4UCUA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
total genus 98
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucuA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucuA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucuA02
4EEQA 4B3MB 2HIXA 2VUGA 1VS0A 1FVIA 4DR1B 1XMOB 1DGSA 2ZM6B 4DV4B 3W1GA 3TY9A 1XK5A 1N33B 4UCUA 4AQYB 3JSLA 3NC0B 1CKNB 1CKMA 3PN1A 3NBYB 2UUCB 1HNXB 3GJXB 3RR5A 4JI7B 2OWOA 2HVQA 4PZ7A 4JI5B 2CFMA 3NBZB 4UCOA 3TY5A 2HIVA 4LFAB 3SGIA 2UUBB 2HVRA 4JYAB 4JI8B 1TAEA 4JI0B 4X66B 4B3SB 1IBLB 3T1HB 2E5LB 3RTXA 2UUAB 5LMUB 4CC6A 4DV2B 1N32B 3BA8A 1N34B 4LH6A 4DRFA 4DR2B 4DR5B 4PZ6A 3TY8A 5IWAB 1P16A 4LFCB 3QWUA 2HVSA 1J5EB 3BA9A 4DV6B 4UCSA 1V9PA 4DUYB 1I94B 1XNQB 4DV0B 3BABA 4DR4B 4UFZA 4B3TB 4EFBA 4GKJB 2UXDB 4OX9B 1XDNA 3UQ8A 4NXMB 4YHHB 4DR3B 4DR6B 4LF8B 3GDEA 5LMNB 1XNRB 4LH7A 1X9NA 3S24A 2VQFB 5D1OA 4DV1B 3KYHC 2HHHB 5FPRA 1N36B 4DR7B 4LF4B 4CC5A 4JI2B 3JSNA 5FPOA 2UXCB 4E6NA 5DISC 2Q2TA 3GB8B 4JI6B 2F4VB 1IBKB 1CKNA 5D1OB 3OTOB 4LFBB 1TA8A 4LF5B 1HR0B 3BAAA 4DV5B 1HNZB 4LF6B 4B3RB 4EQ5A 3L2PA 1P8LA 4GKKB 4NXNB 4X65B 5BR8B 4GLXA 4LF9B 2VQEB 1A0IA 3T1YB 1CKOA 4JI1B 4YY3B 4UCTA 4X64B 1S68A 4JI4B 4KHPB 1HNWB 2Q2UA 3W1BA 4EFEA 1IBMB 4TOIA 3VNNA 4DUZB 1ZAUA 2UXBB 4DV7B 1B04A 4UCRA 4DV3B 4LF7B 5D1PA 4X62B 1XMQB 4K0KB 3W5OA 4UCVA 4JV5B 2UU9B 4PZ8A 1FJGB 4JI3B
chains in the Genus database with same CATH superfamily
3OTOO 4LFBO 4EEQA 1H8HG 2B5UA 1VS0A 5KHGA 1FVIA 2ZM6B 1JPXA 4J9QA 3ZIAG 3WU2Z 4NXNO 3JCUZ 1SFOA 4RAIA 1GM8A 3BQ2A 3J80W 1KBHA 1P49A 4Q4DA 1ZQ7A 3W7XA 2W70A 3X2QB 1R3JC 4PA9A 2GTAA 2XTAA 3OTOH 4O3QA 4LFBH 2FKXA 3LQSA 3DTFA 5IDJA 1HR0H 3H3VH 3L75H 2R84A 3GV5B 4NXNH 2QWQB 4LF7O 3SR2C 2ZNIA 3QF7A 3AK1A 4X1KB 4FMTA 4QPKA 3TCUA 4HNAB 3JD0A 4BIUA 2Y69C 3Q8QB 5E25A 4EGQA 5TISZ 4UXNA 5L3CA 4QJFA 1KMIZ 2R7ZG 2DABA 2B63A 2RCVA 5IT9N 1OCRC 2QKCA 3T4DA 4F4LA 4LF7H 1IDSA 3RYCB 1I7NA 4PI0A 3OR7C 5D5PA 1JDBB 1L0LH 2W6ZA 5H6RA 4MVRA 2EILB 1NT2B 1Y74B 2KQXA 3SYAA 1NQTA 5IJ9A 3RYHB 2VPQA 3OEHG 2FMLA 1B6QA 1AB3A 5LMUO 1Q82W 4EBDA 1SZXA 2W6IG 2WAMA 1Z2NX 2YYAA 3LMLA 3GV7B 1XBLA 4U6PA 4G28B 2IJIA 1EN5A 3APOA 5L3BA 2AQ4A 3CWBH 3K5LA 2R85A 3I12A 2RQ6A 3KTMA 1YJWV 2VUMA 1DIKA 3RB6A 1PL0A 4O7TA 4B3SH 5D1OB 4JYCA 4A3BG 5BPHA 2W7PA 1HDJA 5LMUH 3GTQA 1MG1A 3K5NA 1GK9A 2GSMB 2XAGA 1HNZB 1VF6C 1RM1B 3IG0A 2Y0SA 2PUSA 4WFBV 2PMZA 4MTEA 3HKEA 4CE5A 2W9AA 3JAKB 3N8DA 5B66Z 4O4LB 4O2AB 4YY3B 5KMGA 4MSWC 4NLGA 3AX6A 2ARHA 1KKCA 3L73H 4EFEA 1NKDA 1VQ9V 4K8XA 1PNKA 2C2RA 1TUEB 2V7QG 1ZAUA 2UXBB 2Y0PA 1AR1B 3BEHA 2CNVA 1A9XA 3CP1A 5IYDG 1VQPV 1W0KG 1KECA 3ABKB 5BZBA 4I9QA 4O4LF 1NVPB 4IIJA 4O2AF 5KHHA 1SS3A 5FD5A 4HNUA 4DL2A 5LL6b 4FJCC 1XHXA 1AR4A 4J80A 4I0XB 1EFRG 3OMNB 2DIKA 2VQFO 1MSWD 5C8YA 3R5XA 5I5SA 4PZ7A 4I4TA 3ZMVA 4LWSB 4O7RA 2HDKA 1VQKV 2CW8A 2Z3YA 4G27B 3T99A 1KC7A 1WH2A 4QW8A 4GX2A 5IYZA 3ZHTA 4A3EG 3FB7C 4XDKA 1S10A 1B6SA 4DL6A 3G71V 1H2KA 2M7WA 2RNBA 5JCOC 4D6TH 1WB7A 4RB1A 5JQGA 5BXZA 3DC5A 3N40P 4RNNA 5BR8O 3D36A 1R9TA 2DWEC 2X6AA 1B3QA 4TUYB 3QO5A 3TQ1A 3FYIB 4ZBMA 4JI4O 4JTCB 5IY5B 1FFXA 4BWAA 4IR9A 2R93G 2QTSA 4X8AA 4Z2WA 4B3TB 4FFLA 1XDNA 4DUZO 2Q68A 4YHHB 5F9LA 5BR8H 2WDTA 4JYAO 2EJ0A 4IGGA 1X9NA 4ASUG 1OCZC 4TUYF 2E2IA 2A06H 3FAVA 5E1AC 2O57A 2HHHB 5K1XA 2KKWA 1JIHA 3UZBA 2JJ2G 2YS8A 1Q6HA 3TIIA 4AQYO 2ASDA 3E5NA 3M9MB 2J6TA 2UUBH 5FPOA 2DZDA 2HGSA 4JYAH 3CJHB 5HBRB 2F4VB 3G4SV 2P7TC 3SNOA 3RGZA 4JI5O 1QLEB 5LOVA 4EKWA 3A0HZ 2PTMA 4WFFA 4FE2A 4J9OA 4FBUA 3RYFB 3OUZA 1P8LA 3ABMC 2ZE6A 3RFCA 2QKSA 2ZDGA 4X65B 1T3NA 4UV8A 5KT2A 4AQYH 3CE2A 4FBTA 2JEUA 3LUTB 3D8CA 1KD1W 1A0IA 2A1HA 2FP4B 5D5QA 5AG2A 2DJVA 2EJ2A 4AILC 4M0JA 3RGBA 1I08A 5J2TB 3RIZA 2BTOA 4GZRB 5KAFZ 2IM9A 2W6NA 3PFFA 3WB2A 4UCRA 2GQSA 1RFYA 2KSWA 1GM7A 2ZKOA 1IXBA 1MA1A 2YZLA 1KUTA 4FFMA 3K0GA 2WAQA 4LF8H 1IZ3A 4TT3G 4J7ZA 3M9OB 1YI2V 5J2TF 3M4IA 1JQ0A 3E8HA 5BWXA 4DR1B 4IYIA 4NXMO 4YR2A 1EKVA 2Q69A 4UCUA 3MR6A 3GTMA 4PWQA 3Q8RB 3CHXA 1CE8A 2N74A 5GONA 4DV1O 1KC8W 2WYOA 3V6KA 5DM6V 1HNXB 1S72V 5KFRA 3K3WA 2PYJA 3BRCA 1P7BA 1TWGA 2ABJA 4JV1A 2VOBA 1D5AA 1SQGA 2LW7A 1M5IA 1SRYA 2HHFB 2HLDG 5H9CA 5C1OA 3JZIA 3FKIA 4DV1H 4LP8A 2EIYA 5CMUA 2PGGA 5CBHA 4LCUC 2B1IA 1GRJA 1FXKC 3G67A 4HNVA 5HFLA 4FS2A 2IJJA 4DV3H 1T5EA 4TV8B 4UCSA 5KA6A 3ZHSA 1FJGH 1RK5A 3DSQA 3T5KA 1WRVA 1FPOA 1WP8A 5KUKA 4DR3B 2QM4A 1GLVA 1I2KA 3ETHA 5JVLA 5KFQA 3KHGA 3U10A 1EZ1A 3K3PA 2JS5A 5JVDA 4O7NA 1ZWIC 1Q3EA 4TV8F 2V4QA 2X5RA 1MZFA 2R7KA 5KG4A 2UUCH 5LGTA 1XMOO 4FLVA 1SETA 1KBLA 5EZYB 4RZRA 2VWKA 5FR9A 4JI2B 2VRZA 1EHIA 3F5WC 3OUUA 3JD4A 3VBBA 2ITDC 3PW5A 2YIDA 5B1AB 3OHAA 3CCQV 4A3KG 2X6BA 2OT5A 4MVQA 5EZYF 2M05A 4IR1A 3T1HO 2W6JG 3NXSA 3B8NA 4ECRA 4PA6A 2BOBC 4YJ3B 1VIBA 1N34O 2Y4RA 1I7FA 1HNWB 4JXUA 3JAWA 1GYFA 4TOIA 2WLLA 3GIDA 5KT3A 3V4ZA 1UFIA 2VWJA 1EBOA 1YITV 5B1NA 2UXCO 1Y4MA 3N2KB 4O4JA 1Y67A 1S5HC 1SCUB 1EKPA 1L1FA 4X1YB 4O3NA 3JD1A 1KUQA 4YJ3F 2DLNA 2ASJA 1AROP 1BXRA 4X9QA 5BWTA 1HP8A 1N33B 2JJ1G 3N27A 3SJBC 3WWIA 5LMNO 5JQWA 2JA6A 1F23A 4WF9V 2VQEO 1W2BU 2JRIA 2OCCC 5LGNA 4H0LB 2WLNA 3OSNA 2UXCH 4FU0A 4PD4F 1R6NA 4TV9B 1BHAA 1SZTA 4DR7O 1V54B 5KG7A 4LFAB 1AJPA 1Y1WG 1RSOA 1JDEA 2WPDG 2YZNA 4O4HA 2R8KA 1TAEA 4ZHQA 4B7KA 1FFTB 2VQEH 1OCZB 5DAAA 2QTOA 4R50A 1K83A 2P67A 4TV9F 4JTDB 4CZZA 3MD0A 4DR7H 2YS7A 1F51A 1L8DA 4N21A 1YTFB 2Z04A 2C28A 3T1YO 4FLWA 4QGPA 2WLHA 2ZD9A 1SESA 3BA9A 2A0LA 3L71H 5LBQA 2GLTA 3BHPA 3U0ZA 1YVWA 4X62H 3PR4A 4KXRA 4QWEA 1I94B 4NVPA 1MZBA 3T54A 3BABA 1GN3A 2UXDB 4ABMA 2R82A 2UXNA 2W9BA 3RWRD 3ABMB 2F95B 3T9FA 2IW5A 3L4KA 3UM7A 3W7TA 3RF2A 3S24A 2N05A 5KG5A 4J0MA 1NR7A 2R8IA 3FB8C 4EB6A 2XAFA 1Q6IA 3KG2A 1CXZB 3K5MA 1E4GT 3EYYA 1N36B 5CA1A 3A0RA 3CCJV 2YW2A 4R8CA 1VP7A 3J81W 1DAAA 2W6PA 5H80A 2ETNA 5BYBA 1RPOA 5BWVA 3R5FA 3X2QC 3WO0A 2Q2TA 3DGEA 4MV9A 2R7MA 3SPHA 1L2ZA 3A8TA 3BY6A 1Y66A 3CXCU 1S5JA 3W7WA 4QIWE 3BJYA 1PKXA 3CPWU 3U9SA 3CC4V 4YBZB 2CH7A 1B33N 3H4DA 2BE3A 4JYYA 1Q8IA 5E79Z 2UUAO 4MV6A 2LJ2A 4JI1B 1XNRO 4F6RB 4JF3A 3P3NA 4J9YB 4RB3C 3JALB 1WLEA 5F9NA 4RU9A 1IBMB 1K34A 5IWAO 1BGWA 3T9EA 2EJ7A 1K33A 5L1LA 3IC7A 4Q6GA 3TIGA 5KFWA 1EM1A 2EJRA 4UCVA 4JV5B 1EUDB 1UC9A 5HNEA 2UUAH 4MVSA 1XNRH 2JVDA 4DV0O 5LA6A 2OIEA 2EILC 4O4IB 1NBMG 4M7EA 1NTKH 5IWAH 4ZI7A 2HG8A 3PO2G 1V4YA 4R7RA 4LF4H 1FXKB 2B63G 1NVPD 5K3WA 2DN9A 1K5SA 4WBNB 4HR7A 1JFFB 1SA0A 2QGNA 2OWOA 5FLXW 1XEQA 2BR0A 3UT5A 1GSHA 2ALZA 3Q4HB 2AHZA 4O4IF 4D7SA 1S03G 4PJ0Z 4DL5A 2X0SA 3O9OA 1KP2A 4JI6O 4C5BA 1YJNV 4UUGA 4MVZA 1S5LZ 2QKAA 4LF5O 1N32B 4WBNF 4R8UB 4J9RA 3HKZE 1RM1C 4LF6O 3R65A 4B3RO 3NR7A 2SCUB 3PW4A 5LYJB 3VPBA 4FFOA 2ZR2A 5IYBO 2VUMG 4ECYA 3H40A 3QNEA 4JI6H 2CKZB 2P6JA 4MW3A 4U3FH 3ETEA 1OHHG 2FLPA 4JI3H 4B3MH 2W0FC 3I4MG 4B3RH 3BQ0A 1RPRA 2V5AA 2GUZB 5LYJF 5B3SB 1XMQO 2N04A 3ABKC 3JATA 3SPJA 2JEXA 3P32A 1K97A 2KG7B 4JI8O 3LULA 3U9TA 1IBLO 4Q4CA 3BACA 3GIIA 5JWPA 1VQMV 3CEBA 1RP3B 4CMDA 5LXTA 3CQZA 3N6XA 4PDVA 3WFVA 2WE6A 3JSNA 2DWDC 4JI8H 5KT7A 4LNUB 3B2EE 1KJJA 1IBLH 1ROPA 2E5LH 4DV6O 3CD6V 2FL4A 4M9UA 2FK3A 2CTWA 1KTAA 1Y1WA 2EZOA 2YRWA 5EOYA 4GKKB 3ZEDA 1VQ8V 4JI0O 1GO3F 2YEVA 2QK4A 2JGDB 2QDOA 1SC5B 3MHSC 2DE0X 5LHIA 1SYXB 1FD9A 3OAAG 2HVJC 3OGIB 3KALA 4DV6H 4HNAA 3J80N 4ED6A 3VNNA 3AK2A 4W4KA 1BJTA 2YIBD 4O81A 1FXHA 3RV3A 3ETGA 5EBMC 4JI0H 5GTHZ 2OCHA 3G6EV 1YJ9V 1LNQA 4K0KB 3JZFA 1Z2GA 5IY5C 5KG0A 4DR6H 2NLJC 3S3WA 2F66C 3RYCA 4BY1G 2ADPA 4DR4O 3HKCA 4J9SA 4PELA 5LP6A 3ASOC 1GSAA 5FD6A 5DECA 5EDWA 2LGWA 2XAJA 2AGOA 2IBZH 1XI1A 3N41B 5H2FZ 1DK1A 4EBEA 3BFRA 2ZIOA 4RQFA 3D3QA 1XUQA 5KFPA 4F4XA 4MTFA 3RYHA 2GBOA 2JEIA 1AJNA 3H1LH 4O2BB 2CFMA 2XUMA 3SGIA 2NU8B 5KFLA 4A2BA 1ZHQA 4DL3A 2QF7A 1G4YB 1XL6A 5EK0A 4RO2A 3RTXA 4DRXA 3OEEG 4MV7A 3SPGA 1WN7A 1HR0O 5KT5A 3HPLC 4DXWA 4O2BF 4MVOA 1AUVA 1Y14B 1YXBA 1MNGA 