3ETHA

Crystal structure of e. coli purk in complex with mgatp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3ethA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3ethA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ethA01
2V59A 4C5AA 3SE7A 1CE8A 1I7NA 3LP8A 5LYJF 2SCUB 3Q2OA 5HV6A 2W6MA 5LXTF 2R7NA 4MA5A 3VPCA 5J2TF 1JDBB 4IWYA 2CNQA 3TINA 3G8CA 4J6EA 3JZIA 1A48A 3VPDA 2VHEA 1Z2NX 5JH7F 4QSHA 5C8YF 1KJQA 5CAEB 3HB9A 3VPBA 4MV8A 4O7TA 3VMMA 1DV2A 2GLTA 4O4JF 3BFPA 4M99A 4FFRA 2YRXA 4YAKB 4YAJB 2XCLA 4C5CA 2I8CA 3RV3A 3VOTA 4FFOA 2NU8B 4EGQA 1EUCB 5CA0F 3U9SA 4L1KA 2YW2A 3N8DA 4IIJF 2W71A 5H80A 4XYMB 2Z02A 3JZFA 3R5FA 1EUDB 3BSSA 4O81A 4C5BA 4YJ3F 4EA7A 2W6QA 2YRWA 2NU9B 2R7LA 2PVPA 4O7SA 2GPWA 4ZHQF 2YZMA 4O84A 2CNVA 4O82A 2I87A 4HNTA 4HQ6A 2DWCA 2J9GA 4XZ3B 1OBGA 1C3OA 2R85A 5BPHA 2XD4A 2W6ZA 4I4TF 3WO0A 5I47A 2YWVA 2GQRA 1GSOA 3R5HA 4ZOLF 3K3PA 2ZDQA 3QFFA 2W6NA 4MV4A 2FPPB 1W93A 3U54A 4TV9F 1A9XA 2V58A 1C30A 3KAJA 5D8DA 1Z2PX 4O4LF 1GSHA 1CQJB 2CNUA 4DLKA 2V5AA 2W6OA 1EZ1A 4IWXA 2GQSA 4XYLB 5JVLA 2R86A 5CA1F 4IZOA 2DIKA 3KAKA 3AW8A 1IOWA 1SCUB 3TW6A 3JRWA 1DIKA 2NPOA 5JQGF 1KC7A 5JQWA 4YB8B 5GONF 3V4ZA 4MV3A 2FPGB 3KREA 2YS6A 2OLSA 2FPIB 3BSWA 2QK4A 3LWBA 4O4HF 5LP6F 1CS0A 3TQTA 1PX2A 1BXRA 3GIDA 5C1PA 1JKJB 3RFCA 1WR2A 3WO1A 4O86A 4O7VA 2R87A 3K5IA 1JDEA 4EABA 5FNVF 4O7YA 3U55A 5LOVF 1ULZA 2HGSA 4GGMX 3R9RA 2CQYA 3MJFA 4NYEA 4ME6A 1M0WA 2I80A 1AUXA 1KEEA 4EA8A 1EHIA 2VPQA 4FFPA 2YL2A 2R84A 5HBRB 4WBNF 4XX0B 2W70A 4M9CA 4M98A 3TIGA 4O7RA 4TV8F 2C00A 1AUVA 3Q1KA 3ORRA 1DV1A 2FP4B 4ZI7F 2YS7A 3U9TA 5K2MA 1GSAA 4ZQIA 5DMXA 5C1OA 1KJIA 3ORQA 4O7LA 4EA9A 3N6RA 5EZYF 4FU0A 1GLVA 3NUAA 3OUUA 3HBLA 2QF7A 1T36A 2NU7B 1BNCA 5CB4F 4HR7A 1PK8A 1GGOA 2VR1A 1KJJA 3AX6A 4FGRA 3MWDA 2R7MA 2HJWA 1VBHA 2R6FA 4M9UA 2R7KA 4DIMA 4FFLA 4E4TA 5BPFA 4MA0A 2P0AA 3R5XA 3K5HA 2VQDA 1M0TA 1Z2OX 3ETHA 4MAMA 4O4IF 4WD3A 4IHJF 4HNVA 5KX5F 1M6VA 2GPSA 3GLKA 1VBGA 3I12A 3UFXB 5BMVF 4RZQA 4HNUA 2PN1A 4EG0A 3OUZA 3G8DA 3MWEA 1KJ9A 3V4SA 2W6PA 4O7ZA 3TIIA 1W96A 4I55F 2WYOA 1UC8A 3RUPA 1VKZA 2ZDHA 4EAAA 4FFMA 4I50F 1JLLB 1CQIB 2R82A 2NUAB 2YZNA 3E5NA 3DF7A 5LA6F 5J2UF 4Y8VB 1B6RA 1I7LA 2PBZA 1KBLA 4EGJA 5JVDF 2X0SA 2FB9A 1KUTA 3JRXA 2YYAA 2ZDGA 3R23A 4O7WA 2NU6B 4TUYF 1E4EA 2IP4A 4O2AF 1UC9A 1KJ8A 3WNZA 5IYZF 3ETJA 4O83A 2YZLA 5KKNB 4YJ2F 1E4EB 3RV4A 4O2BF 4MV9A 2DZDA 4MV6A 4MV7A 3HO8A 1IOVA 2DLNA 4MV1A 4FE2A 3BG5A 3KALA 3VA7A 4FFNA 1OBDA 2Z04A 3BSYA 1EYZA 2CZGA 4O7NA 1B6SA 2YZGA 4YBZB
chains in the Genus database with same CATH superfamily
4DZTA 2V59A 1OLUB 3SE7A 2GEBA 1EJ0A 4YBZA 1E6UA 5ALNA 5KJEA 1M5TA 4ADSG 2GBFA 2CJXA 2QR5A 5IG2A 1ZM2A 5HV6A 2MSEB 2G83A 1A7KA 1PHRA 2YWDA 3C4VA 3QEOA 5CJJA 1T6ZA 3FLEA 4P98A 4PG8A 4GXRA 3SXPA 1EDZA 1FP1D 2C3YA 1G0NA 1PL8A 3OT4A 1YS2X 5EGSA 2DUJA 3ZGZA 5A5EA 3MTJA 1NDUA 2H85A 4PZEA 3W0LB 5FPKA 3ZCTA 5KT6A 3KP1A 3DE0X 4HDRA 1C9DB 3DOUA 4KEAA 3WRYA 5FEMA 2TMKA 3CPJB 2DPJA 1VGVA 4L15A 2I7TA 2CSXA 3DWFA 5IAKA 1W35A 1AGNA 2AEMA 2CMFA 2OBMA 2OY0A 3G8CA 2ZE8A 2CXRA 3HBFA 3HG7A 3OOSA 3ZHCA 2HZBA 1YZNA 5I9NA 1AKWA 3R2JA 3TJZA 3QPUA 1OAAA 4K86A 2BR3A 2CXQA 1BS2A 2IFTA 8OHMA 3WSTA 4RY0A 4R1OA 1T2EA 5CM0A 3H99A 4GU5A 3TIXB 4Z7QB 5AVOA 2C7OA 2BFAA 1MW9X 3A4NA 2CJPA 2IYSA 3AT1A 4MEBA 1JZSA 2F17A 4EAQA 2OHVA 1IEXA 1T0UA 4BX3A 4ND5A 1ITZA 3NTUA 3NO4A 2CLHB 3R3YA 2FPMA 2OCYC 3C6MA 1X7ZA 4NZZA 1PWEA 2MWMA 2JW5A 1NF8A 2IQ5A 2YHSA 1PJ2A 3OU6A 4U0JA 4XB1A 5IDWA 5F7OA 2QLTA 5HOEA 2PKYX 2FZ4A 4IUBS 3GLHB 5HCNA 2OBYA 3KJXA 2RHGB 1V5GA 1IHPA 2HG8A 2IZ6A 10MHA 2MSLA 4D4MA 2CW8A 1TZCA 2PD4A 4QM7A 4BO6A 2CBXA 2G7ZA 4YQFA 5BSWA 2P3QA 3PGJA 3VOTA 4O4JA 4FFBB 1XT6A 5AH0A 2OV1A 4NHEA 2IYXA 2OBXA 5ERYA 4O0MA 3DE6X 3V1NA 4ZRNA 2ZUWA 3AEUB 1GRVA 4I5FA 1G38A 3ETEA 1YZKA 3GA7A 5FFNA 3BE5A 1WHTB 4JIGA 1T94A 4Q4JA 3P32A 4RNNA 3DBOB 4IIJF 1YBMA 4UBMA 4TYMA 1JR3D 2M6KA 3CZQA 3EEQA 2FOIA 1NAIA 3RVOA 4YV2A 3FFAA 1YE8A 3JAKB 3PE3A 4FHZA 4MRMB 4QVKA 2ZI7A 5PGMA 4XYMB 1ZOOA 3OVMA 5B3JC 6PFKA 4URXR 5KFKA 1KGDA 1XRLA 2PMCA 2DWPA 3WYEA 2OBLA 4FYKA 1TCVA 3R5FA 4KQMA 4PCUA 3TPZA 1QMGA 1YR3A 5EC8A 1HRDA 4AUNA 2XT6A 3E35A 1YZGA 3F6CA 1EUDB 3KSDO 4UHKA 1YS4A 4DUGD 4C5BA 1Y14B 2W9CA 1MBZA 3JQ8A 4CQMA 4A15A 5LMZA 1G8YA 2CNNA 2NU9B 2F59A 4ILEA 3VO8A 1JKMA 1HFKA 1R9GA 2VTKA 1CZLA 4H16A 5GJBA 2VSNA 4H1TA 1RFGE 3W5BA 1U5CA 3SEAA 1GPMA 1E5QA 1KMMA 2LBPA 3GRFA 3K1AB 4KR9A 3WICA 1U0GA 4S0ZA 2CHUA 4N3BA 3T5AA 4LF9B 4PLHA 4FMDF 4PLZA 1TXGA 4KXUA 1K1EA 2Z5FA 2IBSA 5DI9A 3V6LA 1P77A 2QTMA 4NBUA 3IVMA 1JH9A 4IO0A 4YCNA 3AYXB 3IEPA 5T6MA 1VG8A 4PIVA 4F3YA 1ONSA 3WIUA 3J7AC 4ZOLA 2H0AA 4JV1A 2HIGA 2Z6VA 4GEGA 2C20A 1C7FA 1RP7A 2FMKA 3IO3A 4KQ2A 4DBLC 4HVAA 4URHA 1UZLA 1XQYA 2JAOA 1K88A 2C0CA 1V1JA 4V0NA 5FP0A 2ZIVB 2PX3A 2O5CA 2QM8A 2ZDQA 5IN4A 1VZ3A 1ZH8A 2WSIA 5IYCG 2B7LA 1A4XA 3VQTA 3H9QA 4IS3A 1TAQA 4IHJB 1JQAA 4OIFA 4BBSG 1TM4E 1YZHA 1NF9A 1JFFB 4FN5A 2F64A 2XE7A 2H4FA 4GX0A 5DK4A 3WRYC 1A7UA 1H4TA 3AUSA 5EKTA 5IULC 1QCZA 2J3IA 