4O7RA

Saicar synthetase (type-2) in complex with ump/udp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
KAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with UMP/UDP
rcsb
source organism Pyrococcus horikoshii
total genus 74
structure length 228
sequence length 228
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7rA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7rA02
4CFWA 3RPYA 5KZIA 4G6OA 5CVFA 5K3YA 5BQ0A 2IZTA 4JQ8A 4FIHA 3O8UA 5A6OA 4C34A 4HNVA 2Z2WA 1R39A 3A8WA 2Y4PA 4ANMA 1JAMA 2Y6OA 4PUZA 4ALVA 4EH9A 2W1IA 4CVAA 3VBXA 5C1QB 3M11A 5JZNA 5E8TA 2OLSA 2O64A 4MV8A 4MH7A 5FD2A 3HZTA 1F3MC 2BTSA 2AC3A 3PJCA 2IZUA 2OZOA 3H3CA 5M06A 2YS6A 5FXRA 2HK5A 4C3FA 1PXJA 3N9XA 2C0OA 4F7NA 3P23A 3IOKA 2PULA 2DWBA 5HD4A 3OC1A 4XP3A 4MV9A 1HCKA 3BLRA 3CGOA 4AG8A 4E8AA 4ZK5A 2BILB 3PVUA 3ORIA 4EYMA 4YTCA 2X7FA 4GG7A 3JXWA 2CLQA 2HJWA 3T8OA 3ZMMA 2BHHA 4TYHA 1H1RA 3BYSA 2WMSA 3I0OA 3LMGA 4IFGA 1GSAA 4O0YA 5AWMA 4DEGA 4ZLOA 4FK6A 3QZIA 4FZ7A 3CSVA 2X7GA 1L3RE 2R3RA 5HNGA 4BICA 3BRBA 4U81A 1BL6A 2XK6A 3JRXA 1XBCA 5AX9A 3QLGA 5IQHA 2XCHA 3KXHA 3NW7A 4FEVA 3AXWA 3ZZWA 4EGJA 1YI6A 3DK3A 3PXRA 5DR2A 2VTRA 5DFPA 3VS7A 3FMKA 5LWMA 3S0OA 2UZTA 1YOLA 1QPCA 2XNEA 2Y4IB 4Q9SA 5HIDA 3Q9WA 4IAFA 3RCJA 3FLWA 2OJGA 2F9GA 2BMCA 2JBOA 3LXKA 4DFBA 2EU9A 2PYWA 3Q32A 4MD7E 3CP9A 5LWNA 4MWIA 3ELJA 4NYEA 4NK9A 5AV3A 5BVEA 1PK8A 1T46A 3LM5A 5A54A 4HNIA 3R2YA 4TRLA 1NY3A 3CCNA 4QTDA 5E1SA 3U87A 1ND4A 5FBNC 4DCAA 3CTJA 3O0GA 2CCHA 2CPKE 4IAAA 4IVAA 3OWPA 5HTBA 3TUDA 3AMYA 3MH2A 3CD8A 3VHEA 3S00A 4E1ZA 4XBUA 3UE4A 2QR7A 2WQBA 4CMTA 2XKDA 2Z8CA 1XH6A 3KULA 2SCUB 3UOHA 2ZB1A 2WKMA 3DKGA 2PZIA 3QA0A 1XKKA 4AA5A 5C26A 3L9PA 3TJCA 5JFSA 3FQHA 3E3BX 4LI5A 4MV7A 3LFAA 4OTDA 2OFUA 5DEYA 2PZ5A 3IW6A 4AGWA 1YWVA 3CPCA 4XV1A 4MXOA 4XP0A 1YQJA 3EN5A 2ZDGA 5KZ0A 5KMKA 1QPJA 2OW3A 4BDJA 4PMPA 4J71A 2CGUA 1M2PA 4QP8A 3MA3A 2ZDUA 3DB6A 4MNEA 4FSUA 1CMKE 4L42A 4YAJB 3FV8A 3CKWA 5BVFA 2CJMA 3SX9A 3DOGA 4O6EA 3UGCA 3FUPA 4QTBA 3R22A 2ONLA 1O9UA 3HP2A 3RK9A 4AZEA 3ANQA 4Y95A 1B38A 1PXIA 2IW9A 1JQHA 5E91A 4EK8A 2IJMA 3H10A 4QMSA 5DRBA 2UZVA 3KB7A 3PSCA 2B4SB 3Q6UA 1FGKA 3FL4A 3QQUA 4DF3A 3EQIA 1BUHA 5ANIA 4NFNA 5EDRA 3RGFA 2GTNA 1XHAA 5CU2A 1RDQE 1TQPA 1YI4A 2Q0BA 4KKEA 5E8ZA 1XBAA 4GSBA 2J2IB 2WNTA 5LOHA 2PVNA 3QZHA 1MRYA 1OIRA 4YP8A 1KOBA 3FI2A 1IOVA 4CQEA 4W4XA 1LPUA 3V6SA 5L2SA 4QMLA 5BVDA 4GJ2A 2PWLA 3OY1A 1JSUA 2OLCA 1R0PA 2PHKA 4YJTA 4A9RA 5H8GA 4D9TA 4LV5A 3OXZA 3K3PA 2XK3A 1AGWA 2XNMA 1S9IA 3FQEA 5HG8A 1GY3A 3HRBA 1EUCB 5JZJA 1E4EB 2UW6A 3PVGA 4QQCA 4B4LA 3O50A 2W1ZA 2W1DA 3D2IA 5EW8A 4X2FA 1JKJB 1U5RA 3KY2A 4IIJF 3LW0A 4ZHQF 3FLZA 4FICA 4I4EA 4EBVA 3VO3A 4RVLA 1PYXA 3ZBFA 5GIOE 3BWJA 1W82A 3EB0A 3Q5ZA 4JG6A 5EYKA 4JLCA 5C9CA 3W8QA 4HGEA 4EH3A 4F08A 3ULIA 3UG1A 3KCKA 4OT5A 4PL3A 4OTHA 4FGRA 1FQ1B 2J9GA 3G5DA 3R00A 3DNDA 5CQUA 3AD4A 3ZXZA 2F2CB 5EHOA 3HAMA 3HV3A 4AW0A 3RK5A 2V0DA 3VIDA 3FHRA 2B0QA 5L6WL 3CY3A 3C0IA 2R3IA 3O23A 4U0IA 4RIYA 4YZBA 5HBEA 2P0CA 5HIBA 3GI3A 4BCMA 4HYUA 3BYVA 2UUEA 3OFMA 3UOJA 2FPIB 2YZNA 4JDIA 4BI0A 1O6KA 4NM5A 5H80A 2WMUA 3CD3A 1KE8A 4F65A 2QI8A 4H36A 5A6NA 4G9RA 4X3JA 4F99A 1RE8A 4IM0A 4ZOGA 3RV4A 5BMVF 1U54A 4YZDA 2PU8A 1Y57A 1FVTA 2JAMA 4C4EA 1UNHA 4G3CA 1CKJA 1K2PA 3PWDA 5EK7A 3GUBA 4L6QA 2Z7SA 3SKCA 2H96A 4EWHA 2RGPA 2W6QA 2C6EA 2XVDA 4NCTA 4YJPA 4MYGA 3FPQA 5E8UA 2W4KA 3QFFA 2OZAA 1URWA 1JNKA 4IZ7A 3VBTA 1KWPA 3ZSGA 3UO5A 1M0TA 2GQGA 1YXUA 2R3QA 3QTWA 4S33A 4C02A 4E4NA 3RPVA 3MVMA 2VU3A 4U3YA 1PKDA 4XG9A 1CKPA 2C47A 3QALE 4DGNA 2VGPA 4BDEA 4FG9A 4EQMA 3WARA 2R7NA 4P5QA 3CS9A 2UW8A 2YZLA 3CJGA 3IQ7A 4DLJA 2W70A 4FV9A 1YXXA 5KO1A 3E7OA 4LFIA 3RP9A 5M4UA 1R1WA 4O91A 5D10A 2WEIA 3PA5A 3UODA 5A4QA 4FTNA 2BZHB 2R3OA 3LHJA 4RIXA 4HCTA 5IUGA 2ZOQA 3ET7A 4I22A 5JQWA 1OUYA 1RQQA 2FSOX 4F1OA 3R5XA 3PXZA 4L44A 3M1SA 2R9SA 5J2TF 1DIKA 2CN8A 3C51A 3FLNC 3S4QA 5K9IA 2BROA 4HJOA 1PYEA 3QQKA 5EYCA 5M55A 4ASDA 1YXTA 1WCCA 5D8DA 1HOWA 2QCSA 2BAJA 3K3JA 4OBOA 4DFYA 4XV2A 3VBWA 3R73A 2NUAB 2WMXA 1FGIA 1W7HA 4AS0A 5KMOA 5IEXA 4FV7A 4YZCA 3ORQA 2DZDA 2X1NA 5HX8A 2HCKA 4AW2A 5CAQA 4A9UA 5LOVF 1YHVA 1G8SA 3EZRA 4TTHB 1SNUA 1Y91A 4IZAA 3SRVB 1PY5A 4A4LA 2ZV2A 3EL7A 3ORMA 4DIMA 1S9JA 5A4TA 3I6WA 5EI8A 1OKZA 3H0ZA 4FSZA 2IW8A 2YHVA 5JKGA 4F64A 2R64A 2E9OA 5EW3A 4FYOA 5IA0A 5FEDA 2ZB0A 4RC2A 3RPOA 4OTGA 2Z02A 3GOPA 4E6DA 4GK4A 2ZV7A 1ZY5A 2XRWA 3MDYA 2PVJA 3OTUA 1BMKA 3CE3A 5CAOA 4RZQA 5IQEA 2BKZA 3CQEA 3HV5A 3NDMA 2JLDA 4CD0A 5K4JA 2GPWA 2YS7A 4E93A 3PZHA 2YJSA 4O21A 4TYJA 4ZSJA 4FNZA 1WAKA 5DG5A 3DBEA 4G16A 4YHTA 4ACMA 4TT7A 5AP2A 2REIA 3KMWA 3MTLA 4ORKA 3NIEA 3NYOA 3VN9A 5IQCA 4U6RA 3U6IA 3AG9A 4C5CA 4IH8A 3QKMA 3BX5A 4EK4A 3I6UA 4H3BA 2BZIB 3CR0A 2WQOA 3QXPA 4EOLA 4GUBA 2BRHA 4LOOA 4XG4A 5JH6A 5CAUA 3TZ7A 5DT4A 2IVVA 4HW7A 1UNLA 1YDTE 4NH1A 3QD3A 3ZFYA 2B55A 4JNWA 4ASZA 2JFMA 1XH4A 4BB4A 5IA4A 4FKJA 1CE8A 3ZZEA 4I55F 4DEDA 3LXLA 1SYKA 2QODA 4NM3A 3UP7A 1FPUA 3SC1A 4C0TA 3UZTA 3DU8A 3NUNA 3QBNA 2DWCA 3IW7A 5GNKA 4MQ1A 2ZAZA 1YRPA 