4O7NA

Saicar synthetase (type-2) in complex with adp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
EVYEGKAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP
rcsb
source organism Pyrococcus horikoshii
total genus 71
structure length 233
sequence length 233
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7nA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7nA02
3IECA 5CEIA 5EQEA 3RWQA 3TTIA 3OW4A 4R7IA 1V1KA 3EJ1A 4IAAA 4QP6A 4EG0A 5DH3A 2VWVA 4F6UA 2OH4A 2QOCA 2XNNA 4HW7A 2DWBA 1JKJB 3MWUA 2IW9A 3WF9A 3DQWA 2DIKA 5D8DA 4FG8A 3DKCA 3QF9A 2CN8A 2UZLA 3A7GA 4N0SA 4EZ3A 1TQMA 3R23A 1T36A 3E88A 3LW0A 3U87A 4ZJJA 2PVYA 3P23A 5CI6A 1GIJA 5ANIA 3TTJA 2YA9A 4RJ4A 3TINA 2GTNA 1QMZA 4CFMA 4PMTA 3GXLA 4LG4A 4ACDA 2ERKA 4PRJA 2QHNA 1IEPA 1REJA 2RFNA 3BQCA 3HB9A 2UZEA 3PA3A 5JT2A 3POOA 1IASA 1PXIA 4FG9A 3IO7A 2ITQA 5JQWA 5AP2A 1Q8YA 3HMOA 5TF9A 3P79A 5CAVA 5IMXA 4FICA 1WBWA 2GS2A 4AW5A 1YI6A 5LP6F 3RKBA 4A06A 4TYHA 4FV2A 5DFPA 1ZYJA 3F69A 5LXMA 3TV4A 3OCBA 1H8FA 3ET7A 4PF4A 2Y9QA 3HECA 4W4XA 5DPVA 1YWNA 3C5UA 3FXZA 1VKZA 4TYGA 2JD5A 3IOPA 4XHKB 3EYGA 5EW9A 4YC8A 5BVEA 3U4WA 2JBOA 4EONA 3TIIA 4DLKA 4FKVA 4CFWA 3ORXA 5M44A 1TKIA 3KU2A 3NW7A 4RJ5A 3JYAA 2Q0BA 4J99A 3G8DA 4AN3A 2WTVA 2VTJA 5KZ0A 1PK8A 2ZAZA 1WBSA 3LCTA 3NCZA 2PZ5A 3O7LD 3GC0A 4BDAA 3UOKA 3BKBA 5IG1A 2QK4A 1L3RE 2V58A 5ETAA 4X3FC 4EWQA 4JI9A 4ALUA 5CSXA 1ZYCA 5C1PA 3LMHA 3UQCA 4HGLA 3F3TA 3KK8A 5AUXA 3G9LX 3UIXA 5H9BA 2GU8A 2VWIA 3ODYX 2XYNA 5EM6A 3R7UA 3VHEA 3PPKA 4W8EA 4MAOA 5BPFA 3D94A 2F4JA 2ITTA 2VTTA 5CS6A 3R1SA 3CCNA 4DEDA 1BL7A 5AM7A 2R3KA 4QSHA 3KA0A 2YRXA 3QTZA 3EIDA 3DKFA 3PY0A 4MK0A 4CNHA 4ZSLA 3RVGA 1XWSA 3EH9A 1EH4A 3G6HA 4FTLA 4RC2A 2H6DA 3EL7A 4TYHB 2HXQA 2QOHA 3UOLA 2R7BA 2E9VA 2JKMA 3LCDA 4LQMA 4BDFA 3U6JA 2CNVA 3RALA 4FKTA 4DG3E 1CQIB 4F9YA 2BVAA 2XH5A 2W4KA 2PYWA 2PVPA 2BCJA 5IEVA 4MV9A 4FT0A 1KJQA 2QURA 3NUXA 3VW8A 2IVSA 2WNTA 3R5FA 4I50F 4ARKA 3QTSA 1YDRE 4O0TA 3V5TA 2XCHA 3BE9A 1OKWA 4F64A 3DJ7A 4CLIA 1FPUA 3FZOA 3OFMA 4FV3A 4XG8A 3RFCA 5AIRA 3FZRA 2WEIA 3C0GA 3IW6A 3NUAA 5A4CA 1PMNA 2YISA 3GC7A 1PMEA 4K6ZA 4AE6A 4ZTQA 1JVPP 2EB2A 4AUAA 3QQUA 3VS0A 5BMVF 2W4JA 5HCXA 2J5FA 3D5VA 4NM7A 1OL6A 3KCKA 3PJ8A 3R2YA 2HIWA 1HOWA 4RIYB 4V05A 3SV0A 2XYUA 3F2RA 4DGGA 2C6KA 5KUPA 5LXTF 5DR9A 3GBZA 1PXKA 3PXFA 3UGCA 4L6QA 2VU3A 3GIDA 3MGYA 4EHEA 5IQDA 4YPDA 5E1EA 5L8JA 3UOJA 4BIEA 4I5HA 3KVXA 2PHKA 3FQHA 3H30A 4FFMA 3ZS5A 1Z9XA 4ZOLF 1S9IA 3UP7A 2G2HA 5IZFA 3DF7A 2XEZA 2VN9A 4U80A 4O6EA 2RIOA 3DS6A 3UIBA 5A4LA 2VNWA 4O22A 3PRIA 3QTUA 4JNWA 1EYZA 2XS0A 2RFEA 3BHUA 5CZIA 3ZLSA 3LM0A 2W1GA 3O2MA 5FM2A 2OZOA 3PZEA 3UO6A 2P55A 5AJQA 4CV9A 3NVKI 3ZM4A 4BCGA 5HBHA 2YM3A 4ORKA 2O5KA 4NM3A 4EK4A 4J7BA 2C30A 4I5PA 4F6WA 1CE8A 4M12A 5HEZA 2VAGA 3A61A 1P4OA 2V62A 3CY2A 4FC0A 4IBMA 3ZC5A 4BVUA 1Z2PX 5KMKA 2BRMA 1LEWA 2PE0A 3BQRA 3NUUA 4LMNA 3D9VA 4BIDA 4QMNA 5KZIA 2J4ZA 2ZB1A 4UB7A 2YM6A 4FTQA 4UYNA 2PPQA 5FEDA 3CGOA 5AP3A 3Q60A 1FGIA 3O8PA 4K33A 4C34A 2AYPA 5KBQA 3N6RA 4DGMA 1FVRA 3NDMA 4QMWA 2VO0A 4GIHA 1MUOA 2EWAA 4GMYA 4D1SA 1XH7A 2CKPA 1YW2A 2C6MA 2OIDA 3HV6A 3O23A 3DB6A 3R04A 4G3EA 4X2GA 3SKCA 4HGEA 3NNUA 3DK7A 2FYSA 2HZIA 2FPPB 2BHEA 3VHKA 4Z3VA 2GLTA 4R78A 4Y46A 5EDRA 3RUPA 3OCSA 5EK7A 3TNWA 2CNUA 4FV9A 3UNJA 3QU0A 3Q9XA 1ZZ2A 4J96A 4PDSA 4PV0A 4UALA 2W5HA 5I9YA 2VPQA 1JAMA 1S9JA 1G5SA 3S00A 4GK3A 3G8CA 1UU3A 2EUFB 4I24A 3V6SA 4CMUA 1KJ9A 5FNVF 2EVAA 3OXZA 4D0XA 5EHOA 5JQGF 2XKEA 4L01A 4AZEA 4CXAA 4OTFA 3MTLA 3UJGA 5A4QA 1HCLA 3FQSA 2X2MA 3QUPA 1H26A 2YZLA 4I6BA 4XP0A 3W10A 5CQUA 3VPBA 5JEBA 4MBJA 4HZRA 4EH7A 5LMKA 1JLUE 4ASXA 5CAPA 1H24A 5DE2A 4EH3A 2YCQA 1KV1A 4K18A 4Y85A 3VVHA 4N57A 2Y4IC 2GFSA 3OC1A 4MQ2A 5EW3A 3LJ1A 4RT7A 3UMXA 1YVJA 4ITJA 2ITWA 3CTQA 1W0XC 3D5WA 3FAAA 3WO1A 5EW8A 4AW1A 4IZYA 2FPIB 5IUGA 2NPQA 4A9TA 4FSZA 2BZJA 4TT7A 2QO9A 1PMVA 5DI1A 4FKGA 4C0TA 2A27A 3PIYA 1Q8UA 5ANGA 3ZSIA 4EHZA 2I6LA 5IQHA 4GRBA 2X8DA 4O7VA 3NGAA 4C37A 3PP0A 2XNEA 2GNGA 2VV9A 3C4FA 4X0MA 4B4LA 2QOQA 4Q5HA 2ZM3A 2FSMX 3QTRA 4ERWA 3OT8A 4CFFA 1JNKA 4MYGA 3TZ7A 2O0UA 5ANJA 4U9AA 4O84A 3G0FA 1ZWSA 4LGGA 4EGJA 1FBNA 3N9XA 4O7TA 5TKDA 2WAJA 4GUBA 4NU1A 4RQKA 5CAOA 5HX8A 3RK5A 2GPSA 2NU9B 3VO3A 4FEVA 4IB3A 3GQLA 2BRHA 3HAVA 2XIRA 1XH9A 2GNHA 3BZ3A 4QMZA 4YBJA 4YZ9A 4NSTA 3FKOA 2BMCA 2WTDA 3FMNA 4JIAA 4Y95A 3R8PA 4R1YA 4D58A 4XLIA 3QQLA 4BCOA 3NYVA 1H00A 3IGGA 4MX9A 3NRMA 3B8QA 3W2RA 2YIYA 3HV5A 2J0KA 4RWKA 1LPUA 3FWQA 4DH1A 1NW1A 2QO2A 3JZFA 4O7NA 5FP5A 2UZDA 3F9NA 2C6OA 2FSTX 3BIZA 3HMMA 4NK9A 1Y57A 4FTCA 5EI8A 2OO8X 3RAIA 2W5BA 5HBEA 5GHVA 4O96A 2I0HA 4A4OA 5J5SA 1Q62A 3BHTA 3BRBA 3PXZA 4XRLA 4DEBA 4YC3A 1ZARA 4ZTRA 3EQHA 4JOAA 4I21A 3U4UA 2YFXA 5T6KA 3V4SA 1STCE 4E4NA 4IVAA 3QD2B 3KFAA 4IX4A 3SW4A 3O8UA 1WZYA 2C5XA 2WPAA 4X3FA 4FSYA 4RLKA 3NIEA 4I6QA 3UC4A 5CZHA 2R3HA 5LVLA 5L2SA 2EU9A 5A6NA 3PY3A 3R1YA 2CCHA 3VWAA 1YHVA 1KUTA 5AFVA 4O4HF 3GFEA 2HOGA 5GINE 2XK6A 1OKVA 4QQ5A 1KOBA 1Q24A 4L3JA 3U9SA 3E8DA 3E92A 1OUYA 4ASDA 4EQMA 4KINA 3SLSA 4AW0A 2VWXA 