1XSEA 4TV9F 2H0RA 1COWD 4W1RA 4FDUA 2XYGA 2HSWA 4P6VF 5K09A 3Q6NA 1QJ4A 2V58A 3C1OA 4GHWA 3WGIA 2D1RA 5AK4A 2IYRA 3K0FB 1ZP6A 3OIUA 3E9YA 1FQKA 3QLEA 3TOSA 3W1WA 2VXOA 1YFJA 1KEPA 4J29A 3M34A 1OU4A 4WGFA 1XNQH 5F76A 3WDSA 3MS2A 4WZAE 2HHAA 5DG9A 1U0LA 2WF8A 1US8B 4FT2A 4A0SA 3PHCA 3AR5A 4MZDA 4YP3A 2JD2A 4JROA 1L5FA 4ILKA 2GH1A 2GA9A 2X4IA 4O4LA 4U7PB 3VKVA 2DCMA 4L57A 4E14A 1U0FA 4YI5A 2QLBA 8ABPA 1T0JB 3GJ5A 1GARA 4I9GA 3GRKA 1TF5A 3EYAA 1TUGA 3OMLA 3E05A 1ELOA 1JTEA 2QM3A 1JIJA 4DUYH 4HPJB 3D8TA 4HYEA 3A58B 3WLIA 2BLLA 1FDOA 1L3CA 1DT3A 3GTGA 2EKLA 3OX4A 1WBJB 3RSLA 1WPRA 1VFPA 1IL0A 2CMDA 2DHCA 3R7NA 1DTEA 3G59A 5KNBH 2NUTA 3B12A 1X19A 4ZHSA 4IMJB 2HJHA 3KQOA 4N5HX 4TTJA 1U1FA 2RGCA 4H08A 1NKSA 2XTJA 3UWSA 2YVAA 1EFTA 4QWEA 3EK2A 2MSKA 2JGKA 5SYNA 1OA1A 2ZBEA 4O6VA 5DTQA 3T4XA 2YHAA 3Q3VA 4YRSA 5B7GA 1J1ZA 1AKQA 1E5DA 2NU9A 3HNRA 1E3EA 2GD0A 2QLFA 2ENWA 3NP9A 4EY3A 1KZYC 2YYZA 3N39C 4PC3A 3JQ8B 4DMGA 4W9NC 3STXA 3MJEA 3TFWA 2IV3A 4CM9D 3A9VA 3C8UA 4WVLA 3N41B 4KGXA 2PRSA 4PPYA 5DMHA 4IGAA 4Z51A 4R7RA 1M76A 3UBMA 2D0OB 3V4VB 2XWPA 2XYVA 5F7ZA 3IUQA 1E6CA 1QWSA 4GR9A 4C20A 3LZDA 3G6VA 2EYQA 1Z7YA 3THSA 4CG1A 4EMUA 3PX7A 1CRWG 1R0WA 1DINA 2C83A 3BE6A 4NCNA 3F47A 5G0VA 5KFTA 5H0IA 2G72A 2UZIR 3G6WA 1T2DA 5KVCA 3U3KA 5TQVA 5F2KA 5ADWA 3IERA 3MHPA 3GMIA 3KHTA 1MEEA 2K5UA 3TRIA 1I6MA 5CTJA 1TJ4A 3I1YA 3LCMA 3LPCA 2QI9C 1K7SN 3GHYA 3L0BA 4CHTA 1O8BA 1ZD2P 3M5DA 1VL2A 3L04A 1YA4A 1DPFA 4W1SA 2WZDA 3TFOA 3PNQA 3OSNA 2V8BA 2QX6A 2Z9BA 2CQYA 1P29A 3P5SA 4GL2A 2VHQA 2OBFA 2WIKA 3P0JA 1J09A 1JE0A 3Q98A 3ROPA 1HYQA 1IBSA 1DMRA 4FKZA 2JA8G 2W8BA 1PBNA 1T5IA 1WUIS 1WCIA 3NFRA 4G0YA 1QZZA 1APBA 1M7GA 3VDNB 4P4UA 3CXUA 3GLQA 2VYVD 1ZMXA 3A4TA 5B6PA 3UGJA 1JIHA 4MDHA 3UIEA 4M1WA 3BFXA 4MRAA 1XEXA 1ZK0A 1OFGA 3HQ4O 2X8WA 4JI3H 3WA6A 2W70A 2J6IA 2VF2A 4Q44A 2PR2A 3GB9A 5D6OA 1DC4A 2OC9A 5I7HA 4LDJA 2H2GA 1W36B 5DGBA 1DGQA 1HTWA 3PR2B 4D46A 4YAIA 3CVYA 4UEQA 4UEKA 3RWOA 1U8CB 3AQIA 2XNJA 2R7AA 3QEMB 3QP9A 4UHHA 1E2FA 2F1RA 2PXCA 4BNGA 5AVSA 4EITA 1KIAA 2KHZA 4HUJA 5I7OA 2BQUA 2ZI5A 1UMCA 3R40A 1BW9B 1JAHA 3PVCA 4GMDA 1M83A 4GI5A 2AGPA 2HMWA 3ORRA 3TW8B 1R6DA 4RXTA 4RESA 1Q1AA 1V3UA 1GTG1 3N40P 2N1BA 3NWEA 1DAPA 3BA8A 1O95C 1Z4MA 4QPPA 4BQSA 1F1BA 4IRCA 3QELB 4I1RA 1CZRA 2B8NA 1X7GA 3WTBA 3U3RA 2B20A 2OUIA 4CVNA 1DDIA 2V6GA 3M82A 5TJ9A 1WXHA 3GQVA 1Y3HA 3WK4A 4D41A 4P0QB 2ACKA 4GZMA 1PUJA 1Z5ZA 2QW1A 1V51A 2RB4A 2BFEA 5ECWA 5MN5A 4A4DA 4IIXA 4DSZA 4WBNB 1U28A 4WAUA 5JUWA 1NVAA 5EVJA 1SKMA 4PBTA 4AJEA 1AQNA 3RS4A 4UFOA 5B1EA 2XQVA 5LQKA 4AG5A 4UU7A 1M1UA 3LF2A 1F17A 5LYJB 1YH3A 4KNVA 4QFMA 2G6TA 3REQA 1YKSA 5BR8H 3NEYA 3HCFA 4PRZA 3IDZA 3NBXX 4Q19A 1EM8A 3NDPA 4MHTA 2HWWA 3AZPA 1BHSA 3L46A 4BV3A 4HV4A 4NCHA 4UCVA 1E58A 2OD2A 2V7VA 4KP7A 4CFYA 1F0PA 1PQYA 1RWMA 4FYPA 5AOBA 3ZJTA 4NX2A 3BABA 4MVJG 5AUQA 1MAWA 5G4LA 5BR8B 2V4MA 3GLRA 3X2SA 1PBTA 2VZEA 4M89A 4IIVA 2Q07A 5IANA 4OJNA 2HDKA 1V95A 5T64A 3VBEA 3GBSA 3TVTA 2EVWX 4X62B 1R50A 3ZWAA 2B1IA 5DGTA 3M33A 2CFCA 4KLZA 3U3DA 2GN0A 3INNA 3WL5A 4EYKA 1BKYA 3O8OA 1HH4A 1UEXC 3CN9A 2R1TA 2PH1A 3G49A 4NMXB 2P62A 3CNBA 3UWKA 4MW2A 1H6BA 4QFCA 4EBCA 2YDXA 4MUJA 4UC0A 3QSYA 5D1PA 2WDPA 2WJYA 2L18A 4FLFA 4H59A 1W73A 4MVJH 4DJDC 5BWTA 2JH9A 4GBED 3KQNA 3TKYA 1P7CA 3PJDA 2NM0A 3L2OB 1HETA 3ESRA 5LQCA 1U8TA 4AURA 3DQPA 3A9RA 3UTDA 4L3WA 2YIJA 4RY9A 3T5DA 1Y1WG 4AYBE 2F1JA 3EX7C 1VIVA 5JNLA 2CXSA 2IY7A 5DX0A 4PYIA 1A9TA 3VYSB 4BO9A 1EXDA 3DZHA 2HHJA 2FPOA 1E3SA 5TSDA 4CLOA 1ZK2A 3IG0A 3ASYA 2UXDH 4OA8A 3UUFA 1TW2A 2ANCA 2C84A 1WWKA 1Y34E 3H83A 4A10A 1EAYA 1RPTA 4LF8H 3OF5A 3WGVA 5L3VA 1IHUA 1QH1B 1MQ9A 1A9ZA 4YMTA 3P94A 4JY7A 4UDNA 2R93A 1ZNZA 4IH9A 1VP3A 3DXFA 4ND7A 5J4HA 4AC9A 5HCUA 4C4OA 3NZEA 3MWEA 1HKUA 2WIFA 5BMVA 2UKDA 2PBRA 2ZJ6A 4RABA 3TM5A 3V2IA 1DFGA 4DNQA 1RXWA 2BHRA 2UVQA 4WA7A 1EFPB 4ED6A 2IEYA 4ZJZA 4R9UC 4LFBH 4UE3S 5K99A 3NYIA 3VTFA 3OP1A 2A7XA 4RCYA 1B73A 5IUNC 1R3UA 3QLVC 1KO4A 1LV8A 3RROA 4NCIA 4DJJA 4A2BA 4X66B 4G89A 1LNZA 1I2DA 3N2ZB 4HL6A 3QEJA 4BFCA 2C7VA 4I08A 1W4ZA 2R96A 1LPPA 4YTEA 1A0OA 1PHPA 4ER7A 1EQ2A 1RCTE 4K8RB 3SZUA 1XLTA 2COGA 3D02A 2NUAB 4FP9A 3LAWA 4XR4A 1PN3A 4C06A 2RH9B 5HKOA 1T0IA 2GNPA 2PS0A 3DEAA 4A6EA 2XYHA 1SD2A 4R1NA 3QOFA 3EW9A 3TGLA 3MT8A 2FEAA 2J9XB 3DO6A 4TLBA 4ZCLA 4UUGA 1RXUA 1J2YA 5G0WA 4AJLA 1XNJA 4J91A 3DCIA 1V6AA 3OQPA 5JPIA 1Q6ZA 1EU1A 3GJ3A 1HE8B 2P27A 3MD9A 5KMGB 2Z2IA 1MXHA 1PK7A 1XNRH 3OQHA 4I4CA 4RF3A 4YWHA 4XFKA 2H1OA 3ZZUA 5IZ4A 5KTKA 4JB0A 5CLGA 4K9QA 4UUQA 4GUDA 1T0PA 3CG4A 4TKUA 3JSXA 1EXVA 4MEAA 4BMCA 2X9NA 5DM2A 3U7JA 2O8VA 4EZBA 1YZFA 3AQ4A 1KSGA 1N5RA 2O3SA 3RFXA 5ALQA 1RI4A 5ANRB 5JCZA 4TYPA 1BJRE 4OP3A 4TQGA 4X93A 5ILOA 1KJ8A 1IQRA 2WB1A 2DAPA 1KSHA 5THXA 3QH4A 2YW9A 1CJSA 4MZXA 4R1LA 4ZJUA 4X1YB 4G0ZA 2J3MA 3GT3A 4A6DA 1JEYB 5K3WA 3WX0A 3IC5A 2Z95A 2LTAA 3H9BA 1DQYA 3L93A 3ONWA 4UVHA 3A6HA 2Y68A 3EISA 3KFXA 3RV4A 1ABFA 2JASA 4PWQA 2WF9A 4DUZB 2ZETA 4ERXA 5HUJA 1JZTA 4CUKA 1EZZA 1E2UA 1H66A 2HJRA 