4DV7H 5IP9G 3JASB 4PDMA 2CGNA 4BW9A 5BMVB 1G2WA 3RB4A 3L4JA 4DUYB 2Q0OC 4GX1A 5EYPB 5BYAA 4TVIA 2DYSC 3RUPA 4CH4A 2WLIB 1FKAO 1PX2A 3GDEA 2EULA 2BCCH 2C2EA 1B6RA 3GTJA 2VQFB 1IVSA 1BS3A 5BMVF 1KJQA 3Q8SB 1WB8A 3H4BA 3R23A 3ABLB 2VR1A 4FFBB 4RB2C 5KG1A 1BNCA 1AP6A 1EN6A 4ECTA 4ETSA 1FKAH 1OCCC 3GB8B 4Q8EA 5KFHA 3RJ0A 4ED8A 2P0AA 3N44B 4DV2H 1KJIA 1GAXA 1YCIA 2UVRA 2ZDIC 3N43B 3RW0A 4I50A 1K9MW 5BR8B 1E4EA 2HEPA 4B3SO 1J5EH 3AG4B 3QO7A 1TWFA 3CRCA 5GTIZ 4X64B 3OMIB 1Y76B 4JI4B 1DV1A 5LL6Y 1NI8A 1K73W 4I5SA 3K57A 2Z5UA 4DUZB 1B04A 2GHYA 1BCCH 4IRKA 1IXMA 2OTLV 3C90A 1CS0A 3H1JH 2GPSA 4DK1A 1A0GA 2FLLA 3FKIG 2QWNB 1IBKO 2CGOA 1E4FT 3C3SA 3H01A 4FZ0A 2Y0IA 2ZGIA 4DV4B 4WFHA 4GCZA 2COIA 1YEWA 2JK5C 1CEZA 5DLGA 3BVOA 2JDIG 1VQOV 3N6RA 4AQYB 4LF9O 1CKNB 1XDCA 4HQ6A 4A3DG 1ORQC 3HXLA 4GLWA 4JI7B 3ZMUA 4YJ2A 1IBKH 2HG5C 1ENVA 4JI5B 3LDEA 2XCLA 2HIVA 4YXWG 3T9BA 2B1GA 2PYLA 4DV5H 5HFMA 3U11A 1ZUQA 2KB1A 4C2MA 3E22A 2FPIB 4LF9H 1M4UA 3CJHA 3IC9A 5B1AC 3ZS8C 1S0OA 1R3LC 1M90W 4LH6A 4DRFA 1P4RA 4FM2A 4DR2B 1C3OA 5HV6A 5EWGA 2ZM6O 3CCRV 3GIQA 3FYEB 3LDCA 4FFRA 1AUXA 5IYBG 3C3TA 2B9ZA 4O7ZA 2YXLA 4QWCA 4WCEV 1VF7A 2ODTX 3CSWA 2WB1E 1M56C 3JAMN 2VPSA 1VMGA 1GSOA 4FM0A 2W9CB 3L9DA 1YTFD 4LR3A 1ZX3A 3K59A 2R7NA 1BMFG 1VQLV 4E4TA 4NXMB 2D2CB 4QJFB 2ZM6H 1EUCB 1YIJV 1H2NA 5T14A 4UB6Z 2KSDA 2QSAA 1E1QG 2EIKB 3GIKA 3LNNA 4DV1B 2QM8A 2YICA 2XC9A 5DGAA 1RYRA 1JLLB 2CAZC 3UZOA 1BHBA 2R7LA 1WNSA 3CCLV 4XYMB 2MCTA 4RNMA 3RVYA 1RJRA 3PR5B 4NTWA 3K58A 5EC1C 4UUJC 1IOVA 1SQBH 4LMYA 3GTGA 5IJ9B 3B4SA 3K04A 4B7EA 2YI8A 2CUGA 1V54C 1AI4A 3DF7A 4PA4A 5H5NA 3ASOB 2UUBO 3SYQA 1EZJA 2JA6G 4FLZA 2XCAA 5C1PA 2HHFA 3UO2A 4XYLB 5FJ8G 3SDLA 2W71A 5I5YA 1BSMA 2IU3A 2BSKB 1VBHA 3JAMW 1PD3A 1KQSU 1IYEA 5CA0A 3HKEB 4FFKA 4A3CG 4Q45A 1JMKC 4PZ8A 1UC8A 1ZHSA 1U96A 4TV8A 3T9DA 1US6A 3E8GA 3JCZA 5KX5B 4CHIA 5KHIA 2ZINA 3TINA 1JJOA 3UKMA 1XMOB 2DQ3A 5ITZA 3WNZA 4BBSG 4LF8O 1VF6A 2F1MA 2R9RB 3TJTA 4FFPA 4IRDA 3LDDA 3ZHVA 1CKMA 1T36A 1H8EG 2NU7B 4KL1A 4IIJB 4MV8A 4NZMA 5KX5F 1JJ2U 1OWTA 3DTGA 4BBRG 4IT5A 4X89A 3OD4A 4R6ZA 2DYSB 3AG3B 2E74B 2JEFA 3ETJA 4WD3A 3S3XA 5L3GA 2V58A 2CTPA 3T1HB 1T94A 3PW0A 3QVNA 2JA7A 4QIWA 3BA8A 4I4TB 1N34B 1I1KA 4YY3H 4IIJF 3HOYG 3GB7C 1I7LA 2XCPA 1Y1VG 3MWMA 3QWUA 2Y4TA 2E3CA 2UXBH 5JJEB 4BXXG 5IYZB 3T9CA 1OCCB 3KKYA 1BQZA 3FB5C 5JQGB 4YJ3A 4I4TF 3G6VA 2CDYA 4DW1A 3M8AA 3UQ8A 2CTRA 3SJQC 2K1EA 4DV3O 1CQIB 3GTKA 2Q7HA 2W57A 5LMNB 4OXSA 5KFXA 3OT7A 5IYZF 5C4XG 4NZOA 1FJGO 5B1BC 2X0LA 2H3OA 4MVUA 1FFXB 2HP8A 1LUWA 4I9WA 3H1HH 5JCOA 5JQGF 5DGIA 4O7LA 5IP7G 3KHHA 1AI7A 4DR7B 3ZN1A 3BCCH 4JTAB 2VS0A 5C3EG 1GGOA 2UUCO 3UFXB 2NVXA 1S77D 3FAVB 4HAMA 1ULZA 1JKJB 4FIPC 1RK6A 4L8JA 3H9VA 1OJHA 3GIPA 2IP4A 3IN5A 4GX0A 2ZDHA 3T1YB 4JAAA 3VOUA 4ZKIA 1BGYH 3OTFA 3ABUA 3HKZA 3H1KH 3E8FA 3JARB 1PV0A 4J7JA 1S68A 2HHHO 2Q2UA 4FLUA 1IYDA 2YRXA 4I7ZB 2Z0AA 4A2AA 3RBDA 4B3TH 2R92A 4N23A 1ZL8A 2ZXWB 2QB5A 1A32A 4MW8A 5EBLC 2UU9B 1F4NA 4MA5A 2F4VO 4MTGA 1X59A 3SPCA 4RUEA 4RCNA 2HHHH 1OBGA 4OX9O 4PDBA 3MFHA 2F43G 5B3SC 4J9NA 1XK5A 2R8HA 3CRRA 3B8MA 4X65O 3JSLA 2EZPA 2FYUH 1O9GA 1W93A 3MDSA 3GIJA 2AGQA 1M56B 3T2MA 4ECQA 2F4VH 4ZOLB 3T7AA 2YL2A 5EWFA 1FYJA 3RBZA 5KFJA 3G8CA 2COJA 1WSCA 1XHZA 4OX9H 2Q73A 3OUFA 3UYYA 4X88A 5CBFA 3A0BZ 3N2GA 4X65H 5K1PA 3T4ZA 2C2DA 5GONB 2UUAB 5DG9A 3OFNG 2Q67A 2L35A 1DF5A 4U3JB 4ZOLF 1IX9A 2P90A 4LSAA 2UVUA 3AG1C 5IJ0A 4DR1O 3RFRA 3TY8A 5IWAB 1Y6XA 3EPIA 5KHJA 1X4TA 1MMMA 5KFKA 4LFCB 3D3IA 1E1RG 4MTOA 4X20A 4O3OA 4YAJB 2FK2A 1KKDA 1I5XA 3TGUH 3CX5F 2NN4A 4RUFA 5GONF 3J81N 2PY5A 2UVVA 4FZ1A 1HNXO 2ZQMA 4F6RA 1WJZA 2PF4E 4DV0B 4QPJA 3P3PA 1JVMA 3JALA 4E2LA 5A9GA 1L0NH 3HKDB 3TEKA 3A2FA 4DR1H 4X62O 4RUCA 1S76D 2DPJA 2V9WA 4BY7G 3TXQA 4TSFG 2P5OA 2QYZA 1TVKA 1HNXH 2AHYA 4ECXA 1QU7A 2QE7G 5KFOA 2R6FA 2GDSA 3G80A 5A2QW 3VPCA 3AEIA 4O4IA 2P4KA 5FNVA 4KUMA 1W96A 2BTQB 1NU1H 3F7VC 4J10A 4BWSC 1K92A 1FXKA 1M57C 5JVDB 4JI6B 1VQ4V 2QEXV 2FMAA 4C5AA 2Q5ZA 1GKFA 3E83A 4LF5B 1WCMG 3K79A 4Z1VA 4K8ZA 4LF6B 4B3RB 3TW7A 5JJJB 4UV9A 1TWCA 4WHXA 2RGRA 1P84F 2R8GA 1JA8A 2DQ0A 1H38A 1Z2PX 1WPXA 5F2VO 5JVDF 3LSUA 1N4CA 3CC2V 4KHPB 1SERA 3APQA 4R8UA 2YIAA 5KFCA 5J2UB 1Y1VA 4C7UA 5FLXN 1F4MA 4JI2O 1PP9H 1WP7A 1XMQB 3W5OA 4CMFA 1WPBA 2OYQA 4JGSA 2XGQA 2XAHA 2HVKC 1XNQO 3MR3A 2IJKA 4GC6A 3ZBHA 3PW2A 1MOFA 5KLVH 2WLLB 2XT9A 4YP3A 2A3QA 4I55B 5J2UF 1E79G 1J95A 4JI2H 2DMXA 4C5CA 3RYIA 3OGCC 5I60A 1N48A 1S3JA 2KG7A 4O4JB 2YU9A 2F23A 1M0WA 4XBFA 4IHJA 1HNWO 1XNQH 4H13B 1GN2A 3ABLC 4LF4O 4EYIB 2NU9B 1BQ0A 4I55F 3SE7A 4RAYA 3DXRA 1R3IC 4JI0B 2EIJC 4RWUA 3ZX6A 1IURA 2W8KA 2D3OW 5B1BB 4O4JF 1TWAA 3U54A 3JRXA 2FE3A 4ZQIA 4H44B 1HNWH 1W0JG 3LNMB 4DR5B 2LO1A 4Q44A 3CS5A 3GLKA 3GILA 5H6QA 3ZJZA 1RSOB 1RYSA 1QVGU 4O4HB 5IYCO 3AG4C 5JH7B 1AI6A 1Q5OA 1I1LA 2FK1A 1V9PA 4RQEA 2Q7DA 2EINB 3H1IH 4DR4B 5DG8A 4MTDA 4EFBA 2ZE5A 4GX5A 1U97A 3WB0A 2WWWA 1I5YA 4O82A 2V4RA 5KKNB 3SPIA 1N33H 5EWEA 4O4HF 4ZHQF 4LH7A 4ECVA 5JH7F 4O3SA 1YHQV 4F4ZA 4JI3O 3LSQA 1UJWB 4B3MO 3KHLA 3ETQA 1KT8A 1WA8B 3GQCA 2RDCA 4JAUA 4X1IA 1CPYA 4LBEC 2W9BB 2IA6A 4LFAH 3B77A 1KP3A 2IH3C 4FFNA 4MV1A 5D8DA 3CCMV 4WFGA 4FLXA 4MA0A 3OTOB 4LFBB 1TA8A 3STZC 2QR4A 4EB6B 3OE7G 4RNOA 1I94O 2A79B 3K03A 1HR0B 1S0MA 3T1CA 4O2BA 2JGUA 2UXDO 1TUBB 3G6YA 4CBCA 4NXNB 3KREA 4X66O 3CB2A 2E5LO 4DLKA 3E89A 4CH5A 1VEWA 3CMEV 3BQ1A 1VQ7V 2RGVA 3ABTA 4MT8A 4WFAV 1EZVH 4YQWA 4ED7A 2ADQB 3HOXG 1I94H 4F6EA 4BIOA 2UXDH 5L3FA 1NS1A 4U7NA 4AYBA 3PVXA 4QE9A 3U55A 2WB1A 4LF7B 4X66H 3RAQA 2W6OA 1R1BA 3JASA 3IGAC 5EC2C 3Q2OA 3QZ8A 2P22C 5BMVA 2HIXA 4Q43A 2Q7EA 5I5WA 3AG1B 3W1GA 1S97A 3R5HA 1P7GA 4XX0B 1N36H 2LP7A 2H94A 1MZEA 2EIKC 4DR6O 3PJSK 2YZGA 3WG7C 2AGAA 3NC0B 3AG2B 2WLIA 5L9XA 2LFRA 2E75B 4UVAA 5KFTA 3LSSA 4U7CA 5BWUA 4X1KA 1VQ5V 2HVQA 5BPFA 4UCOA 2PI4A 1QCEA 4ZI7B 3TW6A 4ME6A 4RB0A 3U0GA 5KFVA 4F4WA 1DTOA 4B3SB 3ASNC 5LMUB 3RN4A 4JI1H 2P06A 1SA0B 1VKZA 3RGXA 3MR2A 2PZSA 1K5QA 3B09A 3UT5B 2RN9A 2RDJA 3VA7A 2FPGB 5CM0A 2RF4A 4FLTA 1IBMH 1Y74A 4A93G 4ZI7F 5I5XA 1KJ8A 3T5JA 1QR9A 3ICXA 1M57B 4FPPA 2ATKC 4JV5H 1Q6UA 4J9LA 1VARA 1Y76A 3T5HA 3CYOA 4DV7O 4ED0A 3FFQA 4YIOA 4O3RA 4LSXA 4JYBA 1K4CC 3K9AA 5D1OA 5C44G 4L1KA 3GTOA 2Q8VA 1K4DC 4KP4A 1URFA 1D2DA 3JD2A 1BE3H 4QNHB 1V55C 3ZRWB 1F7YA 2COGA 3L70H 2DYRB 3JAKA 2E76B 5I47A 1AVMA 2QJ1A 4J11A 3ZHRA 2GQRA 4E6NA 1IOWA 2FB5A 1FS0G 1CKNA 4O4LA 4O2AA 1I2LA 2G38A 4J9KA 3ORQA 3RB3A 3M9NB 2V59A 4PDRA 1N32H 4CKEA 4Y8VB 2W8LA 3TXSA 5LXTB 5DG7A 3AG3C 3RB0A 2LFSA 3ETDA 4DV2O 1A3GA 3LWBA 4DO2A 2JA5A 1NZ6A 4G2KA 3HR0A 4UCTA 1EYZA 2BQUA 4RAZA 1HWYA 2GV9A 3FD9A 2C00A 1COWG 4TQFA 4WFEA 5LXTF 1GM9A 1J5EO 1Q43A 4I0XA 5D1PA 2LGQA 2YEVB 1GO3E 2CTQA 2EIJB 3VQXA 4FLYA 2JA7G 3HT5A 3T5LA 4O86A 5KFSA 5KFEA 4LWSA 2MW2B 4GKJO 2W9CA 3QO8A 2Y48A 3D36C 4TWKA 1O9HA 5KT6A 3BPZA 4GKKO 1G6UA 2WA4A 2ZE8A 3E86A 2Q6AA 3PN1A 5I5TA 3M7MX 2R72A 3GJXB 1M0TA 3IFXA 4IYHA 3HKCB 4GKJH 5LP6B 1C30A 4L87A 1M6VA 2UUBB 3RBEA 4JYAB 2AW9A 4GKKH 3L74H 4TUYA 1N56A 4K0KO 1I0HA 1QR8A 4QWBA 3HKBB 4FK5C 4DV5O 3KAKA 5CB4B 4YR0A 3J7AK 3TQTA 5LP6F 3AYHB 1PNLA 2WLJA 5IYCG 1B06A 3EPGA 1SEIA 2A7WA 2IMWP 1ZTEA 4K0KH 4DRXB 3K06A 1FAFA 2R8JA 1SKVA 5DN6G 4UFZA 5CB4F 2ZCEA 2HGXA 2ZXWC 2BSKA 1KJ9A 4R7CA 2WSSG 2X7RB 3G6XA 5KFIA 5L3DA 4HZ3A 4LF8B 2WLKA 4O3PA 4IRCA 1DV2A 5FLMG 4UB8Z 2JA8G 1O75A 2BQ3A 2VA3A 5KX5A 1QHTA 3HO8A 5IT9W 3RYFA 2HJFC 1R73A 2R92G 4CC5A 1THZA 3GVMA 3GV8B 4AYBE 1XQ8A 3AG7A 1KYOF 4DK0A 4QW9A 2YIBA 4DIMA 4NTYA 3DAAA 4JAVA 5J2TA 3F7YC 4QWAA 1NR1A 4DUYO 2YS6A 1ZSPA 2DPIA 2CZGA 4J7KA 5BY1A 4EQ5A 3TETA 4FM9A 1Z5WA 4GLXA 1QNMA 2EIMC 3WG7B 3CCEV 5DGBA 4A3FG 4XDJA 2ITCC 2O03A 2PN1A 3CCUV 3QTCA 3ZMZA 4CS2A 3K08A 4DAAA 1YF2A 2YSUB 3WB1A 5C93A 4DUYH 4IAJA 2DAAA 2ZE7A 4I50B 3TK1A 1E4EB 4DV3B 2WA3A 2YXHA 4RUAA 2PBZA 1NH2D 