4UCOA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucoA02
2VQFB 4GKKB 1CKNB 4PZ8A 3BAAA 2UUBB 3SGIA 4LH7A 4DUZB 4LF5B 4DR4B 1V9PA 4CC6A 4LF4B 1FJGB 5D1OA 2Q2TA 1HR0B 2UUAB 1N33B 2UUCB 4X66B 3GB8B 1VS0A 4KHPB 4EFBA 1DGSA 4LFCB 4NXMB 4UCSA 1XMOB 5LMUB 3S24A 4JI7B 4DV6B 1XDNA 4DR1B 1CKNA 3W5OA 3PN1A 2CFMA 3OTOB 4JYAB 4UCTA 4B3MB 4JI3B 4JI1B 4JI2B 4EFEA 2E5LB 1XMQB 3TY9A 4LH6A 3W1BA 3BA9A 1CKMA 3T1HB 4JI4B 1CKOA 1J5EB 4B3SB 4LFBB 4UFZA 2UXCB 4LF6B 1X9NA 2Q2UA 1XK5A 4EQ5A 4B3RB 4JI5B 1ZAUA 4UCOA 1HNXB 2ZM6B 1A0IA 4LFAB 4DV7B 5D1OB 4DR2B 4JI6B 1IBLB 3L2PA 4LF7B 1P8LA 4DR6B 1P16A 1HNWB 4DV4B 1IBKB 3T1YB 4UCVA 3VNNA 4DR5B 4DR7B 4NXNB 5D1PA 2HVRA 3UQ8A 4PZ6A 4PZ7A 2UU9B 4JV5B 3GJXB 3JSNA 3KYHC 3TY5A 4DRFA 1S68A 5DISC 4B3TB 2F4VB 4DV0B 2HHHB 4AQYB 4UCUA 1TAEA 2HVSA 5IWAB 4YHHB 1I94B 4X65B 5FPRA 4DV3B 4X62B 3GDEA 2VQEB 4DV1B 4UCRA 1IBMB 2OWOA 4LF8B 4TOIA 3RTXA 3NC0B 3W1GA 1HNZB 3JSLA 4X64B 1N34B 5FPOA 5BR8B 4DR3B 2VUGA 4CC5A 5LMNB 4JI8B 2HVQA 4E6NA 1XNQB 3NBZB 4OX9B 4EEQA 3TY8A 3BA8A 1TA8A 4YY3B 4DV2B 1N36B 3BABA 1FVIA 1N32B 2UXBB 4K0KB 2HIXA 4JI0B 4GKJB 3RR5A 3NBYB 3QWUA 2UXDB 1B04A 4GLXA 4DV5B 1XNRB 4LF9B 4DUYB 2HIVA
chains in the Genus database with same CATH superfamily
1B6SA 5L9XA 4FFKA 4MVRA 1CS0A 2GTAA 1B3QA 2V4RA 3KHLA 4ED8A 4RUFA 1KKDA 3P3PA 1SQVH 4LC1A 4LF5B 3JZ6A 4PV1B 4LFAH 4U3FH 5CR5A 1SZTA 4RB0A 5KX5A 2CQYA 2W71A 5IDJA 3FKIG 4YR3A 5CA1A 1VMGA 1B06A 2FLNA 4NTWA 2EIYA 3CWBH 1NTKH 4A3IG 1Y1WA 5K1XA 4O84A 2VWJA 4GUNA 4B3TH 2CZGA 3T4ZA 1K3EA 2FKXA 3W5OA 2NVYA 1Y76B 3OTOB 1DF4A 4J9PA 1KYOF 3GWOA 5LMUH 3SYCA 4QIWA 1AI5A 4U3JA 3KHRA 4AILC 3LP8A 2YW2A 5KFNA 2EZOA 3GV5B 2W6JG 1X9NA 1IDSA 2P4KA 3ZMZA 5IYCG 3M4IA 4JI5B 3N44B 1I6UA 4QPJA 3OAAG 2DMXA 4LWSA 2AGAA 4RQEA 1IBLB 4FZ0A 3MWMA 4DR5O 2FL4A 2GTSA 1XMQH 1R3LC 5JH7B 2E5LO 5HNEA 3T5JA 2OCCB 1ENVA 2YIBA 4UB6Z 3H1LH 2HGSA 4LFBH 3R5XA 4UXNA 1PD3A 3GVMA 4IIJB 4J10A 2BQUA 2ZD9A 1WP7A 2KSWA 5IYZF 2W7PA 1VQKV 1E4EA 5I5YA 5EIBC 2W70A 4ZHQB 1B33N 2YS6A 5KHHA 1IYDA 4ETSA 2E3CA 2IJHA 3FMAA 1VQOV 2XGPA 4FBUA 5CA1B 1SA0B 3BVOA 1TAEA 4FBTA 4WBNF 4Q44A 2Y0PA 2RDIA 5FPRA 4X1KA 2OT5A 3T9AA 4TQSA 1R3KC 2P4VA 3GTLA 3EPIA 4I55F 4FLVA 3NC0B 4DQNA 3CP1A 2JJ2G 2ZNIA 2N74A 5J2TF 3VOTA 4B3TO 3RT3C 4DR3B 1Q6HA 3E8BA 4DV5H 2IU0A 3OM3B 4E6NA 1S5JA 1DIKA 3I12A 1SRYA 3ABKC 1ROPA 3P30A 1FYJA 2QSAA 1WN7A 1H8EG 3OEHG 3ZMTA 4YAKB 3SE7A 5BPHA 5HFLA 5IYDO 1F23A 3KXYT 3ZBHA 3ASNC 3IJ4A 3SR2C 3G6EV 1XNQO 2VR1A 2JA7A 4LF9B 1OBGA 4CH6A 1OCCC 1NZ6A 2LFRA 4IIJA 3JALB 3BAAA 3FAVB 5H9CA 4JYCA 1CQIB 3VPCA 2E74B 1YHQV 3ZHRA 1I1LA 4LSXA 1IBLH 3GTPA 5EIBD 1Q8IA 4TUYA 3J7AU 2XD4A 2UVUA 4TQFA 1BZKA 4GCZA 2OH2A 5LP6B 5CN0A 4K8ZA 2ZXWB 5KG0A 1Z2NX 2PMZE 5C1OA 2WA3A 3S24A 1I2LA 3ZHSA 3FD9A 3KG2A 2PMZA 4A2AA 4DR3H 2CTQA 4JZGA 2DWDC 4CS4A 3MHSC 1Q86W 1UC8A 2WAMA 4UCTA 3CS5A 4JI3B 1RP3B 2X5RA 5KFIA 1CKOA 3ETHA 1J5EB 4M7EA 4ZOLB 4DV5O 4B3SB 5KFDA 2R93A 2XOKG 4PDMA 5JVDA 3ASNB 4DXWA 3JAMW 3GV7B 2YDEA 3STLC 4P30A 4BIOA 1BE3H 1P8LA 4O2AF 1P16A 1UC9A 3T1YB 3B8NA 4IR9A 3BPZA 3U9SA 4MTFA 1NQTA 4LBEC 2V9WA 4JAAA 3ABTA 2Z3YA 4O4LB 2DQ0A 4C5CA 2NU6B 5FJ8G 2VQEH 2QWOB 2PN1A 1KP2A 1NVPB 4LWSB 1B6RA 3U10A 2HVSA 1YIJV 1M93A 3K9AA 2YS8A 3F5WC 3FYEB 3MHHC 4KHPH 5KHIA 1AILA 2GQRA 2R92G 1P7BA 3M9OB 3SJQC 1M57C 3T1HH 2VA3A 3JSLA 2RDCA 3CSWA 3JAKB 5CB4B 2V7QG 1RPOA 1GN6A 2UUAO 4J9RA 1RK6A 3ZMVA 2JEXA 2H3OA 2IW5A 5DLGA 2VWKA 5FLXW 1AVMA 5HFMA 5B1NA 3E83A 3ZS8C 2EIMC 1MZBA 2W8LA 4DUYB 3KALA 3C90A 3ETEA 2R7MA 4LNUA 2UVRA 4RWUA 4NVPA 2CTRA 2HJWA 4K0KH 1W0JG 3MD0A 4I7ZB 2FKLA 3ABMC 5JH7F 2BOCC 3SYOA 1XL4A 2WA4A 3GTGA 4CH3A 3SJAC 4JI2O 2ODMA 2PZSA 4MS2A 4I50F 4KHPB 5LGNA 1A48A 4I7HA 2ITDC 2LP7A 4NXMB 5IJ0A 4GZRB 5CMUA 3HKBB 4F6EA 3GILA 1EHIA 3H4DA 2DJVA 2E2IA 1W0KG 5HV6A 2LFSA 2ZIMA 4YB8B 3K3PA 2Y4TA 5EBMC 4KHPO 3ORQA 3DXRA 4DL3A 1SQGA 2X6CA 4HR7A 5LYJB 2E5LB 2JEIA 4A3GG 3L72H 4X88A 1DK1A 1GYFA 4D7TA 1I7FA 2UXCB 3K04A 5GW7A 2RMKB 3CSXA 3D36C 4UUGA 4B3RB 4YBZB 2V59A 1FKAO 3DC5A 1N0JA 2ZE7A 4I4TF 4YP3A 4JTDB 2BQ3A 4JAUA 4DR6B 1HNWB 4EYIB 1RYRA 3VNNA 1I5XA 4JI6O 3DAAA 4XX0B 1AB3A 4Z1VA 2HLDG 1M0TA 5I60A 3RIZA 4X65H 5BWVA 3N42B 2FMAA 3KYHC 5C4XG 2ZQMA 3Q8PB 1IXBA 3WG7B 5KLVH 1FFTB 4JI5O 1YSCA 3ETDA 1H2MA 4JI2H 5GTHZ 2RF4A 4IHJA 5KFUA 4O81A 5K2MA 4JI8H 4H13B 2PYLA 4WFAV 3GDEA 3RV4A 1G2WA 1LR1A 1XHXA 4ZIBA 1GN2A 1YDXA 3KHGA 2OIGA 2XIGA 1CE8A 3KAJA 3QZ8A 3SJBC 5LHGA 3CB2A 2CW7A 2PY5A 1ZLZA 2QKAA 4O82A 4NYKA 3BQ2A 4BWAA 1ZETA 4DV4H 4Q20A 2EBOA 1L1FA 3BA8A 4CKCA 5KG7A 1S0OA 1JQ0A 3DF7A 4NXNO 1GLVA 1WJZA 1OCOB 3T9CA 1XEQA 5KFMA 1JCHA 4O4JB 4EKWA 3H20A 4XYLB 1K5QA 1M7JA 2GPSA 2A79B 3V4SA 2WLJA 3LSQA 1XHZA 3A0BZ 4GLWA 4O4JF 5C44G 5LOVB 3N2KA 3GTKA 5C93A 1SQFA 1F4NA 4X65O 5KKNB 2Q2TA 2R9AA 3HKCA 4O2BA 4YJ3B 2CH7B 1TUEB 3L74H 2CUGA 4NLGA 2JDIG 1Z2OX 2R6FA 1EN4A 1N4CA 3MJFA 4JI7B 4LNUB 5L3DA 2ETNA 3JAMN 2QEXV 1R9TA 2XHBA 1K7DA 1S5LZ 4OPAA 1XQ8A 3WWHA 4IYHA 2QYZA 4QPKA 4LMYA 2J6TA 3CRRA 3CC4V 1FXKB 1WP8A 1JFFB 2EULA 4FVMA 2CNQA 1KT8A 4UV8A 4QNHB 3WWJA 3E22A 2Z02A 5KAFZ 1M0WA 1HNXB 3KHHA 1BS3A 2DYSC 3ETGA 4NXNH 2XAGA 2JA7G 4PA6A 3D8CA 5DG7A 4QWEA 3S3XA 3RYCB 4FZ1A 4NTYA 1K1SA 3E8HA 4DR5B 4B3SH 4DV7H 3JALA 3ZN0A 4WFBV 4A3DG 1Q43A 5I5TA 3OMIB 4JI7O 3D3QA 4E4TA 4ED0A 2RDJA 3H1IH 3B09A 4O3SA 1JDBB 3K0DA 2IJKA 1NTMH 3CHXA 2QTSA 3GIJA 1N0NA 3APQA 1RFYA 1VAJA 1K34A 2HJFC 4N21A 2ZCEA 4O2BB 5KX5B 2Q68A 1EKVA 2HDKA 3EHBB 4TOIA 3ZHTA 4L1KA 3N2GA 2YCHA 4TT3G 1VKZA 2FTKA 3LDDA 4P9OA 1XMOO 1R3JC 1IOVA 1KJIA 3H01A 4O7YA 2GQSA 2XCPA 1HNZO 1BMFG 3I55V 3NBZB 2R72A 4I9QA 5IYZB 5KHKA 1TA8A 3U9TA 3LNMB 1GMGA 3VQVA 1XI1A 1CEZA 5EWFA 2HIXA 3AEIA 2EJRA 2W8KA 4X1YB 5KFWA 1IYEA 2Q7EA 4PWQA 2IH3C 5B1AC 1M56C 3JASB 2J6UA 3OUFA 3PW4A 3K5OA 3GTQA 2ASJA 1KP3A 1US6A 1JVMA 3HOUG 2HG5C 3SGIA 3FKSG 2OCCC 3VQWA 2AGQA 1Y74B 2N04A 3GIIA 4FFOA 1ZHSA 4PA3A 5E25A 3RAXA 4JI7H 1FS0G 2Z04A 4Z2WA 1HR0B 2DZDA 1R73A 3Q8QB 2C2AA 4X20A 3U55A 1VS0A 4J9NA 1DGSA 4B7EA 3V4ZA 2V1DA 4LFCO 4O7VA 1R6KA 1M56B 2RQ6A 1PNMA 4JYAH 4AQYH 2YS7A 4JASA 4ZQIA 1I2KA 1Y6XA 4UUJC 2R85A 4JPRA 5I5XA 3N2KB 3ZX6A 4QWBA 4MTEA 1ZUQA 4RNMA 2HKOA 3C3TA 4B3MB 1VARA 4JI2B 1THZA 3LQSA 3BCCH 1XREA 3HT5A 4JI4B 5JVDF 1NKDA 3AK1A 1I50A 4YXWG 4MW3A 2IA6A 4FLXA 3LMLA 1E4GT 1MABG 4WF9V 2YXHA 4DV7B 3B8MA 3LSSA 4H37A 4Z1MG 5IYZA 1R3IC 5GONF 1S03G 4DR7H 1A9XA 4FGRA 1SETA 1YJNV 4YY3O 2JRIA 4PA7A 3J81N 2UXDO 1G6UA 1NR1A 1FJGO 5FNVF 4LF6H 4JI0H 4X1YA 4DUZO 3WWIA 3N6RA 4NXNB 3L4JA 2HVRA 2P22C 3HOWG 4PZ7A 2Q0OC 5T14A 2DYRB 3IG0A 1TWGA 4D7SA 1ET0A 1N56A 2HHHB 1BSMA 2QWPB 2QTOA 3PO3G 1IOWA 4AQYB 3N8DA 3CCQV 5DAAA 4B3MO 1VQNV 3AW8A 1GSAA 5FD6A 4TSFG 3PZPA 2Y4UA 1HP8A 3G67A 1UPGA 3KTMA 5L3CA 5D8DA 3OE7G 3E22B 3CX5F 3LULA 5DQHA 4LFCH 2WSSG 1Q90D 5LP6A 5KG1A 1RSOA 2XTAA 2KB1A 4JGSA 4AQYO 1GKFA 1Q6IA 2VPSA 4IRKA 2WYOA 2HHHH 1IURA 4A3CG 4NTXA 3CXHF 5LGTA 1WH2A 1BJTA 5JJNB 3N6XA 5DM6V 1OJHA 4TV8B 3TY8A 2ZR3A 5IT9N 5B5EZ 3T9FA 4DV2B 3BABA 5EYPA 2YRXA 1IBKH 4JI0B 4O7SA 3CCRV 4R8CA 5H2FZ 1I7NA 2ILMA 3IN5A 3QWUA 4ECTA 2N05A 4ZOLA 2R9RB 3GIDA 4EB6B 4ED7A 4FS2A 1E4EB 1GM8A 3THOA 3SNOA 4WFHA 5LA6A 1N34O 4PI0A 4K6NA 2RCVA 2UXDH 2AGOA 3OFNG 5EBLC 3UCSC 4JI0O 1GN3A 4LF9H 2EJ7A 1NBMG 2YRWA 5KT5A 5IY5C 2ASDA 2DQ3A 3ZCCA 2XGQA 2R93G 4CC6A 3SI8A 4TV9A 3JD0A 4AHCA 3RB0A 1FXKA 4X66B 3RGBA 3GB8B 1DLBA 3LDEA 4FLYA 2HR3A 2P7TC 4DW1A 4MV4A 2PBZA 4B3MH 2VUMG 5DG9A 5LMNH 5JQGB 1YTFB 3GQCA 2BSKB 2OCHA 4DV3O 2C35B 4KP4A 3JRWA 4A5UB 2DPIA 4IRDA 4K35A 1JLLB 5EC1C 1V55C 1G1XB 1XMQB 2HHHO 3I4NG 4FK5C 5L3FA 2PI4A 1EYZA 1KJJA 1NR7A 3R66A 1JMKC 2M6YA 4EQ5A 2CTPA 1VQMV 2E2HA 2IU3A 4JI4H 5BZBA 1IBKO 4Q4CA 3IFXA 4WBNB 2L6LA 1K5SA 5KT3A 4O4HF 4TUYB 2UU9B 4YIOA 5EC2C 1BGYH 1SERA 3OSPA 1RK5A 4CZZA 4G27B 2F4VB 3MR2A 3OUUA 2IJIA 3OGIB 3CC7V 