2JKZA 5AXCA 1UPUA 3WRXC 4AS3A 3OO1A 1F48A 4NOKA 4BNIA 4RH0A 2CDBA 1P3Y1 1DT5A 2ID4A 5CXUA 3BMNB 2VYQA 4BRWA 2AGVA 4JD5A 3J81W 5JU6A 1GUAA 3MIIA 4UDXX 4BY9E 2AD1A 5F9FA 3MQFA 2AMFA 1X7XB 2LKDA 3CWZA 1OXBB 1TQ6A 4II3A 1BJTA 3IUPA 5ALSA 2MR5A 2OCAA 3ETDA 2Z04A 4YR9A 4YHHB 1WZIA 4LJRA 4EARA 4Y18A 1OBVA 3B13B 4QBTA 4RZ3A 5E9WA 5CBPB 1DAEA 5KFLA 1VMIA 1BWRA 4Q9KA 2YBDA 1K89A 4DV7B 4RZHA 4BZXA 5A62A 1B2LA 5I9LA 2CGEA 1SHTX 3L7AA 4R8KA 3EY4A 2BFPA 4IJVA 3JWPA 4NKRA 4EI7A 4U63A 2VUGA 3ZNNA 1SUAA 1WXFA 3QU4A 4XIFA 5CDUA 3WLEA 1I24A 3IEXA 3HKBA 3IAUA 3N5CA 3CVZA 1K97A 1Q91A 3E0QA 7GPBA 3LWNA 1M1NB 4QRDA 2Z43A 4R8MA 3AHJA 2OBNA 1CUAA 1PGNA 3ONDA 3CZMA 3L7MA 2X86A 4G0WA 4AAYA 2XZOA 1SHZA 1XTUA 4X97A 2AJ8A 4R7ZA 5DYGA 3PCRB 5MFZA 4QXOA 1XQWA 5ECYA 1JKJA 1ZBQA 4PZCA 1I6UA 5AMXA 3PUJA 4KRXA 4JWTA 2FEOA 1ZD9A 2EDCA 3OD1A 3EARA 3G0OA 5EL0A 4KE9A 3HB9A 3DXXA 1VLQA 2LPMA 3UBTA 1FDWA 3JZAA 2IZ0A 1BU8A 2W2PA 3LECA 5HRUA 6YASA 1H2XA 2DFLA 3O3NB 4QO7A 3OPMA 5I4BA 5KQMA 5KFOA 5TGZA 4UHEA 2HSJA 3K0KA 3PVXA 4O29A 5DSZA 4B48A 4NOJA 4O4JF 3BFPA 4IJMA 4R8SA 2RJNA 1PUIA 2CL5A 2AFHB 2HWXA 1W30A 4ZPXA 3F3KA 3UB4A 5H5JA 3M7IA 2QX7A 3BQNB 3EBPA 3USZA 3K09A 5DNUA 5IYZA 5EEHA 1N0VC 4XM2A 4NLGA 1TK9A 5T3UA 3DLBA 2RKBA 2G63A 4JI8H 2YC2C 1ZXBA 2XMSA 2NU8B 3NWOA 4GBJA 5EP4A 4EI8A 1NW6A 1JHYA 1UIRA 3MYRA 4P86A 3KT8A 4GF5A 3F46A 4PSVA 1CUIA 4GOLD 3EGDB 3L4SO 1SCJA 1TWAA 1Q77A 1T24A 2BC9A 4IIUA 4DA7A 4YRBA 2FQQA 4OQFA 2B1GA 1CP2A 3GRVA 1NJGA 2J7PD 2PY6A 4OSOA 3SXUA 3TVYA 4UAGA 5C44G 3O26A 2Y1OA 3EWSA 3KG2A 5HZKA 4G5YA 1ISSA 5ITWA 5LSAA 3P0FA 4BY7G 2BSXA 2H7CA 4ZOBA 2ZI6A 2UYGA 2DCUA 3E03A 4BZPA 2AX4A 4DABA 4GDMA 3AERB 2PSFA 4HT3B 4YUWA 5DBGA 1UBMS 3MT7A 9LDTA 1JEYA 3DC7A 4K9OA 3ORSA 4F5EA 3U81A 1SUWA 4B3MB 1R9TA 4YCBA 1S0MA 3K8ZA 3IIJA 2PYZA 1AIPA 1MX9A 2QPOA 4JDUA 4WOKA 1O0BA 5LJLA 2PX0A 1KEKA 4U2DA 3Q9NA 4AW9A 1QYIA 3LW8A 4KVGA 1Q7RA 4FMCF 1YDGA 3KXLA 3L7CA 1HLPA 5JZSA 3L6BA 3DBRB 1L4GA 1LF0A 3EWAA 3KAPA 2HF7A 2I4RA 4O33A 2ZIXB 4TWAA 3W9BA 3X1JA 4BRZA 3IEMA 1EFPA 5KTPA 1S3FA 5LXTA 1XVUA 4YRNA 4PINA 3DEKA 3UA3A 2WJ4A 3WGKA 4Q03A 2IJGX 1IU9A 3ROKA 3ZU3A 2AXNA 4Y1GA 1SU8A 4U0KA 3RRXA 4TKUB 4LF8B 3IFSA 3RR5A 2BFMA 3OJFA 4N5DA 3IMEA 5LBTA 3IUBA 1MTOA 4F84A 5EJGA 2H51A 1QOPB 1ULBA 5AK0A 4QHTA 4RH1A 4O3RA 4H3SA 5AP9A 1F6DA 2JFGA 4TPKA 4EYQA 2AJBA 2OORA 5CX1A 2NNLD 1SZCA 4FUTA 5AM5A 1E1QA 1TF2A 2OZPA 4XJTA 4BHTA 3QE9Y 4F9TA 3Q3JB 2DAAA 1JALA 2ST1A 4AJPA 1IHOA 1SO8A 2H9IA 2NXWA 4IGIA 1IXKA 4RIHA 3ZJ5A 2V4UA 4MQ6A 4EDFA 5F3WB 2OH2A 2Y66A 3TOVA 1LC3A 2I6FA 1P1RA 2FE1A 3GEBA 3NV7A 4LWOA 3OJCA 1NXSA 4BMYA 3A3PA 4HADA 2P6PA 3FVTA 2L82A 4MS4B 4BRSA 3E53A 1WZCA 4C4XA 4P2GA 1Z68A 3TOXA 1L5QA 1YFZA 4P38A 1V47A 1U7UA 2QXUA 2HRQA 3ZOZA 4L5IA 1EEHA 3S5UA 5AVTA 3GTOA 3VJLA 1JMKC 2CXUA 5K0LA 5JSQA 3LGSA 1RHKA 2KW5A 3D4OA 4W8OA 3TSZA 3UQ8A 4BUJA 1T5SA 1A0GA 2Y0PA 4YXWD 4WIAA 4R81A 1E92A 4L50A 1QP8A 1CKNB 4DLKA 3BGWA 1QQBA 5C8XA 4ECQA 1V3VA 1R37A 3QTLA 1V45E 1U3UA 4XYLB 3R3UA 3RYTC 4BEBA 3BICA 2JLAA 3VVCA 3KAKA 3I9V6 2FWJA 1BHJA 2GLXA 2CXTA 3NXKA 3CTPA 1XVLA 2HHCA 2XVXA 3CO0S 1P2BA 3HU2A 4X71A 4Z86A 4AN0A 1BCRB 3PQEA 3TRDA 4P36A 3JVEA 4PQGA 3KR2A 5JYBA 4LF4B 2Z58A 2JCBA 2VPZA 5GONF 3E22A 2RBGA 1T25A 2ZJ8A 4JL5A 4NL4H 4YK7A 1KE2A 4CLOB 5IAAA 4M55A 3QNMA 1PT5A 4CQNA 5ICSA 3R7DA 4RZSA 5K6RA 2XVAA 2PKWA 2H4JA 4IDOA 3WGLA 2XCQA 3IAEA 4CM6A 4EX7A 4KQWA 3RAEC 4K0KB 1JBKA 2UVRA 1KVSA 4D98A 4YUAA 3TF5A 5TVKA 3PEUA 3VAAA 2A9OA 3RDPA 3JTMA 2OXTA 1WXGA 3TXXA 4ZEXA 2FQXA 3KTFA 3DBIA 2PSHA 1YO6A 1YOBA 1OCEA 1FC0A 4N65A 3IVGA 3IR6A 3ZXYA 4POOA 4J1TA 1BHQ1 1MORA 1TD1A 5C1PA 3FOZA 4UJ5A 5TT1A 1I01A 1HT1E 3H6GA 2AFIB 3FMAA 3GDHA 3I52A 4ZI7B 4P58A 1TZBA 3L7DA 1L5MA 5HTKA 3EPKA 2HCJB 3GQCA 3GFGA 5EMHA 3K3VA 3LUGA 2Q9AA 3UWMA 3HM2A 1TPZA 4E5VA 4RTMA 3RTXA 4PQYA 2FGJA 1F2UA 4ZRMA 5DHRA 4AF6A 1CC1S 2LGJA 2PNFA 3MERA 3QEMA 1GQFA 4KTTE 2I2FA 5GIOE 1FP4A 1GZ3A 3A6DA 1UWKA 1YIAA 2NYUA 4M87A 2KB0A 3ZIAD 4DCTA 2MSCB 4OI0A 5FEUA 1ZCBA 1ZOLA 2OV2A 1L5KA 2WM8A 5FOQA 1YI0A 1CV2A 1QHHB 1GDDA 4JYBA 3TZHA 3WYGA 1EESA 1XEXB 3GJQA 2MMGA 2JGFA 1UBEA 1SIWA 1G8JA 1OZFA 1VOTA 5LOVF 2AN9A 3L7NA 4MDEA 4DR5H 1YU6A 2HV8A 5DNEA 1P8JA 1FUEA 1E7QA 2G67A 4LRXA 5LBIA 4P3XA 4M83A 5BWBA 3RJ9A 3U17A 4HTFB 4JOBA 1UC4B 3GUHA 3FB4A 3P9ZA 4WBNA 1DC8A 4FIZA 1M1XB 1NWCA 5FLXA 2EQAA 4R9NA 2YL2A 1Z6YA 2F62A 3N76A 2JHPA 1T29A 2REQB 3OC0A 1NQTA 4HGPA 1N5JA 1XZKA 5ES3A 3VHXA 2E21A 3EBOA 2XMZA 3EAGA 4H15A 3ADCA 4NH0A 4UUBA 4DR6B 4XRRA 1XVAA 1R8QA 3CYFA 3KSRA 5BQ3A 4XX0B 3FPCA 4Y9UA 4KN5A 6NULA 1EVIA 3RC7A 1UDRA 4J9KA 2VUMG 3SX0A 4RPCA 4QUGA 3ZDYB 1SXJC 3P9YA 5EWJB 1X86B 5T8KC 3RSHA 4PIMA 3VXKA 3CF6R 3ZBQA 3EC2A 4RSGA 3RAFC 4DLNA 2VDWB 2G9NA 3WL6A 5BURA 4PDBA 2ZU6A 1V11A 4WESB 3TQ1A 3SYNA 1C0EA 1DEOA 3MGCA 2DHRA 2YJZA 3LC7O 3QWUA 3FE2A 3NTRA 1OV6A 1VDMA 4GD3Q 2GN4A 4XCVA 3LUHA 2BQRA 3FPHA 1Z75A 1IZZA 4GPAA 1CUSA 1JP7A 1NHGA 2C9OA 1Q50A 3FHTA 2QUIA 3ZI7A 4ZI7F 1G3RA 4DBZA 4YYZA 1NU6A 1NXWA 3K9NA 1ZSVA 3LUJA 4JCCA 