3ETHA

Crystal structure of e. coli purk in complex with mgatp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3ethA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3ethA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ethA01
2SCUB 1JDEA 1Z2PX 4M98A 2CQYA 2VQDA 1M6VA 3TW6A 2P0AA 4IHJF 5C8YF 2V59A 2W70A 4FU0A 4FFOA 4O86A 1VKZA 4HR7A 3U55A 3WO1A 3ETHA 4ME6A 5GONF 1IOWA 2NU7B 3KAKA 2I80A 3TIGA 1I7NA 5JVLA 2R7LA 4E4TA 3V4ZA 1UC9A 3AW8A 1GSOA 1KJQA 4HNTA 1C30A 3JZFA 3R5FA 4O4LF 1A48A 1CQIB 4TV8F 2XD4A 1AUXA 1EZ1A 3JRWA 3I12A 3WO0A 3VOTA 2ZDQA 1BXRA 5LA6F 4O7SA 1T36A 3N8DA 4IWXA 2R6FA 1W96A 2NU6B 3JRXA 3HO8A 4Y8VB 1B6RA 3Q2OA 5JVDF 4MV1A 2R87A 4O4HF 4XYMB 1JKJB 5DMXA 1GLVA 1JLLB 2I87A 2YZMA 4HNUA 3ORRA 2R7KA 3R9RA 4EA9A 3U9SA 3SE7A 5BPHA 4GGMX 3VPDA 4MV7A 2Z04A 4EG0A 3R5HA 5CB4F 5C1PA 4IWYA 2W71A 4O81A 4O7TA 3LWBA 3N6RA 5I47A 2YRWA 5JH7F 4XZ3B 1E4EA 4IZOA 3JZIA 3WNZA 2V58A 4C5CA 4O2AF 4FGRA 2CNVA 3GLKA 2YWVA 4ZQIA 2DLNA 1VBGA 2HJWA 3HBLA 3R23A 2GPSA 1JDBB 4MV6A 4FFRA 2OLSA 1B6SA 4MA0A 2YL2A 2NUAB 4EA7A 1EUCB 4FFPA 2R82A 4L1KA 1GSAA 1EYZA 1ULZA 4MV3A 3U54A 4O84A 4J6EA 2FPPB 3OUZA 2VPQA 3V4SA 5KKNB 2W6ZA 4QSHA 5JQGF 2DWCA 5EZYF 5LXTF 1KC7A 2GQSA 3DF7A 4EA8A 4O4IF 2CNUA 3KAJA 5IYZF 2W6MA 4HNVA 1SCUB 3GIDA 2DZDA 2R85A 2R84A 3U9TA 5HV6A 3BG5A 2VHEA 4FFNA 5CAEB 4YAKB 5LYJF 4FFLA 3E5NA 1BNCA 5KX5F 2FPIB 4YJ3F 4M9UA 1I7LA 4DLKA 3BSYA 4WD3A 3BSSA 3TQTA 4O7ZA 3VPBA 1CS0A 2QK4A 3UFXB 2J9GA 4ZOLF 3RUPA 1GSHA 4TV9F 2YYAA 3HB9A 2FP4B 5J2TF 4O7YA 1A9XA 3BSWA 5FNVF 2YZNA 1KBLA 3OUUA 1WR2A 4YAJB 1E4EB 2NPOA 1EUDB 3K3PA 4EGQA 2W6PA 4O7LA 3KALA 1AUVA 2QF7A 4I55F 5LOVF 1EHIA 4TUYF 2Z02A 1Z2NX 2ZDGA 3AX6A 1DIKA 3NUAA 3RFCA 5D8DA 2V5AA 4ZHQF 3VMMA 4XYLB 2R86A 5C1OA 4DIMA 3MWDA 5BMVF 2YZLA 1CQJB 3TIIA 1DV2A 2XCLA 3ORQA 5HBRB 5BPFA 1W93A 4YB8B 2GPWA 3RV3A 4O4JF 5K2MA 4YBZB 3LP8A 1IOVA 2GLTA 2I8CA 2X0SA 5CA0F 4YJ2F 2WYOA 2PN1A 2YW2A 4HQ6A 2CZGA 4EGJA 5J2UF 4I4TF 3MWEA 3Q1KA 4MV4A 4O7NA 3G8DA 4XX0B 3K5HA 3ETJA 1OBGA 5LP6F 2PVPA 3KREA 1UC8A 4RZQA 4MA5A 5JQWA 2FPGB 4O7RA 2W6OA 3QFFA 4O82A 3VPCA 2VR1A 1PX2A 1VBHA 4O7VA 2NU8B 4I50F 3MJFA 3RV4A 4O83A 2W6NA 4ZI7F 1GGOA 1KUTA 2ZDHA 2IP4A 1OBDA 1M0WA 1M0TA 4WBNF 1KJ8A 2PBZA 4M99A 1DV1A 4O2BF 2R7MA 1KJJA 2R7NA 3K5IA 4C5BA 4MV9A 1C3OA 2W6QA 4FE2A 4FFMA 2CNQA 2DIKA 5H80A 4NYEA 2C00A 3R5XA 2YS7A 3TINA 1PK8A 2FB9A 2NU9B 1KEEA 1KJ9A 4C5AA 4EAAA 3VA7A 4IIJF 2YS6A 2GQRA 4MAMA 1KJIA 4O7WA 4EABA 4MV8A 2YRXA 1CE8A 3G8CA 2YZGA 5CA1F 1Z2OX 2HGSA 4M9CA 3BFPA
chains in the Genus database with same CATH superfamily
2CZCA 2QZJA 1V8ZA 3CV3A 1ZXLA 4ALLA 3QVUA 4ECVA 1TCVA 5LWHA 2FRDA 3DT6A 4B85A 5G4KB 3AI1A 1I1MA 5FQNA 4EQZA 2QRPA 2WA2A 4YQZA 3MD0A 2EX4A 4BMVA 4B75A 4ZT6A 5T5QA 4B4KA 3UWMA 4MQEA 1T5LA 5IP9G 2XUOA 5JHGB 4DRFA 2D2FA 1KZ1A 5FBHA 5IKPA 3ETGA 2BZ1A 2BGUA 3LK6A 4RKQA 2Q6OA 2C4UA 3ETDA 3W4IA 5A4FS 1Y3CE 1VMIA 1XV5A 1V9LA 1S9DA 1Q84A 4YROA 3CBQA 2C61A 2BQRA 3ORRA 4UJ5A 2GETA 3SX0A 3HGMA 4NKRA 1KI1A 3CLSC 1OU0A 4JYZA 3QE3A 3Q9SA 1I6WA 1NE2A 1E0AA 4UUAA 1AZLA 2J3IA 4TQUS 2KWIA 2AJBA 1D4AA 4LWPA 2WZQA 4KHZA 2FAXA 2QDKA 1OGJA 2FK2A 1Z4QA 1XRSB 4FJ0A 2PZEA 1ICIA 2WPNA 3S27A 2BFCB 4HH4A 2PNJA 1CB0A 5KG6A 4PQEA 1IXYA 2REXB 4D9FA 1P8AA 2ZRFA 3GH1A 5E2AA 1JDBB 4B6EA 4D3DA 5JISA 4PSDA 3RADC 4ZCTA 4HOYA 3FF4A 4H4DA 4LSZA 2FQYA 4UMEA 4MCHA 1F7UA 3SNOA 1U04A 3W3ZB 4BVFA 3R8FA 3DTNA 4KO4S 3W8EA 5FNVA 4X3CA 3DZKA 5D51S 2JS7A 3I83A 3G0DA 3UBTA 5LOVA 2NN3C 1DXQA 6ADHA 1Q19A 3VJLA 1OLXB 4NY1A 2GAJA 1NXWA 1DC8A 2JDIA 2NPIA 4FFNA 2QTRA 2XB6A 3HEBA 3EZGA 3CLVA 1WL8A 4NBVA 1HFEL 5I01A 3CR7A 3FTDA 3WL8A 4RAOA 3KPVA 3BRCA 1NTOA 4OK6A 3T9BA 2HBYA 3F4LA 2R751 1Y6RA 1GCOA 1XTQA 2ZIUB 2NO9A 1RABA 1IQUA 1SCJA 5JNVA 3V4VB 2P5UA 3QXJA 4QQFA 2AXPA 2O4UX 5CFMA 1A76A 1O6CA 4ZV7A 5EQTA 3EARA 1SRQA 2PQ0A 3N40P 1FLAA 2FUKA 1VAJA 4CT5A 3A9WA 1D4FA 1XTKA 1P19A 1RM4A 1FW6A 3STYA 2D5BA 3E9MA 4QWDA 5IWCA 5T7BA 2JLBA 3V6JA 4CMFA 4BV2A 2CJXA 3WYCA 3TXXA 4EYQA 3VVBA 2Z83A 3V2GA 4PBRA 3NXKA 3TW4A 4QGGA 4ALMA 3QFSA 1Q3KA 5ANRB 3TPZA 1VM6A 5B1HA 3IDOA 3LX5A 4M54A 3M1LA 2Q4BA 1T1JA 5FFFA 3CE9A 4EI2A 1J2JA 1AK2A 1VTKA 3OP4A 3BIOA 1C7EA 3OF5A 2C77A 5KQMA 1C9KA 3B6ZA 5DGXA 3JY6A 4KACA 4C7OB 3CEBA 1E3JA 1Y8AA 3BC1A 2OGUA 1N2ZA 1FP7A 4QGAA 5BVHB 3GVHA 1B00A 2EW2A 2YVLA 4L72A 2VWGA 1J8FA 1G3IA 1BEEA 4IRMA 4ENQA 2ZWAA 5H80A 2HJVA 3UPUA 5LQSA 2HMYB 1JE1A 1G64A 4K9PA 3V1LA 1MVNA 1NVVQ 4H1UA 3U1BA 2MYUA 2GKGA 1Z4NA 2JLUA 3ER8A 3CF2A 3K9FC 2CUKA 1LF5A 4LS3A 2PX2A 3ZHQA 2FMTA 4QWEA 2O2JA 1OWPA 5LYJB 3RYTC 1EK6A 2PRIA 3OPXA 3GLHB 5EZ6B 2OXTA 4Q4CA 4HAWA 4KRYA 2KS6A 4C7VA 5C8YF 3IT3A 3N6XA 2XY4A 1ZD3A 1G8GA 2DOKA 1QFYA 1DZ3A 1YSCA 1IUKA 4QO8A 2ONJA 3WGOA 1HNXH 3I9MA 3TF5A 1N33H 5H7XA 1FL9A 3ZN2A 4YJGB 1JSCA 1F0KA 3CKLA 4GKAA 5JWHA 3W6PA 3ZY3A 4R1QA 1A9RA 4Q3LA 1MEEA 2AFVA 1DCTA 4HYKA 2ZRNA 3PHIA 3PJDA 2Q9BA 3DAOA 2OORA 2PG3A 1MVLA 3EIHA 3CVVA 3M1AA 4LVUA 4CTMA 1LJUA 2QJTA 3RHFA 3OPQA 5T14A 1L9XA 5AK3A 3NG1A 1CZNA 2C5LA 3C43A 3GBSA 