4UCUA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucuA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucuA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucuA02
2UUBB 1P16A 4DUZB 3NC0B 5IWAB 2HIXA 3W1GA 1XNRB 1FVIA 1B04A 4JI6B 4DUYB 2CFMA 4UFZA 4B3TB 4CC6A 3RTXA 4DV2B 2UU9B 3BABA 4X66B 1CKOA 4DR4B 2UUCB 3T1HB 3UQ8A 1CKMA 3S24A 5D1PA 2HHHB 4DV7B 4X64B 3KYHC 4B3SB 4EEQA 4X62B 4PZ7A 5LMNB 1HNZB 2VUGA 1XMQB 1V9PA 4DR7B 4LF7B 4LF9B 1XNQB 4AQYB 3NBYB 4LF6B 4DR5B 5D1OB 1HNWB 4YY3B 4UCVA 1X9NA 4JI0B 3BAAA 3JSLA 1DGSA 4DR2B 1IBMB 4K0KB 3T1YB 3TY8A 5LMUB 1I94B 3RR5A 4JI1B 4GKKB 3TY5A 1IBKB 4DV5B 4JYAB 4DR6B 4LFBB 2Q2UA 1N36B 3PN1A 4JI8B 4LF4B 4DV0B 4LFAB 3JSNA 1HR0B 4LH6A 4NXMB 4DV4B 2ZM6B 5FPOA 1N34B 3W5OA 5BR8B 1VS0A 3BA9A 4UCRA 4LFCB 1CKNA 3GJXB 4LF5B 4X65B 2VQFB 1J5EB 4PZ6A 4EFBA 4DRFA 3OTOB 4TOIA 4UCUA 4JI5B 1HNXB 2UXBB 2UXCB 4E6NA 1P8LA 5FPRA 4LH7A 3SGIA 4DV3B 5DISC 4CC5A 4JI3B 1CKNB 4JI4B 1S68A 4UCOA 4OX9B 2UUAB 3GB8B 4GLXA 4DV1B 1XDNA 4GKJB 4UCTA 4YHHB 4DR3B 2OWOA 1A0IA 4LF8B 2HVQA 1FJGB 2Q2TA 3QWUA 4B3RB 4JI2B 3NBZB 1XMOB 4JV5B 4NXNB 2HIVA 4UCSA 1N32B 3L2PA 5D1OA 4DR1B 1N33B 2F4VB 4PZ8A 2UXDB 3W1BA 1TA8A 1ZAUA 1TAEA 4KHPB 4EFEA 3VNNA 2VQEB 1IBLB 2E5LB 2HVRA 3TY9A 3BA8A 4B3MB 1XK5A 2HVSA 4DV6B 3GDEA 4EQ5A 4JI7B
chains in the Genus database with same CATH superfamily
1E4FT 2I80A 4GLWA 3JAKB 4O3QA 3FB5C 2QDOA 4DR4O 5DM6V 3HB3B 1EZ1A 4IT5A 2UXNA 4YJ3F 4FM0A 1K97A 3E89A 1IBKO 1ORQC 3HKBA 3AG7A 4E2LA 4DV2B 1RPOA 3T1HB 1HNZO 1AUXA 5JVDF 1TWCA 1W59A 5L1LA 1XMQO 5E1AC 4IAJA 2UVWA 4DV7B 3TETA 2RDIA 4NTWA 4Q8EA 3VPBA 2CUGA 4PZ7A 4MAMA 1RK6A 4MV9A 2YXHA 2BTOA 2R7KA 4FLZA 1B6SA 2EIMC 2H94A 3JCZA 2ITCC 3RV4A 1EKPA 1IBMH 2VS0A 3HO8A 3RN4A 3MR2A 1DGSA 4QNHB 1JX4A 3CJHB 3FYEB 4I9WA 3IG0A 3ZEDA 2P4KA 3ABUA 2HGXA 2CTPA 2OCCC 1F4NA 4O2AB 4FM2A 4RNMA 3RYHA 4LF9H 2ADQB 3SPCA 4GYCB 5JQGA 3UO2A 5JJJB 4IR9A 3E86A 4QWAA 1BCCH 1J5EH 1GTOA 1YCIA 5KFEA 3T4DA 1HNXH 4IZOA 1SESA 3E8BA 5KFKA 2VQEO 3T1YH 4X9QA 2WA4A 1YXBA 2B1GA 4J0MA 3JD2A 1AI5A 1JCHA 4DV1O 2ATLA 1GGOA 4Q4DA 1BHAA 4BY7G 4FLTA 1BNCA 5EK0A 5I5UA 4YJ2B 1Z5WA 4JTCB 2W9BB 3M9OB 1I3QA 5EDWA 1K92A 4L1KA 3NUAA 4NYKA 5KFJA 1QCEA 2FKLA 4ME6A 3H1KH 2QGNA 1Q7YW 1CQJB 4X62O 2DYSB 4B3MO 5KHGA 3L9DA 3N2GB 1PV0A 2ITDC 3FKSG 2ARHA 3RB3A 3N8DA 4AQYO 4KHPB 2EULA 5BYBA 2GTSA 5I47A 5F9NA 3JASA 3HKZA 2ZDIA 2HVSA 1I1KA 4DYLA 4DV6B 4NZMA 1JFFA 2V5AA 3E8HA 4O2AF 2HHFA 1OCRC 2A1HA 2EJ0A 2X5RA 2GV9A 3JAWB 4JI6B 3ETDA 1SA0B 1GN6A 1VF6A 2JEFA 2N74A 4A2BA 2G38A 2ZT9B 5KFXA 3LDDA 1HDJA 3CC7V 2DABA 5KMGB 4QWDA 1ZSPA 4YR2A 3OAAG 2WLLA 1K33A 1SQGA 4Z2WA 3ZRWA 5L3EA 4B3SB 5CB4A 4MA0A 1BSMA 1MSDA 1IYEA 3KAKA 3ABLB 4EBCA 2Q7GA 4PDRA 2OIGA 1W2BU 1H2KA 2FPIB 3ZIAG 4TV9A 1NI8A 3HKZE 4YJ2F 3WWHA 2YEVA 5A2QN 3EPIA 3DTUB 2JEGA 1KECA 3AK3A 5KFSA 4F6RB 5KFWA 2YS8A 3AG3B 3EYYA 2BE3A 1N36O 4DL5A 3BFRA 5LMUB 1FAFA 2R9AA 2R92G 1K4CC 1N0JA 4YHHO 3LWBA 2W7OA 1Z2GA 2J6TA 1ZTEA 3GTPA 4I7ZB 1Q43A 4TSFG 4ZHQF 1E4EA 3H1LH 3TK1A 1O9HA 1XREA 3H4BA 5KFAA 4BW5A 4OPHA 3GTLA 1AI7A 4RQEA 4MSWC 5CA1A 4KP4A 3FDSA 5FL7G 5L1KA 3BQ2A 2UXCH 4JUZA 3CRQA 3KAJA 2ZDIC 3K06A 1US6A 5KFPA 2W9CB 5FPRA 3UT5A 1VQLV 1OWTA 3CCQV 3Q8RB 4TQSA 1R73A 2F43G 3L74H 2ILMA 1S10A 1T36A 4PV1B 4JYBA 2CH7A 1VAJA 1Q5OA 4FVMA 1K3EA 3KXYT 2C2DA 3HKEA 4LF5H 1YHQV 3W7XA 1A0GA 2IW5A 5B1AB 3OTOH 3AYHB 1Y67A 4JI2B 4PJ0Z 1GRJA 2EILC 4JV5B 4ED6A 3JAKA 3ETHA 2C2EA 4JV1A 4DV3H 2NUAB 2UVRA 4LF9O 1K4DC 4AILC 2UUBH 3D8CA 4LCUC 4DUYH 5KFDA 3RVYA 2Y48A 2IH3C 4DR2O 4A3LG 1TUBA 3H40A 2R7NA 2WLMA 3U10A 1NKDA 2IU3A 1MG1A 3Q8PB 5HNEA 2PBZA 1S5JA 3PR5B 3N27A 2HFEC 5LMNO 3KALA 4JV2A 1CKMA 4PDBA 4FS1A 3PW2A 4QE7A 3T99A 1QU7A 4JYYA 1SQXH 1CEZA 3TQTA 3LNMB 3CJHA 2HGWA 3U11A 2VUGA 3ZN1A 4BBSG 2KB1A 1XNQB 2DPIA 3WB0A 4TQRA 2FYUH 1M56C 4LF6B 4RB0A 5L1IA 5LGUA 4O2AA 3DTGA 1Q6HA 4MVRA 1H8HG 4TV8B 4RZRA 3PZPA 3D3IA 5EWGA 2BQ3A 3T1HH 5KHJA 2HVKC 3TXSA 4WF9V 1ROPA 1V51A 4DV7H 3R5FA 2YL2A 1BE3H 1K73W 1MMMA 4LF4H 3RYCB 3GIIA 3K3WA 1RJPA 2XASA 4O4LA 3JSNA 2FKXA 1NTKH 4ZI7B 3GILA 2W6NA 1A32A 2PI4A 5DQIA 3CD6V 3IFXA 1SS3A 2N04A 1KTAA 3VOTA 1S0NA 4X65B 2KSWA 1KJJA 4K8ZA 2W9BA 4EYIB 2C2RA 1SC5B 3T5JA 3KHHA 3DF7A 5KFYA 1YJWV 2BQUA 3GIJA 5BMVB 1BS3A 2JIZG 3TCUA 3TW7A 2FB5A 3CHXA 4FLXA 5B3SC 4PA3A 3CCSV 2MCTA 4JI3B 1PNLA 4UCOA 4APMA 1S77D 1XILA 3ZN0A 3HOZG 4J9SA 5C1PA 4GKJB 1QVGU 5I5TA 3T2MA 5BYAA 1MZEA 4BWAA 1GLVA 2LFSA 5KUMA 4K6NA 4O82A 1EN6A 4Z1VA 1XMOB 4FJCC 1BT8A 2HIVA 3LQSA 2RDCA 3DC6A 3G6BA 4TV8F 1KC8W 1E79G 2W70A 3JAWA 3H9VA 1SA0A 1OCCB 4EKWA 2RGRA 3F7YC 4RCNA 1SERA 3MR3A 1GN4A 1XL4A 3L71H 3L4JA 4EQ5A 1SQBH 3CMAV 2AZ2A 3RT3C 2O03A 2V59A 4O7TA 3AK2A 3APOA 4HBNA 3CCUV 5JWPA 5HFMA 4TUYB 2GTAA 2HJWA 2GBOA 2W0FC 4ZI7F 3N43B 2EIMB 4HQ6A 5CMUA 4JYAO 1Y1WA 3SJQC 4BBRG 3SR2C 5EWFA 1GAXA 3CCVV 3RBDA 2YRXA 4ED3A 1Y66A 2UUCB 1AP5A 1FKAO 3ZCCA 5D1PA 4FS2A 1B6RA 1EKFA 2PF4E 4B7KA 2ZIOA 4DV6H 5BMVF 3R5XA 1VARA 2A7WA 3GB7C 3VBBA 2R8HA 4LF5O 1AI4A 1YSCA 1MNGA 2GDSA 5BWTA 1ZHQA 1SQQH 3ZMUA 2LJ2A 2WPDG 4F6EA 3G6YA 4FFMA 4JI6H 2YZNA 2F95B 5C5JA 5FLXN 1OZ0A 5KAFZ 3ZJZA 4ECYA 3E8GA 4DV3O 4PD4F 4K3AA 2DYSC 3RGBA 4LWSA 2ZINA 1OJHA 1PK8A 1IBMB 3JZIA 3K5OA 3MJFA 4B3SH 5JJEB 2V4QA 1BGYH 1EZJA 4A3KG 1FJGO 1Y1VG 4JTAB 3HOWG 4G3IA 1N34H 4PDMA 5BR8H 3CXHF 2CDYA 3G80A 2W9CA 3F5WC 4O4JB 4ABMA 4FLUA 2YI9A 3HKBB 1N32O 4DV4B 1KJ9A 2F4VO 4O83A 4J9QA 1PKXA 4O4IB 2RDJA 4GUNA 3ZHTA 5JJNB 3OTFA 1J5EB 4ECVA 4TUYF 4J9LA 4MW3A 4ECSA 5LMUH 1NZ6A 2KKWA 2Z04A 1HNXB 1BZKA 2R93A 3JCUZ 3GIDA 2W8LA 2JEIA 2JEXA 2WWWA 2SCUB 2W57A 3QQMA 2COJA 3KREA 3IGAC 4J9RA 2JRIA 3OGCC 2YU9A 3ABLC 4YIOA 1D2DA 3M7MX 4DK1A 4IWYA 4LSAA 3ZBHA 4IIJF 4DV2O 4IR1A 4O7RA 2FE3A 2EIKB 1KEEA 3UZOA 1YF2A 1WB7A 2EJ7A 4AI8A 4OGQB 2HGSA 1OCRB 3IJ4A 4H13B 4DL6A 3AG3C 1M93A 1O9GA 4NTYA 3KHLA 3U9SA 2E5LO 3VQVA 3KTMA 1R9TA 3L2PA 2OYQA 2IP4A 3RYHB 2AHYA 1TA8A 4EFEA 3STZC 3ZHUA 5JQGB 1IBLB 2HVRA 2QM8A 2W6IG 3GTOA 5B1NA 3CB2A 4BIZA 1V4YA 3PW5A 1K9MW 1JDEA 1XNRH 1F4MA 1SCUB 4Q8FA 2Q4PA 2MK3A 3K3VA 4J10A 4JV5H 2LO1A 3RBEA 4CS4A 4MV8A 5LA6A 4O4IF 3U55A 1VIBA 1SETA 1AB3A 3RFRA 4K35A 3MWEA 5CBHA 1C3OA 4TV8A 1URFA 3OE7G 4J9ZB 1KU9A 1OHHG 1A48A 4PA7A 2A06H 5KFTA 3JALA 4F4LA 1KQSU 5CA3A 3RYCA 2VOBA 1E1QG 4CH3A 5I60A 5B1AC 4IYHA 1I94O 3ORQA 2OLSA 3WG7C 1IOWA 4JI0B 1RJQA 1H38A 4GKKH 1GN3A 4JGSA 2JGDA 4K0KB 1G2WA 4DV5H 4MTFA 3ABKB 3OGIB 5L3DA 4U7NA 3G67A 4A3IG 1IX9A 3CCLV 4QJFB 2HHFB 4CBCA 4LFCO 4TVIA 1AI6A 3M9NB 2QJ1A 2LW7A 4ICGA 3TGUH 5JQGF 4LF6H 3N42B 2F23A 1VQ6V 1FFTB 2Z0AA 3MHSC 3K5NA 4UCRA 4KHPO 4JI5H 2OTLV 2E75B 4PZ6A 1I08A 4YIPA 3ZRWB 4ZBMA 4TOIA 4RUFA 2UXCB 2M05A 2DWCA 3T9BA 2ALZA 4JI4H 4MTOA 2LGWA 4DR3O 4TV9B 3N6RA 1M0WA 2Q67A 3OEEG 4HAMA 3CRRA 2UUAB 4YB8B 5KFMA 1N0NA 1WNSA 3SJAC 3IN5A 4X65H 4RZQA 4TM5A 2B1IA 1VBGA 1A3GA 1DIKA 2J6UA 4B3RB 3H20A 4B3SO 1GSOA 1NTZH 4UCSA 4AYBE 4TUYA 1N33B 2O57A 2QE7G 1JX9A 3TXQA 4JI3H 3H0GA 3V4SA 2ZNIA 3X2QC 2YZMA 3ZRXA 1RSOB 4P9PA 2XCLA 5CA1B 4GKJH 2W6MA 2CGOA 2JDIG 3C3SA 1JLLB 1UC8A 2UUBB 2W8KA 4CZZA 2P0AA 2YYAA 2HIXA 3TW6A 1OCOC 5EC2C 3LDEA 4IRDA 4DUYB 1XMOH 1M56B 3ZX6A 4NVPA 3VQXA 1JR9A 1KJQA 5JUMA 1VEWA 3TQ1A 3UT5B 2HHHO 3HB9A 2WLJA 2ZR2A 1LUWA 3A0RA 3FKIA 5L9XA 1MZBA 3QFFA 2GQSA 2KSDA 1M57B 1Y6XA 2FLLA 5CB4F 2D2CB 1GYFA 2DQ3A 2MW2B 2OIEA 2IU0A 2EINC 3OUFA 4YXWG 5EOYA 4EEYA 4ASUG 4TV9F 1V9PA 1V54C 3AG1B 1GO3E 4ED2A 3B8NA 1K1QA 4RB1A 2JEJA 4LMYA 2NR5A 2ZNJA 3ETEA 2DPJA 1JMKC 4ED1A 1X9NA 4O4JA 3B8MA 2UUCH 4WFHA 2COGA 3R5HA 3S3XA 4D7TA 4B08A 2NU8B 1Q3EA 1Z5VA 4UB8Z 1OCCC 2Q6AA 4O4IA 3K5IA 4JAVA 5DN6G 3RR5A 5B5EZ 1VQ9V 4JI8H 3OSNA 2DW4A 1YJNV 5BWVA 4QGPA 1X4TA 1K8AW 1TUBB 3ZS8C 4FK5C 5B3SB 4LF4B 2M6YA 4JI2O 4A3GG 4NLGA 4DQNA 1AROP 1O75A 1NR1A 5CA1F 2R6FA 4E4EA 3BA9A 3GJXB 5IYBG 5KAIZ 1F23A 3KZIZ 2Q0OC 4DRFA 