3ETHA

Crystal structure of e. coli purk in complex with mgatp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
b'MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3ethA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3ethA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ethA01
5CA0F 2FB9A 4ME6A 3VA7A 1B6SA 1EYZA 3MJFA 3VPBA 1VKZA 2WYOA 3U55A 4TV8F 3MWDA 4O7VA 4C5AA 4YAJB 4O7YA 4FFOA 2YRWA 4YAKB 2YZMA 5LYJF 1CS0A 4I4TF 4IHJF 4ZI7F 2YS7A 1KUTA 4FFRA 2I8CA 4XX0B 2QK4A 1WR2A 3KAJA 3R5HA 4MAMA 5KX5F 1W96A 2R85A 4O4IF 2W6OA 3VMMA 1EUCB 5CAEB 2V59A 1KJJA 3U9TA 3TIGA 3RV3A 1GSHA 3SE7A 3N6RA 5LA6F 1KJIA 1VBGA 3Q2OA 2HJWA 4L1KA 2R6FA 2W6NA 3V4ZA 4FFMA 4O7NA 4MV9A 5DMXA 5H80A 2Z04A 1DV1A 4FFPA 3HB9A 2R84A 2W71A 1Z2OX 4J6EA 5GONF 3E5NA 3WO0A 2W6QA 2FP4B 4IZOA 3AX6A 5JVDF 1C30A 2XD4A 1T36A 4XZ3B 5D8DA 4HQ6A 3ORRA 2YWVA 2NPOA 4O7LA 4O7RA 4NYEA 5BPHA 4O7ZA 2DWCA 5J2UF 2GPSA 3GLKA 4MA0A 3JRWA 1C3OA 3NUAA 1Z2NX 4ZQIA 3K5HA 3GIDA 5IYZF 2CNUA 4O86A 1BNCA 4O4JF 2YYAA 2QF7A 2W70A 4M9CA 2GPWA 5JVLA 2R7KA 1PX2A 1BXRA 3QFFA 2I87A 1A9XA 1A48A 2ZDGA 4HNTA 2CNVA 1KJ8A 1DV2A 2NU9B 2VR1A 1SCUB 3BSYA 2CZGA 1CQIB 1I7NA 3WO1A 3BSWA 3R23A 3G8CA 1GSAA 3UFXB 4EG0A 4O81A 4C5CA 2ZDQA 4XYMB 2J9GA 2P0AA 2CQYA 4O4HF 5BPFA 4I55F 4O7TA 1EUDB 4RZQA 4C5BA 5EZYF 4FU0A 4O2BF 3V4SA 3KALA 2YW2A 1E4EB 3N8DA 4ZOLF 3VOTA 3KREA 1B6RA 5FNVF 5KKNB 2OLSA 2ZDHA 2YZGA 4O82A 2PBZA 4EA7A 2XCLA 3VPDA 4O84A 3BG5A 4M99A 3MWEA 1GGOA 5HV6A 1E4EA 2V58A 1IOWA 5K2MA 4IWYA 2V5AA 3ORQA 4WD3A 4IWXA 2IP4A 4M9UA 2I80A 3OUUA 4FFNA 2NU6B 4TUYF 3BFPA 2NUAB 3RFCA 2DLNA 1M6VA 1Z2PX 5C8YF 1KC7A 3VPCA 1DIKA 1EZ1A 4EAAA 5JH7F 2HGSA 3HBLA 4O83A 1GSOA 2YZLA 5JQGF 3LWBA 1M0TA 2GQRA 5C1OA 1IOVA 1VBHA 1KJQA 1CQJB 5J2TF 2NU8B 2R86A 4MV6A 1M0WA 4MV3A 4EGJA 4MV8A 4O4LF 3K5IA 1KEEA 2FPIB 4FE2A 2VHEA 1UC9A 4MA5A 5LOVF 3ETHA 2NU7B 1OBGA 2PN1A 1ULZA 3HO8A 2R82A 3U54A 2PVPA 3Q1KA 1OBDA 3KAKA 5HBRB 1EHIA 4YBZB 1JDBB 3K3PA 3LP8A 4O7WA 4YJ2F 4HR7A 2FPGB 2X0SA 2C00A 5CB4F 2YL2A 2DIKA 4O7SA 3R5FA 2YZNA 3JZIA 4EGQA 4IIJF 4O2AF 1W93A 1AUVA 5C1PA 2GQSA 1CE8A 4E4TA 3U9SA 3DF7A 4Y8VB 1JDEA 4DLKA 2FPPB 1I7LA 5CA1F 4I50F 3ETJA 1JLLB 2VQDA 4EABA 2R7MA 2W6PA 4M98A 3R5XA 4EA9A 4QSHA 5I47A 1GLVA 4TV9F 4YB8B 3G8DA 3OUZA 1KBLA 1UC8A 3RUPA 2VPQA 2W6ZA 3JZFA 1JKJB 2YRXA 3TIIA 4GGMX 2GLTA 2W6MA 3BSSA 1PK8A 3AW8A 1KJ9A 5BMVF 3TINA 2CNQA 2R7NA 2Z02A 3R9RA 4MV7A 4WBNF 3TW6A 1AUXA 5LXTF 4HNUA 4MV4A 4MV1A 3WNZA 4FGRA 5JQWA 2SCUB 3JRXA 4YJ3F 3RV4A 2R87A 2R7LA 5LP6F 4FFLA 4DIMA 4HNVA 2DZDA 4XYLB 3I12A 4EA8A 4ZHQF 2YS6A 3TQTA
chains in the Genus database with same CATH superfamily
1EVEA 4P54A 4LFCB 1T8YA 2IDKA 5BV7A 2HJRA 2IGBA 1PYOA 3AUUA 3PVCA 2RG1A 4JJEA 1L8QA 4L4ZA 2W2LA 1XZQA 2FW6A 4Q3EA 4RH0A 2BIFA 5LYJF 2SKDA 1XX6A 1J0XO 1QRAA 2WTXA 5F52A 3ZGXA 3N2GB 3T7SA 2KSQA 3ZCVA 4CN9A 1YDFA 2QTGA 2RI1A 3MC1A 3VMMA 2GFQA 4PFJA 5JS2A 2WV9A 1PFGA 4JKOA 3KK0A 1GPNA 3IT0A 5F2EA 4LGMA 1CEQA 4KBFA 3VZPA 2VDOB 4GQBA 2GNAA 4B9EA 5K0ZA 1E2BA 4BC0A 5AR1A 4KEAA 3H8VA 1TNDA 2HN9A 2XUFA 1G0OA 5FPQA 3WWEA 2AZMA 5EIFA 1RYFA 5BT9A 4P8RA 1NY6A 2J4FA 2YBDA 1EGHA 3BGIA 2DSTA 1HL3A 1U8CB 3WC4A 2FDXA 1SBIA 3TAXA 1WPXA 2IYVA 4TMKA 4X90A 3LF1A 3NTXA 1OX6A 3HXOA 4GLXA 3HRIA 3G9UA 5K3BA 4NYEA 2J3JA 2V1UA 1VLVA 3FIJA 4WLNA 1G7CA 3VYRB 2AG5A 2ZROA 2P67A 1UMDB 4G65A 4HZIA 3GZ4A 3FUXA 4WEQA 5D1HA 3VJRA 3TD2A 1FSGA 3U0GA 3JAWB 1DEKA 3ENQA 2WU3A 4G5XA 5BRJA 1ETUA 3R6WA 4BO8A 3B1XA 4OA5A 4PNZA 1Y9AA 1E5QA 5J4LA 2ZRIA 5C0OE 1CR4A 4FGSA 1GSAA 1HFJA 5K0SA 2H4ZA 5B6IA 1PLLA 4MO9A 3U44A 2MSEB 1G8KA 4E4RA 4DLPA 3NWBA 4IGIA 1EVZA 2GEVA 5C5EA 1WZ2A 1DJQA 1O5TA 1ZM7A 4RF5A 1XD2B 3F67A 4H59A 2HC9A 3G2HA 5HA5A 1TIBA 5JVDA 4E22A 4FKZA 3ZD7A 1HTBA 2OOKA 3B6ZA 2X0NA 2IYFA 1GYRA 5KUTA 5A71A 1T4DA 1E9FA 5HKKD 1WKVA 3O1JC 4LMRA 3HCDA 4FN5A 3LZCA 3DMTA 2I2CA 1DAPA 4BX0A 1GR0A 3MWGA 2C29D 2R7ZG 2P1DA 2WZQA 3SEAA 5F9FA 4IRCA 4JBLA 4LJSA 5ALOA 3NG1A 5GM2A 4YGXB 1JJAA 4LOJA 3SR3A 3JQAD 2PR7A 2D7CA 3TSOA 2O07A 4GU5A 3PEWA 3QM1A 3O2NA 2J6CA 5DSXA 2ZXUA 2FSHA 3WGKA 1CS0B 3ILYA 3FHCB 1V47A 5A3QA 2PU7A 1RYDA 4J1TC 2ZYRA 4J8PA 5M04A 3A11A 2ZBEA 4COOA 3WNVA 2JLXA 3ZTTA 5KFJA 1TM5E 1V41E 5BW8A 2W0MA 4AJHA 1D0VA 2WV7A 3IXLA 3TZBA 1WE2A 3QJYA 2H4WA 4S1PA 5IZCC 1SCKA 1JR3A 1RRKA 2WSMA 3AYZB 2X0EA 3KDAA 5HZKA 2EJCA 3FB4A 5I4KA 4QD3A 2IOQA 2OFWA 4DMLA 3GIWA 3ONFA 3KHKA 2FR0A 4XQEA 4Q3NA 4HY3A 2G1UA 4N39A 5E7QA 2CNLA 4EA9A 2WTNA 2JVIA 3QVSA 3N2IA 2OKCA 3S1AA 2X9GA 3NRCA 5EJ4A 1CY7A 2C2OA 2I76A 1XNHA 3OC6A 4RGYA 1JEQB 3NRBA 1UK6A 5EIEA 2B69A 2PQMA 4ZHQA 1HDOA 4QLAA 3EBLA 2GM9A 3NCHA 4QTZA 2ZU0C 4J2OA 1N3IA 3IIJA 4M0CA 1H5UA 1LS6A 4RVSA 1VHJA 2WHRA 5FUVA 3VKVA 4HMPA 3RQSA 3VA7A 5ALTA 5CXUA 3IODA 2PNJA 1PT7A 4G8DA 3MTBA 5F1OA 2BGLA 2YZMA 2FRVA 3UVEA 4GXRA 4NCXA 4BO5A 3IUSA 1G5HA 2BCJQ 3TW8A 1JHDA 2X4DA 3X1MA 5HUHA 3IALA 3R0IA 4OD0A 4TQRA 1PS9A 1VB3A 1ZJYA 4YECA 3SVLA 3X1XA 1UBTS 5AOCA 1YONA 1SBCA 1S3IA 1Z3IX 1KAGA 3V4ZA 4V0LA 5FTNA 4RELA 4DR7H 5AYVA 4YGYA 2FPPA 4LF8B 