2CH7A 4XBFA 4MVQA 3T1CA 4BBRG 2UVVA 1L8DA 4IR1A 5KFRA 2VQEB 4UCRA 4MTXA 1VIBA 2BCCH 3RYFA 4RCNA 3WG7C 2NU7B 3W1GA 3CPWU 5LMNO 2V4QA 4D6TH 1BXRA 4EYHB 5KHGA 1N34B 1MZFA 3G8DA 2VUGA 4CC5A 4O7NA 2OIEA 1SC5B 1BNCA 2NR5A 3HB3B 5J2UF 3OUSA 5KFVA 2VOBA 3ETJA 1EZ1A 1MG1A 1VBHA 4O86A 1N36B 1W59A 3D3IA 2QF7A 5K3WA 5L1LA 4DR5H 3MR5A 1JXLA 1Y67A 2E5LH 3HXLA 3OR6C 4K8XA 4ECQA 4DR4O 4BR6A 4YR0A 1E1RG 2FK1A 1OWTA 4A3JG 4JI4O 2QA4V 4YIPA 3NGDA 1O75A 2GV9A 2ITCC 1RSOB 5JCOA 2YWVA 2P5OA 1CKNB 4WFGA 1I3QA 2BTQB 1V55B 1BHAA 5KT4A 4U7OA 2DYRC 1VQLV 3OHAA 4WBNA 3F5TA 2PGGA 3SPCA 1TWFA 2JJ1G 1EKPA 5IE9A 3NR7A 4JI1O 1SQQH 1FJGB 5KS8A 5TISZ 1M9NA 4FFLA 5D5QA 1MOFA 5I5UA 1KQSU 4FU0A 1OHHG 3JATA 3CXCU 2R7ZG 1GK9A 4LCUC 1EN5A 3B77A 1GM9A 2QKCA 2MK3A 5EZYB 1J5EH 1UNNC 2WPDG 5B1BB 1HW7A 2F4VH 4A3MG 3AG1B 3G6YA 1SS3A 4TM5A 2R8IA 3B40A 5KUMA 1Y1WG 3N27A 4PDBA 3HOVG 3N41B 5KFOA 2IJJA 2XT9A 2B63A 5LXTF 4B7KA 4P2ZA 1BQ0A 2COJA 3ORRA 1FAFA 1XK5A 4KL1A 2NVXA 3Q4HA 3N40P 1KEEA 4Q45A 3QNEA 5LBQA 2AU0A 1XNQH 2WB1A 4J9YB 3FKIA 4DR2B 3CEBA 4CE5A 5KFBA 4QE7A 3V6HA 2AHZA 3K03A 4MTOA 2B9ZA 5B1BC 4DR4H 4UB8Z 1IBLO 2CW8A 2PVPA 2GLTA 2MW2B 3GWKC 1WNSA 4L8JA 2XCLA 3W7SA 2CE4A 4PZ6A 2Y4RA 4U3JB 5BWUA 2UXCO 3H9VA 5H6QA 4J9MA 1Y66A 3KCYA 1WLEA 1B6QA 4QJFB 2W9CA 1F7YA 1S68A 5ITZA 1R6TA 2F1MA 3ZRWA 2ABJA 4JI1H 2A0LA 2QM7A 1AI4A 4J9QA 2C2RA 5HBRB 2C2EA 4X89A 4LF8B 5LYJA 4U7NA 2R70A 2F93B 4AYBE 3S3WA 4DK0A 4GT1A 5BMVF 5F9NA 2F4VO 2BQRA 3HOYG 4J7JA 2W9BB 3TINA 1PKXA 4GKKH 4KFMA 5IP7G 4FM0A 1U96A 2V4DA 3AK3A 4OPHA 2PI5A 4UVAA 4FFBA 3RR5A 3X2QC 3CVZA 4CS2A 5CAEB 3HBLA 3ABMB 4R8UB 1C3OA 2HHFA 3MDSA 5KFPA 3EVKA 3AG3C 3KAKA 5C8YA 1S0MA 1CXZB 4NZNA 1VF5B 2P90A 3EXAA 2XAHA 2VQEO 3R23A 3U0ZA 1XL6A 1XOUA 5BWXA 2X7RB 2FE3A 1K83A 4O2AB 3L73H 1N33B 1AI7A 2UXXA 4DR1H 4IAJA 4TWKA 5LP6C 3DSQA 5ITZB 1JKJB 1KKCA 4X8AA 2IM9A 4RU9A 4MW8A 2QWNB 1CPYA 3T1HO 1AJPA 2L35A 3BJYA 1KU9A 3VMMA 3ETQA 1PPJH 3OSNA 3PN1A 2F23A 5J2UA 3FAVA 3J7AK 2HVJC 4FLUA 2EINB 2UUAH 4WHXA 1SZXA 1JPXA 4JYYA 3WNZA 1ZX3A 2DABA 2WAQE 1P84F 1WA8A 4FM9A 3T1HB 4TV8A 2ADQB 2VS0A 1OCCB 2FMLA 2Q7GA 2NN4A 1AN7A 4QWAA 4GKKO 1KB9F 1M57B 3TJTA 2DOSA 1VQ5V 1H2LA 2VRZA 3X2QB 3HKCB 2COIA 1JX4A 4MV6A 4LF7B 3CE2A 5C8YB 2W6NA 3TW6A 1KECA 1XDCA 3PR5B 4IGGA 4LF5H 3CYOA 4K0KO 2HEPA 4QW8A 3H1JH 4R8UA 4BWSC 3UQ8A 1KMIZ 5I5WA 4JV5B 1JR9A 3SPIA 1Y14B 1QR9A 4MVSA 4MAMA 1KBLA 3BQ1A 2RJZA 4ED1A 1IZ3A 4F4YA 4OGQB 1TWAA 2A7WA 4I55A 5JWPA 3Q4HB 1WB8A 3O65A 5IJ0B 3U54A 1WAZA 4GC7A 4W4KA 2JIZG 2LO1A 4DR1O 1GTOA 4NZMA 1RYSA 1IBMB 3VQXA 3NUAA 5JQWA 5LOVF 2GDSA 2HG8A 2CNVA 5IYBG 4I0XB 1K4CC 4X64B 3CC2V 5C5JA 3CJHA 3K5LA 4QJFA 4H44B 2W9CB 4J9OA 5CBGA 4GX5A 3CD6V 2GSMB 1HR0O 3RN4A 4J9LA 4CBCA 2VUMA 2H8PC 3RB3A 5KFFA 3RFCA 3UZOA 3VQYA 1EUCB 4HZ3A 1HDJA 4MA5A 5BWTA 3R5FA 4J9ZB 1VQ6V 3K3VA 2Q6AA 4FIPC 1DTOA 5KFSA 2FB9A 3CCSV 3ASOB 3OMNB 2QK4A 1N48A 1ULZA 4E4EA 1JDEA 1SCUB 4XDLA 1V54B 5L1KA 3AYHB 2YYAA 3Q2OA 1MZEA 4JTCB 5J9PC 5DQIA 1NTZH 1L0NH 1Z5VA 3HKDA 4JI5H 2ZM6H 1V9PA 1SFOA 1AI6A 2QM8A 3AG2B 4ZI7A 4HBNA 4UVBA 4LF7H 4Y8VB 3STZC 3F8NA 2UUCB 4JI8O 2LJ2A 4FFBB 3CRCA 4JF3A 1A32A 3F7YC 2Z0AA 1MA1A 5H5NA 1JX9A 5LMUB 3OR7C 5CB4F 1N33H 5JVLA 3U11A 3G80A 1PNKA 5DEDA 4DV6B 1NH2B 3GTJA 5E79Z 4C5BA 1TWCA 2DW4A 1QNMA 2X6BA 3UKMA 4JYAB 1D2DA 4DV4O 2QWQB 1RM1B 4JI1B 4YJ2A 1NI8A 3K5IA 4W4LA 5KFAA 4IWYA 4DV6O 3CCVV 4A3EG 3G6BA 1XNRO 4LFBB 4DIMA 2W9AA 3G71V 2Y69C 2WLIB 2LW7A 4LFAB 5KFXA 3D36A 3L2PA 4X20B 2Q8VA 3TXQA 4BAYA 2X0LA 4DRXA 2V5AA 1TGOA 4O2BF 3T2MA 5KX5F 3W7UA 2YI8A 3DXRB 4DV2H 4LP8A 1Z2GA 2QB5A 4HNUA 5CA1F 3PO2G 5IT9W 1IX9A 5EOYA 4X64O 4XYMB 5EZYF 3CCMV 5KFYA 2YZLA 4PD4F 5LA6B 1Q82W 5DISC 5KUKA 4DL6A 3CRAA 1T5EA 4RB2C 2JA5G 1G4YB 2EZPA 3T5LA 3M9MB 2P6JA 3RYHB 4IIJF 2MCTA 4O7LA 1WCMG 5K1PA 1SQXH 2WLLB 5IY5B 3SYPA 4PDVA 4TV9B 3LNNA 3NXSA 1I94B 4O4HB 4O4IF 2XAQA 4JI3H 4F50A 1VF6C 2WLNA 4L87A 1CP9A 5L3EA 3RV3A 2R9IA 4FFPA 1NS1A 3DTUB 5DMXA 2YZNA 4JUZA 1OV9A 1TVKA 2LW1A 5LMNB 3T4DA 4EGQA 2Q0AA 4X1IB 1I0HA 5KHJA 4PA9A 1AR4A 5JQGA 5CA0B 4JV1A 1YZBA 4YJ2B 2K9PA 2WLIA 2GUZB 2EINC 3A0HZ 4ECRA 3T1YH 4F6RB 1ZL8A 2R86A 2ZDGA 3SDLA 5JH7A 4NZOA 3HOXG 5JJJB 4ECYA 4J11A 4DV5B 4B3SO 2ZE5A 4DV7O 4C7UA 2A3QA 3JD4A 4O4LA 3QO5A 4FLWA 2CNUA 4PZ8A 3RYIB 1H2GA 1EKFA 1KUTA 3UO2A 1QLEC 1DF5A 2ZKOA 1GO3E 4DV2O 4DR4B 3MFIA 3E89A 3CCJV 3JZFA 1FXHA 4X64H 4PDLA 4RAIA 3JAWA 3OW2U 3H0GG 5BR8O 2V58A 3GTOA 1GSOA 1XDNA 4Q6GA 1VQ8V 1GH6A 1XBLA 3QO8A 4JI3O 3TIIA 4ICGA 1Z5WA 2QE7G 1TWHA 4MV7A 5I47A 4LH6A 2IH1C 1I94H 2XNDG 3T9DA 1CKMA 5DECA 4RAYA 2YICA 1SEIA 1C30A 2QM4A 5CBFA 4JV5O 1ZSPA 2ZM6B 3ZRXA 1QVGU 4QIWF 4ZI7B 1MSWD 1O9GA 1VEWA 3T1YO 3L71H 1F51A 3FB5C 2GUZA 4UCVA 1Y76A 2LQTA 2XCAA 4TV9F 4ZI7F 1OCZB 3CCLV 2WB1E 4LSAA 1BHBA 3K0GA 3JCZA 1Y74A 3JCUZ 3BACA 1M90W 3RYIA 5KMGA 1PK8A 3VA7A 1N8RW 2J6SA 2FJZA 3ZHUA 5KG2A 1I1MA 2HP8A 4QW9A 1MMMA 3ZRVA 1K1QA 2ATKC 4JYAO 1YJWV 2Q5ZA 4CH5A 5DGHA 4RB3C 1V51A 3RF2A 5BMVA 4R50A 3OEEG 1YCIA 4NB5A 5A2QN 5CM0A 2W6MA 4NR1A 3K9SA 5AG2A 3RB4A 3TXSA 2YSUB 1K8AW 4FJCC 3RJ0A 4FM2A 1H38A 3GTMA 2ARHA 5CBHA 4ECVA 4IL6Z 3ZJZA 5KFQA 3VPDA 2KKWA 4YY3B 4CS3A 1SESA 1I94O 3T7AA 4DR7O 5CE8A 1SA0A 5IWAO 1M1KW 3QVNA 1T36A 5JCOC 1L2ZA 5C1PA 4C2MA 1FFXA 1LUWA 4JV5H 4MV1A 4JV2A 4DUZH 2E76B 4DL7A 3A8TA 3TEKA 1SQBH 1I7LA 2EILC 2WLLA 2R8HA 2W6PA 5JVDB 5IP9G 5D5PA 2EILB 4M9UA 2PUSA 5KG6A 5B1OA 2R8KA 4RNNA 4CH4A 3WB1A 1N36O 2EIJB 3IC7A 2DN9A 1HNWO 2PF4E 1WSCA 2JA6G 1J95A 3K57A 5D1OA 2R84A 2IP4A 5FNVB 2C28A 3PW2A 1KUQA 4MT8A 2EIKC 1ZL8B 1G8MA 1S97A 4AI8A 4OX9O 2C22A 1JJ2U 3ZRWB 4YAJB 2BE3A 3RYCA 1GRJA 5L1IA 1E1QG 3ICXA 4RAZA 2EJ2A 2IBKA 2UUCH 3TQTA 2YIBD 1DAAA 4RUAA 4O4IB 3ABKB 2HGWA 3N43B 1JJOA 1S0NA 4ZHQA 1URFA 3CEIA 5A9GA 5H80A 1XILA 4UFZA 3ZMSA 3DGEA 2UVWA 4DR6H 2EIKB 1ZAUA 1Q7YW 5LXTB 4BIUA 2DWEC 3I56V 4A3FG 2UUBH 1N34H 2CDYA 4MV9A 3HPLC 3K5NA 1KC7A 5CA0F 4GX1A 5FLXN 4CMDA 5FLMG 2D2CB 3JD2A 4DO2A 2P0AA 5FD5A 2Q4PA 4BBSG 4YJ3A 2GHYA 2Q7HA 2CAZC 2R82A 3J80W 4J41A 1S0VA 3JSNA 2B5UA 1YEWA 4Q4DA 4MVOA 3TY5A 2R87A 2CKZB 2EJ0A 2NNUA 1BQZA 4DUYO 3HO8A 2FB5A 3SPGA 1HNWH 5LHHA 4F4ZA 5B3SB 3R5HA 4UCUA 3L70H 1H2SB 5LL6b 5IWAB 3HKBA 4IWXA 2ZDHA 2QKSA 3JZIA 3GIQA 5KT6A 5L3GA 1JA8A 1DV1A 1VQ9V 4TQRA 3RUPA 2COGA 4OX9H 2JVDA 3FYIB 2YIDA 3V6KA 4MA0A 5F9LA 2FYUH 4NXMO 1Y4MA 2BTOA 2A9HA 3ABLB 5BYAA 4O3RA 2UUCO 4RUEA 4JI8B 2HVQA 1JIHA 5J2TA 4JYBA 4FMTA 3FX7A 3MWDA 4BW9A 2DAAA 3M7MX 2D3OW 4DR6O 2OTJV 1XUQA 2B1GA 3UO3A 5E1AC 5DN6G 2CK3G 2HIVA 4O7WA 1ZHQA 4MVUA 1HNXO 1OCZC 1XMQO 1WRVA 4J7KA 5KFCA 3T9BA 5BXZA 3GIKA 3BQ0A 3JARB 3AG7A 4ECXA 3JYCA 1NJIW 4O7RA 1X4TA 3RVYA 2YC0A 4HNAA 4QWCA 2EX3A 3L75H 3PVXA 2HVKC 4EFBA 4DUYH 2XUMA 1ZQ7A 2JS3A 4F4XA 2DYSB 3AK2A 3RYFB 2NUAB 5B1AB 2YEVA 4MTGA 4DR1B 5KG3A 4I9WA 5IYDG 1Q3EA 2LGQA 1FFXB 3G6VA 2CFMA 3WO1A 4DL5A 2Y0IA 1QVFU 3DC6A 1K4DC 4HN2A 3B2EE 1W2BU 2WLMA 4NXMH 4X9QA 3JRXA 5JUMA 1HWYA 4JTAB 4AYBA 4J42A 1RJPA 1PL0A 3J81W 3E8GA 2RGRA 4HYOA 1RM1C 5D1OB 3QFFA 2Q73A 1Q5OA 5KFKA 1M5IA 3H3VH 4RO2A 5KG5A 2JGUA 4WFFA 4RB1A 2UXBH 4DR7B 1QCEA 1AR5A 3R65A 4O2AA 4DL2A 1HNXH 2ZXWC 2NU9B 3CMAV 3FB6C 4BIZA 4DR2H 1BT8A 1P49A 4HNAB 5H6RA 1NVPD 3UZBA 1AR1B 4O3NA 1SQPH 1PM9A 3E86A 2BR0A 4O4IA 3OD4A 5LL6Y 2YXLA 3EPGA 1J5EO 1ZTEA 2GPWA 4CKBA 2W0FC 4O7ZA 1K92A 4X62B 3WU2Z 2G38A 5KG4A 3K79A 5BYBA 3Q8SB 2FPIB 3G6XA 2VPQA 5I5SA 4EB6A 5FL7G 3ZHVA 1QU7A 3DTGA 2JEJA 3W7TA 3ZMUA 4LF4H 4DR3O 3PW0A 3LDCA 4ZHQF 2JEFA 5IYBO 4YHHH 4CHIA 1KJQA 2Q67A 4Q43A 1R1BA 2E75B 1EZVH 2FK2A 2IMWP 3ZN1A 3AG4B 1S76D 4GX0A 4FLTA 1EBOA 1GSHA 3CRMA 3AG1C 1S3JA 3QQMA 3L4KA 2ZE6A 3I5DA 2AXTZ 4F4WA 3EFFK 3T5KA 2NU8B 2W7OA 1O9HA 5L1JA 3RAQA 4J9SA 3P32A 3RBEA 5KFLA 4O3OA 3T99A 1LUVA 3KZIZ 2UXCH 1UJWB 4BY1G 4I55B 3RB6A 4KXRA 2R8JA 4HAMA 2UXBO 4DRXB 4DUZB 4PELA 3TETA 5DG8A 