4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
2HVRA 3OTOB 4LH6A 2UUBB 4EEQA 2UXBB 1DGSA 2Q2TA 5D1PA 1XDNA 3QWUA 5LMNB 4DR6B 4YHHB 4UCRA 5BR8B 1S68A 2HIXA 4B3SB 1VS0A 4DR3B 4DUYB 3NBYB 1N33B 4DV6B 2CFMA 2UUCB 1X9NA 4DR1B 2OWOA 5LMUB 4JYAB 3NC0B 4X62B 4DR5B 4KHPB 4PZ7A 5D1OB 4LF4B 1FJGB 1J5EB 5IWAB 4E6NA 1XMOB 4X64B 2F4VB 1IBKB 1P8LA 1P16A 4DUZB 1XNQB 1N36B 1HR0B 4OX9B 4GLXA 4LFBB 1B04A 3S24A 2VQFB 1CKMA 1XNRB 1I94B 1N34B 4X66B 3TY5A 4GKKB 4X65B 3VNNA 3GB8B 1A0IA 4AQYB 4UCUA 4EFEA 3BAAA 4PZ6A 4LF9B 4UFZA 4DV2B 2UUAB 4DV1B 4JI0B 4LF8B 4JI8B 2UXCB 4EQ5A 1CKNA 3BA8A 4JV5B 4B3TB 4JI6B 4B3RB 2HVQA 3JSNA 3TY9A 1XMQB 1N32B 4CC5A 4JI3B 1HNZB 1IBMB 3PN1A 4UCSA 4PZ8A 4DR7B 4K0KB 1HNWB 2E5LB 3UQ8A 3TY8A 3BA9A 2HHHB 3L2PA 4LH7A 4JI1B 4EFBA 3T1HB 4TOIA 4DRFA 3W5OA 4GKJB 1V9PA 3SGIA 3NBZB 3KYHC 4B3MB 1FVIA 3T1YB 1CKOA 2ZM6B 1HNXB 4UCVA 4JI5B 5D1OA 3RR5A 2HIVA 1TA8A 4JI2B 4LF6B 4NXMB 4DV7B 3GJXB 4JI7B 4DR4B 3RTXA 5FPOA 1XK5A 3W1BA 4DV0B 1CKNB 3W1GA 4UCTA 4LFCB 4UCOA 2VQEB 2UXDB 1ZAUA 4JI4B 4DR2B 2UU9B 5FPRA 2VUGA 3BABA 4LF7B 2Q2UA 4DV3B 5DISC 4DV5B 3GDEA 4LF5B 4NXNB 4CC6A 1TAEA 4DV4B 1IBLB 4LFAB 2HVSA 4YY3B 3JSLA
chains in the Genus database with same CATH superfamily
3RYIB 2VQFH 2YWVA 3L75H 3PR5B 1KJ8A 5HV6A 3D36C 2GV9A 4IR1A 2BCCH 1KBLA 2KSWA 4O4HF 3ETJA 1NR7A 4I55A 1VQ5V 5KFGA 1JFFB 2EZPA 2ZDQA 1XL4A 5CA1A 2C00A 1TWGA 1VARA 1KC7A 1TVKB 1JIHA 5B1NA 5B3SC 4MTXA 1SCUB 4NYEA 5JVLA 3D3QA 4TV9A 4UVBA 2XGQA 3RUPA 2QYZA 5B1BC 4DL5A 3GLKA 3JARA 3SPIA 1XQ8A 5IWAB 1YJNV 3SPJA 2PVPA 4FFNA 2RGRA 3VBBA 4MTEA 4ZQIA 5A2QW 3KXYT 4CKEA 3ZMUA 4O4LA 1WNSA 3JAWB 5KFAA 1M56C 2DPJA 1TUBB 1I94B 3WU2Z 3HB9A 1ZL8A 1I7LA 4IGGA 1P7BA 5B1AB 2EBOA 3FKIG 2RQ6A 1HWYA 3CCRV 1BHAA 5KLVH 1XOUA 5BWUA 1EN5A 1XNRH 5E1AC 2P90A 4X65O 3JZIA 2DYSB 2OT5A 4EBEA 2AW9A 4AQYH 1RPRA 3J81W 2CDYA 4K8XA 4CC5A 3CPWU 2DQ0A 3U54A 4DV7O 4FBUA 1JX9A 1NVPB 3KHGA 2GUZA 1SESA 1MG1A 2PUSA 3T1HB 2J6TA 4RQEA 4DL7A 4YIOA 1RJRA 4PA9A 1Z2GA 5BZBA 1IBKO 1JOYA 2R8GA 1WP7A 4NVPA 2A9HA 5CR5A 4YIPA 3C0FB 4QGPA 2RDIA 3GTPA 4NXMB 3GJXB 2PI5A 2LW7A 2KG7B 1PK8A 1CKNB 3QQMA 2X6AA 4Q0YA 2CZGA 1HW7A 5KFBA 2UXBO 2Q4PA 2FL4A 3K57A 1JKJB 3OSPA 1CXZB 2VR1A 1K4DC 2IJIA 4ED7A 3GDEA 2LGWA 3RYFA 5L3FA 3ZBHA 4FFLA 2JEJA 4IIJA 4BW5A 2YICA 4O7WA 1WP8A 3AG3B 3CYOA 4CBCA 5FLMG 4JTAB 4TQRA 4A3GG 3T1HH 3ZHQA 1W96A 3HBLA 3BACA 2ETNA 4MV3A 2WLIB 4O84A 2QDOA 2DYRC 4TM5A 1PNMA 2J9GA 5C8YA 2F95B 3KG2A 1DV2A 4L1KA 5D5PA 1QLEB 3CMEV 5EWFA 3LNNA 5LP6C 3BG5A 1XNQH 4LP8A 5C4XG 3D8CA 3CCSV 2VPQA 5KFWA 1S0VA 3PO2G 4KHPB 4ED2A 1OCZC 3ZN0A 1M56B 1KEEA 3RAXA 4ED6A 4JGSA 5DAAA 3R5XA 4CHIA 4RO2A 1MSWD 1DK1A 2EJ0A 5DG9A 3EPGA 2ZINA 1UC8A 3ETGA 1QVGU 5LYJA 2R87A 4MVMA 3H0GG 2IH1C 3ZS8C 2FPIB 1NQTA 3DTUB 1GRJA 2ZNJA 4PDRA 1BJTA 3GTQA 3QVNA 2V5AA 1HNXH 3HKZA 4D6TH 2DYSC 2YL2A 4RWUA 5IYZA 4JI7H 2KQXA 3LWBA 2VOBA 4U6PA 1XDCA 4C2MA 2HEPA 1S97A 2UUCH 2ZIMA 2UXCB 3GIMA 2DOSA 2EULA 5H9CA 4E4TA 2NVYA 5KG2A 5IJ0A 2COGA 5DGHA 2KG7A 2QA4V 1R3KC 1XNQO 1R9TA 4A3KG 3WWIA 3SJAC 3IG0A 4W4LA 4X66O 1IYDA 5I5VA 5CB4A 5CM0A 5KFLA 5J2UB 2FB9A 2NU7B 4DV0H 2IH3C 3OTFA 3KYHC 5DQHA 3HOZG 1WLEA 3T5KA 4FM1A 4JI6O 2X0SA 1Y1VA 4A3JG 1HNXB 4I0XA 5KHGA 2HIVA 3RB6A 1AI7A 1TA8A 2EX3A 1I50A 1YCIA 2HDKA 5K2MA 4JI7B 4DR4B 5HBRB 3KHLA 3CCQV 3LSQA 3FAVB 5KG6A 3JALA 3R5FA 5CA1F 4DR5H 3NUAA 3UCSC 1MMMA 4WFEA 4ECRA 3G6EV 2LFSA 5CBGA 3BABA 1N48A 4ECYA 3I5DA 4FM9A 4TV9F 4NTWA 3TW6A 1N32H 5KFHA 2JA6A 5KUMA 2C28A 1XUQA 3JYCA 2Y0PA 2DMXA 4NB5A 4DR7H 2WLLA 4O2AA 1WRVA 2K9PA 4H0LB 2Q5ZA 4ED8A 4CH5A 5J2UF 1TUBA 4EEQA 1DGSA 1Y76A 2HFEC 2XHBA 2R92G 1FJGO 3BPZA 3T4DA 3SPGA 4RAZA 5HFLA 1GN4A 1KYOF 5CA3A 3EHBB 4DUZO 3GIJA 4DV3O 4D7SA 4IWYA 2QWNB 5KFPA 4DR4O 4FFOA 1TVKA 4DL2A 1YF2A 3K08A 4DK1A 4LF8H 4XDLA 3GTLA 4DR4H 4X62O 3I12A 1IDSA 1RK6A 2PGGA 4HZ3A 2XAGA 4FZ0A 4JTDB 2ZCEA 4O4JB 3AG7A 1SFOA 3VQVA 1KJIA 4Q8FA 3ZHSA 1G1XB 2JS3A 4CS4A 4XDJA 5C1PA 1N33H 4DR7O 4B7EA 4NYKA 1XNQB 2DABA 3J7AU 4LF9H 4HQ6A 3VMMA 1IZ3A 3OUZA 5B1BB 2FK3A 4MTGA 2I80A 1KQSU 5B66Z 5KHHA 4XX0B 2PI4A 5IDJA 1AP5A 5A9GA 5C8YF 1Y1WA 2JA7A 2EJRA 3FB6C 4UFZA 4B3SH 3UZOA 3NR7A 3J81N 1VQPV 4I4TB 1E79G 2JGUA 4MVZA 2QWRB 5EIBD 2HVQA 4B3RB 1W2BU 3PW2A 4FVMA 5EBMC 3CRQA 2YUAA 3W7WA 1IBMB 1A3GA 1DF4A 4Z1VA 4YR0A 4JI5O 2W0XA 4MSWC 4LH7A 3MR5A 2XUMA 1AI4A 3L71H 1V9PA 1SKVA 3LSUA 1DIKA 1FVIA 4PBCA 4GCZA 2VUMA 5IE9A 1AJPA 4XBFA 1QQCA 2AXTZ 4EYIB 2UUCO 2BR0A 2R85A 4DV5H 4H33A 1R3JC 4DK0A 4YAJB 4LF5H 3CQZA 2EIKB 2QTSA 3EXAA 5LP6A 2XAJA 4DV0B 3WWHA 1IBLH 4WBNF 3T2MA 1WB7A 4LFCB 4RNMA 1R6NA 3GTMA 1KU9A 2W70A 5BWWA 3D36A 5IYCG 3RB4A 2EJ7A 3E22A 4MVOA 2XTAA 2PZSA 3OEHG 3G71V 3OD4A 4F4LA 4YY3O 3WWJA 4JTCB 1VF6C 3OMAB 4BW9A 1OCCB 4M0JA 5E79Z 4QJFB 5J2TA 3B4SA 2WLIA 2W6PA 3QNEA 2YRWA 3FD9A 1ORQC 1GN6A 4JXUA 5D1PA 3WB1A 1V54C 4F4WA 4BR6A 2DLNA 4FFKA 1S68A 3ASNC 3ZMSA 5L3CA 4PHZA 5KT3A 4YXWG 1G6UA 2E2HA 3GV8B 2JDIG 3TK1A 2P7TC 2JA6G 3U0GA 3IGAC 4LFCH 3PW5A 4JI3H 2JS5A 5KG0A 4K35A 4ZOLA 1HNXO 2ZM6O 4QWBA 5BWRA 4YBZB 4P9OA 2ZXWB 4J7JA 2EJ3A 2JEGA 4MW3A 4O3QA 2F23A 1V55B 5L3GA 3SJQC 4XDKA 4RNOA 1NKDA 4EBCA 1Z2PX 2Z04A 4WFAV 4X66B 4UXNA 1WPBA 3HKDB 3VNNA 4B3TH 4LFAO 3OR6C 3W7TA 3ABMB 1CPYA 4EFEA 3OUFA 1BZKA 4GLWA 5LMNH 5BMVF 3HKCB 4LF9B 3N2GA 2Y69C 4WF9V 4LF7O 3FKSG 2AZ0A 2AZ2A 2YS7A 2CGNA 4RB1A 3CD6V 1NVPD 3CEBA 1TWHA 2JA8G 1PNKA 3MWMA 4LBEC 5C93A 2NU6B 1BMFG 5FNVA 1BGYH 2BSKB 3PN1A 1LUWA 5I5SA 3ZN1A 1OZ0A 3ASOC 2C2EA 1S3JA 3E8FA 3K5MA 1OBDA 1RJQA 4O2AF 2EIKC 3HKEA 1K9MW 1M6VA 1K34A 4PA7A 5BR8H 4AYBE 4RNNA 4Q6GA 1AI6A 2WA4A 4CS3A 1AUVA 1EN4A 1GM9A 1CKOA 2PTMA 4X65H 1FXKC 5LOVB 3OMIB 2HVJC 4EB6B 2R7MA 3CCMV 2PBZA 3G4SV 3HKBB 1JVMA 1K1QA 4QW9A 3SPHA 4IR9A 4DV1O 1GTOA 4DV5B 3QZ7A 4LF5B 3JD0A 3ZX6A 5KT5A 4ECQA 2YZGA 3AG2C 5KG1A 1VQ6V 1KKDA 2IMWP 3RVZA 3ASNB 2P4KA 2KKWA 3D3IA 1YIJV 4TUYF 5KFTA 4Q44A 1WB8A 5BY1A 4J10A 5JVDF 2UXDO 4DV3H 1XDNA 2NVXA 1RSOB 4ECWA 1Q6UA 4B3MH 3TEKA 1VEWA 4P9PA 4LF4H 1P84F 4J9ZB 2ZR2A 3K5LA 2QWOB 3TQTA 3JALB 4LC1A 3GIQA 2ZXWC 4I50A 3UKMA 3JCUZ 4Q4CA 4O4JA 4APMA 1KUQA 3HKZE 4NXMO 5E25A 2WDTA 5KT7A 1N34H 4X1YB 3H01A 1I5XA 2UUBO 3H4BA 2DN9A 3LMLA 1IBKB 4LSAA 3ABMC 1VIBA 4C7UA 4QJFA 3BQ0A 4HBNA 2GDSA 1XMQO 3H40A 4A3DG 3T54A 4KUMA 3H4DA 1CE8A 1KMIZ 3RYFB 4BXXG 3T5JA 4LNUA 5KHIA 2RNBA 3FX7A 4UV8A 5IYCO 1CS0A 1U97A 2E3CA 3Q8SB 3RF2A 4NR1A 4IIJF 4RAIA 5EBWC 2ZGIA 3T99A 5LL6b 4A3BG 4PZ6A 3DTFA 3CHXA 5LHHA 3VPBA 1FXKA 4QIWA 1YITV 1Y1VG 4DR2O 2KSDA 2VS0A 4X66H 4LR3A 1K8AW 3H9VA 3JAMN 4JI0O 2UUAO 2WYOA 4HNTA 2QM7A 4O2BA 4JI6B 4B3TB 5KHJA 2CAZC 3KALA 4O7LA 4RB3C 4QWEA 2FKXA 1M57B 5JJEB 1AROP 4Y8VB 1PM9A 3K79A 5H2FZ 2XAQA 2NR5A 3OUUA 5LYJF 4DO2A 4QW8A 1OV9A 2IP4A 4DV7H 3OAAG 5DG7A 4UUJC 2HGSA 2E2IA 2QKCA 4F50A 3Q1KA 3HKDA 2ITDC 1GM8A 5EIBC 1FFXB 3NXSA 1WA8A 2DAAA 5EC2C 2YEVB 2UXCO 2AGPA 1HNWO 3N43B 2HHHH 4HNUA 5IYDO 4YQWA 1MA1A 2N04A 2VQEB 1CEZA 1YEWA 4DL3A 1BT8A 4A3MG 2WAQE 3N44B 2M7WA 1EZ1A 2MCTA 4U7CA 3A2FA 5JH7B 1VAJA 3ORRA 4NXNB 2JEUA 4X1KB 3CCJV 2DIKA 3KHHA 1Q3EA 5KFDA 1M7JA 1Q86W 1K5SA 4DV6H 2WE6A 2CQYA 1YJ9V 3CRAA 4FLZA 3BJYA 4HNAB 1JJ2U 2BQRA 1GH6A 3B8NA 1OCCC 4DLKA 3IAYA 4J80A 1XBLA 4GT1A 1BXRA 4OXSA 1AP6A 4X1KA 4DUYB 2W6OA 4EG0A 4JI2O 3ETQA 5EZYB 3CC2V 1W0KG 1PP9H 4RCNA 2HGXA 3CWBH 5IT9N 1RK5A 1XMQH 1UPGA 4AYBA 4JPRA 4RUEA 4LF4B 3GV5B 3L9DA 3ETHA 4NTXA 5EYPA 3TJTA 1ZUQA 1GO3E 2C2DA 1COWG 2RN9A 1WPXA 2IU0A 2CTQA 4IWXA 3H1HH 5FLXN 3QTCA 3ZRVA 1H2NA 3RIZA 3G67A 4GKKB 2R7ZA 2MK3A 4HYKA 2M05A 1DF5A 2IA6A 1IBKH 2C35B 4FPPA 4PA6A 4ZIBA 1XREA 4Q20A 4WFGA 5LXTF 4FLWA 1D2DA 3AEIA 4MVRA 5KMGB 2WTFA 2E5LH 4FZ1A 3RBEA 5C5JA 2AHYA 2QGNA 5LA6A 3BA8A 3RV3A 5JVDA 2R6FA 3UM7A 3CP1A 3HOXG 2LFRA 2YW2A 3K59A 3R5HA 5C3EG 3GQCA 1B6RA 3BVOA 1Q43A 1B6SA 2R93A 3Q4HB 3C90A 3ZIAG 2B1GA 4JI6H 