4UCOA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucoA02
4UCRA 1ZAUA 1A0IA 3NBZB 2Q2TA 3T1HB 4DRFA 4DV4B 1I94B 5D1PA 1J5EB 4OX9B 2F4VB 2VUGA 1CKNA 2HVQA 4TOIA 4UFZA 1HNWB 1CKOA 4UCVA 4B3MB 3L2PA 2UUAB 1XDNA 4JI5B 3SGIA 2UXBB 4B3SB 1B04A 3JSNA 4DR5B 1N32B 4LF9B 4X65B 4NXMB 1IBLB 1P16A 2VQEB 4EEQA 4JV5B 1N34B 1XMOB 2UXCB 2Q2UA 4CC5A 2OWOA 1VS0A 5FPOA 4CC6A 3BAAA 4DV2B 2UUCB 5D1OB 3RR5A 3KYHC 2UU9B 4JI8B 3NC0B 3S24A 4EFBA 4K0KB 4B3TB 3TY5A 4DR1B 1HNZB 4X62B 4X66B 3BA9A 1X9NA 1N36B 3GB8B 4GKJB 2UXDB 3BA8A 4LF7B 5D1OA 2HVSA 4YY3B 1FJGB 3PN1A 2VQFB 1N33B 4JI4B 4PZ6A 1TAEA 2HHHB 3UQ8A 1HR0B 1HNXB 1CKNB 4NXNB 2E5LB 4DV7B 1P8LA 4UCSA 4AQYB 4DUZB 4DV3B 1IBMB 4LFCB 4JI2B 3GJXB 2HVRA 3NBYB 4DUYB 4GLXA 4JI0B 5IWAB 4DR4B 3TY8A 4E6NA 3T1YB 2UUBB 3QWUA 4UCOA 4B3RB 1DGSA 3VNNA 4GKKB 4DR6B 4PZ8A 5LMNB 4DV1B 3TY9A 3GDEA 4LF6B 4YHHB 5LMUB 2HIVA 5BR8B 3W5OA 4UCTA 4JI6B 4DV5B 1V9PA 4LF8B 2CFMA 5DISC 1XNQB 1S68A 1TA8A 4DR3B 4JYAB 1XMQB 4LFBB 4DV6B 4UCUA 4JI1B 2ZM6B 3JSLA 4DR7B 1XK5A 5FPRA 4DR2B 1CKMA 4LH7A 3W1GA 4EFEA 1IBKB 3OTOB 1XNRB 3W1BA 4PZ7A 4JI7B 4X64B 1FVIA 4LH6A 4JI3B 4LF4B 4DV0B 2HIXA 3BABA 4LF5B 3RTXA 4LFAB 4EQ5A 4KHPB
chains in the Genus database with same CATH superfamily
2JGDB 4IHJF 4PI2A 2W6NA 4A3IG 4G2KA 4YY3O 4O3RA 1GO3E 1XDCA 5D1PA 1IBLO 3ETGA 1S5LZ 4LSXA 3GTGA 4FS1A 3N2GA 1UJWB 4I5SA 2XCAA 1AB3A 5KG0A 3H1KH 1M4UA 3M9OB 4F50A 4ECRA 2Y4UA 3CEIA 3ZHSA 1W96A 4B3MB 1Q6HA 2E5LH 4O7NA 5EZYF 4JTCB 1GM9A 2AGQA 2CZGA 2YYAA 5JQWA 5GW7A 4A93G 2UUCH 3BACA 1XNRH 1YCIA 4MTXA 4YR3A 4O81A 2DWDC 3AG4B 2VQEO 3WFVA 1N34O 3PW7A 1MZFA 1ZWIC 3UM7A 3TCUA 3OE7G 4IIJB 1VQLV 2AHYA 2W6QA 4JI8B 5K2MA 3MR5A 2JJ2G 2UXCH 5B1NA 4I7ZB 4O7VA 1Y1VG 3O9OA 2CGOA 3B8MA 4R8UB 1EN5A 4BR6A 5J2TF 2HLDG 3BQ2A 2Q5ZA 2AZ0A 4AYBE 3PFFA 2XUMA 4JAUA 4JI6H 3T5HA 3RYHB 5I5SA 4QJFA 2XTAA 4RUEA 1Z2OX 4Q44A 2VQFH 3CPWU 4FK5C 2ARHA 3T7AA 3MWDA 3N6XA 4IZOA 4NKGB 4EB6A 4DV3B 3G71V 2WLIB 5TISZ 3OAAG 3PW5A 2GPSA 3ZEDA 4O2AF 4RQEA 3CCEV 3Q8SB 2COGA 1S0OA 1QU7A 2R8JA 1WP7A 4MS2A 4E6NA 3AK3A 4EB6B 1N4CA 4B3RB 1AP6A 3HKEB 1VBGA 3K08A 2AW9A 1KJJA 4A3MG 1PK8A 1IDSA 3GDEA 4MV8A 4CE5A 1VQ9V 4ED8A 2R7ZG 4UCTA 4MVUA 2YI8A 3KHLA 2XAHA 5JJEB 1XNQB 3ZHTA 1BS3A 2DPJA 2CAZC 4B08A 4UCUA 4DV4H 2CK3G 1V55B 2EZPA 3W7XA 2C2EA 2F23A 5L3BA 2AXTZ 2WYOA 2VWKA 4TQSA 1EFRG 2Q6AA 5I5YA 5IY5B 4P2ZA 3R66A 5LHIA 1ZX3A 2QGNA 3DTUB 1K97A 4DV0O 1OJHA 3EXAA 4ZOLF 2RGRA 4YY3H 4DL5A 1BMFG 4NTXA 3R9RA 1K92A 3WB0A 4CMDA 3K59A 1A0IA 4I0XA 3ABKC 2YRWA 1PP9H 1VQOV 3DTFA 3OTFA 1J5EB 4JYYA 2NR5A 3ZN0A 1G1XB 5A2QW 1N0JA 1S77D 5LA6A 1IBMH 4TT3G 3CB2A 3VBBA 1MA1A 3AYHB 4O3PA 2UVVA 4DV1H 1RYSA 1Z2NX 2P06A 4O2AB 5K1XA 3CMEV 1BGYH 2ZT9B 3N42B 5KFCA 3CVZA 1H2KA 2WAMA 3FKIG 2B63G 5KFVA 2R8GA 3HT5A 4TWKA 3JZFA 1H2MA 5D8DA 1SRYA 5FLXN 5JQGB 1UC9A 3F5TA 4JV5H 2ZD9A 1F51A 1SQVH 5EWFA 1Z2GA 5C5JA 3LDDA 5CBHA 3IG0A 5KG7A 5KFKA 5IYZB 1THZA 4HQ6A 3HXLA 3HKBB 3MAQA 5D1OA 1T94A 2Z02A 4BWSC 3HOXG 2F1MA 1N33O 4KHPH 5CA3A 3T1CA 1IBKH 2OCHA 3M4IA 4X65O 4WCEV 3N41B 1TAEA 4HYOA 3RYFA 2C35B 3TQ1A 2W6MA 4C5AA 4FGRA 4DV2O 4I50F 3A0HZ 1KT8A 4PI0A 3TIIA 4O3OA 5EZYB 5JJNB 1BHBA 4UB8Z 4FM9A 3AG2B 3HKCA 4YJ3B 3WG7B 3VQVA 4DR4B 2PGGA 3K9SA 1L0LH 3UCSC 1AI5A 4TVIA 2W70A 5K1PA 4O7SA 2Q7GA 5LA6B 2DYSB 2FKXA 2LO1A 3K5OA 4GZRB 4XDLA 5IYCO 3HB9A 3ORQA 3T54A 3F7VC 3MWMA 2HEPA 3HB3B 4MA0A 4Q8FA 1EBOA 1GO3F 4IT5A 4RNMA 2FE3A 4JZGA 5IT9W 2W7PA 2JJ1G 2WLJA 3BEHA 3QTCA 1OBDA 3D3IA 5CBGA 2Q7HA 3ABTA 2C00A 2YS8A 1AR1B 4F4WA 1P4RA 1N8RW 1Q82W 1IX9A 2IW5A 3CE2A 1KUQA 3CC2V 2YU9A 5DG7A 1EKFA 2XGQA 5KFRA 1EZJA 4YXWG 4KHPO 1N33H 3L72H 3IC7A 4MTDA 4ZHQA 4FVMA 1JLLB 3U0GA 3KCYA 1B6RA 4KFMA 4CH4A 1GSHA 2EJ0A 4TQDA 1Q86W 4YP3A 1UNNC 1SF9A 4GKKH 3KZIZ 5KFQA 2PY5A 1K8AW 4LMYA 2Q67A 2GDSA 4IR1A 3SGIA 4JI3O 3CRRA 4FFPA 3CJHB 4JTDB 3DGEA 2JK5C 1RPOA 2HVJC 3FAVB 3T4ZA 4B3SO 3HKZA 3RB6A 2V9WA 3MHHC 1QR9A 3CCSV 4J9SA 4FFRA 3S3XA 5IYZA 4FU0A 3HKDB 3AG1C 4CC5A 3GLKA 2RN9A 4FLTA 4DV1O 3BFRA 2L35A 3FYEB 1RPRA 4MVOA 5DQIA 1R3LC 5KFSA 4EFBA 2QWNB 4DR1B 4FMTA 2GBOA 2QKAA 3IN5A 4PA7A 3N6RA 1AP5A 2FPIB 4F4LA 5KFAA 3BQ0A 3ZHUA 3IAYA 4LF5H 3KCXA 2Q7DA 3VQYA 3QG5A 3GIPA 2JEUA 3BJYA 1HR0B 4DV7B 1K33A 3ABLB 1BZKA 4DL2A 1Q43A 1GN3A 2B5UA 2A3QA 3LULA 5CA0F 3RGXA 3G67A 2KSWA 3JD0A 4WFBV 4FLYA 4U7NA 3ICXA 1L1FA 4ICGA 2UXXA 4JYAO 5B1BB 2WLNA 2VS0A 4LFBO 4FJCC 3GV7B 2ZCEA 1YHQV 3W7TA 2UUBB 1MABG 2F4VO 1FYJA 2NU8B 3H01A 5DEDA 3VNNA 4XZ3B 3OFNG 2A06H 3WWHA 2AU0A 4WFFA 5I5UA 5DG9A 1QNMA 2RCVA 2WA4A 1J5EH 5LMUB 2QB5A 1VQ8V 1JJ2U 1SESA 2X0LA 3ABUA 2YRXA 4DV5B 4JV0A 5KFOA 3WB2A 5CA1B 1S5JA 4CKEA 3JCZA 1BJTA 1N36H 2LFSA 2ZM6B 4MV3A 2PVPA 1FXKB 5FPRA 3U11A 2CUGA 1GN4A 5B66Z 3W1GA 1KECA 3H0GG 3EVKA 1IBKO 4ZOLA 5KFZA 3AW8A 4BY1G 1WPXA 2D3OW 1EUDB 2Y0SA 4IL6Z 4M9UA 1I2KA 4FZ1A 4EQ5A 4RAIA 3RT3C 4P9PA 5FNVB 4LF8O 1HP8A 3RGBA 1EKPA 2QJ1A 4LF4H 3T5JA 4TV8F 2HP8A 2BE3A 3JASA 3E2EA 1K4DC 1Z5WA 2ZKOA 3NXSA 3DXRA 4RUAA 4MVQA 1OCZB 2EIKC 3TIGA 4F4ZA 4WBNA 4J9RA 5H6QA 5CE8A 1FD9A 1GN6A 3HOVG 3L2PA 2M6YA 4I4TA 4PDLA 4QIWE 1EN4A 2XAFA 4CHIA 1YTFB 3S3WA 1R6KA 4X1KB 4YR2A 4K8ZA 2E5LO 5LOVB 4LFBH 1M0TA 5CA1A 1M93A 1K5SA 2FLLA 2FYUH 2C2RA 2LW7A 1WCMG 2E2IA 4D7SA 5KMGB 1TVKB 3JALB 3APOA 2LQTA 5FR9A 5LXTB 4LP8A 4B3TB 2Y4TA 2EIMC 3J7AK 4GKJB 4X20B 3ZIAG 5B3SB 3A8TA 2UXDO 4R50A 3OEHG 3ETJA 4DR4O 5CMUA 1Y4MA 3WB1A 2A9HA 2DYRB 2HHHO 5L1KA 4JI4O 3GTQA 1HNXB 5DN6G 1GSAA 5KFTA 2JGUA 1WLEA 4J7JA 5EBLC 1EHIA 4M0JA 2XAGA 1TGOA 1RP3B 3HR0A 1AUXA 4W4LA 4H13B 4BW9A 3T1YB 1C30A 4CZZA 3VA7A 4UCOA 5IY5C 2ASDA 4I55B 2MK3A 4CH3A 3CMAV 3EYYA 2ZIOA 4NXNO 5LMNB 5CM0A 3AK2A 3AG2C 2NU7B 3OSPA 1FJGH 5BR8B 3JD3A 3T5KA 2GTAA 5BR8O 1V4YA 4NZNA 3QFFA 2YXYA 1WA8A 4IRKA 3GTLA 5LL6b 3T1YH 2QDOA 2YC0A 5H80A 2X0SA 2VQFO 4O4HA 3DC6A 2B1IA 2Q68A 3KXYT 4MW8A 2R82A 1QLNA 1PL4A 2DWCA 3HOWG 1RYRA 3UZBA 5T14A 1S0MA 1OHHG 3MJFA 1FVIA 3BABA 5KT4A 3K9AA 2YZGA 4JUZA 1AVMA 1KQSU 4ED3A 3E35A 4O4JB 1Q81W 1M90W 4U6PA 2JA7G 2R85A 2UVWA 2QR4A 4MT8A 4X1YB 3M9NB 2J6TA 5LYJF 4I50A 5IJ9A 1JDBB 2VQEH 4KP4A 1XBLA 3JD1A 3OUUA 2QM4A 2ATLA 2O03A 2UUCO 5B1AB 2X5RA 4ME6A 2UUAB 2FPPB 3K58A 3Q8PB 4C7UA 2QTOA 2EIYA 2V1DA 2W9AA 3C90A 1SQGA 4EBCA 2R93A 4JV2A 4O2BB 1D2DA 4MSWC 1TUBA 4TV8B 4RNNA 4QJFB 3E86A 5I5XA 5EZYA 2YIAA 5CN0A 4X65B 1B3QA 5ITZB 2VQEB 4JV5B 2R92A 5EIBC 3SJAC 2UVUA 5J9PC 2R70A 1NH2B 1NU1H 2KSDA 2NLJC 1WA8B 3CS5A 2LW1A 4ED1A 4RCNA 3V4SA 4LF7B 3RYCB 2ZE5A 3UT5A 1ULZA 1N32H 4X65H 3ZRWB 3H1LH 5BXZA 2R7MA 5J2UA 4O82A 2MCTA 4PZ6A 2YXLA 1QR8A 1DV1A 2HGXA 3G6BA 2E5LB 4UCSA 4IWXA 1XUQA 1K9MW 2VQDA 1KBLA 4DL4A 1KJ9A 1VQKV 2RMKB 2YUAA 4YR0A 1H8HG 1E4EB 4QW8A 2FK1A 3NBYB 2CQYA 4DUYB 2IJKA 4JAAA 4X1IA 1A0GA 1B06A 2CTRA 4X88A 3SJBC 2VUMG 3OUFA 3RB0A 3TEKA 4B3RO 2DIKA 4MVRA 3CC7V 4TM5A 1DGSA 2YIBA 3L74H 3B40A 2JA6G 1QBZA 1MSDA 4QE7A 4GKKB 2YZLA 4J9YB 2V4RA 5H6RA 3GIIA 2F93B 2PMZA 2ADQB 4JI7O 2P6JA 5I60A 1FXHA 1V9PA 4JI0O 5EWEA 2R8IA 3THOA 5BYAA 1U96A 3CCVV 1YJWV 2LFRA 4MTGA 5H2FZ 4DXWA 5D5QA 2I8CA 4BAYA 3K5HA 2HHFA 2RJZA 1N56A 3ZJZA 1Q8IA 1TVKA 3JALA 3T5LA 1VEWA 2IH1C 3BG5A 5KG5A 3L9DA 3VOTA 3PO2G 1EUCB 1GH6A 3RFCA 3H0GA 4LFAH 1QCEA 2UXDH 3L71H 5HV6A 1KTAA 5CBFA 3JD4A 3ZMUA 3W7WA 4MV1A 4GX0A 1I1KA 1G8MA 3AG1B 2IA6A 4FLWA 4DV4O 2OT5A 3CHXA 4OX9B 4RAZA 3WWIA 1AJQA 1N0NA 2WLHA 2R9AA 2ITDC 5E79Z 1JFFB 4JI5H 1RK5A 2E3CA 4ZI7B 3OUSA 4CS4A 4KUMA 4IAJA 3K3WA 4DR1O 1JX9A 3EPIA 4D6TH 2VA2A 2UXBB 2MW2B 2W6OA 3KAJA 2FMLA 3OR6C 5KFFA 3QF7A 4Q45A 3RV3A 1OCZC 2EIKB 3GWKC 3G8CA 3Q8QB 1HDJA 3ABLC 1IBLB 2ZDQA 4DV7O 1XMOB 5JCOA 4LSAA 1NVPB 5LMUH 1KB9F 3B4SA 3CCUV 2HHFB 1K1QA 4JXUA 2DOSA 3NC0B 5FD5A 1SA0B 4IYHA 4QNHB 4LF8H 5KFBA 3OD4A 1QVGU 4J7KA 3FB5C 1OCRC 1YJNV 3UO2A 3OMNB 1BNCA 4JYCA 1N33B 3LQSA 1PNKA 3L70H 5KFXA 1IXBA 2UUAH 1GYFA 2ZNJA 