4UCOA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 98
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucoA02
4JI8B 1IBMB 3JSNA 1CKNA 4X62B 4UCSA 3L2PA 4DV1B 4PZ7A 4DV2B 3QWUA 4DR5B 2HVQA 1N32B 4JYAB 1P8LA 5D1OB 4E6NA 1XNQB 1N33B 5DISC 4EEQA 3BA8A 1FJGB 5D1OA 1HNWB 3BA9A 4OX9B 4K0KB 4UCVA 3OTOB 4DR1B 4JI3B 2ZM6B 4LF7B 3JSLA 1CKOA 4EFEA 5BR8B 1VS0A 1A0IA 1V9PA 4TOIA 4DR2B 4DUYB 4NXNB 2UUAB 4DRFA 3VNNA 2Q2TA 3NBYB 4DV6B 1HNXB 4LF4B 4GKJB 5FPOA 2VQEB 1S68A 4DV5B 1XMOB 4JI5B 4JI4B 2UUCB 1I94B 3TY5A 4JV5B 1IBKB 4UCTA 4LF9B 4JI0B 1ZAUA 2E5LB 3GB8B 4LH7A 4EQ5A 3T1YB 2HIVA 3S24A 4UFZA 3W5OA 2F4VB 4JI7B 4LFCB 2UXDB 3NBZB 4PZ6A 3W1BA 4GKKB 4UCUA 4X65B 2VQFB 4DUZB 5LMNB 1TAEA 3RTXA 3W1GA 4CC5A 4GLXA 4DR7B 1XMQB 2CFMA 1B04A 3PN1A 1N34B 1FVIA 4UCOA 4DR3B 4DV4B 2UXBB 4NXMB 3UQ8A 1CKMA 4LF5B 4DV7B 4JI6B 1TA8A 2UXCB 3TY8A 4DV0B 4DV3B 3NC0B 2HVSA 2HHHB 1IBLB 4AQYB 4LF8B 4DR4B 4LFBB 1X9NA 4B3MB 4LF6B 4DR6B 4PZ8A 5LMUB 4EFBA 3BABA 3GDEA 2OWOA 3SGIA 5IWAB 4B3TB 1HR0B 2Q2UA 4JI1B 2UU9B 2UUBB 1HNZB 3RR5A 3BAAA 4LFAB 1XDNA 4CC6A 4B3RB 1J5EB 1XNRB 4X64B 5FPRA 3KYHC 4YY3B 5D1PA 2HIXA 2VUGA 1XK5A 4UCRA 2HVRA 1DGSA 4X66B 4B3SB 1P16A 3TY9A 3T1HB 1N36B 1CKNB 4KHPB 4YHHB 3GJXB 4JI2B 4LH6A
chains in the Genus database with same CATH superfamily
1P49A 3OHAA 4ED0A 2WLMA 5DMXA 5KX5B 5IJ9B 1I7NA 1HR0O 4HN2A 3K3VA 2C22A 3ZCCA 4WFHA 2UU9O 3C3SA 4E4EA 3KREA 2R8KA 4A3EG 1N48A 3UT5A 2ZXWC 1VQ4V 5EOYA 5BMVB 2W6ZA 2GBOA 5B1BB 1N33B 4NKGB 3CD6V 5KFXA 1P84F 5IYDG 2HHHH 4LF4H 1HNWB 2HHFA 4HBNA 2BSKB 5EYPA 1Y67A 4WFGA 3A0HZ 1WH2A 2DWDC 4K8XA 1Y1WG 4XDJA 3OAAG 5LOVA 4L1KA 2YEVB 1K1SA 2B5UA 1V51A 5DQGA 3UKMA 3SYQA 4FMTA 2ODMA 4FE2A 4FIPC 4IWXA 4YJ3A 2JEGA 2A79B 3GTJA 1K97A 2O03A 1N32O 1I50A 2KSDA 5KA5A 4MTXA 4BR6A 2N74A 4X64H 1R6TA 1M93A 4J9RA 2VQEB 2E76B 1MSDA 3G67A 1ZHQA 3TY5A 3H1LH 1IBLH 3OEHG 4LF8H 2MK3A 1ET0A 3HR0A 1SERA 5D8DA 1TWFA 3O65A 5BXZA 3ZJZA 4FS1A 3SE7A 3VBBA 4XYLB 3M99B 3STLC 1A9XA 5KG6A 4FLTA 1XMQB 3DXRA 3K5NA 2CQYA 2NN4A 3L74H 4DV2H 2V4DA 1TWGA 3PW2A 3O9OA 1KKDA 3WWIA 2XC9A 4ABMA 1TA8A 4RB1A 1I94O 4DR4B 1WCMG 2EIKC 4FLWA 1P4RA 1SQBH 2W6OA 5LHGA 1ZETA 2NU6B 4X20A 2DPJA 2XIGA 2VQFO 5DLGA 2DYRB 2ZE6A 2PN1A 3HKDB 2R7ZG 4M9UA 1H8HG 4PDLA 3W7UA 3K08A 3APQA 2LQTA 4DUYH 3Q4HB 1XNRB 3CVZA 3ZHSA 1YI2V 1Q43A 4JF3A 4FFOA 2YUAA 3RYCA 2WAQA 2VWKA 2ZCEA 4U3FH 5BWUA 1SCUB 2IJJA 4LF6O 4JI5H 1G8MA 4B3SB 2FLNA 3LDEA 4K6NA 1W96A 1VQ7V 5IP7G 4YJ2A 1YJ9V 1T94A 1SETA 3JAWB 1IBMB 4GKKH 4IIJB 4WHXA 3IFXA 3T9CA 5C1PA 4FFBB 4A3FG 4DUZH 3AG4B 4P9PA 3ZEDA 5BZBA 2COJA 4EBEA 4LFAO 2X6AA 5J2UF 1VBGA 1N56A 4DR7H 1NT2B 1I5XA 2LP7A 2QWNB 4RUCA 1AI4A 2HVQA 3TGUH 4RNMA 4EYHB 3CP1A 2X5RA 5KUKA 2WLIB 4O4LF 5FD6A 5H9CA 4ZI7A 4CKBA 1B6RA 5CA1A 3P3PA 3OW2U 1KJ9A 4X1IB 2Q68A 3RW0A 4JI8O 5LMUH 4I50A 4JI0H 4TUYA 2JA5A 2ZDHA 4J80A 5C1OA 1L0LH 3HOYG 3L70H 2ZDIA 2Z04A 2F95B 2DQ3A 2X7RB 4MVQA 4CS3A 4DV1O 5F9LA 1S0OA 3DAAA 5EC2C 2E2IA 4I0XA 5IT9W 4DR5O 3PFFA 1TGOA 3B40A 1N34H 1FFXA 2Z0AA 2HFEC 3CCJV 5KS8A 2CAZC 5H6RA 5FPOA 4A2AA 2GTSA 4K0KO 4AYBE 1EM1A 4UCTA 4I7ZB 2JGUA 3SJQC 1RM1B 4MVSA 2J6UA 3OMAB 4JI7B 2QF7A 1OCCB 2XD4A 3W1BA 1PP9H 1FXKB 1WN7A 4CC5A 5ITZB 3G6VA 2UVRA 3Q1KA 2HVKC 4DV4B 4NTXA 4MAMA 1WPBA 2X0LA 5KFFA 3PO2G 1F4MA 4C5CA 1IXBA 3N2GA 4DV3B 3NC0B 3S3XA 1D5NA 4ECTA 2GPWA 3I55V 4A2BA 2EILC 4J11A 5IYZA 3PZPA 4L8JA 1GRJA 2UXDO 3FD9A 4EFBA 1RK6A 2V9WA 5BY1A 4WBNF 1TVKA 4O7LA 3LP8A 4U7OA 5IWAB 4QWBA 3RYIA 4EBDA 3HT5A 3SYCA 1Q5OA 5I5UA 2DLNA 4O4IF 1J95A 4M7EA 5KHJA 5KFJA 1A48A 4JI6O 1QQCA 2UXCO 1GM8A 4J7KA 2KQXA 2HJDA 3U0ZA 1B6SA 3M9NB 5KMGB 1RSOA 3T1HO 1UPGA 2RDCA 4HAMA 3T4DA 2R93G 3RT3C 3CCSV 3HKCB 3KHHA 3R23A 3CPWU 1UNNC 1OHHG 2EINC 3H0GA 5JVDF 5JCOC 3CEBA 4F6RA 3JAKB 4BWSC 1Q6IA 3ZRWB 3LWBA 1KJQA 4JYAB 2BTOA 1SZXA 4EEQA 2RCVA 4DV0H 4EGJA 3SPGA 1FJGB 3E8HA 4FVMA 3CWBH 2UVWA 1VAJA 3G6XA 5A9GA 1OCRC 3ZRXA 2P4KA 3T2MA 3RYHB 4JI2O 1K83A 1YXBA 3CSXA 5KA6A 2ZM6B 2JEIA 4LF7B 4R6ZA 5CMUA 1PD3A 3H4DA 5CR5A 5KLVH 1L0NH 3BCCH 4O4JA 3A2FA 2HGXA 1KBLA 4CMDA 3B09A 2R9IA 4PA9A 4DR2B 2UUBH 4X89A 1I3QA 5BWVA 4H13B 1H38A 3BQ1A 5HV6A 4BXXG 4DV6B 4EEYA 4PJ0Z 4CS2A 3TCUA 1F23A 4DV5B 1XMOB 4ZKIA 2Q0AA 3OUZA 1K8AW 4JTCB 2Y4RA 3GB8B 4LF6H 1GTOA 2DWCA 3S24A 4R8UB 1AROP 4NYKA 4C5AA 3K5MA 4PZ6A 1N0JA 4J9QA 4C5BA 3H4BA 4RO2A 1NTMH 4O2AF 2B1IA 2CW8A 4O7VA 5C8YB 2YI8A 2FPPB 2RQ6A 3PN1A 5CN0A 1CPYA 2AZ2A 3K3PA 4HNTA 1SQQH 5L1LA 4LF5B 1COWG 1NH2B 2CGNA 1SKVA 5KFVA 3N41B 1VQ6V 3ABMC 3LULA 4JI4O 3ZMZA 3TETA 4O3RA 1KB9F 2CW7A 5FNVF 4Z1VA 4A3KG 1XQ8A 4B3MB 4LF9O 3CHXA 1KKCA 2H94A 3KG2A 5LA6A 4OPHA 4PZ8A 3KALA 3F5WC 4ZIBA 3RGBA 1US6A 2ZE7A 4TQFA 3SYAA 1YEWA 1G2WA 3VQYA 1R3KC 2CDYA 2DN9A 4G27B 4DRXA 1G4YB 4WFAV 1Z2NX 3T99A 1IYDA 3GIKA 4JI8H 5BR8H 2YICA 3B77A 4IRDA 3U11A 3QNEA 5B5EZ 5CE8A 2AGPA 3NGDA 4DV1H 3GVMA 5KG5A 2B63A 3AG3C 3DTUB 4FM2A 4O86A 4AYBA 3Q8SB 2HG8A 1MG1A 3Q8QB 3T5JA 2YC0A 3UM7A 5CAEB 3ABLC 2DABA 3IN5A 1H8EG 2FPIB 5BWXA 5KG0A 2JIZG 3RBZA 1TWCA 4K0KH 1OCZC 1CKNB 4O4LB 2ASDA 2K9PA 4J9YB 4FJCC 4JAUA 5FL7G 1GM9A 3AG1B 3ETJA 2QKAA 3L2PA 1EBOA 2DOSA 1AR4A 4ME6A 4PA6A 5K1XA 1DAAA 5D1OB 1H2NA 1E4EA 1JPXA 3LMLA 2AHYA 2WLNA 4UUJC 4YAJB 1N36O 1SQVH 4JGSA 3J81W 4PDBA 5J2UA 1NR7A 3THOA 1RPRA 2YRWA 4R7RA 1XDCA 3OM3B 1ZWIC 1H2GA 1C3OA 1TUEB 2ZNJA 2UUAO 3HOVG 3RB0A 4MSWC 1HNZH 4J9ZB 3RYFA 2Z02A 2UXNA 2J9GA 2VPQA 3AK3A 4GLWA 3VNNA 3RFCA 2EULA 3CRAA 5LBQA 5LOVF 3PW5A 2R8JA 3E22B 2Z5UA 3ZX6A 4LF4B 2UXCH 4JASA 1I1MA 5LHHA 4YJ3F 2J6SA 1KJIA 4Q8FA 1V55B 3T1HH 3AK2A 3OMNB 5BWRA 5KG2A 3C90A 4YP3A 3BVOA 4IHJA 5KFAA 5I5WA 4EKWA 3CX5F 2CFMA 5DGHA 4TV8A 1XI1A 2ZE8A 2ZDQA 5BWTA 2VRZA 4NXMB 2Y4UA 1NQTA 3MFIA 2KKWA 2Y0IA 3BFRA 3OEEG 3R66A 1IBLB 4LF8B 1DTOA 4RQEA 1X9NA 1Q3EA 3LSUA 4TQRA 1IOVA 3AG7A 2V4RA 3RB6A 3ABTA 3GDEA 4QE7A 5L9XA 4HNUA 3GV7B 1W0JG 4DR3O 2UXBO 1KP2A 1O9HA 1NJIW 3D8CA 4DV7O 5JVDB 3PW7A 5FPRA 3KYHC 4XYMB 4ZOLA 2ASJA 4A3BG 1LNQA 5CA0B 2ATLA 1JVMA 5KHIA 4FLVA 4GKJH 3LDDA 2ZNIA 1E4GT 3E83A 3CRQA 4QPKA 1F7YA 3RBDA 3JALB 2V58A 1BXRA 3JD1A 4JYBA 3B4SA 5LXTA 3R65A 1BQ0A 3FKIG 2PTMA 3E5NA 4LC1A 1S97A 3KCYA 3UO3A 5GTIZ 1JFFA 2YIAA 1OCOC 2ZT9B 3I5DA 4X64O 4YJ2F 4O7SA 2Q7GA 5I60A 4CHIA 2C2DA 3ZHQA 1Y74B 1TUBB 2OLSA 2FK2A 4R50A 5JH7B 4DL7A 1CQIB 1Y1VG 1K7DA 2C28A 3OTOB 3GTKA 3WB0A 1A3GA 4O82A 1I1KA 3EPGA 4BY1G 3UO2A 4J10A 1VMGA 1WA8A 5KFNA 2P4VA 5FLXN 4ZI7F 1NVPB 5JCOA 3FFQA 4DV2O 2DPIA 5CA1F 4OPAA 2R7MA 4JI1H 1VQ5V 5KFOA 4O2AB 1K4DC 1XOUA 3D36C 3A8TA 4PBCA 1XNQO 4I50F 4TUYF 4MV8A 4FK5C 3EFFK 5JWPA 3W7TA 1VEWA 1AJQA 1ZTEA 2ABJA 4GC7A 3I4NG 1A0GA 4X66H 2AHZA 4JI0B 2AGQA 4QNHB 3HB9A 1Z2PX 4ED2A 1PNKA 4YR0A 5KHKA 3CMEV 3K0DA 3CCRV 2Q7EA 3ETQA 2W71A 4Q45A 3V6JA 4X65B 2W7PA 1KC8W 2SCUB 4X62H 4DUYO 4JPRA 5AG2A 3KAJA 1N34B 1LUWA 3AG4C 1KECA 2EIYA 2M7WA 4BW5A 3UQ8A 3HB3B 2HDKA 2YXLA 3ZHRA 4JI5O 1I2LA 2CH7A 1B6QA 5EIBD 4LFBB 1HWYA 3FYEB 4ED7A 2YI9A 3T1YO 4DIMA 5JQWA 3FAVB 2ZE5A 3HKEA 1QVFU 4GKKO 2F93B 4DR1H 2WSSG 3WFVA 4NVPA 4DUZO 1Q82W 4DR7O 1HR0B 3ASNB 3QQMA 1H2SB 3GIPA 5IYZF 3WWJA 3N2KB 3DC5A 4J7ZA 4U3JA 2UU9B 5IDJA 3RR5A 2YCHA 3ABUA 2XCAA 3HOWG 4CC6A 2UUAH 5KFTA 3E8GA 1GYFA 2PF4E 2C2EA 4RNOA 1HNXH 2BQRA 1WPXA 2FL4A 5L3CA 2HIXA 1AP5A 2BR0A 4NR1A 2J6TA 3TJTA 1KJJA 5LMUO 3TY9A 1Z5VA 5IYCO 2WLLA 5A2QW 2QA4V 4N21A 4O7RA 3RV3A 2PUSA 1EKFA 1RM1C 2FMAA 3UT5B 1OCCC 1V54B 1DV1A 4RUFA 1IYEA 2VOBA 3KHLA 1WAZA 5KFPA 1DIKA 1FXKC 3OHBA 2XAGA 2XAFA 3JAMN 1G6UA 1N32B 2P06A 4YY3O 3CCEV 4P9OA 4HYKA 1MZEA 1BL8A 5DISC 2IW5A 5EYPB 3MWMA 2DWEC 5KHHA 2QTOA 5LOVB 3GIMA 1GSHA 4PDRA 3Q8RB 2W9AA 5EBWC 4ED1A 2CK3G 3JATA 2XAJA 2B9ZA 1CKOA 1WNSA 1JKJB 3CYOA 1PK8A 2E74B 3ASOB 2XHBA 4FFKA 2DE0X 2P7TC 4DR3H 2UXBH 2GSMB 1GH6A 4FFLA 4DV7H 4BW9A 1KC7A 3UZBA 1KP3A 2Y69C 2L6LA 1Q6HA 4O4JF 1I94B 3RVYA 3OFNG 2P22C 