1MQBA 4IJ9A 3C7QA 4GH2A 4TY1A 4JBOA 5CYIA 4DH7A 3FKNA 3RM6A 3T9IA 4RVTA 3W1FA 2YIQA 4FTCA 4LV8A 3GT8A 2ITNA 4YLKA 4Y73A 2CKQA 4FKWA 3ZLWA 1ZWSA 3MESA 4YHFA 3H9RA 3P7BA 4CG9A 2ZM3A 3GNIB 5AP6A 4PQNA 4E20A 5DA3A 5E92A 4EK5A 1EHIA 2A0CX 2JFLA 3LMIA 4FODA 1QPEA 3V5LA 4A9TA 4AZVA 4USFA 2VTNA 4MNFA 4WNOA 2JDRA 4ID7A 5ACBC 4LL5A 2QD9A 3G8DA 4D1XA 2UW5A 2XIZA 3ERKA 1K3AA 3ORKA 4NKSA 4H1MA 3NMUF 3DLZA 4U9AA 3V4SA 4JG8A 2EXCX 3AOXA 2WPAA 3UZPA 4QMOA 2HXLA 3OEFX 2UZDA 2BKKA 3VAPA 3BHUA 3R23A 4C59A 2QNJA 2Y6MA 4O0XA 5LCJA 1W83A 3C0GA 2CNQA 1Q3WA 4ITHA 4LQMA 5DI1A 3UPXA 3RFCA 2XIXA 3DFAA 3RVGA 3TV4A 4EZ7A 1MRVA 1OGUA 3QKKA 2PMNX 3MPAA 1EYZA 1Z9XA 3R1SA 2PVFA 4FMQA 4H3PA 1WBNA 2BZKB 4RIWA 2R3HA 4IJPA 3Q2MA 4D4YA 1OI9A 4XYMB 1M7QA 4B99A 4USEA 3PE2A 5AFVA 5CB4F 4U40A 2GNFA 3D94A 5JGDA 1RJBA 4PMSA 2C6DA 3FC2A 4QP1A 1QPDA 4C38A 2IW6A 4G3DA 3F2AA 3ULZA 3QD2B 2YDKA 3V6RA 4QMMA 3TZ8A 3DBDA 2GFCA 1EH4A 2PVLA 3PXFA 4R3CA 5B2LA 4BCIA 2XCLA 4XRJA 2GTMA 4JR3A 1CQIB 1H0WA 1JOWB 1ZOHA 3LE6A 4UYAA 4CZUA 4DTBA 2PVHA 3DGKA 2XK8A 5E8SA 1DM2A 5CAEB 1Q41A 4PNIA 4XOZA 4X6QC 4I41A 3UNJA 3JVSA 3PJ2A 4LRMA 1PW2A 4CRSA 2XZSA 3NX8A 3FMMA 5DGZA 4DITA 3DA6A 4G5PA 4CKIA 2VD5A 3S3IA 4CT2A 2YFXA 5ETCA 4BZNA 2I8CA 5C03A 3CPBA 4JOAA 4AWIA 3AC2A 4F9YA 2BUJA 3KF7A 4BCHA 4R78A 1AUVA 3ANRA 4R3PA 2QO9A 3EQRA 4B0GA 5JQ5A 1J1CA 3R83A 1CM8A 3I1AA 3LCSA 4CLIA 3RHXA 1IG1A 3NCGA 5C8YF 3PWYA 5HCXA 2C5VA 2H34A 2VO0A 4F1MA 5K5XA 1Q24A 2XUUA 4XJ0A 2H8HA 3F3WA 5M44A 3WO1A 2VWBA 2NP8A 5BUJA 3KCFA 4AUAA 5A4LA 4O4IF 3EZVA 4XUFA 3IW4A 5KMJA 1C30A 3R0TA 4OR5A 4DGGA 2OXXA 3OT8A 2J5FA 4MVFA 5DHJA 3TNHA 3UO6A 3R5FA 4TV9F 3ACKA 3KA0A 4FG7A 5ANJA 4I21A 3SG8A 5M4FA 3TNIA 2OIQA 1KEEA 2G1TA 5B2KA 4C3PA 2GNHA 4PF4A 5CT0A 3TINA 2A1AB 3EOCA 2QU6A 4UEUA 3TNQB 3R7UA 3PA3A 1WVWA 2C6LA 4BCNA 4FKIA 4YSJA 3HB9A 4JBPA 5JN2A 5IF1A 2XYUA 4EH5A 3O71A 4EC8A 4JDHA 1Q61A 1YDRE 2E9UA 2J7TA 2P4IA 4WG4A 4TW9A 5HI2A 2VTIA 1PXNA 4AZTA 5BPYA 2JD5A 2P55A 4X2NA 1UU7A 4YMJA 2NU9B 3SW7A 3MJ1A 3FXWA 3O96A 4FFPA 2HZ4A 2R3FA 4BCPA 2HELA 1Q8WA 4QP4A 3OCBA 3E8CA 3TXOA 4GU6A 4LG4A 4L7SA 4IB1A 4HVDA 3COMA 2E2BA 3AMBA 3HRFA 3KEXA 1ZAOA 3QCYA 3SGCA 5AMNA 2F7ZE 1OPKA 1H28A 4XBRA 1JWHA 4F9WA 3FE3A 5BNJA 2R3NA 3MWDA 4P4CA 4LRKA 4ITIA 3PY0A 3PXKA 4BCGA 2I1MA 1H26A 3ORLA 1F5QA 3GCSA 4IWOA 3MSSA 4AA4A 5CEOA 1KUTA 4KKHA 4AGCA 4IE9A 3LJ0A 4O7NA 3LIJA 2YM7A 4YC6A 4R7HA 4MBJA 3QTSA 3RPSA 1B39A 2E9PA 3UC4A 4YJOA 2ITPA 2JKMA 4WUAA 5IQIA 2X6EA 4EKLA 3MWEA 3TKHA 1KJQA 4TNDA 4I94A 1ZARA 2WQNA 3NNXA 4FIFA 4PL4A 2XNBA 5H8EA 2C5YA 3EFWA 2KTYA 4C5AA 4FZAB 3Q4ZA 4XRLA 5DNRA 3VBVA 2RFEA 4FGBA 3A7FA 2OH0E 2ETRA 3C4FA 4NUSA 5LMKC 4HCUA 1ZZLA 2QURA 3FEGA 5EQPA 2VTMA 3EIDA 3ZUVA 1BXRA 4YBJA 4LUEA 4CV9A 5IA2A 4ZS4A 4O7TA 4EORA 4ZSLA 5HLNA 1NT2A 4FSTA 4Z9LA 3ACJA 4AAAA 1JLLB 1PXMA 3IDBA 3C1XA 2BAQA 3VRZA 4G6LA 3PXYA 4RT7A 1VBGA 1WBVA 2A4LA 5I9ZA 3HP5A 2BDJA 5CI7A 4I5PA 1WBOA 4IW0A 3ZTXA 4DT8A 4ERWA 5AP1A 4IIRA 4PDYA 5A4EA 3AQVA 4LM5A 2Z04A 4FKQA 3UVPA 4BIDA 5LVMA 1LR4A 2PL0A 4LOQA 2O63A 3IECA 4YZMA 4XCUA 1IRKA 1BI7A 3I81A 3MFTA 4FUXA 5BYZA 1XJDA 2QG5A 1QL6A 3E8NA 4AOJA 3MJ2A 3C0HA 3NW6A 2PN1A 4FIJA 1U4DA 3FLQA 3FZTA 3KN5A 3FLYA 4MHAA 5AUYA 3V5TA 3SXSA 3V8SA 5LQFA 2WMVA 1APME 2BTRA 5GHVA 2YIRA 2R2PA 3ORRA 3BG5A 2YERA 1OL2A 4L43A 1UU3A 3P79A 3N4UA 4IEBA 3I7BA 5EYDA 5E1EA 3BU5A 3A62A 4HPTE 4ZTQA 4K0YA 3TI1A 3IG7A 4IWQA 5GJFA 3F7ZA 4AT5A 4DE4A 4XLVA 5EM7A 2Z7QA 5LXTF 4GUEA 3TUCA 1WR2A 2VX0A 5HU3A 2GHLA 4L9IA 5BMMA 4YO4A 4D1SA 4ENXA 2VX1A 4FKUA 3QF9A 4S32A 4YLLA 3WZJA 5KX5F 3LFNA 4R1YA 1OPLA 5ANKA 4WUNA 3MN3A 5J9ZA 2QF7A 1BI8A 1XH8A 3MFRA 3PRIA 1VR2A 3QQGA 4IADA 4QMPA 5E8YA 4D28A 2ITTA 5HBJA 5EOBA 2GS2A 5TO8A 4FI1A 3SDJA 2B53A 3K54A 3VJNA 4QYYA 4F6UA 4YPDA 1P14A 4FNYA 2EB2A 3A7JA 4FZ6A 2YDIA 2ONLC 3V01A 3WYXA 4KIQA 2YEXA 5D9HA 4WBNF 3VS4A 2PTKA 5DYJA 5J87A 1L8TA 2I0VA 2ZMDA 2DYLA 3GCUA 4F6WA 4FTAA 5JEBA 1Z57A 2OXDA 3FL5A 3QZFA 2G9XA 4O0TA 4DFXE 4YJ2F 3UIMA 4BDAA 3RK7A 2VNYA 3HEGA 3DBFA 3QTIA 4FKSA 3SD0A 5J9LA 4DTAA 5EZYF 1PXKA 4L68A 2PUIA 2J9MA 3BYUA 3DQXA 4M15A 5T3QA 3V51A 4F0IA 1KBLA 3G51A 4O38A 4CT1A 3F3ZA 2XEYA 2UZNA 2FB9A 3E8EA 1OIUA 5L8KA 4TPTA 4KBKA 3JZIA 2HY0A 2JAVA 4YTFA 4KNBA 5AUXA 4MV1A 2BVAA 3R1YA 5AV2A 3EFKA 5J2UF 4N6YA 2WMRA 5CXHA 3NCZA 3VA7A 4ASEA 1YWRA 1Y6BA 3L9NA 1MP8A 3NNUA 4DH1A 4E26A 4DTKA 1GSHA 2NU6B 4XG2A 4V0GB 2W1FA 4ANQA 2OIDA 1IA8A 2ZMCA 1NVQA 4QTAA 1OUKA 3IDPA 3RMFA 3WE8A 3DF7A 4MWHA 4I6FA 4NIFB 4DHFA 2YITA 2W5HA 3KKVA 4FC0A 4QMWA 2FSMX 4DG3E 3DS6A 4N70A 2CZGA 1R0EA 2C6TA 2YDJA 1UU8A 1Q4LA 2J0MB 2WMTA 3P7CA 2A19B 3QYWA 2OXYA 4JL9A 3QRKA 3OROA 3MH0A 3ZU7A 1M2RA 4O7LA 2P2HA 4WA9A 4FTRA 4BTJA 3E5NA 5IDNA 2GS7A 4K2RA 3W33A 5CSVA 1GIJA 5M4IA 3HGKA 4Y8VB 4QP6A 3K5IA 4RFYA 4ZZOA 3GC8A 4GYIA 4CV8A 3TZMA 3AT3A 3BHYA 2UZBA 1LEWA 1IA9A 3IDCA 4OBQA 1YI3A 3COIA 3KRJA 4CFXA 3AX6A 4R5SA 3VUHA 5KKNB 4MAMA 2J0LA 3FWQA 3PPKA 4I24A 4R77A 4YNOA 3K3IA 3N6RA 3QGWA 4MXXA 2XK7A 5CF6A 3P4KA 3R9OA 5B2MA 3C5IA 2VZ6A 3WNZA 3FY0A 2BR1A 2BPMA 3BHTA 3LZBA 