4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
5LMUB 1HNWB 4CC6A 1A0IA 1VS0A 4EQ5A 1I94B 4DR5B 4DUYB 1XDNA 2Q2TA 1P8LA 1XK5A 3NBYB 4EEQA 3NC0B 5IWAB 5FPOA 3VNNA 4DR1B 4OX9B 4B3TB 4JI2B 1J5EB 4K0KB 3SGIA 5BR8B 4CC5A 3W5OA 4YHHB 4DR3B 4NXNB 2HHHB 4DV6B 4DV1B 4GKKB 3QWUA 2VQFB 5D1OA 4DR6B 3BAAA 4JI6B 5D1PA 1CKOA 2HVRA 3GDEA 1XNQB 1N32B 2HVQA 1N33B 2F4VB 3OTOB 4EFBA 3PN1A 2E5LB 3BA8A 4DUZB 3S24A 4DV3B 4LH7A 4NXMB 3RTXA 3TY5A 4X62B 3KYHC 4JI7B 3L2PA 4JI5B 2UUAB 4KHPB 4UFZA 4AQYB 4LH6A 2Q2UA 4X66B 4YY3B 1CKNA 1XNRB 4LF5B 3RR5A 4PZ6A 1P16A 4DRFA 1XMOB 2ZM6B 2VQEB 3W1GA 3BABA 1S68A 4JI1B 4LF4B 3GB8B 2UXBB 4B3RB 5D1OB 4UCTA 1ZAUA 5LMNB 1DGSA 3W1BA 4DV4B 1N34B 4TOIA 4DV5B 4PZ8A 3GJXB 3UQ8A 4DR4B 4UCSA 2UXDB 4B3SB 4LF9B 2UUCB 4GLXA 4LFAB 4DR7B 4UCOA 1B04A 1FVIA 1TAEA 2UU9B 4JI3B 2OWOA 4LFBB 1IBMB 1IBLB 4UCRA 4JI0B 4JYAB 4UCVA 3BA9A 1FJGB 4LFCB 3JSLA 2HIVA 2HIXA 2VUGA 3JSNA 1IBKB 4LF8B 4DV2B 1CKMA 1TA8A 1CKNB 3TY8A 3T1YB 4B3MB 2HVSA 4JV5B 4DR2B 1HNZB 1V9PA 1XMQB 1N36B 4JI4B 5DISC 2CFMA 4JI8B 4UCUA 4PZ7A 3T1HB 4DV0B 4X64B 2UUBB 4LF6B 4E6NA 4LF7B 3NBZB 3TY9A 4EFEA 1HNXB 5FPRA 4DV7B 1HR0B 1X9NA 2UXCB 4X65B 4GKJB
chains in the Genus database with same CATH superfamily
1MSDA 4LSAA 3AG4C 3N2GB 1EKFA 3HXLA 1BCCH 4DL4A 3NUAA 4LCUC 1V4YA 3W7WA 1GYFA 3CCLV 4O3QA 1SKVA 1WN7A 2RF4A 2H3OA 5LXTB 4J9SA 3QTCA 1NVPB 1I6UA 3HKBB 3RGZA 2AW9A 3U54A 2ETNA 3R5XA 2DZDA 4O4IF 1KKCA 2L35A 1OBGA 2YZLA 1CKOA 4X1KB 2JEGA 4HNTA 1S0NA 5J2TA 1GO3F 2HVJC 1S10A 2W70A 2FLNA 3SYQA 4UV9A 1N33B 1KT8A 4ZHQF 4FU0A 3GIJA 4EG0A 1I94H 1XUQA 5I5TA 1OZ0A 2UXDO 4EFBA 5IYZB 4IIJF 1I0HA 2DPIA 3OMNB 2HP8A 3TY5A 3CJHA 2AGAA 4B3TH 4C5CA 4WBNF 5BR8H 5B3SC 2Z3YA 5L1JA 3CEIA 1IBMO 2C35B 4DV6H 2LGWA 3CRAA 4RO2A 4DR6H 4YY3B 4LSXA 3SI8A 5GW7A 5JVDF 1IBKO 5KHHA 4ZOLA 1XMOB 1MZEA 2BE3A 4P2ZA 2E2HA 4MV6A 5KG1A 1SQFA 1EN6A 4M0JA 5CA1A 2BQRA 2IH1C 3EXAA 1N34B 4DV3H 3MAQA 4LF9O 4C5BA 3Q2OA 1JX9A 2Q4PA 1EUCB 3M7MX 4JI8O 4DR7B 4HNVA 1B04A 4YJ3B 4WBNB 4Y8VB 1M4UA 3JARB 1K1SA 5C5JA 5A9GA 1H2SB 4WD3A 1XQ8A 2RDCA 1IBLB 3HKEA 2P4KA 5JH7B 1RP3B 3ABLB 5EBMC 2VQEH 3JSNA 1JDBB 5J2TF 1K8AW 2LW7A 2QKCA 2C2RA 1S5JA 1CKNB 1KYOF 1FXKA 2Y4UA 4QJFB 5LHIA 1W93A 3ETEA 3RWRD 4CHIA 4DV4H 3T9BA 5BY1A 1IOVA 5IWAO 4FFLA 2CKZB 3FAVB 4O2AA 2HJWA 1KC8W 3QO7A 2ZJTA 2XAHA 4Z2WA 2VQFO 1CP9A 5FLMG 1XOUA 2DAAA 1EFRG 2YUAA 3L73H 4AYBA 4O4LF 5KUMA 3PW2A 5BWUA 4ZOLF 3B09A 4FM0A 4FBTA 4W4LA 5DQIA 1WP7A 3T9DA 5CA1F 1SS3A 1RYRA 3S3XA 2JJ1G 1SQPH 1P4RA 3AYHB 5FNVF 5LL6Y 4YJ2B 4FJCC 1OCOB 4NYEA 1PKXA 3AG7A 1OV9A 5DECA 5BPFA 3F7YC 3Q4HA 5KX5A 3K5MA 3CCQV 3CQZA 3RGXA 4JI4H 1R6KA 3GTLA 4CBCA 4MVZA 2BQUA 4CC5A 3MWEA 4H44B 2V5AA 4LF5O 4NXNB 2HHHB 3QNEA 5D1OA 3VBBA 2ZE7A 4P30A 2ZIMA 3TQTA 4MT8A 2Y0IA 4LNUA 3K9SA 1K3EA 1KEEA 3OGIB 4MV8A 1XNQB 3D3QA 2F4VB 2JEIA 3IC7A 3RN4A 5K2MA 3RYHA 4KUMA 4O2AF 2EIMC 2ZDIC 2HGWA 2B63A 3BQ0A 3JD4A 1KP3A 4JI5B 4D6TH 2QWOB 4TVIA 3ETQA 2QTSA 3HT5A 4X66B 3HO8A 2ZDQA 2XGPA 2CGNA 2NLJC 2COIA 2YW2A 2WDTA 3MWDA 2I8CA 1NH2D 1VP7A 2KG7A 3W1GA 4B3MO 4NZOA 3OTOH 4RUEA 2E5LH 1N0NA 2JGDA 2AGPA 1VBGA 4B3SB 2QSAA 5JCOA 3SR2C 4DR7O 4LFAB 2A0LA 5FR9A 3Q8PB 1FVIA 3ETHA 3T1HO 5LGTA 2GTAA 3LDCA 1SZTA 3ABMB 3OSPA 5IP7G 1AR4A 3CJHB 3F7VC 2W7OA 1HNXO 1PL4A 2YL2A 3T5JA 2XAFA 2A3QA 2DPJA 4DV2B 5CB4B 5EWEA 4MSWC 2W9AA 4DR1O 4FLVA 1WA8B 4O81A 4K0KO 3PJSK 5KFRA 5KFQA 4F4WA 2HLDG 4DYLA 5HFMA 1NR7A 4UB8Z 1ZL8B 4UCUA 4DV0B 4XX0B 3H4BA 2FYUH 4ZIBA 2OTJV 1TUEB 2R6FA 4PDLA 1XI1A 4C2MA 1I50A 4I0XB 3RB6A 1ZUQA 4GKJB 4MV3A 4HAMA 3HKEB 1WNSA 4MVUA 1VQNV 5KMGA 2ITCC 5HBRB 2W8LA 3VNNA 4QW9A 1FXKB 1SCUB 2R7LA 5EYPB 3UM7A 2WB1A 1XNRO 2EIJC 3H1LH 1KJJA 5KS8A 5L3GA 1GSAA 5I47A 1HR0H 1YITV 5JQGA 3GV7B 2UXCH 4LF4O 2V9WA 5LMNO 2DABA 2NNUA 1YDXA 3AG1B 2R92G 1GH6A 1VQ4V 2JK5C 2UVRA 3I56V 3K5NA 3K3VA 1WCMA 1N4CA 5DEDA 4NXMB 2YS6A 1VF7A 1SQQH 2RQ6A 5AG2A 2DIKA 3RYCB 3L2PA 3HKZA 1R3LC 2E76B 4EEYA 4JYAO 4TV9A 5EZYF 1H2LA 2XCPA 3CCRV 1FD9A 4ZI7A 3FX7A 3SPHA 5KX5B 3TJTA 4FLWA 4E4EA 3W7SA 4QWBA 2A79B 5B1BB 2W9BA 4AILC 3GTOA 1VQ5V 4FZ0A 2XT9A 3Q8QB 1VF6C 2C2AA 3FB6C 2UXBB 1I1KA 5D1OB 2RGRA 2HFEC 3BPZA 1HNZO 1V55B 3V4SA 5CAEB 1ZSPA 1XHXA 4LNUB 4PA9A 1CEZA 2GHYA 4RUCA 4JI7H 3DGEA 3V6JA 5FD5A 2ZDHA 3QO5A 2GUZB 4AQYH 3BQ1A 3UYYA 5C8YF 1AJPA 2I87A 4ECWA 4L1KA 2WLJA 4JI3B 1IX9A 1JR9A 3BFRA 5JQGF 4EGQA 3JCUZ 3UZBA 3AG3C 1PNMA 4JV2A 1T3NA 4BWSC 4LBEC 1Z5VA 1TWAA 1E4GT 2P6JA 5KFSA 3TY8A 1K5SA 2CGOA 4FFNA 4FFKA 2K9PA 5F2VO 4ETSA 4M7EA 1EN5A 1NVPD 3GTGA 2YZNA 2EX3A 3B8MA 4CH3A 3W7UA 4JV0A 5KT6A 2Y4RA 5KFBA 4RWUA 1KECA 2VPSA 5IYBG 3CMAV 2QK4A 4J11A 1K9MW 4GKKO 4QWAA 4FLTA 1Y1WG 3ABKB 4I7ZB 4RU9A 4K8ZA 2P4VA 3N43B 4PDRA 1Q3EA 1VQ8V 1Q7YW 1MSWD 4MTXA 4M9UA 1FJGH 3UCSC 1GM7A 3TY9A 1XBLA 5CBFA 1GK9A 3FFQA 4FE2A 3PVXA 4A3BG 1NJIW 3KG2A 3L71H 2DYSB 3T1YH 4TSFG 2ZXWC 3E2EA 2GQSA 3ASOB 1O9GA 3JAWA 4ICGA 2DW4A 3GLKA 4YAJB 1TGOA 5EIBC 3T9AA 3J7AU 1M6VA 3CSWA 1LR1A 2UUBH 4YHHB 4FLXA 5H6RA 4LF7H 1ZTEA 5I5YA 4G3IA 4IAJA 2IMWP 3ASNC 4J80A 5EK0A 3AK1A 2VOBA 2Y69C 4PHZA 3ZBHA 4JUZA 1E4EA 3RF2A 1SESA 4EB6A 4OX9H 1BZKA 3RW0A 3RUPA 4MW3A 3A0HZ 1RK6A 3RFCA 1Y67A 4LFBO 4DR3H 2XAGA 4DIMA 1KKDA 1TWCA 5KMGB 4Z1MG 4QPKA 2E3CA 4JI6H 4PA4A 4LFCO 5JJEB 2JA5A 3MFHA 2XAQA 3N6XA 2GSMB 3AG2B 2ZM6B 5BWRA 1IYDA 2FPIB 1SQBH 5L3FA 1S68A 2Q0OC 2HEPA 2ZDIA 3ZRSA 3K5OA 2UVUA 1ZAUA 3MDSA 3W1BA 1YJ9V 2QR4A 1JVMA 3STZC 1XMQO 4YB8B 3MR5A 1YCIA 2FK3A 4FS1A 2XC9A 5IY5C 2PBZA 2YI9A 3J81W 2Q7EA 5FLXW 4BBSG 2UUAH 4DL2A 4X64O 1KMIZ 1MOFA 4O7WA 2N04A 1KU9A 2WLMA 3SYOA 3W7TA 3GIKA 4PDMA 4LF8B 2EBOA 3MR2A 1HNWO 2HHFB 2NU6B 4D7SA 4TV9B 4MTOA 1KJQA 5DGBA 1AJQA 1U97A 4RQFA 1VIBA 4ZI7B 4DR5O 1B06A 3IC9A 1WRVA 4MAMA 3GV8B 4JV5B 4DR4H 4FMTA 4JI2O 4XZ3B 3GIQA 1AR5A 4X20A 3W7XA 3I55V 4H0LB 3CMEV 4MV1A 3AW8A 1M56B 2ADQB 5LGUA 4DLKA 1M7JA 3SPGA 2VUMG 1F4MA 3CCMV 1JFFA 5KFJA 3T54A 3RAXA 2WPDG 5C93A 5KT5A 3JALB 1N32O 1KTAA 2W6MA 2E2IA 4BBRG 4A93G 3SPJA 4EBEA 4DUZO 3GTJA 3G6VA 2DYRC 4BIZA 4K6NA 1RK5A 2YEVB 3R9RA 1RM1C 3GV5B 4ZQIA 3WWIA 4R8UA 4FBUA 3D36C 1SETA 1OCCB 3K08A 1QVFU 1NTZH 2NR5A 1A48A 1F23A 1L1FA 4LR3A 5I5WA 1JCHA 1R3KC 2X0LA 4DV7H 4LP8A 4J9PA 3DAAA 2GQRA 3IJ4A 3TW6A 3AG1C 5DG9A 4IRKA 3K79A 1XILA 4F6RA 1OCZC 5GONB 4XDLA 4O7SA 4QE7A 1YTFB 4RUAA 3ZMSA 2QM8A 3P3PA 4FLZA 1FKAO 2NUAB 3JAMN 4O4JF 2HR3A 3PFFA 1RFYA 2KQXA 3ZN1A 4O84A 3VPBA 3TCUA 5FJ8G 4DW0A 2UVVA 4BY1G 1BQZA 1BT8A 4I50B 5EOYA 4TUYF 2ADPA 1UPGA 4HZ3A 4LH6A 4JI0O 2R9IA 2IH3C 3CEBA 4U7NA 3U0GA 3PZPA 1JDEA 3OSNA 4OPHA 3DSQA 2BOBC 3PW5A 4MS2A 1N33H 4ED6A 4ED0A 1QR8A 5EBLC 2FLPA 2UXDB 2PYLA 1N36O 2PUSA 2COJA 4X1IA 2AQ4A 4MV7A 3PR5B 4ED1A 1BGYH 2ZE6A 4FFBA 4FVMA 1AP5A 2F1MA 4LF6O 4YY3H 1Y14B 2J6UA 3CWBH 3D8CA 1VF6A 2PF4E 1IBMB 3FYIB 1WJZA 1YSCA 2ZGIA 1XMOH 4X65O 2GPSA 1PPJH 1IBKB 2OTLV 3CE2A 1Z2OX 2GTSA 4CH6A 1RPRA 5GTHZ 3FKIG 3GTQA 1DF4A 1EZJA 2VS0A 1JIHA 4A3CG 3O9OA 1N34H 3CC7V 4Q4DA 3L74H 1I5YA 2V1DA 4I4TB 3B2EE 1R9TA 5LYJB 3E5NA 1THZA 2AHZA 1NTKH 2CH7B 2P5OA 3R5FA 5DISC 3C3TA 3KKYA 3CB2A 3H0GG 3ZRVA 1S77D 4J9QA 5KHJA 2IW5A 4JI8B 2PMZA 2QWPB 3EHBB 3H20A 2R8IA 3ETDA 5B66Z 4PZ7A 2RGVA 1IBLH 2WSSG 1FXHA 3QF7A 2ZNJA 3ORQA 1DIKA 1VQKV 4E6NA 1GAXA 5DAAA 3HOWG 4I7HA 5L1KA 2QWQB 1SQVH 4O4HA 3APQA 2QKAA 2R85A 2XCLA 4KL1A 4ZHQA 2ZD9A 4QPJA 4I5SA 1PD3A 4IIJA 2P06A 2IJIA 5E25A 2R8JA 3NC0B 4B7EA 5IWAB 4A3FG 1R73A 3E8FA 3A0RA 1N0JA 1SA0B 3H01A 5KG3A 1OCRB 1M5IA 1NTMH 1NR1A 4DV1B 2VQFB 4L87A 5JVDA 3UFXB 1NKDA 2EIKB 3K58A 3A8TA 2VRZA 4EBCA 4B3RO 4ED3A 2CTPA 4JXUA 4DV5O 1PNLA 1M0TA 2PTMA 3H1HH 2J9GA 1JFFB 2W6OA 5KFEA 1TUBA 1AI5A 2UUCO 1BHBA 2J6SA 3BVOA 1L8DA 4RZRA 4PA7A 4IL6Z 4IGGA 3GTMA 3T5HA 2V4DA 1R6NA 1YVWA 1WR2A 3T5LA 1U96A 3H1IH 4TV8A 2HHHH 2D2CB 3JATA 4NXNH 3SYAA 5KHKA 1R3IC 4NR1A 1RSOA 4R8UB 4LF5B 1AR1B 2WAQA 