4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
b'PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
5FPRA 1VS0A 3RTXA 3GDEA 3JSLA 1ZAUA 1XDNA 3BABA 1XMOB 4DV2B 3RR5A 4NXMB 4UCSA 4LH7A 2E5LB 4JI1B 2HIVA 3NBYB 1HNZB 4LFCB 4PZ7A 4UCOA 5LMUB 2HVRA 1CKMA 3T1YB 3JSNA 5FPOA 4UCVA 4B3SB 4LF6B 4DR4B 1IBMB 2UUBB 4JI6B 4CC5A 4JI8B 4JV5B 1FVIA 2UXDB 1DGSA 1P8LA 1J5EB 4X64B 4AQYB 2UUCB 4LH6A 3TY8A 4CC6A 1P16A 5D1PA 1IBKB 4UCTA 3BA9A 2HVSA 3KYHC 1V9PA 4PZ8A 3OTOB 4JI0B 4EFBA 3QWUA 4YY3B 1B04A 3BA8A 3S24A 4X65B 1XK5A 4GKJB 2CFMA 3W1GA 4DR7B 4UFZA 1TA8A 4DV7B 4DR1B 1FJGB 4EEQA 4GLXA 3T1HB 2Q2TA 4EFEA 2UXBB 2HIXA 4B3TB 3VNNA 4UCUA 5BR8B 4DV5B 4NXNB 1XNQB 3NC0B 4LF7B 4YHHB 2VQEB 2VQFB 1N34B 4DR6B 4DV6B 1CKNB 3PN1A 4K0KB 4LF9B 4DV1B 4JI2B 1XNRB 4LFAB 4DR2B 4X62B 4LF8B 3GB8B 1TAEA 3TY9A 4DR5B 1IBLB 2F4VB 3W5OA 1N33B 1N36B 1XMQB 1HNXB 4JI4B 2UU9B 4LF5B 1S68A 4GKKB 2Q2UA 2UUAB 2OWOA 4JI3B 4KHPB 4JI5B 4X66B 1HNWB 4E6NA 2ZM6B 4JYAB 2VUGA 1A0IA 1N32B 2UXCB 3TY5A 3W1BA 3SGIA 3BAAA 2HHHB 4B3RB 4LFBB 1CKOA 1CKNA 4DRFA 3L2PA 4UCRA 5D1OB 4B3MB 4DUYB 5D1OA 4TOIA 5IWAB 4DV0B 4EQ5A 1I94B 5LMNB 4DV4B 3UQ8A 1HR0B 3GJXB 5DISC 4LF4B 1X9NA 4DV3B 4DR3B 4JI7B 4PZ6A 4OX9B 2HVQA 3NBZB 4DUZB
chains in the Genus database with same CATH superfamily
4LFCO 4ME6A 4KXRA 4ZKIA 2FPIB 2GTAA 3BPZA 4I55F 2AHYA 4GKJH 4LH7A 3CJHA 2PYJA 1KP2A 3G6BA 1QBZA 3GLKA 2B63A 4UUGA 2W9BA 1BHBA 3R5HA 1I7NA 1Y76B 4AYBA 2JA6G 3FKSG 2JDIG 3K9AA 5KFOA 4MV9A 1IBKO 4CC5A 1KKDA 1G2WA 5BR8H 1AJNA 2NU9B 1YTFD 2X6CA 1FXHA 1PP9H 2JGDB 4JI0O 4JI2O 4HNTA 3RBZA 3APQA 4AQYB 1AI5A 4LH6A 1I50A 3JAMW 2A3QA 4X62H 2Q7GA 1S5HC 3RBDA 4YBZB 1XUQA 2ZT9B 1HDJA 2A7WA 2ATLA 2QM8A 2C2EA 2M6YA 3M9OB 2IH3C 4B7KA 3RJ0A 1XK5A 3OTFA 4GKJB 1NT2B 5EC2C 3RBEA 4B3TO 4HYOA 3QO7A 3PR5B 4PJ0Z 3D8CA 4EGQA 1FJGB 4O2BF 1FXKB 5IE9A 5KX5A 2NVXA 3K03A 5EWFA 4J42A 1Y1WG 1VARA 4DUYH 2K9PA 5BR8B 5I5WA 1B3QA 1MSDA 3CP1A 5HFMA 4LF8O 4YIPA 1E4EA 2CNQA 1WRVA 4LF4H 2EX3A 1I1KA 1HNXO 3JARA 4O4LA 1R3KC 4BWSC 1YEWA 1WPBA 1VQMV 4X62B 2HFEC 4YAJB 2L6LA 4O4JA 3R5FA 1VEWA 2ZE5A 5JCOC 1N48A 3ZHSA 3KAJA 4CKEA 2LW7A 5DN6G 4E4TA 2E5LO 4YJ3A 5JQWA 2EIJB 1N8RW 1R9TA 1E79G 2YEVA 2RN9A 4PA3A 2OWOA 4LFBO 2QEXV 2NU8B 5LYJB 4BW9A 3E8FA 2EILC 2P06A 3LNMB 3N2KA 3RYIB 1KT8A 3KHLA 4B3SH 4DR4H 3JD1A 4U3JA 4MTEA 3GIDA 3ZHVA 2LO1A 4JV5H 4Q20A 5KFLA 1FXKC 4DUYB 2WDTA 2Q6AA 3H20A 4I7ZB 3CMAV 2IJKA 1YJ9V 1TWGA 3GV7B 1HWYA 4LF4B 2DZDA 1Q43A 1H2KA 2COJA 3HO8A 4C5BA 4F4YA 5LHIA 3FD9A 2Q0OC 1F7YA 4GX5A 3HKZA 3CC4V 2OCHA 3TW7A 1A0GA 5KG6A 4I7HA 3CJHB 4GCZA 4DR7H 1KP3A 3AK1A 3DGEA 1K34A 4ZOLA 2JK5C 2XD4A 3F7YC 3ZMUA 4B3SB 4QIWA 4A3JG 3SDLA 4DR4B 1S77D 3K08A 5EYPA 1SYXB 4Q4CA 2ZD9A 5FR9A 4A3BG 4HN2A 2XASA 1DLBA 1N32H 3L70H 3U10A 1CPYA 4JV5B 5KS8A 1SQXH 3RYFA 1GSAA 3AK2A 5DQGA 3AYHB 4K0KO 4YB8B 3ML0A 4FLVA 2OH2A 3UO2A 2DABA 2W0FC 1MNGA 4MVOA 2BCCH 1FS0G 2FPGB 1AI6A 4ED0A 1S0MA 3OEEG 2R85A 1IBLH 2HP8A 5AG2A 1I2LA 4C5CA 4JI7H 2Y0PA 1GO3E 3CSXA 5LL6Y 3NR7A 4JF3A 4JTCB 1RYSA 4QJFA 3Q8PB 1SQQH 2DE0X 1PM9A 4BAYA 4DR7B 2RF4A 2HJDA 3IN5A 2COIA 2X0SA 2QKAA 4GYCB 4RZQA 1OBGA 3UZBA 5LXTA 1QR9A 1PNLA 1N34O 4FS1A 3TJTA 3FKIG 4GLXA 4J80A 1NBMG 2WYOA 4DV1O 1EKVA 3HKDB 3MWMA 5KKNB 1XREA 1I94H 5KFXA 4O3OA 2ILMA 1E4EB 1JQ0A 1F51A 5IYZA 4YXWG 1XMQO 3JARB 3CD6V 4QIWE 4OX9H 3W7XA 1QNMA 2VS0A 1LNQA 4O4JB 1IBLB 3D36C 1WB7A 1FYJA 2W6IG 3BFRA 1VQKV 4JYAO 1SQFA 4JV2A 3ZRXA 4YJ3B 2K1EA 5IP7G 3RB0A 3ZHQA 1AUVA 5LMUO 1XL4A 3N2KB 1E4GT 2B1IA 2ZE7A 4CMDA 3LSQA 1T36A 3ZMSA 2Q7HA 2R7ZG 3EVKA 4QWEA 4U3JB 5EWGA 5B3SB 3ZRWB 4JI8H 2YRWA 3CB2A 5JQGA 1PKXA 1S5LZ 3K3VA 4RAZA 4J7KA 4EQ5A 4TQDA 1I94B 1I7FA 3G8DA 4X64H 3HOVG 2XOKG 4EGJA 2X7RB 1KKCA 4ZI7A 2ZKOA 2WB1E 4QWBA 1XILA 4OX9B 1AN7A 3NBZB 1GRJA 2OTLV 2HEPA 3FMAA 3WNZA 5BY1A 2JA7A 3SJBC 3JAWA 3MHSC 2B5UA 3B8NA 3RB6A 5BYAA 3T5JA 4DIMA 4FLZA 5GTIZ 1M0WA 4J9MA 1R3LC 2QYZA 2IBZH 4ZOLB 2WLNA 3JATA 3PO2G 4JAVA 3W7SA 5EYPB 4H13B 4IYHA 2HGSA 1VF5B 4JI8B 4CH5A 1OCRB 5KFGA 1M9NA 3RYFB 5B3SC 4DK0A 5IT9N 2QWNB 4Q6GA 4X64B 4PBCA 2PZSA 3Q1KA 3L9DA 4IT5A 4ECTA 3V4ZA 3VOUA 3HB9A 2FK3A 1GYFA 5KHGA 1Z2GA 1G1XB 3AW8A 4RNMA 1GGOA 4A3GG 4DR3H 5KG1A 5F2VO 1X4TA 3OT7A 4LNUA 1SFOA 2YYAA 2N05A 3BG5A 2UU9H 4J9QA 3GTLA 3WU2Z 4GKKH 4I50A 1O9HA 3CVZA 3T5LA 4PHZA 5JJJB 4XZ3B 1SC5B 4NXNO 2WLKA 4WFFA 4O81A 3PW4A 5IYDG 2YS7A 5LXTB 3MHHC 4DW1A 4DR6O 4O2AA 2YS6A 5JVLA 5B5EZ 1SS3A 1W0KG 2WAMA 5C1OA 3GB7C 4YP3A 2GDSA 3S3XA 5IWAH 4DV5B 5DG7A 1OCOC 1XNQB 2Y69C 3HOYG 5LMNH 3AG2C 2IP4A 5FNVA 4DRXB 5IYZB 4DR5O 3VOTA 1W2BU 3PO3G 2UVVA 2EIMB 1I3QA 4I9WA 2ARHA 1EZ1A 4PELA 4JZGA 3LUTB 3FB7C 4HR7A 2OTJV 3P3NA 1EFRG 4FK5C 1WR2A 2Y0IA 2UU9B 1IZ3A 2W0XA 4GKKB 3ZRVA 1MZBA 2JA5G 4D7TA 4LFCH 4JAAA 2YCHA 4OXSA 5KFRA 3DXRA 2HJFC 5EK0A 1V4YA 4K6NA 1JKJB 4LSAA 4U7CA 2VWKA 1IBMO 3WG7C 3HOUG 4NR1A 3WWIA 4O3RA 5ITZB 3L2PA 4NZNA 5JQGB 2PY5A 5IWAB 4MW8A 4Q44A 4P2ZA 2HHFA 5LMNB 3GJXB 1A9XA 3K06A 2WLLB 1IBKH 5J2UA 4DV2O 2WAQA 4ZI7B 4YJ2A 5KG7A 5KFTA 3DC5A 4GC6A 4ED2A 4JI0H 5BWTA 1RPRA 1Z2OX 3QTCA 4DXWA 4WBNF 3JAWB 3JASB 1YVWA 1KECA 2DQ0A 1WPXA 3KCYA 1EZVH 5IJ0A 1Q81W 2C2RA 1PPJH 4LFCB 4EYIB 4PZ7A 4FS2A 3JATB 1R73A 1ENVA 3ETEA 2ZE8A 3ABUA 5KHJA 5CB4A 4WF9V 4B3TH 2FPPB 3OFNG 1RPOA 3AG3C 4ECQA 4DK1A 1Y67A 2UXNA 3DSQA 2VOBA 3IFXA 1P16A 1IBKB 1DF5A 3EPIA 5LBQA 5DAAA 1TVKB 4LF8H 4RB0A 1YJWV 1PL4A 1TWCA 4JI0B 1WLEA 1HNXH 2ZDHA 3HKEA 4RQEA 1V55B 3WB0A 5I5UA 5JWPA 2W6QA 1JMKC 4LF5H 3NGDA 4N23A 4I50B 5KG2A 4H0LB 2WAQE 2CNVA 1W0JG 2EZOA 1M90W 1KTAA 2IA6A 2E5LH 2C35B 1KEEA 1OJHA 5IJ9A 4LFBH 4O2AB 4FLXA 1M6VA 1Y14B 4B3TB 5CA1A 2V58A 3RF2A 4LC1A 1IX9A 4WD3A 5FNVB 2R92G 4BBRG 3PN1A 1F23A 3E22A 1HP8A 2P4KA 1QVGU 4O7WA 1K1SA 1PX2A 4LF8B 1I5YA 4LWSA 4O86A 1Y74A 4KFMA 1BE3H 3H1IH 1HNXB 2QWPB 5BWXA 4R8UA 2LFSA 4J9LA 1FPOA 3JAKA 4LF5B 1XOUA 4F6RA 2Q2UA 1V55C 4IIJF 4FFKA 5EZYB 1VF6A 5BWWA 3DXRB 4LF6O 4O7TA 3OSNA 2AZ2A 4LFBB 3APOA 3OE7G 3DC6A 4YIOA 1WAZA 5K3WA 4DW0A 2HHFB 2Z04A 4BIZA 1K9MW 4FBUA 2E3CA 3AX6A 4TV9A 4CBCA 2JEUA 5C8YF 5J2UB 1IOWA 3KXYT 2XT9A 4YJ2B 1RYRA 4K0KH 2A1HA 3RGXA 2W7PA 3ETHA 4FFOA 4C7UA 5KFQA 3GILA 2CTWA 5A2QN 4I4TA 1GN6A 3JZFA 1K3EA 1Z2PX 2W6JG 2EJ7A 5EWEA 4A3CG 2F66C 3T5HA 5DMXA 1P7BA 4MVRA 4O3QA 1JR9A 1GMGA 4FIPC 5I5YA 1B6RA 2UVUA 1JDBB 3OR7C 4UV8A 2CTRA 1G8MA 4P9PA 3FYEB 1VQ9V 1QLNA 5CB4B 5KT5A 1GM7A 4R7CA 4EEYA 3KTMA 4K8XA 4APMA 1NH2B 1N34H 1AI7A 2V9WA 4DV1H 1XI1A 1H38A 3CC2V 4NB5A 3TY8A 1H2LA 5CA0F 3LDEA 4UCTA 4JGSA 4QW9A 5H80A 5IDJA 1I2KA 1NQTA 3JALB 2Q4PA 3MDSA 1XMQH 3HKEB 3E2EA 1TUEB 1SEIA 1BGWA 4CS2A 4W4LA 1Y76A 3D3IA 2UXBO 1X59A 1AR4A 4JYAH 1YTFB 4IHJF 2BE3A 3ABLB 2CW7A 5IJ9B 4PDVA 2QKCA 5B66Z 4ZHQB 3I12A 5B1AC 1AI4A 4W4KA 5DGIA 3L73H 5CA1B 3G6YA 2DPIA 3BQ0A 3KHHA 4RB1A 2YUAA 3W7WA 1HR0H 4X88A 1N34B 2QGNA 3E22B 4DV1B 2YIAA 4JI4O 3PFFA 3UO3A 2DIKA 3T54A 4J9YB 2HDKA 2GBOA 4ED6A 4LWSB 3R9RA 1IDSA 3W5OA 3RV3A 4R8UB 2F93B 2R87A 1XMQB 5A9GA 4GLWA 2ZXWC 2IJIA 3R23A 4HNUA 1WJZA 1Q82W 3JAKB 2HHHO 4F6RB 5I60A 4RUFA 2IM9A 2OYQA 3T7AA 2FJZA 2IMWP 3G67A 4I5SA 1SQPH 3CPWU 4E6NA 2KQXA 3CXHF 2QK4A 4JYAB 4RZRA 1K8AW 1YHQV 2EJ3A 1JX9A 4BR6A 1HW7A 4U7NA 1YJNV 3TQ1A 1IYDA 3ABLC 4UCRA 3H1KH 1UPGA 2CUGA 4DUZO 4IWXA 4DQNA 4MW3A 2UUCO 5KG3A 5HNEA 1HR0B 4TV9B 3OM3B 1AJPA 4ECZA 1Z5VA 3RGZA 1MOFA 2W6ZA 1VP7A 2FYUH 2J6TA 3G71V 4O2BA 5LP6A 5C3EG 4I4TB 4D7SA 3BABA 3AG1B 1TUBB 2WWWA 4I9QA 2OIGA 2VA2A 2JA6A 3HOZG 5KFNA 4JI6O 1BL8A 1L1FA 3LDCA 4AHCA 3U9TA 1ROPA 3W7TA 3TIGA 1VF6C 1J5EO 4G2KA 4TV8F 3ZMTA 1RJRA 1W59A 1MZEA 3M7MX 3TINA 3QO8A 1NU1H 4NXNH 2VQFO 3RFCA 4Q8EA 2YC0A 3TCUA 4DR6H 3H1JH 5KFJA 5JVDF 3K79A 4UUJC 4X1YA 1VQNV 1O75A 1MG1A 3OW2U 5IYDO 1VKZA 2DAAA 4G28B 3LDDA 3SPHA 1VBHA 4DR5H 3G6XA 4H44B 3LMLA 1E1QG 2CW8A 1N36H 3OD4A 3OMAB 1AR5A 4J10A 1Y1WA 4WCEV 1EBOA 2JRIA 1AJQA 