4UCOA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucoA02
4EFBA 4DV6B 1IBMB 4NXMB 1XDNA 5D1PA 1J5EB 1ZAUA 1IBLB 1N34B 3S24A 4UCRA 3W1BA 1TAEA 2HVQA 4LF7B 3TY8A 3BA9A 2E5LB 2UU9B 4DR4B 2UXCB 3TY9A 1VS0A 4DR1B 2CFMA 2VQFB 4JV5B 2HIXA 4LH6A 2HVSA 1P16A 5FPRA 4DR5B 1V9PA 3T1HB 2UUCB 3BA8A 3W5OA 4UCVA 5IWAB 3UQ8A 2UUAB 1XMOB 1XMQB 1IBKB 4X65B 4LH7A 3RR5A 1I94B 4UFZA 4UCOA 3JSLA 4CC6A 2Q2UA 4GLXA 4EFEA 2VQEB 4JI1B 4DR2B 3JSNA 4LF4B 2UUBB 1X9NA 2HVRA 1N36B 3SGIA 4LFAB 4E6NA 4JI8B 4K0KB 4UCSA 4NXNB 4DR6B 3W1GA 4EEQA 1FVIA 4B3TB 1A0IA 4UCTA 3BABA 2VUGA 4PZ8A 4B3SB 4KHPB 2F4VB 4JI3B 4EQ5A 4DV1B 2ZM6B 4OX9B 3NBYB 1DGSA 3NBZB 5LMNB 4GKJB 4JI4B 4DR7B 1N33B 4X66B 2OWOA 5D1OB 4DV0B 1CKNB 4DV4B 3L2PA 1P8LA 1B04A 4DV5B 4LF5B 3VNNA 4DUZB 3TY5A 4LFBB 1XNRB 3BAAA 4B3MB 4JI7B 4LF6B 3OTOB 3RTXA 2HHHB 4LF9B 3T1YB 3PN1A 3GDEA 4DR3B 4X64B 5FPOA 1S68A 4DV3B 1CKOA 1HNXB 4DUYB 2Q2TA 4TOIA 1CKMA 5LMUB 3GJXB 4JI2B 1HNZB 2HIVA 4DV7B 4PZ6A 4GKKB 1XK5A 5BR8B 4AQYB 1N32B 3QWUA 4YY3B 4PZ7A 3KYHC 1TA8A 2UXDB 4UCUA 4X62B 4B3RB 4LFCB 4JI0B 3NC0B 4JI5B 4DV2B 4YHHB 5D1OA 1CKNA 5DISC 4LF8B 3GB8B 4JYAB 4CC5A 1HNWB 4JI6B 1HR0B 1XNQB 4DRFA 2UXBB 1FJGB
chains in the Genus database with same CATH superfamily
1YIJV 2F93B 3U9SA 4ZI7F 1ZAUA 1I7FA 1R3JC 2R7ZA 1S0VA 2QWNB 3G71V 4RB1A 2FKLA 4O7TA 2YEVB 5CB4F 3OMAB 2AHYA 3JARB 1PL0A 4B3TO 4XYMB 4FLZA 1TAEA 5DEDA 3JALB 2UU9B 1XMOH 1Q6HA 3BQ1A 4JV5B 3SJAC 4LH6A 3K3VA 2W9BA 5FPRA 3CD6V 3FAVB 2IJHA 5CBFA 3L4JA 1Y74A 2HG5C 3IFXA 3W7WA 4CKEA 1PNMA 4FZ0A 5EYPA 4IRDA 2V1DA 5KFFA 2Q7DA 2FPIB 2EJ7A 2QJ1A 4O7ZA 2K9PA 3BCCH 4BY1G 4JV5H 4JI1B 2YXYA 2HVRA 4FFKA 3BFRA 2EIJB 1K3EA 2P4VA 3SPCA 1JVMA 4RAZA 1AI6A 3B77A 5IYDG 2HP8A 3UZOA 4JAAA 2X6AA 3JARA 2EJ0A 2PMZA 2R9IA 1SEIA 3V6KA 1VQ9V 1JMKC 2JEXA 2IJIA 1PX2A 2GUZA 2YRXA 3JATB 5C8YB 1L8DA 1RM1B 2RNBA 3T5KA 1NR7A 3UO3A 5BZBA 1PKXA 3FAVA 1E4EB 1KC8W 4JI4B 1Q86W 1AB3A 3WB1A 2ZD9A 3T9CA 2GPSA 3F7YC 2OWOA 2YW2A 1GN4A 4MV7A 4A3KG 2EIJC 1EFRG 5E25A 3ETJA 2Z04A 2NLJC 3RYHA 1YJ9V 3PO3G 4GT1A 1SFOA 2A7WA 2Q73A 2R9RB 1NS1A 2ZJTA 1QR8A 2UXBO 1RK5A 1VP7A 3GWKC 4DR3B 3QO5A 1QLEB 3N8DA 2RF4A 4DK0A 1I7LA 2V4DA 3OAAG 3RB4A 5KG5A 4WFBV 2FLPA 4I7HA 2X7RB 1BMFG 4YR0A 4LFCH 4DR4O 3EPIA 2VQFO 3K3WA 5C8YA 4AQYB 3RVZA 1K9MW 1NH2B 5B1AC 4C5CA 5EWFA 5IP7G 5FLMG 4DR3H 4RZQA 1RYSA 4A3CG 2WLLA 3JASA 1E4EA 3RWRD 2UUAO 3AK1A 1B3QA 3MWEA 2WPDG 5CR5A 1EZ1A 3GIMA 3HOXG 5DG8A 5BMVF 2Q7GA 3GILA 3RVYA 3PW4A 4JF3A 5BWVA 4O7LA 1OCZC 3IGAC 4CC5A 4YR2A 3GTKA 5BMVB 2IU3A 3UT5B 5FL7G 4JI6B 4K3AA 1V55C 1XNQB 1JDBB 2O57A 4AQYH 1WB8A 1JCHA 2C2AA 2C22A 3SJBC 3KHGA 5JH7F 2A06H 2ZR3A 4JV2A 2C2RA 4O4JB 2RN9A 3D3QA 4UCRA 2P67A 2F23A 4B3SO 5DN6G 3NUAA 4DL3A 3WNZA 2WA4A 4RQEA 4DIMA 3NXSA 3ABLB 2GTSA 1P16A 2HR3A 2QB5A 4U7OA 1PM9A 3D8CA 2G38A 2HVJC 3H0GG 3H40A 4ED0A 4R6ZA 2ZIOA 1NKDA 4PA9A 3GV5B 5KFYA 1F4MA 1XMQB 4LH7A 1L0LH 5KFHA 2GPWA 4O2AF 3CRAA 3C3TA 1BQ0A 3KHRA 4LFBO 2JEFA 1H2KA 3UT5A 3WO0A 3GTGA 4DYLA 4EFEA 4RO2A 3SPHA 2X0SA 4QW8A 5LGTA 1VQPV 3L71H 2LW7A 1OHHG 1B6QA 1UPGA 2V7QG 3W1GA 2COIA 4O4JA 5EDWA 3QZ7A 1M9NA 5IJ0A 1Z2NX 2P22C 5KFXA 1EM1A 2JA7G 2WSSG 2F4VB 2CNQA 1N56A 4C7UA 3PW5A 2XTAA 2ZE6A 5BY1A 2ASLA 4TM5A 4CH4A 3TGUH 5HNEA 3BPZA 2UU9O 4X62O 1GKFA 4KXRA 1KKCA 2DQ0A 4JASA 4JI0O 1H2MA 4X1IA 3FB5C 4DV2O 1NR1A 4HR7A 3E8GA 1PP9H 5KG0A 4WFGA 4JYAO 2F4VH 4FM1A 4HN2A 3VA7A 1DV2A 3ETGA 4P30A 2ZR2A 5IT9W 4ECYA 5FPOA 3CC4V 4I50B 5KHKA 4D7TA 4NTXA 3LSSA 5KX5F 3CCJV 1IBLO 4JI1O 4TOIA 5EWEA 2AGOA 1CXZB 5KX5B 3ETHA 2LO1A 4N23A 2QA4V 2VRZA 4QE9A 1EHIA 4NTWA 5BR8B 3H0GA 4UVBA 1M56B 4DR5O 1WCMG 4L1KA 2W9CA 3HO8A 1EN5A 2J6UA 2R8IA 4J9PA 1VF6C 3ICXA 4X20A 4JYBA 4CH6A 1I2KA 1SQBH 1GAXA 2F43G 3VPDA 4FS1A 2PTMA 4MTEA 2WLIA 2B5UA 5D5PA 3JYCA 3WFVA 5BR8H 2HGSA 2W6MA 1BHBA 3ZMZA 4I50A 2EIKB 4FFLA 1F7YA 2ZKOA 2BR0A 2I87A 3T9DA 2IU0A 1KKDA 1WP8A 2OCHA 4M7EA 5CA1F 5BYAA 3W1BA 5F2VO 3MHSC 2NUAB 4CS2A 3GTMA 5B1NA 3J81W 4UV8A 5KAFZ 4DR1B 1H38A 2DYSB 2V9WA 3CB2A 2LQTA 3WO1A 3UFXB 3FKSG 1R1BA 2EILB 3W5OA 1NI8A 3RF2A 3TJTA 3AK3A 4DR7O 3HOWG 2CZGA 1Z2GA 2EIKC 1Q81W 4XDKA 5CA3A 4F4LA 4Q4DA 3SR2C 1JQ0A 1XNRO 3GWOA 3GIIA 3FB8C 3L73H 3VMMA 1COWG 2BTOA 1Y14B 5I5SA 1YF2A 5H9CA 1FAFA 4IIJF 1N36B 4NKGB 2GBOA 4AYBA 2E2HA 2EINC 2F95B 1A0IA 1AR1B 3MDSA 2EIMC 4X1YB 3RN4A 3CJHA 4RB2C 4O3RA 1QVFU 4F4YA 1Y6XA 5KT5A 2QWQB 4A3EG 3ZHUA 3B4SA 2ZE7A 3Q8QB 4YXWG 3T2MA 4XZ3B 1VQLV 1N36H 1IXBA 4R7RA 3TK1A 4U7NA 3AG7A 5HFMA 3HKZA 4DV0B 4DV4B 1I1LA 4PA4A 5B5EZ 3BVOA 1FD9A 1JDEA 5T14A 1YJNV 3M99B 1K73W 1ROPA 4G2KA 3S3WA 4MV9A 2WLHA 3SE7A 1TWAA 2UXNA 2CH7B 2YZGA 4QWCA 4ECXA 4A3FG 2CNVA 2DE0X 2Z0AA 5DECA 4BIOA 2X5RA 4DV0H 4DV4H 4F50A 2HKOA 3IAYA 5B1BB 2W7OA 2XCAA 2XAHA 3Q1KA 4X1YA 4PV1B 1LUVA 1I2LA 1SQXH 3AG3B 4LP8A 4O4LF 1E1RG 1TA8A 3EHBB 2XIGA 2BCCH 2PYLA 1XHXA 3KG2A 5FJ8G 4QWBA 5KFDA 1AILA 2XAQA 2XCLA 4QWAA 3CPWU 4KFMA 3T5HA 4A5UB 3B2EE 2MW2B 2FJZA 4YAJB 2Y0PA 2PMZE 1BSMA 4IR1A 1UFIA 3THOA 4LSXA 1XDNA 2WWWA 3RGBA 3CCEV 4A93G 4H0LB 3AG3C 1VF7A 3K3PA 4DR6O 1GM8A 2L6LA 4KL1A 3G67A 4LF7B 2HVQA 2E5LB 5IYBG 1NVPB 4KHPO 1N4CA 1MZEA 4MT8A 2UXCB 1OBGA 5BWXA 4JI3O 2EJ3A 1KEEA 4J9LA 2E2IA 5H6RA 2KQXA 4TWKA 4MTGA 4RQFA 2V5AA 2DYRB 1V9PA 2XOKG 2DIKA 2PZSA 3EVKA 5IY5B 3AG1B 1IBKB 3OHBA 2LFRA 4X66O 1WA8B 2KSWA 2W9AA 5L3GA 5GTIZ 4BWAA 4LF7H 5CA0F 2E5LH 1F4NA 2IJJA 4WHXA 2W6OA 2UXCH 3TEKA 1GRJA 5JJNB 2JRIA 2R70A 5CA0B 2WLKA 3QO7A 4IRKA 4KP4A 2XAGA 2AHZA 1VQMV 4QJFB 1OV9A 4O7YA 2CGNA 2OTLV 5HFLA 2QTSA 2DYRC 4EEQA 4Y8VB 2VUMG 3ZS8C 5KT2A 2P7TC 3AG1C 3N6XA 1PNLA 2CW8A 4IR9A 4WCEV 1VARA 2PGGA 3BY6A 5JQWA 4UV9A 2JEJA 4BY7G 1O75A 2OIEA 3NBZB 5KHHA 3SPGA 4BW5A 1W96A 4C2MA 4EBCA 3QF7A 1Y1WA 2ZNJA 1T5EA 4I55B 3HKEB 5D1OB 4Z1VA 5LBQA 3TW7A 1K92A 1XOUA 3H9VA 3OEEG 2GQRA 4TV8B 4LF8O 4ED1A 3OR7C 4RU9A 4CZZA 4R50A 5I5WA 2EBOA 3HKDB 1FJGO 4DV6O 4UVCA 1FXKA 1I08A 4RWUA 4TT3G 4QJFA 3RYIB 5JVLA 3R66A 2W0FC 1S5LZ 4DUYB 5EC2C 4O82A 2Q9LA 3R5HA 3T9FA 3DTUB 1EKPA 3OM3B 2E76B 1KU9A 1ZTEA 3M9OB 1OCOC 1EKVA 2J6TA 5BXZA 4DV7B 5FD6A 1RPRA 5A2QN 5J2UB 2JK5C 2JEUA 2WLJA 4O81A 1TUEB 4A2BA 3ABKB 4TV9A 4B3RB 1TVKB 3K06A 1EZVH 2Y48A 1S77D 4I55A 2DN9A 5I5TA 3HKEA 5D1OA 4FFOA 5KG1A 3NR7A 1J5EH 4A3GG 4TV8A 4IRCA 3BEHA 4DV7H 4E4EA 4QW9A 2CAZC 3TXSA 1FPOA 2ZIMA 5KMGB 3HKDA 2DQ3A 1N8RW 3IG0A 5B3SB 1JOYA 3RYIA 4TUYB 3MFHA 1N34B 2LGQA 3B40A 2QWRB 1KJ9A 3F5TA 1M6VA 4CH3A 3TY8A 1GSHA 1VAJA 3STLC 3RUPA 3K9AA 3K03A 4O4IA 4O86A 4BBRG 1N48A 5LHGA 5J2UA 3LP8A 3H1JH 2B1IA 2OLSA 2CTRA 2I80A 3M7MX 5CN0A 2EJ2A 2R7LA 4UB6Z 3PR5B 3LNMB 4MV4A 3T5JA 1R73A 3E86A 3K5NA 1V54C 1DTOA 5EZYF 1N34H 1TVKA 1QU7A 4JTCB 3RR5A 2ZE8A 3PFFA 1OWTA 5EZYB 3RB3A 1ZWIC 1QLNA 4O4HB 5KFZA 4XX0B 1SKVA 4GLXA 4DR2B 3JSNA 5KMGA 3DTGA 3EPGA 4D6TH 4U6PA 2Q68A 3SGIA 5KFLA 3R65A 4DV3O 2H8PC 3D36A 3MD0A 4EGJA 4TUYA 4OX9H 2CTQA 1XQ8A 2Y69C 4IHJF 3RB6A 3HKCB 2IM9A 1GLVA 1SETA 4GUNA 3BQ2A 5JCOC 1RYRA 3HOUG 3AG2B 5H2FZ 1M57C 2P90A 4DR2H 3HB3B 1RJQA 5BPFA 3S3XA 4NLGA 2W0XA 1GMGA 2Q8VA 4K35A 1RFYA 5DG9A 3UO2A 4O4HA 4O3PA 4FFBB 1IOWA 1K4CC 2V4RA 4O84A 4MV3A 5KT4A 1BGWA 1YI2V 4XYLB 1KQSU 5KFWA 5AG2A 4PHZA 4DAAA 4J7ZA 4EBDA 4PDRA 2QYZA 2BQUA 4A3LG 3LWBA 3HKCA 2DPIA 3CHXA 4P9OA 5ITZA 2Z3YA 2VS0A 2FYUH 3RYCA 5IYBO 5C4XG 3CRRA 3DC6A 3GIJA 4QE7A 5KA5A 2UUCO 5KUMA 4F6RA 3BHPA 2QE7G 1N0JA 2GHYA 2ZINA 3ZJZA 5DM6V 5KUKA 1S10A 5F9LA 2BQRA 2UVVA 1URFA 4AYBE 1SERA 1JA8A 2QGNA 2JEIA 4ZKIA 3MWMA 3SDLA 3KHLA 3K0GA 5I5XA 3CCLV 3JAKA 3M9NB 4FFBA 2ALZA 1I3QA 4E4TA 2YU9A 5LOVB 4NXMB 2YXLA 4WFHA 3JRXA 4JTAB 2VQFH 3IC9A 1KUTA 3RFCA 1DK1A 1K83A 2VA2A 4AI8A 2W9BB 4FBTA 5I5UA 4J9SA 3BA9A 3J81N 3HKZE 1JX4A 1KJ8A 4P9PA 4DUYO 1Y74B 1EN4A 2JA5A 2HIXA 4FZ1A 1NTZH 5H6QA 5EYPB 2Q0AA 5KFPA 4DW0A 2CQYA 5LMNO 2E75B 1RK6A 5KFIA 5DQGA 2WAMA 3UQ8A 3U54A 5DQIA 3FDSA 