1AI5A 4BIZA 3CVZA 3ASNB 2EJ3A 1FJGB 1AP5A 1MABG 3E2EA 2F93B 2VQFH 3EHBB 4DL4A 2NR5A 4IZOA 1VQ6V 1PK8A 3TY9A 3VQWA 1SQPH 2ZDIA 4I50F 2J6SA 1OCOC 2QWOB 4PV1B 2AZ0A 2FKLA 2CQYA 3ZRVA 2IJHA 4GUNA 3DTUB 2UUCB 5KFFA 3RAXA 2EX3A 4O83A 4X64O 3ORRA 3T9AA 3KXYT 1R3KC 3NBZB 3H20A 1K1QA 5KFUA 5I5UA 2W0XA 2JEGA 1R6KA 3KCXA 3OUSA 2HVRA 3CRQA 1H2SB 4HYKA 2HJWA 2DOSA 2HKOA 3GWKC 3VOTA 1WCMA 2ZT9B 4ECUA 5KMGB 4ECSA 3WWHA 4OPHA 2XD4A 4YJ2B 2AZ2A 1HNZO 4X64H 4JI4H 4NYEA 4A5UB 5KFNA 4DV4O 4MAMA 1Z5VA 1KEEA 2JEJA 1I6UA 1V55B 4DUZH 2YXYA 3E22B 4HN2A 3CSXA 5KT4A 4YY3O 1I3QA 1W59A 4JASA 1NJIW 4W4LA 1K8AW 2R9IA 1M7JA 4JI7O 3JARA 4YJ2F 3FKSG 1JCHA 5EZYA 1HNZH 4OX9B 4I7HA 2UXBO 2H8PC 1HW7A 5KFYA 2C2AA 4DV4H 4TQDA 1VAJA 1M1KW 2IBKA 5C8YB 3K5OA 4CH3A 3VMMA 1N0JA 1GMGA 1Q90D 3QZ7A 2QM7A 2Z02A 3CRAA 3ZCCA 4CKCA 4JI7H 4JI5H 3PO3G 3M99B 4DR2O 1QLNA 1GH6A 4OGQB 2ZJTA 2R7ZA 3CRMA 2UXCB 1DF4A 5C8YF 2C35B 4K3AA 3HOVG 5KFBA 5JJNB 2OTJV 4ZOLA 1G1XB 3KAJA 3R9RA 1JX4A 2Y69B 4DR2H 4PA3A 3OMAB 4BR6A 2HFEC 2VQEB 4AHCA 3I56V 3N2KA 2NUAB 1OCRB 4X1YA 2FB9A 2Y4UA 4O7WA 2YDEA 3RVZA 4U3JA 5KUMA 4A3IG 2XGPA 3HB3B 4NXMH 2XASA 2X6CA 1XL4A 3G6BA 4X62B 3E8BA 4NB5A 1EKFA 3GTLA 1YZBA 1I50A 1KU9A 2EINC 3R66A 4O84A 3RV4A 1NTZH 4TV9A 2VUGA 5KAIZ 4B3TO 2FTKA 5CBGA 4MV3A 4YHHO 3MFIA 1N0NA 4A3LG 3HKDA 5CA0B 3FMAA 3MJFA 3MWEA 3NBYB 5LOVB 1AILA 2OLSA 1QBZA 3EVKA 4ECWA 1Q7YW 1LUVA 3TY5A 4YR3A 4MVMA 5ITZB 4LC1A 1GTOA 5CN0A 4YHHH 2EBOA 3H0GG 3UCSC 2Y0SE 5CA0F 2BQRA 2BTQA 2PMZE 4YB8B 4ED2A 4CC6A 4MV4A 3W7UA 4QE7A 5LOVF 1V51A 1JX9A 2QWRB 2HR3A 5KG3A 3FB6C 3NUAA 2NNUA 2ZR3A 3VQYA 4DW0A 1VQNV 1P16A 2ZDQA 5L1IA 5DQIA 4ED3A 2AGPA 2GTSA 4KFMA 4XDLA 1BL8A 3AW8A 5A2QN 5JUMA 4MS2A 1SF9A 5KHKA 1GN4A 5LHHA 2Q0AA 1XNQB 2Q9LA 1K3EA 2M6YA 3CCSV 5KS8A 2AXTZ 3F5TA 3MWDA 1XMOH 5J2UA 3QFFA 5KFAA 5EIBD 2EIMB 1TGOA 4P9OA 4NKGB 1XNRB 4Q20A 2W6QA 1VBGA 4D7TA 3WWJA 3IJ4A 4MTXA 1M9NA 3KYHC 4O7YA 4EYHB 5B1OA 3K5HA 4J9MA 4QIWF 5FPRA 2LW1A 2J6UA 1D5NA 5FL7G 2QWPB 3HOUG 4LF4B 3AG2C 4I55A 2NU6B 4PHZA 4ICGA 2RDIA 4ED1A 4FGRA 5L3EA 5CE8A 4HNTA 3K5IA 4YAKB 3T1HH 1Q81W 5DQGA 3ML0A 5DEDA 5L1KA 1R6TA 2V4DA 2R93A 3BAAA 1N34H 2YZMA 4IWYA 3CC7V 3PZPA 2CE4A 4HBNA 4E4EA 1OCOB 4J9ZB 4A3GG 1ET0A 4DQNA 2CNQA 2I80A 1WR2A 3O65A 3Q1KA 2W7OA 1DLBA 2CK3G 3NGDA 4PBCA 3OHBA 4QWDA 3SJCC 3G8DA 3JRWA 4QSHA 5CAEB 3WO1A 5DQHA 1YDXA 3ZHUA 4IL6Z 5EIBC 5JH7A 5LMNH 3STLC 1SQQH 4WBNA 1JFFA 1ZLZA 3W1BA 4JI3B 4B3MB 1OV9A 3Q4HA 3SYCA 3VPDA 1UPGA 1DGSA 2ZNJA 4O7VA 4DR3O 2ILMA 4GYCB 5IE9A 1TWHA 1ZL8B 1VF5B 1RJQA 5I5VA 1S0VA 3KZIZ 4J9PA 1Q86W 3ZRSA 2ODMA 3ZN0A 5K2MA 3RR5A 1NH2B 4K35A 3B40A 4P30A 4TQSA 1BT8A 4K6NA 2E2HA 1PPJH 4AI8A 1WA8A 2DYRC 3BG5A 4A3MG 5LYJA 2I8CA 4OPAA 4DR3H 4JI8B 4X66B 5KG6A 2HGWA 1IBLB 2E5LB 1UNNC 5KFDA 5J9PC 2UU9O 3T1YH 2UVWA 2Q7GA 2PVPA 2XOKG 3JAWB 4CS3A 5L1JA 4NTXA 1RJPA 2ATLA 3MR5A 4U7OA 4O7SA 4G3IA 1TUBA 2GUZA 3MHHC 4P9PA 5KFZA 3AK3A 3N2GB 3HB9A 2HVSA 3HOWG 3V6JA 1XILA 1QQCA 3K3VA 3EXAA 4DV6B 2WAQE 2UU9H 2IU0A 2YCHA 2JIZG 3K0DA 2VA2A 5IJ0B 4EGJA 2NVYA 2WTFA 2R9AA 4DR6B 4PI2A 4X20B 1CP9A 5GW7A 1OBDA 3OR6C 3CCVV 2JA5G 4LNUA 3EFFK 4DL7A 4GC7A 4JV2A 4JZ2A 3RT3C 3JD3A 1K1SA 1SQXH 4PDLA 1N33O 3OSPA 2FLNA 1JOYA 4ZHQB 4LFCO 3I55V 4ZIBA 2JGDA 2L6LA 3IAYA 4H33A 3UO3A 5DISC 4EG0A 4H37A 1EN4A 1TVKB 2QA4V 3THOA 5LP6C 3V6HA 5EBWC 2K9PA 4LFAO 1K7DA 4IWXA 2XAQA 3J7AU 3L2PA 2RJZA 1A48A 3H0GA 5FNVB 2XNDG 4LFCH 4BAYA 2YC0A 4EEYA 1CKOA 5KFMA 3SYOA 3Q8PB 1PM9A 4CH6A 2VQDA 1CQJB 1M93A 1WAZA 5DGHA 4NYKA 2FPPB 5CA3A 3FX7A 2LQTA 4JUZA 4DV0H 2OH2A 3I4NG 1N8RW 1FXVA 4FS1A 4DV7B 1JR9A 5FNVF 1MSDA 1OZ0A 5IYDO 2PI5A 3P30A 4Q0YA 2MK3A 4RZQA 2DW4A 1AN7A 5CA1B 5KFGA 2Q4PA 1GN6A 2YUAA 2RMKB 1QVFU 4GT1A 1SQFA 4XZ3B 2HJDA 1S0NA 4P2ZA 3SYPA 1PNMA 5KG2A 4KHPO 1N36O 3ZRXA 5CA1F 5CR5A 4LF5H 2CW7A 2XHBA 3FDSA 2CH7B 3K9SA 4LF6H 3JZ6A 3CMAV 3L72H 3V4SA 3ZRWA 1YSCA 4NZNA 5BWWA 3RYIB 3E35A 3SJAC 4DV2B 3QQMA 4J42A 2C22A 4IHJB 5EYPA 3HBLA 4KHPH 2WLMA 2GPWA 4PZ6A 4TQRA 2I87A 2OIGA 3HOZG 4NR1A 3JYCA 1SQVH 4JPRA 4YIPA 3DXRB 3F8NA 3ZMSA 1J5EB 2W6MA 4JI1O 2CNUA 4HYOA 2IH1C 3MAQA 1XMQH 1G8MA 5LA6B 4FM1A 2ASLA 2R87A 1IBMO 4IHJF 3SI8A 2V1DA 4GKJB 1ZETA 3ZHQA 5DMXA 4F50A 1LR1A 3GWOA 4J41A 1BZKA 4FFBA 3VQVA 5LHGA 4JV5O 3GTPA 5B5EZ 2P4VA 2OCCB 3KCYA 4B08A 3W7SA 2R86A 5LA6F 1XOUA 2J9GA 1S9FA 5DLFA 4BW5A 4DR5O 1PL4A 4UVBA 4APMA 3OW2U 1H2MA 4Z1MG 3QG5A 2YWVA 4CKBA 2XIGA 1H2LA 1XREA 2ZIMA 3I5DA 4JZGA 1IBKB 2BOCC 4CS4A 4F4YA 4FVMA 2A9HA 5LGUA 1AJQA 4DV5B 2AU0A 5KA5A 4X1IB 4A3JG 1NTMH 4DR5H 1KB9F 4LF9B 2JS3A 1Z2OX 1JXLA 3CEIA 1AR5A 2DWCA 3GIMA 1N32O 3DC6A 2R70A 4ECZA 3HKBA 3LP8A 3N42B 3CXHF 3ZMTA 5CB4A 3OM3B 3KHRA 4DR4H 1I1MA 1H2GA 2UXXA 3JATB 2YI9A 2FJZA 4Q8FA 4JV0A 3PW7A 4DYLA 4TM5A 4PA7A 5C5JA 4EBCA 4UVCA 5BWRA 3C0FB 1QLEC
chains in the Genus database with same CATH topology
2VQFH 4EEQA 5LA6A 1VS0A 5KHGA 2HHHH 4PDBA 1FVIA 4O4IB 2ZM6B 4M7EA 5IWAH 4ZI7A 3TY9A 1XK5A 3VQWA 4R7RA 4LF4H 3JSLA 1O9GA 3J80W 1P49A 2UUCB 4WBNB 1JFFB 1SA0A 5FLXW 2EX3A 4ZOLB 2OWOA 2F4VH 3KXYT 3UT5A 3OTOH 4LFBH 3NBZB 3H20A 1XHZA 4OX9H 1HR0H 4D7SA 1S03G 2HVRA 3N2GA 1H2SB 4NXNH 4X65H 3SR2C 5K1PA 2ZNIA 3QF7A 5GONB 5KMGB 2UUAB 4X1KB 1N32B 4HNAB 4YJ2B 4U3JB 4LSAA 4X64H 4JI4H 5IJ0A 3TY8A 3RFRA 5IWAB 1Z5VA 1X4TA 5KHJA 5LYJB 1KMIZ 4LFCB 1I6UA 4DUZH 4X20A 3E22B 3CSXA 4LF7H 4JI6H 3RYCB 2PY5A 4F6RA 4PI0A 3JARA 5D5PA 4DV0B 4JI3H 3JALA 4B3MH 5EZYA 1HNZH 4B3RH 4OX9B 4I7HA 3HKDB 1HW7A 3A2FA 1NT2B 4DR1H 4DV4H 4TQDA 3JATA 5IJ9A 3RYHB 5C8YB 3K5OA 4CH3A 2P5OA 1TVKA 1HNXH 4JI7H 1Z2NX 3LMLA 4JI5H 5LXTA 5A2QW 3N6XA 4O4IA 5FNVA 3K5LA 2BTQB 2WE6A 3JSNA 2RQ6A 2ZJTA 4BWSC 2UXCB 4JI8H 5JVDB 4JI6B 4LNUB 3B2EE 1IBLH 4B3SH 5D1OB 2E5LH 5JJNB 5LMUH 4LF5B 3K5NA 4ZOLA 3KAJA 4K8ZA 1HNZB 4LF6B 4B3RB 3IG0A 5JJJB 5EOYA 4DR2H 4GKKB 2PUSA 3ZEDA 4MTEA 2RGRA 3HKEA 3JAKB 2VQEB 4AHCA 3N2KA 1Z2PX 4O4LB 4O2AB 4YY3B 4X1YA 5KMGA 1SYXB 4KHPB 3KALA 4DV6H 2YIAA 4HNAA 4EFEA 4U3JA 3VNNA 5J2UB 4K8XA 1BJTA 1ZAUA 2UXBB 2YIBD 4NXMH 4JI0H 4X62B 1XMQB 4K0KB 3W5OA 4DR6H 1WPBA 2OYQA 1KU9A 4I9QA 4IIJA 2F66C 3RYCA 4TV9A 2VUGA 3HKCA 5KHHA 5LP6A 5FD6A 5FD5A 4I55B 1XI1A 5LL6b 3N41B 1XHXA 3HKDA 2ZIOA 5CA0B 3FMAA 4JI2H 3RYIA 3RYHA 3NBYB 4O4JB 5LOVB 5C8YA 4PZ7A 1M0WA 4I4TA 4IHJA 1XNQH 4O2BB 2CFMA 3TY5A 2CW8A 3SGIA 5ITZB 1WH2A 4YHHH 4A2BA 1ZHQA 4RAYA 4JI0B 2BTQA 5IYZA 3RTXA 4DRXA 4CC6A 5JCOC 4MV7A 4RB1A 2FE3A 1WN7A 5JQGA 1HNWH 4DR5B 3VQYA 1P16A 3N40P 4O4HB 4DV7H 3JASB 5JH7B 4TUYB 1Q5OA 4BW9A 5BMVB 1FFXA 1V9PA 4BWAA 5KHKA 3L4JA 4DUYB 2Q0AA 1XNQB 5EYPB 4DR4B 4B3TB 4MTDA 4EFBA 1XDNA 3WB0A 1XMOH 5J2UA 4YHHB 4CH4A 5BR8H 2WDTA 3GDEA 5EIBD 1N33H 1TGOA 1XNRB 4LH7A 1X9NA 4D7TA 2VQFB 3KYHC 2HHHB 3ETQA 5K1XA 2KKWA 5FPRA 4X1IA 4LF4B 4LFAH 4FFBB 4RB2C 4I55A 2UUBH 4PHZA 4ETSA 5FPOA 2HGSA 1FKAH 4JYAH 3GB8B 2F4VB 3RGZA 4FLXA 3RJ0A 3T1HH 5LOVA 3OTOB 1TA8A 4LFBB 3N44B 4EB6B 4DV2H 2PTMA 1HR0B 2V4DA 3BAAA 1N34H 4O2BA 2JGUA 3N43B 1TUBB 3RYFB 4I50A 1P8LA 4NXNB 4X65B 4HBNA 5BR8B 2HEPA 4AQYH 3CB2A 1A0IA 4CH5A 5D5QA 1J5EH 4AILC 2RGVA 3RGBA 4X64B 4JI4B 5J2TB 3RIZA 2BTOA 1I94H 3K57A 2UXDH 2IM9A 4DUZB 3WB2A 1B04A 4UCRA 3SJCC 2KSWA 4LF7B 4X66H 4DK1A 4LF8H 3JASA 5EIBC 5JH7A 5LMNH 4WBNA 1JFFA 3W1BA 1E4FT 4JI3B 2P22C 5BMVA 4B3MB 2HIXA 3M4IA 2Q7EA 4DR1B 1DGSA 2ZNJA 4DV4B 3W1GA 1N36H 1YEWA 4GYCB 4UCUA 4AQYB 3NC0B 1CKNB 3CHXA 5GONA 2WYOA 3HXLA 4X1KA 1HNXB 3RR5A 4JI7B 1IBKH 4YJ2A 2HVQA 2PYJA 4JI5B 3BRCA 4UCOA 2VOBA 2HIVA 2PYLA 4ZI7B 5LYJA 1D5AA 4DV5H 1SQGA 3U11A 4DR3H 4RB0A 4JI8B 1M5IA 4X66B 3E22A 4B3SB 1IBLB 2E5LB 4LF9H 1M4UA 3T1YH 5LMUB 2Q7GA 4DV1H 4JI1H 3ZS8C 3JAWB 1SA0B 4CS3A 2PGGA 3RGXA 2PZSA 3UT5B 4LH6A 4DRFA 4FM2A 4DR2B 4FLTA 1IBMH 1TUBA 3N2GB 2HVSA 2YXLA 3ICXA 1QQCA 1VF7A 3K3VA 1T5EA 4TV8B 4DV3H 4DV6B 2VPSA 2UU9H 4UCSA 4JV5H 4FM0A 2YCHA 1FJGH 4LR3A 3K59A 5IJ0B 3DSQA 4NXMB 