3AEIA 4MTDA 1XI1A 3H3VH 4WFAV 4DL6A 3BFRA 4DV4B 1K5QA 1I08A 4DR5B 2UVVA 2W57A 2PYJA 5LA6B 5IYZF 5LP6B 2P06A 2YICA 1WRVA 3SJQC 1FXKC 1I5XA 3A8TA 2R85A 2NN4A 4UCUA 4FFOA 4M9UA 3T7AA 3R9RA 2FB5A 5EOYA 4CH6A 2ZE8A 3RYHA 1GN6A 3TGUH 2ODMA 4FMTA 5IE9A 3N8DA 2OIGA 3H0GA 3H1LH 1HNZO 2E75B 4O83A 4Q4CA 4JAUA 1KBLA 2AGQA 3G6BA 5KA5A 3RFCA 3WU2Z 5IY5C 1VQ8V 5EK0A 3Q1KA 3OEHG 4MW3A 5CA0B 3V6HA 2C2EA
chains in the Genus database with same CATH topology
4GYCB 4I55B 1GYFA 4U3JB 4ZHQA 2UUBB 5D1OA 4K8XA 3RYHB 1XK5A 4YJ2A 2YIBA 5KHHA 1Q5OA 1N32B 4O4HA 1X9NA 4GKKH 4O4LA 4X62B 4CH4A 5KHGA 3LMLA 3ICXA 4DV5H 4NXMH 1FFXB 4DV6B 5JCOA 1XQ8A 4JI2H 3BHPA 5J2TB 5DISC 1O75A 2V4DA 3JAKA 4DV7H 3N2KA 4PZ7A 5JVDA 4O4IB 4DR2B 5C8YB 5IWAB 3SJBC 2XIGA 3RYCA 5JH7A 3SGIA 2VQEH 4X64B 4LF9B 1J5EB 2HVSA 2UUBH 4A2BA 1TUBB 5CA1A 3LNNA 3RR5A 1V9PA 2JGUA 2HEPA 4UCTA 3RYCB 4JI3B 1JFFB 1Q43A 1FVIA 4X1YB 4TUYB 5CB4B 2CFMA 1N32H 4CC6A 5KHIA 4O2AA 4EB6B 4MV9A 1I94H 4EEQA 2VUGA 3IAYA 5LA6A 2RQ6A 1TVKB 2UXCH 4OX9B 2YXLA 4LFCB 5EYPB 1T5EA 1E4FT 1HNZH 1DGSA 2UUCB 4LFBB 4CH3A 5FLXW 3RGXA 4UCSA 4LR3A 1XNQH 2OYQA 4DR3B 1IBKH 1FKAH 4DR5H 3TY5A 4GLXA 3KAKA 3UT5A 1XNRB 1JMKC 4LF7B 4LMYA 1HNWB 4JI4H 2ZIMA 2F4VH 3UQ8A 1I94B 2RJZA 4J0MA 1Z2OX 5GONA 4X1KB 4LFAB 4TV9A 5JJNB 4RB3C 4JI8H 4DUYB 3N44B 2VPSA 3N40P 1XMQB 4X1KA 3T1YB 3FFQA 3SJAC 3QWUA 3H20A 4GKJH 3MAQA 3L2PA 4AQYB 3N2KB 1D5AA 5C8YA 3K5MA 2PY5A 1B04A 4IAJA 3M7MX 4X66H 1IBMH 2MCTA 5IJ9A 2Q0AA 1ZHSA 4O4JB 1WPBA 3QTCA 2E3CA 2BTOA 4JI3H 3K5NA 4KL1A 2VWJA 3C0FB 4YHHB 4DV0B 4FM9A 4DV3B 1I6UA 3BABA 4X1IB 3RJ0A 1J5EH 5CA0A 3JARB 1Q8IA 1SA0B 4I55A 4LFCH 1TVKA 4U3JA 1YEWA 1I7FA 4ZOLB 2XHBA 2HHHB 4HBNA 4GKKB 5IJ9B 3THOA 2KKWA 2RGRA 3GDEA 2E5LH 3MWMA 4X20B 4JI5B 4AILC 3J80W 4B3TB 5KX5A 2P22C 3RF2A 1P8LA 4NVPA 1HNXB 1NT2B 4LH6A 4BWSC 3HKCA 2O03A 1S5JA 5KMGB 4M7EA 3J81W 1S68A 3N2GB 3NBZB 4RB2C 4TQFA 2OWOA 1XHZA 5D1PA 5FPOA 4LF5H 2JVDA 4ZOLA 3HKDB 1FJGH 3JATB 2GV9A 3BRCA 3VQXA 5LXTA 4EFBA 1TUBA 2YIAA 5CA1B 4DK1A 4FM2A 3OTOH 1L2ZA 4B08A 4IHJA 2WDTA 5LL6b 4DRXA 1O9GA 2PGGA 3RTXA 2UUAH 2IM9A 4EB6A 4B3TH 2Q7EA 3WB2A 1CKOA 1X4TA 4DR6H 3CB2A 1XNQB 1HR0B 2Q7HA 1N33B 4X66B 2Q2UA 3NC0B 1SKVA 3KAJA 4DUZB 1A0IA 4FLUA 5LOVA 1Q3EA 4I4TB 3QF7A 4FVMA 2P5OA 3ZEDA 4B3RH 5LOVB 2BTQB 4YHHH 5KHKA 4DV0H 4JI1H 1P49A 4BW9A 4FM1A 4B3SB 3W1BA 4ZI7B 4TQDA 4K8ZA 3T1YH 4DR1B 4UCVA 4DRFA 2UXBH 4DV4H 3JALA 4JI0H 3JAMW 1L8DA 4F6RA 5JJEB 5EIBD 3RYFB 2ZNJA 3JAWB 5ITZB 4RAZA 2Q7GA 4L8JA 3JSNA 4CS3A 3TY9A 4B3MB 3U0ZA 4TV8A 4FLWA 4DV5B 4JI1B 5D5PA 1HNXH 4LH7A 1IBKB 4B3RB 1ZHQA 2PTMA 4FLTA 4AHCA 4RB1A 3RYIA 2UU9H 2F66C 2WE6A 4YJ3B 3JASA 5D1OB 1XDNA 1HNZB 3JALB 2F1MA 4X64H 4LF9H 4DR4H 4X1IA 5EYPA 3FMAA 2WYOA 3WB0A 2QM4A 3BPZA 3QG5A 2R70A 5FD6A 5KHJA 5LXTB 3GJXB 1KU9A 4DV6H 5J2UB 3K5OA 4JI2B 3RIZA 2YI9A 1N36H 1QQCA 5EZYA 2ZM6B 2HVQA 1M0TA 3K58A 1JJOA 5K1PA 4DR7B 4DR2H 1KMIZ 4LNUA 4YJ3A 4D7SA 4CS4A 4DV1B 4JI5H 2R9AA 5IJ0B 2F93B 4FFBB 4MTEA 4DR7H 1M5IA 4ZIBA 1FJGB 2ZM6H 4LF6H 3HKEB 4IIJB 2ZINA 2CAZC 1M93A 4JI6B 3U10A 3HKEA 4IIJA 5JCOC 2HVRA 4LF5B 3RYFA 2HHHH 4X65B 3JAWA 5ITZA 3KALA 4YJ2B 3RGZA 1XHXA 5D5QA 1Z5VA 1XMQH 2UXDB 4KHPB 4X20A 1Z2PX 4O2BB 5FNVB 5IYZB 3E22A 4NXNB 1Z5WA 4DV1H 4DR4B 3RYIB 1SQGA 4LSXA 2YIBD 1SA0A 5IYZA 4AQYH 3JAKB 1WH2A 4CS2A 2PZSA 4I4TA 4LFAH 5KMGA 3HXLA 3VNNA 1N34B 5JQGA 3T1HB 4K0KB 5A2QW 2HIVA 4OX9H 4DUZH 4MV7A 3BAAA 4FLVA 3DSQA 4CH5A 3JATA 4UCOA 4I9QA 1G6UA 4DR1H 4PZ6A 4RAYA 3RFRA 2UXBB 3S24A 3T1HH 4O2AB 1IBMB 1XNRH 4UCRA 4NXNH 2VWKA 1VF7A 4PI0A 5BMVB 3HKCB 2HIXA 4JI4B 4I7HA 3A2FA 4PI2A 4FLYA 4BWAA 3VQWA 3L4JA 4YY3H 2F4VB 3L4KA 2VQFB 3WB1A 2VQEB 4B3MH 4JYAB 5LMNB 1N34H 3KXYT 4Q6GA 4HNAA 5LYJB 3VQVA 4ZHQB 4E6NA 2FE3A 3UT5B 3OTFA 1QHTA 4I50B 4LF6B 1AN7A 4KHPH 5BMVA 2JS5A 2BTQA 2QJ1A 4O4HB 4DV2B 4LF8H 1HNWH 1N33H 4JV5H 4O2BA 4TV9B 1XMOH 3K57A 1JFFA 5KX5B 4R7RA 4ETSA 2F95B 3W1GA 1IBLH 4LF4B 3GB8B 3HKBA 3OTOB 1Z2NX 4JI7B 2EX3A 5JVDB 4LSAA 5EZYB 1MZBA 5IT9W 2ZNIA 5IWAH 2HGSA 2Q2TA 3N2GA 3N41B 4O4JA 3K3VA 1HR0H 4TOIA 5FNVA 3E22B 4DR6B 4X1YA 4TUYA 5CB4A 1RSOA 3RGBA 3ZS8C 4FFBA 5JJJB 1TGOA 3N43B 1S03G 1VS0A 1XMOB 5LP6C 1ZAUA 3CVZA 1M0WA 1FFXA 4LF4H 5K1XA 2CW7A 3SJCC 2PYLA 4TV8B 3TY8A 4DK0A 5J2TA 5J2UA 3ETQA 2ZCEA 4HNAB 2CW8A 3U11A 1SYXB 4CC5A 2PUSA 4LF8B 4NXMB 4X62H 4DV2H 4DV3H 3J7AK 2YCHA 4JV5B 1HW7A 1SQFA 2R72A 1WN7A 4PHZA 1N36B 1CKMA 4JI7H 4ZI7A 1CKNA 4DUYH 5FD5A 2ZIOA 4O4LB 5LYJA 1IBLB 4RB0A 4JI0B 3K59A 3N42B 2ZJTA 5BR8H 4GKJB 4A2AA 3B2EE 4LNUB 4IHJB 4YY3B 5LMNH 5IJ0A 3CSXA 4EQ5A 3BA9A 5JH7B 4LF7H 4JYAH 5LMUB 2RGVA 4B3SH 2UU9B 4MTDA 3F8NA 4FLZA 4D7TA 1M4UA 3K5LA 1XI1A 3VQYA 4JI8B 1WNSA 4FLXA 3JARA 4X65H 3JASB 4EFEA 4DV4B 4DR3H 1H2SB 3DF7A 2VQFH 2KSWA 4O4IA 3EYYA 4DR5B 3M4IA 1O9HA 2W57A 2PYJA 3CHXA 5EIBC 5LA6B 5BR8B 4WBNB 5LP6B 3JSLA 4I50A 4FM0A 1SEIA 3RWRD 3HKDA 3SR2C 1BJTA 3NBYB 3W5OA 4UCUA 4WBNA 5LP6A 4PZ8A 5EOYA 4CH6A 1TAEA 2YI8A 3PN1A 3RYHA 4APMA 5LMUH 1TA8A 1BGWA 4F6RB 4K0KH 4DRXB 3HKBB 4PDBA 1E4GT 2VOBA 3KYHC 5JQGB 3BA8A 3N6XA 4Q0YA 5FPRA 3IG0A 2UUAB 2UXDH 1P16A 1CKNB 2UUCH 4LFBH 4RZQA 5GONB 4JI6H 5CA0B 2UXCB 4DV7B 2E5LB 4UFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK B;  4DR7 B;  3GDE A;  4TOI A;  4DR6 B;  4JI5 B;  2UUB B;  5D1O A;  4DV1 B;  4B3T B;  1XK5 A;  1N32 B;  1X9N A;  