4UCUA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucuA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucuA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucuA02
3GDEA 1XNQB 2OWOA 4YY3B 5FPOA 4EQ5A 3NBZB 4TOIA 4GLXA 2UXDB 4LFAB 1IBLB 4JYAB 5D1OA 2Q2UA 1XMQB 1J5EB 1V9PA 4YHHB 1HNXB 1N33B 4LFCB 2UUAB 2E5LB 4DR2B 2UXBB 4DR3B 4PZ6A 4DV6B 5D1PA 1P16A 1B04A 2Q2TA 3BA9A 1P8LA 3BABA 2HVSA 3JSLA 2ZM6B 3TY9A 4GKKB 2UUCB 4LF8B 3SGIA 1X9NA 1CKMA 4CC6A 4LF7B 4LF9B 4B3RB 4DV0B 1CKNB 1CKNA 4DV7B 5LMUB 3JSNA 4UCTA 1N32B 5D1OB 2HVRA 4DR6B 2VUGA 4EFBA 4JI2B 1HNWB 4JI3B 4X64B 1N34B 2HIXA 4DRFA 3VNNA 1VS0A 4JI1B 4X65B 2VQFB 4DV1B 5DISC 4JI7B 4LF6B 5FPRA 4LF5B 1DGSA 1A0IA 4DUYB 2UXCB 4PZ7A 4DUZB 5LMNB 3BAAA 1CKOA 4LF4B 4UCUA 2CFMA 1XDNA 4JI5B 3NC0B 3KYHC 5BR8B 4UCRA 1FVIA 1IBKB 4UCVA 4EFEA 3L2PA 1TAEA 4B3TB 3RR5A 4DV3B 3GB8B 4DV5B 1TA8A 1XMOB 2F4VB 1ZAUA 4X62B 4DR7B 4B3SB 1FJGB 3RTXA 4DV2B 1S68A 3T1YB 4JI4B 4NXMB 3BA8A 4UCSA 3TY8A 1XK5A 4PZ8A 2VQEB 4KHPB 2HIVA 4JI0B 4UCOA 3GJXB 4B3MB 4JI8B 4LFBB 1IBMB 3NBYB 3TY5A 4K0KB 4DR4B 3QWUA 4AQYB 3W5OA 4NXNB 4OX9B 4EEQA 3OTOB 4UFZA 5IWAB 1I94B 3PN1A 2HHHB 4CC5A 1HR0B 1XNRB 4E6NA 4X66B 3W1BA 4DV4B 3UQ8A 2HVQA 4LH6A 3T1HB 4JI6B 3W1GA 4JV5B 4DR1B 1N36B 4DR5B 1HNZB 3S24A 2UUBB 4LH7A 4GKJB 2UU9B
chains in the Genus database with same CATH superfamily
3K58A 2EBOA 3H1JH 2W9CB 4QGPA 2W8KA 2JS5A 5IP7G 4P9OA 3T9DA 3CVZA 4QW9A 3BFRA 3WO0A 1BCCH 4YHHB 2QWPB 1HR0H 2HP8A 5EYPA 3M7MX 3O65A 3T5JA 4O3SA 5DGAA 2KSDA 4O84A 1B04A 2ZDGA 3CRQA 4O4IB 1K5QA 2Q2TA 2CQYA 5A2QW 2IJKA 3CC7V 2YZNA 4ECUA 4X62O 1SQQH 3JZFA 1R3JC 5KT7A 4APMA 1CKNA 3OEEG 1Q8IA 3K04A 2C2DA 5D1OB 3H40A 4O4JA 1V4YA 4AHCA 2YU9A 1AUXA 4DRFA 1TUBB 4YBZB 4X65H 2DABA 1OCOB 1HNZO 1Y1VA 5BWWA 4A5UB 2RCVA 1TWFA 4QNHB 2EIKC 4JYCA 4ECYA 3HKEA 3AG2C 4DK1A 2YS8A 3CX5F 4Z2WA 3J81W 4O4LF 2FE3A 4DLKA 1NI8A 1Q86W 4B3RH 3GIPA 3K9AA 3GB8B 3J80N 1XBLA 3N40P 3IJ4A 1HR0O 2F4VB 4FBTA 5ITZB 4QW8A 1QCEA 3ZS8C 5KFQA 2FPGB 3SYAA 1FJGB 2GLTA 3T1YH 2LQTA 2PGGA 2VQFH 1R3LC 3AK3A 4UCSA 1NS1A 1ZX3A 1AI7A 1IXBA 4LF4H 1YJWV 2R8JA 3GWOA 5IJ9A 3GV5B 3GJXB 3RWRD 4XZ3B 4A3EG 4A3MG 3H4DA 1S0OA 4UUJC 2HR3A 5IYZB 5DGBA 1O9HA 2QR4A 5BXZA 4K0KB 5LBQA 1NVPD 4X65O 3CRCA 4YJ3A 2BQUA 5LL6b 1ZQ7A 3OTOH 1UC9A 3LDEA 5J2UA 4NZMA 2CAZC 2KG7B 2HJWA 3IG0A 4QWEA 1JR9A 5BYBA 2PI5A 5KAFZ 5LA6B 5IJ0A 4FLZA 4RNNA 5H9CA 1M4UA 2ZDIA 2HVQA 3SPGA 1M1KW 1VF5B 3K06A 3L74H 5IY5B 4B3RO 3QO7A 4GX5A 4FLYA 4DR5B 5BYAA 2W9BB 4F4XA 5IE9A 3T9CA 4GC7A 4IAJA 5JH7A 4O2BB 2DQ3A 2WPDG 2ZXWB 1I3QA 3STLC 3G8CA 2VQFO 2PI4A 2QM4A 2D3OW 1Q6HA 3LWBA 3O9OA 1E1QG 1V9PA 4QSHA 3IGAC 3ZMSA 5A2QN 4LF4O 4D7TA 2GV9A 1K5SA 3DGEA 1E4EA 5LYJB 2FLLA 4MTXA 2WAQA 5KHJA 3FDSA 3T1HH 3GB7C 1D5NA 1BXRA 2BQRA 4C7UA 3GTJA 1JJ2U 1UFIA 2JEFA 1BMFG 3OTOO 3SGIA 3UO2A 2QJ1A 3ETHA 4J9KA 3JZIA 4DYLA 4IZOA 4DR6B 4HN2A 1RPOA 5CN0A 3WO1A 4ECTA 1SETA 1HNWB 4RB2C 3RB6A 2JA6A 1E4FT 4F6EA 2X6CA 5L1KA 1Z2PX 3MWEA 1SC5B 1JJOA 1SQXH 4DUZB 4W4LA 3I56V 3SE7A 2L35A 4DL2A 1QVGU 2IBKA 1NH2B 1ET0A 2W57A 3PJSK 1XUQA 2VS0A 3JAKA 4DV3B 4O4HA 4IRCA 1Y1WG 2GHYA 1IURA 2R70A 1N32H 1BZKA 5EIBC 1GM7A 3E5NA 3PFFA 3E86A 1X59A 4GYCB 4X64H 2W8LA 5BY1A 1SEIA 3T1HO 4RB1A 4WFHA 4P30A 4O81A 2P22C 1K34A 3GTKA 3ZRWA 1OCOC 3CP1A 5BMVA 2DIKA 3OD4A 3T99A 4Q8FA 5BR8H 1A32A 4UCOA 4B3MB 3OTFA 3WB2A 5F9NA 3LSQA 4LFBB 1ZWIC 2XOKG 2QGNA 2IBZH 3VOUA 2IW5A 5HBRB 4NXNB 3HR0A 4UB6Z 2ZIOA 1R9TA 4L8JA 2EJ2A 1JDBB 2OCHA 4C5BA 3RYFA 2EZOA 4U6PA 1AP6A 2X6BA 3BRCA 5KG3A 3JALB 1KUTA 4YJ2B 5L1IA 3ZHQA 3ETQA 4BWSC 2B5UA 3C90A 1OV9A 3TJTA 1HNZB 3R5FA 4ZI7B 1N32O 4K8XA 4MS2A 1WR2A 2W9AA 4TQFA 2YZLA 4X64O 3OUUA 5KT4A 2NR5A 5KG1A 3ZRXA 4M0JA 1R73A 2R9IA 2PYLA 2Q2UA 1YCIA 2IU0A 4J9QA 3A2FA 4K35A 2JA7G 1KP3A 2EULA 3JATB 5DQIA 1S9FA 5BR8O 2W0XA 1KBHA 2QWQB 3UM7A 1SZXA 3HOWG 1GN2A 2AGPA 4BWAA 1SA0B 3THOA 2W71A 2MW2B 1I1KA 1XHZA 1N36H 4Z1MG 3WFVA 1VBHA 5CA3A 4QJFB 3ABTA 3JAWA 1CKMA 3KHHA 4PDMA 2XASA 3EFFK 1PNLA 3Q8QB 4YJ3F 2C22A 5EWGA 2ZXWC 5BWVA 3BJYA 4JI2B 1N34H 2HLDG 5J2TB 2E2HA 1SQVH 4WBNB 1XQ8A 5J2UF 1JLLB 1VS0A 4X65B 1Q90D 3OSNA 2HG8A 4LNUB 3PW7A 4PZ7A 2IJIA 2EIYA 3U9SA 3N2GA 1JA8A 1YI2V 5BPFA 1M57B 3QO5A 1JXLA 2LFSA 4DL5A 4LF8H 2W7OA 2YIBD 3T2MA 4B3TB 1PPJH 3HBLA 5KS8A 1WP7A 5JH7F 1RPRA 2EINB 3B8MA 3T9FA 3CMEV 2ZT9B 4B3SB 1S5JA 3E22A 2D2CB 4J7KA 3KAKA 4F50A 1WB7A 3GWKC 3T1YB 1N36O 4F6RA 1AUVA 2P0AA 2ZJTA 2WA4A 1FS0G 3K5IA 1XK5A 4HAMA 2ASDA 2WA3A 3TEKA 4IIJA 1JFFB 1LUVA 5CBGA 4J9ZB 4J9RA 1DTOA 3DSQA 1IBKH 4JI8H 2F95B 2OIGA 1AI6A 1K1SA 5DGIA 2V4QA 1N34O 3IC9A 1HWYA 3NR7A 4YIOA 3JAMW 5KG6A 4Y8VB 3N27A 2E75B 3OW2U 5JJEB 4PA7A 3UKMA 3K5LA 5KA6A 3OTOB 1R3KC 1L8DA 1KUQA 4DAAA 3SPCA 1JCHA 3J7AK 1V54B 5FLMG 3RF2A 1Y74B 1T3NA 1RJPA 3HKDB 3G67A 1KB9F 3B09A 4LF8O 2ZINA 4O4LB 2HJFC 4NR1A 4TQRA 2JA6G 2NU9B 4A3CG 4X88A 4FBUA 4J9YB 1EKFA 4JYAH 1FXVA 4A2BA 3JASA 1YHQV 1DF4A 2ZNJA 5JJNB 4BR6A 2PTMA 2W6PA 3V6JA 4EBEA 2XCLA 2FLPA 2DMXA 4ZHQF 2QWOB 1IBKO 4JI8O 5EWEA 2FLNA 3RBEA 5D1PA 4A3JG 2JRIA 5J9PC 1UJWB 3E35A 4EB6B 5BMVF 1B06A 2UU9H 2AW9A 2H94A 2NVXA 3W7UA 1I08A 5KFMA 1NR7A 3E8BA 1M6VA 2HJDA 2GDSA 4PDLA 3T4ZA 3K9SA 5H6QA 2QSAA 2JS3A 3SDLA 5KT5A 3ZMZA 5KX5A 4PDBA 2EIJB 5KG2A 5B3SB 2I8CA 4FPPA 4JYAO 4PJ0Z 3M9NB 3PO3G 1FVIA 1RK5A 3HT5A 3FAVB 1PX2A 3CHXA 1A48A 2WLIB 3RR5A 2ADQB 2I87A 2ZGIA 4Q6GA 3EVKA 4MVQA 4U3JB 2LJ2A 4FFBB 1DV2A 1SKVA 1K8AW 5GTIZ 3KHGA 4KL1A 1KJ9A 4MVSA 4WF9V 4DV2B 1VKZA 2Y4RA 3D3QA 3D36A 3LQSA 1CP9A 2WB1A 3L4KA 4M9UA 1T94A 1MSDA 4JTAB 2UU9O 1I1LA 4Q4DA 3R9RA 1L0NH 5KT6A 3H1IH 4J9MA 4U7OA 4O3OA 4KHPB 5JCOC 2QTSA 3CJHB 3H1KH 3QVNA 1IBMB 1Q5OA 1M57C 5L1JA 3OUFA 1ZETA 3RB3A 3N8DA 3FKSG 4KP4A 3C0FB 2F4VH 2Q7EA 3CB2A 2MK3A 3OM3B 4DQNA 3FKIA 4YR2A 4RAYA 3CXCU 5DM6V 1PM9A 5KFRA 2EINC 2R72A 3S3XA 1N56A 1VQPV 1Z2OX 4H33A 1XL4A 2JGDA 2ZR3A 5LP6A 3HOVG 2RF4A 1QBZA 4PV1B 3TCUA 2UUBB 3TGUH 2YRXA 3AG7A 1K9MW 5B1NA 4MV1A 4K0KH 4FGRA 1NZ6A 3UCSC 1K4DC 5L3DA 5B5EZ 4K6NA 1WLEA 4HBNA 2FKXA 2R9AA 2WAQE 4G3IA 4BW9A 4QWDA 4MV9A 4ZOLA 3T9EA 2CGOA 1OZ0A 3AG1B 5EBLC 3K79A 3JYCA 2QKCA 4UV9A 4IRKA 1V54C 4ECSA 3GIQA 1P8LA 2XNDG 1MSWD 1I1MA 2NLJC 2F4VO 2UUCH 1PNMA 4IIJF 3VQVA 3N6XA 4DV0H 4CC6A 3MAQA 1CKNB 1GRJA 1GSOA 2VUMA 3ZJZA 2NN4A 3ZMUA 3LP8A 3KCXA 3U0ZA 1N34B 2COGA 1OBDA 3HKBA 3VMMA 4XX0B 4PI0A 4J11A 4MW8A 4K0KO 3M4IA 4JI5H 2YDEA 5LMNB 5JQWA 2NVYA 2CFMA 4A3DG 3STZC 4PA6A 4UCRA 2DLNA 3U54A 3KXYT 1H2NA 2N04A 2WLKA 4DO2A 5JUMA 1EUCB 2DYSB 3JD0A 2R87A 3KZIZ 3DTGA 3WWJA 4ECWA 1H8EG 1NR1A 1KD1W 1XMOB 2R7ZA 3D8CA 1ULZA 1HNWH 5KHGA 3B40A 2NU8B 1COWG 4ED7A 1YJNV 2UUCO 4CKBA 4PA4A 4DUZH 4WFFA 1BL8A 5KFIA 2COIA 5CA1A 4MTEA 2EIJC 5IJ9B 4J7ZA 2CTRA 4I50A 2AGQA 3ZHVA 1B33N 1H38A 3KALA 2OH2A 5B3SC 4JI8B 1TWGA 1EUDB 4DR4B 4YJ3B 1GMGA 4HNAB 2XT9A 5KFLA 2CGNA 1AJPA 2YXLA 3TW6A 3BG5A 5J2UB 1IYEA 1HP8A 4EYHB 2CTPA 2UXXA 3UT5A 4JI5O 4ICGA 1TVKA 5KKNB 2A7WA 4RAZA 4QIWA 5C3EG 1FD9A 3AYHB 3J80W 3OMIB 4A3BG 4JI6H 1DIKA 5KX5F 2FYUH 3GTOA 1ENVA 4I0XA 1ORQC 4J41A 4DL6A 1M56B 1I2LA 3V4SA 4B3MH 2CW7A 4X1IA 1WNSA 1G6UA 3E8FA 4LFBH 5JH7B 3G6XA 1HNWO 5C8YA 1BT8A 4RUAA 4BY1G 2W0FC 1A9XA 4NXNH 2YL2A 1Z5VA 2J9GA 4JYAB 3ZMVA 1VAJA 2M05A 1B3QA 3MWDA 4J9NA 1H2SB 4DL4A 4DUZO 4RQEA 1I50A 1HNXB 3KHLA 1P84F 4LFCB 4YXWG 2WLJA 5H2FZ 3DTUB 2GBOA 2R7NA 4PHZA 5CM0A 2R7KA 1DAAA 4DV3O 4CH3A 3ZX6A 3BABA 3LSSA 1FFXA 3ZBHA 3OGIB 4FFMA 1ZL8B 2FK3A 5KFCA 3KHRA 1X9NA 2XCPA 3K0DA 4JXUA 2E76B 2QM8A 2A3QA 2Y69B 5JWPA 3GIIA 3VA7A 5D8DA 2YI9A 3QG5A 4JI6O 2Q7DA 5E25A 2QTOA 2ITDC 1EBOA 3MR6A 1AJNA 2KQXA 4B3MO 4LF6B 4J9SA 4LFBO 2UXCB 2R85A 5BWRA 2WLLA 3AG1C 5CA0F 5CE8A 4HNTA 5KFAA 2R93G 4NXNO 1QR9A 1PKXA 4I7ZB 3JD3A 1H2GA 1W59A 2FPPB 3ASOB 3JARB 1Y66A 4UB8Z 4O2AA 4CMDA 1I7FA 3CC4V 4DRXB 3F7YC 4FLUA 3AW8A 3IAYA 4CZZA 4JI2H 2JDIG 3S3WA 5KMGA 