4UCOA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucoA02
2UXCB 4LF7B 1HNWB 4UFZA 4JV5B 4DV4B 4KHPB 2CFMA 3NBZB 3NBYB 4JI1B 1XDNA 3OTOB 1S68A 3T1HB 4YY3B 4TOIA 4JI3B 1XNRB 1HNXB 4CC6A 4X66B 4DV0B 2HVRA 4PZ8A 4UCVA 3S24A 3GB8B 3RR5A 4DR4B 1P8LA 2UU9B 4LF6B 2HVSA 4GKKB 4GLXA 5D1OA 4NXNB 3GJXB 2E5LB 1N36B 2UUAB 2OWOA 4E6NA 1B04A 2ZM6B 3RTXA 3BA9A 4YHHB 4JI8B 4LFCB 4B3MB 4JI6B 3BA8A 4DV2B 5LMUB 4DR1B 1VS0A 3GDEA 1N33B 3TY5A 1IBMB 1V9PA 2HVQA 1HR0B 4PZ7A 4X64B 4DR7B 2Q2UA 4NXMB 4LH7A 2HHHB 4K0KB 1XK5A 4UCOA 1XMOB 3JSLA 4EQ5A 2Q2TA 4X65B 3W5OA 3QWUA 2VUGA 3W1BA 4EEQA 4DV1B 4UCTA 4EFEA 1CKOA 3W1GA 4X62B 4LF8B 1A0IA 3TY9A 4LF5B 4JYAB 4B3SB 4OX9B 4DRFA 4DV5B 4LF9B 5DISC 4B3RB 4UCRA 2HIXA 1N32B 4JI5B 3L2PA 4LFBB 1FJGB 4DR6B 4DV6B 1X9NA 4JI4B 3KYHC 4DUZB 1CKMA 4UCUA 1TA8A 1HNZB 1XNQB 3UQ8A 5BR8B 2UUBB 4LFAB 4DR5B 1I94B 2F4VB 3SGIA 5IWAB 5LMNB 2VQEB 2VQFB 1J5EB 2HIVA 5D1PA 3T1YB 4DR3B 4CC5A 4DV7B 4AQYB 1FVIA 4DV3B 4EFBA 3NC0B 4DR2B 1N34B 1IBLB 3BAAA 4JI2B 1CKNB 4PZ6A 5D1OB 3TY8A 4JI7B 1IBKB 4GKJB 4JI0B 4DUYB 1ZAUA 2UXDB 5FPOA 1TAEA 1P16A 4UCSA 3JSNA 5FPRA 3BABA 4LF4B 4B3TB 2UXBB 4LH6A 3PN1A 3VNNA 2UUCB 1CKNA 1XMQB 1DGSA
chains in the Genus database with same CATH superfamily
3C3TA 2JS5A 3CHXA 3SYOA 5KT2A 1HNWH 1BS3A 1I3QA 3OTOB 2AZ2A 3TW7A 4A3EG 4RB1A 1XMOO 4MVSA 4CC6A 2P7TC 3J80W 4DV0B 3KTMA 5CMUA 2ZGIA 4PWQA 3JATB 1OCRB 1X4TA 4L87A 3DC5A 4JV0A 1R6NA 1M57B 2HVSA 2EILB 4YXWG 4DRXB 4JI8O 4MV6A 2HKOA 4DR4H 4O7WA 3JATA 2DPJA 4MVUA 5FL7G 3JZFA 4MVQA 5BWWA 3ZS8C 2QA4V 1KJ8A 2XC9A 3JAWB 3CXHF 1SQBH 3ZX6A 4DRXA 4QNHB 2Z3YA 3QVNA 2C2RA 4U7NA 4DL5A 3RWRD 4O83A 4A3BG 4CS4A 1JDEA 3JAWA 2EIKC 2XNDG 2P5OA 1YSCA 3SE7A 1A9XA 3CWBH 1WCMG 1EZJA 5IY5C 1NJIW 1M56C 3CCJV 2DN9A 2GHYA 5KLVH 1IBMH 1XQ8A 3D3QA 2JEJA 1MNGA 1NTZH 1BE3H 3M9MB 4R7CA 3W1GA 1ZL8B 2KSDA 2UXBO 2D3OW 1A0IA 1EN6A 2AGPA 3RGBA 5IT9N 4L8JA 3OMAB 2R7ZA 1VEWA 1WN7A 2N05A 1KD1W 2CE4A 1ZL8A 4KHPO 2CNVA 2Z02A 3ETJA 3L75H 2ETNA 3GTMA 4BBSG 2EJ0A 1S97A 3CD6V 1GYFA 1AJQA 4IIJB 3ABLB 4JPRA 3ABKC 3LSQA 5IP7G 5JJNB 1QVGU 3L70H 5JVDB 3CEBA 5KFFA 5LP6C 3FKIA 1H8HG 1LUWA 2XD4A 4IIJA 1JPXA 5LOVB 2Q0OC 4LF6O 2VPQA 3RBDA 4GKKO 2X0LA 5JVDA 2KKWA 3HPLC 5K3WA 2M7WA 1PL0A 3VA7A 4DR2B 2HGSA 4JI7B 1EUCB 4KL1A 2GTSA 4RNNA 1VF7A 5LOVA 1P16A 2ILMA 3WWIA 1ENVA 2YL2A 2R92G 2NNUA 5I5XA 5LHHA 5B1NA 2HHFB 2AU0A 2JA6G 3ORQA 2YZLA 4X89A 4RU9A 3GTOA 4IL6Z 2OLSA 4DV4H 1K33A 4O4HF 3H4BA 2QE7G 2XAGA 1KU9A 2ZJTA 2HHFA 1V54B 3E86A 3A0HZ 1EKPA 4X1YB 4G2KA 2HP8A 2Q7HA 5C93A 2ZIOA 4PA7A 3WB0A 4EG0A 2WLKA 3V6HA 1FKAH 2EJ7A 1YIJV 5B5EZ 4X1YA 1K34A 4ME6A 2RN9A 5CBGA 1OZ0A 5B1OA 1L1FA 2JJ1G 4I0XB 2UUAB 2OWOA 5BYAA 2E76B 5IYDG 5HBRB 2XOKG 3T4ZA 4DXWA 1YITV 1S72V 1SESA 2PI5A 3T5HA 1Y1VG 1EZ1A 4O3PA 2R85A 1C3OA 4B3MB 2UUBO 4QJFB 3DXRB 4I0XA 5JVLA 2JGDB 1DF4A 1VMGA 4DR1B 3T9BA 4APMA 3GTPA 1Y76B 1WLEA 1N33B 5KFQA 3N42B 4DV2H 3IFXA 2YXLA 3ETQA 2L35A 4NXMB 4K0KB 4LC1A 2CAZC 3DXRA 5KFEA 2JGDA 4JI0O 4WFAV 4DUYO 5KHJA 3TXSA 5KHHA 1Y76A 2HHHH 2BCCH 3CE2A 5DQGA 5KG0A 4JYAB 2UUCO 4I7ZB 5DISC 1Q82W 1WP8A 1I6UA 3K9AA 2B1IA 2XUMA 3ZHUA 1BT8A 4EKWA 4DAAA 3Q8QB 2YZMA 3N6XA 5JUMA 5EK0A 4H44B 4PA9A 4DR6B 5KFBA 5C1OA 3ABMC 4YJ3F 1H8EG 1IDSA 3FYIB 5CA0F 1VBHA 5EZYF 2P4VA 2BQRA 2QWPB 5KFNA 3DGEA 3UQ8A 4IYHA 4MTDA 5KFJA 1O9HA 1GM7A 2ZDGA 5LHGA 2WLJA 5D5QA 1TWGA 3TQTA 3ETGA 2CGNA 3U11A 4CC5A 4LF8H 2W6NA 4O4LF 4PZ6A 2RDIA 1FPOA 1A0GA 2YXHA 3MFHA 3K5LA 3O65A 3OR7C 3APQA 4GUNA 1FXKC 2P67A 3JCUZ 1YI2V 3BABA 3JD1A 4FVMA 2EIJB 3RV3A 4EBCA 2QR4A 2XCLA 4A3FG 3X2QC 4Z2WA 1U96A 5JCOC 2R9IA 1S5LZ 1K73W 3BY6A 2CKZB 1ULZA 2XGPA 4X64O 5KFVA 3UO3A 1JR9A 4KFMA 5B1BC 4YY3B 4R50A 5DMXA 2M6YA 3F8NA 3ASNC 1X59A 2CDYA 1QLEC 1I1KA 2DIKA 3OE7G 2ZR2A 3H01A 1GM8A 5BWTA 2IJJA 4X62O 2ASJA 4LF5O 5EBLC 3T9EA 1H2NA 2YDEA 4B3SO 2WLNA 1JOYA 4RUFA 4J7KA 3OD4A 4EGQA 1PPJH 2EJ2A 1R3KC 4I7HA 4H33A 1N56A 4IRDA 2GUZB 1Z2GA 1N36B 3ZMSA 4IYIA 4DV6O 1YDXA 2HR3A 1CPYA 2V4DA 1VAJA 1R1BA 2BOCC 2ZXWC 1HNZO 2GUZA 1Q6UA 1AR5A 3BA9A 5DN6G 4HN2A 2ZM6H 4JI6B 4DR5O 4CKBA 3HOVG 3ZMUA 2PTMA 5CA1F 4O4HB 4FLWA 4A3LG 5DG8A 4QWCA 4FLTA 3WO0A 1E4EB 2Q2UA 3HKCA 4AYBA 3CPWU 2C2AA 1EFRG 1YJ9V 2QWOB 1Z2PX 3D36A 4O4HA 1VIBA 2X6CA 4U6PA 1WPXA 3AK1A 3GIPA 4LF8B 1IOVA 4GC6A 1E4EA 4CS3A 3Q1KA 4QGPA 4RZRA 1I7NA 4EBEA 1HNWO 4YR0A 4UCRA 5LGNA 4FFRA 2FLNA 3ICXA 4C2MA 1QHTA 1VQ9V 1N32B 5EWGA 2CUGA 1GSHA 3RYFB 1GN2A 3CRAA 1X9NA 1COWG 1Y1WG 2DQ3A 3N8DA 1P7GA 4DUZH 5D5PA 1VQ6V 4LFAB 2QB5A 2R86A 3AW8A 4FLVA 2XAHA 3I56V 4DR4O 3ZIAG 3SGIA 4J7ZA 1I1MA 4FMTA 2VOBA 3B8NA 2W57A 5BWXA 4DV7B 5FLMG 3GV7B 5TISZ 4J9KA 1K9MW 5DGHA 3CX5F 1TVKB 3ZN0A 5LP6F 1BXRA 4RUCA 3TIGA 1IBKH 4XYMB 2QTSA 1JFFB 1R3JC 3E83A 2XAJA 1Q7YW 1FXVA 1NI8A 3TIIA 4CS2A 3K3PA 2AZ0A 1W0KG 4O2AF 3SJCC 2QM7A 2R84A 2DPIA 1S9FA 4H0LB 1AJPA 4ED7A 1B33N 1IBMO 2G38A 2CFMA 1JFFA 4YJ3B 4JI1B 5CA0B 1Q90D 5JJJB 5EZYB 4TOIA 4NVPA 3GQCA 3C0FB 2VPSA 4KXRA 2UVWA 2R72A 3I4NG 4MV1A 4QWDA 4FFBB 4YJ3A 5CA0A 2WLMA 3DTFA 5C5JA 4EYHB 3RR5A 1MZEA 2ATLA 5I47A 4O4LB 4B3MO 1YJWV 4NB5A 2DABA 1J95A 2WA4A 1JMKC 4YB8B 2XASA 3HOYG 1OBGA 3TETA 4EYIB 3T5JA 4O4LA 4PV1B 4QPKA 2PMZE 4F4LA 2W6PA 5IYZF 1JXLA 4LFCB 1A3GA 5BPHA 5L3BA 1JX4A 2W9AA 4A3GG 1R6KA 2OIEA 5DG9A 1KUTA 3GTQA 3GDEA 3GTKA 2CZGA 4DL2A 4NTWA 3K0DA 2ZE7A 2E2IA 3BFRA 1SFOA 2VUMG 4MTXA 4W4LA 4W4KA 4BIZA 4IT5A 1XMOB 3LSSA 5E1AC 3W5OA 3WG7C 2DOSA 4O7RA 4MV9A 4QE7A 5DECA 1CQIB 5LBQA 5F2VO 4DV5B 1AVMA 3R65A 5IP9G 4ECRA 2IU3A 3DTGA 1ROPA 3VBBA 3ZJZA 4DV4O 4GZRB 2HG5C 4U3FH 1WAZA 5J9PC 1Z5VA 2CH7A 2UXNA 4J9NA 4FFKA 4ZQIA 3H0GG 4GX1A 2CW8A 4HYOA 5E25A 2CGOA 2EJRA 4Z1MG 4WBNF 2RMKB 1K5SA 3W7WA 2NLJC 1FFTB 4J9RA 3CMAV 3K5NA 3A8TA 1FKAO 3K04A 4FFMA 1T5EA 5CA1B 4O3OA 1RK5A 5BR8H 4MS2A 1U97A 3ZEDA 1I94H 2WSSG 2EZPA 2IM9A 4TWKA 4MTOA 5DM6V 2DYRC 1OJHA 4C7UA 3T1YH 3PO3G 1GTOA 1SRYA 4DV3H 2EIKB 3Q4HB 1IBLH 1KTAA 3JASB 5GW7A 3H1IH 3OUZA 1SQQH 4E4TA 5IY5B 2UXBB 1M56B 3AG1C 5KFYA 1IXMA 2PUSA 3CSXA 4ASUG 4DV2O 3G80A 4WCEV 5KG7A 1EHIA 4EEYA 3PO2G 2NVXA 3T9CA 3Q4HA 4R8CA 2BSKB 4GX0A 4TT3G 3JASA 3WO1A 2ZDQA 1DK1A 3OHBA 4KHPB 4MTGA 3KXYT 1PM9A 1QCEA 2W8KA 4DL6A 3RFRA 2HHHO 1NZ6A 1WPBA 1ZQ7A 1BNCA 2DYSB 2BSKA 5LA6F 1DF5A 5I5TA 4YIPA 5KFIA 1N36O 4JI3H 3AX6A 2HVRA 2YRWA 3QG5A 4CH5A 3CCUV 2QDOA 4MV8A 4JTDB 1MA1A 1AB3A 1KYOF 1I0HA 3ABKB 4LF6B 4GKKB 2CTQA 5KG2A 2FLPA 1MSWD 3U9SA 2DAAA 3HKZA 2P4KA 1G4YB 5LP6B 1AILA 1EKFA 1KP2A 1NU1H 2DQ0A 4E6NA 3T2MA 3UT5A 2IJHA 3Q8PB 2NUAB 2OIGA 5LP6A 1L0LH 1H38A 4TV8F 2YYAA 1RP3B 5L1KA 4LF8O 2LGQA 4NYKA 4JV1A 3SPIA 1JA8A 1V9PA 4PZ7A 2ZDIC 2V1DA 3B09A 3OMIB 5DQHA 5LL6b 1R6TA 1HR0H 4EQ5A 1GSAA 4ECWA 3PJSK 2VUGA 4Q4CA 4ZI7F 3PW5A 3CCQV 1WJZA 2Y4TA 3E89A 1CKOA 1SZTA 3G6BA 3ZMZA 2RGRA 3LP8A 2FL4A 4NZNA 4RB3C 3D8CA 4OX9H 2KG7B 3T9FA 3JAMW 3RB3A 3TK1A 1URFA 1G6UA 1GN3A 2ZD9A 4F6RB 5KG1A 3OUSA 5IYZB 3LWBA 4ETSA 5KHIA 3QO8A 2KG7A 4JV2A 4YAKB 3MHSC 2UUBB 1S0VA 1XNQH 4OPHA 1FYJA 4F6RA 3FAVB 5LMNB 1KMIZ 5IYZA 3GV8B 4HAMA 5KFRA 4TUYF 2WAQA 3WFVA 3GTGA 4DIMA 5IWAH 4P9PA 4O7LA 2EX3A 2HEPA 3BJYA 3HOZG 4DR3H 4XYLB 4NKGB 4JI0B 4AQYH 3FAVA 4DUYB 2R7LA 2ZM6O 4UCSA 3THOA 2ZE5A 2IH3C 3GIJA 2FPGB 2UUCB 4Q4DA 2JA5G 1QR8A 4PDVA 1KT8A 4FLYA 1MOFA 4BW5A 1IXBA 4UB6Z 1YCIA 3N6RA 4AILC 2YIBD 2YI8A 1UC9A 4O3SA 3BCCH 4RQFA 2PI4A 3LDCA 2K9PA 3WWHA 2JEGA 2Q6AA 1ZHSA 2IBKA 3EXAA 1C30A 3RBZA 3ABMB 4O81A 5KFSA 4IAJA 1SKVA 5CE8A 4QW9A 2R8JA 2AHZA 2PGGA 4GLXA 2YEVB 1M7JA 4NZMA 3GIDA 2UU9H 4LNUB 1KJQA 4ZHQF 4N21A 1M9NA 4IZOA 2YEVA 3GV5B 1GN4A 2PN1A 5KT5A 5DGIA 4Q44A 4LNUA 4JGSA 2RF4A 4FFPA 1KJIA 3BA8A 5J2TF 3CQZA 5LL6Y 3U54A 5GTHZ 4FM2A 2Y48A 5LYJB 3TY5A 3FMAA 1FXKB 5H5NA 4TSFG 1CQJB 5L3FA 2WTFA 3M9OB 4DV5O 1EN4A 4Z1VA 5KFPA 4J9OA 4X64B 4AI8A 2F43G 3JD3A 5LA6B 2KB1A 3X2QB 1IBKO 5DLGA 3OMNB 3KHGA 3SJBC 