4O7RA

Saicar synthetase (type-2) in complex with ump/udp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
KAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with UMP/UDP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 74
structure length 228
sequence length 228
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7rA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7rA02
3HB9A 3EQIA 1V0OA 3R9DA 1I09A 3I6UA 2GNLA 5KBQA 3GC0A 3KMUA 3OS3A 1MRVA 2B1PA 2XNOA 3A4OX 3UOHA 4DGGA 1Q8WA 5J8IA 3Q60A 4H39A 1P14A 4FVRA 3BU5A 1CTPE 2YM6A 3SLSA 3C1XA 3BYSA 5F4NA 3ATSA 3PY0A 3RMFA 4XX9A 3R02A 3UOJA 3NYVA 3A99A 3D0EA 3NUPA 3E63A 3F61A 2VGOA 2YISA 1IAJA 2JIUA 4GS6A 3OWKA 2CSNA 3FLYA 2PUIA 4YSJA 4AX8A 4AT5A 5JRQA 2Z7RA 2WMXA 5T68A 3QD4A 4OR5A 5HCYA 5I9UA 3VUIA 4PTEA 4JR3A 1KJJA 5A3XA 4FX3A 2VTHA 4X2GA 1M7NA 4BDAA 3KXHA 4W4XA 4ENXA 5J9ZA 4NU1A 2BHHA 4BGHA 5ACKA 4E5BA 3QGYA 4KD1A 4EK8A 2GS2A 3CGOA 4RLLA 3RKBA 2FP4B 3HMOA 4YO4A 3ORLA 3HVCA 2YCSA 2C4GA 4DH5A 4DGOA 3CQUA 3LXLA 4FKIA 2BPMA 4IB0A 3WF7A 4QP3A 5CXZA 3RV4A 4GMYA 2OICA 4ORKA 2X8DA 1XJDA 4J97A 3WIGA 3WF8A 4ITJA 2RF9A 3Q4ZA 4PL4A 4B8MA 4D2SA 4WD5A 4U5JA 4S31A 4IM2A 4YUQA 5HD7A 4DYMA 4YHJA 2OF4A 3GXLA 1H24A 4LG4A 2R3QA 3D5UA 2F7EE 3FI8A 3H9FA 3OCBA 4ZSEA 4M67A 2R87A 5CAOA 3LWBA 1CQIB 4GFGA 4EH5A 4W4VA 3PVBA 5I9XA 2OI4X 1OITA 2YCQA 2F7ZE 3SKCA 3QGWA 4RJ8A 3ZH8A 3QYWA 3EN9A 3ZONA 5JZNA 4ACDA 2YIWA 5IQHA 2OZAA 4YGAA 3QQGA 2C3LA 1TKIA 2IN6A 2WD1A 2JDOA 3NZ0A 4IC8A 5IDPA 2OKRA 4LL5A 4PRJA 2EXMA 1BX6A 2ITYA 2X4ZA 4RIOA 2PVHA 5IA5A 2YZGA 2JAMA 4MCVA 3HNGA 3FJQE 5H80A 5JQGF 2B0QA 4QP6A 5BYYA 5A6OA 1YOJA 1TQIA 5IQCA 1F0QA 4ONAA 3HAMA 4YJRA 2BRBA 3UJGA 1CE8A 5BUIA 2SRCA 2NRYA 4LOPA 5HG5A 2WU7A 1RJBA 2GNIA 2VNWA 5AEPA 3PZEA 4F0IA 3GU4A 5HTBA 1BNCA 1JAMA 3C4ZA 2XEZA 3PVWA 3SVVA 4L45A 4EZ7A 5B2MA 4AT4A 3H0ZA 4ZHQF 4G5JA 3PJ3A 4I4FA 3LFAA 2NP8A 3OEZA 1EUDB 3C5UA 5EQPA 1B38A 3CE3A 1TQMA 3COMA 4M7IA 4NW5A 4TW9A 5LMKA 5AV1A 3UG2A 4FK6A 4QTBA 4A07A 5JZJA 3EOCA 4DE4A 4F64A 1O6LA 4G3GA 3HO8A 3HRBA 2VTIA 4IZYA 4L1KA 2Z7QA 3ZFMA 4DINA 1KOBA 3Q9XA 4GUEA 3GOKA 4EQCA 4FZAB 3Q2JA 3O71A 4GT5A 5CSVA 2JBPA 1W83A 4JBQA 4JS8A 4O7TA 4YR8A 3IDBA 3OWLA 3F5PA 4RX5A 5IPJA 4YJ2F 5AADA 4QP9A 2YJSA 3VBXA 2GMXA 4MV4A 3R22A 3FXWA 4JBOA 4KKGA 2C68A 3MPMA 3UC3A 2I40A 5TOZA 3FMMA 2VTJA 3N6RA 4DBNA 1IRKA 1ZMWA 2PVLA 4KIQA 3TWJA 4BB4A 4QNYA 4ZSLA 1Y91A 1AQ1A 3AG9A 2YAKA 3R1QA 4K8AA 3RGFA 3DK3A 2JLDA 3SXRA 3TV4A 4FFNA 3EQRA 2KULA 3QTSA 2VGPA 4RX8A 4R3RA 1BI8A 5KBRA 2YRWA 3MTFA 1OL7A 4NSTA 3V8TA 4TRLA 2FB8A 2P2HA 2VWWA 4PDSA 3SW4A 4EUUA 4G3FA 4UB7A 5AUUA 5IEXA 3FBVA 2FSOX 4RVLA 2R7IA 1CKJA 3LQ3A 2YZLA 5HCXA 4TKSA 3JXWA 2P0CA 3O50A 1PXPA 3SGCA 4O7ZA 3FY0A 2VO0A 1JSUA 4KKEA 4NKAA 4E4TA 4QNAA 3R00A 4M8TA 2E9NA 4L01A 2FGIA 1KBLA 4O0YA 3BQCA 5HBJA 4F63A 3DDPA 4FKRA 3G90X 3U8WA 4X6RA 1H4LA 3NCGA 4KAOA 1SNXA 2BZIB 2WGJA 5EW8A 3B2TA 3MN3A 4GUBA 5HO7A 2IJMA 4TUYF 4G3DA 5AJQA 4E8AA 3L8SA 3U4UA 1O6KA 5EZYF 4FZFB 1UU9A 3A7FA 2UW3A 4Y5HA 3NNWA 3OG7A 4G5PA 5HGIA 3ZUVA 4AA5A 1Y57A 2YDJA 4HZSA 5H8BA 3ZC6A 2VTLA 3QQUA 3RPYA 4I6FA 2QOKA 5AP5A 4G6LA 5HE1A 4M9UA 3DXPA 2XNEA 2WTKC 3R71A 1WBTA 4C34A 2PSQA 3LIJA 3FQHA 4MTAA 2UZVA 5TKDA 3VQHA 4AS0A 4C2WA 4YZMA 4DTBA 2NU8B 1ZYDA 4DFYA 4HW7A 3FSFA 3ULZA 4C61A 4P7EA 3OUZA 2VTRA 4XH6A 2ZV2A 3RCDA 4L3JA 4AN9A 4F7JA 2BDJA 4R77A 4L52A 3NUUA 4OW8A 3RAIA 2R3NA 2ZMDA 2G2HA 3HP2A 3UBDA 3UVPA 1LEZA 5A4LA 3QQFA 4IVBA 1KSWA 3O8TA 1TVOA 3ZOSA 3FZPA 5CU6A 3RWQA 3CD8A 4DFNA 5JK3A 4MA0A 4GH2A 4C4FA 4IANA 4O0RA 1VEBA 5BPHA 2CNUA 4EOLA 3PA5A 1Z5MA 5CXHA 2VX1A 2JKOA 3VS5A 1WZYA 3PJ1A 1FINA 5L8KA 3L9MA 4PWNA 5GJFA 3F82A 5FXQA 4D1SA 4EOIA 3E62A 4WIHA 3MJ2A 3VS7A 1YQJA 4DN5A 1W7HA 1QPJA 5FXSA 5AP2A 4RX9A 2CKEA 2B55A 2YZMA 3UIMA 3IOKA 4FK3A 3RHXA 3FL5A 1H28A 3F3ZA 1Y6AA 3MVMA 4U3YA 2E9VA 3LKMA 5I4NA 3C4EA 1DI9A 2PZPA 4FKGA 4IVAA 2FPPB 4GVAA 1OL1A 4IAAA 4L43A 3TI1A 4FFRA 4RC2A 3ZTXA 4IAYA 5CAUA 2RFDA 1REJA 3A61A 4RQVA 3P0MA 2Y4IB 4CCUA 4UEUA 2B9FA 3D7ZA 3D83A 4FFMA 1XBCA 2QU6A 2ZV7A 5HEZA 5HICA 1OZ1A 3U51A 3ACKA 1JNKA 4PP7A 4AFEA 4R1VA 3GC8A 3GC9A 4JX7A 4EQMA 1QL6A 2HCKA 2YL2A 3N8DA 4QMTA 4BCIA 4XYLB 5LA6F 3EJ1A 2H6DA 2ITNA 2OIBA 3EFJA 3F7ZA 4D4YA 4USEA 4QMUA 4ANLA 4RVMA 3MVJA 5ETIA 3VS4A 4A9UA 2PULA 1SM2A 3DKOA 3MB6A 2V58A 1UNGA 4YU2A 3FYKX 5E92A 3U9NA 3P7AA 1WR2A 3DU8A 2QO7A 4C5CA 1J7LA 1EUCB 3ET7A 3NIEA 4U79A 2YEXA 3W1FA 3OD6X 4FFLA 5D1JA 3ZEWA 3E88A 4EORA 1OPLA 2XK9A 3LJ2A 4UYNA 1FGKA 1YOMA 4TWCA 5EYKA 4D2RA 4D28A 4C4GA 4M13A 1E1VA 3LXKA 5G6VA 4WRSA 4YTCA 2WMTA 2W5HA 3C4FA 3CTJA 2YITA 4E93A 4YHFA 3AC8A 2BHEA 3A60A 4QTDA 4CFUA 4EOSA 4CKJA 4DLIA 3Q9ZA 3FWQA 4KBAA 5M4CA 3R1NA 4OGRA 1LUFA 2BVAA 4FSQA 4EH6A 3KEXA 3JZFA 4AA0A 4NFNA 3LE6A 4X3JA 4FSTA 2UW7A 4L68A 3D94A 5BX0A 4MXOA 4QP4A 2VWXA 4FV7A 4YJVA 4A06A 4NW6A 1NVRA 1WCCA 5M57A 3JY0A 4WBNF 4ALUA 3WNZA 4TNDA 4FV2A 3PLAE 3ANQA 3DB6A 3UGCA 4MNEA 4OTDA 4DT8A 4YZDA 5F95A 2Y4PA 2ITXA 1E4EB 4M0ZA 1LEWA 2JDSA 3CPCA 2R5TA 4Y73A 1A9XA 1O9UA 3P86A 5FEEA 4YURA 1XR1A 