2ZM6H 2R9AA 3FFQA 4DR3B 4DR6B 2QM4A 4PI2A 4X20B 3U10A 4LSXA 2JS5A 5JVDA 3LNNA 4LNUA 5D1OA 1Q3EA 4DV1B 2CAZC 2UUCH 1WNSA 4FLVA 2MCTA 5EZYB 2VWKA 3K58A 4JI2B 4ZHQB 3JAKA 4LMYA 4ZIBA 5IJ9B 3IAYA 2QJ1A 4E6NA 5DISC 1CKNA 4O4LA 4O2AA 2YI8A 1TVKB 3THOA 5LP6C 1N32H 3DF7A 5LXTB 3L2PA 2RJZA 5FNVB 4FLZA 4LFCH 1CKOA 4UCTA 4YJ3B 4CH6A 1I7FA 1HNWB 1M93A 4RAZA 3JAWA 2GV9A 1GYFA 4TOIA 4TQFA 3JAMW 4DV0H 4DV7B 5CA0A 2VWJA 3HKEB 1Q43A 5D1PA 3VQXA 4FLYA 1JMKC 4PZ8A 3N2KB 4O4JA 4Q0YA 1ZHSA 4TV8A 4X1YB 4RZQA 5KX5B 1AN7A 5CA1B 5KHIA 2ZINA 1JJOA 1XMOB 5ITZA 1O9HA 3BPZA 2F1MA 3SJBC 1SQFA 1N33B 1G6UA 1CKMA 3PN1A 3M7MX 2UXCH 2R72A 3GJXB 4KL1A 1M0TA 4IIJB 4TV9B 3HKCB 4LF5H 4GKJH 5LP6B 4LFAB 2CW7A 2XHBA 1RSOA 4LF6H 2UUBB 4JYAB 4O4HA 4GKKH 1TAEA 4ZHQA 4TUYA 3T1HB 2VQEH 3RYIB 3SJAC 3HKBB 4DV2B 3BA8A 4I4TB 1N34B 4IHJB 4YY3H 3KAKA 5EYPA 5CB4B 3J7AK 4KHPH 4PZ6A 4DR7H 1L8DA 3MWMA 3QWUA 2E3CA 2UXBH 4FLWA 5JJEB 3F8NA 1SEIA 1J5EB 5IYZB 3BA9A 3MAQA 4X62H 1XMQH 4K0KH 3BHPA 4DRXB 3U0ZA 5LA6B 4FM1A 1SKVA 5JQGB 1I94B 4YJ3A 4NVPA 1MZBA 3BABA 4UFZA 2UXDB 4GKJB 2ZCEA 3UQ8A 3RWRD 4FFBA 2F95B 4LF8B 3VQVA 3L4KA 2Q7HA 2W57A 5LMNB 3RF2A 3S24A 4J0MA 4B08A 1FFXB 4EB6A 3K5MA 1O75A 1E4GT 5JCOA 5KX5A 3EYYA 1N36B 1QHTA 5CA1A 5IT9W 3RYFA 4DR7B 4APMA 4CC5A 3J81W 3QG5A 1XQ8A 2XIGA 4DK0A 2ZIMA 2Q2TA 2YIBA 1IBKB 4MV9A 4CS4A 1L2ZA 5J2TA 4FVMA 1S5JA 4DV5B 4X1IB 4L8JA 4EQ5A 4FM9A 4DR5H 1Z5WA 4GLXA 4LF9B 1Q8IA 3T1YB 1Z2OX 3OTFA 4JI1B 4F6RB 2O03A 3JARB 2R70A 3QTCA 3HKBA 1S68A 4RB3C 4CS2A 3JALB 2Q2UA 4FLUA 1IBMB 3WB1A 1BGWA 3N42B 4A2AA 5CB4A 4IAJA 4DUYH 4DR4H 4B3TH 4I50B 3JATB 2YI9A 4Q6GA 4DV3B 4UCVA 4JV5B 2UU9B 3CVZA 2UUAH 3C0FB 1XNRH 1FJGB 2JVDA 2F93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEQ A;  4B3M B;  2HIX A;  2VUG A;  1VS0 A;  1FVI A;  4DR1 B;  1XMO B;  1DGS A;  2ZM6 B;  4DV4 B;  3W1G A;  3TY9 A;  1XK5 A;  1N33 B;  4UCU A;  4AQY B;  3JSL A;  3NC0 B;  1CKN B;  1CKM A;  3PN1 A;  3NBY B;  2UUC B;  1HNX B;  3GJX B;  3RR5 A;  4JI7 B;  2OWO A;  2HVQ A;  4PZ7 A;  4JI5 B;  2CFM A;  3NBZ B;  4UCO A;  3TY5 A;  2HIV A;  4LFA B;  3SGI A;  2UUB B;  2HVR A;  4JYA B;  4JI8 B;  1TAE A;  4JI0 B;  4X66 B;  4B3S B;  1IBL B;  3T1H B;  2E5L B;  3RTX A;  2UUA B;  5LMU B;  4CC6 A;  4DV2 B;  1N32 B;  3BA8 A;  1N34 B;  4LH6 A;  4DRF A;  4DR2 B;  4DR5 B;  4PZ6 A;  3TY8 A;  5IWA B;  1P16 A;  4LFC B;  3QWU A;  2HVS A;  1J5E B;  3BA9 A;  4DV6 B;  4UCS A;  1V9P A;  4DUY B;  1I94 B;  1XNQ B;  4DV0 B;  3BAB A;  4DR4 B;  4UFZ A;  4B3T B;  4EFB A;  4GKJ B;  2UXD B;  4OX9 B;  1XDN A;  3UQ8 A;  4NXM B;  4YHH B;  4DR3 B;  4DR6 B;  4LF8 B;  3GDE A;  5LMN B;  1XNR B;  4LH7 A;  1X9N A;  3S24 A;  2VQF B;  5D1O A;  4DV1 B;  3KYH C;  2HHH B;  5FPR A;  1N36 B;  4DR7 B;  4LF4 B;  4CC5 A;  4JI2 B;  3JSN A;  5FPO A;  2UXC B;  4E6N A;  5DIS C;  2Q2T A;  3GB8 B;  4JI6 B;  2F4V B;  1IBK B;  1CKN A;  5D1O B;  3OTO B;  4LFB B;  1TA8 A;  4LF5 B;  1HR0 B;  3BAA A;  4DV5 B;  1HNZ B;  4LF6 B;  4B3R B;  4EQ5 A;  3L2P A;  1P8L A;  4GKK B;  4NXN B;  4X65 B;  5BR8 B;  4GLX A;  4LF9 B;  2VQE B;  1A0I A;  3T1Y B;  1CKO A;  4JI1 B;  4YY3 B;  4UCT A;  4X64 B;  1S68 A;  4JI4 B;  4KHP B;  1HNW B;  2Q2U A;  3W1B A;  4EFE A;  1IBM B;  4TOI A;  3VNN A;  4DUZ B;  1ZAU A;  2UXB B;  4DV7 B;  1B04 A;  4UCR A;  4DV3 B;  4LF7 B;  5D1P A;  4X62 B;  1XMQ B;  4K0K B;  3W5O A;  4UCV A;  4JV5 B;  2UU9 B;  4PZ8 A;  1FJG B;  4JI3 B; 
#chains in the Genus database with same CATH topology
 3OTO O;  4LFB O;  4EEQ A;  1H8H G;  2B5U A;  1VS0 A;  5KHG A;  1FVI A;  2ZM6 B;  1JPX A;  4J9Q A;  3ZIA G;  3WU2 Z;  4NXN O;  3JCU Z;  1SFO A;  4RAI A;  1GM8 A;  3BQ2 A;  3J80 W;  1KBH A;  1P49 A;  4Q4D A;  1ZQ7 A;  3W7X A;  2W70 A;  3X2Q B;  1R3J C;  4PA9 A;  2GTA A;  2XTA A;  3OTO H;  4O3Q A;  4LFB H;  2FKX A;  3LQS A;  3DTF A;  5IDJ A;  1HR0 H;  3H3V H;  3L75 H;  2R84 A;  3GV5 B;  4NXN H;  2QWQ B;  4LF7 O;  3SR2 C;  2ZNI A;  3QF7 A;  3AK1 A;  4X1K B;  4FMT A;  4QPK A;  3TCU A;  4HNA B;  3JD0 A;  4BIU A;  2Y69 C;  3Q8Q B;  5E25 A;  4EGQ A;  5TIS Z;  4UXN A;  5L3C A;  4QJF A;  1KMI Z;  2R7Z G;  2DAB A;  2B63 A;  2RCV A;  5IT9 N;  1OCR C;  2QKC A;  3T4D A;  4F4L A;  4LF7 H;  1IDS A;  3RYC B;  1I7N A;  4PI0 A;  3OR7 C;  5D5P A;  1JDB B;  1L0L H;  2W6Z A;  5H6R A;  4MVR A;  2EIL B;  1NT2 B;  1Y74 B;  2KQX A;  3SYA A;  1NQT A;  5IJ9 A;  3RYH B;  2VPQ A;  3OEH G;  2FML A;  1B6Q A;  1AB3 A;  5LMU O;  1Q82 W;  4EBD A;  1SZX A;  2W6I G;  2WAM A;  1Z2N X;  2YYA A;  3LML A;  3GV7 B;  1XBL A;  4U6P A;  4G28 B;  2IJI A;  1EN5 A;  3APO A;  5L3B A;  2AQ4 A;  3CWB H;  3K5L A;  2R85 A;  3I12 A;  2RQ6 A;  3KTM A;  1YJW V;  2VUM A;  1DIK A;  3RB6 A;  1PL0 A;  4O7T A;  4B3S H;  5D1O B;  4JYC A;  4A3B G;  5BPH A;  2W7P A;  1HDJ A;  5LMU H;  3GTQ A;  1MG1 A;  3K5N A;  1GK9 A;  2GSM B;  2XAG A;  1HNZ B;  1VF6 C;  1RM1 B;  3IG0 A;  2Y0S A;  2PUS A;  4WFB V;  2PMZ A;  4MTE A;  3HKE A;  4CE5 A;  2W9A A;  3JAK B;  3N8D A;  5B66 Z;  4O4L B;  4O2A B;  4YY3 B;  5KMG A;  4MSW C;  4NLG A;  3AX6 A;  2ARH A;  1KKC A;  3L73 H;  4EFE A;  1NKD A;  1VQ9 V;  4K8X A;  1PNK A;  2C2R A;  1TUE B;  2V7Q G;  1ZAU A;  2UXB B;  2Y0P A;  1AR1 B;  3BEH A;  2CNV A;  1A9X A;  3CP1 A;  5IYD G;  1VQP V;  1W0K G;  1KEC A;  3ABK B;  5BZB A;  4I9Q A;  4O4L F;  1NVP B;  4IIJ A;  4O2A F;  5KHH A;  1SS3 A;  5FD5 A;  4HNU A;  4DL2 A;  5LL6 b;  4FJC C;  1XHX A;  1AR4 A;  4J80 A;  4I0X B;  1EFR G;  3OMN B;  2DIK A;  2VQF O;  1MSW D;  5C8Y A;  3R5X A;  5I5S A;  4PZ7 A;  4I4T A;  3ZMV A;  4LWS B;  4O7R A;  2HDK A;  1VQK V;  2CW8 A;  2Z3Y A;  4G27 B;  3T99 A;  1KC7 A;  1WH2 A;  4QW8 A;  4GX2 A;  5IYZ A;  3ZHT A;  4A3E G;  3FB7 C;  4XDK A;  1S10 A;  1B6S A;  4DL6 A;  3G71 V;  1H2K A;  2M7W A;  2RNB A;  5JCO C;  4D6T H;  1WB7 A;  4RB1 A;  5JQG A;  5BXZ A;  3DC5 A;  3N40 P;  4RNN A;  5BR8 O;  3D36 A;  1R9T A;  2DWE C;  2X6A A;  1B3Q A;  4TUY B;  3QO5 A;  3TQ1 A;  3FYI B;  4ZBM A;  4JI4 O;  4JTC B;  5IY5 B;  1FFX A;  4BWA A;  4IR9 A;  2R93 G;  2QTS A;  4X8A A;  4Z2W A;  4B3T B;  4FFL A;  1XDN A;  4DUZ O;  2Q68 A;  4YHH B;  5F9L A;  5BR8 H;  2WDT A;  4JYA O;  2EJ0 A;  4IGG A;  1X9N A;  4ASU G;  1OCZ C;  4TUY F;  2E2I A;  2A06 H;  3FAV A;  5E1A C;  2O57 A;  2HHH B;  5K1X A;  2KKW A;  1JIH A;  3UZB A;  2JJ2 G;  2YS8 A;  1Q6H A;  3TII A;  4AQY O;  2ASD A;  3E5N A;  3M9M B;  2J6T A;  2UUB H;  5FPO A;  2DZD A;  2HGS A;  4JYA H;  3CJH B;  5HBR B;  2F4V B;  3G4S V;  2P7T C;  3SNO A;  3RGZ A;  4JI5 O;  1QLE B;  5LOV A;  4EKW A;  3A0H Z;  2PTM A;  4WFF A;  4FE2 A;  4J9O A;  4FBU A;  3RYF B;  3OUZ A;  1P8L A;  3ABM C;  2ZE6 A;  3RFC A;  2QKS A;  2ZDG A;  4X65 B;  1T3N A;  4UV8 A;  5KT2 A;  4AQY H;  3CE2 A;  4FBT A;  2JEU A;  3LUT B;  3D8C A;  1KD1 W;  1A0I A;  2A1H A;  2FP4 B;  5D5Q A;  5AG2 A;  2DJV A;  2EJ2 A;  4AIL C;  4M0J A;  3RGB A;  1I08 A;  5J2T B;  3RIZ A;  2BTO A;  4GZR B;  5KAF Z;  2IM9 A;  2W6N A;  3PFF A;  3WB2 A;  4UCR A;  2GQS A;  1RFY A;  2KSW A;  1GM7 A;  2ZKO A;  1IXB A;  1MA1 A;  2YZL A;  1KUT A;  4FFM A;  3K0G A;  2WAQ A;  4LF8 H;  1IZ3 A;  4TT3 G;  4J7Z A;  3M9O B;  1YI2 V;  5J2T F;  3M4I A;  1JQ0 A;  3E8H A;  5BWX A;  4DR1 B;  4IYI A;  4NXM O;  4YR2 A;  1EKV A;  2Q69 A;  4UCU A;  3MR6 A;  3GTM A;  4PWQ A;  3Q8R B;  3CHX A;  1CE8 A;  2N74 A;  5GON A;  4DV1 O;  1KC8 W;  2WYO A;  3V6K A;  5DM6 V;  1HNX B;  1S72 V;  5KFR A;  3K3W A;  2PYJ A;  3BRC A;  1P7B A;  1TWG A;  2ABJ A;  4JV1 A;  2VOB A;  1D5A A;  1SQG A;  2LW7 A;  1M5I A;  1SRY A;  2HHF B;  2HLD G;  5H9C A;  5C1O A;  3JZI A;  3FKI A;  4DV1 H;  4LP8 A;  2EIY A;  5CMU A;  2PGG A;  5CBH A;  4LCU C;  2B1I A;  1GRJ A;  1FXK C;  3G67 A;  4HNV A;  5HFL A;  4FS2 A;  2IJJ A;  4DV3 H;  1T5E A;  4TV8 B;  4UCS A;  5KA6 A;  3ZHS A;  1FJG