1J1CA 4RJ7A 4HNUA 2BTRA 2PVNA 3ZO3A 3F6XA 3BLRA 4F7JA 3UMWA 3D4QA 4V0GA 5FD2A 2QNJA 3KMWA 3G33A 2XKDA 1GJOA 2QOIA 4FE2A 4G6NA 1P4FA 4FVRA 4G34A 3G9NA 1J1BA 4MVFA 5CVGA 4FNXA 3EOCA 2XBAA 3KN5A 4K77A 4L9IA 3LFQA 3R8MA 3T8OA 4C02A 4FFOA 3FUPA 3NYXA 4EZ5A 4FSUA 4QMOA 4DFYA 5A4TA 1U54A 4F0IA 2W05A 4ZTMA 3ENMA 4JS8A 5LMAA 3VRZA 4M97A 5DGZA 5CAEB 3VBVA 4HZSA 5FBNC 5B0XA 3RM7A 3DCVA 1WR2A 3DJ6A 2R86A 4L67A 2IVTA 4RIXA 5DYJA 5AUZA 2WB8A 5B2KA 3FSFA 5IEYA 4I5CA 1KBLA 4L1KA 1P2AA 3VOTA 2QLUA 5DRDA 2GQGA 4X3FB 2OLSA 4I0TA 4JG6A 4XOYA 4OTGA 2G2FA 4O0UA 1GSOA 5I9VA 3UQFA 3QHWA 2VX0A 4YJOA 3KULA 3WF8A 4BDCA 2ERZE 2V5QA 5E90A 3RAHA 4E6QA 3PA5A 4C4EA 1KEEA 3Q52A 1IRKA 4RC3A 4DFZE 2ETKA 4IFGA 5IQAA 4ZLZA 1CS0A 4H1MA 4D1XA 3VIDA 3NR9A 3BELA 4BRXA 4QTCA 5KMIA 4S31A 2R85A 2AUHA 2X8EA 4KAOA 4O82A 3QD3A 2WOTA 2P3GX 2A1AB 5IH4A 3IDCA 4PL4A 4U5JA 2QODA 4S2ZA 3NNVA 4L3PA 3A8XA 5CSVA 2BAJA 4EI4A 3LHJA 1ZOEA 1M2PA 3NPCA 5I0BA 2ZV2A 4DAWA 1PKGA 4FTJA 5A4EA 4HVSA 4F65A 4AS0A 3SE7A 1Q8ZA 2V0DA 4PTGA 4U81A 3VBTA 4FKPA 4JDJA 1AD5A 2Q0NA 3LQ8A 3ORNA 3S95A 3SA0A 5HBRB 1YDTE 1XHAA 5HG9A 3NAYA 3CEKA 4PDYA 1U54B 3LE6A 5D12A 3OUUA 3CR0A 4DH5A 1OM1A 4DYMA 1YOJA 2JEDA 3O50A 1JKSA 3D2IA 4I4FA 4IAKA 4MD8E 2XRWA 4O7WA 3ZUTA 3FKLA 2VUWA 2PUIA 4NT4A 3KXXA 2IG7A 4YJVA 2WTCA 2I0VA 1QPDA 4IWQA 4DITA 4USEA 3QTXA 4FV7A 3MN3A 4M15A 4HNVA 4J98A 3I81A 4FSRA 2DUVA 4G9CA 3P7BA 5IA1A 2GNJA 3ZYAA 2BDJA 1I7LA 4YBZB 3QFVA 4G5PA 1XBAA 1Z2NX 5HG5A 2JKOA 4TYEA 2W6OA 2HZ4A 5DNRA 3NUYA 3H0YA 4J97A 1H1WA 4ID7A 3DBQA 3D5UA 3EQBA 2I7QA 4JRNA 1RW8A 5KHWA 4EK6A 3PSDA 2JKKA 5EYKA 5C4KA 3BGPA 2PWLA 1TVOA 5L2TA 1M0WA 1OL7A 3DQXA 5D7VA 4ZS0A 2I8CA 4ZI7F 2JAMA 1AUVA 3BG5A 2WQBA 2VTHA 3UFXB 4NUSA 4ZTNA 4MXCA 4G9RA 5LA6F 5AX9A 4BKJA 4FZ6A 4B99A 3W8QA 4FFLA 2QC6A 5EOLA 2GHGA 2UW6A 2W6MA 4RIOA 3WZKA 1GIHA 3RINA 1MQBA 4XV2A 4AW2A 3KAKA 4R3RA 2YDIA 5I9XA 1PW2A 4MTAA 1Q5KA 2XNBA 3WBLA 3ZRLA 5J1VA 3R28A 4JG8A 5LVNA 3WF5A 1ZXEA 3UG1A 2XCLA 1IG1A 2VTMA 2GQRA 3HP5A 1W93A 4F9AA 3MJFA 4QQTA 3MWEA 1C30A 3QLFA 5LCKA 5HU9A 4EC8A 4BF2A 3BLQA 4DEEA 4JDKA 2R84A 2SCUB 1W8CA 2XCKA 4W4YA 3WE8A 4TNDA 4J52A 4JQEA 3HMPA 4F70A 3JZIA 4AT4A 4YR8A 4YJSA 4IJ9A 3Q3BA 2JDTA 3RM6A 2RKUA 2XNPA 3CIKA 4CGAA 4KWPA 3JS2A 2XIYA 4QP7A 3ORIA 5HHWA 4ZSEA 2ZYBA 3AC4A 3AT4A 3PLSA 4FI1A 5CB4F 3QRJA 4B8LA 1B6CB 3LCKA 3MY1A 4I3ZA 4KBCA 1WVYA 4QO9A 2NNWB 2B55A 4IAZA 3TM0A 2I87A 4KIOA 1P5EA 3NX8A 4IIJF 4FR4A 4JBPA 4KIPA 3PG1A 1LUFA 3GU6A 3GI3A 4FVPA 1ZMVA 3T9IA 2XF0A 4JDHA 4GJ3A 3LQ3A 4IQ6A 1U46A 3KRWA 3QRKA 5ANEA 5FQDC 3TZ9A 2JITA 5JRSA 5C8YF 2BIYA 4Z55A 5HBJA 4GYGA 1TQPA 5L8LA 2WHBA 5AWMA 4TV8F 1FVTA 5DWRA 5LYJF 2ITNA 1BI7A 4WIHA 3A7HA 3MWDA 4V01A 3UVRA 2W1ZA 4FV6A 3ZHPC 2O2UA 3MI9A 3ZU7A 4C58A 3D83A 5IQFA 3B2WA 3R7VA 3VULA 3GP0A 5J7HA 2VTSA 2Y4IB 5C8MA 3PXRA 4H36A 1BLXA 3P78A 4GH2A 3EFLA 4AZFA 3UZTA 2VGPA 3ANRA 5GJFA 2QOOA 5IQBA 1IOWA 5AV4A 3RV4A 4MF1A 3TXOA 2HXLA 4BCNA 5HQ0A 2VTOA 2JBPA 3RPSA 2Z8CA 5M4FA 1OITA 3HA8A 3WZDA 4EK8A 2HWPA 3P9JA 4FYNA 5AUTA 1ZOGA 2YZMA 1SVGA 2IZUA 3ORTA 2RF9A 3P7CA 1TQIA 2UW3A 2X9FA 4AN2A 4DTBA 3V3VA 1CSNA 1PYXA 1G3NA 5EQYA 5EQPA 4WUAA 4A9SA 4F4PA 4M67A 2Z04A 1LEZA 1CKIA 4X7QA 2B4SB 1FQ1B 3F61A 5FGKA 2H9VA 1AQ1A 1C3OA 4XG9A 3P86A 4YZDA 2XA4A 3OXIA 3P5KA 2YZAA 4EYMA 3D14A 4RPVA 1NA7A 1UV5A 5KCVA 4BCIA 3HYHA 5L3AA 4C5CA 4O4LF 3GOKA 3QD0A 2BZKB 4RZQA 2F7XE 3K3PA 4IX6A 5HE2A 1H0VA 4ANSA 1H1PA 3DT1A 4GV1A 4XYLB 3TIGA 5CAQA 4YO6A 4O7RA 4AGUA 3Q04A 4L42A 2X2LA 3GCUA 4AOJA 2HYYA 2IO6A 4BTKA 5HV6A 3MJ2A 4E5WA 3QKLA 1E1XA 4IB5A 1BL6A 3DA6A 1YDSE 4E4MA 3DTWA 1B38A 3AC1A 2Z7LA 4ZTLA 3PSBA 4O91A 4D5HA 4A9YA 2J0LA 4O7SA 4U8ZA 4S30A 4FL1A 1J91A 3DNDA 4RX9A 4HVDA 3GCQA 2R3OA 3C7QA 3HV4A 4G3GA 2YJSA 3OROA 4K2RA 3UYTA 2NP8A 2VTIA 3HRFA 3RPRA 4FTKA 3W16A 1MRVA 3F2AA 1SYKA 4GL9A 2CKOA 2W6PA 3BU5A 4E4TA 5DT3A 4G16A 2BRGA 3E63A 2VTRA 2BZHB 4FV4A 3VUMA 3VBXA 4LM5A 3PXYA 4O0VA 5HESA 4XEYA 3GQIA 4FFPA 2V55A 3U9CA 4OR5A 3MV5A 4D4YA 3EZVA 5IUIA 4DIMA 4B8MA 2W6ZA 2E9OA 4HCTA 4GEOA 3NUNA 4C2WA 3KXMA 2HZNA 4U7ZA 4IB1A 4AX8A 3QL8A 3U55A 2RG6A 5HCYA 3WE4A 1YXSA 2UW9A 5AP7A 4WO5A 3GC8A 1UU7A 4EBVA 4EH9A 1DS5A 5AAFA 2ZMDA 4HVHA 2YS7A 3DKOA 2OIQA 2WELA 5KKRC 3QRTA 4TKSA 5CYIA 4XBUA 4IAIA 1A48A 4UV0A 2QOBA 4PTEA 5FXQA 2R3GA 3DNEA 2JAVA 4RSSA 3A7FA 3DBDA 4Y72A 2QG7A 3RCJA 2F2UA 3ULIA 4MNEA 5K5XA 4OTQA 2R82A 3R1QA 4CFUA 4IWPA 4M0ZA 4YLKA 3U54A 4IHJF 3FHRA 5IQEA 3DKGA 5CF8A 3KB7A 4QNYA 3R83A 1Q41A 4BR3A 3P4KA 4A9UA 4NJ3A 3R30A 4GCJA 1UU8A 3VS5A 3RI1A 2VO7A 1KE5A 4F9CA 4G6LA 3IDBA 4AA5A 2V5AA 2UUEA 5EYCA 1PX2A 3QCQA 1WBOA 5EDQA 3F3WA 3ZUVA 3GENA 4KRCA 3KY2A 5KHXA 5J9LA 4IAFA 5GONF 4IH8A 2JDRA 2YHVA 4O38A 4ZIMA 1YWVA 1OKYA 4PDOA 2ZV8A 5E91A 3ZC6A 4DEIA 4X6RA 3TDVA 4LOQA 4M84A 3V8WA 3LXKA 5BVNA 1NY3A 2Z7QA 1PYEA 3MB6A 3ZBXA 1DIKA 4EBWA 5A14A 3JXWA 2JIVA 5HE3A 4IIRA 4BI1A 3TKHA 4GG7A 4JT3A 3TT0A 4E1ZA 3A62A 4Z16A 2HJWA 3H9OA 3H9FA 4IWDA 2AC5A 1W83A 4MXZA 1WVXA 2XM9A 3GT8A 3H4JA 4ONAA 3UC3A 3BYSA 4O6LA 4BCQA 1OIUA 4FX3A 2C1AA 5DEWA 2F7EE 