3ETHA

Crystal structure of e. coli purk in complex with mgatp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
b'MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
molecule tags Lyase
source organism Escherichia coli
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3ethA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3ethA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ethA01
1CE8A 1E4EB 2WYOA 5D8DA 4O81A 1PX2A 5K2MA 4M9CA 4O7RA 4M9UA 2R85A 3U55A 4O83A 2V58A 4GGMX 4MAMA 5JQGF 1BNCA 2W6NA 1EYZA 1B6SA 2R7NA 4DLKA 3VPBA 3KAKA 4O4HF 1W93A 2YZNA 4MA0A 2NU8B 2DIKA 5C8YF 3R23A 2R7MA 3Q1KA 2Z02A 4L1KA 4EGQA 1CQJB 1PK8A 4TV8F 2OLSA 5C1OA 1GGOA 2VR1A 1AUXA 3BSSA 4O7LA 2IP4A 1Z2NX 2R86A 2V59A 2I87A 2GLTA 2V5AA 4FFLA 4TUYF 3KAJA 1I7LA 1KJJA 1BXRA 4IWYA 1EHIA 3HO8A 5BPHA 3BG5A 1EUCB 2YS6A 4Y8VB 2DZDA 1EZ1A 3RV3A 2XCLA 4XYMB 5LA6F 4FFPA 2ZDQA 1CQIB 3WO1A 3WO0A 4C5AA 3TQTA 2YZGA 2CNUA 4O4JF 2FP4B 3BFPA 1EUDB 2PVPA 2DLNA 3K5IA 1T36A 2GQSA 3BSYA 1CS0A 2P0AA 3GLKA 2SCUB 1W96A 4I50F 4YJ2F 4MV6A 1OBGA 4FFNA 1KC7A 1KJ9A 4IHJF 2R7LA 4O7SA 1M6VA 4EA8A 3R5XA 3QFFA 4ZI7F 2QF7A 3AX6A 4YBZB 2DWCA 2HGSA 2NU9B 2VPQA 4HQ6A 5LXTF 1WR2A 5GONF 5BPFA 4EABA 4WD3A 3U9SA 2R6FA 4EGJA 1E4EA 1UC9A 5LOVF 3DF7A 5LP6F 4HNVA 1VBHA 2I8CA 3MWDA 5KX5F 5H80A 4IWXA 2R7KA 4XYLB 3UFXB 3N6RA 2ZDHA 2W70A 1GSAA 4O2AF 1IOWA 4MV7A 1SCUB 3R5FA 4HR7A 4FGRA 4C5CA 5KKNB 4TV9F 3TIIA 5FNVF 2PBZA 1JDBB 2YYAA 3HB9A 4IZOA 3U54A 3V4SA 4I4TF 1M0WA 1KUTA 4O82A 2CQYA 3MWEA 3R9RA 3JZIA 4ME6A 1JLLB 4HNUA 4M99A 2XD4A 3E5NA 2GPWA 4I55F 1DIKA 5JQWA 3KREA 4O86A 2W6QA 5C1PA 1IOVA 3RUPA 4O4IF 4FFRA 5JH7F 1C3OA 2W6MA 2VHEA 3JZFA 4WBNF 1UC8A 3VOTA 2YRXA 4YAKB 3G8DA 1JKJB 2NUAB 4O7ZA 5IYZF 2VQDA 3VA7A 4O4LF 3GIDA 4DIMA 1DV2A 4MV4A 5J2UF 2NPOA 3OUUA 4O7WA 4MA5A 4ZHQF 4C5BA 2FPPB 4FFMA 4M98A 1VKZA 3JRWA 3RV4A 3VPCA 3OUZA 4O2BF 3N8DA 3TW6A 2I80A 3U9TA 2ZDGA 3TIGA 5BMVF 5I47A 1GSOA 1KBLA 3AW8A 4MV9A 2W6ZA 3SE7A 3ETJA 3JRXA 2HJWA 2NU7B 3ORRA 3ETHA 2Z04A 2J9GA 2CNVA 2YW2A 1GSHA 2YRWA 2GQRA 3WNZA 5EZYF 2NU6B 2YWVA 1B6RA 4YAJB 4O7TA 2C00A 3LWBA 4XZ3B 3KALA 2FPIB 4EA9A 1JDEA 5DMXA 1C30A 1AUVA 1M0TA 3V4ZA 2W6PA 5JVDF 4EAAA 2YZLA 4ZQIA 1DV1A 4FFOA 4J6EA 3HBLA 5CA0F 3K3PA 5J2TF 5JVLA 4EA7A 1KEEA 4YB8B 4MV8A 3Q2OA 1GLVA 2X0SA 3G8CA 4IIJF 1Z2PX 1KJIA 4NYEA 5HBRB 4HNTA 4XX0B 2QK4A 3NUAA 2FPGB 2W71A 4ZOLF 4E4TA 1Z2OX 2W6OA 4O7YA 3RFCA 1OBDA 4O84A 5CAEB 1I7NA 2CNQA 4O7VA 3MJFA 3LP8A 3I12A 4O7NA 3VMMA 2CZGA 3BSWA 5CB4F 5CA1F 2FB9A 4YJ3F 1KJQA 1KJ8A 4FU0A 3K5HA 2YZMA 2GPSA 4MV1A 3ORQA 2R84A 2PN1A 4EG0A 3VPDA 2R82A 2YL2A 5HV6A 4RZQA 2R87A 4FE2A 1A48A 2YS7A 4MV3A 3R5HA 3TINA 1ULZA 5LYJF 1VBGA 4QSHA 1A9XA
chains in the Genus database with same CATH superfamily
3VC1A 2D2XA 5M29A 1XEAA 1TFUA 4GQBA 2QTGA 2IEZA 4OXKA 3R20A 1I51A 1A72A 3TI9A 2H0RA 4LJYA 4BMYA 2YICA 4J0KA 4IMJB 5DTEA 1X70A 3R41A 4JLAA 1S2NA 3EFOB 1IBCA 1G2IA 3NVMB 2IYUA 3CJRA 3CX8A 4LZWA 4MS1A 4EG8A 5KOJA 4U0JA 1KI6A 1VRVA 1PF7E 4UHHA 1H85A 4TVIA 3PWSA 2YOFA 4GX1A 3HCCA 2ONCA 2O14A 4KQ2A 2WWTA 1W35A 3N43B 3VVCA 2A9VA 4MAMA 3HOZG 3EIFA 4MWEA 2R9VA 2AX4A 1SPXA 2YMPA 2IS1A 5AKJA 4DLKA 3F6CA 2Z1MA 2Y6VA 4LRWA 3BMOA 3ETNA 1GZDA 3H3JA 4X3PA 1IM5A 3E7XA 1CUUA 1W93A 1SC4A 4D0LB 2YXLA 4IGIA 4D45A 2BL4A 1BFDA 1VE6A 2QN3A 3R23A 2AYZA 2UVPA 4Y2GA 4DM3A 5DOZA 2FMTA 1CKOA 1QE3A 4PZ8A 4WLEA 1E4FT 1DCTA 5BRNA 3JY6A 2FETA 4MUJA 2IV2X 1W76A 1XEXB 4HG2A 4JGBA 2WYHA 3ABZA 3FF1A 3EARA 3HKDA 3FPLA 2ZAIA 4MDEA 3E61A 4N7RA 1JYEA 1PL0A 2QL7A 2C7PA 2OLSA 1VSUA 3WGJA 3C6YA 3HC7A 2JGAA 4ON9A 5E2AA 4O4HA 5TSDA 1ADFA 1GGOA 1L7VC 4JCCA 1Z45A 3PI6A 1ZYUA 4XUCA 4N82A 5HE9A 2ZJ7A 1YCDA 4ZU6X 2GJSA 3ZOKA 1WULS 1YBMA 3VNQA 1DCFA 1FK8A 4KAFA 2FW7A 4NENB 3SC2B 5H9WA 5KOHA 4KAJA 3CX6A 3SBDA 4MQUA 1KHTA 2ACEA 3QY9A 2IUFA 1HYQA 1UZAA 2V9CA 3JR7A 4MH0R 2LCFA 4YCLA 2HREA 3RH0A 1U0OC 2GX6A 4IDHA 4JBHA 1FL9A 1S2DA 3L7DA 3ORSA 2DBQA 4WLUA 1LNQA 1P1HA 2PD6A 2VRCD 1U2RA 2B4TO 5AK4A 2ZWMA 3D7KA 3KJEA 5FWDA 1WCIA 1JLHA 1IONA 1H8HA 3RB4A 4HGOA 3MD0A 5DHTA 1SKUA 1USGA 1VHJA 2KSQA 3OURA 1VL6A 5A5GA 4LVOA 1ZA1A 4ESVA 2MR5A 3OVMA 4IIJA 5EVJA 2VUUA 2Z8ZA 1JFLA 1T6NA 2V98A 3BN3A 3DOFA 3ZR4B 1Y9ZA 3VR5A 4ALJA 4RMIA 1EK0A 3SDBA 1DIRA 2JH3A 3BCRA 1JV2B 4MVJH 5D6NA 1E9AA 1N2ZA 3MOSA 3N9IA 4U2GA 1PJ8A 4RSRA 4EG4A 1E98A 1RLIA 4WZBB 4CLHA 1SVKA 1QKJA 4XYMB 1VG8A 4PANA 4QJ4A 1HNNA 1Z38A 3B51X 1UDXA 3UQZA 5IYZB 2N0SA 2R6HA 3A4YA 1KPGA 1ZHHA 1XG5A 1FP7A 4EFEA 2H06A 4XQGA 3DE2X 1ZRSA 4LDRA 3TD9A 3HO6A 1TYDE 4HQNA 1XZJA 2OO3A 2NMVA 3COVA 5KSZA 1SVOA 1YBVA 2CXTA 4YDQA 1TA0A 4TWAA 1R9NA 3H2ZA 5C5EA 3RB6A 1RC0A 4QELA 4XEUA 4YP1A 3SOZA 1PZEA 5CVDA 5AVKA 3V55A 2WJAA 5DLGA 2KJQA 3ZLTA 5JH7B 1GHTA 4FFBA 2OBYA 3L0OA 1EVLA 2ZRBA 5EC8A 5JZ9A 4KZPA 4WT7A 1F7VA 1PGNA 2YY7A 2QN7A 1VBKA 4CC6A 4MS3A 1RXUA 4WNIA 5CYOA 2I2FA 4OUKX 4QLBA 1MAWA 4RNMA 1P81A 2XZLA 3R3VA 1FZTA 4NS1A 3FMAA 2CDBA 3SICE 3WL3A 4MKRA 3CONA 2RJ3A 4HFMA 2BGIA 2Q21A 3DMFA 3F6PA 3INRA 1KNXA 1TYEB 3HLTA 4CDNA 4CQJA 3DC7A 5AW2A 1W36D 