4UCUA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucuA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucuA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucuA02
4AQYB 1FJGB 4GKJB 3T1YB 5FPOA 3VNNA 1XK5A 4DV7B 5LMNB 4EQ5A 3OTOB 5LMUB 4DR1B 4JI0B 3QWUA 1I94B 4DR2B 4DR5B 1FVIA 4DV0B 4JI5B 2HVRA 4YY3B 2HVQA 3RR5A 4UCVA 1P8LA 2VUGA 1HNWB 2UU9B 1CKNA 4LF6B 1P16A 4LFAB 3SGIA 1HNXB 2UUCB 4NXNB 4CC6A 4JI1B 3PN1A 3GB8B 4DUYB 3BAAA 3NC0B 1CKMA 4LH7A 1A0IA 4B3RB 1XMQB 5IWAB 4DV5B 1IBLB 1IBMB 1TA8A 2OWOA 4DV2B 4DUZB 1V9PA 3S24A 1DGSA 4JV5B 2VQFB 1XNQB 4DV6B 1HR0B 3W5OA 4DV1B 2ZM6B 4NXMB 3JSNA 4UCSA 1TAEA 4X65B 4PZ6A 3JSLA 2CFMA 3W1BA 4LF8B 4LF5B 4B3TB 4UCTA 3KYHC 4DV3B 3NBYB 1IBKB 1X9NA 5D1OA 4LF4B 3GDEA 4DRFA 4TOIA 4JI4B 4EFBA 4DR3B 3BABA 4UCOA 1XMOB 3W1GA 4LFBB 4EEQA 4B3SB 4LF9B 5FPRA 3TY8A 4B3MB 4JI2B 4JYAB 1N32B 5DISC 3NBZB 2UUAB 4E6NA 3TY9A 4UCRA 4X66B 3TY5A 4X64B 4DR6B 4K0KB 5BR8B 3UQ8A 2F4VB 3BA8A 1XDNA 2HIXA 2UUBB 1VS0A 2HIVA 1HNZB 3L2PA 3BA9A 4LFCB 1XNRB 4JI8B 1J5EB 4LH6A 1CKOA 4PZ7A 2Q2TA 3GJXB 3RTXA 4JI7B 5D1OB 4EFEA 2VQEB 2UXCB 4YHHB 4DV4B 1CKNB 4DR7B 5D1PA 4JI3B 4DR4B 4LF7B 1ZAUA 4OX9B 2Q2UA 2UXDB 1S68A 2E5LB 1N36B 4UFZA 4CC5A 4JI6B 2HHHB 2HVSA 1N33B 1B04A 2UXBB 1N34B 4UCUA 4GKKB 4PZ8A 4GLXA 4X62B 4KHPB 3T1HB
chains in the Genus database with same CATH superfamily
3CEIA 3AG2C 5FPOA 1KKDA 3VNNA 2JS3A 1IVSA 3RW0A 5J2UB 2EX3A 4TQRA 4ZI7F 1E1RG 4YY3B 2WSSG 4FS2A 3GTOA 2VUGA 5EBLC 5EK0A 1M93A 3N27A 3GIIA 4O4LB 3SYOA 4JI2H 2YZMA 3HKBB 1W93A 5LP6C 3OHAA 2FK2A 3IFXA 2EIJB 3E5NA 4HQ6A 1J5EH 3N41B 4J9LA 2PTMA 5LMNH 1OCRB 3M9OB 3JASA 2JA5A 3ABUA 2QJ1A 3Q8RB 4G28B 3HKEB 2KSWA 3H9VA 3CCRV 4IHJB 3UZOA 3PJSK 5LOVB 4ED2A 4TV8A 4K8XA 4C5AA 4KFMA 2NU6B 2DYRC 1TAEA 4X65B 5IJ0B 1XEQA 4FM9A 2Y0IA 1HWYA 4WBNF 3ZIAG 2ZT9B 1FAFA 2DWDC 1EZJA 1L1FA 1ZL8A 2WAQA 5KT7A 2QYZA 5D5PA 4PBCA 2GV9A 2JEUA 4MTOA 5EYPA 1IZ3A 3CB2A 4RQFA 2N74A 1M1KW 4WHXA 4IIJF 4I4TF 3T2MA 1EKVA 3OT7A 1FPOA 1WH2A 2ZDIC 3AYHB 4LFBB 1I1MA 3JAMN 2JRIA 1GKFA 5FPRA 5JQGB 2ZDHA 2JA6A 5DQGA 1GSAA 5EZYB 3TIGA 2L6LA 4LF7H 4CS3A 1QLEB 3MWDA 2JGDA 3W7XA 3AG3C 1N48A 2YSUB 5KAIZ 3RYCA 1B3QA 2XAFA 1XNRB 1P84F 2JJ1G 3RVZA 4I9QA 1OJHA 4PELA 4DW1A 3T5KA 4GKJH 5DMXA 1MABG 3HOZG 1XUQA 1JJ2U 3OFNG 2ZR2A 4J9ZB 1EKPA 4RB2C 3GIDA 1AR1B 2E5LB 1GH6A 1N36B 3W7TA 3AX6A 2K1EA 4YIPA 4FM1A 1LNQA 2HHHB 1W0KG 4B7KA 1B04A 4MTGA 2W7OA 3SYQA 1PM9A 4YJ3A 3G4SV 4KHPB 4MV8A 4LF4H 2QK4A 1F4NA 5A9GA 4H13B 3V6JA 5ITZB 3T1YB 4NTWA 1QLNA 5LMNB 5KG1A 5KLVH 3GTKA 2Q9LA 3OTFA 5C8YA 4DL4A 4EB6A 4DV0B 1T5EA 2KG7A 2ZM6H 2ASLA 5B1NA 1VQ4V 3ASNB 4FFNA 1C3OA 2R6FA 2X7RB 5KFOA 3Q2OA 1YIJV 5LHHA 4A3FG 2W6ZA 2KB1A 4GC6A 4FBUA 5C8YF 4JI7H 3GTQA 1L0LH 4WFGA 5EC1C 5J2TF 2IJIA 5I5SA 2HG5C 1DLBA 4P30A 3RJ0A 1S97A 4X8AA 3BY6A 4M9UA 1JOYA 4QPKA 3VPCA 1EN4A 3ICXA 4JAAA 3Q8QB 1IBLO 4XDLA 1XMQB 3MR5A 4IRDA 3JAKA 5EZYA 1HP8A 2LO1A 4GCZA 2YZNA 5A2QN 4J9MA 1CQIB 2R92G 5GTHZ 4JV5B 1RSOA 2Q67A 1XNQB 5HFMA 2EZPA 5BWVA 2IJHA 1AI5A 2DJVA 4XBFA 3GVMA 1NT2B 1WNSA 2X6BA 1QQCA 3BPZA 3KHLA 3TGUH 3OGCC 1GMGA 4X1YB 5GW7A 5I5WA 4RZRA 4RNMA 3EPGA 4JI4B 3M8AA 3JD1A 1B06A 2BOBC 1QLEC 3ZBHA 2HG8A 1SZXA 2IBZH 4JASA 5KHJA 2ZE8A 3AG3B 4RUEA 2HGWA 4DR4O 1TVKA 1ZTEA 1AR4A 4JYCA 1QVGU 1ZLZA 2FE3A 3ETDA 5DGBA 2E2HA 5KG3A 2FTKA 4Q20A 4ABMA 4DO2A 5I5VA 2UUAB 2OTJV 2HHHO 5KG4A 3O9OA 4J9SA 1QCEA 3I4MG 2YC0A 3GV8B 1TUEB 4K6NA 4DR2H 3UQ8A 5BWUA 1M57C 4C7UA 1GN2A 5LMUH 1LR1A 2FPPB 3OR6C 2DWEC 1ZSPA 2AHYA 5H6RA 5H80A 5I60A 2E74B 5CAEB 2OYQA 2J6SA 3AG1C 1UNNC 1OCRC 1SA0B 4Y8VB 4EYIB 4X65O 2UXCB 2COGA 3H1JH 4WFHA 5H6QA 1N32H 2Y48A 1K1SA 1THZA 4B3SO 4E4EA 4LF9O 4ECWA 3RFCA 4EGJA 2I87A 1JA8A 3E35A 4LBEC 3SPJA 4EYHB 2DYRB 3IN5A 4A3GG 3E8HA 1BZKA 4DV7H 2XHBA 5L3DA 3WO0A 1OZ0A 1E4FT 3IC9A 4DV0O 4O81A 4IL6Z 2CNUA 1M7JA 4OPAA 3SI8A 1I6UA 4TV9A 4L1KA 1RM1B 3ZHVA 3DF7A 1KJ8A 2W70A 4JV0A 3UT5A 3PW5A 1S10A 1V55C 3RGZA 1WP8A 1FKAO 1NZ6A 3UCSC 3E2EA 2JGUA 4LFCO 2DPIA 4JV5O 2Q5ZA 4JI1H 5JH7A 3RYFB 4ZHQA 3K5OA 3JAMW 1P16A 4RAYA 3RWRD 4RAIA 2CTRA 2ZE5A 2AGAA 3JD0A 4KXRA 4D7TA 4NXMO 1VQPV 2OCCC 2L35A 3RB3A 1K83A 2DQ0A 4P9PA 1JR9A 2IU3A 3NC0B 1Q6HA 5HBRB 3B40A 1DV2A 2XUMA 3STLC 1BS3A 5LP6B 1AR5A 4ZI7B 4FMTA 4MTXA 2EIJC 4C5BA 1MSDA 1MZFA 3WG7C 4IWXA 2LQTA 5KT4A 5KFCA 1BT8A 1B6RA 2X0LA 1EUDB 3QVNA 5KFPA 4MV1A 4DV1B 2GDSA 3H3VH 2V7QG 1S5HC 5JWPA 2DABA 5DG8A 1EFRG 1RJRA 2CFMA 1OCZC 3N2GA 5IY5C 5L3BA 1A3GA 1WAZA 1J5EO 2F23A 2FK1A 3CWBH 3LSUA 5GONB 4J9RA 4QJFA 1NBMG 4MTFA 4O4JF 2C35B 4LF4B 2UXBO 1VQKV 1KJ9A 2FB5A 5KFWA 1SESA 1H2MA 2YICA 3CC2V 1DAAA 1K4CC 1XMOB 4UUJC 2AHZA 3I56V 2WA3A 2WLNA 1N36H 2QE7G 2EILB 1Y4MA 3DXRA 2W57A 1XNQH 4I50B 3RB6A 2OLSA 3ASNC 1SEIA 1QHTA 3MR3A 5CBHA 1YITV 2HLDG 1JDEA 2SCUB 2NUAB 1Y76A 1BNCA 4DR6B 4FFLA 5I5TA 1IXBA 1KUQA 2F4VB 1M6VA 1DTOA 4ME6A 1JQ0A 3CJHA 1T94A 1FFXB 4DR6O 3ZMVA 4MA5A 1CKOA 3K06A 2Q2TA 3G6XA 3PW4A 1M0WA 1URFA 3JYCA 3RYFA 5LXTA 4YHHB 3EFFK 5FD5A 3K9AA 4LF7B 2YCHA 1YTFD 1N34O 4R50A 1OCCC 2R93A 2DMXA 2P4KA 1BHBA 2ZGIA 4CKCA 4A3LG 2CTWA 3J81N 4DUZH 5LBQA 5KFLA 3HXLA 3N8DA 4KHPH 4B3TO 3A8TA 2QGNA 4U6PA 3G6YA 5LA6F 4YXWG 3QWUA 4IR1A 2X6AA 1XNRO 1HR0O 1O75A 1VF5B 5K1XA 4DUZO 1E4GT 1IX9A 5TISZ 2ZR3A 4I55A 2LP7A 5JJNB 5H5NA 4LMYA 1C30A 2ZQMA 4CS4A 3ETJA 2ZXWB 4YY3H 3C3SA 5E1AC 4TUYB 3GV5B 2BR0A 1Y74A 2LGQA 3HB9A 1RP3B 2R86A 3UYYA 2XGPA 4O86A 1M4UA 4TQFA 5KFIA 2LJ2A 5IWAB 3FB6C 1HNWO 1IBMB 1Z5WA 4I50F 2Y0SE 4LFAH 5KHIA 4X62H 3CHXA 4D7SA 5HFLA 3SJBC 4RAZA 1D5AA 1IOVA 3L75H 3JSNA 1FXKA 4YAJB 3E86A 1UFIA 2KQXA 4OX9H 5IP9G 1EM1A 1AJNA 2DW4A 1G1XB 3B4SA 2W6PA 2OCHA 1PP9H 3PW2A 1XQ8A 2RNBA 3ORRA 1Q6UA 1X9NA 3EYYA 5DAAA 2PI4A 5HV6A 5LXTB 5JH7F 1GSOA 3J80N 4JI8H 1RM1C 3T5HA 4EG0A 2NU8B 3OM3B 2OT5A 3OUFA 4UVCA 4EEQA 3K08A 2QKSA 3E83A 4YIOA 3MAQA 3FKIG 1GN6A 1SETA 1KJJA 5LL6Y 1G6UA 4ECZA 5DISC 2DWCA 3I5DA 4TT3G 3KAJA 3M99B 2GUZB 2Q8VA 5IYCG 2FLPA 4JI8O 4GKJO 4DLKA 4DR5H 2HHFB 5KFEA 4FS1A 4O4HF 4G27B 3OAAG 3L2PA 3RBZA 1N33O 2YS7A 4JI8B 4ECUA 5EBWC 2HJFC 3MHSC 1KQSU 4J7JA 4MV3A 4R6ZA 1FJGH 5DLFA 1M57B 4MVMA 1RYRA 1N32O 2AU0A 1YZBA 4LF6H 3Q1KA 4RNOA 4FJCC 4YHHO 1WCMG 5KFZA 1VIBA 2P67A 5KG5A 4ASUG 4FLVA 3BHPA 2XC9A 5BMVB 4ZBMA 3ZRWA 2JEFA 3SE7A 1XOUA 2GPWA 3G71V 4O2AF 2WLMA 1NH2D 3FYIB 2W6OA 1KTAA 1K5SA 1F51A 3JCUZ 5IYZA 3RBEA 4F6EA 1N8RW 3OHBA 4EQ5A 2W9BA 3OTOB 2W9CA 4AI8A 1I5YA 3ZHTA 3PO2G 4TV8B 1ZQ7A 3UZBA 4HNTA 2FMAA 2ZIMA 4J0MA 3AG7A 1FD9A 3FAVB 1H2NA 3BEHA 4UCVA 4PDRA 2FKLA 3WB0A 2FYUH 3HKCA 4RB0A 1WPBA 2ILMA 5C1OA 5CA0F 4J10A 4CH5A 4B3MH 2UUCB 2R9RB 1MA1A 3EVKA 2JEXA 4DRXA 3V4ZA 1GYFA 4X1KA 1YF2A 4HYKA 1B6QA 3K5NA 1PV0A 4LH7A 4LC1A 4WFAV 1JPXA 3GV7B 2QTSA 4CH3A 4A3DG 1QR9A 1TA8A 5KFQA 1F23A 3S24A 3ZHSA 2GUZA 3ABLB 2Q68A 1R3KC 3GB7C 4O4LF 4CMDA 1XL4A 2YWVA 5B66Z 3MJFA 3AK2A 3J80W 2ZKOA 4O4HB 2YIBD 2DAAA 3M4IA 1SC5B 5BZBA 4R8UB 5CA1B 3J81W 1OCZB 1V4YA 4I55F 2WDTA 1ZWIC 4O4JA 5IY5B 1PX2A 2W6QA 2EIMB 4DRFA 3GIMA 4BBRG 3WU2Z 1I2KA 5JVLA 2CK3G 4FFPA 3LDEA 3K0GA 1WJZA 3R66A 5BMVA 2CZGA 4O7VA 3F8NA 4Q4DA 3T5JA 3BRCA 3E22B 3H40A 3HKEA 3T9FA 2NU7B 4K8ZA 4DV2H 2Y0SA 1EN6A 3X2QC 5IWAH 5ITZA 1AP5A 3OMNB 4I0XB 2UUBB 2CQYA 4YR3A 3T1CA 1WRVA 3BA9A 2ADQB 2EJ2A 1AI4A 2XTAA 5JQGF 5KX5A 5IYCO 1PL0A 2LW1A 2FL4A 1K73W 2YIBA 1GSHA 1SZTA 5LL6b 1D2DA 1PK8A 1FXHA 4F4YA 3KXYT 2HJDA 1WA8B 2V4DA 4A3BG 4JTDB 4O7LA 1BE3H 4BR6A 4MV6A 1VF6C 1HW7A 3SYCA 4TVIA 4QW9A 2CTPA 3W7SA 1S3JA 4UCUA 3CS5A 4FK5C 3VPBA 2W8LA 3SJQC 3P32A 2RCVA 2ZNJA 2R7ZA 2VOBA 2V4RA 4P2ZA 2LFRA 1EZVH 2Q7HA 4O4IF 3VQWA 4BY1G 4KP4A 4G3IA 1NKDA 4WBNA 4Z1MG 2YIDA 3RB0A 2KKWA 1S0MA 5BYBA 2PGGA 1OBGA 4ED8A 1T36A 2EIYA 4NR1A 1K3EA 2DZDA 4DK0A 2IJJA 2UU9B 4JI6O 2CE4A 2IW5A 3BCCH 3H1HH 2W71A 4QWCA 1H8HG 5IE9A 4MVSA 4JYAH 1US6A 4JI1B 5FLXN 3CCQV 2B63G 4ZOLB 1Z2GA 2PI5A 2QKCA 