1FJG B;  1P8L A;  1HNX B;  1VS0 A;  4LH6 A;  4X62 B;  1XMO B;  1ZAU A;  4DV6 B;  1S68 A;  3NBZ B;  4JI6 B;  2OWO A;  5D1P A;  5FPO A;  5DIS C;  3TY8 A;  2HVR A;  4PZ7 A;  4LF5 B;  4DR2 B;  5IWA B;  3SGI A;  4EFB A;  4X65 B;  4X64 B;  4LF9 B;  1J5E B;  4CC5 A;  2HVS A;  4LF8 B;  4NXM B;  3RR5 A;  1V9P A;  4UCT A;  4JV5 B;  4JI3 B;  2UXD B;  4KHP B;  1FVI A;  3RTX A;  2CFM A;  4CC6 A;  4NXN B;  4DR4 B;  1N36 B;  1CKM A;  1CKO A;  4EEQ A;  2VUG A;  1XNQ B;  1HR0 B;  1CKN A;  1N33 B;  1IBL B;  4X66 B;  2Q2U A;  3NC0 B;  4JI0 B;  4DUZ B;  4OX9 B;  4LFC B;  1N34 B;  3T1H B;  1A0I A;  3VNN A;  4K0K B;  4GKJ B;  1DGS A;  2HIV A;  2UUC B;  4LFB B;  3BAA A;  4UCS A;  4UCO A;  4YY3 B;  4DR3 B;  4PZ6 A;  4EQ5 A;  3BA9 A;  2UXB B;  3S24 A;  1IBM B;  4B3S B;  3TY5 A;  4GLX A;  5LMU B;  4UCR A;  1XNR B;  2HIX A;  3W1B A;  4LF7 B;  4JI4 B;  2UU9 B;  1HNW B;  3UQ8 A;  1I94 B;  4DR1 B;  2F4V B;  4UCV A;  4DRF A;  2VQF B;  4JI8 B;  2VQE B;  4LFA B;  4EFE A;  4JYA B;  4DV4 B;  5LMN B;  4DUY B;  4DR5 B;  1XMQ B;  3T1Y B;  3QWU A;  5BR8 B;  3L2P A;  3JSL A;  4AQY B;  3JSN A;  3TY9 A;  4E6N A;  4B3M B;  1B04 A;  4DV5 B;  4JI1 B;  4LF6 B;  3NBY B;  4LH7 A;  3W5O A;  1IBK B;  4UCU A;  4B3R B;  4PZ8 A;  4DV2 B;  1TAE A;  3PN1 A;  1TA8 A;  5D1O B;  1XDN A;  1HNZ B;  4YHH B;  4DV0 B;  3KYH C;  3BA8 A;  4DV3 B;  3W1G A;  5FPR A;  4LF4 B;  3GB8 B;  2UUA B;  3BAB A;  3OTO B;  1P16 A;  4JI7 B;  3GJX B;  1CKN B;  4JI2 B;  2UXC B;  2Q2T A;  2ZM6 B;  4DV7 B;  2HHH B;  2HVQ A;  2E5L B;  4UFZ A; 
#chains in the Genus database with same CATH topology
 1GYF A;  3HOW G;  2VQD A;  2EIM C;  4E4E A;  3FKS G;  4F6E A;  1C30 A;  3EHB B;  3RYH B;  3CRM A;  1G1X B;  4Q43 A;  3LUT B;  1WLE A;  1N32 B;  1BS3 A;  3LML A;  3ICX A;  3IGA C;  1FFX B;  5JCO A;  4JI2 H;  3I4N G;  3BHP A;  2YYA A;  1FD9 A;  1O75 A;  1AI6 A;  2UXB O;  3N2K A;  4BBR G;  4DV7 H;  5IWA B;  2XIG A;  2YZM A;  3D8C A;  2VQE H;  4X64 B;  3HO8 A;  1J5E B;  2HVS A;  2OTL V;  1TUB B;  4A5U B;  4RQF A;  1V9P A;  2JGU A;  4FGR A;  4X64 O;  4DAA A;  4B3T O;  4JI3 B;  1Q43 A;  4J9O A;  1SQB H;  4X1Y B;  4BY1 G;  4MA0 A;  4TUY B;  2OIE A;  2CFM A;  5BWX A;  2FL4 A;  2EJ2 A;  2DYR B;  4PWQ A;  1R3L C;  4QWD A;  4U7N A;  1SER A;  1IXM A;  1NS1 A;  2WLI B;  4MV9 A;  4F4Y A;  5LA6 A;  2FLP A;  4J9L A;  5BWW A;  5KAF Z;  1XDC A;  4OX9 B;  3R65 A;  2WAQ A;  1YSC A;  4IR1 A;  3V4Z A;  1Q86 W;  4UV9 A;  5DN6 G;  4G27 B;  5H5N A;  4P9O A;  2DAB A;  2OYQ A;  3I12 A;  3G8D A;  5DMX A;  2CGO A;  3AG1 B;  1VKZ A;  3GIQ A;  2QWN B;  1B6Q A;  4GLX A;  4WFG A;  1XNR B;  1KUQ A;  4LF7 B;  4LMY A;  2EIL B;  1ZET A;  1TWH A;  2ADP A;  4JI4 H;  3CC4 V;  1MG1 A;  2EBO A;  4BIZ A;  5EZY F;  2UUA O;  4EEY A;  4LFA B;  4W4K A;  5JJN B;  4A3F G;  4JI8 H;  3W7X A;  5EBW C;  2HG8 A;  4CKB A;  1PNK A;  3L2P A;  4AQY B;  4CKE A;  2PBZ A;  4ED3 A;  1GGO A;  2J6U A;  2R6F A;  2CH7 A;  1B04 A;  4MAM A;  2DJV A;  4KXR A;  5IJ9 A;  3JRX A;  4LF6 O;  2Q0A A;  1I5Y A;  4RCN A;  4O82 A;  4JI3 H;  2Q68 A;  1H2K A;  3MHS C;  5KFT A;  4KL1 A;  3CX5 F;  2VWJ A;  4QWC A;  4DV3 O;  2A9H A;  1XUQ A;  3CE2 A;  4YHH O;  2CE4 A;  2CNU A;  2IJH A;  1DV1 A;  2YS6 A;  3I56 V;  3RB6 A;  4DV3 B;  3SI8 A;  3BAB A;  1J5E H;  1KD1 W;  2R7L A;  2PN1 A;  4YR0 A;  4G2K A;  1OCC C;  1I1M A;  2YW2 A;  4TQR A;  4I55 A;  3PR4 A;  1AP6 A;  1I7F A;  1H8H G;  4GKK B;  1IYD A;  2WLL A;  5IJ9 B;  5BWU A;  2RGR A;  1QLE B;  3SYO A;  5L1K A;  1RPO A;  2YSU B;  2UVU A;  1P4R A;  2I80 A;  3GV5 B;  4YY3 O;  3J80 W;  4NZM A;  3HB9 A;  5LA6 F;  4Q20 A;  4R8U B;  1HWY A;  3ZHT A;  3RF2 A;  2DN9 A;  3MR3 A;  4BWS C;  1OCO C;  3HKC A;  5IWA O;  1I0H A;  3OR6 C;  1JOY A;  2HKO A;  4RB2 C;  4TQF A;  4ME6 A;  3LWB A;  1XHZ A;  5JQW A;  3HKD B;  1LUW A;  3BRC A;  3TK1 A;  2R9I A;  3VQX A;  5LXT A;  1AR4 A;  2UXD O;  5KFS A;  4DK1 A;  1PP9 H;  2HLD G;  5B1B C;  4FM2 A;  5DQG A;  2AGP A;  4IHJ A;  3PW0 A;  5LL6 b;  2GTA A;  1O9G A;  3TXS A;  2UVW A;  2M6Y A;  3G80 A;  5FJ8 G;  3CCL V;  1VAJ A;  4GZR B;  3WO0 A;  1VMG A;  3CB2 A;  1XNQ B;  2BR0 A;  4O84 A;  4X66 B;  3KAJ A;  4DUZ B;  4JYC A;  3CD6 V;  2QF7 A;  1M57 B;  4UVB A;  2A0L A;  1K4D C;  4XYM B;  5KFV A;  4B3R H;  3TEK A;  1HNW O;  1F23 A;  5EC1 C;  3E8B A;  1P49 A;  2W70 A;  2YU9 A;  1AI4 A;  4B3S B;  4K35 A;  2F4V O;  3AG4 C;  3G6X A;  4UCV A;  1Q6I A;  5IYC G;  3PW5 A;  2FP4 B;  1ET0 A;  4NTW A;  1AI5 A;  4F6R A;  2CGN A;  2Y69 B;  1Y66 A;  4JYY A;  4LFC O;  3DC6 A;  3K08 A;  2NR5 A;  5JVL A;  4LFA O;  5ITZ B;  1R3K C;  2XAQ A;  5E25 A;  2LP7 A;  2ZDI C;  3JSN A;  4CS3 A;  3TY9 A;  1WP8 A;  5KUM A;  3MDS A;  4DV5 B;  3MR2 A;  3MD0 A;  5D5P A;  1CS0 A;  1MNG A;  1IBK B;  4Q8E A;  1ZHQ A;  3FB6 C;  3WWH A;  4FLT A;  2GDS A;  4RB1 A;  1R3J C;  2UU9 H;  3QZ7 A;  2ZGI A;  2WE6 A;  2OLS A;  4IT5 A;  3OUZ A;  4QSH A;  5IYB O;  5FNV F;  1PM9 A;  2BE3 A;  1FKA O;  2F23 A;  1NJI W;  2R9R B;  1EN5 A;  3FMA A;  2IA6 A;  3WB0 A;  2QM4 A;  4A3K G;  4A3D G;  1FAF A;  2R84 A;  5FD6 A;  5KHJ A;  3GJX B;  1KU9 A;  2DZD A;  5KLV H;  5KFK A;  1N36 H;  1WA8 B;  3K58 A;  1JJO A;  4DR2 H;  3BVO A;  2H8P C;  3CRC A;  1T94 A;  2Q7D A;  2HJF C;  4D7S A;  5J2T F;  2CUG A;  1JX9 A;  