1E3QA 1T8WA 3MRTA 3SZGA 4YUVA 1L5GB 1N9KA 3HRIA 1Q5PA 4JDUA 1PBTA 3B1ZA 4UCQA 5LOVB 1HMYA 5L45A 5KFXA 1KBZA 2VK8A 4JH0A 4KG7A 4XWTA 4YRPA 1ML3A 3TEFA 1T29A 3DDCA 4FXOA 3T3MB 4URWR 2AXPA 5G3ZA 2WF6A 1OAAA 2PH7A 1JT9A 1C1XA 1XZCA 4I1SA 4MVXA 4F6LA 5LMCA 4NWIA 3PW0A 3GLSA 5A4MS 3KZMA 4J6FA 1DWQA 5FDFA 2AQHA 3C8DA 4JLMA 4L28A 3NBYB 1EVQA 1GITA 1R0RE 3JQPA 4L22A 5FIUA 3IC5A 3TZ6A 1ENOA 1SOAA 6YASA 3VDQA 1FDVA 1PZFA 4I5IA 2ZTHA 2PVSA 3STWA 2VBGA 4A3MG 1RZVA 4UNPA 3VH4A 3QVUA 3DHWC 4O2BB 1C4KA 2EL7A 4K9NA 3LVFO 3AR4A 4CKEA 3PRHA 5FBWB 3EZGA 4QASA 3WJ2A 4BNDB 2H2AA 1JAIA 4QWWA 1J2YA 2A14A 5JDCC 3LGXA 3OECA 1U0BB 1V2HE 1QE0A 4BATA 1MCZA 2CLSA 3SVTA 3GN1A 1VL5A 1JQ5A 3ZY3A 3QEBZ 5G02A 1FY2A 3C6BA 4GYWA 5AKIA 2GPNA 3T9CA 3ENQA 3WAJA 3RSSA 3TS1A 2Y1XA 5FLMG 4Q9DA 1YFLA 2XODA 3NDPA 4FMCF 5IP5A 4KZKA 3U61B 4LSXA 1MJNA 3LKVA 4XVHA 4JN6B 1LV8A 3AHHA 4PSUA 4BASA 1MJFA 2X3FA 5KYNA 1G63A 3WB1A 5ITVA 1BN7A 4Y2QA 1L2ZA 3W3AH 3UENA 4DSZA 4P53A 3WNBA 3G5LA 1RJEA 1S4MA 3FH0A 3R6GA 1KQPA 1TF2A 4JCOA 2YCLA 4HKTA 1D6SA 4XDGA 4HNAB 4AIRA 4J9LA 1J99A 1UZNA 4DUGD 3H6GA 2W8ZA 4M54A 1KY2A 1YK1A 2YFHA 1U2DC 3Q3CA 4G0VA 4A2AA 3D4BA 4J16C 3P45A 2OBXA 3H4TA 3AFMA 4HO1X 1KGSA 4LY0A 2EDCA 3I5XA 2G9RA 1DTEA 4E22A 3GBSA 1R6UA 1XL0A 4KOAA 5C3UA 3DE7X 5FPQA 3LTNC 5KB3A 1VJ5A 4PN3A 2ASJA 1LX7A 4YN3A 3SS8A 1F9EA 2QTRA 4IY1A 4AJ9A 3AM1A 3M89A 3UGKA 3QE3A 3EXEA 5CB6A 5CFQA 3RAEC 1EIZA 4Y6RA 3RUCA 4E2WA 1DGSA 1XDGA 4H0FA 2J08A 5L3QB 1YS6A 3D5EA 2A1UA 2BP7B 3O6VA 4C30A 2I1LA 1ZETA 1QYDA 4JYAB 4ZPJA 4LISA 4BGUA 3F8WA 2YX1A 4F86A 4NCBA 4WEOA 4EB0A 1DBSA 3QI7A 1GNLA 3KM0A 1KOJA 3FNFA 1K6MA 4WK4B 1S2OA 1TQ2A 2POCA 4WZ6A 2AEEA 1EM8B 1S3GA 2VK1A 3LNCA 3GPIA 1LLUA 4HNAA 1S5PA 4O8ZA 2IHBA 3MFIA 2XYVA 2JRLA 3GOHA 3JYHA 5J2UA 2W2OA 1KIAA 4I2VA 3L1UA 1EVKA 1MJHA 3UY4A 1C4OA 2PX4A 1LBSA 1QYRA 3EC2A 4JBIA 1QMPA 3ZJVA 4WADA 4FS3A 1BH2A 2EX1A 4FB5A 3GTKA 5F9LA 3Q5EA 3GQCA 2GNAA 2COEA 4E88A 2PMZE 3PTZA 4WEQA 2XRZA 2JDID 5HK8A 1AKYA 2MYUA 1P7WA 4P98A 5FR9A 4MAFA 2I3DA 3N8GA 1XFAA 1GD1O 1Z13A 2R6CA 2VJQA 1ZFNA 2WG1A 4ZOLA 4A15A 4CMJA 3TLYA 1A5ZA 1EP2B 4DIDA 2HHJA 2REQA 4OLHA 2VHZA 4GUAA 1TB4A 3I4CA 4HB0A 4J3FA 2B3TA 5DX1A 4HZUA 1TT7A 2CFCA 2P67A 3B36A 2ZUBA 3M6WA 5CXQA 1PJQA 5DHUA 4LBZA 3DZCA 3GT7A 2VJCA 3L8CA 3MJDA 4KVGA 3AKDA 5ED0A 5JVDA 4E14A 4F7WA 1JDVA 2B69A 3TTTA 2QRVA 4EFDA 4P36A 1POXA 4IKOA 3IL2A 4KX5A 4MYHA 1ISSA 1LBTA 4G9BA 4C4XA 5JH7F 4P22A 4RB0A 3BRWA 4DQVA 5F12A 3CO0S 2H5EA 4RPGA 1UL1X 2JIRA 2TMGA 2HU5A 1ZNQO 3GAMA 3GB9A 4C4TA 1UWVA 2V9ZA 1WPRA 4B1FA 4YUXA 4LH6A 1NATA 1WZIA 1SUDA 3EZ9A 4KVZA 2ZR8A 1EJ6A 4UVGA 1UR5A 5AKYA 3WAKA 1ZGBA 1A5BB 2NG1A 1EWTA 2XV1A 4DXAA 4GPIB 4XTRA 2JS7A 1XTVA 1QS0A 1G38A 4X6XA 5TLSA 1I4DD 3PPIA 1SOVA 2RH4A 5JAOA 4R6WA 2VNSA 1VOTA 4HCJA 4NFLA 4U6QA 3BZBA 1SWWA 3WX0A 4ZTZB 1GGJA 4X91A 3W34A 1TZMA 4L4ZA 5CFRA 1F4PA 3PXEA 4ZMSA 5JNLA 1QH1B 1LTKA 4LMRA 3VOAA 4B33A 3RBVA 3REQA 1DAEA 4BFTA 1RE0A 1FMFA 2QRVB 1CUIA 1SHLA 4KIGA 1U0HC 2HNAA 1FNCA 2VZ9A 1G59A 2ENUA 1IZYA 4OCZA 1AUOA 2O7VA 3CGGA 3E9QA 5CCBA 2PZMA 3LYHA 4M1EA 4H3SA 2PPLA 4S35A 2X41A 2H4XA 3OMXA 4O2BF 1V3UA 4FFDA 1N2GA 4ECSA 1KHHA 4WXYB 5AYVA 3CUSA 4CM7A 2BEKA 4LCBA 1W34A 3UMSA 2AJCA 2TSYB 4DPMA 3NDRA 1FQOA 2VHQA 4DILA 2XCPA 3P1JA 1IBLB 1YKSA 4E31A 4Q9NA 2BMEA 2VC2B 1GUBA 5TARA 2PUEA 5BW8A 1RXEA 1BW9B 1JHQA 3O3OB 1SXPA 2NTYC 2YDYA 1CV2A 3NOOA 4OQFA 4ID9A 4FUTA 1SFRA 3PDIA 1F8XA 3CQZA 1NJ8A 2JI9A 4FLMA 1UT5A 3Q9LA 1GUDA 2C5LA 4CCAA 1JX4A 4S1PA 3F3SA 3I1YA 2FR0A 5L3ZA 5CM9C 3MTJA 2ISCA 4V39A 2P2LA 1ADCA 1IU9A 2YW2A 2K2QB 2QG4A 1RADA 1IXZA 3QHPA 4BJHB 1OH7A 4ROTA 3RWOA 3TUIC 1CUXA 4R7GA 1ZIXA 4C2BA 5IYDG 2J0SA 2YRWA 3LUDA 1O97C 3QQ5A 4RFLA 4L5BA 1F3LA 4NP6A 5H3HA 1TCBA 2Q27A 3CXRA 5E6UB 1XCBA 4HSEA 3RAGA 2PMKA 4BFWA 1HLDA 1EJ0A 4B3BA 2QRJA 4DDTA 4E70A 4I5GA 3WDMA 1YZKA 4ZKEA 1WS6A 4G5SA 4R05A 3EGOA 3KVYA 2Y99A 2P5TB 1FJHA 5EMLA 4AZ0B 1OC4A 3HCDA 3ZLUA 5HTKA 5IH3A 2PXHA 1NVKA 2UAGA 5DMXA 3PK0A 2XIGA 3SJ7A 2AEJA 4L6IA 2WJYA 4J0MA 5CCDA 4B5LA 3TE7A 1TO1E 1SIBE 3I0MA 4IV5A 3NDBB 4NZNA 1RAGA 221PA 1KC3A 2OSBA 4BWSC 2BEUA 3PR3A 3Q9SA 4ENVA 1KO4A 5CLIA 3LJKA 4FSDA 4AT1A 5JXJA 2W0SA 1KAQA 3BD7A 2VWPA 1XE3A 5I45A 3WGYA 5K3OA 3I62A 2CLHB 4LTDA 4B5KA 1C7EA 4EHJA 4EY8A 5FWXA 3UANA 5I4BA 3P2OA 3PUJA 5LZ4A 1IZ9A 3FVWA 2JZCA 3EXAA 4PSDA 5ALRA 4ZI5A 5KOIA 2JG3A 2QQEA 3NNDA 2YBDA 4TSRA 1GLVA 4IRMA 5CNJA 4C7MA 1DPFA 2Q5CA 2WSBA 2R3SA 1T24A 1QYCA 4FKBA 4RIFA 2VTEA 3OZAA 3QVLA 3ZE1B 4E2ZA 2XJ4A 5HKLA 4B3MH 1N2EA 1WU7A 3D6NB 1VG0B 3EXHA 3WE7A 4PWZA 4AUMA 3A27A 5AKZA 1V9SA 4BLTA 2ZRKA 1E3JA 2EHJA 2ZTLA 1MQ9A 1BE6A 3ICPA 3NUAA 3QFTA 2WJPA 3BL6A 4IGKA 3RVJA 4AAYA 2Q8QA 1EFDN 3QXHA 4UBOA 2BMAA 2RHTA 4FWIB 4BBSG 5D00A 4FS1A 3W4IA 2PLAA 2PH5A 1NPTO 3JVVA 1TWCA 1I94B 1M1ZA 3EH1A 4YFYA 1O9HA 4AJJA 4X65B 4FX5A 4ED8A 3TO5A 3RFCA 4NBVA 3FNHA 4AKGA 1R8YA 2B35A 3JD2A 4K2AA 1GGKA 4TZKA 3TL3A 5B2ZA 4KWEA 1CERA 3MJFA 3BJRA 1RJPA 1H3FA 3FPEA 5CE8A 5B58T 3VSDA 2JKZA 2VH1A 2PRSA 2B8JA 3ZU2A 1HDZA 3IVMA 2DU8A 4FX2A 