1IOWA 5EIBD 4FFOA 4RCNA 5L1IA 5BY1A 1COWG 4UUGA 2ZXWC 1K9MW 3PR4A 1IBLB 3ZHUA 2OWOA 2FPIB 1TWCA 2B1GA 2VQFO 4HNAA 5L1JA 2B1IA 3F5WC 3N2KB 1LUVA 3RVYA 4H0LB 5KFFA 2H8PC 5C8YB 2F66C 5DLGA 4JI1O 1R73A 2R7ZG 1YTFB 2R7KA 3P3NA 1QVFU 2CH7B 3U11A 3RN4A 4X1IA 4A3CG 1O9GA 1F4MA 1Y1WG 1XHZA 4NTXA 4B3RO 3NUAA 5E79Z 1VQ9V 1VQ7V 4TWKA 4UB6Z 3SJCC 1AROP 4FFRA 4FFKA 1CEZA 1W0JG 4FLTA 3T1HO 2K9PA 4DR7O 1KBLA 3D3QA 2JA7G 3ETGA 2YIAA 4DV4H 1DK1A 3K3WA 2YS6A 5KHGA 2V5AA 2FLLA 2QWRB 4PDLA 1KT8A 2R70A 3ZRVA 4FZ0A 2BTQA 1RJPA 2EZOA 3TW6A 3MFHA 3UT5B 1XDNA 2WWWA 4JI0H 2XGQA 2XAHA 3DTFA 5KS8A 4FVMA 1VMGA 1WLEA 4ECSA 3RTXA 2XNDG 4FM0A 2QA4V 3T5LA 3G6BA 4J80A 2R8HA 1NVPB 4CHIA 4MVQA 5DGIA 2QWQB 4FZ1A 5AG2A 1YI2V 2WYOA 1V51A 4ZOLA 1HNXO 4DAAA 4JI5H 4UFZA 3K3VA 3APQA 5EZYF 4TUYF 4QIWE 2BSKA 5JQWA 2OIGA 5GTIZ 4QE7A 3ZN1A 1P8LA 5KKNB 1GAXA 1IBMH 4APMA 4JI3O 3ZRSA 3CCJV 3QQMA 2QM7A 2O03A 4LFCH 2NNUA 3FFQA 1YCIA 2LFSA 2Q4PA 1OWTA 2YZLA 3RR5A 2LW7A 3D3IA 3F7YC 2BE3A 4JI3H 3M9MB 3KCYA 1BQZA 1IDSA 4IHJF 3SGIA 3CX5F 3CQZA 1AJQA 2YEVB 3VOUA 3JZIA 4X1IB 3RGXA 2JIZG 2ABJA 4O3NA 4Q45A 3K0DA 5H9CA 3X2QB 3OSNA 3OEHG 5C5JA 3K5MA 5F9LA 1K7DA 3LQSA 3OEEG 3OMIB 4B3RB 4DUYH 2QTOA 1DF4A 2E2IA 2XT9A 2AGPA 4Q8FA 5KT6A 2ATKC 1CE8A 4UB8Z 5KFTA 3AG1B 4U3JA 4EGQA 1M0TA 3I12A 2IJKA 2BQRA 3B8NA 3GIJA 5JJJB 2CUGA 1KBHA 4O3RA 1CXZB 4DR1O 2UUCO 5DN6G 5KX5F 2W8KA 2YZGA 4RO2A 4HBNA 4NVPA 1FFXA 2YRXA 3KYHC 1XILA 4F4WA 3NBYB 3CCEV 2FLNA 4DK1A 5D1OA 2QF7A 5C44G 4DR2O 3ABTA 4DV3H 3ZEDA 3BQ0A 4O2BF 2Q0OC 1N36O 4UCOA 2YW2A 3MHHC 4FGRA 2F4VH 3IGAC 4LNUA 2BSKB 2X0SA 1HNXH 5DM6V 3GTLA 5KMGB 2ZCEA 3RYIA 4MVZA 1DV1A 5LHIA 1EUCB 1KJIA 3JARB 4MV4A 3RAXA 3EXAA 5BR8B 1VQNV 1GTOA 4X20B 4DR1H 2DN9A 2OCCB 1A48A 4J9OA 5FLXW 4J9QA 3R5HA 4XDKA 2QB5A 3ASOC 3MD0A 2UVUA 4YP3A 4QJFB 1CQJB 1CKNB 1VF7A 5KUMA 3WG7B 3HO8A 3MWMA 4DV4O 4LF8H 3ZX6A 2Q2UA 3QNEA 1SQBH 4H44B 1N0JA 2WLIB 2E5LH 4JTCB 5IWAO 1D5NA 2YRWA 2QWNB 1ZUQA 2P22C 3KREA 3M7MX 1N33B 4F50A 2YDEA 4DL5A 2Z0AA 5B1AB 3GILA 3J7AK 2VS0A 3T9AA 4RNNA 4NTYA 2HP8A 5L3EA 3G8CA 4AQYH 4BY7G 4O3OA 5EWFA 3P30A 4JI7O 2IH3C 1Z2NX 3JZ6A 3U9TA 5CA0A 2Q73A 1M90W 4A3KG 3T7AA 1JFFA 4F6RB 3N6XA 5IDJA 3JATA 1K1QA 2R8KA 4JAUA 5D5QA 3CSWA 3A2FA 2WB1A 3D36C 3CRQA 1YEWA 3C90A 2Q7DA 4A5UB 3THOA 4ECQA 2F95B 5FR9A 3DC5A 1YJNV 3BAAA 3WNZA 3K59A 1XMOH 4NZOA 1L0NH 1K4DC 3RYHB 5LGTA 1HDJA 1EN5A 4LNUB 3ML0A 3TXQA 2VWJA 2B9ZA 1BSMA 1WSCA 1KC7A 3ZMTA 5J2UA 1Q7YW 3C0FB 5FLMG 4DL6A 4JI6H 4NKGB 3LSQA 4A2BA 4FU0A 4NXNO 2RQ6A 1OCCB 3JSLA 2Y69C 3PR5B 3EPIA 1PL4A 3OTOH 3CXHF 4O4LA 4DV3B 2Z02A 1P4RA 3MR6A 2F4VO 4XX0B 2W6IG 3B2EE 4A3MG 4B3RH 3VQVA 1MZEA 4DR3B 4TM5A 3H1IH 3KHHA 2R87A 4QSHA 1PNMA 4GLWA 3JASB 4JYAO 1HR0H 2R7NA 5EIBC 4DL3A 3Q4HA 3K9SA 3C3TA 3Q8PB 5LOVF 5DECA 1I3QA 1YSCA 2WLHA 2Y4TA 3ASOB 3UKMA 3PW7A 2W9BB 3OMAB 4JZ2A 3SR2C 3TETA 3AG4B 2F93B 3ORQA 1J5EB 1H8EG 2Z3YA 3OTOO 3CD6V 1SYXB 5KG7A 3VMMA 4I9WA 1KD1W 1YHQV 3UFXB 5H2FZ 3U0ZA 5B1BC 3KCXA 4PDVA 4X62O 2J9GA 4B3SH 5JQGA 2QM8A 4IRCA 4CC5A 2PMZA 4IZOA 2COJA 3HOYG 3G6VA 2ARHA 1P49A 2XCPA 2MCTA 5IP7G 5LYJA 1A0GA 4I7ZB 4BWSC 2M6YA 2UXCO 5LGUA 4DV7B 4L87A 1EZ1A 3CPWU 4U3FH 4DR2B 5I5XA 3N40P 2IMWP 1BL8A 1IBKO 5FD6A 4R7CA 1KYOF 2YI8A 3BVOA 1HNWB 4PDBA 2Y0PA 1MMMA 1AVMA 4KUMA 3ETQA 1JX9A 3R65A 1N0NA 4YQWA 3HT5A 3LUTB 3J7AU 1QR8A 1UPGA 5L9XA 5L1LA 4F4ZA 2NU9B 3KTMA 1JXLA 2IBKA 2W6NA 1TWHA 3HKZA 1R6TA 5KFMA 3RIZA 3N42B 1A0IA 1IYEA 1GO3F 3U0GA 4LWSB 1AJPA 5CA1F 3L4KA 3GTJA 4A3IG 1L8DA 5CN0A 4CKBA 3FD9A 1KB9F 5IJ9A 4DUZB 5FJ8G 1DGSA 4K35A 4Z1VA 1GN3A 3MFIA 1JKJB 2Y4UA 4J9PA 1U97A 1Y14B 1VP7A 1HR0B 2ZM6B 2JEJA 4NXMB 4O7ZA 1Z2OX 4LF5O 2ETNA 2FJZA 2V4QA 4O7WA 2JA6G 1BMFG 5JCOC 3HKCB 3DC6A 4JV2A 1P7BA 3E8GA 3STZC 1JJOA 4PA4A 1I1LA 2QSAA 2XD4A 2ZDQA 4IIJA 5J2TB 4DR5O 4NZNA 4X88A 4MVUA 3VOTA 1GN4A 1JX4A 4JV1A 4EFBA 2QKAA 4DW0A 1GK9A 1WA8A 3ZJZA 4Q8EA 2ZIOA 4JI2O 2NN4A 1R6NA 4C5CA 1RYSA 3T9EA 3HR0A 4WF9V 3I55V 5LYJB 4YHHH 1RSOB 4ZQIA 1WB8A 2FKXA 1QU7A 4UXNA 4X9QA 1IYDA 1KP2A 4LSAA 3L74H 4JUZA 1JVMA 4F4XA 1IXMA 2B5UA 4N23A 3L72H 4K0KO 2H94A 2HIVA 4PA3A 2VUMA 2RGVA 2V9WA 1BHAA 3TQTA 1YDXA 3PO3G 3WB1A 4NXNH 2GPSA 3UM7A 2CAZC 3K03A 2R8JA 4TSFG 5L3GA 4PD4F 4K3AA 3VBBA 5D1PA 4XYLB 3HKBA 2EJ3A 2WAMA 3DTUB 4Q43A 1XMOO 2R84A 3KKYA 1EYZA 4QIWA 3ABLC 4XYMB 3E22A 1B33N 1MG1A 3JAWA 1N34B 1S72V 4LWSA 2COIA 1AUVA 2CW8A 3HKDB 3CE2A 4CZZA 3B09A 4ZOLF 3QO7A 1BCCH 3OGIB 5LOVA 1Y1WA 1VKZA 3UO2A 3SDLA 3KALA 5BWRA 1I94B 2EIMC 5I47A 3TJTA 1GO3E 1SQPH 1E79G 2WA4A 1F7YA 1P7GA 5EBMC 5KX5B 2X5RA 2VQDA 1BJTA 1Y1VA 4Q4CA 1ZL8B 2CH7A 4HYOA 1XHXA 4O7NA 1H2SB 2Z04A 2QEXV 1R3JC 1TGOA 3PN1A 4QW8A 3FB8C 4DUYB 5BMVF 5LHGA 5J9PC 3PW0A 4N21A 5I5YA 1R3IC 2F1MA 3ZMSA 2C22A 1V54B 3ZMUA 2Y4RA 2GHYA 3AG4C 4HN2A 4DV5B 2E5LO 2ASJA 2ATLA 2VQFB 2J6TA 2WLLB 5B1BB 2PF4E 4NYKA 4X66O 4PZ6A 4X65H 3PZPA 3DTGA 1RK5A 1NI8A 2VRZA 2NVXA 2D3OW 3R5FA 3W1BA 4IGGA 1K8AW 4LF5B 4GC7A 1X59A 1FKAH 2YYAA 2R72A 5B3SC 5T14A 2P5OA 4GYCB 1FXVA 1UC9A 4QWEA 5CBGA 5IYBO 3W7UA 4KL1A 3ZN0A 2EULA 3LDCA 4ZI7A 5LGNA 4A2AA 4DL2A 1H2LA 4Q44A 4FM2A 2YUAA 4TQDA 1SKVA 4JI2B 3CRCA 4HNAB 2HR3A 4YJ3B 2R85A 4DL7A 4Q6GA 2UXCH 2I80A 3WWIA 2GLTA 4WD3A 4GX5A 4WFFA 5BWWA 4LF9H 1W59A 2ZE7A 3U9SA 1WN7A 3BA8A 3I4NG 5IYDO 2YXYA 4WCEV 3RV3A 5LMUO 3DSQA 2JA7A 5GONF 1AB3A 1RJQA 1N4CA 4EFEA 2UUAH 2HGXA 2GQSA 4O2AA 3CC7V 2IP4A 3E89A 4FLYA 2Z5UA 2CNVA 2PYLA 4O3PA 5DG9A 4DR3O 1XL6A 2JA8G 1S0VA 1I7NA 2VA3A 4AYBE 4PZ8A 2E75B 3G80A 4TV9F 4NYEA 2AGQA 3JAKB 4DV3O 2BTQB 2HEPA 4O4IA 1M56C 4U3JB 1R1BA 2WLLA 1SQVH 2MW2B 1OBDA 4XDJA 4MAMA 3CJHB 3F5TA 1NTMH 4DR5B 2AZ0A 1FYJA 1O9HA 4O7YA 4JI5B 1KC8W 2R7MA 4UVBA 1T3NA 4YJ2B 3QFFA 2HGSA 2JK5C 1AI7A 4X66H 3RV4A 1VF6A 1K5QA 3O65A 2ZDGA 3VPDA 2UU9H 1QBZA 5KT3A 2W0XA 4IYIA 1G2WA 3U10A 3K57A 1NS1A 1I1KA 5E25A 2WTFA 1I08A 4MVRA 4DUYO 2A7WA 1AN7A 1ZETA 4BWAA 3FKIA 2ASDA 5K2MA 2XIGA 1SQFA 1TVKB 3V4SA 3CRAA 2ODTX 5KFYA 2OIEA 3V6HA 5KMGA 5LA6B 4O3QA 4OX9O 3VQXA 4MS2A 5EDWA 4WFEA 1XDCA 3MWEA 5LMNO 3H1LH 4AHCA 4G2KA 2WLKA 4LFAO 1XNQO 4J7KA 1K33A 2R9AA 1IBKB 4LFBO 3M9NB 5F9NA 4TUYA 1IBMO 4QWBA 2UXBH 3ABMC 2EJ0A 3OUSA 2HHHH 4DV7O 4YY3O 1KUTA 3JD4A 2OH2A 5CBFA 2C2DA 4JPRA 3GTPA 1VARA 3NBZB 3GIPA 2N04A 4RQEA 4W4KA 5KG6A 4TV9B 1XREA 2OTLV 1LUWA 2UUBO 2O57A 4EBCA 5KHKA 1HNZO 3JZFA 2C2RA 3E8BA 5D8DA 1Q43A 2DYSB 4F6RA 4AILC 3K5IA 1SQQH 4LCUC 3GJXB 2VUMG 4PHZA 2P4VA 3JATB 4YJ2A 1FS0G 5JH7B 5LXTF 2VQEB 1CS0A 4RU9A 1Q90D 3HKZE 5KFSA 4BXXG 3TW7A 3CRRA 1N33H 2GBOA 2Q0AA 3KZIZ 5JVDF 4DV1H 1SFOA 1M56B 2VPSA 2UXBB 4R7RA 5LP6A 4Z2WA 4CKEA 4GKJB 1J95A 3ABKB 3R9RA 4JF3A 1VQMV 2WAQE 4A93G 2HHFA 4UV9A 2ITDC 4B3TH 5IT9N 1HNZH 2ZM6O 3RF2A 2JEGA 1VQ8V 3H20A 3N6RA 1VQ5V 4CH4A 2XAQA 4PI0A 2HVRA 3SPGA 2W6MA 3N2GB 4DQNA 2EINB 1CKNA 3K79A 3RGBA 2R9IA 4MTEA 3P3PA 2NLJC 2ALZA 5JJEB 3GB8B 1G4YB 2PUSA 3TEKA 4LP8A 3QTCA 5JCOA 1VBHA 4I4TB 2UVWA 5KFVA 3KAKA 1NU1H 4IRKA 1K92A 3KHRA 3DXRB 3R23A 1SERA 3NGDA 3G67A 1R9TA 1ZX3A 2M7WA 2IH1C 3Q4HB 2V1DA 3K3PA 3H4DA 1S03G 1TUBA 4DV2B 4FLWA 5EC2C 3ZRXA 2JEIA 3PFFA 3ETHA 5KG2A 3NXSA 4M0JA 1S0OA 1E4EA 1RPOA 3B77A 4J11A 2DOSA 2IA6A 3RB4A 4J41A 2P6JA 3FAVA 3GWOA 5DEDA 1VBGA 2GTSA 1OCOB 1ULZA 4EEYA 3ABMB 3UO3A 1NVPD 3K5HA 2XCLA 4ED6A 3KHGA 2RDJA 4EBEA 3H01A 1S76D 2R8GA 5C93A 4J9YB 4X1KB 5B1AC 4E4TA 3G8DA 3JD3A 4O2BA 2HDKA 4IR9A 1K97A 1WPXA 2UXNA 3RYHA 5DQIA 5KFUA 4BAYA 4MW8A 4X64H 3IC7A 3JALB 3WWHA 2A06H 1VQLV 5IT9W 1PD3A 3CRMA 4E6NA 3TY5A 4NZMA 3RBDA 3MR2A 3QF7A 2F43G 3W7WA 3T9BA 1H2GA 5KFXA 4O4HA 4U7CA 4DR3H 4LFCB 5FNVB 1Y1VG 1NJIW 1B6SA 5CA1A 1JIHA 4I55B 2FMLA 4ECRA 1JLLB 2B63A 4JI3B 5KAFZ 2EIKC 2EJRA 4QGPA 2XAJA 1Y6XA 3MDSA 4A3JG 3CVZA 1FFTB 3CMAV 1Y74B 1Q81W 4I4TA 5B5EZ 5KFHA 4GKKB 2V58A 5KFAA 4PJ0Z 2Y69B 3HOUG 5IYZF 2NR5A 1GM8A 3L70H 1GM7A 1ORQC 2R82A 2IU0A 4ED1A 3OSPA 