4UCUA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucuA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucuA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucuA02
4LF6B 3S24A 4DR1B 4DV7B 4X65B 4LF5B 3UQ8A 4GKJB 3L2PA 5FPOA 4GKKB 4X62B 1XMOB 1A0IA 4OX9B 3KYHC 4LH7A 3NBZB 4JI8B 1IBLB 1HNWB 4JI5B 4DV6B 2UUAB 4JV5B 3GB8B 3TY9A 4K0KB 1TA8A 4TOIA 2UXDB 3W1GA 2CFMA 4PZ7A 3W5OA 4UFZA 4B3TB 2UXCB 3BA9A 4LFBB 4YY3B 1XDNA 4DR6B 4DR5B 2HVSA 4B3RB 4JYAB 4DR2B 1XMQB 5IWAB 4EQ5A 1HR0B 2ZM6B 5LMNB 4DR4B 4PZ6A 1N34B 1CKNB 1HNZB 4B3SB 4JI4B 4LF4B 4JI2B 4UCRA 2UUBB 4UCTA 4LF7B 4JI0B 3NC0B 3VNNA 3BABA 1X9NA 2UXBB 1IBMB 3JSNA 4DR7B 4YHHB 3OTOB 4DV1B 4EFBA 1XK5A 4PZ8A 3T1YB 1FJGB 1CKNA 1N33B 1N32B 1DGSA 1TAEA 2OWOA 4JI1B 1VS0A 4DV2B 2UUCB 4JI6B 4AQYB 3NBYB 4JI7B 4DUZB 5LMUB 1XNRB 2HHHB 2VUGA 1J5EB 4NXMB 5D1PA 2VQFB 2E5LB 3BAAA 4DV3B 1HNXB 2UU9B 1B04A 3RR5A 2F4VB 4LF9B 4LFAB 4KHPB 4EEQA 1CKMA 4X64B 3RTXA 3TY5A 4JI3B 5D1OB 1FVIA 4E6NA 1ZAUA 1S68A 4DRFA 1I94B 4UCOA 5DISC 2HIVA 3W1BA 3GJXB 1V9PA 4DV0B 4UCSA 4DV5B 1N36B 2HVRA 3PN1A 5D1OA 5BR8B 1P8LA 4EFEA 1CKOA 3GDEA 4DV4B 2Q2TA 2HVQA 3SGIA 4UCUA 4B3MB 3T1HB 1IBKB 4DR3B 4CC5A 2Q2UA 4UCVA 4NXNB 4GLXA 1XNQB 2VQEB 4CC6A 3QWUA 4LF8B 1P16A 4X66B 3TY8A 4LFCB 4DUYB 2HIXA 5FPRA 3JSLA 3BA8A 4LH6A
chains in the Genus database with same CATH superfamily
4JTCB 1TUEB 2QTSA 1K5QA 1VQLV 2EIMB 4TV9A 4DUZH 5LMUH 2ZE5A 3T99A 4JASA 1JDEA 3MFHA 2X6AA 2E5LH 4CH6A 4WFAV 3MAQA 4OPHA 2UU9H 3CCUV 2FKXA 2BQ3A 3K5OA 1SQXH 5BWRA 2UXDB 3SPIA 2KQXA 2VA2A 1XI1A 2WLJA 1IXMA 3OHBA 1TVKB 1FXKB 3I4MG 4XBFA 5CN0A 4EGQA 1B6QA 1WA8B 1AUXA 4RO2A 3TIGA 5KT7A 2DYSB 3ZBHA 4PA7A 1EHIA 2VPQA 2GQRA 4TQFA 3T1HO 4PZ6A 2OCCB 3TXQA 1DV2A 1YJWV 3FAVA 2WLHA 4C2MA 4FVMA 4JV1A 2QE7G 2ZIMA 2YRXA 1ZL8B 1GM8A 1M9NA 1PL4A 4CE5A 3CVZA 3IFXA 4TUYB 3E8BA 4HNTA 5H5NA 3BPZA 4P9PA 1PX2A 3ETJA 2W71A 1L8DA 2QKSA 4OGQB 1IXBA 2Z04A 3K3VA 1WPXA 4QGPA 4HYOA 2W7OA 5CE8A 2GBOA 4X62O 1K73W 1BJTA 1V54B 5EBWC 1OCZC 4UVCA 4DLKA 1XNRB 2HHHB 2Q69A 1OCRB 4H0LB 4C5BA 1SS3A 3CYOA 2WSSG 4U3JA 4RB3C 4DYLA 4X1KB 2W0FC 3AK1A 4B3TO 2HGXA 2R93A 5KHGA 4R8UB 4YHHH 3TW7A 3AYHB 5C3EG 3HKEB 1EM1A 2F4VB 3RR5A 1Y4MA 2WE6A 3W7XA 4LFAB 4K0KH 3T9BA 4X64B 4RUCA 4I0XA 3BRCA 4PD4F 4YR2A 2YZLA 1XHXA 3EXAA 2JA6A 1Q43A 5BYAA 2V1DA 2PY5A 4JV2A 2DE0X 4YJ2B 1IBMO 5D1OA 2CDYA 1Y14B 2J6TA 3Q1KA 3VOTA 4W4LA 1XREA 2FB9A 3CXHF 1R1BA 4FS2A 4IT5A 5JQGB 2R6FA 2F95B 1Q3EA 2UXCO 1T3NA 4BY7G 1Z2OX 3JASA 3LSSA 4IHJF 4EG0A 3QWUA 1K5SA 4DR2O 2R85A 5IWAO 2Y0IA 1GM9A 3OMIB 5T14A 4TV8A 1VF7A 1BGWA 5KT5A 5K3WA 5EYPA 5EBMC 2Q0AA 4R50A 5FJ8G 2RDIA 1Z5VA 3ASOB 1WAZA 4JYCA 2CW8A 4RQFA 2XAHA 2I8CA 3CQZA 5L3EA 4OX9B 3H1HH 4QJFA 1MZBA 3T1HH 2YIDA 1Y67A 3G4SV 1XDCA 2JS5A 1JX9A 1JKJB 4YIOA 5L3BA 4AYBA 5FNVF 1BZKA 1W2BU 3TY9A 4QW9A 4Y8VB 2DN9A 4UV8A 2DABA 4CMFA 3GTQA 2P7TC 3QVNA 4I5SA 4LWSB 2BQRA 3OAAG 1RJQA 5DG9A 1AB3A 2RJZA 1ZHQA 2AQ4A 1GLVA 1I1KA 2ZQMA 1U96A 1VMGA 3QO7A 3BCCH 4O3SA 1S5HC 5KKNB 3F5TA 3HKDB 3RB4A 1GK9A 3RFRA 4A93G 4X62H 4B3SB 3K57A 5BPHA 2DPJA 2R9AA 3RVYA 2C35B 3CC2V 5JH7B 3WWHA 2YRWA 1YF2A 2Q67A 1S76D 5BZBA 2C00A 2W9AA 3G6XA 4DR3H 1IBKH 5GONA 3WB1A 3DC6A 2ZXWC 1WCMA 3BEHA 3SE7A 3HXLA 3G71V 2EJ7A 4ZKIA 3T1YB 3GIIA 4B3TH 5HNEA 1KQSU 5KS8A 5J2TF 4J9KA 3R5XA 1KC7A 1A0GA 4H33A 3FD9A 2IJHA 2GLTA 1AR1B 4DR1H 1OBGA 5LOVF 4AQYB 2PVPA 2DW4A 3L75H 2HDKA 2GUZB 5K1XA 1J5EB 4MTGA 2UXDO 1X59A 2ZE6A 2LW7A 4ZHQB 2YXHA 1P7BA 3SPGA 2PI5A 1CKMA 1PKXA 5KG6A 3UKMA 4LR3A 2UXCH 3CHXA 2XAJA 2JJ1G 4IWYA 1VARA 3J80W 1FXVA 5LBQA 4O3NA 4DR2H 3D36A 3T2MA 3T4ZA 1XHZA 3W1BA 5IWAH 2E2HA 4NR1A 1WB8A 1WB7A 1UPGA 1I7NA 3M9NB 1EKVA 1N34H 4JTDB 1ZX3A 4MV7A 3H40A 5GW7A 4PDLA 2UVUA 4X9QA 1TWGA 2YI8A 1US6A 4ETSA 1EZJA 4ZIBA 5BY1A 2UVWA 3FKIG 1CQJB 1ZUQA 4NXNB 3HKBA 3GIDA 3K06A 2VQEB 2X0SA 1FJGH 1Y1VA 3J7AK 2ETNA 3AW8A 3D3QA 5KFSA 2JA8G 2IW5A 3ETEA 5EOYA 2WTFA 3GIMA 2MW2B 3ML0A 1XNRO 2HHHO 4I55A 4FZ0A 4J9NA 4LF4O 3JD4A 1PD3A 5DQGA 3ZX6A 4JI7H 1NBMG 4X65B 2CNVA 3U9SA 1H38A 5FPOA 2J9GA 4R7CA 4ED6A 1JMKC 3GQCA 1KJ8A 3PO2G 4LFAO 4X64O 4JI8B 4W4KA 3U0ZA 3SPHA 3LDDA 4DAAA 2EIMC 4DIMA 3APOA 1CXZB 4YJ3F 4YY3B 4DR6B 3V6JA 2FL4A 4JYAB 2ZNJA 2W6MA 2A3QA 4GUNA 5IJ0B 4O7VA 4MTEA 3PZPA 2A79B 2HEPA 4YJ3A 3ABUA 2C22A 3F7YC 2OT5A 4JI0B 1FXKC 4K35A 2A0LA 5I5UA 4RUAA 2JRIA 1SQGA 4J9LA 3AG2B 1BL8A 2UXDH 4JAVA 4HBNA 1PNLA 3JRWA 4YBZB 1EN6A 2KB1A 1DGSA 1Y1VG 4DV0O 1FD9A 3D36C 2NU8B 4PDRA 2JA7A 5LP6A 4O2BF 5EC2C 3ZRWA 2HHFB 3I55V 1YJNV 4O82A 1PM9A 1LNQA 3UO2A 4ECQA 2YU9A 3QZ7A 1AI6A 1ZWIC 2VUGA 4NXMB 2ZKOA 2AU0A 5JJEB 2CTRA 2WAQA 4HNAA 4O4JF 1Z2NX 4ICGA 4JV5H 3ZHUA 2PN1A 1V54C 1YDXA 4EEQA 4IYIA 1O9HA 1KB9F 4FFMA 2QF7A 4C5CA 1OCRC 1DAAA 3RB6A 4WFGA 2IJIA 4DR5H 2KSDA 4I4TF 4IIJF 5DISC 5CA1B 4B3SO 3RYIA 4JV0A 5LHHA 1R9TA 1SA0B 4DV5B 2AZ2A 1R73A 1YITV 4QNHB 2HHHH 3V4ZA 4LF4H 5JCOC 4ECVA 3T1YO 1M90W 4PV1B 4LFAH 5C8YB 1WNSA 4X64H 4FLWA 3N6RA 3HKCA 2RGVA 3SYPA 2X6CA 2B9ZA 1NTZH 2ZM6O 4AQYO 4O4IF 3QO8A 2PZSA 1R6NA 3KKYA 2ADQB 2VWJA 5B1AB 1J5EO 4LF6B 4QW8A 4ECZA 3LWBA 3OMAB 3TETA 3N2KB 2LGWA 2YXLA 5LXTB 5LHIA 4YQWA 4ZI7F 2R7KA 5CMUA 1CP9A 3QO5A 1AJPA 2W9BA 2BSKB 3ASOC 1N0JA 1EUCB 3BHPA 1S5LZ 5CA0F 1PK8A 4MV8A 2L35A 2XD4A 4ZI7A 1GM7A 1YZBA 5FLXN 4Q0YA 1XDNA 1MOFA 2NVXA 3JD3A 3IGAC 1XMQB 4X8AA 3WFVA 1KJQA 1XEQA 4J9MA 1HP8A 4DV0H 4LNUB 5LMNB 3I4NG 1DTOA 3U10A 3IC9A 4X20B 3CCMV 1JJ2U 1WR2A 1NVPD 4JI4B 5LGTA 3NC0B 5L1IA 4NXNO 3VNNA 5I5SA 3VPBA 1CEZA 2VQEO 3JATA 2UXBB 4KUMA 2LO1A 4TVIA 3Q8RB 3M9OB 4J80A 5KG3A 4ED7A 1A3GA 3JAWA 4D7TA 3KHLA 3EVKA 3I5DA 4X65O 1MMMA 3H4BA 2EINC 4O2AF 3VPDA 5B1BB 1RSOB 1RYRA 4B3SH 3SYOA 3A0HZ 5A9GA 4JI8O 1EBOA 3JAMW 3Q8PB 4UVBA 3LMLA 2ZDIA 3TW6A 2H3OA 4FFLA 4MAMA 1I3QA 2RQ6A 4TWKA 1HNXB 3K5LA 1S0NA 3DGEA 3FYIB 4CH3A 2UUAH 4YY3O 4DR6O 4A2BA 3EHBB 3TY5A 4JYAO 1FVIA 2B1GA 3H20A 1TWFA 3H01A 1GMGA 1M7JA 3CRRA 4DRFA 1S03G 2LJ2A 2J6UA 2QDOA 1DLBA 4HNVA 2ZM6H 2AGQA 4AQYH 3SPCA 4UCSA 4JI0O 5IYCG 4Z1MG 1AJQA 5IDJA 3DTFA 1I2LA 5IT9N 3GTKA 4O84A 3H9VA 4LF7H 4QPJA 1CKOA 1PV0A 4RNOA 5B1NA 1VQ8V 3U11A 3ZMZA 2V59A 1G2WA 1NVPB 4DR7H 3BY6A 2RDJA 4PA6A 1FFXA 4Q4CA 3RJ0A 4DQNA 2JEIA 4IR9A 4O3PA 1GKFA 3RGZA 3HKZA 3DXRA 5KFBA 3JSLA 1SYXB 2CE4A 4NXMO 4KP4A 4DV7B 3EFFK 1IDSA 4AHCA 3FDSA 4TQSA 5B5EZ 4BIOA 2ARHA 2WB1E 3HO8A 5ITZB 3HOWG 2KKWA 1X4TA 4NXNH 1BNCA 5I5WA 2P4KA 4L87A 1DK1A 2C28A 4WFHA 4JAAA 5JWPA 3N8DA 3ZMVA 3PW5A 2YXYA 2YSUB 3FAVB 3AX6A 2BOCC 4DV5O 3H0GG 4J9OA 1H2SB 1SC5B 1HR0B 3K0GA 2IU0A 1TGOA 1K34A 2V7QG 2MCTA 4X65H 5BPFA 5KFZA 4MTXA 1JX4A 1F51A 1WLEA 5CB4F 2R8IA 2X6BA 3MHHC 2VOBA 1D5AA 4DV1B 2W6ZA 5DM6V 1N33B 3GIJA 4LF6O 4JZ2A 4YY3H 1BXRA 3TINA 3O9OA 4U3JB 1CQIB 4C5AA 1B33N 4X89A 4FLUA 4JI6B 2QTOA 3VQWA 1VQ4V 5BR8O 2CTPA 1MNGA 3AG2C 4GX0A 2ITDC 2Q0OC 4I0XB 4B3MO 4JI0H 2EJ2A 5KFPA 2V5AA 1NTMH 3R9RA 5J2UF 1P4RA 4XDLA 3PJSK 4M9UA 1BE3H 4JYYA 4IRKA 4FZ1A 3T9DA 3A0BZ 1D2DA 4O4LA 5D1OB 3CC7V 1THZA 5E79Z 5LMNO 4NLGA 4RAIA 1GN3A 2ZDQA 2PMZE 5KFRA 5KFNA 1V9PA 2E76B 2XIGA 5DMXA 4O3OA 2XASA 1JOYA 4YB8B 3ABTA 1F4NA 1SQPH 3F5WC 3JASB 2UXBO 2M7WA 4F6EA 2R7LA 4YAJB 1P8LA 3ZCCA 3JARB 3CCVV 4TV8B 3V6HA 3RT3C 5EYPB 2ZR2A 3ETHA 5CBHA 5KFKA 1WSCA 4A3BG 1I7FA 2ZD9A 1GSOA 2B63G 4QWCA 3J81W 4EGJA 3LDCA 1P49A 1QR9A 5L1KA 4LFCB 2VUMG 4QJFB 5IYZF 3MR6A 2ASJA 1NR1A 4J9ZB 3LULA 4X88A 4DV5H 3K5HA 1VQPV 3ZS8C 4Q43A 4JF3A 1H2MA 2NNUA 4MA0A 4TM5A 1HNXO 4GC6A 3D8CA 4O4HF 4NTXA 2CQYA 3KYHC 5JVDA 3OTOO 4A2AA 2YIBA 2NVYA 5B1AC 2ZNIA 3CRMA 4RUEA 1L2ZA 4O83A 2R86A 1H2NA 1M0WA 2DPIA 2CFMA 2W57A 4UFZA 4M7EA 5LYJA 3J7AU 5KG4A 4I9QA 4U7NA 4LC1A 3PW7A 1AROP 5KA5A 2IBKA 4FMTA 1XILA 4I50F 3LDEA 3GLKA 5IY5B 3OEHG 5GONB 3ZRSA 1S0VA 3LSQA 3VQVA 3E83A 1I5YA 5BR8H 2UUBB 1RJRA 5IE9A 4A3LG 1TUBB 2XHBA 4RB0A 4B3MH 1B06A 2NU6B 3KG2A 5KFMA 4H13B 4RNMA 1JR9A 