2PQ2A 2D5IA 3G6WA 2A0XA 3R5SA 4MDHA 4YCJA 3SMVA 1HYGA 4GM1A 4O6VA 2WJ6A 4N6OA 1C3JA 3K8OE 5IKXA 4EB6A 2OLJA 1PV2A 4FPXA 1Q7CA 2GBLC 3RTDA 1NQVA 2GBPA 3H7IA 2UYOA 4LHWA 4MQ4A 4JLWA 5DDIP 3T1YH 1AGRA 3TFWA 1U9IC 1UDRA 1I50A 4WV3A 4XDZA 1SUSA 2ZYVX 3WA6A 2P7IA 2UVRA 5LQCA 1UJ2A 1RACA 4HN4B 1G5FA 1X2BA 3ZN2A 2NWQA 2Q45A 4BRWA 5HV6A 3TKLA 3NHZA 4RZQA 3GRAA 3HJAA 1HOTA 1CWUA 4XX1A 2X58A 3F4LA 2ZIVB 5DCUA 3OQ6A 1IN6A 4BAUA 5DISC 4YUZA 5BURA 3IS3A 4O33A 3GF4A 1VFNA 3J81W 4XGIA 1W47A 1KO5A 3NTOA 3ZIUA 4OA5A 1MGOA 1QSGA 3FFTA 4ETWA 1KPIA 2I0FA 5HRUA 1FFWA 2YJ5A 3ZI7A 3ZE9A 3WRXA 1NW5A 4IW3B 3RU9A 2FQXA 3AIKA 3MGBA 4OQDA 1P2SA 1NN5A 1CB0A 2GT1A 4MB6A 3WOHA 4BVBA 4MKGA 5LD2B 1Y4SA 1E3WB 3OM8A 3Q12A 5FBKA 1I9CA 1K5HA 3M5PA 4BLVA 1QIFA 5HQ3A 2GD2A 4IFTA 4M9UA 3VOSA 2XUZA 3AL2A 3PQ5A 3G0OA 3ZU3A 1V4YA 1X77A 3PC6A 1KL7A 1QHEA 3HHEA 2DCMA 4ZC1A 5B58C 5EJ8A 2HDKA 2X0RA 3DFFA 2IYQA 2DWPA 2BBOA 3FWPA 4Z53A 2HCTA 2Q29A 4E11A 2QV0A 3OD5A 4AZTA 1DCKA 5DNAA 3FMVA 3PC8C 1NVDA 4QDJA 3VPBA 1HG0A 1VJ0A 5CLQA 2R68A 3NRBA 1GQRA 4YXWD 1K98A 2HXGA 2FE1A 2FLKA 2XF2A 1GSIA 3C6XA 2A33A 3NNSA 3ONWA 4IXTA 5EG5A 4JDPA 2QQGA 3GEIA 3WDSA 1X9IA 5HJ2A 4C89A 3CVYA 4LMBA 3WHPA 3WYGA 1DEHA 5IP7G 3LHIA 1MQAA 5KG4A 2O2XA 4GI2A 5DTIA 3BIWA 1IB6A 5CIWA 1Y8ZA 3BJYA 2V9WA 1PYOA 3IP8A 3EE6A 3WB9A 4DLYA 3O8RA 1IVYA 4G6ZA 5LQNA 1VE5A 3ZWKA 3D6JA 3MSXA 1NNUA 5JCJD 4CM9D 4LSAA 4TV8F 4UMDA 1Z25A 3V8VA 4DT1B 5HQJA 4Z7QB 1S0MA 2BMJA 4HDQB 2UUAH 1FVIA 3K0HA 3KJFA 4NECA 5G0SA 1XYYA 5G41A 2AR7A 3FGNA 3LZDA 3RBZA 3CRNA 2BJWA 1IXRC 1HEYA 3TDMA 1RQRA 2EOAA 5J5CA 2WRZA 3HCWA 1XVVA 1WOYA 1OWOA 3A26A 2O1XA 2XPCA 3E7WA 3HV2A 3ILSA 3MINA 1N1GA 3K9BA 4GLJA 5F73A 1HUQA 4BMNA 5F77A 3A6LA 5JCZA 2VXBA 1BA2A 5EIOA 3NDIA 4PG7A 4MRRA 3T1NA 3EGVA 2D8AA 2I7VA 5JMWA 1J9EA 5HZMA 5JD5A 4HQOA 1IEQA 1FZQA 3Q7PA 4K9DA 1I7LA 4PZLA 4ND5A 5AOBA 3VHLB 3NRJA 5FLXW 2RGRA 3CCBA 1KDOA 1L4EA 3OTWA 5DSZA 5SY6A 1H8HD 1K3UB 2EBUA 2PX6A 3ND7A 2F1KA 4CR7A 4IIXA 5EXSA 4F4HA 2P27A 2VXCA 2HBYA 2ZCVA 3FNBA 1XLUA 5F1KA 3H2HA 3DMDA 3IPRA 3X44A 4KN9S 1NDHA 1ZICA 3BG5A 3C41J 1H6DA 4HRXA 2GM4A 3O83A 3PVSA 2CL7X 1E63A 1Y8CA 2JEZA 1WHSB 4CIBA 1YZVA 2XR1A 3A10A 4J91A 3KKQA 1OTHA 1YU9A 3W2FA 1WSDA 5LA6F 2CBZA 3LX5A 1NY6A 1V47A 5I7SA 4IRXA 3PQDA 5LQMA 1MB2A 4FR2A 3F9IA 2PZFA 4YBZA 2XYRA 1XTTA 2LUOA 3PS9A 3DG9A 1AGYA 4Q9JA 3TNYA 4XVCA 2GSWA 3V8EA 1I1NA 1KMMA 1H0KA 4URUR 4ZK6A 1UKZA 4RKRA 1WQ3A 5E4FA 5KHOC 4CHIA 3Q8XB 2GSDA 3H19A 4DR3H 1TAEA 1UBEA 4LC0A 3CLRD 3IFSA 1ESNA 3H4IA 1JIIA 1T2EA 3IUPA 3KTMA 5JLAA 5JFTA 2VAVA 2ZUVA 1HM5A 3U56A 2CJWA 5EWGA 2NGRA 4GZMA 4WCDA 4XGRA 2PUBA 2Q8PA 1GG8A 4DL6A 2Q6VA 5EP2A 4US2R 3UG7A 5DCWA 2FOXA 3JWEA 3Q10A 4KNYA 4PNZA 2JBAB 3NV7A 2BKXA 4S24A 4EW3A 3BWMA 1M67A 3TAXA 2V8OA 2Y4NA 4RL4A 3T1OA 3PJFA 1Z0IA 4Q4CA 1EFPA 5DB4A 3WL7A 3WYEA 5JD3A 2GXAA 1JXAA 1U2ZA 5CK5A 2CL0X 4LNAA 5IJZA 1M0SA 3C7AA 2PLNA 3KQWA 1M6NA 2FWMX 4JR0A 5AIAA 3T3PB 1JHRA 2IHVA 3D31A 4MZXA 2JH8A 3V46A 4M8SA 3M4JA 1CUEA 3U4AA 4DNPA 1QHIA 3I42A 1KZ6A 4NHOA 2HL6A 3M9OB 4MSUA 1D5CA 1Y8QB 5DN9A 5JYDA 5CVTA 4KL8S 1YR2A 4B3TB 2IY9A 2AOVA 3N2GA 3I9V1 3AV3A 4IHJA 4H31A 3AJRA 2Y1EA 2ZB4A 4NLLA 1PEDA 2PKQP 2YYSA 3LLSA 3GK3A 4EYKA 3FYSA 4R0NA 4UE6A 4MI9A 4B8ZA 5CEEA 2ST1A 4CM4B 3P9IA 1OWTA 4IDGA 4QPNA 4JXUA 1QPGA 3CRW1 3O3NB 1QYWA 2XGQA 1VTKA 2EV9A 2AN3A 2XCOA 3QUBA 1ANKA 3EZ7A 1VBFA 3NYQA 4B7ZA 2OXCA 3AO0B 4RZIA 3WXBA 2PA3A 3BULA 1T5SA 4QBIA 5A6SB 4CKYA 3I3OA 1RI3A 5JRZA 4JXZA 1MB9A 2O1WA 3FHLA 5J1SB 4UUNA 2FRXA 2PFSA 4FOLA 4CG3A 2NSDA 2OG1A 4XIJA 3SJCA 1DHRA 4DL2A 1N9ZA 3BB3A 5EZQA 1RC1A 2C9YA 1GIAA 2HPAA 1L3IA 2P2YA 3EGWA 4L3VA 1X38A 3N0TA 4M21A 4Z4FA 3LUPA 3IMEA 1CUFA 4QBFA 1N25A 4M9RA 2CJYA 1IJEA 1L4LA 4NY1A 1GFSA 1XCPA 4PSAA 4S0ZA 4YJ2B 4HNVA 2Z08A 2D4AA 4DCGA 5CT6A 2J07A 5DLDA 1TU0A 2FZ4A 2WT9A 3BDAA 2G6BA 2VJYA 4XWYA 4EIWA 3OIUA 1KMCA 3BJEA 1PFVA 3P9PA 2GFHA 1BVRA 1JR3A 1MOQA 2C3PA 3KB8A 1DKMA 4GI3A 1EWRA 4BEJA 2HF8A 3N2YA 4XYLB 3N6RA 3T7SA 4Q05A 3F73A 5AM1A 1IZ7A 1TQHA 4PICA 4XARA 2W7OA 2ZSUA 4YR7A 3NGXA 3UMCA 1E2FA 3ZZ0A 3OOWA 3DB1A 2RC5A 1GT6A 4O2AF 1JECA 1JU3A 2FRVA 2PO5A 3G9TA 4H60A 3BD6A 3ZXIA 3SKXA 4COKA 3KXYT 1JHDA 1I2MA 2PYDA 1X7HA 3E48A 2DABA 5EWLB 3WIEA 4TYYA 3EBLA 4OU5A 2HJ9A 2YMMA 4G07A 3QEOA 2JA8G 1SVSA 4V3BA 3MS7A 4F0JA 3QFHA 2IUYA 2C54A 1X92A 1XMVA 5TE9A 1I6MA 1UMDB 3T61A 4LXXA 2O8FA 2FW1A 1IY0A 4ALLA 4G86A 4D9GA 2D0OB 4ZI7B 4TKUA 4BYMA 2H1RA 2R4TA 3LLMA 4LDJA 4G9GA 4DLNA 5DYNA 2HCJB 1TPZA 1VSVA 5JSYA 3U31A 1FU7A 4BFZA 3UJNA 2H54A 2HAEA 3HMKA 2I4OA 2GCPA 3PX3A 3VU8A 2O06A 3O4GA 4B6QA 4KXXA 2GCNA 3D7NA 2BWJA 1ZWLA 2IHJA 4GZ6A 2YFQA 4W5OA 4LF4B 1UJNA 4GC7A 1NF9A 3PHJA 1B16A 3WL6A 3HSSA 4HDSB 3TZCA 4AB1A 3O47A 3PDHA 2V6JA 4G5OA 1XQVA 2P4EA 1HT0A 1NVMB 2VF2A 1BN6A 2EJBA 4GI5A 4LGCA 4XFDA 2OD7A 1B8UA 2GAFA 3IMFA 2PZEA 1IXKA 2WNIA 4B6PA 4X94A 3LCMA 3IV6A 3NPMA 4LSWA 2QN1A 4RENA 1EFVA 2I2AA 5D1OB 1WKBA 3X2SA 3G2QA 4FEYA 4B4VA 5BWCA 4JI7B 3AONB 1S10A 1PK9A 3G6KA 3I9JA 3OA0A 2WYVA 3NGMA 2JHAA 4ZEVA 4F45A 1BDMA 4Y9TA 