2F93 B;  1EN4 A;  5CA0 F;  3WWI A;  1FJG B;  1VF6 A;  3TCU A;  2BSK A;  2Y0P A;  1N33 O;  3L9D A;  1IOV A;  1M93 A;  4FZ0 A;  2LW7 A;  1E4E A;  1L0L H;  4JI6 B;  3AW8 A;  3ZHS A;  1MZF A;  1IOW A;  3T9E A;  5KG6 A;  4IIJ A;  1ROP A;  3G67 A;  2QTS A;  2Q67 A;  4MTX A;  2QKC A;  3RYF A;  5KX5 F;  2HHF A;  1Y1V A;  2HHH H;  4A3B G;  3TJT A;  2WB1 E;  1K9M W;  2UXD B;  4ED2 A;  1ENV A;  4O2B B;  4NYK A;  5IYZ B;  4NXN B;  4YB8 B;  3RYI B;  2K9P A;  2R82 A;  3UYY A;  2YIB D;  1Y1W G;  3ZIA G;  2YEV A;  4RUA A;  4DL3 A;  1SA0 A;  2QWQ B;  4ECR A;  2H94 A;  3JZ6 A;  4CS2 A;  2R8G A;  2ASL A;  1VQP V;  3K3P A;  2X6B A;  4XDL A;  5JQG A;  5A2Q W;  4OX9 H;  4PDM A;  4FLV A;  1GLV A;  2EIK B;  2R93 A;  3VOU A;  1KJ9 A;  1YTF B;  2HGX A;  3DTG A;  2Z04 A;  4PZ6 A;  5KFL A;  4PV1 B;  1EZ1 A;  1VF7 A;  1D2D A;  2J6S A;  4WD3 A;  1SQX H;  3GWK C;  4BWA A;  3L4J A;  5LHH A;  2F4V B;  3L4K A;  2FMA A;  5C93 A;  3WB1 A;  4JYA B;  3JYC A;  2AHY A;  3OAA G;  4DYL A;  1TWF A;  3QO7 A;  2AZ0 A;  1VP7 A;  1PX2 A;  4RUC A;  2AXT Z;  5LYJ B;  4JI8 O;  3RBZ A;  1VQM V;  4E6N A;  3ZRX A;  4ICG A;  3UT5 B;  4XDK A;  3OTF A;  5H2F Z;  3KCX A;  2DIK A;  3CSW A;  2EIN B;  4FK5 C;  4RNM A;  1HNW H;  1Y1V G;  4FFL A;  2BSK B;  4DL4 A;  2IJI A;  1RP3 B;  3AK3 A;  3Q8P B;  1P7B A;  2OCH A;  1XMO H;  4CKC A;  1Y74 B;  3NR7 A;  4CHI A;  4JI7 B;  1MMM A;  5EZY B;  3KHG A;  1QVG U;  5IT9 W;  5LP6 F;  2FYU H;  3ABL C;  2ODT X;  3N41 B;  1EBO A;  3L71 H;  1E79 G;  2L35 A;  4MVM A;  3ZHV A;  4B3M O;  2JA7 G;  4DL5 A;  1AJQ A;  5IYD G;  4X1Y A;  4TUY A;  3EFF K;  5B66 Z;  4C7U A;  5JJJ B;  2R93 G;  1V51 A;  1NR1 A;  5JH7 F;  3DXR A;  1Y74 A;  4EGJ A;  1K5S A;  4WHX A;  1W2B U;  3GV7 B;  3ABM B;  1K33 A;  4P9P A;  1S03 G;  1J95 A;  1GRJ A;  2W7P A;  4ED6 A;  5L3E A;  5K1X A;  3SJC C;  2E5L O;  4TV8 B;  2W6O A;  3D36 A;  1JDB B;  3ABT A;  3ASO C;  2XTA A;  2NU8 B;  2ZCE A;  1JVM A;  4HNA B;  2CW8 A;  4EYI B;  3ML0 A;  3H1K H;  2ITC C;  4GCZ A;  5JQG F;  2YCH A;  2RDI A;  1XBL A;  3L73 H;  2R72 A;  1NR7 A;  4O3N A;  3CMA V;  2JEF A;  4LF7 O;  4XZ3 B;  3ABL B;  2JK5 C;  4PDV A;  5C1P A;  1XIL A;  4ZI7 A;  3JZF A;  1CKN A;  2WLI A;  5LYJ A;  4RB0 A;  5CR5 A;  3K59 A;  2R92 G;  3TII A;  4O3O A;  1S77 D;  4A2A A;  4A3C G;  2WLH A;  5GW7 A;  4R8C A;  1DAA A;  3GII A;  2VPQ A;  3P32 A;  4EQ5 A;  5BPH A;  1OCC B;  3LDD A;  3W7W A;  2C2D A;  4MVU A;  4LF7 H;  1S3J A;  3P3P A;  1B6S A;  5LMU B;  1U96 A;  4MTO A;  5TIS Z;  1M4U A;  3ASO B;  3VQY A;  1FJG O;  4JI8 B;  2ZDI A;  1WNS A;  5CBG A;  4FLX A;  3VPB A;  3JAS B;  1SCU B;  2DYS B;  1BNC A;  4H44 B;  1O9H A;  2YID A;  3BG5 A;  2PI4 A;  4IL6 Z;  3CHX A;  4MW8 A;  4H0L B;  5BR8 B;  4I50 A;  4FM0 A;  3RWR D;  3HKD A;  4FS1 A;  3Q8Q B;  3DTU B;  3UO3 A;  1BJT A;  2RMK B;  1KBH A;  5DAA A;  5LP6 A;  3WG7 B;  3CCU V;  5IYB G;  1URF A;  3PN1 A;  4APM A;  5B1B B;  4K0K H;  5I5S A;  4EGQ A;  3E83 A;  3HKB B;  4DW0 A;  5KFH A;  4GUN A;  4AI8 A;  3TIG A;  3IG0 A;  2UUA B;  4LF5 O;  1P16 A;  3HOZ G;  3HOY G;  2UUC H;  4RZQ A;  5GON B;  2QA4 V;  3RN4 A;  4GC6 A;  2UXC B;  3H4D A;  4DV7 B;  4RNO A;  2G38 A;  2FPI B;  4I55 B;  3L74 H;  4U3J B;  1THZ A;  3LSS A;  4K8X A;  2Z5U A;  4ZI7 F;  5HFM A;  4EKW A;  3EPG A;  1X9N A;  1Q5O A;  2R8J A;  4X8A A;  4O4L A;  5LHI A;  3T1H O;  5LOV F;  1FS0 G;  4CH4 A;  4EBC A;  2ALZ A;  2OT5 A;  1BGY H;  1XQ8 A;  5DED A;  4YBZ B;  5J2T B;  3JAK A;  4O4I B;  5C8Y B;  3SJB C;  1WB7 A;  1F4M A;  1S5H C;  3RYC A;  3SGI A;  5F9N A;  1KJJ A;  1Y6X A;  1S9F A;  4GX1 A;  1SS3 A;  2Z3Y A;  4O7V A;  4A2B A;  2JA5 A;  1FVI A;  3MFH A;  4CC6 A;  1EZV H;  2HGW A;  4O4J F;  1HR0 O;  4CMF A;  1E4E B;  1JXL A;  2DWD C;  4EB6 B;  2VUG A;  1K92 A;  5EBL C;  3AG3 B;  3IAY A;  1D5N A;  3ZRW A;  3FKI G;  2RQ6 A;  4TV8 F;  3OUU A;  1TVK B;  2UXC H;  1K73 W;  2YXL A;  3BQ2 A;  5KFD A;  1GAX A;  4J9M A;  2UUC B;  5BY1 A;  4JAV A;  1GM8 A;  3JD0 A;  5FLM G;  4Z1V A;  3RGX A;  5FLX W;  1K7D A;  5EC2 C;  4UCS A;  4LR3 A;  1XNQ H;  2Y4T A;  4DR3 B;  4E4T A;  2J9G A;  3T1C A;  2JS3 A;  3CPW U;  2DWE C;  4ZOL F;  1FKA H;  3TY5 A;  2E2I A;  1VAR A;  4MT8 A;  4Q8F A;  3ORQ A;  1JMK C;  1IBK O;  1GSO A;  3DC5 A;  5A9G A;  2F4V H;  1I94 B;  2RJZ A;  3ZHR A;  3WNZ A;  5GON A;  2RNB A;  4TV9 A;  4RB3 C;  2VUM G;  2P0A A;  3HPL C;  2W0X A;  2YDE A;  3N44 B;  2VPS A;  4YP3 A;  3N40 P;  3FFQ A;  3SJA C;  3RW0 A;  3GTO A;  1N34 O;  2ZR2 A;  3N2K B;  1D5A A;  3QQM A;  1SRY A;  3JAM N;  1H38 A;  4O4L F;  4IAJ A;  1ORQ C;  2MCT A;  2YS7 A;  4B7K A;  1ZHS A;  1WPB A;  3QTC A;  2E3C A;  1XMO O;  2C22 A;  2JA8 G;  5IYC O;  3K5N A;  1QR8 A;  3C0F B;  3GTL A;  4U6P A;  3SPI A;  5KFM A;  2KQX A;  4DV0 B;  3ZN0 A;  4FM9 A;  3GTG A;  3BAC A;  5BZB A;  2UUC O;  1XRE A;  1M6V A;  1I6U A;  4X9Q A;  1SA0 B;  1GKF A;  2PMZ E;  4M0J A;  2QWR B;  4ZBM A;  4ZOL B;  4U7C A;  4NYE A;  3GDE A;  3K04 A;  2HFE C;  5LGU A;  1IDS A;  1SQP H;  4JI5 B;  3ZRS A;  4PA3 A;  4HR7 A;  2XOK G;  2FML A;  4DXW A;  4B3T B;  3VOT A;  1YDX A;  1EZJ A;  1FXH A;  3CME V;  2P22 C;  4H33 A;  4FFK A;  1NT2 B;  4LH6 A;  2AZ2 A;  2N74 A;  1ZQ7 A;  1H8E G;  1W0J G;  4IYI A;  4C5A A;  4M7E A;  1VQL V;  1S68 A;  3CCR V;  