5KQRA 2JIOA 3MAGA 3OBBA 2V55B 1U9IC 5G4KB 5KAMA 3MAJA 1ZHSA 2OV2A 4H31A 2B1GA 4HFMA 2PUJA 5EDWA 4W6QA 4P5PA 4B3SB 3OTQA 3ME5A 3PPVA 5HXAA 2P68A 4LV8B 1IIBA 3L8GA 1SRRA 2FE4A 2F3UA 2WFZA 4NLLA 3LRXA 3C0FB 4H4EA 721PA 4GOND 3CF0A 4JOBA 4KSCA 3GV7B 2C9ZA 3LK7A 3OIDA 2DKFA 3VC2A 2VEDA 3IB3A 3ZWPA 1MAVA 2O48X 1W59A 1KHHA 1MB0A 2HQRA 2PLFA 3JPYA 4F3YA 1P73A 1E4FT 4TXLA 1AO3A 3ZKWB 1JAHA 1YQEA 4OKSA 3U7IA 3NTQA 1TJ5A 1NBME 5CPFA 3TAUA 4EG4A 4B31A 1GTG1 3FPAA 1XRNA 4BRWA 3VZCA 5KI6A 2HLHA 3LVQE 2P5TB 3UNXA 2Q8QA 4F7WA 1CHNA 3MCTA 2G04A 4I6JA 3O7WA 4KRGA 3E9CA 4D99A 1RXSA 2XB2A 3ETGA 2EBUA 4RDCA 4RF4A 5IUKC 4G5QA 1DAGA 1KI9A 4C0JA 1D7OA 1E5DA 5BRAA 1PT8A 3UXHA 5AUNB 1T9HA 3G02A 1AIPA 1C7EA 1VHLA 1UBGA 5C7OO 1W9HA 4EA7A 3PFGA 5ERGB 2XMSA 1KTVA 3L7DA 2OXFA 3BRWD 4U6QA 5CW1A 3DMFA 3MQ2A 3U4DA 3R9IA 5CBPB 5D7BA 4WD3A 2C1EA 3GRFA 2R6CA 2Y1LA 1D6JA 1DC6A 1VG9B 1P16A 3GXBA 4LCJA 2IYRA 2Q1WA 3AY6A 3RU7A 3O5AA 4EGAA 1BN6A 1Y8ZA 3RC3A 13PKA 1XK7A 5HOQA 3SSAA 1NT2A 2IWHA 3WLTA 3QI2A 3I45A 3CFYA 5H5JA 4IUDS 5EQFA 1U0OC 4RBNA 2GYYA 4FZ3A 5ILGA 1JYFA 4X63A 3AM3A 3BHJA 3ZV5A 2VZEA 5DLYA 2V5UA 2B7CA 2OBMA 1VLLA 4PBTA 1V95A 2WHPB 1SWVA 2D2XA 1A71A 1J0BA 3K15A 5KFHA 2A9PA 3I2IA 1DFIA 4YAGA 1WCXA 4KO2S 3HXQA 2A86A 5J9FA 4CC5A 3UJBA 1FX0B 4DCOA 2BBOA 3HWSA 3NC4A 3F96A 4YP5A 1SCUA 2FFAA 4CBVA 3V1LA 2X14A 3H11B 5H02A 4HVLA 1VHQA 2X1HA 2HNKA 3A1FA 3E03A 5JBIA 4G86A 5CH8A 3HNOA 3VH2A 1NTRA 1W5BA 5DF1A 3OT1A 1P45A 3M8KA 4E5MA 4LVNA 5CFMA 1JIXA 3FWPA 4WVFA 4M0PA 1E3IA 4TV9F 3IIIA 3GLUA 3EVTA 5F1YA 3EUAA 4P86A 3Q9UA 3UT5A 1LH0A 2WAMA 2TMGA 4GLOA 1ST3A 2UUCB 2QHXA 2RGXA 5HNKA 1EK0A 5KFFA 3N3AC 4D9GA 2IGTA 3FUCA 3LOQA 2GPAA 5H82A 4AZ0A 4RA6B 1U6JA 4CKBA 5L1IA 5K8LA 3ZJTA 2C99A 3AIIA 4MVWA 3T4PA 3O2SB 4KQIA 1M5UA 2ZQYA 4CL3A 3L7IA 3QVJA 3DFKA 1LK5A 3A2LA 2JGKA 1RC8A 1EWQA 1CJCA 3HBJA 4WK4B 5F9HA 2O6HA 1YC2A 4FT4A 1ZXLA 2EZTA 3P32A 4HUQB 1L7XA 2Q2UA 5ALHA 4KKXB 2R60A 1A96A 1L4BA 2WD9A 4WZZA 3EF1A 4BEWA 4RSMA 5FWAA 2HQBA 4OJTA 3PTAA 3U9TA 1X87A 3ADCA 4ZVSA 1GYPA 3V9AA 2QG9A 4Q05A 3FPFA 4NQZA 4JYZA 4FFMA 2J85A 5EIWA 2O2CA 3RHTA 1D6MA 1R8YA 1DINA 3OBIA 3OWXA 2VRCD 4FLMA 4FYXA 4V3CA 5IT0A 1U3FA 1YKSA 3O9VA 5IAAA 1YI0A 4BO7A 1K2WA 5JAUA 4OJMX 2H8KA 2HLNA 4PQRA 5CW2A 3RRXA 5A7FA 5P8WA 1XMSA 2AQHA 4A0RA 4EJ6A 1WWKA 2BFDA 3FPLA 3QITA 4ZVQA 4DL3A 3PCRB 4L0QA 3D2CA 4UBOA 3AI1A 3WWIA 5LLSA 3FTPA 1JVSA 1P18A 3GEGA 2M1ZA 2QBYB 4B8ZA 3ZDCA 4C0QC 2J3MA 5DNAA 2C9OA 2WWVD 2R8IA 3U16A 4NJOA 4LJ8A 1FS4A 1TF7A 4J16C 5K8IA 3P45A 5KFAA 2DWOA 1NW5A 4JB3A 5FNVA 3VOSA 3KHTA 3N2KA 4UTVA 2II6A 3SR0A 2MHCA 1E77A 3DKPA 3ZZTA 3TBFA 3W2TA 4JI1H 4Z0HO 2WMDA 1PJAA 4EHAA 5BWCA 3G2IA 3ESAA 3BN3A 2DPHA 2E1RA 1VM6A 4EG1A 1DBVO 3M9OB 1HG1A 4I9UA 2ZYGA 3GRCA 4CLDA 3SXUB 3E0QA 4LGVA 2P9BA 4I99A 1PD1A 3D6JA 821PA 2XCRB 5AI0A 4LY3A 1V4YA 2WWRA 2RKWA 2FZGA 4CG0A 5JLAA 4MP3A 4ZO7A 4CGYA 1PJQA 1YBMA 1KOFA 3ETDA 2ECKA 1M1XB 2L42A 5B3JA 1YDEA 3LQKA 5LP1A 4C03A 4YAIA 3K70B 2GHIA 5K8VA 3IOBA 1J5PA 1T9DA 1ZYUA 3SAJA 1M0WA 4DA6A 1BZYA 5GGYA 4MVJD 1Z16A 4FE2A 2CHEA 2XCOA 1GARA 3ZV3A 2XGSA 4FS8A 1QOZA 3C97A 2BQRA 1OXSC 4R5MA 4Z54A 1FFGA 5IBPA 3F7MA 4AJOA 4QODA 4JP1A 1ZAKA 4KE9A 4XVHA 1FFXA 1QRRA 3EQ6A 2OAP1 1EZ4A 2PRJA 3NX4A 1AD2A 1E9RA 2P4QA 3KXYT 3IEUA 4R0MA 3UJCA 3MJEA 2UXBB 1IXZA 5ENZA 4ZTUB 3DDOA 3F8NA 3OCUA 3ZYZA 4BRSA 4A3SA 2IE8A 3U3XA 4PG4A 2CHGA 3NI2A 1B04A 3TGLA 4TT3A 4OTZA 4RFSB 5KFXA 1KSJA 3K2EA 2WNSA 4YH1A 2IPLA 1QTNA 1Z4PX 3QEMA 1ULBA 1UEIA 1WSAA 2B63A 1PCXA 4RX1A 5CA0B 2P35A 5CLJA 4UFNA 1ZGCA 1JJFA 1XQXA 1L4KA 4FBGA 4D41A 4NHEA 3TDKA 1B2RA 4D56A 3E9QA 1HQKA 4AMZA 3EGXA 1OVMA 4OMUA 1QB8A 1SEVA 5FOWA 2HMSA 1DRUA 2X4IA 2NUAA 2YCLA 3BXXA 4AUKA 4B43A 4A9AA 1JLRA 1WXIA 4J1TA 2PUBA 3KQUA 4YJ2A 1LRKA 3M9XA 3BL5A 2O2SA 2E5FA 2HMTA 4OKIA 2FPLA 3D8NA 1O0CA 2CVZA 2Q2TA 4JLBA 1U5AA 2NQTA 2YBEA 1T26A 1FDOA 4QAJA 3GIPA 3QV1A 5IZCA 4QGFA 1MW9X 2GESA 1Q95A 4ER5A 2DAAA 3IEXA 1HNNA 1OAAA 1C8VB 3DVSX 1YJQA 3SYKA 3ZNPA 4UU1A 2BY4A 1ZS9A 3D3QA 4XD7A 4KV7A 2ZCJA 2ZIZA 3WL7A 4O3PA 1XHLA 3MWEB 2X1LA 4NDAA 2WTAA 1V7PC 1Q1QA 1N34B 3DBRB 5ES4B 3CGGA 3SY8A 5ALGA 5H1YA 2X5KO 3IA2A 2IBKA 1TQ8A 1U9CA 1DTSA 3LY9A 4QWDA 4LEIA 2P30A 3RANA 4HC4A 3FOFC 1W85A 3FMOB 4QVGA 3U4CA 5JZOA 2PMZA 3KKMA 4B85A 4ZP1A 3UB2A 4YCLA 1F8FA 1Q84A 1KRXA 1VI6A 4V0MA 1UC5B 3WWCA 2C3OA 4JDPA 4MMZB 3OO1A 2FYTA 2C4TA 3CF6R 1NQTA 3DTVB 5IP7G 1T2CA 1SIOA 4DADA 3NUAA 3UK7A 4W5JA 2GBIA 4D1YA 4LYGA 3C0KA 4M86A 2X7HA 5HRCA 4GKJH 2IH4A 1Z0DA 3T3HA 1QYWA 3BZBA 4HWGA 4OHMA 2Y1EA 1GA1A 3FROA 4XVRA 4QU5A 1MX5A 1K68A 3M5DA 3OOEA 4A1FA 4ZOLA 1CSEE 5DW0A 4NBSA 4V03A 2ZI3A 3L92A 1KMMA 3D7NA 2ADOA 9LDBA 4UKDA 4O2BF 2HB6A 1E59A 1QF9A 5IBQA 1ULSA 2PUHA 5AM0A 4CN8A 1OV4A 3TOXA 3VC3A 1UODA 4DAOA 5JCZA 4PHGA 1U3GA 4WBXC 3HCRA 1JQEA 3EK2A 5DXJA 3MFYA 1FDTA 1G7SA 4ZO4A 1XRQA 4JI4H 4A3IG 3Q15C 1ZA1A 1Y63A 2QL5A 2V9PA 3FCOA 1PK7A 5IM5A 5I7VA 2B21A 5JCOA 4Z4CA 3WMGA 1JG3A 1FP4B 5JH7F 2YY7A 4F7DA 3AOGA 2GKOA 4QEZA 3IUYA 4YI5A 5IM4F 5KFIA 3VYTB 2R86A 