5BVHB 2XUDA 1NF3A 3C15C 4AECA 1BDJA 3I9FA 2BI4A 2O7RA 1AA6A 2JLUA 5GZ6A 1LQ2A 2PL3A 3BGSA 1LRKA 1W1IA 3HHPA 4K81B 5KCMA 3NEJA 5AW7A 3GLGB 2RBEA 3MJCA 3OCYA 3GYBA 2QJWA 3HA2A 1DC7A 3RAJA 3QUBA 3VNBA 4GWGA 2VWPA 4HLCA 1UOQA 3ZJ4A 2ZPUA 2JA6A 2KLBA 5AKYA 1ZD4A 2HRCA 2JBAB 4IR9A 3D7MA 3O1HB 5AW9A 3GTPA 4RFSA 3SLKA 3V9PA 2ONYA 1OYWA 1H05A 3Q8RB 1DBRA 1WDTA 4S0XA 1QFZA 1W87A 3IJEB 2HEGA 3HA7A 2JIRA 3SFZA 2XUPA 3B3JA 2L19A 3DV0A 4AZVA 4YXFA 4ECUA 3O8NA 5K0ZA 1JUDA 1V3TA 5K3AA 4LRSB 2VAPA 1LBEA 2LDXA 2F9MA 3KVYA 1NUTA 4JODA 4XIGS 5HF8A 3TB6A 3ZLBA 2GEVA 1RMQA 4EZEA 2Z6QA 4TZ6A 4IJWA 4JJ8A 4ZCTA 2ZUSA 1RCFA 2QRMA 3ILHA 2R7MA 2JVKA 2ETXA 4HZIA 1NXXA 4HNSA 1YZVA 4XVHA 1RLIA 5IF9A 4M0DA 4JHLA 3VR6D 1VBHA 4WZ6A 3QPDA 4D4IA 2FDCA 4B3GA 1U1CA 3SHWA 3D3QA 3CTMA 4FB4A 2OCKA 5FIUA 2R7KA 1NLFA 3MB5A 4N5NA 1SUEA 1YWGO 3VX4A 5IDYA 1QF6A 4DCJA 2V6IA 3IT3A 4G56A 4CM7A 4DA4A 5B3KA 1KXJA 1B42A 2C9CA 2P0AA 3MGGA 3T5JA 1GPYA 4YMHA 3K05A 1VPDA 4MARA 5H83A 3PENA 3JQAA 5IJ0A 1PNTA 1EBUA 1GQQA 3HDVA 5IKEA 2BZ0A 3W5AA 2WPDA 2A59A 2A33A 3BB4A 2FMFA 4D74A 2MCTA 1M0TA 3SSNA 3ZNPA 3I6MA 5I5TA 3BACA 5IK2D 4MWOA 4WD3A 1JIQA 1W25A 5LP6B 1JIKA 3NXSA 2JH8A 4M6WA 5IHXA 2ZIFA 3TDMA 1VL6A 4Z8YA 4BX2A 3ZY3A 1RAEA 1RMTA 1E1KA 1XN1A 2A14A 2WT4A 1LLCA 2I22A 4RQBA 3E6AA 4R2IA 4ZMBA 1VCMA 1ZRSA 1SQ5A 1AHHA 2ASEA 5BMVF 3OJWA 4UD6A 1N57A 4D79A 3CCBA 2W83A 3A3YA 1XQ6A 4I6GA 4RZQA 2CJYA 4A0GA 5I9IA 1N34B 2WSMA 4M4SA 2Z83A 2ZJ0A 2XUIA 1PT7A 3ELYA 4IKEA 3N75A 2Q6IA 1PVDA 1S2DA 2BDUA 1P44A 3ILVA 4MYUA 1N2HA 1G5RA 3GGOA 4EB0A 1CJKC 5F2NA 4Q7KA 3W9YA 5FI0B 3TOZA 4CN9A 2FKAA 1H2WA 1P6UA 1Z36A 5ALRA 3ZOKA 3B60A 1K5GA 3DEHA 2ZT6A 1FFBA 3UZUA 2W90A 4UZEA 1S4MA 4Z0NA 2ZDHA 1EB8A 2Y0EA 4R51A 1SM4A 3HVJA 2B5WA 3LLUA 3HKCA 4K40A 1IZ7A 3BFVA 4NZYA 2YHUA 4YP1A 1G3QA 2OKCA 3C7AA 3PTZA 2B7CA 5HYVA 3MHTA 2DULA 1N1DA 3A3OA 1K3TA 4FB5A 3PNSA 1KDRA 2P2YA 4N0PA 2FEXA 4M8KA 4GOKA 4QEZA 4QDUA 2OPHA 2GFQA 3JAKA 3W5HA 4Q3KA 4YUYA 1VJDA 4R2XA 3JQQA 2B7BA 1GO2A 5D3KA 4A3JG 2BOVA 3UMCA 4BFTA 1JHMA 3GEEA 2GHQA 2F8TA 5NLLA 3AVPA 1RKQA 3H4TA 2AJLI 2IHTA 3MMNA 3OTHA 4DLUA 4IV0A 4UOZA 1FVOA 3IUMA 5A9SA 1UPBA 1R7RA 5FJIA 3ABSB 2RHHA 4FYWA 5DN6A 2ZUEA 3CLUC 3P2IA 1PGJA 1IEWA 1MR3F 1T2UA 4RUKA 5JS7A 3WWDA 4N3CA 1GJRA 2OP0A 1UMDB 3C1TA 1KRXA 1T35A 2VZLA 3A9SA 3MK31 4LG1A 4WECA 2DERA 1TYEB 4CM9A 4JYAB 4ZU1X 4AFNA 5AJYA 1IPFA 3CUUA 4O7WA 1KAOA 4ZOEA 4RB1A 1N9KA 2A1UA 3GLGA 1T15A 5IWAH 1XZJA 3F9CA 4FJ1A 3II6X 4C05A 4CRWB 3PR4A 2DE0X 5ILGA 4RVUA 2PUDA 2Q3HA 1G5QA 2RF4A 3N3AC 3QVWA 4RTOA 1X1QA 5I5EA 2JIMA 3BM5A 1KZ4A 2KWIA 4IQ8A 3NGXA 5TIIA 2EOAA 1Z5OA 3EXEB 4URUR 1CUUA 2RGNA 3GRAA 5D1OA 2LZ0A 4EJSA 3PKJA 5HM6A 3CT4A 4JASB 3ICPA 1QU2A 5AI4A 1W88B 1H42A 1PD0A 1W9MA 2EZTA 2JGRA 1SC9A 3BDAA 4QXRA 4TTSA 4WESA 3RTEA 4C6TB 2IDJA 1JTVA 4P82A 4CIWA 1XZBA 2WEKA 3C8MA 3AEKA 2CLMB 1JFLA 4LHSA 3UMJA 3UJ3X 3VYUB 2H8KA 1IOVA 4G25A 1PWHA 3N87A 1OROA 5EJMA 3KJNA 3SC6A 2JPDA 2D3TA 4BY1G 2KQUA 2XQJA 5GM1A 3SOPA 5KX5B 5D86A 1ODIA 1HWYA 4NE9A 2C7BA 5E9AA 4JI0H 2H1HA 3NGLA 4RIIA 1E2EA 3RT9A 3HE3A 3AVTA 3BBPA 1E6MA 1HE1C 1V43A 4DMLA 1JG3A 2CLSA 1I6KA 1M8PA 3FCSB 4A3BG 3O9MA 3ZWNA 1T5OA 1X77A 1NI4A 3CH7A 4JA0A 1LQUA 3WIVA 4Q21A 5B1IA 1DKNA 2WV7A 3RS2A 1V9LA 2O1SA 4D6PA 3DLIA 4QTYA 1XTJA 3GPCA 2OFXA 3ZD9A 1A7AA 3V8QA 2NP6A 4MA5A 4X6YA 3NAZA 4A91A 1VJGA 3QU7A 3WNCA 2F1OA 4ZIRA 2YXBA 3ISTA 2FY8A 2VPIA 3RAGA 4KUGA 1QJCA 4MJLA 5KB3A 4W1QA 3QG5A 4DCGA 4MS1B 4FZRA 4MIKA 1NQOA 1YD7A 1XEWY 3D8SA 4KHZA 1DTWB 4Q3LA 1MTZA 1Y1TA 3MYYA 5CLIA 3WYFA 4IWYA 3H17A 3SJCA 4MW0A 1IQUA 4REMA 3BEDA 4UCSA 1SG0A 3VYVA 2UUAB 2D06A 3S24A 4RTKA 3X2EA 1SGWA 2OO5A 1CDEA 5E3IA 3AI7A 1GKKA 4CDRA 4EZIA 9ATCA 1C7RA 3Q8KA 1KMHB 3LQRA 1U1GA 1MG0A 1XF1A 5DHSA 1F4VA 2IOQA 4HS9A 4RJTA 3CVWA 1TAUA 3BGIA 3PHIA 3LPDA 3U5TA 1AKMA 3ISVA 4Y6RA 2XDQB 5C8YF 5C4XG 1HDCA 2FF5A 3JX9A 3NHLA 4WCFB 2R93G 3N2EA 4ZK6A 2P4SA 1G8KA 2I8LA 3JQ9C 5KSZA 2G36A 1YRHA 2QYHA 1IJFA 2BEWB 2VSYA 4Z49A 3WGYA 4AX4A 3SGLA 1OH5A 1GNVA 4F4XA 1SHLA 2XX3A 1WIWA 1UK8A 5CD9A 1G20A 1E1QD 1FTGA 2BEUA 2CFOA 3QFSA 3GFPA 3KJEA 4WY2A 2WY2D 4AQ7A 2F8LA 1EB9A 4RLFA 1ZUNA 1Z73A 2O57A 2C96A 1K7CA 1RK5A 3NGDA 3O5AA 1O5TA 1GITA 2AYZA 2D1FA 4CUJA 5CYOA 3LF1A 2ZRCA 5INTA 2X7HA 3PGXA 4LGVA 4X3CA 5CK5A 3UT5A 4FS3A 4RLHA 5GIPE 4ZEOA 3VU9A 1GEGA 1SULA 2EKDA 3HDQA 4LJAA 3U62A 4OXIA 1V9PA 2C4UA 4LOKA 5JY1A 2ABJA 5GOTA 5K3FB 1CF2O 1KI1A 2AC7A 1N5DA 2D59A 3IDSA 5EJ9A 2Z02A 1WPXA 2HIAA 4Q9IA 3F6EX 4H3VA 3SX4A 3Q4GA 1XZMA 4ARSA 1F0KA 1U8YA 1KYZA 1L4MA 4LI3X 4IHAA 4UMFA 2V0CA 1DVRA 3C39A 3NJ4A 3IXQA 2X5KO 2AFHE 2W6QA 5IFLA 1ZIOA 2QYOA 3PQFA 2ZR0A 4A26A 4D9JA 1Z06A 3BTSA 1SBYA 2HLNA 2VF7A 3DNMA 3L02A 3L43A 4AZ3A 2WUEA 1BWQA 3DMYA 3U80A 1XJWA 3VNAA 1CYEA 2GBGA 4LQDA 4YR3A 4BVJA 3BAZA 4OYRA 4TRNA 3RS5A 1RLOA 3AOEA 1JECA 3PDCA 5L8VA 3AEQA 4HWGA 1N32H 3GRYA 2V4RA 5K4GA 1U5BA 3VAZA 3DT6A 3ORHA 1HYBA 4L5AA 3P27A 1TA4A 4QAJA 3G0CA 4QJ4A 4KKVA 5L4SA 4DNOA 4MVCA 1J5EB 1GOTA 3K9GA 1W0CA 3MAJA 1SK8A 3MGAA 3FKQA 