4UCUA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucuA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucuA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucuA02
4DRFA 2UUCB 4UCUA 2UUAB 2HIVA 4JV5B 3W1GA 5LMNB 1IBMB 4DV0B 1CKNB 4PZ7A 4X66B 4DV7B 3W5OA 4DV5B 4B3TB 4JI5B 2UU9B 4JI2B 4LF5B 1HNZB 3L2PA 4DR1B 2HHHB 5LMUB 4GKKB 2HVSA 3SGIA 4GLXA 1XMQB 4DV3B 1ZAUA 4YY3B 4JI7B 4NXMB 4KHPB 3RR5A 4B3SB 5DISC 1HNWB 4EQ5A 4LF8B 3PN1A 1HR0B 2VUGA 1HNXB 3JSNA 4JYAB 3QWUA 2F4VB 4JI4B 4LF6B 4DR4B 2Q2TA 1CKOA 2Q2UA 3TY9A 3NC0B 4X64B 1J5EB 4YHHB 1P8LA 4DR6B 1P16A 3NBZB 1IBKB 4PZ6A 3T1HB 2UXDB 2CFMA 1TAEA 4JI8B 4B3RB 3TY8A 4NXNB 2HVRA 2E5LB 4UCVA 1CKNA 4CC5A 4LFAB 4OX9B 4EEQA 4DV1B 4JI6B 1FVIA 4K0KB 1S68A 4TOIA 4UCSA 4LF7B 2ZM6B 4LF9B 4LFCB 4JI1B 4DR3B 3UQ8A 1FJGB 4LF4B 4EFEA 1XNQB 3BABA 2VQEB 1I94B 1N32B 3T1YB 2UXCB 1TA8A 1CKMA 2HIXA 3KYHC 1N33B 3RTXA 4JI0B 3OTOB 1XDNA 3BA9A 4LH6A 1VS0A 5D1PA 3TY5A 4UCTA 3GJXB 4E6NA 4CC6A 1XNRB 4UCRA 2HVQA 3S24A 4DV4B 1IBLB 4DUZB 3VNNA 4DUYB 4JI3B 2VQFB 3BA8A 3NBYB 5FPOA 1B04A 4DR2B 2UUBB 5FPRA 3GDEA 1V9PA 1A0IA 2UXBB 3GB8B 4LFBB 3JSLA 1XMOB 2OWOA 4AQYB 5D1OA 1X9NA 3BAAA 4PZ8A 4B3MB 4UCOA 4UFZA 4GKJB 1N36B 3W1BA 4DR5B 5IWAB 4X62B 4DV6B 4LH7A 1N34B 1DGSA 4DV2B 4X65B 4EFBA 4DR7B 1XK5A 5BR8B 5D1OB
chains in the Genus database with same CATH superfamily
2QWPB 2R9RB 3WFVA 2NU8B 2W8LA 3GTKA 5DGHA 4JV5B 3QVNA 1OBDA 4DR6H 2J9GA 2M6YA 2VQFH 4X66B 3W5OA 3MAQA 3MWMA 4B3RH 1W59A 2UVWA 4DR2O 1KC8W 3AYHB 1I7FA 3EVKA 4LF5B 2UXBH 2Q5ZA 4J9QA 4DV3B 2EZOA 1LUWA 5DGAA 1Y66A 4NZMA 1WN7A 2ODTX 4K35A 4DIMA 5FLXW 3SPJA 4JV1A 2KKWA 1SEIA 3QG5A 5GTHZ 4DR5H 2EZPA 4RQEA 5KT7A 2CTPA 4WFFA 4JYAO 1ZTEA 1HR0B 3IC9A 3JSNA 4FZ1A 4DV2H 4MTOA 3ZCCA 2AHZA 3FYIB 2VQEH 1FFXA 1HNWO 1L2ZA 4CH6A 4MW3A 4FBTA 3E35A 4QE7A 1TUEB 4WD3A 2A06H 1SRYA 4BWAA 4TUYF 1Y76A 4I55F 1XMQO 4GKKO 3Q8PB 2EBOA 3TXSA 4Z2WA 2C22A 2FPIB 4MV6A 1WA8A 4KFMA 5GONF 4JV0A 2Y69B 4UB8Z 2MW2B 5HFMA 3H1HH 4GX1A 4OPAA 5CA1F 3EPIA 1Z2NX 3MDSA 4Z1VA 1BE3H 1K33A 4JI8O 4CHIA 3ZMTA 1F23A 2UUBH 4LF7B 2N74A 1BZKA 2C2DA 1RSOB 3BG5A 4O7VA 4ZQIA 3PW4A 2QE7G 4ED8A 4FFPA 5LL6b 4GC7A 5JVDF 4HBNA 3RYFB 3F5WC 2PVPA 3N40P 1YI2V 2RGRA 4I50B 1AJNA 1N36H 2E76B 1I94B 1M5IA 4A3MG 2ZE8A 4DV6H 1X4TA 5DG7A 5DGBA 4LSAA 4LP8A 5LGUA 5CB4A 3OUUA 2ZE7A 1GH6A 5J2UA 5FJ8G 2DQ3A 4JTCB 2FK1A 4X1YA 4CC6A 3DF7A 2VPSA 2UXDH 1GM8A 4I4TB 1Y67A 3CCVV 4ECRA 2ZT9B 2V4DA 1VQPV 1QU7A 3R5FA 1I5YA 4DUZB 1DTOA 4G2KA 1K83A 4HAMA 3K5NA 1B33N 1B04A 1Q6IA 3WO1A 3MFIA 2P4VA 4PDVA 3IG0A 1BCCH 4DR1H 4LFBB 3JSLA 4ZHQF 2Y0SE 2GPSA 3P3PA 4LF4H 1M57B 4IWXA 2EINB 2NNUA 4JAUA 3SE7A 5EYPA 2R7ZA 4YXWG 3R9RA 1WAZA 3M4IA 4NYKA 1GTOA 2UVVA 3FB7C 1XK5A 1GN3A 4XDKA 3E22B 4U7OA 5LGTA 4Q8FA 3FFQA 3QQMA 2AHYA 5I5XA 2UUAB 3UCSC 4YHHH 4R8UB 3V4ZA 1JFFA 2BOBC 4UUGA 2WLHA 4CKBA 4PZ7A 1NU1H 1QR9A 1NKDA 3ABKB 1PD3A 2YXYA 5CBGA 4ECVA 5EDWA 1XMQB 2IA6A 5KS8A 3ZMUA 4EGQA 4JI7B 4B3MH 1MZBA 3ETEA 5JH7A 1AJQA 1BXRA 5J2UB 4Q45A 5EWFA 4O7NA 3IJ4A 4EB6B 5KFUA 1YCIA 5FNVB 1VQ6V 2Y0IA 1OZ0A 3HKBA 3ABKC 1V51A 3T5LA 1K73W 5LHHA 5IYDO 4KXRA 3WB2A 3CCQV 4MV9A 4J9MA 4O3NA 5JCOC 5JJEB 4PZ6A 3BJYA 2FMLA 2FYUH 5EZYB 3VOTA 3UO3A 4B3TH 5EWGA 2XAJA 2DWEC 1EKPA 3OE7G 2MK3A 4DV0O 4ME6A 3JCUZ 1SS3A 1F7YA 5LGNA 4A2BA 4JV5O 4WCEV 1VKZA 2CNVA 1Q6UA 3DTUB 4B3RO 3HKEB 4D7SA 5KG3A 1R3KC 3T1CA 1IBKO 1KJ8A 4YIPA 4JI1B 3HXLA 1KU9A 2R8KA 1IX9A 1SESA 2EINC 3TGUH 4BAYA 4QWAA 2P67A 5KFZA 4HNAB 1R3JC 1IURA 5IJ9B 4A3LG 2FKLA 2R8IA 4DR4H 2QDOA 1HNXO 1VQOV 3BQ2A 3KCXA 4F6RB 4FLVA 3VPCA 2C2RA 2R85A 2COGA 4QW9A 1KUQA 1GAXA 1TVKB 3T1HH 3SPIA 5KA5A 4ECSA 1IBLB 2JK5C 4I50A 3HT5A 2WLIA 3R65A 5GONB 4MV8A 5KFKA 1PM9A 2FB5A 4C5CA 4GX5A 3V6KA 2QGNA 4JGSA 3JATB 3X2QB 3JRWA 1AI7A 5BPFA 5KA6A 5BR8O 1B3QA 2ZIMA 3M8AA 2DWDC 4O81A 3H0GG 3L74H 3RFCA 4ED0A 5EOYA 3JARA 1UFIA 1DK1A 1DGSA 4O7ZA 1YSCA 5IJ0A 3UZBA 3N27A 2B1IA 5LA6A 4AHCA 3N2GA 4GKJO 4O86A 5BR8B 3JATA 2R8GA 3ZHVA 1XREA 2ASJA 1TWAA 2HVJC 1Q43A 3F8NA 4DV4H 2HKOA 3HKZA 5I5UA 3ASOC 2PF4E 1EUCB 2Q68A 1VMGA 4JAVA 1GN4A 1JIHA 2JEGA 3N41B 2IMWP 4GX2A 3GWOA 2HHHB 4OX9H 5LXTF 1JJOA 4IR9A 1VQ9V 3NR7A 3JD1A 1IBLO 3CHXA 1QVFU 2W6NA 3JYCA 2CGNA 2CNUA 3ZHSA 5CA3A 4B3SB 4PWQA 2VR1A 2HGWA 4TV9A 3ZHRA 4PD4F 5C1PA 3ASNB 3D36A 3FX7A 2A9HA 3ZMSA 4GLWA 2FLNA 1NVPD 4APMA 4JI4B 4J9ZB 1MOFA 5KFVA 4B7EA 2EX3A 2Q2UA 4DL7A 3EFFK 4DV0H 3K5LA 3UYYA 3NBZB 1IBKB 1N0NA 3LSQA 5KFOA 4TV8B 4O2BB 1GKFA 3GLKA 5KFRA 4DL5A 2PI5A 3ZBHA 4J10A 4K0KB 2PYLA 4EEYA 2W0XA 2FJZA 2C00A 4QNHB 5KG0A 2BTQA 4H33A 2YXLA 4TUYA 1EZJA 4DK1A 2ZM6B 4LF9B 2WB1E 2AGPA 5BZBA 1ZWIC 1OHHG 1A9XA 1JCHA 4RUFA 4NB5A 1XNQB 5EIBC 2ADQB 2JS5A 3T1YB 2F4VO 4RZRA 4HYKA 4X62H 3KAKA 1EFRG 4O7TA 3MFHA 4UV9A 4J9KA 4FLTA 1SFOA 3H4BA 4UCTA 5JJJB 2HJDA 2PTMA 2P0AA 4O3OA 4NXNH 3DTFA 4QSHA 2ZNJA 2Y69C 1I1KA 3QO8A 1G1XB 2XGQA 1H2GA 4A5UB 2XAQA 2XNDG 2GUZB 1V9PA 2AU0A 3SPCA 5KMGB 1M1KW 3ABMB 1DF5A 1JKJB 1K7DA 1DF4A 5CAEB 4R8CA 4NXMH 1JDBB 5KFMA 4TVIA 3PO3G 3FMAA 2AW9A 3KHRA 5IP7G 3G8DA 4B08A 5DQGA 1N34B 1Q3EA 2BSKB 2JEJA 1AVMA 3MWDA 5LHIA 5JCOA 1AI5A 1AROP 2ZDIA 4A3JG 3PZPA 3I4NG 4J9SA 2R7NA 2KSDA 1Y1WG 1JQ0A 4UCUA 1JMKC 3Q8RB 3GIMA 2VWKA 2XOKG 4IGGA 4ECYA 2ZDQA 2UU9B 2YRXA 4QWDA 1M56B 4IR1A 2CTWA 3JASA 2ILMA 4DUZO 2HVSA 3HR0A 4C7UA 1MABG 1ZUQA 1QVGU 4MVOA 1Y76B 4ED6A 2BTOA 3AK2A 1IYDA 5CB4B 4QE9A 2ZKOA 3ORRA 3KXYT 2W7PA 5BYAA 2HFEC 4PHZA 4XDJA 1MZFA 4O82A 3OTOO 3MWEA 4QJFA 3AG3C 5L3GA 1KYOF 1GSHA 4LWSA 2NVXA 4X20B 3SNOA 4A3FG 3K0GA 5KG1A 2IJHA 2RJZA 1NJIW 4Q43A 3ETJA 3T4ZA 3GV5B 3P30A 2R82A 2OTLV 4FFRA 2CE4A 4RAYA 3TEKA 5DLFA 4WFEA 1R6TA 4PA7A 1TAEA 3H3VH 4UXNA 1W2BU 1XI1A 4ECZA 4EYHB 2E74B 5IJ9A 2Z0AA 5KX5B 2B5UA 4UCSA 4O3PA 1A48A 2F66C 3T5HA 1Q90D 3WO0A 1VQ8V 3DAAA 4X1KB 4O2BA 2V58A 2ZXWC 3PO2G 1TA8A 2GQSA 1N33B 1JDEA 1Y6XA 3QO5A 1RM1B 3CJHB 1Z2PX 3FAVB 1EN5A 1T36A 4Y8VB 3BA9A 3STLC 1Z2GA 4O7WA 3GJXB 3JALB 2UXBO 3LDDA 5B66Z 3CVZA 2VQFO 1N8RW 2V1DA 2VA3A 4JI2O 3RN4A 1K5QA 4X66O 1NR1A 2UXBB 3TINA 2MCTA 1XMOB 4MV1A 3HOVG 4UUJC 5FL7G 1DV2A 3OSPA 4ZKIA 2W0FC 4PA6A 2EIMB 3W7TA 4DR5B 1N32H 5J2TF 4ZHQA 4NVPA 3UM7A 3HBLA 2X7RB 2CKZB 3GVMA 4FM2A 4BR6A 1Y1VG 5K3WA 2W6OA 3CPWU 1KQSU 3K06A 3GTPA 1W96A 2Q7DA 1SA0A 3CE2A 2JGDA 3G80A 3W7WA 4A3GG 4HZ3A 3EPGA 3RB6A 2W6JG 2HDKA 2IJJA 3FKSG 3JD3A 4JI2B 3OMNB 3CSWA 5JH7F 3GIKA 4X88A 5EK0A 5LMUB 3G8CA 3JZIA 4DV4O 2DAAA 4NTYA 3B2EE 4ZI7A 3T9AA 4HNTA 4KHPB 3T9DA 1WNSA 2BSKA 1RJRA 3K3WA 1D5AA 1FD9A 3OMAB 4DK0A 5JQGA 1S0NA 1VQ5V 3R66A 1IXBA 5F2VO 4ED3A 4XYMB 4U3JA 3RB3A 1I94H 3L70H 2ZR2A 2ABJA 2Q69A 4MVUA 3GTOA 1YJNV 2VUMG 3ICXA 4X64B 5LMNH 3KHGA 4ETSA 1XUQA 4JYYA 5LYJB 1QNMA 4CKCA 4DR1O 5BWUA 4ECTA 2CFMA 1KEEA 1V4YA 3CB2A 3DC6A 2XHBA 2PGGA 4PBCA 1Z2OX 5KFWA 5KFYA 3PR5B 3BEHA 1K3EA 1QLEC 4RO2A 2QWOB 2GLTA 1WP7A 1AP6A 1E79G 5D5PA 1TWFA 1GRJA 2QB5A 2XASA 5LL6Y 3C0FB 1XEQA 3BABA 5KT5A 2VQDA 2Q7EA 3RTXA 4O4IA 3U10A 1J5EH 4PI0A 1JX9A 3J81N 4X65H 1QLEB 2YC0A 1COWG 1CEZA 3BFRA 4P30A 4RCNA 2BR0A 2R6FA 5IYZF 1AILA 1EUDB 1I0HA 4NTXA 3GWKC 1UC8A 3OR6C 4LFAH 4NR1A 3U0GA 4I7ZB 1JA8A 5FPRA 5C8YB 4JI5H 2C2EA 5LOVA 4J7KA 1Y74A 3T4DA 4O4JB 1XMQH 1RK5A 4QPKA 3CCUV 4B3MB 4JI7H 2NVYA 3JD2A 4IRCA 2VQEO 3ZN1A 1V54C 1ZQ7A 2F43G 4NKGB 4JYAH 1K5SA 4ICGA 3CSXA 4LCUC 3UZOA 4LF9O 1XILA 1XNRH 3HKDB 4B3MO 5J2TA 1TGOA 4FMTA 2CTRA 4JAAA 2NN4A 1US6A 2Z02A 3CCEV 1BNCA 2Q73A 2ITCC 3T2MA 4LFAO 3T9CA 2EJ2A 4QW8A 2EIJC 2ZE6A 1S76D 3U54A 2WLKA 4RUCA 4YJ2B 2LP7A 3HKCB 4YY3B 4U3FH 3RR5A 4WBNF 2XAHA 5A9GA 1I08A 5L3BA 4FLWA 3HOWG 2I8CA 1AP5A 5B1BC 3K3VA 3J7AK 5J2TB 1WPBA 4Z1MG 3T1YO 1R9TA 3VPDA 2Y4RA 5IYBG 2CQYA 4DR4B 2DYSB 3K5IA 5EC2C 3H9VA 1S03G 2YICA 3RV4A 2X6AA 3ABLB 2OYQA 5B3SB 5LYJF 3OMIB 4ZBMA 4ABMA 1I3QA 2J6SA 4DV5O 3H1IH 2QKCA 5KUMA 2QYZA 2N04A 3RFRA 2EIKC 2IU3A 2OCCC 5JH7B 