5KOJA 4ZAXA 2LIPA 3UMMA 2I2FA 2V6FA 4EUSA 3QJGA 3W0LB 1E9DA 3NAZA 2A9QA 4DCUA 2QG4A 5K0BA 3K4HA 2Y71A 4RVCA 1NXPA 3AI2A 4TGLA 3PXDA 2JLUA 4X1YA 1RU3A 2BM0A 2XXJA 4DR7B 1DOHA 1NC3A 4QPDA 2OR3A 1GFIA 4U2DA 4N3CA 1K9VF 2Z4TA 4U7TB 3BGWA 1GGFA 2NSYA 1XRPA 3MRTA 3JASA 3B6JA 5EQJB 3N8HA 2IQIA 3DWFA 2ACWA 4ZDKA 4L7VA 5D2CA 3TLYA 4DT1B 3ABZA 2V4QA 1YQ9A 1BFUA 3CF4G 3QU7A 4WVLA 3KR1A 1Q5PA 1YRLA 2FAXA 1W4RA 1TCUA 2VDQB 4HSEA 4Z4EA 2H07A 3GLVA 4KXWA 3QPVA 3GFSA 4O3OA 1Y3AA 1C7FA 4PM4A 1VTKA 1SCBA 4JBXA 3MCVA 4DA0A 2XNSA 2OB1A 4P3NA 4CQMD 1XPRA 4YMUA 1AUXA 5SY6A 4CE6A 1K4MA 1RPTA 3WNZA 1QZ3A 4BCDA 4L0CA 5A9RA 5DCLA 2FXVA 3H16A 4EHFA 2PCLA 5I48A 3LT1A 3RVDA 3RRFA 1TC1A 5BY2A 1EQUA 2G1AA 2TMKA 3GIJA 4LGYA 2AJBA 4NJMB 2QRQA 2XXAB 4AY4A 3PGJA 1GU1A 5AMXA 4WZBE 4FFOA 3UFBA 3UGTA 3AYHB 2NUPB 4TS9A 1Y7HA 4ARAA 3UBMA 1YOBA 2I4TA 1FYDA 3DL4A 4O4IF 2ZS7A 3JYHA 2C2YA 3SJAA 1Z5UA 4DLVA 3P0EA 1OASA 3PUVA 3MTDA 4MW2A 1TKBA 4JMLA 1KWKA 1BKSB 4PO8A 2GK3A 4ESHA 1JXLA 5L3VA 5JJIA 3C3YA 1E4OA 4A8PA 4CWAA 4XD2A 3L0BA 2I1LA 1W6RA 3PDHA 2X8LA 5IAEA 3IRVA 1JDUA 4A6XA 3G7UA 2IY9A 1D6SA 4M8LA 2C96A 5FA6A 3OQIB 3QPUA 2JFNA 1BEEA 1ISJA 1PX0A 5AW3A 3GPBA 4PFQA 2WG2A 2XX3A 1SKYE 3IA7A 4XLTA 2CCGA 1H3EA 4XH9B 4IGEA 2CMDA 1S7GA 3AUYA 1HNZB 1DCKA 4EJ0A 1D9ZA 4WCVA 4BVEA 2Y6VA 2YICA 4UTPA 4MWDA 1V1JA 2FPOA 3MWJA 4AZWA 5AW1A 4RVUA 4B0PA 1ZH6A 2EWWA 4DIFA 5JTTA 4HATA 4B6OA 3C4VA 1ZMXA 5ECWA 3NPMA 4ETIA 2XOEA 3MLAA 5BQXA 1NF3A 3TQHA 3M70A 4ZVUA 4EG0A 1FRQA 1UXKA 1U8XX 4Y6OA 2QX4A 5JEEA 2ID4A 3SBDA 5CT4A 4G4SP 4BN4A 2BMVA 5J1SB 4FGLA 1NN3A 5IAGA 4A3BG 1AN7A 3UPUA 2O6LA 1NQOA 1VKHA 3CCFA 1KWGA 3KYCB 3CZPA 4Q3DA 4MI1A 4U4AA 4XVUA 3QXXA 4H1TA 2ABJA 3NH9A 2DTDA 3RC2A 1NVXQ 1DFGA 3VDRA 3QYPA 1UBMS 7REQB 3D8TA 4J2HA 4JI5B 2EGGA 3VKGA 4POOA 1OLUA 2V1XA 3IOYA 4KO1S 3GG9A 1VKRA 1WXGA 1UNNC 4LSZA 4N6GA 1GEGA 2IIVA 4JFAA 3NHYA 1NVGA 1VHWA 3ANLA 3W3AH 1YIAA 4YPFA 3AR9A 1E1YA 2YHBA 3UA3A 4J16A 3NWEA 2QW1A 2IUEA 5TJHA 4KDCA 4D6YA 2IIQA 1TMGE 3MINB 4KQHA 4A3GG 1O5OA 5L1KA 2QQ0A 3D4OA 5G41A 1BHQ1 4ECRA 2P5UA 2EBFX 3MUEA 1DQNA 2DKOA 2E4UA 1WCWA 2OCBA 4TQUS 3VSCA 1L4GA 3R41A 3CNEA 1PR1A 2AE1A 3L8DA 5MGNA 1TGVA 3R3SA 1GGJA 4J0GA 3ZWXA 3O2JA 1BWPA 1LLCA 2QD5A 4PZCA 1EGMB 4RD1A 3CUTA 3FNBA 1XQ6A 5EXPA 5GAJA 4WBNA 5ALQA 2I3AA 2FPUA 3ES9A 1EFVA 4CCAA 1RZRD 1W36D 2Q6TA 3IPRA 3ZPXA 3A70A 3SS7X 3JAKA 3UT6A 4FR0A 5H9VA 1IONA 2ZTMA 2O8BB 3EXFB 4EAQA 2J1LA 1Q83A 4X3CA 1W7AA 3U3DA 1Y1QA 1HMPA 3P9IA 4RLHA 1GNPA 1JLMA 5ICGA 1IM8A 3Q8KA 1XYVA 1P0MA 5EZYB 2R79A 1NWCA 4Y67A 2AR0A 2C7GA 2VPYA 2VQ6A 4JI1B 1G21B 4TMZA 1I50A 2RHBA 5AJHA 2Y4NA 3KOYA 4F06A 2X9QA 3NNNA 4LXQA 1W52X 2DOKA 3SE0A 3RTEA 2REXB 3KXKA 3IBFA 2YMMA 2BHNA 2G72A 4G4JA 3OFJA 3F8SA 1YA8A 4YRPA 3SNOA 3DXFA 5LDHA 2ZCUA 1Q17A 4PPYA 2FGJA 5A0FA 4P82A 3RM3A 3M34A 2W7PA 3VSBA 4RTQA 3T8YA 1VQ1A 3A6KA 1Q74A 4ARUA 3DFMA 3RS3A 4Y1GA 2NPIA 1CLUA 3ZW8A 2CYCA 2FRXA 4M2LA 1UOEA 3IP8A 3EMBA 1HWYA 1J8MF 4FZJA 4D3DA 1VE1A 3UXMA 1HYEA 4J0DA 2PGNA 5BWXA 3HBMA 5FAKA 4JA2A 4XM1A 3DYBA 2D1YA 3OJCA 1P72A 1Z3CA 2ZB4A 4F4ZA 3FR8A 4A2AA 4WK0B 3AESA 1G2QA 1AQLA 1TU3A 1T4GA 3ZJVA 5DG9A 1OGIA 4D80A 1C9KA 1VMIA 2G9RA 3B85A 2RDJA 5BYJA 3H2GA 3WRWA 5C53B 4YT2A 2QL7A 1RZ3A 2HQOA 1WUJS 3LSTA 3QELA 3DBLB 3B12A 2ATIA 4YAJA 3R23A 1GV1A 1R12A 3GJ7A 3VRHA 3BJZA 3HCNA 2CQYA 4YAKA 3ET5A 5JYCA 3ZD8A 4MRRA 2H1FA 3JWEA 3QNUA 3FUVA 3GPCA 1XHFA 2Z9CA 5FL3A 3UCEA 5EG5A 1JQJC 5DNDA 3WMXA 3VPHA 4JOCA 4CJXA 4DILA 5I8PA 1B4DA 2WMOB 1M0EA 3GARA 4JVMA 4NK4A 4REQA 1Z7WA 2SNIE 1QG4A 3HDVA 3GUVA 1AKUA 1B8PA 2F8SA 2QYTA 1SK9A 1WP4A 3IO3A 4DV5H 4HB2A 2ATEA 3LZ6A 4D6PA 2XZLA 4MWCA 4H7DA 3GLIE 4XWYA 2PANA 1XTVA 2ZIXA 1HH4A 3J80A 2HJVA 2H65A 4E31A 3IDZA 4AT1A 3PFHA 3HXTA 4RL6A 2FW9A 2JIRA 3Q11A 3ECAA 4B73A 3ZHBA 3UAVA 1WKBA 3MG9A 5B58T 4C30A 4UZFA 4BMXA 3EGIA 3KWLA 3FGPA 2FJPA 4IYJA 4RE6A 4HQFA 1SWWA 2HLDD 4QPCA 4DNFA 1H2FA 1V1MB 1VL0A 3AFIA 4CV2A 4O7WA 2J3EA 1E9BA 3LLMA 1ZC4A 4TXHA 3D3WA 3KHRA 1ZQ7A 2J3HA 4CM7A 3T52A 2CFRA 4QEKA 2Q8NA 3TKAA 4PC1A 3LBHA 4NMLA 4O02B 3KHGA 1IHYA 1MTOA 3HRHA 4C6TB 5FOSA 5FWXB 4NBUA 4JBGA 5C35A 2W11A 1PHPA 5AW0A 1XKXA 3IEVA 1NONA 5IDYA 4RY0A 5ENDA 1IN4A 2JCGA 1UMBB 3BSSA 3PF8A 1CYEA 4FYYA 3KU1A 3MR6A 1Q91A 3A04A 1K89A 3J7TA 4DQ0A 4U39A 1I2AA 5AKLA 2COGA 4L4RA 3EQZA 3WL4A 4C2TA 1CETA 4A0FA 3AMVA 3ZV6A 2KM1A 1E1NA 2KS6A 2PU5A 4MW4A 4B6EA 1M34B 1RQGA 4G25A 4DDMA 3UGQA 5DBGA 4WOKA 1BDJA 3I2FA 1AKTA 1KJWA 3I53A 3AUXA 2V9CA 3VKWA 4ZI5A 4O5OA 2GWRA 3RJ5A 2VUHB 4O25A 3MILA 4LX8A 4IJQA 2X0JA 3RAXA 2ERYA 1V11A 3M7IA 2HIXA 3KHUA 2QTBA 5I6DA 3OX1A 4TV9A 4HDMB 1V16B 3ITNA 4OQZA 5TE9A 4TMYA 5CDUA 4QW9A 2O2IA 1BTOA 4L72A 5JAIA 4FFPA 4M7EA 5DI9A 1OTXA 4R68A 4FYWA 4DLLA 2YV2A 1EDEA 3U37A 3EGOA 4F0JA 3I0ZA 1OYVA 1QIHA 1DIGA 2XGQA 1VPTA 1D2CA 4ITRC 4M38A 2XTAA 5FD8A 2Y8EA 5BPHA 3PC7A 4JJFA 3GPLA 1W88A 1WX1A 3QPBA 1HNXH 1GGEA 3NHBA 3FLBA 2XUIA 3C3JA 3PGLA 5TGZA 1AA9A 3U2QA 2DFDA 3DVQX 3EAGA 1OX4B 3C39A 4JC8A 1BS2A 5KTSA 3THXA 3JD2A 1FFDA 1PLKA 4XRRA 1DV2A 