2R87A 1N32B 2XTAA 3T7AA 5BMVB 1ENVA 3JAKA 4DV7O 2OH2A 3B40A 3Q8SB 3OSPA 2HFEC 5LMNH 2OTJV 4F4XA 2QKAA 1M4UA 4X1YA 5DGAA 3P3PA 3K59A 4LF5H 3CCRV 2F43G 2Q7EA 4ME6A 4RQEA 5I5XA 1XL4A 2VQFB 4RNNA 1EFRG 2UXBH 4EBCA 2IJKA 1Q8IA 2MK3A 3PVXA 4K8ZA 2XCLA 1AR5A 5B1BC 1VQ7V 2VR1A 4E4EA 2YWVA 3K3PA 5IP9G 4O7LA 4MV1A 5FR9A 1HR0O 4OPAA 4H44B 4E6NA 2FJZA 1I5XA 4BBSG 2QWQB 1SCUB 4R8CA 3UT5A 4A3IG 5IYDG 5I5TA 4TSFG 3ETDA 4ZOLB 3TK1A 4UUJC 3HKBB 4GCZA 4ABMA 1L0NH 4IGGA 1N36B 1TWCA 3KALA 5E1AC 3OUUA 4DV1O 4CZZA 4KXRA 1UC8A 4DV4B 1T94A 1HNXH 1N33O 5DGBA 3GIQA 4I55B 2Q2UA 2FPPB 3OTOH 4FFOA 3JCUZ 2C2AA 1XNQB 3E8HA 4GX1A 2RDCA 4LF8B 3H3VH 3DC5A 2ODTX 3KZIZ 2FPIB 2FLPA 2XNDG 1AJNA 3CS5A 3F7VC 1N0NA 4GKKB 3AG1B 1VKZA 4WHXA 3BVOA 1AI7A 2Y4UA 1FFTB 4ECXA 1BHBA 5KX5F 1YCIA 3KTMA 4DV6B 3MJFA 3E2EA 3GTLA 4FFBA 2Y0SE 4YXWG 1KP3A 2QWPB 4PZ7A 1K97A 2NU9B 5FD6A 3RV3A 5KFUA 4G3IA 1NKDA 2EILC 1GAXA 3K5IA 1MSDA 3LP8A 1S97A 3PO3G 4DV7H 4IHJA 4FBTA 5KLVH 1KBHA 1IYEA 1W0KG 1FKAO 2Z0AA 4UCRA 3ZHQA 4JI2B 4MVOA 3P32A 5LP6B 2ODMA 1C30A 3ZRWB 1KKCA 3JSNA 4LFCO 5C44G 1VF6A 2ZJTA 4EB6A 3RW0A 3RN4A 1Y74A 2RGRA 4MVMA 4KFMA 5DG7A 5KFFA 1NZ6A 4AILC 3ZJZA 2ZR3A 3AEIA 2OTLV 2R9RB 1LUVA 5FNVA 1KJIA 4ZQIA 2BQUA 1YEWA 2EIYA 5DGIA 4JPRA 3W7UA 5LGUA 2Y48A 1EN5A 3HPLC 4BWSC 4FLZA 3X2QC 3HT5A 4F6RA 2R7MA 3P3NA 1Q86W 2P90A 2C2RA 3RBEA 4RWUA 3JRXA 2R84A 3K9AA 4O7SA 2CH7A 1E4EA 3T5HA 2EINB 4MVZA 4LCUC 4L1KA 3B8MA 4DV1H 3OUFA 3FKIA 4MT8A 4JXUA 4PA4A 4O86A 1NU1H 1N33H 1VQ9V 1U97A 3RGBA 2CGNA 5KG7A 2Y4RA 4FU0A 1ZHSA 1KMIZ 2ILMA 1I94B 1S0MA 3ABKC 5B66Z 1VAJA 2I87A 3GIPA 1R3LC 2ATLA 1CS0A 5CM0A 1S3JA 3CP1A 3HKCB 2JDIG 4BIZA 3RYCB 5J2TA 4PI0A 3SR2C 1O75A 4F4LA 3QG5A 4FM0A 3TXSA 3M8AA 5LOVA 1JFFA 1N32O 1IBMH 2YS6A 3WU2Z 1GTOA 3HOYG 1GO3E 5EBLC 1QQCA 4I9WA 3V6KA 2AW9A 4FBUA 2ZT9B 1B3QA 1SRYA 5KFTA 5KFCA 2OIEA 3SYQA 4HYKA 2O03A 3AG7A 3JYCA 2Q73A 2XCPA 3S24A 3P30A 1O9GA 2AGAA 2W9BB 3J80N 1GSAA 1QCEA 1JJOA 3UQ8A 4GKJB 4H37A 4HQ6A 1XMOB 3K0DA 4TT3G 2WPDG 4ZBMA 3ICXA 4D7SA 1QLNA 3ASNC 1K4CC 3CCQV 2YIAA 4JI5B 3W7WA 3GB8B 4TUYF 3H4DA 4RZQA 3W5OA 4LFCH 2GHYA 2XGQA 5D5PA 5BXZA 1S72V 3U9TA 3KHRA 4LFBB 5KFGA 3N42B 4B3RB 3JATB 1N36O 4TUYA 2Z5UA 5H6QA 4K6NA 2VS0A 2XAFA 1SKVA 3WWJA 3FMAA 4GC7A 2CNQA 3OTFA 5DEDA 1XNQO 3ZMTA 2F4VO 4DW1A 3N43B 2BTQA 3QNEA 5KFQA 4LF8O 1N48A 5IY5C 4ECWA 5LGNA 1XK5A 5I47A 3SDLA 1OJHA 3CCJV 4XX0B 1CKNA 2YYAA 4ED1A 1V51A 3IJ4A 3FX7A 4CS2A 3T5KA 4UV9A 2V4RA 3BQ0A 5KFWA 1HW7A 1SESA 5GTIZ 2W7PA 1OCOB 4XYMB 3PW0A 2R70A 2AZ0A 5IYBO 4I7HA 1I6UA 2FK3A 3W7TA 4DV6O 1GGOA 2IH3C 4O7ZA 4HR7A 2Y69C 3OR6C 1M57C 1MA1A 3ZEDA 4NVPA 1Z5WA 1KU9A 4QWEA 3CJHA 5JQGF 2RCVA 3T1CA 1AVMA 3RYHA 1ZLZA 4MVUA 4PDVA 3U54A 5A2QN 2W6IG 1VQ6V 3G8CA 4GT1A 5EZYB 5IJ9A 3FYEB 4UCOA 2CNUA 4ECTA 2E3CA 5JQGA 4JI2O 2X5RA 2WAMA 4OX9O 1FFXB 1YVWA 1GO3F 3K79A 3K08A 3E5NA 4A3FG 2FE3A 2LQTA 1XUQA 3DXRB 3GILA 4O2BA 2PF4E 2IP4A 2Q2TA 3AK2A 3SGIA 2W6QA 4JYBA 1VBGA 2DLNA 3WB0A 1KJ9A 3UFXB 5KT2A 4QWDA 2E2IA 3CMEV 3JZ6A 1XQ8A 4CC6A 2YZGA 3PW4A 5KAIZ 4O4JA 2ZDHA 4FLXA 2HVKC 2KG7B 1OCCC 1BQ0A 4TQRA 3BA8A 2N04A 4XDKA 1XNRH 4X1IB 1I1MA 1CPYA 4I4TA 4IIJA 4DK0A 2DAAA 2R8JA 2B1IA 2RN9A 1OBDA 1IBLB 1GH6A 4HNUA 4NB5A 5JH7F 2F4VH 5B3SB 1Z2GA 4CH5A 5JQWA 2FKLA 1JA8A 2EJRA 3AG1C 5KUKA 5GTHZ 3NXSA 2L6LA 5IYBG 2R8HA 1IURA 3ZHVA 1BHAA 1BGYH 1UNNC 2YUAA 4FFPA 5J9PC 2BE3A 1JIHA 4O4IA 5KHHA 1HNZB 1X9NA 1GN4A 5L3GA 3G6EV 2HG5C 1IOVA 2DYRB 3WNZA 3DTUB 1EZ1A 1I7LA 3TJTA 2COGA 5C1OA 4DV6H 4A3EG 1YSCA 3K04A 4ZHQF 3E8FA 1OV9A 3CCSV 3K9SA 4WF9V 3VOUA 4BAYA 3STLC 2P22C 2OWOA 1VS0A 5L9XA 4DV2B 5EWGA 5LP6C 2UUCB 4Z1VA 4GKJO 3V4SA 5L1JA 5LHGA 1XMOO 2P06A 5CA0A 5LL6b 4F50A 3U0GA 4DUZB 5LMUB 4O4LB 4JI2H 2EX3A 2DQ3A 4J9YB 5BWVA 4BXXG 1BCCH 4JI5O 2JIZG 2QKCA 4OX9H 3HR0A 1Y66A 5FD5A 3RV4A 2E5LB 4CHIA 3VBBA 1AI4A 2UU9B 2ASLA 3UYYA 4CMDA 2WLLA 1VP7A 1I08A 4B3RO 2C2DA 3HOUG 4RAZA 2QWNB 2PUSA 3OMNB 4IRCA 2PGGA 1QU7A 3VQXA 2R8KA 3ABLB 1KJJA 4PWQA 5KFEA 1QVGU 1RPRA 3T4DA 4FFKA 2LFSA 4MV6A 2QM7A 2JS3A 2Q5ZA 4O2AA 1VQ5V 1S0OA 2PBZA 3BFRA 3JAMN 5KHJA 2Y0PA 4O7NA 3VQYA 2W0XA 3L71H 1R6KA 2R82A 3Q2OA 3T1YH 4P9OA 4MV9A 3OUSA 3HOZG 1C3OA 1BS3A 3ORQA 5JVDB 3H0GA 4DUYB 3N27A 3BQ1A 4G28B 2COIA 3UZBA 5FPRA 5C5JA 2J6SA 5HFMA 1RK5A 2HR3A 3ETQA 1XL6A 3CSXA 4ECYA 2CKZB 2G38A 3I12A 4QPKA 3IN5A 1J5EH 5LYJB 2X0LA 5LA6B 4MVRA 4BIUA 5KFOA 2OCHA 1HR0H 4ASUG 5KFVA 1K1SA 2QSAA 3KHGA 2DMXA 4TV9B 1TA8A 4K0KB 5KG0A 2EIJC 2FPGB 3FB6C 3GV7B 2VPSA 2C2EA 2V58A 2CZGA 1PL0A 2LFRA 1NTKH 1S9FA 3N2GA 4CS4A 2Q68A 1WJZA 1ULZA 2AHZA 3LSUA 4GKJH 5I5YA 1J95A 3G6YA 2P5OA 2N74A 1NH2D 3QTCA 3WO0A 1Y1WG 4ED0A 4NKGB 4CBCA 5KG5A 1M6VA 2EILB 2OIGA 2UXNA 2JEGA 4BR6A 3ABMC 1S77D 3O65A 4X1YB 3H1LH 3K3WA 2VQEH 1IOWA 1VIBA 3OSNA 4AI8A 4LBEC 3FB5C 3HOVG 4IZOA 4CH4A 2VQDA 3RFCA 1DV1A 3RB3A 3CCEV 3K5NA 5CA1F 5F2VO 2DJVA 3STZC 1AI5A 3T9CA 1IBLO 3DTGA 2ZDIC 3CEBA 1TWHA 1KT8A 3UT5B 2DOSA 2V4QA 5CA1A 1DIKA 3L9DA 4JI8H 4GX2A 4QIWE 2Q7GA 1EN4A 1OCOC 4MTFA 4LF9B 4WFBV 4KHPB 5DQHA 5CB4A 5DGHA 2B63A 5C8YF 5E25A 3X2QB 3T5JA 2VUMA 4IR1A 2EULA 4DR6H 3QFFA 2F1MA 4FS1A 4FFNA 1SQQH 4JYAH 2PTMA 1G4YB 1HNZO 3MHSC 4GZRB 1QLEC 3OW2U 1QVFU 2LGQA 1K3EA 2D3OW 3HB9A 1RK6A 5TISZ 1EZVH 3PN1A 2I80A 2HVRA 3AG3B 4R7RA 3JD0A 1RP3B 2ZINA 3E89A 2W6JG 2OLSA 1IBKB 2JEXA 3ABKB 4U7OA 4CC5A 4DR3B 1EUDB 5LXTF 1FXHA 1EKPA 1NH2B 3CXCU 4DV2O 3N2KA 4C7UA 2UUCO 3GV8B 1XMQO 4X66B 4J9RA 5DECA 1RJPA 3EPIA 4NYKA 5J2UA 2HGWA 1M56C 1G6UA 4J11A 4ED2A 5LMUO 1F7YA 4HZ3A 1EKFA 5KG2A 1AP6A 4JI4O 4DR1B 2R7ZG 2E75B 4FFBB 3ZRXA 4PELA 2UU9O 4MV3A 3T9AA 1R3IC 3THOA 2W6OA 4RCNA 3GV5B 3W7SA 4NXMH 1A0IA 1WRVA 3K03A 4GYCB 1YJ9V 1Q7YW 2W6NA 1JDBB 1PPJH 4Q8EA 1QHTA 2HJFC 4IHJB 2PYJA 3ZMSA 2FP4B 2ZE8A 5DLGA 3CRQA 2CTQA 2UXCB 4HN2A 3J81N 3GWOA 2HVSA 4DR2B 5IWAB 3RYFA 2WLIA 4EB6B 3ASNB 5F9LA 4DR4B 5B3SC 5IYZA 1N34B 1H2KA 3C0FB 2JEFA 2JJ2G 5CBGA 2WB1A 5FNVB 1IBLH 4K8XA 4F4WA 3OE7G 4RZRA 1XBLA 3RBDA 4F4ZA 1IYDA 4O4HA 4DUYO 2IA6A 5CAEB 1FJGB 4F6RB 5KFHA 2EIKB 4WBNF 3FKSG 5DQIA 5EDWA 1BT8A 2RMKB 2DYRC 1NQTA 4IYHA 2CH7B 1E4EB 3CPWU 4LMYA 3RF2A 1UFIA 3T9EA 1A9XA 1NT2B 1G1XB 4WD3A 4LF6H 5EWEA 4QIWF 5JUMA 4WBNA 1E1QG 5HBRB 1Y76A 4JI7B 5KFLA 3JZFA 3JZIA 2EJ0A 4BW5A 2P0AA 3HBLA 4F4YA 1KD1W 1RPOA 4I50A 4E4TA 4K0KO 1I2KA 1SERA 4FGRA 3CX5F 1KP2A 1K33A 2YS8A 4FIPC 1F23A 2SCUB 4CKCA 1R3JC 2IJJA 5J2TB 4YIPA 3MDSA 1MZEA 2P6JA 3L4KA 2BCCH 2HJWA 1E4GT 3TQ1A 2NU7B 2UUCH 4Z2WA 1B6SA 2Y69B 4J7KA 2GQSA 5LOVB 1M57B 1JFFB 1KUTA 1AN7A 1XMQH 3GJXB 3OM3B 3E35A 4Q6GA 4O3QA 1V55B 5DAAA 1AUVA 2YICA 4JI4H 2YEVA 1S5JA 4XZ3B 5H2FZ 3TGUH 2HVQA 3ABLC 4YR0A 3T54A 4O7YA 3PW2A 4AYBE 3SJQC 3Q4HA 5EK0A 1M5IA 5I60A 2GTAA 2ABJA 1P16A 3KAJA 5F9NA 2W6PA 1FS0G 5L3CA 2PMZA 2JVDA 4IWXA 3OHAA 5ITZA 3E22A 3E8GA 4NZOA 2Q6AA 1YIJV 2DWDC 2ADPA 2HJDA 4YR3A 4FLYA 4ECRA 2XT9A 3GTMA 3ZHTA 4LF9O 4FLVA 4KHPO 2F93B 2K1EA 1OCCB 3JALA 2QJ1A 5B1OA 5KT3A 3M4IA 1URFA 2QWRB 1HNWB 3OGCC 4JV5B 3FB7C 4FFRA 3W1GA 2QYZA 5KFIA 1AR4A 4O7TA 3NR7A 4JI6O 2R92A 3FB8C 3OD4A 4DUYH 4DR5B 2BTQB 3GTPA 2ASDA 2E74B 4P2ZA 1CKNB 3CB2A 3S3XA 3WG7C 1IBKO 4DR3O 4Q44A 4LF4B 3OUZA 3WB2A 5HV6A 2ZCEA 5I5VA 3CE2A 2NN4A 5HFLA 3BABA 2JGDA 4X66O 2FK1A 1IVSA 1QR8A 1L0LH 3RUPA 2ZIOA 4EFBA 1MSWD 4YJ3B 4PZ8A 4DR1O 1G8MA 5D8DA 1GN2A 5KX5A 1ET0A 1E1RG 3IC7A 2QR4A 1H8EG 1JQ0A 4A3KG 5KHKA 3CJHB 4MSWC 5EIBC 1PP9H 3VA7A 1UC9A 5KFJA 3RYHB 2Z02A 3GTJA 3JCZA 4PA3A 2GV9A 2EBOA 4CKBA 4DV3B 5IJ9B 1N8RW 4EBDA 3ZN1A 3CSWA 2WLNA 4TV8F 1B04A 2JEUA 1L1FA 3RTXA 1MG1A 3L70H 3R5FA 3JARA 4ECSA 2R92G 1ZAUA 1HWYA 4DR4O 4O2BB 4FM2A 1N34O 4HNAB 4DV0B 3U55A 1FYJA 1SQBH 3H1KH 3AK3A 1R3KC 4CS3A 5LL6Y 4J9SA 4FJCC 2XAGA 1T5EA 4O4JB 4MVSA 1FJGO 2R93G 3CD6V 1W96A 1QBZA 3RYIB 4LF9H 4U7CA 2V9WA 4KHPH 1YTFD 2DWEC 1Q6UA 4DRXA 1W93A 5L3DA 2W9CA 2YI9A 2WLKA 3AG3C 4I4TB 4IIJB 