4UCOA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucoA02
3VNNA 3BA9A 4DUYB 3JSLA 4LH6A 4JI1B 4DV6B 4PZ8A 2CFMA 5LMNB 4JI2B 4E6NA 4DR3B 4LFAB 2E5LB 1N33B 1B04A 1TA8A 4UCTA 4JI7B 4DV0B 1XMQB 3QWUA 1XK5A 5LMUB 4K0KB 2HHHB 5D1PA 4DV1B 5DISC 1P8LA 4PZ6A 1CKNA 3RR5A 1N32B 3GJXB 3T1YB 1N36B 5IWAB 4X62B 2UXCB 4B3SB 4GKJB 3UQ8A 3KYHC 5D1OB 4EFEA 4PZ7A 4CC5A 1P16A 5D1OA 4YHHB 4JI8B 1VS0A 5FPRA 4JI0B 3NBZB 1J5EB 4AQYB 2Q2TA 2UXDB 2Q2UA 1ZAUA 4UCRA 2UXBB 4EEQA 5FPOA 1XNQB 4LH7A 3S24A 4DV7B 2OWOA 3W5OA 4GLXA 1CKMA 2VQEB 3TY8A 3TY9A 4JV5B 3TY5A 2VUGA 4DV4B 4JI3B 4DV3B 4DRFA 1IBLB 4DV2B 4X64B 1HNWB 3GDEA 3BA8A 4JI5B 1N34B 4B3TB 4DR2B 4LF4B 4EQ5A 4LF7B 4DR1B 4YY3B 2HIXA 4TOIA 1I94B 3NBYB 3W1GA 3RTXA 1HNXB 4DUZB 1FVIA 3NC0B 1IBKB 3OTOB 4DV5B 4NXNB 4CC6A 1TAEA 4LF9B 4EFBA 1V9PA 1XMOB 4NXMB 4GKKB 2HIVA 3SGIA 3BABA 2F4VB 3T1HB 2UUBB 2HVRA 4X66B 3JSNA 1X9NA 4UCVA 4DR6B 1CKOA 4DR4B 4JI6B 4UCOA 1XNRB 4UCSA 4DR7B 2UUAB 4LF8B 1XDNA 1DGSA 3BAAA 2UU9B 3L2PA 4B3MB 4LF5B 2HVQA 2HVSA 1A0IA 4JYAB 1HNZB 5BR8B 1FJGB 2UUCB 4JI4B 4X65B 4KHPB 1CKNB 3PN1A 4LF6B 3GB8B 4DR5B 4B3RB 4LFCB 2VQFB 4UCUA 1IBMB 4OX9B 4LFBB 4UFZA 1S68A 3W1BA 2ZM6B 1HR0B
chains in the Genus database with same CATH superfamily
5BY1A 5FNVF 2WLMA 3N40P 3JSLA 2R8IA 4O4IA 3SE7A 3B09A 3OW2U 5KT2A 4TWKA 1KT8A 2BE3A 1GN6A 4B7KA 1PV0A 4LMYA 2HKOA 2P22C 2A7WA 3APQA 2GV9A 5H2FZ 2R7NA 4DK1A 2ADQB 3G6BA 3RGZA 4J9KA 1CKNA 1ZQ7A 3GQCA 5CA3A 1I1MA 1XEQA 2KKWA 1WA8A 2WLNA 1WP7A 1TWHA 1M93A 1M90W 3H1KH 4RNOA 2Q7GA 4GCZA 4O4HB 2YIAA 1P16A 1QVGU 2CTQA 1JDBB 2E3CA 4CMFA 2V4DA 3WB0A 1B33N 3AG2B 5DM6V 4AQYB 3M9OB 2Q2TA 2IH1C 5FNVB 3ABKB 4RQEA 2XC9A 4KHPO 3CCRV 2EJ2A 3AK2A 3JAWA 3B4SA 4NB5A 2OWOA 3N2GB 3AW8A 4O4IF 2QB5A 4G2KA 4K0KH 3G71V 1S5HC 3AG2C 2A1HA 2ZM6O 1C30A 2CGNA 4DV3B 4LP8A 4L8JA 3G80A 2FK1A 4LWSA 3QO7A 1G2WA 4I9QA 3ZIAG 2YZGA 2YRWA 1ZLZA 3G8CA 1N33O 2AHYA 5DLGA 3AG1B 5KHJA 4DUZB 1VEWA 5LYJA 1WH2A 3JASB 4HZ3A 1EHIA 4DV5B 4NLGA 3K5HA 3QTCA 3QO5A 1W93A 2JJ2G 4FZ1A 3CWBH 4ICGA 3QFFA 2JJ1G 2FLNA 1ULZA 4Q8EA 2NVXA 3IFXA 2W9CB 2AGOA 1CP9A 2FTKA 5LHIA 5FLXW 3RYCB 3K06A 5HV6A 4O4IB 3Q8PB 3QVNA 4MVOA 2R7ZG 4TSFG 4FLTA 4X64H 5IJ9A 1E4EA 1SCUB 4UCSA 2V59A 1A32A 3KG2A 3RIZA 4TUYA 2CAZC 3V4SA 5I5WA 4LR3A 3NR7A 3L72H 1CPYA 4CHIA 1CKNB 2R92A 5GONA 4PV1B 3FMAA 2R8KA 1WA8B 5L3DA 4K35A 3ZX6A 5KUMA 3STZC 1NS1A 2ALZA 1NVPD 1N34O 4CH3A 4U3FH 2GQRA 1P4RA 1N0NA 4FK5C 1HR0B 4LF7O 5LYJF 4J9PA 1AVMA 1D5AA 4RAZA 1GO3E 5KX5A 4KL1A 3LULA 2HFEC 4J9OA 3JAWB 2VS0A 3H1LH 5KFRA 3MFIA 1XMQB 1IXMA 4GKKO 3L71H 2F4VO 2UUCH 4X65H 5LMUH 2VRZA 3E86A 1N32B 4QWCA 3T1YH 2W0FC 5H6RA 4TUYF 4FLVA 4TQRA 2XOKG 4LWSB 1RM1C 1XNRO 4I50F 3SNOA 4O82A 5GONF 4A3IG 3HKDA 1RYRA 1F4NA 1I5YA 4JI0B 3RV4A 5JQGF 2ZT9B 5LYJB 2QF7A 2AZ2A 4A93G 1EKVA 2Q0AA 3ASNC 3ZMUA 5KHIA 1DF4A 3TIGA 4UUGA 4KUMA 2VQEH 4CMDA 4JZ2A 3Q2OA 3TY5A 1BT8A 4JYCA 2LQTA 5IJ9B 3Q8RB 1IBLH 4A3CG 3E8HA 1E4EB 3O65A 4FZ0A 3GDEA 1MG1A 3UYYA 3KXYT 4TUYB 3A2FA 1B6RA 3HB3B 3KHLA 1S0MA 1GN4A 3GTQA 2W6QA 5K1PA 5GONB 1M5IA 1XOUA 4DV1O 2RDCA 5JQGB 1XNQH 3RB0A 1S10A 4WFAV 1A48A 3UFXB 2IMWP 4EFBA 2JK5C 2NLJC 2X0LA 4FFRA 2AU0A 3ABMC 3HOYG 3KCYA 1B6QA 1OCCC 2Q73A 3W7TA 4ED7A 5EIBC 1BQZA 2ZE8A 2JEGA 4O7SA 4F4WA 3ZHRA 3WB1A 1J5EO 4YJ3A 1FS0G 5KFQA 2BQUA 3ABUA 3K5NA 3HKZE 3MWMA 1MSWD 2IU3A 1HP8A 4BIZA 1MSDA 1IBKH 1JJ2U 2PZSA 2Q4PA 1FJGH 1GN3A 4JV5O 5CA0A 2WLHA 3P32A 4FFKA 3CD6V 3OUZA 3ZMSA 3J80N 4U7OA 1VQNV 4R7CA 4WFBV 3I12A 2Y0SE 5KFLA 1VQ6V 1PNKA 2Y4TA 2OTLV 2R72A 3HKDB 4JAVA 1QLNA 3JYCA 1WJZA 5HFMA 4YY3O 3OTFA 4MVQA 4HNVA 2VPSA 3UM7A 2UXDO 1SF9A 1K97A 2A06H 4LFAB 3RVYA 3ZS8C 2UU9H 2JRIA 3CCJV 3UT5A 2JA6G 1XBLA 4MTXA 2E2HA 4K0KB 4YJ3F 2DQ3A 3JALA 2W6MA 3MD0A 4DR5H 4X66O 3RR5A 3ZHVA 2XAJA 2QKSA 2VUMG 2QGNA 3KZIZ 1QU7A 1OCRB 1EN6A 1S9FA 3IC7A 3WG7C 2UUAO 4O86A 4YXWG 2YS7A 2K9PA 4JI8B 3KCXA 3JATA 5CA0F 4ED1A 4DYLA 4B3MO 4BBSG 2RDJA 4IYIA 2NU6B 3JRWA 5CR5A 3MR3A 3N6RA 2PBZA 4DV7B 2DPIA 1S72V 1PNMA 1K5SA 3CHXA 3OFNG 3E2EA 2NN4A 3E89A 3L4KA 4UVAA 4IRCA 1GRJA 1DTOA 2V4RA 2B1GA 4ECWA 5EC1C 3DTFA 3ZBHA 1K83A 5KG2A 4YJ3B 4X64B 2ATLA 3GTGA 4UUJC 3VQXA 5GTIZ 4GKJH 3KHGA 3FKSG 4Z1VA 1YEWA 3PR4A 5EZYA 2ZDIC 4JUZA 3N44B 2JA7A 5CA0B 5DQIA 5ITZA 4F4YA 3JZFA 4DL5A 4FLWA 3FYIB 3V4ZA 1H2GA 2HVRA 2P90A 2NU7B 2D2CB 4K6NA 3H01A 4UCVA 1AB3A 4Q4CA 4AQYO 3T9AA 1HNWH 4LF4H 1M57B 2N74A 3T1CA 4DR7B 4M7EA 2EIJC 4JI6H 4JV0A 1K73W 3UT5B 4DR1H 3TETA 1SETA 5E1AC 1BMFG 2XASA 2JS3A 2N05A 4QW9A 2UVUA 5DQGA 5I5VA 3JALB 3OHAA 3T7AA 4QIWA 2UUCB 4X65B 4JI4H 2YWVA 1G8MA 1M57C 3ZRVA 3SYCA 3ZN0A 1IBMB 3WNZA 2ZGIA 2GTAA 4FS1A 3DTGA 5KG0A 4UFZA 5KHKA 3ZHQA 5EZYF 3PVXA 1AI6A 4APMA 4FJCC 1YVWA 3VA7A 3JATB 1AUXA 2RGRA 2VA2A 1ZWIC 4JI1B 1ZL8A 4ETSA 1M4UA 1NKDA 4DUZO 3L75H 1B06A 2ODMA 2BR0A 5J2TA 4DV5O 5KFCA 2CZGA 2GPWA 4ZIBA 3K79A 2HJFC 3F8NA 5EWFA 5C44G 1Z2PX 4DV0H 5L1KA 4JYAH 1M7JA 3FKIG 4O3OA 5KG7A 1JLLB 1M1KW 4O7TA 4I9WA 5KFWA 4DAAA 5LXTA 2AGPA 3AYHB 2YXYA 1OV9A 2F66C 4RAYA 4QIWF 4UXNA 1EZVH 2R93G 3PW2A 5FPRA 1EYZA 3WWHA 2EJ3A 5EZYB 4M0JA 4ZBMA 2E76B 5ITZB 4FVMA 4J9ZB 1K8AW 3H4DA 2F95B 2Y69B 4J11A 1MABG 1XNQB 4RNNA 4LH7A 4GLWA 2YXLA 3OGIB 4NZOA 1LUWA 2EIMB 1K4DC 3K5MA 1S76D 2W7PA 5KG5A 2KQXA 1HR0O 5E25A 5FR9A 5J2TF 4JI3B 1V51A 3CCLV 5IWAH 1NR1A 4X62H 4HNAA 1BSMA 1AI4A 4J9QA 4X9QA 1FYJA 1DK1A 1AN7A 1I7FA 3M4IA 1L0NH 1S5JA 1S97A 1I1KA 1I94B 1N56A 1NH2D 1XMQO 5IYBO 1UC8A 1ZETA 1XHZA 1IBKB 5LXTF 1P84F 2YI8A 2GSMB 2QM7A 3ETGA 1FFTB 2Q68A 1N32O 3RN4A 1I7LA 5KFVA 4PA6A 4J80A 3RYFA 3OGCC 5F2VO 3GTJA 3PJSK 2JA5A 5FJ8G 1JQ0A 1ZL8B 4JI0O 3CE2A 2RGVA 4A3GG 4PDVA 3A0RA 4GX1A 5J2TB 4AYBA 3JZIA 3RB4A 1RK5A 4J9MA 5KFIA 3V6KA 3U0ZA 1SKVA 3HR0A 4MW8A 2UU9B 2YL2A 2FPGB 4HN2A 5CM0A 5H80A 1E79G 2Q67A 2R86A 3OUSA 4PJ0Z 3M9NB 3K3VA 3IN5A 5LP6F 3PN1A 4DR5B 2PI4A 4B3RH 4L1KA 4LFCH 4MA5A 5L3FA 5LXTB 3RAXA 4FM1A 2PUSA 2I8CA 4EKWA 1J95A 2RN9A 2OTJV 2FB9A 2PMZE 3WO1A 3U55A 4TT3G 4DR6H 3A8TA 1OBGA 2YCHA 5KFAA 4ECTA 5LMNB 4UVBA 3BQ2A 5JJJB 2E5LB 3E22A 1SZTA 1BGYH 5IYDG 4WFGA 1N36B 2VQFH 4HNAB 1ZHQA 4U6PA 4CH5A 1EFRG 4IAJA 3T2MA 2UXCH 4GX0A 5LP6B 2HG8A 4GKJB 3OR6C 2B5UA 5EWGA 1L0LH 4FM9A 4YHHB 4ECXA 5KA5A 1VS0A 5CAEB 5KT6A 2HJDA 4ECUA 5J9PC 3K9AA 2ZKOA 4ED0A 2Q2UA 5EWEA 1IX9A 5LP6C 4ZQIA 3K0DA 4EEQA 3CX5F 3T54A 3RYFB 3MHHC 4QW8A 1KKCA 1M0WA 2J6UA 5BWXA 4Q0YA 3TY8A 2W9AA 2HHHH 1T94A 1H2MA 4EBEA 1R6KA 5EIBD 2XD4A 5B1AB 4DRFA 5IE9A 4FLXA 1R73A 4DR4O 1HNWB 5DQHA 4P30A 4LF4B 5KT3A 2W7OA 4B3TB 4FU0A 5DGIA 4IHJA 3T9DA 4DR1B 4F6EA 3TQ1A 1NI8A 4LFAO 3HKCA 4MTDA 1K4CC 5B1AC 3I55V 4K0KO 4PDMA 1TAEA 3SYOA 1IZ3A 5B5EZ 2IJKA 2HDKA 1FKAH 4JTDB 1IYEA 4CS4A 4NXMB 1IVSA 1AJQA 1CEZA 2WA3A 4DRXA 5DECA 3Q1KA 4H13B 4QWDA 3J80W 3VPDA 2UUBH 4RWUA 4JI8O 3NXSA 1PD3A 2ASLA 4ED8A 3DAAA 5DEDA 2PN1A 1SFOA 5AG2A 4PA9A 3OM3B 1WN7A 4O4HA 4Y8VB 5DG9A 4XX0B 1XI1A 4DV7O 4RO2A 2A9HA 4G27B 4PELA 3AX6A 3E22B 3CMEV 2YZNA 4JYAB 2BOCC 5BPHA 4JF3A 4JYBA 2QWQB 5BR8B 1HNZH 4FM0A 1CE8A 3GTKA 3I4NG 3CEBA 2W8KA 4EYHB 4K8XA 4JYYA 1VQ8V 2FP4B 5JVDA 2FYUH 2ZR2A 4DUYB 3GIMA 1GYFA 4LH6A 3RAQA 3EYYA 1DLBA 1TWAA 4QJFA 2IBZH 3GWKC 4FFNA 2CQYA 1EUCB 2PF4E 2UXBO 1QVFU 2DZDA 1X4TA 4DR3H 1SQGA 3F5TA 4H37A 1TA8A 4LF5H 1GO3F 5I5TA 2YDEA 1VQMV 2HGXA 3CQZA 1Q6UA 2ABJA 2X0SA 3T9CA 4A3MG 1XK5A 3JD2A 1Z5WA 4PDLA 5KFYA 1COWG 5IWAB 1Q81W 1AR1B 4X62B 3HO8A 1S0NA 4PI2A 1BCCH 1SQFA 3IJ4A 4IHJB 3EHBB 4O84A 4DR7O 3HKCB 2XGPA 1W0KG 1TWFA 1I50A 2V9WA 1B3QA 1JA8A 1QNMA 2UUCO 4X65O 2ZDHA 3CSXA 4DXWA 1VQLV 5JVDF 3TIIA 1IBMO 4AHCA 3MJFA 4TV9A 4DRXB 1K7DA 4DO2A 3HBLA 2K1EA 1N4CA 2M7WA 1NU1H 1MA1A 3PR5B 3MWDA 5BWRA 1KB9F 1URFA 4JI1O 3CSWA 3BCCH 2OCCB 3T99A 2R8GA 4B3SH 1LUVA 2FB5A 4DR2B 3HKZA 5IYBG 1BJTA 1WCMA 3AG4B 1K34A 4X89A 4FFPA 4UV9A 2RQ6A 5FD6A 2OCCC 3OTOH 3AG3C 3EPIA 2AGQA 2BQRA 1AR4A 