1Y8YA 4YTHA 4MNEB 4QMMA 4E8AA 3V5PA 2YYAA 2OSCA 2ITUA 2F57A 2REIA 4P2KA 2WIPA 3PP1A 4ZP5A 3F5GA 4F1OA 4C2VA 4W4WA 3JR1A 3LQ5A 2WMWA 3OS3A 3REPA 4AAAA 4FYOA 3LFNA 1XBBA 3FLZA 4BI0A 1OGUA 3FXXA 4G6OA 2J2IB 4Z9LA 3HRCA 3WZUA 3RPYA 3K3IA 3AMBA 3KXHA 3EFJA 3QYZA 4AZSA 2JFMA 2GCDA 2WTWA 2B0QA 2PZIA 5IH6A 4OTRA 5AIKA 2PE1A 2OG8A 3VC4A 1HCKA 2QU6A 1OBDA 4YHJA 1FINA 4F1MA 3DU8A 5E8TA 2PZPA 3CY3A 3F5UA 4IX3A 3JRXA 2IP4A 5C1OA 2BDWA 5BPHA 5EG3A 4AGWA 4RC4A 3SAYA 3MA6A 5D11A 2WMBA 3IDPA 4BZNA 4FZFB 4XV9A 4UXLA 4WSYA 5M51A 2J90A 3PVWA 4O4IF 4IB0A 3HO8A 3WYXA 1ERKA 5FDPA 4XX0B 3EQIA 4BDEA 5EZYF 2XRUA 1UNGA 2VTQA 5F94A 4D1ZA 3Q4CA 4YLJA 4HNFA 2UZWE 3ZFMA 2UW5A 4IVDA 2Z7SA 3PLAE 4TWCA 4CQEA 2BRNA 3CQUA 3NZ0A 4N6ZA 1UVRA 3QYWA 5F95A 5HNBA 3UVPA 3LWBA 5GJGA 4IEBA 3UTOA 2OF2A 4QP8A 3HUBA 4ALWA 3H10A 5HVKA 3DOGA 4YPSA 4QP9A 4NYEA 3PIZA 2XBJA 3SRVA 3VQUA 2XK7A 4FIHA 4HGSA 1ND4A 3UZPA 3GU8A 3PY1A 5EHYA 4UBAA 2XNMA 4PNIA 4IDVA 5JSMA 4KIQA 2NU7B 4FFRA 5DT4A 3KL8A 3P0MA 5CT7A 4JL9A 5JVLA 4ZLOA 3R6XA 3IS5A 3I60A 1KE8A 3MFSA 5D10A 3LVPA 3NWWA 2WTKB 3FLYA 3QQGA 4IVBA 4GIIA 3L9LA 1GZ8A 3R9OA 2C5YA 3V01A 4DF3A 4D4SA 4PMPA 2BR1A 3K5UA 1PF8A 3SW7A 2G01A 1OIYA 3KMMA 4LOPA 2CJMA 4YTFA 3CJGA 5CU4A 4YTCA 5EYDA 4Z7GA 4M68A 3RGFA 3Q9WA 4FK3A 4ME6A 3SXFA 1PXMA 1B6RA 4OTWA 2CZGA 2IW8A 2O64A 4IC7A 5TOZA 4WG5A 1YRPA 3HV7A 4FK6A 4HPUE 5DN3A 1GLVA 3NNWA 3RZBA 1M6VA 2HK5A 2XKCA 3FPMA 3GC9A 4IAYA 4MXXA 4YC6A 5HNGA 3ZBFA 3TUBA 4U44A 2QOLA 3HVCA 4DGLC 5E8UA 2WXVA 3FL5A 3L9NA 3PA4A 2BUJA 1O9UA 4EHVA 4I4EA 4QMPA 4CLJA 3KN6A 4OBOA 4AZTA 5IDPA 4TWPA 2B1PA 4FBXA 4MD7E 3O0GA 2ZMCA 3DLZA 4EJ7A 2A19B 3VPCA 3ZLXA 4C4HA 5J87A 4XP2A 3UIMA 4FU0A 1VBGA 2YW2A 3DLSA 2BILB 3TV7A 4FV8A 2IVVA 3QZIA 4F63A 3ORRA 2OIBA 4F7SA 4EOLA 3WF6A 5C27A 5E4HA 4ZEGA 4CT1A 4LUEA 4OGRA 4GKHA 5M07A 4YUQA 4I0RA 4C3PA 4D4VA 2B9HA 1E1VA 4WOVA 3BGZA 4DN5A 4NH1A 3OEFX 3UDBA 3GUBA 4XG7A 4EEVA 4M7IA 2VWYA 5J2TF 3QXOA 5CWZA 3H0ZA 4FNZA 4M13A 4BTMA 3RPVA 1SZMA 4DH3A 4E6DA 4EC9A 2QCSA 3HDNA 2WGJA 4GT4A 4MXOA 3WI6A 1NVRA 4APPA 2R3QA 2W96B 3JVSA 3OHTA 4HOKA 4CRSA 3IW8A 2X2KA 3ZDIA 5BYLA 3FI3A 4J53A 4Y83A 5GIOE 1R0EA 3ANQA 3MJ1A 1URWA 3R73A 4O7LA 4XUFA 2W1HA 4LI5A 3KCFA 4CD0A 4CFXA 1H07A 4O0YA 3B8RA 4CTBA 3KXNA 4U43A 1M7QA 5I4NA 5DMXA 3R8ZA 1XKKA 4ZY5A 4P5QA 4UY9A 5JGAA 5EDPA 1CQJB 3EQDA 5JGBA 4YJ3F 5CA1F 3BU3A 5DVRA 3QX4A 3FJQE 4EOPA 5K4JA 2W99B 1H01A 2VWZA 1GZNA 4KKGA 5AP5A 5C1QB 5DEYA 2RL5A 3MPMA 2VTNA 1I09A 3VF9A 3WIKA 3OTVA 4CMTA 3ATTA 4MBIA 1IR3A 2A0CX 3PG3A 5C8KA 2R64A 4QMSA 1W98A 1K3AA 1OIRA 4BDIA 2YWPA 3Q6UA 2WD1A 4BTJA 3VAPA 5HG7A 3TJDA 3Q4UA 5I9ZA 3UODA 5BMMA 2VZ6A 2Z2WA 4FZDB 1RDQE 3HMNA 3K3JA 2O63A 2YRWA 3NEWA 1R78A 5AMNA 3GFWA 3OOGA 5CT0A 3QXPA 5E92A 3HLLA 3NIZA 4ZLYA 5CF6A 4J1RA 3PVGA 3OT3A 2IZRA 5AX3A 4LFIA 4BCKA 2ITVA 2NU6B 1UNLA 3PPJA 4EOQA 4TTHB 2WOUA 4BDJA 2X0GA 3GCSA 4H3QA 1H1SA 4MD9E 3EQCA 5F1ZA 4L7FA 4BDBA 4I94A 5T68A 5J9ZA 3F2NA 4G3CA 3PWYA 4FKOA 3PPZA 4I92A 3C50A 4YJPA 4EWHA 3G5DA 3I79A 2VWUA 2G1TA 3QKMA 1OECA 3FLQA 2H96A 3TDWA 1JKTA 1LR4A 4MCVA 4TWOA 5FM3A 4XG4A 4ZY6A 2R3FA 3EKKA 4RVLA 2PUPA 1GSAA 3WILA 5KKRB 4XS2A 4LYNA 4DBNA 3VBWA 5E7RA 5HO7A 5FBOA 3CS9A 3AD5A 4GFMA 1MRUA 2C0TA 5AP4A 4NWMA 1CMKE 4DEGA 3IG7A 4I41A 4A4XA 2WQNA 3UYSA 2KULA 1QPCA 1ZYSA 3C0IA 5BPYA 4UYAA 1OVEA 3SDJA 2Y0AA 4CKRA 2FVDA 4PTCA 4OTDA 4TWNA 3V5LA 2UW7A 2X6EA 4KRDA 4BHZA 4YJ2F 4DA5A 5AV0A 2IJMA 2R7KA 2HY0A 5EOBA 5F4NA 4QYFA 2PZYA 2WMAA 4F6SA 4DT8A 4KBKA 4H39A 2V7AA 2Y8OA 5TO8A 4G3FA 2C5NA 3PXKA 1BMKA 4EOKA 1JDEA 1K2PA 4QP3A 3Q4ZA 5IA3A 4NW5A 3DB8A 5CASA 4LRJA 2RG5A 3BLHA 3V5QA 1IAJA 3COKA 3Q6WA 4OLIA 3MY5A 4FKIA 3SD0A 2YS6A 1XQZA 1OBGA 3IW4A 4AFJA 4EUUA 3MH1A 2JDSA 4IJPA 2DQ7X 5DBXA 3E5NA 1EUCB 4MNFA 4O2PA 1Q99A 3OZ6A 4USFA 4WBNF 4XX9A 4ZMFA 1EHIA 3VS6A 4BICA 3FZSA 5B7VA 1VYWA 4DT9A 4FTOA 1FOTA 2OJFE 4TV9F 3A7IA 3ZFYA 4V04A 3Q5IA 4WNOA 3WNZA 3WF7A 4FKLA 4ENYA 4B0GA 4FKQA 2X0SA 1OI9A 2BIKB 2X8IA 2C00A 5JZJA 4F1TA 4DBXA 2YCFA 4I93A 4FEWA 4DLJA 1Y8GA 1SNXA 5B2MA 5JRQA 4K1BA 5EHLA 3TUCA 2WYOA 5CEQA 3E7VA 2IWIA 4TYJA 5CXHA 3G6GA 1R0PA 3R8VA 3ETHA 4FFNA 3UG2A 4AGCA 3R00A 3RCDA 2JDVA 4R1VA 3SXRA 3ZRMA 4EOJA 3L8PA 3RHKA 1W7HA 4GVJA 3ENHA 4M14A 2CGXA 1JKKA 2LAVA 2J51A 3G15A 1Y6AA 4S34A 4IW0A 2WTIA 5JFXA 4BIBA 3VRYA 3O71A 2C1BA 2WU7A 3TI1A 4CZUA 4KSQA 3MW1A 4CFNA 5A54A 3OUZA 2OBJA 3QTQA 2Z60A 2YITA 4OTHA 2R3MA 2Z02A 3S4QA 2ZDQA 2OFUA 4HQ6A 4DFUA 5CSPA 2P0AA 2X7OA 1F3MC 4J71A 4U0IA 4NM0A 4C3FA 5L2IA 4OT5A 5LOHA 2JFLA 2VO6A 3D7ZA 5CTPA 4FSMA 3SQQA 5BVDA 5A6OA 2FGIA 4DTKA 4DG0E 4R5YA 4Y73A 4F7NA 3MVMA 1ZRZA 2J0IA 3T9TA 4WKQA 4U42A 5AP1A 4RFYA 1BYGA 4M8TA 3R7IA 4MBLA 4DTAA 1E4EA 2XJ0A 3RWPA 3CLYA 4AF3A 5BVWA 3UNZA 2B9JA 3GOPA 3L9MA 1FVVA 5IDNA 3OWKA 4V0GB 2C6EA 4FA2A 3TNIA 4L46A 1GZOA 1SCUB 4KABA 5DR2A 4I22A 4EKLA 4GT5A 2YACA 5D9HA 4FSNA 1ZLTA 5FUTA 5ITAA 3PE2A 3T3UA 3EB0A 3QRUA 3FQEA 2O65A 2YIQA 3LJ2A 4H58A 4MXAA 3OWLA 3QHRA 2P2IA 5CLPA 4HPTE 3QRIA 1GIIA 3R21A 3AD6A 3MFUA 3COHA 5CI7A 4G3DA 3HMIA 3CTJA 4H1JA 3TCPA 4AP7A 