1NT2B 1Q86W 1OCOC 1Y74B 2R7LA 5CBFA 3FAVA 5LP6C 3LQSA 3GTJA 4BWSC 3L75H 5K1XA 3Q8QB 1KECA 4MTFA 3QZ7A 2EIKB 4DL6A 2ATLA 2DYRB 1ZHQA 1QCEA 2ZXWB 3AG2B 4TQSA 4K8XA 5I5VA 3EHBB 2UXCB 5B1AB 1CKMA 4K6NA 3HKCA 1KJJA 3LULA 2J6UA 4FM9A 4EYIB 4X9QA 3Q2OA 2ZCEA 1XDNA 1Q81W 5BPHA 2VRZA 2LW7A 1JOYA 3E22A 4HYOA 4HQ6A 4Q44A 4MTDA 5L1KA 4CZZA 3M7MX 4JI8H 2RDJA 1B06A 2QWNB 1FXHA 4ED1A 2P4KA 3VNNA 4E4EA 2R7MA 2VPQA 4R6ZA 2OIEA 1NS1A 3T7AA 4DV7H 2OT5A 3T5JA 1SKVA 1A0IA 4D6TH 2VOBA 3SYQA 4LFCH 2Q4PA 4PELA 4DLKA 4DYLA 3BY6A 4O3RA 4E2LA 1VQLV 4GKJB 2K9PA 4B3SH 3M9NB 1PNLA 3CWBH 1AUVA 4DV2O 4K3AA 1CQJB 5L3DA 5KX5F 5KFIA 2F1MA 2EIYA 2Z5UA 1WH2A 1MMMA 4I4TA 4YBZB 1SQQH 3FB6C 1W0KG 3J80N 2EJRA 3A2FA 4K8ZA 1KJIA 1ZX3A 3RVYA 1IOVA 2BCCH 1ULZA 3K59A 3QZ8A 3KTMA 1E1RG 1NR7A 4WFBV 3TIIA 1CKNB 3L4KA 2Q9LA 3T5KA 2E2HA 1YF2A 4DV5B 3UKMA 4TT3G 2Q7GA 3L2PA 3M9OB 3OHBA 4K0KH 4JTAB 1BGYH 1XHXA 3IC7A 4XX0B 2EJ7A 4CKEA 2ZM6H 2E3CA 2GHYA 4MT8A 1EBOA 4HNUA 5BWRA 1M4UA 3K79A 4YP3A 4DW1A 3RAQA 3DGEA 2W57A 1HNXB 5I47A 3RB4A 1AR4A 5JWPA 2V7QG 4TQFA 3T1YH 3G6VA 2QM8A 5DG9A 1GO3F 3JAWA 4A3KG 2YS7A 2YDEA 4L1KA 4MVRA 3R23A 3U9SA 3RIZA 2JEUA 5FD5A 1KUTA 3ETHA 1VF7A 4CC5A 4DV1O 3LDEA 2X6CA 1FVIA 2R72A 3V6HA 2DPJA 1S68A 2ODMA 1H2NA 4GT1A 4X1IA 1BQZA 2BQ3A 1SZTA 1AJPA 3U9TA 3HOUG 1BS3A 3TQ1A 3RYCB 4LF8H 1YDXA 1S0MA 5EYPB 1E1QG 4FK5C 4LF6O 1IZ3A 4WFGA 4MS2A 4FLZA 5B1AC 1N34H 1S77D 3ZRVA 1ET0A 4MVZA 2DWCA 2QM4A 1KMIZ 1K9MW 5C5JA 2B9ZA 4TM5A 5L1JA 4FJCC 3I55V 3TJTA 1KD1W 2WB1A 4LFBO 3HB9A 3CQZA 1I2KA 5HFLA 5JVLA 4RNOA 4DUYB 2HGXA 3SPHA 3U55A 1LUVA 1ROPA 1S3JA 5DLGA 5J2UF 4LR3A 4G27B 3KCYA 4U3JB 1IBMO 1M6VA 4WBNA 4DR3H 2YU9A 3RYHA 1KKCA 1OCRB 1GO3E 1CXZB 3PW2A 3JAWB 3D3QA 2XIGA 2Y48A 4PJ0Z 2DN9A 4BIZA 4X65O 1I2LA 3TW6A 2C35B 4PA4A 1NBMG 4YR3A 2LJ2A 1MG1A 4XYLB 2YEVB 1TVKA 2DE0X 4QWBA 1S5HC 3AK1A 1G6UA 3SPGA 2W6MA 3CJHA 1Y4MA 3W7UA 4FM1A 5JUMA 1KJ9A 5EBLC 5IY5C 1T5EA 2RNBA 5CA0F 2QTSA 1IBMB 2RGVA 2JIZG 5JQWA 2YIDA 2DIKA 2WA4A 1ZETA 4KP4A 3ASOB 1MNGA 2ADPA 3SYOA 2FK3A 4IRKA 1CE8A 1G2WA 4ZHQB 3OSNA 4M0JA 3E86A 1FKAO 1M90W 1NTKH 3N43B 1HR0O 1S0OA 3HKDA 3ZJZA 2YCHA 3ZRWA 2F4VB 2RDCA 1UC9A 3QWUA 3T9FA 1M56C 1BL8A 2YEVA 4LF6B 1S9FA 5IP9G 4A3BG 5GONA 1P8LA 3CRCA 5KT6A 5F9LA 5KFXA 5LMUO 1Q7YW 2FPGB 4Q6GA 5EBMC 4BIUA 3MR3A 3ZEDA 1L0NH 4BY7G 1NTZH 3D36C 1CS0A 4DV1B 3ZRWB 1WSCA 2Z04A 1ZLZA 2JDIG 3E89A 3G4SV 3RBZA 4WHXA 5LP6B 2F93B 4OXSA 2PBZA 3Q8SB 1RYRA 4RB1A 3DXRA 5C3EG 3LSSA 1M57C 5CA1B 3WG7C 4I7HA 3RAXA 3AK3A 5KG7A 3MD0A 4R8UA 5DN6G 1OJHA 3DSQA 4I50F 5AG2A 3RYIA 5JVDB 3UT5A 2P7TC 2YS8A 1EN6A 4QPJA 3GQCA 3CEIA 2UXNA 4FVMA 1AR1B 4NTWA 3KALA 1XL6A 1B6RA 3N8DA 1QR8A 2E5LH 3N44B 4AI8A 3N6RA 2QKSA 2VQFB 3OR7C 1HNZO 2H8PC 5KFTA 4DR2B 4RB3C 3H20A 4LF5H 4PI2A 4IIJA 4MTXA 2GV9A 3HKBB 1OBGA 4J42A 1PX2A 3BAAA 4DV3H 3SJAC 1JR9A 4KHPH 4RAIA 4JI0O 4JZ2A 4L87A 2RN9A 4DR7O 2UXCO 3A8TA 3K9SA 3IGAC 1HR0H 1I1LA 1K97A 1YEWA 2IH3C 4DV2B 1OV9A 5C4XG 2XAFA 1JVMA 2Y4TA 1FKAH 5C93A 2AXTZ 3AG4B 5DECA 1K1SA 5FD6A 1JX4A 5KHJA 3T9BA 4E4TA 4UVAA 2DOSA 2HEPA 4IIJB 4TV9F 4IHJA 4JF3A 1WCMG 3Q4HB 3QFFA 1FYJA 2GSMB 4YJ3F 2FK2A 4F4LA 3RWRD 3QTCA 3ASNC 3BQ1A 4IYIA 1KKDA 2GPWA 5LBQA 5KG5A 3ML0A 2L6LA 4QIWF 5DGIA 2FE3A 1VP7A 3VQWA 3OEHG 4EBDA 4DR7H 2WE6A 4WF9V 3G6XA 1VF5B 5LA6F 1FXKA 2EIMC 3RT3C 1O9HA 2A3QA 1V55B 1WB7A 4WFAV 1J5EB 4JV5H 4JI1O 2WWWA 4I5SA 2R87A 4QIWA 2UXDB 1Q82W 4B3RB 4FS2A 1MZEA 2W9BB 1S97A 5DAAA 1GGOA 1HNZH 3VOUA 5GW7A 2R9IA 1E4FT 4DUZH 3CCMV 1IDSA 3CRMA 4LFAB 1YTFB 5BMVA 1QBZA 4J9YB 5J9PC 3I4MG 4MTGA 4F4XA 1C30A 2B1GA 3I12A 2WLLB 5C1OA 2HGSA 4LWSB 2XUMA 5JJNB 1ZL8A 4YAJB 4LF4B 1I1MA 2AZ2A 2X5RA 4FLUA 1NI8A 4UV8A 4MA0A 2JA6A 2ZDHA 1RM1C 2JEXA 3ZX6A 3TK1A 1FXVA 4O7LA 3FD9A 5BY1A 1KBHA 4JV2A 5KT3A 2ETNA 3PR4A 4A3CG 2Q0OC 3B8NA 4NXMO 4UCRA 2WYOA 2V9WA 5KFPA 1R6KA 1RFYA 1LR1A 1OCZC 4ECWA 4TWKA 3OUFA 5ITZA 2GQRA 4UB6Z 4I0XA 1XBLA 2YIBA 4O4IF 1W93A 2UUBB 1S72V 2W70A 2RQ6A 3C3SA 3L9DA 4RNMA 4LF7H 3ETDA 2R93A 3O65A 3MR6A 2AGAA 2OWOA 2YIAA 1FJGH 4I55B 1C3OA 4ECUA 3HOZG 3FDSA 3B77A 3B4SA 4O2AA 2O57A 1R3LC 5E79Z 4DV6B 2WDTA 1XNQO 2CGOA 2IW5A 1QLNA 5I60A 4U7CA 4LF4O 4X62O 1BHBA 2ZINA 4F6RA 5KHHA 4EGJA 1SQXH 4CMDA 5D1OB 2NU9B 2C28A 2HIVA 4HNAA 3W1GA 3IAYA 1YZBA 1Z5VA 4PA9A 4CH5A 2P90A 2NU6B 2YYAA 5BMVB 2GTAA 3CCJV 4B3TB 4I0XB 4RUEA 2UXDO 3SDLA 4DR1B 3JZFA 3CMEV 4O4LB 1THZA 4X64O 2RDIA 2WSSG 1SA0B 1A32A 4FGRA 2JA7A 5A2QW 1TUBB 3OAAG 1OCCB 5D5QA 4JI4O 2QSAA 5IWAH 1ENVA 4P2ZA 3OHAA 1E4GT 5BWWA 4FFKA 2R84A 4BXXG 5DG8A 2R9AA 4FFNA 5H5NA 2ZJTA 3G71V 1S10A 2B63A 4B3SO 3SJQC 3B40A 1A0GA 2YSUB 4JXUA 3OUZA 2UUAH 4HR7A 2KSWA 5BWVA 5L1LA 2CK3G 2R93G 3T1HB 3V4SA 4JI8B 5HNEA 3J80W 2RMKB 4O2BF 1KJQA 2YRWA 4GKKH 2P22C 1T94A 1H8EG 4QJFB 4EB6A 4YAKB 3GTLA 4LFCB 1HNWH 3JALA 2J6TA 5LYJA 4KL1A 3OM3B 4EFEA 3CMAV 2WA3A 4GX0A 3VQYA 4GKJH 1B6SA 1FS0G 4DR5O 5KFQA 1Y1VA 1EHIA 2WAQE 4JI0B 3K03A 4J0MA 4LF8O 3A0HZ 5KFEA 1EYZA 2PZSA 1HP8A 4E6NA 3GV7B 4KHPO 4DXWA 4LSXA 3CXHF 4DV3O 4DV4B 2PMZA 4FPPA 4FE2A 4JI3O 1EM1A 4AILC 1YHQV 4LF5O 3H1JH 3CRAA 4IT5A 4R7CA 2YS6A 4DV5H 4ED2A 5H6RA 2HHHH 2ZD9A 2FB9A 3RV3A 1R73A 1Y1WA 3APOA 1WP8A 2ZDGA 5I5TA 5KFCA 2XGPA 3JD4A 1YVWA 2FLPA 1VARA 2H94A 5LXTB 1XQ8A 4NLGA 1N33O 2HG8A 2R7ZG 4B7KA 4J11A 4FBUA 4IWYA 1UNNC 5EWEA 1HNXH 2GUZA 1B6QA 1BJTA 2R92A 1VQ4V 1YJWV 1U96A 4Q0YA 3DXRB 1R6NA 2XT9A 3CC7V 3E5NA 3MR5A 4A3DG 4H0LB 4DV0B 1KC7A 4JI3H 4MSWC 5BMVF 2HHFA 4M7EA 2CTQA 5L9XA 2CW7A 4YB8B 2OIGA 4H37A 4O4HB 1N0JA 4O2AB 1CQIB 3JRXA 4GZRB 2N05A 5L1IA 1ORQC 1S5LZ 4I55A 2JGDB 3RYFA 3K57A 1M0WA 3HO8A 4JUZA 2JA6G 4EQ5A 1SC5B 2ALZA 1HW7A 1IYEA 1M0TA 2W71A 1RSOA 4JTDB 3TCUA 1DAAA 5KFFA 3GTMA 1WPXA 5K2MA 5KHKA 1SYXB 2DQ0A 1GYFA 3TXQA 4J41A 1P4RA 1URFA 2Y4UA 5KHGA 1Q5OA 3APQA 2IJKA 5B1NA 1K4DC 4MVSA 4A3IG 4NXNB 2HVRA 4XZ3B 3GILA 3WB0A 3ZS8C 2QF7A 1NZ6A 3STZC 4DUYH 3UO2A 2YZNA 1WRVA 2YL2A 4O7RA 4AYBE 4R7RA 2WLIB 4LNUA 2XCPA 4MVMA 5FNVA 3RF2A 3M99B 5DEDA 4PDMA 3RGXA 2WPDG 3KREA 2LO1A 5TISZ 3V6JA 4JI4H 3AX6A 3OEEG 3IFXA 5C8YA 3FKIG 1VIBA 3VPBA 1XOUA 5CMUA 1V55C 5FR9A 3OTOB 1L1FA 1F4MA 5LOVF 2V4QA 2LFRA 3VBBA 3B8MA 1WA8B 2HLDG 2QK4A 5KFGA 2FPPB 3CXCU 2B63G 2XCAA 1ZSPA 4JI6H 4DUYO 1EZVH 4BBSG 5IYBO 5C8YF 3LMLA 2UU9O 3D8CA 3JASB 1VBGA 2ZNIA 5IJ0B 4O4IB 2YWVA 1S0VA 3H40A 4IYHA 4AQYB 1NVPB 5D1OA 5LP6A 3WG7B 4PZ8A 3R5HA 2W8KA 3TETA 4FU0A 3PJSK 1M9NA 3H0GA 4DL2A 1XNQH 2QJ1A 4Q4DA 4GCZA 1I94O 3L73H 1KP3A 1H2SB 4PV1B 4TSFG 3JAKB 3AG4C 4LMYA 2GDSA 3LDCA 3OUSA 4DV6O 2LFSA 1FJGO 3ZMZA 1L8DA 1ZL8B 1N36O 5HV6A 3O9OA 2Q2TA 4LF6H 2XD4A 1OCCC 3RYHB 1PV0A 1BT8A 2CNQA 4IRDA 5IYZB 3C3TA 2GTSA 1E4EB 2HJFC 3U11A 2IH1C 2YZGA 3JZ6A 5KMGA 2DABA 3NUAA 2UUBO 2DYSC 2Z3YA 3K5OA 2VWJA 3AW8A 2JA5G 1AUXA 1Z5WA 1I50A 3K58A 3C90A 5K1PA 4DV1H 2KG7B 3L72H 4DRXB 2NU7B 3WWHA 1H2MA 1NH2D 2HR3A 3K5HA 3SYPA 1X59A 1AI6A 4NXMB 2YZLA 3FKIA 3RVZA 5IE9A 1JFFB 2W6IG 1BMFG 3BVOA 4ECXA 2PUSA 4BW5A 3PN1A 3VMMA 2XTAA 5DMXA 4YR2A 3PW5A 2R70A 3MHHC 4J9RA 2DMXA 4F6EA 5BWXA 1YITV 3LSUA 5T14A 1F51A 5L3FA 1GSAA 2IM9A 4ZOLA 4MTEA 1P16A 3GIJA 2ZM6O 3HB3B 2HHHO 4O7YA 3UT5B 4M9UA 4RB2C 3TY8A 2PI4A 4YJ3B 4CBCA 3GIDA 2E5LB 3K3PA 2UU9H 4O4HF 4F50A 4J9OA 2UXXA 4K0KO 2LGQA 2HVKC 2XCLA 1YTFD 1BQ0A 5DQHA 3L4JA 3N42B 2YZMA 4DR2H 3DC5A 3NGDA 3N6XA 1L0LH 4YQWA 1WLEA 4OPHA 5IDJA 2JJ1G 1I7NA 1D5NA 4EBEA 2FMAA 1AB3A 3CYOA 4EKWA 3ZRXA 1N32B 4N21A 2HIXA 4GYCB 4FM0A 4EBCA 2W6QA 3RW0A 3WWIA 1I5XA 3LNMB 5FLMG 4P9PA 3N2KB 5E25A 4HNVA 4CS3A 5CR5A 3CD6V 1JXLA 3A0BZ 1PL0A 2XAGA 3F7YC 3RBDA 3OFNG 5D1PA 5BYBA 1T3NA 5KG4A 4F4YA 3P32A 4ZI7B 1H8HG 1JPXA 2I87A 3Q4HA 5GTIZ 2A1HA 1W0JG 3BA8A 4J7ZA 4DL3A 1QQCA 4A93G 1XDCA 1GM7A 1TWHA 2CH7A 1PL4A 3OW2U 1XL4A 5HBRB 1TWGA 4X1IB 3CS5A 3E83A 1O9GA 2UUCO 5JQGF 4GC6A 1RYSA 3H4DA 3H1KH 1GN6A 4IHJB 3THOA 2FTKA 2DW4A 1PNKA 2A7WA 2AZ0A 