1SF9A 3TXSA 4ED7A 3ZHQA 4I7HA 3PVXA 2CGOA 4I0XA 4U7OA 1YJ9V 5BWTA 3GTGA 2CKZB 3JRWA 1AILA 5KFBA 2QWOB 1S0NA 2R8IA 2JA5G 4DR7H 4LF6B 3TIIA 4LFAB 1N56A 2A79B 3U54A 5F2VO 2RDCA 4FFMA 5KT5A 1SCUB 4LF4O 4CC6A 1KMIZ 1XMQH 2H3OA 1NR1A 1SRYA 4HNUA 2CGNA 4ZHQF 1CP9A 1VAJA 2DYSC 4DV1O 3GIKA 5BXZA 5BYAA 2EBOA 1EHIA 5L3CA 3RT3C 1N34H 4YJ3F 4NB5A 4XZ3B 4LF5H 3W5OA 4BIOA 2C2EA 3D36A 3VA7A 1I94O 4QWDA 5HNEA 3FX7A 2ITCC 2WLJA 4LF8B 2VQFH 5IYBG 4MA0A 4MTDA 2PYJA 5KUKA 1I7LA 1DF5A 4F4LA 3T1YH 4FBTA 3OUUA 1IBLH 4DV2O 4KHPO 5EOYA 1JDBB 3QZ8A 2AW9A 4X64O 2WE6A 4AYBA 3R5XA 3BJYA 1XNRH 2CNQA 2BOCC 3ABKC 2P90A 3RUPA 4IAJA 3FYEB 4B3MO 2J6UA 3ZRWB 2GQRA 4CE5A 2VWKA 4OGQB 4PDMA 4FE2A 4EBDA 5IJ9B 1KJQA 5KA5A 2VR1A 4BBSG 1K34A 1TWFA 3AK1A 5IYZB 2EINC 2AZ2A 3HKDA 4DV0H 1FJGO 5IJ0A 4BIZA 4LFBH 2DIKA 1I94H 4BIUA 3OD4A 2PZSA 1VS0A 4ETSA 1BGYH 5I5UA 2W9CB 3L9DA 5EWEA 3L73H 4EB6B 3NR7A 2EIKB 5EYPB 2R7LA 4O7SA 1GM9A 1I50A 3BQ1A 3LNMB 4B08A 3HOVG 2HJWA 2FB9A 5IYDG 4DRXB 4HR7A 1WB7A 2DE0X 3CCSV 1H38A 1XMQO 1ET0A 4PV1B 5KFGA 2QDOA 3SPIA 4OPHA 3HOXG 3LSSA 5KFDA 2JGDB 1YJWV 2GSMB 3F7VC 4JYBA 3T1HB 2EJ7A 2BCCH 1M9NA 3TK1A 3RYCB 1XK5A 5DG7A 5CM0A 5CB4F 3IG0A 2W7PA 3TQ1A 1SS3A 4O3SA 1NTKH 4JI4O 1XI1A 4O7TA 5BR8H 1W96A 3T54A 2RGRA 3GIQA 1RK6A 5JVDB 3HB3B 5DGHA 2HVKC 3A0RA 1S9FA 1UJWB 4ECYA 1Y66A 1HNXB 3LP8A 4R8UA 4X1YA 3K58A 4MT8A 3T4DA 3T1YO 4O4JB 2Q69A 2FPGB 1NQTA 4QNHB 5L3FA 3FMAA 1H2KA 3LMLA 3JAWB 1VEWA 3T9DA 1A9XA 1ZHSA 4UVAA 4YR2A 4LF6O 4J9KA 3QG5A 4EKWA 3ZCCA 2W6JG 4D6TH 4GKKH 3OUZA 5KFJA 4IYHA 2PMZE 3S3XA 4NXMH 2KG7B 4J9NA 1NTZH 5KA6A 2HVJC 5EWGA 4A3EG 1BQ0A 2C00A 2CDYA 2UU9O 4UCTA 3CP1A 3CCLV 2A1HA 2YEVA 1SA0A 2P7TC 3JCZA 4QIWF 1V55B 4JYYA 4R8CA 3WFVA 3B8MA 3HPLC 1UC8A 1OCOC 2X6CA 2YXHA 3L4JA 1CPYA 2C28A 5C4XG 1Q86W 4B3SB 1DIKA 1KECA 4P9OA 1RPRA 4B3MB 4DR4H 1N32B 4H33A 4ICGA 3CCVV 4YB8B 3WB2A 3CCMV 3TY9A 3RFRA 4X66B 2QR4A 2ZE6A 2MK3A 4X64B 2A3QA 1KU9A 4O4IB 3CC4V 2VPQA 4WBNB 4JI5O 3KG2A 3H1KH 4MV7A 1YVWA 2WB1E 1PNKA 2YS8A 4YR0A 4MV9A 4JZGA 4LH6A 2UUAO 4YBZB 2ZDIA 2PBZA 5JVDA 3JRXA 3CCUV 2E76B 5D1OB 2UUCH 1V54C 4O7RA 5FL7G 5J2UF 1HNWH 4DR4B 4ECXA 2XOKG 1G8MA 4FFBB 4JAVA 4YJ2F 1PPJH 3WO1A 3HOWG 2DQ3A 4JI6B 4HAMA 2HVSA 4O83A 1W2BU 1E1QG 1AUXA 2JDIG 1KEEA 3AK3A 2V59A 4X62B 2FK3A 4HZ3A 2BQUA 3BG5A 1FJGB 1M5IA 4DV5H 3LULA 4MSWC 2JVDA 5KFNA 4RB1A 2P06A 2UVRA 2ZNIA 2ZD9A 5LA6A 3LNNA 4E2LA 2Q6AA 5B3SB 3TINA 3ZS8C 5LMUB 2EILC 3N2KA 4X20A 4JI0B 1GLVA 1GGOA 3SYAA 2XAGA 4GX0A 4IWYA 5LP6F 5KFRA 3A0HZ 3SPHA 5KG0A 3GWKC 1KP3A 4DV6O 3CMEV 3IAYA 2HVQA 2CTQA 4JV5H 4DV5O 3LDDA 4O2AB 1SQXH 3K04A 3E8FA 1FXKC 5GONA 5CE8A 3CYOA 4JGSA 4B7EA 1GRJA 3ZMZA 4J7ZA 3Q8SB 1I2LA 3T99A 3K5LA 1CKMA 1MZBA 2M05A 4LF8O 4GKKO 2PN1A 1VQ6V 2JS5A 3VQYA 4LSXA 2N05A 1YXBA 1RFYA 5CA0B 4ED0A 5DGAA 1Y76B 4UCSA 1SQGA 2KSDA 3GLKA 4DV6H 5KT2A 4CBCA 2RJZA 2G38A 4B3TB 5LYJF 4ZHQB 4JI4H 2RMKB 3AW8A 1R6KA 2JJ2G 4GUNA 4UV8A 3T1HH 3GDEA 2E3CA 3SYPA 1I7FA 2RN9A 1X4TA 1EKFA 3D8CA 3W1GA 4FFBA 3OE7G 1Z5VA 2LGWA 3TY8A 4JYAB 3N44B 5C1PA 4PA9A 1Q82W 4M7EA 4QE9A 4W4LA 4H37A 3FKSG 2RF4A 3JD2A 4FLUA 2VQEH 2W9AA 3SNOA 1JMKC 1TWGA 2HFEC 1S77D 4QWAA 3OR7C 4K0KB 3ZHRA 2I8CA 3CSXA 2YXLA 4FPPA 1BGWA 4GZRB 4FIPC 3QO8A 2R93G 1HNZB 2YL2A 4YAKB 4IT5A 3A0BZ 3BQ2A 5BPHA 4K0KH 2AGOA 4Q0YA 4WFBV 5B1OA 4JI7B 2YU9A 4RZQA 3S3WA 3QZ7A 2GTAA 2HKOA 4QPJA 2Q7EA 5L1KA 2PY5A 1ZAUA 4BW5A 3AEIA 5DQHA 4PA6A 1L2ZA 2UXDB 1S68A 1Q5OA 1WP7A 2VA2A 1ROPA 1EBOA 3ETEA 2Q7GA 4I50A 4RB3C 2DPJA 4CH6A 5CMUA 2ODMA 4GLXA 2UXDO 4U7NA 4LF7O 4ZKIA 4AQYB 3U55A 4NLGA 3FDSA 3SPCA 5JUMA 2ZINA 5BPFA 2QM4A 4MVOA 1NR7A 2A0LA 2XASA 1PNLA 5CB4A 1AI6A 4X89A 4DR1B 2UUBH 5BWXA 4L8JA 3TCUA 1E4EB 3GTMA 1FVIA 3AG2B 2UXDH 1Q6IA 2BTOA 2FP4B 1KKCA 3T4ZA 2W0FC 4DYLA 1Z2PX 2BQ3A 4NXNB 2DLNA 2IM9A 3APOA 4RUCA 2D2CB 4FLZA 2A9HA 4C2MA 4LR3A 2AXTZ 2UXXA 4O2BB 3SJAC 4PWQA 4ECTA 3HBLA 3QO5A 3RAQA 1PKXA 3CEBA 4TQSA 4DR6H 2R92A 4OXSA 1R3LC 4JXUA 3JALA 1V9PA 1MNGA 3RYIB 3CXCU 2NVYA 3H0GG 1TWAA 4DV6B 2AQ4A 3JARA 4GT1A 5K3WA 1MOFA 2VQEO 1Y67A 4JI0O 3V6KA 2C2AA 4PI2A 1OHHG 5CA3A 1S5LZ 5FNVA 4FLXA 4ECVA 1WR2A 1ZHQA 3FB5C 1Q8IA 4DXWA 1S5JA 2P0AA 1I0HA 3DAAA 1IBKH 5KFKA 3N43B 2UVVA 4TOIA 2CW7A 4J42A 3BABA 5FNVF 3WWJA 3GQCA 5K1PA 1U96A 4HNVA 4LF9B 4CMFA 2WLIA 4ED3A 4AQYO 1I5XA 1JCHA 3L71H 1AP6A 4PA7A 4DIMA 3EHBB 1TUBB 3G6EV 3LWBA 4IHJA 3H4BA 4UCRA 3BACA 4CS2A 4I5SA 3OW2U 1Q3EA 1WCMA 2XCAA 1FXKB 2RDIA 1ENVA 2YI9A 4MW3A 4GX2A 2HIXA 4O84A 2WPDG 5CB4B 3IJ4A 5A2QW 1JFFB 3T9CA 1BXRA 2ZJTA 4RUAA 3BFRA 4RUFA 4PZ7A 4ZIBA 1NH2B 4RWUA 4IIJB 5J2TA 2QWPB 1VQOV 3H0GA 1IURA 4DV4B 5KHHA 4DR7B 1XBLA 4GX1A 4TV8F 3DGEA 5CR5A 1MSWD 4OX9B 1OV9A 5C3EG 1A32A 4BW9A 4O82A 1QNMA 4JTAB 2PVPA 3FB7C 5BR8O 2ADPA
chains in the Genus database with same CATH topology
5IYZA 4BWSC 5FPOA 3VNNA 4DV7B 4EQ5A 4I7HA 5J2UB 3OTOB 2EX3A 4TV8B 4DR2B 4J0MA 2ZIMA 3N40P 4YY3B 5FD6A 4UCVA 3WB0A 2YI8A 1HNWB 2VUGA 3HKCA 4RB0A 4DR7H 4LF6B 1M93A 1WPBA 4O4LB 4LFAB 4PDBA 4CH5A 4JI2H 3ETQA 3HKBB 2UUCB 4CC6A 5LP6C 4B3MH 1KMIZ 4DRXA 1GYFA 1XMQH 4X1KA 1J5EH 3N41B 3K5NA 4LH7A 2PTMA 5LMNH 3RIZA 3N42B 1A0IA 3JASA 3L4KA 4CH3A 1L8DA 2QJ1A 1TA8A 5IJ9A 3HKEB 4DUZB 3S24A 2KSWA 1DGSA 4IHJB 1N34H 5LOVB 4LF5H 4TV8A 3W5OA 1HR0B 4K8XA 2ZM6B 4NXMB 1TAEA 4X65B 1Z2OX 5IJ0B 3J80W 4FM9A 4LF8B 4O4HB 2VQFH 5JCOC 3HKCB 2YIBD 4MTDA 2PYJA 5D5PA 3M4IA 3T1YH 1JJOA 2GV9A 1IBLH 5CA1B 5EYPA 5EOYA 3J81W 3CB2A 4IIJA 5J2TB 2WDTA 4DRFA 4O4JA 2WE6A 4EFBA 1XNRH 1WH2A 4LFBB 2ZIOA 4IAJA 5FPRA 5JQGB 5BMVA 3F8NA 2VWKA 3BRCA 5EZYB 3E22B 4LF7H 4CS3A 5IJ9B 3HKEA 5LYJB 4YHHH 4K8ZA 4DV2H 5IYZB 3HKDA 5IWAH 5ITZA 4LSAA 4DV0H 3RYCA 5IJ0A 4LFBH 1I94H 2PZSA 2UUBB 1VS0A 2HIVA 4ETSA 3BA9A 1XNRB 4EB6B 2RGVA 4I9QA 3WB1A 5KX5A 5EYPB 4NXNH 4GKJH 2CAZC 2YIBA 5D1PA 4B08A 5LL6b 3HKBA 3KXYT 2V4DA 4RB2C 4DRXB 2E5LB 1N36B 1HW7A 4FM1A 2HHHB 3E22A 3JAWA 1B04A 1N34B 4UCUA 4YJ3A 4KHPB 2ZNJA 3T1HB 4LF4H 2VOBA 2CW8A 3HKDB 2Q7HA 3VQWA 5ITZB 3T1YB 3RYCB 1XK5A 4WBNA 5LMNB 3IG0A 5LOVA 3KALA 2KKWA 1I94B 3OTFA 5C8YA 1XI1A 2PGGA 4EB6A 5BR8H 4DV0B 1T5EA 2ZM6H 2RGRA 5JVDB 5KX5B 1BJTA 4DK0A 2UU9B 1XHXA 1H2SB 1HNXB 4JYAH 4JI7H 4JI1B 4X1YA 3K58A 1TGOA 3PN1A 4ZOLB 4DUYB 4O4JB 3FMAA 5EIBD 3LMLA 3RJ0A 3JAWB 2F1MA 1ZHSA 3ICXA 1XMQB 3JAKA 5EZYA 4DV5B 1IBLB 2OWOA 3QG5A 4HNAA 4GKKH 4JV5B 1RSOA 2VQFB 3N2KB 1XNQB 5C8YB 2F66C 4PZ6A 4X65H 4NXMH 3W1BA 1NT2B 4LF5B 1WNSA 1QQCA 3BPZA 1FKAH 4UCTA 3U11A 2R72A 1SA0A 4X1IA 4X1YB 1O9GA 2P5OA 4GYCB 4JI4B 1XHZA 3L4JA 5KHJA 3SJCC 4B3SB 4KL1A 4A2AA 1TVKA 4ZI7A 4FM2A 4TQDA 4FLTA 1SKVA 4B3MB 4JI2B 2FE3A 4DR4H 1N32B 2YIAA 4HNAB 4YJ3B 4DV4H 3WB2A 4Q6GA 2UUAB 2UXCH 3TY9A 3RFRA 5KHGA 4X66B 2R70A 4X64B 1KU9A 2BTQA 4O4IB 4DR2H 3UQ8A 4WBNB 4LF9H 3UT5B 1WN7A 3BA8A 1XDNA 4MV7A 4JI0H 5LMUH 4FVMA 4MV9A 3DSQA 4LH6A 3RTXA 2OYQA 5JVDA 4FM0A 5D1OB 1SA0B 4EFEA 2UUCH 2UXCB 2UUAH 4O2AA 1N32H 1HNWH 4DR4B 4FLYA 2WYOA 4FFBB 2PYLA 4JI5H 4ZOLA 4UFZA 3K3VA 4JI6B 2HVSA 4PZ8A 4DV7H 4X62B 2XHBA 1E4FT 1P8LA 1I6UA 3JAKB 1IBMH 1FJGB 1M5IA 4TV9A 4APMA 4DV5H 2JVDA 4RB1A 2BTQB 2HEPA 2ZNIA 5LA6A 3DF7A 3LNNA 4O4IA 4U3JB 3UT5A 4LFCH 2O03A 3ZS8C 5LMUB 3N2KA 4JI0B 4X20A 3RGZA 3FFQA 2JGUA 4DR5B 1O9HA 4JI5B 3IAYA 4YJ2B 2HVQA 3RR5A 2HGSA 4JI1H 4X66H 5JH7A 4JV5H 3RYFB 4JI3H 4ZHQA 3K5OA 4O2AB 1P16A 4RAYA 3JAMW 2UU9H 3RWRD 3SGIA 5GONA 4X1IB 3RGXA 3U10A 4D7TA 3K57A 3NC0B 3K5LA 1CKMA 1MZBA 3K5MA 1AN7A 4BWAA 5LP6B 2XIGA 4B3RB 1SQFA 1TVKB 4ZI7B 4DUYH 5KMGA 5LA6B 2JS5A 3VQYA 4LSXA 4U3JA 3VQXA 5CA0B 1M0TA 4DV1B 4UCSA 5JJJB 4AHCA 1SQGA 2CFMA 4DV6H 3N2GA 4HBNA 2RJZA 4B3TB 4NVPA 4ZHQB 4JI4H 1FFXA 3KYHC 3NBYB 2R9AA 4DK1A 1IBKB 5GONB 5D1OA 4LF4B 3T1HH 3GDEA 4DV3H 3ZEDA 4TUYA 2E3CA 1I7FA 1X4TA 2UXBH 4UCOA 1XMOB 2HHHH 3W1GA 2F4VH 4FFBA 1N36H 4LNUA 1Z5VA 2W57A 3TY8A 1XNQH 4I50B 4JYAB 3N44B 1HNXH 5KMGB 3NBZB 4M7EA 