3F7OA 2AWNA 4L6CA 3UT0A 4YRKA 1KIFA 4B84A 3IOEA 2BQ3A 2IV7A 3VVBA 1Y9DA 3W3AD 3KTOA 5HTOA 2O5VA 1MJHA 4I1VA 4L9SA 2G77B 2I2XB 3KQSA 3IMFA 3R5HA 4LNUB 3HRKA 3JQ9A 1F6WA 4RVDA 3PD1A 5EIHA 4AKHA 4EHLA 4JQZA 2GJ4A 3KYBA 4I4TA 1N5OX 3PQ7A 1SG6A 3JU3A 2B4RO 1XRMA 2QT9A 1OXSC 1G8AA 3CRZA 2FPPB 1E2NA 4IJ6A 1C81A 4LCEA 3DKPA 3UN1A 2HCBA 3OSUA 2DJIA 5SZHB 4H7DA 3NKLA 4KE7A 2J9RA 4G41A 1R1DA 4KQFA 1D03A 3GP8A 2DYKA 1VLMA 3EG9B 1H5UA 4BP9A 2PZAA 3BWYA 1JR3A 3KAJA 1Z6GA 4BTLA 2R8HA 2C03A 1E9EA 3Q0EA 3AUYA 4YAGA 3T9DA 4E4YA 3JPWA 3K30A 4ND2A 3IS3A 3LT1A 1XCMA 1GAJA 1GU7A 4L4XA 5K0EA 1KJWA 5JO0A 3HBAA 5EIBD 1R0SA 2Q4OA 3RVDA 3MZ0A 2FH5B 3VNUA 2OOSA 2NVWA 4W7HA 1W4AA 3RYFB 2HRDA 1NVWQ 1NJ1A 1A8IA 1XDNA 3C85A 1OOEA 1PNVA 2H7VA 3ZU2A 4DUGA 3FD8A 3V2HA 5K3CA 5U1PA 2BW0A 3ZEAA 4B71A 3MG9A 4Y2QA 5FL7D 1ZSNA 2J0SA 1E2GA 4MDFA 2ASDA 4ZAZA 1MO3A 2H57A 2JD1A 2FKNA 1M10A 3WS7A 5BV0A 4K6HA 1BFDA 1UBFA 2HAEA 2IP1A 3ESBA 5G1OA 1ZMOA 4MGKR 5CA0B 2A5GA 3PFBA 2IBTA 1AC5A 1UFVA 1U8ZA 5T67A 4YAKA 4V0RA 2CXHA 5EZ5A 2GUGA 1GG8A 3G1TA 1JEOA 4EELA 1MO4A 4TYQA 1XA4A 3FWZA 1P9NA 4ZYVA 3OQBA 5TQ0A 4ARAA 3T9CA 1PUXA 1Q12A 4XM0A 5LZ7A 1VDZA 4QDTA 4O4IB 2CYAA 4B7CA 1KF0A 3N74A 5GQSA 2YJ4A 2FSGA 5DISC 1RLTA 5CYFA 3D2AA 1ECFA 2FF7A 2INGX 1SQ0A 3MAGA 4J2TA 3CUEF 3NGMA 5DHTA 3AUAA 2WD7B 3GFOA 1DXOA 1UBLS 2VTVA 1GKYA 1KBQA 1HSZA 1QCCA 3OZGA 5KOJB 4Z3DA 4RVGA 4G8DA 3LTEA 3AIOA 2DPHA 2ID8A 1ZRMA 4PSUA 2C35B 2ZTSA 2WJ6A 5DTEA 2PE5A 1QHFA 4BVEA 2AZXA 4H6VA 3G2NA 4NYJQ 3ZJYA 2V6MA 1F4LA 4IXNA 1ZK4A 2Z30A 1Q57A 2FYTA 3EF1A 2PUCA 5L4NA 1JJIA 4HBZA 4KWTA 4RYLA 3H0GG 1RBZA 2ZVDA 1HLFA 2VL7A 3GIQA 3IPLA 3MR6A 2GJ8A 3OU7A 4WACA 2P68A 3RVSA 4JI4B 1PFYA 1A04A 2C5FA 1P2GA 1GY8A 4D5GA 5JMOA 4TM5A 1J7JA 1RAFA 1BXGA 3EVAA 4I8DA 4U3JB 2A67A 1L4FA 2JCXA 1BN6A 2GDJA 2BMWA 3AWDA 4QSMA 4UEWA 3FHOA 4R8RA 1XKXA 2SKCA 2BFWA 2QTGA 4Z2AA 4BEVA 4DDMA 1DQSA 5AJUA 2HW8A 4KWHA 1M5UA 4FHFA 4GQAA 2DH5A 2GN2A 4ND4A 4OGLA 1VPLA 4PWYA 5CYGA 5EIEA 2HZ7A 3JCZA 3V7FA 2R84A 1M75A 4C7VA 2Y2UA 1I1LA 1AB5A 1GTVA 1PV2A 4OIMA 4XIYA 2VSFA 5IASA 3K96A 5KJFA 1RDFA 5LFAA 2F3QA 2W6CX 2X7XA 3O8CA 5DTJA 3MTQA 3PJEA 1SVUA 2GI4A 2NO0A 5EPOA 5L1IA 2E1RA 4ZVLA 4PZUA 2TMGA 2CF5A 1WF3A 3FPSA 1JG1A 5FFFA 3ELBA 4GR5A 3QXJA 4PZPA 3HFRA 4R0MA 2W9AA 1C7ZA 3ZYCA 1N3LA 5CG1A 1L4BA 1FFDA 4JT4A 4OMUA 2CNKA 1MQ8B 2Q9UA 4XGIA 4DWVA 4EHBA 3QF4A 3KEQA 4M76B 4US2R 5IK2A 1G5PA 3W4KA 3NHUA 4A3DG 4PHHA 3VDRA 5HUHA 3EOAI 3JVVA 4X84A 4F2GA 1DV1A 3H2BA 3RC1A 4V3BA 2I66A 1OZGA 1EK0A 1XF9A 1HYGA 2WJAA 3ENWA 1FMJA 3ZKWB 2EFJA 1NLUA 1P81A 2C5GA 2YHBA 3ZWYA 1N5KA 3RB4A 1UPXA 3EZYA 1XPRA 3B38A 4UZSA 1O8CA 4YUZA 2QU8A 1KYVA 3HA3A 4F1KA 2XA2A 1EINA 4XXHA 5ER6A 3B48A 3H3FA 2HBYA 3SR4A 4GW3A 4FU0A 1UDCA 1F5SA 2Q27A 2ZJBA 4YMUA 4EPXA 4IR7A 5K0TA 2VBCA 3FTDA 3G88A 3OEHA 4X64H 3E3MA 2JJ2D 5B3AA 3ACBA 3HXQA 4QULA 3IVRA 4ER0A 3P4UA 1QCYA 2ZOSA 3KXKA 1N5IA 2HGXA 1WV0A 2OZLA 2VQEH 4E6EA 3BX1A 3RE1A 4HR7A 2JGNA 4H9GA 1CR0A 3K9WA 3O3CA 1TM7E 4RAOA 4C2TA 3DHWC 2H48A 1Z4PX 2P6NA 4KQJA 3H8SA 3F0TA 1QYRA 2YFQA 2WUVA 3EEBA 5AKEA 4JI4H 4JCOA 2EX4A 1NUSA 1RWNA 3E3OA 1A69A 1CS4C 2AN1A 1GPWB 4KWIA 4F46A 1E63A 1WXEA 1KVRA 3NBMA 3SBDA 4F38A 1WOYA 1Y8RB 5CT9A 3I9MA 5I5SA 3QPWA 3HKZE 1N5MA 4LYJA 1BS1A 2COIA 1PS0A 1XTZA 2R79A 1GZ5A 3DW3X 3QFCA 1GADO 3GEGA 3M81A 3D0QA 3HB1A 5DO9A 4OV6B 1D09A 2WT9A 3QVJA 4DVJA 4B4VA 4KOAA 4KE8A 4ZPJA 5CX4A 4RZRA 1UJCA 1Z74A 4REOA 5C51B 4GPZA 2ADFA 3T3MB 5EZYB 5KYUB 4L3VA 1FNBA 1SVKA 2O7NA 3V32A 1JR2A 4G24A 1B8UA 1NNSA 4KXLA 5FPYA 3LQFA 3O8RA 2HWUA 1WX1A 3RFVA 3VH3A 1L5YA 3I8OA 1U3FA 3KLBA 1V8BA 1YJQA 4B4WA 5B3JA 3TAUA 4TTVA 1R8XA 1W34A 3HLTA 4EJMA 1RAIA 4F8EA 3UHFA 3PQ2A 1JHDA 1GT6A 3NHRA 2BD0A 1A97A 5AW5A 3A32A 3L05A 2QNRA 4KN8A 4GEKA 3GELA 5E3HA 1MJGA 3IQXA 3JQBA 3WBKA 3FDXA 1J4AA 5ICGA 3ODGA 3SFTA 3TIFA 3LKBA 3RTGA 5TMBA 2JIDA 4J9OA 2H2IA 2XUAA 3N8IA 1UKZA 1GNQA 2FMUA 2B25A 2FW6A 4JI5H 2BCGY 2GNAA 3ED1A 4X8HA 4JUAA 1UQRA 5FYQA 3OAAD 3PQ3A 2WTEA 1KJ9A 5CU7A 2UXCH 3OPYI 2QL7A 5ILQA 3BIFA 4K6CA 1YQWA 2GCNA 3RRNA 2AFRA 2RI0A 2GB4A 4XGKA 4XIIA 1U90A 4YXWA 3W6ZA 4V24A 4DGSA 2I4TA 3GNTA 2PWAA 3W78A 4RPHA 2ZULA 4COOA 1Q21A 4WXHA 3IP6A 1VPWA 2E4UA 3Q0IA 1G6HA 2HDHA 2RG1A 4CMFA 4E5YA 5FAKA 2X41A 1A76A 3OA2A 1XNQB 4OM7A 4LMPA 1GGFA 1T2NA 2IDKA 2R82A 1GYPA 5EINA 4LA4A 4P3OA 1DQPA 3GVHA 1CX9B 4A3FG 4HEQA 4IG4A 3R75A 4NFSA 1NU8A 4IAJA 4L8WB 3DF7A 2ZRMA 3CXRA 5KTNA 1OI7A 2X1MA 4CEHB 2QVYX 4UNSA 3RYCB 3SS9X 2O54A 1E5XA 2CE7A 4NJEA 3QQ5A 1P17A 1IY9A 2IEIA 2AOXA 1S3SA 5FULA 1H2EA 3RAQA 3EC1A 2VC2B 3M8KA 4KPUB 4LK3A 1XBTA 3UGQA 3ID6C 3X1DA 1P1BA 4GP6A 3GVXA 4P3PA 4E1AA 3ZK8A 3JSNA 4C7JA 3RIXA 3CIOA 3U4MA 1FS6A 1XRNA 1MAVA 1NT2A 1U4OA 4BC1A 1Y7HA 1WOMA 2AC2A 4BO5A 3HN7A 4QXMA 1VLHA 2CHGA 1Z0IA 2HF2A 1C41A 2E2HA 2ZU0C 3B3GA 5CYPA 2GTHA 1L5LA 3M6IA 3H86A 4MV5A 5KAPA 2XKAA 5C37A 4ENUA 3LE8A 3R23A 2B78A 3V97A 1JJAA 3T1NA 5M29A 5I5WA 1KDTA 2WU1A 2CBZA 4TUYF 4IM7A 4BV8A 1CF4A 1E4EA 3IMCA 1BSVA 1ZKDA 3HACA 4DG5A 5MGBA 4Q3OA 2GVNA 3GV0A 