4O7RA

Saicar synthetase (type-2) in complex with ump/udp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
b'KAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with UMP/UDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 74
structure length 228
sequence length 228
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7rA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7rA02
3L9PA 2J9GA 3FMKA 3BWJA 3PXFA 4L9IA 3TG1A 3ZSHA 4YZMA 4TKSA 3R8VA 4G3FA 1OGUA 2C6MA 4QNYA 5EYKA 3ZSIA 3VRYA 4G5JA 4A9RA 1IOVA 3VBVA 5HVJA 3I12A 5DNRA 3Q9XA 3DKCA 4KA3A 4GKHA 1XHAA 3OOMA 5AP6A 2Z04A 2A0CX 3PVGA 3U6JA 3KMUA 3MWDA 2B9IA 2HYYA 2OH0E 3RGFA 1IG1A 2CKEA 2PMOX 1BMKA 3JYAA 3AW8A 4AW5A 2ONLA 3G2FA 4PUZA 3ORZA 4QYGA 3T3UA 2O3PA 4C3FA 4MV6A 5J2TF 4ANBA 4D58A 2C0IA 3L9LA 4FVPA 2WMWA 4N4SA 2RIOA 5EZYF 2ETKA 3Q3BA 4WBBB 5HICA 1SM2A 3W1FA 3UNJA 2C6LA 2BAKA 1Y57A 5GIOE 4ITIA 3QKKA 4Y46A 3H3CA 4E6DA 1HCLA 2HCKA 3ID6C 1UNLA 3Q4ZA 3ZO3A 4UBAA 2W1CA 2WMAA 4USEA 2YACA 3LFCA 1H1SA 3SOAA 2X2LA 3TZ7A 5JGDA 1TQIA 4FIJA 4TYEA 2LAVA 3W8LA 4CT1A 5HO8A 2KTYA 1RQQA 5IQAA 4YTFA 4QYHA 2QG7A 3ZXTA 2NU7B 3DKGA 5CF6A 1YXTA 2Y6MA 5AAEA 1YW2A 3LXKA 3KCFA 4PRJA 5HD7A 3MJFA 2Z02A 4S33A 5BMMA 1M2QA 3WE4A 3QRJA 4RMZA 4QP3A 3DKOA 3JY9A 3NAYA 2ACXA 4JBOA 2WGJA 4RVMA 1YRPA 4UN0C 1J3HA 2EXMA 5HX8A 5E7RA 2OWBA 3LCSA 4J52A 3B2TA 2W6QA 3R22A 3TTJA 3CPCA 4EUUA 4C62A 3EQPA 2B52A 3AD4A 4QMQA 4Y8VB 4J8NA 1RDQE 4XV3A 4GUBA 5DRDA 1A9XA 3U9CA 3JY0A 1U4DA 4FTIA 3QFFA 1JDEA 3QQFA 1OZ1A 1NY3A 4H05A 4IEBA 5AA8A 3UQGA 4FV5A 4DEEA 2PZIA 3HRBA 3ROYA 3NUYA 2I7QA 4FIEA 3WO0A 3C4FA 3GVUA 1OL1A 3E3PA 4Y5QA 1YQJA 1CMKE 3BWFA 3Q1KA 5CSHA 1GSOA 1ZWSA 4MV1A 2VO6A 5T3QA 5CEOA 4XZ3B 4EH7A 3O2MA 4ANLA 5KUPA 4R3CA 4MWHA 2CNVA 3OWPA 4FTKA 4BIDA 4A4LA 2BDFA 3NWWA 1WMKA 3AXWA 5LCJA 2W1GA 4OTWA 4L8MA 4AN3A 3ZEWA 3SG8A 2V58A 3FC1X 2WOUA 4K8AA 4RG0A 3QQUA 5HNIX 5D8DA 1AD5A 5HG8A 4FKIA 4U3YA 4F99A 1KJQA 2R87A 2WQOA 3LCTA 1PKDA 3HL7A 2ZJWA 4E8AA 3FBVA 3EWHA 3O50A 5IYZF 4AXAA 1B6CB 2X7GA 5JKGA 2PY3A 4D0WA 4Y8DA 3HZTA 3REPA 3OD6X 2YS7A 2VTJA 4DA5A 2R7LA 3IG7A 4U5JA 4XV9A 4AGUA 4C5CA 4FTTA 5IA3A 4QYYA 4DH1A 3QWKA 4FYNA 4NH1A 4F9YA 2VR1A 4ZSGA 4DLIA 3TV6A 4OR5A 3L8XA 2ZM3A 1MUOA 2FSLX 2VTOA 3DXPA 4IVCA 4UALA 3RUPA 4ZAUA 4HOKA 3FSKA 4L46A 2JIUA 2GLTA 3WO1A 3KL8A 3F61A 5JQ5A 3QTUA 4NYEA 1BI7A 4DEAA 2W06A 4YJRA 2C6KA 3EYHA 1NT2A 4FV8A 2W6NA 5AUZA 5K5XA 3IW4A 2GHGA 5IH4A 3KC3A 4ENXA 5AIRA 1CKJA 3TACA 5HTBA 3LMGA 5EQYA 4LL0A 4QNAA 2CDZA 4DFXE 5ACBC 3ZM9A 5ICPA 4O22A 3ZDIA 2OICA 5HCYA 2A1AB 3IK3A 4I21A 4U81A 4HYHA 2WMRA 1VBHA 1H01A 4K2RA 4PV0A 3VS0A 2XK9A 2GNJA 3UG2A 3ETJA 2VGOA 4NWMA 1KE6A 2ITUA 5H8EA 3RPSA 3UO4A 4C59A 4F4PA 2OH4A 3KN6A 3SVVA 1UKIA 2WPAA 4R1VA 2WMBA 4FKVA 2XRWA 3N9XA 4I24A 4JXFA 4EEVA 4C02A 4KKGA 3L9MA 4L01A 1SNXA 3PP1A 2WQEA 3QZHA 4MV7A 2Y4PA 3NNWA 3QF9A 5E8YA 3V5TA 1JKSA 4RFYA 4YJVA 4I4TF 4IWPA 5KNJA 4AW1A 2OI4X 4LMNA 4A9SA 1GZNA 1WBVA 3V5QA 5LJJA 2JEDA 5BPHA 5HE3A 2WFYA 3Q2OA 3TJDA 4AUAA 4FFNA 1EH4A 1STCE 2VTAA 4O4LF 4OTDA 1M0TA 4M15A 4WNMA 4C4IA 3FXZA 5EK7A 1JBPE 1ZMVA 4ZTQA 4FVQA 4YJQA 3GENA 3NEWA 4D2RA 1PMUA 3UPZA 3PZEA 1G8AA 3GU7A 5DHJA 5FDXA 3GP0A 3OWJA 4BCGA 4BF2A 4EH4A 5JK3A 3CBLA 3B8RA 3GCPA 3P08A 4JG7A 4AQCA 3R5HA 4APCA 4FTLA 5HCXA 4O27B 4BCKA 3R00A 5D41A 4PTGA 4IAIA 2WNTA 4UB7A 2WKMA 3RPRA 2ZB0A 4OW8A 4KINA 2YCFA 2XIYA 3GU4A 2FPPB 4YJ3F 2VU3A 2XKEA 4B7TA 5CANA 5HX6A 4DAWA 2J90A 3ALNA 2WEIA 3MIYA 5EDQA 3ZHPC 3SAYA 2YZMA 3OUKA 3VUIA 2VWWA 4MNEA 4II5A 3TW6A 3SE7A 3PXRA 4DH3A 5HTCA 4L44A 2OLSA 4EHZA 3P9JA 1JNKA 3QRIA 3PXZA 3GOKA 4Z16A 5CSPA 5DEWA 3FMDA 3UVPA 5A6NA 2H8HA 2FPGB 3QWJA 2R3MA 2VD5A 4L1KA 3L8SA 3L1SA 2A27A 5IMXA 2XJ0A 2FUMA 5AP3A 3BCEA 3QCYA 3G9NA 5EOBA 2QOOA 2UZNA 3BGPA 2OZAB 3SLSA 3N6RA 1B38A 3COHA 2X8IA 3MIAA 5E1SA 2RFSA 2CKPA 4QP2A 5C8KA 4CSVA 3UE4A 3EZVA 3ZLYA 4CFMA 1P14A 3TT0A 5KKRC 3BU3A 4CV8A 2QOKA 4FTCA 3ZEPA 2ZMDA 4IADA 4AU8A 3P78A 3MFUA 5BQ0A 1DM2A 1GLVA 4QTAA 3K5IA 2XB7A 4QP9A 4BIEA 4TWNA 5CVHA 1JKTA 3KREA 2LGCA 4OLIA 3RPYA 3NUPA 4AW0A 2E9PA 4O0SA 4PY1A 4JX3A 3VUGA 3PG3A 2IJMA 4D28A 2X2MA 3SD0A 5AIKA 4FZ6A 2WELA 5DR6A 4YP8A 5CA0F 1WBSA 4JT3A 5AP7A 4QQCA 2BZJA 3JRWA 4MV9A 4EH8A 4FG8A 2CMWA 1U59A 2XKCA 4FGRA 2DWCA 2YJRA 3SC1A 3WZJA 4FSQA 4R3RA 2YL2A 4HQ6A 3QUPA 5M4CA 1CS0A 4ZTLA 3F69A 4V0GB 2Q0NA 5HG9A 4IDVA 4FV1A 4K77A 3V8WA 4I6FA 3PA5A 3H30A 3LPBA 2GCDA 5AX3A 4YBKA 3RZBA 3KAKA 2UW4A 3PZHA 5J9YA 2R3OA 4LOOA 3QD3A 4YHFA 3WZUA 3HO8A 5M07A 3R9NA 5T6KA 2JIVA 3EHAA 1FBNA 3KMWA 3KRLA 4DN5A 2PN1A 3QLGA 4RFMA 4E6QA 5T68A 3C0HA 1RE8A 3EFKA 3NSZA 3O71A 4IB1A 3PY3A 4FKLA 4PWNA 2GQRA 3WI6A 3CTQA 2JBPA 4RIXA 2PE2A 4U9AA 5ETFA 4J96A 1W98A 3LQ5A 3NR9A 3UZTA 2WOTA 1I09A 3QYZA 1L3RE 3DAKA 3O0GA 3F5PA 4G3DA 3LFBA 3EKNA 3GIDA 2BDJA 2Y4IC 3OEFX 3TZ9A 3S3IA 1AGWA 4BYJA 3W33A 5K4IA 3JZIA 5KO1A 1M52A 5E8XA 5IMEA 3SOCA 1WZYA 4ZHQF 4O0YA 1XBBA 4F7LA 4NJDA 3E63A 3ZONA 5D7AA 4D55A 1KSWA 3PJCA 5IZFA 1RJBA 3KCKA 3FSFA 4ASDA 3EKKA 3FHRA 4IAAA 5B0XA 3DGKA 4FNWA 4FSYA 4YR8A 1FVRA 