1EUCB

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
394
structure length
393
Chain Sequence
MVNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
total genus 132
structure length 393
sequence length 394
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1eucB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1eucB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucB03
1C3OA 2GQSA 1CQJA 2XD4A 4ZHQF 1IOWA 2NU7A 4FFPA 2PBZA 4FFNA 2I8CA 2YW2A 5JQGF 2NU9B 2W6MA 4NYEA 5JVDF 1W96A 1EZ1A 3JRXA 3JRWA 1UC9A 1KJJA 3AX6A 1I7NA 3KAKA 1PX2A 1JDBB 2FPGA 3TIGA 4MV8A 4Y8VA 4EGQA 2R7LA 2W6QA 3U54A 4MV3A 5C8YF 1B6SA 3RV4A 3PFFA 5FNVF 2DZDA 2HGSA 5JVLA 1GSHA 3G8CA 3N8DA 2R84A 2VQDA 2FPIA 1OBDA 3R9RA 4O84A 4YB8A 4IZOA 5DMXA 4HNTA 5LP6F 3OUZA 2VR1A 3NUAA 3Q1KA 4L1KA 1CE8A 1B6RA 2C00A 2NU6A 1JLLB 3JZIA 3VA7A 2FP4A 1KUTA 4YAJB 5EZYF 2CQYA 4MV9A 4FFLA 2CNQA 3AW8A 5LXTF 2PVPA 5BMVF 2GQRA 4XYMA 2P0AA 2V59A 3GIDA 3MJFA 2ZDQA 3ORRA 5CAEA 1UC8A 1VBHA 4FFOA 4O7LA 4O4LF 2FPPB 2I87A 4EG0A 4XYLB 4O7TA 1JKJB 4I55F 2HJWA 1KJ8A 2I80A 5CA1F 4DIMA 3U55A 1JDEA 4O7ZA 1BNCA 3WO1A 1EUCB 1WR2A 4O81A 4XZ3A 2J9GA 3U9SA 2IP4A 5HBRB 5BPFA 3R5XA 2GPWA 2Z04A 1IOVA 1CQIA 4O86A 1W93A 2NU8A 2GPSA 2CNVA 1M0TA 4YAKB 3VMMA 4O82A 4MV7A 4YBZB 2R82A 4FFRA 2YZGA 4HR7A 2SCUB 2W70A 4IHJF 3RFCA 3TINA 1E4EB 4MA0A 3RV3A 4QSHA 1EYZA 3K5HA 2GLTA 4HQ6A 2NU9A 1EUDB 1VBGA 2YV2A 3K5IA 5J2UF 3ORQA 4DLKA 5KKNB 2CNUA 2R6FA 4O2BF 2Z02A 2X0SA 4ZOLF 4YJ3F 3MWDB 2W6ZA 2R86A 1SCUB 5H80A 5I47A 4O7VA 3I12A 1KJ9A 1M0WA 3KREA 4O4IF 5D8DA 2YS7A 4RZQA 3E5NA 2DIKA 5K2MA 4FE2A 1JLLA 2YZNA 3GLKA 4TV8F 3R5FA 3MWEB 4HNVA 4YAJA 4FU0A 2CZGA 4XX0B 1EHIA 1C30A 4C5BA 2R7NA 5KX5F 1M6VA 1OBGA 4WD3A 2R7KA 1GSOA 5CA0F 3UFXB 3KALA 3WNZA 4YJ2F 5JH7F 3HO8A 5CB4F 4O2AF 4O4JF 5J2TF 2FPPA 2CSUA 1KJIA 2V5AA 2V58A 4XYLA 3VPDA 1JKJA 2NUAB 5GONF 3Q2OA 1VKZA 4O83A 1ULZA 1CQJB 1EUCA 5LOVF 4IWYA 4ZI7F 3ETHA 4E4TA 5HBRA 2NU7B 1DV2A 3R23A 3U9TA 5HV6A 1AUVA 2VPQA 3ETJA 2W6NA 3JZFA 5LA6F 3V4SA 4M9UA 1KJQA 5JQWA 3KAJA 2YZMA 5LYJF 1A48A 3R5HA 3VPCA 4FGRA 1BXRA 3BG5A 4YAKA 3TQTA 2FPGB 2QF7A 3DMYA 4YBZA 4HNUA 4Y8VB 1I7LA 4TV9F 1Z2OX 4O7WA 4O7NA 2SCUA 3TIIA 5IYZF 3LP8A 1E4EA 2YL2A 5C1OA 1KBLA 4MV4A 4C5AA 2DWCA 1OI7A 2ZDGA 2DLNA 4MAMA 2YRXA 2YYAA 3RUPA 4IWXA 1EUDA 2YWVA 3N6RA 2FPIB 1KC7A 4YB8B 4O7SA 3SE7A 5BPHA 3OUUA 2NU6B 2YS6A 3QFFA 4O4HF 1PK8A 2FP4B 4IIJF 4MV6A 3MWDA 1AUXA 2WYOA 2R85A 2W6PA 1SCUA 1CS0A 5C1PA 4XYMB 4I4TF 3TW6A 1T36A 4MA5A 3HB9A 3VOTA 1Z2NX 1DV1A 5CAEB 2ZDHA 3MWEA 1A9XA 4XX0A 3VPBA 3V4ZA 2OLSA 2YRWA 4EGJA 2FB9A 1KEEA 3DF7A 4MV1A 2R87A 3G8DA 4ZQIA 1Z2PX 1GSAA 2YV1A 4XZ3B 4O7RA 4C5CA 4WBNF 3LWBA 3K3PA 3UFXA 1GGOA 2YZLA 2XCLA 3WO0A 2W6OA 4TUYF 1CQIB 2PN1A 1GLVA 2NU8B 1DIKA 2W71A 2QK4A 4O7YA 4FFMA 4I50F 3HBLA 2NUAA 2R7MA 4ME6A
chains in the Genus database with same CATH superfamily
3L6RA 2ERYA 1U3GA 4FIZA 4H7FA 5IVHA 2ZWAA 3KHLA 3NONA 2O7SA 4ZCMA 5A9SB 4PX2A 5KFFA 2IBKA 4GC9A 1VL2A 2GK3A 1RM4A 2FHPA 3IHWA 2PZMA 1PQ4A 4QUBA 1PX2A 3DM9B 1Z0IA 3NTQA 3JATA 4GM0A 2XQIA 1OFGA 3E2MA 2AW5A 1DG3A 4CQNA 4EPXA 3AUSA 3PGJA 3LWZA 1F6WA 3RK1A 4DIFA 4ZDKA 2IXFA 1XELA 1ZVJA 1NU8A 3QVJA 1J8MF 5LD2C 1J33A 2OCIA 5DMXA 4RWZA 3G85A 1NFFA 2HGZA 4YLYA 3PV0A 3CV3A 3PQFA 4DIBA 5HPYB 2V4ZA 1KGDA 4UMFA 4RPCA 2BSAA 3TLJA 1TTTA 1V3VA 3DFUA 1J21A 2CQYA 5IMBA 2JLZA 4JASB 3LQRA 3RM3A 4HLDA 2K5UA 5C37A 3RJMA 2GM4A 1ISFA 2PKQP 2CXUA 1JWLA 1EXNA 5MGNA 4H7PA 2BKVA 4CDMA 1X7YB 1MG5A 2YFKA 3N1UA 4JC8A 1FCJA 1ESZA 2RGAA 1V8DA 3DBIA 1ZUWA 3AKYA 3OPQA 2WT9A 2ZIAA 1S89A 3RW9A 1XQ9A 3VZCA 4QNRA 5K3FB 1U31A 2O5EA 2Z2IA 4WZAE 5IF3A 1N36B 3HACA 4A1FA 2IU6A 1I2DA 3QKIA 3NC0B 5EINA 4ZXPA 3JAKB 3K5HA 4CN9A 1YL5A 4I2NA 4LGYA 5CK5A 1IY2A 2QN3A 4I8DA 4D9EA 2GN6A 3E3NA 3DL4A 3MJSA 2J32A 4A26A 3OOHA 5AK6A 2X0FA 2PPLA 1X8JA 5AI4A 1F0PA 1BDIA 4F86A 5G3ZA 3SOPA 1SMKA 5HX7A 4TSFD 1FRNA 4DSTA 1DXOA 1QVAA 5F7XA 4J0JA 4G4JA 4IFTA 3X2FA 3E82A 4BNVA 3U39A 4ZIRB 5EZQA 3OZUA 2EFGA 5AJVB 3F7OA 4DCMA 2FSPA 1H42A 5I5WA 1BMDA 3MMSA 2BCGY 5IT5A 3O4IA 4IWNA 4LMRA 5ES3A 2WNSA 2HZ7A 5UKDA 1UC5B 1FLDA 2W2KA 1PDVA 1I7DA 4A3JG 2AN3A 4J9OA 5KIAA 2QD1A 1G5FA 2IODA 3I09A 2IXDA 1GTL1 5KO2A 4JQZA 5HNKA 4YR9A 4YYEA 4ZA2A 5HBRA 1FYEA 1PGPA 3QBJA 1GO2A 2O8VA 1XPUA 2YVAA 4ENPA 1JEJA 3L92A 1IZ7A 1VJRA 5JWRA 4ADSG 5FA8A 1LBSA 4QTXA 1SVLA 4YP9A 2QN8A 2DWUA 1G3MA 2NGRA 1P7VA 1W4BA 1R12A 1PL8A 1SXJB 1RMTA 4UHJA 3UA3A 1XKTA 4E2XA 2ATLA 1BGWA 2MSDB 3ASUA 1J24A 3VV3A 3LGXA 3RARA 4TXNA 1OZGA 4DLBA 1XF9A 3CB2A 5EKTA 1BTOA 5AKYA 1PNTA 4FMDB 4MPPA 4CHTA 3AUYA 4UOEA 4UEKA 4WZAA 3K8YA 1LLDA 3DVAB 5ARBA 4RGVA 2VYND 1U7UA 2ILVA 4J0MA 3OTOH 1FSFA 3HM2A 9ABPA 1E1CA 1D2HA 1FUKA 3W5IA 2LRHA 1NF9A 1P1HA 4G0MA 1OROA 2CJWB 1UM8A 2P6MA 2EXXA 5TARA 2WVHA 4J9RA 3GELA 3TTSA 5I7FA 9GPBA 3U16A 5DG9A 3C7AA 4PVCA 4Q24A 5EWJB 3D8TA 3WXMA 2A0UA 3KQNA 2RGXA 1PZGA 2XHEA 3P9ZA 3PIIA 3DHYA 2WWGA 5AHWA 3QU2A 1U0FA 4K2HA 3WG9A 4AJKA 4JP8A 3QJGA 3BF8A 2ATCA 5ALJA 1CR4A 2ZUTA 2F55A 1L7MA 4R8VA 1AA9A 4F2GA 1SBQA 