4QPAA 1ZAOA 3FMMA 1F5QA 2QU5A 5DOSA 4AFEA 4YO4A 3CBLA 4JR7A 1PJKA 4E7WA 3LFBA 4RIXB 2QQ7A 4FZ7A 4PP7A 4RVKA 2PMOX 2C6LA 5DIAA 4ANMA 4G5JA 1PHKA 1MP8A 4X2KA 5HNIX 3POZA 4MV4A 4NL0A 4TN6A 3G2FA 2PVMA 2C68A 3RPOA 3Q1KA 3ZONA 3KULB 3DK6A 3U51A 1ZZLA 2PK9A 1O6LA 2GFCA 5HIDA 3PZHA 2VRXA 3PJ2A 3R7YA 1DAYA 4YZBA 4WG4A 4RWLA 3E93A 2UZNA 5DHJA 4D0WA 2BDFA 4TZRA 3C4XA 4BCFA 2RGPA 3RTPA 1FMKA 5CU3A 4BYJA 1URCA 3LIJA 4M0YA 4BYIA 5M53A 2ZM4A 3P1AA 2FSOX 4B9DA 4DFNA 4DH7A 5AEPA 2UV2A 1M0TA 2ZM1A 3AW8A 2R3RA 5ANKA 4ZTSA 5FTQA 3F5XA 3SC1A 5M57A 2ITYA 4TL0A 5CY3A 1REKA 3H3CA 1B39A 1J7UA 3DFCB 4MA0A 5HLNA 2OZAA 2J9MA 2QD9A 1M52A 4YAJB 1UKHA 4XYMB 5C01A 1OZ1A 2F9GA 4D55A 2CMWA 3MFTA 2PVLA 5BMSA 1ZY5A 3OD6X 3F82A 4I5MA 3QBNA 3ZO4A 5AUUA 3C4ZA 2UZOA 3AC3A 3F88A 3C4EA 4ACMA 5I5ZA 5IH5A 1GGOA 3KF7A 4CT2A 3DXNA 5L8KA 2RFDA 3I7BA 2JGZA 2QHMA 5CNNA 5J95A 4HNIA 4QOXA 1U5RA 3LFSA 2XK8A 3DPKA 3UO5A 4MV1A 2WTKC 2YIWA 4FG7A 3VUHA 4C4GA 5LWMA 1WMKA 3OOMA 5ACBC 3O96A 4WG3A 3TV6A 3UQGA 5LVPA 5C4LA 1KC7A 1IOVA 2JDOA 1O6YA 4UZHA 2OXYA 2YWVA 3A8WA 3DAEA 4QQJA 3R8LA 3W2OA 3E7OA 4FL2A 3OW3A 5L6PA 2QR8A 5IQCA 3RHXA 2PVFA 4LUDA 2W1FA 2HENA 5EH0A 3BWFA 2W1IA 5HG8A 4EQCA 3OVVA 2UW0A 1BX6A 5HE1A 3E62A 4RJ6A 3R9RA 2J5EA 5LCJA 4CVAA 1Z2OX 5G1XA 4MEDA 4WBOA 5B2LA 3L8XA 5M09A 4EYJA 2PY3A 4JQ8A 2B52A 3FZTA 3ORPA 4HNTA 1CKPA 3R9HA 5H3QA 5GIPE 4ZMEA 2GPHA 3MIYA 4AA4A 2OZAB 4EOIA 2HW6A 5CEMA 3HGKA 2W5AA 3V8TA 3QLGA 4TPTA 3ORLA 4C62A 3R5XA 1YXTA 2GHMA 3L8VA 4YJRA 3GCVA 4J8NA 5CU6A 5KO1A 4RLLA 2R7MA 4U79A 5FLFA 3KVWA 3TKIA 3C4WA 3QA8A 4UWBA 5CX9A 5FTOA 3V4ZA 5DR6A 1B6SA 3U6IA 1KE6A 4JG7A 4EQUA 3KRXA 4QTEA 3DDQA 3DBEA 3AG9A 4QP1A 4WHZA 5BUIA 2OLCA 2QOKA 2YDKA 3NYNA 3PJCA 2BROA 3CKXA 3KRRA 3LZBA 4FSWA 5EM8A 4F0FA 1JKLA 4FEUA 3O51A 4LRKA 3OUKA 4Y8VB 5BNJA 5F20A 2YEXA 4I0SA 1YXXA 2J0JA 3QAME 3FPQA 3JUHA 3ZO2A 4AN9A 4Q9ZA 2BAKA 3U9NA 4FZAB 4U40A 3VS3A 2WU6A 2HELA 4EZ7A 1OPKA 1WVWA 3UVQA 3TKUA 5HZNA 3U9TA 2ETRA 4QMTA 2X7FA 3E3BX 4ANQA 5HCZA 3VA7A 3DK3A 4YZCA 4LL0A 5AV1A 4BI2A 2IVUA 4QMXA 5J2UF 2O3PA 4L52A 3S3IA 2F49A 5HTCA 3NW5A 2R3LA 4Y5QA 4RX7A 4E73A 4J95A 4BDDA 4QMQA 3UO4A 3Q2MA 3EN4A 1VR2A 2EXCX 3PRFA 1VEBA 3R02A 4FIGA 4JJRA 2R7NA 3FMLA 3E8NA 3EQFA 2X4ZA 2R7IA 3SX9A 3FLWA 4HYIA 5E9EA 2ZDUA 3IKAA 4TXCA 5M4IA 4DEAA 1R39A 4CFVA 4CKJA 3OWPA 1PMUA 3JRWA 3QC9A 4MH7A 5HGIA 3RK9A 2XUUA 4LMUA 4QYYA 3KC3A 3TQTA 3EWHA 2YM8A 4AZVA 3OTUA 3VJOA 4RWIA 1H08A 4CZTA 5FP6A 3VS1A 4XZ3B 4CMOA 3F7WA 3AT2A 4WA9A 2I40A 3GEQA 4AG8A 2BAQA 4L3LA 4ZHQF 3V51A 4AGDA 3COMA 5M55A 2PBZA 2P33A 3KK9A 4ZSJA 2GPWA 5ICPA 3T3VA 1OUKA 1G8AA 4OTIA 4TY1A 4MAMA 2IN6A 4NFNA 4RZWA 3W2PA 4GW8A 3CP9A 4G31A 3LAUA 3KRLA 4S32A 4DHFA 4E93A 2CCIA 2PMIA 5BQ0A 4Y5HA 2YM7A 4TUYF 4QP4A 2YABA 4YB8B 4O0SA 4IE9A 3FHIA 1BKXA 2B9FA 4CSVA 4DFXE 5EKNA 4NJDA 1QL6A 5HI2A 1KOAA 4JDIA 4M3QA 4D4RA 2V22A 4FODA 3VF8A 4C5BA 4IX5A 4RIWA 4XLVA 1ZY4A 4CCUA 4EORA 2SRCA 5AV3A 3F7ZA 5DLSA 5BYZA 5A9UA 2XM8A 1U4DA 3MPTA 5L2WA 5JQ8A 3LFEA 4K11A 2A2AA 4IANA 5AM6A 5CEKA 5DRBA 5K3YA 5KMJA 3JY0A 3FC1X 3M42A 2QVSE 3ETAA 1KWPA 3A4OX 3PXQA 4GK2A 1UA2A 3CTHA 4HCVA 1XH6A 4DC2A 3ORKA 3RV3A 2PMNX 4C4JA 2GS7A 4F9BA 4JAIA 4YJTA 4LV5A 4I6HA 5J9YA 1KE7A 4MXYA 1H0WA 4L68A 5EFQA 4FKRA 4S33A 3UOHA 3QZFA 2H34A 3MBLA 4K0YA 3G0EA 3VBQA 3FKNA 3ETJA 5BVFA 4I4TF 5GNKA 3LFAA 2Z7RA 2DS1A 5FXSA 4EOSA 4WRGA 4FOCA 3ODZX 2GNLA 2JC6A 2QONA 2XIXA 2XMYA 3FDNA 4UXQA 3IONA 3FC2A 4FGBA 5L6OA 2XEYA 3IGOA 2GS6A 5LWNA 4LL5A 2XVDA 3ACKA 4GVAA 1GZKA 3NMUF 2XNGA 3KKVA 3UPZA 3MS9A 4DCAA 4KS8A 5I9WA 1RJBA 2WO6A 3W33A 2QKWB 4D9TA 4YSJA 2W0JA 2YAKA 5CNOA 4BGQA 3C9WA 5K4IA 5CENA 5IA4A 1OPJA 1U5QA 3CXWA 4RIWB 5EYMA 3ZMMA 4L44A 5DA3A 1V0OA 2PVHA 2CLQA 4IACA 4NFMA 4DFBA 4YURA 3EHAA 3KXZA 1PXLA 5HU3A 3TZ8A 3G90X 4ACCA 4ITHA 2BKZA 3K5IA 2R0UA 1OPLA 3Q9YA 5L6WL 4JR3A 1VZOA 4X6QC 4EH4A 2YIRA 5CANA 3MH3A 3AD4A 5LVOA 1PY5A 1YI4A 4UZDA 1QPJA 2PVKA 3QA0A 3RNIA 4BZOA 3QGWA 2GNIA 5BYYA 3QGYA 3TNHA 4ANLA 5E1SA 3LP8A 2ESMA 3CQEA 5CAUA 2BKKA 4M69B 3R7EA 2XD4A 1WBTA 2HWOA 4II5A 2XKFA 4ASEA 3Q32A 4QTAA 1Q61A 3LXLA 3S1HA 2WMUA 5KKNB 1UNHA 4ENXA 3GNIB 4HJOA 2R3PA 3D2KA 3SVVA 4L7SA 4IM0A 1WCCA 5F9EA 4RQVA 4UN0C 5KX8A 3R63A 4GFOA 5LMBA 2JIIA 5HLWA 3ZLYA 1A9XA 4EK3A 1YI3A 3BHVA 2OJ9A 2I1MA 4A4LA 3NYOA 4RFMA 2OXXA 3VQHA 2X39A 2C0OA 3EN5A 3NVMB 2XIKA 2PU8A 2YIXA 4FUYA 4EJNA 3ZTXA 3HBLA 4YJQA 2WFYA 2Y6MA 3ROCA 4NKSA 4DINA 3WZJA 4FV5A 3VUDA 1Y91A 3PJ3A 4RX5A 4ZY4A 4QNAA 3R9NA 4PWNA 3EL8A 4BHNA 3KEXA 3QX2A 1OB3A 3FE3A 4FKWA 3AX6A 4WBBB 5EM5A 1VYZA 4MV3A 3BV2A 2DYLA 1H27A 2C5OA 4L8MA 2RFSA 2R5TA 2WQOA 3V5JA 4QP2A 3ZSGA 4ANBA 4ERKA 3MESA 3QQFA 2IZSA 2QKRA 5CQWA 3I0OA 4RRVA 2OJIA 4FNYA 4EL9A 4FIFA 2PTKA 4FOBA 3N4TA 3TIZA 2ZDGA 3CPBA 1DAWA 3C13A 5A46A 2GSFA 3A2CA 3PE1A 2R3IA 2ZDHA 4YZMA 1Q8TA 3SOCA 2R0IA 2WZJA 3OMVA 4KS7A 1KV2A 4E20A 2BFYA 3CD8A 3V04A 3FYJX 4RIYA 1RE8A 3DGKA 3EMGA 4QYEA 2W6NA 3QUDA 4HYHA 3SG8A 4AQCA 4DLIA 2W70A 4C5AA 1PXPA 3OY1A 5H8BA 1ZYDA 5CU0A 4AA0A 2EXMA 2HW7A 3VUIA 3TJCA 5KMOA 4YHTA 4DG2E 5M08A 4NTTA 