4ZI7A 1EFRG 3G6VA 4UV9A 5IP7G 3N27A 1B33N 1NZ6A 4DR2H 3ZRSA 4FFRA 4MV1A 4WBNB 5KFXA 1VF6A 1MOFA 3PW4A 4I9QA 1FYJA 5H5NA 3GILA 2R8HA 5IT9W 2JGDB 4I50B 4DV4H 3H1JH 5BR8O 1KJJA 3K5NA 1VQ7V 2LO1A 4ECSA 1TWAA 1ZSPA 3OFNG 3APQA 3RVYA 2X7RB 1YTFB 3CEIA 4J11A 1AUXA 4WFHA 1SQGA 5DISC 5LGNA 2FK2A 4F6RA 1JJOA 2ILMA 2J6SA 3HB3B 3CRMA 5DG8A 5KFFA 4CC6A 5BPHA 2R84A 4FLVA 4DL4A 2NLJC 2JGDA 4K0KH 4K8ZA 1I1KA 1U96A 4I55B 5KHKA 2YZLA 3B2EE 4DR1H 2PY5A 1OCOC 2YC0A 4PA3A 5KX5B 4GUNA 3LUTB 4DR6B 3GIPA 4OGQB 3V6HA 2DE0X 3BQ2A 2X0LA 1YHQV 4FFBA 1E1QG 1J5EO 2C2RA 2CH7A 4DV6B 4ZOLF 2H3OA 3OM3B 3QO7A 4LF4O 2X6CA 1X9NA 1S5JA 4DRXB 1BE3H 4I0XB 4YJ3A 3W7SA 5DGBA 1RYRA 3A0HZ 1DV1A 2RCVA 4J9NA 1NTKH 2WB1A 4JYAB 2BTQA 1SA0A 2KB1A 5L1JA 3WO0A 1QNMA 4UUGA 5JH7A 4DUYO 2BOBC 4ME6A 3IJ4A 2HHHO 4X9QA 2UVRA 2QM4A 1P8LA 1RPOA 4R8UB 5DLFA 1ZL8B 2AGAA 1HR0B 1AR5A 1B04A 4JI3O 3J80N 2XAHA 1I2KA 4R50A 3T9DA 4QWCA 1P7GA 2RDCA 4J7ZA 1NH2D 2FTKA 3JATA 4MAMA 1NJIW 2Q9LA 2WAQA 4K6NA 4RAYA 4X20B 4PELA 3G6XA 3LQSA 2Z3YA 5KA5A 1JDBB 1M93A 2QJ1A 4CH3A 2XGPA 2Q7EA 4JI1H 4BIZA 2OCHA 3C3SA 2B5UA 4DV2O 2ATLA 4JV5B 4X8AA 3Q8PB 2FB5A 4JYAH 3L4KA 2G38A 4GKJO 4YY3H 1HNWB 2E5LB 3UQ8A 2F4VO 4JAUA 1BSMA 4ECUA 2DWDC 3AG1B 2DJVA 1IVSA 4TV9B 3B09A 1KTAA 3T9BA 2W7PA 4B7KA 4EYHB 2QM8A 1Q6IA 4JI4H 1FD9A 3IFXA 1ZLZA 1LR1A 3M9MB 1K1SA 5D1OA 4X88A 3QO5A 5FD5A 2UVVA 3DF7A 5LXTA 1IX9A 2YZMA 4HN2A 1GM7A 4H37A 4UCTA 3CXHF 5I47A 4IAJA 3DAAA 1NH2B 4K3AA 4AQYO 4DR2B 2H94A 2OIGA 3ZCCA 3W7XA 2AU0A 1ZQ7A 2XAFA 1OCOB 2Q69A 4ABMA 1UNNC 3N2GB 4A3LG 1XILA 5I5TA 4Q45A 1THZA 5KAFZ 4DV4B 4MV8A 1AILA 2W8LA 4YY3B 1WJZA 1TWFA 5KFSA 2BTQB 5KAIZ 3V4SA 2UXDH 3OTOB 4NLGA 1KD1W 4L87A 1N8RW 2Q2TA 3ETEA 1FXHA 3GV7B 5L1KA 1ZTEA 2HIXA 3K58A 4HAMA 3SDLA 3WFVA 1QR8A 1ZHSA 3CXCU 4FFPA 2UUCB 3HO8A 3ZHTA 2GQRA 1WCMA 2H8PC 4UB8Z 4RU9A 4ED1A 1K4CC 5CAEB 3Q8RB 1ROPA 1OBGA 3ZEDA 4BAYA 4UB6Z 4CH6A 3B8MA 2FE3A 1NBMG 5IJ9A 1JX4A 2W6QA 2E76B 5LGUA 4DL6A 3TGUH 2P0AA 2Y4TA 3L70H 2Q68A 3E8GA 1N36B 1HNZO 2A1HA 4C5AA 1GYFA 2SCUB 2IBKA 2JEFA 3N2KA 3OR7C 3Q4HA 4ZHQA 3S24A 1SC5B 1WSCA 1NS1A 4PI0A 3P3PA 1S5LZ 3KAJA 3FFQA 3E8BA 3S3WA 5J2TB 3GB8B 2EJ2A 4A2BA 4MV6A 2HG5C 3V4ZA 1ULZA 2XCLA 2FKLA 2CNQA 4DV5O 4DV1B 2XNDG 4XYLB 1JCHA 3T5LA 2FPGB 5JJNB 5DLGA 5I5UA 2ARHA 1K33A 1I94H 5HFMA 3AG1C 3U55A 3K04A 2P5OA 3MFIA 3TCUA 5LMUH 2Z0AA 1N32B 2IU3A 4DR7B 3P3NA 3TY8A 1I2LA 1N4CA 4JZGA 3M4IA 1L2ZA 1Q90D 1R3IC 4L8JA 4J9RA 4KL1A 3KZIZ 2YDEA 3VQXA 4FM0A 5LHIA 3DC6A 1VMGA 3ZMTA 2ZDGA 2XCPA 3PW0A 1N36O 3NBZB 2JA7G 3AX6A 4O7VA 1KJQA 2AHZA 2X5RA 3ABLC 3RFRA 5KA6A 4WBNA 5C44G 4A93G 5CA0F 3L4JA 2B9ZA 1KBHA 4O4LB 2IM9A 3KKYA 1H2LA 3OUSA 5JH7F 1CQJB 4DIMA 4AHCA 1SQBH 2EZOA 3G6BA 3TETA 1W93A 4TSFG 2JJ2G 5LMUO 5FPOA 2JEXA 2WA3A 4XYMB 3VPCA 5ITZA 1SRYA 2DWEC 3HKCA 2Y48A 2O57A 4P2ZA 3M8AA 1SA0B 1T5EA 4JI4B 4O7NA 2CW7A 1EM1A 5IYZB 1XMOH 4PA4A 2ATKC 4LF7B 1Y74B 5GONA 3KCYA 5DMXA 1YI2V 1H2KA 2M6YA 4KP4A 3G8DA 4EBDA 2A0LA 2D3OW 5CB4F 4PDLA 2HVRA 2Z5UA 1PNLA 3T9CA 5L1IA 4A3EG 1RFYA 4X1YA 5KT2A 2ASJA 2V7QG 1GN3A 5EOYA 4UCRA 5LGTA 3E5NA 5I5YA 3E89A 2GQSA 1IXBA 5EYPB 1XEQA 1JR9A 4B3SB 3HOWG 4JI7O 3T9FA 2GTAA 3PVXA 5L3BA 5CN0A 1Z2NX 1F7YA 4CZZA 4A3CG 4IRDA 2VA2A 2BTOA 5BYBA 2ZDHA 2ZQMA 4BIUA 2W6IG 1XMOB 1K5QA 5JQGB 4X89A 4GX5A 5B1AC 1GSAA 1W0JG 3FYIB 4J42A 5LMNO 4PJ0Z 4LFBB 2QK4A 1IXMA 4O2BB 1CQIB 3ZJZA 1AVMA 4YJ2A 1KUTA 1RJPA 3CC4V 4TV8A 2E5LO 4F4YA 2R70A 2QB5A 3MFHA 3I56V 5CE8A 4YJ2F 2NNUA 3LDCA 3UT5B 4DV2B 5DN6G 4X1IB 3HXLA 5IYDG 2UXXA 3MR3A 2IW5A 5IP9G 4DYLA 5I5XA 3GIIA 2GLTA 2E74B 3SE7A 4CKBA 2RGVA 3Q8QB 1BL8A 2V9WA 2YYAA 4EGQA 3WNZA 3STLC 1M1KW 3ABLB 2Y69B 2ABJA 5J9PC 5KT4A 3AW8A 3F7YC 3L2PA 1UFIA 1FFTB 4A5UB 1IOVA 1AJNA 2A7WA 4TUYB 5TISZ 4JZ2A 5GW7A 1HR0O 2UXNA 5A2QN 4KHPO 1BQ0A 3ZRWB 3ABUA 1FKAO 2LP7A 3CCUV 5DGIA 3LP8A 3ASOB 5J2UA 3CCEV 1SQVH 2VRZA 4IHJF 1N33O 2W9CA 1AB3A 1KJ9A 3FDSA 2RF4A 1H8EG 3JZFA 5FL7G 3W1BA 2JRIA 4B3RO 3S3XA 1TUEB 4RB2C 1V4YA 3PR4A 1Q82W 5FR9A 1WAZA 3GWOA 4DV6O 2YS6A 1ZAUA 3KTMA 3RN4A 4WHXA 3H3VH 2WWWA 1FXKB 4DR3O 3RYIA 3AK3A 2OTJV 4J9PA 2B63A 1VF7A 2FYUH 4J9LA 3ABKC 2PN1A 4U3JB 5JWPA 3M9OB 4YJ3B 1QLEC 3CX5F 1M4UA 5EC1C 3EVKA 2UXBB 2A06H 1NTZH 3JRXA 5LMNB 1MZBA 3RB0A 1GKFA 3OGCC 3G6YA 2N05A 4ED3A 3LSSA 3OGIB 5KFOA 3AG3C 4JI5H 4O83A 1Q81W 4JYCA 4U3JA 1OWTA 4YJ2B 3RFCA 3HKBA 4O4IF 2CTRA 2EIYA 3JASB 1S72V 3MR2A 3HOVG 3CSXA 2F43G 5DGAA 1SZTA 3WG7C 3NGDA 4A2AA 5BMVB 4X64B 5LP6B 4JV0A 2BQ3A 5J2TF 1BNCA 3L73H 4DUZB 4M7EA 1Y4MA 5L9XA 1EUCB 4DV4O 3APOA 4GX0A 1OCZB 2XASA 3VQWA 1XNRB 4KXRA 1CKMA 3K3WA 4F6RB 1YTFD 2VWKA 4X65B 4DQNA 4AQYB 4FJCC 4PD4F 2R8JA 3CRRA 2R8KA 1PX2A 3R66A 5CA0A 2OH2A 4J9YB 4LFBH 2VUMG 2Y4UA 4ZI7B 2QTOA 3MD0A 4UVAA 3H20A 1H38A 4BWAA 1AR1B 5K3WA 1O9HA 3H1IH 3BRCA 2VQFO 3QO8A 3OHBA 1GN2A 4ECXA 2LW1A 2FK1A 4MV7A 1XHXA 2YS8A 2OYQA 1A0GA 3JAMW 4DRXA 3BEHA 2ODTX 1KP3A 4EFBA 4NXMH 5GTIZ 3BHPA 3BFRA 5IWAO 5GTHZ 5L1LA 3W5OA 4GKJB 4LNUB 4B3RH 4A3IG 2ZE8A 2FMLA 2AQ4A 5FD6A 4TV8B 4B3MB 1IOWA 1JPXA 2XOKG 2HR3A 3LNMB 2E75B 1SEIA 3X2QB 3GTGA 1US6A 2COIA 1YZBA 2DWCA 3RR5A 1HDJA 1ENVA 3BQ1A 4LF6B 1R1BA 3UT5A 1ZHQA 1B6QA 5KKNB 3R9RA 2Q0OC 4NZOA 4TQFA 1VQ9V 4JYBA 4RZQA 4GX1A 3DTGA 4F4ZA 3AG4B 4JI8H 1LUVA 4I4TA 1GLVA 1D5AA 4F4XA 5LHGA 2R8IA 1N0NA 1IBLB 5D8DA 2QR4A 2R86A 2Y0SA 3CE2A 1H8HG 3ZRXA 1I08A 4GKJH 5JCOA 5H6RA 3K5OA 2R7LA 4H44B 3L74H 1X59A 2Q7GA 3CC7V 4RUAA 3UZBA 1SQFA 4GYCB 3WG7B 4G3IA 1EBOA 1XHZA 2CK3G 1H2GA 3SR2C 2VQEO 2W0FC 2AGOA 3IC7A 2UXBH 3QFFA 1K83A 3OT7A 3QZ8A 4I4TF 1Y74A 1GMGA 5GONB 3NC0B 2Q67A 4ZI7F 1S0OA 1UJWB 2F93B 4O82A 4BY1G 1VQOV 4RB0A 1M0TA 4MVSA 3E8HA 1UC9A 1JXLA 1K7DA 3U0ZA 1SERA 4WCEV 3TXSA 1BGWA 1K92A 3K3PA 2A79B 2P06A 4TT3G 3SYCA 4R7RA 2VQFB 2Z02A 4N23A 3OTOO 3QG5A 3AYHB 4JI8O 2DPIA 1VKZA 2AGQA 4ECTA 2HJDA 3CJHA 4JUZA 4UCUA 4GX2A 3R65A 4J0MA 3HOUG 4Q4DA 1VQKV 2UUAB 4JI0B 1QU7A 3OEEG 4O4IA 1QVFU 2OCCC 4O7TA 5IJ0B 3GB7C 4O7RA 1RSOA 5KG5A 3OHAA 1XNRO 4O7SA 2UVWA 3JSNA 2R72A 5KFJA 5DECA 1I0HA 2VPSA 1S76D 3HT5A 5IWAH 4EEYA 3SPCA 2R7ZG 4J9MA 1N0JA 4IL6Z 4X64O 4FS2A 1S0NA 2V59A 2I87A 4MA0A 4YJ3F 4BBSG 1ZWIC 3KAKA 2V4DA 4I7ZB 3T1HO 3RJ0A 2R9IA 4QSHA 4E2LA 4DUYH 5KFRA 5DQGA 4FMTA 3VQYA 5KMGA 4RUFA 3MWEA 4DV7B 1S0MA 4FBTA 5JQWA 3B40A 1HP8A 2ZE7A 4QPJA 3W1GA 2ZD9A 4BIOA 2UUAH 4JI0H 3GVMA 3GWKC 4O86A 2YIDA 2W9AA 1AJQA 2IJJA 4IHJA 4J41A 4N21A 4TV8F 4TVIA 2WLLB 2VQDA 4LF6H 2XT9A 1A48A 3HR0A 3HPLC 1NT2B 3TIIA 5KFMA 3JARB 1N56A 5L3EA 4I5SA 2HVSA 3FB7C 3FB8C 3STZC 5LL6Y 3MJFA 3F7VC 1I94O 2HHFB 5DEDA 1VBGA 4GKKH 4LH6A 4QWAA 2CNUA 3W7UA 4FFMA 2Q73A 3KHRA 3RAQA 3F5WC 4ETSA 1AI5A 1OJHA 2IJKA 4FFBB 3ABKB 3K06A 2FJZA 2CKZB 4FU0A 4Z2WA 1N33B 1M9NA 2ZE6A 3A8TA 4NKGB 1E4EA 1I1MA 5CMUA 3ZMVA 3SJBC 1T36A 1NTMH 4J9SA 1Y6XA 4CMFA 1RYSA 3DC5A 2W7OA 1F23A 4QE7A 1A9XA 4QIWE 3N40P 1PD3A 2V4RA 2Q0AA 4LF6O 3MDSA 2PMZA 4J9OA 2CE4A 4FLTA 1J5EB 2JVDA 3RYHB 2PYLA 2XCAA 3V6KA 5KFZA 3E83A 1I7NA 2PF4E 1SQXH 5ITZB 2DW4A 3ZMZA 2FPPB 2WAMA 1SQQH 4PDMA 1LNQA 3WB2A 2OCCB 3RBDA 1N34B 3TY5A 2GPSA 3U11A 5GONF 3JCZA 3OE7G 3I55V 4LSXA 3UO3A 3VOUA 1JA8A 1V55C 1HNZH 4R6ZA 1VQ8V 1IBMH 1PPJH 3PW7A 3I4MG 3RT3C 1I3QA 4EQ5A 4KFMA 3K0GA 3KCXA 1KB9F 3SYQA 3ETDA 4KHPH 4I55F 4Q8EA 1Q5OA 2J6UA 4K0KB 3TQ1A 4ECZA 2F1MA 5C1OA 3CCVV 4DRFA 3FB5C 1MSDA 2LJ2A 4DR6H 4WD3A 3OW2U 1SQPH 1QR9A 2L6LA 1BCCH 5CB4B 4MV4A 3JD3A 1EN6A 5K1PA 1KC8W 2ZM6B 4DR3H 4ICGA 4PI2A 4OPHA 1EZJA 4PV1B 3U9TA 1Q6HA 2CW8A 2YEVA 4FK5C 5K1XA 1OHHG 5B1OA 3X2QC 3CCLV 1RM1C 2UXCH 2VUGA 2ZJTA 2QSAA 2HLDG 5LOVF 1NI8A 4G2KA 2YSUB 1IURA 2Y4RA 2VA3A 4NTYA 1L8DA 1NR1A 1EKFA 2HP8A 5KFVA 2HJFC 4C5BA 2W57A 2VQEH 3AG4C 2EIJC 2EILB 2WB1E 2BOCC 1H2SB 2QKAA 2UUBB 2V4QA 4JI4O 5LYJB 2P6JA 3RYHA 2QKSA 2W6MA 4NXNH 3OSNA 2OTLV 5FNVF 3RB3A 1VS0A 4DR3B 4YAKB 2ZM6H 2W71A 1NU1H 2QWPB 