4EBE A;  2MK3 A;  2Z0A A;  4JZ2 A;  2LGQ A;  2XD4 A;  5D1P A;  4ZOL A;  1SZX A;  4L1K A;  4CZZ A;  1FJG H;  4N21 A;  2QK4 A;  1QVF U;  2QTO A;  1IXB A;  2YIA A;  5CA1 B;  2W9A A;  1YVW A;  3OTO H;  4B08 A;  3GIM A;  3CYO A;  3IFX A;  1W96 A;  3CJH B;  3CC2 V;  4DRX A;  1R73 A;  2PGG A;  2WLM A;  4TV9 F;  1KJI A;  4WF9 V;  2B63 A;  1JIH A;  1B33 N;  2XCP A;  3WFV A;  1CKO A;  4BR6 A;  1X4T A;  3K06 A;  2EIN C;  1N36 O;  4ZKI A;  3H1I H;  1HR0 B;  2W6N A;  5DQI A;  3OMI B;  1N33 B;  5EWF A;  5KFY A;  2YEV B;  2Q2U A;  3NC0 B;  3Q4H B;  1SES A;  3F5T A;  3ZMS A;  1PPJ H;  1CXZ B;  3OGC C;  5KFC A;  1S0M A;  3JCU Z;  4FVM A;  2W71 A;  3KKY A;  2M05 A;  5L1I A;  2YZG A;  2WLL B;  3ZJZ A;  4DV0 H;  5BWR A;  1YTF D;  4FM1 A;  1NBM G;  4W4L A;  4X89 A;  1QU7 A;  4KUM A;  3NXS A;  4ZI7 B;  2SCU B;  4TQD A;  4I4T F;  2L6L A;  4J7J A;  1K97 A;  1RK6 A;  3T1Y H;  1WCM A;  4UUJ C;  2R7K A;  2P6J A;  4LC1 A;  5LHG A;  4DRF A;  1F51 A;  2W7O A;  3JAL A;  2XCL A;  4JI0 H;  4ECS A;  1L8D A;  1S76 D;  2R7N A;  5CB4 F;  3D3I A;  5LBQ A;  2ABJ A;  3ABM C;  2K1E A;  4O7T A;  1NVP B;  1GO3 F;  1M56 C;  3C3S A;  3RUP A;  2C28 A;  3B40 A;  3UO2 A;  4GKK O;  1EKP A;  3MJF A;  2XAH A;  3U0Z A;  1B06 A;  1V4Y A;  3VMM A;  4A93 G;  1COW G;  1H2G A;  4B3R B;  4XX0 B;  5IP9 G;  5KFX A;  4QPJ A;  1AR5 A;  1EKF A;  4YJ3 B;  4NXN O;  3U54 A;  2Q0O C;  1HNZ B;  2F1M A;  4X64 H;  3ABK B;  4X1I A;  5EYP A;  2DPI A;  1AR1 B;  1Q81 W;  4C2M A;  3PW7 A;  4FIP C;  1SQV H;  4RAI A;  1I2L A;  1UNN C;  2W6M A;  5DQH A;  5LXT B;  3CEB A;  5BXZ A;  3K5O A;  4P30 A;  4FE2 A;  4JI2 B;  2YI9 A;  2OH2 A;  1QQC A;  5EZY A;  4XYL B;  2WAQ E;  1GK9 A;  5KT4 A;  1M0T A;  3AK2 A;  4JI2 O;  1N56 A;  5K1P A;  4DR7 B;  1RJR A;  5H6Q A;  1MOF A;  1MZE A;  2CTP A;  1KMI Z;  4KP4 A;  2RDJ A;  3ETD A;  4LNU A;  4MVR A;  2WLN A;  4JI5 H;  5GTI Z;  3GLK A;  3ZMU A;  5L3D A;  1UPG A;  1EUD B;  3OSP A;  1S10 A;  5BPF A;  4MTE A;  1SF9 A;  2JA5 G;  4ZIB A;  1S72 V;  2ZT9 B;  5KFE A;  3T9C A;  1B3Q A;  3HKE B;  4U3F H;  5I5U A;  2QKA A;  2ZIN A;  2W9B B;  2P90 A;  1XNQ O;  1K4C C;  1EUC B;  3RT3 C;  3U10 A;  4GX0 A;  2YL2 A;  3KHR A;  5H9C A;  4J7K A;  5IYD O;  5DGH A;  5L3G A;  4LF5 B;  3GV8 B;  2J6T A;  5ITZ A;  2XGP A;  1PK8 A;  3KAL A;  2EIJ C;  1M9N A;  5FLX N;  3WWJ A;  2GQS A;  1Z5V A;  4I55 F;  1Z2P X;  5FNV B;  3K3W A;  3T9D A;  4FFP A;  2UUB O;  4CE5 A;  5KT3 A;  1N4C A;  2QM8 A;  4A3J G;  1SQG A;  3N27 A;  4O7R A;  2R87 A;  2IBZ H;  4AQY H;  2COJ A;  3JAK B;  4DV7 O;  1W59 A;  1WH2 A;  1Y67 A;  2W6Z A;  4I4T A;  2ZD9 A;  3VNN A;  4K0K B;  2HIV A;  4LF4 O;  3BAA A;  4N23 A;  3FAV B;  4FZ1 A;  3F7V C;  3SYC A;  5KFB A;  1JLL B;  3DSQ A;  3JAT A;  4JF3 A;  4I9Q A;  1G6U A;  3A0H Z;  4DR1 H;  1GN3 A;  3STZ C;  2HP8 A;  2RF4 A;  4HN2 A;  3O65 A;  3ZRV A;  2UXB B;  4P2Z A;  4RAY A;  3OR7 C;  3MHH C;  5KG1 A;  4I5S A;  3Q8S B;  4PA6 A;  3DGE A;  2HIX A;  5LXT F;  3R23 A;  4FLY A;  5EWG A;  3VQW A;  5DGA A;  2EIM B;  4YY3 H;  2XC9 A;  1SZT A;  4JTD B;  4JI3 O;  3JD4 A;  3CXH F;  1N34 H;  1ZUQ A;  4F4X A;  2P4V A;  3BQ0 A;  2RCV A;  4DR6 O;  1YIT V;  3AYH B;  4JTC B;  2JEX A;  1YIJ V;  4ZHQ B;  2Y0S E;  1PKX A;  1CPY A;  1QHT A;  4I50 B;  2JEI A;  4Q44 A;  2I8C A;  5KKN B;  2ZQM A;  4A3L G;  4LF8 H;  2W0F C;  2JGD A;  4NZN A;  1YF2 A;  4QWB A;  3GTQ A;  3K57 A;  1XMQ O;  1BHB A;  2HVK C;  3E5N A;  5KX5 B;  1T3N A;  3UFX B;  1R9T A;  4FPP A;  3FB7 C;  4LF4 B;  3GB8 B;  3OTO B;  3AK1 A;  4LSA A;  5CA1 F;  3U55 A;  1IBL O;  2ZNI A;  5FR9 A;  5IWA H;  1NH2 B;  2HGS A;  3OD4 A;  1NU1 H;  3GIJ A;  2EIL C;  2N04 A;  3CCQ V;  1EHI A;  2CNV A;  5DLG A;  4PDL A;  4FFB A;  3E35 A;  1TGO A;  5CM0 A;  5LMN O;  1PL0 A;  5KT7 A;  5JWP A;  3N43 B;  3RV4 A;  3BQ1 A;  4DIM A;  3T9B A;  1XEQ A;  5B1O A;  2DW4 A;  3AG4 B;  4DL2 A;  1FFX A;  4O81 A;  1GM9 A;  4JI7 O;  5F9L A;  2DWC A;  2GPW A;  3S3W A;  2DQ3 A;  5B1A C;  4FFM A;  4O4H F;  2Q8V A;  2VR1 A;  4BY7 G;  4LF8 B;  4NKG B;  1YZB A;  3HBL A;  4NZO A;  5DG7 A;  1WN7 A;  1R6K A;  4O7W A;  5EWE A;  4B3R O;  1Q6H A;  1LUV A;  3APQ A;  4JI1 O;  2QEX V;  4ZHQ F;  2FK1 A;  4JI7 H;  4HNV A;  1F7Y A;  4DUY H;  4ECU A;  4ECQ A;  3X2Q C;  3EPI A;  1AJN A;  2ZJT A;  4GKJ B;  1BT8 A;  3ZBH A;  1KKC A;  3VA7 A;  3ABU A;  4IHJ B;  2NVY A;  3G6V A;  2CTR A;  2CNQ A;  3PR5 B;  5IJ0 A;  3CSX A;  2PI5 A;  3MWD A;  3ZHU A;  4IIJ F;  1WPX A;  5JH7 B;  2ZE7 A;  2IW5 A;  2EJR A;  3ORR A;  3E8G A;  2DPJ A;  2QE7 G;  1CP9 A;  3F8N A;  3QVN A;  4R6Z A;  1V54 C;  4D7T A;  4HZ3 A;  3K5L A;  1YCI A;  4X65 H;  3BY6 A;  2H3O A;  4EFE A;  4DR3 H;  5LL6 Y;  2KSW A;  2AGO A;  3TIN A;  5KG3 A;  4MV1 A;  1G4Y B;  2VQF O;  2W6Q A;  4WBN B;  4UVA A;  1BSM A;  1H2N A;  2AHZ A;  3W7S A;  5T14 A;  4O3Q A;  3ETG A;  3QNE A;  1I50 A;  3H4B A;  5L1L A;  3AG3 C;  4KHP O;  5KFR A;  3OTO O;  1ZX3 A;  4G28 B;  3NUA A;  3CXC U;  1BGW A;  3K0D A;  4F6R B;  3SPJ A;  4DRX B;  3APO A;  3MR5 A;  4QJF A;  1KP2 A;  1E4G T;  3RVY A;  4MVS A;  3OE7 G;  3KYH C;  3N6X A;  3P30 A;  4QW8 A;  4JYA O;  5HFL A;  2UXD H;  2IH3 C;  3B8N A;  1I7L A;  3HOV G;  5I5V A;  1CKN B;  1P84 F;  4LFB H;  4KFM A;  4RWU A;  1JKJ B;  4JV1 A;  1AJP A;  1U97 