4UVCA 3PO2G 4FM9A 4IR1A 2R70A 1I2LA 2FB9A 4O4HF 1OWTA 3X2QC 1NZ6A 1XNQH 4F4YA 2F4VH 5LHHA 1B33N 3AEIA 2BCCH 3N40P 2HG8A 3HBLA 3E8BA 5JWPA 1R6TA 3QQMA 5ITZA 1SC5B 3LDDA 2COGA 3N27A 3FDSA 2ODMA 2ZE5A 3JYCA 4F6RB 4HNAB 5H2FZ 1VQPV 1GM8A 2PYJA 1JOYA 2YXLA 4JI5H 2YDEA 3AK2A 3F5TA 4X66H 4RNMA 3LUTB 1DV2A 3EPIA 2WA4A 4ECYA 2W71A 4YAKB 2OWOA 4YJ2F 3UO3A 4R8CA 3BA9A 4O4LA 2RN9A 1S0MA 1QCEA 3R23A 2ODTX 2YIBA 3T9FA 3TIGA 3CHXA 2NU7B 4WHXA 2DWDC 4P9OA 2ZR3A 4DUYO 5D8DA 5B1AC 4B3MB 3ETGA 2CW8A 3ZJZA 4B3SH 5IJ9B 4IYIA 5FNVA 2QJ1A 3DXRB 1J5EO 4FFOA 4LFAH 3HOVG 5DG8A 5BWWA 5IYCO 1Z2PX 5DG7A 4TV8F 1PNKA 3TW7A 3T5KA 1V54B 4GX2A 3TXSA 3T1HB 3G6XA 3OM3B 4O7TA 3GWKC 3KCXA 3BHPA 3HR0A 3QVNA 3RT3C 4FFBB 4EFEA 5FPRA 1HNXB 3L4KA 4DV2H 4IYHA 3UT5A 1VQ7V 3CD6V 2ARHA 1G6UA 4NZNA 3QO8A 4IHJF 2BQ3A 5IYDG 5LP6C 4EQ5A 2ILMA 4MV4A 2YYAA 1Q81W 3ZS8C 1BQ0A 4DR1B 2ZQMA 2K1EA 4K0KB 2E74B 4QWCA 4J0MA 3H4DA 2FJZA 2F23A 4DV1O 4DV0H 4DW1A 2VR1A 1P7BA 5C4XG 2NVXA 3OT7A 1FPOA 5DGAA 3WG7B 4JI1O 4BWAA 4KP4A 4GKJH 2C00A 2B5UA 4N21A 2HVQA 4WF9V 4O4IB 3VPDA 4YP3A 2IU3A 3R65A 1T5EA 3CX5F 3T7AA 4QIWF 2WAMA 4HYKA 1Q6HA 3ZX6A 4U3JA 1R3JC 5DN6G 5I5UA 3H1JH 1M1KW 3C0FB 4IIJB 4J7KA 3ETJA 1XNRB 1PM9A 5JQWA 2DOSA 1Q6UA 3OEEG 4JYYA 4R7RA 2O57A 1W59A 4P9PA 2GPWA 2FMAA 1QBZA 4LF4B 3RIZA 3J80W 1TWFA 1D2DA 5LMNB 5JVDB 5E79Z 1GN6A 3K5LA 4NXMH 4F50A 4FFRA 2JA7A 3U11A 4N23A 1G2WA 1DF5A 2LFRA 1I1LA 2EINB 3EYYA 5H6QA 1OBDA 1COWG 1S76D 3CRCA 1TUBB 4TQSA 3A2FA 5KFPA 4JYAB 1FS0G 4UCVA 3GIIA 2VUGA 4HQ6A 2QB5A 5KAIZ 2OCCB 5LMUO 4GX1A 3ZRWA 1Y6XA 1JXLA 2QGNA 3N2KA 3R66A 2P7TC 2X5RA 1TA8A 1Y74A 3U10A 1MMMA 1E1RG 2UXBH 2A06H 3ZMVA 5CMUA 3WO0A 5H5NA 4X9QA 1Q90D 2WLIA 2EILB 3JZ6A 1RJQA 3HKCA 5D5PA 1HNZB 1H8EG 1HDJA 1I7NA 2B63G 3BCCH 4A3LG 1Q8IA 5J2TB 4MVQA 3CYOA 3WU2Z 5DQGA 2OLSA 3GIPA 4J9LA 1ROPA 2R7ZA 4JI3H 2OH2A 1R1BA 3NXSA 4O7LA 2P67A 1KJ8A 4O3RA 1M57B 1V51A 2HJDA 1KUTA 2A7WA 5CA0F 1AJNA 3MHSC 4X1YA 4GZRB 1A0IA 5DQHA 3M99B 4I55A 3ZMUA 2E75B 3N8DA 4X62O 4ZOLB 3VQWA 1YF2A 3ZIAG 4KHPO 5KFAA 3G6YA 3H3VH 4TQDA 5CA3A 3LULA 2F95B 5CA1B 2VPQA 4MTGA 2GLTA 4GKKB 3SJAC 4R50A 5FNVB 5EZYA 2DWCA 5CR5A 3DTUB 2QE7G 4A3KG 4DK1A 1VMGA 4ECTA 4H13B 1YIJV 5KG7A 1BL8A 2W6IG 4GX5A 4X8AA 4QW8A 2W9CA 1P49A 1NI8A 1PK8A 2RDIA 2YS7A 3ZCCA 3UT5B 1HW7A 2Q7DA 2UU9O 2CK3G 2VQDA 4FIPC 5KHGA 2WLLA 4YHHH 3QZ7A 4QGPA 1XEQA 3CCEV 1Q82W 1S3JA 2BTQA 5C8YA 3HOXG 3QFFA 4O2AB 1BNCA 2R7MA 4H33A 1ORQC 1GO3E 3K04A 1JA8A 2WLHA 2Q8VA 2X6AA 2IJHA 4EYHB 4I55F 3N41B 2OT5A 4TOIA 2ZDGA 3K5HA 5JUMA 1SQGA 2QM4A 4JGSA 4MW8A 3QZ8A 1TAEA 1E1QG 1FAFA 2V4QA 2ASDA 3OMAB 4J9YB 3OUZA 3H1KH 3SDLA 4LFBB 2ZINA 4CS3A 3JAKA 3Q4HB 3CCJV 4LFCB 2ZM6H 3G80A 3IGAC 3GIDA 1I94O 3K0DA 3IG0A 1T36A 1J95A 1WCMG 1UC8A 1A3GA 1NBMG 3JZIA 4B3TO 3ABTA 3LNNA 1KJ9A 5BR8O 3B77A 5L1LA 1XMQB 4JF3A 4MA5A 5JJNB 4JTCB 2C22A 4C5AA 5F9LA 3JD0A 4DV6O 5KFXA 4J7ZA 2BR0A 4DR6O 1S72V 1MNGA 4X64B 4TQFA 3G6BA 3RYHB 3ABLC 3L72H 3U55A 4NVPA 3NBZB 4TWKA 5KFWA 4LF8H 1IOWA 4WFAV 1A9XA 2AXTZ 4IRDA 1HNWB 5LOVF 3P30A 2QEXV 2EJ0A 4DV3O 4JV5H 3AK3A 4HN2A 4DR5B 3RAQA 3VPCA 4K35A 2HVKC 1Y74B 2KG7B 2M7WA 2ZT9B 5KA6A 1K33A 3JD3A 1IYEA 3T9EA 4JI2B 3LMLA 5K3WA 3U9SA 4I9QA 4BW5A 3HKCB 2N74A 2JGDB 2V59A 3L9DA 5HV6A 3E8HA 3MR3A 1XDCA 1D5AA 5LP6A 2VQEO 2VA2A 4IWYA 3RYFA 1K4DC 3V6KA 2HVRA 1T94A 5BMVA 1DTOA 4YQWA 3OFNG 1N32B 4Q8FA 5KG6A 1QHTA 3FB7C 3E35A 1QVGU 2QA4V 5J9PC 1OCOC 4DR2H 4DUZB 1K4CC 2C2EA 4O3SA 3NR7A 2ZIOA 3SNOA 2R9AA 1FYJA 5HFLA 5KFGA 4XBFA 4WFBV 2DQ0A 4OPAA 2VA3A 3H40A 4PZ6A 3ZHUA 2YU9A 1P16A 1ZHSA 4RB2C 4O7YA 5KG0A 4BAYA 4DAAA 5KG5A 3BABA 3GILA 3GVMA 2FMLA 3O65A 1YJNV 1QR9A 5KA5A 5B1NA 5EZYB 1DGSA 2DE0X 2W6NA 4A2AA 1EBOA 4J9ZB 3VOTA 4JV1A 2B1IA 2CNQA 3RB4A 4A5UB 1AUXA 1GSOA 1E4FT 4JI4O 4UVAA 3OGCC 3OE7G 1QLEB 4FPPA 4XYMB 4I9WA 1WLEA 1H2NA 2EZOA 4W4KA 5BWTA 2W9CB 1XREA 1EHIA 3JZFA 4AYBE 5FLXN 5LP6F 4JI0B 1PX2A 3RV3A 3LSUA 2HIXA 1W96A 2WLLB 3CRMA 5BMVF 2QWNB 5GTIZ 2CNUA 2BTQB 2EILC 3K9AA 5C8YB 1SEIA 4YR0A 4CH4A 2QDOA 3AG4B 4GYCB 3ZHQA 2HVSA 2UXDH 5CN0A 1BE3H 1N8RW 5JQGB 4WFGA 1I2KA 2IA6A 1GLVA 5KFFA 1N36B 1I08A 1GMGA 3TQ1A 3WB2A 1PV0A 3ABMC 1KC7A 2JA5G 1IBMH 5KG4A 4LF6B 2XTAA 1WB8A 2V7QG 3IFXA 1S5LZ 1LNQA 4TM5A 4RB0A 1IBKH 1GN2A 3T4DA 4X65B 2F66C 1S5HC 3ZMZA 3SYCA 3OTOO 2YWVA 4E2LA 5IYCG 4ECUA 4DL6A 2E5LO 1N48A 3JAKB 2HJFC 1K7DA 3KZIZ 3G8DA 2W9BB 2RDJA 4DRXA 4NYKA 1YXBA 4O4JA 4LF9H 3UZOA 3JD1A 3J7AK 4JI8H 4Q43A 5B3SB 3IAYA 4IT5A 3G6EV 2W6JG 4TUYA 1Q5OA 3V4ZA 1XHZA 4QNHB 5EDWA 1VARA 3B40A 3LSSA 3CXCU 2ASLA 4FGRA 4HNUA 4O3PA 1BXRA 4MTFA 1SF9A 3JCZA 5KT4A 4Q8EA 1MZBA 3LWBA 2FKXA 5IWAH 2JDIG 2JS5A 3TIIA 3NGDA 1FXKC 3SJQC 4J41A 5KFDA 2XGQA 3RB0A 3D3IA 2CE4A 4DV1H 1VQLV 3QG5A 1G4YB 3N2GA 2VQFH 3DTFA 2RCVA 3LQSA 4A3MG 2NU9B 5LYJF 5A2QW 2WE6A 3BRCA 1RJPA 3FB8C 1AI7A 3GB8B 3HB3B 4B3RB 5LXTA 4O2BF 4RB3C 2R8KA 2KKWA 3HKBA 4DV5B 1BSMA 1S9FA 5LA6F 3GJXB 1TWGA 4UCSA 2C28A 2UUCB 3TINA 4X1KA 3C90A 3WB0A 2ZCEA 3CS5A 3ZHTA 1EZ1A 1SQXH 4PA6A 1SRYA 1S0VA 5J2UF 4LF5H 3JAWB 2XUMA 1Z5WA 3UO2A 4UCRA 3TK1A 5B1BC 1UC9A 1HR0O 2UXCO 3KXYT 3M8AA 2W0XA 2R9RB 4O7VA 2R93A 1V55C 2SCUB 3CVZA 1ZETA 2JEUA 2FLLA 5L1IA 3IN5A 3WWHA 3MD0A 2JA6A 1VQ9V 1K34A 2Q73A 5IP9G 4ABMA 4ECZA 1H2KA 4DL3A 1K5QA 4GCZA 1Y1VA 4J42A 2WB1E 1C30A 1BGWA 3T4ZA 4JAUA 1YZBA 1E4EB 2WLNA 4CH5A 5FL7G 4EB6B 1XL4A 3JASA 2FPGB 3ML0A 5EC1C 5H9CA 3JAMW 1X9NA 1LUWA 2DMXA 1E79G 5LXTF 4YJ3A 2GDSA 4WBNA 4B3MH 1VS0A 3HOUG 1Q43A 2XCAA 2ITDC 4B08A 5KLVH 4RUFA 4DUYB 1ZX3A 3WFVA 4JAVA 2Q2TA 4JI7O 4EEQA 2F43G 4XDKA 1TVKA 3EFFK 1JMKC 4DR7H 1J5EB 2EIMB 4AQYO 2YZMA 3ABKC 4OXSA 2H8PC 3T1HH 4EYIB 3AX6A 3FYEB 2N05A 4QJFA 5KHIA 3HKDA 5IYZF 3KCYA 1QLNA 2Z0AA 1BMFG 3I12A 5I60A 1HNXH 3VMMA 3FAVA 2ATLA 3GDEA 2LO1A 4BR6A 2PN1A 2DYSC 1ENVA 4UUGA 1S0OA 3HB9A 3DC5A 1H2MA 1K92A 1GM9A 3ASOC 4XDJA 5LBQA 1G1XB 4L8JA 3RBEA 4NTYA 3KAKA 2GV9A 4JTAB 4LH7A 2ALZA 4DR1H 4MVMA 2ZNIA 4K0KH 1Z2GA 4EBDA 1KUQA 2X0SA 4E4TA 4CKBA 2JA8G 1FJGO 4O4JB 2CQYA 5IT9W 1IZ3A 2D3OW 1EZVH 4DRFA 1YEWA 4YJ2A 3OEHG 4X20B 2FP4B 4PDBA 5KFYA 3BG5A 4TUYB 4K3AA 3FMAA 4R7CA 4JI1B 3T1YO 4YJ3F 3OUUA 3APOA 4FLYA 4G28B 3B4SA 1SERA 1GN4A 4UCTA 2XD4A 5CBGA 2R87A 3CP1A 4ED7A 4U3FH 5KFVA 5JH7F 3U0ZA 2BOCC 2PGGA 1B6QA 2ASJA 2UUBO 4U6PA 2KB1A 3TETA 1XNRH 1YJWV 4LF7O 1ULZA 4J9NA 1MZFA 2LGQA 4DL7A 5CBHA 3AG2C 2R7KA 4EGJA 5KFLA 3ABUA 4LF4H 5KFTA 5LMNH 2R72A 3M4IA 3E22A 1IDSA 4IHJA 2IJJA 4PD4F 2R8HA 1H38A 3S3WA 4OX9O 4DXWA 2Q0AA 2Z5UA 5T14A 3VQXA 2JEXA 2QWRB 4AI8A 3OUFA 3ZHVA 4DR3O 1S03G 2CFMA 4JI6O 2XASA 3K0GA 5C3EG 2CZGA 2AZ0A 2P0AA 3BEHA 4JYAH 2P90A 2FB5A 2EIJB 5BWVA 4DQNA 4O7ZA 4PELA 3RBZA 4GX0A 2BTOA 5LMUB 4O7RA 3SYPA 1ZLZA 5K1PA 2Q6AA 1RYSA 5BPHA 1AP6A 4EKWA 5DMXA 1HNZH 1IXBA 5TISZ 4ED2A 1GTOA 1AB3A 1SYXB 5IJ0A 1B6RA 3CPWU 2GBOA 2LP7A 5FPOA 3OHAA 4WFFA 4RB1A 1NQTA 2ATKC 4NTWA 2UUAO 1DAAA 1FFTB 5KFOA 4A3JG 1PP9H 5B1OA 1KBLA 4QIWA 1Y66A 1M56C 5CB4A 1EUDB 3TXQA 1WPBA 5DGIA 3KHRA 1P7GA 3Q8RB 2CDYA 4X1IB 2I80A 1WA8A 2YRXA 3MR6A 2EJ2A 3PR4A 4HYOA 2CTWA 4PWQA 3K06A 3OR6C 3ZRXA 1ZL8A 4DR4O 2X7RB 3JASB 3S24A 1FFXA 2JGUA 4YBZB 4X62B 1OCCC 3G71V 1SFOA 2VWKA 4RQEA 4I0XA 3RGBA 4D7TA 5L3EA 1OHHG 4KHPB 4GKKH 4KFMA 4O3NA 2VWJA 2MW2B 2EULA 5DLGA 1TVKB 5B5EZ 3KHGA 4RAIA 4DO2A 3UKMA 3KHHA 4ECXA 3GTKA 3BQ2A 3AG3B 2CTRA 1Y76A 4GC7A 2YZGA 4ECQA 2FK1A 2Z04A 2RJZA 3D36A 3HKDB 5EYPA 4ECVA 2R7NA 5L3DA 3E83A 2IM9A 4PZ8A 2OCHA 1WP8A 3M9MB 3J80N 4ZBMA 2ZKOA 4GLXA 4J9OA 4O4HB 2RNBA 2Y0PA 3MHHC 1KBHA 4UCOA 1NT2B 2QKSA 3M9NB 2UU9B 3L70H 2HG5C 5BYBA 4ZHQB 5CB4F 1AUVA 2CW7A 2R86A 4Q4CA 3VA7A 5DM6V 2XHBA 4DV7O 4IR9A 2W0FC 1Z2NX 3JSLA 4K8XA 1O75A 2Q68A 2JEFA 1KQSU 4ZKIA 3K3PA 4Q0YA 5CA0A 3LP8A 3ZEDA 3KTMA 5H80A 3RYCA 5KFMA 2F93B 5L3CA 2R8GA 1F51A 4GT1A 2ZXWB 1CE8A 4YIPA 4UXNA 4RNOA 1ZHQA 2OIGA 4TQRA 1JPXA 