1MHTA 1VL8A 2ZJ3A 1NLUA 1KH2A 1OROA 3IQIX 3H40A 3ZGVA 1C9DB 5D00A 3ANTA 2WWXA 1XTZA 4EZBA 4X7PA 2NTJA 2X9LA 1X9IA 4TKMA 1N75A 1AX9A 1EUZA 3DZFA 2XD9A 4ZGBA 2APJA 4II2A 4WNIA 1UOQA 3OLWA 4Z9BA 4EVSA 4HDQB 1JA0A 4YRKA 3FR7A 1BVRA 2BCEA 3T1TA 2ANCA 3GB8B 1S0MA 3V6MA 5B7QA 1RQXA 3NXKA 4U2EA 2Y0SA 3S40A 3R4CA 4KH1A 1N1EA 3D4NA 4HNHA 1IATA 3LQRA 1ZINA 3UUWA 4BWFB 4DRYA 2EKZA 2R2AA 5T5QA 2QMZA 3OA0A 3H2HA 4Z0TA 3SHOA 3GUZA 2VJPA 3KVVA 1XVUA 1GEEA 4MV3A 1XYGA 4DABA 2GCIA 4GPAA 5LQSA 2DPXA 4MA5A 5F4BA 2ALZA 3WXBA 5JXHA 1NRIA 3GFGA 3WX0A 3HM2A 1AHPA 1FOEB 4HDKA 1PE0A 2L17A 1BMFD 4Q39A 3MJCA 1Q2UA 3OZUA 1H94A 4FMCF 1L7PA 2FPGB 5ALKA 2GD6A 4BB0A 1JPVA 4QXPA 4IDFA 2PZKA 2B82A 3W5JA 1SC4A 2XUDA 3LI2A 1T3LA 3LM8A 1BCSA 2VAVA 1L7RA 4DL4A 2P90A 2EJ2A 1CRWG 2XBUA 1K4YA 4TX1A 5BR8H 1RKQA 1NX9A 4RGVA 3ICEA 1CY1A 3DL0A 2HU7A 2R68A 3RQIA 3U1VA 4J2TA 4DL2A 1YRYE 4DA4A 1J33A 2WJWA 4OGGA 4GSLA 5FV7A 4K40A 1T24A 3NWOA 4R84A 1AN0A 4YJFB 1N78A 5BNFA 4IH1A 3JV7A 5SZKB 4ZQFA 5L53A 3W5UA 1C3EA 3EVEA 2R6GA 3G8AA 4RZ3A 5K3AA 5KTKA 3E2MA 2LKDA 2Q9BA 2YUIA 2AF3C 3MQ4A 4B3TH 1BXRB 4O3FA 3DXXA 2I6SA 4WINA 2UYOA 3E7FA 5IZ4A 4A03A 1MQSA 5JW6A 2YOGA 1MKYA 2FG6C 4QNMA 1CCWA 2MOKA 2QN2A 5E2IA 1AQIA 3VMFA 1Y9DA 1P4JA 4JJAA 4CFZA 3KQQA 4BNJA 4XWTA 2X0IA 4NYMQ 1DMSA 4KQEA 3WDKA 3WGVA 3EVAA 2M2IA 4Q7MB 2ZSDA 3PHLA 5TV2A 1XCMA 5C5JA 3OFND 2BUAA 4CEHA 3TR6A 1YH3A 1UBNA 2FSGA 3S6JA 3ABSB 2I4LA 1R1DA 3B53X 4GEGA 2H54A 4HGZA 3U7RA 1ACJA 1YU9A 1FX1A 1E2PA 2NVYA 3TLKA 1R74A 4ECUA 1JIIA 2YRFA 3CVVA 4CDNA 1V3VA 3HYTA 1BMQA 2JJMA 1M6VB 1T13A 4ES6A 1Q3KA 5CDHA 1N2GA 3PPYA 2PMBA 4XEHA 1COWA 3DLIA 3R3YA 1RJ9A 2EJWA 2OBYA 2A8YA 4IZIA 3TQIA 2DR0A 2FEPA 4KLZA 3ZG6A 3A9TA 2K87A 3G5TA 2BELA 3E7XA 3W5VA 1BA2A 4NJEA 3IEMA 2IBTA 1XVLA 2N1BA 1FFHA 1DBRA 1ES9A 1P0IA 4HAOA 3OSPA 1NC1A 2XADA 1H3NA 1A2KC 3F8WA 2A1TS 4GR9A 1JDSA 1ZH8A 3U5TA 1ZIYA 4NHOA 1XZCA 1TL7C 1U7WA 3QVGB 1RJGA 4LE0A 3D6AA 1F06A 5ALIA 2AUTA 4F9GA 1FUKA 2NSDA 4MS1B 5G0VA 4F1JA 1YI8A 3QWFA 2QW8A 3SLRA 4I55F 2IYSA 3X0DA 1TK2A 5G4LA 4B32A 2E37A 4JEHA 2R00C 3T1HH 1JJ7A 4K0KH 1OKKA 1LPMA 4C88A 4CMGA 1GGOA 1E4EA 5MN4A 5K2MA 4L78A 2PVCA 2HSWA 3OZVA 1WCIB 2AJCA 1KQGA 1E98A 2JPDA 3T4EA 1ZGGA 2B5VA 3T9BA 3GTPA 4DVJA 3DWEX 3O8OA 4HNQA 4GRDA 3CX8A 4V2IA 3U4GA 3M6VA 2J07A 3HBNA 1TT5B 2UU9H 1GLNA 1W5SA 1BOOA 3GJXC 3H0EA 1TZBA 4HDAA 1XMQB 3DNFA 4JV1A 2HT6A 3ASYA 1CZUA 4TTTS 5IMBA 3UB4A 1ZD4A 3ZWMA 4RPHA 1VFNA 1ZSYA 4DAEA 1FFAA 4FGJA 2Z1DA 4JENA 3PKJA 2QQFA 2XZOA 1WB6A 5BQFA 4ZAZA 2AU0A 1GUAA 3ZVNA 4O2BA 4IIJA 4JYAH 1GL6A 3Q85A 2EGUA 4BKRA 5C7IO 3MMXA 4G0UA 3USCS 4G9EA 1XRRA 3STWA 4RB0A 3JALB 3AEUB 4V2UA 4URHA 4GOKA 2HDKA 4DYDA 5FWNA 1IZZA 3GNSA 4HCJA 4Q9HA 4EKDA 4DMUB 2OO3A 3E1SA 1IXSB 1SG6A 1RKBA 1BHJA 1G5RA 2O23A 4Y8VB 1NJ5A 1RAAA 4AIIA 3L3BA 2CBZA 3V2HA 2Y6UA 1MO5A 1Z7BA 1FP6A 2Q0SA 4MW1A 4F3RA 2IEZA 3IR6A 3L5KA 4Q12A 2A35A 4DWWA 5IM4A 2P3OA 4DSOA 2AT1A 5EUBA 6REQB 1JTVA 3DEAA 4CMAA 4Z99A 2HK8A 3GFPA 2C9YA 4NBLA 2VDNB 2WZCA 4F3CA 5A06A 4BBAA 6Q21A 4B8WA 4EY5A 4XE5A 2XZDA 4ZYZA 2CLMB 3VPBA 1KO7A 3TSZA 2GUWA 2GD0A 1T4MA 4LYDA 5HILA 3CZ5A 1REQB 2GX6A 4DR1B 3DKVA 4PHCA 1QVAA 3B9PA 4MZXA 1DARA 2PKRA 3B9RA 1UDAA 4HH4A 5D01A 2Y4OA 3QFHA 1OZ0A 1HXHA 5IN4A 5KDDA 4F60A 1JHMA 2O3QA 1ADJA 1TJPB 4LF7H 1VB5A 2JFQA 3CW2A 4D4KA 5FBQB 4YCAA 1E6CA 4A2PA 1MC5A 1LFAA 2XVYA 3OOSA 4D8XA 2V7WA 3ADDA 1N6RA 4DV5B 1WABA 4IIGA 3R3UA 4U5XA 3T5LA 3SJUA 2G4CA 3FNQA 2YN0A 3GK3A 1VLHA 2CJPA 1UM9A 5JJ5A 1HORA 4CL0A 2RAVA 1NXVA 1P2TA 2JF0A 3NGMA 4PSAA 3CVZA 4IR7A 1GM5A 2ZZNA 2MINA 4JUIA 3IV6A 2EP8A 4N6NA 3V7WA 3I01A 4R7TA 5KSWB 1VS0A 2XKJE 1CUDA 2ZSUA 5FB3A 5TQ2B 1Q1GA 2XKKA 2OZLB 1VECA 1ZBDA 3ZXXA 2BGMA 2X2PA 3CZRA 1R9NA 1USIA 2YJTD 3DAPA 4LK2A 2CLHB 2JRCA 4YCMA 3CKKA 2L19A 4RZXA 2V96A 2NXWA 3FDIA 3VFDA 1R4MB 4MROA 5ILQA 1XALA 5KWIA 2Q1YA 1A77A 3FYUC 5CA1B 3VR5A 1T0BA 5D1OA 4OKNA 5HIIA 4L6CA 4QU9A 1KDVA 4R9SA 1CW2B 1PHRA 4W63A 5LNK1 1L5QA 1L9KA 3LX6A 4I2VA 3ZEIA 1O1YA 3C74A 1Y5RA 2GN9A 2Q5OA 3KALA 4KAFA 5DOZA 3BAAA 1QG6A 4NEHB 5TPWB 5HTKA 1G7TA 5E8RA 1T35A 4FOSA 2VTBA 3EMVA 5K5EA 4PLWA 1YZYA 4TKVB 4PBCA 4UAUA 4YMVA 1QPGA 4E1AA 4NPHA 3IELA 1YL7A 1I24A 4I2NA 4ZCMA 5DU2A 5T6MA 2QN7A 4OLBA 3N8IA 3WGIA 3TGPA 2PTHA 1DIKA 2HW8A 1YHNA 5J5CA 2XH8A 2WVGA 3PNSA 4LW8A 3PDWA 3WK9A 1Y9EA 4XZ3A 3KZXA 1TT7A 5DXFA 4GYYA 2VTVA 4NX2A 2D00A 2OFOA 3H87A 4P0PB 1E2GA 5LQCA 1S3SA 4UE2A 3GZJA 3G6WA 4RKYA 1WD7A 1J42A 1L8OA 4YRZA 4RA9B 2V8BA 3F6SA 1FQJA 1D1TA 2CVPA 4TZ0A 4LCEA 2E89A 3RC7A 1QH8A 3QKUA 3PDUA 4A82A 1JE0A 3SMQA 1MC8A 3HKCA 1JBKA 1XRJA 2CXHA 3FPJA 4AECA 5JYBA 2ARKA 1IAVA 4DJTA 1MQ8B 5KG0A 3P52A 1BKDR 1P5RA 4QVKA 1TYZA 1R3DA 3H99A 2G09A 5JS7A 4REMA 4MIKA 1X1RA 1TO2E 3AU9A 2G83A 4WHXA 2IH5A 1FXSA 1HNXB 3ZK9A 5DEIA 4HEA6 4QXOA 1PS8A 3CGWA 2IPXA 3A1EA 5F5NA 2XCPA 3DEFA 1NG9A 4HHEA 2PZAA 3TW7A 2P6OA 1ZM4A 2FXIA 5SICE 1T9AA 2GF9A 5BOSA 3HLKA 3T5JA 2JGLA 4R1PA 3TJRA 3Q6IA 2AYXA 4MEJA 3JZAA 1KI1A 1DG9A 2X7JA 1X1SA 2H51A 4U8HA 4KNWA 4DTCA 2MT9A 2O7VA 1LVHA 