2PYWA 3EN7A 4OT5A 2ERZE 2GQSA 4LM5A 3OOGA 4YZCA 4DEIA 1EHIA 2C5OA 3QWKA 5CEOA 1H1PA 1OUYA 4BCPA 3U6HA 5HE2A 3TZ7A 4RIXB 3FE3A 2PMNX 1I7LA 2OW3A 2W1IA 2Q0BA 2WMQA 3L9NA 3SXFA 2PUNA 3UYSA 3LFFA 4FKWA 4KKHA 4RZVA 3WZKA 1F5QA 4XOZA 4CFFA 4S2ZA 5LOHA 3UP7A 4QMSA 4ITIA 4E4LA 3DTWA 1OGUA 2QODA 3QCSA 3FMNA 4N57A 2UVYA 3N9XA 4XG8A 4AF3A 3GB2A 3GU8A 3DQWA 4FNWA 4IVCA 2IZSA 4XBRA 5LOVF 5T3QA 3BYOA 3A7HA 1M6VA 2YDIA 3HL7A 4XG4A 3VUKA 3ORPA 3P08A 4G6OA 1KV1A 4LGGA 4DH7A 1KJ9A 2W6OA 1PXOA 2PMLX 2XK3A 3CTHA 4PDPA 4Y5QA 2GQRA 1LR4A 3U9SA 4FSWA 5FTOA 2JKMA 4BR3A 5JRSA 2OK1A 3HYHA 3OWPA 5HESA 3ZXZA 2R3GA 3QHRA 5ANJA 2I8CA 3NS9A 3VMMA 3PFQA 1P4FA 2VTOA 5GJDA 5K5NA 4JDKA 3OT8A 4MKCA 2NU7B 2A2AA 2O5KA 3OY1A 4MV6A 2OO8X 2XNGA 3ZEPA 4ASZA 2Y9QA 3DK6A 3QALE 3P9JA 4E4XA 4LRMA 4AG8A 1IG1A 4EOOA 2ZV9A 2OXDA 3BI6A 5EI8A 3A2CA 3FYJX 3G9LX 3T3VA 3QKKA 3HX4A 3VNTA 4BCGA 1Q8UA 3VN9A 5BVFA 5IMXA 4EHGA 5CS6A 5FBNC 2VX3A 4ZY4A 1T36A 1T45A 4DEEA 3ROYA 1H1RA 4FTTA 4O91A 4CSVA 1VBGA 3GCQA 4MH7A 4F0FA 3WO0A 3CGFA 2XCHA 1Q4LA 2UV2A 3LAUA 2F4JA 2WMUA 2PVRA 1ND4A 3ZZEA 2UZUE 4FYOA 2FSTX 4I93A 1T46A 4J52A 4ZEGA 3CSVA 5AP6A 3JY9A 4IB5A 4TL0A 4I0SA 2WKMA 2X0SA 3GGFA 2C6TA 3R5XA 5K4JA 1GSHA 5AV4A 4GCJA 3PDTA 2OFVA 2VD5A 3EZRA 3BIZA 4RIWA 4U7ZA 1GAGA 5FM2A 4BDEA 5HIDA 2GS6A 4YLKA 3HGKA 3G8CA 1UWHA 2QU5A 4X3FC 4EL9A 2Y0AA 4AE9A 2PMOX 4DEAA 1ZMUA 4GT3A 2GSFA 2QD9A 4R7HA 5E90A 5M06A 4H3QA 3H10A 4CV9A 1BI7A 2CLQA 3O17A 4RWIA 5GINE 2W71A 3MH2A 2QKWB 4YPDA 4E6CA 4H36A 1A9UA 3DCVA 1APME 4RA4A 4XCUA 4CLJA 3BHYA 5JQ8A 4XBUA 4K0YA 4OTGA 4MK0A 4X0MA 4G9RA 4AWIA 2WMVA 4X2FA 2IW9A 4BN1A 2XNNA 2DWBA 4EWHA 4FSRA 5CEKA 2G1TA 4MV3A 3G6GA 2OH4A 4QTCA 5FTQA 3UP2A 5BNJA 3W2RA 2XKEA 3DNDA 3IQ7A 5JH7F 3F2NA 3PIZA 5CT0A 3GVUA 2ZM3A 3GENA 3HZTA 1XQZA 4V05A 1NA7A 4WKQA 3VIDA 3HAVA 4L7FA 4NTSA 2QOIA 3QFFA 3QQLA 4TZRA 3FC2A 5M56A 2BRHA 3QUDA 3K3IA 1GZOA 1WBWA 3R73A 3R9RA 4YTFA 5EQYA 2VNYA 3AOXA 5DH3A 3W2PA 3TM0A 3K5HA 3AW8A 3ID6C 3ZSIA 4C02A 2OJGA 3C9WA 3H0YA 4FZDB 2HWOA 4YHTA 3VUGA 3ZXTA 5F9EA 3SAYA 3MFSA 5BVDA 3NCZA 1SVGA 3Q5ZA 4FSZA 5I9ZA 3IONA 5E8UA 2R2PA 4AE6A 2VR1A 3IW5A 3LMHA 4GJ2A 4AZTA 3VWAA 3ORKA 1XH9A 2HAKA 2W4OA 3SDJA 3U55A 2C0OA 4A9RA 1BL6A 3PG1A 4L3PA 4ACGA 5LWMA 3OOMA 2O63A 1OM1A 3MFTA 3UE4A 5CAPA 1FBNA 3LCDA 2YHVA 1IA8A 3R01A 1W82A 3TKIA 3FI2A 5A46A 4XZ3B 2X6EA 4GIHA 4CMOA 3NUSA 3SC1A 2ACXA 4BI1A 5CF8A 1W93A 4C38A 3DFCB 5CEMA 1VBHA 3QQJA 4TYJA 4XUFA 2G15A 4H1JA 4AOTA 4YLJA 4O22A 1URWA 2NRUA 3D14A 3FC1X 1H0WA 3CXWA 3W10A 3FMKA 4GYIA 1HOWA 2OJIA 3RTPA 4ZMFA 1ULZA 2WOTA 3JRXA 1FOTA 2R3PA 3TZ8A 4ZLZA 4GK3A 2X2MA 4KBKA 4AA4A 3MH3A 5BPYA 1Y8GA 1YWRA 2UZLA 3DXQA 1PY5A 5M08A 3UQGA 2HW7A 5E8VA 4PQNA 2UUEA 5KMKA 4GVJA 4MA5A 3QUPA 3LHJA 5EYMA 5CNNA 3O7LD 2A4LA 3I1AA 5D7VA 5CX9A 4IACA 4EEVA 1PXKA 3R8ZA 4M12A 5CAVA 3IK3A 3OCGA 2W1HA 1R0PA 2CLXA 3MIAA 1Q97A 4JAJA 2WIHA 3E5AA 1KJQA 4FIIA 3VPCA 2CCIA 1RE8A 4O7RA 1SVEA 4IBMA 4K33A 3V8WA 4XJ0A 4QMQA 2C30A 3R1SA 5BVKA 4GU6A 2VN9A 3KAKA 2R86A 4LGHA 2UZWE 2HENA 4QO9A 5DLSA 5IH4A 3PP0A 1W8CA 2OU7A 3GU6A 4GV1A 2BIKB 5HNBA 2YM3A 2X7GA 3R8PA 4R3CA 3V4ZA 4O0VA 5KKRB 2W1ZA 3OMVA 4HNIA 5HI2A 4JAIA 4CT1A 4M3QA 4OBOA 2XCKA 4H1MA 1Q8YA 1JSVA 1P4OA 2VX0A 3A7JA 3P4KA 3PIXA 3PY3A 1X8BA 2R3OA 4FNXA 4NIFB 4AXAA 5GIPE 1R39A 4ASXA 4YJ3F 4AP7A 1J1BA 3CBLA 4M68A 4XNEA 4YTHA 5CYIA 4DC2A 4DGNA 2O65A 2XRUA 3QQKA 3AT3A 1O6YA 3HV7A 5K3YA 4DCEA 2KTYA 4JDHA 4I5PA 3E64A 5LYJF 3FLWA 3R9OA 3W33A 3LCSA 3H30A 3K3PA 4F6SA 3Q32A 4K2RA 2JFMA 2Y8OA 3MYGA 2EWAA 2XNBA 2ITTA 3WF9A 3THBA 4CEGA 4XYFA 4HVSA 5K9IA 4TTHB 3JS2A 2WU6A 4AOIA 2GDOA 1UU8A 2QURA 3EYGA 3PJ2A 3NNVA 3RM6A 5JFVA 5JQ5A 3QX2A 3F7WA 3G0FA 3U9CA 3WZEA 5L2TA 2XNMA 2GNGA 2ZAZA 5KX8A 4NJDA 2XJ0A 2PK9A 5DVRA 4U80A 2ETKA 4C37A 1G8SA 3B8RA 1VKZA 2V59A 3KMWA 4I5HA 2R3RA 5CSPA 2VV9A 2ESMA 3DY7A 2J6MA 2I0VA 3RK7A 5JVDF 5AUXA 1R3CA 3KVWA 4F08A 1AUXA 5AFVA 3QL8A 3UNJA 3O7LB 5BVOA 2Y6MA 2VWIA 4IB1A 3FLZA 1K2PA 2QG5A 4YBJA 5AAFA 4BTFA 4F1OA 3KC3A 2FPIB 3FMEA 4RG0A 4Q9SA 3VS1A 4J8NA 1H25A 3C13A 3C4CA 3MY5A 3I6WA 5EFQA 2PVNA 2XBJA 3Q6WA 2PE1A 2EXCX 3HKOA 3TNHA 4CTBA 4WNMA 4QQ5A 3ZM4A 4IX3A 3DA6A 1YWVA 5AWMA 3SA0A 2PVFA 5DHJA 2R3MA 3PVGA 4D9UA 2CN5A 3T8OA 3GCUA 2DIKA 3OXZA 4GT4A 2C0TA 4H3PA 4BBEA 4CFMA 3UFXB 5HVJA 1IAHA 5LP6F 1Q24A 2OJFE 3QD2B 4L8MA 2R7KA 4FTCA 4DEDA 1PMUA 2V55A 2FVDA 3ETHA 3RCJA 2PE0A 3NIZA 3VUDA 3DS6A 5FEDA 2UVXA 1JQHA 3CTQA 5EOLA 5CI7A 4FG9A 3UPXA 3QRJA 4Y95A 3MWUA 3VC4A 2W17A 2QHNA 3HMPA 3IS5A 3R21A 4MX9A 4Y8DA 5DN3A 4ZZMA 3FKLA 1WBOA 4U8ZA 5FG8A 4F65A 3SRVB 4QP8A 4R5YA 5IDNA 2REIA 3E5NA 5ETFA 5H8GA 1ZLTA 2HIWA 3TINA 1H1QA 4RFYA 3HDMA 3HDNA 4A9TA 4E26A 3F88A 5E8SA 5E9EA 4JX3A 1MUOA 5DMXA 2C69A 5FRIA 3DKGA 1ZZ2A 3PPKA 2HZIA 4BDGA 4LRJA 3QKMA 4IMYA 2C3IB 3WYXA 3KULA 3QFVA 1Q3WA 2WELA 1PRYA 4JRVA 1MP8A 2XYUA 1DV2A 2WMSA 2OXXA 3FKNA 4MD8E 3R30A 2R3FA 4LOQA 3DZQA 1C3OA 2HW6A 2UW5A 3QTQA 2E2BA 4GFOA 5KHXA 2NU9B 2J2IB 3FUPA 5IQEA 5C26A 2W9ZB 4FKOA 5D41A 3V5JA 4DG0E 2B9IA 2XZSA 4FEVA 3BU6A 2BROA 1GIIA 4N4SA 