A;  4J41 A;  4J10 A;  3ZMT A;  5DLF A;  4ZHQ A;  4YAJ B;  1Y4M A;  3RB4 A;  3CS5 A;  1MAB G;  4IR9 A;  1XK5 A;  4YJ2 A;  5KHH A;  4DW1 A;  4O4H A;  3QO5 A;  4GKK H;  1K1S A;  4IHJ F;  3MR6 A;  3BJY A;  4DV6 B;  1I2K A;  1KT8 A;  2ZDH A;  1L0N H;  1KQS U;  2LW1 A;  2ASD A;  2PMZ A;  1TUE B;  2V4D A;  1V54 B;  3RVZ A;  3J7A U;  4PZ7 A;  3TXQ A;  2CH7 B;  4DR2 B;  2X0L A;  1OBD A;  1VBH A;  4LF9 B;  1FYJ A;  1VQ9 V;  2UUB H;  1NI8 A;  2WA3 A;  3LNN A;  4K0K O;  4MV8 A;  3RYC B;  4LF9 O;  2R8H A;  1JFF B;  2ASJ A;  3IJ4 A;  2XAG A;  3E8H A;  5CB4 B;  1N32 H;  2COI A;  2V58 A;  2IJJ A;  2EJ7 A;  4X66 O;  2FPG B;  3SE7 A;  1KTA A;  4O2A A;  1RM1 C;  3T5L A;  2Q5Z A;  5IT9 N;  3FDS A;  3E8F A;  3RAX A;  1ZLZ A;  1CEZ A;  4JAS A;  2Z02 A;  2WPD G;  5EYP B;  1E4F T;  1DGS A;  4LFB B;  3ABK C;  1GN4 A;  2BOC C;  2XAS A;  4ABM A;  4CH3 A;  1RSO B;  5KUK A;  2KB1 A;  2X6A A;  3DTF A;  2JIZ G;  1IBK H;  4ED7 A;  3RB0 A;  1R6N A;  3U0G A;  4PEL A;  3GVM A;  3K03 A;  1P7G A;  2YWV A;  2EIY A;  3OHB A;  1EFR G;  1RPR A;  2ZIM A;  5DGI A;  1DF4 A;  2CTW A;  3JCZ A;  3CC7 V;  4J0M A;  3U9S A;  2VA3 A;  3HKZ A;  4FFN A;  5IDJ A;  4X1K B;  5DGB A;  4PDR A;  4DUY O;  1XMQ B;  3QWU A;  3MAQ A;  4YJ2 F;  3K5M A;  3H1J H;  4O7L A;  3M7M X;  1IBM H;  4IRK A;  5HBR B;  3CRR A;  5I5T A;  2EZO A;  4O4J B;  4YXW G;  2BTO A;  3OHA A;  2YXY A;  2NUA B;  1TWA A;  2UXX A;  4ECW A;  3AG2 B;  3R5H A;  4DV0 O;  3ZMV A;  5C4X G;  3GIP A;  4MTG A;  1S0V A;  5CAE B;  2FLN A;  1Y76 A;  3VPC A;  4LFB O;  3A0R A;  2HDK A;  3RJ0 A;  1BCC H;  5CA0 A;  4FS2 A;  1XOU A;  1RM1 B;  4LFC H;  1TVK A;  4RU9 A;  4HBN A;  2KKW A;  3I55 V;  1IVS A;  4O2A F;  2B1I A;  3MWM A;  4X20 B;  4WFH A;  4AIL C;  3J81 N;  3FX7 A;  2M7W A;  5KX5 A;  1F4N A;  3ZRW B;  1UJW B;  1P8L A;  2IH1 C;  4NVP A;  2B63 G;  3BCC H;  5LGT A;  5KT2 A;  2O03 A;  1S5J A;  5KMG B;  3J81 W;  5I5Y A;  2OWO A;  5FPO A;  2QDO A;  2JVD A;  4LF5 H;  3GID A;  4DV6 O;  3JAT B;  4YJ3 F;  3G6E V;  2GV9 A;  4QIW E;  3PW4 A;  2DAA A;  3SPG A;  2FLL A;  5BYA A;  4X88 A;  4EFB A;  1TUB A;  2GUZ A;  3GTP A;  4PA4 A;  1L2Z A;  1NTM H;  1N32 O;  2X6C A;  3RV3 A;  3CRQ A;  2GHY A;  4X65 O;  3RTX A;  2E2H A;  1A3G A;  2P7T C;  2IU3 A;  2ILM A;  3CEI A;  3O9O A;  2Q7E A;  3LP8 A;  3CWB H;  3AX6 A;  4DR6 H;  2X7R B;  4B3S O;  2ARH A;  3OMA B;  1Q82 W;  1DV2 A;  4GT1 A;  3T2M A;  3F5W C;  1W93 A;  4DQN A;  1SKV A;  2W6P A;  5B3S B;  1Y14 B;  3VPD A;  4FLU A;  3AG2 C;  5LOV A;  1NKD A;  4I4T B;  2Y4R A;  2HG5 C;  2ZE6 A;  5DM6 V;  2FKX A;  3ZX6 A;  1TWG A;  3RBE A;  2R8K A;  4PBC A;  4U7O A;  3TQ1 A;  3B09 A;  2XT9 A;  5CE8 A;  4K8Z A;  1ZL8 A;  4QE7 A;  1DTO A;  4JV0 A;  1BZK A;  2FKL A;  2BQU A;  3T5K A;  1JR9 A;  3JAM W;  3H0G G;  5JJE B;  5EIB D;  4DV4 O;  3L75 H;  3JAW B;  4RAZ A;  2Q7G A;  4L8J A;  2DMX A;  2DYR C;  4DUZ O;  2AW9 A;  4TM5 A;  2NU7 B;  4TV8 A;  1OHH G;  4FLW A;  4JI1 B;  1AUX A;  3ZCC A;  1I1K A;  3OUF A;  2PTM A;  4AHC A;  3RYI A;  2F66 C;  1OJH A;  4AQY O;  1GO3 E;  1FFT B;  1PD3 A;  4J42 A;  5HV6 A;  1KKD A;  3JAS A;  5D1O B;  1H2M A;  2ZE5 A;  1XDN A;  3JAL B;  3STL C;  5KG0 A;  4DR4 H;  5KFP A;  2WYO A;  4J11 A;  3BPZ A;  3ETH A;  3QG5 A;  3K9S A;  1NZ6 A;  1KC7 A;  1DLB A;  3IC9 A;  4MTF A;  1AB3 A;  3RIZ A;  5KFJ A;  4CBC A;  1ULZ A;  2HVQ A;  2Q4P A;  2QKS A;  2WLK A;  3GB7 C;  1Q7Y W;  4JI6 O;  3T9F A;  4JUZ A;  3CP1 A;  5B3S C;  4ED1 A;  5L1J A;  4O3R A;  4YJ3 A;  4TWK A;  4DV1 B;  4BIU A;  2R9A A;  5KT5 A;  1KB9 F;  2R7M A;  3T99 A;  2RN9 A;  4FFB B;  1GN2 A;  5C1O A;  4TSF G;  5E79 Z;  4JGS A;  3JRW A;  2YS8 A;  2CZG A;  2I87 A;  3RAQ A;  4IYH A;  1M7J A;  4O2B F;  5JCO C;  2W9B A;  3E2E A;  4O7N A;  1N0N A;  4DR3 O;  1A48 A;  1VQ7 V;  3NGD A;  5EDW A;  5KA6 A;  4IRC A;  4YJ2 B;  3RGZ A;  1SC5 B;  1XHX A;  2V7Q G;  1TWC A;  1XMQ H;  2FTK A;  2NU6 B;  4KHP B;  2EZP A;  4X20 A;  1QR9 A;  2FJZ A;  3MFI A;  2Y48 A;  1YJW V;  1I94 O;  1KEE A;  3E22 A;  1Z5W A;  2OCC B;  4DR4 B;  5JUM A;  2JJ2 G;  4OGQ B;  3OGI B;  4RUF A;  1YI2 V;  1V55 B;  4LSX A;  3GTM A;  4OPH A;  5IYZ A;  1G8M A;  3TW7 A;  4YR3 A;  2JA7 A;  2JA6 A;  3AG7 A;  4HYO A;  4LFA H;  1JA8 A;  5KMG A;  2NLJ C;  3HXL A;  2LFS A;  3T1H B;  1N34 B;  4A3M G;  2RDC A;  2NVX A;  1I7N A;  4MV7 A;  4NXM O;  3KHL A;  2ETN A;  4CH5 A;  1I3Q A;  2LGW A;  4EYH B;  4ECX A;  2GUZ B;  3RFR A;  2UU9 O;  3LSU A;  2R7Z A;  4O2A B;  3GIK A;  2ZXW C;  3UCS C;  4F4Z A;  4NXN H;  1VQK V;  4PI0 A;  4J9K A;  4I7H A;  2W8K A;  2XAF A;  3A2F A;  1QNM A;  4PI2 A;  4MVZ A;  3ZMZ A;  1XNR O;  2GLT A;  3K5H A;  3TQT A;  2PVP A;  1FXK A;  2Q69 A;  4R50 A;  2VQE B;  4O3P A;  5C44 G;  4B3M H;  2WLJ A;  4UUG A;  2QWO B;  5KFA A;  4RNN A;  3KXY T;  4CMD A;  3OT7 A;  1CE8 A;  4YAK B;  3I4M G;  2GPS A;  2YRW A;  3VQV A;  3E86 A;  4DR7 O;  2Y0S A;  1AN7 A;  2W6J G;  2ATL A;  1S97 A;  2QJ1 A;  4O4H B;  4DV2 B;  1A9X A;  4MV3 A;  1BMF G;  1OV9 A;  1B6R A;  2YRX A;  5B1A B;  4O2B A;  4TV9 B;  4WFE A;  4ECY A;  2QM7 A;  2CKZ B;  4GX2 A;  2QWP B;  4R7R A;  2F95 B;  1S5L Z;  3W1G A;  3HKB A;  4TQS A;  3HB3 B;  3AG1 C;  1XL4 A;  4WBN F;  1CQI B;  3ASN B;  2HHH O;  1WJZ A;  3G6Y A;  3N2G A;  3OEE G;  4YIP A;  