2ZCEA 1SEIA 1QHTA 3RYIA 4FLUA 2VQEH 1JMKC 4TV9B 3JARB 4DR6B 4K0KB 5BR8B 3CSXA 2YXLA 5KHKA 1BGWA 2F4VB 4X20B 4DR1H 1HNZB 5FLXW 1Q43A 4F6RA 4AILC 1FFXB 1CKOA 4K0KH 2Q2TA 3GJXB 4Q0YA 4PHZA 4YJ2A 3JATB 4JI7B 1M0WA 5JH7B 4RZQA 2VQEB 3RYFA 5LXTA 4YHHB 1CKNB 1VF7A 2Q7EA 3MWMA 2PY5A 5FD5A 1N33H 4LF7B 2YCHA 1ZAUA 4LF8H 1L2ZA 2Q2UA 2Q0AA 2UXDB 1S68A 1Q5OA 2E5LH 4DV1H 2Q7GA 4I50A 4RB3C 2P22C 4CH6A 3M7MX 1N33B 2UXBB 2VPSA 4GLXA 5LP6A 4R7RA 4DUZH 3J7AK 4AQYB 4GKJB 3HXLA 4AQYH 4KHPH 2ZINA 2QM4A 1Z2NX 4B3TH 1HNZH 5CA0A 5CB4A 4DR1B 3QWUA 3RF2A 2UUBH 1O75A 1JFFA 4L8JA 3H20A 4F6RB 1FVIA 4CH4A 2HVRA 4PI0A 5K1XA 1E4GT 3N6XA 2UXDH 3JATA 3N2GB 2BTOA 4I55A 5JJNB 5D5QA 1CKNA 3A2FA 4LMYA 3RGBA 4MTEA 1Z2PX 4CS4A 1YEWA 4NXNB 2IM9A 4YY3H 3THOA 5JJEB 3GB8B 2F95B 2PUSA 4FLZA 4TUYB 4LR3A 3QTCA 5JCOA 3BAAA 4I4TB 4O2BB 3SJAC 3K59A 3KAKA 1XMOH 3RYHB 1M4UA 4LNUB 4TQFA 4DR6H 5IWAB 1IBMB 1S03G 2VWJA 1Z5WA 1TUBA 3JALA 4DV2B 4FLWA 4LFAH 5KHIA 1V9PA 4X62H 3RYIB 5J2UA 3CHXA 4D7SA 3C0FB 3SJBC 4JI6H 4DV6B 4RAZA 1D5AA 3JARA 3JSNA 4A2BA 2RQ6A 3JSLA 4PI2A 4OX9H 3OTOH 5FNVA 4FLXA 1ZHQA 4O4LA 4DV3B 1Q8IA 1XQ8A 1X9NA 1S5JA 3B2EE 3EYYA 1IBKH 3N43B 4X1KB 5LXTB 4B3RH 3VQVA 4TOIA 2CW7A 4JI8H 4O2BA 4DR3B 3BABA 3RYHA 5K1PA 4EEQA 4LF9B 3JASB 3MAQA 4X64H 1HR0H 5EIBC 1G6UA 1TUBB 3JALB 5DISC 3KAJA 4IHJA 5IT9W 4E6NA 4UCRA 3TY5A 4CS2A 3QF7A 1Q3EA 4DR5H 2YI9A 2HIXA 3SR2C 5CB4B 4O4HA 3L2PA 5A2QW 1JFFB 2F93B 5FNVB 4LFCB 1J5EB 4JI8B 2ZJTA 4DR3H 1SYXB 4PZ7A 4ZIBA 5CA1A 1FJGH 4I55B 4IIJB 5J2TA 4DV4B 5KHHA 4LF6H 3U0ZA 4DR7B 4JI3B 4OX9B 4FLVA 3BHPA 3CVZA 4BW9A 4B3SH 5JQGA 5BMVB 4I4TA 4CC5A 1P49A 4GKKB 2MCTA 5LYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY B;  1FJG B;  4GKJ B;  3T1Y B;  5FPO A;  3VNN A;  1XK5 A;  4DV7 B;  5LMN B;  4EQ5 A;  3OTO B;  5LMU B;  4DR1 B;  4JI0 B;  3QWU A;  1I94 B;  4DR2 B;  4DR5 B;  1FVI A;  4DV0 B;  4JI5 B;  2HVR A;  4YY3 B;  2HVQ A;  3RR5 A;  4UCV A;  1P8L A;  2VUG A;  1HNW B;  2UU9 B;  1CKN A;  4LF6 B;  1P16 A;  4LFA B;  3SGI A;  1HNX B;  2UUC B;  4NXN B;  4CC6 A;  4JI1 B;  3PN1 A;  3GB8 B;  4DUY B;  3BAA A;  3NC0 B;  1CKM A;  4LH7 A;  1A0I A;  4B3R B;  1XMQ B;  5IWA B;  4DV5 B;  1IBL B;  1IBM B;  1TA8 A;  2OWO A;  4DV2 B;  4DUZ B;  1V9P A;  3S24 A;  1DGS A;  4JV5 B;  2VQF B;  1XNQ B;  4DV6 B;  1HR0 B;  3W5O A;  4DV1 B;  2ZM6 B;  4NXM B;  3JSN A;  4UCS A;  1TAE A;  4X65 B;  4PZ6 A;  3JSL A;  2CFM A;  3W1B A;  4LF8 B;  4LF5 B;  4B3T B;  4UCT A;  3KYH C;  4DV3 B;  3NBY B;  1IBK B;  1X9N A;  5D1O A;  4LF4 B;  3GDE A;  4DRF A;  4TOI A;  4JI4 B;  4EFB A;  4DR3 B;  3BAB A;  4UCO A;  1XMO B;  3W1G A;  4LFB B;  4EEQ A;  4B3S B;  4LF9 B;  5FPR A;  3TY8 A;  4B3M B;  4JI2 B;  4JYA B;  1N32 B;  5DIS C;  3NBZ B;  2UUA B;  4E6N A;  3TY9 A;  4UCR A;  4X66 B;  3TY5 A;  4X64 B;  4DR6 B;  4K0K B;  5BR8 B;  3UQ8 A;  2F4V B;  3BA8 A;  1XDN A;  2HIX A;  2UUB B;  1VS0 A;  2HIV A;  1HNZ B;  3L2P A;  3BA9 A;  4LFC B;  1XNR B;  4JI8 B;  1J5E B;  4LH6 A;  1CKO A;  4PZ7 A;  2Q2T A;  3GJX B;  3RTX A;  4JI7 B;  5D1O B;  4EFE A;  2VQE B;  2UXC B;  4YHH B;  4DV4 B;  1CKN B;  4DR7 B;  5D1P A;  4JI3 B;  4DR4 B;  4LF7 B;  1ZAU A;  4OX9 B;  2Q2U A;  2UXD B;  1S68 A;  2E5L B;  1N36 B;  4UFZ A;  4CC5 A;  4JI6 B;  2HHH B;  2HVS A;  1N33 B;  1B04 A;  2UXB B;  1N34 B;  4UCU A;  4GKK B;  4PZ8 A;  4GLX A;  4X62 B;  4KHP B;  3T1H B; 
#chains in the Genus database with same CATH topology
 3CEI A;  3AG2 C;  5FPO A;  1KKD A;  3VNN A;  2JS3 A;  1IVS A;  3RW0 A;  5J2U B;  2EX3 A;  4TQR A;  4ZI7 F;  1E1R G;  4YY3 B;  2WSS G;  4FS2 A;  3GTO A;  2VUG A;  5EBL C;  5EK0 A;  1M93 A;  3N27 A;  3GII A;  4O4L B;  3SYO A;  4JI2 H;  2YZM A;  3HKB B;  1W93 A;  5LP6 C;  3OHA A;  2FK2 A;  3IFX A;  2EIJ B;  3E5N A;  4HQ6 A;  1J5E H;  3N41 B;  4J9L A;  2PTM A;  5LMN H;  1OCR B;  3M9O B;  3JAS A;  2JA5 A;  3ABU A;  2QJ1 A;  3Q8R B;  4G28 B;  3HKE B;  2KSW A;  3H9V A;  3CCR V;  4IHJ B;  3UZO A;  3PJS K;  5LOV B;  4ED2 A;  4TV8 A;  4K8X A;  4C5A A;  4KFM A;  2NU6 B;  2DYR C;  1TAE A;  4X65 B;  5IJ0 B;  1XEQ A;  4FM9 A;  2Y0I A;  1HWY A;  4WBN F;  3ZIA G;  2ZT9 B;  1FAF A;  2DWD C;  1EZJ A;  1L1F A;  1ZL8 A;  2WAQ A;  5KT7 A;  2QYZ A;  5D5P A;  4PBC A;  2GV9 A;  2JEU A;  4MTO A;  5EYP A;  1IZ3 A;  3CB2 A;  4RQF A;  2N74 A;  1M1K W;  4WHX A;  4IIJ F;  4I4T F;  3T2M A;  1EKV A;  3OT7 A;  1FPO A;  1WH2 A;  2ZDI C;  3AYH B;  4LFB B;  1I1M A;  3JAM N;  2JRI A;  1GKF A;  5FPR A;  5JQG B;  2ZDH A;  2JA6 A;  5DQG A;  1GSA A;  5EZY B;  3TIG A;  2L6L A;  4LF7 H;  4CS3 A;  1QLE B;  3MWD A;  2JGD A;  3W7X A;  3AG3 C;  1N48 A;  2YSU B;  5KAI Z;  3RYC A;  1B3Q A;  2XAF A;  1XNR B;  1P84 F;  2JJ1 G;  3RVZ A;  4I9Q A;  1OJH A;  4PEL A;  4DW1 A;  3T5K A;  4GKJ H;  5DMX A;  1MAB G;  3HOZ G;  1XUQ A;  1JJ2 U;  3OFN G;  2ZR2 A;  4J9Z B;  1EKP A;  4RB2 C;  3GID A;  1AR1 B;  2E5L B;  1GH6 A;  1N36 B;  3W7T A;  3AX6 A;  2K1E A;  4YIP A;  4FM1 A;  1LNQ A;  2HHH B;  1W0K G;  4B7K A;  1B04 A;  4MTG A;  2W7O A;  3SYQ A;  1PM9 A;  4YJ3 A;  3G4S V;  4KHP B;  4MV8 A;  4LF4 H;  2QK4 A;  1F4N A;  5A9G A;  4H13 B;  3V6J A;  5ITZ B;  3T1Y B;  4NTW A;  1QLN A;  5LMN B;  5KG1 A;  5KLV H;  3GTK A;  2Q9L A;  3OTF A;  5C8Y A;  4DL4 A;  4EB6 A;  4DV0 B;  1T5E A;  2KG7 A;  2ZM6 H;  2ASL A;  5B1N A;  1VQ4 V;  3ASN B;  4FFN A;  1C3O A;  2R6F A;  2X7R B;  5KFO A;  3Q2O A;  1YIJ V;  5LHH A;  4A3F G;  2W6Z A;  2KB1 A;  4GC6 A;  4FBU A;  5C8Y F;  4JI7 H;  3GTQ A;  1L0L H;  4WFG A;  5EC1 C;  5J2T F;  2IJI A;  5I5S A;  2HG5 C;  1DLB A;  4P30 A;  3RJ0 A;  1S97 A;  4X8A A;  3BY6 A;  4M9U A;  1JOY A;  4QPK A;  3VPC A;  1EN4 A;  3ICX A;  4JAA A;  3Q8Q B;  1IBL O;  4XDL A;  1XMQ B;  3MR5 A;  4IRD A;  3JAK A;  5EZY A;  1HP8 A;  2LO1 A;  4GCZ A;  2YZN A;  5A2Q N;  4J9M A;  1CQI B;  2R92 G;  5GTH Z;  4JV5 B;  1RSO A;  2Q67 A;  1XNQ B;  5HFM A;  2EZP A;  5BWV A;  2IJH A;  1AI5 A;  2DJV A;  4XBF A;  3GVM A;  1NT2 B;  1WNS A;  2X6B A;  1QQC A;  3BPZ A;  3KHL A;  3TGU H;  3OGC C;  1GMG A;  4X1Y B;  5GW7 A;  5I5W A;  4RZR A;  4RNM A;  3EPG A;  4JI4 B;  3M8A A;  3JD1 A;  1B06 A;  2BOB C;  1QLE C;  3ZBH A;  2HG8 A;  1SZX A;  2IBZ H;  4JAS A;  5KHJ A;  2ZE8 A;  3AG3 B;  4RUE A;  2HGW A;  4DR4 O;  1TVK A;  1ZTE A;  1AR4 A;  4JYC A;  1QVG U;  1ZLZ A;  2FE3 A;  3ETD A;  5DGB A;  2E2H A;  5KG3 A;  2FTK A;  4Q20 A;  4ABM A;  4DO2 A;  5I5V A;  2UUA B;  2OTJ V;  2HHH O;  5KG4 A;  3O9O A;  4J9S A;  1QCE A;  3I4M G;  2YC0 A;  3GV8 B;  1TUE B;  4K6N A;  4DR2 H;  3UQ8 A;  5BWU A;  1M57 C;  4C7U A;  1GN2 A;  5LMU H;  1LR1 A;  2FPP B;  3OR6 C;  2DWE C;  1ZSP A;  2AHY A;  5H6R A;  5H80 A;  5I60 A;  2E74 B;  5CAE B;  2OYQ A;  2J6S A;  3AG1 C;  1UNN C;  1OCR C;  1SA0 B;  4Y8V B;  4EYI B;  4X65 O;  2UXC B;  2COG A;  3H1J H;  4WFH A;  5H6Q A;  1N32 H;  2Y48 A;  1K1S A;  1THZ A;  4B3S O;  4E4E A;  4LF9 O;  4ECW A;  3RFC A;  4EGJ A;  2I87 A;  1JA8 A;  3E35 A;  4LBE C;  3SPJ A;  4EYH B;  2DYR B;  3IN5 A;  4A3G G;  3E8H A;  1BZK A;  4DV7 H;  2XHB A;  5L3D A;  3WO0 A;  1OZ0 A;  1E4F T;  3IC9 A;  4DV0 O;  4O81 A;  4IL6 Z;  2CNU A;  1M7J A;  4OPA A;  3SI8 A;  1I6U A;  4TV9 A;  4L1K A;  1RM1 B;  3ZHV A;  3DF7 A;  1KJ8 A;  2W70 A;  4JV0 A;  3UT5 A;  3PW5 A;  1S10 A;  1V55 C;  3RGZ A;  1WP8 A;  1FKA O;  1NZ6 A;  3UCS C;  3E2E A;  2JGU A;  4LFC O;  2DPI A;  4JV5 O;  2Q5Z A;  4JI1 H;  5JH7 A;  3RYF B;  4ZHQ A;  3K5O A;  3JAM W;  1P16 A;  4RAY A;  3RWR D;  4RAI A;  2CTR A;  2ZE5 A;  2AGA A;  3JD0 A;  4KXR A;  4D7T A;  4NXM O;  1VQP V;  2OCC C;  2L35 A;  3RB3 A;  1K83 A;  2DQ0 A;  4P9P A;  1JR9 A;  2IU3 A;  3NC0 B;  1Q6H A;  5HBR B;  3B40 A;  1DV2 A;  2XUM A;  3STL C;  1BS3 A;  5LP6 B;  1AR5 A;  4ZI7 B;  4FMT A;  4MTX A;  2EIJ C;  4C5B A;  1MSD A;  1MZF A;  3WG7 