3SRVB 3B8QA 2RFNA 4YUQA 4ZS0A 3HP5A 2WMVA 3UZPA 4C5AA 1BYGA 1MQBA 3MY0A 4WOVA 2CLXA 1UA2A 3TV4A 1I7NA 2W1ZA 4DFLA 3OCTA 3TIIA 4U0IA 5M55A 1OBDA 3GC9A 2R3IA 3RV3A 3ERKA 3NX8A 4QMXA 3R8ZA 2YA9A 4BCOA 2VPQA 4GS6A 1XH8A 2QO7A 3I79A 2PL0A 4UWCA 4OTFA 5EHLA 4IIRA 5CS6A 5DG5A 1GIIA 3D15A 4IJ9A 3ENHA 3ATTA 4IE9A 4FEVA 1MQ4A 3IW8A 5CXHA 2EXCX 3PPJA 3V8TA 4X3FA 4MBLA 4BN1A 2ZMCA 4ALUA 3VNTA 2GHLA 4I5MA 4N6YA 4DBNA 3FQHA 4FL1A 4KUJA 2I0VA 4CEGA 2XBAA 2HXLA 4EK4A 2GU8A 2BZKB 3C7QA 3K5VA 2BZIB 3ELJA 1QL6A 4DEGA 5LWNA 1AUXA 2UW3A 1UU7A 3BEAA 3K3PA 4O2BF 1KE8A 4AGWA 2C00A 5FBOA 1UVRA 4KS7A 3KVXA 3P4KA 4PF4A 1GIHA 1H1QA 3CTJA 4FIIA 4O0TA 4W4XA 3WNZA 3LCOA 4RPVA 3R7YA 4BDJA 3EQCA 4O4HF 4HZRA 2WEVA 3Q5IA 3DT1A 4FUYA 1H0WA 5EOLA 5HG7A 3D9VA 4CFVA 5BUJA 1Z2PX 3RAKA 4PX6A 3PY1A 4M8TA 5I5ZA 3L8PA 3QQLA 3SA0A 3N4VA 2CN8A 2P0CA 1MRVA 5J95A 4DG2E 2WU6A 4RFZA 2C6DA 3BYOA 2ZM4A 2W6OA 3PIZA 4M0ZA 4AT4A 2O65A 3SX9A 4IM2A 3VS2A 2C4GA 3HDMA 4XBRA 3SQQA 2IVVA 3GU8A 3GC0A 4FV2A 2F49A 3BBWA 5KKRB 3UMWA 2I87A 2BAQA 1SZMA 2IW8A 4EQMA 3RHKA 3LMIA 3I60A 4HPUE 2W4KA 5EHYA 4DINA 4BI0A 3LWBA 3VOTA 3F2RA 3FLWA 4DYMA 5IF1A 2BHEA 5JGBA 3PWYA 4WIHA 3SGCA 4F6SA 2JGZA 4MNFA 3EFWA 1M14A 2QU6A 2JDOA 4O7ZA 4MCVA 4ACDA 4CCBA 4GJ3A 4ZLOA 5EM7A 1Q8UA 4YZ9A 2IZUA 3FLZA 3ZUTA 5DT4A 2P0AA 4FKPA 4I6QA 3Q53A 2YYAA 3LKMA 3WF5A 1Q3DA 1U54A 4JG6A 4CCUA 4F0FA 4XG8A 2G01A 4YC6A 1GGOA 4QTDA 2YAKA 3TZMA 4C36A 1PJKA 3GU6A 5AM6A 1J7LA 2B0QA 2J0LA 2OZOA 3H4JA 3NUNA 3HLLA 1Y91A 4ZY6A 2YN8A 3R5XA 4AZEA 3QD0A 4JNWA 3CC6A 4L53A 2VNWA 4DEDA 4E6CA 2QCSA 4ZIMA 4E93A 2JLDA 2ESMA 4QTCA 4YO4A 4LGGA 4X3JA 2PUNA 3BELA 3ZO4A 4D1ZA 3ZFYA 1Y6AA 1NXKA 1V1KA 3ZFXA 1GZKA 3TKUA 2QHNA 4LUDA 4DFYA 5ANKA 4AT3A 5B7VA 2HGSA 4V01A 4FTRA 4XLVA 2YIXA 3FMEA 5JGAA 2VUWA 2Y4IB 5LOHA 2PZRA 4YHTA 3CJGA 4TV8F 3LOKA 2H6DA 4GT4A 2P55A 2VWBA 1LPUA 4CMUA 4NT4A 4S30A 1JSVA 3V04A 5HLWA 2GPWA 2X4ZA 3F3VA 2OXYA 1J7UA 1W0XC 4I50F 3FUPA 3PA3A 2VWYA 5C27A 3R0TA 2XMYA 2YRXA 4O7WA 2B53A 3ORRA 3G15A 4G1WA 3U9TA 1OUKA 4BHZA 1GAGA 1NVQA 3HP2A 4FV0A 2OO8X 4BTJA 3OG7A 3CY3A 4WRGA 3MFSA 1OKVA 1KV1A 4M97A 3EQDA 3NYNA 3BGQA 4RJ7A 2YWPA 4OT5A 1M2PA 2GNGA 4FSRA 3OZ6A 2B9FA 3OY1A 4AA4A 4F6UA 5IQDA 2PVLA 2VTNA 2X0SA 3IW6A 3ZXZA 4Q5HA 3R2BA 3GOPA 4AZSA 1Q62A 3KAJA 2WQMA 3FMLA 3HX4A 3R1NA 3ZBXA 4DH7A 1YXUA 4IANA 4RX7A 1ERKA 2XEYA 4AT5A 5HU9A 5HQ0A 3OXIA 4IB0A 4XBUA 2BRHA 3ZDUA 3OFMA 4ZMFA 3FC2A 3A7JA 3DDPA 1BX6A 5A54A 3BLHA 4FZ7A 2W71A 3QD2B 2O5KA 3NYVA 4D4YA 4OBOA 5LXTF 3E8NA 4EI4A 5TO8A 4E6AA 5KCVA 2X9FA 4M69B 3QXOA 2OF2A 2R2PA 3KK8A 1QPDA 2X9EA 4RRVA 4O0RA 3CTHA 1CSNA 3DDQA 2YCQA 4MXXA 3AQVA 1FQ1B 5J1VA 4IC7A 3HRFA 1OB3A 4EKLA 1REKA 4RJ8A 2W1EA 2VWXA 5E8VA 4ZSEA 3ZRLA 3BQRA 3Q4CA 3Q52A 3ZFMA 3S1HA 4KABA 3Q2JA 4KKHA 1ZY4A 2HWOA 1A06A 5F4NA 5TR6A 5EQEA 2XP2A 2B55A 3UYTA 4ZK5A 4BGQA 3FI3A 1TVOA 2QI8A 5ANIA 2OFUA 5CX9A 3KU2A 4I0RA 2BRNA 3F5GA 1O6KA 4XX9A 4DEIA 3PSCA 4NSTA 3V6RA 5CTPA 4BHNA 2BCJA 3FDNA 4L3LA 3OF0A 2WTCA 4MXCA 5D7VA 4IZ7A 2KULA 3KULA 3SDJA 1JLLB 4EK5A 2PULA 3L8VA 1OKYA 1SCUB 2W5BA 4WO5A 2Z60A 3IDCA 4IVDA 3QKLA 3RCDA 4FYOA 5CAOA 1OITA 5AV2A 4B8LA 3NCZA 3O8PA 1XKKA 3TZ8A 4GFGA 4GUEA 4IM3A 3AC5A 4EOSA 3R9OA 1B6RA 2R7IA 5D11A 3C5UA 3VUMA 4LFIA 5LA6F 2VWVA 4H3PA 2XNOA 3NAXA 5JFSA 3HMPA 4JRNA 4CQEA 3QLFA 4G2FA 2XA4A 4YJNA 3DZQA 1SYKA 2VTIA 3QALE 4HNIA 4L45A 2XYNA 2ITVA 2YZNA 3ANRA 1QPJA 2C68A 5D10A 2HELA 4BTMA 4FFLA 2C3KA 4DEBA 2VRXA 5CI6A 2YEXA 1XH9A 2XNPA 5J9LA 4IDTA 2OW3A 4EL9A 4JOAA 3PA4A 4LV8A 2F2CB 1WVYA 3KFAA 3HMMA 4IACA 4YLJA 5AP5A 2CKOA 3DK3A 5E8UA 4FX3A 5KMMA 1ULZA 5ETAA 4YSJA 3D7ZA 2QF7A 1M17A 3WIKA 4BB4A 1YVJA 1KJ9A 3HMOA 4I41A 2VAGA 3I6WA 3DNEA 5E8ZA 4F0GA 1BXRA 4EONA 4JDKA 4QYEA 2ITXA 3BQCA 4EC8A 3B2WA 4L3JA 2XM9A 3ZMMA 4J8MA 2VWIA 4C0TA 5I9UA 4HW7A 2C5XA 5BPYA 1DV1A 4FV4A 2BRBA 3AC3A 2XNGA 3EQHA 2XK6A 4NCTA 5CI7A 1KC7A 4RVLA 4XH6A 4FNZA 1P2AA 2CKQA 2JKKA 1YOMA 1G5SA 3UODA 5DA3A 4O38A 5E8SA 3VPBA 3LAUA 3W2OA 5TOZA 3FI4A 3M2WA 2JD5A 1IRKA 4M67A 3TUCA 4JS8A 3D14A 4GK3A 4C4HA 3TNHA 4FSWA 2NPQA 5IUGA 5FRIA 5IQBA 5L3AA 2ERZE 3FPQA 4BDBA 4BRXA 3MYGA 3M42A 1OIYA 2C69A 2XNNA 2ZAZA 1YHSA 3OUNB 2VN9A 5DEYA 4O0UA 2HJWA 3PG1A 1H1WA 3TNPC 4EHVA 2R7KA 3F5UA 2I6LA 4CXAA 4AX8A 3TI1A 1GNGA 4IIJF 4U6RA 5E4HA 5CAVA 4D9TA 2DQ7X 3UC4A 3POZA 4RWKA 3JXWA 3TKHA 4KD1A 1VZOA 3FY0A 4I94A 5C8NA 3BG5A 2BR1A 4IZOA 2X2KA 4QP1A 3ORNA 5F94A 5LCKA 3ZC5A 4AG8A 5LVPA 1ZYCA 3HVCA 4GK2A 4DTAA 5EH0A 2ZDHA 4WUNA 2Z8CA 2BFXA 5DR9A 3D83A 4TYGA 2VTLA 5AP0A 5IEVA 3O96A 2ZDGA 4AOTA 4FMQA 3PJ2A 4R78A 4K6ZA 4DTKA 3KXMA 5BYLA 2YZLA 4I1ZA 4ERWA 2PVYA 3Q9WA 2AC3A 4H1MA 2PBZA 4RIWA 2PVRA 4EH9A 5DIAA 4TN6A 4NUSA 5HBRB 1ND4A 3KF4A 4QMMA 3NW6A 2I1MA 3C50A 3EJ1A 3PXYA 5LMAA 4RBLA 5DI1A 4DCEA 1BKXA 3KEXA 3EQFA 5CQWA 3SHEA 2QD9A 4O0XA 3HRCA 3DY7A 3LFFA 1KOAA 3A8WA 3ACKA 4O7LA 3NLBA 5BNJA 2J0IA 4XG6A 3HNGA 1NW1A 4ZTNA 2R7BA 5H8GA 4RQKA 4C38A 4QPAA 2W4JA 4CGAA 4FSMA 2HZ4A 4I20A 2XKFA 5DRBA 3LW0A 2GDOA 4JBQA 4AZWA 3C4CA 4IB3A 4JL9A 4ACGA 1ZZLA 2ITZA 1YDSE 2OJGA 4XG4A 5M4IA 