4PI2A 2JA6G 1WH2A 2GDSA 4JI7O 1VBHA 4Q45A 3CCLV 2AGPA 5KFDA 3DSQA 4CKEA 4JI6H 3SJAC 3M9MB 2UUBO 2LP7A 3A2FA 1I1LA 2F66C 4EYIB 5GONF 5KMGA 3LNNA 2FK2A 2M6YA 4B7KA 4J7ZA 2BTOA 3H1IH 4FK5C 2WA4A 3MD0A 2UUAB 1K1QA 1KECA 5BWUA 3PR4A 4A3GG 1W0JG 3AG4B 4A5UB 4X66H 1VF5B 4O4IB 1M0TA 3BA9A 5KUMA 1TUBA 2AXTZ 3I56V 2UVVA 5BMVF 3ZN0A 4EQ5A 1E4FT 2FB5A 2YW2A 3VPCA 4G27B 2ZM6B 3L4JA 4A3MG 4Q8FA 3CC4V 1NJIW 1KYOF 2VQFO 4PA9A 3MR3A 1HDJA 4ED3A 4U3FH 2EIJB 1Y6XA 1TVKA 4UCTA 5BMVA 4LF7B 4ZI7B 1FXKA 3KAKA 3BG5A 4PDBA 1Q5OA 1WA8A 2WAQE 1WPBA 2AGOA 1GN6A 1FKAH 1WP7A 1VF6C 1JVMA 4GX5A 4DR7B 5CA0B 2Y0SA 5EWFA 5C93A 2X7RB 4LP8A 5L3FA 4WFFA 4R6ZA 4JAUA 3B09A 4YAKB 4NZMA 2R9IA 4EKWA 1YTFB 1ZL8A 1SFOA 4J41A 3QZ8A 3B2EE 4DR4H 2HP8A 1Q82W 4O7RA 2WLLB 3ABMB 4ZOLF 4E2LA 4DV4O 3RB0A 2EIKC 3JAWB 1HNWO 4DW0A 4JV5O 4RU9A 4JGSA 3ZRVA 5DN6G 1Q6IA 4ZOLA 3FFQA 1MABG 2VRZA 4D6TH 1GYFA 1WCMG 4DR5O 4I55F 4JI3B 5KFYA 1B6RA 2WLMA 4FM1A 4NTWA 1FAFA 1LUWA 4O2AB 2QA4V 1ZETA 4X1KA 2QB5A 3GVMA 1K9MW 3WO1A 1EYZA 2FTKA 4GKKO 4R8UA 1BQZA 3HKEA 3IG0A 2CGOA 3K58A 2FYUH 1RYSA 4FM9A 2YZNA 1DF4A 2UUBH 5JCOA 3GDEA 5BWWA 4YJ2F 3QQMA 4PBCA 2A06H 3K5MA 4BBRG 4DL3A 1K4DC 3SI8A 1K83A 4DL7A 1QLEB 2YS7A 1V55C 2XC9A 1ZTEA 1YXBA 1FPOA 3G67A 3ZMUA 4B08A 4YJ2A 2A7WA 1N32H 2H8PC 4O7WA 2ITCC 4A3CG 2QK4A 4LH6A 4XDJA 3OGIB 1NI8A 1BMFG 3F8NA 1I0HA 1JCHA 3UM7A 3SJBC 4BY1G 4DV3O 3R66A 4M0JA 2JA5A 4LSAA 3DF7A 3G8DA 1OWTA 2VQFH 4LH7A 2D2CB 1M56B 4QE7A 2GPSA 2CW7A 1BSMA 4UXNA 2DYSC 2WDTA 2FLNA 3N2GB 4NTYA 1NS1A 1M1KW 5LP6F 5A2QW 1DF5A 2KSWA 1JLLB 2OCCC 3OT7A 3OEEG 1JPXA 5KA6A 1OZ0A 1TWAA 2R7NA 1N36H 2FMLA 1KBLA 5KT6A 2XGPA 3ZHSA 4K3AA 4LWSA 2UVRA 2NUAB 1WP8A 4DV4H 1I50A 4DL2A 1KTAA 2XCAA 4RB1A 1HNWH 4RAYA 2WA3A 4QWBA 3DAAA 3HKDA 1XNQH 4DL4A 1RFYA 2Q8VA 2A9HA 3KCXA 1I94O 3HOXG 4LF8H 3G80A 3MR2A 1RM1B 3TEKA 4JI1B 3ZIAG 3RIZA 2HVJC 2GPWA 2BOBC 5JH7A 3G6VA 4MTOA 2N05A 5DG8A 3Q8QB 5CB4B 2K9PA 3ZHRA 1AILA 4XYLB 4P30A 2QEXV 4GKKH 5FL7G 2JA5G 2UUAO 2JEJA 1VEWA 3SNOA 2XOKG 2A1HA 1IZ3A 5D5QA 4DK1A 4QSHA 4Q20A 2W8LA 2CUGA 4U6PA 5JVLA 2GSMB 2YIBD 3RYCA 2R72A 4J7JA 1LR1A 2GUZA 1S68A 3HKZE 3RAXA 2JA7G 3B8NA 3R5HA 2EZOA 4ZHQA 4LF7O 1A48A 2AHYA 2QGNA 1Z2PX 3RWRD 4JUZA 2W70A 2IMWP 3UO3A 2O57A 5EC1C 2IBZH 5BR8B 4DR7O 5J2UB 2Q9LA 5IYCO 4DV3H 4MTDA 5JJJB 4B3MB 3NUAA 1ROPA 1K8AW 1JXLA 4I7ZB 2HGSA 4GLXA 5FLXW 4WCEV 4LFBO 5CA3A 1KC8W 2ZGIA 4MVQA 2UXXA 3VMMA 3GIKA 3JD2A 3KHHA 3S3WA 3E86A 3SYCA 3N6XA 5AG2A 1GRJA 5FLMG 4LF5B 3L2PA 4EYHB 1N56A 2EJ3A 5IP7G 5JJNB 5EIBD 2Z3YA 1V4YA 1Y1WA 2YCHA 4JI3O 3NBZB 3B4SA 2HG8A 2F23A 3RYFB 2ALZA 2WLIB 2DZDA 4IRDA 5IYZB 3MWMA 1VQMV 3N41B 4O81A 2DQ0A 2OYQA 1F4MA 4DXWA 3GTGA 4EBEA 1COWG 4BW9A 1I94H 4KL1A 3CMAV 4UB6Z 3UCSC 2FLLA 1GSHA 2YZMA 1ZQ7A 4O4HB 2EZPA 3GTOA 3AG4C 1D5NA 5K1PA 2PI4A 3LNMB 1KUQA 3TIIA 2XUMA 2FMAA 1CE8A 5KFXA 5IJ0A 1A32A 1SZTA 4WBNB 4YHHB 3C90A 1Y76B 3OTOB 5C4XG 1OCZB 4N23A 4NYEA 3WG7B 3L72H 4B7EA 1TAEA 2NR5A 5KAFZ 3APQA 4I50B 4A3JG 2ZE7A 2Y4TA 4FLTA 3IAYA 5IT9W 4QE9A 1K92A 5EZYF 3H1JH 4OXSA 1VQKV 3GB7C 3HB3B 3JD1A 4J42A 4J9QA 2RF4A 3CWBH 3N40P 1XMOH 2P67A 5L1LA 5EZYA 3SPJA 3JAKB 3BAAA 2WYOA 4DL5A 3TQTA 3RGXA 2HHFA 4JI5H 4L8JA 2NLJC 4MA5A 5KG1A 5CBFA 2CAZC 2CTWA 3C3SA 4PJ0Z 3CRAA 4EEYA 2YEVB 4FE2A 3RAQA 2QWOB 3WWIA 4LFBH 2DWCA 4B3RH 2IU3A 5C1PA 3R65A 1SEIA 5H9CA 2Q7DA 4BWAA 1KEEA 2QM4A 3Q4HB 2R7ZA 1AP5A 3B77A 2COJA 2YL2A 3NGDA 1ZSPA 2HKOA 4EFEA 1PNMA 3SYAA 2KG7A 3L73H 2DIKA 1YI2V 3PR5B 4J9PA 3T1HB 3E22B 2HLDG 3CRCA 3TCUA 5H6RA 1K7DA 1P7GA 4UCVA 2Q7HA 1SA0A 1SF9A 3ETGA 4JI1O 2QM8A 4JI3H 1Q6HA 4X1IA 3TY8A 4MW8A 3SJCC 4WFEA 5H80A 3JALB 4A3DG 4HAMA 3L74H 4RB2C 3MWEA 5C8YA 2XAQA 4LSXA 2ZDGA 3EPGA 1NR7A 3C3TA 4X62B 3BACA 3MWDA 4NZNA 1M93A 4DL6A 2CK3G 4Q4DA 3QF7A 1YHQV 2LW1A 1VQOV 3EYYA 3BJYA 1Q81W 2B5UA 2ATKC 5KT4A 1N4CA 4TOIA 4IL6Z 2PYLA 3BQ2A 1MZFA 4QWAA 4B3TB 3PFFA 1T36A 5LXTA 1SQVH 2W8KA 1R6TA 2JGDB 4JTAB 4TQDA 4DUZO 4JZGA 2R8GA 2M05A 3CEIA 1KKDA 4MV4A 3LQSA 2BSKA 2ZXWB 1UJWB 2JGUA 2E5LO 5BYBA 1H2GA 3G6BA 4APMA 3OR7C 5KX5B 4O4LF 2VA3A 3GWKC 1VQNV 1IBMB 3M7MX 3T9FA 3R23A 3MFIA 4LNUA 3N44B 1SQFA 4X20A 5K2MA 4MW3A 2BR0A 2Q4PA 1OHHG 4IAJA 5DLFA 4LF5O 5BWTA 2VWKA 4O3RA 1QNMA 5KFAA 3NBYB 4J10A 2YDEA 1H2LA 1Y74B 3T5LA 2RNBA 4MS2A 1RM1C 5D1PA 4PDMA 1P84F 3KCYA 4PHZA 1ORQC 5KHIA 3RBZA 4DO2A 1RSOA 1XOUA 2YC0A 2WWWA 4N21A 3M99B 4UB8Z 4UUGA 4JI1H 1E79G 1SZXA 3OFNG 1W59A 2GTSA 2HIVA 5JVDF 2P4VA 1S10A 4RUFA 3A0RA 1Q90D 4DRXB 1WN7A 4J0MA 4G2KA 2IM9A 2V4DA 5IYDO 2W9CB 3KXYT 1HNZH 4ECUA 3D3IA 4YHHO 4UVAA 3A8TA 4FPPA 5LYJF 4UCUA 3UZOA 4QIWA 5LA6F 3RVZA 1IX9A 1H8HG 2JK5C 3ORRA 5BWXA 4ED8A 2IH1C 4YP3A 5KMGB 3LUTB 4TV9F 5CR5A 5LA6A 4GLWA 3MR5A 3KREA 1SETA 1PNKA 4DV2H 2HIXA 2H94A
chains in the Genus database with same CATH topology
3SJAC 4TV9A 4DV7B 3A2FA 2F66C 5LMUH 4DUZH 5KMGA 3LNNA 4AHCA 1XNRH 4X1IB 4I4TA 4IIJA 4DK0A 2E5LH 4CH6A 2BTOA 3MAQA 2UU9H 5ITZB 2KKWA 1X4TA 1IBLB 4NXNH 3K5OA 2UUAB 2F4VH 4CH5A 2UXDB 4X66H 4O4IB 1XI1A 1M0TA 3BA9A 1TVKB 1TUBA 1H2SB 4EQ5A 1E4FT 1HR0B 2ZM6B 3L4JA 2MCTA 1TGOA 4X65H 4PZ6A 4TQFA 4O4IA 5KHHA 1HNZB 1X9NA 5BMVA 4LF7B 1TVKA 4UCTA 4ZI7B 4FVMA 2ZIMA 3KAKA 4PDBA 1Q5OA 3CVZA 1WPBA 1FKAH 4TUYB 4DV6H 2VOBA 4DR7B 1D5AA 5CA0B 4DV1B 3BPZA 1N33B 1L8DA 4YY3H 2P22C 2OWOA 1VS0A 4U3JB 4DV2B 3K3VA 4FLUA 5LP6C 2UUCB 4JI6B 3B2EE 3VQWA 4DR4H 1BJTA 5CA0A 5LL6b 4DUZB 5LMUB 4O4LB 4JI2H 1XNRB 2HHHB 2EX3A 4JI0H 3JAWB 4OX9H 5FD5A 2E5LB 4U3JA 4RB3C 4ZOLA 4X1KB 3FFQA 2UU9B 5KHGA 4YHHH 3HKEB 1GYFA 3RR5A 2F4VB 2WE6A 4LFAB 4K0KH 4X64B 4RAZA 4O4LA 4JI3B 5D1OB 4FM1A 2PUSA 3BRCA 4O2AB 1XHXA 2PGGA 3VQXA 4X1KA 1Q43A 1V9PA 2XIGA 3HKEA 3IG0A 3K58A 2PY5A 3JASB 4FM9A 4YJ2B 5D1OA 1P8LA 2UUBH 5JCOA 3JARB 4O2AA 3GDEA 4TV8B 5EYPB 5KHJA 3K5MA 1I7FA 5JQGB 3VQYA 2F95B 1Q3EA 1Z2OX 3JASA 3J81W 3T1YH 4MV9A 3QWUA 1N32H 4YJ2A 4B08A 1P49A 4LFCB 5JVDB 4TV8A 1VF7A 4DUYB 1BGWA 5FPRA 5EYPA 4LH6A 4DV5H 3F8NA 2Q0AA 3ETQA 1Z5VA 3ZS8C 3SJBC 3CSXA 2CW8A 4LSAA 3DF7A 1J5EH 5LYJB 3KYHC 4OX9B 2VQFH 5LA6B 4LH7A 1MZBA 5JVDA 3T1HH 4A2AA 2YIBA 2JS5A 2CW7A 2WDTA 3N2GB 2ZNIA 5A2QW 1L2ZA 2KSWA 3TY9A 4TV9B 1TA8A 4K0KB 1M0WA 2CFMA 2W57A 4UFZA 4M7EA 5LYJA 2VPSA 4I9QA 2RJZA 1ZHQA 3N2GA 4CS4A 5GONB 3HKDB 3VQVA 4GKJH 1N36H 3RFRA 4X62H 4B3SB 3K57A 2P5OA 5BR8H 2UUBB 2R9AA 3QTCA 4DV4H 1TUBB 5JH7B 2XHBA 4RB0A 4B3MH 4RB1A 1IBKH 4DR3H 1HNWH 4RAYA 5GONA 3WB1A 3HKDA 1XNQH 4X1YB 3HXLA 2VQEH 3T1YB 4B3TH 4LF8H 1N32B 5BMVB 3JAKA 4JI1B 3RIZA 5JH7A 4CH4A 5LMNH 4DR1H 3K5NA 4AQYB 1M4UA 5CB4B 4X1YA 4LF5H 3K59A 4GKKH 1J5EB 5K1XA 2Q7EA 2VQFB 3UT5B 2UXBH 5D5QA 5CA1A 4DK1A 1Q8IA 4JI8H 4ZHQB 4K8ZA 2Q7GA 4LF9B 4KHPB 1CKMA 2YIBD 5CB4A 3RYCA 2R72A 4LR3A 4E6NA 3CHXA 2UXCH 1S68A 3UT5A 3J80W 4DR6H 2F1MA 4JYAH 4DR2H 2PTMA 5IWAH 4ZOLB 1XHZA 3W1BA 4ZHQA 3HKBB 3RWRD 1Z2PX 1N34H 1N36B 2HVRA 3PN1A 3KALA 5BR8B 4MV7A 4R7RA 5J2UB 4DV3H 4MTDA 2ZINA 2YI8A 5JJJB 4DV4B 1HNXH 4B3MB 4ZIBA 4ETSA 4I55B 1IBKB 4DR3B 4CC5A 2Q2UA 4NXNB 4GLXA 2HGSA 5FLXW 3OTOH 3HKBA 1XNQB 2VQEB 3N2KA 1FJGH 4LF8B 4X66B 3J7AK 5J2UA 1G6UA 5EOYA 4I55A 4DR1B 3N6XA 4FFBB 4JI7H 4X65B 4LF5B 3L2PA 5FPOA 4GKKB 3THOA 4NXMH 1JMKC 1A0IA 5JJNB 5EIBD 4GYCB 2YCHA 3NBZB 4JI8B 3RYFB 3U0ZA 1QHTA 4IHJB 4DV6B 2PYJA 4FFBA 5IYZB 4PZ7A 3MWMA 3N41B 2UXCB 2OYQA 5FD6A 4YY3B 4DR6B 2HVSA 4BW9A 4JYAB 1I94H 4KL1A 2ZNJA 4DR2B 5IWAB 3RYFA 5IJ0B 4MTEA 4EB6B 2HEPA 4IHJA 4DV7H 4DR4B 4O4HB 4YJ3A 5IYZA 1N34B 3C0FB 4JI2B 4UCRA 5K1PA 4JI0B 5FNVB 5LP6B 1IBLH 4K8XA 1SQGA 3JSNA 5IJ0A 2ZJTA 4EB6A 4WBNB 4YHHB 3OTOB 2UXDH 4HBNA 4O4HA 2RGRA 1FJGB 4F6RB 1DGSA 1TAEA 4I50B 4AILC 3RF2A 5FNVA 5LP6A 4LMYA 1HR0H 1YEWA 4FLTA 3IAYA 1NT2B 4LF6H 5IT9W 4WBNA 4JI7B 4BWSC 4FLZA 4F6RA 2VUGA 4NXMB 1XMOH 3N40P 5JJEB 4I50A 5EZYA 3JAKB 3BAAA 2WYOA 4HNAA 1Z2NX 3RGXA 4DV1H 4JI5H 4JV5H 4L8JA 4EEQA 1O9HA 1N33H 2CAZC 3RGBA 