3ETHA

Crystal structure of e. coli purk in complex with mgatp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Phosphoribosylaminoimidazole carboxylase ATPase subunit
publication title Structural analysis of the active site geometry of N(5)-Carboxyaminoimidazole ribonucleotide synthetase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3ethA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3ethA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ethA01
1VBGA 3BSWA 1I7LA 1ULZA 2VQDA 2PVPA 3ORQA 1BNCA 4IIJF 2YS6A 4DLKA 2YRXA 1C3OA 5EZYF 3HBLA 2CNUA 1KEEA 1EYZA 1VBHA 3G8DA 1WR2A 4FFNA 3WNZA 2C00A 2YZGA 4DIMA 3TIGA 3WO1A 2I80A 4O4IF 1KJJA 2YWVA 5J2UF 3RV4A 3UFXB 2J9GA 1UC9A 2QF7A 2CNQA 5KX5F 5H80A 4TUYF 4FFMA 5JVDF 4I4TF 2R7KA 2R6FA 3DF7A 1DV2A 4XX0B 3JRXA 3KALA 3AX6A 1T36A 4MV8A 4J6EA 4O7ZA 2NU7B 3NUAA 1M6VA 5JH7F 4O81A 1AUVA 1AUXA 1GSAA 2YL2A 2FB9A 3VPDA 4MV4A 4C5BA 2W6OA 3VA7A 2YYAA 3R5FA 2I8CA 1GSHA 3MJFA 2NU9B 1GSOA 2FP4B 2DLNA 3R5XA 2VR1A 3MWEA 4EABA 4Y8VB 2R87A 2ZDHA 2R82A 4O4JF 2HJWA 4C5AA 4QSHA 3TQTA 2ZDGA 5K2MA 3BSYA 1EZ1A 2YZMA 4XYLB 2W6NA 4MV7A 4FFOA 3SE7A 1CQJB 4MV1A 5LXTF 2CQYA 1CE8A 4GGMX 4FU0A 1UC8A 3HB9A 2NU8B 2NPOA 2R7MA 2VHEA 5D8DA 2GLTA 5C1PA 3I12A 4O7WA 3LP8A 1GLVA 1B6RA 5LYJF 5LOVF 4MAMA 2FPGB 4HR7A 3KAKA 4O7VA 5GONF 5HV6A 5DMXA 4EG0A 4FFLA 1OBGA 2YRWA 5JVLA 3K5IA 3ORRA 4HNUA 5KKNB 3K5HA 3OUZA 4EGJA 5HBRB 1I7NA 2R84A 3TIIA 2YZNA 2R85A 3JZFA 3R5HA 4O82A 4L1KA 4EA9A 2GPWA 4WBNF 2GQSA 2XCLA 5CA1F 4E4TA 4NYEA 3JRWA 3V4ZA 3RV3A 5CA0F 4IHJF 2W6ZA 4FFRA 4YAJB 2YZLA 4EA8A 1GGOA 4O7NA 1DIKA 4WD3A 1PK8A 3RFCA 4ZHQF 4IWYA 2FPIB 2W71A 4I50F 4O2AF 4EAAA 2R7NA 1M0WA 1KJQA 3VPBA 3TINA 1E4EB 1KUTA 2YS7A 1W93A 2HGSA 1KC7A 3N6RA 4EA7A 2ZDQA 5JQGF 5LP6F 4C5CA 1KBLA 4YJ3F 4MV3A 3U9TA 2GPSA 1BXRA 2V59A 5BMVF 2W6PA 2QK4A 4IZOA 1IOVA 1EUCB 2VPQA 3KREA 5C8YF 1Z2OX 4I55F 3ETJA 2NU6B 1PX2A 3R9RA 2FPPB 4M98A 2DZDA 2NUAB 4ZQIA 3E5NA 1KJ9A 3GIDA 3AW8A 3WO0A 2YW2A 2W6QA 3K3PA 2GQRA 5FNVF 1Z2NX 4M9UA 2I87A 4MV9A 4FFPA 4YBZB 4ME6A 4IWXA 3GLKA 1JDEA 3QFFA 4ZI7F 3JZIA 4HQ6A 3VPCA 1M0TA 2DWCA 1IOWA 1KJ8A 3TW6A 4HNTA 1EHIA 1DV1A 1JLLB 4M9CA 5I47A 3G8CA 4HNVA 2Z04A 3VMMA 4YB8B 5LA6F 1VKZA 2V58A 4MA0A 2P0AA 4ZOLF 2Z02A 3U54A 5C1OA 5JQWA 4O7TA 1C30A 3LWBA 1CS0A 2CZGA 2CNVA 4MV6A 4XYMB 2XD4A 1E4EA 4O4LF 3BSSA 4XZ3B 2V5AA 2IP4A 4O7SA 4MA5A 4O86A 2OLSA 1OBDA 1A48A 3ETHA 3R23A 4TV8F 2W70A 4FE2A 2PBZA 1JKJB 5J2TF 4O7RA 4TV9F 3Q1KA 3U55A 3V4SA 4O2BF 4O7YA 1JDBB 4FGRA 1A9XA 1B6SA 1CQIB 3N8DA 1Z2PX 2WYOA 2R7LA 2R86A 3MWDA 4O4HF 2PN1A 4YAKB 5BPHA 3BFPA 3OUUA 4O7LA 5CAEB 3VOTA 3HO8A 2X0SA 3Q2OA 1EUDB 5CB4F 4EGQA 4O84A 1KJIA 3U9SA 5IYZF 5BPFA 4M99A 1W96A 2SCUB 3BG5A 3RUPA 4YJ2F 1SCUB 3KAJA 2W6MA 2DIKA 4O83A 4RZQA
chains in the Genus database with same CATH superfamily
4TYYA 4BGIA 2GAAA 3FFAA 1NFFA 4ZYVA 4P3XA 5IEBA 2EQ5A 2HLNA 1WAMA 3RSLA 1VRVA 4JYZA 4YK7A 2I4RA 1KEEA 4PY2A 4CF5A 5A4DA 2HUPA 2BW0A 5L9XA 5I5SA 3HYLA 4QDOA 3MJDA 1QTIA 2OGZA 2OXRA 5H70A 5IJ9B 4GKKB 1DMSA 1SURA 2QP3A 5TRTA 4FQ7A 2JFGA 3IIJA 4XKJA 1YZTA 5LPNA 3JRXA 1WMBA 1P75A 4BKUA 2FP4A 3I6YA 4WEQA 3B70A 5FPSA 1CNMA 1QH0A 3SNKA 1NFQA 1R4ZA 3FWNA 3RVPA 4YAKA 3G2HA 4I46A 4XRRA 4TTVA 1J07A 3P2IA 1PNVA 3AHFA 5CB4B 2ZWPA 2QJFA 3HMKA 1SQ6A 2A92A 2XW6A 2VR1A 4KSCA 3BWYA 1H2XA 4HDCA 3QVXA 4F9EA 5K8CA 4BX9A 5ALIA 3WIOA 2AR7A 3PPYA 3WAKA 4WCFA 4KQFA 1TPYA 2ZAMA 3JU3A 4YPVA 5CU7A 4DDUA 2ZIZA 4DJJA 4TLMB 1PDOA 2PYZA 5EUMA 1SQFA 4F3YA 2BGLA 1I2BA 2P2LA 3FVTA 3L7AA 3N07A 3GQBB 3G5UA 2JIMA 4HYEA 4N7BA 1OBVA 1NA5A 1G291 2J8ZA 1U8UA 3RVSA 1T5LA 1PJZA 1PNQA 1OJLA 2QE6A 2I99A 5J59A 1DG9A 2GUGA 3LCRA 4Z7NB 4N82A 1B33N 4AS1A 3HB1A 2Y1DA 1XJ0A 3PLNA 3WP0A 4RF2A 2BMWA 5DJ5A 1AHPA 3TQRA 3SS8A 5HM8A 5BWBA 3GI1A 3ZOZA 4ARVA 4LVCA 1N5JA 3Q9NA 3P2YA 4DDMA 4BBRG 4AY3A 1VI2A 4BN5A 4YCDA 1UQRA 1E3IA 3ZDQA 2FPRA 3S7TA 4AG5A 2W71A 5EXXA 2R7NA 1JQJC 1P18A 2BR3A 1Q1EA 1PJRA 3HKZE 1W93A 4S1PA 5KTPA 5J2UA 4TL8A 3V46A 4Z0TA 4MDFA 4X61A 4B71A 1PEKE 1YFJA 1LDGA 5ALPA 2X0IA 2F90A 3G0HA 3WAGA 1TM5E 3JQAA 3LCMA 3D5TA 1E3DA 3IP7A 4QYIA 4BQIA 3PE6A 2BEJA 2A6PA 5ALLA 1IXYA 3NV9A 3X1KA 3QE2A 5IARA 1TEVA 5L1IA 2E89A 2C0CA 4D8WA 2OYRA 4KQ2A 4TN5A 3DDSA 2WV7A 2RGNC 2B98A 3DZFA 1Y1TA 2GD2A 3AJEA 4S2UA 3RB3A 4PCAA 1G6HA 2PBRA 2GYVA 2J30A 2JATA 3UJHA 3M6WA 5AOVA 3T61A 3TQOA 2OHOA 5ITSA 5D2CA 3LDHA 4R2XA 3D31A 3GGJA 4IOLA 3AU8A 1ZOOA 4IOMA 1DT5A 3BGIA 3NOXA 3RROA 3V2UA 2DYKA 3OCCA 2JCVA 4K88A 4OJMX 1NBMA 3T5KA 1U1IA 3KQPA 5FBQB 4GBED 3C24A 2DAAA 4FTWA 4BZZA 5CT9A 3COVA 3WLAA 3J81k 2QENA 1AKNA 4F5YA 5BMVB 5IKXA 3M3DA 1OKKA 2C4KA 4L73A 2OXIA 3Q5GA 3BM5A 3FW1A 2IBSA 4CCAA 1Z2PX 3U3DA 1OLXA 4A9AA 1NSTA 2X0SA 3GEDA 4NAUA 2RI0A 4FP9A 4WINA 4EVQA 2ZIUB 4MA4A 4HDQB 3H1EA 2QBYA 2P9TA 1G6OA 1Z2DA 3CY6A 1JJVA 1XHLA 2I0FA 4AWBA 2ET6A 2B1RA 1KKUA 3LMKA 4JIMA 2FSSA 4QT4A 3E53A 3PC3A 1N2CA 4DPKA 1QFJA 1HF3A 3KBBA 3SE0A 2W58A 7REQA 4OIFA 2QG6A 2FLWA 2FG6C 1XN1A 1N1DA 1XDDA 4GX0A 3L01A 1K7SN 3BJRA 3MTJA 4U5QA 4K0KB 4A2CA 4YHHB 4DLNA 