2F4VH 1FFXA 1I6UA 1XI1A 4LFCO 2NUAB 1JMKC 1MNGA 5BWTA 4DV0O 2OWOA 2BSKA 1B06A 3N8DA 2CGOA 3BCCH 4DXWA 4ASUG 4DR5B 1M90W 4PZ7A 4I9WA 3RYCB 3LULA 2OLSA 2W9CB 3K5IA 4AI8A 1HNWH 3JAKA 4JI1O 2P22C 4O2BF 5CBFA 2ZT9B 1P16A 4TQSA 1L0LH 4O7YA 4GLXA 1IBLO 3L72H 2NU9B 3TW7A 4NZMA 3PZPA 2HHFA 4R7CA 4W4KA 1JQ0A 4LWSB 4DW0A 4LF5O 4JV1A 4QIWF 4D7TA 1SYXB 1J5EH 2UUBH 2CUGA 3PJSK 1EUDB 2R93G 1WCMG 3E22B 1Q7YW 2XC9A 3BAAA 1VP7A 3DXRA 2ZDIC 3CRCA 5CBHA 1A32A 5KFUA 2W6NA 4FLUA 1DLBA 2W9BA 2UVUA 2RMKB 2R82A 5FNVB 4H13B 1K73W 1FAFA 4LF8B 1WR2A 4LWSA 2UU9H 1QLNA 1ZX3A 5IJ9B 5F9NA 5F9LA 5DM6V 2YXYA 2O03A 5IYBO 2WLJA 3I4NG 4B3MO 3G80A 5KFIA 2GHYA 5FJ8G 2GSMB 1HNZB 2R7NA 4O4HB 4Z1MG 2N74A 2EINB 1VBHA 1K97A 2QE7G 3E86A 1VQMV 2Q7HA 1BHBA 4PDBA 1I5YA 2JA5G 3SGIA 2QEXV 2YIBD 3B77A 5IYZF 3T1YB 2GPWA 4DR1O 1GGOA 2XD4A 2PMZE 1XMOO 3FMAA 4O4HA 2CTPA 2HVKC 3J7AK 2JJ1G 1G2WA 4JV2A 2P4VA 3SJCC 1V51A 2R92A 5KG3A 2ADQB 1XK5A 3V6JA 4LF9O 4O4LF 2HG8A 4O81A 3P30A 5EWEA 3RGZA 2EILC 2EIJB 4X1IA 2UU9B 2ZKOA 1P4RA 4DAAA 4HYOA 4DV3B 1J95A 5IY5B 5B5EZ 1N36H 1MABG 3JASA 3VOTA 4WFBV 4QPKA 2EIMB 2ALZA 1URFA 4JAAA 3RBZA 1DTOA 3EFFK 3RWRD 3LDEA 2UU9O 2ADPA 4O2AB 2IJHA 3GTKA 1X4TA 3JAKB 2FP4B 3QWUA 3SYOA 2YU9A 1P49A 4OX9O 5KG4A 5DQIA 3T1YH 4FS1A 1FJGH 5EK0A 2C2AA 1IYEA 4MT8A 4LMYA 3K03A 1EHIA 5KX5A 3LDDA 2W8KA 1ET0A 3E35A 4IIJB 3T7AA 2ZDIA 5KFQA 4OX9H 4DR1B 3H1LH 4MS2A 5LMUB 2R9AA 1FKAH 1K3EA 5D1OB 2WLKA 2CH7B 5JQGA 1YDXA 3SYAA 3N2KB 4ZHQB 1B3QA 3ORQA 2F4VB 1OCRC 4WFFA 2W9BB 3JD2A 4TQDA 3ZHVA 3R23A 2HKOA 1Q8IA 5JQGF 2WLMA 2PYJA 1PV0A 3SYPA 2YIBA 4JV5O 1D5NA 2Q8VA 2YI9A 4MTOA 1Z2OX 1WH2A 1WN7A 3F8NA 4IT5A 3U10A 1N32O 4EGJA 1E4EB 1SETA 1HR0H 1VQLV 3N42B 4O4JF 2EINC 3VA7A 2IBZH 4MW8A 4IZOA 3RW0A 1Y14B 3UYYA 4B08A 2W6JG 1BQZA 1G4YB 4JI3B 4FM2A 4PZ8A 5LA6F 4MVQA 5LBQA 1JLLB 3T1CA 5BPFA 2HHHB 5KX5F 4JI2H 4PDVA 4JI1B 2HJWA 2YRXA 4O3RA 3O9OA 1EKVA 4JV5H 5KT6A 2DZDA 4JYAO 1EKPA 3KREA 4O7ZA 1Y66A 1RP3B 5BXZA 1Z5VA 4LCUC 1SZXA 4CE5A 3K3VA 1PL0A 2JEIA 4MTFA 1MZEA 4JYYA 3EYYA 1DAAA 3RTXA 3PFFA 5BWXA 1F4MA 2FMAA 2YI8A 2DQ3A 1Y67A 4DR6O 5CA1B 3T9EA 2EIMC 2W6ZA 3Q2OA 5CA0B 2VWJA 1YJWV 4I50F 2COJA 2D2CB 1YVWA 4FE2A 2P67A 2QWQB 3MWDA 1PKXA 1V54B 2JA5A 3AK1A 2ITCC 1TAEA 4LFBO 4LFAB 4HNAA 4CMDA 2XIGA 3ZHUA 3ZRWA 1GAXA 4RZRA 1SS3A 1RM1B 4O3SA 3PO3G 2BQUA 4OPAA 2OIEA 3RGBA 3TXQA 1M0WA 1T94A 5EBLC 4YR3A 1EZVH 5BR8B 3K5HA 4DV2H 2RJZA 3MAQA 4BWSC 5EDWA 3MHHC 4QE9A 3NBYB 2QF7A 4J9KA 4AILC 5KUKA 5EWGA 3N6XA 5FLXW 4ZKIA 4B3SO 1PL4A 5IYBG 1FS0G 3UO2A 2WSSG 4QNHB 3RYCA 1TGOA 1S9FA 3T9AA 2B63G 1VQ4V 1R73A 4U3FH 4JF3A 3G8CA 5LXTB 4M9UA 1S03G 4O3NA 5I60A 3JD1A 1FJGB 1QBZA 1W59A 1FXVA 5C8YB 5H80A 4BBRG 1WA8B 1GK9A 3JD4A 4YB8B 1FPOA 1QCEA 3K9AA 4K0KO 4Q43A 1R6TA 2GTSA 4OX9B 2YIAA 4EKWA 3WO1A 4IRCA 2Q7DA 4MVUA 5T14A 1Z5WA 3BY6A 4JASA 2YXLA 5JCOC 1YSCA 3HKEB 3N6RA 3DSQA 1A0IA 5AG2A 3AK2A 2HGWA 1EYZA 2ASDA 3JZ6A 3VPDA 2X6BA 3GTJA 3CVZA 4G27B 1E4FT 4PWQA 4FLXA 4GKKO 3UFXB 1N34O 1CKNA 2LGQA 3MHSC 5BMVA 5EZYF 3RV4A 2ZR3A 2F66C 5KFKA 1R3LC 2MW2B 3H0GA 5KG7A 4MTDA 4DV1H 4C5CA 3SI8A 4BY7G 4J9QA 4IYIA 4ECVA 1XL6A 2ASLA 2ZIOA 3DGEA 3T1YO 3CMAV 4CS2A 2GUZB 2ZNIA 3OMNB 3A0BZ 3P32A 3DXRB 3T4ZA 2L35A 1SF9A 4UCVA 2V1DA 4JI5B 4JI2B 1JFFA 1IBMO 5BWVA 2ODMA 2NU8B 2WLHA 4MV9A 5HNEA 5LOVA 3C3TA 2GBOA 2FLLA 4CKCA 3AG2B 4YP3A 2R9RB 3ICXA 2YXHA 1JDEA 4X62H 3A0RA 4LF8O 4UCOA 1S10A 4ZBMA 5KFCA 1L0NH 3WB0A 3QF7A 4X64H 4IYHA 1O9GA 4R8CA 4G28B 4E4EA 3SNOA 4DUZH 2WLNA 2DYRB 4NXNO 3JATB 1E4GT 3HOYG 4P30A 3M9NB 2Y0IA 3IC9A 1S5HC 1CP9A 2ZE5A 4QWDA 4LF7H 2B1IA 5JJJB 5KFEA 1GO3F 5IY5C 3CB2A 5LA6B 3TIGA 4YHHB 3J80W 2LQTA 3MR6A 1ZETA 2CTWA 1VF5B 2JIZG 3JRWA 4LFAH 2YCHA 4JAVA 4TUYA 4UVCA 1AN7A 2CFMA 1YXBA 2RDJA 3FKIA 4DW1A 1MZFA 4DR5O 5BYAA 2R7KA 1E1RG 2K1EA 2C22A 3M99B 4R8UA 4X62B 4GC7A 2Y0SE 2BE3A 1VQNV 3ABTA 1I1LA 3TINA 1QHTA 4E6NA 2Q6AA 1S77D 2WPDG 3O65A 3K9SA 3T5HA 4IRKA 5B3SB 4U7NA 3F5TA 2V58A 1F51A 1GSOA 3IN5A 5LP6F 3E2EA 4O3PA 1G8MA 4B3TO 1TWCA 4FLYA 3CJHB 3M7MX 3RGXA 4EB6A 4GC6A 4NZNA 1OCRB 2CNVA 1AR4A 2A3QA 4YHHH 4ZHQF 4O4IB 1M57C 4ZOLB 3N41B 4U7OA 1BS3A 1KT8A 4A3FG 1R6KA 5I5WA 5KFNA 1O75A 4TWKA 2NN4A 4RUCA 4JI8B 5D5QA 3FAVA 3U9SA 3THOA 4F6EA 3TY9A 3JAWA 1XMQB 5JUMA 1KKCA 4XZ3B 4ED0A 4UCSA 4FGRA 3EPIA 4J7KA 3ZHRA 3BA9A 5JVDB 5KS8A 3GTOA 4O3OA 4TOIA 1Y1WG 2I8CA 1I7FA 1L1FA 4HR7A 4HNVA 3GIDA 3FYEB 1Y76B 3GIKA 1F4NA 3ML0A 1KECA 2FLPA 2FLNA 1M5IA 1KP2A 1C3OA 1C30A 4MA5A 3H1KH 4IHJB 5F2VO 2JK5C 1H2MA 2UXDB 5EZYA 1T3NA 3OTOH 3K0DA 5FPRA 2Q2UA 4GZRB 5KFYA 4I7HA 5H6QA 4CH4A 4RQFA 3CSWA 4YHHO 3CS5A 2YZNA 4YR2A 5L3DA 4FIPC 4X20A 1GSHA 3JSLA
chains in the Genus database with same CATH topology
3RYIB 2HVRA 2VQFH 2KKWA 2W57A 2VQEH 1H2SB 4X1YA 2UUBB 5LYJB 2GV9A 4DV3H 3RYHA 1XDNA 5EOYA 4B3MH 4NXNH 4UCRA 2KSWA 4LF4H 4I55A 5EYPB 1JFFB 3K5LA 4DR3B 4B3SB 1VS0A 2ZM6H 3JALB 5CA1A 1Z2NX 2F4VH 1FFXA 1I6UA 1TVKB 4I50A 1XI1A 1JMKC 4O4JA 2OWOA 2BTOA 4APMA 4TV9A 4DR5B 4PZ7A 3RYCB 2WDTA 3JARA 1N34H 4X1YB 1XQ8A 5IWAB 1XMOB 1HNWH 3JAKA 2P22C 5JQGB 3LMLA 1IBKB 4LSAA 2RGRA 1P16A 4MTEA 5A2QW 4GLXA 4LFBB 3KXYT 4HBNA 4O4LA 4O2BB 1WNSA 4YJ2A 3JAWB 1TUBB 1I94B 4TV8A 4D7TA 1SYXB 1J5EH 3RYFB 1KMIZ 2UUBH 2R70A 4LNUA 5KHIA 2RQ6A 2E3CA 3E22B 3RF2A 3BAAA 5LL6b 4PZ6A 3CHXA 3UT5B 4DV2B 4X1IB 3HXLA 4FLUA 1XNRH 5FNVB 4X66H 4LF8B 4LR3A 2UU9H 2RGVA 2WYOA 5IJ9B 3KALA 4O2BA 4JI6B 4B3TB 5KHJA 2CAZC 4AQYH 4RB3C 3J81W 2O03A 4K8XA 4CC5A 5JJEB 1HNZB 4O4HB 3L2PA 2PUSA 3T1HB 4TUYB 2Q7HA 4PDBA 3SGIA 2HGSA 2YIBD 3HKDA 3T1YB 5EIBC 1FFXB 4NVPA 5J2UA 3FMAA 3C0FB 4O4HA 3N43B 2HHHH 3J7AK 4NXMB 3SJCC 3GJXB 1XK5A 3W1BA 1CKNB 4Q0YA 4RB2C 1HW7A 2VQEB 3RGZA 1YEWA 1ZAUA 2UU9B 4X1IA 3K57A 3RYIA 3N44B 4DV3B 2MCTA 3A2FA 5JH7B 3RYFA 3GDEA 4NXNB 1N36H 1VF7A 3JASA 4IIJA 4X1KB 4U3JB 1Q3EA 3RWRD 4DV6H 4YJ3B 2WE6A 3T1HH 1M4UA 4O2AB 2UXBB 4FLZA 1X4TA 3JAKB 4HNAB 3QWUA 1P49A 5LMNB 1MZBA 3T1YH 1FJGH 5C8YA 2F95B 3IAYA 5D5PA 4DUYB 4JI5H 4X1KA 4U3JA 4LMYA 4YJ2B 5KX5A 3LNNA 5LP6C 3ETQA 3HKBA 5EZYB 3JASB 4IIJB 1XNQH 4OX9H 3CSXA 4DR1B 5LMUB 2R9AA 1XMQH 1FKAH 4KHPB 5D1OB 5JQGA 4LF4B 4A2AA 5BMVB 3N2KB 4ZHQB 4X64B 5EYPA 5LP6B 2F4VB 4DUZB 4M7EA 4TQDA 2ZINA 1Q8IA 5LYJA 2PYJA 3ZS8C 3VQWA 1XNRB 2YIBA 2ZNJA 1CKMA 3QTCA 1BJTA 2YI9A 3RIZA 4F6RB 4GKKB 1HNXH 1WH2A 2VWKA 4X65B 1Z2OX 3F8NA 4AQYB 1IBKH 3U10A 5IYZA 4JI7H 1HR0H 5CA0A 3N42B 4ZIBA 2VOBA 4LFBH 4FLWA 4ZI7B 2E5LH 5KMGB 2HEPA 2UUCH 3H20A 2ZIMA 5LA6A 4BWAA 2UXCB 1O9HA 3BA8A 4B08A 3BRCA 5JVDA 4JI3B 5IJ0A 4MV7A 1XHXA 2OYQA 3JAMW 3K59A 4FM2A 3SJAC 4PZ8A 3IG0A 4DRXA 4JI2H 2HHHB 5CB4A 4JI1B 4EFBA 4NXMH 3BHPA 5J2UB 1Q43A 3W5OA 4GKJB 4JV5H 4DV0H 4LNUB 4JI6H 4B3RH 4ZI7A 3OTFA 5FD6A 4TV8B 4B3MB 3KYHC 4FM1A 1Z5VA 1SEIA 4DR2H 1HNXB 3K3VA 5KHGA 2HIVA 3RR5A 4WBNB 1TA8A 2EX3A 4LF6B 4I9QA 4JI7B 4DR4B 3UT5A 3EYYA 3RTXA 5IT9W 1ZHQA 4I50B 4DV4H 2YI8A 4TQFA 3JALA 5CA1B 3K5NA 4DR5H 4RZQA 5CA0B 2VWJA 4JI8H 3BABA 4I4TA 5DISC 1SQGA 1D5AA 4FM9A 4F6RA 1JJOA 1N32H 4CC6A 1TAEA 1IBLB 4LFAB 4HNAA 4FLVA 2XIGA 4DR7H 4K0KH 4O2AA 4K8ZA 4I55B 5KHKA 3B2EE 4CH5A 1TUBA 3RGBA 1DGSA 4EEQA 2XHBA 1M0WA 4DR1H 2PY5A 5JCOA 3BPZA 4GKJH 3K5OA 4RAZA 5KX5B 2Q7GA 4DR6B 5BR8B 4D7SA 4DV2H 2RJZA 1SQFA 3MAQA 4BWSC 4GYCB 1TVKA 4FFBA 3NBYB 1XHZA 4DV6B 3SR2C 4AILC 4DK1A 1X9NA 4LF8H 4DR4H 3N6XA 1S5JA 4DRXB 5FLXW 4YJ3A 2UXBH 2PGGA 3RYCA 1TGOA 5GONB 4JYAB 2BTQA 1SA0A 3NC0B 1S03G 5LXTB 2ZCEA 2F93B 4O4JB 4RB0A 1M0TA 1FJGB 3VQVA 3U0ZA 5JH7A 5C8YB 4CS4A 1N33H 2QM4A 1P8LA 1BGWA 1XNQB 1HR0B 4OX9B 2YIAA 4LF9H 1B04A 4R7RA 2VQFB 1Z5WA 2YXLA 3QG5A 5JCOC 3JATA 5KHHA 3HKEB 3DSQA 1A0IA 4UCUA 4RAYA 4X20B 4J0MA 4UFZA 2UUAB 4JI0B 3CVZA 4B3SH 4O4IA 1M93A 2QJ1A 4I4TB 4CH3A 5IJ0B 1E4FT 2Q7EA 4JI1H 2JGUA 4FLXA 1RSOA 1CKNA 5BMVA 5EIBD 4JV5B 2HVQA 4B3RB 3JSNA 2R72A 4FVMA 4JYAH 2F66C 2VPSA 3L4KA 1IBMB 4MTDA 4DV1H 5IWAH 4YY3H 1HNWB 2E5LB 3UQ8A 4LH7A 2ZIOA 4CS2A 4TV9B 1V9PA 2ZNIA 1SKVA 3KAKA 1FVIA 2V4DA 3RJ0A 4JI4H 1QQCA 4UCVA 4JI5B 5D1OA 4DUYH 5FD5A 4JI2B 1JFFA 3VQYA 4DV5H 5KMGA 4DV7B 4DK0A 4LF5H 3DF7A 5LXTA 5LP6A 4MV9A 5LOVA 4DV0B 1IBLH 3W1GA 2UUAH 4JI0H 4UCTA 3ICXA 4LFCB 4X62H 4IAJA 4UCOA 1KU9A 4IHJA 4DR2B 3WB0A 3E22A 3QF7A 4X64H 1O9GA 4LF6H 2PZSA 1NT2B 3N2GB 4DUZH 3JARB 4DV4B 2HVSA 4BW9A 3JATB 4YY3B 1E4GT 5J2TA 2BTQB 2UXDH 3OTOB 4GKKH 4LH6A 2Q2TA 4LF7H 5JJJB 5D1PA 3WB1A 3CB2A 5LA6B 4ETSA 4YHHB 3J80W 4FFBB 1S68A 2HIXA 4LFAH 3K58A 2YCHA 1ZHSA 4TUYA 4PHZA 1AN7A 1N33B 2CFMA 1G6UA 2UUCB 4DV7H 3SJBC 3ZEDA 4LFCH 3N40P 4X62B 4JI3H 2Q0AA 2JS5A 4CH6A 2FE3A 4FLTA 4ZOLA 1QHTA 1J5EB 4E6NA 5IJ9A 2JVDA 3RYHB 2PYLA 1N36B 5ITZB 1GYFA 3N2KA 4ZHQA 3S24A 4PI0A 3WB2A 1Z2PX 3KAJA 4FLYA 3M7MX 4X66B 1N34B 4EB6A 3FFQA 1WPBA 3HKDB 3TY5A 3RGXA 3U11A 3VNNA 5J2TB 3GB8B 4B3TH 4EFEA 4A2BA 4LSXA 4YHHH 5LMNH 4O4IB 3HKCB 4ZOLB 1HNZH 3N41B 4LF9B 1IBMH 3N2GA 4DV1B 5JJNB 1O75A 1I94H 4JI8B 5D5QA 4EQ5A 4RB1A 2P5OA 3THOA 3TY9A 5LMUH 3JAWA 1XMQB 1N32B 3MWMA 4KHPH 5FNVA 3PN1A 1Q5OA 4UCSA 4DR7B 4K0KB 3TY8A 2F1MA 3BA9A 5JVDB 3K5MA 3M4IA 1L2ZA 4L8JA 4KL1A 4TOIA 4DRFA 3VQXA 4FM0A 3HKEA 1I7FA 3NBZB 4DR6H 5BR8H 3RFRA 5CB4B 4WBNA 4Q6GA 5K1PA 4CS3A 3L4JA 2IM9A 4O4LB 2PTMA 2ZM6B 1CKOA 4DR3H 4X65H 1M5IA 5LOVB 4PI2A 4AHCA 4EB6B 5FPOA 2CW8A 4IHJB 5K1XA 5ITZA 3HKCA 3HKBB 5EZYA 2UXDB 2CW7A 3OTOH 1SA0B 1T5EA 4JI4B 5IYZB 1XMOH 2UXCH 5FPRA 2VUGA 2Q2UA 4LF7B 2ZJTA 4I7HA 5GONA 4CH4A 4DV5B 4LF5B 1L8DA 1WN7A 4X20A 3JSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVR A;  3OTO B;  4LH6 A;  2UUB B;  4EEQ A;  2UXB B;  1DGS A;  2Q2T A;  5D1P A;  1XDN A;  3QWU A;  5LMN B;  4DR6 B;  4YHH B;  4UCR A;  5BR8 B;  1S68 A;  2HIX A;  4B3S B;  1VS0 A;  4DR3 B;  4DUY B;  3NBY B;  1N33 B;  4DV6 B;  2CFM A;  2UUC B;  1X9N A;  4DR1 B;  2OWO A;  5LMU B;  4JYA B;  3NC0 B;  4X62 B;  4DR5 B;  4KHP B;  4PZ7 A;  5D1O B;  4LF4 B;  1FJG B;  1J5E B;  5IWA B;  4E6N A;  1XMO B;  4X64 B;  2F4V B;  1IBK B;  1P8L A;  1P16 A;  4DUZ B;  1XNQ B;  1N36 B;  1HR0 B;  4OX9 B;  4GLX A;  4LFB B;  1B04 A;  3S24 A;  2VQF B;  1CKM A;  1XNR B;  1I94 B;  1N34 B;  4X66 B;  3TY5 A;  4GKK B;  4X65 B;  3VNN A;  3GB8 B;  1A0I A;  4AQY B;  4UCU A;  4EFE A;  3BAA A;  4PZ6 A;  4LF9 B;  4UFZ A;  4DV2 B;  2UUA B;  4DV1 B;  4JI0 B;  4LF8 B;  4JI8 B;  2UXC B;  4EQ5 A;  1CKN A;  3BA8 A;  4JV5 B;  4B3T B;  4JI6 B;  4B3R B;  2HVQ A;  3JSN A;  3TY9 A;  1XMQ B;  1N32 B;  4CC5 A;  4JI3 B;  1HNZ B;  1IBM B;  3PN1 A;  4UCS A;  4PZ8 A;  4DR7 B;  4K0K B;  1HNW B;  2E5L B;  3UQ8 A;  3TY8 A;  3BA9 A;  2HHH B;  3L2P A;  4LH7 A;  4JI1 B;  4EFB A;  3T1H B;  4TOI A;  4DRF A;  3W5O A;  4GKJ B;  1V9P A;  3SGI A;  3NBZ B;  3KYH C;  4B3M B;  1FVI A;  3T1Y B;  1CKO A;  2ZM6 B;  1HNX B;  4UCV A;  4JI5 B;  5D1O A;  3RR5 A;  2HIV A;  1TA8 A;  4JI2 B;  4LF6 B;  4NXM B;  4DV7 B;  3GJX B;  4JI7 B;  4DR4 B;  3RTX A;  5FPO A;  1XK5 A;  3W1B A;  4DV0 B;  1CKN B;  3W1G A;  4UCT A;  4LFC B;  4UCO A;  2VQE B;  2UXD B;  1ZAU A;  4JI4 B;  4DR2 B;  2UU9 B;  5FPR A;  2VUG A;  3BAB A;  4LF7 B;  2Q2U A;  4DV3 B;  5DIS C;  4DV5 B;  3GDE A;  4LF5 B;  4NXN B;  4CC6 A;  1TAE A;  4DV4 B;  1IBL B;  4LFA B;  2HVS A;  4YY3 B;  3JSL A; 
#chains in the Genus database with same CATH topology
 3RYI B;  2VQF H;  2YWV A;  3L75 H;  3PR5 B;  1KJ8 A;  5HV6 A;  3D36 C;  2GV9 A;  4IR1 A;  2BCC H;  1KBL A;  2KSW A;  4O4H F;  3ETJ A;  1NR7 A;  4I55 A;  1VQ5 V;  5KFG A;  1JFF B;  2EZP A;  2ZDQ A;  1XL4 A;  5CA1 A;  2C00 A;  1TWG A;  1VAR A;  1KC7 A;  1TVK B;  1JIH A;  5B1N A;  5B3S C;  4MTX A;  1SCU B;  4NYE A;  5JVL A;  3D3Q A;  4TV9 A;  4UVB A;  2XGQ A;  3RUP A;  2QYZ A;  5B1B C;  4DL5 A;  3GLK A;  3JAR A;  3SPI A;  1XQ8 A;  5IWA B;  1YJN V;  3SPJ A;  2PVP A;  4FFN A;  2RGR A;  3VBB A;  4MTE A;  4ZQI A;  5A2Q W;  3KXY T;  4CKE A;  3ZMU A;  4O4L A;  1WNS A;  3JAW B;  5KFA A;  1M56 C;  2DPJ A;  1TUB B;  1I94 B;  3WU2 Z;  3HB9 A;  1ZL8 A;  1I7L A;  4IGG A;  1P7B A;  5B1A B;  2EBO A;  3FKI G;  2RQ6 A;  1HWY A;  3CCR V;  1BHA A;  5KLV H;  1XOU A;  5BWU A;  1EN5 A;  1XNR H;  5E1A C;  2P90 A;  4X65 O;  3JZI A;  2DYS B;  2OT5 A;  4EBE A;  2AW9 A;  4AQY H;  1RPR A;  3J81 W;  2CDY A;  4K8X A;  4CC5 A;  3CPW U;  2DQ0 A;  3U54 A;  4DV7 O;  4FBU A;  1JX9 A;  1NVP B;  3KHG A;  2GUZ A;  1SES A;  1MG1 A;  2PUS A;  3T1H B;  2J6T A;  4RQE A;  4DL7 A;  4YIO A;  1RJR A;  4PA9 A;  1Z2G A;  5BZB A;  1IBK O;  1JOY A;  2R8G A;  1WP7 A;  4NVP A;  2A9H A;  5CR5 A;  4YIP A;  3C0F B;  4QGP A;  2RDI A;  3GTP A;  4NXM B;  3GJX B;  2PI5 A;  2LW7 A;  2KG7 B;  1PK8 A;  1CKN B;  3QQM A;  2X6A A;  4Q0Y A;  2CZG A;  1HW7 A;  5KFB A;  2UXB O;  2Q4P A;  2FL4 A;  3K57 A;  1JKJ B;  3OSP A;  1CXZ B;  2VR1 A;  1K4D C;  2IJI A;  4ED7 A;  3GDE A;  2LGW A;  3RYF A;  5L3F A;  3ZBH A;  4FFL A;  2JEJ A;  4IIJ A;  4BW5 A;  2YIC A;  4O7W A;  1WP8 A;  3AG3 B;  3CYO A;  4CBC A;  5FLM G;  4JTA B;  4TQR A;  4A3G G;  3T1H H;  3ZHQ A;  1W96 A;  3HBL A;  3BAC A;  2ETN A;  4MV3 A;  2WLI B;  4O84 A;  2QDO A;  2DYR C;  4TM5 A;  1PNM A;  2J9G A;  5C8Y A;  2F95 B;  3KG2 A;  1DV2 A;  4L1K A;  5D5P A;  1QLE B;  3CME V;  5EWF A;  3LNN A;  5LP6 C;  3BG5 A;  1XNQ H;  4LP8 A;  5C4X G;  3D8C A;  3CCS V;  2VPQ A;  5KFW A;  1S0V A;  3PO2 G;  4KHP B;  4ED2 A;  1OCZ C;  3ZN0 A;  1M56 B;  1KEE A;  3RAX A;  4ED6 A;  4JGS A;  5DAA A;  3R5X A;  4CHI A;  4RO2 A;  1MSW D;  1DK1 A;  2EJ0 A;  5DG9 A;  3EPG A;  2ZIN A;  1UC8 A;  3ETG A;  1QVG U;  5LYJ A;  2R87 A;  4MVM A;  3H0G G;  2IH1 C;  3ZS8 C;  2FPI B;  1NQT A;  3DTU B;  1GRJ A;  2ZNJ A;  4PDR A;  1BJT A;  3GTQ A;  3QVN A;  2V5A A;  1HNX H;  3HKZ A;  4D6T H;  2DYS C;  2YL2 A;  4RWU A;  5IYZ A;  4JI7 H;  2KQX A;  3LWB A;  2VOB A;  4U6P A;  1XDC A;  4C2M A;  2HEP A;  1S97 A;  2UUC H;  2ZIM A;  2UXC B;  3GIM A;  2DOS A;  2EUL A;  5H9C A;  4E4T A;  2NVY A;  5KG2 A;  5IJ0 A;  2COG A;  5DGH A;  2KG7 A;  2QA4 V;  1R3K C;  1XNQ O;  1R9T A;  4A3K G;  3WWI A;  3SJA C;  3IG0 A;  4W4L A;  4X66 O;  1IYD A;  5I5V A;  5CB4 A;  5CM0 A;  5KFL A;  5J2U B;  2FB9 A;  2NU7 B;  4DV0 H;  2IH3 C;  3OTF A;  3KYH C;  5DQH A;  3HOZ G;  1WLE A;  3T5K A;  4FM1 A;  4JI6 O;  2X0S A;  1Y1V A;  4A3J G;  1HNX B;  4I0X A;  5KHG A;  2HIV A;  3RB6 A;  1AI7 A;  1TA8 A;  2EX3 A;  1I50 A;  1YCI A;  2HDK A;  5K2M A;  4JI7 B;  4DR4 B;  5HBR B;  3KHL A;  3CCQ V;  3LSQ A;  3FAV B;  5KG6 A;  3JAL A;  3R5F A;  5CA1 F;  4DR5 H;  3NUA A;  3UCS C;  1MMM A;  4WFE A;  4ECR A;  3G6E V;  2LFS A;  5CBG A;  3BAB A;  1N48 A;  4ECY A;  3I5D A;  4FM9 A;  4TV9 F;  4NTW A;  3TW6 A;  1N32 H;  5KFH A;  2JA6 A;  5KUM A;  2C28 A;  1XUQ A;  3JYC A;  2Y0P A;  2DMX A;  4NB5 A;  4DR7 H;  2WLL A;  4O2A A;  1WRV A;  2K9P A;  4H0L B;  2Q5Z A;  4ED8 A;  4CH5 A;  5J2U F;  1TUB A;  4EEQ A;  1DGS A;  1Y76 A;  2HFE C;  2XHB A;  2R92 G;  1FJG O;  3BPZ A;  3T4D A;  3SPG A;  4RAZ A;  5HFL A;  1GN4 A;  1KYO F;  5CA3 A;  3EHB B;  4DUZ O;  3GIJ A;  4DV3 O;  4D7S A;  4IWY A;  2QWN B;  5KFP A;  4DR4 O;  4FFO A;  1TVK A;  4DL2 A;  1YF2 A;  3K08 A;  4DK1 A;  4LF8 H;  4XDL A;  3GTL A;  4DR4 H;  4X62 O;  3I12 A;  1IDS A;  1RK6 A;  2PGG A;  4HZ3 A;  2XAG A;  4FZ0 A;  4JTD B;  2ZCE A;  4O4J B;  3AG7 A;  1SFO A;  3VQV A;  1KJI A;  4Q8F A;  3ZHS A;  1G1X B;  2JS3 A;  4CS4 A;  4XDJ A;  5C1P A;  1N33 H;  4DR7 O;  4B7E A;  4NYK A;  1XNQ B;  2DAB A;  3J7A U;  4LF9 H;  4HQ6 A;  3VMM A;  1IZ3 A;  3OUZ A;  5B1B B;  2FK3 A;  4MTG A;  2I80 A;  1KQS U;  5B66 Z;  5KHH A;  4XX0 B;  2PI4 A;  5IDJ A;  1AP5 A;  5A9G A;  5C8Y F;  1Y1W A;  2JA7 A;  2EJR A;  3FB6 C;  4UFZ A;  4B3S H;  3UZO A;  3NR7 A;  3J81 N;  1VQP V;  4I4T B;  1E79 G;  2JGU A;  