4FLWA 2Q9LA 4JXUA 4E2LA 1CXZB 1XBLA 2Q2TA 1MABG 1DTOA 3EXAA 3R5XA 2ZDGA 1ZLZA 2W6MA 5L3FA 4NXNB 3LP8A 1NTZH 2R6FA 4DR6B 5E79Z 1M5IA 4NTXA 2QDOA 3Q8SB 4BIOA 2LW1A 4JZ2A 4Z1MG 1W93A 1D2DA 1AR1B 3JCZA 2XTAA 3WWHA 4DR5B 1C30A 4YR0A 2BQRA 3AG7A 4M7EA 1HNWO 4DV2H 3SPIA 1N36B 4AILC 2F1MA 5L9XA 2W8KA 2QA4V 2HGXA 4B3RO 3FAVB 3RGBA 3TK1A 4CS4A 5TISZ 4L1KA 3SYAA 2CE4A 3T1YO 3EHBB 3HKDA 2VUGA 1B06A 1S5JA 2JJ2G 4J0MA 2HJWA 3TY5A 3A8TA 3K5LA 5K2MA 1QLEB 1RFYA 4FM0A 3E8GA 4GC7A 4IL6Z 2A79B 2AGAA 1V51A 4TQSA 4AYBE 4MV8A 3FYIB 1VQ8V 1I08A 4ECUA 3GTMA 2R82A 1XMOO 1TGOA 5JH7F 4NXMO 1JDEA 5KFCA 1GN3A 3JD0A 5LYJF 2QR4A 1CS0A 5FPRA 5HV6A 1ORQC 4O2BB 5LP6B 5E1AC 4DL2A 2B1GA 3Q8RB 4PDBA 3N44B 4DV2B 4UCSA 4EB6A 2ZDQA 3L72H 3MAQA 5KG0A 1WCMG 5KUKA 2CKZB 2DYSB 4BY1G 1URFA 3K5OA 3ZRWA 4MT8A 5KFUA 1CKMA 1K4DC 3CWBH 1S0NA 1JLLB 4J9SA 5BYBA 2A06H 1YITV 5DLGA 3PW5A 1QLEC 2EJ0A 4FLYA 4TT3G 3CEBA 4MA5A 3H1LH 5KG4A 4DV6O 1IXMA 4MTGA 5FLXW 4X1YB 2AZ0A 3Q4HA 2GLTA 1KMIZ 3RYHB 2LFRA 4OGQB 5D1PA 4YY3O 3OR6C 3T9EA 3H01A 5L1LA 4A3EG 2HVSA 2R72A 3C3TA 1GLVA 2GQRA 4A3FG 1KYOF 4GX1A 3T99A 3QWUA 5B1BB 5BMVA 2EIJC 5CBGA 2R8HA 2ZGIA 5LP6C 2IH1C 3RV4A 2UUAH 3FKIA 4FFBB 1JCHA 2YZLA 3K3PA 2BTOA 4UVCA 1KUTA 3P30A 3U54A 4RUCA 2Z0AA 4L87A 4KUMA 2GTSA 2VQEO 4HBNA 1I6UA 4QPKA 2FLLA 4JV0A 2V7QG 4PI0A 5FL7G 1MMMA 4LF6H 4LMYA 4YAKB 2Q73A 1NI8A 2Q69A 2R8IA 2PYLA 4UXNA 1RM1B 3AG4B 5KFSA 3RFRA 4JI3O 3OUSA 3ZMZA 4KHPO 3TY9A 1AUXA 3UYYA 5J9PC 3CRCA 4FFPA 5LOVF 1AP6A 2BOCC 1JOYA 5KFZA 2CTPA 1TWFA 5KX5F 1S03G 2UXCO 2XAHA 2R7ZA 2ASLA 2UUAB 1B6QA 1ZUQA 4TVIA 1J95A 1SF9A 3HKZE 1TWAA 4FBTA 1P84F 3WB2A 4B3MO 2NUAB 5KFDA 1DAAA 1A0IA 1N32B 2JVDA 1SQGA 3CCQV 3SGIA 4O4LF 4DLKA 4DRXA 2PI4A 3IG0A 2QWRB 2YU9A 1SQBH 4O7NA 4QE9A 4DV3O 4DRFA 4EBEA 4PWQA 4R50A 2E74B 3DF7A 5CR5A 1KJQA 4FM9A 2I80A 2C22A 3ICXA 4YJ3F 3WWJA 5DISC 4JUZA 2Z5UA 4JI7B 1KU9A 4FFNA 4GT1A 5K1XA 1WP7A 3VQWA 1VQ6V 4A2AA 3GDEA 2ZIMA 4DO2A 4RWUA 1ZHSA 1KBLA 5T14A 2XNDG 3SYCA 3CCEV 4EB6B 1S76D 5L1IA 2N04A 1GO3F 5BXZA 4DV7O 3HR0A 3VBBA 1AVMA 1NVPD 2R70A 2CNUA 1FKAO 3U0GA 5ITZA 4XDKA 3LNNA 3MR3A 2UXBH 2P6JA 3L4JA 2E75B 2WLLA 1PL0A 3IAYA 3OTOO 3Q4HB 3OHBA 5E25A 5GTHZ 1ZHQA 3OSPA 3GIJA 4NYKA 4GZRB 3JASA 1DF4A 1Q6IA 3MFHA 4ZOLF 2J6SA 4MTOA 5I5XA 2R8KA 2CZGA 1YZBA 5BMVB 2OCCB 3H4BA 4JI4H 4DR1O 2CGNA 3TIIA 4X20A 2CFMA 3GTGA 4X66O 2DJVA 4IRCA 5LL6b 1MA1A 2WLIB 1V54B 3GTOA 2H3OA 3KALA 1SA0A 5KA6A 2Z3YA 2HHHH 4E4EA 1DV2A 4PA7A 1COWG 3N42B 4EFEA 2UXBB 3ORQA 4G3IA 2PVPA 4CE5A 1OWTA 1N56A 5EIBD 4WBNA 5J2TF 1TVKA 3C0FB 2XC9A 4RB3C 2FK1A 4A3LG 3CRQA 1NTMH 2OLSA 2PGGA 1GTOA 4RNOA 1PD3A 2WSSG 4DL5A 4DUZH 5KAIZ 2JA5A 1Y1VG 3N41B 4KL1A 3MWDA 1E1RG 2W9CA 4Q4DA 4WFBV 2YIBD 1JFFA 4QPJA 4JI4B 1ET0A 3H9VA 4CZZA 2OCCC 5I5TA 2YXHA 3EPGA 4TUYA 3B40A 5IYZF 4MA0A 1P49A 3VMMA 5BPFA 1PV0A 3GVMA 4ZQIA 2HHHB 2C28A 4Y8VB 4JI6H 1WB8A 1OCRC 1NKDA 2JGUA 1THZA 4CH6A 3VQYA 1IVSA 2VA3A 2ZIOA 4TOIA 3DTGA 3OUUA 1F4MA 1CEZA 1J5EH 2DW4A 3E8HA 1QU7A 3H1HH 3UQ8A 4AQYO 1QVFU 2YICA 3STLC 3QZ8A 2ATKC 2WPDG 3SJCC 2JEJA 1R6NA 4DR3B 3ASOB 2QKSA 2JEGA 4DUZB 4BIUA 3N8DA 3JCUZ 4EBDA 1HNZO 2YSUB 2VR1A 5EZYA 1ZAUA 3QZ7A 3RR5A 1DK1A 4HNVA 4GKJO 1K92A 4HNAA 1NR7A 2AXTZ 5JQGF 5CA3A 3JZIA 4PA4A 5KMGA 5KHIA 1KC7A 2RGVA 1FJGO 3BHPA 3K3WA 3T1CA 5IY5B 5CAEB 5D5PA 4MV6A 3WB1A 3ZHRA 5KLVH 5L3DA 4JI6B 3J7AU 2BTQA 3ZCCA 3ABKB 4U7OA 2WTFA 2D2CB 1J5EB 4FU0A 1YF2A 2EIMC 1IYEA 3F8NA 4JI2H 4EBCA 3TGUH 4WHXA 4DL4A 3JAMN 2C00A 4X65O 2JEXA 2R9RB 4C5AA 1GKFA 5L3CA 5GONA 1RK5A 1KJJA 3H40A 1K5QA 5LHHA 4X20B 5EBMC 1HNWH 3I4MG 1SA0B 2ETNA 5EC1C 2LQTA 4LF7O 5BPHA 5KFHA 4F4ZA 2R92A 4B3RH 1NR1A 4HQ6A 4LF9O 1Z5WA 3O9OA 3BRCA 5IY5C 1C3OA 3T1YH 2FP4B 2PUSA 4DR2O 3NC0B 2CGOA 1GK9A 4WBNB 3T9CA 2NLJC 3RB4A 3H0GG 1H8HG 4I50F 4JI2B 3JALA 3ABKC 3SYQA 1KQSU 4CS3A 3RAQA 4WFHA 3GB8B 3T4ZA 1KJIA 4GUNA 3HT5A 5D8DA 1M7JA 4IAJA 1XMOH 2W9CB 1S97A 4O2AF 4FVMA 2ZM6O 1JFFB 1K5SA 2VRZA 4NXMH 2PMZA 3CCJV 4IZOA 4O83A 3K5HA 1U97A 4IRKA 4ZHQA 4TUYB 5FNVF 1HNWB 1EUDB 1VIBA 2V59A 5DG8A 5CBFA 1L0LH 3BQ1A 2YW2A 2UVRA 2IU3A 4K3AA 1ULZA 4B3RB 2JA8G 3VQXA 4PI2A 4MAMA 4JV5O 2WLJA 4MTXA 1N4CA 2EULA 5D1OA 4J9PA 1LUVA 3ASNB 2F43G 5D5QA 2YRXA 5LA6F 1FAFA 1U96A 4PZ6A 4NKGB 5K1PA 4DV6H 4IHJA 1S68A 2NU6B 2IJHA 4J9OA 5LGUA 5IP9G 3E83A 4YR2A 4YY3H 1AP5A 3ABMB 1XMOB 4O4IF 4JASA 4NXMB 1VQ4V 4ECVA 4HNAB 1T94A 1SESA 3FX7A 2E5LB 1A32A 2A0LA 3CCMV 4R6ZA 4FM2A 5KMGB 2DWEC 3GV5B 2ODTX 2UXXA 2R7MA 3VPDA 5H6RA 1SQVH 2MCTA 1T5EA 4MSWC 2UXDO 2EIKB 2RDIA 1WH2A 1JJOA 3RN4A 3TXSA 4YJ2F 4YQWA 1FD9A 2PMZE 5IYBG 2BTQB 5DECA 3P32A 2VQEH 2FMLA 5KT2A 1E4FT 3T9FA 3GIMA 1Q8IA 4JTAB 2MK3A 4IIJB 4CC6A 3SNOA 4J7ZA 5BZBA 1M0TA 1AB3A 1Q3EA 2CQYA 2AGOA 1TUBA 3KAKA 1IBLO 3DAAA 5GONB 1ZETA 4GX0A 5C93A 1IURA 3GTQA 4O4HF 4TSFG 4YY3B 2KG7A 2P7TC 5CB4F 4JI3H 4KHPH 3OAAG 2Q8VA 4O84A 5KFIA 1BGYH 1LUWA 3OEHG 2UXCH 3CCRV 5C8YB 3QO5A 1Z2NX 1DIKA 4RUEA 2R9IA 4LFAO 1BSMA 4B3MH 2EIKC 4ZBMA 1M56B 1O9GA 4ED8A 2ZNIA 2VQEB 2XGQA 2V4DA 1SRYA 1I0HA 1P7GA 3TXQA 4K0KB 4FGRA 4ICGA 2J6UA 5DM6V 4DV3H 1W96A 2JEIA 2XUMA 1PNKA 3SI8A 2RGRA 4IR1A 2P22C 3R65A 3UT5B 2FKLA 4JI5O 2SCUB 1XHXA 2QSAA 3E5NA 4ABMA 3B77A 3N2GB 1SETA 1YCIA 4JI3B 4KHPB 3JYCA 2Q7DA 3RIZA 2VUMG 5JVDA 5LMUH 2XGPA 4A5UB 1I1LA 2UXCB 3GIQA 3W1BA 1S3JA 2FLPA 4I55A 4IR9A 1K7DA 3N6RA 1R6TA 5D1OB 2YIDA 5L3EA 1G4YB 4B3MB 3MR6A 3GTPA 4X64O 5L1JA 4Z2WA 3K9SA 3A0RA 4DV3B 5LGNA 2XCAA 2XHBA 4IHJB 5B1OA 3OTOH 3U0ZA 2R86A 1NJIW 3FAVA 5IYCO 3X2QB 4BBSG 4QE7A 2GPSA 1S10A 2ADPA 3ZIAG 2RJZA 2HIVA 4UVAA 3FB5C 2FMAA 4O3NA 4UCOA 5LMUB 1K1QA 5KT6A 2LP7A 4TV9F 4DR1H 4FM1A 4RAIA 2IU0A 3NUAA 2Y4TA 4Q8FA 1H2GA 1WSCA 2PI5A 1QQCA 3HKBA 4DV5O 1XNQO 1OV9A 1K73W 5IT9W 2R93G 1R3JC 1OBDA 2VQDA 1Y4MA 1P8LA 1SKVA 1UNNC 2CTQA 2JJ1G 3N27A 3HB3B 1R6KA 1OCCB 1SERA 4BW5A 1BT8A 1KUQA 5CE8A 3BA9A 3EYYA 2DQ3A 3B2EE 5KFBA 4RQFA 3OTOB 4U6PA 4WFAV 4EFBA 3CCSV 2DWDC 2UU9O 4JPRA 2GQSA 1VF7A 2KG7B 3GWKC 5KFYA 2WA4A 2Y4UA 1KBHA 3MD0A 1FFXB 4UFZA 2V1DA 3G8CA 4O7LA 4YHHO 3C3SA 4DR1B 4O7VA 5JH7A 1H2NA 3CX5F 3U55A 4K35A 2YS8A 4Z1VA 3RYHA 4UCUA 4I0XA 1PK8A 2OT5A 3GWOA 4FZ0A 1CKNB 2Y4RA 3RAXA 4XDJA 5C4XG 3SPJA 1JIHA 4J9NA 2E2IA 2ODMA 3I56V 2BQ3A 4FLUA 5KFWA 1FFTB 3IC7A 3CRRA 4FFBA 3ZEDA 3AG1C 5DEDA 3RWRD 4J9KA 3M9NB 1GM9A 3ZJZA 3OMIB 3KREA 3VPBA 5L3BA 2Y48A 1ZX3A 2KKWA 1HNZH 2IW5A 3SJQC 4RB2C 2IBKA 5JVDB 2XAGA 4CKBA 3EFFK 1OZ0A 4B7EA 1YSCA 1Y6XA 3KCXA 4DV0O 1EUCB 4LSXA 3WO1A 4M0JA 1IBMH 3RYCA 1S9FA 2I87A 4I55B 4IRDA 4TQFA 4Q45A 1M57B 1FJGH 2OIEA 3ZX6A 5KG5A 2ZQMA 1JPXA 2RQ6A 2ZR3A 3M99B 2HG8A 3CEIA 2N74A 4DL6A 2YIBA 1YI2V 3TQTA 1X9NA 1QHTA 3W7UA 4RU9A 3V6HA 3QNEA 2A9HA 3PW7A 1WCMA 4X1KA 3V6JA 3D36A 1JXLA 2EBOA 4X65H 1BZKA 2NN4A 4X1IB 4ZIBA 1S0OA 2EZPA 1RSOA 3ZRSA 2UUBO 5I5SA 3ORRA 4EG0A 1HNZB 3DTUB 2QWQB 4MV1A 4D6TH 2HVRA 2LGQA 2Q5ZA 5HBRB 2PF4E 2EILB 4UCVA 5FPOA 5BWRA 3T4DA 1IBMB 3HKBB 3Q2OA 3RB3A 3T5KA 2B63G 5LP6F 3OMNB 4LF7H 5LOVA 3CXCU 3T2MA 1WP8A 4MVSA 3FDSA 3LSUA 2XAFA 1M57C 3BVOA 5I47A 4LF9H 2EJRA 1BS3A 1PNMA 3OUZA 4DR2H 5KUMA 4P30A 4CHIA 1T3NA 2J9GA 3GIIA 4BY7G 3UZOA 4AI8A 1EN5A 3E86A 1NVPB 3LQSA 3PZPA 2V4QA 4OPHA 3SPGA 4LF5O 1B04A 4X65B 3T1HO 4A93G 2DYRB 3E89A 2P4VA 2FL4A 2ZM6H 3STZC 1D5NA 1CE8A 1FXVA 5JH7B 4XBFA 1ZTEA 1XNRO 2P5OA 1AROP 4I0XB 4LF7B 4IYIA 1BQZA 5KFMA 4LCUC 4LF9B 2W6PA 1RJQA 4O3PA 4O7ZA 2AQ4A 1MSWD 3CCVV 4DR2B 2RDCA 1TAEA 4EKWA 3MR5A 5H5NA 3THOA 2M05A 2H94A 2WLIA 2YDEA 3C90A 3KG2A 3RUPA 2HGWA 4ED7A 1I5XA 2DYSC 3CRMA 2QB5A 3M8AA 4J9ZB 3BEHA 2PTMA 2ZM6B 2DYRC 4XYMB 3FB8C 1CP9A 3G4SV 2GPWA 4NZMA 3V6KA 2P0AA 2W9AA 3BAAA 1S72V 4MVQA 4F4LA 4PV1B 3RYCB 4QWCA 1DV1A 4DYLA 2W9BB 2ASJA 2X5RA 2HKOA 2F95B 4HYKA 3HXLA 3JD3A 2UXDH 3U9SA 1JJ2U 1AILA 4FMTA 3K5NA 5EBWC 3SYPA 1VQ5V 2ZJTA 1EHIA 4H37A 2B9ZA 1OHHG 1RP3B 1N0JA 4G27B 1LR1A 