3CCRV 4B7KA 4E4EA 5LYJA 2R8IA 4EEQA 1FXKA 2BQUA 2AHYA 1SERA 4X62B 4IWXA 2CNUA 4LF5B 4X65H 2FMAA 1UJWB 5E79Z 4B3SB 5B1BB 3CJHB 3ASNB 5KFMA 1SZXA 2A1HA 2FKLA 3OT7A 1QLEB 4PI2A 2XGQA 5CA3A 2YU9A 1H2KA 3K5HA 2C2DA 2Q69A 4DV6B 4G3IA 1A32A 4JYBA 3CJHA 4JI5H 3AG3B 1AUXA 3J81W 3KHHA 3SPHA 5DGBA 1FJGH 4UCUA 1HNZB 5KFXA 2WDTA 4FFOA 4TV8B 1JKJB 2YWVA 3HBLA 3K3VA 2R7NA 3W7TA 2Y0IA 3RGXA 4BIUA 4DR5B 2OYQA 4JF3A 3RV4A 2QF7A 2R8HA 3DC6A 4BY1G 4FE2A 1RSOB 2QYZA 1E4GT 3QNEA 4ZI7B 2R7MA 3GIIA 2R9AA 3K59A 2LJ2A 4CMFA 3LNMB 3DSQA 4UV8A 1O9GA 1JIHA 1RSOA 2B63A 1TWAA 2UXDH 2Y0SE 1BQZA 4ZI7A 2PMZA 3SJQC 4PDMA 1HNWB 3EHBB 1RPOA 2YC0A 1XDNA 1N8RW 3B8MA 3MD0A 4JZGA 1IYDA 5EIBC 4HZ3A 3V4ZA 3SPGA 2ITCC 3U0ZA 4GC7A 4FBUA 1XREA 2F1MA 2YCHA 1MSDA 3BQ0A 1XNRH 1B06A 5KG6A 4X66H 2W6JG 2ADPA 1CXZB 2LW1A 5KUMA 4DR4B 1Y4MA 4TUYB 1AI7A 1PP9H 3PVXA 2WA3A 1IURA 2JGUA 4LMYA 4FPPA 4ECTA 2RJZA 1I5XA 2Y0PA 1Z2NX 4TUYA 2YZNA 2K1EA 4RQEA 3ABTA 3WNZA 3V6KA 5BR8O 4J0MA 3RJ0A 1I94O 2XCPA 5IJ9B 3LQSA 4JXUA 5DAAA 4YHHH 3N43B 2JA7G 3CCEV 4FIPC 1RM1B 4WFGA 2Q67A 3T1YO 1IBMB 1KJ9A 3SPCA 3SNOA 4YP3A 2EZOA 1WP7A 4DV3O 1IBLO 5BY1A 4LH7A 1LR1A 4ECXA 1GN6A 4UCOA 3SR2C 5IJ9A 1WSCA 2EULA 4F50A 1VQ4V 5KT6A 2F93B 5EBWC 4EFEA 2HG8A 3T5KA 3VMMA 2YS7A 1VF6C 2FK3A 2R6FA 2B1GA 4LF9H 4TQRA 2A9HA 3K9SA 3FD9A 4UUJC 1GRJA 4UVCA 5LMNO 2C2EA 4YJ2F 4QWAA 4A93G 5BWUA 1CKMA 3JALB 1AN7A 1G8MA 1AR1B 4J9SA 1BGWA 5J2TB 4QJFA 4JI4H 4DL4A 3AG2C 2V59A 2COJA 4LCUC 4UVBA 3RYCB 2DWEC 3LDDA 5IYDO 1L2ZA 2GV9A 2W6OA 3JALA 4XDLA 2PY5A 3AK2A 2CTWA 5D1PA 5FNVF 5IT9W 5J2TA 3VPCA 4FK5C 4FM9A 3CMEV 4GX2A 2VQFH 1J5EH 3APOA 5KX5F 3HKZE 3RYCA 1ZWIC 3VPDA 3FB8C 4M9UA 3T54A 1E4FT 1AI4A 4HR7A 2UVRA 2FTKA 1RJPA 5JQGF 2HJDA 5CB4F 2ADQB 3AG4C 3QO7A 4LF4H 1Q3EA 4Q6GA 5KFLA 5FLXN 1XI1A 3VOTA 4DV4B 4FBTA 2UXCH 1H2GA 3OAAG 3UM7A 3WG7B 4LF7H 1B6QA 3MWEA 3QZ7A 3DTUB 1HR0O 4FS1A 2B5UA 2ZE8A 3JZIA 1I08A 2WWWA 1IX9A 1KC7A 4TQSA 1SA0B 1M90W 4EBDA 2QWQB 1VF5B 3JAKB 4G27B 1P7BA 5KFCA 2HVJC 3G4SV 4L1KA 4UCVA 3OSNA 4OX9O 1PKXA 4CMDA 3TGUH 5H2FZ 1SA0A 5EDWA 5FD6A 2J6SA 3OUFA 2Z04A 2PYLA 1W59A 1M0WA 2W6QA 3ABUA 1I5YA 2NR5A 5L9XA 4JUZA 2QKAA 4MA5A 3H40A 5KFGA 3SYCA 3H1LH 3GTJA 2O57A 3RTXA 3L74H 2IMWP 2DYRB 1KQSU 4CZZA 4A3IG 4DV2B 2IH1C 1YXBA 5IWAO 3A2FA 3V6JA 5LMUH 5EYPB 4DR3O 3WWJA 4AQYO 2WAQE 2FPPB 1OBDA 3AG1B 2HHHB 5I5VA 3UZOA 2YRXA 1NS1A 3ZRVA 4PJ0Z 4R8UB 2W0FC 2CW7A 5EYPA 5DG7A 4ECVA 4ZIBA 1S0NA 4C5AA 2QWRB 1TWHA 4NR1A 4DV1H 1NBMG 4RZQA 2V9WA 2C28A 5BWRA 3ZRXA 2HIXA 3K08A 2Y69C 4MV3A 5J2UF 1IVSA 4R8UA 3TINA 1PNLA 4WFHA 3IG0A 2QM8A 4ECQA 4EB6B 3PFFA 2ASLA 1MZFA 3JD4A 3ZBHA 1T94A 3KG2A 3KKYA 3HKBB 3RVYA 1MABG 4U3JB 4EB6A 2BTQB 2JK5C 4PELA 1JQ0A 3FKIG 4GYCB 3R9RA 2UU9O 5L1IA 3MAQA 4A2BA 1NR1A 3HKBA 2YS6A 2GPSA 1BCCH 3ML0A 4U3JA 2DLNA 1A48A 5IYCG 2F23A 2VQEH 3TY8A 2BTQA 5JQWA 5KAIZ 1BSMA 5C3EG 2D2CB 3T9AA 4D7SA 3K03A 2E74B 1N34H 2EINC 2HVKC 1T36A 1LUVA 3RB4A 4JASA 2ALZA 4MVZA 3GWKC 3JSNA 3WU2Z 5C1PA 2COIA 1I2KA 2A79B 1D5NA 3DF7A 2XIGA 4B3TH 4F4YA 1XMQH 2YIBA 5LXTF 2JRIA 3RYFA 2Q73A 5L3GA 5L1JA 4JV5H 1K7DA 3CEIA 1NTMH 2ATKC 4HYKA 1QNMA 4X65O 3NUAA 3ASOC 1ZLZA 4NTXA 3K06A 1Y14B 5K2MA 1HNXH 3RB6A 2B9ZA 3UYYA 4TM5A 2VA2A 3ZHRA 5FNVB 4Y8VB 5LGTA 2XAFA 2KQXA 5KX5B 1W0JG 1GKFA 1W2BU 4JI5O 1JJOA 1TVKA 1FJGO 2YI9A 3SPJA 4FFNA 2FK2A 4F4ZA 2QGNA 4NXNH 3I4MG 5H6QA 1JDBB 5JQGB 2E5LH 5CB4B 2ZM6B 1KP3A 3T9DA 5KX5A 5AG2A 3LUTB 1SEIA 5FR9A 1YHQV 4J9ZB 3SYQA 1V55C 1K1QA 1VQPV 1YVWA 4JI8H 3RFCA 5JQGA 3BQ1A 4JAUA 3IC7A 3Q8RB 5CB4A 1GAXA 5EZYA 3VPBA 3OTFA 2R8KA 2QM4A 1O75A 1OCCC 2UVUA 1EYZA 4ECUA 1F51A 3K58A 4DR7H 4MTEA 2FMLA 2UXDO 2W6ZA 4FFBA 3W1BA 4B08A 4WD3A 1M6VA 4BAYA 4I50F 1AR4A 5HFMA 3FKSG 3R66A 1GGOA 1KECA 5BMVF 1AP5A 5KFDA 4O86A 4YR3A 1RJRA 2FE3A 3GWOA 1IOWA 3G6EV 3KAKA 2X7RB 2Y0SA 2DMXA 1AI6A 4MV4A 3N27A 4X1KB 3ORRA 3WB2A 2DWCA 2HJWA 4DUZB 3E8HA 4LFBH 4X66O 4IHJF 4I9WA 2QKSA 4E2LA 3E2EA 4X1KA 5K1PA 2ZDHA 2GBOA 1KEEA 3OW2U 3U0GA 3QZ8A 1DAAA 2NU7B 1K97A 2AGAA 1PD3A 2F4VH 2ZKOA 3TW6A 1L0NH 1I2LA 3MJFA 5D1OB 5HNEA 3QTCA 4TQDA 1IBKB 1D5AA 3PW4A 4FLXA 5K1XA 3JZ6A 4UXNA 3RT3C 4RAYA 3OM3B 3RN4A 5KFUA 4O7NA 3K79A 3W7XA 2LQTA 1AJNA 4YHHO 2FYUH 1P49A 4X88A 5J2UB 1SC5B 1BQ0A 3T99A 1B3QA 3SYAA 1EUDB 1S03G 1XILA 2CQYA 4TQFA 5EWFA 3Q2OA 1I1LA 1CP9A 1P84F 3A0BZ 5J2UA 2VS0A 3B2EE 5F9NA 3AG7A 1XEQA 2OCCC 2P6JA 3T1HH 4RCNA 2BQ3A 3CRRA 1R73A 2YZGA 5A9GA 5CA1A 1AP6A 3UZBA 2Z5UA 1K3EA 5EC1C 4JI2H 4LF9O 1S77D 2PZSA 3CXCU 2ZNIA 1OCOC 4D6TH 5L3DA 3C3SA 4PD4F 2N04A 2V5AA 2W71A 1E1QG 5GTIZ 3ETEA 3ZHTA 1R3IC 3RUPA 4JI4O 1HW7A 4G28B 4RO2A 5KAFZ 2BOBC 2FKXA 4K35A 3N44B 1JLLB 4P9OA 3PZPA 3CCVV 3ZCCA 4BBRG 3RW0A 3L72H 5LXTB 2M05A 4DK0A 3M9NB 1PK8A 4IRKA 5I60A 3E8FA 1WCMA 3WB1A 3FX7A 2RCVA 1VARA 4PA3A 3UCSC 5LXTA 2IU0A 3CC4V 3F5WC 5D8DA 5JWPA 4Q20A 1KUQA 3EFFK 1QR9A 5KT4A 2HJFC 4WFEA 4DRFA 2UXCO 3CVZA 4LF7O 2PVPA 1DV1A 4O2AB 2ODMA 2Q8VA 3EPIA 3I5DA 3BVOA 4B3RH 2I87A 1FFXB 4O82A 4QSHA 2W8LA 1PV0A 2HFEC 3H4DA 2R82A 5IYBG 5BXZA 4F6EA 2YIAA 4O2AA 4O7ZA 2OT5A 4OXSA 2Q0AA 4GCZA 4O7SA 1Z2OX 5BR8B 1SQPH 4YIOA 3OHAA 1I94B 2V4RA 4BWAA 4Q43A 1N0JA 4YQWA 5IE9A 3T1YB 2YXYA 3J80N 4DV3B 4C5BA 1M4UA 2ZCEA 1IBLB 1S5HC 4JI2B 2FP4B 4J9PA 1NH2D 4I50B 3W7SA 1TAEA 3GVMA 4NZOA 5BMVB 3G67A 4A2AA 2R92A 3OR6C 3MFIA 2W7PA 4DL3A 1H2LA 3QO5A 5LMUO 3KAJA 2JA6A 4GKJH 1UNNC 4I50A 3E35A 4KUMA 4UFZA 4I55F 3NR7A 1YZBA 3MR2A 1WA8B 2W9CB 3NBZB 3UO2A 2W6IG 4J11A 4JI3B 4IHJB 3V4SA 5JVDF 4K6NA 3OTOH 5KT7A 4MVOA 1WA8A 2JVDA 1OHHG 4PZ8A 1VQOV 2CNQA 4DV0H 3GB7C 1P8LA 4IHJA 1VF6A 2RDCA 1WNSA 1KBHA 4CKCA 3F7VC 2QKCA 3BEHA 4PA6A 2E75B 2HLDG 5B1AC 2XHBA 3AG2B 3IGAC 4XZ3B 3ZN1A 1NVPD 4FZ1A 1K8AW 2JEFA 4I5SA 3NXSA 4X8AA 3L71H 1Y1VA 3LDEA 2W9BB 5HFLA 5KFHA 4WBNB 1JCHA 1V4YA 1IZ3A 3K5OA 3I55V 3VQYA 4FU0A 4Q45A 3PW0A 1VS0A 2WB1E 1WH2A 2VQEO 2OH2A 1VQLV 2QWNB 4OGQB 3LMLA 2X0SA 5KA5A 1HR0B 2W9BA 3R5HA 1N34O 2R93G 4WBNA 3AG4B 3AK3A 2A3QA 3G6YA 2R9RB 1VQKV 5F9LA 5GONF 4ZKIA 4JZ2A 1RYRA 4B3TO 4UB8Z 5DEDA 4DUZO 2VWJA 1YJNV 4OX9B 3JD2A 4Q8FA 4WFFA 1UPGA 2SCUB 4C5CA 5C4XG 2UXXA 1S76D 4JV5O 4R6ZA 4GX5A 3HO8A 3CP1A 4U7CA 3MR3A 4QPJA 4J9LA 1DLBA 2EIMC 2J6UA 2FB9A 3RAQA 2ZE6A 3K5IA 4FZ0A 1HNXO 3B4SA 1XNQB 4ED3A 4BXXG 4UUGA 2XTAA 5KFTA 3J7AK 1D2DA 2V7QG 1I50A 4OPAA 2DWDC 5IWAB 3B40A 4HNAB 4BR6A 1VQ8V 4DR3B 3OUUA 2C00A 3EVKA 5LA6A 4NXNO 4AQYB 3TXQA 1KKDA 3FB6C 2E5LO 2OTJV 2P06A 5JCOA 3CC7V 3QF7A 1SQFA 2VR1A 1ZAUA 2F66C 4DR2H 4FM0A 3P30A 3CCSV 3JARB 5CBFA 3HB9A 4JI7H 4HNAA 3ETHA 4O4IF 1N0NA 4LH6A 5C44G 1BMFG 3M4IA 3OGCC 4RB0A 1EM1A 3OFNG 3JARA 2ODTX 1HP8A 3W7UA 1BGYH 2PF4E 4DR7O 4PDRA 1EZVH 1H2SB 2ZXWB 3G71V 3FDSA 4TV8A 2Y69B 3S3XA 4QWBA 4HNTA 1S0MA 3N40P 3KZIZ 3TCUA 3SYPA 3M7MX 4DW1A 1NTKH 4FFLA 1ET0A 2IA6A 1K83A 2UU9B 3T1CA 4I9QA 1Y74B 2I80A 4LBEC 5B3SC 3GJXB 5JH7F 4LFBO 2CK3G 5KG5A 4EGJA 2CTRA 5KHKA 2MK3A 1PNMA 1Y74A 4ABMA 2UUAH 4ZOLF 4K8ZA 4ECSA 2DYSC 5KA6A 4QE9A 1OV9A 4I55B 4KP4A 1ZX3A 3HOUG 2F4VO 4B3MH 4LSAA 4PDLA 2EINB 1NKDA 1B6RA 2LGWA 3HR0A 4DR1H 3VQWA 3RYHB 3U10A 4J9MA 1N33H 1G1XB 1VKZA 1VQ7V 3N2GB 5H80A 4I55A 1GK9A 2A0LA 1GO3E 3H3VH 4X65B 4NXMH 2BR0A 1VQ5V 2IJKA 4K0KH 3HOXG 2Y4RA 3RYHA 3ETDA 3N2GA 4LWSB 1M1KW 3IAYA 1LNQA 4DLKA 4RNMA 2R87A 3NGDA 4J41A 4IGGA 4JYAH 2O03A 3FYEB 3L4JA 3ASOB 1FS0G 1SQGA 4JI5B 2GLTA 1SCUB 2W0XA 1FJGB 3T1HO 1E79G 4LWSA 4DW0A 1Y1WA 4A3KG 4DR6H 3ZHQA 4JI2O 3AYHB 1JVMA 1EBOA 4RB2C 4A5UB 4O3RA 4NYEA 3L9DA 2LP7A 4HNVA 4NTYA 1QBZA 1MG1A 1K4CC 3STZC 1VQMV 4CBCA 1RK6A 1V55B 1K5QA 5GONB 4ZHQB 4CH3A 4Q0YA 2UXDB 5H9CA 3FB7C 1S10A 2P22C 4JI3O 2E2HA 3MWDA 4RUAA 3E8BA 4IRCA 1OCCB 2QEXV 2W7OA 1FAFA 4B7EA 5GONA 4ZHQA 1XHZA 4TVIA 2P0AA 1SYXB 5EIBD 1F4NA 1F7YA 2JDIG 5CM0A 3GILA 1B6SA 4ED2A 1WRVA 5DGAA 3VQXA 2P90A 1XNRB 3H1HH 2WLHA 4X66B 2YUAA 4YY3H 2CTPA 2OCHA 1MZBA 