3D3QA 4DK0A 3H3VH 3U54A 2WLJA 1M0TA 2COJA 1YZBA 2EIYA 3KHRA 3AG4C 2Y0SA 3R5FA 5JVDB 1Q6IA 1XDCA 2DPJA 4JZGA 2FPIB 1ZX3A 5LOVA 1CS0A 3T1HH 1R3LC 2R7LA 2DOSA 1EM1A 4QJFB 4DR6B 4MVRA 3S3WA 1KBLA 4XDKA 5LL6Y 4TV9F 4IWXA 3MR6A 4JV2A 3HKEB 2FK2A 3STLC 1XNQO 1VF5B 2ZDGA 1KJJA 1A0IA 2R8JA 2JEUA 3HKBA 1VQ5V 4HYOA 4Q45A 2RF4A 1KECA 4J9LA 4JI3O 3L70H 1VIBA 4PHZA 2I87A 2VQFB 4X20A 4QWAA 2DWEC 3LDCA 1AUVA 1NH2B 1K3EA 4UB8Z 2KG7A 3SYAA 1I94O 2P67A 4DV6B 4YR2A 4U3JA 4IL6Z 1O75A 3PZPA 5LHHA 1IBKO 2R8HA 4X1YA 1Q3EA 4NKGB 5CBGA 3KALA 1YI2V 5LOVF 3IAYA 5EDWA 4TV9B 3VBBA 1KKDA 3TJTA 3ZHUA 5DG7A 1SESA 4I50A 1Y76A 5LA6A 2R82A 5KFOA 4JI7H 2WLKA 2HHHB 2FL4A 5JVLA 2R7MA 5K1XA 1P8LA 1DV1A 4MVZA 5JQGA 3HOVG 2IP4A 5IYCG 1VF7A 2IJHA 1H38A 3AEIA 2ZE5A 5KS8A 1G4YB 3RFRA 1L8DA 2HR3A 2UU9O 3HOXG 5C8YA 2CUGA 2QSAA 5L1LA 3CEIA 1PP9H 5J2UA 1BL8A 1YSCA 2P4KA 2F43G 2R7ZA 4DR5O 3H4BA 3CCQV 4BWSC 1O9GA 1RM1B 4OXSA 4AI8A 3RBEA 2EJRA 3K08A 3OMIB 2JS5A 3JAMN 5KFGA 5LOVB 2C2RA 1XUQA 4HNUA 3RBDA 2ITCC 4GX5A 4YJ2F 5BYAA 3O9OA 1JOYA 4DV2H 2X7RB 5KFSA 1NTZH 5DN6G 5LA6F 4YR0A 4LC1A 5LMNO 3CCVV 3ASNB 3CVZA 3H1IH 1Q82W 1KQSU 2E5LO 5FLMG 4I55F 4JV1A 1I2KA 4EBDA 3NBYB 3GB7C 3ABLC 3HKBB 3NGDA 4O7VA 4O4JA 2AZ0A 1I6UA 4NXNB 3CB2A 3WO0A 3A0HZ 4X20B 2YSUB 4WCEV 1N36O 1S77D 4NZNA 5C8YF 3H0GG 5KFZA 1FXKA 4O2AA 5J2UF 2EBOA 1VQOV 4GKJO 2W9BA 3T9FA 2GTSA 2KG7B 4ZKIA 4YHHO 4MTGA 4OPAA 4U3JB 2COGA 2IA6A 2EIKB 1CKOA 4CE5A 3K5IA 4RUAA 1TUEB 4X1YB 4FS2A 5JQWA 3WFVA 1VF6C 4J7KA 4I50B 1Y76B 5LA6B 3ABMB 3SJQC 3IC9A 4LF5B 2XIGA 1OCCB 2EIKC 5KFNA 1GGOA 3KAJA 4KHPH 5L1IA 2HGWA 1HNWO 4XYLB 2WLIA 4LF4O 3FFQA 1K1QA 4B3TO 3H1HH 2Q0OC 2QKCA 4O4JF 3CXHF 5C8YB 1YDXA 4DR1O 2H3OA 5BYBA 1VMGA 5J2UB 3LDDA 2W57A 1H8EG 2ZDIA 1R3KC 3T9BA 4CKCA 1RPOA 4O2AF 3MHSC 4F4LA 4O7LA 2B9ZA 3VQVA 2XT9A 1N33H 4JGSA 1AJPA 5LL6b 1SERA 4UCTA 3JZ6A 2WAQE 2QYZA 4NXMO 3GVMA 1P7GA 4GX2A 5C93A 1KUTA 4Q8FA 5HNEA 2VWKA 3M7MX 4J7ZA 3ZRWA 4MV8A 4R8UA 2OH2A 4OX9H 1IYDA 3N2KA 2Q69A 5LGNA 4B3SB 1BZKA 4LBEC 1GMGA 1KP2A 1U96A 1PPJH 5KFBA 3SJCC 1ZHSA 4JYAO 5BR8O 4O4JB 1K1SA 3GIIA 2ZIMA 4A3BG 3CP1A 2XCPA 4JI2H 3UKMA 5L3CA 3CC4V 1FXKB 2YXHA 4O2AB 3W5OA 3WG7B 2NVYA 1Y66A 2BSKB 2W9BB 5F9LA 2ZJTA 1QBZA 2NR5A 2Q7HA 2XUMA 2VUGA 3HXLA 4DUYO 4NZMA 3BJYA 1DAAA 2RNBA 4XZ3B 1FXKC 3LMLA 3ZJZA 1D5NA 4LF7H 1GKFA 1JR9A 3CCUV 3SYPA 4CKEA 2EINB 2Y4UA 5D8DA 4NTWA 4PA7A 2AGAA 2DYSC 1CQJB 2FKXA 3TXQA 2WWWA 2ZE6A 4O2BA 4X62O 1VQ9V 4G28B 1VBGA 3TCUA 2WLIB 3RJ0A 3W7XA 2EINC 2F4VH 3V6HA 5IP9G 2JA6A 4RB3C 4QPKA 2PMZA 2HVKC 2R9IA 5KFUA 1JX9A 4I0XA 3DXRA 1XDNA 1AILA 1XNRH 2E2IA 2QM8A 4J42A 3RF2A 3PO3G 5IDJA 1F7YA 1I08A 2QKAA 4GT1A 1LR1A 1WPBA 2Q6AA 2Q9LA 2Q8VA 4KP4A 1HNXH 5C4XG 5JJEB 2JGDA 2V58A 3QNEA 3PW5A 4P9OA 3GV5B 3ZRWB 2HGSA 1P49A 3AK3A 4R8UB 2CH7A 3N2KB 3RVZA 4JTAB 5B3SC 1XMOH 1AROP 2EIJB 3GLKA 3OSNA 3GV7B 5CA1A 5CB4A 1S68A 4MW3A 2WPDG 3CC7V 4DR2O 4GC7A 3A0BZ 3T4DA 3VNNA 3R9RA 2XAFA 1OZ0A 2V7QG 4BBRG 1NBMG 3U9SA 5LHGA 3BPZA 4O2BF 3MFHA 2MW2B 1S0OA 5A9GA 4LF8H 3SPHA 2B63A 4XDLA 1Z2GA 4DL3A 3GTPA 4FPPA 2LFSA 4X8AA 4ZI7A 5LMUB 4BIOA 1Y67A 1F23A 4DV1H 4DV3O 4LF6H 3T1YB 2WDTA 3VPCA 1V54B 4HQ6A 4DR6O 1XL4A 2OIEA 4RUFA 2VOBA 1QQCA 1PK8A 4ED6A 3FB5C 3CPWU 3SR2C 1AP6A 1TGOA 2QJ1A 1V54C 3P3NA 2JEJA 3ETJA 5CA1F 1R1BA 1WLEA 1G6UA 5CB4F 4ECRA 4DL7A 2JEFA 4O2BB 5FPOA 4H33A 4A3FG 2BCCH 2VQFO 4QWEA 1XILA 1YXBA 4GYCB 1R6NA 2VQEB 2ASDA 1WPXA 1L1FA 4C5CA 3QZ8A 1JFFA 4JV5H 3LNMB 4I0XB 5DGAA 3BVOA 3N43B 1IBLB 5C5JA 3GTMA 4DV6O 1ORQC 1VAJA 2YICA 3DXRB 2EZPA 4ZI7F 3BA8A 2YC0A 5BPFA 4J10A 2WA4A 1SC5B 4ME6A 4LSXA 2WLLA 3RTXA 3TK1A 2JGDB 4FM2A 3ETQA 4J41A 1FD9A 1SQBH 1SQVH 2UXDH 4JXUA 5LBQA 2HHHO 1KTAA 4MV1A 1JKJB 2CH7B 3ZN1A 2R9AA 3DC6A 4O4LF 3GIKA 1DF5A 1YHQV 2VQDA 5CA1B 5CB4B 1NJIW 3SGIA 4QE9A 4U7CA 3RWRD 4DV4H 4A3EG 2Q5ZA 4ASUG 5IT9N 4DL4A 4W4KA 1B6SA 3FKIA 5KT7A 5JUMA 5LP6A 3MAQA 1H2LA 3LWBA 5E79Z 2OLSA 1KC8W 1MNGA 1FKAO 2JA5G 4ZI7B 4B3MH 2HVQA 1SYXB 2HVSA 4YAJB 1FJGB 3FX7A 3GB8B 4BIUA 4OX9B 2IW5A 1UFIA 5BWUA 2ZXWB 2XAQA 2R70A 1I1LA 4IWYA 4A2AA 3W1BA 2Y0PA 1Y1WA 4O4LB 4ZHQA 2R87A 2PI5A 2XCAA 3JD3A 2CNVA 3WB2A 2HVJC 1PKXA 1NZ6A 4BY7G 4PZ8A 2ZXWC 3Q4HA 2ASJA 2PYLA 4JI2B 3T5HA 3K5LA 4NXNO 4E6NA 3ZHTA 1C3OA 2R6FA 3CRQA 2NU9B 4HR7A 2DMXA 3J7AK 1QLEC 3UZBA 4Z1MG 1Z2NX 1GK9A 3QWUA 1YTFB 4FMTA 1JFFB 5JCOC 4IYHA 3CRRA 4WBNA 1EZ1A 2V1DA 2LW1A 3JAMW 4LFBH 4CH6A 3SJBC 4RUEA 3T5JA 2L35A 3KYHC 3PW4A 4DL2A 1K92A 1MOFA 2XAGA 4EB6A 2WLLB 2ARHA 1BHAA 3RT3C 5D1OA 3RUPA 4O3PA 4EEYA 2C35B 4QWBA 2D3OW 1X59A 4LF5O 4YIOA 1KJ8A 3C90A 2P4VA 3VOTA 4E2LA 2ZIOA 3X2QB 1DIKA 4BY1G 4UCRA 1TVKA 2EJ7A 4ZHQF 2HG5C 4A3LG 1WB8A 4G3IA 2R9RB 3MDSA 4A3DG 1R3IC 1VKZA 2XCLA 2P0AA 5BWVA 3X2QC 1CXZB 4BXXG 2YU9A 5FD5A 5L3GA 3I56V 3HOUG 3UCSC 3ABTA 4A3JG 4FIPC 1JMKC 4WBNF 1HNXB 1Y14B 2W6ZA 3VMMA 4NTYA 5KFKA 4QSHA 2HHFA 4DV5H 4GZRB 4CBCA 4Q43A 5KAFZ 4PDRA 1XMOB 2HIVA 2BQ3A 4B3SO 4ZHQB 3FYEB 4I5SA 2XNDG 3SJAC 4ABMA 1YJWV 1T5EA 5JH7A 4O83A 3Q4HB 4FBTA 3JAKA 4BW9A 1ZSPA 4JI6B 4JI5H 3CC2V 4LF8B 4MTEA 1DGSA 1EN5A 2YIBD 5HFLA 5IJ0A 4FLUA 2CTRA 2JVDA 1FPOA 3EXAA 4I7ZB 3AK1A 1SS3A 4WBNB 4JI4B 4LF6B 1PL4A 1YJ9V 1OJHA 2KSWA 2QM4A 1GAXA 2IH3C 2WB1E 3APOA 5GW7A 4EB6B 3PW0A 5D1OB 5KFDA 1Z2OX 1HR0H 4M9UA 3G6EV 2VA3A 1O9HA 2QWOB 1QHTA 1V55B 4Q44A 1TVKB 2JDIG 3K3WA 4FGRA 3RV3A 4RCNA 5CE8A 1B04A 1TUBA 1UC9A 2C28A 1GH6A 2R85A 4DV0B 1E1RG 3T5LA 3D36A 3BACA 5JH7F 2YUAA 1V55C 4UVCA 5A2QN 2N04A 1D2DA 2YW2A 4IZOA 1WSCA 5KMGA 2W6PA 1A9XA 1IXBA 4ECVA 4X64O 3UO2A 4YAKB 4WFEA 1Y1VG 4EFEA 1F51A 3GIPA 2W6JG 1SA0A 4LNUA 4E4EA 4R7RA 1I7NA 5IY5C 4MT8A 4JI0H 1QCEA 1IOWA 5I47A 4ECYA 2W70A 3FB6C 2UXDB 2HHFB 1ZAUA 1THZA 2LGQA 4HNTA 3HKEA 3SDLA 1WRVA 5DGHA 1CKMA 3E8GA 1RK6A 4NR1A 1YCIA 3OMAB 2R7KA 5L3BA 4DV4B 1N8RW 4BAYA 2DJVA 2DAAA 5JH7B 3CRMA 3JAKB 2KSDA 2Y0IA 3E8BA 2ZNJA 3H40A 1Q7YW 3JCUZ 1M56B 5IJ0B 3BFRA 2HIXA 1W2BU 3M9MB 3U9TA 4E4TA 5KUKA 1HWYA 5LMUO 5KG1A 3QZ7A 1M56C 3V6JA 3T1YO 4CZZA 4K8ZA 4JAUA 3GILA 1H8HG 2C2AA 4JPRA 2Z04A 1OCOB 3CYOA 1X9NA 3CMAV 5H6QA 3RYHA 3AG3B 1A0GA 4IIJA 2IU0A 1IURA 4AYBE 4RB1A 1TUBB 5DAAA 1OCOC 3C0FB 5JJNB 2P6JA 4RZQA 2WAQA 1S03G 2F93B 2VQEO 2O57A 4RB0A 4ECSA 2ZD9A 1ROPA 3M8AA 4H44B 5KMGB 4FLZA 4B3RB 5DMXA 4LFCB 2QWNB 4LF9H 3B40A 3FB8C 1IBLO 4LFBB 4WFHA 2DLNA 5KG4A 3RB6A 3D36C 5KT4A 4IR1A 1SA0B 3ICXA 2QWPB 3EVKA 4LNUB 4F50A 2JIZG 2RCVA 2UVRA 3ETEA 4YB8B 2BOBC 3CCEV 5C1OA 1XREA 3ORQA 4A2BA 4DR4H 4DW0A 3ORRA 3NUAA 3LDEA 3HT5A 3QQMA 4LFAH 1N0JA 3B77A 3SPJA 1JDEA 4IIJF 1M6VA 4MA0A 2ZNIA 2H94A 2CGOA 3SPIA 4O7YA 2AW9A 3ABKC 4C5AA 1XQ8A 1NTKH 1GN2A 1RP3B 4FE2A 5DGBA 2FK3A 2UXCB 2A3QA 3J81N 4TQSA 2DWDC 4PZ7A 1VF6A 2C00A 5DLFA 2I80A 2R92G 4JI8H 3JD4A 4O81A 3KKYA 1RJRA 1MZFA 3ZCCA 1S0VA 2E74B 1Q6HA 1FJGO 1ET0A 3AG7A 4ECQA 4U7NA 4YJ2A 5B66Z 4MV6A 4DV7H 2CTWA 4OX9O 3H1JH 3DGEA 2L6LA 4X1KA 4FFLA 3LUTB 5CMUA 1WB7A 4DQNA 3AG1C 4RAIA 4I55A 5F9NA 3G6XA 3K9SA 3P30A 3RYHB 4C5BA 4B08A 1UJWB 4J0MA 4IIJB 2EILB 5BWWA 2W6OA 4B7EA 5KFPA 5HBRB 4C2MA 4J9SA 4JI5B 2GUZA 2CW8A 3JRXA 4JI2O 2YIBA 5IT9W 3OT7A 2PY5A 4TOIA 1UNNC 3SPCA 3L9DA 4TQFA 1WAZA 2EILC 1V4YA 3W7UA 4WD3A 3ZMVA 1AP5A 1Y6XA 4I7HA 2UXBH 3E35A 3B2EE 5KKNB 1HW7A 4JTCB 3G6VA 3C3TA 1SQPH 2LW7A 2LJ2A 4XYMB 2UUBB 2ATKC 2AXTZ 1T36A 3ABLB 1I0HA 1PNLA 3DSQA 2QWRB 2ZE7A 4UB6Z 1KJQA 4UCOA 2W71A 4TQDA 4DR7H 3BAAA 3HB9A 2W0XA 1I2LA 2IJIA 2M05A 3ETDA 1HNZB 4EGQA 3SI8A 3WWJA 1Q86W 3N41B 2OYQA 3WU2Z 4FBUA 2BTOA 4O7ZA 3RYIA 1RJPA 1G1XB 1W0JG 3E8FA 1IBMH 5KA6A 1DV2A 5BXZA 2OCHA 4MVMA 2ZINA 2BSKA 3KHHA 2VPQA 5B1OA 1YTFD 5LGTA 1KJ9A 3WWIA 3BA9A 1KBHA 1GTOA 4R8CA 3LNNA 2X5RA 4JI1H 1HNXO 3JARA 2R84A 1L2ZA 3BQ0A 3CRAA 2DQ0A 5I5YA 4YJ2B 1VQ7V 2FLLA 3ZRXA 5B1NA 4DR3B 2CE4A 4X1KB 3ML0A 1XMOO 5KX5F 4I55B 1WP8A 4MVSA 3W7SA 4O3QA 1GSAA 5K2MA 5DG8A 5FL7G 