1VQPV 1RFYA 5KFWA 3K06A 1OCOB 3J80W 1M57C 2YDEA 1MSWD 4LCUC 2JGDA 4GCZA 2K9PA 5B3SC 3KREA 5I47A 4FBTA 2Q9LA 1SKVA 3FX7A 5DGIA 2W0XA 1AR4A 5IWAB 1FXKC 2ZXWC 4EBDA 5KLVH 1ZQ7A 2B1GA 3ZMSA 4B3SH 3QWUA 2DE0X 2W8KA 3UZOA 4FZ0A 4OPHA 3PR4A 2ALZA 5LP6A 4PZ8A 4JGSA 2ZE8A 4GT1A 1I7NA 4HNAA 5JWPA 3R65A 5KFEA 1JX4A 2FPGB 1A48A 5KT2A 1QHTA 3RYCA 4CS2A 1K83A 4JI6B 5KFHA 4CH6A 4MTOA 4LF8B 4QIWA 3UKMA 2QM7A 4TV9B 1XHZA 1JOYA 2YIBD 5LXTF 1HNXH 3KHRA 4DR3B 1I5YA 2JS5A 3ASNC 3JARB 4ED0A 3I56V 1GK9A 1DF5A 4MVSA 4O4LB 4ECQA 2XAQA 2IMWP 1GM7A 3VMMA 1F7YA 3J80N 4B3TH 5JQGF 3R5XA 4MV9A 3W7SA 1B6SA 4LF4B 2Q8VA 4PDMA 2Y69B 4H33A 4Q43A 4XDJA 5KG6A 1ZSPA 4O7ZA 4QSHA 4ETSA 4DRFA 5IYBO 1UPGA 4JTAB 4IGGA 2F4VB 4U7CA 2VUGA 1KP2A 3G4SV 4O7RA 3CJHA 4B3MH 4QWAA 3HO8A 4J9OA 1I08A 4LF7H 2YWVA 4F6EA 3SJQC 4FFBA 5BZBA 1OV9A 2V5AA 5EC2C 3L4KA 3J7AU 2JDIG 2HGSA 1FFXB 4QWBA 5KFUA 4GLWA 5L3EA 4B3SB 1B04A 3MDSA 3A0BZ 5DECA 2W9CB 2WPDG 3UO3A 3MR3A 1CE8A 1YVWA 1SYXB 4NLGA 4EEYA 1DIKA 1Q3EA 1JPXA 4YHHH 5B1AC 1YITV 2P22C 2CTWA 3RIZA 2A79B 5L9XA 1VIBA 4ASUG 2CNUA 4MW3A 4RB0A 3GTPA 3CEBA 3PW2A 2JEFA 1K1SA 1CEZA 4PA3A 2R6FA 4IYIA 4ZIBA 1IXMA 2PI5A 1Z2PX 1BL8A 2N74A 4J9MA 4PDVA 5IJ0A 5LGNA 3H9VA 3GV5B 4NXNB 3F5WC 5L1IA 2CW7A 4AQYB 3BVOA 1KJIA 2WTFA 4Y8VB 1Q90D 2Q0OC 2P67A 2LGQA 1TWAA 3HBLA 2VOBA 5KT6A 3HKCB 4JI0B 4F6RB 1S0VA 1GMGA 2DZDA 1H2LA 3K3PA 4PD4F 3C3TA 2DQ3A 5KG4A 3JAMN 3QZ7A 4NXMO 1VQ7V 2OCCC 3ZMVA 1I50A 4EGQA 4J9PA 1EN6A 1VMGA 4BIUA 3RYFB 3LWBA 2UU9O 4YHHB 4C5CA 2JEXA 1UFIA 1VBHA 1NI8A 5I5WA 1GN2A 3ETDA 1EM1A 3E22A 3LSQA 1VAJA 2PN1A 3N2KB 3R5HA 2AGAA 2CTPA 3G8DA 4A3BG 3D8CA 4BW5A 2R93G 4FLUA 3RF2A 4IWYA 5ITZA 5F9NA 3B8NA 1H2SB 3U55A 4TUYA 4U3JA 2HIXA 2XOKG 4F4YA 3ZS8C 4TV8A 2KG7A 1R3IC 1N32B 3RN4A 2OH2A 3T1HB 4DRXB 4LF6H 3AG4C 3ORRA 2H8PC 1FKAO 4DR2H 4PA4A 3N2GB 4J9ZB 3RUPA 4A3DG 4DW0A 5A2QN 2VWJA 4BWAA 2Q4PA 1I5XA 4RWUA 1PNLA 5IJ9B 3GIMA 3L4JA 3DF7A 3I4NG 3D36A 3SPJA 4DR3H 5LMNH 1Y74B 3SYAA 3TXQA 1MMMA 1FS0G 3TETA 2JEJA 1M6VA 5J2TB 5CB4F 4PDBA 5KT5A 1O9HA 1I94O 2NNUA 3GIJA 3RAXA 1PNMA 4LF9B 1RM1B 1XNQH 4NXMB 3GILA 2XAJA 1MZBA 4FFLA 2ZNIA 4DYLA 4A3JG 4FE2A 3RR5A 4QWDA 3K5LA 4ED2A 4FLXA 1ZLZA 3KYHC 2QWOB 3BY6A 4R6ZA 2EILB 3KALA 5IYBG 2N05A 3K5NA 4JAVA 3H1JH 1PX2A 5LHGA 1XMQH 1K73W 3E8HA 4DV0H 3GTOA 1AILA 4YY3B 1E1RG 1AROP 1Y1VA 2COJA 2CKZB 3ZHQA 2VUMA 4ECTA 2ZM6O 1GRJA 2Z5UA 4IHJA 3T9DA 1C3OA 2R84A 3PVXA 2WE6A 1NS1A 2ZXWB 4DR6O 3WWJA 3SYPA 4YJ2A 4C2MA 3EPGA 1NTMH 4DV6H 3H3VH 4DR7H 2RDIA 3P30A 1HNZH 5B5EZ 4YIOA 4Q20A 3Q1KA 3CRMA 4DR5O 1S3JA 1V55C 3TY8A 1VQ4V 3FFQA 1OCOC 4HNUA 1SETA 1YDXA 3JZIA 4L8JA 3RW0A 2QWPB 1WB8A 3RJ0A 3RYIB 2NN4A 2BR0A 4QW9A 3ABKB 3HOZG 4E4TA 4RB1A 1SZTA 5KX5B 2DABA 2GQRA 2AGPA 1S68A 1SA0A 1TA8A 1A32A 3QNEA 2Y69C 4JYAB 1ZL8B 1KD1W 5L3CA 3JSLA 1URFA 3ZBHA 4N21A 4BBSG 2XGPA 2ATKC 3G6XA 1N48A 5GTHZ 3GWOA 1BE3H 3GTMA 1D5NA 1XHXA 3W1BA 1I3QA 4J80A 5L3GA 3VPDA 5KG1A 1GGOA 4L87A 2IU0A 2VR1A 3RTXA 1PV0A 4ZHQF 1ZAUA 4JI8H 5IDJA 2YCHA 1JXLA 2FLNA 1T3NA 1XMQO 1WN7A 2P4VA 2J6UA 3GIKA 1S0NA 4PJ0Z 4ZI7F 5LYJB 4UUGA 3T1HH 4E4EA 5JCOC 2ZE6A 2UXBH 3RVYA 5H5NA 3NUAA 1SFOA 4Z1MG 2CGNA 2CNVA 2E2HA 1OCRB 4X62O 5FLMG 3ZHRA 4LC1A 1XNQO 2Q73A 1VQNV 4ABMA 4NZMA 1VF6A 4O4IF 4FIPC 1I94H 4QPJA 3G6YA 2IBKA 3STZC 4JI1O 4OX9H 3K0DA 2R8KA 1P16A 1KBHA 2WAQE 4JI7H 4PV1B 1RSOA 2P7TC 1M57B 3K3VA 1KC7A 4TUYB 4LNUA 3BAAA 5LMNO 2R9RB 3L73H 2GLTA 5J2UB 1OWTA 2AGOA 5J2TA 1YXBA 3BA9A 3GB7C 3RVZA 5IYDO 3BA8A 2OTJV 3A2FA 4PA6A 3LP8A 2C2DA 2W7OA 4DUYH 2HVSA 1V54C 3K0GA 3FKSG 1ZHSA 3RFRA 3RGZA 4DUZH 2JA5G 5H9CA 1SQBH 4TSFG 3JAKA 4DUZO 2YICA 4IRCA 2ILMA 2C28A 2EJ2A 1DTOA 2KB1A 5LHHA 4YJ3A 4QGPA 1IOVA 4DUYO 1I2LA 1XREA 2XCPA 5FNVF 2ZDHA 1M9NA 1A9XA 3OSNA 4Z2WA 5DGAA 3I5DA 1HR0H 4ZQIA 2NVYA 4DR6B 1R9TA 4AILC 4LF6B 1VQMV 1US6A 5I5TA 2RNBA 2XT9A 1K7DA 2HIVA 1CP9A 4PBCA 4LFCH 3HKBA 3E8GA 2FK3A 1SQQH 4I9QA 2HJDA 1ZL8A 3VQWA 4X62H 3SPHA 4O4LF 1CPYA 2DWEC 2BOBC 3IC9A 1H8EG 3NGDA 1E4GT 2JA6A 2COIA 2FTKA 5LOVF 5JH7A 2HVKC 3OTOB 4WHXA 2ZDIA 2I80A 1BHAA 2W9BA 3CXHF 4KL1A 4LH6A 4JI3B 2HR3A 4MTEA 5L3DA 1S97A 2WAQA 4DLKA 3ZMZA 2XIGA 3V6KA 5C8YB 1EZ1A 1FXVA 1I94B 2W9CA 1GKFA 5LA6F 4LF9O 1E4EA 4X66H 1ZTEA 2SCUB 4WD3A 2GTSA 2WDTA 2FMAA 4HYKA 4I50B 3V4ZA 4NB5A 3P3PA 4GC6A 3GIDA 3E89A 4JI2H 3ABMC 3ZRXA 1Q7YW 3QO7A 2PYLA 4LFCO 4O3QA 1W0KG 2HGWA 2H94A 2B9ZA 2X7RB 2WB1A 1ORQC 4MA5A 1MNGA 1XMOO 1WP8A 5KFLA 2UXCB 3DTGA 3FB8C 1YSCA 1VS0A 3JZ6A 5D1OB 4JV1A 3WO1A 5I5VA 3GTJA 1I0HA 1SQFA 3MR6A 2BQUA 2OIEA 1LR1A 1SCUB 5KX5F 1PPJH 4O4LA 4C5BA 4X64H 3T9AA 4DR5H 1Q5OA 2C2AA 2Y0SE 3I12A 2N04A 3PN1A 4HR7A 3Q8RB 3ETHA 1H2NA 4J9KA 1SEIA 5DGBA 3CCRV 4I55F 3AX6A 2GHYA 2CTQA 2DN9A 2EILC 2W6IG 1ZUQA 3OTOO 4DR6H 1L2ZA 4HN2A 1RJRA 4EGJA 1P49A 4YB8B 1AJNA 3CWBH 4B3TO 4JI4H 3RBDA 1S72V 2PF4E 2W71A 2R8HA 4DV5O 1W59A 3SJCC 1GLVA 4BXXG 2WB1E 3HOUG 2EJRA 2LJ2A 3QO8A 5KHIA 2V59A 4GLXA 2LGWA 2F95B 1Y66A 4O4JA 2QF7A 4O7WA 4I4TB 2AZ2A 3H20A 3LNNA 1B6QA 1NTKH 3G6EV 3RBZA 1MZEA 4DV1B 2F66C 2UUBH 2Q7EA 2ASJA 4IHJB 1OCCB 5LXTA 1CS0A 2GUZA 3W5OA 4DW1A 1KU9A 2JA8G 1GAXA 5KMGA 5DLGA 2ETNA 2J9GA 1SQXH 3R23A 2YXHA 4O83A 2FJZA 4U7OA 2M05A 4O4HF 3X2QC 4GUNA 4EYHB 5JVLA 4IIJA 5F9LA 1K3EA 3E83A 5EC1C 4E2LA 1IOWA 1PL0A 2WA3A 4NYEA 5KA5A 4P9OA 4H44B 3FMAA 1O75A 1IYEA 2GQSA 1JMKC 4NVPA 5F2VO 4JI7B 3ZRVA 1F4MA 1KJ8A 4LF4O 4OGQB 2P90A 1RSOB 2UUAO 2PBZA 4KHPB 1RM1C 1YF2A 4TV9A 2A0LA 4YJ3F 1AI6A 4O2AA 3B09A 4O7YA 5C8YA 2HVQA 4TOIA 5C1PA 1VARA 1XILA 3FB7C 2WLIA 2CH7A 1S10A 4NTYA 1H38A 2NVXA 1HNWB 1CKOA 4A5UB 1MOFA 3K04A 1P84F 4RUCA 4K6NA 2EIMB 4ZI7A 5LMUO 1B33N 4QWEA 3H1IH 2G38A 1N36O 4DV7H 4A3KG 2W8LA 5HNEA 4MVMA 3JSNA 3LNMB 1PM9A 3BRCA 3GV8B 1RJPA 1JIHA 4MTFA 5L1LA 5C1OA 2JIZG 3B77A 2XNDG 4O7LA 2KQXA 5LL6Y 4DR1H 3WO0A 2C22A 3T4DA 3TY5A 5KFYA 1HNZB 1OZ0A 4DV3O 4X66B 1VF7A 4O4IB 4MV7A 4X66O 4JYAH 2OYQA 2RQ6A 4DL3A 4RO2A 3SNOA 2UVRA 2EINC 1NTZH 1G6UA 4K8XA 1JFFA 4ED6A 2R87A 5FL7G 1W0JG 3LDCA 4UV8A 1CKNB 1JCHA 3M99B 5C44G 1WPBA 3DSQA 5C93A 4JZ2A 2BOCC 2W6JG 3U10A 4YAJB 3CYOA 1LUWA 5HBRB 3VPCA 3T9BA 2XHBA 1Y74A 1DK1A 2V58A 1V54B 1AUVA 2HVRA 3AK1A 2A1HA 5CA0A 5C8YF 4I4TF 2QM8A 3ZRSA 1GSOA 2YZNA 2DQ0A 3U0ZA 2UUBO 3RB3A 5KHGA 4WFEA 3U9TA 4JI0H 4L1KA 1UC8A 5JUMA 5DAAA 3CCJV 3OR7C 2RF4A 4YHHO 1BSMA 2KG7B 5KUMA 1YTFD 2EJ7A 2EJ3A 2GPWA 4FM0A 5EYPB 5KFMA 4X9QA 4M7EA 2Q0AA 2WLKA 1JQ0A 5KFJA 3T2MA 5IYZF 2R72A 1TWFA 3CCMV 1XEQA 4A3EG 1R3JC 3HKDA 4DR2O 1FKAH 2YSUB 3P32A 4DR2B 4LWSB 3OM3B 5CR5A 2FK2A 1NQTA 1IURA 3W7UA 1M5IA 1WR2A 2PI4A 3MHSC 3LUTB 3VQXA 5FLXW 4DL6A 4FS2A 1P7GA 4YAKB 2YEVA 3JRWA 4G27B 4GX1A 5KG2A 2CW8A 3A0RA 1TWGA 3TJTA 2JEIA 4YJ2B 3T99A 5JVDF 1TUBB 3RAQA 4BBRG 1KUTA 1CKNA 1VP7A 4UXNA 1E79G 3H1HH 3SYOA 2WLMA 3R5FA 2ODMA 2OIGA 3DC5A 2GV9A 2FKLA 1WSCA 5LP6F 3JASB 1WNSA 1Y1WA 1BT8A 3CP1A 4GX2A 5CA0B 2L6LA 5IYDG 5KFGA 4HZ3A 4J11A 5IP9G 3WNZA 1T5EA 2ZR3A 2EBOA 3GQCA 1IYDA 2ASLA 5KG3A 3ABMB 5JH7B 4DAAA 4G28B 4UVAA 5FPOA 4IIJF 5KX5A 4OXSA 1PKXA 1FXKA 3S24A 2FLPA 4O2BA 4ECUA 2W6ZA 1YZBA 2Z3YA 4A3LG 5DG8A 1FPOA 4O4HB 2UXDB 4ECYA 3O65A 4GKJO 3B2EE 1K34A 3N2KA 3E8FA 1FJGB 2QKSA 3DAAA 4HNVA 1GM8A 2PZSA 4A3GG 4Q0YA 2IM9A 1DF4A 2P0AA 2BCCH 2ZDIC 3AG3B 4R8CA 1P8LA 2H3OA 3CRCA 4DRXA 2IJIA 1QQCA 1IBMB 1R1BA 2R7NA 1R6TA 2JA5A 4DQNA 4TQFA 1AJPA 4O86A 5BWVA 5KT7A 1OCCC 1KMIZ 1QVFU 1ZHQA 4DK1A 2OTLV 5BWWA 4IR9A 5KHHA 2HFEC 3N40P 3KHGA 2ZINA 3X2QB 4JV5O 3HKZE 4IRDA 1H2GA 2EIJC 2QWRB 1HR0O 3MWEA 5KHKA 4Q4CA 5K3WA 4O3NA 3BPZA 4DK0A 4UUJC 4QIWF 4RZQA 1FAFA 3JRXA 3ASOB 5EDWA 3RB4A 1WAZA 4JF3A 3C3SA 2JVDA 4I0XB 4J0MA 4LFBB 5IE9A 3E5NA 3ZN1A 3AG7A 5EWGA 4LH7A 3TQTA 3LDEA 1Y1WG 1Q6UA 5J2UF 3N27A 2VPSA 1ROPA 2FP4B 5GTIZ 1HNWO 4F6RA 5KS8A 3CCQV 5EOYA 3V6HA 1E1QG 3EFFK 4FFMA 3L75H 2Q2TA 2WLLB 4X1IB 4GX5A 1EZVH 2HG8A 3CCLV 3P3NA 