4ME6A 2YW9A 2H4HA 1U7OA 4M0LA 1W4LA 4A23A 3EOZA 4TLBA 1JIHA 5FEMA 5BV1A 5FLYA 2IWRA 2B6NA 2QTHA 1U4SA 4BMZA 1U1CA 4TWJA 4UXJA 4DCNA 4KFTA 3JWPA 3RTBA 1Z68A 2IMWP 3U4QA 3D8BA 1UPAA 1PGPA 2JA6G 3NM6B 4I1UA 4NAHA 4UDNA 3RWMB 2HUPA 5LUBA 4DIBA 4XR9A 1BRMA 1OXTA 4X3PA 3COSA 4XQ0A 5C51B 3SE7A 2A6PA 1GAJA 3EPLA 3HKEA 4D4GA 1PR2A 1A4IA 2A9VA 2HA4A 4G1VA 3UJ7A 2ZYDA 2FZWA 2J9XB 1XMXA 4YRMA 5L9XA 4B45A 1JQAA 4UE6A 3PXBA 2J7PA 5GOTA 4O63O 2GO1A 4BE4A 1F1JA 3W1EA 4U7WA 4NONA 3EZ9A 5J4YA 2GQ0A 3SWWA 4C29A 1ZRMA 3TM5A 1TUBB 4EBFA 4W7SA 3DKKA 4B7AA 2Q21A 4MUEA 4Y2JA 2GJSA 1D5WA 1LDGA 3DPUA 3GLKA 4HTFB 3R0VA 2HWXA 4B1FA 2DE0X 2AMJA 1ISGA 3EIFA 3ZCSA 1E7YA 1U2RA 2K5UA 2FJ0A 5CLHA 5KWEA 4ASUA 1FLNA 1SQSA 3Q72A 2PFGA 4HNTA 3ZS9A 1GPH1 3F5QA 2A9JA 3OF3A 1GN9A 5BR8B 1CVLA 4B83A 5KNCA 3VC7A 5MFPA 1EDZA 1DZIA 4ZEXA 2GF2A 1TYBE 3JWJA 1Q22A 2GT1A 1UP4A 4LJ6A 3AUKA 4LPKA 1R9MA 3PNMA 1XCOA 2O1XA 3ZLTA 1KKMA 1B6RA 3FNFA 1PR6A 3IPXA 4MVJH 3GJ6A 4F6CA 3PX2A 4YIHA 3X3HA 1D03A 4AN0A 1II0A 4C3OB 3FOAA 2ZM6H 3EX7C 3UWMA 1Z08A 4O4LB 4KHPH 5LZ7A 1IOWA 3C43A 1RWNA 1ONSA 3K0FA 2G8NA 4D02A 3FDXA 2HO4A 5B6JA 3JQ9C 3WHIA 1CR0A 4J7UA 3H1TA 4ZRNA 2IYYA 5EP4A 4YCCA 1PQYA 2MCFA 3TNYA 3EC7A 4OB7A 5BUSA 2OLEA 3VNAA 4TWRA 1PUJA 5IHXA 2ZJFA 3ROQA 1KMNA 1RLIA 1XEFA 1G20B 1K7EB 4JLAA 2WDPA 3QU9A 4JGBA 2M98A 1PNVA 4KR2A 1J8QA 1BGXT 3ZHVA 1JIKA 5JLJA 2Y1XA 2WOJA 2VRBA 2WF7A 1GCGA 1P2GA 3E7WA 1RYHA 4HLDA 4NENB 3DDWA 3NT5A 4YXWA 1U8AA 4Y9UA 2BUCA 4N3NA 1XD8A 1N7GA 4J7AA 2B7BA 2WDTA 5IW8A 4P4LA 2P9FA 3TZEA 4RTSA 4YS6A 3V46A 2YZ2A 2QRGA 2R00A 2PT5A 2PYZA 1GCIA 3U26A 4B3JA 4EHJA 4FQ7A 4I5DA 1UBRS 3RHZA 3W9YA 4R1UA 1Z29A 2GHRA 3EGDB 1A2BA 4W9NC 4Q9LA 3KDPA 3ZHQA 4XUGB 3U17A 1E3QA 2K6GA 4IQ4A 3CLUC 1WEKA 4UVEA 4KE7A 5CG1A 2X15A 3TNDA 4GGMX 4E11A 1RTKA 4ZCTA 3NALA 2QLJA 1ESCA 1KXJA 4BFUA 3ZIAA 1SOAA 3BL6A 5LJLA 3M6UA 3S8EA 2DPYA 2VPSA 4KWIA 5DWVA 2PEZA 3R5SA 2O1WA 5AK3A 3Q4GA 4FKBA 4F4UA 4II7A 3QX7A 4L28A 5DASA 4X64H 1KOGA 2GK4A 2DKNA 1SXGA 1H8ED 3S68A 1G16A 3FMAA 3JQAB 1QVWA 3SZGA 3L1HA 4GMXA 1EFDN 5F35A 3A05A 5DM0A 3HJGA 3ZDEA 2IXEA 3T1HB 1ZOSA 4WE3A 2CL5A 2WZDA 3TXYA 2CDNA 2HD4A 1EUYA 5FOVA 3PUIA 1XEWX 3FGOA 3QVOA 3NIFB 4QOHA 3QVMA 4IX9A 4PYIA 5JD6A 4XJTA 3EZGA 4LXIA 2AUNA 1R5OA 2AGPA 3SXJA 1HYQA 3TECE 2OTCA 4M9XA 1H42A 3STVA 4GQIA 3HVJA 1ZC3A 3C3EA 1GNRA 1BVYF 5C8YB 2R6FA 1CY6A 1UJNA 2GBCA 1KFBB 1UINA 4WCDA 3CIOA 3AR8A 1WETA 1NBMD 2UU9B 4DHWA 4V39A 1U9IA 4U00A 2FWJA 2JA2A 3QF4B 3HJRA 1DI0A 4L8GA 2R0QC 5KHAA 4MRMB 4CMKA 3QKWA 3MGKA 3SYTA 4HWRA 2BZ1A 2QTTA 5T3YA 2Q2NA 4Q1CA 4ZOQI 1FMFA 3AM1A 5LZ5A 2AMVA 5H68A 1E5XA 4JYAB 3WGNA 2GPSA 4C0LA 2WWYA 2GUGA 3GNLA 2ZWAA 4KJZA 4ECXA 5JO0A 3MRSA 3JWGA 4AMGA 2WT9A 2ZJ6A 4GE3A 4RGBA 1RI2A 5FUQA 4CGZA 4FYJA 3EGVA 2R96A 1XA4A 4PLVA 2EFCB 3CLKA 1BIFA 2G4VA 3TH5A 3L18A 4W5QA 4EY4A 2O20A 3C4QA 4ECTA 1E6LA 4IQFA 5KFWA 3BFJA 4YYZA 4N47A 2D0PB 1ENYA 2QZSA 4XWWA 4MQFA 1LB1B 1QFYA 5HVNA 4CLOB 1QTIA 4Q3BA 3AKCA 1S9DA 3V4SA 5LMCA 1ZVJA 5A0VA 4RHUA 2A5LA 4AZSA 3ANYB 4UNRA 2WUFA 4PYLA 1XNQH 5KFZA 4RCNA 3GGCA 4LYAA 2GETA 3Q7EA 1RJRA 3H6HA 1XNJA 3N53A 3LOUA 3P9QA 1S0NA 1V71A 1XJQA 1E7QA 3PI7A 2CT8A 2JLCA 1YR1A 3WR5A 1CWUA 4IR1A 3DMGA 2HY7A 3A6LA 2AJ8A 3KHHA 4KFCA 4HH0A 1C14A 1ECPA 1WB4A 2Y0SE 4MVJM 3OA2A 4UCSA 3HI4A 4LS3A 1VKNA 1P5JA 1OX5A 2G9ZA 3NV7A 4MUMA 2JZNA 5IJZA 2XSZD 3FYUA 3OF5A 1AUOA 1OI3A 3GLGA 2HMWA 2LUOA 4K9DA 4BX9A 4BV3A 4CTJA 3JCZA 5JBQA 4XAQA 3BMXA 5I5SA 3WWZA 3S2SA 3D2AA 4WT7A 3WDMA 4YR9A 6ABPA 2BFCB 4MKIA 4ZKDA 1LPOA 3IMKA 3HQ4O 3CLSC 4I50A 4W6ZA 5LQJA 2NU9A 3H5WA 4LJYA 1QCYA 3JQEA 1Z7GA 3QVUA 5BMVB 2CXRA 1GKKA 4MKXA 4W5HA 4EYEA 1JL3A 2QRVA 3T9FA 2HA2A 5KT4A 4JBNA 3V7NA 5L4NA 4H2DA 2MYPA 4QW8A 2W6IA 4K6MA 1IEVA 1U5BA 2W6JA 3PA6A 3EA4A 3DF9A 3BZWA 1R8XA 2VJOA 2REOA 3GJZA 3WGJA 5JZBA 5FDFA 1PR0A 3B52X 1RHQA 1R15A 2V6GA 2CNBA 4Q82A 2JAWA 3IQGX 3BD7A 4OQQA 2RB4A 2X8JA 3K09C 2GD2A 2DFTA 4R1LA 1E79D 1X1CA 5C9ZA 2XQIA 1E2EA 3STYA 5IASA 2Q99A 3JRXA 2MSLA 3NUGA 1NYRA 5BV2P 5KCZA 4LFAH 3HGMA 5IKOA 1N4AA 1MOQA 3NWJA 3V7UA 5TX7A 4PG5A 5LYJA 2I7CA 1OLSB 5EGSA 1QIFA 4ZEWA 2VLBA 1N8SA 3WAGA 2JH8A 2SICE 3QPWA 1SXJB 3REFA 4MVJP 2EXXA 2F8LA 5DYNA 5DHAA 4LDAA 4QAQA 1UPXA 1M76A 1C80A 5FBWB 5K0JA 4CUZA 3F3SA 4YR2A 1H9AA 4JU9A 3HY4A 4BFXA 1XZBA 4RWEA 1CJKC 3VZQA 1OC4A 3N8NA 2ZRDA 4G2TA 1F5SA 5TEVA 3H1PA 3WBFA 1TWGA 2VQEH 10MHA 1MC4A 4P2GA 5FLXA 3RVJA 4AZ3B 4EBEA 3RJTA 4LMBA 1XVTA 3HPQA 4ZCRA 2XRFA 4PZYA 3NTVA 1E7MA 3Q5GA 1BYIA 2YXDA 4GKAA 3PE6A 1E5LA 4UULA 3A10A 3QFTA 1L5FA 2VJKA 2COIA 3HCCA 2ZRJA 3DR5A 1U90A 3T1YH 2WJIA 2YWEA 5JEDA 1BDBA 4BXOA 4D74A 2DC1A 4LBVA 3LBNA 4B81A 3OEED 3CUVA 4OJYA 5LLTA 4ZQIA 4I46A 3OZDA 4RKEA 2IBMA 5AJTA 1XVAA 3LY5A 1WY7A 4UVGA 2XOXA 3HVRA 2PE5A 4RHEA 2X22A 4RV5A 4PGAA 1A48A 3FHJA 4DLZA 1P9RA 1IVSA 4MUNA 2O59A 2HBYA 4BMSA 1UBCA 2ZEJA 4CMCA 2QTVB 3OHSX 1I01A 1Z6PA 3MW8A 2NP6A 3BGOS 3AB3A 5L3ZA 4GPIB 2XNJA 4Z9FA 3LHKA 2A33A 3HYRA 4MHTA 1F0PA 2XC9A 4MHOA 1USUA 1IULA 4IEIA 3E8XA 1TM1E 1ST2A 1T9GS 3VOAA 