2AQ4A 5B5EZ 4DR7B 2ASLA 1K1QA 4J9LA 2RF4A 1FXKC 1FAFA 2UUCB 2V5AA 2QA4V 4X64H 4RZQA 5LMNB 2E2IA 1PK8A 3JD0A 1DIKA 1RJPA 3AG1C 2E5LO 2EULA 1VF6A 2OCHA 1HNZB 1J95A 1XMOH 4J9PA 1G4YB 5EBWC 3S3WA 1YJ9V 4LNUB 2HJWA 1TWCA 4RB0A 5KLVH 2WLMA 5KFSA 4G3IA 4RNNA 2IJIA 5I5WA 3RYIB 5JVDA 2R86A 1PPJH 2BTQB 4DAAA 4YIOA 2DLNA 2YXHA 1N32O 4JYCA 1U97A 3BPZA 5CA1A 5IYCO 1JLLB 1SQGA 2EJ3A 4TQRA 1OCRC 4IZOA 4FFMA 1SCUB 3NC0B 2HP8A 4PDLA 4MVQA 2X6BA 4DR6B 2CH7B 1A3GA 3GIQA 4PA3A 3PW7A 5D8DA 5F9NA 4MAMA 4X66H 1GMGA 3CC4V 4O4LF 4EG0A 4JI2H 1E4EA 2X0LA 1PP9H 4A2AA 5LMUH 1QHTA 5IYDG 2UVUA 1P7BA 2SCUB 3KHLA 3GB7C 3ZMVA 5IYCG 2BOCC 3SYCA 4DO2A 4X1YB 5EC1C 1FJGB 3WNZA 1GN2A 2OTJV 4QIWE 5KT2A 3GIIA 1F4NA 4ZIBA 1K4CC 4I9QA 4MV3A 2V4RA 2VQEB 1P49A 2BE3A 4J7JA 3J7AU 3RUPA 2FP4B 5A2QN 4X20A 5H6QA 3RGZA 1I7LA 3R5XA 1Q8IA 2D2CB 1VS0A 2JRIA 2Y0SA 2W9CB 3TY5A 4O3QA 2PN1A 4JYBA 4MA5A 1XNRB 4JI7O 4MV7A 1DV1A 3HKZE 3K9AA 4UVBA 4MV4A 4W4LA 2COIA 2IU0A 3I5DA 5EIBD 1Q6HA 1MA1A 2R8HA 2L35A 2DZDA 3NBYB 2LGWA 4JI5O 2YI8A 3BACA 2V59A 1XHZA 5DM6V 2QEXV 4ZOLB 1K8AW 2O03A 2CAZC 3ZN0A 3EXAA 5E1AC 3W7SA 5BXZA 5EZYA 2UUAO 2HG5C 4YY3H 2QR4A 3G67A 4UCOA 5KFLA 2DJVA 4C2MA 1N36B 3W1BA 5DQIA 2JJ2G 5KHIA 5IWAB 1UJWB 1FFXB 4PDBA 4RAZA 5IWAO 3ORQA 4DR3O 4X65B 3ZHUA 3RYCA 1D2DA 4XDLA 4DRFA 3AG7A 1PKXA 2EILC 1KP2A 2YIBD 4O2AF 3T99A 4ASUG 4AQYO 3OT7A 3SYAA 3CCSV 3OGIB 2M05A 4OX9O 2JGUA 3AG1B 4IL6Z 1VBHA 4Q4CA 3L71H 4FFBA 4JI5B 4LFBH 3LNNA 4GKKB 3MHSC 1SQPH 3E8BA 1ZAUA 3G6EV 3AG3B 1VQMV 1GSOA 3RBEA 5DISC 1GK9A 2JEIA 2Q7HA 1HNWB 3HKEA 4YJ3A 4Q8EA 2ARHA 3TIGA 2VUGA 2Q6AA 2COJA 2YUAA 4FLYA 2VS0A 4JYAB 5L3EA 2UXCH 3CCRV 1H2LA 4CMFA 4DW0A 2P5OA 2NUAB 4JI0H 4CE5A 3GV8B 2EIJB 1MSWD 3ABUA 4RQFA 4YHHB 3J81W 3H01A 1G8MA 4O4JF 2K1EA 4LF7O 3ETGA 4LBEC 3AG2C 3MR2A 3G6BA 2G38A 2DYRC 3OD4A 4DQNA 5LA6B 1WR2A 3U0ZA 1VAJA 3E8HA 4NXNO 3JARB 3DTGA 4IIJF 2KG7A 4DRXA 2VUMA 4C5AA 3WB1A 4O4LA 1UPGA 1KBLA 5LOVB 4GUNA 2PMZE 4PDRA 2OLSA 2Y0PA 1O75A 5IYZA 1HWYA 2M7WA 3ABLC 2P6JA 2CZGA 1RPOA 1H2KA 2ATKC 5KFBA 4ED7A 4Q20A 3VA7A 1SQBH 4W4KA 4TV9B 4U7NA 2F23A 1XMOO 3PFFA 3G6YA 3W7XA 2W9AA 2ASDA 3KKYA 5KUKA 4BIOA 4JI3B 3JAMN 1VQNV 2QWQB 5IT9N 5FPOA 4NZOA 3FB5C 5B3SC 2JEFA 4CS2A 5I5YA 2FLLA 3KG2A 2FKXA 3CRQA 4X1KA 1VQ7V 1N4CA 2F95B 2GBOA 3Q1KA 4ZI7F 4JI1H 1X9NA 3S3XA 4F4WA 4TUYB 3M9MB 3T9EA 4UFZA 4N23A 1WB8A 5ITZB 3TW7A 1SZXA 4JPRA 2I80A 3E8FA 2W9CA 5IY5B 1M93A 4MW8A 5CA0A 5KT4A 3JCZA 3GIPA 4H44B 4J80A 3ABTA 3CC2V 4LFCO 4I9WA 2R8JA 1MSDA 2ZR3A 2ZE5A 3KAJA 1SQVH 4CS4A 1CPYA 1IOWA 2PY5A 1V54B 3B09A 4O3SA 1EKVA 1IBLH 4YJ2F 5KAIZ 3F5TA 1GM9A 2KB1A 1KT8A 2E75B 3JAMW 4YR0A 2JVDA 2IBKA 4DV7B 3HPLC 3ETQA 2JA5A 1AI4A 3CCLV 5FNVF 3RJ0A 4NZNA 5L3CA 2OH2A 2ZGIA 4YHHO 2LW1A 3CEBA 1SETA 3LUTB 3ZRSA 4WBNB 5BWTA 4TQDA 3K5MA 3VQVA 2W6PA 4DL4A 3QO7A 4FFLA 1R1BA 4RWUA 4LF8B 5EZYF 3F7VC 3OTFA 3KHHA 1RK6A 4R50A 5BR8H 4JZGA 1CKOA 2A0LA 3PVXA 3TY9A 3OTOH 5KFDA 2R92G 3EYYA 4WFHA 4RUAA 5KFNA 2CW8A 2JA7G 3D3IA 4H13B 3UFXB 1SERA 2ITDC 3ZHQA 2IBZH 1N56A 2VA2A 4OX9B 1GLVA 4EEQA 2ZIOA 2W6ZA 4JI6B 1HDJA 3WWJA 3AEIA 2WAMA 3CP1A 2WTFA 1VQKV 3SR2C 4TOIA 4O4HA 3T1HO 3GTGA 1YXBA 1RPRA 3P3NA 2CUGA 3K04A 5LP6F 1OWTA 4AQYH 4DR3B 3UQ8A 2X0SA 5H2FZ 2FL4A 2HHFB 4L8JA 4O84A 3BQ0A 3LP8A 1VEWA 4FIPC 1N34O 5C44G 4DR4O 3WU2Z 1CP9A 4RU9A 4OGQB 1NH2B 4QWEA 4LH6A 5CM0A 4QGPA 4D7TA 2KQXA 1EN4A 1IBKH 2UVRA 4O7SA 3SI8A 3OGCC 4YY3O 2HVQA 5LHGA 4ECQA 2CDYA 2R7KA 1K34A 2OCCB 3BCCH 4B3TO 5CA0B 3QF7A 2D3OW 1EKFA 1XNRO 5CB4F 4FLXA 4LF9H 3SJBC 4CH4A 1DLBA 1P84F 1NTMH 1Y14B 4C5BA 2NR5A 3ZHTA 1IVSA 2JS3A 2Q8VA 2XC9A 3RB0A 3HOYG 3A0RA 1LNQA 4X62B 1SF9A 3E2EA 4ZOLF 4QWCA 1TUBA 2WAQA 2WLLA 5B1BB 2F4VH 1RP3B 2W7OA 3N2KA 4CH3A 4O4JA 4NYEA 3IN5A 4I4TF 2W9BA 3H1LH 4JI6O 3LWBA 4O83A 3TQTA 2WLNA 3VQXA 3KZIZ 2YW2A 1WCMA 3T54A 4HN2A 3PW0A 5KKNB 4DR6O 3SGIA 1FXKB 3FYEB 4GLXA 1FPOA 2BQRA 1J5EO 1K92A 5KG2A 4A3EG 3HOXG 4U6PA 2DPIA 5KFHA 5H80A 4BW9A 1EZ1A 1KTAA 5KAFZ 2A79B 2LQTA 5LXTA 1NQTA 1YIJV 2QWRB 2AGQA 2QKAA 3QNEA 3BRCA 5KFJA 2AGOA 2ZQMA 2QM7A 3X2QC 2P06A 4X8AA 1N48A 2NLJC 1IBMH 2BQUA 5FLXN 2C2AA 1AN7A 1BSMA 5I5SA 4KUMA 4UCVA 2EJ0A 1CKNA 4DV7O 4JASA 5H9CA 3E8GA 1P7GA 2ZDIC 5LMNO 1BGWA 5KG6A 3RGBA 4J9NA 1OCOB 1BHAA 1WJZA 4FS1A 3N2GB 1FFTB 3MJFA 3CX5F 3ABMC 1RJQA 3KYHC 5IT9W 5KX5A 1VF6C 3BHPA 1R3IC 4UVCA 1M7JA 2H3OA 4FFBB 3K08A 4X89A 4BY1G 5KFAA 1ZHSA 3JAKA 1OCZB 3FB8C 3I56V 5CN0A 1KB9F 3CRRA 2UUCH 3S24A 3GTQA 2RCVA 5B1OA 1IXMA 5CE8A 1PNMA 5JQGB 1JJ2U 2WLJA 4G28B 3GDEA 5CBHA 4TV8F 3GB8B 4AYBA 2YI9A 2IP4A 2JA8G 3K0DA 1S5JA 4YJ2A 4BBRG 1I6UA 4LC1A 2Q67A 4XBFA 4IHJF 2Q0AA 2PYJA 1N33H 4LH7A 4P9OA 4IAJA 2EILB 4TV8A 1H38A 4FFOA 4F4ZA 1SQFA 3SJCC 2QTOA 4EFBA 3NXSA 1AR5A 4FZ0A 3ZIAG
chains in the Genus database with same CATH topology
2UUCB 1SA0A 5FD6A 4JV5B 4X64H 5KHJA 4RZQA 5LMNB 4DR6H 2HEPA 2VQFH 4IIJB 4X66B 4IHJA 3W5OA 3MAQA 3MWMA 4B3RH 4JI2B 1I7FA 4LF5B 1HNZB 2UXBH 5LMUB 1XMOH 4LNUB 4DV3B 4RB0A 3RWRD 3QTCA 3B2EE 4ZI7A 1WN7A 4KHPB 5FLXW 1WNSA 3RYIB 5JVDA 2KKWA 1SEIA 3QG5A 4DR5H 1D5AA 5JQGA 4DK0A 2BTQB 2FE3A 1HR0B 3JSNA 3VQWA 4DV2H 4U3JA 4DR7H 2VQEH 1FFXA 3BPZA 1I94H 5CA1A 2WE6A 1L2ZA 4CH6A 1SQGA 1O9HA 3ICXA 4BWAA 3NC0B 4X64B 1J5EB 4JV5H 5LMNH 4DR6B 4ETSA 5LYJB 4X66H 2UXDB 2CFMA 4B3RB 4JI2H 1HNZH 3CB2A 1E4FT 4DUZH 4LFAB 2XHBA 2PGGA 1QHTA 4A2AA 5LMUH 5BMVA 1Z2OX 1Z2NX 2UUBH 4LF7B 2HGSA 4X1YB 5JJNB 5D5PA 1FJGB 5LL6b 4LF4B 4HBNA 3RYFB 4ZIBA 3C0FB 4I9QA 4FLUA 3N40P 2RGRA 3BABA 4I50B 2VQEB 1P49A 1I94B 1M5IA 1N36H 2Q7EA 4DV6H 3RTXA 1X4TA 4O4IA 4X20A 3U10A 4LSAA 3RGZA 5CB4A 1J5EH 4PI0A 5J2UA 1Q8IA 4X65H 1VS0A 3TY5A 4X1YA 4CC6A 1XNRB 2VPSA 4UCRA 4I4TB 2WYOA 3DF7A 4MV7A 2UXDH 2V4DA 4DUZB 5EIBD 4LFAH 5ITZA 2YIBA 3K5NA 3NBYB 1B04A 2UUBB 2YI8A 5FPRA 5C8YB 4JI5H 3IG0A 2RQ6A 1XHZA 5LOVA 2O03A 4ZOLB 4LF7H 4DR1H 4LFBB 2CAZC 3JSLA 2OWOA 2YIAA 4O4JB 1FJGH 4I55B 5EZYA 1XMQH 4LF4H 4YY3H 4B3MB 4UCOA 4JI7H 4O2AA 1N36B 3W1BA 5EYPA 5KHIA 5IWAB 4DV6B 2WDTA 3M4IA 1FFXB 4PDBA 4RAZA 4JYAH 4X65B 2ZINA 3RYCA 1XK5A 4F6RA 3CSXA 5KHHA 1XNRH 3HKDB 5D1OB 3E22B 4DRFA 5J2TA 1TGOA 3FFQA 2YIBD 2UUAB 4HNAA 2HIVA 3W1GA 4YHHH 3IAYA 1JFFA 1Z5VA 4CH5A 2JGUA 4PZ7A 5BMVB 4FFBA 4B3TB 4JI5B 4DR1B 4LFBH 3LNNA 4GKKB 4YJ2B 1XMQB 4O4LB 1ZAUA 3HKCB 4YY3B 4JI7B 4B3MH 1MZBA 3RR5A 1SA0B 5DISC 5JH7A 5A2QW 2Q7HA 1TUBB 5J2UB 5D5QA 1HNWB 5IWAH 3HKEA 1E4GT 4YJ3A 4FLWA 2R9AA 4EB6B 2VUGA 5FNVB 4FLYA 2ZJTA 3K3VA 3J7AK 5J2TB 1WPBA 4JYAB 3HKBA 2UXCH 4DR4B 2P5OA 4JI0H 2UUAH 1S03G 4YHHB 2KSWA 3J81W 3WB2A 4MV9A 2OYQA 5JCOC 5JJEB 3T1HB 4PZ6A 4JI8B 3J80W 5EZYB 4B3TH 5LA6B 4GKKH 3RFRA 2P22C 5JH7B 1NT2B 3U0ZA 4A2BA 5LP6C 3JARB 3HKEB 4D7SA 4BWSC 4DRXA 5K1XA 3WB1A 4O4LA 4EB6A 4LFCB 1HNWH 3JALA 4JI1B 3HXLA 5LYJA 1KU9A 4KL1A 5LOVB 4EFEA 1ZHQA 3VQYA 4GKJH 4K8XA 4HNAB 5IJ9B 1O75A 2UXCB 5IYZA 1CKMA 3HKCA 4DR4H 4FM9A 4JI0B 4F6RB 4FLVA 4J0MA 2ZCEA 1XDNA 4MTDA 3E22A 4TV9B 2PZSA 4E6NA 1TVKB 3M7MX 3T1HH 4JI8H 4LSXA 4DV4B 1IBLB 3VNNA 4I50A 4JI3B 4AILC 4DV7H 5FPOA 5GONB 4DV5H 4CS2A 1SKVA 1A0IA 2HHHH 4X1KA 2VOBA 4LFCH 2F95B 4JI1H 3JATB 1X9NA 4TUYB 5LXTB 1XQ8A 2ZIMA 4UFZA 4GKJB 4B3SH 5ITZB 5EOYA 3JARA 1DGSA 2F1MA 1M93A 1HNXH 5CA0A 5IJ0A 1WH2A 4I4TA 1BJTA 5LA6A 4AHCA 4Q0YA 3N2GA 3A2FA 4K8ZA 5BR8B 3JATA 3KAJA 4CS4A 3K59A 1Q43A 2PY5A 3F8NA 4DV4H 1IBLH 4DV0B 3JAMW 4JI3H 2JVDA 1CKNB 3L4KA 4DV7B 4DV5B 4M7EA 3ETQA 3N41B 2Q7GA 3L2PA 3RJ0A 2CW7A 2HHHB 4OX9H 1JJOA 4O4HB 4K0KH 4O2AB 3CHXA 1XHXA 4WBNB 4TQDA 3K5MA 3VQVA 4I55A 4B3SB 2ZM6H 2E3CA 3RYFA 3K57A 1M0WA 1M4UA 4TV9A 4EQ5A 4LF8B 1HW7A 1M0TA 1RSOA 2W57A 1HNXB 3OTFA 4APMA 4TQFA 5KHKA 4JI4B 3T1YH 1SYXB 1GYFA 5BR8H 1CKOA 5KHGA 2EX3A 2Q2UA 3JAWA 3TY9A 3OTOH 1Q5OA 3EYYA 4DV0H 3K5LA 2CW8A 3NBZB 1IBKB 3RIZA 4TV8B 4O2BB 4NXNB 2HVRA 3WB0A 5FD5A 3ZS8C 1VF7A 4CC5A 4OX9B 4EEQA 2ZIOA 4JI6B 1FVIA 4DUYH 