3PO3 G;  1NTK H;  3SYP A;  4J9R A;  1HR0 H;  4TOI A;  5FNV A;  3LNM B;  5L3C A;  5KG2 A;  3E22 B;  3I5D A;  3G4S V;  3PFF A;  5CB4 A;  1KJ8 A;  1RSO A;  3LSQ A;  1KP3 A;  3ZS8 C;  3OMN B;  4WFF A;  4FBT A;  1G2W A;  4YIO A;  3LQS A;  1PV0 A;  3H01 A;  1XMO B;  1ZAU A;  2ZXW B;  1KJQ A;  3CVZ A;  2ITD C;  3D36 C;  2W8L A;  3G71 V;  1VQN V;  1K8A W;  2PYL A;  1IX9 A;  5C3E G;  5K2M A;  5J2T A;  3SPH A;  2YZN A;  3KG2 A;  5DEC A;  4RQE A;  4BBS G;  3PO2 G;  2DE0 X;  2V4R A;  4GC7 A;  3K79 A;  4BAY A;  1VF6 C;  4CC5 A;  2A1H A;  1OCR B;  4DV2 H;  4NXM B;  4X62 H;  4DV3 H;  3MWE A;  3H1H H;  2V5A A;  1HW7 A;  1AVM A;  1SQF A;  2C35 B;  3V6J A;  3SYA A;  1N48 A;  5B1N A;  4J9Q A;  1M56 B;  4HQ6 A;  1I1L A;  1WSC A;  3FD9 A;  4PHZ A;  1AP5 A;  3QO8 A;  1N36 B;  1GM7 A;  4PJ0 Z;  1CKM A;  1WR2 A;  5JVD F;  4NTY A;  5KG4 A;  3T5J A;  4OXS A;  3GTK A;  4OPA A;  5KFI A;  5FD5 A;  1LNQ A;  2ZIO A;  1IBL B;  4JI0 B;  3N42 B;  4J9Z B;  5BR8 H;  3KTM A;  3BEH A;  3KZI Z;  1BHA A;  5KFU A;  4IWX A;  2X5R A;  2Y4U A;  4OX9 O;  4I9W A;  2NNU A;  2A3Q A;  3BA9 A;  1L1F A;  2AQ4 A;  1R1B A;  3W7T A;  2COG A;  4AYB E;  4A3E G;  2RGV A;  3IN5 A;  5FL7 G;  4QWE A;  2UU9 B;  2FPP B;  4FLZ A;  2A7W A;  1Y76 B;  1JQ0 A;  3OSN A;  4K3A A;  3JAR A;  1QCE A;  1H2S B;  4QNH B;  3DF7 A;  2VQF H;  3EYY A;  4O4I A;  3M4I A;  4QWA A;  2UVR A;  1VQ5 V;  3GIL A;  3WO1 A;  5EIB C;  1N0J A;  3JSL A;  1M90 W;  3T4D A;  1SEI A;  4BIO A;  3E89 A;  3ETJ A;  3SR2 C;  5KFN A;  1OCZ C;  3PZP A;  3NBY B;  3W5O A;  4BW5 A;  4WBN A;  3FYI B;  1IUR A;  1RYS A;  4PZ8 A;  2B9Z A;  1WCM G;  4MV4 A;  1TAE A;  3FB8 C;  1R3I C;  2YI8 A;  1E1R G;  5LMU H;  1NTZ H;  1TA8 A;  1GSA A;  1OCR C;  4PDB A;  1YXB A;  2VOB A;  2IBK A;  5JQG B;  3BA8 A;  4Q0Y A;  4YR2 A;  5FPR A;  2EIK C;  1ARO P;  4GX5 A;  5C8Y F;  3EVK A;  2OTJ V;  3M9M B;  4JV2 A;  4JI6 H;  4UV8 A;  2A79 B;  1DIK A;  2ZDG A;  4FFR A;  2BQ3 A;  4J9Y B;  2E5L B;  4UFZ A;  2BOB C;  5BWV A;  4GYC B;  2R86 A;  4F50 A;  2R92 A;  1NQT A;  1KYO F;  5BWT A;  1H2L A;  3K0G A;  2UUB B;  5D1O A;  3F7Y C;  1UC9 A;  5C5J A;  1BE3 H;  2YIB A;  1N8R W;  4EG0 A;  2VUM A;  3R5X A;  2WA4 A;  4I0X B;  4IRD A;  3A0B Z;  4X62 B;  4JXU A;  5KHG A;  4DV5 H;  1UFI A;  4NXM H;  2HJW A;  4R7C A;  2EUL A;  4Z1M G;  4UXN A;  2X0S A;  2JEG A;  1C3O A;  5DIS C;  5H6R A;  1KUT A;  4J7Z A;  5JVD A;  4ECZ A;  5I60 A;  5JH7 A;  2LJ2 A;  4TVI A;  3KRE A;  1AUV A;  2YC0 A;  1KC8 W;  5CA1 A;  1W0K G;  3RR5 A;  5KAI Z;  2HEP A;  4UCT A;  1Q90 D;  4QGP A;  1PNL A;  3ETE A;  5KHI A;  5KFG A;  4O4I F;  4B7E A;  2R7Z G;  1DF5 A;  5BYB A;  2VRZ A;  1I94 H;  4EEQ A;  1M1K W;  4O3S A;  2GBO A;  4LFC B;  5KG7 A;  1T5E A;  1HNZ H;  2Q9L A;  3JD1 A;  1OZ0 A;  1ZWI C;  4DR5 H;  5IY5 B;  3KAK A;  4K6N A;  3UT5 A;  1BXR A;  3CCE V;  2JRI A;  5DG8 A;  2WTF A;  2LQT A;  4HNT A;  1HNW B;  4IZO A;  1A32 A;  3UQ8 A;  3GWO A;  1Z2O X;  4O7Z A;  5CMU A;  3JD3 A;  1RJQ A;  5KFW A;  1AIL A;  4DUY B;  2EIJ B;  3H9V A;  2B5U A;  3L72 H;  4X1K A;  3U9T A;  3T1Y B;  2O57 A;  4IGG A;  3H20 A;  4GKJ H;  4A3G G;  2KSD A;  3FB5 C;  5C8Y A;  3R66 A;  5CA3 A;  2PY5 A;  4X66 H;  1GMG A;  3QFF A;  2V1D A;  5F2V O;  2IMW P;  2UXN A;  4I0X A;  1JDE A;  5A2Q N;  2VS0 A;  4NTX A;  4F4W A;  4DR4 O;  2V9W A;  3CQZ A;  2MW2 B;  1JPX A;  4UB8 Z;  4QPK A;  4YHH B;  4JV5 O;  4I50 F;  4YQW A;  2QGN A;  1VQ4 V;  3B77 A;  4X1I B;  1VEW A;  3JAR B;  1Q8I A;  1YEW A;  4I7Z B;  4U3J A;  2XHB A;  2HHH B;  3V6K A;  1JCH A;  3JZI A;  2JJ1 G;  1VIB A;  3THO A;  2XND G;  2E5L H;  2A06 H;  3X2Q B;  3T1Y O;  2Q6A A;  1T36 A;  1ZSP A;  2DYS C;  3HOX G;  1PNM A;  5DG9 A;  4DL7 A;  2IU0 A;  1GH6 A;  2KG7 A;  4NB5 A;  1HNX B;  2C00 A;  2WAM A;  4ED8 A;  5EBM C;  2UXC O;  3N2G B;  3NBZ B;  3OW2 U;  2WSS G;  4LP8 A;  2QB5 A;  5E1A C;  3ZHQ A;  1WP7 A;  3TET A;  3V4S A;  5L9X A;  4O7S A;  2FK3 A;  4JAA A;  4F4L A;  2CK3 G;  2VA2 A;  3UZB A;  2WDT A;  2LFR A;  2YZL A;  2UUA H;  3M9O B;  2IM9 A;  4PD4 F;  3HT5 A;  3SDL A;  4JI5 O;  4EB6 A;  5H80 A;  4B3T H;  4QE9 A;  1SET A;  1Q6U A;  3LDE A;  3OM3 B;  3Q4H A;  3WB2 A;  5B5E Z;  5I5X A;  5BR8 O;  3C3T A;  2Q7H A;  2GTS A;  2ADQ B;  1WA8 A;  2BCC H;  1R6T A;  4MS2 A;  3LDC A;  1HDJ A;  1A0I A;  5K3W A;  2P67 A;  1Q3E A;  3QF7 A;  1J5E O;  2Q73 A;  2P5O A;  2ZKO A;  3FAV A;  3ZED A;  5LOV B;  2BTQ B;  1GTO A;  2WB1 A;  1FPO A;  4YHH H;  5KHK A;  1OCO B;  2C2A A;  3FYE B;  4BW9 A;  2FK2 A;  1LR1 A;  4JI1 H;  3TW6 A;  2W9C B;  3W1B A;  4ED0 A;  4O86 A;  2IP4 A;  3OFN G;  4PA7 A;  1QLE C;  3CCV V;  4DR1 B;  2HVJ C;  3T9A A;  3M9N B;  2UXB H;  4DV4 H;  3M99 B;  1K34 A;  2GQR A;  4FJC C;  4TUY F;  4MSW C;  2V59 A;  3RYF B;  5HNE A;  2ZNJ A;  3ZN1 A;  3T5H A;  2DQ0 A;  1EKV A;  3K9A A;  2OCC C;  3PW2 A;  5D8D A;  1MA1 A;  4B3M B;  1HNX H;  4LH7 A;  4DV5 O;  4A3I G;  2NU9 B;  1K1Q A;  1PL4 A;  4HNU A;  2GSM B;  4J9S A;  4LF9 H;  1VF5 B;  4H13 B;  4Q45 A;  2JGD B;  1M57 C;  2XAJ A;  2VQE O;  4UVC A;  2R70 A;  3N6R A;  5KG5 A;  4DV6 H;  5L3F A;  4FU0 A;  5J2U B;  5BMV F;  4Y8V B;  4DR1 O;  3J80 N;  1V55 C;  3B4S A;  4DO2 A;  4NR1 A;  4HYK A;  3UKM A;  2ZM6 B;  4LWS A;  2ZDQ A;  2ATK C;  1E1Q G;  1WB8 A;  1ZTE