3RW0A 3G67A 4IRDA 5I5UA 4CS2A 3ZMTA 2GUZB 4FFMA 3UQ8A 4JI6O 2XHBA 2ZDQA 4LF8O 5BWTA 2ZM6H 3N27A 4CC5A 3RGBA 3H0GA 2Z0AA 3NBZB 3FDSA 2DABA 3UZOA 1JVMA 1BQ0A 4JI4O 3VPBA 1I5XA 4CKBA 3U10A 5L1JA 3HPLC 4LF6O 2IBKA 4D6TH 2UVVA 4PDBA 4IGGA 5EBLC 1NQTA 3EPGA 1ZUQA 5KLVH 4JI3H 2J6TA 5KX5B 1BNCA 3CS5A 3VQYA 5KFMA 4EQ5A 4J9RA 4TVIA 3OEHG 1FFXA 1GM9A 1I94H 5K3WA 4Z2WA 1JJOA 3FD9A 4DV0O 1S3JA 3B8NA 3NC0B 3GTLA 1ENVA 3OTOB 1QR9A 3RYIB 2X6BA 5EOYA 3RB3A 4LF9B 4ED3A 1WR2A 1NTMH 1AJNA 3ZHSA 2C22A 2WYOA 3IG0A 2UXNA 3B8MA 2FE3A 3GIQA 3T1HB 1GM7A 5EC2C 3G8DA 4UV8A 2P06A 4PA3A 5KHHA 2WAMA 3JARB 1VARA 2DYSB 4DR4B 4EG0A 2LGWA 1N34H 4MVUA 4N21A 2DW4A 3SPGA 4MV4A 1PM9A 3L2PA 5EBMC 2FMLA 3PFFA 1W96A 4HAMA 1NT2B 5BMVA 1YITV 2HP8A 3TEKA 1M9NA 2GBOA 3K03A 4DV4O 3H9VA 4WHXA 4GC6A 5IWAO 2QK4A 5IYDO 1JCHA 4TV8A 3ZRSA 3K04A 4GKKH 5CBFA 3KTMA 5A2QW 1RSOA 3LSSA 3K5OA 2XGQA 1SQXH 4PD4F 3TINA 1KEEA 2JA7G 2OIGA 1TWGA 2Z02A 2Y4RA 1GSOA 2CFMA 2QR4A 3LSQA 2QTOA 1Y74A 5LMNH 1OCRC 3N6XA 2VUMA 5B3SB 2E5LH 1BGWA 1IDSA 4JI7B 2MCTA 2PYJA 3D3IA 3CRCA 2Q7EA 3D8CA 3BEHA 3OR7C 5H9CA 4EYIB 2ZCEA 1N36H 1IOVA 2B63G 5KG6A 2EZOA 2Y48A 4DIMA 3BG5A 2MK3A 1H2SB 2IJJA 4MV3A 2HEPA 1LNQA 5BMVF 1FFXB 1OWTA 1A3GA 3G4SV 4YHHH 2RJZA 4RU9A 2X6AA 1MZEA 5KHGA 3T4ZA 4TV8F 2FJZA 1P7BA 3OE7G 1GLVA 4X1IA 2UXBB 2A79B 1NR7A 3JD1A 4B3RO 2ZR3A 3R65A 4JAAA 4LFCO 3S24A 4LFBO 2DIKA 2V4QA 1WNSA 2CKZB 4D7SA 4W4LA 3H20A 2YI9A 5JWPA 5KFJA 3THOA 3CJHA 2QA4V 2UXXA 4PA4A 5C1PA 1AI5A 3F5WC 2EJ0A 3R23A 2JEXA 3T5KA 1MMMA 1YJNV 4DV2B 4RUCA 2JA8G 2CNQA 4OGQB 4B3TH 4O4LA 1UPGA 2CK3G 3KREA 5D5PA 3W1GA 2WTFA 1J5EH 1ZTEA 5I5SA 5BMVB 1PX2A 5JCOA 2YZLA 3FAVA 2VR1A 3BHPA 4EGJA 3RGXA 1BE3H 1VBHA 5IYZA 5B1BB 2QDOA 5TISZ 4TV8B 2CW7A 1V9PA 3R5XA 1RSOB 2UXCO 2WB1A 3FB7C 4NXMH 3BABA 4DLKA 1HDJA 2J9GA 1F4MA 4NTXA 3KAKA 5L9XA 5B1BC 3OSPA 1JPXA 3MR5A 4CH4A 2J6SA 4FLYA 2CDYA 1Y74B 3GTOA 2C2EA 1BXRA 2PGGA 1EZJA 4YY3H 2OT5A 2LO1A 3Q8QB 1OCZB 1GSHA 3OUUA 2RMKB 4KFMA 4X88A 1Z5VA 2PTMA 5BR8H 2EX3A 2ODTX 4KHPB 5FLXN 4F6RA 2AHZA 1RPRA 4P2ZA 3P3PA 4O3NA 5KG3A 1GM8A 4UCUA 1R9TA 3ETHA 4O7NA 2SCUB 1OCZC 3JCZA 4I4TA 4OPHA 2ZQMA 3LSUA 4JI5O 2NU8B 2ZM6B 4NYKA 1Q43A 4PWQA 4O3SA 4X66H 4CS3A 3QO8A 5CN0A 3BRCA 4DUYH 5IYZF 5GTHZ 3K57A 3J81W 2WE6A 2P5OA 1S5LZ 1TWCA 4X1IB 1KU9A 5BZBA 3TGUH 1K33A 3K59A 4FFBA 4Q4DA 1VQ4V 2UUAH 2ILMA 2NUAB 1N33B 1Y1WG 3K3PA 4A3KG 2IM9A 2XAHA 1KP3A 3PO2G 2LP7A 3OD4A 3CJHB 5EYPA 1NVPB 2COIA 3LQSA 3L74H 3M99B 5D1PA 4XDJA 4C7UA 4ED2A 3MR2A 2FLPA 2R93A 2A0LA 1KMIZ 2UUBO 4J9NA 4J7JA 1H2NA 2Y69C 3GJXB 3I5DA 4P9PA 4FFOA 2P7TC 1BHBA 4WFFA 4J9YB 5D5QA 2EIMC 1W59A 4KXRA 4QE7A 1QLEB 4MSWC 2G38A 2NNUA 3K0GA 1K5QA 2FMAA 1HNZO 3FAVB 4I4TF 4QGPA 2YYAA 1SQQH 5IYZB 1K9MW 3BY6A 3CCSV 3I4MG 2GDSA 3ASOB 4ECZA 2FKLA 1I3QA 2Z5UA 1E1QG 2LFRA 3OMNB 4GLXA 3HOZG 4XBFA 3TY9A 3VQWA 2V5AA 2QTSA 2JGUA 3ASOC 1KD1W 3R66A 1T3NA 2CNUA 3S3XA 1AR5A 3F7YC 4NYEA 1N34B 4MTFA 3ZEDA 4DR2H 4LF7B 2YEVA 1JXLA 4DR3O 1KYOF 3EFFK 2YS8A 4F4XA 1JX4A 2B1IA 4AQYH 4ZOLA 4PI0A 2YS6A 4F6RB 4CC6A 1Q5OA 1JIHA 3OAAG 3TQTA 3GIJA 3RFCA 4I4TB 1FXHA 5C3EG 4GKKB 4Q20A 2AQ4A 1H2KA 4MTOA 1VQPV 2F4VB 1EKFA 4LSAA 4BW5A 4DV3H 3LP8A 3DF7A 4IT5A 4RQFA 5KFTA 3TXSA 1OBDA 3G6YA 4DL6A 3CXCU 3GV8B 3IGAC 4FFBB 1XNRB 4DW1A 1U97A 1US6A 5KFHA 4R50A 1SZXA 4O7WA 4NVPA 4O7RA 2ITDC 4TM5A 2W6IG 5EYPB 2C2DA 2GPSA 4MAMA 4YR3A 3BQ1A 4DUZH 1FXVA 3L73H 3SYQA 4H0LB 2BTQA 5EK0A 1VQKV 5L3EA 2XTAA 1N48A 3E83A 3C3SA 2EULA 1RYSA 2QE7G 4LCUC 5KFEA 4ZOLF 5T14A 5IYCO 1AI7A 1PL0A 1YF2A 4QPJA 5IP7G 4MV9A 4N23A 4YP3A 3TW6A 4DV6H 4AILC 5CBHA 3Q8SB 3OTOO 1EKPA 2DN9A 1Q8IA 4LF9O 3RBZA 5LGUA 4RZRA 1FAFA 1KUQA 2UVWA 2FPPB 4MS2A 2HJWA 1MZBA 3OEEG 3K58A 4A5UB 4DV1B 4QIWE 5DISC 3T1HO 4PZ6A 1EN4A 1Q90D 2WSSG 2W6NA 4HYKA 3U0GA 4QNHB 1R3JC 4YBZB 2YEVB 4L87A 3L4JA 5EBWC 2YZMA 2GHYA 2F1MA 1R6TA 2YIDA 3F7VC 4BR6A 3T9EA 1KJIA 2O03A 4MV7A 1E4GT 4ZOLB 1J5EB 4WF9V 2Z3YA 1SRYA 3QG5A 1KC7A 3DC5A 1CQIB 2W8LA 2ETNA 3OUFA 5KT5A 2HLDG 3DTUB 1XMQH 4YQWA 3GIDA 4JV5B 5IY5B 1YIJV 2YRXA 2GLTA 4RB2C 1N32H 1E4FT 3QF7A 2X6CA 2E75B 1EUDB 3OHBA 4O3RA 3N42B 4R6ZA 4JASA 3TW7A 2F23A 3VOUA 4GUNA 4D7TA 4YY3B 4IRKA 4PBCA 4JI7O 1SEIA 1FVIA 2BTQB 1QR8A 3ZMZA 5FNVA 1XL6A 3CCMV 2RDIA 4EBCA 5I5XA 4NXNH 4HBNA 5H5NA 4IHJF 5KFFA 3N2GA 2DWCA 4YIPA 2M6YA 2H8PC 4X66B 2DYRB 3JSNA 3J7AU 2ADPA 3W7WA 1Y4MA 1OHHG 5I60A 2Q7DA 2DE0X 2UUAB 1EBOA 4Q6GA 3R5HA 2CTPA 4B3MB 3JD0A 5KAIZ 3GWOA 2DYRC 3N8DA 1Y1VA 4RNMA 2GQSA 2PVPA 1VP7A 2VWJA 5KFXA 3JASA 4K3AA 2KB1A 3MWEA 3PW7A 1RFYA 2QEXV 4O4HF 1XHXA 1RJQA 2JEIA 3UO3A 4DV2O 1WCMG 3HOWG 2W9CA 4BWAA 4F4ZA 1BS3A 4IR9A 3RYCA 3U11A 3E5NA
chains in the Genus database with same CATH topology
3VNNA 3BA9A 3N40P 3JSLA 3LNNA 4O4IA 4JI1H 3BPZA 4DR6H 3JARA 1L2ZA 2YCHA 5LMNB 4LF8H 4YJ2B 5JJJB 4DR3B 2E5LB 4LMYA 2P22C 4X1KB 4ZI7A 2GV9A 3E22A 4DK1A 4I55B 5LMUB 3RGZA 4DV1H 1CKNA 4LF6H 3T1YB 1N36B 2VQFH 4HNAB 1ZHQA 2KKWA 4CH5A 2WDTA 4IAJA 4CS2A 1M93A 5LP6B 2UXCH 4GKJB 3UQ8A 2Q7GA 2XHBA 2ZM6H 2VOBA 4O4HB 1QQCA 2YIAA 4CC5A 3RGBA 1P16A 4YHHB 4FM9A 1VS0A 3SR2C 3NBZB 2E3CA 1TGOA 2V4DA 3WB0A 2QJ1A 4AQYB 2Q2TA 2Q2UA 5FNVB 5LP6C 1G6UA 3U10A 4EEQA 3JAWA 4O2BB 5FPOA 3RYFB 2OWOA 3N2GB 4GYCB 4PDBA 2VQEB 1M0WA 4Q0YA 4K0KH 3TY8A 2HHHH 1JFFA 4JV5H 5EIBD 4DV3B 4JI3H 5KX5B 4DRFA 3N43B 1IBLB 4FLXA 1HNWB 4L8JA 3VQYA 3BA8A 4LF4B 4B3TB 4EQ5A 4IHJA 4I9QA 4DR1B 4LSXA 3HKCA 1FFXA 4MTDA 1I94H 3RTXA 1JJOA 5KHJA 4DUZB 3ETQA 4FM2A 3NC0B 3OTOB 5LYJA 2UXDH 1WH2A 3JASB 4DV5B 3RYIB 3QTCA 5EOYA 1TAEA 4LF9B 2R9AA 1FKAH 5CA1B 4CS4A 5CB4B 4NXMB 3SGIA 2WYOA 3IG0A 5FLXW 3RYCB 2FE3A 4DRXA 3T1HB 3RWRD 3J80W 2UUBH 4DV4H 4O4IB 5KHHA 3JARB 4FLTA 4X64H 4DR4B 5IJ9A 5LP6A 4UCSA 1N34H 3MAQA 1WN7A 4O4HA 3L2PA 3RIZA 4TUYA 1XI1A 2CAZC 4ZI7B 4B3MH 2HVQA 1SYXB 3E22B 4LR3A 2HVSA 4JYAB 5BR8B 1HNZH 1NT2B 4FM0A 1FJGB 5BMVA 1CKNB 5GONA 3GB8B 3FMAA 4K8XA 4OX9B 4TV8A 4GKKH 2R70A 5A2QW 1RSOA 3K5OA 4A2AA 3W1BA 4CH3A 5JVDA 4O4LB 1HR0B 4ZHQA 1D5AA 4RAZA 4DUYB 3WB2A 1GYFA 4LH6A 3EYYA 5KX5A 4KL1A 4PZ8A 2CFMA 2PYLA 4JI2B 3JAWB 5LMNH 3N6XA 3K5LA 4E6NA 1X4TA 4DR3H 1SQGA 2E5LH 1BGWA 1TA8A 4LF5H 3J7AK 4JI7B 1XMQB 2MCTA 2PYJA 1Z2NX 3QWUA 1XK5A 2Q7EA 1JFFB 2UUCH 5JCOC 4X65H 1Z5WA 5LMUH 4WBNA 1N32B 3T1YH 2ZCEA 1N36H 5IWAB 3JAMW 4X62B 4FLVA 4LFBH 4CH6A 4PI2A 3SJBC 1SQFA 4IHJB 3KYHC 1H2SB 4EB6A 2HEPA 3HKCB 1FFXB 5D1OA 3HKDA 4YHHH 2RJZA 4JI0B 5LYJB 5KHGA 2ZIOA 4X1IA 4UCRA 1TVKA 3CSXA 2UXBB 2Q0AA 3S24A 5KHIA 4AHCA 4TV9A 1WNSA 4DRXB 4D7SA 2VQEH 3H20A 2YI9A 3THOA 3TY5A 5FD5A 5IJ9B 4DV2B 1IBLH 4B3SH 3GDEA 4DR2B 4B3TH 3KXYT 4O4LA 3A2FA 4TUYB 1JMKC 1BJTA 5D5PA 3W1GA 1HNXB 1J5EH 5BMVB 2RQ6A 5FD6A 5K1PA 5JCOA 5GONB 3OTOH 1M5IA 3BHPA 3RGXA 4DV5H 5JQGB 5IYZA 4DK0A 1XNQH 4TV8B 1M0TA 4EFBA 2CW7A 1V9PA 1XMOB 2HIVA 4NXMH 5JVDB 3BABA 4ZHQB 5LOVA 3T1HH 5EIBC 3SJAC 3KAKA 1T5EA 4DR6B 4CH4A 3WB1A 5JH7A 4FLYA 3JAKA 4YJ3A 4BW9A 4JI6B 4JI5H 3HKEB 4LF8B 2PGGA 4MTEA 1DGSA 2YIBD 3K5NA 4FLUA 5IJ0A 4YY3H 3MWMA 2JVDA 1Z5VA 1A0IA 2PTMA 5BR8H 2EX3A 2PZSA 1IBKH 3HKBA 1FJGH 4WBNB 4JI4B 4KHPB 4F6RA 5CA0A 4LF6B 4PHZA 2KSWA 2VQFB 4UCUA 4X20A 2QM4A 4I4TA 4EB6B 2ZM6B 5D1OB 2R72A 3HKDB 1Q43A 4X66H 4CS3A 1Z2OX 1HR0H 3BRCA 3OTFA 4DUYH 3J81W 3K57A 1O9HA 4DV6B 2WE6A 2P5OA 1QHTA 4U3JA 2VPSA 1O75A 4X1IB 1KU9A 3K59A 1TVKB 4FFBA 2UUAH 4X1YA 1Q3EA 3KALA 4LFAB 3ZS8C 1N33B 2UU9H 1B04A 3UT5A 1TUBA 3IAYA 4TV9B 2IM9A 4DV0B 4JI7H 4I50A 5LA6A 5EYPA 5D1PA 4K0KB 2HHHB 3JALA 5K1XA 1KMIZ 1P8LA 4DR5H 3RR5A 5JQGA 3GJXB 5KMGA 1VF7A 5D5QA 3RFRA 4EFEA 1L8DA 1SA0A 4LNUA 4JI8B 4R7RA 3JATA 5C8YA 4JI0H 5J2UA 2UXDB 1ZAUA 5IYZB 3HKEA 4DV7B 4BWSC 1O9GA 4GLXA 1CKMA 3CHXA 2JS5A 3L4KA 5LOVB 3TY9A 3VQWA 4DV4B 2JGUA 5JH7B 3JAKB 4YJ3B 4X64B 4DV2H 2ZNJA 3VQXA 4GKJH 1N34B 3ZEDA 5IJ0B 3CVZA 4DR2H 4LF7B 2HIXA 3NBYB 1YEWA 5EZYA 3HKBB 3N44B 