2QTOA 2IJKA 4B7KA 2WA3A 1KD1W 2AGQA 2DLNA 2LW1A 4LFBH 2HDKA 1K1QA 4O86A 4CKEA 4LFCH 1AVMA 1HP8A 1W0KG 1F4NA 3STLC 2YCHA 1VEWA 3KALA 1N33O 4IWXA 3ASNB 4TV8B 1EM1A 3JATB 3I4NG 2AGOA 4A3DG 2NVYA 2GUZA 4FFPA 1RSOB 1L2ZA 2FTKA 2JA7G 2Y69B 3A0BZ 1I94B 1VF5B 4LC1A 3N44B 3NBYB 1XMQH 1QQCA 4RAZA 3JD2A 1B6SA 3CRQA 4QE9A 4B3TB 4J9MA 4NTXA 5BR8B 5BZBA 3E22B 4IHJB 4YY3O 4Q20A 4X64H 2XAJA 4GUNA 4DV6B 5ITZB 4TT3G 4DR6B 3BAAA 2W57A 1XMOO 5D1PA 3CC2V 1YTFD 2AHYA 2OIEA 1VQ6V 3GIMA 3B8NA 1HNWH 1WH2A 2V4RA 1N34O 4PBCA 4DR5H 2YXYA 3I5DA 4O4LB 4DV3B 5HNEA 5KX5F 4CMDA 5KFIA 2CAZC 1QU7A 2HKOA 1G8MA 1WPXA 4JI2H 5KT7A 4CKCA 2FKLA 2Y0SA 5IY5B 5KUKA 2HGSA 4UB6Z 4MA0A 2CNVA 2R7ZG 1OCRC 4GC6A 4UFZA 3L4JA 1IBLO 5I5SA 4BW9A 3N42B 3FB5C 5IJ0B 3RVYA 2UVWA 1MA1A 2EIKC 1OJHA 4XYLB 4BXXG 2X6BA 3TGUH 2VQEB 1N32H 3I4MG 1CQJB 1AI6A 1TWHA 5BYAA 3Q1KA 4Q6GA 4DV4B 4DUZH 3K03A 5F9NA 5C1OA 2L6LA 1W0JG 2PI5A 2QM7A 1JX4A 4YR3A 2PMZE 1GRJA 4PV1B 1FFXB 3H9VA 4FLUA 3THOA 3MJFA 4O83A 4MVRA 4YR2A 2JRIA 4ECRA 1BJTA 3VQYA 2RMKB 2IP4A 5LHGA 2W6PA 2YIAA 5LOVA 1Q6IA 5KT2A 1L0LH 1FKAH 2R92A 2PY5A 3OAAG 3SJBC 3Q8SB 2DYRB 1Y76B 1RM1B 4JI4B 4UVBA 1DV1A 2J6TA 1EKPA 4NXNO 2HHHO 3RYIA 3BY6A 1PL0A 1CPYA 1KB9F 5KAFZ 4HBNA 2M6YA 2YIDA 3KHLA 4JI0H 1JJ2U 2W8KA 4JYCA 2EJRA 4Q45A 3OHBA 1XNQO 1K73W 4F4XA 2F4VO 3OUSA 4U3JB 3RB3A 3DTGA 1OCZB 1WAZA 1QNMA 4Q44A 4F4ZA 1EKVA 3BJYA 3CCVV 1P8LA 3PW4A 5BXZA 4RZQA 5CA0B 4PDVA 1N36H 4JI5O 4CS4A 3SGIA 2CTQA 2YSUB 4X66O 1V54C 4CS2A 2HHFA 2Q7HA 3W5OA 2DN9A 2XIGA 3MWMA 4LF6H 2MCTA 4A3GG 5IE9A 2WAQE 1EYZA 5L3BA 1KJIA 1IVSA 2NN4A 2IBKA 4NZMA 2H94A 3OD4A 4X65H 2WTFA 1DK1A 4MVOA 2Z02A 3OMIB 5KKNB 4YIOA 1YI2V 4O82A 3BACA 1N56A 3OTOB 3PN1A 1L0NH 4B3SO 5D5QA 2E5LB 2O03A 2UXNA 5C44G 4LFAO 3LDEA 3ZRWB 4O7NA 3N2KB 4F4LA 3JALA 2R84A 3M9OB 1JJOA 1ZQ7A 3P32A 1NU1H 1M90W 2WLIB 1I3QA 4J9KA 4ED8A 1Y1WA 3RR5A 3WG7C 1I1MA 4HR7A 3RBDA 2YEVA 4DV2O 3ZHSA 5KFHA 1ZWIC 2QF7A 3CCSV 1DLBA 5DGHA 2M05A 2Q69A 2QYZA 4DV4O 1JLLB 4IZOA 1FXVA 4YXWG 2ZR2A 2JEJA 5LL6b 4BIOA 3UQ8A 2JIZG 1M0WA 3WNZA 3HOZG 4X1YB 4BIUA 5IYDO 4QIWE 4APMA 4DV0O 3EPGA 5GONA 4TV9F 4I55B 5IDJA 1GN3A 4F6EA 4ZI7F 3VQVA 2WYOA 4GLWA 1W2BU 1UFIA 5DLFA 4ME6A 5EWGA 4PA3A 4GKJO 4FS2A 1AI4A 4B3RH 5KFNA 4DK0A 3RJ0A 4I50A 3FD9A 3KAJA 4DV5H 5C1PA 2ZE8A 1MABG 4FM2A 2UUCH 1A0GA 3SJCC 1M9NA 2PVPA 4JTDB 2KSDA 2EINC 1BS3A 3VOUA 5KFCA 1Q86W 3RVZA 2BSKA 1CS0A 2FE3A 1A32A 4G2KA 1IXMA 4LMYA 4MTEA 2AZ2A 4R6ZA 2DWEC 2AU0A 1D5NA 3J81N 2NU8B 2OCCC 2YI8A 2ABJA 3K59A 2V58A 4U7CA 1HR0B 5CE8A 3F5WC 2UXCB 1VBHA 1X4TA 3PW0A 1P84F 2PZSA 4NXMO 3U9TA 5BWXA 2WWWA 1SZXA 1XDNA 1IURA 1XK5A 3ZN0A 3OW2U 1NS1A 5L9XA 1JQ0A 5LOVB 5GONF 3HPLC 3JRXA 4RAYA 1M57C 1UJWB 3QWUA 4UUJC 3ZHRA 3K57A 4QSHA 2B9ZA 4I4TA 4FM1A 5LYJA 2UXBO 2W7PA 3RYIB 2CH7A 4LWSA 5I5VA 3X2QB 4I50F 4JZ2A 4O2BA 4DUYH 4JASA 3RFRA 3T9CA 3GWOA 5LA6A 4FFMA 4MTDA 2JVDA 4ECSA 1J5EH 4KXRA 3KYHC 4JI7B 2W6ZA 3EVKA 3KREA 2P22C 4J10A 3V6HA 4JI3O 3RV4A 4AQYB 2YRWA 3G8CA 2YC0A 5J2UA 1AILA 2YS8A 1URFA 1US6A 2VUMA 2R82A 3LSQA 5JJJB 3SPCA 1EN4A 1VKZA 3E8GA 4C7UA 5A2QN 1SA0A 2Q9LA 4X89A 5EIBD 5B1AB 1O9HA 4QWEA 2XOKG 3CRRA 5FD6A 4JPRA 4QWDA 3PO3G 1BHAA 4ASUG 2Q7GA 2JS3A 2Y4TA 2FK2A 4JYBA 4WFHA 1GSHA 5CM0A 5EC2C 1JKJB 4I4TF 1FJGB 4O3OA 2HIVA 4NB5A 2X6CA 4J9RA 5EBWC 4FK5C 4JI1H 5E1AC 5KFKA 1NH2B 2DQ3A 3T1YB 5KFZA 5LP6B 3GQCA 4AHCA 4DR2B 3RYFB 1F7YA 3R5HA 5BMVB 2Y0SE 2EJ3A 2XNDG 3CSXA 4CZZA 3DC6A 4YHHO 4Z1VA 4A3EG 1B3QA 3WB1A 3E89A 4NLGA 1I7FA 2UUBB 4JAAA 2CUGA 1ET0A 4LF7B 2UXXA 5IYZA 4MV9A 1Y4MA 1RPOA 2DJVA 4HNAA 5K1XA 3ICXA 3HOYG 4CC6A 2YIBD 2LFSA 4PI0A 3SPIA 5KT3A 2A9HA 4OX9B 3JRWA 4A3IG 2MK3A 1H2GA 1VAJA 3DF7A 3G67A 3C3SA 4DR3B 4IRCA 2FPPB 4OGQB 4JI6B 2ZM6O 2Q67A 3CC4V 2PI4A 4X88A 2EJ7A 5IJ9A 3DXRA 2R93G 2BSKB 3K3WA 4UV8A 5LMUH 1H8HG 4BY7G 1XL6A 1HWYA 1X59A 1I7LA 3FKIA 2JA6G 3JARA 2B1GA 3BA8A 3GTPA 3RTXA 4A2BA 2IU0A 4NKGB 1Y1VG 5JH7A 4WCEV 1RJRA 1GGOA 2Y48A 3E86A 3GB7C 5LGNA 4H37A 2UUAB 3H0GA 1WB7A 2Q2UA 1CKNA 3WO1A 4J7JA 5JCOC 1C3OA 3SE7A 4CE5A 3F8NA 4LF8O 3HKZE 3T99A 3FKSG 3P3NA 4PJ0Z 2WLKA 2YXHA 2G38A 5EWFA 2JJ2G 5IT9N 4PI2A 1VQMV 2C2DA 3CCUV 4JV5O 3L75H 3N6RA 1S97A 4DR4B 4X62H 1UNNC 4LF9B 5KG2A 4LWSB 2YICA 1K97A 5KFUA 1CQIB 1K83A 1GKFA 3OR7C 4O2BB 4KHPH 3OTFA 4FZ1A 5I5XA 3WWJA 1AN7A 2A1HA 4G27B 5LA6B 4DRXB 1KP2A 4O4IA 3MFIA 2HGXA 4CMFA 5IYBO 1MG1A 2EZPA 2Q5ZA 4JZGA 1I5XA 1CKMA 4DL5A 3PW7A 1M93A 4MVSA 5J2UB 1VQOV 4DR2O 1LUVA 4RCNA 3ORRA 2KSWA 4U7OA 3CXHF 1WSCA 1V9PA 1QLEC 2LJ2A 3K5IA 2UU9H 2IBZH 2FL4A 5JVLA 1YHQV 3TEKA 3G4SV 4WFEA 3ZMTA 2OYQA 2EIYA 2W6QA 2LQTA 3T2MA 1AROP 3T1CA 1CXZB 4DV7B 3LNMB 4RNNA
chains in the Genus database with same CATH topology
3JATB 4LSAA 3N2GB 1HNWB 3HXLA 1L2ZA 4JV5H 1I94B 4DR5B 3N44B 3NBYB 1XMQH 1QQCA 4RAZA 1GYFA 1SKVA 4B3TB 4JI2B 1WN7A 3LMLA 5BR8B 5LXTB 3E22B 4IHJB 3QTCA 4I9QA 1I6UA 4X64H 3HKCB 3HKBB 4DV6B 3RGZA 5ITZB 4LR3A 4DR6B 3BAAA 2W57A 5D1PA 1D5AA 5LP6A 3RYFA 1CKOA 4X1KB 4DV7H 2HVRA 5J2TA 5BMVA 4F6RA 5GONB 1N32B 1WH2A 1HNWH 1N33B 1I94H 1QHTA 4FLZA 4DR5H 4EFBA 5IYZB 4DR2H 4DUZB 4O4LB 4DV3B 2CAZC 2ZIOA 3TY5A 2R9AA 4B3TH 4JI2H 5BR8H 2HGSA 4I50B 5EOYA 4UFZA 3L4JA 4DV6H 4LH6A 4BW9A 3N42B 4DR6H 4YY3B 5IJ0B 4LSXA 4PZ6A 1P16A 1ZHSA 5KHHA 4ZOLA 4RB2C 3DSQA 1XMOB 2VQEB 3BABA 1N32H 1N33H 1SQFA 5EZYB 5CA1A 1DGSA 4A2AA 4Q6GA 4DV4B 1N34B 4DUZH 4DV3H 3MAQA 1E4FT 2UXDB 2PYLA 2PUSA 3M7MX 4X1IA 4DR7B 4MV7A 1B04A 4YJ3B 4WBNB 4FFBA 1M4UA 3JARB 4FVMA 2F1MA 4YY3H 1FFXB 1H2SB 4FLUA 1IBMB 1XQ8A 1IBLB 3HKEA 3THOA 4JI0B 5JH7B 1XMOH 2VQEH 2HIXA 3JSNA 1IBKB 1Z2OX 4CH6A 1BJTA 1S5JA 3VQYA 1CKNB 2BTQB 5C8YB 1SEIA 4CH4A 4DV4H 1N34H 2YIAA 4GYCB 3RWRD 5LOVA 2HVSA 1FKAH 2UXDH 2PY5A 4I4TB 3SJBC 3B2EE 5JQGB 5LYJB 4O2AA 2P5OA 2ZJTA 1N36B 4JI4B 5DISC 3CB2A 3WB2A 5KHJA 3H20A 4JI8B 3RYIA 4PZ7A 2RGVA 1IBLH 4HBNA 1IBMH 4LF6B 4JI0H 2ZNJA 3QF7A 4E6NA 4RB0A 1IBKH 4FM0A 4I7HA 4X65B 4O4HA 4U3JB 2F66C 3L4KA 4KL1A 4ZHQA 3JAKB 4YJ2B 4IIJA 1P8LA 4DRXA 4O4JA 4LF9H 4RZQA 5CA0B 5KX5A 5IWAB 3K5MA 3NC0B 3RGXA 1N36H 4JI4H 4CS4A 3J7AK 3SGIA 4JI8H 2XIGA 4CC5A 4CS2A 3IAYA 2Q7HA 1SA0B 3W5OA 3MWMA 1M5IA 4TUYA 4NXNB 2HHHB 4LF6H 4DV1B 2MCTA 1Q5OA 2VQFB 5D1OA 1XHZA 5JVDA 2ZIMA 4LNUA 3K58A 4X65H 1XNQB 2F4VB 1M0TA 2PTMA 3OTOB 1JFFB 3PN1A 5D5QA 1TUBA 1MZBA 2E5LB 2O03A 3RYHA 1L8DA 5IWAH 2JS5A 3N2KB 2V4DA 3JALA 1JJOA 4JI5B 4TV8A 2HHHH 3ETQA 3JATA 4DV1H 4NXNH 2VQFH 3QG5A 3N2GA 4X66B 5KHKA 1RSOA 4LF5B 3RR5A 2WDTA 4FM9A 5A2QW 2WE6A 2R70A 3BRCA 3W1GA 1XNQH 2F4VH 3GB8B 4B3RB 5LXTA 4RB3C 3N40P 3OTOH 2KKWA 2E5LH 3HKBA 4DV5B 5LL6b 5ITZA 3GJXB 3UQ8A 4UCSA 4F6RB 3SR2C 5JCOA 4B3SB 2UUCB 1M0WA 4HNAB 4LFAB 4X1KA 4X1YB 3WB0A 2ZCEA 2PYJA 4JI5H 2YXLA 1FVIA 4APMA 5GONA 4I55B 4X66H 3VQVA 4LF5H 2OWOA 3JAWB 1Z5WA 4UCRA 2WYOA 3BA9A 3KXYT 4O4LA 4DV2B 2YIBA 4B3RH 3CHXA 4DK0A 5CB4B 3RJ0A 3CVZA 4I50A 3KAJA 4B3MB 4DV5H 2CW8A 4FM2A 4B3SH 5IJ9B 4FLVA 2UUCH 5FNVA 2QJ1A 3SJCC 4LFAH 1Z2PX 1BGWA 2FE3A 4UCUA 4LMYA 3T1HB 4DV0B 4MTEA 4CH5A 4EB6B 2YI8A 4ZIBA 3BHPA 3K59A 3JASA 4FFBB 4EFEA 5FPRA 1XI1A 1HNXB 1HR0B 3UT5A 1X9NA 2UXCB 3JAMW 4DV2H 1X4TA 4GKJB 1G6UA 4YJ3A 4WBNA 4B3MH 3HKEB 5LP6C 1VS0A 2PZSA 1Q43A 1WNSA 4B08A 4EQ5A 1XDNA 4DUYB 2Q2TA 5KMGA 1XK5A 4EEQA 3ZS8C 1TVKA 4DR1B 3VNNA 1JMKC 4DR7H 1J5EB 4K0KB 5EYPB 5LOVB 4J0MA 3T1HH 4DV0H 4RAYA 3QWUA 5KHIA 3HKDA 3K57A 4I4TA 4FM1A 1HNXH 1HR0H 5JQGA 2UXCH 5LYJA 4BWAA 3RYIB 4GKJH 3GDEA 2HVQA 4O2BA 4DUYH 3RFRA 4O4IB 3K5NA 3K3VA 4L8JA 3KAKA 2GV9A 4LH7A 4NXMB 5LA6A 4DR1H 2ZNIA 4MTDA 2JVDA 1VF7A 1J5EH 4K0KH 2RQ6A 1T5EA 3KYHC 4JI7B 2P22C 3RYCB 3L2PA 4U3JA 4AQYB 4TV9A 3C0FB 4IIJB 1XNRB 4O4JB 5IT9W 4ZI7A 5KX5B 5J2UA 4FLWA 4DRFA 4R7RA 1YEWA 4YJ2A 4X20B 4AILC 4PDBA 4TUYB 5JJJB 3FMAA 4JI1B 4LF4B 2UXBB 5D1OB 4FLYA 3RIZA 3J80W 2RGRA 4UCTA 5LMNB 3BPZA 1SA0A 5JVDB 5EIBD 3K5LA 1XHXA 