4O7NA

Saicar synthetase (type-2) in complex with adp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
b'EVYEGKAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 233
sequence length 233
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7nA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7nA02
3EYHA 1H1SA 2P0AA 5C4LA 5CVFA 4BHNA 2ZMCA 2HCKA 1XWSA 3NRMA 3P78A 2C30A 3CE3A 2XK7A 4M67A 4WBOA 4XOYA 4N70A 3WF8A 3H10A 4D9UA 5B2LA 2R7MA 2ESMA 5E8WA 3EQPA 5J9ZA 3FSFA 1V1KA 4DT9A 1G5SA 3FI8A 4I5HA 2BRBA 3S3IA 3UYTA 4XS2A 3RM6A 3ZLYA 4O7RA 2JAMA 3IW5A 2PUIA 3KN6A 4GYGA 4BIBA 3V5JA 1T45A 2ZM3A 2RFNA 3LFBA 4BGHA 1AUXA 1PYXA 3UZTA 4GL9A 3W2OA 3WF7A 5CSXA 3COIA 3I0OA 2R3FA 4FIEA 2OKRA 4FFMA 3DF7A 1YI6A 1XH9A 1TKIA 4PDSA 1OB3A 4O86A 3FV8A 3QA8A 2WQMA 4IB0A 4EOMA 2DS1A 2JDSA 3MW1A 3QTZA 1R0EA 1FVRA 4ZXTA 4RBLA 3R9HA 3SRVB 1JDBB 4Z7HA 1H1RA 4BIEA 4GT5A 3OBJA 1C30A 2ZJWA 4BDKA 4G9CA 4EHVA 5BYYA 5GJDA 3VMMA 5KZIA 1UWHA 2E9PA 3KRXA 2GHGA 2ITZA 3FDNA 3UZPA 4E5AX 2WEIA 5H2UA 2PULA 1Q97A 3UO5A 3MFTA 3IOKA 3D83A 4EHEA 1IAJA 1AQ1A 2AC5A 4GJ3A 4J96A 3KGAA 1FVTA 3NUPA 5ANOA 2PN1A 2HY0A 3D15A 1R0PA 1WMKA 3A62A 3KREA 2XKDA 2OSCA 3PRFA 1G8AA 4RJ3A 3ZDUA 4ZSEA 4D55A 5HZNA 4QMQA 4QP9A 4RMZA 1JSUA 5D12A 4LUEA 3P5KA 1FPUA 5DEYA 2PVRA 5GHVA 4FTJA 4LRMA 1KV1A 3ZO1A 1JWHA 3MH3A 3PP1A 3QX2A 2ITPA 4LRKA 4DBXA 3KVXA 3MFUA 1DAWA 4M7IA 4YO6A 1W82A 1DI9A 1O9UA 4UZDA 3LMIA 3DXQA 1PXKA 3MA6A 4YAKB 4GVAA 3WZDA 4N6ZA 4UXQA 2DLNA 3H9OA 4ENYA 5IF1A 4F64A 2PU8A 4XV3A 5CYIA 5AJQA 3FLZA 3HRFA 4DTKA 3R23A 3HV3A 3CD8A 5I9XA 4YJVA 4KIOA 2V62A 5AUTA 2BVAA 3QTXA 3RJCA 4L3JA 4ZY6A 2BR1A 1JKTA 1OPJA 5LXTF 5LP6F 2WEVA 4MV3A 4DG2E 5TT7A 3R7EA 1GIHA 3VS5A 3UMWA 2WFYA 4MBIA 1YVJA 5FLFA 3PXZA 1PXJA 5HBJA 2QO7A 4KAOA 4L45A 5HX6A 3QUDA 5HEZA 3VS1A 4D4VA 5L2WA 3Q32A 2NPQA 2ZVAA 4G1WA 3AT2A 5HE1A 1G3NA 1KSWA 3I5NA 3AMAA 3O2MA 2IO6A 3ZM9A 3PRIA 3A4PA 4U7ZA 3VBYA 3TIYA 3I7BA 4XG3A 3QRKA 2BFXA 2GSFA 2Y4IB 3ANQA 3FZTA 3LJ2A 4GK2A 3O7LD 5FEDA 4YJOA 2FSOX 4YJTA 4DIMA 4ZTQA 3HAMA 4QYEA 3KF4A 1WCCA 3LFCA 2VU3A 4RWJA 4FEWA 4FG9A 4FGBA 3ALNA 4C4JA 4FSYA 5L6PA 1EUCB 2Z2WA 4NW6A 5L8JA 4ZJIA 3KRLA 2VWZA 2XEZA 3GU5A 3TM0A 1W7HA 4ACGA 4IBMA 4RC2A 4EBWA 4RZWA 1YDSE 3GC9A 2LGCA 3RAIA 4JS8A 1OBGA 4OT6A 4GU9A 2VTSA 1RDQE 4A9TA 3UFXB 1OL7A 4E6DA 5BVEA 4XG8A 4O6LA 3R7VA 4GK4A 3E8DA 4MTAA 3WF9A 4KD1A 4AW1A 3EB0A 3LFSA 5HHWA 5ACBC 4HW7A 2JAVA 2Z7SA 3IDCA 2ITVA 4E8AA 5I4NA 2P33A 5IQBA 4C62A 4C61A 3NCGA 2W6MA 3EL8A 4MEDA 4PY1A 5D10A 4BDAA 3CKWA 2PVNA 4ZEGA 2O64A 3FYJX 3WZJA 3Q1KA 4XCUA 4TT7A 5GONF 2YIRA 4ACDA 2VTQA 5A46A 4EGQA 4UWYA 4YU2A 1U46A 3EQHA 5AUVA 4QMZA 1ZAOA 4P2KA 1PMVA 5DN3A 2B4SB 2RFEA 4IM3A 4PWNA 3FQHA 3HL7A 3LQ5A 4EOKA 4WT6A 4F99A 4A9RA 4EH6A 3PE2A 5A14A 4HPTE 2F7EE 5A4QA 3TDVA 2HY81 3CY2A 3FY0A 1OPKA 1SVEA 3TTIA 5CF4A 3WO1A 2BTSA 1GIJA 1SNXA 2RIOA 3FMNA 4UZHA 4L53A 4CFFA 2VV9A 4J99A 2CJMA 2VGPA 2IVTA 3CR0A 4K11A 3CXWA 2PTKA 3ORIA 4IH8A 4W4VA 5AA8A 2CMWA 3EHAA 1M0TA 1U54B 2VX3A 4ZSJA 4FFNA 5IUIA 3DV3A 2QOFA 4C33A 3A7FA 3HMNA 3R8PA 4BCQA 2GS6A 1K9AA 2YACA 1XHAA 2OJIA 3FLWA 4O27B 4WG3A 2R7NA 2NRYA 4M8TA 2DYLA 4FOBA 1Y91A 2PSQA 4RIOA 4KKEA 3CCNA 1RE8A 4YBJA 4AZWA 5DVRA 3N51A 4BCPA 4BN1A 1YRPA 1JVPP 3DK3A 5BVFA 1BYGA 1CTPE 2O2UA 3TKHA 4XNEA 4F70A 4ZTMA 4YJ2F 5CB4F 3KQ7A 3QQGA 2GS2A 4XUFA 1PJKA 3W1FA 5CF6A 4U0IA 2YS7A 4HYIA 4BDIA 3L9PA 3T3UA 3R02A 5A4EA 3VUIA 2IVUA 3VJNA 3D7TA 2I87A 1KJ9A 3EFWA 3QD4A 2JDOA 2R0UA 4GG5A 4LL0A 2CNQA 3FSKA 2GLTA 3ZRKA 3KXNA 3AC2A 5DT3A 2GFSA 4FU0A 2X7OA 3AXWA 4R1VA 3VN9A 2XRWA 3FKOA 1R3CA 3AC4A 4CFNA 1YOMA 5HVKA 3V5TA 1URCA 3MS9A 3R30A 3FMDA 3MJ1A 2GQSA 1B6SA 4FKVA 4D2SA 4EK3A 4FT9A 5IA0A 2XK9A 4R78A 5E8UA 2VZ6A 3KXHA 4MXAA 3IG7A 3G0EA 4RIXA 5JFXA 4DFUA 4BY9E 3DKOA 2EU9A 3HMMA 4TYIA 4B6LA 2OF4A 4MV1A 3THBA 1KOBA 1B6RA 5TKDA 3ATTA 5GIOE 1E9HA 2CNUA 4LOOA 5C8NA 2UW8A 5CU3A 3R71A 4IAYA 4C34A 3ETJA 3KKVA 2WMQA 5M56A 3MVHA 1KOAA 4ASXA 3H4JA 5IDNA 1CM8A 3GC8A 2WQEA 4CG9A 3LQ8A 5BMVF 4IIJF 3C0IA 3O0GA 2ZDGA 4NWMA 3LFEA 4ASDA 2JD5A 4I22A 1QPCA 3KXMA 4QTCA 4JOAA 2R4BA 4ME6A 4RA4A 3V04A 2QOBA 4HPUE 3W8QA 3CQUA 4CTCA 2B54A 4O84A 4EC9A 4YO4A 4MV4A 2V0DA 3C5IA 2BKZA 3ZDIA 5F1ZA 1ZYJA 2J9GA 2PWLA 3Q04A 4ZTRA 4RC4A 4BCJA 5JQWA 2WELA 3TN8A 4CRLA 3IO7A 3WI6A 3R21A 4YZNA 4L00A 3QHRA 4FEXA 3MDYA 4X2JA 5M08A 3WYYA 5AP5A 3TDWA 5AM6A 1WR2A 2QR8A 3RPRA 4BVUA 5IDPA 1Q8TA 2OJJA 4ANLA 3R5XA 4YLKA 4HYSA 2UZTA 3O51A 2DZDA 4RGJA 3COKA 4MXZA 3TZMA 4DEIA 3BCEA 3SG8A 4DEBA 3POZA 5E4HA 3QRUA 4QPAA 4FA2A 4ZTNA 3LP8A 3IW4A 1ZZ2A 3ACKA 5KKNB 4DTBA 4O4HF 5FNVF 3OY3A 3GCQA 3JZFA 4XLVA 2R2PA 2DQ7X 3ORTA 3DLSA 5E91A 5FXQA 5FD2A 1G8SA 4E7WA 2Z7LA 4I1ZA 3A7GA 5DR2A 1Y57A 1GNGA 2I40A 1JOWB 2W1EA 4YHJA 3UG1A 4UALA 3CP9A 3UJGA 3HDMA 4MNFA 3R1NA 4QP6A 4BTFA 4L44A 2CLXA 3PXFA 4BZOA 1GY3A 1HCKA 5CEQA 3IK3A 2GU8A 4U81A 3ZFMA 4RWLA 4XV1A 4DH1A 5HBRB 2IVVA 2BALA 5FTOA 3KCFA 5CSPA 1RW8A 4C4FA 3BBTB 3AD4A 4EUUA 2DUVA 3N8DA 3SAYA 5JGAA 4JNWA 1JQHA 3TZ8A 3QL8A 4QYFA 3K3PA 4FFOA 4C5AA 4F0IA 1KE9A 