4ZCRA 1EFHA 2CBGA 3OMXA 3G6WA 3TFQA 5KG5A 1X2BA 1Y9DA 1Y8AA 3IT2A 4LBZA 2B34A 4B17A 1JPJA 3WISA 2I2FA 1K06A 5BSRA 1NKSA 5DGHA 1DHTA 5D1OA 3GZNA 1EUDA 1PKEA 3JD0A 3OM1A 3RAQA 4JLMA 3T15A 3SC2A 4ENSA 2FJPA 1S8FA 5LU9A 1R16A 4JGGA 1XZNA 2TECE 2VJLA 4PONA 3I1FA 1ENYA 2AG6A 2FF7A 1YVUA 4LSZA 1TJYA 4MQFA 4B0PA 3LUKA 1T2DA 4M0UA 4NPAA 4Q37A 3HE3A 4TSFA 1WBDA 1DJQA 2AFIA 4EHAA 2Q4DA 3ROPA 4QATA 1PJ4A 3ASVA 3BB1A 1TT5B 4FGKA 3ZLJA 4JLVA 2IS6A 3DVSX 4WWHA 5J1SB 2JLZA 3B3AA 3K8OE 1G4HA 4CIVA 4TV9A 4F4ZA 4N1AA 4ZDWA 4FB4A 4KJXA 2XSZA 3KRTA 4R2KA 4JLBA 2NVXA 2IUYA 2E9SA 3QTLA 2WWIA 5DPMA 3CGGA 3WBBA 3GNQA 1C8BA 4TM7A 4BDSA 4GMKA 4C4OA 3WLKX 2VUUA 1W8DA 1ULBA 3K92A 4PZ9A 1IVNA 2EBHX 2GGSA 1VBNA 3HEMA 2F00A 3TTSA 2OD9A 3M4JA 1NJGA 5LXTB 1C1XA 2H1VA 1UANA 1RLIA 1Z12A 4KK3A 5HCNA 5TMDA 4D02A 2MSLA 3PRYA 3MNFA 1O96B 3R0IA 1HLGA 4HLUA 4IDAA 2V8OA 4F3NA 4KTVE 2W93A 4K9RA 2KLBA 5E3IA 1J5PA 2I2XB 4TTQA 3UK1A 5KG0A 3LC2O 1MRZA 2PMZA 4L4XA 3UK6A 1SA0A 3BCHA 2GXUA 1BMFD 1QOPB 4G4JA 2P6MA 1FBTA 1E79D 4DXDA 3TNFA 2VF4X 4XPZA 4WMLA 1FQOA 5BT9A 1VJTA 4HYQA 1TQHA 3FIJA 1OLOA 2PD3A 2I2BA 1JJ7A 4AK9A 1BWPA 2HMVA 2RG1A 4R2IA 4X66B 2XXAB 1LSUA 2G4VA 2CLIB 5HP4A 1K86A 3HVKA 4YMTA 2ZR0A 2GNAA 2OC4A 4KKXB 2WJIA 4MQEA 4P4TA 5LA6F 2EZUA 2GCOA 1VKZA 1UXOA 3CGWA 3HWSA 3RIEA 2VNAA 4RBNA 5ALOA 3LWBA 4M37A 3WMRA 4X41A 2JA6A 1T4CB 4WECA 2REOA 2Z5LA 1BXKA 1GPYA 1CY6A 3ZCRA 2DB3A 2Q27A 2Y77A 3QEMA 5GPBA 5LOVA 1OLSB 2JFPA 3QFHA 2A9VA 3MTGA 2A0YA 5CD9A 1J8QA 1E77A 4RE5A 5JSYA 3WYBA 3W7AA 2JBWA 4O7YA 2WUGA 5AW2A 3KE9A 5A5GA 2RKWA 1KZ1A 1VZ3A 5DNUA 3OIGA 1E58A 4Z53A 2VPIA 1JA9A 1PFUA 3UT5A 2NV6A 2QDKA 4AUNA 4U9UA 1HKUA 3ESDA 4PVDA 3KUXA 1WZUA 5CB4F 4O3OA 3U9SA 4F3TA 3ASYA 5LSAA 3TKAA 2BQ3A 1AMNA 4MGKR 3UHPA 3D8NA 2WZCA 3O8CA 4JQOA 4Q9JA 1RI3A 2V4UA 3BZBA 3R0ZA 5HDQA 5ILOA 2BE9A 4RU1A 5CG2A 3I9V1 1ZNXA 4ZJYA 2RK6A 1C3OA 1UAGA 3KVYA 4OHCA 4RL4A 3S2YA 2VDMB 1WPXA 1E1MA 1UMCA 2JLUA 1XNQB 2I80A 2IP2A 3ZCTA 3E05A 5JAZA 2CF6A 3NXKA 2VAWA 5DV9A 4CMJA 5DGBA 4LI3X 2ZLBA 3AHCA 1E0KA 5JCZA 4HPJB 5KKCA 4XDZA 4LXGA 4G01B 2EAUA 4HRXA 1E2KA 4KNYA 4LSMA 5AVZA 2QYTA 4BKQA 3RSZA 3FNBA 1PBNA 3IOBA 4KRFA 2QM7A 2IHVA 2I6FA 4U39A 3AERA 3QYPA 2G0NA 3FFXA 4Y8VA 4CF6A 3O92A 2LKCA 2Q3MA 4IRKA 1M73E 4DRYA 2R62A 5DTMA 1AE1A 1MDBA 3HYNA 3OP1A 3NCHA 3I72A 2B9VA 3L06A 1O94C 3QLVA 1CDDA 2MWMA 1YVPA 2W2VA 1IPHA 2O5RA 2C3PA 2KX7A 2QG4A 1NMQA 1N5OX 2W6NA 3EPPA 3BBPA 4BNFA 5FI1B 1TJ3A 2XCQA 3CMMA 4CMHA 3ICPA 1C1HA 1FDIA 3EXG1 4L2IA 2O6HA 3NQ41 4WN9A 3KHSA 1RVDA 4Z0NA 5KTYA 1V8PA 1NVEA 1OFVA 5K3WA 1ZW1A 1BE1A 4HQOA 1Y3AA 4PGGA 2EX4A 2AMLA 3R8XA 4X1KB 1G1MA 2B6HA 5AKLA 3V8PA 2IT1A 1VHLA 3FJYA 3OQBA 1NPYA 1M7GA 2HA2A 1OXVA 3WZ2A 3HKCA 5D00A 1WOYA 1PLKA 3ANTA 2OCBA 1O77A 2OLJA 1KI2A 1QYIA 1JFTA 3ACCA 1BDBA 1XOIA 1E2HA 4DPLA 1YR8A 2JARA 5KFSA 4JBLA 2WJYA 2VYVD 5H0IA 3VNBA 4N49A 2ZJ0A 4NHOA 1KFKB 4TKVB 2ZI6A 1AV7A 4N65A 4JSTA 1JILA 3RFCA 5AW8A 1IM5A 1VLHA 1V1MA 1CS0B 1E6CA 3TUIC 1BOOA 1CUSA 3AM4A 5A3QA 5FNZA 2C4HA 1OT5A 3GLHE 4X1YA 2ABWA 1NXQA 3PQ6A 2O2XA 2R8BA 2VWPA 5AM0A 1SD1A 2V9ZA 3NLLA 4UD2A 2R8IA 3JW8A 4I3GA 2E87A 5K6AC 4H7EA 5BMVF 2DETA 2W6PA 5IABA 4JT8A 4Q9AA 4Y6RA 1FTGA 4KLCA 5I5VA 2ZULA 4KN6A 2AG0A 2FCRA 5FWAA 1LTQA 1V39A 4CWAA 2QUHA 4RULA 3JVIA 4NONA 1DRWA 1JHQA 4QGHA 3M6VA 4TYNA 1TZ2A 4PCLA 2BOVA 5FP0A 4GP6A 4MKHA 4Z1OA 3IUYA 5LLSA 4RNNA 3B1WA 1VCOA 4DR7B 4NEQA 4J1TC 3GVIA 1X9NA 3IQFA 5FWXB 3BKXA 1VJ1A 2R93A 5JU6A 4XM0A 2HU5A 5TGDA 1AZSC 4A27A 4J1SA 3I23A 4O2AB 1DKRA 3K6RA 1SUBA 2I65A 3BD7A 3M6MD 4RFLA 2DHDA 2WW8A 1I4OA 3G1WA 4X62B 3F6PA 2GYWA 2DUWA 1MC8A 5BQPA 1QHYA 4BLSA 3CX4A 3WYFA 2M6LA 4LFCB 3EBOA 2W2QA 4FWBA 2KW5A 3QW2A 2QMOA 3SG0A 3S27A 1PCXA 5TQ0B 4QGFA 5BWRA 1SNYA 5G3YA 3CQ9A 1HT3A 1NMEA 4DANA 2PZMA 1IH8A 2W2KB 1XZIA 5I9MA 2B8EA 2I54A 2ANCA 5LZ9A 3KOXA 4DWVA 1CZLA 3WIBA 3INYA 4QARA 5AJHA 4MW7A 2PMCA 3IQEA 1ZNZA 5CA0A 3TLBA 4GI5A 4BV9A 1PYOA 3OOWA 5MDHA 5LP6C 4D0LB 2HXGA 3CH7A 1BNCA 4HTAA 4DIFA 3C5EA 2N0SA 1PD0A 4BJ1A 1X80B 3UJBA 5A7FA 1M9NA 2ZPUA 4M60A 4K6MA 1X8LA 2QN7A 4ALNA 4NBUA 3NTUA 2CFMA 3VPXA 3LVFO 1M2VB 4RUKA 5IN4A 2I66A 3H8WA 4M8LA 4X94A 1EVZA 3PW0A 2W8LA 1BDIA 1WUKS 2YNMA 1DJLA 2LRHA 2CSXA 2QSZA 2B82A 3FWZA 1OAKA 4TN1A 5F1OA 4M9ZA 3ZGNA 3CEBA 2NO4A 4QGBA 3GLHB 4LKOA 3CRMA 1CUJA 1XVIA 3Q3GE 3AY6A 3RS8A 2JGJA 4CVNA 5HNKA 3R7AA 3W6ZA 2YC2C 1PV4A 1ETHA 3I58A 5IFLA 5D7NA 4M7PA 4ZI3A 2PWPA 3ZQ6A 5B57C 2QIPA 1NI3A 1V26A 3C7TA 4EJ0A 3PTAA 4ENPA 4WFQA 2C9OA 4TL7A 3KXPA 1Y34E 3H2GA 3B3GA 3L4JA 1NBOA 2QTVB 3OCZA 4PF1A 5LXTF 2J0VA 3FNGA 5F5NA 2ZI3A 4O8CA 2P3OA 1F9EA 3HEAA 3QF4B 4BFSA 1XKTA 4PZCA 4AUKA 1NNSA 5KYTA 4QIWA 5EP2A 4QOIA 4UM5A 4D4IA 4TUYB 4HF7A 1I2LA 4V2IA 4XARA 1KK0A 2UYYA 3DVQX 3W2HA 1PX0A 1F2TB 3DXFA 1U8FO 4V02A 1E5XA 1HE2A 4EITA 2ZW9A 5G2OA 1JX6A 2YBEA 3TG2A 4WV3A 2ECKA 1GGEA 5KFHA 3ZNQA 1P29A 4QM7A 2Z4SA 1T3LA 3SBEA 4GOOD 4ED1A 4PC6A 2IKSA 2QTZA 4QU8A 2RE8A 4BV3A 2AGVA 2PJRA 4BNTA 4E88A 1JN0A 4XGIA 2PLFA 4P3PA 4GQAA 5F5XA 1HY3A 3K7EA 3AF0A 1QYCA 4CFSA 4UPVA 3AVQA 4QPPA 