5HBRB 1XMOB 2ZDIA 3AG4B 4PA3A 1M5IA 2W8LA 3RV4A 1Q8IA 1JJOA 1MG1A 1B33N 2D2CB 4UUJC 5DLFA 5LGUA 4DO2A 3CEIA 2R72A 3N44B 3LUTB 3OTOO 2WDTA 4J9QA 1DV1A 1BZKA 5LOVA 4LFAB 2WAQA 5EBLC 2Q7HA 4LC1A 2GUZB 2OT5A 1A48A 4LSAA 1OCRC 2C00A 1IVSA 4FK5C 5LMUO 2MK3A 1HP8A 3BACA 5L3BA 2L35A 2KB1A 1K7DA 1JFFB 1VIBA 1S9FA 2Q7EA 5IYZB 4FLTA 5DGAA 4EB6B 2JDIG 4YY3O 5KAIZ 2QM7A 5J9PC 1QHTA 4GKJB 4LFAH 3X2QB 3RYHB 2CE4A 4FPPA 3PW2A 2RGRA 3GIDA 1WAZA 1K4DC 3L2PA 2XUMA 4FGRA 1B04A 5KHGA 1IXMA 4J9KA 2FPPB 3RB0A 2VWJA 3VPBA 3E5NA 4C5BA 3RTXA 4ED2A 4X64B 2QK4A 1S68A 3ZBHA 4GKJH 1IX9A 3L75H 5C8YF 1VMGA 1E1QG 1GYFA 1AP6A 2RDIA 4WFFA 3X2QC 2WLLB 3JASB 2YI8A 4UVAA 1JFFA 3GV8B 5IYZA 4R8UB 4EB6A 4X64H 1M7JA 3UM7A 4ECZA 3ZN1A 3UYYA 4X89A 1CEZA 4LFCB 3R5XA 4JI5B 2R6FA 4YR3A 4U3FH 1FKAO 3T54A 1NH2D 2FPGB 5J2TB 5L9XA 1IBLH 1PD3A 3LDDA 3Q2OA 4MS2A 1RM1C 4GX0A 3KTMA 3J7AU 5KFVA 2DWDC 4Q0YA 4RNOA 4LR3A 3QO8A 3JD2A 2PBZA 5C5JA 4W4LA 4JI5H 3J7AK 3UZBA 5A2QW 2Q0OC 3PZPA 2AGAA 2XGPA 5CBGA 2FK2A 3E89A 5TISZ 1B6SA 2FL4A 4DL7A 2NU9B 2ATLA 2FTKA 4JUZA 3DC5A 2HG8A 2E3CA 2VQDA 2Q5ZA 1SA0A 5KFSA 4R8UA 1I0HA 5KFNA 1SQGA 1QLEC 4UCVA 1BXRA 4FVMA 1TUBA 2DAAA 3AYHB 4PDBA 3DTFA 3RBEA 4DV5O 1FXVA 4JI8H 4MW8A 2AXTZ 5J2TA 4O4JF 1JKJB 1XL4A 1GM7A 3K59A 1G8MA 3KCXA 2VQEB 1SQQH 1B6RA 4JI7O 2YC0A 3M4IA 5IJ0B 1UC8A 2O03A 1JIHA 4K8ZA 2CNUA 2DW4A 1HNXO 1RJRA 4CH5A 5K2MA 3Q8PB 1Y1VA 4NXMO 1N33H 3AEIA 4DV1B 2VQEH 4X1IB 1N32O 5EC1C 3A0HZ 1DGSA 2BOBC 1AVMA 4JTDB 1OBDA 3CRQA 1CKNB 3PR4A 4AHCA 5JUMA 3JD4A 3RYFB 4YAKB 4G3IA 4YIOA 3VNNA 4HBNA 4A3IG 1XMOO 3FD9A 5KT3A 4P2ZA 4B3MB 1BNCA 4DV1H 3E8FA 3ABLC 1L1FA 3OSNA 4J9RA 1BS3A 2RCVA 4F4XA 3GDEA 3T1YB 3TW6A 3K04A 3CSWA 1S5HC 1GH6A 3JAMN 5H5NA 4RNMA 3FB6C 1BE3H 3ABMB 3K5LA 2DWCA 4Q6GA 2VOBA 2W9CB 1FS0G 4WFEA 2AZ2A 4B3MH 4JV5O 2BE3A 1GK9A 1QR9A 4X20B 3T1YH 2R7KA 1MZFA 4LBEC 3K5IA 5BWWA 2ZQMA 5LXTB 2FMLA 2WLIB 4B7EA 1PL4A 1CKNA 4I50F 1KD1W 3RYFA 3T5LA 3GB8B 3F7VC 4APMA 1M0TA 1UC9A 3SJCC 1K1QA 2HDKA 3DGEA 3ABMC 3CE2A 1IBMB 4FM9A 1SS3A 5JJEB 1VQNV 3PO2G 4FU0A 2HLDG 4R8CA 5L1KA 3GTPA 2QF7A 3KREA 1GN3A 4JPRA 1W2BU 2ZDGA 3C0FB 3F8NA 2A3QA 4J9ZB 1DIKA 3GTJA 1IBMH 4J42A 2W6JG 3A2FA 4JI4O 1KT8A 5DGHA 2A79B 5LXTA 1EYZA 2LW1A 1JX9A 1I94B 4CBCA 3GIPA 2NU6B 2EZPA 1VQ4V 1KC7A 3RGXA 4LFCO 4RAYA 4X88A 3ZHVA 1NU1H 4CMFA 4ME6A 1M56C 3KKYA 4DR3O 5IYDO 5KHJA 1PPJH 2EZOA 3E8HA 4MVOA 1S0MA 4K0KB 3CJHB 4NYEA 2JJ2G 2R8KA 5K3WA 4C5AA 2C2DA 3VPCA 1I94H 3K5MA 1BGYH 1YZBA 2EULA 2VPQA 1AR5A 2WA3A 2X0LA 1VF5B 2ZM6B 3SYQA 1S72V 1AJPA 4AQYO 3DXRB 2HFEC 4LF5H 3T99A 4DUZH 3F5WC 3U9TA 3ABTA 1S97A 4K0KH 3OUSA 5L3CA 1KP2A 1YXBA 2AGQA 3O9OA 4ETSA 1MSDA 4LF9H 1YTFD 3KAKA 1I5XA 3FYEB 1H8HG 2D3OW 4BWSC 4EEYA 1MOFA 4IZOA 4O7NA 5BWRA 1K8AW 3K5HA 4O3NA 1MA1A 4ECQA 4JI6O 2DYSC 1XNQO 2FP4B 1S03G 5CAEB 2ZM6H 4ED3A 3FYIB 2EILC 3HKBB 4PDLA 5JQGA 5C3EG 5KFKA 5GW7A 2Q2TA 3TXQA 1YTFB 1KECA 1UNNC 4EKWA 2WE6A 4IYHA 3O65A 3HOYG 4YHHH 2A1HA 4JGSA 4QSHA 3R9RA 3DXRA 4I0XB 3W7SA 1Y66A 1L0NH 5LHIA 1XMQO 3ZCCA 2RJZA 1KUQA 1FJGH 3JD1A 2YSUB 4G27B 4BR6A 4Z1MG 4J7JA 4Q20A 1Z2PX 3ORRA 2QWPB 1CP9A 3N40P 5LP6B 5EOYA 1HR0B 4ZOLB 2NNUA 4OPHA 3HPLC 4Q8EA 4EFBA 2JA8G 3ASOB 3EXAA 3HKBA 2YZNA 1TWCA 2C2EA 5KG2A 2DPJA 3I56V 3H4DA 3TINA 1V51A 3Q8RB 2EIYA 3MR6A 2ZXWB 2YIBA 3H1HH 3CXHF 4X9QA 5L1LA 2F4VO 1GGOA 1HR0H 2QR4A 2W6QA 4JZ2A 2XC9A 1Y1WG 3JAWA 4FLWA 1XUQA 4PI2A 3STZC 3BA8A 4I0XA 3M9MB 5IWAB 4D7SA 2R7MA 1NVPD 5L1JA 3I4MG 4X65B 5KFUA 2UUBH 3C3SA 2CW7A 4MVZA 5B1BC 3CWBH 4I9WA 3ASOC 3OUZA 2M7WA 4U3JB 3KHHA 5LYJA 5LP6A 3Q4HA 4YBZB 1W59A 2WLMA 4ZOLA 1E4FT 4J9OA 3RBZA 3BG5A 2ABJA 1TWHA 3U0GA 4GX5A 3ZRWA 4MV1A 1OCCB 4DLKA 5LL6b 5IWAH 4YJ2B 2CUGA 4NXNB 4X65H 4F4WA 4PDMA 2VUGA 4J10A 1AUXA 5IYCG 4FLVA 2VPSA 2YUAA 3RFRA 3GV7B 1YCIA 1S5JA 3G6YA 3RIZA 5BR8O 3SPJA 4DK1A 4ECRA 2JA6A 3K5OA 4IAJA 1ZHQA 2BOCC 4GLWA 2W8KA 4O3SA 1T36A 4NXNH 2Q4PA 5E79Z 3N42B 1ZHSA 2COGA 3NGDA 2VWKA 1S76D 1P8LA 1Q3EA 5L3DA 2EX3A 4IYIA 1OCCC 1FXKB 3B8MA 1T94A 4U3JA 4RNNA 3RBDA 1E79G 4FJCC 4LF6B 4JI2H 2HHHB 2EJRA 2KSDA 1M0WA 3QG5A 4FFPA 3LSUA 5IY5C 3K57A 2Y0SA 4GKKH 3CC2V 4YJ2A 1S0OA 3OMNB 1U96A 3WG7B 3GJXB 3OT7A 2DWEC 2UXDH 1HNZB 2GV9A 3CX5F 2YZLA 4TV9B 4I55F 5KFTA 3HOZG 4PZ6A 4DR1O 4FS2A 1XK5A 1WLEA 1VQKV 2ZGIA 4LF6H 3OGIB 2HHHH 2IH3C 4TV8F 1FXKC 4UCUA 2PY5A 5BPHA 4OGQB 2NU8B 3IN5A 2C35B 2P0AA 4J9YB 1HNZH 3BRCA 3P3PA 3APOA 1HNWB 3T9EA 1I7NA 3LULA 2IBZH 3PVXA 4PELA 3OFNG 4YJ3A 5KLVH 1VQ5V 1IYDA 1WRVA 3ORQA 4I4TB 1TGOA 4YB8B 4O4IF 4RB3C 4Q44A 3JAMW 1J5EB 1P49A 1N36O 4ZHQB 5J2UF 3E2EA 5GONB 4O4IB 2CTPA 2LFSA 4CS3A 5L1IA 1XREA 2BSKB 2UUCH 3VQWA 2PI5A 3L9DA 5D8DA 1HNWH 1WN7A 4L8JA 4JYCA 2HVSA 4EBEA 3T1HB 1RSOB 2W57A 2J6SA 4ECWA 1RJPA 3MR3A 4LF4H 3RGZA 4DV0O 4DV4O 4NZNA 1GO3F 1F51A 2IW5A 3LSQA 4TUYF 2V58A 4CC6A 4LNUB 4NB5A 5K1PA 3SNOA 1BQZA 2JIZG 4WBNB 5C44G 3R23A 3T1HH 4I4TA 1KJJA 3CEBA 3ABKC 4E6NA 1EN6A 3N2KA 4ZHQA 5GONA 4PBCA 3MFIA 4B3TB 2BSKA 5FNVB 3TQTA 5KFRA 5KG4A 1ZQ7A 4RUAA 4EYHB 4OX9B 2IA6A 4ABMA 4O4HF 1L2ZA 2PN1A 1RSOA 5B3SC 2WYOA 3D36C 5K1XA 5KG3A 1I50A 4B3TH 4I9QA 4HYOA 4CE5A 4MA5A 4QIWA 4OPAA 2UVUA 4CS4A 2QEXV 1ZUQA 3IJ4A 2ASJA 4LNUA 3E22B 2FK1A 3BAAA 2R84A 5EK0A 3W7UA 2XD4A 2JGDA 4QNHB 2QKSA 4WBNA 2RGVA 2W71A 2DJVA 3QFFA 1CQIB 5KFEA 3C90A 1YSCA 4MTXA 3ZHSA 4A3DG 3N2GB 3GVMA 2QTOA 5ITZB 3RYCB 2FB5A 4N21A 1Z5VA 1O9HA 2ZNIA 2KKWA 3U11A 2JA5G 2HIVA 2PVPA 4LF7O 2E5LO 4ECTA 5FNVA 4HZ3A 4F6RB 2UXCO 4MV8A 4MSWC 3N6RA 1BCCH 3H20A 3QVNA 3TQ1A 3HXLA 4MVUA 3E8BA 2AW9A 5DQHA 3H3VH 5KFAA 4DRXB 4G28B 1VQ6V 5B1OA 3JAKB 1GM9A 1IBKO 4PA6A 3AW8A 5C93A 4M9UA 5KFGA 2LGWA 2W6PA 4ICGA 5IP9G 4NYKA 1Q82W 2UVRA 1H2LA 1SQVH 3AG2C 3E22A 4GC7A 1K34A 2CTWA 2UXBB 1EUDB 3WB2A 2NVXA 3HR0A 2HJWA 3P30A 3I4NG 2RDCA 1DF5A 1GSAA 2PUSA 5BYBA 3LDEA 2DOSA 3N2GA 3OEHG 4H44B 3FB7C 5JWPA 3KCYA 2Q6AA 4O2BB 3PJSK 2QWOB 1Z2OX 1C30A 2ITCC 4BIZA 4DR4B 1WB7A 2CFMA 3CVZA 2YDEA 2JGUA 1YDXA 2VQFB 5JVDB 2UXBH 2M05A 4L87A 3CRCA 5EWGA 2VA3A 1QBZA 4MW3A 1FFXB 2UUAB 3SYOA 2W6ZA 4DRXA 3OD4A 2R86A 5LHHA 5LOVF 2B63A 2I8CA 3CS5A 1AI5A 4MVMA 4DR4H 2AU0A 2GQSA 3APQA 4MVQA 4QPKA 2J9GA 1AJNA 2JVDA 3BJYA 1US6A 1E4GT 4Q45A 2UUAH 3UKMA 2ZDIC 2V59A 1I5YA 4NZMA 4JV1A 1FVIA 4YP3A 3WU2Z 4PJ0Z 4O2BA 4B3SB 3P3NA 1AP5A 5F9NA 3RW0A 1BHAA 4DV7O 5LA6B 1BL8A 4FFMA 2COJA 4TVIA 3MHHC 4LMYA 5JVDA 4K6NA 2JS3A 4ASUG 4B3RO 1FFXA 4JI7H 3L72H 2ASDA 4FE2A 1MZBA 3CC7V 1V4YA 1I1KA 3G4SV 4B3SH 2R9AA 1TWGA 2OH2A 3SI8A 4LFBB 2LP7A 1BJTA 3G6XA 1KMIZ 1Y76B 1THZA 3V6HA 5CMUA 5IJ9A 4BW9A 5IYZF 3WWHA 1W0KG 3G8DA 3AG4C 1N34O 1AJQA 4IWXA 3V4ZA 3FX7A 1GTOA 5C1PA 4LFBH 3FKIA 4ZI7B 2NU7B 4O3QA 5LA6A 3V6JA 4FFNA 1IDSA 3GQCA 3KZIZ 1QQCA 5CB4B 4A3JG 3TCUA 4ZIBA 4O3OA 2VR1A 5KT6A 4X62B 3I12A 5CM0A 4JI0B 4DV2B 4OX9O 3LMLA 3I5DA 1QCEA 2R93A 2W70A 3T9BA 4XBFA 3K79A 2XHBA 4PA7A 4JYAB 2B1GA 1Y67A 4ECSA 1K1SA 2YYAA 4DRFA 4J9NA 2GSMB 2QDOA 4DR2O 2Q69A 1M1KW 1Y76A 1K5QA 3CYOA 2UU9H 4X62H 1Y1VG 3RAQA 4GCZA 4JI0H 1IBLB 4HAMA 1B06A 4DV2H 2ZCEA 3SPIA 3S24A 5HV6A 3ABUA 2R8JA 1SA0B 1R6TA 4JYAH 3CCQV 3VOTA 3TY9A 2QKCA 3MWDA 1TUBB 4ZI7A 2YEVA 3OMIB 2DMXA 1P84F 2ZDQA 4DR5B 5J2TF 1K33A 5CB4A 5LGNA 3ZMSA 3T7AA 3JALA 1R6NA 4H37A 3GIKA 1MNGA 2YIAA 4HNAB 4JI1H 3GTLA 4MAMA 2Y0SE 1SZTA 4UFZA 2W6NA 1D5AA 5EBWC 4UXNA 3ZHTA 2BQ3A 4JAUA 1I6UA 4DR5H 5B1AB 3MR2A 3N27A 5DGIA 5FLXN 3A0RA 4JI8B 3T4ZA 4JV0A 2DABA 2XAJA 1UJWB 2HHFB 3BQ0A 4JI4H 1OCZB 3WWIA 1YHQV 4EQ5A 1V55B 1WNSA 4FM2A 3MR5A 4GX1A 4DQNA 2FLLA 1Q43A 3D3IA 1XBLA 1WP7A 4DR7B 1N33B 2R8HA 1IOVA 3JATA 1AI7A 4HNAA 4FM0A 1WPBA 3U10A 4J0MA 2YI9A 3JZ6A 1XNRB 3VQVA 5FD5A 3G8CA 3Q8SB 4UB8Z 1MABG 4PD4F 5FR9A 1M4UA 3VBBA 1P4RA 4DR7H 4FLYA 1XEQA 2FE3A 2IJKA 3W7TA 5L3EA 4CMDA 2P5OA 5KKNB 2FKXA 1T3NA 1H2SB 5L3FA 2HHFA 4O7VA 2IBKA 5JH7B 3G6EV 1XNRH 1SQFA 3OE7G 1K5SA 2XNDG 