4W4VA 1PX2A 3OC1A 5FLFA 3K5HA 2GNIA 4FOBA 4U44A 1JWHA 2HW6A 4E5WA 2ZM1A 4I0TA 4FL3A 4O82A 4OTQA 1JQHA 1YWRA 4DGNA 4E4XA 1JPAA 4G6NA 3DU8A 3WF8A 2ZDQA 5C1OA 2NRYA 2XS0A 4J97A 1R0EA 4PDPA 2WTKC 4O4IF 4WBOA 4Y85A 4DFUA 3AX6A 4OTGA 2GQSA 3VBQA 5FTGA 4HZSA 4KAOA 2QODA 2C0TA 3MPAA 5IA2A 5JFXA 3NVKI 2P4IA 5H8BA 2CLQA 4DGLC 1WBTA 3UO6A 2CN5A 4A7CA 4GYIA 4YLKA 2O64A 3V51A 3LIJA 4HVSA 4MBJA 4D9UA 4MA0A 3UC3A 5CNNA 1BUHA 2R3JA 4WG5A 5FDPA 4IFCA 2X39A 1Y8GA 3BBTB 4BZOA 2Y6OA 2JDTA 3ODYX 2UVXA 3PUPA 4Q5EA 4FTNA 4MXYA 3BEGA 4IQ6A 5CYIA 2YABA 1PF8A 3UYSA 4FKSA 4CKIA 3QU0A 1Q5KA 2OJJA 3K3JA 4ZSJA 5HVKA 3BZ3A 4LRMA 5J2UF 1KJJA 1M2RA 2VQDA 2UVZA 5KMIA 4XYMB 3HMNA 1B6SA 4E4MA 4IX6A 1OM1A 3C4WA 3JVRA 1JDBB 3LMHA 2Z7SA 1PXPA 3DLZA 3K54A 3PXKA 3UIBA 3QRTA 3GU5A 2PVMA 1VJYA 2HZIA 2W0JA 4KSQA 4GCJA 4NW5A 3CGOA 4IHJF 1XH6A 5EDPA 3GEQA 3LXPA 3KXNA 5FEDA 5D12A 1WVWA 2UW7A 4YURA 4WBNF 2W6ZA 2WTIA 3E5AA 3L9NA 1EUCB 2W9ZB 2XNMA 3FYKX 1DI9A 3RP9A 4EQUA 5IA4A 4MH7A 5EM8A 3KKVA 3FXXA 4GL9A 1KUTA 2REIA 4RX8A 3DFCB 3VS7A 4O86A 4OBPA 3G8CA 3UQFA 2HXQA 3GNIB 4V0GA 5CXZA 5F9EA 4F9AA 3E3BX 3AC1A 3PRFA 3DLSA 3OCSA 4LRKA 4Y73A 5CAUA 4DH5A 1OI9A 3LJ1A 4ZXTA 3RM7A 3OUZA 4ZY5A 4DG0E 4ZOGA 3HEGA 3MTLA 5HIBA 2W70A 4YJTA 2C6OA 5DR2A 3COMA 3UP2A 2ZYBA 5B2MA 4JBPA 4KB8A 2PVJA 4HCUA 4BDIA 2X6DA 4XLIA 1OMWA 4AA5A 4HR7A 4BR3A 5HNGA 4CZTA 4QMUA 1Q99A 2X4FA 3I5NA 1UV5A 2WTJA 4QMNA 3HUCA 2R7NA 4G6OA 1XQZA 4RLKA 4JLCA 4UX9A 4HNTA 3I0OA 5IPJA 2X8DA 2YDIA 3ZUVA 4B6LA 1YI6A 1H1PA 3RVGA 3PSBA 4XNEA 5HLNA 4AZFA 3TNWA 4EJNA 5BPFA 4U7ZA 3VF9A 3R5FA 1CKIA 2QU5A 4RZVA 3DK6A 4NKSA 4Z7HA 5LVMA 3KRJA 4FTAA 1PXOA 5HIEA 1WCCA 5DVRA 4JDJA 1GZOA 2XJ1A 4F6WA 4BY9E 2RGPA 3HB9A 4CZUA 3FJQE 3DTWA 5D1JA 5GNKA 4EHEA 1GJOA 3FZSA 1CM8A 4BBEA 3R8PA 5CALA 1GOLA 1M7QA 4X0MA 4FKWA 2C6IA 4OBQA 4BDFA 5DMXA 4L3PA 5LARA 2CGWA 2CNQA 3CSVA 4FSNA 5CU6A 3KK9A 2G2IA 5DH3A 5EQPA 5HI2A 3ROCA 3VS3A 3AOXA 4FICA 4F09A 5HG5A 4UZDA 2XIKA 4NM5A 4U41A 1ZOEA 2VX0A 3QFVA 3ETHA 4O81A 2UV2A 3VQHA 2R3HA 1EYZA 2W9FB 3E62A 2J51A 2W5AA 4I4EA 2P33A 4EWQA 4OUCA 4JR3A 5FBNC 2UUEA 2XNBA 3IONA 3QX2A 4RA5A 4FE2A 4X2NA 5E9EA 5CEQA 2CJMA 4W8DA 4FZAB 4ZSLA 3ZO2A 4DEHA 3PE1A 3R02A 3GCVA 3FZRA 4IHPA 2WTKB 1OIQA 1KWPA 2GPHA 5M53A 2R0IA 5M4FA 4OT6A 1VEBA 4DCAA 4EBVA 4FK6A 2G9XA 5HNBA 3QGYA 4AOJA 4WKQA 1E4EB 2UZDA 1I44A 4AWIA 2GHMA 5K5NA 5CU3A 1YI4A 1NVSA 3W2PA 2O63A 2JKOA 4JIAA 5FQDC 5C26A 2BIKB 2WMUA 2PPQA 3QQHA 3C4EA 2BKKA 5EDRA 3MV5A 3OBJA 2VX1A 1R3CA 2QLQA 1SVGA 3LFEA 1ZY5A 2C5VA 3ZTXA 1PXNA 1OL7A 1CTPE 1FVTA 2XM8A 2XUUA 3QL8A 4JJRA 1PXIA 3A61A 4LRJA 1LEZA 3CKXA 2V55A 4IZ5A 4YZBA 4DGGA 4JVGA 3GC8A 3RKBA 2R3QA 4E26A 4FKQA 4UV0A 1APME 5BX0A 3KB7A 3LFAA 1JAMA 3Q32A 4J71A 4HNUA 4R7IA 3F3ZA 3NCGA 3FE3A 5CLPA 3BPRA 4C3PA 2O8YA 4FFOA 4R7BA 2RG6A 5F20A 5L6OA 3D5XA 3OWLA 3MB6A 4QP8A 4FKRA 1OIUA 1ZOGA 4J99A 3GXLA 3O7LD 3UTOA 1W93A 4GT5A 4RC4A 3II5A 3EN9A 3GQIA 4C2WA 5EM5A 4FSZA 2OJ9A 2ZOQA 3DF7A 3VF8A 4YC8A 4WNOA 1V0OA 2C1AA 1FMKA 3OT8A 2F7ZE 4AOIA 4EK6A 5JH6A 4DE4A 5L2TA 2Y7JA 4BDHA 3LQ8A 4FL2A 3LHJA 1F0QA 3D5UA 5AUWA 2XK4A 4MWIA 4NL0A 3ALOA 1B39A 3I0QA 4YPDA 5L8KA 2WHBA 4K11A 4KRCA 5HCZA 4B0GA 3FLYA 5A46A 2C47A 4TUYF 3N4TA 1IA8A 5CF8A 4FT5A 5CY3A 3QBNA 3KALA 5HGIA 1ZYJA 3UDBA 4ARKA 1IAJA 3DB6A 2X8EA 3A4OX 2F57A 3WOWA 5DN3A 3R8UA 2IVUA 2WZJA 1XBCA 1NA7A 3IGGA 5HORA 3UJGA 2XH5A 4S2ZA 4P5QA 5CZHA 2O0UA 2YM5A 3ET7A 4TY1A 3UNZA 4CKRA 4V04A 4MXAA 3W55A 5BVNA 4WRSA 4GRBA 4EGJA 2G2HA 4IAKA 3VJOA 1O6LA 4C34A 2ITPA 3P1AA 3A8XA 4I0SA 3NYOA 4JBVA 1PXLA 4BDAA 5ANGA 5I9WA 3WF6A 5CF5A 4H3QA 3JR1A 5BYYA 3E93A 2B7AA 4HNFA 2E2BA 2R64A 3E7VA 1BNCA 1UWJA 2Z7LA 4X7QA 1M0WA 4YSMA 4USFA 3WIGA 3QTZA 4BI2A 1DIKA 3GFWA 2YAAA 3OWKA 1OECA 4AZVA 2BPMA 4FTMA 3UGCA 3U6IA 4FEQA 2A4LA 1YOJA 4FIGA 4QP7A 4RC3A 4IB5A 5IU2A 3T3VA 4F7NA 3NYXA 4FKOA 4G9CA 4LUEA 3ZH8A 4IVAA 5M08A 3LQ3A 3CD3A 4A9UA 4P7EA 4TYIA 2Y9QA 4EOMA 3R1YA 4O4JF 4YGAA 2BRMA 4FKUA 2WMSA 4ZJIA 3VBXA 4EH6A 3BHHA 2IN6A 2V5AA 4BCMA 1BI8A 2DIKA 4BDEA 5JFWA 4HVHA 2BUJA 3VO3A 4IH8A 2BRGA 3MPTA 4O0WA 3ZM4A 1YHVA 4RIYB 4FTUA 4CFNA 4PMMA 2F9GA 3PRIA 3O8UA 5FM2A 5ANEA 3Q9ZA 2C3LA 4YJOA 2YZAA 5EKNA 4XHKB 3JPVA 3ORKA 2V0DA 4BTFA 2R86A 4TNBA 3MDYA 4L67A 2WD1A 3T8OA 2BAJA 3WZDA 3W2SA 2J6MA 4AGCA 4YZNA 4HYIA 4RX5A 4HVGA 5HE1A 1JSTA 3ZU7A 1Q8WA 3BHYA 3PJ1A 5M06A 2R3FA 3RPVA 5M4UA 3G9LX 1SNUA 5IA5A 5M09A 4CKJA 4YBJA 3DPKA 5DPVA 5J7HA 4LG4A 4QMVA 2B9JA 3C1XA 4ZJJA 4F9CA 5CAEB 1FOTA 2XBJA 4NFNA 3OEZA 4G5PA 4EOIA 3A4PA 1XH7A 2OSCA 2PVNA 3BRBA 5EI6A 3U4WA 3ZLSA 3FL4A 4PNIA 1KEEA 1WBNA 1FMOE 4ACCA 3QD4A 4ZLYA 5IQGA 2QVSE 5A4QA 1M6VA 2PTKA 2PVPA 3JS2A 3Q9YA 5EW3A 3T9TA 3QCQA 3BKBA 2Z7QA 3GB2A 3R8LA 5I0BA 2C1BA 4OTHA 3R01A 1H25A 2VO7A 4PL4A 2PUIA 3W16A 3V4ZA 2YCRA 3EFLA 4IC8A 2RFEA 4CRLA 3CP9A 5JFVA 4TV9F 4F63A 4AGDA 4BI1A 4FT3A 3MPMA 2P2IA 4PP9A 4NK9A 1U5RA 4LQMA 3EN6A 4Q2AA 1ZRZA 3RAIA 4ASZA 4KIOA 3G6HA 5LQFA 4QPSA 2OIBA 3WZEA 1Q97A 4MNEB 5LMKC 4I3ZA 2YW2A 2EU9A 4P4CA 5JQ8A 1H4LA 4AA0A 2CGXA 4FODA 5HO7A 2H34A 5FP6A 1Q24A 3R63A 