5BMVF 2W0FC 4UVBA 4ECSA 5IJ0B 2O57A 2QWQB 3CD6V 2PUSA 1VQ5V 5BMVA 4U3JB 2Y0PA 3KHHA 1V51A 4JI5B 2PTMA 4O4JF 1JKJB 4W4KA 4PWQA 4PHZA 2YEVB 2WWWA 4ECZA 4DR5B 4K35A 1EKVA 1XOUA 1KKCA 2WLLA 3MR2A 1KP3A 1NH2D 1LNQA 2EULA 5BPHA 4Q4DA 4A2BA 4O84A 2EINB 4EEQA 3D36C 1N34B 1BQ0A 2VPQA 4FFNA 2Q2UA 4FLZA 4P30A 4DV2B 3H4DA 2HJWA 3E22B 1A3GA 1S9FA 5HFLA 1JDEA 3IFXA 4DV5H 3D3QA 4JI8O 2IH3C 4B3RH 4MAMA 4CH5A 2E76B 3CSWA 5KAFZ 1S76D 4EKWA 4PA9A 3F7YC 4X20A 2R7KA 1YIJV 4FFBB 5IYCG 1HNWH 5BWXA 4U3FH 3PW0A 2VQFB 3RV4A 2E75B 3SYQA 5BPFA 1IVSA 1QLEC 2NUAB 2W57A 4J9NA 2ZE7A 4CS3A 5KUKA 4XYMB 4DUZB 1HWYA 5FNVA 2NU6B 4N23A 4LFCB 1WH2A 3ASNB 2QEXV 3T9FA 2F43G 4TQRA 3NR7A 3QZ8A 3APQA 4KXRA 5CB4A 2QYZA 4UV9A 4YQWA 5BWRA 2EZOA 3T9EA 3MFIA 1DV2A 2DYRC 1U97A 1DAAA 1N34H 2BTOA 4PDRA 4J9QA 1M56B 4X89A 3PR5B 2IJJA 1XNRO 3ML0A 3M7MX 2YS6A 4JI2O 4O4IA 5L1JA 3OHBA 2CFMA 5LOVA 4HBNA 5HFMA 5LGUA 4DV6O 1F23A 4DR7O 3SPGA 4DV6B 4DR7B 4JI1B 4JPRA 4RB3C 5EBWC 4O7TA 2ZR2A 1S5HC 3CX5F 4DIMA 2Z0AA 4QPKA 4TUYF 2ZM6H 3C0FB 3KG2A 1WB7A 2ABJA 1TWHA 1FFXA 3M9MB 2DMXA 4Z1VA 1IBLH 4GKJH 5EK0A 4DV0B 3EHBB 4LFAO 2VA3A 4LFAB 3NBZB 4DV4B 4WBNF 1NT2B 3FKIA 1KEEA 2B63A 3OEEG 2ZDGA 3SYCA 2CDYA 1Y76B 3SR2C 3OGIB 4PELA 2UXNA 5IT9N 3SI8A 5LP6B 4A2AA 3Q4HB 4EBEA 4FM1A 2Q69A 4UCVA 1AI4A 1I7FA 1TWCA 3H4BA 2J6SA 1XDNA 3MD0A 4XX0B 1AR5A 1ZETA 4ZHQB 5JVDB 4RUFA 3K5MA 4DR3O 2QE7G 1KJQA 3LMLA 3J81W 2AHZA 1KYOF 2HJFC 4CMFA 4LNUB 1K5QA 4FFKA 3CXCU 1XL6A 2P4KA 2Y0IA 3FD9A 1FJGO 2FB9A 3JCUZ 4JI3H 4ZBMA 1S03G 2OWOA 4NXNH 5KAIZ 5KFNA 2A7WA 4LF6O 4LWSA 5BWTA 5GONF 1CXZB 1JJOA 4ECVA 4A3FG 4APMA 2R92G 4RB2C 2AQ4A 5KFPA 1YEWA 4B3MO 1Y67A 2CNQA 2GSMB 5GONA 3GB8B 3U9SA 2DPIA 4NR1A 3OMAB 4WFHA 1O9GA 2OCCB 4K3AA 1OBGA 3K5IA 4AYBA 4ECWA 4CBCA 4TV9F 5EBMC 1Q6IA 1JR9A 4X8AA 3ZHVA 2ODTX 2EIJB 2HHHH 4O3SA 2HG5C 2X6CA 3RWRD 4D7TA 5FJ8G 4DR4H 1Y76A 3BCCH 2RDCA 4RAYA 2IU3A 4H0LB 2Z04A 2Y48A 2XD4A 3FAVA 3UYYA 2CH7B 3I4MG 2RDJA 1KKDA 2UU9H 3KAKA 3AG3C 1HNXO 4X1YA 4OX9O 2XC9A 4JI1H 4K0KH 1CQJB 1NR1A 1VKZA 1RK6A 4NXMH 1K4CC 1ENVA 3RYHA 1I1LA 4B7KA 4XYLB 4ZOLB 1JVMA 1SC5B 4J42A 1NVPD 2UXBO 4R7CA 3FDSA 4ECXA 5BY1A 1G2WA 5DISC 2BSKA 1TUEB 3T1HO 1SS3A 3VPBA 2QSAA 4DL7A 1NBMG 1X59A 1L8DA 2E74B 3K79A 1L0NH 5KA6A 2PYJA 1XK5A 1Z5VA 3TINA 2V7QG 4EG0A 3ASOC 1DLBA 2RGVA 3OUZA 4AQYO 3K57A 4HNAB 2QA4V 2KKWA 3ETEA 4I7HA 4PZ7A 4MV4A 4RQFA 2GUZB 1RJQA 4I9WA 4LF5B 4DV3H 3I55V 3QQMA 2ADPA 1R3KC 3TW7A 5LYJA 2QK4A 3CSXA 1JA8A 3PJSK 3BHPA 5BMVB 4UVCA 4FFOA 5A9GA 2QKCA 3KKYA 3Q4HA 4YJ2F 4CKBA 1BCCH 3OHAA 1X4TA 3ETQA 4FM2A 3TK1A 3UFXB 1AI7A 3UT5B 1F4NA 3GIQA 3OT7A 4AHCA 3E8BA 3JAWB 2HDKA 4CKCA 4G3IA 5IWAH 1VF6C 1KC8W 1BQZA 3JD2A 3IJ4A 1VQ6V 2ZQMA 2BQRA 4BY7G 1J95A 3TGUH 2QTSA 4RZRA 2LP7A 2FB5A 1WRVA 1NJIW 4ZKIA 1J5EO 1SQPH 4Q6GA 4R7RA 4F4XA 1SERA 2OLSA 3RBEA 5KT3A 4CC6A 2UUCB 3PW4A 5CAEB 2R7ZA 5IP7G 1VF5B 3J81N 1EYZA 1IBMO 5KHJA 4JI5O 2P5OA 1HNZO 3ZRWA 4X62B 5KFDA 3H40A 1X9NA 5L3FA 5DQHA 1Y6XA 2DJVA 5E1AC 1NR7A 2X6BA 4J9LA 3G6VA 3LSUA 3GTKA 1W93A 2HKOA 3UQ8A 4J41A 5JQGA 1BGWA 3QVNA 1M7JA 2JRIA 1XQ8A 3JAMW 5DM6V 5CB4B 4ED7A 4BIOA 2YI9A 3GJXB 4LF5O 2I87A 3JATA 3HKEA 5D5PA 2W6PA 4WBNB 4NTWA 3LSSA 3QO5A 4Q8EA 2M7WA 5KKNB 3MFHA 3PZPA 3ZCCA 4XDKA 2IJHA 3TY9A 1YJ9V 2BTQB 3T9CA 1ET0A 3CRAA 3HOYG 3OW2U 3TXSA 2YL2A 2DAAA 5BYBA 1G4YB 4YIPA 1I6UA 3CQZA 5IWAO 5JH7F 1XMQB 1M1KW 2Y4RA 3G80A 3OTOH 4R8UA 4AI8A 2YW2A 3JARA 4GKKO 1SZXA 1R6NA 4EFEA 1IBKB 4OPAA 1HW7A 1WJZA 2BTQA 4NYKA 1XNRB 2ZGIA 2DYSC 4X64B 5B1OA 4RU9A 5EIBD 4X64O 5DLFA 2EX3A 4MVZA 2JEGA 3N8DA 1I7LA 4YBZB 4JI6O 2YS7A 1T36A 4UCRA 1N32O 4QWCA 1R73A 1W2BU 5FD6A 4FLVA 3SDLA 1P7BA 2XCLA 2JA7A 4WFAV 4AQYH 1XMOH 4UFZA 2NU9B 2UXCO 4NZOA 4H37A 1NZ6A 4BIZA 5KFIA 2IP4A 3K03A 3BQ1A 1NKDA 4QE9A 3DXRB 3JAKB 1I1MA 1XI1A 1QLEB 5C4XG 2D2CB 3N43B 3AEIA 4A3CG 2W9BB 2F4VH 1WCMA 4LR3A 5LP6C 2K1EA 2BQ3A 1GTOA 3F8NA 2YIDA 4LF9H 4J10A 2UU9B 3CC4V 4K0KO 1M0WA 2PMZE 4K0KB 5LBQA 2BSKB 2V4QA 4JYBA 4J7ZA 3SPCA 5DGHA 1N36B 4O2BF 4GC7A 3STLC 4I55A 1LUVA 4HNTA 3CRQA 1COWG 5C3EG 4JASA 2V4DA 2R7LA 5E25A 3WG7C 4JI4B 1CQIB 4WF9V 5LGTA 4DO2A 2HHHB 4DV2H 3JAWA 1M56C 2DLNA 1E4FT 4GYCB 1MG1A 2DW4A 5DQGA 4JI2B 4UB6Z 3SPIA 1YI2V 3Q2OA 4FBUA 3FB6C 5JVDA 3JATB 5DMXA 3OMIB 3T1YO 2ZJTA 3GVMA 3JYCA 3WU2Z 3TW6A 2X6AA 5BR8H 4XBFA 3PO3G 2IBZH 3VOUA 3M8AA 1BXRA 4B7EA 4RNOA 2R9IA 5AG2A 5GONB 2CE4A 2R86A 1IZ3A 4LF7O 3OGCC 2ITCC 1AN7A 3KTMA 2FL4A 5BWUA 5CA1F 2JS3A 3HPLC 3N44B 4FPPA 3ZX6A 5B1BC 3FYIB 1CKMA 4X1KA 4EYIB 4WFGA 2YZMA 3SE7A 2VRZA 5JJJB 4HAMA 3V6JA 1D5AA 3ZMTA 1PD3A 1FFTB 3IGAC 3RYIA 3U54A 2WSSG 2ZIMA 5EYPA 1XL4A 4LBEC 4MV6A 1Y14B 2XASA
chains in the Genus database with same CATH topology
4PI2A 1ZAUA 2Q2TA 4O4JB 4JI8H 2YCHA 4X1IB 5D1PA 4X1YB 4LSXA 1WN7A 4I50A 5IJ9A 5IJ0B 2VQEH 5LYJB 3N2GA 3T1HH 2PUSA 2QM4A 1M4UA 5JCOC 2O03A 2UXBH 5BMVA 4U3JB 4B3MB 2UUAB 3K58A 4JI5B 2E5LH 2PTMA 1SQGA 4PHZA 4O2BB 4DR5B 4TV8B 1TUBA 1I94H 2UUCH 5EZYA 1XNRH 2YIAA 4OX9H 4X65B 4A2BA 5ITZB 1P16A 2VQEB 4EEQA 4JV5B 4JI7H 1N34B 1RSOA 2Q2UA 4FLZA 3K3VA 4TUYB 4LNUA 4DV2B 3BAAA 4IIJB 5EIBC 3SJAC 3E22B 4JI8B 4DV5H 2R70A 2UXCH 5J2UB 4B3RH 4CH5A 5J2TA 3BA9A 3BA8A 3A2FA 4LF7B 4X20A 4DUYH 3RYCB 2HVSA 4FFBB 3UT5A 1HNWH 1N32H 4X65H 1ZHSA 2VQFB 5J2UA 2MCTA 3RFRA 4PZ6A 4JI6H 2W57A 2YXLA 3RGZA 4DUZH 3RYHB 2E5LB 4UCSA 1Z2OX 4CS3A 2VQFH 3JAKA 3N6XA 4DUZB 4EB6A 5FNVA 4DV3B 4LFCB 4YJ3A 3ZEDA 1WH2A 3NBYB 4DUYB 4X1IA 3SJBC 4E6NA 5CB4A 4EB6B 4B3RB 1HR0H 3HKEB 1DGSA 2YIBA 4GKKB 4DR6B 1N34H 2F93B 2BTOA 4AILC 4LF6B 3GDEA 4LFCH 2HIVA 3HKBA 4UCTA 2YI8A 3M7MX 1V9PA 4O4IA 3THOA 4I9QA 5JJEB 3VQWA 2CFMA 1XNQB 4X62H 5LOVA 4HBNA 5D5QA 4DV6B 2CAZC 4B08A 4UCUA 4JI1B 4DR7B 2RJZA 4DV4H 4RB3C 1E4GT 1Q8IA 1TVKA 3JALA 2WYOA 5JH7A 2VWKA 3OTOB 3C0FB 2ZM6H 4LFAH 1FFXA 1IBLH 4GKJH 4KL1A 2UXDH 4LH6A 4JI3B 4DV0B 4MTEA 2RGRA 4YY3H 4LFAB 3WB0A 3K59A 1A0IA 3NBZB 2XIGA 3OTFA 5C8YB 1NT2B 4DV4B 4FLWA 1J5EB 1I94B 4RAZA 3CHXA 4OX9B 4X66H 2WDTA 5A2QW 2R9AA 4I50B 3SR2C 4JI5H 1JFFB 5LA6A 5LP6B 2E3CA 4A2AA 3CB2A 4ZI7B 1IBMH 4FM1A 4JI2H 4CS4A 4UCVA 1I7FA 4DV1H 4IAJA 2PYLA 1XDNA 1Z2NX 4O2AB 5K1XA 2UXBB 3KAJA 4ZHQB 3N42B 5JVDB 3K5MA 3CVZA 3QF7A 3LMLA 3J81W 4B3SH 4LNUB 1IBLB 4JI3H 1XMOB 2UXCB 1S03G 2OWOA 1VS0A 5JCOA 4NXNH 4LSAA 5D1OB 5LMUH 5JQGB 1JJOA 4JV5H 4APMA 1SQFA 3NC0B 4RB2C 5FD5A 1SA0B 4LF8H 1YEWA 3IG0A 5GONA 3GB8B 4O4LA 4X64H 4DR5H 5IYZB 3HXLA 1Q5OA 3HKBB 3MAQA 5D1OA 4BWSC 1O9GA 2F1MA 4KHPH 3PN1A 1N33B 1IBKH 3M4IA 1SEIA 3N41B 1TAEA 2UUAH 1GYFA 2ZNJA 3RYFA 4DR6H 3J80W 1L2ZA 4JI4H 1P49A 2HHHH 4PI0A 3RWRD 4D7TA 4DR4H 3SJCC 5EZYB 5JJNB 4FM9A 4RAYA 3HKCA 1SKVA 4YJ3B 5KHIA 3VQVA 4GLXA 5IWAB 4DR4B 2PGGA 2F95B 4O4JA 4I4TB 2UU9H 3KAKA 3H20A 3LNNA 4X1YA 3QWUA 4JI1H 4K0KH 5K1PA 2Q7GA 5LA6B 5LP6A 4NXMH 4PZ8A 4DV1B 3K5OA 3RYHA 2F66C 4HNAA 2UUBH 2Q7EA 4ZOLB 4IHJB 5LXTA 1QHTA 3RYCA 4CS2A 3W5OA 3MWMA 1KU9A 2HEPA 4JI6B 5KMGA 4CH6A 4LF8B 1HNXH 1XHZA 4TV9B 5DISC 2YIBD 4DR3B 2FE3A 5IT9W 2JS5A 1L8DA 3JARB 3QTCA 1XK5A 4IIJA 2PYJA 2Q7HA 1Z5VA 4O4LB 2RGVA 3FMAA 1O75A 4B3TH 3K57A 4HNAB 2KKWA 1JMKC 4MV9A 4NVPA 4PZ7A 4JI7B 4LF4B 4LF5B 4DV3H 4KHPB 4TV9A 5LYJA 4ETSA 1N33H 3CSXA 4O2AA 4DRFA 3BHPA 5BMVB 4MTDA 4ZHQA 5C8YA 4FVMA 2F4VB 2VUGA 2HVQA 4TOIA 4CH4A 1X4TA 4B3MH 3ETQA 4LF7H 4FM2A 4TQDA 1HNWB 1CKOA 4FFBA 3UT5B 4GKKH 4ZI7A 3L4KA 2PY5A 4LMYA 4AHCA 3JAWB 2HGSA 1FFXB 3SGIA 5IWAH 4I7HA 4DV7H 4B3SB 1B04A 3JSNA 3BRCA 1SYXB 5IYZA 3HKDB 4R7RA 4Q6GA 1Q3EA 4CC5A 4YHHH 4FLTA 2P22C 4CC6A 2UUCB 4DR1H 3RIZA 4RB0A 5KHJA 4EFBA 2P5OA 3TY5A 4DR1B 1HNZB 4X62B 4X66B 1VF7A 1X9NA 4O4IB 4MV7A 4JYAH 2OYQA 2RQ6A 3IAYA 1G6UA 4ZIBA 4K8XA 4LF5H 1Z2PX 1JFFA 3VQYA 3QG5A 5IJ0A 3UQ8A 1HR0B 1CKNB 5JQGA 4DV7B 4NXNB 1BGWA 1WPBA 3DSQA 1Q43A 4AQYB 2CW7A 1XQ8A 3JAMW 3U10A 5CB4B 2XHBA 3GJXB 2YI9A 2KSWA 3RGXA 4FLYA 