4LNUB 1O9HA 4NXMH 5FD6A 3U11A 4JI7H 3U0ZA 5FD5A 2PGGA 3EYYA 2Q7GA 4AQYH 1TUBB 1XNRH 4JI3B 3A2FA 4JYAB 4UCVA 1FJGB 2VUGA 2HIVA 3N2KA 4JI1H 4LF4H 1TA8A 3U10A 2UXBH 4BWSC 1Z5VA 5LMNH 2R72A 1E4GT 3M4IA 3TY8A 3E22A 4IHJA 3T1YB 5LP6B 4M7EA 3HKCA 5D5PA 3RYFB 4AHCA 4DR2B 1HNZB 4ETSA 2Q0AA 1Q8IA 5J2TB 2EX3A 3VQXA 4CH3A 5BMVB 3CSXA 2VPSA 1S03G 2CFMA 3WB1A 4FLTA 1I7FA 4JI3H 4K8ZA 3N43B 2UUBB 1Q3EA 4JYAH 1FJGH 4LF7B 5IYZA 4MV9A 3TY9A 3FFQA 4HNAA 5K1XA 4X1YA 2BTOA 5LMUB 3ICXA 5K1PA 4CC6A 1A0IA 3T1YH 4I55A 2YIBD 1HNZH 4PI0A 1O9GA 3JAWA 4ZOLB 5IJ0A 1SYXB 3VQWA 1TGOA 5EIBC 5FPOA 4RB1A 4OX9B 4TQDA 2F95B 5CA1B 3DF7A 4YHHB 2UUBH 5CB4A 4FLXA 4DR3B 1WPBA 4GKKB 3SJAC 5FNVB 5EZYA 4LF7H 4JI6B 4IAJA 4X1IB 4DK1A 5IJ9A 5LMUH 2VOBA 4PHZA 3JARA 1P49A 3JASB 3RF2A 3BA8A 3S24A 4EB6A 1FFXA 3UT5B 1HW7A 2JGUA 3RTXA 4A2BA 4X62B 4OX9H 5JH7A 2VWKA 3RGBA 5KHGA 4D7TA 4YHHH 2UUAB 4DR3H 4KHPB 4GKKH 2Q2UA 1CKNA 2BTQA 5C8YA 5KMGB 2E3CA 5JCOC 2VWJA 3F8NA 5JJEB 4JI6H 1TVKB 4O2AB 3N6XA 2ZM6B 1S68A 4PI2A 2HEPA 2RJZA 3HKDB 3K5OA 5EYPA 1ZAUA 3W1BA 3N41B 2IM9A 4TOIA 4PZ8A 4DR4B 4X62H 4LF9B 4GLXA 1SQGA 2QM4A 4O4HB 2YI9A 4UCOA 1NT2B 2Q7EA 3J81W 5FLXW 1TAEA 2UUAH 4KHPH 4O2BB 2UU9B 1KMIZ 4ZHQB 3OTFA 2CW7A 1AN7A 4LFBB 5LA6B 2ZINA 4DRXB 4CS3A 4O4IA 2XHBA 1KU9A 3JAKA 1Z2NX 4LFCB 3JSLA 2ZM6H 4K8XA 1O75A 4LF8B 1CKMA 5CA0A 4Q0YA 4D7SA 4TV9B 3ZEDA 1M93A 3RYCA 3IG0A 2F93B 4ZI7B 5J2UB 4DR4H 4JV5B 2KSWA 3LNNA 1V9PA 1ZHQA 1XMQB 4X20A 5JJNB 2UU9H 4LFBH 4X64B 2OYQA 4TQFA 3RYHB 4LFCH 1JFFA 4NVPA 3NBZB 4LF8H 2YCHA 3JALB 3KALA 4DV7B 4TV8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU B;  1HNW B;  4CC6 A;  1A0I A;  1VS0 A;  4EQ5 A;  1I94 B;  4DR5 B;  4DUY B;  1XDN A;  2Q2T A;  1P8L A;  1XK5 A;  3NBY B;  4EEQ A;  3NC0 B;  5IWA B;  5FPO A;  3VNN A;  4DR1 B;  4OX9 B;  4B3T B;  4JI2 B;  1J5E B;  4K0K B;  3SGI A;  5BR8 B;  4CC5 A;  3W5O A;  4YHH B;  4DR3 B;  4NXN B;  2HHH B;  4DV6 B;  4DV1 B;  4GKK B;  3QWU A;  2VQF B;  5D1O A;  4DR6 B;  3BAA A;  4JI6 B;  5D1P A;  1CKO A;  2HVR A;  3GDE A;  1XNQ B;  1N32 B;  2HVQ A;  1N33 B;  2F4V B;  3OTO B;  4EFB A;  3PN1 A;  2E5L B;  3BA8 A;  4DUZ B;  3S24 A;  4DV3 B;  4LH7 A;  4NXM B;  3RTX A;  3TY5 A;  4X62 B;  3KYH C;  4JI7 B;  3L2P A;  4JI5 B;  2UUA B;  4KHP B;  4UFZ A;  4AQY B;  4LH6 A;  2Q2U A;  4X66 B;  4YY3 B;  1CKN A;  1XNR B;  4LF5 B;  3RR5 A;  4PZ6 A;  1P16 A;  4DRF A;  1XMO B;  2ZM6 B;  2VQE B;  3W1G A;  3BAB A;  1S68 A;  4JI1 B;  4LF4 B;  3GB8 B;  2UXB B;  4B3R B;  5D1O B;  4UCT A;  1ZAU A;  5LMN B;  1DGS A;  3W1B A;  4DV4 B;  1N34 B;  4TOI A;  4DV5 B;  4PZ8 A;  3GJX B;  3UQ8 A;  4DR4 B;  4UCS A;  2UXD B;  4B3S B;  4LF9 B;  2UUC B;  4GLX A;  4LFA B;  4DR7 B;  4UCO A;  1B04 A;  1FVI A;  1TAE A;  2UU9 B;  4JI3 B;  2OWO A;  4LFB B;  1IBM B;  1IBL B;  4UCR A;  4JI0 B;  4JYA B;  4UCV A;  3BA9 A;  1FJG B;  4LFC B;  3JSL A;  2HIV A;  2HIX A;  2VUG A;  3JSN A;  1IBK B;  4LF8 B;  4DV2 B;  1CKM A;  1TA8 A;  1CKN B;  3TY8 A;  3T1Y B;  4B3M B;  2HVS A;  4JV5 B;  4DR2 B;  1HNZ B;  1V9P A;  1XMQ B;  1N36 B;  4JI4 B;  5DIS C;  2CFM A;  4JI8 B;  4UCU A;  4PZ7 A;  3T1H B;  4DV0 B;  4X64 B;  2UUB B;  4LF6 B;  4E6N A;  4LF7 B;  3NBZ B;  3TY9 A;  4EFE A;  1HNX B;  5FPR A;  4DV7 B;  1HR0 B;  1X9N A;  2UXC B;  4X65 B;  4GKJ B; 
#chains in the Genus database with same CATH topology
 1MSD A;  4LSA A;  3AG4 C;  3N2G B;  1EKF A;  3HXL A;  1BCC H;  4DL4 A;  3NUA A;  4LCU C;  1V4Y A;  3W7W A;  1GYF A;  3CCL V;  4O3Q A;  1SKV A;  1WN7 A;  2RF4 A;  2H3O A;  5LXT B;  4J9S A;  3QTC A;  1NVP B;  1I6U A;  3HKB B;  3RGZ A;  2AW9 A;  3U54 A;  2ETN A;  3R5X A;  2DZD A;  4O4I F;  1KKC A;  2L35 A;  1OBG A;  2YZL A;  1CKO A;  4X1K B;  2JEG A;  4HNT A;  1S0N A;  5J2T A;  1GO3 F;  2HVJ C;  1S10 A;  2W70 A;  2FLN A;  3SYQ A;  4UV9 A;  1N33 B;  1KT8 A;  4ZHQ F;  4FU0 A;  3GIJ A;  4EG0 A;  1I94 H;  1XUQ A;  5I5T A;  1OZ0 A;  2UXD O;  4EFB A;  5IYZ B;  4IIJ F;  1I0H A;  2DPI A;  3OMN B;  2HP8 A;  3TY5 A;  3CJH A;  2AGA A;  4B3T H;  4C5C A;  4WBN F;  5BR8 H;  5B3S C;  2Z3Y A;  5L1J A;  3CEI A;  1IBM O;  2C35 B;  4DV6 H;  2LGW A;  3CRA A;  4RO2 A;  4DR6 H;  4YY3 B;  4LSX A;  3SI8 A;  5GW7 A;  5JVD F;  1IBK O;  5KHH A;  4ZOL A;  1XMO B;  1MZE A;  2BE3 A;  4P2Z A;  2E2H A;  4MV6 A;  5KG1 A;  1SQF A;  1EN6 A;  4M0J A;  5CA1 A;  2BQR A;  2IH1 C;  3EXA A;  1N34 B;  4DV3 H;  3MAQ A;  4LF9 O;  4C5B A;  3Q2O A;  1JX9 A;  2Q4P A;  1EUC B;  3M7M X;  4JI8 O;  4DR7 B;  4HNV A;  1B04 A;  4YJ3 B;  4WBN B;  4Y8V B;  1M4U A;  3JAR B;  1K1S A;  5C5J A;  5A9G A;  1H2S B;  4WD3 A;  1XQ8 A;  2RDC A;  1IBL B;  3HKE A;  2P4K A;  5JH7 B;  1RP3 B;  3ABL B;  5EBM C;  2VQE H;  3JSN A;  1JDB B;  5J2T F;  1K8A W;  2LW7 A;  2QKC A;  2C2R A;  1S5J A;  1CKN B;  1KYO F;  1FXK A;  2Y4U A;  4QJF B;  5LHI A;  1W93 A;  3ETE A;  3RWR D;  4CHI A;  4DV4 H;  3T9B A;  5BY1 A;  1IOV A;  5IWA O;  4FFL A;  2CKZ B;  3FAV B;  4O2A A;  2HJW A;  1KC8 W;  3QO7 A;  2ZJT A;  2XAH A;  4Z2W A;  2VQF O;  1CP9 A;  5FLM G;  1XOU A;  2DAA A;  1EFR G;  2YUA A;  3L73 H;  4AYB A;  4O4L F;  5KUM A;  3PW2 A;  5BWU A;  4ZOL F;  3B09 A;  4FM0 A;  4FBT A;  4W4L A;  5DQI A;  1WP7 A;  3T9D A;  5CA1 F;  1SS3 A;  1RYR A;  3S3X A;  2JJ1 G;  1SQP H;  1P4R A;  3AYH B;  5FNV F;  5LL6 Y;  4YJ2 B;  4FJC C;  1OCO B;  4NYE A;  1PKX A;  3AG7 A;  1OV9 A;  5DEC A;  5BPF A;  3F7Y C;  3Q4H A;  5KX5 A;  3K5M A;  3CCQ V;  3CQZ A;  3RGX A;  4JI4 H;  1R6K A;  3GTL A;  4CBC A;  4MVZ A;  2BQU A;  4CC5 A;  3MWE A;  4H44 B;  2V5A A;  4LF5 O;  4NXN B;  2HHH B;  3QNE A;  5D1O A;  3VBB A;  2ZE7 A;  4P30 A;  2ZIM A;  3TQT A;  4MT8 A;  2Y0I A;  4LNU A;  3K9S A;  1K3E A;  1KEE A;  3OGI B;  4MV8 A;  1XNQ B;  3D3Q A;  2F4V B;  2JEI A;  3IC7 A;  3RN4 A;  5K2M A;  3RYH A;  4KUM A;  4O2A F;  2EIM C;  2ZDI C;  2HGW A;  2B63 A;  3BQ0 A;  3JD4 A;  1KP3 A;  4JI5 B;  4D6T H;  2QWO B;  4TVI A;  3ETQ A;  2QTS A;  3HT5 A;  4X66 B;  3HO8 A;  2ZDQ A;  2XGP A;  2CGN A;  2NLJ C;  2COI A;  2YW2 A;  2WDT A;  3MWD A;  2I8C A;  1NH2 D;  1VP7 A;  2KG7 A;  3W1G A;  4B3M O;  4NZO A;  3OTO H;  4RUE A;  2E5L H;  1N0N A;  2JGD A;  2AGP A;  1VBG A;  4B3S B;  2QSA A;  5JCO A;  3SR2 C;  4DR7 O;  4LFA B;  2A0L A;  5FR9 A;  3Q8P B;  1FVI A;  3ETH A;  3T1H O;  5LGT A;  2GTA A;  3LDC A;  1SZT A;  3ABM B;  3OSP A;  5IP7 G;  1AR4 A;  3CJH B;  3F7V C;  2W7O A;  1HNX O;  1PL4 A;  2YL2 A;  3T5J A;  2XAF A;  2A3Q A;  2DPJ A;  4DV2 B;  5CB4 B;  5EWE A;  4MSW C;  2W9A A;  4DR1 O;  4FLV A;  1WA8 B;  4O81 A;  4K0K O;  3PJS K;  5KFR A;  5KFQ A;  4F4W A;  2HLD G;  4DYL A;  5HFM A;  1NR7 A;  4UB8 Z;  1ZL8 B;  4UCU A;  4DV0 B;  4XX0 B;  3H4B A;  2FYU H;  4ZIB A;  2OTJ V;  1TUE B;  2R6F A;  4PDL A;  1XI1 A;  4C2M A;  1I50 A;  4I0X B;  3RB6 A;  1ZUQ A;  4GKJ B;  4MV3 A;  4HAM A;  3HKE B;  1WNS A;  4MVU A;  1VQN V;  5KMG A;  2ITC C;  5HBR B;  2W8L A;  3VNN A;  4QW9 A;  1FXK B;  1SCU B;  2R7L A;  5EYP B;  3UM7 A;  2WB1 A;  1XNR O;  2EIJ C;  3H1L H;  1KJJ A;  5KS8 A;  5L3G A;  1GSA A;  5I47 A;  1HR0 H;  1YIT V;  5JQG A;  3GV7 B;  2UXC H;  4LF4 O;  2V9W A;  5LMN O;  2DAB A;  2NNU A;  1YDX A;  3AG1 B;  2R92 G;  1GH6 A;  1VQ4 V;  2JK5 C;  2UVR A;  3I56 V;  3K5N A;  3K3V A;  1WCM A;  1N4C A;  5DED A;  4NXM B;  2YS6 A;  1VF7 A;  1SQQ H;  2RQ6 A;  5AG2 A;  2DIK A;  3RYC B;  3L2P A;  3HKZ A;  1R3L C;  2E76 B;  4EEY A;  4JYA O;  4TV9 A;  5EZY F;  1H2L A;  2XCP A;  3CCR V;  1FD9 A;  4ZI7 A;  3FX7 A;  3SPH A;  5KX5 B;  3TJT A;  4FLW A;  4E4E A;  3W7S A;  4QWB A;  2A79 B;  5B1B B;  2W9B A;  4AIL C;  3GTO A;  1VQ5 V;  4FZ0 A;  2XT9 A;  3Q8Q B;  1VF6 C;  2C2A A;  3FB6 C;  2UXB B;  1I1K A;  5D1O B;  2RGR A;  2HFE C;  3BPZ A;  1HNZ O;  1V55 B;  3V4S A;  5CAE B;  1ZSP A;  1XHX A;  