1KD1W 2GBOA 2Z5UA 1GN4A 3OTFA 1P4RA 4J80A 4MVMA 4DR2O 3TQ1A 3PW7A 2JA5A 2DLNA 4LFCB 3ZRSA 1P7GA 2JS5A 1Z2PX 3WFVA 1Y1VG 3I4MG 2QDOA 2ADPA 1I08A 4R7CA 3RYHA 2O57A 5F2VO 2P06A 5BMVB 1YF2A 4K3AA 2KG7A 3KKYA 4QE9A 1CKNA 3PFFA 2KQXA 2WWWA 1NU1H 5DLFA 4LF4O 4NYEA 5EYPB 3FFQA 1EM1A 4M0JA 1FD9A 4YHHO 3W1BA 1T3NA 3WB0A 5DGBA 2Q2UA 5C3EG 2C00A 2X6AA 3FB7C 1FPOA 1EN6A 4IHJB 3EYYA 4HNTA 5EZYA 4JI6B 1H2KA 4WCEV 1PNLA 4WD3A 3MR6A 3SPJA 5KFEA 4DV4B 2JEUA 5CA3A 3BEHA 2ZIOA 4IT5A 1VQ4V 4TQDA 4RQFA 5GONB 4PI2A 2QGNA 3MR3A 1L0LH 3C3SA 3J80N 2EJ3A 2W6ZA 2R7KA 2ZGIA 4B3TB 4MV3A 2R7NA 5EDWA 2JK5C 5EK0A 1K33A 3AX6A 3K08A 3UM7A 4TUYF 3K5MA 5LYJF 5DGAA 4XZ3B 3P3NA 4E2LA 4YHHB 3H0GA 4JV0A 4DV1B 3K3WA 2HFEC 3IGAC 2OLSA 3FB8C 1YTFD 4TV8F 4I50A 1OBDA 2JA6A 4QSHA 3QF7A 2XASA 1BCCH 4X62H 5IYCO 1OCRC 2YL2A 1WA8B 3JATB 2ALZA 2KG7B 4OX9B 3ASOC 4EEQA 1H2NA 3OMAB 4FPPA 1PX2A 4MVZA 5KFHA 1AROP 4ED6A 3RFRA 2ZDIA 1FXVA 2ZR2A 4XDKA 5L3BA 1CQJB 2F66C 1FVIA 4K0KB 2ZINA 3RGXA 4GLXA 4LF5O 4Q0YA 2Y0SA 4J0MA 4DV0O 5KAIZ 1FKAH 4B3RO 4I5SA 2VQFB 4GKKB 2JGDA 2R8GA 4JI6H 2BOBC 4A2BA 3H1KH 3E5NA 3HR0A 3QO7A 3GB7C 4A3KG 2YIAA 5KT7A 1QHTA 4B08A 4LF4B 4EBDA 4R6ZA 2F43G 4O4HA 1TVKB 2FPGB 2K1EA 2J9GA 4EBEA 1S5HC 2QR4A 2YZMA 3SYQA 1QQCA 1SKVA 1KBHA 5KMGB 5EWGA 3CMEV 1I1KA 4P9PA 2A1HA 3OHBA 3A0RA 4ECZA 3BRCA 1R6NA 3T9EA 3RGZA 2FLLA 1U97A 3QTCA 1K73W 1HR0H 3E8FA 2HJDA 4DV1H 4EFEA 3AG4C 1Q81W 4DLKA 3TY9A 4X62O 3GIMA 3BA9A 3MWEA 1A0GA 3UFXB 4ECUA 5BY1A 3O9OA 3ZEDA 5LA6F 4G28B 1A0IA 2ZDQA 2M7WA 4J9KA 3G4SV 2CGNA 2WLKA 3JAWB 4QGPA 4YJ3F 2NLJC 1S72V 4UV9A 1IBKB 4CKEA 1A3GA 4DV0H 3A2FA 1N32H 5D1PA 2JGDB 3LWBA 3LUTB 3T54A 5KA5A 4U7CA 2ZM6O 2KSDA 3HKZA 4O3QA 2ZNJA 4B3RH 4YQWA 3GJXB 1AJQA 3WB2A 5GTIZ 4LF7O 1KJ8A 3KCXA 1K97A 4DRFA 1OZ0A 3ZHQA 2ZE8A 2YU9A 2M05A 1MNGA 4Q8EA 4H33A 3GV8B 4ABMA 1GGOA 4WFEA 4DYLA 3RVZA 1N33O 2XAFA 4ZBMA 4X65B 4DV3B 4MV8A 4YJ2F 2B63G 1EFRG 2IBZH 4UVCA 1AJNA 2EIJC 3JASA 4FFRA 4U6PA 1EZJA 2W6IG 3U0GA 5FPOA 4RNOA 4A3BG 4DV6H 1XNRH 1AUVA 1XNQB 2HGXA 1D5AA 2DWCA 1YVWA 4DV1O 3TW7A 5C8YF 3Q1KA 4MSWC 4DK1A 2UXBB 3VOUA 5A2QW 3VPBA 2ASLA 2UXDB 3OGCC 1QLEB 3BY6A 5J2UB 2FLPA 4RZQA 5KFGA 3BHPA 3C0FB 2OTLV 3ABUA 4G3IA 3V6JA 2Y48A 2ZJTA 4PJ0Z 3K58A 1V54C 5FR9A 1WR2A 3BFRA 1BL8A 3JD1A 2I8CA 3PR4A 4BY7G 3CJHB 5KFJA 1LNQA 2UUBB 1N32O 3OT7A 4APMA 4IRCA 4I50B 3MAQA 2WAQA 1IBMH 1GM7A 1ZWIC 4JZ2A 3TK1A 2UUAB 3JAKA 5CB4A 5IJ9A 3ML0A 1KTAA 4QIWE 1AP5A 2ODTX 1IVSA 4J7ZA 3RW0A 1FXKC 3MFHA 1F4MA 4XDJA 3GIPA 1BGWA 2FK3A 2XAJA 1E4FT 4ZKIA 3IC9A 1VP7A 3W7XA 5KFTA 3K06A 2YI9A 5KFZA 4PBCA 1XMOH 5DQGA 2QJ1A 4Q8FA 1K9MW 3W7WA 1HNZH 3GLKA 4MTDA 4CMFA 3TCUA 2HHFB 5CA0A 4HQ6A 1WPBA 2VQFO 2F95B 5LGUA 2W6QA 2YXYA 3ABLC 4O4LF 3WO0A 1YXBA 4F6RA 3BG5A 5DGIA 2FPPB 3M9NB 4QWDA 2Y0SE 4ME6A 2AGPA 5LHIA 2I80A 4KUMA 3FDSA 2RGVA 2RN9A 1V4YA 3QG5A 3H40A 3LSUA 4GKJH 1VQ7V 5B3SC 4FFMA 3UT5B 1NT2B 5FNVA 1GO3F 2BSKA 2LGWA 2W0XA 4I4TA 3HOZG 3RBZA 4PDRA 4GX2A 4GYCB 4O4JA 3CCEV 3R9RA 3HKEB 2BTQA 3DTFA 1MSDA 3SPHA 5LOVA 1IBMO 3HB9A 5BR8H 3AG2C 2CTWA 5JJEB 1TUBA 1UFIA 4O3PA 5BPFA 1AUXA 1WPXA 3JARA 4DW0A 3RTXA 5LXTA 3KREA 3K5HA 1HNZB 3Q8RB 4A3LG 5BR8B 3TGUH 5I5VA 2R7ZA 1OCRB 5LP6F 1VQPV 1PP9H 3CQZA 2EIMB 2DIKA 2AQ4A 2QWRB 1T94A 2WDTA 4FE2A 4NKGB 1VBGA 1S77D 4ED3A 4EBCA 2ZT9B 2YEVB 1AP6A 4GKJB 3NBYB 3JD3A 2VQFH 1W96A 2UU9H 1RJRA 1X59A 4ECSA 2UXNA 3CRQA 1KJ9A 3AG3B 4ZOLF 2W57A 2Q69A 4YY3H 1FJGH 4LF6O 3F7VC 4PA4A 4GKJO 2O03A 5GONA 3SJCC 4LF8H 1ORQC 4H0LB 4LH7A 4HYKA 1WB7A 2YUAA 4O7TA 1KC8W 2A06H 4OXSA 2PTMA 2WTFA 4FM1A 3OTOO 4F4LA 1M6VA 4I4TB 2Q7DA 2Y69B 2ZDIC 2Q9LA 1RPRA 5BWWA 4YR2A 2VA2A 5J2TB 2FP4B 4UCSA 1XMOB 1H8HG 4I0XA 3VBBA 4FFNA 5EWEA 3PJSK 2RNBA 3OUZA 4EEYA 1S10A 4R7RA 1OCOC 2JA8G 1S9FA 2ATLA 2R92A 3M99B 2B1IA 1RJQA 4N23A 3UYYA 1M4UA 2I87A 3N2GB 2AW9A 1PV0A 2W9BA 4BW5A 2YZGA 5BWRA 1E79G 3K59A 1EUDB 5IWAH 1VF7A 4EG0A 3IAYA 4IZOA 4LF6B 5EBWC 2XC9A 2SCUB 4UCOA 2VQDA 3QZ7A 2P67A 4HNVA 4X66O 4TVIA 4GC6A 1SYXB 4X1KB 4IYIA 2UU9O 3TIGA 3M8AA 1COWG 1I5YA 4A93G 4C5AA 4G2KA 3APOA 2CGOA 1N36H 4X1IA 1QR8A 4LFAO 4O83A 2W6OA 3B4SA 1QBZA 1Q6UA 1YI2V 4ASUG 5KA6A 3HKDB 4ECWA 4LF9O 3E2EA 4LF8O 4DV0B 2OYQA 4DAAA 1SF9A 2PYJA 2R7LA 1D5NA 1VF6A 3CCUV 5KT2A 3E35A 3OTOH 2AZ0A 3HKZE 1JFFA 1IXMA 4PHZA 4JXUA 1PL4A 4DL4A 2OWOA 4FS1A 5B66Z 4IHJF 3SYAA 3PW5A 1W93A 5LMUO 1NH2D 3L9DA 1QLNA 4LR3A 2H94A 5JQGF 1GAXA 1YITV 1JOYA 3H4BA 2WLHA 4DV3H 4RZRA 2AHYA 3RBDA 4BXXG 1DV2A 3G8CA 4FLZA 3ZIAG 3UT5A 4RUCA 2JEGA 2WE6A 4ED2A 4EGJA 3RWRD 2DE0X 5IJ9B 2UUBO 1N32B 1Y1VA 3T5HA 2DPJA 1YJ9V 3H1HH 3HKEA 1B04A 2AZ2A 1XNRB 4LFBO 1WCMA 2X0SA 4X66H 1TUBB 2C2DA 4JAVA
chains in the Genus database with same CATH topology
2UXCH 4I55B 3SGIA 1Z5VA 4DRXB 4DUZB 3HKDA 4JI5H 3VQWA 4LF5B 2ZM6H 4LFAH 1V9PA 4ZI7A 1ZHSA 4HBNA 4LF7H 4JI7H 4RB0A 5KX5A 1HR0B 3F8NA 2UUCB 3OTFA 4X20A 1VS0A 4FFBB 1DGSA 4LFCB 5CA1A 2JS5A 1Z2PX 3RYHA 5LMUB 1N33H 2RQ6A 5K1XA 4JYAH 3U11A 4AQYH 4DV6B 5BMVB 2VWJA 4B3TH 1CKNA 3W5OA 3OTOB 3N2KB 4MTEA 4JYAB 4B3MB 5LMUH 4JI1B 5EYPB 3FFQA 4YJ2A 4JI2B 4U3JA 4AILC 3W1BA 4JI4B 3WB0A 4LFBB 1X9NA 2Q2UA 4FLXA 3LMLA 1E4GT 3M4IA 4JI5B 3N44B 1I6UA 4LFAB 4DV7B 4IHJB 5IYZA 4DR7H 3EYYA 1S03G 5EZYA 4JI6B 1IBLB 3MWMA 3L2PA 4X20B 1XMQH 5JH7B 1G6UA 4DRXA 4LF6H 4DV4B 2YIBA 1TGOA 4JI0H 2HGSA 4X1YA 2ZIOA 4LFBH 2YI8A 4NXNB 2HVRA 3L4JA 2P22C 4IIJB 4DV2H 4TQDA 5GONB 4PI2A 4PZ7A 2KSWA 5IT9W 5EOYA 5EIBC 4ZHQB 5LA6B 5DISC 1T5EA 5KHHA 4D7SA 3IG0A 4B3TB 4ETSA 4RB2C 2E3CA 3RYHB 2HHHB 3FMAA 2MCTA 4AQYB 5CA1B 5K1PA 5FD6A 1SA0B 3K5MA 1TAEA 4TV9B 3LNNA 4YHHB 1I94B 5FPRA 4O4HB 4DV1B 3E22B 4X1KA 4JI3H 4LFCH 4I50A 4FLVA 3NC0B 5LP6A 1RSOA 3QF7A 2VPSA 4X62H 2ZNIA 2WYOA 2HHHH 1TVKA 4DR3B 1WH2A 5LMNB 3JATB 5JJNB 1BJTA 4E6NA 3N6XA 4DV5H 1S5JA 4OX9B 4TV8B 4EEQA 3TY8A 2Q0AA 4X1IB 5KHJA 1WN7A 5JQGA 3RFRA 4DV2B 5CA0B 3BABA 4YJ2B 5EYPA 2F66C 1FVIA 4K0KB 3T1YH 3KXYT 1IBKH 2ZINA 4JI0B 4F6RB 3SR2C 3QWUA 4ZOLA 3RGXA 4GLXA 4Q0YA 4J0MA 5JH7A 5JJJB 4DV5B 4EB6B 4LF9B 1FKAH 4CH6A 3THOA 5LA6A 4O4LA 4IIJA 4PI0A 2VQFB 3JALB 4GKKB 2UXDH 4PZ8A 4FLWA 3BAAA 3RYIB 4LSXA 1IBLH 4JI6H 4LF9H 4A2BA 5EIBD 4DR4B 1Q8IA 2YIAA 4TUYA 1QHTA 4B08A 4CC6A 4LF4B 4TV9A 4AHCA 4X64H 4O4HA 1TVKB 3JAWA 3RGBA 4X66B 3GB8B 4FLYA 4TQFA 5LP6B 4K8ZA 1QQCA 1SKVA 5KMGB 4B3MH 1Z2NX 3S24A 5JQGB 5LMNH 4DR3H 4A2AA 1XDNA 4Q6GA 4CS4A 3BRCA 3RGZA 3QTCA 1HR0H 1Z5WA 4UCTA 4JI3B 4MV7A 4DV1H 4EFEA 1XMQB 3TY9A 4LH6A 1I94H 3BA9A 1CKMA 4RAYA 1CKOA 1J5EB 4M7EA 4ZOLB 4B3SB 1SEIA 3ZEDA 1JMKC 2QM4A 4EQ5A 1A0IA 2ZM6B 5JVDA 3JAMW 4ZI7B 4JI4H 1O9GA 3JAWB 1P8LA 4WBNB 1P16A 4UCVA 3T1YB 1IBKB 4DV0H 4TUYB 3A2FA 1N32H 5D1PA 3BPZA 2ZNJA 2UU9B 4B3RH 4LSAA 3GJXB 3WB2A 4DRFA 4O4LB 2F4VB 3RYIA 5KMGA 2VQEH 3U10A 2HVSA 1L8DA 4CH5A 1M93A 4X65B 4DV3B 4RB3C 3RF2A 2VQEB 5BMVA 4UCRA 3RYFA 4KHPH 5KHIA 3JASA 3W1GA 3T1HH 3JSLA 5KHGA 1N34B 5FPOA 3JAKB 5CB4B 2VUGA 4DV6H 4CC5A 1XNRH 3RJ0A 4FM2A 1XNQB 1D5AA 2VOBA 2KKWA 4YY3B 4CS3A 1N36B 4DK1A 1SA0A 2VWKA 2UXBB 4DR5H 5FLXW 2E5LH 5JCOC 1L2ZA 3HXLA 5A2QW 4K8XA 1FFXA 5J2UB 2UXDB 4JV5H 4RZQA 3BHPA 3C0FB 3ZS8C 4DUZH 1MZBA 4DUYB 2ZJTA 3KALA 4LNUA 3K58A 1O75A 2GV9A 5JVDB 5JCOA 5D5PA 4NVPA 2PUSA 2P5OA 1CKNB 2BTQB 4CH4A 4K0KH 2UUBB 4WBNA 2PGGA 3WB1A 4APMA 4I50B 3MAQA 1IBMH 4CH3A 3SJAC 1FJGB 3K57A 2PZSA 5D1OA 5D5QA 5FNVB 2UUAB 3JAKA 5CB4A 5IJ9A 4KHPB 4I7HA 3JATA 4NXMB 5IJ0A 3HKBB 5EZYB 1J5EH 3RYCA 1BGWA 2ZIMA 1HW7A 1E4FT 2F4VH 3ICXA 4RAZA 2UUCH 1SQGA 2YIBD 2YI9A 1XMOH 4O4IB 5LYJB 2E5LB 2QJ1A 3N43B 1JJOA 4PDBA 3N41B 4ZHQA 1HNZH 4MTDA 1GYFA 4D7TA 1I7FA 4UFZA 5CA0A 2UXCB 1WPBA 4DR6H 1XK5A 2F95B 3CSXA 4KL1A 4B3RB 4F6RA 3N40P 1ZAUA 1XNQH 5LXTB 4DR2B 2UUBH 1N34H 2RGVA 4DR6B 4MV9A 3QG5A 3K5NA 1HNWB 3VNNA 4DR4H 4GKJH 2CW8A 1M0TA 1WNSA 4L8JA 3UT5B 1NT2B 5FD5A 5FNVA 4PZ6A 3RIZA 4YJ3A 2Q7HA 2CAZC 4X65H 