3PPXA 3BZUA 2HO5A 2C8VA 2PGXA 4AG5A 4RPCA 4B3RH 1O0CA 3KKPA 4NG4A 4YPOA 5KNCH 4EATA 2H5EA 3RS3A 2B7CA 3ZWMA 2MINA 2FOXA 3SIWA 4LYYA 2HV8A 3OT1A 4KH1A 4O0LA 2QXYA 2XZDA 1OXVA 4QM6A 5KT4A 4GOMD 3GGDA 3DZJA 3P27A 1DNPA 3V4OA 4NPHA 1OT3A 3CUKA 2WWVD 3GI1A 5TT0A 1CIJA 5FV7A 1U0LA 4NOMA 3UMMA 3ZWYA 4CETA 4KODA 3KTAA 4BQEA 1EBFA 2V7XA 4P7GA 1CQJA 1DXHA 1SYXB 1QRUA 3AG5A 4MTCA 1OZHA 1YZGA 2V7QD 1NJ5A 2EQAA 4BTEA 1O4VA 2GM5A 4H6WA 2W8ZA 4AKEA 1EYZA 5KNBA 2AEFA 3ZLJA 3O8NA 5B2ZA 4LG1A 2GKSA 4G97A 5LB4A 1GARA 1G8YA 4F0JA 4X8OA 1Z35A 4JY7A 3DDZX 2RGNC 3QWHA 1K8RA 1CB7A 1L5GB 3VVCA 5E38A 5H3CA 1KMHA 2WLSA 2RGUA 3LHSA 1BNCA 1TJNA 3OIDA 4EW6A 2BI4A 4ODIA 4N41A 1OJ7A 4YRPA 1TYBE 1MW8X 4RZXA 3OSZA 5JT1A 4R8VA 2HREA 4IH9A 4EKGA 1AKEA 1FFYA 3PG5A 4J0FA 4DMKA 3LUGA 5TMPA 3CSDA 3BZWA 3O4VA 2RGYA 2YUIA 1JLKA 3LH5A 3WMEA 1XBTA 1JJVA 4AF7A 3QKSB 2H2DA 3RFTA 1RLUA 3KZNA 1AKRA 4AJIA 1RW4A 3Q3VA 1WVGA 2W43A 4UUMA 4M89A 2B21A 2V6JA 1BAPA 4DQVA 1A8HA 3DV0A 1V3TA 4R0NA 1QYVA 4MPJA 1DX4A 1P39A 5F4BA 4JROA 4OGLA 2BGGA 1LWNA 1P0PA 3T5DA 3W04A 4G5GA 4QPCA 4DJDC 1XNJA 3Q7TA 2G72A 3WFZA 4F06A 3TKYA 1FNNA 1KFCB 2CDRA 2OQIA 5DK4A 4MWGA 3GA7A 3ZWCA 2GN4A 3HL4A 1EP3B 4UTXA 4Z2YA 3FYTA 4Q9KA 2IOFK 3E9RA 3LCCA 5IN5A 3H2SA 3PVZA 5EIFA 2ZVJA 2UZ0A 2O2ZA 2Q2WA 3NHPA 3REQB 1Q50A 2DF8A 1P31A 1DRJA 4APMA 1Q1QA 3D5QA 1MABA 4RVCA 5TMDA 5JU6A 1BVRA 4YUXA 2UVQA 3EF1A 3SR0A 2H9IA 4E14A 5KPDA 1NPTO 4R54A 1YZTA 3BKWA 2RH4A 1I3NA 3BABA 5KFSA 5AVQA 4D9GA 3T94A 3FM9A 3GLTA 3O4IA 1SH7A 2P5TB 4XIFA 4FGJA 3BN3A 4DQ0A 1DGQA 2RHDA 5FUMA 4Z1MA 2XWPA 4GPTA 3I72A 4X65B 1JPVA 3SICE 4CRWB 4HDSA 1MC1A 4C9BA 4Y6OA 1T4GA 4GI3A 1G6OA 4JL8A 5KC9A 5HXAA 4CLRB 3FTFA 2P62A 4J9UE 4V0OA 2VUHB 3EPKA 3K70D 4QVKA 3PJFA 3K09C 2NO1A 2IHVA 5AJTA 3VDMA 4BWYA 3O2JA 1F9AA 1Q57A 1J0XO 4ETWA 2BL4A 2ZQZA 4WVFA 1Q3HA 1HYEA 2EJUA 1SHLA 3EXIB 3UY4A 4OM7A 1K1EA 4WINA 5ALRA 2AGOA 4E09A 2G83A 4CIWA 1QGDA 1FS4A 2XXJA 5LQRA 5M3BA 1T9ZA 1GKKA 5B3JA 3E05A 3GARA 1UKEA 4CYMA 3C3JA 5DZSA 3QEAZ 3DVAB 3S1AB 5CVJA 2XUGA 2Q3LA 4K5QA 3A9TA 3RRJA 4NCKA 2PMDA 1Z6XA 2EZTA 4JI8B 3C8UA 1UJCA 1GZVA 2XDQB 1SUSA 1GTZA 1FY2A 4BGUA 1OH6A 5CB4F 2AJCA 3O1HB 4GC5A 2Z08A 4E6NA 3GJ8A 1OCEA 1DMRA 2AOTB 3FUVA 3C5WP 3IVGA 4NTZA 3FLAA 4RGYA 2HPZA 3MAGA 3GLKA 4RQBA 4RPKA 3ISJA 4D4KA 4JQCA 3K9NA 2AJLI 2JJQA 2I3BA 4RH0A 4HX9A 3PWSA 4UM9D 4X5OA 1Z75A 3PB3A 2ZSHA 1ODFA 1QHIA 1HT0A 3JQ8B 1RYRA 1UKVY 1EGHA 3GNLA 1Y8QB 4NZNA 5JS8A 1AGYA 5DXFA 1JAIA 4RNOA 1G5HA 2ZYGA 3LQQA 4WNIA 4ZCLA 4F6RA 3GIPA 4UVHA 2QTCA 2AG6A 4WN9A 2VPYA 3AEUB 1QHGA 4ZOEA 1ZMTA 4PYIA 1CY6A 2NTJA 1Z15A 4MUFA 1QG6A 3E5NA 3FYDA 3B1WA 2ZIZA 4PYJA 2GCPA 3GFFA 1W5AA 2VK2A 4CKWB 1L7BA 4TROA 4JCCA 1K06A 4HRAA 3U7QA 1JHPA 1ULTA 3I6MA 3WSWA 1GUDA 3GBVA 4B17A 3TOVA 1XZGA 3TLEA 1V3UA 13PKA 1XWFA 3BCSA 2Y2VA 1TW3A 7GPBA 4JP2A 1C0PA 4PO3X 4N7JA 3G9TA 3A6DA 2B0CA 3I32A 4RVGA 1VSUA 1A50B 3UGJA 3COVA 3ACDA 2H1VA 1NWHA 4N7BA 1BRMA 3NGDA 4HL6A 3WAKA 1F51E 3OSNA 4WY8A 2Q3CA 3EC7A 4FS2A 3A31A 5J2TB 2BBWA 3K1ZA 5FT9A 1T0BA 3BK1A 3DWGA 2B7LA 4KSCA 3HYNA 5BYJA 2OK7A 1DO8A 4XIGS 4D3XA 3D2CA 5IM4F 3UCFA 4TMKA 4BRSA 4YP0A 3C3YA 1SBZA 3GVIA 3BFJA 1O94D 2BDTA 3CEPB 5AJVB 3SXJA 2QZ4A 2QRMA 2BMEA 1WMAA 1ZD9A 1Z2AA 7MDHA 4CNQA 4UCWA 1JQJC 4W4TA 1NASA 1QC5B 3PNMA 1Q0PA 3T9FA 3O8CA 3OTIA 4GE0A 4O5OA 3C3CA 1QK5A 5C8YA 3KD3A 4LHYA 2CNQA 5K0LA 1RWKA 5TRTA 5FDFA 3BHIA 1BYUA 1E63A 3TQIA 1HZJA 4EAAA 5GZ6A 2ZBRA 4P7JA 2WWHA 4XD2A 1GL9B 1K5DA 2Q21A 5EN4A 5HTOA 5AOBA 5JAUA 3UKOA 3UQ8A 2ERXA 2P3QA 3EYAA 1TJ3A 5G0UA 4X84A 2IH4A 3DFKA 4AQDA 1WMDA 4UD2A 4CHGA 5DAAA 2ATIA 1R8JA 5E9WA 1U98A 2KLBA 4BATA 4XEUA 3ZCRA 3AUAA 3OA2A 4KUGA 3NH9A 3NS7A 4E4TA 3ZCQA 4OO3A 5IYBG 2ZJ8A 2MSWA 2BN4A 1U3VA 4LGMA 2FPKA 1K97A 2Q6TA 5JJIA 1VSQA 1N6PA 1DCFA 2GLUA 4MIEA 4XWWA 1UP6A 5JXWA 1HX7A 2A8YA 1EB9A 3QEBZ 3USES 2XSZD 4MV1A 4RU1A 3KL2A 4LH7A 1PZGA 3DLBA 3KBOA 3R7LA 1IXKA 4TKZA 2GNPA 3D0RA 1AN7A 2AYZA 4E2YA 4PWZA 2F55A 3N2IA 4XQ0A 2Z04A 4HVCA 621PA 1WV0A 5B4TA 3HOYG 3T0IA 2QAJA 2ORED 3RDPA 5TS2A 4XZ3B 3H2BA 4QUKA 3HUDA 1RVDA 2IYQA 3L5KA 4LY6A 3P9YA 4HEQA 2NSHA 3ZWOA 3FCYA 1CRPA 1NQVA 3M6VA 1I13A 2NO4A 4B7ZA 2XIJA 1QGZA 2FMUA 1ZYUA 1B8PA 4R05A 5SY6A 4ECYA 4EG8A 5D5PA 2ZFUA 1EJ0A 3FWZA 1G0NA 4S3MA 3WAGA 2QVZX 1FXSA 2QN2A 3PRYA 1P3Y1 3O5AA 1BD4A 1O5IA 1U3GA 2XLBA 5EMHA 4IHQA 4A0GA 1E2PA 4ZOCA 5EI5A 1YZHA 1FTYA 2GQSA 2OCIA 2GO7A 3RFFA 1P9OA 4PSAA 3DH0A 3WP1B 2ZJBA 3GEBA 3ABRB 4LJAA 2R4TA 1J4AA 1A5AB 3LFUA 1SBQA 4UDYX 2YU9A 2EWMA 3PHHA 1XEAA 2YXEA 2UUAH 5BSUA 5SICE 2X6RA 3D6FA 2V7EA 4ZEMA 2D13A 2E4XA 4MTDA 1LPAB 3TDNA 4BZQA 4TMYA 3SF8B 3LQ4A 3IT2A 1PJ8A 3AERB 3RF7A 4R2LA 2ZRJA 4LJ7A 3SZMA 2Y2UA 5EE9A 3G5LA 1YRAA 1GGKA 2DHEA 4MRNA 1W88B 4WKGA 1COZA 2CVHA 1F17A 2PJRA 2OCBA 1OWLA 4G86A 4ZHQF 1XO1A 1DT5A 3PDIA 1NBOA 3R3YA 3AQIA 2IITA 1E4YA 3G85A 4XYEA 4OQ4A 3TB4A 1U8TA 3BIFA 4WAUA 1LC0A 3BXZA 2GBGA 1PFKA 3AB7A 3VR3A 2FUNB 3ZHTA 4O4JF 1L5MA 1UK8A 3GBPA 4YPVA 3HCPA 3EXHB 4RC9A 2PEYA 4YAIA 4KAAA 1CKMA 4DMRA 1Z5UA 4NBRA 