2WG1A 1OXSC 2NX2A 2IDZA 1Q1NA 4B6PA 5JYCA 2B8NA 1QZUA 4MULA 3OFSA 3WKEA 5B1DA 1T0IA 1Q77A 5JVDA 1BFDA 4G1UC 3UC9A 2V6BA 2B7CA 2CL5A 2VKQA 1PZNA 2WC1A 3QUQA 2BTQB 5K51A 4LGCA 4J76A 4Q7LA 1WM1A 1UF9A 4PAWA 2EKQA 3EOBI 3OF2A 4GZ6A 1DXHA 3FX2A 2CXSA 3VHXB 1VYUA 2OM6A 3D5QA 4N5MA 5JCOA 1ZH6A 2PGDA 1ML3A 3GTOA 2GVZC 1CJSA 4HNTA 4LOIA 1MLDA 3KSDO 4PYLA 4RHCA 4Y1FA 1XDWA 3MWGA 4WADA 4MPDA 3ZDBA 2XUGA 1ZM9A 3WOHA 3NGMA 1A5BB 2ZIEA 1QIHA 4IVNA 3I2IA 4MB6A 5BQ3A 1YBMA 5DIZA 4P33A 2VT2A 2E6KA 2HRCA 4PNHA 3S8EA 1H4SA 5DT2A 4MCIA 3HXOA 3C70A 4KQXA 2CUNA 3BORA 5JCJA 1OAAA 4D6PA 3LK6A 4OM7A 2R8RA 2VP9A 1OYWA 2PX8A 3QPAA 5C80A 3NU1A 3IHTA 1E5LA 1YCGA 4ND4A 3TQFA 1YS1X 1LV8A 3BBLA 1XC7A 5JBIA 3MA0A 1M2OA 1K5PA 2GBCA 4MJ3A 2WTMA 2ZE6A 4IVPA 5HIIA 3MTDA 2W6MA 1T13A 4H08A 3KKNA 1HE4A 1MUUA 5LWHA 1D2MA 4DF3A 1CP2A 5LWQA 4LYEA 1P5HA 2NSLA 3FTQA 3ZDAA 4RFSA 4X3PA 1K8XB 5KS2A 4ZAZA 1IBLH 3BULA 3GWGA 5ALKA 1OBFO 2GZRA 2PD4A 3B2QA 2HHJA 2BELA 1REQA 1UBJS 4QQ8A 3LSTA 3CS3A 1JZQA 2ZZKA 3DZBA 2OORC 4KXWA 3W6NA 2BDEA 4PZPA 1XMXA 3SZ3A 4ZTBA 1ZIPA 3DF7A 2KMLA 3RFVA 4DR7H 1IZ9A 3DM5A 4DW8A 2CUTA 1PYGA 3VZPA 2BH9A 1EIZA 4D8TA 1UZAA 3R75A 4FIZA 1H0SA 3HWX1 4O2RA 5I5EA 3BD8A 3H2IA 4HMOA 3VOSA 1OXBB 3L77A 3PDIA 3EQ7A 3EB9A 4RTNA 2C3YA 4GLWA 3QWHA 1WQ1R 5K0LA 1MGPA 3KKLA 5E4FA 1QF7A 2ZYUX 1KMCA 3E2MA 4J16C 4X90A 1IZ7A 5HSGA 2UZ1B 5E6UB 3PL5A 1L0BA 1O6GA 2NYAA 4DSZA 1I01A 4TRNA 4WLUA 1UKEA 4W63A 1P0PA 1ZDMA 4IF6A 3S1AB 1BW9B 4JJKA 1R8SA 1A69A 3H1GA 3WZMA 2Q6LA 3SICE 1QP0A 2B78A 1THGA 1JQKA 5DHQA 1QB8A 4PZZA 2KE5A 3O90A 3MVEA 4EW1A 4ZO7A 5K0ZA 1CV2A 2PUEA 4PLYA 1PZGA 3B1VA 3F2VA 2VC2B 3GPCA 2ALZA 3VR2A 1RSZA 2XT9A 1LQTA 4KQ6A 3TL2A 2QAGB 5CM8B 1JXQA 3NDBB 3VH3A 2Y4RA 2QW1A 4N5DA 2E1RA 1RLUA 3ABRB 4NP6A 4HPXB 2W83A 3TOVA 2WAOA 3V97A 2CHVA 3JALA 4LXQA 3A3OA 4C3ZA 3H3FA 2ZB2A 4PR3A 3AR6A 3U39A 4TT8A 4M0CA 4Y2UA 2RAVA 3W4JA 2REQA 5BORA 2VF2A 1U0BB 3TNJA 3FHCB 4F5ZA 3RBAA 2F6RA 3E03A 3VZRA 4O2AF 3L6UA 3LY8A 3IJRA 3JXEA 5LDDC 2JEOA 1J70A 2VSOA 1KAMA 4PG4A 3ADBA 2PRIA 1U7OA 1A5TA 3WNQA 3DKPA 2LP4Y 2RHHA 1JMYA 4Y6OA 4XJXA 4ZDIA 1OBHA 2DHRA 5EKSA 4WBXC 4DLRA 4P08A 1ZG3A 3WL8A 5D87A 3OG9A 3K94A 4BB5A 3MR5A 1O2DA 4ZYYA 1SG6A 2WIGA 2JJ2A 1NUTA 3ONVA 4XVRA 4MO9A 5CDYA 3NC0C 1XRJA 4S0ZA 4BNHA 2WFZA 5L95A 5IXYA 1ESNA 1LWNA 3P26A 2F8SA 2P77A 2AJBA 2IZ6A 5C9ZA 4AZSA 3UN1A 2D2VA 3HV0A 5IDQA 4GG1A 2CDNA 1CQWA 1WMAA 2Z3WA 2ZB3A 1B14A 4WQMA 3UGJA 1XTIA 3W6UA 3IIMA 2XUJA 3CR7A 1Z7EA 4J0MA 1N3LA 1G5TA 4BQNA 2BPOA 2OO5A 4NQRA 4JJZA 3QU4A 3E7WA 1N2SA 4JR0A 3AVUA 1S9DA 4F2HA 4FGRA 3I30X 3L18A 2ZE7A 3FM9A 4QD3A 2B7LA 3JAMW 5JMPA 4IP0A 2WIAA 1QM5A 3NT5A 2IHYA 1V51A 4RZUA 4YCSA 3KSRA 1FBNA 5KIAA 3A0UA 4M0KA 4NCIA 9GPBA 1NVKA 2NVBA 1PG5A 3IPRA 1PNTA 1JIIA 1GQYA 4M6WB 4L16A 3JYLA 4JI0H 2DSNA 2P4EA 2WOJA 3TQ1A 4NENA 1D6MA 4CU2A 4J2HA 1YIAA 1T2UA 1R6BX 5ES4B 2MHCA 3ILVA 5EWMB 2PUTA 3ZE6A 1YR9A 4J07A 4L02A 1P1KA 2AOWA 1VLZA 4BVFA 1CP3A 5KJEA 1XEAA 2D1QA 2XD9A 1AG9A 3CLTD 1WD7A 4QC2A 4EFEA 4TUYF 2OO3A 4TV8B 2ZRBA 1QFYA 2YYZA 5U4XA 2R7KA 2R6FA 2VDPB 1V9LA 1OHHD 1EINA 4CM9A 2Y0EA 4E2FA 3BAAA 1U2TA 3LPAA 2ZJ1A 2PWYA 1UXKA 1J2UA 4BGUA 5C35A 3ET4A 4KLRA 4B44A 3BXPA 4J0EA 1GUAA 4ALKA 4BP8A 3VDRA 2GBLC 5CGQB 2ZBGA 3MJFA 3BRSA 2FP4B 3D7NA 3PHGA 2RJNA 2OT3B 4Q3NA 3E6AA 3GUVA 4X9XA 5ENVA 5EGNA 3IJPA 2ODWA 1U2QA 4XSGA 1SHTX 5NULA 3V4RA 4PC1A 1MXHA 2Q9BA 3LDFA 1Y1WG 4RQTA 1R4MB 3ZU6A 4C4SA 2AZXA 2HREA 1D8AA 3D8SA 4JVNA 1EWVA 2Q1XA 4PANA 1WW8A 4ILEA 2X5KO 2GCGA 3OJ0A 3L8YA 3IBYA 2IYLD 4Y9UA 3E18A 4AJLA 3OD5A 1DEHA 1RJWA 2FMFA 3TBFA 3ZVMA 3CONA 4IIEA 3GLVA 3X1XA 2JGAA 1OBGA 4O2BA 3NGDA 4PAMA 1ZD2P 1V35A 2XCOA 1ZYUA 4DQKA 2WKPA 3DL4A 1R88A 4K9MA 4C6TA 1VCHA 2Z5FA 1ARZA 5J43A 3EC7A 2EKPA 3I83A 1L5QA 3JS5A 2NV2B 2NSDA 2EERA 1NP7A 1CUWA 2C9ZA 3KUKA 3M6LA 5TT0A 2IGTA 3MHTA 1NN0A 3OTHA 3WGHA 3R41A 3TRHA 4KE8A 2P67A 3PCTA 2ADMA 4Y2YA 2B6NA 4Q45A 2RHCA 3GJQA 1G6KA 2BMEA 3SVZA 4KPUA 1A1SA 3VNRA 1CT9A 3CA8A 2AOUB 3IMFA 1DAHA 2QP4A 4F6LA 2DEUA 2JBAA 1NTRA 1E7SA 1GRNA 3GRRA 1Z4QA 1L9KA 3KJFA 1XCLA 1ZD4A 1L7RA 2BGRA 4FS3A 4V1CA 3TIXB 1HBJA 4EKDA 1QGED 4MR8A 1RACA 3JQAB 3STWA 5B36A 2BFBB 4J9PA 2O7QA 4UJ5A 3VC7A 6REQA 4MVJD 3T52A 3UB4A 3LULA 3OX2A 3Q8LA 1PKXA 4IGIA 4HCJA 3KB6A 5KYKA 1WXDA 4RPCA 2WTXA 1H2BA 3BPSA 5E4YA 2FWPA 3PQEA 1RIFA 5IJWA 1VL1A 3SZGA 1FNBA 5EVJA 5GVSA 2ZEJA 2JH9A 3GRVA 4BATA 2X2EA 2GZHA 5JJIA 1SKAA 4ZFNA 2B92A 1EGAA 4K9OA 4MA5A 3K70C 4KAFA 5CDFE 2HLPA 4BO2A 4JJIA 2G1PA 2DTEA 1Z6QA 2HQSA 2HLHA 3VOAA 4HH0A 5KPJA 3H83A 1WBBA 4G5SA 2YHUA 2HN9A 5JC8A 3VVMA 2H9YA 1IM2A 2NUAA 4A0GA 2ID8A 4OBEA 5FPRA 1WMSA 4FDLA 1J0AA 1KNXA 4Z1MD 3AHEA 2BFNA 2ZETA 4L7QA 4LHYA 5K3AA 3NASA 2QYOA 1SMKA 3AOEA 1N78A 1TWHA 4IHJA 4EB6B 4H31A 2I8AA 3A6FA 4O3SA 1JLSA 2XQKA 4Z4CA 2PVPA 4GQIA 1MOZA 1AF4A 2GVDC 4JJAA 2OQVA 3PW2A 1K8QA 4TWBA 2NVOA 2C00A 2WF8A 4OGGA 1BJRE 1KYIA 3EF1A 2QTTA 2OHJA 3SFVA 2QS9A 4MUAA 4ZAWA 2JJ1D 4D4LA 3UQ8A 2GD6A 1NBWB 1N9GB 1CG6A 2IIVA 4ZT5A 3E1GA 1RZUA 2X2PA 1FP1D 7REQB 1RHRA 1TC1A 3PQ8A 2WMOB 4CMFA 