1DC7A 3BQNB 3H05A 3QEMB 2DPXA 4G36A 5ADVA 3GRPA 4B9EA 1GZ7A 3H9CA 4CN8A 2B4QA 2C58A 3E1SA 4WCFA 3DMPA 3LFTA 1KAGA 5HNEA 2CYBA 5TQ2B 2A92A 2V4QA 1K9SA 3ET5A 1IJFA 3LLUA 3OMWA 3MHTA 1T5IA 1HEIA 3GTMA 4W6ZA 4GR9A 1H5NA 1OXVA 1PUXA 2PUTA 3ENVA 5BVHB 3E3LA 4BFCA 2FMFA 4U7PB 3SSAA 3GJSA 5HIMA 3D7RA 2V6IA 1XTRA 2DQKA 1OHHD 3KPJA 3JQCA 5C5IA 2OHOA 5I5TA 4RTQA 1K7FB 1OGJA 1JZSA 4TV9A 3GFOA 4A5OA 3ANXA 1EFVB 1OOEA 3GVHA 1ZA2A 3ZGVA 1LBEA 1NRJB 2SECE 2VHUA 2YHIA 3FOAA 2B61A 4JBNA 3EY4A 4OB8A 4PSCA 1W75A 1ZN2A 4DIMA 2ZUDA 1DV2A 3GIKA 1Z3CA 5G0UA 5K01A 1Y5MA 2ZRPA 5FJIA 1P60A 2QR3A 2ON6A 4BNLA 4ZYVA 2PX3A 1U8FO 3GGCA 3NHBA 1KK0A 4LX8A 1NXWA 4DUPA 1Z4OA 1KK1A 1OX5A 1X3SA 2ATVA 3CPJB 4LAFA 1EEXB 3TMYA 5HOQA 4RGVA 4U2BA 4DV2H 1BWQA 2QXYA 1UPBA 3TDNA 2W93A 1U0GA 3AR7A 3T5PA 1EXWA 1PJCA 2BMFA 2P35A 4K7JA 3ZVKA 1OZHA 2J9FB 2LBPA 3SSNA 4AXBA 4UCXA 5EE0A 3H1BA 3G8AA 4JUCA 3DV2A 2YYYA 1D0IA 1RYZA 4RMGA 3O82A 4WZAE 5FP0A 1G8MA 1G19A 3L0CA 2JEFA 3NXKA 1WB5A 4QOHA 1LWOA 1RJDA 1G8YA 4MGYR 1GPAA 1W0JD 1T0UA 1APBA 2PTGA 2UVPB 3PEVA 3QV1A 4N7JA 2R5FA 3RDPA 2OFWA 1MDFA 3FDZB 3NHWA 4HDSA 2FAXA 1O0BA 3DBLA 1Z7GA 4AY6A 1KI8A 2XT0A 4M4SA 3MSCA 5F51A 1ZSYA 4RXUA 4CL3A 4AXXA 1FVHA 2EWMA 1MVNA 4WLNA 2I7XA 5LN1A 2AGOA 5KSYA 1E7RA 1DFGA 1WDWB 1YMUA 5FTJA 2BBTA 2GRUA 2X0IA 4QOSA 4HYYA 3W5UA 2QLMA 1EJBA 5LQAA 4DV7H 1S2MA 2RDIA 2D1YA 3A6EA 1YA8A 3CW9A 1M2GA 1QX3A 4FBLA 4TVKA 3B7PA 1V0JA 4EZIA 5I7AA 2XA2A 2PGAA 2LW7A 3DXFA 4N7BA 4O4JB 5JS2A 5JZOA 1I33A 2EFEB 2HN9A 3K2QA 2WSSA 3QFCA 1RAFA 4FGSA 1W0CA 1M8FA 3R5KA 4Q39A 1EKFA 3W7AA 3HCAA 3CMCO 1U0LA 4EHLA 3CX4A 5KQLA 1EDEA 3KALA 4K0RA 3OSNA 3T5JA 2XNDA 2BJVA 5DV9A 5K0CA 2EARA 5CYFA 3LY9A 3CWCA 1JA9A 3UC9A 3C16C 4JHLA 4JI0H 1BH6A 1NKSA 4ALNA 1PT8A 1S3SA 3KKEA 4Q1VA 4DIKA 4BGDA 5E4TA 1KTAA 4W5HA 4J9KA 4H7DA 5EJ2A 2V7GA 3NOXA 5GWXA 5JPCA 3THRA 1T35A 4DR6H 3Q2IA 2B0CA 3KFVA 3HKZA 3IOYA 1JQDA 1DBRA 1L4FA 2HMVA 1RCTE 3DE4X 3CUTA 4H7EA 5GGXA 1W5EA 2BCGY 1MRNA 3ZXUB 1IOLA 4TYQA 3H4DA 4EA7A 3T7JA 5FCDA 4N18A 3AESB 3WI7A 2PJRA 1OQAA 2C2XA 5I9NA 4C07A 2J33A 4LYGA 5KTNA 5GVRA 1T9KA 2O05A 1KJIA 2RIPA 2JCSA 4YRCA 4OXQA 3VPAA 4BY7G 3AUKA 1TADA 1NM5C 2EEZA 3BH6A 4M8IA 4PG6A 5ADWA 1WRVA 1XNQH 4N54A 4TQGA 4F96A 3KFXA 1RI2A 1WBJB 3D1LA 2QD2A 3U7RA 4A6EA 1XA4A 2W6ID 2YV1A 2QK4A 3OWHA 4LZZA 5MDHA 2OTCA 5DX0A 5L4LA 2BDTA 4IX1A 1IG0A 3JVIA 1I0IA 2QOEA 1GGMA 4RZ3A 3TH5A 1A9QA 1R1DA 3RIYA 3VSEA 3ZXSA 1YQ9A 3TZHA 5KTOA 1CRLA 1R6DA 1SRRA 2GF2A 4D98A 4IOJA 5D3MB 3OQPA 1GV1A 4LYJA 4P4NA 1G0NA 4A4DA 2AK3A 4PYOA 3K0AB 4P5PA 3RVLA 1D03A 4RK5A 4AX4A 4G3IA 5K6TA 3CEHA 5EZ5A 1TWHA 4F5WA 4YV0A 1TEZA 3ZWCA 2ZTUA 4C3VA 1QF7A 4CM8A 2YVLA 1PSWA 2Q5LA 3ESDA 3LQ4A 4MS1B 3I12A 1BXZA 2YUIA 3PD7A 1A4IA 4HZGA 3S2EA 3AFGA 2O7NA 3AESA 3STUA 1BCSB 3QTLA 3VMMA 2B8WA 4IS3A 4QQRA 5MN4A 5JUWA 2HIAA 3AVVA 2QTVA 4K6GA 4L6AA 4MQFB 4CMAA 3D6TB 5JAIA 1II8B 2NO0A 1GGVA 4FNAA 5DYTA 5A7GA 4DA8A 2OGSA 4X1KA 1O75A 1EUQA 3RYHB 4BMSA 3KR1A 4XVQA 3H11A 5T4BA 1IPFA 3HR8A 4K9MA 3DNPA 5TMBA 4MV1A 2O8BA 1L1RA 2OXEA 1ULUA 2VEDA 3RT7A 1FJGH 4G65A 3WRVA 2PR7A 5HDBB 1BHSA 3TN7A 1O6CA 1Z7WA 2BFNA 1P39A 1G18A 3A4TA 4JU9A 5KTYA 4CC5A 1Y1LA 3W8FA 4YV1A 1QGUB 2AKYA 2Y77A 3L04A 5EZ6B 5GVSA 4QJFA 1QQBA 1KOGA 5C81A 3UOGA 1MENA 2FZLA 3CVJA 1O94C 3CLSD 2DPLA 4BQPA 1C81A 4LOIA 2DG2A 2Q3JA 4DMHA 3GLIA 1XTZA 3HNRA 4Z2YA 3W4KA 4RGBA 3B20A 3C6QA 3KQVA 1XMSA 4U2KA 4DR1H 3OJCA 5KNDD 5TV2A 3D5TA 4MWSA 5IUKC 1CVRA 2WYOA 3VYUB 2AOUB 4CNBA 1KWKA 4GRIA 4EVQA 1JQ3A 2ZI4A 2BZSA 3C8UA 3P20A 5EWLA 3WYNA 4EF4A 1UQUA 4IQ4A 5AXBA 2FK2A 4E21A 2J5BA 2ZQ5A 3TSZA 4XRGA 4I9GA 1AQNA 2JD0A 5JS8A 2BF4A 1REQA 2ADMA 2NV2B 5JSUA 2XKAA 3ZDXB 4O83A 1DINA 2XNJA 4FB4A 4PN7A 1NJ6A 2A2ZA 1L5OA 4DV5B 1VZ2A 2VP0A 3IA2A 3S99A 2ZYIA 4RZ2A 3C3BA 2BGKA 5D5HA 2FN8A 4K9LA 3ICEA 1JSRA 1WPXA 4AJ2A 1LY1A 4YAKA 3FKIG 5C8ZA 2IA6A 3H13A 4OMDA 3RC1A 2OCPA 1Z0KA 4MA0A 3TR0A 2FZWA 1N5JA 1U2GA 2LKCA 3TM4A 5M7EA 4TOIA 1XXHA 2DQSA 4ZEOA 1KK3A 1X13A 5C3MA 2I66A 3DOOA 4OGFA 3UYLA 2AOUA 4KQFA 2F9LA 1Y4UA 3BAAA 2NLOA 3B78A 4KYUA 3VVMA 4OP2A 4NCAA 1J0XO 1NQ5A 1WXXA 1SG9A 1Y1SA 4IO0A 3TJZA 2XOKD 1W2GA 3AYXB 3GJZA 1PI3A 3BQ9A 3CRVA 2IH5A 4E5KA 5I8ZA 5C1OA 5BWRA 7MDHA 3L82B 1UJCA 5JYBA 1FMTA 4ZALA 4X71A 4FCCA 2DH6A 3BMCB 2ERCA 1FCJA 2G04A 2XDQB 3BH0A 3MQ2A 4GPTA 3UZUA 3RYCA 1VJ1A 4OX9Y 2W9BA 3L9WA 2JA7G 3AJ9A 4YAEA 2GZ2A 4KNVA 1OFUA 1DG3A 5CYPA 3BRWD 2PHZA 4K8OA 1F9AA 1YR7A 1UOPA 4MB0A 4E5PA 3RREA 5AM3A 2F64A 1EHYA 1VHQA 4XFKA 4JP5A 4CQMD 3ASUA 1KJJA 2FN3A 3DTNA 3ZYZA 1CJVC 2W2QA 1J1UA 2AFRA 1H66A 1QOPB 1TPYA 4I14A 2WD7B 3L4JA 3I28A 1K06A 1MG5A 3ZNNA 2HIXA 5BPHA 1HFJA 1JDJA 1L4KA 3IUNA 1ZEMA 3N5KA 3QMVA 2CFRA 2AOWA 1F3OA 2H7VA 3ELYA 4N03A 4N4AA 4D42A 4F46A 1UIMA 2D5LA 2XC9A 1R9GA 5B57C 4CTJA 2AS0A 1AVTA 2FEMA 2FX3A 1OTYA 2F3PA 4WN3A 1VI6A 2W2VA 4Q3NA 2GNPA 4QU5A 3I4MG 2WNSA 3C5WP 5CA1B 5I4IA 1F51E 3NHMA 2PWBA 3NWJA 3OEED 2UVUA 3AB3A 1T3GA 3SYLA 2RKOA 2ZJ8A 3KDAA 1PNQA 3OPYI 3IPYA 5CT4A 4PINA 1Z63A 3B1KA 2WWRA 1KH2A 2Y9MB 4YCCA 3GLTA 2VXYA 