4ZHQB 1MMMA 1MZEA 2RDIA 1RSOA 4A3GG 1WCMA 4I5SA 3GILA 3ZRWB 3ZEDA 2WLNA 2DZDA 2V58A 4ZOLF 3SNOA 4TQSA 1F4NA 2E2IA 1JMKC 1WN7A 5BMVB 3HKZA 2R92G 5CMUA 2OCCB 4TVIA 1VQOV 2VPQA 1QR8A 2DJVA 4E2LA 5L3FA 3IFXA 1O9GA 3CXHF 3GVMA 4B3TH 5JVDB 4O7TA 3MR2A 2BTOA 3H1LH 3QWUA 3RGBA 3GIJA 2QE7G 1N0NA 5KFZA 1UNNC 1LNQA 1QNMA 2VA2A 3HOUG 5KHIA 1Z2NX 3GV7B 2DYSC 2CNVA 4YQWA 4B3SH 4EG0A 4UFZA 2CUGA 5F9LA 4GCZA 3RYFB 3E89A 4MTGA 4R8UB 3E8HA 4JF3A 5DG8A 1YTFB 4HR7A 3RN4A 3TQ1A 2QEXV 3GIDA 3R65A 1Q3EA 1I5YA 1Y6XA 2Y0PA 3GTPA 4ZQIA 3SJBC 4X1KB 3APOA 4TV9A 3WB1A 1AP5A 4FMTA 1KKDA 3SPHA 4ZIBA 2Z0AA 2RJZA 2IH1C 4JI2O 3GDEA 3RV3A 3H20A 1ZTEA 2C35B 4J80A 1GN3A 2Q8VA 1QLNA 1VF7A 1IBLH 4IL6Z 2UXDB 4MW3A 4QPKA 1WAZA 2EX3A 1RJRA 3T4DA 3BACA 4MTFA 1AB3A 3B2EE 3QTCA 4TUYA 4DW1A 4TWKA 5FR9A 3UZOA 5KFJA 1Q82W 2OYQA 2Y4TA 1QLEB 4B3TO 1SRYA 5GONF 3BA9A 2FB9A 1M90W 3E83A 2W6ZA 5CA1F 2X0LA 4B3SO 2UUCB 1I2KA 4NVPA 4I50F 1M56C 3CCMV 4MT8A 3M9OB 1GKFA 3DC6A 4JZ2A 4DV0B 3T1YO 1K73W 3Q8PB 2PY5A 1VARA 3LUTB 4IYIA 3DTFA 3ASNB 4NYKA 5KT3A 2AZ0A 2G38A 4NB5A 3HXLA 2VQDA 3SYOA 1M0WA 3VOTA 3CC2V 4K3AA 4QIWF 3N2KA 1K92A 2FMLA 4PDVA 2R8IA 3CWBH 1X4TA 4BIZA 5KFSA 3RGZA 2W70A 4JI5B 1IBLO 3KYHC 3HKCA 4TV8B 5KLVH 2A1HA 2ARHA 3W7TA 2YICA 5EBMC 2WB1E 5C8YF 1AILA 3T5KA 4B08A 3ZHUA 4CS2A 2Y69C 5EZYA 1BQZA 3EHBB 1YXBA 1S5LZ 2DYRB 4ASUG 3CRMA 2ZD9A 4WCEV 4CH6A 4PD4F 4EGJA 2CH7A 1S76D 5KG5A 2B9ZA 2WAMA 2H3OA 4PZ8A 2WTFA 1F4MA 1S3JA 2Q0AA 4IIJB 3L4JA 5HNEA 1VQKV 3ZMTA 2RGVA 2CE4A 3ML0A 5K3WA 2RDJA 4O7SA 5BPHA 5K2MA 2W9CA 3BQ2A 4NTWA 5IYCG 3ASOC 2CKZB 1VF6C 3OHBA 2ATKC 2C2EA 3AK2A 1K4CC 4DV2H 1SQGA 4GX0A 1XNRH 3I5DA 4OGQB 2FJZA 2ILMA 1EN6A 3MR5A 2L6LA 4I4TB 4X66B 4DV4B 4O4IA 4JI6B 4KHPH 1TWHA 1ZHQA 3ZHSA 4FM0A 1XNQH 4GKJB 3HO8A 5KFNA 2OCCC 1NQTA 1IBMH 3MWMA 4UVAA 1EKVA 3T7AA 4O2AF 1K97A 4GT1A 5D1OA 1TUBA 1WPXA 1VQ4V 2Q7HA 4X89A 5B1BB 1N48A 3RUPA 4D6TH 4O4JF 4DR3H 1IVSA 2GQRA 2ZDHA 4PZ6A 2DWDC 1NVPB 4OXSA 4XDLA 3ZHRA 3LDCA 4EGQA 2IJHA 4J9PA 3JSLA 1GSHA 3N6RA 2HGXA 2UUBH 2FP4B 1H2KA 1GM8A 3OGCC 4LR3A 4A3IG 4TSFG 1Y1VG 2JGUA 4E4EA 4C5CA 4UVCA 1OWTA 2LO1A 4DV2O 3BVOA 1WA8A 3BQ1A 2DQ0A 2GTAA 5LMUB 1XNRO 5ITZA 1SYXB 4R8CA 4UCTA 3CCEV 3V6KA 2BSKB 1Y14B 3K03A 4FFNA 1OCRB 1BE3H 4ED6A 4LC1A 4KHPO 2NUAB 2BCCH 2Q69A 4DV1B 5KX5B 3K5HA 1XNQO 4P2ZA 1RK6A 3L71H 2ADPA 1IBMO 2UVVA 2J6SA 5KFBA 4FFRA 4CS3A 1QLEC 3G80A 5C93A 1EFRG 2QKAA 4U3FH 2YS6A 2DOSA 4LP8A 2PVPA 4JGSA 4O7RA 2ITCC 1PL0A 2VR1A 3UO3A 2AHYA 1BNCA 1YIJV 4DR3O 3ZRSA 3H3VH 3CCVV 1R6KA 1XOUA 2Z5UA 4FFOA 2BQ3A 1BGWA 3TINA 5LA6A 4JASA 4ECVA 1YVWA 1D5AA 5LGUA 1EN5A 1KC8W 2UUBO 3ASNC 3I4NG 3PR5B 4TUYF 1VIBA 3RYIB 2XHBA 2IM9A 3SYPA 5LMNH 1CEZA 2YEVB 2JJ2G 3W7XA 3L72H 4ETSA 3PZPA 4J7JA 5EWFA 3ORQA 2W9BA 1S72V 4KUMA 5JQGA 5L1LA 3N42B 3L75H 1QVFU 5CR5A 2BOBC 4AI8A 3VQWA 4O3RA 3EXAA 4WFBV 1XMOH 3APQA 1NT2B 4J42A 1B6RA 3TIIA 4QIWE 3K5MA 3DF7A 2W6IG 3ETGA 2A79B 1CS0A 3PN1A 3SPJA 5DAAA 4WHXA 5C44G 2BOCC 4E4TA 4GLWA 5LYJA 4RUCA 4FS1A 5CA0B 1GO3F 1MZBA 2JGDB 2O03A 2DYRC 3QQMA 3CCQV 3W1GA 5KG7A 2HEPA 4JUZA 1LUWA 3DXRB 5EDWA 4X1YB 3K3VA 4DR4H 3ABKB 3AEIA 4UVBA 5HFMA 3NBZB 3NUAA 3OHAA 4J9OA 2RGRA 4IRDA 1IBLB 1SF9A 2QDOA 1W93A 3RYCA 5FLXW 2CTWA 3DAAA 5LMNO 2UUAH 4GX2A 2UXBH 4XDJA 2K1EA 2IU3A 1SS3A 4DR2B 4QE9A 1Q6IA 1IYDA 2YSUB 5EZYF 3OSPA 1K83A 3WU2Z 1SZTA 4LWSA 4F4YA 5F2VO 2QWRB 1XMOO 2R82A 4QPJA 1YITV 1RM1B 4LF9B 2N05A 3OMAB 1BS3A 1ZUQA 5FL7G 1YJ9V 4O4HF 3OEHG 2RQ6A 1NJIW 3MR3A 1GM9A 1HNXH 2AXTZ 5L3EA 3HKBB 4LFCH 4I55A 2FPIB 4O3NA 4IR9A 5IYBG 2DWEC 3TXQA 1XDCA 1A0IA 5B1BC 2OTJV 4DIMA 1GLVA 4RUFA 4DR4O 1N4CA 1CKOA 1F23A 1KT8A 4UCUA 3G8DA 5DQHA 4B7KA 5LOVA 4O4IF 2W6NA 3VPDA 2X7RB 4EFEA 4PA3A 2R8HA 3LNNA 1OCZB 3MJFA 2UUAO 2UXBO 1RYRA 4DR7H 4XYLB 4N23A 3TXSA 4RNOA 1GN4A 3UYYA 2M6YA 2V4RA 4B7EA 1F7YA 3HKZE 1TUEB 1G1XB 3MD0A 3OAAG 3RTXA 1S68A 1VQNV 2QYZA 3Q2OA 2FKLA 3JALA 4LF6H 3RJ0A 1OCRC 3EPIA 5GONB 1VQ8V 2UXCH 3BEHA 1YSCA 2OTLV 1JPXA 5CA1B 2JVDA 5TISZ 2X0SA 4WFGA 4ZI7A 1Q7YW 1KMIZ 1R3IC 4I50B 2AGOA 3SI8A 3K59A 4FM2A 3JCZA 1K33A 2PN1A 3NGDA 1HNXO 3ZIAG 2UVUA 4LFCO 2ZKOA 1I7NA 1B6QA 3FB6C 4H13B 4Q8EA 2EILB 2Y48A 4EEQA 4Q4CA 2QWNB 2E74B 3JCUZ 5IWAB 3H0GA 3JATA 1I5XA 2VA3A 3VPCA 4EEYA 2RDCA 2XAGA 4DK0A 1XNRB 4BIOA 4E6NA 3D36C 3UQ8A 1KU9A 4LH6A 1MOFA 5GW7A 4I0XB 3MHHC 1BJTA 4JV5B 4NKGB 5FD5A 3FYIB 1S5HC 1EN4A 1PNKA 4X1IB 5FLXN 4DR7O 4QJFA 5KFUA 3BPZA 2PZSA 2JA5A 1XNQB 2DWCA 5C8YB 4O7VA 2GUZA 3HB3B 2MCTA 2CW8A 2XCAA 1US6A 1FYJA 4YP3A 1FXKB 2YUAA 2O57A 2WWWA 4LF6O 3JRXA 2UXCO 3CRRA 3OT7A 3BY6A 1K7DA 1W0JG 1VQ5V 2GTSA 5KUMA 4AILC 3RVZA 4FM1A 5IYBO 5LA6F 5I5WA 4DR3B 2NU7B 5I5UA 2ZM6H 4RWUA 4O7YA 1XREA 3MHSC 3WNZA 3TY9A 2VPSA 4JTCB 5JQGF 1CQIB 2P4KA 2UXDH 1GO3E 3KTMA 4DV7B 3ABKC 1L1FA 5L3BA 1XEQA 4QWBA 4F4ZA 3I4MG 5DG9A 4JI1H 4JV1A 1DK1A 4QWAA 3OR7C 3VBBA 3C3TA 3JRWA 5EYPB 4LF5B 2DE0X 4DUYB 2WLLB 4XDKA 1KECA 3W7SA 5LYJF 2XAHA 2PYJA 4DL7A 1EZJA 3FMAA 4LBEC 4CKEA 1GAXA 3Q8RB 2FTKA 1GK9A 1RP3B 4O2AB 3FX7A 4DV5H 1JX4A 2YI8A 4MA5A 1WSCA 4A2AA 4IHJA 2E3CA 5BZBA 1RM1C 3PW5A 1GTOA 1CE8A 4O4JB 1RSOB 4HYOA 1CXZB 4DW0A 2EJ3A 2ZM6O 3G6YA 2Y0SA 3HKDA 2QK4A 2YZGA 2PBZA 4RUEA 1YF2A 3HKEB 4JPRA 3AK1A 1N8RW 2IH3C 3CCRV 4ZKIA 1M9NA 2Q73A 2UXDO 4FM9A 4JI0B 4ED8A 3QF7A 3ETJA 4C5AA 2OIEA 2ZDQA 1FXHA 1PK8A 4JI1O 1Z2GA 1XILA 4AQYB 3ETDA 1VQ9V 4PA9A 4K8ZA 4IT5A 3CSWA 1KJQA 3OUZA 3A0HZ 1OCZC 4BY7G 2Q67A 5EIBD 2YWVA 5DG7A 4UUGA 4O7LA 4FLXA 4I55F 5KUKA 3M9MB 1AR4A 1XI1A 2NNUA 1KTAA 2ODMA 4FFPA 4O7WA 5FJ8G 4EB6A 4DV0O 1KJIA 4Q45A 4FFKA 3Q4HA 4HYKA 4FFLA 4F4WA 1Y76A 1EHIA 3RV4A 5LOVF 5IYDG 2OWOA 2UVRA 3BQ0A 3RVYA 4ED3A 2EJ0A 2A9HA 2ASLA 3A0RA 1WRVA 4OPAA 5IT9W 4IWXA 1S0MA 3CS5A 1J5EH 2DPJA 1OHHG 2P90A 4EBCA 2Z04A 3WG7B 4TUYB 3U55A 5IDJA 3I12A 4D7SA 2UUAB 2EILC 5IJ0B 2UXBB 3DC5A 3RYHA 4X66H 4DV4H 3T9AA 3GIMA 3F8NA 2ZQMA 3ETEA 1P16A 2LP7A 3KREA 3F7VC 3SPIA 1XHXA 5LHHA 4GKJH 3GQCA 4ZI7F 4NTXA 2ODTX 1JVMA 3I55V 2YZMA 3CQZA 1VQLV 3RBDA 4FFBA 4LSAA 2XGPA 4MVUA 1SERA 4F4LA 1BQ0A 1FXKC 2LGQA 4O7NA 2W6JG 3ABMB 1DF5A 4TT3G 1TWAA 5DISC 2IJJA 4J9LA 2ZE6A 1E4EB 1S77D 3F5TA 5I5YA 4ED1A 2XAQA 2KB1A 1L2ZA 1G4YB 3WB0A 1S10A 3H4BA 2KKWA 4OPHA 3U10A 3CJHA 4JYBA 1SCUB 3ZN1A 1J5EO 1Q81W 1TAEA 5CB4A 1KJ8A 2Q0OC 1RYSA 1I7LA 3RW0A 5LMUH 5DLGA 3AX6A 2JA8G 4DR7B 4X66O 1EZ1A 4DV4O 1I6UA 2W6OA 5LGNA 5EZYB 2UXNA 4DV1H 2HHFA 3N43B 1URFA 4JI4B 2JJ1G 3BA8A 2ZCEA 4X20A 1ZLZA 2P7TC 4JAUA 4NXMB 2X5RA 4MV7A 4GKJO 3HB9A 3TY8A 3RB4A 1QQCA 1SFOA 3CCUV 2VQEB 4CH4A 3FKIG 3RGXA 2W6QA 5LP6F 4UXNA 5B66Z 4FU0A 5KFEA 2XC9A 2VRZA 3OMNB 5IYDO 3JAKB 5C1PA 1GN6A 3P30A 4O4HB 4OX9H 5JVLA 2P6JA 1ROPA 3K0GA 3PW2A 1KEEA 1AROP 1IXMA 2VWKA 5DQGA 2XGQA 2YRWA 2P5OA 1IX9A 2HHHB 3K5OA 1Y67A 2JK5C 5IP9G 4CC5A 5H6RA 2RN9A 2WE6A 2Q9LA 1T5EA 2B1IA 5EK0A 4RQFA 3P3PA 3LNMB 2SCUB 5KFWA 5IT9N 4PI2A 4O7ZA 5LMUO 4JYYA 1MNGA 1Z5WA 3A0BZ 3FYEB 3FB7C 3SYCA 4AYBA 4LFAH 1AI4A 3RT3C 1EYZA 2EIMB 4DV1O 3LULA 4CHIA 4RU9A 4FZ0A 1XMQH 3CPWU 1NH2D 4CKCA 4IHJF 2W6MA 3D3IA 2ETNA 1IOVA 1N33H 3G71V 4BW5A 1GGOA 3FD9A 3SR2C 1XL6A 2GQSA 3R23A 2RMKB 2KSWA 1WP8A 3QNEA 2JA7A 4OX9O 5BWTA 2VUMG 1BSMA 3M99B 2ZM6B 3MDSA 2XIGA 1NTMH 4LF7H 4J0MA 2XTAA 3P32A 4NZOA 2PMZA 3CEBA 1WA8B 2BTQA 3GTQA 4HNVA 4H0LB 2HVRA 5LHGA 4JI3H 4Q44A 5FNVA 4JI1B 5L3GA 4DR2H 1FKAH 4BBRG 5K1PA 4LCUC 2BE3A 3CCJV 3WG7C 1MG1A 1KP2A 1S97A 3R5XA 4LFAO 2R7ZG 1M0TA 1XMQO 3U9TA 1YZBA 2ZDIC 5I5XA 2R8GA 2XAFA 4RCNA 3KCYA 3G6EV 2DAAA 2R7LA 4LF9H 4HNAA 1N33O 3JAWB 1PD3A 4DV5B 3K5NA 4NTYA 5DEDA 3T9BA 5EC1C 2ABJA 4RZQA 4XBFA 4RB0A 3J7AU 1H2LA 4JZGA 5LXTA 3KAJA 3ABMC 3PO2G 4LF7O 4PDRA 3RIZA 1SQBH 3N2GB 2JEJA 5JQGB 3FB5C 5KFHA 1GH6A 4JI3O 5KFGA 3NBYB 3SYQA 4QWCA 4TQDA 1G2WA 4DR2O 1FKAO 4NZNA 4IGGA 1AR1B 2QA4V 4EKWA 3E22B 1I94B 1OCCB 1WJZA 3FFQA 4F6RB 2V9WA 2RNBA 1A0GA 1JDEA 1EKPA 3U0GA 