1Q5OA 2I8CA 3MWEA 3J81W 2AGPA 2YWVA 2R8JA 4JI1O 5IYBO 1NTKH 2HVJC 4X1KB 3PW2A 5A2QW 2NR5A 5B1BC 3MJFA 3JSLA 2R8GA 3JRWA 4M9UA 2FKXA 4F50A 1JVMA 4GX2A 5KFAA 5F9LA 4MVZA 4QSHA 3PJSK 2XCPA 2PBZA 3BQ2A 1RSOB 4O3SA 5KFPA 3NBYB 3T9BA 5J2TA 2ZINA 2H8PC 3GV8B 2P67A 2YZNA 4H33A 4O4JF 4UB8Z 5DQIA 2RNBA 2WLMA 4LF6B 5DGAA 5EIBC 1H2MA 3D3QA 1UC9A 3K58A 2R7LA 2E76B 5LOVB 2WB1A 5KX5B 2UXDB 2W70A 1RM1C 3AG4C 5KFVA 4LFAH 2W6OA 4CH3A 4XX0B 3G6EV 4LBEC 1SZXA 4MS2A 4U3FH 2AW9A 4O4LB 1CQIB 4A3MG 3UFXB 4JYBA 3L71H 3BA8A 1G6UA 4JI5H 3HKCA 3KKYA 3JRXA 1R1BA 1Y66A 5EOYA 4J9RA 3R66A 5KT7A 5IYCG 2YEVB 1BQ0A 3PW0A 1K33A 2YZGA 3N6XA 4HZ3A 5C5JA 3B4SA 2VWJA 1I1MA 5C1PA 2QTOA 1Y1VA 4CMFA 4F4WA 1HR0O 5BMVF 2F4VO 3HOWG 1N33O 1M1KW 4P9OA 2NVYA 4QIWF 4LFAB 1L2ZA 2M7WA 5FJ8G 5KHHA 3U11A 1WNSA 2HVKC 1EN4A 5HFLA 1N0NA 2COGA 2ADQB 2Q68A 5KA5A 1L0NH 1SCUB 2VPQA 2GUZA 1L8DA 3GIPA 3MR2A 4JI5B 1H2SB 4CH4A 4ASUG 3S3WA 1XQ8A 1BXRA 4DV4O 2RMKB 1IXBA 2EINB 1GSHA 5DG9A 1CKOA 5DGHA 3GTJA 3K0GA 5CM0A 5FLMG 2AU0A 2ZDIA 2BOBC 1OCOB 1A3GA 2Y69B 3M4IA 3AG2B 2UUCH 2YXYA 2QWOB 4DV5H 1XNQH 5LXTF 1RK6A 4X9QA 3K57A 2C2DA 3O65A 3CYOA 4FJCC 3F5WC 1XL6A 3K04A 3RTXA 3ZN1A 1NS1A 2KSDA 1JX4A 2W6NA 3J80W 3IC9A 2HR3A 4JAUA 4J7JA 5J2TB 1V54C 2V4RA 1OCZB 1D5AA 4QJFB 2JA7G 2EJ2A 2Q67A 4ETSA 2WE6A 2Q7EA 2W8LA 3WG7B 4IWYA 3PVXA 1EKPA 2EINC 1BNCA 3ETQA 1K4CC 1WA8A 2V5AA 4YHHH 2VQFH 1S0VA 2GV9A 5B1NA 3HPLC 2IJJA 4RAYA 2BQUA 2XAJA 4QGPA 4MTFA 2UUCB 3HOXG 4ECRA 4XYLB 5GW7A 3KYHC 2LGWA 3FFQA 3QFFA 4PZ8A 1K97A 1N36O 1US6A 3HBLA 4B08A 5KAFZ 4FFRA 3E8BA 3HKCB 3P3PA 5H2FZ 4ZI7F 5L1KA 3CS5A 2L35A 4LP8A 5LA6A 5BR8O 4ED3A 2E2HA 5F9NA 5LGTA 5CMUA 3DTFA 1EKFA 3A0BZ 1OCZC 3VA7A 1EN6A 4EEQA 5CBHA 3H0GA 5C44G 4WFGA 1B6SA 3QG5A 2JIZG 4IIJA 5BWUA 4DV0H 1YIJV 4X62O 3B09A 4YHHB 3LSSA 1YXBA 3AG3B 4O4IA 2VQFB 5JJNB 3H4DA 4BXXG 3CSWA 4F6EA 3K59A 1H8EG 4X8AA 2FLNA 3ASOC 4JTDB 2DN9A 3IGAC 4O7YA 3K0DA 2MW2B 4PDMA 2QM4A 2WA3A 5LHGA 3CQZA 2O03A 1IOVA 2QTSA 3UKMA 4MTDA 2GUZB 5C8YA 2XIGA 1UJWB 2W71A 3ZS8C 3LWBA 2ZR2A 3QQMA 5KT4A 3V4SA 3VPCA 3GQCA 4DUYO 3WO0A 4A3DG 4OPAA 1EM1A 4N21A 2CH7A 3ZHUA 1K83A 5H9CA 2UUBH 1JA8A 1GN4A 2QJ1A 5H6QA 2FE3A 4LF4O 4DL3A 3PR4A 4DV0B 4PA6A 4O4HA 3UT5A 3KHGA 3H3VH 4FE2A 4JYCA 1VQPV 2DOSA 4A3IG 1QCEA 3N2GA 3Q8QB 3VQVA 4TUYF 3JZ6A 2NU7B 2C2AA 5KFFA 2UVWA 4F4XA 2ZNJA 3L75H 2X0LA 4B3SO 5FD6A 4DR4O 4DAAA 2X6BA 5CA0A 3RT3C 4LNUB 4NLGA 1Q6UA 3T1YB 2GSMB 3JSNA 3T1HH 2PN1A 2YXLA 2ZCEA 2YI8A 3F5TA 1SZTA 2UUBB 3CE2A 2JEFA 3CCLV 4PD4F 3OGCC 1WA8B 1GSOA 3N43B 1BMFG 2JS3A 3K5IA 3J7AK 5EBLC 5EZYF 3A2FA 1DGSA 1BHAA 2O57A 1VBGA 2DMXA 2ZE6A 2ALZA 5FLXN 1XNRH 3E35A 2ZDIC 5KT3A 2KB1A 2AGQA 3WFVA 3KZIZ 4DR7O 2ITCC 3TETA 2G38A 1KC8W 3RVZA 2UUAO 2EIYA 1A48A 5J2UF 3OUFA 3MFIA 2W7OA 4MV4A 5DGBA 5FD5A 3QF7A 4MVMA 5LA6B 1N32O 2R7KA 2FK2A 4NYEA 3SPCA 1VQLV 2XAQA 2BSKA 3RVYA 3OHAA 3T1HB 4RNNA 4QNHB 1EYZA 1BCCH 2HIXA 3GIKA 3AEIA 3VNNA 4JYYA 3CCUV 5GONF 3ASNC 1Q7YW 4O4IB 4DV6B 1I7LA 1GM8A 3LULA 2Z02A 4JI7O 5KFKA 4XDLA 1XNRB 4NTWA 1F4NA 3SYOA 4ECWA 3ETJA 1VAJA 1ZSPA 2Y0SA 3BACA 2GHYA 2YL2A 2VUMA 2P90A 4EYHB 2FB9A 3ABMC 1TWHA 2JS5A 1KJ8A 1WN7A 1FFXA 1ZL8A 3N40P 4PDRA 2BR0A 3J81N 5KFEA 5I5VA 4PDLA 4JI1H 2ABJA 4J41A 3SJAC 1XEQA 4X89A 3JD4A 1CQJB 4LR3A 1VQ7V 3RW0A 1VQOV 1P4RA 2Q0AA 2QF7A 4O82A 4TM5A 4ECXA 5DLFA 2CH7B 1I94O 5IJ0B 2W57A 1CKNA 5B1AB 2ITDC 3TW6A 4OX9O 2QM7A 1KB9F 3K5MA 3CRAA 4ED1A 2ASDA 4O4HB 3G80A 1GAXA 2LJ2A 3I5DA 5L3GA 3IJ4A 4TV8A 3CMEV 2RCVA 4MV7A 3BJYA 3ABTA 4ZHQF 4PA9A 3UCSC 2HVQA 4KP4A 2WLHA 1VS0A 1UFIA 3QVNA 4J11A 5CA1F 1UC8A 3ZN0A 3BCCH 1XDNA 4O7SA 4QWDA 2HLDG 2ZXWB 5CA0B 1M93A 1R3IC 4JI1B 3NXSA 4DV7H 2Y0SE 4JI8O 3AK3A 2R93A 1KJ9A 3A0HZ 3ZBHA 1FKAH 2R7NA 2FTKA 4FLTA 4UVBA 1M56C 3KHRA 3L4KA 1M4UA 4C2MA 2CK3G 1FVIA 3OGIB 3ZHTA 3L74H 2DWCA 2JGDA 3ETGA 1YDXA 4O7RA 4QW8A 3SR2C 4A2BA 1XDCA 1MZFA 2AHZA 4K8ZA 2HG5C 4FPPA 3B8MA 2R84A 5JCOA 4ECYA 2DLNA 4Q0YA 4X1IA 2QE7G 2VPSA 2F4VH 1V9PA 1N33H 1BJTA 1VMGA 1KD1W 3SE7A 4R8CA 4UB6Z 1XHZA 3S24A 3G6VA 4FFLA 5EDWA 4DL7A 4WFEA 3UM7A 3W1GA 2RDJA 4X66H 1Y74B 2F23A 1TA8A 4DV7B 4MV3A 4FZ1A 4FFMA 3I4NG 5BWVA 1ZWIC 4RUAA 2BSKB 4Q43A 5CN0A 1FXKA 3ETDA 4IGGA 4I4TF 1GH6A 2CDYA 3T9AA 1Q90D 4YR3A 4DV4H 3FB6C 1GN2A 5JJEB 4DR3O 1Q6HA 2KSWA 2XCLA 4MVUA 5KHKA 4NVPA 4GKKO 5JUMA 3I55V 3X2QC 2X6AA 4CKCA 2F4VB 2CAZC 4TWKA 1N33B 2D3OW 1ZL8B 4BWAA 4NTYA 2YZMA 3BY6A 3F7VC 1EZJA 3CC7V 4NZOA 3M9MB 4ECSA 3TEKA 5DQHA 1B33N 3ZMVA 3JD2A 4X66B 3T9DA 3CHXA 5LYJA 1NZ6A 1ZQ7A 3RYIA 5IWAO 3J80N 5LMNO 4A3KG 4RCNA 4RO2A 1QR8A 4UV9A 2FB5A 4TQRA 3GTKA 2YI9A 1Q86W 4DV4B 4AQYH 1OCCC 2R9AA 4HAMA 2DPJA 4TV8B 4L8JA 4QWAA 1NH2D 4JV1A 1RJPA 4R7RA 2NNUA
chains in the Genus database with same CATH topology
4X1KB 5A2QW 3JSLA 1ZAUA 5EZYA 4I4TA 3BPZA 3RR5A 1Z2PX 4GKJH 4LH7A 4HNAA 2PYJA 2F66C 3NBYB 5KMGA 2ZINA 5J2TA 5KHIA 2RGVA 3BHPA 5D5PA 3WB1A 4LF6B 5EIBC 5CB4B 3K58A 4MV9A 4JI6B 4CC5A 5BR8H 2BTQA 5LOVB 4K8XA 4APMA 1N34H 5KX5B 2UXDB 1J5EB 4JI2H 1XI1A 3F8NA 4DV1H 4LFAH 4AQYB 4LH6A 3TY8A 3JAMW 4CH3A 4X62H 2Q7GA 4UCTA 3JALB 5GONA 4O4LB 1XMQH 3HKEB 1SEIA 3BA8A 1G6UA 1BGWA 3RJ0A 4CS2A 4X20B 3OTFA 4GKJB 1XK5A 4JI5H 1NT2B 3HKCA 5EOYA 1HNWH 4JYAH 1SA0B 2CW7A 5IJ9B 1FJGB 4B3RH 5KX5A 4ZHQB 1Z5WA 3BRCA 3N6XA 3T1YH 2VWJA 2PUSA 4DUYH 5CA1B 5BR8B 3NC0B 4WBNB 4RB1A 1HR0H 1N34B 4LF4H 3E22B 2EX3A 4DV1B 3JALA 4JI2B 3JARA 4LFAB 4O4LA 1L2ZA 2YIAA 4CS3A 4BWSC 1YEWA 1WPBA 5KHHA 4X62B 3GB8B 3U11A 1WNSA 4O4JA 4IAJA 5JCOC 3W5OA 1XMOH 2F93B 4FVMA 1XMQB 3KAJA 1JFFB 4NXMH 4YJ3A 1L8DA 3JAKB 4F6RB 2OWOA 4JI5B 2IM9A 2OYQA 4ZHQA 4TUYB 5LYJB 4BW9A 1HNWB 4E6NA 1H2SB 3N2KA 3RYIB 4CH4A 4JYAB 4B3SH 1XQ8A 4DR4H 1HW7A 4B3RB 4U3JA 4MTEA 3VQXA 4PI2A 1CKOA 4JV5H 4UCRA 5D1OA 4DUYB 2WDTA 3M4IA 3H20A 5D5QA 2UUCH 1HR0B 4TV9B 4DV5H 1XNQH 4LF4B 4PZ6A 1Z5VA 1Q43A 3K57A 5K1PA 4DV6H 4IHJA 3RGZA 1S68A 3RTXA 4O2BA 5LP6A 4I4TB 4D7SA 4YY3H 3BABA 1XMOB 1TUBB 4I9QA 4NXMB 4I7HA 3J80W 4HNAB 4DR7H 2E5LB 4FM2A 5KMGB 5J2TB 1D5AA 4ZOLA 2MCTA 4AHCA 1T5EA 4B3SB 4ETSA 2WE6A 2Q7EA 4DR4B 1WH2A 1JJOA 5EYPA 1SYXB 3M7MX 4NXNH 1N32H 2BTQB 3U10A 3ETQA 4JV5B 4YHHH 2VQEH 3RYFA 2VQFH 4DR6H 2GV9A 1E4FT 4X1YA 1O75A 4RAYA 4FLVA 1Q8IA 2UUCB 4IIJB 4CC6A 1M0TA 1Q3EA 1TUBA 3KAKA 4DR5H 3KYHC 3FFQA 3LMLA 1IBLH 4PZ8A 4JI7H 5GONB 2CW8A 1N36H 3CSXA 4B08A 4YY3B 4JI3H 4KHPH 3HKCB 4DR7B 5LA6A 2UXCH 4GYCB 5C8YB 4RZQA 4FLWA 5LXTA 1Z2NX 4EEQA 4GLXA 2Q2TA 2WYOA 3HKDB 3QG5A 3MWMA 4B3MH 1O9GA 4IIJA 4NXNB 4DV0H 1I94H 2ZNIA 4YHHB 2VQEB 2V4DA 4O4IA 2VQFB 5IYZA 4DR6B 5JJNB 1M5IA 4K0KB 3K59A 4DV3H 3JARB 4OX9H 2RGRA 2P22C 3UT5B 2QM4A 4O4JB 4DR5B 2O03A 1IBLB 1XHXA 4M7EA 4DV2H 3N2GB 1N36B 4AILC 2F1MA 1SQFA 4YJ3B 4MTDA 5C8YA 2XIGA 3ZS8C 4JI3B 3RGBA 4KHPB 4CS4A 3RIZA 5JVDA 5LMUH 3HKDA 3N2KB 1E4GT 2VUGA 1S5JA 4J0MA 2UXCB 3TY5A 3W1BA 3K5LA 2Q7HA 2UUBH 4FM0A 4U3JB 4I55A 4JI8H 2QJ1A 2FE3A 3CB2A 5D1OB 5JQGA 4B3MB 3K3VA 4RAZA 4DV0B 4EQ5A 4TQDA 1I94B 1I7FA 4O4HA 4X64H 3UT5A 4ZI7A 1TGOA 4DV3B 3N2GA 4OX9B 2XHBA 3VQVA 1AN7A 3NBZB 4IHJB 3OTOH 5FPRA 3U0ZA 2HEPA 4O2BB 5LP6B 3FMAA 2ZNJA 4PDBA 3SJBC 3JAWA 3N44B 4DV2B 2RJZA 4UCSA 5FD6A 4EB6A 5CA0A 3MAQA 2HIVA 4LNUB 4FLZA 1M0WA 3K5OA 4ZOLB 4UCOA 5LMUB 4DR1H 1CKMA 3JATA 4FM1A 3T1YB 3JSNA 3T1HH 2YXLA 2ZCEA 2YI8A 5EYPB 2UUBB 1QQCA 2HGSA 3HKBA 4JI8B 4CH5A 3N43B 5IT9W 4FLYA 3RYFB 3J7AK 4DK0A 3A2FA 4Q6GA 1DGSA 4X1YB 1P8LA 5FLXW 4X64B 2PZSA 1XNRH 1SKVA 1KMIZ 3RYHB 5D1PA 1GYFA 5KHGA 3BA9A 2HVSA 2R72A 3EYYA 3B2EE 3OTOB 4DR3H 1X4TA 4LNUA 4EFBA 3QWUA 5BMVA 2UU9H 1VF7A 5LP6C 4GKKH 4I50A 2UUAH 4FFBB 1O9HA 2BTOA 3CVZA 1FFXB 4PHZA 4UFZA 5JJJB 3QF7A 5FD5A 5LA6B 4DR1B 5LXTB 4HBNA 4O2AA 5JH7A 3T1HB 1I6UA 2HIXA 4PI0A 3VNNA 3RYHA 4UCUA 4DV5B 5IWAH 1XNQB 4LMYA 4LF6H 5LMNH 5FNVA 4O4IB 4DRXB 5IYZB 4DV6B 1CKNB 2PYLA 1XNRB 3RFRA 4FLUA 4FFBA 3TY9A 3ZEDA 2JS5A 