2VOBA 3JATA 3HKEA 2HVRA 5D5PA 3HKCB 3ICXA 4F6RB 5CA0A 4JI0B 4WBNB 3U0ZA 2ZCEA 2UUBB 5KHGA 4JI0H 3VNNA 3TY9A 3RYFB 2BTQB 4YHHB 1J5EH 4FM0A 5EYPB 5LMUB 4M7EA 2Q0AA 3E22A 4DV5B 3WB2A 2R72A 5CA1B 1S5JA 1I6UA 1BJTA 1N36H 3N2KB 3HKDA 1XMQB 2ZM6B 3OTOH 1FKAH 5FPRA 3U11A 3JARA 4DR2B 3W1GA 4EFEA 1IBKB 4ZOLA 1M5IA 4FLUA 1HW7A 3RF2A 2BTQA 5ITZA 1XNRB 3VQXA 5FLXW 1H2SB 4X64B 4TUYA 4U3JA 5EIBD 2HIXA 2EX3A 3ZS8C 4TV8A 4EQ5A 1N32B 5FNVB 2CW8A 3RGBA 4UCRA 2QJ1A 4LF4H 3T1HB 4YJ2B 4DRXB 5FD6A 4LF6H 3JASA 1TUBB 4FLVA 4DR2H 1Z5WA 1CKNA 3N2GB 4AQYH 2VWJA 1XMOH 4UFZA 4BWAA 4WBNA 5IJ9B 3L4JA 3DF7A 2GV9A 4DR3H 5LMNH 3JASB 3L2PA 1WNSA 4I4TA 3JAKB 5J2TB 5CA0B 4PDBA 1O9HA 1XI1A 4X1KB 4LF9B 3N43B 1XNQH 2F4VH 1T5EA 4LR3A 5LP6C 4NXMB 4K8ZA 1MZBA 5LOVB 5JH7B 2ZNIA 4LFBH 1M0TA 5CA1A 1M93A 3RR5A 3F8NA 5FPOA 4LF9H 3K5LA 4FLXA 5KX5A 4D7SA 3KYHC 5KMGB 2UU9B 1TVKB 3JALB 3KALA 3S24A 1M0WA 4O2BA 3K5NA 5LXTB 4K0KB 4B3TB 1N36B 4O4HB 4GKJB 4X20B 2UXDB 3J7AK 1XMQH 4DV0H 3B2EE 4I55A 4YY3B 3N2KA 1FJGB 2V4DA 2PZSA 4IHJA 3WB1A 4JI4B 4Q0YA 2IM9A 2HHHB 1HNXB 2WE6A 4DV2H 3JAWA 1P8LA 2JGUA 1E4FT 4GYCB 4DRXA 4YJ2A 4DV6H 4DR7H 1QQCA 1IBMB 1HNZH 4JI2B 1TGOA 4TQFA 5JVDA 1KMIZ 3JATB 1ZHQA 4DK1A 2ZJTA 4BW9A 3TY8A 3T1YB 3FFQA 5KHHA 3N40P 4UCOA 2ZINA 4I55B 4CH3A 5BR8H 3EYYA 2ZIOA 4L8JA 5KHKA 5LMNB 3BPZA 4DK0A 4RZQA 3RJ0A 1FJGH 5BR8B 3RYIB 5GONB 4RB1A 2JVDA 5KX5B 1S68A 1SA0A 1TA8A 4JYAB 1AN7A 4J0MA 5LL6b 3T1YH 4LFBB 3JSLA 3N44B 1CKMA 4O4HA 4X1KA 4LH7A 3KXYT 5JJJB 2VPSA 1D5AA 1XHXA 3W1BA 4F6RA 3RYIA 1FVIA 2ZIMA 5EYPA 3BABA 5EOYA 3RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCR A;  1ZAU A;  1A0I A;  3NBZ B;  2Q2T A;  3T1H B;  4DRF A;  4DV4 B;  1I94 B;  5D1P A;  1J5E B;  4OX9 B;  2F4V B;  2VUG A;  1CKN A;  2HVQ A;  4TOI A;  4UFZ A;  1HNW B;  1CKO A;  4UCV A;  4B3M B;  3L2P A;  2UUA B;  1XDN A;  4JI5 B;  3SGI A;  2UXB B;  4B3S B;  1B04 A;  3JSN A;  4DR5 B;  1N32 B;  4LF9 B;  4X65 B;  4NXM B;  1IBL B;  1P16 A;  2VQE B;  4EEQ A;  4JV5 B;  1N34 B;  1XMO B;  2UXC B;  2Q2U A;  4CC5 A;  2OWO A;  1VS0 A;  5FPO A;  4CC6 A;  3BAA A;  4DV2 B;  2UUC B;  5D1O B;  3RR5 A;  3KYH C;  2UU9 B;  4JI8 B;  3NC0 B;  3S24 A;  4EFB A;  4K0K B;  4B3T B;  3TY5 A;  4DR1 B;  1HNZ B;  4X62 B;  4X66 B;  3BA9 A;  1X9N A;  1N36 B;  3GB8 B;  4GKJ B;  2UXD B;  3BA8 A;  4LF7 B;  5D1O A;  2HVS A;  4YY3 B;  1FJG B;  3PN1 A;  2VQF B;  1N33 B;  4JI4 B;  4PZ6 A;  1TAE A;  2HHH B;  3UQ8 A;  1HR0 B;  1HNX B;  1CKN B;  4NXN B;  2E5L B;  4DV7 B;  1P8L A;  4UCS A;  4AQY B;  4DUZ B;  4DV3 B;  1IBM B;  4LFC B;  4JI2 B;  3GJX B;  2HVR A;  3NBY B;  4DUY B;  4GLX A;  4JI0 B;  5IWA B;  4DR4 B;  3TY8 A;  4E6N A;  3T1Y B;  2UUB B;  3QWU A;  4UCO A;  4B3R B;  1DGS A;  3VNN A;  4GKK B;  4DR6 B;  4PZ8 A;  5LMN B;  4DV1 B;  3TY9 A;  3GDE A;  4LF6 B;  4YHH B;  5LMU B;  2HIV A;  5BR8 B;  3W5O A;  4UCT A;  4JI6 B;  4DV5 B;  1V9P A;  4LF8 B;  2CFM A;  5DIS C;  1XNQ B;  1S68 A;  1TA8 A;  4DR3 B;  4JYA B;  1XMQ B;  4LFB B;  4DV6 B;  4UCU A;  4JI1 B;  2ZM6 B;  3JSL A;  4DR7 B;  1XK5 A;  5FPR A;  4DR2 B;  1CKM A;  4LH7 A;  3W1G A;  4EFE A;  1IBK B;  3OTO B;  1XNR B;  3W1B A;  4PZ7 A;  4JI7 B;  4X64 B;  1FVI A;  4LH6 A;  4JI3 B;  4LF4 B;  4DV0 B;  2HIX A;  3BAB A;  4LF5 B;  3RTX A;  4LFA B;  4EQ5 A;  4KHP B; 
#chains in the Genus database with same CATH topology
 2JGD B;  4IHJ F;  4PI2 A;  2W6N A;  4A3I G;  4G2K A;  4YY3 O;  4O3R A;  1GO3 E;  1XDC A;  5D1P A;  1IBL O;  3ETG A;  1S5L Z;  4LSX A;  3GTG A;  4FS1 A;  3N2G A;  1UJW B;  4I5S A;  2XCA A;  1AB3 A;  5KG0 A;  3H1K H;  1M4U A;  3M9O B;  4F50 A;  4ECR A;  2Y4U A;  3CEI A;  3ZHS A;  1W96 A;  4B3M B;  1Q6H A;  2E5L H;  4O7N A;  5EZY F;  4JTC B;  1GM9 A;  2AGQ A;  2CZG A;  2YYA A;  5JQW A;  5GW7 A;  4A93 G;  2UUC H;  3BAC A;  1XNR H;  1YCI A;  4MTX A;  4YR3 A;  4O81 A;  2DWD C;  3AG4 B;  2VQE O;  3WFV A;  1N34 O;  3PW7 A;  1MZF A;  1ZWI C;  3UM7 A;  3TCU A;  3OE7 G;  4IIJ B;  1VQL V;  2AHY A;  2W6Q A;  4JI8 B;  5K2M A;  3MR5 A;  2JJ2 G;  2UXC H;  5B1N A;  4I7Z B;  4O7V A;  1Y1V G;  3O9O A;  2CGO A;  3B8M A;  4R8U B;  1EN5 A;  4BR6 A;  5J2T F;  2HLD G;  3BQ2 A;  2Q5Z A;  2AZ0 A;  4AYB E;  3PFF A;  2XUM A;  4JAU A;  4JI6 H;  3T5H A;  3RYH B;  5I5S A;  4QJF A;  2XTA A;  4RUE A;  1Z2O X;  4Q44 A;  2VQF H;  3CPW U;  4FK5 C;  2ARH A;  3T7A A;  3MWD A;  3N6X A;  4IZO A;  4NKG B;  4EB6 A;  4DV3 B;  3G71 V;  2WLI B;  5TIS Z;  3OAA G;  3PW5 A;  2GPS A;  3ZED A;  4O2A F;  4RQE A;  3CCE V;  3Q8S B;  2COG A;  1S0O A;  1QU7 A;  2R8J A;  1WP7 A;  4MS2 A;  4E6N A;  3AK3 A;  4EB6 B;  1N4C A;  4B3R B;  1AP6 A;  3HKE B;  1VBG A;  3K08 A;  2AW9 A;  1KJJ A;  4A3M G;  1PK8 A;  1IDS A;  3GDE A;  4MV8 A;  4CE5 A;  1VQ9 V;  4ED8 A;  2R7Z G;  4UCT A;  4MVU A;  2YI8 A;  3KHL A;  2XAH A;  5JJE B;  1XNQ B;  3ZHT A;  1BS3 A;  2DPJ A;  2CAZ C;  4B08 A;  4UCU A;  4DV4 H;  2CK3 G;  1V55 B;  2EZP A;  3W7X A;  2C2E A;  2F23 A;  5L3B A;  2AXT Z;  2WYO A;  2VWK A;  4TQS A;  1EFR G;  2Q6A A;  5I5Y A;  5IY5 B;  4P2Z A;  3R66 A;  5LHI A;  1ZX3 A;  2QGN A;  3DTU B;  1K97 A;  4DV0 O;  1OJH A;  3EXA A;  4ZOL F;  2RGR A;  4YY3 H;  4DL5 A;  1BMF G;  4NTX A;  3R9R A;  1K92 A;  3WB0 A;  4CMD A;  3K59 A;  1A0I A;  4I0X A;  3ABK C;  2YRW A;  1PP9 H;  1VQO V;  3DTF A;  3OTF A;  1J5E B;  4JYY A;  2NR5 A;  3ZN0 A;  1G1X B;  5A2Q W;  1N0J A;  1S77 D;  5LA6 A;  1IBM H;  4TT3 G;  3CB2 A;  3VBB A;  1MA1 A;  3AYH B;  4O3P A;  2UVV A;  4DV1 H;  1RYS A;  1Z2N X;  2P06 A;  4O2A B;  5K1X A;  3CME V;  1BGY H;  2ZT9 B;  3N42 B;  5KFC A;  3CVZ A;  1H2K A;  2WAM A;  3FKI G;  2B63 G;  5KFV A;  2R8G A;  3HT5 A;  4TWK A;  3JZF A;  1H2M A;  5D8D A;  1SRY A;  5FLX N;  5JQG B;  1UC9 A;  3F5T A;  4JV5 H;  2ZD9 A;  1F51 A;  1SQV H;  5EWF A;  1Z2G A;  5C5J A;  3LDD A;  5CBH A;  3IG0 A;  5KG7 A;  5KFK A;  5IYZ B;  1THZ A;  4HQ6 A;  3HXL A;  3HKB B;  3MAQ A;  5D1O A;  1T94 A;  2Z02 A;  4BWS C;  3HOX G;  2F1M A;  1N33 O;  4KHP H;  5CA3 A;  3T1C A;  1IBK H;  2OCH A;  3M4I A;  4X65 O;  4WCE V;  3N41 B;  1TAE A;  4HYO A;  3RYF A;  2C35 B;  3TQ1 A;  2W6M A;  4C5A A;  4FGR A;  4DV2 O;  4I50 F;  3A0H Z;  1KT8 A;  4PI0 A;  3TII A;  4O3O A;  5EZY B;  5JJN B;  1BHB A;  4UB8 Z;  4FM9 A;  3AG2 B;  3HKC A;  4YJ3 B;  3WG7 B;  3VQV A;  4DR4 B;  2PGG A;  3K9S A;  1L0L H;  3UCS C;  1AI5 A;  4TVI A;  2W70 A;  5K1P A;  4O7S A;  2Q7G A;  5LA6 B;  2DYS B;  2FKX A;  2LO1 A;  3K5O A;  4GZR B;  4XDL A;  5IYC O;  3HB9 A;  3ORQ A;  3T54 A;  3F7V C;  3MWM A;  2HEP A;  3HB3 B;  4MA0 A;  4Q8F A;  1EBO A;  1GO3 F;  4IT5 A;  4RNM A;  2FE3 A;  4JZG A;  5IT9 W;  2W7P A;  2JJ1 G;  2WLJ A;  3BEH A;  3QTC A;  1OBD A;  3D3I A;  5CBG A;  2Q7H A;  3ABT A;  2C00 A;  2YS8 A;  1AR1 B;  4F4W A;  1P4R A;  1N8R W;  1Q82 W;  1IX9 A;  2IW5 A;  3CE2 A;  1KUQ A;  3CC2 V;  2YU9 A;  5DG7 A;  1EKF A;  2XGQ A;  5KFR A;  1EZJ A;  4YXW G;  4KHP O;  1N33 H;  3L72 H;  3IC7 A;  4MTD A;  4ZHQ A;  4FVM A;  1JLL B;  3U0G A;  3KCY A;  1B6R A;  4KFM A;  4CH4 A;  1GSH A;  2EJ0 A;  4TQD A;  1Q86 W;  4YP3 A;  1UNN C;  1SF9 A;  4GKK H;  3KZI Z;  5KFQ A;  2PY5 A;  1K8A W;  4LMY A;  2Q67 A;  2GDS A;  4IR1 A;  3SGI A;  4JI3 O;  3CRR A;  4FFP A;  3CJH B;  4JTD B;  3DGE A;  2JK5 C;  1RPO A;  2HVJ C;  3FAV B;  3T4Z A;  4B3S O;  3HKZ A;  3RB6 A;  2V9W A;  3MHH C;  1QR9 A;  3CCS V;  4J9S A;  4FFR A;  3S3X A;  5IYZ A;  4FU0 A;  3HKD B;  3AG1 C;  4CC5 A;  3GLK A;  2RN9 A;  4FLT A;  4DV1 O;  3BFR A;  2L35 A;  3FYE B;  1RPR A;  4MVO A;  5DQI A;  1R3L C;  5KFS A;  4EFB A;  2QWN B;  4DR1 B;  4FMT A;  2GBO A;  2QKA A;  3IN5 A;  4PA7 A;  3N6R A;  1AP5 A;  2FPI B;  4F4L A;  5KFA A;  3BQ0 A;  3ZHU A;  3IAY A;  4LF5 H;  3KCX A;  2Q7D A;  3VQY A;  3QG5 A;  3GIP A;  2JEU A;  3BJY