5LGTA 3EYYA 4LF9O 1D2DA 3UFXB 2F66C 1ZL8A 2XAJA 3W7WA 3T1CA 3E8GA 1HDJA 1EZVH 5CBFA 4MVRA 5CB4F 1P7BA 1VQ7V 4JV2A 2R9RB 3RYCB 1CQJB 4LSXA 5IWAH 1J5EB 3ZN0A 3J81N 2OLSA 3N44B 3V6HA 4BAYA 5KFFA 1RFYA 1V51A 4LWSB 4JV5H 2HVSA 1V55B 4Z1VA 4GKKH 2ZIMA 3JARA 4MV6A 1VF6A 2YXHA 4R7RA 5E1AC 4DRXA 2BR0A 4G28B 4I9WA 5A9GA 3WWHA 1IDSA 3JSNA 3JASB 3ABUA 4G2KA 3VPBA 4ZHQA 3GTMA 2EIMC 1M5IA 3GTLA 5KFDA 1NKDA 4I55B 3K3PA 1I0HA 5KFOA 5FPRA 2CNQA 3GTGA 3U11A 4IYHA 4MV4A 2AZ2A 5B1OA 5LOVB 4GZRB 1UC8A 3L2PA 5JVDA 4HNUA 5IWAO 3E2EA 1MA1A 3PW0A 4DL3A 3MFIA 1WCMG 4DV7H 1G8MA 1ZSPA 2Y0SE 1JIHA 2AGAA 4X62B 2I80A 4ECXA 1KBLA 1RJQA 3M8AA 4R8UA 4GC6A 4JV5O 4GX1A 2IMWP 4GKKO 4LF5H 3G4SV 4WD3A 4DUYH 4CE5A 4X1KA 5DLFA 2K9PA 1DV1A 4RB3C 2HKOA 2FL4A 4FJCC 1VMGA 4ED2A 4RAIA 4CMFA 3LMLA 4TV9F 5JJJB 2OT5A 5IYZA 3L9DA 3CCSV 4OX9B 5IYCO 2CNUA 4MVZA 2C2AA 2DN9A 3B77A 3UZBA 4X8AA 2KG7A 4U7NA 5B1AB 4H44B 1BHBA 4YR3A 5E79Z 4L1KA 1GYFA 4ZBMA 1L0LH 1HR0B 5FNVF 4MTOA 4MV3A 4YR0A 3JD1A 3LDDA 1O75A 4NLGA 3MFHA 4DR1H 3CEIA 2YC0A 1BGYH 4JI0H 2C00A 3S24A 2JEUA 4DV7O 5IY5C 4YY3H 1S0NA 2YIAA 3AG3B 1P4RA 4O82A 4JAVA 2GUZB 4I7HA 4O2BA 4AQYH 1E4GT 5H80A 4EQ5A 1Y4MA 5AG2A 3X2QB 4GLXA 3RFCA 4LFAB 2F93B 3N41B 3G6VA 1CPYA 3T5HA 4LF5O 1XMQB 4DUYO 4JV0A 5LHIA 5KHKA 3RB0A 4RO2A 2E5LH 1U96A 1N33B 2HFEC 4DV6H 3VQXA 2AQ4A 1OCCC 2LGWA 5LXTF 2W7PA 5LP6B 3A8TA 2HGWA 3OFNG 3VQYA 4YAJB 1MZFA 4TV8A 3ORRA 2YXYA 1B6SA 4WFEA 5EOYA 5KAIZ 4LF7B 1SQFA 4B3RB 3P3NA 3IC7A 5KA5A 1AR5A 1OBGA 2QB5A 1AN7A 1WPBA 4PBCA 4O3PA 2R8KA 4R6ZA 2VUGA 2ATLA 1NTZH 4ECRA 4JI3B 4Q43A 3TQTA 3H9VA 2LW7A 1KYOF 4DR1O 2QF7A 3T5LA 1VBGA 4JI7H 1K1QA 4ZOLB 4JI0O 2VQFB 5T14A 2JEGA 2ZE8A 4FZ1A 4YAKB 1DGSA 4O86A 5K1XA 3AG4B 4YY3O 2XD4A 3OR6C 4R7CA 4LF4B 4AQYO 3CE2A 4ECQA 4UCVA 3ZCCA 1VP7A 4H37A 4MA0A 4LMYA 1KKCA 1V55C 4IHJB 2VWJA 1E79G 2E5LO 2WLMA 3FB8C 4MSWC 1T36A 5L9XA 4DV6O 5I5TA 2J6UA 3ICXA 1IZ3A 3L70H 4NYEA 1J95A 5BWXA 2B1GA 2Y0IA 3SJCC 4FS2A 1KQSU 4I4TA 1H8HG 1P7GA 2A0LA 2M7WA 5KFVA 4KFMA 1ZHSA 5KFYA 1NU1H 1FAFA 2HIVA 3WWIA 5HV6A 2CDYA 2FK1A 1MABG 2NU6B 2Q6AA 3TY5A 2Q68A 3PW4A 3K08A 4JI7O 4FK5C 2ZE7A 1BHAA 5BWUA 4JI4H 1R6NA 1W0KG 4NXMH 4G27B 3IN5A 2Z3YA 4EBDA 2YS7A 2JEIA 2R7MA 4YJ2A 3T1HB 5DGHA 2VQEH 3HOZG 1YEWA 4AYBE 1C3OA 2R86A 3Q4HB 2IA6A 5GTHZ 1Y76B 2GPWA 3KKYA 5FPOA 5JVDF 1W2BU 5I5VA 5KG4A 5L3CA 2BSKA 4YHHH 2JEXA 1FPOA 3RBZA 4DXWA 3UT5B 4Q20A 2HHHH 1TWCA 1TVKB 3G6BA 2XUMA 2R84A 1AJQA 3RYHB 2V5AA 4MTDA 5B1AC 1Q6UA 2F43G 5KHHA 3L73H 1SA0A 2B63A 1S0VA 3H1HH 3NXSA 2PMZE 4FLTA 5C1OA 2ALZA 4PWQA 4GKKB 1FFTB 4EYIB 3LSUA 2FK2A 3OE7G 5IYZF 4TM5A 3AG3C 4P9PA 4JI4O 4NXMO 1M7JA 1N32B 4MAMA 5I5SA 4XYMB 2F1MA 3X2QC 5J2TA 4X64B 4GUNA 4WBNA 2VQEO 2CZGA 2ASJA 4LNUA 3RYIA 3TW7A 5JCOA 5I60A 3JAMN 2YEVA 1THZA 2EJ7A 3ABLB 1PV0A 2ZE5A 3K57A 1FFXB 5BR8B 4ME6A 3GIKA 5EBWC 3PR4A 1N0JA 5LP6C 5CB4B 1VEWA 4YHHO 1NTKH 4RNMA 1SQPH 2P67A 3CCLV 2HHHO 4IWYA 1TA8A 2R93A 4O2BF 4YIPA 4MVOA 3QFFA 2Q4PA 4KXRA 4A3FG 1FJGH 1IOWA 1OJHA 4C2MA 4FIPC 2LFRA 3V4ZA 2R6FA 2ZNIA 5HFLA 2V7QG 2HHFB 4X20B 3RAXA 5CA0A 4M7EA 4YB8B 2WDTA 1TGOA 4X9QA 2WYOA 2FMAA 1QHTA 3C3SA 2DW4A 2V59A 4HQ6A 3DXRA 1JFFA 2YW2A 3AG4C 4X1YA 2PF4E 4O3QA 2GSMB 1K3EA 1DLBA 4TV8F 1QU7A 1PL4A 1WH2A 2R92A 3W5OA 3RFRA 1P49A 2AHZA 3TETA 1PP9H 1SESA 4BBSG 2Q5ZA 2HDKA 4MVMA 5H5NA 5KMGB 5LL6Y 4IR1A 2J6TA 3HOYG 1EM1A 1Y74A 1JOYA 2IP4A 3W1BA 3SJAC 3PVXA 1VQ6V 4DR5H 2N74A 4O4LA 5D5QA 5DECA 4DR1B 1WB8A 1N36B 3B8NA 5CAEB 3H01A 2HVJC 2C2RA 1VQMV 2FB5A 1FJGO 3KG2A 3K3WA 4L87A 4CS4A 3HOXG 2A06H 4YY3B 2JIZG 3ZHTA 3BHPA 4BIUA 4TOIA 2F23A 1JKJB 2Z02A 3T54A 4QE7A 3SJQC 1U97A 4ED0A 1I94H 1YDXA 2EIKB 3Q1KA 4FVMA 5KFKA 3EPGA 3AG2B 2E5LB 1AVMA 1AI5A 3QZ8A 5EC2C 4DV6B 1R1BA 2P4VA 3QO8A 4I4TF 2HG5C 3JD4A 3OUSA 1H2MA 4DV5O 4TV9B 3CRAA 3ZRVA 4N21A 4O83A 2Y4UA 4FLVA 2WLHA 2QM7A 4CH5A 4UV8A 3CD6V 4LF8B 2C28A 5C5JA 2VOBA 2BTQB 3F5WC 4DR6H 1GSAA 4A3LG 4FE2A 4EFBA 2HIXA 5FNVB 1UPGA 2P06A 4CBCA 1M93A 4DR5O 3VNNA 1E1RG 5KFPA 2QKSA 4JI7B 1R6TA 4A3KG 5GONA 1JQ0A 3R5HA 3QZ7A 3CSXA 3BAAA 4BXXG 1XDNA 3NC0B 2EJRA 4ABMA 2H8PC 4YJ2F 2YCHA 1F51A 1YTFD 1IBKB 1NBMG 1JX9A 3FAVA 2V4DA 4DV3H 2Q7GA 4JTDB 2WLIA 1I94O 4MV8A 5KFTA 4Q0YA 5FD6A 4U3JA 2HGSA 3HPLC 4RZRA 1ZAUA 3BCCH 2HVKC 2ZR2A 2YIDA 1KC7A 3B4SA 5CBHA 2V1DA 5LXTB 2YIBA 2DPIA 1C30A 3N2KB 2YYAA 3R66A 1A3GA 2CK3G 2GPSA 4DR6O 3GLKA 3ABLC 3HKCB 4JAAA 1W96A 3TIGA 2WSSG 3H0GG 4R50A 4FLWA 3Q8SB 3JZ6A 3CMAV 1FXKA 1LR1A 4U7CA 4W4KA 4X62H 2EZPA 5KT2A 2AU0A 2B63G 2PUSA 1KJJA 5DMXA 3RAQA 2UVWA 2X6AA 4A93G 4WFAV 5J2TF 2CTQA 5DN6G 4WBNF 1Y1WA 4J10A 2JA5G 1S03G 1HW7A 2CH7B 4I9QA 3CYOA 1Q43A 4ECZA 4HZ3A 3TK1A 3GV8B 1HNZH 3JD2A 4PELA 5C4XG 5KG0A 5D5PA 2LW1A 2COJA 5KFXA 4LH7A 5I47A 2UU9B
chains in the Genus database with same CATH topology
3K58A 4K0KH 4DR4H 3NBZB 2RGRA 2JS5A 1IBLB 3RYCB 3CVZA 5FLXW 3RYCA 4HBNA 2R9AA 4LSXA 5IWAH 1J5EB 4YHHB 2UUAH 4BW9A 3N44B 2UXBH 4MV9A 4ZOLA 1HR0H 4DR2B 5EYPA 3M7MX 1B04A 4O4IB 2Q2TA 1P8LA 4JV5H 5A2QW 2HVSA 4GKKH 2UUCH 2ZIMA 3JARA 3VQVA 3N6XA 4DV0H 4CC6A 3MAQA 4LF9B 4R7RA 4DRXA 1CKNB 4APMA 1CKNA 1Q8IA 3JSNA 3JASB 5D1OB 2RQ6A 4O4JA 4ZHQA 4AHCA 3U0ZA 1HNXH 1M5IA 1TUBB 1N34B 4DRFA 4X65H 3HKBB 3HKBA 4LFCH 4I55B 4I55A 4PI0A 5FPRA 1A0IA 3HKEA 4DK1A 3U11A 3M4IA 4JI5H 5LMNB 1CKOA 4UCUA 2CFMA 3J81W 5LOVB 5LOVA 4UCRA 3KXYT 2FE3A 4EFEA 3L2PA 5JVDA 4B3RH 3LNNA 3GB8B 3N40P 4DV7H 4DR7H 1XMOB 2F4VB 5ITZB 4X62B 3ZS8C 1HNWH 1FJGB 5KHGA 3T1YH 3RTXA 2PGGA 1S68A 2VQFH 3JALA 4LF6H 3RJ0A 4LF5H 4UCSA 5GONB 4DUYH 2UXCH 4DUZH 4X1KA 4LF4H 5CA1B 2JVDA 5CA1A 4MTEA 4ZI7A 4RB3C 5IJ9B 1KMIZ 4I50B 5IJ9A 4I50A 3GJXB 3RWRD 3LMLA 3K59A 4FM2A 3KALA 4JI8B 5IYZB 5JJJB 1O9HA 5IYZA 4K0KB 4DR4B 4YJ3B 4HNAB 4YJ3A 5LL6b 2YXLA 4OX9B 3OTOH 5J2UB 5J2UA 4EEQA 2CAZC 5IWAB 3IG0A 3UT5A 3JATA 5LA6B 1TVKA 5IJ0A 4RAZA 1GYFA 4FLZA 1HR0B 3J80W 4DK0A 1XNRB 4E6NA 1O75A 1M4UA 4JI6H 3UQ8A 2HVQA 1KU9A 4LH6A 4DR1H 1BJTA 4JV5B 4FLYA 5FD5A 4DR5B 3S24A 4JI0H 4X1IB 4B3MH 2CW7A 4X1IA 1WNSA 1G6UA 4LFBH 3BPZA 2PZSA 4YY3H 5JH7B 2YIAA 5JH7A 1XNQB 4IAJA 5C8YB 4O2BB 4I7HA 5C8YA 4O2BA 2MCTA 2CW8A 4AQYH 1E4GT 4EQ5A 4NXNH 4GLXA 1Z5VA 4LFAB 2F93B 4JYAB 2QM4A 3N41B 1XMQB 1H2SB 5KHKA 1V9PA 1HNXB 4AILC 2E5LH 4D7TA 2GV9A 1N33B 4LFCB 4FM1A 4DV6H 3VQXA 4PHZA 5LYJB 4DR3B 5KHJA 3T1HH 4CH3A 5LP6B 2ZM6H 3VQYA 3BABA 1FFXA 4TV8A 3TY9A 2VPSA 3SGIA 1X9NA 5EOYA 4LF7B 2QJ1A 1SQFA 4B3RB 2UXDH 1AN7A 1WPBA 4DV7B 4DR6B 2YI9A 2VUGA 3QG5A 1HNWB 4JI3B 4RB2C 4JI1H 1E4FT 4JI7H 4ZOLB 2VQFB 1Z2PX 4LF6B 1JJOA 5EYPB 4LF5B 1DGSA 5K1XA 4DUYB 2UXCB 4DUZB 2PYJA 4LF4B 3FMAA 2W57A 4UCVA 4LMYA 3JARB 4O2AB 4O2AA 1I7FA 3JAKA 2YI8A 4DV3B 4O4HA 4A2AA 4DV5H 4IHJB 2VWJA 4DRXB 4IHJA 2E3CA 2R70A 4FLUA 1N32H 5EIBC 3IAYA 4JI2H 4GYCB 3ICXA 4O4JB 4ZHQB 5KMGA 4X64H 1SEIA 1RSOA 4RB1A 3SJCC 2P22C 3HKDA 4I4TA 3ZEDA 1JMKC 1WN7A 3HKEB 5BMVB 5BMVA 1ZHSA 5BR8H 4FM9A 2HIVA 4JI0B 4UCOA 3QF7A 1O9GA 4B3MB 3OTFA 3WB2A 4B3TH 4LFBB 5JVDB 2BTOA 3TY5A 3QWUA 3RGBA 4AQYB 4NXNB 4K8ZA 5KHIA 1Z2NX 2ZIOA 4B3SH 4L8JA 4UFZA 3RYFB 5EIBD 3RYFA 4JI4H 4NXMH 3BRCA 3JALB 4FLXA 1Q3EA 4YJ2B 1XI1A 4YJ2A 3SJBC 3ETQA 4X1KB 3T1HB 4BWSC 1YEWA 2VQEH 4EB6A 4TV9A 3WB1A 1HNZB 4ZI7B 4ZIBA 4K8XA 2RJZA 3GDEA 4TQFA 2OWOA 3H20A 5FPOA 1VF7A 1IBLH 5IT9W 2UXDB 2EX3A 1J5EH 2PYLA 2Q2UA 4YHHH 3A2FA 3UT5B 2HHHH 3JATB 4TUYB 1TVKB 3B2EE 3QTCA 4TUYA 4D7SA 5IJ0B 2UUAB 2UXBB 3RYHB 3RYHA 4X66H 4MTDA 4DV4H 4BWAA 2OYQA 5KHHA 3F8NA 1SA0B 1P16A 1SA0A 3THOA 3BA9A 1XHZA 1N36H 4FLTA 1XHXA 4GKJH 4GKKB 2UUCB 4NVPA 1CKMA 3JAWA 4DV0B 4FFBA 4LSAA 2PY5A 1N32B 1N34H 2F1MA 4JI2B 5J2TB 5J2TA 4X64B 4WBNB 1XQ8A 4WBNA 1VS0A 3HXLA 4X65B 5DISC 1M0WA 4LNUB 4LNUA 3RYIA 3N2KA 4PZ7A 5JCOA 1L2ZA 1X4TA 3WB0A 3N2GA 3RGZA 2KKWA 4JI5B 3U10A 3KYHC 3K57A 1FFXB 5BR8B 3HKCA 4TV8B 4LF8H 5LP6C 5CB4B 1TAEA 2YIBD 5CB4A 4B3TB 1TA8A 5LMUH 