4K0KB 2R72A 2PYLA 1S68A 3SR2C 4TOIA 2BTQA 4R7RA 4X1IA 4O4HA 2YXLA 4TUYA 4LNUA 4DK1A 2ZM6B 4LF9B 5FNVA 4AQYH 3RYCB 3UQ8A 4DR3B 3RF2A 4LF8H 4L8JA 3RGXA 5EYPB 1XNQB 5EIBC 4JI4H 2JS5A 3T1YB 4FLZA 4X62H 3KAKA 5C8YA 1N34H 3OTOB 2QM4A 4LH6A 1KMIZ 4D7TA 4FLTA 1IBKH 4UCTA 5JJJB 2PTMA 2HVQA 4NXNH 2ZNJA 4DUYB 4JI6H 3LMLA 3JASB 2ZNIA 5CA0B 5IJ0B 4O4IB 3QF7A 1V9PA 4LR3A 4FLXA 4LF9H 4U3JB 3SJBC 5KMGB 4WBNA 4CH4A 4AQYB 5D1OA 4DR3H 5LP6A 3RYHA 4PZ8A 4NXMH 3JAWB 3FMAA 1XNQH 2QJ1A 2XIGA 4X62B 1H2SB 4B08A 1N34B 1Q3EA 3JAKB 1TVKA 1TUBA 5JCOA 4LMYA 2F4VH 1L8DA 1G6UA 3N2KA 4CH3A 4FM1A 4LF6H 2Q2TA 4O4JA 3RYHB 4UCUA 1T5EA 5IYZB 1JMKC 1IBMB 2VWKA 2RGVA 3U11A 5KMGA 3VQXA 2UU9B 3K5OA 2VWJA 1Z5WA 3JASA 3K58A 4DV1H 5K1PA 4DRXB 2HVSA 3SGIA 4GLXA 4ZHQB 4NXMB 2BTOA 5CB4B 4BW9A 3KXYT 1JFFB 4PHZA 2PUSA 5LXTA 3PN1A 3N43B 3HKDA 4X20B 2YCHA 3QWUA 2F4VB 3BRCA 2RJZA 2R70A 4LF6B 5GONA 1P8LA 2IM9A 4ZOLA 4RAYA 1IBMH 4MTEA 1P16A 3UT5B 4RB2C 1TAEA 4Q6GA 3TY8A 1AN7A 4YJ3B 2UU9H 2E5LB 3ZEDA 1XI1A 4UCVA 1CKNA 5IJ9A 5KX5B 4DV1B 3L4JA 3N42B 1BGWA 3RGBA 4DR2H 4UCSA 5LP6B 2F66C 2F93B 3N6XA 4RB1A 3N2GB 5CA1B 4I7HA 4X1KB 4O2BA 3KYHC 1N32B 2HIXA 5IT9W 1TA8A 4GYCB 5KX5A 3BHPA 4FM0A 3DSQA 1N33B 3N2KB 1Z2PX 4CS3A 5JVDB 4FFBB 3BA9A 3RYIA 3UT5A 1ZHSA 5D1PA 3JAKA 4FVMA 3GJXB 3JALB 3KALA 2UUCH 3S24A 2E5LH 4ZI7B 3N44B 3CVZA 2VQFB 3BA8A 5JQGB 4DR2B 1QQCA 4RB3C 3GDEA 3H20A 4LF5H 2UXBB 4PI2A 2YI9A 4IIJA 3GB8B 2MCTA 2GV9A 1XMOB 3HKBB 4X1IB 3BAAA 4DV3H 1O9GA 3SJAC 4KHPH 1S5JA 4YJ2A 1I6UA 4DR5B 1N32H 4IHJB 2Q0AA 4ZHQA 3THOA 2PYJA 4LH7A 4NVPA 1N33H 4IAJA 1HR0H 4TV8A 1YEWA 4DV2B 1SQFA 3SJCC 4EFBA 4FM2A 4DR7B 1FKAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRF A;  2UUC B;  4UCU A;  2UUA B;  2HIV A;  4JV5 B;  3W1G A;  5LMN B;  1IBM B;  4DV0 B;  1CKN B;  4PZ7 A;  4X66 B;  4DV7 B;  3W5O A;  4DV5 B;  4B3T B;  4JI5 B;  2UU9 B;  4JI2 B;  4LF5 B;  1HNZ B;  3L2P A;  4DR1 B;  2HHH B;  5LMU B;  4GKK B;  2HVS A;  3SGI A;  4GLX A;  1XMQ B;  4DV3 B;  1ZAU A;  4YY3 B;  4JI7 B;  4NXM B;  4KHP B;  3RR5 A;  4B3S B;  5DIS C;  1HNW B;  4EQ5 A;  4LF8 B;  3PN1 A;  1HR0 B;  2VUG A;  1HNX B;  3JSN A;  4JYA B;  3QWU A;  2F4V B;  4JI4 B;  4LF6 B;  4DR4 B;  2Q2T A;  1CKO A;  2Q2U A;  3TY9 A;  3NC0 B;  4X64 B;  1J5E B;  4YHH B;  1P8L A;  4DR6 B;  1P16 A;  3NBZ B;  1IBK B;  4PZ6 A;  3T1H B;  2UXD B;  2CFM A;  1TAE A;  4JI8 B;  4B3R B;  3TY8 A;  4NXN B;  2HVR A;  2E5L B;  4UCV A;  1CKN A;  4CC5 A;  4LFA B;  4OX9 B;  4EEQ A;  4DV1 B;  4JI6 B;  1FVI A;  4K0K B;  1S68 A;  4TOI A;  4UCS A;  4LF7 B;  2ZM6 B;  4LF9 B;  4LFC B;  4JI1 B;  4DR3 B;  3UQ8 A;  1FJG B;  4LF4 B;  4EFE A;  1XNQ B;  3BAB A;  2VQE B;  1I94 B;  1N32 B;  3T1Y B;  2UXC B;  1TA8 A;  1CKM A;  2HIX A;  3KYH C;  1N33 B;  3RTX A;  4JI0 B;  3OTO B;  1XDN A;  3BA9 A;  4LH6 A;  1VS0 A;  5D1P A;  3TY5 A;  4UCT A;  3GJX B;  4E6N A;  4CC6 A;  1XNR B;  4UCR A;  2HVQ A;  3S24 A;  4DV4 B;  1IBL B;  4DUZ B;  3VNN A;  4DUY B;  4JI3 B;  2VQF B;  3BA8 A;  3NBY B;  5FPO A;  1B04 A;  4DR2 B;  2UUB B;  5FPR A;  3GDE A;  1V9P A;  1A0I A;  2UXB B;  3GB8 B;  4LFB B;  3JSL A;  1XMO B;  2OWO A;  4AQY B;  5D1O A;  1X9N A;  3BAA A;  4PZ8 A;  4B3M B;  4UCO A;  4UFZ A;  4GKJ B;  1N36 B;  3W1B A;  4DR5 B;  5IWA B;  4X62 B;  4DV6 B;  4LH7 A;  1N34 B;  1DGS A;  4DV2 B;  4X65 B;  4EFB A;  4DR7 B;  1XK5 A;  5BR8 B;  5D1O B; 
#chains in the Genus database with same CATH topology
 2QWP B;  2R9R B;  3WFV A;  2NU8 B;  2W8L A;  3GTK A;  5DGH A;  4JV5 B;  3QVN A;  1OBD A;  4DR6 H;  2J9G A;  2M6Y A;  2VQF H;  4X66 B;  3W5O A;  3MAQ A;  3MWM A;  4B3R H;  1W59 A;  2UVW A;  4DR2 O;  1KC8 W;  3AYH B;  1I7F A;  3EVK A;  4LF5 B;  2UXB H;  2Q5Z A;  4J9Q A;  4DV3 B;  2EZO A;  1LUW A;  5DGA A;  1Y66 A;  4NZM A;  1WN7 A;  2ODT X;  4K35 A;  4DIM A;  5FLX W;  3SPJ A;  4JV1 A;  2KKW A;  1SEI A;  3QG5 A;  5GTH Z;  4DR5 H;  2EZP A;  4RQE A;  5KT7 A;  2CTP A;  4WFF A;  4JYA O;  1ZTE A;  1HR0 B;  3IC9 A;  3JSN A;  4FZ1 A;  4DV2 H;  4MTO A;  3ZCC A;  2AHZ A;  3FYI B;  2VQE H;  1FFX A;  1HNW O;  1L2Z A;  4CH6 A;  4MW3 A;  4FBT A;  3E35 A;  4QE7 A;  1TUE B;  4WD3 A;  2A06 H;  1SRY A;  4BWA A;  4TUY F;  1Y76 A;  4I55 F;  1XMQ O;  4GKK O;  3Q8P B;  2EBO A;  3TXS A;  4Z2W A;  2C22 A;  2FPI B;  4MV6 A;  1WA8 A;  4KFM A;  5GON F;  4JV0 A;  2Y69 B;  4UB8 Z;  2MW2 B;  5HFM A;  3H1H H;  4GX1 A;  4OPA A;  5CA1 F;  3EPI A;  1Z2N X;  3MDS A;  4Z1V A;  1BE3 H;  1K33 A;  4JI8 O;  4CHI A;  3ZMT A;  1F23 A;  2UUB H;  4LF7 B;  2N74 A;  1BZK A;  2C2D A;  1RSO B;  3BG5 A;  4O7V A;  4ZQI A;  3PW4 A;  2QE7 G;  4ED8 A;  4FFP A;  5LL6 b;  4GC7 A;  5JVD F;  4HBN A;  3RYF B;  3F5W C;  2PVP A;  3N40 P;  1YI2 V;  2RGR A;  4I50 B;  1AJN A;  1N36 H;  2E76 B;  1I94 B;  1M5I A;  4A3M G;  2ZE8 A;  4DV6 H;  1X4T A;  5DG7 A;  5DGB A;  4LSA A;  4LP8 A;  5LGU A;  5CB4 A;  3OUU A;  2ZE7 A;  1GH6 A;  5J2U A;  5FJ8 G;  2DQ3 A;  4JTC B;  2FK1 A;  4X1Y A;  4CC6 A;  3DF7 A;  2VPS A;  2UXD H;  1GM8 A;  4I4T B;  1Y67 A;  3CCV V;  4ECR A;  2ZT9 B;  2V4D A;  1VQP V;  1QU7 A;  3R5F A;  1I5Y A;  4DUZ B;  1DTO A;  4G2K A;  1K83 A;  4HAM A;  3K5N A;  1B33 N;  1B04 A;  1Q6I A;  3WO1 A;  3MFI A;  2P4V A;  4PDV A;  3IG0 A;  1BCC H;  4DR1 H;  4LFB B;  3JSL A;  4ZHQ F;  2Y0S E;  2GPS A;  3P3P A;  4LF4 H;  1M57 B;  4IWX A;  2EIN B;  2NNU A;  4JAU A;  3SE7 A;  5EYP A;  2R7Z A;  4YXW G;  3R9R A;  1WAZ A;  3M4I A;  4NYK A;  1GTO A;  2UVV A;  3FB7 C;  1XK5 A;  1GN3 A;  4XDK A;  3E22 B;  4U7O A;  5LGT A;  4Q8F A;  3FFQ A;  3QQM A;  2AHY A;  5I5X A;  2UUA B;  3UCS C;  4YHH H;  4R8U B;  3V4Z A;  1JFF A;  2BOB C;  4UUG A;  2WLH A;  4CKB A;  4PZ7 A;  1NU1 H;  1QR9 A;  1NKD A;  3ABK B;  1PD3 A;  2YXY A;  5CBG A;  4ECV A;  5EDW A;  1XMQ B;  2IA6 A;  5KS8 A;  3ZMU A;  4EGQ A;  4JI7 B;  4B3M H;  1MZB A;  3ETE A;  5JH7 A;  1AJQ A;  1BXR A;  5J2U B;  4Q45 A;  5EWF A;  4O7N A;  3IJ4 A;  4EB6 B;  5KFU A;  1YCI A;  5FNV B;  1VQ6 V;  2Y0I A;  1OZ0 A;  3HKB A;  3ABK C;  1V51 A;  3T5L A;  1K73 W;  5LHH A;  5IYD O;  4KXR A;  3WB2 A;  3CCQ V;  4MV9 A;  4J9M A;  4O3N A;  5JCO C;  5JJE B;  4PZ6 A;  3BJY A;  2FML A;  2FYU H;  5EZY B;  3VOT A;  3UO3 A;  4B3T H;  5EWG A;  2XAJ A;  2DWE C;  1EKP A;  3OE7 G;  2MK3 A;  4DV0 O;  4ME6 A;  3JCU Z;  1SS3 A;  1F7Y A;  5LGN A;  4A2B A;  4JV5 O;  4WCE V;  1VKZ A;  2CNV A;  1Q6U A;  3DTU B;  4B3R O;  3HKE B;  4D7S A;  5KG3 A;  1R3K C;  3T1C A;  1IBK O;  1KJ8 A;  4YIP A;  4JI1 B;  3HXL A;  1KU9 A;  2R8K A;  1IX9 A;  1SES A;  2EIN C;  3TGU H;  4BAY A;  4QWA A;  2P67 A;  5KFZ A;  4HNA B;  1R3J C;  1IUR A;  5IJ9 B;  4A3L G;  2FKL A;  2R8I A;  4DR4 H;  2QDO A;  1HNX O;  1VQO V;  3BQ2 A;  3KCX A;  4F6R B;  4FLV A;  3VPC A;  2C2R A;  2R85 A;  2COG A;  4QW9 A;  1KUQ A;  1GAX A;  1TVK B;  3T1H H;  3SPI A;  5KA5 A;  4ECS A;  1IBL B;  2JK5 C;  4I50 A;  3HT5 A;  2WLI A;  3R65 A;  5GON B;  4MV8 A;  5KFK A;  1PM9 A;  2FB5 A;  4C5C A;  4GX5 A;  3V6K A;  2QGN A;  4JGS A;  3JAT B;  3X2Q B;  3JRW A;  1AI7 A;  5BPF A;  5KA6 A;  5BR8 O;  1B3Q A;  2ZIM A;  3M8A A;  2DWD C;  4O81 A;  3H0G G;  3L74 H;  3RFC A;  4ED0 A;  5EOY A;  3JAR A;  1UFI A;  1DK1 A;  1DGS A;  4O7Z A;  1YSC A;  5IJ0 A;  3UZB A;  3N27 A;  2B1I A;  5LA6 A;  4AHC A;  3N2G A;  4GKJ O;  4O86 A;  5BR8 B;  3JAT A;  2R8G A;  3ZHV A;  1XRE A;  2ASJ A;  1TWA A;  2HVJ C;  1Q43 A;  3F8N A;  4DV4 H;  2HKO A;  3HKZ A;  5I5U A;  3ASO C;  2PF4 E;  1EUC B;  2Q68 A;  1VMG A;  4JAV A;  1GN4 A;  1JIH A;  2JEG A;  3N41 B;  2IMW P;  4GX2 A;  3GWO A;  2HHH B;  4OX9 H;  5LXT F;  1JJO A;  4IR9 A;  1VQ9 V;  3NR7 A;  3JD1 A;  1IBL O;  3CHX A;  1QVF U;  2W6N A;  3JYC A;  2CGN A;  2CNU A;  3ZHS A;  5CA3 A;  4B3S B;  4PWQ A;  2VR1 A;  2HGW A;  4TV9 A;  3ZHR A;  4PD4 F;  5C1P A;  