H;  1RK5 A;  3DSQ A;  3T5K A;  1WRV A;  1FPO A;  1WP8 A;  5KUK A;  4DR3 B;  2QM4 A;  1GLV A;  1I2K A;  3ETH A;  5JVL A;  5KFQ A;  3KHG A;  3U10 A;  1EZ1 A;  3K3P A;  2JS5 A;  5JVD A;  4O7N A;  1ZWI C;  1Q3E A;  4TV8 F;  2V4Q A;  2X5R A;  1MZF A;  2R7K A;  5KG4 A;  2UUC H;  5LGT A;  1XMO O;  4FLV A;  1SET A;  1KBL A;  5EZY B;  4RZR A;  2VWK A;  5FR9 A;  4JI2 B;  2VRZ A;  1EHI A;  3F5W C;  3OUU A;  3JD4 A;  3VBB A;  2ITD C;  3PW5 A;  2YID A;  5B1A B;  3OHA A;  3CCQ V;  4A3K G;  2X6B A;  2OT5 A;  4MVQ A;  5EZY F;  2M05 A;  4IR1 A;  3T1H O;  2W6J G;  3NXS A;  3B8N A;  4ECR A;  4PA6 A;  2BOB C;  4YJ3 B;  1VIB A;  1N34 O;  2Y4R A;  1I7F A;  1HNW B;  4JXU A;  3JAW A;  1GYF A;  4TOI A;  2WLL A;  3GID A;  5KT3 A;  3V4Z A;  1UFI A;  2VWJ A;  1EBO A;  1YIT V;  5B1N A;  2UXC O;  1Y4M A;  3N2K B;  4O4J A;  1Y67 A;  1S5H C;  1SCU B;  1EKP A;  1L1F A;  4X1Y B;  4O3N A;  3JD1 A;  1KUQ A;  4YJ3 F;  2DLN A;  2ASJ A;  1ARO P;  1BXR A;  4X9Q A;  5BWT A;  1HP8 A;  1N33 B;  2JJ1 G;  3N27 A;  3SJB C;  3WWI A;  5LMN O;  5JQW A;  2JA6 A;  1F23 A;  4WF9 V;  2VQE O;  1W2B U;  2JRI A;  2OCC C;  5LGN A;  4H0L B;  2WLN A;  3OSN A;  2UXC H;  4FU0 A;  4PD4 F;  1R6N A;  4TV9 B;  1BHA A;  1SZT A;  4DR7 O;  1V54 B;  5KG7 A;  4LFA B;  1AJP A;  1Y1W G;  1RSO A;  1JDE A;  2WPD G;  2YZN A;  4O4H A;  2R8K A;  1TAE A;  4ZHQ A;  4B7K A;  1FFT B;  2VQE H;  1OCZ B;  5DAA A;  2QTO A;  4R50 A;  1K83 A;  2P67 A;  4TV9 F;  4JTD B;  4CZZ A;  3MD0 A;  4DR7 H;  2YS7 A;  1F51 A;  1L8D A;  4N21 A;  1YTF B;  2Z04 A;  2C28 A;  3T1Y O;  4FLW A;  4QGP A;  2WLH A;  2ZD9 A;  1SES A;  3BA9 A;  2A0L A;  3L71 H;  5LBQ A;  2GLT A;  3BHP A;  3U0Z A;  1YVW A;  4X62 H;  3PR4 A;  4KXR A;  4QWE A;  1I94 B;  4NVP A;  1MZB A;  3T54 A;  3BAB A;  1GN3 A;  2UXD B;  4ABM A;  2R82 A;  2UXN A;  2W9B A;  3RWR D;  3ABM B;  2F95 B;  3T9F A;  2IW5 A;  3L4K A;  3UM7 A;  3W7T A;  3RF2 A;  3S24 A;  2N05 A;  5KG5 A;  4J0M A;  1NR7 A;  2R8I A;  3FB8 C;  4EB6 A;  2XAF A;  1Q6I A;  3KG2 A;  1CXZ B;  3K5M A;  1E4G T;  3EYY A;  1N36 B;  5CA1 A;  3A0R A;  3CCJ V;  2YW2 A;  4R8C A;  1VP7 A;  3J81 W;  1DAA A;  2W6P A;  5H80 A;  2ETN A;  5BYB A;  1RPO A;  5BWV A;  3R5F A;  3X2Q C;  3WO0 A;  2Q2T A;  3DGE A;  4MV9 A;  2R7M A;  3SPH A;  1L2Z A;  3A8T A;  3BY6 A;  1Y66 A;  3CXC U;  1S5J A;  3W7W A;  4QIW E;  3BJY A;  1PKX A;  3CPW U;  3U9S A;  3CC4 V;  4YBZ B;  2CH7 A;  1B33 N;  3H4D A;  2BE3 A;  4JYY A;  1Q8I A;  5E79 Z;  2UUA O;  4MV6 A;  2LJ2 A;  4JI1 B;  1XNR O;  4F6R B;  4JF3 A;  3P3N A;  4J9Y B;  4RB3 C;  3JAL B;  1WLE A;  5F9N A;  4RU9 A;  1IBM B;  1K34 A;  5IWA O;  1BGW A;  3T9E A;  2EJ7 A;  1K33 A;  5L1L A;  3IC7 A;  4Q6G A;  3TIG A;  5KFW A;  1EM1 A;  2EJR A;  4UCV A;  4JV5 B;  1EUD B;  1UC9 A;  5HNE A;  2UUA H;  4MVS A;  1XNR H;  2JVD A;  4DV0 O;  5LA6 A;  2OIE A;  2EIL C;  4O4I B;  1NBM G;  4M7E A;  1NTK H;  5IWA H;  4ZI7 A;  2HG8 A;  3PO2 G;  1V4Y A;  4R7R A;  4LF4 H;  1FXK B;  2B63 G;  1NVP D;  5K3W A;  2DN9 A;  1K5S A;  4WBN B;  4HR7 A;  1JFF B;  1SA0 A;  2QGN A;  2OWO A;  5FLX W;  1XEQ A;  2BR0 A;  3UT5 A;  1GSH A;  2ALZ A;  3Q4H B;  2AHZ A;  4O4I F;  4D7S A;  1S03 G;  4PJ0 Z;  4DL5 A;  2X0S A;  3O9O A;  1KP2 A;  4JI6 O;  4C5B A;  1YJN V;  4UUG A;  4MVZ A;  1S5L Z;  2QKA A;  4LF5 O;  1N32 B;  4WBN F;  4R8U B;  4J9R A;  3HKZ E;  1RM1 C;  4LF6 O;  3R65 A;  4B3R O;  3NR7 A;  2SCU B;  3PW4 A;  5LYJ B;  3VPB A;  4FFO A;  2ZR2 A;  5IYB O;  2VUM G;  4ECY A;  3H40 A;  3QNE A;  4JI6 H;  2CKZ B;  2P6J A;  4MW3 A;  4U3F H;  3ETE A;  1OHH G;  2FLP A;  4JI3 H;  4B3M H;  2W0F C;  3I4M G;  4B3R H;  3BQ0 A;  1RPR A;  2V5A A;  2GUZ B;  5LYJ F;  5B3S B;  1XMQ O;  2N04 A;  3ABK C;  3JAT A;  3SPJ A;  2JEX A;  3P32 A;  1K97 A;  2KG7 B;  4JI8 O;  3LUL A;  3U9T A;  1IBL O;  4Q4C A;  3BAC A;  3GII A;  5JWP A;  1VQM V;  3CEB A;  1RP3 B;  4CMD A;  5LXT A;  3CQZ A;  3N6X A;  4PDV A;  3WFV A;  2WE6 A;  3JSN A;  2DWD C;  4JI8 H;  5KT7 A;  4LNU B;  3B2E E;  1KJJ A;  1IBL H;  1ROP A;  2E5L H;  4DV6 O;  3CD6 V;  2FL4 A;  4M9U A;  2FK3 A;  2CTW A;  1KTA A;  1Y1W A;  2EZO A;  2YRW A;  5EOY A;  4GKK B;  3ZED A;  1VQ8 V;  4JI0 O;  1GO3 F;  2YEV A;  2QK4 A;  2JGD B;  2QDO A;  1SC5 B;  3MHS C;  2DE0 X;  5LHI A;  1SYX B;  1FD9 A;  3OAA G;  2HVJ C;  3OGI B;  3KAL A;  4DV6 H;  4HNA A;  3J80 N;  4ED6 A;  3VNN A;  3AK2 A;  4W4K A;  1BJT A;  2YIB D;  4O81 A;  1FXH A;  3RV3 A;  3ETG A;  5EBM C;  4JI0 H;  5GTH Z;  2OCH A;  3G6E V;  1YJ9 V;  1LNQ A;  4K0K B;  3JZF A;  1Z2G A;  5IY5 C;  5KG0 A;  4DR6 H;  2NLJ C;  3S3W A;  2F66 C;  3RYC A;  4BY1 G;  2ADP A;  4DR4 O;  3HKC A;  4J9S A;  4PEL A;  5LP6 A;  3ASO C;  1GSA A;  5FD6 A;  5DEC A;  5EDW A;  2LGW A;  2XAJ A;  2AGO A;  2IBZ H;  1XI1 A;  3N41 B;  5H2F Z;  1DK1 A;  4EBE A;  3BFR A;  2ZIO A;  4RQF A;  3D3Q A;  1XUQ A;  5KFP A;  4F4X A;  4MTF A;  3RYH A;  2GBO A;  2JEI A;  1AJN A;  3H1L H;  4O2B B;  2CFM A;  2XUM A;  3SGI A;  2NU8 B;  5KFL A;  4A2B A;  1ZHQ A;  4DL3 A;  2QF7 A;  1G4Y B;  1XL6 A;  5EK0 A;  4RO2 A;  3RTX A;  4DRX A;  3OEE G;  4MV7 A;  3SPG A;  1WN7 A;  1HR0 O;  5KT5 A;  3HPL C;  4DXW A;  4O2B F;  4MVO A;  1AUV A;  1Y14 B;  1YXB A;  1MNG A;  4DV7 H;  5IP9 G;  3JAS B;  4PDM A;  2CGN A;  4BW9 A;  5BMV B;  1G2W A;  3RB4 A;  3L4J A;  4DUY B;  2Q0O C;  4GX1 A;  5EYP B;  5BYA A;  4TVI A;  2DYS C;  3RUP A;  4CH4 A;  2WLI B;  1FKA O;  1PX2 A;  3GDE A;  2EUL A;  2BCC H;  2C2E A;  1B6R A;  3GTJ A;  2VQF B;  1IVS A;  1BS3 A;  5BMV F;  1KJQ A;  3Q8S B;  1WB8 A;  3H4B A;  3R23 A;  3ABL B;  2VR1 A;  4FFB B;  4RB2 C;  5KG1 A;  1BNC A;  1AP6 A;  1EN6 A;  4ECT A;  4ETS A;  1FKA H;  1OCC C;  3GB8 B;  4Q8E A;  5KFH A;  3RJ0 A;  4ED8 A;  2P0A A;  3N44 B;  4DV2 H;  1KJI A;  1GAX A;  1YCI A;  2UVR A;  2ZDI C;  3N43 B;  3RW0 A;  4I50 A;  1K9M W;  5BR8 B;  1E4E A;  2HEP A;  4B3S O;  1J5E H;  3AG4 B;  3QO7 A;  1TWF A;  3CRC A;  5GTI Z;  4X64 B;  3OMI B;  1Y76 B;  4JI4 B;  1DV1 A;  5LL6 Y;  1NI8 A;  1K73 W;  4I5S A;  3K57 A;  2Z5U A;  4DUZ B;  1B04 A;  2GHY A;  1BCC H;  4IRK A;  1IXM A;  2OTL V;  3C90 A;  1CS0 A;  3H1J H;  2GPS A;  4DK1 A;  1A0G A;  2FLL A;  3FKI G;  2QWN B;  1IBK O;  2CGO A;  1E4F T;  3C3S A;  3H01 A;  4FZ0 A;  2Y0I A;  2ZGI A;  4DV4 B;  4WFH A;  4GCZ A;  2COI A;  1YEW A;  2JK5 C;  1CEZ A;  5DLG A;  3BVO A;  2JDI G;  1VQO V;  3N6R A;  4AQY B;  4LF9 O;  1CKN B;  1XDC A;  4HQ6 A;  4A3D G;  1ORQ C;  3HXL A;  4GLW A;  4JI7 B;  3ZMU A;  4YJ2 A;  1IBK H;  2HG5 C;  1ENV A;  4JI5 B;  3LDE A;  2XCL A;  2HIV A;  4YXW G;  3T9B A;  2B1G A;  2PYL A;  4DV5 H;  5HFM A;  3U11 A;  1ZUQ A;  2KB1 A;  4C2M A;  3E22 A;  2FPI B;  4LF9 H;  1M4U A;  3CJH A;  3IC9 A;  5B1A C;  3ZS8 C;  1S0O A;  1R3L C;  1M90 W;  4LH6 A;  4DRF A;  1P4R A;  4FM2 A;  4DR2 B;  1C3O A;  5HV6 A;  5EWG A;  2ZM6 O;  3CCR V;  3GIQ A;  3FYE B;  3LDC A;  4FFR A;  1AUX A;  5IYB G;  3C3T A;  2B9Z A;  4O7Z A;  2YXL A;  4QWC A;  4WCE V;  1VF7 A;  2ODT X;  3CSW A;  2WB1 E;  1M56 C;  3JAM N;  2VPS A;  1VMG A;  1GSO A;  4FM0 A;  2W9C B;  3L9D A;  1YTF D;  4LR3 A;  1ZX3 A;  3K59 A;  2R7N A;  1BMF G;  1VQL V;  4E4T A;  4NXM B;  2D2C B;  4QJF B;  2ZM6 H;  1EUC B;  1YIJ V;  1H2N A;  5T14 A;  4UB6 Z;  2KSD A;  2QSA A;  1E1Q G;  2EIK B;  3GIK A;  3LNN A;  4DV1 B;  2QM8 A;  2YIC A;  2XC9 A;  5DGA A;  1RYR A;  1JLL B;  2CAZ C;  3UZO A;  1BHB A;  2R7L A;  1WNS A;  3CCL V;  4XYM B;  2MCT A;  4RNM A;  3RVY A;  1RJR A;  3PR5 B;  4NTW A;  3K58 A;  5EC1 C;  4UUJ C;  1IOV A;  1SQB H;  4LMY A;  3GTG A;  5IJ9 B;  3B4S A;  3K04 A;  4B7E A;  2YI8 A;  2CUG A;  1V54 C;  1AI4 A;  3DF7 A;  4PA4 A;  5H5N A;  3ASO B;  2UUB O;  3SYQ A;  1EZJ A;  2JA6 G;  4FLZ A;  2XCA A;  5C1P A;  2HHF A;  3UO2 A;  4XYL B;  5FJ8 G;  3SDL A;  2W71 