4X2JA 2R3PA 3F9NA 4XMOA 5JMSA 2R0UA 2PVKA 2YIWA 1KV2A 3BYUA 3MH2A 3Q04A 2EB3A 4G3CA 3HDNA 5DYJA 5H9BA 4E73A 4KWPA 3FKLA 2W1IA 3RK9A 3UOLA 2V22A 2F2UA 1UU8A 2QR8A 3Q6UA 4GT3A 4TNDA 4NM3A 4RWJA 3WF7A 3BI6A 4ZP5A 5AADA 4FI1A 5IUHA 3KRWA 3KVWA 2NU6B 5L6WL 4GVAA 1YI3A 2BTSA 5IQHA 1H0VA 3ORMA 3G90X 2UW8A 1W83A 3DJ5A 4QYFA 4E7WA 5BVOA 3EN7A 3R7OA 4EOKA 3NNVA 2W1HA 2WMTA 4QOXA 2QURA 3KA0A 4AAAA 4RZQA 3OTUA 5AAGA 4DFBA 2JKMA 3MY5A 2E9VA 4OTRA 3TL8A 3LFSA 4M9UA 1TQMA 3NIZA 3V3VA 2YIYA 4M84A 3RM6A 4GEOA 4KBKA 4O21A 5J5SA 3G33A 3U87A 3GC7A 4YJPA 4A9YA 4L68A 1W82A 4P90A 1O6YA 4KKEA 3BGZA 2YZGA 2IW6A 3I7BA 5E8TA 5CZIA 3FKNA 1X8BA 4WA9A 3VHEA 3DQXA 4GYGA 3A60A 4QMSA 4AP7A 3THBA 3TM0A 2WIPA 4GG5A 4FZDB 3NUAA 4J98A 3FMJA 1VYWA 4O91A 5I9ZA 4DT8A 3IO7A 4ZSAA 2I8CA 4ZEGA 2PYWA 3ZUUA 4BCHA 5L2SA 5G1XA 1YDTE 3PLSA 2UZUE 3HV7A 4FOCA 4EBWA 4JQ7A 3OMVA 5GIPE 2X6EA 4F1MA 3HGKA 5M56A 4CTBA 1JLUE 2QO2A 2F7EE 4RJ5A 2CGUA 4H36A 2VTPA 4I93A 4QT1A 5DLSA 5FP5A 4D1SA 2HIWA 3NNUA 3QUEA 3FXWA 3QTIA 3MJ1A 3ITZA 4IM0A 5HVYA 3AC2A 4FTOA 4YNOA 3VW8A 2YM3A 3LP8A 4XOYA 2HY81 4AZTA 5ITAA 4C2VA 4RVTA 5B2KA 3V5WA 2ZDUA 3K2LA 3AMYA 5IQIA 5AUUA 1PYXA 4MV4A 3POOA 5J8IA 4F1OA 1O9UA 4MTAA 5ETCA 3NS9A 3QXPA 4YJ2F 3ORQA 3R6XA 4U42A 3WYXA 4WHZA 3PWDA 4DGMA 3TTIA 4UYNA 4F64A 4EZ5A 4AACA 4O7VA 3VBYA 3AGLA 4BBFA 5IG1A 3MJ2A 5IQCA 3JVSA 5L8JA 2QHMA 4BCFA 3R9RA 1IR3A 4NU1A 3QKMA 5LVOA 3VW6A 4PMTA 5HZNA 3TIYA 3QX4A 4R5SA 5IA0A 3MSSA 4QMLA 2WIHA 3R7IA 3MI9A 4F7SA 3AD6A 3RALA 4PP7A 1UKHA 3D7TB 3CY2A 2QC6A 2XK7A 3HYHA 5AP1A 2IG7A 3F3UA 4CFUA 3A62A 3PTGA 4IX5A 5FXSA 3ZZWA 3QYWA 4ENYA 2HY0A 4YMJA 3RAHA 2IVTA 1UNHA 2PUUA 5DGZA 3RI1A 3ORPA 3VS6A 3FAAA 4FBXA 4A07A 3E87A 5HESA 4J53A 5HE2A 1TQPA 3IDPA 4GK4A 2QQ7A 5E90A 5CU0A 3KGAA 4O2ZA 4NZWB 3R28A 4AFEA 4FT7A 3UPXA 2J9MA 1REJA 3KXZA 4W4YA 3U9SA 3TINA 1RW8A 5AV1A 4ZOLF 4DLKA 3RK7A 3MWUA 3PIXA 5HLPA 4YC3A 3VRZA 4DH8A 4GMYA 5AEPA 3HMIA 1SVEA 4U80A 2VO0A 4DLJA 3QZGA 1R1WA 4GFMA 3W8QA 5GONF 3RPOA 4K33A 1Q8ZA 2V62A 4YZCA 2JFMA 2I0YA 3BU5A 4QMZA 4PNKA 4JI9A 4PL5A 4C4JA 3GCQA 4F0IA 5A6OA 2ITYA 1FPUA 4P5ZA 4WNKA 2JAVA 3CKWA 4U8ZA 1YKRA 4X6QC 5IQEA 2AC5A 3CPBA 2P2HA 3QRUA 3EQGA 4CD0A 1DS5A 5E92A 5JH7F 5LVLA 5KBRA 4GG7A 1XJDA 4KIPA 3BYVA 2GNLA 4FSTA 4CT2A 3MFTA 5KMOA 1OPKA 2BIYA 3CQEA 3PXQA 4I23A 4JX7A 2NRUA 2X81A 4KNBA 3UZRA 3EN5A 2PZPA 1HCKA 4ZTSA 1YHWA 3BV3A 4ANMA 4XV2A 4BYIA 4L00A 4IJPA 4O7NA 5C01A 4PTEA 3UO5A 3E8DA 3KRXA 3NW7A 5L6PA 4N0SA 5LOVF 3D5WA 3FQSA 5JRQA 1Q61A 4C3RA 3FMMA 3TWJA 4GKIA 2W7XA 4QQ5A 1YXVA 4ASXA 5EYDA 3MVJA 3GQLA 3EL8A 5BYZA 1V0BA 3RWQA 4MKCA 5FM3A 3EIDA 4I6HA 3E92A 2W6PA 4YPSA 2XCKA 2NO3A 3E8CA 1EUDB 2OFVA 4R77A 1U54B 3QC9A 5BVWA 1E1VA 1W8CA 3OS3A 2HK5A 4G3GA 4MBIA 4EC9A 4BCQA 4K9YA 3CCNA 5AUTA 3RTPA 3ORLA 2C6TA 4Y72A 1GSAA 4FSUA 2BTRA 4MX9A 5JVDF 1XWSA 3OY3A 5IH5A 2BMCA 1PW2A 4LL5A 1ZMWA 2XRUA 4LV5A 3VC4A 2IZRA 2ZV2A 3G5DA 3JZFA 4PMSA 3HECA 5D9HA 1WBOA 2RL5A 3IDBA 3MVHA 2R4BA 2IO6A 3QTXA 3KXHA 1T36A 2DLNA 3F3WA 1ATPE 4KIQA 4ALWA 4WSYA 3FZ1A 4F70A 3SKCA 2R3LA 4XYLB 4YAKB 1BL6A 2I40A 1OKZA 2JBOA 4FNYA 4ZTMA 2JC6A 1GIJA 1XBAA 5H2UA 4BDGA 5BMVF 4TXCA 1YWNA 3NDMA 4X6RA 4D5KA 1DAWA 5EI2A 3S0OA 4R7HA 4YAJB 4GU6A 5HBHA 1OBGA 4NFMA 4DTBA 2RG5A 1OL6A 3FZTA 3OP5A 4L6QA 4AFJA 4EWHA 2J0MB 3UVRA 4XCUA 3AMBA 5A4LA 5K9IA 2VTTA 3G0FA 1Q41A 1L8TA 3LXNA 5J87A 2XD4A 2HAKA 4BZNA 4D0XA 3DCVA 4OGRA 3OROA 4O6LA 4TTHB 4HYUA 3R1SA 3U54A 1GY3A 1PMVA 4GH2A 1LEWA 3Q5ZA 3QTWA 4U79A 1KOBA 2UZVA 5GJFA 1JOWB 2J5FA 5DWRA 5HEZA 3G51A 4G17A 4JAIA 1QMZA 3KQ7A 3RNIA 4G16A 4RJ6A 3TCPA 4RC2A 3WBLA 3QA0A 5KE0A 4QMPA 5FTQA 3CEKA 3OHTA 4RJ3A 3H9FA 5CB4F 3I1AA 4TW9A 4YBZB 1JKJB 5JQGF 4Z9LA 3RINA 4MXOA 2HWPA 1OKWA 2HENA 4KRDA 4ACHA 2FGIA 4C58A 4ZMEA 1P5EA 1FINA 3ZRKA 4R5YA 4YJUA 5A9UA 2BILB 4XRJA 3DBFA 4LGHA 4RWIA 3PE2A 3DBCA 4YJSA 5HIDA 2OXDA 1H24A 1ZXEA 3GFEA 1Z2NX 3HAVA 3LM0A 4BKJA 3NZ0A 4D1XA 1ZAOA 1E9HA 2ONLC 3O51A 4I5CA 2VTSA 4BC6A 5M57A 1F3MC 5AA9A 4MA5A 1A48A 3FKOA 3U9NA 2QONA 2W96B 3QTQA 4CNHA 4EOQA 3MBLA 4JAJA 1MRUA 1CQJB 4O96A 1OIRA 2WMQA 4UWYA 2QLUA 4HGLA 3UQCA 2F7XE 3DTCA 3U51A 3G8DA 2W5HA 3EQRA 4O7SA 3QHRA 4U45A 5KHWA 3NUXA 4EH3A 1KJ8A 5FEEA 1SVHA 3TDWA 3ULIA 5I9XA 1Q8TA 3F82A 1GZ8A 4HGEA 3ORTA 3BE9A 3CD8A 4I5HA 4EKKA 1E4EA 4QMYA 4ZI7F 3OT3A 3DK7A 3DJ6A 1YXSA 2R3KA 3QQKA 4QSHA 2ZDTA 1J1CA 2QKRA 1T46A 3NRMA 4K1BA 4MAMA 4BZDA 5C1QB 2C0OA 2UZEA 4EQCA 4EJ7A 4GV1A 1PXJA 4XG9A 2YERA 2YRWA 5BVEA 2YITA 1ZYDA 2ZVAA 5L8LA 4KS8A 2YCSA 5KMKA 1P4OA 3KULB 1IA9A 3EOCA 2C5OA 3DNDA 5EM6A 2ITTA 2IVSA 3GBZA 4X2GA 4H39A 3N51A 1GSHA 3P86A 4FK3A 3VJNA 3ZO1A 4EH2A 1C30A 4TWCA 3Q6WA 5DE2A 5BVKA 2ZB1A 3I5ZA 3E7OA 1VYZA 2QOFA 4HGTA 3GGFA 2OIQA 1U46A 2OZAA 2ITNA 3MW1A 2UW6A 3UBDA 4XP2A 4A06A 3I6UA 4HGSA 3RCJA 2VGPA 3P79A 3VAPA 5CSWA 3V8SA 2B4SB 3P7CA 4J7BA 5CA1F 3E88A 4BGHA 2ZV7A 3KN5A 4ACMA 5CU4A 4F08A 4RA4A 5EFQA 3R7EA 3WILA 1AUVA 2XJ2A 2EB2A 3IGOA 1YOLA 4N57A 1VBGA 2VTHA 4GIHA 5L2WA 2W99B 2CSNA 2YM8A 4H58A 4JR7A 2QO9A 4S32A 3TUBA 4TRLA 5EYCA 2PZYA 2ITWA 4IAYA 1VR2A 