A;  1HR0 B;  4DV7 B;  1K33 A;  3ABL B;  1BZK A;  4DL2 A;  1Q43 A;  1GN3 A;  2B5U A;  2A3Q A;  3LUL A;  5CA0 F;  3RGX A;  3G67 A;  2KSW A;  3JD0 A;  4WFB V;  4FLY A;  4U7N A;  3ICX A;  1L1F A;  4ICG A;  2UXX A;  4JYA O;  5B1B B;  2WLN A;  2VS0 A;  4LFB O;  4FJC C;  3GV7 B;  2ZCE A;  1YHQ V;  3W7T A;  2UUB B;  1MAB G;  2F4V O;  1FYJ A;  2NU8 B;  3H01 A;  5DED A;  3VNN A;  4XZ3 B;  3OFN G;  2A06 H;  3WWH A;  2AU0 A;  4WFF A;  5I5U A;  5DG9 A;  1QNM A;  2RCV A;  2WA4 A;  1J5E H;  5LMU B;  2QB5 A;  1VQ8 V;  1JJ2 U;  1SES A;  2X0L A;  3ABU A;  2YRX A;  4DV5 B;  4JV0 A;  5KFO A;  3WB2 A;  5CA1 B;  1S5J A;  4CKE A;  3JCZ A;  1BJT A;  1N36 H;  2LFS A;  2ZM6 B;  4MV3 A;  2PVP A;  1FXK B;  5FPR A;  3U11 A;  2CUG A;  1GN4 A;  5B66 Z;  3W1G A;  1KEC A;  3H0G G;  3EVK A;  1IBK O;  4ZOL A;  5KFZ A;  3AW8 A;  4BY1 G;  1WPX A;  2D3O W;  1EUD B;  2Y0S A;  4IL6 Z;  4M9U A;  1I2K A;  4FZ1 A;  4EQ5 A;  4RAI A;  3RT3 C;  4P9P A;  5FNV B;  4LF8 O;  1HP8 A;  3RGB A;  1EKP A;  2QJ1 A;  4LF4 H;  3T5J A;  4TV8 F;  2HP8 A;  2BE3 A;  3JAS A;  3E2E A;  1K4D C;  1Z5W A;  2ZKO A;  3NXS A;  3DXR A;  4RUA A;  4MVQ A;  1OCZ B;  2EIK C;  3TIG A;  4F4Z A;  4WBN A;  4J9R A;  5H6Q A;  5CE8 A;  1FD9 A;  1GN6 A;  3HOV G;  3L2P A;  2M6Y A;  4I4T A;  4PDL A;  4QIW E;  1EN4 A;  2XAF A;  4CHI A;  1YTF B;  3S3W A;  1R6K A;  4X1K B;  4YR2 A;  4K8Z A;  2E5L O;  5LOV B;  4LFB H;  1M0T A;  5CA1 A;  1M93 A;  1K5S A;  2FLL A;  2FYU H;  2C2R A;  2LW7 A;  1WCM G;  2E2I A;  4D7S A;  5KMG B;  1TVK B;  3JAL B;  3APO A;  2LQT A;  5FR9 A;  5LXT B;  4LP8 A;  4B3T B;  2Y4T A;  2EIM C;  3J7A K;  4GKJ B;  4X20 B;  3ZIA G;  5B3S B;  3A8T A;  2UXD O;  4R50 A;  3OEH G;  3ETJ A;  4DR4 O;  5CMU A;  1Y4M A;  3WB1 A;  2A9H A;  2DYR B;  2HHH O;  5L1K A;  4JI4 O;  3GTQ A;  1HNX B;  5DN6 G;  1GSA A;  5KFT A;  2JGU A;  1WLE A;  4J7J A;  5EBL C;  1EHI A;  4M0J A;  2XAG A;  1TGO A;  1RP3 B;  3HR0 A;  1AUX A;  4W4L A;  4H13 B;  4BW9 A;  3T1Y B;  1C30 A;  4CZZ A;  3VA7 A;  4UCO A;  5IY5 C;  2ASD A;  4I55 B;  2MK3 A;  4CH3 A;  3CMA V;  3EYY A;  2ZIO A;  4NXN O;  5LMN B;  5CM0 A;  3AK2 A;  3AG2 C;  2NU7 B;  3OSP A;  1FJG H;  5BR8 B;  3JD3 A;  3T5K A;  2GTA A;  5BR8 O;  1V4Y A;  4NZN A;  3QFF A;  2YXY A;  1WA8 A;  4IRK A;  3GTL A;  5LL6 b;  3T1Y H;  2QDO A;  2YC0 A;  5H80 A;  2X0S A;  2VQF O;  4O4H A;  3DC6 A;  2B1I A;  2Q68 A;  3KXY T;  4MW8 A;  2R82 A;  1QLN A;  1PL4 A;  2DWC A;  3HOW G;  1RYR A;  3UZB A;  5T14 A;  1S0M A;  1OHH G;  3MJF A;  1FVI A;  3BAB A;  5KT4 A;  3K9A A;  2YZG A;  4JUZ A;  1AVM A;  1KQS U;  4ED3 A;  3E35 A;  4O4J B;  1Q81 W;  1M90 W;  4U6P A;  2JA7 G;  2R85 A;  2UVW A;  2QR4 A;  4MT8 A;  4X1Y B;  3M9N B;  2J6T A;  5LYJ F;  4I50 A;  5IJ9 A;  1JDB B;  2VQE H;  4KP4 A;  1XBL A;  3JD1 A;  3OUU A;  2QM4 A;  2ATL A;  2O03 A;  2UUC O;  5B1A B;  2X5R A;  4ME6 A;  2UUA B;  2FPP B;  3K58 A;  3Q8P B;  4C7U A;  2QTO A;  2EIY A;  2V1D A;  2W9A A;  3C90 A;  1SQG A;  4EBC A;  2R93 A;  4JV2 A;  4O2B B;  1D2D A;  4MSW C;  1TUB A;  4TV8 B;  4RNN A;  4QJF B;  3E86 A;  5I5X A;  5EZY A;  2YIA A;  5CN0 A;  4X65 B;  1B3Q A;  5ITZ B;  2VQE B;  4JV5 B;  2R92 A;  5EIB C;  3SJA C;  2UVU A;  5J9P C;  2R70 A;  1NH2 B;  1NU1 H;  2KSD A;  2NLJ C;  1WA8 B;  3CS5 A;  2LW1 A;  4ED1 A;  4RCN A;  3V4S A;  4LF7 B;  3RYC B;  2ZE5 A;  3UT5 A;  1ULZ A;  1N32 H;  4X65 H;  3ZRW B;  3H1L H;  5BXZ A;  2R7M A;  5J2U A;  4O82 A;  2MCT A;  4PZ6 A;  2YXL A;  1QR8 A;  1DV1 A;  2HGX A;  3G6B A;  2E5L B;  4UCS A;  4IWX A;  1XUQ A;  1K9M W;  2VQD A;  1KBL A;  4DL4 A;  1KJ9 A;  1VQK V;  2RMK B;  2YUA A;  4YR0 A;  1H8H G;  1E4E B;  4QW8 A;  2FK1 A;  3NBY B;  2CQY A;  4DUY B;  2IJK A;  4JAA A;  4X1I A;  1A0G A;  1B06 A;  2CTR A;  4X88 A;  3SJB C;  2VUM G;  3OUF A;  3RB0 A;  3TEK A;  4B3R O;  2DIK A;  4MVR A;  3CC7 V;  4TM5 A;  1DGS A;  2YIB A;  3L74 H;  3B40 A;  2JA6 G;  1QBZ A;  1MSD A;  4QE7 A;  4GKK B;  2YZL A;  4J9Y B;  2V4R A;  5H6R A;  3GII A;  2F93 B;  2PMZ A;  2ADQ B;  4JI7 O;  2P6J A;  5I60 A;  1FXH A;  1V9P A;  4JI0 O;  5EWE A;  2R8I A;  3THO A;  5BYA A;  1U96 A;  3CCV V;  1YJW V;  2LFR A;  4MTG A;  5H2F Z;  4DXW A;  5D5Q A;  2I8C A;  4BAY A;  3K5H A;  2HHF A;  2RJZ A;  1N56 A;  3ZJZ A;  1Q8I A;  1TVK A;  3JAL A;  3T5L A;  1VEW A;  2IH1 C;  3BG5 A;  5KG5 A;  3L9D A;  3VOT A;  3PO2 G;  1EUC B;  1GH6 A;  3RFC A;  3H0G A;  4LFA H;  1QCE A;  2UXD H;  3L71 H;  5HV6 A;  1KTA A;  5CBF A;  3JD4 A;  3ZMU A;  3W7W A;  4MV1 A;  4GX0 A;  1I1K A;  1G8M A;  3AG1 B;  2IA6 A;  4FLW A;  4DV4 O;  2OT5 A;  3CHX A;  4OX9 B;  4RAZ A;  3WWI A;  1AJQ A;  1N0N A;  2WLH A;  2R9A A;  2ITD C;  5E79 Z;  1JFF B;  4JI5 H;  1RK5 A;  2E3C A;  4ZI7 B;  3OUS A;  4CS4 A;  4KUM A;  4IAJ A;  3K3W A;  4DR1 O;  1JX9 A;  3EPI A;  4D6T H;  2VA2 A;  2UXB B;  2MW2 B;  2W6O A;  3KAJ A;  2FML A;  3OR6 C;  5KFF A;  3QF7 A;  4Q45 A;  3RV3 A;  1OCZ C;  2EIK B;  3GWK C;  3G8C A;  3Q8Q B;  1HDJ A;  3ABL C;  1IBL B;  2ZDQ A;  4DV7 O;  1XMO B;  5JCO A;  4LSA A;  1NVP B;  5LMU H;  1KB9 F;  3B4S A;  3CCU V;  2HHF B;  1K1Q A;  4JXU A;  2DOS A;  3NC0 B;  5FD5 A;  1SA0 B;  4IYH A;  4QNH B;  4LF8 H;  5KFB A;  3OD4 A;  1QVG U;  4J7K A;  3FB5 C;  1OCR C;  1YJN V;  3UO2 A;  3OMN B;  1BNC A;  4JYC A;  1N33 B;  3LQS A;  1PNK A;  3L70 H;  5KFX A;  1IXB A;  2UUA H;  1GYF A;  2ZNJ A;  1VQP V;  1RFY A;  5KFW A;  3K06 A;  1OCO B;  3J80 W;  1M57 C;  2YDE A;  1MSW D;  4LCU C;  2JGD A;  4GCZ A;  2K9P A;  5B3S C;  3KRE A;  5I47 A;  4FBT A;  2Q9L A;  1SKV A;  3FX7 A;  5DGI A;  2W0X A;  1AR4 A;  5IWA B;  1FXK C;  2ZXW C;  4EBD A;  5KLV H;  1ZQ7 A;  2B1G A;  3ZMS A;  4B3S H;  3QWU A;  2DE0 X;  2W8K A;  3UZO A;  4FZ0 A;  4OPH A;  3PR4 A;  2ALZ A;  5LP6 A;  4PZ8 A;  4JGS A;  2ZE8 A;  4GT1 A;  1I7N A;  4HNA A;  5JWP A;  3R65 A;  5KFE A;  1JX4 A;  2FPG B;  1A48 A;  5KT2 A;  1QHT A;  3RYC A;  4CS2 A;  1K83 A;  4JI6 B;  5KFH A;  4CH6 A;  4MTO A;  4LF8 B;  4QIW A;  3UKM A;  2QM7 A;  4TV9 B;  1XHZ A;  1JOY A;  2YIB D;  5LXT F;  1HNX H;  3KHR A;  4DR3 B;  1I5Y A;  2JS5 A;  3ASN C;  3JAR B;  4ED0 A;  3I56 V;  1GK9 A;  1DF5 A;  4MVS A;  4O4L B;  4ECQ A;  2XAQ A;  2IMW P;  1GM7 A;  3VMM A;  1F7Y A;  3J80 N;  4B3T H;  5JQG F;  3R5X A;  4MV9 A;  3W7S A;  1B6S A;  4LF4 B;  2Q8V A;  4PDM A;  2Y69 B;  4H33 A;  4Q43 A;  4XDJ A;  5KG6 A;  1ZSP A;  4O7Z A;  4QSH A;  4ETS A;  4DRF A;  5IYB O;  1UPG A;  4JTA B;  4IGG A;  2F4V B;  4U7C A;  2VUG A;  1KP2 A;  3G4S V;  4O7R A;  3CJH A;  4B3M H;  4QWA A;  3HO8 A;  4J9O A;  1I08 A;  4LF7 H;  2YWV A;  4F6E A;  3SJQ C;  4FFB A;  5BZB A;  1OV9 A;  2V5A A;  5EC2 C;  3L4K A;  3J7A U;  2JDI G;  2HGS A;  1FFX B;  4QWB A;  5KFU A;  4GLW A;  5L3E A;  4B3S B;  1B04 A;  3MDS A;  3A0B Z;  5DEC A;  2W9C B;  2WPD G;  3UO3 A;  3MR3 A;  1CE8 A;  1YVW A;  1SYX B;  4NLG A;  4EEY A;  1DIK A;  1Q3E A;  1JPX A;  4YHH H;  5B1A C;  1YIT V;  2P22 C;  2CTW A;  3RIZ A;  2A79 B;  5L9X A;  1VIB A;  4ASU G;  2CNU A;  4MW3 A;  4RB0 A;  3GTP A;  3CEB A;  3PW2 A;  2JEF A;  1K1S A;  1CEZ A;  4PA3 A;  2R6F A;  4IYI A;  4ZIB A;  1IXM A;  2PI5 A;  1Z2P X;  1BL8 A;  2N74 A;  4J9M A;  4PDV A;  5IJ0 A;  5LGN A;  3H9V A;  3GV5 B;  4NXN B;  3F5W C;  5L1I A;  2CW7 A;  4AQY B;  3BVO A;  1KJI A;  2WTF A;  4Y8V B;  1Q90 D;  2Q0O C;  2P67 A;  2LGQ A;  1TWA A;  3HBL A;  2VOB A;  5KT6 A;  3HKC B;  4JI0 B;  4F6R B;  1S0V A;  1GMG A;  2DZD A;  1H2L A;  3K3P A;  4PD4 F;  3C3T A;  2DQ3 A;  5KG4 A;  3JAM N;  3QZ7 A;  4NXM O;  1VQ7 V;  2OCC C;  3ZMV A;  1I50 A;  4EGQ A;  4J9P A;  1EN6 A;  1VMG A;  4BIU A;  3RYF B;  3LWB A;  2UU9 O;  4YHH B;  4C5C A;  2JEX A;  1UFI A;  1VBH A;  1NI8 A;  5I5W A;  1GN2 A;  3ETD A;  1EM1 A;  3E22 A;  3LSQ A;  1VAJ A;  2PN1 A;  3N2K