2I22A 1CDOA 2PR2A 4C4TA 3CLTC 3GEPA 1FS5A 4HWOA 3HU1A 5ALTA 2Q5OA 2ZJOA 4TVBA 1B3BA 3TLCA 4X8HA 3VUEA 2XA2A 4B80A 3Q0TA 2X7XA 1PUJA 4D9BA 1JDBB 1J8FA 3AJEA 3GN2A 3KR2A 2E4UA 4FLMA 2JLCA 1LFDB 3U54A 1WXEA 3HOWG 2PJDA 4Q6BA 5H9VA 2JVIA 5JD3A 1GA1A 2Q1SA 2XA1A 4HEHA 2JBWA 1F2TA 2R84A 4MRPA 5CGQB 3R09A 3WLIA 5HIAA 4BP1A 3KTDA 3SOZA 2JNWA 2HA0A 4RWEA 4RHCA 4WFKA 3KEMA 4O2AA 3EQ2A 4JY7A 2R8XA 4JLJA 1E2NA 3U3KA 2WI8A 3LXMA 3PUWA 1X9HA 1T3ZA 4NBLA 3HL0A 3CUEF 3O95A 4X62H 2NAFA 3C5HA 1A88A 5EWGA 5C46F 2O2DA 3WS7A 1OU4A 2P6UA 1N0UA 5AOBA 1QG2A 1JJ7A 2ADFA 1JDEA 1GITA 2ZVJA 5IEBA 4UBMA 3CVOA 5H0IA 2PM8A 3ETCA 2YNMA 5CBKA 1Z56C 4IZIA 2JA6G 2QUZA 1IHPA 3G9UA 2FGJA 2DQKA 4JLKA 4HXEB 5JFGA 1T8YA 4YBZB 5BORA 4OBEA 3DAGA 3RV3A 2DFVA 3U7FB 2GRAA 1EYZA 1VLLA 3DEKA 3K0SA 5I5EA 2X13A 4Y0VA 1KY4A 4LXIA 2TYSB 4S0XA 1N7GA 3K1TA 3GT7A 4WY5A 4K03A 2FW8A 5LR6A 3UYKA 1T5HX 3OKFA 4CQJA 2WSYB 3SEAA 1VI2A 1QYDA 4BB6A 2ZVDA 2G8LA 4BAUA 1Y6JA 4M55A 3PICA 1B26A 4HVCA 4KX3A 5C51B 3L8CA 3NCTA 3H17A 2O05A 1GP2A 3WL5A 1CUBA 3H0GA 1GDDA 3W8DA 4S2EA 4IDQA 3GIPA 2FE1A 2BTEA 2O7QA 3MIZA 2B2CA 1S2GA 1U2DA 3AFHA 3H2KA 5B6PA 5JXIA 1XPOA 4RESA 4L7QA 5DN9A 1O5OA 4ON9A 3E7XA 1EWYA 2RHWA 3Q8XB 4M88A 4BBRG 4M9RA 5DVZA 1P0IA 4P36A 3TG2A 4QOIA 5DYIA 1K6MA 1ZM9A 1T91A 4ZCIA 3E22A 1XG5A 1U8CB 4XDHA 2PWBA 2VCHA 4GMHA 4M0UA 4Y2RA 1DBSA 4LYJA 2FMKA 2WWHA 2GN2A 3FDXA 2R97A 2PFKA 2ZWPA 3JATB 4UHCA 4X65B 4AMZA 3JQFA 4RGQA 4KQ9A 1FFWA 2BR5A 3KXLA 1WMBA 1PHPA 4TLAA 4M8LA 1ICIA 5FD6A 3CH6A 5EFOA 1BFKA 2W93A 4F4IA 1WXFA 2ZAOA 4EKEA 1GTSA 1IZ9A 1MORA 5JJKA 3BXZA 4J16A 4UUBA 1V35A 4WA8A 3EQ7A 5HA5A 5HTKA 2J3QA 3KXDA 1EUQA 3ZS8A 4JX9A 3EC1A 2DHQA 5C4IA 2E48A 2KBEA 2WHQA 3P0IA 1U8XX 1JP7A 2AN4A 3ZKAA 1V7PC 5T64A 3A2LA 4HS9A 1YC5A 2Y66A 4W6ZA 1PD0A 3NHFA 1IONA 4LZPA 1FQWA 5IJAA 1RJFA 2HCBA 3GPCA 1KE2A 4ZCQA 2LWIA 4FWBA 2VH5R 2WWFA 1IY0A 3VU3A 1G1AA 2JLVA 3ZWVA 3LQSA 2GFIA 1E5TA 4OLBA 2Q8NA 4AG3A 1WJGA 3DWFA 1XK5A 3SSNA 1E1YA 4YRLA 4U7JA 1KWGA 3OSZA 3QWIA 3OVMA 2ISQA 3SZOA 1YL7A 3DE1X 3TL6A 1N56A 1SBZA 2BOVA 2W6MA 4LFBH 1EZ1A 1KO5A 4D8YA 4GXTA 4TSRA 3UHPA 1KI1A 3UT6A 3CRZA 4PLGA 1WP4A 1V4NA 2I6QA 2QLBA 1IN5A 1QKIA 1EA5A 3GBPA 5NLLA 2V65A 1LW7A 3OE7D 5K1ZA 1XNQB 4Z1MA 2A4KA 3PHCA 3WQHA 3DV2A 4G5RA 1HI9A 5TQJA 2QOEA 3EQ8A 3DKIA 4NJMA 2ZTUA 1ZOLA 3DMHA 2OXFA 2ON6A 1PJAA 1S2OA 5A4DA 4QW9A 1XWFA 2OHFA 4WDQA 5E4YA 5E1BA 1CHNA 2W2KB 2JA1A 5ADUS 3ADKA 1SWVA 1WF3A 3LAWA 3TBHA 2DETA 2DPGA 1P77A 4MMYB 1K7YA 5HBRB 1Q7BA 1T9GS 4LE1A 2VA9A 4DKXA 1I4TD 2F59A 3VDMA 1RHQA 3LU1A 4E4YA 1EE2A 4DLPA 2J45A 3GXOA 1R15A 3V1TC 2D4HA 4B17A 4Z49A 2XCUA 4JC0A 1FMFA 4FFRA 4BAGA 2OO7A 1EFDN 4EHBA 4HQ6A 3PNLA 1KRXA 2ZTMA 4MWSA 4CL0A 5CURA 5DNUA 3LPNA 1L5VA 4NCJA 3WIUA 1OBCA 2JGAA 3MERA 2V8BA 4WZAB 3EDQA 1QNFA 3U4HA 5EQDA 3BXEA 5DHFA 1KK1A 3DCIA 1PUIA 1CUDA 1E1CB 1Z4PX 6YASA 4FE2A 3NUQA 1N6PA 5L3VA 3O31A 1K4KA 1U8FO 2Z2ZA 1CZUA 3PFWO 3TNDA 2NVXA 2FKNA 4DXDA 4E5UA 4KI7A 3EHDA 3OUTA 1Y63A 1EVJA 5DW0A 3ENWA 3UTDA 2XSZD 1YI0A 4W8OA 3Q2OA 5JNSA 4GMFA 1PF7E 1GRRA 1M2KA 2B7CA 3A1NA 4IWYA 1DAHA 1XN4A 2WNHA 2PNFA 4KWCA 5CFQA 3ROPA 1JVNA 2NO0A 3PLAE 1L3BA 3N3AC 4QBFA 4XOUA 5IM4A 5EJ2A 2Z8ZA 3HYLA 1WF6A 3AB7A 4ISBA 3R44A 4MW5A 3DV9A 3Q9SA 4G5GA 1N2CE 2RHDA 2Y3IA 3CZ4A 2P1RA 3VR0A 1F2TB 3MJ4A 4IX9A 1SURA 1XDGA 4B4DA 2JHCA 3CW9A 4O2AB 4FW9A 2XHZA 2XODA 3PIRA 5LZ4A 4NAVA 3VH1A 5JWOA 2H4JA 4J07A 3EIHA 1JHVA 1XR3A 2N1MA 3NHMA 5L4LA 1N9GA 1USVA 1GLGA 4N47A 5ALHA 3T4UA 2R60A 3NBYB 1QH8A 4TN1A 2UZ1A 2ZRMA 1RC1A 2FPOA 4RZRA 2GBIA 1QCYA 4KQKA 1NMYA 5C3EG 1FE8A 2HLNA 1T35A 5K01A 1CUVA 2QZSA 2H4YA 1KYTA 2G36A 4C07A 4KLRA 2VQEB 4MWOA 2H1OA 2ZI6A 2GPNA 4HADA 1H22A 2FY8A 2GM9A 1MQSA 3W5SA 2YMMA 1GQYA 2JDID 5COAA 1K7SN 4DVGA 1MJGM 3GOQA 3X3HA 5ERXA 5TB5A 5AIBA 3UKDA 4OHPA 2I8CA 2GGSA 3ZQKA 1Z2DA 3CW8X 3TN7A 3IAHA 3TDNA 4Y2TA 2JHAA 1KARA 5H70A 4FBMA 3JCZA 4J2HA 5B1EA 3H97A 2LZ0A 1NVFA 1UP4A 2KYRA 2JF0A 4RF4A 3A6ZA 1ABFA 4I55A 5CA0A 9MHTA 1JFLA 5F76A 3N59A 3EIUA 4L57A 2IU0A 1Z4KA 4ZVSA 2ZSBA 3ER9A 5EJ6A 3JW8A 2RCNA 3QTTA 2H4WA 1B8NA 3L0PA 4YP1A 3D8BA 1OZFA 1N2CA 3AB8A 3I5MA 1RWBA 3VX3A 4G5HA 4ZI7A 3AJ9A 3EZ6A 3HWWA 4IUCS 4Z5XA 3OE4A 4ZU3A 3G6KA 1Z62A 1SC6A 4OX9Y 3AFMA 3E22B 5HIMA 1NY6A 3KWJA 2A4MA 3FYUC 4JJKA 2HHCA 2HDHA 2J33A 4QJ4A 1ZJYA 3BMCA 4EABA 3AM4A 1HGXA 3DE0X 5KDDA 4I08A 1ONOA 4W63A 3F9IA 3ZU2A 2WB1E 4WOPA 4HJRA 5IANA 5KSZA 3N70A 3D4BA 1XNJA 2QXTA 2G6TA 1KYWA 4DMMA 1E77A 3BRWD 4TL9A 5JNRA 1Z8FA 4CDRA 3SP1A 2GLTA 3A4TA 5SYAA 1SA0A 4LS3A 3K0CC 3OJOA 2PRYA 2VDWA 5FV4A 4DV0H 2HU7A 4JAVC 4MJ3A 5PNTA 4FSXA 5D3ZA 2C2WA 1RI1A 1A7UA 4CMEA 1Z08A 1GG9A 3T7KA 2VDRB 2FWNA 2ZJ4A 3R3WA 3QEKA 3VHRA 3LNTA 5G1NA 1CNEA 1WG8A 3JQ9C 3T15A 3IG0A 5EIHA 4O7VA 3W8NA 1UC4B 4OOEA 4BO5A 4OU4A 4Z8YA 2I3DA 5L6MB 1XTZA 1RMYA 1S4MA 4YS6A 4RCNA 1A9QA 4M1ZA 1SIWA 3T5JA 2PJRA 4DLLA 2G06A 3D4IA 4W82A 2X8LA 4R5MA 1ZPDA 1ZW6A 2BUAA 1XLTA 3SDSA 3EEIA 1QUEA 4DBLC 1YB7A 2OQRA 4A82A 1QYVA 3W5OA 3C5VA 3SYMA 3BPSA 3NIFB 3ZPXA 3HM9A 4PM4A 1KMMA 1B0PA 2R6R1 3BSWA 2J6IA 