3K9AA 1I08A 2Q0OC 2XCLA 1AJNA 1K4CC 5JVLA 2F4VB 2W9BA 2W0XA 3G80A 3N8DA 3RVZA 4UVBA 2VQFB 1E1QG 3W1GA 1GN2A 1DK1A 4FZ1A 5BPFA 2Y0SE 4DK1A 4QWEA 5B1NA 3JCZA 3W7XA 1PV0A 3M4IA 1WP8A 2BOCC 2JS3A 2LGWA 1BZKA 4IYHA 2FYUH 2Y48A 3J80N 3WO0A 3E8FA 1G1XB 4EYIB 2GUZB 4AILC 5EIBC 5LHIA 4X20B 3T54A 4LF6B 4B08A 1W93A 3BJYA 4MV7A 3RB3A 3OSPA 1AB3A 2FK3A 3HKBA 4LP8A 1SEIA 4A3JG 2N05A 2NVXA 2Q2UA 1JX4A 5IJ9A 1GM7A 4B3RO 5LA6F 1NBMG 3RYCB 4LFAB 4IR9A 5KKNB 1THZA 3Q2OA 4DV0O 2DYSB 4D6TH 2R8HA 4LR3A 4IRCA 1XNQH 4YJ2B 4DR6O 2CTPA 3RGXA 2ZIOA 4UB6Z 3RIZA 3GIDA 3CJHA 1UJWB 1YJWV 1YJNV 4JI8B 1P7GA 1XL4A 3P3NA 4DL3A 2W6IG 2BTQB 5T14A 5LMNH 4C7UA 5JQGA 2UUBO 2LGQA 4RZRA 1EKVA 4DV1B 2PZSA 2LFRA 1AN7A 3ETDA 4DR5B 2PBZA 4TVIA 1HW7A 4ECZA 4ZI7B 4E6NA 4O2BB 2VWJA 5CA1B 4FLUA 2Q69A 4A5UB 3LQSA 4MTDA 4AQYH 4TUYB 3OGIB 1CS0A 4GX2A 2NU9B 1B06A 1WRVA 4K0KB 3I4MG 2IJKA 5EBMC 3G4SV 5EZYF 1M9NA 5KFSA 3T1YH 1XEQA 5KFWA 4I0XB 5C5JA 1W2BU 4JAVA 3FKSG 4EBCA 2JEXA 4MW8A 1V9PA 5KFZA 1GK9A 3ZHTA 4NXNB 4J9PA 2LO1A 4E2LA 1IX9A 2OH2A 5C44G 4GZRB 4J9SA 4O3SA 1RP3B 2FJZA 5HFMA 4ECRA 4QW9A 3BACA 2JGDA 2ZQMA 1M5IA 3L75H 3CSWA 2OCCB 3T5KA 2EBOA 2PGGA 4Z1MG 3JASA 2PVPA 4DYLA 4MA0A 4IWYA 1ROPA 5LP6C 2UXDB 1BGWA 4YXWG 5BR8O 4O7TA 1L1FA 3DTGA 1EUCB 5IY5B 2V7QG 3AG1C 5H80A 3N2GB 2AW9A 5EC1C 1F51A 1KUTA 4U7NA 3G8CA 3D36A 1YTFD 2R92A 3CC2V 3NUAA 4JI6B 1SS3A 1PL0A 5IYZB 4O3NA 2UXCB 1GKFA 4IHJF 3TY8A 3HOZG 2YIBD 4YY3H 5JJEB 3E89A 2IH3C 3QO8A 2YU9A 4JZ2A 3SPJA 4TV8F 1TVKB 2ZDGA 2P0AA 2Q8VA 3RYIB 2NU8B 3VPDA 5LYJA 2YSUB 4JTDB 2W0FC 4I5SA 1YIJV 3HXLA 3CEIA 4YR2A 2X0SA 3N40P 2BE3A 5IYBO 4IIJA 5KT7A 1NVPD 2FKXA 1XDNA 2WA4A 3SYOA 3E2EA 1RSOB 3CCLV 2RDJA 1PL4A 4B3SO 5I47A 4JAAA 2WAMA 2YS6A 5DQIA 3EHBB 3T1CA 2WA3A 3MFHA 3ETGA 2Q6AA 4H0LB 4O4HA 4FFRA 3FB7C 4YHHB 5IT9N 4JI2B 2Y0SA 3ZMSA 3GV5B 5JJJB 1BQZA 3JRWA 1KT8A 1M56C 1V55C 4ZOLF 5EDWA 2FB9A 3OUFA 4F6RB 2PY5A 3DSQA 5B3SC 2R9AA 1HNZO 1EZ1A 2KG7A 4ZHQA 4X1YA 4RNNA 3GV8B 4D7SA 4ECVA 3JD0A 5LXTF 4OGQB 4JV0A 1QNMA 1XHXA 2WWWA 5DM6V 3BQ2A 1KU9A 1SA0A 3JYCA 3OUSA 3UZOA 3BA9A 1DF4A 5IJ0A 3K0GA 3T9BA 4BIZA 1ZX3A 2ITCC 4I55A 3K5OA 5H6QA 3JD4A 1Q7YW 2GDSA 2NU7B 2WLHA 1VS0A 4A3MG 2P90A 2ARHA 5H2FZ 5JJNB 4RAYA 3SJAC 1XL6A 4DRFA 2OTLV 3ICXA 3KAKA 4B3RH 5KFDA 2YDEA 2HGSA 2KB1A 2R72A 3GB7C 2UVVA 2QKCA 3MDSA 1BMFG 4KXRA 4PV1B 4JI4B 3GTGA 4ED3A 1B33N 2QWRB 3GWKC 4LF9B 4DR6H 4FBTA 2JS5A 3ORQA 4KP4A 3F8NA 2DIKA 3N27A 5K1PA 1A32A 2OIGA 1M57B 4DV4O 2IJIA 2W9CA 2RJZA 1S0NA 3G8DA 4MS2A 1YVWA 3QTCA 1RYRA 4RUAA 4DV3O 1N0NA 3CC7V 5GONA 4WCEV 4GKJO 4MV9A 3EXAA 5LA6B 4JYCA 2E2HA 5L1IA 5E79Z 3TIGA 2E5LO 2RGRA 2D2CB 4DRXB 2QWQB 2VPSA 1I5YA 5KMGA 5B1AC 5KFQA 1EZVH 4G2KA 4NLGA 3K04A 1O9GA 1IXMA 2FPGB 1AI7A 3QZ8A 1JJOA 4B3TB 3OSNA 4UUGA 4MT8A 2HR3A 1YSCA 3AK1A 5L1KA 2JA5G 5EWGA 4IZOA 3M8AA 3ZRSA 3SPIA 3MWEA 5DG9A 4AHCA 4DW0A 1AUXA 1UC9A 4Z2WA 5DLFA 5D1PA 4CH6A 2KSWA 2VQEH 2NR5A 4BBSG 4N23A 5KUMA 5CA3A 5J2TA 4F6EA 1N36B 2QM4A 1M0WA 2N04A 1YZBA 1R6KA 5BPHA 1I1LA 4KL1A 4WFEA 5JUMA 1FXHA 3ORRA 2HG5C 3RFRA 2AGOA 1EZJA 1EN5A 4JI1O 4I4TF 3H1JH 3KHRA 2Y4TA 2F66C 3EPIA 4Q44A 1TWHA 3L4JA 2QM8A 3LSQA 4UV8A 5J2UB 2MCTA 2VUMA 2LW7A 3DC6A 4X66O 3PO3G 3V4ZA 4MVOA 1IURA 4DR4H 1XHZA 2D3OW 4J42A 4FM1A 4KHPO 3VQVA 2QWOB 4DW1A 2JA7A 1CXZB 4RAZA 4J9LA 4CBCA 2I87A 2XTAA 4FFMA 1Z2OX 2HJWA 3BPZA 1ZLZA 3GIJA 4FZ0A 3RYFB 1CE8A 4X62O 2ZGIA 4YIPA 4Y8VB 1S72V 4QWCA 4TOIA 1CEZA 4BIUA 5C8YA 1WR2A 2X6CA 1JLLB 5DN6G 3NBYB 5EZYA 4G28B 4UVCA 1XNRH 1K3EA 1NS1A 4RZQA 1FKAO 4PA3A 4JV5B 3FB5C 5H5NA 3WWHA 1SZTA 4B3SH 1ZAUA 2JEJA 4JI3O 4DR1O 2HIVA 4EQ5A 1F4NA 5DGIA 4NZNA 3FB8C 2HGWA 5K3WA 3TXQA 2WB1E 3OGCC 1BHBA 3N6XA 3VQWA 4F50A 3MD0A 4HYOA 3RF2A 2ZJTA 4DR3B 2UXBB 1V54C 2ZINA 1HNXO 2IJHA 3AG2B 4DV7B 3H0GG 2JA6A 1X4TA 1I2KA 5GTHZ 4PDVA 2HHHB 1FFTB 4B3MO 4U7CA 1IBKO 5CM0A 1ZL8B 4X8AA 1C30A 4CH4A 2R9RB 4IT5A 4LFCO 5LP6A 3JARA 4MVUA 3L71H 1M90W 3RWRD 3L72H 4QPJA 3GWOA 1W59A 4EB6A 3E8BA 5EWEA 3H3VH 3WNZA 3JCUZ 4ZOLB 3BAAA 4O3PA 1VF5B 4WBNB 2AZ0A 3ASOC 4X64B 3NR7A 3J81N 3CCVV 2EILB 1JX9A 4CZZA 3BHPA 4PI2A 4O4IB 1PNMA 3T4ZA 2HLDG 5L3BA 4XX0B 3PR4A 5KX5F 1OZ0A 5B1BC 3MR2A 3SI8A 1IOWA 5LGNA 3W7SA 3RV4A 1L2ZA 1IDSA 2H8PC 3A0BZ 3WU2Z 1JXLA 2A3QA 4RB0A 1QR9A 2R6FA 1VF7A 4DV2B 2OIEA 1J5EO 1KTAA 1VF6C 4DV4H 3TQTA 5KT4A 4DL6A 4W4LA 1XNQB 5KFMA 2FMLA 2ALZA 4DV3H 2VS0A 1PPJH 5JQGF 1WLEA 4NTWA 4RU9A 2YXHA 1SRYA 1KBHA 1T5EA 1WA8B 2EINB 1EN6A 2Q9LA 2EJ0A 4NYEA 2E5LH 3OT7A 2OTJV 4Q8EA 5J9PC 2W70A 3N42B 5IWAH 4QSHA 3OUUA 2YL2A 1QR8A 1RPOA 4DUYB 5IE9A 2GV9A 2Q2TA 4MVRA 2Q7DA 1S5LZ 4HQ6A 1GSOA 3KZIZ 1KYOF 4UVAA 4RUEA 3K59A 1Y76B 1AR1B 4JV1A 3STZC 4JI5B 1H2LA 2DYSC 2V59A 3U9SA 2R7LA 4I7HA 4BWAA 4LH7A 2B63G 3T1YB 2CNVA 1VQMV 3HO8A 2FKLA 2YYAA 4PHZA 3ZMTA 1OJHA 4GKKB 4FLZA 1VQKV 3CMAV 4DUZB 2GLTA 4GLXA 4DR7B 2MW2B 4XBFA 3GTPA 4NXMO 4J9NA 2BQUA 4MTGA 2DYRC 1YDXA 2JA8G 1CKMA 2CH7B 4GX0A 1MABG 2FB5A 4OXSA 1Y1WA 2UUCO 3PVXA 2GHYA 2OYQA 4YIOA 1S76D 3QG5A 2XAQA 5CA0A 2WPDG 2DQ0A 5HNEA 5DGBA 4CS4A 4QGPA 5LMUB 4YB8B 3SPHA 5BYAA 1P7BA 3BABA 3N43B 5IYDO 3L4KA 2W6PA 4KHPH 5FNVB 4U3JB 4Q4DA 1E4FT 3GIQA 5LMNO 5KFLA 2ZM6H 4LF7H 4FM0A 1S0MA 4IYIA 4GCZA 4QE9A 1SESA 3R5XA 3T7AA 3FDSA 3GTMA 2WYOA 2YZMA 4DQNA 4DR2H 1EFRG 3ZHUA 4YAKB 5LYJF 3R9RA 2VQDA 4E4TA 4YY3B 3RN4A 4DV6H 4AQYO 5CB4A 2YIBA 3MHSC 2WLLB 5F9NA 5KT6A 4DV5H 2HP8A 1XK5A 4LNUB 1KD1W 2EZOA 1XMOH 4F4LA 4IIJF 1R6NA 2I8CA 2QSAA 4HNVA 1N8RW 1FKAH 3GJXB 5KFYA 2WB1A 2BQ3A 3ZBHA 1Q81W 4HNAA 2G38A 4JI3H 1JDBB 4CMFA 4FS2A 2YS7A 4J7JA 4H33A 5CBFA 2EJ7A 3JZFA 2R70A 1Z5WA 4DLKA 3QFFA 1WCMA 3IG0A 4PI0A 4I9QA 4O4HF 1U96A 3ABLB 1MOFA 4PA7A 3CC4V 1Q86W 1BCCH 4D7TA 1OCZB 5KFHA 2QDOA 4K8ZA 4WF9V 4QJFA 2R8GA 4I4TA 4TV9A 1GGOA 2C2RA 4B3MH 2R7ZA 4ZHQF 1IBKH 1JMKC 4A3IG 2EIJB 3OR7C 1Q90D 1VQ9V 3VOTA 4DL4A 4LFCH 1PKXA 3DGEA 3J7AK 5CBHA 3HPLC 5F2VO 4LSXA 3F7VC 2DMXA 3CXHF 1UFIA 3UYYA 2QKSA 4RWUA 4Q43A 2W6MA 4I55F 2JJ1G 3BQ0A 3JD3A 1K73W 2HHFB 1K9MW 1BS3A 4B7EA 2XUMA 3CCMV 3N44B 4FLYA 3GLKA 4FFNA 1NH2D 3KTMA 4OX9O 2FP4B 2W9BB 1AI5A 2V1DA 1RFYA 4RAIA 3F7YC 3OD4A 1BJTA 2OT5A 4ETSA 3MR3A 3NXSA 4A3CG 1DLBA 1EN4A 4YJ3B 1BT8A 3E86A 5KFUA 4MW3A 3HOUG 3WB2A 4R7CA 4K3AA 4PA4A 1FVIA 3WB1A 1H2MA 3TINA 3P32A 4JXUA 4IRKA 4X1KA 4YBZB 1J5EH 5A2QN 3AYHB 1AI6A 4DV0B 2BCCH 3X2QB 4ICGA 3B2EE 5I5XA 2F23A 3T9DA 1FS0G 3T5LA 4DR6B 4J41A 2CUGA 3HKBB 4DK0A 4LWSA 4XDLA 2R85A 2AXTZ 1WSCA 1S3JA 1VQLV 3G6EV 1E79G 2C2AA 4B7KA 1SC5B 5GONF 5D5PA 2GTAA 3DXRB 3CS5A 4R8CA 1SQPH 2EIMB 2QB5A 1KEEA 4K35A 3UFXB 2UUBB 4APMA 1GMGA 1RYSA 2A9HA 2CTQA 3BEHA 1GSAA 2CE4A 4QIWA 3H40A 3OTFA 1VARA 3U0GA 1AUVA 1FPOA 4JYYA 4TQDA 3CJHB 3JD2A 1CQJB 2PI4A 2ZD9A 2A06H 2XOKG 1I7LA 2IA6A 1DGSA 2R87A 1ZQ7A 2ADPA 4UXNA 5KG1A 2V5AA 5JQGB 4TSFG 4X88A 5FR9A 4QWDA 1HDJA 3MHHC 2RNBA 3CQZA 1Y14B 5BYBA 5KX5A 1D5AA 5J2TF 4WFBV 1NTZH 1XUQA 3K5IA 1GAXA 1M57C 2ODTX 2ATKC 2UXXA 2YZNA 3ETEA 5CBGA 1SYXB 3S3WA 1S0VA 1P8LA 4NXMH 3SJCC 5EK0A 2XGPA 4U6PA 5BMVA 2P6JA 2RMKB 2UUCH 1DV2A 3EYYA 3CE2A 4A3GG 2ILMA 2BSKA 1OCOB 3GTLA 5DQHA 2HVJC 4MVMA 5BR8B 3TW7A 1FAFA 2EJRA 3OMIB 2YEVA 1A0IA 4ECWA 2ZIMA 3CCUV 1VF6A 4ZBMA 2JGDB 3G6YA 1N33O 5IYCG 2JVDA 3MR5A 1GN4A 3JASB 3CXCU 4ECQA 2R93A 3VQXA 4F4ZA 1HNWO 3K57A 4I50B 2I80A 2F1MA 1AP6A 5C8YF 2F4VO 1ULZA 2GUZA 2YXYA 1SQXH 1K92A 1ZSPA 3H1IH 2LW1A 1RJQA 2NNUA 1S9FA 5KG4A 2FE3A 3H1KH 1NTKH 5E1AC 2PI5A 5EWFA 1FFXB 1EHIA 2QTSA 3LSSA 3U9TA 3IJ4A 3ABKB 5KFEA 2HKOA 3V6HA 1I7FA 5L1JA 1YITV 2VQEO 3ZS8C 1BNCA 3H20A 1MSWD 5LYJB 3K9SA 2Q4PA 2W6JG 4Q6GA 4FLXA 1QLEB 5FJ8G 2NUAB 3OTOH 3PW0A 2HEPA 2OWOA 1IZ3A 4H44B 1RJRA 3D3QA 4XDKA 4C2MA 2B1GA 1XMQO 4TQSA 1R3LC 1HNZB 5DAAA 4IGGA 1KMIZ 3BG5A 2BTQA 3HKDA 2CTRA 5LP6F 4CH3A 1EKPA 1AR5A 3M7MX 1NZ6A 2ITDC 3Q4HA 2JK5C 4MV1A 4DR4O 4O4HB 1JA8A 4MTFA 4O2BA 5B66Z 3BRCA 5L3DA 