3GLSA 5J47A 5J2TB 3DZHA 5A5EA 3GUUA 3C8HA 1JR3E 3V4LA 2YOFA 4K6FA 2IS2A 3GO4A 4IH9A 1O6ZA 4OBBA 2RKOA 1QKIA 1AS2A 1KNXA 2X5XA 1SHLA 3WMWA 1VBFA 4KXFB 4DNPA 3A1NA 1CDDA 4MS3B 3HBLA 3OLCX 4Y18A 1R37A 1UKCA 3DOUA 3L7AA 4GI3A 3JY6A 5J4VA 5DT2A 4DVGA 1K6EA 1XTUA 1GOTA 4YV1A 3ZUGA 5FPHA 2JLQA 4YV7A 2ZTVA 1CRZA 1O96A 2PH1A 1XTIA 3FLAA 3KR2A 1BH6A 1IEXA 3K0SA 3K16A 5B4UA 5DLFA 3USZA 2XNCA 4UBMA 4ZJPA 3QKTA 4JJIA 3WIUA 1TECE 1RM4A 2F9FA 1MJGM 1P9NA 4FFWA 3CUWA 4G26A 1OE0A 4IG9A 5G02A 4JCOA 5CIYA 1CY8A 1R00A 4P3OA 3IAAA 5EJ6A 3HA5A 4F84A 2B1JA 3WK7A 4EI8A 4AM8A 1KR5A 4MV0A 1W1WA 3F9RA 4CMDA 1U2QA 3GT3A 4EITA 2VSOA 2R92A 4N0PA 2BDTA 2R6R1 1V2GA 4HAZA 3PFNA 4NOKA 1X7DA 3S5JA 4LZNA 1QFSA 4BP8A 2AGOA 1GFZA 4C76A 4AW9A 4RK5A 5JZ9A 4WGGA 2KQUA 4GRIA 3CSUA 1Q0RA 4AJ4A 4Y0VA 3HNRA 1SKUA 4KAAA 3O95A 5AHWA 5B2EA 4F3NA 4QDXA 2G0AA 2HDWA 1ULHA 3ZZUA 4NYIR 5DM60 1T5DX 1Z37A 4HEHA 5AH0A 2YS6A 4C43A 3TLEA 3LT5A 5KYUA 4AY3A 1LSOA 2CLEB 3AQIA 3LT0A 2IKQA 3LC7O 2ZATA 4WXMA 2CFIA 3HWX1 3GBPA 1PIWA 3W5DA 4BHTA 4B5KA 1P7CA 3DE0X 4NCHA 4K9OA 4R9NA 1E3WB 3LXXA 1U7ZA 1XCGB 4Q8EA 4LRYA 3KJHA 2FUG6 4Q9KA 5SZIA 5A05A 1CJMA 1NATA 5FUBA 3R74A 5JUWA 3M6FA 1WKCA 2F3QA 4G1BA 3M1IA 3HKBB 4WW0A 2RK4A 1JJIA 1FFEA 2OHXA 4W9NA 3GD7A 4YMLA 4XDHA 1W2HA 3K8OE 4OV6B 1C1YA 3MWFA 3CE6A 1V7ZA 2ZIUB 5L1JA 4QT4A 1XEXA 3O1LA 2HHJA 3WSTA 4H17A 3S1LA 3O6VA 2WJGA 1C2TA 2WWGA 2WU0A 4WJLA 4E5NA 2DQZA 2AKEA 5DHPA 2BHRA 2PX6A 4Z4FA 3PJRA 2EJUA 1XZDA 4GP7A 4KYTA 4R8VA 1JYEA 5DTEA 1SEIA 4EKEA 2YJ3A 4Q15A 5YASA 5HIMA 5ARCA 1MC1A 3T1VA 4BQFA 3PPIA 4DM4A 4YDQA 2AYYA 2HHHH 1BW9A 2C5FA 3CMMA 1DX6A 3L0IB 4HNSA 2C61A 1Q1EA 2C7BA 3COVA 3FXAA 2FWBA 1DIRA 3RUFA 3RFTA 2I6GA 3VAAA 4K2AA 1EKPA 4Z8YA 5IXYA 1NUQA 2ZYAA 4C5BA 2X2OA 3MWLA 1L5HA 4A3KG 4P22A 5KFKA 3UYKA 1TTQB 1BDMA 4MUFA 1S8FA 4L9SA 1LA2A 2YTZA 4B33A 3F4LA 4B5LA 2AK2A 2HIAA 3B60A 2JI7A 3VO2A 3VV2A 1KAOA 1K92A 2FKLA 3E9RA 2BTQB 1DRJA 1VYTA 4N48A 3A4IA 3GA5A 4MVJG 3K53A 4GKJB 3AJDA 4FP9A 2J09A 1OXXK 3PVSA 3CC8A 3KLOA 3L8ZA 3PO2G 3TFOA 2NLOA 3FPHA 1N2JA 2LBPA 3E4DA 3K7EA 1YTLA 4YAFA 2Y1WA 1F20A 3JS5A 4RMNA 1S9FA 1TD1A 3F1KA 2R1TA 4YCBA 3Q7QA 1E0JA 2DFLA 4XYBA 3WYAA 1OBFO 1KY5A 2X0KA 2I8AA 2ZSEA 1OWNA 2P6PA 3PUHA 3WKBA 3NVMB 4ZO8A 4BIMA 1RXYA 3KSUA 2E55A 5B6PA 1G3QA 3VHQA 1QORA 4NBWA 3ESBA 1X86B 2QRUA 5CX1A 3ZHXA 2C22A 1Z88A 3OZFA 5BN3A 3DQPA 4L16A 3F7NA 2FZCA 1MAWA 2C97A 3DFFA 1O87A 5M3BA 4NATA 5TMEA 4AS2A 3PQCA 4JI4B 3ZZNA 4G4GA 2GBFA 2R7MA 8MHTA 5D3MA 1GP2A 1I3QA 3ACDA 4JKIA 4MOWA 3TKLA 2BHTA 3Q3JB 5B1DA 1RQPA 1E1RD 1X80A 3FYTA 3FHOA 4KDEA 4O4JB 5CVDA 2I2WA 1ZQ1A 2XCQA 1OAKA 3W7VA 1FTYA 2G5GX 3QY0A 4PAWA 1DQRA 3EDCA 1TAGA 2JA7A 3GQBB 2GARA 1T0PA 4K1XA 5F21A 2ZSHA 1SU6A 4ICIA 2FG7C 2GA8A 3BE4A 1NLZA 3L8MA 2Q4BA 2Q4DA 4H16A 3ZJ4A 4A2CA 5A03A 4TS3A 1CQJA 2Q6VA 1QU2A 4FFBB 3T15A 1TRHA 5C2JB 3NAMA 3MBIA 1AV7A 1MO6A 2XA1A 3BA8A 5EJFA 4ZCLA 4OM7A 4A3MG 2P9JA 2QROA 3HKZA 2R85A 4EL5A 1WZCA 3LFUA 1LDYA 3L79A 1KPHA 3Q7PA 1Z17A 1RAGA 3FSJX 4JYCA 4PHTA 4GR4A 3TLXA 4YJDA 1U65A 4NICA 1G6Q1 5F9MA 3FCYA 4Z2AA 1FLAA 3CO5A 3FZNA 2XQVA 1OVGA 2BR3A 5LWQA 4GXTA 1YZKA 3LQYA 4KK4A 5E8JA 5ALLA 4C6RA 4LDQA 3ENWA 2NV6A 2QI9F 3KEFA 3S99A 3DM9B 1DEOA 1SBZA 2YVQA 4Z8XA 3IUJA 1RMTA 3JZMA 5BURA 5IYCG 1Y6ZA 3BBLA 3RR5A 1YR7A 3T7DA 2E4AA 3HUFA 3EIQA 4YUVA 4WPGA 3H2ZA 3DYIA 2QM7A 1G18A 1NXTA 3FRHA 4QXAA 4AX4A 2SCUA 2X5JO 3MCAA 3OQ6A 2A78A 3VHXA 4DPLA 1DWPA 1FU7A 1C7QA 1ZH2A 3OKAA 4RH3A 3RUEA 3SQNA 2E0IA 1P1JA 3KJIA 4A3FG 2IHBA 4QOFA 3GUCA 1CE8B 1G8JA 1QO0D 1P0QA 3AH8A 1LZKA 5H83A 4Q9IA 5JSFA 5I5EA 1W35A 1T5HX 4UOEA 2RB5A 1L8XA 3CVWA 2DGDA 3RBZA 1YD7A 4V0SA 3TLBA 2FGKA 1SVNA 1EHYA 2IYXA 1AKQA 4MYTA 1PKEA 2H16A 3PQ5A 1DDIA 1C9NA 1HDRA 1AT1A 3GTQA 2QIPA 3WWOA 4YJ3B 3CA8A 3W9UA 1EE9A 3INRA 4LFAB 2R93G 2WIKA 4J29A 1Y80A 3SYLA 2GI4A 1S10A 3KZOA 1JMKC 5FT9A 4D3ZA 2IP4A 1JXMA 3HZZA 2ONZA 3I2KA 1X1AA 4PLHA 1MN6A 2RGDA 1QCZA 2HHAA 1OF1A 1JFRA 2ZKIA 1OXUA 3NXSA 1Z6AA 1GT91 3UG6A 3BE8A 5BW6B 1U9YA 4L74A 1Y8QA 1WPQA 2A1TR 5DBIA 2JKZA 4XUDA 4PCLA 3V3KA 1G1AA 4B4KA 1M2VA 3R7FA 2ZVPX 2BYTA 4QQNA 4R1SA 2OV4A 2ZTLA 1QP0A 2VDPB 1K8YB 4OI0A 5J58A 5KYWA 1G66A 1NFQA 4Z7OB 2CK3A 5L3QB 2C9CA 3YASA 1JAXA 3QG5A 3SS8A 4JXKA 4KSBA 3KZNA 4BNZA 2VFAA 1PT5A 3C5EA 1HZJA 2Y0PA 1DTWA 3ZDRA 1FPQA 1VIVA 4ZEMA 4L6IA 3N6XA 4DMKA 4J75A 3OEYA 2IDMA 4E1VA 4MR7B 3F1LA 3M6MD 5K3SA 3ML1A 3DT8A 2GJ8A 2D1QA 1OV6A 4ZAFA 4DLKA 4ZMRA 4A2BA 1P3Y1 3UAGA 4EQ5A 1NMXA 2HWYA 4GSYA 3D6MA 4OHFA 4G41A 1VBNA 2VOBA 4ZANA 2AFVA 4F21A 3VAYA 4PEVA 1QYIA 3WE7A 5KC9A 3ZE6A 4PVCA 1TKCA 4MUIA 4HI0E 2A1UA 1P7YA 1P2UA 1M74A 1SFOA 4BNIA 4ETNA 4N7RA 3L7CA 4ZU3A 4WESB 4XJSA 4CKWA 4NKRA 2OVFA 4MVJI 1HE3A 5DKFA 4LZZA 4OEHA 4BEBA 3ZC3A 3G5UA 2R87A 4HVCA 1YBHA 2OLKA 4ER0A 5KFUA 3KTAB 1VLMA 1R4ZA 1U99A 2VUMG 2VP4A 4K9MA 2EQAA 1X14A 2PMZE 1WR8A 3H3XA 3T94A 4Y1EA 1H65A 3N70A 4ODIA 4X3OA 1P91A 4ZMBA 4V0ME 5DEOA 2XE8A 4P7GA 2ZIAA 4H0CA 1SHKA 3GRKA 5DRTA 4NSNA 3FCSB 3ZHSA 2CHVA 3N0WA 1HDIA 1F2TA 4DSUA 1HT3A 1QIIA 3K1AA 