B;  3R5H A;  2AGA A;  2CTP A;  3G8D A;  4A3B G;  3D8C A;  4BW5 A;  2R93 G;  4FLU A;  3RF2 A;  4IWY A;  5ITZ A;  5F9N A;  3B8N A;  1H2S B;  3U55 A;  4TUY A;  4U3J A;  2HIX A;  2XOK G;  4F4Y A;  3ZS8 C;  4TV8 A;  2KG7 A;  1R3I C;  1N32 B;  3RN4 A;  2OH2 A;  3T1H B;  4DRX B;  4LF6 H;  3AG4 C;  3ORR A;  2H8P C;  1FKA O;  4DR2 H;  4PA4 A;  3N2G B;  4J9Z B;  3RUP A;  4A3D G;  4DW0 A;  5A2Q N;  2VWJ A;  4BWA A;  2Q4P A;  1I5X A;  4RWU A;  1PNL A;  5IJ9 B;  3GIM A;  3L4J A;  3DF7 A;  3I4N G;  3D36 A;  3SPJ A;  4DR3 H;  5LMN H;  1Y74 B;  3SYA A;  3TXQ A;  1MMM A;  1FS0 G;  3TET A;  2JEJ A;  1M6V A;  5J2T B;  5CB4 F;  4PDB A;  5KT5 A;  1O9H A;  1I94 O;  2NNU A;  3GIJ A;  3RAX A;  1PNM A;  4LF9 B;  1RM1 B;  1XNQ H;  4NXM B;  3GIL A;  2XAJ A;  1MZB A;  4FFL A;  2ZNI A;  4DYL A;  4A3J G;  4FE2 A;  3RR5 A;  4QWD A;  3K5L A;  4ED2 A;  4FLX A;  1ZLZ A;  3KYH C;  2QWO B;  3BY6 A;  4R6Z A;  2EIL B;  3KAL A;  5IYB G;  2N05 A;  3K5N A;  4JAV A;  3H1J H;  1PX2 A;  5LHG A;  1XMQ H;  1K73 W;  3E8H A;  4DV0 H;  3GTO A;  1AIL A;  4YY3 B;  1E1R G;  1ARO P;  1Y1V A;  2COJ A;  2CKZ B;  3ZHQ A;  2VUM A;  4ECT A;  2ZM6 O;  1GRJ A;  2Z5U A;  4IHJ A;  3T9D A;  1C3O A;  2R84 A;  3PVX A;  2WE6 A;  1NS1 A;  2ZXW B;  4DR6 O;  3WWJ A;  3SYP A;  4YJ2 A;  4C2M A;  3EPG A;  1NTM H;  4DV6 H;  3H3V H;  4DR7 H;  2RDI A;  3P30 A;  1HNZ H;  5B5E Z;  4YIO A;  4Q20 A;  3Q1K A;  3CRM A;  4DR5 O;  1S3J A;  1V55 C;  3TY8 A;  1VQ4 V;  3FFQ A;  1OCO C;  4HNU A;  1SET A;  1YDX A;  3JZI A;  4L8J A;  3RW0 A;  2QWP B;  1WB8 A;  3RJ0 A;  3RYI B;  2NN4 A;  2BR0 A;  4QW9 A;  3ABK B;  3HOZ G;  4E4T A;  4RB1 A;  1SZT A;  5KX5 B;  2DAB A;  2GQR A;  2AGP A;  1S68 A;  1SA0 A;  1TA8 A;  1A32 A;  3QNE A;  2Y69 C;  4JYA B;  1ZL8 B;  1KD1 W;  5L3C A;  3JSL A;  1URF A;  3ZBH A;  4N21 A;  4BBS G;  2XGP A;  2ATK C;  3G6X A;  1N48 A;  5GTH Z;  3GWO A;  1BE3 H;  3GTM A;  1D5N A;  1XHX A;  3W1B A;  1I3Q A;  4J80 A;  5L3G A;  3VPD A;  5KG1 A;  1GGO A;  4L87 A;  2IU0 A;  2VR1 A;  3RTX A;  1PV0 A;  4ZHQ F;  1ZAU A;  4JI8 H;  5IDJ A;  2YCH A;  1JXL A;  2FLN A;  1T3N A;  1XMQ O;  1WN7 A;  2P4V A;  2J6U A;  3GIK A;  1S0N A;  4PJ0 Z;  4ZI7 F;  5LYJ B;  4UUG A;  3T1H H;  4E4E A;  5JCO C;  2ZE6 A;  2UXB H;  3RVY A;  5H5N A;  3NUA A;  1SFO A;  4Z1M G;  2CGN A;  2CNV A;  2E2H A;  1OCR B;  4X62 O;  5FLM G;  3ZHR A;  4LC1 A;  1XNQ O;  2Q73 A;  1VQN V;  4ABM A;  4NZM A;  1VF6 A;  4O4I F;  4FIP C;  1I94 H;  4QPJ A;  3G6Y A;  2IBK A;  3STZ C;  4JI1 O;  4OX9 H;  3K0D A;  2R8K A;  1P16 A;  1KBH A;  2WAQ E;  4JI7 H;  4PV1 B;  1RSO A;  2P7T C;  1M57 B;  3K3V A;  1KC7 A;  4TUY B;  4LNU A;  3BAA A;  5LMN O;  2R9R B;  3L73 H;  2GLT A;  5J2U B;  1OWT A;  2AGO A;  5J2T A;  1YXB A;  3BA9 A;  3GB7 C;  3RVZ A;  5IYD O;  3BA8 A;  2OTJ V;  3A2F A;  4PA6 A;  3LP8 A;  2C2D A;  2W7O A;  4DUY H;  2HVS A;  1V54 C;  3K0G A;  3FKS G;  1ZHS A;  3RFR A;  3RGZ A;  4DUZ H;  2JA5 G;  5H9C A;  1SQB H;  4TSF G;  3JAK A;  4DUZ O;  2YIC A;  4IRC A;  2ILM A;  2C28 A;  2EJ2 A;  1DTO A;  2KB1 A;  5LHH A;  4YJ3 A;  4QGP A;  1IOV A;  4DUY O;  1I2L A;  1XRE A;  2XCP A;  5FNV F;  2ZDH A;  1M9N A;  1A9X A;  3OSN A;  4Z2W A;  5DGA A;  3I5D A;  1HR0 H;  4ZQI A;  2NVY A;  4DR6 B;  1R9T A;  4AIL C;  4LF6 B;  1VQM V;  1US6 A;  5I5T A;  2RNB A;  2XT9 A;  1K7D A;  2HIV A;  1CP9 A;  4PBC A;  4LFC H;  3HKB A;  3E8G A;  2FK3 A;  1SQQ H;  4I9Q A;  2HJD A;  1ZL8 A;  3VQW A;  4X62 H;  3SPH A;  4O4L F;  1CPY A;  2DWE C;  2BOB C;  3IC9 A;  1H8E G;  3NGD A;  1E4G T;  2JA6 A;  2COI A;  2FTK A;  5LOV F;  5JH7 A;  2HVK C;  3OTO B;  4WHX A;  2ZDI A;  2I80 A;  1BHA A;  2W9B A;  3CXH F;  4KL1 A;  4LH6 A;  4JI3 B;  2HR3 A;  4MTE A;  5L3D A;  1S97 A;  2WAQ A;  4DLK A;  3ZMZ A;  2XIG A;  3V6K A;  5C8Y B;  1EZ1 A;  1FXV A;  1I94 B;  2W9C A;  1GKF A;  5LA6 F;  4LF9 O;  1E4E A;  4X66 H;  1ZTE A;  2SCU B;  4WD3 A;  2GTS A;  2WDT A;  2FMA A;  4HYK A;  4I50 B;  3V4Z A;  4NB5 A;  3P3P A;  4GC6 A;  3GID A;  3E89 A;  4JI2 H;  3ABM C;  3ZRX A;  1Q7Y W;  3QO7 A;  2PYL A;  4LFC O;  4O3Q A;  1W0K G;  2HGW A;  2H94 A;  2B9Z A;  2X7R B;  2WB1 A;  1ORQ C;  4MA5 A;  1MNG A;  1XMO O;  1WP8 A;  5KFL A;  2UXC B;  3DTG A;  3FB8 C;  1YSC A;  1VS0 A;  3JZ6 A;  5D1O B;  4JV1 A;  3WO1 A;  5I5V A;  3GTJ A;  1I0H A;  1SQF A;  3MR6 A;  2BQU A;  2OIE A;  1LR1 A;  1SCU B;  5KX5 F;  1PPJ H;  4O4L A;  4C5B A;  4X64 H;  3T9A A;  4DR5 H;  1Q5O A;  2C2A A;  2Y0S E;  3I12 A;  2N04 A;  3PN1 A;  4HR7 A;  3Q8R B;  3ETH A;  1H2N A;  4J9K A;  1SEI A;  5DGB A;  3CCR V;  4I55 F;  3AX6 A;  2GHY A;  2CTQ A;  2DN9 A;  2EIL C;  2W6I G;  1ZUQ A;  3OTO O;  4DR6 H;  1L2Z A;  4HN2 A;  1RJR A;  4EGJ A;  1P49 A;  4YB8 B;  1AJN A;  3CWB H;  4B3T O;  4JI4 H;  3RBD A;  1S72 V;  2PF4 E;  2W71 A;  2R8H A;  4DV5 O;  1W59 A;  3SJC C;  1GLV A;  4BXX G;  2WB1 E;  3HOU G;  2EJR A;  2LJ2 A;  3QO8 A;  5KHI A;  2V59 A;  4GLX A;  2LGW A;  2F95 B;  1Y66 A;  4O4J A;  2QF7 A;  4O7W A;  4I4T B;  2AZ2 A;  3H20 A;  3LNN A;  1B6Q A;  1NTK H;  3G6E V;  3RBZ A;  1MZE A;  4DV1 B;  2F66 C;  2UUB H;  2Q7E A;  2ASJ A;  4IHJ B;  1OCC B;  5LXT A;  1CS0 A;  2GUZ A;  3W5O A;  4DW1 A;  1KU9 A;  2JA8 G;  1GAX A;  5KMG A;  5DLG A;  2ETN A;  2J9G A;  1SQX H;  3R23 A;  2YXH A;  4O83 A;  2FJZ A;  4U7O A;  2M05 A;  4O4H F;  3X2Q C;  4GUN A;  4EYH B;  5JVL A;  4IIJ A;  5F9L A;  1K3E A;  3E83 A;  5EC1 C;  4E2L A;  1IOW A;  1PL0 A;  2WA3 A;  4NYE A;  5KA5 A;  4P9O A;  4H44 B;  3FMA A;  1O75 A;  1IYE A;  2GQS A;  1JMK C;  4NVP A;  5F2V O;  4JI7 B;  3ZRV A;  1F4M A;  1KJ8 A;  4LF4 O;  4OGQ B;  2P90 A;  1RSO B;  2UUA O;  2PBZ A;  4KHP B;  1RM1 C;  1YF2 A;  4TV9 A;  2A0L A;  4YJ3 F;  1AI6 A;  4O2A A;  3B09 A;  4O7Y A;  5C8Y A;  2HVQ A;  4TOI A;  5C1P A;  1VAR A;  1XIL A;  3FB7 C;  2WLI A;  2CH7 A;  1S10 A;  4NTY A;  1H38 A;  2NVX A;  1HNW B;  1CKO A;  4A5U B;  1MOF A;  3K04 A;  1P84 F;  4RUC A;  4K6N A;  2EIM B;  4ZI7 A;  5LMU O;  1B33 N;  4QWE A;  3H1I H;  2G38 A;  1N36 O;  4DV7 H;  4A3K G;  2W8L A;  5HNE A;  4MVM A;  3JSN A;  3LNM B;  1PM9 A;  3BRC A;  3GV8 B;  1RJP A;  1JIH A;  4MTF A;  5L1L A;  5C1O A;  2JIZ G;  3B77 A;  2XND G;  4O7L A;  2KQX A;  5LL6 Y;  4DR1 H;  3WO0 A;  2C22 A;  3T4D A;  3TY5 A;  5KFY A;  1HNZ B;  1OZ0 A;  4DV3 O;  4X66 B;  1VF7 A;  4O4I B;  4MV7 A;  4X66 O;  4JYA H;  2OYQ A;  2RQ6 A;  4DL3 A;  4RO2 A;  3SNO A;  2UVR A;  2EIN C;  1NTZ H;  1G6U A;  4K8X A;  1JFF A;  4ED6 A;  2R87 A;  5FL7 G;  1W0J G;  3LDC A;  4UV8 A;  1CKN B;  1JCH A;  3M99 B;  5C44 G;  1WPB A;  3DSQ A;  5C93 A;  4JZ2 A;  2BOC C;  2W6J G;  3U10 A;  4YAJ B;  3CYO A;  1LUW A;  5HBR B;  3VPC A;  3T9B A;  2XHB A;  1Y74 A;  1DK1 A;  2V58 A;  1V54 B;  1AUV A;  2HVR A;  3AK1 A;  2A1H A;  5CA0 A;  5C8Y F;  4I4T F;  2QM8 A;  3ZRS A;  1GSO A;  2YZN A;  2DQ0 A;  3U0Z A;  2UUB O;  3RB3 A;  5KHG A;  4WFE A;  3U9T A;  4JI0 H;  4L1K A;  1UC8 A;  5JUM A;  5DAA A;  3CCJ V;  3OR7 C;  2RF4 A;  4YHH O;  1BSM A;  2KG7 B;  5KUM A;  1YTF D;  2EJ7 A;  2EJ3 A;  2GPW A;  4FM0 A;  5EYP B;  5KFM A;  4X9Q A;  4M7E A;  2Q0A A;  2WLK A;  1JQ0 A;  5KFJ A;  3T2M A;  5IYZ F;  2R72 A;  1TWF A;  3CCM V;  1XEQ A;  4A3E G;  1R3J C;  3HKD A;  4DR2 O;  1FKA H;  2YSU B;  3P32 A;  4DR2 B;  4LWS B;  3OM3 B;  5CR5 A;  2FK2 A;  1NQT A;  1IUR A;  3W7U A;  1M5I A;  1WR2 A;  2PI4 A;  3MHS C;  3LUT B;  3VQX A;  5FLX W;  4DL6 A;  4FS2 A;  1P7G A;  4YAK B;  2YEV A;  3JRW A;  4G27 B;  4GX1 A;  5KG2 A;  2CW8 A;  3A0R A;  1TWG A;  3TJT A;  2JEI A;  4YJ2 B;  3T99 A;  5JVD F;  1TUB B;  3RAQ A;  4BBR G;  1KUT A;  1CKN A;  1VP7 A;  4UXN A;  1E79 G;  3H1H H;  3SYO A;  2WLM A;  3R5F A;  2ODM A;  2OIG A;  3DC5 A;  2GV9 A;  2FKL A;  1WSC A;  5LP6 F;  3JAS B;  1WNS A;  