4EFBA

Crystal structure of dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA ligase
rcsb
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 103
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4efbA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4efbA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4efbA02
4JI3B 4JI6B 4OX9B 1P16A 4EFBA 3L2PA 1IBMB 2UUBB 4X64B 4CC5A 4DUYB 3BA8A 3SGIA 2F4VB 4PZ6A 1HR0B 3BABA 1A0IA 4PZ8A 5D1PA 5LMUB 3W5OA 4UCSA 3UQ8A 2HVRA 4CC6A 4EFEA 4JV5B 2HIVA 3W1BA 2CFMA 4PZ7A 4DR1B 4LFAB 4UCTA 4GKKB 1TAEA 1XMQB 2HVSA 1CKNB 4UCOA 1HNWB 1DGSA 1N36B 4B3MB 2UUCB 1FVIA 4LF4B 4NXNB 4LF9B 4UCRA 2UXDB 5D1OB 1I94B 2VQEB 4DUZB 3JSLA 2E5LB 3TY9A 1V9PA 4KHPB 1X9NA 4GLXA 1XNQB 4B3TB 4B3RB 2HHHB 4UCVA 3BA9A 4YY3B 2VUGA 3RTXA 3TY5A 4LH7A 2ZM6B 3T1YB 4DRFA 2Q2UA 4DR7B 5DISC 1HNXB 3OTOB 1N34B 4EEQA 1IBLB 1ZAUA 4TOIA 4LF5B 1XK5A 4LF8B 2Q2TA 3KYHC 1CKOA 3NBYB 5D1OA 4JI2B 3W1GA 3GJXB 1XNRB 1S68A 2UXCB 3QWUA 4DR3B 3NBZB 4LH6A 4E6NA 3VNNA 4DV3B 4LFCB 4DR2B 4X62B 5IWAB 1P8LA 4DV0B 4DV2B 4B3SB 1TA8A 1VS0A 1J5EB 4LF6B 4JI4B 3NC0B 1FJGB 4JYAB 4EQ5A 4UCUA 5LMNB 1IBKB 1XDNA 4DV5B 2HVQA 4DR6B 3RR5A 4JI7B 1XMOB 1B04A 4DV1B 5FPOA 4JI5B 2UU9B 2VQFB 4AQYB 3GB8B 4X65B 5BR8B 3PN1A 5FPRA 2UUAB 4UFZA 4JI0B 4YHHB 4LFBB 4X66B 1N32B 1N33B 4JI8B 2UXBB 3BAAA 4DV6B 4LF7B 4DR5B 4K0KB 4NXMB 3TY8A 1CKNA 4JI1B 4GKJB 3GDEA 3T1HB 2OWOA 2HIXA 4DV4B 3S24A 3JSNA 4DV7B 1CKMA 4DR4B 1HNZB
chains in the Genus database with same CATH superfamily
2YDEA 1SFOA 2ZD9A 2UUCH 1I5XA 2MK3A 2QE7G 4O84A 3L2PA 2QTSA 1SETA 3HB9A 4PDMA 2UUBB 1JLLB 3E8HA 3PJSK 1KTAA 4DR3H 4JI5H 4OX9H 3N43B 3ETEA 3K03A 2B63A 2IJHA 2GHYA 2W6JG 5LMUB 1NTMH 5JJJB 1EZ1A 1UC8A 3DGEA 2DMXA 1AN7A 4AHCA 2BR0A 2F66C 2HIVA 2J6SA 2CTWA 5KUKA 1M57C 3GTJA 2F4VH 4A3CG 4J7KA 5L3FA 4RUAA 3F8NA 4UCTA 3OM3B 4C5AA 2QWRB 3BQ2A 3RB0A 2E76B 1FFXB 2JA7A 1WNSA 1HNWB 1WJZA 2R82A 5DQHA 5DGBA 3FYIB 2QKAA 2QWOB 5IJ0B 3RYFB 4BAYA 4XX0B 1OBDA 5KG2A 2ZE8A 2YU9A 4NXNB 1F4NA 4UCRA 3ABTA 3T1CA 1NU1H 2VQEB 1RM1C 2AGQA 1GO3F 2AHZA 3B8MA 3WWJA 4JYBA 1OCZB 4EYHB 3SYCA 5B1NA 1NQTA 2A06H 4B3TB 1Q3EA 1QLEB 1K33A 1RP3B 2PMZA 2RDCA 3RTXA 2EILB 1M9NA 4BIUA 5L1LA 4KHPH 3K5HA 1ZLZA 4YJ3A 3RYIA 2W71A 4MVMA 1MA1A 2EX3A 1M5IA 1TWCA 3K9AA 2VQEH 3OHAA 4PDRA 2W70A 4RB1A 4YAKB 1Q86W 3K5OA 3W7SA 2C2DA 1IOVA 3RBDA 3T9CA 5C3EG 1CEZA 3KHGA 2UVRA 4KUMA 2RMKB 4LF8O 2OCHA 3RAQA 4PDBA 1B06A 4LFCB 5JJNB 4YJ2A 1GK9A 5JCOA 1A9XA 2JA8G 1AP5A 1ZL8A 3SPHA 4LF6B 4FFLA 3VBBA 3GTMA 1FFTB 5LL6Y 4O3SA 1O9GA 5L3GA 1THZA 4PELA 2I87A 2JS3A 4QIWF 1E4EA 3R5FA 4ECVA 3IC7A 1CP9A 4FLXA 3MHHC 2RGVA 1CE8A 4A2AA 1T5EA 1S5HC 3L74H 3CCVV 1U97A 4FFBB 1BHBA 3PVXA 4JGSA 2JA7G 5H2FZ 3TIGA 4HNAB 1VF6C 3GB7C 2YYAA 3MR2A 3V4ZA 1QBZA 3J80W 1WB8A 3PO3G 2XNDG 4DV5H 3I56V 4G28B 1HNXO 3T5LA 4O3QA 3OGIB 5KMGB 4NXNH 5KG6A 2V4DA 4NXMH 5I5VA 2AZ2A 3T5JA 4ECUA 1AI5A 2YL2A 1YJNV 3G8DA 4M9UA 4DAAA 2QK4A 2CTQA 3B8NA 4X9QA 1XEQA 4X64B 4GYCB 4IYHA 4O7VA 2CNVA 1M4UA 4J9MA 2IM9A 1W59A 3X2QC 4CH5A 2XAJA 4YBZB 2GDSA 4F4LA 1VQ4V 2ASJA 1V55C 4GX2A 3G71V 5IJ9B 2X0SA 2CUGA 3CRRA 2WPDG 2UU9O 1JR9A 4G27B 1FVIA 5BWXA 2JRIA 4LF4B 2XGPA 1WLEA 1B6QA 2UXDB 2ZXWB 3JD0A 2Y4UA 5J2TA 5IY5B 2RDJA 4KP4A 5BR8H 5B1AC 2VUGA 1WB7A 2YXYA 1XUQA 4FPPA 1IURA 2DJVA 4DR7B 4KHPO 3CCQV 5LGUA 1HWYA 2Y48A 2DLNA 2ZINA 4O83A 4MS2A 1WH2A 1K34A 2HHHO 2R87A 4C5CA 1MMMA 4HNUA 3UT5A 3DAAA 4DR4O 4WHXA 3GV8B 1SQBH 1FXHA 3QF7A 3U0ZA 3GJXB 1A32A 1COWG 4M7EA 4QJFA 1MOFA 4O4JF 4FM1A 4LBEC 5A2QN 3PW5A 4I5SA 4DR2B 4J9QA 2VS0A 5F9LA 4ECWA 5KFZA 1FKAO 3TINA 4LC1A 1VIBA 3FAVB 5DECA 3CPWU 4MV6A 1Y1WG 4R50A 5J2UA 4FM0A 2ZM6H 2HVQA 2YS7A 4W4LA 4DK0A 5LP6A 4A3JG 2H8PC 4X66H 5IT9W 4MA0A 3H1KH 4DRXA 3OMNB 5C8YF 2YI8A 4QW8A 4YY3O 5BYAA 3BAAA 1M7JA 3WO1A 1Y1VG 2FK3A 2NU9B 3H40A 3Q1KA 2R7MA 4JTCB 1FJGH 1MG1A 3GDEA 2EBOA 1HNXH 4FIPC 1WPXA 5CAEB 2QGNA 4NXMO 3JZ6A 3CJHB 3WWHA 5IYBG 2ZR3A 1EKFA 1URFA 3R66A 2YW2A 1MSDA 3AG7A 2XAFA 3OSNA 3F7VC 1VARA 4PHZA 3TIIA 2XC9A 4CKCA 3MR5A 3E89A 4IRDA 5KX5A 2PYLA 1VBHA 5D1PA 2CGNA 5KFMA 3KALA 2LFSA 2ZDIC 4LF6O 3KCYA 3RN4A 5JVDB 3G6BA 4LFAB 4I55F 2HP8A 2ZE5A 4DW1A 2EIJC 3A2FA 3HKDA 4B3RH 1I94O 3RVZA 1NTZH 1YCIA 4O2AA 4DV4H 5CM0A 1UNNC 2EJ0A 3OR7C 4GZRB 4MVSA 4J7ZA 3OTFA 4EGJA 3HOUG 4X1KA 1Y74B 5IYZF 2JJ1G 4DV1H 5DLFA 4DR5H 2V1DA 5B5EZ 4WFBV 1BL8A 5BR8O 3FAVA 4B3RB 5C44G 3RB6A 3BA9A 2J6UA 3HB3B 3VQYA 2ZM6B 5DISC 3RUPA 1XL4A 4FLWA 2WLJA 1SERA 1N4CA 3FFQA 3JCUZ 3GIMA 5CA0B 2X0LA 4JI1H 4Q6GA 2O57A 5BWVA 1GN3A 3BVOA 5LHGA 4DR1H 4I4TA 1TWAA 4BIZA 3SJCC 3CHXA 2XIGA 3C0FB 1HNWH 4DV2O 3RFCA 4R8UB 3V6KA 3QVNA 2HVKC 4E6NA 2CK3G 5DM6V 5IDJA 4IIJF 2Q7HA 1DK1A 1D5AA 4DL6A 1W0KG 4A3KG 4DV6H 5KT3A 1VAJA 1FKAH 1GRJA 3CJHA 3FB6C 4X65H 4RZRA 2WA4A 1WPBA 4I7ZB 3FB8C 1UFIA 3WG7C 2R93A 2WDTA 5KFBA 4DR6B 3U9TA 1WA8A 4HYOA 3RR5A 5KFWA 4X66O 2UXDO 5GONA 5KG1A 5BPFA 5KT7A 1B04A 4I50B 2RJZA 2ABJA 4D7SA 2W6NA 5DMXA 4FK5C 3EPGA 3D3QA 4AQYB 3PZPA 2DOSA 3ZN0A 5LL6b 2LGWA 4ED2A 4RB0A 3BG5A 4A3LG 2XASA 5KT4A 4F4YA 2W6IG 3RYHB 1KMIZ 2W9CA 4MW8A 2EJ3A 4APMA 2Z02A 5KFVA 5BMVA 4LFBH 3CSWA 3JSNA 2IA6A 5EIBC 1CKMA 5JWPA 4BBSG 2C28A 2CAZC 4Q8EA 2B9ZA 1I0HA 3MDSA 3B4SA 4TV9F 4DR3B 3VPDA 1K83A 2UUBH 4GKJO 4LF5H 2VWKA 5FNVB 1P7GA 2HJDA 2BTQB 3T5HA 3JASB 4DL5A 1KD1W 3EVKA 5DQGA 1S97A 4O3NA 1FPOA 1TVKA 1EZVH 4J42A 3BABA 4NKGB 1R6TA 2QR4A 1J5EO 4GKKO 2WLKA 1KEEA 3AK1A 5CA0A 4JV5B 4TWKA 1N33H 2ZIOA 3L71H 4PV1B 4JV0A 1I3QA 4FBUA 1R6KA 5C4XG 4IHJB 4XDKA 3UKMA 1NVPD 1KJ9A 4RU9A 4MVOA 4Q45A 3V6HA 1Z2OX 4IR1A 2FMAA 2NUAB 1DGSA 4TV8B 4ETSA 1DV1A 2NNUA 2Q4PA 2A1HA 2EIKB 4A3FG 2CH7B 3T9AA 1YTFD 4BBRG 3TXQA 3M8AA 5JQGB 4DV1O 2DYRC 3EYYA 3EXAA 4DR5O 1W96A 4IZOA 4AYBA 3LQSA 2QM7A 5KHGA 3G6YA 1Q43A 4JPRA 3OTOB 1N34B 2ETNA 1I2LA 3P30A 2NU6B 1EM1A 4JI1O 1IBLB 5I5YA 3ZHUA 3N42B 3KCXA 1KKDA 5J2UF 5E79Z 3ZMTA 2P22C 5LP6B 4O4IF 4DV2H 1AILA 4DV0O 3W7XA 3BY6A 2V5AA 2W9CB 1JKJB 2CTRA 2UXCB 3JATA 3T4DA 2DZDA 1YITV 3NUAA 4X62B 3JAMN 3PR4A 2HVJC 4RO2A 3A8TA 3CXHF 3ZX6A 1I08A 4WFGA 5TISZ 4JI4B 2GUZA 4NTXA 3JYCA 2VA3A 2GTAA 2BTQA 3T9FA 4DK1A 4YJ3F 4UV9A 5EZYA 5LA6B 1ULZA 1C3OA 1K1SA 4ICGA 1H2MA 4MW3A 1TUBB 4B3MO 3G8CA 1TVKB 1K73W 2VQFB 3RIZA 2R7NA 2LJ2A 3PN1A 4LF9O 2WA3A 1WR2A 3HR0A 1KJJA 2CW7A 1O9HA 2W6OA 4DV7O 1ET0A 1H2GA 1BNCA 5KX5F 3M7MX 3R9RA 4A3DG 3F5WC 4LFBO 1F7YA 1IBLH 2UXBO 1JPXA 1N36H 3J7AU 5BWRA 4I0XA 5LMUH 2E75B 3KTMA 4I55A 2UUBO 4WF9V 4ED1A 4LF5O 3LNMB 2R7ZA 4EFBA 4QIWA 1L2ZA 4WBNF 4X1KB 3APQA 1R3LC 4K6NA 3X2QB 4WFHA 3K9SA 5KFRA 1NS1A 1RJPA 1J5EH 3H0GG 3V4SA 1M1KW 5K3WA 2WLNA 3UQ8A 4CC6A 1GM7A 2YXLA 4DV3O 3W1BA 2P67A 1EHIA 1F4MA 1SQVH 2IU3A 4FFRA 3PW0A 3L73H 4B7EA 1DV2A 4ED0A 3OHBA 1SQGA 4A2BA 2OYQA 4X88A 1AR5A 1MSWD 1M56C 1OCRC 5HBRB 1MABG 5ITZB 2DQ3A 3N40P 3WO0A 3VA7A 2F1MA 2E5LB 2H3OA 4J9PA 2D2CB 4DO2A 3R5XA 1UJWB 2KSDA 4UCVA 1CQIB 1Y1WA 3KREA 3ASOC 4U7CA 3I12A 2XAQA 1KJQA 2Q2UA 5EBWC 5CBHA 2K9PA 4LF4H 2VUMA 4O7WA 4TQSA 2E3CA 1B6SA 3ML0A 3ASOB 2ZQMA 4TOIA 2J9GA 1XNRO 1YI2V 2PUSA 4MV9A 3T9DA 3UYYA 4ZIBA 4JI6H 3T1YO 3UZBA 1I5YA 2VRZA 3CEIA 5CBFA 4J0MA 4DV0H 2ITDC 4DR2H 1AJPA 1AUVA 2ITCC 1V4YA 4DR7H 2Y69B 2FKLA 1U96A 2UXNA 3UCSC 1OHHG 1RFYA 1Q6UA 1ZHQA 5IP7G 1KKCA 1GH6A 4O7SA 4IR9A 4EB6A 3RYHA 2Q5ZA 3QNEA 5EDWA 4MV1A 2PZSA 5I5WA 3SDLA 4QPJA 2HGWA 4FE2A 1AI6A 5KFCA 2YWVA 3W7WA 3N2GB 4DV5B 5KLVH 4GC6A 4FLTA 2ASDA 4O2BA 1M0TA 2UUAH 1GSOA 3AK3A 2YZGA 5CBGA 4TV9A 5FNVA 5LYJF 4JUZA 4LF9H 3E8GA 1S10A 1M57B 5EYPB 2ZDIA 2YCHA 4KL1A 2L6LA 3QZ7A 1OCZC 3RVYA 1I7FA 2W8LA 2Y0SE 4JI1B 1IBLO 2UVVA 2UXBH 5F2VO 4ED7A 2YRXA 1K3EA 5B1BB 1I1MA 4MTGA 4ECQA 1FXKA 3E22A 4RAZA 4GX1A 3ZIAG 4O7RA 1Q81W 3RB4A 4I9WA 2JA5G 1R6NA 1Y76B 4D6TH 1BQZA 2Q69A 4FZ1A 3CC2V 2A3QA 2BOBC 2M6YA 2A0LA 1PP9H 3BA8A 5IP9G 2F93B 1T94A 1S77D 1WP7A 4O4HF 3KHLA 3K08A 2VWJA 4JXUA 