3ASN B;  3D36 A;  3FX7 A;  2A9H A;  3ZMS A;  4GLW A;  2FLN A;  1NVP D;  4APM A;  4JI4 B;  4J9Z B;  1MOF A;  5KFV A;  4B7E A;  2EX3 A;  2Q2U A;  4DL7 A;  3EFF K;  4DV0 H;  3K5L A;  3UYY A;  3NBZ B;  1IBK B;  1N0N A;  3LSQ A;  5KFO A;  4TV8 B;  4O2B B;  1GKF A;  3GLK A;  5KFR A;  4DL5 A;  2PI5 A;  3ZBH A;  4J10 A;  4K0K B;  2PYL A;  4EEY A;  2W0X A;  2FJZ A;  2C00 A;  4QNH B;  5KG0 A;  2BTQ A;  4H33 A;  2YXL A;  4TUY A;  1EZJ A;  4DK1 A;  2ZM6 B;  4LF9 B;  2WB1 E;  2AGP A;  5BZB A;  1ZWI C;  1OHH G;  1A9X A;  1JCH A;  4RUF A;  4NB5 A;  1XNQ B;  5EIB C;  2ADQ B;  2JS5 A;  3T1Y B;  2F4V O;  4RZR A;  4HYK A;  4X62 H;  3KAK A;  1EFR G;  4O7T A;  3MFH A;  4UV9 A;  4J9K A;  4FLT A;  1SFO A;  3H4B A;  4UCT A;  5JJJ B;  2HJD A;  2PTM A;  2P0A A;  4O3O A;  4NXN H;  3DTF A;  4QSH A;  2ZNJ A;  2Y69 C;  1I1K A;  3QO8 A;  1G1X B;  2XGQ A;  1H2G A;  4A5U B;  2XAQ A;  2XND G;  2GUZ B;  1V9P A;  2AU0 A;  3SPC A;  5KMG B;  1M1K W;  3ABM B;  1DF5 A;  1JKJ B;  1K7D A;  1DF4 A;  5CAE B;  4R8C A;  4NXM H;  1JDB B;  5KFM A;  4TVI A;  3PO3 G;  3FMA A;  2AW9 A;  3KHR A;  5IP7 G;  3G8D A;  4B08 A;  5DQG A;  1N34 B;  1Q3E A;  2BSK B;  2JEJ A;  1AVM A;  3MWD A;  5LHI A;  5JCO A;  1AI5 A;  1ARO P;  2ZDI A;  4A3J G;  3PZP A;  3I4N G;  4J9S A;  2R7N A;  2KSD A;  1Y1W G;  1JQ0 A;  4UCU A;  1JMK C;  3Q8R B;  3GIM A;  2VWK A;  2XOK G;  4IGG A;  4ECY A;  2ZDQ A;  2UU9 B;  2YRX A;  4QWD A;  1M56 B;  4IR1 A;  2CTW A;  3JAS A;  2ILM A;  4DUZ O;  2HVS A;  3HR0 A;  4C7U A;  1MAB G;  1ZUQ A;  1QVG U;  4MVO A;  1Y76 B;  4ED6 A;  2BTO A;  3AK2 A;  1IYD A;  5CB4 B;  4QE9 A;  2ZKO A;  3ORR A;  3KXY T;  2W7P A;  5BYA A;  2HFE C;  4PHZ A;  4XDJ A;  1MZF A;  4O82 A;  3OTO O;  3MWE A;  4QJF A;  3AG3 C;  5L3G A;  1KYO F;  1GSH A;  4LWS A;  2NVX A;  4X20 B;  3SNO A;  4A3F G;  3K0G A;  5KG1 A;  2IJH A;  2RJZ A;  1NJI W;  4Q43 A;  3ETJ A;  3T4Z A;  3GV5 B;  3P30 A;  2R82 A;  2OTL V;  4FFR A;  2CE4 A;  4RAY A;  3TEK A;  5DLF A;  4WFE A;  1R6T A;  4PA7 A;  1TAE A;  3H3V H;  4UXN A;  1W2B U;  1XI1 A;  4ECZ A;  4EYH B;  2E74 B;  5IJ9 A;  2Z0A A;  5KX5 B;  2B5U A;  4UCS A;  4O3P A;  1A48 A;  2F66 C;  3T5H A;  1Q90 D;  3WO0 A;  1VQ8 V;  3DAA A;  4X1K B;  4O2B A;  2V58 A;  2ZXW C;  3PO2 G;  1TA8 A;  2GQS A;  1N33 B;  1JDE A;  1Y6X A;  3QO5 A;  1RM1 B;  3CJH B;  1Z2P X;  3FAV B;  1EN5 A;  1T36 A;  4Y8V B;  3BA9 A;  3STL C;  1Z2G A;  4O7W A;  3GJX B;  3JAL B;  2UXB O;  3LDD A;  5B66 Z;  3CVZ A;  2VQF O;  1N8R W;  2V1D A;  2VA3 A;  4JI2 O;  3RN4 A;  1K5Q A;  4X66 O;  1NR1 A;  2UXB B;  3TIN A;  2MCT A;  1XMO B;  4MV1 A;  3HOV G;  4UUJ C;  5FL7 G;  1DV2 A;  3OSP A;  4ZKI A;  2W0F C;  4PA6 A;  2EIM B;  3W7T A;  4DR5 B;  1N32 H;  5J2T F;  4ZHQ A;  4NVP A;  3UM7 A;  3HBL A;  2X7R B;  2CKZ B;  3GVM A;  4FM2 A;  4BR6 A;  1Y1V G;  5K3W A;  2W6O A;  3CPW U;  1KQS U;  3K06 A;  3GTP A;  1W96 A;  2Q7D A;  1SA0 A;  3CE2 A;  2JGD A;  3G80 A;  3W7W A;  4A3G G;  4HZ3 A;  3EPG A;  3RB6 A;  2W6J G;  2HDK A;  2IJJ A;  3FKS G;  3JD3 A;  4JI2 B;  3OMN B;  3CSW A;  5JH7 F;  3GIK A;  4X88 A;  5EK0 A;  5LMU B;  3G8C A;  3JZI A;  4DV4 O;  2DAA A;  4NTY A;  3B2E E;  4ZI7 A;  3T9A A;  4HNT A;  4KHP B;  3T9D A;  1WNS A;  2BSK A;  1RJR A;  3K3W A;  1D5A A;  1FD9 A;  3OMA B;  4DK0 A;  5JQG A;  1S0N A;  1VQ5 V;  3R66 A;  1IXB A;  5F2V O;  4ED3 A;  4XYM B;  4U3J A;  3RB3 A;  1I94 H;  3L70 H;  2ZR2 A;  2ABJ A;  2Q69 A;  4MVU A;  3GTO A;  1YJN V;  2VUM G;  3ICX A;  4X64 B;  5LMN H;  3KHG A;  4ETS A;  1XUQ A;  4JYY A;  5LYJ B;  1QNM A;  4CKC A;  4DR1 O;  5BWU A;  4ECT A;  2CFM A;  1KEE A;  1V4Y A;  3CB2 A;  3DC6 A;  2XHB A;  2PGG A;  4PBC A;  1Z2O X;  5KFW A;  5KFY A;  3PR5 B;  3BEH A;  1K3E A;  1QLE C;  4RO2 A;  2QWO B;  2GLT A;  1WP7 A;  1AP6 A;  1E79 G;  5D5P A;  1TWF A;  1GRJ A;  2QB5 A;  2XAS A;  5LL6 Y;  3C0F B;  1XEQ A;  3BAB A;  5KT5 A;  2VQD A;  2Q7E A;  3RTX A;  4O4I A;  3U10 A;  1J5E H;  4PI0 A;  1JX9 A;  3J81 N;  4X65 H;  1QLE B;  2YC0 A;  1COW G;  1CEZ A;  3BFR A;  4P30 A;  4RCN A;  2BR0 A;  2R6F A;  5IYZ F;  1AIL A;  1EUD B;  1I0H A;  4NTX A;  3GWK C;  1UC8 A;  3OR6 C;  4LFA H;  4NR1 A;  3U0G A;  4I7Z B;  1JA8 A;  5FPR A;  5C8Y B;  4JI5 H;  2C2E A;  5LOV A;  4J7K A;  1Y74 A;  3T4D A;  4O4J B;  1XMQ H;  1RK5 A;  4QPK A;  3CCU V;  4B3M B;  4JI7 H;  2NVY A;  3JD2 A;  4IRC A;  2VQE O;  3ZN1 A;  1V54 C;  1ZQ7 A;  2F43 G;  4NKG B;  4JYA H;  1K5S A;  4ICG A;  3CSX A;  4LCU C;  3UZO A;  4LF9 O;  1XIL A;  1XNR H;  3HKD B;  4B3M O;  5J2T A;  1TGO A;  4FMT A;  2CTR A;  4JAA A;  2NN4 A;  1US6 A;  2Z02 A;  3CCE V;  1BNC A;  2Q73 A;  2ITC C;  3T2M A;  4LFA O;  3T9C A;  2EJ2 A;  4QW8 A;  2EIJ C;  2ZE6 A;  1S76 D;  3U54 A;  2WLK A;  4RUC A;  4YJ2 B;  2LP7 A;  3HKC B;  4YY3 B;  4U3F H;  3RR5 A;  4WBN F;  2XAH A;  5A9G A;  1I08 A;  5L3B A;  4FLW A;  3HOW G;  2I8C A;  1AP5 A;  5B1B C;  3K3V A;  3J7A K;  5J2T B;  1WPB A;  4Z1M G;  3T1Y O;  1R9T A;  3VPD A;  2Y4R A;  5IYB G;  2CQY A;  4DR4 B;  2DYS B;  3K5I A;  5EC2 C;  3H9V A;  1S03 G;  2YIC A;  3RV4 A;  2X6A A;  3ABL B;  2OYQ A;  5B3S B;  5LYJ F;  3OMI B;  4ZBM A;  4ABM A;  1I3Q A;  2J6S A;  4DV5 O;  3H1I H;  2QKC A;  5KUM A;  2QYZ A;  2N04 A;  3RFR A;  2EIK C;  2IU3 A;  2OCC C;  5JH7 B;  1NT2 B;  1Q86 W;  1OCO C;  1Y74 B;  2R7L A;  5CBF A;  3FAV A;  5LP6 C;  3LQS A;  3GTJ A;  4BWS C;  3L75 H;  5K1X A;  3Q8Q B;  1KEC A;  4MTF A;  3QZ7 A;  2EIK B;  4DL6 A;  2ATL A;  2DYR B;  1ZHQ A;  1QCE A;  2ZXW B;  3AG2 B;  4TQS A;  4K8X A;  5I5V A;  3EHB B;  2UXC B;  5B1A B;  1CKM A;  4K6N A;  3HKC A;  1KJJ A;  3LUL A;  2J6U A;  4FM9 A;  4EYI B;  4X9Q A;  3Q2O A;  2ZCE A;  1XDN A;  1Q81 W;  5BPH A;  2VRZ A;  2LW7 A;  1JOY A;  3E22 A;  4HYO A;  4HQ6 A;  4Q44 A;  4MTD A;  5L1K A;  4CZZ A;  3M7M X;  4JI8 H;  2RDJ A;  1B06 A;  2QWN B;  1FXH A;  4ED1 A;  2P4K A;  3VNN A;  4E4E A;  2R7M A;  2VPQ A;  4R6Z A;  2OIE A;  1NS1 A;  3T7A A;  4DV7 H;  2OT5 A;  3T5J A;  1SKV A;  1A0I A;  4D6T H;  2VOB A;  3SYQ A;  4LFC H;  2Q4P A;  4PEL A;  4DLK A;  4DYL A;  3BY6 A;  4O3R A;  4E2L A;  1VQL V;  4GKJ B;  2K9P A;  4B3S H;  3M9N B;  1PNL A;  3CWB H;  1AUV A;  4DV2 O;  4K3A A;  1CQJ B;  5L3D A;  5KX5 F;  5KFI A;  2F1M A;  2EIY A;  2Z5U A;  1WH2 A;  1MMM A;  4I4T A;  4YBZ B;  1SQQ H;  3FB6 C;  1W0K G;  3J80 N;  2EJR A;  3A2F A;  4K8Z A;  1KJI A;  1ZX3 A;  3RVY A;  1IOV A;  2BCC H;  1ULZ A;  3K59 A;  3QZ8 A;  3KTM A;  1E1R G;  1NR7 A;  4WFB V;  3TII A;  1CKN B;  3L4K A;  2Q9L A;  3T5K A;  2E2H A;  1YF2 A;  4DV5 B;  3UKM A;  4TT3 G;  2Q7G A;  3L2P A;  3M9O B;  3OHB A;  4K0K H;  4JTA B;  1BGY H;  1XHX A;  3IC7 A;  4XX0 B;  2EJ7 A;  4CKE A;  2ZM6 H;  2E3C A;  2GHY A;  4MT8 A;  1EBO A;  4HNU A;  5BWR A;  1M4U A;  3K79 A;  4YP3 A;  4DW1 A;  3RAQ A;  3DGE A;  2W57 A;  1HNX B;  5I47 A;  3RB4 A;  1AR4 A;  5JWP A;  2V7Q G;  4TQF A;  3T1Y H;  3G6V A;  2QM8 A;  5DG9 A;  1GO3 F;  3JAW A;  4A3K G;  2YS7 A;  2YDE A;  4L1K A;  4MVR A;  3R23 A;  3U9S A;  3RIZ A;  2JEU A;  5FD5 A;  1KUT A;  3ETH A;  1VF7 A;  4CC5 A;  4DV1 O;  3LDE A;  2X6C A;  1FVI A;  2R72 A;  3V6H A;  2DPJ A;  1S68 A;  2ODM A;  1H2N A;  4GT1 A;  4X1I A;  1BQZ A;  2BQ3 A;  1SZT A;  1AJP A;  3U9T A;  3HOU G;  1BS3 A;  3TQ1 A;  3RYC B;  4LF8 H;  1YDX A;  1S0M A;  5EYP B;  1E1Q G;  4FK5 C;  4LF6 O;  1IZ3 A;  4WFG A;  4MS2 A;  4FLZ A;  5B1A C;  1N34 H;  1S77 D;  3ZRV A;  1ET0 A;  4MVZ A;  2DWC A;  2QM4 A;  1KMI Z;  1K9M W;  5C5J A;  2B9Z A;  4TM5 A;  5L1J A;  4FJC C;  3I55 V;  3TJT A;  1KD1 W;  2WB1 A;  4LFB O;  3HB9 A;  3CQZ A;  1I2K A;  5HFL A;  5JVL A;  4RNO A;  4DUY B;  2HGX A;  3SPH A;  3U55 A;  1LUV A;  1ROP A;  1S3J A;  5DLG A;  5J2U F;  4LR3 A;  4G27 B;  3KCY A;  4U3J B;  1IBM O;  1M6V A;  4WBN A;  4DR3 