3ZFXA 4FV5A 1KJ8A 2R82A 3GLKA 2YCSA 4BRXA 4ANLA 2OO8X 3WZEA 2R7LA 2YA9A 3A7GA 3FZOA 5LVNA 5FUTA 4JX7A 4NCTC 4PV0A 3QTQA 3EN4A 3KXXA 4I6HA 3MVLA 5AP3A 3E64A 2ITQA 4RQVA 3TV7A 4E5WA 4Z16A 3SA0A 3K5HA 3R1QA 5JK3A 4RZVA 4YZ9A 1E4EA 4G3FA 3QD4A 3R28A 4RVMA 3AW8A 4RLLA 2XNNA 4JRNA 3OWKA 2VTHA 3F82A 2AC5A 2RKUA 4XHKB 4E6AA 3A4OX 3NVMB 2C5NA 3MVJA 3R9RA 3UG2A 4B9DA 2P0AA 3F5UA 5JMSA 2BHEA 4R5YA 2HZIA 3C4WA 3KXZA 3D5UA 3QWJA 4AE9A 3LAUA 4FV8A 3V5QA 3WF9A 4XZ3B 3L8VA 2H9VA 2HW6A 4ZIMA 3MIYA 2X2KA 3KXMA 5DR6A 4RWKA 3FI8A 1KC7A 2YM4A 2OF4A 3HMNA 1SZMA 5DE2A 4NTSA 5DR9A 2FPPB 3IW5A 3Q9ZA 4RX7A 4IACA 3NWWA 2GS6A 2WIHA 5ANEA 5EI2A 3H9OA 3U55A 1M52A 4GIHA 2BFYA 3NUPA 3EN9A 3QUPA 2ZDTA 1KSWA 3BQRA 3ZDUA 4C4GA 4CRLA 3E88A 2I40A 3F3UA 1OKYA 2V22A 4W8EA 2Z60A 3V04A 5J7HA 3VBYA 4BCJA 4NT4A 2R7KA 4A4OA 4RWJA 1P4FA 2X7OA 3L9MA 3QQFA 4FIIA 5ANGA 2G15A 3SQQA 1PF8A 2B1PA 1TQMA 2W1EA 4MBIA 4O22A 2WEVA 4GV1A 4IB3A 1GSOA 4YJSA 2QOFA 4KSQA 4NM0A 3A4PA 5GJGA 2IN6A 5C27A 3UOKA 4AGUA 1PKGA 2R0UA 5EDPA 4BDCA 4DG2E 1G8AA 4CTBA 2JEDA 3QUEA 2J51A 3GCPA 4FV0A 2WFYA 5JGAA 2RFDA 3PRFA 3V8TA 4DGMA 3BGZA 1JSTA 2YACA 3G6HA 4DT9A 4WNKA 2OJ9A 3P5KA 3NNWA 4C2WA 4Q9ZA 1M6VA 3Q4TA 2OH4A 3ZC5A 4QOXA 5IQBA 2J4ZA 5HE3A 3F3TA 3UVRA 3V5JA 4NFMA 3NRMA 3ZUTA 4FL1A 4HNFA 3VS1A 4MA5A 2WOUA 4BDIA 4EZ5A 5FM3A 2O8YA 3I60A 2C6IA 3BV3A 4QP3A 3NUUA 4EI4A 2AYPA 3UPZA 2CLXA 3UC3A 2X39A 4EK6A 3TIIA 5M51A 5KNJA 3N8DA 3BCEA 1W84A 3MB6A 3DXNA 4D2RA 4DFUA 2XB7A 3DDQA 3VUGA 4A4XA 3LM0A 3S95A 1KE5A 4KABA 2NRUA 3VW8A 4IQ6A 4XYFA 5FTQA 4EHEA 4F09A 1PMUA 4HVGA 2A2AA 2EB3A 3HUBA 1WMKA 4OTFA 4PL5A 3ORZA 1OPJA 4BTFA 1OITA 4FT3A 4O84A 4ZJJA 3PP1A 1O6YA 2W7XA 5CEQA 4DBNA 5AUUA 3DBCA 2V62A 1G5SA 4KWPA 4Y46A 5L6OA 3S1HA 2YL2A 2IVSA 3HLLA 2VWVA 3LQ3A 5FRIA 4BTKA 3BKBA 3JYAA 4P5ZA 3FI3A 2HIWA 3UMXA 4Z3VA 2HWPA 2YRXA 1DS5A 3BBTB 3VS5A 1W96A 4II5A 3G33A 2YAKA 4IX6A 2XIKA 4M0ZA 4E6QA 5AJQA 3G0EA 4D0XA 3HX4A 3ZEPA 4ITJA 4RGJA 4NL0A 5EYMA 5CF8A 4U97A 1LUFA 3SRVA 1M0WA 3DV3A 3V5WA 3NUSA 3PG3A 1ZYCA 1UU9A 1KJJA 4ONAA 4MKCA 2PE0A 2VTSA 3DXPA 3GENA 4F1TA 4AU8A 4QMQA 3P7AA 3HO8A 2C4GA 3ITZA 2VWIA 2XM9A 3F3VA 3ORPA 3NW5A 4KKGA 4NKAA 2JGZA 4G3GA 3FY2A 2VRXA 4WKQA 3G9NA 5CEIA 3LFDA 4L45A 2R84A 2XKEA 1PMNA 4P2KA 3PJ1A 2J90A 2VO6A 5IA1A 1LEZA 3QCXA 1YOJA 1WBSA 4RWLA 3I0QA 3FYKX 4AN3A 4UB7A 3NLBA 5KKRC 2WGJA 3DJ7A 1JDEA 3E62A 4QTCA 5EFQA 4EUUA 3SAYA 5KHWA 2GFSA 2QKWB 4MXZA 2X8EA 3EQPA 3W2PA 4TN6A 1XR1A 4I4FA 4G9CA 2WQEA 3C4ZA 3WI6A 5BMSA 1R78A 3R71A 1PXPA 2OJFE 4MK0A 4YTHA 4J1RA 5IQAA 2WTKB 5D12A 5C4LA 1CS0A 2IPXA 3VUMA 4EBWA 5E90A 2PSQA 3WYYA 1Q8TA 1H0VA 4YTIA 1OKVA 2ETMA 3UO4A 3R8VA 4NSTA 3QRUA 5LVOA 1FBNA 3ETAA 3LFBA 4M7IA 5HLWA 4NM7A 3D9VA 3WILA 3PYYA 2ERZE 2PMIA 1R3CA 2PUNA 4DG0E 4AZFA 4JR7A 4EJNA 1OL7A 4DC2A 2BZJA 3HKOA 4LGGA 4TYGA 3HMMA 3O8PA 2VO7A 4FIEA 4N0SA 1J7LA 4OLIA 5HHWA 3REPA 2PMOX 5C8KA 2W99B 4J96A 3CGFA 3FBVA 2VNWA 1PMEA 4I93A 4KUJA 5DVRA 5H9BA 4EOKA 4ALWA 3U6HA 4FTKA 3HA6A 2QO7A 4FU0A 2WMBA 2XNPA 4AOIA 1Y8GA 3OXTA 3F61A 2CCIA 2XNGA 4OTRA 5AM7A 2PE1A 4AFEA 4FTJA 3KRXA 3SG9A 1SVGA 2GPHA 3FLSA 3CEKA 4IM3A 3BE2A 5F20A 3MPTA 4FVRA 1J7UA 3ATTA 5ANOA 2I6LA 3VS0A 4D4RA 4D1ZA 3QQLA 3DY7A 3LKMA 4BDGA 3OS3A 4Z7HA 3BHVA 4FSWA 2VQDA 3FYJX 3JPVA 3I79A 4JAIA 2C6OA 4HCVA 3DTCA 5IA5A 2QOBA 4F4PA 2OGVA 1VJYA 1XQZA 2IO6A 4YJNA 4FKVA 3D83A 3FI4A 3VWAA 3WF6A 3HECA 3WOWA 1CQJB 1W0XC 2JIUA 3U9SA 3DZQA 4J8NA 3MGYA 4F7SA 5HX6A 4EC9A 2QK4A 4S34A 4WIHA 2R5TA 3COKA 3JVRA 3R7YA 4ENYA 1E9HA 2VTQA 3QD0A 4JQ7A 4E4MA 2W4JA 4MF1A 5AAGA 2CHLA 2A27A 4TL0A 1VBHA 4XG8A 4NZWB 4ZTHA 3KAJA 4I20A 4KD1A 4CFMA 5FBOA 2OKRA 2J0JA 3VF9A 3GQLA 1OBGA 3UQCA 5DH3A 3HV6A 3OTVA 4FTUA 1SVEA 5CZHA 2G01A 5IZFA 4E73A 4JJRA 4UV0A 3VOTA 4ALUA 2PK9A 4RQKA 3E87A 3ZH8A 3ODYX 4ERKA 2ITYA 1GNGA 2XF0A 2CN5A 4I92A 5I9YA 1IEPA 1W93A 3TEIA 3WIKA 1PJKA 3U54A 4WG3A 2HZNA 4IX4A 5AA9A 2EWAA 4EL9A 3ZSHA 1H07A 5EKNA 2BRBA 3B2WA 1BL7A 4S30A 4G3EA 5GONF 4X6RA 5EG3A 3OOGA 3RAWA 1H25A 4QPSA 2YISA 3TT0A 3HVCA 1H24A 2J0IA 2J0KA 3V5PA 3DAKA 4JG7A 5CSXA 3LMHA 3AC3A 1WVXA 3F69A 2G2IA 5J1VA 4HNTA 4U44A 4CTCA 5EM5A 3NUXA 2FGIA 3KRRA 2UW3A 2X0GA 1T36A 2WTDA 2F2UA 2ITXA 4O0SA 5BUIA 3HMIA 3THBA 3MYGA 4AN9A 4EOOA 2JBPA 4QT1A 4QSHA 2WIPA 3WBLA 2CGWA 2XBAA 2XIYA 1DI8A 5DPVA 3OCTA 3QRTA 4FEWA 3TNWA 3ZXTA 1JKLA 1XWSA 3B2TA 3QRJA 4ZP5A 5DRDA 4FFLA 4B8LA 4C4JA 5DIAA 4A9YA 3V8WA 4AXAA 4PP9A 4CLJA 3W55A 3W2OA 4H58A 4AOTA 3R8PA 5JFXA 4AZWA 1CDKA 3GEQA 4BHZA 1Q8YA 2G2FA 2Z7RA 4R7BA 5ICPA 4O2ZA 5D7AA 3AGMA 3RTPA 1P4OA 4J8MA 3GU7A 4OUCA 5E9EA 5CEPA 3CC6A 2IP4A 3DLSA 4YJVA 4E6CA 4YBKA 3FJQE 2OIBA 3GCVA 3G9LX 3MS9A 5CAVA 3OP5A 4ZZNA 5IEVA 4L67A 4RMZA 2NPQA 2EUFB 2WU6A 2BIKB 3KREA 3Q52A 3KRLA 3P1AA 1UV5A 3QGYA 3UNKA 4WT6A 4O27B 3ZOSA 4I0RA 3UYSA 4EG0A 3ODZX 5B7VA 2G2HA 1WFCA 4X3FC 2FPGB 3FXZA 3R7OA 4AE6A 1GZKA 2BRMA 3QA8A 5CA1F 4BCFA 3KFAA 3TM0A 4ARKA 3ZRKA 4BDBA 4CFNA 5M09A 4IDTA 3RWPA 1H1WA 4EHZA 2C6KA 3RPRA 3QCQA 2W6ZA 1Q8ZA 5JGBA 1W98A 4KINA 1VZOA 4FOBA 3UQFA 1GOLA 5BYLA 3RAHA 2R0IA 4GFOA 