3S3XA 3C90A 4DR1B 4B3SO 1GM9A 1S0MA 3OUSA 4JASA 1HR0O 4A3BG 4YR0A 1VEWA 2HVSA 4O7NA 4JYYA 2PGGA 3V6JA 4B3MB 2YRWA 5K1PA 1GM8A 1VQ7V 3D36A 4X1IB 1B33N 2YICA 3FYEB 1JX9A 4ED3A 4UXNA 4NZMA 1XMOH 3A0BZ 5IYBO 2DQ0A 1VQNV 4PD4F 4A5UB 5LHHA 1X9NA 3N44B 3MD0A 2ALZA 3TY5A 4YIPA 4X89A 4O2BB 1HNXB 4H33A 5EK0A 4O4LF 5BZBA 4JI6O 1SQQH 3T1YH 3D36C 4FM2A 4EGQA 3WFVA 4CZZA 2Q2TA 3DC5A 2QYZA 1M0WA 4BY7G 1Q82W 4FLUA 3NBYB 5EZYB 5LA6A 4CH6A 4O2AF 5D1OA 5C5JA 4DR2O 4QWAA 4JI3O 1TUBA 1S68A 1A48A 1OCCC 1IOWA 1PV0A 2EIKC 4XDLA 3N41B 2J6TA 4O7LA 2BQUA 5EOYA 5IYZA 4FFPA 1FXKB 3H1JH 2JDIG 3ETDA 3FMAA 2YC0A 4EQ5A 4H0LB 5I5SA 1EN6A 1EUDB 3UT5B 4F50A 4NTYA 1WN7A 3LMLA 4P9PA 2UUAO 4JI7B 3TXSA 1NKDA 3DTGA 4TUYB 3L70H 3OUZA 4QJFB 1TWHA 4FBTA 4J9ZB 4I4TF 4UFZA 2R7ZG 1N32B 5H5NA 4PA9A 3IC9A 3RJ0A 3D8CA 5LMNH 4J10A 4IRKA 2EJ7A 1VP7A 1KC7A 3KKYA 3MJFA 2O03A 3P32A 4J9SA 5LOVF 3AG3C 5DG7A 3JAKB 3S24A 3D3IA 2IBZH 2DWDC 1DF4A 2IW5A 4DR4B 1EN4A 2V59A 5I5TA 3K0GA 2KSWA 1O75A 4OX9B 3JALB 1GO3E 4RB2C 1TGOA 3RGXA 4E2LA 1WP8A 3S3WA 3L4JA 3HOVG 1L8DA 4JI2O 5KFIA 3HKBB 1OBGA 5L3DA 2P4VA 2JEUA 3BEHA 1VF6A 3ZHSA 3N6XA 1BGWA 1VMGA 2MCTA 2JA6G 2HHFB 1ZQ7A 2JS5A 1N48A 1XNQH 1TAEA 2R70A 3OAAG 4R7CA 5GTIZ 4DLKA 5DAAA 4ECYA 3KAJA 3CC7V 5B1BC 3HKEA 3RWRD 5H9CA 1XMOO 2W6ZA 5DG8A 4DUZB 1E1QG 5DGAA 2QWPB 2JEIA 2OH2A 1Q5OA 5JCOC 1XNQB 5L3EA 1SCUB 4LF7H 2A7WA 4ZOLF 5K1XA 4IAJA 4J11A 2X7RB 5LXTB 4AI8A 3E5NA 2UXXA 1YSCA 2KKWA 3N2GA 3LSUA 2B1IA 1I6UA 1IVSA 1Y74A 4FJCC 4X64O 1Q7YW 2ADQB 3ZHRA 4A3IG 2AGAA 5CE8A 2XD4A 3P3NA 4M0JA 3CC4V 3QWUA 5DGHA 1XI1A 4MSWC 1ZHSA 5CB4A 2XAHA 1IBKO 2DYRB 2W6MA 2N04A 1OCOC 5KFXA 1Y6XA 3RV4A 3H3VH 4UUJC 3SPCA 4MV3A 3NC0B 3JALA 4OGQB 4UCUA 3SYOA 5LMNB 1IXBA 1Z5WA 5KT6A 3HKBA 2XCLA 3KAKA 5KG5A 1L0LH 1AVMA 4BIOA 4MV8A 4XYMB 4X8AA 4CMDA 2R9AA 3CEBA 2FLNA 3RF2A 4F4XA 2FPIB 3AG2B 4DL3A 3SI8A 4WFEA 1PNLA 4K3AA 2Q8VA 4FGRA 1K4CC 4R6ZA 3T1HB 4JI8H 4JZGA 3RYFA 3NGDA 1Y66A 5H6RA 1OCRB 2FL4A 3HKEB 4O7YA 2ASLA 1R1BA 3BFRA 4FS1A 4QE7A 4GLWA 4MVRA 3ICXA 5FLXN 3GTOA 1R3JC 4FLVA 1BGYH 3CSXA 1XQ8A 1XHXA 1B6RA 4JI2H 4G2KA 5BY1A 2XHBA 4O86A 4CC5A 1NT2B 2JA5A 3G6XA 1M6VA 1VBGA 1YVWA 4F6RA 1QR8A 3FKIA 2H94A 4UCSA 4EFEA 2EIMC 2QM8A 4RWUA 3HXLA 3U10A 2WAQE 3K3WA 2WAQA 4A3MG 2Z5UA 1MNGA 2W0XA 3GQCA 5JH7F 3JD4A 4B7KA 5D1OB 4ZHQB 4KFMA 2QJ1A 3T7AA 3RFRA 3TY9A 5CA1A 3O65A 1R3KC 2B5UA 2KG7B 1PKXA 4LF7O 4CE5A 2R92A 2HDKA 3DF7A 4D7TA 4MT8A 3WG7B 1JMKC 4NZOA 3JAMW 4TV8A 1IYEA 1RPOA 2WLIA 1PX2A 3KYHC 1XOUA 3RYCB 4W4KA 3K59A 2M7WA 2W8KA 4TUYA 4QE9A 2R8JA 1T3NA 1OV9A 4IGGA 1VQ8V 3CRMA 4BY1G 3JCZA 1IBMO 4ECXA 3DSQA 4ZI7B 3JD3A 2R7KA 1GYFA 4DL2A 2EZPA 2Q73A 2ILMA 5D5QA 2YZNA 5DLGA 2Q6AA 2QTOA 2EIMB 5KHJA 1VQLV 3HPLC 1DLBA 3VOTA 4O3OA 3WB0A 1KP2A 1Z5VA 2WLLB 3HBLA 2UUCO 1J95A 1AB3A 3AYHB 3SPJA 2ODTX 3GTGA 4PA3A 3T4ZA 1JJOA 5BR8B 1M93A 1SYXB 4RAYA 4LFBB 1MZBA 4EBCA 4UVAA 5EBMC 4LSXA 1BQ0A 3CCUV 4O81A 1JVMA 3CCRV 4ECTA 3OUUA 5FD5A 4JI8O 3BCCH 2CDYA 2A9HA 4DL7A 1HDJA 3AG2C 2YXHA 5J2TB 3GVMA 4Q20A 4YR3A 3Q8PB 2YIDA 3K0DA 5FL7G 3QFFA 3ABMB 2YZLA 3K04A 1L0NH 1PM9A 2KG7A 2RNBA 2QSAA 4PA6A 4OPAA 5IWAO 3SGIA 5K2MA 2A79B 2NVYA 1BE3H 2LO1A 4JAAA 3LDDA 2HVRA 1KJIA 3W7UA 1KB9F 5AG2A 2VA2A 1ZETA 2Y0PA 2HFEC 3T2MA 3IN5A 4I0XB 1CPYA 3RGBA 4ZOLA 2L35A 4I55B 3EHBB 2VQEO 1SRYA 4J9YB 5KG4A 3DC6A 1MZFA 3ZRWB 3N8DA 3GTKA 3CB2A 4MA5A 1AI7A 1EFRG 1QLNA 1CQJB 1YJ9V 4JI5O 1X4TA 1V9PA 3E35A 4KHPB 4MTOA 3J80N 5H6QA 3PW7A 5CB4B 2W6QA 3VPBA 1A3GA 2R8GA 3T1YB 1VQKV 4WFFA 2CE4A 3ETHA 4YJ2F 4PI2A 4YXWG 5KFYA 1K7DA 3K5LA 3HKZA 2DABA 1ZAUA 4NLGA 2DYSC 3HKZE 5ITZA 3O9OA 3RT3C 4QGPA 1FS0G 5C8YA 3AG1B 2DPJA 3QTCA 1SS3A 3PR5B 1Q6HA 2HGXA 2ATKC 2BTOA 1VF7A 3UO2A 1Y67A 1JQ0A 1P8LA 3PW2A 1KQSU 3Q8QB 2DWCA 2IJIA 4G3IA 4XBFA 5LGTA 4LCUC 4CH3A 5D8DA 1S9FA 1AJNA 3ASNB 2BOCC 2ADPA 2ZE7A 1FJGB 1KU9A 2DE0X 3GIQA 1YF2A 1NR7A 3JRWA 2XT9A 5BXZA 2BCCH 3MWMA 4L8JA 5KFTA 4NXNO 3VQWA 2HKOA 5EWFA 4ED6A 3K3VA 2XOKG 2ZJTA 5KFKA 1XMQH 1QR9A 3Q4HA 1XREA 2FB5A 4JF3A 2UU9B 1JDEA 1VF5B 4LF8H 5KFDA 4UV8A 3MWDA 4J9RA 1JFFA 4JI0B 5DN6G 2RDIA 3JD1A 2ZXWC 3ZCCA 1RYRA 5KFPA 4LF7B 1P84F 4FZ0A 3OMAB 1Z2NX 4CMFA 1YDXA 4BR6A 5EC2C 3B2EE 4PA7A 1SQPH 3TY8A 1JOYA 4MVUA 1G4YB 2Z0AA 3IFXA 2W9BB 2X6CA 2DYSB 4DV7B 2OCCB 2YIBA 1YHQV 3C3TA 3W7TA 1KUTA 4QWEA 3EPIA 5LP6C 3HKCB 2YUAA 4TQRA 3JZFA 3GIJA 2RGRA 2YEVB 1I7LA 5BPHA 4IL6Z 4TQFA 1JXLA 2CZGA 1RPRA 3CMEV 4HNTA 1K9MW 2FYUH 5JH7A 3SJQC 3DXRA 5LHIA 2M05A 4IYIA 1SC5B 2XUMA 2WE6A 4FFMA 2JIZG 5CA1B 3LNNA 2HJWA 1QQCA 4QWDA 2OIGA 4FLYA 1NH2B 1YTFB 3PW4A 2CQYA 3E22B 4DV5O 5L3CA 4LWSB 5IT9N 4U3JB 2RF4A 3G80A 5JJEB 3AW8A 2HHHH 1Z2GA 1CKNB 3HOXG 3ZHVA 2UUCB 2UVWA 2CGOA 2DN9A 1S72V 4DR4H 4LF9B 1OCCB 4PA4A 5KT2A 2ZE6A 1VQOV 3CRAA 4GLXA 1YIJV 1N0NA 4YHHO 1GN4A 2HHHB 3ABMC 1HP8A 2RCVA 4O4JA 3GV5B 3SYAA 1S76D 4K0KO 3F7YC 4RUEA 1BHAA 4Q0YA 5GONB 3N2KA 3ZMZA 1Z2PX 4TM5A 4ECRA 2Q7GA 4MVZA 1UC9A 1KJ8A 2XCAA 2GSMB 1OCOB 5I5XA 2UU9H 5C1PA 3RAXA 4C7UA 3U55A 1P7BA 2VR1A 2WLLA 1FFXA 3GWOA 2Y0IA 2R93G 2IU0A 4RQFA 2BQRA 4DL4A 1QLEC 5IJ0A 2QEXV 1I1LA 4J41A 4DV3B 4YY3H 1PNMA 2COIA 5BMVB 5DEDA 3NR7A 2Y4TA 2LGQA 4OPHA 2HJFC 1TA8A 4NTWA 5KUMA 2C35B 1KP3A 1Y1VA 2EIYA 5IYCG 3GILA 2XCPA 1QNMA 2GV9A 1EYZA 1UPGA 2WYOA 1XMQO 3JAWA 3CRQA 1FXVA 2E2IA 1YJWV 3M4IA 4F4ZA 1F23A 1XDCA 4RCNA 3ABKB 3KHHA 3T1HH 4RNMA 1H2NA 3IJ4A 2DIKA 4FFNA 1DF5A 4LF6H 1CKNA 4EEYA 2PVPA 4B3TH 2HIXA 2ZM6O 1I1KA 4O3PA 2CH7A 5CMUA 1QHTA 4DQNA 3GWKC 5JQGA 4ASUG 1I94H 2DWEC 2C22A 1LUWA 3E8BA 3ZRWA 3ABLB 1GTOA 2XGQA 2IP4A 1F51A 4O4JB 5IY5C 2Q0AA 3RW0A 2QB5A 4RNNA 2F4VB 1FYJA 4IIJB 5D5PA 4PZ8A 3GIIA 2YS8A 3K57A 1ZTEA 2PF4E 2C2RA 1FJGO 2YIAA 4NYEA 2LP7A 3TCUA 4FM9A 3JAKA 4LFCH 2CFMA 1E79G 4DUYH 5KG7A 4E4EA 3I5DA 1ZSPA 4EYIB 4EBDA 2OT5A 1FD9A 3BHPA 2K1EA 1VQ9V 5A9GA 2GPWA 3SR2C 1N36B 2ZR2A 2V4RA 4JTAB 2V7QG 3QQMA 3J81N 1RSOA 3BQ0A 2CW8A 4DR6O 4DR1O 2NU7B 2WLMA 2Y69C 3JATB 4Z1MG 4JI0O 4ECSA 1S0OA 1D2DA 1XILA 5KMGA 5C8YB 3CRCA 1I94B 1GN2A 2GLTA 4O3RA 2WWWA 1VKZA 4YHHH 1NJIW 4RAIA 1NZ6A 3CCLV 2JEXA 4DV6O 5CA3A 4K0KH 3JD2A 2HHFA 2IJKA 2FTKA 3JAWB 3I4NG 4RB3C 5EBLC 4B3RO 1K1QA 3M9MB 1G2WA 4DV4O 1GKFA 2SCUB 2CTPA 5FJ8G 1M90W 5L1IA 4RNOA 1XL6A 1SQXH 2NU8B 3MR3A 5FR9A 5JUMA 4LR3A 2Y0SA 3ABUA 4ED8A 2AGPA 4BW9A 3UZOA 4EBEA 2JGDA 3SYPA 4QW9A 4MAMA 5L9XA 1JFFB 4JI4O 2DAAA 4JAUA 3K5NA 2F43G 2ZNJA 4DV2B 4JAVA 3APOA 3Q2OA 5JVDF 1S0VA 1W93A 3H9VA 3CS5A 4X1YA 1SESA 1KBLA 3UM7A 5T14A 1GN6A 3WNZA 4LP8A 3OGCC 3CCEV 4JYAB 2FLPA 3A0RA 2MW2B 1PK8A 4N21A 4IWYA 5KHKA 4YQWA 4JV2A 3LWBA 4TV8F 4UB8Z 2HR3A 1HNWO 1ORQC 1ZX3A 1M56B 2LFRA 1PL0A 4CS3A 3UFXB 1AI4A 2EULA 5DQIA 4IIJA 3JARB 4PBCA 1K92A 4U7OA 1K97A 5FLXW 3QO5A 1EN5A 4X66B 3T1HO 2IMWP 3DXRB 3AG4B 3TJTA 4X20B 3MFHA 2N05A 3CCJV 1BCCH 4AQYH 5KFEA 4X65O 4B3TO 1SEIA 3H20A 4GKJB 3R5HA 5KFAA 3LSSA 2OWOA 2QWNB 4WFAV 2DPIA 4LWSA 3OW2U 4LNUB 2EZOA 3OEEG 1YZBA 2UXDH 4JI3B 5IYDG 3ZMSA 3L75H 5L3BA 2ZDGA 5J2UB 2YIBD 1FAFA 3CD6V 5LP6F 4NB5A 4JV5O 4O4IB 2Q0OC 2B1GA 5KKNB 4P2ZA 2ARHA 1HNZO 4L87A 4HYKA 1RK5A 3M9OB 4A93G 4PZ6A 3H1LH 3LDCA 3CCMV 1LR1A 1V51A 1I50A 4LFCO 2C2AA 4DUYO 2BSKA 1VQ5V 3ABLC 2XTAA 1WSCA 3HOWG 1QU7A 3N2KB 3ORRA 3L9DA 1KC8W 3CXCU 4DIMA 2ODMA 1JA8A 2LW7A 4I9QA 4I50F 4GKJH 3QZ8A 2UVUA 4DR6H 4YAJB 1G6UA 2R7LA 4JI0H 4CBCA 1JJ2U 3IAYA 1V55B 3HT5A 4EB6B 3B09A 4Q4DA 1H2SB 1PPJH 1QCEA 4F6RB 3ZEDA 2V58A 2E2HA 4GKKH 1US6A 4JTDB 1N33O 4JZ2A 4LH7A 1NI8A 1AUXA 2VPSA 5KX5B 4B08A 3KXYT 3G6EV 4O2BF 1H8HG 4GX5A 1JCHA 2CKZB 4TV9B 3CMAV 3JARA 4LF8B 3SPGA 3VMMA 4NYKA 4Q4CA 1CKOA 3LSQA 4IWXA 3A0HZ 2RN9A 5LYJA 3H1IH 4GX0A 1E4FT 4Z1VA 3GIDA 4JYCA 3DTFA 5LGNA 3PFFA 4JI2B 4ZKIA 3LP8A 2R8KA 5EYPA 4B3MH 4O2AB 1SA0B 2W57A 4WCEV 2LQTA 2ATLA 2HG8A 5KHHA 4JI4H 4WBNB 3NBZB 5I60A 3VNNA 3VPCA 5I5UA 2C2EA 1E4GT 3N6RA 2OLSA 1SQFA 2F95B 4DV7H 1OZ0A 3AG4C 3E8FA 1RJQA 