2DUWA 1RWKA 4O2LA 4A2QA 1NIJA 2EIHA 5GIOE 4AJIA 3G6XA 1XR3A 1YZHA 1DV1A 3RYHB 3CKMA 2R84A 1QS0B 5KSOA 3GGJA 3TMYA 4K9RA 3VR4D 3G9QA 4YV2A 7MHTA 3DVAB 1OHHA 3KSDO 2FQYA 5CYOA 2V6BA 2O8DB 3HL4A 4WL0A 2V54A 3S2YA 2R1ZA 3IXQA 1TEVA 5JMPA 4Z1MA 3KUUA 1RBYA 2WOOA 3V1NA 3DPSA 3WHPA 2F55A 4KE8A 1C3OA 4DQVA 2C5HA 2JARA 2PGJA 2IX3A 3OJ0A 1L5ZA 1H2YA 1WDMA 1Y1TA 4HZUB 2WPDD 4PO3X 2DFPA 5DGCA 1JQKA 2VTEA 4KAXA 4EO7A 1TWCA 1AUQA 4GDMA 3SBOA 4I6GA 2QSZA 3QU4A 4ZVMA 2VDJA 4UD2A 2CLIB 1QAMA 4IQ8A 4AKSA 4LXUA 2CEKA 1MMFB 4BDTA 1QDUA 1W4CA 1X1QA 4YT5A 2WG0A 5DVZA 3VR6D 1QRSA 2LGJA 5KOYA 1N3BA 5BWNA 1MIHA 3OVMA 1AE1A 3LUCA 4CTMA 4Q02A 2CDBA 2JEZA 4M99A 3RIXA 3I8OA 4PONA 4YR7A 4A91A 3JTMA 5JYEA 3U3JA 5JH7A 1XDBA 2MIIA 1T6XA 1Y1KE 3GEHA 3OQMA 4EW3A 4L8FA 2B5WA 1GGVA 2C2EA 4L5AA 1YB6A 1CZHA 4KZKA 5LN1A 1FTNA 4C05A 3JVDA 1LV8A 1IEWA 4LSWA 2ZJ8A 3HKDA 3ZW9A 1EG7A 2Q28A 1E9SA 1SOUA 5DCUA 5LOVF 2HNAA 4C4OA 3UOGA 3PUJA 1FP7A 1ULZA 4YDHB 1D2HA 1L8AA 4S1VA 5AVXA 2NVXA 2N46A 3GJQA 4YXFA 2VUUA 4B40A 3K3PA 1GXSA 4R16A 1QPBA 3TY5A 4U7JA 3VDNB 3EZXA 3LCRA 1CUBA 3NIDB 1UBOS 4HFJA 4GC9A 3AR4A 3RF7A 1NQ5A 5ADHA 3RS5A 4WACA 3SI8A 1W93A 4EBBA 1XIVA 5HE9A 3PZRA 4TXJA 5KVVA 1VSUA 5FUWA 1SQ5A 2Q2QA 4BN0A 4N18A 1I1OA 5JBNA 4I4IA 3A7EA 4G37A 2AFIA 3NM4A 4C0HA 1L5WA 3EVGA 4DZRA 4HYKA 3I5XA 4AG3A 5FX2A 1DKMA 1Y4SA 3MMSA 1P6QA 3IKMB 5CNJA 3UY4A 1KMQA 2EFGA 3QUTA 4AK9A 2ODWA 1SVMA 5JSHA 3K94A 2HHHB 4EYHB 1OSNA 3KEQA 3TLMA 4X6LA 4AKIA 3C5WP 1MF7A 2FZVA 3EFBA 2QXTA 3FY4A 2E82A 1KZ9A 2IUFA 2OHJA 2C3YA 1YR2A 3GTKA 2BEUA 2J0UA 1D9XA 1GQRA 3ZHZA 1T2DA 3H9EO 4EKNB 4WY2A 5TLSA 1CQWA 5LC1A 1O58A 3ADKA 1XTBA 4EYGA 1GGHA 3QWUA 2ON6A 1NNEA 1XTKA 5DNCA 1MQAA 5T3UA 2X0RA 4O4IA 2PKQP 4IHJF 3AVVA 3OTGA 3FDFA 1X7GA 1Z5OA 4OY3A 3RJ0A 1AC5A 3QVVA 4G07A 2P2GA 3RARA 1SOMA 1E2JA 4QO8A 2WKPA 4CLEA 3D6HA 4XI9A 1Q0UA 3PGXA 3E3AA 1QAQA 3CTMA 3AF5A 2ODNA 1PZMA 4LF5H 5IWAH 1II9A 1H4VB 1Z36A 2O2EA 3TFQA 2WJJA 2W2KA 2AS0A 3I1YA 4BVAA 3MLBA 4JV2A 1SVUA 5C8XA 2X5RA 2B36A 2QI9C 3ET4A 5L7TA 4GVPA 4KIJA 2W71A 3LY7A 1RKVA 1VP3A 4RK1A 4Z3DA 4OXXA 4UUOA 2D6FA 5DV9A 3K32A 3O8BA 5K45A 3VDMA 1A2QA 5ILOA 3I04M 3REQB 2O19A 4UUMA 3TLZA 5AM3A 3A4TA 2OBXA 4KC0A 1HE1C 4F5ZA 1I2LA 3SD7A 3SJBA 3VUEA 3SR4A 1PFYA 3PSHA 2Q3LA 2Y77A 1RIFA 5A1TA 5AI6A 4EBDA 2Q7XA 4CU5A 1SB8A 1YE8A 2D5IA 3MS7A 4B35A 3TPCA 1J0CA 1Z26A 3BRQA 2Z6VA 4CUKA 4E07A 2HRCA 4F3KA 2G76A 4MKFA 4E2WA 1XTRA 3DBIA 1E8MA 5EIAA 3RIYA 4ZXFA 3OAAD 1VDMA 3HJHA 1QU3A 1E6KA 3I2GA 3C7KA 2X3FA 3C7CB 5BPFA 1TYDE 1M1UA 3TTTA 1SYXB 5ELMA 2I2AA 4CNBA 2QU8A 2P3SA 3IT1A 2Y27A 1YIOA 3O75A 3N8DA 2I6XA 5E6RA 1PN3A 4PLCA 1QIEA 3IMFA 1IN8A 1YMUA 4UAGA 2YY6A 3OP1A 5KQSA 1QQ7A 3AINA 4D8WA 1UXJA 3TOCA 3ZLVA 4RIFA 1UAYA 2C03A 1T1SA 2ZXEA 1UJ5A 3Q3GE 1QRUA 3GLTA 4AYBA 2EWVA 3AV3A 4JI3H 3OZ7A 4XLLA 2GMWA 5K99A 3I30X 3S7ZA 1LDBA 2PZLA 3GGSA 4LTDA 2VDWA 4G5YA 3BQMB 1Z2DA 4EEQA 1XUOA 3T0FA 1OFHA 1LJLA 4YIKA 4WQMA 5AI5A 1VJ5A 4WZ6A 5T64A 1SQFA 4EUFA 4WXPA 5CVVA 3LPNA 2EX1A 2JI9A 1PGQA 3A1UA 1N6PA 4D26A 4JGGA 2DCMA 1O6BA 3WA7A 1LBQA 3O9MA 3T7EA 5IRCD 3RJZA 4IJKA 3FLEA 2ZRNA 3PQ3A 2AFHA 1SK8A 4XIGS 1FNSA 1KDOA 2AW3A 1YKFA 3DM5A 3H1AA 3PQFA 4EHKA 3T7RA 1Y7PA 1M2NA 2X0SA 1U98A 1YCDA 2QTFA 2DTEA 4DHEA 2VDUE 2DQYA 3EOBI 2Q7DA 1R0XA 2ZJTA 4OP2A 5HBRA 3L46A 4BO9A 2VT6A 1FMJA 4PHHA 2Q5CA 1P2VA 1U8YA 4YQWA 2Y0EA 1XQVA 1FY2A 2YJGA 5F4ZA 1RWBA 3RVSA 1Y8RB 1S89A 2ZOSA 4OXKA 3QF7A 2XAAA 4PFSA 1AMOA 3A9WA 1QFMA 3OE4A 2FWNA 1KH3A 3AR5A 4PICA 4L5CA 4U0JA 5CDTA 5JJLA 8ADHA 2V65A 2KI5A 1WBJB 2OXIA 3TW6A 3FUWA 2MSKA 1MDBA 1U9JA 3GLQA 1ATZA 2E1PA 3GAZA 1SHTX 4WX2B 1MT0A 5EJGA 2BJHA 3LD9A 2WYIA 4G9GA 1EYZA 2A0UA 3HHPA 1HGXA 3OZTA 5A1JA 3RKUA 3FNHA 2HJSA 1Y6RA 5K01A 1J8FA 5EWMB 3LW8A 4DV7H 1B23P 3NUZA 3BMCA 1YR3A 2D7DA 3ZXSA 1U2TA 4B48A 3P9RA 2VK8A 4TQGA 1CKMA 3WYDA 2LW7A 4Y2UA 5FIUA 4OQYA 8AT1A 1LI7A 5I9IA 3ROPA 2GR9A 3CSWA 4O08A 2XOKD 2H18A 2QU7A 2XDQA 2VQ3A 3HOYG 2RIRA 4G5OA 3R75A 4NOJA 5D84A 3OI7A 3I6MA 3LIPA 2A14A 3TPZA 5I60A 2QWXA 5KYYA 3GVCA 1NPDA 4YQZA 4DPKA 3QEKA 3U61B 2XVZA 3ON5A 4EPVA 4TQSA 5F2OA 4RW0A 4Q7KA 5C8DA 4YHHH 3Q3CA 2JDID 4BE9A 4B3TB 2BM9A 3QTTA 2GNOA 3CJQA 4OBWA 5LJIA 1I7QB 3GNTA 3FFTA 2FP4A 3QX9A 2AOTA 4J0JA 4Q93A 3RH0A 2NACA 4G8BA 5FOTA 2PZMA 5IPFA 1PG5A 1YR6A 1JX6A 4OX9Y 3VYWA 2WKRA 2X77A 1NVEA 2QF7A 3QGMA 4N49A 2P2ZA 4I8XA 3HRKA 3L2OB 2PS3A 1A9XA 5KMGA 2Q7OE 4IAJA 4PS1A 3TBKA 1KJ8A 4OGLA 4YRGA 1WSWA 5CDYA 2Q0HA 4D4LA 3G0BA 3M83A 3GYBA 3HK2A 3T5CA 4CUJA 1PR4A 4M1MA 1SKBA 3T5KA 3KL4A 4GR5A 4H7FA 4Y6RA 1X7YB 5GZ1A 1MG0A 2X7XA 1NNLA 1FMCA 4ZZ1A 1B6TA 2NZJA 5A4FS 4PPQA 3ZDAA 2NXCA 2FY8A 1Z4QA 1VG1A 2F3TA 2IA5A 4PQYA 2VQSA 5IDWA 2FLWA 4Y2RA 5TDHA 1E64A 3ANXA 5EWLA 5JCJD 1OWTA 2FE1A 1SZDA 1I4WA 3KT6A 3DKIA 3B3QA 4BC1A 1XJ5A 1YIDA 5IP9G 1QV9A 5HNEA 4UMEA 3ACCA 1ZCFA 5KWVA 3I64A 5I9LA 1Q12A 2XNHA 5NULA 5K09A 2GQRA 4UNQA 3V3TA 3CRNA 3FNEA 1DIBA 1VIYA 4W1SA 2X3UA 3ZQJA 1NUAA 4D92A 1P4SA 4Y6PA 2EKBA 4QWCA 1PD0A 2R82A 1JDJA 3M3HA 5IYDG 3H42B 1J2JA 2QG6A 2CYBA 3BA1A 