3TMYA 4TMTA 4TVOA 4BCCA 2YIDA 5A5GA 5JNUA 3TZ6A 1CJMA 1H8EA 4B6PA 1V1RB 4KNVA 2VF2A 5TPWB 3UCXA 4HGOA 1RC1A 1D5WA 4HS9A 3E61A 4J9NA 3IG0A 1ZFNA 1MO2A 5BW8A 4QFMA 1Z0KA 2AE1A 2QMOA 3DVQX 1ML4A 3MFHA 2B25A 4LA4A 4GOOD 4FYYA 1RXUA 4ED1A 3FNHA 2CF6A 1YC2A 2Y1LA 4GPD1 3VOSA 1SQFA 3A37A 2BP7A 2FX2A 1CYEA 2X1HA 5HE8A 2YWDA 1UBRS 3T35A 4TZ0A 3MZ0A 4GOKA 4RM2A 3AR7A 2X23A 1FVOA 4C5AA 1J70A 4D96A 3UFBA 2VUGA 5J3JA 5T41A 2XKAA 4X1IA 2G04A 1K8YB 3TNYA 2PANA 3DZHA 3SU8A 2RAUA 4O3PA 3H6HA 2ZBDA 5IH3A 4F4JA 2W2PA 1LDYA 3KYBA 5JNWA 2LBPA 3PENA 4HAZA 3WV5A 1Z0JA 2WQ6A 1W36D 2IIBA 5IRCD 4MJXA 1T3LA 3OZBA 4ZYLA 2WB2A 5FPKA 1IBCA 4A3GG 2PSSA 3VSDA 3P94A 1TFRA 5GONF 3EZFA 4DQNA 3LMKA 2J32A 1NY5A 5B3AA 1XALA 2OCKA 4NK4A 2RGGA 4DDVA 5HPYB 1DJQA 3IO5A 1G8MA 4O8CA 2R44A 2I4LA 1VFPA 5LQCA 5CB4A 3OD5A 2I2XB 4OXKA 3IDAA 5BN4A 6CHYA 1NQUA 3CEMA 4E2FA 1DQSA 4XFDA 1YB5A 1E1LA 5EJIA 4L76A 2HBQA 2JGDB 4LWQA 3IT0A 1H2ZA 3MCZA 4GT1A 3KJGA 1FSFA 3LYUA 3KHLA 1W4ZA 3SE7A 3HRKA 3ZVRA 4HEA1 4G65A 3E7DA 4Q4AB 5CLFA 1SXJA 4UBJA 3WLOA 4WKNA 8LDHA 1J8VA 4U7TB 4V0KA 2DYKA 2BM0A 1YB4A 4ZCRA 1UPCA 5SYAA 2RI0A 3F47A 2GPTA 1RE0A 3G8YA 1XXHB 2K7FA 1NUQA 5I9SA 1AQJA 2EL9A 1BJRE 4LJRA 3GOQA 2K5UA 1DDIA 3ZLBA 4GGOA 5HF6A 3ZKAA 2YCLA 1SVNA 1PNOA 3QVMA 4L5BA 1KVTA 1A1VA 3DDWA 3DEIA 2BLLA 5E7IA 3GDWA 5B55A 1BOFA 2ALZA 3R7SA 2J3LA 4JI6H 2P6PA 1HUQA 2O3JA 5MF6A 2EJBA 3UBMA 4HMQA 1OPRA 1WOYA 1E8MA 5JV5A 3OZCA 3ZTYA 2CW8A 4IDPA 4GWLA 4I3FA 4YLEA 3P1JA 2GBFA 4FCVA 3RGZA 4I9NA 1ZGGA 1C7FA 3TSAA 2R93A 1P29A 3RUPA 1L5OA 3PJGA 2VKTA 2A30A 1XTSA 4EYIB 2CFTA 3R44A 1IH8A 2C58A 4LFAH 4R8UA 4CL2A 1PR9A 2WJWA 3ZWQA 1T5HX 3ZDDA 2HHHH 4JHLA 3DAHA 4LF5B 2OP0A 1EP1B 4Z4IA 1NMZA 1VL5A 2PDAA 1PDOA 5IM4A 2C54A 2K2WA 3C3WA 1FUEA 4NATA 5EMLA 4BNIA 4B48A 2X5OA 3IP5A 1U2DA 1VZ2A 2QS9A 2VRBA 5B4VA 2YHBA 1W34A 1O96A 4NBLA 5JARA 4RD0A 4HWGA 3ZGZA 3EOAI 2HRCA 4TV9B 3RC7A 3LBIA 1FSZA 1NIJA 3DQQA 3CG0A 2ZYIA 4YV2A 2ASLA 3F6EX 3RVKA 3T9DA 3F6SA 1K1QA 2I65A 2XECA 3E1KA 2B69A 4MGIR 2XQIA 1J8MF 2X13A 3QMVA 5IAJA 4TL6A 2FR0A 3H8WA 4U2BA 2PMEA 2FRVA 4BQIA 1X0XA 1BMQA 4UUNA 3IAS6 2DPMA 2KBFA 2HVQA 5JZOA 3ZJYA 2WM8A 3DMTC 2GCGA 2XMDA 1KSHA 4J49A 3K0AA 3F8SA 1HYGA 4P36A 3PXEA 5JZSA 3L7KA 3GOHA 1XZFA 1QFMA 2A59A 4QA9A 3Q4GA 4BC0A 2HADA 2D3TA 2P7HA 3BEOA 2R4QA 2XC9A 4Y2QA 4BVHA 4KUHA 2OBYA 2ZCUA 1ZP6A 2YS7A 2OGWA 3TINA 2HF2A 3NCTA 3K20A 3VPGA 2I4IA 1NDQA 3RUHA 4LJLA 2QG9A 1KOFA 1NQAO 1UIMA 3EJ6A 2H9YA 1QR6A 5BXYA 4XWTA 5I4KA 1ZIDA 1Q16A 3PCRB 4C4TA 4ZYTA 2SCUB 3OQJA 1TFUA 5HZKA 2FFAA 2ID9A 2E2IA 1K27A 1FYDA 1XTVA 1T0JB 2Y67A 1DB3A 2JAQA 2JPDA 1KQOA 2M1XA 3HR4A 4FCTA 2X8AA 2UUCH 4QIWE 1VJRA 2UKDA 1I7NA 2YJTD 2XIQA 5EVJA 3N2LA 4RCVA 3I2YX 2QJWA 2HU7A 3V4ZA 4PYRA 4HQNA 3TZEA 1XMJA 2H4XA 1WUKS 2ZBUA 3VHQA 4BVKA 1PTJA 3L0CA 4WUTA 3H0CA 3GFRA 1N5DA 1EZ1A 2ZPUA 2OLKA 4AUEA 1ULUA 1V35A 4LJ6A 5L51A 3HDQA 2CGEA 4KKVA 4C20A 1NFQA 5CVDA 1KVRA 1JLLB 1EFCA 1P6QA 3WBJA 2BKEA 2BFEA 3PFGA 1Q1NA 2VFAA 2OT3B 2X9GA 2QD3A 1YS7A 5IUJC 3NC0B 4V2IA 3TLBA 3KWJA 1S5PA 3WB9A 3CEHA 1MBZA 3L0IB 5C1PA 3CF4A 4A0FA 2ZAOA 2VI5A 2R92A 3LOQA 1XZEA 4JLNA 3E9NA 1ZD2P 4M8SA 2XQKA 4PLVA 2HVSA 4JYBA 2J9XB 2PLAA 5L8VA 4DR7H 3PGA1 1N0UA 3L0DA 3BXGA 5CB6A 1JQEA 2W4MA 3BREA 3V80A 3E9QA 4ZDWA 2P4SA 1YQ9A 1N0WA 2FWIA 1N1MA 5EKUA 3ZDZB 1A77A 3QVTA 1JQKA 5KOJB 1QPBA 4GX2A 4BX3A 4C0QC 4PYLA 3GROA 4BKPA 3QMWA 1ILEA 4EHIA 3QK7A 3AUFA 3C7AA 1WCIB 1K6EA 1TUIA 1V7PC 3FUWA 1Z7WA 2IHBA 4DLKA 3EVCA 5KSWB 4OHVA 4YMHA 3GP3A 4TLBA 4R0MA 1A9XA 1UFRA 1SUDA 5FH9A 4DR2H 5JWOA 3UH1A 2VHVA 4O4JA 2YWHA 3UMGA 1IHUA 1WBBA 2EBUA 4KO2S 3F8NA 3Q2IA 3SJAA 2BONA 3A32A 1FTSA 3SQLA 3KJFA 4B2LA 1VJ1A 1P0IA 1RI5A 1JSRA 2I4TA 1H5QA 1ZLXA 5F7ZA 2PYDA 1SUAA 2O03A 1QMPA 3ZJUA 1GYQA 4ZCSA 3BE6A 1DQNA 4Y2UA 3IE1A 1KRHA 3E82A 1JKFA 4G9GA 1FDVA 4FNOA 3C16C 4L51A 1VE7A 2C04A 5DNAA 4IRDA 4RYLA 4PZDA 4CUZA 4RZ2A 3JQRA 2JIRA 1H9CA 1DC3A 3RUIA 5JMWA 3PITA 1A9SA 4R71A 4OFZA 1O8BA 1QBGA 1RC8A 1WMBA 1ACJA 4X7BA 2XCQA 2UYGA 4A6DA 1DZIA 2PBFA 2YVUA 4FM9A 4G5XA 2I1QA 4I1VA 3ICVA 3FDFA 2XA1A 4C7MA 5AM3A 1WTAA 3RV4A 4L08A 3TJRA 3HEMA 4AG6A 3FJ1A 1V47A 4R8KA 3CF6R 1M0TA 4MQ4A 1HL3A 1RXCA 3AESA 1PG5A 3NJRA 3TRDA 4ABTA 2XMGA 2P3SA 3NTRA 1PJRA 4HBZA 3T4EA 3O1JC 1NLFA 2O8CB 2ZUEA 2WJ3A 1N1EA 5AKLA 1FBTA 1O9GA 1DLJA 4JLDA 4K9RA 1W73A 2EBWA 1ABBA 4CMEC 2O7QA 1E98A 1FP6A 3RTDA 1XIVA 1OF1A 5L3ZA 1CUIA 3MTJA 4N82A 2C84A 4ROTA 2J6CA 5JS1A 3RSHA 1R6BX 1XCOA 4KVZA 5E6RB 1YBMA 1JTFA 2ECFA 3NJ4A 4ZEXA 1MX9A 4EQ5A 1G42A 4LDAA 1N32B 2MSDB 3CLKA 2FPOA 4YK7A 4CL0A 2VHQA 4KZKA 1HA3A 1YTLA 1YBAA 1UPFA 2NWQA 1H65A 3ETHA 2VAPA 5FR9A 2G09A 2JF0A 3TZBA 3WGMA 1JDNA 1HFJA 3RRNA 4UM8B 1US8A 3HYCA 1VHLA 3OHAA 2FZGA 4KXYA 3FCXA 4LZPA 3W6ZA 5AI0A 3B2EA 2AFIE 4RJIA 3S40A 2XB2A 3EAQA 2CBGA 4GSYA 4KQXA 3OUTA 2R6FA 1PNQA 1Q91A 3I23A 3DTTA 2QRHA 3L8DA 3A4VA 3BQ9A 3VZSA 4XYMB 2W9CB 1GUFA 3NOOA 5DISB 5DBHX 2RH8A 2AKAB 2J0UB 3HZRA 4S1TA 1M1YA 1U31A 4YAKA 2VO1A 3IYLW 1UP7A 3O2NA 2JAOA 2QRNA 2GT1A 4RD4A 4KR6A 4I9FA 