4L7FA 3VF9A 2ZV2A 3WIKA 4FEVA 4I4EA 3KY2A 4FSZA 4II5A 1KC7A 4C4IA 1IEPA 3VRZA 4IFCA 2BRMA 1IA9A 4MNEB 3RK7A 4CKIA 4P7EA 4P90A 4Z3VA 4RX8A 1JAMA 1K2PA 2W9FB 4DH3A 2JDTA 2JIIA 3NX8A 3OC1A 3IDBA 5DFPA 3HZTA 3ZBFA 3OW3A 4BI2A 4DLKA 5DLSA 4XZ3B 1OMWA 3CTQA 4HYUA 4FV9A 3Q2MA 3PYYA 2WXVA 2VWBA 5I9YA 2YL2A 4WUAA 4RIWA 4YJQA 4C3RA 4OR5A 3SGCA 3Q4CA 4F1OA 2YDIA 3DGKA 3DZQA 4IWOA 2UZVA 3M2WA 3PSBA 3TIZA 2H34A 5LXMA 3LZBA 3RFCA 1Q3DA 4RPVA 2FPIB 3VNTA 4PMTA 2NP8A 2P55A 3WBLA 3ZRMA 3NPCA 5BUIA 3I0QA 3LFFA 3QZIA 1LEWA 2FYSA 4KNBA 4XYLB 2C47A 4F6SA 3EQDA 1A06A 5F20A 2VTLA 3VRYA 2R7BA 5LCJA 1ND4A 4L1KA 1YXVA 3LCKA 3FZOA 3D5VA 4FEUA 5EW8A 2P3GX 5CF5A 1TQIA 4TNBA 4U97A 1UU3A 2QHNA 2YA9A 1KUTA 2VAGA 4NM0A 4GU6A 1KWPA 4DLJA 5CQUA 4EHGA 2FSLX 2QOKA 4YP8A 4EK4A 2YM6A 3AD6A 4FIHA 5BQ0A 5KBRA 2HWOA 2W1CA 3C5UA 3NMUF 3UIXA 4QQCA 4MAMA 2B9FA 1F5QA 3G9LX 4ZLYA 5CSVA 1GIIA 3QWJA 4USDA 3TW6A 2Q0NA 3VOTA 3VUDA 3PJ3A 4FV7A 3PLAE 5D8DA 4E26A 3HVCA 3QHWA 1W0XC 4YTHA 3U8WA 2XCHA 3DFAA 1LR4A 1P5EA 4FKPA 3R2YA 1H0WA 1NXKA 2GNJA 4DH8A 5HTBA 3PIXA 5M53A 3PPJA 4BCHA 3ATSA 1SZMA 4RSSA 2XVDA 3VBTA 2PUUA 4F1TA 3NUAA 1CKIA 4Y72A 3L9MA 2BRHA 2PUPA 3NZ0A 4QQTA 4EZ3A 3Q2JA 4QOXA 3BYSA 3CTHA 4M0YA 4PQNA 2ETKA 2W0JA 3AGLA 3FEGA 4HGLA 5IQEA 3FQEA 4IAZA 3CTJA 4X3JA 1E4EA 1MQ4A 2W17A 3U87A 1P4FA 1FMKA 2I7QA 3FI2A 2XK3A 3PLSA 1WBNA 4XX9A 3EYGA 2BCJA 3E7OA 3ELJA 3NVMB 5FM3A 5DMXA 4ZY4A 4M14A 1YW2A 4ANQA 2CCHA 2PY3A 4D4YA 1JDEA 4NTSA 3ZZEA 4HZRA 4JIAA 3FXZA 4IANA 2IW6A 2C5VA 3BQRA 1KE7A 5IQFA 4S34A 3UQGA 4C36A 3F5UA 3S1HA 5CVGA 4C0TA 4O0WA 2OK1A 4PDOA 1JPAA 3E8NA 3B8RA 4FYOA 4QYHA 4L6QA 5BVNA 1BUHA 3N4TA 4O6EA 3QA0A 4YJPA 1Y8YA 4EYJA 2ITXA 2X1NA 4KA3A 4B99A 5HU9A 4BICA 2Z02A 3ZXZA 2CPKE 3NDMA 4EKKA 4JAIA 5I9UA 4ITIA 4N4SA 4L9IA 2YM3A 3MIYA 4FOCA 3BEGA 4O0RA 5GJFA 3R1QA 4D5HA 1JLLB 2PUNA 2PE0A 4RRVA 4A07A 4I5CA 1LEZA 5JRSA 4BBMA 2ZM4A 3R8LA 4FKLA 2VTPA 3KVWA 4DE4A 2XK8A 4FKWA 4HCTA 4ONAA 4RJ8A 4K33A 5E8SA 3Q53A 1H00A 1ZOGA 5I9WA 4JVGA 5LVMA 2UZEA 2B9JA 5J9LA 3GQIA 1YWNA 4OUCA 2SCUB 3A8XA 2R84A 1UVRA 3ULIA 5HI2A 4F4PA 4GK3A 5KMIA 1J91A 3DFCB 3R1YA 5LVPA 4WSYA 4ZI7F 2PYWA 2GCDA 3NAXA 4ANBA 2W6PA 2E9OA 4I3ZA 2WQNA 4OBQA 1FGKA 4EOOA 1I7NA 3U9SA 2OIQA 2YCSA 3E88A 4IJPA 5BPFA 4U41A 5EHOA 2FO0A 1XJDA 2X8IA 3MTLA 4JG6A 4RVMA 3ZXTA 4AT5A 5LVOA 2A0CX 5D9HA 4CQEA 5LOVF 2UW6A 3ERKA 3IECA 3LHJA 5EI2A 5LQFA 3VAPA 2C3LA 3RP9A 1Z57A 4RQVA 1JKSA 3RK9A 5A54A 5FP5A 3QZFA 3IPHA 1K3AA 3MVLA 3MPTA 2HWPA 2P0CA 5EQYA 5JT2A 4OT5A 1AUVA 3O8UA 2F49A 4O82A 3C4CA 3EFLA 2YCRA 4KWPA 5HNGA 3EQFA 2DWBA 5L6OA 2JDVA 1GGOA 2PVYA 2OFUA 2PVMA 4G3FA 1H25A 3GOKA 4IWQA 1ZMUA 2I0EA 4I24A 2XNBA 4TTHB 5M57A 4L7SA 3K2LA 3G6HA 2C0OA 2HOGA 3F5XA 4J1RA 4JBOA 2CN5A 2W6ZA 3DY7A 3LLTA 1Z5MA 3GC0A 3PUPA 4AZEA 4TN6A 4EOJA 1JSVA 1PMUA 2VRXA 4Y95A 4EUTA 4O7SA 2QO9A 4GS6A 4LMNA 1OBDA 2P4IA 4FV2A 3TACA 4DG3E 1IOWA 3GU8A 3QKLA 3LCOA 3OCBA 2PMOX 4FZ6A 5AUWA 2IJMA 3S95A 4DEEA 1SVGA 3DJ5A 4K9YA 4S31A 3FXWA 4FMQA 4BCOA 2I80A 4E1ZA 1PF8A 1Y8GA 4M15A 2VWVA 2OBJA 3BYMA 4ASEA 5CA0F 4PL4A 5H8GA 4U42A 5FDXA 3GVUA 5HVYA 4I4FA 3V5PA 4PP9A 4X2NA 4YHFA 3UC4A 5GJGA 5AX9A 4I41A 3DA6A 3KU2A 5K3YA 3EZRA 4LUDA 2XZSA 3UVPA 4FVRA 4AT3A 2JKMA 4D9TA 3F9NA 5JEBA 2YWPA 1Z2NX 3UIUA 3E8EA 4O7ZA 3ITZA 5IEXA 1KE5A 3DJ7A 3E64A 5IH4A 2O8YA 4NSTA 2HXLA 2B52A 2C0TA 4J53A 4TNDA 2BZKB 3ZMMA 2GPSA 4YJUA 2WKMA 4R7HA 2OF2A 4ORKA 4TYGA 5FBOA 1OL1A 2J0JA 3ZEPA 4BIDA 2G2IA 2IVSA 1H07A 3ZUTA 3LLAA 5AP0A 2WMTA 4IWPA 5F94A 1REJA 4MWIA 2X6DA 5ACKA 5CALA 4RIYA 3D7ZA 3MH2A 1Q62A 3KULA 4F7SA 2C5XA 3IQ7A 4UEUA 2O63A 1PRYA 4GYIA 4RFMA 5AIRA 2HZNA 4IAAA 2OWBA 2YM7A 4DCEA 2XP2A 3G8DA 1YHVA 4NTTA 3LM0A 3E5NA 5HESA 5KHXA 2G2FA 3KEXA 3C4EA 4IC7A 2YRWA 5J5SA 3ZH8A 3AD5A 3DXPA 1DM2A 3VHEA 4CNHA 3PPZA 4WNOA 4Q2AA 2ZV7A 5C4KA 3AC8A 3P1AA 3D94A 3V51A 4PDPA 1H0VA 5DEWA 4MH7A 5FEQA 3RINA 3LJ0A 2FB9A 5CA1F 5GIPE 3C13A 1WVWA 1Y6AA 4Z9LA 5AAEA 5DH3A 3CKXA 1OL2A 4GFOA 4JBVA 4ERWA 3A2CA 2V5QA 3ORMA 3DB8A 2OH0E 4DEHA 2YZGA 2XCKA 4FSTA 2QD9A 3BPRA 2GNIA 4QYYA 5DT0A 2J5EA 4JJRA 4R3PA 4WUNA 5CU4A 2OFVA 4BC6A 3JR1A 4AN3A 2XBAA 2CKPA 3F6XA 1B39A 4PMPA 2JLDA 3D2IA 2ZDUA 4W8EA 5HIDA 2QLUA 2GS7A 1QCFA 4HJOA 3K54A 4MAOA 4YTCA 2HJWA 3P86A 3QRJA 2CCIA 4KRDA 2W1DA 5BPHA 3OZ6A 5JZJA 4UB7A 3NR9A 4AE6A 3QQFA 4NCTA 5HCZA 4FV3A 3TNQB 3FMJA 3WZEA 2HGSA 4I21A 4AAAA 5IA3A 3I6UA 1IRKA 5FRIA 3L8XA 3FC1X 4FIIA 1H1PA 4TL0A 2OGVA 4C02A 2W1GA 1MRVA 4YBKA 2PMNX 4DN5A 4LQMA 4AGCA 3NUSA 4IWDA 3R5HA 2J9MA 3PJCA 4L43A 3RPSA 2PHKA 4BDJA 4RX5A 4RJ6A 2VO0A 3VS7A 4G3DA 5EOBA 3L8SA 4MXXA 4OTRA 2WMAA 3D9VA 3S4QA 3SHEA 3DAKA 3SOAA 3MJFA 2WTWA 1CSNA 4G16A 4LGGA 3W18A 3FYKX 2FP4B 2QI8A 3Q9ZA 4YNOA 5EK7A 4YJNA 3BHTA 3VIDA 4BDEA 3SA0A 5AV3A 3A60A 5CXHA 5E8XA 4CFXA 3DBCA 4XYMB 3BGZA 2I1MA 4XRLA 5ANJA 4HNIA 4U9AA 2VNWA 2WMUA 4FG8A 4R7BA 1XBBA 3MWEA 5BYZA 3AW8A 3VPCA 3SV0A 3O96A 4DGGA 3EZVA 4EOLA 4Q9SA 4V0GB 5AP4A 1U5RA 4N57A 4L46A 3VBXA 4FFRA 4S2ZA 1SMHA 3QD2B 3EMGA 2XM9A 5IYZF 3QGYA 3LFAA 1Q61A 3F82A 2G2HA 2VWUA 2G9XA 