3ESCA 4YJ2A 1XQXA 3ROFA 4IS2A 2ES4A 4RF4A 3DE5X 5KC9A 5EESA 1HYHA 4IMPA 3U4QA 2J7PA 4L9AA 5BV0A 2V5UA 5SICE 2ACVA 3RBXA 4EI7A 3RS4A 3DAPA 1DGQA 1M2KA 5CURA 3NBAA 1NL3A 2O23A 1RVV1 6Q21A 3E22B 3WLHA 4LTMA 2HHFA 2O2CA 3GGSA 4KXUA 2B2CA 3C24A 4M3NA 2YZ7A 5B1EA 1L1FA 1MO4A 3IPXA 2A9PA 4YUYA 4ZZIA 1YI1A 1RPNA 2F7SA 3Q5GA 2OB2A 4DDHA 1XRQA 3WMGA 3WWZA 1QZ3A 4M89A 4ZDWA 1DRKA 2PMCA 1MGPA 4ZOQI 1FMLA 4G89A 1ZVMA 1KC7A 3HWWA 4RS3A 1YJ8A 4FEGA 2UXDH 3WNVA 1ZUIA 1H4SA 3CBGA 4J1TC 4Q0MA 3MWMA 4FZRA 3M34A 4WUVA 1YQGA 4LYHA 5KNCA 3HR4A 3ZZTA 2FEPA 2F1OA 1YHZA 4H18A 4DMFA 1UXJA 4QOFA 4TRMA 3PFWO 5B2FA 1LDGA 2BGUA 1CDDA 1YZQA 1Y14B 2CLLB 1LTHR 1YR9A 1XGKA 2QRGA 3GT0A 3JQAA 3BMXA 4K28A 2DUWA 4PX5A 1Q3TA 3HXMA 4M38A 1QR2A 1H65A 1L2TA 2BN4A 2Q6KA 3ZH9B 2JJ1A 3JD1A 3M81A 5CT8A 3NGDA 1VLHA 1E1RA 4HQ6A 3GL9A 1ZHSA 3KIPA 3M33A 3PDIB 3HY6A 5EINA 1E4GT 1JXQA 3LHKA 3I9KA 2BRUC 2W6CX 4KBFA 4Z0NA 2P62A 1AE1A 3AR6A 2C1XA 4UUMA 4C3OB 4K0KB 1JR6A 1UJ6A 1XZFA 4P4TA 1NBMD 1WCV1 1I14A 4P2BA 5SYMA 2Z9CA 4NLGA 4G0YA 5T8KC 5K0FA 2JGFA 1QHHA 3JATB 1GP2A 3LUGA 2HV8A 4W6QA 3I8XA 4YQZA 2W7TA 5AWFC 3W4JA 3RQIA 4BN0A 4CN9A 1R4ZA 1WVMA 2YXBA 1FYWA 3TB6A 1E4EA 4A0RA 4A3SA 3OCCA 4ETSA 5HMMA 3GLIB 4EVIA 1V71A 4R3WA 3F5DA 1Q92A 3QOYA 1CJUC 3QKRA 4YRIA 3O75A 5LC1A 4YRQA 3ZXXA 2VVTA 3ID6C 4QQNA 5KUTA 3MWEB 4BNGA 2FLVA 2QE6A 4KKVA 3PVCA 1VB3A 4OMFG 4UAGA 2Q7OE 1F6DA 5KCZA 3VKGA 3K2BA 2XE8A 1AQLA 3TBKA 3U5ZB 1DBWA 1EK2A 1M10A 1J1ZA 3IHWA 3LW8A 4FONA 1PWXA 4RIHA 1TQDA 5D01A 4UCSA 1G8PA 5EXXA 4H2DA 1HKUA 3PGVA 4UCFA 3UOWA 4NMLA 1RP1A 1ZL0A 4N5DA 2RDJA 1CUJA 3MLBA 5B1IA 1YIOA 2J4CA 3KWLA 1L5YA 4JI1H 2HVQA 1U1CA 1FLAA 1U63A 2ZDHA 4ZVPA 2NVUB 4B3CA 3L6EA 4PAOA 1NAIA 5KYVA 3R9XB 4UM8B 4RIEA 3D4PA 1SCUB 3DLIA 2B82A 2XWSA 6AT1A 4UEKA 3DZJA 4YALA 1M73E 3DM9B 4GMGA 3DXZA 4RNCA 1NKVA 3BERA 2CLKB 4XYGA 5F1OA 4ZVVA 4EG1A 1X1SA 1MQ8B 5KFZA 2YHIB 4PIVA 4V0RA 1MRZA 3V5NA 1UINA 1ZP6A 3FCEA 1Z0UA 2QX4A 1JR3D 2GPBA 1S2GA 2PUWA 1A7JA 2H8GA 1QQ5A 2RHDA 3HEBA 4MEAA 4MTLA 4CM8B 5BMVA 4EOGA 4UFNA 4GRDA 5E7QA 4B2LA 4PQGA 5KYGA 1JDTA 4LV6A 1N9GB 5E7JA 2I5PO 4YYZA 3I9NA 2VK4A 2YJ4A 3IVXA 4PNHA 1KRWA 1FSFA 4KLRA 1JDBB 3OWOA 2O20A 3OFJA 4DJFC 4B4OA 3GP8A 1NN3A 1T0BA 5JHGB 5ILGA 4I4TF 2JJYA 4FFWA 4OFXA 3RCBA 2XCIA 1N2CE 1IY1A 1Z0DA 3A9RA 1OH6A 1SZCA 4DJ5X 5ICFA 2AK2A 1KO7A 2FUKA 3WR5A 4EMSA 1NW8A 1S03G 4M36A 2A0YA 2DWQA 2QG9A 3BACA 4ZYWA 4Q47A 3QZUA 4HOYA 1N6KA 1WCIB 1SIUA 4EY4A 1YDGA 2QVYX 3F7TA 5LL6b 3NVAA 3ZVLA 4RVUA 3KELA 4MUXA 3ELUA 3IIMA 3PCXA 4JLOA 4P3KA 1NW6A 3O5AA 4Y2TA 5LB2A 4EUSA 1VJTA 1ZN8A 5HA5A 1J8YF 5A3VA 1QO9A 3ELDA 3DB2A 2YXDA 2RK4A 4JB3A 5K3DA 2CVQA 2CNKA 4FGLA 4YP6A 2D8MA 4WZBA 3T95A 1HTWA 1CDOA 4BRUA 2F55A 3PEFA 4ISBA 2IP1A 1JEJA 1OV6A 2XAUA 1XRLA 1M2VA 3KQQA 3RUPA 3KT8A 3O38A 4IGAA 3QOXA 3GJXB 5UKDA 4P9NA 1G3UA 4JI3H 2OZEA 3BBPA 4GO1A 1Z4LA 3FFAA 3GWGA 3CKKA 1JH9A 1AY0A 1ZCJA 2H6EA 2R93G 1JA0A 2XMQA 4M88A 5EP4A 3RUIA 4DBZA 3B5EA 4JX9A 4ZVQA 4AYBE 3DYVA 2YU9A 3I2GA 4NE9A 1OI2A 1T8TA 4I4NA 2AV6A 4DR2B 1WSBA 3CIFA 3PFGA 4W5TA 2C8LA 5CP8A 5AW3A 1WBDA 4ZT3A 3PQ3A 5B6JA 5T6MA 3CR3C 4X6YA 3H97A 4HWRA 5LP6B 4EY7A 1T0IA 2H9AA 3FGPA 2V7QD 3DYIA 3IOCA 2ZJ2A 2UZ0A 4NF2A 2X42A 4FMCB 4G0ZA 4X1OA 1IB0A 4N3GA 2BHSA 2G83A 3ISJA 1XU4A 1V6SA 4P0PB 2YUTA 4MRMB 1TVCA 2QL5A 2X1LA 4IJWA 2QM7A 4DOMA 1DAMA 5KAPA 3A9WA 3K53A 4JP3A 4L5AA 1KC1A 4UVIA 5F21A 2ONJA 4K6NA 1M3SA 2HYDA 4FILA 2WB1A 4FP9A 4RLSA 5DJ5A 9MHTA 4FDUA 5CNKA 1E2HA 4DMUB 5JY1A 1NXOA 2J3HA 3PITA 3K0CA 1NVBA 1YUBA 3RV4A 2Q1XA 4PWYA 4DCUA 1HNXH 3PLAE 3EXG1 4DR5B 2HF7A 2NO6A 1JLRA 3DWGA 3JSXA 3WYAA 2O4CA 2Q3BA 3BC1A 3OHAA 3DMNA 1V35A 3UQYS 3FROA 1RCUA 2Q5EA 3DEAA 3TOVA 3WBKA 4F9GA 1U9ZA 3EVFA 3CA8A 2KPOA 1J5EH 3NHLA 2DRIA 3BMOB 3OT1B 4K9OA 1E7WA 5DHRA 4CKCA 2ZI7A 4M0KA 3CYFA 1R64A 2MOKA 2P9TA 3IEPA 1OXTA 1TU4A 3AV0B 3KQMA 3UJHA 1GTRA 2D7DA 3EIQA 1PG5A 4MV9A 4DV4H 1OWLA 1P75A 2X6QA 3CY6A 1I9GA 3F7OA 3K0EA 4N3AA 4PPQA 2AOXA 4CL2A 5TQ2A 3F4KA 4LN1A 3VKUA 1U8TA 4BLWA 1L7QA 3QENA 1K7SN 3WRXC 3UV3A 1GAQA 1BU8A 2J09A 3S1SA 2Q2UA 2BFFB 2WM3A 1A8HA 5AUNB 3GPLA 2PD4A 1PQYA 4Y8VA 1ZMRA 3ECAA 3RTBA 3U7QA 3MMSA 1RPTA 3R3UA 1Y0BA 2W2KB 4IIBA 4IFBA 3DVRX 2NIPA 1X1DA 3S24A 4OHUA 4MPJA 3HJBA 4UU8A 4A8JB 3PUXA 3KWMA 1YSCA 5B7GA 2BZ0A 1BXRB 3ZCPA 4LWPA 5IAJA 4BQSA 4Y9DA 1U99A 1NQTA 1MR3F 3I52A 1NBMA 1GPNA 7MHTA 3LVRE 4KRFA 3ZHRA 4FHZA 4ECRA 1JG7A 1TO6A 3L41A 3NBQA 1JZQA 3FGOA 2IX3A 3MCWA 1A9TA 2X86A 3RLIA 1Q7TA 2B7BA 4NFSA 5CVJA 5ESXA 3MWYW 2OZPA 1ARZA 3C6KA 4U7HA 4C7OA 1XHEA 2CK3D 2WTNA 3X0DA 1QGUA 1AX9A 2K4MA 3I09A 4MLCA 1TK3A 3AI7A 2UV8A 3S0JA 4I81A 3PUYA 5H70A 5HM6A 2ICAA 1D6JA 4LZOA 2A5LA 3AF3A 4D0GA 4YR3A 3JPWA 1E9FA 2YJ3A 3IJEB 3ANMA 3MA0A 4NHEA 5FLXA 4L57A 5JVLA 4ABTA 1QHFA 3Q87B 3RR5A 3IB6A 3IDFA 3CH7A 3IPAA 2ZUWA 1AS0A 1ODJA 1Y9EA 3BHMA 5IPFA 1I5OA 2CYAA 5D1HA 3ODGA 1E0KA 3P9YA 4IX9A 2ZM6B 4B7XA 5EXPA 3H9EO 1MC4A 4YP3A 3EGDA 4YRGA 3NAZA 5KFKA 1IAQA 1SU4A 2QIOA 3BD8A 4POAA 4BVKA 5I5XA 5B7NA 2BUBA 1ZH8A 5AP9A 1DQSA 4TUYB 3EBPA 3HGQA 1U0EA 