3VMMA 3T1HB 4ASUG 3QVNA 4OX9H 1SFOA 1D2DA 2NLJC 5KFBA 2VA3A 1JQ0A 4LH6A 2XCPA 3RGZA 2KG7B 1CP9A 4L87A 1UC8A 2W57A 3GQCA 4ZHQB 4X65H 4X1YB 1NR1A 2YW2A 2WDTA 2M05A 4BAYA 3ZIAG 4JV2A 3JAWA 4I9WA 4MVZA 3QWUA 3SPCA 1FXVA 1XNRO 4FFBA 3HKZE 1SA0B 5IP9G 5KG3A 5IJ0B 2XGQA 4P2ZA 3AG2C 4HZ3A 3BA8A 3M9MB 4I55B 5L3GA 4LFBH 3WG7B 2WLIA 3CB2A 1R3JC 1M1KW 3CCQV 1OBDA 1IBMO 1O75A 3JSLA 4EGQA 2LJ2A 4TM5A 4X1IA 1S03G 4NXNO 1HR0H 1ZHSA 2YZLA 3TEKA 3ETHA 3D3IA 4NB5A 2UU9H 1QCEA 3WO1A 5GW7A 3RUPA 4GKJB 4MV3A 3SNOA 2QE7G 3TK1A 2VR1A 3AEIA 4PD4F 2E5LB 1VQ8V 1BHAA 2QM7A 3GILA 3H9VA 3TXSA 3M9OB 1Q8IA 1PNLA 2W9CB 4O4JB 1QHTA 4MV6A 2CKZB 4O3OA 3I56V 1X59A 2ZXWB 3EVKA 3T9AA 5KT2A 5GONB 2AQ4A 3GTQA 3RB4A 2ASLA 1WB7A 1FXKA 1JIHA 3BY6A 1URFA 5ITZA 2Y69B 1HP8A 1N32H 4MTOA 5B1OA 4O7NA 3QZ7A 1H2KA 2ETNA 4J0MA 2IH1C 4JI7O 4MA5A 3OE7G 3VA7A 1FD9A 5HBRB 2R7KA 3MWDA 1MZBA 3U55A 3SGIA 2CNQA 5EBLC 1I6UA 4JI1B 5TISZ 3DTFA 5CA0F 4XZ3B 2W6NA 4LSAA 3UCSC 4ED8A 2R82A 3V4SA 5BWWA 1U97A 5J2TB 1JJ2U 2JEFA 1N33H 1MMMA 2GQSA 2VUGA 4O84A 3MR6A 3SR2C 4UCRA 4X66B 3F5TA 1I94H 3ZRVA 4YHHO 3QF7A 3CRRA 2R7NA 5LGUA 4QW8A 4NZOA 1HNWH 4KHPB 2QYZA 1QVGU 4DL2A 3IC9A 4P30A 2F4VH 1M0TA 5IWAO 2R8IA 2NVYA 2BOBC 5CB4F 3JSNA 1M4UA 5LGTA 4RB3C 2VQFH 1MA1A 4X62B 1YCIA 4RQFA 4FGRA 1M6VA 3HKCA 4PZ7A 1ZUQA 5JH7F 4CE5A 1VP7A 2ZR2A 4ED6A 4Q0YA 1OBGA 2EIKB 3JAKA 3G71V 3ZRWA 1IVSA 3H1HH 3PW4A 1Y6XA 2PMZE 4NZMA 5KT5A 3AX6A 1QBZA 2R92G 2YZGA 3DF7A 3P30A 4RB2C 4YR3A 3IC7A 5IYBG 4O3QA 4JI3B 4DR1B 3CRCA 1SQGA 3JRXA 3RYHA 1K34A 3GTOA 4TT3G 5EZYB 4TV9F 2CTWA 2VA2A 1XMQH 2IBZH 2XNDG 1E4EB 4LFAH 2UUAB 2AGAA 4JYAO 2WLKA 2QR4A 1HNXB 1NI8A 1S68A 2DJVA 1FJGO 3TQ1A 4DO2A 2XT9A 2IM9A 3FKIA 3K5LA 4Q20A 1IBKB 2Q73A 2YS8A 3RAXA 2FK1A 2QGNA 1R3IC 5FD5A 2ZM6O 3KCXA 4LF7O 4LFCB 4IL6Z 4UCUA 2DZDA 3JZIA 3MAQA 5KFIA 4R8UA 3RTXA 1JOYA 1YF2A 2A0LA 3HKZA 4DR2O 1SF9A 3CRMA 3LNMB 1B04A 2HJFC 2FTKA 4O81A 4DV6O 1Y1VA 3ASNC 4DR5H 4ECXA 2PYJA 1KUQA 2K1EA 4DV5O 1XMOO 1S10A 5LP6B 4FPPA 3JARB 3LDCA 4F4WA 4IHJB 4EG0A 4GX5A 2RF4A 1BSMA 2RDIA 4B3TO 4EB6B 1XREA 5D5QA 3QO5A 2A7WA 3SYPA 1R73A 2EIJC 2O57A 4NTYA 3APOA 4TV8B 2CZGA 3KXYT 1IBMH 2Q67A 2L35A 4H37A 3ZN1A 5KAFZ 1EUDB 2IBKA 4NXNH 2P5OA 1VIBA 4LF5O 3K5HA 4LBEC 1J5EB 1S77D 4O7YA 5KFKA 5C3EG 3K79A 3PJSK 3ZMVA 2W8KA 2COIA 4IR1A 1MNGA 1OV9A 2M6YA 4GC6A 3T9EA 1VQOV 3RAQA 1VKZA 5I5YA 4AI8A 3C3TA 1P16A 4WFFA 2QWPB 3GIIA 4QIWF 2RGVA 2UXDH 4UV9A 1PX2A 4IAJA 5LL6b 1CKNA 4O4LA 4UCSA 5C93A 2W7OA 4LMYA 2C00A 1WJZA 1T36A 1XILA 4JI6H 5L3FA 1EYZA 1R1BA 3VOUA 3I12A 3VPBA 4DXWA 4JTAB 3W7WA 5D1OA 5DG8A 3OR6C 2IP4A 1M56B 3X2QC 3K03A 5LXTB 2YIDA 1BE3H 4UCVA 2R84A 4BY7G 2JEUA 1Y66A 5B3SB 2DAAA 1JFFB 4JI7H 4G3IA 2GQRA 3U10A 3TW6A 4FM9A 2RN9A 5BMVF 1BGYH 2XASA 1DF5A 4W4KA 1VQPV 4JUZA 2FLLA 4GT1A 2EIMC 1K33A 4GYCB 4X9QA 2CGOA 2GPSA 4UB8Z 4BBRG 3Q8PB 3HBLA 2A1HA 4JV5O 2UUCB 2CNUA 4Q4CA 3E22A 4PELA 3V6KA 1ZL8A 3H01A 4UFZA 4YHHH 3KKYA 4JI2H 2R86A 1V4YA 1R9TA 5LMNB 1TAEA 3FX7A 4CKCA 3JZ6A 2EZPA 4DL5A 3HOXG 1NU1H 4CH5A 4JZGA 3B8NA 5LL6Y 2PYLA 3T5HA 5L3EA 1E1RG 1Z2GA 4J9MA 2HHHO 3ZMUA 2PMZA 4O7WA 4LF4O 5FLXW 1N4CA 1GN6A 2IU0A 4WBNA 1FYJA 2HVSA 1PM9A 3FYIB 1RK5A 3K58A 3B8MA 4FFPA 1AVMA 4AQYB 1OCRB 3SJBC 4PWQA 4QIWE 1Q6UA 4O4IA 1AILA 5KFRA 2DW4A 2E3CA 4WD3A 4MV4A 2VUMG 4KUMA 4O83A 5DGAA 3R5FA 2ZKOA 3MJFA 1YHQV 1S5HC 4QWAA 1YTFB 2JA7G 1I0HA 2EX3A 2V4QA 5KT3A 2WLJA 1LR1A 5CB4B 4YQWA 4HR7A 1XBLA 4TWKA 4JYAH 1ORQC 1IBLO 4LF8O 3E35A 3FB6C 5B1AB 5JVDA 3HKEB 2YWVA 4ECUA 4JI4H 4J9KA 4A3DG 4BIOA 1FJGH 4HNAB 4GUNA 1QLNA 4A93G 3K06A 2P67A 3LNNA 3N6RA 4LF9H 3J7AU 1MZFA 3TIIA 4CKEA 2EJ2A 1K1QA 3JALA 2ZDIC 1ENVA 5DEDA 4O2BF 3FMAA 5K2MA 1SQFA 2ADQB 5I5SA 3ABMB 1Y4MA 4KFMA 4QJFB 4I4TB 3LUTB 3ABKC 4TV9B 2JJ2G 3C0FB 1Y76A 4OX9B 2XAHA 5I5VA 4ECYA 2JA6G 5HFLA 5KFCA 1Y74A 1TUBA 3L9DA 2IMWP 5JH7A 3R5HA 2OCCC 1QLEC 2Z3YA 3U54A 1VBHA 4EFEA 4O7ZA 4B3TH 5I5TA 1WP7A 3IAYA 1GO3F 1VQNV 2F43G 2QEXV 1QU7A 3G6BA 1OWTA 3AG3B 5DECA 3KHGA 2Q5ZA 1KQSU 5IY5C 4J9OA 2Q7HA 4LF5H 3AW8A 4O2AA 4ZQIA 1RJPA 4F4XA 1T3NA 2YRXA 2WAQE 3JAMW 3OTOO 2FLPA 2OCHA 3JATB 1W0KG 1N36H 5DG7A 1JR9A 3W5OA 1K5QA 3NBZB 2X6BA 1GN3A 1M7JA 3ML0A 2WE6A 3PR5B 5FNVA 4X1KB 3IGAC 3RJ0A 1B3QA 4UCOA 2IU3A 1GLVA 1K5SA 2E75B 4GX1A 2W6QA 4LWSB 2COGA 3VPCA 5KG7A 5E25A 2W8LA 4MTEA 2EJ3A 4JI0O 5KHGA 5KFGA 5KAIZ 2JDIG 4LNUA 4RCNA 3T9FA 3K3WA 2H3OA 3WG7C 4ECSA 1NKDA 3A0RA 4X65O 2AU0A 5FLMG 3L73H 3FAVA 4A3LG 2QK4A 3QO7A 2C35B 1N34O 2LFSA 4FU0A 1WB8A 1TWAA 4DAAA 1LUVA 3ZN0A 1KJ8A 1L8DA 2QJ1A 4LCUC 4F4YA 3ZHVA 4B3RB 2UVUA 4PDMA 3N2KA 4FBUA 1S5JA 1AJPA 4LFBO 3RBEA 1JCHA 4JV5H 5C4XG 3SDLA 4M0JA 2JRIA 2ZR3A 2Y0PA 3J80W 2WTFA 2HVRA 1GO3E 1JDEA
chains in the Genus database with same CATH topology
1P49A 5LXTA 3RGZA 4KL1A 5KX5B 5IJ9B 3K3VA 2W57A 2PTMA 4ZHQB 4X65H 4X1YB 3RFRA 2WDTA 1JFFA 2YIAA 3JAWA 2F66C 3QWUA 3UT5A 4FFBA 1SA0B 3L4JA 5EOYA 2Q7GA 5BMVB 1N33B 5IJ0B 2MCTA 5J2UB 2HHHH 1TUBB 3BA8A 4LF4H 4I55B 5JH7B 1HNWB 4HBNA 4DR4H 4LFBH 1XHZA 5EYPA 4FM1A 3VQVA 3CB2A 3OTOB 1WH2A 4RAZA 4K8XA 3WB0A 5LOVA 1O75A 1Z2OX 3BPZA 3JSLA 3RYFB 4X1IA 1S03G 5JCOA 3FFQA 1ZHSA 1HR0H 4YJ3A 4TOIA 4JI1H 2UU9H 5C8YA 2O03A 4O2AB 3NBYB 5EZYA 1XNRH 4X64H 1M93A 4GKJB 2VQEB 4RZQA 1ZHQA 3TY5A 4JV5B 1IBLH 4LF8H 4X66H 4B3SH 4JI0B 1ZAUA 2E5LB 1Z2PX 4EQ5A 2HIVA 5KHKA 2Q7EA 1Q8IA 3ETQA 4O4JB 1QHTA 4X65B 3N6XA 3VQWA 4FLTA 3RF2A 1XMQB 4X62H 2ZJTA 3K5NA 5GONB 3KAJA 1N34B 4DR3B 2UXBB 4DV2H 2V4DA 5ITZA 2ZINA 3UQ8A 4DV7B 1N32H 1X4TA 1TA8A 4RB1A 2YXLA 2HHHB 5EIBD 4DR4B 4LFBB 2YI9A 4CH4A 4FLWA 4J0MA 3HKEA 5LP6A 2F93B 4X20A 3JARA 2XIGA 4DR1H 1MZBA 4NVPA 3SGIA 3RWRD 3HKDB 1HR0B 1I6UA 1H2SB 4EB6A 4JI1B 3N2KB 4U3JA 2UU9B 3RR5A 4ZOLB 3BAAA 2YCHA 4WBNB 4LSAA 4DUYH 4CC6A 2UUAH 1XNRB 4X64B 3CVZA 1Q43A 1GYFA 1HNXH 3BHPA 3RYCA 2VWKA 4PI2A 2ZCEA 5J2TB 4O4IB 2HIXA 1N33H 2VUGA 3SR2C 4UCRA 4JI5H 4X66B 4B3SB 1I94H 3QF7A 3TY9A 1Z5VA 1HNWH 5A2QW 4KHPB 4YJ2A 2PUSA 1L2ZA 2F4VH 1M0TA 3JAWB 1IBMB 4GKKH 4IIJB 3JSNA 1M4UA 4RB3C 3UT5B 2VQFH 4FFBB 4DUZH 4X62B 3ZEDA 2VOBA 4RB0A 4DR7H 3HKCA 1NT2B 1VF7A 4PZ7A 4DV2B 4DV4H 2HVQA 1G6UA 1N32B 1XNQB 4Q0YA 3JAKA 5DISC 5EYPB 4DV3H 3MWMA 5FD6A 4ZI7A 5KHHA 5LOVB 5CA1A 1T5EA 3DF7A 4X1IB 4RB2C 5LMUH 4JI0H 4I50A 4JI3B 4TUYA 4DR1B 2E5LH 1SQGA 3JATA 3N42B 1CKOA 3RYHA 5IWAH 1WNSA 2F95B 5EZYB 4CS3A 5IT9W 1XMQH 4DUYB 1TGOA 2XHBA 4LFAH 2UUAB 2GV9A 2Q2TA 1N34H 4DR3H 2UXBH 1FFXA 1HNXB 3K59A 4BW9A 2CAZC 4DV7H 1S68A 5FPOA 4A2AA 2IM9A 4JI5B 1I94B 3K5LA 1IBKB 4UCTA 2P22C 4I7HA 4BWAA 2JGUA 4LH7A 3T1YB 5FD5A 2F4VB 4JI7B 4LFCB 4PHZA 3W1BA 4GKKB 4UCUA 3MAQA 4FLZA 2VQFB 4DUZB 3W1GA 3RTXA 1WN7A 4CC5A 4DK1A 5ITZB 4GLXA 4DR7B 1B04A 4DV4B 3M4IA 1CKMA 1WPBA 4DR5H 2PYJA 3N2GA 4DV3B 3NC0B 5LP6B 4AILC 4A2BA 5EIBC 5IYZA 4X20B 3JARB 4LF6B 4B08A 2OYQA 4L8JA 3QG5A 5CA0A 4CS4A 4IHJB 5LMUB 3BABA 4EFBA 3N43B 4MV7A 4EB6B 3L4KA 5D5QA 4KHPH 5FNVB 4U3JB 1TVKA 3HKBA 1E4FT 2ZM6H 4LF7H 5IWAB 1SEIA 3KXYT 4FM0A 4TV8B 3RYIA 1IBMH 1Q5OA 2Q2UA 2WYOA 5IJ9A 3RYCB 4LFAB 5KHJA 4M7EA 4DR2H 2P5OA 4NXNH 1QQCA 1J5EB 4YY3B 4DV6H 4LR3A 3U0ZA 1XNQH 5CB4A 2YIBA 4DV5H 1XK5A 4YJ2B 4LNUB 5KMGB 1RSOA 1XMOH 3RGXA 1P16A 2ZIOA 3RIZA 1FKAH 3GJXB 2RGVA 2UXDH 4JI8B 4HNAA 4IAJA 3HKCB 5LL6b 4JI3H 1CKNA 4O4LA 2BTQB 5LMNH 5JCOC 4UCSA 5JQGA 4DV1B 4LMYA 4F6RA 3IG0A 2R70A 1Z5WA 3JAKB 2PZSA 1AN7A 4BWSC 4PI0A 4DR5B 4I9QA 1HW7A 4JYAB 4ZI7B 4E6NA 2BTOA 4O2BB 2VWJA 4JI6H 5CA1B 4EEQA 4FLUA 4DV0H 4D7TA 4K8ZA 1FJGB 4MTDA 4AQYH 5D1OA 4FVMA 4TUYB 4I4TA 4TV9A 4B3MH 4K0KB 5LXTB 1IBKH 4UCVA 3RYHB 1JMKC 3CSXA 3T1YH 2ZM6B 4LF7B 1JFFB 4JI7H 4LFCH 3J7AK 3U10A 4FM9A 4O4JA 3A2FA 4LSXA 1V9PA 4DR2B 4NXNB 2UUBH 4GYCB 4DV6B 4CS2A 4DV5B 1XMOB 4FLYA 3N44B 2Q0AA 2UUCB 1M5IA 3E22A 2PGGA 3JASA 3GB8B 4LF6H 3S24A 5LP6C 1BJTA 4UFZA 2UXDB 4ETSA 4YHHH 4JI2H 3K5MA 4PZ6A 1BGWA 4YJ3B 