1GN6A 4JI6H 3OTFA 1XNQH 2JS5A 4A3MG 1QVGU 1Q7YW 3K0DA 2Y4RA 4O7RA 3ZRXA 2A9HA 1VBHA 5KFBA 3DAAA 4ED6A 2BTQB 1PNKA 4M0JA 1CS0A 4FIPC 2N74A 3H4BA 4O2AB 3GLKA 2UXXA 4LFAO 4GYCB 5BMVA 3E35A 5JJJB 1SCUB 4FLUA 4GX2A 4TQFA 5LXTF 1XMQH 4X1KB 2MCTA 4EYIB 5JH7A 3H01A 2RQ6A 1WR2A 4QIWE 5E1AC 1A9XA 3N41B 1KJIA 2CK3G 5LL6Y 1GO3E 4GKJO 3WB0A 1KTAA 4PI0A 2YZMA 5A9GA 3J80W 5C1OA 4CKCA 1G1XB 1ZLZA 1AR4A 4CHIA 5KA6A 4B08A 2BTQA 3R5FA 3JSLA 1YJWV 2UVWA 1YITV 4PDVA 4RZRA 4J9MA 4H13B 4MTFA 2B9ZA 2HVKC 4X64O 3K9SA 2ETNA 4ECUA 3OSPA 3CCRV 1R3IC 4O2AA 4DL4A 5EIBD 3JCUZ 2PYJA 4DR6B 3CP1A 4UCTA 4PZ8A 4R7CA 3VQXA 1XI1A 4KHPB 3U55A 4IT5A 4JI3B 2QSAA 4X1KA 3HT5A 4NTYA 1F23A 4HYKA 2PI4A 1VKZA 5IE9A 1K97A 2X6CA 2NVYA 4TQRA 3TIIA 1Q6IA 4ZBMA 4K8XA 4JI5O 4X66B 4DR6H 5DMXA 5JQGF 4LF5B 4A2AA 4WD3A 3G6VA 4QGPA 5JQGB 4H33A 2P06A 4DUZB 5KFOA 4KHPH 3OUUA 4JI3H 3H1LH 4YIPA 1LNQA 4YQWA 1ZX3A 4LF9B 3PN1A 2PF4E 4RUEA 1CKOA 4A3BG 2DLNA 4X66H 1QNMA 1VF6A 2YS7A 3ASNB 1DF4A 4WFAV 5EIBC 4JI8O 3K58A 3L70H 4MVSA 1SQPH 2HJDA 3HB9A 4WF9V 2JA7A 5KX5A 1KBLA 2ODTX 3KYHC 3CXCU 4UUGA 3K08A 3SJQC 5CA1B 3JRWA 3ZEDA 1ENVA 2YIBD 2EINB 3SYAA 1GN2A 1RP3B 4YHHB 4RAIA 4Q43A 4X8AA 4BIUA 2EIMB 3VOUA 2ITDC 3SYPA 4LF8B 2IH1C 1ORQC 1N33O 5IDJA 2M6YA 2VQEO 1FJGB 2W6IG 2YS6A 4Z2WA 3ETDA 3ASNC 4DV6B 3QNEA 5D1PA 4DR1H 2C28A 1ZSPA 2XGQA 2OTJV 2OCCB 2HJFC 2LJ2A 3JAWB 2WB1A 4LF8H 1WH2A 2F1MA 3EFFK 2XCPA 4IIJB 5DLGA 2JA6G 4NZOA 3MJFA 1ZETA 4DV1O 1A32A 1AI4A 4DV6H 5LYJF 5LP6F 2R85A 2WAQE 4HNVA 4ZOLF 5CA1A 1HDJA 2ATKC 5LYJB 1FFTB 3Q4HB 1WCMA 4JYYA 1VBGA 2FLNA 3AK2A 4UCOA 2AGPA 3ZRWB 3JZIA 3ETEA 3ZRSA 4E2LA 2OCCC 4LCUC 4B3MO 5KFQA 1M93A 3P32A 2UUBB 1X9NA 3PW0A 3T1YO 1FYJA 1ULZA 1TWFA 3A8TA 3ML0A 1HWYA 2ZT9B 3AX6A 5KFCA 3RT3C 5KT7A 3RAXA 3ZMTA 1ZL8B 5LP6C 5KFJA 4IIJA 3GIQA 4ED8A 3NBYB 5I47A 1LR1A 5I60A 1AROP 4J11A 4QPJA 1CPYA 5B66Z 4J7KA 2ADQB 3LNNA 1O9GA 1Z5WA 2ZXWC 2WLNA 1H2GA 4YJ2F 4O4LB 1XL6A 3L74H 3TY5A 4TSFG 1NQTA 3ZMUA 2X6BA 5FLXW 1OJHA 2RMKB 4OXSA 1NTKH 3DF7A 1NT2B 1IURA 2IMWP 1IBMO 2ZE5A 3EYYA 1FXHA 1D5NA 2YICA 4DW1A 3CCSV 4DV3B 3WWJA 3SYCA 4IWYA 1Q6UA 1RPOA 3OR6C 2V4QA 2FMAA 4HNTA 4JI2B 2SCUB 1A0GA 1SC5B 1PV0A 2CH7A 3CCUV 1JR9A 1ZL8A 4DXWA 2QKAA 4GKKB 3ETQA 3OW2U 2H94A 1NBMG 3QWUA 2YS8A 2QM4A 1EZJA 2UXDB 5KS8A 1HW7A 4DV3H 4GZRB 5H80A 3CMAV 1H8EG 3NC0B 4YJ3F 4EG0A 2FK3A 5DISC 4YJ3B 1I94O 4MA0A 1N0NA 4BAYA 1JPXA 4O4LA 3T1CA 3GTQA 2ADPA 4MV6A 1XDCA 2YL2A 4JAVA 4LF5O 4ECVA 2KG7B 4TV9F 2E74B 4DUZO 5KG7A 3E83A 1SZXA 4U7CA 4K0KO 3CQZA 3OUFA 3QTCA 4JZGA 1EUCB 3FFQA 1LUWA 4LF9O 3JZFA 3KALA 1SF9A 1WPXA 2HGXA 3M8AA 3T4DA 3JD3A 1IBKH 3ZIAG 5EBMC 3CCVV 1VS0A 5DAAA 2ZM6O 4PWQA 1KBHA 2DZDA 2CGOA 2UUCB 4I5SA 1VQOV 3ZMVA 4O7SA 4I4TF 3OHAA 3WG7C 3LQSA 3CRMA 3G80A 4ZHQF 1OCOB 5GONF 3DSQA 4FBUA 2Q2UA 4LWSB 3N2KB 4B7KA 2R92G 3A0BZ 4W4KA 4YHHO 5BWTA 1WA8A 1KYOF 4LF4B 3UCSC 3G6BA 2KG7A 5KHIA 3ZHQA 5CA0A 1Y4MA 4KUMA 2GLTA 3BABA 1BT8A 1Q5OA 4IGGA 1G2WA 4HQ6A 2W7PA 4EGQA 2YWVA 3MAQA 4QIWF 1JXLA 3ZN0A 1PK8A 2ODMA 3H1IH 5LMNB 1AUVA 2P4KA 2AQ4A 4TQSA 4FMTA 4HNUA 2N04A 1EKFA 4J41A 4WBNF 4DL5A 3ZX6A 3KAJA 2JGDB 1P7BA 4O7WA 2YCHA 1P7GA 1SESA 4BBSG 2P6JA 1R3KC 2XASA 4FLXA 4DUYH 2XAFA 2ARHA 4LWSA 1HR0O 2GDSA 4RCNA 5KG6A 3OTOB 2R8GA 5FNVF 4MTDA 1R9TA 5LMNH 5CE8A 5DGBA 1A3GA 4XDJA 3L4KA 1V54B 2UUBO 1CKMA 3KXYT 5LMUB 4Q4CA 2HEPA 4B3RH 2ILMA 5CBHA 1CQJB 2VUMA 3QZ8A 4FFRA 4QWEA 3OTOH 1XHZA 4YY3B 3LDCA 2B63G 3RV3A 5IWAO 4X65O 2Y69B 4RUFA 5LMUH 4DL6A 2R92A 2YXHA 4RUCA 1NJIW 4XDLA 3ZHRA 3U0ZA 1WJZA 3RJ0A 1M57B 1X59A 4YY3H 2AZ0A 1M90W 1ET0A 3N43B 4NXNO 2OIGA 2NR5A 4TQDA 1SRYA 2CDYA 2Z5UA 3JCZA 2IP4A 2YRWA 1D2DA 2ZDHA 4MVRA 4F4ZA 2Y0IA 4BXXG 4DL2A 3HBLA 4JI2O 4CKBA 1NTMH 3QQMA 4IHJB 1SYXB 5I5YA 1XILA 1R3LC 4F6EA 3J80N 1KJQA 2HGWA 1JJ2U 4GKKO 2FB9A 1VQ8V 1S3JA 4JXUA 4ED7A 2RDJA 1OZ0A 2Y4TA 1AN7A 3VQYA 2QM8A 2Y4UA 4NR1A 2OYQA 3GB7C 2UXDO 1MMMA 4RB0A 2N05A 5JCOA 4O2BF 1IZ3A 4LF6O 2R87A 2HHHO 5EZYA 5D5QA 5JVDF 4UCSA 5IT9N 2R7ZG 5IYCO 1WSCA 4GC6A 2YIDA 1JLLB 3FKIG 1FKAH 4IL6Z 3OGCC 4O83A 1VEWA 1HNZO 3I55V 3CMEV 1YEWA 4MTOA 4ZQIA 1W0JG 2CKZB 2Z02A 2R7NA 1Q90D 4IHJA 2R93G 2JJ1G 3TETA 2H3OA 1C3OA 2Q67A 1NZ6A 1MSWD 2F66C 2R82A 1U97A 4DV5B 4I7ZB 3H1KH 1HNWO 5IJ9B 3T9AA 2WB1E 4JI7B 1VQ7V 5I5VA 4QWDA 3JD0A 2WTFA 1S0NA 1J95A 3B8NA 5LA6F 1J5EO 5BWUA 1I1MA 3V4SA 2K1EA 3PW7A 1DAAA 1HNXB 1W93A 3FMAA 3B09A 4LF4O 2GTAA 4DV5H 4Q8FA 5KFMA 4AILC 2JEGA 1R6KA 5DG7A 1YVWA 4J80A 2A0LA 3CCMV 1N32B 1GSOA 1IYEA 3GTOA 3CSXA 1DLBA 5GTHZ 4PZ7A 1KP3A 1CE8A 3TIGA 1EBOA 3T1HO 3IC7A 1KB9F 3HOVG 2XT9A 3W7XA 1HNXH 2NN4A 1OCRB 4NVPA 4NXMH 1X4TA 3ZRVA 1G4YB 1G6UA 1N32H 1H2NA
chains in the Genus database with same CATH topology
3HKDA 4EFBA 2F93B 3IG0A 4O2AB 1ZAUA 1I7FA 3HKBA 4GYCB 5BMVA 4RB1A 3RYIA 4TUYB 1N34B 5JJJB 3JARB 4CH3A 4FLZA 1TAEA 4FLUA 4TQFA 3TY8A 2YIBA 3JALB 2UU9B 1XMOH 1XMQH 4X1KB 2MCTA 4O4IA 1HR0H 5JH7A 4JV5B 2RQ6A 5J2UA 3SJAC 4LH6A 3K3VA 3JAWA 5FPRA 4FLWA 3N41B 3M7MX 4PI2A 3BA8A 3L4JA 5IWAB 3WB0A 4D7SA 4PI0A 3K5NA 3J80W 1N34H 4X65B 1TVKA 2UUBH 5EYPA 3RR5A 2CW7A 5EZYB 4B08A 2BTQA 4O4HB 3JSLA 4U3JB 5LYJA 1SKVA 2QJ1A 5LP6A 4GLXA 4JV5H 4ZOLA 4JI1B 1E4FT 4DR2B 3JSNA 5KMGA 2HVRA 3SGIA 4O2AA 5LL6b 5IWAH 4RAZA 4YJ2B 5EIBD 4OX9H 4NXNB 4TUYA 4X65H 2PYJA 4DR6B 1XQ8A 3JARA 4UCTA 2VUGA 4PZ8A 3HKCB 2IM9A 4FLVA 1SEIA 2VPSA 1JMKC 3VQXA 1XI1A 4KHPB 3RFRA 5JCOC 4JI3B 1S5JA 4X1KA 3RIZA 3JATB 5C8YB 1L8DA 4DK1A 4DR2H 3K5OA 4IAJA 1ZHQA 4JI4B 3WB1A 4K8XA 4NXNH 3N42B 4X66B 2OWOA 1ZHSA 4DR6H 4MV7A 2VWKA 1P8LA 1Q3EA 2EX3A 4LF5B 4A2AA 4KHPH 5JQGB 3RYHA 4DUZB 4O4HA 4JI3H 4U3JA 4FFBB 4LF6B 2ZJTA 4JI2H 2HHHB 4LF9B 3PN1A 1M0WA 3QG5A 4DR3B 1BGWA 3K57A 1CKOA 4GKKH 4DK0A 2V4DA 4PHZA 4YJ2A 4X66H 3GJXB 2UXDH 3HKCA 1HNZB 4I7HA 2GV9A 5EIBC 4LFCH 4TV9B 3K58A 3CHXA 4PZ6A 5ITZA 1XK5A 3RYCA 5C8YA 4AQYB 4LF6H 5KX5A 2HHHH 4DR3H 3KYHC 4RZQA 3JASA 5CA1B 3ZEDA 4UCUA 2YIBD 4F6RA 2PY5A 3BHPA 3RWRD 2ZINA 4YHHB 2Q7GA 1HNZH 3BRCA 4LF8B 3MWMA 4CC5A 1HNWB 5BMVB 3UT5B 4JI6B 3JAKA 1XNQB 4FFBA 4AQYH 1FJGB 4YJ3A 3SJBC 4DV6B 4I4TB 1TGOA 5LOVB 4RB3C 4NXMB 5D1PA 2YXLA 1J5EB 3JAMW 1P49A 4ZHQB 4DR1H 2VQFH 5GONB 4O4IB 4O4JB 4CS3A 4UCRA 3JAWB 2UUCH 3VQWA 4LF8H 3BA9A 1WH2A 2F1MA 1HNWH 1WN7A 4L8JA 4IIJB 2HIXA 5EYPB 2Q0AA 1P16A 2HVSA 4DV6H 3T1HB 2W57A 2ZIOA 5CA1A 3UQ8A 5LYJB 1XMOB 1XMQB 4LH7A 3RGZA 4LF4H 1M5IA 4UCOA 1Q8IA 1JJOA 4CC6A 4LNUB 3UT5A 2R72A 4EFEA 3N44B 5K1PA 1M93A 2UUBB 1X9NA 2WDTA 4WBNB 3T1HH 4I4TA 5LOVA 4LFAB 4E6NA 3N2KA 4ZHQA 2Q7HA 5GONA 4LSAA 3W1GA 4O4JA 4B3TB 5IJ0A 1Z2NX 2P22C 5FNVB 2F4VB 5LP6C 1JFFB 4IIJA 4OX9B 2Q7EA 5IYZB 4FLTA 4EB6B 3NBYB 4CH4A 1L2ZA 3BPZA 1QHTA 1RSOA 4GKJB 2WYOA 4LFAH 3RYHB 5K1XA 2RGRA 3LNNA 4X1IA 1O9GA 1Z5WA 3L2PA 5KMGB 4B3TH 4I9QA 1B04A 5KHGA 4O4LB 4CS4A 2F4VH 3TY5A 4FM1A 4LNUA 3E22B 2VWJA 3BAAA 5FLXW 3DF7A 3RTXA 1NT2B 5IT9W 4X64B 4WBNA 5FPOA 1S68A 2RGVA 3EYYA 4I50B 5KHKA 4GKJH 4D7TA 4DV3B 3N2GB 1GYFA 5ITZB 3RYCB 4TOIA 1Z5VA 1O9HA 5KX5B 4JI2B 2ZNIA 2KKWA 3U11A 2HIVA 3JASB 5FNVA 2YI8A 4F6RB 1JFFA 4GKKB 3ETQA 5BR8B 5IYZA 3QWUA 3H20A 4EB6A 2QM4A 4X64H 3HXLA 2UXDB 1HW7A 4DV3H 4DRXB 4LFCB 3NC0B 3JAKB 4JI5B 3ICXA 4X20A 4CH6A 5DISC 4YJ3B 5J2TB 2PTMA 4O4LA 4MTEA 1IBLH 3E22A 5D5PA 5BR8H 2UXBB 3WB2A 2HGSA 4Q0YA 4I50A 4LR3A 2PUSA 3N2GA 4JI5H 3J7AK 3QTCA 3FFQA 4M7EA 4O2BB 5A2QW 1Z2OX 3W1BA 3KALA 4CS2A 4DR4B 1IBKH 3J81W 1VS0A 4DR1B 2CFMA 2JGUA 2VQFB 3CVZA 3CB2A 5JVDB 2UXBH 2E3CA 1SA0A 1SQGA 2UUCB 3W5OA 3RF2A 4UCVA 1FFXB 2UUAB 4FVMA 1TUBA 4DRXA 4PDBA 4JI8H 3DSQA 4DR4H 2Q2UA 5J2TA 3N2KB 3SR2C 3K59A 2VQEB 4LF4B 2BTOA 3M4IA 5IJ0B 2O03A 2JVDA 1N36B 1E4GT 4K8ZA 2UUAH 5KHIA 5CA0A 2F95B 4CH5A 1FVIA 1A0IA 4O2BA 3BABA 1Q5OA 4B3SB 4X1YB 1N33H 4RB2C 5LA6B 3MAQA 4DV1B 2VQEH 4X1IB 4LMYA 5JVDA 1DGSA 5LMNB 1N36H 1FFXA 4R7RA 4JI7H 4DV0B 1CKNB 4DV4B 1MZBA 