5J2TB 3L4KA 1E4GT 4LFBH 1ZHSA 1KMIZ 4DR5H 2UUCH 4B3RH 1AN7A 1I94B 5LOVB 5DISC 1JFFB 5CA1B 1SEIA 1XMQH 3GJXB 3RYIA 4Q6GA 1SA0B 4BWAA 4DV5B 2QM4A 2HHHH 3HKCB 3RYCB 5J2TA 4JI4H 4LF4H 5JCOC 1S5JA 4EFEA 4PI0A 3SR2C 1O75A 3QG5A 4FM0A 2HVQA 5LOVA 3T1HB 1JFFA 3E22B 1IBMH 4UCVA 5C8YB 2Q7HA 1SA0A 1WNSA 4X64H 4LFAH 4JI3H 4FLWA 1M5IA 4X1IA 3HKCA 1QQCA 2RGVA 1P16A 3TY8A 3KAJA 3SJCC 2JVDA 2PZSA 2O03A 5ITZA 3JALB 2VWJA 3E22A 4LF6B 3S24A 1O9GA 4RB2C 5C8YA 4LSXA 1JJOA 3UQ8A 4GKJB 3N2KB 4FLYA 2YXLA 4X62B 1XMOB 4FLVA 1M93A 3ICXA 2F93B 5LXTB 3QF7A 3JALA 4D7SA 2QJ1A 3EYYA 3M4IA 2YIAA 4JI5B 1HNWB 4JV5B 3GB8B 4TOIA 2PYLA 3W1GA 4RZQA 3BHPA 3W5OA 4LFCH 4B3TB 5D5PA 4ZI7A 4DUYH 4LFBB 1XDNA 4Q0YA 4DR5B 3N42B 5LXTA 3JATB 4B3RB 2BTQB 4TUYA 4TQDA 1XMQB 4DV0H 4LNUB 5LMNB 3U10A 4X20B 2JGUA 1CKNB 3CB2A 1SKVA 4JI4B 4LF4B 3FMAA 3WB2A 4APMA 3NC0B 3OTFA 5KX5B 3VNNA 2ZCEA 3BABA 3N43B 3JATA 2BTQA 2UXBB 1IBMB 3M7MX 4LNUA 3N44B 1SQFA 2ZIOA 4EFBA 4X20A 1XK5A 4YJ3B 4PZ8A 1CKNA 3JAWA 4D7TA 4CS2A 5KX5A 4IAJA 1HW7A 2VWKA 5KHKA 3NBYB 2R70A 5EIBC 4I7HA 4B3SH 1I6UA 3RYHB 3JAMW 3LMLA 2GV9A 5D1PA 4PHZA 5IJ9B 4DV3B 5KHIA 2RQ6A 3ZEDA 1HNXB 3K5LA 4NVPA 1Z5WA 1KU9A 1B04A 4CH3A 2UUAH 1RSOA 4A2BA 3TY5A 3RTXA 3RYHA 1FVIA 3JARA 4JI1H 1ZAUA 3H20A 4O2BB 4DRFA 5EZYB 4FM2A 5IJ9A 1S03G 4UCOA 2HIVA 2E3CA 5JQGA 4HNAB 2ZM6H 4AQYH 4DV0B 4UCSA 1FFXB 4CS3A 4DRXB 1WN7A 4J0MA 2IM9A 2V4DA 3KXYT 1HNZH 4LF7H 2FE3A 1T5EA 4O4JB 1CKOA 4O2BA 2Q2TA 3SGIA 3U11A 4UCUA 3WB0A 3RYIB 4LF9H 4DR7H 4KHPH 1FFXA 3RJ0A 4DRXA 5KMGB 1XQ8A 4CC6A 2YI9A 3RGZA 4I4TB 4IIJB 4PI2A 5LA6A 1WH2A 4O4JA 4FLXA 4DV2H 2HIXA 3DSQA 4JI6H 3JSLA 3BA8A 1SYXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 B;  3S24 A;  4DR1 B;  4DV7 B;  4X65 B;  4LF5 B;  3UQ8 A;  4GKJ B;  3L2P A;  5FPO A;  4GKK B;  4X62 B;  1XMO B;  1A0I A;  4OX9 B;  3KYH C;  4LH7 A;  3NBZ B;  4JI8 B;  1IBL B;  1HNW B;  4JI5 B;  4DV6 B;  2UUA B;  4JV5 B;  3GB8 B;  3TY9 A;  4K0K B;  1TA8 A;  4TOI A;  2UXD B;  3W1G A;  2CFM A;  4PZ7 A;  3W5O A;  4UFZ A;  4B3T B;  2UXC B;  3BA9 A;  4LFB B;  4YY3 B;  1XDN A;  4DR6 B;  4DR5 B;  2HVS A;  4B3R B;  4JYA B;  4DR2 B;  1XMQ B;  5IWA B;  4EQ5 A;  1HR0 B;  2ZM6 B;  5LMN B;  4DR4 B;  4PZ6 A;  1N34 B;  1CKN B;  1HNZ B;  4B3S B;  4JI4 B;  4LF4 B;  4JI2 B;  4UCR A;  2UUB B;  4UCT A;  4LF7 B;  4JI0 B;  3NC0 B;  3VNN A;  3BAB A;  1X9N A;  2UXB B;  1IBM B;  3JSN A;  4DR7 B;  4YHH B;  3OTO B;  4DV1 B;  4EFB A;  1XK5 A;  4PZ8 A;  3T1Y B;  1FJG B;  1CKN A;  1N33 B;  1N32 B;  1DGS A;  1TAE A;  2OWO A;  4JI1 B;  1VS0 A;  4DV2 B;  2UUC B;  4JI6 B;  4AQY B;  3NBY B;  4JI7 B;  4DUZ B;  5LMU B;  1XNR B;  2HHH B;  2VUG A;  1J5E B;  4NXM B;  5D1P A;  2VQF B;  2E5L B;  3BAA A;  4DV3 B;  1HNX B;  2UU9 B;  1B04 A;  3RR5 A;  2F4V B;  4LF9 B;  4LFA B;  4KHP B;  4EEQ A;  1CKM A;  4X64 B;  3RTX A;  3TY5 A;  4JI3 B;  5D1O B;  1FVI A;  4E6N A;  1ZAU A;  1S68 A;  4DRF A;  1I94 B;  4UCO A;  5DIS C;  2HIV A;  3W1B A;  3GJX B;  1V9P A;  4DV0 B;  4UCS A;  4DV5 B;  1N36 B;  2HVR A;  3PN1 A;  5D1O A;  5BR8 B;  1P8L A;  4EFE A;  1CKO A;  3GDE A;  4DV4 B;  2Q2T A;  2HVQ A;  3SGI A;  4UCU A;  4B3M B;  3T1H B;  1IBK B;  4DR3 B;  4CC5 A;  2Q2U A;  4UCV A;  4NXN B;  4GLX A;  1XNQ B;  2VQE B;  4CC6 A;  3QWU A;  4LF8 B;  1P16 A;  4X66 B;  3TY8 A;  4LFC B;  4DUY B;  2HIX A;  5FPR A;  3JSL A;  3BA8 A;  4LH6 A; 
#chains in the Genus database with same CATH topology
 4JTC B;  1TUE B;  2QTS A;  1K5Q A;  1VQL V;  2EIM B;  4TV9 A;  4DUZ H;  5LMU H;  2ZE5 A;  3T99 A;  4JAS A;  1JDE A;  3MFH A;  2X6A A;  2E5L H;  4CH6 A;  4WFA V;  3MAQ A;  4OPH A;  2UU9 H;  3CCU V;  2FKX A;  2BQ3 A;  3K5O A;  1SQX H;  5BWR A;  2UXD B;  3SPI A;  2KQX A;  2VA2 A;  1XI1 A;  2WLJ A;  1IXM A;  3OHB A;  1TVK B;  1FXK B;  3I4M G;  4XBF A;  5CN0 A;  4EGQ A;  1B6Q A;  1WA8 B;  1AUX A;  4RO2 A;  3TIG A;  5KT7 A;  2DYS B;  3ZBH A;  4PA7 A;  1EHI A;  2VPQ A;  2GQR A;  4TQF A;  3T1H O;  4PZ6 A;  2OCC B;  3TXQ A;  1DV2 A;  1YJW V;  3FAV A;  2WLH A;  4C2M A;  4FVM A;  4JV1 A;  2QE7 G;  2ZIM A;  2YRX A;  1ZL8 B;  1GM8 A;  1M9N A;  1PL4 A;  4CE5 A;  3CVZ A;  3IFX A;  4TUY B;  3E8B A;  4HNT A;  5H5N A;  3BPZ A;  4P9P A;  1PX2 A;  3ETJ A;  2W71 A;  1L8D A;  2QKS A;  4OGQ B;  1IXB A;  2Z04 A;  3K3V A;  1WPX A;  4QGP A;  4HYO A;  2W7O A;  5CE8 A;  2GBO A;  4X62 O;  1K73 W;  1BJT A;  1V54 B;  5EBW C;  1OCZ C;  4UVC A;  4DLK A;  1XNR B;  2HHH B;  2Q69 A;  1OCR B;  4H0L B;  4C5B A;  1SS3 A;  3CYO A;  2WSS G;  4U3J A;  4RB3 C;  4DYL A;  4X1K B;  2W0F C;  3AK1 A;  4B3T O;  2HGX A;  2R93 A;  5KHG A;  4R8U B;  4YHH H;  3TW7 A;  3AYH B;  5C3E G;  3HKE B;  1EM1 A;  2F4V B;  3RR5 A;  1Y4M A;  2WE6 A;  3W7X A;  4LFA B;  4K0K H;  3T9B A;  4X64 B;  4RUC A;  4I0X A;  3BRC A;  4PD4 F;  4YR2 A;  2YZL A;  1XHX A;  3EXA A;  2JA6 A;  1Q43 A;  5BYA A;  2V1D A;  2PY5 A;  4JV2 A;  2DE0 X;  4YJ2 B;  1IBM O;  5D1O A;  2CDY A;  1Y14 B;  2J6T A;  3Q1K A;  3VOT A;  4W4L A;  1XRE A;  2FB9 A;  3CXH F;  1R1B A;  4FS2 A;  4IT5 A;  5JQG B;  2R6F A;  2F95 B;  1Q3E A;  2UXC O;  1T3N A;  4BY7 G;  1Z2O X;  3JAS A;  3LSS A;  4IHJ F;  4EG0 A;  3QWU A;  1K5S A;  4DR2 O;  2R85 A;  5IWA O;  2Y0I A;  1GM9 A;  3OMI B;  5T14 A;  4TV8 A;  1VF7 A;  1BGW A;  5KT5 A;  5K3W A;  5EYP A;  5EBM C;  2Q0A A;  4R50 A;  5FJ8 G;  2RDI A;  1Z5V A;  3ASO B;  1WAZ A;  4JYC A;  2CW8 A;  4RQF A;  2XAH A;  2I8C A;  3CQZ A;  5L3E A;  4OX9 B;  3H1H H;  4QJF A;  1MZB A;  3T1H H;  2YID A;  1Y67 A;  3G4S V;  1XDC A;  2JS5 A;  1JX9 A;  1JKJ B;  4YIO A;  5L3B A;  4AYB A;  5FNV F;  1BZK A;  1W2B U;  3TY9 A;  4QW9 A;  4Y8V B;  2DN9 A;  4UV8 A;  2DAB A;  4CMF A;  3GTQ A;  2P7T C;  3QVN A;  4I5S A;  4LWS B;  2BQR A;  3OAA G;  1RJQ A;  5DG9 A;  1AB3 A;  2RJZ A;  1ZHQ A;  2AQ4 A;  1GLV A;  1I1K A;  2ZQM A;  1U96 A;  1VMG A;  3QO7 A;  3BCC H;  4O3S A;  1S5H C;  5KKN B;  3F5T A;  3HKD B;  3RB4 A;  1GK9 A;  3RFR A;  4A93 G;  4X62 H;  4B3S B;  3K57 A;  5BPH A;  2DPJ A;  2R9A A;  3RVY A;  2C35 B;  3CC2 V;  5JH7 B;  3WWH A;  2YRW A;  1YF2 A;  2Q67 A;  1S76 D;  5BZB A;  2C00 A;  2W9A A;  3G6X A;  4DR3 H;  1IBK H;  5GON A;  3WB1 A;  3DC6 A;  2ZXW C;  1WCM A;  3BEH A;  3SE7 A;  3HXL A;  3G71 V;  2EJ7 A;  4ZKI A;  3T1Y B;  3GII A;  4B3T H;  5HNE A;  1KQS U;  5KS8 A;  5J2T F;  4J9K A;  3R5X A;  1KC7 A;  1A0G A;  4H33 A;  3FD9 A;  2IJH A;  2GLT A;  1AR1 B;  4DR1 H;  1OBG A;  5LOV F;  4AQY B;  2PVP A;  2DW4 A;  3L75 H;  2HDK A;  2GUZ B;  5K1X A;  1J5E B;  4MTG A;  2UXD O;  1X59 A;  2ZE6 A;  2LW7 A;  4ZHQ B;  2YXH A;  1P7B A;  3SPG A;  2PI5 A;  1CKM A;  1PKX A;  5KG6 A;  3UKM A;  4LR3 A;  2UXC H;  3CHX A;  2XAJ A;  2JJ1 G;  4IWY A;  1VAR A;  3J80 W;  1FXV A;  5LBQ A;  4O3N A;  4DR2 H;  3D36 A;  3T2M A;  3T4Z A;  1XHZ A;  3W1B A;  5IWA H;  2E2H A;  4NR1 A;  1WB8 A;  1WB7 A;  1UPG A;  1I7N A;  3M9N B;  1EKV A;  1N34 H;  4JTD B;  1ZX3 A;  4MV7 A;  3H40 A;  5GW7 A;  4PDL A;  2UVU A;  4X9Q A;  1TWG A;  2YI8 A;  1US6 A;  4ETS A;  1EZJ A;  4ZIB A;  5BY1 A;  2UVW A;  3FKI G;  1CQJ B;  1ZUQ A;  4NXN B;  3HKB A;  3GID A;  3K06 A;  2VQE B;  2X0S A;  1FJG H;  1Y1V A;  3J7A K;  2ETN A;  3AW8 A;  3D3Q A;  5KFS A;  2JA8 G;  2IW5 A;  3ETE A;  5EOY A;  2WTF A;  3GIM A;  2MW2 B;  3ML0 A;  1XNR O;  2HHH O;  4I55 A;  4FZ0 A;  4J9N A;  4LF4 O;  3JD4 A;  1PD3 A;  5DQG A;  3ZX6 A;  4JI7 H;  1NBM G;  4X65 B;  2CNV A;  3U9S A;  1H38 A;  5FPO A;  2J9G A;  4R7C A;  4ED6 A;  1JMK C;  3GQC A;  1KJ8 A;  3PO2 G;  4LFA O;  4X64 O;  4JI8 B;  4W4K A;  3U0Z A;  3SPH A;  3LDD A;  4DAA A;  2EIM C;  4DIM A;  3APO A;  1CXZ B;  4YJ3 F;  4YY3 B;  4DR6 B;  3V6J A;  2FL4 A;  4JYA B;  2ZNJ A;  2W6M A;  2A3Q A;  4GUN A;  5IJ0 B;  4O7V A;  4MTE A;  3PZP A;  2A79 B;  2HEP A;  4YJ3 A;  3ABU A;  2C22 