2ZBUA 2C4WA 3TUIC 3BBPA 3PWZA 4E5VA 3EQ7A 4K0KB 1UKYA 5GZ6A 3RAJA 1N9KA 2I1QA 3JZIA 3B1ZA 3I8SA 3BXOA 4RTRA 4R5HA 1E8DA 5LMUH 1ZK3A 5B3KA 2H59A 4J0KA 1WF3A 5KDLA 1JDBC 2XYHA 3FSEA 4GMGA 2J9RA 1J8DA 2P91A 3BMOA 2B8NA 4Y0AA 4XIIA 2GH1A 1XDGA 3ESCA 2VF7A 5KSZA 1XVIA 4OHUA 1GRRA 3R5XA 1MB2A 1W5TA 2EJTA 2QN3A 2UYCA 1INLA 1C81A 1MIOB 2IP1A 4XWKA 4OFWA 3KQMA 1TAQA 2KPOA 2OUIA 5BVGB 5KQMA 4DDTA 5KINB 4JCCA 5T6BA 4MV7A 2PT7A 2JA5G 1N6IA 3QYJA 1CKNA 1IDN1 4JAVC 3CPEA 1CB0A 5TB5A 1NUSA 5A9SB 5BSUA 3CX3A 5KYXB 4ALNA 4LKRA 4LBYA 3CINA 1CERA 1W46A 3KCNA 3L82B 4BZWA 2CNDA 4WOBA 2G36A 1MRSA 3MJFA 3LC1O 5GIPE 1XDDA 4RO0A 2FZ4A 2WF6A 4V24A 5ARBA 5GGXA 1E4YA 2Z83A 2O8EA 2W0SA 4INZA 4AF8A 5CJ2A 2WRZA 1RWWA 1OMOA 1VZ2A 1I13A 3EWNA 1XXHB 5DYYA 4NZ9A 2ISQA 2UZ1B 1J9ZA 3NGDA 2IYOA 4DAAA 5EN4A 4CXMA 3T54A 2IV7A 1G8GA 2AQ4A 1PZFA 3ZY3A 2ASDA 1VBGA 2OUKA 1O97D 4N9WA 3IDOA 4EWLA 2PMFA 3CEAA 1DJLA 1EG2A 3Q3EA 4RADA 3HKZE 1B33N 4K9PA 4JSTA 4X71A 1MBZA 2GF0A 3WLLA 5HQTA 3PQ4A 3ROMA 3IAS1 4I1OA 2UVPB 1LSJA 4EFBA 2PZ8A 2W37A 1Y14B 5KT3A 1GPJA 1MGPA 4AKHA 2A4MA 3WQSB 4AUMA 2TMYA 1QGAA 1XQ9A 3WGTA 4EBCA 4L4SA 2FF7A 4H3KB 2QY9A 2IXFA 4KN5A 4E30A 3OMXA 3SSNA 2GFIA 2O0MA 4XCQA 5KOHB 5AVWA 1DAMA 2YIVX 1NYLA 1L9XA 4C01A 3ZDZB 3GRYA 3R6DA 4KLNA 2Q0QA 3I5AA 5SY4A 4MA0A 3VH3A 3KFXA 4JL6A 5TR9A 4BLQA 1JQBA 3KT3A 3GEBA 2ZJ1A 1BS1A 4LF7B 1KR2A 2GAFA 1DXHA 1P4RA 4G24A 4LZJA 1K7SN 4XTRA 4QUKA 1KE2A 2HHLA 4MULA 3WGZA 3OPMA 2QUAA 5LKRA 5SZHB 3L9WA 2CF5A 4DEXA 3LNTA 5ALZA 2FDRA 1QE5A 4QTUB 2FEWB 3U9LA 3HOZG 2YXPX 3VO8A 4WOPA 4I9NA 1IHOA 2OPBA 3PT5A 5JNVA 2BISA 5EMHA 4FYPA 1GDTA 4J9NA 1BJRE 1YB7A 4JK3A 1IHXA 1RCUA 3KREA 1WV0A 4XIFA 2WUVA 2XTZA 2ZAYA 1EUCA 1PLJA 1XMPA 3P27A 4QRHA 4QQRA 3LQ2A 1VYUA 3Q7IA 4N0MA 4ATNA 2JCXA 3ORHA 2XB6A 1LSSA 1C0LA 3OE5A 1BQ4A 4YP6A 4G0QA 3UHOA 4HRVA 4V3BA 2GA9A 5ETJA 4GKBA 4B6RA 2C2BA 1POXA 3P0FA 1YNOA 1C1DB 4FTWA 3RGWS 2KMLA 4BZQA 2EERA 4N65A 3SC4A 2NXEA 3GAMA 1P1FA 3K05A 3BRSA 1Y5IA 1W0JA 1O77A 1RXIA 2IH2A 4PC7A 1QQTA 3MWDB 2CB9A 3PU6A 2YZKA 3QP9A 1JEOA 4LZLA 3OSNA 4EHIA 4OFZA 4D0LB 1TA0A 1D0IA 3SF8B 2MJLA 5D5QA 3L6EA 3EUWA 1FFWA 3S1SA 4LF5B 3BMQB 3JW8A 2AJDA 5IWAB 2C58A 2HCBA 4LY9A 2HIHA 4HR7A 1AGYA 4IS2A 1XLVA 4Y1RA 2RGCA 4ALJA 1C3VA 1T0UA 4JV5H 4WAUA 1UDCA 3PL5A 1MCZA 1T9GR 2W7OA 5TQ0A 1S4QA 2VK2A 3SJCA 2J9ZB 1IIRA 1ZA2A 1S68A 4BGVA 1N2CB 3TS1A 1NY5A 3EZYA 3ETJA 1NPYA 1T3HA 1T3SA 3TK1A 3GTMA 1ZUNA 2FWRA 3A9VA 3U7GA 4RY8A 3LAWA 4CM4B 1KBLA 5L3SA 3ROTA 2NZ8A 3GWZA 4M53A 3MT8A 2NQ8A 1C0KA 3T9DA 1PV2A 2WA1A 1JN0A 3ER6A 5EXSA 5E1MA 1R2QA 3DG9A 2Z3WA 2VJYA 4RJTA 3ZK8A 4PO1A 4YAWA 5BQ5A 5JS6A 3PKIA 4HH3C 2GCEA 5E25A 2ZB2A 4O1HA 1QP7A 3MSCA 4EX6A 2LZ0A 2QT9A 3BGSA 3BQ0A 4GYJA 1RJPA 2VL7A 3EIWA 1PT6A 2YC4C 3DMDA 4X62H 4MGHA 4MINA 1B15A 3E4CA 2GZHA 1GQOA 2CMFA 3Q3VA 2G70A 5LQNA 5E9WA 4L5JA 1ETHA 4E94A 3PB3A 3GPDG 4J0HA 5CTAA 3JQDA 2JKYA 2IUTA 3HDHA 2A2ZA 3OLZA 1V1RA 2P1RA 1Z0IA 3KQKA 2BW0A 3FRJA 4WGFA 3RHFA 1ITZA 4URXR 5FO1A 4B44A 3OHAA 3F46A 4QSMA 5JC1A 1N6NA 4CLRA 5AUQA 1QYRA 4ZQHA 2JGMA 2H0QA 2G1KA 4C4SA 2VPXA 3AETB 2DUNA 4Z4GA 4BMNA 2JRLA 4OYLA 4KU4A 5FI5A 5K0NA 3WB1A 1HETA 2HR1A 1DJOA 3F97A 1QIMA 1PL0A 3L4SO 4BWSC 3QVXA 4OXYA 5BQPA 3QUSA 1YACA 2IZ1A 2YXNA 2PUTA 3G8YA 5D1PA 4HD8A 3VPGA 1BEUB 2CL6X 1KP9A 3KB8A 2AUMA 3IMCA 3UMCA 5K03A 3A8TA 1IFXA 2LE0A 5GP1A 2GK6A 5IXSA 1AQNA 1YGPA 1LWOA 3DE2X 1IY9A 1EFLA 3GP5A 4OHRA 1A97A 1N48A 4UDXX 1WD5A 2N1MA 3C85A 3TW4A 1TM3E 2J08A 1XROA 3TTUA 3OJEA 5TPZA 4I55A 4WLUA 1ZOOA 2Z09A 2IZ6A 4RM3A 1CQIB 1YRAA 4F4CA 5ALNA 4BBRG 4C5CA 2EIYA 4C0SA 2Y0CA 1U1GA 3H18A 3TQSA 3II6X 2QZJA 4Q4JB 2EEPA 5TT0A 4JI6H 3DNPA 3HB5X 4ZU6X 1J7KA 2BGKA 5F73A 3PW4A 3BGDA 2Y68A 4MDHA 1GG2A 4ZREA 4V0OA 4OVKA 4FBMA 3VU9A 5AVVA 3K9QO 3VPDA 1D09A 3SLGA 3V1UA 2JG3A 3TLGA 1JXOA 2L2QA 3EG9B 5CXSA 2IIPA 3OT5A 4XR4A 3JQ9A 3T0GA 4ZJZA 5EHZA 3T5BA 1GNVA 1FJ2A 2CFTA 1XF1A 3AKDA 3TO5A 5KDOA 4MMXB 3DEHA 3MB8A 2AI1A 1YB5A 3R9XB 2BZSA 3R2JA 1U6KA 3RT1A 2X13A 4BJHB 1TEXA 2QXUA 2I4OA 3IP6A 3Q5EA 5HSGA 1HPLA 1KO5A 5EVJA 1PSDA 2Y99A 3FFAA 5DM70 3CCBA 2WWIA 1S97A 4JGIA 4O2RA 1XMJA 4F2DA 3Q1KA 2BR4A 1M6EX 2ZJ4A 3EG5A 3ETLA 4EMBA 4C0AC 3SK0A 2AYZA 3LQ4A 1RJEA 4O3NA 1J99A 2BFEB 1NP6A 5TSDA 2ZM6B 2YZ7A 1L5YA 4YHHB 2P4UA 4KHPB 5F78A 2M05A 5DFAA 3ZZ0A 1JDTA 4LHSA 4OFXA 4GC7A 1G2IA 3K6JA 3U0BA 1KGDA 3LKDA 3FKIA 4L08A 1NL3A 4QJ3A 1UKVY 2GM3A 4M3NA 2NXJA 1DAHA 2X8BA 3OEWA 4XJXA 1CRPA 4MKGA 2BUBA 4DV0H 1RHMA 4OI1A 4F9TA 4XARA 2V5VA 1E89A 1SCDA 5D5HA 3JQ7B 3B1VA 2QYHA 2V4MA 3TUZC 1NJ1A 4BYMA 2F3RA 1P80A 5G0WA 3KKNA 2AFIE 4FDAA 2CNQA 1I4EB 1T5LA 4ZN6A 1R0SA 3N42B 5LOVA 3H8SA 2R4UA 4ZQCB 3UJNA 1IYEA 4MLZA 5T57A 2Y1GA 4LE1A 3W77A 1LFDB 4ZV9A 3TL6A 3SFVA 1ZONA 4NG4A 4DJFC 2YVKA 1H5QA 2QUIA 5F9LA 4MWBA 5I7UA 2DERA 4UJ5A 3Q7TA 4UUNA 5IJWA 3EC2A 5EIOA 1P2FA 3DE6X 4C07A 4MS4A 4ZTZB 3U13A 4NXNH 4JT2A 3K9LA 5A0TA 3N44B 1AGNA 1RI3A 4KWCA 6ADHA 4KXLA 3AUJB 3WP1B 1JHUA 3OCJA 3C3MA 16PKA 2BC9A 3CYFA 1IK4A 1DC5A 3F7TA 3RTAA 2OWDA 1EPUA 3RSOA 1QK3A