3J80W 3N42B 4I4TA 3JSNA 4U3JB 3KYHC 1YEWA 3TY5A 1S68A 4GYCB 5ITZA 4O4JA 2F1MA 3HKEB 2BTQA 5LOVA 5BR8H 1HNWH 4JI2H 4JI1H 4UCUA 4IHJA 1TUBA 5JJEB 1H2SB 4JI8H 5LL6b 5IWAB 2PYLA 3HKBA 3GDEA 1XHXA 4ZIBA 3JARA 4LF8B 4OX9H 5LYJA 2JVDA 3RTXA 2R70A 5LXTA 2XIGA 3KAJA 2F93B 4DK0A 1HNZB 3SJBC 2BTOA 3CB2A 5BR8B 2CW7A 2PY5A 4JI8B 2HVQA 4BWAA 4DV4H 4GKKH 2WDTA 5J2TA 3BA8A 4FM0A 3DF7A 2V4DA 4BW9A 3M7MX 4FFBA 4GKJB 3RR5A 3NBYB 3CVZA 4O4JB 4CS2A 2VQFH 3H20A 2UU9H 2HIVA 3KAKA 5C8YA 1ZHQA 2W57A 4YY3H 1FJGH 1XHZA 5LOVB 3N2KA 2O03A 5GONA 3JARB 3SJCC 4LF8H 4LH7A 1X4TA 1SQFA 3U0ZA 2FE3A 2Q2TA 2R9AA 2PTMA 3HKCA 4HNAA 4O2AB 4O2BA 4YJ3B 2EX3A 4FM1A 1N33B 4I4TB 4DUYH 4EFBA 4DR1H 4IAJA 1Z2OX 5LP6C 3DSQA 5ITZB 5J2TB 4UCSA 1XMOB 2IM9A 3RYFB 4JI7B 4LNUB 1KU9A 3ETQA 4DR1B 4R7RA 1Q3EA 3PN1A 1FFXB 5J2UA 2CFMA 2XHBA 3J7AK 4FLUA 2UUAH 1XQ8A 1M4UA 3N2GB 3B2EE 4NXMH 4LMYA 3K59A 4FM9A 5IWAH 1VF7A 3T1HB 4TV8A 1JFFB 4FVMA 3IAYA 2Q7GA 4LF6B 3E22A 1AN7A 1M0WA 4UCOA 1HNXB 3J81W 2RGRA 5D1OB 4NXNH 3HKCB 1Q5OA 4LF7B 3RYCB 1SYXB 5C8YB 1M5IA 4X1KB 2JGUA 4LF5H 4RB1A 4DR5B 2UXBH 4B3SH 4DR7B 2HEPA 4BWSC 4DV7H 4X1IA 3JALA 3UQ8A 4O2AA 1N36H 1KMIZ 4JV5B 1HNXH 1Q43A 4DR2H 2RJZA 3HKDB 1P49A 4HNAB 4DV0B 2OYQA 4I55A 3CHXA 4O4IA 2YXLA 2PYJA 5IJ0B 3OTOH 1JFFA 2ZCEA 4O2BB 4X62B 5KX5B 4PHZA 1IBMB 3VQXA 2OWOA 4TOIA 3N2GA 4EB6A 2YCHA 4LF4H 4LR3A 4X64B 4YHHH 4DV3H 3K5LA 3NBZB 2R72A 4I9QA 5IYZB 5KHKA 4FLZA 3UT5A 1TA8A 4FLTA 2WE6A 3VQVA 1XI1A 3VQYA 3RWRD 5IJ9B 1N32B 3K3VA 2HIXA 3L4KA 4X1YB 3HKEA 1B04A 2Q7EA 3JASB 1XNRB 3K5OA 1O9HA 4X66H 1TUBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF B;  4GKK B;  1CKN B;  4PZ8 A;  3BAA A;  2UUB B;  3SGI A;  4LH7 A;  4DUZ B;  4LF5 B;  4DR4 B;  1V9P A;  4CC6 A;  4LF4 B;  1FJG B;  5D1O A;  2Q2T A;  1HR0 B;  2UUA B;  1N33 B;  2UUC B;  4X66 B;  3GB8 B;  1VS0 A;  4KHP B;  4EFB A;  1DGS A;  4LFC B;  4NXM B;  4UCS A;  1XMO B;  5LMU B;  3S24 A;  4JI7 B;  4DV6 B;  1XDN A;  4DR1 B;  1CKN A;  3W5O A;  3PN1 A;  2CFM A;  3OTO B;  4JYA B;  4UCT A;  4B3M B;  4JI3 B;  4JI1 B;  4JI2 B;  4EFE A;  2E5L B;  1XMQ B;  3TY9 A;  4LH6 A;  3W1B A;  3BA9 A;  1CKM A;  3T1H B;  4JI4 B;  1CKO A;  1J5E B;  4B3S B;  4LFB B;  4UFZ A;  2UXC B;  4LF6 B;  1X9N A;  2Q2U A;  1XK5 A;  4EQ5 A;  4B3R B;  4JI5 B;  1ZAU A;  4UCO A;  1HNX B;  2ZM6 B;  1A0I A;  4LFA B;  4DV7 B;  5D1O B;  4DR2 B;  4JI6 B;  1IBL B;  3L2P A;  4LF7 B;  1P8L A;  4DR6 B;  1P16 A;  1HNW B;  4DV4 B;  1IBK B;  3T1Y B;  4UCV A;  3VNN A;  4DR5 B;  4DR7 B;  4NXN B;  5D1P A;  2HVR A;  3UQ8 A;  4PZ6 A;  4PZ7 A;  2UU9 B;  4JV5 B;  3GJX B;  3JSN A;  3KYH C;  3TY5 A;  4DRF A;  1S68 A;  5DIS C;  4B3T B;  2F4V B;  4DV0 B;  2HHH B;  4AQY B;  4UCU A;  1TAE A;  2HVS A;  5IWA B;  4YHH B;  1I94 B;  4X65 B;  5FPR A;  4DV3 B;  4X62 B;  3GDE A;  2VQE B;  4DV1 B;  4UCR A;  1IBM B;  2OWO A;  4LF8 B;  4TOI A;  3RTX A;  3NC0 B;  3W1G A;  1HNZ B;  3JSL A;  4X64 B;  1N34 B;  5FPO A;  5BR8 B;  4DR3 B;  2VUG A;  4CC5 A;  5LMN B;  4JI8 B;  2HVQ A;  4E6N A;  1XNQ B;  3NBZ B;  4OX9 B;  4EEQ A;  3TY8 A;  3BA8 A;  1TA8 A;  4YY3 B;  4DV2 B;  1N36 B;  3BAB A;  1FVI A;  1N32 B;  2UXB B;  4K0K B;  2HIX A;  4JI0 B;  4GKJ B;  3RR5 A;  3NBY B;  3QWU A;  2UXD B;  1B04 A;  4GLX A;  4DV5 B;  1XNR B;  4LF9 B;  4DUY B;  2HIV A; 
#chains in the Genus database with same CATH topology
 1B6S A;  5L9X A;  4FFK A;  4MVR A;  1CS0 A;  2GTA A;  1B3Q A;  2V4R A;  3KHL A;  4ED8 A;  4RUF A;  1KKD A;  3P3P A;  1SQV H;  4LC1 A;  4LF5 B;  3JZ6 A;  4PV1 B;  4LFA H;  4U3F H;  5CR5 A;  1SZT A;  4RB0 A;  5KX5 A;  2CQY A;  2W71 A;  5IDJ A;  3FKI G;  4YR3 A;  5CA1 A;  1VMG A;  1B06 A;  2FLN A;  4NTW A;  2EIY A;  3CWB H;  1NTK H;  4A3I G;  1Y1W A;  5K1X A;  4O84 A;  2VWJ A;  4GUN A;  4B3T H;  2CZG A;  3T4Z A;  1K3E A;  2FKX A;  3W5O A;  2NVY A;  1Y76 B;  3OTO B;  1DF4 A;  4J9P A;  1KYO F;  3GWO A;  5LMU H;  3SYC A;  4QIW A;  1AI5 A;  4U3J A;  3KHR A;  4AIL C;  3LP8 A;  2YW2 A;  5KFN A;  2EZO A;  3GV5 B;  2W6J G;  1X9N A;  1IDS A;  2P4K A;  3ZMZ A;  5IYC G;  3M4I A;  4JI5 B;  3N44 B;  1I6U A;  4QPJ A;  3OAA G;  2DMX A;  4LWS A;  2AGA A;  4RQE A;  1IBL B;  4FZ0 A;  3MWM A;  4DR5 O;  2FL4 A;  2GTS A;  1XMQ H;  1R3L C;  5JH7 B;  2E5L O;  5HNE A;  3T5J A;  2OCC B;  1ENV A;  2YIB A;  4UB6 Z;  3H1L H;  2HGS A;  4LFB H;  3R5X A;  4UXN A;  1PD3 A;  3GVM A;  4IIJ B;  4J10 A;  2BQU A;  2ZD9 A;  1WP7 A;  2KSW A;  5IYZ F;  2W7P A;  1VQK V;  1E4E A;  5I5Y A;  5EIB C;  2W70 A;  4ZHQ B;  1B33 N;  2YS6 A;  5KHH A;  1IYD A;  4ETS A;  2E3C A;  2IJH A;  3FMA A;  1VQO V;  2XGP A;  4FBU A;  5CA1 B;  1SA0 B;  3BVO A;  1TAE A;  4FBT A;  4WBN F;  4Q44 A;  2Y0P A;  2RDI A;  5FPR A;  4X1K A;  2OT5 A;  3T9A A;  4TQS A;  1R3K C;  2P4V A;  3GTL A;  3EPI A;  4I55 F;  4FLV A;  3NC0 B;  4DQN A;  3CP1 A;  2JJ2 G;  2ZNI A;  2N74 A;  5J2T F;  3VOT A;  4B3T O;  3RT3 C;  4DR3 B;  1Q6H A;  3E8B A;  4DV5 H;  2IU0 A;  3OM3 B;  4E6N A;  1S5J A;  1DIK A;  3I12 A;  1SRY A;  3ABK C;  1ROP A;  3P30 A;  1FYJ A;  2QSA A;  1WN7 A;  1H8E G;  3OEH G;  3ZMT A;  4YAK B;  3SE7 A;  5BPH A;  5HFL A;  5IYD O;  1F23 A;  3KXY T;  3ZBH A;  3ASN C;  3IJ4 A;  3SR2 C;  3G6E V;  1XNQ O;  2VR1 A;  2JA7 A;  4LF9 B;  1OBG A;  4CH6 A;  1OCC C;  1NZ6 A;  2LFR A;  4IIJ A;  3JAL B;  3BAA A;  3FAV B;  5H9C A;  4JYC A;  1CQI B;  3VPC A;  2E74 B;  1YHQ V;  3ZHR A;  1I1L A;  4LSX A;  1IBL H;  3GTP A;  5EIB D;  1Q8I A;  4TUY A;  3J7A U;  2XD4 A;  2UVU A;  4TQF A;  1BZK A;  4GCZ A;  2OH2 A;  5LP6 B;  5CN0 A;  4K8Z A;  2ZXW B;  5KG0 A;  1Z2N X;  2PMZ E;  5C1O A;  2WA3 A;  3S24 A;  1I2L A;  3ZHS A;  3FD9 A;  3KG2 A;  2PMZ A;  4A2A A;  4DR3 H;  2CTQ A;  4JZG A;  2DWD C;  4CS4 A;  3MHS C;  1Q86 W;  1UC8 A;  2WAM A;  4UCT A;  3CS5 A;  4JI3 B;  1RP3 B;  2X5R A;  5KFI A;  1CKO A;  3ETH A;  1J5E B;  4M7E A;  4ZOL B;  4DV5 O;  4B3S B;  5KFD A;  2R93 A;  2XOK G;  4PDM A;  5JVD A;  3ASN B;  4DXW A;  3JAM W;  3GV7 B;  2YDE A;  3STL C;  4P30 A;  4BIO A;  1BE3 H;  1P8L A;  4O2A F;  1P16 A;  1UC9 A;  3T1Y B;  3B8N A;  4IR9 A;  3BPZ A;  3U9S A;  4MTF A;  1NQT A;  4LBE C;  2V9W A;  4JAA A;  3ABT A;  2Z3Y A;  4O4L B;  2DQ0 A;  4C5C A;  2NU6 B;  5FJ8 G;  2VQE H;  2QWO B;  2PN1 A;  1KP2 A;  1NVP B;  4LWS B;  1B6R A;  3U10 A;  2HVS A;  1YIJ V;  1M93 A;  3K9A A;  2YS8 A;  3F5W C;  3FYE B;  3MHH C;  4KHP H;  5KHI A;  1AIL A;  2GQR A;  2R92 G;  1P7B A;  3M9O B;  3SJQ C;  1M57 C;  3T1H H;  2VA3 A;  3JSL A;  2RDC A;  3CSW A;  3JAK B;  5CB4 B;  2V7Q G;  1RPO A;  1GN6 A;  2UUA O;  4J9R A;  1RK6 A;  3ZMV A;  2JEX A;  2H3O A;  2IW5 A;  5DLG A;  2VWK A;  5FLX W;  1AVM A;  5HFM A;  5B1N A;  3E83 A;  3ZS8 C;  2EIM C;  1MZB A;  2W8L A;  4DUY B;  3KAL A;  3C90 A;  3ETE A;  2R7M A;  4LNU A;  2UVR A;  4RWU A;  4NVP A;  2CTR A;  2HJW A;  4K0K H;  1W0J G;  3MD0 A;  4I7Z B;  2FKL A;  3ABM C;  5JH7 F;  2BOC C;  3SYO A;  1XL4 A;  2WA4 A;  3GTG A;  4CH3 A;  3SJA C;  4JI2 O;  2ODM A;  2PZS A;  4MS2 A;  4I50 F;  4KHP B;  5LGN A;  1A48 A;  4I7H A;  2ITD C;  2LP7 A;  4NXM B;  5IJ0 A;  4GZR B;  5CMU A;  3HKB B;  4F6E A;  3GIL A;  1EHI A;  3H4D A;  2DJV A;  2E2I A;  1W0K G;  5HV6 A;  2LFS A;  2ZIM A;  4YB8 B;  3K3P A;  2Y4T A;  5EBM C;  4KHP O;  3ORQ A;  3DXR A;  4DL3 A;  1SQG A;  2X6C A;  4HR7 A;  5LYJ B;  2E5L B;  2JEI A;  4A3G G;  3L72 H;  4X88 A;  1DK1 A;  1GYF A;  4D7T A;  1I7F A;  2UXC B;  3K04 A;  5GW7 A;  2RMK B;  3CSX A;  3D36 C;  4UUG A;  4B3R B;  4YBZ B;  2V59 A;  1FKA O;  3DC5 A;  1N0J A;  2ZE7 A;  4I4T F;  4YP3 A;  4JTD B;  2BQ3 A;  4JAU A;  4DR6 B;  1HNW B;  4EYI B;  1RYR A;  3VNN A;  1I5X A;  4JI6 O;  3DAA A;  4XX0 B;  1AB3 A;  4Z1V A;  2HLD G;  1M0T A;  5I60 A;  3RIZ A;  4X65 H;  5BWV A;  3N42 B;  2FMA A;  3KYH C;  5C4X