3I4BA 3PFQA 3K3IA 4FKTA 1H8FA 4FV9A 3FZPA 2Y0AA 3EQBA 4Y95A 5AV3A 2IZSA 5HBJA 5KKNB 2BALA 3PIYA 4EOLA 2RKUA 4NTSA 3H0YA 4USDA 3SW4A 4UWBA 1XH5A 2GS6A 4RGJA 2V59A 1QCFA 1YWVA 5CSVA 3F2AA 2GNHA 2ETRA 5J9ZA 2R3GA 3V01A 3P7BA 3ZYAA 3LVPA 4TYHB 3F7WA 2WXVA 4JQEA 3HAMA 2O2UA 3U4UA 1ZARA 4BIBA 5CAQA 4XX0B 4CTCA 4RIOA 1H08A 5DOSA 1JSUA 3T9IA 4C4FA 2ZV9A 4RQVA 3GT8A 5C4LA 3SXSA 1LR4A 2CCHA 2GFSA 4ZZOA 5KBQA 3TIGA 3HV5A 3IOKA 3QCXA 4X2FA 2PMNX 5EKOA 4O2AF 3VUDA 2W1DA 3GI3A 4O84A 5HU3A 2AYPA 1KE7A 4XS2A 2XCLA 2QOQA 2XKDA 3R8MA 4IWQA 5CF4A 4NW6A 3Q2MA 3LXLA 2OK1A 4IVBA 4LM5A 2YM4A 5FEQA 3R83A 5K4JA 3LZBA 4GVJA 3RV4A 4RX9A 1BL7A 1JKKA 2E9UA 1PYEA 4NM7A 5JRSA 1QPCA 3ENMA 2YISA 4MD8E 4CLIA 4E4TA 4JDHA 3EYGA 3BYSA 3R2YA 3D2IA 3MY1A 3SRVA 1XO2B 3S95A 2VZ6A 2GNFA 5CEMA 5AAFA 3A99A 3DOGA 5ETIA 2FSTX 2X1NA 3TNIA 2NNWB 2C5YA 3CLYA 5IDNA 5K3YA 4I92A 2PHKA 3VWAA 2BZHB 1H26A 3VVHA 4IMYA 3WF9A 4IFGA 5HV6A 1FGKA 2X0GA 4BDCA 4BTKA 3MB7A 4FV3A 3C51A 3FMNA 4CG9A 2XIZA 4PQNA 1JVPP 2WU7A 4RIYA 3NVMB 1Z9XA 3G6GA 4I22A 4EUTA 3O17A 1J1BA 5IEYA 4RIWB 5CT7A 4O7TA 2Y8OA 2PU8A 2YWVA 3ZLXA 4E4LA 3V5JA 4EOOA 1KBLA 3PDTA 4XJ0A 2C5NA 4ANQA 4FA2A 4CVAA 3PJ8A 4FC0A 4U43A 3ETAA 4U97A 3BYMA 3GCUA 5C4KA 3UNKA 2J50A 3HUBA 1ZOHA 3RFCA 2ITOA 4EYJA 4TZRA 3F88A 3C9WA 5I9YA 2OG8A 4HCVA 4EK3A 3NIEA 5AFVA 3V6SA 3W32A 3HBLA 4Q9SA 4FEXA 4M7IA 1CKPA 3H9RA 4AS0A 4WG4A 4NJ3A 4C61A 1H00A 4IWOA 3DJ7A 4EYMA 3PSDA 5FUTA 3S00A 3KRRA 2CZGA 2R7MA 4ZTRA 4C33A 3PPKA 2V7AA 5HKMA 4GSBA 3UOHA 4IZAA 4GW8A 2XF0A 5F95A 3EZRA 3PLAE 4RWLA 3W2RA 2OU7A 2PZ5A 2F4JA 3BIZA 4PDSA 1J7IA 3MS9A 4S31A 4W4WA 3BHVA 2EUFB 5IQFA 2IWIA 5GJGA 5IEXA 4RT7A 3F3TA 4WUAA 4EZ3A 3ULZA 3RWPA 4ERKA 4UY9A 4MD7E 3RJCA 4A4XA 3SG9A 2JDSA 2PE0A 4RVKA 4BICA 1U5QA 1OL2A 5EHOA 2Z2WA 4HVIA 2W6MA 3H0ZA 1H07A 3PVBA 4A4OA 2JDRA 3FL5A 4IX3A 3FEGA 1HOWA 2IP4A 1EHIA 5CSXA 2R5TA 2YFXA 2CHLA 2JIIA 3QAME 3W10A 5IISA 2C6EA 4ASEA 2PK9A 2YDKA 4QMWA 4M0YA 2JITA 3ZC6A 1PY5A 5CAPA 1OUYA 4L43A 3MA6A 3I7CA 4LMUA 3AC8A 4ZZMA 4YTCA 3DXQA 5BUIA 2QOBA 4BVUA 4M3QA 2JKQA 3LCKA 4XG3A 3QTSA 4XYFA 2C30A 3R30A 3FHIA 4DITA 5CEPA 4FR4A 5EI8A 2B1PA 3CE3A 3MTFA 4FGBA 2QK4A 1UWHA 2V7OA 1Q3WA 2OF4A 4PMPA 1R0PA 5CASA 3O7LB 1DV2A 3DBDA 4Y5HA 1CE8A 2QOCA 3ACJA 4AE6A 1CDKA 3HA8A 1CQIB 3OCGA 2IPXA 5JQWA 1Y6BA 1ZYSA 2WYOA 5A3XA 1UU9A 3BE2A 3SW7A 3MN3A 1E1XA 4A9TA 4ITHA 3FQEA 3OCBA 3COIA 2H96A 5FTOA 1G3NA 5I9VA 4YTHA 2CNUA 5KX8A 1T45A 2FA2A 2E9NA 1AQ1A 3PJ3A 5JZNA 2A2AA 3BLQA 4D4SA 2R3RA 5FXRA 4IW0A 4CRSA 3R7VA 1URWA 5EW9A 4J95A 2GPSA 5BVFA 2VTRA 2Z7RA 5TT7A 3W2QA 2WTVA 3VIDA 4O2PA 4S34A 3ANQA 4XRLA 4E5AX 2PMIA 2QNJA 2R3NA 3DB8A 4KSPA 4W8EA 4IZYA 3UIUA 4BCIA 1VKZA 1IOWA 5CVGA 5BUEA 4EH5A 5AMNA 4XG2A 4QMTA 3BX5A 4QP4A 3PPZA 3P0MA 4DT9A 4G34A 5CVFA 4M12A 2X7OA 4O0VA 3Q60A 3D5VA 1OPLA 2W1FA 3VMMA 4QTBA 3P5KA 5EW8A 3NMUF 4NTTA 1XR1A 2W4OA 4B9DA 4MAOA 3QGWA 4E20A 3MH0A 3WZKA 5IDPA 4FFPA 3A7HA 3ZLWA 4L7SA 5JN2A 4NM0A 3TEIA 5FXQA 4CFWA 3LJ0A 3VUHA 2DWBA 4PL3A 5M51A 4MQ2A 2YIRA 4MHAA 3VBWA 3E8EA 1PMEA 2J7TA 3DA6A 5BVDA 2WMXA 3F7ZA 4HPTE 4N70A 4ORKA 4QQJA 4HJOA 3TDVA 3IECA 5FNVF 5KX5F 5CNOA 1Q8YA 1R39A 3SXRA 4AN2A 3EMGA 4FTQA 4ZJVA 2UW9A 3FI8A 3TQTA 2QG5A 2OIDA 4RLLA 3LFQA 4XOZA 4QQTA 4YTIA 3IS5A 5E8WA 3DBQA 4EG0A 4Q9ZA 4ONAA 2BVAA 2J4ZA 5AM7A 5CEIA 3BV2A 3C4XA 1YXXA 3OTVA 3VQUA 2YHVA 3WE8A 3COKA 2OJFE 3QRKA 1OL5A 4UXLA 1M7NA 2FH9A 4HYSA 3NUSA 2C3JA 4QP6A 3TV7A 4JG8A 4E1ZA 4H3BA 2C3IB 4CMTA 4IWDA 4CLJA 2R85A 3S2PA 4YB8B 4WNPA 3D7TA 3IW5A 4FFRA 4D5HA 2PVFA 5CQUA 5ANDA 3OOGA 4AE9A 2HW7A 2R82A 2WO6A 3RAWA 2UVYA 5J1WA 3FWQA 3FY2A 5CWZA 1K3AA 3OXZA 4APPA 3UIMA 3QHWA 1H1RA 5KMNA 3VA7A 3IPHA 5E1EA 4JRVA 2GFCA 2XYUA 4H1JA 3TKIA 2WB8A 5ANJA 3VS4A 2JFLA 3SXFA 4U40A 4C35A 4LYNA 5AJQA 4ITJA 3LLTA 3NGAA 4F9WA 3FLSA 2UZWE 2GS2A 4WT6A 4X3FC 3C0GA 4ZTHA 3RHXA 4BCPA 3UOJA 4CV9A 5E91A 5HD4A 3ZRMA 1K2PA 2CCIA 2XCHA 3D4QA 2OLCA 4F7JA 4ZY4A 5LWMA 4MK0A 3TUDA 5DFPA 4R3PA 2G15A 3AT4A 3EN4A 3HV4A 2GSFA 4I6BA 5C03A 4BCJA 3MVMA 3KMMA 5LMKA 2IZTA 1EZ1A 3AT2A 4ME6A 4M13A 2VWUA 4HNVA 5TF9A 3ATSA 2YIQA 4FG9A 1KE9A 3C5IA 4B8MA 4JIKA 5CEKA 2B9HA 4X2KA 3LCDA 4QTEA 4DGOA 1NVRA 2SRCA 2VO3A 1UU3A 2DYLA 3OW4A 3UVQA 2HZNA 3R21A 3DS6A 4I5PA 1WAKA 3O8TA 4GIIA 2NP8A 4JQ8A 3MESA 4YNEA 4CFXA 4XV1A 1IASA 3AGMA 1Q4LA 2V5QA 3FPMA 3UP7A 2IW9A 3S4QA 3M1SA 1PRYA 3DBEA 4YHJA 2BHHA 4ZQIA 2VWZA 4MQ1A 3P23A 4M14A 1PK8A 2I0HA 2ZV8A 3KXXA 4E5BA 5KHXA 1R78A 4N6ZA 1WR2A 1S9JA 1PKGA 4LI5A 1Z57A 3DAJA 4EHGA 3EFJA 2J2IB 2XIRA 3EL7A 3VS5A 3NNXA 3R9HA 5AWMA 4AF3A 1MRYA 2QKWB 2NU9B 2JAMA 2UW0A 5EYMA 2P3GX 4FVRA 5CENA 4G6LA 3KY2A 4FU0A 3D2KA 3LFDA 4EORA 4XG7A 5JZJA 5DT0A 2VX3A 3R73A 3ZOSA 2PWLA 2UZBA 2WTDA 2XNEA 3EH9A 1WBPA 3I81A 3QZIA 3OVVA 3FMHA 3R1QA 1S9IA 4FV6A 4MF1A 1F5QA 3K5UA 4FIFA 4MXZA 3QUDA 4PTCA 4Z7GA 2NU8B 3IW7A 2ITQA 3AC4A 4UZHA 5CU2A 4DBXA 4YU2A 5LXMA 3JRXA 2W17A 4KBCA 4Y83A 2YDJA 3WYYA 2RFDA 1FGIA 2WQNA 3FI2A 4GU9A 4UYAA 2W05A 3C4ZA 4XP3A 4BDKA 2HZ0A 2YM6A 2PE1A 1H28A 3P7AA 5DT3A 5IUIA 5KMJA 1DI8A 4IAFA 3AT3A 3R7UA 