4IHJF 1H8EG 2UXCH 2AZ0A 2NVXA 2IH3C 1N36O 1Y76A 2AW9A 3L72H 5DGIA 1IBKB 1K5QA 3RYCA 2ZCEA 1BT8A 3WB2A 1KBHA 5C1OA 3GIKA 3THOA 3ZMUA 1XMOB 2P0AA 4C5BA 3K5MA 4DV1B 2FMLA 1SZXA 1KUQA 2YZMA 1YXBA 4JI8B 2UXBB 4ZI7A 4A3EG 4K35A 4F6EA 2Z3YA 3QO7A 4E4TA 2F23A 4IT5A 4AQYO 4C2MA 4J9KA 2VQFH 3R23A 1I7NA 3AX6A 3T54A 4Q43A 4J9OA 3QG5A 3TQTA 4Q44A 5LOVB 2R9RB 4DV4B 4X1IA 1XBLA 5BWUA 5HFMA 3H1HH 1EBOA 2Q9LA 1ZUQA 4TSFG 2JK5C 2FE3A 2ZKOA 2NLJC 1W0JG 5BYBA 2NR5A 1SF9A 1RSOB 4H44B 4JV5H 3ZHTA 1IBMB 3E86A 4J9NA 4QIWE 1HNZH 1CXZB 5H80A 3RB3A 4DXWA 1YEWA 3F5TA 2W7PA 2AQ4A 1HR0B 1V54B 1EKVA 2PYJA 4LMYA 4GT1A 4HN2A 4LF4O 3ETJA 4PDLA 2E74B 4YJ3B 5LMUO 1DIKA 4RZQA 2FK2A 3OD4A 5FD6A 1XNRH 4ABMA 4HNVA 2OCCC 3WWIA 5CN0A 4BW5A 5IYZB 3T5KA 1TWFA 2IBKA 4DR7O 2JGDB 1RJRA 2BQ3A 3OFNG 5CR5A 3JASA 3GTPA 1WRVA 4YY3B 4DV3H 2JEGA 4MTDA 4IRCA 3ZRSA 4LSAA 4MV4A 2PY5A 4ZOLB 5CA0F 1K5SA 4H13B 4LF5B 3MAQA 1VQMV 4OXSA 2V4QA 1MZEA 3G4SV 1I2KA 1Y14B 5JQWA 1XNRB 3OSPA 3K79A 3ZRXA 4HR7A 2ZIMA 4FFBA 4PI0A 5GW7A 3G67A 4UVBA 1AR1B 2EIJB 2VQDA 3LUTB 1S03G 2D3OW 4HQ6A 2R72A 4HNAA 3STZC 2UXCO 4DW0A 4J80A 3T99A 3AG1C 4R7RA 3OEHG 4Q8FA 1NVPB 3GTQA 2B63G 4UB6Z 4LNUA 4EG0A 3CWBH 4HBNA 3NXSA 3OMIB 3WB1A 3GIPA 2JVDA 4BWSC 3BRCA 4MTXA 3BACA 2FPGB 4XYLB 4CKBA 4O82A 5FPRA 5KFFA 4O4IA 5IYDO 1TUEB 1N33B 4JI7H 2WAMA 2JA6A 1N8RW 2VQFO 3SYQA 4NXMB 3OT7A 3T9BA 4HZ3A 3E83A 2Q67A 1QVGU 4YP3A 2VPQA 2FLLA 4PWQA 2P4KA 1HR0H 1G8MA 4O4LB 1ENVA 2PN1A 3MHSC 1S0NA 5FNVF 3Q4HB 4JI6B 3SJBC 2W6PA 1DTOA 2R6FA 5E1AC 5KG3A 1OWTA 3KHRA 5EZYF 3P3PA 2FKXA 2ZNIA 1A0GA 5C93A 4ZBMA 1AJQA 3OR6C 1AROP 3TGUH 2OTJV 4Y8VB 4N23A 1A0IA 3W5OA 1R73A 2YSUB 3SPIA 2EINC 3H4DA 3FKIG 3EFFK 5KFHA 1X59A 3H4BA 4PZ7A 2PI4A 3VQXA 1EZJA 3TETA 4QSHA 5KFNA 3FD9A 3CE2A 3HKCA 3CVZA 4UCOA 2W9AA 1PNKA 2Q7EA 3K58A 4TT3G 4FLZA 4QWBA 4DYLA 4L1KA 3TW6A 3ZHQA 5JQGF 1Q8IA 5LYJB 4LFAH 4Z2WA 4NVPA 5JH7B 3Q8SB 1H2KA 4PJ0Z 1SA0A 4FFOA 1WCMA 3IGAC 2BE3A 2EJ2A 3RV3A 1AR4A 3OTOH 4WBNA 1N34H 4O4HA 4FFKA 5B66Z 5B3SB 2W7OA 1K8AW 1BMFG 2QWQB 4MTEA 4DRFA 5HFLA 5KFJA 4PDVA 3SJAC 3I55V 4B3SH 3GTLA 3BPZA 4EEQA 2R92G 1RYSA 4K8XA 3JRXA 5KFOA 3ZN1A 3QO8A 5KA6A 2IH1C 1ROPA 2FP4B 3W1GA 2AXTZ 1LUVA 2IJJA 4CKEA 4DRXB 3TEKA 4LH6A 4U3FH 3J7AK 4ME6A 2G38A 1IXMA 5LMNO 3TK1A 1GGOA 3TW7A 4B3SB 2YS6A 4ZI7F 1BXRA 3K3PA 1BJTA 1B3QA 5EIBD 3N27A 3UO3A 5LOVA 1BS3A 1SKVA 5LA6F 2GPSA 1S5JA 1N32O 5KFGA 1H2LA 2QF7A 4QWCA 4JI3H 4JI5B 5A2QW 2WSSG 1T36A 3GB8B 4I7HA 1V54C 1R9TA 3ORQA 2UUAB 3IG0A 3ASNC 4JI7O 4UVCA 3WU2Z 5B3SC 2VUMG 1H38A 2Q7DA 4BXXG 1RK6A 4EKWA 2YI9A 2EJRA 3CX5F 1WAZA 1Y4MA 5JVDA 4MVQA 3U11A 1TWGA 5BWTA 2N74A 5LXTF 2CNQA 1GSHA 3HKDB 4ZHQA 4O7TA 2WB1E 1IX9A 5JVLA 2PMZE 3H01A 3RBZA 2WB1A 3GLKA 5J2TF 4U6PA 3ZBHA 3HO8A 2WLHA 3LULA 3J81W 2AGOA 2KQXA 2EINB 2ZDHA 1K4DC 2P6JA 3CCSV 1GLVA 2AU0A 1P49A 5EWEA 1N56A 3CP1A 2WLIB 4X62O 3H0GA 2COGA 3MR6A 1HW7A 3FDSA 3HOYG 4U7NA 3R65A 2Z04A 1N0JA 4TUYF 2NN4A 1G1XB 3JZIA 2P7TC 4LFAO 1KECA 4FVMA 1NR1A 4I4TB 2PBZA 4X64H 3KG2A 1AP6A 3OE7G 3B40A 4R8UA 1IYDA 2C00A 3CQZA 1GSAA 3OTOO 1N34O 3MWEA 4A3GG 3SNOA 1IZ3A 3SE7A 2FB9A 2HGSA 5KFSA 4WD3A 4DUZO 2JGUA 3ZRVA 2I8CA 3ETGA 2XAGA 2R86A 1XNQO 3G6VA 3L4KA 1KT8A 4CHIA 2AHYA 1PD3A 4QNHB 1EUCB 1OJHA 1WA8B 3FKSG 1R3IC 1Q90D 4TQDA 2ZDQA 4GC7A 2FJZA 4CS2A 1IDSA 4I50A 2OIEA 4YB8B 4FU0A 5FLMG 4BWAA 4FS2A 3T9EA 3E2EA 4JYAO 3BQ1A 3KZIZ 5KAIZ 4RUFA 1VS0A 1J5EB 2X6BA 2PTMA 3K5IA 2FPPB 3B77A 1XDNA 2GBOA 3ZMVA 1RM1B 4RUCA 1SZTA 2JEFA 4O4LA 1NBMG 1GAXA 1N32H 4QPKA 2HLDG 1E1RG 1W2BU 4ZQIA 4MTFA 3DTUB 4P9OA 4XZ3B 2ZT9B 3PO2G 4X65B 4YHHB 4XDJA 4DV6B 4DR5B 2E5LO 1IBKH 4K0KB 1NTKH 2PI5A 2P90A 4X1YB 5KAFZ 3MFIA 2R9IA 5L1KA 4RQEA 2GQSA 4CH4A 3FB7C 4TVIA 5E25A 1WCMG 4YR2A 4J9LA 5B1AB 4NR1A 4F4WA 2LW1A 4IHJA 2X5RA 1VQPV 2R8IA 1E4EB 2QDOA 5DG9A 3CYOA 1HNZB 2COJA 3ABKC 1P16A 4K8ZA 3FB5C 2X6AA 5HV6A 3ETQA 1JIHA 5J9PC 4GCZA 2V9WA 4DUYB 4DR3O 3AEIA 1S5LZ 4H37A 4OX9O 4X20A 1DAAA 1P4RA 3HOZG 1EKPA 3AG3B 2R84A 4O4HB 4AILC 5CA1F 4X62H 2VOBA 5KFUA 2F4VO 2P06A 3RBEA 4GKKB 1XMQB 2W0FC 1L1FA 5I47A 3OUFA 1JDBB 4HAMA 3U9SA 1JX4A 3JSLA 1ZWIC 1QVFU 4ECZA 5EC1C 3U54A 2CNUA 5EWGA 2HG5C 4DUZH 3STLC 2GTSA 4R8CA 1S3JA 5KFLA 1D5NA 2BSKB 3I4MG 1LNQA 4NZNA 3FX7A 5IJ9A 2GQRA 4UUGA 2JEJA 2GUZB 5GONF 5IYCO 2Y4RA 5B1OA 5BWWA 1XK5A 1VQ6V 5GTHZ 4CS4A 3TQ1A 3VQVA 3C3SA 5LBQA 1FXKC 2QA4V 4JYAH 3GV7B 3ZS8C 2W9BA 3K06A 3U0GA 5IWAB 5KFQA 4DV0B 5BMVF 2P5OA 1NH2D 2I80A 1GMGA 4GUNA 4J7JA 4KXRA 5HNEA 3Q8RB 2ZGIA 4P30A 2YEVA 3AK2A 5KT5A 5KHIA 3LDEA 4AYBE 2QKSA 4FMTA 3RYIB 1CS0A 5IE9A 5LXTA 3M9NB 5FPOA 4ZHQF 2WTFA 2DW4A 1C30A 4JV1A 1BZKA 1IBMH 4YIOA 2R85A 1XHZA 3VOUA 1BSMA 2OTLV 5IWAH 2E5LH 2Q68A 2R8HA 3RGZA 3BJYA 4U3JA 4MV7A 5KS8A 2QM4A 2QKCA 4O7ZA 5CB4F 5F9NA 1PL4A 2EILC 2HEPA 2RQ6A 1Q6IA 3M99B 3ZJZA 5KA5A 5L1JA 4YJ2B 2FK1A 2JJ2G 5KG0A 1KYOF 2KB1A 1ZL8B
chains in the Genus database with same CATH topology
2UUCH 4EFBA 3L2PA 1L2ZA 4JV5H 1IBMB 4X1KB 2UUBB 4DR3H 1HNZH 4OX9H 4JI5H 1YEWA 3SGIA 3N43B 1HR0B 1J5EH 5LMUB 5JJJB 3UQ8A 2HVRA 4CC6A 2YXLA 1AN7A 4AHCA 2F66C 2HIVA 3W1BA 2PYJA 4LMYA 2F4VH 3RGBA 3F8NA 4ZOLA 4UCTA 4YJ3B 4RZQA 4I55B 1FFXB 5FD6A 1SQGA 1WNSA 1HNWB 1XNRH 4A2BA 2OYQA 5IJ0B 3RYFB 5ITZB 3CB2A 3N40P 4NXNB 4UCRA 2F1MA 5IYZB 2VQEB 2E5LB 1X4TA 1V9PA 4KHPB 4B3TB 3JASA 1Q3EA 4UCVA 5CB4B 4YY3B 4DV3H 3RTXA 4MTDA 3T1YB 2Q2UA 4LSAA 4LF4H 4PI2A 2PY5A 4KHPH 4YJ3A 4ZOLB 2E3CA 3RYIA 3K5LA 2EX3A 2VQEH 1M5IA 1ZAUA 4TOIA 4LF5B 3MAQA 2PUSA 4MV9A 4JI6H 4ZIBA 4RB1A 3K5OA 5ITZA 5C8YA 4J0MA 4DV0H 3QTCA 4DR2H 1XNRB 4DR7H 2BTOA 4PDBA 1ZHQA 4LFCB 2ZIMA 4FFBA 5JJNB 4PI0A 1VF7A 4YJ2A 1P8LA 5JCOA 4EB6A 3RYHA 1S03G 2R72A 4HNAA 4CH3A 4LF6B 2PZSA 1FJGB 1KU9A 4R7RA 1O9GA 3N2GB 4DV5B 3MWMA 4L8JA 4FLTA 4O2BA 3VQWA 1M0TA 4LNUA 2UUAH 4HBNA 3K3VA 2ZJTA 1XMQH 4FLXA 3WB1A 4BWSC 2JVDA 3BRCA 2RGVA 2UU9B 4TV9A 5FNVA 4A2AA 4LF8H 4LF9H 1T5EA 1JFFA 5FPRA 4JI0B 4O4IA 1N33B 4FFBB 4JI7H 4LF7B 2YCHA 5EYPB 4KL1A 1Z2NX 4HNAB 1I7FA 4NXMB 3B2EE 3TY8A 3J80W 4JI1B 2UXBH 4DV5H 4DV7B 2YIBA 3E22A 1HR0H 4O4LB 4RAZA 5KMGB 4NXNH 4NXMH 2V4DA 5LP6C 3HKCB 4JI6B 3SJBC 2RGRA 4TQFA 2ZNIA 4X64B 5JH7A 4GYCB 3BA8A 2F93B 1M4UA 1A0IA 2WE6A 2IM9A 3W5OA 5CA1B 3LNNA 1QQCA 4CH5A 4FLYA 2VWJA 4PZ7A 4DR1B 3E22B 3VQXA 4U3JB 5IJ9B 5JJEB 3HKCA 2HVSA 1CKNB 2PGGA 4UCOA 3CVZA 2HHHH 2Q7EA 3K58A 4FLZA 2UUCB 5K1PA 4B3MB 4X1IB 1FVIA 4LF4B 1Q8IA 5LYJB 4LF9B 4DR4H 4LFAH 2UXDB 4NVPA 5JH7B 1XMOH 5J2TA 1SA0A 1X9NA 4GLXA 3OTOH 4WBNA 3N44B 1N34H 4O4HA 5BR8H 2HHHB 2VUGA 4O4JA 3TY5A 4MTEA 4DRFA 4DR7B 4O2BB 3SJAC 1HNXB 4B3SH 3BPZA 4EEQA 5GONB 4Q0YA 3N2KA 1Z2PX 2ZINA 4K8XA 1WH2A 2Q7GA 3T1YH 4FM2A 2Q2TA 3UT5A 2UU9H 1M0WA 4FLUA 3NBYB 5EZYB 5LA6A 4CH6A 5D1OA 3W1GA 3QF7A 1FFXA 1TUBA 3U0ZA 3GJXB 1S68A 4M7EA 4DRXB 5IJ0A 4LH6A 4FM1A 3N41B 3J7AK 4DV3B 4YY3H 5BMVB 5EOYA 5IYZA 4DR2B 4B3SB 3FMAA 1TA8A 1BJTA 5EIBD 4EQ5A 5J2UA 4FM0A 5LOVA 2ZM6H 1SKVA 3UT5B 2GV9A 2HVQA 1WN7A 3LMLA 2WYOA 4DK0A 5LP6A 1S5JA 4JI7B 3JAWA 4X66H 5IT9W 4TUYB 4JI3H 4JI5B 4DRXA 5A2QW 3M4IA 3GB8B 4I7HA 2UUAB 2YI8A 4UFZA 3IG0A 1N32B 3BAAA 3RJ0A 3T1HH 5LMNH 2O03A 2YI9A 4LF6H 1CKNA 1FJGH 4B3TH 3GDEA 2HIXA 3JAKB 5JVDA 3S24A 3U11A 1HNXH 1QHTA 5JQGA 1I94H 4DR4B 3HKDB 4ZHQA 2KSWA 1O75A 4OX9B 3JALB 4RB2C 1TGOA 3RGXA 4PHZA 3L4JA 4O4JB 3J81W 1L8DA 2Q0AA 3HKBB 5KX5A 2F4VB 2PYLA 4IIJB 5D5PA 4PZ8A 5D1PA 3KALA 3K57A 1P49A 3N6XA 4FM9A 2YIAA 1BGWA 3JAKA 5JVDB 4LFCH 2MCTA 2CFMA 4DUYH 4LFAB 2JS5A 3BHPA 3A2FA 3HKDA 1HW7A 1TAEA 2R70A 1XNQH 4B3RH 4O2AA 3SR2C 1N36B 4DV4H 1RSOA 2CW8A 3KAJA 3OTFA 3JATB 3HKEA 4X1KA 4FVMA 3RWRD 4I4TB 5KMGA 5C8YB 1I94B 4X64H 4DUZB 4DV1H 4DR5H 4YHHH 1Q5OA 5JCOC 1XNQB 4B3RB 2HGSA 3BA9A 3VQYA 4K0KH 2ZM6B 2JGUA 4LF7H 5DISC 4FLWA 5K1XA 4IAJA 3JAWB 4RB3C 5LXTB 3FFQA 5CA0B 3L4KA 4JI1H 4Q6GA 2KKWA 3N2GA 4DR1H 1I6UA 4I4TA 4TQDA 4LR3A 3SJCC 3CHXA 2XIGA 3C0FB 