3V33A 3NUAA 2GLXA 2J4DA 3KLMX 3PVSA 5KFTA 2FSGA 3ZW8A 2Y1XA 1GCAA 1WD5A 2H18A 2QU8A 5JFTA 4PM4A 1Q5PA 3RBEA 2Q6IA 3BC1A 4N5IX 4A8JA 1VJ5A 1TUBB 2EDCA 3PNYA 1YB2A 3CMCO 4Z3DA 4C5AA 4XPIA 1EWYA 2DF8A 3O8DA 5L7TA 2ENWA 4NZMA 3MT8A 1VGRA 4RPIA 3UA3A 4RTLA 1W4CA 2ZM5A 1YS4A 4GPEA 1VB5A 1C7JA 1QC5B 3VSCA 5L3QB 3PR5B 3IA2A 3WSTA 5DHAA 1UPUA 2AFIB 2QD2A 1JHMA 2D5AA 1Z15A 3DEAA 1YT5A 3AM3A 2I4IA 2F4NA 4UCWA 4F8YA 3TUJC 4UTXA 2NLOA 3DKIA 2JJQA 3O3CA 3NJRA 1M2HA 1R4NB 1LK7A 3WRWA 2ZCVA 5EE1A 2Z6QA 4EBEA 1XZPA 3DCJA 3G13A 3MOIA 1V4BA 5IT5A 2OYSA 5DX0A 1JECA 3K1TA 3AJDA 4EGSA 4PSCA 6GPBA 4B7CA 1P74A 4UQOA 2JA7A 5DGIA 1VSBA 2YJTD 3OIDA 3TXAA 1QIEA 4Q1CA 4AB1A 4PQRA 4Z9FA 5AXDA 3DV0A 1Q11A 4NIMA 1KDTA 1N7HA 2GQ0A 5IDXA 1E0JA 3OICA 1KZ4A 1B76A 3BXEA 3N0XA 2PIDA 2IS2A 4QXOA 2FZ4A 1M8FA 1W0KD 3C5CA 4RLQA 5AFSA 2VPTA 4ZZIA 2P5UA 3PFWO 3K3VA 5KSZA 2XMBA 2AC2A 2A5LA 1T8WA 1IAQA 2IDMA 1UODA 1DPFA 4WA7A 3R3JA 4LYGA 4JJ8A 1ZI6A 2UVWA 1RRVA 4DLVA 4EKYA 1ADGA 1OQAA 5LA6B 1OW3B 4MIYA 2CEAA 3DO6A 4D5EA 2WJ4A 5FAKA 2R8YA 3FSEA 3W77A 4R9NA 4DMKA 2ZBDA 2QPLA 2FSUA 3Q6MA 2AOXA 2Y1KA 5DLYA 4JWTA 1RM5A 1A8PA 4ZHQB 4QWCA 3TRIA 3O4HA 5AHOA 3NOVA 5DO9A 4LMRA 5DIFA 1T2FA 1HEYA 1EKFA 2Q5CA 2B3DA 3BXXA 1PZHA 4GI2A 1YKGA 5CB0A 1O0SA 3VU1A 3OQMA 3OT4A 4CC5A 4JJ4A 4TV8F 4IVQA 1RCUA 4AX4A 4I3FA 4IGFA 1JKJB 5DHSA 2C4WA 1XDNA 3UMRA 4AZ0B 3WWJA 1T8YA 2HA3A 3IBSA 4FFSA 1NBEA 4J3JA 4G0NA 3MWMA 5JRJA 4EA6A 1WDKA 3UPDA 5I8ZA 3PCXA 3KKQA 1MA0A 1Q3TA 5H68A 2XRZA 5DWDA 1Z4OA 5A71A 5EN4A 3PV0A 1GYQA 5LQDA 1QZTA 1JEDA 4C07A 3O4GA 1X0VA 3VV3A 3BSWA 5ELMA 4UCUA 4YH1A 1ECFA 1A4UA 4Z4HA 4D7AA 1U0TA 5B6JA 4OMCA 1G7RA 1CFZA 1Y8CA 3RUEA 3T7AA 3G0DA 5BR8H 2C2ZA 5HKKA 3OQJA 3BDVA 3ZZNA 4KKVA 5ALQA 4FQ5A 5H80A 1UMCB 1PL8A 1J49A 2JI6A 2VBFA 4G2NA 4C7XA 5LNK1 2H4WA 4AUMA 5F1KA 4YV7A 2C4MA 5F9LA 2YKGA 1C0PA 1JG6A 3B6MA 4R2LA 4Y2TA 4GX2A 5D01A 5KFEA 3NEJA 1ZGBA 2CVZA 2G08A 3ZK9A 4G0VA 4B76A 2X9NA 5E3JA 2TMDA 1ZJ5A 4F45A 4CCYB 1UKYA 4PLHA 3TLEA 4NTZA 4CNBA 4DHWA 2PL9A 2I3AA 3WYNA 3AERB 1YNOA 4H7JA 1NWCA 4Y8VB 1UFVA 3ZWVA 1NMYA 1GIAA 4UHJA 1DCMA 2BMVA 2XIGA 3ANYB 1JSXA 3HA3A 3BF7A 4NLLA 2JDID 3V6MA 3G9QA 4F5DA 1L7VC 1ELOA 1NLMA 3EEOA 5H83A 4GOLD 4ZCTA 4YQZA 3FPBA 2CL7X 3RT9A 2XNCA 3HNOA 4DXAA 3OFKA 2IVZA 1LBSA 3JQFA 3HJNA 3I6IA 4G4SO 1TQDA 2X58A 5CFOA 4QDXA 3CTMA 1Z0KA 2WKRA 3PEWA 2P3LA 5KFVA 3OQ6A 2EL7A 1LK5A 1D1PA 1C1DB 2P4UA 5CNIA 2ZPAA 1GPMA 5KWSA 1LPBB 3KVNA 3M5PA 3KELA 2JS7A 4DY6A 1MN6A 4OCZA 4HBZA 3PDJA 1DJOA 5J40A 2B2CA 1OXMA 1JA0A 1ZRNA 1JHRA 3AM5A 3F96A 4UKDA 3Q9SA 3OIUA 4DCJA 1YJBA 3NDPA 1F6BA 1NQAO 1Z6PA 2ZUSA 1CR2A 2QTBA 6LDHA 3PI7A 4ECSA 1A2BA 4P0TA 3TEJA 2CV0A 2HGSA 1I5OA 4MP6A 3WC4A 4MMXB 1FXWA 2ASDA 2PHZA 4TRMA 4ZV4A 2DUUA 2QSYA 5TEVA 2HNKA 1DQNA 4PLVA 2YW9A 1MG5A 3VJRA 3TQSA 3Q10A 1ONOA 1TIBA 1T5BA 5HHTA 1VMIA 2PUDA 3DC2A 4ENRA 5IP7G 1FS5A 4IL5A 3V55A 4QTZA 4I6GA 5IPFA 3OAAD 1BCRB 3ITEA 1Z3CA 3EZ2A 3RU9A 4W7HA 1DCTA 1U0NA 2YXBA 2JLCA 1USVA 4GLJA 4B6OA 3ZZMA 3QBEA 1IUKA 4FHEA 5BUQA 3MOSA 2EZTA 3EEBA 4J7XA 4MQ6A 5DKFA 2J5QA 1WY5A 2A1HA 2J5XA 3IBCA 3VPFA 1QE0A 1UIMA 3GAFA 1QE5A 3QVOA 5AK6A 1MZPA 4JXZA 2PMFA 3AV0B 2GD0A 4P3NA 1U90A 2BTEA 4ESHA 5AVOA 4FGSA 4FIDA 4BJ5A 1VE1A 2NAFA 5IK2D 4ZOEA 1ORVA 2A30A 1DNPA 2QVCA 2P1ZA 4PG5A 1SXJA 1WY7A 1EK1A 1SC9A 4D3ZA 2FX3A 3LHIA 4BBZA 1V41E 5I9LA 2WQ6A 5KG3A 2ZG6A 3KOWA 4OSOA 1JHAA 2Y99A 3W5OA 1KP9A 1DI0A 2VRBA 3MBOA 3JAWB 3KG2A 3O4IA 4G2TA 2RAFA 3NTRA 4JASB 1SBZA 1GUZA 4EJFA 1J42A 3HA7A 2P68A 1QP4A 2PXAA 4URUR 3U2QA 3O8OB 1T1RA 1EU1A 1YXMA 2DBRA 2ZM6B 3RFXA 2RJ3A 3DM9B 5TF0A 4CMEA 2X3YA 3DPUA 1BZYA 4LXTA 1W35A 2QVGA 3FOZA 1HDCA 4AKIA 4TLCA 4TMWA 2VH1A 1ZM3A 3FOCA 3CT6A 3H4BA 4DMFA 5E2IA 3V80A 4XZ3A 3E70C 4LOLA 5LB4A 2PM8A 4L78A 2WLSA 4LRTB 2GPJA 421PA 1QLJA 3OBBA 2XY4A 4DIKA 2YV4A 2C83A 2WYVA 4TRJA 3ZGZA 1KAOA 3IEPA 5CB8A 1FFYA 4RTKA 3A04A 2H08A 4CDMA 4FUQA 2V5UA 3FF1A 3CKKA 4YCMA 1GA1A 2H1SA 5AKEA 4M53A 1PDWA 1GL3A 3N39C 1BH2A 4OQFA 2J3DA 4B47A 3NC1C 2HJSA 1NUUA 3ROTA 1LVUA 3KDAA 5EWLB 3N2KA 2EJ3A 5HCIA 5F9FA 4INOA 5HNEA 4BFVA 3SC6A 4GS5A 2RI6A 1CUAA 1VMDA 3ZDEA 3K9FC 4FJ1A 3B51X 4MRRA 4ZRMA 1HTTA 2WB1A 1KJZA 1P3Y1 1RXIA 4XJTA 1SUDA 4IIBA 3QQMA 5TS3A 4UM8B 3KT3A 2O2EA 2WE8A 5CX1A 1DS6A 1BHO1 4ZOBA 4D25A 1RPAA 2DPLA 4OREX 1ZRHA 1NW7A 2ZFUA 3WXMA 1HDRA 4XWYA 2FG7C 5KFZA 4XFKA 1AD2A 4BEWA 2VDLB 2CCGA 5DRYA 4XVCA 5F2EA 4OJNA 2ZVQX 4GOJA 4NFLA 2G5GX 3JTEA 1R64A 1B23P 2GPWA 2GEUA 4IHAA 1RLOA 3TNDA 3FRIA 4G1BA 2RSLA 2W90A 2I2AA 1I7DA 1IZ0A 1TQ2A 4DCGA 4WJZA 2CKZB 2JIZA 4ZHQF 2QM3A 1I2MA 1ZUNB 2OA0A 1KAHA 3VVBA 2XZLA 4A82A 4A8PA 3LPCA 4XQ9A 2RMKA 3IPXA 4CDGA 3ICEA 3QI2A 3DTNA 4Q16A 1Z2OX 3UKJA 5JTUA 2C22A 5KDOA 2GBPA 4ML3A 3M9LA 2BFEB 1DAEA 4U2GA 1FFEA 3MXTA 2YW2A 5BR7A 2Z6VA 3BHJA 4BWGA 1XTTA 5EKTA 5G1NA 1U0EA 4BMXA 1BX0A 1NASA 4TYQA 3HA5A 1ZJJA 1DZIA 1Z8HA 2C42A 3EVEA 5HMMA 2E2HA 1XA3A 1EE1A 1F20A 4I50B 2ICAA 2V7WA 2X8AA 3EPGA 5F3WB 5DGTA 3HSKA 1QQTA 1A8SA 3OPXA 2CZGA 2HO4A 5LZ5A 3T3MB 2PV0A 3R76A 3I01A 4RAYA 4YJ3B 3ABZA 3GLSA 4C4TA 