1WN7A 1FFXA 3RWRD 3N40P 1S03G 2UU9B 4JI1H 4GKKB 1MZBA 2UUAB 2KKWA 3SJAC 4D7TA 1HNZH 4RB2C 4LFCH 4LR3A 5JVDB 2YCHA 3WB2A 2Q0AA 4LSAA 1A0IA 1N32B 2JVDA 1SQGA 2VWKA 4LSXA 3SGIA 5IJ0B 1IBMH 3RYCA 4DRXA 2W57A 4I55B 3IG0A 1CKNA 4TQFA 1FJGH 5ITZB 4DRFA 3L2PA 5JQGB 2PY5A 2RQ6A 5IWAB 3K5MA 3DF7A 4O4HB 5LMNB 4FM9A 3GJXB 3ICXA 1IBKH 2YIBA 5J2UA 5DISC 4ZI7B 4JI7B 4TV8A 1X9NA 1QHTA 1KU9A 4YJ2A 4MV7A 2HVQA 5K1XA 4JI0H 1VS0A 4X1KA 3VQWA 1Z2OX 4A2AA 3GDEA 2ZIMA 1XDNA 3QTCA 3JAWB 3JASB 1ZHSA 4X65H 4X1IB 4ZIBA 4EB6B 1RSOA 5CA0B 1M93A 4JI1B 5IJ0A 4DV7H 1HNZB 4LFCB 4PZ7A 2R70A 2HVRA 3JATB 1FKAH 5ITZA 5FPOA 4UCVA 3LNNA 2UXBH 4FLTA 1IBMB 5KHJA 3HKBB 5CB4A 3L4JA 4B3TH 3L4KA 1M4UA 4LF7H 5LOVA 1FVIA 4DK1A 4LF9H 3IAYA 3DSQA 2VOBA 1ZHQA 4A2BA 3SR2C 1P16A 4DR2H 1IBKB 4K8ZA 1TVKB 3JASA 4LF8H 5JCOA 4Q0YA 4X1IA 2VPSA 4RB0A 2F4VH 1V9PA 4JI0B 1N33H 1HNXH 3HKEA 1BJTA 3WB0A 5BMVB 4JI4H 1B04A 1JMKC 1XHZA 3S24A 4I50B 4X65B 4LF5H 4X20A 2CFMA 3W1GA 4X66H 5LL6b 1TA8A 2ZM6H 4DV7B 2E5LH 3KALA 1SA0A 5IJ9A 2HHHH 4LFBH 4O2AB 5JH7B 4FLXA 3N42B 4EFEA 2UXBB 2P5OA 4B3TB 5CA1A 3RF2A 5EIBD 4WBNA 4DV4H 4LF7B 1TVKA 5FNVB 3C0FB 4RB3C 3PN1A 5JJEB 4LF9B 2PGGA 3E22A 4DR2B 2KSWA 4DUZH 5KHKA 4NVPA 4LF8B 1TAEA 3N41B 4KL1A 2F4VB 2CAZC 3THOA 1N33B 2YIBD 1HNXB 4BWAA 1JFFA 4JI4B 3JAKA 4LF5B 2Q2UA 4F6RA 5EZYB 4TUYA 4X66B 3CHXA 5LYJA 2PTMA 2ZM6B 3RYIA 1P49A 3BAAA 2HHHB 3RYCB 4LFBB 4JI6H 2JGUA 4CH6A 2F95B 3VQYA 3HXLA 2ZIOA 2YI9A 4TOIA 2UXDH 1J5EH 3K5NA 4DV4B 3UQ8A 4AQYH 2E3CA 2ZJTA 4TV9A 2R9AA 5J2UB 3SJCC 3KXYT 4TV8B 4L8JA 4DR3B 1Q5OA 4YJ2B 3J81W 4K0KH 3RGXA 4R7RA 4DUZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPR A;  1VS0 A;  3RTX A;  3GDE A;  3JSL A;  1ZAU A;  1XDN A;  3BAB A;  1XMO B;  4DV2 B;  3RR5 A;  4NXM B;  4UCS A;  4LH7 A;  2E5L B;  4JI1 B;  2HIV A;  3NBY B;  1HNZ B;  4LFC B;  4PZ7 A;  4UCO A;  5LMU B;  2HVR A;  1CKM A;  3T1Y B;  3JSN A;  5FPO A;  4UCV A;  4B3S B;  4LF6 B;  4DR4 B;  1IBM B;  2UUB B;  4JI6 B;  4CC5 A;  4JI8 B;  4JV5 B;  1FVI A;  2UXD B;  1DGS A;  1P8L A;  1J5E B;  4X64 B;  4AQY B;  2UUC B;  4LH6 A;  3TY8 A;  4CC6 A;  1P16 A;  5D1P A;  1IBK B;  4UCT A;  3BA9 A;  2HVS A;  3KYH C;  1V9P A;  4PZ8 A;  3OTO B;  4JI0 B;  4EFB A;  3QWU A;  4YY3 B;  1B04 A;  3BA8 A;  3S24 A;  4X65 B;  1XK5 A;  4GKJ B;  2CFM A;  3W1G A;  4DR7 B;  4UFZ A;  1TA8 A;  4DV7 B;  4DR1 B;  1FJG B;  4EEQ A;  4GLX A;  3T1H B;  2Q2T A;  4EFE A;  2UXB B;  2HIX A;  4B3T B;  3VNN A;  4UCU A;  5BR8 B;  4DV5 B;  4NXN B;  1XNQ B;  3NC0 B;  4LF7 B;  4YHH B;  2VQE B;  2VQF B;  1N34 B;  4DR6 B;  4DV6 B;  1CKN B;  3PN1 A;  4K0K B;  4LF9 B;  4DV1 B;  4JI2 B;  1XNR B;  4LFA B;  4DR2 B;  4X62 B;  4LF8 B;  3GB8 B;  1TAE A;  3TY9 A;  4DR5 B;  1IBL B;  2F4V B;  3W5O A;  1N33 B;  1N36 B;  1XMQ B;  1HNX B;  4JI4 B;  2UU9 B;  4LF5 B;  1S68 A;  4GKK B;  2Q2U A;  2UUA B;  2OWO A;  4JI3 B;  4KHP B;  4JI5 B;  4X66 B;  1HNW B;  4E6N A;  2ZM6 B;  4JYA B;  2VUG A;  1A0I A;  1N32 B;  2UXC B;  3TY5 A;  3W1B A;  3SGI A;  3BAA A;  2HHH B;  4B3R B;  4LFB B;  1CKO A;  1CKN A;  4DRF A;  3L2P A;  4UCR A;  5D1O B;  4B3M B;  4DUY B;  5D1O A;  4TOI A;  5IWA B;  4DV0 B;  4EQ5 A;  1I94 B;  5LMN B;  4DV4 B;  3UQ8 A;  1HR0 B;  3GJX B;  5DIS C;  4LF4 B;  1X9N A;  4DV3 B;  4DR3 B;  4JI7 B;  4PZ6 A;  4OX9 B;  2HVQ A;  3NBZ B;  4DUZ B; 
#chains in the Genus database with same CATH topology
 4LFC O;  4ME6 A;  4KXR A;  4ZKI A;  2FPI B;  2GTA A;  3BPZ A;  4I55 F;  2AHY A;  4GKJ H;  4LH7 A;  3CJH A;  2PYJ A;  1KP2 A;  3G6B A;  1QBZ A;  3GLK A;  2B63 A;  4UUG A;  2W9B A;  1BHB A;  3R5H A;  1I7N A;  1Y76 B;  4AYB A;  2JA6 G;  3FKS G;  2JDI G;  3K9A A;  5KFO A;  4MV9 A;  1IBK O;  4CC5 A;  1KKD A;  1G2W A;  5BR8 H;  1AJN A;  2NU9 B;  1YTF D;  2X6C A;  1FXH A;  1PP9 H;  2JGD B;  4JI0 O;  4JI2 O;  4HNT A;  3RBZ A;  3APQ A;  4AQY B;  1AI5 A;  4LH6 A;  1I50 A;  3JAM W;  2A3Q A;  4X62 H;  2Q7G A;  1S5H C;  3RBD A;  4YBZ B;  1XUQ A;  2ZT9 B;  1HDJ A;  2A7W A;  2ATL A;  2QM8 A;  2C2E A;  2M6Y A;  3M9O B;  2IH3 C;  4B7K A;  3RJ0 A;  1XK5 A;  3OTF A;  4GKJ B;  1NT2 B;  5EC2 C;  3RBE A;  4B3T O;  4HYO A;  3QO7 A;  3PR5 B;  4PJ0 Z;  3D8C A;  4EGQ A;  1FJG B;  4O2B F;  1FXK B;  5IE9 A;  5KX5 A;  2NVX A;  3K03 A;  5EWF A;  4J42 A;  1Y1W G;  1VAR A;  4DUY H;  2K9P A;  5BR8 B;  5I5W A;  1B3Q A;  1MSD A;  3CP1 A;  5HFM A;  4LF8 O;  4YIP A;  1E4E A;  2CNQ A;  1WRV A;  4LF4 H;  2EX3 A;  1I1K A;  1HNX O;  3JAR A;  4O4L A;  1R3K C;  4BWS C;  1YEW A;  1WPB A;  1VQM V;  4X62 B;  2HFE C;  4YAJ B;  2L6L A;  4O4J A;  3R5F A;  1VEW A;  2ZE5 A;  5JCO C;  1N48 A;  3ZHS A;  3KAJ A;  4CKE A;  2LW7 A;  5DN6 G;  4E4T A;  2E5L O;  4YJ3 A;  5JQW A;  2EIJ B;  1N8R W;  1R9T A;  1E79 G;  2YEV A;  2RN9 A;  4PA3 A;  2OWO A;  4LFB O;  2QEX V;  2NU8 B;  5LYJ B;  4BW9 A;  3E8F A;  2EIL C;  2P06 A;  3LNM B;  3N2K A;  3RYI B;  1KT8 A;  3KHL A;  4B3S H;  4DR4 H;  3JD1 A;  4U3J A;  4MTE A;  3GID A;  3ZHV A;  2LO1 A;  4JV5 H;  4Q20 A;  5KFL A;  1FXK C;  4DUY B;  2WDT A;  2Q6A A;  3H20 A;  4I7Z B;  3CMA V;  2IJK A;  1YJ9 V;  1TWG A;  3GV7 B;  1HWY A;  4LF4 B;  2DZD A;  1Q43 A;  1H2K A;  2COJ A;  3HO8 A;  4C5B A;  4F4Y A;  5LHI A;  3FD9 A;  2Q0O C;  1F7Y A;  4GX5 A;  3HKZ A;  3CC4 V;  2OCH A;  3TW7 A;  1A0G A;  5KG6 A;  4I7H A;  3CJH B;  4GCZ A;  4DR7 H;  1KP3 A;  3AK1 A;  3DGE A;  1K34 A;  4ZOL A;  2JK5 C;  2XD4 A;  3F7Y C;  3ZMU A;  4B3S B;  4QIW A;  4A3J G;  3SDL A;  4DR4 B;  1S77 D;  3K08 A;  5EYP A;  1SYX B;  4Q4C A;  2ZD9 A;  5FR9 A;  4A3B G;  4HN2 A;  2XAS A;  1DLB A;  1N32 H;  3L70 H;  3U10 A;  1CPY A;  4JV5 B;  5KS8 A;  1SQX H;  3RYF A;  1GSA A;  3AK2 A;  5DQG A;  3AYH B;  4K0K O;  4YB8 B;  3ML0 A;  4FLV A;  2OH2 A;  3UO2 A;  2DAB A;  2W0F C;  1MNG A;  4MVO A;  2BCC H;  1FS0 G;  2FPG B;  1AI6 A;  4ED0 A;  1S0M A;  3OEE G;  2R85 A;  1IBL H;  2HP8 A;  5AG2 A;  1I2L A;  4C5C A;  4JI7 H;  2Y0P A;  1GO3 E;  3CSX A;  5LL6 Y;  3NR7 A;  4JF3 A;  4JTC B;  1RYS A;  4QJF A;  3Q8P B;  1SQQ H;  2DE0 X;  1PM9 A;  4BAY A;  4DR7 B;  2RF4 A;  2HJD A;  3IN5 A;  2COI A;  2X0S A;  2QKA A;  4GYC B;  4RZQ A;  1OBG A;  3UZB A;  5LXT A;  1QR9 A;  1PNL A;  1N34 O;  4FS1 A;  3TJT A;  3FKI G;  4GLX A;  4J80 A;  1NBM G;  2WYO A;  4DV1 O;  1EKV A;  3HKD B;  3MWM A;  5KKN B;  1XRE A;  1I94 H;  5KFX A;  4O3O A;  2ILM A;  1E4E B;  1JQ0 A;  1F51 A;  5IYZ A;  4YXW G;  1XMQ O;  3JAR B;  3CD6 V;  4QIW E;  4OX9 H;  3W7X A;  1QNM A;  2VS0 A;  1LNQ A;  4O4J B;  1IBL B;  3D36 C;  1WB7 A;  1FYJ A;  2W6I G;  3BFR A;  1VQK V;  4JYA O;  1SQF A;  4JV2 A;  3ZRX A;  4YJ3 B;  2K1E A;  5IP7 G;  3RB0 A;  3ZHQ A;  1AUV A;  5LMU O;  1XL4 A;  3N2K B;  1E4G T;  2B1I A;  2ZE7 A;  4CMD A;  3LSQ A;  1T36 A;  3ZMS A;  2Q7H A;  2R7Z G;  3EVK A;  4QWE A;  4U3J B;  5EWG A;  5B3S B;  3ZRW B;  4JI8 H;  2YRW A;  3CB2 A;  5JQG A;  1PKX A;  1S5L Z;  3K3V A;  4RAZ A;  4J7K A;  4EQ5 A;  4TQD A;  1I94 B;  1I7F A;  3G8D A;  4X64 H;  3HOV G;  2XOK G;  4EGJ A;  2X7R B;  1KKC A;  4ZI7 A;  2ZKO A;  2WB1 E;  4QWB A;  1XIL A;  4OX9 B;  1AN7 A;  3NBZ B;  1GRJ A;  2OTL V;  2HEP A;  3FMA A;  3WNZ A;  5BY1 A;  2JA7 A;  3SJB C;  3JAW A;  3MHS C;  2B5U A;  3B8N A;  3RB6 A;  5BYA A;  3T5J A;  4DIM A;  4FLZ A;  5GTI Z;  1M0W A;  4J9M A;  1R3L C;  2QYZ A;  2IBZ H;  4ZOL B;  2WLN A;  3JAT A;  3PO2 G;  4JAV A;  3W7S A;  5EYP B;  4H13 B;  4IYH A;  2HGS A;  1VF5 B;  4JI8 B;  4CH5 A;  1OCR B;  5KFG A;  1M9N A;  3RYF B;  5B3S C;  4DK0 A;  5IT9 N;  2QWN B;  4Q6G A;  4X64 B;  4PBC A;  2PZS A;  3Q1K A;  3L9D A;  4IT5 A;  4ECT A;  3V4Z A;  3VOU A;  3HB9 A;  2FK3 A;  1GYF A;  5KHG A;  1Z2G A;  1G1X B;  3AW8 A;  4RNM A;  1GGO A;  4A3G G;  4DR3 H;  5KG1 A;  5F2V O;  1X4T A;  3OT7 A;  4LNU A;  1SFO A;  2YYA A;  2N05 A;  