4AHCA 3KAJA 3RYFB 2YCHA 4B3SH 3VNNA 2R9AA 4HBNA 4FLXA 4LFBB 4DUYH 1BJTA 4B3MB 4DV1H 4MV9A 1KMIZ 3OTOB 3GDEA 3T1YB 4MTDA 5LMNH 5IJ9A 4BW9A 3L4KA 4DV0H 1CKMA 4DV4H 3KXYT 5LMUB 2HEPA 3IAYA 3K5LA 4B3RH 4Q6GA 2VOBA 4X1YA 4LFBH 4ZI7B 5LA6A 4B3MH 3OTOH 4X20B 1QQCA 4YY3B 1XHZA 5CB4B 3T1YH 1TA8A 2XIGA 4ZIBA 2PYLA 1XHXA 4X62B 5LXTB 4JI0B 4DV2B 3LMLA 1CKNA 5LMUH 3RYFA 2XHBA 3B2EE 3GB8B 4JYAB 4APMA 3U0ZA 4DRFA 1M0TA 3RJ0A 3SJCC 4LSXA 3THOA 4YY3H 1IBMB 4FM9A 1XDNA 2UU9H 3RGBA 4X62H 5JJEB 3N43B 4JI0H 1IBLB 4DV2H 1VF7A 2ZCEA 3S24A 4TQDA 1SA0B 4KL1A 2HVQA 4LF7B 3C0FB 2E5LB 4JYAH 3F8NA 3TY9A 2UXCB 1TUBB 4ZI7A 1IBMH 4DR5B 1V9PA 4IHJB 5CB4A 1SYXB 3JALA 2PZSA 3A2FA 5LXTA 1IBKB 4JI1H 2YIAA 4HNAB 2KSWA 1AN7A 3VQYA 1I94B 4UFZA 4BWAA 2OYQA 4LF7H 4RB0A 2E5LH 3RGXA 2UXCH 1D5AA 4RAYA 5JCOA 5JJNB 2R70A 5CA0B 1I6UA 5EZYA 4DR5H 5KHJA 5D5QA 4JI8B 4K0KB 4UCSA 4EEQA 1I94H 1FKAH 3ZS8C 4JI4H 3K5MA 1YEWA 3N6XA 2CW8A 4EQ5A 1WNSA 4FM2A 2ZM6B 2PGGA 4LF5H 1O75A 1Q43A 3NBZB 5KHHA 4DUZH 4IHJA 4K0KH 3QF7A 4DR7B 2ZNJA 1N33B 1T5EA 3JATA 4I55B 4ETSA 3HKEB 2F66C 4HNAA 5D1OB 4LF9H 4FM0A 1WPBA 3U10A 3KAKA 2YI9A 4J0MA 4DV5B 4TV8B 4BWSC 5IJ9B 1XNRB 3VQVA 1S03G 2ZM6H 4JI7B 5FD5A 3HKDB 3HKBB 5JQGA 1M4UA 3RYIB 4DR7H 1HNXB 4DUYB 4FLYA 3FMAA 2FE3A 2Q2TA 2P5OA 1KU9A 4DV5H 1H2SB 2WE6A 4DV7B 5JH7B 4AILC 5FD6A 1XNRH 4YHHH 5J2UB 1N32B 3CSXA 4PZ7A 1SQFA 4A2BA 4TV9A 4B3RB 3OTFA 4JI6H 1XNQH 2JS5A 1HNXH 1TVKB 1FJGH 2RJZA 4I55A 3HKEA 5D1OA 4NVPA 1Z2PX 1X4TA 4NXMH 1J5EH 2BTQB 4TV8A 3N40P 5LP6B 5EOYA 2CAZC 1HR0B 4DV7H 4ZOLB 2ZIMA 1G6UA 1N32H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFB A;  4DV6 B;  1IBM B;  4NXM B;  1XDN A;  5D1P A;  1J5E B;  1ZAU A;  1IBL B;  1N34 B;  3S24 A;  4UCR A;  3W1B A;  1TAE A;  2HVQ A;  4LF7 B;  3TY8 A;  3BA9 A;  2E5L B;  2UU9 B;  4DR4 B;  2UXC B;  3TY9 A;  1VS0 A;  4DR1 B;  2CFM A;  2VQF B;  4JV5 B;  2HIX A;  4LH6 A;  2HVS A;  1P16 A;  5FPR A;  4DR5 B;  1V9P A;  3T1H B;  2UUC B;  3BA8 A;  3W5O A;  4UCV A;  5IWA B;  3UQ8 A;  2UUA B;  1XMO B;  1XMQ B;  1IBK B;  4X65 B;  4LH7 A;  3RR5 A;  1I94 B;  4UFZ A;  4UCO A;  3JSL A;  4CC6 A;  2Q2U A;  4GLX A;  4EFE A;  2VQE B;  4JI1 B;  4DR2 B;  3JSN A;  4LF4 B;  2UUB B;  1X9N A;  2HVR A;  1N36 B;  3SGI A;  4LFA B;  4E6N A;  4JI8 B;  4K0K B;  4UCS A;  4NXN B;  4DR6 B;  3W1G A;  4EEQ A;  1FVI A;  4B3T B;  1A0I A;  4UCT A;  3BAB A;  2VUG A;  4PZ8 A;  4B3S B;  4KHP B;  2F4V B;  4JI3 B;  4EQ5 A;  4DV1 B;  2ZM6 B;  4OX9 B;  3NBY B;  1DGS A;  3NBZ B;  5LMN B;  4GKJ B;  4JI4 B;  4DR7 B;  1N33 B;  4X66 B;  2OWO A;  5D1O B;  4DV0 B;  1CKN B;  4DV4 B;  3L2P A;  1P8L A;  1B04 A;  4DV5 B;  4LF5 B;  3VNN A;  4DUZ B;  3TY5 A;  4LFB B;  1XNR B;  3BAA A;  4B3M B;  4JI7 B;  4LF6 B;  3OTO B;  3RTX A;  2HHH B;  4LF9 B;  3T1Y B;  3PN1 A;  3GDE A;  4DR3 B;  4X64 B;  5FPO A;  1S68 A;  4DV3 B;  1CKO A;  1HNX B;  4DUY B;  2Q2T A;  4TOI A;  1CKM A;  5LMU B;  3GJX B;  4JI2 B;  1HNZ B;  2HIV A;  4DV7 B;  4PZ6 A;  4GKK B;  1XK5 A;  5BR8 B;  4AQY B;  1N32 B;  3QWU A;  4YY3 B;  4PZ7 A;  3KYH C;  1TA8 A;  2UXD B;  4UCU A;  4X62 B;  4B3R B;  4LFC B;  4JI0 B;  3NC0 B;  4JI5 B;  4DV2 B;  4YHH B;  5D1O A;  1CKN A;  5DIS C;  4LF8 B;  3GB8 B;  4JYA B;  4CC5 A;  1HNW B;  4JI6 B;  1HR0 B;  1XNQ B;  4DRF A;  2UXB B;  1FJG B; 
#chains in the Genus database with same CATH topology
 1YIJ V;  2F93 B;  3U9S A;  4ZI7 F;  1ZAU A;  1I7F A;  1R3J C;  2R7Z A;  1S0V A;  2QWN B;  3G71 V;  4RB1 A;  2FKL A;  4O7T A;  2YEV B;  5CB4 F;  3OMA B;  2AHY A;  3JAR B;  1PL0 A;  4B3T O;  4XYM B;  4FLZ A;  1TAE A;  5DED A;  3JAL B;  2UU9 B;  1XMO H;  1Q6H A;  3BQ1 A;  4JV5 B;  3SJA C;  4LH6 A;  3K3V A;  2W9B A;  5FPR A;  3CD6 V;  3FAV B;  2IJH A;  5CBF A;  3L4J A;  1Y74 A;  2HG5 C;  3IFX A;  3W7W A;  4CKE A;  1PNM A;  4FZ0 A;  5EYP A;  4IRD A;  2V1D A;  5KFF A;  2Q7D A;  2FPI B;  2EJ7 A;  2QJ1 A;  4O7Z A;  2K9P A;  3BCC H;  4BY1 G;  4JV5 H;  4JI1 B;  2YXY A;  2HVR A;  4FFK A;  3BFR A;  2EIJ B;  1K3E A;  2P4V A;  3SPC A;  1JVM A;  4RAZ A;  1AI6 A;  3B77 A;  5IYD G;  2HP8 A;  3UZO A;  4JAA A;  2X6A A;  3JAR A;  2EJ0 A;  2PMZ A;  2R9I A;  1SEI A;  3V6K A;  1VQ9 V;  1JMK C;  2JEX A;  2IJI A;  1PX2 A;  2GUZ A;  2YRX A;  3JAT B;  5C8Y B;  1L8D A;  1RM1 B;  2RNB A;  3T5K A;  1NR7 A;  3UO3 A;  5BZB A;  1PKX A;  3FAV A;  1E4E B;  1KC8 W;  4JI4 B;  1Q86 W;  1AB3 A;  3WB1 A;  2ZD9 A;  3T9C A;  2GPS A;  3F7Y C;  2OWO A;  2YW2 A;  1GN4 A;  4MV7 A;  4A3K G;  2EIJ C;  1EFR G;  5E25 A;  3ETJ A;  2Z04 A;  2NLJ C;  3RYH A;  1YJ9 V;  3PO3 G;  4GT1 A;  1SFO A;  2A7W A;  2Q73 A;  2R9R B;  1NS1 A;  2ZJT A;  1QR8 A;  2UXB O;  1RK5 A;  1VP7 A;  3GWK C;  4DR3 B;  3QO5 A;  1QLE B;  3N8D A;  2RF4 A;  4DK0 A;  1I7L A;  2V4D A;  3OAA G;  3RB4 A;  5KG5 A;  4WFB V;  2FLP A;  4I7H A;  2X7R B;  1BMF G;  4YR0 A;  4LFC H;  4DR4 O;  3EPI A;  2VQF O;  3K3W A;  5C8Y A;  4AQY B;  3RVZ A;  1K9M W;  1NH2 B;  5B1A C;  4C5C A;  5EWF A;  5IP7 G;  5FLM G;  4DR3 H;  4RZQ A;  1RYS A;  4A3C G;  2WLL A;  3JAS A;  1E4E A;  3RWR D;  2UUA O;  3AK1 A;  1B3Q A;  3MWE A;  2WPD G;  5CR5 A;  1EZ1 A;  3GIM A;  3HOX G;  5DG8 A;  5BMV F;  2Q7G A;  3GIL A;  3RVY A;  3PW4 A;  4JF3 A;  5BWV A;  4O7L A;  1OCZ C;  3IGA C;  4CC5 A;  4YR2 A;  3GTK A;  5BMV B;  2IU3 A;  3UT5 B;  5FL7 G;  4JI6 B;  4K3A A;  1V55 C;  1XNQ B;  1JDB B;  2O57 A;  4AQY H;  1WB8 A;  1JCH A;  2C2A A;  2C22 A;  3SJB C;  3KHG A;  5JH7 F;  2A06 H;  2ZR3 A;  4JV2 A;  2C2R A;  4O4J B;  2RN9 A;  3D3Q A;  4UCR A;  2P67 A;  2F23 A;  4B3S O;  5DN6 G;  3NUA A;  4DL3 A;  3WNZ A;  2WA4 A;  4RQE A;  4DIM A;  3NXS A;  3ABL B;  2GTS A;  1P16 A;  2HR3 A;  2QB5 A;  4U7O A;  1PM9 A;  3D8C A;  2G38 A;  2HVJ C;  3H0G G;  3H40 A;  4ED0 A;  4R6Z A;  2ZIO A;  1NKD A;  4PA9 A;  3GV5 B;  5KFY A;  1F4M A;  1XMQ B;  4LH7 A;  1L0L H;  5KFH A;  2GPW A;  4O2A F;  3CRA A;  3C3T A;  1BQ0 A;  3KHR A;  4LFB O;  2JEF A;  1H2K A;  3UT5 A;  3WO0 A;  3GTG A;  4DYL A;  4EFE A;  4RO2 A;  3SPH A;  2X0S A;  4QW8 A;  5LGT A;  1VQP V;  3L71 H;  2LW7 A;  1OHH G;  1B6Q A;  1UPG A;  2V7Q G;  3W1G A;  2COI A;  4O4J A;  5EDW A;  3QZ7 A;  1M9N A;  5IJ0 A;  1Z2N X;  2P22 C;  5KFX A;  1EM1 A;  2JA7 G;  2WSS G;  2F4V B;  2CNQ A;  1N56 A;  4C7U A;  3PW5 A;  2XTA A;  2ZE6 A;  5BY1 A;  2ASL A;  4TM5 A;  4CH4 A;  3TGU H;  5HNE A;  3BPZ A;  2UU9 O;  4X62 O;  1GKF A;  4KXR A;  1KKC A;  2DQ0 A;  4JAS A;  4JI0 O;  1H2M A;  4X1I A;  3FB5 C;  4DV2 O;  1NR1 A;  4HR7 A;  3E8G A;  1PP9 H;  5KG0 A;  4WFG A;  4JYA O;  2F4V H;  4FM1 A;  4HN2 A;  3VA7 A;  1DV2 A;  3ETG A;  4P30 A;  2ZR2 A;  5IT9 W;  4ECY A;  5FPO A;  3CC4 V;  4I50 B;  5KHK A;  4D7T A;  4NTX A;  3LSS A;  5KX5 F;  3CCJ V;  1IBL O;  4JI1 O;  4TOI A;  5EWE A;  2AGO A;  1CXZ B;  5KX5 B;  3ETH A;  2LO1 A;  4N23 A;  2QA4 V;  2VRZ A;  4QE9 A;  1EHI A;  4NTW A;  5BR8 B;  3H0G A;  4UVB A;  1M56 B;  4DR5 O;  1WCM G;  4L1K A;  2W9C A;  3HO8 A;  1EN5 A;  2J6U A;  2R8I A;  4J9P A;  1VF6 C;  3ICX A;  4X20 A;  4JYB A;  4CH6 A;  1I2K A;  1SQB H;  1GAX A;  2F43 G;  3VPD A;  4FS1 A;  2PTM A;  4MTE A;  2WLI A;  2B5U A;  5D5P A;  3JYC A;  3WFV A;  5BR8 H;  2HGS A;  2W6M A;  1BHB A;  3ZMZ A;  4I50 A;  2EIK B;  4FFL A;  1F7Y A;  2ZKO A;  2BR0 A;  2I87 A;  3T9D A;  2IU0 A;  1KKD A;  1WP8 A;  2OCH A;  4M7E A;  5CA1 F;  5BYA A;  3W1B A;  5F2V O;  3MHS C;  2NUA B;  4CS2 A;  3GTM A;  5B1N A;  3J81 W;  4UV8 A;  5KAF Z;  4DR1 B;  1H38 A;  2DYS B;  2V9W A;  3CB2 A;  2LQT A;  3WO1 A;  3UFX B;  3FKS G;  1R1B A;  2EIL B;  3W5O A;  1NI8 A;  3RF2 A;  3TJT A;  3AK3 A;  4DR7 O;  3HOW G;  2CZG A;  1Z2G A;  2EIK C;  1Q81 W;  4XDK A;  5CA3 A;  4F4L A;  4Q4D A;  3SR2 C;  1JQ0 A;  1XNR O;  3GWO A;  3GII A;  3FB8 C;  3L73 H;  3VMM A;  1COW G;  2BTO