H;  2YU9 A;  3RYH A;  1KKC A;  1OCR B;  1GO3 E;  1CXZ B;  3PW2 A;  3JAW B;  3D3Q A;  2XIG A;  2Y48 A;  4PJ0 Z;  2DN9 A;  4BIZ A;  4X65 O;  1I2L A;  3TW6 A;  2C35 B;  4PA4 A;  1NBM G;  4YR3 A;  2LJ2 A;  1MG1 A;  4XYL B;  2YEV B;  1TVK A;  2DE0 X;  4QWB A;  1S5H C;  3AK1 A;  1G6U A;  3SPG A;  2W6M A;  3CJH A;  1Y4M A;  3W7U A;  4FM1 A;  5JUM A;  1KJ9 A;  5EBL C;  5IY5 C;  1T5E A;  2RNB A;  5CA0 F;  2QTS A;  1IBM B;  2RGV A;  2JIZ G;  5JQW A;  2YID A;  2DIK A;  2WA4 A;  1ZET A;  4KP4 A;  3ASO B;  1MNG A;  2ADP A;  3SYO A;  2FK3 A;  4IRK A;  1CE8 A;  1G2W A;  4ZHQ B;  3OSN A;  4M0J A;  3E86 A;  1FKA O;  1M90 W;  1NTK H;  3N43 B;  1HR0 O;  1S0O A;  3HKD A;  3ZJZ A;  2YCH A;  3ZRW A;  2F4V B;  2RDC A;  1UC9 A;  3QWU A;  3T9F A;  1M56 C;  1BL8 A;  2YEV A;  4LF6 B;  1S9F A;  5IP9 G;  4A3B G;  5GON A;  1P8L A;  3CRC A;  5KT6 A;  5F9L A;  5KFX A;  5LMU O;  1Q7Y W;  2FPG B;  4Q6G A;  5EBM C;  4BIU A;  3MR3 A;  3ZED A;  1L0N H;  4BY7 G;  1NTZ H;  3D36 C;  1CS0 A;  4DV1 B;  3ZRW B;  1WSC A;  2Z04 A;  1ZLZ A;  2JDI G;  3E89 A;  3G4S V;  3RBZ A;  4WHX A;  5LP6 B;  2F93 B;  4OXS A;  2PBZ A;  3Q8S B;  1RYR A;  4RB1 A;  3DXR A;  5C3E G;  3LSS A;  1M57 C;  5CA1 B;  3WG7 C;  4I7H A;  3RAX A;  3AK3 A;  5KG7 A;  3MD0 A;  4R8U A;  5DN6 G;  1OJH A;  3DSQ A;  4I50 F;  5AG2 A;  3RYI A;  5JVD B;  3UT5 A;  2P7T C;  2YS8 A;  1EN6 A;  4QPJ A;  3GQC A;  3CEI A;  2UXN A;  4FVM A;  1AR1 B;  4NTW A;  3KAL A;  1XL6 A;  1B6R A;  3N8D A;  1QR8 A;  2E5L H;  3N44 B;  4AI8 A;  3N6R A;  2QKS A;  2VQF B;  3OR7 C;  1HNZ O;  2H8P C;  5KFT A;  4DR2 B;  4RB3 C;  3H20 A;  4LF5 H;  4PI2 A;  4IIJ A;  4MTX A;  2GV9 A;  3HKB B;  1OBG A;  4J42 A;  1PX2 A;  3BAA A;  4DV3 H;  3SJA C;  1JR9 A;  4KHP H;  4RAI A;  4JI0 O;  4JZ2 A;  4L87 A;  2RN9 A;  4DR7 O;  2UXC O;  3A8T A;  3K9S A;  3IGA C;  1HR0 H;  1I1L A;  1K97 A;  1YEW A;  2IH3 C;  4DV2 B;  1OV9 A;  5C4X G;  2XAF A;  1JVM A;  2Y4T A;  1FKA H;  5C93 A;  2AXT Z;  3AG4 B;  5DEC A;  1K1S A;  5FD6 A;  1JX4 A;  5KHJ A;  3T9B A;  4E4T A;  4UVA A;  2DOS A;  2HEP A;  4IIJ B;  4TV9 F;  4IHJ A;  4JF3 A;  1WCM G;  3Q4H B;  3QFF A;  1FYJ A;  2GSM B;  4YJ3 F;  2FK2 A;  4F4L A;  3RWR D;  3QTC A;  3ASN C;  3BQ1 A;  4IYI A;  1KKD A;  2GPW A;  5LBQ A;  5KG5 A;  3ML0 A;  2L6L A;  4QIW F;  5DGI A;  2FE3 A;  1VP7 A;  3VQW A;  3OEH G;  4EBD A;  4DR7 H;  2WE6 A;  4WF9 V;  3G6X A;  1VF5 B;  5LA6 F;  1FXK A;  2EIM C;  3RT3 C;  1O9H A;  2A3Q A;  1V55 B;  1WB7 A;  4WFA V;  1J5E B;  4JV5 H;  4JI1 O;  2WWW A;  4I5S A;  2R87 A;  4QIW A;  2UXD B;  1Q82 W;  4B3R B;  4FS2 A;  1MZE A;  2W9B B;  1S97 A;  5DAA A;  1GGO A;  1HNZ H;  3VOU A;  5GW7 A;  2R9I A;  1E4F T;  4DUZ H;  3CCM V;  1IDS A;  3CRM A;  4LFA B;  1YTF B;  5BMV A;  1QBZ A;  4J9Y B;  5J9P C;  3I4M G;  4MTG A;  4F4X A;  1C30 A;  2B1G A;  3I12 A;  2WLL B;  5C1O A;  2HGS A;  4LWS B;  2XUM A;  5JJN B;  1ZL8 A;  4YAJ B;  4LF4 B;  1I1M A;  2AZ2 A;  2X5R A;  4FLU A;  1NI8 A;  4UV8 A;  4MA0 A;  2JA6 A;  2ZDH A;  1RM1 C;  2JEX A;  3ZX6 A;  3TK1 A;  1FXV A;  4O7L A;  3FD9 A;  5BY1 A;  1KBH A;  4JV2 A;  5KT3 A;  2ETN A;  3PR4 A;  4A3C G;  2Q0O C;  3B8N A;  4NXM O;  4UCR A;  2WYO A;  2V9W A;  5KFP A;  1R6K A;  1RFY A;  1LR1 A;  1OCZ C;  4ECW A;  4TWK A;  3OUF A;  5ITZ A;  2GQR A;  4UB6 Z;  4I0X A;  1XBL A;  2YIB A;  4O4I F;  1W93 A;  2UUB B;  1S72 V;  2W70 A;  2RQ6 A;  3C3S A;  3L9D A;  4RNM A;  4LF7 H;  3ETD A;  2R93 A;  3O65 A;  3MR6 A;  2AGA A;  2OWO A;  2YIA A;  1FJG H;  4I55 B;  1C3O A;  4ECU A;  3HOZ G;  3FDS A;  3B77 A;  3B4S A;  4O2A A;  2O57 A;  1R3L C;  5E79 Z;  4DV6 B;  2WDT A;  1XNQ O;  2CGO A;  2IW5 A;  1QLN A;  5I60 A;  4U7C A;  4LF4 O;  4X62 O;  1BHB A;  2ZIN A;  4F6R A;  5KHH A;  4EGJ A;  1SQX H;  4CMD A;  5D1O B;  2NU9 B;  2C28 A;  2HIV A;  4HNA A;  3W1G A;  3IAY A;  1YZB A;  1Z5V A;  4PA9 A;  4CH5 A;  2P90 A;  2NU6 B;  2YYA A;  5BMV B;  2GTA A;  3CCJ V;  4B3T B;  4I0X B;  4RUE A;  2UXD O;  3SDL A;  4DR1 B;  3JZF A;  3CME V;  4O4L B;  1THZ A;  4X64 O;  2RDI A;  2WSS G;  1SA0 B;  1A32 A;  4FGR A;  2JA7 A;  5A2Q W;  1TUB B;  3OAA G;  1OCC B;  5D5Q A;  4JI4 O;  2QSA A;  5IWA H;  1ENV A;  4P2Z A;  3OHA A;  1E4G T;  5BWW A;  4FFK A;  2R84 A;  4BXX G;  5DG8 A;  2R9A A;  4FFN A;  5H5N A;  2ZJT A;  3G71 V;  1S10 A;  2B63 A;  4B3S O;  3SJQ C;  3B40 A;  1A0G A;  2YSU B;  4JXU A;  3OUZ A;  2UUA H;  4HR7 A;  2KSW A;  5BWV A;  5L1L A;  2CK3 G;  2R93 G;  3T1H B;  3V4S A;  4JI8 B;  5HNE A;  3J80 W;  2RMK B;  4O2B F;  1KJQ A;  2YRW A;  4GKK H;  2P22 C;  1T94 A;  1H8E G;  4QJF B;  4EB6 A;  4YAK B;  3GTL A;  4LFC B;  1HNW H;  3JAL A;  2J6T A;  5LYJ A;  4KL1 A;  3OM3 B;  4EFE A;  3CMA V;  2WA3 A;  4GX0 A;  3VQY A;  4GKJ H;  1B6S A;  1FS0 G;  4DR5 O;  5KFQ A;  1Y1V A;  1EHI A;  2WAQ E;  4JI0 B;  3K03 A;  4J0M A;  4LF8 O;  3A0H Z;  5KFE A;  1EYZ A;  2PZS A;  1HP8 A;  4E6N A;  3GV7 B;  4KHP O;  4DXW A;  4LSX A;  3CXH F;  4DV3 O;  4DV4 B;  2PMZ A;  4FPP A;  4FE2 A;  4JI3 O;  1EM1 A;  4AIL C;  1YHQ V;  4LF5 O;  3H1J H;  3CRA A;  4IT5 A;  4R7C A;  2YS6 A;  4DV5 H;  4ED2 A;  5H6R A;  2HHH H;  2ZD9 A;  2FB9 A;  3RV3 A;  1R73 A;  1Y1W A;  3APO A;  1WP8 A;  2ZDG A;  5I5T A;  5KFC A;  2XGP A;  3JD4 A;  1YVW A;  2FLP A;  1VAR A;  2H94 A;  5LXT B;  1XQ8 A;  4NLG A;  1N33 O;  2HG8 A;  2R7Z G;  4B7K A;  4J11 A;  4FBU A;  4IWY A;  1UNN C;  5EWE A;  1HNX H;  2GUZ A;  1B6Q A;  1BJT A;  2R92 A;  1VQ4 V;  1YJW V;  1U96 A;  4Q0Y A;  3DXR B;  1R6N A;  2XT9 A;  3CC7 V;  3E5N A;  3MR5 A;  4A3D G;  4H0L B;  4DV0 B;  1KC7 A;  4JI3 H;  4MSW C;  5BMV F;  2HHF A;  4M7E A;  2CTQ A;  5L9X A;  2CW7 A;  4YB8 B;  2OIG A;  4H37 A;  4O4H B;  1N0J A;  4O2A B;  1CQI B;  3JRX A;  4GZR B;  2N05 A;  5L1I A;  1ORQ C;  1S5L Z;  4I55 A;  2JGD B;  3RYF A;  3K57 A;  1M0W A;  3HO8 A;  4JUZ A;  2JA6 G;  4EQ5 A;  1SC5 B;  2ALZ A;  1HW7 A;  1IYE A;  1M0T A;  2W71 A;  1RSO A;  4JTD B;  3TCU A;  1DAA A;  5KFF A;  3GTM A;  1WPX A;  5K2M A;  5KHK A;  1SYX B;  2DQ0 A;  1GYF A;  3TXQ A;  4J41 A;  1P4R A;  1URF A;  2Y4U A;  5KHG A;  1Q5O A;  3APQ A;  2IJK A;  5B1N A;  1K4D C;  4MVS A;  4A3I G;  4NXN B;  2HVR A;  4XZ3 B;  3GIL A;  3WB0 A;  3ZS8 C;  2QF7 A;  1NZ6 A;  3STZ C;  4DUY H;  3UO2 A;  2YZN A;  1WRV A;  2YL2 A;  4O7R A;  4AYB E;  4R7R A;  2WLI B;  4LNU A;  2XCP A;  4MVM A;  5FNV A;  3RF2 A;  3M99 B;  5DED A;  4PDM A;  3RGX A;  2WPD G;  3KRE A;  2LO1 A;  5TIS Z;  3V6J A;  4JI4 H;  3AX6 A;  3OEE G;  3IFX A;  5C8Y A;  3FKI G;  1VIB A;  3VPB A;  1XOU A;  5CMU A;  1V55 C;  5FR9 A;  3OTO B;  1L1F A;  1F4M A;  5LOV F;  2V4Q A;  2LFR A;  3VBB A;  3B8M A;  1WA8 B;  2HLD G;  2QK4 A;  5KFG A;  2FPP B;  3CXC U;  2B63 G;  2XCA A;  1ZSP A;  4JI6 H;  4DUY O;  1EZV H;  4BBS G;  5IYB O;  5C8Y F;  3LML A;  2UU9 O;  3D8C A;  3JAS B;  1VBG A;  2ZNI A;  5IJ0 B;  4O4I B;  2YWV A;  1S0V A;  3H40 A;  4IYH A;  4AQY B;  1NVP B;  5D1O A;  5LP6 A;  3WG7 B;  4PZ8 A;  3R5H A;  2W8K A;  3TET A;  4FU0 A;  3PJS K;  1M9N A;  3H0G A;  4DL2 A;  1XNQ H;  2QJ1 A;  4Q4D A;  4GCZ A;  1I94 O;  3L73 H;  1KP3 A;  1H2S B;  4PV1 B;  4TSF G;  3JAK B;  3AG4 C;  4LMY A;  2GDS A;  3LDC A;  3OUS A;  4DV6 O;  2LFS A;  1FJG O;  3ZMZ A;  1L8D A;  1ZL8 B;  1N36 O;  5HV6 A;  3O9O A;  2Q2T A;  4LF6 H;  2XD4 A;  1OCC C;  3RYH B;  1PV0 A;  1BT8 A;  2CNQ A;  4IRD A;  5IYZ B;  3C3T A;  2GTS A;  1E4E B;  2HJF C;  3U11 A;  2IH1 C;  2YZG A;  3JZ6 A;  5KMG A;  2DAB A;  3NUA A;  2UUB O;  2DYS C;  2Z3Y A;  3K5O A;  2VWJ A;  3AW8 A;  2JA5 G;  1AUX A;  1Z5W A;  1I50 A;  3K58 A;  3C90 A;  5K1P A;  4DV1 H;  2KG7 B;  3L72 H;  4DRX B;  2NU7 B;  3WWH A;  1H2M A;  1NH2 D;  2HR3 A;  3K5H A;  3SYP A;  1X59 A;  1AI6 A;  4NXM B;  2YZL A;  3FKI A;  3RVZ A;  5IE9 A;  1JFF B;  2W6I G;  