1HNWH 4CS2A 4I50A 4BW9A 3QWUA 4E6NA 1XI1A 4BWAA 1JFFB 1ZHSA 5CB4A 2Q7HA 1D5AA 3K5NA 4DV6H 2ZNJA 4DV2B 4X1YA 1FKAH 1VS0A 1J5EB 4X65H 1WPBA 3NC0B 4JYAB 2PTMA 3JALA 4UCUA 2WDTA 5LMNB 1XDNA 4DR6B 1Z5WA 1N32H 5KHKA 3RR5A 4O4LA 5GONA 3HKBA 3KAKA 1B04A 4I50B 2RJZA 4D7SA 4CS3A 4AQYB 4IIJA 3JARB 5LL6b 4X65B 5FLXW 2R9AA 4YHHB 4X66B 4RB0A 3RF2A 4DV6B 4DR5B 1IBKH 3RYHB 4K0KB 1KMIZ 4X1YB 4X20B 4AQYH 1SEIA 3H20A 4APMA 4CH4A 4GKJB 3T1HB 5BMVA 2OWOA 4LFBH 3JSNA 3RYFA 5EIBC 4JI8H 1CKMA 4IHJA 2CAZC 3HKEB 4LNUB 2UXDH 4DR3B 4JI3B 1HNZB 2UUBH 3ICXA 5J2UB 2VWKA 2YIBD 5FNVB 4FLVA 4K8ZA 1P16A 4LF5H 3CSXA 2BTQB 1XQ8A 1XHXA 3ETQA 3JASB 4O4IB 4JI2H 2XHBA 4CC5A 4DUYB 1NT2B 4X20A 4PZ6A 1TVKA 4F6RA 3BABA 4UCSA 4O4HB 5CA0A 4EFEA 4AILC 4JV5B 1N33H 2ZIOA 4X62H 2VOBA 4IHJB 3HXLA 3U10A 4GKKB 3N2KB 1XMQB 1Z2OX 1DGSA 4TV8B 4GKJH 4I9QA 4ETSA 4DR6H 1G6UA 4JI0H 5JQGB 5D1OB 3IAYA 4ZHQB 3EYYA 4EB6B 3JSLA 2QJ1A 1H2SB 3RFRA 3TY9A 4F6RB 3ZEDA 5CA1A 4GKKH 4DUZH 5KHGA 1Q43A 4LH7A 3DF7A 2VPSA 4D7TA 5KX5B 4B08A 3OTOB 1N34B 3KXYT 1JMKC 5IJ9A 3JAMW 1IBLB 4TV8A 4TV9B 1XK5A 3JARA 4LF8B 3N42B 3KYHC 3RYCB 1CKOA 4CS4A 5LYJA 1E4FT 3K59A 5LP6B 2P22C 4JI2B 4DV2H 5EYPA 4B3MH 4TUYA 4O2AB 3VQVA 1SA0B 2W57A 5KHHA 2UXCB 4WBNB 4JI4H 3NBZB 4JYAH 3VNNA 3JATA 3ZS8C 1E4GT 1SQFA 3DSQA 2F95B 4ZI7B 4X62B 5IWAB 4DV7H 4DV0B 1GYFA 2P5OA 5D5QA 4JI4B 2UXCH 5KHJA 1IBKB 5KHIA 2BTQA 3RYCA 4DK1A 2ZCEA 3WB2A 5EZYA 5LA6B 3WB0A 1Z5VA 3THOA 3RYIB 1XMOB 5LXTA 1TUBB 3K5MA 4DV1B 5FPOA 1TVKB 2VQFB 3RIZA 1JJOA 5BR8B 3PN1A 1M93A 1SYXB 4RAYA 1IBMH 4LFBB 1MZBA 2CW7A 1O9HA 4JI8B 2UXBB 1XHZA 2E5LH 4ZI7A 5IWAH 4LSXA 3RGZA 4U3JA 4MV7A 2QM4A 2VQFH 3M7MX 3QG5A 5FD5A 2HEPA 2RQ6A 5LOVB 1IBLH 4DV4B 4X1IA 1N36H 4YJ2B 5LMUH 2FE3A 4I55A 5J2TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 B;  4JI6 B;  4OX9 B;  1P16 A;  4EFB A;  3L2P A;  1IBM B;  2UUB B;  4X64 B;  4CC5 A;  4DUY B;  3BA8 A;  3SGI A;  2F4V B;  4PZ6 A;  1HR0 B;  3BAB A;  1A0I A;  4PZ8 A;  5D1P A;  5LMU B;  3W5O A;  4UCS A;  3UQ8 A;  2HVR A;  4CC6 A;  4EFE A;  4JV5 B;  2HIV A;  3W1B A;  2CFM A;  4PZ7 A;  4DR1 B;  4LFA B;  4UCT A;  4GKK B;  1TAE A;  1XMQ B;  2HVS A;  1CKN B;  4UCO A;  1HNW B;  1DGS A;  1N36 B;  4B3M B;  2UUC B;  1FVI A;  4LF4 B;  4NXN B;  4LF9 B;  4UCR A;  2UXD B;  5D1O B;  1I94 B;  2VQE B;  4DUZ B;  3JSL A;  2E5L B;  3TY9 A;  1V9P A;  4KHP B;  1X9N A;  4GLX A;  1XNQ B;  4B3T B;  4B3R B;  2HHH B;  4UCV A;  3BA9 A;  4YY3 B;  2VUG A;  3RTX A;  3TY5 A;  4LH7 A;  2ZM6 B;  3T1Y B;  4DRF A;  2Q2U A;  4DR7 B;  5DIS C;  1HNX B;  3OTO B;  1N34 B;  4EEQ A;  1IBL B;  1ZAU A;  4TOI A;  4LF5 B;  1XK5 A;  4LF8 B;  2Q2T A;  3KYH C;  1CKO A;  3NBY B;  5D1O A;  4JI2 B;  3W1G A;  3GJX B;  1XNR B;  1S68 A;  2UXC B;  3QWU A;  4DR3 B;  3NBZ B;  4LH6 A;  4E6N A;  3VNN A;  4DV3 B;  4LFC B;  4DR2 B;  4X62 B;  5IWA B;  1P8L A;  4DV0 B;  4DV2 B;  4B3S B;  1TA8 A;  1VS0 A;  1J5E B;  4LF6 B;  4JI4 B;  3NC0 B;  1FJG B;  4JYA B;  4EQ5 A;  4UCU A;  5LMN B;  1IBK B;  1XDN A;  4DV5 B;  2HVQ A;  4DR6 B;  3RR5 A;  4JI7 B;  1XMO B;  1B04 A;  4DV1 B;  5FPO A;  4JI5 B;  2UU9 B;  2VQF B;  4AQY B;  3GB8 B;  4X65 B;  5BR8 B;  3PN1 A;  5FPR A;  2UUA B;  4UFZ A;  4JI0 B;  4YHH B;  4LFB B;  4X66 B;  1N32 B;  1N33 B;  4JI8 B;  2UXB B;  3BAA A;  4DV6 B;  4LF7 B;  4DR5 B;  4K0K B;  4NXM B;  3TY8 A;  1CKN A;  4JI1 B;  4GKJ B;  3GDE A;  3T1H B;  2OWO A;  2HIX A;  4DV4 B;  3S24 A;  3JSN A;  4DV7 B;  1CKM A;  4DR4 B;  1HNZ B; 
#chains in the Genus database with same CATH topology
 2YDE A;  1SFO A;  2ZD9 A;  2UUC H;  1I5X A;  2MK3 A;  2QE7 G;  4O84 A;  3L2P A;  2QTS A;  1SET A;  3HB9 A;  4PDM A;  2UUB B;  1JLL B;  3E8H A;  3PJS K;  1KTA A;  4DR3 H;  4JI5 H;  4OX9 H;  3N43 B;  3ETE A;  3K03 A;  2B63 A;  2IJH A;  2GHY A;  2W6J G;  5LMU B;  1NTM H;  5JJJ B;  1EZ1 A;  1UC8 A;  3DGE A;  2DMX A;  1AN7 A;  4AHC A;  2BR0 A;  2F66 C;  2HIV A;  2J6S A;  2CTW A;  5KUK A;  1M57 C;  3GTJ A;  2F4V H;  4A3C G;  4J7K A;  5L3F A;  4RUA A;  3F8N A;  4UCT A;  3OM3 B;  4C5A A;  2QWR B;  3BQ2 A;  3RB0 A;  2E76 B;  1FFX B;  2JA7 A;  1WNS A;  1HNW B;  1WJZ A;  2R82 A;  5DQH A;  5DGB A;  3FYI B;  2QKA A;  2QWO B;  5IJ0 B;  3RYF B;  4BAY A;  4XX0 B;  1OBD A;  5KG2 A;  2ZE8 A;  2YU9 A;  4NXN B;  1F4N A;  4UCR A;  3ABT A;  3T1C A;  1NU1 H;  2VQE B;  1RM1 C;  2AGQ A;  1GO3 F;  2AHZ A;  3B8M A;  3WWJ A;  4JYB A;  1OCZ B;  4EYH B;  3SYC A;  5B1N A;  1NQT A;  2A06 H;  4B3T B;  1Q3E A;  1QLE B;  1K33 A;  1RP3 B;  2PMZ A;  2RDC A;  3RTX A;  2EIL B;  1M9N A;  4BIU A;  5L1L A;  4KHP H;  3K5H A;  1ZLZ A;  4YJ3 A;  3RYI A;  2W71 A;  4MVM A;  1MA1 A;  2EX3 A;  1M5I A;  1TWC A;  3K9A A;  2VQE H;  3OHA A;  4PDR A;  2W70 A;  4RB1 A;  4YAK B;  1Q86 W;  3K5O A;  3W7S A;  2C2D A;  1IOV A;  3RBD A;  3T9C A;  5C3E G;  1CEZ A;  3KHG A;  2UVR A;  4KUM A;  2RMK B;  4LF8 O;  2OCH A;  3RAQ A;  4PDB A;  1B06 A;  4LFC B;  5JJN B;  4YJ2 A;  1GK9 A;  5JCO A;  1A9X A;  2JA8 G;  1AP5 A;  1ZL8 A;  3SPH A;  4LF6 B;  4FFL A;  3VBB A;  3GTM A;  1FFT B;  5LL6 Y;  4O3S A;  1O9G A;  5L3G A;  1THZ A;  4PEL A;  2I87 A;  2JS3 A;  4QIW F;  1E4E A;  3R5F A;  4ECV A;  3IC7 A;  1CP9 A;  4FLX A;  3MHH C;  2RGV A;  1CE8 A;  4A2A A;  1T5E A;  1S5H C;  3L74 H;  3CCV V;  1U97 A;  4FFB B;  1BHB A;  3PVX A;  4JGS A;  2JA7 G;  5H2F Z;  3TIG A;  4HNA B;  1VF6 C;  3GB7 C;  2YYA A;  3MR2 A;  3V4Z A;  1QBZ A;  3J80 W;  1WB8 A;  3PO3 G;  2XND G;  4DV5 H;  3I56 V;  4G28 B;  1HNX O;  3T5L A;  4O3Q A;  3OGI B;  5KMG B;  4NXN H;  5KG6 A;  2V4D A;  4NXM H;  5I5V A;  2AZ2 A;  3T5J A;  4ECU A;  1AI5 A;  2YL2 A;  1YJN V;  3G8D A;  4M9U A;  4DAA A;  2QK4 A;  2CTQ A;  3B8N A;  4X9Q A;  1XEQ A;  4X64 B;  4GYC B;  4IYH A;  4O7V A;  2CNV A;  1M4U A;  4J9M A;  2IM9 A;  1W59 A;  3X2Q C;  4CH5 A;  2XAJ A;  4YBZ B;  2GDS A;  4F4L A;  1VQ4 V;  2ASJ A;  1V55 C;  4GX2 A;  3G71 V;  5IJ9 B;  2X0S A;  2CUG A;  3CRR A;  2WPD G;  2UU9 O;  1JR9 A;  4G27 B;  1FVI A;  5BWX A;  2JRI A;  4LF4 B;  2XGP A;  1WLE A;  1B6Q A;  2UXD B;  2ZXW B;  3JD0 A;  2Y4U A;  5J2T A;  5IY5 B;  2RDJ A;  4KP4 A;  5BR8 H;  5B1A C;  2VUG A;  1WB7 A;  2YXY A;  1XUQ A;  4FPP A;  1IUR A;  2DJV A;  4DR7 B;  4KHP O;  3CCQ V;  5LGU A;  1HWY A;  2Y48 A;  2DLN A;  2ZIN A;  4O83 A;  4MS2 A;  1WH2 A;  1K34 A;  2HHH O;  2R87 A;  4C5C A;  1MMM A;  4HNU A;  3UT5 A;  3DAA A;  4DR4 O;  4WHX A;  3GV8 B;  1SQB H;  1FXH A;  3QF7 A;  3U0Z A;  3GJX B;  1A32 A;  1COW G;  4M7E A;  4QJF A;  1MOF A;  4O4J F;  4FM1 A;  4LBE C;  5A2Q N;  3PW5 A;  4I5S A;  4DR2 B;  4J9Q A;  2VS0 A;  5F9L A;  4ECW A;  5KFZ A;  1FKA O;  3TIN A;  4LC1 A;  1VIB A;  3FAV B;  5DEC A;  3CPW U;  4MV6 A;  1Y1W G;  4R50 A;  5J2U A;  4FM0 A;  2ZM6 H;  2HVQ A;  2YS7 A;  4W4L A;  4DK0 A;  5LP6 A;  4A3J G;  2H8P C;  4X66 H;  5IT9 W;  4MA0 A;  3H1K H;  4DRX A;  3OMN B;  5C8Y F;  2YI8 A;  4QW8 A;  4YY3 O;  5BYA A;  3BAA A;  1M7J A;  3WO1 A;  1Y1V G;  2FK3 A;  2NU9 B;  3H40 A;  3Q1K A;  2R7M A;  4JTC B;  1FJG H;  1MG1 A;  3GDE A;  2EBO A;  1HNX H;  4FIP C;  1WPX A;  5CAE B;  2QGN A;  4NXM O;  3JZ6 A;  3CJH B;  3WWH A;  5IYB G;  2ZR3 A;  1EKF A;  1URF A;  3R66 A;  2YW2 A;  1MSD A;  3AG7 A;  2XAF A;  3OSN A;  3F7V C;  1VAR A;  4PHZ A;  3TII A;  2XC9 A;  4CKC A;  3MR5 A;  3E89 A;  4IRD A;  5KX5 A;  2PYL A;  1VBH A;  5D1P A;  2CGN A;  5KFM A;  3KAL A;  2LFS A;  2ZDI C;  4LF6 O;  3KCY A;  3RN4 A;  5JVD B;  3G6B A;  4LFA B;  4I55 F;  2HP8 A;  2ZE5 A;  4DW1 A;  2EIJ C;  3A2F A;  3HKD A;  4B3R H;  1I94 O;  3RVZ A;  1NTZ H;  1YCI A;  4O2A A;  4DV4 H;  5CM0 A;  1UNN C;  2EJ0 A;  3OR7 C;  4GZR B;  4MVS A;  4J7Z A;  3OTF A;  4EGJ A;  3HOU G;  4X1K A;  1Y74 B;  5IYZ F;  2JJ1 G;  4DV1 H;  5DLF A;  4DR5 H;  2V1D A;  5B5E Z;  4WFB V;  1BL8 A;  5BR8 O;  3FAV A;  4B3R B;  