5BNWA 2WWVD 4CE5A 3IEIA 4IRMA 1Q19A 1A97A 4MRRA 3FOAA 4HC4A 4J1NA 4BO7A 3THRA 3RSSA 1I5OA 1NQUA 2Z6VA 2QA5A 2MR5A 4RQTA 5TX7A 1LNQA 1M8JA 2HB6A 1E4EA 1RVDA 3ROKA 3MUOA 2A9QA 2JVKA 1QVVA 4GR4A 4FONA 2AYXA 1THTA 2H2HA 2FWRA 3BJIC 3N6RA 5DP2A 6ABPA 1CR6A 2YJ5A 1GTVA 5FPTA 1HZZA 3UH0A 3HGTA 2WB1A 8ADHA 1WMSA 4M8KA 1YCFA 4ZALA 1DCMA 1SEVA 2V6MA 4OUDA 3CUUA 5ICEA 1NBOA 4NJMB 3BH7A 3VR1A 4AF8A 2ZYTX 3GVHA 2D0PB 3T9FA 2ICAA 5KMGA 3V6MA 2AMYA 2MINA 3S2SA 4FHDA 1UKCA 1WMAA 3H84A 2DMRA 2UYCA 4MGZR 3CGWA 3KDSE 2VRCA 2FTKE 2Z5GA 2QV0A 1M0EA 4LBWA 2P2NA 4CG3A 2WJGA 1JDNA 4A2PA 1ID8A 4M4SA 1DLIA 4MRNA 4AYBE 3B8HA 2XVAA 1F2DA 1FNBA 4QTZA 4I5EA 1KHTA 2H3EA 5CLIA 3ZWPA 3KTAA 5IN4A 4DL6A 5C53B 4DR3B 4ETNA 2C29D 2GVDC 4B82A 1KQ3A 4JI4H 2DPLA 2IPNA 3IP1A 3R6DA 2EIHA 1X86B 1HNZH 1DT5A 1PR6A 3ELWA 3OQHA 1CJSA 3IKMB 1KDOA 3OZBA 2RC5A 4MIYA 1FVXA 2DY0A 1DLJA 5E0OA 3PDUA 5IMSA 4BWYA 2UZ4A 3BFJA 3V4FA 1QZUA 3NV7A 1KYYA 2IYZA 4RPHA 3HJRA 1BJKA 4OKNA 2H2AA 3I9NA 4LX0A 1PFWA 2I2FA 1YASA 4OMUA 5K0TA 5LYYA 2OC9A 5ADHA 4ALNA 3FPKA 1JJAA 1VLVA 4K9NA 1JBEA 2GH1A 2O3JA 3KD2A 2J6UA 4MVJI 2VDMB 4ZT3A 3WZLA 2V7TA 4CTOA 3QH4A 3T3DA 1CJCA 1VBMA 2ZREA 3HK2A 4RZ2A 1J07A 5HUHA 5DHRA 1WE2A 1WAMA 2ZYVX 4O3PA 1HTTA 4FTWA 3T95A 3GH1A 1YXMA 1TDJA 1EDOA 1JWBB 1EJ6A 3OIUA 3AY7A 5KFGA 5LUBA 4CL8A 2IXAA 5DGIA 4B84A 3E9EA 4FZJA 2OCYC 4GI7A 3LA8A 1XRQA 4IDAA 4Q7EA 5JDIA 3PJRA 4URFA 4DR2B 3SBDA 2PYZA 4UAGA 3KPJA 3SJBA 1S9HA 2WJAA 2ZAYA 2NU9A 5F2OA 3RVJA 4MK4A 4Q3LA 5INTA 1C8VB 3IUMA 3SS7X 4YCNA 2D1QA 3DF9A 4OMCA 1I6UA 1Q3TA 3ZHQA 4AYBA 4LQ4A 5K3DA 2HBRA 2AE2A 2OL4A 1N9GB 4RO0A 2FMFA 1TZ2A 1HE5A 1QH8B 2M32A 3FYHA 3N6VA 3N8NA 3HR7A 2IYVA 4U63A 2UZ1B 4I5FA 4CETA 4IHKA 5FR2A 5AR1A 3PGKA 1QP7A 3U7QA 5HWSA 3AEXA 1R8QA 2I1VB 4BQOA 2N0SA 4HB0A 1YB2A 3ITNA 4DAOA 4KLZA 1GL7A 5SZIA 1PFYA 4E51A 4BZZA 5DB4A 1G4HA 5DLEA 3CUWA 2DUNA 2BGGA 1MEJA 3QELA 5ALOA 3WKBA 2KJQA 4DCJA 3ICEA 3T5BA 3BXFA 2GXUA 4MICA 4IGKA 4M1OA 2E21A 2D74A 1TZCA 4BRWA 5LWQA 4GW3A 3QOFA 2YY5A 4Y0AA 4BNLA 1VSTA 1M1YE 1X15A 5DZSA 2VCEA 4DV5H 3ZGYA 5I5YA 4F1WA 2IYFA 5DV9A 3D6HA 2ZRGA 2XYVA 4HDNA 2VNAA 2C5AA 4RTJA 4J9VA 1Q1BA 4MUBA 4XCQA 1QO9A 2QB5A 3QUQA 3D0RA 3KV3O 4BX0A 1Q6YA 5KAPA 4HWRA 5BQFA 1GNVA 2XGJA 2Y9MB 3FHOA 3RUFA 2DPHA 3USES 4F8EA 1TB4A 3L7OA 2C4MA 1XMOB 4H3VA 1UKAA 3ZLJA 3HI6A 3NIGB 4I55B 5CA0B 3I45A 4Q9DA 4B4VA 1W25A 5F9MA 4UTNA 1WXXA 1HNXB 5BWOA 3V97A 4BVJA 1U9YA 1V6SA 3EWNA 4MV6A 3FKIA 2C2GA 2HW8A 1ZK2A 3GO4A 1N2CB 3QPAA 1AS3A 2IY7A 2IEZA 5IKOA 3TW6A 2JHPA 1FXWA 2OH2A 5DN6D 3D1VA 2XRMA 1KYQA 2XKBA 3MFHA 4ZKDA 3OKCA 4DR5H 1IJBA 1OIWA 5FL3A 5MN5A 5JBQA 1VXRA 1JNYA 5KCZA 3P0FA 1W5FA 3QFCA 1TJPB 3GJ4A 4TMZA 4CU2A 2AQKA 4ZMSA 2B36A 3BMCB 3P4UA 5EY5B 1U7XA 2OCGA 4IIBA 4ZV4A 2C0PA 4WEOA 1UWCA 4QGHA 4PHCA 1ZETA 4OHYA 3LBNA 1J9ZA 3JSNA 1E6LA 3I5AA 5A6SA 1WSBA 1IHYA 3HPQA 2XBLA 4RENA 4MQ4A 1RR6A 2A9RA 4DLXA 5IVKA 1CJKC 3C1OA 4HWTA 1SA0B 3PDHA 4RHUA 3HJNA 1P3Y1 2P6OA 16PKA 2VDWB 1NF8A 4HFRA 1H8HD 3T1TA 4CFYA 2QN2A 3EAFA 1QHIA 4XWYA 4HSGA 3EA0A 1U2EA 4JJGA 5FNVF 1BVUA 1QO7A 4APMA 3PPVA 2QTLA 2JH9A 4UUPA 4PYLA 1M1YA 1ID1A 4QUEA 4K9PA 1HETA 4AP9A 4KAFA 1DWOA 3GMTA 3CT6A 1EB9A 2JZCA 4IIVA 1DRKA 4RXUA 2A6PA 1S7CA 2A8YA 5IBRA 3RIMA 2FSVC 1FFDA 1RK5A 5EOYA 4C21A 2V59A 4YUAA 3WLSA 2P1ZA 3HMQA 2IIVA 2Z4TA 4RSHA 4Y6LA 1XMJA 1YNSA 5LZ5A 2FWPA 1G6KA 1XRMA 3FMAA 5FYQA 1FSGA 4NE7A 4ARUA 3PYXA 5EHGA 1XALA 5P21A 4DT1A 1V8ZA 5THQA 4ZVLA 3SNHA 3FPLA 1HE8B 4DC0A 4CIXA 3ZJYA 4DV6H 2PSHA 3Q7IA 2R96A 3ZGNA 5A4KA 2HH9A 5AOAA 3E27A 1E4EB 1TZJA 4LUCA 2FMXA 2P3LA 5JS8A 1KH2A 3TGPA 4OXQA 2C5SA 3COPA 4H17A 1MAHA 2ZQYA 1J7KA 1AF7A 2A2ZA 4K9OA 4OUDB 3BCHA 1AZTA 5EKDA 3IALA 3O83A 5AKZA 4XVUA 5DCUA 1R5OA 1MQ9A 1PJRA 3KKLA 5KMGB 1S02A 2MINB 1OMOA 1E2PA 1C30A 3U09A 5TQVA 1G2QA 1YA6A 3O92A 3L46A 3G2NA 4DM3A 2DQ4A 4UVHA 1OTYA 4JB2A 2AZTA 4ZYZA 3MA0A 4EJ6A 1EJBA 1W52X 1YQ9A 2GAIA 2UYYA 1S2DA 2C99A 2DG2A 5FA5A 4ND7A 3T7AA 4P38A 1AA6A 1EQAA 4RTRA 3BBPA 1WU7A 1NE7A 2ZIWB 1NVKA 3KQPA 2NZUG 4KWEA 1VE7A 3EMDA 2W6NA 4IXDA 3OQ1A 5BY2A 4EB8A 3ND7A 1CUAA 3QPVA 2PMZE 1FFBA 3OF2A 3EHEA 4V02A 2A1HA 5AM0A 5KOYA 1NNUA 3TQIA 1S5PA 3KFXA 5LXTA 4PLHA 4KJXA 5FLKA 4BFLA 4ZU6X 3ST7A 2ZYRA 4QGGA 2O3TA 1AGYA 4ECQA 2W8KA 1RM5A 1EK0A 2FF5A 3FSJX 1K83A 2D4AA 5EMHA 1G5RA 1PS0A 2OBBA 2WYOA 1L7XA 2W6PA 2AKAB 1G8SA 2A7XA 4B4KA 2HO5A 3K73O 1TA8A 4I4TF 3LZDA 1T36A 5JWHA 5I8ZA 1UAYA 4CI0B 1H23A 3DXYA 2GCEA 4GI2A 4KN8A 1PT8A 1MAVA 4MB0A 2PT9A 3GFQA 4ARAA 2E7ZA 3VPBA 1GAXA 1ULUA 4OD0A 4Q3NA 1MU0A 3PJFA 4PHGA 3R7DA 1ZKMA 4X7PA 3C8ZA 1N2JA 2NUTA 4L16A 4I5DA 3V4RA 5BWMA 5LL6b 4W7HA 4I50F 3KD3A 4B6JA 1O75A 1NXPA 5EXTA 2UZAA 1ZJ5A 2BM9A 4NEQA 3BAAA 4HLUA 2J09A 1XMIA 4FI3F 4ZOLA 3QA3E 2CXRA 4N5HX 8AT1A 2NU9B 3BKXA 4PZCA 2H7YA 1Z06A 1X0VA 3GYGA 3B8EA 1XZPA 2FPGA 1T15A 3KSRA 3RSGA 3RRBA 5AVWA 4TV8A 1S8AA 4E70A 3JYQA 3N8IA 3KOUA 3MTGA 4TLMB 4U5QA 5KX5A 1II9A 3GFRA 3TEFA 4N8SA 2PMZA 2ZE8A 1DC6A 1KYZA 1TO2E 1RHUA 4GI3A 5FBLB 3DDNA 3MS2A 1WLSA 4X7MA 1ZGZA 2BGJA 2HY7A 4OX9H 3BK7A 