C;  4IWX A;  2LQT A;  5KT4 A;  5KFC A;  1BT8 A;  1B6R A;  2X0L A;  1EUD B;  3QVN A;  5KFP A;  4MV1 A;  4DV1 B;  2GDS A;  3H3V H;  2V7Q G;  1S5H C;  5JWP A;  2DAB A;  5DG8 A;  1EFR G;  1RJR A;  2CFM A;  1OCZ C;  3N2G A;  5IY5 C;  5L3B A;  1A3G A;  1WAZ A;  1J5E O;  2F23 A;  2FK1 A;  3CWB H;  3LSU A;  5GON B;  4J9R A;  4QJF A;  1NBM G;  4MTF A;  4O4J F;  2C35 B;  4LF4 B;  2UXB O;  1VQK V;  1KJ9 A;  2FB5 A;  5KFW A;  1SES A;  1H2M A;  2YIC A;  3CC2 V;  1DAA A;  1K4C C;  1XMO B;  4UUJ C;  2AHZ A;  3I56 V;  2WA3 A;  2WLN A;  1N36 H;  2QE7 G;  2EIL B;  1Y4M A;  3DXR A;  2W57 A;  1XNQ H;  4I50 B;  3RB6 A;  2OLS A;  3ASN C;  1SEI A;  1QHT A;  3MR3 A;  5CBH A;  1YIT V;  2HLD G;  1JDE A;  2SCU B;  2NUA B;  1Y76 A;  1BNC A;  4DR6 B;  4FFL A;  5I5T A;  1IXB A;  1KUQ A;  2F4V B;  1M6V A;  1DTO A;  4ME6 A;  1JQ0 A;  3CJH A;  1T94 A;  1FFX B;  4DR6 O;  3ZMV A;  4MA5 A;  1CKO A;  3K06 A;  2Q2T A;  3G6X A;  3PW4 A;  1M0W A;  1URF A;  3JYC A;  3RYF A;  5LXT A;  4YHH B;  3EFF K;  5FD5 A;  3K9A A;  4LF7 B;  2YCH A;  1YTF D;  1N34 O;  4R50 A;  1OCC C;  2R93 A;  2DMX A;  2P4K A;  1BHB A;  2ZGI A;  4CKC A;  4A3L G;  2CTW A;  3J81 N;  4DUZ H;  5LBQ A;  5KFL A;  3HXL A;  3N8D A;  4KHP H;  4B3T O;  3A8T A;  2QGN A;  4U6P A;  3G6Y A;  5LA6 F;  4YXW G;  3QWU A;  4IR1 A;  2X6A A;  1XNR O;  1HR0 O;  1O75 A;  1VF5 B;  5K1X A;  4DUZ O;  1E4G T;  1IX9 A;  5TIS Z;  2ZR3 A;  4I55 A;  2LP7 A;  5JJN B;  5H5N A;  4LMY A;  1C30 A;  2ZQM A;  4CS4 A;  3ETJ A;  2ZXW B;  4YY3 H;  3C3S A;  5E1A C;  4TUY B;  3GV5 B;  2BR0 A;  1Y74 A;  2LGQ A;  3HB9 A;  1RP3 B;  2R86 A;  3UYY A;  2XGP A;  4O86 A;  1M4U A;  4TQF A;  5KFI A;  2LJ2 A;  5IWA B;  3FB6 C;  1HNW O;  1IBM B;  1Z5W A;  4I50 F;  2Y0S E;  4LFA H;  5KHI A;  4X62 H;  3CHX A;  4D7S A;  5HFL A;  3SJB C;  4RAZ A;  1D5A A;  1IOV A;  3L75 H;  3JSN A;  1FXK A;  4YAJ B;  3E86 A;  1UFI A;  2KQX A;  4OX9 H;  5IP9 G;  1EM1 A;  1AJN A;  2DW4 A;  1G1X B;  3B4S A;  2W6P A;  2OCH A;  1PP9 H;  3PW2 A;  1XQ8 A;  2RNB A;  3ORR A;  1Q6U A;  1X9N A;  3EYY A;  5DAA A;  2PI4 A;  5HV6 A;  5LXT B;  5JH7 F;  1GSO A;  3J80 N;  4JI8 H;  1RM1 C;  3T5H A;  4EG0 A;  2NU8 B;  3OM3 B;  2OT5 A;  3OUF A;  4UVC A;  4EEQ A;  3K08 A;  2QKS A;  3E83 A;  4YIO A;  3MAQ A;  3FKI G;  1GN6 A;  1SET A;  1KJJ A;  5LL6 Y;  1G6U A;  4ECZ A;  5DIS C;  2DWC A;  3I5D A;  4TT3 G;  3KAJ A;  3M99 B;  2GUZ B;  2Q8V A;  5IYC G;  2FLP A;  4JI8 O;  4GKJ O;  4DLK A;  4DR5 H;  2HHF B;  5KFE A;  4FS1 A;  4O4H F;  4G27 B;  3OAA G;  3L2P A;  3RBZ A;  1N33 O;  2YS7 A;  4JI8 B;  4ECU A;  5EBW C;  2HJF C;  3MHS C;  1KQS U;  4J7J A;  4MV3 A;  4R6Z A;  1FJG H;  5DLF A;  1M57 B;  4MVM A;  1RYR A;  1N32 O;  2AU0 A;  1YZB A;  4LF6 H;  3Q1K A;  4RNO A;  4FJC C;  4YHH O;  1WCM G;  5KFZ A;  1VIB A;  2P67 A;  5KG5 A;  4ASU G;  4FLV A;  3BHP A;  2XC9 A;  5BMV B;  4ZBM A;  3ZRW A;  2JEF A;  3SE7 A;  1XOU A;  2GPW A;  3G71 V;  4O2A F;  2WLM A;  1NH2 D;  3FYI B;  2W6O A;  1KTA A;  1K5S A;  1F51 A;  3JCU Z;  5IYZ A;  3RBE A;  4F6E A;  1N8R W;  3OHB A;  4EQ5 A;  2W9B A;  3OTO B;  2W9C A;  4AI8 A;  1I5Y A;  3ZHT A;  3PO2 G;  4TV8 B;  1ZQ7 A;  3UZB A;  4HNT A;  2FMA A;  2ZIM A;  4J0M A;  3AG7 A;  1FD9 A;  3FAV B;  1H2N A;  3BEH A;  4UCV A;  4PDR A;  2FKL A;  3WB0 A;  2FYU H;  3HKC A;  4RB0 A;  1WPB A;  2ILM A;  5C1O A;  5CA0 F;  4J10 A;  4CH5 A;  4B3M H;  2UUC B;  2R9R B;  1MA1 A;  3EVK A;  2JEX A;  4DRX A;  3V4Z A;  1GYF A;  4X1K A;  1YF2 A;  4HYK A;  1B6Q A;  3K5N A;  1PV0 A;  4LH7 A;  4LC1 A;  4WFA V;  1JPX A;  3GV7 B;  2QTS A;  4CH3 A;  4A3D G;  1QR9 A;  1TA8 A;  5KFQ A;  1F23 A;  3S24 A;  3ZHS A;  2GUZ A;  3ABL B;  2Q68 A;  1R3K C;  3GB7 C;  4O4L F;  4CMD A;  1XL4 A;  2YWV A;  5B66 Z;  3MJF A;  3AK2 A;  3J80 W;  2ZKO A;  4O4H B;  2YIB D;  2DAA A;  3M4I A;  1SC5 B;  5BZB A;  4R8U B;  5CA1 B;  3J81 W;  1OCZ B;  1V4Y A;  4I55 F;  2WDT A;  1ZWI C;  4O4J A;  5IY5 B;  1PX2 A;  2W6Q A;  2EIM B;  4DRF A;  3GIM A;  4BBR G;  3WU2 Z;  1I2K A;  5JVL A;  2CK3 G;  4FFP A;  3LDE A;  3K0G A;  1WJZ A;  3R66 A;  5BMV A;  2CZG A;  4O7V A;  3F8N A;  4Q4D A;  3T5J A;  3BRC A;  3E22 B;  3H40 A;  3HKE A;  3T9F A;  2NU7 B;  4K8Z A;  4DV2 H;  2Y0S A;  1EN6 A;  3X2Q C;  5IWA H;  5ITZ A;  1AP5 A;  3OMN B;  4I0X B;  2UUB B;  2CQY A;  4YR3 A;  3T1C A;  1WRV A;  3BA9 A;  2ADQ B;  2EJ2 A;  1AI4 A;  2XTA A;  5JQG F;  5KX5 A;  5IYC O;  1PL0 A;  2LW1 A;  2FL4 A;  1K73 W;  2YIB A;  1GSH A;  1SZT A;  5LL6 b;  1D2D A;  1PK8 A;  1FXH A;  4F4Y A;  3KXY T;  2HJD A;  1WA8 B;  2V4D A;  4A3B G;  4JTD B;  4O7L A;  1BE3 H;  4BR6 A;  4MV6 A;  1VF6 C;  1HW7 A;  3SYC A;  4TVI A;  4QW9 A;  2CTP A;  3W7S A;  1S3J A;  4UCU A;  3CS5 A;  4FK5 C;  3VPB A;  2W8L A;  3SJQ C;  3P32 A;  2RCV A;  2ZNJ A;  2R7Z A;  2VOB A;  2V4R A;  4P2Z A;  2LFR A;  1EZV H;  2Q7H A;  4O4I F;  3VQW A;  4BY1 G;  4KP4 A;  4G3I A;  1NKD A;  4WBN A;  4Z1M G;  2YID A;  3RB0 A;  2KKW A;  1S0M A;  5BYB A;  2PGG A;  1OBG A;  4ED8 A;  1T36 A;  2EIY A;  4NR1 A;  1K3E A;  2DZD A;  4DK0 A;  2IJJ A;  2UU9 B;  4JI6 O;  2CE4 A;  2IW5 A;  3BCC H;  3H1H H;  2W71 A;  4QWC A;  1H8H G;  5IE9 A;  4MVS A;  4JYA H;  1US6 A;  4JI1 B;  5FLX N;  3CCQ V;  2B63 G;  4ZOL B;  1Z2G A;  2PI5 A;  2QKC A;  1IOW A;  5EIB D;  4FFO A;  4RCN A;  5L1I A;  5BY1 A;  1COW G;  4UUG A;  2ZXW C;  1K9M W;  3PR4 A;  1IBL B;  3ZHU A;  2OWO A;  2FPI B;  1TWC A;  2B1G A;  2VQF O;  4HNA A;  5L1J A;  2B1I A;  3F5W C;  3N2K B;  1LUV A;  3RVY A;  4H0L B;  5KFF A;  2H8P C;  5C8Y B;  2F66 C;  5DLG A;  4JI1 O;  1R73 A;  2R7Z G;  1YTF B;  2R7K A;  3P3N A;  1QVF U;  2CH7 B;  3U11 A;  3RN4 A;  4X1I A;  4A3C G;  1O9G A;  1F4M A;  1Y1W G;  1XHZ A;  4NTX A;  4B3R O;  3NUA A;  5E79 Z;  1VQ9 V;  1VQ7 V;  4TWK A;  4UB6 Z;  3SJC C;  1ARO P;  4FFR A;  4FFK A;  1CEZ A;  1W0J G;  4FLT A;  3T1H O;  2K9P A;  4DR7 O;  1KBL A;  3D3Q A;  2JA7 G;  3ETG A;  2YIA A;  4DV4 H;  1DK1 A;  3K3W A;  2YS6 A;  5KHG A;  2V5A A;  2FLL A;  2QWR B;  4PDL A;  1KT8 A;  2R70 A;  3ZRV A;  4FZ0 A;  2BTQ A;  1RJP A;  2EZO A;  3TW6 A;  3MFH A;  3UT5 B;  1XDN A;  2WWW A;  4JI0 H;  2XGQ A;  2XAH A;  3DTF A;  5KS8 A;  4FVM A;  1VMG A;  1WLE A;  4ECS A;  3RTX A;  2XND G;  4FM0 A;  2QA4 V;  3T5L A;  3G6B A;  4J80 A;  2R8H A;  1NVP B;  4CHI A;  4MVQ A;  5DGI A;  2QWQ B;  4FZ1 A;  5AG2 A;  1YI2 V;  2WYO A;  1V51 A;  4ZOL A;  1HNX O;  4DAA A;  4JI5 H;  4UFZ A;  3K3V A;  3APQ A;  5EZY F;  4TUY F;  4QIW E;  2BSK A;  5JQW A;  2OIG A;  5GTI Z;  4QE7 A;  3ZN1 A;  1P8L A;  5KKN B;  1GAX A;  1IBM H;  4APM A;  4JI3 O;  3ZRS A;  3CCJ V;  3QQM A;  2QM7 A;  2O03 A;  4LFC H;  2NNU A;  3FFQ A;  1YCI A;  2LFS A;  2Q4P A;  1OWT A;  2YZL A;  3RR5 A;  2LW7 A;  3D3I A;  3F7Y C;  2BE3 A;  4JI3 H;  3M9M B;  3KCY A;  1BQZ A;  1IDS A;  4IHJ F;  3SGI A;  3CX5 F;  3CQZ A;  1AJQ A;  2YEV B;  3VOU A;  3JZI A;  4X1I B;  3RGX A;  2JIZ G;  2ABJ A;  4O3N A;  4Q45 A;  3K0D A;  5H9C A;  3X2Q B;  3OSN A;  3OEH G;  5C5J A;  3K5M A;  5F9L A;  1K7D A;  3LQS A;  3OEE G;  3OMI B;  4B3R B;  4DUY H;  2QTO A;  1DF4 A;  2E2I A;  2XT9 A;  2AGP A;  4Q8F A;  5KT6 A;  2ATK C;  1CE8 A;  4UB8 Z;  5KFT A;  3AG1 B;  4U3J A;  4EGQ A;  1M0T A;  3I12 A;  2IJK A;  2BQR A;  3B8N A;  3GIJ A;  5JJJ B;  2CUG A;  1KBH A;  4O3R A;  1CXZ B;  4DR1 O;  2UUC O;  5DN6 G;  5KX5 F;  2W8K A;  2YZG A;  4RO2 A;  4HBN A;  4NVP A;  1FFX A;  2YRX A;  3KYH C;  1XIL A;  4F4W A;  3NBY B;  3CCE V;  2FLN A;  4DK1 A;  5D1O A;  2QF7 A;  5C44 G;  4DR2 O;  3ABT A;  4DV3 H;  3ZED A;  3BQ0 A;  4O2B F;  2Q0O C;  1N36 O;  4UCO A;  2YW2 A;  3MHH C;  4FGR A;  2F4V H;  3IGA C;  4LNU A;  2BSK B;  2X0S A;  1HNX H;  5DM6 V;  3GTL A;  5KMG B;  2ZCE A;  3RYI A;  4MVZ A;  1DV1 A;  5LHI A;  1EUC B;  1KJI