1YJ9V 3FB7C 1U97A 2UXBB 1EKVA 2K1EA 3ZMZA 2YS7A 4FFLA 4QWBA 3F5TA 3RWRD 4LH7A 4Q0YA 4GC7A 4XX0B 5DISC 4JF3A 2Y0PA 2QKCA 4DV4H 5JH7B 2FMAA 3QTCA 1VKZA 1UPGA 3A2FA 2R93G 1SRYA 1VQMV 1JDBB 1Q6UA 1S5LZ 2VRZA 1A9XA 4I55B 3A0HZ 3NGDA 2JA5A 4XZ3B 4I4TB 2R8GA 3T5HA 5I5WA 2DWDC 2D3OW 2L35A 4WFBV 3TEKA 3SDLA 3M4IA 4O4LB 4O7WA 1XNQO 2FB9A 4LF6O 4QPKA 5IT9W 2QF7A 3JARB 1AUVA 5KS8A 5D5QA 2FLPA 1CPYA 5IWAH 3ZHVA 1WJZA 4R6ZA 4N21A 3GIKA 4ED8A 1E1RG 2CTWA 2PI5A 2UU9H 3RB6A 3CCJV 1MOFA 1Q90D 4LC1A 5GTIZ 1S72V 4B3TB 4CHIA 5KFZA 1EYZA 3LNNA 5GONB 2CQYA 1I7NA 1IBLH 5IYZA 1K5QA 2VWKA 3A0BZ 4ZIBA 3J80N 2A3QA 3JYCA 4WFFA 4LF7H 3M9MB 4X65O 1L0LH 2ASJA 4M9UA 3D36C 1GSAA 4YY3O 4NTXA 1IXMA 2EIKC 3OMAB 4R7CA 1NH2D 5KFIA 1PNKA 4QJFA 1S3JA 2Q9LA 2CZGA 2BTQA 4U3JB 1UJWB 4MVMA 3OW2U 4DR6O 5KT4A 4LFBO 2UVUA 2X6BA 4MT8A 3RBZA 3SYCA 4I55F 3JAMN 4TT3G 4R50A 4I4TF 4U6PA 4J9OA 4JI1B 2RF4A 1OCZC 4PA9A 1TUEB 4I9QA 1P49A 4NKGB 3L75H 2ZKOA 4O4LF 3OR6C 3TIIA 3QZ7A 2FP4B 4EBDA 2QSAA 2R9IA 2YI8A 1YTFD 4YAJB 3VMMA 2W9AA 1SQVH 1PL4A 2R9RB 4LR3A 1N34B 2YZLA 5BR8B 4FZ1A 4XYLB 4QWEA 4JI0H 1KUQA 1QLEC 1GK9A 3J7AK 3QO5A 4K0KH 4MVSA 5LXTB 1ZUQA 1MSWD 2E2IA 1R3IC 2WSSG 4FZ0A 2R87A 1RYSA 3ZMTA 1JXLA 1MA1A 4HN2A 4MTEA 5CA0B 5KT6A 2NVXA 5HV6A 4OXSA 2VUMG 1Y74A 2AU0A 1ZWIC 3B2EE 3OUZA 2W6JG 2PYJA 1IURA 2R7LA 4HNUA 5H6QA 4ZQIA 4UCTA 2LFRA 4LWSB 4FMTA 1RSOA 1JVMA 4D6TH 4CMFA 4FBUA 2P4VA 5IDJA 1P7BA 4UV9A 4DR1H 4ED0A 3G8CA 3ZMVA 1NJIW 3FAVB 4JZ2A 3PW0A 3ABKC 3K0DA 3RB0A 3RV3A 3K59A 3HKCB 5BWXA 4H0LB 2L6LA 2R8JA 1H8EG 1BMFG 2CAZC 4L87A 3VNNA 2QWRB 3J81N 2UUAH 4IHJA 3BA8A 1WCMA 5I5XA 5EC1C 3E35A 2CK3G 1JPXA 5KHHA 4DUZB 2R84A 1IBMO 3MR6A 1XNRB 3ASOC 4B3RH 3H0GG 2CFMA 4PI0A 2ZE8A 5KFQA 1N33H 2K9PA 5KG3A 3G6XA 2A79B 3CRAA 3WG7B 3I56V 4DR4B 1ZETA 2QWPB 4DXWA 1I1MA 3B4SA 4TWKA 4DV4O 2EJRA 1WAZA 5FNVA 2OTJV 3N2KB 3BPZA 3M8AA 3HOVG 1J5EO 3GWOA 1HNZB 4U7OA 5CA0F 3L4KA 3K0GA 1B06A 1XMQB 3FKIG 1HNXO 4J80A 4J42A 1GKFA 1JJOA 3T1YO 2JS5A 2HG8A 4WHXA 4P2ZA 1Q6IA 1HWYA 4N23A 2GPSA 1XBLA 3AEIA 1S0OA 2QKSA 5DEDA 4DW1A 3ABTA 4GKKB 3TY5A 4LFAH 4MV7A 4NB5A 5A2QW 2JGUA 3WFVA 3ZRVA 4DV5B 4UUGA 5KFLA 1HR0H 3Q1KA 5KG0A 3H3VH 3RFCA 1LNQA 2AZ0A 3DXRB 3PW7A 5I5YA 5LA6B 1M0TA 1DV2A 1NVPB 4WD3A 2VQFH 3W5OA 5DMXA 5E79Z 4CKCA 3UM7A 5JH7A 2C35B 2ZJTA 4BIUA 4JI5B 2IJIA 3ASNB 4GCZA 1M57C 4I55A 4PA4A 2HKOA 2WLNA 3WNZA 5DGAA 4I4TA 4CE5A 3JALB 1T3NA 3OD4A 4R8CA 3CQZA 3X2QB 3GQCA 1JJ2U 5GW7A 3GLKA 4F4WA 4JI4B 5DG7A 4FFPA 1VQNV 1K5SA 3AG1C 5KFRA 4DV1B 2DMXA 3B40A 2COIA 2AQ4A 3GIQA 1EN4A 5KFFA 2V4DA 3JARA 5HFLA 3WB2A 3MR5A 4NXNH 2JGDB 4W4KA 4WFEA 1OCOB 2WLHA 2CW7A 1UFIA 2H8PC 2UXBH 2UXDH 2P67A 1S0MA 5DQHA 5EYPB 5J2TA 2PYLA 1WA8B 2Q69A 3GVMA 3WWIA 2WAQE 4A3JG 2V9WA 2J9GA 2V7QG 4B3MB 5GONA 2CNUA 1FXKC 2JA5G 1HP8A 4RAYA 4UXNA 1H2LA 2EINB 4O3OA 3GV8B 3RAXA 3VOUA 4O7LA 1V54B 1R6KA 3ABMC 2ZIMA 3MD0A 3CC2V 2C2AA 5LA6F 3OHAA 5J2UB 3BHPA 5F2VO 5LP6B 1Z2OX 3FFQA 2XNDG 4X66H 4X1KB 3LUTB 2XAGA 3RTXA 3BABA 1ENVA 1CKOA 3CYOA 3GTKA 4DAAA 3CMEV 2P7TC 2P22C 4U3JA 2UVVA 2BQRA 2IBZH 3WU2Z 1IDSA 3K3PA 4DR7H 1R6NA 5H2FZ 2PN1A 5K3WA 5IYCO 3BACA 4DR5H 3CRMA 1QHTA 5CR5A 5BPFA 2JA8G 4A3DG 1Q81W 2UXCO 2NLJC 3HBLA 4Q4CA 4B3TH 1Q8IA 5EBLC 3BCCH 3H01A 1M7JA 2WB1A 3JRXA 4LSXA 4CH6A 4AHCA 3N44B 1Q82W 4U3FH 1LUVA 4FGRA 2XAFA 4RB2C 4DV0H 2LP7A 2R7ZA 2HJFC 5LXTA 3TINA 3WO0A 3K03A 3VA7A 1GM9A 2CW8A 4NXMH 1N36B 1OBGA 4MV6A 4HNAB 3P3NA 4MTDA 1COWG 4JI8B 3Q8QB 2ZM6H 4B3RO 4IRKA 1WN7A 5LYJB 2VPSA 5LOVA 4Z1MG 2ZDQA 3OTOO 2JA7A 5CA0A 1N33O 4LBEC 4QE9A 2WLKA 5FPOA 3RYFB 2GLTA 4KUMA 3EFFK 1D5NA 2W0XA 5C4XG 5IYCG 4FLVA 1PP9H 3FX7A 1FFXB 5J2UF 5LP6F 4JI1H 4MV3A 2WB1E 4A3BG 2UUBO 4IWXA 4PBCA 2RJZA 4OX9H 4DUYO 3CEIA 1V55C 4CKBA 2F1MA 3FAVA 2XD4A 2RGVA 1XHZA 1MZFA 5KG6A 3HKCA 4LF8H 5KG7A 2ZXWB 1XQ8A 3V6HA 5H9CA 1M9NA 2XT9A 1RK5A 1SFOA 2HLDG 4PHZA 3AX6A 3SPHA 2Q2TA 3N41B 4EYHB 4RNNA 2KG7B 2NU7B 5KT7A 2FK1A 2C00A 3K04A 4RUAA 3EHBB 4Q20A 3G4SV 4MTGA 5D1OA 2E76B 3T5LA 3SYPA 4ECZA 1ZAUA 3W7TA 3EVKA 2XCPA 1KYOF 1GO3F 1QQCA 3WWJA 1R3JC 1DLBA 2EZOA 3PO2G 2DN9A 3C3TA 4I7HA 5F9LA 2ZGIA 3L70H 3EXAA 4FLYA 1N56A 2GPWA 5IWAB 2LQTA 3N2KA 1SYXB 3W1GA 3T1HO 5LYJF 4FLWA 2WTFA 1TVKA 2FLNA 4DV7O 2BOCC 3AG2B 3GWKC 4CC6A 1SQFA 1WCMG 2UU9B 4LF4O 1Z2NX 5K1XA 4JXUA 4KXRA 3UQ8A 2V4RA 2XHBA 3I12A 1BGWA 2F93B 3GV7B 2DJVA 4J9MA 5D8DA 1OCZB 4DLKA 3V6JA 4FE2A 4DUZH 5LMNB 3ETGA 1TWHA 2UXXA 2EX3A 4LF7B 1HNWH 4P30A 2QA4V 4MW8A 1WRVA 2IH1C 3ORRA 1N48A 3A8TA 1VBHA 4O4JF 1NVPD 4U7CA 4IGGA 1I5YA 3DXRA 3PW4A 3T54A 4DR4H 5KA5A 3IAYA 1QLEB 4XBFA 3U0GA 2QWNB 1KJ8A 4ECUA 2ZCEA 1IBKH 2V1DA 5FLXW 3QZ8A 2IJHA 2E3CA 5L3GA 4A3EG 5C8YB 1HNZH 1XMQH 1ZQ7A 3KHRA 3BY6A 4QWCA 4O7NA 2E2HA 4YR3A 1KJIA 1EM1A 1KD1W 1P4RA 1IXBA 1QBZA 5D5PA 1EHIA 3BVOA 5FJ8G 2QTSA 3QO8A 1W96A 5IYZB 3QO7A 5K1PA 5C44G 1N4CA 4GX2A 3VPDA 5EZYB 3CS5A 2ATKC 4JAAA 4RUCA 1CQIB 4F4ZA 2FPPB 4W4LA 1RYRA 2B5UA 5EYPA 1CKNB 1GM7A 1WA8A 2BTQB 3T1CA 3GB8B 4G28B 4JASA 1I6UA 2EIJB 3E5NA 2AGPA 5C1OA 1KP2A 3E2EA 1FS0G 2JK5C 2ZD9A 1AJNA 3ASOB 4AYBA 1K7DA 4YAKB 1VQ5V 1M5IA 3HOXG 3G6EV 3HOUG 3W7UA 1YI2V 4DR1B 4DV6O 3Q4HB 4PZ8A 2RN9A 2ZDHA 3H4DA 1W0JG 5J2UA 5LP6A 1W0KG 4X1KA 4HYOA 1KKDA 3TY9A 2RQ6A 4Q6GA 4JI6O 4DV1H 4C5AA 1FXHA 2R70A 3T4ZA 2Y69C 5IP7G 4TQFA 1N8RW 5BWUA 5A9GA 1FVIA 3JRWA 2CNQA 1B04A 5I5SA 4IYIA 2QWQB 2QM7A 2DZDA 1RPRA 1YIJV 3SNOA 4HNTA 2JVDA 1KKCA 3ASNC 4DL3A 4YBZB 5IYZF 4B7EA 4YR0A 4ECWA 4XDKA 4X62H 1Y74B 3ETQA 5EZYF 4B3MH 4ZOLA 5BZBA 4X64B 1N34O 5BR8O 1I5XA 2E74B 3PJSK 3H1HH 4AQYH 3GTMA 5KHKA 3R66A 4YJ3B 2GHYA 4FFOA 2YIAA 5CBFA 3I55V 1S97A 3HKDA 5LGNA 2Y4TA 5IP9G 4RWUA 5LL6b 5LMUO 4HNAA 3D3QA 3RYIB 1THZA 1SKVA 3BAAA 3BEHA 5LYJA 5L3CA 4GT1A 3RYFA 3CXCU 4IHJB 3I4MG 1AJQA 2DYRB 3SI8A 4MVQA 5FD5A 1WP7A 3LSQA 3RUPA 1TGOA 3CWBH 5I5VA 1FFXA 2QR4A 2Q2UA 2I8CA 1I2LA 4LFAB 3CSWA 3CRCA 5IYBO 4TQDA 1HR0B 3OEHG 1Y1WG 2AHZA 3GTJA 2AGQA 2EJ2A 1WP8A 5DECA 2PMZA 2QEXV 2VA2A 2VR1A 4A93G 4PI2A 4J7ZA 5B1BB 1VS0A 5LP6C 2QKAA 2R7ZG 3JD1A 5LGTA 2VQFB 2FL4A 2R86A 5DLFA 5FNVB 1I7FA 1VQOV 2P5OA 3EPGA 3T9CA 3O65A 5IJ0A 1WPXA 3G6VA 1L8DA 1N36H 1EUDB 2KG7A 2JA7G 1CE8A 5IYDO 1XNRO 4JZGA 2ZR3A 4X8AA 5EIBC 4E4TA 1YZBA 4C7UA 3RAQA 1F7YA 4YHHH 1S68A 5KHIA 1FPOA 2GUZB 4JV5O 1FXKB 4UV8A 4BAYA 1DTOA 3P32A 2XTAA 3RW0A 5BWWA 3F8NA 2Q0AA 2Y4RA 3I4NG 3ABMB 3BRCA 2PMZE 5IY5B 1S76D 2HDKA 2VWJA 3D36A 4NXNB 4PA6A 1NT2B 3JD3A 2PVPA 3PFFA 4Y8VB 2QK4A 2UXDB 2XAQA 3W1BA 2X7RB 4Q45A 3ML0A 1VF5B 4IHJF 3MAQA 3MDSA 2E5LB 5IJ9A 5KLVH 1PX2A 4Q43A 3GTGA 5BPHA 3Q2OA 4G27B 2AGOA 1IOVA 4JI7B 5B66Z 4QIWA 5EWEA 1T94A 5IYDG 4EG0A 3SPJA 3CC4V 4O7YA 4GKKO 2EIYA 3E22B 4DV5O 2RNBA 2JJ2G 5BY1A 4X66B 3H1JH 2PTMA 3HOYG 1KT8A 4CS3A 5TISZ 5FNVF 1I1LA 1WLEA 2GQRA 5HBRB 3KYHC 1WPBA 5H80A 2P06A 4O3PA 4H33A 1Y76B 4CH5A 2ZXWC 2XIGA 4DR7B 4EBEA 5LHIA 5DG8A 4DL7A 4JI5O 3NBYB 2YIBD 5C8YA 4DR5B 1VQ4V 1QR8A 1ZLZA 1NTMH 4QPJA 5J2TB 5CAEB 4QIWE 1YITV 2FPGB 4BW9A 5KG4A 2DOSA 2YIBA 4UCVA 5C93A 3U54A 4DR2H 2R85A 2ODMA 3PR4A 1S9FA 4JI4O 1XI1A 2IBKA 4F4YA 5C3EG 4KL1A 1I94B 3RJ0A 2CTQA 1ZHSA 5LMNH 5EZYA 5KT3A 3KCXA 4DRXB 4DV0B 1V55B 3G8DA 1JQ0A 4X88A 1PL0A 3AK1A 4NXMB 1VQ7V 2ZM6B 2OCHA 4WBNB 4O3RA 3CCEV 5JVLA 3ZMSA 4LFCB 1CKNA 3P3PA 5JH7F 2NNUA 3AG2C 3O9OA 4GZRB 2YWVA 3LSUA 5CM0A 4C5BA 4EFBA 4M7EA 5CBGA 4JI3O 4R8UB 1H2GA 4H37A 1BQZA 3LULA 2M7WA 4WFGA 2RCVA 4H44B 3MFHA 4GKJO 4ZHQB 1M6VA 1M1KW 4PWQA 3OFNG 1GMGA 2QWOB 1S5HC 1PD3A 3Q4HA 4FFBB 4OX9B 2LW1A 4ECTA 2JS3A 1XMOO 4O2BB 2JJ1G 3ZRSA 5L3FA 4NZNA 1M4UA 4O3SA 1AR4A 3MHHC 2W6QA 4DR3B 4WFAV 4LF8B 3SYQA 2Q68A 1G4YB 5K2MA 3SPGA 4X1YB 5J2TF 1FXVA 1KB9F 2JEUA 1I0HA 1AP6A 1IZ3A 4O7SA 3GV5B 1G6UA 4YP3A 4UB6Z 5H5NA 2VQDA 5LOVB 2R82A 2AGAA 5GONF 2BR0A 2ASLA 1NQTA 4PDLA 5DAAA 2PGGA 4I50A 5KG1A 2ZDGA 3K79A 1BL8A 3Q8SB 3NC0B 3RIZA 1FD9A 1Y1VA 2Q73A 