A;  1Y14 B;  5I5S A;  1YF2 A;  5H9C A;  1FAF A;  4IIJ F;  1N36 B;  4NKG B;  2GBO A;  4AYB A;  2E2H A;  2EIN C;  2F95 B;  1A0I A;  1AR1 B;  3MDS A;  2EIM C;  4X1Y B;  3RN4 A;  3CJH A;  4RB2 C;  4O3R A;  1QVF U;  4F4Y A;  1Y6X A;  5KT5 A;  2QWQ B;  4A3E G;  3ZHU A;  3B4S A;  2ZE7 A;  3Q8Q B;  4YXW G;  3T2M A;  4XZ3 B;  1VQL V;  1N36 H;  1IXB A;  4R7R A;  3TK1 A;  4U7N A;  3AG7 A;  5HFM A;  3HKZ A;  4DV0 B;  4DV4 B;  1I1L A;  4PA4 A;  5B5E Z;  3BVO A;  1FD9 A;  1JDE A;  5T14 A;  1YJN V;  3M99 B;  1K73 W;  1ROP A;  4G2K A;  3S3W A;  4MV9 A;  2WLH A;  3SE7 A;  1TWA A;  2UXN A;  2CH7 B;  2YZG A;  4QWC A;  4ECX A;  4A3F G;  2CNV A;  2DE0 X;  2Z0A A;  5DEC A;  4BIO A;  2X5R A;  4DV0 H;  4DV4 H;  4F50 A;  2HKO A;  3IAY A;  5B1B B;  2W7O A;  2XCA A;  2XAH A;  3Q1K A;  4X1Y A;  4PV1 B;  1LUV A;  1I2L A;  1SQX H;  3AG3 B;  4LP8 A;  4O4L F;  1E1R G;  1TA8 A;  3EHB B;  2XIG A;  2BCC H;  2PYL A;  1XHX A;  3KG2 A;  5FJ8 G;  4QWB A;  5KFD A;  1AIL A;  2XAQ A;  2XCL A;  4QWA A;  3CPW U;  4KFM A;  3T5H A;  4A5U B;  3B2E E;  2MW2 B;  2FJZ A;  4YAJ B;  2Y0P A;  2PMZ E;  1BSM A;  4IR1 A;  1UFI A;  3THO A;  4LSX A;  1XDN A;  2WWW A;  3RGB A;  3CCE V;  4A93 G;  4H0L B;  3AG3 C;  1VF7 A;  3K3P A;  4DR6 O;  1GM8 A;  2L6L A;  4KL1 A;  3G67 A;  4LF7 B;  2HVQ A;  2E5L B;  5IYB G;  1NVP B;  4KHP O;  1N4C A;  1MZE A;  4MT8 A;  2UXC B;  1OBG A;  5BWX A;  4JI3 O;  2EJ3 A;  1KEE A;  4J9L A;  2E2I A;  5H6R A;  2KQX A;  4TWK A;  4MTG A;  4RQF A;  2V5A A;  2DYR B;  1V9P A;  2XOK G;  2DIK A;  2PZS A;  3EVK A;  5IY5 B;  3AG1 B;  1IBK B;  3OHB A;  2LFR A;  4X66 O;  1WA8 B;  2KSW A;  2W9A A;  5L3G A;  5GTI Z;  4BWA A;  4LF7 H;  5CA0 F;  2E5L H;  1F4N A;  2IJJ A;  4WHX A;  2W6O A;  2UXC H;  3TEK A;  1GRJ A;  5JJN B;  2JRI A;  2R70 A;  5CA0 B;  2WLK A;  3QO7 A;  4IRK A;  4KP4 A;  2XAG A;  2AHZ A;  1VQM V;  4QJF B;  1OV9 A;  4O7Y A;  2CGN A;  2OTL V;  5HFL A;  2QTS A;  2DYR C;  4EEQ A;  4Y8V B;  2VUM G;  3ZS8 C;  5KT2 A;  2P7T C;  3AG1 C;  3N6X A;  1PNL A;  2CW8 A;  4IR9 A;  4WCE V;  1VAR A;  2PGG A;  3BY6 A;  5JQW A;  4UV9 A;  2JEJ A;  4BY7 G;  1O75 A;  2OIE A;  3NBZ B;  5KHH A;  3SPG A;  4BW5 A;  1W96 A;  4C2M A;  4EBC A;  3QF7 A;  1Y1W A;  2ZNJ A;  1T5E A;  4I55 B;  3HKE B;  5D1O B;  4Z1V A;  5LBQ A;  3TW7 A;  1K92 A;  1XOU A;  3H9V A;  3OEE G;  2GQR A;  4TV8 B;  4LF8 O;  4ED1 A;  3OR7 C;  4RU9 A;  4CZZ A;  4R50 A;  5I5W A;  2EBO A;  3HKD B;  1FJG O;  4DV6 O;  4UVC A;  1FXK A;  1I08 A;  4RWU A;  4TT3 G;  4QJF A;  3RYI B;  5JVL A;  3R66 A;  2W0F C;  1S5L Z;  4DUY B;  5EC2 C;  4O82 A;  2Q9L A;  3R5H A;  3T9F A;  3DTU B;  1EKP A;  3OM3 B;  2E76 B;  1KU9 A;  1ZTE A;  3M9O B;  1OCO C;  1EKV A;  2J6T A;  5BXZ A;  4DV7 B;  5FD6 A;  1RPR A;  5A2Q N;  5J2U B;  2JK5 C;  2JEU A;  2WLJ A;  4O81 A;  1TUE B;  4A2B A;  3ABK B;  4TV9 A;  4B3R B;  1TVK B;  3K06 A;  1EZV H;  2Y48 A;  1S77 D;  4I55 A;  2DN9 A;  5I5T A;  3HKE A;  5D1O A;  4FFO A;  5KG1 A;  3NR7 A;  1J5E H;  4A3G G;  4TV8 A;  4IRC A;  3BEH A;  4DV7 H;  4E4E A;  4QW9 A;  2CAZ C;  3TXS A;  1FPO A;  2ZIM A;  5KMG B;  3HKD A;  2DQ3 A;  1N8R W;  3IG0 A;  5B3S B;  1JOY A;  3RYI A;  4TUY B;  3MFH A;  1N34 B;  2LGQ A;  3B40 A;  2QWR B;  1KJ9 A;  3F5T A;  1M6V A;  4CH3 A;  3TY8 A;  1GSH A;  1VAJ A;  3STL C;  3RUP A;  3K9A A;  3K03 A;  4O4I A;  4O86 A;  4BBR G;  1N48 A;  5LHG A;  5J2U A;  3LP8 A;  3H1J H;  2B1I A;  2OLS A;  2CTR A;  2I80 A;  3M7M X;  5CN0 A;  2EJ2 A;  2R7L A;  4UB6 Z;  3PR5 B;  3LNM B;  4MV4 A;  3T5J A;  1R73 A;  3E86 A;  3K5N A;  1V54 C;  1DTO A;  5EZY F;  1N34 H;  1TVK A;  1QU7 A;  4JTC B;  3RR5 A;  2ZE8 A;  3PFF A;  1OWT A;  5EZY B;  3RB3 A;  1ZWI C;  1QLN A;  4O4H B;  5KFZ A;  4XX0 B;  1SKV A;  4GLX A;  4DR2 B;  3JSN A;  5KMG A;  3DTG A;  3EPG A;  4D6T H;  4U6P A;  2Q68 A;  3SGI A;  5KFL A;  3R65 A;  4DV3 O;  2H8P C;  3D36 A;  3MD0 A;  4EGJ A;  4TUY A;  4OX9 H;  2CTQ A;  1XQ8 A;  2Y69 C;  4IHJ F;  3RB6 A;  3HKC B;  2IM9 A;  1GLV A;  1SET A;  4GUN A;  3BQ2 A;  5JCO C;  1RYR A;  3HOU G;  3AG2 B;  5H2F Z;  1M57 C;  2P90 A;  4DR2 H;  3HB3 B;  1RJQ A;  5BPF A;  3S3X A;  4NLG A;  2W0X A;  1GMG A;  2Q8V A;  4K35 A;  1RFY A;  5DG9 A;  3UO2 A;  4O4H A;  4O3P A;  4FFB B;  1IOW A;  1K4C C;  2V4R A;  4O84 A;  4MV3 A;  5KT4 A;  1BGW A;  1YI2 V;  4XYL B;  1KQS U;  5KFW A;  5AG2 A;  4PHZ A;  4DAA A;  4J7Z A;  4EBD A;  4PDR A;  2QYZ A;  2BQU A;  4A3L G;  3LWB A;  3HKC A;  2DPI A;  3CHX A;  4P9O A;  5ITZ A;  2Z3Y A;  2VS0 A;  2FYU H;  3RYC A;  5IYB O;  5C4X G;  3CRR A;  3DC6 A;  3GIJ A;  4QE7 A;  5KA5 A;  2UUC O;  5KUM A;  4F6R A;  3BHP A;  2QE7 G;  1N0J A;  2GHY A;  2ZIN A;  3ZJZ A;  5DM6 V;  5KUK A;  1S10 A;  5F9L A;  2BQR A;  2UVV A;  1URF A;  4AYB E;  1SER A;  1JA8 A;  2QGN A;  2JEI A;  4ZKI A;  3MWM A;  3SDL A;  3KHL A;  3K0G A;  5I5X A;  3CCL V;  3JAK A;  3M9N B;  4FFB A;  2ALZ A;  1I3Q A;  4E4T A;  2YU9 A;  5LOV B;  4NXM B;  2YXL A;  4WFH A;  3JRX A;  4JTA B;  2VQF H;  3IC9 A;  1KUT A;  3RFC A;  1DK1 A;  1K83 A;  2VA2 A;  4AI8 A;  2W9B B;  4FBT A;  5I5U A;  4J9S A;  3BA9 A;  3J81 N;  3HKZ E;  1JX4 A;  1KJ8 A;  4P9P A;  4DUY O;  1Y74 B;  1EN4 A;  2JA5 A;  2HIX A;  4FZ1 A;  1NTZ H;  5H6Q A;  5EYP B;  2Q0A A;  5KFP A;  4DW0 A;  2CQY A;  5LMN O;  2E75 B;  1RK6 A;  5KFI A;  5DQG A;  2WAM A;  3UQ8 A;  3U54 A;  5DQI A;  3FDS A;  5HBR B;  1XMO B;  2ZDI A;  3AG4 B;  4PA3 A;  1M5I A;  2W8L A;  3RV4 A;  1Q8I A;  1JJO A;  1MG1 A;  1B33 N;  2D2C B;  4UUJ C;  5DLF A;  5LGU A;  4DO2 A;  3CEI A;  2R72 A;  3N44 B;  3LUT B;  3OTO O;  2WDT A;  4J9Q A;  1DV1 A;  1BZK A;  5LOV A;  4LFA B;  2WAQ A;  5EBL C;  2Q7H A;  4LC1 A;  2GUZ B;  2OT5 A;  1A48 A;  4LSA A;  1OCR C;  2C00 A;  1IVS A;  4FK5 C;  5LMU O;  2MK3 A;  1HP8 A;  3BAC A;  5L3B A;  2L35 A;  2KB1 A;  1K7D A;  1JFF B;  1VIB A;  1S9F A;  2Q7E A;  5IYZ B;  4FLT A;  5DGA A;  4EB6 B;  2JDI G;  4YY3 O;  5KAI Z;  2QM7 A;  5J9P C;  1QHT A;  4GKJ B;  4LFA H;  3X2Q B;  3RYH B;  2CE4 A;  4FPP A;  3PW2 A;  2RGR A;  3GID A;  1WAZ A;  1K4D C;  3L2P A;  2XUM A;  4FGR A;  1B04 A;  5KHG A;  1IXM A;  4J9K A;  2FPP B;  3RB0 A;  2VWJ A;  3VPB A;  3E5N A;  4C5B A;  3RTX A;  4ED2 A;  4X64 B;  2QK4 A;  1S68 A;  3ZBH A;  4GKJ H;  1IX9 A;  3L75 H;  5C8Y F;  1VMG A;  1E1Q G;  1GYF A;  1AP6 A;  2RDI A;  4WFF A;  3X2Q C;  2WLL B;  3JAS B;  2YI8 A;  4UVA A;  1JFF A;  3GV8 B;  5IYZ A;  4R8U B;  4EB6 A;  4X64 H;  1M7J A;  3UM7 A;  4ECZ A;  3ZN1 A;  3UYY A;  4X89 A;  1CEZ A;  4LFC B;  3R5X A;  4JI5 B;  2R6F A;  4YR3 A;  4U3F H;  1FKA O;  3T54 A;  1NH2 D;  2FPG B;  5J2T B;  5L9X A;  1IBL H;  1PD3 A;  3LDD A;  3Q2O A;  4MS2 A;  1RM1 C;  4GX0 A;  3KTM A;  3J7A U;  5KFV A;  2DWD C;  4Q0Y A;  4RNO A;  4LR3 A;  3QO8 A;  3JD2 A;  2PBZ A;  5C5J A;  4W4L A;  4JI5 H;  3J7A K;  3UZB A;  5A2Q W;  2Q0O C;  3PZP A;  2AGA A;  2XGP A;  5CBG A;  2FK2 A;  3E89 A;  5TIS Z;  1B6S A;  2FL4 A;  4DL7 A;  2NU9 B;  2ATL A;  2FTK A;  4JUZ A;  3DC5 A;  2HG8 A;  2E3C A;  2VQD A;  2Q5Z A;  1SA0 A;  5KFS A;  4R8U A;  1I0H A;  5KFN A;  1SQG A;  1QLE C;  4UCV A;  1BXR A;  4FVM A;  1TUB A;  2DAA A;  3AYH B;  4PDB A;  3DTF A;  3RBE A;  4DV5 O;  1FXV A;  4JI8 H;  4MW8 A;  2AXT Z;  5J2T A;  4O4J F;  1JKJ B;  1XL4 A;  1GM7 A;  3K59 A;  1G8M A;  3KCX A;  2VQE B;  1SQQ H;  1B6R A;  4JI7 O;  2YC0 A;  3M4I A;  5IJ0 B;  1UC8 A;  2O03 A;  1JIH A;  4K8Z A;  2CNU A;  2DW4 A;  1HNX O;  1RJR A;  4CH5 A;  5K2M A;  3Q8P B;  1Y1V A;  4NXM O;  1N33 H;  3AEI A;  4DV1 B;  2VQE H;  4X1I B;  1N32 O;  5EC1 C;  3A0H Z;  1DGS A;  2BOB C;  1AVM A;  4JTD B;  1OBD A;  3CRQ A;  1CKN B;  3PR4 A;  4AHC A;  5JUM A;  3JD4 A;  3RYF B;  4YAK B;  4G3I A;  4YIO A;  3VNN A;  4HBN A;  4A3I G;  1XMO O;  3FD9 A;  5KT3 