A;  3JAR B;  4MV4 A;  3RAX A;  3EXA A;  5BR8 B;  1VQN V;  1GTO A;  4X20 B;  4DR1 H;  2DN9 A;  2OCC B;  1A48 A;  4J9O A;  5FLX W;  4J9Q A;  3R5H A;  4XDK A;  2QB5 A;  3ASO C;  3MD0 A;  2UVU A;  4YP3 A;  4QJF B;  1CQJ B;  1CKN B;  1VF7 A;  5KUM A;  3WG7 B;  3HO8 A;  3MWM A;  4DV4 O;  4LF8 H;  3ZX6 A;  2Q2U A;  3QNE A;  1SQB H;  4H44 B;  1N0J A;  2WLI B;  2E5L H;  4JTC B;  5IWA O;  1D5N A;  2YRW A;  2QWN B;  1ZUQ A;  2P22 C;  3KRE A;  3M7M X;  1N33 B;  4F50 A;  2YDE A;  4DL5 A;  2Z0A A;  5B1A B;  3GIL A;  3J7A K;  2VS0 A;  3T9A A;  4RNN A;  4NTY A;  2HP8 A;  5L3E A;  3G8C A;  4AQY H;  4BY7 G;  4O3O A;  5EWF A;  3P30 A;  4JI7 O;  2IH3 C;  1Z2N X;  3JZ6 A;  3U9T A;  5CA0 A;  2Q73 A;  1M90 W;  4A3K G;  3T7A A;  1JFF A;  4F6R B;  3N6X A;  5IDJ A;  3JAT A;  1K1Q A;  2R8K A;  4JAU A;  5D5Q A;  3CSW A;  3A2F A;  2WB1 A;  3D36 C;  3CRQ A;  1YEW A;  3C90 A;  2Q7D A;  4A5U B;  3THO A;  4ECQ A;  2F95 B;  5FR9 A;  3DC5 A;  1YJN V;  3BAA A;  3WNZ A;  3K59 A;  1XMO H;  4NZO A;  1L0N H;  1K4D C;  3RYH B;  5LGT A;  1HDJ A;  1EN5 A;  4LNU B;  3ML0 A;  3TXQ A;  2VWJ A;  2B9Z A;  1BSM A;  1WSC A;  1KC7 A;  3ZMT A;  5J2U A;  1Q7Y W;  3C0F B;  5FLM G;  4DL6 A;  4JI6 H;  4NKG B;  3LSQ A;  4A2B A;  4FU0 A;  4NXN O;  2RQ6 A;  1OCC B;  3JSL A;  2Y69 C;  3PR5 B;  3EPI A;  1PL4 A;  3OTO H;  3CXH F;  4O4L A;  4DV3 B;  2Z02 A;  1P4R A;  3MR6 A;  2F4V O;  4XX0 B;  2W6I G;  3B2E E;  4A3M G;  4B3R H;  3VQV A;  1MZE A;  4DR3 B;  4TM5 A;  3H1I H;  3KHH A;  2R87 A;  4QSH A;  1PNM A;  4GLW A;  3JAS B;  4JYA O;  1HR0 H;  2R7N A;  5EIB C;  4DL3 A;  3Q4H A;  3K9S A;  3C3T A;  3Q8P B;  5LOV F;  5DEC A;  1I3Q A;  1YSC A;  2WLH A;  2Y4T A;  3ASO B;  3UKM A;  3PW7 A;  2W9B B;  3OMA B;  4JZ2 A;  3SR2 C;  3TET A;  3AG4 B;  2F93 B;  3ORQ A;  1J5E B;  1H8E G;  2Z3Y A;  3OTO O;  3CD6 V;  1SYX B;  5KG7 A;  3VMM A;  4I9W A;  1KD1 W;  1YHQ V;  3UFX B;  5H2F Z;  3U0Z A;  5B1B C;  3KCX A;  4PDV A;  4X62 O;  2J9G A;  4B3S H;  5JQG A;  2QM8 A;  4IRC A;  4CC5 A;  2PMZ A;  4IZO A;  2COJ A;  3HOY G;  3G6V A;  2ARH A;  1P49 A;  2XCP A;  2MCT A;  5IP7 G;  5LYJ A;  1A0G A;  4I7Z B;  4BWS C;  2M6Y A;  2UXC O;  5LGU A;  4DV7 B;  4L87 A;  1EZ1 A;  3CPW U;  4U3F H;  4DR2 B;  5I5X A;  3N40 P;  2IMW P;  1BL8 A;  1IBK O;  5FD6 A;  4R7C A;  1KYO F;  2YI8 A;  3BVO A;  1HNW B;  4PDB A;  2Y0P A;  1MMM A;  1AVM A;  4KUM A;  3ETQ A;  1JX9 A;  3R65 A;  1N0N A;  4YQW A;  3HT5 A;  3LUT B;  3J7A U;  1QR8 A;  1UPG A;  5L9X A;  5L1L A;  4F4Z A;  2NU9 B;  3KTM A;  1JXL A;  2IBK A;  2W6N A;  1TWH A;  3HKZ A;  1R6T A;  5KFM A;  3RIZ A;  3N42 B;  1A0I A;  1IYE A;  1GO3 F;  3U0G A;  4LWS B;  1AJP A;  5CA1 F;  3L4K A;  3GTJ A;  4A3I G;  1L8D A;  5CN0 A;  4CKB A;  3FD9 A;  1KB9 F;  5IJ9 A;  4DUZ B;  5FJ8 G;  1DGS A;  4K35 A;  4Z1V A;  1GN3 A;  3MFI A;  1JKJ B;  2Y4U A;  4J9P A;  1U97 A;  1Y14 B;  1VP7 A;  1HR0 B;  2ZM6 B;  2JEJ A;  4NXM B;  4O7Z A;  1Z2O X;  4LF5 O;  2ETN A;  2FJZ A;  2V4Q A;  4O7W A;  2JA6 G;  1BMF G;  5JCO C;  3HKC B;  3DC6 A;  4JV2 A;  1P7B A;  3E8G A;  3STZ C;  1JJO A;  4PA4 A;  1I1L A;  2QSA A;  2XD4 A;  2ZDQ A;  4IIJ A;  5J2T B;  4DR5 O;  4NZN A;  4X88 A;  4MVU A;  3VOT A;  1GN4 A;  1JX4 A;  4JV1 A;  4EFB A;  2QKA A;  4DW0 A;  1GK9 A;  1WA8 A;  3ZJZ A;  4Q8E A;  2ZIO A;  4JI2 O;  2NN4 A;  1R6N A;  4C5C A;  1RYS A;  3T9E A;  3HR0 A;  4WF9 V;  3I55 V;  5LYJ B;  4YHH H;  1RSO B;  4ZQI A;  1WB8 A;  2FKX A;  1QU7 A;  4UXN A;  4X9Q A;  1IYD A;  1KP2 A;  4LSA A;  3L74 H;  4JUZ A;  1JVM A;  4F4X A;  1IXM A;  2B5U A;  4N23 A;  3L72 H;  4K0K O;  2H94 A;  2HIV A;  4PA3 A;  2VUM A;  2RGV A;  2V9W A;  1BHA A;  3TQT A;  1YDX A;  3PO3 G;  3WB1 A;  4NXN H;  2GPS A;  3UM7 A;  2CAZ C;  3K03 A;  2R8J A;  4TSF G;  5L3G A;  4PD4 F;  4K3A A;  3VBB A;  5D1P A;  4XYL B;  3HKB A;  2EJ3 A;  2WAM A;  3DTU B;  4Q43 A;  1XMO O;  2R84 A;  3KKY A;  1EYZ A;  4QIW A;  3ABL C;  4XYM B;  3E22 A;  1B33 N;  1MG1 A;  3JAW A;  1N34 B;  1S72 V;  4LWS A;  2COI A;  1AUV A;  2CW8 A;  3HKD B;  3CE2 A;  4CZZ A;  3B09 A;  4ZOL F;  3QO7 A;  1BCC H;  3OGI B;  5LOV A;  1Y1W A;  1VKZ A;  3UO2 A;  3SDL A;  3KAL A;  5BWR A;  1I94 B;  2EIM C;  5I47 A;  3TJT A;  1GO3 E;  1SQP H;  1E79 G;  2WA4 A;  1F7Y A;  1P7G A;  5EBM C;  5KX5 B;  2X5R A;  2VQD A;  1BJT A;  1Y1V A;  4Q4C A;  1ZL8 B;  2CH7 A;  4HYO A;  1XHX A;  4O7N A;  1H2S B;  2Z04 A;  2QEX V;  1R3J C;  1TGO A;  3PN1 A;  4QW8 A;  3FB8 C;  4DUY B;  5BMV F;  5LHG A;  5J9P C;  3PW0 A;  4N21 A;  5I5Y A;  1R3I C;  2F1M A;  3ZMS A;  2C22 A;  1V54 B;  3ZMU A;  2Y4R A;  2GHY A;  3AG4 C;  4HN2 A;  4DV5 B;  2E5L O;  2ASJ A;  2ATL A;  2VQF B;  2J6T A;  2WLL B;  5B1B B;  2PF4 E;  4NYK A;  4X66 O;  4PZ6 A;  4X65 H;  3PZP A;  3DTG A;  1RK5 A;  1NI8 A;  2VRZ A;  2NVX A;  2D3O W;  3R5F A;  3W1B A;  4IGG A;  1K8A W;  4LF5 B;  4GC7 A;  1X59 A;  1FKA H;  2YYA A;  2R72 A;  5B3S C;  5T14 A;  2P5O A;  4GYC B;  1FXV A;  1UC9 A;  4QWE A;  5CBG A;  5IYB O;  3W7U A;  4KL1 A;  3ZN0 A;  2EUL A;  3LDC A;  4ZI7 A;  5LGN A;  4A2A A;  4DL2 A;  1H2L A;  4Q44 A;  4FM2 A;  2YUA A;  4TQD A;  1SKV A;  4JI2 B;  3CRC A;  4HNA B;  2HR3 A;  4YJ3 B;  2R85 A;  4DL7 A;  4Q6G A;  2UXC H;  2I80 A;  3WWI A;  2GLT A;  4WD3 A;  4GX5 A;  4WFF A;  5BWW A;  4LF9 H;  1W59 A;  2ZE7 A;  3U9S A;  1WN7 A;  3BA8 A;  3I4N G;  5IYD O;  2YXY A;  4WCE V;  3RV3 A;  5LMU O;  3DSQ A;  2JA7 A;  5GON F;  1AB3 A;  1RJQ A;  1N4C A;  4EFE A;  2UUA H;  2HGX A;  2GQS A;  4O2A A;  3CC7 V;  2IP4 A;  3E89 A;  4FLY A;  2Z5U A;  2CNV A;  2PYL A;  4O3P A;  5DG9 A;  4DR3 O;  1XL6 A;  2JA8 G;  1S0V A;  1I7N A;  2VA3 A;  4AYB E;  4PZ8 A;  2E75 B;  3G80 A;  4TV9 F;  4NYE A;  2AGQ A;  3JAK B;  4DV3 O;  2BTQ B;  2HEP A;  4O4I A;  1M56 C;  4U3J B;  1R1B A;  2WLL A;  1SQV H;  2MW2 B;  1OBD A;  4XDJ A;  4MAM A;  3CJH B;  3F5T A;  1NTM H;  4DR5 B;  2AZ0 A;  1FYJ A;  1O9H A;  4O7Y A;  4JI5 B;  1KC8 W;  2R7M A;  4UVB A;  1T3N A;  4YJ2 B;  3QFF A;  2HGS A;  2JK5 C;  1AI7 A;  4X66 H;  3RV4 A;  1VF6 A;  1K5Q A;  3O65 A;  2ZDG A;  3VPD A;  2UU9 H;  1QBZ A;  5KT3 A;  2W0X A;  4IYI A;  1G2W A;  3U10 A;  3K57 A;  1NS1 A;  1I1K A;  5E25 A;  2WTF A;  1I08 A;  4MVR A;  4DUY O;  2A7W A;  1AN7 A;  1ZET A;  4BWA A;  3FKI A;  2ASD A;  5K2M A;  2XIG A;  1SQF A;  1TVK B;  3V4S A;  3CRA A;  2ODT X;  5KFY A;  2OIE A;  3V6H A;  5KMG A;  5LA6 B;  4O3Q A;  4OX9 O;  3VQX A;  4MS2 A;  5EDW A;  4WFE A;  1XDC A;  3MWE A;  5LMN O;  3H1L H;  4AHC A;  4G2K A;  2WLK A;  4LFA O;  1XNQ O;  4J7K A;  1K33 A;  2R9A A;  1IBK B;  4LFB O;  3M9N B;  5F9N A;  4TUY A;  1IBM O;  4QWB A;  2UXB H;  3ABM C;  2EJ0 A;  3OUS A;  2HHH H;  4DV7 O;  4YY3 O;  1KUT A;  3JD4 A;  2OH2 A;  5CBF A;  2C2D A;  4JPR A;  3GTP A;  1VAR A;  3NBZ B;  3GIP A;  2N04 A;  4RQE A;  4W4K A;  5KG6 A;  4TV9 B;  1XRE A;  2OTL V;  1LUW A;  2UUB O;  2O57 A;  4EBC A;  5KHK A;  1HNZ O;  3JZF A;  2C2R A;  3E8B A;  5D8D A;  1Q43 A;  2DYS B;  4F6R A;  4AIL C;  3K5I A;  1SQQ H;  4LCU C;  3GJX B;  2VUM G;  4PHZ A;  2P4V A;  3JAT B;  4YJ2 A;  1FS0 G;  5JH7 B;  5LXT F;  2VQE B;  1CS0 A;  4RU9 A;  1Q90 D;  3HKZ E;  5KFS A;  4BXX G;  3TW7 A;  3CRR A;  1N33 H;  2GBO A;  2Q0A A;  3KZI Z;  5JVD F;  4DV1 H;  1SFO A;  1M56 B;  2VPS A;  2UXB B;  4R7R A;  5LP6 A;  4Z2W A;  4CKE A;  4GKJ B;  1J95 A;  3ABK B;  3R9R A;  4JF3 A;  1VQM V;  2WAQ E;  4A93 G;  2HHF A;  4UV9 A;  2ITD C;  4B3T H;  5IT9 N;  1HNZ H;  2ZM6 O;  3RF2 A;  2JEG A;  1VQ8 V;  3H20 A;  3N6R A;  1VQ5 V;  4CH4 A;  2XAQ A;  4PI0 A;  2HVR A;  3SPG A;  2W6M A;  3N2G B;  4DQN A;  2EIN B;  1CKN A;  3K79 A;  3RGB A;  2R9I A;  4MTE A;  3P3P A;  2NLJ C;  2ALZ A;  5JJE B;  3GB8 B;  1G4Y B;  2PUS A;  3TEK A;  4LP8 A;  3QTC A;  5JCO A;  1VBH A;  4I4T B;  2UVW A;  5KFV A;  3KAK A;  1NU1 H;  4IRK A;  1K92 A;  3KHR A;  3DXR B;  3R23 A;  1SER A;  3NGD A;  3G67 A;  1R9T A;  1ZX3 A;  2M7W A;  2IH1 C;  3Q4H B;  2V1D A;  3K3P A;  3H4D A;  1S03 G;  1TUB A;  4DV2 B;  4FLW A;  5EC2 C;  3ZRX A;  2JEI A;  3PFF A;  3ETH A;  5KG2 A;  3NXS A;  4M0J A;  1S0O A;  1E4E A;  1RPO A;  3B77 A;  4J11 A;  2DOS A;  2IA6 A;  3RB4 A;  4J41 A;  2P6J A;  3FAV A;  3GWO A;  5DED A;  1VBG A;  2GTS A;  1OCO B;  1ULZ A;  4EEY A;  3ABM B;  3UO3 A;  1NVP D;  3K5H A;  2XCL A;  4ED6 A;  3KHG A;  2RDJ A;  4EBE A;  3H01 A;  1S76 D;  2R8G A;  5C93 A;  4J9Y B;  4X1K B;  5B1A C;  4E4T A;  3G8D A;  3JD3 A;  4O2B A;  2HDK A;  4IR9 A;  1K97 A;  1WPX A;  2UXN A;  3RYH A;  5DQI A;  5KFU A;  4BAY A;  4MW8 A;  4X64 H;  3IC7 A;  3JAL B;  3WWH A;  2A06 H;  1VQL V;  5IT9 W;  1PD3 A;  3CRM A;  4E6N A;  3TY5 A;  4NZM A;  3RBD A;  3MR2 A;  3QF7 A;  2F43 G;  3W7W A;  3T9B A;  1H2G A;  5KFX A;  4O4H A;  4U7C A;  4DR3 H;  4LFC B;  5FNV B;  1Y1V G;  1NJI W;  1B6S A;  5CA1 A;  1JIH A;  4I55 B;  2FML A;  4ECR A;  1JLL B;  2B63 A;  4JI3 B;  5KAF Z;  2EIK C;  2EJR A;  4QGP A;  2XAJ A;  1Y6X A;  3MDS A;  4A3J G;  3CVZ A;  1FFT B;  3CMA V;  1Y74 B;  1Q81 W;  4I4T A;  5B5E Z;  5KFH A;  4GKK B;  2V58 A;  5KFA A;  4PJ0 Z;  2Y69 B;  3HOU G;  5IYZ F;  2NR5 A;  1GM8 A;  3L70 H;  1GM7 A;  1ORQ C;  2R82 A;  2IU0 A;  4ED1 A;  3OSP A;  1SF9 A;  3TXS A;  4ED7 A;  3ZHQ A;  4I7H A;  3PVX A;  2CGO A;  4I0X A;  4U7O A;  1YJ9 V;  5BWT A;  3GTG A;  2CKZ B;  3JRW A;  1AIL A;  5KFB A;  2QWO B;  1S0N A;  2R8I A;  2JA5 G;  4DR7 H;  4LF6 B;  3TII A;  4LFA B;  1N56 A;  2A79 B;  3U54 A;  5F2V O;  2RDC A;  4FFM A;  5KT5 A;  1SCU B;  4LF4 O;  4CC6 A;  1KMI Z;  1XMQ H;  2H3O A;  1NR1 A;  1SRY A;  4HNU A;  2CGN A;  4ZHQ F;  1CP9 A;  1VAJ A;  2DYS C;  4DV1 O;  3GIK A;  5BXZ A;  5BYA A;  2EBO A;  1EHI A;  5L3C A;  3RT3 C;  1N34 H;  4YJ3 F;  4NB5 A;  4XZ3 B;  4LF5 H;  3W5O A;  4BIO A;  2C2E A;  3D36 A;  3VA7 A;  1I94 O;  4QWD A;  5HNE A;  3FX7 A;  2ITC C;  2WLJ A;  4LF8 B;  2VQF H;  5IYB G;  4MA0 A;  4MTD A;  2PYJ A;  5KUK A;  1I7L A;  1DF5 A;  4F4L A;  3T1Y H;  4FBT A;  3OUU A;  1IBL H;  4DV2 O;  4KHP O;  5EOY A;  1JDB B;  3QZ8 A;  2AW9 A;  4X64 O;  2WE6 A;  4AYB A;  3R5X A;  3BJY A;  1XNR H;  2CNQ A;  2BOC C;  3ABK C;  2P90 A;  3RUP A;  4IAJ A;  3FYE B;  4B3M O;  2J6U A;  3ZRW B;  2GQR A;  4CE5 A;  2VWK A;  4OGQ B;  4PDM A;  4FE2 A;  4EBD A;  5IJ9 B;  1KJQ A;  5KA5 A;  2VR1 A;  4BBS G;  1K34 A;  1TWF A;  3AK1 A;  5IYZ B;  2EIN C;  2AZ2 A;  3HKD A;  4DV0 H;  1FJG O;  5IJ0 A;  4BIZ A;  4LFB H;  2DIK A;  1I94 H;  4BIU A;  3OD4 A;  2PZS A;  1VS0 A;  4ETS A;  1BGY H;  5I5U A;  2W9C B;  3L9D A;  5EWE A;  3L73 H;  4EB6 B;  3NR7 A;  2EIK B;  5EYP B;  2R7L A;  4O7S A;  1GM9 A;  1I50 A;  3BQ1 A;  3LNM B;  4B08 A;  3HOV G;  2HJW A;  2FB9 A;  5IYD G;  4DRX B;  4HR7 A;  1WB7 A;  2DE0 X;  3CCS V;  1H38 A;  1XMQ O;  1ET0 A;  4PV1 B;  5KFG A;  2QDO A;  3SPI A;  4OPH A;  3HOX G;  3LSS A;  5KFD A;  2JGD B;  1YJW V;  2GSM B;  3F7V C;  4JYB A;  3T1H B;  2EJ7 A;  2BCC H;  1M9N A;  3TK1 A;  3RYC B;  1XK5 A;  5DG7 A;  5CM0 A;  5CB4 F;  3IG0 A;  2W7P A;  3TQ1 A;  1SS3 A;  4O3S A;  1NTK H;  4JI4 O;  1XI1 A;  4O7T A;  5BR8 H;  1W96 A;  3T54 A;  2RGR A;  3GIQ A;  1RK6 A;  5JVD B;  3HB3 B;  5DGH A;  2HVK C;  3A0R A;  1S9F A;  1UJW B;  4ECY A;  1Y66 A;  1HNX B;  3LP8 A;  4R8U A;  4X1Y A;  3K58 A;  4MT8 A;  3T4D A;  3T1Y O;  4O4J B;  2Q69 A;  2FPG B;  1NQT A;  4QNH B;  5L3F A;  3FMA A;  1H2K A;  3LML A;  3JAW B;  1VEW A;  3T9D A;  1A9X A;  1ZHS A;  4UVA A;  4YR2 A;  4LF6 O;  4J9K A;  3QG5 A;  4EKW A;  3ZCC A;  2W6J G;  4D6T H;  4GKK H;  3OUZ A;  5KFJ A;  4IYH A;  2PMZ E;  3S3X A;  4NXM H;  2KG7 B;  4J9N A;  1NTZ H;  5KA6 A;  2HVJ C;  5EWG A;  4A3E G;  1BQ0 A;  2C00 A;  2CDY A;  2UU9 O;  4UCT A;  3CP1 A;  3CCL V;  2A1H A;  2YEV A;  1SA0 A;  2P7T C;  3JCZ A;  4QIW F;  1V55 B;  4JYY A;  4R8C A;  3WFV A;  3B8M A;  3HPL C;  1UC8 A;  1OCO C;  2X6C A;  2YXH A;  3L4J A;  1CPY A;  2C28 A;  5C4X G;  1Q86 W;  4B3S B;  1DIK A;  1KEC A;  4P9O A;  1RPR A;  4B3M B;  4DR4 H;  1N32 B;  4H33 A;  4ICG A;  3CCV V;  4YB8 B;  3WB2 A;  3CCM V;  3TY9 A;  3RFR A;  4X66 B;  2QR4 A;  2ZE6 A;  2MK3 A;  4X64 B;  2A3Q A;  1KU9 A;  4O4I B;  3CC4 V;  2VPQ A;  4WBN B;  4JI5 O;  3KG2 A;  3H1K H;  4MV7 A;  1YVW A;  2WB1 E;  1PNK A;  2YS8 A;  4YR0 A;  4MV9 A;  4JZG A;  4LH6 A;  2UUA O;  4YBZ B;  2ZDI A;  2PBZ A;  5JVD A;  3JRX A;  3CCU V;  2E76 B;  5D1O B;  2UUC H;  1V54 C;  4O7R A;  5FL7 G;  5J2U F;  1HNW H;  4DR4 B;  4ECX A;  2XOK G;  1G8M A;  4FFB B;  4JAV A;  4YJ2 F;  1PPJ H;  3WO1 A;  3HOW G;  2DQ3 A;  4JI6 B;  4HAM A;  2HVS A;  4O83 A;  1W2B U;  1E1Q G;  1AUX A;  2JDI G;  1KEE A;  3AK3 A;  2V59 A;  4X62 B;  2FK3 A;  4HZ3 A;  2BQU A;  3BG5 A;  1FJG B;  1M5I A;  4DV5 H;  3LUL A;  4MSW C;  2JVD A;  5KFN A;  4RB1 A;  2P06 A;  2UVR A;  2ZNI A;  2ZD9 A;  5LA6 A;  3LNN A;  4E2L A;  2Q6A A;  5B3S B;  3TIN A;  3ZS8 C;  5LMU B;  2EIL C;  3N2K A;  4X20 A;  4JI0 B;  1GLV A;  1GGO A;  3SYA A;  2XAG A;  4GX0 A;  4IWY A;  5LP6 F;  5KFR A;  3A0H Z;  3SPH A;  5KG0 A;  3GWK C;  1KP3 A;  4DV6 O;  3CME V;  3IAY A;  2HVQ A;  2CTQ A;  4JV5 H;  4DV5 O;  3LDD A;  4O2A B;  1SQX H;  3K04 A;  3E8F A;  1FXK C;  5GON A;  5CE8 A;  3CYO A;  4JGS A;  4B7E A;  1GRJ A;  3ZMZ A;  4J7Z A;  3Q8S B;  1I2L A;  3T99 A;  3K5L A;  1CKM A;  1MZB A;  2M05 A;  4LF8 O;  4GKK O;  2PN1 A;  1VQ6 V;  2JS5 A;  3VQY A;  4LSX A;  2N05 A;  1YXB A;  1RFY A;  5CA0 B;  4ED0 A;  5DGA A;  1Y76 B;  4UCS A;  1SQG A;  2KSD A;  3GLK A;  4DV6 H;  5KT2 A;  4CBC A;  2RJZ A;  2G38 A;  4B3T B;  5LYJ F;  4ZHQ B;  4JI4 H;  2RMK B;  3AW8 A;  1R6K A;  2JJ2 G;  4GUN A;  4UV8 A;  3T1H H;  3GDE A;  2E3C A;  3SYP A;  1I7F A;  2RN9 A;  1X4T A;  1EKF A;  3D8C A;  3W1G A;  4FFB A;  3OE7 G;  1Z5V A;  2LGW A;  3TY8 A;  4JYA B;  3N44 B;  5C1P A;  4PA9 A;  1Q82 W;  4M7E A;  4QE9 A;  4W4L A;  4H37 A;  3FKS G;  2RF4 A;  3JD2 A;  4FLU A;  2VQE H;  2W9A A;  3SNO A;  1JMK C;  1TWG A;  2HFE C;  1S77 D;  4QWA A;  3OR7 C;  4K0K B;  3ZHR A;  2I8C A;  3CSX A;  2YXL A;  4FPP A;  1BGW A;  4GZR B;  4FIP C;  3QO8 A;  2R93 G;  1HNZ B;  2YL2 A;  4YAK B;  4IT5 A;  3A0B Z;  3BQ2 A;  5BPH A;  4K0K H;  2AGO A;  4Q0Y A;  4WFB V;  5B1O A;  4JI7 B;  2YU9 A;  4RZQ A;  3S3W A;  3QZ7 A;  2GTA A;  2HKO A;  4QPJ A;  2Q7E A;  5L1K A;  2PY5 A;  1ZAU A;  4BW5 A;  3AEI A;  5DQH A;  4PA6 A;  1L2Z A;  2UXD B;  1S68 A;  1Q5O A;  1WP7 A;  2VA2 A;  1ROP A;  1EBO A;  3ETE A;  2Q7G A;  4I50 A;  4RB3 C;  2DPJ A;  4CH6 A;  5CMU A;  2ODM A;  4GLX A;  2UXD O;  4U7N A;  4LF7 O;  4ZKI A;  4AQY B;  3U55 A;  4NLG A;  3FDS A;  3SPC A;  5JUM A;  2ZIN A;  5BPF A;  2QM4 A;  4MVO A;  1NR7 A;  2A0L A;  2XAS A;  1PNL A;  5CB4 A;  1AI6 A;  4X89 A;  4DR1 B;  2UUB H;  5BWX A;  4L8J A;  3TCU A;  1E4E B;  3GTM A;  1FVI A;  3AG2 B;  2UXD H;  1Q6I A;  2BTO A;  2FP4 B;  1KKC A;  3T4Z A;  2W0F C;  4DYL A;  1Z2P X;  2BQ3 A;  4NXN B;  2DLN A;  2IM9 A;  3APO A;  4RUC A;  2D2C B;  4FLZ A;  2A9H A;  4C2M A;  4LR3 A;  2AXT Z;  2UXX A;  4O2B B;  3SJA C;  4PWQ A;  4ECT A;  3HBL A;  3QO5 A;  3RAQ A;  1PKX A;  3CEB A;  4TQS A;  4DR6 H;  2R92 A;  4OXS A;  1R3L C;  4JXU A;  3JAL A;  1V9P A;  1MNG A;  3RYI B;  3CXC U;  2NVY A;  3H0G G;  1TWA A;  4DV6 B;  2AQ4 A;  3JAR A;  4GT1 A;  5K3W A;  1MOF A;  2VQE O;  1Y67 A;  4JI0 O;  3V6K A;  2C2A A;  4PI2 A;  1OHH G;  5CA3 A;  1S5L Z;  5FNV A;  4FLX A;  4ECV A;  1WR2 A;  1ZHQ A;  3FB5 C;  1Q8I A;  4DXW A;  1S5J A;  2P0A A;  1I0H A;  3DAA A;  1IBK H;  5KFK A;  3N43 B;  2UVV A;  4TOI A;  2CW7 A;  4J42 A;  3BAB A;  5FNV F;  3WWJ A;  3GQC A;  5K1P A;  1U96 A;  4HNV A;  4LF9 B;  4CMF A;  2WLI A;  4ED3 A;  4AQY O;  1I5X A;  1JCH A;  3L71 H;  1AP6 A;  4PA7 A;  4DIM A;  3EHB B;  1TUB B;  3G6E V;  3LWB A;  4IHJ A;  3H4B A;  4UCR A;  3BAC A;  4CS2 A;  4I5S A;  3OW2 U;  1Q3E A;  1WCM A;  2XCA A;  1FXK B;  2RDI A;  1ENV A;  2YI9 A;  4MW3 A;  4GX2 A;  2HIX A;  4O84 A;  2WPD G;  5CB4 B;  3IJ4 A;  5A2Q W;  1JFF B;  3T9C A;  1BXR A;  2ZJT A;  4RUA A;  3BFR A;  4RUF A;  4PZ7 A;  4ZIB A;  1NH2 B;  4RWU A;  4IIJ B;  5J2T A;  2QWP B;  1VQO V;  3H0G A;  1IUR A;  4DV4 B;  5KHH A;  4DR7 B;  1XBL A;  4GX1 A;  4TV8 F;  3DGE A;  5CR5 A;  1MSW D;  4OX9 B;  1OV9 A;  5C3E G;  1A32 A;  4BW9 A;  4O82 A;  1QNM A;  4JTA B;  2PVP A;  3FB7 C;  5BR8 O;  2ADP A; 