3STLC 1AI5A 4UVAA 3HOWG 1ORQC 1IYEA 4IR9A 1F4MA 5L3EA 2IJIA 4B3RO 5KFOA 1N4CA 2FJZA 1NR7A 1SETA 4YBZB 1XBLA 1AROP 1OCZC 4DL7A 2QSAA 1QVFU 2W70A 4A3MG 2F95B 1WB8A 2AXTZ 4O4IB 1N36H 1B04A 1VP7A 1OWTA 1UFIA 3E8GA 2YW2A 3P3NA 1US6A 2N74A 1FD9A 4YHHB 1JX9A 2Q7EA 5KS8A 4RWUA 4O4IA 3K0GA 4JI6H 1ZHQA 2LW7A 3RIZA 1M5IA 2A7WA 1BJTA 5JJEB 2VUMA 3CRCA 3FB5C 2Z0AA 4HNUA 3JAKA 3JSLA 2Q2TA 4U7OA 3RB0A 4UCTA 1PL4A 1H2MA 3BRCA 5KG4A 4GKJO 2YICA 5BPFA 2H3OA 4LF9B 1XNQO 2DJVA 4X9QA 2OCCB 5JH7B 1HDJA 5KFZA 5T14A 1OCRC 1GSOA 3F5TA 4LP8A 3OTOO 1M57C 2FLLA 5BZBA 1GO3F 3L4KA 3H0GA 2BTOA 4ZOLB 1N32H 4JI4B 2QK4A 5KFWA 2EILC 4HQ6A 1OCOB 1NH2B 5C8YF 4DV0O 4D7TA 5JH7A 5CBHA 2XCAA 3TEKA 3K5MA 3KALA 1Q5OA 1M93A 4ZOLA 2RQ6A 5L3CA 3EPGA 3GIQA 1SS3A 5DLFA 4LFAH 2IP4A 2VQFB 1J5EB 2NU9B 2HIVA 1Q8IA 2XAQA 3CRMA 1BHAA 5IDJA 1CKNB 3G8CA 2C22A 2R7ZG 4MVRA 4DV7H 1EKVA 3SJAC 4JYCA 3AG3C 4XBFA 4LF4B 2JS3A 1K4DC 2BE3A 2HDKA 2B63G 1CKNA 4JYYA 4R7RA 2UXCB 2R8GA 4LF7B 2Q68A 1GH6A 2VWKA 4BIOA 1QQCA 2FPIB 2HGWA 3JRXA 1ZSPA 1RJQA 3RYIB 4WF9V 2Q7DA 3BHPA 5LGUA 5I5UA 2WB1A 3JRWA 4IR1A 4ECZA 1Y67A 1NVPB 2GDSA 3HKCB 4JI1H 2Q7GA 4I4TF 3ZRSA 2GQSA 4N23A 3RYIA 4PI0A 2YS8A 3RF2A 1YTFB 4A3JG 3ABLC 4M7EA 4CHIA 2LFRA 1XOUA 2KSWA 4K3AA 4X1IB 1Q81W 4F4WA 4O3QA 5FLXW 1KBLA 2J9GA 2ASDA 4QIWE 2LO1A 3CCLV 1BZKA 3CYOA 4YJ2B 3ZRWB 5IJ0B 2ZDIA 2VRZA 4X1IA 2EJ3A 3R23A 4QW8A 5IYCO 1XUQA 4O7TA 1BL8A 3U9TA 5LMUB 3KREA 4LFCH 5CR5A 3ZRWA 5IJ0A 4YJ2A 5LHIA 4PDBA 1EN5A 2LFSA 3G6XA 4J10A 1WR2A 4MVMA 4DR2O 4JTAB 3KHRA 2WE6A 4JI7O 1Y6XA 3MDSA 1W96A 3U55A 2R7KA 4Q8EA 3FFQA 4DV1B 5CAEB 2YSUB 1XMOH 3TY9A 4XX0B 1F23A 5EBMC 5FNVA 3QQMA 4FM1A 1DTOA 2ZR3A 4XDKA 2AW9A 1V54C 4RAZA 4DV5H 1RM1C 3L2PA 3ZMVA 4H37A 4O2BF 3KYHC 2Q4PA 1TA8A 3T4DA 2JIZG 3AEIA 3K57A 1P4RA 3LNNA 2WYOA 3R5FA 1ZUQA 5B1AB 3MHHC 2DW4A 2WLLB 4XDJA 5CN0A 1W93A 2ZIMA 3O9OA 2VQEB 5EC2C 1Z5WA 4DO2A 5EOYA 4EFBA 4O7VA 1N34B 2EIYA 1SQXH 3E22B 2UUAO 2WLLA 4A3DG 3G6VA 1VQNV 3P3PA 5L1LA 4NLGA 3GTLA 2QTOA 4O84A 3RVZA 5KT3A 1G2WA 1RFYA 4B3TB 2JEXA 4GLWA 3PN1A 1R9TA 1XNRO 2JA5A 1XMQB 3BG5A 3E22A 2W6MA 3BACA 4DR1O 2UXBH 4J9QA 2JA8G 4JV5B 1N33O 3JD0A 2IBZH 1KC8W 4YAJB 5I5YA 3RGZA 1RYSA 2MCTA 4O4JF 1CS0A 2MW2B 1XDCA 3NBYB 5BYBA 4JAVA 5A2QN 3G8DA 4NXMO 4O7YA 3CC2V 5C8YB 4K0KO 4FS2A 2WPDG 1I7LA 1TWCA 4KHPH 4P2ZA 3LULA 2WAMA 4HBNA 1S3JA 3HB3B 1HNXB 2V4QA 3GIKA 3I12A 4TV9F 4X20B 4UV9A 3L73H 4WFBV 4JYAO 2RGVA 3TQ1A 2QJ1A 5C8YA 2EIMB 4AHCA 3TJTA 5KG3A 2R93A 3EYYA 2XT9A 4MV7A 4X20A 1TWFA 2COGA 4MAMA 5D1OA 4NXNB 4LF6H 2I8CA 3F7YC 3T7AA 5B66Z 2E5LB 4GKKH 4DR6O 3DAAA 4GT1A 4CKEA 2CH7B 4K8XA 3IN5A 1I7FA 2R70A 2AGOA 2Q5ZA 3JCZA 2VQDA 4BWSC 4JI8B 3CB2A 1THZA 3RAXA 2X5RA 3OEEG 3JAMN 3MR6A 2ABJA 2EIJC 2HVQA 4WHXA 4MW3A 3LSUA 4DR7B 3CRQA 4I4TB 3CSWA 5I5WA 1XK5A 2GSMB 5FD5A 4QIWF 3D3IA 1XHXA 2H8PC 4ED0A 3QWUA 5EWEA 2X6AA 3T5LA 3VQVA 3M8AA 2ZT9B 3ZHSA 2OTLV 3B77A 3HKDB 1ZTEA 2NN4A 3KCXA 1TGOA 4MSWC 4I4TA 1QLNA 4J9YB 1R3LC 1Y66A 4ZBMA 3H1JH 4YR2A 1DV2A 1Q86W 3HKDA 4F4XA 2DE0X 2ITDC 5KMGB 3OGIB 4LFBB 4YY3O 2VQFO 1J5EO 3SDLA 1WB7A 3JYCA 1KKCA 2PBZA 1RPRA 3E5NA 5B3SB 2Y4UA 4J42A 3K3WA 5KMGA 4DYLA 1GMGA 5LYJF 4MTFA 1SF9A 2F4VB 4LF4O 2UUBH 3UKMA 2YIDA 5KKNB 3OEHG 1T3NA 5LMNH 2NVYA 5I5SA 1PX2A 3NC0B 5BWVA 5KFAA 4LSXA 1XL6A 3BAAA 4MW8A 5KFKA 1TUEB 1Q6HA 3QFFA 1S0OA 3D36C 3MWMA 2UVVA 4JI0H 3CS5A 4DUYH 5KUKA 3VNNA 1Q43A 3UT5B 2V58A 4JI6O 4IWYA 2AQ4A 1DGSA 3N2KB 2ZQMA 4FLUA 2GPWA 2J6TA 2UUCH 2ARHA 3UFXB 3ZMTA 2JEUA 5HV6A 1FFXA 1YF2A 4O2BB 3OSPA 1S68A 5A2QW 3T1HB 2Q9LA 2RDJA 2IW5A 4J80A 3J7AU 1CEZA 3N2KA 2FB5A 3H9VA 4A3CG 1S5JA 3BPZA 4DK1A 3GLKA 1NT2B 5KHGA 3IJ4A 2JEIA 2GTAA 1HWYA 4O2BA 3S24A 1K1SA 3GB8B 2NU6B 4BY7G 1FXHA 3IC9A 5H6RA 4ICGA 2JJ2G 5IYBO 2C35B 1ZETA 1GLVA 2X6BA 4CE5A 2FK1A 1N32O 4JTCB 4CH4A 2DZDA 1E1RG 3A0RA 5BMVA 3KHLA 4IIJF 3MR5A 4PHZA 5ITZB 3H1KH 4RUEA 2NU8B 3HKEB 4J7JA 4LFAO 4MA0A 4H13B 1VBGA 4BW9A 2JA7A 4DV1O 2W9CA 4O4JB 2L6LA 3RBEA 4ED1A 3M99B 4CH6A 1Q6IA 4JAAA 5ITZA 5LOVF 3J81N 4DV7O 3R5XA 2ZNJA 3ZHVA 4DQNA 4FGRA 3HKEA 3Q8SB 1TUBB 4TV9B 1NQTA 3GIMA 3KCYA 1KB9F 4PA4A 4X64H 2WLIB 4O4JA 4MT8A 4RAIA 2HGXA 1QU7A 5DQIA 2RNBA 1XL4A 4ECYA 1TUBA 4P30A 2AGQA 2GQRA 3PW2A 4TV9A 4X62H 4B3RB 4O3NA 2A06H 4LF5H 4RNOA 2WLIA 4B3SH 1YTFD 1DIKA 3PR4A 1GM9A 2E3CA 4ED6A 4JI1O 2H94A 1PNKA 1MMMA 3C90A 1JJ2U 4M0JA 4LR3A 3P32A 4DV6H 3PW7A 1L8DA 1N48A 2EBOA 4FLZA 1HNZH 3VOUA 4PBCA 1K92A 1OCZB 1CE8A 1M0TA 3H20A 4AYBE 3BQ2A 1SQVH 2PYJA 4DR5H 1KJJA 4ED8A 1XMQO 3HT5A 4QWEA 1FVIA 1AUVA 1BHBA 3CCMV 1V51A 3HXLA 3S3WA 5FPOA 4FJCC 3SI8A 3PR5B 1YEWA 5FPRA 2ZINA 2VA3A 5FJ8G 4QIWA 3N41B 4LFCO 4GKJB 1UC8A
chains in the Genus database with same CATH topology
3CSXA 2XIGA 3DF7A 4B3TH 5GONA 4ZHQA 1XHZA 2JS5A 3CHXA 1XMQH 2YIBA 3JASA 1SYXB 5EIBD 1HNWH 3RYFA 4KHPB 3KXYT 4JV5H 3RFRA 3OTOB 4RB1A 3VQXA 1WPBA 1XNRB 4CC6A 4X66B 3J80W 4YY3H 4DV0B 1MZBA 4JI3H 2HVRA 3JATB 3QG5A 1X4TA 1HNXH 4CH5A 5FNVB 4LF6B 2HVSA 4DRXB 4GKKB 4DR4H 5KX5B 3JATA 1JJOA 1TVKA 2YI9A 3ZS8C 5LP6B 2F95B 3JAWB 4NXNH 4O4IB 2E5LH 5JQGB 4E6NA 1N36H 1B04A 4DRXA 5CB4B 3UT5A 2ZM6B 5KX5A 1SEIA 4YHHB 3RWRD 4CS4A 5LP6A 2Q7EA 3JAWA 4JI8H 4O4IA 4JI6H 5JQGA 2P5OA 5CB4A 1ZHQA 3RIZA 1V9PA 5EZYA 1M5IA 3OTFA 4PZ7A 2QM4A 1O75A 1BJTA 5JJEB 1IBMH 1XQ8A 5LL6b 3K58A 1HR0H 4DR7H 3JAKA 3JSLA 4EQ5A 2Q2TA 4MTEA 2VUGA 4FFBA 3W1BA 4B08A 4UCTA 1CKOA 3W1GA 1A0IA 3BRCA 2RGRA 3RGBA 4LF9B 4L8JA 2FE3A 4RB3C 4OX9H 3KAKA 1WN7A 5JH7B 3JAMW 4X1KB 1G6UA 1N32H 3WB2A 4IIJB 2BTOA 4ZOLB 4F6RB 3L4KA 4JI4B 1GYFA 4DUZB 5IYZB 4LFBH 5JJNB 4ETSA 5JVDB 4D7TA 5JH7A 5KHIA 3K5MA 3KALA 2UUBB 1XNQH 1Q5OA 5LP6C 4X1KA 1M93A 4IIJA 4ZOLA 2RQ6A 4F6RA 5K1PA 5LOVB 5LMNB 1KMIZ 5IYZA 4LFAH 2VQFB 1J5EB 2HIVA 1Q8IA 5JVDA 2KKWA 2F4VH 5IWAH 2EX3A 2HEPA 4DR2B 1CKNB 2HGSA 5D1OB 3QTCA 4TQDA 4JI7B 4DR3H 4KL1A 1IBKB 1D5AA 4JI0B 4DV7H 4AQYH 4DUYB 5K1XA 4FLXA 1VF7A 5LOVA 3SJAC 1P16A 4UCSA 3THOA 4RAYA 4LF4B 2UUCB 1CKNA 1P49A 4R7RA 5J2UB 2UXCB 4LF7B 2VWKA 4FLYA 1QQCA 3RYIB 1S03G 4TQFA 3BHPA 4DV4H 5J2UA 4AILC 1KU9A 2YIBD 3B2EE 2YI8A 3HKCB 2ZJTA 2Q7GA 4JI1H 3T1HH 3RYIA 4X1YB 2Q7HA 5CA1A 4PI0A 2ZIOA 3RF2A 1ZHSA 3WB0A 4JI2H 2PZSA 4M7EA 4IAJA 1SKVA 2ZNIA 1FKAH 2PGGA 2KSWA 4GLXA 4X1IB 4X1YA 2UU9H 4LNUB 5FLXW 2UUAB 2OWOA 1HW7A 4YJ2B 5IJ0B 3N44B 4X1IA 4LNUA 4B3MB 3BA8A 5LXTB 4DK0A 5LMUB 4DR1B 4FM2A 4APMA 4LFCH 5LYJB 5IJ0A 4YJ2A 1N33B 3TY5A 3FMAA 4DV2H 3WB1A 3N42B 4PDBA 2YXLA 4X64B 3ETQA 4NXMB 2WE6A 5LA6B 4K0KB 2CAZC 5LXTA 3SJBC 5KHJA 5KHHA 5LYJA 3FFQA 2HHHH 4EEQA 4DV1B 4X62B 1XMOH 3TY9A 4LF5B 4X65H 4JYAB 5FNVA 4B3SB 4DRFA 4FM1A 3CVZA 5DISC 1I6UA 4RAZA 4O2AB 4DV5H 4PI2A 4B3RH 3N6XA 3L2PA 1FFXB 4DR6B 4DV6B 4JI5H 3KYHC 3J81W 1FJGH 1TA8A 2YIAA 4UCUA 4O2AA 1HNZB 2WDTA 3K57A 2Q0AA 3LNNA 2WYOA 4TV8B 3K3VA 3UQ8A 1Z2OX 5BR8B 3RGXA 4MTDA 1O9HA 4DR5B 1I94B 2OYQA 2ZIMA 5D5QA 4BWAA 2VQEB 1Z5WA 3T1YB 5EOYA 4CC5A 3U11A 4LF8H 4DV3B 4EFBA 4PZ6A 1N34B 1E4GT 1M4UA 2ZCEA 1IBLB 4JI2B 3E22B 4ZI7B 3K5LA 2R9AA 4I50B 3K59A 1TAEA 3DSQA 1O9GA 1RSOA 3BABA 4FVMA 5BMVB 4B3TB 4A2AA 3PN1A 2UXDH 1XMQB 3E22A 4ZI7A 3KAJA 2UXBH 1HNWB 4GKJH 4I50A 4UFZA 5JCOC 4JV5B 3RGZA 2MCTA 3NBZB 3NBYB 1XDNA 5EIBC 4YY3B 5C8YB 3F8NA 4JI3B 4KHPH 4IHJB 4HBNA 3OTOH 1HNXB 3U0ZA 2F1MA 4X20B 2YCHA 2JVDA 1XNRH 4PZ8A 4X66H 2RGVA 4DV0H 2QJ1A 5C8YA 4DR4B 4AHCA 4IHJA 4TUYB 1P8LA 4I7HA 3EYYA 4MV7A 1WNSA 2JGUA 4X20A 5D1OA 4LMYA 4NXNB 2XHBA 4LF6H 2E5LB 1N36B 4GKKH 2RJZA 1Z2NX 4TUYA 2V4DA 4K8XA 1I7FA 2R70A 3BA9A 4BWSC 4J0MA 4JI8B 3RJ0A 3CB2A 4WBNB 2ZM6H 4JI6B 3K5OA 3VQYA 5IJ9B 4YHHH 1VS0A 3N43B 1WH2A 2PTMA 3LMLA 4O4HB 4FLWA 1IBMB 2HVQA 4FLTA 1HR0B 4DR7B 3HKCA 2Q2UA 4I4TB 4WBNA 4LH7A 1XK5A 5FD5A 1Z2PX 1XHXA 4UCOA 3SR2C 5IJ9A 3QWUA 3VQVA 4O4HA 2F93B 4EFEA 3HKDB 4LF8B 1TGOA 4CS3A 4I4TA 2VWJA 4OX9B 4UCRA 4LF9H 3ICXA 1QHTA 1N32B 3HKDA 