2WTIA 4UYNA 2ZYBA 1QL6A 2X7FA 3PJ1A 1A48A 3LFDA 4R5YA 3TCPA 4CV8A 2P2IA 4KIQA 2RKUA 5JZNA 3ZEWA 5FP6A 4C2VA 3OY1A 4R1YA 3OXIA 5EW9A 5M4UA 3MPMA 3LM5A 3Q6WA 3SVVA 4Y46A 3F5GA 4MKCA 5EDRA 1UWJA 4MXCA 3QQLA 4AACA 4EH3A 2GNGA 1X8BA 2QKWB 4S32A 4M69B 5CAOA 4JT3A 4DEAA 3V4SA 4FUYA 3WARA 4FE2A 2GNFA 3IGGA 3P08A 4IM0A 1UA2A 4LRJA 5AUZA 3TJDA 3GENA 4MCVA 4ZSGA 5KZ0A 4HNTA 3CC6A 3PXYA 4UYAA 4CXAA 5LVLA 4IFGA 5HTCA 3NW6A 3Q4TA 4ZK5A 2ITTA 4FTKA 4RG0A 4TKSA 1UNHA 3HUBA 4FV8A 4L01A 5C26A 1XH4A 3R28A 5EM5A 4M97A 5IU2A 1O6KA 2E9NA 3QQKA 4LOPA 4RX9A 3ZUVA 3LPBA 2BHEA 2B55A 5G6VA 3OEZA 2C6TA 1FINA 2PL0A 3FE3A 3NNXA 3PWDA 2XIZA 2GPHA 4X3FC 3AC5A 4ACCA 4CFUA 2J0LA 5BVOA 2QOHA 3MBLA 4M13A 3UNJA 2C6DA 3GFWA 2A2AA 3OW4A 4GVJA 2LAVA 3ZCLA 2JKOA 4TYEA 2GPWA 5CSWA 5J87A 4I92A 4FT0A 2YWVA 5IA5A 4O7VA 4F9YA 3GCUA 4K8AA 4NL0A 4M12A 4XP3A 2W1HA 3E63A 2O5KA 4GT4A 3E3BX 2BPMA 3CLYA 4FSQA 1LP4A 3PVWA 5IQIA 5FBNC 3V5WA 3ZO2A 1PXPA 1QPEA 3MSSA 1SCUB 2BDWA 4FV1A 4NYEA 5CS6A 3ID6C 4IVCA 5AFVA 4GV1A 3BHHA 4O0UA 3CJGA 4GKIA 4U3ZA 4LGHA 4D1ZA 5KNJA 2ETRA 3PVGA 4OTHA 4NU1A 5AA9A 4FL1A 3OBGA 2YITA 3ZSGA 3AG9A 1Z2OX 1Q4LA 1W98A 4AXAA 4C37A 2OLSA 3MWUA 2CGUA 3NUYA 4FL2A 5EHYA 2ZV9A 4WNPA 5KE0A 3E3PA 4KS8A 5CEMA 4M84A 5AV4A 2WTKB 3PA5A 2ITYA 3AC3A 3F7ZA 5LWMA 5EW3A 4JR7A 5KMJA 5JFWA 4OTDA 2XUUA 4GW8A 3GGFA 5DRBA 1PX2A 2YDKA 3ZTXA 2Y8OA 3SXSA 4FZAB 5KCVA 4JX7A 4BCKA 2OH4A 4J52A 5CSHA 4EQUA 1DI8A 3EJ1A 4CSVA 5JMSA 4LG4A 1RJBA 5E8VA 2C69A 3UNZA 4QMUA 2ZB0A 4DA5A 2IWIA 4E73A 2XYNA 4I6BA 4C2WA 4F9CA 2XNEA 3BKBA 4XJ0A 3PXRA 4ZS0A 3U9TA 5D11A 3ORKA 1J3HA 3VQUA 4HGEA 3PPKA 4DITA 5IMXA 4O4IF 4XH6A 5CVHA 3QQUA 2WU6A 4I6HA 5EI6A 3UP2A 3QGWA 5AAGA 3A7JA 1O6LA 5T3QA 1BMKA 4FTTA 2I0YA 1Z2PX 4ACHA 4GKHA 3VS3A 1JBPE 5JK3A 3QYZA 2XH5A 4IAFA 3A99A 4AE9A 4I4TF 1YDRE 3FC2A 2WTJA 3GQLA 3DBDA 4O0SA 3UTOA 5J7HA 4H05A 3BU5A 1CS0A 2XKEA 1REKA 3JXWA 3A4OX 4AP7A 4B8MA 3HDNA 2C1AA 3H9FA 4HGSA 5DBXA 3G9NA 1YI3A 5TO8A 3VO3A 2UW4A 4DFYA 4ERKA 2IN6A 4LMUA 2WU7A 3ORRA 2PZ5A 4DBNA 3T3VA 5JVDF 4HZSA 3QTQA 5BNJA 4CLJA 1ZMVA 1GSAA 2VX1A 2R7LA 3W2QA 1WVYA 4KKHA 1EZ1A 2V59A 2V5AA 4ZLZA 1OECA 3D14A 2VGOA 4ZTHA 4DTAA 4Y83A 1QPJA 3VBVA 3BQCA 5M06A 3KRRA 5JVLA 2EVAA 1U5QA 2W1ZA 5IQAA 1OKYA 4WKQA 2QOCA 3TEIA 2W6NA 3GCPA 3PE1A 1Z9XA 3QYWA 1XR1A 3HECA 2YW2A 2C5NA 4YC3A 5AP1A 2OJFE 4C5CA 3U9NA 4YZMA 3KRJA 4RLLA 3HV4A 2BKKA 3MY5A 4OTQA 4TYHB 3WILA 5JGDA 4ALWA 4MA0A 1ZXEA 2IZRA 4NT4A 4DFBA 3RGFA 1UKIA 2XIXA 3F69A 5FUTA 5IQGA 5JFSA 5H9BA 4AGUA 1YHSA 2R5TA 2PMIA 4FIFA 5B2MA 3QU0A 4Z55A 1PXNA 2RFDA 4HYHA 4YTIA 1R39A 1W83A 4AA5A 3AT4A 3F2NA 3MVMA 4IIRA 1KEEA 3JVRA 1H08A 5E8TA 4B8LA 3DDPA 5AWMA 4APPA 5BUEA 1IOVA 3CSVA 2IZUA 4B7TA 1UU8A 4CG8A 1HOWA 5LMKA 3FY2A 3NUXA 4R3RA 5A4TA 2XNNA 3JS2A 2QF7A 3I12A 3LE6A 1P14A 1ZY4A 3R9OA 4FK6A 3LJ1A 3M11A 4ZMFA 3IDPA 3ORZA 4GEOA 3R83A 4IE9A 3O8PA 4MQ1A 3RV3A 3DDQA 1JLUE 4FNZA 3V01A 5EYDA 3UNKA 2HZIA 3BX5A 1GAGA 3Q9XA 3DNDA 3UIBA 1VKZA 4EK5A 4BCFA 2C5OA 3DOGA 4M0ZA 4A7CA 1H8FA 3PWYA 4F65A 4G31A 2QU6A 4IB5A 2YM8A 5HIEA 5KX5F 2JFMA 4RZVA 4MBJA 1I44A 2ZV8A 4MVFA 5EHLA 3QTRA 4C4GA 4CRSA 3E62A 5CI6A 5J95A 1J7IA 3HO8A 3P7CA 4AWIA 4YZ9A 1Q8WA 2SRCA 3MI9A 5HE0A 4BCMA 3NSZA 3ORNA 4AF3A 2VQDA 3C0GA 4RFYA 4TWNA 2J4ZA 3FAAA 5L6WL 4B0GA 3DT1A 1VJYA 1R78A 4AW0A 1MRUA 2FUMA 4HCVA 1V0BA 5CEKA 2FA2A 3AOXA 3UE4A 5J1VA 3BWFA 4BDHA 3PP0A 3BHYA 3QAME 4O21A 3GCSA 4G3GA 4OBOA 2W1FA 4AS0A 4F09A 4QMTA 3ODZX 5CY3A 1JNKA 4Y85A 3GBZA 1ERKA 2NU9B 3SX9A 4F7LA 2ITWA 5HKMA 1E1XA 3KC3A 3AT3A 4RFZA 4NCTC 5HE3A 3FMLA 2R3IA 4FX3A 2F7XE 2UVZA 3A61A 2F2CB 3BRBA 4IADA 2QQ7A 2P2HA 4RT7A 1DAYA 5LARA 5AADA 5HLWA 4LFIA 2OW3A 4IMYA 4L68A 4E5BA 2FSTX 4KSPA 3DKFA 4FT7A 3NUNA 2V7OA 2A27A 3C4ZA 4KBCA 5A9UA 3SW4A 5H8BA 2UZNA 4IJ9A 2J7TA 4QMMA 5LCKA 4RZQA 3Q9YA 1SVHA 5C27A 1ZYCA 2OZAB 4ZTSA 4I5PA 2PE2A 4FODA 3H0ZA 3O17A 3MVJA 3OOGA 4Y73A 3A8WA 3FQSA 3LCTA 3OTVA 4L3LA 4EH4A 2X8DA 5EDQA 2NU8B 3RV4A 1OIUA 3NCZA 4U45A 5EM7A 4GT3A 4D1XA 2BDJA 2WAJA 3CQEA 4O7TA 5HLNA 3AC1A 3VUHA 5FTQA 3SRVA 2J51A 1CKPA 4U3YA 4EHZA 4BI1A 3TIIA 4MD9E 2YCQA 5J2UF 4IVDA 4IAIA 5D1JA 1M2QA 1WBWA 2W7XA 2YIWA 4FV6A 5E1SA 3UQFA 3TXOA 3PXQA 2UZLA 5DPVA 5IEYA 3PA4A 1M2RA 3R04A 2HIWA 3R2BA 2R3KA 2BIKB 3D2KA 4KSQA 3QUEA 3LWBA 4IM2A 2OXXA 4BBFA 3BIZA 2W5AA 2GTMA 3EKNA 2YZAA 1NY3A 3NGAA 4FSWA 1Q41A 2JBPA 4WIHA 3SD0A 2YRXA 3MY1A 3HMPA 3QD0A 3R73A 4FBXA 5M55A 4D58A 4CKRA 2UUEA 1V0OA 2VO6A 4Y8VB 2ZOQA 4JXFA 1L3RE 2YEXA 3FL5A 3TG1A 4ZSLA 4YPSA 2R64A 4BYIA 2E2BA 3FI4A 3P7AA 2R87A 3FKNA 4PNIA 3Q96A 4K18A 4MK0A 4PTGA 4U44A 4M9UA 5KKRC 4E4TA 3IONA 3MB7A 4R6VA 4U80A 3KA0A 3SW7A 4O4LF 2R3QA 3V4ZA 4O22A 5G1XA 4GIHA 2XMYA 4WNMA 2HK5A 4BGQA 4BGGA 3UG2A 4NFMA 3G0FA 4WOVA 5ETAA 3OVVA 1OKWA 2C6OA 1FQ1B 3AMBA 4IB3A 5EM8A 5M51A 1ZOHA 2Z8CA 3LKMA 3RCDA 1BXRA 2CSNA 5CAQA 5ICPA 4I0TA 5TF9A 4K1BA 4JDJA 4PX6A 3TWJA 1XH6A 3JY9A 4EI4A 4EJ7A 3EKKA 4JDKA 3HA6A 2W05A 2B0QA 3OUNB 4I55F 2HZ4A 3F3TA 5LJJA 4WD5A 4X6QC 3Q52A 2AC3A 4YPDA 4AW5A 2ITUA 3DKCA 2OICA 4IAKA 2J50A 3PY1A 