4LNU B;  4PA9 A;  1CEZ A;  2GHY A;  4RUC A;  4JI7 H;  3DGE A;  3V6J A;  5FD5 A;  2ZDH A;  3QO5 A;  2GUZ B;  4AQY H;  3BQ1 A;  3UYY A;  5C8Y F;  1AJP A;  2I87 A;  4ECW A;  4L1K A;  2WLJ A;  4JI3 B;  1IX9 A;  1JR9 A;  3BFR A;  5JQG F;  4EGQ A;  3JCU Z;  3UZB A;  3AG3 C;  1PNM A;  4JV2 A;  1T3N A;  4BWS C;  4LBE C;  1Z5V A;  1TWA A;  1E4G T;  2P6J A;  5KFS A;  3TY8 A;  1K5S A;  2CGO A;  4FFN A;  4FFK A;  2K9P A;  5F2V O;  4ETS A;  4M7E A;  1EN5 A;  1NVP D;  3GTG A;  2YZN A;  2EX3 A;  3B8M A;  4CH3 A;  3W7U A;  4JV0 A;  5KT6 A;  2Y4R A;  5KFB A;  4RWU A;  1KEC A;  2VPS A;  5IYB G;  3CMA V;  2QK4 A;  4J11 A;  1K9M W;  4GKK O;  4QWA A;  4FLT A;  1Y1W G;  3ABK B;  4I7Z B;  4RU9 A;  4K8Z A;  2P4V A;  3N43 B;  4PDR A;  1Q3E A;  1VQ8 V;  1Q7Y W;  1MSW D;  4MTX A;  4M9U A;  1FJG H;  3UCS C;  1GM7 A;  3TY9 A;  1XBL A;  5CBF A;  1GK9 A;  3FFQ A;  4FE2 A;  3PVX A;  4A3B G;  1NJI W;  3KG2 A;  3L71 H;  2DYS B;  3T1Y H;  4TSF G;  2ZXW C;  3E2E A;  2GQS A;  3ASO B;  1O9G A;  3JAW A;  4ICG A;  2DW4 A;  3GLK A;  4YAJ B;  1TGO A;  5EIB C;  3T9A A;  3J7A U;  1M6V A;  3CSW A;  1LR1 A;  2UUB H;  4YHH B;  4FLX A;  5H6R A;  4LF7 H;  1ZTE A;  5I5Y A;  4G3I A;  4IAJ A;  2IMW P;  3ASN C;  4J80 A;  5EK0 A;  3AK1 A;  2VOB A;  2Y69 C;  4PHZ A;  3ZBH A;  4JUZ A;  1E4E A;  3RF2 A;  1SES A;  4EB6 A;  4OX9 H;  1BZK A;  3RW0 A;  3RUP A;  4MW3 A;  3A0H Z;  1RK6 A;  3RFC A;  1Y67 A;  4LFB O;  4DR3 H;  2XAG A;  4DIM A;  1KKD A;  1TWC A;  5KMG B;  4Z1M G;  4QPK A;  2E3C A;  4JI6 H;  4PA4 A;  4LFC O;  5JJE B;  2JA5 A;  3MFH A;  2XAQ A;  3N6X A;  2GSM B;  3AG2 B;  2ZM6 B;  5BWR A;  1IYD A;  2FPI B;  1SQB H;  5L3F A;  1S68 A;  2Q0O C;  2HEP A;  2ZDI A;  3ZRS A;  3K5O A;  2UVU A;  1ZAU A;  3MDS A;  3W1B A;  1YJ9 V;  2QR4 A;  1JVM A;  3STZ C;  1XMQ O;  4YB8 B;  3MR5 A;  1YCI A;  2FK3 A;  4FS1 A;  2XC9 A;  5IY5 C;  2PBZ A;  2YI9 A;  3J81 W;  2Q7E A;  5FLX W;  4BBS G;  2UUA H;  4DL2 A;  4X64 O;  1KMI Z;  1MOF A;  4O7W A;  2N04 A;  1KU9 A;  2WLM A;  3SYO A;  3W7T A;  3GIK A;  4PDM A;  4LF8 B;  2EBO A;  3MR2 A;  1HNW O;  2HHF B;  2NU6 B;  4D7S A;  4TV9 B;  4MTO A;  1KJQ A;  5DGB A;  1AJQ A;  1U97 A;  4RQF A;  1VIB A;  4ZI7 B;  4DR5 O;  1B06 A;  3IC9 A;  1WRV A;  4MAM A;  3GV8 B;  4JV5 B;  4DR4 H;  4FMT A;  4JI2 O;  4XZ3 B;  3GIQ A;  1AR5 A;  4X20 A;  3W7X A;  3I55 V;  4H0L B;  3CME V;  4MV1 A;  3AW8 A;  1M56 B;  2ADQ B;  5LGU A;  4DLK A;  1M7J A;  3SPG A;  2VUM G;  1F4M A;  3CCM V;  1JFF A;  5KFJ A;  3T54 A;  3RAX A;  2WPD G;  5C93 A;  5KT5 A;  3JAL B;  1N32 O;  1KTA A;  2W6M A;  2E2I A;  4BBR G;  4A93 G;  3SPJ A;  4EBE A;  4DUZ O;  3GTJ A;  3G6V A;  2DYR C;  4BIZ A;  4K6N A;  1RK5 A;  2YEV B;  3R9R A;  1RM1 C;  3GV5 B;  4ZQI A;  3WWI A;  4R8U A;  4FBU A;  3D36 C;  1SET A;  1OCC B;  3K08 A;  1QVF U;  1NTZ H;  2NR5 A;  1A48 A;  1F23 A;  1L1F A;  4LR3 A;  5I5W A;  1JCH A;  1R3K C;  2X0L A;  4DV7 H;  4LP8 A;  4J9P A;  3DAA A;  2GQR A;  3IJ4 A;  3TW6 A;  3AG1 C;  5DG9 A;  4IRK A;  3K79 A;  1XIL A;  4F6R A;  1OCZ C;  5GON B;  4XDL A;  4O7S A;  4QE7 A;  1YTF B;  4RUA A;  3ZMS A;  2QM8 A;  3P3P A;  4FLZ A;  1FKA O;  2NUA B;  3JAM N;  4O4J F;  2HR3 A;  3PFF A;  1RFY A;  2KQX A;  3ZN1 A;  4O84 A;  3VPB A;  3TCU A;  5FJ8 G;  4DW0 A;  2UVV A;  4BY1 G;  1BQZ A;  1BT8 A;  4I50 B;  5EOY A;  4TUY F;  2ADP A;  1UPG A;  4HZ3 A;  4LH6 A;  4JI0 O;  2R9I A;  2IH3 C;  3CEB A;  4U7N A;  3U0G A;  3PZP A;  1JDE A;  3OSN A;  4OPH A;  3DSQ A;  2BOB C;  3PW5 A;  4MS2 A;  1N33 H;  4ED6 A;  4ED0 A;  1QR8 A;  5EBL C;  2FLP A;  2UXD B;  2PYL A;  1N36 O;  2PUS A;  2COJ A;  4X1I A;  2AQ4 A;  4MV7 A;  3PR5 B;  4ED1 A;  1BGY H;  2ZE6 A;  4FFB A;  4FVM A;  1AP5 A;  2F1M A;  4LF6 O;  4YY3 H;  1Y14 B;  2J6U A;  3CWB H;  3D8C A;  1VF6 A;  2PF4 E;  1IBM B;  3FYI B;  1WJZ A;  1YSC A;  2ZGI A;  1XMO H;  4X65 O;  2GPS A;  1PPJ H;  1IBK B;  2OTL V;  3CE2 A;  1Z2O X;  2GTS A;  4CH6 A;  1RPR A;  5GTH Z;  3FKI G;  3GTQ A;  1DF4 A;  1EZJ A;  2VS0 A;  1JIH A;  4A3C G;  3O9O A;  1N34 H;  3CC7 V;  4Q4D A;  3L74 H;  1I5Y A;  2V1D A;  4I4T B;  3B2E E;  1R9T A;  5LYJ B;  3E5N A;  1THZ A;  2AHZ A;  1NTK H;  2CH7 B;  2P5O A;  3R5F A;  5DIS C;  3C3T A;  3KKY A;  3CB2 A;  3H0G G;  3ZRV A;  1S77 D;  4J9Q A;  5KHJ A;  2IW5 A;  4JI8 B;  2PMZ A;  2QWP B;  3EHB B;  3H20 A;  2R8I A;  3ETD A;  5B66 Z;  4PZ7 A;  2RGV A;  1IBL H;  2WSS G;  1FXH A;  3QF7 A;  2ZNJ A;  3ORQ A;  1DIK A;  1VQK V;  4E6N A;  1GAX A;  5DAA A;  3HOW G;  4I7H A;  5L1K A;  2QWQ B;  1SQV H;  4O4H A;  3APQ A;  2QKA A;  2R85 A;  2XCL A;  4KL1 A;  4ZHQ A;  2ZD9 A;  4QPJ A;  4I5S A;  1PD3 A;  4IIJ A;  2P06 A;  2IJI A;  5E25 A;  2R8J A;  3NC0 B;  4B7E A;  5IWA B;  4A3F G;  1R73 A;  3E8F A;  3A0R A;  1N0J A;  1SA0 B;  3H01 A;  5KG3 A;  1OCR B;  1M5I A;  1NTM H;  1NR1 A;  4DV1 B;  2VQF B;  4L87 A;  5JVD A;  3UFX B;  1NKD A;  2EIK B;  3K58 A;  3A8T A;  2VRZ A;  4EBC A;  4B3R O;  4ED3 A;  2CTP A;  4JXU A;  4DV5 O;  1PNL A;  1M0T A;  2PTM A;  3H1H H;  2J9G A;  1JFF B;  2W6O A;  5KFE A;  1TUB A;  1AI5 A;  2UUC O;  1BHB A;  2J6S A;  3BVO A;  1L8D A;  4RZR A;  4PA7 A;  4IL6 Z;  4IGG A;  3GTM A;  3T5H A;  2V4D A;  1R6N A;  1YVW A;  1WR2 A;  3T5L A;  1U96 A;  3H1I H;  4TV8 A;  2HHH H;  2D2C B;  3JAT A;  4NXN H;  3SYA A;  5KHK A;  1R3I C;  4NR1 A;  1RSO A;  4R8U B;  4LF5 B;  1AR1 B;  2WAQ A;  4UVC A;  3PO2 G;  4FM9 A;  4IR1 A;  2R70 A;  1I2L A;  2FB9 A;  4O4H F;  1OWT A;  3X2Q C;  1NZ6 A;  1XNQ H;  4F4Y A;  2F4V H;  5LHH A;  1B33 N;  3AEI A;  2BCC H;  3N40 P;  2HG8 A;  3HBL A;  3E8B A;  5JWP A;  1R6T A;  3QQM A;  5ITZ A;  1SC5 B;  3LDD A;  2COG A;  3N27 A;  3FDS A;  2ODM A;  2ZE5 A;  3JYC A;  4F6R B;  4HNA B;  5H2F Z;  1VQP V;  1GM8 A;  2PYJ A;  1JOY A;  2YXL A;  4JI5 H;  2YDE A;  3AK2 A;  3F5T A;  4X66 H;  4RNM A;  3LUT B;  1DV2 A;  3EPI A;  2WA4 A;  4ECY A;  2W71 A;  4YAK B;  2OWO A;  4YJ2 F;  3UO3 A;  4R8C A;  3BA9 A;  4O4L A;  2RN9 A;  1S0M A;  1QCE A;  3R23 A;  2ODT X;  2YIB A;  3T9F A;  3TIG A;  3CHX A;  2NU7 B;  4WHX A;  2DWD C;  4P9O A;  2ZR3 A;  4DUY O;  5D8D A;  5B1A C;  4B3M B;  3ETG A;  2CW8 A;  3ZJZ A;  4B3S H;  5IJ9 B;  4IYI A;  5FNV A;  2QJ1 A;  3DXR B;  1J5E O;  4FFO A;  4LFA H;  3HOV G;  5DG8 A;  5BWW A;  5IYC O;  1Z2P X;  5DG7 A;  4TV8 F;  1PNK A;  3TW7 A;  3T5K A;  1V54 B;  4GX2 A;  3TXS A;  3T1H B;  3G6X A;  3OM3 B;  4O7T A;  3GWK C;  3KCX A;  3BHP A;  3HR0 A;  3QVN A;  3RT3 C;  4FFB B;  4EFE A;  5FPR A;  1HNX B;  3L4K A;  4DV2 H;  4IYH A;  3UT5 A;  1VQ7 V;  3CD6 V;  2ARH A;  1G6U A;  4NZN A;  3QO8 A;  4IHJ F;  2BQ3 A;  5IYD G;  5LP6 C;  4EQ5 A;  2ILM A;  4MV4 A;  2YYA A;  1Q81 W;  3ZS8 C;  1BQ0 A;  4DR1 B;  2ZQM A;  2K1E A;  4K0K B;  2E74 B;  4QWC A;  4J0M A;  3H4D A;  2FJZ A;  2F23 A;  4DV1 O;  4DV0 H;  4DW1 A;  2VR1 A;  1P7B A;  5C4X G;  2NVX A;  3OT7 A;  1FPO A;  5DGA A;  3WG7 B;  4JI1 O;  4BWA A;  4KP4 A;  4GKJ H;  2C00 A;  2B5U A;  4N21 A;  2HVQ A;  4WF9 V;  4O4I B;  3VPD A;  4YP3 A;  2IU3 A;  3R65 A;  1T5E A;  3CX5 F;  3T7A A;  4QIW F;  2WAM A;  4HYK A;  1Q6H A;  3ZX6 A;  4U3J A;  1R3J C;  5DN6 G;  5I5U A;  3H1J H;  1M1K W;  3C0F B;  4IIJ B;  4J7K A;  3ETJ A;  1XNR B;  1PM9 A;  5JQW A;  2DOS A;  1Q6U A;  3OEE G;  4JYY A;  4R7R A;  2O57 A;  1W59 A;  4P9P A;  2GPW A;  2FMA A;  1QBZ A;  4LF4 B;  3RIZ A;  3J80 W;  1TWF A;  1D2D A;  5LMN B;  5JVD B;  5E79 Z;  1GN6 A;  3K5L A;  4NXM H;  4F50 A;  4FFR A;  2JA7 A;  3U11 A;  4N23 A;  1G2W A;  1DF5 A;  2LFR A;  1I1L A;  2EIN B;  3EYY A;  5H6Q A;  1OBD A;  1COW G;  1S76 D;  3CRC A;  1TUB B;  4TQS A;  3A2F A;  5KFP A;  4JYA B;  1FS0 G;  4UCV A;  3GII A;  2VUG A;  4HQ6 A;  2QB5 A;  5KAI Z;  2OCC B;  5LMU O;  4GX1 A;  3ZRW A;  1Y6X A;  1JXL A;  2QGN A;  