2Q5ZA 2UUCO 3VPCA 5IE9A 4WBNF 5KFHA 5KFNA 4YJ3A 2W6PA 4RO2A 2ZE6A 5KFBA 4JI8O 4O81A 1RM1B 2KQXA 2Q7HA 1G8MA 1S0VA 3RYIA 2WYOA 3S24A 5KA6A 3SYOA 4QW9A 5JVDA 2HHHB 2HG5C 4RAIA 5LHGA 2PZSA 5JCOA 2VA3A 4LNUB 3LDCA 2CE4A 2HEPA 3W7WA 4F4XA 3LSSA 3B09A 2EIJC 4JV0A 1TWAA 3UO3A 3GIMA 3ZHQA 5D1OB 4O2BF 1HW7A 3OUUA 1HNWB 3J80W 3OR7C 2W6ZA 4GX5A 1R3LC 3L73H 4GC6A 3JSLA 1JOYA 3CPWU 1XOUA 2AW9A 5GTHZ 4RNOA 4X64H 1BJTA 4JYAH 2W6OA 3DTFA 5LXTF 3OHBA 1IBKB 5KT2A 5ITZA 2DIKA 5DGBA 1FKAH 1VF6C 2CKZB 1TWGA 2B63A 4NR1A 1R6TA 1YVWA 5LOVF 3QG5A 1TVKB 4LH6A 5DQGA 4PELA 4WCEV 2BSKA 1GM8A 3RGZA 3JAMW 3C90A 2Q8VA 3STLC 3T5KA 1VQ8V 5BWRA 2GUZA 3HXLA 4F50A 1FXKA 2DLNA 5KG2A 1OBDA 4RU9A 2Y4UA 4UUJC 4ECXA 2DQ0A 4DIMA 2R72A 5KUKA 3I5DA 5IWAO 2J6SA 5DLGA 1I7LA 4FM9A 1E4GT 5AG2A 1FJGH 2UU9O 3RF2A 1XDNA 3JATB 2Y69B 1JKJB 1AILA 1A0IA 4DL4A 2LGQA 1N32H 1EUCB 1QNMA 4JYCA 2QYZA 5JCOC 2F4VH 1VQKV 3NBZB 3DGEA 1IBLO 1I2KA 2Q7DA 5BXZA 1WSCA 1Z2PX 2WAQA 2FJZA 2DYRC 1EBOA 2ASDA 4NYEA 4LF7O 3R23A 3E22A 1L0NH 4O4HB 3SJCC 2VQEB 5FLMG 4J9KA 1CP9A 1VP7A 2R8KA 4M0JA 1ZL8B 3AG4B 1P16A 3JD0A 3T9EA 3KHGA 5B1BC 1PM9A 3OUSA 3N40P 3V6KA 2CNVA 1GN2A 1NU1H 4DV2H 1Y76A 1AJPA 4X1IB 4MVZA 3T9DA 5KFUA 3J81W 3K9AA 2YCHA 4XYMB 3IC7A 4A2AA 3CEBA 2QTOA 3BJYA 2PY5A 4CMDA 2E5LH 4I0XB 1H2MA 5FR9A 1KMIZ 3MWDA 1KP3A 2Y0IA 4XDLA 4X62B 4JI7H 2Y0SA 3HT5A 3CSXA 4JI0O 2XC9A 5KKNB 2JA6A 5DGHA 4AQYB 3JZ6A 4K0KO 4YJ2A 1JIHA 2ADPA 4DRXA 5IY5C 1DF4A 4O84A 3QNEA 4YY3B 3H1IH 2DWEC 4RUEA 3FD9A 2WLIB 3UKMA 4WBNA 1QLNA 2CGNA 1J95A 1R3KC 2X6AA 3K58A 1G1XB 2B9ZA 2QM4A 2YICA 4MS2A 1YEWA 1SZXA 1NBMG 4DR6B 1P7GA 4LFBB 3PO3G 1B3QA 4R8UA 3N2GA 5KX5B 4P9OA 2YZGA 4O4HF 1OV9A 1SF9A 5DGIA 3UZBA 1B6QA 1EN5A 4ZHQA 4DR1O 2Y0SE 4BXXG 1F51A 2BOBC 2IA6A 1TWFA 4FFBA 3CP1A 2A9HA 1L1FA 4FBTA 4O2BA 4ZOLB 1I94H 5B1OA 1AVMA 2WA3A 4E6NA 2GSMB 1JA8A 2R8IA 2UUAO 2FK2A 3G71V 4RAZA 1QVFU 3GTQA 2IM9A 3PVXA 4X1YA 3HKDB 3HR0A 4J11A 1SQPH 2XAHA 3FMAA 4A3CG 4A3MG 2Z5UA 5KMGA 3CCRV 1BQ0A 1KC7A 1UC9A 4BY1G 2Z3YA 4LFCH 4ZKIA 4YHHB 1EFRG 2FTKA 2OWOA 1B33N 2HVQA 3KG2A 1T5EA 3JD4A 4X64O 3QWUA 5KFCA 2EZPA 2R7MA 3DAAA 2ZE7A 5E25A 3C0FB 4QW8A 2NVYA 4EB6B 4KHPH 4C2MA 4JPRA 2ABJA 3ZHSA 3U0ZA 3V4ZA 2ZQMA 4F6RA 4NZOA 1TAEA 2XUMA 4IIJB 2W7PA 2DE0X 4L8JA 1ZX3A 1DAAA 2W71A 1EZVH 2OCCB 3APQA 5H6RA 1AN7A 3WO1A 1DV1A 4ECRA 1WH2A 3TIGA 1XDCA 4DO2A 4KFMA 4DR3H 4RQFA 2P90A 5KX5F 3SE7A 3BG5A 4XDJA 4LNUA 4BR6A 4BWSC 3F7VC 5IJ0B 4X89A 3CCMV 3U9TA 2X0LA 4X20B 4YQWA 2X6CA 4O7ZA 4BIOA 5LL6Y 4LFAO 3RGXA 3P30A 4MTXA 1HR0O 4A5UB 4ZOLF 4Q44A 2HP8A 3VQWA 2VQFO 1UNNC 4J9YB 4FFKA 4OPAA 4MVOA 5KT5A 4LF9B 2YS6A 1PPJH 3E8FA 4UVAA 1C30A 2RMKB 4IRCA 1FYJA 4FFNA 5L1JA 3KKYA 3WB1A 4JAUA 4C5CA 2QB5A 1K34A 5IJ9B 3OM3B 4DR2B 1Q86W 2HHHH 3T1YB 3OSPA 4IL6Z 3BQ0A 3THOA 4GX0A 1SEIA 3FYIB 3T7AA 3GIPA 5EBWC 2C28A 5JQWA 1AR5A 2WAMA 3SJBC 1K1SA 4NXNO 1KUTA 2VPQA 4G2KA 2NU9B 2XGQA 2YSUB 1IVSA 2HVJC 2UXDO 2UXBO 5FD6A 5DG9A 2HJDA 3B77A 4ED7A 4FU0A 3ICXA 2B63G 3JATA 1GSHA 1RM1C 4UCUA 4HNVA 4JI7O 3R9RA 1P8LA 2ODTX 5KFGA 4CS2A 2ZE5A 3RVZA 3SGIA 5J9PC 1WB8A 5LHHA 5EBMC 3M99B 1VF7A 3LMLA 3E83A 4MV4A 2XCAA 3R65A 4GLXA 1Y4MA 3K5LA 2I87A 4X66O 4O4HA 4UVCA 2CTRA 3FB6C 2A0LA 4JI2H 3NXSA 1W93A 2EJ3A 3RB4A 4HYKA 1BHBA 2P6JA 3BQ1A 2XGPA 2YRWA 2YXYA 1SZTA 1ZL8A 3DSQA 4ETSA 2XAJA 3TJTA 5KFOA 2C22A 4J9NA 3AW8A 4FFRA 2IJKA 5CE8A 4DR7O 3T9AA 1NR7A 1S03G 4UVBA 4X1IA 4ECQA 4DR5O 3QVNA 3QF7A 1XK5A 3OT7A 2NU6B 5T14A 1VMGA 1MABG 1XL6A 4QIWF 3SPIA 3GDEA 4B3TO 2YC0A 4I0XA 2YDEA 4CKEA 1H2SB 2FMLA 1VQPV 4UFZA 5CN0A 4ZI7A 1M90W 2WE6A 4JTDB 1QR9A 3JASB 4J7JA 4DV0O 2Q7EA 4R7RA 4FM1A 2F66C 2YW2A 2VQEH 4DL2A 4NXMO 2OH2A 2ZM6O 3K5HA 1JFFB 2DAAA 2WLIA 1DK1A 4EEQA 1NH2B 3UCSC 1XNQH 5BMVA 3UFXB 4J41A 1AR1B 2V58A 2FK3A 3K08A 2HR3A 3L72H 3FB8C 4FPPA 5C8YF 2R92A 4D7SA 5EIBD 3MFIA 4J9PA 3S3WA 5LBQA 4K8XA 2VUMA 5KX5A 2YUAA 3CX5F 3CE2A 4JI1O 4I5SA 2WLLB 3ETJA 3IC9A 4MVUA 1ULZA 5CB4B 1P84F 2EILB 1Y14B 1WR2A 3UYYA 2EBOA 5L3BA 4OX9O 1CXZB 4GX1A 4CH4A 4HR7A 3TY8A 1XEQA 4I50B 3ZHRA 4MA5A 2JA6G 1R1BA 4J7KA 1X59A 2IJJA 1YTFB 4JYAB 4LF8O 2YEVB 2ETNA 1IYDA 1H2NA 4A3FG 1K83A 1D5AA 3PN1A 1YDXA 3VQYA 3T9FA 1RP3B 2BCCH 2PUSA 2X0SA 3AG4C 3OMNB 4DW0A 3NR7A 4O86A 4YY3H 1GH6A 1RFYA 4HZ3A 4LF5B 1RJRA 5KG5A 5JVDB 3SYAA 2YIDA 3OTOB 3CVZA 2WDTA 4PDVA 4RB3C 2OT5A 4QSHA 3HPLC 4DR6H 4LFBH 3OMIB 1PNMA 1E4EB 3K5MA 4O3NA 1KBLA 1I50A 1LR1A 2N05A 1XHXA 4DV3B 2AXTZ 2H3OA 2IMWP 4EB6A 1DF5A 1ET0A 4CC5A 1L2ZA 3J7AU 4LP8A 2XOKG 2Z02A 4MV1A 4O7VA 2YXLA 4IIJA 1CS0A 3JZFA 5KFVA 1XUQA 5IT9N 3LP8A 1NS1A 1FJGB 3KCYA 3K57A 5ITZB 1N32B 4EGQA 2F4VB 4FIPC 3N6XA 2CH7B 4X20A 3DC5A 4DUZO 4DK0A 3HKEB 2BSKB 3MWMA 1HNWO 3K9SA 4I50F 3W7SA 1BXRA 1U96A 1KBHA 4EGJA 2NN4A
chains in the Genus database with same CATH topology
1E4FT 3JAKB 3NC0B 3RIZA 2ZIMA 3K3VA 4JV5H 4FM0A 5J2UB 3BHPA 5LP6B 1Z2OX 4X66H 3FFQA 4X1KB 4YJ3A 3HKBA 5LA6A 4CS4A 3RTXA 4DV2B 3BABA 1CKOA 3RFRA 3T1HB 2Q7HA 3RYIA 3S24A 2WYOA 2P22C 4TV8A 4U3JA 5JVDA 4IAJA 2HHHB 4DV7B 4RAYA 2PZSA 5JCOA 4LNUB 4DR7H 1KU9A 2HEPA 4PZ7A 4DR5H 4MV9A 1QHTA 2BTOA 3JALA 4FLZA 3RYCA 2VOBA 4CH3A 4B3TH 1Q8IA 5D1OB 1HW7A 1HNWB 1IBMH 3J80W 4JI0B 4LSXA 4CH6A 3JSLA 4AHCA 4GKKH 3N44B 1DGSA 4K0KB 4DV5H 4JYAH 4X64H 1BJTA 3IG0A 3ZEDA 4RB2C 4DV0H 1IBKB 5LXTA 5ITZA 1FKAH 2CW8A 4NXMH 4O2AB 4FM2A 1N36B 4HNAB 4MTDA 2ZM6H 4JI8B 2QJ1A 3RYHA 4LF9H 3QG5A 1TVKB 4GYCB 3N42B 1WN7A 4LH6A 4LF6H 5LYJB 2VPSA 5JQGA 5LOVA 5JJJB 3RGZA 3JAMW 5CA0A 1J5EH 3RYFB 3K5NA 5FPOA 4UCRA 1HNXH 4JI5H 4FLVA 3HXLA 4PZ6A 3T1YH 1FFXB 4TOIA 4JI1H 2UXCB 2R72A 4J0MA 2RJZA 4JI4H 4OX9H 4FLTA 4TV9B 2F1MA 2RGVA 4FM9A 1XHZA 4YJ2B 1E4GT 1M0WA 1Z5WA 3HKCA 2UUAB 4LF8H 1FJGH 1WNSA 1XQ8A 3RF2A 1XDNA 3SJAC 3JATB 1A0IA 4X65H 4RZQA 4PHZA 1N32H 2Q2TA 3N41B 5JCOC 4B3RB 2F4VH 3H20A 3NBZB 1Z2PX 4UCSA 5KHGA 4TUYA 5D1OA 1N33B 3N2GB 1ZAUA 3E22A 4KHPB 4JI3H 2ZNIA 4O4HB 3SJCC 1QQCA 2VQEB 3JASA 5CA1B 2HVSA 4GKJH 4DV6B 4I7HA 2UUBB 1P16A 1JFFA 4FLYA 5IWAB 2HIXA 3N2KA 1SYXB 3N40P 3W1GA 2GV9A 3JAWB 4JI6B 4DUYB 4DV2H 1SA0B 1XMOH 4FLWA 4NVPA 1TVKA 3VQXA 4X1IB 3UT5B 3J81W 4A2BA 2YCHA 4CC6A 1SQFA 2UU9B 1Z2NX 4A2AA 5K1XA 1MZBA 2PY5A 3UQ8A 5KMGB 2E5LH 2XHBA 1BGWA 1KMIZ 1SQGA 2F93B 4B3SB 5CB4A 4X62B 4JI7H 1GYFA 3KAKA 2Q7GA 4DUZH 5LMNB 5EOYA 2EX3A 3CSXA 1V9PA 4LF7B 1HNWH 4TV9A 4AQYB 4RB1A 4LMYA 2ZNJA 4YJ2A 1JMKC 4DRXA 4YY3B 1X9NA 4F6RB 4DR4H 4O4JA 3EYYA 2UUCH 3IAYA 4WBNA 4D7TA 4B08A 1Q3EA 1Z5VA 2ZCEA 3K58A 1IBKH 4O4IA 5LMUB 3RR5A 2QM4A 1YEWA 4JI8H 2R9AA 5FLXW 2E3CA 4DR6B 1HNZH 4LFBB 5C8YB 1X4TA 1XMQH 1TUBB 3N2GA 3ZS8C 5KX5B 4LF4B 1Q43A 1O75A 1O9HA 4ZHQA 5D5PA 3BA9A 5CA1A 3GJXB 4FFBA 5IYZB 5K1PA 2UXCH 4O2BA 4ZOLB 4DRFA 3KAJA 5EZYB 1I94H 2UXBB 4E6NA 5FPRA 3UT5A 4RAZA 2IM9A 3RWRD 4LH7A 4Q0YA 4X1YA 3HKDB 5DISC 3FMAA 5EYPA 1CKNB 4DV4H 5KMGA 2BTQB 5JH7B 3GB8B 1I6UA 3QTCA 1Q5OA 4LFCH 4FVMA 3KXYT 3A2FA 3HKEA 4LF5H 4YHHB 2OWOA 2HVQA 4I55B 3OTOH 1T5EA 3QWUA 1M5IA 4JI2B 4I4TB 4JV5B 3C0FB 3JAKA 4EB6B 4KHPH 4DR1B 3U0ZA 4PZ8A 4DV3H 3M4IA 4O4LB 5J2UA 5LP6A 4F6RA 1TAEA 4IIJB 4X1KA 4AILC 5IT9W 4L8JA 3JARB 5D5QA 2RQ6A 4Q6GA 3TY9A 2UUBH 4DV1H 1AN7A 5IWAH 1WH2A 2R70A 4DR3H 4DUYH 4TQFA 4LNUA 1TUBA 4BWSC 1FVIA 1B04A 5IJ0B 3U10A 2UU9H 4X20B 4B3TB 2JVDA 1S5JA 3LNNA 5GONB 3RGXA 3KALA 1IBLH 5IYZA 1CKMA 4X62H 4PDBA 3ETQA 2VWKA 4B3MH 4ZOLA 4X64B 4ZIBA 4LF7H 4AQYH 3VQWA 5KHKA 3U11A 4YJ3B 2VUGA 2YIAA 4LF9B 1XNQB 3HKDA 3WB0A 4LF6B 4RB0A 4O2AA 5LL6b 4HNAA 2BTQA 3RYIB 4TV8B 4U3JB 1SKVA 3BAAA 5LYJA 3WB1A 3T1HH 5KHJA 5IJ9B 3RYFA 4IHJB 4DR2B 4DV7H 2HHHH 3T1YB 3THOA 4JI1B 1SEIA 4LF4H 5FD5A 3RYCB 4I9QA 1P49A 1TGOA 2Q2UA 1FFXA 4LFAB 4O4LA 3SJBC 4TQDA 3JSNA 1HR0B 2YI8A 4ZI7B 4PI2A 4LR3A 1N34B 5BR8B 1VS0A 4JI0H 5LP6C 5FD6A 4X65B 2VQFB 2KSWA 4K8ZA 3J7AK 4K0KH 5LXTB 3ICXA 5FNVB 1I7FA 3DF7A 2P5OA 3JATA 4UCUA 5IJ0A 5BMVB 