2X41A 4EG7A 4AKIA 2QI9F 1W8IA 3U7QB 3C4JA 4DS3A 3KXKA 5F3WB 5K8TA 4I4IA 2PU7A 2Z4RA 3JALA 4J90A 3KLBA 4M83A 4B2PA 3FIUA 2ZJ6A 3A70A 3BACA 1W87A 1JWAB 4A8TA 1NUHA 3ZD6A 1UAGA 1DAAA 3JU3A 5LZ7A 3QELB 1QIGA 2QPTA 1VAJA 1F3OA 2ODBA 1TMGE 3TGWA 3E9YA 4FGSA 1RWPA 1G2IA 1P1RA 4GQBA 4WXEA 4L3OA 1UPUA 2QUKA 3Q7PA 1ORHA 3WL7A 4B6FA 4YIKA 2Z1MA 2CJXA 2XOKA 3UH1A 4UM9D 4HDNB 2QTBA 3RBZA 1LF0A 3PVXA 2QX8A 3W3AD 4JI2H 1JDPA 5T5QA 1VMEA 3EVGA 3B1ZA 3AG5A 3PC7A 4RD4A 1T4BA 3NUZA 1EMDA 1Y5NA 3H9GA 3SBXA 2GBFA 1RKQA 3MAJA 3H2HA 1ENOA 2BI7A 2N3ZA 1XJCA 2RDMA 4W5RA 3VHXA 4PQGA 2VWGA 4PBCA 4MW1A 2WICA 3WDMA 2GHIA 4M1EA 1OZ0A 2C2YA 3R77A 2H5JA 4KXNA 1EWQA 5KFMA 3IBCA 2H1HA 3PEWA 2CVZA 2C97A 2HQBA 2ID7A 4RF5A 1QE3A 4MIKA 1IVSA 2JLQA 3HYRA 6CHYA 4WV3A 3BA1A 4KXYA 1FDTA 3OU7A 4XIJA 4EMBA 1NIPA 1ZOOA 4DNOA 4DRZA 3UTCA 4NBSA 1UIRA 1HMPA 3B1JA 1IBLH 3MWLA 2Y1DA 4WH0A 1EDDA 4JGGA 4FBLA 3RK0A 4UTZA 5E7QA 2WE7A 4HDMA 3EVEA 4XYLA 1YDMA 3IP5A 5FRDA 2CW8A 5E9JA 2VQFB 4J91A 5A6SB 2E87A 5DHAA 4LDZA 4QBGB 3RYTC 1PWZA 2D1SA 3HA3A 4JBGA 2ZBVA 3PPXA 4HNAA 1IJKA 2PZBA 3R5HA 2BKAA 4TZ6A 1JZTA 2HGXA 4DLRA 5H83A 1G16A 5JMWA 3TIIA 2RGUA 5CLFA 1YRYE 3RO7A 4JVSB 1LLCA 2R8HA 2UYHA 5IWCA 3HN7A 2OR3A 1NC1A 2D2IA 3SKXA 1DOZA 5EERA 1M1YB 2ETXA 1FDOA 1KI3A 1PFGA 4RQBA 3OUUA 1R9MA 3OZWA 1E79D 1NKTA 4WCFC 3GR6A 1S7GA 3WGKA 4RJIA 4YK7A 2WIBA 3TMAA 4YPVA 4LVUA 1VIYA 3CLUD 5G2OA 2Y0EA 1ESDA 4YRSA 4R41A 1C1DA 3NJ8A 1VPLA 1ETUA 1UMKA 1NVWQ 4EP1A 1RXIA 4PFKA 1WB9A 2CDAA 3MWJA 3RYIA 2GUWA 1KZGB 3ADDA 5JARA 3FMPB 1QQBA 1F6BA 2FSIA 5HK8A 4DT1B 3D2BA 4WA7A 1NP6A 1P4JA 5B64A 5BSUA 3W1WA 4CLEA 1HEYA 3MM4A 1AKRA 1BDHA 5KJ1A 2WZQA 2PL3A 2EX1A 3DHNA 5IDQA 1RLMA 2Q5IA 2WVGA 2IV2X 4G5YA 3VO8A 3SIXA 3AI1A 1QH9A 1CVIA 5FLEX 3HYCA 3AK4A 1DDIA 5EHXA 2Z83A 4H6VA 3LX6A 1RAIA 2GD0A 3DOOA 1RBQA 2XUQA 1VPTA 5HE8A 4BECA 4M1MA 2UZ0A 1O94D 1U3DA 3L7YA 3WGJA 3L1KA 1TFUA 4CG2A 3WK8A 3OWXA 3OZDA 1C30B 4TTTS 2H1SA 1QIIA 5AW5A 2H11A 2GQRA 1YQGA 3PCTA 5I7VA 1IM5A 2P0AA 2FPMA 3G0IA 1W76A 5KYTA 1UC8A 4RK0A 2R1VA 4IO1A 2HU8A 2O2CA 4KR3A 1VIDA 2I3AA 2HJ9A 3OZVA 1T3SA 2NQ8A 2M98A 4IRKA 4R8MA 5G02A 1ODLA 4XVQA 3AXSA 1YCGA 1AGXA 2PL9A 3Q88A 3ZUPA 4AQYH 4RB3C 2GCPA 2X3UA 1ZIPA 5A7HA 3U0BA 1KDYA 5KT7A 4L85A 4C0WA 4DHEA 4TZ0A 1A7AA 3WRXA 5GOTA 1T6YA 2P2SA 1V1JA 5IF9A 3AF4A 4JJAA 1B33N 2WTXA 4UBKA 4JODA 2KSWA 2REBA 1J4AA 1AQNA 1MP0A 4YA6A 4MH0R 3ZCRA 3TW8A 5IM5A 5LXTB 2QL6A 3FROA 4HLNA 3KSDO 4MTDA 3KVOA 3EIEA 4FDTA 4TVSA 4X6XA 4M1KA 4KYVA 5EOVA 4A5OA 2G8NA 2VDKB 3R3SA 1JB1A 2I0FA 3NHLA 1I1MA 1GPAA 3JD2A 2ACKA 2UXDH 5IRCD 4DPKA 3D3EA 2PLFA 3G17A 3I39X 1B74A 2DYKA 1U8EA 1T36B 2GXSA 1O58A 1P5ZB 3B3AA 3C7CB 1RM0A 2FG6C 4HQLA 3Q8RB 1AU9A 3IAEA 4JI1H 3DLPX 1EVLA 2BP7A 1PWXA 5LKRA 1M2VA 4G41A 4YREA 1MB3A 3ONDA 1KI6B 4URVR 5J4LA 2X4DA 2I2WA 4GH5A 2NUTB 1P1KA 1GU0A 4P82A 4A10A 2BFAA 4O4JF 2ZATA 5B3AA 4ZYVA 2C98A 4LV5B 3DUFB 2EHJA 3KQUA 1DUSA 4IFEA 3E4DA 5FH9A 3BD9A 3DVQX 4L5AA 2RMKA 4E4RA 1XKXA 4ZOLB 3EFOA 1GNPA 3NEYA 1VKRA 2H1RA 4WKNA 2DECA 4TMWA 2IFTA 4NXNB 1OFVA 2G5GX 4KO3S 2FPGB 3CW2A 1NX6A 3BF7A 4L6IA 2BGWA 4TV8B 4KAJA 3S0JA 1NJSA 2DLNA 1Q91A 1I24A 5KX5B 4Q48A 4UDYX 1NUPA 5D7BA 4G9GA 1FTGA 1VB3A 4QOHA 1E6EA 1XCJA 1GHTA 4I7HA 3B6KA 5DXJA 1DARA 3TTUA 2AYZA 3EUAA 4EK9A 3MYYA 5FLYA 3S40A 5KG0A 1IK6A 2OFWA 4CLHA 3UYLA 3VO2A 3JALB 2J5RA 2NVWA 2P3QA 5DLQC 1S10A 1ANKA 3O90A 1GVHA 4I6GA 1AN0A 5B7GA 2XJ4A 3UPUA 3HXQA 1BEZA 2ZBUA 4IYRA 2BELA 4N9QA 1NTOA 4KW7A 2H07A 2GPBA 3WOVA 4J49A 4N6OA 1GKYA 1Z12A 3NYIA 3C6QA 4XGNA 4Y6GB 4G0WA 1JKFA 2JLBA 2E5LB 1NN1A 4FMCF 4EW6A 3AIIA 3HCCA 3ED5A 4FYVA 2XJ9A 1LI7A 2FR8C 3RGXA 4QPCA 3D6FA 3H7AA 4WOCA 4KXMA 2JD2A 1G19A 5FOQA 2F3UA 4BFSA 2WQZA 4C0XA 2QZZA 5KAMA 4CT5A 2A0WA 1T9DA 4MPJA 3GIKA 1SVMA 4AN0A 1HNWH 4O4IA 1NI3A 1K9SA 2FMAA 4C2AA 3VHXB 2K87A 3X43A 2NP7A 3FDSA 1FFSA 2MYTA 1KF0A 4BO9A 3SJCA 3OEED 2VR1A 1D04A 3IOYA 5E9QA 4B7CA 2OD2A 4P34A 1HTBA 2X23A 3CF4A 1Q14A 2QDKA 3FOFC 3PXEA 4MHSA 4R2LA 4YMSA 3EIWA 1DKUA 1O6GA 3ROXA 4A6DA 4QYSA 3L7BA 1JLMA 3M5CA 3WX0A 4OQDA 1SJ9A 4GP9A 3NP9A 5L1KA 2GN9A 5HFAA 1EX7A 3EMBA 4OJYA 1JJFA 2P7HA 1X92A 1C2TA 4DV1B 5FPKA 4OB7A 1LPAB 4HDMB 4HB3A 4XYLB 1GFSA 3Q7TA 3OZXA 1VL8A 5SY4A 5BQ3A 1L5WA 3A4LA 1RBMA 3W3AH 3LRTA 2C04A 4BB0A 2Q4BA 3VDNB 1DOAA 4IG4A 1FRZA 1U4SA 3ES9A 4Z0TA 3U4AA 3PDCA 2TMYA 4B40A 4HNAB 2BZ0A 3G2OA 2XRFA 3DM5A 4BRUA 3C3DA 1T5TA 2SECE 2VHJA 3S2EA 4BMCA 3V9PA 5FLXW 2PANA 2AEFA 1Z74A 2W9XA 3T3OA 3UAVA 4DQDA 3PP8A 3FD8A 4B4WA 2G3YA 4N48A 3OHMA 4FNGA 4G4SO 2FQXA 4AZ3A 2Q2VA 1FVIA 4BKMA 4N0DA 2ZIZA 4ZKEA 4XIGS 2ZULA 1GEEA 3A32A 5AM5A 4GXNA 1QX4A 2LXNA 5FPPA 3C14C 8ABPA 5F3RA 5BVHA 4R4JA 4U7WA 4H16A 1D5WA 4ER0A 2GZ3A 2YHBA 5I60A 3U4DA 1V25A 2HYDA 3JS5A 2I4RA 4F3RA 3CM0A 4OHBA 4RDHA 1C1DB 3QVTA 3UM9A 4D3SA 1FL9A 1G0OA 3SS9X 5HQTA 3ZIDA 5B7NA 3GD7A 2X0KA 4A8PA 2JAHA 2W6JA 5CDUA 3IOCA 5J4VA 3RYIB 3QQMA 3UQ8A 4DV4H 1D8TA 3L41A 1L7VC 2RHGB 4LDJA 3PYLA 2XTNA 3OZIA 4X97A 4V1CA 1SY7A 1AO0A 4C3VA 1XAHA 2CL5A 4NV3A 3FTCA 2EG9A 4J9KA 3PSHA 4DVJA 5FBVB 