3N2K A;  3R66 A;  2P7T C;  2X5R A;  1TA8 A;  1Y74 A;  3U10 A;  1MMM A;  1E1R G;  2UXB H;  2A06 H;  3ZMV A;  5CMU A;  3WO0 A;  5H5N A;  4X9Q A;  1Q90 D;  2WLI A;  2EIL B;  3JZ6 A;  1RJQ A;  3HKC A;  5D5P A;  1HNZ B;  1H8E G;  1HDJ A;  1I7N A;  2B63 G;  3BCC H;  4A3L G;  1Q8I A;  5J2T B;  4MVQ A;  3CYO A;  3WU2 Z;  5DQG A;  2OLS A;  3GIP A;  4J9L A;  1ROP A;  2R7Z A;  4JI3 H;  2OH2 A;  1R1B A;  3NXS A;  4O7L A;  2P67 A;  1KJ8 A;  4O3R A;  1M57 B;  1V51 A;  2HJD A;  1KUT A;  2A7W A;  5CA0 F;  1AJN A;  3MHS C;  4X1Y A;  4GZR B;  1A0I A;  5DQH A;  3M99 B;  4I55 A;  3ZMU A;  2E75 B;  3N8D A;  4X62 O;  4ZOL B;  3VQW A;  1YF2 A;  3ZIA G;  4KHP O;  5KFA A;  3G6Y A;  3H3V H;  4TQD A;  5CA3 A;  3LUL A;  2F95 B;  5CA1 B;  2VPQ A;  4MTG A;  2GLT A;  4GKK B;  3SJA C;  4R50 A;  5FNV B;  5EZY A;  2DWC A;  5CR5 A;  3DTU B;  2QE7 G;  4A3K G;  4DK1 A;  1VMG A;  4ECT A;  4H13 B;  1YIJ V;  5KG7 A;  1BL8 A;  2W6I G;  4GX5 A;  4X8A A;  4QW8 A;  2W9C A;  1P49 A;  1NI8 A;  1PK8 A;  2RDI A;  2YS7 A;  3ZCC A;  3UT5 B;  1HW7 A;  2Q7D A;  2UU9 O;  2CK3 G;  2VQD A;  4FIP C;  5KHG A;  2WLL A;  4YHH H;  3QZ7 A;  4QGP A;  1XEQ A;  3CCE V;  1Q82 W;  1S3J A;  2BTQ A;  5C8Y A;  3HOX G;  3QFF A;  4O2A B;  1BNC A;  2R7M A;  4H33 A;  1ORQ C;  1GO3 E;  3K04 A;  1JA8 A;  2WLH A;  2Q8V A;  2X6A A;  2IJH A;  4EYH B;  4I55 F;  3N41 B;  2OT5 A;  4TOI A;  2ZDG A;  3K5H A;  5JUM A;  1SQG A;  2QM4 A;  4JGS A;  4MW8 A;  3QZ8 A;  1TAE A;  1E1Q G;  1FAF A;  2V4Q A;  2ASD A;  3OMA B;  4J9Y B;  3OUZ A;  3H1K H;  3SDL A;  4LFB B;  2ZIN A;  4CS3 A;  3JAK A;  3Q4H B;  3CCJ V;  4LFC B;  2ZM6 H;  3G80 A;  3IGA C;  3GID A;  1I94 O;  3K0D A;  3IG0 A;  1T36 A;  1J95 A;  1WCM G;  1UC8 A;  1A3G A;  1NBM G;  3JZI A;  4B3T O;  3ABT A;  3LNN A;  1KJ9 A;  5BR8 O;  3B77 A;  5L1L A;  1XMQ B;  4JF3 A;  4MA5 A;  5JJN B;  4JTC B;  2C22 A;  4C5A A;  5F9L A;  3JD0 A;  4DV6 O;  5KFX A;  4J7Z A;  2BR0 A;  4DR6 O;  1S72 V;  1MNG A;  4X64 B;  4TQF A;  3G6B A;  3RYH B;  3ABL C;  3L72 H;  3U55 A;  4NVP A;  3NBZ B;  4TWK A;  5KFW A;  4LF8 H;  1IOW A;  4WFA V;  1A9X A;  2AXT Z;  4IRD A;  1HNW B;  5LOV F;  3P30 A;  2QEX V;  2EJ0 A;  4DV3 O;  4JV5 H;  3AK3 A;  4HN2 A;  4DR5 B;  3RAQ A;  3VPC A;  4K35 A;  2HVK C;  1Y74 B;  2KG7 B;  2M7W A;  2ZT9 B;  5KA6 A;  1K33 A;  3JD3 A;  1IYE A;  3T9E A;  4JI2 B;  3LML A;  5K3W A;  3U9S A;  4I9Q A;  4BW5 A;  3HKC B;  2N74 A;  2JGD B;  2V59 A;  3L9D A;  5HV6 A;  3E8H A;  3MR3 A;  1XDC A;  1D5A A;  5LP6 A;  2VQE O;  2VA2 A;  4IWY A;  3RYF A;  1K4D C;  3V6K A;  2HVR A;  1T94 A;  5BMV A;  1DTO A;  4YQW A;  3OFN G;  1N32 B;  4Q8F A;  5KG6 A;  1QHT A;  3FB7 C;  3E35 A;  1QVG U;  2QA4 V;  5J9P C;  1OCO C;  4DR2 H;  4DUZ B;  1K4C C;  2C2E A;  4O3S A;  3NR7 A;  2ZIO A;  3SNO A;  2R9A A;  1FYJ A;  5HFL A;  5KFG A;  4XBF A;  4WFB V;  2DQ0 A;  4OPA A;  2VA3 A;  3H40 A;  4PZ6 A;  3ZHU A;  2YU9 A;  1P16 A;  1ZHS A;  4RB2 C;  4O7Y A;  5KG0 A;  4BAY A;  4DAA A;  5KG5 A;  3BAB A;  3GIL A;  3GVM A;  2FML A;  3O65 A;  1YJN V;  1QR9 A;  5KA5 A;  5B1N A;  5EZY B;  1DGS A;  2DE0 X;  2W6N A;  4A2A A;  1EBO A;  4J9Z B;  3VOT A;  4JV1 A;  2B1I A;  2CNQ A;  3RB4 A;  4A5U B;  1AUX A;  1GSO A;  1E4F T;  4JI4 O;  4UVA A;  3OGC C;  3OE7 G;  1QLE B;  4FPP A;  4XYM B;  4I9W A;  1WLE A;  1H2N A;  2EZO A;  4W4K A;  5BWT A;  2W9C B;  1XRE A;  1EHI A;  3JZF A;  4AYB E;  5FLX N;  5LP6 F;  4JI0 B;  1PX2 A;  3RV3 A;  3LSU A;  2HIX A;  1W96 A;  2WLL B;  3CRM A;  5BMV F;  2QWN B;  5GTI Z;  2CNU A;  2BTQ B;  2EIL C;  3K9A A;  5C8Y B;  1SEI A;  4YR0 A;  4CH4 A;  2QDO A;  3AG4 B;  4GYC B;  3ZHQ A;  2HVS A;  2UXD H;  5CN0 A;  1BE3 H;  1N8R W;  5JQG B;  4WFG A;  1I2K A;  2IA6 A;  1GLV A;  5KFF A;  1N36 B;  1I08 A;  1GMG A;  3TQ1 A;  3WB2 A;  1PV0 A;  3ABM C;  1KC7 A;  2JA5 G;  1IBM H;  5KG4 A;  4LF6 B;  2XTA A;  1WB8 A;  2V7Q G;  3IFX A;  1S5L Z;  1LNQ A;  4TM5 A;  4RB0 A;  1IBK H;  1GN2 A;  3T4D A;  4X65 B;  2F66 C;  1S5H C;  3ZMZ A;  3SYC A;  3OTO O;  2YWV A;  4E2L A;  5IYC G;  4ECU A;  4DL6 A;  2E5L O;  1N48 A;  3JAK B;  2HJF C;  1K7D A;  3KZI Z;  3G8D A;  2W9B B;  2RDJ A;  4DRX A;  4NYK A;  1YXB A;  4O4J A;  4LF9 H;  3UZO A;  3JD1 A;  3J7A K;  4JI8 H;  4Q43 A;  5B3S B;  3IAY A;  4IT5 A;  3G6E V;  2W6J G;  4TUY A;  1Q5O A;  3V4Z A;  1XHZ A;  4QNH B;  5EDW A;  1VAR A;  3B40 A;  3LSS A;  3CXC U;  2ASL A;  4FGR A;  4HNU A;  4O3P A;  1BXR A;  4MTF A;  1SF9 A;  3JCZ A;  5KT4 A;  4Q8E A;  1MZB A;  3LWB A;  2FKX A;  5IWA H;  2JDI G;  2JS5 A;  3TII A;  3NGD A;  1FXK C;  3SJQ C;  4J41 A;  5KFD A;  2XGQ A;  3RB0 A;  3D3I A;  2CE4 A;  4DV1 H;  1VQL V;  3QG5 A;  1G4Y B;  3N2G A;  2VQF H;  3DTF A;  2RCV A;  3LQS A;  4A3M G;  2NU9 B;  5LYJ F;  5A2Q W;  2WE6 A;  3BRC A;  1RJP A;  3FB8 C;  1AI7 A;  3GB8 B;  3HB3 B;  4B3R B;  5LXT A;  4O2B F;  4RB3 C;  2R8K A;  2KKW A;  3HKB A;  4DV5 B;  1BSM A;  1S9F A;  5LA6 F;  3GJX B;  1TWG A;  4UCS A;  2C28 A;  2UUC B;  3TIN A;  4X1K A;  3C90 A;  3WB0 A;  2ZCE A;  3CS5 A;  3ZHT A;  1EZ1 A;  1SQX H;  4PA6 A;  1SRY A;  1S0V A;  5J2U F;  4LF5 H;  3JAW B;  2XUM A;  1Z5W A;  3UO2 A;  4UCR A;  3TK1 A;  5B1B C;  1UC9 A;  1HR0 O;  2UXC O;  3KXY T;  3M8A A;  2W0X A;  2R9R B;  4O7V A;  2R93 A;  1V55 C;  2SCU B;  3CVZ A;  1ZET A;  2JEU A;  2FLL A;  5L1I A;  3IN5 A;  3WWH A;  3MD0 A;  2JA6 A;  1VQ9 V;  1K34 A;  2Q73 A;  5IP9 G;  4ABM A;  4ECZ A;  1H2K A;  4DL3 A;  1K5Q A;  4GCZ A;  1Y1V A;  4J42 A;  2WB1 E;  1C30 A;  1BGW A;  3T4Z A;  4JAU A;  1YZB A;  1E4E B;  2WLN A;  4CH5 A;  5FL7 G;  4EB6 B;  1XL4 A;  3JAS A;  2FPG B;  3ML0 A;  5EC1 C;  5H9C A;  3JAM W;  1X9N A;  1LUW A;  2DMX A;  1E79 G;  5LXT F;  4YJ3 A;  2GDS A;  4WBN A;  4B3M H;  1VS0 A;  3HOU G;  1Q43 A;  2XCA A;  2ITD C;  4B08 A;  5KLV H;  4RUF A;  4DUY B;  1ZX3 A;  3WFV A;  4JAV A;  2Q2T A;  4JI7 O;  4EEQ A;  2F43 G;  4XDK A;  1TVK A;  3EFF K;  1JMK C;  4DR7 H;  1J5E B;  2EIM B;  4AQY O;  2YZM A;  3ABK C;  4OXS A;  2H8P C;  3T1H H;  4EYI B;  3AX6 A;  3FYE B;  2N05 A;  4QJF A;  5KHI A;  3HKD A;  5IYZ F;  3KCY A;  1QLN A;  2Z0A A;  1BMF G;  3I12 A;  5I60 A;  1HNX H;  3VMM A;  3FAV A;  2ATL A;  3GDE A;  2LO1 A;  4BR6 A;  2PN1 A;  2DYS C;  1ENV A;  4UUG A;  1S0O A;  3HB9 A;  3DC5 A;  1H2M A;  1K92 A;  1GM9 A;  3ASO C;  4XDJ A;  5LBQ A;  1G1X B;  4L8J A;  3RBE A;  4NTY A;  3KAK A;  2GV9 A;  4JTA B;  4LH7 A;  2ALZ A;  4DR1 H;  4MVM A;  2ZNI A;  4K0K H;  1Z2G A;  4EBD A;  1KUQ A;  2X0S A;  4E4T A;  4CKB A;  2JA8 G;  1FJG O;  4O4J B;  2CQY A;  5IT9 W;  1IZ3 A;  2D3O W;  1EZV H;  4DRF A;  1YEW A;  4YJ2 A;  3OEH G;  4X20 B;  2FP4 B;  4PDB A;  5KFY A;  3BG5 A;  4TUY B;  4K3A A;  3FMA A;  4R7C A;  4JI1 B;  3T1Y O;  4YJ3 F;  3OUU A;  3APO A;  4FLY A;  4G28 B;  3B4S A;  1SER A;  1GN4 A;  4UCT A;  2XD4 A;  5CBG A;  2R87 A;  3CP1 A;  4ED7 A;  4U3F H;  5KFV A;  5JH7 F;  3U0Z A;  2BOC C;  2PGG A;  1B6Q A;  2ASJ A;  2UUB O;  4U6P A;  2KB1 A;  3TET A;  1XNR H;  1YJW V;  4LF7 O;  1ULZ A;  4J9N A;  1MZF A;  2LGQ A;  4DL7 A;  5CBH A;  3AG2 C;  2R7K A;  4EGJ A;  5KFL A;  3ABU A;  4LF4 H;  5KFT A;  5LMN H;  2R72 A;  3M4I A;  3E22 A;  1IDS A;  4IHJ A;  2IJJ A;  4PD4 F;  2R8H A;  1H38 A;  3S3W A;  4OX9 O;  4DXW A;  2Q0A A;  2Z5U A;  5T14 A;  3VQX A;  2JEX A;  2QWR B;  4AI8 A;  3OUF A;  3ZHV A;  4DR3 O;  1S03 G;  2CFM A;  4JI6 O;  2XAS A;  3K0G A;  5C3E G;  2CZG A;  2AZ0 A;  2P0A A;  3BEH A;  4JYA H;  2P90 A;  2FB5 A;  2EIJ B;  5BWV A;  4DQN A;  4O7Z A;  4PEL A;  3RBZ A;  4GX0 A;  2BTO A;  5LMU B;  4O7R A;  3SYP A;  1ZLZ A;  5K1P A;  2Q6A A;  1RYS A;  5BPH A;  1AP6 A;  4EKW A;  5DMX A;  1HNZ H;  1IXB A;  5TIS Z;  4ED2 A;  1GTO A;  1AB3 A;  1SYX B;  5IJ0 A;  1B6R A;  3CPW U;  2GBO A;  2LP7 A;  5FPO