3RSFA 5JBIA 1TTPB 5CLJA 3P9SA 4TGLA 1B8VA 1XRRA 1QC5A 4QOGA 3QVOA 2AZTA 4JP2A 3QELA 1RHJA 4XGRA 5J5CA 5B55A 4YWJA 3WRWA 2O8BA 2A6PA 3VX3A 1KKMA 1V7PC 2W0MA 2XUFA 2C7RA 3HBNA 1U8UA 3DR5A 3LYHA 4YJHB 2J0EA 3HB5X 1OYYA 2Q0QA 2VH1A 3L0YA 4REQB 1YDMA 4LXTA 4RSRA 3KOZA 3UAZA 3ZWKA 1ZGBA 3GAAA 3S8YA 3I5MA 4BMNA 1LY1A 3M1LA 1Q1EA 2CFIA 5K8UA 2P6OA 2VJKA 4JI3B 1N7JA 4HJXA 3G6XA 5T57A 3OBBA 3PEYA 3OFNA 3PNKA 3T5CA 3D2BA 5JWRA 4LKOA 1M33A 2R8PA 2YV2A 1W48A 1XV5A 1U94A 4M60A 7ADHA 1QYDA 4KUEA 2ODQA 1YBVA 1BDBA 4OUKX 5LQJA 4EEKA 3EFBA 4M1OA 1SBZA 5KQLA 3OKAA 1I36A 2PL5A 13PKA 4XEUA 1Y6GA 3OZWA 3GXOA 3QRWA 5EWGA 4PQEA 3TLZA 1OF1A 4FW9A 4JB8A 4ZGWA 4NH4A 5AK5A 1S6YA 3LCCA 3R7BA 1GIAA 4BQNA 3U19A 5E6SA 4F3RA 1VMKA 2HPVA 4F71A 4YRLA 3EULA 2W2MA 3C1AA 3I8SA 2NVUB 3KDPA 2R7NA 3W5OA 2X8AA 3EF3A 3OOHA 3OTWA 3ZWMA 3BB3A 4A8TA 4AWXA 4DA0A 5FOSA 4FZ3A 2WP0A 1E9VA 2XZLA 2CVFA 4E03A 5AD1A 1DDGA 3C3PA 2VRBA 4NU6A 3DLPX 2G3YA 3L0DA 3KB8A 3TXAA 2DT8A 2PJDA 2NW6A 1LLQA 1NLYA 5HEKA 2FKLA 2JFHA 4EKNB 1Z13A 3H9GA 1LNQA 1Y4UA 2DRIA 3FCAA 5JV5A 1JYFA 1XDWA 2YX1A 3DKIA 3VR2A 1I9CA 1Z9BA 4KQGA 4WK6A 2D1QA 1AQJA 3FTEA 2H17A 4IIGA 1KNXA 5BSFA 1PL7A 4BP1A 2F4VB 4UPVA 3ABOB 4P9NA 3NDRA 1LSOA 5KBYA 4YDQA 1Y6ZA 2FK2A 5DSXA 3UKJA 4RHEA 4ER6A 2HK6A 5CM9C 4CTOA 3NTXA 5CB4B 1ML4A 1XTQA 2CNDA 4QOEA 1V39A 1Z34A 4H31A 4K05A 4M7WA 5BQOA 4F3KA 4FCWA 3PQCA 4ZT3A 4MDYA 2YCHA 4JI1H 1JI0A 4W5QA 1A50B 1T0BA 5JH7A 2VZ0A 2W8ZA 2YXNA 3FCCA 1XZEA 2VWQA 4NEHB 1EIZA 4OB8A 5B64A 4I4NA 5WRFA 4WBSA 3IOMA 3OQ1A 3IPXA 3I04A 3HCWA 1ZIDA 3H0EA 4RD0A 2QHXA 2C1XA 2UUAH 1DWOA 2O4UX 5EYPA 4WN9A 2P5SA 3RVPA 3WGOA 5J58A 2C0QA 2CLFB 2F43B 3FDIA 4KB5A 1K6MA 4WK0B 1FYVA 4OKIA 4EEYA 3EEIA 4HAIA 3PC6A 4X7MA 5IXJA 1FS5A 3B6KA 4J03A 2ZRBA 2ZRGA 4P4GA 3QNUA 1JNXX 4GZ3A 2GMWA 4XJVA 5COAA 4FNOA 5LWHA 1ZJWA 1ZAYA 1WCXA 3AKZA 1S97A 2YV3A 4N12A 1ND6A 5B58T 2FP4A 3U3XA 2XB4A 3FAZA 4QYSA 5TX7A 1SHJA 3NHPA 2BGIA 4GIBA 1MOQA 3HKEA 3IAS1 3IN5A 4MIEA 4FZVA 1IBCA 3D9QX 4DTCA 3IKLA 4MKZA 1D4ZA 1DNPA 3GV8B 4M1EA 2ZJFA 2VLBA 4IW3B 3NONA 4OU5A 4Z1MA 3B6EA 5EQFA 5JAZA 3FCOA 3B7GA 3DLHA 2C9MA 4AWAA 4F0JA 3JQAD 2WJHA 4JBLA 3AF3A 3D1JA 3B3QA 4RADA 4S1PA 5BUCA 3VRHA 4ON9A 4ZK2A 5BOSA 3NI2A 2JA1A 4GI1A 5JBQA 4MS1A 5CPBA 4E2ZA 2EWMA 4O81A 4LSXA 3CVVA 3I4NG 3KYJB 1WBBA 4ZIRB 2QBYA 4Q4CA 1AGYA 1MX3A 3DD5A 5HK8A 4TROA 2JAQA 1VSBA 3BD8A 3EXFA 3HDYA 2FMIA 1VE6A 3IKVA 3GIMA 1KWGA 3OQMA 2PR7A 4K1LA 2C4HA 5D84A 1VTKA 3BREA 1W581 2W42A 2HF9A 5ERGB 4QEDA 4RTLA 1EX7A 1QE5A 2AF3C 3DHYA 3DNPA 4DANA 4X00A 1X1EA 3JRNA 3ICOA 5A6SA 4OQPA 1SFRA 4IS2A 2XKBA 4KC0A 2JGIA 1M8KA 1FNDA 3HUFA 4IGKA 5DHQA 1H8HD 2QSZA 3FYUB 2V6FA 5G0TA 3GEIA 4A8JA 3M89A 4U2EA 4RK0A 1FP6A 3U48A 1RWQA 1U1IA 2WWGA 4RLSA 2B4YA 4G97A 4X65B 2AVNA 2C97A 3GPIA 4HPXB 3AY6A 2IDZA 3ZCPA 1KDZA 4MUMA 2O0MA 4QDZA 1QAQA 4DR3B 2ZVPX 3O1JC 3RUIA 3KQHA 5EA2A 4EG4A 1U0OC 3ML1A 2HSEA 2ENUA 4HG2A 1OFVA 2IPMA 5F3RA 1Y3IA 4QTUB 3GGGA 1Y4DE 3K1AA 4AUKA 4DYVA 5JS6A 3TTSA 2Y1FA 5IP9G 1ZOSA 3I73A 1Z07A 2NZXA 4XDHA 1SA0B 4MQBA 2OCXA 5D01A 3BK2A 3KLOA 4NMMA 4WFJA 1NUAA 4UBJA 3M5CA 5A05A 1G8SA 3M70A 4IXDA 2YXLA 1KORA 1XP5A 3EXEA 1Y5RA 3R5JA 5FL3A 3COZA 3CEHA 1SURA 2ECOA 3NBAA 3L92A 4HDMA 4RGVA 4AU1A 1QDEA 5JDCA 5K0JA 1RI3A 3G1WA 1XTVA 1DCTA 3A26A 4JEHA 3UQZA 4LSGA 4BLPA 4DR2H 4X5OA 2VT6A 2ZPTX 4I81A 4D0RA 3DDHA 2CNUA 1IIRA 2A1UB 3ENQA 2Q0HA 3O92A 4PYKA 1RBYA 1L8XA 4K9NA 1EZ1A 5DN6D 2EW1A 2ZRKA 1ZD8A 1FDRA 2P0EA 2XHZA 2Z8YM 3BH7A 1ACLA 4ZQHA 4G85A 3QG1A 1UJ5A 1S7GA 2CJWB 3ZTWA 2NXCA 2WB4A 2OB2A 2IH5A 1X80A 5CVVA 3FDSA 3RB8A 5EJEA 2XQIA 4WLUA 5SV2A 1ZC4A 4DSOA 1IMJA 1PNRA 1P7YA 4YMSA 1YJAA 2WIDA 3MD0A 2OHGA 4UVDA 1MZBA 2OYCA 3SN6A 3UV3A 1DCMA 1PJLA 2HBQA 3O2SB 5JQWA 4JLAA 3ZWWA 1DAFA 4JWKA 1QLWA 4BFUA 5FO0A 4ZAXA 3K8YA 4Z0HO 5HG0A 4O3MA 2RARA 3B1WA 4S35A 2FPGB 4CLRA 4B1FA 1U4NA 2ZSKA 2YS6A 2PA3A 2QW0X 3BCRA 5DE3A 3I62A 2R8OA 3DZDA 2ZSUA 3U16A 1XLUA 2QP3A 4O2RA 2QQEA 3O8DA 4EPRA 4O4HF 3LK6A 3AY7A 1FX1A 2NYAA 2Q8QA 4EY4A 1V4YA 2JI8A 3AEYA 1GGEA 2WWFA 3BQ2A 3CB4A 3OZXA 3PPVA 5E2BA 1O54A 2IX9A 4HDMB 4BASA 2F1HA 2RKWA 5H16A 1SK9A 3QVTA 4LOHA 4MWGA 1U1EA 2O14A 1GRCA 3SEQA 1XAJA 4ITVA 3CRRA 3HR8A 4PV7A 1AZWA 1ZO8A 4Y9DA 5HQTA 4Q1FA 5CH5A 1UXKA 2DECA 5B1HA 2GJAA 4MVJM 1G17A 3PC8A 5KI6A 2J5KA 2ZPAA 2P3OA 4CGYA 3OQOA 2PZFA 3LHSA 3KELA 3INYA 1TKRA 4ZJPA 1VMEA 4MUIA 5JNVA 2PUEA 4YH1A 4KXYA 1DEHA 1CSEE 1VSQA 4OX9H 4X91A 5TB5A 5CJPA 3RK0A 2ZXUA 1NKVA 1SKYE 3PR1A 3QUAA 5D3MB 2NT3A 1JU3A 3DDSA 2JKYA 4RM2A 4ERNA 1NOIA 1NY6A 5E4TA 4XEHA 4JFRA 5AVRA 1UR5A 4O7YA 2XNDA 3EPRA 3FF1A 1RXSA 4Q93A 3SHTA 3ZXSA 4GP7A 1XDGA 3IT0A 3U55A 4FDAA 4ECRA 1O9HA 1QIEA 2ZT8A 1BMTA 1ZXLA 3X2FA 4NLLA 2IBKA 1NRJB 3QYJA 4A5OA 3GLFE 3PD0A 1D2AA 3BMXA 4FFDA 3AINA 1M0WA 1JWBB 2AT1A 5CT5A 1E5LA 4CKYA 3FDJA 2YJNA 4QJ5A 3RSOA 3S1AA 3O4JA 4LC0A 4A0QA 5F5LA 4OHBA 3LUBA 4TN5A 2XODA 2Y4OA 4LJ6A 4OK3A 1J9GA 3ZE0B 2PO7A 1FTSA 3L7IA 4JX9A 1A5TA 1B04A 1PR2A 3GP5A 3HJTA 1ZCFA 2RKOA 4IDBA 2ZRFA 4WK2B 2JLZA 3FWPA 3QZ8A 