3FLSA 1DV1A 1AGWA 3F3ZA 4E6AA 2OGVA 3GCPA 1WAKA 5FRIA 5HTBA 3UP2A 3EQPA 5CF5A 2OF4A 3MA3A 1Y6BA 3HX4A 3BEAA 3ZSHA 5E8WA 3B2TA 3FYKX 4BDGA 4IZOA 1APME 5HE0A 4W4VA 1YQJA 4JLCA 3PTGA 3CJFA 5IA0A 5CU2A 2OJJA 2PUUA 3VUKA 4B7TA 3ZXTA 2NUAB 3TW6A 2C0IA 2G2IA 4RVMA 4ZSAA 2VWWA 3OG7A 5IEXA 5M4UA 4LRMA 4QT1A 1UWHA 3AMAA 4IDTA 1L8TA 4KBAA 1JPAA 2Q83A 1VJYA 3ZRKA 5IPJA 1WBNA 4K9YA 3NNXA 4YGAA 2GNFA 4QMYA 3S2PA 2CN5A 1UWJA 1O6KA 1SVEA 3AGMA 4FKSA 3KREA 4ALVA 4UX9A 1FGKA 4X2FA 3W8LA 4LOOA 4XG3A 3SRVB 4E5AX 3ULZA 1NVSA 2B9IA 4O81A 4BCJA 5JMSA 4E6CA 3DXQA 3R1NA 2QR7A 1CKJA 4R3CA 3GU7A 2PULA 4ZSGA 3S0OA 2H8HA 4PUZA 5AV2A 5TT7A 3BHYA 3Q4TA 2NU8B 3EKNA 4BY9E 3A99A 3DZQA 3TACA 2W1CA 3LXPA 4PMMA 5AP6A 3V8SA 3R22A 3A4PA 4C4IA 3BYUA 3QQHA 4R7BA 4C59A 3N8DA 1NXKA 5HX6A 2R3NA 4IWOA 3E8CA 4UEUA 4EH5A 3KAJA 4U45A 2YZGA 4CKIA 1JWHA 1OKZA 3QQKA 4FUXA 4JX7A 5H8EA 5JK3A 4HR7A 4ZTHA 2UZUE 2PVRA 1BI8A 4QPSA 5ETCA 2JKQA 4GG5A 3I12A 4MV7A 1M14A 5JH6A 4X21A 3HRBA 4IMYA 1XBCA 2OWBA 2OXDA 3Q53A 3ELJA 2NRUA 1FMOE 3THBA 4Q2AA 4L00A 4CEGA 4CCBA 2ZV9A 1RQQA 4BCPA 3ZDUA 3FMDA 2R87A 3ZCLA 3QQJA 4QYGA 3TEIA 5D1JA 5BUJA 3VN9A 4KKHA 3R2BA 4GU6A 4XG2A 3QZHA 3LFCA 2PL0A 1I44A 3CSVA 3Q96A 4BN1A 4Q5EA 5M4CA 4YJUA 4Z7HA 3DDPA 4XNEA 3FI2A 2P2HA 4IHPA 2E9UA 4O2BF 3EZRA 4JXFA 4AXAA 3TIYA 3FBVA 3QWKA 2CHLA 3BBWA 2W71A 1A06A 2UVXA 3HL7A 1JSVA 4WNMA 4U6RA 4X2JA 4BGHA 1WFCA 1Z5MA 3IOKA 3M2WA 2W06A 2XB7A 5DT0A 4C3RA 2ITOA 1H1QA 5I9UA 3K5HA 1DI8A 1WBVA 5IA5A 2R9SA 3OWJA 4FTTA 2C6TA 3OEZA 4OUCA 3FL4A 2BHHA 4L45A 1YXUA 4O83A 4XH6A 4NCTA 3Q2JA 2C3LA 4U41A 2XK4A 4XBRA 5JKGA 3II5A 3HDMA 3ALOA 3E87A 2JIUA 4P5ZA 2C3JA 1JBPE 3DBFA 2WMQA 5HVYA 4U97A 1R3CA 3V6RA 1CM8A 4AZWA 2X7GA 3L1SA 1PXJA 3NUPA 3CPCA 3VS4A 4CV8A 4PL3A 4QYHA 1DM2A 4GT3A 1R1WA 2HZ0A 4K8AA 4JQ7A 1IA8A 1LP4A 2I0YA 2QI8A 4AWIA 3BYMA 3V5WA 2ITZA 3DAJA 5G6VA 3KGAA 4IFCA 3M11A 4WNKA 4D2SA 3UE4A 4F7LA 5FEEA 3CGFA 2QLQA 3UNKA 3OBJA 4JBOA 4NM5A 5AP0A 4BCMA 4C33A 4R5SA 4LGHA 5E8YA 3LCSA 2BFXA 4TYIA 4EH6A 5CEPA 5LOVF 3KXGA 3VBYA 1KSWA 2P4IA 3AXWA 3COIA 3W1FA 5CVFA 1KJJA 4JBVA 3QKKA 4YZNA 5HVJA 4ACHA 3ZH8A 4F08A 3AQVA 4HVIA 2VR1A 4D5KA 1Q4LA 3KQ7A 2CNQA 2J0MB 2ONLC 3GB2A 3WARA 4MA5A 4F0GA 1XO2B 3LCOA 4AE9A 3G51A 1SMHA 2C5VA 3ZEWA 3DV3A 4PX6A 5CVHA 3DAKA 3VJNA 3VUGA 3ZO1A 2W9ZB 3VMMA 2ZB0A 1P14A 5M56A 3W55A 4BBFA 2YERA 1QCFA 3DBCA 2R2PA 3NUSA 4GS6A 4J8MA 5FG8A 3LFFA 5D41A 3FY0A 2IW6A 4GU9A 4NTSA 4R77A 5IYZF 1J7IA 3R71A 1PXOA 3TN8A 3MB7A 4KB8A 1ZMWA 3OP5A 2ZOQA 2FPGB 2Y6OA 4RBLA 2F2CB 2C3IB 5IQIA 4NZWB 4USDA 5JVDF 3KMUA 3LLAA 5BVKA 2BZIB 1Q8WA 3FV8A 3NAXA 4X2NA 4XMOA 5HICA 5HO8A 1T45A 4A9RA 3PVUA 1PXNA 4FV0A 3H9RA 3QWJA 2W17A 2OICA 3LMGA 3HA6A 3WYYA 3BHHA 3FXWA 3BPRA 2X81A 3LKMA 4QTBA 3ZZWA 4DGOA 1ZMUA 2PUNA 3R0TA 2PN1A 4R3PA 1QPEA 4AOIA 3IPHA 1PKDA 3EYHA 3O17A 3ZXZA 3AC2A 3I5ZA 5HD7A 2UW8A 3MSSA 3I1AA 3P08A 4UWYA 3WZEA 4P90A 1KJ8A 4CTCA 5J8IA 1OL5A 3FMJA 3C5IA 1EZ1A 4DGNA 2UVZA 4MV8A 5KBRA 3VS2A 4WUNA 2C47A 3HZTA 4H3PA 3F3VA 3PWDA 2HCKA 2W7XA 4ZS4A 3WO0A 2PSQA 3JVRA 3OCTA 3TWJA 1E9HA 4O4JF 1KE9A 3FEGA 5HD4A 5EI6A 3QUEA 4JVGA 4CG9A 3DFAA 3KF4A 3E64A 3ZFXA 1DI9A 2X1NA 2R4BA 1CDKA 4EUTA 3ROYA 1J3HA 1H25A 1YHWA 2W1EA 4FT7A 4XYFA 5FTGA 2YCRA 3R9DA 4N6YA 2WQMA 2WIHA 1XJDA 3AT3A 4YNOA 3LXNA 4O2ZA 3SGCA 3BEGA 1W96A 2PMLX 3LM5A 3ATSA 3TZMA 5KMNA 4GYIA 2VO3A 1M2QA 2CDZA 3LLTA 3A7JA 3HUCA 4QMLA 4YBKA 5E8SA 5LARA 1BXRA 2G15A 4X3JA 1GAGA 2FO0A 3LMIA 1UU9A 4DFLA 3C1XA 4E4XA 1Q97A 5CF4A 2XNOA 4C38A 2C6IA 2FB8A 1IAHA 4AACA 3OCGA 3QC4A 2P0CA 4DEHA 4YMJA 2WQEA 2IPXA 2VTAA 3HKOA 3MPAA 1H1RA 1M17A 1ATPE 4L53A 3PSCA 4OBPA 3U6HA 2WMSA 4ZK5A 4ITIA 4PNKA 2QG5A 2YN8A 5H8GA 1ULZA 2AC3A 1JLLB 5BX0A 4FIEA 4FTUA 3RP9A 4D2RA 2XP2A 2QOFA 4AOTA 3AGLA 3PJ1A 4ZAUA 3HAMA 1EUDB 3FI8A 5JFVA 2VQDA 2J9GA 3MIAA 3CE3A 2FB9A 4FVQA 4YSMA 2PZRA 5E8XA 5HKMA 3BU6A 3MVJA 3R5HA 4XRJA 4YHFA 4OT6A 3AC5A 3DZOA 2R7LA 4IZAA 3DXPA 3UPXA 2ZV7A 3EFKA 2NRYA 1SM2A 2YZNA 1I7NA 2FH9A 2XK3A 4ZZMA 1GNGA 2B54A 4QTDA 2PE2A 2C4GA 3I0QA 4F09A 2ETMA 5HLPA 4AT3A 4RJ3A 5DG5A 4WRSA 4AU8A 3L8SA 3VW6A 3F5PA 5C8NA 3OUNB 3UBDA 2DWCA 1ZOHA 3ID6C 4WT6A 4EGQA 2VGOA 3I6UA 3TNQB 5LQFA 4EK5A 4JRVA 4XP3A 3PDTA 4G1WA 2VX1A 3CQWA 4O27B 5JFSA 4IZ7A 4I23A 3BYVA 3I4BA 3D7TA 2W9FB 2YAAA 3BX5A 3GU4A 3W32A 1GSHA 4KUJA 1YOMA 2OW3A 2B7AA 4D28A 4FSTA 4HGTA 4XOZA 4O86A 4CRLA 4IVCA 4EKKA 5HORA 3BV3A 3MFRA 3FMHA 2CGUA 3BE2A 2BRBA 3EFWA 2OJGA 2VD5A 2FA2A 2JLDA 3QTWA 3FLNC 1E4EB 1YHSA 2V59A 2G9XA 4M9UA 3O8TA 4GUEA 3QFFA 4KSPA 2ITXA 2VTPA 5E8ZA 5BUEA 3A60A 3RJCA 4EOOA 3SOAA 3UZRA 3VS7A 1GY3A 2OFVA 2VWBA 4N70A 5J1WA 4TRLA 2CSNA 2VNYA 2QO7A 3OBGA 3F3UA 5HIEA 4H3BA 1A9UA 5KE0A 2F7ZE 1YWRA 3BGQA 4IM2A 4PY1A 2YM4A 3RAKA 3LFDA 3HEGA 4G2FA 4QMVA 3GU5A 1WBPA 2XK9A 3QCXA 5TR6A 4I20A 4NKAA 4NW6A 4E4LA 3NLBA 4XCUA 4BDHA 3OF0A 3AC8A 4JIKA 5M06A 4FNWA 5JH7F 3WOWA 3K5VA 4RZVA 3ALNA 1YXVA 3OY3A 3RMFA 3FMEA 4QRCA 4FKUA 4OBQA 4U3YA 3D15A 4MHAA 4DE4A 3PFQA 4FMQA 5ETFA 3DY7A 5JZNA 4A7CA 3OXTA 3ZZEA 3D5XA 4EOMA 4Y8DA 3D7TB 4EHGA 4O7YA 