G;  2ZQM A;  3Q8P B;  1IXB A;  3WG7 B;  5KLV H;  1FFT B;  4JI5 O;  1YSC A;  3ETD A;  1H2M A;  4JI2 H;  5GTH Z;  2RF4 A;  4IHJ A;  5KFU A;  4O81 A;  5K2M A;  4JI8 H;  4H13 B;  2PYL A;  4WFA V;  3GDE A;  3RV4 A;  1G2W A;  1LR1 A;  1XHX A;  4ZIB A;  1GN2 A;  1YDX A;  3KHG A;  2OIG A;  2XIG A;  1CE8 A;  3KAJ A;  3QZ8 A;  3SJB C;  5LHG A;  3CB2 A;  2CW7 A;  2PY5 A;  1ZLZ A;  2QKA A;  4O82 A;  4NYK A;  3BQ2 A;  4BWA A;  1ZET A;  4DV4 H;  4Q20 A;  2EBO A;  1L1F A;  3BA8 A;  4CKC A;  5KG7 A;  1S0O A;  1JQ0 A;  3DF7 A;  4NXN O;  1GLV A;  1WJZ A;  1OCO B;  3T9C A;  1XEQ A;  5KFM A;  1JCH A;  4O4J B;  4EKW A;  3H20 A;  4XYL B;  1K5Q A;  1M7J A;  2GPS A;  2A79 B;  3V4S A;  2WLJ A;  3LSQ A;  1XHZ A;  3A0B Z;  4GLW A;  4O4J F;  5C44 G;  5LOV B;  3N2K A;  3GTK A;  5C93 A;  1SQF A;  1F4N A;  4X65 O;  5KKN B;  2Q2T A;  2R9A A;  3HKC A;  4O2B A;  4YJ3 B;  2CH7 B;  1TUE B;  3L74 H;  2CUG A;  4NLG A;  2JDI G;  1Z2O X;  2R6F A;  1EN4 A;  1N4C A;  3MJF A;  4JI7 B;  4LNU B;  5L3D A;  2ETN A;  3JAM N;  2QEX V;  1R9T A;  2XHB A;  1K7D A;  1S5L Z;  4OPA A;  1XQ8 A;  3WWH A;  4IYH A;  2QYZ A;  4QPK A;  4LMY A;  2J6T A;  3CRR A;  3CC4 V;  1FXK B;  1WP8 A;  1JFF B;  2EUL A;  4FVM A;  2CNQ A;  1KT8 A;  4UV8 A;  4QNH B;  3WWJ A;  3E22 A;  2Z02 A;  5KAF Z;  1M0W A;  1HNX B;  3KHH A;  1BS3 A;  2DYS C;  3ETG A;  4NXN H;  2XAG A;  2JA7 G;  4PA6 A;  3D8C A;  5DG7 A;  4QWE A;  3S3X A;  3RYC B;  4FZ1 A;  4NTY A;  1K1S A;  3E8H A;  4DR5 B;  4B3S H;  4DV7 H;  3JAL A;  3ZN0 A;  4WFB V;  4A3D G;  1Q43 A;  5I5T A;  3OMI B;  4JI7 O;  3D3Q A;  4E4T A;  4ED0 A;  2RDJ A;  3H1I H;  3B09 A;  4O3S A;  1JDB B;  3K0D A;  2IJK A;  1NTM H;  3CHX A;  2QTS A;  3GIJ A;  1N0N A;  3APQ A;  1RFY A;  1VAJ A;  1K34 A;  2HJF C;  4N21 A;  2ZCE A;  4O2B B;  5KX5 B;  2Q68 A;  1EKV A;  2HDK A;  3EHB B;  4TOI A;  3ZHT A;  4L1K A;  3N2G A;  2YCH A;  4TT3 G;  1VKZ A;  2FTK A;  3LDD A;  4P9O A;  1XMO O;  1R3J C;  1IOV A;  1KJI A;  3H01 A;  4O7Y A;  2GQS A;  2XCP A;  1HNZ O;  1BMF G;  3I55 V;  3NBZ B;  2R72 A;  4I9Q A;  5IYZ B;  5KHK A;  1TA8 A;  3U9T A;  3LNM B;  1GMG A;  3VQV A;  1XI1 A;  1CEZ A;  5EWF A;  2HIX A;  3AEI A;  2EJR A;  2W8K A;  4X1Y B;  5KFW A;  1IYE A;  2Q7E A;  4PWQ A;  2IH3 C;  5B1A C;  1M56 C;  3JAS B;  2J6U A;  3OUF A;  3PW4 A;  3K5O A;  3GTQ A;  2ASJ A;  1KP3 A;  1US6 A;  1JVM A;  3HOU G;  2HG5 C;  3SGI A;  3FKS G;  2OCC C;  3VQW A;  2AGQ A;  1Y74 B;  2N04 A;  3GII A;  4FFO A;  1ZHS A;  4PA3 A;  5E25 A;  3RAX A;  4JI7 H;  1FS0 G;  2Z04 A;  4Z2W A;  1HR0 B;  2DZD A;  1R73 A;  3Q8Q B;  2C2A A;  4X20 A;  3U55 A;  1VS0 A;  4J9N A;  1DGS A;  4B7E A;  3V4Z A;  2V1D A;  4LFC O;  4O7V A;  1R6K A;  1M56 B;  2RQ6 A;  1PNM A;  4JYA H;  4AQY H;  2YS7 A;  4JAS A;  4ZQI A;  1I2K A;  1Y6X A;  4UUJ C;  2R85 A;  4JPR A;  5I5X A;  3N2K B;  3ZX6 A;  4QWB A;  4MTE A;  1ZUQ A;  4RNM A;  2HKO A;  3C3T A;  4B3M B;  1VAR A;  4JI2 B;  1THZ A;  3LQS A;  3BCC H;  1XRE A;  3HT5 A;  4JI4 B;  5JVD F;  1NKD A;  3AK1 A;  1I50 A;  4YXW G;  4MW3 A;  2IA6 A;  4FLX A;  3LML A;  1E4G T;  1MAB G;  4WF9 V;  2YXH A;  4DV7 B;  3B8M A;  3LSS A;  4H37 A;  4Z1M G;  5IYZ A;  1R3I C;  5GON F;  1S03 G;  4DR7 H;  1A9X A;  4FGR A;  1SET A;  1YJN V;  4YY3 O;  2JRI A;  4PA7 A;  3J81 N;  2UXD O;  1G6U A;  1NR1 A;  1FJG O;  5FNV F;  4LF6 H;  4JI0 H;  4X1Y A;  4DUZ O;  3WWI A;  3N6R A;  4NXN B;  3L4J A;  2HVR A;  2P22 C;  3HOW G;  4PZ7 A;  2Q0O C;  5T14 A;  2DYR B;  3IG0 A;  1TWG A;  4D7S A;  1ET0 A;  1N56 A;  2HHH B;  1BSM A;  2QWP B;  2QTO A;  3PO3 G;  1IOW A;  4AQY B;  3N8D A;  3CCQ V;  5DAA A;  4B3M O;  1VQN V;  3AW8 A;  1GSA A;  5FD6 A;  4TSF G;  3PZP A;  2Y4U A;  1HP8 A;  3G67 A;  1UPG A;  3KTM A;  5L3C A;  5D8D A;  3OE7 G;  3E22 B;  3CX5 F;  3LUL A;  5DQH A;  4LFC H;  2WSS G;  1Q90 D;  5LP6 A;  5KG1 A;  1RSO A;  2XTA A;  2KB1 A;  4JGS A;  4AQY O;  1GKF A;  1Q6I A;  2VPS A;  4IRK A;  2WYO A;  2HHH H;  1IUR A;  4A3C G;  4NTX A;  3CXH F;  5LGT A;  1WH2 A;  1BJT A;  5JJN B;  3N6X A;  5DM6 V;  1OJH A;  4TV8 B;  3TY8 A;  2ZR3 A;  5IT9 N;  5B5E Z;  3T9F A;  4DV2 B;  3BAB A;  5EYP A;  2YRX A;  1IBK H;  4JI0 B;  4O7S A;  3CCR V;  4R8C A;  5H2F Z;  1I7N A;  2ILM A;  3IN5 A;  3QWU A;  4ECT A;  2N05 A;  4ZOL A;  2R9R B;  3GID A;  4EB6 B;  4ED7 A;  4FS2 A;  1E4E B;  1GM8 A;  3THO A;  3SNO A;  4WFH A;  5LA6 A;  1N34 O;  4PI0 A;  4K6N A;  2RCV A;  2UXD H;  2AGO A;  3OFN G;  5EBL C;  3UCS C;  4JI0 O;  1GN3 A;  4LF9 H;  2EJ7 A;  1NBM G;  2YRW A;  5KT5 A;  5IY5 C;  2ASD A;  2DQ3 A;  3ZCC A;  2XGQ A;  2R93 G;  4CC6 A;  3SI8 A;  4TV9 A;  3JD0 A;  4AHC A;  3RB0 A;  1FXK A;  4X66 B;  3RGB A;  3GB8 B;  1DLB A;  3LDE A;  4FLY A;  2HR3 A;  2P7T C;  4DW1 A;  4MV4 A;  2PBZ A;  4B3M H;  2VUM G;  5DG9 A;  5LMN H;  5JQG B;  1YTF B;  3GQC A;  2BSK B;  2OCH A;  4DV3 O;  2C35 B;  4KP4 A;  3JRW A;  4A5U B;  2DPI A;  4IRD A;  4K35 A;  1JLL B;  5EC1 C;  1V55 C;  1G1X B;  1XMQ B;  2HHH O;  3I4N G;  4FK5 C;  5L3F A;  2PI4 A;  1EYZ A;  1KJJ A;  1NR7 A;  3R66 A;  1JMK C;  2M6Y A;  4EQ5 A;  2CTP A;  1VQM V;  2E2H A;  2IU3 A;  4JI4 H;  5BZB A;  1IBK O;  4Q4C A;  3IFX A;  4WBN B;  2L6L A;  1K5S A;  5KT3 A;  4O4H F;  4TUY B;  2UU9 B;  4YIO A;  5EC2 C;  1BGY H;  1SER A;  3OSP A;  1RK5 A;  4CZZ A;  4G27 B;  2F4V B;  3MR2 A;  3OUU A;  2IJI A;  3OGI B;  3CC7 V;  2CH7 A;  4XBF A;  4MVQ A;  3T1C A;  4BBR G;  2UVV A;  1L8D A;  4IR1 A;  5KFR A;  2VQE B;  4UCR A;  4MTX A;  1VIB A;  2BCC H;  3RYF A;  4RCN A;  3WG7 C;  2NU7 B;  3W1G A;  3CPW U;  5LMN O;  2V4Q A;  4D6T H;  1BXR A;  4EYH B;  5KHG A;  1N34 B;  1MZF A;  3G8D A;  2VUG A;  4CC5 A;  4O7N A;  2OIE A;  1SC5 B;  1BNC A;  2NR5 A;  3HB3 B;  5J2U F;  3OUS A;  5KFV A;  2VOB A;  3ETJ A;  1EZ1 A;  1MG1 A;  1VBH A;  4O86 A;  1N36 B;  1W59 A;  3D3I A;  2QF7 A;  5K3W A;  5L1L A;  4DR5 H;  3MR5 A;  1JXL A;  1Y67 A;  2E5L H;  3HXL A;  3OR6 C;  4K8X A;  4ECQ A;  4DR4 O;  4BR6 A;  4YR0 A;  1E1R G;  2FK1 A;  1OWT A;  4A3J G;  4JI4 O;  2QA4 V;  4YIP A;  3NGD A;  1O75 A;  2GV9 A;  2ITC C;  1RSO B;  5JCO A;  2YWV A;  2P5O A;  1CKN B;  4WFG A;  1I3Q A;  2BTQ B;  1V55 B;  1BHA A;  5KT4 A;  4U7O A;  2DYR C;  1VQL V;  3OHA A;  4WBN A;  3F5T A;  2PGG A;  3SPC A;  1TWF A;  2JJ1 G;  1EKP A;  5IE9 A;  3NR7 A;  4JI1 O;  1SQQ H;  1FJG B;  5KS8 A;  5TIS Z;  1M9N A;  4FFL A;  5D5Q A;  1MOF A;  5I5U A;  1KQS U;  4FU0 A;  1OHH G;  3JAT A;  3CXC U;  2R7Z G;  1GK9 A;  4LCU C;  1EN5 A;  3B77 A;  1GM9 A;  2QKC A;  2MK3 A;  5EZY B;  1J5E H;  1UNN C;  2WPD G;  5B1B B;  1HW7 A;  2F4V H;  4A3M G;  3AG1 B;  3G6Y A;  1SS3 A;  4TM5 A;  2R8I A;  3B40 A;  5KUM A;  1Y1W G;  3N27 A;  4PDB A;  3HOV G;  3N41 B;  5KFO A;  2IJJ A;  2XT9 A;  2B63 A;  5LXT F;  4B7K A;  4P2Z A;  1BQ0 A;  2COJ A;  3ORR A;  1FAF A;  1XK5 A;  4KL1 A;  2NVX A;  3Q4H A;  3N40 P;  1KEE A;  4Q45 A;  3QNE A;  5LBQ A;  2AU0 A;  1XNQ H;  2WB1 A;  4J9Y B;  3FKI A;  4DR2 B;  3CEB A;  4CE5 A;  5KFB A;  4QE7 A;  3V6H A;  2AHZ A;  3K03 A;  4MTO A;  2B9Z A;  5B1B C;  4DR4 H;  4UB8 Z;  1IBL O;  2CW8 A;  2PVP A;  2GLT A;  2MW2 B;  3GWK C;  1WNS A;  4L8J A;  2XCL A;  3W7S A;  2CE4 A;  4PZ6 A;  2Y4R A;  4U3J B;  5BWU A;  2UXC O;  3H9V A;  5H6Q A;  4J9M A;  1Y66 A;  3KCY A;  1WLE A;  1B6Q A;  4QJF B;  2W9C A;  1F7Y A;  1S68 A;  5ITZ A;  1R6T A;  2F1M A;  3ZRW A;  2ABJ A;  4JI1 H;  2A0L A;  2QM7 A;  1AI4 A;  4J9Q A;  2C2R A;  5HBR B;  2C2E A;  4X89 A;  4LF8 B;  5LYJ A;  4U7N A;  2R70 A;  2F93 B;  4AYB E;  3S3W A;  4DK0 A;  4GT1 A;  5BMV F;  5F9N A;  2F4V O;  2BQR A;  3HOY G;  4J7J A;  2W9B B;  3TIN A;  1PKX A;  4GKK H;  4KFM A;  5IP7 G;  4FM0 A;  1U96 A;  2V4D A;  3AK3 A;  4OPH A;  2PI5 A;  4UVA A;  4FFB A;  3RR5 A;  3X2Q C;  3CVZ A;  4CS2 