1P8LA 4CS2A 1L8DA 1N36H 4MTEA 3CHXA 3SGIA 5CA0B 4FLXA 5EIBC 2MCTA 1VF7A 4JI3B 3LMLA 4YHHH 1S68A 4UCOA 5KHIA 4APMA 3B2EE 2PYJA 4GLXA 3K5LA 4GKJB 4O4HA 4UCTA 3F8NA 4JI2H 2Q0AA 1RSOA 4BWAA 3BRCA 4DR1H 1XMOB 3DSQA 2VWJA 4NXNB 4ETSA 2HIVA 1NT2B 3JAWA 3K59A 3HKCB 1SA0A 2RGRA 2UXDB 3W1BA 1S03G 4X1IA 3VNNA 2CAZC 3MAQA 2E5LB 5IJ9A 2UUAH 3QF7A 3BA8A 4IHJA 1XK5A 3L4JA 3GDEA 4EQ5A 4JI7B 2O03A 5KHHA 4DUZB 4HBNA 4TUYB 1XNRB 4B3RH 1H2SB 3N43B 3E22B 2CFMA 4UFZA 4PI0A 4ZI7A 2WE6A 1N33H 3SR2C 3JASB 4X66B 2PTMA 4DR4B 2Q7EA 2UUCB 4FM1A 4R7RA 4CS3A 2F66C 2VQEH 5D1PA 1JFFB 2ZIOA 5FNVA 3KYHC 4DV6H 3N2KB 1WPBA 3BPZA 4EEQA 1XNQH 5BMVA 1HNZB 1ZHQA 4CH5A 3L4KA 1XMQB 2XIGA 4DR7B 4JI6H 4D7SA 5EIBD 2F95B 3NBYB 2YIBD 5C8YA 1JJOA 4DR5B 4K8XA 5J2TB 2JS5A 5KX5A 4DR2H 4BW9A 2YIBA 4UCVA 3RGBA 5CB4B 2ZINA 1XI1A 1IBMB 3K5OA 4CH4A 3TY8A 4KL1A 1I94B 4B3SH 4I50B 5JJEB 4GKKB 3TY5A 3RJ0A 4MV7A 4LFAH 5A2QW 2JGUA 4DV5B 4JYAB 1ZHSA 5LMNH 1HR0H 5EZYA 1D5AA 3PN1A 3VQYA 2PUSA 4DRXB 4DV0B 1N34H 5BR8H 4O4JB 4FLUA 2YI9A 3HKBB 5LA6B 4DV4B 2ZM6B 4WBNB 4NXMB 1M0TA 2VQFH 4YY3H 3W5OA 4O4IB 4LFCB 1CKNA 4LF5B 5JJNB 3OTFA 5JH7A 1J5EB 5JVDB 2ZJTA 5LMUH 4M7EA 4EFBA 2KKWA 3OTOB 1HNXB 4JI5B 3CVZA 2WDTA 4RB3C 4DR6H 4LFBH 4I55A 2W57A 3K5MA 4I4TA 4ZHQB 3JALB 1XHXA 4DV3B 4EB6A 1L2ZA 4CC5A 3M7MX 4DK1A 4JI4B 4LSAA 4FFBB 4OX9B 4DV1B 4O2BB 2FE3A 4IIJA 1M4UA 2YXLA 2V4DA 3JARA 4DR3B 3WB2A 4NXNH 4LF8B 1FJGB 2HGSA 2CW7A 1M93A 3K57A 1O9GA 2UXBH 2UXDH 4X1YB 3VQVA 5ITZB 5EYPB 1N32B 3L2PA 5J2TA 2PYLA 2OYQA 2F4VB 3RYHB 3N6XA 1TA8A 1G6UA 4X20A 4EFEA 4DK0A 5JQGB 3HKEB 5LOVB 1IBLB 2HVRA 3MWMA 4B3MB 3CB2A 5GONA 1XNRH 2PGGA 4I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB B;  1P16 A;  4DUZ B;  3NC0 B;  5IWA B;  2HIX A;  3W1G A;  1XNR B;  1FVI A;  1B04 A;  4JI6 B;  4DUY B;  2CFM A;  4UFZ A;  4B3T B;  4CC6 A;  3RTX A;  4DV2 B;  2UU9 B;  3BAB A;  4X66 B;  1CKO A;  4DR4 B;  2UUC B;  3T1H B;  3UQ8 A;  1CKM A;  3S24 A;  5D1P A;  2HHH B;  4DV7 B;  4X64 B;  3KYH C;  4B3S B;  4EEQ A;  4X62 B;  4PZ7 A;  5LMN B;  1HNZ B;  2VUG A;  1XMQ B;  1V9P A;  4DR7 B;  4LF7 B;  4LF9 B;  1XNQ B;  4AQY B;  3NBY B;  4LF6 B;  4DR5 B;  5D1O B;  1HNW B;  4YY3 B;  4UCV A;  1X9N A;  4JI0 B;  3BAA A;  3JSL A;  1DGS A;  4DR2 B;  1IBM B;  4K0K B;  3T1Y B;  3TY8 A;  5LMU B;  1I94 B;  3RR5 A;  4JI1 B;  4GKK B;  3TY5 A;  1IBK B;  4DV5 B;  4JYA B;  4DR6 B;  4LFB B;  2Q2U A;  1N36 B;  3PN1 A;  4JI8 B;  4LF4 B;  4DV0 B;  4LFA B;  3JSN A;  1HR0 B;  4LH6 A;  4NXM B;  4DV4 B;  2ZM6 B;  5FPO A;  1N34 B;  3W5O A;  5BR8 B;  1VS0 A;  3BA9 A;  4UCR A;  4LFC B;  1CKN A;  3GJX B;  4LF5 B;  4X65 B;  2VQF B;  1J5E B;  4PZ6 A;  4EFB A;  4DRF A;  3OTO B;  4TOI A;  4UCU A;  4JI5 B;  1HNX B;  2UXB B;  2UXC B;  4E6N A;  1P8L A;  5FPR A;  4LH7 A;  3SGI A;  4DV3 B;  5DIS C;  4CC5 A;  4JI3 B;  1CKN B;  4JI4 B;  1S68 A;  4UCO A;  4OX9 B;  2UUA B;  3GB8 B;  4GLX A;  4DV1 B;  1XDN A;  4GKJ B;  4UCT A;  4YHH B;  4DR3 B;  2OWO A;  1A0I A;  4LF8 B;  2HVQ A;  1FJG B;  2Q2T A;  3QWU A;  4B3R B;  4JI2 B;  3NBZ B;  1XMO B;  4JV5 B;  4NXN B;  2HIV A;  4UCS A;  1N32 B;  3L2P A;  5D1O A;  4DR1 B;  1N33 B;  2F4V B;  4PZ8 A;  2UXD B;  3W1B A;  1TA8 A;  1ZAU A;  1TAE A;  4KHP B;  4EFE A;  3VNN A;  2VQE B;  1IBL B;  2E5L B;  2HVR A;  3TY9 A;  3BA8 A;  4B3M B;  1XK5 A;  2HVS A;  4DV6 B;  3GDE A;  4EQ5 A;  4JI7 B; 
#chains in the Genus database with same CATH topology
 1E4F T;  2I80 A;  4GLW A;  3JAK B;  4O3Q A;  3FB5 C;  2QDO A;  4DR4 O;  5DM6 V;  3HB3 B;  1EZ1 A;  4IT5 A;  2UXN A;  4YJ3 F;  4FM0 A;  1K97 A;  3E89 A;  1IBK O;  1ORQ C;  3HKB A;  3AG7 A;  4E2L A;  4DV2 B;  1RPO A;  3T1H B;  1HNZ O;  1AUX A;  5JVD F;  1TWC A;  1W59 A;  5L1L A;  1XMQ O;  5E1A C;  4IAJ A;  2UVW A;  4DV7 B;  3TET A;  2RDI A;  4NTW A;  4Q8E A;  3VPB A;  2CUG A;  4PZ7 A;  4MAM A;  1RK6 A;  4MV9 A;  2YXH A;  2BTO A;  2R7K A;  4FLZ A;  1B6S A;  2EIM C;  2H94 A;  3JCZ A;  2ITC C;  3RV4 A;  1EKP A;  1IBM H;  2VS0 A;  3HO8 A;  3RN4 A;  3MR2 A;  1DGS A;  4QNH B;  1JX4 A;  3CJH B;  3FYE B;  4I9W A;  3IG0 A;  3ZED A;  2P4K A;  3ABU A;  2HGX A;  2CTP A;  2OCC C;  1F4N A;  4O2A B;  4FM2 A;  4RNM A;  3RYH A;  4LF9 H;  2ADQ B;  3SPC A;  4GYC B;  5JQG A;  3UO2 A;  5JJJ B;  4IR9 A;  3E86 A;  4QWA A;  1BCC H;  1J5E H;  1GTO A;  1YCI A;  5KFE A;  3T4D A;  1HNX H;  4IZO A;  1SES A;  3E8B A;  5KFK A;  2VQE O;  3T1Y H;  4X9Q A;  2WA4 A;  1YXB A;  2B1G A;  4J0M A;  3JD2 A;  1AI5 A;  1JCH A;  4DV1 O;  2ATL A;  1GGO A;  4Q4D A;  1BHA A;  4BY7 G;  4FLT A;  1BNC A;  5EK0 A;  5I5U A;  4YJ2 B;  1Z5W A;  4JTC B;  2W9B B;  3M9O B;  1I3Q A;  5EDW A;  1K92 A;  4L1K A;  3NUA A;  4NYK A;  5KFJ A;  1QCE A;  2FKL A;  4ME6 A;  3H1K H;  2QGN A;  1Q7Y W;  1CQJ B;  4X62 O;  2DYS B;  4B3M O;  5KHG A;  3L9D A;  3N2G B;  1PV0 A;  2ITD C;  3FKS G;  2ARH A;  3RB3 A;  3N8D A;  4AQY O;  4KHP B;  2EUL A;  5BYB A;  2GTS A;  5I47 A;  5F9N A;  3JAS A;  3HKZ A;  2ZDI A;  2HVS A;  1I1K A;  4DYL A;  4DV6 B;  4NZM A;  1JFF A;  2V5A A;  3E8H A;  4O2A F;  2HHF A;  1OCR C;  2A1H A;  2EJ0 A;  2X5R A;  2GV9 A;  3JAW B;  4JI6 B;  3ETD A;  1SA0 B;  1GN6 A;  1VF6 A;  2JEF A;  2N74 A;  4A2B A;  2G38 A;  2ZT9 B;  5KFX A;  3LDD A;  1HDJ A;  3CC7 V;  2DAB A;  5KMG B;  4QWD A;  1ZSP A;  4YR2 A;  3OAA G;  2WLL A;  1K33 A;  1SQG A;  4Z2W A;  3ZRW A;  5L3E A;  4B3S B;  5CB4 A;  4MA0 A;  1BSM A;  1MSD A;  1IYE A;  3KAK A;  3ABL B;  4EBC A;  2Q7G A;  4PDR A;  2OIG A;  1W2B U;  1H2K A;  2FPI B;  3ZIA G;  4TV9 A;  1NI8 A;  3HKZ E;  4YJ2 F;  3WWH A;  2YEV A;  5A2Q N;  3EPI A;  3DTU B;  2JEG A;  1KEC A;  3AK3 A;  5KFS A;  4F6R B;  5KFW A;  2YS8 A;  3AG3 B;  3EYY A;  2BE3 A;  1N36 O;  4DL5 A;  3BFR A;  5LMU B;  1FAF A;  2R9A A;  2R92 G;  1K4C C;  1N0J A;  4YHH O;  3LWB A;  2W7O A;  1Z2G A;  2J6T A;  1ZTE A;  3GTP A;  4I7Z B;  1Q43 A;  4TSF G;  4ZHQ F;  1E4E A;  3H1L H;  3TK1 A;  1O9H A;  1XRE A;  3H4B A;  5KFA A;  4BW5 A;  4OPH A;  3GTL A;  1AI7 A;  4RQE A;  4MSW C;  5CA1 A;  4KP4 A;  3FDS A;  5FL7 G;  5L1K A;  3BQ2 A;  2UXC H;  4JUZ A;  3CRQ A;  3KAJ A;  2ZDI C;  3K06 A;  1US6 A;  5KFP A;  2W9C B;  5FPR A;  3UT5 A;  1VQL V;  1OWT A;  3CCQ V;  3Q8R B;  4TQS A;  1R73 A;  2F43 G;  3L74 H;  2ILM A;  1S10 A;  1T36 A;  4PV1 B;  4JYB A;  2CH7 A;  1VAJ A;  1Q5O A;  4FVM A;  1K3E A;  3KXY T;  2C2D A;  3HKE A;  4LF5 H;  1YHQ V;  3W7X A;  1A0G A;  2IW5 A;  5B1A B;  3OTO H;  3AYH B;  1Y67 A;  4JI2 B;  4PJ0 Z;  1GRJ A;  2EIL C;  4JV5 B;  4ED6 A;  3JAK A;  3ETH A;  2C2E A;  4JV1 A;  4DV3 H;  2NUA B;  2UVR A;  4LF9 O;  1K4D C;  4AIL C;  2UUB H;  3D8C A;  4LCU C;  4DUY H;  5KFD A;  3RVY A;  2Y48 A;  2IH3 C;  4DR2 O;  4A3L G;  1TUB A;  3H40 A;  2R7N A;  2WLM A;  3U10 A;  1NKD A;  2IU3 A;  1MG1 A;  3Q8P B;  5HNE A;  2PBZ A;  1S5J A;  3PR5 B;  3N27 A;  2HFE C;  5LMN O;  3KAL A;  4JV2 A;  1CKM A;  4PDB A;  4FS1 A;  3PW2 A;  4QE7 A;  3T99 A;  1QU7 A;  4JYY A;  1SQX H;  1CEZ A;  3TQT A;  3LNM B;  3CJH A;  2HGW A;  3U11 A;  2VUG A;  3ZN1 A;  4BBS G;  2KB1 A;  1XNQ B;  2DPI A;  3WB0 A;  4TQR A;  2FYU H;  1M56 C;  4LF6 B;  4RB0 A;  5L1I A;  5LGU A;  4O2A A;  3DTG A;  1Q6H A;  4MVR A;  1H8H G;  4TV8 B;  4RZR A;  3PZP A;  3D3I A;  5EWG A;  2BQ3 A;  3T1H H;  5KHJ A;  2HVK C;  3TXS A;  4WF9 V;  1ROP A;  1V51 A;  4DV7 H;  3R5F A;  2YL2 A;  1BE3 H;  1K73 W;  1MMM A;  4LF4 H;  3RYC B;  3GII A;  3K3W A;  1RJP A;  2XAS A;  4O4L A;  3JSN A;  2FKX A;  1NTK H;  4ZI7 B;  3GIL A;  2W6N A;  1A32 A;  2PI4 A;  5DQI A;  3CD6 V;  3IFX A;  1SS3 A;  2N04 A;  1KTA A;  3VOT A;  1S0N A;  4X65 B;  2KSW A;  1KJJ A;  4K8Z A;  2W9B A;  4EYI B;  2C2R A;  1SC5 B;  3T5J A;  3KHH A;  3DF7 A;  5KFY A;  1YJW V;  2BQU A;  3GIJ A;  5BMV B;  1BS3 A;  2JIZ G;  3TCU A;  3TW7 A;  2FB5 