A;  4P2Z A;  4B3M B;  1BNC A;  4DV1 H;  3E8F A;  3ABL C;  1L1F A;  3OSN A;  4J9R A;  1BS3 A;  2RCV A;  4F4X A;  3GDE A;  3T1Y B;  3TW6 A;  3K04 A;  3CSW A;  1S5H C;  1GH6 A;  3JAM N;  5H5N A;  4RNM A;  3FB6 C;  1BE3 H;  3ABM B;  3K5L A;  2DWC A;  4Q6G A;  2VOB A;  2W9C B;  1FS0 G;  4WFE A;  2AZ2 A;  4B3M H;  4JV5 O;  2BE3 A;  1GK9 A;  1QR9 A;  4X20 B;  3T1Y H;  2R7K A;  1MZF A;  4LBE C;  3K5I A;  5BWW A;  2ZQM A;  5LXT B;  2FML A;  2WLI B;  4B7E A;  1PL4 A;  1CKN A;  4I50 F;  1KD1 W;  3RYF A;  3T5L A;  3GB8 B;  3F7V C;  4APM A;  1M0T A;  1UC9 A;  3SJC C;  1K1Q A;  2HDK A;  3DGE A;  3ABM C;  3CE2 A;  1IBM B;  4FM9 A;  1SS3 A;  5JJE B;  1VQN V;  3PO2 G;  4FU0 A;  2HLD G;  4R8C A;  5L1K A;  3GTP A;  2QF7 A;  3KRE A;  1GN3 A;  4JPR A;  1W2B U;  2ZDG A;  3C0F B;  3F8N A;  2A3Q A;  4J9Z B;  1DIK A;  3GTJ A;  1IBM H;  4J42 A;  2W6J G;  3A2F A;  4JI4 O;  1KT8 A;  5DGH A;  2A79 B;  5LXT A;  1EYZ A;  2LW1 A;  1JX9 A;  1I94 B;  4CBC A;  3GIP A;  2NU6 B;  2EZP A;  1VQ4 V;  1KC7 A;  3RGX A;  4LFC O;  4RAY A;  4X88 A;  3ZHV A;  1NU1 H;  4CMF A;  4ME6 A;  1M56 C;  3KKY A;  4DR3 O;  5IYD O;  5KHJ A;  1PPJ H;  2EZO A;  3E8H A;  4MVO A;  1S0M A;  4K0K B;  3CJH B;  4NYE A;  2JJ2 G;  2R8K A;  5K3W A;  4C5A A;  2C2D A;  3VPC A;  1I94 H;  3K5M A;  1BGY H;  1YZB A;  2EUL A;  2VPQ A;  1AR5 A;  2WA3 A;  2X0L A;  1VF5 B;  2ZM6 B;  3SYQ A;  1S72 V;  1AJP A;  4AQY O;  3DXR B;  2HFE C;  4LF5 H;  3T99 A;  4DUZ H;  3F5W C;  3U9T A;  3ABT A;  1S97 A;  4K0K H;  3OUS A;  5L3C A;  1KP2 A;  1YXB A;  2AGQ A;  3O9O A;  4ETS A;  1MSD A;  4LF9 H;  1YTF D;  3KAK A;  1I5X A;  3FYE B;  1H8H G;  2D3O W;  4BWS C;  4EEY A;  1MOF A;  4IZO A;  4O7N A;  5BWR A;  1K8A W;  3K5H A;  4O3N A;  1MA1 A;  4ECQ A;  4JI6 O;  2DYS C;  1XNQ O;  2FP4 B;  1S03 G;  5CAE B;  2ZM6 H;  4ED3 A;  3FYI B;  2EIL C;  3HKB B;  4PDL A;  5JQG A;  5C3E G;  5KFK A;  5GW7 A;  2Q2T A;  3TXQ A;  1YTF B;  1KEC A;  1UNN C;  4EKW A;  2WE6 A;  4IYH A;  3O65 A;  3HOY G;  4YHH H;  2A1H A;  4JGS A;  4QSH A;  3R9R A;  3DXR A;  4I0X B;  3W7S A;  1Y66 A;  1L0N H;  5LHI A;  1XMQ O;  3ZCC A;  2RJZ A;  1KUQ A;  1FJG H;  3JD1 A;  2YSU B;  4G27 B;  4BR6 A;  4Z1M G;  4J7J A;  4Q20 A;  1Z2P X;  3ORR A;  2QWP B;  1CP9 A;  3N40 P;  5LP6 B;  5EOY A;  1HR0 B;  4ZOL B;  2NNU A;  4OPH A;  3HPL C;  4Q8E A;  4EFB A;  2JA8 G;  3ASO B;  3EXA A;  3HKB A;  2YZN A;  1TWC A;  2C2E A;  5KG2 A;  2DPJ A;  3I56 V;  3H4D A;  3TIN A;  1V51 A;  3Q8R B;  2EIY A;  3MR6 A;  2ZXW B;  2YIB A;  3H1H H;  3CXH F;  4X9Q A;  5L1L A;  2F4V O;  1GGO A;  1HR0 H;  2QR4 A;  2W6Q A;  4JZ2 A;  2XC9 A;  1Y1W G;  3JAW A;  4FLW A;  1XUQ A;  4PI2 A;  3STZ C;  3BA8 A;  4I0X A;  3M9M B;  5IWA B;  4D7S A;  2R7M A;  1NVP D;  5L1J A;  3I4M G;  4X65 B;  5KFU A;  2UUB H;  3C3S A;  2CW7 A;  4MVZ A;  5B1B C;  3CWB H;  4I9W A;  3ASO C;  3OUZ A;  2M7W A;  4U3J B;  3KHH A;  5LYJ A;  5LP6 A;  3Q4H A;  4YBZ B;  1W59 A;  2WLM A;  4ZOL A;  1E4F T;  4J9O A;  3RBZ A;  3BG5 A;  2ABJ A;  1TWH A;  3U0G A;  4GX5 A;  3ZRW A;  4MV1 A;  1OCC B;  4DLK A;  5LL6 b;  5IWA H;  4YJ2 B;  2CUG A;  4NXN B;  4X65 H;  4F4W A;  4PDM A;  2VUG A;  4J10 A;  1AUX A;  5IYC G;  4FLV A;  2VPS A;  2YUA A;  3RFR A;  3GV7 B;  1YCI A;  1S5J A;  3G6Y A;  3RIZ A;  5BR8 O;  3SPJ A;  4DK1 A;  4ECR A;  2JA6 A;  3K5O A;  4IAJ A;  1ZHQ A;  2BOC C;  4GLW A;  2W8K A;  4O3S A;  1T36 A;  4NXN H;  2Q4P A;  5E79 Z;  3N42 B;  1ZHS A;  2COG A;  3NGD A;  2VWK A;  1S76 D;  1P8L A;  1Q3E A;  5L3D A;  2EX3 A;  4IYI A;  1OCC C;  1FXK B;  3B8M A;  1T94 A;  4U3J A;  4RNN A;  3RBD A;  1E79 G;  4FJC C;  4LF6 B;  4JI2 H;  2HHH B;  2EJR A;  2KSD A;  1M0W A;  3QG5 A;  4FFP A;  3LSU A;  5IY5 C;  3K57 A;  2Y0S A;  4GKK H;  3CC2 V;  4YJ2 A;  1S0O A;  3OMN B;  1U96 A;  3WG7 B;  3GJX B;  3OT7 A;  2DWE C;  2UXD H;  1HNZ B;  2GV9 A;  3CX5 F;  2YZL A;  4TV9 B;  4I55 F;  5KFT A;  3HOZ G;  4PZ6 A;  4DR1 O;  4FS2 A;  1XK5 A;  1WLE A;  1VQK V;  2ZGI A;  4LF6 H;  3OGI B;  2HHH H;  2IH3 C;  4TV8 F;  1FXK C;  4UCU A;  2PY5 A;  5BPH A;  4OGQ B;  2NU8 B;  3IN5 A;  2C35 B;  2P0A A;  4J9Y B;  1HNZ H;  3BRC A;  3P3P A;  3APO A;  1HNW B;  3T9E A;  1I7N A;  3LUL A;  2IBZ H;  3PVX A;  4PEL A;  3OFN G;  4YJ3 A;  5KLV H;  1VQ5 V;  1IYD A;  1WRV A;  3ORQ A;  4I4T B;  1TGO A;  4YB8 B;  4O4I F;  4RB3 C;  4Q44 A;  3JAM W;  1J5E B;  1P49 A;  1N36 O;  4ZHQ B;  5J2U F;  3E2E A;  5GON B;  4O4I B;  2CTP A;  2LFS A;  4CS3 A;  5L1I A;  1XRE A;  2BSK B;  2UUC H;  3VQW A;  2PI5 A;  3L9D A;  5D8D A;  1HNW H;  1WN7 A;  4L8J A;  4JYC A;  2HVS A;  4EBE A;  3T1H B;  1RSO B;  2W57 A;  2J6S A;  4ECW A;  1RJP A;  3MR3 A;  4LF4 H;  3RGZ A;  4DV0 O;  4DV4 O;  4NZN A;  1GO3 F;  1F51 A;  2IW5 A;  3LSQ A;  4TUY F;  2V58 A;  4CC6 A;  4LNU B;  4NB5 A;  5K1P A;  3SNO A;  1BQZ A;  2JIZ G;  4WBN B;  5C44 G;  3R23 A;  3T1H H;  4I4T A;  1KJJ A;  3CEB A;  3ABK C;  4E6N A;  1EN6 A;  3N2K A;  4ZHQ A;  5GON A;  4PBC A;  3MFI A;  4B3T B;  2BSK A;  5FNV B;  3TQT A;  5KFR A;  5KG4 A;  1ZQ7 A;  4RUA A;  4EYH B;  4OX9 B;  2IA6 A;  4ABM A;  4O4H F;  1L2Z A;  2PN1 A;  1RSO A;  5B3S C;  2WYO A;  3D36 C;  5K1X A;  5KG3 A;  1I50 A;  4B3T H;  4I9Q A;  4HYO A;  4CE5 A;  4MA5 A;  4QIW A;  4OPA A;  2UVU A;  4CS4 A;  2QEX V;  1ZUQ A;  3IJ4 A;  2ASJ A;  4LNU A;  3E22 B;  2FK1 A;  3BAA A;  2R84 A;  5EK0 A;  3W7U A;  2XD4 A;  2JGD A;  4QNH B;  2QKS A;  4WBN A;  2RGV A;  2W71 A;  2DJV A;  3QFF A;  1CQI B;  5KFE A;  3C90 A;  1YSC A;  4MTX A;  3ZHS A;  4A3D G;  3N2G B;  3GVM A;  2QTO A;  5ITZ B;  3RYC B;  2FB5 A;  4N21 A;  1Z5V A;  1O9H A;  2ZNI A;  2KKW A;  3U11 A;  2JA5 G;  2HIV A;  2PVP A;  4LF7 O;  2E5L O;  4ECT A;  5FNV A;  4HZ3 A;  4F6R B;  2UXC O;  4MV8 A;  4MSW C;  3N6R A;  1BCC H;  3H20 A;  3QVN A;  3TQ1 A;  3HXL A;  4MVU A;  3E8B A;  2AW9 A;  5DQH A;  3H3V H;  5KFA A;  4DRX B;  4G28 B;  1VQ6 V;  5B1O A;  3JAK B;  1GM9 A;  1IBK O;  4PA6 A;  3AW8 A;  5C93 A;  4M9U A;  5KFG A;  2LGW A;  2W6P A;  4ICG A;  5IP9 G;  4NYK A;  1Q82 W;  2UVR A;  1H2L A;  1SQV H;  3AG2 C;  3E22 A;  4GC7 A;  1K34 A;  2CTW A;  2UXB B;  1EUD B;  3WB2 A;  2NVX A;  3HR0 A;  2HJW A;  3P30 A;  3I4N G;  2RDC A;  1DF5 A;  1GSA A;  2PUS A;  5BYB A;  3LDE A;  2DOS A;  3N2G A;  3OEH G;  4H44 B;  3FB7 C;  5JWP A;  3KCY A;  2Q6A A;  4O2B B;  3PJS K;  2QWO B;  1Z2O X;  1C30 A;  2ITC C;  4BIZ A;  4DR4 B;  1WB7 A;  2CFM A;  3CVZ A;  2YDE A;  2JGU A;  1YDX A;  2VQF B;  5JVD B;  2UXB H;  2M05 A;  4L87 A;  3CRC A;  5EWG A;  2VA3 A;  1QBZ A;  4MW3 A;  1FFX B;  2UUA B;  3SYO A;  2W6Z A;  4DRX A;  3OD4 A;  2R86 A;  5LHH A;  5LOV F;  2B63 A;  2I8C A;  3CS5 A;  1AI5 A;  4MVM A;  4DR4 H;  2AU0 A;  2GQS A;  3APQ A;  4MVQ A;  4QPK A;  2J9G A;  1AJN A;  2JVD A;  3BJY A;  1US6 A;  1E4G T;  4Q45 A;  2UUA H;  3UKM A;  2ZDI C;  2V59 A;  1I5Y A;  4NZM A;  4JV1 A;  1FVI A;  4YP3 A;  3WU2 Z;  4PJ0 Z;  4O2B A;  4B3S B;  3P3N A;  1AP5 A;  5F9N A;  3RW0 A;  1BHA A;  4DV7 O;  5LA6 B;  1BL8 A;  4FFM A;  2COJ A;  4TVI A;  3MHH C;  4LMY A;  5JVD A;  4K6N A;  2JS3 A;  4ASU G;  4B3R O;  1FFX A;  4JI7 H;  3L72 H;  2ASD A;  4FE2 A;  1MZB A;  3CC7 V;  1V4Y A;  1I1K A;  3G4S V;  4B3S H;  2R9A A;  1TWG A;  2OH2 A;  3SI8 A;  4LFB B;  2LP7 A;  1BJT A;  3G6X A;  1KMI Z;  1Y76 B;  1THZ A;  3V6H A;  5CMU A;  5IJ9 A;  4BW9 A;  5IYZ F;  3WWH A;  1W0K G;  3G8D A;  3AG4 C;  1N34 O;  1AJQ A;  4IWX A;  3V4Z A;  3FX7 A;  1GTO A;  5C1P A;  4LFB H;  3FKI A;  4ZI7 B;  2NU7 B;  4O3Q A;  5LA6 A;  3V6J A;  4FFN A;  1IDS A;  3GQC A;  3KZI Z;  1QQC A;  5CB4 B;  4A3J G;  3TCU A;  4ZIB A;  4O3O A;  2VR1 A;  5KT6 A;  4X62 B;  3I12 A;  5CM0 A;  4JI0 B;  4DV2 B;  4OX9 O;  3LML A;  3I5D A;  1QCE A;  2R93 A;  2W70 A;  3T9B A;  4XBF A;  