3HNGA 3VF8A 4CCUA 3ZO2A 2WXVA 2FYSA 2V5QA 3D5WA 5LP6F 1UKIA 5KMMA 2GU8A 3LLTA 5HG7A 4L52A 4UBAA 3Q96A 4RJ4A 4FSNA 4E4TA 1FVVA 1Y6AA 3GC9A 5CSWA 5CT7A 1E1XA 2X8IA 1BYGA 2GNGA 2VTAA 3QKLA 3ZM9A 4EKKA 3PLAE 4YO6A 1P5EA 2BIYA 2OF2A 2YIWA 3H9FA 3HUCA 2XJ0A 5E8WA 5J8IA 2YYAA 5C1OA 1DI9A 5HICA 3LQ8A 1BLXA 2Y7JA 2FP4B 3POZA 3GC0A 5C8NA 1MRUA 4IFCA 1LP4A 2X4FA 4QPAA 3UDBA 5TKDA 2Y4IC 4OW8A 2OBJA 4WD5A 5TR6A 5CWZA 2B54A 3PJ3A 4K33A 4O7RA 4RJ6A 3C13A 3Q4UA 4GS6A 2P2IA 3G2FA 5IQDA 3HV7A 2C00A 3R8UA 3UVQA 4BKJA 2W0JA 4O83A 4FBXA 2X81A 5JQGF 4GL9A 4EUTA 4IZYA 3U51A 3EYHA 3R6XA 5CNNA 5EM8A 4DBXA 2V58A 3HRCA 2R3JA 3VQUA 3DDPA 3KVXA 5KMLA 4XX9A 4M8TA 2Z7LA 3ZDIA 4HQ6A 4W4VA 3VS2A 4JIKA 3EWHA 3CTHA 4QP7A 2QVSE 3OCSA 3BWFA 4EQUA 4MXAA 1A06A 5IH4A 5HQ0A 4MAOA 2R3LA 4U8ZA 4JS8A 3OVVA 2OJIA 4FSQA 1SMHA 2RFNA 3DCVA 2ITOA 4BCQA 3BI6A 5KMNA 3MWUA 4OTIA 5FNVF 4XS2A 3KXGA 4AT4A 3EKNA 2IG7A 4M3QA 2W5BA 4MEDA 3E63A 5LJJA 3ORXA 3F5GA 3QU0A 3R8LA 5A4CA 4G2FA 4Y5QA 4FYNA 5AP5A 3C4CA 5JFVA 4FTMA 2W1CA 1FOTA 4F9AA 2W6NA 3C9WA 4JQEA 4PDOA 5M08A 2WTVA 2ZM1A 5DT3A 4ZQIA 4ZMFA 2XD4A 3QC4A 3EKKA 1ZYJA 5GJDA 4BN1A 4M68A 2JDSA 3TG1A 1JSVA 5DOSA 3VUKA 4ZLYA 4RWIA 4GT5A 3C50A 4N6ZA 2W17A 1AUXA 3AD5A 2ACXA 5EQYA 3TQTA 4D4SA 4PX6A 1AD5A 4FG8A 5H2UA 2ITWA 1XH7A 4M13A 4O0UA 2XIRA 4AW5A 4FV6A 2ZVAA 1H1PA 1OL5A 2FSTX 2BAKA 4FV1A 4MCVA 2QOQA 1GJOA 4J98A 4HGTA 1GIIA 4UWCA 5HVJA 4BR3A 4DGOA 5CAPA 5JVLA 5JRSA 4FK3A 2ETKA 2VO3A 3VW6A 3KAKA 4I5HA 4M84A 3R7IA 3UNZA 3PVBA 3R63A 3PY3A 3QQJA 4FT5A 4YLJA 3U4WA 4HVHA 3BYMA 3W18A 5AUWA 2I87A 4U42A 4U80A 1BKXA 4ZJIA 5BVOA 4V0GA 4HZRA 3MBLA 4G1WA 3ZRMA 1PHKA 4HYHA 3IO7A 3KGAA 3M2WA 3QQHA 4K77A 2W6PA 1YWNA 5AV1A 1CSNA 3LCDA 4JIAA 1XBBA 3QUDA 4O81A 3V3VA 2BDFA 1J7IA 4OTWA 2OJJA 3VS6A 2PUPA 3NYVA 4MV3A 4I0SA 4CFUA 5M57A 4XG3A 1I7NA 4H05A 3OW3A 4ZEGA 4PY1A 2EVAA 4EOMA 3E8DA 1IASA 3L9LA 3DKFA 2J6MA 4FE2A 2PZRA 4XV3A 2OU7A 4XLIA 4WRSA 4FT7A 2V7AA 4RFMA 3AD6A 4TZRA 5T68A 4CCBA 2W71A 3ENHA 1WBWA 3KK9A 2B9HA 3KC3A 4LUDA 5FGKA 3W8LA 3G6GA 3LQ5A 5HORA 5BPFA 1KV1A 4FV2A 4FOCA 4RVKA 4QO9A 1C3OA 1FVRA 1GGOA 5DMXA 2VTJA 3F2RA 1YXSA 1ZY4A 1Q3DA 3Q60A 3T9TA 3D2KA 4BIEA 3BHHA 3VBQA 5I4NA 2WB8A 2B7AA 4MTAA 4C4HA 3FMJA 1EUDB 4PTCA 4UN0C 5F94A 2XJ2A 1V1KA 2FUMA 2WO6A 3Q5IA 5CU3A 2XKFA 4GCJA 3QTRA 1YXVA 3SV0A 4FT9A 3VMMA 2YIXA 2XP2A 4ZTMA 3SXFA 4XX0B 4MD9E 3UIUA 3H30A 3C5UA 2C0IA 4WO5A 3TDWA 3WF5A 1IOWA 3ZLYA 4D0WA 1KJ9A 4F6SA 4ZZMA 4QYFA 5AADA 2XK4A 4MX9A 4TYIA 1FMKA 3COHA 4DEHA 2XRUA 1Q62A 4AFJA 3W2RA 4M69B 1ZLTA 2C3KA 2W96B 2C3LA 3HA8A 3KK8A 3MB7A 3NEWA 4TYEA 1FINA 5FEQA 4EEVA 2OFVA 2W9FB 4JBQA 3KALA 3K5UA 3TNPC 2P3GX 2QOIA 4AP7A 3RAIA 4IAZA 5TOZA 4F63A 3OEZA 3ZC6A 4FKLA 4X2GA 2VTLA 3NAXA 1SNXA 2GHGA 1FMOE 2QHNA 3PSDA 5CASA 5IISA 3GU6A 4LYNA 2EXMA 4RJ3A 4EZ3A 2O0UA 5H8BA 4ZLZA 2QKRA 1U46A 4WBBB 5J9YA 4QMZA 4RJ8A 1YHWA 1OBDA 3QC9A 3FKLA 3P78A 5TF9A 2O2UA 3D4QA 3ATSA 1SM2A 4C33A 3GXLA 1B6RA 3HBLA 5L2WA 3QFVA 4KS8A 3MA6A 5EH0A 4F0GA 4L8MA 4TWPA 3NIZA 4GKIA 4PWNA 4APPA 5DLSA 3RUPA 4P90A 4YJ3F 3OUNB 5CSHA 2QG7A 4HYSA 1GZ8A 1GAGA 3CTQA 5FP6A 4BYJA 4O0WA 2GSFA 3FQSA 3PTGA 4JI9A 4QMXA 1B6SA 1ZMVA 4DEEA 5HE2A 1DV2A 1IAHA 3ETJA 2X8DA 1M2QA 1JBPE 4ZTLA 3TWJA 2CKPA 2R3KA 3NSZA 2ZDQA 4MA0A 2W9ZB 5ETAA 4J95A 3ZO4A 1PRYA 2V7OA 1J1BA 2BDWA 3BU3A 4F9BA 3CQWA 4ZY5A 3W2QA 4Z7GA 3OUZA 2HAKA 1P2AA 2R7IA 1DAYA 3TCPA 5JVDF 3UMWA 3R2BA 5CNOA 4EH8A 3BZ3A 4FIGA 4X2KA 1VKZA 3G90X 3BIZA 1I7LA 3CQUA 3GP0A 4FL2A 2VWUA 4FUYA 1OIQA 3VS3A 2YABA 2ITUA 5IH6A 3D0EA 5HCYA 4FKOA 2JDTA 2QQ7A 3H0YA 2WTCA 4G17A 4M97A 4YJUA 2X6DA 1H1SA 3A60A 3IW8A 4FNXA 1OIYA 1TVOA 3RAKA 4ACHA 3DPKA 4R6VA 4AN2A 2XNOA 3F5PA 2HWOA 5AV4A 5K4IA 4YUQA 3PIZA 2QOHA 1H01A 2JITA 4FKTA 4GJ3A 4O2PA 3ZRLA 3GU5A 4E5BA 4U79A 4JAJA 4FR4A 3BYOA 5G6VA 3OCGA 1H00A 2VX3A 3DKCA 4IWPA 5IEYA 2R7BA 2YIYA 3EHAA 3NYXA 2VAGA 3Q4CA 2VWZA 5F95A 4K1BA 3EN6A 4LMUA 4NW6A 4UWBA 3GVUA 5DT0A 3UTOA 4BI1A 4DEAA 4FV3A 4ACCA 1H27A 2NO3A 4L00A 4OTQA 3Q3BA 4O2AF 3FZSA 3O51A 4TWNA 3OXIA 4GVAA 3AC1A 4X3FB 2CDZA 3UQGA 4IZ5A 3U9NA 1HCLA 1KE6A 3LVPA 3QL8A 5JH7F 3D7TB 4FA2A 3FAAA 4GFGA 4O4LF 4IVDA 5DEWA 4Y83A 3Q9XA 1UKHA 4CMOA 5FLFA 5BUEA 4GRBA 2KULA 3Q2OA 3F2NA 3QTXA 4JDKA 5LMKA 3R02A 5LXMA 4ZSEA 4IHPA 3N4VA 4M0YA 4C36A 2VWXA 3L8XA 3PDTA 4M9UA 2JKQA 2R3PA 5JRQA 2YCRA 1GLVA 3TTIA 2WU7A 2XA4A 4YJQA 2YM8A 3MFUA 2YWPA 2UW4A 2WTWA 2X4ZA 5LVLA 4YNEA 2QR8A 2XCKA 4U5JA 3MFSA 1I09A 1JPAA 5C8MA 4H3QA 5JT2A 3BQCA 4GYGA 3E92A 2R86A 4JXFA 4YURA 3G8CA 4C61A 1UNGA 4L3PA 3DZOA 4IANA 5CXZA 5LVPA 5KE0A 4UXQA 3QHRA 4BY9E 2VTPA 3QAME 4YJRA 5FG8A 4PP7A 3HMOA 5CSPA 3N4TA 4FZDB 5HD7A 3R9DA 3WZDA 2CKOA 1NW1A 4EOJA 4ZMEA 4E7WA 4ANBA 2XYNA 2WOTA 3QXOA 4YGAA 4YPSA 2JDOA 3NR9A 2QOCA 5CS6A 2I80A 2BRGA 4I0TA 5M56A 5HO7A 4V05A 3KQ7A 3PZEA 5FM2A 3WF7A 4B6LA 4IDVA 3QRIA 5EHYA 2C0TA 2OG8A 2J50A 2PVRA 3BELA 3I5ZA 4O7SA 3QCSA 3RM7A 3MY5A 5I9VA 4IX3A 4KBAA 3FMHA 4KB8A 5FTGA 4BTMA 4IAIA 5AIKA 2PY3A 4FFOA 3R1NA 4BVUA 3GIDA 1H1QA 4BC6A 2JIVA 1OZ1A 2Y0AA 3OF0A 1DV1A 1URCA 4L3JA 2YRWA 