A;  4NLG A;  3VBB A;  2CTQ A;  4C5C A;  4XDJ A;  3QZ8 A;  4CS4 A;  1A0G A;  5LYJ F;  5IJ0 B;  3RBD A;  1VQ6 V;  4LF8 O;  3JD2 A;  4DR7 H;  1M5I A;  2QSA A;  3LUL A;  2ZM6 H;  4FBU A;  4LF6 H;  4IIJ B;  4JTA B;  1VQO V;  2CAZ C;  2XUM A;  3KCY A;  4L87 A;  2EJ3 A;  4ZQI A;  2WWW A;  4WCE V;  4LWS B;  3HKE A;  4WFB V;  1YJ9 V;  3M8A A;  2HVR A;  2P4K A;  3WG7 C;  1MSD A;  2JA6 G;  5KS8 A;  1RYR A;  3CRA A;  4X65 B;  3JAW A;  2C2R A;  2AU0 A;  4JYB A;  2QR4 A;  2Y69 C;  3GTJ A;  2W6I G;  5D5Q A;  1ZL8 B;  2JEU A;  4DV2 O;  3UM7 A;  4DV1 H;  2D3O W;  3SYQ A;  3EXA A;  3ASN C;  4QIW F;  2IJK A;  4BXX G;  2KG7 B;  4RO2 A;  2V4Q A;  2PZS A;  4MVQ A;  2ZR3 A;  1GSH A;  4DUZ H;  2DOS A;  4Q4D A;  4UCO A;  4DLK A;  1NH2 D;  1US6 A;  3S24 A;  3T1H H;  1IBM B;  4JI4 O;  1XNR H;  4PA9 A;  2R8I A;  1AI7 A;  1FXV A;  2E76 B;  4UCR A;  2VWK A;  3SPC A;  5BMV B;  5J2U F;  3HKC B;  1Y1W A;  1IBM O;  4JI4 B;  2LO1 A;  1IYE A;  1IZ3 A;  3H40 A;  1XL6 A;  4X62 O;  3CCM V;  2HJD A;  4GLW A;  3OUS A;  2QYZ A;  3HKZ E;  2VQF B;  3PVX A;  2JEJ A;  1MSW D;  4EBD A;  5LMN B;  3PJS K;  4GKJ O;  1Z2G A;  4JI0 O;  4Q6G A;  5J9P C;  1NVP D;  4J9P A;  4RZR A;  4HNA A;  4LCU C;  4TT3 G;  1RJP A;  2FE3 A;  1K3E A;  5I47 A;  1S0N A;  3SNO A;  5LGN A;  4LF6 B;  4KHP H;  2ZM6 O;  5BMV A;  4AYB A;  2JS5 A;  5GTH Z;  2YXH A;  3IC7 A;  5LMU O;  2BTQ A;  1K83 A;  1N33 H;  1BQ0 A;  4JV5 H;  3HR0 A;  3K5I A;  4E2L A;  2W9C A;  3DAA A;  1JJ2 U;  1JFF A;  3T54 A;  2CDY A;  3DXR B;  4DR5 O;  4R8U A;  4ETS A;  1IBL H;  3B8M A;  4QJF B;  3HOU G;  1Z2N X;  2AGA A;  1EN6 A;  2EX3 A;  5JVD B;  4D6T H;  5L3B A;  3W7U A;  1MZB A;  4G3I A;  4HAM A;  3R5F A;  1S0O A;  4ASU G;  4DR2 O;  1EM1 A;  2Q2T A;  4LBE C;  1OBG A;  4O4J A;  3FKI A;  3D3Q A;  3KHH A;  4MV6 A;  3K3V A;  4ECT A;  4DR6 B;  3RB3 A;  2XCA A;  1SQQ H;  3RGB A;  3C90 A;  4ECV A;  3CJH A;  3Q2O A;  2D2C B;  1VS0 A;  4MVO A;  5LP6 C;  1QLN A;  1FXK B;  2JDI G;  2N05 A;  2YUA A;  1M0W A;  2XGQ A;  2FB9 A;  1OCZ B;  4LF4 H;  2BQR A;  2CW7 A;  1RK5 A;  2F43 G;  2Y0I A;  3TY8 A;  4QIW A;  1DK1 A;  4DK0 A;  1SFO A;  5J2U A;  5CBH A;  4JZG A;  3ETQ A;  1WAZ A;  4MA5 A;  5KFZ A;  5CN0 A;  3U11 A;  1SYX B;  2PUS A;  3S3X A;  3J7A K;  4JV5 B;  5GON F;  4DV1 O;  4Z2W A;  4O7Y A;  5KFF A;  1EYZ A;  1BL8 A;  2E74 B;  5AG2 A;  1OWT A;  1HP8 A;  4QW9 A;  1YJN V;  3Q8R B;  1QBZ A;  4XBF A;  4H37 A;  1CQJ B;  5KFO A;  1JX4 A;  1VBG A;  4C5B A;  4J9N A;  2DLN A;  4J80 A;  4O4L B;  1BQZ A;  3P3N A;  1HNX O;  4JPR A;  3CCJ V;  2CQY A;  1X59 A;  5KT6 A;  3GQC A;  3T4Z A;  2B1G A;  2EJ0 A;  3B2E E;  5I5W A;  5KFQ A;  1RFY A;  4LNU B;  3L70 H;  4IWY A;  4YY3 B;  3G8C A;  5LMN H;  2PF4 E;  1UC8 A;  2HHF B;  1KEC A;  4UB6 Z;  5IP7 G;  3UZO A;  1YHQ V;  4JYA H;  3CCS V;  5CBF A;  4RUE A;  4B3S H;  2HR3 A;  3AEI A;  4MTD A;  1XI1 A;  3H3V H;  4WFA V;  4DL6 A;  3BFR A;  4DV4 B;  1K5Q A;  1I08 A;  4DR5 B;  2UVV A;  2W57 A;  2PYJ A;  5LA6 B;  5IYZ F;  5LP6 B;  2P06 A;  2YIC A;  1WRV A;  3SJQ C;  1FXK C;  1I5X A;  3A8T A;  2R85 A;  2NN4 A;  4UCU A;  4FFO A;  4M9U A;  3T7A A;  3R9R A;  2FB5 A;  5EOY A;  4CH6 A;  2ZE8 A;  3RYH A;  1GN6 A;  3TGU H;  2ODM A;  4FMT A;  5IE9 A;  3N8D A;  2OIG A;  3H0G A;  3H1L H;  1HNZ O;  2E75 B;  4O83 A;  4Q4C A;  4JAU A;  1KBL A;  2AGQ A;  3G6B A;  5KA5 A;  3RFC A;  3WU2 Z;  5IY5 C;  1VQ8 V;  5EK0 A;  3Q1K A;  3OEH G;  4MW3 A;  5CA0 B;  3V6H A;  2C2E A; 
#chains in the Genus database with same CATH homology
 4GYC B;  4I55 B;  1GYF A;  4U3J B;  4ZHQ A;  2UUB B;  5D1O A;  4K8X A;  3RYH B;  1XK5 A;  4YJ2 A;  2YIB A;  5KHH A;  1Q5O A;  1N32 B;  4O4H A;  1X9N A;  4GKK H;  4O4L A;  4X62 B;  4CH4 A;  5KHG A;  3LML A;  3ICX A;  4DV5 H;  4NXM H;  1FFX B;  4DV6 B;  5JCO A;  1XQ8 A;  4JI2 H;  3BHP A;  5J2T B;  5DIS C;  1O75 A;  2V4D A;  3JAK A;  4DV7 H;  3N2K A;  4PZ7 A;  5JVD A;  4O4I B;  4DR2 B;  5C8Y B;  5IWA B;  3SJB C;  2XIG A;  3RYC A;  5JH7 A;  3SGI A;  2VQE H;  4X64 B;  4LF9 B;  1J5E B;  2HVS A;  2UUB H;  4A2B A;  1TUB B;  5CA1 A;  3LNN A;  3RR5 A;  1V9P A;  2JGU A;  2HEP A;  4UCT A;  3RYC B;  4JI3 B;  1JFF B;  1Q43 A;  1FVI A;  4X1Y B;  4TUY B;  5CB4 B;  2CFM A;  1N32 H;  4CC6 A;  5KHI A;  4O2A A;  4EB6 B;  4MV9 A;  1I94 H;  4EEQ A;  2VUG A;  3IAY A;  5LA6 A;  2RQ6 A;  1TVK B;  2UXC H;  4OX9 B;  2YXL A;  4LFC B;  5EYP B;  1T5E A;  1E4F T;  1HNZ H;  1DGS A;  2UUC B;  4LFB B;  4CH3 A;  5FLX W;  3RGX A;  4UCS A;  4LR3 A;  1XNQ H;  2OYQ A;  4DR3 B;  1IBK H;  1FKA H;  4DR5 H;  3TY5 A;  4GLX A;  3KAK A;  3UT5 A;  1XNR B;  1JMK C;  4LF7 B;  4LMY A;  1HNW B;  4JI4 H;  2ZIM A;  2F4V H;  3UQ8 A;  1I94 B;  2RJZ A;  4J0M A;  1Z2O X;  5GON A;  4X1K B;  4LFA B;  4TV9 A;  5JJN B;  4RB3 C;  4JI8 H;  4DUY B;  3N44 B;  2VPS A;  3N40 P;  1XMQ B;  4X1K A;  3T1Y B;  3FFQ A;  3SJA C;  3QWU A;  3H20 A;  4GKJ H;  3MAQ A;  3L2P A;  4AQY B;  3N2K B;  1D5A A;  5C8Y A;  3K5M A;  2PY5 A;  1B04 A;  4IAJ A;  3M7M X;  4X66 H;  1IBM H;  2MCT A;  5IJ9 A;  2Q0A A;  1ZHS A;  4O4J B;  1WPB A;  3QTC A;  2E3C A;  2BTO A;  4JI3 H;  3K5N A;  4KL1 A;  2VWJ A;  3C0F B;  4YHH B;  4DV0 B;  4FM9 A;  4DV3 B;  1I6U A;  3BAB A;  4X1I B;  3RJ0 A;  1J5E H;  5CA0 A;  3JAR B;  1Q8I A;  1SA0 B;  