5LA6F 4HVTA 5TDHA 5C7OO 3RWOA 4TTQA 2YZKA 2IUSA 3GLTA 1KMHA 3T5CA 5CFLA 1B23P 3OHSX 3Q8MA 3RIGA 3N2GA 1DAPA 3UQZA 1SUDA 3G8YA 3HKCA 3P4XA 4LG1A 4MS1A 3ZZMA 4J29A 1FYXA 2DAAA 4A27A 3RS0A 4LQCA 4TRJA 4BFZA 3LY9A 1P3JA 1KJZA 1QF7A 1D2EA 1K7XB 1YZHA 1PKEA 3C0FB 3WYDA 2OP0A 3GC6A 3ZHUA 3OG9A 3GJZA 1D4AA 3G8AA 1J2TA 4BX2A 3U62A 2QJWA 3HEBA 3LCMA 3KFVA 3CNBA 2R1VB 3OMXA 2RGNC 3ZHRA 1E3QA 2BKXA 4K9KA 2GMWA 1ZWKA 4F21A 4BBPA 2FB9A 1IN6A 5D87A 4ZQIA 2ZRCA 3DD1A 3VFDA 3ZCVA 1C0EA 3UV3A 1KO7A 1WKVA 4NABA 2YZLA 3N0XA 1F0NA 1NAHA 2XGMA 3HB5X 2OE2A 4IQ8A 2B1IA 1NBME 4NWIA 3W7BA 5EZSA 4ME6A 3H86A 4DDVA 3I5XA 3EGEA 3MB8A 3DZIA 2D3WA 5HG0A 5ISMA 4P0TA 3TD2A 4E2ZA 3R8FA 1Z82A 4CMIA 5GQSA 1ZAYA 4WFIA 1F2UA 3TW8B 4P0PB 1VHLA 2IYLD 2EWVA 5DG8A 5C5EA 3QX8A 4CMFA 1N0HA 4CM5A 2O0LA 3HV2A 2WQ6A 1UBEA 2HIVA 3VKGA 4L9AA 2H54A 3KYBA 2Z5LA 4NV0A 3PW4A 3FUCA 2RHLA 4IZOA 2Q7XA 1RIFA 2YXNA 2C82A 2M1ZA 1YFZA 1JPUA 1XA3A 3QVXA 1GJRA 1VCIA 3L1HA 1PRYA 3T0FA 2Q5CA 3UMMA 2BP7B 3I37X 1M2VB 3SYKA 3CLRD 4FZ5A 2BH9A 3ETDA 1SHZA 5SZKB 3OPXA 4OFXA 1OWTA 1FUIA 3NPMA 1EVKA 1X1EA 1GPH1 2ZI4A 4YQFA 3B6EA 4JELA 4JXKA 1UBJS 5FT9A 4J7UA 3L05A 4TV9A 4RA9A 2XR1A 3LQ1A 3LUGA 1P9WA 1Z73A 5KQPA 4QM6A 5CM2Z 4RTLA 1OKKA 1TYZA 1OYWA 2AL7A 3AJAA 2XXAA 4XUGB 3EFOB 4RJTA 1U04A 4HWSA 5DTMA 4BX9A 1Y7HA 3RWBA 4JYPA 3GTMA 4LF6B 4PSVA 4YXWA 4HR7A 5DQHA 2M2IA 4FN4A 4PG6A 3GJ5A 5AM4A 5C7LO 2XCTB 1GTZA 1CFJA 4NDAA 1P2TA 4XDZA 2PZJA 5JV5A 2X19A 3NFYA 2EZ8A 2HBYA 2MDTA 3CUTA 4XB1A 4CV2A 2NYVA 1NBMA 3HFSA 3OOWA 1H1TA 1YVDA 3MB5A 1F0KA 4MWGA 3HWSA 4FCCA 1AMNA 5KJ6A 3RU9A 3IBYA 1KETA 5IUJC 5JCOC 2ZCVA 5DX0A 1N5DA 4LE2A 3M3PA 3HCPA 5DWDA 1A5AB 3ND5A 1I3KA 2XRZA 3H04A 3WLNA 2VVTA 2ZYSA 5K2MA 2B63G 4EDFA 3ZBUA 1D0VA 2DHEA 4FDMA 4N7BA 4ND1A 4QL3A 2E5WA 1ZMBA 4WJKB 2EF0A 2R5FA 5DH9A 1FBTA 2PMDA 3R3VA 3FNQA 5MHTA 4RUKA 2IELA 1FFAA 4M7OA 2YN0A 1K4YA 3VJRA 1JJIA 5LBUA 3DLCA 1SUPA 4YRJA 3ZV3A 1T2DA 3CTPA 1MCZA 1YQXA 4AKTA 5HBGA 2R6JA 4LTNA 3RPEA 4QPZA 4QFDA 2XEDA 3NTXA 2HUPA 3X1JA 3KAJA 4PN3A 2O50A 1JKIA 5BUQA 4O4IB 5G0UA 2R66A 5JS7A 3NC1C 1Q83A 3LP8A 1OPXA 2XCOA 3PC4A 3HOXG 4OQFA 5KWVA 4RYDA 3AUFA 1BRMA 4NPAA 4I0WB 3AT1A 4ED7A 2VQ6A 3EISA 3FCYA 5EE3A 4IIJF 4TQ9A 2BEKA 4GC5A 5BV7A 5KSOA 2PS3A 4BMOB 5KVAA 1EE9A 4ZO8A 3C74A 1K5DA 1N33H 3NHYA 5AJZA 2JJYA 2PMEA 2DJIA 2PRKA 3HDQA 2TMKA 3H4BA 4DA6A 4DLUA 5L3QA 3ZNPA 3OFND 4RQUA 3L0OA 5KZMB 3N86A 2P30A 1GPWB 4A03A 3NVKI 2QU8A 3G82C 4NY1A 5BXQC 5KDLA 4J75A 1SVSA 1U3TA 4ZZIA 4X61A 2W2LD 3JYPA 3I5UA 3QBDA 2C28A 2ZT8A 1A5BB 4P7KA 1BJTA 3B5IA 2B21A 1M2EA 2BR0A 4AZ3B 4BAZA 3FG9A 4A3GG 4Y8VA 1C9NA 1ZOIA 1BRTA 2ORVA 1X7HA 3AEKA 4XQ9A 3AHJA 4L28A 3UF0A 2P35A 1IUOA 1QC5A 5BVHB 3WK9A 2AQHA 2NXNA 3ONNA 3X1DA 2X42A 3L18A 1P4GA 1E2IA 4U8HA 3ZQ6A 3RHSA 2ZSUA 1Y5LA 4D0LB 2B3TA 1ZXXA 5BV8A 3CR3C 1D0IA 3CZMA 1JJVA 2HHLA 3I4FA 1MO6A 2XIQA 4GP7A 3HO1A 3BXOA 3K1AA 2BWJA 3MNFA 1ZA1A 1KBQA 2YMQA 1BROA 4X85A 3O8OA 3A31A 1XZEA 1BO6A 2QUHA 4LJLA 2RB4A 3L6BA 5LPNA 1LSSA 1YAJA 3O4JA 3HB4X 1JL3A 4V1CB 5JHGB 2ZUDA 2GYVA 1ISSA 1YZ3A 3RVRA 2LVBA 4WZ6A 4II2A 1MPXA 4CJXA 2KX7A 2CUNA 5MDHA 2D2EA 1S1CA 3RE1A 2XA9A 4QXPA 3G2QA 1WU8A 4IPTA 4WTOA 1KMHB 3Q8SB 2JJ2D 1D6JA 1GQFA 4RLFA 3F1LA 3N2GB 2GOYA 2V03A 4P6VF 2VDVE 4B6SA 1L4GA 1MJNA 1JJBA 2EJ0A 3HKCB 3KHHA 3Q5DA 4XQEA 4NBKA 2W6IA 4L4SA 4MS1B 2QVCA 2O3SA 3RTCA 1DBWA 1OF1A 3HYNA 4QEDA 3Q6IA 1USIA 4IO0A 3OQNA 3OFSA 4ETIA 1IJFA 2B8WA 1OIXA 4OHVA 5CB4A 4KXWA 1SKYE 4JYMA 1HX7A 3LUFA 3NBMA 5IK2A 4L8YA 3CVUA 3H1FA 2NOAA 1ZJ6A 3M4IA 1P60A 2ANCA 1I32A 1JECA 4P4NA 1U98A 2XITA 2B37A 4YH1A 4RV9A 1S03G 1V7QA 1LWNA 4CQMA 2JFYA 1I3QA 2VAXA 1KBOA 2VAMA 2V58A 3D1JA 2GN0A 3RVNA 2QN1A 1UXIA 2CV1A 5A71A 2I3GA 1VBKA 2PUJA 4PHFA 4CMIB 1ZNQO 3DTTA 1C5KA 3PFHA 1F2UB 2IDKA 3KE9A 4MJ7A 3IERA 3S27A 4PAWA 4X1KA 2Y9PB 1A2QA 1B8VA 2VSYA 4DJ5X 2HWKA 3FOCA 4L95C 4GOND 5FQOA 5I8WA 3X1XA 1WW2A 4EEKA 1SUSA 2OBFA 3DB2A 4YRNA 3N2IA 2RI6A 2FH5B 3I1IA 4JOBA 4Q0MA 3QKUA 2ZBFA 1WP9A 1JH9A 1PR1A 4YMIA 3MFQA 1QYCA 1G8FA 1NXOA 1TOAA 3EZXA 3ZWNA 2CLMB 2R9VA 1S2LA 4MB2A 4OJMX 1PG2A 3LPLA 3G89A 5EI5A 2AIRA 1GR1A 4H7HA 1TM3E 4Z1OA 5MF6A 1R0LA 1NKVA 1MIHA 1ZSYA 4IMRA 3ZY6A 3VJMA 1ML3A 1JSLA 3LXUX 3BULA 1NMSA 4F5YA 3EARA 3NALA 1NRIA 3PBKA 3S6JA 1W9HA 4TV9B 4RA9B 5K8UA 4G0VA 2E82A 1E0SA 1Z2PX 2YV1A 1TJ4A 3PEYA 1N9ZA 2XXAB 1VJTA 5ECWA 2EU8A 3T6KA 1X7XA 2IZ5A 3P20A 2P9HA 3ZHXA 5C8YA 2IQ5A 1ULAA 2OCKA 5DULA 2J9YB 3JVVA 3F9CA 1A0OA 3BDVA 2IVZA 4MQLA 3T06B 2FKAA 4G3XA 1MOPA 3NP7A 2J9XB 3AIKA 3IP3A 4XJSA 2QUJA 3CVWA 2ZZNA 1TD9A 1USUA 2CCGA 4CM3A 3AX6A 5EIFA 4PHHA 5EAIA 2I78A 2AEEA 3C3JA 1DAFA 3L9XA 2CYCA 4OBXA 1L7RA 2NO9A 5FD8A 3KL4A 3TZLA 1D03A 3UMJA 1K4MA 3UW1A 2AJDA 3NUAA 1O6BA 1I2LA 1GG8A 2NU6A 4JLPA 2AXPA 5AQ1A 5J2TA 3AR4A 1EKVA 3K4QA 5KYXA 4H1WA 3A05A 2N46A 2JFQA 2DSNA 3ZDCA 3G88A 3DE4X 1Q0QA 5DE3A 2CCJA 3IP8A 4BV9A 4B48A 3HJHA 2B4YA 1QPZA 1XDDA 4TM8A 3L0CA 2AJLI 1R88A 4RABA 1W5TA 1G7TA 5BMOA 1CBUA 5IPFA 4JP1A 4Q0YA 3OO1A 4X66B 5JR3A 3O5AA 1EEHA 3LT5A 5DNVA 3QBVA 3N44B 2UVQA 