4HPTE 1OIUA 3QZHA 2OGVA 1H07A 4PP9A 4R5SA 4Z7GA 3HEGA 1FGIA 3Q4CA 4LMNA 4ZZNA 5D11A 1OKWA 2W1DA 3CJFA 4F6WA 5M53A 3FKOA 2X8IA 3S2PA 4CKRA 2QONA 4ZP5A 5FD2A 4BVUA 5EH0A 3LXNA 5KMIA 4OTRA 3D5VA 4O82A 4FUXA 4ZOGA 2GU8A 3PRIA 4ERWA 4MF1A 5CF6A 5J5SA 5KCVA 3JRWA 2WOUA 4KS8A 3HA8A 2R4BA 4DFXE 3EQFA 4HNVA 3ZO3A 2P55A 3WIKA 3PSCA 4GIIA 4AGCA 4FSMA 2XEYA 4CD0A 5CA1F 3ELJA 3P5KA 3FZ1A 4WNPA 3GQLA 5DYJA 5C27A 1JDBB 4PF4A 3LQ8A 4DG2E 4I50F 2RG5A 1ZXEA 4ZK5A 2ITPA 4OTWA 1BMKA 2BFYA 3PUPA 3PXZA 4FU0A 5J7HA 2IW8A 2QR8A 4GSBA 2NU6B 4HNUA 5DE2A 3FPMA 2PVYA 4O38A 3MFUA 1JKLA 5IZFA 1OVEA 4FTQA 4O6EA 4AGUA 4C62A 5IA0A 5JFSA 5AP7A 4GU9A 4JQ8A 3TV6A 4NM7A 4F99A 4BZOA 4C33A 3KVXA 5CLPA 4CMUA 5L2WA 3I7CA 4CNHA 2WZJA 2C6OA 2WMBA 1BXRA 3F9NA 4FGRA 4ZOLF 4V04A 5H2UA 4OTIA 4D9TA 4Z3VA 3O51A 3UZRA 3VVHA 4YAKB 4C2VA 2HELA 5C1OA 5CSXA 4ACMA 3MS9A 4PTGA 3I0OA 5HLPA 1WMKA 2B53A 4MWHA 2XBAA 3SG9A 2XK4A 4FZ7A 4EHVA 3HV6A 4X3FA 3ZRLA 1ZY5A 3TKUA 3ZCLA 3BWFA 3EKKA 3CPBA 2I0HA 4FKVA 4UXLA 2OZAB 3UNZA 3WI6A 5J2UF 4JG6A 3KF4A 3VBTA 3PXQA 2DWCA 4CV8A 5AUVA 2XF0A 5AV0A 3Q6UA 4FVQA 4ZIMA 5L6PA 3PIYA 4O7WA 4PNIA 4IZ5A 1U4DA 4Q5HA 3CLYA 1DAYA 3HUBA 2YM5A 1RW8A 3OBGA 4ID7A 4D58A 3E8EA 3PG3A 1YI3A 3M42A 5BUJA 5C4KA 1A06A 2NNWB 2W6MA 4O81A 4BCMA 2W7XA 3ACJA 3G5DA 5L2SA 3NUXA 4N6ZA 4EOMA 1UU3A 5JT2A 5M09A 2Q0NA 4NUSA 5DEYA 4HYSA 3VS0A 4G16A 2VO6A 5GHVA 4IX6A 4IADA 2BAQA 2R3IA 2UW9A 3AMBA 5CU4A 5CVGA 3FLQA 4EK5A 2X6DA 2W5BA 2R85A 3IW4A 3OZ6A 5LXTF 2RFSA 5M07A 3NUAA 5DFPA 2R7MA 4UZDA 3ZM9A 4CVAA 2C6DA 3JZIA 2J0KA 1DIKA 2UZOA 4QRCA 5CEQA 5E8ZA 5DG5A 2A0CX 3SE7A 4F9WA 3MA6A 4WNKA 3W2CA 1UU7A 5EKNA 2X4FA 4FMQA 5CZIA 4EK4A 5IUGA 3EQCA 4EGJA 3F5XA 4UZHA 4YNOA 2G9XA 3PPJA 4JQEA 2R7LA 3NW5A 2NPQA 3PVUA 4PDOA 3ZSGA 5IF1A 4TWPA 1B6RA 4J8MA 1CMKE 2BRNA 5ANOA 1H0VA 3KRRA 3W2SA 3BLQA 2AC5A 4YJQA 4AZEA 3VPBA 2JBOA 3BBWA 4HGTA 3QD3A 1GOLA 2WHBA 1PHKA 4YJTA 1OL6A 2CCHA 1WBVA 2CDZA 2WMRA 3QRKA 3RK5A 3UOKA 4E6AA 1F3MC 4FEWA 5AV3A 4JQ7A 4KBCA 3I5ZA 2HK5A 4BIEA 1GLVA 5FP5A 3BEAA 3R0TA 2QLUA 4P2KA 4MEDA 4HR7A 5E7RA 4UWCA 2E9UA 1H1WA 3CC6A 2YWPA 4WA9A 3QX4A 4CG9A 5KMOA 3MPAA 1Z2OX 5L6OA 4J99A 3MFRA 3C0HA 5D10A 4RA5A 4E73A 1Z2NX 5JFWA 2QOBA 4L9IA 4F6UA 1YI4A 5LCKA 4HVIA 2WQBA 5BMSA 5LVOA 3W32A 5EDRA 2IVUA 2FPGB 4A9YA 5FNVF 2WXVA 1H26A 4FA2A 2VTNA 4ZJJA 4FV4A 4GKIA 4ASDA 3VUMA 4MBJA 3P1AA 5M4UA 1UNHA 3L8VA 3N4UA 2HJWA 2GQGA 3S95A 4IW0A 5A4CA 4HNFA 5EM6A 2OZOA 2YA9A 4AW1A 4EQUA 5EW3A 3DK7A 4AW0A 2CGXA 4MXXA 4FTAA 5E1EA 1PXLA 4O0WA 5AIKA 3F66A 4GEOA 4P90A 4FBXA 3D7TA 3LFBA 4WRGA 3S00A 1GSOA 3BHVA 2HXQA 5HORA 2JITA 1HCLA 2GPHA 2ZDUA 3NWWA 4ZJIA 3R7OA 2BMCA 4FKJA 4IWQA 5AA9A 1GIJA 3UQFA 5BYZA 4AW5A 3VS2A 4QSHA 2R3LA 4G3CA 2BUJA 4G9CA 4RVKA 3O23A 3UZPA 5FP6A 3H9OA 2Z7SA 2XYNA 3ZS5A 3KRLA 5LVNA 1AGWA 2UW4A 2WPAA 5DNRA 4EK6A 2V7OA 2XP2A 3RHKA 3RFCA 2XA4A 4I5CA 4J96A 2V22A 2CGVA 1PYEA 1OKYA 2WTIA 4FICA 4XX0B 4ZQIA 3WARA 3C7QA 3TG1A 4YJUA 3FI4A 2C5YA 4FODA 4DFZE 4TN6A 5ANGA 4FKPA 4E5AX 1Y6BA 3BYUA 3RP9A 3DTCA 3PWDA 5BUEA 3E8NA 4B99A 3V6RA 5DT4A 4I1ZA 4EYMA 3MESA 3S3IA 5CEPA 3HRCA 3I7BA 3Q9YA 3R2YA 4I22A 2J7TA 2W4KA 4YJPA 3LJ0A 3TNWA 2FSMX 3VBWA 4Z9LA 5DOSA 3BBTB 4BBFA 5HE0A 3QLGA 4YMJA 2Z7LA 2B52A 3UQCA 3W2OA 3PWYA 1G8AA 3F2RA 2R7NA 1FPUA 3BE2A 4C3FA 3A7IA 3Q04A 5CZHA 4KB8A 5HE3A 4BTJA 4M14A 3LXPA 4O0TA 2X7FA 3LCKA 5KX5F 2W1GA 2F57A 2HYYA 3AT2A 4FG7A 4USDA 4CFXA 4I41A 1ATPE 3EQHA 4YB8B 4MYGA 4IM0A 1W96A 3BWJA 4MAOA 3PJCA 5AMNA 4UY9A 2C1AA 1IEPA 5IA2A 1KV2A 4HGEA 3DFAA 4IB3A 5LARA 2HGSA 4Q9ZA 4FT0A 4O4HF 4BHZA 1JPAA 4UWBA 4H05A 3DOGA 3MH1A 2QOQA 4XEYA 2IW6A 5EQEA 4YZBA 3V5PA 3COIA 4MD9E 4PUZA 4LI5A 5HU9A 3G15A 2GPWA 4X7QA 3HRFA 4OBQA 2Y6OA 1G3NA 1Q3DA 2QF7A 4O84A 3F69A 3ZFXA 1OKZA 4BI0A 4DEBA 1GZ8A 2P3GX 2XIZA 2BKZA 5C1PA 2WIPA 1KUTA 1J3HA 4OTFA 4XLVA 1PXJA 4NH1A 1CKIA 2EB2A 2R0IA 3S1HA 1XKKA 3TDVA 2CHLA 4K1BA 3QRIA 4K9YA 4L46A 4FFPA 3TNQB 4E1ZA 5T6KA 4DCAA 2B4SB 3EMGA 4I55F 1NVSA 4RC3A 2P33A 1Q41A 4ZJVA 4CRSA 4K77A 4E4NA 5KMLA 5LMBA 3HMIA 2XMYA 5BYLA 4TWNA 4Y46A 4EK3A 3SV0A 3TDWA 3UNKA 2X2LA 2V0DA 4KIOA 2IZTA 2BFXA 2X81A 3EN5A 4C0TA 3LFQA 3JYAA 2IG7A 1A48A 2WQMA 3EYHA 4GFMA 3DNEA 2CJMA 3LFNA 3TIGA 4XP2A 3FLSA 1JKJB 2WAJA 3GCPA 3KRXA 4QP1A 4MVFA 4MNEB 5DR6A 3W2QA 1NVQA 5ACBC 3PSBA 4QPAA 4FL1A 4ZI7F 4FKTA 2GHLA 5A4TA 4FV1A 4M69B 5H8EA 2W6NA 4DHFA 5L8JA 3V4SA 3I12A 2BAKA 2XKDA 3QWJA 2BDWA 3V5LA 4HGLA 3SHEA 1ZRZA 2XKCA 3EB0A 1R78A 3FSKA 4BTMA 1YXUA 4TYEA 4U97A 4I3ZA 4EC9A 5CU3A 1OL5A 2VWYA 2WNTA 5J1WA 4DGMA 2I87A 3RI1A 3MIYA 4MXZA 3NAXA 4JVGA 4MQ2A 4TYIA 2XKFA 4BTKA 1AD5A 3F2AA 3SOAA 3WBLA 2ITZA 4YO6A 5FUTA 3QHWA 3LM5A 3AC1A 3SD0A 3DQXA 4X21A 1G5SA 3QZIA 4L44A 5IQBA 2HXLA 5C8MA 5CB4F 1WBPA 2YWVA 2WTWA 3ZSHA 3V5WA 4A4OA 4ZLOA 1ZWSA 1PYXA 2IPXA 2JKQA 5FTGA 4CRLA 5LJJA 1RDQE 3K5VA 2PZRA 5EOBA 3RJCA 3VQUA 3NYXA 3MVLA 3EHAA 2RFEA 3VBVA 3W55A 5L2IA 2OIDA 3ULIA 3M1SA 2X1NA 3TIIA 3OUKA 1R1WA 3GLKA 5FXRA 4RJ7A 3FHRA 1YVJA 1W84A 2JEDA 4IIJF 2XIRA 1XH8A 3GU5A 4P4CA 4ZTNA 1YDTE 3QXPA 4WT6A 3ZC5A 1YRPA 4XG6A 