4J3FA 5EOVA 3TKAA 3BWCA 3ZCRA 2JEJA 2PX4A 3LZ6A 4YALA 5JAPA 5IXSA 5LXTB 1QAOA 5FNVB 2X5NA 2BFCB 4G1EB 3LZCA 4LF6B 2GZAA 4JVMA 4RHCA 2ZQYA 4KIJA 1C1YA 3V8VA 6Q21A 5IWCA 4J9MA 4CT0A 4GGOA 1XHLA 1AO0A 3UAXA 5HFJA 3UTCA 4ENVA 5BWRA 4M1ZA 3HCOA 4CODB 2O3JA 4LYHA 4MGYR 4FE7A 3ROXA 2G17A 2QTVA 3BXXA 1OILA 1T9KA 1YQEA 1JHQA 3IQZA 3MBKA 3QMWA 3CO5A 1S0NA 1QIIA 3DMHA 3KEGA 2FP4B 2FW7A 2GEDA 3EGXB 4KMMA 4LZAA 5F4ZA 1KE1A 1L5GB 5CDFE 4LX0A 2H54A 5LKRA 5GADl 4E32A 8ATCA 1CIJA 4M7PA 3EIQA 4W5NA 3S1SA 2WHPB 4I50A 4JV5H 3LRXA 3FBTA 1Q7GA 2HA4A 1QG6A 2JBAA 4FXPA 1A3CA 2ZYGA 3N6RA 4W5JA 4G09A 3SX2A 4I19A 5JAQA 1GWNA 2PV0A 1L4YA 4P33A 3BH6A 4L2IB 5KFGA 2Z57A 4HVCA 3A3KA 4BFZA 3C5CA 1MH1A 1P7VA 3DDCA 3FPAA 3GG2A 4OL0A 2FSVC 2I7XA 4DWOA 3OX2A 5JH7B 3LQ1A 3FIUA 4FOTA 3BHIA 3NORA 3AYHB 1F20A 1GCIA 3E18A 3QM1A 4G07A 4AO7A 2O8DB 1MA0A 2QX8A 2XWQA 4HJRA 4CIVA 5EXPA 4LDPA 2CFTA 2WD8A 5JO9A 1LTKA 1PR4A 5BSMA 4KJXA 1I4LD 4QXQA 3KUCA 4HB2A 2E89A 2PYDA 1M8JA 2XRZA 1MW8X 3QUQA 1TJYA 2J0UB 2H7YA 4AMVA 4UTOA 4BVGA 3LHDA 8LDHA 4GM1A 4E5SA 4ZGBA 1CQZA 1F9AA 2V3WA 4AF7A 1GILA 4REQA 4DIUA 4XDGA 3N53A 5EKXA 1G3IA 2E4YA 3E9QA 3ZVNA 1YJCA 1DLIA 2EBWA 2RCYA 4CMKA 1CJTC 2HO5A 1O0SA 5FCDA 5DFAA 1JQKA 1EVZA 5JI3E 4MB0A 5JNUA 1EUYA 2XHEA 4XPZA 3OF3A 4LNAA 1HEIA 1UBSB 4RIFA 5IXYA 1JPJA 1Z3CA 4MW1A 2OOKA 1WUKS 3VHXB 3R5XA 2DFPA 2QMYA 2Q5FA 2ZTUA 4LJ9A 1A4UA 3FRJA 4UULA 1HNWB 2RGAA 4XDYA 4B9EA 4PZ0A 1QP0A 3VKGA 3DTVA 3EY9A 2X2EA 5DLPA 4MAMA 4O4IF 4EBEA 1P61B 3K9CA 5H3HA 2H1RA 1ENYA 3SS7X 4LW8A 4E6PA 5ALJA 3W5VA 3RIEA 1FSFA 1KK0A 3OKCA 4MQFA 2WVJA 2F3PA 4KQXA 4J7AA 5KFEA 2AFIE 3B1JA 1QANA 4KZPA 1WUTA 2X19A 3L0PA 3KYHC 5KTSA 4R7TA 3I12A 1GLNA 2H1VA 1GP2A 4BKRA 3DFZA 2C22A 1IHYA 2H1FA 1Z0SA 3GBVA 2RC6A 3FSGD 1RADA 4YAOA 5I8ZA 2PUAA 2P65A 4MKGA 1RYFA 4FQ7A 2X0KA 3H9JA 3S5JA 1ZRHA 1CERA 3ANYB 3OEED 3U3MA 3AXTA 4AO6A 2QR3A 1K9SA 2K2WA 1WM1A 4OKSA 4CL8A 3BWVA 3P2MA 2HA7A 1EZ4A 3DUFA 3HU3A 5DBOA 1M1YA 4TMTA 4N76A 1FPQA 4ICIA 1Y81A 4PN3A 3UF0A 4QWCA 3NOVA 4M36A 1NW9B 1HFJA 2J30A 2QM7A 4ZANA 1X1DA 2CUZA 5TV2A 2VDMB 4XVUA 1FZTA 2UXBH 3ENZA 3HJBA 3RUCA 2PUBA 1FVIA 1M8FA 4M0FA 3V7YA 2X0RA 5CM8B 1IVNA 4UM5A 4KK3A 4CQJA 2UYOA 1KVTA 1YMQA 3DO5A 5KEIA 2CDRA 3V8NA 2BCEA 1Z8HA 2F3UA 2Q9CA 3R3XA 4PYOA 5FHQA 3HDHA 5AJZA 5HIIA 3GMSA 3STUA 3KS9A 1YCFA 3UH1A 1BWPA 3VR6A 2ALJA 3EFOB 3HYRA 2HCTA 1X7YA 3DM5A 2A9KA 3H2IA 1J8FA 3LNTA 3LVBA 4L4RA 1FFHA 2JI7A 2HNBA 1PR0A 4RBNA 3ZDZB 3EH1A 4D9NA 4BXOB 2QN8A 3G7NA 4PFSA 3Q5GA 1PD1A 1A8QA 1BCRA 3FYUC 5IC4A 1AZSC 2FPUA 1GA1A 2JCVA 2FRXA 3PXXA 4DGQA 3R8CA 4TMFA 1YJXA 4HF7A 4B45A 4CI9A 5ELLA 1EDOA 3G17A 1XPOA 5DBIA 3KB6A 2WPDD 3HYLA 3Q3EA 2FX3A 3UJDA 4NAHA 1YL6A 5JVDA 2XB2A 2DQ4A 2CJFA 3WIOA 5AVYA 1FK8A 1E5VA 5TVGA 1O6BA 1PYDA 4JOSA 1DJMA 3WKEA 2ZZMA 3MBIA 3W6NA 2ISQA 4NV0A 1D6JA 2HVSA 3AVYA 3DF9A 3H2JA 3UC5A 3MXTA 2ZJ2A 1U2QA 1W29A 5GM2A 4CF7A 5HBGA 4DNXA 1YQGA 3U1TA 3KRTA 4P4LA 3C3DA 4OHVA 3G9XA 1UODA 3GT4A 2VYNA 3EXG2 3QLTA 4MI9A 4RQAA 2V55B 1CY6A 3N59A 4WNCA 3THXB 1XPUA 4OX9Y 5JJCA 5DEOA 1SRRA 2R00C 2OXFA 2Q4RA 4MKRA 2XCSB 2XEDA 5F9HA 2YZLA 5F1OA 1NG1A 4FINA 2XTZA 1EXNA 2BPOA 4ED7A 2ATEA 2ZSJA 2XADA 3CX3A 2DP4E 3ITDA 4EEQA 3B53X 3ITEA 3OWXA 5CVTA 2ZCJA 5FLEX 2EWVA 2HRRA 2B9EA 3M9LA 1Y37A 4KX3A 3V1LA 1ZM9A 3FHLA 5KYYA 1RYYA 5HJEA 3A04A 2Y6UA 1ODCA 1U2EA 3HGMA 2UZAA 1PI3A 4HH0A 1UKEA 2VJQA 1N3BA 5KYTA 5IBPA 3T1HB 3MR3A 1P73A 4LYFA 3PYMA 1U2DC 4XLZA 2OGSA 4R2LA 1WB4A 3BSYA 3TZBA 1I4EB 3V8PA 3LRTA 5IM4F 1X7DA 4FBGA 3AF6A 3NBZC 2HXYA 3KM0A 3OLCX 1JMVA 2QRQA 4ROTA 4DOMA 1YGPA 5ESRA 5I51A 3U44A 2X0IA 3THYA 1Q7CA 2Z1DA 2FK3A 4CKWA 1WPGA 2Q2OA 2W6MA 5AHOA 2Q1XA 4UHFA 2V0GA 2VSQA 3DBRA 1SOUA 4X7RA 4ITRC 5CH3A 2CHVA 1U2SA 4GPTA 5DTIA 3ELWA 1U02A 3WMRA 1AJEA 4ARVA 4LHZA 1GZVA 1J56A 2ANBA 4WK4B 3EFHA 3G0BA 3EIXA 4CMIA 3KSZO 3LX8A 2D13A 3A6LA 3H9EO 3OY7A 3FY4A 1NYTA 3TZCA 1V26A 2CNQA 1D1TA 2JL1A 3JWIA 1P1JA 2Q2VA 4M0LA 5KSOA 5KFSA 5FBWB 4C03A 4OM8A 4ZVPA 4P7BA 3CRW1 3C3JA 5GGYA 1NBMA 2WSSD 5B4TA 3PJRA 1JIIA 4ZYLA 5FPSA 4Y2JA 4CU2A 1EE2A 2HH9A 4IRUB 4RVSA 5KS8A 4MTEA 4U7CA 4DV1H 1T5HX 2C3UA 1UMBB 3J7TA 2I7VA 4DUPA 2I67A 2V7XA 4EKEA 5KYGA 2ORED 3IT2A 3AVVA 3X1KA 3OEHD 4TN1A 3WGZA 4NENA 2Z5LA 5EMJA 1QGAA 5EQJB 3TLGA 4TL6A 2NU7A 3TQOA 1XR3A 2VKTA 3WGMA 1CHNA 2VHXA 2DWUA 2F2TA 2V9CA 5KT4A 4H7HA 4YP9A 2AFHA 3UJ8A 4D82A 5K6AC 3U44B 3THYB 1JQDA 1N9GB 1RI2A 5LC1A 3HK2A 1FW6A 4FFRA 3L07A 2QN7A 1MRSA 3BMQB 1CQWA 3K9LA 5FYDA 3RM3A 4DLZA 3PHHA 4WERA 2RH4A 3VNNA 1J8QA 2Z3VA 3UWOA 3NHSA 1L3IA 2JIQA 1M67A 2FG5A 3RHZA 3WB9A 5L9XA 1OBCA 2EHJA 4BNMA 1EX1A 2C5AA 1LBHA 1LRJA 4EYHB 1J07A 1NNUA 1XU7A 1WZEA 3GH1A 1U80A 1Y9ZA 2B61A 1I0LA 4JOQA 4LJ8A 3B2EA 3OESA 4AZ0A 5HQ3A 3R3VA 2X76A 2G70A 3RBVA 3C7CB 3VR4A 3W1EA 5KTTA 2O3TA 4K9KA 4RANA 3BA6A 5LMCA 4LYGA 1DO2A 4LYAA 4HGRA 2DJ5A 3K6RA 4JLUA 3VO9A 3ER8A 4QREA 2YMQA 4GSKA 4FVTA 1OR8A 4BNKA 1C30B 1XTPA 4BGEA 2QLMA 1TTQB 4FHDA 4LSAA 1R5OA 3A1FA 3FYSA 4L27A 3KUKA 1NMSA 2FQWA 3I30X 2OXCA 4ZYUA 2GEFA 2J3QA 