2CW8A 5C8YB 1TAEA 5LMNB 3WB2A 2YI8A 4CH5A 2RQ6A 3PN1A 1FVIA 3N2GB 3WB1A 2PYLA 4LF5B 4X1KA 4JI6B 1SKVA 5IYZB 5FLXW 3N41B 4WBNA 2UXCB 3TY8A 1J5EH 4DV0B 2HVSA 2YIBD 4YY3H 3K58A 3B2EE 5JJEB 3SJBC 4AQYB 2CW7A 1XQ8A 4B3MB 3CHXA 4O4IA 4DR6B 5LA6A 1TVKB 3HKBB 4DK0A 4PZ8A 3KALA 4ZIBA 3RYIB 3RGBA 2E3CA 5LYJA 4TQFA 3HXLA 1YEWA 5D5PA 3VQYA 4DRXA 1Z2NX 4JI8H 3N40P 5BR8H 3U11A 2EX3A 4IIJA 2UUBB 4APMA 1XDNA 4DV1H 5CB4B 3OTFA 4FM2A 4JYAH 4TQDA 5JVDA 3HKEB 4JI4H 1DGSA 1FJGH 4HNAB 4LF9H 3LNNA 4K0KH 4O4HA 1CKNB 4O4LB 4YHHB 4JI2B 5JQGB 5JJJB 4F6RB 3JALA 2PY5A 3DSQA 3FMAA 2R9AA 1SQFA 3L2PA 5KX5A 1D5AA 4ZHQA 4X1YA 5K1XA 1SYXB 4NXMH 4D7SA 1P8LA 5D1OB 4I4TB 4TV9B 1XHXA 3LMLA 1KU9A 1SA0A 3SJCC 3C0FB 5BMVA 3BA9A 5IJ0A 4OX9B 2UUCH 3J81W 4PDBA 5J2UA 3EYYA 1TUBA 3THOA 4I55A 5JH7A 4R7RA 3K5OA 4EFEA 5BR8B 4B3TH 3IAYA 1VS0A 2ZNJA 1A0IA 5JJNB 1HNZH 2ZIMA 3RYFA 3SJAC 4RAYA 4DRFA 3KAKA 3ICXA 3VNNA 4B3RH 2Q7HA 3E22B 4LF5H 2HGSA 2JVDA 3JASB 4LF4B 4O2AA 2R72A 3VQXA 2UXCH 4JI4B 3K57A 3JAMW 4I50B 2F1MA 4LF9B 3JATB 3T1HH 4DR6H 1N36H 2JS5A 3W5OA 3NBZB 3F8NA 4IHJA 5K1PA 2WE6A 2FE3A 5FNVA 4X1KB 2CFMA 1FFXB 3RJ0A 4TV8A 1XI1A 2RJZA 4UCOA 4NXMB 3QTCA 2KKWA 1I7FA 5GONA 4MV9A 3ZS8C 5LA6B 3H20A 1IBLB 4LF8B 5LYJB 1X9NA 1Q3EA 4Q6GA 4MTEA 5KHGA 2RGRA 4DRXB 4FLXA 2VPSA 4LNUA 5KMGA 3OTOH 3GDEA 2HEPA 2OWOA 1O9GA 1JJOA 4B3TB 1HNZB 1O9HA 1KMIZ 1L8DA 2QJ1A 2BTQA 3HKDA 4B3RB 4AHCA 5JVDB 4CH3A 5FPRA 3KYHC 3N2KA 3M7MX 4ZOLA 5D1PA 4CH6A 1S5JA 5CA0B 2KSWA 5KHIA 2VQEH 4O4HB 4FLVA 4GKJH 4O2BA 3BRCA 2ZNIA 4JV5H 1E4GT 5J2TA 3T1HB 1N36B 3JALB 2QM4A 4OX9H 1M0WA 3J80W 2HVRA 4LH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 B;  1IBM B;  3JSN A;  1CKN A;  4X62 B;  4UCS A;  3L2P A;  4DV1 B;  4PZ7 A;  4DV2 B;  3QWU A;  4DR5 B;  2HVQ A;  1N32 B;  4JYA B;  1P8L A;  5D1O B;  4E6N A;  1XNQ B;  1N33 B;  5DIS C;  4EEQ A;  3BA8 A;  1FJG B;  5D1O A;  1HNW B;  3BA9 A;  4OX9 B;  4K0K B;  4UCV A;  3OTO B;  4DR1 B;  4JI3 B;  2ZM6 B;  4LF7 B;  3JSL A;  1CKO A;  4EFE A;  5BR8 B;  1VS0 A;  1A0I A;  1V9P A;  4TOI A;  4DR2 B;  4DUY B;  4NXN B;  2UUA B;  4DRF A;  3VNN A;  2Q2T A;  3NBY B;  4DV6 B;  1HNX B;  4LF4 B;  4GKJ B;  5FPO A;  2VQE B;  1S68 A;  4DV5 B;  1XMO B;  4JI5 B;  4JI4 B;  2UUC B;  1I94 B;  3TY5 A;  4JV5 B;  1IBK B;  4UCT A;  4LF9 B;  4JI0 B;  1ZAU A;  2E5L B;  3GB8 B;  4LH7 A;  4EQ5 A;  3T1Y B;  2HIV A;  3S24 A;  4UFZ A;  3W5O A;  2F4V B;  4JI7 B;  4LFC B;  2UXD B;  3NBZ B;  4PZ6 A;  3W1B A;  4GKK B;  4UCU A;  4X65 B;  2VQF B;  4DUZ B;  5LMN B;  1TAE A;  3RTX A;  3W1G A;  4CC5 A;  4GLX A;  4DR7 B;  1XMQ B;  2CFM A;  1B04 A;  3PN1 A;  1N34 B;  1FVI A;  4UCO A;  4DR3 B;  4DV4 B;  2UXB B;  4NXM B;  3UQ8 A;  1CKM A;  4LF5 B;  4DV7 B;  4JI6 B;  1TA8 A;  2UXC B;  3TY8 A;  4DV0 B;  4DV3 B;  3NC0 B;  2HVS A;  2HHH B;  1IBL B;  4AQY B;  4LF8 B;  4DR4 B;  4LFB B;  1X9N A;  4B3M B;  4LF6 B;  4DR6 B;  4PZ8 A;  5LMU B;  4EFB A;  3BAB A;  3GDE A;  2OWO A;  3SGI A;  5IWA B;  4B3T B;  1HR0 B;  2Q2U A;  4JI1 B;  2UU9 B;  2UUB B;  1HNZ B;  3RR5 A;  3BAA A;  4LFA B;  1XDN A;  4CC6 A;  4B3R B;  1J5E B;  1XNR B;  4X64 B;  5FPR A;  3KYH C;  4YY3 B;  5D1P A;  2HIX A;  2VUG A;  1XK5 A;  4UCR A;  2HVR A;  1DGS A;  4X66 B;  4B3S B;  1P16 A;  3TY9 A;  3T1H B;  1N36 B;  1CKN B;  4KHP B;  4YHH B;  3GJX B;  4JI2 B;  4LH6 A; 
#chains in the Genus database with same CATH topology
 1P49 A;  3OHA A;  4ED0 A;  2WLM A;  5DMX A;  5KX5 B;  5IJ9 B;  1I7N A;  1HR0 O;  4HN2 A;  3K3V A;  2C22 A;  3ZCC A;  4WFH A;  2UU9 O;  3C3S A;  4E4E A;  3KRE A;  2R8K A;  4A3E G;  1N48 A;  3UT5 A;  2ZXW C;  1VQ4 V;  5EOY A;  5BMV B;  2W6Z A;  2GBO A;  5B1B B;  1N33 B;  4NKG B;  3CD6 V;  5KFX A;  1P84 F;  5IYD G;  2HHH H;  4LF4 H;  1HNW B;  2HHF A;  4HBN A;  2BSK B;  5EYP A;  1Y67 A;  4WFG A;  3A0H Z;  1WH2 A;  2DWD C;  4K8X A;  1Y1W G;  4XDJ A;  3OAA G;  5LOV A;  4L1K A;  2YEV B;  1K1S A;  2B5U A;  1V51 A;  5DQG A;  3UKM A;  3SYQ A;  4FMT A;  2ODM A;  4FE2 A;  4FIP C;  4IWX A;  4YJ3 A;  2JEG A;  2A79 B;  3GTJ A;  1K97 A;  2O03 A;  1N32 O;  1I50 A;  2KSD A;  5KA5 A;  4MTX A;  4BR6 A;  2N74 A;  4X64 H;  1R6T A;  1M93 A;  4J9R A;  2VQE B;  2E76 B;  1MSD A;  3G67 A;  1ZHQ A;  3TY5 A;  3H1L H;  1IBL H;  3OEH G;  4LF8 H;  2MK3 A;  1ET0 A;  3HR0 A;  1SER A;  5D8D A;  1TWF A;  3O65 A;  5BXZ A;  3ZJZ A;  4FS1 A;  3SE7 A;  3VBB A;  4XYL B;  3M99 B;  3STL C;  1A9X A;  5KG6 A;  4FLT A;  1XMQ B;  3DXR A;  3K5N A;  2CQY A;  2NN4 A;  3L74 H;  4DV2 H;  2V4D A;  1TWG A;  3PW2 A;  3O9O A;  1KKD A;  3WWI A;  2XC9 A;  4ABM A;  1TA8 A;  4RB1 A;  1I94 O;  4DR4 B;  1WCM G;  2EIK C;  4FLW A;  1P4R A;  1SQB H;  2W6O A;  5LHG A;  1ZET A;  2NU6 B;  4X20 A;  2DPJ A;  2XIG A;  2VQF O;  5DLG A;  2DYR B;  2ZE6 A;  2PN1 A;  3HKD B;  2R7Z G;  4M9U A;  1H8H G;  4PDL A;  3W7U A;  3K08 A;  3APQ A;  2LQT A;  4DUY H;  3Q4H B;  1XNR B;  3CVZ A;  3ZHS A;  1YI2 V;  1Q43 A;  4JF3 A;  4FFO A;  2YUA A;  3RYC A;  2WAQ A;  2VWK A;  2ZCE A;  4U3F H;  5BWU A;  1SCU B;  2IJJ A;  4LF6 O;  4JI5 H;  1G8M A;  4B3S B;  2FLN A;  3LDE A;  4K6N A;  1W96 A;  1VQ7 V;  5IP7 G;  4YJ2 A;  1YJ9 V;  1T94 A;  1SET A;  3JAW B;  1IBM B;  4GKK H;  4IIJ B;  4WHX A;  3IFX A;  3T9C A;  5C1P A;  4FFB B;  4A3F G;  4DUZ H;  3AG4 B;  4P9P A;  3ZED A;  5BZB A;  2COJ A;  4EBE A;  4LFA O;  2X6A A;  5J2U F;  1VBG A;  1N56 A;  4DR7 H;  1NT2 B;  1I5X A;  2LP7 A;  2QWN B;  4RUC A;  1AI4 A;  2HVQ A;  3TGU H;  4RNM A;  4EYH B;  3CP1 A;  2X5R A;  5KUK A;  2WLI B;  4O4L F;  5FD6 A;  5H9C A;  4ZI7 A;  4CKB A;  1B6R A;  5CA1 A;  3P3P A;  3OW2 U;  1KJ9 A;  4X1I B;  2Q68 A;  3RW0 A;  4JI8 O;  5LMU H;  4I50 A;  4JI0 H;  4TUY A;  2JA5 A;  2ZDH A;  4J80 A;  5C1O A;  1L0L H;  3HOY G;  3L70 H;  2ZDI A;  2Z04 A;  2F95 B;  2DQ3 A;  2X7R B;  4MVQ A;  4CS3 A;  4DV1 O;  5F9L A;  1S0O A;  3DAA A;  5EC2 C;  2E2I A;  4I0X A;  5IT9 W;  4DR5 O;  3PFF A;  1TGO A;  3B40 A;  1N34 H;  1FFX A;  2Z0A A;  2HFE C;  3CCJ V;  5KS8 A;  2CAZ C;  5H6R A;  5FPO A;  4A2A A;  2GTS A;  4K0K O;  4AYB E;  1EM1 A;  4UCT A;  4I7Z B;  2JGU A;  3SJQ C;  1RM1 B;  4MVS A;  2J6U A;  3OMA B;  4JI7 B;  2QF7 A;  1OCC B;  2XD4 A;  3W1B A;  1PP9 H;  1FXK B;  1WN7 A;  4CC5 A;  5ITZ B;  3G6V A;  2UVR A;  3Q1K A;  2HVK C;  4DV4 B;  4NTX A;  4MAM A;  1WPB A;  2X0L A;  5KFF A;  3PO2 G;  1F4M A;  4C5C A;  1IXB A;  3N2G A;  4DV3 B;  3NC0 B;  3S3X A;  1D5N A;  4ECT A;  2GPW A;  3I55 V;  4A2B A;  2EIL C;  4J11 A;  5IYZ A;  3PZP A;  4L8J A;  1GRJ A;  2UXD O;  3FD9 A;  4EFB A;  1RK6 A;  2V9W A;  5BY1 A;  4WBN F;  1TVK A;  4O7L A;  3LP8 A;  4U7O A;  5IWA B;  4QWB A;  3RYI A;  4EBD A;  3HT5 A;  3SYC A;  1Q5O A;  5I5U A;  2DLN A;  4O4I F;  1J95 A;  4M7E A;  5KHJ A;  5KFJ A;  1A48 A;  4JI6 O;  1QQC A;  2UXC O;  1GM8 A;  4J7K A;  2KQX A;  2HJD A;  3U0Z A;  1B6S A;  3M9N B;  5KMG B;  1RSO A;  3T1H O;  1UPG A;  2RDC A;  4HAM A;  3T4D A;  2R93 G;  3RT3 C;  3CCS V;  3HKC B;  3KHH A;  3R23 A;  3CPW U;  1UNN C;  1OHH G;  2EIN C;  3H0G A;  5JVD F;  5JCO C;  3CEB A;  4F6R A;  3JAK B;  4BWS C;  1Q6I A;  3ZRW B;  3LWB A;  1KJQ A;  4JYA B;  2BTO A;  1SZX A;  4EEQ A;  2RCV A;  4DV0 H;  4EGJ A;  3SPG A;  1FJG B;  3E8H A;  4FVM A;  3CWB H;  2UVW A;  1VAJ A;  3G6X A;  5A9G A;  1OCR C;  3ZRX A;  2P4K A;  3T2M A;  3RYH B;  4JI2 O;  1K83 A;  1YXB A;  3CSX A;  5KA6 A;  2ZM6 B;  2JEI A;  4LF7 B;  4R6Z A;  5CMU A;  1PD3 A;  3H4D A;  5CR5 A;  5KLV H;  1L0N H;  3BCC H;  4O4J A;  3A2F A;  2HGX A;  1KBL A;  4CMD A;  3B09 A;  2R9I A;  4PA9 A;  4DR2 B;  2UUB H;  4X89 A;  1I3Q A;  5BWV A;  4H13 B;  1H38 A;  3BQ1 A;  5HV6 A;  4BXX G;  4DV6 B;  4EEY A;  4PJ0 Z;  4CS2 A;  3TCU A;  1F23 A;  4DV5 B;  1XMO B;  4ZKI A;  2Q0A A;  3OUZ A;  1K8A W;  4JTC B;  2Y4R A;  3GB8 