5C44 G;  3RB6 A;  3BA9 A;  2J6U A;  3HB3 B;  3VQY A;  2ZM6 B;  5DIS C;  3RUP A;  1XL4 A;  4FLW A;  2WLJ A;  1SER A;  1N4C A;  3FFQ A;  3JCU Z;  3GIM A;  5CA0 B;  2X0L A;  4JI1 H;  4Q6G A;  2O57 A;  5BWV A;  1GN3 A;  3BVO A;  5LHG A;  4DR1 H;  4I4T A;  1TWA A;  4BIZ A;  3SJC C;  3CHX A;  2XIG A;  3C0F B;  1HNW H;  4DV2 O;  3RFC A;  4R8U B;  3V6K A;  3QVN A;  2HVK C;  4E6N A;  2CK3 G;  5DM6 V;  5IDJ A;  4IIJ F;  2Q7H A;  1DK1 A;  1D5A A;  4DL6 A;  1W0K G;  4A3K G;  4DV6 H;  5KT3 A;  1VAJ A;  1FKA H;  1GRJ A;  3CJH A;  3FB6 C;  4X65 H;  4RZR A;  2WA4 A;  1WPB A;  4I7Z B;  3FB8 C;  1UFI A;  3WG7 C;  2R93 A;  2WDT A;  5KFB A;  4DR6 B;  3U9T A;  1WA8 A;  4HYO A;  3RR5 A;  5KFW A;  4X66 O;  2UXD O;  5GON A;  5KG1 A;  5BPF A;  5KT7 A;  1B04 A;  4I50 B;  2RJZ A;  2ABJ A;  4D7S A;  2W6N A;  5DMX A;  4FK5 C;  3EPG A;  3D3Q A;  4AQY B;  3PZP A;  2DOS A;  3ZN0 A;  5LL6 b;  2LGW A;  4ED2 A;  4RB0 A;  3BG5 A;  4A3L G;  2XAS A;  5KT4 A;  4F4Y A;  2W6I G;  3RYH B;  1KMI Z;  2W9C A;  4MW8 A;  2EJ3 A;  4APM A;  2Z02 A;  5KFV A;  5BMV A;  4LFB H;  3CSW A;  3JSN A;  2IA6 A;  5EIB C;  1CKM A;  5JWP A;  4BBS G;  2C28 A;  2CAZ C;  4Q8E A;  2B9Z A;  1I0H A;  3MDS A;  3B4S A;  4TV9 F;  4DR3 B;  3VPD A;  1K83 A;  2UUB H;  4GKJ O;  4LF5 H;  2VWK A;  5FNV B;  1P7G A;  2HJD A;  2BTQ B;  3T5H A;  3JAS B;  4DL5 A;  1KD1 W;  3EVK A;  5DQG A;  1S97 A;  4O3N A;  1FPO A;  1TVK A;  1EZV H;  4J42 A;  3BAB A;  4NKG B;  1R6T A;  2QR4 A;  1J5E O;  4GKK O;  2WLK A;  1KEE A;  3AK1 A;  5CA0 A;  4JV5 B;  4TWK A;  1N33 H;  2ZIO A;  3L71 H;  4PV1 B;  4JV0 A;  1I3Q A;  4FBU A;  1R6K A;  5C4X G;  4IHJ B;  4XDK A;  3UKM A;  1NVP D;  1KJ9 A;  4RU9 A;  4MVO A;  4Q45 A;  3V6H A;  1Z2O X;  4IR1 A;  2FMA A;  2NUA B;  1DGS A;  4TV8 B;  4ETS A;  1DV1 A;  2NNU A;  2Q4P A;  2A1H A;  2EIK B;  4A3F G;  2CH7 B;  3T9A A;  1YTF D;  4BBR G;  3TXQ A;  3M8A A;  5JQG B;  4DV1 O;  2DYR C;  3EYY A;  3EXA A;  4DR5 O;  1W96 A;  4IZO A;  4AYB A;  3LQS A;  2QM7 A;  5KHG A;  3G6Y A;  1Q43 A;  4JPR A;  3OTO B;  1N34 B;  2ETN A;  1I2L A;  3P30 A;  2NU6 B;  1EM1 A;  4JI1 O;  1IBL B;  5I5Y A;  3ZHU A;  3N42 B;  3KCX A;  1KKD A;  5J2U F;  5E79 Z;  3ZMT A;  2P22 C;  5LP6 B;  4O4I F;  4DV2 H;  1AIL A;  4DV0 O;  3W7X A;  3BY6 A;  2V5A A;  2W9C B;  1JKJ B;  2CTR A;  2UXC B;  3JAT A;  3T4D A;  2DZD A;  1YIT V;  3NUA A;  4X62 B;  3JAM N;  3PR4 A;  2HVJ C;  4RO2 A;  3A8T A;  3CXH F;  3ZX6 A;  1I08 A;  4WFG A;  5TIS Z;  4JI4 B;  2GUZ A;  4NTX A;  3JYC A;  2VA3 A;  2GTA A;  2BTQ A;  3T9F A;  4DK1 A;  4YJ3 F;  4UV9 A;  5EZY A;  5LA6 B;  1ULZ A;  1C3O A;  1K1S A;  4ICG A;  1H2M A;  4MW3 A;  1TUB B;  4B3M O;  3G8C A;  1TVK B;  1K73 W;  2VQF B;  3RIZ A;  2R7N A;  2LJ2 A;  3PN1 A;  4LF9 O;  2WA3 A;  1WR2 A;  3HR0 A;  1KJJ A;  2CW7 A;  1O9H A;  2W6O A;  4DV7 O;  1ET0 A;  1H2G A;  1BNC A;  5KX5 F;  3M7M X;  3R9R A;  4A3D G;  3F5W C;  4LFB O;  1F7Y A;  1IBL H;  2UXB O;  1JPX A;  1N36 H;  3J7A U;  5BWR A;  4I0X A;  5LMU H;  2E75 B;  3KTM A;  4I55 A;  2UUB O;  4WF9 V;  4ED1 A;  4LF5 O;  3LNM B;  2R7Z A;  4EFB A;  4QIW A;  1L2Z A;  4WBN F;  4X1K B;  3APQ A;  1R3L C;  4K6N A;  3X2Q B;  4WFH A;  3K9S A;  5KFR A;  1NS1 A;  1RJP A;  1J5E H;  3H0G G;  3V4S A;  1M1K W;  5K3W A;  2WLN A;  3UQ8 A;  4CC6 A;  1GM7 A;  2YXL A;  4DV3 O;  3W1B A;  2P67 A;  1EHI A;  1F4M A;  1SQV H;  2IU3 A;  4FFR A;  3PW0 A;  3L73 H;  4B7E A;  1DV2 A;  4ED0 A;  3OHB A;  1SQG A;  4A2B A;  2OYQ A;  4X88 A;  1AR5 A;  1MSW D;  1M56 C;  1OCR C;  5HBR B;  1MAB G;  5ITZ B;  2DQ3 A;  3N40 P;  3WO0 A;  3VA7 A;  2F1M A;  2E5L B;  2H3O A;  4J9P A;  2D2C B;  4DO2 A;  3R5X A;  1UJW B;  2KSD A;  4UCV A;  1CQI B;  1Y1W A;  3KRE A;  3ASO C;  4U7C A;  3I12 A;  2XAQ A;  1KJQ A;  2Q2U A;  5EBW C;  5CBH A;  2K9P A;  4LF4 H;  2VUM A;  4O7W A;  4TQS A;  2E3C A;  1B6S A;  3ML0 A;  3ASO B;  2ZQM A;  4TOI A;  2J9G A;  1XNR O;  1YI2 V;  2PUS A;  4MV9 A;  3T9D A;  3UYY A;  4ZIB A;  4JI6 H;  3T1Y O;  3UZB A;  1I5Y A;  2VRZ A;  3CEI A;  5CBF A;  4J0M A;  4DV0 H;  2ITD C;  4DR2 H;  1AJP A;  1AUV A;  2ITC C;  1V4Y A;  4DR7 H;  2Y69 B;  2FKL A;  1U96 A;  2UXN A;  3UCS C;  1OHH G;  1RFY A;  1Q6U A;  1ZHQ A;  5IP7 G;  1KKC A;  1GH6 A;  4O7S A;  4IR9 A;  4EB6 A;  3RYH A;  2Q5Z A;  3QNE A;  5EDW A;  4MV1 A;  2PZS A;  5I5W A;  3SDL A;  4QPJ A;  2HGW A;  4FE2 A;  1AI6 A;  5KFC A;  2YWV A;  3W7W A;  3N2G B;  4DV5 B;  5KLV H;  4GC6 A;  4FLT A;  2ASD A;  4O2B A;  1M0T A;  2UUA H;  1GSO A;  3AK3 A;  2YZG A;  5CBG A;  4TV9 A;  5FNV A;  5LYJ F;  4JUZ A;  4LF9 H;  3E8G A;  1S10 A;  1M57 B;  5EYP B;  2ZDI A;  2YCH A;  4KL1 A;  2L6L A;  3QZ7 A;  1OCZ C;  3RVY A;  1I7F A;  2W8L A;  2Y0S E;  4JI1 B;  1IBL O;  2UVV A;  2UXB H;  5F2V O;  4ED7 A;  2YRX A;  1K3E A;  5B1B B;  1I1M A;  4MTG A;  4ECQ A;  1FXK A;  3E22 A;  4RAZ A;  4GX1 A;  3ZIA G;  4O7R A;  1Q81 W;  3RB4 A;  4I9W A;  2JA5 G;  1R6N A;  1Y76 B;  4D6T H;  1BQZ A;  2Q69 A;  4FZ1 A;  3CC2 V;  2A3Q A;  2BOB C;  2M6Y A;  2A0L A;  1PP9 H;  3BA8 A;  5IP9 G;  2F93 B;  1T94 A;  1S77 D;  1WP7 A;  4O4H F;  3KHL A;  3K08 A;  2VWJ A;  4JXU A;  3S3X A;  3C90 A;  4DR1 B;  4B3S O;  1GM9 A;  1S0M A;  3OUS A;  4JAS A;  1HR0 O;  4A3B G;  4YR0 A;  1VEW A;  2HVS A;  4O7N A;  4JYY A;  2PGG A;  3V6J A;  4B3M B;  2YRW A;  5K1P A;  1GM8 A;  1VQ7 V;  3D36 A;  4X1I B;  1B33 N;  2YIC A;  3FYE B;  1JX9 A;  4ED3 A;  4UXN A;  4NZM A;  1XMO H;  3A0B Z;  5IYB O;  2DQ0 A;  1VQN V;  4PD4 F;  4A5U B;  5LHH A;  1X9N A;  3N44 B;  3MD0 A;  2ALZ A;  3TY5 A;  4YIP A;  4X89 A;  4O2B B;  1HNX B;  4H33 A;  5EK0 A;  4O4L F;  5BZB A;  4JI6 O;  1SQQ H;  3T1Y H;  3D36 C;  4FM2 A;  4EGQ A;  3WFV A;  4CZZ A;  2Q2T A;  3DC5 A;  2QYZ A;  1M0W A;  4BY7 G;  1Q82 W;  4FLU A;  3NBY B;  5EZY B;  5LA6 A;  4CH6 A;  4O2A F;  5D1O A;  5C5J A;  4DR2 O;  4QWA A;  4JI3 O;  1TUB A;  1S68 A;  1A48 A;  1OCC C;  1IOW A;  1PV0 A;  2EIK C;  4XDL A;  3N41 B;  2J6T A;  4O7L A;  2BQU A;  5EOY A;  5IYZ A;  4FFP A;  1FXK B;  3H1J H;  2JDI G;  3ETD A;  3FMA A;  2YC0 A;  4EQ5 A;  4H0L B;  5I5S A;  1EN6 A;  1EUD B;  3UT5 B;  4F50 A;  4NTY A;  1WN7 A;  3LML A;  4P9P A;  2UUA O;  4JI7 B;  3TXS A;  1NKD A;  3DTG A;  4TUY B;  3L70 H;  3OUZ A;  4QJF B;  1TWH A;  4FBT A;  4J9Z B;  4I4T F;  4UFZ A;  2R7Z G;  1N32 B;  5H5N A;  4PA9 A;  3IC9 A;  3RJ0 A;  3D8C A;  5LMN H;  4J10 A;  4IRK A;  2EJ7 A;  1VP7 A;  1KC7 A;  3KKY A;  3MJF A;  2O03 A;  3P32 A;  4J9S A;  5LOV F;  3AG3 C;  5DG7 A;  3JAK B;  3S24 A;  3D3I A;  2IBZ H;  2DWD C;  1DF4 A;  2IW5 A;  4DR4 B;  1EN4 A;  2V59 A;  5I5T A;  3K0G A;  2KSW A;  1O75 A;  4OX9 B;  3JAL B;  1GO3 E;  4RB2 C;  1TGO A;  3RGX A;  4E2L A;  1WP8 A;  3S3W A;  3L4J A;  3HOV G;  1L8D A;  4JI2 O;  5KFI A;  3HKB B;  1OBG A;  5L3D A;  2P4V A;  2JEU A;  3BEH A;  1VF6 A;  3ZHS A;  3N6X A;  1BGW A;  1VMG A;  2MCT A;  2JA6 G;  2HHF B;  1ZQ7 A;  2JS5 A;  1N48 A;  1XNQ H;  1TAE A;  2R70 A;  3OAA G;  4R7C A;  5GTI Z;  4DLK A;  5DAA A;  4ECY A;  3KAJ A;  3CC7 V;  5B1B C;  3HKE A;  3RWR D;  5H9C A;  1XMO O;  2W6Z A;  5DG8 A;  4DUZ B;  1E1Q G;  5DGA A;  2QWP B;  2JEI A;  2OH2 A;  1Q5O A;  5JCO C;  1XNQ B;  5L3E A;  1SCU B;  4LF7 H;  2A7W A;  4ZOL F;  5K1X A;  4IAJ A;  4J11 A;  2X7R B;  5LXT B;  4AI8 A;  3E5N A;  2UXX A;  1YSC A;  2KKW A;  3N2G A;  3LSU A;  2B1I A;  1I6U A;  1IVS A;  1Y74 A;  4FJC C;  4X64 O;  1Q7Y W;  2ADQ B;  3ZHR A;  4A3I G;  2AGA A;  5CE8 A;  2XD4 A;  3P3N A;  4M0J A;  3CC4 V;  3QWU A;  5DGH A;  1XI1 A;  4MSW C;  1ZHS A;  5CB4 A;  2XAH A;  1IBK O;  2DYR B;  2W6M A;  2N04 A;  1OCO C;  5KFX A;  1Y6X A;  3RV4 A;  3H3V H;  4UUJ C;  3SPC A;  4MV3 A;  3NC0 B;  3JAL A;  4OGQ B;  4UCU A;  3SYO A;  5LMN B;  1IXB A;  1Z5W A;  5KT6 A;  3HKB A;  2XCL A;  3KAK A;  5KG5 