A;  3CHX A;  4FLX A;  5B3S C;  4PA3 A;  3CCS V;  2MCT A;  4JI3 B;  1PNL A;  4UCO A;  4APM A;  1S77 D;  1XIL A;  3ZN0 A;  3HOZ G;  4J9S A;  5C1P A;  4GKJ B;  1QVG U;  5I5T A;  3T2M A;  5BYA A;  1MZE A;  4BWA A;  1GLV A;  2LFS A;  5KUM A;  4K6N A;  4O82 A;  1EN6 A;  4Z1V A;  1XMO B;  4FJC C;  1BT8 A;  2HIV A;  3LQS A;  2RDC A;  3DC6 A;  3G6B A;  4TV8 F;  1KC8 W;  1E79 G;  2W70 A;  3JAW A;  3H9V A;  1SA0 A;  1OCC B;  4EKW A;  2RGR A;  3F7Y C;  4RCN A;  1SER A;  3MR3 A;  1GN4 A;  1XL4 A;  3L71 H;  3L4J A;  4EQ5 A;  1SQB H;  3CMA V;  2AZ2 A;  3RT3 C;  2O03 A;  2V59 A;  4O7T A;  3AK2 A;  3APO A;  4HBN A;  3CCU V;  5JWP A;  5HFM A;  4TUY B;  2GTA A;  2HJW A;  2GBO A;  2W0F C;  4ZI7 F;  3N43 B;  2EIM B;  4HQ6 A;  5CMU A;  4JYA O;  1Y1W A;  3SJQ C;  4BBR G;  3SR2 C;  5EWF A;  1GAX A;  3CCV V;  3RBD A;  2YRX A;  4ED3 A;  1Y66 A;  2UUC B;  1AP5 A;  1FKA O;  3ZCC A;  5D1P A;  4FS2 A;  1B6R A;  1EKF A;  2PF4 E;  4B7K A;  2ZIO A;  4DV6 H;  5BMV F;  3R5X A;  1VAR A;  2A7W A;  3GB7 C;  3VBB A;  2R8H A;  4LF5 O;  1AI4 A;  1YSC A;  1MNG A;  2GDS A;  5BWT A;  1ZHQ A;  1SQQ H;  3ZMU A;  2LJ2 A;  2WPD G;  4F6E A;  3G6Y A;  4FFM A;  4JI6 H;  2YZN A;  2F95 B;  5C5J A;  5FLX N;  1OZ0 A;  5KAF Z;  3ZJZ A;  4ECY A;  3E8G A;  4DV3 O;  4PD4 F;  4K3A A;  2DYS C;  3RGB A;  4LWS A;  2ZIN A;  1OJH A;  1PK8 A;  1IBM B;  3JZI A;  3K5O A;  3MJF A;  4B3S H;  5JJE B;  2V4Q A;  1BGY H;  1EZJ A;  4A3K G;  1FJG O;  1Y1V G;  4JTA B;  3HOW G;  4G3I A;  1N34 H;  4PDM A;  5BR8 H;  3CXH F;  2CDY A;  3G80 A;  2W9C A;  3F5W C;  4O4J B;  4ABM A;  4FLU A;  2YI9 A;  3HKB B;  1N32 O;  4DV4 B;  1KJ9 A;  2F4V O;  4O83 A;  4J9Q A;  1PKX A;  4O4I B;  2RDJ A;  4GUN A;  3ZHT A;  5JJN B;  3OTF A;  1J5E B;  4ECV A;  4TUY F;  4J9L A;  4MW3 A;  4ECS A;  5LMU H;  1NZ6 A;  2KKW A;  2Z04 A;  1HNX B;  1BZK A;  2R93 A;  3JCU Z;  3GID A;  2W8L A;  2JEI A;  2JEX A;  2WWW A;  2SCU B;  2W57 A;  3QQM A;  2COJ A;  3KRE A;  3IGA C;  4J9R A;  2JRI A;  3OGC C;  2YU9 A;  3ABL C;  4YIO A;  1D2D A;  3M7M X;  4DK1 A;  4IWY A;  4LSA A;  3ZBH A;  4IIJ F;  4DV2 O;  4IR1 A;  4O7R A;  2FE3 A;  2EIK B;  1KEE A;  3UZO A;  1YF2 A;  1WB7 A;  2EJ7 A;  4AI8 A;  4OGQ B;  2HGS A;  1OCR B;  3IJ4 A;  4H13 B;  4DL6 A;  3AG3 C;  1M93 A;  1O9G A;  4NTY A;  3KHL A;  3U9S A;  2E5L O;  3VQV A;  3KTM A;  1R9T A;  3L2P A;  2OYQ A;  2IP4 A;  3RYH B;  2AHY A;  1TA8 A;  4EFE A;  3STZ C;  3ZHU A;  5JQG B;  1IBL B;  2HVR A;  2QM8 A;  2W6I G;  3GTO A;  5B1N A;  3CB2 A;  4BIZ A;  1V4Y A;  3PW5 A;  1K9M W;  1JDE A;  1XNR H;  1F4M A;  1SCU B;  4Q8F A;  2Q4P A;  2MK3 A;  3K3V A;  4J10 A;  4JV5 H;  2LO1 A;  3RBE A;  4CS4 A;  4MV8 A;  5LA6 A;  4O4I F;  3U55 A;  1VIB A;  1SET A;  1AB3 A;  3RFR A;  4K35 A;  3MWE A;  5CBH A;  1C3O A;  4TV8 A;  1URF A;  3OE7 G;  4J9Z B;  1KU9 A;  1OHH G;  1A48 A;  4PA7 A;  2A06 H;  5KFT A;  3JAL A;  4F4L A;  1KQS U;  5CA3 A;  3RYC A;  2VOB A;  1E1Q G;  4CH3 A;  5I60 A;  5B1A C;  4IYH A;  1I94 O;  3ORQ A;  2OLS A;  3WG7 C;  1IOW A;  4JI0 B;  1RJQ A;  1H38 A;  4GKK H;  1GN3 A;  4JGS A;  2JGD A;  4K0K B;  1G2W A;  4DV5 H;  4MTF A;  3ABK B;  3OGI B;  5L3D A;  4U7N A;  3G67 A;  4A3I G;  1IX9 A;  3CCL V;  4QJF B;  2HHF B;  4CBC A;  4LFC O;  4TVI A;  1AI6 A;  3M9N B;  2QJ1 A;  2LW7 A;  4ICG A;  3TGU H;  5JQG F;  4LF6 H;  3N42 B;  2F23 A;  1VQ6 V;  1FFT B;  2Z0A A;  3MHS C;  3K5N A;  4UCR A;  4KHP O;  4JI5 H;  2OTL V;  2E75 B;  4PZ6 A;  1I08 A;  4YIP A;  3ZRW B;  4ZBM A;  4TOI A;  4RUF A;  2UXC B;  2M05 A;  2DWC A;  3T9B A;  2ALZ A;  4JI4 H;  4MTO A;  2LGW A;  4DR3 O;  4TV9 B;  3N6R A;  1M0W A;  2Q67 A;  3OEE G;  4HAM A;  3CRR A;  2UUA B;  4YB8 B;  5KFM A;  1N0N A;  1WNS A;  3SJA C;  3IN5 A;  4X65 H;  4RZQ A;  4TM5 A;  2B1I A;  1VBG A;  1A3G A;  1DIK A;  2J6U A;  4B3R B;  3H20 A;  4B3S O;  1GSO A;  1NTZ H;  4UCS A;  4AYB E;  4TUY A;  1N33 B;  2O57 A;  2QE7 G;  1JX9 A;  3TXQ A;  4JI3 H;  3H0G A;  3V4S A;  2ZNI A;  3X2Q C;  2YZM A;  3ZRX A;  1RSO B;  4P9P A;  2XCL A;  5CA1 B;  4GKJ H;  2W6M A;  2CGO A;  2JDI G;  3C3S A;  1JLL B;  1UC8 A;  2UUB B;  2W8K A;  4CZZ A;  2P0A A;  2YYA A;  2HIX A;  3TW6 A;  1OCO C;  5EC2 C;  3LDE A;  4IRD A;  4DUY B;  1XMO H;  1M56 B;  3ZX6 A;  4NVP A;  3VQX A;  1JR9 A;  1KJQ A;  5JUM A;  1VEW A;  3TQ1 A;  3UT5 B;  2HHH O;  3HB9 A;  2WLJ A;  2ZR2 A;  1LUW A;  3A0R A;  3FKI A;  5L9X A;  1MZB A;  3QFF A;  2GQS A;  2KSD A;  1M57 B;  1Y6X A;  2FLL A;  5CB4 F;  2D2C B;  1GYF A;  2DQ3 A;  2MW2 B;  2OIE A;  2IU0 A;  2EIN C;  3OUF A;  4YXW G;  5EOY A;  4EEY A;  4ASU G;  4TV9 F;  1V9P A;  1V54 C;  3AG1 B;  1GO3 E;  4ED2 A;  3B8N A;  1K1Q A;  4RB1 A;  2JEJ A;  4LMY A;  2NR5 A;  2ZNJ A;  3ETE A;  2DPJ A;  1JMK C;  4ED1 A;  1X9N A;  4O4J A;  3B8M A;  2UUC H;  4WFH A;  2COG A;  3R5H A;  3S3X A;  4D7T A;  4B08 A;  2NU8 B;  1Q3E A;  1Z5V A;  4UB8 Z;  1OCC C;  2Q6A A;  4O4I A;  3K5I A;  4JAV A;  5DN6 G;  3RR5 A;  5B5E Z;  1VQ9 V;  4JI8 H;  3OSN A;  2DW4 A;  1YJN V;  5BWV A;  4QGP A;  1X4T A;  1K8A W;  1TUB B;  3ZS8 C;  4FK5 C;  5B3S B;  4LF4 B;  2M6Y A;  4JI2 O;  4A3G G;  4NLG A;  4DQN A;  1ARO P;  1O75 A;  1NR1 A;  5CA1 F;  2R6F A;  4E4E A;  3BA9 A;  3GJX B;  5IYB G;  5KAI Z;  1F23 A;  3KZI Z;  2Q0O C;  4DRF A;  1YJ9 V;  3FB7 C;  1U97 A;  2UXB B;  1EKV A;  2K1E A;  3ZMZ A;  2YS7 A;  4FFL A;  4QWB A;  3F5T A;  3RWR D;  4LH7 A;  4Q0Y A;  4GC7 A;  4XX0 B;  5DIS C;  4JF3 A;  2Y0P A;  2QKC A;  4DV4 H;  5JH7 B;  2FMA A;  3QTC A;  1VKZ A;  1UPG A;  3A2F A;  2R93 G;  1SRY A;  1VQM V;  1JDB B;  1Q6U A;  1S5L Z;  2VRZ A;  1A9X A;  4I55 B;  3A0H Z;  3NGD A;  2JA5 A;  4XZ3 B;  4I4T B;  2R8G A;  3T5H A;  5I5W A;  2DWD C;  2D3O W;  2L35 A;  4WFB V;  3TEK A;  3SDL A;  3M4I A;  4O4L B;  4O7W A;  1XNQ O;  2FB9 A;  4LF6 O;  4QPK A;  5IT9 W;  2QF7 A;  3JAR B;  1AUV A;  5KS8 A;  5D5Q A;  2FLP A;  1CPY A;  5IWA H;  3ZHV A;  1WJZ A;  4R6Z A;  4N21 A;  3GIK A;  4ED8 A;  1E1R G;  2CTW A;  2PI5 A;  2UU9 H;  3RB6 A;  3CCJ V;  1MOF A;  1Q90 D;  4LC1 A;  5GTI Z;  1S72 V;  4B3T B;  4CHI A;  5KFZ A;  1EYZ A;  3LNN A;  5GON B;  2CQY A;  1I7N A;  1IBL H;  5IYZ A;  1K5Q A;  2VWK A;  3A0B Z;  4ZIB A;  3J80 N;  2A3Q A;  3JYC A;  4WFF A;  4LF7 H;  3M9M B;  4X65 O;  1L0L H;  2ASJ A;  4M9U A;  3D36 C;  1GSA A;  4YY3 O;  4NTX A;  1IXM A;  2EIK C;  3OMA B;  4R7C A;  1NH2 D;  5KFI A;  1PNK A;  4QJF A;  1S3J A;  2Q9L A;  2CZG A;  2BTQ A;  4U3J B;  1UJW B;  4MVM A;  3OW2 U;  4DR6 O;  5KT4 A;  4LFB O;  2UVU A;  2X6B A;  4MT8 A;  3RBZ A;  3SYC A;  4I55 F;  3JAM N;  4TT3 G;  4R50 A;  4I4T F;  4U6P A;  4J9O A;  4JI1 B;  2RF4 A;  1OCZ C;  4PA9 A;  1TUE B;  4I9Q A;  1P49 A;  4NKG B;  3L75 H;  2ZKO A;  4O4L F;  3OR6 C;  3TII A;  3QZ7 A;  2FP4 B;  4EBD A;  2QSA A;  2R9I A;  2YI8 A;  1YTF D;  4YAJ B;  3VMM A;  2W9A A;  1SQV H;  1PL4 A;  2R9R B;  4LR3 A;  1N34 B;  2YZL A;  5BR8 B;  4FZ1 A;  4XYL B;  4QWE A;  4JI0 H;  1KUQ A;  1QLE C;  1GK9 A;  3J7A K;  3QO5 A;  4K0K H;  4MVS A;  5LXT B;  1ZUQ A;  1MSW D;  2E2I A;  1R3I C;  2WSS G;  4FZ0 A;  2R87 A;  1RYS A;  3ZMT A;  1JXL A;  1MA1 A;  4HN2 A;  4MTE A;  5CA0 B;  5KT6 A;  2NVX A;  5HV6 A;  4OXS A;  2VUM G;  1Y74 A;  2AU0 A;  1ZWI C;  3B2E E;  3OUZ A;  2W6J G;  2PYJ A;  1IUR A;  2R7L A;  4HNU A;  5H6Q A;  4ZQI A;  4UCT A;  2LFR A;  4LWS B;  4FMT A;  1RSO A;  1JVM A;  4D6T H;  4CMF A;  4FBU A;  2P4V A;  5IDJ A;  1P7B A;  4UV9 A;  4DR1 H;  4ED0 A;  3G8C A;  3ZMV A;  1NJI W;  3FAV B;  4JZ2 A;  3PW0 A;  3ABK C;  3K0D A;  3RB0 A;  3RV3 A;  3K59 A;  3HKC B;  5BWX A;  4H0L B;  2L6L A;  2R8J A;  1H8E G;  1BMF G;  2CAZ C;  4L87 A;  3VNN A;  2QWR B;  3J81 N;  2UUA H;  4IHJ A;  3BA8 A;  1WCM A;  5I5X A;  5EC1 C;  3E35 A;  2CK3 G;  1JPX A;  5KHH A;  4DUZ B;  2R84 