B;  4LF6 H;  1GTO A;  2DWC A;  3S24 A;  4R8U B;  1ARO P;  4NYK A;  4C5A A;  3K5M A;  4PZ6 A;  1N0J A;  4J9Q A;  4C5B A;  3H4B A;  4RO2 A;  1NTM H;  4O2A F;  2B1I A;  2CW8 A;  4O7V A;  5C8Y B;  2YI8 A;  2FPP B;  2RQ6 A;  3PN1 A;  5CN0 A;  1CPY A;  2AZ2 A;  3K3P A;  4HNT A;  1SQQ H;  5L1L A;  4LF5 B;  1COW G;  1NH2 B;  2CGN A;  1SKV A;  5KFV A;  3N41 B;  1VQ6 V;  3ABM C;  3LUL A;  4JI4 O;  3ZMZ A;  3TET A;  4O3R A;  1KB9 F;  2CW7 A;  5FNV F;  4Z1V A;  4A3K G;  1XQ8 A;  4B3M B;  4LF9 O;  3CHX A;  1KKC A;  2H94 A;  3KG2 A;  5LA6 A;  4OPH A;  4PZ8 A;  3KAL A;  3F5W C;  4ZIB A;  3RGB A;  1US6 A;  2ZE7 A;  4TQF A;  3SYA A;  1YEW A;  1G2W A;  3VQY A;  1R3K C;  2CDY A;  2DN9 A;  4G27 B;  4DRX A;  1G4Y B;  4WFA V;  1Z2N X;  3T99 A;  1IYD A;  3GIK A;  4JI8 H;  5BR8 H;  2YIC A;  3B77 A;  4IRD A;  3U11 A;  3QNE A;  5B5E Z;  5CE8 A;  2AGP A;  3NGD A;  4DV1 H;  3GVM A;  5KG5 A;  2B63 A;  3AG3 C;  3DTU B;  4FM2 A;  4O86 A;  4AYB A;  3Q8S B;  2HG8 A;  1MG1 A;  3Q8Q B;  3T5J A;  2YC0 A;  3UM7 A;  5CAE B;  3ABL C;  2DAB A;  3IN5 A;  1H8E G;  2FPI B;  5BWX A;  5KG0 A;  2JIZ G;  3RBZ A;  1TWC A;  4K0K H;  1OCZ C;  1CKN B;  4O4L B;  2ASD A;  2K9P A;  4J9Y B;  4FJC C;  4JAU A;  5FL7 G;  1GM9 A;  3AG1 B;  3ETJ A;  2QKA A;  3L2P A;  1EBO A;  2DOS A;  1AR4 A;  4ME6 A;  4PA6 A;  5K1X A;  1DAA A;  5D1O B;  1H2N A;  1E4E A;  1JPX A;  3LML A;  2AHY A;  2WLN A;  4UUJ C;  4YAJ B;  1N36 O;  1SQV H;  4JGS A;  3J81 W;  4PDB A;  5J2U A;  1NR7 A;  3THO A;  1RPR A;  2YRW A;  4R7R A;  1XDC A;  3OM3 B;  1ZWI C;  1H2G A;  1C3O A;  1TUE B;  2ZNJ A;  2UUA O;  3HOV G;  3RB0 A;  4MSW C;  1HNZ H;  4J9Z B;  3RYF A;  2Z02 A;  2UXN A;  2J9G A;  2VPQ A;  3AK3 A;  4GLW A;  3VNN A;  3RFC A;  2EUL A;  3CRA A;  5LBQ A;  5LOV F;  3PW5 A;  2R8J A;  3E22 B;  2Z5U A;  3ZX6 A;  4LF4 B;  2UXC H;  4JAS A;  1I1M A;  5LHH A;  4YJ3 F;  2J6S A;  1KJI A;  4Q8F A;  1V55 B;  3T1H H;  3AK2 A;  3OMN B;  5BWR A;  5KG2 A;  3C90 A;  4YP3 A;  3BVO A;  4IHJ A;  5KFA A;  5I5W A;  4EKW A;  3CX5 F;  2CFM A;  5DGH A;  4TV8 A;  1XI1 A;  2ZE8 A;  2ZDQ A;  5BWT A;  2VRZ A;  4NXM B;  2Y4U A;  1NQT A;  3MFI A;  2KKW A;  2Y0I A;  3BFR A;  3OEE G;  3R66 A;  1IBL B;  4LF8 B;  1DTO A;  4RQE A;  1X9N A;  1Q3E A;  3LSU A;  4TQR A;  1IOV A;  3AG7 A;  2V4R A;  3RB6 A;  3ABT A;  3GDE A;  4QE7 A;  5L9X A;  4HNU A;  3GV7 B;  1W0J G;  4DR3 O;  2UXB O;  1KP2 A;  1O9H A;  1NJI W;  3D8C A;  4DV7 O;  5JVD B;  3PW7 A;  5FPR A;  3KYH C;  4XYM B;  4ZOL A;  2ASJ A;  4A3B G;  1LNQ A;  5CA0 B;  2ATL A;  1JVM A;  5KHI A;  4FLV A;  4GKJ H;  3LDD A;  2ZNI A;  1E4G T;  3E83 A;  3CRQ A;  4QPK A;  1F7Y A;  3RBD A;  3JAL B;  2V58 A;  1BXR A;  3JD1 A;  4JYB A;  3B4S A;  5LXT A;  3R65 A;  1BQ0 A;  3FKI G;  2PTM A;  3E5N A;  4LC1 A;  1S97 A;  3KCY A;  3UO3 A;  5GTI Z;  1JFF A;  2YIA A;  1OCO C;  2ZT9 B;  3I5D A;  4X64 O;  4YJ2 F;  4O7S A;  2Q7G A;  5I60 A;  4CHI A;  2C2D A;  3ZHQ A;  1Y74 B;  1TUB B;  2OLS A;  2FK2 A;  4R50 A;  5JH7 B;  4DL7 A;  1CQI B;  1Y1V G;  1K7D A;  2C28 A;  3OTO B;  3GTK A;  3WB0 A;  1A3G A;  4O82 A;  1I1K A;  3EPG A;  4BY1 G;  3UO2 A;  4J10 A;  1VMG A;  1WA8 A;  5KFN A;  2P4V A;  5FLX N;  4ZI7 F;  1NVP B;  5JCO A;  3FFQ A;  4DV2 O;  2DPI A;  5CA1 F;  4OPA A;  2R7M A;  4JI1 H;  1VQ5 V;  5KFO A;  4O2A B;  1K4D C;  1XOU A;  3D36 C;  3A8T A;  4PBC A;  1XNQ O;  4I50 F;  4TUY F;  4MV8 A;  4FK5 C;  3EFF K;  5JWP A;  3W7T A;  1VEW A;  1AJQ A;  1ZTE A;  2ABJ A;  4GC7 A;  3I4N G;  1A0G A;  4X66 H;  2AHZ A;  4JI0 B;  2AGQ A;  4QNH B;  3HB9 A;  1Z2P X;  4ED2 A;  1PNK A;  4YR0 A;  5KHK A;  3CME V;  3K0D A;  3CCR V;  2Q7E A;  3ETQ A;  2W71 A;  4Q45 A;  3V6J A;  4X65 B;  2W7P A;  1KC8 W;  2SCU B;  4X62 H;  4DUY O;  4JPR A;  5AG2 A;  3KAJ A;  1N34 B;  1LUW A;  3AG4 C;  1KEC A;  2EIY A;  2M7W A;  4BW5 A;  3UQ8 A;  3HB3 B;  2HDK A;  2YXL A;  3ZHR A;  4JI5 O;  1I2L A;  2CH7 A;  1B6Q A;  5EIB D;  4LFB B;  1HWY A;  3FYE B;  4ED7 A;  2YI9 A;  3T1Y O;  4DIM A;  5JQW A;  3FAV B;  2ZE5 A;  3HKE A;  1QVF U;  4GKK O;  2F93 B;  4DR1 H;  2WSS G;  3WFV A;  4NVP A;  4DUZ O;  1Q82 W;  4DR7 O;  1HR0 B;  3ASN B;  3QQM A;  1H2S B;  3GIP A;  5IYZ F;  3WWJ A;  3N2K B;  3DC5 A;  4J7Z A;  4U3J A;  2UU9 B;  5IDJ A;  3RR5 A;  2YCH A;  3ABU A;  2XCA A;  3HOW G;  4CC6 A;  2UUA H;  5KFT A;  3E8G A;  1GYF A;  2PF4 E;  2C2E A;  4RNO A;  1HNX H;  2BQR A;  1WPX A;  2FL4 A;  5L3C A;  2HIX A;  1AP5 A;  2BR0 A;  4NR1 A;  2J6T A;  3TJT A;  1KJJ A;  5LMU O;  3TY9 A;  1Z5V A;  5IYC O;  2WLL A;  5A2Q W;  2QA4 V;  4N21 A;  4O7R A;  3RV3 A;  2PUS A;  1EKF A;  1RM1 C;  2FMA A;  3UT5 B;  1OCC C;  1V54 B;  1DV1 A;  4RUF A;  1IYE A;  2VOB A;  3KHL A;  1WAZ A;  5KFP A;  1DIK A;  1FXK C;  3OHB A;  2XAG A;  2XAF A;  3JAM N;  1G6U A;  1N32 B;  2P06 A;  4YY3 O;  3CCE V;  4P9O A;  4HYK A;  1MZE A;  1BL8 A;  5DIS C;  2IW5 A;  5EYP B;  3MWM A;  2DWE C;  5KHH A;  2QTO A;  5LOV B;  3GIM A;  1GSH A;  4PDR A;  3Q8R B;  2W9A A;  5EBW C;  4ED1 A;  2CK3 G;  3JAT A;  2XAJ A;  2B9Z A;  1CKO A;  1WNS A;  1JKJ B;  3CYO A;  1PK8 A;  2E74 B;  3ASO B;  2XHB A;  4FFK A;  2DE0 X;  2P7T C;  4DR3 H;  2UXB H;  2GSM B;  1GH6 A;  4FFL A;  4DV7 H;  4BW9 A;  1KC7 A;  3UZB A;  1KP3 A;  2Y69 C;  2L6L A;  1Q6H A;  4O4J F;  1I94 B;  3RVY A;  3OFN G;  2P22 C;  3K9A A;  1I08 A;  2Q0O C;  2XCL A;  1AJN A;  1K4C C;  5JVL A;  2F4V B;  2W9B A;  2W0X A;  3G80 A;  3N8D A;  3RVZ A;  4UVB A;  2VQF B;  1E1Q G;  3W1G A;  1GN2 A;  1DK1 A;  4FZ1 A;  5BPF A;  2Y0S E;  4DK1 A;  4QWE A;  5B1N A;  3JCZ A;  3W7X A;  1PV0 A;  3M4I A;  1WP8 A;  2BOC C;  2JS3 A;  2LGW A;  1BZK A;  4IYH A;  2FYU H;  2Y48 A;  3J80 N;  3WO0 A;  3E8F A;  1G1X B;  4EYI B;  2GUZ B;  4AIL C;  5EIB C;  5LHI A;  4X20 B;  3T54 A;  4LF6 B;  4B08 A;  1W93 A;  3BJY A;  4MV7 A;  3RB3 A;  3OSP A;  1AB3 A;  2FK3 A;  3HKB A;  4LP8 A;  1SEI A;  4A3J G;  2N05 A;  2NVX A;  2Q2U A;  1JX4 A;  5IJ9 A;  1GM7 A;  4B3R O;  5LA6 F;  1NBM G;  3RYC B;  4LFA B;  4IR9 A;  5KKN B;  1THZ A;  3Q2O A;  4DV0 O;  2DYS B;  4D6T H;  2R8H A;  4LR3 A;  4IRC A;  1XNQ H;  4YJ2 B;  4DR6 O;  2CTP A;  3RGX A;  2ZIO A;  4UB6 Z;  3RIZ A;  3GID A;  3CJH A;  1UJW B;  1YJW V;  1YJN V;  4JI8 B;  1P7G A;  1XL4 A;  3P3N A;  4DL3 A;  2W6I G;  2BTQ B;  5T14 A;  5LMN H;  4C7U A;  5JQG A;  2UUB O;  2LGQ A;  4RZR A;  1EKV A;  4DV1 B;  2PZS A;  2LFR A;  1AN7 A;  3ETD A;  4DR5 B;  2PBZ A;  4TVI A;  1HW7 A;  4ECZ A;  4ZI7 B;  4E6N A;  4O2B B;  2VWJ A;  5CA1 B;  4FLU A;  2Q69 A;  4A5U B;  3LQS A;  4MTD A;  4AQY H;  4TUY B;  3OGI B;  1CS0 A;  4GX2 A;  2NU9 B;  1B06 A;  1WRV A;  4K0K B;  3I4M G;  2IJK A;  5EBM C;  3G4S V;  5EZY F;  1M9N A;  5KFS A;  3T1Y H;  1XEQ A;  5KFW A;  4I0X B;  5C5J A;  1W2B U;  4JAV A;  3FKS G;  4EBC A;  2JEX A;  4MW8 A;  1V9P A;  5KFZ A;  1GK9 A;  3ZHT A;  4NXN B;  4J9P A;  2LO1 A;  4E2L A;  1IX9 A;  2OH2 A;  5C44 G;  4GZR B;  4J9S A;  4O3S A;  1RP3 B;  2FJZ A;  5HFM A;  4ECR A;  4QW9 A;  3BAC A;  2JGD A;  2ZQM A;  1M5I A;  3L75 H;  3CSW A;  2OCC B;  3T5K A;  2EBO A;  2PGG A;  4Z1M G;  3JAS A;  2PVP A;  4DYL A;  4MA0 A;  4IWY A;  1ROP A;  5LP6 C;  2UXD B;  1BGW A;  4YXW G;  5BR8 O;  4O7T A;  1L1F A;  3DTG A;  1EUC B;  5IY5 B;  2V7Q G;  3AG1 C;  5H80 A;  3N2G B;  2AW9 A;  5EC1 C;  1F51 A;  1KUT A;  4U7N A;  3G8C A;  3D36 A;  1YTF D;  2R92 A;  3CC2 V;  3NUA A;  4JI6 B;  1SS3 A;  1PL0 A;  5IYZ B;  4O3N A;  2UXC B;  1GKF A;  4IHJ F;  3TY8 A;  3HOZ G;  2YIB D;  4YY3 H;  5JJE B;  3E89 A;  2IH3 C;  3QO8 A;  2YU9 A;  4JZ2 A;  3SPJ A;  4TV8 F;  1TVK B;  2ZDG A;  2P0A A;  2Q8V A;  3RYI B;  2NU8 B;  3VPD A;  5LYJ A;  2YSU B;  4JTD B;  2W0F C;  4I5S A;  1YIJ V;  3HXL A;  3CEI A;  4YR2 A;  2X0S A;  3N40 P;  2BE3 A;  5IYB O;  4IIJ A;  