A;  3OHA A;  4WFF A;  4RB1 A;  1NQT A;  2ATK C;  4NTW A;  2UUA O;  1DAA A;  1FFT B;  5KFO A;  4A3J G;  1PP9 H;  5B1O A;  1KBL A;  4QIW A;  1Y66 A;  1M56 C;  5CB4 A;  1EUD B;  3TXQ A;  1WPB A;  5DGI A;  3KHR A;  1P7G A;  3Q8R B;  2CDY A;  4X1I B;  2I80 A;  1WA8 A;  2YRX A;  3MR6 A;  2EJ2 A;  3PR4 A;  4HYO A;  2CTW A;  4PWQ A;  3K06 A;  3OR6 C;  3ZRX A;  1ZL8 A;  4DR4 O;  2X7R B;  3JAS B;  3S24 A;  1FFX A;  2JGU A;  4YBZ B;  4X62 B;  1OCC C;  3G71 V;  1SFO A;  2VWK A;  4RQE A;  4I0X A;  3RGB A;  4D7T A;  5L3E A;  1OHH G;  4KHP B;  4GKK H;  4KFM A;  4O3N A;  2VWJ A;  2MW2 B;  2EUL A;  5DLG A;  1TVK B;  5B5E Z;  3KHG A;  4RAI A;  4DO2 A;  3UKM A;  3KHH A;  4ECX A;  3GTK A;  3BQ2 A;  3AG3 B;  2CTR A;  1Y76 A;  4GC7 A;  2YZG A;  4ECQ A;  2FK1 A;  2Z04 A;  2RJZ A;  3D36 A;  3HKD B;  5EYP A;  4ECV A;  2R7N A;  5L3D A;  3E83 A;  2IM9 A;  4PZ8 A;  2OCH A;  1WP8 A;  3M9M B;  3J80 N;  4ZBM A;  2ZKO A;  4GLX A;  4J9O A;  4O4H B;  2RNB A;  2Y0P A;  3MHH C;  1KBH A;  4UCO A;  1NT2 B;  2QKS A;  3M9N B;  2UU9 B;  3L70 H;  2HG5 C;  5BYB A;  4ZHQ B;  5CB4 F;  1AUV A;  2CW7 A;  2R86 A;  4Q4C A;  3VA7 A;  5DM6 V;  2XHB A;  4DV7 O;  4IR9 A;  2W0F C;  1Z2N X;  3JSL A;  4K8X A;  1O75 A;  2Q68 A;  2JEF A;  1KQS U;  4ZKI A;  3K3P A;  4Q0Y A;  5CA0 A;  3LP8 A;  3ZED A;  3KTM A;  5H80 A;  3RYC A;  5KFM A;  2F93 B;  5L3C A;  2R8G A;  1F51 A;  4GT1 A;  2ZXW B;  1CE8 A;  4YIP A;  4UXN A;  4RNO A;  1ZHQ A;  2OIG A;  4TQR A;  1JPX A;  2QTO A;  2IJK A;  4B7K A;  2WA3 A;  1KD1 W;  2AGQ A;  2DLN A;  2LW1 A;  4LFB H;  2HDK A;  1K1Q A;  4O86 A;  4CKE A;  4LFC H;  1AVM A;  1HP8 A;  1W0K G;  1F4N A;  3STL C;  2YCH A;  1VEW A;  3KAL A;  1N33 O;  4IWX A;  3ASN B;  4TV8 B;  1EM1 A;  3JAT B;  3I4N G;  2AGO A;  4A3D G;  2NVY A;  2GUZ A;  4FFP A;  1RSO B;  1L2Z A;  2FTK A;  2JA7 G;  2Y69 B;  3A0B Z;  1I94 B;  1VF5 B;  4LC1 A;  3N44 B;  3NBY B;  1XMQ H;  1QQC A;  4RAZ A;  3JD2 A;  1B6S A;  3CRQ A;  4QE9 A;  4B3T B;  4J9M A;  4NTX A;  5BR8 B;  5BZB A;  3E22 B;  4IHJ B;  4YY3 O;  4Q20 A;  4X64 H;  2XAJ A;  4GUN A;  4DV6 B;  5ITZ B;  4TT3 G;  4DR6 B;  3BAA A;  2W57 A;  1XMO O;  5D1P A;  3CC2 V;  1YTF D;  2AHY A;  2OIE A;  1VQ6 V;  3GIM A;  3B8N A;  1HNW H;  1WH2 A;  2V4R A;  1N34 O;  4PBC A;  4DR5 H;  2YXY A;  3I5D A;  4O4L B;  4DV3 B;  5HNE A;  5KX5 F;  4CMD A;  5KFI A;  2CAZ C;  1QU7 A;  2HKO A;  1G8M A;  1WPX A;  4JI2 H;  5KT7 A;  4CKC A;  2FKL A;  2Y0S A;  5IY5 B;  5KUK A;  2HGS A;  4UB6 Z;  4MA0 A;  2CNV A;  2R7Z G;  1OCR C;  4GC6 A;  4UFZ A;  3L4J A;  1IBL O;  5I5S A;  4BW9 A;  3N42 B;  3FB5 C;  5IJ0 B;  3RVY A;  2UVW A;  1MA1 A;  2EIK C;  1OJH A;  4XYL B;  4BXX G;  2X6B A;  3TGU H;  2VQE B;  1N32 H;  3I4M G;  1CQJ B;  1AI6 A;  1TWH A;  5BYA A;  3Q1K A;  4Q6G A;  4DV4 B;  4DUZ H;  3K03 A;  5F9N A;  5C1O A;  2L6L A;  1W0J G;  2PI5 A;  2QM7 A;  1JX4 A;  4YR3 A;  2PMZ E;  1GRJ A;  4PV1 B;  1FFX B;  3H9V A;  4FLU A;  3THO A;  3MJF A;  4O83 A;  4MVR A;  4YR2 A;  2JRI A;  4ECR A;  1BJT A;  3VQY A;  2RMK B;  2IP4 A;  5LHG A;  2W6P A;  2YIA A;  5LOV A;  1Q6I A;  5KT2 A;  1L0L H;  1FKA H;  2R92 A;  2PY5 A;  3OAA G;  3SJB C;  3Q8S B;  2DYR B;  1Y76 B;  1RM1 B;  4JI4 B;  4UVB A;  1DV1 A;  2J6T A;  1EKP A;  4NXN O;  2HHH O;  3RYI A;  3BY6 A;  1PL0 A;  1CPY A;  1KB9 F;  5KAF Z;  4HBN A;  2M6Y A;  2YID A;  3KHL A;  4JI0 H;  1JJ2 U;  2W8K A;  4JYC A;  2EJR A;  4Q45 A;  3OHB A;  1XNQ O;  1K73 W;  4F4X A;  2F4V O;  3OUS A;  4U3J B;  3RB3 A;  3DTG A;  1OCZ B;  1WAZ A;  1QNM A;  4Q44 A;  4F4Z A;  1EKV A;  3BJY A;  3CCV V;  1P8L A;  3PW4 A;  5BXZ A;  4RZQ A;  5CA0 B;  4PDV A;  1N36 H;  4JI5 O;  4CS4 A;  3SGI A;  2CTQ A;  2YSU B;  4X66 O;  1V54 C;  4CS2 A;  2HHF A;  2Q7H A;  3W5O A;  2DN9 A;  2XIG A;  3MWM A;  4LF6 H;  2MCT A;  4A3G G;  5IE9 A;  2WAQ E;  1EYZ A;  5L3B A;  1KJI A;  1IVS A;  2NN4 A;  2IBK A;  4NZM A;  2H94 A;  3OD4 A;  4X65 H;  2WTF A;  1DK1 A;  4MVO A;  2Z02 A;  3OMI B;  5KKN B;  4YIO A;  1YI2 V;  4O82 A;  3BAC A;  1N56 A;  3OTO B;  3PN1 A;  1L0N H;  4B3S O;  5D5Q A;  2E5L B;  2O03 A;  2UXN A;  5C44 G;  4LFA O;  3LDE A;  3ZRW B;  4O7N A;  3N2K B;  4F4L A;  3JAL A;  2R84 A;  3M9O B;  1JJO A;  1ZQ7 A;  3P32 A;  1NU1 H;  1M90 W;  2WLI B;  1I3Q A;  4J9K A;  4ED8 A;  1Y1W A;  3RR5 A;  3WG7 C;  1I1M A;  4HR7 A;  3RBD A;  2YEV A;  4DV2 O;  3ZHS A;  5KFH A;  1ZWI C;  2QF7 A;  3CCS V;  1DLB A;  5DGH A;  2M05 A;  2Q69 A;  2QYZ A;  4DV4 O;  1JLL B;  4IZO A;  1FXV A;  4YXW G;  2ZR2 A;  2JEJ A;  5LL6 b;  4BIO A;  3UQ8 A;  2JIZ G;  1M0W A;  3WNZ A;  3HOZ G;  4X1Y B;  4BIU A;  5IYD O;  4QIW E;  4APM A;  4DV0 O;  3EPG A;  5GON A;  4TV9 F;  4I55 B;  5IDJ A;  1GN3 A;  4F6E A;  4ZI7 F;  3VQV A;  2WYO A;  4GLW A;  1W2B U;  1UFI A;  5DLF A;  4ME6 A;  5EWG A;  4PA3 A;  4GKJ O;  4FS2 A;  1AI4 A;  4B3R H;  5KFN A;  4DK0 A;  3RJ0 A;  4I50 A;  3FD9 A;  3KAJ A;  4DV5 H;  5C1P A;  2ZE8 A;  1MAB G;  4FM2 A;  2UUC H;  1A0G A;  3SJC C;  1M9N A;  2PVP A;  4JTD B;  2KSD A;  2EIN C;  1BS3 A;  3VOU A;  5KFC A;  1Q86 W;  3RVZ A;  2BSK A;  1CS0 A;  2FE3 A;  1A32 A;  4G2K A;  1IXM A;  4LMY A;  4MTE A;  2AZ2 A;  4R6Z A;  2DWE C;  2AU0 A;  1D5N A;  3J81 N;  2NU8 B;  2OCC C;  2YI8 A;  2ABJ A;  3K59 A;  2V58 A;  4U7C A;  1HR0 B;  5CE8 A;  3F5W C;  2UXC B;  1VBH A;  1X4T A;  3PW0 A;  1P84 F;  2PZS A;  4NXM O;  3U9T A;  5BWX A;  2WWW A;  1SZX A;  1XDN A;  1IUR A;  1XK5 A;  3ZN0 A;  3OW2 U;  1NS1 A;  5L9X A;  1JQ0 A;  5LOV B;  5GON F;  3HPL C;  3JRX A;  4RAY A;  1M57 C;  1UJW B;  3QWU A;  4UUJ C;  3ZHR A;  3K57 A;  4QSH A;  2B9Z A;  4I4T A;  4FM1 A;  5LYJ A;  2UXB O;  2W7P A;  3RYI B;  2CH7 A;  4LWS A;  5I5V A;  3X2Q B;  4I50 F;  4JZ2 A;  4O2B A;  4DUY H;  4JAS A;  3RFR A;  3T9C A;  3GWO A;  5LA6 A;  4FFM A;  4MTD A;  2JVD A;  4ECS A;  1J5E H;  4KXR A;  3KYH C;  4JI7 B;  2W6Z A;  3EVK A;  3KRE A;  2P22 C;  4J10 A;  3V6H A;  4JI3 O;  3RV4 A;  4AQY B;  2YRW A;  3G8C A;  2YC0 A;  5J2U A;  1AIL A;  2YS8 A;  1URF A;  1US6 A;  2VUM A;  2R82 A;  3LSQ A;  5JJJ B;  3SPC A;  1EN4 A;  1VKZ A;  3E8G A;  4C7U A;  5A2Q N;  1SA0 A;  2Q9L A;  4X89 A;  5EIB D;  5B1A B;  1O9H A;  4QWE A;  2XOK G;  3CRR A;  5FD6 A;  4JPR A;  4QWD A;  3PO3 G;  1BHA A;  4ASU G;  2Q7G A;  2JS3 A;  2Y4T A;  2FK2 A;  4JYB A;  4WFH A;  1GSH A;  5CM0 A;  5EC2 C;  1JKJ B;  4I4T F;  1FJG B;  4O3O A;  2HIV A;  4NB5 A;  2X6C A;  4J9R A;  5EBW C;  4FK5 C;  4JI1 H;  5E1A C;  5KFK A;  1NH2 B;  2DQ3 A;  3T1Y B;  5KFZ A;  5LP6 B;  3GQC A;  4AHC A;  4DR2 B;  3RYF B;  1F7Y A;  3R5H A;  5BMV B;  2Y0S E;  2EJ3 A;  2XND G;  3CSX A;  4CZZ A;  3DC6 A;  4YHH O;  4Z1V A;  4A3E G;  1B3Q A;  3WB1 A;  3E89 A;  4NLG A;  1I7F A;  2UUB B;  4JAA A;  2CUG A;  1ET0 A;  4LF7 B;  2UXX A;  5IYZ A;  4MV9 A;  1Y4M A;  1RPO A;  2DJV A;  4HNA A;  5K1X A;  3ICX A;  3HOY G;  4CC6 A;  2YIB D;  2LFS A;  4PI0 A;  3SPI A;  5KT3 A;  2A9H A;  4OX9 B;  3JRW A;  4A3I G;  2MK3 A;  1H2G A;  1VAJ A;  3DF7 A;  3G67 A;  3C3S A;  4DR3 B;  4IRC A;  2FPP B;  4OGQ B;  4JI6 B;  2ZM6 O;  2Q67 A;  3CC4 V;  2PI4 A;  4X88 A;  2EJ7 A;  5IJ9 A;  3DXR A;  2R93 G;  2BSK B;  3K3W A;  4UV8 A;  5LMU H;  1H8H G;  4BY7 G;  1XL6 A;  1HWY A;  1X59 A;  1I7L A;  3FKI A;  2JA6 G;  3JAR A;  2B1G A;  3BA8 A;  3GTP A;  3RTX A;  4A2B A;  2IU0 A;  4NKG B;  1Y1V G;  5JH7 A;  4WCE V;  1RJR A;  1GGO A;  2Y48 A;  3E86 A;  3GB7 C;  5LGN A;  4H37 A;  2UUA B;  3H0G A;  1WB7 A;  2Q2U A;  1CKN A;  3WO1 A;  4J7J A;  5JCO C;  1C3O A;  3SE7 A;  4CE5 A;  3F8N A;  4LF8 O;  3HKZ E;  3T99 A;  3FKS G;  3P3N A;  4PJ0 Z;  2WLK A;  2YXH A;  2G38 A;  5EWF A;  2JJ2 G;  5IT9 N;  4PI2 A;  1VQM V;  2C2D A;  3CCU V;  4JV5 O;  3L75 H;  3N6R A;  1S97 A;  4DR4 B;  4X62 H;  1UNN C;  4LF9 B;  5KG2 A;  4LWS B;  2YIC A;  1K97 A;  5KFU A;  1CQI B;  1K83 A;  1GKF A;  3OR7 C;  4O2B B;  4KHP H;  3OTF A;  4FZ1 A;  5I5X A;  3WWJ A;  1AN7 A;  2A1H A;  4G27 B;  5LA6 B;  4DRX B;  1KP2 A;  4O4I A;  3MFI A;  2HGX A;  4CMF A;  5IYB O;  1MG1 A;  2EZP A;  2Q5Z A;  4JZG A;  1I5X A;  1CKM A;  4DL5 A;  3PW7 A;  1M93 A;  4MVS A;  5J2U B;  1VQO V;  4DR2 O;  1LUV A;  4RCN A;  3ORR A;  2KSW A;  4U7O A;  3CXH F;  1WSC A;  1V9P A;  1QLE C;  2LJ2 A;  3K5I A;  2UU9 H;  2IBZ H;  2FL4 A;  5JVL A;  1YHQ V;  3TEK A;  3G4S V;  4WFE A;  3ZMT A;  2OYQ A;  2EIY A;  2W6Q A;  2LQT A;  3T2M A;  1ARO P;  3T1C A;  1CXZ B;  4DV7 B;  3LNM B;  4RNN A; 