4RA5A 1ZOEA 3VBWA 4WNKA 4O0TA 2FH9A 5HE2A 1GSHA 2JKKA 5ITAA 3MH1A 3IGOA 5HG9A 3VJOA 2BZHB 3WNZA 2BAQA 5EI8A 4FIGA 2BUJA 3ZO3A 2JIVA 5IA4A 3ZBXA 5BX0A 1T36A 1YI4A 1JKLA 3GU7A 3LQ3A 2PK9A 4NJ3A 4MYGA 4IZOA 1GOLA 3ZFXA 2NRUA 4J98A 5CT0A 3PDTA 4FC0A 4FKSA 3PZEA 3NAYA 3R8VA 4CMTA 3ULZA 3LOKA 4AN9A 4JQ7A 2QNJA 4TXCA 3VC4A 2Z7QA 3WF5A 4HVDA 5LVNA 3TINA 3OOMA 1Q5KA 3KN5A 2HAKA 2WNTA 4C58A 1PYEA 3FLNC 3EQBA 3FZSA 3I4BA 3OT8A 4FK3A 5AV0A 5CAPA 4X3FA 2ZMDA 4JX3A 4XYFA 4OTGA 4AA0A 5FXRA 3JPVA 5EYCA 4IZYA 3Q60A 5DR6A 5DHJA 3AQVA 5CENA 4H1MA 2X2LA 2B9HA 2AUHA 3NIEA 2GMXA 3O50A 3G90X 1BI8A 5JH6A 4QP1A 3HEGA 4FSRA 2WTVA 3B2TA 3ORLA 3OD6X 4MV7A 1QPDA 1OPLA 4ZZOA 4F9WA 1XH5A 2B7AA 3ZHPC 3CEKA 3G5DA 5HX8A 3CPCA 2PZYA 3D0EA 2GNHA 3ORPA 2PPQA 4C38A 3F66A 4AW2A 1KJIA 3SC1A 2G15A 2YDJA 3NW5A 3WE4A 5JGBA 3FMMA 1UKHA 4YJ3F 4XX0B 4GJ2A 3MTFA 2WMSA 4EOQA 3Q6UA 1PKGA 4BDDA 3W2PA 4G2FA 1YXUA 5ANGA 5DR9A 5IUHA 3RPOA 3TV4A 4IHJF 3LCSA 3COHA 3LXLA 3OG7A 4UWBA 5EM6A 3T9TA 4AZSA 3I6WA 3EN7A 4EWHA 1CQIB 2WTCA 5ANDA 3M42A 2UZWE 4AN2A 4G3CA 4FV4A 5AUYA 4B4LA 4W8DA 2PZRA 3QD3A 5HBEA 3PTGA 4C4HA 4EC8A 5A6NA 2XYUA 3GU4A 3HUCA 1U54A 2GHMA 5C1QB 2CHLA 2V22A 5F9EA 1Q24A 3FBVA 3F7WA 2NNWB 3ZSHA 4X7QA 1I09A 2YM5A 3GC7A 2X0GA 3H9RA 4EGJA 4BDBA 3F5PA 3EFKA 3G2FA 2CGXA 4RJ5A 2VO3A 1H1QA 1KV2A 1PKDA 2QLQA 3QCQA 2W9ZB 4J7BA 3W2SA 3U4UA 2GTNA 5E1EA 4FKUA 2YCFA 2NO3A 3E93A 3EWHA 4AX8A 3V5LA 2WIPA 2NU6B 4CCBA 3FLSA 2FPPB 2WGJA 3FMHA 5C01A 5A3XA 2EWAA 4J71A 4W4YA 4O0YA 2BIYA 3OT3A 2YIYA 3RVGA 4ZJVA 3JYAA 4H3QA 2XKCA 4CT1A 5L3AA 3BU6A 1KE8A 3AMYA 1XO2B 2RG5A 2JFLA 4N6YA 4ZTLA 5JSMA 4KABA 2G01A 3KFAA 3TIGA 2H96A 3I7CA 3OEFX 3BE9A 4H36A 4UXLA 2VTIA 3I81A 4F7JA 4EH9A 1WAKA 3UPZA 1BL6A 2YYAA 4J8NA 1ZY5A 4C4EA 4LV8A 1H27A 3EH9A 4C7TA 2RGPA 1NVRA 1URWA 2C6MA 4FGRA 4ITHA 2WMRA 4L42A 1UNGA 5DIAA 1ZLTA 4ZLOA 4ZY5A 3HP2A 4WO5A 2Z60A 1UU7A 1B6CB 1FOTA 4P5ZA 5HQ0A 5LMKC 3LXPA 5HGIA 5BUJA 2QK4A 3KMMA 4BF2A 3C0HA 4FI1A 3CS9A 3P4KA 4A4XA 5LYJF 2QR7A 2X4FA 3FMKA 4IEBA 2V55A 4UN0C 3DTCA 2XB7A 4XRJA 5JRQA 2UZBA 1PXIA 4KIPA 2YERA 4EOIA 5D7VA 4YB8B 3PY3A 2PE1A 1RQQA 4FT3A 4I6FA 1ZZLA 3JVSA 5E90A 3QC4A 3R5FA 2VWYA 5HD7A 3L9LA 2J90A 1TQPA 3ALOA 3QRIA 3HMOA 1S9IA 4FEQA 4AFEA 4BBEA 3GP0A 4DCAA 3DCVA 3OFMA 3DTWA 4JDHA 4MD8E 1M0WA 2J0MB 4BTMA 2XNGA 3OCSA 4KKGA 3FI3A 4IX6A 1PY5A 4DFLA 2Y6OA 3NNWA 5HG8A 2O65A 3NYXA 3ZUUA 1GJOA 4I5MA 3OWPA 4JQ8A 4C3FA 3RHKA 3HBLA 2NU7B 2Y6MA 3LMHA 2QO2A 3UOHA 1YOJA 4EH8A 2QURA 3UO6A 4AUAA 1A9XA 3ODYX 3W2CA 4IZAA 1PXOA 3PJ2A 4UY9A 2QU5A 2VD5A 4G3EA 5EFQA 3UIMA 1IASA 3N4VA 4ZIMA 1PW2A 4G6LA 4X21A 4E6CA 4YJRA 5DNRA 1SYKA 3FHIA 2OI4X 3NYVA 3O8TA 3GCVA 4JIKA 5DYJA 3TZ9A 3QX4A 3ZU7A 3DB6A 2VTNA 2VWXA 4QTAA 4AT4A 2YISA 4P4CA 3PZHA 4JI9A 4U40A 2X6EA 2WTDA 4I0SA 2J6MA 1BNCA 4FSUA 1MRYA 3MWDA 5E8YA 3R8UA 2YFXA 4TW9A 1H4LA 5CX9A 3MH0A 3GOPA 5CU6A 3D7TB 2ITNA 4KBKA 5H3QA 3U6HA 2XNPA 3B2WA 5T6KA 2CLQA 1S9JA 3NWWA 4R5SA 3K3IA 1MP8A 2G1TA 1WZYA 1YOLA 1LPUA 4NJDA 5HO7A 4V04A 4YNEA 5B0XA 1PMNA 4PNKA 3V8SA 4CZTA 4EZ7A 4ZZNA 2X8EA 1H1WA 4DEGA 2VTMA 3SQQA 2WQBA 4O4JF 3NW7A 1WBVA 2E9VA 3EIDA 5K9IA 5KMLA 4RIXB 4YMJA 3NNUA 1OKVA 3R8ZA 3NVKI 4YGAA 2X0SA 5K5NA 2YZNA 3ETAA 4MWHA 3KXGA 3E7VA 4LV5A 3H30A 4ENXA 3HRBA 3RZBA 4F08A 1J1CA 5IMEA 5EG3A 1MQBA 1ULZA 4F0FA 1SM2A 2CGWA 2ETMA 4FTQA 4O2ZA 2YJSA 5LMBA 5KMMA 5CI7A 2FSMX 2VTJA 3MIAA 3DBFA 3R01A 4Z16A 3U9CA 3M1SA 4D2RA 4C35A 4LM5A 4DF3A 3R0TA 2W06A 5KMKA 3EN6A 2F7ZE 3EFJA 1F3MC 2UZDA 2YAAA 2YM4A 2YHVA 3DBQA 1LUFA 4XV9A 3DZOA 3KB7A 4QQJA 3R7UA 2CKEA 2A1AB 3UYSA 2AYPA 4WBBB 4ASZA 2JEDA 5HG7A 4KBAA 1YWRA 4IVBA 2R3OA 2BTRA 4G34A 5EH0A 3RCJA 1PXLA 3QZHA 1IAHA 3P23A 3JY0A 3S2PA 5IQHA 3K5IA 4BB4A 5L8KA 3KCKA 4QMYA 4GUBA 4XEYA 3Q2OA 2J2IB 2BMCA 1B38A 2C5YA 3FWQA 5HBHA 4Y5HA 3SLSA 4BCIA 2YZMA 1W8CA 3IOPA 5EDPA 1OVEA 2R82A 2YIXA 3SXRA 3C4WA 1GSOA 4FUXA 4AGWA 3OCTA 4L3PA 4XMOA 5IEVA 1CE8A 4RWIA 4ZS4A 4KS7A 2Y9QA 3BU3A 3IW6A 4OTIA 3DLZA 4KUJA 4NW5A 1W84A 4FSNA 5EYMA 3A7HA 4OTWA 5CNOA 3L9NA 3ZSIA 4EOSA 4U6RA 2W6OA 4W4XA 4MBLA 4XP2A 4H39A 3QKKA 4FKOA 4J97A 3UZRA 1YKRA 3CGFA 3QBNA 2VTHA 3PG1A 1OIQA 4R3CA 3MB6A 5HVJA 5JQ5A 5BVWA 5IH5A 5JFVA 3UP7A 5CANA 2DIKA 4X6RA 3BBWA 4QMLA 2VNYA 4HNFA 2F4JA 2ZDQA 4A06A 1YQJA 4FIJA 5KX8A 4AZTA 4A9YA 3NLBA 4TV8F 3ZLXA 4JDIA 3BE2A 1WBTA 4EH5A 3K5VA 5M07A 3BHVA 2PVPA 2WOUA 5C1PA 5JQGF 5CAUA 3ZS5A 5CEIA 5BVDA 4D4RA 1ATPE 1OKZA 2BHHA 3BYOA 4FR4A 5EKNA 1VBHA 2R85A 4DGLC 3GU6A 2Y4IC 3UPXA 2XKFA 4FVQA 4O96A 4PL5A 4XBUA 2OZOA 1CQJB 3G51A 2Q83A 2WTKC 4CGAA 3G8CA 4EORA 4LYNA 3V5QA 4UV0A 4DGNA 2HW7A 3GB2A 4JQEA 4TWOA 1GZKA 3QXOA 4C5BA 3PJ8A 4OW8A 3POOA 5AP3A 4FNYA 2HENA 2VWIA 5DOSA 1U59A 2WOTA 3TTJA 1HCLA 4FKRA 5L2SA 3HB9A 2XNMA 4RIWB 2RG6A 3F3VA 3NEWA 4IZ5A 1STCE 4K0YA 4PL3A 3H3CA 4XHKB 4QPSA 4ZP5A 4H58A 3T9IA 4ZSAA 5JQ8A 1XBCA 4L67A 2VWWA 1ZARA 2R7KA 1P2AA 2OU7A 5AIKA 1GLVA 4XG7A 2C6IA 2CN8A 4PTCA 4JRNA 5AEPA 1ZYSA 4FTOA 4HGTA 4NM5A 5HG5A 5JKGA 2C00A 3VPBA 1KBLA 2BDFA 2BZJA 4FNXA 3VULA 5CXZA 3RUPA 3DKGA 3W33A 1EUDB 