4RZQA 5BMMA 5A9UA 3RUPA 4EGQA 1GNGA 3AC5A 3KXMA 3QZGA 5CVHA 3UODA 4C5BA 4O96A 5ANEA 2YDKA 3COKA 3ORTA 2GPSA 2XK7A 3HUCA 4BICA 4XRJA 1WBSA 5B2KA 3ZUTA 2PHKA 3KFAA 3FAAA 3MPTA 1VJYA 4AZWA 2JAVA 5M55A 4QQTA 3JVSA 2ZM4A 2PZ5A 4O2PA 3NNUA 4O2BF 2WMAA 4PL3A 2CGUA 4M97A 3IW6A 3R8LA 4TT7A 4IAZA 3AT4A 4IJPA 3D9VA 3DBEA 3KAJA 4XP3A 3RVGA 5C01A 2OIQA 2W1EA 3Q96A 4YJOA 3VA7A 2X9EA 3RAWA 5J2TF 2YIXA 2JIIA 3HA6A 4WG5A 4K6ZA 4HYIA 3M11A 5H3QA 4EYJA 5KHWA 3D2IA 3PA4A 1QCFA 2YW2A 4U43A 2VUWA 4IZ7A 2OJJA 3HMMA 3IDCA 1KE8A 4JBPA 4RIWB 3UIBA 1M0TA 3GI3A 4L6QA 5M4IA 3AXWA 4HVHA 2P0AA 2H96A 2BZHB 4D4VA 2Z60A 3Q5IA 4O7VA 3TIZA 5A4EA 4RJ5A 1EH4A 3ZBXA 3QAME 3EFKA 4H58A 2IVVA 3Q9WA 3QTUA 1XH6A 3MB7A 4O0UA 5JSMA 3UZTA 3UTOA 3LMIA 5ANIA 2B9JA 4QT1A 3KXGA 1GZKA 4BCQA 5DRDA 2I80A 4YJNA 4DF3A 3NDMA 3R83A 3TKHA 1OBDA 2QG7A 1SVHA 2J0JA 2C6KA 4HGSA 4IJ9A 5B2LA 3F3UA 4ALVA 2FB9A 2R3HA 3BLHA 3BYVA 4EBWA 4EBVA 3Q52A 2OG8A 4A9SA 5EK7A 3RALA 2X0GA 3BHUA 3NLBA 3NPCA 5TT7A 4BDFA 1Y8YA 3L9LA 1ZOGA 4CQEA 2FO0A 3ZLSA 4O4JF 4O7NA 2VTQA 2QR7A 3LP8A 1H1SA 3SOCA 3V6SA 4EKKA 2A27A 3VBYA 2XB7A 2JC6A 2J90A 4QTAA 2XUUA 5EM8A 5DR2A 4AAAA 3R8MA 3ETJA 2CKPA 4O27B 3CQEA 4MNFA 3AMAA 3ORIA 2W06A 3PRFA 5EKOA 4L67A 3S0OA 3A7GA 4X2KA 5ANDA 4TXCA 5KZ0A 5A6NA 1JKTA 1H08A 1OPJA 2DYLA 3ALOA 2FYSA 3KGAA 2GFCA 3D5XA 4R1YA 5JQWA 2ITQA 4J53A 1YDSE 4N0SA 2UZDA 3AQVA 3FQSA 3HP5A 3VUHA 4FL2A 4FTUA 5IQAA 4O0SA 4JJRA 2ONLC 3GQIA 3JVRA 2DS1A 4FSYA 3LZBA 4RJ4A 3VRYA 4F1TA 2W70A 4IAKA 2GTMA 3TJDA 5KUPA 4Q2AA 3FMLA 3TCPA 2VRXA 3DBCA 3TEIA 5HX8A 3QCXA 4ME6A 3AC3A 2O3PA 4PY1A 3WOWA 4KINA 5LVLA 4FEQA 1IOWA 5KZIA 4EH7A 4EH2A 4ANMA 3MJ1A 3OTUA 3AC2A 2PBZA 3CS9A 1VZOA 3UIXA 4DG3E 4HQ6A 3QXOA 5ANKA 4IHJF 2R3KA 4BC6A 4RX7A 1ERKA 5GONF 3QRTA 5AA8A 1MRUA 3W18A 4BCHA 3B2WA 3O8PA 2QVSE 3U87A 4LUDA 3AD6A 5TF9A 3E7VA 4ASEA 3OHTA 2X9FA 4BZDA 3AC4A 2RGPA 3LMGA 2WTKB 2C6IA 2HZ0A 3CY3A 4I6QA 4JIAA 5E4HA 4D5KA 4MWIA 4F9CA 4RJ3A 3BPRA 3UO4A 4EJ7A 2ETMA 4B7TA 2I7QA 4O7YA 5EDQA 4FV9A 3IW8A 2HWPA 3QKLA 4FIEA 4Y8VB 4B0GA 3QA0A 4QQCA 3KN6A 4KIPA 2ZDHA 2BTRA 2QOLA 4JIKA 4DA5A 2ZV8A 2E9OA 1Z57A 2W1FA 5IMEA 5CVFA 4JL9A 2R7BA 4FEUA 4WHZA 2GFSA 3AMYA 2XIKA 3BE9A 4I21A 4MXAA 4PTCA 4XG3A 2SCUB 3EN4A 3W16A 4EONA 3OW3A 2GNFA 4KSQA 2GNJA 2OJ9A 3RPVA 1XH7A 3KRJA 4LOOA 3RAKA 1P2AA 4QMWA 5AP3A 4AZVA 4F9YA 2VWUA 3KF7A 5K4IA 4KS7A 2UW6A 4QMLA 3HMNA 4QYFA 1P5EA 4TPTA 1XBBA 2PY3A 2ZYBA 3DJ6A 5L6WL 4NFMA 5DIAA 3V04A 4NM0A 2X8EA 4DGLC 2YCRA 3EQDA 5CU2A 3SXSA 4BDCA 1MRYA 2XRWA 2OBJA 2Y4IC 5IQDA 2UW0A 1GIHA 2WFYA 5DWRA 1URCA 3FMDA 2YN8A 4ZTLA 4B8LA 1IASA 4RLKA 1JKKA 4FKQA 4XHKB 4CKIA 3R8VA 5IA1A 4QMXA 5C8NA 3Q3BA 3DKCA 4O4LF 2R3JA 2I1MA 2XJ2A 4RIYA 4WUAA 2ZDQA 1PW2A 4I20A 4C35A 1UV5A 5GNKA 1IOVA 3MH0A 4HPUE 1DS5A 3HV5A 3IG7A 4O21A 4TWOA 3Q2OA 2XNPA 4JOAA 5HIBA 3IPHA 4YNEA 4ZTHA 4EZ5A 1CSNA 5DBXA 2H9VA 3ENHA 3K3JA 4FV3A 4FIFA 5JMSA 3GP0A 1M2RA 5JN2A 3AGLA 2WTCA 3E8DA 4V0GA 2UZBA 1QPDA 2ZB0A 2VTPA 5AUYA 3U4WA 4RFMA 1PMNA 2IVSA 1U5QA 4EOPA 1OECA 4FTKA 5D7AA 5HLNA 4FV6A 2GNHA 4XG9A 1C30A 4S33A 1OUKA 3R7VA 2CPKE 5EYCA 1Q5KA 3OVVA 4D55A 3SX9A 4XV2A 3E3BX 2PL0A 3NSZA 2F2CB 4BYIA 4DTAA 1STCE 4FC0A 2W5AA 3MJFA 4C4HA 4G2FA 5I9YA 4D0WA 4O2AF 3OUNB 3FI3A 3DBQA 3NNXA 3NYOA 2W6QA 4W4WA 3TTIA 3MA3A 5HBHA 2YIYA 2ETRA 1OIRA 4NCTC 2IWIA 3ZLYA 2CZGA 4CTCA 4HCUA 3ZO1A 3G9NA 4U6RA 1JOWB 2VTSA 2VPQA 4FTRA 3TZMA 4O0XA 1CQJB 1S9JA 4RQKA 1QMZA 4E6DA 5HKMA 2W05A 4MBLA 4S30A 2WMWA 5HCZA 3ANRA 4BY9E 5JKGA 1I44A 2WYOA 1EZ1A 4XG7A 3EQGA 5EM7A 2XD4A 4NT4A 1U46A 3F6XA 2F7XE 2VU3A 3EN6A 3KL8A 3NVMB 4R3PA 4XP0A 5HVYA 1KWPA 3ERKA 2HOGA 3V01A 3KK8A 3F5UA 2VQDA 4XRLA 4MV8A 5IISA 2XM8A 4OLIA 1KE9A 4U0IA 3E93A 2QLQA 4CGAA 2JKKA 3OTVA 3NEWA 1ZY4A 3AD5A 4FTLA 5LWNA 3OP5A 3ZUUA 5KO1A 5E91A 3HBLA 5CA0F 2Z2WA 4KABA 5GJGA 3TIYA 3VW6A 3NAYA 3FMJA 5AAGA 3CY2A 5AAEA 4GYGA 5IQGA 3AD4A 4S32A 3KMMA 3PXYA 4I92A 5CANA 5C8YF 2WO6A 2DZDA 2PMIA 3WF6A 4ANSA 4BDDA 1YWNA 5HVKA 4FSNA 3ORMA 4D1XA 2IZUA 4RT7A 5AM6A 3ZHPC 4ZTQA 5IEVA 5DGZA 4FIHA 2J5FA 3ETAA 3C0GA 4CCBA 2BZJA 3E3PA 3KULB 3OFMA 5A54A 5CENA 4P5QA 4MQ1A 3I0QA 2C6EA 2QOCA 1OB3A 3IOPA 1OIYA 3OCTA 4FTIA 4BIDA 5JFXA 4ENYA 3DV3A 5HG9A 3IDPA 3PYYA 1ZYCA 1FMKA 3QBNA 1HCKA 3R28A 3B8QA 3COHA 4FYNA 3V5QA 5M51A 3R1YA 3G6HA 1YKRA 2V7AA 4JXFA 4Z55A 5IG1A 3RPRA 4NM5A 5G1XA 4F70A 3TJCA 4JI9A 3BGZA 3F3TA 4LUEA 3ORRA 4TV9F 2HY81 2HY0A 2BAJA 2I6LA 2VWBA 1BLXA 4XYMB 3IECA 3QTXA 3R5HA 1VYWA 4PV0A 3OF0A 2PVJA 4QYEA 3KALA 3UG1A 2OLSA 4A7CA 2G2IA 3DB8A 3QCYA 1BYGA 2ITUA 2NO3A 4KRDA 4GRBA 3QCQA 4J71A 1YOLA 3NVKI 4ZSGA 5KNJA 3LVPA 2VAGA 3U54A 4BI2A 4DFBA 4ERKA 5HV6A 3MVHA 3A8XA 4U42A 4C4EA 3TUCA 3BKBA 4E4MA 2XIYA 1H00A 3LFDA 3W8LA 1FVTA 4IFGA 3NMUF 3OY3A 3I4BA 3H4JA 4B4LA 2C6MA 4C58A 2CNVA 1ZMVA 2G2FA 2FUMA 5F1ZA 3RV3A 3P78A 2W9FB 5LQFA 2F9GA 2PVKA 3UPZA 1OBGA 4ZTRA 1WFCA 4BCFA 5I9VA 2Z04A 5CF4A 2PZYA 3C5IA 4ZY5A 1PX2A 4YZ9A 3CKXA 3CR0A 4QQJA 4QOXA 1M7QA 3D15A 5AUTA 5BVNA 3KQ7A 3LJ1A 3DPKA 4UV0A 5EYDA 3R7UA 2AUHA 2IZRA 2C5VA 4RZWA 4WNOA 3KCFA 4AACA 1OPKA 