3ENKA 4PXAA 3RHSA 4UUAA 2QIPA 1PR0A 2FWIA 4UXHA 2VA2A 2B9VA 2OR3A 2Q9UA 2R8EA 1GA6A 4US0R 1GYPA 1YDFA 1F1BA 5H4HA 3EMBA 4XDYA 1C7FA 4H7FA 2CKDA 2NZYA 3T15A 2X5OA 3T0IA 2XIQA 1T5DX 2HDNB 4RJJA 4HUJA 4BZXA 3KHLA 2W4MA 4R83A 4HTFB 4NCKA 1DBQA 4KP7A 1G17A 4CMDA 3EAQA 6PFKA 3BXFA 3MJCA 3HFRA 4D81A 1Z29A 4EO9A 3B82A 4MW4A 5ALZA 2CZGA 2BRUA 3JARA 2I3GA 4M1SA 2H1SA 4YBRA 3M3PA 3N28A 1C1DA 5FEMA 2FB9A 3BL8A 1LC3A 1W85B 1KEEB 3N3AC 4JAVC 4GYKA 2BFWA 1GM5A 2COUA 3GZJA 1WMAA 3G6XA 4S1TA 3O8DA 3GBVA 1ADJA 5HS4A 2L17A 5C31A 3D6HA 1OAOC 3D4OA 2AU0A 5FOUA 4ER5A 4PQEA 1TD9A 2YWRA 3FAKA 4M0FA 4OKIA 3LA8A 4ENUA 5LUAA 3D2AA 1P91A 1RLOA 4CM4A 1JLSA 1H6AA 4N0QA 4EG3A 3QE2A 3T3OA 4A2PA 1GILA 1U04A 3QEMA 1SK8A 2C57A 2GZ3A 1RM5A 4OBXA 1K5PA 2Z2KA 4EJ6A 1W48A 4UMVA 4DBLE 4Z3KA 4AUEA 1NSYA 2C2ZA 2YWJA 2ZI3A 1Y1RA 3H3VH 1T8SA 3EN0A 1QS0B 1IC6A 1NBME 4J16A 3QFRA 2QGFA 1CUZA 3GQBB 2VUHB 2MINB 2YMQA 2DB3A 4O81A 2CWDA 4G5RA 2BBSA 1V8FA 3JARB 3E5RA 4G97A 4Y0VA 1NLYA 3TW4A 4Z7JA 2WB2A 3D0QA 1BVHA 5IVIA 2NXEA 3BTSA 4Y9RA 1OPRA 1G8JA 3M4ZA 2ECPA 2MSKA 4D8YA 5BWMA 2ATXA 1QH1A 4I19A 2O3QA 4V0QA 3SZMA 5A4DA 2JK1A 1XYGA 4AFNA 1HL7A 3DDWA 5DAAA 1WLYA 1VM6A 4GR4A 4ZJZA 4MHOA 4P5EA 4ZAYA 2W6NA 4BMDA 4MKFA 2XB4A 1F20A 1D2HA 2PZJA 3UT0A 4D80A 4XYLA 3B8EA 3BGSA 3EQ8A 2V0GA 5E3IA 1N6RA 4Q0YA 4HVCA 3IOEA 1IDN1 1I4LD 4NBSA 1D6MA 2JCYA 3C4QA 4GECA 1C7ZA 2FSIA 3EX7C 3QE4A 3RS0A 3E7PA 4JBXA 2DIKA 1YH3A 2PGXA 1SVUA 2UKDA 2HXYA 4MJXA 3UPUA 2X2FA 1E1QD 1H2HA 1O03A 4RV4A 3V9AA 1P2BA 1YONA 4Y7CA 3R4VA 4IUBS 1MFZA 2V0CA 2CNWD 2Q28A 3ELWA 2HQSA 4HXGA 4QUHA 1YL5A 4LOHA 2HRQA 2C95A 4F3KA 5AW6A 3I1FA 1K4YA 1YDWA 2QM0A 4EKIA 1KMHB 1C9MA 3W3ZB 1GNSA 4FZ5A 4J0DA 1JF8A 4ZO8A 1Q12A 5FTNA 4NFYA 2IY7A 4HK4A 2BHNA 2PGOA 3OZIA 4OI4A 4IBOA 1ACLA 5DG9A 5KDOA 4QT0A 2AWOA 1D04A 2IWRA 3AHGA 1GGNA 4TKVA 2HU7A 3DDNA 2FFHA 1YRQA 1J00A 1TIPA 1XPJA 2V59A 2QI9C 4ZAXA 1WJGA 3I01M 1AQYA 4TSFD 3MGAA 1OMOA 3CPEA 3UMFA 4HUTA 4YRFA 2C29D 2OWOA 2QTHA 1ONOA 2FZCA 4KQCA 5KFVA 1SZDA 1A5TA 2V4RA 2FMHA 4DR1B 4G1FA 1IHDA 2XAAA 1Y3DE 2F2TA 1BXRA 2DPJA 2BTQA 1TKCA 3G0GA 2JLYA 1ZQ1A 2BUCA 4KH1A 3FOWA 3SPXA 3ZVNA 3I6MA 5LXTB 1JNYA 1P2TA 2GCEA 4HNGA 1PR9A 1WSWA 1YRHA 4IDCA 2P7HA 3H5TA 1ISFA 3ED5A 5F9MA 1DRVA 2JZNA 3BK1A 3HKZE 4D96A 3JQRA 4QULA 1RXWA 1FJGB 1HWYA 5KCMA 5FXMA 4B3FX 2IDZA 1D7AA 2YC4C 4MYRA 2REQB 3DBIA 4J1NA 5CJPA 2HZBA 3GU3A 1WZEA 4QU8A 1NSTA 1VPVA 2DQYA 3MTQA 4BLPA 3HR7A 4O2AA 1DQZA 3VV3A 2ATIA 2ONYA 3F5MA 2IL1A 1P4GA 3CH6A 4Q6BA 1NVVR 1TEVA 4FR0A 5KTKA 3DOIA 3NS7A 4DR7H 4UHKA 1G1AA 1WD7A 5IJAA 3V4PB 4QHTA 1YS2X 3E03A 4CT4B 1PZMA 3P8ZA 4XWGA 1PZHA 4EY6A 4DREA 2BFEB 4IVPA 4GLBA 4IIDA 4W5JA 3GMDA 1KAHA 3QWAA 5A05A 2QRPA 5JEDA 4J43A 1O3YA 5EE5B 2W2LA 3A6ZA 1L3CA 3NBFA 2I1QA 3I6BA 4AWBA 1G41A 2Q07A 4WHXA 3CHYA 1X6VA 3HUTA 1VLZA 2ACKA 3U5TA 3GV8B 1W5SA 3IG0A 2O2GA 1W96A 4HEA6 4GXNA 2VYNA 5FI1B 4OY3A 1B3BA 1NT2A 1W88B 1TCUA 2OFXA 2Q3HA 5BQ5A 1EAMA 3OF2A 2Z56A 2Q4RA 4IQ0A 5KSPA 4E6PA 1NU8A 2DFPA 2AMYA 2OCDA 4C4OA 1JHYA 2NPIA 4HS4A 2JGJA 4R2IA 4TWZA 4WGFA 5IJWA 2V6MA 3IP1A 3MRSA 4IIJB 1DFIA 1VCOA 2EJCA 3I53A 2G07A 2OV3A 3HJUA 5FWYA 4YMGA 3NT5A 4MWZA 2UU9H 1KS2A 2PZKA 3BH7A 1GNRA 3WK6A 5CXUA 3KB1A 4LY9A 2IEDA 3D0OA 4EBEA 4BX9A 3LBNA 5DT9A 4LJ4A 5FI3A 1AGPA 3CT4A 4HDRA 4H7JA 2X0NA 4OKSA 1SEVA 1PKXA 1QTNA 4CIAA 1QIKA 2VPQA 1LZLA 1M6WA 2CZQA 3G85A 4IDNA 1CG6A 4G0MA 4P3XA 5DH9A 5TPWB 3RSHA 2WU8A 1DJQA 1Y1WA 3DBVO 3CF4A 1XHLA 3G2JA 4U4AA 1X1EA 1ZGZA 2BSAA 2CJFA 4U5QA 5I5VA 4DSTA 3PENA 2FSHA 3UC5A 2QXUA 4F3RA 1Z22A 3OCXA 4URXR 1E1DA 3TTWA 4QYXA 3Q41A 1WMSA 1F48A 5HJ7A 1QGED 1LFAA 2OD9A 4WLFA 3VBEA 3Q5DA 4YMTA 4MVJM 5AIBA 2ZUCA 2ZXFA 3DZKA 2GTPA 4PO1A 3FMOB 4PS1A 3FLAA 5FHQA 4OU4A 3RSOA 4CQMB 3CVXA 2B30A 2BKEA 1JFRA 1MHPA 1Y1WG 3R3HA 4GBED 5FL7D 4AMBA 3PUHA 3KE8A 2BE9A 5THXA 2HVSA 1GZ5A 3ZWAA 5AW1A 4D3SA 1A2BA 4LV8B 2J9RA 4B6RA 3QLTA 5JNRA 2GWHA 1NUUA 5C44G 1J90A 4TN5A 1LQUA 1ORDA 3E05A 4K03A 4EF6A 3PFFA 2V1UA 3I4FA 3DCYA 1WX1A 1QB8A 1ZJJA 4QGAA 3GRKA 2YFYA 4D25A 4YJKA 5T41A 3RAJA 1E0DA 4QICA 2W83A 4A0HA 1JT2A 1QRTA 3GFPA 1FTGA 4WL0A 1WG8A 1G8KA 3E9RA 3O0DA 4NOLA 3RYIA 3TSCA 4YIHA 4A3BG 1CZKA 4NJEA 1WXIA 1L7OA 2Q62A 1T4MA 3NUGA 3BABA 1DAOA 1G4AE 1NBEA 1NV9A 2D74A 4XEHA 5D84A 3WYFA 5J4HA 1P1KA 2A1IA 3OU6A 4AJLA 1UWKA 1OBVA 1WM1A 4O8CA 3U3ZA 5KYYA 1PT9A 1MZVA 2VJOA 1XRNA 4WKPA 5B53A 2OXIA 5EXTA 5GTDA 2R60A 1QP7A 3WA7A 4PDBA 2H2GA 3TTVA 5IZ4A 1TM1E 1SURA 3HXLA 2AR9A 2EWWA 4LFBB 1ZDMA 4FGRA 1QCZA 2X7HA 5DHFA 1FDUA 1NG1A 4N01A 1FTYA 1KF0A 4UFZA 3C3WA 2I65A 1Z8HA 2VT2A 5AXCA 1WY7A 2A9QA 3D8TA 4GC5A 5LBTA 4S05A 4DL7A 2R6DA 2ZZKA 1IIRA 5K03A 1Q1GA 3ASVA 4BO0A 5ALNA 2MYNA 2WIGA 3K8YA 1VYUA 2FWPA 2YYAA 4DR5H 2CMHA 2WFLA 3AR5A 4AG5A 4QQKA 1JR2A 1K75A 1KSHA 3KYBA 4PGHA 5I3CA 2O8DA 1JIHA 2BISA 3M4IA 1N7JA 3H8VA 1VE3A 5KFBA 1X7YB 2I22A 2X0KA 5AQ1A 1Y34E 3WICA 1XLTA 1UAGA 1W4CA 1VXOA 4TRRA 3DD5A 4JEMA 1CY4A 3U40A 3WZ2A 3KQUA 4ECXA 2BEVA 1N8NA 3N70A 1GL3A 2Y1WA 1QV7A 5A0VA 2A8YA 3MTEA 1K8RA 4EELA 3JZIA 2BZGA 1P2DA 