4DLKA 3QTZA 3TIZA 2GDOA 3Q6WA 4MBLA 2OI4X 4IB0A 4Y85A 5FTOA 3EQHA 3OD6X 2CSNA 4DH8A 4XYLB 4ZTSA 4FT0A 4RBLA 5DWRA 3OZ6A 4ZOLF 3TIGA 4OBPA 4TXCA 1Z2NX 3ZO1A 4RJ7A 2WQMA 4F0FA 2YM6A 4YU2A 3LFQA 4KA3A 3EN7A 2B9FA 3OBGA 2DS1A 4D5HA 3PVWA 2PVMA 5H3QA 2RF9A 3I12A 3PG1A 4CFFA 5HBHA 4DH5A 2JIIA 2PZPA 4BGGA 4J99A 2V55A 4IAKA 1KE7A 4KSPA 3IOPA 2VUWA 4TWCA 2QONA 5D1JA 4D2SA 3DFCB 5CX9A 5TT7A 5KX8A 4QRCA 5CF4A 3D15A 3PLSA 4HGSA 4U7ZA 5E4HA 3CXWA 4DH3A 2X2LA 5HU9A 2ESMA 5IA3A 5L3AA 4IWDA 5IU2A 5CQWA 3LFSA 4XH6A 1VYZA 4RG0A 4Q5HA 4EGQA 1Z2OX 1STCE 1JKKA 5AP0A 5C4KA 4FVQA 3BGPA 1PX2A 4UZHA 1Y8YA 3KU2A 5A9UA 4AF3A 4BYIA 5AEPA 5BYYA 4TYHB 3Q04A 3ZUUA 2LAVA 2CNVA 5EW9A 2UZOA 3IKAA 2JDVA 3MVHA 2E9NA 2PVPA 4I6QA 4G5JA 3GC7A 2JKOA 4QYGA 5D7VA 4A7CA 2O65A 4RC4A 4BI2A 3ZLSA 4CNHA 2XBJA 4QMTA 1H8FA 3K5VA 5HNBA 4DINA 4FTIA 3A61A 4RX5A 1JDBB 3ORNA 3EJ1A 5CU4A 3UBDA 4FV4A 5AX3A 4J53A 2OICA 4AQCA 4PDSA 1TQIA 3W32A 3C4XA 4WNMA 3WZUA 3OY3A 2Y8OA 4APCA 3GU4A 4EH4A 3SW4A 4C7TA 4O7ZA 5KCVA 1J91A 4LMNA 3RJCA 3LFCA 5EI6A 3NGAA 1BNCA 3KRWA 3R8ZA 3IS5A 3OT3A 4D9UA 4ZI7F 3FSKA 4IVCA 2VR1A 5HEZA 3FHIA 4XP2A 3MI9A 5HG5A 3OUUA 3A8XA 5ETIA 1ZYDA 2YCQA 4RA4A 3QWKA 5E7RA 4QQTA 5J1WA 2WMQA 3I4BA 2WD1A 3R9NA 4HR7A 4CGAA 4GMYA 3FZRA 4MD8E 3W16A 3CY2A 5BVWA 4BBEA 3OBJA 4D4VA 2R3GA 4ZS0A 4I50F 2IVUA 2GNLA 3B8RA 4RA5A 5IUHA 2UW7A 5L6PA 1M7NA 2BRNA 4J52A 2WMAA 3SOCA 1KJIA 2UW9A 4HPUE 2GNIA 4CSVA 3KULB 3G0FA 3R7VA 4EOPA 5B0XA 3UZRA 4GG5A 1WVYA 3DT1A 2QC6A 3JY9A 4UY9A 4IZOA 3FMNA 3O7LB 3EQDA 3PXQA 4QYEA 4BHNA 3R21A 1ATPE 5I0BA 1V0BA 5IMXA 5JQ8A 3MW1A 4ZSAA 3SHEA 5BX0A 4GT4A 1F0QA 4WHZA 4EHGA 3EQBA 4ZXTA 4AT3A 4WRGA 2W5AA 3U4UA 4LRJA 4P7EA 2WTIA 4LOPA 3RKBA 4FX3A 2FVDA 3ALOA 4F7JA 5AP4A 3O8TA 4QMUA 3E93A 2C69A 4RIOA 4MNEB 5F1ZA 4O7WA 2FSLX 2R7MA 2X9FA 2Q0NA 3R5HA 4KRCA 2WZJA 3MH1A 1OM1A 4NTTA 2FB8A 2HOGA 2W4OA 4RSSA 2C1AA 3CKXA 2X0SA 4N4SA 3TL8A 1MUOA 4A06A 1JKSA 1REJA 2ZM4A 4M67A 4UWYA 5FDPA 4KBCA 3N51A 4UZDA 5J95A 4BZDA 4YAKB 3QLFA 1EZ1A 3KMMA 4IMYA 4X0MA 4O86A 5IQGA 4FSRA 3UIXA 2IVTA 4FKGA 5CEMA 1OVEA 2GHMA 3F66A 4FZFB 2UW0A 3NZ0A 1PMVA 3LPBA 2HENA 4PTEA 4YR8A 5GIPE 1CKIA 5AV0A 5JFWA 5CEKA 3KMUA 3W10A 5CANA 3VPCA 5HKMA 1XO2B 4HVSA 3I5NA 4RJ5A 2UZUE 5AUVA 3BV2A 4BGQA 4U43A 4C4IA 3PPZA 3R9HA 5L2TA 2HGSA 3ORTA 4HNUA 2R3MA 4G34A 3DJ5A 1U5QA 1ZMWA 2C1BA 3FMEA 3ZO3A 5I9WA 5BVNA 2GNJA 3D5VA 3OWJA 5A46A 3NNVA 4ZY4A 2R4BA 3FKOA 3TACA 5HZNA 2YCFA 3NPCA 3UJGA 3NUYA 4CFVA 1T45A 5IQFA 2YW2A 3NVKI 4YBZB 5HVYA 1M14A 2YM3A 3BLQA 1ZOEA 1JLUE 1RW8A 2E9VA 2QOKA 3DTWA 4BBMA 4O4HF 5LYJF 2DLNA 2GPSA 3U6JA 4C58A 4A9SA 3E3PA 3LXNA 3WF8A 1ZOGA 1UVRA 2VTTA 3FPMA 4KAOA 3O7LD 5I9UA 2I0HA 3JY0A 2NU8B 3AMAA 3NAYA 4M14A 4IBMA 5IPJA 5AAEA 4L01A 2I0EA 5L2IA 4ACGA 2B9JA 4Z55A 4RIYB 2V59A 5CENA 3F88A 4XNEA 4E4LA 2HW7A 1DAWA 2PVYA 3EQFA 3VNTA 4C5BA 3PIYA 3TDVA 3GU8A 5C1PA 2QLQA 3F7WA 5CVHA 3DB8A 4KRDA 4DYMA 1IR3A 3TTJA 1TKIA 2NRYA 3WE4A 4ZJVA 4YB8B 5M4CA 3TZ9A 2F4JA 1XH9A 1GZOA 1WBTA 3NS9A 2ITZA 5CA0F 2R87A 3PA4A 2RG6A 2XEZA 4ACDA 1U54B 3A7HA 3FZ1A 4QMYA 2C5OA 4XV9A 3WIGA 3CLYA 3GQIA 3ZFMA 3NYNA 4AX8A 4EK3A 3DBQA 5AA8A 4RC3A 4FFMA 4FEQA 3SOAA 4DEIA 2UZWE 3DK7A 2F57A 3RZBA 4CZTA 5FDXA 4NW5A 3W2CA 5ITAA 4BGHA 4C2VA 1CTPE 4BF2A 1ERKA 1ZZ2A 4K18A 3JR1A 4U41A 3VHKA 2OZAB 2W1HA 3D7ZA 4CEGA 3D14A 2FO0A 1VYWA 3POOA 1KE9A 3TW6A 4IAYA 3D5XA 4KS7A 3BLHA 4DAWA 2HY81 3PP0A 3LFFA 4N57A 1JVPP 5LMAA 4RRVA 4KIOA 4BDKA 2CGXA 3FZPA 2C6MA 3MY0A 3OHTA 3JS2A 3ZONA 4QQJA 4RFZA 1V0OA 3GOKA 4UX9A 5K5NA 4FVPA 4O6LA 4NJDA 3ZS5A 4DLIA 4MXCA 4AGDA 3MJFA 3BPRA 3RCDA 5KBQA 1UWJA 2ZJWA 5ETFA 3T3VA 4CKJA 4QQ5A 3I7CA 2R85A 3Q9YA 3TKUA 5AM6A 4FL3A 1Q5KA 4RIXB 4QTEA 2YN8A 3HV4A 2F7EE 1A48A 4HOKA 4IVBA 2GCDA 4K11A 4O0RA 5CU6A 3ZYAA 5IDPA 4KIPA 4UYNA 1NA7A 3GB2A 5AP7A 4HZSA 4BDFA 4EJ7A 3WZKA 1NXKA 4I1ZA 2C3IB 4NU1A 4EH7A 2V5AA 5CZIA 4XG7A 2IZSA 4IC7A 4NWMA 5LMBA 2XMYA 3G15A 3PJ8A 4GK3A 1XH5A 4MQ2A 3ZCLA 4JRVA 4E4XA 5CLPA 3VQHA 3P9JA 4FTOA 4O96A 4TWOA 3PPJA 4Y72A 2O3PA 4RX9A 5M53A 4X21A 3C4EA 5D41A 3PFQA 5CU0A 5KHXA 5FEEA 1Z2PX 4D55A 4TV8F 3OMVA 4GW8A 3DAJA 1OMWA 2XS0A 4FSYA 4PMTA 4EHVA 4XOYA 4BCKA 4BDHA 1O6LA 2NNWB 2UVZA 2AUHA 4GK2A 2IZRA 2SRCA 3O17A 3ETHA 3EMGA 3TN8A 4XMOA 2BALA 5IH5A 2YM5A 3BEGA 3R04A 2F7XE 4I6BA 4QNAA 5HLPA 3PIXA 2BCJA 1YVJA 3AT2A 5KMIA 3OWLA 3OG7A 2YZMA 4F7LA 1SVHA 4JX3A 4H1JA 4QP9A 5C01A 3F5XA 2VWYA 2HZ0A 2GQSA 3QYZA 3LCOA 1NVSA 1A9UA 4GFMA 4QNYA 4ZTRA 4R3RA 4PNKA 2YZGA 3VVHA 4GU9A 3VC4A 5GINE 4ANSA 3RINA 4O7VA 2PZYA 5F4NA 3TIYA 5IYZF 4G6NA 3FMDA 5HG9A 4DCEA 1ZYSA 2OWBA 3SE7A 4CMUA 4GKHA 4E5AX 3B8QA 3VJOA 3T3UA 4MV4A 1REKA 3BBWA 3E7VA 2UZEA 4I5CA 4IX5A 4DFZE 4MV6A 1PXOA 4USDA 1WBPA 4F70A 5LCKA 4C3RA 4YC3A 4FKPA 5CVGA 3EYGA 3RALA 1X8BA 3FXXA 4S31A 3DQWA 4Q2AA 4CXAA 2VTOA 4L53A 5AIRA 2W05A 4L1KA 3U9TA 3VRYA 3BEAA 3A99A 4QYHA 5IG1A 3HDNA 2HYYA 3JRWA 2LGCA 2C5XA 3ROCA 2YZAA 3PE1A 2W1GA 4K6ZA 4RX8A 5EDQA 2Q83A 5CF5A 1KOAA 3PY1A 4K9YA 4WBOA 5FP5A 3DKOA 3CBLA 2JKKA 1AQ1A 3L8PA 3UYTA 2RL5A 4BCOA 1K9AA 4BDDA 1B6CB 4PTGA 