4LFBB 5KMGB 3RYFB 1X9NA 1CKMA 3JALB 1XNQB 1AN7A 1BGWA 5J2TB 4JI4H 4DUZH 5D5PA 4LFAB 3J7AK 5KMGA 3RYCB 4FLVA 2F4VB 3SGIA 2UUBH 5IWAB 1L2ZA 2GV9A 3JALA 2PY5A 2VOBA 4HNAB 2W57A 5D1PA 4DR3B 5IT9W 5J2TA 4DV7B 5LA6A 4AQYB 5LMNH 4LSXA 4FM9A 3NC0B 2VQFH 1J5EH 3BAAA 3RYCA 5JCOA 3QF7A 1TVKB 1SQFA 1ZAUA 2F66C 1E4FT 4FM0A 3MWMA 4DR2H 3JARB 4JI7H 4HNAA 1IBKH 4JI0H 1JFFB 4DUYH 4LH6A 3VNNA 1Q43A 3UT5B 4CS2A 1DGSA 3N2KB 4LF4H 1Q3EA 4FLUA 4Q6GA 3M4IA 3SJCC 2UUCH 1XI1A 4RB0A 4DV4B 2UXCH 3JARA 4LF7H 1FFXA 2CFMA 1JFFA 4YJ3B 4JI1B 4O2BB 5CA0B 1S68A 5A2QW 5JJJB 3T1HB 5EZYB 1H2SB 4TOIA 3N2KA 4NVPA 1SA0B 3C0FB 2VPSA 4TV8A 1S5JA 3BPZA 4DK1A 1NT2B 5KHGA 2R72A 3JAKB 3N40P 4FFBB 4UCVA 4O2BA 4YJ3A 5CA0A 3GB8B 3S24A 3RR5A 3M7MX 1SA0A 2UU9B 4I9QA 5FD6A 4O4LB 2PYLA 4CH4A 1M0WA 3GJXB 1JMKC 5KHKA 5BMVA 4O4LA 2UUAH 4PHZA 5ITZB 4K8ZA 3RTXA 3HKEB 4LFCB 4I55B 4BW9A 4DV2B 4O4JB 4B3MH 4LSAA 3GDEA 3A2FA 4CH6A 5LMUH 5EYPB 5ITZA 4DR1H 2ZNJA 3RYHB 3U10A 3VQWA 3HKEA 1N33H 1TUBB 3N2GB 4I55A 2HHHB 4TV9B 4X64H 1XMOB 4O4JA 4X65B 3W5OA 2CW7A 4NXMH 4K0KH 4MV9A 5EYPA 4ZIBA 3RYHA 1TUBA 4DV1H 3N2GA 4DV5B 3IAYA 4RZQA 4TV9A 4X62H 4B3RB 4LF5H 4JYAH 2HIXA 2O03A 4B3SH 3L4JA 3IG0A 2E3CA 4EB6B 1SQGA 4JI5B 1Z5VA 1FJGB 4LR3A 2CW8A 4DR6H 4DV6H 3HKBB 1L8DA 4U3JB 4EB6A 4FLZA 4RB2C 1HNZH 2BTQB 3K5NA 1T5EA 5CA1B 1M0TA 3H20A 5BR8H 4GYCB 3MAQA 2PYJA 3ZEDA 4DR5H 1I94H 4A2BA 2IM9A 3HKBA 4U3JA 1FVIA 2VQEH 3TY8A 2BTQA 3T1YH 5GONB 4ZHQB 3HXLA 4D7SA 4CH3A 4DV3H 1N34H 1IBLH 4Q0YA 2UXDB 5FPOA 3JASB 1YEWA 3JSNA 5FPRA 2ZINA 2P22C 2UXBB 3N41B 4GKJB 2PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC B;  4LF7 B;  1HNW B;  4UFZ A;  4JV5 B;  4DV4 B;  4KHP B;  2CFM A;  3NBZ B;  3NBY B;  4JI1 B;  1XDN A;  3OTO B;  1S68 A;  3T1H B;  4YY3 B;  4TOI A;  4JI3 B;  1XNR B;  1HNX B;  4CC6 A;  4X66 B;  4DV0 B;  2HVR A;  4PZ8 A;  4UCV A;  3S24 A;  3GB8 B;  3RR5 A;  4DR4 B;  1P8L A;  2UU9 B;  4LF6 B;  2HVS A;  4GKK B;  4GLX A;  5D1O A;  4NXN B;  3GJX B;  2E5L B;  1N36 B;  2UUA B;  2OWO A;  4E6N A;  1B04 A;  2ZM6 B;  3RTX A;  3BA9 A;  4YHH B;  4JI8 B;  4LFC B;  4B3M B;  4JI6 B;  3BA8 A;  4DV2 B;  5LMU B;  4DR1 B;  1VS0 A;  3GDE A;  1N33 B;  3TY5 A;  1IBM B;  1V9P A;  2HVQ A;  1HR0 B;  4PZ7 A;  4X64 B;  4DR7 B;  2Q2U A;  4NXM B;  4LH7 A;  2HHH B;  4K0K B;  1XK5 A;  4UCO A;  1XMO B;  3JSL A;  4EQ5 A;  2Q2T A;  4X65 B;  3W5O A;  3QWU A;  2VUG A;  3W1B A;  4EEQ A;  4DV1 B;  4UCT A;  4EFE A;  1CKO A;  3W1G A;  4X62 B;  4LF8 B;  1A0I A;  3TY9 A;  4LF5 B;  4JYA B;  4B3S B;  4OX9 B;  4DRF A;  4DV5 B;  4LF9 B;  5DIS C;  4B3R B;  4UCR A;  2HIX A;  1N32 B;  4JI5 B;  3L2P A;  4LFB B;  1FJG B;  4DR6 B;  4DV6 B;  1X9N A;  4JI4 B;  3KYH C;  4DUZ B;  1CKM A;  4UCU A;  1TA8 A;  1HNZ B;  1XNQ B;  3UQ8 A;  5BR8 B;  2UUB B;  4LFA B;  4DR5 B;  1I94 B;  2F4V B;  3SGI A;  5IWA B;  5LMN B;  2VQE B;  2VQF B;  1J5E B;  2HIV A;  5D1P A;  3T1Y B;  4DR3 B;  4CC5 A;  4DV7 B;  4AQY B;  1FVI A;  4DV3 B;  4EFB A;  3NC0 B;  4DR2 B;  1N34 B;  1IBL B;  3BAA A;  4JI2 B;  1CKN B;  4PZ6 A;  5D1O B;  3TY8 A;  4JI7 B;  1IBK B;  4GKJ B;  4JI0 B;  4DUY B;  1ZAU A;  2UXD B;  5FPO A;  1TAE A;  1P16 A;  4UCS A;  3JSN A;  5FPR A;  3BAB A;  4LF4 B;  4B3T B;  2UXB B;  4LH6 A;  3PN1 A;  3VNN A;  2UUC B;  1CKN A;  1XMQ B;  1DGS A; 
#chains in the Genus database with same CATH topology
 3C3T A;  2JS5 A;  3CHX A;  3SYO A;  5KT2 A;  1HNW H;  1BS3 A;  1I3Q A;  3OTO B;  2AZ2 A;  3TW7 A;  4A3E G;  4RB1 A;  1XMO O;  4MVS A;  4CC6 A;  2P7T C;  3J80 W;  4DV0 B;  3KTM A;  5CMU A;  2ZGI A;  4PWQ A;  3JAT B;  1OCR B;  1X4T A;  4L87 A;  3DC5 A;  4JV0 A;  1R6N A;  1M57 B;  2HVS A;  2EIL B;  4YXW G;  4DRX B;  4JI8 O;  4MV6 A;  2HKO A;  4DR4 H;  4O7W A;  3JAT A;  2DPJ A;  4MVU A;  5FL7 G;  3JZF A;  4MVQ A;  5BWW A;  3ZS8 C;  2QA4 V;  1KJ8 A;  2XC9 A;  3JAW B;  3CXH F;  1SQB H;  3ZX6 A;  4DRX A;  4QNH B;  2Z3Y A;  3QVN A;  2C2R A;  4U7N A;  4DL5 A;  3RWR D;  4O83 A;  4A3B G;  4CS4 A;  1JDE A;  3JAW A;  2EIK C;  2XND G;  2P5O A;  1YSC A;  3SE7 A;  1A9X A;  3CWB H;  1WCM G;  1EZJ A;  5IY5 C;  1NJI W;  1M56 C;  3CCJ V;  2DN9 A;  2GHY A;  5KLV H;  1IBM H;  1XQ8 A;  3D3Q A;  2JEJ A;  1MNG A;  1NTZ H;  1BE3 H;  3M9M B;  4R7C A;  3W1G A;  1ZL8 B;  2KSD A;  2UXB O;  2D3O W;  1A0I A;  1EN6 A;  2AGP A;  3RGB A;  5IT9 N;  4L8J A;  3OMA B;  2R7Z A;  1VEW A;  1WN7 A;  2N05 A;  1KD1 W;  2CE4 A;  1ZL8 A;  4KHP O;  2CNV A;  2Z02 A;  3ETJ A;  3L75 H;  2ETN A;  3GTM A;  4BBS G;  2EJ0 A;  1S97 A;  3CD6 V;  1GYF A;  1AJQ A;  4IIJ B;  3ABL B;  4JPR A;  3ABK C;  3LSQ A;  5IP7 G;  5JJN B;  1QVG U;  3L70 H;  5JVD B;  3CEB A;  5KFF A;  5LP6 C;  3FKI A;  1H8H G;  1LUW A;  2XD4 A;  4IIJ A;  1JPX A;  5LOV B;  2Q0O C;  4LF6 O;  2VPQ A;  3RBD A;  4GKK O;  2X0L A;  5JVD A;  2KKW A;  3HPL C;  5K3W A;  2M7W A;  1PL0 A;  3VA7 A;  4DR2 B;  2HGS A;  4JI7 B;  1EUC B;  4KL1 A;  2GTS A;  4RNN A;  1VF7 A;  5LOV A;  1P16 A;  2ILM A;  3WWI A;  1ENV A;  2YL2 A;  2R92 G;  2NNU A;  5I5X A;  5LHH A;  5B1N A;  2HHF B;  2AU0 A;  2JA6 G;  3ORQ A;  2YZL A;  4X89 A;  4RU9 A;  3GTO A;  4IL6 Z;  2OLS A;  4DV4 H;  1K33 A;  4O4H F;  3H4B A;  2QE7 G;  2XAG A;  1KU9 A;  2ZJT A;  2HHF A;  1V54 B;  3E86 A;  3A0H Z;  1EKP A;  4X1Y B;  4G2K A;  2HP8 A;  2Q7H A;  5C93 A;  2ZIO A;  4PA7 A;  3WB0 A;  4EG0 A;  2WLK A;  3V6H A;  1FKA H;  2EJ7 A;  1YIJ V;  5B5E Z;  4X1Y A;  1K34 A;  4ME6 A;  2RN9 A;  5CBG A;  1OZ0 A;  5B1O A;  1L1F A;  2JJ1 G;  4I0X B;  2UUA B;  2OWO A;  5BYA A;  2E76 B;  5IYD G;  5HBR B;  2XOK G;  3T4Z A;  4DXW A;  1YIT V;  1S72 V;  1SES A;  2PI5 A;  3T5H A;  1Y1V G;  1EZ1 A;  4O3P A;  2R85 A;  1C3O A;  4B3M B;  2UUB O;  4QJF B;  3DXR B;  4I0X A;  5JVL A;  2JGD B;  1DF4 A;  1VMG A;  4DR1 B;  3T9B A;  4APM A;  3GTP A;  1Y76 B;  1WLE A;  1N33 B;  5KFQ A;  3N42 B;  4DV2 H;  3IFX A;  2YXL A;  3ETQ A;  2L35 A;  4NXM B;  4K0K B;  4LC1 A;  2CAZ C;  3DXR A;  5KFE A;  2JGD A;  4JI0 O;  4WFA V;  4DUY O;  5KHJ A;  3TXS A;  5KHH A;  1Y76 A;  2HHH H;  2BCC H;  3CE2 A;  5DQG A;  5KG0 A;  4JYA B;  2UUC O;  4I7Z B;  5DIS C;  1Q82 W;  1WP8 A;  1I6U A;  3K9A A;  2B1I A;  2XUM A;  3ZHU A;  1BT8 A;  4EKW A;  4DAA A;  3Q8Q B;  2YZM A;  3N6X A;  5JUM A;  5EK0 A;  4H44 B;  4PA9 A;  4DR6 B;  5KFB A;  5C1O A;  3ABM C;  4YJ3 F;  1H8E G;  1IDS A;  3FYI B;  5CA0 F;  1VBH A;  5EZY F;  2P4V A;  2BQR A;  2QWP B;  5KFN A;  3DGE A;  3UQ8 A;  4IYH A;  4MTD A;  5KFJ A;  1O9H A;  1GM7 A;  2ZDG A;  5LHG A;  2WLJ A;  5D5Q A;  1TWG A;  3TQT A;  3ETG A;  2CGN A;  3U11 A;  4CC5 A;  4LF8 H;  2W6N A;  4O4L F;  4PZ6 A;  2RDI A;  1FPO A;  1A0G A;  2YXH A;  3MFH A;  3K5L A;  3O65 A;  3OR7 C;  3APQ A;  4GUN A;  1FXK C;  2P67 A;  3JCU Z;  1YI2 V;  3BAB A;  3JD1 A;  4FVM A;  2EIJ B;  3RV3 A;  4EBC A;  2QR4 A;  2XCL A;  4A3F G;  3X2Q C;  4Z2W A;  1U96 A;  5JCO C;  2R9I A;  1S5L Z;  1K73 W;  3BY6 A;  2CKZ B;  1ULZ A;  2XGP A;  4X64 O;  5KFV A;  3UO3 A;  1JR9 A;  4KFM A;  5B1B C;  4YY3 B;  4R50 A;  5DMX A;  2M6Y A;  3F8N A;  3ASN C;  1X59 A;  2CDY A;  1QLE C;  1I1K A;  2DIK A;  3OE7 G;  2ZR2 A;  3H01 A;  1GM8 A;  5BWT A;  2IJJ A;  4X62 O;  2ASJ A;  4LF5 O;  5EBL C;  3T9E A;  1H2N A;  2YDE A;  4B3S O;  2WLN A;  1JOY A;  4RUF A;  4J7K A;  3OD4 A;  4EGQ A;  1PPJ H;  2EJ2 A;  1R3K C;  4I7H A;  4H33 A;  1N56 A;  4IRD A;  2GUZ B;  1Z2G A;  1N36 B;  3ZMS A;  4IYI A;  4DV6 O;  1YDX A;  2HR3 A;  1CPY A;  2V4D A;  1VAJ A;  1R1B A;  2BOC C;  2ZXW C;  1HNZ O;  2GUZ A;  1Q6U A;  1AR5 A;  3BA9 A;  5DN6 G;  4HN2 A;  2ZM6 H;  4JI6 B;  4DR5 O;  4CKB A;  3HOV G;  3ZMU A;  2PTM A;  5CA1 F;  4O4H B;  4FLW A;  4A3L G;  5DG8 A;  4QWC A;  4FLT A;  3WO0 A;  1E4E B;  2Q2U A;  3HKC A;  4AYB A;  3CPW U;  2C2A A;  1EFR G;  1YJ9 V;  2QWO