3BG5 A;  2UU9 H;  4J9Q A;  3GTL A;  3WU2 Z;  4GKK H;  4I50 A;  1O9H A;  3CVZ A;  3T5L A;  4PHZ A;  5JJJ B;  4XZ3 B;  1SC5 B;  4NXN O;  2WLK A;  4WFF A;  4O81 A;  3PW4 A;  5IYD G;  2YS7 A;  5LXT B;  3MHH C;  4DW1 A;  4DR6 O;  4O2A A;  2YS6 A;  5JVL A;  5B5E Z;  1SS3 A;  1W0K G;  2WAM A;  5C1O A;  3GB7 C;  4YP3 A;  2GDS A;  3S3X A;  5IWA H;  4DV5 B;  5DG7 A;  1OCO C;  1XNQ B;  2Y69 C;  3HOY G;  5LMN H;  3AG2 C;  2IP4 A;  5FNV A;  4DRX B;  5IYZ B;  4DR5 O;  3VOT A;  1W2B U;  3PO3 G;  2UVV A;  2EIM B;  1I3Q A;  4I9W A;  2ARH A;  1EZ1 A;  4PEL A;  4JZG A;  3LUT B;  3FB7 C;  4HR7 A;  2OTJ V;  3P3N A;  1EFR G;  4FK5 C;  1WR2 A;  2Y0I A;  2UU9 B;  1IZ3 A;  2W0X A;  4GKK B;  3ZRV A;  1MZB A;  2JA5 G;  4D7T A;  4LFC H;  4JAA A;  2YCH A;  4OXS A;  5KFR A;  3DXR A;  2HJF C;  5EK0 A;  1V4Y A;  4K6N A;  1JKJ B;  4LSA A;  4U7C A;  2VWK A;  1IBM O;  3WG7 C;  3HOU G;  4NR1 A;  3WWI A;  4O3R A;  5ITZ B;  3L2P A;  4NZN A;  5JQG B;  2PY5 A;  5IWA B;  4MW8 A;  4Q44 A;  4P2Z A;  2HHF A;  5LMN B;  3GJX B;  1A9X A;  3K06 A;  2WLL B;  1IBK H;  5J2U A;  4DV2 O;  2WAQ A;  4ZI7 B;  4YJ2 A;  5KG7 A;  5KFT A;  3DC5 A;  4GC6 A;  4ED2 A;  4JI0 H;  5BWT A;  1RPR A;  1Z2O X;  3QTC A;  4DXW A;  4WBN F;  3JAW B;  3JAS B;  1YVW A;  1KEC A;  2DQ0 A;  1WPX A;  3KCY A;  1EZV H;  5IJ0 A;  1Q81 W;  2C2R A;  1PPJ H;  4LFC B;  4EYI B;  4PZ7 A;  4FS2 A;  3JAT B;  1R73 A;  1ENV A;  3ETE A;  2ZE8 A;  3ABU A;  5KHJ A;  5CB4 A;  4WF9 V;  4B3T H;  2FPP B;  3OFN G;  1RPO A;  3AG3 C;  4ECQ A;  4DK1 A;  1Y67 A;  2UXN A;  3DSQ A;  2VOB A;  3IFX A;  1P16 A;  1IBK B;  1DF5 A;  3EPI A;  5LBQ A;  5DAA A;  1TVK B;  4LF8 H;  4RB0 A;  1YJW V;  1PL4 A;  1TWC A;  4JI0 B;  1WLE A;  1HNX H;  2ZDH A;  3HKE A;  4RQE A;  1V55 B;  3WB0 A;  5I5U A;  5JWP A;  2W6Q A;  1JMK C;  4LF5 H;  3NGD A;  4N23 A;  4I50 B;  5KG2 A;  4H0L B;  2WAQ E;  2CNV A;  1W0J G;  2EZO A;  1M90 W;  1KTA A;  2IA6 A;  2E5L H;  2C35 B;  1KEE A;  1OJH A;  5IJ9 A;  4LFB H;  4O2A B;  4FLX A;  1M6V A;  1Y14 B;  4B3T B;  5CA1 A;  2V58 A;  3RF2 A;  4LC1 A;  1IX9 A;  4WD3 A;  5FNV B;  2R92 G;  4BBR G;  3PN1 A;  1F23 A;  3E22 A;  1HP8 A;  2P4K A;  1QVG U;  4O7W A;  1K1S A;  1PX2 A;  4LF8 B;  1I5Y A;  4LWS A;  4O86 A;  1Y74 A;  4KFM A;  1BE3 H;  3H1I H;  1HNX B;  2QWP B;  5BWX A;  4R8U A;  2LFS A;  4J9L A;  1FPO A;  3JAK A;  4LF5 B;  1XOU A;  4F6R A;  2Q2U A;  1V55 C;  4IIJ F;  4FFK A;  5EZY B;  1VF6 A;  5BWW A;  3DXR B;  4LF6 O;  4O7T A;  3OSN A;  2AZ2 A;  4LFB B;  3APO A;  3OE7 G;  3DC6 A;  4YIO A;  1WAZ A;  5K3W A;  4DW0 A;  2HHF B;  2Z04 A;  4BIZ A;  1K9M W;  4FBU A;  2E3C A;  3AX6 A;  4TV9 A;  4CBC A;  2JEU A;  5C8Y F;  5J2U B;  1IOW A;  3KXY T;  2XT9 A;  4YJ2 B;  1RYR A;  4K0K H;  2A1H A;  3RGX A;  2W7P A;  3ETH A;  4FFO A;  4C7U A;  5KFQ A;  3GIL A;  2CTW A;  5A2Q N;  4I4T A;  1GN6 A;  3JZF A;  1K3E A;  1Z2P X;  2W6J G;  2EJ7 A;  5EWE A;  4A3C G;  2F66 C;  3T5H A;  5DMX A;  1P7B A;  4MVR A;  4O3Q A;  1JR9 A;  1GMG A;  4FIP C;  5I5Y A;  1B6R A;  2UVU A;  1JDB B;  3OR7 C;  4UV8 A;  2CTR A;  1G8M A;  4P9P A;  3FYE B;  1VQ9 V;  1QLN A;  5CB4 B;  5KT5 A;  1GM7 A;  4R7C A;  4EEY A;  3KTM A;  4K8X A;  4APM A;  1NH2 B;  1N34 H;  1AI7 A;  2V9W A;  4DV1 H;  1XI1 A;  1H38 A;  3CC2 V;  4NB5 A;  3TY8 A;  1H2L A;  5CA0 F;  3LDE A;  4UCT A;  4JGS A;  4QW9 A;  5H80 A;  5IDJ A;  1I2K A;  1NQT A;  3JAL B;  2Q4P A;  3MDS A;  1XMQ H;  3HKE B;  3E2E A;  1TUE B;  1SEI A;  1BGW A;  4CS2 A;  4W4L A;  1Y76 A;  3D3I A;  2UXB O;  1X59 A;  1AR4 A;  4JYA H;  1YTF B;  4IHJ F;  2BE3 A;  3ABL B;  2CW7 A;  5IJ9 B;  4PDV A;  2QKC A;  5B66 Z;  4ZHQ B;  3I12 A;  5B1A C;  1AI4 A;  4W4K A;  5DGI A;  3L73 H;  5CA1 B;  3G6Y A;  2DPI A;  3BQ0 A;  3KHH A;  4RB1 A;  2YUA A;  3W7W A;  1HR0 H;  4X88 A;  1N34 B;  2QGN A;  3E22 B;  4DV1 B;  2YIA A;  4JI4 O;  3PFF A;  3UO3 A;  2DIK A;  3T54 A;  4J9Y B;  2HDK A;  2GBO A;  4ED6 A;  4LWS B;  3R9R A;  1IDS A;  3W5O A;  3RV3 A;  4R8U B;  2F93 B;  2R87 A;  1XMQ B;  5A9G A;  4GLW A;  2ZXW C;  2IJI A;  3R23 A;  4HNU A;  1WJZ A;  1Q82 W;  3JAK B;  2HHH O;  4F6R B;  5I60 A;  4RUF A;  2IM9 A;  2OYQ A;  3T7A A;  2FJZ A;  2IMW P;  3G67 A;  4I5S A;  1SQP H;  3CPW U;  4E6N A;  2KQX A;  3CXH F;  2QK4 A;  4JYA B;  4RZR A;  1K8A W;  1YHQ V;  2EJ3 A;  1JX9 A;  4BR6 A;  1HW7 A;  4U7N A;  1YJN V;  3TQ1 A;  1IYD A;  3ABL C;  4UCR A;  3H1K H;  1UPG A;  2CUG A;  4DUZ O;  4IWX A;  4DQN A;  4MW3 A;  2UUC O;  5KG3 A;  5HNE A;  1HR0 B;  4TV9 B;  3OM3 B;  1AJP A;  4ECZ A;  1Z5V A;  3RGZ A;  1MOF A;  2W6Z A;  1VP7 A;  2FYU H;  2J6T A;  3G71 V;  4O2B A;  5LP6 A;  5C3E G;  4I4T B;  4D7S A;  3BAB A;  3AG1 B;  1TUB B;  2WWW A;  4I9Q A;  2OIG A;  2VA2 A;  2JA6 A;  3HOZ G;  5KFN A;  4JI6 O;  1BL8 A;  1L1F A;  3LDC A;  4AHC A;  3U9T A;  1ROP A;  3W7T A;  3TIG A;  1VF6 C;  1J5E O;  4G2K A;  4TV8 F;  3ZMT A;  1RJR A;  1W59 A;  1MZE A;  3M7M X;  3TIN A;  3QO8 A;  1NU1 H;  4NXN H;  2VQF O;  3RFC A;  4Q8E A;  2YC0 A;  3TCU A;  4DR6 H;  3H1J H;  5KFJ A;  5JVD F;  3K79 A;  4UUJ C;  4X1Y A;  1VQN V;  1O75 A;  1MG1 A;  3OW2 U;  5IYD O;  1VKZ A;  2DAA A;  4G28 B;  3LDD A;  3SPH A;  1VBH A;  4DR5 H;  3G6X A;  4H44 B;  3LML A;  1E1Q G;  2CW8 A;  1N36 H;  3OD4 A;  3OMA B;  1AR5 A;  4J10 A;  1Y1W A;  4WCE V;  1EBO A;  2JRI A;  1AJQ A;  4FLW A;  2Q9L A;  4JXU A;  4E2L A;  1CXZ B;  1XBL A;  2Q2T A;  1MAB G;  1DTO A;  3EXA A;  3R5X A;  2ZDG A;  1ZLZ A;  2W6M A;  5L3F A;  4NXN B;  3LP8 A;  1NTZ H;  2R6F A;  4DR6 B;  5E79 Z;  1M5I A;  4NTX A;  2QDO A;  3Q8S B;  4BIO A;  2LW1 A;  4JZ2 A;  4Z1M G;  1W93 A;  1D2D A;  1AR1 B;  3JCZ A;  2XTA A;  3WWH A;  4DR5 B;  1C30 A;  4YR0 A;  2BQR A;  3AG7 A;  4M7E A;  1HNW O;  4DV2 H;  3SPI A;  1N36 B;  4AIL C;  2F1M A;  5L9X A;  2W8K A;  2QA4 V;  2HGX A;  4B3R O;  3FAV B;  3RGB A;  3TK1 A;  4CS4 A;  5TIS Z;  4L1K A;  3SYA A;  2CE4 A;  3T1Y O;  3EHB B;  3HKD A;  2VUG A;  1B06 A;  1S5J A;  2JJ2 G;  4J0M A;  2HJW A;  3TY5 A;  3A8T A;  3K5L A;  5K2M A;  1QLE B;  1RFY A;  4FM0 A;  3E8G A;  4GC7 A;  4IL6 Z;  2A79 B;  2AGA A;  1V51 A;  4TQS A;  4AYB E;  4MV8 A;  3FYI B;  1VQ8 V;  1I08 A;  4ECU A;  3GTM A;  2R82 A;  1XMO O;  1TGO A;  5JH7 F;  4NXM O;  1JDE A;  5KFC A;  1GN3 A;  3JD0 A;  5LYJ F;  2QR4 A;  1CS0 A;  5FPR A;  5HV6 A;  1ORQ C;  4O2B B;  5LP6 B;  5E1A C;  4DL2 A;  2B1G A;  3Q8R B;  4PDB A;  3N44 B;  4DV2 B;  4UCS A;  4EB6 A;  2ZDQ A;  3L72 H;  3MAQ A;  5KG0 A;  1WCM G;  5KUK A;  2CKZ B;  2DYS B;  4BY1 G;  1URF A;  3K5O A;  3ZRW A;  4MT8 A;  5KFU A;  1CKM A;  1K4D C;  3CWB H;  1S0N A;  1JLL B;  4J9S A;  5BYB A;  2A06 H;  1YIT V;  5DLG A;  3PW5 A;  1QLE C;  2EJ0 A;  4FLY A;  4TT3 G;  3CEB A;  4MA5 A;  3H1L H;  5KG4 A;  4DV6 O;  1IXM A;  4MTG A;  5FLX W;  4X1Y B;  2AZ0 A;  3Q4H A;  2GLT A;  1KMI Z;  3RYH B;  2LFR A;  4OGQ B;  5D1P A;  4YY3 O;  3OR6 C;  3T9E A;  3H01 A;  5L1L A;  4A3E G;  2HVS A;  2R72 A;  3C3T A;  1GLV A;  2GQR A;  4A3F G;  1KYO F;  4GX1 A;  3T99 A;  3QWU A;  5B1B B;  5BMV A;  2EIJ C;  5CBG A;  2R8H A;  2ZGI A;  5LP6 C;  2IH1 C;  3RV4 A;  2UUA H;  3FKI A;  4FFB B;  1JCH A;  2YZL A;  3K3P A;  2BTO A;  4UVC A;  1KUT A;  3P30 A;  3U54 A;  4RUC A;  2Z0A A;  4L87 A;  4KUM A;  2GTS A;  2VQE O;  4HBN A;  1I6U A;  4QPK A;  2FLL A;  4JV0 A;  2V7Q G;  4PI0 A;  5FL7 G;  1MMM A;  4LF6 H;  4LMY A;  4YAK B;  2Q73 A;  1NI8 A;  2Q69 A;  2R8I A;  2PYL A;  4UXN A;  1RM1 B;  3AG4 B;  5KFS A;  3RFR A;  4JI3 O;  3OUS A;  3ZMZ A;  4KHP O;  3TY9 A;  1AUX A;  3UYY A;  5J9P C;  3CRC A;  4FFP A;  5LOV F;  1AP6 A;  2BOC C;  1JOY A;  5KFZ A;  2CTP A;  1TWF A;  5KX5 F;  1S03 G;  2UXC O;  2XAH A;  2R7Z A;  2ASL A;  2UUA B;  1B6Q A;  1ZUQ A;  4TVI A;  1J95 A;  1SF9 A;  3HKZ E;  1TWA A;  4FBT