2NNLD 3HU1A 5FOTA 1QYIA 3BQ2A 1KWGA 2J3JA 3EVBA 1RP7A 1T5BA 2HXYA 4C0HA 3W9UA 2XVYA 3WFJA 1VKHA 2HJ9A 1VJ5A 5CT5A 4R1OA 4JB0A 3ZGNA 1CY0A 1X1AA 2Z4RA 1SD1A 3GLIE 1JVBA 5GJVC 2OBBA 3OP1A 5CFLA 5KNCD 4MR9B 3ZBPA 1D4ZA 4OQDA 1SZCA 1ZZEA 2J0QA 3AJRA 2BQUA 3R6GA 3LL4A 3KEMA 5KFYA 4RNNA 1KDTA 3GA0A 1ZINA 2ZIFA 4EO7A 2QM3A 2PSEA 2NW6A 2ADFA 2ZQYA 1EUCB 4RJJA 2XKBA 2O2SA 3QJGA 1RKQA 1G8PA 1QZZA 2IHJA 3EWIA 3FN4A 4NBUA 3VX4A 4OAPA 3AETA 3JPYA 4EB6A 2HDWA 3DO5A 3UGQA 3WGNA 4CKZA 2I2WA 4FMDF 3TI9A 1R9GA 4JJ6A 2IIQA 3A6EA 2RKOA 1ESZA 3PYMA 1PR3A 3OH8A 5AK4A 1WEKA 4L2IA 4ENUA 1GQQA 2CJWB 4RKFA 1Y1PA 1XAHA 2A9JA 2QVLA 1M83A 2Y77A 2V1XA 4M38A 1Q7RA 4NCAA 1VHJA 3UZUA 4B6RA 4HTFB 3CM0A 1MA3A 4C2AA 3UXHA 4FDTA 4RHUA 1KI8A 4KH0A 5FUYA 3OOJA 4DDKA 1RPZA 4G4GA 4EYSA 2BFMA 1OGYA 3F49S 2JEIA 5KMGA 3IKJA 2IEDA 2V4QA 1YVDA 5H9WA 4RTOA 1FQOA 4WBXC 1TUBA 5JALA 3IP3A 1YRQA 1W2GA 4ZVNA 3PUKA 3P2IA 3SFZA 2WI8A 4RY9A 2CLSA 3A6GA 5BN1A 1W93A 3USZA 4DLLA 5ALGA 1KEUA 3TQSA 3Q0EA 1XNRH 4ISBA 2WYOA 1RRFA 1Q12A 5G4KA 1WXHA 3OFKA 4KWIA 3CE6A 3KEQA 1IQRA 3PUXA 3E15A 1S96A 2W6CX 2Q6LA 3U4CA 1G59A 4XX0B 4JI2B 4KK4A 3I2HA 5ELXA 4A4DA 4AQYH 1A2OA 4H7KA 4RHXA 3ZCXA 4Q93A 1EWRA 3SOPA 1KO5A 2OKCA 5IBPA 4DR1H 1P1FA 4NIMA 1QYDA 3MB5A 5DYTA 1SZDA 1NJ8A 3UICA 4TX1A 2XGOA 2H16A 5CW1A 2ZDHA 1YE3A 4QXAA 3H1GA 1M0WA 1D7OA 5L7TA 2Y05A 3I64A 1NJFA 3HP4A 3M3PA 2M6KA 4UHJA 4Q3BA 4NYEA 1IVYA 4Q05A 2WYIA 2VDWB 3HTXA 3F9IA 3O74A 3VC1A 1H1TA 2GD1O 1QKIA 1EG7A 4D4LA 4IGEA 1BX1A 4INZA 5FLXA 3NATA 5EJ5A 5JMTA 3TLKA 1J0EA 1V5IA 2NYRA 4Q7MB 1FDSA 4V39A 1SQ5A 3Q7SA 3PT9A 3RAEC 4E5YA 2VXOA 1FJXA 3HNPA 4WLEA 2YOHA 1B3RA 5G3ZA 2BFCA 1BFUA 3G7NA 1JV2B 2Y0SA 4GOLD 1CJVC 4WCFA 2IYWA 2F90A 3N6VA 1GSOA 1ZM3A 5AW5A 5A5VA 3V1UA 4EI8A 4D25A 5KYXB 5KJEA 2WC1A 4H7DA 4BV3A 5HF8A 4TRMA 4MDHA 4JVSB 3ZZ0A 3AUJB 3SD7A 1Q15A 3PVCA 4LFCB 3HU3A 2O2DA 4H2DA 3FJOA 2XB8A 3FD8A 2C0PA 4RHFA 4CV3A 1A9OA 1XP8A 4RF5A 3BZBA 1NDHA 4EGFA 1OIWA 1DXYA 5DX1A 1E9DA 3DFIA 1HZZA 4NMLA 1E4GT 5FBLB 4HNUA 1DCMA 4RSRA 1TWCA 4QYIB 2OB2A 4K86A 1A2BA 1XXLA 1W8IA 4J16C 4R9UC 2RIPA 2HY7A 3I6YA 5AK5A 2GK4A 4HCJA 1YRLA 4ZANA 2OD7A 2A0XA 3HKCB 4B6JA 2LDXA 4AWAA 4MR7B 2ZSIA 4A10A 5F9MA 1NE7A 3UHFA 4E5VA 5HKOA 4LOKA 2WYWA 4UATA 3DJFA 2VZ0A 5HQ3B 3AHCA 3QRWA 1MT0A 4G0YA 2IEGA 1ZC3A 2ZI4A 4KZPA 1Q2UA 4GECA 2F3SA 2V55B 4W7IA 4DCGA 2XV1A 1G3UA 2GRJA 2QUKA 4H0CA 4EHJA 3DEZA 3BB4A 4CM1A 4LHZA 4ISCA 4YR3A 1SM4A 1PJBA 1N5IA 4J0GA 3WB2A 2WWGA 3OC0A 3UN1A 3N0TA 3UG7A 2F1JA 2FPRA 4F3YA 1O6ZA 4P83A 4JR1A 2CF5A 1XF1A 1S2LA 4PYKA 3URMA 5ECYA 4MP3A 2PLRA 4TLEA 5LU8A 2ASDA 3RUEA 5AOAA 3MHPA 1QZ3A 1KYZA 3OX2A 2UAGA 2A57A 3OCCA 2OYCA 221PA 4L6AA 1NKSA 2G4LA 3I4LA 2F4VH 1ZNYA 4YECA 4C7OA 5J2TF 3FGOA 5A3RA 2WD7B 3QWUA 3EUEA 3KLOA 2X6TA 1H22A 2IPAB 3OZWA 1C3XA 1OWMA 4IVPA 5BVHA 4FSHA 3ZY5A 2WIJA 1OBHA 1WABA 1JDVA 1OC2A 1J0AA 2JAXA 4MRMB 4OQXA 4IHAA 7REQB 1LZKA 3B9BA 4UU1A 5FI3A 4CIAA 4GBGA 3WG9A 2Y1EA 3PNQA 3WK6A 2W2NA 3TM5A 4Q47A 2XF2A 1LVUA 2QYSA 2ATLA 1B43A 3I5AA 1KKMA 3GLHA 5JDCC 4LE0A 3R41A 5I8PA 3IVRA 1HEYA 3TOZA 2ZIEA 4DBZA 2ZVPX 5K4AA 3LQYA 4L0DA 3OJ0A 4RKYA 3ZTWA 4D99A 4YAFA 3ZXIA 3EPHA 2J7KA 1L7MA 2GEUA 1SPBS 3MOGA 5KFAA 1ZAKA 4ERNA 2I1LA 2MSEB 4R2XA 4A1OA 5AVJA 5KO2A 5FADA 1M2FA 3HGQA 5F64A 2BOVA 1CDZA 4YI5A 1XD8A 2HA2A 3RUAA 3JQEA 1O0BA 4GVPA 2AUTA 4OUKX 4ZKDA 1YRBA 3KFXA 4OX9H 1JDZA 1VPTA 5IJWA 1PFGA 2A1TS 3HN7A 2I29A 2AG0A 3KEFA 3K92A 2VBFA 2WF7A 4N8EA 4AYBE 3BJRA 1JKXA 4X60A 2F2TA 1CNEA 3QPAA 1IY1A 1XGKA 2XB4A 1Y9ZA 3HYLA 4XVUA 1J21A 3GLQA 2J7PA 3RVMA 4A8JB 5IANA 3ROZA 4LX0A 2GFQA 2QB5A 3ZJ5A 1XTBA 1VDZA 1LRLA 1Y6FA 1KJNA 1JVSA 4UNIA 3KCQA 4UQOA 4IYJA 3ENVA 3I58A 4ZI5A 2I54A 4X20B 3RYHB 4ME6A 1IOWA 4IH4A 3C41J 1SHZA 3RAQA 2PU5A 5J9FA 3HGTA 2QM0A 2RG7A 3L7JA 1FNSA 1U1IA 4BXOB 1K0FA 3GGJA 3RU7A 2YJNA 2PUVA 4AMUA 4DQXA 1H9BA 4XB1A 4CR8A 2GJ9A 3TIXB 5AI4A 3EUFA 3UT6A 5I7HA 2P9JA 3JWEA 3GFQA 3A05A 2UUBH 4S24A 3ZD6A 3E3LA 1M6NA 2WHXA 4QT0A 3U0VA 4FGZA 4A91A 4A92A 4IIDA 3V4FA 3KPJA 4FS3A 1KFJB 3IAM1 4JGIA 1SURA 5KFCA 1HY3A 5DCUA 4YWHA 5E6SB 4UM7A 1WW3A 4Y6PA 4YJFA 2HQBA 5AUNB 4JP3A 3ZI0A 5FA5A 1WDLA 5FO0A 2XYVA 3U9LA 2A35A 2FK7A 2UVDA 5BNZA 5JZ9A 4QAQA 1ZJWA 5LCXA 2QZPA 4ETNA 1Y1TA 4UBOA 4IR9A 3VPSA 4R1MA 5L3QB 4EG1A 3QKSA 3D43A 3SYNA 2X41A 1KO8A 4NE7A 4D42A 2OLJA 3DEAA 3RASA 4BKQA 4ZZIA 1NPDA 1D0IA 4RZIA 3FOFC 3J7AC 1K89A 2AU0A 2DTEA 1KEWA 4QYTA 5ER6A 4FFRA 5C8XA 1JALA 4BLSA 1QS0B 1J99A 4YP9A 3ZWPA 1IULA 2DEUA 4LY0A 4MYDA 4BNYA 3IQGX 2WUGA 2ZKIA 3S68A 1TU4A 2D54A 4G89A 4BFVA 1LNSA 2PV0A 4S05A 1G3QA 2WIBA 2VXBA 3MT8A 3F6BX 4DNXA 1QGUB 1XMVA 4YV0A 4LOIA 5KQPA 1NF2A 3GCGA 2VYND 5A03A 3QSGA 3K9GA 4KVFA 5HM6A 2AV6A 4RQTA 3OFSA 5BSVA 3REQA 2HDNB 4NOLA 4ED9A 1W4CA 1JS1X 1C7JA 4JYCA 4ZRNA 4YMTA 1XRNA 3CO5A 5G0TA 4ZAGA 1SU8A 1MG5A 4Q0MA 1K7XB 2GN6A 5KTSA 5K8JB 2ZIWB 5KFGA 4QEZA 4B6OA 4X62B 4G6ZA 1OMOA 2IE8A 3H4BA 2CV1A 4EPXA 1TRKA 4WKCA 1GAXA 4JKYA 2ES4A 1XMOB 3P5BA 1PT9A 2N3ZA 2QUJA 2R86A 4LF7H 2WFMA 4NZYA 1X1EA 3M9NB 