A;  3F7Y C;  2OT5 A;  4JI0 B;  1FXK C;  4K35 A;  2A0L A;  5I5U A;  4RUA A;  2JRI A;  1SQG A;  4J9L A;  3AG2 B;  1BL8 A;  2UXD H;  4JAV A;  4HBN A;  1PNL A;  3JRW A;  4YBZ B;  1EN6 A;  2KB1 A;  1DGS A;  1Y1V G;  4DV0 O;  1FD9 A;  3D36 C;  2NU8 B;  4PDR A;  2JA7 A;  5LP6 A;  4O2B F;  5EC2 C;  3ZRW A;  2HHF B;  3I55 V;  1YJN V;  4O82 A;  1PM9 A;  1LNQ A;  3UO2 A;  4ECQ A;  2YU9 A;  3QZ7 A;  1AI6 A;  1ZWI C;  2VUG A;  4NXM B;  2ZKO A;  2AU0 A;  5JJE B;  2CTR A;  2WAQ A;  4HNA A;  4O4J F;  1Z2N X;  4ICG A;  4JV5 H;  3ZHU A;  2PN1 A;  1V54 C;  1YDX A;  4EEQ A;  4IYI A;  1O9H A;  1KB9 F;  4FFM A;  2QF7 A;  4C5C A;  1OCR C;  1DAA A;  3RB6 A;  4WFG A;  2IJI A;  4DR5 H;  2KSD A;  4I4T F;  4IIJ F;  5DIS C;  5CA1 B;  4B3S O;  3RYI A;  4JV0 A;  5LHH A;  1R9T A;  1SA0 B;  4DV5 B;  2AZ2 A;  1R73 A;  1YIT V;  4QNH B;  2HHH H;  3V4Z A;  4LF4 H;  5JCO C;  4ECV A;  3T1Y O;  1M90 W;  4PV1 B;  4LFA H;  5C8Y B;  1WNS A;  4X64 H;  4FLW A;  3N6R A;  3HKC A;  2RGV A;  3SYP A;  2X6C A;  2B9Z A;  1NTZ H;  2ZM6 O;  4AQY O;  4O4I F;  3QO8 A;  2PZS A;  1R6N A;  3KKY A;  2ADQ B;  2VWJ A;  5B1A B;  1J5E O;  4LF6 B;  4QW8 A;  4ECZ A;  3LWB A;  3OMA B;  3TET A;  3N2K B;  2LGW A;  2YXL A;  5LXT B;  5LHI A;  4YQW A;  4ZI7 F;  2R7K A;  5CMU A;  1CP9 A;  3QO5 A;  1AJP A;  2W9B A;  2BSK B;  3ASO C;  1N0J A;  1EUC B;  3BHP A;  1S5L Z;  5CA0 F;  1PK8 A;  4MV8 A;  2L35 A;  2XD4 A;  4ZI7 A;  1GM7 A;  1YZB A;  5FLX N;  4Q0Y A;  1XDN A;  1MOF A;  2NVX A;  3JD3 A;  3IGA C;  1XMQ B;  4X8A A;  3WFV A;  1KJQ A;  1XEQ A;  4J9M A;  1HP8 A;  4DV0 H;  4LNU B;  5LMN B;  3I4N G;  1DTO A;  3U10 A;  3IC9 A;  4X20 B;  3CCM V;  1JJ2 U;  1WR2 A;  1NVP D;  4JI4 B;  5LGT A;  3NC0 B;  5L1I A;  4NXN O;  3VNN A;  5I5S A;  3VPB A;  1CEZ A;  2VQE O;  3JAT A;  2UXB B;  4KUM A;  2LO1 A;  4TVI A;  3Q8R B;  3M9O B;  4J80 A;  5KG3 A;  4ED7 A;  1A3G A;  3JAW A;  4D7T A;  3KHL A;  3EVK A;  3I5D A;  4X65 O;  1MMM A;  3H4B A;  2EIN C;  4O2A F;  3VPD A;  5B1B B;  1RSO B;  1RYR A;  4B3S H;  3SYO A;  3A0H Z;  5A9G A;  4JI8 O;  1EBO A;  3JAM W;  3Q8P B;  4UVB A;  3LML A;  2ZDI A;  3TW6 A;  2H3O A;  4FFL A;  4MAM A;  1I3Q A;  2RQ6 A;  4TWK A;  1HNX B;  3K5L A;  1S0N A;  3DGE A;  3FYI B;  4CH3 A;  2UUA H;  4YY3 O;  4DR6 O;  4A2B A;  3EHB B;  3TY5 A;  4JYA O;  1FVI A;  2B1G A;  3H20 A;  1TWF A;  3H01 A;  1GMG A;  1M7J A;  3CRR A;  4DRF A;  1S03 G;  2LJ2 A;  2J6U A;  2QDO A;  1DLB A;  4HNV A;  2ZM6 H;  2AGQ A;  4AQY H;  3SPC A;  4UCS A;  4JI0 O;  5IYC G;  4Z1M G;  1AJQ A;  5IDJ A;  3DTF A;  1I2L A;  5IT9 N;  3GTK A;  4O84 A;  3H9V A;  4LF7 H;  4QPJ A;  1CKO A;  1PV0 A;  4RNO A;  5B1N A;  1VQ8 V;  3U11 A;  3ZMZ A;  2V59 A;  1G2W A;  1NVP B;  4DR7 H;  3BY6 A;  2RDJ A;  4PA6 A;  1FFX A;  4Q4C A;  3RJ0 A;  4DQN A;  2JEI A;  4IR9 A;  4O3P A;  1GKF A;  3RGZ A;  3HKZ A;  3DXR A;  5KFB A;  3JSL A;  1SYX B;  2CE4 A;  4NXM O;  4KP4 A;  4DV7 B;  3EFF K;  1IDS A;  4AHC A;  3FDS A;  4TQS A;  5B5E Z;  4BIO A;  2ARH A;  2WB1 E;  3HO8 A;  5ITZ B;  3HOW G;  2KKW A;  1X4T A;  4NXN H;  1BNC A;  5I5W A;  2P4K A;  4L87 A;  1DK1 A;  2C28 A;  4WFH A;  4JAA A;  5JWP A;  3N8D A;  3ZMV A;  3PW5 A;  2YXY A;  2YSU B;  3FAV B;  3AX6 A;  2BOC C;  4DV5 O;  3H0G G;  4J9O A;  1H2S B;  1SC5 B;  1HR0 B;  3K0G A;  2IU0 A;  1TGO A;  1K34 A;  2V7Q G;  2MCT A;  4X65 H;  5BPF A;  5KFZ A;  4MTX A;  1JX4 A;  1F51 A;  1WLE A;  5CB4 F;  2R8I A;  2X6B A;  3MHH C;  2VOB A;  1D5A A;  4DV1 B;  2W6Z A;  5DM6 V;  1N33 B;  3GIJ A;  4LF6 O;  4JZ2 A;  4YY3 H;  1BXR A;  3TIN A;  3O9O A;  4U3J B;  1CQI B;  4C5A A;  1B33 N;  4X89 A;  4FLU A;  4JI6 B;  2QTO A;  3VQW A;  1VQ4 V;  5BR8 O;  2CTP A;  1MNG A;  3AG2 C;  4GX0 A;  2ITD C;  2Q0O C;  4I0X B;  4B3M O;  4JI0 H;  2EJ2 A;  5KFP A;  2V5A A;  1NTM H;  3R9R A;  5J2U F;  1P4R A;  4XDL A;  3PJS K;  4M9U A;  1BE3 H;  4JYY A;  4IRK A;  4FZ1 A;  3T9D A;  3A0B Z;  1D2D A;  4O4L A;  5D1O B;  3CC7 V;  1THZ A;  5E79 Z;  5LMN O;  4NLG A;  4RAI A;  1GN3 A;  2ZDQ A;  2PMZ E;  5KFR A;  5KFN A;  1V9P A;  2E76 B;  2XIG A;  5DMX A;  4O3O A;  2XAS A;  1JOY A;  4YB8 B;  3ABT A;  1F4N A;  1SQP H;  3F5W C;  3JAS B;  2UXB O;  2M7W A;  4F6E A;  2R7L A;  4YAJ B;  1P8L A;  3ZCC A;  3JAR B;  3CCV V;  4TV8 B;  3V6H A;  3RT3 C;  5EYP B;  2ZR2 A;  3ETH A;  5CBH A;  5KFK A;  1WSC A;  4A3B G;  1I7F A;  2ZD9 A;  1GSO A;  2B63 G;  4QWC A;  3J81 W;  4EGJ A;  3LDC A;  1P49 A;  1QR9 A;  5L1K A;  4LFC B;  2VUM G;  4QJF B;  5IYZ F;  3MR6 A;  2ASJ A;  1NR1 A;  4J9Z B;  3LUL A;  4X88 A;  4DV5 H;  3K5H A;  1VQP V;  3ZS8 C;  4Q43 A;  4JF3 A;  1H2M A;  2NNU A;  4MA0 A;  4TM5 A;  1HNX O;  4GC6 A;  3D8C A;  4O4H F;  4NTX A;  2CQY A;  3KYH C;  5JVD A;  3OTO O;  4A2A A;  2YIB A;  2NVY A;  5B1A C;  2ZNI A;  3CRM A;  4RUE A;  1L2Z A;  4O83 A;  2R86 A;  1H2N A;  1M0W A;  2DPI A;  2CFM A;  2W57 A;  4UFZ A;  4M7E A;  5LYJ A;  3J7A U;  5KG4 A;  4I9Q A;  4U7N A;  4LC1 A;  3PW7 A;  1ARO P;  5KA5 A;  2IBK A;  4FMT A;  1XIL A;  4I50 F;  3LDE A;  3GLK A;  5IY5 B;  3OEH G;  5GON B;  3ZRS A;  1S0V A;  3LSQ A;  3VQV A;  3E83 A;  1I5Y A;  5BR8 H;  2UUB B;  1RJR A;  5IE9 A;  4A3L G;  1TUB B;  2XHB A;  4RB0 A;  4B3M H;  1B06 A;  2NU6 B;  3KG2 A;  5KFM A;  4H13 B;  4RNM A;  1JR9 A;  2R87 A;  1N32 B;  2XTA A;  3T7A A;  5BMV B;  1ENV A;  3JAK A;  4DV7 O;  2OH2 A;  3B40 A;  3Q8S B;  3OSP A;  2HFE C;  5LMN H;  2OTJ V;  4F4X A;  2QKA A;  1M4U A;  4X1Y A;  5DGA A;  3P3P A;  3K59 A;  4LF5 H;  3CCR V;  2F43 G;  2Q7E A;  4ME6 A;  4RQE A;  5I5X A;  1XL4 A;  2VQF B;  4RNN A;  1EFR G;  2UXB H;  4EBC A;  2IJK A;  1Q8I A;  2MK3 A;  3PVX A;  4K8Z A;  2XCL A;  1AR5 A;  5B1B C;  1VQ7 V;  2VR1 A;  4E4E A;  2YWV A;  3K3P A;  5IP9 G;  4O7L A;  4MV1 A;  5FR9 A;  1HR0 O;  4OPA A;  4H44 B;  4E6N A;  2FJZ A;  1I5X A;  4BBS G;  2QWQ B;  1SCU B;  4R8C A;  3UT5 A;  4A3I G;  5IYD G;  5I5T A;  4TSF G;  3ETD A;  4ZOL B;  3TK1 A;  4UUJ C;  3HKB B;  4GCZ A;  4ABM A;  1L0N H;  4IGG A;  1N36 B;  1TWC A;  3KAL A;  5E1A C;  3OUU A;  4DV1 O;  4CZZ A;  4KXR A;  1UC8 A;  4DV4 B;  1T94 A;  1HNX H;  1N33 O;  5DGB A;  3GIQ A;  4I55 B;  2Q2U A;  2FPP B;  3OTO H;  4FFO A;  3JCU Z;  2C2A A;  1XNQ B;  3E8H A;  4GX1 A;  2RDC A;  4LF8 B;  3H3V H;  3DC5 A;  2ODT X;  3KZI Z;  2FPI B;  2FLP A;  2XND G;  1AJN A;  3CS5 A;  3F7V C;  1N0N A;  4GKK B;  3AG1 B;  1VKZ A;  4WHX A;  3BVO A;  1AI7 A;  2Y4U A;  1FFT B;  4ECX A;  1BHB A;  5KX5 F;  1YCI A;  3KTM A;  4DV6 B;  3MJF A;  3E2E A;  3GTL A;  4FFB A;  2Y0S E;  4YXW G;  1KP3 A;  2QWP B;  4PZ7 A;  1K97 A;  2NU9 B;  5FD6 A;  3RV3 A;  5KFU A;  4G3I A;  1NKD A;  2EIL C;  1GAX A;  3K5I A;  1MSD A;  3LP8 A;  1S97 A;  3PO3 G;  4DV7 H;  4IHJ A;  4FBT A;  5KLV H;  1KBH A;  1IYE A;  1W0K G;  1FKA O;  2Z0A A;  4UCR A;  3ZHQ A;  4JI2 B;  4MVO A;  3P32 A;  5LP6 B;  2ODM A;  1C30 A;  3ZRW B;  1KKC A;  3JSN A;  4LFC O;  5C44 G;  1VF6 A;  2ZJT A;  4EB6 A;  3RW0 A;  3RN4 A;  1Y74 A;  2RGR A;  4MVM A;  4KFM A;  5DG7 A;  5KFF A;  1NZ6 A;  4AIL C;  3ZJZ A;  2ZR3 A;  3AEI A;  2OTL V;  2R9R B;  1LUV A;  5FNV A;  1KJI A;  4ZQI A;  2BQU A;  1YEW A;  2EIY A;  5DGI A;  4JPR A;  3W7U A;  5LGU A;  2Y48 A;  1EN5 A;  3HPL C;  4BWS C;  4FLZ A;  3X2Q C;  3HT5 A;  4F6R A;  2R7M A;  3P3N A;  1Q86 W;  2P90 A;  2C2R A;  3RBE A;  4RWU A;  3JRX A;  2R84 A;  3K9A A;  4O7S A;  2CH7 A;  1E4E A;  3T5H A;  2EIN B;  4MVZ A;  4LCU C;  4L1K A;  3B8M A;  4DV1 H;  3OUF A;  3FKI A;  4MT8 A;  4JXU A;  4PA4 A;  4O86 A;  1NU1 H;  1N33 H;  1VQ9 V;  1U97 A;  3RGB A;  2CGN A;  5KG7 A;  2Y4R A;  4FU0 A;  1ZHS A;  1KMI Z;  2ILM A;  1I94 B;  1S0M A;  3ABK C;  5B66 Z;  1VAJ A;  2I87 A;  3GIP A;  1R3L C;  2ATL A;  1CS0 A;  5CM0 A;  1S3J A;  3CP1 A;  3HKC B;  2JDI G;  4BIZ A;  3RYC