#chains in the Genus database with same CATH homology
 3JAT B;  4LSA A;  3N2G B;  1HNW B;  3HXL A;  1L2Z A;  4JV5 H;  1I94 B;  4DR5 B;  3N44 B;  3NBY B;  1XMQ H;  1QQC A;  4RAZ A;  1GYF A;  1SKV A;  4B3T B;  4JI2 B;  1WN7 A;  3LML A;  5BR8 B;  5LXT B;  3E22 B;  4IHJ B;  3QTC A;  4I9Q A;  1I6U A;  4X64 H;  3HKC B;  3HKB B;  4DV6 B;  3RGZ A;  5ITZ B;  4LR3 A;  4DR6 B;  3BAA A;  2W57 A;  5D1P A;  1D5A A;  5LP6 A;  3RYF A;  1CKO A;  4X1K B;  4DV7 H;  2HVR A;  5J2T A;  5BMV A;  4F6R A;  5GON B;  1N32 B;  1WH2 A;  1HNW H;  1N33 B;  1I94 H;  1QHT A;  4FLZ A;  4DR5 H;  4EFB A;  5IYZ B;  4DR2 H;  4DUZ B;  4O4L B;  4DV3 B;  2CAZ C;  2ZIO A;  3TY5 A;  2R9A A;  4B3T H;  4JI2 H;  5BR8 H;  2HGS A;  4I50 B;  5EOY A;  4UFZ A;  3L4J A;  4DV6 H;  4LH6 A;  4BW9 A;  3N42 B;  4DR6 H;  4YY3 B;  5IJ0 B;  4LSX A;  4PZ6 A;  1P16 A;  1ZHS A;  5KHH A;  4ZOL A;  4RB2 C;  3DSQ A;  1XMO B;  2VQE B;  3BAB A;  1N32 H;  1N33 H;  1SQF A;  5EZY B;  5CA1 A;  1DGS A;  4A2A A;  4Q6G A;  4DV4 B;  1N34 B;  4DUZ H;  4DV3 H;  3MAQ A;  1E4F T;  2UXD B;  2PYL A;  2PUS A;  3M7M X;  4X1I A;  4DR7 B;  4MV7 A;  1B04 A;  4YJ3 B;  4WBN B;  4FFB A;  1M4U A;  3JAR B;  4FVM A;  2F1M A;  4YY3 H;  1FFX B;  1H2S B;  4FLU A;  1IBM B;  1XQ8 A;  1IBL B;  3HKE A;  3THO A;  4JI0 B;  5JH7 B;  1XMO H;  2VQE H;  2HIX A;  3JSN A;  1IBK B;  1Z2O X;  4CH6 A;  1BJT A;  1S5J A;  3VQY A;  1CKN B;  2BTQ B;  5C8Y B;  1SEI A;  4CH4 A;  4DV4 H;  1N34 H;  2YIA A;  4GYC B;  3RWR D;  5LOV A;  2HVS A;  1FKA H;  2UXD H;  2PY5 A;  4I4T B;  3SJB C;  3B2E E;  5JQG B;  5LYJ B;  4O2A A;  2P5O A;  2ZJT A;  1N36 B;  4JI4 B;  5DIS C;  3CB2 A;  3WB2 A;  5KHJ A;  3H20 A;  4JI8 B;  3RYI A;  4PZ7 A;  2RGV A;  1IBL H;  4HBN A;  1IBM H;  4LF6 B;  4JI0 H;  2ZNJ A;  3QF7 A;  4E6N A;  4RB0 A;  1IBK H;  4FM0 A;  4I7H A;  4X65 B;  4O4H A;  4U3J B;  2F66 C;  3L4K A;  4KL1 A;  4ZHQ A;  3JAK B;  4YJ2 B;  4IIJ A;  1P8L A;  4DRX A;  4O4J A;  4LF9 H;  4RZQ A;  5CA0 B;  5KX5 A;  5IWA B;  3K5M A;  3NC0 B;  3RGX A;  1N36 H;  4JI4 H;  4CS4 A;  3J7A K;  3SGI A;  4JI8 H;  2XIG A;  4CC5 A;  4CS2 A;  3IAY A;  2Q7H A;  1SA0 B;  3W5O A;  3MWM A;  1M5I A;  4TUY A;  4NXN B;  2HHH B;  4LF6 H;  4DV1 B;  2MCT A;  1Q5O A;  2VQF B;  5D1O A;  1XHZ A;  5JVD A;  2ZIM A;  4LNU A;  3K58 A;  4X65 H;  1XNQ B;  2F4V B;  1M0T A;  2PTM A;  3OTO B;  1JFF B;  3PN1 A;  5D5Q A;  1TUB A;  1MZB A;  2E5L B;  2O03 A;  3RYH A;  1L8D A;  5IWA H;  2JS5 A;  3N2K B;  2V4D A;  3JAL A;  1JJO A;  4JI5 B;  4TV8 A;  2HHH H;  3ETQ A;  3JAT A;  4DV1 H;  4NXN H;  2VQF H;  3QG5 A;  3N2G A;  4X66 B;  5KHK A;  1RSO A;  4LF5 B;  3RR5 A;  2WDT A;  4FM9 A;  5A2Q W;  2WE6 A;  2R70 A;  3BRC A;  3W1G A;  1XNQ H;  2F4V H;  3GB8 B;  4B3R B;  5LXT A;  4RB3 C;  3N40 P;  3OTO H;  2KKW A;  2E5L H;  3HKB A;  4DV5 B;  5LL6 b;  5ITZ A;  3GJX B;  3UQ8 A;  4UCS A;  4F6R B;  3SR2 C;  5JCO A;  4B3S B;  2UUC B;  1M0W A;  4HNA B;  4LFA B;  4X1K A;  4X1Y B;  3WB0 A;  2ZCE A;  2PYJ A;  4JI5 H;  2YXL A;  1FVI A;  4APM A;  5GON A;  4I55 B;  4X66 H;  3VQV A;  4LF5 H;  2OWO A;  3JAW B;  1Z5W A;  4UCR A;  2WYO A;  3BA9 A;  3KXY T;  4O4L A;  4DV2 B;  2YIB A;  4B3R H;  3CHX A;  4DK0 A;  5CB4 B;  3RJ0 A;  3CVZ A;  4I50 A;  3KAJ A;  4B3M B;  4DV5 H;  2CW8 A;  4FM2 A;  4B3S H;  5IJ9 B;  4FLV A;  2UUC H;  5FNV A;  2QJ1 A;  3SJC C;  4LFA H;  1Z2P X;  1BGW A;  2FE3 A;  4UCU A;  4LMY A;  3T1H B;  4DV0 B;  4MTE A;  4CH5 A;  4EB6 B;  2YI8 A;  4ZIB A;  3BHP A;  3K59 A;  3JAS A;  4FFB B;  4EFE A;  5FPR A;  1XI1 A;  1HNX B;  1HR0 B;  3UT5 A;  1X9N A;  2UXC B;  3JAM W;  4DV2 H;  1X4T A;  4GKJ B;  1G6U A;  4YJ3 A;  4WBN A;  4B3M H;  3HKE B;  5LP6 C;  1VS0 A;  2PZS A;  1Q43 A;  1WNS A;  4B08 A;  4EQ5 A;  1XDN A;  4DUY B;  2Q2T A;  5KMG A;  1XK5 A;  4EEQ A;  3ZS8 C;  1TVK A;  4DR1 B;  3VNN A;  1JMK C;  4DR7 H;  1J5E B;  4K0K B;  5EYP B;  5LOV B;  4J0M A;  3T1H H;  4DV0 H;  4RAY A;  3QWU A;  5KHI A;  3HKD A;  3K57 A;  4I4T A;  4FM1 A;  1HNX H;  1HR0 H;  5JQG A;  2UXC H;  5LYJ A;  4BWA A;  3RYI B;  4GKJ H;  3GDE A;  2HVQ A;  4O2B A;  4DUY H;  3RFR A;  4O4I B;  3K5N A;  3K3V A;  4L8J A;  3KAK A;  2GV9 A;  4LH7 A;  4NXM B;  5LA6 A;  4DR1 H;  2ZNI A;  4MTD A;  2JVD A;  1VF7 A;  1J5E H;  4K0K H;  2RQ6 A;  1T5E A;  3KYH C;  4JI7 B;  2P22 C;  3RYC B;  3L2P A;  4U3J A;  4AQY B;  4TV9 A;  3C0F B;  4IIJ B;  1XNR B;  4O4J B;  5IT9 W;  4ZI7 A;  5KX5 B;  5J2U A;  4FLW A;  4DRF A;  4R7R A;  1YEW A;  4YJ2 A;  4X20 B;  4AIL C;  4PDB A;  4TUY B;  5JJJ B;  3FMA A;  4JI1 B;  4LF4 B;  2UXB B;  5D1O B;  4FLY A;  3RIZ A;  3J80 W;  2RGR A;  4UCT A;  5LMN B;  3BPZ A;  1SA0 A;  5JVD B;  5EIB D;  3K5L A;  1XHX A;  4LNU B;  1O9H A;  4NXM H;  5FD6 A;  3U11 A;  4JI7 H;  3U0Z A;  5FD5 A;  2PGG A;  3EYY A;  2Q7G A;  4AQY H;  1TUB B;  1XNR H;  4JI3 B;  3A2F A;  4JYA B;  4UCV A;  1FJG B;  2VUG A;  2HIV A;  3N2K A;  4JI1 H;  4LF4 H;  1TA8 A;  3U10 A;  2UXB H;  4BWS C;  1Z5V A;  5LMN H;  2R72 A;  1E4G T;  3M4I A;  3TY8 A;  3E22 A;  4IHJ A;  3T1Y B;  5LP6 B;  4M7E A;  3HKC A;  5D5P A;  3RYF B;  4AHC A;  4DR2 B;  1HNZ B;  4ETS A;  2Q0A A;  1Q8I A;  5J2T B;  2EX3 A;  3VQX A;  4CH3 A;  5BMV B;  3CSX A;  2VPS A;  1S03 G;  2CFM A;  3WB1 A;  4FLT A;  1I7F A;  4JI3 H;  4K8Z A;  3N43 B;  2UUB B;  1Q3E A;  4JYA H;  1FJG H;  4LF7 B;  5IYZ A;  4MV9 A;  3TY9 A;  3FFQ A;  4HNA A;  5K1X A;  4X1Y A;  2BTO A;  5LMU B;  3ICX A;  5K1P A;  4CC6 A;  1A0I A;  3T1Y H;  4I55 A;  2YIB D;  1HNZ H;  4PI0 A;  1O9G A;  3JAW A;  4ZOL B;  5IJ0 A;  1SYX B;  3VQW A;  1TGO A;  5EIB C;  5FPO A;  4RB1 A;  4OX9 B;  4TQD A;  2F95 B;  5CA1 B;  3DF7 A;  4YHH B;  2UUB H;  5CB4 A;  4FLX A;  4DR3 B;  1WPB A;  4GKK B;  3SJA C;  5FNV B;  5EZY A;  4LF7 H;  4JI6 B;  4IAJ A;  4X1I B;  4DK1 A;  5IJ9 A;  5LMU H;  2VOB A;  4PHZ A;  3JAR A;  1P49 A;  3JAS B;  3RF2 A;  3BA8 A;  3S24 A;  4EB6 A;  1FFX A;  3UT5 B;  1HW7 A;  2JGU A;  3RTX A;  4A2B A;  4X62 B;  4OX9 H;  5JH7 A;  2VWK A;  3RGB A;  5KHG A;  4D7T A;  4YHH H;  2UUA B;  4DR3 H;  4KHP B;  4GKK H;  2Q2U A;  1CKN A;  2BTQ A;  5C8Y A;  5KMG B;  2E3C A;  5JCO C;  2VWJ A;  3F8N A;  5JJE B;  4JI6 H;  1TVK B;  4O2A B;  3N6X A;  2ZM6 B;  1S68 A;  4PI2 A;  2HEP A;  2RJZ A;  3HKD B;  3K5O A;  5EYP A;  1ZAU A;  3W1B A;  3N41 B;  2IM9 A;  4TOI A;  4PZ8 A;  4DR4 B;  4X62 H;  4LF9 B;  4GLX A;  1SQG A;  2QM4 A;  4O4H B;  2YI9 A;  4UCO A;  1NT2 B;  2Q7E A;  3J81 W;  5FLX W;  1TAE A;  2UUA H;  4KHP H;  4O2B B;  2UU9 B;  1KMI Z;  4ZHQ B;  3OTF A;  2CW7 A;  1AN7 A;  4LFB B;  5LA6 B;  2ZIN A;  4DRX B;  4CS3 A;  4O4I A;  2XHB A;  1KU9 A;  3JAK A;  1Z2N X;  4LFC B;  3JSL A;  2ZM6 H;  4K8X A;  1O75 A;  4LF8 B;  1CKM A;  5CA0 A;  4Q0Y A;  4D7S A;  4TV9 B;  3ZED A;  1M93 A;  3RYC A;  3IG0 A;  2F93 B;  4ZI7 B;  5J2U B;  4DR4 H;  4JV5 B;  2KSW A;  3LNN A;  1V9P A;  1ZHQ A;  1XMQ B;  4X20 A;  5JJN B;  2UU9 H;  4LFB H;  4X64 B;  2OYQ A;  4TQF A;  3RYH B;  4LFC H;  1JFF A;  4NVP A;  3NBZ B;  4LF8 H;  2YCH A;  3JAL B;  3KAL A;  4DV7 B;  4TV8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...