4ZOLA 4PI0A 4AQYH 4O4JA 4F6RB 5CA0B 5ITZA 1I6UA 4NXNB 4CC6A 1Q5OA 3CB2A 4X20B 4K8ZA 4I4TB 4GKKB 4O2AA 4FLWA 2F4VB 4LSAA 2HVRA 4DV3H 1X9NA 3DF7A 4U3JB 3RYHA 4UCVA 1CKOA 4IIJA 1HNWH 4FFBB 4X1YB 1XNRB 4LF4H 4DR7B 4JI6H 4M7EA 4RB1A 4DR1H 3UT5B 1TUBB 4NVPA 3C0FB 5JJNB 4LF5B 4I50B 5LA6B 2XIGA 5EYPB 4RZQA 1S03G 4DUZH 2F93B 3JALB 4RB0A 2UUCB 3KAJA 4X65B 2BTQA 4JI4H 4KHPH 4FLZA 5KMGB 4B3RB 4LF9H 4LFCB 1IBMB 4LFBB 4UFZA 5KHKA 3FFQA 4APMA 1SA0B 3ICXA 4LNUB 3JATB 5C8YB 2RGRA 4JI1B 5J2UB 2W57A 4MV9A 4ETSA 1M4UA 4DV6H 4A2BA 4DR4H 4AILC 5J2TA 3VQVA 4LFAH 1Q8IA 1N33H 4ZIBA 5LL6b 4UCTA 3F8NA 4JYAH 1Z2PX 4DV0H 1MZBA 2ZNIA 3K58A 4DV1B 5DISC 4PZ6A 2VWKA 3M7MX 1XQ8A 4OX9H 3N2KA 2UXCB 5LXTA 4B3SB 2F66C 4RAYA 4PZ7A 3L4JA 2F1MA 5FPRA 4JI8H 2O03A 4MV7A 5EZYB 1E4GT 4ZOLB 3SJCC 1J5EB 1ZHSA 4O4JB 5ITZB 2ZIMA 4FVMA 2F95B 3QG5A 4JI2H 4YJ2A 1XNQB 4LH7A 2YXLA 4DV7H 4O2AB 3W5OA 1XMQH 4X1KA 3K5MA 2ZJTA 4I55A 4JV5B 2VUGA 2Q7HA 4JI3B 4RB2C 3HXLA 1N32H 1E4FT 3RYHB 4J0MA 3QF7A 4B08A 5IWAH 4X62H 4IIJB 4HNAA 3N42B 3LMLA 4JI5B 4D7TA 1AN7A 2CW8A 5IT9W 2YIBA 1I7FA 3M4IA 2PY5A 4YY3B 1S5JA 4LF7H 4TOIA 1I94B 1SEIA 4TQFA 1FVIA 1XHZA 1IBKB 2BTQB 2YI8A 5FNVA 4I7HA 2UXBH 4NXNH 4HBNA 4O2BA 3B2EE 1HW7A 3RYFA 3N2GA 3RJ0A 2F4VH 2UUBB 4RB3C 4X66B 3JSNA 3DSQA 2RGVA 5J2TB 4UCOA 1XDNA 1XNRH 2UUAB 4TQDA 4DR7H 3U0ZA 1SKVA 3RF2A 4Q6GA 3BAAA 2UU9B 4B3MB 1WPBA 1HNXH 1HNZB 5JJEB 3N41B 3K3VA 2OYQA 2VWJA 3PN1A 3JASA 2BTOA 3RYIA 1P49A 4DR5B 2HGSA 4B3RH 1XHXA 3N2KB 5LXTB 1IBMH 4LFCH 1XMOH 4FM1A 2PUSA 2ZINA 5CA1A 4BWAA 5CB4A 1S68A 3RYCA 3U11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VNN A;  3BA9 A;  4DUY B;  3JSL A;  4LH6 A;  4JI1 B;  4DV6 B;  4PZ8 A;  2CFM A;  5LMN B;  4JI2 B;  4E6N A;  4DR3 B;  4LFA B;  2E5L B;  1N33 B;  1B04 A;  1TA8 A;  4UCT A;  4JI7 B;  4DV0 B;  1XMQ B;  3QWU A;  1XK5 A;  5LMU B;  4K0K B;  2HHH B;  5D1P A;  4DV1 B;  5DIS C;  1P8L A;  4PZ6 A;  1CKN A;  3RR5 A;  1N32 B;  3GJX B;  3T1Y B;  1N36 B;  5IWA B;  4X62 B;  2UXC B;  4B3S B;  4GKJ B;  3UQ8 A;  3KYH C;  5D1O B;  4EFE A;  4PZ7 A;  4CC5 A;  1P16 A;  5D1O A;  4YHH B;  4JI8 B;  1VS0 A;  5FPR A;  4JI0 B;  3NBZ B;  1J5E B;  4AQY B;  2Q2T A;  2UXD B;  2Q2U A;  1ZAU A;  4UCR A;  2UXB B;  4EEQ A;  5FPO A;  1XNQ B;  4LH7 A;  3S24 A;  4DV7 B;  2OWO A;  3W5O A;  4GLX A;  1CKM A;  2VQE B;  3TY8 A;  3TY9 A;  4JV5 B;  3TY5 A;  2VUG A;  4DV4 B;  4JI3 B;  4DV3 B;  4DRF A;  1IBL B;  4DV2 B;  4X64 B;  1HNW B;  3GDE A;  3BA8 A;  4JI5 B;  1N34 B;  4B3T B;  4DR2 B;  4LF4 B;  4EQ5 A;  4LF7 B;  4DR1 B;  4YY3 B;  2HIX A;  4TOI A;  1I94 B;  3NBY B;  3W1G A;  3RTX A;  1HNX B;  4DUZ B;  1FVI A;  3NC0 B;  1IBK B;  3OTO B;  4DV5 B;  4NXN B;  4CC6 A;  1TAE A;  4LF9 B;  4EFB A;  1V9P A;  1XMO B;  4NXM B;  4GKK B;  2HIV A;  3SGI A;  3BAB A;  2F4V B;  3T1H B;  2UUB B;  2HVR A;  4X66 B;  3JSN A;  1X9N A;  4UCV A;  4DR6 B;  1CKO A;  4DR4 B;  4JI6 B;  4UCO A;  1XNR B;  4UCS A;  4DR7 B;  2UUA B;  4LF8 B;  1XDN A;  1DGS A;  3BAA A;  2UU9 B;  3L2P A;  4B3M B;  4LF5 B;  2HVQ A;  2HVS A;  1A0I A;  4JYA B;  1HNZ B;  5BR8 B;  1FJG B;  2UUC B;  4JI4 B;  4X65 B;  4KHP B;  1CKN B;  3PN1 A;  4LF6 B;  3GB8 B;  4DR5 B;  4B3R B;  4LFC B;  2VQF B;  4UCU A;  1IBM B;  4OX9 B;  4LFB B;  4UFZ A;  1S68 A;  3W1B A;  2ZM6 B;  1HR0 B; 
#chains in the Genus database with same CATH topology
 5BY1 A;  5FNV F;  2WLM A;  3N40 P;  3JSL A;  2R8I A;  4O4I A;  3SE7 A;  3B09 A;  3OW2 U;  5KT2 A;  4TWK A;  1KT8 A;  2BE3 A;  1GN6 A;  4B7K A;  1PV0 A;  4LMY A;  2HKO A;  2P22 C;  2A7W A;  3APQ A;  2GV9 A;  5H2F Z;  2R7N A;  4DK1 A;  2ADQ B;  3G6B A;  3RGZ A;  4J9K A;  1CKN A;  1ZQ7 A;  3GQC A;  5CA3 A;  1I1M A;  1XEQ A;  2KKW A;  1WA8 A;  2WLN A;  1WP7 A;  1TWH A;  1M93 A;  1M90 W;  3H1K H;  4RNO A;  2Q7G A;  4GCZ A;  4O4H B;  2YIA A;  1P16 A;  1QVG U;  2CTQ A;  1JDB B;  2E3C A;  4CMF A;  2V4D A;  3WB0 A;  1B33 N;  3AG2 B;  5DM6 V;  4AQY B;  3M9O B;  2Q2T A;  2IH1 C;  5FNV B;  3ABK B;  4RQE A;  2XC9 A;  4KHP O;  3CCR V;  2EJ2 A;  3AK2 A;  3JAW A;  3B4S A;  4NB5 A;  2OWO A;  3N2G B;  3AW8 A;  4O4I F;  2QB5 A;  4G2K A;  4K0K H;  3G71 V;  1S5H C;  3AG2 C;  2A1H A;  2ZM6 O;  1C30 A;  2CGN A;  4DV3 B;  4LP8 A;  4L8J A;  3G80 A;  2FK1 A;  4LWS A;  3QO7 A;  1G2W A;  4I9Q A;  3ZIA G;  2YZG A;  2YRW A;  1ZLZ A;  3G8C A;  1N33 O;  2AHY A;  5DLG A;  3AG1 B;  5KHJ A;  4DUZ B;  1VEW A;  5LYJ A;  1WH2 A;  3JAS B;  4HZ3 A;  1EHI A;  4DV5 B;  4NLG A;  3K5H A;  3QTC A;  3QO5 A;  1W93 A;  2JJ2 G;  4FZ1 A;  3CWB H;  4ICG A;  3QFF A;  2JJ1 G;  2FLN A;  1ULZ A;  4Q8E A;  2NVX A;  3IFX A;  2W9C B;  2AGO A;  1CP9 A;  2FTK A;  5LHI A;  5FLX W;  3RYC B;  3K06 A;  5HV6 A;  4O4I B;  3Q8P B;  3QVN A;  4MVO A;  2R7Z G;  4TSF G;  4FLT A;  4X64 H;  5IJ9 A;  1E4E A;  1SCU B;  4UCS A;  2V59 A;  1A32 A;  3KG2 A;  3RIZ A;  4TUY A;  2CAZ C;  3V4S A;  5I5W A;  4LR3 A;  3NR7 A;  3L72 H;  1CPY A;  4CHI A;  1CKN B;  2R92 A;  5GON A;  4PV1 B;  3FMA A;  2R8K A;  1WA8 B;  5L3D A;  4K35 A;  3ZX6 A;  5KUM A;  3STZ C;  1NS1 A;  2ALZ A;  1NVP D;  1N34 O;  4CH3 A;  4U3F H;  2GQR A;  1P4R A;  1N0N A;  4FK5 C;  1HR0 B;  4LF7 O;  5LYJ F;  4J9P A;  1AVM A;  1D5A A;  4RAZ A;  1GO3 E;  5KX5 A;  4KL1 A;  3LUL A;  2HFE C;  4J9O A;  3JAW B;  2VS0 A;  3H1L H;  5KFR A;  3MFI A;  1XMQ B;  1IXM A;  4GKK O;  3L71 H;  2F4V O;  2UUC H;  4X65 H;  5LMU H;  2VRZ A;  3E86 A;  1N32 B;  4QWC A;  3T1Y H;  2W0F C;  5H6R A;  4TUY F;  4FLV A;  4TQR A;  2XOK G;  4LWS B;  1RM1 C;  1XNR O;  4I50 F;  3SNO A;  4O82 A;  5GON F;  4A3I G;  3HKD A;  1RYR A;  1F4N A;  1I5Y A;  4JI0 B;  3RV4 A;  5JQG F;  2ZT9 B;  5LYJ B;  2QF7 A;  2AZ2 A;  4A93 G;  1EKV A;  2Q0A A;  3ASN C;  3ZMU A;  5KHI A;  1DF4 A;  3TIG A;  4UUG A;  4KUM A;  2VQE H;  4CMD A;  4JZ2 A;  3Q2O A;  3TY5 A;  1BT8 A;  4JYC A;  2LQT A;  5IJ9 B;  3Q8R B;  1IBL H;  4A3C G;  3E8H A;  1E4E B;  3O65 A;  4FZ0 A;  3GDE A;  1MG1 A;  3UYY A;  3KXY T;  4TUY B;  3A2F A;  1B6R A;  3HB3 B;  3KHL A;  1S0M A;  1GN4 A;  3GTQ A;  2W6Q A;  5K1P A;  5GON B;  1M5I A;  1XOU A;  4DV1 O;  2RDC A;  5JQG B;  1XNQ H;  3RB0 A;  1S10 A;  4WFA V;  1A48 A;  3UFX B;  2IMW P;  4EFB A;  2JK5 C;  2NLJ C;  2X0L A;  4FFR A;  2AU0 A;  3ABM C;  3HOY G;  3KCY A;  1B6Q A;  1OCC C;  2Q73 A;  3W7T A;  4ED7 A;  5EIB C;  1BQZ A;  2ZE8 A;  2JEG A;  4O7S A;  4F4W A;  3ZHR A;  3WB1 A;  1J5E O;  4YJ3 A;  1FS0 G;  5KFQ A;  2BQU A;  3ABU A;  3K5N A;  3HKZ E;  3MWM A;  1MSW D;  2IU3 A;  1HP8 A;  4BIZ A;  1MSD A;  1IBK H;  1JJ2 U;  2PZS A;  2Q4P A;  1FJG H;  1GN3 A;  4JV5 O;  5CA0 A;  2WLH A;  3P32 A;  4FFK A;  3CD6 V;  3OUZ A;  3ZMS A;  3J80 N;  4U7O A;  1VQN V;  4R7C A;  4WFB V;  3I12 A;  2Y0S E;  5KFL A;  1VQ6 V;  1PNK A;  2Y4T A;  2OTL V;  2R72 A;  3HKD B;  4JAV A;  1QLN A;  3JYC A;  1WJZ A;  5HFM A;  4YY3 O;  3OTF A;  4MVQ A;  4HNV A;  2VPS A;  3UM7 A;  2UXD O;  1SF9 A;  1K97 A;  2A06 H;  4LFA B;  3RVY A;  3ZS8 C;  2UU9 H;  2JRI A;  3CCJ V;  3UT5 A;  2JA6 G;  1XBL A;  4MTX A;  2E2H A;  4K0K B;  4YJ3 F;  2DQ3 A;  3JAL A;  2W6M A;  3MD0 A;  4DR5 H;  4X66 O;  3RR5 A;  3ZHV A;  2XAJ A;  2QKS A;  2VUM G;  2QGN A;  3KZI Z;  1QU7 A;  1OCR B;  1EN6 A;  1S9F A;  3IC7 A;  3WG7 C;  2UUA O;  4O86 A;  4YXW G;  2YS7 A;  2K9P A;  4JI8 B;  3KCX A;  3JAT A;  5CA0 F;  4ED1 A;  4DYL A;  4B3M O;  4BBS G;  2RDJ A;  4IYI A;  2NU6 B;  3JRW A;  5CR5 A;  3MR3 A;  3N6R A;  2PBZ A;  4DV7 B;  2DPI A;  1S72 V;  1PNM A;  1K5S A;  3CHX A;  3OFN G;  3E2E A;  2NN4 A;  3E89 A;  3L4K A;  4UVA A;  4IRC A;  1GRJ A;  1DTO A;  2V4R A;  2B1G A;  4ECW A;  5EC1 C;  3DTF A;  3ZBH A;  1K83 A;  5KG2 A;  4YJ3 B;  4X64 B;  2ATL A;  3GTG A;  4UUJ C;  3VQX A;  5GTI Z;  4GKJ H;  3KHG A;  3FKS G;  4Z1V A;  1YEW A;  3PR4 A;  5EZY