B;  5J2T A;  4PI0 A;  3SR2 C;  1O75 A;  4F4L A;  3QG5 A;  4FM0 A;  3TXS A;  3M8A A;  5LOV A;  1JFF A;  1N32 O;  1IBM H;  2YS6 A;  3WU2 Z;  1GTO A;  3HOY G;  1GO3 E;  5EBL C;  1QQC A;  4I9W A;  3V6K A;  2AW9 A;  4FBU A;  2ZT9 B;  1B3Q A;  1SRY A;  5KFT A;  5KFC A;  2OIE A;  3SYQ A;  4HYK A;  2O03 A;  3AG7 A;  3JYC A;  2Q73 A;  2XCP A;  3S24 A;  3P30 A;  1O9G A;  2AGA A;  2W9B B;  3J80 N;  1GSA A;  1QCE A;  1JJO A;  3UQ8 A;  4GKJ B;  4H37 A;  4HQ6 A;  1XMO B;  3K0D A;  4TT3 G;  2WPD G;  4ZBM A;  3ICX A;  4D7S A;  1QLN A;  3ASN C;  1K4C C;  3CCQ V;  2YIA A;  4JI5 B;  3W7W A;  3GB8 B;  4TUY F;  3H4D A;  4RZQ A;  3W5O A;  4LFC H;  2GHY A;  2XGQ A;  5D5P A;  5BXZ A;  1S72 V;  3U9T A;  3KHR A;  4LFB B;  5KFG A;  3N42 B;  4B3R B;  3JAT B;  1N36 O;  4TUY A;  2Z5U A;  5H6Q A;  4K6N A;  2VS0 A;  2XAF A;  1SKV A;  3WWJ A;  3FMA A;  4GC7 A;  2CNQ A;  3OTF A;  5DED A;  1XNQ O;  3ZMT A;  2F4V O;  4DW1 A;  3N43 B;  2BTQ A;  3QNE A;  5KFQ A;  4LF8 O;  1N48 A;  5IY5 C;  4ECW A;  5LGN A;  1XK5 A;  5I47 A;  3SDL A;  1OJH A;  3CCJ V;  4XX0 B;  1CKN A;  2YYA A;  4ED1 A;  1V51 A;  3IJ4 A;  3FX7 A;  4CS2 A;  3T5K A;  4UV9 A;  2V4R A;  3BQ0 A;  5KFW A;  1HW7 A;  1SES A;  5GTI Z;  2W7P A;  1OCO B;  4XYM B;  3PW0 A;  2R70 A;  2AZ0 A;  5IYB O;  4I7H A;  1I6U A;  2FK3 A;  3W7T A;  4DV6 O;  1GGO A;  2IH3 C;  4O7Z A;  4HR7 A;  2Y69 C;  3OR6 C;  1M57 C;  1MA1 A;  3ZED A;  4NVP A;  1Z5W A;  1KU9 A;  4QWE A;  3CJH A;  5JQG F;  2RCV A;  3T1C A;  1AVM A;  3RYH A;  1ZLZ A;  4MVU A;  4PDV A;  3U54 A;  5A2Q N;  2W6I G;  1VQ6 V;  3G8C A;  4GT1 A;  5EZY B;  5IJ9 A;  3FYE B;  4UCO A;  2CNU A;  4ECT A;  2E3C A;  5JQG A;  4JI2 O;  2X5R A;  2WAM A;  4OX9 O;  1FFX B;  1YVW A;  1GO3 F;  3K79 A;  3K08 A;  3E5N A;  4A3F G;  2FE3 A;  2LQT A;  1XUQ A;  3DXR B;  3GIL A;  4O2B A;  2PF4 E;  2IP4 A;  2Q2T A;  3AK2 A;  3SGI A;  2W6Q A;  4JYB A;  1VBG A;  2DLN A;  3WB0 A;  1KJ9 A;  3UFX B;  5KT2 A;  4QWD A;  2E2I A;  3CME V;  3JZ6 A;  1XQ8 A;  4CC6 A;  2YZG A;  3PW4 A;  5KAI Z;  4O4J A;  2ZDH A;  4FLX A;  2HVK C;  2KG7 B;  1OCC C;  1BQ0 A;  4TQR A;  3BA8 A;  2N04 A;  4XDK A;  1XNR H;  4X1I B;  1I1M A;  1CPY A;  4I4T A;  4IIJ A;  4DK0 A;  2DAA A;  2R8J A;  2B1I A;  2RN9 A;  1OBD A;  1IBL B;  1GH6 A;  4HNU A;  4NB5 A;  5JH7 F;  2F4V H;  5B3S B;  1Z2G A;  4CH5 A;  5JQW A;  2FKL A;  1JA8 A;  2EJR A;  3AG1 C;  5KUK A;  5GTH Z;  3NXS A;  2L6L A;  5IYB G;  2R8H A;  1IUR A;  3ZHV A;  1BHA A;  1BGY H;  1UNN C;  2YUA A;  4FFP A;  5J9P C;  2BE3 A;  1JIH A;  4O4I A;  5KHH A;  1HNZ B;  1X9N A;  1GN4 A;  5L3G A;  3G6E V;  2HG5 C;  1IOV A;  2DYR B;  3WNZ A;  3DTU B;  1EZ1 A;  1I7L A;  3TJT A;  2COG A;  5C1O A;  4DV6 H;  4A3E G;  1YSC A;  3K04 A;  4ZHQ F;  3E8F A;  1OV9 A;  3CCS V;  3K9S A;  4WF9 V;  3VOU A;  4BAY A;  3STL C;  2P22 C;  2OWO A;  1VS0 A;  5L9X A;  4DV2 B;  5EWG A;  5LP6 C;  2UUC B;  4Z1V A;  4GKJ O;  3V4S A;  5L1J A;  5LHG A;  1XMO O;  2P06 A;  5CA0 A;  5LL6 b;  4F50 A;  3U0G A;  4DUZ B;  5LMU B;  4O4L B;  4JI2 H;  2EX3 A;  2DQ3 A;  4J9Y B;  5BWV A;  4BXX G;  1BCC H;  4JI5 O;  2JIZ G;  2QKC A;  4OX9 H;  3HR0 A;  1Y66 A;  5FD5 A;  3RV4 A;  2E5L B;  4CHI A;  3VBB A;  1AI4 A;  2UU9 B;  2ASL A;  3UYY A;  4CMD A;  2WLL A;  1VP7 A;  1I08 A;  4B3R O;  2C2D A;  3HOU G;  4RAZ A;  2QWN B;  2PUS A;  3OMN B;  4IRC A;  2PGG A;  1QU7 A;  3VQX A;  2R8K A;  3ABL B;  1KJJ A;  4PWQ A;  5KFE A;  1QVG U;  1RPR A;  3T4D A;  4FFK A;  2LFS A;  4MV6 A;  2QM7 A;  2JS3 A;  2Q5Z A;  4O2A A;  1VQ5 V;  1S0O A;  2PBZ A;  3BFR A;  3JAM N;  5KHJ A;  2Y0P A;  4O7N A;  3VQY A;  2W0X A;  3L71 H;  1R6K A;  2R82 A;  3Q2O A;  3T1Y H;  4P9O A;  4MV9 A;  3OUS A;  3HOZ G;  1C3O A;  1BS3 A;  3ORQ A;  5JVD B;  3H0G A;  4DUY B;  3N27 A;  3BQ1 A;  4G28 B;  2COI A;  3UZB A;  5FPR A;  5C5J A;  2J6S A;  5HFM A;  1RK5 A;  2HR3 A;  3ETQ A;  1XL6 A;  3CSX A;  4ECY A;  2CKZ B;  2G38 A;  3I12 A;  4QPK A;  3IN5 A;  1J5E H;  5LYJ B;  2X0L A;  5LA6 B;  4MVR A;  4BIU A;  5KFO A;  2OCH A;  1HR0 H;  4ASU G;  5KFV A;  1K1S A;  2QSA A;  3KHG A;  2DMX A;  4TV9 B;  1TA8 A;  4K0K B;  5KG0 A;  2EIJ C;  2FPG B;  3FB6 C;  3GV7 B;  2VPS A;  2C2E A;  2V58 A;  2CZG A;  1PL0 A;  2LFR A;  1NTK H;  1S9F A;  3N2G A;  4CS4 A;  2Q68 A;  1WJZ A;  1ULZ A;  2AHZ A;  3LSU A;  4GKJ H;  5I5Y A;  1J95 A;  3G6Y A;  2P5O A;  2N74 A;  1NH2 D;  3QTC A;  3WO0 A;  1Y1W G;  4ED0 A;  4NKG B;  4CBC A;  5KG5 A;  1M6V A;  2EIL B;  2OIG A;  2UXN A;  2JEG A;  4BR6 A;  3ABM C;  1S77 D;  3O65 A;  4X1Y B;  3H1L H;  3K3W A;  2VQE H;  1IOW A;  1VIB A;  3OSN A;  4AI8 A;  4LBE C;  3FB5 C;  3HOV G;  4IZO A;  4CH4 A;  2VQD A;  3RFC A;  1DV1 A;  3RB3 A;  3CCE V;  3K5N A;  5CA1 F;  5F2V O;  2DJV A;  3STZ C;  1AI5 A;  3T9C A;  1IBL O;  3DTG A;  2ZDI C;  3CEB A;  1TWH A;  1KT8 A;  3UT5 B;  2DOS A;  2V4Q A;  5CA1 A;  1DIK A;  3L9D A;  4JI8 H;  4GX2 A;  4QIW E;  2Q7G A;  1EN4 A;  1OCO C;  4MTF A;  4LF9 B;  4WFB V;  4KHP B;  5DQH A;  5CB4 A;  5DGH A;  2B63 A;  5C8Y F;  5E25 A;  3X2Q B;  3T5J A;  2VUM A;  4IR1 A;  2EUL A;  4DR6 H;  3QFF A;  2F1M A;  4FS1 A;  4FFN A;  1SQQ H;  4JYA H;  2PTM A;  1G4Y B;  1HNZ O;  3MHS C;  4GZR B;  1QLE C;  3OW2 U;  1QVF U;  2LGQ A;  1K3E A;  2D3O W;  3HB9 A;  1RK6 A;  5TIS Z;  1EZV H;  3PN1 A;  2I80 A;  2HVR A;  3AG3 B;  4R7R A;  3JD0 A;  1RP3 B;  2ZIN A;  3E89 A;  2W6J G;  2OLS A;  1IBK B;  2JEX A;  3ABK B;  4U7O A;  4CC5 A;  4DR3 B;  1EUD B;  5LXT F;  1FXH A;  1EKP A;  1NH2 B;  3CXC U;  4DV2 O;  3N2K A;  4C7U A;  2UUC O;  3GV8 B;  1XMQ O;  4X66 B;  4J9R A;  5DEC A;  1RJP A;  3EPI A;  4NYK A;  5J2U A;  2HGW A;  1M56 C;  1G6U A;  4J11 A;  4ED2 A;  5LMU O;  1F7Y A;  4HZ3 A;  1EKF A;  5KG2 A;  1AP6 A;  4JI4 O;  4DR1 B;  2R7Z G;  2E75 B;  4FFB B;  3ZRX A;  4PEL A;  2UU9 O;  4MV3 A;  3T9A A;  1R3I C;  3THO A;  2W6O A;  4RCN A;  3GV5 B;  3W7S A;  4NXM H;  1A0I A;  1WRV A;  3K03 A;  4GYC B;  1YJ9 V;  1Q7Y W;  2W6N A;  1JDB B;  1PPJ H;  4Q8E A;  1QHT A;  2HJF C;  4IHJ B;  2PYJ A;  3ZMS A;  2FP4 B;  2ZE8 A;  5DLG A;  3CRQ A;  2CTQ A;  2UXC B;  4HN2 A;  3J81 N;  3GWO A;  2HVS A;  4DR2 B;  5IWA B;  3RYF A;  2WLI A;  4EB6 B;  3ASN B;  5F9L A;  4DR4 B;  5B3S C;  5IYZ A;  1N34 B;  1H2K A;  3C0F B;  2JEF A;  2JJ2 G;  5CBG A;  2WB1 A;  5FNV B;  1IBL H;  4K8X A;  4F4W A;  3OE7 G;  4RZR A;  1XBL A;  3RBD A;  4F4Z A;  1IYD A;  4O4H A;  4DUY O;  2IA6 A;  5CAE B;  1FJG B;  4F6R B;  5KFH A;  2EIK B;  4WBN F;  3FKS G;  5DQI A;  5EDW A;  1BT8 A;  2RMK B;  2DYR C;  1NQT A;  4IYH A;  2CH7 B;  1E4E B;  3CPW U;  4LMY A;  3RF2 A;  1UFI A;  3T9E A;  1A9X A;  1NT2 B;  1G1X B;  4WD3 A;  4LF6 H;  5EWE A;  4QIW F;  5JUM A;  4WBN A;  1E1Q G;  5HBR B;  1Y76 A;  4JI7 B;  5KFL A;  3JZF A;  3JZI A;  2EJ0 A;  4BW5 A;  2P0A A;  3HBL A;  4F4Y A;  1KD1 W;  1RPO A;  4I50 A;  4E4T A;  4K0K O;  1I2K A;  1SER A;  4FGR A;  3CX5 F;  1KP2 A;  1K33 A;  2YS8 A;  4FIP C;  1F23 A;  2SCU B;  4CKC A;  1R3J C;  2IJJ A;  5J2T B;  4YIP A;  3MDS A;  1MZE A;  2P6J A;  3L4K A;  2BCC H;  2HJW A;  1E4G T;  3TQ1 A;  2NU7 B;  2UUC H;  4Z2W A;  1B6S A;  2Y69 B;  4J7K A;  2GQS A;  5LOV B;  1M57 B;  1JFF B;  1KUT A;  1AN7 A;  1XMQ H;  3GJX B;  3OM3 B;  3E35 A;  4Q6G A;  4O3Q A;  1V55 B;  5DAA A;  1AUV A;  2YIC A;  4JI4 H;  2YEV A;  1S5J A;  4XZ3 B;  5H2F Z;  3TGU H;  2HVQ A;  3ABL C;  4YR0 A;  3T54 A;  4O7Y A;  3PW2 A;  4AYB E;  3SJQ C;  3Q4H A;  5EK0 A;  1M5I A;  5I60 A;  2GTA A;  2ABJ A;  1P16 A;  3KAJ A;  5F9N A;  2W6P A;  1FS0 G;  5L3C A;  2PMZ A;  2JVD A;  4IWX A;  3OHA A;  5ITZ A;  3E22 A;  3E8G A;  4NZO A;  2Q6A A;  1YIJ V;  2DWD C;  2ADP A;  2HJD A;  4YR3 A;  4FLY A;  4ECR A;  2XT9 A;  3GTM A;  3ZHT A;  4LF9 O;  4FLV A;  4KHP O;  2F93 B;  2K1E A;  1OCC B;  3JAL A;  