B;  1Z2P X;  3D36 A;  4O4H A;  1VIB A;  2X6C A;  4U6P A;  1WPX A;  3AK1 A;  3GIP A;  4LF8 B;  1IOV A;  4GC6 A;  1E4E A;  4CS3 A;  3Q1K A;  4QGP A;  4RZR A;  1I7N A;  4EBE A;  1HNW O;  4YR0 A;  4UCR A;  5LGN A;  4FFR A;  2FLN A;  3ICX A;  4C2M A;  1QHT A;  1VQ9 V;  1N32 B;  5EWG A;  2CUG A;  1GSH A;  3RYF B;  1GN2 A;  3CRA A;  1X9N A;  1COW G;  1Y1W G;  2DQ3 A;  3N8D A;  1P7G A;  4DUZ H;  5D5P A;  1VQ6 V;  4LFA B;  2QB5 A;  2R86 A;  3AW8 A;  4FLV A;  2XAH A;  3I56 V;  4DR4 O;  3ZIA G;  3SGI A;  4J7Z A;  1I1M A;  4FMT A;  2VOB A;  3B8N A;  2W57 A;  5BWX A;  4DV7 B;  5FLM G;  3GV7 B;  5TIS Z;  4J9K A;  1K9M W;  5DGH A;  3CX5 F;  1TVK B;  3ZN0 A;  5LP6 F;  1BXR A;  4RUC A;  3TIG A;  1IBK H;  4XYM B;  2QTS A;  1JFF B;  1R3J C;  3E83 A;  2XAJ A;  1Q7Y W;  1FXV A;  1NI8 A;  3TII A;  4CS2 A;  3K3P A;  2AZ0 A;  1W0K G;  4O2A F;  3SJC C;  2QM7 A;  2R84 A;  2DPI A;  1S9F A;  4H0L B;  1AJP A;  4ED7 A;  1B33 N;  1IBM O;  2G38 A;  2CFM A;  1JFF A;  4YJ3 B;  4JI1 B;  5CA0 B;  1Q90 D;  5JJJ B;  5EZY B;  4TOI A;  4NVP A;  3GQC A;  3C0F B;  2VPS A;  4KXR A;  2UVW A;  2R72 A;  3I4N G;  4MV1 A;  4QWD A;  4FFB B;  4YJ3 A;  5CA0 A;  2WLM A;  3DTF A;  5C5J A;  4EYH B;  3RR5 A;  1MZE A;  2ATL A;  5I47 A;  4O4L B;  4B3M O;  1YJW V;  4NB5 A;  2DAB A;  1J95 A;  2WA4 A;  1JMK C;  4YB8 B;  2XAS A;  3HOY G;  1OBG A;  3TET A;  4EYI B;  3T5J A;  4O4L A;  4PV1 B;  4QPK A;  2PMZ E;  4F4L A;  2W6P A;  5IYZ F;  1JXL A;  4LFC B;  1A3G A;  5BPH A;  5L3B A;  1JX4 A;  2W9A A;  4A3G G;  1R6K A;  2OIE A;  5DG9 A;  1KUT A;  3GTQ A;  3GDE A;  3GTK A;  2CZG A;  4DL2 A;  4NTW A;  3K0D A;  2ZE7 A;  2E2I A;  3BFR A;  1SFO A;  2VUM G;  4MTX A;  4W4L A;  4W4K A;  4BIZ A;  4IT5 A;  1XMO B;  3LSS A;  5E1A C;  3W5O A;  3WG7 C;  2DOS A;  4O7R A;  4MV9 A;  4QE7 A;  5DEC A;  1CQI B;  5LBQ A;  5F2V O;  4DV5 B;  1AVM A;  3R65 A;  5IP9 G;  4ECR A;  2IU3 A;  3DTG A;  1ROP A;  3VBB A;  3ZJZ A;  4DV4 O;  4GZR B;  2HG5 C;  4U3F H;  1WAZ A;  5J9P C;  1Z5V A;  2CH7 A;  2UXN A;  4J9N A;  4FFK A;  4ZQI A;  3H0G G;  4GX1 A;  2CW8 A;  4HYO A;  5E25 A;  2CGO A;  2EJR A;  4Z1M G;  4WBN F;  2RMK B;  1K5S A;  3W7W A;  2NLJ C;  1FFT B;  4J9R A;  3CMA V;  3K5N A;  3A8T A;  1FKA O;  3K04 A;  4FFM A;  1T5E A;  5CA1 B;  4O3O A;  1RK5 A;  5BR8 H;  4MS2 A;  1U97 A;  3ZED A;  1I94 H;  2WSS G;  2EZP A;  2IM9 A;  4TWK A;  4MTO A;  5DM6 V;  2DYR C;  1OJH A;  4C7U A;  3T1Y H;  3PO3 G;  1GTO A;  1SRY A;  4DV3 H;  2EIK B;  3Q4H B;  1IBL H;  1KTA A;  3JAS B;  5GW7 A;  3H1I H;  3OUZ A;  1SQQ H;  4E4T A;  5IY5 B;  2UXB B;  1M56 B;  3AG1 C;  5KFY A;  1IXM A;  2PUS A;  3CSX A;  4ASU G;  4DV2 O;  3G80 A;  4WCE V;  5KG7 A;  1EHI A;  4EEY A;  3PO2 G;  2NVX A;  3T9C A;  3Q4H A;  4R8C A;  2BSK B;  4GX0 A;  4TT3 G;  3JAS A;  3WO1 A;  2ZDQ A;  1DK1 A;  3OHB A;  4KHP B;  4MTG A;  3KXY T;  1PM9 A;  1QCE A;  2W8K A;  4DL6 A;  3RFR A;  2HHH O;  1NZ6 A;  1WPB A;  1ZQ7 A;  1BNC A;  2DYS B;  2BSK A;  5LA6 F;  1DF5 A;  5I5T A;  4YIP A;  5KFI A;  1N36 O;  4JI3 H;  3AX6 A;  2HVR A;  2YRW A;  3QG5 A;  4CH5 A;  3CCU V;  2QDO A;  4MV8 A;  4JTD B;  1MA1 A;  1AB3 A;  1KYO F;  1I0H A;  3ABK B;  4LF6 B;  4GKK B;  2CTQ A;  5KG2 A;  2FLP A;  1MSW D;  3U9S A;  2DAA A;  3HKZ A;  2P4K A;  1G4Y B;  5LP6 B;  1AIL A;  1EKF A;  1KP2 A;  1NU1 H;  2DQ0 A;  4E6N A;  3T2M A;  3UT5 A;  2IJH A;  3Q8P B;  2NUA B;  2OIG A;  5LP6 A;  1L0L H;  1H38 A;  4TV8 F;  2YYA A;  1RP3 B;  5L1K A;  4LF8 O;  2LGQ A;  4NYK A;  4JV1 A;  3SPI A;  1JA8 A;  1V9P A;  4PZ7 A;  2ZDI C;  2V1D A;  3B09 A;  3OMI B;  5DQH A;  5LL6 b;  1R6T A;  1HR0 H;  4EQ5 A;  1GSA A;  4ECW A;  3PJS K;  2VUG A;  4Q4C A;  4ZI7 F;  3PW5 A;  3CCQ V;  1WJZ A;  2Y4T A;  3E89 A;  1CKO A;  1SZT A;  3G6B A;  3ZMZ A;  2RGR A;  3LP8 A;  2FL4 A;  4NZN A;  4RB3 C;  3D8C A;  4OX9 H;  2KG7 B;  3T9F A;  3JAM W;  3RB3 A;  3TK1 A;  1URF A;  1G6U A;  1GN3 A;  2ZD9 A;  4F6R B;  5KG1 A;  3OUS A;  5IYZ B;  3LWB A;  4ETS A;  5KHI A;  3QO8 A;  2KG7 A;  4JV2 A;  4YAK B;  3MHS C;  2UUB B;  1S0V A;  1XNQ H;  4OPH A;  1FYJ A;  4F6R A;  3FAV B;  5LMN B;  1KMI Z;  5IYZ A;  3GV8 B;  4HAM A;  5KFR A;  4TUY F;  2WAQ A;  3WFV A;  3GTG A;  4DIM A;  5IWA H;  4P9P A;  4O7L A;  2EX3 A;  2HEP A;  3BJY A;  3HOZ G;  4DR3 H;  4XYL B;  4NKG B;  4JI0 B;  4AQY H;  3FAV A;  4DUY B;  2R7L A;  2ZM6 O;  4UCS A;  3THO A;  2ZE5 A;  2IH3 C;  3GIJ A;  2FPG B;  2UUC B;  4Q4D A;  2JA5 G;  1QR8 A;  4PDV A;  1KT8 A;  4FLY A;  1MOF A;  4BW5 A;  1IXB A;  4UB6 Z;  1YCI A;  3N6R A;  4AIL C;  2YIB D;  2YI8 A;  1UC9 A;  4O3S A;  3BCC H;  4RQF A;  2PI4 A;  3LDC A;  2K9P A;  3WWH A;  2JEG A;  2Q6A A;  1ZHS A;  2IBK A;  3EXA A;  1C30 A;  3RBZ A;  3ABM B;  4O81 A;  5KFS A;  4IAJ A;  1SKV A;  5CE8 A;  4QW9 A;  2R8J A;  2AHZ A;  2PGG A;  4GLX A;  2YEV B;  1M7J A;  4NZM A;  3GID A;  2UU9 H;  4LNU B;  1KJQ A;  4ZHQ F;  4N21 A;  1M9N A;  4IZO A;  2YEV A;  3GV5 B;  1GN4 A;  2PN1 A;  5KT5 A;  5DGI A;  4Q44 A;  4LNU A;  4JGS A;  2RF4 A;  4FFP A;  1KJI A;  3BA8 A;  5J2T F;  3CQZ A;  5LL6 Y;  3U54 A;  5GTH Z;  4FM2 A;  2Y48 A;  5LYJ B;  3TY5 A;  3FMA A;  1FXK B;  5H5N A;  4TSF G;  1CQJ B;  5L3F A;  2WTF A;  3M9O B;  4DV5 O;  1EN4 A;  4Z1V A;  5KFP A;  4J9O A;  4X64 B;  4AI8 A;  2F43 G;  3JD3 A;  5LA6 B;  2KB1 A;  3X2Q B;  1IBK O;  5DLG A;  3OMN B;  3KHG A;  3SJB C;  3CCR V;  4B7K A;  4E4E A;  5LYJ A;  2R8I A;  4EEQ A;  1FXK A;  2BQU A;  2AHY A;  1SER A;  4X62 B;  4IWX A;  2CNU A;  4LF5 B;  4X65 H;  2FMA A;  1UJW B;  5E79 Z;  4B3S B;  5B1B B;  3CJH B;  3ASN B;  5KFM A;  1SZX A;  2A1H A;  2FKL A;  3OT7 A;  1QLE B;  4PI2 A;  2XGQ A;  5CA3 A;  2YU9 A;  1H2K A;  3K5H A;  2C2D A;  2Q69 A;  4DV6 B;  4G3I A;  1A32 A;  4JYB A;  3CJH A;  4JI5 H;  3AG3 B;  1AUX A;  3J81 W;  3KHH A;  3SPH A;  5DGB A;  1FJG H;  4UCU A;  1HNZ B;  5KFX A;  2WDT A;  4FFO A;  4TV8 B;  1JKJ B;  2YWV A;  3HBL A;  3K3V A;  2R7N A;  3W7T A;  2Y0I A;  3RGX A;  4BIU A;  4DR5 B;  2OYQ A;  4JF3 A;  3RV4 A;  2QF7 A;  2R8H A;  3DC6 A;  4BY1 G;  4FE2 A;  1RSO B;  2QYZ A;  1E4G T;  3QNE A;  4ZI7 B;  2R7M A;  3GII A;  2R9A A;  3K59 A;  2LJ2 A;  4CMF A;  3LNM B;  3DSQ A;  4UV8 A;  1O9G A;  1JIH A;  1RSO A;  2B63 A;  1TWA A;  2UXD H;  2Y0S E;  1BQZ A;  4ZI7 A;  2PMZ A;  3SJQ C;  4PDM A;  1HNW B;  3EHB B;  1RPO A;  2YC0 A;  1XDN A;  1N8R W;  3B8M A;  3MD0 A;  4JZG A;  1IYD A;  5EIB C;  4HZ3 A;  3V4Z A;  3SPG A;  2ITC C;  3U0Z A;  4GC7 A;  4FBU A;  1XRE A;  2F1M A;  2YCH A;  1MSD A;  3BQ0 A;  1XNR H;  1B06 A;  5KG6 A;  4X66 H;  2W6J G;  2ADP A;  1CXZ B;  2LW1 A;  5KUM A;  4DR4 B;  1Y4M A;  4TUY B;  1AI7 A;  1PP9 H;  3PVX A;  2WA3 A;  1IUR A;  2JGU A;  4LMY A;  4FPP A;  4ECT A;  2RJZ A;  1I5X A;  2Y0P A;  1Z2N X;  4TUY A;  2YZN A;  2K1E A;  4RQE A;  3ABT A;  3WNZ A;  3V6K A;  5BR8 O;  4J0M A;  3RJ0 A;  1I94 O;  2XCP A;  5IJ9 B;  3LQS A;  4JXU A;  5DAA A;  4YHH H;  3N43 B;  2JA7 G;  3CCE V;  4FIP C;  1RM1 B;  4WFG A;  2Q67 A;  3T1Y O;  1IBM B;  1KJ9 A;  3SPC A;  3SNO A;  4YP3 A;  2EZO A;  1WP7 A;  4DV3 O;  1IBL O;  5BY1 A;  4LH7 A;  1LR1 A;  4ECX A;  1GN6 A;  4UCO A;  3SR2 C;  5IJ9 A;  1WSC A;  2EUL A;  4F50 A;  1VQ4 V;  5KT6 A;  2F93 B;  5EBW C;  4EFE A;  2HG8 A;  3T5K A;  3VMM A;  2YS7 A;  1VF6 C;  2FK3 A;  2R6F A;  2B1G A;  4LF9 H;  4TQR A;  2A9H A;  3K9S A;  3FD9 A;  4UUJ C;  1GRJ A;  4UVC A;  5LMN O;  2C2E A;  4YJ2 F;  4QWA A;  4A93 G;  5BWU A;  1CKM A;  3JAL B;  1AN7 A;  1G8M A;  1AR1 B;  4J9S A;  1BGW A;  5J2T B;  4QJF A;  4JI4 H;  4DL4 A;  3AG2 C;  2V59 A;  2COJ A;  4LCU C;  4UVB A;  3RYC B;  2DWE C;  3LDD A;  5IYD O;  1L2Z A;  2GV9 A;  2W6O A;  3JAL A;  4XDL A;  2PY5 A;  3AK2 A;  2CTW A;  5D1P A;  5FNV F;  5IT9 W;  5J2T A;  3VPC A;  4FK5 C;  4FM9 