A;  1L0L H;  1AVM A;  4BIO A;  4MV8 A;  4XYM B;  4X8A A;  4CMD A;  2R9A A;  3CEB A;  2FLN A;  3RF2 A;  4F4X A;  2FPI B;  3AG2 B;  4DL3 A;  3SI8 A;  4WFE A;  1PNL A;  4K3A A;  2Q8V A;  4FGR A;  1K4C C;  4R6Z A;  3T1H B;  4JI8 H;  4JZG A;  3RYF A;  3NGD A;  1Y66 A;  5H6R A;  1OCR B;  2FL4 A;  3HKE B;  4O7Y A;  2ASL A;  1R1B A;  3BFR A;  4FS1 A;  4QE7 A;  4GLW A;  4MVR A;  3ICX A;  5FLX N;  3GTO A;  1R3J C;  4FLV A;  1BGY H;  3CSX A;  1XQ8 A;  1XHX A;  1B6R A;  4JI2 H;  4G2K A;  5BY1 A;  2XHB A;  4O86 A;  4CC5 A;  1NT2 B;  2JA5 A;  3G6X A;  1M6V A;  1VBG A;  1YVW A;  4F6R A;  1QR8 A;  3FKI A;  2H94 A;  4UCS A;  4EFE A;  2EIM C;  2QM8 A;  4RWU A;  3HXL A;  3U10 A;  2WAQ E;  3K3W A;  2WAQ A;  4A3M G;  2Z5U A;  1MNG A;  2W0X A;  3GQC A;  5JH7 F;  3JD4 A;  4B7K A;  5D1O B;  4ZHQ B;  4KFM A;  2QJ1 A;  3T7A A;  3RFR A;  3TY9 A;  5CA1 A;  3O65 A;  1R3K C;  2B5U A;  2KG7 B;  1PKX A;  4LF7 O;  4CE5 A;  2R92 A;  2HDK A;  3DF7 A;  4D7T A;  4MT8 A;  3WG7 B;  1JMK C;  4NZO A;  3JAM W;  4TV8 A;  1IYE A;  1RPO A;  2WLI A;  1PX2 A;  3KYH C;  1XOU A;  3RYC B;  4W4K A;  3K59 A;  2M7W A;  2W8K A;  4TUY A;  4QE9 A;  2R8J A;  1T3N A;  1OV9 A;  4IGG A;  1VQ8 V;  3CRM A;  4BY1 G;  3JCZ A;  1IBM O;  4ECX A;  3DSQ A;  4ZI7 B;  3JD3 A;  2R7K A;  1GYF A;  4DL2 A;  2EZP A;  2Q73 A;  2ILM A;  5D5Q A;  2YZN A;  5DLG A;  2Q6A A;  2QTO A;  2EIM B;  5KHJ A;  1VQL V;  3HPL C;  1DLB A;  3VOT A;  4O3O A;  3WB0 A;  1KP2 A;  1Z5V A;  2WLL B;  3HBL A;  2UUC O;  1J95 A;  1AB3 A;  3AYH B;  3SPJ A;  2ODT X;  3GTG A;  4PA3 A;  3T4Z A;  1JJO A;  5BR8 B;  1M93 A;  1SYX B;  4RAY A;  4LFB B;  1MZB A;  4EBC A;  4UVA A;  5EBM C;  4LSX A;  1BQ0 A;  3CCU V;  4O81 A;  1JVM A;  3CCR V;  4ECT A;  3OUU A;  5FD5 A;  4JI8 O;  3BCC H;  2CDY A;  2A9H A;  4DL7 A;  1HDJ A;  3AG2 C;  2YXH A;  5J2T B;  3GVM A;  4Q20 A;  4YR3 A;  3Q8P B;  2YID A;  3K0D A;  5FL7 G;  3QFF A;  3ABM B;  2YZL A;  3K04 A;  1L0N H;  1PM9 A;  2KG7 A;  2RNB A;  2QSA A;  4PA6 A;  4OPA A;  5IWA O;  3SGI A;  5K2M A;  2A79 B;  2NVY A;  1BE3 H;  2LO1 A;  4JAA A;  3LDD A;  2HVR A;  1KJI A;  3W7U A;  1KB9 F;  5AG2 A;  2VA2 A;  1ZET A;  2Y0P A;  2HFE C;  3T2M A;  3IN5 A;  4I0X B;  1CPY A;  3RGB A;  4ZOL A;  2L35 A;  4I55 B;  3EHB B;  2VQE O;  1SRY A;  4J9Y B;  5KG4 A;  3DC6 A;  1MZF A;  3ZRW B;  3N8D A;  3GTK A;  3CB2 A;  4MA5 A;  1AI7 A;  1EFR G;  1QLN A;  1CQJ B;  1YJ9 V;  4JI5 O;  1X4T A;  1V9P A;  3E35 A;  4KHP B;  4MTO A;  3J80 N;  5H6Q A;  3PW7 A;  5CB4 B;  2W6Q A;  3VPB A;  1A3G A;  2R8G A;  3T1Y B;  1VQK V;  4WFF A;  2CE4 A;  3ETH A;  4YJ2 F;  4PI2 A;  4YXW G;  5KFY A;  1K7D A;  3K5L A;  3HKZ A;  2DAB A;  1ZAU A;  4NLG A;  2DYS C;  3HKZ E;  5ITZ A;  3O9O A;  3RT3 C;  4QGP A;  1FS0 G;  5C8Y A;  3AG1 B;  2DPJ A;  3QTC A;  1SS3 A;  3PR5 B;  1Q6H A;  2HGX A;  2ATK C;  2BTO A;  1VF7 A;  3UO2 A;  1Y67 A;  1JQ0 A;  1P8L A;  3PW2 A;  1KQS U;  3Q8Q B;  2DWC A;  2IJI A;  4G3I A;  4XBF A;  5LGT A;  4LCU C;  4CH3 A;  5D8D A;  1S9F A;  1AJN A;  3ASN B;  2BOC C;  2ADP A;  2ZE7 A;  1FJG B;  1KU9 A;  2DE0 X;  3GIQ A;  1YF2 A;  1NR7 A;  3JRW A;  2XT9 A;  5BXZ A;  2BCC H;  3MWM A;  4L8J A;  5KFT A;  4NXN O;  3VQW A;  2HKO A;  5EWF A;  4ED6 A;  3K3V A;  2XOK G;  2ZJT A;  5KFK A;  1XMQ H;  1QR9 A;  3Q4H A;  1XRE A;  2FB5 A;  4JF3 A;  2UU9 B;  1JDE A;  1VF5 B;  4LF8 H;  5KFD A;  4UV8 A;  3MWD A;  4J9R A;  1JFF A;  4JI0 B;  5DN6 G;  2RDI A;  3JD1 A;  2ZXW C;  3ZCC A;  1RYR A;  5KFP A;  4LF7 B;  1P84 F;  4FZ0 A;  3OMA B;  1Z2N X;  4CMF A;  1YDX A;  4BR6 A;  5EC2 C;  3B2E E;  4PA7 A;  1SQP H;  3TY8 A;  1JOY A;  4MVU A;  1G4Y B;  2Z0A A;  3IFX A;  2W9B B;  2X6C A;  2DYS B;  4DV7 B;  2OCC B;  2YIB A;  1YHQ V;  3C3T A;  3W7T A;  1KUT A;  4QWE A;  3EPI A;  5LP6 C;  3HKC B;  2YUA A;  4TQR A;  3JZF A;  3GIJ A;  2RGR A;  2YEV B;  1I7L A;  5BPH A;  4IL6 Z;  4TQF A;  1JXL A;  2CZG A;  1RPR A;  3CME V;  4HNT A;  1K9M W;  2FYU H;  5JH7 A;  3SJQ C;  3DXR A;  5LHI A;  2M05 A;  4IYI A;  1SC5 B;  2XUM A;  2WE6 A;  4FFM A;  2JIZ G;  5CA1 B;  3LNN A;  2HJW A;  1QQC A;  4QWD A;  2OIG A;  4FLY A;  1NH2 B;  1YTF B;  3PW4 A;  2CQY A;  3E22 B;  4DV5 O;  5L3C A;  4LWS B;  5IT9 N;  4U3J B;  2RF4 A;  3G80 A;  5JJE B;  3AW8 A;  2HHH H;  1Z2G A;  1CKN B;  3HOX G;  3ZHV A;  2UUC B;  2UVW A;  2CGO A;  2DN9 A;  1S72 V;  4DR4 H;  4LF9 B;  1OCC B;  4PA4 A;  5KT2 A;  2ZE6 A;  1VQO V;  3CRA A;  4GLX A;  1YIJ V;  1N0N A;  4YHH O;  1GN4 A;  2HHH B;  3ABM C;  1HP8 A;  2RCV A;  4O4J A;  3GV5 B;  3SYA A;  1S76 D;  4K0K O;  3F7Y C;  4RUE A;  1BHA A;  4Q0Y A;  5GON B;  3N2K A;  3ZMZ A;  1Z2P X;  4TM5 A;  4ECR A;  2Q7G A;  4MVZ A;  1UC9 A;  1KJ8 A;  2XCA A;  2GSM B;  1OCO B;  5I5X A;  2UU9 H;  5C1P A;  3RAX A;  4C7U A;  3U55 A;  1P7B A;  2VR1 A;  2WLL A;  1FFX A;  3GWO A;  2Y0I A;  2R93 G;  2IU0 A;  4RQF A;  2BQR A;  4DL4 A;  1QLE C;  5IJ0 A;  2QEX V;  1I1L A;  4J41 A;  4DV3 B;  4YY3 H;  1PNM A;  2COI A;  5BMV B;  5DED A;  3NR7 A;  2Y4T A;  2LGQ A;  4OPH A;  2HJF C;  1TA8 A;  4NTW A;  5KUM A;  2C35 B;  1KP3 A;  1Y1V A;  2EIY A;  5IYC G;  3GIL A;  2XCP A;  1QNM A;  2GV9 A;  1EYZ A;  1UPG A;  2WYO A;  1XMQ O;  3JAW A;  3CRQ A;  1FXV A;  2E2I A;  1YJW V;  3M4I A;  4F4Z A;  1F23 A;  1XDC A;  4RCN A;  3ABK B;  3KHH A;  3T1H H;  4RNM A;  1H2N A;  3IJ4 A;  2DIK A;  4FFN A;  1DF5 A;  4LF6 H;  1CKN A;  4EEY A;  2PVP A;  4B3T H;  2HIX A;  2ZM6 O;  1I1K A;  4O3P A;  2CH7 A;  5CMU A;  1QHT A;  4DQN A;  3GWK C;  5JQG A;  4ASU G;  1I94 H;  2DWE C;  2C22 A;  1LUW A;  3E8B A;  3ZRW A;  3ABL B;  1GTO A;  2XGQ A;  2IP4 A;  1F51 A;  4O4J B;  5IY5 C;  2Q0A A;  3RW0 A;  2QB5 A;  4RNN A;  2F4V B;  1FYJ A;  4IIJ B;  5D5P A;  4PZ8 A;  3GII A;  2YS8 A;  3K57 A;  1ZTE A;  2PF4 E;  2C2R A;  1FJG O;  2YIA A;  4NYE A;  2LP7 A;  3TCU A;  4FM9 A;  3JAK A;  4LFC H;  2CFM A;  1E79 G;  4DUY H;  5KG7 A;  4E4E A;  3I5D A;  1ZSP A;  4EYI B;  4EBD A;  2OT5 A;  1FD9 A;  3BHP A;  2K1E A;  1VQ9 V;  5A9G A;  2GPW A;  3SR2 C;  1N36 B;  2ZR2 A;  2V4R A;  4JTA B;  2V7Q G;  3QQM A;  3J81 N;  1RSO A;  3BQ0 A;  2CW8 A;  4DR6 O;  4DR1 O;  2NU7 B;  2WLM A;  2Y69 C;  3JAT B;  4Z1M G;  4JI0 O;  4ECS A;  1S0O A;  1D2D A;  1XIL A;  5KMG A;  5C8Y B;  3CRC A;  1I94 B;  1GN2 A;  2GLT A;  4O3R A;  2WWW A;  1VKZ A;  4YHH H;  1NJI W;  4RAI A;  1NZ6 A;  3CCL V;  2JEX A;  4DV6 O;  5CA3 A;  4K0K H;  3JD2 A;  2HHF A;  2IJK A;  2FTK A;  3JAW B;  3I4N G;  4RB3 C;  5EBL C;  4B3R O;  1K1Q A;  3M9M B;  1G2W A;  4DV4 O;  1GKF A;  2SCU B;  2CTP A;  5FJ8 G;  1M90 W;  5L1I A;  4RNO A;  1XL6 A;  1SQX H;  2NU8 B;  3MR3 A;  5FR9 A;  5JUM A;  4LR3 A;  2Y0S A;  3ABU A;  4ED8 A;  2AGP A;  4BW9 A;  3UZO A;  4EBE A;  2JGD A;  3SYP A;  4QW9 A;  4MAM A;  5L9X A;  1JFF B;  4JI4 O;  2DAA A;  4JAU A;  3K5N A;  2F43 G;  2ZNJ A;  4DV2 B;  4JAV A;  3APO A;  3Q2O A;  5JVD F;  1S0V A;  1W93 A;  3H9V A;  3CS5 A;  4X1Y A;  1SES A;  1KBL A;  3UM7 A;  5T14 A;  1GN6 A;  3WNZ A;  4LP8 A;  3OGC C;  3CCE V;  4JYA B;  2FLP A;  3A0R A;  2MW2 B;  1PK8 A;  4N21 A;  4IWY A;  5KHK A;  4YQW A;  4JV2 A;  3LWB A;  4TV8 F;  4UB8 Z;  2HR3 A;  1HNW O;  1ORQ C;  1ZX3 A;  1M56 B;  2LFR A;  1PL0 A;  4CS3 A;  3UFX B;  1AI4 A;  2EUL A;  5DQI A;  4IIJ A;  3JAR B;  4PBC A;  1K92 A;  4U7O A;  1K97 A;  5FLX W;  3QO5 A;  1EN5 A;  4X66 B;  3T1H O;  2IMW P;  3DXR B;  3AG4 B;  3TJT A;  4X20 B;  3MFH A;  2N05 A;  3CCJ V;  1BCC H;  4AQY H;  5KFE A;  4X65 O;  4B3T O;  1SEI A;  3H20 A;  4GKJ B;  3R5H A;  5KFA A;  3LSS A;  2OWO A;  2QWN B;  4WFA V;  2DPI A;  4LWS A;  3OW2 U;  4LNU B;  2EZO A;  3OEE G;  1YZB A;  2UXD H;  4JI3 B;  5IYD G;  3ZMS A;  3L75 H;  5L3B A;  2ZDG A;  5J2U B;  2YIB D;  1FAF A;  3CD6 V;  5LP6 F;  4NB5 A;  4JV5 O;  4O4I B;  2Q0O C;  2B1G A;  5KKN B;  