A;  1P84 F;  3WB2 A;  4B3M O;  2NUA B;  5KFD A;  1DAA A;  1A0I A;  1N32 B;  2JVD A;  1SQG A;  3CCQ V;  3SGI A;  4O4L F;  4DLK A;  4DRX A;  2PI4 A;  3IG0 A;  2QWR B;  2YU9 A;  1SQB H;  4O7N A;  4QE9 A;  4DV3 O;  4DRF A;  4EBE A;  4PWQ A;  4R50 A;  2E74 B;  3DF7 A;  5CR5 A;  1KJQ A;  4FM9 A;  2I80 A;  2C22 A;  3ICX A;  4YJ3 F;  3WWJ A;  5DIS C;  4JUZ A;  2Z5U A;  4JI7 B;  1KU9 A;  4FFN A;  4GT1 A;  5K1X A;  1WP7 A;  3VQW A;  1VQ6 V;  4A2A A;  3GDE A;  2ZIM A;  4DO2 A;  4RWU A;  1ZHS A;  1KBL A;  5T14 A;  2XND G;  3SYC A;  3CCE V;  4EB6 B;  1S76 D;  5L1I A;  2N04 A;  1GO3 F;  5BXZ A;  4DV7 O;  3HR0 A;  3VBB A;  1AVM A;  1NVP D;  2R70 A;  2CNU A;  1FKA O;  3U0G A;  5ITZ A;  4XDK A;  3LNN A;  3MR3 A;  2UXB H;  2P6J A;  3L4J A;  2E75 B;  2WLL A;  1PL0 A;  3IAY A;  3OTO O;  3Q4H B;  3OHB A;  5E25 A;  5GTH Z;  1ZHQ A;  3OSP A;  3GIJ A;  4NYK A;  4GZR B;  3JAS A;  1DF4 A;  1Q6I A;  3MFH A;  4ZOL F;  2J6S A;  4MTO A;  5I5X A;  2R8K A;  2CZG A;  1YZB A;  5BMV B;  2OCC B;  3H4B A;  4JI4 H;  4DR1 O;  2CGN A;  3TII A;  4X20 A;  2CFM A;  3GTG A;  4X66 O;  2DJV A;  4IRC A;  5LL6 b;  1MA1 A;  2WLI B;  1V54 B;  3GTO A;  2H3O A;  3KAL A;  1SA0 A;  5KA6 A;  2Z3Y A;  2HHH H;  4E4E A;  1DV2 A;  4PA7 A;  1COW G;  3N42 B;  4EFE A;  2UXB B;  3ORQ A;  4G3I A;  2PVP A;  4CE5 A;  1OWT A;  1N56 A;  5EIB D;  4WBN A;  5J2T F;  1TVK A;  3C0F B;  2XC9 A;  4RB3 C;  2FK1 A;  4A3L G;  3CRQ A;  1NTM H;  2OLS A;  2PGG A;  1GTO A;  4RNO A;  1PD3 A;  2WSS G;  4DL5 A;  4DUZ H;  5KAI Z;  2JA5 A;  1Y1V G;  3N41 B;  4KL1 A;  3MWD A;  1E1R G;  2W9C A;  4Q4D A;  4WFB V;  2YIB D;  1JFF A;  4QPJ A;  4JI4 B;  1ET0 A;  3H9V A;  4CZZ A;  2OCC C;  5I5T A;  2YXH A;  3EPG A;  4TUY A;  3B40 A;  5IYZ F;  4MA0 A;  1P49 A;  3VMM A;  5BPF A;  1PV0 A;  3GVM A;  4ZQI A;  2HHH B;  2C28 A;  4Y8V B;  4JI6 H;  1WB8 A;  1OCR C;  1NKD A;  2JGU A;  1THZ A;  4CH6 A;  3VQY A;  1IVS A;  2VA3 A;  2ZIO A;  4TOI A;  3DTG A;  3OUU A;  1F4M A;  1CEZ A;  1J5E H;  2DW4 A;  3E8H A;  1QU7 A;  3H1H H;  3UQ8 A;  4AQY O;  1QVF U;  2YIC A;  3STL C;  3QZ8 A;  2ATK C;  2WPD G;  3SJC C;  2JEJ A;  1R6N A;  4DR3 B;  3ASO B;  2QKS A;  2JEG A;  4DUZ B;  4BIU A;  3N8D A;  3JCU Z;  4EBD A;  1HNZ O;  2YSU B;  2VR1 A;  5EZY A;  1ZAU A;  3QZ7 A;  3RR5 A;  1DK1 A;  4HNV A;  4GKJ O;  1K92 A;  4HNA A;  1NR7 A;  2AXT Z;  5JQG F;  5CA3 A;  3JZI A;  4PA4 A;  5KMG A;  5KHI A;  1KC7 A;  2RGV A;  1FJG O;  3BHP A;  3K3W A;  3T1C A;  5IY5 B;  5CAE B;  5D5P A;  4MV6 A;  3WB1 A;  3ZHR A;  5KLV H;  5L3D A;  4JI6 B;  3J7A U;  2BTQ A;  3ZCC A;  3ABK B;  4U7O A;  2WTF A;  2D2C B;  1J5E B;  4FU0 A;  1YF2 A;  2EIM C;  1IYE A;  3F8N A;  4JI2 H;  4EBC A;  3TGU H;  4WHX A;  4DL4 A;  3JAM N;  2C00 A;  4X65 O;  2JEX A;  2R9R B;  4C5A A;  1GKF A;  5L3C A;  5GON A;  1RK5 A;  1KJJ A;  3H40 A;  1K5Q A;  5LHH A;  4X20 B;  5EBM C;  1HNW H;  3I4M G;  1SA0 B;  2ETN A;  5EC1 C;  2LQT A;  4LF7 O;  5BPH A;  5KFH A;  4F4Z A;  2R92 A;  4B3R H;  1NR1 A;  4HQ6 A;  4LF9 O;  1Z5W A;  3O9O A;  3BRC A;  5IY5 C;  1C3O A;  3T1Y H;  2FP4 B;  2PUS A;  4DR2 O;  3NC0 B;  2CGO A;  1GK9 A;  4WBN B;  3T9C A;  2NLJ C;  3RB4 A;  3H0G G;  1H8H G;  4I50 F;  4JI2 B;  3JAL A;  3ABK C;  3SYQ A;  1KQS U;  4CS3 A;  3RAQ A;  4WFH A;  3GB8 B;  3T4Z A;  1KJI A;  4GUN A;  3HT5 A;  5D8D A;  1M7J A;  4IAJ A;  1XMO H;  2W9C B;  1S97 A;  4O2A F;  4FVM A;  2ZM6 O;  1JFF B;  1K5S A;  2VRZ A;  4NXM H;  2PMZ A;  3CCJ V;  4IZO A;  4O83 A;  3K5H A;  1U97 A;  4IRK A;  4ZHQ A;  4TUY B;  5FNV F;  1HNW B;  1EUD B;  1VIB A;  2V59 A;  5DG8 A;  5CBF A;  1L0L H;  3BQ1 A;  2YW2 A;  2UVR A;  2IU3 A;  4K3A A;  1ULZ A;  4B3R B;  2JA8 G;  3VQX A;  4PI2 A;  4MAM A;  4JV5 O;  2WLJ A;  4MTX A;  1N4C A;  2EUL A;  5D1O A;  4J9P A;  1LUV A;  3ASN B;  2F43 G;  5D5Q A;  2YRX A;  5LA6 F;  1FAF A;  1U96 A;  4PZ6 A;  4NKG B;  5K1P A;  4DV6 H;  4IHJ A;  1S68 A;  2NU6 B;  2IJH A;  4J9O A;  5LGU A;  5IP9 G;  3E83 A;  4YR2 A;  4YY3 H;  1AP5 A;  3ABM B;  1XMO B;  4O4I F;  4JAS A;  4NXM B;  1VQ4 V;  4ECV A;  4HNA B;  1T94 A;  1SES A;  3FX7 A;  2E5L B;  1A32 A;  2A0L A;  3CCM V;  4R6Z A;  4FM2 A;  5KMG B;  2DWE C;  3GV5 B;  2ODT X;  2UXX A;  2R7M A;  3VPD A;  5H6R A;  1SQV H;  2MCT A;  1T5E A;  4MSW C;  2UXD O;  2EIK B;  2RDI A;  1WH2 A;  1JJO A;  3RN4 A;  3TXS A;  4YJ2 F;  4YQW A;  1FD9 A;  2PMZ E;  5IYB G;  2BTQ B;  5DEC A;  3P32 A;  2VQE H;  2FML A;  5KT2 A;  1E4F T;  3T9F A;  3GIM A;  1Q8I A;  4JTA B;  2MK3 A;  4IIJ B;  4CC6 A;  3SNO A;  4J7Z A;  5BZB A;  1M0T A;  1AB3 A;  1Q3E A;  2CQY A;  2AGO A;  1TUB A;  3KAK A;  1IBL O;  3DAA A;  5GON B;  1ZET A;  4GX0 A;  5C93 A;  1IUR A;  3GTQ A;  4O4H F;  4TSF G;  4YY3 B;  2KG7 A;  2P7T C;  5CB4 F;  4JI3 H;  4KHP H;  3OAA G;  2Q8V A;  4O84 A;  5KFI A;  1BGY H;  1LUW A;  3OEH G;  2UXC H;  3CCR V;  5C8Y B;  3QO5 A;  1Z2N X;  1DIK A;  4RUE A;  2R9I A;  4LFA O;  1BSM A;  4B3M H;  2EIK C;  4ZBM A;  1M56 B;  1O9G A;  4ED8 A;  2ZNI A;  2VQE B;  2XGQ A;  2V4D A;  1SRY A;  1I0H A;  1P7G A;  3TXQ A;  4K0K B;  4FGR A;  4ICG A;  2J6U A;  5DM6 V;  4DV3 H;  1W96 A;  2JEI A;  2XUM A;  1PNK A;  3SI8 A;  2RGR A;  4IR1 A;  2P22 C;  3R65 A;  3UT5 B;  2FKL A;  4JI5 O;  2SCU B;  1XHX A;  2QSA A;  3E5N A;  4ABM A;  3B77 A;  3N2G B;  1SET A;  1YCI A;  4JI3 B;  4KHP B;  3JYC A;  2Q7D A;  3RIZ A;  2VUM G;  5JVD A;  5LMU H;  2XGP A;  4A5U B;  1I1L A;  2UXC B;  3GIQ A;  3W1B A;  1S3J A;  2FLP A;  4I55 A;  4IR9 A;  1K7D A;  3N6R A;  1R6T A;  5D1O B;  2YID A;  5L3E A;  1G4Y B;  4B3M B;  3MR6 A;  3GTP A;  4X64 O;  5L1J A;  4Z2W A;  3K9S A;  3A0R A;  4DV3 B;  5LGN A;  2XCA A;  2XHB A;  4IHJ B;  5B1O A;  3OTO H;  3U0Z A;  2R86 A;  1NJI W;  3FAV A;  5IYC O;  3X2Q B;  4BBS G;  4QE7 A;  2GPS A;  1S10 A;  2ADP A;  3ZIA G;  2RJZ A;  2HIV A;  4UVA A;  3FB5 C;  2FMA A;  4O3N A;  4UCO A;  5LMU B;  1K1Q A;  5KT6 A;  2LP7 A;  4TV9 F;  4DR1 H;  4FM1 A;  4RAI A;  2IU0 A;  3NUA A;  2Y4T A;  4Q8F A;  1H2G A;  1WSC A;  2PI5 A;  1QQC A;  3HKB A;  4DV5 O;  1XNQ O;  1OV9 A;  1K73 W;  5IT9 W;  2R93 G;  1R3J C;  1OBD A;  2VQD A;  1Y4M A;  1P8L A;  1SKV A;  1UNN C;  2CTQ A;  2JJ1 G;  3N27 A;  3HB3 B;  1R6K A;  1OCC B;  1SER A;  4BW5 A;  1BT8 A;  1KUQ A;  5CE8 A;  3BA9 A;  3EYY A;  2DQ3 A;  3B2E E;  5KFB A;  4RQF A;  3OTO B;  4U6P A;  4WFA V;  4EFB A;  3CCS V;  2DWD C;  2UU9 O;  4JPR A;  2GQS A;  1VF7 A;  2KG7 B;  3GWK C;  5KFY A;  2WA4 A;  2Y4U A;  1KBH A;  3MD0 A;  1FFX B;  4UFZ A;  2V1D A;  3G8C A;  4O7L A;  4YHH O;  3C3S A;  4DR1 B;  4O7V A;  5JH7 A;  1H2N A;  3CX5 F;  3U55 A;  4K35 A;  2YS8 A;  4Z1V A;  3RYH A;  4UCU A;  4I0X A;  1PK8 A;  2OT5 A;  3GWO A;  4FZ0 A;  1CKN B;  2Y4R A;  3RAX A;  4XDJ A;  5C4X G;  3SPJ A;  1JIH A;  4J9N A;  2E2I A;  2ODM A;  3I56 V;  2BQ3 A;  4FLU A;  5KFW A;  1FFT B;  3IC7 A;  3CRR A;  4FFB A;  3ZED A;  3AG1 C;  5DED A;  3RWR D;  4J9K A;  3M9N B;  1GM9 A;  3ZJZ A;  3OMI B;  3KRE A;  3VPB A;  5L3B A;  2Y48 A;  1ZX3 A;  2KKW A;  1HNZ H;  2IW5 A;  3SJQ C;  4RB2 C;  2IBK A;  5JVD B;  2XAG A;  4CKB A;  3EFF K;  1OZ0 A;  4B7E A;  1YSC A;  1Y6X A;  3KCX A;  4DV0 O;  1EUC B;  4LSX A;  3WO1 A;  4M0J A;  1IBM H;  3RYC A;  1S9F A;  2I87 A;  4I55 B;  4IRD A;  4TQF A;  4Q45 A;  1M57 B;  1FJG H;  2OIE A;  3ZX6 A;  5KG5 A;  2ZQM A;  1JPX A;  2RQ6 A;  2ZR3 A;  3M99 B;  2HG8 A;  3CEI A;  2N74 A;  4DL6 A;  2YIB A;  1YI2 V;  3TQT A;  1X9N A;  1QHT A;  3W7U A;  4RU9 A;  3V6H A;  3QNE A;  2A9H A;  3PW7 A;  1WCM A;  4X1K A;  3V6J A;  3D36 A;  1JXL A;  2EBO A;  4X65 H;  1BZK A;  2NN4 A;  4X1I B;  4ZIB A;  1S0O A;  2EZP A;  1RSO A;  3ZRS A;  2UUB O;  5I5S A;  3ORR A;  4EG0 A;  1HNZ B;  3DTU B;  2QWQ B;  4MV1 A;  4D6T H;  2HVR A;  2LGQ A;  2Q5Z A;  5HBR B;  