4B08A 1FJGH 4DR7B 4B3SB 1S5JA 3E22A 4CS2A 1I6UA 3KAKA 2ZNIA 5EZYB 5EZYA 4DV1H 3T1YB 3N43B 4X20B 4JI4B 4X20A 3BA8A 2ZCEA 5CA0A 4CH6A 4F6RA 4NXMB 4MV7A 3TY8A 2ZJTA 4M7EA 2WDTA 1QQCA 1TGOA 2WYOA 1XK5A 4PZ8A 2Q0AA 1QHTA 4IIJB 2VQEB 4IIJA 3L4JA 1JFFB 4CH4A 1JFFA 4X1YA 2RGVA 3DSQA 3RGXA 1IBKH 4JI8H 2F95B 3JAKB 1WH2A 3JAMW 4O4HB 4OX9H 3W5OA 3RFRA 1P49A 5JJEB 3K5LA 3OTOB 2VWKA 5KMGB 1L8DA 4DV2H 2P5OA 1SQGA 3K5OA 2HHHB 3RF2A 1XNRH 4CC5A 3J7AK 2WE6A 1T5EA 3HKDB 4I4TB 4X66B 3SJAC 4DV4B 3W1BA 4O4IA 2ZINA 4O4LB 4DR5H 4JI6B 4O4LA 5D5QA 4KHPH 1ZHQA 4DR1B 1N36B 4PI2A 4FM0A 1XNQH 4GKJB 1Z5WA 1IBMH 4CS4A 3MWMA 4YY3B 3BHPA 4LFAH 4JYAH 4TOIA 4A2BA 1XMQH 3JASA 5D1OA 2ZNJA 5JJNB 1I94H 1TUBA 2PTMA 1N33H 4FVMA 2Q7HA 4DR3H 3SR2C 2E5LB 4PZ6A 4DV6B 5D1PA 2KSWA 4EB6B 3JSLA 4TV9B 2UUBH 2ZM6B 2XIGA 2UU9H 4FLVA 4CH5A 4LF8B 4LR3A 4LF7H 4J0MA 2JGUA 2VOBA 2BTQB 2BTQA 4DR6H 5LMUB 5ITZA 1SYXB 4UCTA 2HVRA 4JI3H 4EFBA 2HIXA 5FNVB 5FNVA 3VNNA 1M93A 4JI1B 4DR2H 1FKAH 4DV1B 4JI7B 5K1PA 5GONA 5KX5B 5KX5A 4PDBA 3CSXA 3BAAA 1XDNA 3NC0B 1M0TA 4CS3A 1FVIA 2YCHA 1IBKB 2V4DA 3CHXA 4DV3H 2Q7GA 3RR5A 4LF9H 4HNAA 3JAWB 4Q0YA 4Q6GA 5FD6A 4U3JB 4DV5B 4U3JA 2HGSA 4FFBB 3K5NA 1ZAUA 1SKVA 1BGWA 4RZQA 4KL1A 5LA6A 4DV2B 4RB0A 1D5AA 3L4KA 5LXTB 5LXTA 2YIBA 3KAJA 2XHBA 3RYIB 2IM9A 3N2KB 3RIZA 5LMNH 4ETSA 3N2GB 4KHPB 5JCOC 5JQGB 5JQGA 3HKCB 3N42B 1IBMB 3NBYB 1Q5OA 4FLWA 4TQDA 3VQWA 1XMOH 3C0FB 1NT2B 2F4VH 2Q7EA 3CB2A 3K5MA 4X62H 3DF7A 4RAYA 2PUSA 3E22B 1I94B 2R72A 3PN1A 5LYJA 3FFQA 4F6RB 5CA0B 1Z2OX 1S03G 1MZBA 1HW7A 4I9QA 2O03A 1Q43A 3EYYA 5LP6A 1HNZH 2F66C 3W1GA 2HEPA 5D5PA 2UUBB 4X1YB 4LH7A 3K3VA 2UU9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDE A;  1XNQ B;  2OWO A;  4YY3 B;  5FPO A;  4EQ5 A;  3NBZ B;  4TOI A;  4GLX A;  2UXD B;  4LFA B;  1IBL B;  4JYA B;  5D1O A;  2Q2U A;  1XMQ B;  1J5E B;  1V9P A;  4YHH B;  1HNX B;  1N33 B;  4LFC B;  2UUA B;  2E5L B;  4DR2 B;  2UXB B;  4DR3 B;  4PZ6 A;  4DV6 B;  5D1P A;  1P16 A;  1B04 A;  2Q2T A;  3BA9 A;  1P8L A;  3BAB A;  2HVS A;  3JSL A;  2ZM6 B;  3TY9 A;  4GKK B;  2UUC B;  4LF8 B;  3SGI A;  1X9N A;  1CKM A;  4CC6 A;  4LF7 B;  4LF9 B;  4B3R B;  4DV0 B;  1CKN B;  1CKN A;  4DV7 B;  5LMU B;  3JSN A;  4UCT A;  1N32 B;  5D1O B;  2HVR A;  4DR6 B;  2VUG A;  4EFB A;  4JI2 B;  1HNW B;  4JI3 B;  4X64 B;  1N34 B;  2HIX A;  4DRF A;  3VNN A;  1VS0 A;  4JI1 B;  4X65 B;  2VQF B;  4DV1 B;  5DIS C;  4JI7 B;  4LF6 B;  5FPR A;  4LF5 B;  1DGS A;  1A0I A;  4DUY B;  2UXC B;  4PZ7 A;  4DUZ B;  5LMN B;  3BAA A;  1CKO A;  4LF4 B;  4UCU A;  2CFM A;  1XDN A;  4JI5 B;  3NC0 B;  3KYH C;  5BR8 B;  4UCR A;  1FVI A;  1IBK B;  4UCV A;  4EFE A;  3L2P A;  1TAE A;  4B3T B;  3RR5 A;  4DV3 B;  3GB8 B;  4DV5 B;  1TA8 A;  1XMO B;  2F4V B;  1ZAU A;  4X62 B;  4DR7 B;  4B3S B;  1FJG B;  3RTX A;  4DV2 B;  1S68 A;  3T1Y B;  4JI4 B;  4NXM B;  3BA8 A;  4UCS A;  3TY8 A;  1XK5 A;  4PZ8 A;  2VQE B;  4KHP B;  2HIV A;  4JI0 B;  4UCO A;  3GJX B;  4B3M B;  4JI8 B;  4LFB B;  1IBM B;  3NBY B;  3TY5 A;  4K0K B;  4DR4 B;  3QWU A;  4AQY B;  3W5O A;  4NXN B;  4OX9 B;  4EEQ A;  3OTO B;  4UFZ A;  5IWA B;  1I94 B;  3PN1 A;  2HHH B;  4CC5 A;  1HR0 B;  1XNR B;  4E6N A;  4X66 B;  3W1B A;  4DV4 B;  3UQ8 A;  2HVQ A;  4LH6 A;  3T1H B;  4JI6 B;  3W1G A;  4JV5 B;  4DR1 B;  1N36 B;  4DR5 B;  1HNZ B;  3S24 A;  2UUB B;  4LH7 A;  4GKJ B;  2UU9 B; 
#chains in the Genus database with same CATH topology
 3K58 A;  2EBO A;  3H1J H;  2W9C B;  4QGP A;  2W8K A;  2JS5 A;  5IP7 G;  4P9O A;  3T9D A;  3CVZ A;  4QW9 A;  3BFR A;  3WO0 A;  1BCC H;  4YHH B;  2QWP B;  1HR0 H;  2HP8 A;  5EYP A;  3M7M X;  3O65 A;  3T5J A;  4O3S A;  5DGA A;  2KSD A;  4O84 A;  1B04 A;  2ZDG A;  3CRQ A;  4O4I B;  1K5Q A;  2Q2T A;  2CQY A;  5A2Q W;  2IJK A;  3CC7 V;  2YZN A;  4ECU A;  4X62 O;  1SQQ H;  3JZF A;  1R3J C;  5KT7 A;  4APM A;  1CKN A;  3OEE G;  1Q8I A;  3K04 A;  2C2D A;  5D1O B;  3H40 A;  4O4J A;  1V4Y A;  4AHC A;  2YU9 A;  1AUX A;  4DRF A;  1TUB B;  4YBZ B;  4X65 H;  2DAB A;  1OCO B;  1HNZ O;  1Y1V A;  5BWW A;  4A5U B;  2RCV A;  1TWF A;  4QNH B;  2EIK C;  4JYC A;  4ECY A;  3HKE A;  3AG2 C;  4DK1 A;  2YS8 A;  3CX5 F;  4Z2W A;  3J81 W;  4O4L F;  2FE3 A;  4DLK A;  1NI8 A;  1Q86 W;  4B3R H;  3GIP A;  3K9A A;  3GB8 B;  3J80 N;  1XBL A;  3N40 P;  3IJ4 A;  1HR0 O;  2F4V B;  4FBT A;  5ITZ B;  4QW8 A;  1QCE A;  3ZS8 C;  5KFQ A;  2FPG B;  3SYA A;  1FJG B;  2GLT A;  3T1Y H;  2LQT A;  2PGG A;  2VQF H;  1R3L C;  3AK3 A;  4UCS A;  1NS1 A;  1ZX3 A;  1AI7 A;  1IXB A;  4LF4 H;  1YJW V;  2R8J A;  3GWO A;  5IJ9 A;  3GV5 B;  3GJX B;  3RWR D;  4XZ3 B;  4A3E G;  4A3M G;  3H4D A;  1S0O A;  4UUJ C;  2HR3 A;  5IYZ B;  5DGB A;  1O9H A;  2QR4 A;  5BXZ A;  4K0K B;  5LBQ A;  1NVP D;  4X65 O;  3CRC A;  4YJ3 A;  2BQU A;  5LL6 b;  1ZQ7 A;  3OTO H;  1UC9 A;  3LDE A;  5J2U A;  4NZM A;  2CAZ C;  2KG7 B;  2HJW A;  3IG0 A;  4QWE A;  1JR9 A;  5BYB A;  2PI5 A;  5KAF Z;  5LA6 B;  5IJ0 A;  4FLZ A;  4RNN A;  5H9C A;  1M4U A;  2ZDI A;  2HVQ A;  3SPG A;  1M1K W;  1VF5 B;  3K06 A;  3L74 H;  5IY5 B;  4B3R O;  3QO7 A;  4GX5 A;  4FLY A;  4DR5 B;  5BYA A;  2W9B B;  4F4X A;  5IE9 A;  3T9C A;  4GC7 A;  4IAJ A;  5JH7 A;  4O2B B;  2DQ3 A;  2WPD G;  2ZXW B;  1I3Q A;  3STL C;  3G8C A;  2VQF O;  2PI4 A;  2QM4 A;  2D3O W;  1Q6H A;  3LWB A;  3O9O A;  1E1Q G;  1V9P A;  4QSH A;  3IGA C;  3ZMS A;  5A2Q N;  4LF4 O;  4D7T A;  2GV9 A;  1K5S A;  3DGE A;  1E4E A;  5LYJ B;  2FLL A;  4MTX A;  2WAQ A;  5KHJ A;  3FDS A;  3T1H H;  3GB7 C;  1D5N A;  1BXR A;  2BQR A;  4C7U A;  3GTJ A;  1JJ2 U;  1UFI A;  2JEF A;  1BMF G;  3OTO O;  3SGI A;  3UO2 A;  2QJ1 A;  3ETH A;  4J9K A;  3JZI A;  4DYL A;  4IZO A;  4DR6 B;  4HN2 A;  1RPO A;  5CN0 A;  3WO1 A;  4ECT A;  1SET A;  1HNW B;  4RB2 C;  3RB6 A;  2JA6 A;  1E4F T;  4F6E A;  2X6C A;  5L1K A;  1Z2P X;  3MWE A;  1SC5 B;  1JJO A;  1SQX H;  4DUZ B;  4W4L A;  3I56 V;  3SE7 A;  2L35 A;  4DL2 A;  1QVG U;  2IBK A;  1NH2 B;  1ET0 A;  2W57 A;  3PJS K;  1XUQ A;  2VS0 A;  3JAK A;  4DV3 B;  4O4H A;  4IRC A;  1Y1W G;  2GHY A;  1IUR A;  2R70 A;  1N32 H;  1BZK A;  5EIB C;  1GM7 A;  3E5N A;  3PFF A;  3E86 A;  1X59 A;  4GYC B;  4X64 H;  2W8L A;  5BY1 A;  1SEI A;  3T1H O;  4RB1 A;  4WFH A;  4P30 A;  4O81 A;  2P22 C;  1K34 A;  3GTK A;  3ZRW A;  1OCO C;  3CP1 A;  5BMV A;  2DIK A;  3OD4 A;  3T99 A;  4Q8F A;  5BR8 H;  1A32 A;  4UCO A;  4B3M B;  3OTF A;  3WB2 A;  5F9N A;  3LSQ A;  4LFB B;  1ZWI C;  2XOK G;  2QGN A;  2IBZ H;  3VOU A;  2IW5 A;  5HBR B;  4NXN B;  3HR0 A;  4UB6 Z;  2ZIO A;  1R9T A;  4L8J A;  2EJ2 A;  1JDB B;  2OCH A;  4C5B A;  3RYF A;  2EZO A;  4U6P A;  1AP6 A;  2X6B A;  3BRC A;  5KG3 A;  3JAL B;  1KUT A;  4YJ2 B;  5L1I A;  3ZHQ A;  3ETQ A;  4BWS C;  2B5U A;  3C90 A;  1OV9 A;  3TJT A;  1HNZ B;  3R5F A;  4ZI7 B;  1N32 O;  4K8X A;  4MS2 A;  1WR2 A;  2W9A A;  4TQF A;  2YZL A;  4X64 O;  3OUU A;  5KT4 A;  2NR5 A;  5KG1 A;  3ZRX A;  4M0J A;  1R73 A;  2R9I A;  2PYL A;  2Q2U A;  1YCI A;  2IU0 A;  4J9Q A;  3A2F A;  4K35 A;  2JA7 G;  1KP3 A;  2EUL A;  3JAT B;  5DQI A;  1S9F A;  5BR8 O;  2W0X A;  1KBH A;  2QWQ B;  3UM7 A;  1SZX A;  3HOW G;  1GN2 A;  2AGP A;  4BWA A;  1SA0 B;  3THO A;  2W71 A;  2MW2 B;  1I1K A;  1XHZ A;  1N36 H;  4Z1M G;  3WFV A;  1VBH A;  5CA3 A;  4QJF B;  3ABT A;  3JAW A;  1CKM A;  3KHH A;  4PDM A;  2XAS A;  3EFF K;  1PNL A;  3Q8Q B;  4YJ3 F;  2C22 A;  5EWG A;  2ZXW C;  5BWV A;  3BJY A;  4JI2 B;  1N34 H;  2HLD G;  5J2T B;  2E2H A;  1SQV H;  4WBN B;  1XQ8 A;  5J2U F;  1JLL B;  1VS0 A;  4X65 B;  1Q90 D;  3OSN A;  2HG8 A;  4LNU B;  3PW7 A;  4PZ7 A;  2IJI A;  2EIY A;  3U9S A;  3N2G A;  1JA8 A;  1YI2 V;  5BPF A;  1M57 B;  3QO5 A;  1JXL A;  2LFS A;  4DL5 A;  4LF8 H;  2W7O A;  2YIB D;  3T2M A;  4B3T B;  1PPJ H;  3HBL A;  