A;  5CAE B;  3HBL A;  3ABM B;  4R8U B;  1C3O A;  2HHF A;  3MDS A;  5KFP A;  3EVK A;  3AG3 C;  3KAK A;  5C8Y A;  1S0M A;  1CXZ B;  4NZN A;  1VF5 B;  2P90 A;  3EXA A;  2XAH A;  2VQE O;  3R23 A;  3U0Z A;  1XL6 A;  1XOU A;  5BWX A;  2X7R B;  2FE3 A;  1K83 A;  4O2A B;  3L73 H;  1N33 B;  1AI7 A;  2UXX A;  4DR1 H;  4IAJ A;  4TWK A;  5LP6 C;  3DSQ A;  5ITZ B;  1JKJ B;  1KKC A;  4X8A A;  2IM9 A;  4RU9 A;  4MW8 A;  2QWN B;  1CPY A;  3T1H O;  1AJP A;  2L35 A;  3BJY A;  1KU9 A;  3VMM A;  3ETQ A;  1PPJ H;  3OSN A;  3PN1 A;  2F23 A;  5J2U A;  3FAV A;  3J7A K;  2HVJ C;  4FLU A;  2EIN B;  2UUA H;  4WHX A;  1SZX A;  1JPX A;  4JYY A;  3WNZ A;  1ZX3 A;  2DAB A;  2WAQ E;  1P84 F;  1WA8 A;  4FM9 A;  3T1H B;  4TV8 A;  2ADQ B;  2VS0 A;  1OCC B;  2FML A;  2Q7G A;  2NN4 A;  1AN7 A;  4QWA A;  4GKK O;  1KB9 F;  1M57 B;  3TJT A;  2DOS A;  1VQ5 V;  1H2L A;  2VRZ A;  3X2Q B;  3HKC B;  2COI A;  1JX4 A;  4MV6 A;  4LF7 B;  3CE2 A;  5C8Y B;  2W6N A;  3TW6 A;  1KEC A;  1XDC A;  3PR5 B;  4IGG A;  4LF5 H;  3CYO A;  4K0K O;  2HEP A;  4QW8 A;  3H1J H;  4R8U A;  4BWS C;  3UQ8 A;  1KMI Z;  5I5W A;  4JV5 B;  1JR9 A;  3SPI A;  1Y14 B;  1QR9 A;  4MVS A;  4MAM A;  1KBL A;  3BQ1 A;  2RJZ A;  4ED1 A;  1IZ3 A;  4F4Y A;  4OGQ B;  1TWA A;  2A7W A;  4I55 A;  5JWP A;  3Q4H B;  1WB8 A;  3O65 A;  5IJ0 B;  3U54 A;  1WAZ A;  4GC7 A;  4W4K A;  2JIZ G;  2LO1 A;  4DR1 O;  1GTO A;  4NZM A;  1RYS A;  1IBM B;  3VQX A;  3NUA A;  5JQW A;  5LOV F;  2GDS A;  2HG8 A;  2CNV A;  5IYB G;  4I0X B;  1K4C C;  4X64 B;  3CC2 V;  5C5J A;  3CJH A;  3K5L A;  4QJF A;  4H44 B;  2W9C B;  4J9O A;  5CBG A;  4GX5 A;  3CD6 V;  2GSM B;  1HR0 O;  3RN4 A;  4J9L A;  4CBC A;  2VUM A;  2H8P C;  3RB3 A;  5KFF A;  3RFC A;  3UZO A;  3VQY A;  1EUC B;  4HZ3 A;  1HDJ A;  4MA5 A;  5BWT A;  3R5F A;  4J9Z B;  1VQ6 V;  3K3V A;  2Q6A A;  4FIP C;  1DTO A;  5KFS A;  2FB9 A;  3CCS V;  3ASO B;  3OMN B;  2QK4 A;  1N48 A;  1ULZ A;  4E4E A;  1JDE A;  1SCU B;  4XDL A;  1V54 B;  5L1K A;  3AYH B;  2YYA A;  3Q2O A;  1MZE A;  4JTC B;  5J9P C;  5DQI A;  1NTZ H;  1L0N H;  1Z5V A;  3HKD A;  4JI5 H;  2ZM6 H;  1V9P A;  1SFO A;  1AI6 A;  2QM8 A;  3AG2 B;  4ZI7 A;  4HBN A;  4UVB A;  4LF7 H;  4Y8V B;  3STZ C;  3F8N A;  2UUC B;  4JI8 O;  2LJ2 A;  4FFB B;  3CRC A;  4JF3 A;  1A32 A;  3F7Y C;  2Z0A A;  1MA1 A;  5H5N A;  1JX9 A;  5LMU B;  3OR7 C;  5CB4 F;  1N33 H;  5JVL A;  3U11 A;  3G80 A;  1PNK A;  5DED A;  4DV6 B;  1NH2 B;  3GTJ A;  5E79 Z;  4C5B A;  1TWC A;  2DW4 A;  1QNM A;  2X6B A;  3UKM A;  4JYA B;  1D2D A;  4DV4 O;  2QWQ B;  1RM1 B;  4JI1 B;  4YJ2 A;  1NI8 A;  3K5I A;  4W4L A;  5KFA A;  4IWY A;  4DV6 O;  3CCV V;  4A3E G;  3G6B A;  1XNR O;  4LFB B;  4DIM A;  2W9A A;  3G71 V;  2Y69 C;  2WLI B;  2LW7 A;  4LFA B;  5KFX A;  3D36 A;  3L2P A;  4X20 B;  2Q8V A;  3TXQ A;  4BAY A;  2X0L A;  4DRX A;  2V5A A;  1TGO A;  4O2B F;  3T2M A;  5KX5 F;  3W7U A;  2YI8 A;  3DXR B;  4DV2 H;  4LP8 A;  1Z2G A;  2QB5 A;  4HNU A;  5CA1 F;  3PO2 G;  5IT9 W;  1IX9 A;  5EOY A;  4X64 O;  4XYM B;  5EZY F;  3CCM V;  5KFY A;  2YZL A;  4PD4 F;  5LA6 B;  1Q82 W;  5DIS C;  5KUK A;  4DL6 A;  3CRA A;  1T5E A;  4RB2 C;  2JA5 G;  1G4Y B;  2EZP A;  3T5L A;  3M9M B;  2P6J A;  3RYH B;  4IIJ F;  2MCT A;  4O7L A;  1WCM G;  5K1P A;  1SQX H;  2WLL B;  5IY5 B;  3SYP A;  4PDV A;  4TV9 B;  3LNN A;  3NXS A;  1I94 B;  4O4H B;  4O4I F;  2XAQ A;  4JI3 H;  4F50 A;  1VF6 C;  2WLN A;  4L87 A;  1CP9 A;  5L3E A;  3RV3 A;  2R9I A;  4FFP A;  1NS1 A;  3DTU B;  5DMX A;  2YZN A;  4JUZ A;  1OV9 A;  1TVK A;  2LW1 A;  5LMN B;  3T4D A;  4EGQ A;  2Q0A A;  4X1I B;  1I0H A;  5KHJ A;  4PA9 A;  1AR4 A;  5JQG A;  5CA0 B;  4JV1 A;  1YZB A;  4YJ2 B;  2K9P A;  2WLI A;  2GUZ B;  2EIN C;  3A0H Z;  4ECR A;  3T1Y H;  4F6R B;  1ZL8 A;  2R86 A;  2ZDG A;  3SDL A;  5JH7 A;  4NZO A;  3HOX G;  5JJJ B;  4ECY A;  4J11 A;  4DV5 B;  4B3S O;  2ZE5 A;  4DV7 O;  4C7U A;  2A3Q A;  3JD4 A;  4O4L A;  3QO5 A;  4FLW A;  2CNU A;  4PZ8 A;  3RYI B;  1H2G A;  1EKF A;  1KUT A;  3UO2 A;  1QLE C;  1DF5 A;  2ZKO A;  1GO3 E;  4DV2 O;  4DR4 B;  3MFI A;  3E89 A;  3CCJ V;  3JZF A;  1FXH A;  4X64 H;  4PDL A;  4RAI A;  3JAW A;  3OW2 U;  3H0G G;  5BR8 O;  2V58 A;  3GTO A;  1GSO A;  1XDN A;  4Q6G A;  1VQ8 V;  1GH6 A;  1XBL A;  3QO8 A;  4JI3 O;  3TII A;  4ICG A;  1Z5W A;  2QE7 G;  1TWH A;  4MV7 A;  5I47 A;  4LH6 A;  2IH1 C;  1I94 H;  2XND G;  3T9D A;  1CKM A;  5DEC A;  4RAY A;  2YIC A;  1SEI A;  1C30 A;  2QM4 A;  5CBF A;  4JV5 O;  1ZSP A;  2ZM6 B;  3ZRX A;  1QVG U;  4QIW F;  4ZI7 B;  1MSW D;  1O9G A;  1VEW A;  3T1Y O;  3L71 H;  1F51 A;  3FB5 C;  2GUZ A;  4UCV A;  1Y76 A;  2LQT A;  2XCA A;  4TV9 F;  4ZI7 F;  1OCZ B;  3CCL V;  2WB1 E;  4LSA A;  1BHB A;  3K0G A;  3JCZ A;  1Y74 A;  3JCU Z;  3BAC A;  1M90 W;  3RYI A;  5KMG A;  1PK8 A;  3VA7 A;  1N8R W;  2J6S A;  2FJZ A;  3ZHU A;  5KG2 A;  1I1M A;  2HP8 A;  4QW9 A;  1MMM A;  3ZRV A;  1K1Q A;  2ATK C;  4JYA O;  1YJW V;  2Q5Z A;  4CH5 A;  5DGH A;  4RB3 C;  1V51 A;  3RF2 A;  5BMV A;  4R50 A;  3OEE G;  1YCI A;  4NB5 A;  5A2Q N;  5CM0 A;  2W6M A;  4NR1 A;  3K9S A;  5AG2 A;  3RB4 A;  3TXS A;  2YSU B;  1K8A W;  4FJC C;  3RJ0 A;  4FM2 A;  1H38 A;  3GTM A;  2ARH A;  5CBH A;  4ECV A;  4IL6 Z;  3ZJZ A;  5KFQ A;  3VPD A;  2KKW A;  4YY3 B;  4CS3 A;  1SES A;  1I94 O;  3T7A A;  4DR7 O;  5CE8 A;  1SA0 A;  5IWA O;  1M1K W;  3QVN A;  1T36 A;  5JCO C;  1L2Z A;  5C1P A;  4C2M A;  1FFX A;  1LUW A;  4JV5 H;  4MV1 A;  4JV2 A;  4DUZ H;  2E76 B;  4DL7 A;  3A8T A;  3TEK A;  1SQB H;  1I7L A;  2EIL C;  2WLL A;  2R8H A;  2W6P A;  5JVD B;  5IP9 G;  5D5P A;  2EIL B;  4M9U A;  2PUS A;  5KG6 A;  5B1O A;  2R8K A;  4RNN A;  4CH4 A;  3WB1 A;  1N36 O;  2EIJ B;  3IC7 A;  2DN9 A;  1HNW O;  2PF4 E;  1WSC A;  2JA6 G;  1J95 A;  3K57 A;  5D1O A;  2R84 A;  2IP4 A;  5FNV B;  2C28 A;  3PW2 A;  1KUQ A;  4MT8 A;  2EIK C;  1ZL8 B;  1G8M A;  1S97 A;  4AI8 A;  4OX9 O;  2C22 A;  1JJ2 U;  3ZRW B;  4YAJ B;  2BE3 A;  3RYC A;  1GRJ A;  5L1I A;  1E1Q G;  3ICX A;  4RAZ A;  2EJ2 A;  2IBK A;  2UUC H;  3TQT A;  2YIB D;  1DAA A;  4RUA A;  4O4I B;  3ABK B;  2HGW A;  3N43 B;  1JJO A;  1S0N A;  4ZHQ A;  1URF A;  3CEI A;  5A9G A;  5H80 A;  1XIL A;  4UFZ A;  3ZMS A;  3DGE A;  2UVW A;  4DR6 H;  2EIK B;  1ZAU A;  1Q7Y W;  5LXT B;  4BIU A;  2DWE C;  3I56 V;  4A3F G;  2UUB H;  1N34 H;  2CDY A;  4MV9 A;  3HPL C;  3K5N A;  1KC7 A;  5CA0 F;  4GX1 A;  5FLX N;  4CMD A;  5FLM G;  2D2C B;  3JD2 A;  4DO2 A;  2P0A A;  5FD5 A;  2Q4P A;  4BBS G;  4YJ3 A;  2GHY A;  2Q7H A;  2CAZ C;  2R82 A;  3J80 W;  4J41 A;  1S0V A;  3JSN A;  2B5U A;  1YEW A;  4Q4D A;  4MVO A;  3TY5 A;  2R87 A;  2CKZ B;  2EJ0 A;  2NNU A;  1BQZ A;  4DUY O;  3HO8 A;  2FB5 A;  3SPG A;  1HNW H;  5LHH A;  4F4Z A;  5B3S B;  3R5H A;  4UCU A;  3L70 H;  1H2S B;  5LL6 b;  5IWA B;  3HKB A;  4IWX A;  2ZDH A;  2QKS A;  3JZI A;  3GIQ A;  5KT6 A;  5L3G A;  1JA8 A;  1DV1 A;  1VQ9 V;  4TQR A;  3RUP A;  2COG A;  4OX9 H;  2JVD A;  3FYI B;  2YID A;  3V6K A;  4MA0 A;  5F9L A;  2FYU H;  4NXM O;  1Y4M A;  2BTO A;  2A9H A;  3ABL B;  5BYA A;  4O3R A;  2UUC O;  4RUE A;  4JI8 B;  2HVQ A;  1JIH A;  5J2T A;  4JYB A;  4FMT A;  3FX7 A;  3MWD A;  4BW9 A;  2DAA A;  3M7M X;  2D3O W;  4DR6 O;  2OTJ V;  1XUQ A;  2B1G A;  3UO3 A;  5E1A C;  5DN6 G;  2CK3 G;  2HIV A;  4O7W A;  1ZHQ A;  4MVU A;  1HNX O;  1OCZ C;  1XMQ O;  1WRV A;  4J7K A;  5KFC A;  3T9B A;  5BXZ A;  3GIK A;  3BQ0 A;  3JAR B;  3AG7 A;  4ECX A;  3JYC A;  1NJI W;  4O7R A;  1X4T A;  3RVY A;  2YC0 A;  4HNA A;  4QWC A;  2EX3 A;  3L75 H;  3PVX A;  2HVK C;  4EFB A;  4DUY H;  2XUM A;  1ZQ7 A;  2JS3 A;  4F4X A;  2DYS B;  3AK2 A;  3RYF B;  2NUA B;  5B1A B;  2YEV A;  4MTG A;  4DR1 B;  5KG3 A;  4I9W A;  5IYD G;  1Q3E A;  2LGQ A;  1FFX B;  