A;  2ZDI C;  4JUZ A;  3N44 B;  2JA7 A;  5CA0 B;  5DQI A;  5ITZ A;  4F4Y A;  3JZF A;  4DL5 A;  4FLW A;  3FYI B;  3V4Z A;  1H2G A;  2HVR A;  2P90 A;  2NU7 B;  2D2C B;  4K6N A;  3H01 A;  4UCV A;  1AB3 A;  4Q4C A;  4AQY O;  3T9A A;  1HNW H;  4LF4 H;  1M57 B;  2N74 A;  3T1C A;  4DR7 B;  4M7E A;  2EIJ C;  4JI6 H;  4JV0 A;  1K73 W;  3UT5 B;  4DR1 H;  3TET A;  1SET A;  5E1A C;  1BMF G;  2XAS A;  2JS3 A;  2N05 A;  4QW9 A;  2UVU A;  5DQG A;  5I5V A;  3JAL B;  3OHA A;  3T7A A;  4QIW A;  2UUC B;  4X65 B;  4JI4 H;  2YWV A;  1G8M A;  1M57 C;  3ZRV A;  3SYC A;  3ZN0 A;  1IBM B;  3WNZ A;  2ZGI A;  2GTA A;  4FS1 A;  3DTG A;  5KG0 A;  4UFZ A;  5KHK A;  3ZHQ A;  5EZY F;  3PVX A;  1AI6 A;  4APM A;  4FJC C;  1YVW A;  3VA7 A;  3JAT B;  1AUX A;  2RGR A;  2VA2 A;  1ZWI C;  4JI1 B;  1ZL8 A;  4ETS A;  1M4U A;  1NKD A;  4DUZ O;  3L75 H;  1B06 A;  2ODM A;  2BR0 A;  5J2T A;  4DV5 O;  5KFC A;  2CZG A;  2GPW A;  4ZIB A;  3K79 A;  2HJF C;  3F8N A;  5EWF A;  5C44 G;  1Z2P X;  4DV0 H;  5L1K A;  4JYA H;  1M7J A;  3FKI G;  4O3O A;  5KG7 A;  1JLL B;  1M1K W;  4O7T A;  4I9W A;  5KFW A;  4DAA A;  5LXT A;  2AGP A;  3AYH B;  2YXY A;  1OV9 A;  2F66 C;  4RAY A;  4QIW F;  4UXN A;  1EZV H;  2R93 G;  3PW2 A;  5FPR A;  1EYZ A;  3WWH A;  2EJ3 A;  5EZY B;  4M0J A;  4ZBM A;  2E76 B;  5ITZ B;  4FVM A;  4J9Z B;  1K8A W;  3H4D A;  2F95 B;  2Y69 B;  4J11 A;  1MAB G;  1XNQ B;  4RNN A;  4LH7 A;  4GLW A;  2YXL A;  3OGI B;  4NZO A;  1LUW A;  2EIM B;  1K4D C;  3K5M A;  1S76 D;  2W7P A;  5KG5 A;  2KQX A;  1HR0 O;  5E25 A;  5FR9 A;  5J2T F;  4JI3 B;  1V51 A;  3CCL V;  5IWA H;  1NR1 A;  4X62 H;  4HNA A;  1BSM A;  1AI4 A;  4J9Q A;  4X9Q A;  1FYJ A;  1DK1 A;  1AN7 A;  1I7F A;  3M4I A;  1L0N H;  1S5J A;  1S97 A;  1I1K A;  1I94 B;  1N56 A;  1NH2 D;  1XMQ O;  5IYB O;  1UC8 A;  1ZET A;  1XHZ A;  1IBK B;  5LXT F;  1P84 F;  2YI8 A;  2GSM B;  2QM7 A;  3ETG A;  1FFT B;  2Q68 A;  1N32 O;  3RN4 A;  1I7L A;  5KFV A;  4PA6 A;  4J80 A;  3RYF A;  3OGC C;  5F2V O;  3GTJ A;  3PJS K;  2JA5 A;  5FJ8 G;  1JQ0 A;  1ZL8 B;  4JI0 O;  3CE2 A;  2RGV A;  4A3G G;  4PDV A;  3A0R A;  4GX1 A;  5J2T B;  4AYB A;  3JZI A;  3RB4 A;  1RK5 A;  4J9M A;  5KFI A;  3V6K A;  3U0Z A;  1SKV A;  3HR0 A;  4MW8 A;  2UU9 B;  2YL2 A;  2FPG B;  4HN2 A;  5CM0 A;  5H80 A;  1E79 G;  2Q67 A;  2R86 A;  3OUS A;  4PJ0 Z;  3M9N B;  3K3V A;  3IN5 A;  5LP6 F;  3PN1 A;  4DR5 B;  2PI4 A;  4B3R H;  4L1K A;  4LFC H;  4MA5 A;  5L3F A;  5LXT B;  3RAX A;  4FM1 A;  2PUS A;  2I8C A;  4EKW A;  1J95 A;  2RN9 A;  2OTJ V;  2FB9 A;  2PMZ E;  3WO1 A;  3U55 A;  4TT3 G;  4DR6 H;  3A8T A;  1OBG A;  2YCH A;  5KFA A;  4ECT A;  5LMN B;  4UVB A;  3BQ2 A;  5JJJ B;  2E5L B;  3E22 A;  1SZT A;  1BGY H;  5IYD G;  4WFG A;  1N36 B;  2VQF H;  4HNA B;  1ZHQ A;  4U6P A;  4CH5 A;  1EFR G;  4IAJ A;  3T2M A;  2UXC H;  4GX0 A;  5LP6 B;  2HG8 A;  4GKJ B;  3OR6 C;  2B5U A;  5EWG A;  1L0L H;  4FM9 A;  4YHH B;  4ECX A;  5KA5 A;  1VS0 A;  5CAE B;  5KT6 A;  2HJD A;  4ECU A;  5J9P C;  3K9A A;  2ZKO A;  4ED0 A;  2Q2U A;  5EWE A;  1IX9 A;  5LP6 C;  4ZQI A;  3K0D A;  4EEQ A;  3CX5 F;  3T54 A;  3RYF B;  3MHH C;  4QW8 A;  1KKC A;  1M0W A;  2J6U A;  5BWX A;  4Q0Y A;  3TY8 A;  2W9A A;  2HHH H;  1T94 A;  1H2M A;  4EBE A;  1R6K A;  5EIB D;  2XD4 A;  5B1A B;  4DRF A;  5IE9 A;  4FLX A;  1R73 A;  4DR4 O;  1HNW B;  5DQH A;  4P30 A;  4LF4 B;  5KT3 A;  2W7O A;  4B3T B;  4FU0 A;  5DGI A;  4IHJ A;  3T9D A;  4DR1 B;  4F6E A;  3TQ1 A;  1NI8 A;  4LFA O;  3HKC A;  4MTD A;  1K4C C;  5B1A C;  3I55 V;  4K0K O;  4PDM A;  1TAE A;  3SYO A;  1IZ3 A;  5B5E Z;  2IJK A;  2HDK A;  1FKA H;  4JTD B;  1IYE A;  4CS4 A;  4NXM B;  1IVS A;  1AJQ A;  1CEZ A;  2WA3 A;  4DRX A;  5DEC A;  3Q1K A;  4H13 B;  4QWD A;  3J80 W;  3VPD A;  2UUB H;  4RWU A;  4JI8 O;  3NXS A;  1PD3 A;  2ASL A;  4ED8 A;  3DAA A;  5DED A;  2PN1 A;  1SFO A;  5AG2 A;  4PA9 A;  3OM3 B;  1WN7 A;  4O4H A;  4Y8V B;  5DG9 A;  4XX0 B;  1XI1 A;  4DV7 O;  4RO2 A;  2A9H A;  4G27 B;  4PEL A;  3AX6 A;  3E22 B;  3CME V;  2YZN A;  4JYA B;  2BOC C;  5BPH A;  4JF3 A;  4JYB A;  2QWQ B;  5BR8 B;  1HNZ H;  4FM0 A;  1CE8 A;  3GTK A;  3I4N G;  3CEB A;  2W8K A;  4EYH B;  4K8X A;  4JYY A;  1VQ8 V;  2FP4 B;  5JVD A;  2FYU H;  2ZR2 A;  4DUY B;  3GIM A;  1GYF A;  4LH6 A;  3RAQ A;  3EYY A;  1DLB A;  1TWA A;  4QJF A;  2IBZ H;  3GWK C;  4FFN A;  2CQY A;  1EUC B;  2PF4 E;  2UXB O;  1QVF U;  2DZD A;  1X4T A;  4DR3 H;  1SQG A;  3F5T A;  4H37 A;  1TA8 A;  4LF5 H;  1GO3 F;  5I5T A;  2YDE A;  1VQM V;  2HGX A;  3CQZ A;  1Q6U A;  2ABJ A;  2X0S A;  3T9C A;  4A3M G;  1XK5 A;  3JD2 A;  1Z5W A;  4PDL A;  5KFY A;  1COW G;  5IWA B;  1Q81 W;  1AR1 B;  4X62 B;  3HO8 A;  1S0N A;  4PI2 A;  1BCC H;  1SQF A;  3IJ4 A;  4IHJ B;  3EHB B;  4O84 A;  4DR7 O;  3HKC B;  2XGP A;  1W0K G;  1TWF A;  1I50 A;  2V9W A;  1B3Q A;  1JA8 A;  1QNM A;  2UUC O;  4X65 O;  2ZDH A;  3CSX A;  4DXW A;  1VQL V;  5JVD F;  3TII A;  1IBM O;  4AHC A;  3MJF A;  4TV9 A;  4DRX B;  1K7D A;  4DO2 A;  3HBL A;  2K1E A;  1N4C A;  2M7W A;  1NU1 H;  1MA1 A;  3PR5 B;  3MWD A;  5BWR A;  1KB9 F;  1URF A;  4JI1 O;  3CSW A;  3BCC H;  2OCC B;  3T99 A;  2R8G A;  4B3S H;  1LUV A;  2FB5 A;  4DR2 B;  3HKZ A;  5IYB G;  1BJT A;  1WCM A;  3AG4 B;  1K34 A;  4X89 A;  4FFP A;  4UV9 A;  2RQ6 A;  5FD6 A;  2OCC C;  3OTO H;  3AG3 C;  3EPI A;  2AGQ A;  2BQR A;  1AR4 A;  3D3Q A;  4DK0 A;  3H3V H;  3U54 A;  2WLJ A;  1M0T A;  2COJ A;  1YZB A;  2EIY A;  3KHR A;  3AG4 C;  2Y0S A;  3R5F A;  5JVD B;  1Q6I A;  1XDC A;  2DPJ A;  4JZG A;  2FPI B;  1ZX3 A;  5LOV A;  1CS0 A;  3T1H H;  1R3L C;  2R7L A;  2DOS A;  1EM1 A;  4QJF B;  4DR6 B;  4MVR A;  3S3W A;  1KBL A;  4XDK A;  5LL6 Y;  4TV9 F;  4IWX A;  3MR6 A;  4JV2 A;  3HKE B;  2FK2 A;  3STL C;  1XNQ O;  1VF5 B;  2ZDG A;  1KJJ A;  1A0I A;  2R8J A;  2JEU A;  3HKB A;  1VQ5 V;  4HYO A;  4Q45 A;  2RF4 A;  1KEC A;  4J9L A;  4JI3 O;  3L70 H;  1VIB A;  4PHZ A;  2I87 A;  2VQF B;  4X20 A;  4QWA A;  2DWE C;  3LDC A;  1AUV A;  1NH2 B;  1K3E A;  4UB8 Z;  2KG7 A;  3SYA A;  1I94 O;  2P67 A;  4DV6 B;  4YR2 A;  4U3J A;  4IL6 Z;  1O75 A;  3PZP A;  5LHH A;  1IBK O;  2R8H A;  4X1Y A;  1Q3E A;  4NKG B;  5CBG A;  3KAL A;  1YI2 V;  5LOV F;  3IAY A;  5EDW A;  4TV9 B;  3VBB A;  1KKD A;  3TJT A;  3ZHU A;  5DG7 A;  1SES A;  4I50 A;  1Y76 A;  5LA6 A;  2R82 A;  5KFO A;  4JI7 H;  2WLK A;  2HHH B;  2FL4 A;  5JVL A;  2R7M A;  5K1X A;  1P8L A;  1DV1 A;  4MVZ A;  5JQG A;  3HOV G;  2IP4 A;  5IYC G;  1VF7 A;  2IJH A;  1H38 A;  3AEI A;  2ZE5 A;  5KS8 A;  1G4Y B;  3RFR A;  1L8D A;  2HR3 A;  2UU9 O;  3HOX G;  5C8Y A;  2CUG A;  2QSA A;  5L1L A;  3CEI A;  1PP9 H;  5J2U A;  1BL8 A;  1YSC A;  2P4K A;  2F43 G;  2R7Z A;  4DR5 O;  3H4B A;  3CCQ V;  4BWS C;  1O9G A;  1RM1 B;  4OXS A;  4AI8 A;  3RBE A;  2EJR A;  3K08 A;  3OMI B;  2JS5 A;  3JAM N;  5KFG A;  5LOV B;  2C2R A;  1XUQ A;  4HNU A;  3RBD A;  2ITC C;  4GX5 A;  4YJ2 F;  5BYA A;  3O9O A;  1JOY A;  4DV2 H;  2X7R B;  5KFS A;  1NTZ H;  5DN6 G;  5LA6 F;  4YR0 A;  4LC1 A;  5LMN O;  3CCV V;  3ASN B;  3CVZ A;  3H1I H;  1Q82 W;  1KQS U;  2E5L O;  5FLM G;  4I55 F;  4JV1 A;  1I2K A;  4EBD A;  3NBY B;  3GB7 C;  3ABL C;  3HKB B;  3NGD A;  4O7V A;  4O4J A;  2AZ0 A;  1I6U A;  4NXN B;  3CB2 A;  3WO0 A;  3A0H Z;  4X20 B;  2YSU B;  4WCE V;  1N36 O;  1S77 D;  4NZN A;  5C8Y F;  3H0G G;  5KFZ A;  1FXK A;  4O2A A;  5J2U F;  2EBO A;  1VQO V;  4GKJ O;  2W9B A;  3T9F A;  2GTS A;  2KG7 B;  4ZKI A;  4YHH O;  4MTG A;  4OPA A;  4U3J B;  2COG A;  2IA6 A;  2EIK B;  1CKO A;  4CE5 A;  3K5I A;  4RUA A;  1TUE B;  4X1Y B;  4FS2 A;  5JQW A;  3WFV A;  1VF6 C;  4J7K A;  4I50 B;  1Y76 B;  5LA6 B;  3ABM B;  3SJQ C;  3IC9 A;  4LF5 B;  2XIG A;  1OCC B;  2EIK C;  5KFN A;  1GGO A;  3KAJ A;  4KHP