1Y1W A;  1BT8 A;  3CP1 A;  4GX2 A;  5CA0 B;  2L6L A;  5IYD G;  5KFG A;  4HZ3 A;  4J11 A;  5IP9 G;  3WNZ A;  1T5E A;  2ZR3 A;  2EBO A;  3GQC A;  1IYD A;  2ASL A;  5KG3 A;  3ABM B;  5JH7 B;  4DAA A;  4G28 B;  4UVA A;  5FPO A;  4IIJ F;  5KX5 A;  4OXS A;  1PKX A;  1FXK A;  3S24 A;  2FLP A;  4O2B A;  4ECU A;  2W6Z A;  1YZB A;  2Z3Y A;  4A3L G;  5DG8 A;  1FPO A;  4O4H B;  2UXD B;  4ECY A;  3O65 A;  4GKJ O;  3B2E E;  1K34 A;  3N2K A;  3E8F A;  1FJG B;  2QKS A;  3DAA A;  4HNV A;  1GM8 A;  2PZS A;  4A3G G;  4Q0Y A;  2IM9 A;  1DF4 A;  2P0A A;  2BCC H;  2ZDI C;  3AG3 B;  4R8C A;  1P8L A;  2H3O A;  3CRC A;  4DRX A;  2IJI A;  1QQC A;  1IBM B;  1R1B A;  2R7N A;  1R6T A;  2JA5 A;  4DQN A;  4TQF A;  1AJP A;  4O86 A;  5BWV A;  5KT7 A;  1OCC C;  1KMI Z;  1QVF U;  1ZHQ A;  4DK1 A;  2OTL V;  5BWW A;  4IR9 A;  5KHH A;  2HFE C;  3N40 P;  3KHG A;  2ZIN A;  3X2Q B;  4JV5 O;  3HKZ E;  4IRD A;  1H2G A;  2EIJ C;  2QWR B;  1HR0 O;  3MWE A;  5KHK A;  4Q4C A;  5K3W A;  4O3N A;  3BPZ A;  4DK0 A;  4UUJ C;  4QIW F;  4RZQ A;  1FAF A;  3JRX A;  3ASO B;  5EDW A;  3RB4 A;  1WAZ A;  4JF3 A;  3C3S A;  2JVD A;  4I0X B;  4J0M A;  4LFB B;  5IE9 A;  3E5N A;  3ZN1 A;  3AG7 A;  5EWG A;  4LH7 A;  3TQT A;  3LDE A;  1Y1W G;  1Q6U A;  5J2U F;  3N27 A;  2VPS A;  1ROP A;  2FP4 B;  5GTI Z;  1HNW O;  4F6R A;  5KS8 A;  3CCQ V;  5EOY A;  3V6H A;  1E1Q G;  3EFF K;  4FFM A;  3L75 H;  2Q2T A;  2WLL B;  4X1I B;  4GX5 A;  1EZV H;  2HG8 A;  3CCL V;  3P3N A;  5BMV F;  2W0F C;  4UVB A;  4ECS A;  5IJ0 B;  2O57 A;  2QWQ B;  3CD6 V;  2PUS A;  1VQ5 V;  5BMV A;  4U3J B;  2Y0P A;  3KHH A;  1V51 A;  4JI5 B;  2PTM A;  4O4J F;  1JKJ B;  4W4K A;  4PWQ A;  4PHZ A;  2YEV B;  2WWW A;  4ECZ A;  4DR5 B;  4K35 A;  1EKV A;  1XOU A;  1KKC A;  2WLL A;  3MR2 A;  1KP3 A;  1NH2 D;  1LNQ A;  2EUL A;  5BPH A;  4Q4D A;  4A2B A;  4O84 A;  2EIN B;  4EEQ A;  3D36 C;  1N34 B;  1BQ0 A;  2VPQ A;  4FFN A;  2Q2U A;  4FLZ A;  4P30 A;  4DV2 B;  3H4D A;  2HJW A;  3E22 B;  1A3G A;  1S9F A;  5HFL A;  1JDE A;  3IFX A;  4DV5 H;  3D3Q A;  4JI8 O;  2IH3 C;  4B3R H;  4MAM A;  4CH5 A;  2E76 B;  3CSW A;  5KAF Z;  1S76 D;  4EKW A;  4PA9 A;  3F7Y C;  4X20 A;  2R7K A;  1YIJ V;  4FFB B;  5IYC G;  1HNW H;  5BWX A;  4U3F H;  3PW0 A;  2VQF B;  3RV4 A;  2E75 B;  3SYQ A;  5BPF A;  1IVS A;  1QLE C;  2NUA B;  2W57 A;  4J9N A;  2ZE7 A;  4CS3 A;  5KUK A;  4XYM B;  4DUZ B;  1HWY A;  5FNV A;  2NU6 B;  4N23 A;  4LFC B;  1WH2 A;  3ASN B;  2QEX V;  3T9F A;  2F43 G;  4TQR A;  3NR7 A;  3QZ8 A;  3APQ A;  4KXR A;  5CB4 A;  2QYZ A;  4UV9 A;  4YQW A;  5BWR A;  2EZO A;  3T9E A;  3MFI A;  1DV2 A;  2DYR C;  1U97 A;  1DAA A;  1N34 H;  2BTO A;  4PDR A;  4J9Q A;  1M56 B;  4X89 A;  3PR5 B;  2IJJ A;  1XNR O;  3ML0 A;  3M7M X;  2YS6 A;  4JI2 O;  4O4I A;  5L1J A;  3OHB A;  2CFM A;  5LOV A;  4HBN A;  5HFM A;  5LGU A;  4DV6 O;  1F23 A;  4DR7 O;  3SPG A;  4DV6 B;  4DR7 B;  4JI1 B;  4JPR A;  4RB3 C;  5EBW C;  4O7T A;  2ZR2 A;  1S5H C;  3CX5 F;  4DIM A;  2Z0A A;  4QPK A;  4TUY F;  2ZM6 H;  3C0F B;  3KG2 A;  1WB7 A;  2ABJ A;  1TWH A;  1FFX A;  3M9M B;  2DMX A;  4Z1V A;  1IBL H;  4GKJ H;  5EK0 A;  4DV0 B;  3EHB B;  4LFA O;  2VA3 A;  4LFA B;  3NBZ B;  4DV4 B;  4WBN F;  1NT2 B;  3FKI A;  1KEE A;  2B63 A;  3OEE G;  2ZDG A;  3SYC A;  2CDY A;  1Y76 B;  3SR2 C;  3OGI B;  4PEL A;  2UXN A;  5IT9 N;  3SI8 A;  5LP6 B;  4A2A A;  3Q4H B;  4EBE A;  4FM1 A;  2Q69 A;  4UCV A;  1AI4 A;  1I7F A;  1TWC A;  3H4B A;  2J6S A;  1XDN A;  3MD0 A;  4XX0 B;  1AR5 A;  1ZET A;  4ZHQ B;  5JVD B;  4RUF A;  3K5M A;  4DR3 O;  2QE7 G;  1KJQ A;  3LML A;  3J81 W;  2AHZ A;  1KYO F;  2HJF C;  4CMF A;  4LNU B;  1K5Q A;  4FFK A;  3CXC U;  1XL6 A;  2P4K A;  2Y0I A;  3FD9 A;  1FJG O;  2FB9 A;  3JCU Z;  4JI3 H;  4ZBM A;  1S03 G;  2OWO A;  4NXN H;  5KAI Z;  5KFN A;  2A7W A;  4LF6 O;  4LWS A;  5BWT A;  5GON F;  1CXZ B;  1JJO A;  4ECV A;  4A3F G;  4APM A;  2R92 G;  4RB2 C;  2AQ4 A;  5KFP A;  1YEW A;  4B3M O;  1Y67 A;  2CNQ A;  2GSM B;  5GON A;  3GB8 B;  3U9S A;  2DPI A;  4NR1 A;  3OMA B;  4WFH A;  1O9G A;  2OCC B;  4K3A A;  1OBG A;  3K5I A;  4AYB A;  4ECW A;  4CBC A;  4TV9 F;  5EBM C;  1Q6I A;  1JR9 A;  4X8A A;  3ZHV A;  2ODT X;  2EIJ B;  2HHH H;  4O3S A;  2HG5 C;  2X6C A;  3RWR D;  4D7T A;  5FJ8 G;  4DR4 H;  1Y76 A;  3BCC H;  2RDC A;  4RAY A;  2IU3 A;  4H0L B;  2Z04 A;  2Y48 A;  2XD4 A;  3FAV A;  3UYY A;  2CH7 B;  3I4M G;  2RDJ A;  1KKD A;  2UU9 H;  3KAK A;  3AG3 C;  1HNX O;  4X1Y A;  4OX9 O;  2XC9 A;  4JI1 H;  4K0K H;  1CQJ B;  1NR1 A;  1VKZ A;  1RK6 A;  4NXM H;  1K4C C;  1ENV A;  3RYH A;  1I1L A;  4B7K A;  4XYL B;  4ZOL B;  1JVM A;  1SC5 B;  4J42 A;  1NVP D;  2UXB O;  4R7C A;  3FDS A;  4ECX A;  5BY1 A;  1G2W A;  5DIS C;  2BSK A;  1TUE B;  3T1H O;  1SS3 A;  3VPB A;  2QSA A;  4DL7 A;  1NBM G;  1X59 A;  1L8D A;  2E74 B;  3K79 A;  1L0N H;  5KA6 A;  2PYJ A;  1XK5 A;  1Z5V A;  3TIN A;  2V7Q G;  4EG0 A;  3ASO C;  1DLB A;  2RGV A;  3OUZ A;  4AQY O;  3K57 A;  4HNA B;  2QA4 V;  2KKW A;  3ETE A;  4I7H A;  4PZ7 A;  4MV4 A;  4RQF A;  2GUZ B;  1RJQ A;  4I9W A;  4LF5 B;  4DV3 H;  3I55 V;  3QQM A;  2ADP A;  1R3K C;  3TW7 A;  5LYJ A;  2QK4 A;  3CSX A;  1JA8 A;  3PJS K;  3BHP A;  5BMV B;  4UVC A;  4FFO A;  5A9G A;  2QKC A;  3KKY A;  3Q4H A;  4YJ2 F;  4CKB A;  1BCC H;  3OHA A;  1X4T A;  3ETQ A;  4FM2 A;  3TK1 A;  3UFX B;  1AI7 A;  3UT5 B;  1F4N A;  3GIQ A;  3OT7 A;  4AHC A;  3E8B A;  3JAW B;  2HDK A;  4CKC A;  4G3I A;  5IWA H;  1VF6 C;  1KC8 W;  1BQZ A;  3JD2 A;  3IJ4 A;  1VQ6 V;  2ZQM A;  2BQR A;  4BY7 G;  1J95 A;  3TGU H;  2QTS A;  4RZR A;  2LP7 A;  2FB5 A;  1WRV A;  1NJI W;  4ZKI A;  1J5E O;  1SQP H;  4Q6G A;  4R7R A;  4F4X A;  1SER A;  2OLS A;  3RBE A;  5KT3 A;  4CC6 A;  2UUC B;  3PW4 A;  5CAE B;  2R7Z A;  5IP7 G;  1VF5 B;  3J81 N;  1EYZ A;  1IBM O;  5KHJ A;  4JI5 O;  2P5O A;  1HNZ O;  3ZRW A;  4X62 B;  5KFD A;  3H40 A;  1X9N A;  5L3F A;  5DQH A;  1Y6X A;  2DJV A;  5E1A C;  1NR7 A;  2X6B A;  4J9L A;  3G6V A;  3LSU A;  3GTK A;  1W93 A;  2HKO A;  3UQ8 A;  4J41 A;  5JQG A;  1BGW A;  3QVN A;  1M7J A;  2JRI A;  1XQ8 A;  3JAM W;  5DM6 V;  5CB4 B;  4ED7 A;  4BIO A;  2YI9 A;  3GJX B;  4LF5 O;  2I87 A;  3JAT A;  3HKE A;  5D5P A;  2W6P A;  4WBN B;  4NTW A;  3LSS A;  3QO5 A;  4Q8E A;  2M7W A;  5KKN B;  3MFH A;  3PZP A;  3ZCC A;  4XDK A;  2IJH A;  3TY9 A;  1YJ9 V;  2BTQ B;  3T9C A;  1ET0 A;  3CRA A;  3HOY G;  3OW2 U;  3TXS A;  2YL2 A;  2DAA A;  5BYB A;  1G4Y B;  4YIP A;  1I6U A;  3CQZ A;  5IWA O;  5JH7 F;  1XMQ B;  1M1K W;  2Y4R A;  3G80 A;  3OTO H;  4R8U A;  4AI8 A;  2YW2 A;  3JAR A;  4GKK O;  1SZX A;  1R6N A;  4EFE A;  1IBK B;  4OPA A;  1HW7 A;  1WJZ A;  2BTQ A;  4NYK A;  1XNR B;  2ZGI A;  2DYS C;  4X64 B;  5B1O A;  4RU9 A;  5EIB D;  4X64 O;  5DLF A;  2EX3 A;  4MVZ A;  2JEG A;  3N8D A;  1I7L A;  4YBZ B;  4JI6 O;  2YS7 A;  1T36 A;  4UCR A;  1N32 O;  4QWC A;  1R73 A;  1W2B U;  5FD6 A;  4FLV A;  3SDL A;  1P7B A;  2XCL A;  2JA7 A;  4WFA V;  4AQY H;  1XMO H;  4UFZ A;  2NU9 B;  2UXC O;  4NZO A;  4H37 A;  1NZ6 A;  4BIZ A;  5KFI A;  2IP4 A;  3K03 A;  3BQ1 A;  1NKD A;  4QE9 A;  3DXR B;  3JAK B;  1I1M A;  1XI1 A;  1QLE B;  5C4X G;  2D2C B;  3N43 B;  3AEI A;  4A3C G;  2W9B B;  2F4V H;  1WCM A;  4LR3 A;  5LP6 C;  2K1E A;  2BQ3 A;  1GTO A;  3F8N A;  2YID A;  4LF9 H;  4J10 A;  2UU9 B;  3CC4 V;  4K0K O;  1M0W A;  2PMZ E;  4K0K B;  5LBQ A;  2BSK B;  2V4Q A;  4JYB A;  4J7Z A;  3SPC A;  5DGH A;  1N36 B;  4O2B F;  4GC7 A;  3STL C;  4I55 A;  1LUV A;  4HNT A;  3CRQ A;  1COW G;  5C3E G;  4JAS A;  2V4D A;  2R7L A;  5E25 A;  3WG7 C;  4JI4 B;  1CQI B;  4WF9 V;  5LGT A;  4DO2 A;  2HHH B;  4DV2 H;  3JAW A;  1M56 C;  2DLN A;  1E4F T;  4GYC B;  1MG1 A;  2DW4 A;  5DQG A;  4JI2 B;  4UB6 Z;  3SPI A;  1YI2 V;  3Q2O A;  4FBU A;  3FB6 C;  5JVD A;  3JAT B;  5DMX A;  3OMI B;  3T1Y O;  2ZJT A;  3GVM A;  3JYC A;  3WU2 Z;  3TW6 A;  2X6A A;  5BR8 H;  4XBF A;  3PO3 G;  2IBZ H;  3VOU A;  3M8A A;  1BXR A;  4B7E A;  4RNO A;  2R9I A;  5AG2 A;  5GON B;  2CE4 A;  2R86 A;  1IZ3 A;  4LF7 O;  3OGC C;  2ITC C;  1AN7 A;  3KTM A;  2FL4 A;  5BWU A;  5CA1 F;  2JS3 A;  3HPL C;  3N44 B;  4FPP A;  3ZX6 A;  5B1B C;  3FYI B;  1CKM A;  4X1K A;  4EYI B;  4WFG A;  2YZM A;  3SE7 A;  2VRZ A;  5JJJ B;  4HAM A;  3V6J A;  1D5A A;  3ZMT A;  1PD3 A;  1FFT B;  3IGA C;  3RYI A;  3U54 A;  2WSS G;  2ZIM A;  5EYP A;  1XL4 A;  4LBE C;  4MV6 A;  1Y14 B;  2XAS A; 