2QJ1 A;  5B1O A;  5KT3 A;  3M4I A;  1URF A;  2QWR B;  1HNW B;  3OGC C;  4JV5 B;  3FB7 C;  4FFR A;  3W1G A;  2QYZ A;  5KFI A;  1AR4 A;  4O7T A;  3NR7 A;  4JI6 O;  2R92 A;  3FB8 C;  3OD4 A;  4DUY H;  4DR5 B;  2BTQ B;  3GTP A;  2ASD A;  2E74 B;  4P2Z A;  1CKN B;  3CB2 A;  3S3X A;  3WG7 C;  1IBK O;  4DR3 O;  4Q44 A;  4LF4 B;  3OUZ A;  3WB2 A;  5HV6 A;  2ZCE A;  5I5V A;  3CE2 A;  2NN4 A;  5HFL A;  3BAB A;  2JGD A;  4X66 O;  2FK1 A;  1IVS A;  1QR8 A;  1L0L H;  3RUP A;  2ZIO A;  4EFB A;  1MSW D;  4YJ3 B;  4PZ8 A;  4DR1 O;  1G8M A;  5D8D A;  1GN2 A;  5KX5 A;  1ET0 A;  1E1R G;  3IC7 A;  2QR4 A;  1H8E G;  1JQ0 A;  4A3K G;  5KHK A;  3CJH B;  4MSW C;  5EIB C;  1PP9 H;  3VA7 A;  1UC9 A;  5KFJ A;  3RYH B;  2Z02 A;  3GTJ A;  3JCZ A;  4PA3 A;  2GV9 A;  2EBO A;  4CKB A;  4DV3 B;  5IJ9 B;  1N8R W;  4EBD A;  3ZN1 A;  3CSW A;  2WLN A;  4TV8 F;  1B04 A;  2JEU A;  1L1F A;  3RTX A;  1MG1 A;  3L70 H;  3R5F A;  3JAR A;  4ECS A;  2R92 G;  1ZAU A;  1HWY A;  4DR4 O;  4O2B B;  4FM2 A;  1N34 O;  4HNA B;  4DV0 B;  3U55 A;  1FYJ A;  1SQB H;  3H1K H;  3AK3 A;  1R3K C;  4CS3 A;  5LL6 Y;  4J9S A;  4FJC C;  2XAG A;  1T5E A;  4O4J B;  4MVS A;  1FJG O;  2R93 G;  3CD6 V;  1W96 A;  1QBZ A;  3RYI B;  4LF9 H;  4U7C A;  2V9W A;  4KHP H;  1YTF D;  2DWE C;  1Q6U A;  4DRX A;  1W93 A;  5L3D A;  2W9C A;  2YI9 A;  2WLK A;  3AG3 C;  4I4T B;  4IIJ B;  4PI2 A;  2JA6 G;  1WH2 A;  2GDS A;  4JI7 O;  1VBH A;  4Q45 A;  3CCL V;  2AGP A;  5KFD A;  3DSQ A;  4CKE A;  4JI6 H;  3SJA C;  3M9M B;  2UUB O;  2LP7 A;  3A2F A;  1I1L A;  2F66 C;  4EYI B;  5GON F;  5KMG A;  3LNN A;  2FK2 A;  2M6Y A;  4B7K A;  4J7Z A;  2BTO A;  3H1I H;  4FK5 C;  2WA4 A;  3MD0 A;  2UUA B;  1K1Q A;  1KEC A;  5BWU A;  3PR4 A;  4A3G G;  1W0J G;  3AG4 B;  4A5U B;  4X66 H;  1VF5 B;  4O4I B;  1M0T A;  3BA9 A;  5KUM A;  1TUB A;  2AXT Z;  3I56 V;  2UVV A;  5BMV F;  3ZN0 A;  4EQ5 A;  1E4F T;  2FB5 A;  2YW2 A;  3VPC A;  4G27 B;  2ZM6 B;  3L4J A;  4A3M G;  4Q8F A;  3CC4 V;  1NJI W;  1KYO F;  2VQF O;  4PA9 A;  3MR3 A;  1HDJ A;  4ED3 A;  4U3F H;  2EIJ B;  1Y6X A;  1TVK A;  4UCT A;  5BMV A;  4LF7 B;  4ZI7 B;  1FXK A;  3KAK A;  3BG5 A;  4PDB A;  1Q5O A;  1WA8 A;  2WAQ E;  1WPB A;  2AGO A;  1GN6 A;  1FKA H;  1WP7 A;  1VF6 C;  1JVM A;  4GX5 A;  4DR7 B;  5CA0 B;  2Y0S A;  5EWF A;  5C93 A;  2X7R B;  4LP8 A;  5L3F A;  4WFF A;  4R6Z A;  4JAU A;  3B09 A;  4YAK B;  4NZM A;  2R9I A;  4EKW A;  1YTF B;  1ZL8 A;  1SFO A;  4J41 A;  3QZ8 A;  3B2E E;  4DR4 H;  2HP8 A;  1Q82 W;  4O7R A;  2WLL B;  3ABM B;  4ZOL F;  4E2L A;  4DV4 O;  3RB0 A;  2EIK C;  3JAW B;  1HNW O;  4DW0 A;  4JV5 O;  4RU9 A;  4JGS A;  3ZRV A;  5DN6 G;  1Q6I A;  4ZOL A;  3FFQ A;  1MAB G;  2VRZ A;  4D6T H;  1GYF A;  1WCM G;  4DR5 O;  4I55 F;  4JI3 B;  5KFY A;  1B6R A;  2WLM A;  4FM1 A;  4NTW A;  1FAF A;  1LUW A;  4O2A B;  2QA4 V;  1ZET A;  4X1K A;  2QB5 A;  3GVM A;  1K9M W;  3WO1 A;  1EYZ A;  2FTK A;  4GKK O;  4R8U A;  1BQZ A;  3HKE A;  3IG0 A;  2CGO A;  3K58 A;  2FYU H;  1RYS A;  4FM9 A;  2YZN A;  1DF4 A;  2UUB H;  5JCO A;  3GDE A;  5BWW A;  4YJ2 F;  3QQM A;  4PBC A;  2A06 H;  3K5M A;  4BBR G;  4DL3 A;  1K4D C;  3SI8 A;  1K83 A;  4DL7 A;  1QLE B;  2YS7 A;  1V55 C;  2XC9 A;  1ZTE A;  1YXB A;  1FPO A;  3G67 A;  3ZMU A;  4B08 A;  4YJ2 A;  2A7W A;  1N32 H;  2H8P C;  4O7W A;  2ITC C;  4A3C G;  2QK4 A;  4LH6 A;  4XDJ A;  3OGI B;  1NI8 A;  1BMF G;  3F8N A;  1I0H A;  1JCH A;  3UM7 A;  3SJB C;  4BY1 G;  4DV3 O;  3R66 A;  4M0J A;  2JA5 A;  4LSA A;  3DF7 A;  3G8D A;  1OWT A;  2VQF H;  4LH7 A;  2D2C B;  1M56 B;  4QE7 A;  2GPS A;  2CW7 A;  1BSM A;  4UXN A;  2DYS C;  2WDT A;  2FLN A;  3N2G B;  4NTY A;  1NS1 A;  1M1K W;  5LP6 F;  5A2Q W;  1DF5 A;  2KSW A;  1JLL B;  2OCC C;  3OT7 A;  3OEE G;  1JPX A;  5KA6 A;  1OZ0 A;  1TWA A;  2R7N A;  1N36 H;  2FML A;  1KBL A;  5KT6 A;  2XGP A;  3ZHS A;  4K3A A;  4LWS A;  2UVR A;  2NUA B;  1WP8 A;  4DV4 H;  1I50 A;  4DL2 A;  1KTA A;  2XCA A;  4RB1 A;  1HNW H;  4RAY A;  2WA3 A;  4QWB A;  3DAA A;  3HKD A;  1XNQ H;  4DL4 A;  1RFY A;  2Q8V A;  2A9H A;  3KCX A;  1I94 O;  3HOX G;  4LF8 H;  3G80 A;  3MR2 A;  1RM1 B;  3TEK A;  4JI1 B;  3ZIA G;  3RIZ A;  2HVJ C;  2GPW A;  2BOB C;  5JH7 A;  3G6V A;  4MTO A;  2N05 A;  5DG8 A;  3Q8Q B;  5CB4 B;  2K9P A;  3ZHR A;  1AIL A;  4XYL B;  4P30 A;  2QEX V;  4GKK H;  5FL7 G;  2JA5 G;  2UUA O;  2JEJ A;  1VEW A;  3SNO A;  2XOK G;  2A1H A;  1IZ3 A;  5D5Q A;  4DK1 A;  4QSH A;  4Q20 A;  2W8L A;  2CUG A;  4U6P A;  5JVL A;  2GSM B;  2YIB D;  3RYC A;  2R72 A;  4J7J A;  1LR1 A;  2GUZ A;  1S68 A;  3HKZ E;  3RAX A;  2JA7 G;  3B8N A;  3R5H A;  2EZO A;  4ZHQ A;  4LF7 O;  1A48 A;  2AHY A;  2QGN A;  1Z2P X;  3RWR D;  4JUZ A;  2W70 A;  2IMW P;  3UO3 A;  2O57 A;  5EC1 C;  2IBZ H;  5BR8 B;  4DR7 O;  5J2U B;  2Q9L A;  5IYC O;  4DV3 H;  4MTD A;  5JJJ B;  4B3M B;  3NUA A;  1ROP A;  1K8A W;  1JXL A;  4I7Z B;  2HGS A;  4GLX A;  5FLX W;  4WCE V;  4LFB O;  5CA3 A;  1KC8 W;  2ZGI A;  4MVQ A;  2UXX A;  3VMM A;  3GIK A;  3JD2 A;  3KHH A;  3S3W A;  3E86 A;  3SYC A;  3N6X A;  5AG2 A;  1GRJ A;  5FLM G;  4LF5 B;  3L2P A;  4EYH B;  1N56 A;  2EJ3 A;  5IP7 G;  5JJN B;  5EIB D;  2Z3Y A;  1V4Y A;  1Y1W A;  2YCH A;  4JI3 O;  3NBZ B;  3B4S A;  2HG8 A;  2F23 A;  3RYF B;  2ALZ A;  2WLI B;  2DZD A;  4IRD A;  5IYZ B;  3MWM A;  1VQM V;  3N41 B;  4O81 A;  2DQ0 A;  2OYQ A;  1F4M A;  4DXW A;  3GTG A;  4EBE A;  1COW G;  4BW9 A;  1I94 H;  4KL1 A;  3CMA V;  4UB6 Z;  3UCS C;  2FLL A;  1GSH A;  2YZM A;  1ZQ7 A;  4O4H B;  2EZP A;  3GTO A;  3AG4 C;  1D5N A;  5K1P A;  2PI4 A;  3LNM B;  1KUQ A;  3TII A;  2XUM A;  2FMA A;  1CE8 A;  5KFX A;  5IJ0 A;  1A32 A;  1SZT A;  4WBN B;  4YHH B;  3C90 A;  1Y76 B;  3OTO B;  5C4X G;  1OCZ B;  4N23 A;  4NYE A;  3WG7 B;  3L72 H;  4B7E A;  1TAE A;  2NR5 A;  5KAF Z;  3APQ A;  4I50 B;  4A3J G;  2ZE7 A;  2Y4T A;  4FLT A;  3IAY A;  5IT9 W;  4QE9 A;  1K92 A;  5EZY F;  3H1J H;  4OXS A;  1VQK V;  3GB7 C;  3HB3 B;  3JD1 A;  4J42 A;  4J9Q A;  2RF4 A;  3CWB H;  3N40 P;  1XMO H;  2P67 A;  5L1L A;  5EZY A;  3SPJ A;  3JAK B;  3BAA A;  2WYO A;  4DL5 A;  3TQT A;  3RGX A;  2HHF A;  4JI5 H;  4L8J A;  2NLJ C;  4MA5 A;  5KG1 A;  5CBF A;  2CAZ C;  2CTW A;  3C3S A;  4PJ0 Z;  3CRA A;  4EEY A;  2YEV B;  4FE2 A;  3RAQ A;  2QWO B;  3WWI A;  4LFB H;  2DWC A;  4B3R H;  2IU3 A;  5C1P A;  3R65 A;  1SEI A;  5H9C A;  2Q7D A;  4BWA A;  1KEE A;  2QM4 A;  3Q4H B;  2R7Z A;  1AP5 A;  3B77 A;  2COJ A;  2YL2 A;  3NGD A;  1ZSP A;  2HKO A;  4EFE A;  1PNM A;  3SYA A;  2KG7 A;  3L73 H;  2DIK A;  1YI2 V;  3PR5 B;  4J9P A;  3T1H B;  3E22 B;  2HLD G;  3CRC A;  3TCU A;  5H6R A;  1K7D A;  1P7G A;  4UCV A;  2Q7H A;  1SA0 A;  1SF9 A;  3ETG A;  4JI1 O;  2QM8 A;  4JI3 H;  1Q6H A;  4X1I A;  3TY8 A;  4MW8 A;  3SJC C;  4WFE A;  5H80 A;  3JAL B;  4A3D G;  4HAM A;  3L74 H;  4RB2 C;  3MWE A;  5C8Y A;  2XAQ A;  4LSX A;  2ZDG A;  3EPG A;  1NR7 A;  3C3T A;  4X62 B;  3BAC A;  3MWD A;  4NZN A;  1M93 A;  4DL6 A;  2CK3 G;  4Q4D A;  3QF7 A;  1YHQ V;  2LW1 A;  1VQO V;  3EYY A;  3BJY A;  1Q81 W;  2B5U A;  2ATK C;  5KT4 A;  1N4C A;  4TOI A;  4IL6 Z;  2PYL A;  3BQ2 A;  1MZF A;  4QWA A;  4B3T B;  3PFF A;  1T36 A;  5LXT A;  1SQV H;  2W8K A;  1R6T A;  2JGD B;  4JTA B;  4TQD A;  4DUZ O;  4JZG A;  2R8G A;  2M05 A;  3CEI A;  1KKD A;  4MV4 A;  3LQS A;  2BSK A;  2ZXW B;  1UJW B;  2JGU A;  2E5L O;  5BYB A;  1H2G A;  3G6B A;  4APM A;  3OR7 C;  5KX5 B;  4O4L F;  2VA3 A;  3GWK C;  1VQN V;  1IBM B;  3M7M X;  3T9F A;  3R23 A;  3MFI A;  4LNU A;  3N44 B;  1SQF A;  4X20 A;  5K2M A;  4MW3 A;  2BR0 A;  2Q4P A;  1OHH G;  4IAJ A;  5DLF A;  4LF5 O;  5BWT A;  2VWK A;  4O3R A;  1QNM A;  5KFA A;  3NBY B;  4J10 A;  2YDE A;  1H2L A;  1Y74 B;  3T5L A;  2RNB A;  4MS2 A;  1RM1 C;  5D1P A;  4PDM A;  1P84 F;  3KCY A;  4PHZ A;  1ORQ C;  5KHI A;  3RBZ A;  4DO2 A;  1RSO A;  1XOU A;  2YC0 A;  2WWW A;  4N21 A;  3M99 B;  4UB8 Z;  4UUG A;  4JI1 H;  1E79 G;  1SZX A;  3OFN G;  1W59 A;  2GTS A;  2HIV A;  5JVD F;  2P4V A;  1S10 A;  4RUF A;  3A0R A;  1Q90 D;  4DRX B;  1WN7 A;  4J0M A;  4G2K A;  2IM9 A;  2V4D A;  5IYD O;  2W9C B;  3KXY T;  1HNZ H;  4ECU A;  3D3I A;  4YHH O;  4UVA A;  3A8T A;  4FPP A;  5LYJ F;  4UCU A;  3UZO A;  4QIW A;  5LA6 F;  3RVZ A;  1IX9 A;  1H8H G;  2JK5 C;  3ORR A;  5BWX A;  4ED8 A;  2IH1 C;  4YP3 A;  5KMG B;  3LUT B;  4TV9 F;  5CR5 A;  5LA6 A;  4GLW A;  3MR5 A;  3KRE A;  1SET A;  1PNK A;  4DV2 H;  2HIX A;  2H94 A; 