H;  5L1I A;  2HGW A;  1HNW O;  4XYL B;  2WLI A;  4LF4 O;  3FFQ A;  1K1Q A;  4B3T O;  3H1H H;  2Q0O C;  2QKC A;  4O4J F;  3CXH F;  5C8Y B;  1YDX A;  4DR1 O;  2H3O A;  5BYB A;  1VMG A;  5J2U B;  3LDD A;  2W57 A;  1H8E G;  2ZDI A;  1R3K C;  3T9B A;  4CKC A;  1RPO A;  4O2A F;  3MHS C;  4F4L A;  4O7L A;  2B9Z A;  3VQV A;  2XT9 A;  1N33 H;  4JGS A;  1AJP A;  5LL6 b;  1SER A;  4UCT A;  3JZ6 A;  2WAQ E;  2QYZ A;  4NXM O;  3GVM A;  1P7G A;  4GX2 A;  5C93 A;  1KUT A;  4Q8F A;  5HNE A;  2VWK A;  3M7M X;  4J7Z A;  3ZRW A;  4MV8 A;  4R8U A;  2OH2 A;  4OX9 H;  1IYD A;  3N2K A;  2Q69 A;  5LGN A;  4B3S B;  1BZK A;  4LBE C;  1GMG A;  1KP2 A;  1U96 A;  1PPJ H;  5KFB A;  3SJC C;  1ZHS A;  4JYA O;  5BR8 O;  4O4J B;  1K1S A;  3GII A;  2ZIM A;  4A3B G;  3CP1 A;  2XCP A;  4JI2 H;  3UKM A;  5L3C A;  3CC4 V;  1FXK B;  2YXH A;  4O2A B;  3W5O A;  3WG7 B;  2NVY A;  1Y66 A;  2BSK B;  2W9B B;  5F9L A;  2ZJT A;  1QBZ A;  2NR5 A;  2Q7H A;  2XUM A;  2VUG A;  3HXL A;  4DUY O;  4NZM A;  3BJY A;  1DAA A;  2RNB A;  4XZ3 B;  1FXK C;  3LML A;  3ZJZ A;  1D5N A;  4LF7 H;  1GKF A;  1JR9 A;  3CCU V;  3SYP A;  4CKE A;  2EIN B;  2Y4U A;  5D8D A;  4NTW A;  4PA7 A;  2AGA A;  2DYS C;  1CQJ B;  2FKX A;  3TXQ A;  2WWW A;  2ZE6 A;  4O2B A;  4X62 O;  1VQ9 V;  4G28 B;  1VBG A;  3TCU A;  2WLI B;  3RJ0 A;  3W7X A;  2EIN C;  2F4V H;  3V6H A;  5IP9 G;  2JA6 A;  4RB3 C;  4QPK A;  2PMZ A;  2HVK C;  2R9I A;  5KFU A;  1JX9 A;  4I0X A;  3DXR A;  1XDN A;  1AIL A;  1XNR H;  2E2I A;  2QM8 A;  4J42 A;  3RF2 A;  3PO3 G;  5IDJ A;  1F7Y A;  1I08 A;  2QKA A;  4GT1 A;  1LR1 A;  1WPB A;  2Q6A A;  2Q9L A;  2Q8V A;  4KP4 A;  1HNX H;  5C4X G;  5JJE B;  2JGD A;  2V58 A;  3QNE A;  3PW5 A;  4P9O A;  3GV5 B;  3ZRW B;  2HGS A;  1P49 A;  3AK3 A;  4R8U B;  2CH7 A;  3N2K B;  3RVZ A;  4JTA B;  5B3S C;  1XMO H;  1ARO P;  2EIJ B;  3GLK A;  3OSN A;  3GV7 B;  5CA1 A;  5CB4 A;  1S68 A;  4MW3 A;  2WPD G;  3CC7 V;  4DR2 O;  4GC7 A;  3A0B Z;  3T4D A;  3VNN A;  3R9R A;  2XAF A;  1OZ0 A;  2V7Q G;  4BBR G;  1NBM G;  3U9S A;  5LHG A;  3BPZ A;  4O2B F;  3MFH A;  2MW2 B;  1S0O A;  5A9G A;  4LF8 H;  3SPH A;  2B63 A;  4XDL A;  1Z2G A;  4DL3 A;  3GTP A;  4FPP A;  2LFS A;  4X8A A;  4ZI7 A;  5LMU B;  4BIO A;  1Y67 A;  1F23 A;  4DV1 H;  4DV3 O;  4LF6 H;  3T1Y B;  2WDT A;  3VPC A;  1V54 B;  4HQ6 A;  4DR6 O;  1XL4 A;  2OIE A;  4RUF A;  2VOB A;  1QQC A;  1PK8 A;  4ED6 A;  3FB5 C;  3CPW U;  3SR2 C;  1AP6 A;  1TGO A;  2QJ1 A;  1V54 C;  3P3N A;  2JEJ A;  3ETJ A;  5CA1 F;  1R1B A;  1WLE A;  1G6U A;  5CB4 F;  4ECR A;  4DL7 A;  2JEF A;  4O2B B;  5FPO A;  4H33 A;  4A3F G;  2BCC H;  2VQF O;  4QWE A;  1XIL A;  1YXB A;  4GYC B;  1R6N A;  2VQE B;  2ASD A;  1WPX A;  1L1F A;  4C5C A;  3QZ8 A;  1JFF A;  4JV5 H;  3LNM B;  4I0X B;  5DGA A;  3BVO A;  3N43 B;  1IBL B;  5C5J A;  3GTM A;  4DV6 O;  1ORQ C;  1VAJ A;  2YIC A;  3DXR B;  2EZP A;  4ZI7 F;  3BA8 A;  2YC0 A;  5BPF A;  4J10 A;  2WA4 A;  1SC5 B;  4ME6 A;  4LSX A;  2WLL A;  3RTX A;  3TK1 A;  2JGD B;  4FM2 A;  3ETQ A;  4J41 A;  1FD9 A;  1SQB H;  1SQV H;  2UXD H;  4JXU A;  5LBQ A;  2HHH O;  1KTA A;  4MV1 A;  1JKJ B;  2CH7 B;  3ZN1 A;  2R9A A;  3DC6 A;  4O4L F;  3GIK A;  1DF5 A;  1YHQ V;  2VQD A;  5CA1 B;  5CB4 B;  1NJI W;  3SGI A;  4QE9 A;  4U7C A;  3RWR D;  4DV4 H;  4A3E G;  2Q5Z A;  4ASU G;  5IT9 N;  4DL4 A;  4W4K A;  1B6S A;  3FKI A;  5KT7 A;  5JUM A;  5LP6 A;  3MAQ A;  1H2L A;  3LWB A;  5E79 Z;  2OLS A;  1KC8 W;  1MNG A;  1FKA O;  2JA5 G;  4ZI7 B;  4B3M H;  2HVQ A;  1SYX B;  2HVS A;  4YAJ B;  1FJG B;  3FX7 A;  3GB8 B;  4BIU A;  4OX9 B;  2IW5 A;  1UFI A;  5BWU A;  2ZXW B;  2XAQ A;  2R70 A;  1I1L A;  4IWY A;  4A2A A;  3W1B A;  2Y0P A;  1Y1W A;  4O4L B;  4ZHQ A;  2R87 A;  2PI5 A;  2XCA A;  3JD3 A;  2CNV A;  3WB2 A;  2HVJ C;  1PKX A;  1NZ6 A;  4BY7 G;  4PZ8 A;  2ZXW C;  3Q4H A;  2ASJ A;  2PYL A;  4JI2 B;  3T5H A;  3K5L A;  4NXN O;  4E6N A;  3ZHT A;  1C3O A;  2R6F A;  3CRQ A;  2NU9 B;  4HR7 A;  2DMX A;  3J7A K;  1QLE C;  3UZB A;  4Z1M G;  1Z2N X;  1GK9 A;  3QWU A;  1YTF B;  4FMT A;  1JFF B;  5JCO C;  4IYH A;  3CRR A;  4WBN A;  1EZ1 A;  2V1D A;  2LW1 A;  3JAM W;  4LFB H;  4CH6 A;  3SJB C;  4RUE A;  3T5J A;  2L35 A;  3KYH C;  3PW4 A;  4DL2 A;  1K92 A;  1MOF A;  2XAG A;  4EB6 A;  2WLL B;  2ARH A;  1BHA A;  3RT3 C;  5D1O A;  3RUP A;  4O3P A;  4EEY A;  2C35 B;  4QWB A;  2D3O W;  1X59 A;  4LF5 O;  4YIO A;  1KJ8 A;  3C90 A;  2P4V A;  3VOT A;  4E2L A;  2ZIO A;  3X2Q B;  1DIK A;  4BY1 G;  4UCR A;  1TVK A;  2EJ7 A;  4ZHQ F;  2HG5 C;  4A3L G;  1WB8 A;  4G3I A;  2R9R B;  3MDS A;  4A3D G;  1R3I C;  1VKZ A;  2XCL A;  2P0A A;  5BWV A;  3X2Q C;  1CXZ B;  4BXX G;  2YU9 A;  5FD5 A;  5L3G A;  3I56 V;  3HOU G;  3UCS C;  3ABT A;  4A3J G;  4FIP C;  1JMK C;  4WBN F;  1HNX B;  1Y14 B;  2W6Z A;  3VMM A;  4NTY A;  5KFK A;  4QSH A;  2HHF A;  4DV5 H;  4GZR B;  4CBC A;  4Q43 A;  5KAF Z;  4PDR A;  1XMO B;  2HIV A;  2BQ3 A;  4B3S O;  4ZHQ B;  3FYE B;  4I5S A;  2XND G;  3SJA C;  4ABM A;  1YJW V;  1T5E A;  5JH7 A;  4O83 A;  3Q4H B;  4FBT A;  3JAK A;  4BW9 A;  1ZSP A;  4JI6 B;  4JI5 H;  3CC2 V;  4LF8 B;  4MTE A;  1DGS A;  1EN5 A;  2YIB D;  5HFL A;  5IJ0 A;  4FLU A;  2CTR A;  2JVD A;  1FPO A;  3EXA A;  4I7Z B;  3AK1 A;  1SS3 A;  4WBN B;  4JI4 B;  4LF6 B;  1PL4 A;  1YJ9 V;  1OJH A;  2KSW A;  2QM4 A;  1GAX A;  2IH3 C;  2WB1 E;  3APO A;  5GW7 A;  4EB6 B;  3PW0 A;  5D1O B;  5KFD A;  1Z2O X;  1HR0 H;  4M9U A;  3G6E V;  2VA3 A;  1O9H A;  2QWO B;  1QHT A;  1V55 B;  4Q44 A;  1TVK B;  2JDI G;  3K3W A;  4FGR A;  3RV3 A;  4RCN A;  5CE8 A;  1B04 A;  1TUB A;  1UC9 A;  2C28 A;  1GH6 A;  2R85 A;  4DV0 B;  1E1R G;  3T5L A;  3D36 A;  3BAC A;  5JH7 F;  2YUA A;  1V55 C;  4UVC A;  5A2Q N;  2N04 A;  1D2D A;  2YW2 A;  4IZO A;  1WSC A;  5KMG A;  2W6P A;  1A9X A;  1IXB A;  4ECV A;  4X64 O;  3UO2 A;  4YAK B;  4WFE A;  1Y1V G;  4EFE A;  1F51 A;  3GIP A;  2W6J G;  1SA0 A;  4LNU A;  4E4E A;  4R7R A;  1I7N A;  5IY5 C;  4MT8 A;  4JI0 H;  1QCE A;  1IOW A;  5I47 A;  4ECY A;  2W70 A;  3FB6 C;  2UXD B;  2HHF B;  1ZAU A;  1THZ A;  2LGQ A;  4HNT A;  3HKE A;  3SDL A;  1WRV A;  5DGH A;  1CKM A;  3E8G A;  1RK6 A;  4NR1 A;  1YCI A;  3OMA B;  2R7K A;  5L3B A;  4DV4 B;  1N8R W;  4BAY A;  2DJV A;  2DAA A;  5JH7 B;  3CRM A;  3JAK B;  2KSD A;  2Y0I A;  3E8B A;  2ZNJ A;  3H40 A;  1Q7Y W;  3JCU Z;  1M56 B;  5IJ0 B;  3BFR A;  2HIX A;  1W2B U;  3M9M B;  3U9T A;  4E4T A;  5KUK A;  1HWY A;  5LMU O;  5KG1 A;  3QZ7 A;  1M56 C;  3V6J A;  3T1Y O;  4CZZ A;  4K8Z A;  4JAU A;  3GIL A;  1H8H G;  2C2A A;  4JPR A;  2Z04 A;  1OCO B;  3CYO A;  1X9N A;  3CMA V;  5H6Q A;  3RYH A;  3AG3 B;  1A0G A;  4IIJ A;  2IU0 A;  1IUR A;  4AYB E;  4RB1 A;  1TUB B;  5DAA A;  1OCO C;  3C0F B;  5JJN B;  2P6J A;  4RZQ A;  2WAQ A;  1S03 G;  2F93 B;  2VQE O;  2O57 A;  4RB0 A;  4ECS A;  2ZD9 A;  1ROP A;  3M8A A;  4H44 B;  5KMG B;  4FLZ A;  4B3R B;  5DMX A;  4LFC B;  2QWN B;  4LF9 H;  3B40 A;  3FB8 C;  1IBL O;  4LFB B;  4WFH A;  2DLN A;  5KG4 A;  3RB6 A;  3D36 C;  5KT4 A;  4IR1 A;  1SA0 B;  3ICX A;  2QWP B;  3EVK A;  4LNU B;  4F50 A;  2JIZ G;  2RCV A;  2UVR A;  3ETE A;  4YB8 B;  2BOB C;  3CCE V;  5C1O A;  1XRE A;  3ORQ A;  4A2B A;  4DR4 H;  4DW0 A;  3ORR A;  3NUA A;  3LDE A;  3HT5 A;  3QQM A;  4LFA H;  1N0J A;  3B77 A;  3SPJ A;  1JDE A;  4IIJ F;  1M6V A;  4MA0 A;  2ZNI A;  2H94 A;  2CGO A;  3SPI A;  4O7Y A;  2AW9 A;  3ABK C;  4C5A A;  1XQ8 A;  1NTK H;  1GN2 A;  1RP3 B;  4FE2 A;  5DGB A;  2FK3 A;  2UXC B;  2A3Q A;  3J81 N;  4TQS A;  2DWD C;  4PZ7 A;  1VF6 A;  2C00 A;  5DLF A;  2I80 A;  2R92 G;  4JI8 H;  3JD4 A;  4O81 A;  3KKY A;  1RJR A;  1MZF A;  3ZCC A;  1S0V A;  2E74 B;  1Q6H A;  1FJG O;  1ET0 A;  3AG7 A;  4ECQ A;  4U7N A;  4YJ2 A;  5B66 Z;  