3A2CA 4D5KA 4U3ZA 4YZNA 1Q97A 4XG6A 2VWWA 5HV6A 5HO8A 3P0MA 3R01A 4FTTA 4RPVA 5EKOA 3LJ1A 3TUBA 3U9CA 2ZYBA 1ZRZA 5CY3A 1W8CA 1Q8UA 3OW4A 2VN9A 3HL7A 4CG8A 5KBRA 3MH3A 3ZSIA 2IWIA 4IM2A 4S2ZA 4D58A 1J3HA 3BE9A 2WELA 3V4ZA 5DBXA 4G31A 3ZLXA 4EOQA 4EQCA 3KN6A 4EWQA 4C4FA 2YAAA 3L1SA 5A14A 3WO0A 3QTUA 4UALA 3LXPA 2QOOA 4H39A 4O7YA 2YWVA 3FC1X 4ME6A 2ZV9A 4FSMA 5G1XA 1E1VA 4W8DA 4TUYF 3TKIA 2VV9A 3ALNA 2PE2A 3NUAA 4HGLA 4ASXA 5KUPA 4W4YA 1GIHA 3SXRA 3LLAA 2XKCA 2CNUA 2XK9A 4RIWB 3TV6A 5KKRB 4RLKA 4B7TA 1YOMA 2OSCA 2DIKA 4DGLC 2PVKA 2WYOA 4CKRA 4FEUA 3AC5A 3UP2A 2QOLA 3MIAA 5BVKA 3EQCA 4C37A 3GFEA 4R1VA 2P33A 4I3ZA 2RG5A 2QHMA 3FSFA 4HYIA 4NJ3A 3GBZA 5E8XA 3E5AA 5HE1A 1MQ4A 3EFJA 3ZEWA 5HVKA 3LWBA 4FTQA 4O0VA 3IGOA 2XH5A 3LFEA 3PUPA 2DQ7X 3DAEA 3RI1A 5A3XA 3QX2A 4LL0A 3QZGA 5IUIA 3R7EA 3SVVA 4ZSGA 3KL8A 4BBFA 5FQDC 5L8LA 2ZV8A 1H08A 4X7QA 4QMNA 2WTJA 1V0PA 1VEBA 3RV3A 4AW1A 1OL1A 4QP2A 3EFLA 3HDMA 2UZLA 3K2LA 3RWQA 2H6DA 5ANDA 5AAFA 5EHLA 3U8WA 3IONA 4GT3A 1SCUB 4QMVA 3LCKA 3R8MA 5IMEA 5HGIA 4M12A 5LA6F 4R7IA 4V04A 4FNWA 2ITVA 4GEOA 4GVJA 4A07A 5J5SA 4WOVA 2O5KA 3P86A 3RNIA 1H4LA 2OK1A 4UXLA 1UA2A 4EYJA 4JDJA 3IGGA 1WZYA 3JZFA 1QCFA 5FXQA 5DN3A 4FTLA 5D11A 3O2MA 2QU5A 4YC8A 1YDSE 3A7IA 4F9CA 3LJ2A 2YJRA 3Q53A 5LARA 5HNIX 3AT4A 3LOKA 2NU7B 3S2PA 4Y5HA 3M42A 5ACKA 3GGFA 4OT6A 4IB5A 4O2BF 4JBVA 2UVXA 2GMXA 2VGOA 3UIBA 3FDNA 2XM8A 4DEBA 1YHSA 3JUHA 4WSYA 2FH9A 2QLUA 2DUVA 4EOSA 4O4JF 4I23A 2X2MA 3EL8A 3DJ6A 4GIIA 4I5MA 4IC8A 3AC4A 5E8VA 3W2SA 2CGVA 4V01A 1OECA 3PSBA 5HE0A 2C68A 4DFLA 5EQEA 4RZWA 2UVYA 4ZTNA 2B52A 2B9IA 5EOLA 2GQRA 2W6MA 2WTKC 3F6XA 5M07A 2PUUA 4BZOA 1PXLA 2PPQA 4JT3A 3HMPA 3LP8A 4X3FA 4ZAUA 1QMZA 3UOLA 4L7FA 4ZY6A 5F9EA 3HYHA 3D7TA 3GFWA 1I44A 1Z5MA 4PMMA 5HESA 5CALA 3MPMA 4TKSA 2BFXA 1Q99A 3MTFA 3KF4A 2WHBA 3ROYA 2F49A 2WMWA 3QHWA 5I5ZA 3GCQA 4IHJF 4O82A 4YHJA 4B8MA 2ERKA 4WG5A 5L8JA 2QO2A 1G3NA 2HXQA 2XJ1A 3H4JA 3ZHPC 3EQGA 3Q1KA 2C30A 2RIOA 2Y9QA 3II5A 2VPQA 4I4TF 3MV5A 3ZBXA 4C62A 5HBRB 3HAVA 3RHKA 5JSMA 4FFRA 3VPBA 1U59A 3LCTA 1BX6A 2I0YA 4Q5EA 4K8AA 1OL6A 4L46A 5EM6A 3DXQA 4OGRA 5T6KA 2JC6A 3BGQA 4DFNA 4EOIA 3KVWA 3Q2JA 2PMLX 3VUIA 1OKWA 4EONA 3AC8A 3OUKA 3P08A 4TNBA 4JVGA 5CI6A 4EH6A 3UFXB 4U45A 3BU6A 3TJDA 4X2JA 1NVRA 3L8SA 3QX4A 3EH9A 4FKRA 4PRJA 5AUTA 3SLSA 3VUDA 3CJFA 2I7QA 4Y8DA 4AACA 4EH2A 3IPHA 4AZSA 4DN5A 4L3LA 5HCZA 5BPHA 3ID6C 2X9EA 2RFSA 4LGHA 2WAJA 3FMLA 4MXYA 4FEXA 1A9XA 1GZNA 5AUZA 1JKTA 3OOMA 2PBZA 3DK6A 5HIEA 5I9XA 2CKEA 4J97A 4W4WA 2ZDHA 3DNEA 2CMWA 4PDPA 2J5EA 3R30A 1IAJA 3VULA 1UWHA 3KXNA 1YW2A 3AGLA 4AA0A 1OB3A 1ZXEA 2UV2A 2FA2A 2GLTA 1ZMUA 4BIBA 4WNPA 5CTPA 4DA5A 4FFNA 2C3JA 2W06A 3MY1A 1M17A 5FXSA 1ULZA 2W6OA 5HTCA 1KV2A 4HVIA 1YKRA 4XEYA 3ENMA 4YSMA 3IK3A 4C35A 3CIKA 3ZM4A 3F9NA 4J7BA
chains in the Genus database with same CATH superfamily
4CFWA 3RPYA 5KZIA 4G6OA 5CVFA 5K3YA 5BQ0A 2IZTA 4JQ8A 4FIHA 3O8UA 5A6OA 4C34A 4HNVA 2Z2WA 1R39A 3A8WA 2Y4PA 4ANMA 1JAMA 2Y6OA 4PUZA 4ALVA 4EH9A 2W1IA 4CVAA 2NYAA 3VBXA 5C1QB 3M11A 5JZNA 5E8TA 2OLSA 2O64A 4MV8A 4MH7A 5FD2A 3HZTA 1F3MC 2BTSA 2AC3A 2EJ3A 3PJCA 2IZUA 2OZOA 3H3CA 5M06A 2YS6A 5FXRA 2HK5A 4C3FA 1PXJA 3N9XA 2C0OA 4F7NA 3P23A 3IOKA 2PULA 2DWBA 5HD4A 3OC1A 4XP3A 4MV9A 1HCKA 3BLRA 3CGOA 4AG8A 4E8AA 4ZK5A 2BILB 2HDKA 3PVUA 3T9CA 3ORIA 4EYMA 4YTCA 2X7FA 4GG7A 3JXWA 2CLQA 2HJWA 3T8OA 3ZMMA 2BHHA 4TYHA 1H1RA 3BYSA 2WMSA 3I0OA 3LMGA 4IFGA 1GSAA 4O0YA 5AWMA 4DEGA 4ZLOA 4FK6A 3QZIA 4FZ7A 3CSVA 2X7GA 1L3RE 2R3RA 5HNGA 4BICA 3BRBA 2OWOA 4U81A 1BL6A 2XK6A 3AKJA 3JRXA 1XBCA 5AX9A 3QLGA 5IQHA 2XCHA 3KXHA 3NW7A 4FEVA 3AXWA 3ZZWA 4EGJA 1YI6A 3DK3A 3PXRA 5DR2A 2VTRA 5DFPA 3VS7A 3FMKA 5LWMA 3S0OA 2UZTA 1YOLA 1QPCA 2XNEA 2Y4IB 4Q9SA 5HIDA 3Q9WA 4IAFA 3RCJA 3T9AA 3FLWA 2OJGA 2F9GA 2BMCA 2JBOA 3LXKA 4DFBA 2EU9A 2PYWA 3Q32A 4MD7E 3TY5A 3CP9A 5LWNA 4MWIA 3ELJA 4NYEA 4NK9A 5AV3A 5BVEA 1PK8A 1T46A 1XK5A 3LM5A 5A54A 4HNIA 3R2YA 4TRLA 1NY3A 3CCNA 4QTDA 5E1SA 3U87A 4PZ7A 1ND4A 5FBNC 4DCAA 3CTJA 3O0GA 2CCHA 2CPKE 4IAAA 4IVAA 3OWPA 5HTBA 3TUDA 4WHXA 3AMYA 3MH2A 3CD8A 3VHEA 3S00A 4E1ZA 5I47A 4XBUA 3UE4A 2QR7A 2WQBA 4CMTA 2XKDA 2Z8CA 1XH6A 3BL7A 3KULA 2SCUB 3UOHA 2ZB1A 2WKMA 3DKGA 2PZIA 3QA0A 1XKKA 1DAAA 2HIVA 4AA5A 5C26A 3L9PA 3TJCA 5JFSA 3FQHA 3E3BX 4LI5A 4MV7A 3LFAA 4OTDA 2OFUA 5DEYA 2PZ5A 3IW6A 4AGWA 1YWVA 3CPCA 4XV1A 4MXOA 4XP0A 1YQJA 3EN5A 2ZDGA 5KZ0A 5KMKA 1QPJA 2OW3A 4BDJA 4PMPA 4J71A 2CGUA 1M2PA 4QP8A 3MA3A 2ZDUA 3DB6A 4MNEA 4FSUA 1CMKE 4L42A 4YAJB 3FV8A 3CKWA 5BVFA 2CJMA 3SX9A 3DOGA 4O6EA 3UGCA 3FUPA 4QTBA 3R22A 2ONLA 1O9UA 3HP2A 3RK9A 4AZEA 3ANQA 4Y95A 1TA8A 1B38A 1PXIA 2IW9A 1JQHA 5E91A 3CEBA 4EK8A 2IJMA 3H10A 4QMSA 5DRBA 2UZVA 3KB7A 3PSCA 2B4SB 3Q6UA 1FGKA 3FL4A 3QQUA 4DF3A 2A1HA 3EQIA 1BUHA 5ANIA 5DGHA 4NFNA 5EDRA 3RGFA 2HVQA 2GTNA 1XHAA 5CU2A 1RDQE 1TQPA 1YI4A 2Q0BA 4KKEA 5E8ZA 1XBAA 4GSBA 2J2IB 2WNTA 5LOHA 2PVNA 3WWJA 3GDEA 3QZHA 1MRYA 1OIRA 4YP8A 1KOBA 3FI2A 1IOVA 4CQEA 4W4XA 1LPUA 3V6SA 5L2SA 4QMLA 5BVDA 4GJ2A 2PWLA 3OY1A 2OLCA 1JSUA 1R0PA 