A;  3CME V;  4GX2 A;  2VQF H;  1J5E H;  3APO A;  5KX5 F;  3HKZ E;  3RYC A;  1ZWI C;  3VPD A;  3FB8 C;  4M9U A;  3T54 A;  1E4F T;  1AI4 A;  4HR7 A;  2UVR A;  2FTK A;  1RJP A;  5JQG F;  2HJD A;  5CB4 F;  2ADQ B;  3AG4 C;  3QO7 A;  4LF4 H;  1Q3E A;  4Q6G A;  5KFL A;  5FLX N;  1XI1 A;  3VOT A;  4DV4 B;  4FBT A;  2UXC H;  1H2G A;  3OAA G;  3UM7 A;  3WG7 B;  4LF7 H;  1B6Q A;  3MWE A;  3QZ7 A;  3DTU B;  1HR0 O;  4FS1 A;  2B5U A;  2ZE8 A;  3JZI A;  1I08 A;  2WWW A;  1IX9 A;  1KC7 A;  4TQS A;  1SA0 B;  1M90 W;  4EBD A;  2QWQ B;  1VF5 B;  3JAK B;  4G27 B;  1P7B A;  5KFC A;  2HVJ C;  3G4S V;  4L1K A;  4UCV A;  3OSN A;  4OX9 O;  1PKX A;  4CMD A;  3TGU H;  5H2F Z;  1SA0 A;  5EDW A;  5FD6 A;  2J6S A;  3OUF A;  2Z04 A;  2PYL A;  1W59 A;  1M0W A;  2W6Q A;  3ABU A;  1I5Y A;  2NR5 A;  5L9X A;  4JUZ A;  2QKA A;  4MA5 A;  3H40 A;  5KFG A;  3SYC A;  3H1L H;  3GTJ A;  2O57 A;  3RTX A;  3L74 H;  2IMW P;  2DYR B;  1KQS U;  4CZZ A;  4A3I G;  4DV2 B;  2IH1 C;  1YXB A;  5IWA O;  3A2F A;  3V6J A;  5LMU H;  5EYP B;  4DR3 O;  3WWJ A;  4AQY O;  2WAQ E;  2FPP B;  1OBD A;  3AG1 B;  2HHH B;  5I5V A;  3UZO A;  2YRX A;  1NS1 A;  3ZRV A;  4PJ0 Z;  4R8U B;  2W0F C;  2CW7 A;  5EYP A;  5DG7 A;  4ECV A;  4ZIB A;  1S0N A;  4C5A A;  2QWR B;  1TWH A;  4NR1 A;  4DV1 H;  1NBM G;  4RZQ A;  2V9W A;  2C28 A;  5BWR A;  3ZRX A;  2HIX A;  3K08 A;  2Y69 C;  4MV3 A;  5J2U F;  1IVS A;  4R8U A;  3TIN A;  1PNL A;  4WFH A;  3IG0 A;  2QM8 A;  4ECQ A;  4EB6 B;  3PFF A;  2ASL A;  1MZF A;  3JD4 A;  3ZBH A;  1T94 A;  3KG2 A;  3KKY A;  3HKB B;  3RVY A;  1MAB G;  4U3J B;  4EB6 A;  2BTQ B;  2JK5 C;  4PEL A;  1JQ0 A;  3FKI G;  4GYC B;  3R9R A;  2UU9 O;  5L1I A;  3MAQ A;  4A2B A;  1NR1 A;  3HKB A;  2YS6 A;  2GPS A;  1BCC H;  3ML0 A;  4U3J A;  2DLN A;  1A48 A;  5IYC G;  2F23 A;  2VQE H;  3TY8 A;  2BTQ A;  5JQW A;  5KAI Z;  1BSM A;  5C3E G;  2D2C B;  3T9A A;  4D7S A;  3K03 A;  2E74 B;  1N34 H;  2EIN C;  2HVK C;  1T36 A;  1LUV A;  3RB4 A;  4JAS A;  2ALZ A;  4MVZ A;  3GWK C;  3JSN A;  3WU2 Z;  5C1P A;  2COI A;  1I2K A;  2A79 B;  1D5N A;  3DF7 A;  2XIG A;  4B3T H;  4F4Y A;  1XMQ H;  2YIB A;  5LXT F;  2JRI A;  3RYF A;  2Q73 A;  5L3G A;  5L1J A;  4JV5 H;  1K7D A;  3CEI A;  1NTM H;  2ATK C;  4HYK A;  1QNM A;  4X65 O;  3NUA A;  3ASO C;  1ZLZ A;  4NTX A;  3K06 A;  1Y14 B;  5K2M A;  1HNX H;  3RB6 A;  2B9Z A;  3UYY A;  4TM5 A;  2VA2 A;  3ZHR A;  5FNV B;  4Y8V B;  5LGT A;  2XAF A;  2KQX A;  5KX5 B;  1W0J G;  1GKF A;  1W2B U;  4JI5 O;  1JJO A;  1TVK A;  1FJG O;  2YI9 A;  3SPJ A;  4FFN A;  2FK2 A;  4F4Z A;  2QGN A;  4NXN H;  3I4M G;  5H6Q A;  1JDB B;  5JQG B;  2E5L H;  5CB4 B;  2ZM6 B;  1KP3 A;  3T9D A;  5KX5 A;  5AG2 A;  3LUT B;  1SEI A;  5FR9 A;  1YHQ V;  4J9Z B;  3SYQ A;  1V55 C;  1K1Q A;  1VQP V;  1YVW A;  4JI8 H;  3RFC A;  5JQG A;  3BQ1 A;  4JAU A;  3IC7 A;  3Q8R B;  5CB4 A;  1GAX A;  5EZY A;  3VPB A;  3OTF A;  2R8K A;  2QM4 A;  1O75 A;  1OCC C;  2UVU A;  1EYZ A;  4ECU A;  1F51 A;  3K58 A;  4DR7 H;  4MTE A;  2FML A;  2UXD O;  2W6Z A;  4FFB A;  3W1B A;  4B08 A;  4WD3 A;  1M6V A;  4BAY A;  4I50 F;  1AR4 A;  5HFM A;  3FKS G;  3R66 A;  1GGO A;  1KEC A;  5BMV F;  1AP5 A;  5KFD A;  4O86 A;  4YR3 A;  1RJR A;  2FE3 A;  3GWO A;  1IOW A;  3G6E V;  3KAK A;  2X7R B;  2Y0S A;  2DMX A;  1AI6 A;  4MV4 A;  3N27 A;  4X1K B;  3ORR A;  3WB2 A;  2DWC A;  2HJW A;  4DUZ B;  3E8H A;  4LFB H;  4X66 O;  4IHJ F;  4I9W A;  2QKS A;  4E2L A;  3E2E A;  4X1K A;  5K1P A;  2ZDH A;  2GBO A;  1KEE A;  3OW2 U;  3U0G A;  3QZ8 A;  1DAA A;  2NU7 B;  1K97 A;  2AGA A;  1PD3 A;  2F4V H;  2ZKO A;  3TW6 A;  1L0N H;  1I2L A;  3MJF A;  5D1O B;  5HNE A;  3QTC A;  4TQD A;  1IBK B;  1D5A A;  3PW4 A;  4FLX A;  5K1X A;  3JZ6 A;  4UXN A;  3RT3 C;  4RAY A;  3OM3 B;  3RN4 A;  5KFU A;  4O7N A;  3K79 A;  3W7X A;  2LQT A;  1AJN A;  4YHH O;  2FYU H;  1P49 A;  4X88 A;  5J2U B;  1SC5 B;  1BQ0 A;  3T99 A;  1B3Q A;  3SYA A;  1EUD B;  1S03 G;  1XIL A;  2CQY A;  4TQF A;  5EWF A;  3Q2O A;  1I1L A;  1CP9 A;  1P84 F;  3A0B Z;  5J2U A;  2VS0 A;  3B2E E;  5F9N A;  3AG7 A;  1XEQ A;  2OCC C;  2P6J A;  3T1H H;  4RCN A;  2BQ3 A;  3CRR A;  1R73 A;  2YZG A;  5A9G A;  5CA1 A;  1AP6 A;  3UZB A;  2Z5U A;  1K3E A;  5EC1 C;  4JI2 H;  4LF9 O;  1S77 D;  2PZS A;  3CXC U;  2ZNI A;  1OCO C;  4D6T H;  5L3D A;  3C3S A;  4PD4 F;  2N04 A;  2V5A A;  2W71 A;  1E1Q G;  5GTI Z;  3ETE A;  3ZHT A;  1R3I C;  3RUP A;  4JI4 O;  1HW7 A;  4G28 B;  4RO2 A;  5KAF Z;  2BOB C;  2FKX A;  4K35 A;  3N44 B;  1JLL B;  4P9O A;  3PZP A;  3CCV V;  3ZCC A;  4BBR G;  3RW0 A;  3L72 H;  5LXT B;  2M05 A;  4DK0 A;  3M9N B;  1PK8 A;  4IRK A;  5I60 A;  3E8F A;  1WCM A;  3WB1 A;  3FX7 A;  2RCV A;  1VAR A;  4PA3 A;  3UCS C;  5LXT A;  2IU0 A;  3CC4 V;  3F5W C;  5D8D A;  5JWP A;  4Q20 A;  1KUQ A;  3EFF K;  1QR9 A;  5KT4 A;  2HJF C;  4WFE A;  4DRF A;  2UXC O;  3CVZ A;  4LF7 O;  2PVP A;  1DV1 A;  4O2A B;  2ODM A;  2Q8V A;  3EPI A;  3I5D A;  3BVO A;  4B3R H;  2I87 A;  1FFX B;  4O82 A;  4QSH A;  2W8L A;  1PV0 A;  2HFE C;  3H4D A;  2R82 A;  5IYB G;  5BXZ A;  4F6E A;  2YIA A;  4O2A A;  4O7Z A;  2OT5 A;  4OXS A;  2Q0A A;  4GCZ A;  4O7S A;  1Z2O X;  5BR8 B;  1SQP H;  4YIO A;  3OHA A;  1I94 B;  2V4R A;  4BWA A;  4Q43 A;  1N0J A;  4YQW A;  5IE9 A;  3T1Y B;  2YXY A;  3J80 N;  4DV3 B;  4C5B A;  1M4U A;  2ZCE A;  1IBL B;  1S5H C;  4JI2 B;  2FP4 B;  4J9P A;  1NH2 D;  4I50 B;  3W7S A;  1TAE A;  3GVM A;  4NZO A;  5BMV B;  3G67 A;  4A2A A;  2R92 A;  3OR6 C;  3MFI A;  2W7P A;  4DL3 A;  1H2L A;  3QO5 A;  5LMU O;  3KAJ A;  2JA6 A;  4GKJ H;  1UNN C;  4I50 A;  3E35 A;  4KUM A;  4UFZ A;  4I55 F;  3NR7 A;  1YZB A;  3MR2 A;  1WA8 B;  2W9C B;  3NBZ B;  3UO2 A;  2W6I G;  4J11 A;  4JI3 B;  4IHJ B;  3V4S A;  5JVD F;  4K6N A;  3OTO H;  5KT7 A;  4MVO A;  1WA8 A;  2JVD A;  1OHH G;  4PZ8 A;  1VQO V;  2CNQ A;  4DV0 H;  3GB7 C;  1P8L A;  4IHJ A;  1VF6 A;  2RDC A;  1WNS A;  1KBH A;  4CKC A;  3F7V C;  2QKC A;  3BEH A;  4PA6 A;  2E75 B;  2HLD G;  5B1A C;  2XHB A;  3AG2 B;  3IGA C;  4XZ3 B;  3ZN1 A;  1NVP D;  4FZ1 A;  1K8A W;  2JEF A;  4I5S A;  3NXS A;  4X8A A;  3L71 H;  1Y1V A;  3LDE A;  2W9B B;  5HFL A;  5KFH A;  4WBN B;  1JCH A;  1V4Y A;  1IZ3 A;  3K5O A;  3I55 V;  3VQY A;  4FU0 A;  4Q45 A;  3PW0 A;  1VS0 A;  2WB1 E;  1WH2 A;  2VQE O;  2OH2 A;  1VQL V;  2QWN B;  4OGQ B;  3LML A;  2X0S A;  5KA5 A;  1HR0 B;  2W9B A;  3R5H A;  1N34 O;  2R93 G;  4WBN A;  3AG4 B;  3AK3 A;  2A3Q A;  3G6Y A;  2R9R B;  1VQK V;  5F9L A;  5GON F;  4ZKI A;  4JZ2 A;  1RYR A;  4B3T O;  4UB8 Z;  5DED A;  4DUZ O;  2VWJ A;  1YJN V;  4OX9 B;  3JD2 A;  4Q8F A;  4WFF A;  1UPG A;  2SCU B;  4C5C A;  5C4X G;  2UXX A;  1S76 D;  4JV5 O;  4R6Z A;  4GX5 A;  3HO8 A;  3CP1 A;  4U7C A;  3MR3 A;  4QPJ A;  4J9L A;  1DLB A;  2EIM C;  2J6U A;  2FB9 A;  3RAQ A;  2ZE6 A;  3K5I A;  4FZ0 A;  1HNX O;  3B4S A;  1XNQ B;  4ED3 A;  4BXX G;  4UUG A;  2XTA A;  5KFT A;  3J7A K;  1D2D A;  2V7Q G;  1I50 A;  4OPA A;  2DWD C;  5IWA B;  3B40 A;  4HNA B;  4BR6 A;  1VQ8 V;  4DR3 B;  3OUU A;  2C00 A;  3EVK A;  5LA6 A;  4NXN O;  4AQY B;  3TXQ A;  1KKD A;  3FB6 C;  2E5L O;  2OTJ V;  2P06 A;  5JCO A;  3CC7 V;  3QF7 A;  1SQF A;  2VR1 A;  1ZAU A;  2F66 C;  4DR2 H;  4FM0 A;  3P30 A;  3CCS V;  3JAR B;  5CBF A;  3HB9 A;  4JI7 H;  4HNA A;  3ETH A;  4O4I F;  1N0N A;  4LH6 A;  5C44 G;  1BMF G;  3M4I A;  3OGC C;  4RB0 A;  1EM1 A;  3OFN G;  3JAR A;  2ODT X;  1HP8 A;  3W7U A;  1BGY H;  2PF4 E;  4DR7 O;  4PDR A;  1EZV H;  1H2S B;  2ZXW B;  3G71 V;  3FDS A;  4TV8 A;  2Y69 B;  3S3X A;  4QWB A;  4HNT A;  1S0M A;  3N40 P;  3KZI Z;  3TCU A;  3SYP A;  3M7M X;  4DW1 A;  1NTK H;  4FFL A;  1ET0 A;  2IA6 A;  1K83 A;  2UU9 B;  3T1C A;  4I9Q A;  1Y74 B;  2I80 A;  4LBE C;  5B3S C;  