2LTAA 3IMKA 2O5CA 2AB0A 2I2DA 4JI4H 4LPSA 4GL4A 1GGVA 3GEIA 5LLSA 4M22A 2QMUA 1VBMA 6Q21A 1UF9A 1XELA 2EEZA 2YVQA 3OBBA 1TK9A 4ZVRA 3QVSA 3GMIA 4LGYA 2PZAA 1Z5ZA 4CLRA 1WD5A 5HCIA 2I4OA 2VDNB 3V55A 4KNWA 1RWQA 1JLRA 1N8TA 1VGVA 2EGHA 2WWYA 3GEEA 3QX3A 4R5MA 3R1IA 4MPDA 3W3AH 5TNXA 4AKGA 2DPLA 2NZXA 1V3QE 5GJWC 4B82A 2VQFH 3T38A 1QU3A 3EXIA 4MYCA 1BCRB 4YQEA 2VPWA 4E12A 1M34B 4XJVA 1WZCA 3ZCUA 1OBDA 1Z36A 5E1OA 2IOYA 1AF4A 3M34A 1KETA 4BNTA 4JYAB 4C4XA 3IQXA 1D1SA 1LTKA 4KXUA 2JLXA 4AS2A 3DVAA 3S1AA 3MTBA 2EGGA 5DHAA 4L02A 2VYVA 4V0RA 4MVJF 1RTKA 4A16A 1O4WA 3QOYA 3L05A 4IIJF 1FFEA 2QQEA 2XDQA 4GOXA 1XZQA 2IEZA 2AQIA 1UJ4A 1II8B 2D7JA 1M1ZA 3A3OA 5GINE 1HPLA 4ZXPA 2OUIA 1L6RA 5CITA 3OTOH 5F7OA 5DNDA 3ESYA 5F1KA 1BXZA 4C0KA 1JTVA 2IEIA 1M5TA 4UE2A 3FPFA 2EIHA 2OY0A 3MCAA 4WLNA 4GRAA 5WRFA 4LZAA 1A4XA 4LTNA 1W52X 2OZVA 2I67A 1MC4A 2DY0A 1ZISA 2HIXA 4DRZA 3TFQA 3JQ8A 1CZLA 4RK5A 1NVVR 2CHGA 1W0KD 1OZ0A 2KHZA 4BO3A 1Y8QA 2GUWA 2VF7A 1H2RS 5IU6A 3L8HA 1S2MA 4R1NA 2PMZA 3CY6A 4G8BA 1V1MB 1P1CA 1NNLA 1KI7A 5DWVA 5ELMA 3PJRA 4PLZA 5ALXA 4KL8S 1RBYA 2A3RA 1C3OB 1W5EA 3AEUA 5EJ8A 4CG2A 4O63O 3RPEA 2I6TA 3CSWA 1Y5RA 1IBLB 3F67A 1PR4A 1NNEA 4QDXA 2JA8G 4CKWA 3PVXA 3TGLA 3DD1A 4UUQA 2C2WA 4C1NA 3KQSA 3IA2A 3FPKA 4LNHA 4B0PA 3GTLA 4O2LA 2VPZA 4G0PA 3FDXA 4XQGA 2AYXA 4TSFD 3PLNA 1S0NA 1NSYA 2CFOA 3C7CB 3L18A 1BTOA 4FW9A 3MBIA 2CCJA 3WMFA 1Q5PA 1L1FA 2EZ4A 3CPJB 2YL2A 1NY6A 5U4XA 2PEZA 4DJJA 4JNCA 1JU9A 5A7HA 4DANA 3JCZA 4BNXA 3QKWA 5J2TA 4AD8A 5LKAA 4HFMA 5LZ8A 1N9GB 1MH9A 2CL5A 2JJ2D 4S1NA 4X94A 2WF9A 4L22A 3FYCA 4YHHH 3RR2A 1QJCA 4DV7B 1AZTA 3ELBA 5I7FA 5BRAA 5F9NA 3IVCA 3GXOA 3T1NA 4YRZA 1L4GA 2HLDD 3AOEA 3T4PA 3EGVA 1D1QA 4DF3A 2ZI3A 5LFAA 2WJPA 2JHFA 2ZSFA 1JE0A 2QI9C 4JBLA 4UMVA 2RC6A 2ZRKA 1UWLA 4TV9F 2P9ZA 3HB9A 4Q0YA 1KBQA 2WVHA 3SYMA 2Y6UA 4EY6A 1ZGZA 1F1BA 3OUUA 4YRGA 4BMDA 1QC5A 2BGJA 1AKVA 4L27A 4H6PA 2A9OA 3QH4A 4DLYA 4WXRA 2FE3A 3D1VA 1RP1A 1GSIA 1GL3A 1Y1RA 4JUAA 3V8PA 4UFOA 1UBSB 1JR2A 4ZC8A 2I34A 3N0RA 1CWUA 4Z0PA 2HPVA 1ZUIA 4HAOA 3TEJA 3BTVA 2WHYA 2HLPA 4JLOA 3I61A 3AG6A 4G0WA 3G88A 4OBBA 3SEQA 5DGIA 2YMLA 4FOPA 5G4LA 4H1VA 4EBBA 1P7CA 4OB6A 5A4KA 1Z3CA 3GQBB 1W5FA 2ZWOA 5C7IO 4C76A 4QD3A 1TADA 4Y1RB 3BHNA 1BE8A 3QPCA 5JCJA 2IZ5A 3NALA 3HWX1 4L07A 1IG3A 2JD1A 4X1KB 2GK6A 5AK0A 5DM4A 2XTNA 1Y1LA 2R7ZG 2BZGA 3W7VA 2YXNA 1Y6QA 2I9PA 3CURA 1S03G 4OIMA 3OZDA 1EFLA 2VH1A 1WETA 3WBKA 1P7VA 4HGRA 4KX5A 4Y6QA 3SKXA 3L04A 3EBOA 2VJCA 1M0EA 4X61A 3H86A 4IIHA 2QTFA 1Y7LA 4CMDA 3JZAA 3DDCA 1DKOA 4Q5IA 4I8IA 4KTVE 4AY6A 4LXIA 4N48A 5AKHA 2QY9A 2Z09A 2B63A 4YCJA 1SG0A 5DBFA 4AMBA 3VDNB 1T3NA 3H9JA 5EHXA 3S3TA 2Q4DA 2YWRA 4F12A 4KIFA 3UGTA 2R8YA 1QIKA 1CX9B 4XUDA 4TTVA 1ODSA 3NW9A 1E9FA 4UEKA 3UKJA 3PTAA 3GMTA 3PA8A 4DUZB 5KSPA 5CM2Z 5BSHA 2F43B 2JCYA 1B1CA 4MICA 1EDZA 4L9WA 3OT4A 3VOTA 3VPFA 2B4YA 4L3WA 4D7AA 4U9UA 3AVUA 1RYDA 3IUYA 4U5XA 5BV8A 2XTJA 4NENB 1QXSA 2HUPA 3DB1A 5I6DA 2DY1A 3GAAA 1HYBA 3O4JA 1ODIA 1XKLA 5B7QA 1OX5A 1PS9A 1NUTA 1E2JA 2IF0A 3MWKA 1JYEA 1AA6A 1OW3B 2WVGA 5BPHA 4GGMX 2UVRA 3GVXA 3KQPA 3EEBA 4NICA 5T4BA 4GC9A 1N6OA 3LPDA 1B04A 3G2LA 3INRA 3SF8A 2F17A 2R6DA 3C7TA 2Z43A 3KHGA 2GJSA 1YIAA 3WYEA 4QGBA 4RZHA 5LLTA 4FLEA 4FB4A 3AW9A 1WZIA 2B8TA 4PNEA 1EK5A 1S2OA 1W88A 3BDAA 3WXMA 3W2IA 4C2MA 1XZLA 4JB3A 1OFIA 4IDOA 3BH6A 1XPUA 4ZHSA 3FSJX 5KREA 5GIOE 3E7PA 5IKEA 1EM8B 3K8ZA 5I9LA 1VIAA 1H0KA 3IRUA 3TZCA 1Z5PA 3IVXA 3QBDA 3EXHA 1FJ2A 3L8YA 5KKNB 4H0NA 4QSHA 2W4IA 1UMBB 3AY3A 4WFJA 4AAYA 2B2XA 1GADO 2ISCA 3RRZA 4F21A 3AJDA 3BTSA 1R6AA 1H5UA 3L1VA 5I7OA 5TPWA 2NO5A 2P27A 2PD6A 1TAGA 4S1VA 5THKA 5EJ7A 4F2PA 2HUNA 3MTQA 3TUZC 3URKA 5F33A 5BWWA 1KYQA 4JVNA 3MRSA 2MSKA 4I1OA 4RS3A 3ZE9A 1VKOA 4XQEA 2FP4B 4HN4B 4BIMA 2V4UA 4R9SA 3OSUA 4LMRA 1E4EB 1EUDB 2ZUWA 1JL3A 1MJ5A 1VBKA 1YUBA 3GUZA 2DFLA 3W5DA 3EVAA 2B4AA 1E77A 2XF8A 4X71A 3IEKA 2IGBA 1Z22A 3EEFA 2VP0A 2RGBA 2JLCA 1VG9B 1Y9AA 3TIIA 1JT9A 4OB8A 4COOA 2HZBA 4A3IG 4GNRA 1D2HA 4LF9H 4FBUA 1X1RA 1PFVA 3U7GA 5H3HA 2QEQA 1QB8A 5BQ5A 5AW7A 1GCIA 2ZJTA 5C5JA 3CZ5A 4HGYA 2BFOA 1NBMA 5T6MA 4K3UA 4DV0B 4BLRA 4MVJA 2AFHB 5EEHA 2RB5A 1EBUA 4RZ3A 5JPCA 4IIJA 4FDLA 3HKZA 1CR4A 2GZ3A 4FYPA 1NAHA 4YPFA 2JAUA 4EJ2A 3WZLA 1CS4C 2VF5X 4PWQA 2CDNA 3VZQA 2WUVA 3TI7A 2V96A 3QE4A 1D04A 1JPUA 1DV1A 3LDUA 2GXQA 1T91A 2UV8A 2JGDA 5HGXA 3CSSA 2C96A 3L4JA 4LZWA 3MWDB 5DNWA 3PW2A 5EWFA 2P68A 1RYFA 5HK8A 4RZUA 2PV7A 2BSQA 5LWQA 3AYHB 2GCIA 4ZVSA 4U1RA 5KYWB 4HDOB 2XNSA 4GEKA 3ETEA 3ZGVA 1G9SA 2C4HA 2P11A 4L5CA 3MTAA 1SHTX 2YV5A 4KQ6A 3AKEA 3TCNA 2V59A 1T6BY 4O3QA 3WIVA 1XXHA 4NCNA 3WR5A 1JRLA 2XUQA 4Z7QB 3AVWA 1NVAA 2OO3A 4AY5A 4L8LA 1JXMA 2CNLA 1AA9A 5L6MB 4LUCA 4ZPXA 2QX7A 1YO6A 1ID1A 3TLXA 2C59A 5LM3A 3H5NA 3JRWA 4GKJB 2VK1A 1AV6A 3KVNA 3HUEA 2C7GA 2XUHA 4PANA 2CLFB 3EGIA 2JLSA 1MAVA 3W6OA 1F12A 5EWMB 2H2GA 2G70A 1JIXA 1FU7A 3SCZA 2VJPA 2H48A 4KBGA 3RHZA 2H5IA 1ZD8A 1N25A 4TL9A 1Z13A 2R5FA 1WB4A 1YCHA 4CZ2A 1H6AA 4CHIA 2INGX 3NBAA 1MFZA 4NBWA 4UCRA 3KWMA 