3ZZEA 3KF7A 3GUBA 1IEPA 5G6VA 5ACKA 3ORXA 4MYGA 4Z55A 4BGGA 4ID7A 4L42A 2ERKA 2FVDA 3BHTA 3DQWA 5AUXA 3CXWA 4TL0A 3M11A 3DXNA 3DKFA 4XEYA 2I80A 2G2FA 3F6XA 2E9OA 3DAEA 2CPKE 3FZOA 3NPCA 2GS7A 4RIXB 5AP4A 1KJIA 4UXQA 4FEUA 4ANSA 3ZBFA 3UG1A 4EOPA 5LYJF 2OJIA 2PMLX 2PSQA 3F2NA 5AP2A 3V4SA 3Q4UA 2XK8A 2R84A 5H3QA 3A2CA 2OGVA 4NIFB 3UMXA 1W96A 1V0PA 5H80A 1K9AA 4HCTA 3PY0A 4DG3E 4BDDA 1PMNA 4RSSA 4LOPA 3GCSA 3O23A 4PDOA 3MH1A 2J0KA 3TIZA 5KMLA 3LLAA 4NKAA 2VTQA 5HE0A 2VNYA 2WTWA 2XEZA 2GTNA 1IAHA 2UZOA 3OXTA 1WVXA 3CGFA 5LP6F 2A19B 3BHUA 3AMAA 4IAZA 4FKJA 4R6VA 2EWAA 2FB8A 3W18A 3C0IA 4DF3A 1H27A 1A9UA 2EVAA 2OXXA 2Q0BA 3DV3A 5JVLA 4MVFA 3HV6A 4IBMA 4XP0A 1ZLTA 4K0YA 5DBXA 5HBEA 3OBGA 1Y8YA 1PHKA 1TKIA 3UOKA 4O83A 2XZSA 4G3EA 2QOIA 3GLKA 3CQWA 4TWOA 1ZMUA 2NUAB 3CIKA 4I55F 5C1PA 3QA8A 4ALVA 5A14A 4R1YA 4FNXA 3LE6A 2BFYA 4YLLA 4FZFB 3TXOA 4BCNA 4Z3VA 5IA1A 2PUPA 4DHFA 1BLXA 4M68A 4WG3A 5AUVA 2J5EA 1KE5A 2X7FA 4O7YA 4QMOA 2GMXA 3MA3A 3QQGA 3RK5A 2XVDA 4X3FB 3ZCLA 2QOLA 2XK3A 4GJ2A 2J0JA 4DFNA 3VPCA 4PDYA 4IX4A 3H10A 3QC4A 3ZSGA 3Q96A 4LOQA 3HV3A 1PXKA 2R9SA 3QQJA 3QCSA 4O7RA 4GFOA 4ZZNA 5BMSA 2G1TA 4J1RA 2JDVA 3CJFA 4DC2A 4EZ7A 4D2SA 2FYSA 4OTIA 4C37A 5AV0A 3BLRA 3LM5A 3HKOA 3D0EA 4E4NA 2XIXA 3LFNA 3UIXA 3A7IA 5GHVA 1I7LA 2FO0A 1XH4A 4FTJA 3LJ2A 1FVVA 3N4UA 5AX9A 3U55A 1JKLA 3R71A 3VBTA 4UEUA 5GINE 1C3OA 3NUUA 3R23A 4BBMA 5M44A 4C5BA 2QR7A 4D4VA 2H9VA 4XUFA 1LP4A 1OPJA 4EOJA 5JT2A 2YM7A 4QO9A 2GQGA 4F1TA 4FT9A 1MP8A 2FB9A 4C7TA 3F5XA 3QTRA 3MFRA 4FG7A 3E64A 5EG3A 3FLNC 3MGYA 3FLQA 3PP0A 1YDRE 3DZOA 5KZ0A 4FFMA 4FT0A 4TT7A 5IH6A 3KXGA 4O6EA 5KZIA 2B54A 3VULA 3Q4TA 3UFXB 3RMFA 3IKAA 1URCA 4AN9A 5B2LA 3IQ7A 4MV3A 4DIMA 3CS9A 5A4CA 3BU6A 5FD2A 5JEBA 4B99A 3U8WA 3DFAA 5CT0A 3IOPA 4ZS4A 2VV9A 3FYJX 2UZTA 3TN8A 5ANOA 1WBWA 4B4LA 4V05A 3CQUA 3H9OA 5C9CA 1G8SA 4EGQA 3A7GA 2BKZA 3ZS5A 3VN9A 1PXMA 1UNGA 2YJSA 2VTMA 3PVWA 1DAYA 3CR0A 4TYJA 5HHWA 1W7HA 3E5NA 2QOHA 4I4FA 5TKDA 4F9BA 4HVDA 4RZWA 1W84A 2DS1A 4KBAA 3V5PA 3D94A 5AV4A 1SMHA 2WAJA 5AUYA 3OUUA 4JDIA 3NW5A 2DUVA 3TNQB 4P2KA 3EB0A 3VHKA 3PVUA 1LUFA 4ZLZA 2OBJA 2GTMA 3ORIA 5LMBA 4C4EA 3G0EA 4RJ4A 5FG8A 4AW2A 3R9DA 1Z2OX 2FP4B 3QZFA 4FEWA 4FIHA 1OVEA 4TWPA 4MD9E 2BROA 3U6HA 2CGVA 2PVHA 2FSOX 4EK8A 2FPIB 3V5LA 2YS6A 2ETMA 4L7FA 4TYHA 2HOGA 3PYYA 4G31A 4TPTA 2BDWA 5FGKA 5C8YF 1WFCA 4YZDA 4YO6A 3SV0A 2FSMX 5A4EA 3N8DA 3R04A 5I4NA 4MEDA 1QPEA 3ODZX 2Q83A 1ZZ2A 2UW5A 2WQBA 4WD5A 3W2CA 4F65A 3JUHA 3EQIA 4D4RA 4DFZE 3WARA 5A4TA 4MV8A 5LVNA 4CFFA 2RF9A 4NCTC 2I0EA 5C8MA 4CG8A 4FV7A 2SCUB 2UZLA 3A7FA 4FKGA 4G9RA 3AD5A 3TJCA 3VS1A 2AUHA 4CMOA 4QRCA 4C4GA 5JSMA 4U3ZA 4K18A 5GJDA 3C13A 3F66A 5F1ZA 5L2IA 3HA6A 4X21A 3MVLA 1Z5MA 3MH3A 1J91A 3VUKA 2DZDA 4FUXA 3FV8A 4L52A 3MWEA 3OW3A 1P4FA 3AG9A 2OKRA
chains in the Genus database with same CATH superfamily
3L9PA 2J9GA 3FMKA 3BWJA 3PXFA 3O5AA 4L9IA 3TG1A 3ZSHA 4YZMA 4TKSA 3WWHA 3R8VA 4G3FA 1OGUA 2C6MA 4QNYA 5EYKA 3ZSIA 3VRYA 4G5JA 4A9RA 1IOVA 3VBVA 5HVJA 3I12A 5DNRA 3Q9XA 3DKCA 4KA3A 4GKHA 1XHAA 3OOMA 5AP6A 2Z04A 3VNNA 2A0CX 3PVGA 3U6JA 3KMUA 3MWDA 2B9IA 2HYYA 2OH0E 3RGFA 1IG1A 2CKEA 2PMOX 1BMKA 3JYAA 3AW8A 4AW5A 2AEGA 2ONLA 3G2FA 4PUZA 3ORZA 4QYGA 3T3UA 2O3PA 4C3FA 4MV6A 5J2TF 4ANBA 4D58A 2C0IA 3L9LA 4FVPA 2WMWA 4N4SA 2RIOA 5EZYF 2ETKA 3Q3BA 4WBBB 5HICA 1SM2A 3W1FA 3UNJA 2C6LA 5CM0A 2BAKA 1Y57A 5GIOE 4ITIA 3QKKA 4Y46A 3H3CA 4E6DA 1HCLA 2HCKA 3ID6C 1UNLA 3Q4ZA 3ZO3A 4UBAA 2W1CA 2WMAA 4USEA 1A0IA 2YACA 3LFCA 1H1SA 3SOAA 2X2LA 3TZ7A 5JGDA 1TQIA 4FIJA 4TYEA 2LAVA 3W8LA 4CT1A 5HO8A 2KTYA 1RQQA 5IQAA 4YTFA 4QYHA 2QG7A 3ZXTA 2NU7B 3DKGA 5CF6A 1YXTA 2Y6MA 5AAEA 1A0GA 1YW2A 3LXKA 3KCFA 4PRJA 5HD7A 3MJFA 2Z02A 4S33A 5BMMA 1M2QA 3WE4A 3QRJA 4RMZA 3WWIA 4QP3A 3DKOA 3JY9A 3NAYA 2ACXA 4JBOA 2WGJA 4RVMA 1YRPA 3BL9A 1J3HA 2EXMA 4UN0C 5E7RA 5HX8A 2OWBA 3LCSA 4J52A 3B2TA 2W6QA 3R22A 3TTJA 3CPCA 4EUUA 4C62A 3EQPA 2B52A 3AD4A 4QMQA 4Y8VB 4J8NA 1RDQE 4XV3A 4GUBA 5DRDA 1A9XA 3U9CA 5JZJA 3JSLA 3JY0A 1U4DA 4FTIA 3QFFA 4FJVA 1JDEA 3QQFA 1OZ1A 1NY3A 4H05A 4IEBA 5AA8A 3UQGA 4FV5A 4DEEA 5BWVA 2PZIA 3HRBA 1TAEA 3ROYA 3NUYA 2I7QA 4FIEA 3WO0A 3C4FA 3GVUA 2CFMA 1OL1A 3E3PA 4Y5QA 1YQJA 1CMKE 3BWFA 4WHXA 3Q1KA 5CSHA 1GSOA 1ZWSA 4MV1A 1VLRA 2VO6A 5T3QA 5CEOA 4XZ3B 4EH7A 3O2MA 4ANLA 5KUPA 4R3CA 4MWHA 2CNVA 3OWPA 4FTKA 4BIDA 4A4LA 2BDFA 3NWWA 1WMKA 2HVQA 3AXWA 5LCJA 3W0OA 2W1GA 4OTWA 4L8MA 4AN3A 5I5YA 3ZEWA 3SG8A 2V58A 3FC1X 2WOUA 4K8AA 4RG0A 3QQUA 5HNIX 5D8DA 1AD5A 5HG8A 4FKIA 4U3YA 4F99A 1KJQA 2R87A 2WQOA 3LCTA 1PKDA 3HL7A 2ZJWA 4E8AA 3FBVA 3BL7A 3EWHA 3O50A 4AXAA 1B6CB 2X7GA 5JKGA 3NBZB 2PY3A 4D0WA 5IYZF 4Y8DA 4Q4DA 5I5SA 5BWUA 3HZTA 3REPA 3OD6X 2YS7A 2VTJA 4DA5A 1G2WA 2R7LA 3IG7A 4U5JA 4XV9A 4AGUA 4C5CA 4CC6A 4FTTA 5IA3A 4QYYA 4DH1A 3QWKA 4FYNA 4NH1A 4F9YA 2VR1A 4ZSGA 4DLIA 3TV6A 4OR5A 3L8XA 2ZM3A 1MUOA 2FSLX 2VTOA 3DXPA 4IVCA 4UALA 3RUPA 2COIA 4ZAUA 5DGIA 4HOKA 3FSKA 4L46A 2JIUA 2GLTA 3WO1A 3KL8A 3F61A 5JQ5A 3QTUA 4NYEA 1BI7A 4DEAA 2W06A 4YJRA 2EJ2A 2C6KA 3EYHA 1NT2A 