3GJX B;  5JH7 F;  4LFB O;  2CK3 G;  5KG5 A;  4EGJ A;  2CTR A;  5KHK A;  2MK3 A;  1PNM A;  1Y74 A;  4ABM A;  2UUA H;  4ZOL F;  4K8Z A;  4ECS A;  2DYS C;  5KA6 A;  4QE9 A;  1OV9 A;  4I55 B;  4KP4 A;  1ZX3 A;  3HOU G;  2F4V O;  4B3M H;  4LSA A;  4PDL A;  2EIN B;  1NKD A;  1B6R A;  2LGW A;  3HR0 A;  4DR1 H;  3VQW A;  3RYH B;  3U10 A;  4J9M A;  1N33 H;  1G1X B;  1VKZ A;  1VQ7 V;  3N2G B;  5H80 A;  4I55 A;  1GK9 A;  2A0L A;  1GO3 E;  3H3V H;  4X65 B;  4NXM H;  2BR0 A;  1VQ5 V;  2IJK A;  4K0K H;  3HOX G;  2Y4R A;  3RYH A;  3ETD A;  3N2G A;  4LWS B;  1M1K W;  3IAY A;  1LNQ A;  4DLK A;  4RNM A;  2R87 A;  3NGD A;  4J41 A;  4IGG A;  4JYA H;  2O03 A;  3FYE B;  3L4J A;  3ASO B;  1FS0 G;  1SQG A;  4JI5 B;  2GLT A;  1SCU B;  2W0X A;  1FJG B;  3T1H O;  1E79 G;  4LWS A;  4DW0 A;  1Y1W A;  4A3K G;  4DR6 H;  3ZHQ A;  4JI2 O;  3AYH B;  1JVM A;  1EBO A;  4RB2 C;  4A5U B;  4O3R A;  4NYE A;  3L9D A;  2LP7 A;  4HNV A;  4NTY A;  1QBZ A;  1MG1 A;  1K4C C;  3STZ C;  1VQM V;  4CBC A;  1RK6 A;  1V55 B;  1K5Q A;  5GON B;  4ZHQ B;  4CH3 A;  4Q0Y A;  2UXD B;  5H9C A;  3FB7 C;  1S10 A;  2P22 C;  4JI3 O;  2E2H A;  3MWD A;  4RUA A;  3E8B A;  4IRC A;  1OCC B;  2QEX V;  2W7O A;  1FAF A;  4B7E A;  5GON A;  4ZHQ A;  1XHZ A;  4TVI A;  2P0A A;  1SYX B;  5EIB D;  1F4N A;  1F7Y A;  2JDI G;  5CM0 A;  3GIL A;  1B6S A;  4ED2 A;  1WRV A;  5DGA A;  3VQX A;  2P90 A;  1XNR B;  3H1H H;  2WLH A;  4X66 B;  2YUA A;  4YY3 H;  2CTP A;  2OCH A;  1MZB A;  3STL C;  1AI5 A;  4UVA A;  3HOW G;  1ORQ C;  1IYE A;  4IR9 A;  1F4M A;  5L3E A;  2IJI A;  4B3R O;  5KFO A;  1N4C A;  2FJZ A;  1NR7 A;  1SET A;  4YBZ B;  1XBL A;  1ARO P;  1OCZ C;  4DL7 A;  2QSA A;  1QVF U;  2W70 A;  4A3M G;  2F95 B;  1WB8 A;  2AXT Z;  4O4I B;  1N36 H;  1B04 A;  1VP7 A;  1OWT A;  1UFI A;  3E8G A;  2YW2 A;  3P3N A;  1US6 A;  2N74 A;  1FD9 A;  4YHH B;  1JX9 A;  2Q7E A;  5KS8 A;  4RWU A;  4O4I A;  3K0G A;  4JI6 H;  1ZHQ A;  2LW7 A;  3RIZ A;  1M5I A;  2A7W A;  1BJT A;  5JJE B;  2VUM A;  3CRC A;  3FB5 C;  2Z0A A;  4HNU A;  3JAK A;  3JSL A;  2Q2T A;  4U7O A;  3RB0 A;  4UCT A;  1PL4 A;  1H2M A;  3BRC A;  5KG4 A;  4GKJ O;  2YIC A;  5BPF A;  2H3O A;  4LF9 B;  1XNQ O;  2DJV A;  4X9Q A;  2OCC B;  5JH7 B;  1HDJ A;  5KFZ A;  5T14 A;  1OCR C;  1GSO A;  3F5T A;  4LP8 A;  3OTO O;  1M57 C;  2FLL A;  5BZB A;  1GO3 F;  3L4K A;  3H0G A;  2BTO A;  4ZOL B;  1N32 H;  4JI4 B;  2QK4 A;  5KFW A;  2EIL C;  4HQ6 A;  1OCO B;  1NH2 B;  5C8Y F;  4DV0 O;  4D7T A;  5JH7 A;  5CBH A;  2XCA A;  3TEK A;  3K5M A;  3KAL A;  1Q5O A;  1M93 A;  4ZOL A;  2RQ6 A;  5L3C A;  3EPG A;  3GIQ A;  1SS3 A;  5DLF A;  4LFA H;  2IP4 A;  2VQF B;  1J5E B;  2NU9 B;  2HIV A;  1Q8I A;  2XAQ A;  3CRM A;  1BHA A;  5IDJ A;  1CKN B;  3G8C A;  2C22 A;  2R7Z G;  4MVR A;  4DV7 H;  1EKV A;  3SJA C;  4JYC A;  3AG3 C;  4XBF A;  4LF4 B;  2JS3 A;  1K4D C;  2BE3 A;  2HDK A;  2B63 G;  1CKN A;  4JYY A;  4R7R A;  2UXC B;  2R8G A;  4LF7 B;  2Q68 A;  1GH6 A;  2VWK A;  4BIO A;  1QQC A;  2FPI B;  2HGW A;  3JRX A;  1ZSP A;  1RJQ A;  3RYI B;  4WF9 V;  2Q7D A;  3BHP A;  5LGU A;  5I5U A;  2WB1 A;  3JRW A;  4IR1 A;  4ECZ A;  1Y67 A;  1NVP B;  2GDS A;  3HKC B;  4JI1 H;  2Q7G A;  4I4T F;  3ZRS A;  2GQS A;  4N23 A;  3RYI A;  4PI0 A;  2YS8 A;  3RF2 A;  1YTF B;  4A3J G;  3ABL C;  4M7E A;  4CHI A;  2LFR A;  1XOU A;  2KSW A;  4K3A A;  4X1I B;  1Q81 W;  4F4W A;  4O3Q A;  5FLX W;  1KBL A;  2J9G A;  2ASD A;  4QIW E;  2LO1 A;  3CCL V;  1BZK A;  3CYO A;  4YJ2 B;  3ZRW B;  5IJ0 B;  2ZDI A;  2VRZ A;  4X1I A;  2EJ3 A;  3R23 A;  4QW8 A;  5IYC O;  1XUQ A;  4O7T A;  1BL8 A;  3U9T A;  5LMU B;  3KRE A;  4LFC H;  5CR5 A;  3ZRW A;  5IJ0 A;  4YJ2 A;  5LHI A;  4PDB A;  1EN5 A;  2LFS A;  3G6X A;  4J10 A;  1WR2 A;  4MVM A;  4DR2 O;  4JTA B;  3KHR A;  2WE6 A;  4JI7 O;  1Y6X A;  3MDS A;  1W96 A;  3U55 A;  2R7K A;  4Q8E A;  3FFQ A;  4DV1 B;  5CAE B;  2YSU B;  1XMO H;  3TY9 A;  4XX0 B;  1F23 A;  5EBM C;  5FNV A;  3QQM A;  4FM1 A;  1DTO A;  2ZR3 A;  4XDK A;  2AW9 A;  1V54 C;  4RAZ A;  4DV5 H;  1RM1 C;  3L2P A;  3ZMV A;  4H37 A;  4O2B F;  3KYH C;  2Q4P A;  1TA8 A;  3T4D A;  2JIZ G;  3AEI A;  3K57 A;  1P4R A;  3LNN A;  2WYO A;  3R5F A;  1ZUQ A;  5B1A B;  3MHH C;  2DW4 A;  2WLL B;  4XDJ A;  5CN0 A;  1W93 A;  2ZIM A;  3O9O A;  2VQE B;  5EC2 C;  1Z5W A;  4DO2 A;  5EOY A;  4EFB A;  4O7V A;  1N34 B;  2EIY A;  1SQX H;  3E22 B;  2UUA O;  2WLL A;  4A3D G;  3G6V A;  1VQN V;  3P3P A;  5L1L A;  4NLG A;  3GTL A;  2QTO A;  4O84 A;  3RVZ A;  5KT3 A;  1G2W A;  1RFY A;  4B3T B;  2JEX A;  4GLW A;  3PN1 A;  1R9T A;  1XNR O;  2JA5 A;  1XMQ B;  3BG5 A;  3E22 A;  2W6M A;  3BAC A;  4DR1 O;  2UXB H;  4J9Q A;  2JA8 G;  4JV5 B;  1N33 O;  3JD0 A;  2IBZ H;  1KC8 W;  4YAJ B;  5I5Y A;  3RGZ A;  1RYS A;  2MCT A;  4O4J F;  1CS0 A;  2MW2 B;  1XDC A;  3NBY B;  5BYB A;  4JAV A;  5A2Q N;  3G8D A;  4NXM O;  4O7Y A;  3CC2 V;  5C8Y B;  4K0K O;  4FS2 A;  2WPD G;  1I7L A;  1TWC A;  4KHP H;  4P2Z A;  3LUL A;  2WAM A;  4HBN A;  1S3J A;  3HB3 B;  1HNX B;  2V4Q A;  3GIK A;  3I12 A;  4TV9 F;  4X20 B;  4UV9 A;  3L73 H;  4WFB V;  4JYA O;  2RGV A;  3TQ1 A;  2QJ1 A;  5C8Y A;  2EIM B;  4AHC A;  3TJT A;  5KG3 A;  2R93 A;  3EYY A;  2XT9 A;  4MV7 A;  4X20 A;  1TWF A;  2COG A;  4MAM A;  5D1O A;  4NXN B;  4LF6 H;  2I8C A;  3F7Y C;  3T7A A;  5B66 Z;  2E5L B;  4GKK H;  4DR6 O;  3DAA A;  4GT1 A;  4CKE A;  2CH7 B;  4K8X A;  3IN5 A;  1I7F A;  2R70 A;  2AGO A;  2Q5Z A;  3JCZ A;  2VQD A;  4BWS C;  4JI8 B;  3CB2 A;  1THZ A;  3RAX A;  2X5R A;  3OEE G;  3JAM N;  3MR6 A;  2ABJ A;  2EIJ C;  2HVQ A;  4WHX A;  4MW3 A;  3LSU A;  4DR7 B;  3CRQ A;  4I4T B;  3CSW A;  5I5W A;  1XK5 A;  2GSM B;  5FD5 A;  4QIW F;  3D3I A;  1XHX A;  2H8P C;  4ED0 A;  3QWU A;  5EWE A;  2X6A A;  3T5L A;  3VQV A;  3M8A A;  2ZT9 B;  3ZHS A;  2OTL V;  3B77 A;  3HKD B;  1ZTE A;  2NN4 A;  3KCX A;  1TGO A;  4MSW C;  4I4T A;  1QLN A;  4J9Y B;  1R3L C;  1Y66 A;  4ZBM A;  3H1J H;  4YR2 A;  1DV2 A;  1Q86 W;  3HKD A;  4F4X A;  2DE0 X;  2ITD C;  5KMG B;  3OGI B;  4LFB B;  4YY3 O;  2VQF O;  1J5E O;  3SDL A;  1WB7 A;  3JYC A;  1KKC A;  2PBZ A;  1RPR A;  3E5N A;  5B3S B;  2Y4U A;  4J42 A;  3K3W A;  5KMG A;  4DYL A;  1GMG A;  5LYJ F;  4MTF A;  1SF9 A;  2F4V B;  4LF4 O;  2UUB H;  3UKM A;  2YID A;  5KKN B;  3OEH G;  1T3N A;  5LMN H;  2NVY A;  5I5S A;  1PX2 A;  3NC0 B;  5BWV A;  5KFA A;  4LSX A;  1XL6 A;  3BAA A;  4MW8 A;  5KFK A;  1TUE B;  1Q6H A;  3QFF A;  1S0O A;  3D36 C;  3MWM A;  2UVV A;  4JI0 H;  3CS5 A;  4DUY H;  5KUK A;  3VNN A;  1Q43 A;  3UT5 B;  2V58 A;  4JI6 O;  4IWY A;  2AQ4 A;  1DGS A;  3N2K B;  2ZQM A;  4FLU A;  2GPW A;  2J6T A;  2UUC H;  2ARH A;  3UFX B;  3ZMT A;  2JEU A;  5HV6 A;  1FFX A;  1YF2 A;  4O2B B;  3OSP A;  1S68 A;  5A2Q W;  3T1H B;  2Q9L A;  2RDJ A;  2IW5 A;  4J80 A;  3J7A U;  1CEZ A;  3N2K A;  2FB5 A;  3H9V A;  4A3C G;  1S5J A;  3BPZ A;  4DK1 A;  3GLK A;  1NT2 B;  5KHG A;  3IJ4 A;  2JEI A;  2GTA A;  1HWY A;  4O2B A;  3S24 A;  1K1S A;  3GB8 B;  2NU6 B;  4BY7 G;  1FXH A;  3IC9 A;  5H6R A;  4ICG A;  2JJ2 G;  5IYB O;  2C35 B;  1ZET A;  1GLV A;  2X6B A;  4CE5 A;  2FK1 A;  1N32 O;  4JTC B;  4CH4 A;  2DZD A;  1E1R G;  3A0R A;  5BMV A;  3KHL A;  4IIJ F;  3MR5 A;  4PHZ A;  5ITZ B;  3H1K H;  4RUE A;  2NU8 B;  3HKE B;  4J7J A;  4LFA O;  4MA0 A;  4H13 B;  1VBG A;  4BW9 A;  2JA7 A;  4DV1 O;  2W9C A;  4O4J B;  2L6L A;  3RBE A;  4ED1 A;  3M99 B;  4CH6 A;  1Q6I A;  4JAA A;  5ITZ A;  5LOV F;  3J81 N;  4DV7 O;  3R5X A;  2ZNJ A;  3ZHV A;  4DQN A;  4FGR A;  3HKE A;  3Q8S B;  1TUB B;  4TV9 B;  1NQT A;  3GIM A;  3KCY A;  1KB9 F;  4PA4 A;  4X64 H;  2WLI B;  4O4J A;  4MT8 A;  4RAI A;  2HGX A;  1QU7 A;  5DQI A;  2RNB A;  1XL4 A;  4ECY A;  1TUB A;  4P30 A;  2AGQ A;  2GQR A;  3PW2 A;  4TV9 A;  4X62 H;  4B3R B;  4O3N A;  2A06 H;  4LF5 H;  4RNO A;  2WLI A;  4B3S H;  1YTF D;  1DIK A;  3PR4 A;  1GM9 A;  2E3C A;  4ED6 A;  4JI1 O;  2H94 A;  1PNK A;  1MMM A;  3C90 A;  1JJ2 U;  4M0J A;  4LR3 A;  3P32 A;  4DV6 H;  3PW7 A;  1L8D A;  1N48 A;  2EBO A;  4FLZ A;  1HNZ H;  3VOU A;  4PBC A;  1K92 A;  1OCZ B;  1CE8 A;  1M0T A;  3H20 A;  4AYB E;  3BQ2 A;  1SQV H;  2PYJ A;  4DR5 H;  1KJJ A;  4ED8 A;  1XMQ O;  3HT5 A;  4QWE A;  1FVI A;  1AUV A;  1BHB A;  3CCM V;  1V51 A;  3HXL A;  3S3W A;  5FPO A;  4FJC C;  3SI8 A;  3PR5 B;  1YEW A;  5FPR A;  2ZIN A;  2VA3 A;  5FJ8 G;  4QIW A;  3N41 B;  4LFC O;  4GKJ B;  1UC8 A; 