2XBJA 3P0MA 4E6AA 3VS6A 4LL5A 2UW0A 3F3UA 4FT5A 1O6YA 2W4KA 2X2MA 2VTAA 3TV6A 1W96A 5LWNA 4G17A 4K2RA 4OGRA 2QG5A 3ROCA 4L8MA 1EHIA 3C4XA 4FFLA 3SDJA 3UVQA 4CV9A 4J95A 4FV5A 2CKOA 3O23A 3R7IA 4HCUA 2R7IA 5CU0A 4OBPA 3GNIB 5IZFA 3ANRA 2WMVA 2VTTA 2X39A 3KF7A 5GNKA 3EOCA 3VW8A 2OJGA 4O7YA 3KK9A 3VBQA 2PVFA 4D0WA 4CFMA 2OJ9A 3L1SA 4FTLA 3U55A 3RPYA 1AD5A 2GHLA 5CLPA 3W10A 1KJQA 2VTOA 3IW8A 3Q3BA 3VS0A 4I50F 3F88A 2PVHA 1YHWA 2BROA 2IPXA 4RWKA 4EK8A 3O71A 2XD4A 5L2TA 4IDTA 3WYXA 1KE6A 5FDPA 1BL7A 2OO8X 1H24A 2RFSA 4AU8A 2E9UA 2F9GA 3PVUA 4LI5A 1E4EB 4ZQIA 5HCYA 3G6GA 3HNGA 3TL8A 2IZTA 3LW0A 4AA4A 2KULA 1H26A 4E4LA 5AP2A 1AGWA 4FTNA 3TI1A 2XK6A 1Y6BA 2C3IB 1DS5A 3FZPA 2C6EA 3PXKA 3D5UA 3DQXA 4X3FB 4F9BA 3U6IA 4X2KA 3D5XA 4HQ6A 2O3PA 2NUAB 4FFPA 3RTPA 3SE7A 2R3NA 3K5HA 4WA9A 3BYVA 2XJ2A 1E1VA 3UVRA 3ZRLA 4CMOA 3CD3A 4XG9A 1XBAA 2ZM1A 3V8WA 5LA6F 4YTFA 4MA5A 3DAJA 4EBVA 3GIDA 1Q99A 5D41A 2QG7A 2XRUA 4FZFB 4IB1A 4V05A 1Q8UA 2VX0A 2ONLC 2EB2A 5C9CA 1CKJA 5CEOA 5KMOA 3GI3A 1JKJB 3GT8A 2QOLA 2W1IA 2WMBA 4GFMA 5I5ZA 2VR1A 2UW3A 3G15A 3FXXA 4MV6A 4EZ5A 2JIUA 2R3RA 3KMUA 5HV6A 4DG0E 5KMNA 4FTMA 3P7BA 2HZ0A 3TJCA 3ZFYA 1M17A 4APCA 4NM7A 2QOOA 4I23A 5AV1A 2VN9A 4O81A 3MFRA 5E92A 1BX6A 1Q3WA 3WZUA 4PUZA 3OS3A 1VEBA 1M7QA 1FVVA 2IW9A 2W4OA 5CQWA 4PF4A 2UW7A 4R7IA 1VBGA 1WBPA 1OUKA 1VYWA 1EH4A 2PBZA 4FKIA 4E4XA 5HO8A 2XCLA 4HVGA 5I0BA 3GLKA 4HVIA 4O2AF 2PZPA 5F4NA 3NYOA 4FTIA 3CY3A 2W4JA 3MY0A 4HOKA 3RKBA 2GQRA 3U54A 4Q5HA 4AFJA 4ZHQF 3ORXA 5DWRA 5FGKA 4F0GA 3IKAA 4O7WA 4EH7A 3QKMA 4DLIA 2A19B 3HKOA 1NW1A 5E7RA 4R77A 2BAJA 4N0SA 2JGZA 4FTCA 1CDKA 1NVQA 4CCUA 2HW6A 3BEAA 3NS9A 1W93A 2FPGB 4YZCA 4QMWA 4D1SA 5CWZA 2VTRA 3AGMA 1M2PA 3RK5A 5CASA 4S33A 2Y7JA 3MV5A 4JAJA 3Q4ZA 4QMVA 1T46A 2EXMA 3E92A 4JG8A 2XIKA 4YC8A 2XJ1A 5AV2A 3W2RA 3PIYA 1KJ8A 3CBLA 4QYGA 1WVXA 3QCYA 4ANMA 4Y5QA 3RI1A 4USFA 4S30A 3AX6A 3C1XA 5CTPA 2WPAA 4G9RA 3QQHA 4NM3A 1ZYDA 3DXNA 2PZIA 4HVHA 5M4CA 5JH7F 3V6RA 5AP6A 3I1AA 3U4WA 2Y0AA 4YSMA 4KRCA 3G33A 5KO1A 4EYMA 4QQ5A 3QF9A 4XLIA 5IPJA 4BDCA 4IX5A 5F95A 5EKOA 3S00A 5E8ZA 3TNPC 5H8EA 3A7IA 2W71A 2YAKA 4BCNA 4X0MA 3Q9WA 1FGIA 4IC8A 5HLPA 3E87A 2EB3A 3TQTA 4QP7A 3EL7A 2QODA 4YLJA 3TNHA 3H0YA 2OXYA 4CT2A 3BGQA 3D4QA 3R8MA 3UGCA 3ZC5A 3EQIA 3CJFA 3FLYA 5ANEA 3R7OA 3HAVA 3HRCA 3QLFA 2H9VA 1GZOA 2HYYA 4YC6A 5A6OA 4MV9A 4ITJA 5I9VA 3OTUA 4YBZB 2R3HA 4QP4A 3OUKA 4YSJA 2ZAZA 4ALVA 3KXZA 5K4JA 5J1WA 4O0VA 4FTRA 4FICA 2VUWA 3OF0A 5FXSA 3K3JA 3L8VA 3QZGA 3OP5A 4O0XA 3KRWA 5J8IA 4HR7A 5L8LA 4RVTA 1BKXA 3LIJA 3UOJA 3VUGA 4IVAA 2VO7A 3QFVA 3F61A 2ZB1A 3ZZWA 1UNLA 3C51A 5FM2A 4QNAA 2PMLX 3OWLA 4JL9A 2WZJA 4O38A 2WD1A 5ETFA 4QMOA 2A4LA 3IS5A 4MX9A 3WE8A 2GNLA 2X2KA 4BYJA 4D4SA 1KJJA 2JC6A 1WFCA 2QVSE 4I20A 5HIBA 4E6QA 3WO0A 5AM7A 3EN5A 2J5FA 1VR2A 3OCGA 4Y8DA 4FV0A 4U79A 4BCGA 4CFVA 2UZOA 5IA1A 3UMXA 4TUYF 1XH7A 4V0GA 4FVPA 3R22A 2DWCA 3DS6A 4FKTA 1APME 4BHZA 1OL5A 4JG7A 5LMAA 1VZOA 4RIYB 3OXZA 3I79A 3PSCA 4GCJA 4QMXA 4F9AA 3KULB 2BZIB 3ZONA 2OLCA 3SKCA 3TNIA 3FZRA 5AAFA 4DH5A 2W99B 3E5AA 2ITQA 1NA7A 3PY0A 3UDBA 4D28A 2HXQA 3MN3A 2I6LA 4QTEA 4QSHA 1OZ1A 4QP8A 4AZVA 3GXLA 1ZWSA 3WZKA 1OIRA 2YIQA 4E5WA 4ACMA 3NIZA 2UVYA 4QTDA 3OWJA 4FL3A 3QCSA 2QKRA 4JBQA 4MHAA 4TY1A 4ZMEA 2R86A 1GZ8A 4TRLA 4G5PA 4CLIA 2C6LA 4YR8A 3LXKA 4YJSA 4ZAUA 3MYGA 3TV7A 1TQMA 2OG8A 5AUXA 3NNVA 2C6KA 1NT2A 1ZRZA 3N9XA 3FPMA 4CKJA 4EH2A 4DT8A 1XQZA 2IG7A 2B9IA 2YABA 3FZ1A 4EWQA 4F6WA 2UZUE 5I9ZA 2WHBA 3LVPA 4QRCA 4FTAA 4RLKA 5TR6A 4XV2A 2QONA 5BMMA 3KL8A 4NKAA 3KAKA 2I0HA 4MQ2A 2XJ0A 3DBEA 3LCDA 4QNYA 2J0IA 1R1WA 5AX3A 3F2RA 3GUBA 3OROA 4X2FA 3VS4A 4B9DA 4DH7A 5CAVA 3QLGA 3ZLWA 4BDFA 3VUMA 4A9SA 3HX4A 4DFZE 5CF8A 5KUPA 4Q5EA 1BLXA 2XK4A 4DEDA 5DGZA 1H28A 4ZOLF 5HU3A 3UQCA 4YZDA 4G5JA 1IG1A 3R6XA 4DINA 3KALA 4PP7A 4RJ7A 3QFFA 5M44A 3UO4A 2VPQA 4U43A 4GFGA 1DV2A 2XIYA 5CT7A 3RAHA 3TKUA 4YUQA 4A9UA 4UBAA 4I6QA 3R7YA 3UODA 5L2IA 4IW0A 3NUUA 4JLCA 4H1JA 4M68A 4NH1A 3RALA 3BGPA 4WRSA 4WRGA 3UBDA 5KHWA 4XOZA 3EQCA 5C1OA 4DGMA 4XG6A 5AP7A 3IW7A 4CMUA 4JRVA 4AOTA 4EK6A 2XEYA 3RPVA 3O7LB 3QCXA 3DQWA 3VQHA 2CNVA 2B1PA 4NKSA 3Q5IA 4WG4A 4D0XA 1I7LA 4TWPA 3Q4UA 4CEGA 2XIRA 4BKJA 3SOCA 2ERKA 4I0RA 5KBQA 1J7LA 4EJNA 4G6OA 5CZIA 3N6RA 2JKQA 3DPKA 2BILB 1P4OA 2V7AA 3FUPA 4RVKA 4AOIA 5DG5A 4CD0A 3W8LA 2X4ZA 3W32A 3MA3A 3MPAA 3OWKA 4QP3A 5AMNA 1M52A 5BPYA 4E4NA 4M3QA 4EL9A 3UOLA 3ACJA 2UVXA 4IX4A 2ZDHA 3SXFA 1NVSA 2HELA 4ZJJA 4A4OA 3MJ2A 4E93A 5HORA 2WYOA 3HMIA 4HNUA 3FLQA 3JRXA 2H6DA 2FGIA 2J0KA 3LFQA 4FZ7A 4EQCA 3VF8A 4GSBA 4FZDB 3LXNA 5IQDA 3BHUA 1H01A 5CU2A 3JRWA 2YJRA 4H3BA 1OM1A 4O2PA 3PIZA 3KXXA 3S0OA 3CQWA 2QC6A 4IDVA 5ETCA 2QHMA 2WQOA 3FMEA 4O7LA 3I5ZA 3GFEA 3ZM4A 4TYJA 4F6UA 5M09A 5CZHA 4EKLA 5KKRB 4UX9A 4YURA 3W16A 5HNBA 5B2KA 3OMVA 5IQCA 2X9FA 3LFNA 5LOHA 3TNWA 4AG8A 2WIHA 2R3MA 3ET7A 2C1BA 2PVLA 3F3WA 4MV8A 2R0IA 4LOQA 5B7VA 2WMWA 3JUHA 5FTGA 5JN2A 2XNOA 5TOZA 3QALE 3MGYA 3OXTA 3ZC6A 1OL6A 4MF1A 1F0QA 1YXSA 3II5A 4GH2A 3FJQE 4NZWB 4XG4A 5FG8A 3TT0A 3JZIA 