4MV6 A;  4DV7 H;  2CTW A;  4OX9 O;  3H1J H;  3DGE A;  2L6L A;  4X1K A;  4FFL A;  3LUT B;  5CMU A;  1WB7 A;  4DQN A;  3AG1 C;  4RAI A;  4I55 A;  5F9N A;  3G6X A;  3K9S A;  3P30 A;  3RYH B;  4C5B A;  4B08 A;  1UJW B;  4J0M A;  4IIJ B;  2EIL B;  5BWW A;  2W6O A;  4B7E A;  5KFP A;  5HBR B;  4C2M A;  4J9S A;  4JI5 B;  2GUZ A;  2CW8 A;  3JRX A;  4JI2 O;  2YIB A;  5IT9 W;  3OT7 A;  2PY5 A;  4TOI A;  1UNN C;  3SPC A;  3L9D A;  4TQF A;  1WAZ A;  2EIL C;  1V4Y A;  3W7U A;  4WD3 A;  3ZMV A;  1AP5 A;  1Y6X A;  4I7H A;  2UXB H;  3E35 A;  3B2E E;  5KKN B;  1HW7 A;  4JTC B;  3G6V A;  3C3T A;  1SQP H;  2LW7 A;  2LJ2 A;  4XYM B;  2UUB B;  2ATK C;  2AXT Z;  1T36 A;  3ABL B;  1I0H A;  1PNL A;  3DSQ A;  2QWR B;  2ZE7 A;  4UB6 Z;  1KJQ A;  4UCO A;  2W71 A;  4TQD A;  4DR7 H;  3BAA A;  3HB9 A;  2W0X A;  1I2L A;  2IJI A;  2M05 A;  3ETD A;  1HNZ B;  4EGQ A;  3SI8 A;  3WWJ A;  1Q86 W;  3N41 B;  2OYQ A;  3WU2 Z;  4FBU A;  2BTO A;  4O7Z A;  3RYI A;  1RJP A;  1G1X B;  1W0J G;  3E8F A;  1IBM H;  5KA6 A;  1DV2 A;  5BXZ A;  2OCH A;  4MVM A;  2ZIN A;  2BSK A;  3KHH A;  2VPQ A;  5B1O A;  1YTF D;  5LGT A;  1KJ9 A;  3WWI A;  3BA9 A;  1KBH A;  1GTO A;  4R8C A;  3LNN A;  2X5R A;  4JI1 H;  1HNX O;  3JAR A;  2R84 A;  1L2Z A;  3BQ0 A;  3CRA A;  2DQ0 A;  5I5Y A;  4YJ2 B;  1VQ7 V;  2FLL A;  3ZRX A;  5B1N A;  4DR3 B;  2CE4 A;  4X1K B;  3ML0 A;  1XMO O;  5KX5 F;  4I55 B;  1WP8 A;  4MVS A;  3W7S A;  4O3Q A;  1GSA A;  5K2M A;  5DG8 A;  5FL7 G;  3RW0 A;  3G67 A;  4IRD A;  5I5U A;  4CS2 A;  3ZMT A;  2GUZ B;  4FFM A;  3UQ8 A;  4JI6 O;  2XHB A;  2ZDQ A;  4LF8 O;  5BWT A;  2ZM6 H;  3N27 A;  4CC5 A;  3RGB A;  3H0G A;  2Z0A A;  3NBZ B;  3FDS A;  2DAB A;  3UZO A;  1JVM A;  1BQ0 A;  4JI4 O;  3VPB A;  1I5X A;  4CKB A;  3U10 A;  5L1J A;  3HPL C;  4LF6 O;  2IBK A;  4D6T H;  2UVV A;  4PDB A;  4IGG A;  5EBL C;  1NQT A;  3EPG A;  1ZUQ A;  5KLV H;  4JI3 H;  2J6T A;  5KX5 B;  1BNC A;  3CS5 A;  3VQY A;  5KFM A;  4EQ5 A;  4J9R A;  4TVI A;  3OEH G;  1FFX A;  1GM9 A;  1I94 H;  5K3W A;  4Z2W A;  1JJO A;  3FD9 A;  4DV0 O;  1S3J A;  3B8N A;  3NC0 B;  3GTL A;  1ENV A;  3OTO B;  1QR9 A;  3RYI B;  2X6B A;  5EOY A;  3RB3 A;  4LF9 B;  4ED3 A;  1WR2 A;  1NTM H;  1AJN A;  3ZHS A;  2C22 A;  2WYO A;  3IG0 A;  2UXN A;  3B8M A;  2FE3 A;  3GIQ A;  3T1H B;  1GM7 A;  5EC2 C;  3G8D A;  4UV8 A;  2P06 A;  4PA3 A;  5KHH A;  2WAM A;  3JAR B;  1VAR A;  2DYS B;  4DR4 B;  4EG0 A;  2LGW A;  1N34 H;  4MVU A;  4N21 A;  2DW4 A;  3SPG A;  4MV4 A;  1PM9 A;  3L2P A;  5EBM C;  2FML A;  3PFF A;  1W96 A;  4HAM A;  1NT2 B;  5BMV A;  1YIT V;  2HP8 A;  3TEK A;  1M9N A;  2GBO A;  3K03 A;  4DV4 O;  3H9V A;  4WHX A;  4GC6 A;  5IWA O;  2QK4 A;  5IYD O;  1JCH A;  4TV8 A;  3ZRS A;  3K04 A;  4GKK H;  5CBF A;  3KTM A;  5A2Q W;  1RSO A;  3LSS A;  3K5O A;  2XGQ A;  1SQX H;  4PD4 F;  3TIN A;  1KEE A;  2JA7 G;  2OIG A;  1TWG A;  2Z02 A;  2Y4R A;  1GSO A;  2CFM A;  2QR4 A;  3LSQ A;  2QTO A;  1Y74 A;  5LMN H;  1OCR C;  3N6X A;  2VUM A;  5B3S B;  2E5L H;  1BGW A;  1IDS A;  4JI7 B;  2MCT A;  2PYJ A;  3D3I A;  3CRC A;  2Q7E A;  3D8C A;  3BEH A;  3OR7 C;  5H9C A;  4EYI B;  2ZCE A;  1N36 H;  1IOV A;  2B63 G;  5KG6 A;  2EZO A;  2Y48 A;  4DIM A;  3BG5 A;  2MK3 A;  1H2S B;  2IJJ A;  4MV3 A;  2HEP A;  1LNQ A;  5BMV F;  1FFX B;  1OWT A;  1A3G A;  3G4S V;  4YHH H;  2RJZ A;  4RU9 A;  2X6A A;  1MZE A;  5KHG A;  3T4Z A;  4TV8 F;  2FJZ A;  1P7B A;  3OE7 G;  1GLV A;  4X1I A;  2UXB B;  2A79 B;  1NR7 A;  3JD1 A;  4B3R O;  2ZR3 A;  3R65 A;  4JAA A;  4LFC O;  3S24 A;  4LFB O;  2DIK A;  2V4Q A;  1WNS A;  2CKZ B;  4D7S A;  4W4L A;  3H20 A;  2YI9 A;  5JWP A;  5KFJ A;  3THO A;  3CJH A;  2QA4 V;  2UXX A;  4PA4 A;  5C1P A;  1AI5 A;  3F5W C;  2EJ0 A;  3R23 A;  2JEX A;  3T5K A;  1MMM A;  1YJN V;  4DV2 B;  4RUC A;  2JA8 G;  2CNQ A;  4OGQ B;  4B3T H;  4O4L A;  1UPG A;  2CK3 G;  3KRE A;  5D5P A;  3W1G A;  2WTF A;  1J5E H;  1ZTE A;  5I5S A;  5BMV B;  1PX2 A;  5JCO A;  2YZL A;  3FAV A;  2VR1 A;  3BHP A;  4EGJ A;  3RGX A;  1BE3 H;  1VBH A;  5IYZ A;  5B1B B;  2QDO A;  5TIS Z;  4TV8 B;  2CW7 A;  1V9P A;  3R5X A;  1RSO B;  2UXC O;  2WB1 A;  3FB7 C;  4NXM H;  3BAB A;  4DLK A;  1HDJ A;  2J9G A;  1F4M A;  4NTX A;  3KAK A;  5L9X A;  5B1B C;  3OSP A;  1JPX A;  3MR5 A;  4CH4 A;  2J6S A;  4FLY A;  2CDY A;  1Y74 B;  3GTO A;  2C2E A;  1BXR A;  2PGG A;  1EZJ A;  4YY3 H;  2OT5 A;  2LO1 A;  3Q8Q B;  1OCZ B;  1GSH A;  3OUU A;  2RMK B;  4KFM A;  4X88 A;  1Z5V A;  2PTM A;  5BR8 H;  2EX3 A;  2ODT X;  4KHP B;  5FLX N;  4F6R A;  2AHZ A;  1RPR A;  4P2Z A;  3P3P A;  4O3N A;  5KG3 A;  1GM8 A;  4UCU A;  1R9T A;  3ETH A;  4O7N A;  2SCU B;  1OCZ C;  3JCZ A;  4I4T A;  4OPH A;  2ZQM A;  3LSU A;  4JI5 O;  2NU8 B;  2ZM6 B;  4NYK A;  1Q43 A;  4PWQ A;  4O3S A;  4X66 H;  4CS3 A;  3QO8 A;  5CN0 A;  3BRC A;  4DUY H;  5IYZ F;  5GTH Z;  3K57 A;  3J81 W;  2WE6 A;  2P5O A;  1S5L Z;  1TWC A;  4X1I B;  1KU9 A;  5BZB A;  3TGU H;  1K33 A;  3K59 A;  4FFB A;  4Q4D A;  1VQ4 V;  2UUA H;  2ILM A;  2NUA B;  1N33 B;  1Y1W G;  3K3P A;  4A3K G;  2IM9 A;  2XAH A;  1KP3 A;  3PO2 G;  2LP7 A;  3OD4 A;  3CJH B;  5EYP A;  1NVP B;  2COI A;  3LQS A;  3L74 H;  3M99 B;  5D1P A;  4XDJ A;  4C7U A;  4ED2 A;  3MR2 A;  2FLP A;  2R93 A;  2A0L A;  1KMI Z;  2UUB O;  4J9N A;  4J7J A;  1H2N A;  2Y69 C;  3GJX B;  3I5D A;  4P9P A;  4FFO A;  2P7T C;  1BHB A;  4WFF A;  4J9Y B;  5D5Q A;  2EIM C;  1W59 A;  4KXR A;  4QE7 A;  1QLE B;  4MSW C;  2G38 A;  2NNU A;  3K0G A;  1K5Q A;  2FMA A;  1HNZ O;  3FAV B;  4I4T F;  4QGP A;  2YYA A;  1SQQ H;  5IYZ B;  1K9M W;  3BY6 A;  3CCS V;  3I4M G;  2GDS A;  3ASO B;  4ECZ A;  2FKL A;  1I3Q A;  2Z5U A;  1E1Q G;  2LFR A;  3OMN B;  4GLX A;  3HOZ G;  4XBF A;  3TY9 A;  3VQW A;  2V5A A;  2QTS A;  2JGU A;  3ASO C;  1KD1 W;  3R66 A;  1T3N A;  2CNU A;  3S3X A;  1AR5 A;  3F7Y C;  4NYE A;  1N34 B;  4MTF A;  3ZED A;  4DR2 H;  4LF7 B;  2YEV A;  1JXL A;  4DR3 O;  1KYO F;  3EFF K;  2YS8 A;  4F4X A;  1JX4 A;  2B1I A;  4AQY H;  4ZOL A;  4PI0 A;  2YS6 A;  4F6R B;  4CC6 A;  1Q5O A;  1JIH A;  3OAA G;  3TQT A;  3GIJ A;  3RFC A;  4I4T B;  1FXH A;  5C3E G;  4GKK B;  4Q20 A;  2AQ4 A;  1H2K A;  4MTO A;  1VQP V;  2F4V B;  1EKF A;  4LSA A;  4BW5 A;  4DV3 H;  3LP8 A;  3DF7 A;  4IT5 A;  4RQF A;  5KFT A;  3TXS A;  1OBD A;  3G6Y A;  4DL6 A;  3CXC U;  3GV8 B;  3IGA C;  4FFB B;  1XNR B;  4DW1 A;  1U97 A;  1US6 A;  5KFH A;  4R50 A;  1SZX A;  4O7W A;  4NVP A;  4O7R A;  2ITD C;  4TM5 A;  2W6I G;  5EYP B;  2C2D A;  2GPS A;  4MAM A;  4YR3 A;  3BQ1 A;  4DUZ H;  1FXV A;  3L73 H;  3SYQ A;  4H0L B;  2BTQ A;  5EK0 A;  1VQK V;  5L3E A;  2XTA A;  1N48 A;  3E83 A;  3C3S A;  2EUL A;  1RYS A;  2QE7 G;  4LCU C;  5KFE A;  4ZOL F;  5T14 A;  5IYC O;  1AI7 A;  1PL0 A;  1YF2 A;  4QPJ A;  5IP7 G;  4MV9 A;  4N23 A;  4YP3 A;  3TW6 A;  4DV6 H;  4AIL C;  5CBH A;  3Q8S B;  3OTO O;  1EKP A;  2DN9 A;  1Q8I A;  4LF9 O;  3RBZ A;  5LGU A;  4RZR A;  1FAF A;  1KUQ A;  2UVW A;  2FPP B;  4MS2 A;  2HJW A;  1MZB A;  3OEE G;  3K58 A;  4A5U B;  4DV1 B;  4QIW E;  5DIS C;  3T1H O;  4PZ6 A;  1EN4 A;  1Q90 D;  2WSS G;  2W6N A;  4HYK A;  3U0G A;  4QNH B;  1R3J C;  4YBZ B;  2YEV B;  4L87 A;  3L4J A;  5EBW C;  2YZM A;  2GHY A;  2F1M A;  1R6T A;  2YID A;  3F7V C;  4BR6 A;  3T9E A;  1KJI A;  2O03 A;  4MV7 A;  1E4G T;  4ZOL B;  1J5E B;  4WF9 V;  2Z3Y A;  1SRY A;  3QG5 A;  1KC7 A;  3DC5 A;  1CQI B;  2W8L A;  2ETN A;  3OUF A;  5KT5 A;  2HLD G;  3DTU B;  1XMQ H;  4YQW A;  3GID A;  4JV5 B;  5IY5 B;  1YIJ V;  2YRX A;  2GLT A;  4RB2 C;  1N32 H;  1E4F T;  3QF7 A;  2X6C A;  2E75 B;  1EUD B;  3OHB A;  4O3R A;  3N42 B;  4R6Z A;  4JAS A;  3TW7 A;  2F23 A;  3VOU A;  4GUN A;  4D7T A;  4YY3 B;  4IRK A;  4PBC A;  4JI7 O;  1SEI A;  1FVI A;  2BTQ B;  1QR8 A;  3ZMZ A;  5FNV A;  1XL6 A;  3CCM V;  2RDI A;  4EBC A;  5I5X A;  4NXN H;  4HBN A;  5H5N A;  4IHJ F;  5KFF A;  3N2G A;  2DWC A;  4YIP A;  2M6Y A;  2H8P C;  4X66 B;  2DYR B;  3JSN A;  3J7A U;  2ADP A;  3W7W A;  1Y4M A;  1OHH G;  5I60 A;  2Q7D A;  2DE0 X;  2UUA B;  1EBO A;  4Q6G A;  3R5H A;  2CTP A;  4B3M B;  3JD0 A;  5KAI Z;  3GWO A;  2DYR C;  3N8D A;  1Y1V A;  4RNM A;  2GQS A;  2PVP A;  1VP7 A;  2VWJ A;  5KFX A;  3JAS A;  4K3A A;  2KB1 A;  3MWE A;  3PW7 A;  1RFY A;  2QEX V;  4O4H F;  1XHX A;  1RJQ A;  2JEI A;  3UO3 A;  4DV2 O;  1WCM G;  3HOW G;  2W9C A;  4BWA A;  4F4Z A;  1BS3 A;  4IR9 A;  3RYC A;  3U11 A;  3E5N A; 