3WBFA 3IE2A 5U1PA 3WL4A 4FFBA 1SOMA 2JHGA 3Q8PB 3PVSA 1GZHB 3AHEA 1VYUA 3ZIDA 1G5QA 4DUGD 3SX4A 4WADA 2E1RA 5EERA 4KXVA 2R1VB 5JCOA 1S9FA 1NM5A 2JA6G 1NBIA 1CERA 3PUJA 3CMCO 1S8NA 1GEGA 1VKRA 2CNOA 4H31A 3DYVA 2I9KA 3ES9A 4TV9A 3SMQA 4BO5A 1LY1A 3ER6A 4A3BG 2FH5B 1JAXA 4JWKA 3RC3A 3KHKA 5DF1A 4QOFA 4MLZA 2RHOA 5FOUA 5BW5A 1SCUB 2V1UA 3U9TA 5C8VA 4HLUC 4B3FX 1KEZA 4NCHA 1MC5A 1CY8A 4HX2A 1SC3A 1SUCA 1LNQA 1W48A 4TQSA 5K0TA 1ZSNA 1YC5A 3UAYA 1ZOPA 3R0IA 1RADA 4O1IA 3KUXA 4CQNA 1DPFA 2WKWA 4BMYA 3ZU4A 4HVTA 4NMXB 4J3JA 1KBLA 2G80A 3L40A 3INYA 1WHSB 4R2KA 4PX3A 3R7BA 4TYPA 4HNRA 4U6QA 3PRKE 4PHCA 5DGAA 3BICA 5DCWA 3HM2A 1SVUA 5CLLA 4KXWA 4MWZA 2UZ3A 1SFRA 3TGPA 1S3IA 5CTJA 4RK6A 5FPTA 5CPFA 4CMBA 2WSLA 3GFTA 5JI2E 4MINA 2O48X 3LE8A 4MX8A 2VS1A 4YO8A 2YDXA 1GUAA 2KI5A 3EWNA 4I3HA 2BHLA 4FUQA 3AY7A 3VR6H 5TLSA 1Q44A 4L4RA 3SQNA 2Q4OA 4BLTA 1RQ7A 4R2IA 5BVGA 1T26A 1K7CA 1NAIA 4FUTA 1KP2A 1I2CA 3GCDA 1O77A 2EP5A 1Y7HA 2JIBA 4Z3KA 2OZPA 1UMDB 2BKLA 3G6YA 5AM5A 1BO6A 4BO9A 3U5TA 2I22A 1ZA2A 1T9AA 4HV4A 2BISA 3IPCA 4JP1A 2UVVA 1Z18A 4O2AB 3E9ZA 4D56A 1QVAA 3U40A 3G9UA 3AEKB 3OT5A 1B2RA 3WSTA 3KVRA 3DR5A 1EDDA 3WNDA 1UFVA 3NBFA 3ZV6A 2QP9X 3HCDA 3U3XA 3OEEA 1JLLA 4YUVA 1H3NA 3LLMA 1BE6A 1IJFA 3LD9A 5REQB 1KARA 5SZIA 2A9QA 2P91A 5AI9A 1A27A 1XDWA 3WGJA 5BWBA 4RMNA 1AKQA 5KG0A 4M98A 4EB8A 1WB5A 5DRTA 3ZNQA 1EX1A 2UZAA 2GXSA 2NXWA 1Z8DA 2HT1A 4OV6B 3RLFA 1MQSA 3W4KA 1VKZA 1FS5A 1Q11A 4FONA 2LZ0A 3HO1A 1TZ2A 3IOBA 3BCUA 3VVMA 4UEQA 3A1WA 2BGLA 3NOVA 2Y1GA 4J43A 3NHMA 2KQUA 1UJMA 3DTVD 3K6KA 1OV6A 4GAEA 3JVUA 3YASA 2OLEA 3ILVA 3O1IC 3VAZA 2O59A 2AWNA 1FB5A 1EA5A 1Y8CA 1U3UA 3OY7A 1CV2A 5KOJA 1RYZA 2NP6A 3S70A 2O07A 4DRYA 4RY8A 2LV8A 3HBAA 4PV7A 2G0TA 1IUPA 4BFSA 1B26A 4ZQFA 4PZLA 4TOIA 1WCIA 3WWPA 4AZ3B 1U11A 4DLRA 2P9QA 3H04A 1LSOA 1QIIA 4YREA 2IKQA 3P32A 1DAPA 1E9SA 3QEKA 2JFGA 5M2QA 3KOMA 4AC9A 1Z25A 3R5HA 2B99A 1NYRA 4G1BA 4OLJA 3S2FA 4KR0A 3UEOA 3TK1A 3SR3A 1JHMA 5KUTA 1ZUHA 1Y3AA 3AF6A 1L5ZA 1T2AA 2IODA 1I0ZA 3RNOA 2G82A 3TSCA 2GBLC 4D46A 4YALA 4AY4A 5L3RA 2E0IA 5CDTA 2WSIA 3MLEA 1PNVA 3LSYA 3UMCA 2ICAA 1C41A 2RI6A 2EP7A 4D6PA 4O2BB 4G07A 1QYWA 4EEQA 3T5PA 1Y8RB 1ULBA 2VJYA 2VTKA 4ENWA 4FBTA 3OWOA 5DT9A 2ZE5A 3ZIAD 3E0XA 3QX9A 2FPPB 1SO8A 3WJ7A 1P6UA 3EIWA 5FOQA 2X8JA 3D6AA 8AT1A 1QIJA 4LSMA 2EFDB 4WOPA 4FWIB 3CRZA 4BVBA 5KNLA 3IILA 5F3RA 1L0BA 2L19A 3H40A 1OBFO 2E21A 3FHCB 1FUKA 5LYJF 3PQ8A 3R6WA 3HZHA 3SFTA 5AIBA 4KFUA 4QVIA 2OCPA 3IR5A 1FJGB 2IYEA 3V42A 3ADKA 5HNKA 4N9WA 1AX9A 3W5JA 4O7YA 2A14A 2HQOA 2WB1E 4QUGA 1L5WA 4Q6WA 2XH8A 3RK1A 3C24A 1Z0FA 2J5XA 1G2OA 2VDUE 2XOEA 4OHYA 2FUG6 2EWVA 1FTNA 4JJ7A 5EAIA 2JCXA 1EAYA 2J87A 4MQMA 4B4DA 3D4PA 5T6BA 3D6HA 2O8CA 5IT4A 1GVHA 3O6VA 4ZU3A 1M8PA 3MLAA 1GGEA 3SFVA 1SXGA 4DABA 2TMDA 5LZ2A 4Y2PA 2VN8A 4EVRA 1GYPA 4UNPA 2HTFA 4BLPA 5HKKD 3HVKA 1UEXC 3PXGA 5E6RA 2R66A 2E49A 3DVRX 1DSSG 4EELA 1ZWLA 3H2IA 3DW3X 4EUNA 1EFAA 1V7CA 1JHZA 3BKXA 4QELA 1MZPA 2J31A 2FVYA 3EF0A 3F3KA 4DCUA 4BVLA 4GLFA 3BH7A 3ORYA 1Z06A 2FA9A 5CEJA 5ALFA 5JZBA 1PJSA 4QGHA 3ZK9A 1QWSA 1YA8A 4KDCA 1LSJA 1EUQA 3NHLA 1J5XA 2DJ5A 3PI7A 1GPYA 4XYMA 4D9JA 2W9CA 1EEXB 5DWQA 3EA0A 3NNNA 2JK1A 3JQFA 1ULHA 1JMYA 1XVIA 2J0UA 2FZWA 2VWPA 2W6IA 2VSXA 3C14C 5K2OA 2VBCA 3BD8A 4KYIB 2IYTA 1TKRA 4JLMA 3GDEA 4A9AA 2V54A 3EF3A 3EAGA 5B6JA 1DWOA 1ZH0A 1VYHA 4Y2JA 1VKNA 3RU2A 4X91A 1XZJA 1MB3A 2G9NA 4BZXA 5LD2B 4Q43A 3R7FA 4MR9A 1MJNA 2DUMA 1B15A 4WZAA 3GAMA 4OQPA 2L42A 1CRLA 1K63A 1EJ2A 4KQFA 3E18A 5GP1A 1PT7A 5HZGA 4RNMA 3BORA 4Y3UA 2GM4A 1EUCA 3EPPA 2HNBA 3GLGB 3LUHA 5DHTA 3LCMA 1C9MA 3H2HA 2COUA 4Y2SA 2XVZA 2GPAA 5KWVA 5IEBA 3JYOA 3BH0A 1K9VF 4E08A 4DUPA 1F2VA 3N7UA 2C9MA 1DRWA 1T6YA 2MYNA 4P53A 4AY2A 2CJWA 4CKEB 2XVAA 3RTEA 1N5MA 5HIKA 1DAHA 3EIXA 4OHXA 3GEGA 2V97A 4TQRA 4H18A 3CMMA 1MJGM 4U7CA 3QPWA 1EKFA 1W7AA 4J7CA 4ITVA 2IU0A 3U60B 1XR3A 1R37A 3PUHA 4CTOA 5I51A 4C6HA 4CLHA 3OPYI 2GA9A 4KLCA 4Y2YA 4DLNA 3A2KA 4G3IA 1KSFX 1R6VA 2C2KA 1IHDA 1IM2A 3COYA 1C8LA 3PLAE 3DL7A 1QRTA 3BMOB 3FCSB 1A5SB 3TQOA 4MWBA 2GEDA 3TIVA 5E2IA 5C4IA 1G6KA 4PBCA 4MUBA 4EBCA 4OYLA 4YXWA 2PUHA 4QU0A 1SUIA 3AR5A 1AB6A 2AI3A 3KKOA 4I14A 1MQ9A 1HI9A 1V41E 3OUZA 1JFLA 1XZPA 5I5UA 3LT0A 2CE2X 3KWFA 2ACKA 4LC0A 1L7XA 2FZVA 1Q6YA 1RYHA 1EFTA 4J03A 1YQXA 5K8CA 4NS1A 5T4EA 3WWEA 3KAJA 4H1HA 2HWXA 1V7QA 1R0KA 1BMFD 3ITDA 3AILA 1Y7PA 2VVTA 4ETSA 3SYKA 5IN4A 4JENA 3LS2A 3L1JA 2CYAA 4DHEA 2Q6VA 3DHYA 1XOIA 3B8EA 1Z83A 5E1DA 1RR6A 3H1PA 2HWWA 3K1TA 1OE0A 4L5YA 5K03A 4C7KA 3D6JA 3S44A 1IIRA 2PWPA 3AVTA 3LBYA 3D8TA 2QN7A 3GVCA 1NVTA 2VDWA 2E4WA 4X00A 4URUR 1ONPA 2XYRA 4QHSA 3DFUA 3MBOA 1Z47A 3Q98A 4Q9DA 2PUJA 3SHFA 3FMFA 1FMTA 1QHEA 2ZSBA 2ZT6A 4ZV4A 2FEWB 4IGKA 1UL1X 1U7UA 2C0CA 5BNFA 3H1TA 1HXHA 2PMWB 4I1PA 5HJ5A 2XCPA 4II7A 1T1SA 3OECA 4GZMA 4POOA 4NZMA 2A9FA 1E58A 1WULS 3DKVA 1Q7CA 1FMCA 2JVJA 3BD7A 2E87A 3PW4A 5KYXA 2WVJA 2Q1WA 3S8MA 5JTTA 4W9MC 3MR3A 4BZZA 1JH8A 4I6EA 1F6BA 2OAGA 4C04A 2A5FA 2ID7A 2XRYA 1IBKB 2FLVA 2XADA 4B3XA 