1SNUA 4ZZMA 3RAKA 2Z7RA 4PMSA 1JKKA 4AQCA 3LAUA 4NFNA 4NUSA 4BTJA 1A9UA 1UV5A 3HGKA 5C8YF 4FG7A 2QOQA 2OXDA 2ZDTA 4FKGA 4ZOGA 3F2AA 1L8TA 5BMSA 4YAJB 3VA7A 3LMGA 2FVDA 4IACA 2IW8A 3TKIA 5DE2A 3BLHA 3VHKA 3BLRA 5IISA 2UW9A 2JDRA 5DA3A 5AUUA 5EQPA 2UW5A 3ZOSA 4BRXA 3SG9A 3QTUA 3ETHA 2GDOA 1DIKA 4KINA 4TYHA 3C7QA 3BV2A 2UV2A 3DAEA 4H3PA 5T68A 4QT1A 4QP2A 2R3LA 3WIGA 1FBNA 3BG5A 3B8QA 5A4CA 2BFYA 1YWVA 3DK6A 3QTSA 2QCSA 3QXPA 4G6NA 5ETIA 5C8KA 2RF9A 2C4GA 1JSTA 4YZBA 4RX7A 2R3JA 4NK9A 3UOKA 3DJ6A 4TWCA 1J7UA 2Z04A 1M7NA 1PMEA 4FTUA 4W4WA 4EG0A 3BZ3A 5HNIX 2V58A 3HYHA 5CNNA 1C3OA 4MD7E 4AGDA 3ZYAA 2ONLA 4RQKA 2ACXA 4IZ7A 2R9SA 3BI6A 5FEEA 4EONA 3CIKA 3BWJA 3TUDA 2FB8A 3V8TA 2PVJA 3COMA 1J1BA 3MESA 4RC3A 4AZFA 1WBSA 4F63A 2W5BA 1IR3A 1XH8A 2O0UA 5FQDC 3QTWA 3TZ7A 3TUBA 3PA3A 4ALUA 5K4IA 4QMNA 4BZNA 2YN8A 3R9RA 3ENMA 4O2BF 1YXTA 3KK8A 3QQJA 1FMOE 3E8CA 2PVKA 4C3PA 1OGUA 4QMSA 5H80A 4AOJA 2CDZA 3BLQA 1V0PA 3BELA 3RHXA 2REIA 3UC3A 5D7AA 2H8HA 4F1MA 4CZUA 3DK7A 4RVLA 3C9WA 4ARKA 5J2TF 4JBPA 3F3ZA 2BRGA 4FNWA 3TUCA 5DI1A 2X9EA 4IHPA 4DYMA 4XP0A 3NYNA 4QTBA 4DC2A 2XF0A 1Q8ZA 3HLLA 4DFXE 5CEPA 2I8CA 1ZMWA 5HCXA 3BV3A 2BAKA 2IP4A 4DFNA 5J9YA 2EUFB 3DU8A 1IA8A 3C4FA 4E4MA 2C3KA 2YS6A 3R9DA 2OIBA 4PV0A 4EEVA 3HV5A 4K77A 4BDGA 4TV9F 4O91A 2WMXA 3L8PA 1U4DA 3PFQA 1TVOA 2WB8A 3CPBA 3I60A 5M4FA 3HP5A 3C50A 1PHKA 2I0VA 3HV7A 4FSMA 5HICA 3RWQA 4F7NA 2ITOA 3Q5ZA 5EOLA 2C0IA 5EZYF 3RNIA 3U51A 2Y4PA 3R1SA 4GUEA 4MXOA 2R3PA 4FKQA 3QWKA 5EYKA 3OUZA 4L52A 3RAWA 3ORQA 1OIYA 1XKKA 3EQGA 1QMZA 2YZLA 3CGOA 3N4UA 2W96B 3FPQA 2B53A 1DV1A 5C03A 4EQMA 5IA2A 2W5HA 5DRDA 2CKQA 4GIIA 2KTYA 2OZAA 5E9EA 3FKLA 3R9NA 1M14A 4EOPA 5BVKA 4IX3A 3EQRA 4J8MA 5M4IA 2GQGA 3QUPA 4TZRA 3K5UA 4OLIA 4DHFA 2F2UA 4X2GA 3T8OA 2C3JA 5ANIA 2X7GA 5A4LA 4K6ZA 3RWPA 2BRNA 2XM8A 4IQ6A 4KB8A 3R00A 4WHZA 3EN4A 4U5JA 3V3VA 4FKJA 4CTBA 4D5KA 5IG1A 2XS0A 4U8ZA 3RM7A 4DGOA 4QO9A 4USEA 2R3GA 3PVBA 4MNEA 4P5QA 3PSDA 4GRBA 4PMMA 4YLLA 5IUGA 2JITA 2Q0BA 3HA8A 3P9JA 3VVHA 4WG5A 1PXMA 2OIDA 4O7NA 4Z7GA 4HNVA 3OHTA 3VUKA 1CMKE 5K5XA 1GZNA 3P79A 5HD4A 5GINE 3ROYA 4CFWA 1OI9A 3DNEA 5BYLA 3ZLSA 3MFSA 3OUUA 3W55A 4BZDA 2X81A 4I93A 3ENHA 2EXCX 2CGVA 5DT4A 4Q9ZA 4FYNA 3REPA 2GFCA 5ANKA 3VW6A 3ZO4A 4XG2A 2F57A 2JBOA 4A4LA 1EYZA 1PK8A 1VYZA 4E20A 4HVSA 4XBRA 3VS2A 3QRTA 4CVAA 3FL4A 4GG7A 2W6QA 4RJ4A 4NIFB 5EQEA 4V01A 3U6JA 3VWAA 4I94A 4TPTA 3V6SA 4GMYA 2CZGA 4WBNF 1OUYA 4DAWA 3KMWA 2IZSA 4OTFA 5C8MA 5CAEB 2C68A 2RL5A 3WF6A 3D5WA 5IH6A 3BYUA 3GEQA 4BR3A 1OITA 3HV6A 4BTKA 1YXXA 3QTIA 3RMFA 1Q8YA 3FHRA 1YDTE 3R63A 4PRJA 4O83A 1WBOA 2W70A 4PTEA 4ANSA 4BI0A 1MUOA 2QOIA 4JR3A 3PG3A 2XA4A 4PDYA 1UU9A 4ID7A 4YHTA 4C59A 4UWCA 3EN9A 3QC9A 2ERZE 3WOWA 3KAJA 2WO6A 1M6VA 1BI7A 4MXYA 4QMPA
chains in the Genus database with same CATH superfamily
3EYHA 1H1SA 2P0AA 1TAEA 5C4LA 5CVFA 4BHNA 1EKFA 2ZMCA 2HCKA 1XWSA 3NRMA 3P78A 2C30A 3CE3A 2XK7A 4M67A 4WBOA 4XOYA 4N70A 3WF8A 3H10A 4D9UA 5B2LA 2R7MA 3RTXA 2ESMA 5E8WA 3EQPA 5J9ZA 3FSFA 1V1KA 4DT9A 1G5SA 3FI8A 4I5HA 2BRBA 3S3IA 3UYTA 4XS2A 3RM6A 3ZLYA 4O7RA 2JAMA 3IW5A 2PUIA 3KN6A 4GYGA 3T9FA 4BIBA 3V5JA 1T45A 2ZM3A 2RFNA 3LFBA 4BGHA 1AUXA 1PYXA 3UZTA 4GL9A 3W2OA 3WF7A 5CSXA 3COIA 3I0OA 2R3FA 4FIEA 2OKRA 4FFMA 3DF7A 3T9EA 1YI6A 1XH9A 1TKIA 4PDSA 1OB3A 4O86A 3FV8A 3QA8A 2WQMA 4FJVA 4IB0A 4EOMA 2DS1A 2JDSA 3MW1A 3QTZA 1R0EA 1FVRA 4ZXTA 4RBLA 3R9HA 5BWTA 3SRVB 1JDBB 4Z7HA 1H1RA 4BIEA 4GT5A 3W0MA 3OBJA 1C30A 2ZJWA 4BDKA 4G9CA 4DHZA 4EHVA 5GJDA 5BYYA 3SGIA 3VMMA 5KZIA 3U0GA 1UWHA 2E9PA 3KRXA 2GHGA 2ITZA 3FDNA 3UZPA 4E5AX 2WEIA 5H2UA 2PULA 1Q97A 3UO5A 3MFTA 3IOKA 3D83A 4EHEA 1IAJA 1AQ1A 2AC5A 4GJ3A 4J96A 3KGAA 1FVTA 3NUPA 5ANOA 2PN1A 2HY0A 3D15A 3GJXB 1R0PA 1WMKA 3A62A 3KREA 2XKDA 2OSCA 3PRFA 1G8AA 4RJ3A 3ZDUA 4ZSEA 4D55A 5D1OA 5HZNA 1UC9A 4QMQA 4QP9A 4RMZA 1JSUA 5D12A 4LUEA 3P5KA 1FPUA 5DEYA 2PVRA 5GHVA 4FTJA 4LRMA 1KV1A 3ZO1A 1JWHA 3MH3A 3PP1A 3QX2A 2ITPA 4LRKA 4DBXA 3KVXA 3MFUA 1DAWA 4M7IA 3DTGA 4YO6A 1W82A 5BYBA 1DI9A 1O9UA 4UZDA 3LMIA 3DXQA 1PXKA 3MA6A 4YAKB 4GVAA 3WZDA 4N6ZA 4UXQA 2DLNA 3H9OA 4ENYA 5IF1A 4F64A 2PU8A 4XV3A 5CYIA 5AJQA 3FLZA 3HRFA 3W0QA 4DTKA 3R23A 3HV3A 3CD8A 5I9XA 4YJVA 4KIOA 2V62A 5AUTA 2BVAA 3QTXA 3RJCA 4L3JA 4ZY6A 2BR1A 1JKTA 1OPJA 5LXTF 5LP6F 2WEVA 4MV3A 4DG2E 5TT7A 3R7EA 1GIHA 3VS5A 3UMWA 2WFYA 4MBIA 1YVJA 5FLFA 3PXZA 1PXJA 5HBJA 2QO7A 4KAOA 4L45A 5HX6A 1A3GA 3QUDA 5HEZA 3VS1A 4D4VA 5L2WA 3Q32A 2NPQA 2ZVAA 4G1WA 4BJJA 3AT2A 5HE1A 3W0RA 3NMUF 1G3NA 1KSWA 3I5NA 3AMAA 3O2MA 2IO6A 3ZM9A 3PRIA 3A4PA 4U7ZA 3VBYA 3TIYA 3I7BA 4XG3A 3QRKA 2BFXA 2GSFA 2Y4IB 3ANQA 3FZTA 3LJ2A 4GK2A 3O7LD 5FEDA 4YJOA 2FSOX 4YJTA 2DAAA 4DIMA 4ZTQA 3HAMA 4QYEA 3KF4A 1WCCA 3LFCA 2VU3A 4RWJA 4FEWA 4FG9A 4FGBA 3ALNA 4C4JA 4FSYA 5L6PA 1EUCB 2Z2WA 4NW6A 3T54A 3AKJA 5L8JA 4ZJIA 3KRLA 2VWZA 2XEZA 3GU5A 3TM0A 1W7HA 4ACGA 4IBMA 4RC2A 4EBWA 4RZWA 1YDSE 3GC9A 2LGCA 2XARA 3RAIA 4JS8A 1OBGA 4OT6A 4GU9A 2VTSA 1RDQE 4A9TA 3CSWA 1OL7A 3UFXB 4E6DA 5BVEA 4XG8A 4O6LA 3R7VA 4GK4A 3E8DA 