5KS8 A;  1WP7 A;  5JH7 F;  1RPR A;  2EIN B;  3B8M A;  3T9F A;  3CME V;  2ZT9 B;  4B3S B;  1S5J A;  3E22 A;  2D2C B;  4J7K A;  3KAK A;  4F50 A;  1WB7 A;  3GWK C;  3T1Y B;  1N36 O;  4F6R A;  1AUV A;  2P0A A;  2ZJT A;  2WA4 A;  1FS0 G;  3K5I A;  1XK5 A;  4HAM A;  2ASD A;  2WA3 A;  3TEK A;  4IIJ A;  1JFF B;  1LUV A;  5CBG A;  4J9Z B;  4J9R A;  1DTO A;  3DSQ A;  1IBK H;  4JI8 H;  2F95 B;  2OIG A;  1AI6 A;  1K1S A;  5DGI A;  2V4Q A;  1N34 O;  3IC9 A;  1HWY A;  3NR7 A;  4YIO A;  3JAM W;  5KG6 A;  4Y8V B;  3N27 A;  2E75 B;  3OW2 U;  5JJE B;  4PA7 A;  3UKM A;  3K5L A;  5KA6 A;  3OTO B;  1R3K C;  1L8D A;  1KUQ A;  4DAA A;  3SPC A;  1JCH A;  3J7A K;  1V54 B;  5FLM G;  3RF2 A;  1Y74 B;  1T3N A;  1RJP A;  3HKD B;  3G67 A;  1KB9 F;  3B09 A;  4LF8 O;  2ZIN A;  4O4L B;  2HJF C;  4NR1 A;  4TQR A;  2JA6 G;  2NU9 B;  4A3C G;  4X88 A;  4FBU A;  4J9Y B;  1EKF A;  4JYA H;  1FXV A;  4A2B A;  3JAS A;  1YHQ V;  1DF4 A;  2ZNJ A;  5JJN B;  4BR6 A;  2PTM A;  2W6P A;  3V6J A;  4EBE A;  2XCL A;  2FLP A;  2DMX A;  4ZHQ F;  2QWO B;  1IBK O;  4JI8 O;  5EWE A;  2FLN A;  3RBE A;  5D1P A;  4A3J G;  2JRI A;  5J9P C;  1UJW B;  3E35 A;  4EB6 B;  5BMV F;  1B06 A;  2UU9 H;  2AW9 A;  2H94 A;  2NVX A;  3W7U A;  1I08 A;  5KFM A;  1NR7 A;  3E8B A;  1M6V A;  2HJD A;  2GDS A;  4PDL A;  3T4Z A;  3K9S A;  5H6Q A;  2QSA A;  2JS3 A;  3SDL A;  5KT5 A;  3ZMZ A;  5KX5 A;  4PDB A;  2EIJ B;  5KG2 A;  5B3S B;  2I8C A;  4FPP A;  4JYA O;  4PJ0 Z;  3M9N B;  3PO3 G;  1FVI A;  1RK5 A;  3HT5 A;  3FAV B;  1PX2 A;  3CHX A;  1A48 A;  2WLI B;  3RR5 A;  2ADQ B;  2I87 A;  2ZGI A;  4Q6G A;  3EVK A;  4MVQ A;  4U3J B;  2LJ2 A;  4FFB B;  1DV2 A;  1SKV A;  1K8A W;  5GTI Z;  3KHG A;  4KL1 A;  1KJ9 A;  4MVS A;  4WF9 V;  4DV2 B;  1VKZ A;  2Y4R A;  3D3Q A;  3D36 A;  3LQS A;  1CP9 A;  2WB1 A;  3L4K A;  4M9U A;  1T94 A;  1MSD A;  4JTA B;  2UU9 O;  1I1L A;  4Q4D A;  3R9R A;  1L0N H;  5KT6 A;  3H1I H;  4J9M A;  4U7O A;  4O3O A;  4KHP B;  5JCO C;  2QTS A;  3CJH B;  3H1K H;  3QVN A;  1IBM B;  1Q5O A;  1M57 C;  5L1J A;  3OUF A;  1ZET A;  3RB3 A;  3N8D A;  3FKS G;  4KP4 A;  3C0F B;  2F4V H;  2Q7E A;  3CB2 A;  2MK3 A;  3OM3 B;  4DQN A;  3FKI A;  4YR2 A;  4RAY A;  3CXC U;  5DM6 V;  1PM9 A;  5KFR A;  2EIN C;  2R72 A;  3S3X A;  1N56 A;  1VQP V;  1Z2O X;  4H33 A;  1XL4 A;  2JGD A;  2ZR3 A;  5LP6 A;  3HOV G;  2RF4 A;  1QBZ A;  4PV1 B;  3TCU A;  2UUB B;  3TGU H;  2YRX A;  3AG7 A;  1K9M W;  5B1N A;  4MV1 A;  4K0K H;  4FGR A;  1NZ6 A;  3UCS C;  1K4D C;  5L3D A;  5B5E Z;  4K6N A;  1WLE A;  4HBN A;  2FKX A;  2R9A A;  2WAQ E;  4G3I A;  4BW9 A;  4QWD A;  4MV9 A;  4ZOL A;  3T9E A;  2CGO A;  1OZ0 A;  3AG1 B;  5EBL C;  3K79 A;  3JYC A;  2QKC A;  4UV9 A;  4IRK A;  1V54 C;  4ECS A;  3GIQ A;  1P8L A;  2XND G;  1MSW D;  1I1M A;  2NLJ C;  2F4V O;  2UUC H;  1PNM A;  4IIJ F;  3VQV A;  3N6X A;  4DV0 H;  4CC6 A;  3MAQ A;  1CKN B;  1GRJ A;  1GSO A;  2VUM A;  3ZJZ A;  2NN4 A;  3ZMU A;  3LP8 A;  3KCX A;  3U0Z A;  1N34 B;  2COG A;  1OBD A;  3HKB A;  3VMM A;  4XX0 B;  4PI0 A;  4J11 A;  4MW8 A;  4K0K O;  3M4I A;  4JI5 H;  2YDE A;  5LMN B;  5JQW A;  2NVY A;  2CFM A;  4A3D G;  3STZ C;  4PA6 A;  4UCR A;  2DLN A;  3U54 A;  3KXY T;  1H2N A;  2N04 A;  2WLK A;  4DO2 A;  5JUM A;  1EUC B;  2DYS B;  3JD0 A;  2R87 A;  3KZI Z;  3DTG A;  3WWJ A;  4ECW A;  1H8E G;  1NR1 A;  1KD1 W;  1XMO B;  2R7Z A;  3D8C A;  1ULZ A;  1HNW H;  5KHG A;  3B40 A;  2NU8 B;  1COW G;  4ED7 A;  1YJN V;  2UUC O;  4CKB A;  4PA4 A;  4DUZ H;  4WFF A;  1BL8 A;  5KFI A;  2COI A;  5CA1 A;  4MTE A;  2EIJ C;  5IJ9 B;  4J7Z A;  2CTR A;  4I50 A;  2AGQ A;  3ZHV A;  1B33 N;  1H38 A;  3KAL A;  2OH2 A;  5B3S C;  4JI8 B;  1TWG A;  1EUD B;  4DR4 B;  4YJ3 B;  1GMG A;  4HNA B;  2XT9 A;  5KFL A;  2CGN A;  1AJP A;  2YXL A;  3TW6 A;  3BG5 A;  5J2U B;  1IYE A;  1HP8 A;  4EYH B;  2CTP A;  2UXX A;  3UT5 A;  4JI5 O;  4ICG A;  1TVK A;  5KKN B;  2A7W A;  4RAZ A;  4QIW A;  5C3E G;  1FD9 A;  3AYH B;  3J80 W;  3OMI B;  4A3B G;  4JI6 H;  1DIK A;  5KX5 F;  2FYU H;  3GTO A;  1ENV A;  4I0X A;  1ORQ C;  4J41 A;  4DL6 A;  1M56 B;  1I2L A;  3V4S A;  4B3M H;  2CW7 A;  4X1I A;  1WNS A;  1G6U A;  3E8F A;  4LFB H;  5JH7 B;  3G6X A;  1HNW O;  5C8Y A;  1BT8 A;  4RUA A;  4BY1 G;  2W0F C;  1A9X A;  4NXN H;  2YL2 A;  1Z5V A;  2J9G A;  4JYA B;  3ZMV A;  1VAJ A;  2M05 A;  1B3Q A;  3MWD A;  4J9N A;  1H2S B;  4DL4 A;  4DUZ O;  4RQE A;  1I50 A;  1HNX B;  3KHL A;  1P84 F;  4LFC B;  4YXW G;  2WLJ A;  5H2F Z;  3DTU B;  2GBO A;  2R7N A;  4PHZ A;  5CM0 A;  2R7K A;  1DAA A;  4DV3 O;  4CH3 A;  3ZX6 A;  3BAB A;  3LSS A;  1FFX A;  3ZBH A;  3OGI B;  4FFM A;  1ZL8 B;  2FK3 A;  5KFC A;  3KHR A;  1X9N A;  2XCP A;  3K0D A;  4JXU A;  2E76 B;  2QM8 A;  2A3Q A;  2Y69 B;  5JWP A;  3GII A;  3VA7 A;  5D8D A;  2YI9 A;  3QG5 A;  4JI6 O;  2Q7D A;  5E25 A;  2QTO A;  2ITD C;  1EBO A;  3MR6 A;  1AJN A;  2KQX A;  4B3M O;  4LF6 B;  4J9S A;  4LFB O;  2UXC B;  2R85 A;  5BWR A;  2WLL A;  3AG1 C;  5CA0 F;  5CE8 A;  4HNT A;  5KFA A;  2R93 G;  4NXN O;  1QR9 A;  1PKX A;  4I7Z B;  3JD3 A;  1H2G A;  1W59 A;  2FPP B;  3ASO B;  3JAR B;  1Y66 A;  4UB8 Z;  4O2A A;  4CMD A;  1I7F A;  3CC4 V;  4DRX B;  3F7Y C;  4FLU A;  3AW8 A;  3IAY A;  4CZZ A;  4JI2 H;  2JDI G;  3S3W A;  5KMG A;  4ZHQ B;  1MMM A;  1MZE A;  2RDI A;  1RSO A;  4A3G G;  1WCM A;  4I5S A;  3GIL A;  3ZRW B;  3ZED A;  2WLN A;  2DZD A;  2V58 A;  4ZOL F;  3SNO A;  4TQS A;  1F4N A;  2E2I A;  1JMK C;  1WN7 A;  5BMV B;  3HKZ A;  2R92 G;  5CMU A;  2OCC B;  4TVI A;  1VQO V;  2VPQ A;  1QR8 A;  2DJV A;  4E2L A;  5L3F A;  3IFX A;  1O9G A;  3CXH F;  3GVM A;  4B3T H;  5JVD B;  4O7T A;  3MR2 A;  2BTO A;  3H1L H;  3QWU A;  3RGB A;  3GIJ A;  2QE7 G;  1N0N A;  5KFZ A;  1UNN C;  1LNQ A;  1QNM A;  2VA2 A;  3HOU G;  5KHI A;  1Z2N X;  3GV7 B;  2DYS C;  2CNV A;  4YQW A;  4B3S H;  4EG0 A;  4UFZ A;  2CUG A;  5F9L A;  4GCZ A;  3RYF B;  3E89 A;  4MTG A;  4R8U B;  3E8H A;  4JF3 A;  5DG8 A;  1YTF B;  4HR7 A;  3RN4 A;  3TQ1 A;  2QEX V;  3GID A;  3R65 A;  1Q3E A;  1I5Y A;  1Y6X A;  2Y0P A;  3GTP A;  4ZQI A;  3SJB C;  4X1K B;  3APO A;  4TV9 A;  3WB1 A;  1AP5 A;  4FMT A;  1KKD A;  3SPH A;  4ZIB A;  2Z0A A;  2RJZ A;  2IH1 C;  4JI2 O;  3GDE A;  3RV3 A;  3H20 A;  1ZTE A;  2C35 B;  4J80 A;  1GN3 A;  2Q8V A;  1QLN A;  1VF7 A;  1IBL H;  4IL6 Z;  2UXD B;  4MW3 A;  4QPK A;  1WAZ A;  2EX3 A;  1RJR A;  3T4D A;  3BAC A;  4MTF A;  1AB3 A;  3B2E E;  3QTC A;  4TUY A;  4DW1 A;  4TWK A;  5FR9 A;  3UZO A;  5KFJ A;  1Q82 W;  2OYQ A;  2Y4T A;  1QLE B;  4B3T O;  1SRY A;  5GON F;  3BA9 A;  2FB9 A;  1M90 W;  3E83 A;  2W6Z A;  5CA1 F;  2X0L A;  4B3S O;  2UUC B;  1I2K A;  4NVP A;  4I50 F;  1M56 C;  3CCM V;  4MT8 A;  3M9O B;  1GKF A;  3DC6 A;  4JZ2 A;  4DV0 B;  3T1Y O;  1K73 W;  3Q8P B;  2PY5 A;  1VAR A;  3LUT B;  4IYI A;  3DTF A;  3ASN B;  4NYK A;  5KT3 A;  2AZ0 A;  2G38 A;  4NB5 A;  3HXL A;  2VQD A;  3SYO A;  1M0W A;  3VOT A;  3CC2 V;  4K3A A;  4QIW F;  3N2K A;  1K92 A;  2FML A;  4PDV A;  2R8I A;  3CWB H;  1X4T A;  4BIZ A;  5KFS A;  3RGZ A;  2W70 A;  4JI5 B;  1IBL O;  3KYH C;  3HKC A;  4TV8 B;  5KLV H;  2A1H A;  2ARH A;  3W7T A;  2YIC A;  5EBM C;  2WB1 E;  5C8Y F;  1AIL A;  3T5K A;  4B08 A;  3ZHU A;  4CS2 A;  2Y69 C;  5EZY A;  1BQZ A;  3EHB B;  1YXB A;  1S5L Z;  2DYR B;  4ASU G;  3CRM A;  2ZD9 A;  4WCE V;  4CH6 A;  4PD4 F;  4EGJ A;  2CH7 A;  1S76 D;  5KG5 A;  2B9Z A;  2WAM A;  2H3O A;  4PZ8 A;  2WTF A;  1F4M A;  1S3J A;  2Q0A A;  4IIJ B;  3L4J A;  5HNE A;  1VQK V;  3ZMT A;  2RGV A;  2CE4 A;  3ML0 A;  5K3W A;  2RDJ A;  4O7S A;  5BPH A;  5K2M A;  2W9C A;  3BQ2 A;  4NTW A;  5IYC G;  3ASO C;  2CKZ B;  1VF6 C;  3OHB A;  2ATK C;  2C2E A;  3AK2 A;  1K4C C;  4DV2 H;  1SQG A;  4GX0 A;  1XNR H;  3I5D A;  4OGQ B;  2FJZ A;  2ILM A;  1EN6 A;  3MR5 A;  2L6L A;  4I4T B;  4X66 B;  4DV4 B;  4O4I A;  4JI6 B;  4KHP H;  1TWH A;  1ZHQ A;  3ZHS A;  4FM0 A;  1XNQ H;  4GKJ B;  3HO8 A;  5KFN A;  2OCC C;  1NQT A;  1IBM H;  3MWM A;  4UVA A;  1EKV A;  3T7A A;  4O2A F;  1K97 A;  4GT1 A;  5D1O A;  1TUB A;  1WPX A;  1VQ4 V;  2Q7H A;  4X89 A;  5B1B B;  1N48 A;  3RUP A;  4D6T H;  4O4J F;  4DR3 H;  1IVS A;  2GQR A;  2ZDH A;  4PZ6 A;  2DWD C;  1NVP B;  4OXS A;  4XDL A;  3ZHR A;  3LDC A;  4EGQ A;  2IJH A;  4J9P A;  3JSL A;  1GSH A;  3N6R A;  2HGX A;  2UUB H;  2FP4 B;  1H2K A;  1GM8 A;  3OGC C;  4LR3 A;  4A3I G;  4TSF G;  1Y1V G;  2JGU A;  4E4E A;  4C5C A;  4UVC A;  1OWT A;  2LO1 A;  4DV2 O;  3BVO A;  1WA8 A;  3BQ1 A;  2DQ0 A;  2GTA A;  5LMU B;  1XNR O;  5ITZ A;  1SYX B;  4R8C A;  4UCT A;  3CCE V;  3V6K A;  2BSK B;  1Y14 B;  3K03 A;  4FFN A;  1OCR B;  1BE3 H;  4ED6 A;  4LC1 A;  4KHP O;  2NUA B;  2BCC H;  2Q69 A;  4DV1 B;  5KX5 B;  3K5H A;  1XNQ O;  4P2Z A;  1RK6 A;  3L71 H;  2ADP A;  1IBM O;  2UVV A;  2J6S A;  5KFB A;  4FFR A;  4CS3 A;  1QLE C;  3G80 A;  5C93 A;  1EFR G;  2QKA A;  4U3F H;  2YS6 A;  2DOS A;  4LP8 A;  2PVP A;  4JGS A;  4O7R A;  2ITC C;  1PL0 A;  2VR1 A;  3UO3 A;  2AHY A;  1BNC A;  1YIJ V;  4DR3 O;  3ZRS A;  3H3V H;  3CCV V;  1R6K A;  1XOU A;  2Z5U A;  4FFO A;  2BQ3 A;  1BGW A;  3TIN A;  5LA6 A;  4JAS A;  4ECV A;  1YVW A;  1D5A A;  5LGU A;  1EN5 A;  1KC8 W;  2UUB O;  3ASN C;  3I4N G;  3PR5 B;  4TUY F;  1VIB A;  3RYI B;  2XHB A;  2IM9 A;  3SYP A;  5LMN H;  1CEZ A;  2YEV B;  2JJ2 G;  3W7X A;  3L72 H;  4ETS A;  3PZP A;  4J7J A;  5EWF A;  3ORQ A;  2W9B A;  1S72 V;  4KUM A;  5JQG A;  5L1L A;  3N42 B;  3L75 H;  1QVF U;  5CR5 A;  2BOB C;  4AI8 A;  3VQW A;  4O3R A;  3EXA A;  4WFB V;  1XMO H;  3APQ A;  1NT2 B;  4J42 A;  1B6R A;  3TII A;  4QIW E;  3K5M A;  3DF7 A;  2W6I G;  3ETG A;  2A79 B;  1CS0 A;  3PN1 A;  3SPJ A;  5DAA A;  4WHX A;  5C44 G;  2BOC C;  4E4T A;  4GLW A;  5LYJ A;  4RUC A;  4FS1 A;  5CA0 B;  1GO3 F;  1MZB A;  2JGD B;  2O03 A;  2DYR C;  3QQM A;  3CCQ V;  3W1G A;  5KG7 A;  2HEP A;  4JUZ A;  1LUW A;  3DXR B;  5EDW A;  4X1Y B;  3K3V A;  4DR4 H;  3ABK B;  3AEI A;  4UVB A;  5HFM A;  3NBZ B;  3NUA A;  3OHA A;  4J9O A;  2RGR A;  4IRD A;  1IBL B;  1SF9 A;  2QDO A;  1W93 A;  3RYC A;  5FLX W;  2CTW A;  3DAA A;  5LMN O;  2UUA H;  4GX2 A;  2UXB H;  4XDJ A;  2K1E A;  2IU3 A;  1SS3 A;  4DR2 B;  4QE9 A;  1Q6I A;  1IYD A;  2YSU B;  5EZY F;  3OSP A;  1K83 A;  3WU2 Z;  1SZT A;  4LWS A;  4F4Y A;  5F2V O;  2QWR B;  1XMO O;  2R82 A;  4QPJ A;  1YIT V;  1RM1 B;  4LF9 B;  2N05 A;  3OMA B;  1BS3 A;  1ZUQ A;  5FL7 G;  1YJ9 V;  4O4H F;  3OEH G;  2RQ6 A;  1NJI W;  3MR3 A;  1GM9 A;  1HNX H;  2AXT Z;  5L3E A;  3HKB B;  4LFC H;  4I55 A;  2FPI B;  4O3N A;  4IR9 A;  5IYB G;  2DWE C;  3TXQ A;  1XDC A;  1A0I A;  5B1B C;  2OTJ V;  4DIM A;  1GLV A;  4RUF A;  4DR4 O;  1N4C A;  1CKO A;  1F23 A;  1KT8 A;  4UCU A;  3G8D A;  5DQH A;  4B7K A;  5LOV A;  4O4I F;  2W6N A;  3VPD A;  2X7R B;  4EFE A;  4PA3 A;  2R8H A;  3LNN A;  1OCZ B;  3MJF A;  2UUA O;  2UXB O;  1RYR A;  4DR7 H;  4XYL B;  4N23 A;  3TXS A;  4RNO A;  1GN4 A;  3UYY A;  2M6Y A;  2V4R A;  4B7E A;  1F7Y A;  3HKZ E;  1TUE B;  1G1X B;  3MD0 A;  3OAA G;  3RTX A;  1S68 A;  1VQN V;  2QYZ A;  3Q2O A;  2FKL A;  3JAL A;  4LF6 H;  3RJ0 A;  1OCR C;  3EPI A;  5GON B;  1VQ8 V;  2UXC H;  3BEH A;  1YSC A;  2OTL V;  1JPX A;  5CA1 B;  2JVD A;  5TIS Z;  2X0S A;  4WFG A;  4ZI7 A;  1Q7Y W;  1KMI Z;  1R3I C;  4I50 B;  2AGO A;  3SI8 A;  3K59 A;  4FM2 A;  3JCZ A;  1K33 A;  2PN1 A;  3NGD A;  1HNX O;  3ZIA G;  2UVU A;  4LFC O;  2ZKO A;  1I7N A;  1B6Q A;  3FB6 C;  4H13 B;  4Q8E A;  2EIL B;  2Y48 A;  4EEQ A;  4Q4C A;  2QWN B;  2E74 B;  3JCU Z;  5IWA B;  3H0G A;  3JAT A;  1I5X A;  2VA3 A;  3VPC A;  4EEY A;  2RDC A;  2XAG A;  4DK0 A;  1XNR B;  4BIO A;  4E6N A;  3D36 C;  3UQ8 A;  1KU9 A;  4LH6 A;  1MOF A;  5GW7 A;  4I0X B;  3MHH C;  1BJT A;  4JV5 B;  4NKG B;  5FD5 A;  3FYI B;  1S5H C;  1EN4 A;  1PNK A;  4X1I B;  5FLX N;  4DR7 O;  4QJF A;  5KFU A;  3BPZ A;  2PZS A;  2JA5 A;  1XNQ B;  2DWC A;  5C8Y B;  4O7V A;  2GUZ A;  3HB3 B;  2MCT A;  2CW8 A;  2XCA A;  1US6 A;  1FYJ A;  4YP3 A;  1FXK B;  2YUA A;  2O57 A;  2WWW A;  4LF6 O;  3JRX A;  2UXC O;  3CRR A;  3OT7 A;  3BY6 A;  1K7D A;  1W0J G;  1VQ5 V;  2GTS A;  5KUM A;  4AIL C;  3RVZ A;  4FM1 A;  5IYB O;  5LA6 F;  5I5W A;  4DR3 B;  2NU7 B;  5I5U A;  2ZM6 H;  4RWU A;  4O7Y A;  1XRE A;  3MHS C;  3WNZ A;  3TY9 A;  2VPS A;  4JTC B;  5JQG F;  1CQI B;  2P4K A;  2UXD H;  1GO3 E;  3KTM A;  4DV7 B;  3ABK C;  1L1F A;  5L3B A;  1XEQ A;  4QWB A;  4F4Z A;  3I4M G;  5DG9 A;  4JI1 H;  4JV1 A;  1DK1 A;  4QWA A;  3OR7 C;  3VBB A;  3C3T A;  3JRW A;  5EYP B;  4LF5 B;  2DE0 X;  4DUY B;  2WLL B;  4XDK A;  1KEC A;  3W7S A;  5LYJ F;  2XAH A;  2PYJ A;  4DL7 A;  1EZJ A;  3FMA A;  4LBE C;  4CKE A;  1GAX A;  3Q8R B;  2FTK A;  1GK9 A;  1RP3 B;  4O2A B;  3FX7 A;  4DV5 H;  1JX4 A;  2YI8 A;  4MA5 A;  1WSC A;  4A2A A;  4IHJ A;  2E3C A;  5BZB A;  1RM1 C;  3PW5 A;  1GTO A;  1CE8 A;  4O4J B;  1RSO B;  4HYO A;  1CXZ B;  4DW0 A;  2EJ3 A;  2ZM6 O;  3G6Y A;  2Y0S A;  3HKD A;  2QK4 A;  2YZG A;  2PBZ A;  4RUE A;  1YF2 A;  3HKE B;  4JPR A;  3AK1 A;  1N8R W;  2IH3 C;  3CCR V;  4ZKI A;  1M9N A;  2Q73 A;  2UXD O;  4FM9 A;  4JI0 B;  4ED8 A;  3QF7 A;  3ETJ A;  4C5A A;  2OIE A;  2ZDQ A;  1FXH A;  1PK8 A;  4JI1 O;  1Z2G A;  1XIL A;  4AQY B;  3ETD A;  1VQ9 V;  4PA9 A;  4K8Z A;  4IT5 A;  3CSW A;  1KJQ A;  3OUZ A;  3A0H Z;  1OCZ C;  4BY7 G;  2Q67 A;  5EIB D;  2YWV A;  5DG7 A;  4UUG A;  4O7L A;  4FLX A;  4I55 F;  5KUK A;  3M9M B;  1AR4 A;  1XI1 A;  2NNU A;  1KTA A;  2ODM A;  4FFP A;  4O7W A;  5FJ8 G;  4EB6 A;  4DV0 O;  1KJI A;  4Q45 A;  4FFK A;  3Q4H A;  4HYK A;  4FFL A;  4F4W A;  1Y76 A;  1EHI A;  3RV4 A;  5LOV F;  5IYD G;  2OWO A;  2UVR A;  3BQ0 A;  3RVY A;  4ED3 A;  2EJ0 A;  2A9H A;  2ASL A;  3A0R A;  1WRV A;  4OPA A;  5IT9 W;  4IWX A;  1S0M A;  3CS5 A;  1J5E H;  2DPJ A;  1OHH G;  2P90 A;  4EBC A;  2Z04 A;  3WG7 B;  4TUY B;  3U55 A;  5IDJ A;  3I12 A;  4D7S A;  2UUA B;  2EIL C;  5IJ0 B;  2UXB B;  3DC5 A;  3RYH A;  4X66 H;  4DV4 H;  3T9A A;  3GIM A;  3F8N A;  2ZQM A;  3ETE A;  1P16 A;  2LP7 A;  3KRE A;  3F7V C;  3SPI A;  1XHX A;  5LHH A;  4GKJ H;  3GQC A;  4ZI7 F;  4NTX A;  2ODT X;  1JVM A;  3I55 V;  2YZM A;  3CQZ A;  1VQL V;  3RBD A;  4FFB A;  4LSA A;  2XGP A;  4MVU A;  1SER A;  4F4L A;  1BQ0 A;  1FXK C;  2LGQ A;  4O7N A;  2W6J G;  3ABM B;  1DF5 A;  4TT3 G;  1TWA A;  5DIS C;  2IJJ A;  4J9L A;  2ZE6 A;  1E4E B;  1S77 D;  3F5T A;  5I5Y A;  4ED1 A;  2XAQ A;  2KB1 A;  1L2Z A;  1G4Y B;  3WB0 A;  1S10 A;  3H4B A;  2KKW A;  4OPH A;  3U10 A;  3CJH A;  4JYB A;  1SCU B;  3ZN1 A;  1J5E O;  1Q81 W;  1TAE A;  5CB4 A;  1KJ8 A;  2Q0O C;  1RYS A;  1I7L A;  3RW0 A;  5LMU H;  5DLG A;  3AX6 A;  2JA8 G;  4DR7 B;  4X66 O;  1EZ1 A;  4DV4 O;  1I6U A;  2W6O A;  5LGN A;  5EZY B;  2UXN A;  4DV1 H;  2HHF A;  3N43 B;  1URF A;  4JI4 B;  2JJ1 G;  3BA8 A;  2ZCE A;  4X20 A;  1ZLZ A;  2P7T C;  4JAU A;  4NXM B;  2X5R A;  4MV7 A;  4GKJ O;  3HB9 A;  3TY8 A;  3RB4 A;  1QQC A;  1SFO A;  3CCU V;  2VQE B;  4CH4 A;  3FKI G;  3RGX A;  2W6Q A;  5LP6 F;  4UXN A;  5B66 Z;  4FU0 A;  5KFE A;  2XC9 A;  2VRZ A;  3OMN B;  5IYD O;  3JAK B;  5C1P A;  1GN6 A;  3P30 A;  4O4H B;  4OX9 H;  5JVL A;  2P6J A;  1ROP A;  3K0G A;  3PW2 A;  1KEE A;  1ARO P;  1IXM A;  2VWK A;  5DQG A;  2XGQ A;  2YRW A;  2P5O A;  1IX9 A;  2HHH B;  3K5O A;  1Y67 A;  2JK5 C;  5IP9 G;  4CC5 A;  5H6R A;  2RN9 A;  2WE6 A;  2Q9L A;  1T5E A;  2B1I A;  5EK0 A;  4RQF A;  3P3P A;  3LNM B;  2SCU B;  5KFW A;  5IT9 N;  4PI2 A;  4O7Z A;  5LMU O;  4JYY A;  1MNG A;  1Z5W A;  3A0B Z;  3FYE B;  3FB7 C;  3SYC A;  