A;  1IBM O;  3MR6 A;  1XNR B;  3ASO C;  4B3R H;  3H0G G;  2CFM A;  4PI0 A;  2ZE8 A;  5KFQ A;  1N33 H;  2K9P A;  5KG3 A;  3G6X A;  2A79 B;  3CRA A;  3WG7 B;  3I56 V;  4DR4 B;  1ZET A;  2QWP B;  4DXW A;  1I1M A;  3B4S A;  4TWK A;  4DV4 O;  2EJR A;  1WAZ A;  5FNV A;  2OTJ V;  3N2K B;  3BPZ A;  3M8A A;  3HOV G;  1J5E O;  3GWO A;  1HNZ B;  4U7O A;  5CA0 F;  3L4K A;  3K0G A;  1B06 A;  1XMQ B;  3FKI G;  1HNX O;  4J80 A;  4J42 A;  1GKF A;  1JJO A;  3T1Y O;  2JS5 A;  2HG8 A;  4WHX A;  4P2Z A;  1Q6I A;  1HWY A;  4N23 A;  2GPS A;  1XBL A;  3AEI A;  1S0O A;  2QKS A;  5DED A;  4DW1 A;  3ABT A;  4GKK B;  3TY5 A;  4LFA H;  4MV7 A;  4NB5 A;  5A2Q W;  2JGU A;  3WFV A;  3ZRV A;  4DV5 B;  4UUG A;  5KFL A;  1HR0 H;  3Q1K A;  5KG0 A;  3H3V H;  3RFC A;  1LNQ A;  2AZ0 A;  3DXR B;  3PW7 A;  5I5Y A;  5LA6 B;  1M0T A;  1DV2 A;  1NVP B;  4WD3 A;  2VQF H;  3W5O A;  5DMX A;  5E79 Z;  4CKC A;  3UM7 A;  5JH7 A;  2C35 B;  2ZJT A;  4BIU A;  4JI5 B;  2IJI A;  3ASN B;  4GCZ A;  1M57 C;  4I55 A;  4PA4 A;  2HKO A;  2WLN A;  3WNZ A;  5DGA A;  4I4T A;  4CE5 A;  3JAL B;  1T3N A;  3OD4 A;  4R8C A;  3CQZ A;  3X2Q B;  3GQC A;  1JJ2 U;  5GW7 A;  3GLK A;  4F4W A;  4JI4 B;  5DG7 A;  4FFP A;  1VQN V;  1K5S A;  3AG1 C;  5KFR A;  4DV1 B;  2DMX A;  3B40 A;  2COI A;  2AQ4 A;  3GIQ A;  1EN4 A;  5KFF A;  2V4D A;  3JAR A;  5HFL A;  3WB2 A;  3MR5 A;  4NXN H;  2JGD B;  4W4K A;  4WFE A;  1OCO B;  2WLH A;  2CW7 A;  1UFI A;  2H8P C;  2UXB H;  2UXD H;  2P67 A;  1S0M A;  5DQH A;  5EYP B;  5J2T A;  2PYL A;  1WA8 B;  2Q69 A;  3GVM A;  3WWI A;  2WAQ E;  4A3J G;  2V9W A;  2J9G A;  2V7Q G;  4B3M B;  5GON A;  2CNU A;  1FXK C;  2JA5 G;  1HP8 A;  4RAY A;  4UXN A;  1H2L A;  2EIN B;  4O3O A;  3GV8 B;  3RAX A;  3VOU A;  4O7L A;  1V54 B;  1R6K A;  3ABM C;  2ZIM A;  3MD0 A;  3CC2 V;  2C2A A;  5LA6 F;  3OHA A;  5J2U B;  3BHP A;  5F2V O;  5LP6 B;  1Z2O X;  3FFQ A;  2XND G;  4X66 H;  4X1K B;  3LUT B;  2XAG A;  3RTX A;  3BAB A;  1ENV A;  1CKO A;  3CYO A;  3GTK A;  4DAA A;  3CME V;  2P7T C;  2P22 C;  4U3J A;  2UVV A;  2BQR A;  2IBZ H;  3WU2 Z;  1IDS A;  3K3P A;  4DR7 H;  1R6N A;  5H2F Z;  2PN1 A;  5K3W A;  5IYC O;  3BAC A;  4DR5 H;  3CRM A;  1QHT A;  5CR5 A;  5BPF A;  2JA8 G;  4A3D G;  1Q81 W;  2UXC O;  2NLJ C;  3HBL A;  4Q4C A;  4B3T H;  1Q8I A;  5EBL C;  3BCC H;  3H01 A;  1M7J A;  2WB1 A;  3JRX A;  4LSX A;  4CH6 A;  4AHC A;  3N44 B;  1Q82 W;  4U3F H;  1LUV A;  4FGR A;  2XAF A;  4RB2 C;  4DV0 H;  2LP7 A;  2R7Z A;  2HJF C;  5LXT A;  3TIN A;  3WO0 A;  3K03 A;  3VA7 A;  1GM9 A;  2CW8 A;  4NXM H;  1N36 B;  1OBG A;  4MV6 A;  4HNA B;  3P3N A;  4MTD A;  1COW G;  4JI8 B;  3Q8Q B;  2ZM6 H;  4B3R O;  4IRK A;  1WN7 A;  5LYJ B;  2VPS A;  5LOV A;  4Z1M G;  2ZDQ A;  3OTO O;  2JA7 A;  5CA0 A;  1N33 O;  4LBE C;  4QE9 A;  2WLK A;  5FPO A;  3RYF B;  2GLT A;  4KUM A;  3EFF K;  1D5N A;  2W0X A;  5C4X G;  5IYC G;  4FLV A;  1PP9 H;  3FX7 A;  1FFX B;  5J2U F;  5LP6 F;  4JI1 H;  4MV3 A;  2WB1 E;  4A3B G;  2UUB O;  4IWX A;  4PBC A;  2RJZ A;  4OX9 H;  4DUY O;  3CEI A;  1V55 C;  4CKB A;  2F1M A;  3FAV A;  2XD4 A;  2RGV A;  1XHZ A;  1MZF A;  5KG6 A;  3HKC A;  4LF8 H;  5KG7 A;  2ZXW B;  1XQ8 A;  3V6H A;  5H9C A;  1M9N A;  2XT9 A;  1RK5 A;  1SFO A;  2HLD G;  4PHZ A;  3AX6 A;  3SPH A;  2Q2T A;  3N41 B;  4EYH B;  4RNN A;  2KG7 B;  2NU7 B;  5KT7 A;  2FK1 A;  2C00 A;  3K04 A;  4RUA A;  3EHB B;  4Q20 A;  3G4S V;  4MTG A;  5D1O A;  2E76 B;  3T5L A;  3SYP A;  4ECZ A;  1ZAU A;  3W7T A;  3EVK A;  2XCP A;  1KYO F;  1GO3 F;  1QQC A;  3WWJ A;  1R3J C;  1DLB A;  2EZO A;  3PO2 G;  2DN9 A;  3C3T A;  4I7H A;  5F9L A;  2ZGI A;  3L70 H;  3EXA A;  4FLY A;  1N56 A;  2GPW A;  5IWA B;  2LQT A;  3N2K A;  1SYX B;  3W1G A;  3T1H O;  5LYJ F;  4FLW A;  2WTF A;  1TVK A;  2FLN A;  4DV7 O;  2BOC C;  3AG2 B;  3GWK C;  4CC6 A;  1SQF A;  1WCM G;  2UU9 B;  4LF4 O;  1Z2N X;  5K1X A;  4JXU A;  4KXR A;  3UQ8 A;  2V4R A;  2XHB A;  3I12 A;  1BGW A;  2F93 B;  3GV7 B;  2DJV A;  4J9M A;  5D8D A;  1OCZ B;  4DLK A;  3V6J A;  4FE2 A;  4DUZ H;  5LMN B;  3ETG A;  1TWH A;  2UXX A;  2EX3 A;  4LF7 B;  1HNW H;  4P30 A;  2QA4 V;  4MW8 A;  1WRV A;  2IH1 C;  3ORR A;  1N48 A;  3A8T A;  1VBH A;  4O4J F;  1NVP D;  4U7C A;  4IGG A;  1I5Y A;  3DXR A;  3PW4 A;  3T54 A;  4DR4 H;  5KA5 A;  3IAY A;  1QLE B;  4XBF A;  3U0G A;  2QWN B;  1KJ8 A;  4ECU A;  2ZCE A;  1IBK H;  2V1D A;  5FLX W;  3QZ8 A;  2IJH A;  2E3C A;  5L3G A;  4A3E G;  5C8Y B;  1HNZ H;  1XMQ H;  1ZQ7 A;  3KHR A;  3BY6 A;  4QWC A;  4O7N A;  2E2H A;  4YR3 A;  1KJI A;  1EM1 A;  1KD1 W;  1P4R A;  1IXB A;  1QBZ A;  5D5P A;  1EHI A;  3BVO A;  5FJ8 G;  2QTS A;  3QO8 A;  1W96 A;  5IYZ B;  3QO7 A;  5K1P A;  5C44 G;  1N4C A;  4GX2 A;  3VPD A;  5EZY B;  3CS5 A;  2ATK C;  4JAA A;  4RUC A;  1CQI B;  4F4Z A;  2FPP B;  4W4L A;  1RYR A;  2B5U A;  5EYP A;  1CKN B;  1GM7 A;  1WA8 A;  2BTQ B;  3T1C A;  3GB8 B;  4G28 B;  4JAS A;  1I6U A;  2EIJ B;  3E5N A;  2AGP A;  5C1O A;  1KP2 A;  3E2E A;  1FS0 G;  2JK5 C;  2ZD9 A;  1AJN A;  3ASO B;  4AYB A;  1K7D A;  4YAK B;  1VQ5 V;  1M5I A;  3HOX G;  3G6E V;  3HOU G;  3W7U A;  1YI2 V;  4DR1 B;  4DV6 O;  3Q4H B;  4PZ8 A;  2RN9 A;  2ZDH A;  3H4D A;  1W0J G;  5J2U A;  5LP6 A;  1W0K G;  4X1K A;  4HYO A;  1KKD A;  3TY9 A;  2RQ6 A;  4Q6G A;  4JI6 O;  4DV1 H;  4C5A A;  1FXH A;  2R70 A;  3T4Z A;  2Y69 C;  5IP7 G;  4TQF A;  1N8R W;  5BWU A;  5A9G A;  1FVI A;  3JRW A;  2CNQ A;  1B04 A;  5I5S A;  4IYI A;  2QWQ B;  2QM7 A;  2DZD A;  1RPR A;  1YIJ V;  3SNO A;  4HNT A;  2JVD A;  1KKC A;  3ASN C;  4DL3 A;  4YBZ B;  5IYZ F;  4B7E A;  4YR0 A;  4ECW A;  4XDK A;  4X62 H;  1Y74 B;  3ETQ A;  5EZY F;  4B3M H;  4ZOL A;  5BZB A;  4X64 B;  1N34 O;  5BR8 O;  1I5X A;  2E74 B;  3PJS K;  3H1H H;  4AQY H;  3GTM A;  5KHK A;  3R66 A;  4YJ3 B;  2GHY A;  4FFO A;  2YIA A;  5CBF A;  3I55 V;  1S97 A;  3HKD A;  5LGN A;  2Y4T A;  5IP9 G;  4RWU A;  5LL6 b;  5LMU O;  4HNA A;  3D3Q A;  3RYI B;  1THZ A;  1SKV A;  3BAA A;  3BEH A;  5LYJ A;  5L3C A;  4GT1 A;  3RYF A;  3CXC U;  4IHJ B;  3I4M G;  1AJQ A;  2DYR B;  3SI8 A;  4MVQ A;  5FD5 A;  1WP7 A;  3LSQ A;  3RUP A;  1TGO A;  3CWB H;  5I5V A;  1FFX A;  2QR4 A;  2Q2U A;  2I8C A;  1I2L A;  4LFA B;  3CSW A;  3CRC A;  5IYB O;  4TQD A;  1HR0 B;  3OEH G;  1Y1W G;  2AHZ A;  3GTJ A;  2AGQ A;  2EJ2 A;  1WP8 A;  5DEC A;  2PMZ A;  2QEX V;  2VA2 A;  2VR1 A;  4A93 G;  4PI2 A;  4J7Z A;  5B1B B;  1VS0 A;  5LP6 C;  2QKA A;  2R7Z G;  3JD1 A;  5LGT A;  2VQF B;  2FL4 A;  2R86 A;  5DLF A;  5FNV B;  1I7F A;  1VQO V;  2P5O A;  3EPG A;  3T9C A;  3O65 A;  5IJ0 A;  1WPX A;  3G6V A;  1L8D A;  1N36 H;  1EUD B;  2KG7 A;  2JA7 G;  1CE8 A;  5IYD O;  1XNR O;  4JZG A;  2ZR3 A;  4X8A A;  5EIB C;  4E4T A;  1YZB A;  4C7U A;  3RAQ A;  1F7Y A;  4YHH H;  1S68 A;  5KHI A;  1FPO A;  2GUZ B;  4JV5 O;  1FXK B;  4UV8 A;  4BAY A;  1DTO A;  3P32 A;  2XTA A;  3RW0 A;  5BWW A;  3F8N A;  2Q0A A;  2Y4R A;  3I4N G;  3ABM B;  3BRC A;  2PMZ E;  5IY5 B;  1S76 D;  2HDK A;  2VWJ A;  3D36 A;  4NXN B;  4PA6 A;  1NT2 B;  3JD3 A;  2PVP A;  3PFF A;  4Y8V B;  2QK4 A;  2UXD B;  2XAQ A;  3W1B A;  2X7R B;  4Q45 A;  3ML0 A;  1VF5 B;  4IHJ F;  3MAQ A;  3MDS A;  2E5L B;  5IJ9 A;  5KLV H;  1PX2 A;  4Q43 A;  3GTG A;  5BPH A;  3Q2O A;  4G27 B;  2AGO A;  1IOV A;  4JI7 B;  5B66 Z;  4QIW A;  5EWE A;  1T94 A;  5IYD G;  4EG0 A;  3SPJ A;  3CC4 V;  4O7Y A;  4GKK O;  2EIY A;  3E22 B;  4DV5 O;  2RNB A;  2JJ2 G;  5BY1 A;  4X66 B;  3H1J H;  2PTM A;  3HOY G;  1KT8 A;  4CS3 A;  5TIS Z;  5FNV F;  1I1L A;  1WLE A;  2GQR A;  5HBR B;  3KYH C;  1WPB A;  5H80 A;  2P06 A;  4O3P A;  4H33 A;  1Y76 B;  4CH5 A;  2ZXW C;  2XIG A;  4DR7 B;  4EBE A;  5LHI A;  5DG8 A;  4DL7 A;  4JI5 O;  3NBY B;  2YIB D;  5C8Y A;  4DR5 B;  1VQ4 V;  1QR8 A;  1ZLZ A;  