#chains in the Genus database with same CATH homology
 4PI2 A;  1ZAU A;  2Q2T A;  4O4J B;  4JI8 H;  2YCH A;  4X1I B;  5D1P A;  4X1Y B;  4LSX A;  1WN7 A;  4I50 A;  5IJ9 A;  5IJ0 B;  2VQE H;  5LYJ B;  3N2G A;  3T1H H;  2PUS A;  2QM4 A;  1M4U A;  5JCO C;  2O03 A;  2UXB H;  5BMV A;  4U3J B;  4B3M B;  2UUA B;  3K58 A;  4JI5 B;  2E5L H;  2PTM A;  1SQG A;  4PHZ A;  4O2B B;  4DR5 B;  4TV8 B;  1TUB A;  1I94 H;  2UUC H;  5EZY A;  1XNR H;  2YIA A;  4OX9 H;  4X65 B;  4A2B A;  5ITZ B;  1P16 A;  2VQE B;  4EEQ A;  4JV5 B;  4JI7 H;  1N34 B;  1RSO A;  2Q2U A;  4FLZ A;  3K3V A;  4TUY B;  4LNU A;  4DV2 B;  3BAA A;  4IIJ B;  5EIB C;  3SJA C;  3E22 B;  4JI8 B;  4DV5 H;  2R70 A;  2UXC H;  5J2U B;  4B3R H;  4CH5 A;  5J2T A;  3BA9 A;  3BA8 A;  3A2F A;  4LF7 B;  4X20 A;  4DUY H;  3RYC B;  2HVS A;  4FFB B;  3UT5 A;  1HNW H;  1N32 H;  4X65 H;  1ZHS A;  2VQF B;  5J2U A;  2MCT A;  3RFR A;  4PZ6 A;  4JI6 H;  2W57 A;  2YXL A;  3RGZ A;  4DUZ H;  3RYH B;  2E5L B;  4UCS A;  1Z2O X;  4CS3 A;  2VQF H;  3JAK A;  3N6X A;  4DUZ B;  4EB6 A;  5FNV A;  4DV3 B;  4LFC B;  4YJ3 A;  3ZED A;  1WH2 A;  3NBY B;  4DUY B;  4X1I A;  3SJB C;  4E6N A;  5CB4 A;  4EB6 B;  4B3R B;  1HR0 H;  3HKE B;  1DGS A;  2YIB A;  4GKK B;  4DR6 B;  1N34 H;  2F93 B;  2BTO A;  4AIL C;  4LF6 B;  3GDE A;  4LFC H;  2HIV A;  3HKB A;  4UCT A;  2YI8 A;  3M7M X;  1V9P A;  4O4I A;  3THO A;  4I9Q A;  5JJE B;  3VQW A;  2CFM A;  1XNQ B;  4X62 H;  5LOV A;  4HBN A;  5D5Q A;  4DV6 B;  2CAZ C;  4B08 A;  4UCU A;  4JI1 B;  4DR7 B;  2RJZ A;  4DV4 H;  4RB3 C;  1E4G T;  1Q8I A;  1TVK A;  3JAL A;  2WYO A;  5JH7 A;  2VWK A;  3OTO B;  3C0F B;  2ZM6 H;  4LFA H;  1FFX A;  1IBL H;  4GKJ H;  4KL1 A;  2UXD H;  4LH6 A;  4JI3 B;  4DV0 B;  4MTE A;  2RGR A;  4YY3 H;  4LFA B;  3WB0 A;  3K59 A;  1A0I A;  3NBZ B;  2XIG A;  3OTF A;  5C8Y B;  1NT2 B;  4DV4 B;  4FLW A;  1J5E B;  1I94 B;  4RAZ A;  3CHX A;  4OX9 B;  4X66 H;  2WDT A;  5A2Q W;  2R9A A;  4I50 B;  3SR2 C;  4JI5 H;  1JFF B;  5LA6 A;  5LP6 B;  2E3C A;  4A2A A;  3CB2 A;  4ZI7 B;  1IBM H;  4FM1 A;  4JI2 H;  4CS4 A;  4UCV A;  1I7F A;  4DV1 H;  4IAJ A;  2PYL A;  1XDN A;  1Z2N X;  4O2A B;  5K1X A;  2UXB B;  3KAJ A;  4ZHQ B;  3N42 B;  5JVD B;  3K5M A;  3CVZ A;  3QF7 A;  3LML A;  3J81 W;  4B3S H;  4LNU B;  1IBL B;  4JI3 H;  1XMO B;  2UXC B;  1S03 G;  2OWO A;  1VS0 A;  5JCO A;  4NXN H;  4LSA A;  5D1O B;  5LMU H;  5JQG B;  1JJO A;  4JV5 H;  4APM A;  1SQF A;  3NC0 B;  4RB2 C;  5FD5 A;  1SA0 B;  4LF8 H;  1YEW A;  3IG0 A;  5GON A;  3GB8 B;  4O4L A;  4X64 H;  4DR5 H;  5IYZ B;  3HXL A;  1Q5O A;  3HKB B;  3MAQ A;  5D1O A;  4BWS C;  1O9G A;  2F1M A;  4KHP H;  3PN1 A;  1N33 B;  1IBK H;  3M4I A;  1SEI A;  3N41 B;  1TAE A;  2UUA H;  1GYF A;  2ZNJ A;  3RYF A;  4DR6 H;  3J80 W;  1L2Z A;  4JI4 H;  1P49 A;  2HHH H;  4PI0 A;  3RWR D;  4D7T A;  4DR4 H;  3SJC C;  5EZY B;  5JJN B;  4FM9 A;  4RAY A;  3HKC A;  1SKV A;  4YJ3 B;  5KHI A;  3VQV A;  4GLX A;  5IWA B;  4DR4 B;  2PGG A;  2F95 B;  4O4J A;  4I4T B;  2UU9 H;  3KAK A;  3H20 A;  3LNN A;  4X1Y A;  3QWU A;  4JI1 H;  4K0K H;  5K1P A;  2Q7G A;  5LA6 B;  5LP6 A;  4NXM H;  4PZ8 A;  4DV1 B;  3K5O A;  3RYH A;  2F66 C;  4HNA A;  2UUB H;  2Q7E A;  4ZOL B;  4IHJ B;  5LXT A;  1QHT A;  3RYC A;  4CS2 A;  3W5O A;  3MWM A;  1KU9 A;  2HEP A;  4JI6 B;  5KMG A;  4CH6 A;  4LF8 B;  1HNX H;  1XHZ A;  4TV9 B;  5DIS C;  2YIB D;  4DR3 B;  2FE3 A;  5IT9 W;  2JS5 A;  1L8D A;  3JAR B;  3QTC A;  1XK5 A;  4IIJ A;  2PYJ A;  2Q7H A;  1Z5V A;  4O4L B;  2RGV A;  3FMA A;  1O75 A;  4B3T H;  3K57 A;  4HNA B;  2KKW A;  1JMK C;  4MV9 A;  4NVP A;  4PZ7 A;  4JI7 B;  4LF4 B;  4LF5 B;  4DV3 H;  4KHP B;  4TV9 A;  5LYJ A;  4ETS A;  1N33 H;  3CSX A;  4O2A A;  4DRF A;  3BHP A;  5BMV B;  4MTD A;  4ZHQ A;  5C8Y A;  4FVM A;  2F4V B;  2VUG A;  2HVQ A;  4TOI A;  4CH4 A;  1X4T A;  4B3M H;  3ETQ A;  4LF7 H;  4FM2 A;  4TQD A;  1HNW B;  1CKO A;  4FFB A;  3UT5 B;  4GKK H;  4ZI7 A;  3L4K A;  2PY5 A;  4LMY A;  4AHC A;  3JAW B;  2HGS A;  1FFX B;  3SGI A;  5IWA H;  4I7H A;  4DV7 H;  4B3S B;  1B04 A;  3JSN A;  3BRC A;  1SYX B;  5IYZ A;  3HKD B;  4R7R A;  4Q6G A;  1Q3E A;  4CC5 A;  4YHH H;  4FLT A;  2P22 C;  4CC6 A;  2UUC B;  4DR1 H;  3RIZ A;  4RB0 A;  5KHJ A;  4EFB A;  2P5O A;  3TY5 A;  4DR1 B;  1HNZ B;  4X62 B;  4X66 B;  1VF7 A;  1X9N A;  4O4I B;  4MV7 A;  4JYA H;  2OYQ A;  2RQ6 A;  3IAY A;  1G6U A;  4ZIB A;  4K8X A;  4LF5 H;  1Z2P X;  1JFF A;  3VQY A;  3QG5 A;  5IJ0 A;  3UQ8 A;  1HR0 B;  1CKN B;  5JQG A;  4DV7 B;  4NXN B;  1BGW A;  1WPB A;  3DSQ A;  1Q43 A;  4AQY B;  2CW7 A;  1XQ8 A;  3JAM W;  3U10 A;  5CB4 B;  2XHB A;  3GJX B;  2YI9 A;  2KSW A;  3RGX A;  4FLY A;  2VOB A;  3JAT A;  3HKE A;  2HVR A;  5D5P A;  3HKC B;  3ICX A;  4F6R B;  5CA0 A;  4JI0 B;  4WBN B;  3U0Z A;  2ZCE A;  2UUB B;  5KHG A;  4JI0 H;  3VNN A;  3TY9 A;  3RYF B;  2BTQ B;  4YHH B;  1J5E H;  4FM0 A;  5EYP B;  5LMU B;  4M7E A;  2Q0A A;  3E22 A;  4DV5 B;  3WB2 A;  2R72 A;  5CA1 B;  1S5J A;  1I6U A;  1BJT A;  1N36 H;  3N2K B;  3HKD A;  1XMQ B;  2ZM6 B;  3OTO H;  1FKA H;  5FPR A;  3U11 A;  3JAR A;  4DR2 B;  3W1G A;  4EFE A;  1IBK B;  4ZOL A;  1M5I A;  4FLU A;  1HW7 A;  3RF2 A;  2BTQ A;  5ITZ A;  1XNR B;  3VQX A;  5FLX W;  1H2S B;  4X64 B;  4TUY A;  4U3J A;  5EIB D;  2HIX A;  2EX3 A;  3ZS8 C;  4TV8 A;  4EQ5 A;  1N32 B;  5FNV B;  2CW8 A;  3RGB A;  4UCR A;  2QJ1 A;  4LF4 H;  3T1H B;  4YJ2 B;  4DRX B;  5FD6 A;  4LF6 H;  3JAS A;  1TUB B;  4FLV A;  4DR2 H;  1Z5W A;  1CKN A;  3N2G B;  4AQY H;  2VWJ A;  1XMO H;  4UFZ A;  4BWA A;  4WBN A;  5IJ9 B;  3L4J A;  3DF7 A;  2GV9 A;  4DR3 H;  5LMN H;  3JAS B;  3L2P A;  1WNS A;  4I4T A;  3JAK B;  5J2T B;  5CA0 B;  4PDB A;  1O9H A;  1XI1 A;  4X1K B;  4LF9 B;  3N43 B;  1XNQ H;  2F4V H;  1T5E A;  4LR3 A;  5LP6 C;  4NXM B;  4K8Z A;  1MZB A;  5LOV B;  5JH7 B;  2ZNI A;  4LFB H;  1M0T A;  5CA1 A;  1M93 A;  3RR5 A;  3F8N A;  5FPO A;  4LF9 H;  3K5L A;  4FLX A;  5KX5 A;  4D7S A;  3KYH C;  5KMG B;  2UU9 B;  1TVK B;  3JAL B;  3KAL A;  3S24 A;  1M0W A;  4O2B A;  3K5N A;  5LXT B;  4K0K B;  4B3T B;  1N36 B;  4O4H B;  4GKJ B;  4X20 B;  2UXD B;  3J7A K;  1XMQ H;  4DV0 H;  3B2E E;  4I55 A;  4YY3 B;  3N2K A;  1FJG B;  2V4D A;  2PZS A;  4IHJ A;  3WB1 A;  4JI4 B;  4Q0Y A;  2IM9 A;  2HHH B;  1HNX B;  2WE6 A;  4DV2 H;  3JAW A;  1P8L A;  2JGU A;  1E4F T;  4GYC B;  4DRX A;  4YJ2 A;  4DV6 H;  4DR7 H;  1QQC A;  1IBM B;  1HNZ H;  4JI2 B;  1TGO A;  4TQF A;  5JVD A;  1KMI Z;  3JAT B;  1ZHQ A;  4DK1 A;  2ZJT A;  4BW9 A;  3TY8 A;  3T1Y B;  3FFQ A;  5KHH A;  3N40 P;  4UCO A;  2ZIN A;  4I55 B;  4CH3 A;  5BR8 H;  3EYY A;  2ZIO A;  4L8J A;  5KHK A;  5LMN B;  3BPZ A;  4DK0 A;  4RZQ A;  3RJ0 A;  1FJG H;  5BR8 B;  3RYI B;  5GON B;  4RB1 A;  2JVD A;  5KX5 B;  1S68 A;  1SA0 A;  1TA8 A;  4JYA B;  1AN7 A;  4J0M A;  5LL6 b;  3T1Y H;  4LFB B;  3JSL A;  3N44 B;  1CKM A;  4O4H A;  4X1K A;  4LH7 A;  3KXY T;  5JJJ B;  2VPS A;  1D5A A;  1XHX A;  3W1B A;  4F6R A;  3RYI A;  1FVI A;  2ZIM A;  5EYP A;  3BAB A;  5EOY A;  3RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...