5BQ5A 3L8EA 1DKNA 2ALJA 4HDNA 5FD6A 4KE6A 3K4PA 2NUPB 1J2YA 2ZJ7A 2FUG6 4J2OA 4O3RA 1FLDA 1YQDA 3SQOA 2WD8A 4MROA 4KOEC 4KBFA 4A6PA 3LQSA 5HUJA 1JU3A 1SUIA 3VOTA 2YCHA 2NT4A 3AEUB 2JVKA 2ON6A 4ZA2A 3M89A 4U8GA 3GGDA 4TZTA 5C4IA 1DBVO 1F7UA 4ISCA 3HO6A 5K4AA 2DMRA 3OCWA 2FJZA 2PDAA 3K71B 5L4SA 2CY0A 5L3SA 2D4AA 2G17A 4JR2A 4QJIA 2IE0A 4P98A 2FZ5A 3O95A 4AJ2A 1RJPA 2E5WA 5C52B 3EFBA 4RFSB 1UJ5A 1NXPA 4H4EA 3CZCA 4WNIA 3VBCA 3GOHA 1ET0A 5FR2A 2FTKE 2QD1A 3USES 2JJMA 4QELA 3SHQA 1ZWKA 3P9YA 2YDYA 3ZD6A 1VE9A 4EBDA 5TQ2A 1NIPA 2OL4A 3TEFA 2QW0X 4RDCA 3GTPA 1N48A 3V2IA 4UM9B 5LP1A 1BWQA 1UFKA 4ND3A 4DVGA 4NOMA 4C3OB 5DM60 2JLAA 1QIKA 5JW6A 4XYGA 2B1JA 1FU7A 2QTWB 2X77A 1GUDA 3L6OO 5FR1A 3RIZA 4J0IA 1N6PA 1ECBA 2CXPA 2WAQE 1QHXA 4NBVA 4B3JA 2I6TA 4HHEA 4YYZA 2W8BB 1DBSA 2Z5VA 4Q1FA 2IA6A 1IBLB 2J3EA 2G72A 2NO6A 3VU3A 5KYUA 5L6LB 1OPXA 2QE7A 1QPBA 2R5NA 3GROA 2FW7A 1VCMA 3QOXA 3Q8XB 4DM3A 2O03A 4FXPA 1C3EA 3PENA 4ZQBA 4HNUA 2GA8A 2O0JA 4YV0A 3R74A 3OIFA 5CNMA 1S01A 3JATA 2ZM6H 4HRAA 3W3AD 2YWFA 5HRCA 2QPTA 3TDKA 4LK2A 4P7BA 3ZEAA 3VR3A 1TKAA 4Y3UA 3BH6A 6Q21A 4M89A 1OR8A 1EGQA 3CZMA 3GVPA 3FJOA 3GAMA 3KZKA 3B9QA 1SOWA 3I6MA 4CIBA 3R7LA 1CYEA 2HPVA 2PS0A 1TRKA 4BO9A 1KTAA 1DC4A 3RKSA 4IWYA 1XMJA 1U1DA 3O5AA 2X23A 4YQFA 1U0FA 3VUFA 1Y1LA 4E94A 1E1CB 3L7IA 2B35A 3RG8A 1RRMA 2JC3A 4IAOA 3EEFA 3I5AA 4Y1EA 2C2KA 1GA6A 3BFKA 1OLUA 3DEYX 2GD1O 4IG9A 2Y93A 4DQDA 5ECGC 2N75A 3FPKA 3BICA 3JWIA 2SKDA 4ZQIA 3E5NA 1FX0A 3I9MA 3UVEA 2VJMA 1MAVA 2ZXFA 1E8DA 2XGQA 2G83A 1T4BA 3HG7A 3OZIA 4FMDB 3KKZA 2GN8A 3WJAA 4UM7A 4UDXX 4TKUB 3ONDA 3UNXA 1U8YA 1XGKA 4CMAA 1F5NA 4C21A 2ONCA 2HDOA 4KHPB 4NYMQ 2Y1GA 4M87A 2L17A 4G0MA 1V3QE 1IY0A 3IQXA 1RWVA 1V2HE 3AUUA 4DPMA 1D2RA 1HYHA 2BM0A 4A0SA 2P9HA 4R1PA 3UHOA 3AXTA 1GO2A 1UZUA 3AJRA 2P6OA 5DB4A 1YDMA 2YWXA 2A1IA 4IR1A 1JR2A 4BFYA 3EJWA 2FN3A 2P30A 2HGWA 4R84A 4M7WA 1SQSA 4DJDC 1NATA 4JLWA 2W70A 5EIHA 1S2MA 2XQGA 2ZE8A 4JT2A 2AUNA 1WS6A 4O29A 3X1ZA 3VPGA 5I5XA 4ZIRB 2CLDX 4F4HA 2XKAA 4D3DA 5AHRA 3CNBA 1SU4A 2I4TA 4HQKA 2G07A 5H4GA 1L5RA 4NJEB 5KWEA 1N3BA 4Z8XA 2ZGVA 4DLWA 1ISIA 3JASB 3S40A 2XB9A 2WJ6A 5I6DA 4YBZA 1EBFA 3HKEB 4WBNA 4YAUA 4KV9A 2Q2WA 2V0NA 1KYWA 3WIDA 4JVLA 2PJZA 2C78A 2ZYRA 2EJWA 5KTTA 4HTFA 1G3MA 1I80A 1RC8A 1QIIA 4LCEA 2X1HA 2PV7A 5M34A 2YHSA 2C5EA 4GM4A 1UBGA 4Q3LA 1GTSA 3VX3A 5EHIA 3AWIA 3WIUA 3KR9A 1Q7CA 1TGVA 3DQZA 1QONA 3BJMA 2HUNA 1J2RA 1XWIA 2XVYA 2NVUB 3PXBA 2BEWA 4U7WA 2FLNA 4V1CI 4FGWA 3WADA 4LWOA 4J7AA 1HMPA 4IDQA 1A9QA 4UTRA 4DTIA 5I7RA 2WJ3A 1F6DA 3NTXA 2R47A 3GW8A 5FNVA 2RGCA 2B37A 4Q4HA 2H9IA 4NSNA 4MK4A 5DASA 5B3JC 1C7FA 2QTMA 4Z49A 4DMCA 3K16A 3HCDA 3CW8X 3ROXA 3T7RA 1BCSA 4JI0B 4A0HA 1Z45A 3R3HA 1O5TA 1U28C 3NBYC 2NZJA 2BFWA 4ZOAA 3OFVA 4DV4H 1JR3A 3W5CA 9LDTA 3EE6A 1PR0A 1LLUA 4Q4JB 4HS4A 1WPRA 4TQGA 3DE0X 5BNWA 1MORA 4L5CA 3OWOA 2RB4A 4UBOA 4HEA1 4JUFA 2NSJA 1BC5A 1GZUA 3GTKA 3A4MA 5HBRB 1E2IA 3BILA 3PFIA 4XUGB 1V7ZA 1CUIA 3BEDA 1R0KA 4YA6A 4F92B 3COPA 2NSHA 1LA2A 2IY9A 1NW8A 1KO4A 2NU9A 3MAGA 3OZWA 4WLNA 5CBPA 5EJIA 1QCZA 4Y9TA 5KT5A 1U81A 2GCNA 3VJKA 2WU0A 3ZCPA 5D3MB 1OUMA 2OGTA 1T2NA 1Y5RA 3TS1A 1GPH1 3L7MA 4X8MA 5T64A 3OJCA 4I50F 2HRDA 2VAXA 2ATCA 3BCRA 4J9VA 3E23A 5I5TA 4CL8A 3DSRA 1X3SA 1P1BA 1AB5A 3E9RA 3RNLA 3N6RA 3E7FA 5T6BA 3TE7A 1LZKA 3VU9A 3B8HA 2Z95A 4RGBA 4YJ3F 5F51A 2VAPA 4ZVVA 4OM8A 3H5OA 5MGBA 3B3QA 3H11A 4BU1A 3OEED 2JIBA 2GWRA 5IVIA 4OBBA 3AL2A 3I2HA 5HJ7A 3TRDA 4M1EA 3DYBA 5AVSA 3V4FA 2XNHA 4FWTA 3PLAE 3G17A 1ZOSA 5JJ5A 1H6BA 3UMFA 1DWQA 1QOQB 3EXEB 4BNVA 1R8XA 2EJTA 3U6BA 2VK8A 2PANA 1M1YA 1XDGA 2G5CA 5CA1B 3IESA 2I2WA 4EUKA 5JI2E 1QNFA 1Q15A 3KIPA 1DV1A 3H2SA 3R5TA 2H1FA 3G7UA 4Q34A 1W46A 3ZBQA 5GJWC 3CQZA 4JI5H 4CTNA 3CR8A 2H4FA 3K9GA 1GTG1 1LTHR 3KQLA 3P0RA 2BMAA 1BXZA 4EK9A 1ZGAA 1EFVA 2X15A 4RC9A 2HBYA 2YVUA 4K05A 4B32A 1LQUA 1PJCA 4JK3A 2IYXA 1XVUA 4DR5H 4MW9A 1ZC3A 3D4LA 3EDYA 2G36A 1R0RE 1NV9A 4JP8A 1NUHA 4XWTA 1T9GR 2V7EA 1IYZA 2PH1A 4IS2A 3KJHA 2EVWX 3DAFA 2YQ4A 2PBZA 1CRWG 1G7CA 1QVVA 5LMCA 5EUCA 5IN5A 3UW3A 3H84A 1PEYA 2CUKA 2GM9A 1A8HA 4LYDA 1WF6A 3S2IA 3RIGA 3VBEA 4RWEA 2OILA 5GV8A 3IOCA 3SI7A 2QL5A 4C2UA 3E27A 2O57A 3A4YA 1JPNA 4Q48A 4EHHA 5BUZA 4DL2A 2Y1LA 3OC6A 2FN9A 1KGSA 3ECCA 4JP1A 1K4MA 1QF6A 1R3UA 4HEQA 3RHZA 2P0EA 3VC2A 1M5RA 3JD1A 4P38A 3UUGA 4U7HA 1AKYA 4BY1G 3ZE1B 2DM6A 4RD3A 4XLLA 3BK2A 3NHSA 3K2BA 1A88A 4KUGA 2JA6G 2RAUA 4XB6B 4DM4A 2II6A 1E2PA 5HF5A 1ACMA 2HJHA 2O2ZA 1T5TA 1P4HA 4EJ6A 4Y98A 4I8DA 4XX0B 3A9WA 3ZXSA 5FO1A 2QJTA 2VRCA 4CKEB 4ZP1A 4FD2A 4KHPH 1ESEA 4ZVKA 2IS4A 2X5RA 1Z7YA 1AHIA 1E9AA 2WJZB 1ST2A 4KITB 1E1RA 4RANA 3KXIA 1G9XA 2YJ6A 1LJ8A 4NE9A 1K7CA 3PXXA 1HZZC 1EX6A 2YY6A 4N7MA 1ZP6A 1IULA 3NRJA 1QXSA 3WRYA 1T3GA 2QIOA 1JAYA 3T12A 2CT8A 4FBLA 1M2GA 3BL5A 2C9MA 2VF5X 2WA2A 4FMCB 5LQKA 1CE8A 3I64A 3OIWA 1ZW6A 1LU9A 1NDQA 4MTEA 5HZGA 5B3KA 1K75A 5E7QA 4CV3A 5KYNA 1THTA 4L3OA 3QU2A 5I01A 4N54A 1I3MA 4R7GA 3QU7A 4O4LA 2FMTA 2Z8ZA 3W8EA 3GTMA 3WYDA 2GEDA 4C4YA 4WK2B 2ERXA 1V25A 5EWEA 1QBKC 2HG8A 3QVMA 