#chains in the Genus database with same CATH homology
 3SJA C;  4TV9 A;  4DV7 B;  3A2F A;  2F66 C;  5LMU H;  4DUZ H;  5KMG A;  3LNN A;  4AHC A;  1XNR H;  4X1I B;  4I4T A;  4IIJ A;  4DK0 A;  2E5L H;  4CH6 A;  2BTO A;  3MAQ A;  2UU9 H;  5ITZ B;  2KKW A;  1X4T A;  1IBL B;  4NXN H;  3K5O A;  2UUA B;  2F4V H;  4CH5 A;  2UXD B;  4X66 H;  4O4I B;  1XI1 A;  1M0T A;  3BA9 A;  1TVK B;  1TUB A;  1H2S B;  4EQ5 A;  1E4F T;  1HR0 B;  2ZM6 B;  3L4J A;  2MCT A;  1TGO A;  4X65 H;  4PZ6 A;  4TQF A;  4O4I A;  5KHH A;  1HNZ B;  1X9N A;  5BMV A;  4LF7 B;  1TVK A;  4UCT A;  4ZI7 B;  4FVM A;  2ZIM A;  3KAK A;  4PDB A;  1Q5O A;  3CVZ A;  1WPB A;  1FKA H;  4TUY B;  4DV6 H;  2VOB A;  4DR7 B;  1D5A A;  5CA0 B;  4DV1 B;  3BPZ A;  1N33 B;  1L8D A;  4YY3 H;  2P22 C;  2OWO A;  1VS0 A;  4U3J B;  4DV2 B;  3K3V A;  4FLU A;  5LP6 C;  2UUC B;  4JI6 B;  3B2E E;  3VQW A;  4DR4 H;  1BJT A;  5CA0 A;  5LL6 b;  4DUZ B;  5LMU B;  4O4L B;  4JI2 H;  1XNR B;  2HHH B;  2EX3 A;  4JI0 H;  3JAW B;  4OX9 H;  5FD5 A;  2E5L B;  4U3J A;  4RB3 C;  4ZOL A;  4X1K B;  3FFQ A;  2UU9 B;  5KHG A;  4YHH H;  3HKE B;  1GYF A;  3RR5 A;  2F4V B;  2WE6 A;  4LFA B;  4K0K H;  4X64 B;  4RAZ A;  4O4L A;  4JI3 B;  5D1O B;  4FM1 A;  2PUS A;  3BRC A;  4O2A B;  1XHX A;  2PGG A;  3VQX A;  4X1K A;  1Q43 A;  1V9P A;  2XIG A;  3HKE A;  3IG0 A;  3K58 A;  2PY5 A;  3JAS B;  4FM9 A;  4YJ2 B;  5D1O A;  1P8L A;  2UUB H;  5JCO A;  3JAR B;  4O2A A;  3GDE A;  4TV8 B;  5EYP B;  5KHJ A;  3K5M A;  1I7F A;  5JQG B;  3VQY A;  2F95 B;  1Q3E A;  1Z2O X;  3JAS A;  3J81 W;  3T1Y H;  4MV9 A;  3QWU A;  1N32 H;  4YJ2 A;  4B08 A;  1P49 A;  4LFC B;  5JVD B;  4TV8 A;  1VF7 A;  4DUY B;  1BGW A;  5FPR A;  5EYP A;  4LH6 A;  4DV5 H;  3F8N A;  2Q0A A;  3ETQ A;  1Z5V A;  3ZS8 C;  3SJB C;  3CSX A;  2CW8 A;  4LSA A;  3DF7 A;  1J5E H;  5LYJ B;  3KYH C;  4OX9 B;  2VQF H;  5LA6 B;  4LH7 A;  1MZB A;  5JVD A;  3T1H H;  4A2A A;  2YIB A;  2JS5 A;  2CW7 A;  2WDT A;  3N2G B;  2ZNI A;  5A2Q W;  1L2Z A;  2KSW A;  3TY9 A;  4TV9 B;  1TA8 A;  4K0K B;  1M0W A;  2CFM A;  2W57 A;  4UFZ A;  4M7E A;  5LYJ A;  2VPS A;  4I9Q A;  2RJZ A;  1ZHQ A;  3N2G A;  4CS4 A;  5GON B;  3HKD B;  3VQV A;  4GKJ H;  1N36 H;  3RFR A;  4X62 H;  4B3S B;  3K57 A;  2P5O A;  5BR8 H;  2UUB B;  2R9A A;  3QTC A;  4DV4 H;  1TUB B;  5JH7 B;  2XHB A;  4RB0 A;  4B3M H;  4RB1 A;  1IBK H;  4DR3 H;  1HNW H;  4RAY A;  5GON A;  3WB1 A;  3HKD A;  1XNQ H;  4X1Y B;  3HXL A;  2VQE H;  3T1Y B;  4B3T H;  4LF8 H;  1N32 B;  5BMV B;  3JAK A;  4JI1 B;  3RIZ A;  5JH7 A;  4CH4 A;  5LMN H;  4DR1 H;  3K5N A;  4AQY B;  1M4U A;  5CB4 B;  4X1Y A;  4LF5 H;  3K59 A;  4GKK H;  1J5E B;  5K1X A;  2Q7E A;  2VQF B;  3UT5 B;  2UXB H;  5D5Q A;  5CA1 A;  4DK1 A;  1Q8I A;  4JI8 H;  4ZHQ B;  4K8Z A;  2Q7G A;  4LF9 B;  4KHP B;  1CKM A;  2YIB D;  5CB4 A;  3RYC A;  2R72 A;  4LR3 A;  4E6N A;  3CHX A;  2UXC H;  1S68 A;  3UT5 A;  3J80 W;  4DR6 H;  2F1M A;  4JYA H;  4DR2 H;  2PTM A;  5IWA H;  4ZOL B;  1XHZ A;  3W1B A;  4ZHQ A;  3HKB B;  3RWR D;  1Z2P X;  1N34 H;  1N36 B;  2HVR A;  3PN1 A;  3KAL A;  5BR8 B;  4MV7 A;  4R7R A;  5J2U B;  4DV3 H;  4MTD A;  2ZIN A;  2YI8 A;  5JJJ B;  4DV4 B;  1HNX H;  4B3M B;  4ZIB A;  4ETS A;  4I55 B;  1IBK B;  4DR3 B;  4CC5 A;  2Q2U A;  4NXN B;  4GLX A;  2HGS A;  5FLX W;  3OTO H;  3HKB A;  1XNQ B;  2VQE B;  3N2K A;  1FJG H;  4LF8 B;  4X66 B;  3J7A K;  5J2U A;  1G6U A;  5EOY A;  4I55 A;  4DR1 B;  3N6X A;  4FFB B;  4JI7 H;  4X65 B;  4LF5 B;  3L2P A;  5FPO A;  4GKK B;  3THO A;  4NXM H;  1JMK C;  1A0I A;  5JJN B;  5EIB D;  4GYC B;  2YCH A;  3NBZ B;  4JI8 B;  3RYF B;  3U0Z A;  1QHT A;  4IHJ B;  4DV6 B;  2PYJ A;  4FFB A;  5IYZ B;  4PZ7 A;  3MWM A;  3N41 B;  2UXC B;  2OYQ A;  5FD6 A;  4YY3 B;  4DR6 B;  2HVS A;  4BW9 A;  4JYA B;  1I94 H;  4KL1 A;  2ZNJ A;  4DR2 B;  5IWA B;  3RYF A;  5IJ0 B;  4MTE A;  4EB6 B;  2HEP A;  4IHJ A;  4DV7 H;  4DR4 B;  4O4H B;  4YJ3 A;  5IYZ A;  1N34 B;  3C0F B;  4JI2 B;  4UCR A;  5K1P A;  4JI0 B;  5FNV B;  5LP6 B;  1IBL H;  4K8X A;  1SQG A;  3JSN A;  5IJ0 A;  2ZJT A;  4EB6 A;  4WBN B;  4YHH B;  3OTO B;  2UXD H;  4HBN A;  4O4H A;  2RGR A;  1FJG B;  4F6R B;  1DGS A;  1TAE A;  4I50 B;  4AIL C;  3RF2 A;  5FNV A;  5LP6 A;  4LMY A;  1HR0 H;  1YEW A;  4FLT A;  3IAY A;  1NT2 B;  4LF6 H;  5IT9 W;  4WBN A;  4JI7 B;  4BWS C;  4FLZ A;  4F6R A;  2VUG A;  4NXM B;  1XMO H;  3N40 P;  5JJE B;  4I50 A;  5EZY A;  3JAK B;  3BAA A;  2WYO A;  4HNA A;  1Z2N X;  3RGX A;  4DV1 H;  4JI5 H;  4JV5 H;  4L8J A;  4EEQ A;  1O9H A;  1N33 H;  2CAZ C;  3RGB A;  5J2T B;  3L4K A;  1E4G T;  4LFB H;  1ZHS A;  1KMI Z;  4DR5 H;  2UUC H;  4B3R H;  1AN7 A;  1I94 B;  5LOV B;  5DIS C;  1JFF B;  5CA1 B;  1SEI A;  1XMQ H;  3GJX B;  3RYI A;  4Q6G A;  1SA0 B;  4BWA A;  4DV5 B;  2QM4 A;  2HHH H;  3HKC B;  3RYC B;  5J2T A;  4JI4 H;  4LF4 H;  5JCO C;  1S5J A;  4EFE A;  4PI0 A;  3SR2 C;  1O75 A;  3QG5 A;  4FM0 A;  2HVQ A;  5LOV A;  3T1H B;  1JFF A;  3E22 B;  1IBM H;  4UCV A;  5C8Y B;  2Q7H A;  1SA0 A;  1WNS A;  4X64 H;  4LFA H;  4JI3 H;  4FLW A;  1M5I A;  4X1I A;  3HKC A;  1QQC A;  2RGV A;  1P16 A;  3TY8 A;  3KAJ A;  3SJC C;  2JVD A;  2PZS A;  2O03 A;  5ITZ A;  3JAL B;  2VWJ A;  3E22 A;  4LF6 B;  3S24 A;  1O9G A;  4RB2 C;  5C8Y A;  4LSX A;  1JJO A;  3UQ8 A;  4GKJ B;  3N2K B;  4FLY A;  2YXL A;  4X62 B;  1XMO B;  4FLV A;  1M93 A;  3ICX A;  2F93 B;  5LXT B;  3QF7 A;  3JAL A;  4D7S A;  2QJ1 A;  3EYY A;  3M4I A;  2YIA A;  4JI5 B;  1HNW B;  4JV5 B;  3GB8 B;  4TOI A;  2PYL A;  3W1G A;  4RZQ A;  3BHP A;  3W5O A;  4LFC H;  4B3T B;  5D5P A;  4ZI7 A;  4DUY H;  4LFB B;  1XDN A;  4Q0Y A;  4DR5 B;  3N42 B;  5LXT A;  3JAT B;  4B3R B;  2BTQ B;  4TUY A;  4TQD A;  1XMQ B;  4DV0 H;  4LNU B;  5LMN B;  3U10 A;  4X20 B;  2JGU A;  1CKN B;  3CB2 A;  1SKV A;  4JI4 B;  4LF4 B;  3FMA A;  3WB2 A;  4APM A;  3NC0 B;  3OTF A;  5KX5 B;  3VNN A;  2ZCE A;  3BAB A;  3N43 B;  3JAT A;  2BTQ A;  2UXB B;  1IBM B;  3M7M X;  4LNU A;  3N44 B;  1SQF A;  2ZIO A;  4EFB A;  4X20 A;  1XK5 A;  4YJ3 B;  4PZ8 A;  1CKN A;  3JAW A;  4D7T A;  4CS2 A;  5KX5 A;  4IAJ A;  1HW7 A;  2VWK A;  5KHK A;  3NBY B;  2R70 A;  5EIB C;  4I7H A;  4B3S H;  1I6U A;  3RYH B;  3JAM W;  3LML A;  2GV9 A;  5D1P A;  4PHZ A;  5IJ9 B;  4DV3 B;  5KHI A;  2RQ6 A;  3ZED A;  1HNX B;  3K5L A;  4NVP A;  1Z5W A;  1KU9 A;  1B04 A;  4CH3 A;  2UUA H;  1RSO A;  4A2B A;  3TY5 A;  3RTX A;  3RYH A;  1FVI A;  3JAR A;  4JI1 H;  1ZAU A;  3H20 A;  4O2B B;  4DRF A;  5EZY B;  4FM2 A;  5IJ9 A;  1S03 G;  4UCO A;  2HIV A;  2E3C A;  5JQG A;  4HNA B;  2ZM6 H;  4AQY H;  4DV0 B;  4UCS A;  1FFX B;  4CS3 A;  4DRX B;  1WN7 A;  4J0M A;  2IM9 A;  2V4D A;  3KXY T;  1HNZ H;  4LF7 H;  2FE3 A;  1T5E A;  4O4J B;  1CKO A;  4O2B A;  2Q2T A;  3SGI A;  3U11 A;  4UCU A;  3WB0 A;  3RYI B;  4LF9 H;  4DR7 H;  4KHP H;  1FFX A;  3RJ0 A;  4DRX A;  5KMG B;  1XQ8 A;  4CC6 A;  2YI9 A;  3RGZ A;  4I4T B;  4IIJ B;  4PI2 A;  5LA6 A;  1WH2 A;  4O4J A;  4FLX A;  4DV2 H;  2HIX A;  3DSQ A;  4JI6 H;  3JSL A;  3BA8 A;  1SYX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...