4AYB A;  4LFA H;  1AI4 A;  3RT3 C;  1EYZ A;  2EIM B;  4DV1 O;  3LUL A;  4CHI A;  4RU9 A;  4FZ0 A;  1XMQ H;  3CPW U;  1NH2 D;  4CKC A;  4IHJ F;  2W6M A;  3D3I A;  2ETN A;  1IOV A;  1N33 H;  3G71 V;  4BW5 A;  1GGO A;  3FD9 A;  3SR2 C;  1XL6 A;  2GQS A;  3R23 A;  2RMK B;  2KSW A;  1WP8 A;  3QNE A;  2JA7 A;  4OX9 O;  5BWT A;  2VUM G;  1BSM A;  3M99 B;  2ZM6 B;  3MDS A;  2XIG A;  1NTM H;  4LF7 H;  4J0M A;  2XTA A;  3P32 A;  4NZO A;  2PMZ A;  3CEB A;  1WA8 B;  2BTQ A;  3GTQ A;  4HNV A;  4H0L B;  2HVR A;  5LHG A;  4JI3 H;  4Q44 A;  5FNV A;  4JI1 B;  5L3G A;  4DR2 H;  1FKA H;  4BBR G;  5K1P A;  4LCU C;  2BE3 A;  3CCJ V;  3WG7 C;  1MG1 A;  1KP2 A;  1S97 A;  3R5X A;  4LFA O;  2R7Z G;  1M0T A;  1XMQ O;  3U9T A;  1YZB A;  2ZDI C;  5I5X A;  2R8G A;  2XAF A;  4RCN A;  3KCY A;  3G6E V;  2DAA A;  2R7L A;  4LF9 H;  4HNA A;  1N33 O;  3JAW B;  1PD3 A;  4DV5 B;  3K5N A;  4NTY A;  5DED A;  3T9B A;  5EC1 C;  2ABJ A;  4RZQ A;  4XBF A;  4RB0 A;  3J7A U;  1H2L A;  4JZG A;  5LXT A;  3KAJ A;  3ABM C;  3PO2 G;  4LF7 O;  4PDR A;  3RIZ A;  1SQB H;  3N2G B;  2JEJ A;  5JQG B;  3FB5 C;  5KFH A;  1GH6 A;  4JI3 O;  5KFG A;  3NBY B;  3SYQ A;  4QWC A;  4TQD A;  1G2W A;  4DR2 O;  1FKA O;  4NZN A;  4IGG A;  1AR1 B;  2QA4 V;  4EKW A;  3E22 B;  1I94 B;  1OCC B;  1WJZ A;  3FFQ A;  4F6R B;  2V9W A;  2RNB A;  1A0G A;  1JDE A;  1EKP A;  3U0G A;  5LGT A;  3EYY A;  4LF9 O;  1D2D A;  3UFX B;  2F66 C;  1ZL8 A;  2XAJ A;  3W7W A;  3T1C A;  3E8G A;  1HDJ A;  1EZV H;  5CBF A;  4MVR A;  5CB4 F;  1P7B A;  1VQ7 V;  4JV2 A;  2R9R B;  3RYC B;  1CQJ B;  4LSX A;  5IWA H;  1J5E B;  3ZN0 A;  3J81 N;  2OLS A;  3N44 B;  3V6H A;  4BAY A;  5KFF A;  1RFY A;  1V51 A;  4LWS B;  4JV5 H;  2HVS A;  1V55 B;  4Z1V A;  4GKK H;  2ZIM A;  3JAR A;  4MV6 A;  1VF6 A;  2YXH A;  4R7R A;  5E1A C;  4DRX A;  2BR0 A;  4G28 B;  4I9W A;  5A9G A;  3WWH A;  1IDS A;  3JSN A;  3JAS B;  3ABU A;  4G2K A;  3VPB A;  4ZHQ A;  3GTM A;  2EIM C;  1M5I A;  3GTL A;  5KFD A;  1NKD A;  4I55 B;  3K3P A;  1I0H A;  5KFO A;  5FPR A;  2CNQ A;  3GTG A;  3U11 A;  4IYH A;  4MV4 A;  2AZ2 A;  5B1O A;  5LOV B;  4GZR B;  1UC8 A;  3L2P A;  5JVD A;  4HNU A;  5IWA O;  3E2E A;  1MA1 A;  3PW0 A;  4DL3 A;  3MFI A;  1WCM G;  4DV7 H;  1G8M A;  1ZSP A;  2Y0S E;  1JIH A;  2AGA A;  4X62 B;  2I80 A;  4ECX A;  1KBL A;  1RJQ A;  3M8A A;  4R8U A;  4GC6 A;  4JV5 O;  4GX1 A;  2IMW P;  4GKK O;  4LF5 H;  3G4S V;  4WD3 A;  4DUY H;  4CE5 A;  4X1K A;  5DLF A;  2K9P A;  1DV1 A;  4RB3 C;  2HKO A;  2FL4 A;  4FJC C;  1VMG A;  4ED2 A;  4RAI A;  4CMF A;  3LML A;  4TV9 F;  5JJJ B;  2OT5 A;  5IYZ A;  3L9D A;  3CCS V;  4OX9 B;  5IYC O;  2CNU A;  4MVZ A;  2C2A A;  2DN9 A;  3B77 A;  3UZB A;  4X8A A;  2KG7 A;  4U7N A;  5B1A B;  4H44 B;  1BHB A;  4YR3 A;  5E79 Z;  4L1K A;  1GYF A;  4ZBM A;  1L0L H;  1HR0 B;  5FNV F;  4MTO A;  4MV3 A;  4YR0 A;  3JD1 A;  3LDD A;  1O75 A;  4NLG A;  3MFH A;  4DR1 H;  3CEI A;  2YC0 A;  1BGY H;  4JI0 H;  2C00 A;  3S24 A;  2JEU A;  4DV7 O;  5IY5 C;  4YY3 H;  1S0N A;  2YIA A;  3AG3 B;  1P4R A;  4O82 A;  4JAV A;  2GUZ B;  4I7H A;  4O2B A;  4AQY H;  1E4G T;  5H80 A;  4EQ5 A;  1Y4M A;  5AG2 A;  3X2Q B;  4GLX A;  3RFC A;  4LFA B;  2F93 B;  3N41 B;  3G6V A;  1CPY A;  3T5H A;  4LF5 O;  1XMQ B;  4DUY O;  4JV0 A;  5LHI A;  5KHK A;  3RB0 A;  4RO2 A;  2E5L H;  1U96 A;  1N33 B;  2HFE C;  4DV6 H;  3VQX A;  2AQ4 A;  1OCC C;  2LGW A;  5LXT F;  2W7P A;  5LP6 B;  3A8T A;  2HGW A;  3OFN G;  3VQY A;  4YAJ B;  1MZF A;  4TV8 A;  3ORR A;  2YXY A;  1B6S A;  4WFE A;  5EOY A;  5KAI Z;  4LF7 B;  1SQF A;  4B3R B;  3P3N A;  3IC7 A;  5KA5 A;  1AR5 A;  1OBG A;  2QB5 A;  1AN7 A;  1WPB A;  4PBC A;  4O3P A;  2R8K A;  4R6Z A;  2VUG A;  2ATL A;  1NTZ H;  4ECR A;  4JI3 B;  4Q43 A;  3TQT A;  3H9V A;  2LW7 A;  1KYO F;  4DR1 O;  2QF7 A;  3T5L A;  1VBG A;  4JI7 H;  1K1Q A;  4ZOL B;  4JI0 O;  2VQF B;  5T14 A;  2JEG A;  2ZE8 A;  4FZ1 A;  4YAK B;  1DGS A;  4O86 A;  5K1X A;  3AG4 B;  4YY3 O;  2XD4 A;  3OR6 C;  4R7C A;  4LF4 B;  4AQY O;  3CE2 A;  4ECQ A;  4UCV A;  3ZCC A;  1VP7 A;  4H37 A;  4MA0 A;  4LMY A;  1KKC A;  1V55 C;  4IHJ B;  2VWJ A;  1E79 G;  2E5L O;  2WLM A;  3FB8 C;  4MSW C;  1T36 A;  5L9X A;  4DV6 O;  5I5T A;  2J6U A;  3ICX A;  1IZ3 A;  3L70 H;  4NYE A;  1J95 A;  5BWX A;  2B1G A;  2Y0I A;  3SJC C;  4FS2 A;  1KQS U;  4I4T A;  1H8H G;  1P7G A;  2A0L A;  2M7W A;  5KFV A;  4KFM A;  1ZHS A;  5KFY A;  1NU1 H;  1FAF A;  2HIV A;  3WWI A;  5HV6 A;  2CDY A;  2FK1 A;  1MAB G;  2NU6 B;  2Q6A A;  3TY5 A;  2Q68 A;  3PW4 A;  3K08 A;  4JI7 O;  4FK5 C;  2ZE7 A;  1BHA A;  5BWU A;  4JI4 H;  1R6N A;  1W0K G;  4NXM H;  4G27 B;  3IN5 A;  2Z3Y A;  4EBD A;  2YS7 A;  2JEI A;  2R7M A;  4YJ2 A;  3T1H B;  5DGH A;  2VQE H;  3HOZ G;  1YEW A;  4AYB E;  1C3O A;  2R86 A;  3Q4H B;  2IA6 A;  5GTH Z;  1Y76 B;  2GPW A;  3KKY A;  5FPO A;  5JVD F;  1W2B U;  5I5V A;  5KG4 A;  5L3C A;  2BSK A;  4YHH H;  2JEX A;  1FPO A;  3RBZ A;  4DXW A;  3UT5 B;  4Q20 A;  2HHH H;  1TWC A;  1TVK B;  3G6B A;  2XUM A;  2R84 A;  1AJQ A;  3RYH B;  2V5A A;  4MTD A;  5B1A C;  1Q6U A;  2F43 G;  5KHH A;  3L73 H;  1SA0 A;  2B63 A;  1S0V A;  3H1H H;  3NXS A;  2PMZ E;  4FLT A;  5C1O A;  2ALZ A;  4PWQ A;  4GKK B;  1FFT B;  4EYI B;  3LSU A;  2FK2 A;  3OE7 G;  5IYZ F;  4TM5 A;  3AG3 C;  4P9P A;  4JI4 O;  4NXM O;  1M7J A;  1N32 B;  4MAM A;  5I5S A;  4XYM B;  2F1M A;  3X2Q C;  5J2T A;  4X64 B;  4GUN A;  4WBN A;  2VQE O;  2CZG A;  2ASJ A;  4LNU A;  3RYI A;  3TW7 A;  5JCO A;  5I60 A;  3JAM N;  2YEV A;  1THZ A;  2EJ7 A;  3ABL B;  1PV0 A;  2ZE5 A;  3K57 A;  1FFX B;  5BR8 B;  4ME6 A;  3GIK A;  5EBW C;  3PR4 A;  1N0J A;  5LP6 C;  5CB4 B;  1VEW A;  4YHH O;  1NTK H;  4RNM A;  1SQP H;  2P67 A;  3CCL V;  2HHH O;  4IWY A;  1TA8 A;  2R93 A;  4O2B F;  4YIP A;  4MVO A;  3QFF A;  2Q4P A;  4KXR A;  4A3F G;  1FJG H;  1IOW A;  1OJH A;  4C2M A;  4FIP C;  2LFR A;  3V4Z A;  2R6F A;  2ZNI A;  5HFL A;  2V7Q G;  2HHF B;  4X20 B;  3RAX A;  5CA0 A;  4M7E A;  4YB8 B;  2WDT A;  1TGO A;  4X9Q A;  2WYO A;  2FMA A;  1QHT A;  3C3S A;  2DW4 A;  2V59 A;  4HQ6 A;  3DXR A;  1JFF A;  2YW2 A;  3AG4 C;  4X1Y A;  2PF4 E;  4O3Q A;  2GSM B;  1K3E A;  1DLB A;  4TV8 F;  1QU7 A;  1PL4 A;  1WH2 A;  2R92 A;  3W5O A;  3RFR A;  1P49 A;  2AHZ A;  3TET A;  1PP9 H;  1SES A;  4BBS G;  2Q5Z A;  2HDK A;  4MVM A;  5H5N A;  5KMG B;  5LL6 Y;  4IR1 A;  2J6T A;  3HOY G;  1EM1 A;  1Y74 A;  1JOY A;  2IP4 A;  3W1B A;  3SJA C;  3PVX A;  1VQ6 V;  4DR5 H;  2N74 A;  4O4L A;  5D5Q A;  5DEC A;  4DR1 B;  1WB8 A;  1N36 B;  3B8N A;  5CAE B;  3H01 A;  2HVJ C;  2C2R A;  1VQM V;  2FB5 A;  1FJG O;  3KG2 A;  3K3W A;  4L87 A;  4CS4 A;  3HOX G;  2A06 H;  4YY3 B;  2JIZ G;  3ZHT A;  3BHP A;  4BIU A;  4TOI A;  2F23 A;  1JKJ B;  2Z02 A;  3T54 A;  4QE7 A;  3SJQ C;  1U97 A;  4ED0 A;  1I94 H;  1YDX A;  2EIK B;  3Q1K A;  4FVM A;  5KFK A;  3EPG A;  3AG2 B;  2E5L B;  1AVM A;  1AI5 A;  3QZ8 A;  5EC2 C;  4DV6 B;  1R1B A;  2P4V A;  3QO8 A;  4I4T F;  2HG5 C;  3JD4 A;  3OUS A;  1H2M A;  4DV5 O;  4TV9 B;  3CRA A;  3ZRV A;  4N21 A;  4O83 A;  2Y4U A;  4FLV A;  2WLH A;  2QM7 A;  4CH5 A;  4UV8 A;  3CD6 V;  4LF8 B;  2C28 A;  5C5J A;  2VOB A;  2BTQ B;  3F5W C;  4DR6 H;  1GSA A;  4A3L G;  4FE2 A;  4EFB A;  2HIX A;  5FNV B;  1UPG A;  2P06 A;  4CBC A;  1M93 A;  4DR5 O;  3VNN A;  1E1R G;  5KFP A;  2QKS A;  4JI7 B;  1R6T A;  4A3K G;  5GON A;  1JQ0 A;  3R5H A;  3QZ7 A;  3CSX A;  3BAA A;  4BXX G;  1XDN A;  3NC0 B;  2EJR A;  4ABM A;  2H8P C;  4YJ2 F;  2YCH A;  1F51 A;  1YTF D;  1IBK B;  1NBM G;  1JX9 A;  3FAV A;  2V4D A;  4DV3 H;  2Q7G A;  4JTD B;  2WLI A;  1I94 O;  4MV8 A;  5KFT A;  4Q0Y A;  5FD6 A;  4U3J A;  2HGS A;  3HPL C;  4RZR A;  1ZAU A;  3BCC H;  2HVK C;  2ZR2 A;  2YID A;  1KC7 A;  3B4S A;  5CBH A;  2V1D A;  5LXT B;  2YIB A;  2DPI A;  1C30 A;  3N2K B;  2YYA A;  3R66 A;  1A3G A;  2CK3 G;  2GPS A;  4DR6 O;  3GLK A;  3ABL C;  3HKC B;  4JAA A;  1W96 A;  3TIG A;  2WSS G;  3H0G G;  4R50 A;  4FLW A;  3Q8S B;  3JZ6 A;  3CMA V;  1FXK A;  1LR1 A;  4U7C A;  4W4K A;  4X62 H;  2EZP A;  5KT2 A;  2AU0 A;  2B63 G;  2PUS A;  1KJJ A;  5DMX A;  3RAQ A;  2UVW A;  2X6A A;  4A93 G;  4WFA V;  5J2T F;  2CTQ A;  5DN6 G;  4WBN F;  1Y1W A;  4J10 A;  2JA5 G;  1S03 G;  1HW7 A;  2CH7 B;  4I9Q A;  3CYO A;  1Q43 A;  4ECZ A;  4HZ3 A;  3TK1 A;  3GV8 B;  1HNZ H;  3JD2 A;  4PEL A;  5C4X G;  5KG0 A;  5D5P A;  2LW1 A;  2COJ A;  5KFX A;  4LH7 A;  5I47 A;  2UU9 B; 