1BMF G;  3BVO A;  4ECX A;  2PUS A;  4BW5 A;  3PN1 A;  3VMM A;  2XTA A;  5DMX A;  4YR2 A;  3PW5 A;  2R70 A;  3MHH C;  4J9R A;  2DMX A;  4F6E A;  5BWX A;  1YIT V;  3LSU A;  5T14 A;  1F51 A;  5L3F A;  1GSA A;  2IM9 A;  4ZOL A;  4MTE A;  1P16 A;  3GIJ A;  2ZM6 O;  3HB3 B;  2HHH O;  4O7Y A;  3UT5 B;  4M9U A;  4RB2 C;  3TY8 A;  2PI4 A;  4YJ3 B;  4CBC A;  3GID A;  2E5L B;  3K3P A;  2UU9 H;  4O4H F;  4F50 A;  4J9O A;  2UXX A;  4K0K O;  2LGQ A;  2HVK C;  2XCL A;  1YTF D;  1BQ0 A;  5DQH A;  3L4J A;  3N42 B;  2YZM A;  4DR2 H;  3DC5 A;  3NGD A;  3N6X A;  1L0L H;  4YQW A;  1WLE A;  4OPH A;  5IDJ A;  2JJ1 G;  1I7N A;  1D5N A;  4EBE A;  2FMA A;  1AB3 A;  3CYO A;  4EKW A;  3ZRX A;  1N32 B;  4N21 A;  2HIX A;  4GYC B;  4FM0 A;  4EBC A;  2W6Q A;  3RW0 A;  3WWI A;  1I5X A;  3LNM B;  5FLM G;  4P9P A;  3N2K B;  5E25 A;  4HNV A;  4CS3 A;  5CR5 A;  3CD6 V;  1JXL A;  3A0B Z;  1PL0 A;  2XAG A;  3F7Y C;  3RBD A;  3OFN G;  5D1P A;  5BYB A;  1T3N A;  5KG4 A;  4F4Y A;  3P32 A;  4ZI7 B;  1H8H G;  1JPX A;  2I87 A;  3Q4H A;  5GTI Z;  2A1H A;  1W0J G;  3BA8 A;  4J7Z A;  4DL3 A;  1QQC A;  4A93 G;  1XDC A;  1GM7 A;  1TWH A;  2CH7 A;  1PL4 A;  3OW2 U;  1XL4 A;  5HBR B;  1TWG A;  4X1I B;  3CS5 A;  3E83 A;  1O9G A;  2UUC O;  5JQG F;  4GC6 A;  1RYS A;  3H4D A;  3H1K H;  1GN6 A;  4IHJ B;  3THO A;  2FTK A;  2DW4 A;  1PNK A;  2A7W A;  2AZ0 A;  2AQ4 A;  5B5E Z;  4DR7 B;  2ASL A;  1K1Q A;  4J9L A;  2RF4 A;  1FXK C;  1FAF A;  2UUC B;  2V5A A;  2QA4 V;  4X64 H;  4RZQ A;  5LMN B;  2E2I A;  1PK8 A;  3JD0 A;  1DIK A;  1RJP A;  3AG1 C;  2E5L O;  2EUL A;  1VF6 A;  2OCH A;  1HNZ B;  1J95 A;  1XMO H;  4J9P A;  1G4Y B;  5EBW C;  3S3W A;  1YJ9 V;  4LNU B;  2HJW A;  1TWC A;  4RB0 A;  5KLV H;  2WLM A;  5KFS A;  4G3I A;  4RNN A;  2IJI A;  5I5W A;  3RYI B;  5JVD A;  2R86 A;  1PPJ H;  2BTQ B;  4DAA A;  4YIO A;  2DLN A;  2YXH A;  1N32 O;  4JYC A;  1U97 A;  3BPZ A;  5CA1 A;  5IYC O;  1JLL B;  1SQG A;  2EJ3 A;  4TQR A;  1OCR C;  4IZO A;  4FFM A;  1SCU B;  3NC0 B;  2HP8 A;  4PDL A;  4MVQ A;  2X6B A;  4DR6 B;  2CH7 B;  1A3G A;  3GIQ A;  4PA3 A;  3PW7 A;  5D8D A;  5F9N A;  4MAM A;  4X66 H;  1GMG A;  3CC4 V;  4O4L F;  4EG0 A;  4JI2 H;  1E4E A;  2X0L A;  1PP9 H;  4A2A A;  5LMU H;  1QHT A;  5IYD G;  2UVU A;  1P7B A;  2SCU B;  3KHL A;  3GB7 C;  3ZMV A;  5IYC G;  2BOC C;  3SYC A;  4DO2 A;  4X1Y B;  5EC1 C;  1FJG B;  3WNZ A;  1GN2 A;  2OTJ V;  4QIW E;  5KT2 A;  3GII A;  1F4N A;  4ZIB A;  1K4C C;  4I9Q A;  4MV3 A;  2V4R A;  2VQE B;  1P49 A;  2BE3 A;  4J7J A;  3J7A U;  3RUP A;  2FP4 B;  5A2Q N;  4X20 A;  5H6Q A;  3RGZ A;  1I7L A;  3R5X A;  1Q8I A;  2D2C B;  1VS0 A;  2JRI A;  2Y0S A;  2W9C B;  3TY5 A;  4O3Q A;  2PN1 A;  4JYB A;  4MA5 A;  1XNR B;  4JI7 O;  4MV7 A;  1DV1 A;  3HKZ E;  3K9A A;  4UVB A;  4MV4 A;  4W4L A;  2COI A;  2IU0 A;  3I5D A;  5EIB D;  1Q6H A;  1MA1 A;  2R8H A;  2L35 A;  2DZD A;  3NBY B;  2LGW A;  4JI5 O;  2YI8 A;  3BAC A;  2V59 A;  1XHZ A;  5DM6 V;  2QEX V;  4ZOL B;  1K8A W;  2O03 A;  2CAZ C;  3ZN0 A;  3EXA A;  5E1A C;  3W7S A;  5BXZ A;  5EZY A;  2UUA O;  2HG5 C;  4YY3 H;  2QR4 A;  3G67 A;  4UCO A;  5KFL A;  2DJV A;  4C2M A;  1N36 B;  3W1B A;  5DQI A;  2JJ2 G;  5KHI A;  5IWA B;  1UJW B;  1FFX B;  4PDB A;  4RAZ A;  5IWA O;  3ORQ A;  4DR3 O;  4X65 B;  3ZHU A;  3RYC A;  1D2D A;  4XDL A;  4DRF A;  3AG7 A;  1PKX A;  2EIL C;  1KP2 A;  2YIB D;  4O2A F;  3T99 A;  4ASU G;  4AQY O;  3OT7 A;  3SYA A;  3CCS V;  3OGI B;  2M05 A;  4OX9 O;  2JGU A;  3AG1 B;  4IL6 Z;  1VBH A;  4Q4C A;  3L71 H;  4FFB A;  4JI5 B;  4LFB H;  3LNN A;  4GKK B;  3MHS C;  1SQP H;  3E8B A;  1ZAU A;  3G6E V;  3AG3 B;  1VQM V;  1GSO A;  3RBE A;  5DIS C;  1GK9 A;  2JEI A;  2Q7H A;  1HNW B;  3HKE A;  4YJ3 A;  4Q8E A;  2ARH A;  3TIG A;  2VUG A;  2Q6A A;  2COJ A;  2YUA A;  4FLY A;  2VS0 A;  4JYA B;  5L3E A;  2UXC H;  3CCR V;  1H2L A;  4CMF A;  4DW0 A;  2P5O A;  2NUA B;  4JI0 H;  4CE5 A;  3GV8 B;  2EIJ B;  1MSW D;  3ABU A;  4RQF A;  4YHH B;  3J81 W;  3H01 A;  1G8M A;  4O4J F;  2K1E A;  4LF7 O;  3ETG A;  4LBE C;  3AG2 C;  3MR2 A;  3G6B A;  2G38 A;  2DYR C;  3OD4 A;  4DQN A;  5LA6 B;  1WR2 A;  3U0Z A;  1VAJ A;  3E8H A;  4NXN O;  3JAR B;  3DTG A;  4IIJ F;  2KG7 A;  4DRX A;  2VUM A;  4C5A A;  3WB1 A;  4O4L A;  1UPG A;  1KBL A;  5LOV B;  4GUN A;  2PMZ E;  4PDR A;  2OLS A;  2Y0P A;  1O75 A;  5IYZ A;  1HWY A;  2M7W A;  3ABL C;  2P6J A;  2CZG A;  1RPO A;  1H2K A;  2ATK C;  5KFB A;  4ED7 A;  4Q20 A;  3VA7 A;  1SQB H;  4W4K A;  4TV9 B;  4U7N A;  2F23 A;  1XMO O;  3PFF A;  3G6Y A;  3W7X A;  2W9A A;  2ASD A;  3KKY A;  5KUK A;  4BIO A;  4JI3 B;  3JAM N;  1VQN V;  2QWQ B;  5IT9 N;  5FPO A;  4NZO A;  3FB5 C;  5B3S C;  2JEF A;  4CS2 A;  5I5Y A;  2FLL A;  3KG2 A;  2FKX A;  3CRQ A;  4X1K A;  1VQ7 V;  1N4C A;  2F95 B;  2GBO A;  3Q1K A;  4ZI7 F;  4JI1 H;  1X9N A;  3S3X A;  4F4W A;  4TUY B;  3M9M B;  3T9E A;  4UFZ A;  4N23 A;  1WB8 A;  5ITZ B;  3TW7 A;  1SZX A;  4JPR A;  2I80 A;  3E8F A;  2W9C A;  5IY5 B;  1M93 A;  4MW8 A;  5CA0 A;  5KT4 A;  3JCZ A;  3GIP A;  4H44 B;  4J80 A;  3ABT A;  3CC2 V;  4LFC O;  4I9W A;  2R8J A;  1MSD A;  2ZR3 A;  2ZE5 A;  3KAJ A;  1SQV H;  4CS4 A;  1CPY A;  1IOW A;  2PY5 A;  1V54 B;  3B09 A;  4O3S A;  1EKV A;  1IBL H;  4YJ2 F;  5KAI Z;  3F5T A;  1GM9 A;  2KB1 A;  1KT8 A;  2E75 B;  3JAM W;  4YR0 A;  2JVD A;  2IBK A;  4DV7 B;  3HPL C;  3ETQ A;  2JA5 A;  1AI4 A;  3CCL V;  5FNV F;  3RJ0 A;  4NZN A;  5L3C A;  2OH2 A;  2ZGI A;  4YHH O;  2LW1 A;  3CEB A;  1SET A;  3LUT B;  3ZRS A;  4WBN B;  5BWT A;  4TQD A;  3K5M A;  3VQV A;  2W6P A;  4DL4 A;  3QO7 A;  4FFL A;  1R1B A;  4RWU A;  4LF8 B;  5EZY F;  3F7V C;  3OTF A;  3KHH A;  1RK6 A;  4R50 A;  5BR8 H;  4JZG A;  1CKO A;  2A0L A;  3PVX A;  3TY9 A;  3OTO H;  5KFD A;  2R92 G;  3EYY A;  4WFH A;  4RUA A;  5KFN A;  2CW8 A;  2JA7 G;  3D3I A;  4H13 B;  3UFX B;  1SER A;  2ITD C;  3ZHQ A;  2IBZ H;  1N56 A;  2VA2 A;  4OX9 B;  1GLV A;  4EEQ A;  2ZIO A;  2W6Z A;  4JI6 B;  1HDJ A;  3WWJ A;  3AEI A;  2WAM A;  3CP1 A;  2WTF A;  1VQK V;  3SR2 C;  4TOI A;  4O4H A;  3T1H O;  3GTG A;  1YXB A;  1RPR A;  3P3N A;  2CUG A;  3K04 A;  5LP6 F;  1OWT A;  4AQY H;  4DR3 B;  3UQ8 A;  2X0S A;  5H2F Z;  2FL4 A;  2HHF B;  4L8J A;  4O84 A;  3BQ0 A;  3LP8 A;  1VEW A;  4FIP C;  1N34 O;  5C44 G;  4DR4 O;  3WU2 Z;  1CP9 A;  4RU9 A;  4OGQ B;  1NH2 B;  4QWE A;  4LH6 A;  5CM0 A;  4QGP A;  4D7T A;  2KQX A;  1EN4 A;  1IBK H;  2UVR A;  4O7S A;  3SI8 A;  3OGC C;  4YY3 O;  2HVQ A;  5LHG A;  4ECQ A;  2CDY A;  2R7K A;  1K34 A;  2OCC B;  3BCC H;  4B3T O;  5CA0 B;  3QF7 A;  2D3O W;  1EKF A;  1XNR O;  5CB4 F;  4FLX A;  4LF9 H;  3SJB C;  4CH4 A;  1DLB A;  1P84 F;  1NTM H;  1Y14 B;  4C5B A;  2NR5 A;  3ZHT A;  1IVS A;  2JS3 A;  2Q8V A;  2XC9 A;  3RB0 A;  3HOY G;  3A0R A;  1LNQ A;  4X62 B;  1SF9 A;  3E2E A;  4ZOL F;  4QWC A;  1TUB A;  2WAQ A;  2WLL A;  5B1B B;  2F4V H;  1RP3 B;  2W7O A;  3N2K A;  4CH3 A;  4O4J A;  4NYE A;  3IN5 A;  4I4T F;  2W9B A;  3H1L H;  4JI6 O;  3LWB A;  4O83 A;  3TQT A;  2WLN A;  3VQX A;  3KZI Z;  2YW2 A;  1WCM A;  3T54 A;  4HN2 A;  3PW0 A;  5KKN B;  4DR6 O;  3SGI A;  1FXK B;  3FYE B;  4GLX A;  1FPO A;  2BQR A;  1J5E O;  1K92 A;  5KG2 A;  4A3E G;  3HOX G;  4U6P A;  2DPI A;  5KFH A;  5H80 A;  4BW9 A;  1EZ1 A;  1KTA A;  5KAF Z;  2A79 B;  2LQT A;  5LXT A;  1NQT A;  1YIJ V;  2QWR B;  2AGQ A;  2QKA A;  3QNE A;  3BRC A;  5KFJ A;  2AGO A;  2ZQM A;  2QM7 A;  3X2Q C;  2P06 A;  4X8A A;  1N48 A;  2NLJ C;  1IBM H;  2BQU A;  5FLX N;  2C2A A;  1AN7 A;  1BSM A;  5I5S A;  4KUM A;  4UCV A;  2EJ0 A;  1CKN A;  4DV7 O;  4JAS A;  5H9C A;  3E8G A;  1P7G A;  2ZDI C;  5LMN O;  1BGW A;  5KG6 A;  3RGB A;  4J9N A;  1OCO B;  1BHA A;  1WJZ A;  4FS1 A;  3N2G B;  1FFT B;  3MJF A;  3CX5 F;  3ABM C;  1RJQ A;  3KYH C;  5IT9 W;  5KX5 A;  1VF6 C;  3BHP A;  1R3I C;  4UVC A;  1M7J A;  2H3O A;  4FFB B;  3K08 A;  4X89 A;  4BY1 G;  5KFA A;  1ZHS A;  3JAK A;  1OCZ B;  3FB8 C;  3I56 V;  5CN0 A;  1KB9 F;  3CRR A;  2UUC H;  3S24 A;  3GTQ A;  2RCV A;  5B1O A;  1IXM A;  5CE8 A;  1PNM A;  5JQG B;  1JJ2 U;  2WLJ A;  4G28 B;  3GDE A;  5CBH A;  4TV8 F;  3GB8 B;  4AYB A;  2YI9 A;  2IP4 A;  2JA8 G;  3K0D A;  1S5J A;  4YJ2 A;  4BBR G;  1I6U A;  4LC1 A;  2Q67 A;  4XBF A;  4IHJ F;  2Q0A A;  2PYJ A;  1N33 H;  4LH7 A;  4P9O A;  4IAJ A;  2EIL B;  4TV8 A;  1H38 A;  4FFO A;  4F4Z A;  1SQF A;  3SJC C;  2QTO A;  4EFB A;  3NXS A;  1AR5 A;  4FZ0 A;  3ZIA G; 