4BKJA 1M14A 2UVZA 3BX5A 3L8PA 3V3VA 2J5EA 4A4LA 4DT9A 2WTVA 2YERA 5ETCA 3VO3A 4I0RA 4ZSJA 5M4FA 1KE5A 3EFWA 1ZOHA 1WVYA 4YAJB 3ZRKA 3OUUA 2C5NA 4R6VA 4UALA 4PNKA 1CM8A 3LM0A 5H9BA 1SNUA 2YACA 2PE2A 4I6HA 4EHEA 3A4PA 3GEQA 5BMVF 3K5IA 2UZEA 4WO5A 1V0PA 3GOPA 3UO5A 2PWLA 4X3FB 3CQWA 4ZS4A 3C50A 4D1ZA 4FG8A 1Q61A 2ERKA 3H9RA 4FL3A 2ZDGA 3LLAA 4FKUA 4EH4A 2XVDA 4JDIA 4Z7HA 2CN8A 3WZJA 2BTSA 2YIRA 3BG5A 5BPFA 3LLTA 4JT3A 4RC4A 4BIBA 3MTLA 3ZBFA 2J9GA 1YXVA 3OEFX 3DXNA 1UKIA 5ETAA 3WZUA 2JDTA 4HVGA 4O4IF 4EJNA 3OT3A 3A62A 3WF5A 4G17A 5FDXA 1ZAOA 3EFLA 3PXFA 4FTMA 3QD0A 3MW1A 3O0GA 5B0XA 4HYHA 3AX6A 4IQ6A 4O6LA 3DZOA 3Q1KA 2YJRA 5FEQA 1AUVA 4FV8A 4BDKA 3UIUA 3FZSA 4DEHA 3FXZA 1VR2A 4G1WA 5EHOA 2BRMA 2ZDTA 2P2IA 3E7OA 4JG8A 4YZNA 2AYPA 4IX4A 3TNPC 4D0XA 4MV1A 2WQEA 4X2JA 5EG3A 5J95A 1BKXA 4NKSA 1U59A 3R7IA 3V5TA 5DT3A 2EVAA 4R78A 4NZWB 3QU0A 3BGPA 3P79A 5E8XA 4E5WA 4G6NA 2OLCA 4EZ3A 2R64A 3F5GA 4QYYA 3FPQA 2VO3A 4BDBA 1JLLB 1YXXA 4GKHA 4X6QC 2PVMA 1OMWA 1SZMA 3GCVA 1UWJA 4YJSA 3UYTA 3ZFYA 3QRUA 2PN1A 5CQWA 3CCNA 3SG8A 3BRBA 5IA3A 1B39A 5HBRB 3EQBA 2CKOA 5CTPA 1YW2A 4KSPA 5EM5A 2RFNA 3KN5A 3P7BA 3KREA 2PUPA 4G3EA 3F3VA 4GJ3A 1WAKA 2ONLA 5D12A 2QC6A 5EI2A 4ZMEA 4YLLA 1VYZA 3II5A 3W8QA 1WVWA 4AN3A 4DITA 3E92A 4IVDA 5D9HA 2O2UA 3NUNA 4ZTMA 5CNOA 3TUDA 2W6PA 2H8HA 1CS0A 4F9BA 4FUYA 2XM9A 4IM3A 4EOQA 4NL0A 4XOYA 4NK9A 1Q62A 5A4QA 4R7IA 2WTJA 2AC3A 4IH8A 3TW6A 3DAEA 4I5MA 5AV2A 4QMNA 2B7AA 2GTNA 3PZHA 2B54A 2I0YA 4G31A 4BCJA 3QZFA 3VJOA 2VTAA 5HO8A 3ALNA 3VF8A 3M2WA 1ZYJA 5AP4A 2OXYA 4EH9A 3GFWA 2E9PA 5DT0A 1SCUB 2WEVA 2EU9A 4QMMA 2YZAA 4FTNA 2OWBA 2WQNA 4Q5EA 2BR1A 5FBOA 1K3AA 2HZ4A 4XMOA 4EH8A 1EYZA 5BQ0A 1UVRA 1ZOEA 3IGOA 3LCOA 5KKRC 3ITZA 3LCTA 4CT2A 3WZDA 2LGCA 4YSMA 4M0YA 2VWVA 3D2KA 4D4RA 3WO1A 2OFUA 2BILB 2VTTA 4Y72A 3BHTA 4FNYA 5HZNA 5IA4A 3VBQA 5D8DA 1V0BA 3RNIA 2WB8A 1QPCA 1H27A 5L8LA 3DLSA 2YFXA 4MXCA 4U44A 4RWJA 5IYZF 4C4IA 4AGWA 2EUFB 3ATTA 4BGQA 1FVVA 4DIMA 4H3BA 4L42A 3D7TB 4FV5A 3KRWA 3O96A 4UYAA 3L8XA 4CZTA 5BVWA 2Z02A 4FKLA 4IHPA 1S9IA 4C3RA 3JR1A 4DFUA 4DFLA 2BRGA 4XV9A 3KCKA 4DBXA 4MV7A 1REKA 3C4WA 3LPBA 4C59A 4LFIA 1Q99A 2O64A 5CEIA 4BDHA 3GIDA 5HG8A 3EL7A 3GCSA 3QTRA 3UO6A 3NW6A 4QMPA 3R9HA 3T9TA 2O0UA 2C6LA 3DAJA 5JEBA 2WTDA 1YXSA 4EC8A 1J7UA 4WG3A 1B6SA 3PXRA 3LFSA 5AUWA 3R8UA 1PXMA 3REPA 4QMZA 3JUHA 4DH3A 3QTZA 4I4EA 2R0UA 3MI9A 5KE0A 3R23A 3FLNC 4JR7A 3TNIA 1KE6A 1PMEA 4M84A 3MGYA 3S4QA 4YBZB 2VTMA 5EHYA 5CAQA 2QCSA 1PF8A 3RK9A 3KKVA 4QTEA 4ZSAA 5HLWA 3LFCA 1XBAA 3O2MA 3VF9A 3OXTA 3H3CA 2DQ7X 4FT5A 4OT6A 4AZSA 3PA3A 5HU3A 2IP4A 3MDYA 5F20A 3KK9A 4BBMA 3DJ5A 4L7SA 3U6JA 4APPA 4CZUA 3NR9A 2O8YA 3U9TA 2YABA 3EIDA 4IWDA 2PUUA 4NYEA 1J1CA 1WBNA 4ACCA 4EKLA 4DLKA 3WYYA 2FA2A 2YYAA 3VULA 1GJOA 3QC9A 2IO6A 3BZ3A 4FT9A 3G2FA 4EWQA 2J4ZA 1XO2B 4U9AA 3C4XA 3A8WA 4ZXTA 3QTIA 5E1SA 3KXNA 4JLCA 3PJ8A 3ZYAA 2X39A 4BCOA 4NCTA 5IQFA 5KMMA 2J51A 2ZMCA 1PXIA 2C47A 4FVPA 4U3ZA 4WBOA 4AOJA 4CMTA 3KA0A 2B9HA 4QPSA 4W8EA 3PPZA 4CFNA 3P23A 2C3JA 4JBVA 4BCKA 3FY2A 5C9CA 4QP2A 5HHWA 3DKFA 3R04A 4BCNA 3FL4A 2OF2A 3FEGA 1KOAA 2J0LA 3KY2A 4I0TA 4UWYA 3HV3A 4XS2A 5LMAA 5HTCA 4F7LA 1KJIA 1M0WA 1E4EA 2XJ1A 2DLNA 4JRNA 1SYKA 3KU2A 2RIOA 4WBBB 3BV3A 3MWDA 4FSUA 3ZLWA 3QC4A 4EH3A 1JDEA 4IEBA 1FQ1B 4GK4A 1L3RE 2OSCA 3RPOA 2I0EA 4FTJA 4A4XA 3POOA 4AN2A 4X2NA 3V51A 3FQEA 4BDJA 2QK4A 3JPVA 4NTTA 4RIXA 4FFOA 4HYUA 2JFLA 4TNBA 4WOVA 4FT3A 1W0XC 1V1KA 3R9NA 2PPQA 4WUNA 1Z2PX 4E6QA 5AIRA 4QMYA 3RPSA 4EHZA 4LYNA 4YC6A 5CT7A 2F2UA 5JGAA 5KKNB 2J0MB 2QKRA 4ZTSA 2P4IA 4HCVA 3R6XA 3CIKA 4CFVA 5M44A 4CLIA 3TN8A 1PKGA 3PTGA 2W96B 4F0GA 2IVTA 5FM3A 3FHIA 4FI1A 3TXOA 1Z9XA 1J91A 3GUBA 2J50A 4N70A 5GIOE 2VO7A 3HV4A 2A19B 1XWSA 3DF7A 5KMJA 4PMSA 5CY3A 3FDNA 5EHLA 2BALA 3ZZWA 5HIEA 5DR9A 4I4TF 3Q4TA 4BYJA 3WE8A 4IWPA 2RG6A 1M17A 3R7YA 4AW2A 2ZVAA 4AUAA 4HOKA 4RJ6A 2C00A 4GL9A 4YTIA 4D5HA 5AM7A 1RQQA 5J9YA 3MWEA 3ZLXA 5EW9A 5J9LA 2QOFA 2W4JA 3UC4A 3DAKA 3Q53A 4S34A 1CKPA 3V8SA 4E20A 1U54A 3QYZA 2RKUA 3GT8A 4FT7A 3VHEA 1B6CB 3ODYX 1YHSA 4DEGA 3D5WA 4KWPA 4D4SA 2W6ZA 3CJGA 1TQPA 3HLLA 1OIQA 3QQHA 4IAFA 2YS6A 2W99B 4IFCA 5A14A 4P5ZA 2V5QA 1FMOE 2XH5A 2FH9A 1OI9A 2JGZA 3OCSA 5CSHA 3LOKA 3FXXA 4FGBA 3QUEA 4FR4A 2RL5A 2W1CA 2R82A 2OH0E 1DI8A 2VWZA 2QO2A 4ZY6A 4AT3A 5AP0A 1U54B 4ARKA 4BZNA 2YRXA 4EG0A 4B6LA 2V5AA 3VRZA 1L8TA 5HBEA 3RWPA 4RRVA 4RFZA 2W0JA 4K18A 4E7WA 4MHAA 1YHWA 1XH4A 3KXXA 3ZRMA 4TY1A 3KXZA 2YS7A 4YC8A 3WILA 3K2LA 3SW7A 1ZZLA 3POZA 5C8KA 4YP8A 4OTQA 2DUVA 3UVQA 4O83A 2C5XA 2CMWA 5HNIX 3ENMA 3NGAA 4F1MA 3D4QA 2YIQA 4IE9A 4JDJA 4OUCA 2EB3A 2YCFA 1PMVA 5JVLA 3IGGA 3R2BA 4C4JA 3MBLA 4USFA 4FE2A 4I24A 3QLFA 4FOBA 2JIVA 3CEKA 1NY3A 4F4PA 1ZYSA 2VZ6A 3BELA 4FIGA 4FKSA 4KNBA 2C1BA 5DPVA 2ZOQA 4L53A 4AGDA 3BV2A 4RMZA 3TZ9A 3FZOA 3SQQA 3RINA 4HZRA 5HG7A 5F94A 3I79A 5IUIA 3ORNA 3E87A 5J87A 4U40A 1DAWA 1H8FA 3OXIA 5EI6A 5IU2A 3BGQA 4PMMA 4YPSA 5C4LA 2QNJA 2QO9A 2NUAB 3LFEA 3I5NA 3KB7A 3GC7A 4BRXA 5LMKC 5CU0A 4PMPA 2ZJWA 4OBPA 3UOLA 1Q8TA 3BHHA 5E8WA 3RM7A 