4B84A 5HIKA 5K7SA 1G6Q1 1YL5A 5C81A 4D8UA 4YEDA 5BVGA 4EG0A 2XVAA 1BDHA 1EK0A 4BUJA 2DULA 5GJVC 3WLJA 5HIJA 2QM8A 3FKSA 3DD1A 4Q3CA 4R1MA 4N3NA 3IRUA 4TOIA 3X43A 3OIVA 1GZSA 4R5MA 3AUYA 4DV5H 4FMDF 3AB7A 5IYZA 3U7QA 4ZEMA 2Q99A 1NLUA 5ECWA 4CHTA 1ZHHA 2XE8A 2AMYA 2ZSBA 4YPOA 4UTVA 3TPCA 4Z9AA 1XZLA 4KFCA 4GC5A 3GBSA 1UZMA 3NOQA 2OCPA 2ZWAA 3TG8A 2V65A 5FTNA 5AJTA 4DIBA 5AUOB 1MC1A 2ACVA 4DR1H 2PU7A 1Y6FA 3D6TB 2O7RA 4KW7A 2R79A 5FUVA 1BDMA 3F6EX 5AKHA 2ZUEA 4PPQA 4Q9LA 3L0IB 3SGLA 2EBWA 3OWHA 1SCJA 5LL6b 4QHTA 1HNNA 4JSYA 4RUCA 2SBTA 2RHJA 2ZB4A 4LSXA 3TLZA 1UP4A 1ENZA 3AUKA 5CIQA 3ZJ4A 1USIA 1B8UA 4CLOA 2HPZA 4A36A 2NAPA 2AI3A 1WNTA 3HM9A 3RI3A 1G2OA 4KQCA 1ADFA 4RIFA 1Z2NX 4ND1A 2GSWA 2FU5C 3ERCA 1UWCA 1XAGA 3OOHA 2YWHA 3OPVA 4BASA 1LS1A 1GARA 3LUDA 2W42A 4GZ3A 2LD4A 3C6MA 2CLEB 2AEJA 2IIQA 3F4BA 4P53A 2PZFA 1EP1B 5CT8A 4P32A 1UXJA 1KEEB 2COUA 2N46A 3EGVA 1Z62A 1C7IA 3TGWA 1ZZGA 3BMOA 5FUQA 4TYWA 1C8VB 4OQMA 1UK6A 1AZWA 3ZIUA 5CG1A 1XMVA 4B73A 4TS9A 1XL0A 2VAMA 1T3HA 3R7NA 3I3OA 1SBYA 4CDNA 2EX0A 3R23A 1TAGA 1UAYA 1Y9EA 4YYEA 3R4VA 1V4YA 4JYMA 2PRKA 2Z57A 3MJSA 4YAKB 1LW6E 4EKNB 1YBAA 1SVNA 1VLVA 3C3KA 3O4RA 5D86A 1FYFA 5AKKA 1NBME 1JTFA 1NP3A 1XMPA 1WVMA 4QASA 3NIBA 2MR6A 4LDPA 3B5EA 4QQNA 4XDHA 3RTCA 1CRPA 1BG6A 2W9CA 1NVFA 4JU9A 4EY4A 3KFXA 4WCFB 2R1ZA 3E2IA 3K6KA 4OJYA 5HKBA 1O97D 1X7WA 4IMPA 4S24A 5BV8A 4Q4LA 4I5DA 1TA9A 1TJ4A 2I34A 2R93G 3BFVA 5JNRA 1I1LA 1J09A 4DUGD 5FOSA 2GTPA 2OENG 1JQEA 1Z88A 1EGVB 4P34A 4MYRA 5E4TA 1UJ6A 2D5CA 2ODEA 3HTXA 4JJFA 2X8LA 1JWLA 4FW9A 5L7YA 1SZJG 1OB5A 3HCWA 3LWNA 4HEJA 3GMDA 1W87A 2PUJA 1NM5A 3TN7A 1YB7A 5FB3A 2QI9C 1O4VA 1IY9A 3NW9A 3HJRA 1NVAA 3R0QA 3QHAA 4GI3A 1BRMA 3DOEA 4ZK2A 4HLNA 4O81A 5HE9A 1OI2A 2I8CA 1N2CE 2Q41A 2PCJA 2V5VA 2AFVA 3P9QA 1R0YA 1JSRA 4MUGA 2E1PA 5C0OE 1USWA 4V38A 2EEZA 2JAXA 3B13B 1R6DA 4AZVA 3NEPX 5KC9A 4IXTA 3V1NA 2HBZA 5KPDA 1W5FA 3LKVA 2UZ4A 1O9GA 4HGQA 2ZVPX 1NJ8A 3AI2A 1W94A 4E08A 1RJGA 4YJHA 5J2UB 1U9CA 4PYRA 1I7PA 5BR8B 3PGXA 2KQUA 4JODA 5BW5A 3C6BA 5F3DA 3RVOA 4PXSA 4YP9A 4QYIB 4CM5A 1M1ZA 4ND8A 2NZ2A 2C28A 4CE5A 2F48A 4NG4A 3UANA 5CW2A 1CHDA 1EA5A 1E69A 3W8FA 5DLEA 3GPBA 2XWBF 3DYVA 1OH5A 4EHBA 3MRVA 5CVTA 3ELBA 4GRIA 1X19A 1K97A 4M0EA 4FFWA 2YWCA 5DYTA 2RI1A 3EXHC 2AFIE 1IY2A 3CLRC 5CA1F 4CN8A 2AI2A 4ZT3A 1V8OA 1NE7A 3LUJA 4HWRA 2PXCA 1XU7A 1U3FA 3AJ9A 4RNCA 5ITWA 2EKZA 5ALNA 5EIAA 4QYSA 3S99A 2X8JA 2Y3IA 5TPZD 5BQFA 4XYLA 4X85A 1E2EA 2QEQA 4WI1A 3ND8A 7ABPA 2AE1A 1U7XA 5A6VA 1KKLA 1C14A 3PA6A 4TMFA 2VA9A 4EA7A 1IZZA 3QE9Y 2GTIA 4HVLA 3LOUA 4X84A 3RLFA 5T4EA 4D0RA 5KJ1A 1E1DA 1U2DC 3U6KA 3UHFA 4K6KA 3BTVA 1OLXB 4J9MA 3O1IC 2W6QA 4KQWA 2RGXA 1DIHA 1LRLA 4KO4S 3RH0A 4AJPA 5JYEA 2ONYA 5LFAA 4L9WA 4XVQA 1U9ZA 4W7SA 3ZE7A 2QBYB 3IVCA 1ODKA 1IB0A 5EXDA 4NMWA 4URVR 1RWPA 1XVTA 3ZGXA 3I0NA 4DZRA 3SDBA 2PMZE 3JAMA 3AETA 1J2JA 3CF4A 4W5QA 1N2CB 3PPIA 3I8OA 4N0EA 5EKDA 4G97A 4TS3A 2VKTA 2C20A 4OBWA 4MYUA 1RYDA 2ZZNA 2W8KA 1W76A 5AP9A 5JHGB 2RHOA 1Y1KE 2BGIA 4BKRA 3HQ4O 1S0NA 5AKZA 4DUZH 1NNEA 1V3VA 1T9DA 2BMFA 5KC8A 4M7OA 4UHFA 3G2OA 1H05A 1P2BA 3L7JA 1T9AA 5DQHA 4DA9A 1SXJB 2QRJA 3NBFA 3BWDD 4YJGA 5D1OB 3GZNB 1PIWA 4QXAA 1EUDB 4H35A 3A28A 2XDYA 2HIGA 3QVSA 1DWOA 4OXKA 1PTJC 3SC2B 2MDTA 3ZJUA 4QJ5A 4KQMA 1OJ7A 3UGQA 5A5FA 4BX8A 1I4DD 4MQFB 2JZCA 4TQAA 2I3DA 1K2VN 3AESA 2VNJA 4ZI2A 4PSVA 8ADHA 1ZINA 4FMCF 1I94B 3ITNA 4ECEA 1H6CA 4AUEA 4KOAA 3AHDA 5ALMA 3Q3CA 3VQTA 4RNOA 4CG3A 5E9WA 4HY3A 2ORIA 3JZAA 1J0EA 1XZKA 4TYPA 3C1OA 1XA4A 4HX2A 1Z08A 1T6XA 5AW3A 4GE0A 4MQUA 5DF1A 4A26A 2Y1WA 4TV9B 3FUUA 3H8SA 5JAIA 3KB2A 1F51E 3W5SA 3LLMA 3M6AA 3QZUA 3SZOA 3NXSA 4M1YA 1PFQA 2H7YA 4JBXA 3EVTA 1G2WA 2H31A 3HDJA 1JHUA 3TRKA 4UNQA 1GCGA 4M55A 4TXJA 5DI3A 3WQRA 5L1JA 4JQZA 3VR1A 3VYVA 1XTZA 2REBA 1EZ1A 5CTAA 3W8NA 1C1XB 3QY0A 5B3AA 1RS0A 2XHZA 3FCUB 1JSLA 3BMQA 4U2KA 3LYAA 3FBWA 5IF9A 3ND9A 2RF4A 5KNLA 4PC3A 1NYTA 1C80A 1RR6A 1R0XA 5AHWA 1ZK0A 4PZAA 5D8DA 4XI9A 4RVNA 3VI3B 1LSOA 4LA4A 1MENA 1NRXA 3PZPA 1VC2A 4CQJA 3FJ1A 2GZSA 1U2EA 1JLKA 5HKLA 1JKIA 3FPLA 4WLVA 4R8KA 5EXEA 1SA0B 3RB4A 4H3VA 2NZYA 4QU5A 4G8JA 3ESRA 4M49A 2H1CA 1QHIA 1W0JA 2CLHB 2XV1A 4ZTUB 1RI5A 3EIHA 1B0AA 1V71A 1S9FA 4EPXA 5B2ZA 2GAFA 3VPAA 4B4WA 3RK4A 2JFYA 2JEIA 4B34A 4GD3Q 2WFMA 4YJ2A 4GOKA 1IOZA 3HSYA 5GGYA 4MQEB 1P7ZA 3LW7A 2P8SA 2J87A 3RVKA 2GCOB 3A1CA 3H05A 2AZ4A 3QFRA 1CUBA 2VDUE 4JBIA 2VYND 3PR2B 4RABA 2QLJA 1K3FA 2JGEA 1PJLA 1HYQA 2V55B 1Q14A 4QWEA 4GOND 3SDSA 4YIKA 2Z09A 3RS4A 2Q0HA 2HWYA 3RABA 1DDIA 1J8FA 3QEMB 2HF7A 3D1JA 5LOVB 4WKNA 3G5LA 4KUEA 1R1DA 3LBAA 1KI6A 2HLDA 3JQDA 2B8JA 3DMTA 3A3PA 1HK7A 3PUXA 1IPFA 1CXZA 1YFLA 2X3FA 2HWKA 1ISFA 3Q3IA 3S1SA 3UT5B 1SWVA 1B42A 1ZCAA 1VAJA 1LZLA 2VF8A 3P9NA 4JUAA 2EJ0A 4PE5B 1G59A 3OU7A 4ERNA 2VJBA 4R3UC 1HT0A 1JFFA 4CT0A 1YR3A 3K20A 1GAWA 1WETA 4YS6A 4LGMA 1UKBA 1GQFA 1A9SA 3PVXA 2I6QA 4JJEA 1C3OB 3HYRA 1EVJA 3T34A 1N25A 3GJ0A 3E22A 1Y8RA 3Q7PA 5DHUA 3X3HA 2GN6A 3KV3O 3DPSA 2ZUTA 5EJEA 1O9BA 1FVFA 2V4QA 4B85A 5IJXA 1X7DA 2IU0A 1R5OA 