1Z6GA 3GFVA 4YRCA 1Q0RA 3LUKA 3S2UA 2C7PA 3RBDA 1UMDA 2WTUA 3I72A 3I83A 4PYJA 3KO8A 1JR6A 7REQA 1V48A 2HFKA 3VR4A 4M7EA 1JBQA 3NLLA 3RHTA 4HH4A 3K9GA 2DPXA 4P7JA 3RSQA 3EB9A 3EDMA 3SM3A 4OQYA 2HHHH 1E8NA 5KWEA 3FZGA 3W5DA 2JH3A 4HWKA 2I2XB 3K72B 2YVQA 2HV8A 2NVUA 5SZHB 5JNVA 4KC0A 5GAJA 4FQ8A 2CMGA 2PS0A 1RQXA 4QOEA 1P0QA 1H2RS 2ZG6A 4ZVTA 1XZMA 4PZEA 4EI9A 1NRJB 2BVNA 1P74A 4EB6A 4DR7H 5IZCA 3SAJA 5IC4A 5G1OA 4J0DA 1CUUA 3I12A 5FWYB 3DAHA 3PWSA 3P2OA 1ZAKA 1AQ6A 2O54A 5HSGA 1AZLA 2Y27A 2NZYA 3IQXA 1LDEA 2XCPA 4R7ZA 5LB4A 5L3QB 3D02A 2H59A 3ZGVA 1P18A 2VT3A 3EVAA 1SB9A 1FMLA 3HNOA 3KQMA 5HDBB 2XRYA 2OQVA 1UFOA 3WGNA 2OP1A 4G5SA 3HXMA 3OX4A 1BFDA 3LDHA 4Q8FA 1UKEA 3PNMA 1P1CA 2GHRA 1F2VA 4EFKA 2P9BA 3IS3A 3E18A 2A0KA 1DE0A 5AIAA 3R5TA 4R8KA 2PNJA 4LRTB 1QYXA 1K6XA 1LPBB 3FVRA 5LOVF 1T10A 4NOJA 4EX7A 4EFLA 1E9RA 2G40A 3HVJA 2GNOA 3UJDA 5C8XA 3U80A 1FIUA 2WTNA 1RCTE 4MQUA 1J2UA 2Z6QA 4MRAA 5CXSA 2QD3A 3D7KA 3WADA 5TGTA 1WXHA 1AB6A 4LZJA 5IC6A 4Q3BA 4P0QB 4Y8VB 4HNUA 3BE6A 4JZKA 1I2ZA 5KTTA 1IEVA 3WNVA 3CRQA 3AEKB 1JRLA 1X74A 2YRXA 3I42A 1QC5B 3QXGA 2W9BA 1OHHD 3MD0A 5ALLA 4HQ0A 3RK4A 1Z5UA 5GM1A 2JEYA 2PT5A 2A59A 4PFSA 4PPFA 4BVAA 1PJZA 1JDTA 1DBVO 3ONWA 3VU8A 3K1AB 4JJFA 3NOVA 2XT9A 1AUPA 3UG6A 3O8OB 2C84A 2RIPA 2O2XA 1BGXT 1C1HA 3TYXA 4WOBA 1O97C 4HLQB 2ASVA 4QU0A 4BJ1A 1OJ7A 2BN4A 2RD2A 5J63A 1F0YA 2D5BA 2EATA 3REGA 4NVRA 2IW3A 1MXHA 3AHIA 2ZU0C 2BV3A 2CK3A 2AS0A 2Q5FA 2H2IA 1RJGA 1TLFA 1EBBA 2WMYA 3IESA 5JJLA 1PJ3A 4B1FA 3NVMB 3EYYA 3S1SA 1GZ6A 5F3DA 4AY4A 3QIVA 4BV8A 5FI5A 1RS0A 3F96A 3TRDA 3V2GA 1CQZA 3NV9A 5FPOA 1TT5A 3M33A 4FFNA 5D5PA 2PLAA 1HDGO 1KJJA 1P7WA 1OXBB 4HAVA 1MX1A 4R0NA 4EJ0A 2DLCX 3SF8A 4YCJA 3N0WA 2VTDA 2DH5A 4EHKA 3HOZG 3OTGA 4NPHA 2RBKA 1VPWA 3DEAA 5CB4B 2IYEA 4W1PA 3Q7RA 5CCBA 2V9ZA 3E7WA 1GAEO 4MP6A 4BN0A 3EWIA 2UUBH 4FZ3A 1YFJA 2WYHA 2QLLA 3KLNA 2CE2X 1GU1A 1Z45A 1SUBA 4DY4A 5ALZA 5EUCA 4JI6H 4Z9FA 4DR6B 4JMPA 3PJEA 4K87A 4WGFA 1IMJA 5TR9A 4RPLA 4CQMB 4FDVA 2YW9A 4C0QC 2H92A 5KC8A 3EBOA 1XPJA 1Q92A 3F90A 4ALMA 3ID6C 3EOZA 4TOIA 5G4KA 2R44A 3Q6NA 4PAGA 1KZ9A 4GX0A 3LNCA 4YMVA 4GOXA 2OM2A 1JYFA 1AKWA 4WLUA 2HT6A 3G0OA 1PYGA 2VAVA 1MNQA 4X1KB 5DLYA 1MW8X 4R2IA 2DH6A 5DHQA 5KFUA 2WM8A 1P5HA 5K6TA 3TNLA 2XUAA 4UVEA 2EBFX 1Z16A 5J2UF 5BWXA 2NYUA 3VYUB 4B7AA 2FN7A 4AQDA 4QOSA 4Q9JA 1OA0A 4F45A 5TEWA 2WE6A 4PPGA 4Z3DA 4YJ2A 1HQYE 4HZUA 4GGPA 1UT8A 5FJIA 4EYEA 4JV0A 3ZJTA 2XDAA 2BJHA 3DTVD 3JQGA 4UHFA 3WDSA 5LMNB 2WF8A 4DV7H 3I01A 3ZHZA 4LSMA 2PMWB 2HA6A 4UBOA 5CLHA 1K98A 3B9BA 4WKGA 1B8OA 1AKQA 3FA2A 2IYYA 4UC0A 5IW8A 1SKYB 2QJRA 2X3FA 4NMLA 5LM3A 3C87A 1OD6A 1ZD5A 4JBHA 1KI6A 1X7XB 5C8YB 3LOQA 5FFMA 1XHFA 3G2KA 4ZO7A 2XT0A 4EFNA 3DUFA 4DDWA 2ZIEA 1TUBA 3IPXA 1XLVA 4LBZA 2GT1A 1YZVA 1I1QB 1D07A 3OQOA 1X9IA 2PA3A 1LTQA 1WKBA 2V74B 3AEUA 1K06A 1XZLA 5DM1A 1H4TA 4PLYA 2XQKA 421PA 1JE0A 4PS0A 3MGKA 5AJTA 4RELA 5HKAA 4CTMA 2P9YA 3M1AA 4Q47A 4UCRA 1LI5A 1EEXB 3KYJB 4LK2A 2FKLA 3A4VA 3OJEA 2JIRA 4LRYA 5IT9W 1ZVMA 2NU6B 1ZMXA 2CW5A 4RZUA 3B89A 5J2TB 5KYXB 4NG5A 3BXPA 2MWMA 3W7VA 3LZ6A 2GXAA 2WIDA 3MWDA 1B8UA 3CQ9A 3GDHA 1J5EH 1M34E 3U40A 2LIPA 1NW7A 4Z53A 1YT5A 3AEQA 3UOAB 2ENWA 3RAXA 1UK9A 4OXIA 1PR0A 4FHGA 4EENA 1T2AA 2F62A 1A72A 1XO1A 3AUAA 3NAGA 1E9BA 1QOPB 1KJNA 4MW9A 1I0IA 4JNCA 5HKOA 3TCXB 2VXOA 1R8SA 2HIHA 3K9HA 3HVHA 1MC4A 2W8ZA 4G26A 3T7JA 4XGKA 4EA7A 4NCXA 5EA2A 4B3FX 4FFSA 1FVOA 5C34B 3TAHA 4O3RA 7AT1A 1UMDB 4Y1RA 7REQB 7GPBA 5GINE 4A2CA 2MSNA 1L8AA 3MCVA 4HFMA 1JHZA 3UW3A 2X9VA 3GTLA 2O4CA 4AJ1A 1OUMA 4X90A 1XDUA 2ID8A 3M5PA 2OYRA 4F4UA 2R1ZA 2F6RA 4N5MA 2B99A 2NVUB 1UL1X 1CDDA 1TRKA 1A82A 5D1OA 1RYMA 2ZS9A 5KFCA 1FXSA 5FPHA 1LH0A 4R8RA 5EYPA 5CVDA 1A4UA 4EB6B 4UCUA 1GQSA 1QK3A 1ZK3A 3NKFA 3LUDA 3Q1LA 4KDRA 4YAWA 3CXUA 3PQ8A 3GGSA 1B6RA 4LDAA 3UJPA 1U28C 2CLIB 2ZTHA 2H5EA 4RK5A 2QSYA 4V2IA 2QTVA 3AUJB 3ZXIA 4JQOA 3WK6A 4MUMA 4EG5A 2K7ZA 1HT1E 3OLZA 3T1YB 4FJ1A 5E2BA 4EZEA 2W11A 3EA5A 2J4FA 1YMVA 1E1QA 4N7RA 4MYCA 4GI1A 1B6TA 3WHKA 1N1EA 4NP6A 3NG1A 4FZRA 1M34A 5CDHA 3F5SA 3K5WA 2O0JA 5KUTA 4E6NA 2C58A 1LPNA 2VXBA 4ZC8A 3HU3A 1MIOA 1VS0A 3JD1A 2QUIA 1L4FA 1XHLA 5KHAA 1U9CA 3CU5A 1VOTA 3U3MA 1OCEA 2BHLA 1JG6A 4G2NA 4X8LA 2W70A 1R0WA 3GUUA 3LT2A 2Z08A 4P4GA 2IEGA 3EUEA 4QJIA 4AMVA 2Y4RA 4QJFA 1DFIA 1FMTA 1CZRA 1CUFA 5CFZA 2W9BB 5GV7A 1R27A 4UUQA 5J9FA 2XZPA 2JJ1A 4K7JA 1WXDA 3I04M 2OSBA 5L3RA 4ZV9A 3MUEA 1XZBA 4CM4A 4FYIA 3KVRA 4B71A 3UOWA 2ORYA 2FLLA 4NLGA 5DXFA 4B3RB 1PK7A 5A04A 2JFXA 4F2DA 4EH1A 2WIAA 3F9RA 3RTGA 4MHOA 1E1RA 4PE5B 5BSHA 3TL2A 1GADO 3UC5A 2CHQA 4FU0A 3HY3A 3L1IA 4K81B 1QK5A 3HUUA 3WGYA 4ARCA 3LT1A 1HUQA 1RRMA 4RK7A 3H18A 4KQMA 4CZ2A 2DBZA 2HA7A 2JLYA 2R68A 3HEMA 4UDXX 4G3IA 4MQEA 2QJFA 1J25A 2IXGA 1BC5A 4F50A 3ZVMA 3HCWA 1GGEA 1TT5B 1N6LA 1H0RA 3GA5A 1E7MA 3BMNA 1CWUA 2UUCB 3FPEA 4HYTA 2VUSA 2DHDA 3AJ8A 4D9NA 3FOBA 2GHQA 1ZOSA 3FM9A 2VHCA 3SF8B 3SNOA 1RPTA 1QB8A 2JCYA 1RWNA 4JXJA 3YASA 2V9CA 2Q9BA 3VM6A 5JD6A 2B8NA 3KKEA 1P0CA 1X1TA 1GV0A 4B4UA 3E9DA 2O5CA 1V41E 3BAFA 