2C0IA 4IAIA 4C3PA 1GY3A 2YM4A 4GG5A 3CP9A 1E9HA 4U81A 3LW0A 1BUHA 3NX8A 4WG4A 3EWHA 5AUZA 4BF2A 3GBZA 5HX6A 2QHMA 4FZ6A 2GHMA 3ORQA 3GU7A 4DTKA 4TV8F 3DLZA 4LQMA 3MY1A 4RPVA 4AQCA 5J1VA 4J98A 3I60A 3OC1A 2JDVA 3DDQA 3F3WA 3NRMA 3OWJA 5IEYA 4J7BA 1UA2A 4W4YA 5DI1A 4HVDA 4APCA 3DBDA 2CGWA 4O7LA 5IH5A 4RBLA 4J95A 3MSSA 2ITVA 4YBKA 3ZO4A 4L00A 4AZFA 1PK8A 1UKHA 2ITWA 4DAWA 1LP4A 1M2PA 5JGBA 3UMWA 4FTOA 4QMVA 5HNGA 1GZNA 3VHKA 2XK6A 5LCJA 3NYNA 4IX5A 2GS7A 3BEGA 4PMTA 3WE4A 4RGJA 3TQTA 1JWHA 2Q83A 3CD3A 4XV3A 4LV5A 2ZB1A 1SMHA 1KJ8A 4OTHA 4ACHA 4I23A 3R63A 2BCJA 3BLRA 1CDKA 5AP1A 2R9SA 3IW7A 3EH9A 1W98A 1XHAA 2GHGA 2JDRA 3IO7A 5JH6A 4MXYA 5DEWA 3MV5A 3R7EA 2UW8A 3O8UA 1OKVA 5L3AA 5CALA 4EUTA 5E8YA 1J7IA 4NWMA 1OL2A 1PJKA 5HD4A 1NT2A 2BIYA 2CKQA 4TYHA 4GK2A 4L3LA 3N4TA 4ZAUA 1H01A 5C1QB 1QPEA 3G33A 3OBJA 4XLIA 3G8DA 1KEEA 5EDPA 3EQPA 2YM8A 4C7TA 5TO8A 2XCLA 5I9WA 4FEXA 4MD7E 3PXKA 4ZS0A 5JGDA 3BYMA 5CWZA 3BQRA 3OROA 4IC7A 1FVRA 3PE1A 4XV1A 4BDIA 3QA8A 1MQBA 3U6IA 4TYHB 2WEIA 1YHVA 3PE2A 4DH1A 4FIJA 4IWOA 5HQ0A 3ZMMA 3HECA 1IR3A 4O2ZA 4RWKA 2Y7JA 1YDRE 2BDFA 3K5UA 3QTWA 3VS3A 5AX3A 5FQDC 3EL8A 4CG8A 4EI4A 4EOJA 2ZM1A 5B7VA 2R84A 1YI6A 3NUYA 3G51A 4TYGA 1Q8ZA 4QYHA 3N51A 1M52A 4F7NA 3GNIB 3R5FA 4PL5A 4B9DA 5DRBA 3FMHA 3FZRA 4BGGA 3C51A 1UNLA 1ZARA 3TL8A 2A1AB 1I7NA 2XIXA 3K54A 4I6BA 4HCTA 1PXNA 5BVEA 4EOKA 3RAHA 4F09A 4KA3A 1JSTA 3ZU7A 4V01A 2PVPA 5I0BA 1DM2A 1U5RA 3VJNA 2WQOA 4JNWA 4AU8A 5KMNA 4FOCA 3LQ5A 2CNQA 2GLTA 4QP7A 3VOTA 2X2KA 4ZZOA 4MBIA 3DBFA 1K9AA 3L9PA 2HZNA 3PP1A 3Q4UA 2UZNA 3DGKA 4LMUA 5CI6A 3E8CA 3L1SA 3TT0A 1JVPP 1GSAA 5LVMA 1GGOA 2QOHA 2XK8A 4M15A 3TACA 1R0EA 3Q2MA 5E8TA 5AX9A 2PZIA 5I5ZA 3TUBA 4QYGA 4O86A 4UN0C 2C3KA 2XS0A 5CSWA 3TV7A 1KC7A 4LL0A 2QI8A 4N6YA 5C03A 4RSSA 4Y83A 4F9AA 3FZTA 5FLFA 4QMOA 4W8DA 5IQIA 3P7CA 4UX9A 1YXTA 2YAAA 1E1XA 3EKNA 3T3UA 2Z8CA 4ZLYA 1BL7A 4U41A 4NJ3A 2LAVA 1JKSA 4CXAA 4C5AA 5CF5A 4K11A 4O7SA 5TR6A 4Y85A 3ZO2A 4KUJA 3VAPA 4G34A 4RIYB 2PU8A 4YC3A 1KE7A 3NW7A 2QQ7A 4DH8A 3DT1A 4I94A 3RZBA 4BHNA 2H34A 3AGMA 3DJ7A 4IIRA 3UVRA 4RWLA 4DLJA 1MQ4A 3PLSA 3EZVA 3QF9A 4IDVA 1JBPE 5ITAA 5K5XA 2YZNA 3T9IA 2J9MA 3ORZA 4IZAA 4WSYA 3I81A 3ODZX 4GG7A 4V0GB 3VW8A 5FDPA 5DA3A 2UZTA 2ITOA 4F7SA 4MAMA 4JG7A 4HNTA 2PTKA 1NW1A 3BCEA 3BU3A 4IZOA 3CKWA 4AFJA 2F49A 4Z16A 4PDYA 4R7BA 1LPUA 1JLUE 4UXQA 5IH6A 4ALWA 4RVTA 4LV8A 3UMXA 4HJOA 4J1RA 4ANBA 4UBAA 3ROCA 2V62A 2FSLX 5CQUA 3ZDIA 3VS6A 4CFWA 4NM3A 4LRKA 4II5A 5ICPA 3OW4A 3SRVA 3C0IA 3PY1A 3N4VA 5FGKA 5LXMA 1M2QA 1PKDA 4PX6A 3FV8A 1DV1A 1XH5A 3MY0A 1WVXA 3ZDUA 2G01A 4IDTA 1IA9A 3G0EA 4ITHA 5LVPA 3IKAA 4FV0A 2YM7A 4ANQA 3ORXA 3PSDA 4U45A 3GFEA 4MV9A 2QOOA 4GW8A 5IUHA 2BZKB 2BKKA 4XG2A 3TTJA 1NXKA 3UDBA 4KRCA 2JD5A 2GCDA 4C36A 2X7OA 2J0IA 5CASA 4FNZA 5CAEB
chains in the Genus database with same CATH superfamily
3HB9A 3EQIA 1V0OA 3R9DA 1I09A 3I6UA 2GNLA 5KBQA 3GC0A 3KMUA 3LQSA 3OS3A 1MRVA 2B1PA 2XNOA 3A4OX 3UOHA 4DGGA 1Q8WA 5J8IA 3TYKA 3Q60A 4H39A 1P14A 4FVRA 3BU5A 1CTPE 2YM6A 3SLSA 3C1XA 3BYSA 5F4NA 3ATSA 3PY0A 3RMFA 4XX9A 3R02A 3UOJA 3NYVA 3A99A 3D0EA 3NUPA 3E63A 1S68A 3F61A 2VGOA 2YISA 1IAJA 2JIUA 4GS6A 3OWKA 2CSNA 3FLYA 2PUIA 4YSJA 4AX8A 4AT5A 5JRQA 2Z7RA 2WMXA 5T68A 3QD4A 4OR5A 3W0OA 5HCYA 5I9UA 3VUIA 4PTEA 4JR3A 1KJJA 5A3XA 4FX3A 4GLWA 2VTHA 4X2GA 1M7NA 4BDAA 3KXHA 4W4XA 4ENXA 5J9ZA 4NU1A 2BHHA 4BGHA 5ACKA 5BV3A 4E5BA 3QGYA 4KD1A 4EK8A 3NBYB 2GS2A 3CGOA 4RLLA 3RKBA 2FP4B 3HMOA 4YO4A 3ORLA 3HVCA 2YCSA 2C4GA 4DH5A 4DGOA 3CQUA 3LXLA 4FKIA 2BPMA 4IB0A 3WF7A 4QP3A 5CXZA 3RV4A 4GMYA 2OICA 4ORKA 2X8DA 1XJDA 4J97A 3WIGA 3WF8A 4ITJA 2RF9A 3Q4ZA 4PL4A 4B8MA 4D2SA 4WD5A 4U5JA 4S31A 4IM2A 4YUQA 5HD7A 4DYMA 4YHJA 2OF4A 2DAAA 3GXLA 1H24A 4QDEA 4LG4A 2R3QA 3D5UA 3QQMA 2F7EE 3FI8A 3H9FA 3OCBA 4ZSEA 4M67A 2R87A 5CAOA 3LWBA 1CQIB 4GFGA 4EH5A 4W4VA 3PVBA 1EKFA 5I9XA 2OI4X 1OITA 2YCQA 2F7ZE 3SKCA 3QGWA 4RJ8A 3ZH8A 3QYWA 3EN9A 3ZONA 5JZNA 4ACDA 2YIWA 5IQHA 2OZAA 4YGAA 3QQGA 2C3LA 1TKIA 2IN6A 2WD1A 2JDOA 3NZ0A 4IC8A 5IDPA 2OKRA 4LL5A 4PRJA 2EXMA 1BX6A 2ITYA 2X4ZA 4RIOA 4RCNA 2PVHA 5IA5A 2YZGA 2JAMA 4MCVA 3HNGA 3FJQE 5H80A 5JQGF 2B0QA 4QP6A 5BYYA 2DABA 5A6OA 1YOJA 1TQIA 5IQCA 1F0QA 4ONAA 3HAMA 4YJRA 2BRBA 3UJGA 1CE8A 4Q4CA 5BUIA 5FPRA 2SRCA 2NRYA 4LOPA 5HG5A 2WU7A 1RJBA 2GNIA 2VNWA 5AEPA 3PZEA 4F0IA 3GU4A 5HTBA 3T9CA 1BNCA 1JAMA 3C4ZA 2XEZA 2Q2UA 3PVWA 3SVVA 4L45A 4EZ7A 5B2MA 4AT4A 4DHJA 3H0ZA 4ZHQF 4G5JA 3PJ3A 4I4FA 3LFAA 2NP8A 3OEZA 1EUDB 3C5UA 5EQPA 1B38A 3CE3A 1TQMA 3COMA 4M7IA 4NW5A 4TW9A 5LMKA 5AV1A 3UG2A 4FK6A 4QTBA 4A07A 5JZJA 3EOCA 4DE4A 4F64A 1O6LA 4G3GA 3HO8A 3HRBA 2VTIA 4IZYA 4L1KA 2Z7QA 3ZFMA 5BWRA 4DINA 1KOBA 3Q9XA 4GUEA 3GOKA 4EQCA 4FZAB 3Q2JA 3O71A 4GT5A 5DAAA 5CSVA 2JBPA 1W83A 4JBQA 4JS8A 4O7TA 4YR8A 3IDBA 3OWLA 3F5PA 4RX5A 5IPJA 4YJ2F 5AADA 4QP9A 2YJSA 3VBXA 2GMXA 4MV4A 3R22A 3FXWA 4JBOA 4KKGA 2C68A 3MPMA 3UC3A 2I40A 5TOZA 3FMMA 2VTJA 3N6RA 4DBNA 1IRKA 1ZMWA 5CM0A 2PVLA 4KIQA 3TWJA 4BB4A 4QNYA 4ZSLA 1Y91A 1AQ1A 3AG9A 2YAKA 3R1QA 4K8AA 3RGFA 