3G6V A;  2CFM A;  3WO1 A;  4DL5 A;  2Y0I A;  1QVF U;  3DC6 A;  1K4D C;  4HN2 A;  3B2E E;  1W2B U;  2WLM A;  4NXM H;  4X9Q A;  3JRX A;  5JUM A;  1HWY A;  4JTA B;  4AYB A;  4J42 A;  1RJP A;  1PL0 A;  3J81 W;  3E8G A;  2RGR A;  4HYO A;  1RM1 C;  5D1O B;  3QFF A;  2Q73 A;  1Q5O A;  5KFK A;  1M5I A;  3H3V H;  4RO2 A;  5KG5 A;  2JGU A;  4WFF A;  4RB1 A;  2UXB H;  4DR7 B;  1QCE A;  1AR5 A;  3R65 A;  4O2A A;  4DL2 A;  1HNX H;  2ZXW C;  2NU9 B;  3CMA V;  3FB6 C;  4BIZ A;  4DR2 H;  1BT8 A;  1P49 A;  4HNA B;  5H6R A;  1NVP D;  3UZB A;  1AR1 B;  4O3N A;  1SQP H;  1PM9 A;  3E86 A;  2BR0 A;  4O4I A;  3OD4 A;  5LL6 Y;  2YXL A;  3EPG A;  1J5E O;  1ZTE A;  2GPW A;  4CKB A;  2W0F C;  4O7Z A;  1K92 A;  4X62 B;  3WU2 Z;  2G38 A;  5KG4 A;  3K79 A;  5BYB A;  3Q8S B;  2FPI B;  3G6X A;  2VPQ A;  5I5S A;  4EB6 A;  5FL7 G;  3ZHV A;  1QU7 A;  3DTG A;  2JEJ A;  3W7T A;  3ZMU A;  4LF4 H;  4DR3 O;  3PW0 A;  3LDC A;  4ZHQ F;  2JEF A;  5IYB O;  4YHH H;  4CHI A;  1KJQ A;  2Q67 A;  4Q43 A;  1R1B A;  2E75 B;  1EZV H;  2FK2 A;  2IMW P;  3ZN1 A;  3AG4 B;  1S76 D;  4GX0 A;  4FLT A;  1EBO A;  1GSH A;  3CRM A;  3AG1 C;  1S3J A;  3QQM A;  3L4K A;  2ZE6 A;  3I5D A;  2AXT Z;  4F4W A;  3EFF K;  3T5K A;  2NU8 B;  2W7O A;  1O9H A;  5L1J A;  3RAQ A;  4J9S A;  3P32 A;  3RBE A;  5KFL A;  4O3O A;  3T99 A;  1LUV A;  3KZI Z;  2UXC H;  1UJW B;  4BY1 G;  4I55 B;  3RB6 A;  4KXR A;  2R8J A;  4HAM A;  2UXB O;  4DRX B;  4DUZ B;  4PEL A;  3TET A;  5DG8 A;  1KD1 W;  2GBO A;  2Z5U A;  1GN4 A;  3OTF A;  1P4R A;  4J80 A;  4MVM A;  4DR2 O;  3TQ1 A;  3PW7 A;  2JA5 A;  2DLN A;  4LFC B;  3ZRS A;  1P7G A;  2JS5 A;  1Z2P X;  3WFV A;  1Y1V G;  3I4M G;  2QDO A;  2ADP A;  1I08 A;  4R7C A;  3RYH A;  2O57 A;  5F2V O;  2P06 A;  5BMV B;  1YF2 A;  4K3A A;  2KG7 A;  3KKY A;  4QE9 A;  1CKN A;  3PFF A;  2KQX A;  2WWW A;  1NU1 H;  5DLF A;  4LF4 O;  4NYE A;  5EYP B;  3FFQ A;  1EM1 A;  4M0J A;  1FD9 A;  4YHH O;  3W1B A;  1T3N A;  3WB0 A;  5DGB A;  2Q2U A;  5C3E G;  2C00 A;  2X6A A;  3FB7 C;  1FPO A;  1EN6 A;  4IHJ B;  3EYY A;  4HNT A;  5EZY A;  4JI6 B;  1H2K A;  4WCE V;  1PNL A;  4WD3 A;  3MR6 A;  3SPJ A;  5KFE A;  4DV4 B;  2JEU A;  5CA3 A;  3BEH A;  2ZIO A;  4IT5 A;  1VQ4 V;  4TQD A;  4RQF A;  5GON B;  4PI2 A;  2QGN A;  3MR3 A;  1L0L H;  3C3S A;  3J80 N;  2EJ3 A;  2W6Z A;  2R7K A;  2ZGI A;  4B3T B;  4MV3 A;  2R7N A;  5EDW A;  2JK5 C;  5EK0 A;  1K33 A;  3AX6 A;  3K08 A;  3UM7 A;  4TUY F;  3K5M A;  5LYJ F;  5DGA A;  4XZ3 B;  3P3N A;  4E2L A;  4YHH B;  3H0G A;  4JV0 A;  4DV1 B;  3K3W A;  2HFE C;  3IGA C;  2OLS A;  3FB8 C;  1YTF D;  4TV8 F;  4I50 A;  1OBD A;  2JA6 A;  4QSH A;  3QF7 A;  2XAS A;  1BCC H;  4X62 H;  5IYC O;  1OCR C;  2YL2 A;  1WA8 B;  3JAT B;  2ALZ A;  2KG7 B;  4OX9 B;  3ASO C;  4EEQ A;  1H2N A;  3OMA B;  4FPP A;  1PX2 A;  4MVZ A;  5KFH A;  1ARO P;  4ED6 A;  3RFR A;  2ZDI A;  1FXV A;  2ZR2 A;  4XDK A;  5L3B A;  1CQJ B;  2F66 C;  1FVI A;  4K0K B;  2ZIN A;  3RGX A;  4GLX A;  4LF5 O;  4Q0Y A;  2Y0S A;  4J0M A;  4DV0 O;  5KAI Z;  1FKA H;  4B3R O;  4I5S A;  2VQF B;  4GKK B;  2JGD A;  2R8G A;  4JI6 H;  2BOB C;  4A2B A;  3H1K H;  3E5N A;  3HR0 A;  3QO7 A;  3GB7 C;  4A3K G;  2YIA A;  5KT7 A;  1QHT A;  4B08 A;  4LF4 B;  4EBD A;  4R6Z A;  2F43 G;  4O4H A;  1TVK B;  2FPG B;  2K1E A;  2J9G A;  4EBE A;  1S5H C;  2QR4 A;  2YZM A;  3SYQ A;  1QQC A;  1SKV A;  1KBH A;  5KMG B;  5EWG A;  3CME V;  1I1K A;  4P9P A;  2A1H A;  3OHB A;  3A0R A;  4ECZ A;  3BRC A;  1R6N A;  3T9E A;  3RGZ A;  2FLL A;  1U97 A;  3QTC A;  1K73 W;  1HR0 H;  3E8F A;  2HJD A;  4DV1 H;  4EFE A;  3AG4 C;  1Q81 W;  4DLK A;  3TY9 A;  4X62 O;  3GIM A;  3BA9 A;  3MWE A;  1A0G A;  3UFX B;  4ECU A;  5BY1 A;  3O9O A;  3ZED A;  5LA6 F;  4G28 B;  1A0I A;  2ZDQ A;  2M7W A;  4J9K A;  3G4S V;  2CGN A;  2WLK A;  3JAW B;  4QGP A;  4YJ3 F;  2NLJ C;  1S72 V;  4UV9 A;  1IBK B;  4CKE A;  1A3G A;  4DV0 H;  3A2F A;  1N32 H;  5D1P A;  2JGD B;  3LWB A;  3LUT B;  3T54 A;  5KA5 A;  4U7C A;  2ZM6 O;  2KSD A;  3HKZ A;  4O3Q A;  2ZNJ A;  4B3R H;  4YQW A;  3GJX B;  1AJQ A;  3WB2 A;  5GTI Z;  4LF7 O;  1KJ8 A;  3KCX A;  1K97 A;  4DRF A;  1OZ0 A;  3ZHQ A;  2ZE8 A;  2YU9 A;  2M05 A;  1MNG A;  4Q8E A;  4H33 A;  3GV8 B;  4ABM A;  1GGO A;  4WFE A;  4DYL A;  3RVZ A;  1N33 O;  2XAF A;  4ZBM A;  4X65 B;  4DV3 B;  4MV8 A;  4YJ2 F;  2B63 G;  1EFR G;  2IBZ H;  4UVC A;  1AJN A;  2EIJ C;  3JAS A;  4FFR A;  4U6P A;  1EZJ A;  2W6I G;  3U0G A;  5FPO A;  4RNO A;  4A3B G;  4DV6 H;  1XNR H;  1AUV A;  1XNQ B;  2HGX A;  1D5A A;  2DWC A;  1YVW A;  4DV1 O;  3TW7 A;  5C8Y F;  3Q1K A;  4MSW C;  4DK1 A;  2UXB B;  3VOU A;  5A2Q W;  3VPB A;  2ASL A;  2UXD B;  3OGC C;  1QLE B;  3BY6 A;  5J2U B;  2FLP A;  4RZQ A;  5KFG A;  3BHP A;  3C0F B;  2OTL V;  3ABU A;  4G3I A;  3V6J A;  2Y48 A;  2ZJT A;  4PJ0 Z;  3K58 A;  1V54 C;  5FR9 A;  1WR2 A;  3BFR A;  1BL8 A;  3JD1 A;  2I8C A;  3PR4 A;  4BY7 G;  3CJH B;  5KFJ A;  1LNQ A;  2UUB B;  1N32 O;  3OT7 A;  4APM A;  4IRC A;  4I50 B;  3MAQ A;  2WAQ A;  1IBM H;  1GM7 A;  1ZWI C;  4JZ2 A;  3TK1 A;  2UUA B;  3JAK A;  5CB4 A;  5IJ9 A;  3ML0 A;  1KTA A;  4QIW E;  1AP5 A;  2ODT X;  1IVS A;  4J7Z A;  3RW0 A;  1FXK C;  3MFH A;  1F4M A;  4XDJ A;  3GIP A;  1BGW A;  2FK3 A;  2XAJ A;  1E4F T;  4ZKI A;  3IC9 A;  1VP7 A;  3W7X A;  5KFT A;  3K06 A;  2YI9 A;  5KFZ A;  4PBC A;  1XMO H;  5DQG A;  2QJ1 A;  4Q8F A;  1K9M W;  3W7W A;  1HNZ H;  3GLK A;  4MTD A;  4CMF A;  3TCU A;  2HHF B;  5CA0 A;  4HQ6 A;  1WPB A;  2VQF O;  2F95 B;  5LGU A;  2W6Q A;  2YXY A;  3ABL C;  4O4L F;  3WO0 A;  1YXB A;  4F6R A;  3BG5 A;  5DGI A;  2FPP B;  3M9N B;  4QWD A;  2Y0S E;  4ME6 A;  2AGP A;  5LHI A;  2I80 A;  4KUM A;  3FDS A;  2RGV A;  2RN9 A;  1V4Y A;  3QG5 A;  3H40 A;  3LSU A;  4GKJ H;  1VQ7 V;  5B3S C;  4FFM A;  3UT5 B;  1NT2 B;  5FNV A;  1GO3 F;  2BSK A;  2LGW A;  2W0X A;  4I4T A;  3HOZ G;  3RBZ A;  4PDR A;  4GX2 A;  4GYC B;  4O4J A;  3CCE V;  3R9R A;  3HKE B;  2BTQ A;  3DTF A;  1MSD A;  3SPH A;  5LOV A;  1IBM O;  3HB9 A;  5BR8 H;  3AG2 C;  2CTW A;  5JJE B;  1TUB A;  1UFI A;  4O3P A;  5BPF A;  1AUX A;  1WPX A;  3JAR A;  4DW0 A;  3RTX A;  5LXT A;  3KRE A;  3K5H A;  1HNZ B;  3Q8R B;  4A3L G;  5BR8 B;  3TGU H;  5I5V A;  2R7Z A;  1OCR B;  5LP6 F;  1VQP V;  1PP9 H;  3CQZ A;  2EIM B;  2DIK A;  2AQ4 A;  2QWR B;  1T94 A;  2WDT A;  4FE2 A;  4NKG B;  1VBG A;  1S77 D;  4ED3 A;  4EBC A;  2ZT9 B;  2YEV B;  1AP6 A;  4GKJ B;  3NBY B;  3JD3 A;  2VQF H;  1W96 A;  2UU9 H;  1RJR A;  1X59 A;  4ECS A;  2UXN A;  3CRQ A;  1KJ9 A;  3AG3 B;  4ZOL F;  2W57 A;  2Q69 A;  4YY3 H;  1FJG H;  4LF6 O;  3F7V C;  4PA4 A;  4GKJ O;  2O03 A;  5GON A;  3SJC C;  4LF8 H;  1ORQ C;  4H0L B;  4LH7 A;  4HYK A;  1WB7 A;  2YUA A;  4O7T A;  1KC8 W;  2A06 H;  4OXS A;  2PTM A;  2WTF A;  4FM1 A;  3OTO O;  4F4L A;  1M6V A;  4I4T B;  2Q7D A;  2Y69 B;  2ZDI C;  2Q9L A;  1RPR A;  5BWW A;  4YR2 A;  2VA2 A;  5J2T B;  2FP4 B;  4UCS A;  1XMO B;  1H8H G;  4I0X A;  3VBB A;  4FFN A;  5EWE A;  3PJS K;  2RNB A;  3OUZ A;  4EEY A;  1S10 A;  4R7R A;  1OCO C;  2JA8 G;  1S9F A;  2ATL A;  2R92 A;  3M99 B;  2B1I A;  1RJQ A;  4N23 A;  3UYY A;  1M4U A;  2I87 A;  3N2G B;  2AW9 A;  1PV0 A;  2W9B A;  4BW5 A;  2YZG A;  5BWR A;  1E79 G;  3K59 A;  1EUD B;  5IWA H;  1VF7 A;  4EG0 A;  3IAY A;  4IZO A;  4LF6 B;  5EBW C;  2XC9 A;  2SCU B;  4UCO A;  2VQD A;  3QZ7 A;  2P67 A;  4HNV A;  4X66 O;  4TVI A;  4GC6 A;  1SYX B;  4X1K B;  4IYI A;  2UU9 O;  3TIG A;  3M8A A;  1COW G;  1I5Y A;  4A93 G;  4C5A A;  4G2K A;  3APO A;  2CGO A;  1N36 H;  4X1I A;  1QR8 A;  4LFA O;  4O83 A;  2W6O A;  3B4S A;  1QBZ A;  1Q6U A;  1YI2 V;  4ASU G;  5KA6 A;  3HKD B;  4ECW A;  4LF9 O;  3E2E A;  4LF8 O;  4DV0 B;  2OYQ A;  4DAA A;  1SF9 A;  2PYJ A;  2R7L A;  1D5N A;  1VF6 A;  3CCU V;  5KT2 A;  3E35 A;  3OTO H;  2AZ0 A;  3HKZ E;  1JFF A;  1IXM A;  4PHZ A;  4JXU A;  1PL4 A;  4DL4 A;  2OWO A;  4FS1 A;  5B66 Z;  4IHJ F;  3SYA A;  3PW5 A;  1W93 A;  5LMU O;  1NH2 D;  3L9D A;  1QLN A;  4LR3 A;  2H94 A;  5JQG F;  1GAX A;  1YIT V;  1JOY A;  3H4B A;  2WLH A;  4DV3 H;  4RZR A;  2AHY A;  3RBD A;  4BXX G;  1DV2 A;  3G8C A;  4FLZ A;  3ZIA G;  3UT5 A;  4RUC A;  2JEG A;  2WE6 A;  4ED2 A;  4EGJ A;  3RWR D;  2DE0 X;  5IJ9 B;  2UUB O;  1N32 B;  1Y1V A;  3T5H A;  2DPJ A;  1YJ9 V;  3H1H H;  3HKE A;  1B04 A;  2AZ2 A;  1XNR B;  4LFB O;  1WCM A;  2X0S A;  4X66 H;  1TUB B;  2C2D A;  4JAV A; 