3K79 A;  2XHB A;  4PA7 A;  4JYA B;  2B1G A;  1Y67 A;  4ECS A;  1K1S A;  2YYA A;  4DRF A;  4J9N A;  2GSM B;  2QDO A;  4DR2 O;  2Q69 A;  1M1K W;  1Y76 A;  1K5Q A;  3CYO A;  2UU9 H;  4X62 H;  1Y1V G;  3RAQ A;  4GCZ A;  4JI0 H;  1IBL B;  4HAM A;  1B06 A;  4DV2 H;  2ZCE A;  3SPI A;  3S24 A;  5HV6 A;  3ABU A;  2R8J A;  1SA0 B;  1R6T A;  4JYA H;  3CCQ V;  3VOT A;  3TY9 A;  2QKC A;  3MWD A;  1TUB B;  4ZI7 A;  2YEV A;  3OMI B;  2DMX A;  1P84 F;  2ZDQ A;  4DR5 B;  5J2T F;  1K33 A;  5CB4 A;  5LGN A;  3ZMS A;  3T7A A;  3JAL A;  1R6N A;  4H37 A;  3GIK A;  1MNG A;  2YIA A;  4HNA B;  4JI1 H;  3GTL A;  4MAM A;  2Y0S E;  1SZT A;  4UFZ A;  2W6N A;  1D5A A;  5EBW C;  4UXN A;  3ZHT A;  2BQ3 A;  4JAU A;  1I6U A;  4DR5 H;  5B1A B;  3MR2 A;  3N27 A;  5DGI A;  5FLX N;  3A0R A;  4JI8 B;  3T4Z A;  4JV0 A;  2DAB A;  2XAJ A;  1UJW B;  2HHF B;  3BQ0 A;  4JI4 H;  1OCZ B;  3WWI A;  1YHQ V;  4EQ5 A;  1V55 B;  1WNS A;  4FM2 A;  3MR5 A;  4GX1 A;  4DQN A;  2FLL A;  1Q43 A;  3D3I A;  1XBL A;  1WP7 A;  4DR7 B;  1N33 B;  2R8H A;  1IOV A;  3JAT A;  1AI7 A;  4HNA A;  4FM0 A;  1WPB A;  3U10 A;  4J0M A;  2YI9 A;  3JZ6 A;  1XNR B;  3VQV A;  5FD5 A;  3G8C A;  3Q8S B;  4UB8 Z;  1MAB G;  4PD4 F;  5FR9 A;  1M4U A;  3VBB A;  1P4R A;  4DR7 H;  4FLY A;  1XEQ A;  2FE3 A;  2IJK A;  3W7T A;  5L3E A;  4CMD A;  2P5O A;  5KKN B;  2FKX A;  1T3N A;  1H2S B;  5L3F A;  2HHF A;  4O7V A;  2IBK A;  5JH7 B;  3G6E V;  1XNR H;  1SQF A;  3OE7 G;  1K5S A;  2XND G;  1GN6 A;  4JI6 H;  3OTF A;  1XNQ H;  2JS5 A;  4A3M G;  1QVG U;  1Q7Y W;  3K0D A;  2Y4R A;  4O7R A;  3ZRX A;  2A9H A;  1VBH A;  5KFB A;  3DAA A;  4ED6 A;  2BTQ B;  1PNK A;  4M0J A;  1CS0 A;  4FIP C;  2N74 A;  3H4B A;  4O2A B;  3GLK A;  2UXX A;  4LFA O;  4GYC B;  5BMV A;  3E35 A;  5JJJ B;  1SCU B;  4FLU A;  4GX2 A;  4TQF A;  5LXT F;  1XMQ H;  4X1K B;  2MCT A;  4EYI B;  5JH7 A;  3H01 A;  2RQ6 A;  1WR2 A;  4QIW E;  5E1A C;  1A9X A;  3N41 B;  1KJI A;  2CK3 G;  5LL6 Y;  1GO3 E;  4GKJ O;  3WB0 A;  1KTA A;  4PI0 A;  2YZM A;  5A9G A;  3J80 W;  5C1O A;  4CKC A;  1G1X B;  1ZLZ A;  1AR4 A;  4CHI A;  5KA6 A;  4B08 A;  2BTQ A;  3R5F A;  3JSL A;  1YJW V;  2UVW A;  1YIT V;  4PDV A;  4RZR A;  4J9M A;  4H13 B;  4MTF A;  2B9Z A;  2HVK C;  4X64 O;  3K9S A;  2ETN A;  4ECU A;  3OSP A;  3CCR V;  1R3I C;  4O2A A;  4DL4 A;  5EIB D;  3JCU Z;  2PYJ A;  4DR6 B;  3CP1 A;  4UCT A;  4PZ8 A;  4R7C A;  3VQX A;  1XI1 A;  4KHP B;  3U55 A;  4IT5 A;  4JI3 B;  2QSA A;  4X1K A;  3HT5 A;  4NTY A;  1F23 A;  4HYK A;  2PI4 A;  1VKZ A;  5IE9 A;  1K97 A;  2X6C A;  2NVY A;  4TQR A;  3TII A;  1Q6I A;  4ZBM A;  4K8X A;  4JI5 O;  4X66 B;  4DR6 H;  5DMX A;  5JQG F;  4LF5 B;  4A2A A;  4WD3 A;  3G6V A;  4QGP A;  5JQG B;  4H33 A;  2P06 A;  4DUZ B;  5KFO A;  4KHP H;  3OUU A;  4JI3 H;  3H1L H;  4YIP A;  1LNQ A;  4YQW A;  1ZX3 A;  4LF9 B;  3PN1 A;  2PF4 E;  4RUE A;  1CKO A;  4A3B G;  2DLN A;  4X66 H;  1QNM A;  1VF6 A;  2YS7 A;  3ASN B;  1DF4 A;  4WFA V;  5EIB C;  4JI8 O;  3K58 A;  3L70 H;  4MVS A;  1SQP H;  2HJD A;  3HB9 A;  4WF9 V;  2JA7 A;  5KX5 A;  1KBL A;  2ODT X;  3KYH C;  3CXC U;  4UUG A;  3K08 A;  3SJQ C;  5CA1 B;  3JRW A;  3ZED A;  1ENV A;  2YIB D;  2EIN B;  3SYA A;  1GN2 A;  1RP3 B;  4YHH B;  4RAI A;  4Q43 A;  4X8A A;  4BIU A;  2EIM B;  3VOU A;  2ITD C;  3SYP A;  4LF8 B;  2IH1 C;  1ORQ C;  1N33 O;  5IDJ A;  2M6Y A;  2VQE O;  1FJG B;  2W6I G;  2YS6 A;  4Z2W A;  3ETD A;  3ASN C;  4DV6 B;  3QNE A;  5D1P A;  4DR1 H;  2C28 A;  1ZSP A;  2XGQ A;  2OTJ V;  2OCC B;  2HJF C;  2LJ2 A;  3JAW B;  2WB1 A;  4LF8 H;  1WH2 A;  2F1M A;  3EFF K;  2XCP A;  4IIJ B;  5DLG A;  2JA6 G;  4NZO A;  3MJF A;  1ZET A;  4DV1 O;  1A32 A;  1AI4 A;  4DV6 H;  5LYJ F;  5LP6 F;  2R85 A;  2WAQ E;  4HNV A;  4ZOL F;  5CA1 A;  1HDJ A;  2ATK C;  5LYJ B;  1FFT B;  3Q4H B;  1WCM A;  4JYY A;  1VBG A;  2FLN A;  3AK2 A;  4UCO A;  2AGP A;  3ZRW B;  3JZI A;  3ETE A;  3ZRS A;  4E2L A;  2OCC C;  4LCU C;  4B3M O;  5KFQ A;  1M93 A;  3P32 A;  2UUB B;  1X9N A;  3PW0 A;  3T1Y O;  1FYJ A;  1ULZ A;  1TWF A;  3A8T A;  3ML0 A;  1HWY A;  2ZT9 B;  3AX6 A;  5KFC A;  3RT3 C;  5KT7 A;  3RAX A;  3ZMT A;  1ZL8 B;  5LP6 C;  5KFJ A;  4IIJ A;  3GIQ A;  4ED8 A;  3NBY B;  5I47 A;  1LR1 A;  5I60 A;  1ARO P;  4J11 A;  4QPJ A;  1CPY A;  5B66 Z;  4J7K A;  2ADQ B;  3LNN A;  1O9G A;  1Z5W A;  2ZXW C;  2WLN A;  1H2G A;  4YJ2 F;  4O4L B;  1XL6 A;  3L74 H;  3TY5 A;  4TSF G;  1NQT A;  3ZMU A;  2X6B A;  5FLX W;  1OJH A;  2RMK B;  4OXS A;  1NTK H;  3DF7 A;  1NT2 B;  1IUR A;  2IMW P;  1IBM O;  2ZE5 A;  3EYY A;  1FXH A;  1D5N A;  2YIC A;  4DW1 A;  3CCS V;  4DV3 B;  3WWJ A;  3SYC A;  4IWY A;  1Q6U A;  1RPO A;  3OR6 C;  2V4Q A;  2FMA A;  4HNT A;  4JI2 B;  2SCU B;  1A0G A;  1SC5 B;  1PV0 A;  2CH7 A;  3CCU V;  1JR9 A;  1ZL8 A;  4DXW A;  2QKA A;  4GKK B;  3ETQ A;  3OW2 U;  2H94 A;  1NBM G;  3QWU A;  2YS8 A;  2QM4 A;  1EZJ A;  2UXD B;  5KS8 A;  1HW7 A;  4DV3 H;  4GZR B;  5H80 A;  3CMA V;  1H8E G;  3NC0 B;  4YJ3 F;  4EG0 A;  2FK3 A;  5DIS C;  4YJ3 B;  1I94 O;  4MA0 A;  1N0N A;  4BAY A;  1JPX A;  4O4L A;  3T1C A;  3GTQ A;  2ADP A;  4MV6 A;  1XDC A;  2YL2 A;  4JAV A;  4LF5 O;  4ECV A;  2KG7 B;  4TV9 F;  2E74 B;  4DUZ O;  5KG7 A;  3E83 A;  1SZX A;  4U7C A;  4K0K O;  3CQZ A;  3OUF A;  3QTC A;  4JZG A;  1EUC B;  3FFQ A;  1LUW A;  4LF9 O;  3JZF A;  3KAL A;  1SF9 A;  1WPX A;  2HGX A;  3M8A A;  3T4D A;  3JD3 A;  1IBK H;  3ZIA G;  5EBM C;  3CCV V;  1VS0 A;  5DAA A;  2ZM6 O;  4PWQ A;  1KBH A;  2DZD A;  2CGO A;  2UUC B;  4I5S A;  1VQO V;  3ZMV A;  4O7S A;  4I4T F;  3OHA A;  3WG7 C;  3LQS A;  3CRM A;  3G80 A;  4ZHQ F;  1OCO B;  5GON F;  3DSQ A;  4FBU A;  2Q2U A;  4LWS B;  3N2K B;  4B7K A;  2R92 G;  3A0B Z;  4W4K A;  4YHH O;  5BWT A;  1WA8 A;  1KYO F;  4LF4 B;  3UCS C;  3G6B A;  2KG7 A;  5KHI A;  3ZHQ A;  5CA0 A;  1Y4M A;  4KUM A;  2GLT A;  3BAB A;  1BT8 A;  1Q5O A;  4IGG A;  1G2W A;  4HQ6 A;  2W7P A;  4EGQ A;  2YWV A;  3MAQ A;  4QIW F;  1JXL A;  3ZN0 A;  1PK8 A;  2ODM A;  3H1I H;  5LMN B;  1AUV A;  2P4K A;  2AQ4 A;  4TQS A;  4FMT A;  4HNU A;  2N04 A;  1EKF A;  4J41 A;  4WBN F;  4DL5 A;  3ZX6 A;  3KAJ A;  2JGD B;  1P7B A;  4O7W A;  2YCH A;  1P7G A;  1SES A;  4BBS G;  2P6J A;  1R3K C;  2XAS A;  4FLX A;  4DUY H;  2XAF A;  2ARH A;  4LWS A;  1HR0 O;  2GDS A;  4RCN A;  5KG6 A;  3OTO B;  2R8G A;  5FNV F;  4MTD A;  1R9T A;  5LMN H;  5CE8 A;  5DGB A;  1A3G A;  4XDJ A;  3L4K A;  1V54 B;  2UUB O;  1CKM A;  3KXY T;  5LMU B;  4Q4C A;  2HEP A;  4B3R H;  2ILM A;  5CBH A;  1CQJ B;  2VUM A;  3QZ8 A;  4FFR A;  4QWE A;  3OTO H;  1XHZ A;  4YY3 B;  3LDC A;  2B63 G;  3RV3 A;  5IWA O;  4X65 O;  2Y69 B;  4RUF A;  5LMU H;  4DL6 A;  2R92 A;  2YXH A;  4RUC A;  1NJI W;  4XDL A;  3ZHR A;  3U0Z A;  1WJZ A;  3RJ0 A;  1M57 B;  1X59 A;  4YY3 H;  2AZ0 A;  1M90 W;  1ET0 A;  3N43 B;  4NXN O;  2OIG A;  2NR5 A;  4TQD A;  1SRY A;  2CDY A;  2Z5U A;  3JCZ A;  2IP4 A;  2YRW A;  1D2D A;  2ZDH A;  4MVR A;  4F4Z A;  2Y0I A;  4BXX G;  4DL2 A;  3HBL A;  4JI2 O;  4CKB A;  1NTM H;  3QQM A;  4IHJ B;  1SYX B;  5I5Y A;  1XIL A;  1R3L C;  4F6E A;  3J80 N;  1KJQ A;  2HGW A;  1JJ2 U;  4GKK O;  2FB9 A;  1VQ8 V;  1S3J A;  4JXU A;  4ED7 A;  2RDJ A;  1OZ0 A;  2Y4T A;  1AN7 A;  3VQY A;  2QM8 A;  2Y4U A;  4NR1 A;  2OYQ A;  3GB7 C;  2UXD O;  1MMM A;  4RB0 A;  2N05 A;  5JCO A;  4O2B F;  1IZ3 A;  4LF6 O;  2R87 A;  2HHH O;  5EZY A;  5D5Q A;  5JVD F;  4UCS A;  5IT9 N;  2R7Z G;  5IYC O;  1WSC A;  4GC6 A;  2YID A;  1JLL B;  3FKI G;  1FKA H;  4IL6 Z;  3OGC C;  4O83 A;  1VEW A;  1HNZ O;  3I55 V;  3CME V;  1YEW A;  4MTO A;  4ZQI A;  1W0J G;  2CKZ B;  2Z02 A;  2R7N A;  1Q90 D;  4IHJ A;  2R93 G;  2JJ1 G;  3TET A;  2H3O A;  1C3O A;  2Q67 A;  1NZ6 A;  1MSW D;  2F66 C;  2R82 A;  1U97 A;  4DV5 B;  4I7Z B;  3H1K H;  1HNW O;  5IJ9 B;  3T9A A;  2WB1 E;  4JI7 B;  1VQ7 V;  5I5V A;  4QWD A;  3JD0 A;  2WTF A;  1S0N A;  1J95 A;  3B8N A;  5LA6 F;  1J5E O;  5BWU A;  1I1M A;  3V4S A;  2K1E A;  3PW7 A;  1DAA A;  1HNX B;  1W93 A;  3FMA A;  3B09 A;  4LF4 O;  2GTA A;  4DV5 H;  4Q8F A;  5KFM A;  4AIL C;  2JEG A;  1R6K A;  5DG7 A;  1YVW A;  4J80 A;  2A0L A;  3CCM V;  1N32 B;  1GSO A;  1IYE A;  3GTO A;  3CSX A;  1DLB A;  5GTH Z;  4PZ7 A;  1KP3 A;  1CE8 A;  3TIG A;  1EBO A;  3T1H O;  3IC7 A;  1KB9 F;  3HOV G;  2XT9 A;  3W7X A;  1HNX H;  2NN4 A;  1OCR B;  4NVP A;  4NXM H;  1X4T A;  3ZRV A;  1G4Y B;  1G6U A;  1N32 H;  1H2N A; 