3DK3A 2JLDA 3SXRA 3TV4A 4FFNA 3EQRA 2KULA 3QTSA 2VGPA 3O5AA 4R3RA 1BI8A 4RX8A 5KBRA 3MTFA 2YRWA 3PFFA 1OL7A 4NSTA 3V8TA 4TRLA 2FB8A 2P2HA 2VWWA 4PDSA 3SW4A 4EUUA 4G3FA 4UB7A 5AUUA 5IEXA 3FBVA 2FSOX 4RVLA 2R7IA 1CKJA 3LQ3A 2YZLA 5HCXA 4TKSA 3JXWA 2P0CA 3O50A 1PXPA 3SGCA 4O7ZA 3FY0A 2VO0A 1JSUA 4KKEA 4NKAA 1FVIA 4QNAA 4E4TA 3R00A 4M8TA 2E9NA 4L01A 2FGIA 1KBLA 4O0YA 3BQCA 5HBJA 4F63A 3DDPA 4FKRA 3G90X 3U8WA 4X6RA 1H4LA 3NCGA 4KAOA 2HVRA 1SNXA 2BZIB 2WGJA 5EW8A 3B2TA 3MN3A 4GUBA 5HO7A 2IJMA 4TUYF 4G3DA 5AJQA 4E8AA 3L8SA 3U4UA 1O6KA 5EZYF 4FZFB 1UU9A 3A7FA 2UW3A 4Y5HA 3NNWA 3OG7A 4G5PA 5HGIA 3ZUVA 4AA5A 1Y57A 2YDJA 4HZSA 5H8BA 3ZC6A 2VTLA 4HN2A 3QQUA 3RPYA 4I6FA 2QOKA 5AP5A 4G6LA 5HE1A 4M9UA 3DXPA 2XNEA 2WTKC 3R71A 1WBTA 4C34A 2PSQA 3LIJA 3FQHA 4MTAA 2UZVA 5TKDA 3VQHA 4AS0A 4C2WA 4YZMA 4DTBA 2NU8B 1ZYDA 4DFYA 4HW7A 3FSFA 3ULZA 5I60A 4C61A 4P7EA 3OUZA 4NZMA 2VTRA 4XH6A 2ZV2A 3RCDA 4L3JA 4AN9A 4F7JA 2BDJA 4R77A 4L52A 3NUUA 4OW8A 3RAIA 2R3NA 2ZMDA 2G2HA 3HP2A 3UBDA 3UVPA 1LEZA 5A4LA 3QQFA 4IVBA 3SGIA 1KSWA 3O8TA 1TVOA 3ZOSA 3FZPA 5CU6A 3RWQA 3CD8A 4DFNA 5JK3A 4MA0A 4GH2A 4C4FA 4IANA 4O0RA 1VEBA 5BPHA 5I5UA 2CNUA 4EOLA 3PA5A 1Z5MA 5CXHA 2VX1A 2JKOA 3VS5A 1WZYA 3PJ1A 1FINA 5L8KA 3L9MA 3GB8B 4PWNA 5GJFA 3F82A 5FXQA 4D1SA 4EOIA 3E62A 4WIHA 3MJ2A 3VS7A 1YQJA 4DN5A 1W7HA 1QPJA 5FXSA 3TY5A 5AP2A 4RX9A 2CKEA 2B55A 2YZMA 3UIMA 3IOKA 4FK3A 3RHXA 3FL5A 1H28A 3F3ZA 1Y6AA 3MVMA 4U3YA 2E9VA 3LKMA 5I4NA 3C4EA 1DI9A 2PZPA 4FKGA 4IVAA 2FPPB 4GVAA 4BJJA 1OL1A 4IAAA 4L43A 3TI1A 4FFRA 4RC2A 3WWJA 3ZTXA 4IAYA 5CAUA 2RFDA 1REJA 3A61A 4RQVA 3P0MA 2Y4IB 4CCUA 4UEUA 2B9FA 3D7ZA 3D83A 4FFMA 1XBCA 2QU6A 2ZV7A 5HEZA 5HICA 1OZ1A 3U51A 3ACKA 1JNKA 4PP7A 4AFEA 2XANA 2XALA 3GC8A 3GC9A 4JX7A 4R1VA 4EQMA 1QL6A 2HCKA 2YL2A 3N8DA 4QMTA 4BCIA 4XYLB 5LA6F 3EJ1A 2H6DA 2ITNA 2OIBA 3EFJA 3F7ZA 4D4YA 4USEA 4QMUA 4ANLA 4RVMA 3MVJA 3TY9A 5ETIA 3VS4A 4A9UA 2PULA 1SM2A 3DKOA 3MB6A 2V58A 1UNGA 4YU2A 1I1KA 3FYKX 5E92A 3U9NA 3P7AA 1WR2A 3W0SA 3DU8A 4CKBA 2QO7A 4C5CA 1J7LA 1EUCB 2Q2TA 3ET7A 3NIEA 4U79A 2YEXA 3W1FA 3OD6X 4FFLA 5D1JA 3ZEWA 3E88A 4EORA 3W1BA 1OPLA 2XK9A 3LJ2A 4UYNA 1FGKA 1YOMA 4TWCA 5EYKA 4D2RA 4D28A 4C4GA 4M13A 1E1VA 3LXKA 5G6VA 4WRSA 4YTCA 2WMTA 2W5HA 3C4FA 3CTJA 2YITA 4E93A 4YHFA 3AC8A 3JSLA 2BHEA 3A60A 4QTDA 4CFUA 4EOSA 4CKJA 4DLIA 3Q9ZA 3FWQA 4KBAA 5M4CA 3R1NA 4OGRA 1LUFA 2BVAA 4FSQA 4EH6A 3KEXA 3JZFA 4AA0A 1B04A 4NFNA 3LE6A 4X3JA 4FSTA 2UW7A 4L68A 3D94A 5BX0A 4MXOA 4QP4A 2VWXA 4FV7A 2XAMA 4YJVA 4A06A 4NW6A 1NVRA 1WCCA 5M57A 3JY0A 5K3WA 4ALUA 3WNZA 4WBNF 4TNDA 4FV2A 3PLAE 3ANQA 3DB6A 3UGCA 4MNEA 4OTDA 4DT8A 4YZDA 5F95A 2Y4PA 2ITXA 1E4EB 4M0ZA 1LEWA 2JDSA 3CPCA 2HGWA 2R5TA 4Y73A 1A9XA 1O9UA 3P86A 5FEEA 4YURA 1XR1A 2PYWA 3EN7A 4OT5A 2ERZE 2GQSA 4LM5A 3OOGA 4YZCA 4DEIA 1EHIA 2C5OA 2EJ3A 3QWKA 5CEOA 1H1PA 1OUYA 4BCPA 3U6HA 5HE2A 3TZ7A 4RIXB 3FE3A 2PMNX 1I7LA 4UFZA 2OW3A 2W1IA 2Q0BA 2WMQA 3L9NA 3SXFA 2PUNA 3UYSA 3LFFA 4FKWA 4KKHA 4RZVA 3WZKA 1F5QA 4XOZA 4CFFA 4S2ZA 4PBCA 3SNOA 5FR9A 5LOHA 3UP7A 4QMSA 4ITIA 4E4LA 3DTWA 1OGUA 2QODA 3QCSA 3FMNA 4N57A 2UVYA 3N9XA 4XG8A 4AF3A 3BL7A 3GB2A 3GU8A 3DQWA 4FNWA 4IVCA 2IZSA 4TM5A 4XBRA 5LOVF 5T3QA 3BYOA 3A7HA 1M6VA 2YDIA 3HL7A 4XG4A 3VUKA 3ORPA 3P08A 4G6OA 1KV1A 4LGGA 2X5RA 4DH7A 1KJ9A 2W6OA 4PZ8A 1PXOA 2PMLX 2XK3A 3CTHA 4PDPA 4Y5QA 2GQRA 1LR4A 3U9SA 4FSWA 5FTOA 2JKMA 4BR3A 5JRSA 2OK1A 3HYHA 3OWPA 5HESA 3ZXZA 2R3GA 3QHRA 5ANJA 2I8CA 3NS9A 3VMMA 3PFQA 3BACA 5BYBA 1P4FA 2VTOA 5GJDA 5K5NA 4JDKA 3OT8A 4MKCA 2NU7B 2A2AA 2O5KA 3OY1A 4MV6A 2OO8X 2XNGA 3ZEPA 4EQ5A 4ASZA 2Y9QA 3DK6A 3QALE 3P9JA 4E4XA 4LRMA 4AG8A 1IG1A 4EOOA 2ZV9A 2OXDA 3BI6A 5EI8A 3A2CA 3FYJX 3G9LX 3T3VA 3QKKA 3HX4A 3VNTA 4BCGA 1Q8UA 3VN9A 5BVFA 5IMXA 4EHGA 5CS6A 5FBNC 2VX3A 4ZY4A 1T36A 1T45A 4DEEA 3ROYA 1H1RA 4FTTA 4O91A 4CSVA 3AKJA 1VBGA 3GCQA 4MH7A 4F0FA 3WO0A 3CGFA 2XCHA 1Q4LA 2UV2A 3LAUA 2F4JA 2WMUA 2PVRA 1ND4A 3ZZEA 2UZUE 4FYOA 2FSTX 4I93A 1T46A 4J52A 4ZEGA 3CSVA 5AP6A 3JY9A 4IB5A 4TL0A 4I0SA 2WKMA 2X0SA 3GGFA 2C6TA 3R5XA 5K4JA 1GSHA 5AV4A 4GCJA 3PDTA 2OFVA 2VD5A 3EZRA 3BIZA 4RIWA 4U7ZA 1GAGA 5FM2A 4BDEA 5HIDA 4UCSA 2GS6A 4YLKA 3HGKA 2COIA 3G8CA 1UWHA 2QU5A 4X3FC 4EL9A 2Y0AA 4AE9A 2PMOX 4DEAA 1ZMUA 4GT3A 3BA8A 2GSFA 2QD9A 4R7HA 5E90A 5M06A 4H3QA 2HVQA 3H10A 3TY8A 4CV9A 1BI7A 2CLQA 3O17A 4RWIA 5GINE 2W71A 4E6NA 3MH2A 2QKWB 4YPDA 4E6CA 4H36A 4Q4DA 1A9UA 3DCVA 1APME 4RA4A 4XCUA 4CLJA 3BHYA 5JQ8A 4XBUA 4K0YA 1IYDA 4OTGA 4MK0A 4QDVA 4G9RA 4X0MA 4AWIA 2WMVA 4X2FA 2IW9A 4BN1A 2XNNA 2DWBA 4EWHA 4FSRA 5CEKA 2G1TA 4MV3A 3G6GA 2OH4A 4QTCA 5FTQA 1X9NA 3UP2A 5BNJA 3W2RA 2XKEA 3DNDA 3IQ7A 5JH7F 3F2NA 3PIZA 5CT0A 3GVUA 2ZM3A 3GENA 3HZTA 1XQZA 4V05A 1NA7A 4WKQA 3VIDA 3HAVA 4L7FA 4NTSA 2QOIA 3QFFA 3QQLA 4TZRA 3FC2A 5M56A 2BRHA 1CKOA 3QUDA 3K3IA 1GZOA 1WBWA 3R73A 3R9RA 4YTFA 5EQYA 4UUGA 2VNYA 3AOXA 5DH3A 3W2PA 3TM0A 3K5HA 3AW8A 3ID6C 3ZSIA 4C02A 2OJGA 3C9WA 3H0YA 4FZDB 2HWOA 4YHTA 3VUGA 3ZXTA 5F9EA 3SAYA 3MFSA 4F78A 3NCZA 5BVDA 1SVGA 3Q5ZA 4FSZA 5I9ZA 3IONA 5E8UA 2R2PA 