2PHKA 4YJTA 4A9RA 5H8GA 4D9TA 4LV5A 3OXZA 3K3PA 2XK3A 1AGWA 2XNMA 1S9IA 3FQEA 4AXDA 5HG8A 3GB8B 1GY3A 3HRBA 1EUCB 5JZJA 1E4EB 2UW6A 3PVGA 4QQCA 4B4LA 3O50A 2W1ZA 2W1DA 3D2IA 5EW8A 4X2FA 1JKJB 1U5RA 3KY2A 4IIJF 3LW0A 4ZHQF 3FLZA 4FICA 4I4EA 4EBVA 3VO3A 4RVLA 1PYXA 3ZBFA 5GIOE 3BWJA 1W82A 3EB0A 3Q5ZA 4JG6A 5EYKA 4JLCA 5C9CA 3W8QA 4HGEA 1FVIA 4EH3A 4F08A 3ULIA 3UG1A 3KCKA 4OT5A 4PL3A 4OTHA 4FGRA 1FQ1B 2J9GA 3G5DA 3R00A 3DNDA 5CQUA 3AD4A 3ZXZA 3BACA 2F2CB 5EHOA 3HAMA 3HV3A 4AW0A 3RK5A 2V0DA 4LH6A 3VIDA 3FHRA 2B0QA 5L6WL 3CY3A 3C0IA 2R3IA 3O23A 4U0IA 4RIYA 4YZBA 5HBEA 2P0CA 5HIBA 3GI3A 4BCMA 4HYUA 3BYVA 2UUEA 3OFMA 3UOJA 2FPIB 2YZNA 4JDIA 5FPRA 4BI0A 1O6KA 4NM5A 5H80A 4DQNA 2WMUA 3CD3A 1KE8A 4F65A 2QI8A 4H36A 5A6NA 4G9RA 4X3JA 4F99A 1RE8A 4IM0A 4ZOGA 1XDNA 3RV4A 5BMVF 1U54A 4YZDA 2PU8A 1Y57A 1FVTA 2JAMA 4C4EA 1UNHA 4G3CA 1CKJA 1K2PA 3PWDA 5EK7A 3GUBA 4L6QA 2Z7SA 3SKCA 2H96A 4EWHA 2RGPA 2W6QA 2C6EA 2XVDA 4NCTA 4YJPA 4MYGA 3FPQA 5E8UA 2W4KA 3QFFA 2OZAA 1URWA 1JNKA 2ZGIA 4IZ7A 3VBTA 1KWPA 3ZSGA 3UO5A 5I5SA 1M0TA 2GQGA 1YXUA 2R3QA 3QTWA 4S33A 4C02A 4E4NA 3RPVA 3MVMA 2VU3A 4U3YA 1PKDA 4CE5A 4XG9A 1CKPA 2C47A 3QALE 4DGNA 2VGPA 4BDEA 4FG9A 4EQMA 3WARA 2R7NA 2Y4RA 4P5QA 3CS9A 2UW8A 2YZLA 3CJGA 3IQ7A 4DLJA 2W70A 4FV9A 1YXXA 5KO1A 3E7OA 4LFIA 3RP9A 5M4UA 1R1WA 4O91A 5D10A 2WEIA 3PA5A 3UODA 5A4QA 4FTNA 2BZHB 2R3OA 3LHJA 4RIXA 4HCTA 5IUGA 2ZOQA 3ET7A 4I22A 5JQWA 1OUYA 1RQQA 2FSOX 4F1OA 3R5XA 3PXZA 4L44A 3M1SA 2R9SA 5J2TF 1DIKA 2CN8A 3C51A 3FLNC 3S4QA 5K9IA 2BROA 4HJOA 1PYEA 3QQKA 5EYCA 5M55A 4ASDA 1YXTA 1WCCA 5D8DA 1HOWA 2QCSA 2BAJA 3K3JA 4OBOA 4DFYA 4XV2A 3VBWA 3R73A 2NUAB 2WMXA 3T7AA 1FGIA 1W7HA 4AS0A 5KMOA 5IEXA 4QDEA 4FV7A 4YZCA 3ORQA 2DZDA 2X1NA 3BLAA 4FJVA 2HCKA 4AW2A 5HX8A 5CAQA 4A9UA 5CM0A 5LOVF 1YHVA 1G8SA 3EZRA 4TTHB 1SNUA 1Y91A 4IZAA 3SRVB 1PY5A 4A4LA 4M0JA 2ZV2A 3EL7A 3ORMA 4DIMA 1S9JA 5A4TA 3I6WA 5EI8A 1OKZA 3H0ZA 4FSZA 2IW8A 2YHVA 5JKGA 4F64A 2R64A 2E9OA 5EW3A 4FYOA 5IA0A 5FEDA 2ZB0A 4RC2A 3RPOA 1ST4A 4OTGA 2Z02A 3GOPA 4E6DA 4GK4A 2ZV7A 1ZY5A 2XRWA 3MDYA 2PVJA 3OTUA 1BMKA 3CE3A 5CAOA 4RZQA 5IQEA 2BKZA 3CQEA 3HV5A 3NDMA 2JLDA 4CD0A 5K4JA 1EKVA 2DAAA 2GPWA 2YS7A 4E93A 3PZHA 2YJSA 4O21A 4TYJA 4ZSJA 4FNZA 1WAKA 5DG5A 3DBEA 3TEKA 4G16A 4YHTA 4ACMA 4TT7A 5AP2A 2REIA 3KMWA 3MTLA 4ORKA 3NIEA 3NYOA 3VN9A 5IQCA 4U6RA 3U6IA 3AG9A 5FPOA 4C5CA 4IH8A 3QKMA 3BX5A 4EK4A 3I6UA 4H3BA 2BZIB 3CR0A 2WQOA 3QXPA 4EOLA 4GUBA 2BRHA 4LOOA 4XG4A 5JH6A 5CAUA 3TZ7A 5DT4A 2IVVA 4HW7A 1UNLA 1YDTE 4NH1A 3QD3A 3ZFYA 2B55A 4JNWA 4ASZA 2JFMA 3BL9A 1XH4A 4BB4A 5IA4A 4FKJA 1CE8A 3ZZEA 4I55F 4DEDA 3LXLA 1SYKA 2QODA 4NM3A 3UP7A 1FPUA 3SC1A 4C0TA 3UZTA 3DU8A 3NUNA 3QBNA 2DWCA 3IW7A 5GNKA 4MQ1A 2ZAZA 1YRPA 1P8LA 1MQBA 4IJ9A 3C7QA 4GH2A 4TY1A 4JBOA 5CYIA 4DH7A 3FKNA 3RM6A 3T9IA 4RVTA 3T99A 3W1FA 2YIQA 4FTCA 4LV8A 3GT8A 2ITNA 4YLKA 4Y73A 2CKQA 4FKWA 3ZLWA 1ZWSA 3MESA 4YHFA 3H9RA 3P7BA 4CG9A 3S24A 2ZM3A 3GNIB 5AP6A 4PQNA 4E20A 5DA3A 5E92A 4EK5A 1EHIA 2A0CX 2JFLA 1IYEA 5JQ8A 3LMIA 4FODA 1QPEA 1ET0A 3V5LA 4A9TA 4AZVA 4USFA 2VTNA 4MNFA 4WNOA 2JDRA 4ID7A 5ACBC 4LL5A 2QD9A 3G8DA 4D1XA 2UW5A 2XIZA 3ERKA 1K3AA 3ORKA 4NKSA 4H1MA 3NMUF 3DLZA 4U9AA 3V4SA 4JG8A 2EXCX 3AOXA 2WPAA 3UZPA 4QMOA 2HXLA 3OEFX 2UZDA 2BKKA 3VAPA 3BHUA 3R23A 4RCNA 4C59A 2QNJA 2Y6MA 3TY8A 4O0XA 5LCJA 1W83A 3C0GA 2CNQA 1Q3WA 4ITHA 4LQMA 5DI1A 3UPXA 3RFCA 2Q2UA 2XIXA 3DFAA 3RVGA 3TV4A 4EZ7A 1MRVA 1OGUA 3QKKA 2PMNX 3MPAA 1EYZA 1Z9XA 3R1SA 2PVFA 4FMQA 4H3PA 1WBNA 2BZKB 4RIWA 2R3HA 2XAOA 3Q2MA 4IJPA 1OI9A 4D4YA 1M7QA 4B99A 4USEA 3PE2A 5AFVA 4XYMB 4U40A 2GNFA 3D94A 5JGDA 1RJBA 4PMSA 2C6DA 3FC2A 4QP1A 4Q4DA 1QPDA 4C38A 2IW6A 4G3DA 3F2AA 3ULZA 3QD2B 2YDKA 3V6RA 4DRFA 4QMMA 3TZ8A 3DBDA 2GFCA 1EH4A 2PVLA 3PXFA 4R3CA 5B2LA 4BCIA 2XCLA 4XRJA 2GTMA 1G8JA 4JR3A 4AXCA 1CQIB 1H0WA 1JOWB 1ZOHA 3LE6A 4UYAA 4CZUA 4DTBA 1IYDA 2PVHA 3DGKA 2XK8A 5E8SA 1EKPA 1DM2A 5CAEB 1Q41A 4PNIA 4XOZA 4X6QC 4I41A 3JSNA 3UNJA 3JVSA 3PJ2A 4LRMA 1PW2A 4CRSA 2XZSA 3NX8A 3FMMA 5DGZA 4DITA 3DA6A 4G5PA 4CKIA 2VD5A 3S3IA 4CT2A 2YFXA 5ETCA 4BZNA 2I8CA 5C03A 3CPBA 4JOAA 4AWIA 3AC2A 4F9YA 5D1OB 2BUJA 3KF7A 4BCHA 4R78A 1AUVA 3ANRA 4R3PA 2QO9A 3EQRA 4B0GA 5JQ5A 1J1CA 3R83A 1CM8A 3I1AA 3LCSA 4CLIA 3RHXA 1IG1A 3NCGA 5C8YF 3PWYA 5HCXA 2C5VA 2H34A 2VO0A 4F1MA 5K5XA 1Q24A 2XUUA 4XJ0A 2H8HA 3F3WA 5M44A 3WO1A 2VWBA 2NP8A 5BUJA 3KCFA 4AUAA 5A4LA 4O4IF 2Q2TA 3EZVA 4XUFA 3IW4A 5KMJA 1C30A 3R0TA 4OR5A 4DGGA 2OXXA 3OT8A 2J5FA 4MVFA 5DHJA 3TNHA 3UO6A 3R5FA 4UCVA 4TV9F 3ACKA 3KA0A 4FG7A 5ANJA 4I21A 3SG8A 5M4FA 3TNIA 2OIQA 1KEEA 2G1TA 5B2KA 4C3PA 2GNHA 4PF4A 5CT0A 3TINA 2A1AB 3EOCA 2QU6A 4UEUA 3TNQB 3R7UA 3PA3A 1WVWA 2C6LA 4BCNA 4FKIA 4YSJA 3HB9A 4JBPA 1OGYA 5JN2A 5IF1A 2XYUA 4EH5A 3O71A 4EC8A 4JDHA 1Q61A 1YDRE 2E9UA 2J7TA 2P4IA 4WG4A 4TW9A 5HI2A 2VTIA 1PXNA 4MUQA 4AZTA 2JD5A 2P55A 4LDTA 1UU7A 4X2NA 4YMJA 5BPYA 2NU9B 3SW7A 3RR5A 3MJ1A 3FXWA 3O96A 4FFPA 2HZ4A 2R3FA 4AQKA 4BCPA 2HELA 1Q8WA 4QP4A 3OCBA 2COJA 3E8CA 3TXOA 4GU6A 4LG4A 4L7SA 1VS0A 3WWHA 4IB1A 4HVDA 