3BCHA 1VE1A 1VG1A 1UKEA 1NU6A 1L5MA 2NQ2C 5FQNA 2FU5C 4V1CI 2PGIA 3ENWA 1RZRA 3OJWA 4DB2A 2A30A 2WM2A 4G0NA 3C3PA 3UB3A 2GJ8A 2HMUA 1FNMA 2FGJA 2WHQA 2CFTA 3QPAA 2Y76A 3C3YA 3QWBA 1UJMA 4HDAA 4CF3A 4J0FA 4PYMA 4YONB 5FBQB 4NVRA 1AKWA 3HVIA 4GX5A 1KDZA 4C0KA 1U0FA 3SYNA 3HLYA 3KSZO 4M1OA 4FW8A 3UN1A 3GUCA 5G4KA 2PYIA 1LKZA 2CXPA 2VH2A 1N2CA 3AI1A 2W6MA 1NMYA 1VLVA 3C8ZA 4LDQA 5ALKA 5JEEA 2Z2YA 4V0NA 1UXHA 3U16A 4MDYA 1XWIA 2Z98A 1C7JA 1EX9A 5FBHA 5EYPA 3AQ4A 8MHTA 3V7WA 2WHPA 4AC9A 3JQFA 2BFPA 4X8OA 2CE7A 1EX7A 2PD3A 1BE8A 4CE5A 1U0TA 2P9YA 3CVOA 2HIHA 2HGXA 1B2LA 4OQ4A 1N2JA 2OORC 4X7PA 3UK0A 4RFSB 1T0HB 3ZWPA 4B31A 3OP4A 2GPTA 1OWNA 4GBMA 2JFFA 4WY5A 2Q2NA 5AK5A 2NZ2A 4YT8A 3GIDA 1T4DA 4JROA 2YXPX 4OOEA 5J2UF 5TNXA 1J21A 1SZPA 3TLCA 3UCFA 3VTKA 3HEAA 2ZWPA 1E6MA 1T5TA 2J7PD 3D3EA 2G17A 1WHTA 3LGAA 4B81A 2VDLB 4RTLA 5BVHA 4M0MA 4WY2A 3G49A 1Z9BA 2PXXA 4P7JA 2N42A 4YRTA 2O5EA 3MR5A 1IQPA 2CY0A 1RYDA 2HA0A 2UYYA 4QARA 3X1MA 2X3YA 3N58A 4FFMA 4N49A 3EG9B 2UUCB 2MU1A 2PSJA 4G8DA 3HDYA 1P9OA 5KG0A 1ONPA 3B9QA 3L7YA 4BLRA 4PNEA 1TKAA 1U2PA 2VNKA 1M6HA 4JUAA 1PFQA 1YHYA 4UBMA 3AVYA 4FDLA 1YZNA 1EB9A 1R00A 4JVLA 2CE2X 4BWFB 5JRJA 2UYCA 3VPFA 1EXMA 2Z2JA 5KYXA 2IBTA 1XXHB 3TNFA 3B6KA 3T9FA 2HHCA 4UKDA 3PHHA 1CRZA 1E6LA 1X7YA 3UKOA 4BRZA 3HSKA 4P32A 4DFDA 2YIJA 1MNQA 1DCMA 1VIAA 3FGZA 3LVQE 721PA 3R7BA 4BY1G 4EHFA 4JBLA 5DLFA 4IGEA 1RWMA 4L0DA 1U9JA 4HWOA 4OO3A 1PDWA 4QECA 2GBCA 1GXSA 2ERYA 3IBTA 1J2EA 2QAGC 4DY4A 3L0SA 4FT2A 4QUGA 3RIEA 4WBNA 2VCEA 3C3KA 5DKFA 1Z39A 1XLVA 5FBZA 5BR8H 2VNHA 4FCTA 5CDYA 1I2CA 2Z6VA 5F7JA 1JWBB 4B4WA 4H59A 3PYLA 4BFLA 1OI3A 4QVKA 2YWVA 3I58A 1B6RA 2D06A 2ZJ3A 4CQLA 4BIMA 3QPCA 3ZWDA 1P61B 1OLUB 4YCBA 3RVSA 2MCTA 3IBGA 4CCWA 4N6NA 4J9VA 2RBGA 3TLKA 1N2CB 2OE2A 3SVZA 4XVUA 5B5SA 4QA9A 1FFXA 3U49A 3AWDA 4M7OA 3LC2O 2ZR9A 3OX1A 2FDXA 2XW6A 4K1LA 5I5GA 3W5OA 1AG9A 1AS2A 5HUHA 3V8MA 4FK8A 2XB8A 1RJFA 1WE2A 4E3WA 3VNRA 3CLUC 2C92A 2Q7XA 3SKVA 4C0LA 3AYHB 1FP4A 1JL3A 5AVQA 3CEBA 3A2LA 4ZEMA 2Z4SA 3L7NA 2FWJA 1TI7A 4LF6H 3ZW9A 4L07A 4J90A 5C3EG 4PFQA 5FL3A 1D0VA 1DWUA 1A76A 3MJVA 1YJXA 4MGEA 3PKZA 5H83A 3R3XA 1XJ5A 3OHPA 2C4NA 2ID9A 3IHLA 5E4YA 1RWPA 1ODCA 3IO5A 1YIDA 2H4WA 4L02A 3WY9A 1QG0A 4EJSA 5AVUA 1YCGA 1SKBA 5K8LA 1TM2A 4TYNA 2ZSFA 1NGSA 1KI1A 2VF4X 3NETA 2D54A 4ZCLA 1GOTA 3SEAA 3TZLA 4X60A 3UUWA 1XQYA 1RMYA 3AB7A 4KQ1A 5EIXA 3LUCA 3MEQA 3V7YA 2YMLA 3OOSA 4RX1A 5ALUA 4BAZA 4Y1RB 5AUOB 1ZONA 3PW2A 3HBMA 2ORVA 2NZJA 1FTNA 3F2VA 2BELA 1AC5A 1IZ8A 3OX4A 2BDEA 4FN4A 4YH1A 2Y9PB 5BYAA 3CPSA 4HADA 1H5UA 1LDNA 2BR5A 4ZJUA 2AN1A 3F96A 3I2KA 3EFOA 1HFWA 4URHA 2OYRA 3RQSA 4UNRA 2XKJE 2OCLA 2E4YA 2JA1A 4KE7A 2C96A 2WM8A 1N9GA 3QUAA 1XELA 1KQ3A 4Q16A 3Q3HA 5CHYA 3TSAA 1FE8A 4PBSA 4Q3BA 3ZGYA 1AUPA 4J9OA 4PR3A 4OGLA 1CK4A 1Q20A 4O7VA 2HOQA 5EL0A 2ZIWB 1HQDA 4FS8A 4D8TA 2GPAA 2AEFA 4UHFA 4LSMA 4BGVA 5FUYA 1R4NB 2O3TA 2RMKA 4INZA 1LRJA 1P0CA 2IZ1A 2SBTA 2ZSEA 3FDXA 4MP8A 4V1CA 1L8QA 4OGWA 4Z0TA 1AD2A 3R9WA 3WLJA 2P1RA 2R1ZA 4Z51A 1PR1A 3K16A 2ZB2A 3IRVA 2Y4OA 2Q3LA 3PEUA 4EUFA 1GDTA 1W88A 4WVLA 2H0AA 1R88A 4GDMA 4QQ8A 3TGWA 4D8VA 4ZTUB 5CLLA 3PQ8A 1VKRA 2PN1A 3EXIB 3SHQA 3TLMA 3DTFA 1GPH1 1MLDA 3B1VA 3GDOA 3GY0A 3G2HA 3SDSA 3A4IA 4WX2B 3HZOA 2J1LA 4GOOD 4LWQA 2VT7A 3SEZA 1FFCA 3HM9A 3IBSA 5LWHA 2HPVA 4W99A 2RH9B 3U0VA 4C0BA 1G3MA 1PG2A 1GQQA 1S2LA 2BGTA 2JGIA 3FM9A 3SEFA 5K7SA 1H4VB 1ONSA 4XUDA 1VBGA 4ED1A 3LX8A 4OA8A 4E4RA 3OJEA 1LQ2A 2DECA 1EJ2A 2CVHA 3RG8A 3OTHA 4CJXA 2EG9A 2BQ3A 3GJ7A 3SZOA 3LDFA 1E4EB 2BTOA 4M6WB 1XKLA 4V03A 3IAAA 3VR4D 2IWHA 1TUIA 5K51A 4CLOB 4AKIA 5JS6A 5COQA 2B63A 1IQUA 1DAFA 2PQ6A 3A1VA 2C94A 3PGKA 3Q7IA 4ONEA 1CHNA 3RSGA 2UXCB 1H2WA 1ABBA 1HR0B 1VI2A 2CVFA 2V58A 5IJXA 4ZGGA 3K6SB 4PTYA 2QRKA 4IIVA 4KI0A 1BNCA 2PSFA 2ZJ6A 2DTXA 1TQ4A 1NBAA 3RB0A 2G9ZA 4NMHA 4ZU1X 1RR6A 5C18A 3KAQA 1RZRD 2R7NA 2Z2ZA 2WFLB 1P7YA 5CA0A 1RNLA 4TXJA 3V8BA 3W6OA 3QU9A 4Y9SA 2OV1A 1FVXA 3FCUB 3I1IA 4JJAA 4V0KA 2DHEA 3ORYA 4WXRA 1DRJA 5B1SA 3RJ5A 2ABJA 3RKSA 2NU8B 5BWLA 1ESCA 4HMOA 1S89A 2QU7A 4G26A 3DMRA 2NM0A 1XZBA 2ASLA 1MEJA 3T5LA 1UK7A 2VI5A 3E4CA 4EUKA 3L4EA 4UNIA 4ZAVA 5KYXB 4IRKA 4BNYA 1GVHA 1OBFO 1WIWA 2YNMA 4BWYA 1H2AS 4JJKA 1CSEE 1VSBA 3TTUA 4FGKA 5F4BA 1CD5A 1OJLA 5KJ1A 1X80A 4BKUA 1I3QA 1H1TA 1A0OA 1J33A 1QK4A 1RKUA 1V5WA 2OQ2A 1WDLA 4UDOA 2EX0A 4TMYA 4AKEA 5G1NA 5T7BA 3J80A 2M2IA 3FW1A 4K6KA 2MYTA 4IDEA 3VSBA 5KQSA 3SC4A 2IU3A 1DIOB 2ODNA 4FBMA 3S55A 1OUMA 4JI4B 4J9QA 1U4SA 2QMHA 3AK4A 4R51A 1H69A 2NW6A 1K6XA 2FG6C 1YRAA 4HQRA 3M1AA 3I83A 4UXJA 5T4EA 4PV7A 2RCYA 4YGXB 2A1TR 4CUZA 5GINE 4YR2A 1RW4A 1D1TA 1LBQA 4NNPA 1HMPA 4DLRA 2PT5A 5TEWA 3FJ1A 1O0CA 5DNWA 1NUHA 4IYRA 2AYYA 3U44B 3VH2A 2ARKA 4RTSA 4IJKA 2H7CA 3U7IA 5LU9A 1ADGA 3LSYA 5DASA 5BW4A 3C98A 3GUUA 4IWYA 3OTQA 1R6BX 4LYEA 3U81A 5T3UA 5IP9G 1OLUA 3BJMA 5DHQA 2C2EA 4KRXA 4I50B 1EHIA 4OYYA 3DFMA 1ISHA 3RHFA 5C1DA 4MYCA 3KQLA 3PC8A 2Y67A 3NIDB 1RYHA 2CDCA 5JXIA 4D4MA 5EWJA 3IVGA 4BCBA 4N7MA 1EUCB 2GS9A 2C3MA 3QG5A 1WSAA 2HHLA 