1XQVA 4ZK6A 3W3AD 1YZ3A 3H20A 1OLXA 5E95A 2JARA 4Y9TA 1JA1A 2NACA 5CGQB 4ND1A 2YJ4A 2P9YA 1ZGCA 1EAMA 1SEIA 4J1TA 4DIDA 5K3FB 1KY2A 3GJXC 4ANFA 2TRSB 2I6GA 2ORYA 4P4SB 3C45A 3L01A 4ZTZB 4QYIA 4B7AA 1XQYA 5CP8A 3KJHA 4QO7A 1V6SA 2QSJA 3HPQA 4K9LA 2D0DA 5JZVA 2Q0HA 3I2GA 3Q7PA 1PUXA 4Z0HO 3VU3A 4DV5B 5CDYA 1R0XA 3OFNA 1UDRA 3HKCA 5DBEX 4UXHA 1NQTA 5D85A 4YRFA 4MR7A 2DT8A 4FB5A 1RHMA 3G0IA 4E4RA 3IOMA 2ZJ6A 3FXAA 5HQ3A 1QV7A 1NF3A 1E8DA 4N01A 4M87A 3G2JA 2NUBA 3OTGA 1RHUA 4M9XA 4HNTA 4TVSA 4LDRA 1N5RA 1U9IA 4ZO4A 4WV3A 4KGDA 1QQTA 4D3YA 1CF9A 1YCDA 4LNAA 4O7SA 4GP6A 4OXXA 5EQFA 1T8TA 5ICSA 4OHOA 3G6KA 3G17A 2QIOA 2JGMA 3LKDA 3EZXA 1HE3A 3WKBA 4RSGA 2P2DA 1KC3A 2NT3A 1J49A 3ETNA 3MPOA 1QANA 3H2YA 1QNFA 2C1XA 1S4MA 5EIWA 4OLFA 4EG0A 2PM8A 1MOZA 3ZK7A 2R62A 2J30A 5CLGA 3JR7A 4BJ1A 2HF9A 2WD7A 2W7TA 2UYQA 1PSZA 1JXOA 1CRWG 4ZI3A 3BWVA 2ZIVB 3CUYA 2CMFA 1ZN8A 3GILA 1TIKA 1N0IA 3P4UA 1FRFS 1HNWB 7REQA 4M46A 1HMPA 2VDOB 2CWWA 4J3FA 2QBYB 5LSAA 4A6PA 1MEJA 4QE3A 4MV6A 3D7KA 1WKBA 1AVTA 5LYJA 1N5KA 4G0ZA 2OM6A 4EJ0A 4QUDA 5BW6B 5EJ2A 2ZU0C 4CBVA 1F8YA 1YJ8A 1FFGA 1N9ZA 2WTBA 4CN8A 5LJLA 3PC4A 4YRRA 2XUZA 2DG2A 4D80A 1Q0QA 5DNCA 4K81B 4C89A 2BMFA 2AG8A 2O52A 4TZ6A 1WDWB 1GZ4A 1GZDA 4UZFA 2C98A 4YJGA 3VV3A 4ZTBA 1X1QA 4X8HA 2QMHA 1LPPA 2OUKA 2QX4A 1GG9A 1XLWA 2XOKD 1NXVA 3HSYA 2WF6A 4EF5A 5EKSA 4L9SA 4IY1A 2UXBH 1SU7A 3U44B 4P2GA 4X9XA 2BGMA 2H4HA 2WU3A 1A04A 2HMSA 3CB2A 1P0MA 2DFNA 4MUXA 2JI4A 3MG9A 1UK6A 1RRKA 3R2JA 1QP0A 1L5YA 2JEYA 4UCFA 5DP1A 2PZFA 4MVWA 1ZOLA 4EDFA 2A5JA 5DKFA 2OHHA 1QPZA 1E9RA 1XF9A 4PO1A 4NFLA 4GI5A 4A8JA 1GGMA 3TVDA 4MI1A 3MINB 3MJVA 3W79A 5JSQA 3FOCA 1A1SA 1LLFA 2CK3D 4YV7A 1ISRA 1X1TA 2ZAIA 4GM0A 4YCBA 5CM9C 1I2LA 2XEXA 3F7TA 4ZVPA 2PZMA 1N6KA 2XUAA 4D0LB 5PNTA 1N34H 4X20A 3RYHA 2ROQA 1NTRA 4KN5A 2BM8A 2IQ5A 2VHWA 4MYTA 3GD7A 1KMCA 4BXOA 1NW8A 4BNFA 2WWWA 5AHRA 4N3CA 2PLWA 1MAHA 3OCVA 1KK3A 1KZ9A 3T1HB 3TNDA 1F20A 3QG5A 2P7IA 2ZXUA 4XB2A 1CUZA 1L3BA 2VAWA 4CCWA 2GEVA 1LA2A 3EC2A 4M86A 3ZI7A 1TYZA 3UATA 1X13A 2GERA 3IHTA 2OAP1 1IUNA 5TT1A 3NGLA 1YHNA 1Z0DA 4K9KA 1GNRA 5E6SA 2C00A 5KVCA 2AOVA 3RH0A 3DTYA 3T15A 3VNNA 4BU1A 1KZYC 3I30X 1JHVA 5SZJA 3PBKA 1GRCA 2V4MA 5LLDA 4B3TH 2MJLA 4E5PA 4X54A 4UHEA 3INGA 1O6GA 2GPJA 4YJHB 5T67A 5CR9A 1A9TA 2BEVB 1Y1VA 3E03A 1NVGA 1DAIA 1M33A 3HHEA 5L3QA 1S8AA 3A4MA 5ALOA 3V1MA 3ZQKA 2BMJA 5C9ZA 5K45A 5FRDA 3BQMB 5FKJA 2F1RA 1O95C 4MMXB 1CNMA 1U0HC 3ZVNA 4YT4A 2DVMA 1D03A 4OOEA 1TVKB 2Q7OE 3TW8B 4TYWA 2QNBA 1QS0A 1B0AA 1HNZH 4C2TA 2AR9A 1A48A 1XDDA 3FOAA 2CLOB 4EJ6A 3PEVA 1EUYA 3G1TA 5JNSA 3AY0A 3H9UA 4CIDA 4XB6B 421PA 2PL5A 3UIEA 1ONSA 2FEXA 2O8NA 2FSVA 3PGJA 5FBRB 4WLVA 1QGUA 1JEQB 3AR8A 4DREA 4EHNA 4WUVA 4MS1B 5T3YA 1TJ4A 1RC0A 5F2KA 3IP8A 3SQXA 1ISGA 3FPGA 3K9WA 3QW2A 3C3KA 2AI1A 1WUJS 3SSOA 1N8KA 1WPRA 1KYXA 1I3KA 2H7YA 1DFHA 3LVFO 2RKBA 1JIKA 1ZN7A 2ZETA 3DXYA 4TS1A 3RK0A 1T8YA 4YIHA 2WF5A 4XM1A 3AIIA 1I2MA 5IASA 2OL4A 3FYUB 4ES6A 3N6RA 3PQ4A 1JEOA 1NZJA 3QLUC 1TMGE 2BIFA 4OXYA 1U2TA 4G0XA 3TEKA 2OXEA 2UXDH 5JCXA 4F56A 1F7VA 3MBKA 4XPIB 4EUEA 2BWJA 1QDEA 3G5AA 4KIWA 1QR2A 2B4RO 4BNWA 2H7VA 1FSSA 2BD0A 5DLGA 3RBEA 2LPMA 2P3LA 2BR0A 4R83A 1M2VB 2JJMA 1MJFA 5A4AA 4F4YA 1Q6ZA 2BBOA 4B32A 4P31A 3FOBA 2Z1NA 3OCXA 3OD1A 1L7QA 5I9NA 3LDGA 3TB6A 1P7ZA 1ZM7A 3V4SA 4A3SA 3ITKA 4HAXA 4LY9A 4OKNA 2NP7A 4DV3H 1VRCA 3MWLA 3DO8A 3GJ3A 1YK0A 4D45A 3HQ4O 1XTIA 3MJDA 1C9JA 1OBVA 1FYXA 4NS4A 3O83A 4ASUA 2W6MA 1N3YA 3WOVA 1EDEA 4JOSA 4Z53A 1DKPA 2H17A 4Z9FA 4AZ0B 1N78A 3WGLA 4WD3A 3EDCA 1D1TA 3D7RA 1BCRA 1JQLB 2DQSA 1L5HB 1F2TB 1LDEA 1M34A 3X2EA 1LB1B 4DE5A 2ZRCA 2M6RA 4B40A 1FQKA 2PA0A 1FFHA 2J6HA 4PVDA 3O8QB 2QN9A 2VA2A 4BMCA 4G85A 5JYEA 3GPIA 4JX9A 2O2EA 5JAHA 2BTOA 2VJMB 4P1ZA 1BHO1 2BZ0A 1HLPA 5IJ0B 1V48A 3R0JA 4K2HA 1XU7A 1II8A 3AM3A 2DQYA 2AOTA 1GPMA 2J08A 4DC9A 2YHUA 4WK2B 1LBTA 3L0ZA 3DDOA 4GLLA 4RD1A 1IVNA 5EIBD 2OO5A 4U7DA 1UDCA 3TLGB 3OBIA 4PZ0A 1AUQA 4GD3Q 4W6QA 1BMDA 2PSDA 3OCZA 4YH1A 2IJGX 3ILSA 4HRVA 4OHFA 1SIUA 3CNQS 2BR3A 5CT4A 1KAEA 5KWEA 2P0EA 1Z82A 1CK4A 3EAFA 4ZWNA 3KKEA 4EBDA 3ZVMA 5ICFA 1NXSA 1PKXA 5F51A 2PT7A 1Z6GA 1AOXA 1JIQA 5BMVB 2JFQA 1Q95A 3AF2A 1VPEA 1QVVA 9ATCA 2BJHA 2IU4A 1V1MA 2Y9MB 3P9RA 3IPYA 4IZIA 4QBHA 1QWOA 3PEUA 1EGAA 2BI8A 1C3OA 2I7DA 1T4MA 5KU7A 4HH1A 4A2AA 3ZDBA 4LZOA 5F7XA 4DEXA 4QSMA 4BBZA 4ZAZA 2NU9B 4L4XA 2C2HA 3KE8A 3DZBA 3M33A 4PC6A 1Z34A 2IYZA 4D0SA 2P75A 1UC5B 5LNK6 3JWJA 3G6WA 1TJ5A 1A3CA 1X42A 3EBLA 1L8XA 1Z2PX 1KVQA 1SMKA 4FZVA 2WT9A 3W90A 4BE7B 3TTWA 4A2QA 2PO7A 3VNQA 4AZVA 2EAUA 2Y1CA 3DSRA 1DE0A 1BWPA 3S29A 1GTVA 4XJSA 3WO1A 4AUMA 3CEAA 1NW5A 4JI7B 1MR3F 4UCVA 1CQWA 1LPNA 3SS9X 5A3JA 2UXCB 2C7RA 1VPLA 2QOEA 4W5WA 2HF7A 3LHKA 4LWOA 3PGVA 5A6VA 5HE9A 1GHTA 2QMEA 3N8DA 1KVSA 3CZPA 2RBGA 3LPCA 5KTRA 1D6JA 1TF2A 3HU5A 1N9GA 3R9KA 3PF8A 3D8RA 4DA4A 4BEBA 3L9XA 4I0WB 2XMQA 5CEEA 1U90A 4KR3A 4F3KA 3IL2A 2OBFA 4B3MH 1JX6A 4X1OA 4WXEA 1C3LA 4JI1B 5HKAA 4LMAA 1Y34E 1KKUA 3U4GA 3IKLA 4DAEA 1R5NA 3I1JA 4EHBA 