5KT7 A;  1NVP D;  2FKX A;  1XDN A;  2WA4 A;  3SYO A;  3E2E A;  1RSO B;  3CCL V;  2RDJ A;  1PL4 A;  4B3S O;  5I47 A;  4JAA A;  2WAM A;  2YS6 A;  5DQI A;  3EHB B;  3T1C A;  2WA3 A;  3MFH A;  3ETG A;  2Q6A A;  4H0L B;  4O4H A;  4FFR A;  3FB7 C;  4YHH B;  5IT9 N;  4JI2 B;  2Y0S A;  3ZMS A;  3GV5 B;  5JJJ B;  1BQZ A;  3JRW A;  1KT8 A;  1M56 C;  1V55 C;  4ZOL F;  5EDW A;  2FB9 A;  3OUF A;  4F6R B;  2PY5 A;  3DSQ A;  5B3S C;  2R9A A;  1HNZ O;  1EZ1 A;  2KG7 A;  4ZHQ A;  4X1Y A;  4RNN A;  3GV8 B;  4D7S A;  4ECV A;  3JD0 A;  5LXT F;  4OGQ B;  4JV0 A;  1QNM A;  1XHX A;  2WWW A;  5DM6 V;  3BQ2 A;  1KU9 A;  1SA0 A;  3JYC A;  3OUS A;  3UZO A;  3BA9 A;  1DF4 A;  5IJ0 A;  3K0G A;  3T9B A;  4BIZ A;  1ZX3 A;  2ITC C;  4I55 A;  3K5O A;  5H6Q A;  3JD4 A;  1Q7Y W;  2GDS A;  2NU7 B;  2WLH A;  1VS0 A;  4A3M G;  2P90 A;  2ARH A;  5H2F Z;  5JJN B;  4RAY A;  3SJA C;  1XL6 A;  4DRF A;  2OTL V;  3ICX A;  3KAK A;  4B3R H;  5KFD A;  2YDE A;  2HGS A;  2KB1 A;  2R72 A;  3GB7 C;  2UVV A;  2QKC A;  3MDS A;  1BMF G;  4KXR A;  4PV1 B;  4JI4 B;  3GTG A;  4ED3 A;  1B33 N;  2QWR B;  3GWK C;  4LF9 B;  4DR6 H;  4FBT A;  2JS5 A;  3ORQ A;  4KP4 A;  3F8N A;  2DIK A;  3N27 A;  5K1P A;  1A32 A;  2OIG A;  1M57 B;  4DV4 O;  2IJI A;  2W9C A;  2RJZ A;  1S0N A;  3G8D A;  4MS2 A;  1YVW A;  3QTC A;  1RYR A;  4RUA A;  4DV3 O;  1N0N A;  3CC7 V;  5GON A;  4WCE V;  4GKJ O;  4MV9 A;  3EXA A;  5LA6 B;  4JYC A;  2E2H A;  5L1I A;  5E79 Z;  3TIG A;  2E5L O;  2RGR A;  2D2C B;  4DRX B;  2QWQ B;  2VPS A;  1I5Y A;  5KMG A;  5B1A C;  5KFQ A;  1EZV H;  4G2K A;  4NLG A;  3K04 A;  1O9G A;  1IXM A;  2FPG B;  1AI7 A;  3QZ8 A;  1JJO A;  4B3T B;  3OSN A;  4UUG A;  4MT8 A;  2HR3 A;  1YSC A;  3AK1 A;  5L1K A;  2JA5 G;  5EWG A;  4IZO A;  3M8A A;  3ZRS A;  3SPI A;  3MWE A;  5DG9 A;  4AHC A;  4DW0 A;  1AUX A;  1UC9 A;  4Z2W A;  5DLF A;  5D1P A;  4CH6 A;  2KSW A;  2VQE H;  2NR5 A;  4BBS G;  4N23 A;  5KUM A;  5CA3 A;  5J2T A;  4F6E A;  1N36 B;  2QM4 A;  1M0W A;  2N04 A;  1YZB A;  1R6K A;  5BPH A;  1I1L A;  4KL1 A;  4WFE A;  5JUM A;  1FXH A;  3ORR A;  2HG5 C;  3RFR A;  2AGO A;  1EZJ A;  1EN5 A;  4JI1 O;  4I4T F;  3H1J H;  3KHR A;  2Y4T A;  2F66 C;  3EPI A;  4Q44 A;  1TWH A;  3L4J A;  2QM8 A;  3LSQ A;  4UV8 A;  5J2U B;  2MCT A;  2VUM A;  2LW7 A;  3DC6 A;  4X66 O;  3PO3 G;  3V4Z A;  4MVO A;  1IUR A;  4DR4 H;  1XHZ A;  2D3O W;  4J42 A;  4FM1 A;  4KHP O;  3VQV A;  2QWO B;  4DW1 A;  2JA7 A;  1CXZ B;  4RAZ A;  4J9L A;  4CBC A;  2I87 A;  2XTA A;  4FFM A;  1Z2O X;  2HJW A;  3BPZ A;  1ZLZ A;  3GIJ A;  4FZ0 A;  3RYF B;  1CE8 A;  4X62 O;  2ZGI A;  4YIP A;  4Y8V B;  1S72 V;  4QWC A;  4TOI A;  1CEZ A;  4BIU A;  5C8Y A;  1WR2 A;  2X6C A;  1JLL B;  5DN6 G;  3NBY B;  5EZY A;  4G28 B;  4UVC A;  1XNR H;  1K3E A;  1NS1 A;  4RZQ A;  1FKA O;  4PA3 A;  4JV5 B;  3FB5 C;  5H5N A;  3WWH A;  1SZT A;  4B3S H;  1ZAU A;  2JEJ A;  4JI3 O;  4DR1 O;  2HIV A;  4EQ5 A;  1F4N A;  5DGI A;  4NZN A;  3FB8 C;  2HGW A;  5K3W A;  3TXQ A;  2WB1 E;  3OGC C;  1BHB A;  3N6X A;  3VQW A;  4F50 A;  3MD0 A;  4HYO A;  3RF2 A;  2ZJT A;  4DR3 B;  2UXB B;  1V54 C;  2ZIN A;  1HNX O;  2IJH A;  3AG2 B;  4DV7 B;  3H0G G;  2JA6 A;  1X4T A;  1I2K A;  5GTH Z;  4PDV A;  2HHH B;  1FFT B;  4B3M O;  4U7C A;  1IBK O;  5CM0 A;  1ZL8 B;  4X8A A;  1C30 A;  4CH4 A;  2R9R B;  4IT5 A;  4LFC O;  5LP6 A;  3JAR A;  4MVU A;  3L71 H;  1M90 W;  3RWR D;  3L72 H;  4QPJ A;  3GWO A;  1W59 A;  4EB6 A;  3E8B A;  5EWE A;  3H3V H;  3WNZ A;  3JCU Z;  4ZOL B;  3BAA A;  4O3P A;  1VF5 B;  4WBN B;  2AZ0 A;  3ASO C;  4X64 B;  3NR7 A;  3J81 N;  3CCV V;  2EIL B;  1JX9 A;  4CZZ A;  3BHP A;  4PI2 A;  4O4I B;  1PNM A;  3T4Z A;  2HLD G;  5L3B A;  4XX0 B;  3PR4 A;  5KX5 F;  1OZ0 A;  5B1B C;  3MR2 A;  3SI8 A;  1IOW A;  5LGN A;  3W7S A;  3RV4 A;  1L2Z A;  1IDS A;  2H8P C;  3A0B Z;  3WU2 Z;  1JXL A;  2A3Q A;  4RB0 A;  1QR9 A;  2R6F A;  1VF7 A;  4DV2 B;  2OIE A;  1J5E O;  1KTA A;  1VF6 C;  4DV4 H;  3TQT A;  5KT4 A;  4DL6 A;  4W4L A;  1XNQ B;  5KFM A;  2FML A;  2ALZ A;  4DV3 H;  2VS0 A;  1PPJ H;  5JQG F;  1WLE A;  4NTW A;  4RU9 A;  2YXH A;  1SRY A;  1KBH A;  1T5E A;  1WA8 B;  2EIN B;  1EN6 A;  2Q9L A;  2EJ0 A;  4NYE A;  2E5L H;  3OT7 A;  2OTJ V;  4Q8E A;  5J9P C;  2W70 A;  3N42 B;  5IWA H;  4QSH A;  3OUU A;  2YL2 A;  1QR8 A;  1RPO A;  4DUY B;  5IE9 A;  2GV9 A;  2Q2T A;  4MVR A;  2Q7D A;  1S5L Z;  4HQ6 A;  1GSO A;  3KZI Z;  1KYO F;  4UVA A;  4RUE A;  3K59 A;  1Y76 B;  1AR1 B;  4JV1 A;  3STZ C;  4JI5 B;  1H2L A;  2DYS C;  2V59 A;  3U9S A;  2R7L A;  4I7H A;  4BWA A;  4LH7 A;  2B63 G;  3T1Y B;  2CNV A;  1VQM V;  3HO8 A;  2FKL A;  2YYA A;  4PHZ A;  3ZMT A;  1OJH A;  4GKK B;  4FLZ A;  1VQK V;  3CMA V;  4DUZ B;  2GLT A;  4GLX A;  4DR7 B;  2MW2 B;  4XBF A;  3GTP A;  4NXM O;  4J9N A;  2BQU A;  4MTG A;  2DYR C;  1YDX A;  2JA8 G;  1CKM A;  2CH7 B;  4GX0 A;  1MAB G;  2FB5 A;  4OXS A;  1Y1W A;  2UUC O;  3PVX A;  2GHY A;  2OYQ A;  4YIO A;  1S76 D;  3QG5 A;  2XAQ A;  5CA0 A;  2WPD G;  2DQ0 A;  5HNE A;  5DGB A;  4CS4 A;  4QGP A;  5LMU B;  4YB8 B;  3SPH A;  5BYA A;  1P7B A;  3BAB A;  3N43 B;  5IYD O;  3L4K A;  2W6P A;  4KHP H;  5FNV B;  4U3J B;  4Q4D A;  1E4F T;  3GIQ A;  5LMN O;  5KFL A;  2ZM6 H;  4LF7 H;  4FM0 A;  1S0M A;  4IYI A;  4GCZ A;  4QE9 A;  1SES A;  3R5X A;  3T7A A;  3FDS A;  3GTM A;  2WYO A;  2YZM A;  4DQN A;  4DR2 H;  1EFR G;  3ZHU A;  4YAK B;  5LYJ F;  3R9R A;  2VQD A;  4E4T A;  4YY3 B;  3RN4 A;  4DV6 H;  4AQY O;  5CB4 A;  2YIB A;  3MHS C;  2WLL B;  5F9N A;  5KT6 A;  4DV5 H;  2HP8 A;  1XK5 A;  4LNU B;  1KD1 W;  2EZO A;  1XMO H;  4F4L A;  4IIJ F;  1R6N A;  2I8C A;  2QSA A;  4HNV A;  1N8R W;  1FKA H;  3GJX B;  5KFY A;  2WB1 A;  2BQ3 A;  3ZBH A;  1Q81 W;  4HNA A;  2G38 A;  4JI3 H;  1JDB B;  4CMF A;  4FS2 A;  2YS7 A;  4J7J A;  4H33 A;  5CBF A;  2EJ7 A;  3JZF A;  2R70 A;  1Z5W A;  4DLK A;  3QFF A;  1WCM A;  3IG0 A;  4PI0 A;  4I9Q A;  4O4H F;  1U96 A;  3ABL B;  1MOF A;  4PA7 A;  3CC4 V;  1Q86 W;  1BCC H;  4D7T A;  1OCZ B;  5KFH A;  2QDO A;  4K8Z A;  4WF9 V;  4QJF A;  2R8G A;  4I4T A;  4TV9 A;  1GGO A;  2C2R A;  4B3M H;  2R7Z A;  4ZHQ F;  1IBK H;  1JMK C;  4A3I G;  2EIJ B;  3OR7 C;  1Q90 D;  1VQ9 V;  3VOT A;  4DL4 A;  4LFC H;  1PKX A;  3DGE A;  3J7A K;  5CBH A;  3HPL C;  5F2V O;  4LSX A;  3F7V C;  2DMX A;  3CXH F;  1UFI A;  3UYY A;  2QKS A;  4RWU A;  4Q43 A;  2W6M A;  4I55 F;  2JJ1 G;  3BQ0 A;  3JD3 A;  1K73 W;  2HHF B;  1K9M W;  1BS3 A;  4B7E A;  2XUM A;  3CCM V;  3N44 B;  4FLY A;  3GLK A;  4FFN A;  1NH2 D;  3KTM A;  4OX9 O;  2FP4 B;  2W9B B;  1AI5 A;  2V1D A;  1RFY A;  4RAI A;  3F7Y C;  3OD4 A;  1BJT A;  2OT5 A;  4ETS A;  3MR3 A;  3NXS A;  4A3C G;  1DLB A;  1EN4 A;  4YJ3 B;  1BT8 A;  3E86 A;  5KFU A;  4MW3 A;  3HOU G;  3WB2 A;  4R7C A;  4K3A A;  4PA4 A;  1FVI A;  3WB1 A;  1H2M A;  3TIN A;  3P32 A;  4JXU A;  4IRK A;  4X1K A;  4YBZ B;  1J5E H;  5A2Q N;  3AYH B;  1AI6 A;  4DV0 B;  2BCC H;  3X2Q B;  4ICG A;  3B2E E;  5I5X A;  2F23 A;  3T9D A;  1FS0 G;  3T5L A;  4DR6 B;  4J41 A;  2CUG A;  3HKB B;  4DK0 A;  4LWS A;  4XDL A;  2R85 A;  2AXT Z;  1WSC A;  1S3J A;  1VQL V;  3G6E V;  1E79 G;  2C2A A;  4B7K A;  1SC5 B;  5GON F;  5D5P A;  2GTA A;  3DXR B;  3CS5 A;  4R8C A;  1SQP H;  2EIM B;  2QB5 A;  1KEE A;  4K35 A;  3UFX B;  2UUB B;  4APM A;  1GMG A;  1RYS A;  2A9H A;  2CTQ A;  3BEH A;  1GSA A;  2CE4 A;  4QIW A;  3H40 A;  3OTF A;  1VAR A;  3U0G A;  1AUV A;  1FPO A;  4JYY A;  4TQD A;  3CJH B;  3JD2 A;  1CQJ B;  2PI4 A;  2ZD9 A;  2A06 H;  2XOK G;  1I7L A;  2IA6 A;  1DGS A;  2R87 A;  1ZQ7 A;  2ADP A;  4UXN A;  5KG1 A;  2V5A A;  5JQG B;  4TSF G;  4X88 A;  5FR9 A;  4QWD A;  1HDJ A;  3MHH C;  2RNB A;  3CQZ A;  1Y14 B;  5BYB A;  5KX5 A;  1D5A A;  5J2T F;  4WFB V;  1NTZ H;  1XUQ A;  3K5I A;  1GAX A;  1M57 C;  2ODT X;  2ATK C;  2UXX A;  2YZN A;  3ETE A;  5CBG A;  1SYX B;  3S3W A;  1S0V A;  1P8L A;  4NXM H;  3SJC C;  5EK0 A;  2XGP A;  4U6P A;  5BMV A;  2P6J A;  2RMK B;  2UUC H;  1DV2 A;  3EYY A;  3CE2 A;  4A3G G;  2ILM A;  2BSK A;  1OCO B;  3GTL A;  5DQH A;  2HVJ C;  4MVM A;  5BR8 B;  3TW7 A;  1FAF A;  2EJR A;  3OMI B;  2YEV A;  1A0I A;  4ECW A;  2ZIM A;  3CCU V;  1VF6 A;  4ZBM A;  2JGD B;  3G6Y A;  1N33 O;  5IYC G;  2JVD A;  3MR5 A;  1GN4 A;  3JAS B;  3CXC U;  4ECQ A;  2R93 A;  3VQX A;  4F4Z A;  1HNW O;  3K57 A;  4I50 B;  2I80 A;  2F1M A;  1AP6 A;  5C8Y F;  2F4V O;  1ULZ A;  2GUZ A;  2YXY A;  1SQX H;  1K92 A;  1ZSP A;  3H1I H;  2LW1 A;  1RJQ A;  2NNU A;  1S9F A;  5KG4 A;  2FE3 A;  3H1K H;  1NTK H;  5E1A C;  2PI5 A;  5EWF A;  1FFX B;  1EHI A;  2QTS A;  3LSS A;  3U9T A;  3IJ4 A;  3ABK B;  5KFE A;  2HKO A;  3V6H A;  1I7F A;  5L1J A;  1YIT V;  2VQE O;  3ZS8 C;  1BNC A;  3H20 A;  1MSW D;  5LYJ B;  3K9S A;  2Q4P A;  2W6J G;  4Q6G A;  4FLX A;  1QLE B;  5FJ8 G;  2NUA B;  3OTO H;  3PW0 A;  2HEP A;  2OWO A;  1IZ3 A;  4H44 B;  1RJR A;  3D3Q A;  4XDK A;  4C2M A;  2B1G A;  1XMQ O;  4TQS A;  1R3L C;  1HNZ B;  5DAA A;  4IGG A;  1KMI Z;  3BG5 A;  2BTQ A;  3HKD A;  2CTR A;  5LP6 F;  4CH3 A;  1EKP A;  1AR5 A;  3M7M X;  1NZ6 A;  2ITD C;  3Q4H A;  2JK5 C;  4MV1 A;  4DR4 O;  4O4H B;  1JA8 A;  4MTF A;  4O2B A;  5B66 Z;  3BRC A;  5L3D A;  3VMM A;  3T1H B;  4ASU G;  3QVN A;  4OX9 H;  1SFO A;  1D2D A;  2NLJ C;  5KFB A;  2VA3 A;  1JQ0 A;  4LH6 A;  2XCP A;  3RGZ A;  2KG7 B;  1CP9 A;  4L87 A;  1UC8 A;  2W57 A;  3GQC A;  4ZHQ B;  4X65 H;  4X1Y B;  1NR1 A;  2YW2 A;  2WDT A;  2M05 A;  4BAY A;  3ZIA G;  4JV2 A;  3JAW A;  4I9W A;  4MVZ A;  3QWU A;  3SPC A;  1FXV A;  1XNR O;  4FFB A;  3HKZ E;  1SA0 B;  5IP9 G;  5KG3 A;  5IJ0 B;  2XGQ A;  4P2Z A;  3AG2 C;  4HZ3 A;  3BA8 A;  3M9M B;  4I55 B;  5L3G A;  4LFB H;  3WG7 B;  2WLI A;  3CB2 A;  1R3J C;  1M1K W;  3CCQ V;  1OBD A;  1IBM O;  1O75 A;  3JSL A;  4EGQ A;  2LJ2 A;  4TM5 A;  4X1I A;  1S03 G;  4NXN O;  1HR0 H;  1ZHS A;  2YZL A;  3TEK A;  3ETH A;  3D3I A;  4NB5 A;  2UU9 H;  1QCE A;  3WO1 A;  5GW7 A;  3RUP A;  4GKJ B;  4MV3 A;  3SNO A;  2QE7 G;  3TK1 A;  2VR1 A;  3AEI A;  4PD4 F;  2E5L B;  1VQ8 V;  1BHA A;  2QM7 A;  3GIL A;  3H9V A;  3TXS A;  3M9O B;  1Q8I A;  1PNL A;  2W9C B;  4O4J B;  1QHT A;  4MV6 A;  2CKZ B;  4O3O A;  3I56 V;  1X59 A;  2ZXW B;  3EVK A;  3T9A A;  5KT2 A;  5GON B;  2AQ4 A;  3GTQ A;  3RB4 A;  2ASL A;  1WB7 A;  1FXK A;  1JIH A;  3BY6 A;  1URF A;  5ITZ A;  2Y69 B;  1HP8 A;  1N32 H;  4MTO A;  5B1O A;  4O7N A;  3QZ7 A;  1H2K A;  2ETN A;  4J0M A;  2IH1 C;  4JI7 O;  4MA5 A;  3OE7 G;  3VA7 A;  1FD9 A;  5HBR B;  2R7K A;  3MWD A;  1MZB A;  3U55 A;  3SGI A;  2CNQ A;  5EBL C;  1I6U A;  4JI1 B;  5TIS Z;  3DTF A;  5CA0 F;  4XZ3 B;  2W6N A;  4LSA A;  3UCS C;  4ED8 A;  2R82 A;  3V4S A;  5BWW A;  1U97 A;  5J2T B;  1JJ2 U;  2JEF A;  1N33 H;  1MMM A;  2GQS A;  2VUG A;  4O84 A;  3MR6 A;  3SR2 C;  4UCR A;  4X66 B;  3F5T A;  1I94 H;  3ZRV A;  4YHH O;  3QF7 A;  3CRR A;  2R7N A;  5LGU A;  4QW8 A;  4NZO A;  1HNW H;  4KHP B;  2QYZ A;  1QVG U;  4DL2 A;  3IC9 A;  4P30 A;  2F4V H;  1M0T A;  5IWA O;  2R8I A;  2NVY A;  2BOB C;  5CB4 F;  3JSN A;  1M4U A;  5LGT A;  4RB3 C;  2VQF H;  1MA1 A;  4X62 B;  1YCI A;  4RQF A;  4FGR A;  1M6V A;  3HKC A;  4PZ7 A;  1ZUQ A;  5JH7 F;  4CE5 A;  1VP7 A;  2ZR2 A;  4ED6 A;  4Q0Y A;  1OBG A;  2EIK B;  3JAK A;  3G71 V;  3ZRW A;  1IVS A;  3H1H H;  3PW4 A;  1Y6X A;  2PMZ E;  4NZM A;  5KT5 A;  3AX6 A;  1QBZ A;  2R92 G;  2YZG A;  3DF7 A;  3P30 A;  4RB2 C;  4YR3 A;  3IC7 A;  5IYB G;  4O3Q A;  4JI3 B;  4DR1 B;  3CRC A;  1SQG A;  3JRX A;  3RYH A;  1K34 A;  3GTO A;  4TT3 G;  5EZY B;  4TV9 F;  2CTW A;  2VA2 A;  1XMQ H;  2IBZ H;  2XND G;  1E4E B;  4LFA H;  2UUA B;  2AGA A;  4JYA O;  2WLK A;  2QR4 A;  1HNX B;  1NI8 A;  1S68 A;  2DJV A;  1FJG O;  3TQ1 A;  4DO2 A;  2XT9 A;  2IM9 A;  3FKI A;  3K5L A;  4Q20 A;  1IBK B;  2Q73 A;  2YS8 A;  3RAX A;  2FK1 A;  2QGN A;  1R3I C;  5FD5 A;  2ZM6 O;  3KCX A;  4LF7 O;  4LFC B;  4IL6 Z;  4UCU A;  2DZD A;  3JZI A;  3MAQ A;  5KFI A;  4R8U A;  3RTX A;  1JOY A;  1YF2 A;  2A0L A;  3HKZ A;  4DR2 O;  1SF9 A;  3CRM A;  3LNM B;  1B04 A;  2HJF C;  2FTK A;  4O81 A;  4DV6 O;  1Y1V A;  3ASN C;  4DR5 H;  4ECX A;  2PYJ A;  1KUQ A;  2K1E A;  4DV5 O;  1XMO O;  1S10 A;  5LP6 B;  4FPP A;  3JAR B;  3LDC A;  4F4W A;  4IHJ B;  4EG0 A;  4GX5 A;  2RF4 A;  1BSM A;  2RDI A;  4B3T O;  4EB6 B;  1XRE A;  5D5Q A;  3QO5 A;  2A7W A;  3SYP A;  1R73 A;  2EIJ C;  2O57 A;  4NTY A;  3APO A;  4TV8 B;  2CZG A;  3KXY T;  1IBM H;  2Q67 A;  2L35 A;  4H37 A;  3ZN1 A;  5KAF Z;  1EUD B;  2IBK A;  4NXN H;  2P5O A;  1VIB A;  4LF5 O;  3K5H A;  4LBE C;  1J5E B;  1S77 D;  4O7Y A;  5KFK A;  5C3E G;  3K79 A;  3PJS K;  3ZMV A;  2W8K A;  2COI A;  4IR1 A;  1MNG A;  1OV9 A;  2M6Y A;  4GC6 A;  3T9E A;  1VQO V;  3RAQ A;  1VKZ A;  5I5Y A;  4AI8 A;  3C3T A;  1P16 A;  4WFF A;  2QWP B;  3GII A;  4QIW F;  2RGV A;  2UXD H;  4UV9 A;  1PX2 A;  4IAJ A;  5LL6 b;  1CKN A;  4O4L A;  4UCS A;  5C93 A;  2W7O A;  4LMY A;  2C00 A;  1WJZ A;  1T36 A;  1XIL A;  4JI6 H;  5L3F A;  1EYZ A;  1R1B A;  3VOU A;  3I12 A;  3VPB A;  4DXW A;  4JTA B;  3W7W A;  5D1O A;  5DG8 A;  3OR6 C;  2IP4 A;  1M56 B;  3X2Q C;  3K03 A;  5LXT B;  2YID A;  1BE3 H;  4UCV A;  2R84 A;  4BY7 G;  2JEU A;  1Y66 A;  5B3S B;  2DAA A;  1JFF B;  4JI7 H;  4G3I A;  2GQR A;  3U10 A;  3TW6 A;  4FM9 A;  2RN9 A;  5BMV F;  1BGY H;  2XAS A;  1DF5 A;  4W4K A;  1VQP V;  4JUZ A;  2FLL A;  4GT1 A;  2EIM C;  1K33 A;  4GYC B;  4X9Q A;  2CGO A;  2GPS A;  4UB8 Z;  4BBR G;  3Q8P B;  3HBL A;  2A1H A;  4JV5 O;  2UUC B;  2CNU A;  4Q4C A;  3E22 A;  4PEL A;  3V6K A;  1ZL8 A;  3H01 A;  4UFZ A;  4YHH H;  3KKY A;  4JI2 H;  2R86 A;  1V4Y A;  1R9T A;  5LMN B;  1TAE A;  3FX7 A;  4CKC A;  3JZ6 A;  2EZP A;  4DL5 A;  3HOX G;  1NU1 H;  4CH5 A;  4JZG A;  3B8N A;  5LL6 Y;  2PYL A;  3T5H A;  5L3E A;  1E1R G;  1Z2G A;  4J9M A;  2HHH O;  3ZMU A;  2PMZ A;  4O7W A;  4LF4 O;  5FLX W;  1N4C A;  1GN6 A;  2IU0 A;  4WBN A;  1FYJ A;  2HVS A;  1PM9 A;  3FYI B;  1RK5 A;  3K58 A;  3B8M A;  4FFP A;  1AVM A;  4AQY B;  1OCR B;  3SJB C;  4PWQ A;  4QIW E;  1Q6U A;  4O4I A;  1AIL A;  5KFR A;  2DW4 A;  2E3C A;  4WD3 A;  4MV4 A;  2VUM G;  4KUM A;  4O83 A;  5DGA A;  3R5F A;  2ZKO A;  3MJF A;  1YHQ V;  1S5H C;  4QWA A;  1YTF B;  2JA7 G;  1I0H A;  2EX3 A;  2V4Q A;  5KT3 A;  2WLJ A;  1LR1 A;  5CB4 B;  4YQW A;  4HR7 A;  1XBL A;  4TWK A;  4JYA H;  1ORQ C;  1IBL O;  4LF8 O;  3E35 A;  3FB6 C;  5B1A B;  5JVD A;  3HKE B;  2YWV A;  4ECU A;  4JI4 H;  4J9K A;  4A3D G;  4BIO A;  1FJG H;  4HNA B;  4GUN A;  1QLN A;  4A93 G;  3K06 A;  2P67 A;  3LNN A;  3N6R A;  4LF9 H;  3J7A U;  1MZF A;  3TII A;  4CKE A;  2EJ2 A;  1K1Q A;  3JAL A;  2ZDI C;  1ENV A;  5DED A;  4O2B F;  3FMA A;  5K2M A;  1SQF A;  2ADQ B;  5I5S A;  3ABM B;  1Y4M A;  4KFM A;  4QJF B;  4I4T B;  3LUT B;  3ABK C;  4TV9 B;  2JJ2 G;  3C0F B;  1Y76 A;  4OX9 B;  2XAH A;  5I5V A;  4ECY A;  2JA6 G;  5HFL A;  5KFC A;  1Y74 A;  1TUB A;  3L9D A;  2IMW P;  5JH7 A;  3R5H A;  2OCC C;  1QLE C;  2Z3Y A;  3U54 A;  1VBH A;  4EFE A;  4O7Z A;  4B3T H;  5I5T A;  1WP7 A;  3IAY A;  1GO3 F;  1VQN V;  2F43 G;  2QEX V;  1QU7 A;  3G6B A;  1OWT A;  3AG3 B;  5DEC A;  3KHG A;  2Q5Z A;  1KQS U;  5IY5 C;  4J9O A;  2Q7H A;  4LF5 H;  3AW8 A;  4O2A A;  4ZQI A;  1RJP A;  4F4X A;  1T3N A;  2YRX A;  2WAQ E;  3JAM W;  3OTO O;  2FLP A;  2OCH A;  3JAT B;  1W0K G;  1N36 H;  5DG7 A;  1JR9 A;  3W5O A;  1K5Q A;  3NBZ B;  2X6B A;  1GN3 A;  1M7J A;  3ML0 A;  2WE6 A;  3PR5 B;  5FNV A;  4X1K B;  3IGA C;  3RJ0 A;  1B3Q A;  4UCO A;  2IU3 A;  1GLV A;  1K5S A;  2E75 B;  4GX1 A;  2W6Q A;  4LWS B;  2COG A;  3VPC A;  5KG7 A;  5E25 A;  2W8L A;  4MTE A;  2EJ3 A;  4JI0 O;  5KHG A;  5KFG A;  5KAI Z;  2JDI G;  4LNU A;  4RCN A;  3T9F A;  3K3W A;  2H3O A;  3WG7 C;  4ECS A;  1NKD A;  3A0R A;  4X65 O;  2AU0 A;  5FLM G;  3L73 H;  3FAV A;  4A3L G;  2QK4 A;  3QO7 A;  2C35 B;  1N34 O;  2LFS A;  4FU0 A;  1WB8 A;  1TWA A;  4DAA A;  1LUV A;  3ZN0 A;  1KJ8 A;  1L8D A;  2QJ1 A;  4LCU C;  4F4Y A;  3ZHV A;  4B3R B;  2UVU A;  4PDM A;  3N2K A;  4FBU A;  1S5J A;  1AJP A;  4LFB O;  3RBE A;  1JCH A;  4JV5 H;  5C4X G;  3SDL A;  4M0J A;  2JRI A;  2ZR3 A;  2Y0P A;  3J80 W;  2WTF A;  2HVR A;  1GO3 E;  1JDE A; 