4ZCTA 1FY2A 5BSRA 4AKEA 3B2EA 3BDIA 3N7AA 2DT5A 5KG7A 1F1JA 2VJLA 3A1FA 4RCZA 4J6EA 3WK5A 3FR8A 3IPAA 1V8PA 4QTTB 1NW6A 1LDGA 3QLJA 4N6NA 3JWIA 5CFMA 2A0XA 2IZ6A 1I5RA 2DFDA 4ICIA 3WSVA 2ZI5A 4PC6A 2J46A 4QXOA 4BQEA 1H2ZA 3OIDA 1NYQA 2ATEA 2QGFA 4D1YA 4TGLA 2W9AA 5G4KB 3M6WA 4IHJA 4IUBS 4EJSA 3K3PA 3EJ6A 3MT0A 4R05A 4D3XA 2P4UA 2ZBRA 1JR4A 2QNRA 3JY6A 4RLQA 1NGSA 2IP2A 3HBLA 4DIKA 2IDJA 1PQPA 1J39A 3G1WA 1NVVR 3GJXC 4CM9D 3MAAC 4PQRA 1LQ2A 2OPBA 4UXIA 2RARA 1GZ7A 3DMDA 1Q22A 1QOZA 4DUZB 3GRRA 4L4ZA 3DMFA 3AVUA 2C2ZA 4F60A 2XCRB 2HLDD 2HHJA 2YQ4A 2VP5A 4RF2A 2DTDA 1ZQ9A 3INTA 5KTMA 4YJ2B 1T5IA 2YH2A 4HZUB 1YB4A 4QU5A 2A0FA 3BYZA 4I6JA 4PV7A 1OA1A 1W0JA 4KKVA 5B3KA 3L77A 2H5LA 5JH7A 3NKVA 3ISTA 3JQGB 4F3YA 3G5UA 5I5XA 1KMIY 3EW7A 1C7QA 5EZYF 5K3CA 3CX3A 1OLOA 1R4MA 5BR7A 1D1SA 3QXHA 2RH4A 2VF4X 4F4JA 3AP1A 3AR6A 2O2SA 1MQAA 1A7JA 4R1TA 4PYIA 2LKDA 4D4LA 4ZOEA 4AZWA 4NX2A 3BSFA 1CX9B 4KGXA 3ME5A 4C6SA 1IUNA 3VKWA 5L8VA 4FEGA 4ZD6A 4Z7NB 1TUBB 3AUXA 1NNSA 1Q0LA 2O9JA 2ERCA 2CMHA 3IELA 1CQIA 1C50A 3JPWA 1DQNA 4QSMA 1QFZA 3AEUB 4QX6A 2C2HA 4A0GA 5AP9A 4HAIA 3ZHOA 2ZUEA 4G1CA 3KT6A 4M0DA 1A71A 1M54A 2CMFA 3HJBA 1F8UA 2OCDA 1MVNA 3HCBA 3H9BA 3WL6A 4ZCSA 4RK6A 1SBCA 2VBCA 4BU0A 1USGA 3WGUA 1O8BA 5L45A 3I92A 3MTEA 1T2CA 1EGQA 3F73A 4Y2PA 1OWLA 3W6NA 4UNNA 5U4XA 2NPFA 3V8MA 3MWDB 4YR2A 4ACBA 3ORSA 3KPUA 1ZHFA 3U3XA 3BJZA 3AEQB 4CN8A 3C3BA 3H19A 5I47A 2C2OA 2Q1TA 3UYYA 2AYYA 1B1CA 4CM8A 4EWLA 1T0JB 2FX2A 5JXGA 4HDKA 1ZR4A 3JZ6A 4YC7A 3AINA 1SCNE 4WXHA 5CTAA 1TQHA 4EBDA 5HKBA 5G0TA 2A5YB 4O3QA 1L7DA 1Z4LA 3R7WA 1QHYA 1TEVA 1PFQA 3RD5A 2H2DA 2BJVA 5CITA 5ALGA 2UUPA 3BWBA 3NH6A 1YR9A 1ACJA 3AF0A 1IHXA 5CCDA 4NYMR 4ZK2A 4Y1RB 2DCUA 2JH8A 2EHDA 2P1DA 3QOXA 1J00A 3WYAA 2A1TR 3QWUA 3LLUA 3H5NA 5HGJA 2CFMA 3WLFA 3ETJA 2OCAA 4GOMD 1GL3A 1FTNA 2WWTA 4J2TA 4HTFA 1BE6A 2FQ1A 4Q4DA 3LGSA 3G0GA 3KBOA 1A4RA 2IUUA 5D1OB 1AHHA 2Y0CA 5CDSA 4BLWA 2QM7A 3NETA 1PE0A 1LVHA 5FUVA 5EYPB 1IXZA 5ER6A 1I2BA 4A2AA 2GLUA 1SKBA 5IKXA 4RVGA 1YKSA 5GP1A 1QKJA 3TXAA 5CXXA 3MT9A 3OJ0A 3NWBA 1DEKA 1DO8A 2W6CX 3BWMA 2QTVB 1I3MA 2XUHA 3JVEA 5CT5A 3EWSA 4UEQA 5CJPA 3N0RA 1JA0A 3N87A 4IJQA 2PCJA 3RT1A 1JHYA 2G25A 3LXXA 3R1IA 1LX6A 4I81A 2QT9A 1Z18A 2CVQA 3LL4A 3SR3A 4PCLA 1DPFA 3BGOS 1M34B 3EUFA 2ZUFA 2HIMA 2GZRA 4M7RA 3MC1A 1FTWA 1QFJA 1MIOB 5AM2A 5EESA 4Q1VA 1E9EA 4LYFA 3SJUA 1DEOA 3JXEA 4IFIA 1BN7A 1WB5A 2IHNA 221PA 1P8LA 4RHEA 5C1DA 3VR2D 5EPOA 2OFXA 3RS9A 1PO7A 2NQ2C 4KV9A 1OTHA 5CR9A 3EPLA 2CVOA 3LGAA 2BBTA 4CFSA 1Z8DA 4K9SA 3A28A 2Y93A 4PXSA 4CM4B 1YWGO 5KS2A 3ZLBA 5B36A 4UTXA 1P2FA 2P6RA 1C2YA 3V42A 4R2WA 4YB8A 2POCA 3D7NA 3ERCA 5T3UA 3H2ZA 3TS1A 4G5FA 2ZRHA 3EAGA 1WBDA 4UMEA 3IV6A 2CSXA 4INJA 4C03A 3PNYA 1NVTA 4H60A 4ZEWA 1DQRA 2QTFA 4I9UA 3AL2A 4UD6A 1A50B 2F1HA 1Q2UA 4DILA 1VBHA 4RHXA 1J0BA 1X77A 3ZWXA 4P2BA 1R00A 4DR4B 1OB2A 4Y9UA 1E3MA 3SICE 4MQEB 2CD9A 2O2JA 1NOIA 3WL8A 1E0KA 5DNYB 1DADA 4QTUB 1CVRA 1K1EA 4HH1A 1JKMA 1NYLA 3BMNB 4PTYA 2PD6A 1P0PA 2XZOA 4HFJA 3L7JA 4CKWA 2PZFA 4C1NA 4DADA 1NXQA 3OHPA 2C1ZA 2WAMA 4XLLA 3M1LA 2PZEA 4N18A 1YDEA 2EDAA 4QWEA 4JR2A 2H4ZA 3SHOA 4NU0A 1MO5A 1KEWA 1B43A 4KJZA 4UEOA 5JNWA 4US0R 4W8HA 3MINA 4XXHA 4FI3C 1Z39A 4F11A 2VN8A 1I80A 1E5DA 2D2FA 4M1YA 5KKNB 1GA6A 5CCXA 2AX4A 1OH6A 2V45A 3H0KA 5CFNA 1WW3A 2WF5A 3AHGA 2NVYA 1RXEA 2O8BA 4BJ5A 3RFTA 3UGKA 3DV0A 2XUIA 2EJBA 4BFVA 5IFLA 4ZGWA 4ECWA 4OMDA 5FO1A 1U0EA 4ED1A 3OM0A 1QHXA 4XD2A 2ACWA 1L6RA 3ZV7A 1NFQA 3W2HA 1TPZA 1AHPA 4NFLA 4BY9E 4IICA 4PQEA 3NBXX 1P2UA 3WLAA 5BV1A 4D43A 5BN5A 3KT3A 4IHJB 4HGPA 3L02A 4C2UA 4C01A 4EJSB 3WYCA 1RMQA 2AMLA 4HNRA 5IBCA 1U2GC 1JIUA 3RJZA 1XU7A 1OZHA 1UDBA 3GEMA 3THOA 1VCNA 1IWBB 5ULLA 5KOHA 3E70C 4KYIB 4O83A 1FUUA 2HWUA 1FRQA 1AJEA 1A5TA 1ZEMA 2AC4A 3M82A 4M86A 2E2IA 3ZGOA 2HF8A 2H31A 2C1EA 1X3SA 3QEMA 4TXJA 1C3EA 1A48A 4N7MA 1V1RA 5C7YA 4HRAA 2PLWA 3FTPA 6ADHA 4G4IA 4C29A 1DNPA 1G0NA 2Q5QA 3L6DA 1OBOA 4JI5B 5KTOA 3MHPA 1AK9A 1F60A 1I1NA 2IHUA 2QZPA 4NS4A 3J81A 4QU9A 3DMTA 2YWVA 4EUFA 4LXXA 5JH7B 2OD9A 4DL3A 4PQFA 4B3HA 1SB8A 4BC1A 3ZHSA 3LVRE 5ALMA 2CL6X 1DPGA 4OP2A 1Q2XA 4BEJA 3AHEA 2UUAH 4NIMA 1E2HA 1PJQA 3DLAA 1GAQA 5DGXA 1EJ2A 1R4MB 3K09C 4KFTA 2Q0SA 4CTJA 4FBUA 1A9XA 1F8XA 1SQGA 3LUJA 3N40P 2CV0A 1JLKA 2WM9B 1UXKA 4KI0A 4J1TA 4OVKA 2JGMA 4JXZA 1A8UA 1G38A 3KU4A 3L6UA 1CQIB 3TQQA 2YXLA 5FO0A 2BEJA 3EBLA 2HX1A 1ZRSA 4PZLA 4PNPA 4P54A 4DIUA 1A9YA 4YROA 3E7FA 4YUWA 4CTKA 3HPRA 4OGFA 5KT2A 4N03A 4D9CA 1LB1B 1N3BA 3KXPA 3H0EA 5L6LB 1N77A 4L15A 4GM4A 1WRBA 1CY1A 3IVMA 3QQ5A 1GZHB 2WLSA 1WH2A 4Z9BA 3G9XA 2IEAA 3U56A 4QYTA 2H9YA 2FPIA 1OBDA 1U99A 3EDOA 4E1VA 4IH1A 3WI7A 3H1TA 5DISB 4CM8B 1T2UA 2ZJ2A 1OTXA 3QOYA 1Q7CA 2ECQA 4HDKB 1SUFA 3BRQA 1C9MA 4K9QA 1P4HA 4FFLA 4HQOA 5C0OE 1GPDG 5BMVF 3H8JA 2C92A 4FD3A 3R7WB 1J20A 5BSWA 5HXAA 4RV4A 2VLIA 2HMTA 4WUVA 1XMPA 5K4AA 2JEFA 1XC7A 2AFHE 1XZKA 2NXCA 3QKSA 2M9MA 4PR0A 3VOSA 4FT2A 3SYRA 4RSMA 1RFGE 1Z7GA 4TX1A 2IH2A 1ZDMA 3D6TB 3GUZA 1F8GA 2MJLA 2QTCA 1NPDA 1H5QA 2OORA 2TSYB 3OJFA 