A;  5I5Y A;  1BSM A;  2IU3 A;  2BSK B;  1VBH A;  3JAM W;  1PD3 A;  1KQS U;  1IYE A;  5CA0 A;  3HKE B;  4FFK A;  4A3C G;  4Q45 A;  1JMK C;  4PZ8 A;  1UC8 A;  1ZHS A;  1U96 A;  4TV8 A;  3T9D A;  1US6 A;  3E8G A;  3JCZ A;  5KX5 B;  4CHI A;  5KHI A;  2ZIN A;  3TIN A;  1JJO A;  3UKM A;  1XMO B;  2DQ3 A;  5ITZ A;  3WNZ A;  4BBS G;  4LF8 O;  1VF6 A;  2F1M A;  2R9R B;  3TJT A;  4FFP A;  4IRD A;  3LDD A;  3ZHV A;  1CKM A;  1T36 A;  1H8E G;  2NU7 B;  4KL1 A;  4IIJ B;  4MV8 A;  4NZM A;  5KX5 F;  1JJ2 U;  1OWT A;  3DTG A;  4BBR G;  4IT5 A;  4X89 A;  3OD4 A;  4R6Z A;  2DYS B;  3AG3 B;  2E74 B;  2JEF A;  3ETJ A;  4WD3 A;  3S3X A;  5L3G A;  2V58 A;  2CTP A;  3T1H B;  1T94 A;  3PW0 A;  3QVN A;  2JA7 A;  4QIW A;  3BA8 A;  4I4T B;  1N34 B;  1I1K A;  4YY3 H;  4IIJ F;  3HOY G;  3GB7 C;  1I7L A;  2XCP A;  1Y1V G;  3MWM A;  3QWU A;  2Y4T A;  2E3C A;  2UXB H;  5JJE B;  4BXX G;  5IYZ B;  3T9C A;  1OCC B;  3KKY A;  1BQZ A;  3FB5 C;  5JQG B;  4YJ3 A;  4I4T F;  3G6V A;  2CDY A;  4DW1 A;  3M8A A;  3UQ8 A;  2CTR A;  3SJQ C;  2K1E A;  4DV3 O;  1CQI B;  3GTK A;  2Q7H A;  2W57 A;  5LMN B;  4OXS A;  5KFX A;  3OT7 A;  5IYZ F;  5C4X G;  4NZO A;  1FJG O;  5B1B C;  2X0L A;  2H3O A;  4MVU A;  1FFX B;  2HP8 A;  1LUW A;  4I9W A;  3H1H H;  5JCO A;  5JQG F;  5DGI A;  4O7L A;  5IP7 G;  3KHH A;  1AI7 A;  4DR7 B;  3ZN1 A;  3BCC H;  4JTA B;  2VS0 A;  5C3E G;  1GGO A;  2UUC O;  3UFX B;  2NVX A;  1S77 D;  3FAV B;  4HAM A;  1ULZ A;  1JKJ B;  4FIP C;  1RK6 A;  4L8J A;  3H9V A;  1OJH A;  3GIP A;  2IP4 A;  3IN5 A;  4GX0 A;  2ZDH A;  3T1Y B;  4JAA A;  3VOU A;  4ZKI A;  1BGY H;  3OTF A;  3ABU A;  3HKZ A;  3H1K H;  3E8F A;  3JAR B;  1PV0 A;  4J7J A;  1S68 A;  2HHH O;  2Q2U A;  4FLU A;  1IYD A;  2YRX A;  4I7Z B;  2Z0A A;  4A2A A;  3RBD A;  4B3T H;  2R92 A;  4N23 A;  1ZL8 A;  2ZXW B;  2QB5 A;  1A32 A;  4MW8 A;  5EBL C;  2UU9 B;  1F4N A;  4MA5 A;  2F4V O;  4MTG A;  1X59 A;  3SPC A;  4RUE A;  4RCN A;  2HHH H;  1OBG A;  4OX9 O;  4PDB A;  3MFH A;  2F43 G;  5B3S C;  4J9N A;  1XK5 A;  2R8H A;  3CRR A;  3B8M A;  4X65 O;  3JSL A;  2EZP A;  2FYU H;  1O9G A;  1W93 A;  3MDS A;  3GIJ A;  2AGQ A;  1M56 B;  3T2M A;  4ECQ A;  2F4V H;  4ZOL B;  3T7A A;  2YL2 A;  5EWF A;  1FYJ A;  3RBZ A;  5KFJ A;  3G8C A;  2COJ A;  1WSC A;  1XHZ A;  4OX9 H;  2Q73 A;  3OUF A;  3UYY A;  4X88 A;  5CBF A;  3A0B Z;  3N2G A;  4X65 H;  5K1P A;  3T4Z A;  2C2D A;  5GON B;  2UUA B;  5DG9 A;  3OFN G;  2Q67 A;  2L35 A;  1DF5 A;  4U3J B;  4ZOL F;  1IX9 A;  2P90 A;  4LSA A;  2UVU A;  3AG1 C;  5IJ0 A;  4DR1 O;  3RFR A;  3TY8 A;  5IWA B;  1Y6X A;  3EPI A;  5KHJ A;  1X4T A;  1MMM A;  5KFK A;  4LFC B;  3D3I A;  1E1R G;  4MTO A;  4X20 A;  4O3O A;  4YAJ B;  2FK2 A;  1KKD A;  1I5X A;  3TGU H;  3CX5 F;  2NN4 A;  4RUF A;  5GON F;  3J81 N;  2PY5 A;  2UVV A;  4FZ1 A;  1HNX O;  2ZQM A;  4F6R A;  1WJZ A;  2PF4 E;  4DV0 B;  4QPJ A;  3P3P A;  1JVM A;  3JAL A;  4E2L A;  5A9G A;  1L0N H;  3HKD B;  3TEK A;  3A2F A;  4DR1 H;  4X62 O;  4RUC A;  1S76 D;  2DPJ A;  2V9W A;  4BY7 G;  3TXQ A;  4TSF G;  2P5O A;  2QYZ A;  1TVK A;  1HNX H;  2AHY A;  4ECX A;  1QU7 A;  2QE7 G;  5KFO A;  2R6F A;  2GDS A;  3G80 A;  5A2Q W;  3VPC A;  3AEI A;  4O4I A;  2P4K A;  5FNV A;  4KUM A;  1W96 A;  2BTQ B;  1NU1 H;  3F7V C;  4J10 A;  4BWS C;  1K92 A;  1FXK A;  1M57 C;  5JVD B;  4JI6 B;  1VQ4 V;  2QEX V;  2FMA A;  4C5A A;  2Q5Z A;  1GKF A;  3E83 A;  4LF5 B;  1WCM G;  3K79 A;  4Z1V A;  4K8Z A;  4LF6 B;  4B3R B;  3TW7 A;  5JJJ B;  4UV9 A;  1TWC A;  4WHX A;  2RGR A;  1P84 F;  2R8G A;  1JA8 A;  2DQ0 A;  1H38 A;  1Z2P X;  1WPX A;  5F2V O;  5JVD F;  3LSU A;  1N4C A;  3CC2 V;  4KHP B;  1SER A;  3APQ A;  4R8U A;  2YIA A;  5KFC A;  5J2U B;  1Y1V A;  4C7U A;  5FLX N;  1F4M A;  4JI2 O;  1PP9 H;  1WP7 A;  1XMQ B;  3W5O A;  4CMF A;  1WPB A;  2OYQ A;  4JGS A;  2XGQ A;  2XAH A;  2HVK C;  1XNQ O;  3MR3 A;  2IJK A;  4GC6 A;  3ZBH A;  3PW2 A;  1MOF A;  5KLV H;  2WLL B;  2XT9 A;  4YP3 A;  2A3Q A;  4I55 B;  5J2U F;  1E79 G;  1J95 A;  4JI2 H;  2DMX A;  4C5C A;  3RYI A;  3OGC C;  5I60 A;  1N48 A;  1S3J A;  2KG7 A;  4O4J B;  2YU9 A;  2F23 A;  1M0W A;  4XBF A;  4IHJ A;  1HNW O;  1XNQ H;  4H13 B;  1GN2 A;  3ABL C;  4LF4 O;  4EYI B;  2NU9 B;  1BQ0 A;  4I55 F;  3SE7 A;  4RAY A;  3DXR A;  1R3I C;  4JI0 B;  2EIJ C;  4RWU A;  3ZX6 A;  1IUR A;  2W8K A;  2D3O W;  5B1B B;  4O4J F;  1TWA A;  3U54 A;  3JRX A;  2FE3 A;  4ZQI A;  4H44 B;  1HNW H;  1W0J G;  3LNM B;  4DR5 B;  2LO1 A;  4Q44 A;  3CS5 A;  3GLK A;  3GIL A;  5H6Q A;  3ZJZ A;  1RSO B;  1RYS A;  1QVG U;  4O4H B;  5IYC O;  3AG4 C;  5JH7 B;  1AI6 A;  1Q5O A;  1I1L A;  2FK1 A;  1V9P A;  4RQE A;  2Q7D A;  2EIN B;  3H1I H;  4DR4 B;  5DG8 A;  4MTD A;  4EFB A;  2ZE5 A;  4GX5 A;  1U97 A;  3WB0 A;  2WWW A;  1I5Y A;  4O82 A;  2V4R A;  5KKN B;  3SPI A;  1N33 H;  5EWE A;  4O4H F;  4ZHQ F;  4LH7 A;  4ECV A;  5JH7 F;  4O3S A;  1YHQ V;  4F4Z A;  4JI3 O;  3LSQ A;  1UJW B;  4B3M O;  3KHL A;  3ETQ A;  1KT8 A;  1WA8 B;  3GQC A;  2RDC A;  4JAU A;  4X1I A;  1CPY A;  4LBE C;  2W9B B;  2IA6 A;  4LFA H;  3B77 A;  1KP3 A;  2IH3 C;  4FFN A;  4MV1 A;  5D8D A;  3CCM V;  4WFG A;  4FLX A;  4MA0 A;  3OTO B;  4LFB B;  1TA8 A;  3STZ C;  2QR4 A;  4EB6 B;  3OE7 G;  4RNO A;  1I94 O;  2A79 B;  3K03 A;  1HR0 B;  1S0M A;  3T1C A;  4O2B A;  2JGU A;  2UXD O;  1TUB B;  3G6Y A;  4CBC A;  4NXN B;  3KRE A;  4X66 O;  3CB2 A;  2E5L O;  4DLK A;  3E89 A;  4CH5 A;  1VEW A;  3CME V;  3BQ1 A;  1VQ7 V;  2RGV A;  3ABT A;  4MT8 A;  4WFA V;  1EZV H;  4YQW A;  4ED7 A;  2ADQ B;  3HOX G;  1I94 H;  4F6E A;  4BIO A;  2UXD H;  5L3F A;  1NS1 A;  4U7N A;  4AYB A;  3PVX A;  4QE9 A;  3U55 A;  2WB1 A;  4LF7 B;  4X66 H;  3RAQ A;  2W6O A;  1R1B A;  3JAS A;  3IGA C;  5EC2 C;  3Q2O A;  3QZ8 A;  2P22 C;  5BMV A;  2HIX A;  4Q43 A;  2Q7E A;  5I5W A;  3AG1 B;  3W1G A;  1S97 A;  3R5H A;  1P7G A;  4XX0 B;  1N36 H;  2LP7 A;  2H94 A;  1MZE A;  2EIK C;  4DR6 O;  3PJS K;  2YZG A;  3WG7 C;  2AGA A;  3NC0 B;  3AG2 B;  2WLI A;  5L9X A;  2LFR A;  2E75 B;  4UVA A;  5KFT A;  3LSS A;  4U7C A;  5BWU A;  4X1K A;  1VQ5 V;  2HVQ A;  5BPF A;  4UCO A;  2PI4 A;  1QCE A;  4ZI7 B;  3TW6 A;  4ME6 A;  4RB0 A;  3U0G A;  5KFV A;  4F4W A;  1DTO A;  4B3S B;  3ASN C;  5LMU B;  3RN4 A;  4JI1 H;  2P06 A;  1SA0 B;  1VKZ A;  3RGX A;  3MR2 A;  2PZS A;  1K5Q A;  3B09 A;  3UT5 B;  2RN9 A;  2RDJ A;  3VA7 A;  2FPG B;  5CM0 A;  2RF4 A;  4FLT A;  1IBM H;  1Y74 A;  4A93 G;  4ZI7 F;  5I5X A;  1KJ8 A;  3T5J A;  1QR9 A;  3ICX A;  1M57 B;  4FPP A;  2ATK C;  4JV5 H;  1Q6U A;  4J9L A;  1VAR A;  1Y76 A;  3T5H A;  3CYO A;  4DV7 O;  4ED0 A;  3FFQ A;  4YIO A;  4O3R A;  4LSX A;  4JYB A;  1K4C C;  3K9A A;  5D1O A;  5C44 G;  4L1K A;  3GTO A;  2Q8V A;  1K4D C;  4KP4 A;  1URF A;  1D2D A;  3JD2 A;  1BE3 H;  4QNH B;  1V55 C;  3ZRW B;  1F7Y A;  2COG A;  3L70 H;  2DYR B;  3JAK A;  2E76 B;  5I47 A;  1AVM A;  2QJ1 A;  4J11 A;  3ZHR A;  2GQR A;  4E6N A;  1IOW A;  2FB5 A;  1FS0 G;  1CKN A;  4O4L A;  4O2A A;  1I2L A;  2G38 A;  4J9K A;  3ORQ A;  3RB3 A;  3M9N B;  2V59 A;  4PDR A;  1N32 H;  4CKE A;  4Y8V B;  2W8L A;  3TXS A;  5LXT B;  5DG7 A;  3AG3 C;  3RB0 A;  2LFS A;  3ETD A;  4DV2 O;  1A3G A;  3LWB A;  4DO2 A;  2JA5 A;  1NZ6 A;  4G2K A;  3HR0 A;  4UCT A;  1EYZ A;  2BQU A;  4RAZ A;  1HWY A;  2GV9 A;  3FD9 A;  2C00 A;  1COW G;  4TQF A;  4WFE A;  5LXT F;  1GM9 A;  1J5E O;  1Q43 A;  4I0X A;  5D1P A;  2LGQ A;  2YEV B;  1GO3 E;  2CTQ A;  2EIJ B;  3VQX A;  4FLY A;  2JA7 G;  3HT5 A;  3T5L A;  4O86 A;  5KFS A;  5KFE A;  4LWS A;  2MW2 B;  4GKJ O;  2W9C A;  3QO8 A;  2Y48 A;  3D36 C;  4TWK A;  1O9H A;  5KT6 A;  3BPZ A;  4GKK O;  1G6U A;  2WA4 A;  2ZE8 A;  3E86 A;  2Q6A A;  3PN1 A;  5I5T A;  3M7M X;  2R72 A;  3GJX B;  1M0T A;  3IFX A;  4IYH A;  3HKC B;  