5JFWA 3NW6A 2ZJWA 4OW8A 3ACJA 3N4UA 5JQ5A 3ZEPA 1F0QA 2WMXA 4IZ5A 2E9NA 2ITPA 1PRYA 4RFZA 3ZOSA 3HP2A 1SVHA 4D9UA 2XIZA 2X4FA 1V0PA 2KTYA 4I1ZA 5ANOA 3FZPA 1BUHA 3BBTB 3SHEA 5JGDA 2V7OA 1XH8A 2R3JA 3DTCA 3C51A 4GKIA 4I6FA 2GDOA 4O21A 1MQ4A 4ASZA 3NSZA 5H2UA 3PIXA 2HY81 1V0BA 4FT9A 4W8DA 4YTIA 3KRJA 2X6DA 2UVYA 2CKEA 3U8WA 4ZZOA 3W18A 2FP4B 3BWJA 3EQGA 2VX3A 3TL8A 4BB4A 2YJRA 3BI6A 3E5AA 4XV1A 2XZSA 3ORMA 4O0XA 4FKJA 3JPVA 4JBQA 4O0RA 4FEQA 5KMMA 4O2AF 4GJ2A 4KKEA 3W2SA 2O8YA 4FTAA 4G17A 1M7NA 3HV3A 4XV3A 2GTMA 2ONLA 3K54A 3CKWA 4U3ZA 5AUVA 4C36A 3ZM9A 4PMSA 4BTFA 4E5BA 4B6LA 4YLLA 5K5NA 2Y4PA 2I80A 4KD1A 2J50A 4RA4A 4XG6A 4ZXTA 5IMEA 4FTIA 3N51A 2ZDTA 4TW9A 3C0HA 4L43A 2XJ2A 4RA5A 2W6QA 2NO3A 3R01A 4PDPA 4KA3A 5AA9A 4BBEA 1JDBB 1JSTA 2YL2A 3TUDA 2IZTA 4YNEA 5EI2A 2A4LA 3NS9A 4FTNA 4BCHA 3F66A 5ANDA 4GK4A 4F9WA 1W84A 1GOLA 4HYUA 4LV8A 5FXRA 3FZ1A 3QCYA 2YCSA 5CSWA 1M2RA 4WD5A 2J7TA 4RG0A 5C03A 5BVOA 4NIFB 5IUHA 5ACKA 2FUMA 1DV2A 2GHLA 2FSLX 4CG8A 5K9IA 5IF1A 4MWHA 2X9EA 3IQ7A 1H4LA 4JX3A 5EKOA 3MTFA 4F99A 4P7EA 1JOWB 1Z57A 2OH0E 5AUYA 5IQGA 5KX5F 2Y7JA 1IA9A 5HIBA 2UW4A 2ZVAA 4TNBA 3JY9A 4C35A 3UIUA 2HGSA 4YAKB 2HAKA 3E3PA 4RMZA 4DCEA 3CC6A 4QQCA 4FT5A 3RK7A 1YOLA 3R7OA 3WIGA 4WNPA 2DLNA 1KJIA 3E8EA 3N4VA 4MQ1A 4MWIA 3L9PA 5AUWA 2E2BA 1Q3DA 4IADA 4BBMA 3PUPA 3I6WA 2WEVA 1K9AA 5A3XA 4A07A 2OI4X 4FIIA 2WKMA 3LJ0A 3IW5A 3K2LA 3PYYA 4Q9SA 4FIJA 4XJ0A 3VNTA 3FSKA 3P7AA 5LJJA 2B53A 3PVBA 4RJ8A 2W4OA 4I55F 4O7ZA 4ZOGA 1Q3WA 3AOXA 3EN7A 4EH8A 5KMLA 5FEQA 4R7HA 1T46A 4FEXA 2I0EA 4RX8A 4O0WA 4FTRA 4E26A 2CGVA 5GJDA 1OIQA 4IC8A 2XJ1A 1OL2A 3EQRA 4C4FA 4YP8A 5CALA 2PVJA 2OKRA 2YDJA 3QALE 3MYGA 4GFGA 1W82A 3AMYA 3GVUA 5IA2A 4ZQIA 3IK3A 1X8BA 1U59A 3QCSA 3W2QA 4FL3A 5IU2A 3BCEA 4JAJA 2OK1A 3FI4A 3Q5ZA 3EN6A 3W2CA 4DH8A 5EM7A 2BTSA 2WMRA 3QZGA 3LOKA 3DJ5A 2BPMA 2C69A 5LVMA 2W1DA 3GLKA 4KNBA 3D0EA 4APCA 3HNGA 3QTIA 5AA8A 4GSBA 4HYSA 5C26A 4UWCA 4BGGA 5C9CA 2E9PA 3O7LB 5FDXA 1YKRA 4C61A 2C3KA 5KNJA 4ZJIA 2GQSA 4ACGA 3I7CA 1CTPE 4FV1A 5AADA 3MH2A 3R8UA 2QF7A 2CLXA 1XR1A 4H05A 2ACXA 3ORQA 1H28A 5CXZA 5AAGA 2OU7A 3NCGA 3Q9ZA 3TG1A 4HVGA 3IW7A 4YU2A 1XH4A 2UZVA 4RGJA 2WMTA 5ETIA 3GGFA 3ORZA 2CGWA 2J6MA 4QMUA 3ZUUA 1BNCA 4P4CA 2CPKE 2YM5A 3FY2A 4FTMA 3EN9A 1NT2A 4C7TA 1OL1A 4HCUA 4IM3A 3ITZA 4NCTC 3SG9A 1G8SA 1OMWA 2LGCA 4BDKA 1AUXA 3BYOA 1XH5A 3MVHA 1JQHA 4EH2A 2WMVA 5IISA 5H80A 3MDYA 1UKIA 3Q2OA 4PL5A 5E8VA 3MY0A 5T3QA 2BALA 5CA0F 3KALA 4PQNA 4MKCA 2C6DA 1VBHA 3M1SA 5D7AA 1SNUA 4RVTA 4ZJVA 2DZDA 3CD3A 4FGRA 2EB3A 1MRYA 2CKQA 2UZTA 4FSQA 3MH0A 4RWJA 3RAWA 1J7LA 1NVQA 2UZBA 3SXSA 5JN2A 5LMKC 3LPBA 3C4CA 3MVLA 4ZZNA 4FT3A 4AT5A 4N4SA 2WTJA 3ZLWA 1JSUA 5CSHA 5CEOA 3TNPC 2VTLA 3ERKA 3I5NA 5AAEA 4R6VA 4PP9A 4MV6A 4BZDA 4YJNA 2GMXA 3FMKA 3QD4A 4BC6A
chains in the Genus database with same CATH superfamily
3IECA 5CEIA 5EQEA 3RWQA 3TTIA 3OW4A 4R7IA 1V1KA 3EJ1A 4IAAA 4QP6A 4EG0A 5DH3A 2VWVA 4F6UA 2OH4A 2QOCA 1G2WA 2XNNA 4HW7A 2DWBA 1JKJB 3MWUA 2IW9A 3WF9A 3DQWA 2DIKA 5D8DA 4FG8A 3DKCA 3QF9A 2CN8A 2UZLA 3A7GA 4N0SA 4EZ3A 1CKNA 4RCNA 1TQMA 3R23A 1T36A 3E88A 3LW0A 3U87A 4ZJJA 2PVYA 3P23A 5CI6A 1GIJA 5ANIA 3TTJA 2YA9A 4RJ4A 3TINA 2GTNA 1QMZA 4CFMA 4PMTA 3GXLA 4LG4A 4ACDA 2ERKA 4PRJA 2QHNA 1IEPA 1REJA 2RFNA 3BQCA 5DAAA 3HB9A 2UZEA 3PA3A 5JT2A 3POOA 1IASA 1PXIA 4FG9A 3IO7A 2ITQA 5JQWA 5AP2A 1Q8YA 3HMOA 2HVSA 5TF9A 3P79A 5CAVA 5IMXA 4FICA 1WBWA 2GS2A 4AW5A 1YI6A 5LP6F 3T9DA 3RKBA 4A06A 4TYHA 4FV2A 5DFPA 5CM0A 1ZYJA 3F69A 5LXMA 3TV4A 3OCBA 1H8FA 3ET7A 4PF4A 5I5UA 2Y9QA 3HECA 4W4XA 5DPVA 1YWNA 3C5UA 3FXZA 4IWYA 1VKZA 4TYGA 2JD5A 3IOPA 4XHKB 3EYGA 5EW9A 4YC8A 5BVEA 3U4WA 2JBOA 4EONA 3TIIA 4DLKA 4FKVA 4CFWA 3ORXA 4AAYA 5M44A 1TKIA 3KU2A 3NW7A 4RJ5A 3JYAA 2Q0BA 4J99A 2A1HA 4AN3A 3G8DA 2ZGIA 2WTVA 2VTJA 5KZ0A 1PK8A 2ZAZA 1WBSA 3LCTA 3NCZA 2PZ5A 3O7LD 3GC0A 4BDAA 3UOKA 3BKBA 5IG1A 1CKNB 1L3RE 2QK4A 5ETAA 2V58A 3UYYA 4X3FC 4EWQA 4JI9A 2COGA 4ALUA 5CSXA 1ZYCA 5C1PA 3LMHA 3UQCA 4HGLA 3F3TA 1IYEA 3KK8A 5AUXA 3G9LX 3UIXA 5H9BA 2GU8A 2VWIA 3ODYX 2XYNA 5EM6A 3R7UA 3VHEA 3PPKA 4W8EA 4MAOA 5BPFA 3D94A 2F4JA 2ITTA 2VTTA 5CS6A 3R1SA 3CCNA 4DEDA 1BL7A 5AM7A 2R3KA 4QSHA 3KA0A 2YRXA 3QTZA 3EIDA 3DKFA 3PY0A 4MK0A 4CNHA 4ZSLA 3RVGA 4EQ5A 1XWSA 3EH9A 1EH4A 3G6HA 4FTLA 4RC2A 2H6DA 3EL7A 4TYHB 2HXQA 2QOHA 3UOLA 2R7BA 2E9VA 2JKMA 3LCDA 4LQMA 4BDFA 3U6JA 2CNVA 3RALA 4FKTA 4DG3E 1CQIB 4F9YA 2BVAA 2XH5A 2W4KA 2PYWA 2PVPA 2BCJA 5IEVA 4MV9A 4FT0A 1KJQA 2QURA 3NUXA 3VW8A 2IVSA 2WNTA 3R5FA 4I50F 4ARKA 3QTSA 1YDRE 4O0TA 3LULA 3V5TA 2XCHA 3BE9A 1OKWA 4F64A 3DJ7A 4CLIA 1FPUA 3FZOA 2OWOA 3OFMA 4FV3A 4XG8A 3RFCA 5AIRA 3FZRA 2WEIA 3C0GA 3IW6A 3NUAA 5A4CA 1PMNA 2YISA 3GC7A 1PMEA 4K6ZA 4AE6A 2CFMA 5BWVA 4ZTQA 1JVPP 2EB2A 5FR9A 4AUAA 3QQUA 3VS0A 3TY8A 5BMVF 2W4JA 1EKVA 5HCXA 2J5FA 3D5VA 4NM7A 1OL6A 3KCKA 3PJ8A 3R2YA 2HDKA 2HIWA 1HOWA 4RIYB 4V05A 3SV0A 2XYUA 3F2RA 4DGGA 2C6KA 5KUPA 5LXTF 5DR9A 3GBZA 1PXKA 3PXFA 3UGCA 4L6QA 2VU3A 3GIDA 3MGYA 4EHEA 5IQDA 4YPDA 5E1EA 3BACA 5L8JA 3UOJA 4BIEA 4I5HA 