4MVZ A;  2QWR B;  5EIB D;  2HVQ A;  4B3R B;  1W2B U;  3PW2 A;  4FVM A;  5EBM C;  3CRQ A;  2YUA A;  3W7W A;  1IBM B;  1A3G A;  1DF4 A;  4Z1V A;  4YR0 A;  4JI5 O;  2W0X A;  4MSW C;  4LH7 A;  3MR5 A;  2XUM A;  1AI4 A;  3L71 H;  1V9P A;  1SKV A;  3LSU A;  1DIK A;  1FVI A;  4PBC A;  4GCZ A;  2VUM A;  5IE9 A;  1AJP A;  4XBF A;  1QQC A;  2AXT Z;  4EYI B;  2UUC O;  2BR0 A;  2R85 A;  4DV5 H;  4H33 A;  1R3J C;  4DK0 A;  4YAJ B;  4LF5 H;  3CQZ A;  2EIK B;  2QTS A;  3EXA A;  5LP6 A;  2XAJ A;  4DV0 B;  3WWH A;  1IBL H;  4WBN F;  3T2M A;  1WB7 A;  4LFC B;  4RNM A;  1R6N A;  3GTM A;  1KU9 A;  2W70 A;  5BWW A;  3D36 A;  5IYC G;  3RB4 A;  2EJ7 A;  3E22 A;  4MVO A;  2XTA A;  2PZS A;  3OEH G;  3G71 V;  3OD4 A;  4F4L A;  4YY3 O;  3WWJ A;  4JTC B;  1VF6 C;  3OMA B;  4BW9 A;  1OCC B;  4M0J A;  5E79 Z;  4QJF B;  5J2T A;  3B4S A;  2WLI A;  2W6P A;  3QNE A;  2YRW A;  3FD9 A;  1ORQ C;  1GN6 A;  4JXU A;  5D1P A;  3WB1 A;  1V54 C;  4F4W A;  4BR6 A;  2DLN A;  4FFK A;  1S68 A;  3ASN C;  3ZMS A;  5L3C A;  4PHZ A;  5KT3 A;  4YXW G;  1G6U A;  2E2H A;  3GV8 B;  2JDI G;  3TK1 A;  2P7T C;  2JA6 G;  3U0G A;  3IGA C;  4LFC H;  3PW5 A;  4JI3 H;  2JS5 A;  5KG0 A;  4K35 A;  4ZOL A;  1HNX O;  2ZM6 O;  4QWB A;  5BWR A;  4YBZ B;  4P9O A;  2ZXW B;  4J7J A;  2EJ3 A;  2JEG A;  4MW3 A;  4O3Q A;  2F23 A;  1V55 B;  5L3G A;  3SJQ C;  4XDK A;  4RNO A;  1NKD A;  4EBC A;  1Z2P X;  2Z04 A;  4WFA V;  4X66 B;  4UXN A;  1WPB A;  3HKD B;  3VNN A;  4B3T H;  4LFA O;  3OR6 C;  3W7T A;  3ABM B;  1CPY A;  4EFE A;  3OUF A;  1BZK A;  4GLW A;  5LMN H;  5BMV F;  3HKC B;  4LF9 B;  3N2G A;  2Y69 C;  4WF9 V;  4LF7 O;  3FKS G;  2AZ0 A;  2AZ2 A;  2YS7 A;  2CGN A;  4RB1 A;  3CD6 V;  1NVP D;  3CEB A;  1TWH A;  2JA8 G;  1PNK A;  3MWM A;  4LBE C;  5C93 A;  2NU6 B;  1BMF G;  5FNV A;  1BGY H;  2BSK B;  3PN1 A;  1LUW A;  5I5S A;  3ZN1 A;  1OZ0 A;  3ASO C;  2C2E A;  1S3J A;  3E8F A;  3K5M A;  1OBD A;  1RJQ A;  4O2A F;  2EIK C;  3HKE A;  1K9M W;  1M6V A;  1K34 A;  4PA7 A;  5BR8 H;  4AYB E;  4RNN A;  4Q6G A;  1AI6 A;  2WA4 A;  4CS3 A;  1AUV A;  1EN4 A;  1GM9 A;  1CKO A;  2PTM A;  4X65 H;  1FXK C;  5LOV B;  3OMI B;  2HVJ C;  4EB6 B;  2R7M A;  3CCM V;  2PBZ A;  3G4S V;  3HKB B;  1JVM A;  1K1Q A;  4QW9 A;  3SPH A;  4IR9 A;  4DV1 O;  1GTO A;  4DV5 B;  3QZ7 A;  4LF5 B;  3JD0 A;  3ZX6 A;  5KT5 A;  4ECQ A;  2YZG A;  3AG2 C;  5KG1 A;  1VQ6 V;  1KKD A;  2IMW P;  3RVZ A;  3ASN B;  2P4K A;  2KKW A;  3D3I A;  1YIJ V;  4TUY F;  5KFT A;  4Q44 A;  1WB8 A;  5BY1 A;  4J10 A;  5JVD F;  2UXD O;  4DV3 H;  1XDN A;  2NVX A;  1RSO B;  4ECW A;  1Q6U A;  4B3M H;  3TEK A;  1VEW A;  4P9P A;  4LF4 H;  1P84 F;  4J9Z B;  2ZR2 A;  3K5L A;  2QWO B;  3TQT A;  3JAL B;  4LC1 A;  3GIQ A;  2ZXW C;  4I50 A;  3UKM A;  3JCU Z;  4Q4C A;  4O4J A;  4APM A;  1KUQ A;  3HKZ E;  4NXM O;  5E25 A;  2WDT A;  5KT7 A;  1N34 H;  4X1Y B;  3H01 A;  1I5X A;  2UUB O;  3H4B A;  2DN9 A;  3LML A;  1IBK B;  4LSA A;  3ABM C;  1VIB A;  4C7U A;  4QJF A;  3BQ0 A;  4HBN A;  2GDS A;  1XMQ O;  3H40 A;  4A3D G;  3T54 A;  4KUM A;  3H4D A;  1CE8 A;  1KMI Z;  3RYF B;  4BXX G;  3T5J A;  4LNU A;  5KHI A;  2RNB A;  3FX7 A;  4UV8 A;  5IYC O;  1CS0 A;  1U97 A;  2E3C A;  3Q8S B;  3RF2 A;  4NR1 A;  4IIJ F;  4RAI A;  5EBW C;  2ZGI A;  3T99 A;  5LL6 b;  4A3B G;  4PZ6 A;  3DTF A;  3CHX A;  5LHH A;  3VPB A;  1FXK A;  4QIW A;  1YIT V;  1Y1V G;  4DR2 O;  2KSD A;  2VS0 A;  4X66 H;  4LR3 A;  1K8A W;  3H9V A;  3JAM N;  4JI0 O;  2UUA O;  2WYO A;  4HNT A;  2QM7 A;  4O2B A;  4JI6 B;  4B3T B;  5KHJ A;  2CAZ C;  3KAL A;  4O7L A;  4RB3 C;  4QWE A;  2FKX A;  1M57 B;  5JJE B;  1ARO P;  4Y8V B;  1PM9 A;  3K79 A;  5H2F Z;  2XAQ A;  2NR5 A;  3OUU A;  5LYJ F;  4DO2 A;  4QW8 A;  1OV9 A;  2IP4 A;  4DV7 H;  3OAA G;  5DG7 A;  4UUJ C;  2HGS A;  2E2I A;  2QKC A;  4F50 A;  3Q1K A;  3HKD A;  2ITD C;  1GM8 A;  5EIB C;  1FFX B;  3NXS A;  1WA8 A;  2DAA A;  5EC2 C;  2YEV B;  2UXC O;  2AGP A;  1HNW O;  3N43 B;  2HHH H;  4HNU A;  5IYD O;  4YQW A;  1MA1 A;  2N04 A;  2VQE B;  1CEZ A;  1YEW A;  4DL3 A;  1BT8 A;  4A3M G;  2WAQ E;  3N44 B;  2M7W A;  1EZ1 A;  2MCT A;  4U7C A;  3A2F A;  5JH7 B;  1VAJ A;  3ORR A;  4NXN B;  2JEU A;  4X1K B;  3CCJ V;  2DIK A;  3KHH A;  1Q3E A;  5KFD A;  1M7J A;  1Q86 W;  1K5S A;  4DV6 H;  2WE6 A;  2CQY A;  1YJ9 V;  3CRA A;  4FLZ A;  3BJY A;  4HNA B;  1JJ2 U;  2BQR A;  1GH6 A;  3B8N A;  1OCC C;  4DLK A;  3IAY A;  4J80 A;  1XBL A;  4GT1 A;  1BXR A;  4OXS A;  1AP6 A;  4X1K A;  4DUY B;  2W6O A;  4EG0 A;  4JI2 O;  3ETQ A;  5EZY B;  3CC2 V;  1W0K G;  1PP9 H;  4RCN A;  2HGX A;  3CWB H;  5IT9 N;  1RK5 A;  1XMQ H;  1UPG A;  4AYB A;  4JPR A;  4RUE A;  4LF4 B;  3GV5 B;  3L9D A;  3ETH A;  4NTX A;  5EYP A;  3TJT A;  1ZUQ A;  1GO3 E;  2C2D A;  1COW G;  2RN9 A;  1WPX A;  2IU0 A;  2CTQ A;  4IWX A;  3H1H H;  5FLX N;  3QTC A;  3ZRV A;  1H2N A;  3RIZ A;  3G67 A;  4GKK B;  2R7Z A;  2MK3 A;  4HYK A;  2M05 A;  1DF5 A;  2IA6 A;  1IBK H;  2C35 B;  4FPP A;  4PA6 A;  4ZIB A;  1XRE A;  4Q20 A;  4WFG A;  5LXT F;  4FLW A;  1D2D A;  3AEI A;  4MVR A;  5KMG B;  2WTF A;  2E5L H;  4FZ1 A;  3RBE A;  5C5J A;  2AHY A;  2QGN A;  5LA6 A;  3BA8 A;  3RV3 A;  5JVD A;  2R6F A;  3UM7 A;  3CP1 A;  3HOX G;  2LFR A;  2YW2 A;  3K59 A;  3R5H A;  5C3E G;  3GQC A;  1B6R A;  3BVO A;  1Q43 A;  1B6S A;  2R93 A;  3Q4H B;  3C90 A;  3ZIA G;  2B1G A;  4JI6 H;  4ZI7 A;  1EFR G;  3G6V A;  4UV9 A;  5IP7 G;  3N27 A;  1B33 N;  1NZ6 A;  4DR2 H;  3ZRS A;  4FFR A;  4MV1 A;  4WBN B;  5KFX A;  1VF6 A;  1MOF A;  3PW4 A;  4I9Q A;  1FYJ A;  5H5N A;  3GIL A;  2R8H A;  5IT9 W;  2JGD B;  4I50 B;  4DV4 H;  3H1J H;  5BR8 O;  1KJJ A;  3K5N A;  1VQ7 V;  2LO1 A;  4ECS A;  1TWA A;  1ZSP A;  3OFN G;  3APQ A;  3RVY A;  2X7R B;  1YTF B;  3CEI A;  4J11 A;  1AUX A;  4WFH A;  1SQG A;  5DIS C;  5LGN A;  2FK2 A;  4F6R A;  1JJO A;  2ILM A;  2J6S A;  3HB3 B;  3CRM A;  5DG8 A;  5KFF A;  4CC6 A;  5BPH A;  2R84 A;  4FLV A;  4DL4 A;  2NLJ C;  2JGD A;  4K0K H;  4K8Z A;  1I1K A;  1U96 A;  4I55 B;  5KHK A;  2YZL A;  3B2E E;  4DR1 H;  2PY5 A;  1OCO C;  2YC0 A;  4PA3 A;  5KX5 B;  4GUN A;  3LUT B;  4DR6 B;  3GIP A;  4OGQ B;  3V6H A;  2DE0 X;  3BQ2 A;  2X0L A;  1YHQ V;  4FFB A;  1E1Q G;  1J5E O;  2C2R A;  2CH7 A;  4DV6 B;  4ZOL F;  2H3O A;  3OM3 B;  3QO7 A;  4LF4 O;  2X6C A;  1X9N A;  1S5J A;  4DRX B;  1BE3 H;  4I0X B;  4YJ3 A;  3W7S A;  5DGB A;  1RYR A;  3A0H Z;  1DV1 A;  2RCV A;  4J9N A;  1NTK H;  2WB1 A;  4JYA B;  2BTQ A;  1SA0 A;  2KB1 A;  5L1J A;  3WO0 A;  1QNM A;  4UUG A;  5JH7 A;  4DUY O;  2BOB C;  4ME6 A;  3IJ4 A;  2HHH O;  4X9Q A;  2UVR A;  2QM4 A;  1P8L A;  1RPO A;  4R8U B;  5DLF A;  1ZL8 B;  2AGA A;  1HR0 B;  1AR5 A;  1B04 A;  4JI3 O;  3J80 N;  2XAH A;  1I2K A;  4R50 A;  3T9D A;  4QWC A;  1P7G A;  2RDC A;  4J7Z A;  1NH2 D;  2FTK A;  3JAT A;  4MAM A;  1NJI W;  2Q9L A;  2WAQ A;  4K6N A;  4RAY A;  4X20 B;  4PEL A;  3G6X A;  3LQS A;  2Z3Y A;  5KA5 A;  1JDB B;  1M93 A;  2QJ1 A;  4CH3 A;  2XGP A;  2Q7E A;  4JI1 H;  4BIZ A;  2OCH A;  3C3S A;  2B5U A;  4DV2 O;  2ATL A;  4JV5 B;  4X8A A;  3Q8P B;  2FB5 A;  4JYA H;  3L4K A;  2G38 A;  4GKJ O;  4YY3 H;  1HNW B;  2E5L B;  3UQ8 A;  2F4V O;  4JAU A;  1BSM A;  4ECU A;  2DWD C;  3AG1 B;  2DJV A;  1IVS A;  4TV9 B;  3B09 A;  1KTA A;  3T9B A;  2W7P A;  4B7K A;  4EYH B;  2QM8 A;  1Q6I A;  4JI4 H;  1FD9 A;  3IFX A;  1ZLZ A;  1LR1 A;  3M9M B;  1K1S A;  5D1O A;  4X88 A;  3QO5 A;  5FD5 A;  2UVV A;  3DF7 A;  5LXT A;  1IX9 A;  2YZM A;  4HN2 A;  1GM7 A;  4H37 A;  4UCT A;  3CXH F;  5I47 A;  4IAJ A;  3DAA A;  1NH2 B;  4K3A A;  4AQY O;  4DR2 B;  2H94 A;  2OIG A;  3ZCC A;  3W7X A;  2AU0 A;  1ZQ7 A;  2XAF A;  1OCO B;  2Q69 A;  4ABM A;  1UNN C;  3N2G B;  4A3L G;  1XIL A;  5I5T A;  4Q45 A;  1THZ A;  