4QLAA 1EAMA 3EVNA 2GZ1A 3PEYA 1OBDA 3ZS8A 2R97A 2W0SA 1A5ZA 3Q0IA 1T8PA 4D45A 1U8AA 5D3KA 3RODA 4GICA 2EKDA 2PN1A 1EJBA 2XNKA 3Q7TA 3K0AA 3BREA 3I1YA 1GN8A 3FZEA 2XJ9A 1CPYA 1TCBA 4CT4B 3NBZB 4W8HA 2LZ0A 2MSNA 1V6CA 2ZQYA 1PTKA 1FVHA 3F5FA 2GFQA 1RPZA 1UBUS 1SVMA 4OD0A 3H1FA 2PSDA 3ZHXA 2FLVA 1GD1O 1YVDA 3JYQA 2NTYC 1XTQA 3NTOA 1QJCA 4CV2A 4PRYA 2B7BA 1CKNA 1DADA 4L2IB 2XUQA 4O5OA 4WN9B 1GZHB 4NOLA 2G88A 1ZMRA 1Q0SA 1XYYA 5JYDA 5J2UF 4D26A 4BQFA 5A7GA 2H9AA 4JEUA 5MF6A 3WLNA 3IAXA 3DWGA 4IV8A 4EP1A 4IH1A 1PVVA 1CRZA 3FMFA 3P9XA 3TB6A 4JYCA 3HKCB 4O7ZA 4I1PA 3FFTA 1FYWA 1G5PA 1G5RA 2Z6AA 3ZWPA 2FB9A 4XTCS 3NYQA 1UT5A 4YONB 4G0YA 5FWNA 1A3CA 5BWWA 3CWCA 1ZR4A 5BUSA 5EJAA 1MB2A 4MOWA 2ZKLA 3W5BA 3K0BA 3CKLA 1L4LA 2BFAA 5H4HA 1U7ZA 3NWEA 4DNFA 2XJ4A 1V1MB 2BE7A 1RVV1 5LQSA 3KPWA 4RQAA 1KO1A 1WU7A 2VHYA 4DT1A 2FKNA 4X1YB 1PNRA 2HJRA 2O3QA 4TVOA 2VTEA 1Z22A 1UC5B 4Z9YA 3WDSA 1Z7BA 3RSQA 3SEAA 5C37A 1M83A 1ML4A 2B4KA 5LZ8A 1P8LA 2EW1A 3M5CA 1ORRA 3QPUA 1QLWA 2F2TA 3AM1A 5FO0A 1QG6A 2DR3A 2HT1A 5DT9A 1DRJA 3TVTA 4KWHA 3ZDDA 4S12A 4GMXA 5LVAA 1I94H 3QYFA 3PEVA 2HXYA 1LPNA 4QIWE 5KAPA 1NJ1A 1FQWA 3FN4A 3ZHVA 2YCBA 1FUIA 1F17A 1M1XB 1TA8A 3GRCA 4RV9A 3MTBA 4F2DA 4LX0A 4ON9A 4AP5A 2A2ZA 5DGAA 1L5HA 4LZLA 3QLUC 3WWPA 3GJXB 2VS1A 4MYDA 3BA1A 4HDOB 3EDCA 1UBLS 2XWQA 1N1GA 4J4HA 4IEFB 2Z9DA 5BQOA 3H1PA 3SOZA 3UGTA 5EFZA 4B6GA 4I4TA 5D1PA 1Y4DE 5TGTA 1NVMB 6NULA 3S2UA 1IATA 2QRGA 1SBCA 4GP7A 1ZBDA 5EKUA 2JNWA 5L3RA 1PT5A 1W5TA 2JLBA 1AQJA 2CNKA 3UH0A 4RA9A 3T0GA 3GYBA 2FXVA 2QU7A 3E7XA 2ZTSA 2XNDD 2VOBA 3TZ6A 4M7EA 4INZA 4JBWA 4OB7A 4B4DA 5I4BA 1ZN9A 5CA0B 4BB6A 2W2TA 1ZVKA 4FJ0A 4NYIQ 1ZM2A 3ZNNA 3KQYA 2O50A 1X92A 2FV8A 1V96A 1VXOA 3FHJA 3SKYA 5KCZA 3GWZA 1H6AA 3FZNA 4QGAA 3IB6A 4H0CA 3ICWA 2HJ9A 2EFGA 1FF9A 2HWWA 4CNQA 2CFCA 2UYOA 3W4KA 2EZ9A 1C3JA 3B38A 4JLNA 5KQMA 3E2PA 3MWJA 3VNUA 3MJTA 3ZU4A 4CUJA 4MQMA 1HURA 1Q6YA 4TV9F 3KOZA 4RVDA 2CSUA 3VTKA 4DQUA 3V00A 2I7TA 1UBNA 3D6NB 4IR9A 2ASEA 4EMSA 1RQPA 2HMTA 4Y2QA 2SKCA 1T5IA 5I3CA 1SUWA 3MWYW 5JBQA 5FJJA 2O48X 1JL3A 1XWWA 5G3ZA 2EP7A 3ZHQA 1A9TA 2CXOA 1UMBA 1WHSA 1FFAA 3P5BA 1OFHA 1DX6A 3QVWA 3KT6A 3MGAA 2DABA 3CF0A 1NOJA 4YB8A 1ODFA 2IITA 2BRUC 2H1IA 1Q7BA 4RXMA 1UM8A 3UHAA 4II2A 3OPNA 5DQGA 3QSGA 1XCPA 3PIIA 4REQA 3E9MA 3W90A 2J9FA 5I9IA 5DGDA 1L1FA 2FR8C 4M22A 2HMAA 3X1MA 2PIAA 5E9JA 4LMBA 5BSTA 1XEXA 3MR6A 1W2WB 3QBVA 3SXUA 4RMNA 3PXCX 3O47A 4H7HA 2H4ZA 4JT9A 2AWNA 4BLTA 4YUWA 3L49A 3M2PA 3LC0A 4FFVA 2QW8A 4BY7G 2WVHA 3N58A 1GR0A 1Z39A 3PF9A 4D3SA 5HIAA 1T4GA 1MW9X 3PC6A 1U0HC 5E38A 1IVYA 3TZBA 2MSDB 1M0EA 1PBTA 4LSGA 1P0QA 4LCJA 1QU2A 3IR5A 4OHYA 3MT9A 4X6XA 1E2DA 5EHXA 4Y6PA 1LRKA 4O5AA 2ZB7A 3GDGA 3T3OA 3ZGOA 4BLQA 2OQ2A 5IULC 4RZRA 4RELA 4RS4A 3UWDA 1Q95A 4Q7EA 4JV0A 3O93A 1NR5A 5F9NA 5JVDB 2D7DA 5LOVF 3GCWA 5DMXA 4ZO6A 2CBXA 2NO5A 5L45A 4KX3A 4BLWA 5JNVA 3EAQA 4GC6A 3RBVA 1A7AA 1KBOA 3BK1A 4KDEA 1H4VB 3STYA 3NIGB 1PWYE 1BAPA 2OHVA 3ZDRA 1H2AS 4KAJA 4WZBA 1L4MA 4UARA 2IZ5A 1T5DX 5DM4A 2D06A 1LF5A 5GZ1A 3LMLA 1J1ZA 1DU4A 4B7XA 5H81A 4BKPA 1BMQA 3OM9A 4BNKA 4RMHA 4YRLA 3SX0A 2PGOA 2ES4A 2K87A 3OJLA 1DTEA 1NYLA 3FPGA 5M3BA 3IVMA 2BKUA 3KQNA 2YIDA 3JSXA 3P0HA 4J94A 1I14A 3EAFA 2RH4A 3NHYA 3Q5DA 1NSFA 1RTKA 2V7UA 5TVKA 3SBOA 1Z0UA 5DSXA 4TZ6A 3UJAA 1ZH8A 3AU9A 1MGOA 4DV4B 3A11A 1TE2A 2F1RA 4C5CA 3N1UA 5EOVA 4DL6A 4JB3A 2X2OA 3LLSA 3OLZA 2V59A 1BU8A 3HRKA 4V2UA 2Z56A 2A7QA 1ODSA 3QKRA 4FE4A 2PAAA 3QE3A 3GBPA 2WTBA 3BQ9A 1BHJA 4TXLA 2WZBA 3GEHA 1Y5NA 4IDPA 1T1IA 1I2AA 3LDUA 2Z08A 4I4CA 3CSSA 4BEVA 2P9QA 1M2OB 4YP3A 2OSBA 4FFPA 2FPLA 4EG7A 4XIJA 4W9RA 2PZBA 1F8YA 1VCNA 1O8BA 1KY3A 3KU4A 2JA7G 4M9CA 5JWRA 1ZFNA 2BHSA 3RBDA 4L8FA 3UKDA 4WGGA 5GMOA 1QX3A 1LC3A 4FLEA 4X7RA 3H8VA 1H5UA 3ZDCA 2BTOA 2P4QA 4GPBA 1REQB 1JX4A 3V7NA 2XD4A 2EFDB 3L4EA 2IODA 3M83A 2VAVA 4EZIA 3A9VA 1T6NA 1XWFA 2V3WA 4GWLA 2GJ8A 4H7KA 3RM3A 1C9MA 2ASVA 3CX7A 1H8ED 3MSCA 1USGA 1E8NA 2NN3C 2Q62A 2GS9A 5A5EA 4KE9A 1DBWA 4H4DA 4R8MA 4RZXA 4C6HA 2CDRA 3KHGA 4FT2A 2RK3A 4MLZA 4XDYA 3TAXA 2BQRA 1BMFA 1YU9A 2UZ3A 1E79A 3PDIB 2QX4A 4A15A 1TA0A 1HGXA 3AB8A 3BG5A 1E1QA 2HCFA 3KHTA 1WZIA 3TEMA 2OV3A 2G0AA 2NXCA 4BHTA 5I7EA 4OAPA 5H3CA 3H4VA 4H15A 3O94A 4JI5B 5JAUA 2D2IA 3D5EA 2HXSA 4RF5A 3ZJTA 3CUEF 2ZXUA 1MEOA 3OZGA 4DR5B 3WLEA 4UOZA 3KP1A 5E6RA 1EM8A 1Y6ZA 4Y2HA 5BXYA 3BQMB 3ICQB 3IP9A 2YXLA 2VP3A 3KFLA 2LGJA 3NBXX 3H86A 4NU8X 4PWYA 2HWUA 3ZU2A 1L7MA 3NHBA 1KRHA 4DMGA 4BBJA 4DB2A 4RPLA 3FCEA 3QVGA 1D6SA 3NTLA 1W4ZA 3EVDA 5KSOA 4HAUA 1PSWA 3JALB 5IXSA 2OHIA 4CM6A 4JV2A 1G5FA 2Q3FA 5C3UA 1PT8A 1EFRD 1PR1A 2XDQA 3CPJB 4CG2A 1WULS 2REQB 3RVBA 2DFVA 1L8AA 5JEEA 2ZRAA 3Q7QA 4I6JA 4AYWA 3IOYA 4B3GA 2J7PD 3SYRA 3S2ZA 4E4YA 4IQ8A 3EQ9A 1AV6A 1B74A 4WA8A 3BT7A 3Q1LA 1YS6A 2IYNA 2B4QA 2R6R1 4OQYA 1LVHA 2ECOA 3WKDA 2CD9A 4MV5A 4U8HA 3BGWA 4JH0A 1XRNA 3CZPA 3UUFA 2IW3A 1VCIA 1XYGA 4L9RA 4DOMA 5LQUA 1SXGA 4MUXA 4O4HA 3WK7A 4E32A 1XL1A 4C0JA 4AY4A 4C04A 2CHFA 1JH8A 1W88A 2D1SA 1O6CA 2JLRA 2Q45A 3I28A 2OZVA 3L84A 1PO7A 1DXQA 3HXQA 