#chains in the Genus database with same CATH homology
 2UUC B;  1SA0 A;  5FD6 A;  4JV5 B;  4X64 H;  5KHJ A;  4RZQ A;  5LMN B;  4DR6 H;  2HEP A;  2VQF H;  4IIJ B;  4X66 B;  4IHJ A;  3W5O A;  3MAQ A;  3MWM A;  4B3R H;  4JI2 B;  1I7F A;  4LF5 B;  1HNZ B;  2UXB H;  5LMU B;  1XMO H;  4LNU B;  4DV3 B;  4RB0 A;  3RWR D;  3QTC A;  3B2E E;  4ZI7 A;  1WN7 A;  4KHP B;  5FLX W;  1WNS A;  3RYI B;  5JVD A;  2KKW A;  1SEI A;  3QG5 A;  4DR5 H;  1D5A A;  5JQG A;  4DK0 A;  2BTQ B;  2FE3 A;  1HR0 B;  3JSN A;  3VQW A;  4DV2 H;  4U3J A;  4DR7 H;  2VQE H;  1FFX A;  3BPZ A;  1I94 H;  5CA1 A;  2WE6 A;  1L2Z A;  4CH6 A;  1SQG A;  1O9H A;  3ICX A;  4BWA A;  3NC0 B;  4X64 B;  1J5E B;  4JV5 H;  5LMN H;  4DR6 B;  4ETS A;  5LYJ B;  4X66 H;  2UXD B;  2CFM A;  4B3R B;  4JI2 H;  1HNZ H;  3CB2 A;  1E4F T;  4DUZ H;  4LFA B;  2XHB A;  2PGG A;  1QHT A;  4A2A A;  5LMU H;  5BMV A;  1Z2O X;  1Z2N X;  2UUB H;  4LF7 B;  2HGS A;  4X1Y B;  5JJN B;  5D5P A;  1FJG B;  5LL6 b;  4LF4 B;  4HBN A;  3RYF B;  4ZIB A;  3C0F B;  4I9Q A;  4FLU A;  3N40 P;  2RGR A;  3BAB A;  4I50 B;  2VQE B;  1P49 A;  1I94 B;  1M5I A;  1N36 H;  2Q7E A;  4DV6 H;  3RTX A;  1X4T A;  4O4I A;  4X20 A;  3U10 A;  4LSA A;  3RGZ A;  5CB4 A;  1J5E H;  4PI0 A;  5J2U A;  1Q8I A;  4X65 H;  1VS0 A;  3TY5 A;  4X1Y A;  4CC6 A;  1XNR B;  2VPS A;  4UCR A;  4I4T B;  2WYO A;  3DF7 A;  4MV7 A;  2UXD H;  2V4D A;  4DUZ B;  5EIB D;  4LFA H;  5ITZ A;  2YIB A;  3K5N A;  3NBY B;  1B04 A;  2UUB B;  2YI8 A;  5FPR A;  5C8Y B;  4JI5 H;  3IG0 A;  2RQ6 A;  1XHZ A;  5LOV A;  2O03 A;  4ZOL B;  4LF7 H;  4DR1 H;  4LFB B;  2CAZ C;  3JSL A;  2OWO A;  2YIA A;  4O4J B;  1FJG H;  4I55 B;  5EZY A;  1XMQ H;  4LF4 H;  4YY3 H;  4B3M B;  4UCO A;  4JI7 H;  4O2A A;  1N36 B;  3W1B A;  5EYP A;  5KHI A;  5IWA B;  4DV6 B;  2WDT A;  3M4I A;  1FFX B;  4PDB A;  4RAZ A;  4JYA H;  4X65 B;  2ZIN A;  3RYC A;  1XK5 A;  4F6R A;  3CSX A;  5KHH A;  1XNR H;  3HKD B;  5D1O B;  3E22 B;  4DRF A;  5J2T A;  1TGO A;  3FFQ A;  2YIB D;  2UUA B;  4HNA A;  2HIV A;  3W1G A;  4YHH H;  3IAY A;  1JFF A;  1Z5V A;  4CH5 A;  2JGU A;  4PZ7 A;  5BMV B;  4FFB A;  4B3T B;  4JI5 B;  4DR1 B;  4LFB H;  3LNN A;  4GKK B;  4YJ2 B;  1XMQ B;  4O4L B;  1ZAU A;  3HKC B;  4YY3 B;  4JI7 B;  4B3M H;  1MZB A;  3RR5 A;  1SA0 B;  5DIS C;  5JH7 A;  5A2Q W;  2Q7H A;  1TUB B;  5J2U B;  5D5Q A;  1HNW B;  5IWA H;  3HKE A;  1E4G T;  4YJ3 A;  4FLW A;  2R9A A;  4EB6 B;  2VUG A;  5FNV B;  4FLY A;  2ZJT A;  3K3V A;  3J7A K;  5J2T B;  1WPB A;  4JYA B;  3HKB A;  2UXC H;  4DR4 B;  2P5O A;  4JI0 H;  2UUA H;  1S03 G;  4YHH B;  2KSW A;  3J81 W;  3WB2 A;  4MV9 A;  2OYQ A;  5JCO C;  5JJE B;  3T1H B;  4PZ6 A;  4JI8 B;  3J80 W;  5EZY B;  4B3T H;  5LA6 B;  4GKK H;  3RFR A;  2P22 C;  5JH7 B;  1NT2 B;  3U0Z A;  4A2B A;  5LP6 C;  3JAR B;  3HKE B;  4D7S A;  4BWS C;  4DRX A;  5K1X A;  3WB1 A;  4O4L A;  4EB6 A;  4LFC B;  1HNW H;  3JAL A;  4JI1 B;  3HXL A;  5LYJ A;  1KU9 A;  4KL1 A;  5LOV B;  4EFE A;  1ZHQ A;  3VQY A;  4GKJ H;  4K8X A;  4HNA B;  5IJ9 B;  1O75 A;  2UXC B;  5IYZ A;  1CKM A;  3HKC A;  4DR4 H;  4FM9 A;  4JI0 B;  4F6R B;  4FLV A;  4J0M A;  2ZCE A;  1XDN A;  4MTD A;  3E22 A;  4TV9 B;  2PZS A;  4E6N A;  1TVK B;  3M7M X;  3T1H H;  4JI8 H;  4LSX A;  4DV4 B;  1IBL B;  3VNN A;  4I50 A;  4JI3 B;  4AIL C;  4DV7 H;  5FPO A;  5GON B;  4DV5 H;  4CS2 A;  1SKV A;  1A0I A;  2HHH H;  4X1K A;  2VOB A;  4LFC H;  2F95 B;  4JI1 H;  3JAT B;  1X9N A;  4TUY B;  5LXT B;  1XQ8 A;  2ZIM A;  4UFZ A;  4GKJ B;  4B3S H;  5ITZ B;  5EOY A;  3JAR A;  1DGS A;  2F1M A;  1M93 A;  1HNX H;  5CA0 A;  5IJ0 A;  1WH2 A;  4I4T A;  1BJT A;  5LA6 A;  4AHC A;  4Q0Y A;  3N2G A;  3A2F A;  4K8Z A;  5BR8 B;  3JAT A;  3KAJ A;  4CS4 A;  3K59 A;  1Q43 A;  2PY5 A;  3F8N A;  4DV4 H;  1IBL H;  4DV0 B;  3JAM W;  4JI3 H;  2JVD A;  1CKN B;  3L4K A;  4DV7 B;  4DV5 B;  4M7E A;  3ETQ A;  3N41 B;  2Q7G A;  3L2P A;  3RJ0 A;  2CW7 A;  2HHH B;  4OX9 H;  1JJO A;  4O4H B;  4K0K H;  4O2A B;  3CHX A;  1XHX A;  4WBN B;  4TQD A;  3K5M A;  3VQV A;  4I55 A;  4B3S B;  2ZM6 H;  2E3C A;  3RYF A;  3K57 A;  1M0W A;  1M4U A;  4TV9 A;  4EQ5 A;  4LF8 B;  1HW7 A;  1M0T A;  1RSO A;  2W57 A;  1HNX B;  3OTF A;  4APM A;  4TQF A;  5KHK A;  4JI4 B;  3T1Y H;  1SYX B;  1GYF A;  5BR8 H;  1CKO A;  5KHG A;  2EX3 A;  2Q2U A;  3JAW A;  3TY9 A;  3OTO H;  1Q5O A;  3EYY A;  4DV0 H;  3K5L A;  2CW8 A;  3NBZ B;  1IBK B;  3RIZ A;  4TV8 B;  4O2B B;  4NXN B;  2HVR A;  3WB0 A;  5FD5 A;  3ZS8 C;  1VF7 A;  4CC5 A;  4OX9 B;  4EEQ A;  2ZIO A;  4JI6 B;  1FVI A;  4DUY H;  4K0K B;  2R72 A;  2PYL A;  1S68 A;  3SR2 C;  4TOI A;  2BTQ A;  4R7R A;  4X1I A;  4O4H A;  2YXL A;  4TUY A;  4LNU A;  4DK1 A;  2ZM6 B;  4LF9 B;  5FNV A;  4AQY H;  3RYC B;  3UQ8 A;  4DR3 B;  3RF2 A;  4LF8 H;  4L8J A;  3RGX A;  5EYP B;  1XNQ B;  5EIB C;  4JI4 H;  2JS5 A;  3T1Y B;  4FLZ A;  4X62 H;  3KAK A;  5C8Y A;  1N34 H;  3OTO B;  2QM4 A;  4LH6 A;  1KMI Z;  4D7T A;  4FLT A;  1IBK H;  4UCT A;  5JJJ B;  2PTM A;  2HVQ A;  4NXN H;  2ZNJ A;  4DUY B;  4JI6 H;  3LML A;  3JAS B;  2ZNI A;  5CA0 B;  5IJ0 B;  4O4I B;  3QF7 A;  1V9P A;  4LR3 A;  4FLX A;  4LF9 H;  4U3J B;  3SJB C;  5KMG B;  4WBN A;  4CH4 A;  4AQY B;  5D1O A;  4DR3 H;  5LP6 A;  3RYH A;  4PZ8 A;  4NXM H;  3JAW B;  3FMA A;  1XNQ H;  2QJ1 A;  2XIG A;  4X62 B;  1H2S B;  4B08 A;  1N34 B;  1Q3E A;  3JAK B;  1TVK A;  1TUB A;  5JCO A;  4LMY A;  2F4V H;  1L8D A;  1G6U A;  3N2K A;  4CH3 A;  4FM1 A;  4LF6 H;  2Q2T A;  4O4J A;  3RYH B;  4UCU A;  1T5E A;  5IYZ B;  1JMK C;  1IBM B;  2VWK A;  2RGV A;  3U11 A;  5KMG A;  3VQX A;  2UU9 B;  3K5O A;  2VWJ A;  1Z5W A;  3JAS A;  3K58 A;  4DV1 H;  5K1P A;  4DRX B;  2HVS A;  3SGI A;  4GLX A;  4ZHQ B;  4NXM B;  2BTO A;  5CB4 B;  4BW9 A;  3KXY T;  1JFF B;  4PHZ A;  2PUS A;  5LXT A;  3PN1 A;  3N43 B;  3HKD A;  4X20 B;  2YCH A;  3QWU A;  2F4V B;  3BRC A;  2RJZ A;  2R70 A;  4LF6 B;  5GON A;  1P8L A;  2IM9 A;  4ZOL A;  4RAY A;  1IBM H;  4MTE A;  1P16 A;  3UT5 B;  4RB2 C;  1TAE A;  4Q6G A;  3TY8 A;  1AN7 A;  4YJ3 B;  2UU9 H;  2E5L B;  3ZED A;  1XI1 A;  4UCV A;  1CKN A;  5IJ9 A;  5KX5 B;  4DV1 B;  3L4J A;  3N42 B;  1BGW A;  3RGB A;  4DR2 H;  4UCS A;  5LP6 B;  2F66 C;  2F93 B;  3N6X A;  4RB1 A;  3N2G B;  5CA1 B;  4I7H A;  4X1K B;  4O2B A;  3KYH C;  1N32 B;  2HIX A;  5IT9 W;  1TA8 A;  4GYC B;  5KX5 A;  3BHP A;  4FM0 A;  3DSQ A;  1N33 B;  3N2K B;  1Z2P X;  4CS3 A;  5JVD B;  4FFB B;  3BA9 A;  3RYI A;  3UT5 A;  1ZHS A;  5D1P A;  3JAK A;  4FVM A;  3GJX B;  3JAL B;  3KAL A;  2UUC H;  3S24 A;  2E5L H;  4ZI7 B;  3N44 B;  3CVZ A;  2VQF B;  3BA8 A;  5JQG B;  4DR2 B;  1QQC A;  4RB3 C;  3GDE A;  3H20 A;  4LF5 H;  2UXB B;  4PI2 A;  2YI9 A;  4IIJ A;  3GB8 B;  2MCT A;  2GV9 A;  1XMO B;  3HKB B;  4X1I B;  3BAA A;  4DV3 H;  1O9G A;  3SJA C;  4KHP H;  1S5J A;  4YJ2 A;  1I6U A;  4DR5 B;  1N32 H;  4IHJ B;  2Q0A A;  4ZHQ A;  3THO A;  2PYJ A;  4LH7 A;  4NVP A;  1N33 H;  4IAJ A;  1HR0 H;  4TV8 A;  1YEW A;  4DV2 B;  1SQF A;  3SJC C;  4EFB A;  4FM2 A;  4DR7 B;  1FKA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...