5KAF Z;  4DV4 B;  4MV8 A;  1AIL A;  2W8L A;  4YY3 B;  1WJZ A;  1TWF A;  5KFS A;  2BTQ B;  5KAI Z;  3V4S A;  2UXD H;  3OTO B;  4NLG A;  1KD1 W;  4L87 A;  1N8R W;  2Q2T A;  3ETE A;  1FXH A;  3GV7 B;  5L1K A;  1ZTE A;  2HIX A;  3K58 A;  4HAM A;  3SDL A;  3WFV A;  1QR8 A;  1ZHS A;  3CXC U;  4FFP A;  2UUC B;  3HO8 A;  3ZHT A;  2GQR A;  1WCM A;  2H8P C;  4UB8 Z;  4RU9 A;  4ED1 A;  1K4C C;  5CAE B;  3Q8R B;  1ROP A;  1OBG A;  3ZED A;  4BAY A;  4UB6 Z;  4CH6 A;  3B8M A;  2FE3 A;  1NBM G;  5IJ9 A;  1JX4 A;  2W6Q A;  2E76 B;  5LGU A;  4DL6 A;  3TGU H;  2P0A A;  2Y4T A;  3L70 H;  2Q68 A;  3E8G A;  1N36 B;  1HNZ O;  2A1H A;  4C5A A;  1GYF A;  2SCU B;  2IBK A;  2JEF A;  3N2K A;  3OR7 C;  3Q4H A;  4ZHQ A;  3S24 A;  1SC5 B;  1WSC A;  1NS1 A;  4PI0 A;  3P3P A;  1S5L Z;  3KAJ A;  3FFQ A;  3E8B A;  3S3W A;  5J2T B;  3GB8 B;  2EJ2 A;  4A2B A;  4MV6 A;  2HG5 C;  3V4Z A;  1ULZ A;  2XCL A;  2FKL A;  2CNQ A;  4DV5 O;  4DV1 B;  2XND G;  4XYL B;  1JCH A;  3T5L A;  2FPG B;  5JJN B;  5DLG A;  5I5U A;  2ARH A;  1K33 A;  1I94 H;  5HFM A;  3AG1 C;  3U55 A;  3K04 A;  2P5O A;  3MFI A;  3TCU A;  5LMU H;  2Z0A A;  1N32 B;  2IU3 A;  4DR7 B;  3P3N A;  3TY8 A;  1I2L A;  1N4C A;  4JZG A;  3M4I A;  1L2Z A;  1Q90 D;  1R3I C;  4L8J A;  4J9R A;  4KL1 A;  3KZI Z;  2YDE A;  3VQX A;  4FM0 A;  5LHI A;  3DC6 A;  1VMG A;  3ZMT A;  2ZDG A;  2XCP A;  3PW0 A;  1N36 O;  3NBZ B;  2JA7 G;  3AX6 A;  4O7V A;  1KJQ A;  2AHZ A;  2X5R A;  3ABL C;  3RFR A;  5KA6 A;  4WBN A;  5C44 G;  4A93 G;  5CA0 F;  3L4J A;  2B9Z A;  1KBH A;  4O4L B;  2IM9 A;  3KKY A;  1H2L A;  3OUS A;  5JH7 F;  1CQJ B;  4DIM A;  4AHC A;  1SQB H;  2EZO A;  3G6B A;  3TET A;  1W93 A;  4TSF G;  2JJ2 G;  5LMU O;  5FPO A;  2JEX A;  2WA3 A;  4XYM B;  3VPC A;  5ITZ A;  1SRY A;  2DWE C;  3HKC A;  2Y48 A;  2O57 A;  4P2Z A;  3M8A A;  1SA0 B;  1T5E A;  4JI4 B;  4O7N A;  2CW7 A;  1EM1 A;  5IYZ B;  1XMO H;  4PA4 A;  2ATK C;  4LF7 B;  1Y74 B;  5GON A;  3KCY A;  5DMX A;  1YI2 V;  1H2K A;  2M6Y A;  4KP4 A;  3G8D A;  4EBD A;  2A0L A;  2D3O W;  5CB4 F;  4PDL A;  2HVR A;  2Z5U A;  1PNL A;  3T9C A;  5L1I A;  4A3E G;  1RFY A;  4X1Y A;  5KT2 A;  2ASJ A;  2V7Q G;  1GN3 A;  5EOY A;  4UCR A;  5LGT A;  3E5N A;  5I5Y A;  3E89 A;  2GQS A;  1IXB A;  5EYP B;  1XEQ A;  1JR9 A;  4B3S B;  3HOW G;  4JI7 O;  3T9F A;  2GTA A;  3PVX A;  5L3B A;  5CN0 A;  1Z2N X;  1F7Y A;  4CZZ A;  4A3C G;  4IRD A;  2VA2 A;  2BTO A;  5BYB A;  2ZDH A;  2ZQM A;  4BIU A;  2W6I G;  1XMO B;  1K5Q A;  5JQG B;  4X89 A;  4GX5 A;  5B1A C;  1GSA A;  1W0J G;  3FYI B;  4J42 A;  5LMN O;  4PJ0 Z;  4LFB B;  2QK4 A;  1IXM A;  4O2B B;  1CQI B;  3ZJZ A;  1AVM A;  4YJ2 A;  1KUT A;  1RJP A;  3CC4 V;  4TV8 A;  2E5L O;  4F4Y A;  2R70 A;  2QB5 A;  3MFH A;  3I56 V;  5CE8 A;  4YJ2 F;  2NNU A;  3LDC A;  3UT5 B;  4DV2 B;  5DN6 G;  4X1I B;  3HXL A;  5IYD G;  2UXX A;  3MR3 A;  2IW5 A;  5IP9 G;  4DYL A;  5I5X A;  3GII A;  2GLT A;  2E74 B;  3SE7 A;  4CKB A;  2RGV A;  3Q8Q B;  1BL8 A;  2V9W A;  2YYA A;  4EGQ A;  3WNZ A;  3STL C;  1M1K W;  3ABL B;  2Y69 B;  2ABJ A;  5J9P C;  5KT4 A;  3AW8 A;  3F7Y C;  3L2P A;  1UFI A;  1FFT B;  4A5U B;  1IOV A;  1AJN A;  2A7W A;  4TUY B;  5TIS Z;  4JZ2 A;  5GW7 A;  1HR0 O;  2UXN A;  5A2Q N;  4KHP O;  1BQ0 A;  3ZRW B;  3ABU A;  1FKA O;  2LP7 A;  3CCU V;  5DGI A;  3LP8 A;  3ASO B;  5J2U A;  3CCE V;  1SQV H;  2VRZ A;  4IHJ F;  1N33 O;  2W9C A;  1AB3 A;  1KJ9 A;  3FDS A;  2RF4 A;  1H8E G;  3JZF A;  5FL7 G;  3W1B A;  2JRI A;  4B3R O;  3S3X A;  1TUE B;  4RB2 C;  1V4Y A;  3PR4 A;  1Q82 W;  5FR9 A;  1WAZ A;  3GWO A;  4DV6 O;  2YS6 A;  1ZAU A;  3KTM A;  3RN4 A;  4WHX A;  3H3V H;  2WWW A;  1FXK B;  4DR3 O;  3RYI A;  3AK3 A;  2OTJ V;  4J9P A;  2B63 A;  1VF7 A;  2FYU H;  4J9L A;  3ABK C;  2PN1 A;  4U3J B;  5JWP A;  3M9O B;  4YJ3 B;  1QLE C;  3CX5 F;  1M4U A;  5EC1 C;  3EVK A;  2UXB B;  2A06 H;  1NTZ H;  3JRX A;  5LMN B;  1MZB A;  3RB0 A;  1GKF A;  3OGC C;  3G6Y A;  2N05 A;  4ED3 A;  3LSS A;  3OGI B;  5KFO A;  3AG3 C;  4JI5 H;  4O83 A;  1Q81 W;  4JYC A;  4U3J A;  1OWT A;  4YJ2 B;  3RFC A;  3HKB A;  4O4I F;  2CTR A;  2EIY A;  3JAS B;  1S72 V;  3MR2 A;  3HOV G;  3CSX A;  2F43 G;  5DGA A;  1SZT A;  3WG7 C;  3NGD A;  4A2A A;  5BMV B;  4X64 B;  5LP6 B;  4JV0 A;  2BQ3 A;  5J2T F;  1BNC A;  3L73 H;  4DUZ B;  4M7E A;  1Y4M A;  5L9X A;  1EUC B;  4DV4 O;  3APO A;  4GX0 A;  1OCZ B;  2XAS A;  3VQW A;  1XNR B;  4KXR A;  1CKM A;  3K3W A;  4F6R B;  1YTF D;  2VWK A;  4X65 B;  4DQN A;  4AQY B;  4FJC C;  4PD4 F;  2R8J A;  3CRR A;  2R8K A;  1PX2 A;  3R66 A;  5CA0 A;  2OH2 A;  4J9Y B;  4LFB H;  2VUM G;  2Y4U A;  4ZI7 B;  2QTO A;  3MD0 A;  4UVA A;  3H20 A;  1H38 A;  4BWA A;  1AR1 B;  5K3W A;  1O9H A;  3H1I H;  3BRC A;  2VQF O;  3QO8 A;  3OHB A;  1GN2 A;  4ECX A;  2LW1 A;  2FK1 A;  4MV7 A;  1XHX A;  2YS8 A;  2OYQ A;  1A0G A;  3JAM W;  4DRX A;  3BEH A;  2ODT X;  1KP3 A;  4EFB A;  4NXM H;  5GTI Z;  3BHP A;  3BFR A;  5IWA O;  5GTH Z;  5L1L A;  3W5O A;  4GKJ B;  4LNU B;  4B3R H;  4A3I G;  2ZE8 A;  2FML A;  2AQ4 A;  5FD6 A;  4TV8 B;  4B3M B;  1IOW A;  1JPX A;  2XOK G;  2HR3 A;  3LNM B;  2E75 B;  1SEI A;  3X2Q B;  3GTG A;  1US6 A;  2COI A;  1YZB A;  2DWC A;  3RR5 A;  1HDJ A;  1ENV A;  3BQ1 A;  4LF6 B;  1R1B A;  3UT5 A;  1ZHQ A;  1B6Q A;  5KKN B;  3R9R A;  2Q0O C;  4NZO A;  4TQF A;  1VQ9 V;  4JYB A;  4RZQ A;  4GX1 A;  3DTG A;  4F4Z A;  3AG4 B;  4JI8 H;  1LUV A;  4I4T A;  1GLV A;  1D5A A;  4F4X A;  5LHG A;  2R8I A;  1N0N A;  1IBL B;  5D8D A;  2QR4 A;  2R86 A;  2Y0S A;  3CE2 A;  1H8H G;  3ZRX A;  1I08 A;  4GKJ H;  5JCO A;  5H6R A;  3K5O A;  2R7L A;  4H44 B;  3L74 H;  1X59 A;  2Q7G A;  3CC7 V;  4RUA A;  3UZB A;  1SQF A;  4GYC B;  3WG7 B;  4G3I A;  1EBO A;  1XHZ A;  2CK3 G;  1H2G A;  3SR2 C;  2VQE O;  2W0F C;  2AGO A;  3IC7 A;  2UXB H;  3QFF A;  1K83 A;  3OT7 A;  3QZ8 A;  4I4T F;  1Y74 A;  1GMG A;  5GON B;  3NC0 B;  2Q67 A;  4ZI7 F;  1S0O A;  1UJW B;  2F93 B;  4O82 A;  4BY1 G;  1VQO V;  4RB0 A;  1M0T A;  4MVS A;  3E8H A;  1UC9 A;  1JXL A;  1K7D A;  3U0Z A;  1SER A;  4WCE V;  3TXS A;  1BGW A;  1K92 A;  3K3P A;  2A79 B;  2P06 A;  4TT3 G;  3SYC A;  4R7R A;  2VQF B;  2Z02 A;  4N23 A;  3OTO O;  3QG5 A;  3AYH B;  4JI8 O;  2DPI A;  1VKZ A;  2AGQ A;  4ECT A;  2HJD A;  3CJH A;  4JUZ A;  4UCU A;  4GX2 A;  3R65 A;  4J0M A;  3HOU G;  4Q4D A;  1VQK V;  2UUA B;  4JI0 B;  1QU7 A;  3OEE G;  4O4I A;  1QVF U;  2OCC C;  4O7T A;  5IJ0 B;  3GB7 C;  4O7R A;  1RSO A;  5KG5 A;  3OHA A;  1XNR O;  4O7S A;  2UVW A;  3JSN A;  2R72 A;  5KFJ A;  5DEC A;  1I0H A;  2VPS A;  1S76 D;  3HT5 A;  5IWA H;  4EEY A;  3SPC A;  2R7Z G;  4J9M A;  1N0J A;  4IL6 Z;  4X64 O;  4FS2 A;  1S0N A;  2V59 A;  2I87 A;  4MA0 A;  4YJ3 F;  4BBS G;  1ZWI C;  3KAK A;  2V4D A;  4I7Z B;  3T1H O;  3RJ0 A;  2R9I A;  4QSH A;  4E2L A;  4DUY H;  5KFR A;  5DQG A;  4FMT A;  3VQY A;  5KMG A;  4RUF A;  3MWE A;  4DV7 B;  1S0M A;  4FBT A;  5JQW A;  3B40 A;  1HP8 A;  2ZE7 A;  4QPJ A;  3W1G A;  2ZD9 A;  4BIO A;  2UUA H;  4JI0 H;  3GVM A;  3GWK C;  4O86 A;  2YID A;  2W9A A;  1AJQ A;  2IJJ A;  4IHJ A;  4J41 A;  4N21 A;  4TV8 F;  4TVI A;  2WLL B;  2VQD A;  4LF6 H;  2XT9 A;  1A48 A;  3HR0 A;  3HPL C;  1NT2 B;  3TII A;  5KFM A;  3JAR B;  1N56 A;  5L3E A;  4I5S A;  2HVS A;  3FB7 C;  3FB8 C;  3STZ C;  5LL6 Y;  3MJF A;  3F7V C;  1I94 O;  2HHF B;  5DED A;  1VBG A;  4GKK H;  4LH6 A;  4QWA A;  2CNU A;  3W7U A;  4FFM A;  2Q73 A;  3KHR A;  3RAQ A;  3F5W C;  4ETS A;  1AI5 A;  1OJH A;  2IJK A;  4FFB B;  3ABK B;  3K06 A;  2FJZ A;  2CKZ B;  4FU0 A;  4Z2W A;  1N33 B;  1M9N A;  2ZE6 A;  3A8T A;  4NKG B;  1E4E A;  1I1M A;  5CMU A;  3ZMV A;  3SJB C;  1T36 A;  1NTM H;  4J9S A;  1Y6X A;  4CMF A;  1RYS A;  3DC5 A;  2W7O A;  1F23 A;  4QE7 