#chains in the Genus database with same CATH homology
 3K58 A;  4K0K H;  4DR4 H;  3NBZ B;  2RGR A;  2JS5 A;  1IBL B;  3RYC B;  3CVZ A;  5FLX W;  3RYC A;  4HBN A;  2R9A A;  4LSX A;  5IWA H;  1J5E B;  4YHH B;  2UUA H;  4BW9 A;  3N44 B;  2UXB H;  4MV9 A;  4ZOL A;  1HR0 H;  4DR2 B;  5EYP A;  3M7M X;  1B04 A;  4O4I B;  2Q2T A;  1P8L A;  4JV5 H;  5A2Q W;  2HVS A;  4GKK H;  2UUC H;  2ZIM A;  3JAR A;  3VQV A;  3N6X A;  4DV0 H;  4CC6 A;  3MAQ A;  4LF9 B;  4R7R A;  4DRX A;  1CKN B;  4APM A;  1CKN A;  1Q8I A;  3JSN A;  3JAS B;  5D1O B;  2RQ6 A;  4O4J A;  4ZHQ A;  4AHC A;  3U0Z A;  1HNX H;  1M5I A;  1TUB B;  1N34 B;  4DRF A;  4X65 H;  3HKB B;  3HKB A;  4LFC H;  4I55 B;  4I55 A;  4PI0 A;  5FPR A;  1A0I A;  3HKE A;  4DK1 A;  3U11 A;  3M4I A;  4JI5 H;  5LMN B;  1CKO A;  4UCU A;  2CFM A;  3J81 W;  5LOV B;  5LOV A;  4UCR A;  3KXY T;  2FE3 A;  4EFE A;  3L2P A;  5JVD A;  4B3R H;  3LNN A;  3GB8 B;  3N40 P;  4DV7 H;  4DR7 H;  1XMO B;  2F4V B;  5ITZ B;  4X62 B;  3ZS8 C;  1HNW H;  1FJG B;  5KHG A;  3T1Y H;  3RTX A;  2PGG A;  1S68 A;  2VQF H;  3JAL A;  4LF6 H;  3RJ0 A;  4LF5 H;  4UCS A;  5GON B;  4DUY H;  2UXC H;  4DUZ H;  4X1K A;  4LF4 H;  5CA1 B;  2JVD A;  5CA1 A;  4MTE A;  4ZI7 A;  4RB3 C;  5IJ9 B;  1KMI Z;  4I50 B;  5IJ9 A;  4I50 A;  3GJX B;  3RWR D;  3LML A;  3K59 A;  4FM2 A;  3KAL A;  4JI8 B;  5IYZ B;  5JJJ B;  1O9H A;  5IYZ A;  4K0K B;  4DR4 B;  4YJ3 B;  4HNA B;  4YJ3 A;  5LL6 b;  2YXL A;  4OX9 B;  3OTO H;  5J2U B;  5J2U A;  4EEQ A;  2CAZ C;  5IWA B;  3IG0 A;  3UT5 A;  3JAT A;  5LA6 B;  1TVK A;  5IJ0 A;  4RAZ A;  1GYF A;  4FLZ A;  1HR0 B;  3J80 W;  4DK0 A;  1XNR B;  4E6N A;  1O75 A;  1M4U A;  4JI6 H;  3UQ8 A;  2HVQ A;  1KU9 A;  4LH6 A;  4DR1 H;  1BJT A;  4JV5 B;  4FLY A;  5FD5 A;  4DR5 B;  3S24 A;  4JI0 H;  4X1I B;  4B3M H;  2CW7 A;  4X1I A;  1WNS A;  1G6U A;  4LFB H;  3BPZ A;  2PZS A;  4YY3 H;  5JH7 B;  2YIA A;  5JH7 A;  1XNQ B;  4IAJ A;  5C8Y B;  4O2B B;  4I7H A;  5C8Y A;  4O2B A;  2MCT A;  2CW8 A;  4AQY H;  1E4G T;  4EQ5 A;  4NXN H;  4GLX A;  1Z5V A;  4LFA B;  2F93 B;  4JYA B;  2QM4 A;  3N41 B;  1XMQ B;  1H2S B;  5KHK A;  1V9P A;  1HNX B;  4AIL C;  2E5L H;  4D7T A;  2GV9 A;  1N33 B;  4LFC B;  4FM1 A;  4DV6 H;  3VQX A;  4PHZ A;  5LYJ B;  4DR3 B;  5KHJ A;  3T1H H;  4CH3 A;  5LP6 B;  2ZM6 H;  3VQY A;  3BAB A;  1FFX A;  4TV8 A;  3TY9 A;  2VPS A;  3SGI A;  1X9N A;  5EOY A;  4LF7 B;  2QJ1 A;  1SQF A;  4B3R B;  2UXD H;  1AN7 A;  1WPB A;  4DV7 B;  4DR6 B;  2YI9 A;  2VUG A;  3QG5 A;  1HNW B;  4JI3 B;  4RB2 C;  4JI1 H;  1E4F T;  4JI7 H;  4ZOL B;  2VQF B;  1Z2P X;  4LF6 B;  1JJO A;  5EYP B;  4LF5 B;  1DGS A;  5K1X A;  4DUY B;  2UXC B;  4DUZ B;  2PYJ A;  4LF4 B;  3FMA A;  2W57 A;  4UCV A;  4LMY A;  3JAR B;  4O2A B;  4O2A A;  1I7F A;  3JAK A;  2YI8 A;  4DV3 B;  4O4H A;  4A2A A;  4DV5 H;  4IHJ B;  2VWJ A;  4DRX B;  4IHJ A;  2E3C A;  2R70 A;  4FLU A;  1N32 H;  5EIB C;  3IAY A;  4JI2 H;  4GYC B;  3ICX A;  4O4J B;  4ZHQ B;  5KMG A;  4X64 H;  1SEI A;  1RSO A;  4RB1 A;  3SJC C;  2P22 C;  3HKD A;  4I4T A;  3ZED A;  1JMK C;  1WN7 A;  3HKE B;  5BMV B;  5BMV A;  1ZHS A;  5BR8 H;  4FM9 A;  2HIV A;  4JI0 B;  4UCO A;  3QF7 A;  1O9G A;  4B3M B;  3OTF A;  3WB2 A;  4B3T H;  4LFB B;  5JVD B;  2BTO A;  3TY5 A;  3QWU A;  3RGB A;  4AQY B;  4NXN B;  4K8Z A;  5KHI A;  1Z2N X;  2ZIO A;  4B3S H;  4L8J A;  4UFZ A;  3RYF B;  5EIB D;  3RYF A;  4JI4 H;  4NXM H;  3BRC A;  3JAL B;  4FLX A;  1Q3E A;  4YJ2 B;  1XI1 A;  4YJ2 A;  3SJB C;  3ETQ A;  4X1K B;  3T1H B;  4BWS C;  1YEW A;  2VQE H;  4EB6 A;  4TV9 A;  3WB1 A;  1HNZ B;  4ZI7 B;  4ZIB A;  4K8X A;  2RJZ A;  3GDE A;  4TQF A;  2OWO A;  3H20 A;  5FPO A;  1VF7 A;  1IBL H;  5IT9 W;  2UXD B;  2EX3 A;  1J5E H;  2PYL A;  2Q2U A;  4YHH H;  3A2F A;  3UT5 B;  2HHH H;  3JAT B;  4TUY B;  1TVK B;  3B2E E;  3QTC A;  4TUY A;  4D7S A;  5IJ0 B;  2UUA B;  2UXB B;  3RYH B;  3RYH A;  4X66 H;  4MTD A;  4DV4 H;  4BWA A;  2OYQ A;  5KHH A;  3F8N A;  1SA0 B;  1P16 A;  1SA0 A;  3THO A;  3BA9 A;  1XHZ A;  1N36 H;  4FLT A;  1XHX A;  4GKJ H;  4GKK B;  2UUC B;  4NVP A;  1CKM A;  3JAW A;  4DV0 B;  4FFB A;  4LSA A;  2PY5 A;  1N32 B;  1N34 H;  2F1M A;  4JI2 B;  5J2T B;  5J2T A;  4X64 B;  4WBN B;  1XQ8 A;  4WBN A;  1VS0 A;  3HXL A;  4X65 B;  5DIS C;  1M0W A;  4LNU B;  4LNU A;  3RYI A;  3N2K A;  4PZ7 A;  5JCO A;  1L2Z A;  1X4T A;  3WB0 A;  3N2G A;  3RGZ A;  2KKW A;  4JI5 B;  3U10 A;  3KYH C;  3K57 A;  1FFX B;  5BR8 B;  3HKC A;  4TV8 B;  4LF8 H;  5LP6 C;  5CB4 B;  1TAE A;  2YIB D;  5CB4 A;  4B3T B;  1TA8 A;  5LMU H;  4B08 A;  1FJG H;  4DR7 B;  4B3S B;  1S5J A;  3E22 A;  4CS2 A;  1I6U A;  3KAK A;  2ZNI A;  5EZY B;  5EZY A;  4DV1 H;  3T1Y B;  3N43 B;  4X20 B;  4JI4 B;  4X20 A;  3BA8 A;  2ZCE A;  5CA0 A;  4CH6 A;  4F6R A;  4NXM B;  4MV7 A;  3TY8 A;  2ZJT A;  4M7E A;  2WDT A;  1QQC A;  1TGO A;  2WYO A;  1XK5 A;  4PZ8 A;  2Q0A A;  1QHT A;  4IIJ B;  2VQE B;  4IIJ A;  3L4J A;  1JFF B;  4CH4 A;  1JFF A;  4X1Y A;  2RGV A;  3DSQ A;  3RGX A;  1IBK H;  4JI8 H;  2F95 B;  3JAK B;  1WH2 A;  3JAM W;  4O4H B;  4OX9 H;  3W5O A;  3RFR A;  1P49 A;  5JJE B;  3K5L A;  3OTO B;  2VWK A;  5KMG B;  1L8D A;  4DV2 H;  2P5O A;  1SQG A;  3K5O A;  2HHH B;  3RF2 A;  1XNR H;  4CC5 A;  3J7A K;  2WE6 A;  1T5E A;  3HKD B;  4I4T B;  4X66 B;  3SJA C;  4DV4 B;  3W1B A;  4O4I A;  2ZIN A;  4O4L B;  4DR5 H;  4JI6 B;  4O4L A;  5D5Q A;  4KHP H;  1ZHQ A;  4DR1 B;  1N36 B;  4PI2 A;  4FM0 A;  1XNQ H;  4GKJ B;  1Z5W A;  1IBM H;  4CS4 A;  3MWM A;  4YY3 B;  3BHP A;  4LFA H;  4JYA H;  4TOI A;  4A2B A;  1XMQ H;  3JAS A;  5D1O A;  2ZNJ A;  5JJN B;  1I94 H;  1TUB A;  2PTM A;  1N33 H;  4FVM A;  2Q7H A;  4DR3 H;  3SR2 C;  2E5L B;  4PZ6 A;  4DV6 B;  5D1P A;  2KSW A;  4EB6 B;  3JSL A;  4TV9 B;  2UUB H;  2ZM6 B;  2XIG A;  2UU9 H;  4FLV A;  4CH5 A;  4LF8 B;  4LR3 A;  4LF7 H;  4J0M A;  2JGU A;  2VOB A;  2BTQ B;  2BTQ A;  4DR6 H;  5LMU B;  5ITZ A;  1SYX B;  4UCT A;  2HVR A;  4JI3 H;  4EFB A;  2HIX A;  5FNV B;  5FNV A;  3VNN A;  1M93 A;  4JI1 B;  4DR2 H;  1FKA H;  4DV1 B;  4JI7 B;  5K1P A;  5GON A;  5KX5 B;  5KX5 A;  4PDB A;  3CSX A;  3BAA A;  1XDN A;  3NC0 B;  1M0T A;  4CS3 A;  1FVI A;  2YCH A;  1IBK B;  2V4D A;  3CHX A;  4DV3 H;  2Q7G A;  3RR5 A;  4LF9 H;  4HNA A;  3JAW B;  4Q0Y A;  4Q6G A;  5FD6 A;  4U3J B;  4DV5 B;  4U3J A;  2HGS A;  4FFB B;  3K5N A;  1ZAU A;  1SKV A;  1BGW A;  4RZQ A;  4KL1 A;  5LA6 A;  4DV2 B;  4RB0 A;  1D5A A;  3L4K A;  5LXT B;  5LXT A;  2YIB A;  3KAJ A;  2XHB A;  3RYI B;  2IM9 A;  3N2K B;  3RIZ A;  5LMN H;  4ETS A;  3N2G B;  4KHP B;  5JCO C;  5JQG B;  5JQG A;  3HKC B;  3N42 B;  1IBM B;  3NBY B;  1Q5O A;  4FLW A;  4TQD A;  3VQW A;  1XMO H;  3C0F B;  1NT2 B;  2F4V H;  2Q7E A;  3CB2 A;  3K5M A;  4X62 H;  3DF7 A;  4RAY A;  2PUS A;  3E22 B;  1I94 B;  2R72 A;  3PN1 A;  5LYJ A;  3FFQ A;  4F6R B;  5CA0 B;  1Z2O X;  1S03 G;  1MZB A;  1HW7 A;  4I9Q A;  2O03 A;  1Q43 A;  3EYY A;  5LP6 A;  1HNZ H;  2F66 C;  3W1G A;  2HEP A;  5D5P A;  2UUB B;  4X1Y B;  4LH7 A;  3K3V A;  2UU9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...