1NTM H;  4QPJ A;  5J2T B;  5CAE B;  4QIW E;  1YIT V;  2FPG B;  4BW9 A;  5KG4 A;  2DOS A;  2YIB A;  4UCV A;  5C93 A;  3U54 A;  4DR2 H;  2R85 A;  2ODM A;  3PR4 A;  1S9F A;  4JI4 O;  1XI1 A;  2IBK A;  4F4Y A;  5C3E G;  4KL1 A;  1I94 B;  3RJ0 A;  2CTQ A;  1ZHS A;  5LMN H;  5EZY A;  5KT3 A;  3KCX A;  4DRX B;  4DV0 B;  1V55 B;  3G8D A;  1JQ0 A;  4X88 A;  1PL0 A;  3AK1 A;  4NXM B;  1VQ7 V;  2ZM6 B;  2OCH A;  4WBN B;  4O3R A;  3CCE V;  5JVL A;  3ZMS A;  4LFC B;  1CKN A;  3P3P A;  5JH7 F;  2NNU A;  3AG2 C;  3O9O A;  4GZR B;  2YWV A;  3LSU A;  5CM0 A;  4C5B A;  4EFB A;  4M7E A;  5CBG A;  4JI3 O;  4R8U B;  1H2G A;  4H37 A;  1BQZ A;  3LUL A;  2M7W A;  4WFG A;  2RCV A;  4H44 B;  3MFH A;  4GKJ O;  4ZHQ B;  1M6V A;  1M1K W;  4PWQ A;  3OFN G;  1GMG A;  2QWO B;  1S5H C;  1PD3 A;  3Q4H A;  4FFB B;  4OX9 B;  2LW1 A;  4ECT A;  2JS3 A;  1XMO O;  4O2B B;  2JJ1 G;  3ZRS A;  5L3F A;  4NZN A;  1M4U A;  4O3S A;  1AR4 A;  3MHH C;  2W6Q A;  4DR3 B;  4WFA V;  4LF8 B;  3SYQ A;  2Q68 A;  1G4Y B;  5K2M A;  3SPG A;  4X1Y B;  5J2T F;  1FXV A;  1KB9 F;  2JEU A;  1I0H A;  1AP6 A;  1IZ3 A;  4O7S A;  3GV5 B;  1G6U A;  4YP3 A;  4UB6 Z;  5H5N A;  2VQD A;  5LOV B;  2R82 A;  2AGA A;  5GON F;  2BR0 A;  2ASL A;  1NQT A;  4PDL A;  5DAA A;  2PGG A;  4I50 A;  5KG1 A;  2ZDG A;  3K79 A;  1BL8 A;  3Q8S B;  3NC0 B;  3RIZ A;  1FD9 A;  1Y1V A;  2Q73 A;  2Q5Z A;  2UUC O;  3VPC A;  5IE9 A;  4WBN F;  5KFH A;  5KFN A;  4YJ3 A;  2W6P A;  4RO2 A;  2ZE6 A;  5KFB A;  4JI8 O;  4O81 A;  1RM1 B;  2KQX A;  2Q7H A;  1G8M A;  1S0V A;  3RYI A;  2WYO A;  3S24 A;  5KA6 A;  3SYO A;  4QW9 A;  5JVD A;  2HHH B;  2HG5 C;  4RAI A;  5LHG A;  2PZS A;  5JCO A;  2VA3 A;  4LNU B;  3LDC A;  2CE4 A;  2HEP A;  3W7W A;  4F4X A;  3LSS A;  3B09 A;  2EIJ C;  4JV0 A;  1TWA A;  3UO3 A;  3GIM A;  3ZHQ A;  5D1O B;  4O2B F;  1HW7 A;  3OUU A;  1HNW B;  3J80 W;  3OR7 C;  2W6Z A;  4GX5 A;  1R3L C;  3L73 H;  4GC6 A;  3JSL A;  1JOY A;  3CPW U;  1XOU A;  2AW9 A;  5GTH Z;  4RNO A;  4X64 H;  1BJT A;  4JYA H;  2W6O A;  3DTF A;  5LXT F;  3OHB A;  1IBK B;  5KT2 A;  5ITZ A;  2DIK A;  5DGB A;  1FKA H;  1VF6 C;  2CKZ B;  1TWG A;  2B63 A;  4NR1 A;  1R6T A;  1YVW A;  5LOV F;  3QG5 A;  1TVK B;  4LH6 A;  5DQG A;  4PEL A;  4WCE V;  2BSK A;  1GM8 A;  3RGZ A;  3JAM W;  3C90 A;  2Q8V A;  3STL C;  3T5K A;  1VQ8 V;  5BWR A;  2GUZ A;  3HXL A;  4F50 A;  1FXK A;  2DLN A;  5KG2 A;  1OBD A;  4RU9 A;  2Y4U A;  4UUJ C;  4ECX A;  2DQ0 A;  4DIM A;  2R72 A;  5KUK A;  3I5D A;  5IWA O;  2J6S A;  5DLG A;  1I7L A;  4FM9 A;  1E4G T;  5AG2 A;  1FJG H;  2UU9 O;  3RF2 A;  1XDN A;  3JAT B;  2Y69 B;  1JKJ B;  1AIL A;  1A0I A;  4DL4 A;  2LGQ A;  1N32 H;  1EUC B;  1QNM A;  4JYC A;  2QYZ A;  5JCO C;  2F4V H;  1VQK V;  3NBZ B;  3DGE A;  1IBL O;  1I2K A;  2Q7D A;  5BXZ A;  1WSC A;  1Z2P X;  2WAQ A;  2FJZ A;  2DYR C;  1EBO A;  2ASD A;  4NYE A;  4LF7 O;  3R23 A;  3E22 A;  1L0N H;  4O4H B;  3SJC C;  2VQE B;  5FLM G;  4J9K A;  1CP9 A;  1VP7 A;  2R8K A;  4M0J A;  1ZL8 B;  3AG4 B;  1P16 A;  3JD0 A;  3T9E A;  3KHG A;  5B1B C;  1PM9 A;  3OUS A;  3N40 P;  3V6K A;  2CNV A;  1GN2 A;  1NU1 H;  4DV2 H;  1Y76 A;  1AJP A;  4X1I B;  4MVZ A;  3T9D A;  5KFU A;  3J81 W;  3K9A A;  2YCH A;  4XYM B;  3IC7 A;  4A2A A;  3CEB A;  2QTO A;  3BJY A;  2PY5 A;  4CMD A;  2E5L H;  4I0X B;  1H2M A;  5FR9 A;  1KMI Z;  3MWD A;  1KP3 A;  2Y0I A;  4XDL A;  4X62 B;  4JI7 H;  2Y0S A;  3HT5 A;  3CSX A;  4JI0 O;  2XC9 A;  5KKN B;  2JA6 A;  5DGH A;  4AQY B;  3JZ6 A;  4K0K O;  4YJ2 A;  1JIH A;  2ADP A;  4DRX A;  5IY5 C;  1DF4 A;  4O84 A;  3QNE A;  4YY3 B;  3H1I H;  2DWE C;  4RUE A;  3FD9 A;  2WLI B;  3UKM A;  4WBN A;  1QLN A;  2CGN A;  1J95 A;  1R3K C;  2X6A A;  3K58 A;  1G1X B;  2B9Z A;  2QM4 A;  2YIC A;  4MS2 A;  1YEW A;  1SZX A;  1NBM G;  4DR6 B;  1P7G A;  4LFB B;  3PO3 G;  1B3Q A;  4R8U A;  3N2G A;  5KX5 B;  4P9O A;  2YZG A;  4O4H F;  1OV9 A;  1SF9 A;  5DGI A;  3UZB A;  1B6Q A;  1EN5 A;  4ZHQ A;  4DR1 O;  2Y0S E;  4BXX G;  1F51 A;  2BOB C;  2IA6 A;  1TWF A;  4FFB A;  3CP1 A;  2A9H A;  1L1F A;  4FBT A;  4O2B A;  4ZOL B;  1I94 H;  5B1O A;  1AVM A;  2WA3 A;  4E6N A;  2GSM B;  1JA8 A;  2R8I A;  2UUA O;  2FK2 A;  3G71 V;  4RAZ A;  1QVF U;  3GTQ A;  2IM9 A;  3PVX A;  4X1Y A;  3HKD B;  3HR0 A;  4J11 A;  1SQP H;  2XAH A;  3FMA A;  4A3C G;  4A3M G;  2Z5U A;  5KMG A;  3CCR V;  1BQ0 A;  1KC7 A;  1UC9 A;  4BY1 G;  2Z3Y A;  4LFC H;  4ZKI A;  4YHH B;  1EFR G;  2FTK A;  2OWO A;  1B33 N;  2HVQ A;  3KG2 A;  1T5E A;  3JD4 A;  4X64 O;  3QWU A;  5KFC A;  2EZP A;  2R7M A;  3DAA A;  2ZE7 A;  5E25 A;  3C0F B;  4QW8 A;  2NVY A;  4EB6 B;  4KHP H;  4C2M A;  4JPR A;  2ABJ A;  3ZHS A;  3U0Z A;  3V4Z A;  2ZQM A;  4F6R A;  4NZO A;  1TAE A;  2XUM A;  4IIJ B;  2W7P A;  2DE0 X;  4L8J A;  1ZX3 A;  1DAA A;  2W71 A;  1EZV H;  2OCC B;  3APQ A;  5H6R A;  1AN7 A;  3WO1 A;  1DV1 A;  4ECR A;  1WH2 A;  3TIG A;  1XDC A;  4DO2 A;  4KFM A;  4DR3 H;  4RQF A;  2P90 A;  5KX5 F;  3SE7 A;  3BG5 A;  4XDJ A;  4LNU A;  4BR6 A;  4BWS C;  3F7V C;  5IJ0 B;  4X89 A;  3CCM V;  3U9T A;  2X0L A;  4X20 B;  4YQW A;  2X6C A;  4O7Z A;  4BIO A;  5LL6 Y;  4LFA O;  3RGX A;  3P30 A;  4MTX A;  1HR0 O;  4A5U B;  4ZOL F;  4Q44 A;  2HP8 A;  3VQW A;  2VQF O;  1UNN C;  4J9Y B;  4FFK A;  4OPA A;  4MVO A;  5KT5 A;  4LF9 B;  2YS6 A;  1PPJ H;  3E8F A;  4UVA A;  1C30 A;  2RMK B;  4IRC A;  1FYJ A;  4FFN A;  5L1J A;  3KKY A;  3WB1 A;  4JAU A;  4C5C A;  2QB5 A;  1K34 A;  5IJ9 B;  3OM3 B;  4DR2 B;  1Q86 W;  2HHH H;  3T1Y B;  3OSP A;  4IL6 Z;  3BQ0 A;  3THO A;  4GX0 A;  1SEI A;  3FYI B;  3T7A A;  3GIP A;  5EBW C;  2C28 A;  5JQW A;  1AR5 A;  2WAM A;  3SJB C;  1K1S A;  4NXN O;  1KUT A;  2VPQ A;  4G2K A;  2NU9 B;  2XGQ A;  2YSU B;  1IVS A;  2HVJ C;  2UXD O;  2UXB O;  5FD6 A;  5DG9 A;  2HJD A;  3B77 A;  4ED7 A;  4FU0 A;  3ICX A;  2B63 G;  3JAT A;  1GSH A;  1RM1 C;  4UCU A;  4HNV A;  4JI7 O;  3R9R A;  1P8L A;  2ODT X;  5KFG A;  4CS2 A;  2ZE5 A;  3RVZ A;  3SGI A;  5J9P C;  1WB8 A;  5LHH A;  5EBM C;  3M99 B;  1VF7 A;  3LML A;  3E83 A;  4MV4 A;  2XCA A;  3R65 A;  4GLX A;  1Y4M A;  3K5L A;  2I87 A;  4X66 O;  4O4H A;  4UVC A;  2CTR A;  3FB6 C;  2A0L A;  4JI2 H;  3NXS A;  1W93 A;  2EJ3 A;  3RB4 A;  4HYK A;  1BHB A;  2P6J A;  3BQ1 A;  2XGP A;  2YRW A;  2YXY A;  1SZT A;  1ZL8 A;  3DSQ A;  4ETS A;  2XAJ A;  3TJT A;  5KFO A;  2C22 A;  4J9N A;  3AW8 A;  4FFR A;  2IJK A;  5CE8 A;  4DR7 O;  3T9A A;  1NR7 A;  1S03 G;  4UVB A;  4X1I A;  4ECQ A;  4DR5 O;  3QVN A;  3QF7 A;  1XK5 A;  3OT7 A;  2NU6 B;  5T14 A;  1VMG A;  1MAB G;  1XL6 A;  4QIW F;  3SPI A;  3GDE A;  4B3T O;  2YC0 A;  4I0X A;  2YDE A;  4CKE A;  1H2S B;  2FML A;  1VQP V;  4UFZ A;  5CN0 A;  4ZI7 A;  1M90 W;  2WE6 A;  4JTD B;  1QR9 A;  3JAS B;  4J7J A;  4DV0 O;  2Q7E A;  4R7R A;  4FM1 A;  2F66 C;  2YW2 A;  2VQE H;  4DL2 A;  4NXM O;  2OH2 A;  2ZM6 O;  3K5H A;  1JFF B;  2DAA A;  2WLI A;  1DK1 A;  4EEQ A;  1NH2 B;  3UCS C;  1XNQ H;  5BMV A;  3UFX B;  4J41 A;  1AR1 B;  2V58 A;  2FK3 A;  3K08 A;  2HR3 A;  3L72 H;  3FB8 C;  4FPP A;  5C8Y F;  2R92 A;  4D7S A;  5EIB D;  3MFI A;  4J9P A;  3S3W A;  5LBQ A;  4K8X A;  2VUM A;  5KX5 A;  2YUA A;  3CX5 F;  3CE2 A;  4JI1 O;  4I5S A;  2WLL B;  3ETJ A;  3IC9 A;  4MVU A;  1ULZ A;  5CB4 B;  1P84 F;  2EIL B;  1Y14 B;  1WR2 A;  3UYY A;  2EBO A;  5L3B A;  4OX9 O;  1CXZ B;  4GX1 A;  4CH4 A;  4HR7 A;  3TY8 A;  1XEQ A;  4I50 B;  3ZHR A;  4MA5 A;  2JA6 G;  1R1B A;  4J7K A;  1X59 A;  2IJJ A;  1YTF B;  4JYA B;  4LF8 O;  2YEV B;  2ETN A;  1IYD A;  1H2N A;  4A3F G;  1K83 A;  1D5A A;  3PN1 A;  1YDX A;  3VQY A;  3T9F A;  1RP3 B;  2BCC H;  2PUS A;  2X0S A;  3AG4 C;  3OMN B;  4DW0 A;  3NR7 A;  4O86 A;  4YY3 H;  1GH6 A;  1RFY A;  4HZ3 A;  4LF5 B;  1RJR A;  5KG5 A;  5JVD B;  3SYA A;  2YID A;  3OTO B;  3CVZ A;  2WDT A;  4PDV A;  4RB3 C;  2OT5 A;  4QSH A;  3HPL C;  4DR6 H;  4LFB H;  3OMI B;  1PNM A;  1E4E B;  3K5M A;  4O3N A;  1KBL A;  1I50 A;  1LR1 A;  2N05 A;  1XHX A;  4DV3 B;  2AXT Z;  2H3O A;  2IMW P;  4EB6 A;  1DF5 A;  1ET0 A;  4CC5 A;  1L2Z A;  3J7A U;  4LP8 A;  2XOK G;  2Z02 A;  4MV1 A;  4O7V A;  2YXL A;  4IIJ A;  1CS0 A;  3JZF A;  5KFV A;  1XUQ A;  5IT9 N;  3LP8 A;  1NS1 A;  1FJG B;  3KCY A;  3K57 A;  5ITZ B;  1N32 B;  4EGQ A;  2F4V B;  4FIP C;  3N6X A;  2CH7 B;  4X20 A;  3DC5 A;  4DUZ O;  4DK0 A;  3HKE B;  2BSK B;  3MWM A;  1HNW O;  3K9S A;  4I50 F;  3W7S A;  1BXR A;  1U96 A;  1KBH A;  4EGJ A;  2NN4 A; 