A;  1A9X A;  4QIW E;  3N40 P;  1PD3 A;  2V4R A;  2Q0A A;  4LF6 O;  3MDS A;  2PMZ A;  4J9O A;  2CE4 A;  4FLT A;  1J5E B;  2JVD A;  3RYH B;  2PYL A;  2XCA A;  3V6K A;  5KFZ A;  3E83 A;  1I7N A;  2PF4 E;  1SQX H;  5ITZ B;  2DW4 A;  3ZMZ A;  2FPP B;  2WAM A;  1SQQ H;  4PDM A;  1LNQ A;  3WB2 A;  2OCC B;  3RBD A;  1N34 B;  3TY5 A;  2GPS A;  3U11 A;  5GON F;  3JCZ A;  3OE7 G;  3I55 V;  4LSX A;  3UO3 A;  3VOU A;  1JA8 A;  1V55 C;  1HNZ H;  4R6Z A;  1VQ8 V;  1IBM H;  1PPJ H;  3PW7 A;  3I4M G;  3RT3 C;  1I3Q A;  4EQ5 A;  4KFM A;  3K0G A;  3KCX A;  1KB9 F;  3SYQ A;  3ETD A;  4KHP H;  4I55 F;  4Q8E A;  1Q5O A;  2J6U A;  4K0K B;  3TQ1 A;  4ECZ A;  2F1M A;  5C1O A;  3CCV V;  4DRF A;  3FB5 C;  1MSD A;  2LJ2 A;  4DR6 H;  4WD3 A;  3OW2 U;  1SQP H;  1QR9 A;  2L6L A;  1BCC H;  5CB4 B;  4MV4 A;  3JD3 A;  1EN6 A;  5K1P A;  1KC8 W;  2ZM6 B;  4DR3 H;  4ICG A;  4PI2 A;  4OPH A;  1EZJ A;  4PV1 B;  3U9T A;  1Q6H A;  2CW8 A;  2YEV A;  4FK5 C;  5K1X A;  1OHH G;  5B1O A;  3X2Q C;  3CCL V;  1RM1 C;  2UXC H;  2VUG A;  2ZJT A;  2QSA A;  2HLD G;  5LOV F;  1NI8 A;  4G2K A;  2YSU B;  1IUR A;  2Y4R A;  2VA3 A;  4NTY A;  1L8D A;  1NR1 A;  1EKF A;  2HP8 A;  5KFV A;  2HJF C;  4C5B A;  2W57 A;  2VQE H;  3AG4 C;  2EIJ C;  2EIL B;  2WB1 E;  2BOC C;  1H2S B;  2QKA A;  2UUB B;  2V4Q A;  4JI4 O;  5LYJ B;  2P6J A;  3RYH A;  2QKS A;  2W6M A;  4NXN H;  3OSN A;  2OTL V;  5FNV F;  3RB3 A;  1VS0 A;  4DR3 B;  4YAK B;  2ZM6 H;  2W71 A;  1NU1 H;  2QWP B;  2F4V H;  1FFX A;  1I6U A;  1XI1 A;  4LFC O;  2NUA B;  1JMK C;  1MNG A;  5BWT A;  4DV0 O;  2OWO A;  2BSK A;  1B06 A;  3N8D A;  2CGO A;  3BCC H;  4DXW A;  4ASU G;  4DR5 B;  1M90 W;  4PZ7 A;  4I9W A;  3RYC B;  3LUL A;  2OLS A;  2W9C B;  3K5I A;  4AI8 A;  1HNW H;  3JAK A;  4JI1 O;  2P22 C;  4O2B F;  5CBF A;  2ZT9 B;  1P16 A;  4TQS A;  1L0L H;  4O7Y A;  4GLX A;  1IBL O;  3L72 H;  2NU9 B;  3TW7 A;  4NZM A;  3PZP A;  2HHF A;  4R7C A;  4W4K A;  1JQ0 A;  4LWS B;  4DW0 A;  4LF5 O;  4JV1 A;  4QIW F;  4D7T A;  1SYX B;  1J5E H;  2UUB H;  2CUG A;  3PJS K;  1EUD B;  2R93 G;  1WCM G;  3E22 B;  1Q7Y W;  2XC9 A;  3BAA A;  1VP7 A;  3DXR A;  2ZDI C;  3CRC A;  5CBH A;  1A32 A;  5KFU A;  2W6N A;  4FLU A;  1DLB A;  2W9B A;  2UVU A;  2RMK B;  2R82 A;  5FNV B;  4H13 B;  1K73 W;  1FAF A;  4LF8 B;  1WR2 A;  4LWS A;  2UU9 H;  1QLN A;  1ZX3 A;  5IJ9 B;  5F9N A;  5F9L A;  5DM6 V;  2YXY A;  2O03 A;  5IYB O;  2WLJ A;  3I4N G;  4B3M O;  3G80 A;  5KFI A;  2GHY A;  5FJ8 G;  2GSM B;  1HNZ B;  2R7N A;  4O4H B;  4Z1M G;  2N74 A;  2EIN B;  1VBH A;  1K97 A;  2QE7 G;  3E86 A;  1VQM V;  2Q7H A;  1BHB A;  4PDB A;  1I5Y A;  2JA5 G;  3SGI A;  2QEX V;  2YIB D;  3B77 A;  5IYZ F;  3T1Y B;  2GPW A;  4DR1 O;  1GGO A;  2XD4 A;  2PMZ E;  1XMO O;  3FMA A;  4O4H A;  2CTP A;  2HVK C;  3J7A K;  2JJ1 G;  1G2W A;  4JV2 A;  2P4V A;  3SJC C;  1V51 A;  2R92 A;  5KG3 A;  2ADQ B;  1XK5 A;  3V6J A;  4LF9 O;  4O4L F;  2HG8 A;  4O81 A;  3P30 A;  5EWE A;  3RGZ A;  2EIL C;  2EIJ B;  4X1I A;  2UU9 B;  2ZKO A;  1P4R A;  4DAA A;  4HYO A;  4DV3 B;  1J95 A;  5IY5 B;  5B5E Z;  1N36 H;  1MAB G;  3JAS A;  3VOT A;  4WFB V;  4QPK A;  2EIM B;  2ALZ A;  1URF A;  4JAA A;  3RBZ A;  1DTO A;  3EFF K;  3RWR D;  3LDE A;  2UU9 O;  2ADP A;  4O2A B;  2IJH A;  3GTK A;  1X4T A;  3JAK B;  2FP4 B;  3QWU A;  3SYO A;  2YU9 A;  1P49 A;  4OX9 O;  5KG4 A;  5DQI A;  3T1Y H;  4FS1 A;  1FJG H;  5EK0 A;  2C2A A;  1IYE A;  4MT8 A;  4LMY A;  3K03 A;  1EHI A;  5KX5 A;  3LDD A;  2W8K A;  1ET0 A;  3E35 A;  4IIJ B;  3T7A A;  2ZDI A;  5KFQ A;  4OX9 H;  4DR1 B;  3H1L H;  4MS2 A;  5LMU B;  2R9A A;  1FKA H;  1K3E A;  5D1O B;  2WLK A;  2CH7 B;  5JQG A;  1YDX A;  3SYA A;  3N2K B;  4ZHQ B;  1B3Q A;  3ORQ A;  2F4V B;  1OCR C;  4WFF A;  2W9B B;  3JD2 A;  4TQD A;  3ZHV A;  3R23 A;  2HKO A;  1Q8I A;  5JQG F;  2WLM A;  2PYJ A;  1PV0 A;  3SYP A;  2YIB A;  4JV5 O;  1D5N A;  2Q8V A;  2YI9 A;  4MTO A;  1Z2O X;  1WH2 A;  1WN7 A;  3F8N A;  4IT5 A;  3U10 A;  1N32 O;  4EGJ A;  1E4E B;  1SET A;  1HR0 H;  1VQL V;  3N42 B;  4O4J F;  2EIN C;  3VA7 A;  2IBZ H;  4MW8 A;  4IZO A;  3RW0 A;  1Y14 B;  3UYY A;  4B08 A;  2W6J G;  1BQZ A;  1G4Y B;  4JI3 B;  4FM2 A;  4PZ8 A;  5LA6 F;  4MVQ A;  5LBQ A;  1JLL B;  3T1C A;  5BPF A;  2HHH B;  5KX5 F;  4JI2 H;  4PDV A;  4JI1 B;  2HJW A;  2YRX A;  4O3R A;  3O9O A;  1EKV A;  4JV5 H;  5KT6 A;  2DZD A;  4JYA O;  1EKP A;  3KRE A;  4O7Z A;  1Y66 A;  1RP3 B;  5BXZ A;  1Z5V A;  4LCU C;  1SZX A;  4CE5 A;  3K3V A;  1PL0 A;  2JEI A;  4MTF A;  1MZE A;  4JYY A;  3EYY A;  1DAA A;  3RTX A;  3PFF A;  5BWX A;  1F4M A;  2FMA A;  2YI8 A;  2DQ3 A;  1Y67 A;  4DR6 O;  5CA1 B;  3T9E A;  2EIM C;  2W6Z A;  3Q2O A;  5CA0 B;  2VWJ A;  1YJW V;  4I50 F;  2COJ A;  2D2C B;  1YVW A;  4FE2 A;  2P67 A;  2QWQ B;  3MWD A;  1PKX A;  1V54 B;  2JA5 A;  3AK1 A;  2ITC C;  1TAE A;  4LFB O;  4LFA B;  4HNA A;  4CMD A;  2XIG A;  3ZHU A;  3ZRW A;  1GAX A;  4RZR A;  1SS3 A;  1RM1 B;  4O3S A;  3PO3 G;  2BQU A;  4OPA A;  2OIE A;  3RGB A;  3TXQ A;  1M0W A;  1T94 A;  5EBL C;  4YR3 A;  1EZV H;  5BR8 B;  3K5H A;  4DV2 H;  2RJZ A;  3MAQ A;  4BWS C;  5EDW A;  3MHH C;  4QE9 A;  3NBY B;  2QF7 A;  4J9K A;  4AIL C;  5KUK A;  5EWG A;  3N6X A;  5FLX W;  4ZKI A;  4B3S O;  1PL4 A;  5IYB G;  1FS0 G;  3UO2 A;  2WSS G;  4QNH B;  3RYC A;  1TGO A;  1S9F A;  3T9A A;  2B63 G;  1VQ4 V;  1R73 A;  4U3F H;  4JF3 A;  3G8C A;  5LXT B;  4M9U A;  1S03 G;  4O3N A;  5I60 A;  3JD1 A;  1FJG B;  1QBZ A;  1W59 A;  1FXV A;  5C8Y B;  5H80 A;  4BBR G;  1WA8 B;  1GK9 A;  3JD4 A;  4YB8 B;  1FPO A;  1QCE A;  3K9A A;  4K0K O;  4Q43 A;  1R6T A;  2GTS A;  4OX9 B;  2YIA A;  4EKW A;  3WO1 A;  4IRC A;  2Q7D A;  4MVU A;  5T14 A;  1Z5W A;  3BY6 A;  4JAS A;  2YXL A;  5JCO C;  1YSC A;  3HKE B;  3N6R A;  3DSQ A;  1A0I A;  5AG2 A;  3AK2 A;  2HGW A;  1EYZ A;  2ASD A;  3JZ6 A;  3VPD A;  2X6B A;  3GTJ A;  3CVZ A;  4G27 B;  1E4F T;  4PWQ A;  4FLX A;  4GKK O;  3UFX B;  1N34 O;  1CKN A;  2LGQ A;  3MHS C;  5BMV A;  5EZY F;  3RV4 A;  2ZR3 A;  2F66 C;  5KFK A;  1R3L C;  2MW2 B;  3H0G A;  5KG7 A;  4MTD A;  4DV1 H;  4C5C A;  3SI8 A;  4BY7 G;  4J9Q A;  4IYI A;  4ECV A;  1XL6 A;  2ASL A;  2ZIO A;  3DGE A;  3T1Y O;  3CMA V;  4CS2 A;  2GUZ B;  2ZNI A;  3OMN B;  3A0B Z;  3P32 A;  3DXR B;  3T4Z A;  2L35 A;  1SF9 A;  4UCV A;  2V1D A;  4JI5 B;  4JI2 B;  1JFF A;  1IBM O;  5BWV A;  2ODM A;  2NU8 B;  2WLH A;  4MV9 A;  5HNE A;  5LOV A;  3C3T A;  2GBO A;  2FLL A;  4CKC A;  3AG2 B;  4YP3 A;  2R9R B;  3ICX A;  2YXH A;  1JDE A;  4X62 H;  3A0R A;  4LF8 O;  4UCO A;  1S10 A;  4ZBM A;  5KFC A;  1L0N H;  3WB0 A;  3QF7 A;  4X64 H;  4IYH A;  1O9G A;  4R8C A;  4G28 B;  4E4E A;  3SNO A;  4DUZ H;  2WLN A;  2DYR B;  4NXN O;  3JAT B;  1E4G T;  3HOY G;  4P30 A;  3M9N B;  2Y0I A;  3IC9 A;  1S5H C;  1CP9 A;  2ZE5 A;  4QWD A;  4LF7 H;  2B1I A;  5JJJ B;  5KFE A;  1GO3 F;  5IY5 C;  3CB2 A;  5LA6 B;  3TIG A;  4YHH B;  3J80 W;  2LQT A;  3MR6 A;  1ZET A;  2CTW A;  1VF5 B;  2JIZ G;  3JRW A;  4LFA H;  2YCH A;  4JAV A;  4TUY A;  4UVC A;  1AN7 A;  2CFM A;  1YXB A;  2RDJ A;  3FKI A;  4DW1 A;  1MZF A;  4DR5 O;  5BYA A;  2R7K A;  1E1R G;  2K1E A;  2C22 A;  3M99 B;  4R8U A;  4X62 B;  4GC7 A;  2Y0S E;  2BE3 A;  1VQN V;  3ABT A;  1I1L A;  3TIN A;  1QHT A;  4E6N A;  2Q6A A;  1S77 D;  2WPD G;  3O65 A;  3K9S A;  3T5H A;  4IRK A;  5B3S B;  4U7N A;  3F5T A;  2V58 A;  1F51 A;  1GSO A;  3IN5 A;  5LP6 F;  3E2E A;  4O3P A;  1G8M A;  4B3T O;  1TWC A;  4FLY A;  3CJH B;  3M7M X;  3RGX A;  4EB6 A;  4GC6 A;  4NZN A;  1OCR B;  2CNV A;  1AR4 A;  2A3Q A;  4YHH H;  4ZHQ F;  4O4I B;  1M57 C;  4ZOL B;  3N41 B;  4U7O A;  1BS3 A;  1KT8 A;  4A3F G;  1R6K A;  5I5W A;  5KFN A;  1O75 A;  4TWK A;  2NN4 A;  4RUC A;  4JI8 B;  5D5Q A;  3FAV A;  3U9S A;  3THO A;  4F6E A;  3TY9 A;  3JAW A;  1XMQ B;  5JUM A;  1KKC A;  4XZ3 B;  4ED0 A;  4UCS A;  4FGR A;  3EPI A;  4J7K A;  3ZHR A;  3BA9 A;  5JVD B;  5KS8 A;  3GTO A;  4O3O A;  4TOI A;  1Y1W G;  2I8C A;  1I7F A;  1L1F A;  4HR7 A;  4HNV A;  3GID A;  3FYE B;  1Y76 B;  3GIK A;  1F4N A;  3ML0 A;  1KEC A;  2FLP A;  2FLN A;  1M5I A;  1KP2 A;  1C3O A;  1C30 A;  4MA5 A;  3H1K H;  4IHJ B;  5F2V O;  2JK5 C;  1H2M A;  2UXD B;  5EZY A;  1T3N A;  3OTO H;  3K0D A;  5FPR A;  2Q2U A;  4GZR B;  5KFY A;  4I7H A;  5H6Q A;  4CH4 A;  4RQF A;  3CSW A;  4YHH O;  3CS5 A;  2YZN A;  4YR2 A;  5L3D A;  4FIP C;  4X20 A;  1GSH A;  3JSL A; 