4AE6A 2VR1A 2ZFYA 3IW5A 3LMHA 4GJ2A 4AZTA 3VWAA 3ORKA 1XH9A 2HAKA 2W4OA 3SDJA 3U55A 3QWUA 3TW7A 2C0OA 4A9RA 1BL6A 3PG1A 4L3PA 4ACGA 5LWMA 3OOMA 2O63A 1OM1A 3MFTA 3UE4A 5CAPA 2Y4RA 1FBNA 3LCDA 2YHVA 1IA8A 3R01A 1W82A 3TKIA 3FI2A 5A46A 4XZ3B 2X6EA 4GIHA 4CMOA 3NUSA 3SC1A 2ACXA 4BI1A 5CF8A 1W93A 4C38A 3DFCB 5CEMA 1VBHA 3QQJA 4TYJA 4XUFA 2G15A 4H1JA 4AOTA 4YLJA 4O22A 1URWA 2NRUA 3D14A 3FC1X 1H0WA 3CXWA 3W10A 2ZGIA 3FMKA 4GYIA 1HOWA 2OJIA 3RTPA 4ZMFA 1ULZA 2WOTA 3JRXA 1FOTA 2R3PA 3TZ8A 4ZLZA 4GK3A 2X2MA 1V9PA 4KBKA 4AA4A 3MH3A 5BPYA 1Y8GA 1YWRA 2UZLA 3DXQA 1PY5A 5M08A 3KYHC 3UZBA 3UQGA 2HW7A 5E8VA 4PQNA 2UUEA 5KMKA 4GVJA 4MA5A 3QUPA 3LHJA 5EYMA 5CNNA 3O7LD 2A4LA 3I1AA 3KIOC 5D7VA 5CX9A 2EIYA 4IACA 4EEVA 1PXKA 3R8ZA 4M12A 5CAVA 3IK3A 3OCGA 2W1HA 3RR5A 1R0PA 3T99A 2CLXA 3MIAA 1Q97A 4JAJA 3W0PA 2WIHA 3E5AA 1KJQA 4FIIA 3VPCA 2CCIA 1RE8A 4O7RA 1SVEA 4IBMA 4K33A 3V8WA 4XJ0A 4QMQA 2C30A 3R1SA 5BVKA 4GU6A 2VN9A 2ABJA 3KAKA 2R86A 4LGHA 2UZWE 2HENA 4QO9A 5DLSA 5BWTA 5IH4A 3PP0A 3BA9A 1W8CA 2OU7A 3GU6A 4GV1A 2BIKB 5HNBA 2YM3A 2X7GA 3R8PA 3DAAA 4R3CA 3V4ZA 4O0VA 5KKRB 2W1ZA 3OMVA 4HNIA 5HI2A 4JAIA 4CT1A 4M3QA 4OBOA 2XCKA 4H1MA 1Q8YA 1JSVA 1P4OA 2VX0A 3A7JA 3P4KA 3PIXA 3PY3A 1X8BA 2R3OA 4FNXA 4NIFB 4AXAA 5GIPE 1R39A 3P5JC 4ASXA 4AP7A 1J1BA 3CBLA 4M68A 4XNEA 4YTHA 4YJ3F 5CYIA 4DC2A 4DGNA 2O65A 2XRUA 3QQKA 3AT3A 1O6YA 3HV7A 5K3YA 4DCEA 2KTYA 4JDHA 4I5PA 3E64A 5LYJF 3FLWA 3R9OA 5DGIA 3W33A 3LCSA 3H30A 3K3PA 4F6SA 3Q32A 4K2RA 2JFMA 2Y8OA 3MYGA 2EWAA 2XNBA 2ITTA 3WF9A 3THBA 4CEGA 4XYFA 4HVSA 5K9IA 4TTHB 1ZYLA 3JS2A 2WU6A 4AOIA 2GDOA 1UU8A 2QURA 3EYGA 3PJ2A 3NNVA 3RM6A 5JFVA 5JQ5A 3QX2A 3F7WA 3G0FA 3U9CA 3WZEA 5L2TA 2XNMA 2GNGA 2ZAZA 5KX8A 4NJDA 2XJ0A 2PK9A 5DVRA 4U80A 2ETKA 4C37A 1G8SA 3B8RA 4AXFA 1VKZA 2V59A 3KMWA 4I5HA 2R3RA 5CSPA 2VV9A 2ESMA 3DY7A 2J6MA 2I0VA 3RK7A 5JVDF 5AUXA 1R3CA 3KVWA 4F08A 1AUXA 3T9EA 5AFVA 3QL8A 3UNJA 3O7LB 5BVOA 2Y6MA 2VWIA 4IB1A 3FLZA 1K2PA 2QG5A 4YBJA 5AAFA 4BTFA 4F1OA 3KC3A 2FPIB 3FMEA 4RG0A 4Q9SA 3VS1A 4EEQA 4J8NA 1H25A 3C13A 3C4CA 3MY5A 5FPOA 3I6WA 5EFQA 2PVNA 2XBJA 3Q6WA 2PE1A 2EXCX 3HKOA 3TNHA 4CTBA 4WNMA 4QQ5A 3W0RA 3ZM4A 4IX3A 3DA6A 1YWVA 5AWMA 3SA0A 2PVFA 5DHJA 2R3MA 3PVGA 4D9UA 2CN5A 3T8OA 4CKEA 3GCUA 2DIKA 3OXZA 4GT4A 2C0TA 4H3PA 4BBEA 4CFMA 3UFXB 5HVJA 1IAHA 3W0QA 5LP6F 1Q24A 2OJFE 3QD2B 4L8MA 2R7KA 4FTCA 4DEDA 1PMUA 2V55A 2FVDA 3ETHA 3RCJA 2PE0A 3NIZA 3VUDA 5K2MA 3DS6A 5FEDA 2UVXA 1JQHA 3CTQA 5EOLA 5CI7A 1UC9A 3VNNA 4FG9A 3UPXA 3QRJA 4Y95A 3MWUA 3VC4A 2W17A 2QHNA 3HMPA 3IS5A 3R21A 4MX9A 4Y8DA 5DN3A 4ZZMA 3FKLA 1WBOA 4U8ZA 5FG8A 4F65A 3SRVB 4QP8A 3GJXB 4R5YA 5IDNA 2REIA 3E5NA 5ETFA 5H8GA 1ZLTA 2HIWA 3TINA 1H1QA 4RFYA 3HDMA 3HDNA 4A9TA 4E26A 3F88A 5E8SA 5E9EA 4JX3A 1MUOA 5DMXA 2C69A 5FRIA 3DKGA 1ZZ2A 3PPKA 2HZIA 4BDGA 4LRJA 3QKMA 4IMYA 1G8KA 2C3IB 3WYXA 3KULA 3AKKA 3QFVA 1Q3WA 2WELA 1PRYA 4JRVA 1MP8A 2XYUA 1DV2A 2WMSA 2OXXA 3FKNA 4MD8E 3R30A 2R3FA 4LOQA 5D1OA 3DZQA 1C3OA 2HW6A 2UW5A 3QTQA 2E2BA 4GFOA 5KHXA 2NU9B 2J2IB 3FUPA 5BWUA 5IQEA 5C26A 1VLRA 2W9ZB 4FKOA 5D41A 3V5JA 2B9IA 4DG0E 2XZSA 4FEVA 3BU6A 2BROA 1GIIA 4N4SA 4HPTE 1OIUA 3QZHA 2OGVA 1H07A 4PP9A 4R5SA 4Z7GA 3HEGA 1FGIA 3Q4CA 4LMNA 4ZZNA 5D11A 1OKWA 2W1DA 3CJFA 4F6WA 5M53A 4DDIA 3FKOA 2X8IA 3S2PA 4CKRA 2QONA 4ZP5A 5FD2A 4BVUA 5EH0A 3LXNA 5KMIA 4OTRA 3D5VA 4O82A 4FUXA 4ZOGA 2GU8A 3PRIA 4ERWA 4MF1A 5CF6A 5J5SA 5KCVA 3JRWA 2WOUA 4KS8A 3HA8A 2R4BA 3T9DA 4DFXE 3EQFA 4HNVA 3ZO3A 2P55A 3WIKA 3PSCA 4GIIA 4AGCA 4FSMA 2XEYA 4CD0A 5CA1F 3ELJA 3P5KA 3FZ1A 4WNPA 3GQLA 5DYJA 2EJ2A 5C27A 1JDBB 4PF4A 3LQ8A 4DG2E 4I50F 3T9FA 2RG5A 1ZXEA 4ZK5A 2ITPA 4OTWA 1BMKA 2BFYA 3PUPA 3PXZA 4FU0A 5J7HA 2IW8A 2QR8A 4GSBA 2NU6B 4HNUA 5DE2A 3FPMA 2PVYA 4O38A 3MFUA 1JKLA 5IZFA 1OVEA 4FTQA 4O6EA 4AGUA 4C62A 5IA0A 5JFSA 5AP7A 1TAEA 4GU9A 4JQ8A 3TV6A 4NM7A 4F99A 4BZOA 4C33A 3KVXA 5CLPA 4CMUA 5L2WA 3I7CA 4CNHA 2WZJA 2C6OA 2WMBA 1BXRA 3F9NA 4FGRA 4ZOLF 4V04A 5H2UA 4OTIA 4D9TA 4Z3VA 3O51A 3UZRA 3VVHA 4UCRA 4YAKB 4C2VA 2HELA 5C1OA 5CSXA 4ACMA 3MS9A 4PTGA 3I0OA 5HLPA 1WMKA 2B53A 4MWHA 2XBAA 3SG9A 2XK4A 4FZ7A 4EHVA 3HV6A 4X3FA 3ZRLA 1ZY5A 3TKUA 3ZCLA 3BWFA 3EKKA 3CPBA 2I0HA 4FKVA 4UXLA 2OZAB 3UNZA 3WI6A 3BABA 5J2UF 4JG6A 3KF4A 3VBTA 3PXQA 2DWCA 4CV8A 5AUVA 2XF0A 5AV0A 3Q6UA 1DAAA 4FVQA 4ZIMA 5L6PA 3PIYA 4O7WA 4PNIA 4IZ5A 1U4DA 4Q5HA 3CLYA 1DAYA 3HUBA 2YM5A 1RW8A 3OBGA 4ID7A 4D58A 3E8EA 3PG3A 1YI3A 3M42A 5BUJA 5C4KA 1A06A 5I5XA 2NNWB 2W6MA 4O81A 4BCMA 2W7XA 1EKPA 4EFEA 3ACJA 3G5DA 5L2SA 1ZAUA 3NUXA 4N6ZA 4EOMA 1UU3A 5JT2A 5M09A 2Q0NA 4NUSA 5DEYA 4HYSA 3VS0A 3WWHA 4G16A 2VO6A 5GHVA 4IX6A 4IADA 2BAQA 2R3IA 2UW9A 3AMBA 5CU4A 5CVGA 3FLQA 4EK5A 2X6DA 2W5BA 2R85A 3IW4A 3OZ6A 5LXTF 2RFSA 5M07A 3NUAA 5DFPA 2R7MA 4UZDA 3ZM9A 4CVAA 2C6DA 3JZIA 2J0KA 1DIKA 2UZOA 4QRCA 5CEQA 5E8ZA 5DG5A 2A0CX 3SE7A 4F9WA 3MA6A 4WNKA 3W2CA 4K6NA 1UU7A 5EKNA 2X4FA 3T54A 4FMQA 5CZIA 4EK4A 5IUGA 3EQCA 4EGJA 3F5XA 4UZHA 4YNOA 2G9XA 3PPJA 4JQEA 2R7LA 3NW5A 2NPQA 3PVUA 4PDOA 3ZSGA 5IF1A 4TWPA 1B6RA 1CKNA 4J8MA 1CMKE