#chains in the Genus database with same CATH homology
 3HKD A;  4EFB A;  2F93 B;  3IG0 A;  4O2A B;  1ZAU A;  1I7F A;  3HKB A;  4GYC B;  5BMV A;  4RB1 A;  3RYI A;  4TUY B;  1N34 B;  5JJJ B;  3JAR B;  4CH3 A;  4FLZ A;  1TAE A;  4FLU A;  4TQF A;  3TY8 A;  2YIB A;  3JAL B;  2UU9 B;  1XMO H;  1XMQ H;  4X1K B;  2MCT A;  4O4I A;  1HR0 H;  5JH7 A;  4JV5 B;  2RQ6 A;  5J2U A;  3SJA C;  4LH6 A;  3K3V A;  3JAW A;  5FPR A;  4FLW A;  3N41 B;  3M7M X;  4PI2 A;  3BA8 A;  3L4J A;  5IWA B;  3WB0 A;  4D7S A;  4PI0 A;  3K5N A;  3J80 W;  1N34 H;  4X65 B;  1TVK A;  2UUB H;  5EYP A;  3RR5 A;  2CW7 A;  5EZY B;  4B08 A;  2BTQ A;  4O4H B;  3JSL A;  4U3J B;  5LYJ A;  1SKV A;  2QJ1 A;  5LP6 A;  4GLX A;  4JV5 H;  4ZOL A;  4JI1 B;  1E4F T;  4DR2 B;  3JSN A;  5KMG A;  2HVR A;  3SGI A;  4O2A A;  5LL6 b;  5IWA H;  4RAZ A;  4YJ2 B;  5EIB D;  4OX9 H;  4NXN B;  4TUY A;  4X65 H;  2PYJ A;  4DR6 B;  1XQ8 A;  3JAR A;  4UCT A;  2VUG A;  4PZ8 A;  3HKC B;  2IM9 A;  4FLV A;  1SEI A;  2VPS A;  1JMK C;  3VQX A;  1XI1 A;  4KHP B;  3RFR A;  5JCO C;  4JI3 B;  1S5J A;  4X1K A;  3RIZ A;  3JAT B;  5C8Y B;  1L8D A;  4DK1 A;  4DR2 H;  3K5O A;  4IAJ A;  1ZHQ A;  4JI4 B;  3WB1 A;  4K8X A;  4NXN H;  3N42 B;  4X66 B;  2OWO A;  1ZHS A;  4DR6 H;  4MV7 A;  2VWK A;  1P8L A;  1Q3E A;  2EX3 A;  4LF5 B;  4A2A A;  4KHP H;  5JQG B;  3RYH A;  4DUZ B;  4O4H A;  4JI3 H;  4U3J A;  4FFB B;  4LF6 B;  2ZJT A;  4JI2 H;  2HHH B;  4LF9 B;  3PN1 A;  1M0W A;  3QG5 A;  4DR3 B;  1BGW A;  3K57 A;  1CKO A;  4GKK H;  4DK0 A;  2V4D A;  4PHZ A;  4YJ2 A;  4X66 H;  3GJX B;  2UXD H;  3HKC A;  1HNZ B;  4I7H A;  2GV9 A;  5EIB C;  4LFC H;  4TV9 B;  3K58 A;  3CHX A;  4PZ6 A;  5ITZ A;  1XK5 A;  3RYC A;  5C8Y A;  4AQY B;  4LF6 H;  5KX5 A;  2HHH H;  4DR3 H;  3KYH C;  4RZQ A;  3JAS A;  5CA1 B;  3ZED A;  4UCU A;  2YIB D;  4F6R A;  2PY5 A;  3BHP A;  3RWR D;  2ZIN A;  4YHH B;  2Q7G A;  1HNZ H;  3BRC A;  4LF8 B;  3MWM A;  4CC5 A;  1HNW B;  5BMV B;  3UT5 B;  4JI6 B;  3JAK A;  1XNQ B;  4FFB A;  4AQY H;  1FJG B;  4YJ3 A;  3SJB C;  4DV6 B;  4I4T B;  1TGO A;  5LOV B;  4RB3 C;  4NXM B;  5D1P A;  2YXL A;  1J5E B;  3JAM W;  1P49 A;  4ZHQ B;  4DR1 H;  2VQF H;  5GON B;  4O4I B;  4O4J B;  4CS3 A;  4UCR A;  3JAW B;  2UUC H;  3VQW A;  4LF8 H;  3BA9 A;  1WH2 A;  2F1M A;  1HNW H;  1WN7 A;  4L8J A;  4IIJ B;  2HIX A;  5EYP B;  2Q0A A;  1P16 A;  2HVS A;  4DV6 H;  3T1H B;  2W57 A;  2ZIO A;  5CA1 A;  3UQ8 A;  5LYJ B;  1XMO B;  1XMQ B;  4LH7 A;  3RGZ A;  4LF4 H;  1M5I A;  4UCO A;  1Q8I A;  1JJO A;  4CC6 A;  4LNU B;  3UT5 A;  2R72 A;  4EFE A;  3N44 B;  5K1P A;  1M93 A;  2UUB B;  1X9N A;  2WDT A;  4WBN B;  3T1H H;  4I4T A;  5LOV A;  4LFA B;  4E6N A;  3N2K A;  4ZHQ A;  2Q7H A;  5GON A;  4LSA A;  3W1G A;  4O4J A;  4B3T B;  5IJ0 A;  1Z2N X;  2P22 C;  5FNV B;  2F4V B;  5LP6 C;  1JFF B;  4IIJ A;  4OX9 B;  2Q7E A;  5IYZ B;  4FLT A;  4EB6 B;  3NBY B;  4CH4 A;  1L2Z A;  3BPZ A;  1QHT A;  1RSO A;  4GKJ B;  2WYO A;  4LFA H;  3RYH B;  5K1X A;  2RGR A;  3LNN A;  4X1I A;  1O9G A;  1Z5W A;  3L2P A;  5KMG B;  4B3T H;  4I9Q A;  1B04 A;  5KHG A;  4O4L B;  4CS4 A;  2F4V H;  3TY5 A;  4FM1 A;  4LNU A;  3E22 B;  2VWJ A;  3BAA A;  5FLX W;  3DF7 A;  3RTX A;  1NT2 B;  5IT9 W;  4X64 B;  4WBN A;  5FPO A;  1S68 A;  2RGV A;  3EYY A;  4I50 B;  5KHK A;  4GKJ H;  4D7T A;  4DV3 B;  3N2G B;  1GYF A;  5ITZ B;  3RYC B;  4TOI A;  1Z5V A;  1O9H A;  5KX5 B;  4JI2 B;  2ZNI A;  2KKW A;  3U11 A;  2HIV A;  3JAS B;  5FNV A;  2YI8 A;  4F6R B;  1JFF A;  4GKK B;  3ETQ A;  5BR8 B;  5IYZ A;  3QWU A;  3H20 A;  4EB6 A;  2QM4 A;  4X64 H;  3HXL A;  2UXD B;  1HW7 A;  4DV3 H;  4DRX B;  4LFC B;  3NC0 B;  3JAK B;  4JI5 B;  3ICX A;  4X20 A;  4CH6 A;  5DIS C;  4YJ3 B;  5J2T B;  2PTM A;  4O4L A;  4MTE A;  1IBL H;  3E22 A;  5D5P A;  5BR8 H;  2UXB B;  3WB2 A;  2HGS A;  4Q0Y A;  4I50 A;  4LR3 A;  2PUS A;  3N2G A;  4JI5 H;  3J7A K;  3QTC A;  3FFQ A;  4M7E A;  4O2B B;  5A2Q W;  1Z2O X;  3W1B A;  3KAL A;  4CS2 A;  4DR4 B;  1IBK H;  3J81 W;  1VS0 A;  4DR1 B;  2CFM A;  2JGU A;  2VQF B;  3CVZ A;  3CB2 A;  5JVD B;  2UXB H;  2E3C A;  1SA0 A;  1SQG A;  2UUC B;  3W5O A;  3RF2 A;  4UCV A;  1FFX B;  2UUA B;  4FVM A;  1TUB A;  4DRX A;  4PDB A;  4JI8 H;  3DSQ A;  4DR4 H;  2Q2U A;  5J2T A;  3N2K B;  3SR2 C;  3K59 A;  2VQE B;  4LF4 B;  2BTO A;  3M4I A;  5IJ0 B;  2O03 A;  2JVD A;  1N36 B;  1E4G T;  4K8Z A;  2UUA H;  5KHI A;  5CA0 A;  2F95 B;  4CH5 A;  1FVI A;  1A0I A;  4O2B A;  3BAB A;  1Q5O A;  4B3S B;  4X1Y B;  1N33 H;  4RB2 C;  5LA6 B;  3MAQ A;  4DV1 B;  2VQE H;  4X1I B;  4LMY A;  5JVD A;  1DGS A;  5LMN B;  1N36 H;  1FFX A;  4R7R A;  4JI7 H;  4DV0 B;  1CKN B;  4DV4 B;  1MZB A;  4AHC A;  3KAJ A;  3RYF B;  2YCH A;  4B3S H;  3VNN A;  2R9A A;  4HBN A;  4FLX A;  4LFB B;  4DUY H;  1BJT A;  4B3M B;  4DV1 H;  4MV9 A;  1KMI Z;  3OTO B;  3GDE A;  3T1Y B;  4MTD A;  5LMN H;  5IJ9 A;  4BW9 A;  3L4K A;  4DV0 H;  1CKM A;  4DV4 H;  3KXY T;  5LMU B;  2HEP A;  3IAY A;  3K5L A;  4B3R H;  4Q6G A;  2VOB A;  4X1Y A;  4LFB H;  4ZI7 B;  5LA6 A;  4B3M H;  3OTO H;  4X20 B;  1QQC A;  4YY3 B;  1XHZ A;  5CB4 B;  3T1Y H;  1TA8 A;  2XIG A;  4ZIB A;  2PYL A;  1XHX A;  4X62 B;  5LXT B;  4JI0 B;  4DV2 B;  3LML A;  1CKN A;  5LMU H;  3RYF A;  2XHB A;  3B2E E;  3GB8 B;  4JYA B;  4APM A;  3U0Z A;  4DRF A;  1M0T A;  3RJ0 A;  3SJC C;  4LSX A;  3THO A;  4YY3 H;  1IBM B;  4FM9 A;  1XDN A;  2UU9 H;  3RGB A;  4X62 H;  5JJE B;  3N43 B;  4JI0 H;  1IBL B;  4DV2 H;  1VF7 A;  2ZCE A;  3S24 A;  4TQD A;  1SA0 B;  4KL1 A;  2HVQ A;  4LF7 B;  3C0F B;  2E5L B;  4JYA H;  3F8N A;  3TY9 A;  2UXC B;  1TUB B;  4ZI7 A;  1IBM H;  4DR5 B;  1V9P A;  4IHJ B;  5CB4 A;  1SYX B;  3JAL A;  2PZS A;  3A2F A;  5LXT A;  1IBK B;  4JI1 H;  2YIA A;  4HNA B;  2KSW A;  1AN7 A;  3VQY A;  1I94 B;  4UFZ A;  4BWA A;  2OYQ A;  4LF7 H;  4RB0 A;  2E5L H;  3RGX A;  2UXC H;  1D5A A;  4RAY A;  5JCO A;  5JJN B;  2R70 A;  5CA0 B;  1I6U A;  5EZY A;  4DR5 H;  5KHJ A;  5D5Q A;  4JI8 B;  4K0K B;  4UCS A;  4EEQ A;  1I94 H;  1FKA H;  3ZS8 C;  4JI4 H;  3K5M A;  1YEW A;  3N6X A;  2CW8 A;  4EQ5 A;  1WNS A;  4FM2 A;  2ZM6 B;  2PGG A;  4LF5 H;  1O75 A;  1Q43 A;  3NBZ B;  5KHH A;  4DUZ H;  4IHJ A;  4K0K H;  3QF7 A;  4DR7 B;  2ZNJ A;  1N33 B;  1T5E A;  3JAT A;  4I55 B;  4ETS A;  3HKE B;  2F66 C;  4HNA A;  5D1O B;  4LF9 H;  4FM0 A;  1WPB A;  3U10 A;  3KAK A;  2YI9 A;  4J0M A;  4DV5 B;  4TV8 B;  4BWS C;  5IJ9 B;  1XNR B;  3VQV A;  1S03 G;  2ZM6 H;  4JI7 B;  5FD5 A;  3HKD B;  3HKB B;  5JQG A;  1M4U A;  3RYI B;  4DR7 H;  1HNX B;  4DUY B;  4FLY A;  3FMA A;  2FE3 A;  2Q2T A;  2P5O A;  1KU9 A;  4DV5 H;  1H2S B;  2WE6 A;  4DV7 B;  5JH7 B;  4AIL C;  5FD6 A;  1XNR H;  4YHH H;  5J2U B;  1N32 B;  3CSX A;  4PZ7 A;  1SQF A;  4A2B A;  4TV9 A;  4B3R B;  3OTF A;  4JI6 H;  1XNQ H;  2JS5 A;  1HNX H;  1TVK B;  1FJG H;  2RJZ A;  4I55 A;  3HKE A;  5D1O A;  4NVP A;  1Z2P X;  1X4T A;  4NXM H;  1J5E H;  2BTQ B;  4TV8 A;  3N40 P;  5LP6 B;  5EOY A;  2CAZ C;  1HR0 B;  4DV7 H;  4ZOL B;  2ZIM A;  1G6U A;  1N32 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...