3VJRA 1P4SA 3Q2IA 1DAKA 4H7FA 1DSSG 3T0GA 3F3SA 4EYGA 4A6XA 2BKXA 2PUTA 1CEQA 1GPH1 1GTRA 1GGJA 3WAKA 1ADCA 4DJAA 1C4XA 4HDSA 1LPAB 1MFPA 2YN0A 4F12A 2ZIGA 3NHWA 4RQUA 5JIBA 1ICEA 3E8SA 3X0DA 5CBPA 4O82A 3PGLA 3TN7A 1OB2A 4HQ6A 2Z4SA 2ZBVA 1IJBA 2IF0A 5C5CA 3DQQA 2J9GA 3HOZG 2WU8A 3IIIA 2JJ1D 1XTSA 4UVEA 2D2EA 1I3MA 1MEOA 5HIMA 3OQJA 1G64A 2WAAA 3AF0A 3VZBA 5AQ1A 2R48A 3CGGA 2QSYA 3V1MA 5KFAA 1AXGA 2HV9A 4I0WB 3RBAA 3GLIA 3H0CA 2XD4A 1OWTA 2Q5JA 2BTQA 2R3SA 1ZJYA 2IYTA 2C07A 3OX3A 2E0IA 3AUFA 4XASA 5KOYA 2JFFA 3C8HA 4RVHA 4CDGA 5F9NA 4QKQA 2WA1A 3TLXA 1SZJG 4Z6KA 3RTBA 1T3GA 1H85A 4P7KA 4JOCA 3K6KA 3ND7A 2R60A 5BVGA 4TV9A 4NYIR 4QICA 1JFVA 2ZITA 2Q6LA 1NKTA 1QZ3A 4NZOA 3K0SA 2D00A 2XJ9A 5AVJA 4ZHQB 4LY3A 2VAXA 1LQTA 4L74A 4KBYA 4WHXA 1YGYA 3D2LA 3IH5A 2XMDA 1KMCA 2FSUA 4HN2A 1HM5A 2HPHA 1MC5A 3W6PA 1LVHA 4Y2XA 3EA5A 4N3AA 2Q5QA 1FLNA 1HFWA 4M46A 4UQPA 4J0GA 3PVSA 1Z2PX 3N2NA 2C5HA 3AEXA 2DLDA 3BEOA 2A0UA 3H5VA 3QFRA 1DIOB 1Z7WA 2DU8A 4DNPA 1DHRA 3W5DA 5D85A 2X8LA 2WIBA 1C50A 1VPEA 2H4ZA 1NX9A 2GD2A 5KJCA 4YCAA 3RREA 5DRYA 5FPTA 2HPZA 4H0NA 5CA0A 2UUPA 4K9PA 5DSTA 4Y2VA 5GZ3A 5F23A 3AFMA 3OZFA 3O4HA 1S02A 3B51X 4P0PB 2GESA 1TKAA 1I1OA 5E7QA 3U7QA 4XWKA 1RQLA 1CT9A 5I9SA 2B99A 2ACWA 3A2MA 1ZXXA 3RYFA 2P9FA 3RHSA 2ZRIA 2DPXA 2EV9A 4L51A 1B7GO 3IRUA 1WS6A 1E32A 2CVPA 5BN3A 1V41E 4I6EA 3A28A 1L7RA 1P60A 1WZUA 1NUPA 1NV9A 1JSLA 4GYKA 1C9EA 2GCGA 3PEWA 4G0VA 5BR1A 5JHHB 3R6DA 5EMKA 2Q4DA 2YIVX 3CX6A 4W5RA 3GIJA 1CR4A 1HQCA 2VXBA 4CL0A 1YZYA 4EKYA 4GRDA 1U28C 2J9ZB 1PX2A 3AUUA 1ZINA 1OT3A 1VE1A 3PVZA 4RPLA 3A6EA 2B4KA 4RSMA 5EWMB 3OFND 3TQIA 1FUUA 1W4BA 2B36A 2W9BA 2WVAA 1N32B 5AK6A 2PKEA 5CLFA 3OZUA 5C46F 2C4MA 2EBFX 4OU4A 2OV3A 1TYZA 1XA0A 3I8XA 2G5CA 2J4CA 1GNLA 3H11A 3T9BA 1H2FA 1K6XA 2NV6A 2RGXA 3RC2A 4BQPA 4LNUA 3P26A 5DDIP 5AKHA 3U5ZB 2I65A 5C4MA 4RPKA 3RF6A 2NPIA 3VU9B 4EVRA 3GAZA 4MKXA 4TV8B 1F2TA 1CUZA 4DFDA 5IH3A 2WSLA 2HSZA 4UM9D 4KR3A 1N2CA 4KMOA 4YC7A 3U1BA 4ED9A 3KXIA 1I50A 2PSSA 1JFTA 4DVGA 5U9CA 2P78A 3PNBA 1OX4A 4YV7A 4PN7A 4EUNA 2XXBA 3GT0A 3CT6A 2I33A 4DUZH 2C1ZA 1EGQA 2XSZA 3BGOS 3FYTA 5CITA 3HPQA 5ALLA 1AUXA 2BR0A 1L5VA 2YJTD 1SVIA 1HQKA 3M6LA 4RELA 3F8TA 4CE5A 3QW4B 5F1YA 521PA 3WADA 2H52A 2POQX 1EBFA 2F48A 2W2OA 4QU9A 2DT5A 4JBXA 4N3GA 4OHWA 1K2WA 3HJNA 1A4RA 1W2WB 3HC7A 3HCAA 3VAYA 4EGCB 1IULA 2ZJ7A 1R6UA 1T8PA 1KDVA 5L45A 1DJNA 3NWJA 3TZLA 3LKZA 2O0HA 4NDZA 3IR5A 2IYVA 1V96A 4MMZB 4R9RA 1E2IA 2XDQA 3AOGA 2N42A 1FFYA 2XGPA 4XWYA 3EGWA 1Y1WA 2HHLA 2FGKA 2ORIA 3LG2A 3C24A 5BRNA 3R44A 3QBDA 2OG2A 3EUFA 3EVEA 4UU0A 2R8RA 4QLOA 4CTKA 4UPEA 3ON5A 4ECSA 2IZOA 1Z4QA 4G1VA 1DKPA 1QIDA 1N8KA 2E7ZA 2ZTHA 1FVFA 3GLSA 1OGJA 1T1SA 3OCVA 3DONA 4NFHA 3FHCB 4QQFA 2EFGA 3HZRA 4QEKA 2QRHA 2BFCA 4EI9A 4RKQA 1U04A 3BFJA 2R92A 3I9OA 3BJYA 4PX5A 2G82A 1R4MA 3CR3C 2AZ4A 3AHFA 2GK4A 4I6JA 2VH5R 3QYFA 1QRUA 1ZETA 1Y8QB 4LZOA 2WB2A 3WI7A 2QRJA 5LL6b 2HT6A 1HZJA 3F2IA 3T52A 1VQ1A 1XZNA 4JU8A 2OQVA 1QYCA 1HG0A 1Y3AA 4FGWA 4KMRA 4PZZA 4E51A 3U61B 3O0DA 1JDPA 4JVNA 1WXWA 1U0NA 1Y4ZA 4TZTA 4DCVA 4NXNB 2B34A 5BW4A 2QTZA 4PZYA 1XDZA 1PKXA 2VDNB 3GG9A 3SYKA 3T3NA 3EPIA 3KXYT 2LRHA 3LY5A 2AKYA 2BMJA 1JAIA 4LF6H 1MLDA 1PFVA 3E9NA 1KKUA 5JJKA 1M73E 3KHSA 2YWXA 1V16B 3RAXA 1BROA 1TIKA 2BFEB 2BUCA 1T36A 2IOFK 3QKUA 4BC0A 1WH2A 2UZ0A 4BNJA 4E30A 3GHHA 2JGJA 3KV1A 4Z1MD 2JHFA 2P30A 1A9RA 4KXQA 3DEIA 1A8UA 3F7TA 2WWXA 1GGOA 4YASA 6AT1A 5LNK1 2FLVA 2FZVA 1II9A 2WIJA 2C95A 2OM2A 3G23A 3NWBA 1P74A 3QWAA 5D3MA 5JFTA 4JI8B 4I99A 4S1VA 4GYJA 4EW3A 4YQYA 4FDMA 1H4SA 4KZKA 1UMCB 2O6LA 4WLVA 5KC8A 3FMPB 3DDZX 3OWOA 1X13A 2ES4A 5LLSA 3FFBA 1Y3DE 2BYTA 5G0UA 2R8GA 5C5JA 4V02A 5LZ8A 1I2BA 4LI0A 3JQ7B 2IHKA 2JZOA 3PT9A 3FKIA 2FK7A 4QBIA 5DHAA 1K4KA 1NVMB 2XF2A 4NBNA 1GV1A 5CW1A 1MV8A 3EXG1 4BMPB 2C77A 2VNJA 4LRTB 4M0PA 1H8HA 4NAUA 4R40A 4WZAA 4GOXA 3E9DA 4KXWA 2X5JO 4RHUA 1GCAA 4L3OA 3KQKA 1GNTA 1YB7A 5BOVA 5KFXA 1HOTA 4IUDS 3ZW9A 4EUKA 1SVSA 4R8VA 1FMCA 4MKIA 3PW7A 1NI4B 2IW1A 2DBZA 3FG9A 3K73O 4PO9A 4XSVA 3FOAA 5A2QA 3KCNA 4QYIB 1GGKA 4J6FA 4A0RA 4KAAA 1WP4A 1R4NA 4YJ2A 1UMDA 3R6LA 3D43A 5JTTA 3UPTA 4H60A 4BFWA 2MT9A 2PGIA 3LXXA 2FWAA 2RGRA 1M6VA 4KQ9A 1UJMA 3ONNA 3F1LA 1I10A 2D5LA 3UFXA 4Q47A 3OKFA 3TXYA 2IITA 3F6PA 2QUAA 1RJQA 1QXSA 1X80B 3Q8QB 2VDRB 2VJOA 3Q8XB 4V0LA 3GAMA 2LKCA 3LY8A 1JU4A 5DNVA 1JLSA 5KFYA 3U3JA 5C3MA 1YHNA 4Q5IA 2B1RA 3OUZA 4FZJA 3JALA 3WDMA 2ORVA 1MVLA 2J07A 4F9EA 5ES4B 2Q3FA 4OQ4A 2OKGA 4A3IG 4JH0A 3HY3A 4CNBA 2PLAA 1EDEA 1S03G 3CE9A 2Q3CA 1AUPA 5DGHA 3Q3HA 1OXTA 2RHRA 4NE2A 1JJ7A 2BONA 1E7MA 3ND8A 3C7TA 3Q3IA 1SHUX 4KIWA 3NHMA 2WYOA 4YONB 3Q72A 5CVCA 4X6LA 3OHMA 4HDAA 1ISIA 1E4VA 2P4EA 3BZUA 3SOZA 2V9PA 2O05A 1D9XA 4MW5A 4YRPA 1QBGA 1N1EA 1LJ8A 2WVGA 3FIJA 3GK3A 1JYSA 2ZM5A 5G4KB 4YNBA 3CVUA 1DJQA 3U0VA 4ARZB 3A9UA 4ZVNA 4XCXA 4UCTA 4XLTA 3PLAE 3FPLA 1FVXA 1KVUA 3COWA 5DLYA 5KYWB 3V4RA 1IZ0A 2R8IA 1QTIA 3VO2A 4FX5A 4PG5A 4IRXA 1DTSA 5L95A 2JLCA 2RAVA 2FN8A 4G8CA 4UU1A 2ZYIA 3IYLW 3DKRA 3PQ6A