#chains in the Genus database with same CATH homology
 1E4F T;  3JAK B;  3NC0 B;  3RIZ A;  2ZIM A;  3K3V A;  4JV5 H;  4FM0 A;  5J2U B;  3BHP A;  5LP6 B;  1Z2O X;  4X66 H;  3FFQ A;  4X1K B;  4YJ3 A;  3HKB A;  5LA6 A;  4CS4 A;  3RTX A;  4DV2 B;  3BAB A;  1CKO A;  3RFR A;  3T1H B;  2Q7H A;  3RYI A;  3S24 A;  2WYO A;  2P22 C;  4TV8 A;  4U3J A;  5JVD A;  4IAJ A;  2HHH B;  4DV7 B;  4RAY A;  2PZS A;  5JCO A;  4LNU B;  4DR7 H;  1KU9 A;  2HEP A;  4PZ7 A;  4DR5 H;  4MV9 A;  1QHT A;  2BTO A;  3JAL A;  4FLZ A;  3RYC A;  2VOB A;  4CH3 A;  4B3T H;  1Q8I A;  5D1O B;  1HW7 A;  1HNW B;  1IBM H;  3J80 W;  4JI0 B;  4LSX A;  4CH6 A;  3JSL A;  4AHC A;  4GKK H;  3N44 B;  1DGS A;  4K0K B;  4DV5 H;  4JYA H;  4X64 H;  1BJT A;  3IG0 A;  3ZED A;  4RB2 C;  4DV0 H;  1IBK B;  5LXT A;  5ITZ A;  1FKA H;  2CW8 A;  4NXM H;  4O2A B;  4FM2 A;  1N36 B;  4HNA B;  4MTD A;  2ZM6 H;  4JI8 B;  2QJ1 A;  3RYH A;  4LF9 H;  3QG5 A;  1TVK B;  4GYC B;  3N42 B;  1WN7 A;  4LH6 A;  4LF6 H;  5LYJ B;  2VPS A;  5JQG A;  5LOV A;  5JJJ B;  3RGZ A;  3JAM W;  5CA0 A;  1J5E H;  3RYF B;  3K5N A;  5FPO A;  4UCR A;  1HNX H;  4JI5 H;  4FLV A;  3HXL A;  4PZ6 A;  3T1Y H;  1FFX B;  4TOI A;  4JI1 H;  2UXC B;  2R72 A;  4J0M A;  2RJZ A;  4JI4 H;  4OX9 H;  4FLT A;  4TV9 B;  2F1M A;  2RGV A;  4FM9 A;  1XHZ A;  4YJ2 B;  1E4G T;  1M0W A;  1Z5W A;  3HKC A;  2UUA B;  4LF8 H;  1FJG H;  1WNS A;  1XQ8 A;  3RF2 A;  1XDN A;  3SJA C;  3JAT B;  1A0I A;  4X65 H;  4RZQ A;  4PHZ A;  1N32 H;  2Q2T A;  3N41 B;  5JCO C;  4B3R B;  2F4V H;  3H20 A;  3NBZ B;  1Z2P X;  4UCS A;  5KHG A;  4TUY A;  5D1O A;  1N33 B;  3N2G B;  1ZAU A;  3E22 A;  4KHP B;  4JI3 H;  2ZNI A;  4O4H B;  3SJC C;  1QQC A;  2VQE B;  3JAS A;  5CA1 B;  2HVS A;  4GKJ H;  4DV6 B;  4I7H A;  2UUB B;  1P16 A;  1JFF A;  4FLY A;  5IWA B;  2HIX A;  3N2K A;  1SYX B;  3N40 P;  3W1G A;  2GV9 A;  3JAW B;  4JI6 B;  4DUY B;  4DV2 H;  1SA0 B;  1XMO H;  4FLW A;  4NVP A;  1TVK A;  3VQX A;  4X1I B;  3UT5 B;  3J81 W;  4A2B A;  2YCH A;  4CC6 A;  1SQF A;  2UU9 B;  1Z2N X;  4A2A A;  5K1X A;  1MZB A;  2PY5 A;  3UQ8 A;  5KMG B;  2E5L H;  2XHB A;  1BGW A;  1KMI Z;  1SQG A;  2F93 B;  4B3S B;  5CB4 A;  4X62 B;  4JI7 H;  1GYF A;  3KAK A;  2Q7G A;  4DUZ H;  5LMN B;  5EOY A;  2EX3 A;  3CSX A;  1V9P A;  4LF7 B;  1HNW H;  4TV9 A;  4AQY B;  4RB1 A;  4LMY A;  2ZNJ A;  4YJ2 A;  1JMK C;  4DRX A;  4YY3 B;  1X9N A;  4F6R B;  4DR4 H;  4O4J A;  3EYY A;  2UUC H;  3IAY A;  4WBN A;  4D7T A;  4B08 A;  1Q3E A;  1Z5V A;  2ZCE A;  3K58 A;  1IBK H;  4O4I A;  5LMU B;  3RR5 A;  2QM4 A;  1YEW A;  4JI8 H;  2R9A A;  5FLX W;  2E3C A;  4DR6 B;  1HNZ H;  4LFB B;  5C8Y B;  1X4T A;  1XMQ H;  1TUB B;  3N2G A;  3ZS8 C;  5KX5 B;  4LF4 B;  1Q43 A;  1O75 A;  1O9H A;  4ZHQ A;  5D5P A;  3BA9 A;  5CA1 A;  3GJX B;  4FFB A;  5IYZ B;  5K1P A;  2UXC H;  4O2B A;  4ZOL B;  4DRF A;  3KAJ A;  5EZY B;  1I94 H;  2UXB B;  4E6N A;  5FPR A;  3UT5 A;  4RAZ A;  2IM9 A;  3RWR D;  4LH7 A;  4Q0Y A;  4X1Y A;  3HKD B;  5DIS C;  3FMA A;  5EYP A;  1CKN B;  4DV4 H;  5KMG A;  2BTQ B;  5JH7 B;  3GB8 B;  1I6U A;  3QTC A;  1Q5O A;  4LFC H;  4FVM A;  3KXY T;  3A2F A;  3HKE A;  4LF5 H;  4YHH B;  2OWO A;  2HVQ A;  4I55 B;  3OTO H;  1T5E A;  3QWU A;  1M5I A;  4JI2 B;  4I4T B;  4JV5 B;  3C0F B;  3JAK A;  4EB6 B;  4KHP H;  4DR1 B;  3U0Z A;  4PZ8 A;  4DV3 H;  3M4I A;  4O4L B;  5J2U A;  5LP6 A;  4F6R A;  1TAE A;  4IIJ B;  4X1K A;  4AIL C;  5IT9 W;  4L8J A;  3JAR B;  5D5Q A;  2RQ6 A;  4Q6G A;  3TY9 A;  2UUB H;  4DV1 H;  1AN7 A;  5IWA H;  1WH2 A;  2R70 A;  4DR3 H;  4DUY H;  4TQF A;  4LNU A;  1TUB A;  4BWS C;  1FVI A;  1B04 A;  5IJ0 B;  3U10 A;  2UU9 H;  4X20 B;  4B3T B;  2JVD A;  1S5J A;  3LNN A;  5GON B;  3RGX A;  3KAL A;  1IBL H;  5IYZ A;  1CKM A;  4X62 H;  4PDB A;  3ETQ A;  2VWK A;  4B3M H;  4ZOL A;  4X64 B;  4ZIB A;  4LF7 H;  4AQY H;  3VQW A;  5KHK A;  3U11 A;  4YJ3 B;  2VUG A;  2YIA A;  4LF9 B;  1XNQ B;  3HKD A;  3WB0 A;  4LF6 B;  4RB0 A;  4O2A A;  5LL6 b;  4HNA A;  2BTQ A;  3RYI B;  4TV8 B;  4U3J B;  1SKV A;  3BAA A;  5LYJ A;  3WB1 A;  3T1H H;  5KHJ A;  5IJ9 B;  3RYF A;  4IHJ B;  4DR2 B;  4DV7 H;  2HHH H;  3T1Y B;  3THO A;  4JI1 B;  1SEI A;  4LF4 H;  5FD5 A;  3RYC B;  4I9Q A;  1P49 A;  1TGO A;  2Q2U A;  1FFX A;  4LFA B;  4O4L A;  3SJB C;  4TQD A;  3JSN A;  1HR0 B;  2YI8 A;  4ZI7 B;  4PI2 A;  4LR3 A;  1N34 B;  5BR8 B;  1VS0 A;  4JI0 H;  5LP6 C;  5FD6 A;  4X65 B;  2VQF B;  2KSW A;  4K8Z A;  3J7A K;  4K0K H;  5LXT B;  3ICX A;  5FNV B;  1I7F A;  3DF7 A;  2P5O A;  3JAT A;  4UCU A;  5IJ0 A;  5BMV B;  1P8L A;  4CS2 A;  1L8D A;  1N36 H;  4MTE A;  3CHX A;  3SGI A;  5CA0 B;  4FLX A;  5EIB C;  2MCT A;  1VF7 A;  4JI3 B;  3LML A;  4YHH H;  1S68 A;  4UCO A;  5KHI A;  4APM A;  3B2E E;  2PYJ A;  4GLX A;  3K5L A;  4GKJ B;  4O4H A;  4UCT A;  3F8N A;  4JI2 H;  2Q0A A;  1RSO A;  4BWA A;  3BRC A;  4DR1 H;  1XMO B;  3DSQ A;  2VWJ A;  4NXN B;  4ETS A;  2HIV A;  1NT2 B;  3JAW A;  3K59 A;  3HKC B;  1SA0 A;  2RGR A;  2UXD B;  3W1B A;  1S03 G;  4X1I A;  3VNN A;  2CAZ C;  3MAQ A;  2E5L B;  5IJ9 A;  2UUA H;  3QF7 A;  3BA8 A;  4IHJ A;  1XK5 A;  3L4J A;  3GDE A;  4EQ5 A;  4JI7 B;  2O03 A;  5KHH A;  4DUZ B;  4HBN A;  4TUY B;  1XNR B;  4B3R H;  1H2S B;  3N43 B;  3E22 B;  2CFM A;  4UFZ A;  4PI0 A;  4ZI7 A;  2WE6 A;  1N33 H;  3SR2 C;  3JAS B;  4X66 B;  2PTM A;  4DR4 B;  2Q7E A;  2UUC B;  4FM1 A;  4R7R A;  4CS3 A;  2F66 C;  2VQE H;  5D1P A;  1JFF B;  2ZIO A;  5FNV A;  3KYH C;  4DV6 H;  3N2K B;  1WPB A;  3BPZ A;  4EEQ A;  1XNQ H;  5BMV A;  1HNZ B;  1ZHQ A;  4CH5 A;  3L4K A;  1XMQ B;  2XIG A;  4DR7 B;  4JI6 H;  4D7S A;  5EIB D;  2F95 B;  3NBY B;  2YIB D;  5C8Y A;  1JJO A;  4DR5 B;  4K8X A;  5J2T B;  2JS5 A;  5KX5 A;  4DR2 H;  4BW9 A;  2YIB A;  4UCV A;  3RGB A;  5CB4 B;  2ZIN A;  1XI1 A;  1IBM B;  3K5O A;  4CH4 A;  3TY8 A;  4KL1 A;  1I94 B;  4B3S H;  4I50 B;  5JJE B;  4GKK B;  3TY5 A;  3RJ0 A;  4MV7 A;  4LFA H;  5A2Q W;  2JGU A;  4DV5 B;  4JYA B;  1ZHS A;  5LMN H;  1HR0 H;  5EZY A;  1D5A A;  3PN1 A;  3VQY A;  2PUS A;  4DRX B;  4DV0 B;  1N34 H;  5BR8 H;  4O4J B;  4FLU A;  2YI9 A;  3HKB B;  5LA6 B;  4DV4 B;  2ZM6 B;  4WBN B;  4NXM B;  1M0T A;  2VQF H;  4YY3 H;  3W5O A;  4O4I B;  4LFC B;  1CKN A;  4LF5 B;  5JJN B;  3OTF A;  5JH7 A;  1J5E B;  5JVD B;  2ZJT A;  5LMU H;  4M7E A;  4EFB A;  2KKW A;  3OTO B;  1HNX B;  4JI5 B;  3CVZ A;  2WDT A;  4RB3 C;  4DR6 H;  4LFB H;  4I55 A;  2W57 A;  3K5M A;  4I4T A;  4ZHQ B;  3JAL B;  1XHX A;  4DV3 B;  4EB6 A;  1L2Z A;  4CC5 A;  3M7M X;  4DK1 A;  4JI4 B;  4LSA A;  4FFB B;  4OX9 B;  4DV1 B;  4O2B B;  2FE3 A;  4IIJ A;  1M4U A;  2YXL A;  2V4D A;  3JAR A;  4DR3 B;  3WB2 A;  4NXN H;  4LF8 B;  1FJG B;  2HGS A;  2CW7 A;  1M93 A;  3K57 A;  1O9G A;  2UXB H;  2UXD H;  4X1Y B;  3VQV A;  5ITZ B;  5EYP B;  1N32 B;  3L2P A;  5J2T A;  2PYL A;  2OYQ A;  2F4V B;  3RYH B;  3N6X A;  1TA8 A;  1G6U A;  4X20 A;  4EFE A;  4DK0 A;  5JQG B;  3HKE B;  5LOV B;  1IBL B;  2HVR A;  3MWM A;  4B3M B;  3CB2 A;  5GON A;  1XNR H;  2PGG A;  4I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...