4I55 A;  4LFC H;  1TVK A;  4U3J A;  1YEW A;  1I7F A;  4ZOL B;  2XHB A;  2HHH B;  4HBN A;  4GKK B;  5IJ9 B;  3THO A;  2KKW A;  2RGR A;  3GDE A;  2E5L H;  3MWM A;  4X20 B;  4JI5 B;  4AIL C;  3J80 W;  4B3T B;  5KX5 A;  2P22 C;  3RF2 A;  1P8L A;  4NVP A;  1HNX B;  1NT2 B;  4LH6 A;  4BWS C;  3HKC A;  2O03 A;  1S5J A;  5KMG B;  4M7E A;  3J81 W;  1S68 A;  3N2G B;  3NBZ B;  4RB2 C;  4TQF A;  2OWO A;  1XHZ A;  5D1P A;  5FPO A;  4LF5 H;  2JVD A;  4ZOL A;  3HKD B;  1FJG H;  3JAT B;  2GV9 A;  3BRC A;  3VQX A;  5LXT A;  4EFB A;  1TUB A;  2YIA A;  5CA1 B;  4DK1 A;  4FM2 A;  3OTO H;  1L2Z A;  4B08 A;  4IHJ A;  2WDT A;  5LL6 b;  4DRX A;  1O9G A;  2PGG A;  3RTX A;  2UUA H;  2IM9 A;  4EB6 A;  4B3T H;  2Q7E A;  3WB2 A;  1CKO A;  1X4T A;  4DR6 H;  3CB2 A;  1XNQ B;  1HR0 B;  2Q7H A;  1N33 B;  4X66 B;  2Q2U A;  3NC0 B;  1SKV A;  3KAJ A;  4DUZ B;  1A0I A;  4FLU A;  5LOV A;  1Q3E A;  4I4T B;  3QF7 A;  4FVM A;  2P5O A;  3ZED A;  4B3R H;  5LOV B;  2BTQ B;  4YHH H;  5KHK A;  4DV0 H;  4JI1 H;  1P49 A;  4BW9 A;  4FM1 A;  4B3S B;  3W1B A;  4ZI7 B;  4TQD A;  4K8Z A;  3T1Y H;  4DR1 B;  4UCV A;  4DRF A;  2UXB H;  4DV4 H;  3JAL A;  4JI0 H;  3JAM W;  1L8D A;  4F6R A;  5JJE B;  5EIB D;  3RYF B;  2ZNJ A;  3JAW B;  5ITZ B;  4RAZ A;  2Q7G A;  4L8J A;  3JSN A;  4CS3 A;  3TY9 A;  4B3M B;  3U0Z A;  4TV8 A;  4FLW A;  4DV5 B;  4JI1 B;  5D5P A;  1HNX H;  4LH7 A;  1IBK B;  4B3R B;  1ZHQ A;  2PTM A;  4FLT A;  4AHC A;  4RB1 A;  3RYI A;  2UU9 H;  2F66 C;  2WE6 A;  4YJ3 B;  3JAS A;  5D1O B;  1XDN A;  1HNZ B;  3JAL B;  2F1M A;  4X64 H;  4LF9 H;  4DR4 H;  4X1I A;  5EYP A;  3FMA A;  2WYO A;  3WB0 A;  2QM4 A;  3BPZ A;  3QG5 A;  2R70 A;  5FD6 A;  5KHJ A;  5LXT B;  3GJX B;  1KU9 A;  4DV6 H;  5J2U B;  3K5O A;  4JI2 B;  3RIZ A;  2YI9 A;  1N36 H;  1QQC A;  5EZY A;  2ZM6 B;  2HVQ A;  1M0T A;  3K58 A;  1JJO A;  5K1P A;  4DR7 B;  4DR2 H;  1KMI Z;  4LNU A;  4YJ3 A;  4D7S A;  4CS4 A;  4DV1 B;  4JI5 H;  2R9A A;  5IJ0 B;  2F93 B;  4FFB B;  4MTE A;  4DR7 H;  1M5I A;  4ZIB A;  1FJG B;  2ZM6 H;  4LF6 H;  3HKE B;  4IIJ B;  2ZIN A;  2CAZ C;  1M93 A;  4JI6 B;  3U10 A;  3HKE A;  4IIJ A;  5JCO C;  2HVR A;  4LF5 B;  3RYF A;  2HHH H;  4X65 B;  3JAW A;  5ITZ A;  3KAL A;  4YJ2 B;  3RGZ A;  1XHX A;  5D5Q A;  1Z5V A;  1XMQ H;  2UXD B;  4KHP B;  4X20 A;  1Z2P X;  4O2B B;  5FNV B;  5IYZ B;  3E22 A;  4NXN B;  1Z5W A;  4DV1 H;  4DR4 B;  3RYI B;  1SQG A;  4LSX A;  2YIB D;  1SA0 A;  5IYZ A;  4AQY H;  3JAK B;  1WH2 A;  4CS2 A;  2PZS A;  4I4T A;  4LFA H;  5KMG A;  3HXL A;  3VNN A;  1N34 B;  5JQG A;  3T1H B;  4K0K B;  5A2Q W;  2HIV A;  4OX9 H;  4DUZ H;  4MV7 A;  3BAA A;  4FLV A;  3DSQ A;  4CH5 A;  3JAT A;  4UCO A;  4I9Q A;  1G6U A;  4DR1 H;  4PZ6 A;  4RAY A;  3RFR A;  2UXB B;  3S24 A;  3T1H H;  4O2A B;  1IBM B;  1XNR H;  4UCR A;  4NXN H;  2VWK A;  1VF7 A;  4PI0 A;  5BMV B;  3HKC B;  2HIX A;  4JI4 B;  4I7H A;  3A2F A;  4PI2 A;  4FLY A;  4BWA A;  3VQW A;  3L4J A;  4YY3 H;  2F4V B;  3L4K A;  2VQF B;  3WB1 A;  2VQE B;  4B3M H;  4JYA B;  5LMN B;  1N34 H;  3KXY T;  4Q6G A;  4HNA A;  5LYJ B;  3VQV A;  4ZHQ B;  4E6N A;  2FE3 A;  3UT5 B;  3OTF A;  1QHT A;  4I50 B;  4LF6 B;  1AN7 A;  4KHP H;  5BMV A;  2JS5 A;  2BTQ A;  2QJ1 A;  4O4H B;  4DV2 B;  4LF8 H;  1HNW H;  1N33 H;  4JV5 H;  4O2B A;  4TV9 B;  1XMO H;  3K57 A;  1JFF A;  5KX5 B;  4R7R A;  4ETS A;  2F95 B;  3W1G A;  1IBL H;  4LF4 B;  3GB8 B;  3HKB A;  3OTO B;  1Z2N X;  4JI7 B;  2EX3 A;  5JVD B;  4LSA A;  5EZY B;  1MZB A;  5IT9 W;  2ZNI A;  5IWA H;  2HGS A;  2Q2T A;  3N2G A;  3N41 B;  4O4J A;  3K3V A;  1HR0 H;  4TOI A;  5FNV A;  3E22 B;  4DR6 B;  4X1Y A;  4TUY A;  5CB4 A;  1RSO A;  3RGB A;  3ZS8 C;  4FFB A;  5JJJ B;  1TGO A;  3N43 B;  1S03 G;  1VS0 A;  1XMO B;  5LP6 C;  1ZAU A;  3CVZ A;  1M0W A;  1FFX A;  4LF4 H;  5K1X A;  2CW7 A;  3SJC C;  2PYL A;  4TV8 B;  3TY8 A;  4DK0 A;  5J2T A;  5J2U A;  3ETQ A;  2ZCE A;  4HNA B;  2CW8 A;  3U11 A;  1SYX B;  4CC5 A;  2PUS A;  4LF8 B;  4NXM B;  4X62 H;  4DV2 H;  4DV3 H;  3J7A K;  2YCH A;  4JV5 B;  1HW7 A;  1SQF A;  2R72 A;  1WN7 A;  4PHZ A;  1N36 B;  1CKM A;  4JI7 H;  4ZI7 A;  1CKN A;  4DUY H;  5FD5 A;  2ZIO A;  4O4L B;  5LYJ A;  1IBL B;  4RB0 A;  4JI0 B;  3K59 A;  3N42 B;  2ZJT A;  5BR8 H;  4GKJ B;  4A2A A;  3B2E E;  4LNU B;  4IHJ B;  4YY3 B;  5LMN H;  5IJ0 A;  3CSX A;  4EQ5 A;  3BA9 A;  5JH7 B;  4LF7 H;  4JYA H;  5LMU B;  2RGV A;  4B3S H;  2UU9 B;  4MTD A;  3F8N A;  4FLZ A;  4D7T A;  1M4U A;  3K5L A;  1XI1 A;  3VQY A;  4JI8 B;  1WNS A;  4FLX A;  3JAR A;  4X65 H;  3JAS B;  4EFE A;  4DV4 B;  4DR3 H;  1H2S B;  3DF7 A;  2VQF H;  2KSW A;  4O4I A;  3EYY A;  4DR5 B;  3M4I A;  1O9H A;  2W57 A;  2PYJ A;  3CHX A;  5EIB C;  5LA6 B;  5BR8 B;  4WBN B;  5LP6 B;  3JSL A;  4I50 A;  4FM0 A;  1SEI A;  3RWR D;  3HKD A;  3SR2 C;  1BJT A;  3NBY B;  3W5O A;  4UCU A;  4WBN A;  5LP6 A;  4PZ8 A;  5EOY A;  4CH6 A;  1TAE A;  2YI8 A;  3PN1 A;  3RYH A;  4APM A;  5LMU H;  1TA8 A;  1BGW A;  4F6R B;  4K0K H;  4DRX B;  3HKB B;  4PDB A;  1E4G T;  2VOB A;  3KYH C;  5JQG B;  3BA8 A;  3N6X A;  4Q0Y A;  5FPR A;  3IG0 A;  2UUA B;  2UXD H;  1P16 A;  1CKN B;  2UUC H;  4LFB H;  4RZQ A;  5GON B;  4JI6 H;  5CA0 B;  2UXC B;  4DV7 B;  2E5L B;  4UFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...