4GKJ H;  5LP6 B;  1C30 A;  4L87 A;  1M6V A;  2UUB B;  3RBE A;  4JYA B;  2AW9 A;  4GKK H;  3L74 H;  4TUY A;  1N56 A;  4K0K O;  1I0H A;  1QR8 A;  4QWB A;  3HKB B;  4FK5 C;  4DV5 O;  3KAK A;  5CB4 B;  4YR0 A;  3J7A K;  3TQT A;  5LP6 F;  3AYH B;  1PNL A;  2WLJ A;  5IYC G;  1B06 A;  3EPG A;  1SEI A;  2A7W A;  2IMW P;  1ZTE A;  4K0K H;  4DRX B;  3K06 A;  1FAF A;  2R8J A;  1SKV A;  5DN6 G;  4UFZ A;  5CB4 F;  2ZCE A;  2HGX A;  2ZXW C;  2BSK A;  1KJ9 A;  4R7C A;  2WSS G;  2X7R B;  3G6X A;  5KFI A;  5L3D A;  4HZ3 A;  4LF8 B;  2WLK A;  4O3P A;  4IRC A;  1DV2 A;  5FLM G;  4UB8 Z;  2JA8 G;  1O75 A;  2BQ3 A;  2VA3 A;  5KX5 A;  1QHT A;  3HO8 A;  5IT9 W;  3RYF A;  2HJF C;  1R73 A;  2R92 G;  4CC5 A;  1THZ A;  3GVM A;  3GV8 B;  4AYB E;  1XQ8 A;  3AG7 A;  1KYO F;  4DK0 A;  4QW9 A;  2YIB A;  4DIM A;  4NTY A;  3DAA A;  4JAV A;  5J2T A;  3F7Y C;  4QWA A;  1NR1 A;  4DUY O;  2YS6 A;  1ZSP A;  2DPI A;  2CZG A;  4J7K A;  5BY1 A;  4EQ5 A;  3TET A;  4FM9 A;  1Z5W A;  4GLX A;  1QNM A;  2EIM C;  3WG7 B;  3CCE V;  5DGB A;  4A3F G;  4XDJ A;  2ITC C;  2O03 A;  2PN1 A;  3CCU V;  3QTC A;  3ZMZ A;  4CS2 A;  3K08 A;  4DAA A;  1YF2 A;  2YSU B;  3WB1 A;  5C93 A;  4DUY H;  4IAJ A;  2DAA A;  2ZE7 A;  4I50 B;  3TK1 A;  1E4E B;  4DV3 B;  2WA3 A;  2YXH A;  4RUA A;  2PBZ A;  1NH2 D;  1AI5 A;  4BIZ A;  3CVZ A;  3ASN B;  2EJ3 A;  1FJG B;  1AP5 A;  1MAB G;  3E2E A;  2F93 B;  2VQF H;  3EHB B;  4DL4 A;  2NR5 A;  4IZO A;  1VQ6 V;  1PK8 A;  3TY9 A;  3VQW A;  1SQP H;  2ZDI A;  4I50 F;  2J6S A;  1OCO C;  2QWO B;  4PV1 B;  2AZ0 A;  2FKL A;  2CQY A;  3ZRV A;  2IJH A;  4GUN A;  3DTU B;  2UUC B;  5KFF A;  3RAX A;  2EX3 A;  4O83 A;  4X64 O;  3ORR A;  3T9A A;  3KXY T;  1R3K C;  3NBZ B;  3H20 A;  1K1Q A;  5KFU A;  5I5U A;  2W0X A;  2JEG A;  1R6K A;  3KCX A;  3OUS A;  2HVR A;  3CRQ A;  1H2S B;  4HYK A;  2HJW A;  2DOS A;  2HKO A;  3GWK C;  3VOT A;  1WCM A;  2ZT9 B;  4ECU A;  5KMG B;  4ECS A;  3WWH A;  4OPH A;  2XD4 A;  4YJ2 B;  2AZ2 A;  1HNZ O;  4X64 H;  4JI4 H;  4NYE A;  4A5U B;  5KFN A;  4DV4 O;  4MAM A;  1Z5V A;  1KEE A;  2JEJ A;  1I6U A;  1V55 B;  4DUZ H;  2YXY A;  3E22 B;  4HN2 A;  3CSX A;  5KT4 A;  4YY3 O;  1I3Q A;  1W59 A;  4JAS A;  1NJI W;  4W4L A;  1K8A W;  2R9I A;  1M7J A;  4JI7 O;  3JAR A;  4YJ2 F;  3FKS G;  1JCH A;  5EZY A;  1HNZ H;  4OX9 B;  4I7H A;  2UXB O;  2H8P C;  1HW7 A;  5KFY A;  2C2A A;  4DV4 H;  4TQD A;  1VAJ A;  1M1K W;  2IBK A;  5C8Y B;  3K5O A;  4CH3 A;  3VMM A;  1N0J A;  1GMG A;  1Q90 D;  3QZ7 A;  2QM7 A;  2Z02 A;  3CRA A;  3ZCC A;  4CKC A;  4JI7 H;  4JI5 H;  3PO3 G;  3M99 B;  4DR2 O;  1QLN A;  1GH6 A;  4OGQ B;  2ZJT A;  2R7Z A;  3CRM A;  2UXC B;  1DF4 A;  5C8Y F;  2C35 B;  4K3A A;  3HOV G;  5KFB A;  5JJN B;  2OTJ V;  4ZOL A;  1G1X B;  3KAJ A;  3R9R A;  1JX4 A;  2Y69 B;  4DR2 H;  4PA3 A;  3OMA B;  4BR6 A;  2HFE C;  2VQE B;  4AHC A;  3I56 V;  3N2K A;  2NUA B;  1OCR B;  4X1Y A;  2FB9 A;  2Y4U A;  4O7W A;  2YDE A;  3RVZ A;  4U3J A;  5KUM A;  4A3I G;  2XGP A;  3HB3 B;  4NXM H;  2XAS A;  2X6C A;  1XL4 A;  3G6B A;  4X62 B;  3E8B A;  4NB5 A;  1EKF A;  3GTL A;  1YZB A;  1I50 A;  1KU9 A;  2EIN C;  3R66 A;  4O84 A;  3RV4 A;  1NTZ H;  4TV9 A;  2VUG A;  5KAI Z;  4B3T O;  2FTK A;  5CBG A;  4MV3 A;  4YHH O;  3MFI A;  1N0N A;  4A3L G;  3HKD A;  5CA0 B;  3FMA A;  3MJF A;  3MWE A;  3NBY B;  5LOV B;  1AIL A;  2OLS A;  1QBZ A;  3EVK A;  4ECW A;  1Q7Y W;  1LUV A;  3TY5 A;  4YR3 A;  4MVM A;  5ITZ B;  4LC1 A;  1GTO A;  5CN0 A;  4YHH H;  2EBO A;  3H0G G;  3UCS C;  2Y0S E;  5CA0 F;  2BQR A;  2BTQ A;  2PMZ E;  4YB8 B;  4ED2 A;  4CC6 A;  4MV4 A;  3W7U A;  4QE7 A;  5LOV F;  1V51 A;  1JX9 A;  2QWR B;  2HR3 A;  5KG3 A;  3FB6 C;  3NUA A;  2NNU A;  2ZR3 A;  3VQY A;  4DW0 A;  1VQN V;  1P16 A;  2ZDQ A;  5L1I A;  5DQI A;  4ED3 A;  2AGP A;  2GTS A;  4KFM A;  4XDL A;  1BL8 A;  3AW8 A;  5A2Q N;  5JUM A;  4MS2 A;  1SF9 A;  5KHK A;  1GN4 A;  5LHH A;  2Q0A A;  1XNQ B;  2Q9L A;  1K3E A;  2M6Y A;  3CCS V;  5KS8 A;  2AXT Z;  3F5T A;  3MWD A;  1XMO H;  5J2U A;  3QFF A;  5KFA A;  5EIB D;  2EIM B;  1TGO A;  4P9O A;  4NKG B;  1XNR B;  4Q20 A;  2W6Q A;  1VBG A;  4D7T A;  3WWJ A;  3IJ4 A;  4MTX A;  1M9N A;  3KYH C;  4O7Y A;  4EYH B;  5B1O A;  3K5H A;  4J9M A;  4QIW F;  5FPR A;  2LW1 A;  2J6U A;  1D5N A;  5FL7 G;  2QWP B;  3HOU G;  4LF4 B;  3AG2 C;  4I55 A;  2NU6 B;  4PHZ A;  4ICG A;  2RDI A;  4ED1 A;  4FGR A;  5L3E A;  5CE8 A;  4HNT A;  3K5I A;  4YAK B;  3T1H H;  1Q81 W;  5DQG A;  3ML0 A;  5DED A;  5L1K A;  1R6T A;  2V4D A;  2R93 A;  3BAA A;  1N34 H;  2YZM A;  4IWY A;  3CC7 V;  3PZP A;  2CE4 A;  4HBN A;  4E4E A;  1OCO B;  4J9Z B;  4A3G G;  1ET0 A;  4DQN A;  2CNQ A;  2I80 A;  1WR2 A;  3O65 A;  3Q1K A;  2W7O A;  1DLB A;  2CK3 G;  3NGD A;  4PBC A;  3OHB A;  4QWD A;  3SJC C;  3G8D A;  3JRW A;  4QSH A;  5CAE B;  3WO1 A;  5DQH A;  1YDX A;  3ZHU A;  4IL6 Z;  5EIB C;  5JH7 A;  5LMN H;  3STL C;  1SQQ H;  4WBN A;  1JFF A;  1ZLZ A;  3W1B A;  4JI3 B;  4B3M B;  1OV9 A;  3Q4H A;  3SYC A;  3VPD A;  1UPG A;  1DGS A;  2ZNJ A;  4O7V A;  4DR3 O;  2ILM A;  4GYC B;  5IE9 A;  1TWH A;  1ZL8 B;  1VF5 B;  1RJQ A;  5I5V A;  1S0V A;  3KZI Z;  4J9P A;  1Q86 W;  3ZRS A;  2ODM A;  3ZN0 A;  5K2M A;  3RR5 A;  1NH2 B;  4K35 A;  3B40 A;  4P30 A;  4TQS A;  1BT8 A;  4K6N A;  2E2H A;  1PPJ H;  4AI8 A;  1WA8 A;  2DYR C;  3BG5 A;  4A3M G;  5LYJ A;  2I8C A;  4OPA A;  4DR3 H;  4JI8 B;  4X66 B;  5KG6 A;  2HGW A;  1IBL B;  2E5L B;  1UNN C;  5KFD A;  5J9P C;  2UU9 O;  3T1Y H;  2UVW A;  2Q7G A;  2PVP A;  2XOK G;  3JAW B;  4CS3 A;  5L1J A;  4NTX A;  1RJP A;  2ATL A;  3MR5 A;  4U7O A;  4O7S A;  4G3I A;  1TUB A;  2GUZ A;  3MHH C;  4P9P A;  5KFZ A;  3AK3 A;  3N2G B;  3HB9 A;  2HVS A;  3HOW G;  3V6J A;  1XIL A;  1QQC A;  3K3V A;  3EXA A;  4DV6 B;  2WAQ E;  2UU9 H;  2IU0 A;  2YCH A;  2JIZ G;  3K0D A;  2VA2 A;  5IJ0 B;  4EGJ A;  2NVY A;  2WTF A;  2R9A A;  4DR6 B;  4PI2 A;  4X20 B;  1CP9 A;  5GW7 A;  1OBD A;  3OR6 C;  3CCV V;  2JA5 G;  4LNU A;  3EFF K;  4DL7 A;  4GC7 A;  4JV2 A;  4JZ2 A;  3RT3 C;  3JD3 A;  1K1S A;  1SQX H;  4PDL A;  1N33 O;  3OSP A;  2FLN A;  1JOY A;  4ZHQ B;  4LFC O;  3I55 V;  4ZIB A;  2JGD A;  2L6L A;  3IAY A;  4H33 A;  3UO3 A;  5DIS C;  4EG0 A;  4H37 A;  1EN4 A;  1TVK B;  2QA4 V;  3THO A;  5LP6 C;  3V6H A;  5EBW C;  2K9P A;  4LFA O;  1K7D A;  4IWX A;  2XAQ A;  3J7A U;  3L2P A;  2RJZ A;  1A48 A;  3H0G A;  5FNV B;  2XND G;  4LFC H;  4BAY A;  2YC0 A;  4EEY A;  1CKO A;  5KFM A;  3SYO A;  3Q8P B;  1PM9 A;  4CH6 A;  2VQD A;  1CQJ B;  1M93 A;  1WAZ A;  5DGH A;  4NYK A;  2FPP B;  5CA3 A;  3FX7 A;  2LQT A;  4JUZ A;  4DV0 H;  2OH2 A;  3I4N G;  1N8R W;  1FXV A;  4FS1 A;  4DV7 B;  1JR9 A;  5FNV F;  1MSD A;  1OZ0 A;  5IYD O;  2PI5 A;  3P30 A;  4Q0Y A;  2MK3 A;  4RZQ A;  2DW4 A;  1AN7 A;  5CA1 B;  5KFG A;  2Q4P A;  1GN6 A;  2YUA A;  2RMK B;  1QVF U;  4GT1 A;  1SQF A;  4XZ3 B;  2HJD A;  1S0N A;  4P2Z A;  3SYP A;  1PNM A;  5KG2 A;  4KHP O;  1N36 O;  3ZRX A;  5CA1 F;  5CR5 A;  4LF5 H;  2CW7 A;  2XHB A;  3FDS A;  2CH7 B;  3K9S A;  4LF6 H;  3JZ6 A;  3CMA V;  3L72 H;  3V4S A;  3ZRW A;  1YSC A;  4NZN A;  5BWW A;  3RYI B;  3E35 A;  3SJA C;  4DV2 B;  3QQM A;  4J42 A;  2C22 A;  4IHJ B;  5EYP A;  3HBL A;  4KHP H;  2WLM A;  2GPW A;  4PZ6 A;  4TQR A;  2I87 A;  2OIG A;  3HOZ G;  4NR1 A;  3JYC A;  1SQV H;  4JPR A;  4YIP A;  3DXR B;  3F8N A;  3ZMS A;  1J5E B;  2W6M A;  4JI1 O;  2CNU A;  4HYO A;  2IH1 C;  3MAQ A;  1XMQ H;  1G8M A;  5LA6 B;  4FM1 A;  2ASL A;  2R87 A;  1IBM O;  4IHJ F;  3SI8 A;  2V1D A;  4GKJ B;  1ZET A;  3ZHQ A;  5DMX A;  4F50 A;  1LR1 A;  3GWO A;  4J41 A;  1BZK A;  4FFB A;  3VQV A;  5LHG A;  4JV5 O;  3GTP A;  5B5E Z;  2P4V A;  2OCC B;  3KCY A;  4B08 A;  3W7S A;  2R86 A;  5LA6 F;  1XOU A;  2J9G A;  1S9F A;  5DLF A;  4BW5 A;  4DR5 O;  1PL4 A;  4UVB A;  4APM A;  3OW2 U;  1H2M A;  4Z1M G;  3QG5 A;  2YWV A;  4CKB A;  2XIG A;  1H2L A;  1XRE A;  2ZIM A;  3I5D A;  4JZG A;  1IBK B;  2BOC C;  4CS4 A;  4F4Y A;  4FVM A;  2A9H A;  5LGU A;  1AJQ A;  4DV5 B;  2AU0 A;  5KA5 A;  4X1I B;  4A3J G;  1NTM H;  4DR5 H;  1KB9 F;  4LF9 B;  2JS3 A;  1Z2O X;  1JXL A;  3CEI A;  1AR5 A;  2DWC A;  3GIM A;  1N32 O;  3DC6 A;  2R70 A;  4ECZ A;  3HKB A;  3LP8 A;  3N42 B;  3CXH F;  3ZMT A;  5CB4 A;  3OM3 B;  3KHR A;  4DR4 H;  1I1M A;  1H2G A;  2UXX A;  3JAT B;  2YI9 A;  2FJZ A;  4Q8F A;  4JV0 A;  3PW7 A;  4DYL A;  4TM5 A;  4PA7 A;  5C5J A;  4EBC A;  4UVC A;  5BWR A;  3C0F B;  1QLE C; 