4MTAA 3WF9A 4KD1A 4AW1A 3EB0A 2ABJA 3LFSA 5HHWA 5ACBC 4HW7A 2JAVA 2Z7SA 3IDCA 2ITVA 4E8AA 5I4NA 2P33A 5IQBA 4C62A 4C61A 3NCGA 2W6MA 3EL8A 4MEDA 4PY1A 5D10A 4BDAA 3CKWA 2PVNA 4ZEGA 2O64A 3FYJX 3WZJA 1CKNB 3Q1KA 4XCUA 4TT7A 5GONF 2YIRA 4ACDA 2VTQA 5A46A 4EGQA 4UWYA 4YU2A 1U46A 3EQHA 5AUVA 4QMZA 1ZAOA 4P2KA 1PMVA 5DN3A 2B4SB 2RFEA 3TMOA 4IM3A 4PWNA 3FQHA 3HL7A 3LQ5A 4EOKA 4WT6A 4F99A 4A9RA 4EH6A 3PE2A 5A14A 3W0OA 3GB8B 4HPTE 2F7EE 5A4QA 3TDVA 3JSNA 2HY81 3CY2A 3FY0A 1OPKA 1SVEA 3TTIA 5CF4A 3WO1A 2BTSA 1GIJA 1SNXA 2RIOA 3FMNA 4UZHA 4L53A 4CFFA 2VV9A 4J99A 2CJMA 2VGPA 2IVTA 3CR0A 4K11A 3CXWA 2PTKA 3ORIA 4IH8A 4W4VA 5AA8A 2CMWA 3EHAA 5BWRA 1M0TA 1U54B 2VX3A 4ZSJA 4FFNA 5IUIA 3DV3A 3BAAA 2QOFA 4C33A 5HNEA 3A7FA 3HMNA 3R8PA 4BCQA 2GS6A 1K9AA 2YACA 1XHAA 2OJIA 3FLWA 4O27B 4WG3A 4AXEA 2NRYA 4M8TA 2R7NA 2DYLA 4FOBA 1Y91A 2PSQA 4RIOA 4KKEA 3CCNA 1RE8A 4YBJA 4AZWA 5DVRA 3N51A 4BCPA 4BN1A 1YRPA 1JVPP 3DK3A 5BVFA 1BYGA 1CTPE 2O2UA 3TKHA 4XNEA 4F70A 4ZTMA 4YJ2F 5CB4F 4M0JA 3KQ7A 3QQGA 2GS2A 4XUFA 1PJKA 3W1FA 5CF6A 4U0IA 4QEBA 2YS7A 4HYIA 4BDIA 3L9PA 3T3UA 3R02A 5A4EA 3VUIA 2IVUA 3VJNA 3D7TA 2I87A 1KJ9A 3EFWA 3QD4A 2JDOA 2R0UA 4GG5A 4LL0A 2CNQA 3FSKA 2GLTA 5BWXA 3ZRKA 3KXNA 3AC2A 5DT3A 2GFSA 4FU0A 2X7OA 3NBYB 3AXWA 4R1VA 3VN9A 2XRWA 3FKOA 1R3CA 3AC4A 4CFNA 1YOMA 5HVKA 3V5TA 1URCA 3MS9A 3R30A 3FMDA 3MJ1A 2GQSA 1B6SA 4FKVA 4D2SA 4EK3A 4FT9A 5IA0A 2XK9A 4R78A 5E8UA 2VZ6A 3KXHA 4MXAA 3W0PA 3IG7A 3G0EA 4RIXA 1FVIA 5JFXA 4DFUA 4BY9E 1P16A 3DKOA 2EU9A 3HMMA 4TYIA 4B6LA 2OF4A 4MV1A 3THBA 1KOBA 1B6RA 5TKDA 3ATTA 5GIOE 1E9HA 2CNUA 4LOOA 5C8NA 2UW8A 5CU3A 3R71A 4IAYA 4C34A 3ETJA 3KKVA 2WMQA 5M56A 3MVHA 1KOAA 4ASXA 3H4JA 5IDNA 1CM8A 3GC8A 2WQEA 4CG9A 3LQ8A 5BMVF 4IIJF 3C0IA 3O0GA 2ZDGA 4NWMA 3LFEA 4ASDA 1I2LA 2JD5A 4I22A 1QPCA 3KXMA 4QTCA 4JOAA 2R4BA 4ME6A 4RA4A 3V04A 2QOBA 4HPUE 3W8QA 3CQUA 4CTCA 2B54A 4O84A 4EC9A 4YO4A 4MV4A 2V0DA 3ML1A 3C5IA 2BKZA 3ZDIA 5F1ZA 1ZYJA 1DAAA 2J9GA 2PWLA 3Q04A 4ZTRA 4RC4A 4BCJA 5JQWA 2WELA 3TN8A 4CRLA 3IO7A 3WI6A 3R21A 4YZNA 4L00A 3QHRA 4FEXA 3MDYA 4X2JA 5M08A 3WYYA 5AP5A 3TDWA 5AM6A 1WR2A 4DRFA 2QR8A 3RPRA 4BVUA 5IDPA 1Q8TA 2OJJA 4ANLA 3R5XA 3T7AA 4YLKA 4HYSA 2UZTA 3O51A 2DZDA 3WWIA 4RGJA 3COKA 4MXZA 3TZMA 4DEIA 3BCEA 3SG8A 1I1LA 1VS0A 4DEBA 3POZA 5E4HA 2AEGA 3QRUA 4QPAA 4FA2A 4ZTNA 3LP8A 3IW4A 1ZZ2A 3ACKA 1P8LA 5KKNB 4DTBA 4O4HF 5FNVF 3OY3A 3GCQA 3JZFA 4XLVA 2R2PA 2DQ7X 3ORTA 3DLSA 5E91A 5FXQA 5FD2A 1G8SA 4E7WA 2Z7LA 1ST4A 4I1ZA 5DGIA 3A7GA 4PBCA 5DR2A 1Y57A 1GNGA 2I40A 1JOWB 2W1EA 4YHJA 3UG1A 4UALA 3CP9A 3UJGA 3HDMA 4MNFA 3R1NA 4QP6A 4BTFA 4L44A 2CLXA 3PXFA 4BZOA 1GY3A 1HCKA 5CEQA 3IK3A 2GU8A 4U81A 3ZFMA 4RWLA 4XV1A 4DH1A 5HBRB 2IVVA 2BALA 5FTOA 3KCFA 5CSPA 1RW8A 4C4FA 3BBTB 3AD4A 4EUUA 2DUVA 3N8DA 3SAYA 5JGAA 4JNWA 1JQHA 3TZ8A 3QL8A 4QYFA 3K3PA 4FFOA 4C5AA 4F0IA 1KE9A 4L7FA 3VF9A 2ZV2A 3WIKA 4FEVA 4I4EA 3KY2A 4FSZA 4II5A 1KC7A 4C4IA 1IEPA 3VRZA 4IFCA 2BRMA 1IA9A 4MNEB 3RK7A 4CKIA 4P7EA 4P90A 4Z3VA 4RX8A 1JAMA 1K2PA 2W9FB 4DH3A 2JDTA 2JIIA 3BL7A 3NX8A 3OC1A 1G2WA 3IDBA 5DFPA 3HZTA 3ZBFA 4UUGA 2XAMA 3OW3A 4BI2A 5DLSA 4XZ3B 4DLKA 1OMWA 3CTQA 4HYUA 4FV9A 3Q2MA 3PYYA 2WXVA 2VWBA 5I9YA 2YL2A 4WUAA 4RIWA 4YJQA 4C3RA 4OR5A 3SGCA 3Q4CA 4F1OA 2YDIA 3DGKA 3DZQA 4IWOA 2UZVA 3M2WA 3PSBA 3TIZA 2H34A 5LXMA 3LZBA 3RFCA 1Q3DA 4RPVA 2FPIB 3VNTA 4PMTA 2NP8A 2P55A 3WBLA 3ZRMA 3NPCA 5BUIA 4CMDA 3I0QA 3LFFA 3QZIA 1LEWA 2FYSA 4KNBA 4XYLB 2C47A 4F6SA 3EQDA 1A06A 5F20A 2VTLA 3VRYA 2R7BA 5LCJA 1ND4A 4L1KA 1YXVA 3LCKA 3FZOA 3D5VA 4FEUA 5EW8A 2P3GX 5CF5A 1TQIA 4TNBA 4U97A 1UU3A 2QHNA 2YA9A 1KUTA 2VAGA 4NM0A 4GU6A 1KWPA 4DLJA 5CQUA 4EHGA 2FSLX 2QOKA 4YP8A 4NZNA 3KIOC 2YM6A 4EK4A 3AD6A 4FIHA 5BQ0A 5KBRA 2HWOA 2W1CA 3C5UA 1VLRA 3UIXA 4QQCA 4MAMA 2B9FA 1F5QA 3G9LX 4ZLYA 5CSVA 1GIIA 3QWJA 4USDA 3TW6A 2Q0NA 3VOTA 3VUDA 3PJ3A 4FV7A 3PLAE 1G8JA 5D8DA 4E26A 3HVCA 3QHWA 1W0XC 4YTHA 3U8WA 2XCHA 3DFAA 1TA8A 1LR4A 1P5EA 4FKPA 3R2YA 1H0WA 3RNYA 1NXKA 2GNJA 4DH8A 5HTBA 3PIXA 5M53A 3PPJA 4BCHA 3ATSA 1SZMA 4RSSA 2XVDA 3VBTA 2PUUA 4F1TA 3NUAA 5I5YA 4CKEA 1CKIA 4Y72A 3L9MA 2EJ2A 2BRHA 2PUPA 3NZ0A 4QQTA 4EZ3A 3Q2JA 4QOXA 3BYSA 3CTHA 4M0YA 4PQNA 2ETKA 2W0JA 3AGLA 3FEGA 4HGLA 5IQEA 3FQEA 4IAZA 3CTJA 4X3JA 1E4EA 1MQ4A 2W17A 3U87A 1P4FA 1FMKA 2I7QA 3FI2A 2XK3A 3PLSA 1WBNA 4XX9A 4DHIB 3EYGA 2BCJA 3E7OA 3ELJA 3NVMB 5FM3A 2HIVA 5DMXA 4ZY4A 4M14A 1YW2A 4ANQA 2CCHA 2PY3A 4D4YA 1JDEA 4NTSA 3ZZEA 4HZRA 4JIAA 3FXZA 4IANA 2IW6A 2C5VA 3BQRA 1KE7A 4AXDA 5IQFA 4S34A 3UQGA 4C36A 3F5UA 3S1HA 5CVGA 4C0TA 4O0WA 2OK1A 4PDOA 1JPAA 3E8NA 3B8RA 4FYOA 4QYHA 4L6QA 5BVNA 1BUHA 3N4TA 4O6EA 3QA0A 4YJPA 1Y8YA 4EYJA 2ITXA 2X1NA 4KA3A 4B99A 5HU9A 4BICA 4TVIA 2Z02A 3ZXZA 2CPKE 3NDMA 4EKKA 4JAIA 5I9UA 4ITIA 4N4SA 4L9IA 2YM3A 3MIYA 4FOCA 3BEGA 4O0RA 5GJFA 3R1QA 4D5HA 1JLLB 2PUNA 2PE0A 1KTAA 4RRVA 4A07A 4I5CA 1LEZA 5JRSA 4BBMA 2ZM4A 3R8LA 4FKLA 2VTPA 3KVWA 4DE4A 2XK8A 4FKWA 4HCTA 4ONAA 4RJ8A 4K33A 5E8SA 3Q53A 1H00A 1ZOGA 5I9WA 4F78A 4JVGA 5LVMA 4MUQA 2UZEA 2B9JA 5J9LA 3GQIA 