2PF4 E;  2EIL B;  4UCV A;  5FPO A;  5BWR A;  3T4D A;  1IBM B;  3HKB B;  3Q2O A;  3RB3 A;  3T5K A;  2B63 G;  5LP6 F;  3OMN B;  4LF7 H;  5LOV A;  3CXC U;  3T2M A;  1WP8 A;  4MVS A;  3FDS A;  3LSU A;  2XAF A;  1M57 C;  3BVO A;  5I47 A;  4LF9 H;  2EJR A;  1BS3 A;  1PNM A;  3OUZ A;  4DR2 H;  5KUM A;  4P30 A;  4CHI A;  1T3N A;  2J9G A;  3GII A;  4BY7 G;  3UZO A;  4AI8 A;  1EN5 A;  3E86 A;  1NVP B;  3LQS A;  3PZP A;  2V4Q A;  4OPH A;  3SPG A;  4LF5 O;  1B04 A;  4X65 B;  3T1H O;  4A93 G;  2DYR B;  3E89 A;  2P4V A;  2FL4 A;  2ZM6 H;  3STZ C;  1D5N A;  1CE8 A;  1FXV A;  5JH7 B;  4XBF A;  1ZTE A;  1XNR O;  2P5O A;  1ARO P;  4I0X B;  4LF7 B;  4IYI A;  1BQZ A;  5KFM A;  4LCU C;  4LF9 B;  2W6P A;  1RJQ A;  4O3P A;  4O7Z A;  2AQ4 A;  1MSW D;  3CCV V;  4DR2 B;  2RDC A;  1TAE A;  4EKW A;  3MR5 A;  5H5N A;  3THO A;  2M05 A;  2H94 A;  2WLI A;  2YDE A;  3C90 A;  3KG2 A;  3RUP A;  2HGW A;  4ED7 A;  1I5X A;  2DYS C;  3CRM A;  2QB5 A;  3M8A A;  4J9Z B;  3BEH A;  2PTM A;  2ZM6 B;  2DYR C;  4XYM B;  3FB8 C;  1CP9 A;  3G4S V;  2GPW A;  4NZM A;  3V6K A;  2P0A A;  2W9A A;  3BAA A;  1S72 V;  4MVQ A;  4F4L A;  4PV1 B;  3RYC B;  4QWC A;  1DV1 A;  4DYL A;  2W9B B;  2ASJ A;  2X5R A;  2HKO A;  2F95 B;  4HYK A;  3HXL A;  3JD3 A;  2UXD H;  3U9S A;  1JJ2 U;  1AIL A;  4FMT A;  3K5N A;  5EBW C;  3SYP A;  1VQ5 V;  2ZJT A;  1EHI A;  4H37 A;  2B9Z A;  1OHH G;  1RP3 B;  1N0J A;  4G27 B;  1LR1 A;  1Q5O A;  2I8C A;  3MWE A;  3J81 W;  2AGP A;  2YWV A;  2R8J A;  4JI1 O;  5IYB O;  1NTK H;  2HVJ C;  4X1K B;  3PW2 A;  5A2Q W;  2NR5 A;  5B1B C;  3MJF A;  3JSL A;  2R8G A;  3JRW A;  4M9U A;  2FKX A;  4F50 A;  1JVM A;  4GX2 A;  5KFA A;  5F9L A;  4MVZ A;  4QSH A;  3PJS K;  2XCP A;  2PBZ A;  3BQ2 A;  1RSO B;  4O3S A;  5KFP A;  3NBY B;  3T9B A;  5J2T A;  2ZIN A;  2H8P C;  3GV8 B;  2P67 A;  2YZN A;  4H33 A;  4O4J F;  4UB8 Z;  5DQI A;  2RNB A;  2WLM A;  4LF6 B;  5DGA A;  5EIB C;  1H2M A;  3D3Q A;  1UC9 A;  3K58 A;  2R7L A;  2E76 B;  5LOV B;  2WB1 A;  5KX5 B;  2UXD B;  2W70 A;  1RM1 C;  3AG4 C;  5KFV A;  4LFA H;  2W6O A;  4CH3 A;  4XX0 B;  3G6E V;  4LBE C;  1SZX A;  4MS2 A;  4U3F H;  2AW9 A;  4O4L B;  1CQI B;  4A3M G;  3UFX B;  4JYB A;  3L71 H;  3BA8 A;  1G6U A;  4JI5 H;  3HKC A;  3KKY A;  3JRX A;  1R1B A;  1Y66 A;  5EOY A;  4J9R A;  3R66 A;  5KT7 A;  5IYC G;  2YEV B;  1BQ0 A;  3PW0 A;  1K33 A;  2YZG A;  3N6X A;  4HZ3 A;  5C5J A;  3B4S A;  2VWJ A;  1I1M A;  5C1P A;  2QTO A;  1Y1V A;  4CMF A;  4F4W A;  1HR0 O;  5BMV F;  2F4V O;  3HOW G;  1N33 O;  1M1K W;  4P9O A;  2NVY A;  4QIW F;  4LFA B;  1L2Z A;  2M7W A;  5FJ8 G;  5KHH A;  3U11 A;  1WNS A;  2HVK C;  1EN4 A;  5HFL A;  1N0N A;  2COG A;  2ADQ B;  2Q68 A;  5KA5 A;  1L0N H;  1SCU B;  2VPQ A;  2GUZ A;  1L8D A;  3GIP A;  3MR2 A;  4JI5 B;  1H2S B;  4CH4 A;  4ASU G;  3S3W A;  1XQ8 A;  1BXR A;  4DV4 O;  2RMK B;  1IXB A;  2EIN B;  1GSH A;  5DG9 A;  1CKO A;  5DGH A;  3GTJ A;  3K0G A;  5CM0 A;  5FLM G;  2AU0 A;  2ZDI A;  2BOB C;  1OCO B;  1A3G A;  2Y69 B;  3M4I A;  3AG2 B;  2UUC H;  2YXY A;  2QWO B;  4DV5 H;  1XNQ H;  5LXT F;  1RK6 A;  4X9Q A;  3K57 A;  2C2D A;  3O65 A;  3CYO A;  4FJC C;  3F5W C;  1XL6 A;  3K04 A;  3RTX A;  3ZN1 A;  1NS1 A;  2KSD A;  1JX4 A;  2W6N A;  3J80 W;  3IC9 A;  2HR3 A;  4JAU A;  4J7J A;  5J2T B;  1V54 C;  2V4R A;  1OCZ B;  1D5A A;  4QJF B;  2JA7 G;  2EJ2 A;  2Q67 A;  4ETS A;  2WE6 A;  2Q7E A;  2W8L A;  3WG7 B;  4IWY A;  3PVX A;  1EKP A;  2EIN C;  1BNC A;  3ETQ A;  1K4C C;  1WA8 A;  2V5A A;  4YHH H;  2VQF H;  1S0V A;  2GV9 A;  5B1N A;  3HPL C;  2IJJ A;  4RAY A;  2BQU A;  2XAJ A;  4QGP A;  4MTF A;  2UUC B;  3HOX G;  4ECR A;  4XYL B;  5GW7 A;  3KYH C;  2LGW A;  3FFQ A;  3QFF A;  4PZ8 A;  1K97 A;  1N36 O;  1US6 A;  3HBL A;  4B08 A;  5KAF Z;  4FFR A;  3E8B A;  3HKC B;  3P3P A;  5H2F Z;  4ZI7 F;  5L1K A;  3CS5 A;  2L35 A;  4LP8 A;  5LA6 A;  5BR8 O;  4ED3 A;  2E2H A;  5F9N A;  5LGT A;  5CMU A;  3DTF A;  1EKF A;  3A0B Z;  1OCZ C;  3VA7 A;  1EN6 A;  4EEQ A;  5CBH A;  3H0G A;  5C44 G;  4WFG A;  1B6S A;  3QG5 A;  2JIZ G;  4IIJ A;  5BWU A;  4DV0 H;  1YIJ V;  4X62 O;  3B09 A;  4YHH B;  3LSS A;  1YXB A;  3AG3 B;  4O4I A;  2VQF B;  5JJN B;  3H4D A;  4BXX G;  3CSW A;  4F6E A;  3K59 A;  1H8E G;  4X8A A;  2FLN A;  3ASO C;  4JTD B;  2DN9 A;  3IGA C;  4O7Y A;  3K0D A;  2MW2 B;  4PDM A;  2QM4 A;  2WA3 A;  5LHG A;  3CQZ A;  2O03 A;  1IOV A;  2QTS A;  3UKM A;  4MTD A;  2GUZ B;  5C8Y A;  2XIG A;  1UJW B;  2W71 A;  3ZS8 C;  3LWB A;  2ZR2 A;  3QQM A;  5KT4 A;  3V4S A;  3VPC A;  3GQC A;  4DUY O;  3WO0 A;  4A3D G;  4OPA A;  1EM1 A;  4N21 A;  2CH7 A;  3ZHU A;  1K83 A;  5H9C A;  2UUB H;  1JA8 A;  1GN4 A;  2QJ1 A;  5H6Q A;  2FE3 A;  4LF4 O;  4DL3 A;  3PR4 A;  4DV0 B;  4PA6 A;  4O4H A;  3UT5 A;  3KHG A;  3H3V H;  4FE2 A;  4JYC A;  1VQP V;  2DOS A;  4A3I G;  1QCE A;  3N2G A;  3Q8Q B;  3VQV A;  4TUY F;  3JZ6 A;  2NU7 B;  2C2A A;  5KFF A;  2UVW A;  4F4X A;  2ZNJ A;  3L75 H;  2X0L A;  4B3S O;  5FD6 A;  4DR4 O;  4DAA A;  2X6B A;  5CA0 A;  3RT3 C;  4LNU B;  4NLG A;  1Q6U A;  3T1Y B;  2GSM B;  3JSN A;  3T1H H;  2PN1 A;  2YXL A;  2ZCE A;  2YI8 A;  3F5T A;  1SZT A;  2UUB B;  3CE2 A;  2JEF A;  3CCL V;  4PD4 F;  3OGC C;  1WA8 B;  1GSO A;  3N43 B;  1BMF G;  2JS3 A;  3K5I A;  3J7A K;  5EBL C;  5EZY F;  3A2F A;  1DGS A;  1BHA A;  2O57 A;  1VBG A;  2DMX A;  2ZE6 A;  2ALZ A;  5FLX N;  1XNR H;  3E35 A;  2ZDI C;  5KT3 A;  2KB1 A;  2AGQ A;  3WFV A;  3KZI Z;  4DR7 O;  2ITC C;  3TET A;  2G38 A;  1KC8 W;  3RVZ A;  2UUA O;  2EIY A;  1A48 A;  5J2U F;  3OUF A;  3MFI A;  2W7O A;  4MV4 A;  5DGB A;  5FD5 A;  3QF7 A;  4MVM A;  5LA6 B;  1N32 O;  2R7K A;  2FK2 A;  4NYE A;  3SPC A;  1VQL V;  2XAQ A;  2BSK A;  3RVY A;  3OHA A;  3T1H B;  4RNN A;  4QNH B;  1EYZ A;  1BCC H;  2HIX A;  3GIK A;  3AEI A;  3VNN A;  4JYY A;  3CCU V;  5GON F;  3ASN C;  1Q7Y W;  4O4I B;  4DV6 B;  1I7L A;  1GM8 A;  3LUL A;  2Z02 A;  4JI7 O;  5KFK A;  4XDL A;  1XNR B;  4NTW A;  1F4N A;  3SYO A;  4ECW A;  3ETJ A;  1VAJ A;  1ZSP A;  2Y0S A;  3BAC A;  2GHY A;  2YL2 A;  2VUM A;  2P90 A;  4EYH B;  2FB9 A;  3ABM C;  1TWH A;  2JS5 A;  1KJ8 A;  1WN7 A;  1FFX A;  1ZL8 A;  3N40 P;  4PDR A;  2BR0 A;  3J81 N;  5KFE A;  5I5V A;  4PDL A;  4JI1 H;  2ABJ A;  4J41 A;  3SJA C;  1XEQ A;  4X89 A;  3JD4 A;  1CQJ B;  4LR3 A;  1VQ7 V;  3RW0 A;  1VQO V;  1P4R A;  2Q0A A;  2QF7 A;  4O82 A;  4TM5 A;  4ECX A;  5DLF A;  2CH7 B;  1I94 O;  5IJ0 B;  2W57 A;  1CKN A;  5B1A B;  2ITD C;  3TW6 A;  4OX9 O;  2QM7 A;  1KB9 F;  3K5M A;  3CRA A;  4ED1 A;  2ASD A;  4O4H B;  3G80 A;  1GAX A;  2LJ2 A;  3I5D A;  5L3G A;  3IJ4 A;  4TV8 A;  3CME V;  2RCV A;  4MV7 A;  3BJY A;  3ABT A;  4ZHQ F;  4PA9 A;  3UCS C;  2HVQ A;  4KP4 A;  2WLH A;  1VS0 A;  1UFI A;  3QVN A;  4J11 A;  5CA1 F;  1UC8 A;  3ZN0 A;  3BCC H;  1XDN A;  4O7S A;  4QWD A;  2HLD G;  2ZXW B;  5CA0 B;  1M93 A;  1R3I C;  4JI1 B;  3NXS A;  4DV7 H;  2Y0S E;  4JI8 O;  3AK3 A;  2R93 A;  1KJ9 A;  3A0H Z;  3ZBH A;  1FKA H;  2R7N A;  2FTK A;  4FLT A;  4UVB A;  1M56 C;  3KHR A;  3L4K A;  1M4U A;  4C2M A;  2CK3 G;  1FVI A;  3OGI B;  3ZHT A;  3L74 H;  2DWC A;  2JGD A;  3ETG A;  1YDX A;  4O7R A;  4QW8 A;  3SR2 C;  4A2B A;  1XDC A;  1MZF A;  2AHZ A;  4K8Z A;  2HG5 C;  4FPP A;  3B8M A;  2R84 A;  5JCO A;  4ECY A;  2DLN A;  4Q0Y A;  4X1I A;  2QE7 G;  2VPS A;  2F4V H;  1V9P A;  1N33 H;  1BJT A;  1VMG A;  1KD1 W;  3SE7 A;  4R8C A;  4UB6 Z;  1XHZ A;  3S24 A;  3G6V A;  4FFL A;  5EDW A;  4DL7 A;  4WFE A;  3UM7 A;  3W1G A;  2RDJ A;  4X66 H;  1Y74 B;  2F23 A;  1TA8 A;  4DV7 B;  4MV3 A;  4FZ1 A;  4FFM A;  3I4N G;  5BWV A;  1ZWI C;  4RUA A;  2BSK B;  4Q43 A;  5CN0 A;  1FXK A;  3ETD A;  4IGG A;  4I4T F;  1GH6 A;  2CDY A;  3T9A A;  1Q90 D;  4YR3 A;  4DV4 H;  3FB6 C;  1GN2 A;  5JJE B;  4DR3 O;  1Q6H A;  2KSW A;  2XCL A;  4MVU A;  5KHK A;  4NVP A;  4GKK O;  5JUM A;  3I55 V;  3X2Q C;  2X6A A;  4CKC A;  2F4V B;  2CAZ C;  4TWK A;  1N33 B;  2D3O W;  1ZL8 B;  4BWA A;  4NTY A;  2YZM A;  3BY6 A;  3F7V C;  1EZJ A;  3CC7 V;  4NZO A;  3M9M B;  4ECS A;  3TEK A;  5DQH A;  1B33 N;  3ZMV A;  3JD2 A;  4X66 B;  3T9D A;  3CHX A;  5LYJ A;  1NZ6 A;  1ZQ7 A;  3RYI A;  5IWA O;  3J80 N;  5LMN O;  4A3K G;  4RCN A;  4RO2 A;  1QR8 A;  4UV9 A;  2FB5 A;  4TQR A;  3GTK A;  2YI9 A;  1Q86 W;  4DV4 B;  4AQY H;  1OCC C;  2R9A A;  4HAM A;  2DPJ A;  4TV8 B;  4L8J A;  4QWA A;  1NH2 D;  4JV1 A;  1RJP A;  4R7R A;  2NNU A; 