#chains in the Genus database with same CATH homology
 3CSX A;  2XIG A;  3DF7 A;  4B3T H;  5GON A;  4ZHQ A;  1XHZ A;  2JS5 A;  3CHX A;  1XMQ H;  2YIB A;  3JAS A;  1SYX B;  5EIB D;  1HNW H;  3RYF A;  4KHP B;  3KXY T;  4JV5 H;  3RFR A;  3OTO B;  4RB1 A;  3VQX A;  1WPB A;  1XNR B;  4CC6 A;  4X66 B;  3J80 W;  4YY3 H;  4DV0 B;  1MZB A;  4JI3 H;  2HVR A;  3JAT B;  3QG5 A;  1X4T A;  1HNX H;  4CH5 A;  5FNV B;  4LF6 B;  2HVS A;  4DRX B;  4GKK B;  4DR4 H;  5KX5 B;  3JAT A;  1JJO A;  1TVK A;  2YI9 A;  3ZS8 C;  5LP6 B;  2F95 B;  3JAW B;  4NXN H;  4O4I B;  2E5L H;  5JQG B;  4E6N A;  1N36 H;  1B04 A;  4DRX A;  5CB4 B;  3UT5 A;  2ZM6 B;  5KX5 A;  1SEI A;  4YHH B;  3RWR D;  4CS4 A;  5LP6 A;  2Q7E A;  3JAW A;  4JI8 H;  4O4I A;  4JI6 H;  5JQG A;  2P5O A;  5CB4 A;  1ZHQ A;  3RIZ A;  1V9P A;  5EZY A;  1M5I A;  3OTF A;  4PZ7 A;  2QM4 A;  1O75 A;  1BJT A;  5JJE B;  1IBM H;  1XQ8 A;  5LL6 b;  3K58 A;  1HR0 H;  4DR7 H;  3JAK A;  3JSL A;  4EQ5 A;  2Q2T A;  4MTE A;  2VUG A;  4FFB A;  3W1B A;  4B08 A;  4UCT A;  1CKO A;  3W1G A;  1A0I A;  3BRC A;  2RGR A;  3RGB A;  4LF9 B;  4L8J A;  2FE3 A;  4RB3 C;  4OX9 H;  3KAK A;  1WN7 A;  5JH7 B;  3JAM W;  4X1K B;  1G6U A;  1N32 H;  3WB2 A;  4IIJ B;  2BTO A;  4ZOL B;  4F6R B;  3L4K A;  4JI4 B;  1GYF A;  4DUZ B;  5IYZ B;  4LFB H;  5JJN B;  4ETS A;  5JVD B;  4D7T A;  5JH7 A;  5KHI A;  3K5M A;  3KAL A;  2UUB B;  1XNQ H;  1Q5O A;  5LP6 C;  4X1K A;  1M93 A;  4IIJ A;  4ZOL A;  2RQ6 A;  4F6R A;  5K1P A;  5LOV B;  5LMN B;  1KMI Z;  5IYZ A;  4LFA H;  2VQF B;  1J5E B;  2HIV A;  1Q8I A;  5JVD A;  2KKW A;  2F4V H;  5IWA H;  2EX3 A;  2HEP A;  4DR2 B;  1CKN B;  2HGS A;  5D1O B;  3QTC A;  4TQD A;  4JI7 B;  4DR3 H;  4KL1 A;  1IBK B;  1D5A A;  4JI0 B;  4DV7 H;  4AQY H;  4DUY B;  5K1X A;  4FLX A;  1VF7 A;  5LOV A;  3SJA C;  1P16 A;  4UCS A;  3THO A;  4RAY A;  4LF4 B;  2UUC B;  1CKN A;  1P49 A;  4R7R A;  5J2U B;  2UXC B;  4LF7 B;  2VWK A;  4FLY A;  1QQC A;  3RYI B;  1S03 G;  4TQF A;  3BHP A;  4DV4 H;  5J2U A;  4AIL C;  1KU9 A;  2YIB D;  3B2E E;  2YI8 A;  3HKC B;  2ZJT A;  2Q7G A;  4JI1 H;  3T1H H;  3RYI A;  4X1Y B;  2Q7H A;  5CA1 A;  4PI0 A;  2ZIO A;  3RF2 A;  1ZHS A;  3WB0 A;  4JI2 H;  2PZS A;  4M7E A;  4IAJ A;  1SKV A;  2ZNI A;  1FKA H;  2PGG A;  2KSW A;  4GLX A;  4X1I B;  4X1Y A;  2UU9 H;  4LNU B;  5FLX W;  2UUA B;  2OWO A;  1HW7 A;  4YJ2 B;  5IJ0 B;  3N44 B;  4X1I A;  4LNU A;  4B3M B;  3BA8 A;  5LXT B;  4DK0 A;  5LMU B;  4DR1 B;  4FM2 A;  4APM A;  4LFC H;  5LYJ B;  5IJ0 A;  4YJ2 A;  1N33 B;  3TY5 A;  3FMA A;  4DV2 H;  3WB1 A;  3N42 B;  4PDB A;  2YXL A;  4X64 B;  3ETQ A;  4NXM B;  2WE6 A;  5LA6 B;  4K0K B;  2CAZ C;  5LXT A;  3SJB C;  5KHJ A;  5KHH A;  5LYJ A;  3FFQ A;  2HHH H;  4EEQ A;  4DV1 B;  4X62 B;  1XMO H;  3TY9 A;  4LF5 B;  4X65 H;  4JYA B;  5FNV A;  4B3S B;  4DRF A;  4FM1 A;  3CVZ A;  5DIS C;  1I6U A;  4RAZ A;  4O2A B;  4DV5 H;  4PI2 A;  4B3R H;  3N6X A;  3L2P A;  1FFX B;  4DR6 B;  4DV6 B;  4JI5 H;  3KYH C;  3J81 W;  1FJG H;  1TA8 A;  2YIA A;  4UCU A;  4O2A A;  1HNZ B;  2WDT A;  3K57 A;  2Q0A A;  3LNN A;  2WYO A;  4TV8 B;  3K3V A;  3UQ8 A;  1Z2O X;  5BR8 B;  3RGX A;  4MTD A;  1O9H A;  4DR5 B;  1I94 B;  2OYQ A;  2ZIM A;  5D5Q A;  4BWA A;  2VQE B;  1Z5W A;  3T1Y B;  5EOY A;  4CC5 A;  3U11 A;  4LF8 H;  4DV3 B;  4EFB A;  4PZ6 A;  1N34 B;  1E4G T;  1M4U A;  2ZCE A;  1IBL B;  4JI2 B;  3E22 B;  4ZI7 B;  3K5L A;  2R9A A;  4I50 B;  3K59 A;  1TAE A;  3DSQ A;  1O9G A;  1RSO A;  3BAB A;  4FVM A;  5BMV B;  4B3T B;  4A2A A;  3PN1 A;  2UXD H;  1XMQ B;  3E22 A;  4ZI7 A;  3KAJ A;  2UXB H;  1HNW B;  4GKJ H;  4I50 A;  4UFZ A;  5JCO C;  4JV5 B;  3RGZ A;  2MCT A;  3NBZ B;  3NBY B;  1XDN A;  5EIB C;  4YY3 B;  5C8Y B;  3F8N A;  4JI3 B;  4KHP H;  4IHJ B;  4HBN A;  3OTO H;  1HNX B;  3U0Z A;  2F1M A;  4X20 B;  2YCH A;  2JVD A;  1XNR H;  4PZ8 A;  4X66 H;  2RGV A;  4DV0 H;  2QJ1 A;  5C8Y A;  4DR4 B;  4AHC A;  4IHJ A;  4TUY B;  1P8L A;  4I7H A;  3EYY A;  4MV7 A;  1WNS A;  2JGU A;  4X20 A;  5D1O A;  4LMY A;  4NXN B;  2XHB A;  4LF6 H;  2E5L B;  1N36 B;  4GKK H;  2RJZ A;  1Z2N X;  4TUY A;  2V4D A;  4K8X A;  1I7F A;  2R70 A;  3BA9 A;  4BWS C;  4J0M A;  4JI8 B;  3RJ0 A;  3CB2 A;  4WBN B;  2ZM6 H;  4JI6 B;  3K5O A;  3VQY A;  5IJ9 B;  4YHH H;  1VS0 A;  3N43 B;  1WH2 A;  2PTM A;  3LML A;  4O4H B;  4FLW A;  1IBM B;  2HVQ A;  4FLT A;  1HR0 B;  4DR7 B;  3HKC A;  2Q2U A;  4I4T B;  4WBN A;  4LH7 A;  1XK5 A;  5FD5 A;  1Z2P X;  1XHX A;  4UCO A;  3SR2 C;  5IJ9 A;  3QWU A;  3VQV A;  4O4H A;  2F93 B;  4EFE A;  3HKD B;  4LF8 B;  1TGO A;  4CS3 A;  4I4T A;  2VWJ A;  4OX9 B;  4UCR A;  4LF9 H;  3ICX A;  1QHT A;  1N32 B;  3HKD A;  4LFB B;  5KMG B;  3RYF B;  1X9N A;  1CKM A;  3JAL B;  1XNQ B;  1AN7 A;  1BGW A;  5J2T B;  4JI4 H;  4DUZ H;  5D5P A;  4LFA B;  3J7A K;  5KMG A;  3RYC B;  4FLV A;  2F4V B;  3SGI A;  2UUB H;  5IWA B;  1L2Z A;  2GV9 A;  3JAL A;  2PY5 A;  2VOB A;  4HNA B;  2W57 A;  5D1P A;  4DR3 B;  5IT9 W;  5J2T A;  4DV7 B;  5LA6 A;  4AQY B;  5LMN H;  4LSX A;  4FM9 A;  3NC0 B;  2VQF H;  1J5E H;  3BAA A;  3RYC A;  5JCO A;  3QF7 A;  1TVK B;  1SQF A;  1ZAU A;  2F66 C;  1E4F T;  4FM0 A;  3MWM A;  4DR2 H;  3JAR B;  4JI7 H;  4HNA A;  1IBK H;  4JI0 H;  1JFF B;  4DUY H;  4LH6 A;  3VNN A;  1Q43 A;  3UT5 B;  4CS2 A;  1DGS A;  3N2K B;  4LF4 H;  1Q3E A;  4FLU A;  4Q6G A;  3M4I A;  3SJC C;  2UUC H;  1XI1 A;  4RB0 A;  4DV4 B;  2UXC H;  3JAR A;  4LF7 H;  1FFX A;  2CFM A;  1JFF A;  4YJ3 B;  4JI1 B;  4O2B B;  5CA0 B;  1S68 A;  5A2Q W;  5JJJ B;  3T1H B;  5EZY B;  1H2S B;  4TOI A;  3N2K A;  4NVP A;  1SA0 B;  3C0F B;  2VPS A;  4TV8 A;  1S5J A;  3BPZ A;  4DK1 A;  1NT2 B;  5KHG A;  2R72 A;  3JAK B;  3N40 P;  4FFB B;  4UCV A;  4O2B A;  4YJ3 A;  5CA0 A;  3GB8 B;  3S24 A;  3RR5 A;  3M7M X;  1SA0 A;  2UU9 B;  4I9Q A;  5FD6 A;  4O4L B;  2PYL A;  4CH4 A;  1M0W A;  3GJX B;  1JMK C;  5KHK A;  5BMV A;  4O4L A;  2UUA H;  4PHZ A;  5ITZ B;  4K8Z A;  3RTX A;  3HKE B;  4LFC B;  4I55 B;  4BW9 A;  4DV2 B;  4O4J B;  4B3M H;  4LSA A;  3GDE A;  3A2F A;  4CH6 A;  5LMU H;  5EYP B;  5ITZ A;  4DR1 H;  2ZNJ A;  3RYH B;  3U10 A;  3VQW A;  3HKE A;  1N33 H;  1TUB B;  3N2G B;  4I55 A;  2HHH B;  4TV9 B;  4X64 H;  1XMO B;  4O4J A;  4X65 B;  3W5O A;  2CW7 A;  4NXM H;  4K0K H;  4MV9 A;  5EYP A;  4ZIB A;  3RYH A;  1TUB A;  4DV1 H;  3N2G A;  4DV5 B;  3IAY A;  4RZQ A;  4TV9 A;  4X62 H;  4B3R B;  4LF5 H;  4JYA H;  2HIX A;  2O03 A;  4B3S H;  3L4J A;  3IG0 A;  2E3C A;  4EB6 B;  1SQG A;  4JI5 B;  1Z5V A;  1FJG B;  4LR3 A;  2CW8 A;  4DR6 H;  4DV6 H;  3HKB B;  1L8D A;  4U3J B;  4EB6 A;  4FLZ A;  4RB2 C;  1HNZ H;  2BTQ B;  3K5N A;  1T5E A;  5CA1 B;  1M0T A;  3H20 A;  5BR8 H;  4GYC B;  3MAQ A;  2PYJ A;  3ZED A;  4DR5 H;  1I94 H;  4A2B A;  2IM9 A;  3HKB A;  4U3J A;  1FVI A;  2VQE H;  3TY8 A;  2BTQ A;  3T1Y H;  5GON B;  4ZHQ B;  3HXL A;  4D7S A;  4CH3 A;  4DV3 H;  1N34 H;  1IBL H;  4Q0Y A;  2UXD B;  5FPO A;  3JAS B;  1YEW A;  3JSN A;  5FPR A;  2ZIN A;  2P22 C;  2UXB B;  3N41 B;  4GKJ B;  2PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...