4FV8A 2W6NA 5AUZA 2Q2UA 5K5XA 3IW4A 2GHGA 5IH4A 3KC3A 4ENXA 5AIRA 1CKJA 3TACA 5HTBA 3LMGA 5EQYA 4LL0A 4QNAA 2CDZA 4DFXE 5ACBC 3ZM9A 5ICPA 4O22A 3ZDIA 2OICA 5HCYA 3HT5A 2A1AB 3IK3A 4I21A 4U81A 4HYHA 2WMRA 1VBHA 1H01A 4K2RA 4PV0A 3VS0A 2XK9A 2GNJA 3UG2A 3ETJA 2VGOA 4NWMA 1KE6A 2ITUA 5H8EA 3RPSA 3UO4A 4C59A 4F4PA 5E25A 2OH4A 3T9AA 3KN6A 3SVVA 1UKIA 2WPAA 4R1VA 2WMBA 4FKVA 2XRWA 3N9XA 4I24A 4JXFA 5D1OB 4EEVA 4C02A 4KKGA 3L9MA 4L01A 1SNXA 3PP1A 2WQEA 3QZHA 4MV7A 2Y4PA 3NNWA 3QF9A 5E8YA 3V5TA 1JKSA 4RFYA 4YJVA 4I4TF 4IWPA 5KNJA 4AW1A 2OI4X 4LMNA 4A9SA 1GZNA 1WBVA 2ODTX 3V5QA 5LJJA 2JEDA 5BPHA 5HE3A 2WFYA 3Q2OA 3TJDA 4AUAA 4FFNA 1EH4A 1STCE 2VTAA 4O4LF 4OTDA 1M0TA 5I60A 4M15A 4WNMA 4C4IA 3FXZA 5EK7A 1JBPE 1ZMVA 4ZTQA 4FVQA 4YJQA 3GENA 3NEWA 4D2RA 4UCTA 5I5WA 1PMUA 3UPZA 3PZEA 1G8AA 3GU7A 5DHJA 5FDXA 3GP0A 3OWJA 4BCGA 4BF2A 4EH4A 5JK3A 3CBLA 3B8RA 3GCPA 3P08A 4JG7A 4AQCA 3R5HA 4APCA 4FTLA 5HCXA 3W1GA 4O27B 3QWUA 4BCKA 3SNOA 3R00A 5D41A 4PTGA 4IAIA 2WNTA 4UB7A 2WKMA 3RPRA 2ZB0A 1XDNA 4OW8A 4KINA 2YCFA 3TY8A 2XIYA 3GU4A 2FPPB 4YJ3F 2VU3A 2XKEA 4B7TA 5CANA 5HX6A 4DAWA 2J90A 3ALNA 2WEIA 3MIYA 5EDQA 3ZHPC 3SAYA 2YZMA 3OUKA 3VUIA 2VWWA 4MNEA 4II5A 3TW6A 3SE7A 3PXRA 4DH3A 5HTCA 3T9DA 4L44A 2OLSA 4EHZA 2HVSA 3P9JA 1JNKA 3QRIA 3PXZA 3GOKA 4Z16A 5CSPA 5DEWA 3FMDA 3UVPA 5A6NA 2H8HA 2FPGB 3QWJA 2R3MA 2VD5A 4L1KA 3L8SA 3L1SA 2A27A 5IMXA 2XJ0A 2FUMA 5AP3A 3BCEA 3QCYA 3G9NA 5EOBA 3GB8B 2QOOA 2UZNA 3BGPA 2OZAB 3SLSA 3RR5A 3N6RA 4CMFA 1B38A 3COHA 2X8IA 3MIAA 3W0MA 5E1SA 2XAMA 2RFSA 2CKPA 4QP2A 5C8KA 4CSVA 3UE4A 3EZVA 3ZLYA 4CFMA 1P14A 3TT0A 5KKRC 3BU3A 4CV8A 2QOKA 4FTCA 3ZEPA 2ZMDA 4IADA 4AU8A 3P78A 3MFUA 5BQ0A 2Q2TA 1DM2A 1GLVA 4QTAA 3K5IA 2XB7A 4QP9A 4BIEA 4TWNA 5CVHA 1JKTA 3KREA 2LGCA 4OLIA 3RPYA 3NUPA 4AW0A 2E9PA 4O0SA 4PY1A 4JX3A 3VUGA 3PG3A 2IJMA 4D28A 1I1KA 2X2MA 3SD0A 4AQKA 5AIKA 4FZ6A 2WELA 5DR6A 4YP8A 5CA0F 1WBSA 4JT3A 5AP7A 4QQCA 2BZJA 3JRWA 4MV9A 4EH8A 4FG8A 2CMWA 1U59A 2XKCA 4FGRA 2DWCA 2YJRA 3SC1A 3WZJA 4FSQA 4R3RA 2YL2A 4HQ6A 3QUPA 5M4CA 1CS0A 4ZTLA 3F69A 4V0GB 2Q0NA 5HG9A 4IDVA 4FV1A 4K77A 4PZ6A 3V8WA 4I6FA 3PA5A 3H30A 1ST0A 2GCDA 3LPBA 4YBKA 5AX3A 3RZBA 2UW4A 3PZHA 5J9YA 2R3OA 4LOOA 3KAKA 3QD3A 4YHFA 3WZUA 3HO8A 5M07A 3R9NA 5T6KA 2JIVA 3EHAA 1FBNA 3KMWA 3KRLA 4DN5A 2PN1A 3QLGA 4RFMA 4E6QA 5T68A 3C0HA 1RE8A 3EFKA 3NSZA 3O71A 4IB1A 3PY3A 4FKLA 4PWNA 2GQRA 3WI6A 3CTQA 3UDSA 2JBPA 4RIXA 2PE2A 4U9AA 5ETFA 4J96A 1W98A 3LQ5A 3NR9A 3UZTA 5FPOA 2WOTA 1I09A 3QYZA 1L3RE 3DAKA 3O0GA 3F5PA 4G3DA 3LFBA 3EKNA 3GIDA 2BDJA 2Y4IC 3OEFX 3TMOA 3S3IA 3TZ9A 1AGWA 4BYJA 3W33A 5K4IA 3JZIA 5KO1A 1M52A 5E8XA 5IMEA 3SOCA 1WZYA 4ZHQF 4O0YA 1XBBA 4F7LA 4NJDA 3E63A 3ZONA 1A3GA 5D7AA 4D55A 1KSWA 3PJCA 5IZFA 1RJBA 3KCKA 3FSFA 4ASDA 3EKKA 3FHRA 4IAAA 5B0XA 3DGKA 4FNWA 4FSYA 4YR8A 1FVRA 3SRVB 3B8QA 2RFNA 4YUQA 4ZS0A 3HP5A 2WMVA 3UZPA 4C5AA 1BYGA 1MQBA 3MY0A 4WOVA 2CLXA 1UA2A 3TV4A 1I7NA 2W1ZA 4DFLA 3OCTA 3TIIA 4U0IA 5M55A 1OBDA 3GC9A 2R3IA 3PFYA 3ERKA 3NX8A 4QMXA 3R8ZA 2YA9A 4BCOA 2VPQA 4GS6A 1XH8A 2QO7A 3I79A 2PL0A 4UWCA 4OTFA 5EHLA 4IIRA 5CS6A 5DG5A 1GIIA 3D15A 4IJ9A 3ENHA 3ATTA 4IE9A 4FEVA 1MQ4A 3IW8A 5CXHA 3UDZA 2EXCX 3PPJA 3V8TA 4X3FA 4MBLA 4BN1A 2ZMCA 4ALUA 3VNTA 2GHLA 4I5MA 2X5RA 4N6YA 4DBNA 3FQHA 4FL1A 4KUJA 2I0VA 4CEGA 2XBAA 2HXLA 4EK4A 2GU8A 2BZKB 3C7QA 4Q4CA 3K5VA 2BZIB 3ELJA 1QL6A 4DEGA 5LWNA 3W0QA 1AUXA 2UW3A 1UU7A 4EFEA 3BEAA 3K3PA 4IWXA 4O2BF 5I5XA 1KE8A 4AGWA 2C00A 5FBOA 1UVRA 4KS7A 3KVXA 3P4KA 4PF4A 2NYAA 1GIHA 1H1QA 3CTJA 4FIIA 4O0TA 4W4XA 3WNZA 3LCOA 4RPVA 3R7YA 4BDJA 3EQCA 4O4HF 4HZRA 2WEVA 3Q5IA 5DISC 3DT1A 4FUYA 1H0WA 5EOLA 5HG7A 1KTAA 3D9VA 4CFVA 5BUJA 1Z2PX 3RAKA 4PX6A 3PY1A 4M8TA 5I5ZA 3L8PA 3QQLA 3SA0A 3N4VA 3RTXA 2CN8A 2P0CA 4CMDA 1MRVA 5J95A 4DG2E 2WU6A 4RFZA 2C6DA 3BYOA 2ZM4A 2W6OA 3PIZA 4M0ZA 4AT4A 2O65A 3SX9A 4IM2A 3VS2A 2C4GA 3HDMA 4XBRA 3SQQA 2IVVA 3GU8A 3TY9A 3GC0A 4FV2A 2F49A 3BBWA 5KKRB 3UMWA 2I87A 4UCVA 2BAQA 1SZMA 2IW8A 4EQMA 3RHKA 3LMIA 3I60A 4HPUE 2W4KA 5EHYA 4DINA 4BI0A 3LWBA 3VOTA 3F2RA 3FLWA 4DYMA 5IF1A 2BHEA 5JGBA 4CE5A 3PWYA 4WIHA 3SGCA 4F6SA 2JGZA 4MNFA 3EFWA 1M14A 2QU6A 2JDOA 4O7ZA 4MCVA 4ACDA 1CKMA 4CCBA 4GJ3A 4ZLOA 5EM7A 1Q8UA 4YZ9A 4DDGA 2IZUA 3FLZA 3ZUTA 5DT4A 2P0AA 4FKPA 4I6QA 3Q53A 2YYAA 3LKMA 3WF5A 1Q3DA 1U54A 4JG6A 4CCUA 4F0FA 4XG8A 2G01A 4YC6A 1GGOA 4QTDA 2YAKA 3TZMA 4C36A 1PJKA 3GU6A 5AM6A 1V9PA 1J7LA 2B0QA 2J0LA 2OZOA 3H4JA 3NUNA 3HLLA 3GJXB 1Y91A 1XK5A 4ZY6A 2YN8A 3R5XA 4AZEA 5CE8A 3QD0A 4JNWA 3CC6A 4L53A 2VNWA 4DEDA 4E6CA 2QCSA 4ZIMA 4E93A 2JLDA 2ESMA 4QTCA 4YO4A 3T9FA 4LGGA 4X3JA 2PUNA 3BELA 3ZO4A 4D1ZA 3ZFYA 1Y6AA 3PFFA 1NXKA 1V1KA 3ZFXA 3T7AA 1GZKA 3TKUA 2QHNA 4LUDA 4DFYA 5D1PA 5ANKA 4AT3A 5B7VA 2HGSA 4V01A 4FTRA 4XLVA 2YIXA 3FMEA 5JGAA 2VUWA 2Y4IB 5LOHA 2PZRA 4YHTA 3CJGA 3PN1A 4TV8F 3LOKA 2H6DA 4GT4A 2P55A 2VWBA 1LPUA 4CMUA 4NT4A 4S30A 1JSVA 3V04A 5HLWA 2GPWA 2X4ZA 3F3VA 2OXYA 1J7UA 1W0XC 4I50F 3FUPA 3PA3A 2VWYA 5C27A 3R0TA 2XMYA 2YRXA 4O7WA 2B53A 3ORRA 3G15A 2Q7DA 4G1WA 3U9TA 1OUKA 4BHZA 