#chains in the Genus database with same CATH homology
 3RYI B;  2HVR A;  2VQF H;  2KKW A;  2W57 A;  2VQE H;  1H2S B;  4X1Y A;  2UUB B;  5LYJ B;  2GV9 A;  4DV3 H;  3RYH A;  1XDN A;  5EOY A;  4B3M H;  4NXN H;  4UCR A;  2KSW A;  4LF4 H;  4I55 A;  5EYP B;  1JFF B;  3K5L A;  4DR3 B;  4B3S B;  1VS0 A;  2ZM6 H;  3JAL B;  5CA1 A;  1Z2N X;  2F4V H;  1FFX A;  1I6U A;  1TVK B;  4I50 A;  1XI1 A;  1JMK C;  4O4J A;  2OWO A;  2BTO A;  4APM A;  4TV9 A;  4DR5 B;  4PZ7 A;  3RYC B;  2WDT A;  3JAR A;  1N34 H;  4X1Y B;  1XQ8 A;  5IWA B;  1XMO B;  1HNW H;  3JAK A;  2P22 C;  5JQG B;  3LML A;  1IBK B;  4LSA A;  2RGR A;  1P16 A;  4MTE A;  5A2Q W;  4GLX A;  4LFB B;  3KXY T;  4HBN A;  4O4L A;  4O2B B;  1WNS A;  4YJ2 A;  3JAW B;  1TUB B;  1I94 B;  4TV8 A;  4D7T A;  1SYX B;  1J5E H;  3RYF B;  1KMI Z;  2UUB H;  2R70 A;  4LNU A;  5KHI A;  2RQ6 A;  2E3C A;  3E22 B;  3RF2 A;  3BAA A;  5LL6 b;  4PZ6 A;  3CHX A;  3UT5 B;  4DV2 B;  4X1I B;  3HXL A;  4FLU A;  1XNR H;  5FNV B;  4X66 H;  4LF8 B;  4LR3 A;  2UU9 H;  2RGV A;  2WYO A;  5IJ9 B;  3KAL A;  4O2B A;  4JI6 B;  4B3T B;  5KHJ A;  2CAZ C;  4AQY H;  4RB3 C;  3J81 W;  2O03 A;  4K8X A;  4CC5 A;  5JJE B;  1HNZ B;  4O4H B;  3L2P A;  2PUS A;  3T1H B;  4TUY B;  2Q7H A;  4PDB A;  3SGI A;  2HGS A;  2YIB D;  3HKD A;  3T1Y B;  5EIB C;  1FFX B;  4NVP A;  5J2U A;  3FMA A;  3C0F B;  4O4H A;  3N43 B;  2HHH H;  3J7A K;  4NXM B;  3SJC C;  3GJX B;  1XK5 A;  3W1B A;  1CKN B;  4Q0Y A;  4RB2 C;  1HW7 A;  2VQE B;  3RGZ A;  1YEW A;  1ZAU A;  2UU9 B;  4X1I A;  3K57 A;  3RYI A;  3N44 B;  4DV3 B;  2MCT A;  3A2F A;  5JH7 B;  3RYF A;  3GDE A;  4NXN B;  1N36 H;  1VF7 A;  3JAS A;  4IIJ A;  4X1K B;  4U3J B;  1Q3E A;  3RWR D;  4DV6 H;  4YJ3 B;  2WE6 A;  3T1H H;  1M4U A;  4O2A B;  2UXB B;  4FLZ A;  1X4T A;  3JAK B;  4HNA B;  3QWU A;  1P49 A;  5LMN B;  1MZB A;  3T1Y H;  1FJG H;  5C8Y A;  2F95 B;  3IAY A;  5D5P A;  4DUY B;  4JI5 H;  4X1K A;  4U3J A;  4LMY A;  4YJ2 B;  5KX5 A;  3LNN A;  5LP6 C;  3ETQ A;  3HKB A;  5EZY B;  3JAS B;  4IIJ B;  1XNQ H;  4OX9 H;  3CSX A;  4DR1 B;  5LMU B;  2R9A A;  1XMQ H;  1FKA H;  4KHP B;  5D1O B;  5JQG A;  4LF4 B;  4A2A A;  5BMV B;  3N2K B;  4ZHQ B;  4X64 B;  5EYP A;  5LP6 B;  2F4V B;  4DUZ B;  4M7E A;  4TQD A;  2ZIN A;  1Q8I A;  5LYJ A;  2PYJ A;  3ZS8 C;  3VQW A;  1XNR B;  2YIB A;  2ZNJ A;  1CKM A;  3QTC A;  1BJT A;  2YI9 A;  3RIZ A;  4F6R B;  4GKK B;  1HNX H;  1WH2 A;  2VWK A;  4X65 B;  1Z2O X;  3F8N A;  4AQY B;  1IBK H;  3U10 A;  5IYZ A;  4JI7 H;  1HR0 H;  5CA0 A;  3N42 B;  4ZIB A;  2VOB A;  4LFB H;  4FLW A;  4ZI7 B;  2E5L H;  5KMG B;  2HEP A;  2UUC H;  3H20 A;  2ZIM A;  5LA6 A;  4BWA A;  2UXC B;  1O9H A;  3BA8 A;  4B08 A;  3BRC A;  5JVD A;  4JI3 B;  5IJ0 A;  4MV7 A;  1XHX A;  2OYQ A;  3JAM W;  3K59 A;  4FM2 A;  3SJA C;  4PZ8 A;  3IG0 A;  4DRX A;  4JI2 H;  2HHH B;  5CB4 A;  4JI1 B;  4EFB A;  4NXM H;  3BHP A;  5J2U B;  1Q43 A;  3W5O A;  4GKJ B;  4JV5 H;  4DV0 H;  4LNU B;  4JI6 H;  4B3R H;  4ZI7 A;  3OTF A;  5FD6 A;  4TV8 B;  4B3M B;  3KYH C;  4FM1 A;  1Z5V A;  1SEI A;  4DR2 H;  1HNX B;  3K3V A;  5KHG A;  2HIV A;  3RR5 A;  4WBN B;  1TA8 A;  2EX3 A;  4LF6 B;  4I9Q A;  4JI7 B;  4DR4 B;  3UT5 A;  3EYY A;  3RTX A;  5IT9 W;  1ZHQ A;  4I50 B;  4DV4 H;  2YI8 A;  4TQF A;  3JAL A;  5CA1 B;  3K5N A;  4DR5 H;  4RZQ A;  5CA0 B;  2VWJ A;  4JI8 H;  3BAB A;  4I4T A;  5DIS C;  1SQG A;  1D5A A;  4FM9 A;  4F6R A;  1JJO A;  1N32 H;  4CC6 A;  1TAE A;  1IBL B;  4LFA B;  4HNA A;  4FLV A;  2XIG A;  4DR7 H;  4K0K H;  4O2A A;  4K8Z A;  4I55 B;  5KHK A;  3B2E E;  4CH5 A;  1TUB A;  3RGB A;  1DGS A;  4EEQ A;  2XHB A;  1M0W A;  4DR1 H;  2PY5 A;  5JCO A;  3BPZ A;  4GKJ H;  3K5O A;  4RAZ A;  5KX5 B;  2Q7G A;  4DR6 B;  5BR8 B;  4D7S A;  4DV2 H;  2RJZ A;  1SQF A;  3MAQ A;  4BWS C;  4GYC B;  1TVK A;  4FFB A;  3NBY B;  1XHZ A;  4DV6 B;  3SR2 C;  4AIL C;  4DK1 A;  1X9N A;  4LF8 H;  4DR4 H;  3N6X A;  1S5J A;  4DRX B;  5FLX W;  4YJ3 A;  2UXB H;  2PGG A;  3RYC A;  1TGO A;  5GON B;  4JYA B;  2BTQ A;  1SA0 A;  3NC0 B;  1S03 G;  5LXT B;  2ZCE A;  2F93 B;  4O4J B;  4RB0 A;  1M0T A;  1FJG B;  3VQV A;  3U0Z A;  5JH7 A;  5C8Y B;  4CS4 A;  1N33 H;  2QM4 A;  1P8L A;  1BGW A;  1XNQ B;  1HR0 B;  4OX9 B;  2YIA A;  4LF9 H;  1B04 A;  4R7R A;  2VQF B;  1Z5W A;  2YXL A;  3QG5 A;  5JCO C;  3JAT A;  5KHH A;  3HKE B;  3DSQ A;  1A0I A;  4UCU A;  4RAY A;  4X20 B;  4J0M A;  4UFZ A;  2UUA B;  4JI0 B;  3CVZ A;  4B3S H;  4O4I A;  1M93 A;  2QJ1 A;  4I4T B;  4CH3 A;  5IJ0 B;  1E4F T;  2Q7E A;  4JI1 H;  2JGU A;  4FLX A;  1RSO A;  1CKN A;  5BMV A;  5EIB D;  4JV5 B;  2HVQ A;  4B3R B;  3JSN A;  2R72 A;  4FVM A;  4JYA H;  2F66 C;  2VPS A;  3L4K A;  1IBM B;  4MTD A;  4DV1 H;  5IWA H;  4YY3 H;  1HNW B;  2E5L B;  3UQ8 A;  4LH7 A;  2ZIO A;  4CS2 A;  4TV9 B;  1V9P A;  2ZNI A;  1SKV A;  3KAK A;  1FVI A;  2V4D A;  3RJ0 A;  4JI4 H;  1QQC A;  4UCV A;  4JI5 B;  5D1O A;  4DUY H;  5FD5 A;  4JI2 B;  1JFF A;  3VQY A;  4DV5 H;  5KMG A;  4DV7 B;  4DK0 A;  4LF5 H;  3DF7 A;  5LXT A;  5LP6 A;  4MV9 A;  5LOV A;  4DV0 B;  1IBL H;  3W1G A;  2UUA H;  4JI0 H;  4UCT A;  3ICX A;  4LFC B;  4X62 H;  4IAJ A;  4UCO A;  1KU9 A;  4IHJ A;  4DR2 B;  3WB0 A;  3E22 A;  3QF7 A;  4X64 H;  1O9G A;  4LF6 H;  2PZS A;  1NT2 B;  3N2G B;  4DUZ H;  3JAR B;  4DV4 B;  2HVS A;  4BW9 A;  3JAT B;  4YY3 B;  1E4G T;  5J2T A;  2BTQ B;  2UXD H;  3OTO B;  4GKK H;  4LH6 A;  2Q2T A;  4LF7 H;  5JJJ B;  5D1P A;  3WB1 A;  3CB2 A;  5LA6 B;  4ETS A;  4YHH B;  3J80 W;  4FFB B;  1S68 A;  2HIX A;  4LFA H;  3K58 A;  2YCH A;  1ZHS A;  4TUY A;  4PHZ A;  1AN7 A;  1N33 B;  2CFM A;  1G6U A;  2UUC B;  4DV7 H;  3SJB C;  3ZED A;  4LFC H;  3N40 P;  4X62 B;  4JI3 H;  2Q0A A;  2JS5 A;  4CH6 A;  2FE3 A;  4FLT A;  4ZOL A;  1QHT A;  1J5E B;  4E6N A;  5IJ9 A;  2JVD A;  3RYH B;  2PYL A;  1N36 B;  5ITZ B;  1GYF A;  3N2K A;  4ZHQ A;  3S24 A;  4PI0 A;  3WB2 A;  1Z2P X;  3KAJ A;  4FLY A;  3M7M X;  4X66 B;  1N34 B;  4EB6 A;  3FFQ A;  1WPB A;  3HKD B;  3TY5 A;  3RGX A;  3U11 A;  3VNN A;  5J2T B;  3GB8 B;  4B3T H;  4EFE A;  4A2B A;  4LSX A;  4YHH H;  5LMN H;  4O4I B;  3HKC B;  4ZOL B;  1HNZ H;  3N41 B;  4LF9 B;  1IBM H;  3N2G A;  4DV1 B;  5JJN B;  1O75 A;  1I94 H;  4JI8 B;  5D5Q A;  4EQ5 A;  4RB1 A;  2P5O A;  3THO A;  3TY9 A;  5LMU H;  3JAW A;  1XMQ B;  1N32 B;  3MWM A;  4KHP H;  5FNV A;  3PN1 A;  1Q5O A;  4UCS A;  4DR7 B;  4K0K B;  3TY8 A;  2F1M A;  3BA9 A;  5JVD B;  3K5M A;  3M4I A;  1L2Z A;  4L8J A;  4KL1 A;  4TOI A;  4DRF A;  3VQX A;  4FM0 A;  3HKE A;  1I7F A;  3NBZ B;  4DR6 H;  5BR8 H;  3RFR A;  5CB4 B;  4WBN A;  4Q6G A;  5K1P A;  4CS3 A;  3L4J A;  2IM9 A;  4O4L B;  2PTM A;  2ZM6 B;  1CKO A;  4DR3 H;  4X65 H;  1M5I A;  5LOV B;  4PI2 A;  4AHC A;  4EB6 B;  5FPO A;  2CW8 A;  4IHJ B;  5K1X A;  5ITZ A;  3HKC A;  3HKB B;  5EZY A;  2UXD B;  2CW7 A;  3OTO H;  1SA0 B;  1T5E A;  4JI4 B;  5IYZ B;  1XMO H;  2UXC H;  5FPR A;  2VUG A;  2Q2U A;  4LF7 B;  2ZJT A;  4I7H A;  5GON A;  4CH4 A;  4DV5 B;  4LF5 B;  1L8D A;  1WN7 A;  4X20 A;  3JSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...