3KVXA 2PHKA 3FQHA 3H30A 4FFMA 3ZS5A 1Z9XA 4ZOLF 1S9IA 3UP7A 2G2HA 3W1BA 5IZFA 3DF7A 2XEZA 2VN9A 4U80A 4O6EA 2RIOA 3DS6A 3UIBA 5A4LA 2VNWA 4O22A 3PRIA 3QTUA 4JNWA 1EYZA 2XS0A 2RFEA 3BHUA 5CZIA 3ZLSA 3LM0A 2W1GA 3O2MA 5FM2A 2OZOA 3PZEA 3UO6A 2P55A 5AJQA 4CV9A 3NVKI 3ZM4A 1V9PA 4BCGA 5HBHA 2YM3A 4ORKA 2O5KA 4NM3A 4EK4A 4J7BA 2C30A 4I5PA 3UZOA 4F6WA 1CE8A 4M12A 5HEZA 2VAGA 3A61A 1P4OA 2V62A 3CY2A 4FC0A 4IBMA 3ZC5A 4BVUA 1Z2PX 5KMKA 2BRMA 1LEWA 2PE0A 3BQRA 3NUUA 4LMNA 3D9VA 4BIDA 4QMNA 5KZIA 2J4ZA 2ZB1A 4UB7A 2YM6A 4FTQA 4UYNA 2PPQA 5FEDA 3CGOA 5AP3A 3Q60A 2ODTX 1FGIA 3O8PA 4K33A 4C34A 2AYPA 5KBQA 3N6RA 4DGMA 1FVRA 3NDMA 4QMWA 2VO0A 4GIHA 1MUOA 2EWAA 4GMYA 4D1SA 1XH7A 2CKPA 1YW2A 2C6MA 2OIDA 3HV6A 3O23A 3DB6A 3R04A 4G3EA 4X2GA 3SKCA 4HGEA 3NNUA 3DK7A 2FYSA 2HZIA 4QDEA 2FPPB 2BHEA 3VHKA 4Z3VA 2GLTA 4R78A 4Y46A 5EDRA 3RUPA 3OCSA 5EK7A 3TNWA 2CNUA 4FV9A 3UNJA 3QU0A 3Q9XA 1ZZ2A 4J96A 4PDSA 4PV0A 4UALA 2W5HA 5I9YA 2VPQA 1JAMA 1S9JA 1G5SA 3S00A 4GK3A 3G8CA 1UU3A 2EUFB 4I24A 3V6SA 4CMUA 1KJ9A 5FNVF 2EVAA 3OXZA 4D0XA 3UDZA 5EHOA 5JQGF 2XKEA 4L01A 4AZEA 4CXAA 4UCTA 3L2PA 4OTFA 3MTLA 3UJGA 5A4QA 1HCLA 3FQSA 2X2MA 3QUPA 1H26A 2YZLA 4I6BA 4XP0A 3W10A 5CQUA 3VPBA 3UZBA 5JEBA 4MBJA 4HZRA 4EH7A 5LMKA 1JLUE 4ASXA 5CAPA 1H24A 5DE2A 4EH3A 2YCQA 1KV1A 4K18A 4Y85A 3VVHA 4N57A 2Y4IC 2GFSA 3OC1A 4MQ2A 5EW3A 3LJ1A 4RT7A 3UMXA 1YVJA 4ITJA 2ITWA 3CTQA 1W0XC 3D5WA 3FAAA 3WO1A 5EW8A 4AW1A 4IZYA 2FPIB 5IUGA 2NPQA 4A9TA 4FSZA 2BZJA 4TT7A 2QO9A 1PMVA 5DI1A 4FKGA 4C0TA 2A27A 3PIYA 1Q8UA 5ANGA 3ZSIA 4EHZA 2I6LA 5IQHA 4GRBA 2X8DA 4O7VA 3NGAA 4C37A 3PP0A 2XNEA 2GNGA 2VV9A 3C4FA 4X0MA 4B4LA 2QOQA 4Q5HA 2ZM3A 2FSMX 3QTRA 4ERWA 3OT8A 4CFFA 1JNKA 4MYGA 3TZ7A 2O0UA 5ANJA 4U9AA 4O84A 3G0FA 1ZWSA 4LGGA 4EGJA 1FBNA 3N9XA 4O7TA 5TKDA 2WAJA 4GUBA 4NU1A 4RQKA 5CAOA 5HX8A 3RK5A 2GPSA 2NU9B 3VO3A 4FEVA 4IB3A 3GQLA 2BRHA 3HAVA 2XIRA 1XH9A 2GNHA 3BZ3A 4QMZA 4YBJA 4YZ9A 4NSTA 3FKOA 2BMCA 2WTDA 3FMNA 4JIAA 4Y95A 3R8PA 4R1YA 4D58A 4DDGA 4XLIA 3QQLA 4BCOA 3NYVA 1H00A 3IGGA 4MX9A 3NRMA 3B8QA 3W2RA 2YIYA 3HV5A 2J0KA 4RWKA 1LPUA 3FWQA 4DH1A 1NW1A 2QO2A 3JZFA 4O7NA 5FP5A 2UZDA 3F9NA 2C6OA 2FSTX 3BIZA 3HMMA 4MUQA 4NK9A 1Y57A 4FTCA 5EI8A 2OO8X 3RAIA 2W5BA 5HBEA 5GHVA 4O96A 2I0HA 4A4OA 5J5SA 1Q62A 3BHTA 3BRBA 3PXZA 4XRLA 4DEBA 1IYDA 2QB5A 4YC3A 1ZARA 4ZTRA 3EQHA 4JOAA 4I21A 3U4UA 2YFXA 5T6KA 3V4SA 1STCE 4E4NA 1I2LA 4IVAA 3QD2B 3KFAA 4IX4A 3SW4A 3O8UA 1WZYA 2C5XA 2WPAA 4X3FA 4FSYA 4RLKA 3NIEA 4I6QA 3UC4A 5CZHA 2R3HA 5LVLA 5L2SA 2EU9A 5A6NA 3PY3A 3R1YA 2CCHA 3VWAA 5BWWA 1YHVA 1KUTA 5AFVA 4O4HF 3GFEA 2HOGA 5GINE 2XK6A 1OKVA 4I6LA 4QQ5A 1KOBA 1Q24A 4L3JA 3U9SA 3E8DA 3E92A 1OUYA 4ASDA 4EQMA 4KINA 3SLSA 4AW0A 2VWXA 1J1CA 4RJ7A 4HNUA 4E6NA 1EKPA 2BTRA 2PVNA 3ZO3A 3F6XA 3BLRA 4F7JA 5BWUA 3UMWA 3D4QA 4V0GA 5FD2A 2QNJA 2XARA 3KMWA 4Q4CA 3G33A 2XKDA 1GJOA 2QOIA 4FE2A 4G6NA 1P4FA 4FVRA 4G34A 4UCRA 3G9NA 1J1BA 4MVFA 5CVGA 4FNXA 3EOCA 2XBAA 3KN5A 4K77A 4L9IA 3LFQA 3R8MA 3T8OA 4C02A 4FFOA 3FUPA 3NYXA 4EZ5A 4FSUA 4QMOA 4DFYA 5A4TA 1U54A 4F0IA 2W05A 4ZTMA 3ENMA 4JS8A 5LMAA 3VRZA 4M97A 5DGZA 5CAEB 3VBVA 4HZSA 5FBNC 5B0XA 3RM7A 3DCVA 1WR2A 3DJ6A 2R86A 4L67A 2IVTA 4RIXA 5DYJA 5AUZA 2WB8A 5B2KA 3FSFA 5IEYA 4I5CA 1KBLA 4L1KA 1P2AA 3VOTA 2QLUA 5DRDA 2GQGA 4X3FB 2OLSA 4I0TA 4JG6A 4XOYA 4OTGA 2G2FA 4O0UA 1GSOA 5I9VA 3UQFA 3QHWA 2VX0A 4YJOA 3KULA 3WF8A 4BDCA 2ERZE 2V5QA 5E90A 3RAHA 4E6QA 3PA5A 4C4EA 1KEEA 3Q52A 1IRKA 4RC3A 4DFZE 2ETKA 4IFGA 5IQAA 4AXCA 4ZLZA 1CS0A 4H1MA 4D1XA 3VIDA 3NR9A 4CE5A 3BELA 4BRXA 4QTCA 5KMIA 4S31A 2R85A 2AUHA 2X8EA 4KAOA 4O82A 3QD3A 2WOTA 2P3GX 2A1AB 5IH4A 3IDCA 4PL4A 4U5JA 1S68A 2QODA 4S2ZA 3NNVA 4L3PA 3A8XA 5CSVA 2BAJA 4EI4A 3LHJA 1ZOEA 1M2PA 3NPCA 5I0BA 2ZV2A 4DAWA 1PKGA 4FTJA 5A4EA 4HVSA 4F65A 4AS0A 3SE7A 1Q8ZA 2V0DA 4PTGA 4U81A 3CEBA 3VBTA 4FKPA 4JDJA 1AD5A 2Q0NA 3LQ8A 3ORNA 3S95A 3SA0A 5HBRB 1YDTE 1XHAA 5HG9A 3BL9A 3NAYA 3CEKA 4PDYA 1U54B 3LE6A 5D12A 3OUUA 3CR0A 4DH5A 1OM1A 4DYMA 1YOJA 2JEDA 3O50A 1JKSA 3D2IA 4I4FA 4IAKA 4MD8E 2XRWA 4O7WA 3ZUTA 3FKLA 2VUWA 2PUIA 4NT4A 3KXXA 2IG7A 4YJVA 2WTCA 2I0VA 1QPDA 4IWQA 4DITA 4USEA 3QTXA 4FV7A 3MN3A 4M15A 4HNVA 4J98A 3I81A 4FSRA 2DUVA 4G9CA 3P7BA 5IA1A 3DTGA 3HT5A 2GNJA 3ZYAA 2BDJA 1I7LA 4YBZB 3QFVA 4G5PA 4PZ7A 1XBAA 1Z2NX 5HG5A 2JKOA 4TYEA 2W6OA 2HZ4A 5DNRA 3NUYA 3H0YA 4J97A 1H1WA 4ID7A 3DBQA 3D5UA 3EQBA 2I7QA 4JRNA 2EIYA 1RW8A 5KHWA 4EK6A 3PSDA 2JKKA 5EYKA 5C4KA 3BGPA 2PWLA 1TVOA 5L2TA 4TVIA 3PFFA 1M0WA 1OL7A 3DQXA 5D7VA 4ZS0A 2I8CA 4ZI7F 2JAMA 1AUVA 3BG5A 2WQBA 2VTHA 3UFXB 4NUSA 4ZTNA 4MXCA 4G9RA 5LA6F 5AX9A 4BKJA 4FZ6A 4B99A 3W8QA 4FFLA 2QC6A 5EOLA 2GHGA 2UW6A 2W6MA 4RIOA 3WZKA 1GIHA 3RINA 1MQBA 4XV2A 4AW2A 3KAKA 4R3RA 2YDIA 5I9XA 1PW2A 4MTAA 4DHJA 1Q5KA 2XNBA 3WBLA 3ZRLA 5J1VA 3R28A 4JG8A 5LVNA 3WF5A 1ZXEA 3UG1A 2XCLA 1IG1A 2VTMA 2GQRA 3HP5A 1W93A 4F9AA 3MJFA 4QQTA 3MWEA 1C30A 3QLFA 5LCKA 5I5TA 5HU9A 4EC8A 4BF2A 3BLQA 4DEEA 4JDKA 2R84A 2SCUB 1W8CA 2XCKA 4W4YA 3WE8A 4TNDA 4J52A 4JQEA 1X9NA 3HMPA 4F70A 3JZIA 4AT4A 4YR8A 