#chains in the Genus database with same CATH homology
 3VNN A;  3BA9 A;  3N40 P;  3JSL A;  3LNN A;  4O4I A;  4JI1 H;  3BPZ A;  4DR6 H;  3JAR A;  1L2Z A;  2YCH A;  5LMN B;  4LF8 H;  4YJ2 B;  5JJJ B;  4DR3 B;  2E5L B;  4LMY A;  2P22 C;  4X1K B;  4ZI7 A;  2GV9 A;  3E22 A;  4DK1 A;  4I55 B;  5LMU B;  3RGZ A;  4DV1 H;  1CKN A;  4LF6 H;  3T1Y B;  1N36 B;  2VQF H;  4HNA B;  1ZHQ A;  2KKW A;  4CH5 A;  2WDT A;  4IAJ A;  4CS2 A;  1M93 A;  5LP6 B;  2UXC H;  4GKJ B;  3UQ8 A;  2Q7G A;  2XHB A;  2ZM6 H;  2VOB A;  4O4H B;  1QQC A;  2YIA A;  4CC5 A;  3RGB A;  1P16 A;  4YHH B;  4FM9 A;  1VS0 A;  3SR2 C;  3NBZ B;  2E3C A;  1TGO A;  2V4D A;  3WB0 A;  2QJ1 A;  4AQY B;  2Q2T A;  2Q2U A;  5FNV B;  5LP6 C;  1G6U A;  3U10 A;  4EEQ A;  3JAW A;  4O2B B;  5FPO A;  3RYF B;  2OWO A;  3N2G B;  4GYC B;  4PDB A;  2VQE B;  1M0W A;  4Q0Y A;  4K0K H;  3TY8 A;  2HHH H;  1JFF A;  4JV5 H;  5EIB D;  4DV3 B;  4JI3 H;  5KX5 B;  4DRF A;  3N43 B;  1IBL B;  4FLX A;  1HNW B;  4L8J A;  3VQY A;  3BA8 A;  4LF4 B;  4B3T B;  4EQ5 A;  4IHJ A;  4I9Q A;  4DR1 B;  4LSX A;  3HKC A;  1FFX A;  4MTD A;  1I94 H;  3RTX A;  1JJO A;  5KHJ A;  4DUZ B;  3ETQ A;  4FM2 A;  3NC0 B;  3OTO B;  5LYJ A;  2UXD H;  1WH2 A;  3JAS B;  4DV5 B;  3RYI B;  3QTC A;  5EOY A;  1TAE A;  4LF9 B;  2R9A A;  1FKA H;  5CA1 B;  4CS4 A;  5CB4 B;  4NXM B;  3SGI A;  2WYO A;  3IG0 A;  5FLX W;  3RYC B;  2FE3 A;  4DRX A;  3T1H B;  3RWR D;  3J80 W;  2UUB H;  4DV4 H;  4O4I B;  5KHH A;  3JAR B;  4FLT A;  4X64 H;  4DR4 B;  5IJ9 A;  5LP6 A;  4UCS A;  1N34 H;  3MAQ A;  1WN7 A;  4O4H A;  3L2P A;  3RIZ A;  4TUY A;  1XI1 A;  2CAZ C;  4ZI7 B;  4B3M H;  2HVQ A;  1SYX B;  3E22 B;  4LR3 A;  2HVS A;  4JYA B;  5BR8 B;  1HNZ H;  1NT2 B;  4FM0 A;  1FJG B;  5BMV A;  1CKN B;  5GON A;  3GB8 B;  3FMA A;  4K8X A;  4OX9 B;  4TV8 A;  4GKK H;  2R70 A;  5A2Q W;  1RSO A;  3K5O A;  4A2A A;  3W1B A;  4CH3 A;  5JVD A;  4O4L B;  1HR0 B;  4ZHQ A;  1D5A A;  4RAZ A;  4DUY B;  3WB2 A;  1GYF A;  4LH6 A;  3EYY A;  5KX5 A;  4KL1 A;  4PZ8 A;  2CFM A;  2PYL A;  4JI2 B;  3JAW B;  5LMN H;  3N6X A;  3K5L A;  4E6N A;  1X4T A;  4DR3 H;  1SQG A;  2E5L H;  1BGW A;  1TA8 A;  4LF5 H;  3J7A K;  4JI7 B;  1XMQ B;  2MCT A;  2PYJ A;  1Z2N X;  3QWU A;  1XK5 A;  2Q7E A;  1JFF B;  2UUC H;  5JCO C;  4X65 H;  1Z5W A;  5LMU H;  4WBN A;  1N32 B;  3T1Y H;  2ZCE A;  1N36 H;  5IWA B;  3JAM W;  4X62 B;  4FLV A;  4LFB H;  4CH6 A;  4PI2 A;  3SJB C;  1SQF A;  4IHJ B;  3KYH C;  1H2S B;  4EB6 A;  2HEP A;  3HKC B;  1FFX B;  5D1O A;  3HKD A;  4YHH H;  2RJZ A;  4JI0 B;  5LYJ B;  5KHG A;  2ZIO A;  4X1I A;  4UCR A;  1TVK A;  3CSX A;  2UXB B;  2Q0A A;  3S24 A;  5KHI A;  4AHC A;  4TV9 A;  1WNS A;  4DRX B;  4D7S A;  2VQE H;  3H20 A;  2YI9 A;  3THO A;  3TY5 A;  5FD5 A;  5IJ9 B;  4DV2 B;  1IBL H;  4B3S H;  3GDE A;  4DR2 B;  4B3T H;  3KXY T;  4O4L A;  3A2F A;  4TUY B;  1JMK C;  1BJT A;  5D5P A;  3W1G A;  1HNX B;  1J5E H;  5BMV B;  2RQ6 A;  5FD6 A;  5K1P A;  5JCO A;  5GON B;  3OTO H;  1M5I A;  3BHP A;  3RGX A;  4DV5 H;  5JQG B;  5IYZ A;  4DK0 A;  1XNQ H;  4TV8 B;  1M0T A;  4EFB A;  2CW7 A;  1V9P A;  1XMO B;  2HIV A;  4NXM H;  5JVD B;  3BAB A;  4ZHQ B;  5LOV A;  3T1H H;  5EIB C;  3SJA C;  3KAK A;  1T5E A;  4DR6 B;  4CH4 A;  3WB1 A;  5JH7 A;  4FLY A;  3JAK A;  4YJ3 A;  4BW9 A;  4JI6 B;  4JI5 H;  3HKE B;  4LF8 B;  2PGG A;  4MTE A;  1DGS A;  2YIB D;  3K5N A;  4FLU A;  5IJ0 A;  4YY3 H;  3MWM A;  2JVD A;  1Z5V A;  1A0I A;  2PTM A;  5BR8 H;  2EX3 A;  2PZS A;  1IBK H;  3HKB A;  1FJG H;  4WBN B;  4JI4 B;  4KHP B;  4F6R A;  5CA0 A;  4LF6 B;  4PHZ A;  2KSW A;  2VQF B;  4UCU A;  4X20 A;  2QM4 A;  4I4T A;  4EB6 B;  2ZM6 B;  5D1O B;  2R72 A;  3HKD B;  1Q43 A;  4X66 H;  4CS3 A;  1Z2O X;  1HR0 H;  3BRC A;  3OTF A;  4DUY H;  3J81 W;  3K57 A;  1O9H A;  4DV6 B;  2WE6 A;  2P5O A;  1QHT A;  4U3J A;  2VPS A;  1O75 A;  4X1I B;  1KU9 A;  3K59 A;  1TVK B;  4FFB A;  2UUA H;  4X1Y A;  1Q3E A;  3KAL A;  4LFA B;  3ZS8 C;  1N33 B;  2UU9 H;  1B04 A;  3UT5 A;  1TUB A;  3IAY A;  4TV9 B;  2IM9 A;  4DV0 B;  4JI7 H;  4I50 A;  5LA6 A;  5EYP A;  5D1P A;  4K0K B;  2HHH B;  3JAL A;  5K1X A;  1KMI Z;  1P8L A;  4DR5 H;  3RR5 A;  5JQG A;  3GJX B;  5KMG A;  1VF7 A;  5D5Q A;  3RFR A;  4EFE A;  1L8D A;  1SA0 A;  4LNU A;  4JI8 B;  4R7R A;  3JAT A;  5C8Y A;  4JI0 H;  5J2U A;  2UXD B;  1ZAU A;  5IYZ B;  3HKE A;  4DV7 B;  4BWS C;  1O9G A;  4GLX A;  1CKM A;  3CHX A;  2JS5 A;  3L4K A;  5LOV B;  3TY9 A;  3VQW A;  4DV4 B;  2JGU A;  5JH7 B;  3JAK B;  4YJ3 B;  4X64 B;  4DV2 H;  2ZNJ A;  3VQX A;  4GKJ H;  1N34 B;  3ZED A;  5IJ0 B;  3CVZ A;  4DR2 H;  4LF7 B;  2HIX A;  3NBY B;  1YEW A;  5EZY A;  3HKB B;  3N44 B;  4ZOL A;  4PI0 A;  4AQY H;  4O4J A;  4F6R B;  5CA0 B;  5ITZ A;  1I6U A;  4NXN B;  4CC6 A;  1Q5O A;  3CB2 A;  4X20 B;  4K8Z A;  4I4T B;  4GKK B;  4O2A A;  4FLW A;  2F4V B;  4LSA A;  2HVR A;  4DV3 H;  1X9N A;  3DF7 A;  4U3J B;  3RYH A;  4UCV A;  1CKO A;  4IIJ A;  1HNW H;  4FFB B;  4X1Y B;  1XNR B;  4LF4 H;  4DR7 B;  4JI6 H;  4M7E A;  4RB1 A;  4DR1 H;  3UT5 B;  1TUB B;  4NVP A;  3C0F B;  5JJN B;  4LF5 B;  4I50 B;  5LA6 B;  2XIG A;  5EYP B;  4RZQ A;  1S03 G;  4DUZ H;  2F93 B;  3JAL B;  4RB0 A;  2UUC B;  3KAJ A;  4X65 B;  2BTQ A;  4JI4 H;  4KHP H;  4FLZ A;  5KMG B;  4B3R B;  4LF9 H;  4LFC B;  1IBM B;  4LFB B;  4UFZ A;  5KHK A;  3FFQ A;  4APM A;  1SA0 B;  3ICX A;  4LNU B;  3JAT B;  5C8Y B;  2RGR A;  4JI1 B;  5J2U B;  2W57 A;  4MV9 A;  4ETS A;  1M4U A;  4DV6 H;  4A2B A;  4DR4 H;  4AIL C;  5J2T A;  3VQV A;  4LFA H;  1Q8I A;  1N33 H;  4ZIB A;  5LL6 b;  4UCT A;  3F8N A;  4JYA H;  1Z2P X;  4DV0 H;  1MZB A;  2ZNI A;  3K58 A;  4DV1 B;  5DIS C;  4PZ6 A;  2VWK A;  3M7M X;  1XQ8 A;  4OX9 H;  3N2K A;  2UXC B;  5LXT A;  4B3S B;  2F66 C;  4RAY A;  4PZ7 A;  3L4J A;  2F1M A;  5FPR A;  4JI8 H;  2O03 A;  4MV7 A;  5EZY B;  1E4G T;  4ZOL B;  3SJC C;  1J5E B;  1ZHS A;  4O4J B;  5ITZ B;  2ZIM A;  4FVM A;  2F95 B;  3QG5 A;  4JI2 H;  4YJ2 A;  1XNQ B;  4LH7 A;  2YXL A;  4DV7 H;  4O2A B;  3W5O A;  1XMQ H;  4X1K A;  3K5M A;  2ZJT A;  4I55 A;  4JV5 B;  2VUG A;  2Q7H A;  4JI3 B;  4RB2 C;  3HXL A;  1N32 H;  1E4F T;  3RYH B;  4J0M A;  3QF7 A;  4B08 A;  5IWA H;  4X62 H;  4IIJ B;  4HNA A;  3N42 B;  3LML A;  4JI5 B;  4D7T A;  1AN7 A;  2CW8 A;  5IT9 W;  2YIB A;  1I7F A;  3M4I A;  2PY5 A;  4YY3 B;  1S5J A;  4LF7 H;  4TOI A;  1I94 B;  1SEI A;  4TQF A;  1FVI A;  1XHZ A;  1IBK B;  2BTQ B;  2YI8 A;  5FNV A;  4I7H A;  2UXB H;  4NXN H;  4HBN A;  4O2B A;  3B2E E;  1HW7 A;  3RYF A;  3N2G A;  3RJ0 A;  2F4V H;  2UUB B;  4RB3 C;  4X66 B;  3JSN A;  3DSQ A;  2RGV A;  5J2T B;  4UCO A;  1XDN A;  1XNR H;  2UUA B;  4TQD A;  4DR7 H;  3U0Z A;  1SKV A;  3RF2 A;  4Q6G A;  3BAA A;  2UU9 B;  4B3M B;  1WPB A;  1HNX H;  1HNZ B;  5JJE B;  3N41 B;  3K3V A;  2OYQ A;  2VWJ A;  3PN1 A;  3JAS A;  2BTO A;  3RYI A;  1P49 A;  4DR5 B;  2HGS A;  4B3R H;  1XHX A;  3N2K B;  5LXT B;  1IBM H;  4LFC H;  1XMO H;  4FM1 A;  2PUS A;  2ZIN A;  5CA1 A;  4BWA A;  5CB4 A;  1S68 A;  3RYC A;  3U11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...