4AZWA 2BRUA 2X77A 2PYIA 2PH5A 5LUAA 4LRUA 3V4LA 4MROA 4DLVA 3PNBA 3DBRB 1VE5A 4XR9A 4EO4A 5EUBA 1XA3A 3WY9A 4F45A 1YBVA 3IQDB 1T5SA 4EL0A 4K9QA 3DT9A 1HLGA 3L4BA 4XWGA 4AP6A 3F5SA 2HIHA 4X7MA 4WMLA 3IHWA 3R6LA 1OI7A 1Q3TA 3SEAA 3GLSA 3NT5A 2UU9H 2GPSA 4BO2A 1WU8A 1EXDA 2HRDA 1U9ZA 1OY1A 3H5RA 3G6VA 1ZRMA 4QFBA 2CMDA 3ZYCA 1F06A 4MCJA 4KO1S 2P41A 3GQBA 1WPQA 4U9HS 2BSXA 3PNKA 1IMJA 4Y1RA 2A1UB 3LUBA 4TKLA 3VBCA 3CR8A 2HBZA 4KTTE 1Y3IA 4BY1G 521PA 1NW9B 4QJFA 4GZ3A 1C7RA 2QT9A 3I5XA 4MNTA 3EVZA 4MB6A 3KB2A 3ZY2A 1D2CA 1JF8A 1EFHA 3FWHA 1G4HA 5CLQA 2D8AA 4O6VA 2JGKA 1P72A 2IOHA 2VZLA 4JJ4A 3OJWA 2VPIA 1MDFA 2VA9A 4KNYA 4QOIA 3EVEA 3K70B 2OMEA 3MMXA 4KWEA 4ECQA 1XN1A 4PTZA 7MHTA 2J41A 4FT4A 2GYUA 3WV4A 1SC1A 4MULA 2A0YA 1WXDA 2XITA 1G8FA 1MH1A 2ORVA 3Q1LA 4PE5B 1XAJA 1PW5A 4DJTA 1ZS9A 3KSDO 2FK3A 4BQRA 4RPIA 3RSLA 3UMFA 3HCBA 4XZ3A 3TL3A 1NW3A 3LK7A 2CLKB 1CJUC 1KH2A 3K0FB 5AW9A 3AF5A 2VSQA 3MHTA 4MIKA 3HP1A 3ZCSA 1GFWA 1ZGBA 2Q1YA 3M89A 1Z7BA 4C0WA 2PKQP 3CRQA 1VL1A 1KY5A 1TZCA 3KQHA 4XLLA 4Q18A 3MNFA 1G9TA 4GRDA 2MYTA 3VR6D 4MV4A 1XZMA 1RJRA 3CISA 1RIIA 1ATIA 4CFSA 4X3OA 2CLLB 2ODWA 4LSGA 4P34A 4Q12A 5DJ5A 5KB3A 1OFVA 4FGWA 3HDVA 5IDWA 4E6PA 2F43A 3NBZB 3W1WA 2YWFA 2WJVA 1TAEA 2RCNA 3FZEA 5E6UB 2XGMA 1U9CA 3R4VA 4CM7A 2Q50A 4TRNA 4UVIA 2B92A 4DQDA 4IR7A 3DEFA 4G25A 5BT8A 5B3KA 821PA 2O8VA 1KSGA 3GIQA 1I7PA 5DTEA 4CC6A 1NQWA 4FE2A 4FFMA 1BKDR 4FINA 4REMA 2JFUA 4UM9B 4LEIA 1XPOA 3G3EA 1DU4A 3KOOA 5CVCA 5F2EA 2A84A 4RJ2A 1Z88A 4R1TA 3IH5A 4NZPA 4KSYA 3TLYA 1NRIA 4MRAA 4RY2A 3CJTA 5KSYA 4L57A 2JCVA 3AERA 3C3XA 3AK4A 3C6QA 2VUSA 3GF4A 3F0TA 4KN8A 1CUEA 4I9UA 3CNBA 2NXJA 3TTUA 4LV5B 3M5PA 4Z4GA 5GZ1A 3DZDA 2FN8A 3A1TA 2IYVA 4OAOA 1RI1A 3PEWA 4DYVA 5H0IA 5A1TA 1ZBQA 2D8MA 1CNFA 4J91A 5D3QA 3DT8A 1VLLA 2IV3A 5HM8A 4TWAA 1L4KA 3ZQJA 2AG1A 3GY0A 4MW0A 1EM8A 3F2IA 2Q41A 4YASA 1Q83A 2CL6X 4PRLA 4CCSA 3U56A 1AUXA 3ECSA 1NMEA 5CA1B 3A14A 1NU8A 1W581 5C1BA 4Y9DA 5EY5B 1V1RA 4YMGA 3O92A 1GGJA 5AK6A 1U2EA 3TCKA 3WKCA 2Q2VA 3KHHA 4IRCA 2B82A 4C3OB 1SOVA 4RX1A 1XK6A 3FTNA 1UKYA 1B2LA 4GPBA 5JRJA 1M8FA 3RU3A 4R01A 2CXSA 4Q9JA 1CRQA 2FP4A 1TXGA 3HV0A 2HG8A 3H5LA 2X0NA 5K8VA 2PHZA 1H8HA 1E0DA 5A02A 1SHKA 3G2NA 1E4EA 1WA5A 1EUDA 3FAZA 3K0SA 3PI6A 2B8EA 1AKMA 2JJ1D 3EHDA 1FVIA 5E7MA 2POQX 1DC5A 2KLHA 3D8BA 3NIWA 1N3IA 2F00A 3M2TA 2G9RA 5MN5A 4G2TA 1OZGA 5CYOA 1JIIA 2Q8NA 4HFRA 3ONVA 3P2YA 1OASA 3GJ7A 4RKWA 5B58T 4JMLA 4ZQHA 3KEOA 3PUVA 2PPLA 3AL2A 4PW0A 1CRZA 4UCOA 2QW1A 1W19A 5A62A 2VF4X 1SQGA 3GIJA 3B9QA 2WFAA 2WAQA 3S2UA 3VDRA 4AO6A 1K8QA 4BWGA 1N2EA 1ZLYA 4R7ZA 4B73A 1P2SA 2H59A 4BNLA 1IY8A 4HUJA 2QTBA 5CXSA 1U6IA 3TZHA 1IBMH 2C5SA 3DR3A 4LJKA 1YD7A 3WGZA 2J9GA 1N5LA 1L5NA 3KXIA 2XE7A 4OTZA 2C9YA 4C4PA 2Z6AA 3H5TA 5A9TA 2JVKA 3E9YA 4O7LA 2CNWD 1EZZA 5EGNA 1EHIA 1J9ZA 3DZFA 5AUOB 3VR2A 4RU9A 1BKSB 4KBFA 4Q4HB 3STTA 3ZU2A 4YWJA 3F3MA 2F9LA 3CNLA 1ZVKA 3MCTA 1Y63A 3AEYA 4Q4AA 3MWDA 4AUKA 4JUCA 1KA9H 3LLUA 4U63A 3HCNA 1GO3E 3GRUA 2JA2A 1CD5A 3MMNA 4QC2A 4E2WA 4OQNA 5KJFA 1N36B 3O91A 4IG9A 3KWLA 5KYWA 3PC7A 4H7JA 4EPRA 2XLCA 3JPWA 4K6KA 4YRCA 1GT91 2YW2A 1N6NA 5IK2A 3IIKA 2FDXA 2RH9B 1J2EA 2PCJA 2GD0A 3NVKI 3G59A 1BJTA 3TMKA 1Y7TA 1II9A 3R77A 4OSOA 3SI7A 1GV0A 1WW2A 4WZZA 1YB1A 3WK8A 4AYWA 4IEIA 5EINA 1O08A 1N2BA 4BGEA 5K20A 1UFOA 5IAEA 1D0VA 2NQ8A 3NHUA 4U2CA 3TZLA 4PRKA 4HVLA 4O83A 1SXJC 2HVRA 1WSCA 4IF4A 3OFJA 4H08A 1GTRA 4JEMA 2PZLA 2LCQA 5EWMA 1E3QA 1T2DA 4ACAA 4GO1A 2CBXA 1E6EA 3KZXA 1SKYE 1NUPA 3L3BA 2VRCD 1E3SA 3ET5A 3GLFE 1NN5A 1V2HE 4Z4CA 3N9IA 4W5OA 3A3PA 4M9CA 1GU1A 1PJTA 3ELYA 3ZLVA 1TKAA 4PG8A 3AZOA 5CIYA 3CVZA 5CG2A 1OVGA 1PJ2A 3AZQA 3CH6A 3SJUA 4ZOLB 1MOQA 3EGXB 2AJDA 2B83A 2NZ8A 2XHZA 3QVOA 4DLTA 4LBYA 4RETA 2RHCA 2DKNA 1EQUA 5J59A 1RAFA 2R7LA 4D4IA 3K2EA 4LY3A 3UA3A 1Y9EA 3LYAA 2R1VA 3HYSA 1PT5A 5KKCA 3FR8A 2DHRA 2Q5QA 2HRBA 4GZLA 4HS4A 1CKEA 4IIXA 5DI3B 2DRIA 5AW3A 4MZDA 5D6NA 4IWXA 4TL8A 2CC2A 1B6RA 4CHTA 1UBJS 3M1YA 4ZMRA 2PRJA 1CUWA 4XDYA 2VBIA 2FZ5A 1SCUA 4OJQA 2Z8YA 4MW4A 2VNAA 2QD1A 1HFWA 2FK1A 3UJCA 3UYKA 3O94A 4F1JA 2EZUA 3HCRA 4ZRDA 4RE5A 5I3CA 2QV7A 4IWYA 1EE9A 3WBBA 5HKLA 1U2DC 3RO7A 1JNYA 2R25B 4X66H 1SKAA 1WHSA 3EXG1 1DX6A 4IZOA 3ROFA 2Y0BA 4L4UA 2RCYA 2BQ3A 4MW7A 5IJXA 2LUOA 2NGRA 3EEOA 4KWHA 1I3MA 2MCTA 3TNFA 1Y6GA 5HK9A 4YDHB 4AROA 3F7MA 4EEYA 1KQ3A 4ZQIA 2WJYA 1E9EA 3KJQA 2Q7DA 4BO4A 2SCUA 1XKXA 3VH1A 3DWEX 1SA0B 3M4NA 4U7PB 1G38A 4KQIA 3G9QA 1G9XA 4MDYA 5F73A 2EKLA 4PY2A 5K7SA 1CU1A 2IYSA 1LVHA 4RVFA 1GG2A 1P8JA 3ROEA 4WFQA 3BA8A 3H17A 1UMDA 4NOJA 4JBXA 1I2ZA 2R84A 1ZCFA 1LKZA 1F8UA 3UJAA 2IL1A 5M04A 4HF7A 4IUBS 4NPCA 3ANSA 4O2AA 4RGQA 5G1OA 4OP1A 2YIVX 2B6NA 1M74A 3WLPA 5KVQA 5TARA 1NP7A 1X7DA 4D3FA 4JV5H 1W36B 2WYVA 1XZIA 3B1ZA 1YZYA 2P2NA 4CJXA 1V4BA 1AUVA 1HO3A 3VU0A 4AX8A 1MV8A 4JD5A 5TJ9A 1KOGA 1SOWA 3RTAA 3A4NA 4OLBA 4QJ5A 2AE2A 5REQA 5CXXA 1E79A 2A7XA 1GCGA 5AXAA 5AO9A 5FBWB 1L5SA 4I6GA 5HBRB 3AP2A 2EFCB 4DR5H 5E4TA 1TZKA 4AX4A 3IP6A 1PTJC 2CHEA 4ZKEA 4KYTA 1JX4A 3F