4YJSA 4IJ9A 3Q3BA 2JDTA 4UCSA 3RM6A 2RKUA 2XNPA 3CIKA 4CGAA 4KWPA 3JS2A 2XIYA 4QP7A 3ORIA 5HHWA 3SGIA 4ZSEA 2ZYBA 3AC4A 3AT4A 1EKFA 3PLSA 4FI1A 5CB4F 3QRJA 4B8LA 1B6CB 3LCKA 3MY1A 4I3ZA 4KBCA 1WVYA 4QO9A 2NNWB 2B55A 4IAZA 3TM0A 2I87A 3CSWA 4KIOA 1P5EA 3NX8A 3PN1A 4IIJF 4FR4A 4JBPA 4KIPA 3PG1A 1LUFA 3GU6A 3GI3A 4FVPA 1ZMVA 3T9IA 2XF0A 4JDHA 4GJ3A 3LQ3A 4IQ6A 1U46A 3KRWA 1ST4A 3QRKA 5ANEA 5FQDC 2JITA 5JRSA 5C8YF 2BIYA 4Z55A 5HBJA 4GYGA 1TQPA 5L8LA 2WHBA 5AWMA 4TV8F 1FVTA 5DWRA 5LYJF 2ITNA 1BI7A 4WIHA 3A7HA 3MWDA 4V01A 3UVRA 2W1ZA 4FV6A 3ZHPC 2O2UA 3MI9A 3ZU7A 4C58A 3D83A 5IQFA 3B2WA 3R7VA 3VULA 3GP0A 5J7HA 2VTSA 2Y4IB 5C8MA 3PXRA 4H36A 2COJA 1BLXA 3P78A 4GH2A 3TYKA 3EFLA 4AZFA 3UZTA 3AKKA 2VGPA 3ANRA 5GJFA 2QOOA 5IQBA 1IOWA 5AV4A 3RV4A 4MF1A 3TXOA 2HXLA 4BCNA 5HQ0A 5K2MA 2VTOA 2JBPA 3RPSA 2Z8CA 5M4FA 1OITA 3HA8A 3WZDA 4EK8A 2HWPA 3P9JA 4FYNA 5AUTA 1ZOGA 2YZMA 1SVGA 2IZUA 3ORTA 2RF9A 3P7CA 1TQIA 1A0GA 2UW3A 2X9FA 4AN2A 4DTBA 3V3VA 1CSNA 1PYXA 1G3NA 5EQYA 5EQPA 4WUAA 4A9SA 4F4PA 4M67A 2Z04A 1LEZA 1CKIA 4X7QA 2B4SB 1FQ1B 3F61A 5FGKA 2H9VA 1AQ1A 1C3OA 4XG9A 3P86A 4YZDA 2XA4A 3OXIA 3P5KA 2YZAA 4EYMA 1G8JA 4UFZA 2DAAA 3D14A 4RPVA 1NA7A 1UV5A 5KCVA 4BCIA 3HYHA 5L3AA 4C5CA 4O4LF 3GOKA 3QD0A 2BZKB 4RZQA 2F7XE 3K3PA 4IX6A 5HE2A 1H0VA 4ANSA 1H1PA 3DT1A 4GV1A 4XYLB 3TIGA 5CAQA 4YO6A 4O7RA 4AGUA 3Q04A 4L42A 3W0PA 2X2LA 3GCUA 4AOJA 2HYYA 2IO6A 4BTKA 5HV6A 3MJ2A 4E5WA 3QKLA 1E1XA 4IB5A 1BL6A 3DA6A 1YDSE 4E4MA 3DTWA 1B38A 3AC1A 2Z7LA 4ZTLA 1I1KA 1UC9A 3PSBA 4LH6A 4O91A 4D5HA 4A9YA 2J0LA 4O7SA 4U8ZA 4S30A 4FL1A 1J91A 3DNDA 4RX9A 4HVDA 4DQNA 3GCQA 2R3OA 3C7QA 3HV4A 4G3GA 2YJSA 3OROA 4JMQA 4K2RA 3UYTA 1A0IA 2NP8A 2VTIA 3HRFA 3RPRA 4FTKA 3W16A 3TEKA 1MRVA 3F2AA 1SYKA 4GL9A 2CKOA 2W6PA 3BU5A 4E4TA 5DT3A 4G16A 2BRGA 3E63A 2VTRA 3TW7A 2BZHB 4FV4A 3VUMA 3VBXA 4LM5A 3PXYA 4O0VA 5HESA 4XEYA 3GQIA 4FFPA 2V55A 3U9CA 4OR5A 3VPDA 3MV5A 4D4YA 3EZVA 5IUIA 4DIMA 4B8MA 2W6ZA 2E9OA 4HCTA 4GEOA 3NUNA 4C2WA 3KXMA 2HZNA 4U7ZA 4IB1A 4AX8A 3QL8A 4UCOA 3U55A 2RG6A 5HCYA 3WE4A 1YXSA 2UW9A 5AP7A 4WO5A 3GC8A 1UU7A 4EBVA 4EH9A 1DS5A 4NZNA 5AAFA 2ZMDA 4HVHA 2YS7A 3DKOA 2OIQA 2WELA 5KKRC 3QRTA 3BAAA 4TKSA 5CYIA 4XBUA 5FPOA 4IAIA 1A48A 4UV0A 2QOBA 4PTEA 5FXQA 2R3GA 3DNEA 2JAVA 4RSSA 3A7FA 3DBDA 4Y72A 2QG7A 3RCJA 2F2UA 3ULIA 4MNEA 5K5XA 2Q7DA 4OTQA 2R82A 3R1QA 4CFUA 4IWPA 4M0ZA 4YLKA 3U54A 4IHJF 3FHRA 5IQEA 3DKGA 5CF8A 3KB7A 4QNYA 3R83A 1Q41A 4BR3A 3P4KA 4A9UA 4NJ3A 4AXDA 3R30A 4GCJA 1UU8A 3VS5A 3RI1A 2VO7A 3KIOC 1KE5A 4F9CA 4G6LA 3IDBA 4AA5A 2V5AA 2UUEA 5EYCA 1PX2A 3QCQA 1WBOA 5EDQA 3F3WA 3ZUVA 3GENA 4KRCA 3KY2A 5KHXA 5J9LA 4IAFA 5GONF 4IH8A 2JDRA 2YHVA 4O38A 4ZIMA 1YWVA 1OKYA 4PDOA 2ZV8A 5E91A 3ZC6A 4DEIA 4X6RA 3TDVA 4LOQA 4M84A 3V8WA 3LXKA 5BVNA 1NY3A 2Z7QA 3VNNA 1PYEA 3MB6A 3ZBXA 1DIKA 4EBWA 5A14A 3JXWA 2JIVA 5HE3A 4IIRA 4BI1A 5I5SA 3TKHA 4GG7A 4JT3A 3TT0A 4E1ZA 3A62A 4Z16A 4CKCA 2HJWA 3H9OA 3H9FA 4IWDA 2AC5A 1W83A 4MXZA 1WVXA 2XM9A 3GT8A 3H4JA 4ONAA 3UC3A 3BYSA 4O6LA 4BCQA 1OIUA 4FX3A 2C1AA 5DEWA 2F7EE 1Y8YA 4YTHA 4MNEB 4QMMA 4E8AA 3V5PA 2YYAA 2OSCA 2ITUA 2F57A 2REIA 4P2KA 1I1MA 3GB8B 2WIPA 3PP1A 4ZP5A 3F5GA 3W0RA 4F1OA 4C2VA 4W4WA 3JR1A 3LQ5A 2WMWA 3OS3A 1A3GA 3REPA 4AAAA 4FYOA 3LFNA 1XBBA 3FLZA 4BI0A 1OGUA 3FXXA 4G6OA 2J2IB 4Z9LA 3HRCA 3WZUA 3RPYA 3K3IA 3AMBA 3KXHA 3EFJA 3QYZA 4AZSA 2JFMA 2GCDA 2WTWA 2B0QA 2PZIA 5IH6A 4OTRA 5AIKA 2PE1A 2OG8A 3VC4A 3NFFB 1HCKA 2QU6A 1OBDA 4YHJA 1FINA 4F1MA 3DU8A 5E8TA 2PZPA 3CY3A 3F5UA 4IX3A 3JRXA 2IP4A 5C1OA 2BDWA 5BPHA 5EG3A 4AGWA 4RC4A 3SAYA 3MA6A 5D11A 4GLXA 2WMBA 3IDPA 4BZNA 4FZFB 4XV9A 4UXLA 4WSYA 5M51A 2J90A 3PVWA 4O4IF 4IB0A 3HO8A 3WYXA 4LDTA 1ERKA 5FDPA 4XX0B 3EQIA 4BDEA 5EZYF 2XRUA 1UNGA 2VTQA 5F94A 4D1ZA 3Q4CA 4YLJA 4HNFA 2UZWE 3ZFMA 4EFEA 4AQKA 2UW5A 4IVDA 2Z7SA 3PLAE 3TMOA 4M0JA 4TWCA 4CQEA 2BRNA 3CQUA 3NZ0A 4N6ZA 1UVRA 3QYWA 5F95A 5HNBA 3UVPA 3LWBA 5GJGA 4IEBA 3UTOA 2OF2A 4QP8A 3HUBA 4ALWA 3H10A 5HVKA 3DOGA 4YPSA 4QP9A 4NYEA 3PIZA 2XBJA 3SRVA 3VQUA 2XK7A 4FIHA 4HGSA 1ND4A 3UZPA 3GU8A 3PY1A 5EHYA 4UBAA 2XNMA 4PNIA 4IDVA 5JSMA 4KIQA 2NU7B 4FFRA 5DT4A 3KL8A 1P16A 3P0MA 5CT7A 4JL9A 5JVLA 4ZLOA 3R6XA 3IS5A 3I60A 1KE8A 3MFSA 5D10A 3LVPA 3NWWA 2WTKB 3FLYA 3QQGA 4IVBA 4GIIA 3L9LA 1GZ8A 3R9OA 2C5YA 3V01A 4DF3A 3T9FA 4D4SA 4PMPA 2BR1A 3K5UA 1PF8A 3SW7A 2G01A 1OIYA 3KMMA 4LOPA 3DAAA 2CJMA 4YTFA 3CJGA 5CU4A 4YTCA 5EYDA 4Z7GA 4M68A 3RGFA 3JZ6A 3Q9WA 4FK3A 4ME6A 1FVIA 3SXFA 1PXMA 1B6RA 4OTWA 2CZGA 2IW8A 2O64A 4IC7A 5TOZA 4WG5A 1YRPA 3HV7A 4FK6A 4HPUE 5DN3A 1GLVA 3NNWA 3RZBA 1M6VA 2HK5A 2XKCA 3FPMA 3GC9A 4IAYA 4MXXA 4YC6A 5HNGA 3ZBFA 3TUBA 4U44A 2QOLA 3HVCA 4DGLC 5E8UA 2WXVA 2HVRA 3FL5A 3L9NA 3PA4A 2BUJA 1O9UA 4EHVA 3NC0B 4I4EA 4QMPA 4CLJA 3KN6A 4OBOA 4AZTA 5IDPA 4TWPA 2B1PA 4FBXA 4MD7E 3O0GA 2ZMCA 3DLZA 4EJ7A 2A19B 3VPCA 3ZLXA 4C4HA 5J87A 4XP2A 3UIMA 1CKOA 4FU0A 1VBGA 2YW2A 3DLSA 2BILB 3TV7A 4FV8A 2IVVA 3QZIA 4F63A 3ORRA 2OIBA 2EJ2A 4F7SA 4EOLA 3WF6A 5C27A 5E4HA 4ZEGA 4CT1A 4LUEA 4OGRA 4GKHA 5M07A 4YUQA 4I0RA 4C3PA 4D4VA