4P2Z A;  2ARH A;  1HNZ O;  4L87 A;  4HYK A;  1RK5 A;  3M9O B;  4A93 G;  4PZ6 A;  3H1L H;  3LDC A;  3CCM V;  1LR1 A;  1V51 A;  1I50 A;  4LFC O;  2C2A A;  4DUY O;  2BSK A;  1VQ5 V;  3ABL C;  2XTA A;  1WSC A;  3HOW G;  1QU7 A;  3N2K B;  3ORR A;  3L9D A;  1KC8 W;  3CXC U;  4DIM A;  2ODM A;  1JA8 A;  2LW7 A;  4I9Q A;  4I50 F;  4GKJ H;  3QZ8 A;  2UVU A;  4DR6 H;  4YAJ B;  1G6U A;  2R7L A;  4JI0 H;  4CBC A;  1JJ2 U;  3IAY A;  1V55 B;  3HT5 A;  4EB6 B;  3B09 A;  4Q4D A;  1H2S B;  1PPJ H;  1QCE A;  4F6R B;  3ZED A;  2V58 A;  2E2H A;  4GKK H;  1US6 A;  4JTD B;  1N33 O;  4JZ2 A;  4LH7 A;  1NI8 A;  1AUX A;  2VPS A;  5KX5 B;  4B08 A;  3KXY T;  3G6E V;  4O2B F;  1H8H G;  4GX5 A;  1JCH A;  2CKZ B;  4TV9 B;  3CMA V;  3JAR A;  4LF8 B;  3SPG A;  3VMM A;  4NYK A;  4Q4C A;  1CKO A;  3LSQ A;  4IWX A;  3A0H Z;  2RN9 A;  5LYJ A;  3H1I H;  4GX0 A;  1E4F T;  4Z1V A;  3GID A;  4JYC A;  3DTF A;  5LGN A;  3PFF A;  4JI2 B;  4ZKI A;  3LP8 A;  2R8K A;  5EYP A;  4B3M H;  4O2A B;  1SA0 B;  2W57 A;  4WCE V;  2LQT A;  2ATL A;  2HG8 A;  5KHH A;  4JI4 H;  4WBN B;  3NBZ B;  5I60 A;  3VNN A;  3VPC A;  5I5U A;  2C2E A;  1E4G T;  3N6R A;  2OLS A;  1SQF A;  2F95 B;  4DV7 H;  1OZ0 A;  3AG4 C;  3E8F A;  1RJQ A;  4IHJ F;  1H8E G;  2UXC H;  2AZ0 A;  2NVX A;  2IH3 C;  1N36 O;  1Y76 A;  2AW9 A;  3L72 H;  5DGI A;  1IBK B;  1K5Q A;  3RYC A;  2ZCE A;  1BT8 A;  3WB2 A;  1KBH A;  5C1O A;  3GIK A;  3THO A;  3ZMU A;  1XMO B;  2P0A A;  4C5B A;  3K5M A;  4DV1 B;  2FML A;  1SZX A;  1KUQ A;  2YZM A;  1YXB A;  4JI8 B;  2UXB B;  4ZI7 A;  4A3E G;  4K35 A;  4F6E A;  2Z3Y A;  3QO7 A;  4E4T A;  2F23 A;  4IT5 A;  4AQY O;  4C2M A;  4J9K A;  2VQF H;  3R23 A;  1I7N A;  3AX6 A;  3T54 A;  4Q43 A;  4J9O A;  3QG5 A;  3TQT A;  4Q44 A;  5LOV B;  2R9R B;  4DV4 B;  4X1I A;  1XBL A;  5BWU A;  5HFM A;  3H1H H;  1EBO A;  2Q9L A;  1ZUQ A;  4TSF G;  2JK5 C;  2FE3 A;  2ZKO A;  2NLJ C;  1W0J G;  5BYB A;  2NR5 A;  1SF9 A;  1RSO B;  4H44 B;  4JV5 H;  3ZHT A;  1IBM B;  3E86 A;  4J9N A;  4QIW E;  1HNZ H;  1CXZ B;  5H80 A;  3RB3 A;  4DXW A;  1YEW A;  3F5T A;  2W7P A;  2AQ4 A;  1HR0 B;  1V54 B;  1EKV A;  2PYJ A;  4LMY A;  4GT1 A;  4HN2 A;  4LF4 O;  3ETJ A;  4PDL A;  2E74 B;  4YJ3 B;  5LMU O;  1DIK A;  4RZQ A;  2FK2 A;  3OD4 A;  5FD6 A;  1XNR H;  4ABM A;  4HNV A;  2OCC C;  3WWI A;  5CN0 A;  4BW5 A;  5IYZ B;  3T5K A;  1TWF A;  2IBK A;  4DR7 O;  2JGD B;  1RJR A;  2BQ3 A;  3OFN G;  5CR5 A;  3JAS A;  3GTP A;  1WRV A;  4YY3 B;  4DV3 H;  2JEG A;  4MTD A;  4IRC A;  3ZRS A;  4LSA A;  4MV4 A;  2PY5 A;  4ZOL B;  5CA0 F;  1K5S A;  4H13 B;  4LF5 B;  3MAQ A;  1VQM V;  4OXS A;  2V4Q A;  1MZE A;  3G4S V;  1I2K A;  1Y14 B;  5JQW A;  1XNR B;  3OSP A;  3K79 A;  3ZRX A;  4HR7 A;  2ZIM A;  4FFB A;  4PI0 A;  5GW7 A;  3G67 A;  4UVB A;  1AR1 B;  2EIJ B;  2VQD A;  3LUT B;  1S03 G;  2D3O W;  4HQ6 A;  2R72 A;  4HNA A;  3STZ C;  2UXC O;  4DW0 A;  4J80 A;  3T99 A;  3AG1 C;  4R7R A;  3OEH G;  4Q8F A;  1NVP B;  3GTQ A;  2B63 G;  4UB6 Z;  4LNU A;  4EG0 A;  3CWB H;  4HBN A;  3NXS A;  3OMI B;  3WB1 A;  3GIP A;  2JVD A;  4BWS C;  3BRC A;  4MTX A;  3BAC A;  2FPG B;  4XYL B;  4CKB A;  4O82 A;  5FPR A;  5KFF A;  4O4I A;  5IYD O;  1TUE B;  1N33 B;  4JI7 H;  2WAM A;  2JA6 A;  1N8R W;  2VQF O;  3SYQ A;  4NXM B;  3OT7 A;  3T9B A;  4HZ3 A;  3E83 A;  2Q67 A;  1QVG U;  4YP3 A;  2VPQ A;  2FLL A;  4PWQ A;  2P4K A;  1HR0 H;  1G8M A;  4O4L B;  1ENV A;  2PN1 A;  3MHS C;  1S0N A;  5FNV F;  3Q4H B;  4JI6 B;  3SJB C;  2W6P A;  1DTO A;  2R6F A;  5E1A C;  5KG3 A;  1OWT A;  3KHR A;  5EZY F;  3P3P A;  2FKX A;  2ZNI A;  1A0G A;  5C93 A;  4ZBM A;  1AJQ A;  3OR6 C;  1ARO P;  3TGU H;  2OTJ V;  4Y8V B;  4N23 A;  1A0I A;  3W5O A;  1R73 A;  2YSU B;  3SPI A;  2EIN C;  3H4D A;  3FKI G;  3EFF K;  5KFH A;  1X59 A;  3H4B A;  4PZ7 A;  2PI4 A;  3VQX A;  1EZJ A;  3TET A;  4QSH A;  5KFN A;  3FD9 A;  3CE2 A;  3HKC A;  3CVZ A;  4UCO A;  2W9A A;  1PNK A;  2Q7E A;  3K58 A;  4TT3 G;  4FLZ A;  4QWB A;  4DYL A;  4L1K A;  3TW6 A;  3ZHQ A;  5JQG F;  1Q8I A;  5LYJ B;  4LFA H;  4Z2W A;  4NVP A;  5JH7 B;  3Q8S B;  1H2K A;  4PJ0 Z;  1SA0 A;  4FFO A;  1WCM A;  3IGA C;  2BE3 A;  2EJ2 A;  3RV3 A;  1AR4 A;  3OTO H;  4WBN A;  1N34 H;  4O4H A;  4FFK A;  5B66 Z;  5B3S B;  2W7O A;  1K8A W;  1BMF G;  2QWQ B;  4MTE A;  4DRF A;  5HFL A;  5KFJ A;  4PDV A;  3SJA C;  3I55 V;  4B3S H;  3GTL A;  3BPZ A;  4EEQ A;  2R92 G;  1RYS A;  4K8X A;  3JRX A;  5KFO A;  3ZN1 A;  3QO8 A;  5KA6 A;  2IH1 C;  1ROP A;  2FP4 B;  3W1G A;  2AXT Z;  1LUV A;  2IJJ A;  4CKE A;  4DRX B;  3TEK A;  4LH6 A;  4U3F H;  3J7A K;  4ME6 A;  2G38 A;  1IXM A;  5LMN O;  3TK1 A;  1GGO A;  3TW7 A;  4B3S B;  2YS6 A;  4ZI7 F;  1BXR A;  3K3P A;  1BJT A;  1B3Q A;  5EIB D;  3N27 A;  3UO3 A;  5LOV A;  1BS3 A;  1SKV A;  5LA6 F;  2GPS A;  1S5J A;  1N32 O;  5KFG A;  1H2L A;  2QF7 A;  4QWC A;  4JI3 H;  4JI5 B;  5A2Q W;  2WSS G;  1T36 A;  3GB8 B;  4I7H A;  1V54 C;  1R9T A;  3ORQ A;  2UUA B;  3IG0 A;  3ASN C;  4JI7 O;  4UVC A;  3WU2 Z;  5B3S C;  2VUM G;  1H38 A;  2Q7D A;  4BXX G;  1RK6 A;  4EKW A;  2YI9 A;  2EJR A;  3CX5 F;  1WAZ A;  1Y4M A;  5JVD A;  4MVQ A;  3U11 A;  1TWG A;  5BWT A;  2N74 A;  5LXT F;  2CNQ A;  1GSH A;  3HKD B;  4ZHQ A;  4O7T A;  2WB1 E;  1IX9 A;  5JVL A;  2PMZ E;  3H01 A;  3RBZ A;  2WB1 A;  3GLK A;  5J2T F;  4U6P A;  3ZBH A;  3HO8 A;  2WLH A;  3LUL A;  3J81 W;  2AGO A;  2KQX A;  2EIN B;  2ZDH A;  1K4D C;  2P6J A;  3CCS V;  1GLV A;  2AU0 A;  1P49 A;  5EWE A;  1N56 A;  3CP1 A;  2WLI B;  4X62 O;  3H0G A;  2COG A;  3MR6 A;  1HW7 A;  3FDS A;  3HOY G;  4U7N A;  3R65 A;  2Z04 A;  1N0J A;  4TUY F;  2NN4 A;  1G1X B;  3JZI A;  2P7T C;  4LFA O;  1KEC A;  4FVM A;  1NR1 A;  4I4T B;  2PBZ A;  4X64 H;  3KG2 A;  1AP6 A;  3OE7 G;  3B40 A;  4R8U A;  1IYD A;  2C00 A;  3CQZ A;  1GSA A;  3OTO O;  1N34 O;  3MWE A;  4A3G G;  3SNO A;  1IZ3 A;  3SE7 A;  2FB9 A;  2HGS A;  5KFS A;  4WD3 A;  4DUZ O;  2JGU A;  3ZRV A;  2I8C A;  3ETG A;  2XAG A;  2R86 A;  1XNQ O;  3G6V A;  3L4K A;  1KT8 A;  4CHI A;  2AHY A;  1PD3 A;  4QNH B;  1EUC B;  1OJH A;  1WA8 B;  3FKS G;  1R3I C;  1Q90 D;  4TQD A;  2ZDQ A;  4GC7 A;  2FJZ A;  4CS2 A;  1IDS A;  4I50 A;  2OIE A;  4YB8 B;  4FU0 A;  5FLM G;  4BWA A;  4FS2 A;  3T9E A;  3E2E A;  4JYA O;  3BQ1 A;  3KZI Z;  5KAI Z;  4RUF A;  1VS0 A;  1J5E B;  2X6B A;  2PTM A;  3K5I A;  2FPP B;  3B77 A;  1XDN A;  2GBO A;  3ZMV A;  1RM1 B;  4RUC A;  1SZT A;  2JEF A;  4O4L A;  1NBM G;  1GAX A;  1N32 H;  4QPK A;  2HLD G;  1E1R G;  1W2B U;  4ZQI A;  4MTF A;  3DTU B;  4P9O A;  4XZ3 B;  2ZT9 B;  3PO2 G;  4X65 B;  4YHH B;  4XDJ A;  4DV6 B;  4DR5 B;  2E5L O;  1IBK H;  4K0K B;  1NTK H;  2PI5 A;  2P90 A;  4X1Y B;  5KAF Z;  3MFI A;  2R9I A;  5L1K A;  4RQE A;  2GQS A;  4CH4 A;  3FB7 C;  4TVI A;  5E25 A;  1WCM G;  4YR2 A;  4J9L A;  5B1A B;  4NR1 A;  4F4W A;  2LW1 A;  4IHJ A;  2X5R A;  1VQP V;  2R8I A;  1E4E B;  2QDO A;  5DG9 A;  3CYO A;  1HNZ B;  2COJ A;  3ABK C;  1P16 A;  4K8Z A;  3FB5 C;  2X6A A;  5HV6 A;  3ETQ A;  1JIH A;  5J9P C;  4GCZ A;  2V9W A;  4DUY B;  4DR3 O;  3AEI A;  1S5L Z;  4H37 A;  4OX9 O;  4X20 A;  1DAA A;  1P4R A;  3HOZ G;  1EKP A;  3AG3 B;  2R84 A;  4O4H B;  4AIL C;  5CA1 F;  4X62 H;  2VOB A;  5KFU A;  2F4V O;  2P06 A;  3RBE A;  4GKK B;  1XMQ B;  2W0F C;  1L1F A;  5I47 A;  3OUF A;  1JDB B;  4HAM A;  3U9S A;  1JX4 A;  3JSL A;  1ZWI C;  1QVF U;  4ECZ A;  5EC1 C;  3U54 A;  2CNU A;  5EWG A;  2HG5 C;  4DUZ H;  3STL C;  2GTS A;  4R8C A;  1S3J A;  5KFL A;  1D5N A;  2BSK B;  3I4M G;  1LNQ A;  4NZN A;  3FX7 A;  5IJ9 A;  2GQR A;  4UUG A;  2JEJ A;  2GUZ B;  5GON F;  5IYC O;  2Y4R A;  5B1O A;  5BWW A;  1XK5 A;  1VQ6 V;  5GTH Z;  4CS4 A;  3TQ1 A;  3VQV A;  3C3S A;  5LBQ A;  1FXK C;  2QA4 V;  4JYA H;  3GV7 B;  3ZS8 C;  2W9B A;  3K06 A;  3U0G A;  5IWA B;  5KFQ A;  4DV0 B;  5BMV F;  2P5O A;  1NH2 D;  2I80 A;  1GMG A;  4GUN A;  4J7J A;  4KXR A;  5HNE A;  3Q8R B;  2ZGI A;  4P30 A;  2YEV A;  3AK2 A;  5KT5 A;  5KHI A;  3LDE A;  4AYB E;  2QKS A;  4FMT A;  3RYI B;  1CS0 A;  5IE9 A;  5LXT A;  3M9N B;  5FPO A;  4ZHQ F;  2WTF A;  2DW4 A;  1C30 A;  4JV1 A;  1BZK A;  1IBM H;  4YIO A;  2R85 A;  1XHZ A;  3VOU A;  1BSM A;  2OTL V;  5IWA H;  2E5L H;  2Q68 A;  2R8H A;  3RGZ A;  3BJY A;  4U3J A;  4MV7 A;  5KS8 A;  2QM4 A;  2QKC A;  4O7Z A;  5CB4 F;  5F9N A;  1PL4 A;  2EIL C;  2HEP A;  2RQ6 A;  1Q6I A;  3M99 B;  3ZJZ A;  5KA5 A;  5L1J A;  4YJ2 B;  2FK1 A;  2JJ2 G;  5KG0 A;  1KYO F;  2KB1 A;  1ZL8 B; 