1IBKH 3C6YA 2RHTA 1KZ4A 5C2JB 1OLXA 2N9UA 2A1IA 1UXJA 2IZ7A 2PS9A 1C4OA 4HTFB 3PZPA 3JYLA 2N1BA 4PO1A 2A9OA 3V6LA 1KEVA 4L5IA 2JFBA 2PZKA 1EXDA 5L40A 3A6PC 2WPNA 2BGTA 3CONA 1TYEB 2EZUA 3K30A 1JSCA 1QGYA 5CD1A 1YVPA 2FWBA 2AZXA 1XWWA 1PEDA 3NAQA 4IGEA 1RC0A 2GF0A 3BVPA 2J7PA 3QG1A 4C7OA 1AK2A 3DT8A 1CUGA 1RYFA 4ECSA 3SLGA 4WN9A 1KKUA 2F9MA 3VYRB 2WABA 3KSBC 4RZQA 3ABZA 5KC9A 2FEKA 5EXPA 4AURA 3PUXA 4HX9A 1S0MA 3P19A 1XDWA 1G5HA 4OHMA 2VO1A 2J3JA 5FWYA 2ODWA 5KREA 4FYMA 1H0SA 1C8LA 4E1BA 1PLKA 1ZN9A 3TTWA 3FNBA 4UPDA 1CZLA 4ZYXA 2FEAA 3EXEA 4PN7A 3OKPA 3MS4A 1EXVA 1PG0A 2QW0X 4QE3A 1PZEA 4YECA 3LLSA 4FBTA 1SBYA 3V8QA 1Z68A 3DULA 3P1JA 2X2PA 4JU9A 4H15A 3QYAA 1QRSA 1HG0A 2HRRA 3JQEA 3SCZA 2CL0X 4LZZA 4LVNA 2AFHA 4X8MA 4WCVA 2EX0A 3WLHA 4Z0PA 2H1VA 4JUCA 4F7DA 1FW6A 1TF5A 5C1OA 2QGNA 2I33A 4B3MH 1OAOA 5FNZA 4QGSA 2R7ZA 2BT4A 1DAGA 4YB8B 1U65A 2HZBA 3H4DA 1Y7IA 1YB1A 5KWSA 3KHTA 2YYSA 1PAUA 4Q1BA 4E11A 1SVIA 2ASJA 2W0MA 1E3TA 4RNDB 2HRDA 4YR7A 2P6PA 3MT7A 3T3PB 4OI1A 3PRJA 3I6YA 3CEPB 4QBTA 3L79A 4NRDA 2Q4OA 3HCNA 3OICA 1NN5A 1G4UR 5IG2A 4DNPA 4X92A 5C52B 1X7ZA 1QE5A 3IEXA 2UXBB 1YO6A 3LPAA 4GWKA 4ZREA 4B73A 5K3EA 4JLDA 1IZ8A 3K92A 3OIGA 5K8IA 2PGXA 2WUDA 4GBJA 1Q0PA 3QEJA 1SVKA 4IIDA 5GY7A 4G1MB 1G4AE 1HWYA 4B9EA 1FSSA 5FADA 2XXBA 4CKWB 3L4BA 1UKZA 1FRFS 5CLGA 2XF8A 4R16A 5LP6A 1QS0A 4RVNA 2VZ0A 4AWAA 4A3KG 3GRFA 2OO5C 1QRRA 4J43A 3E9QA 3WMWA 2V9WA 4M7PA 3R0XA 3MINB 3JRXA 2QN6A 3RUHA 4AYTA 2H1CA 3PR4A 2QE7A 4MRSA 3VR5A 3DW3X 2O8BB 1RBYA 3DV0B 5AKKA 2QQEA 1BE1A 2VYFA 4EPVA 4AMUA 1XZ8A 1CF4A 1ZD9A 3ZDQA 2BCEA 2FZ5A 1ZD8A 3WSTA 5FWAA 2AMJA 2OKCA 2HVSA 4DC9A 3A37A 1SCQA 4RVFA 2X4GA 3JQ8A 4GPZA 3GWZA 5SV2A 4E07A 5E0KB 4CLRB 2XNJA 5EHQA 4RTSA 5K3WA 2IHZA 5BN5B 4JB0A 4FFDA 4I5IA 4G8DA 2DLDA 2Y0DA 4G97A 4AS2A 3QPBA 5LN1A 3C16C 3OU6A 4N3CA 3TGLA 1FLVA 1LNSA 1V43A 5KOHB 3O9VA 3K0HA 1C3XA 1EBFA 1SZDA 5IUNC 2II6A 4P80A 1T1IA 3QEMB 3GV7B 2NXEA 1V1RB 6NULA 3GLRA 2IYXA 4I66A 4RXMA 3CINA 3MBIA 3IA2A 3RODA 3NIWA 4RPGA 2OK8A 4F9TA 3PL1A 2YV3A 5CYFA 1N5LA 1SXQA 3Q8KA 4E94A 1WHTB 3M1IA 4YUYA 4K6GA 4Q1EA 5AVYA 4ECVA 5DWQA 3MWYW 1NRXA 3QK7A 1UOPA 4LWZA 1PTKA 1JT2A 3TTTA 1IC6A 2Z8YM 1N0VC 1M7JA 1JQLB 4FYYA 4GR5A 2CXPA 3ZE0B 4IQ0A 1RZ3A 4O1IA 3OI7A 1S2MA 4JT4A 2EQBA 1HG1A 5DKFA 4U9IS 1MUUA 3F2VA 5TJ9A 4NULA 3WP1B 2Z6UA 4C2MA 4S35A 1A9XB 4MUHA 1KQGA 4PZ6A 3BA9A 2P77A 4TYPA 3MILA 2PEZA 3D6MA 2R7NA 3IKTA 3FX2A 2FLVA 2FDRA 3KJGA 5TRTA 2VPIA 3J80A 4D8TA 5ITSA 4J9SA 3AESA 3O7WA 2VKQA 1AOXA 2FRDA 1RADA 1A0IA 2BEVA 1CF9A 1JDUA 5KG6A 4EYQA 4HYQA 5M7EA 4QQFA 5IDYA 4RDCA 4D8WA 3VUFA 5ED4A 4NNJA 1X9GA 2CLSA 1QV9A 2HD4A 1YQQA 5KNCH 1ZO8A 1U0JA 2A9KA 2D1YA 3D43A 1KEZA 4O7WA 1WCYA 2OVBA 1W1WA 4LRWA 3TTYA 4B8YA 1QVWA 1V9CA 2QQFA 2Q4DA 2Q9UA 2VUIB 4PYKA 4JA2A 2FPIB 1ZCBA 3BHNA 2EQ5A 1RP1A 2J08A 3QI7A 3VHQA 2FWAA 2ECFA 2D0IA 4D26A 2Q21A 3N2EA 4DTIA 3U7HB 3GEIA 5K0FA 2QAGC 1DGQA 5EXXA 1YUMA 1C7FA 4PZAA 3AVTA 4UNPA 1OAAA 2JGJA 2E4VA 3EVDA 1SCUA 2LV8A 4REOA 2PU5A 2DUUA 1DAKA 4Q4HA 2IHVA 4IM7A 3WLPA 4LBYA 3EAQA 5JZVA 2ZJ5A 1ZYUA 4PNZA 3QKSB 1C1YA 2CZCA 2XF2A 4PG4A 1BA2A 2V6BA 3VPGA 3HXLA 4JLMA 3LWBA 2AUMA 4Q4JA 4Y2HA 3SC4A 1OLXB 5A4IS 3K2EA 5BRAA 3BD7A 2XKAA 2JA5G 1JGTA 3VOAA 4OO3A 1SELA 3DUWA 2AFIA 1NHGA 2YYZA 1HFEL 5E7MA 4BVLA 4Y2YA 2V7UA 1H66A 4DYDA 4NK5A 1GVNB 3VNBA 1UEJA 3IURA 1PDOA 3R74A 1W36C 3HVKA 2R8YA 1GYFA 4MI9A 3QI2A 2VHUA 2D0OB 4DUYB 3DE7X 4B2IA 4Z86A 3M4ZA 3C4QA 1KRHA 1DFGA 2HF7A 4JDPA 2DFPA 4LC0A 4RSRA 4J0HA 4C7OB 1A8SA 5GVSA 1FQKA 4DTCA 4WN9B 5JAUA 2FW7A 1MH1A 2OOSA 1TE2A 2CFCA 5I7EA 2FP4A 3ND9A 3TQFA 3DP9A 1NQOA 4LJ9A 3L84A 1SG0A 3GUCA 1MFPA 3WR5A 5TY0A 4W1RA 1I3LA 3QLVC 1E0AA 2LDXA 2A58A 3F4LA 3T9DA 2ZRAA 3THXA 4HEA6 1SQ0A 3GN1A 1RYRA 1NBEA 1QV6A 3NYQA 3G5TA 3EXEB 3OF3A 2PHZA 5I9BA 3TR5A 5FA6A 1HFWA 3WK4A 4DIEA 1TI7A 1DMRA 1Q0ZA 1YMQA 3KR1A 1KZ7B 2VQ3A 4I9FA 2JFOA 4EBBA 1YA8A 2COEA 3K6JA 1ILWA 2AFHB 2OQIA 1RW4A 1GZ3A 3O3OB 2RDJA 2ZR9A 4BLTA 1DI0A 4Y1GA 1T2FA 2JFFA 4HQKA 3WDLA 2H9AA 4JH0A 3D9QX 4QVKA 1MT3A 1UBTS 3LYAA 1YUNA 3QJYA 1U0RA 4JYBA 5JZOA 1GARA 3H2JA 1B04A 4O2RA 3NU1A 4GZ6A 2I7TA 3M81A 4KBFA 1VG8A 1WY5A 2HLHA 3D6NB 4DABA 2OB1A 1WZUA 1N6NA 1EPUA 2OHHA 4KMSA 3B53X 4JBYA 5DTRA 3DWGA 3OU2A 1NP7A 1NVDA 3UWSA 1M66A 3ETEA 2CHFA 1X7ZB 5B57C 4EX6A 3OLWA 1A2OA 3L7LA 4UVGA 1TKBA 3HMKA 3DEYX 5LB2A 2CGEA 2WWWA 2YBDA 3PO2G 1DO2A 2H57A 5JO9A 1PDWA 1WO8A 1NW9B 4DL9A 3MT8A 1FDIA 2FFHA 2GKSA 4F06A 2IE8A 4B79A 1O87A 2WK1A 2BSQA 4PC7A 4ZJYA 2FPRA 5DJ5A 1FMCA 4NMHA 3KJNA 5LP6B 1QS0B 1JZQA 4U00A 4PC2A 3ICCA 2ODAA 4PX3A 4XVRA 3L49A 1ZXLA 1HK7A 1Q7GA 2C77A 1M2NA 3HRIA 4HWGA 1F9EA 4ZQEA 3PXXA 5K2OA 3PHIA 1WCXA 1UXGA 1A4IA 2QUAA 1DKQA 3HLTA 1G3QA 4JUIA 4CLDA 3IAM1 5B37A 3D3JA 4IGFA 3X1YA 1N36H 1FJXA 1QJ4A 3VC7A 2A5FA 1SVOA 1J8VA 1H2EA 3PX3A 2QYOA 2WYIA 2DR3A 4KQ6A 3WIDA 4LTMA 1SZCA 3JQ8B 3A1WA 3HN6A 3NT2A 1J70A 3CLSD 1HC7A 1V37A 3CGGA 4IIFA 4DV2H 2WT4A 1PJLA 2JFGA 1OREA 2V3CC 3TLXA 2AXEA 1J2EA 4GNRA 2GK4A 3IQFA 4L4YA 2IHBA 1JHUA 2OLSA 1QO0D 2L18A 1W0KA