1GAGA 1NVQA 3HP2A 4FV0A 2OO8X 4BTJA 3OG7A 3CY3A 4WRGA 3MFSA 1OKVA 1CKOA 4AXDA 1KV1A 4M97A 3EQDA 3NYNA 3BGQA 4RJ7A 2YWPA 4OT5A 1M2PA 2GNGA 4FSRA 3OZ6A 2B9FA 3OY1A 4AA4A 4F6UA 5IQDA 2PVLA 2VTNA 2X0SA 3IW6A 3ZXZA 4Q5HA 3R2BA 3GOPA 4AZSA 1Q62A 3KAJA 2WQMA 3FMLA 3HX4A 3R1NA 3ZBXA 4DH7A 1YXUA 4IANA 1G8KA 1ERKA 2XEYA 4RX7A 4AT5A 5HU9A 5HQ0A 3OXIA 4IB0A 4XBUA 2BRHA 3ZDUA 3OFMA 4ZMFA 3FC2A 3A7JA 3DDPA 1BX6A 5A54A 3BLHA 4FZ7A 2HG8A 3QD2B 2O5KA 3NYVA 2W71A 4D4YA 4OBOA 5LXTF 3E8NA 4EI4A 5TO8A 4E6AA 5KCVA 2X9FA 4M69B 3QXOA 2COJA 1WRVA 2OF2A 2R2PA 3KK8A 1QPDA 2X9EA 4RRVA 4DDIA 4O0RA 3CTHA 1CSNA 3DDQA 2YCQA 4MXXA 3AQVA 1FQ1B 5CR5A 5J1VA 4IC7A 3HRFA 1OB3A 4EKLA 1REKA 4RJ8A 2W1EA 2VWXA 5E8VA 4ZSEA 3ZRLA 3BQRA 3Q4CA 3Q52A 3ZFMA 3S1HA 4KABA 3Q2JA 4KKHA 5KS8A 1ZY4A 2HWOA 3TW7A 1A06A 5F4NA 5TR6A 5EQEA 2XP2A 2B55A 3UYTA 4ZK5A 4BGQA 3FI3A 1TVOA 2QI8A 5ANIA 2OFUA 5CX9A 3KU2A 4I0RA 2BRNA 3F5GA 1O6KA 4XX9A 4DEIA 3PSCA 4NSTA 3V6RA 5CTPA 4BHNA 2BCJA 3FDNA 4L3LA 3OF0A 2WTCA 4MXCA 5D7VA 4IZ7A 2KULA 3KULA 3SDJA 1JLLB 4EK5A 2PULA 3L8VA 1OKYA 1SCUB 2W5BA 4WO5A 2Z60A 3IDCA 4IVDA 3QKLA 3RCDA 4FYOA 5CAOA 1OITA 5AV2A 4B8LA 3NCZA 3O8PA 1XKKA 3TZ8A 4GFGA 4GUEA 4IM3A 3AC5A 4EOSA 3R9OA 1B6RA 2R7IA 5D11A 3C5UA 3VUMA 4LFIA 5LA6F 2VWVA 4H3PA 2XNOA 3NAXA 5JFSA 3HMPA 4JRNA 4CQEA 3QLFA 4G2FA 2XA4A 3NBYB 4YJNA 3DZQA 1SYKA 2VTIA 3QALE 4HNIA 4L45A 3BABA 2XYNA 2ITVA 2YZNA 3ANRA 1QPJA 2C68A 5D10A 2HELA 4BTMA 1B04A 4FFLA 2C3KA 4DEBA 2VRXA 5CI6A 2YEXA 1XH9A 2XNPA 5J9LA 4IDTA 2OW3A 4EL9A 4JOAA 3PA4A 5BWXA 5I5VA 4LV8A 2F2CB 1WVYA 3KFAA 3HMMA 4IACA 4YLJA 5AP5A 2CKOA 3DK3A 5E8UA 4FX3A 5KMMA 1ULZA 5ETAA 4YSJA 3D7ZA 2QF7A 1M17A 3WIKA 4BB4A 1YVJA 1KJ9A 3HMOA 4I41A 2VAGA 3I6WA 3DNEA 5E8ZA 4F0GA 1BXRA 4EONA 4JDKA 4QYEA 2ITXA 3BQCA 4EC8A 3B2WA 4L3JA 2XM9A 3ZMMA 4J8MA 2VWIA 4C0TA 5I9UA 4HW7A 2C5XA 5BPYA 1DV1A 4FV4A 2BRBA 3AC3A 2XNGA 3EQHA 2XK6A 4NCTA 5CI7A 1KC7A 4RVLA 4XH6A 4FNZA 1P2AA 2CKQA 2JKKA 1YOMA 1G5SA 3UODA 5DA3A 4O38A 2XARA 5E8SA 3LAUA 3W2OA 5TOZA 3FI4A 3VPBA 3M2WA 2JD5A 1IRKA 4M67A 3TUCA 4JS8A 3D14A 4GK3A 4C4HA 3TNHA 4FSWA 2NPQA 5IUGA 5FRIA 5IQBA 5L3AA 2ERZE 3FPQA 1CKNA 4BDBA 4BRXA 3MYGA 3M42A 1OIYA 2C69A 3BACA 2XNNA 2ZAZA 1YHSA 3OUNB 2VN9A 5DEYA 4O0UA 2HJWA 3PG1A 1H1WA 3TNPC 4EHVA 2R7KA 3F5UA 2I6LA 2ZFYA 4AX8A 4CXAA 3TI1A 4UCRA 3T99A 1GNGA 4IIJF 4U6RA 5E4HA 5CAVA 4D9TA 2DQ7X 3UC4A 3POZA 4RWKA 3JXWA 3TKHA 4KD1A 1VZOA 3FY0A 4I94A 5C8NA 1DAAA 3BG5A 2BR1A 4IZOA 2X2KA 4QP1A 3ORNA 5F94A 5LCKA 3ZC5A 4AG8A 5LVPA 4LH6A 1ZYCA 3HVCA 4GK2A 4DTAA 5EH0A 2ZDHA 4WUNA 2Z8CA 2BFXA 5DR9A 3D83A 4TYGA 2VTLA 5AP0A 5IEVA 3O96A 2ZDGA 4AOTA 4FMQA 3PJ2A 4R78A 4K6ZA 4DTKA 3KXMA 5BYLA 2YZLA 4I1ZA 4ERWA 2PVYA 3Q9WA 3T9CA 2AC3A 4H1MA 2PBZA 4RIWA 2PVRA 4EH9A 5DIAA 4DHZA 3NC0B 4TN6A 4NUSA 5HBRB 1ND4A 3KF4A 4QMMA 3NW6A 2I1MA 3C50A 3EJ1A 3PXYA 5LMAA 4RBLA 5DI1A 4DCEA 1BKXA 3KEXA 3EQFA 5CQWA 3SHEA 2QD9A 4O0XA 3HRCA 3DY7A 3LFFA 1KOAA 3A8WA 3ACKA 4O7LA 3NLBA 5BNJA 2J0IA 4PBCA 4XG6A 3HNGA 1NW1A 4ZTNA 2R7BA 5H8GA 4RQKA 4C38A 3T54A 4QPAA 2W4JA 4CGAA 4FSMA 2HZ4A 4I20A 2XKFA 5DRBA 3S24A 3LW0A 2GDOA 4JBQA 4AZWA 3C4CA 4IB3A 4JL9A 4ACGA 1ZZLA 2ITZA 1YDSE 2OJGA 4XG4A 5M4IA 4W4VA 1IYDA 1PX2A 3OC1A 5FLFA 3K5HA 2GNIA 4FOBA 4U44A 1JWHA 2HW6A 4E5WA 2ZM1A 4I0TA 4FL3A 4O82A 4OTQA 1JQHA 1YWRA 4DGNA 4E4XA 1JPAA 4G6NA 3BA9A 3DU8A 3WF8A 2ZDQA 5C1OA 2NRYA 2XS0A 4J97A 1R0EA 4PDPA 2WTKC 4O4IF 4WBOA 4Y85A 4DFUA 3AX6A 4OTGA 2GQSA 3VBQA 5FTGA 4HZSA 4KAOA 1S68A 2QODA 2C0TA 3MPAA 5IA2A 5JFXA 3NVKI 2P4IA 2EIYA 5H8BA 2CLQA 4DGLC 4K6NA 1WBTA 3UO6A 2CN5A 4A7CA 4GYIA 4HN2A 3T9EA 4YLKA 2O64A 3V51A 3LIJA 4HVSA 4MBJA 4D9UA 5BYAA 4MA0A 3UC3A 5CNNA 1BUHA 2R3JA 4WG5A 5FDPA 4IFCA 2X39A 1Y8GA 3BBTB 4BZOA 2Y6OA 2JDTA 3ODYX 2UVXA 3PUPA 4Q5EA 4FTNA 4MXYA 3BEGA 4IQ6A 5CYIA 2YABA 3LULA 1PF8A 3UYSA 4FKSA 3W0SA 4CKIA 3QU0A 1Q5KA 2OJJA 3K3JA 4ZSJA 5HVKA 3BZ3A 4LRMA 5J2UF 1KJJA 1M2RA 2VQDA 2UVZA 3UQ8A 5KMIA 4XYMB 3HMNA 1B6SA 4E4MA 4IX6A 1OM1A 3C4WA 3JVRA 1JDBB 3LMHA 2Z7SA 1PXPA 3DLZA 3K54A 3PXKA 3UIBA 3QRTA 4CKCA 3GU5A 4DHJA 2PVMA 1VJYA 2HZIA 2W0JA 4KSQA 4GCJA 4NW5A 3CGOA 4IHJF 1XH6A 5EDPA 3GEQA 3LXPA 3KXNA 5FEDA 1P16A 5D12A 1WVWA 2UW7A 4YURA 4WBNF 2W6ZA 2WTIA 3E5AA 3L9NA 1EUCB 2W9ZB 2XNMA 3FYKX 1DI9A 3RP9A 4EQUA 5IA4A 4MH7A 5EM8A 3KKVA 4GLWA 3FXXA 4GL9A 1KUTA 2REIA 4RX8A 3DFCB 3VS7A 4O86A 4OBPA 4DQNA 3G8CA 3UQFA 2HXQA 3GNIB 4V0GA 5CXZA 5F9EA 4F9AA 5I5UA 3E3BX 3AC1A 3PRFA 3DLSA 3OCSA 4LRKA 4Y73A 5CAUA 4DH5A 1OI9A 3LJ1A 4ZXTA 3RM7A 1DGSA 3OUZA 4ZY5A 4DG0E 4ZOGA 3HEGA 3MTLA 5HIBA 2W70A 4YJTA 2C6OA 5DR2A 3COMA 3UP2A 2ZYBA 5B2MA 4JBPA 4KB8A 2PVJA 4HCUA 4BDIA 2X6DA 4XLIA 1OMWA 4AA5A 4HR7A 4BR3A 5HNGA 4CZTA 4QMUA 1Q99A 2X4FA 3I5NA 1UV5A 2WTJA 5DAAA 4QMNA 3HUCA 2R7NA 4G6OA 1XQZA 4RLKA 4JLCA 4UX9A 4HNTA 3I0OA 5IPJA 2X8DA 2YDIA 3ZUVA 4B6LA 1YI6A 1H1PA 3RVGA 3PSBA 4XNEA 5HLNA 4AZFA 3TNWA 4EJNA 5BPFA 4U7ZA 3VF9A 3R5FA 1CKIA 2QU5A 4RZVA 3DK6A 4NKSA 4Z7HA 5LVMA 3KRJA 4FTAA 1PXOA 5HIEA 5BWWA 1WCCA 5DVRA 4JDJA 1GZOA 2XJ1A 4F6WA 4BY9E 1G8JA 2RGPA 3HB9A 4CZUA 3FJQE