#chains in the Genus database with same CATH homology
 5IYZ A;  4BWS C;  5FPO A;  3VNN A;  4DV7 B;  4EQ5 A;  4I7H A;  5J2U B;  3OTO B;  2EX3 A;  4TV8 B;  4DR2 B;  4J0M A;  2ZIM A;  3N40 P;  4YY3 B;  5FD6 A;  4UCV A;  3WB0 A;  2YI8 A;  1HNW B;  2VUG A;  3HKC A;  4RB0 A;  4DR7 H;  4LF6 B;  1M93 A;  1WPB A;  4O4L B;  4LFA B;  4PDB A;  4CH5 A;  4JI2 H;  3ETQ A;  3HKB B;  2UUC B;  4CC6 A;  5LP6 C;  4B3M H;  1KMI Z;  4DRX A;  1GYF A;  1XMQ H;  4X1K A;  1J5E H;  3N41 B;  3K5N A;  4LH7 A;  2PTM A;  5LMN H;  3RIZ A;  3N42 B;  1A0I A;  3JAS A;  3L4K A;  4CH3 A;  1L8D A;  2QJ1 A;  1TA8 A;  5IJ9 A;  3HKE B;  4DUZ B;  3S24 A;  2KSW A;  1DGS A;  4IHJ B;  1N34 H;  5LOV B;  4LF5 H;  4TV8 A;  3W5O A;  1HR0 B;  4K8X A;  2ZM6 B;  4NXM B;  1TAE A;  4X65 B;  1Z2O X;  5IJ0 B;  3J80 W;  4FM9 A;  4LF8 B;  4O4H B;  2VQF H;  5JCO C;  3HKC B;  2YIB D;  4MTD A;  2PYJ A;  5D5P A;  3M4I A;  3T1Y H;  1JJO A;  2GV9 A;  1IBL H;  5CA1 B;  5EYP A;  5EOY A;  3J81 W;  3CB2 A;  4IIJ A;  5J2T B;  2WDT A;  4DRF A;  4O4J A;  2WE6 A;  4EFB A;  1XNR H;  1WH2 A;  4LFB B;  2ZIO A;  4IAJ A;  5FPR A;  5JQG B;  5BMV A;  3F8N A;  2VWK A;  3BRC A;  5EZY B;  3E22 B;  4LF7 H;  4CS3 A;  5IJ9 B;  3HKE A;  5LYJ B;  4YHH H;  4K8Z A;  4DV2 H;  5IYZ B;  3HKD A;  5IWA H;  5ITZ A;  4LSA A;  4DV0 H;  3RYC A;  5IJ0 A;  4LFB H;  1I94 H;  2PZS A;  2UUB B;  1VS0 A;  2HIV A;  4ETS A;  3BA9 A;  1XNR B;  4EB6 B;  2RGV A;  4I9Q A;  3WB1 A;  5KX5 A;  5EYP B;  4NXN H;  4GKJ H;  2CAZ C;  2YIB A;  5D1P A;  4B08 A;  5LL6 b;  3HKB A;  3KXY T;  2V4D A;  4RB2 C;  4DRX B;  2E5L B;  1N36 B;  1HW7 A;  4FM1 A;  2HHH B;  3E22 A;  3JAW A;  1B04 A;  1N34 B;  4UCU A;  4YJ3 A;  4KHP B;  2ZNJ A;  3T1H B;  4LF4 H;  2VOB A;  2CW8 A;  3HKD B;  2Q7H A;  3VQW A;  5ITZ B;  3T1Y B;  3RYC B;  1XK5 A;  4WBN A;  5LMN B;  3IG0 A;  5LOV A;  3KAL A;  2KKW A;  1I94 B;  3OTF A;  5C8Y A;  1XI1 A;  2PGG A;  4EB6 A;  5BR8 H;  4DV0 B;  1T5E A;  2ZM6 H;  2RGR A;  5JVD B;  5KX5 B;  1BJT A;  4DK0 A;  2UU9 B;  1XHX A;  1H2S B;  1HNX B;  4JYA H;  4JI7 H;  4JI1 B;  4X1Y A;  3K58 A;  1TGO A;  3PN1 A;  4ZOL B;  4DUY B;  4O4J B;  3FMA A;  5EIB D;  3LML A;  3RJ0 A;  3JAW B;  2F1M A;  1ZHS A;  3ICX A;  1XMQ B;  3JAK A;  5EZY A;  4DV5 B;  1IBL B;  2OWO A;  3QG5 A;  4HNA A;  4GKK H;  4JV5 B;  1RSO A;  2VQF B;  3N2K B;  1XNQ B;  5C8Y B;  2F66 C;  4PZ6 A;  4X65 H;  4NXM H;  3W1B A;  1NT2 B;  4LF5 B;  1WNS A;  1QQC A;  3BPZ A;  1FKA H;  4UCT A;  3U11 A;  2R72 A;  1SA0 A;  4X1I A;  4X1Y B;  1O9G A;  2P5O A;  4GYC B;  4JI4 B;  1XHZ A;  3L4J A;  5KHJ A;  3SJC C;  4B3S B;  4KL1 A;  4A2A A;  1TVK A;  4ZI7 A;  4FM2 A;  4TQD A;  4FLT A;  1SKV A;  4B3M B;  4JI2 B;  2FE3 A;  4DR4 H;  1N32 B;  2YIA A;  4HNA B;  4YJ3 B;  4DV4 H;  3WB2 A;  4Q6G A;  2UUA B;  2UXC H;  3TY9 A;  3RFR A;  5KHG A;  4X66 B;  2R70 A;  4X64 B;  1KU9 A;  2BTQ A;  4O4I B;  4DR2 H;  3UQ8 A;  4WBN B;  4LF9 H;  3UT5 B;  1WN7 A;  3BA8 A;  1XDN A;  4MV7 A;  4JI0 H;  5LMU H;  4FVM A;  4MV9 A;  3DSQ A;  4LH6 A;  3RTX A;  2OYQ A;  5JVD A;  4FM0 A;  5D1O B;  1SA0 B;  4EFE A;  2UUC H;  2UXC B;  2UUA H;  4O2A A;  1N32 H;  1HNW H;  4DR4 B;  4FLY A;  2WYO A;  4FFB B;  2PYL A;  4JI5 H;  4ZOL A;  4UFZ A;  3K3V A;  4JI6 B;  2HVS A;  4PZ8 A;  4DV7 H;  4X62 B;  2XHB A;  1E4F T;  1P8L A;  1I6U A;  3JAK B;  1IBM H;  1FJG B;  1M5I A;  4TV9 A;  4APM A;  4DV5 H;  2JVD A;  4RB1 A;  2BTQ B;  2HEP A;  2ZNI A;  5LA6 A;  3DF7 A;  3LNN A;  4O4I A;  4U3J B;  3UT5 A;  4LFC H;  2O03 A;  3ZS8 C;  5LMU B;  3N2K A;  4JI0 B;  4X20 A;  3RGZ A;  3FFQ A;  2JGU A;  4DR5 B;  1O9H A;  4JI5 B;  3IAY A;  4YJ2 B;  2HVQ A;  3RR5 A;  2HGS A;  4JI1 H;  4X66 H;  5JH7 A;  4JV5 H;  3RYF B;  4JI3 H;  4ZHQ A;  3K5O A;  4O2A B;  1P16 A;  4RAY A;  3JAM W;  2UU9 H;  3RWR D;  3SGI A;  5GON A;  4X1I B;  3RGX A;  3U10 A;  4D7T A;  3K57 A;  3NC0 B;  3K5L A;  1CKM A;  1MZB A;  3K5M A;  1AN7 A;  4BWA A;  5LP6 B;  2XIG A;  4B3R B;  1SQF A;  1TVK B;  4ZI7 B;  4DUY H;  5KMG A;  5LA6 B;  2JS5 A;  3VQY A;  4LSX A;  4U3J A;  3VQX A;  5CA0 B;  1M0T A;  4DV1 B;  4UCS A;  5JJJ B;  4AHC A;  1SQG A;  2CFM A;  4DV6 H;  3N2G A;  4HBN A;  2RJZ A;  4B3T B;  4NVP A;  4ZHQ B;  4JI4 H;  1FFX A;  3KYH C;  3NBY B;  2R9A A;  4DK1 A;  1IBK B;  5GON B;  5D1O A;  4LF4 B;  3T1H H;  3GDE A;  4DV3 H;  3ZED A;  4TUY A;  2E3C A;  1I7F A;  1X4T A;  2UXB H;  4UCO A;  1XMO B;  2HHH H;  3W1G A;  2F4V H;  4FFB A;  1N36 H;  4LNU A;  1Z5V A;  2W57 A;  3TY8 A;  1XNQ H;  4I50 B;  4JYA B;  3N44 B;  1HNX H;  5KMG B;  3NBZ B;  4M7E A;  2ZCE A;  1SEI A;  1QHT A;  3RYI A;  4FLU A;  2VQE H;  1JMK C;  4TV9 B;  3JAR B;  4DR6 B;  4K0K B;  5BR8 B;  3CSX A;  2YXL A;  5KHK A;  1BGW A;  2F4V B;  4X20 B;  4DR1 H;  1HNZ B;  5FLX W;  1Q43 A;  4F6R A;  4AIL C;  1FFX B;  1CKO A;  4K0K H;  2Q2T A;  3GJX B;  4Q0Y A;  4PHZ A;  4YJ2 A;  3JAT B;  4JI7 B;  1M0W A;  5JH7 B;  4RZQ A;  2VQE B;  3RYF A;  5LXT A;  4YHH B;  1CKN B;  1VF7 A;  2Q7E A;  3MWM A;  2PY5 A;  5FD5 A;  1N33 H;  4LF7 B;  2YCH A;  1ZAU A;  4LF8 H;  1L2Z A;  2Q2U A;  2Q0A A;  2UXD B;  1S68 A;  1Q5O A;  2E5L H;  4DV1 H;  2Q7G A;  4I50 A;  4RB3 C;  2P22 C;  4CH6 A;  3M7M X;  1N33 B;  2UXB B;  2VPS A;  4GLX A;  5LP6 A;  4R7R A;  4DUZ H;  3J7A K;  4AQY B;  4GKJ B;  3HXL A;  4AQY H;  4KHP H;  2ZIN A;  2QM4 A;  1Z2N X;  4B3T H;  1HNZ H;  5CA0 A;  5CB4 A;  4DR1 B;  3QWU A;  3RF2 A;  2UUB H;  1O75 A;  1JFF A;  4L8J A;  3H20 A;  4F6R B;  1FVI A;  4CH4 A;  2HVR A;  4PI0 A;  5K1X A;  1E4G T;  3N6X A;  2UXD H;  3JAT A;  3N2G B;  2BTO A;  4I55 A;  5JJN B;  5D5Q A;  1CKN A;  3A2F A;  4LMY A;  3RGB A;  4MTE A;  1Z2P X;  4CS4 A;  1YEW A;  4NXN B;  2IM9 A;  4YY3 H;  3THO A;  5JJE B;  3GB8 B;  2F95 B;  2PUS A;  4FLZ A;  4TUY B;  4LR3 A;  3QTC A;  5JCO A;  3BAA A;  4I4T B;  4O2B B;  3SJA C;  3K59 A;  3KAK A;  1XMO H;  3RYH B;  1M4U A;  4LNU B;  4TQF A;  4DR6 H;  5IWA B;  1IBM B;  1S03 G;  2VWJ A;  1Z5W A;  1TUB A;  3JAL A;  4DV2 B;  4FLW A;  4LFA H;  5KHI A;  1V9P A;  4X62 H;  3RYI B;  5J2U A;  3CHX A;  4D7S A;  3C0F B;  3SJB C;  4JI6 H;  4DV6 B;  4RAZ A;  1D5A A;  3JAR A;  3JSN A;  4A2B A;  2RQ6 A;  3JSL A;  4PI2 A;  4OX9 H;  3OTO H;  5FNV A;  4FLX A;  1ZHQ A;  4O4L A;  4DV3 B;  1Q8I A;  1XQ8 A;  1X9N A;  1S5J A;  3B2E E;  3EYY A;  1IBK H;  3N43 B;  4X1K B;  5LXT B;  4B3R H;  3VQV A;  4TOI A;  2CW7 A;  4JI8 H;  4O2B A;  4DR3 B;  3BAB A;  3RYH A;  5K1P A;  4EEQ A;  4LF9 B;  3JAS B;  3MAQ A;  4X64 H;  1HR0 H;  5EIB C;  1G6U A;  1TUB B;  3JAL B;  5DIS C;  3KAJ A;  4IHJ A;  5IT9 W;  4E6N A;  4UCR A;  3TY5 A;  4CS2 A;  3QF7 A;  1Q3E A;  4DR5 H;  2YI9 A;  2HIX A;  3SR2 C;  5CB4 B;  4O4H A;  3L2P A;  5A2Q W;  1JFF B;  2F93 B;  5FNV B;  4LFC B;  1J5E B;  4JI8 B;  2ZJT A;  4DR3 H;  1SYX B;  4PZ7 A;  4ZIB A;  5CA1 A;  1FJG H;  4I55 B;  4IIJ B;  5J2T A;  4DV4 B;  5KHH A;  4LF6 H;  3U0Z A;  4DR7 B;  4JI3 B;  4OX9 B;  4FLV A;  3BHP A;  3CVZ A;  4BW9 A;  4B3S H;  5JQG A;  5BMV B;  4I4T A;  4CC5 A;  1P49 A;  4GKK B;  2MCT A;  5LYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...