1YWNA 4OUCA 2SCUB 3A8XA 2R84A 1UVRA 3ULIA 5HI2A 4F4PA 4GK3A 5KMIA 1J91A 3DFCB 3R1YA 5LVPA 4WSYA 4ZI7F 2PYWA 2GCDA 3NAXA 4ANBA 2W6PA 2E9OA 4I3ZA 2WQNA 4OBQA 1FGKA 4EOOA 1I7NA 3U9SA 2OIQA 2YCSA 3E88A 4IJPA 5BPFA 3T9CA 3O5AA 4U41A 5EHOA 2FO0A 1XJDA 2X8IA 3MTLA 4JG6A 4RVMA 3ZXTA 4AT5A 5LVOA 2A0CX 5D9HA 4CQEA 5LOVF 2UW6A 3ERKA 3IECA 3LHJA 5EI2A 5LQFA 3VAPA 2C3LA 3RP9A 1Z57A 4RQVA 1JKSA 3RK9A 5A54A 5FP5A 3QZFA 3IPHA 1K3AA 3MVLA 3MPTA 2HWPA 2P0CA 5EQYA 5JT2A 4OT5A 1AUVA 3O8UA 2F49A 4O82A 3C4CA 3EFLA 2YCRA 4KWPA 1UC8A 5HNGA 1ZAUA 3EQFA 2DWBA 5L6OA 2JDVA 1GGOA 2PVYA 4NZMA 4E6NA 2OFUA 2PVMA 4G3FA 1H25A 3GOKA 4IWQA 1ZMUA 2I0EA 4I24A 2XNBA 4TTHB 5M57A 4L7SA 3K2LA 3G6HA 2C0OA 2HOGA 3F5XA 4J1RA 4JBOA 2CN5A 2W6ZA 3DY7A 3LLTA 1Z5MA 3GC0A 3PUPA 4AZEA 4TN6A 4EOJA 1B04A 1JSVA 3VPDA 1PMUA 2VRXA 4Y95A 4CHIA 4EUTA 2OWOA 4O7SA 2QO9A 4GS6A 4LMNA 2COJA 1OBDA 2P4IA 4FV2A 3TACA 4DG3E 1IOWA 3GU8A 3QKLA 3LCOA 3OCBA 2PMOX 4FZ6A 5AUWA 2IJMA 3S95A 4DEEA 1SVGA 3DJ5A 4K9YA 4DHJA 4S31A 3FXWA 4FMQA 4BCOA 2I80A 4E1ZA 1PF8A 1Y8GA 4M15A 2VWVA 2OBJA 3BYMA 4ASEA 5CA0F 4PL4A 5H8GA 4U42A 5FDXA 3GVUA 5HVYA 4I4FA 3V5PA 4PP9A 4X2NA 4YHFA 3UC4A 5GJGA 5AX9A 4I41A 3DA6A 3KU2A 5K3YA 3EZRA 3T99A 4LUDA 1X9NA 2XZSA 3UVPA 4FVRA 4AT3A 2JKMA 4D9TA 3F9NA 5JEBA 2YWPA 1Z2NX 3UIUA 3E8EA 4O7ZA 3ITZA 5IEXA 1KE5A 3DJ7A 3E64A 5IH4A 2O8YA 4NSTA 2HXLA 2B52A 2C0TA 4J53A 4TNDA 2BZKB 3ZMMA 2GPSA 4YJUA 2WKMA 4R7HA 4EEQA 2CFMA 2OF2A 4ORKA 5DAAA 4TYGA 5FBOA 1OL1A 2J0JA 3ZEPA 4BIDA 2G2IA 2IVSA 1H07A 3ZUTA 3LLAA 5AP0A 2WMTA 4IWPA 5F94A 1REJA 4MWIA 2X6DA 5ACKA 5CALA 4RIYA 3D7ZA 3MH2A 1Q62A 3KULA 4F7SA 2C5XA 3IQ7A 4UEUA 2O63A 1PRYA 4GYIA 4RFMA 5AIRA 2HZNA 4IAAA 2OWBA 2YM7A 4DCEA 2XP2A 3G8DA 1YHVA 4NTTA 3LM0A 3E5NA 5HESA 3BABA 5KHXA 2G2FA 3KEXA 3C4EA 4IC7A 2YRWA 5J5SA 3ZH8A 3AD5A 3DXPA 1DM2A 3VHEA 4CNHA 3PPZA 4WNOA 4Q2AA 2ZV7A 5C4KA 3AC8A 3P1AA 3D94A 3V51A 4PDPA 1H0VA 5DEWA 4MH7A 5FEQA 3RINA 3LJ0A 2FB9A 5CA1F 5GIPE 3C13A 1WVWA 1Y6AA 4Z9LA 5AAEA 5DH3A 3CKXA 1OL2A 4GFOA 4JBVA 4ERWA 3A2CA 2V5QA 3ORMA 3DB8A 2OH0E 4DEHA 2YZGA 4UCOA 2XCKA 4FSTA 2QD9A 3BPRA 2GNIA 4QYYA 5DT0A 2J5EA 4JJRA 4R3PA 4WUNA 5CU4A 2OFVA 4BC6A 3JR1A 4AN3A 2XBAA 2CKPA 3F6XA 1B39A 4PMPA 2JLDA 3D2IA 2ZDUA 4W8EA 5HIDA 4JXUA 2QLUA 2GS7A 1QCFA 4HJOA 3K54A 4MAOA 4YTCA 2HJWA 4Q4DA 3P86A 3QRJA 2CCIA 4KRDA 2W1DA 5BPHA 3OZ6A 1EKVA 5JZJA 4UB7A 3NR9A 4AE6A 3QQFA 4NCTA 5HCZA 4FV3A 3TNQB 3FMJA 3WZEA 2HGSA 4I21A 4LH6A 4AAAA 5IA3A 3I6UA 1IRKA 5FRIA 3L8XA 3FC1X 4FIIA 1H1PA 4TL0A 2OGVA 4C02A 2W1GA 1MRVA 4YBKA 2PMNX 4DN5A 4LQMA 4AGCA 3NUSA 4IWDA 3R5HA 2J9MA 3PJCA 4L43A 3RPSA 2PHKA 4BDJA 4RX5A 4RJ6A 2VO0A 3VS7A 4G3DA 5EOBA 3L8SA 4MXXA 4OTRA 2WMAA 3D9VA 3S4QA 3SHEA 3DAKA 3SOAA 3MJFA 2WTWA 2HG8A 1CSNA 4G16A 4LGGA 3W18A 3FYKX 2FP4B 2X5RA 2QI8A 3Q9ZA 4YNOA 5EK7A 4YJNA 3BHTA 3VIDA 4BDEA 3SA0A 5AV3A 3A60A 5CXHA 5E8XA 4CFXA 3DBCA 4XYMB 3BGZA 2I1MA 4XRLA 5ANJA 4HNIA 4U9AA 2VNWA 2WMUA 4FG8A 4R7BA 1XBBA 4AQKA 3MWEA 5BYZA 3AW8A 3VPCA 3SV0A 3O96A 4DGGA 3EZVA 4EOLA 4Q9SA 4V0GB 5AP4A 3TY9A 1U5RA 4N57A 4L46A 3VBXA 4FFRA 4S2ZA 1SMHA 3QD2B 3EMGA 1A0GA 2XM9A 5IYZF 3BLAA 3LFAA 3QGYA 1Q61A 3F82A 1XK5A 2G2HA 2VWUA 2G9XA 2WTIA 4UYNA 2ZYBA 1QL6A 2X7FA 2XANA 3PJ1A 1A48A 3LFDA 4R5YA 3TCPA 4CV8A 2P2IA 4KIQA 2RKUA 5JZNA 3ZEWA 5FP6A 4C2VA 3OY1A 4R1YA 3OXIA 5EW9A 5M4UA 3MPMA 3LM5A 3Q6WA 3SVVA 4Y46A 3F5GA 4MKCA 5EDRA 1UWJA 4MXCA 3QQLA 4AACA 4EH3A 2GNGA 1X8BA 2QKWB 3TY5A 4S32A 4M69B 5CAOA 4JT3A 4DEAA 3V4SA 4FUYA 3WARA 4FE2A 2GNFA 3IGGA 3P08A 4IM0A 1UA2A 3WWHA 4LRJA 5AUZA 3TJDA 3GENA 4MCVA 4ZSGA 5KZ0A 4HNTA 3CC6A 3PXYA 4UYAA 4CXAA 5LVLA 4IFGA 5HTCA 3NW6A 3Q4TA 4ZK5A 2ITTA 4FTKA 4RG0A 4TKSA 1UNHA 3HUBA 4FV8A 4L01A 5C26A 1XH4A 3R28A 5EM5A 4M97A 5IU2A 1O6KA 2E9NA 3QQKA 4LOPA 4RX9A 3ZUVA 3LPBA 2BHEA 2B55A 5G6VA 3OEZA 2C6TA 1FINA 2PL0A 3FE3A 3NNXA 3PWDA 2XIZA 2GPHA 4X3FC 3AC5A 4ACCA 4CFUA 2J0LA 5BVOA 3TW7A 2QOHA 3PFYA 3MBLA 4K6NA 4M13A 3UNJA 2C6DA 3GFWA 2A2AA 3OW4A 4GVJA 2LAVA 3ZCLA 2JKOA 4TYEA 2GPWA 5CSWA 5J87A 4I92A 4FT0A 2YWVA 5IA5A 4O7VA 4F9YA 3GCUA 1G8KA 4K8AA 4NL0A 4M12A 4XP3A 2W1HA 3E63A 2O5KA 4GT4A 3E3BX 2BPMA 3CLYA 4FSQA 1LP4A 3PVWA 5IQIA 5FBNC 3V5WA 3ZO2A 2ZGIA 1PXPA 1QPEA 3MSSA 1SCUB 2BDWA 4FV1A 4IWYA 4NYEA 5CS6A 3ID6C 4IVCA 5AFVA 4GV1A 3BHHA 4O0UA 3CJGA 4GKIA 4U3ZA 4LGHA 4D1ZA 5KNJA 2ETRA 1IYDA 3PVGA 4OTHA 1OGYA 4NU1A 5AA9A 4FL1A 3OBGA 2YITA 3ZSGA 3AG9A 1Z2OX 1Q4LA 1W98A 4AXAA 4C37A 4DDIA 3W0NA 2OLSA 3MWUA 4CC6A 2CGUA 3NUYA 4FL2A 5EHYA 4CE5A 2ZV9A 4WNPA 5KE0A 3E3PA 4KS8A 5CEMA 4M84A 5AV4A 2WTKB 3PA5A 2ITYA 3AC3A 3F7ZA 5LWMA 5EW3A 4JMQA 4JR7A 5KMJA 5JFWA 4OTDA 2XUUA 4GW8A 3GGFA 5DRBA 1PX2A 2YDKA 3ZTXA 2Y8OA 3SXSA 4FZAB 5KCVA 4JX7A 4BCKA 2OH4A 4J52A 5CSHA 4EQUA 1XMMA 1DI8A 3EJ1A 4CSVA 5JMSA 4LG4A 1RJBA 5E8VA 2C69A 3UNZA 4QMUA 2ZB0A 4DA5A 2IWIA 4E73A 2XYNA 4I6BA 4C2WA 4F9CA 2XNEA 3BKBA 2XAOA 4XJ0A 3PXRA 4ZS0A 3U9TA 5D11A 3ORKA 1J3HA 3VQUA 4HGEA 3PPKA 4DITA 5IMXA 2EJ0A 4XH6A 4O4IF 5CVHA 3QQUA 2WU6A 4I6HA 5EI6A 3UP2A 3QGWA 5AAGA 3A7JA 1O6LA 5T3QA 1BMKA 4FTTA