3COMA 2E2BA 3AMBA 3HRFA 3KEXA 1ZAOA 3QCYA 3SGCA 5AMNA 2F7ZE 1OPKA 1H28A 4XBRA 1JWHA 4F9WA 3FE3A 5BNJA 2R3NA 3MWDA 4P4CA 4LRKA 4ITIA 3PY0A 3PXKA 4BCGA 2I1MA 1H26A 3ORLA 1F5QA 3GCSA 4IWOA 3MSSA 4AA4A 5CEOA 1KUTA 4KKHA 4AGCA 4IE9A 3QWUA 3LJ0A 4O7NA 3LIJA 2YM7A 4YC6A 4R7HA 4MBJA 3QTSA 3RPSA 1B39A 2E9PA 3UC4A 4YJOA 5DAAA 2ITPA 2JKMA 4WUAA 5IQIA 2X6EA 4EKLA 3MWEA 4EQ5A 3TKHA 1KJQA 4TNDA 4I94A 3AKLA 1ZARA 2WQNA 3NNXA 4FIFA 4PL4A 1I2KA 2XNBA 5H8EA 2C5YA 3EFWA 2KTYA 3DTFA 4FZAB 4C5AA 3Q4ZA 4XRLA 5DNRA 3VBVA 2RFEA 4FGBA 3A7FA 2OH0E 2ETRA 3C4FA 4NUSA 5LMKC 4HCUA 1ZZLA 2QURA 3FEGA 5EQPA 2VTMA 3EIDA 3ZUVA 1BXRA 4YBJA 4LUEA 4CV9A 5IA2A 4HVSA 4O7TA 3W0RA 4ZSLA 4EORA 4ZS4A 1NT2A 4FSTA 5HLNA 4Z9LA 3ACJA 4AAAA 1JLLB 1PXMA 3IDBA 4DHZA 3C1XA 2BAQA 3VRZA 4MV4A 4G6LA 3PXYA 4RT7A 1VBGA 1WBVA 2A4LA 5I9ZA 3HP5A 2BDJA 5CI7A 5BWVA 4I5PA 1WBOA 4IW0A 3ZTXA 4DT8A 4ERWA 5AP1A 4IIRA 4PDYA 5A4EA 3AQVA 4LM5A 2Z04A 4FKQA 3UVPA 4BIDA 5LVMA 1LR4A 2PL0A 4LOQA 2O63A 3IECA 4YZMA 4XCUA 1IRKA 1BI7A 3I81A 3MFTA 4FUXA 5BYZA 1XJDA 2QG5A 1QL6A 3E8NA 4AOJA 3MJ2A 3C0HA 3NW6A 2PN1A 4FIJA 1U4DA 3FLQA 3FZTA 3KN5A 3FLYA 4MHAA 5AUYA 3V5TA 3SXSA 3V8SA 5LQFA 2WMVA 1APME 2BTRA 4F78A 5GHVA 2YIRA 2R2PA 3ORRA 3BG5A 2YERA 1OL2A 4L43A 1UU3A 3P79A 3N4UA 3GJXB 4IEBA 3I7BA 5EYDA 2HGWA 1UC9A 5E1EA 3BU5A 3A62A 4HPTE 4ZTQA 4K0YA 3TI1A 3IG7A 4IWQA 5GJFA 3F7ZA 4AT5A 4DE4A 4XLVA 5EM7A 2Z7QA 5LXTF 4GUEA 3TUCA 3W0PA 1WR2A 2VX0A 5HU3A 2GHLA 4L9IA 5BMMA 4YO4A 4D1SA 4ENXA 2VX1A 5BYBA 4FKUA 3QF9A 4S32A 4YLLA 3WZJA 5KX5F 3LFNA 4R1YA 1OPLA 5ANKA 4WUNA 3MN3A 5J9ZA 2QF7A 1BI8A 1XH8A 3MFRA 3PRIA 1VR2A 3QQGA 4IADA 4QMPA 5E8YA 4D28A 3PFYA 2ITTA 5HBJA 5EOBA 2GS2A 5TO8A 4FI1A 3SDJA 2B53A 3K54A 3VJNA 4QYYA 4F6UA 4YPDA 5BWUA 1P14A 4FNYA 2EB2A 3A7JA 4FZ6A 2YDIA 2ONLC 3V01A 3WYXA 1CKOA 4KIQA 2YEXA 5D9HA 4WBNF 3VS4A 2PTKA 5DYJA 5J87A 1L8TA 2I0VA 2ZMDA 2DYLA 3GCUA 4F6WA 4FTAA 5JEBA 1Z57A 4AXEA 2OXDA 3FL5A 3QZFA 2G9XA 4O0TA 4DFXE 4YJ2F 3UIMA 4BDAA 3RK7A 2VNYA 3HEGA 3DBFA 3QTIA 4FKSA 3SD0A 5J9LA 4DTAA 5EZYF 1PXKA 4L68A 2PUIA 2J9MA 3BYUA 3DQXA 4M15A 5T3QA 3V51A 4F0IA 1KBLA 3G51A 4O38A 4CT1A 3F3ZA 2XEYA 1S68A 2UZNA 2FB9A 3E8EA 1OIUA 5L8KA 4TPTA 1V9PA 4KBKA 3JZIA 2HY0A 2JAVA 4YTFA 4KNBA 5AUXA 4MV1A 2BVAA 3R1YA 5AV2A 3EFKA 5J2UF 4N6YA 2WMRA 5CXHA 3NCZA 3VA7A 4ASEA 1YWRA 1Y6BA 3L9NA 1MP8A 3NNUA 4DH1A 4E26A 4DTKA 1GSHA 2NU6B 4XG2A 3VPDA 4V0GB 2W1FA 4ANQA 4JXUA 2OIDA 1EKFA 3NBYB 1IA8A 2XALA 1NVQA 2ZMCA 1OUKA 4QTAA 3IDPA 3RMFA 3WE8A 3DF7A 3W1GA 4MWHA 4I6FA 4NIFB 4DHFA 2YITA 2W5HA 3KKVA 3BABA 4FC0A 4QMWA 2FSMX 4DG3E 3DS6A 4N70A 2CZGA 1R0EA 2C6TA 2YDJA 1UU8A 1Q4LA 2J0MB 2WMTA 3P7CA 2A19B 3QYWA 4QEBA 2OXYA 4JL9A 3QRKA 3OROA 4QDVA 3MH0A 3ZU7A 1M2RA 4O7LA 2P2HA 4WA9A 4FTRA 4BTJA 3E5NA 5IDNA 2GS7A 4K2RA 3W33A 5CSVA 1GIJA 5M4IA 3HGKA 4Y8VB 4QP6A 3K5IA 4RFYA 4ZZOA 3GC8A 4GYIA 4CV8A 3TZMA 3AT3A 3BHYA 2UZBA 1LEWA 1IA9A 3IDCA 4OBQA 1YI3A 3COIA 3KRJA 4CFXA 3AX6A 5CE8A 4R5SA 3VUHA 5KKNB 4MAMA 2J0LA 3FWQA 3PPKA 4I24A 4R77A 4YNOA 4PBCA 4NZOA 3K3IA 3N6RA 3QGWA 4MXXA 2XK7A 5CF6A 3P4KA 3R9OA 5B2MA 3C5IA 2VZ6A 3WNZA 3FY0A 2BR1A 2BPMA 3BHTA 3LZBA 3ZFXA 4FV5A 1KJ8A 2R82A 3GLKA 3NBZB 2YCSA 4BRXA 3T9FA 4ANLA 2OO8X 3WZEA 2R7LA 2YA9A 3A7GA 3FZOA 5LVNA 5FUTA 4JX7A 4DHJA 3DAAA 4NCTC 4PV0A 3QTQA 3EN4A 3KXXA 4I6HA 3MVLA 5AP3A 3E64A 2ITQA 4RQVA 3TV7A 4E5WA 4Z16A 3SA0A 1I2LA 3K5HA 3R1QA 5JK3A 4RZVA 4YZ9A 1E4EA 4G3FA 3QD4A 3R28A 4RVMA 3AW8A 4RLLA 2XNNA 2VUGA 4JRNA 3OWKA 2VTHA 3F82A 2AC5A 2RKUA 4XHKB 3TW7A 4E6AA 3A4OX 3NVMB 2C5NA 3MVJA 3R9RA 3UG2A 4B9DA 2P0AA 3F5UA 5JMSA 2BHEA 4R5YA 2HZIA 3C4WA 3KXZA 3D5UA 3QWJA 4AE9A 3LAUA 4FV8A 3V5QA 3WF9A 4XZ3B 3L8VA 2H9VA 2HW6A 4ZIMA 3MIYA 2X2KA 3KXMA 4UCRA 5DR6A 4RWKA 3FI8A 1KC7A 2YM4A 2OF4A 3HMNA 1SZMA 5DE2A 4NTSA 5DR9A 2FPPB 3IW5A 3Q9ZA 4RX7A 4IACA 3NWWA 2GS6A 2WIHA 5ANEA 5EI2A 3H9OA 3U55A 1M52A 4GIHA 2BFYA 3NUPA 3EN9A 3QUPA 2ZDTA 1KSWA 3BQRA 3ZDUA 4C4GA 4CRLA 3E88A 2XARA 2I40A 3F3UA 1OKYA 2V22A 4W8EA 2Z60A 3V04A 5J7HA 3VBYA 4BCJA 4NT4A 2R7KA 4A4OA 4RWJA 1P4FA 2X7OA 3L9MA 3QQFA 4FIIA 5ANGA 2G15A 3SQQA 1PF8A 2B1PA 1TQMA 2W1EA 4MBIA 4O22A 2WEVA 4GV1A 4IB3A 1GSOA 4YJSA 2QOFA 4KSQA 4NM0A 3A4PA 5GJGA 2IN6A 5C27A 3UOKA 4AGUA 1PKGA 2R0UA 5EDPA 4BDCA 4DG2E 1G8AA 4CTBA 2JEDA 3QUEA 2J51A 3GCPA 4FV0A 2WFYA 5JGAA 2RFDA 3PRFA 3V8TA 4DGMA 3BGZA 1JSTA 2YACA 3G6HA 4DT9A 4WNKA 2OJ9A 3P5KA 3NNWA 4C2WA 4Q9ZA 1M6VA 3Q4TA 2OH4A 3ZC5A 4QOXA 5IQBA 2J4ZA 5HE3A 3F3TA 3UVRA 3V5JA 4NFMA 3NRMA 3ZUTA 4FL1A 4HNFA 3VS1A 4MA5A 2WOUA 4BDIA 4EZ5A 5FM3A 3W0SA 2O8YA 3I60A 2C6IA 3BV3A 4QP3A 3NUUA 4EI4A 2AYPA 3UPZA 2CLXA 3UC3A 2X39A 4EK6A 3TIIA 5M51A 5KNJA 3WWIA 1CKMA 3BCEA 3N8DA 1UC8A 1W84A 3MB6A 3DXNA 4D2RA 4DFUA 2XB7A 3DDQA 3VUGA 4A4XA 3LM0A 3S95A 1KE5A 4KABA 2NRUA 3VW8A 4IQ6A 4XYFA 5FTQA 4EHEA 4F09A 1PMUA 4DHIB 2A2AA 4HVGA 2EB3A 3HUBA 1WMKA 4OTFA 4PL5A 3ORZA 1OPJA 4BTFA 1OITA 4FT3A 4O84A 4ZJJA 3PP1A 1O6YA 2W7XA 5CEQA 4DBNA 5AUUA 3DBCA 2V62A 1G5SA 4KWPA 4Y46A 5L6OA 3S1HA 2YL2A 2IVSA 3HLLA 2VWVA 3LQ3A 5FRIA 4BTKA 4NZNA 4UUGA 3BKBA 3JYAA