#chains in the Genus database with same CATH homology
 2UXC H;  4I55 B;  3SGI A;  1Z5V A;  4DRX B;  4DUZ B;  3HKD A;  4JI5 H;  3VQW A;  4LF5 B;  2ZM6 H;  4LFA H;  1V9P A;  4ZI7 A;  1ZHS A;  4HBN A;  4LF7 H;  4JI7 H;  4RB0 A;  5KX5 A;  1HR0 B;  3F8N A;  2UUC B;  3OTF A;  4X20 A;  1VS0 A;  4FFB B;  1DGS A;  4LFC B;  5CA1 A;  2JS5 A;  1Z2P X;  3RYH A;  5LMU B;  1N33 H;  2RQ6 A;  5K1X A;  4JYA H;  3U11 A;  4AQY H;  4DV6 B;  5BMV B;  2VWJ A;  4B3T H;  1CKN A;  3W5O A;  3OTO B;  3N2K B;  4MTE A;  4JYA B;  4B3M B;  5LMU H;  4JI1 B;  5EYP B;  3FFQ A;  4YJ2 A;  4JI2 B;  4U3J A;  4AIL C;  3W1B A;  4JI4 B;  3WB0 A;  4LFB B;  1X9N A;  2Q2U A;  4FLX A;  3LML A;  1E4G T;  3M4I A;  4JI5 B;  3N44 B;  1I6U A;  4LFA B;  4DV7 B;  4IHJ B;  5IYZ A;  4DR7 H;  3EYY A;  1S03 G;  5EZY A;  4JI6 B;  1IBL B;  3MWM A;  3L2P A;  4X20 B;  1XMQ H;  5JH7 B;  1G6U A;  4DRX A;  4LF6 H;  4DV4 B;  2YIB A;  1TGO A;  4JI0 H;  2HGS A;  4X1Y A;  2ZIO A;  4LFB H;  2YI8 A;  4NXN B;  2HVR A;  3L4J A;  2P22 C;  4IIJ B;  4DV2 H;  4TQD A;  5GON B;  4PI2 A;  4PZ7 A;  2KSW A;  5IT9 W;  5EOY A;  5EIB C;  4ZHQ B;  5LA6 B;  5DIS C;  1T5E A;  5KHH A;  4D7S A;  3IG0 A;  4B3T B;  4ETS A;  4RB2 C;  2E3C A;  3RYH B;  2HHH B;  3FMA A;  2MCT A;  4AQY B;  5CA1 B;  5K1P A;  5FD6 A;  1SA0 B;  3K5M A;  1TAE A;  4TV9 B;  3LNN A;  4YHH B;  1I94 B;  5FPR A;  4O4H B;  4DV1 B;  3E22 B;  4X1K A;  4JI3 H;  4LFC H;  4I50 A;  4FLV A;  3NC0 B;  5LP6 A;  1RSO A;  3QF7 A;  2VPS A;  4X62 H;  2ZNI A;  2WYO A;  2HHH H;  1TVK A;  4DR3 B;  1WH2 A;  5LMN B;  3JAT B;  5JJN B;  1BJT A;  4E6N A;  3N6X A;  4DV5 H;  1S5J A;  4OX9 B;  4TV8 B;  4EEQ A;  3TY8 A;  2Q0A A;  4X1I B;  5KHJ A;  1WN7 A;  5JQG A;  3RFR A;  4DV2 B;  5CA0 B;  3BAB A;  4YJ2 B;  5EYP A;  2F66 C;  1FVI A;  4K0K B;  3T1Y H;  3KXY T;  1IBK H;  2ZIN A;  4JI0 B;  4F6R B;  3SR2 C;  3QWU A;  4ZOL A;  3RGX A;  4GLX A;  4Q0Y A;  4J0M A;  5JH7 A;  5JJJ B;  4DV5 B;  4EB6 B;  4LF9 B;  1FKA H;  4CH6 A;  3THO A;  5LA6 A;  4O4L A;  4IIJ A;  4PI0 A;  2VQF B;  3JAL B;  4GKK B;  2UXD H;  4PZ8 A;  4FLW A;  3BAA A;  3RYI B;  4LSX A;  1IBL H;  4JI6 H;  4LF9 H;  4A2B A;  5EIB D;  4DR4 B;  1Q8I A;  2YIA A;  4TUY A;  1QHT A;  4B08 A;  4CC6 A;  4LF4 B;  4TV9 A;  4AHC A;  4X64 H;  4O4H A;  1TVK B;  3JAW A;  3RGB A;  4X66 B;  3GB8 B;  4FLY A;  4TQF A;  5LP6 B;  4K8Z A;  1QQC A;  1SKV A;  5KMG B;  4B3M H;  1Z2N X;  3S24 A;  5JQG B;  5LMN H;  4DR3 H;  4A2A A;  1XDN A;  4Q6G A;  4CS4 A;  3BRC A;  3RGZ A;  3QTC A;  1HR0 H;  1Z5W A;  4UCT A;  4JI3 B;  4MV7 A;  4DV1 H;  4EFE A;  1XMQ B;  3TY9 A;  4LH6 A;  1I94 H;  3BA9 A;  1CKM A;  4RAY A;  1CKO A;  1J5E B;  4M7E A;  4ZOL B;  4B3S B;  1SEI A;  3ZED A;  1JMK C;  2QM4 A;  4EQ5 A;  1A0I A;  2ZM6 B;  5JVD A;  3JAM W;  4ZI7 B;  4JI4 H;  1O9G A;  3JAW B;  1P8L A;  4WBN B;  1P16 A;  4UCV A;  3T1Y B;  1IBK B;  4DV0 H;  4TUY B;  3A2F A;  1N32 H;  5D1P A;  3BPZ A;  2ZNJ A;  2UU9 B;  4B3R H;  4LSA A;  3GJX B;  3WB2 A;  4DRF A;  4O4L B;  2F4V B;  3RYI A;  5KMG A;  2VQE H;  3U10 A;  2HVS A;  1L8D A;  4CH5 A;  1M93 A;  4X65 B;  4DV3 B;  4RB3 C;  3RF2 A;  2VQE B;  5BMV A;  4UCR A;  3RYF A;  4KHP H;  5KHI A;  3JAS A;  3W1G A;  3T1H H;  3JSL A;  5KHG A;  1N34 B;  5FPO A;  3JAK B;  5CB4 B;  2VUG A;  4DV6 H;  4CC5 A;  1XNR H;  3RJ0 A;  4FM2 A;  1XNQ B;  1D5A A;  2VOB A;  2KKW A;  4YY3 B;  4CS3 A;  1N36 B;  4DK1 A;  1SA0 A;  2VWK A;  2UXB B;  4DR5 H;  5FLX W;  2E5L H;  5JCO C;  1L2Z A;  3HXL A;  5A2Q W;  4K8X A;  1FFX A;  5J2U B;  2UXD B;  4JV5 H;  4RZQ A;  3BHP A;  3C0F B;  3ZS8 C;  4DUZ H;  1MZB A;  4DUY B;  2ZJT A;  3KAL A;  4LNU A;  3K58 A;  1O75 A;  2GV9 A;  5JVD B;  5JCO A;  5D5P A;  4NVP A;  2PUS A;  2P5O A;  1CKN B;  2BTQ B;  4CH4 A;  4K0K H;  2UUB B;  4WBN A;  2PGG A;  3WB1 A;  4APM A;  4I50 B;  3MAQ A;  1IBM H;  4CH3 A;  3SJA C;  1FJG B;  3K57 A;  2PZS A;  5D1O A;  5D5Q A;  5FNV B;  2UUA B;  3JAK A;  5CB4 A;  5IJ9 A;  4KHP B;  4I7H A;  3JAT A;  4NXM B;  5IJ0 A;  3HKB B;  5EZY B;  1J5E H;  3RYC A;  1BGW A;  2ZIM A;  1HW7 A;  1E4F T;  2F4V H;  3ICX A;  4RAZ A;  2UUC H;  1SQG A;  2YIB D;  2YI9 A;  1XMO H;  4O4I B;  5LYJ B;  2E5L B;  2QJ1 A;  3N43 B;  1JJO A;  4PDB A;  3N41 B;  4ZHQ A;  1HNZ H;  4MTD A;  1GYF A;  4D7T A;  1I7F A;  4UFZ A;  5CA0 A;  2UXC B;  1WPB A;  4DR6 H;  1XK5 A;  2F95 B;  3CSX A;  4KL1 A;  4B3R B;  4F6R A;  3N40 P;  1ZAU A;  1XNQ H;  5LXT B;  4DR2 B;  2UUB H;  1N34 H;  2RGV A;  4DR6 B;  4MV9 A;  3QG5 A;  3K5N A;  1HNW B;  3VNN A;  4DR4 H;  4GKJ H;  2CW8 A;  1M0T A;  1WNS A;  4L8J A;  3UT5 B;  1NT2 B;  5FD5 A;  5FNV A;  4PZ6 A;  3RIZ A;  4YJ3 A;  2Q7H A;  2CAZ C;  4X65 H;  3J80 W;  3N42 B;  4I4T A;  3JSN A;  4U3J B;  3KYH C;  1YEW A;  3TY5 A;  1S68 A;  4GYC B;  5ITZ A;  4O4J A;  2F1M A;  3HKE B;  2BTQ A;  5LOV A;  5BR8 H;  1HNW H;  4JI2 H;  4JI1 H;  4UCU A;  4IHJ A;  1TUB A;  5JJE B;  1H2S B;  4JI8 H;  5LL6 b;  5IWA B;  2PYL A;  3HKB A;  3GDE A;  1XHX A;  4ZIB A;  3JAR A;  4LF8 B;  4OX9 H;  5LYJ A;  2JVD A;  3RTX A;  2R70 A;  5LXT A;  2XIG A;  3KAJ A;  2F93 B;  4DK0 A;  1HNZ B;  3SJB C;  2BTO A;  3CB2 A;  5BR8 B;  2CW7 A;  2PY5 A;  4JI8 B;  2HVQ A;  4BWA A;  4DV4 H;  4GKK H;  2WDT A;  5J2T A;  3BA8 A;  4FM0 A;  3DF7 A;  2V4D A;  4BW9 A;  3M7M X;  4FFB A;  4GKJ B;  3RR5 A;  3NBY B;  3CVZ A;  4O4J B;  4CS2 A;  2VQF H;  3H20 A;  2UU9 H;  2HIV A;  3KAK A;  5C8Y A;  1ZHQ A;  2W57 A;  4YY3 H;  1FJG H;  1XHZ A;  5LOV B;  3N2K A;  2O03 A;  5GON A;  3JAR B;  3SJC C;  4LF8 H;  4LH7 A;  1X4T A;  1SQF A;  3U0Z A;  2FE3 A;  2Q2T A;  2R9A A;  2PTM A;  3HKC A;  4HNA A;  4O2A B;  4O2B A;  4YJ3 B;  2EX3 A;  4FM1 A;  1N33 B;  4I4T B;  4DUY H;  4EFB A;  4DR1 H;  4IAJ A;  1Z2O X;  5LP6 C;  3DSQ A;  5ITZ B;  5J2T B;  4UCS A;  1XMO B;  2IM9 A;  3RYF B;  4JI7 B;  4LNU B;  1KU9 A;  3ETQ A;  4DR1 B;  4R7R A;  1Q3E A;  3PN1 A;  1FFX B;  5J2U A;  2CFM A;  2XHB A;  3J7A K;  4FLU A;  2UUA H;  1XQ8 A;  1M4U A;  3N2G B;  3B2E E;  4NXM H;  4LMY A;  3K59 A;  4FM9 A;  5IWA H;  1VF7 A;  3T1H B;  4TV8 A;  1JFF B;  4FVM A;  3IAY A;  2Q7G A;  4LF6 B;  3E22 A;  1AN7 A;  1M0W A;  4UCO A;  1HNX B;  3J81 W;  2RGR A;  5D1O B;  4NXN H;  3HKC B;  1Q5O A;  4LF7 B;  3RYC B;  1SYX B;  5C8Y B;  1M5I A;  4X1K B;  2JGU A;  4LF5 H;  4RB1 A;  4DR5 B;  2UXB H;  4B3S H;  4DR7 B;  2HEP A;  4BWS C;  4DV7 H;  4X1I A;  3JAL A;  3UQ8 A;  4O2A A;  1N36 H;  1KMI Z;  4JV5 B;  1HNX H;  1Q43 A;  4DR2 H;  2RJZ A;  3HKD B;  1P49 A;  4HNA B;  4DV0 B;  2OYQ A;  4I55 A;  3CHX A;  4O4I A;  2YXL A;  2PYJ A;  5IJ0 B;  3OTO H;  1JFF A;  2ZCE A;  4O2B B;  4X62 B;  5KX5 B;  4PHZ A;  1IBM B;  3VQX A;  2OWO A;  4TOI A;  3N2G A;  4EB6 A;  2YCH A;  4LF4 H;  4LR3 A;  4X64 B;  4YHH H;  4DV3 H;  3K5L A;  3NBZ B;  2R72 A;  4I9Q A;  5IYZ B;  5KHK A;  4FLZ A;  3UT5 A;  1TA8 A;  4FLT A;  2WE6 A;  3VQV A;  1XI1 A;  3VQY A;  3RWR D;  5IJ9 B;  1N32 B;  3K3V A;  2HIX A;  3L4K A;  4X1Y B;  3HKE A;  1B04 A;  2Q7E A;  3JAS B;  1XNR B;  3K5O A;  1O9H A;  4X66 H;  1TUB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...