1YZUA 1GEEA 5J1TB 2P68A 2O2EA 1TW3A 1E6UA 4QO7A 3A3OA 3GGJA 4NZMA 1C3OB 2VBFA 3I92A 3OJOA 3WWYA 4AF6A 2O8NA 1DX9A 2KSWA 2ZDQA 5FV7A 2AJDA 2OBMA 3L1IA 2BGLA 2D0IA 8LDHA 3TUZC 3UHAA 5ELXA 4CGZA 2GMWA 1Z88A 3B48A 4HGQA 5LZ9A 1UFKA 1RM4A 1STOA 2FUG1 3K15A 1PU2A 2EKBA 3EOBI 2E89A 3QW4B 3RRXA 4R8UB 1LX6A 4O4JF 1DAIA 4KUGA 2FR1A 1NX6A 3F3YA 5BOVA 4BJ3A 1UP4A 3KYCA 4BECA 4GL4A 3C15C 2I6GA 4PXYA 4JT8A 3FNEA 1ZUWA 2FPLA 5KKCA 1T6BY 3ZY4A 5KSOA 2PL5A 5G4KB 1P7CA 4NENA 4WWHA 3SC2A 2P11A 5EFZA 1UQTA 5CA1A 1E4VA 1IQRA 1FXSA 2QMYA 3QLVA 4RH0A 3AIIA 2A35A 2FMAA 4LQLA 5H59A 1KDYA 5C51B 4GVPA 5G1OA 2XE7A 2FUNB 4ZODA 1U9IA 4M0UA 5IS2A 5IABA 2NZ8A 2I9PA 2VA3A 4OH7A 3DULA 4TUYA 3MYRA 3CWQA 3INYA 5BSWA 1BCSA 1EP1B 1Z5NA 2E2WA 2JLCA 2VK2A 4L73A 1YS9A 4OEHA 4DABA 4LQCA 4WFQA 1KZ9A 4QIWA 1LQTA 2PUHA 3GQBA 3TFQA 2GERA 4R8UA 2ID7A 2XLBA 1RYSA 4DIEA 1IOZA 3O2JA 2H48A 1U8ZA 1VYVA 2R8JA 2F9FA 4DCTA 2AHOA 3TECE 1EESA 3H1EA 1GT91 4FS2A 1SVNA 1DO0A 1F4VA 2R62A 4DG8A 2DWCA 1N2IA 2CUTA 2PDAA 4PC1A 1GNVA 2JFYA 1OWPA 4ECVA 3FYHA 4TS1A 1E1QA 4MKIA 3L5KA 4ZMRA 1M72A 4DJAA 5I9BA 1DOHA 4PYNA 4M86A 3U48A 1IPEA 3WB0A 5K3FB 4E5SA 1NX9A 4HDMA 1VL0A 1T5BA 5L1IA 4MIEA 4B7UA 3EHDA 3B6JA 3ZKWA 4OJTA 1NMSA 3H8WA 3IT0A 4ZOBA 4N5LA 5JDIC 4GI1A 4N6GA 1OFIA 4JA0A 3FKJA 3OM9A 4M55A 3DTTA 5A02A 3KOUA 1ZNWA 1QR6A 2VYVA 3PNSA 4JI5B 1JILA 2R6FA 4EGJA 3TY8A 1Z8NA 3BJIC 3GCGA 4LBYA 4QRDA 3VUEA 2XSZA 1UC9A 1JXLA 1UEXC 4CPDA 5CB0A 4M1TA 4BJ1A 3NHYA 2IGBA 2DE0X 3ZDDA 5IDVA 5LP6F 4LH7A 1OXKB 1NY5A 1C1YA 1IYEA 1C0EA 4K26A 5ELLA 2XUIA 1SXJC 3BAFA 4TWJA 4WLVA 1KI2A 3BKWA 4HX9A 5IM5A 4JUFA 4ALKA 5DBEX 2B9EA 2QL6A 3T12A 2X0DA 2HCRA 1OKKA 3KPYA 4UBNA 3TBFA 1K97A 6CHYA 5FD6A 2FFRA 1GQYA 4U7GA 1RT9A 1C3LA 4J9MA 1F38A 1FIUA 1Y3IA 4JKYA 3EA5A 4DJTA 4RYDA 3RBDA 3DMGA 4D9KA 1EFKA 3IRUA 2R8GA 4BO2A 1CJCA 3GV0A 1XP8A 2PIAA 1RK5A 4X1IB 4QEKA 1SU8A 4PO3X 1BKSB 4E1AA 3R5FA 3ONFA 1LBHA 5B3AA 3SNOA 1GG5A 1Z62A 4ENSA 3NYRA 4HN9A 2XB6A 5ALVA 3GIWA 4U6SA 4ZO6A 1CKNA 1PJ3A 2XNHA 4ZCIA 2EBWA 4C9BA 1G4HA 2D7CA 4DA6A 2MWMA 4IRCA 2TMDA 3O4FA 1GGFA 1U3VA 1A7AA 3OKPA 5E1BA 1PLJA 2GPJA 4IKPA 1FFEA 1GNQA 1Q0QA 4A3EG 1B3RA 1AIPA 1KSJA 1Z4MA 2OK8A 4I4LA 4OL9A 2G9NA 4EENA 4TLEA 4LVUA 2VKTA 5I9TA 4EMTA 2C0CA 3FHOA 2H9IA 5DNVA 3C8MA 4BL5A 2AI3A 2XKBA 3ZGOA 3BMCA 3RYCB 3AOEC 2P2DA 3NHAA 4X6UA 2BFAA 3DAYA 3UBTA 3H5VA 1Z07A 5BN5B 3ZG6A 1CS4C 5CW1A 3PICA 2IF0A 1WMBA 2QUBA 1EDOA 2XT9A 4JV2A 2P91A 5NULA 3RTEA 5LVAA 1MO2A 2RONA 3TM5A 3BVPA 2G70A 5A7HA 2Y0SA 1GPKA 1I2LA 2G9UA 3LCJA 3UGTA 4E1VA 2IE0A 4QPPA 3ULKA 2VOBA 1GU1A 2ZBGA 4PEVA 1QTQA 1ZQ9A 5FWAA 3B7GA 1RJRA 1PJRA 2A9KA 4N0EA 1CRWG 1PD1A 1QCYA 3KPWA 2Z6QA 4Q9HA 1GKYA 4FYMA 2HO4A 4JENA 5CMLA 1YE8A 3PXGA 1KBOA 1JQLB 5I7WA 1FW6A 3L43A 5AJTA 3G7UA 2DKOA 5EPUA 4YWJA 2WE8A 5EKSA 3DMTC 3EIEA 2WJ4A 4IQGA 2RHOA 4R3UC 2KWIA 5KMGB 1YQTA 5C53B 4LJ8A 1KMIY 1FRZA 4AS1A 2K2WA 2XNKA 1XQ6A 3WLAA 1U3WA 4NBUA 3QEAZ 3KOMA 4MI3A 3WQQA 1ECGA 4CTMA 2I91A 2QX6A 3AZQA 4BTEA 1Z15A 2X13A 4RNNA 1DO8A 2F3QA 2IIBA 1SHJA 3GD7A 2G4CA 5J9FA 3WHKA 2WMNB 3WWCA 4BMPB 3U2QA 2QORA 4P7GA 1BQEA 3V97A 3HABA 4BMZA 3DCJA 4DJJA 1UBOS 5E0KB 4CKCB 1K86A 4KMSA 1UODA 2P1DA 1ZESA 2R8BA 3V1TC 2F8SA 3JWHA 1MX3A 2XGMA 2HSZA 4HPXB 4MTEA 4H17A 5CD9A 4G0WA 3G13A 5IKPA 2FVXA 1ZZGA 2PGDA 1V3QE 4XWAA 1G8FA 2HMAA 4RD4A 5LUBA 4DEYA 5IXSA 2R4QA 1N0HA 3GMTA 1CUVA 5JSQA 4LNUB 3CTPA 4DRXA 2NUAB 2ZRIA 3C0FB 3WKAA 4LI0A 1X9NA 1V51A 4RQAA 2OEPA 3ANSA 3DZHA 5E6UA 3CBQA 1OX6A 1TAGA 3LQ2A 3WRYA 4ZRNA 1IJKA 2JA5G 4WBSA 1VJCA 4HXYA 1SC6A 1Y48E 1N6IA 4MR8B 5AI9A 5EIWA 3EZ2A 3WBJA 3FCCA 3IQHX 3ZIAD 5B4TA 3T3GA 2KYRA 1GPYA 1PW5A 3F9CA 4IR7A 5A62A 5F23A 5ICGA 2P6UA 2YDXA 1G60A 4TS4A 2CXXA 1XK5A 2CHVA 3K1JA 3M6UA 1W0KD 1KDPA 2WJWA 4E09A 2V3CC 4OHMA 4QLOA 2WICA 2B1IA 5H3LA 2RF4A 3OKFA 4AICA 4E94A 4UOZA 3VPCA 1O6ZA 3BB4A 1AQJA 2WWHA 1P1IA 2WTEA 3J7TA 4LC1A 3IDAA 5KIAA 4JP1A 3U7GA 2VRNA 3E9DA 2EL9A 4GUDA 4YLGA 4ZVLA 3N5CA 3R4CA 3RVRA 2GHQA 4JI2B 5FHRA 5E3JA 3Q2KA 4I9HA 4LYFA 1VSQA 2G9VA 3AVOA 3U3MA 1QK3A 3IE1A 2G6TA 1YACA 1MB0A 2W90A 2E6UX 3KJGA 1YFJA 3U26A 3SQLA 2BM1A 4ER0A 2OORA 3LVBA 2ZYRA 2H2IA 2ZRNA 1GKLA 5CTJA 4JLNA 3ZGLA 1DAAA 4ECWA 2CHFA 3DBOB 3LO8A 2ZG6A 3N2IA 4YP5A 4Z9YA 1JPJA 5CCXA 1TO2E 1YOBA 3OLVA 4EJ0A 2ZYGA 1ZD4A 1KSGA 3CRRA 1RM0A 3BS4A 4JA2A 5C0OE 2ZKIA 3ZE2B 4D6PA 5DNUA 4K6HA 3QLUA 1ID1A 1QWSA 4EPYA 5AVZA 3VZBA 2ZQYA 1G7TA 3A06A 3W5JA 1R18A 2EBFX 1LI4A 4G8BA 1GRNA 4XZ3B 4OFBA 1YS4A 3Q85A 1NNLA 4DKJA 4D1YA 4QUBA 1ECJA 1L4GA 4Q1FA 3A28A 1PQPA 3QVWA 3QZ8A 1G66A 1WL8A 3QQPA 4R69A 3RIGA 4BLSA 4RS4A 5L9XA 2DPIA 3LRPA 4DCSA 3SFVA 3EHEA 3LYUA 2ZBRA 3PBKA 1L7AA 1Y6JA 5CUQA 1V16B 4YAWA 3W5BA 2W6PA 1M7GA 1U6KA 4NONA 5FPPA 1JXMA 3NT2A 2NVUA 4FOPA 1TWAA 1S8OA 4C78A 3GQVA 3KZOA 1SA0A 2OPHA 3LF1A 3GJ0A 2KLBA 5F5NA 4JU8A 1B8OA 4YXWA 2H08A 1ES9A 2BY4A 3ESZA 3FDZA 4GPBA 4KYIB 2IPNA 5I7UA 5KQGA 1Z17A 3U3DA 1K3TA 4CMFA 2HSDA 1KEEA 4JWKA 4BLUA 1GTVA 2ZSJA 2AT1A 3MUNA 1E1KA 2BI7A 2UVDA 3ZV3A 3QP9A 1WQ1R 1ZXXA 3QKSB 1WMDA 4ZZ2A 1K8YB 3O8QB