#chains in the Genus database with same CATH homology
 2VQF H;  4EEQ A;  5LA6 A;  1VS0 A;  5KHG A;  2HHH H;  4PDB A;  1FVI A;  4O4I B;  2ZM6 B;  4M7E A;  5IWA H;  4ZI7 A;  3TY9 A;  1XK5 A;  3VQW A;  4R7R A;  4LF4 H;  3JSL A;  1O9G A;  3J80 W;  1P49 A;  2UUC B;  4WBN B;  1JFF B;  1SA0 A;  5FLX W;  2EX3 A;  4ZOL B;  2OWO A;  2F4V H;  3KXY T;  3UT5 A;  3OTO H;  4LFB H;  3NBZ B;  3H20 A;  1XHZ A;  4OX9 H;  1HR0 H;  4D7S A;  1S03 G;  2HVR A;  3N2G A;  1H2S B;  4NXN H;  4X65 H;  3SR2 C;  5K1P A;  2ZNI A;  3QF7 A;  5GON B;  5KMG B;  2UUA B;  4X1K B;  1N32 B;  4HNA B;  4YJ2 B;  4U3J B;  4LSA A;  4X64 H;  4JI4 H;  5IJ0 A;  3TY8 A;  3RFR A;  5IWA B;  1Z5V A;  1X4T A;  5KHJ A;  5LYJ B;  1KMI Z;  4LFC B;  1I6U A;  4DUZ H;  4X20 A;  3E22 B;  3CSX A;  4LF7 H;  4JI6 H;  3RYC B;  2PY5 A;  4F6R A;  4PI0 A;  3JAR A;  5D5P A;  4DV0 B;  4JI3 H;  3JAL A;  4B3M H;  5EZY A;  1HNZ H;  4B3R H;  4OX9 B;  4I7H A;  3HKD B;  1HW7 A;  3A2F A;  1NT2 B;  4DR1 H;  4DV4 H;  4TQD A;  3JAT A;  5IJ9 A;  3RYH B;  5C8Y B;  3K5O A;  4CH3 A;  2P5O A;  1TVK A;  1HNX H;  4JI7 H;  1Z2N X;  3LML A;  4JI5 H;  5LXT A;  5A2Q W;  3N6X A;  4O4I A;  5FNV A;  3K5L A;  2BTQ B;  2WE6 A;  3JSN A;  2RQ6 A;  2ZJT A;  4BWS C;  2UXC B;  4JI8 H;  5JVD B;  4JI6 B;  4LNU B;  3B2E E;  1IBL H;  4B3S H;  5D1O B;  2E5L H;  5JJN B;  5LMU H;  4LF5 B;  3K5N A;  4ZOL A;  3KAJ A;  4K8Z A;  1HNZ B;  4LF6 B;  4B3R B;  3IG0 A;  5JJJ B;  5EOY A;  4DR2 H;  4GKK B;  2PUS A;  3ZED A;  4MTE A;  2RGR A;  3HKE A;  3JAK B;  2VQE B;  4AHC A;  3N2K A;  1Z2P X;  4O4L B;  4O2A B;  4YY3 B;  4X1Y A;  5KMG A;  1SYX B;  4KHP B;  3KAL A;  4DV6 H;  2YIA A;  4HNA A;  4EFE A;  4U3J A;  3VNN A;  5J2U B;  4K8X A;  1BJT A;  1ZAU A;  2UXB B;  2YIB D;  4NXM H;  4JI0 H;  4X62 B;  1XMQ B;  4K0K B;  3W5O A;  4DR6 H;  1WPB A;  2OYQ A;  1KU9 A;  4I9Q A;  4IIJ A;  2F66 C;  3RYC A;  4TV9 A;  2VUG A;  3HKC A;  5KHH A;  5LP6 A;  5FD6 A;  5FD5 A;  4I55 B;  1XI1 A;  5LL6 b;  3N41 B;  1XHX A;  3HKD A;  2ZIO A;  5CA0 B;  3FMA A;  4JI2 H;  3RYI A;  3RYH A;  3NBY B;  4O4J B;  5LOV B;  5C8Y A;  4PZ7 A;  1M0W A;  4I4T A;  4IHJ A;  1XNQ H;  4O2B B;  2CFM A;  3TY5 A;  2CW8 A;  3SGI A;  5ITZ B;  1WH2 A;  4YHH H;  4A2B A;  1ZHQ A;  4RAY A;  4JI0 B;  2BTQ A;  5IYZ A;  3RTX A;  4DRX A;  4CC6 A;  5JCO C;  4MV7 A;  4RB1 A;  2FE3 A;  1WN7 A;  5JQG A;  1HNW H;  4DR5 B;  3VQY A;  1P16 A;  3N40 P;  4O4H B;  4DV7 H;  3JAS B;  5JH7 B;  4TUY B;  1Q5O A;  4BW9 A;  5BMV B;  1FFX A;  1V9P A;  4BWA A;  5KHK A;  3L4J A;  4DUY B;  2Q0A A;  1XNQ B;  5EYP B;  4DR4 B;  4B3T B;  4MTD A;  4EFB A;  1XDN A;  3WB0 A;  1XMO H;  5J2U A;  4YHH B;  4CH4 A;  5BR8 H;  2WDT A;  3GDE A;  5EIB D;  1N33 H;  1TGO A;  1XNR B;  4LH7 A;  1X9N A;  4D7T A;  2VQF B;  3KYH C;  2HHH B;  3ETQ A;  5K1X A;  2KKW A;  5FPR A;  4X1I A;  4LF4 B;  4LFA H;  4FFB B;  4RB2 C;  4I55 A;  2UUB H;  4PHZ A;  4ETS A;  5FPO A;  2HGS A;  1FKA H;  4JYA H;  3GB8 B;  2F4V B;  3RGZ A;  4FLX A;  3RJ0 A;  3T1H H;  5LOV A;  3OTO B;  1TA8 A;  4LFB B;  3N44 B;  4EB6 B;  4DV2 H;  2PTM A;  1HR0 B;  2V4D A;  3BAA A;  1N34 H;  4O2B A;  2JGU A;  3N43 B;  1TUB B;  3RYF B;  4I50 A;  1P8L A;  4NXN B;  4X65 B;  4HBN A;  5BR8 B;  2HEP A;  4AQY H;  3CB2 A;  1A0I A;  4CH5 A;  5D5Q A;  1J5E H;  4AIL C;  2RGV A;  3RGB A;  4X64 B;  4JI4 B;  5J2T B;  3RIZ A;  2BTO A;  1I94 H;  3K57 A;  2UXD H;  2IM9 A;  4DUZ B;  3WB2 A;  1B04 A;  4UCR A;  3SJC C;  2KSW A;  4LF7 B;  4X66 H;  4DK1 A;  4LF8 H;  3JAS A;  5EIB C;  5JH7 A;  5LMN H;  4WBN A;  1JFF A;  3W1B A;  1E4F T;  4JI3 B;  2P22 C;  5BMV A;  4B3M B;  2HIX A;  3M4I A;  2Q7E A;  4DR1 B;  1DGS A;  2ZNJ A;  4DV4 B;  3W1G A;  1N36 H;  1YEW A;  4GYC B;  4UCU A;  4AQY B;  3NC0 B;  1CKN B;  3CHX A;  5GON A;  2WYO A;  3HXL A;  4X1K A;  1HNX B;  3RR5 A;  4JI7 B;  1IBK H;  4YJ2 A;  2HVQ A;  2PYJ A;  4JI5 B;  3BRC A;  4UCO A;  2VOB A;  2HIV A;  2PYL A;  4ZI7 B;  5LYJ A;  1D5A A;  4DV5 H;  1SQG A;  3U11 A;  4DR3 H;  4RB0 A;  4JI8 B;  1M5I A;  4X66 B;  3E22 A;  4B3S B;  1IBL B;  2E5L B;  4LF9 H;  1M4U A;  3T1Y H;  5LMU B;  2Q7G A;  4DV1 H;  4JI1 H;  3ZS8 C;  3JAW B;  1SA0 B;  4CS3 A;  2PGG A;  3RGX A;  2PZS A;  3UT5 B;  4LH6 A;  4DRF A;  4FM2 A;  4DR2 B;  4FLT A;  1IBM H;  1TUB A;  3N2G B;  2HVS A;  2YXL A;  3ICX A;  1QQC A;  1VF7 A;  3K3V A;  1T5E A;  4TV8 B;  4DV3 H;  4DV6 B;  2VPS A;  2UU9 H;  4UCS A;  4JV5 H;  4FM0 A;  2YCH A;  1FJG H;  4LR3 A;  3K59 A;  5IJ0 B;  3DSQ A;  4NXM B;  2ZM6 H;  2R9A A;  3FFQ A;  4DR3 B;  4DR6 B;  2QM4 A;  4PI2 A;  4X20 B;  3U10 A;  4LSX A;  2JS5 A;  5JVD A;  3LNN A;  4LNU A;  5D1O A;  1Q3E A;  4DV1 B;  2CAZ C;  2UUC H;  1WNS A;  4FLV A;  2MCT A;  5EZY B;  2VWK A;  3K58 A;  4JI2 B;  4ZHQ B;  3JAK A;  4LMY A;  4ZIB A;  5IJ9 B;  3IAY A;  2QJ1 A;  4E6N A;  5DIS C;  1CKN A;  4O4L A;  4O2A A;  2YI8 A;  1TVK B;  3THO A;  5LP6 C;  1N32 H;  3DF7 A;  5LXT B;  3L2P A;  2RJZ A;  5FNV B;  4FLZ A;  4LFC H;  1CKO A;  4UCT A;  4YJ3 B;  4CH6 A;  1I7F A;  1HNW B;  1M93 A;  4RAZ A;  3JAW A;  2GV9 A;  1GYF A;  4TOI A;  4TQF A;  3JAM W;  4DV0 H;  4DV7 B;  5CA0 A;  2VWJ A;  3HKE B;  1Q43 A;  5D1P A;  3VQX A;  4FLY A;  1JMK C;  4PZ8 A;  3N2K B;  4O4J A;  4Q0Y A;  1ZHS A;  4TV8 A;  4X1Y B;  4RZQ A;  5KX5 B;  1AN7 A;  5CA1 B;  5KHI A;  2ZIN A;  1JJO A;  1XMO B;  5ITZ A;  1O9H A;  3BPZ A;  2F1M A;  3SJB C;  1SQF A;  1N33 B;  1G6U A;  1CKM A;  3PN1 A;  3M7M X;  2UXC H;  2R72 A;  3GJX B;  4KL1 A;  1M0T A;  4IIJ B;  4TV9 B;  3HKC B;  4LF5 H;  4GKJ H;  5LP6 B;  4LFA B;  2CW7 A;  2XHB A;  1RSO A;  4LF6 H;  2UUB B;  4JYA B;  4O4H A;  4GKK H;  1TAE A;  4ZHQ A;  4TUY A;  3T1H B;  2VQE H;  3RYI B;  3SJA C;  3HKB B;  4DV2 B;  3BA8 A;  4I4T B;  1N34 B;  4IHJ B;  4YY3 H;  3KAK A;  5EYP A;  5CB4 B;  3J7A K;  4KHP H;  4PZ6 A;  4DR7 H;  1L8D A;  3MWM A;  3QWU A;  2E3C A;  2UXB H;  4FLW A;  5JJE B;  3F8N A;  1SEI A;  1J5E B;  5IYZ B;  3BA9 A;  3MAQ A;  4X62 H;  1XMQ H;  4K0K H;  3BHP A;  4DRX B;  3U0Z A;  5LA6 B;  4FM1 A;  1SKV A;  5JQG B;  1I94 B;  4YJ3 A;  4NVP A;  1MZB A;  3BAB A;  4UFZ A;  2UXD B;  4GKJ B;  2ZCE A;  3UQ8 A;  3RWR D;  4FFB A;  2F95 B;  4LF8 B;  3VQV A;  3L4K A;  2Q7H A;  2W57 A;  5LMN B;  3RF2 A;  3S24 A;  4J0M A;  4B08 A;  1FFX B;  4EB6 A;  3K5M A;  1O75 A;  1E4G T;  5JCO A;  5KX5 A;  3EYY A;  1N36 B;  1QHT A;  5CA1 A;  5IT9 W;  3RYF A;  4DR7 B;  4APM A;  4CC5 A;  3J81 W;  3QG5 A;  1XQ8 A;  2XIG A;  4DK0 A;  2ZIM A;  2Q2T A;  2YIB A;  1IBK B;  4MV9 A;  4CS4 A;  1L2Z A;  5J2T A;  4FVM A;  1S5J A;  4DV5 B;  4X1I B;  4L8J A;  4EQ5 A;  4FM9 A;  4DR5 H;  1Z5W A;  4GLX A;  4LF9 B;  1Q8I A;  3T1Y B;  1Z2O X;  3OTF A;  4JI1 B;  4F6R B;  2O03 A;  3JAR B;  2R70 A;  3QTC A;  3HKB A;  1S68 A;  4RB3 C;  4CS2 A;  3JAL B;  2Q2U A;  4FLU A;  1IBM B;  3WB1 A;  1BGW A;  3N42 B;  4A2A A;  5CB4 A;  4IAJ A;  4DUY H;  4DR4 H;  4B3T H;  4I50 B;  3JAT B;  2YI9 A;  4Q6G A;  4DV3 B;  4UCV A;  4JV5 B;  2UU9 B;  3CVZ A;  2UUA H;  3C0F B;  1XNR H;  1FJG B;  2JVD A;  2F93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...