#chains in the Genus database with same CATH homology
 1P49 A;  5LXT A;  3RGZ A;  4KL1 A;  5KX5 B;  5IJ9 B;  3K3V A;  2W57 A;  2PTM A;  4ZHQ B;  4X65 H;  4X1Y B;  3RFR A;  2WDT A;  1JFF A;  2YIA A;  3JAW A;  2F66 C;  3QWU A;  3UT5 A;  4FFB A;  1SA0 B;  3L4J A;  5EOY A;  2Q7G A;  5BMV B;  1N33 B;  5IJ0 B;  2MCT A;  5J2U B;  2HHH H;  1TUB B;  3BA8 A;  4LF4 H;  4I55 B;  5JH7 B;  1HNW B;  4HBN A;  4DR4 H;  4LFB H;  1XHZ A;  5EYP A;  4FM1 A;  3VQV A;  3CB2 A;  3OTO B;  1WH2 A;  4RAZ A;  4K8X A;  3WB0 A;  5LOV A;  1O75 A;  1Z2O X;  3BPZ A;  3JSL A;  3RYF B;  4X1I A;  1S03 G;  5JCO A;  3FFQ A;  1ZHS A;  1HR0 H;  4YJ3 A;  4TOI A;  4JI1 H;  2UU9 H;  5C8Y A;  2O03 A;  4O2A B;  3NBY B;  5EZY A;  1XNR H;  4X64 H;  1M93 A;  4GKJ B;  2VQE B;  4RZQ A;  1ZHQ A;  3TY5 A;  4JV5 B;  1IBL H;  4LF8 H;  4X66 H;  4B3S H;  4JI0 B;  1ZAU A;  2E5L B;  1Z2P X;  4EQ5 A;  2HIV A;  5KHK A;  2Q7E A;  1Q8I A;  3ETQ A;  4O4J B;  1QHT A;  4X65 B;  3N6X A;  3VQW A;  4FLT A;  3RF2 A;  1XMQ B;  4X62 H;  2ZJT A;  3K5N A;  5GON B;  3KAJ A;  1N34 B;  4DR3 B;  2UXB B;  4DV2 H;  2V4D A;  5ITZ A;  2ZIN A;  3UQ8 A;  4DV7 B;  1N32 H;  1X4T A;  1TA8 A;  4RB1 A;  2YXL A;  2HHH B;  5EIB D;  4DR4 B;  4LFB B;  2YI9 A;  4CH4 A;  4FLW A;  4J0M A;  3HKE A;  5LP6 A;  2F93 B;  4X20 A;  3JAR A;  2XIG A;  4DR1 H;  1MZB A;  4NVP A;  3SGI A;  3RWR D;  3HKD B;  1HR0 B;  1I6U A;  1H2S B;  4EB6 A;  4JI1 B;  3N2K B;  4U3J A;  2UU9 B;  3RR5 A;  4ZOL B;  3BAA A;  2YCH A;  4WBN B;  4LSA A;  4DUY H;  4CC6 A;  2UUA H;  1XNR B;  4X64 B;  3CVZ A;  1Q43 A;  1GYF A;  1HNX H;  3BHP A;  3RYC A;  2VWK A;  4PI2 A;  2ZCE A;  5J2T B;  4O4I B;  2HIX A;  1N33 H;  2VUG A;  3SR2 C;  4UCR A;  4JI5 H;  4X66 B;  4B3S B;  1I94 H;  3QF7 A;  3TY9 A;  1Z5V A;  1HNW H;  5A2Q W;  4KHP B;  4YJ2 A;  2PUS A;  1L2Z A;  2F4V H;  1M0T A;  3JAW B;  1IBM B;  4GKK H;  4IIJ B;  3JSN A;  1M4U A;  4RB3 C;  3UT5 B;  2VQF H;  4FFB B;  4DUZ H;  4X62 B;  3ZED A;  2VOB A;  4RB0 A;  4DR7 H;  3HKC A;  1NT2 B;  1VF7 A;  4PZ7 A;  4DV2 B;  4DV4 H;  2HVQ A;  1G6U A;  1N32 B;  1XNQ B;  4Q0Y A;  3JAK A;  5DIS C;  5EYP B;  4DV3 H;  3MWM A;  5FD6 A;  4ZI7 A;  5KHH A;  5LOV B;  5CA1 A;  1T5E A;  3DF7 A;  4X1I B;  4RB2 C;  5LMU H;  4JI0 H;  4I50 A;  4JI3 B;  4TUY A;  4DR1 B;  2E5L H;  1SQG A;  3JAT A;  3N42 B;  1CKO A;  3RYH A;  5IWA H;  1WNS A;  2F95 B;  5EZY B;  4CS3 A;  5IT9 W;  1XMQ H;  4DUY B;  1TGO A;  2XHB A;  4LFA H;  2UUA B;  2GV9 A;  2Q2T A;  1N34 H;  4DR3 H;  2UXB H;  1FFX A;  1HNX B;  3K59 A;  4BW9 A;  2CAZ C;  4DV7 H;  1S68 A;  5FPO A;  4A2A A;  2IM9 A;  4JI5 B;  1I94 B;  3K5L A;  1IBK B;  4UCT A;  2P22 C;  4I7H A;  4BWA A;  2JGU A;  4LH7 A;  3T1Y B;  5FD5 A;  2F4V B;  4JI7 B;  4LFC B;  4PHZ A;  3W1B A;  4GKK B;  4UCU A;  3MAQ A;  4FLZ A;  2VQF B;  4DUZ B;  3W1G A;  3RTX A;  1WN7 A;  4CC5 A;  4DK1 A;  5ITZ B;  4GLX A;  4DR7 B;  1B04 A;  4DV4 B;  3M4I A;  1CKM A;  1WPB A;  4DR5 H;  2PYJ A;  3N2G A;  4DV3 B;  3NC0 B;  5LP6 B;  4AIL C;  4A2B A;  5EIB C;  5IYZ A;  4X20 B;  3JAR B;  4LF6 B;  4B08 A;  2OYQ A;  4L8J A;  3QG5 A;  5CA0 A;  4CS4 A;  4IHJ B;  5LMU B;  3BAB A;  4EFB A;  3N43 B;  4MV7 A;  4EB6 B;  3L4K A;  5D5Q A;  4KHP H;  5FNV B;  4U3J B;  1TVK A;  3HKB A;  1E4F T;  2ZM6 H;  4LF7 H;  5IWA B;  1SEI A;  3KXY T;  4FM0 A;  4TV8 B;  3RYI A;  1IBM H;  1Q5O A;  2Q2U A;  2WYO A;  5IJ9 A;  3RYC B;  4LFA B;  5KHJ A;  4M7E A;  4DR2 H;  2P5O A;  4NXN H;  1QQC A;  1J5E B;  4YY3 B;  4DV6 H;  4LR3 A;  3U0Z A;  1XNQ H;  5CB4 A;  2YIB A;  4DV5 H;  1XK5 A;  4YJ2 B;  4LNU B;  5KMG B;  1RSO A;  1XMO H;  3RGX A;  1P16 A;  2ZIO A;  3RIZ A;  1FKA H;  3GJX B;  2RGV A;  2UXD H;  4JI8 B;  4HNA A;  4IAJ A;  3HKC B;  5LL6 b;  4JI3 H;  1CKN A;  4O4L A;  2BTQ B;  5LMN H;  5JCO C;  4UCS A;  5JQG A;  4DV1 B;  4LMY A;  4F6R A;  3IG0 A;  2R70 A;  1Z5W A;  3JAK B;  2PZS A;  1AN7 A;  4BWS C;  4PI0 A;  4DR5 B;  4I9Q A;  1HW7 A;  4JYA B;  4ZI7 B;  4E6N A;  2BTO A;  4O2B B;  2VWJ A;  4JI6 H;  5CA1 B;  4EEQ A;  4FLU A;  4DV0 H;  4D7T A;  4K8Z A;  1FJG B;  4MTD A;  4AQY H;  5D1O A;  4FVM A;  4TUY B;  4I4T A;  4TV9 A;  4B3M H;  4K0K B;  5LXT B;  1IBK H;  4UCV A;  3RYH B;  1JMK C;  3CSX A;  3T1Y H;  2ZM6 B;  4LF7 B;  1JFF B;  4JI7 H;  4LFC H;  3J7A K;  3U10 A;  4FM9 A;  4O4J A;  3A2F A;  4LSX A;  1V9P A;  4DR2 B;  4NXN B;  2UUB H;  4GYC B;  4DV6 B;  4CS2 A;  4DV5 B;  1XMO B;  4FLY A;  3N44 B;  2Q0A A;  2UUC B;  1M5I A;  3E22 A;  2PGG A;  3JAS A;  3GB8 B;  4LF6 H;  3S24 A;  5LP6 C;  1BJT A;  4UFZ A;  2UXD B;  4ETS A;  4YHH H;  4JI2 H;  3K5M A;  4PZ6 A;  1BGW A;  4YJ3 B;  2CW8 A;  5C8Y B;  1TAE A;  5LMN B;  3WB2 A;  2YI8 A;  4CH5 A;  2RQ6 A;  3PN1 A;  1FVI A;  3N2G B;  3WB1 A;  2PYL A;  4LF5 B;  4X1K A;  4JI6 B;  1SKV A;  5IYZ B;  5FLX W;  3N41 B;  4WBN A;  2UXC B;  3TY8 A;  1J5E H;  4DV0 B;  2HVS A;  2YIB D;  4YY3 H;  3K58 A;  3B2E E;  5JJE B;  3SJB C;  4AQY B;  2CW7 A;  1XQ8 A;  4B3M B;  3CHX A;  4O4I A;  4DR6 B;  5LA6 A;  1TVK B;  3HKB B;  4DK0 A;  4PZ8 A;  3KAL A;  4ZIB A;  3RYI B;  3RGB A;  2E3C A;  5LYJ A;  4TQF A;  3HXL A;  1YEW A;  5D5P A;  3VQY A;  4DRX A;  1Z2N X;  4JI8 H;  3N40 P;  5BR8 H;  3U11 A;  2EX3 A;  4IIJ A;  2UUB B;  4APM A;  1XDN A;  4DV1 H;  5CB4 B;  3OTF A;  4FM2 A;  4JYA H;  4TQD A;  5JVD A;  3HKE B;  4JI4 H;  1DGS A;  1FJG H;  4HNA B;  4LF9 H;  3LNN A;  4K0K H;  4O4H A;  1CKN B;  4O4L B;  4YHH B;  4JI2 B;  5JQG B;  5JJJ B;  4F6R B;  3JAL A;  2PY5 A;  3DSQ A;  3FMA A;  2R9A A;  1SQF A;  3L2P A;  5KX5 A;  1D5A A;  4ZHQ A;  4X1Y A;  5K1X A;  1SYX B;  4NXM H;  4D7S A;  1P8L A;  5D1O B;  4I4T B;  4TV9 B;  1XHX A;  3LML A;  1KU9 A;  1SA0 A;  3SJC C;  3C0F B;  5BMV A;  3BA9 A;  5IJ0 A;  4OX9 B;  2UUC H;  3J81 W;  4PDB A;  5J2U A;  3EYY A;  1TUB A;  3THO A;  4I55 A;  5JH7 A;  4R7R A;  3K5O A;  4EFE A;  5BR8 B;  4B3T H;  3IAY A;  1VS0 A;  2ZNJ A;  1A0I A;  5JJN B;  1HNZ H;  2ZIM A;  3RYF A;  3SJA C;  4RAY A;  4DRF A;  3KAK A;  3ICX A;  3VNN A;  4B3R H;  2Q7H A;  3E22 B;  4LF5 H;  2HGS A;  2JVD A;  3JAS B;  4LF4 B;  4O2A A;  2R72 A;  3VQX A;  2UXC H;  4JI4 B;  3K57 A;  3JAM W;  4I50 B;  2F1M A;  4LF9 B;  3JAT B;  3T1H H;  4DR6 H;  1N36 H;  2JS5 A;  3W5O A;  3NBZ B;  3F8N A;  4IHJ A;  5K1P A;  2WE6 A;  2FE3 A;  5FNV A;  4X1K B;  2CFM A;  1FFX B;  3RJ0 A;  4TV8 A;  1XI1 A;  2RJZ A;  4UCO A;  4NXM B;  3QTC A;  2KKW A;  1I7F A;  5GON A;  4MV9 A;  3ZS8 C;  5LA6 B;  3H20 A;  1IBL B;  4LF8 B;  5LYJ B;  1X9N A;  1Q3E A;  4Q6G A;  4MTE A;  5KHG A;  2RGR A;  4DRX B;  4FLX A;  2VPS A;  4LNU A;  5KMG A;  3OTO H;  3GDE A;  2HEP A;  2OWO A;  1O9G A;  1JJO A;  4B3T B;  1HNZ B;  1O9H A;  1KMI Z;  1L8D A;  2QJ1 A;  2BTQ A;  3HKD A;  4B3R B;  4AHC A;  5JVD B;  4CH3 A;  5FPR A;  3KYH C;  3N2K A;  3M7M X;  4ZOL A;  5D1P A;  4CH6 A;  1S5J A;  5CA0 B;  2KSW A;  5KHI A;  2VQE H;  4O4H B;  4FLV A;  4GKJ H;  4O2B A;  3BRC A;  2ZNI A;  4JV5 H;  1E4G T;  5J2T A;  3T1H B;  1N36 B;  3JAL B;  2QM4 A;  4OX9 H;  1M0W A;  3J80 W;  2HVR A;  4LH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...