#chains in the Genus database with same CATH homology
 2UUC H;  4EFB A;  3L2P A;  1L2Z A;  4JV5 H;  1IBM B;  4X1K B;  2UUB B;  4DR3 H;  1HNZ H;  4OX9 H;  4JI5 H;  1YEW A;  3SGI A;  3N43 B;  1HR0 B;  1J5E H;  5LMU B;  5JJJ B;  3UQ8 A;  2HVR A;  4CC6 A;  2YXL A;  1AN7 A;  4AHC A;  2F66 C;  2HIV A;  3W1B A;  2PYJ A;  4LMY A;  2F4V H;  3RGB A;  3F8N A;  4ZOL A;  4UCT A;  4YJ3 B;  4RZQ A;  4I55 B;  1FFX B;  5FD6 A;  1SQG A;  1WNS A;  1HNW B;  1XNR H;  4A2B A;  2OYQ A;  5IJ0 B;  3RYF B;  5ITZ B;  3CB2 A;  3N40 P;  4NXN B;  4UCR A;  2F1M A;  5IYZ B;  2VQE B;  2E5L B;  1X4T A;  1V9P A;  4KHP B;  4B3T B;  3JAS A;  1Q3E A;  4UCV A;  5CB4 B;  4YY3 B;  4DV3 H;  3RTX A;  4MTD A;  3T1Y B;  2Q2U A;  4LSA A;  4LF4 H;  4PI2 A;  2PY5 A;  4KHP H;  4YJ3 A;  4ZOL B;  2E3C A;  3RYI A;  3K5L A;  2EX3 A;  2VQE H;  1M5I A;  1ZAU A;  4TOI A;  4LF5 B;  3MAQ A;  2PUS A;  4MV9 A;  4JI6 H;  4ZIB A;  4RB1 A;  3K5O A;  5ITZ A;  5C8Y A;  4J0M A;  4DV0 H;  3QTC A;  4DR2 H;  1XNR B;  4DR7 H;  2BTO A;  4PDB A;  1ZHQ A;  4LFC B;  2ZIM A;  4FFB A;  5JJN B;  4PI0 A;  1VF7 A;  4YJ2 A;  1P8L A;  5JCO A;  4EB6 A;  3RYH A;  1S03 G;  2R72 A;  4HNA A;  4CH3 A;  4LF6 B;  2PZS A;  1FJG B;  1KU9 A;  4R7R A;  1O9G A;  3N2G B;  4DV5 B;  3MWM A;  4L8J A;  4FLT A;  4O2B A;  3VQW A;  1M0T A;  4LNU A;  2UUA H;  4HBN A;  3K3V A;  2ZJT A;  1XMQ H;  4FLX A;  3WB1 A;  4BWS C;  2JVD A;  3BRC A;  2RGV A;  2UU9 B;  4TV9 A;  5FNV A;  4A2A A;  4LF8 H;  4LF9 H;  1T5E A;  1JFF A;  5FPR A;  4JI0 B;  4O4I A;  1N33 B;  4FFB B;  4JI7 H;  4LF7 B;  2YCH A;  5EYP B;  4KL1 A;  1Z2N X;  4HNA B;  1I7F A;  4NXM B;  3B2E E;  3TY8 A;  3J80 W;  4JI1 B;  2UXB H;  4DV5 H;  4DV7 B;  2YIB A;  3E22 A;  1HR0 H;  4O4L B;  4RAZ A;  5KMG B;  4NXN H;  4NXM H;  2V4D A;  5LP6 C;  3HKC B;  4JI6 B;  3SJB C;  2RGR A;  4TQF A;  2ZNI A;  4X64 B;  5JH7 A;  4GYC B;  3BA8 A;  2F93 B;  1M4U A;  1A0I A;  2WE6 A;  2IM9 A;  3W5O A;  5CA1 B;  3LNN A;  1QQC A;  4CH5 A;  4FLY A;  2VWJ A;  4PZ7 A;  4DR1 B;  3E22 B;  3VQX A;  4U3J B;  5IJ9 B;  5JJE B;  3HKC A;  2HVS A;  1CKN B;  2PGG A;  4UCO A;  3CVZ A;  2HHH H;  2Q7E A;  3K58 A;  4FLZ A;  2UUC B;  5K1P A;  4B3M B;  4X1I B;  1FVI A;  4LF4 B;  1Q8I A;  5LYJ B;  4LF9 B;  4DR4 H;  4LFA H;  2UXD B;  4NVP A;  5JH7 B;  1XMO H;  5J2T A;  1SA0 A;  1X9N A;  4GLX A;  3OTO H;  4WBN A;  3N44 B;  1N34 H;  4O4H A;  5BR8 H;  2HHH B;  2VUG A;  4O4J A;  3TY5 A;  4MTE A;  4DRF A;  4DR7 B;  4O2B B;  3SJA C;  1HNX B;  4B3S H;  3BPZ A;  4EEQ A;  5GON B;  4Q0Y A;  3N2K A;  1Z2P X;  2ZIN A;  4K8X A;  1WH2 A;  2Q7G A;  3T1Y H;  4FM2 A;  2Q2T A;  3UT5 A;  2UU9 H;  1M0W A;  4FLU A;  3NBY B;  5EZY B;  5LA6 A;  4CH6 A;  5D1O A;  3W1G A;  3QF7 A;  1FFX A;  1TUB A;  3U0Z A;  3GJX B;  1S68 A;  4M7E A;  4DRX B;  5IJ0 A;  4LH6 A;  4FM1 A;  3N41 B;  3J7A K;  4DV3 B;  4YY3 H;  5BMV B;  5EOY A;  5IYZ A;  4DR2 B;  4B3S B;  3FMA A;  1TA8 A;  1BJT A;  5EIB D;  4EQ5 A;  5J2U A;  4FM0 A;  5LOV A;  2ZM6 H;  1SKV A;  3UT5 B;  2GV9 A;  2HVQ A;  1WN7 A;  3LML A;  2WYO A;  4DK0 A;  5LP6 A;  1S5J A;  4JI7 B;  3JAW A;  4X66 H;  5IT9 W;  4TUY B;  4JI3 H;  4JI5 B;  4DRX A;  5A2Q W;  3M4I A;  3GB8 B;  4I7H A;  2UUA B;  2YI8 A;  4UFZ A;  3IG0 A;  1N32 B;  3BAA A;  3RJ0 A;  3T1H H;  5LMN H;  2O03 A;  2YI9 A;  4LF6 H;  1CKN A;  1FJG H;  4B3T H;  3GDE A;  2HIX A;  3JAK B;  5JVD A;  3S24 A;  3U11 A;  1HNX H;  1QHT A;  5JQG A;  1I94 H;  4DR4 B;  3HKD B;  4ZHQ A;  2KSW A;  1O75 A;  4OX9 B;  3JAL B;  4RB2 C;  1TGO A;  3RGX A;  4PHZ A;  3L4J A;  4O4J B;  3J81 W;  1L8D A;  2Q0A A;  3HKB B;  5KX5 A;  2F4V B;  2PYL A;  4IIJ B;  5D5P A;  4PZ8 A;  5D1P A;  3KAL A;  3K57 A;  1P49 A;  3N6X A;  4FM9 A;  2YIA A;  1BGW A;  3JAK A;  5JVD B;  4LFC H;  2MCT A;  2CFM A;  4DUY H;  4LFA B;  2JS5 A;  3BHP A;  3A2F A;  3HKD A;  1HW7 A;  1TAE A;  2R70 A;  1XNQ H;  4B3R H;  4O2A A;  3SR2 C;  1N36 B;  4DV4 H;  1RSO A;  2CW8 A;  3KAJ A;  3OTF A;  3JAT B;  3HKE A;  4X1K A;  4FVM A;  3RWR D;  4I4T B;  5KMG A;  5C8Y B;  1I94 B;  4X64 H;  4DUZ B;  4DV1 H;  4DR5 H;  4YHH H;  1Q5O A;  5JCO C;  1XNQ B;  4B3R B;  2HGS A;  3BA9 A;  3VQY A;  4K0K H;  2ZM6 B;  2JGU A;  4LF7 H;  5DIS C;  4FLW A;  5K1X A;  4IAJ A;  3JAW B;  4RB3 C;  5LXT B;  3FFQ A;  5CA0 B;  3L4K A;  4JI1 H;  4Q6G A;  2KKW A;  3N2G A;  4DR1 H;  1I6U A;  4I4T A;  4TQD A;  4LR3 A;  3SJC C;  3CHX A;  2XIG A;  3C0F B;  1HNW H;  4CS2 A;  4I50 A;  4BW9 A;  3QWU A;  4E6N A;  1XI1 A;  4BWA A;  1JFF B;  1ZHS A;  5CB4 A;  2Q7H A;  1D5A A;  3K5N A;  4DV6 H;  2ZNJ A;  4DV2 B;  4X1Y A;  1FKA H;  1VS0 A;  1J5E B;  4X65 H;  1WPB A;  3NC0 B;  4JYA B;  2PTM A;  3JAL A;  4UCU A;  2WDT A;  5LMN B;  1XDN A;  4DR6 B;  1Z5W A;  1N32 H;  5KHK A;  3RR5 A;  4O4L A;  5GON A;  3HKB A;  3KAK A;  1B04 A;  4I50 B;  2RJZ A;  4D7S A;  4CS3 A;  4AQY B;  4IIJ A;  3JAR B;  5LL6 b;  4X65 B;  5FLX W;  2R9A A;  4YHH B;  4X66 B;  4RB0 A;  3RF2 A;  4DV6 B;  4DR5 B;  1IBK H;  3RYH B;  4K0K B;  1KMI Z;  4X1Y B;  4X20 B;  4AQY H;  1SEI A;  3H20 A;  4APM A;  4CH4 A;  4GKJ B;  3T1H B;  5BMV A;  2OWO A;  4LFB H;  3JSN A;  3RYF A;  5EIB C;  4JI8 H;  1CKM A;  4IHJ A;  2CAZ C;  3HKE B;  4LNU B;  2UXD H;  4DR3 B;  4JI3 B;  1HNZ B;  2UUB H;  3ICX A;  5J2U B;  2VWK A;  2YIB D;  5FNV B;  4FLV A;  4K8Z A;  1P16 A;  4LF5 H;  3CSX A;  2BTQ B;  1XQ8 A;  1XHX A;  3ETQ A;  3JAS B;  4O4I B;  4JI2 H;  2XHB A;  4CC5 A;  4DUY B;  1NT2 B;  4X20 A;  4PZ6 A;  1TVK A;  4F6R A;  3BAB A;  4UCS A;  4O4H B;  5CA0 A;  4EFE A;  4AIL C;  4JV5 B;  1N33 H;  2ZIO A;  4X62 H;  2VOB A;  4IHJ B;  3HXL A;  3U10 A;  4GKK B;  3N2K B;  1XMQ B;  1Z2O X;  1DGS A;  4TV8 B;  4GKJ H;  4I9Q A;  4ETS A;  4DR6 H;  1G6U A;  4JI0 H;  5JQG B;  5D1O B;  3IAY A;  4ZHQ B;  3EYY A;  4EB6 B;  3JSL A;  2QJ1 A;  1H2S B;  3RFR A;  3TY9 A;  4F6R B;  3ZED A;  5CA1 A;  4GKK H;  4DUZ H;  5KHG A;  1Q43 A;  4LH7 A;  3DF7 A;  2VPS A;  4D7T A;  5KX5 B;  4B08 A;  3OTO B;  1N34 B;  3KXY T;  1JMK C;  5IJ9 A;  3JAM W;  1IBL B;  4TV8 A;  4TV9 B;  1XK5 A;  3JAR A;  4LF8 B;  3N42 B;  3KYH C;  3RYC B;  1CKO A;  4CS4 A;  5LYJ A;  1E4F T;  3K59 A;  5LP6 B;  2P22 C;  4JI2 B;  4DV2 H;  5EYP A;  4B3M H;  4TUY A;  4O2A B;  3VQV A;  1SA0 B;  2W57 A;  5KHH A;  2UXC B;  4WBN B;  4JI4 H;  3NBZ B;  4JYA H;  3VNN A;  3JAT A;  3ZS8 C;  1E4G T;  1SQF A;  3DSQ A;  2F95 B;  4ZI7 B;  4X62 B;  5IWA B;  4DV7 H;  4DV0 B;  1GYF A;  2P5O A;  5D5Q A;  4JI4 B;  2UXC H;  5KHJ A;  1IBK B;  5KHI A;  2BTQ A;  3RYC A;  4DK1 A;  2ZCE A;  3WB2 A;  5EZY A;  5LA6 B;  3WB0 A;  1Z5V A;  3THO A;  3RYI B;  1XMO B;  5LXT A;  1TUB B;  3K5M A;  4DV1 B;  5FPO A;  1TVK B;  2VQF B;  3RIZ A;  1JJO A;  5BR8 B;  3PN1 A;  1M93 A;  1SYX B;  4RAY A;  1IBM H;  4LFB B;  1MZB A;  2CW7 A;  1O9H A;  4JI8 B;  2UXB B;  1XHZ A;  2E5L H;  4ZI7 A;  5IWA H;  4LSX A;  3RGZ A;  4U3J A;  4MV7 A;  2QM4 A;  2VQF H;  3M7M X;  3QG5 A;  5FD5 A;  2HEP A;  2RQ6 A;  5LOV B;  1IBL H;  4DV4 B;  4X1I A;  1N36 H;  4YJ2 B;  5LMU H;  2FE3 A;  4I55 A;  5J2T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...