#chains in the Genus database with same CATH homology
 4X1K B;  5A2Q W;  3JSL A;  1ZAU A;  5EZY A;  4I4T A;  3BPZ A;  3RR5 A;  1Z2P X;  4GKJ H;  4LH7 A;  4HNA A;  2PYJ A;  2F66 C;  3NBY B;  5KMG A;  2ZIN A;  5J2T A;  5KHI A;  2RGV A;  3BHP A;  5D5P A;  3WB1 A;  4LF6 B;  5EIB C;  5CB4 B;  3K58 A;  4MV9 A;  4JI6 B;  4CC5 A;  5BR8 H;  2BTQ A;  5LOV B;  4K8X A;  4APM A;  1N34 H;  5KX5 B;  2UXD B;  1J5E B;  4JI2 H;  1XI1 A;  3F8N A;  4DV1 H;  4LFA H;  4AQY B;  4LH6 A;  3TY8 A;  3JAM W;  4CH3 A;  4X62 H;  2Q7G A;  4UCT A;  3JAL B;  5GON A;  4O4L B;  1XMQ H;  3HKE B;  1SEI A;  3BA8 A;  1G6U A;  1BGW A;  3RJ0 A;  4CS2 A;  4X20 B;  3OTF A;  4GKJ B;  1XK5 A;  4JI5 H;  1NT2 B;  3HKC A;  5EOY A;  1HNW H;  4JYA H;  1SA0 B;  2CW7 A;  5IJ9 B;  1FJG B;  4B3R H;  5KX5 A;  4ZHQ B;  1Z5W A;  3BRC A;  3N6X A;  3T1Y H;  2VWJ A;  2PUS A;  4DUY H;  5CA1 B;  5BR8 B;  3NC0 B;  4WBN B;  4RB1 A;  1HR0 H;  1N34 B;  4LF4 H;  3E22 B;  2EX3 A;  4DV1 B;  3JAL A;  4JI2 B;  3JAR A;  4LFA B;  4O4L A;  1L2Z A;  2YIA A;  4CS3 A;  4BWS C;  1YEW A;  1WPB A;  5KHH A;  4X62 B;  3GB8 B;  3U11 A;  1WNS A;  4O4J A;  4IAJ A;  5JCO C;  3W5O A;  1XMO H;  2F93 B;  4FVM A;  1XMQ B;  3KAJ A;  1JFF B;  4NXM H;  4YJ3 A;  1L8D A;  3JAK B;  4F6R B;  2OWO A;  4JI5 B;  2IM9 A;  2OYQ A;  4ZHQ A;  4TUY B;  5LYJ B;  4BW9 A;  1HNW B;  4E6N A;  1H2S B;  3N2K A;  3RYI B;  4CH4 A;  4JYA B;  4B3S H;  1XQ8 A;  4DR4 H;  1HW7 A;  4B3R B;  4U3J A;  4MTE A;  3VQX A;  4PI2 A;  1CKO A;  4JV5 H;  4UCR A;  5D1O A;  4DUY B;  2WDT A;  3M4I A;  3H20 A;  5D5Q A;  2UUC H;  1HR0 B;  4TV9 B;  4DV5 H;  1XNQ H;  4LF4 B;  4PZ6 A;  1Z5V A;  1Q43 A;  3K57 A;  5K1P A;  4DV6 H;  4IHJ A;  3RGZ A;  1S68 A;  3RTX A;  4O2B A;  5LP6 A;  4I4T B;  4D7S A;  4YY3 H;  3BAB A;  1XMO B;  1TUB B;  4I9Q A;  4NXM B;  4I7H A;  3J80 W;  4HNA B;  4DR7 H;  2E5L B;  4FM2 A;  5KMG B;  5J2T B;  1D5A A;  4ZOL A;  2MCT A;  4AHC A;  1T5E A;  4B3S B;  4ETS A;  2WE6 A;  2Q7E A;  4DR4 B;  1WH2 A;  1JJO A;  5EYP A;  1SYX B;  3M7M X;  4NXN H;  1N32 H;  2BTQ B;  3U10 A;  3ETQ A;  4JV5 B;  4YHH H;  2VQE H;  3RYF A;  2VQF H;  4DR6 H;  2GV9 A;  1E4F T;  4X1Y A;  1O75 A;  4RAY A;  4FLV A;  1Q8I A;  2UUC B;  4IIJ B;  4CC6 A;  1M0T A;  1Q3E A;  1TUB A;  3KAK A;  4DR5 H;  3KYH C;  3FFQ A;  3LML A;  1IBL H;  4PZ8 A;  4JI7 H;  5GON B;  2CW8 A;  1N36 H;  3CSX A;  4B08 A;  4YY3 B;  4JI3 H;  4KHP H;  3HKC B;  4DR7 B;  5LA6 A;  2UXC H;  4GYC B;  5C8Y B;  4RZQ A;  4FLW A;  5LXT A;  1Z2N X;  4EEQ A;  4GLX A;  2Q2T A;  2WYO A;  3HKD B;  3QG5 A;  3MWM A;  4B3M H;  1O9G A;  4IIJ A;  4NXN B;  4DV0 H;  1I94 H;  2ZNI A;  4YHH B;  2VQE B;  2V4D A;  4O4I A;  2VQF B;  5IYZ A;  4DR6 B;  5JJN B;  1M5I A;  4K0K B;  3K59 A;  4DV3 H;  3JAR B;  4OX9 H;  2RGR A;  2P22 C;  3UT5 B;  2QM4 A;  4O4J B;  4DR5 B;  2O03 A;  1IBL B;  1XHX A;  4M7E A;  4DV2 H;  3N2G B;  1N36 B;  4AIL C;  2F1M A;  1SQF A;  4YJ3 B;  4MTD A;  5C8Y A;  2XIG A;  3ZS8 C;  4JI3 B;  3RGB A;  4KHP B;  4CS4 A;  3RIZ A;  5JVD A;  5LMU H;  3HKD A;  3N2K B;  1E4G T;  2VUG A;  1S5J A;  4J0M A;  2UXC B;  3TY5 A;  3W1B A;  3K5L A;  2Q7H A;  2UUB H;  4FM0 A;  4U3J B;  4I55 A;  4JI8 H;  2QJ1 A;  2FE3 A;  3CB2 A;  5D1O B;  5JQG A;  4B3M B;  3K3V A;  4RAZ A;  4DV0 B;  4EQ5 A;  4TQD A;  1I94 B;  1I7F A;  4O4H A;  4X64 H;  3UT5 A;  4ZI7 A;  1TGO A;  4DV3 B;  3N2G A;  4OX9 B;  2XHB A;  3VQV A;  1AN7 A;  3NBZ B;  4IHJ B;  3OTO H;  5FPR A;  3U0Z A;  2HEP A;  4O2B B;  5LP6 B;  3FMA A;  2ZNJ A;  4PDB A;  3SJB C;  3JAW A;  3N44 B;  4DV2 B;  2RJZ A;  4UCS A;  5FD6 A;  4EB6 A;  5CA0 A;  3MAQ A;  2HIV A;  4LNU B;  4FLZ A;  1M0W A;  3K5O A;  4ZOL B;  4UCO A;  5LMU B;  4DR1 H;  1CKM A;  3JAT A;  4FM1 A;  3T1Y B;  3JSN A;  3T1H H;  2YXL A;  2ZCE A;  2YI8 A;  5EYP B;  2UUB B;  1QQC A;  2HGS A;  3HKB A;  4JI8 B;  4CH5 A;  3N43 B;  5IT9 W;  4FLY A;  3RYF B;  3J7A K;  4DK0 A;  3A2F A;  4Q6G A;  1DGS A;  4X1Y B;  1P8L A;  5FLX W;  4X64 B;  2PZS A;  1XNR H;  1SKV A;  1KMI Z;  3RYH B;  5D1P A;  1GYF A;  5KHG A;  3BA9 A;  2HVS A;  2R72 A;  3EYY A;  3B2E E;  3OTO B;  4DR3 H;  1X4T A;  4LNU A;  4EFB A;  3QWU A;  5BMV A;  2UU9 H;  1VF7 A;  5LP6 C;  4GKK H;  4I50 A;  2UUA H;  4FFB B;  1O9H A;  2BTO A;  3CVZ A;  1FFX B;  4PHZ A;  4UFZ A;  5JJJ B;  3QF7 A;  5FD5 A;  5LA6 B;  4DR1 B;  5LXT B;  4HBN A;  4O2A A;  5JH7 A;  3T1H B;  1I6U A;  2HIX A;  4PI0 A;  3VNN A;  3RYH A;  4UCU A;  4DV5 B;  5IWA H;  1XNQ B;  4LMY A;  4LF6 H;  5LMN H;  5FNV A;  4O4I B;  4DRX B;  5IYZ B;  4DV6 B;  1CKN B;  2PYL A;  1XNR B;  3RFR A;  4FLU A;  4FFB A;  3TY9 A;  3ZED A;  2JS5 A;  1WN7 A;  1FFX A;  3RWR D;  3N40 P;  1S03 G;  2UU9 B;  4JI1 H;  4GKK B;  1MZB A;  2UUA B;  2KKW A;  3SJA C;  4D7T A;  1HNZ H;  4RB2 C;  4LFC H;  4LR3 A;  5JVD B;  2YCH A;  3WB2 A;  2Q0A A;  4LSA A;  1A0I A;  1N32 B;  2JVD A;  1SQG A;  2VWK A;  4LSX A;  3SGI A;  5IJ0 B;  1IBM H;  3RYC A;  4DRX A;  2W57 A;  4I55 B;  3IG0 A;  1CKN A;  4TQF A;  1FJG H;  5ITZ B;  4DRF A;  3L2P A;  5JQG B;  2PY5 A;  2RQ6 A;  5IWA B;  3K5M A;  3DF7 A;  4O4H B;  5LMN B;  4FM9 A;  3GJX B;  3ICX A;  1IBK H;  2YIB A;  5J2U A;  5DIS C;  4ZI7 B;  4JI7 B;  4TV8 A;  1X9N A;  1QHT A;  1KU9 A;  4YJ2 A;  4MV7 A;  2HVQ A;  5K1X A;  4JI0 H;  1VS0 A;  4X1K A;  3VQW A;  1Z2O X;  4A2A A;  3GDE A;  2ZIM A;  1XDN A;  3QTC A;  3JAW B;  3JAS B;  1ZHS A;  4X65 H;  4X1I B;  4ZIB A;  4EB6 B;  1RSO A;  5CA0 B;  1M93 A;  4JI1 B;  5IJ0 A;  4DV7 H;  1HNZ B;  4LFC B;  4PZ7 A;  2R70 A;  2HVR A;  3JAT B;  1FKA H;  5ITZ A;  5FPO A;  4UCV A;  3LNN A;  2UXB H;  4FLT A;  1IBM B;  5KHJ A;  3HKB B;  5CB4 A;  3L4J A;  4B3T H;  3L4K A;  1M4U A;  4LF7 H;  5LOV A;  1FVI A;  4DK1 A;  4LF9 H;  3IAY A;  3DSQ A;  2VOB A;  1ZHQ A;  4A2B A;  3SR2 C;  1P16 A;  4DR2 H;  1IBK B;  4K8Z A;  1TVK B;  3JAS A;  4LF8 H;  5JCO A;  4Q0Y A;  4X1I A;  2VPS A;  4RB0 A;  2F4V H;  1V9P A;  4JI0 B;  1N33 H;  1HNX H;  3HKE A;  1BJT A;  3WB0 A;  5BMV B;  4JI4 H;  1B04 A;  1JMK C;  1XHZ A;  3S24 A;  4I50 B;  4X65 B;  4LF5 H;  4X20 A;  2CFM A;  3W1G A;  4X66 H;  5LL6 b;  1TA8 A;  2ZM6 H;  4DV7 B;  2E5L H;  3KAL A;  1SA0 A;  5IJ9 A;  2HHH H;  4LFB H;  4O2A B;  5JH7 B;  4FLX A;  3N42 B;  4EFE A;  2UXB B;  2P5O A;  4B3T B;  5CA1 A;  3RF2 A;  5EIB D;  4WBN A;  4DV4 H;  4LF7 B;  1TVK A;  5FNV B;  3C0F B;  4RB3 C;  3PN1 A;  5JJE B;  4LF9 B;  2PGG A;  3E22 A;  4DR2 B;  2KSW A;  4DUZ H;  5KHK A;  4NVP A;  4LF8 B;  1TAE A;  3N41 B;  4KL1 A;  2F4V B;  2CAZ C;  3THO A;  1N33 B;  2YIB D;  1HNX B;  4BWA A;  1JFF A;  4JI4 B;  3JAK A;  4LF5 B;  2Q2U A;  4F6R A;  5EZY B;  4TUY A;  4X66 B;  3CHX A;  5LYJ A;  2PTM A;  2ZM6 B;  3RYI A;  1P49 A;  3BAA A;  2HHH B;  3RYC B;  4LFB B;  4JI6 H;  2JGU A;  4CH6 A;  2F95 B;  3VQY A;  3HXL A;  2ZIO A;  2YI9 A;  4TOI A;  2UXD H;  1J5E H;  3K5N A;  4DV4 B;  3UQ8 A;  4AQY H;  2E3C A;  2ZJT A;  4TV9 A;  2R9A A;  5J2U B;  3SJC C;  3KXY T;  4TV8 B;  4L8J A;  4DR3 B;  1Q5O A;  4YJ2 B;  3J81 W;  4K0K H;  3RGX A;  4R7R A;  4DUZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...