3OY2A 5CA0F 4JLJA 3NPMA 1OTYA 3PQCA 3GN1A 1VA4A 5G4KA 3KTDA 4OX9H 4ROSA 4D8YA 2A9RA 4IIJA 3DDUA 3LQ4A 3TECE 3OJWA 4PIMA 4KMMA 4IWNA 4FYYA 2QRLA 3N05A 3QUAA 1KZHA 4H6WA 3WLIA 2G80A 3DQQA 1X70A 3ZD8A 2GT1A 3BD9A 4RZ2A 4DWOA 3IJEB 1GV1A 2EG9A 2VYFA 2WYIA 2BFFA 2E5FA 2HKIA 3BZWA 4PHGA 1FFWA 3T41A 3L8ZA 3FZGA 3F5MA 2Y1FA 4EG5A 1SCAA 1JLMA 3MT0A 2PO5A 3QNUA 1WCMA 4LMPA 2V0GA 2VJDA 4DLBA 3H97A 3DW3X 5CM9C 4BUZA 5BT8A 1N2XA 4DV5B 4FD3A 3WGGA 1MDFA 4RYLA 1Y1VA 5IFKA 3L2OB 2HHLA 4NENB 4G4SP 3DPIA 3BXFA 3FVRA 3A3NA 2MOKA 2PLWA 4ZV9A 2VYVA 2O52A 3DDOA 3PHJA 3SMVA 3AG6A 1S3IA 2XIQA 2XEDA 3TUZC 2B0CA 1Y1QA 3U80A 4DR1B 1A82A 1C4KA 3L8GA 4Q19A 3D4OA 1BEUB 1JHXA 4DL7A 1Z6YA 2VXYA 1HNZH 2UUCB 5TE9A 1U7TA 5FADA 1JDBB 4KK4A 3QF7A 1G8GA 1GG9A 1PGJA 4PAGA 4GC7A 2QAGC 4LOAA 4KRYA 1EKVA 3T7TA 1Z47A 4NBRA 3RHTA 1QCCA 4RD1A 2YFHA 1ZVVA 3SM3A 2IYQA 3IQHX 3ZX5A 2YFYA 5JY1A 1LKZA 4Y9RA 2VBCA 3IE0A 1T8TA 1P8AA 2JA5A 3D02A 3ORQA 3LS2A 4G5YA 3TDMA 4GLXA 2KWIA 3LXMA 3IEIA 1P1CA 2CXRA 4PXYA 2JIOA 5ICFA 1GL7A 3C48A 3QMMA 4ZO4A 4CV1A 1V9PA 3CB4A 4AULA 4R7ZA 4BMPB 1AQYA 5I8WA 5I7HA 4X44A 2WUVA 5JVDF 1Y3IA 2XX3A 1Y37A 4U7PB 5JWOA 1KZ9A 2JZNA 4DE5A 3DBLA 4O3PA 3WWYA 3GZ4A 4O2BB 5B5SA 4PINA 1XAJA 1UPCA 4P4GA 1A77A 1K1QA 5ISMA 2OH2A 4K6HA 4DLLA 3CZ9A 1YL6A 4MAFA 4FI3C 4C6TB 2FMIA 3CCCA 4C5BA 4TKZA 2YXPX 4DJAA 3LBYA 3HFSA 1F2UA 3OJEA 1SBIA 4FZJA 2ZJ5A 3PLRA 1PQPA 2WG2A 3IAS1 3URMA 4YRTA 1OC2A 4EJMA 5FTWA 4LHVA 2RH5A 2CZCA 3N2EA 3JV7A 2LPMA 4LZZA 3VR6D 1I5RA 1WWKA 2PKCA 3OQPA 3E84A 4II3A 2DQSA 3P9CA 4K87A 3N2IA 4HN9A 3RARA 1AZLA 1X0XA 4IDHA 3IEMA 2O19A 3O38A 4KPUB 4RADA 5B1EA 2W0MA 4XQEA 1XTRA 4B6RA 1VBKA 2JBAB 1AGNA 3OTQA 4EYOA 2AUMA 3SBXA 1UKZA 4YWJA 1URPA 3K8YA 2YU9A 3MTQA 4RM3A 3HDVA 3LO5A 3E8SA 4U4AA 3R09A 4YJHB 4F4XA 4V1CB 4X60A 1W6UA 3DBHA 4MR8B 5EWJA 2ONJA 2YZNA 2QTAA 2ZTLA 3WLHA 1QGYA 3OCVA 2HNAA 4LXHA 6REQB 1KVTA 1T35A 1E1NA 1C4OA 1GOTA 1BWRA 1QTRA 1RABA 2WVAA 2H8GA 2ZRKA 3L6DA 1O58A 1P1RA 2H2FA 5P21A 2IPLA 4RGYA 1DQZA 1G41A 2HK8A 4MI3A 2YFQA 4ER0A 5JS7A 4LJ8A 1PK8A 3FF4A 3DJFA 1CR1A 2K7ZA 3C16C 3RC2A 1FFXA 1UBSB 2XCIA 4R1QA 1G2QA 2NU8A 2RH8A 2CFTA 1JIHA 2HRBA 1Q1QA 2HFKA 5SYNA 3W5VA 2AR9A 2DPGA 2Y92A 1C7ZA 3NBQA 4CDRA 4LF5H 2BHRA 5M7EA 3F6RA 1M10A 1DEOA 2WUDA 2NUAB 4NZZA 3MGBA 4E6PA 4IZHA 3ANLA 4HXEB 3Q7RA 4C7MA 3WWDA 3WLQA 4HQLA 1EGMB 1U8TA 1UJMA 1J39A 1O9HA 4PFSA 2AZTA 3BA8A 2VXCA 3GRUA 3F7MA 4IWXA 2H07A 1FRZA 2UVRA 4CMCA 4OKSA 5DYGA 4IHJB 3D4NA 2IUSA 1CVRA 3G8CA 2DKFA 2IH5A 5SYMA 4K03A 1JJFA 3AP3A 2NZ8A 3V6JA 1UKCA 1BWSA 1EX9A 2RC5A 3H0GA 4JUBA 5FPQA 1QF9A 1NUQA 1JJAA 2ZRHA 4GQBA 4P83A 4UATA 3ESQA 4DL3A 4EPTA 4MNTA 1QTQA 4RIHA 4MPRA 3EVZA 5D6NA 1B93A 3JARA 3RVNA 4XA8A 2QYSA 4WX2B 5DI9A 4BAZA 4D44A 1TJPB 4N03A 1IONA 3HCAA 2BY4A 3KTFA 1SIWA 4AMGA 2QTHA 1YKSA 2FQQA 3LT5A 1P4GA 4J0DA 1YZYA 3ELDA 4A8JB 4FYKA 6ABPA 2LDBA 4RV5A 4JA2A 4KR0A 1IRXA 4QDUA 4JITA 2HD4A 1R6VA 4XPIB 5I9TA 2D1FA 3HOYG 1A0IA 5AJVB 1VP9A 4U7TB 1PGNA 1J1IA 4OLJA 2CV1A 3S4YA 1FUUA 3MPOA 4WH0A 1TVMA 3AVYA 4WOBA 2RARA 2IYAA 3ZWXA 3U48A 4JP5A 4X92A 4EM6A 3ZXXA 1PNOA 3BFJA 4AMYA 3M9MB 4EO7A 1JSZA 3RD5A 1B04A 3EEYA 1J8DA 4YMSA 2PZAA 5DLFA 2L19A 5IWAB 1QORA 1V16A 3OM0A 3SU8A 3MJCA 3W6OA 4DUZB 2WJPA 4X6UA 3FPFA 2VZEA 2H63A 1P1FA 2DLNA 1B16A 1FSPA 3FCSB 1U4NA 1FVXA 3QXHA 3QXCA 2UVQA 4LI0A 2HCRA 2FLPA 4D3FA 2AU0A 3V1KA 3DV0B 4O25A 3PUVA 1WZCA 1XLTC 3LU1A 1M34A 1VXRA 3PWKA 3OQOA 4M3NA 4XM1A 1CCWA 2ISQA 1SZDA 1VMEA 1E7QA 5JADA 2UUCH 5CVVA 4AP6A 2EFEB 3VDMA 2WIJA 4KLAA 4NAHA 1R3DA 1F4VA 1TAUA 1X14A 4JEHA 1SKYB 3GXBA 1H4TA 4Y2PA 3EMBA 3GNLA 1V9CA 2FZCA 1DUIA 1EP2B 1XB2A 4J90A 2R4QA 1AA9A 4H1WA 3FNQA 4PW0A 1VJGA 2QRMA 3MLEA 4AQYH 1EP3B 2BFOA 4JBYA 3KQTA 4I5EA 1NYQA 5DHTA 1YK1A 2ZRIA 4LTNA 4ZRNA 2H1OA 1PHPA 2A59A 4FE7A 3ER8A 1U0SY 2Y05A 2QRVA 2JD0A 5J4VA 1MW8X 2OY0A 3HL0A 1V47A 4TTSA 4FBTA 4G1MB 3T1VA 3U4MA 3BIWA 1TYCA 2B4AA 3UTDA 1VSVA 4MUBA 3N70A 3PK0A 4RPKA 2IH4A 1WB5A 1GFIA 3PUYA 2V74B 2G82A 3WL4A 2HRQA 4IUDS 1ZIXA 2QYZA 3HFRA 3LM8A 1YQUA 3MBIA 1L6RA 4IZ6A 3V4PB 4OGLA 3SJCA 1W5SA 4D6XA 1QAQA 2JA1A 3UWSA 2OEPA 1W1IA 3HYCA 3C3BA 1IIBA 4ZMBA 2RGBA 3KYHC 2H2DA 1Q1AA 3TCNA 1SCNE 3ILSA 5BN4A 4C4PA 1NR1A 2FWJA 2BGWA 2H4HA 2IPMA 3FKIA 1DAIA 3RIXA 1KI6B 4DCPA 1SFRA 4JNCA 3IB3A 3BA9A 3GILA 1RE0A 2VJOA 1CQXA 5LD2C 4EUSA 3U5TA 1DBIA 3CSUA 1JDEA 1GT6A 1N2ZA 3RTEA 4ZVQA 2W7PA 5I47A 1NV8A 1CFJA 1MHTA 3BWVA 3ORSA 4J9LA 1YUBA 4U2CA 4EZEA 2C4UA 4OG2A 1LDYA 2HSWA 1UP7A 4ZT4A 3EC2A 3F6CA 3WHKA 4BVEA 3W5HA 4EQ6A 4OF4A 3THRA 4P2GA 1D6JA 4FCWA 1Y8RB 3A06A 3PHIA 1LNQA 2Z5GA 4DLYA 5ICCA 4G1CA 3TXYA 5JR3A 4O2BF 1SIUA 3SSOA 4O3QA 4UHEA 2UUPA 4KTTE 4HADA 3EPKA 5FOQA 4CMIA 1DEXA 4I6EA 3KSMA 1C4XA 4RF4A 1SVUA 2Z1NA 1TIKA 3UZOA 4YAOA 4G1FA 4V0KA 3T4XA 3K0AB 4B3HA 3SJZA 5JPCA 4C6SA 1V6SA 2R00A 5DXJA 5J4YA 1WXXA 1JLLA 4NKRA 5SZHB 5DRTA 4RY2A 3X1JA 1KMHA 1SXJE 1HR0H 1XXHA 4ED9A 2XCPA 3I5YA 3Q3VA 2YRXA 2WTAA 4ECQA 5JMOA 4HB2A 3PJDA 1ORWA 3IIKA 4OHRA 4R9SA 3H6GA 1Y7PA 3JQ7A 3CN9A 1N56A 3HDYA 2IX9A 1GGMA 2DBZA 1G8PA 2WYUA