1EUCB

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
394
structure length
393
Chain Sequence
MVNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 132
structure length 393
sequence length 394
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1eucB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1eucB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucB03
2YZGA 3U9TA 2R86A 4EGJA 1E4EA 2NU8A 1AUXA 4MAMA 2DZDA 3WO0A 2YS7A 1B6SA 1AUVA 3DMYA 4O86A 1GSHA 4C5CA 3K5HA 3N8DA 4Y8VB 5C8YF 1IOVA 1T36A 4YB8A 1W93A 3RV4A 1GSAA 3OUUA 2PVPA 4FFPA 1W96A 3OUZA 4O7ZA 1OBDA 2CSUA 3AX6A 4MV7A 4C5AA 3WNZA 4O7YA 1EYZA 1CE8A 2CQYA 1SCUB 3JRXA 4O7SA 3BG5A 1CQJA 3TQTA 3V4ZA 5BMVF 4IZOA 4ZQIA 3K3PA 1Z2PX 2GQSA 5LA6F 4O4LF 4YAJA 2VQDA 3MWDB 1C3OA 4TV8F 2R84A 4O7WA 2NU9A 1C30A 4HNVA 5I47A 2I80A 4O82A 1BNCA 2NU7A 4HQ6A 4XYLB 1JLLA 5J2UF 4FFOA 2FPPB 4MA0A 3TINA 2V5AA 2GPWA 2FP4B 3QFFA 4O81A 5JVDF 1JDEA 3MWEB 2P0AA 2YW2A 5KX5F 1VBHA 4XYMB 2C00A 4XX0B 4FFRA 3VOTA 1EZ1A 5JVLA 3K5IA 1BXRA 1B6RA 4E4TA 2YL2A 2OLSA 1EUCA 5K2MA 4YJ2F 3LP8A 1M0WA 2CNQA 5HBRB 3WO1A 2DIKA 5D8DA 3SE7A 5GONF 4M9UA 1KJ8A 4O83A 4O7RA 3TIIA 3E5NA 4IWYA 4WBNF 1UC8A 2FPGA 2NUAA 3I12A 2Z02A 1JDBB 4O4JF 4YAKB 4DIMA 3VPBA 1A48A 2VR1A 4I4TF 3ETHA 2NU6A 4YBZA 1KC7A 2QF7A 1IOWA 4IWXA 2YWVA 3HB9A 2ZDGA 4O7VA 4MV4A 5J2TF 1CQIA 4YJ3F 1WR2A 4IHJF 4HNTA 3R5HA 4ME6A 3ORQA 3GIDA 2V58A 4O7NA 5CAEB 1ULZA 2WYOA 4FFLA 3N6RA 2YRXA 4ZI7F 2W6QA 1GLVA 1KJ9A 2YV2A 4FFMA 3HBLA 4FGRA 4Y8VA 2IP4A 3Q2OA 4XZ3B 2GLTA 4O2BF 2SCUB 3UFXB 3R9RA 3PFFA 4MV9A 2PN1A 3Q1KA 5FNVF 3DF7A 2Z04A 5LXTF 1KBLA 2W6PA 5H80A 2YRWA 3HO8A 3JZFA 5DMXA 4O84A 4NYEA 3NUAA 1Z2OX 1SCUA 1EHIA 4WD3A 5BPFA 1OI7A 5KKNB 3G8CA 2YZNA 1JKJB 2DLNA 3MWDA 4HR7A 1KJIA 1Z2NX 4HNUA 2R87A 3JRWA 4FE2A 3RV3A 4O7LA 5CA1F 5HV6A 2VPQA 4XYLA 2W70A 2FPPA 4O4IF 1DV2A 2R85A 5CA0F 2R7LA 2FP4A 1DIKA 3MWEA 3VPDA 4QSHA 1KEEA 2DWCA 4XYMA 4XX0A 3R5XA 3JZIA 2FPIB 2PBZA 1KUTA 4DLKA 3VMMA 2GQRA 4TV9F 1EUDB 3TIGA 5EZYF 1E4EB 2NU8B 4EG0A 2R82A 5HBRA 2V59A 3VA7A 3G8DA 4ZOLF 5LYJF 2HJWA 1M6VA 3U9SA 2CNUA 2XD4A 3R5FA 4TUYF 1I7NA 3U54A 3KREA 2YZLA 3GLKA 5IYZF 2QK4A 4YAKA 4ZHQF 3KAKA 3LWBA 4YB8B 1PX2A 3RUPA 1KJJA 2HGSA 5JQGF 2XCLA 4MV8A 4FU0A 2FB9A 4MV1A 1VKZA 2W6NA 4FFNA 2ZDHA 3U55A 3KAJA 5C1OA 1KJQA 4RZQA 3MJFA 5JQWA 1PK8A 5CAEA 1CQJB 2W6ZA 3ORRA 1A9XA 5C1PA 4YAJB 4O4HF 4O2AF 2ZDQA 3ETJA 1CS0A 2NU9B 4L1KA 4O7TA 4XZ3A 1DV1A 5CB4F 2NU7B 1JLLB 2SCUA 3UFXA 4MV3A 4I55F 5JH7F 3RFCA 2GPSA 5BPHA 4EGQA 2YYAA 2YS6A 3VPCA 2I8CA 3TW6A 1OBGA 1UC9A 1EUCB 3R23A 1M0TA 2W6OA 3KALA 2R7KA 1JKJA 2I87A 4C5BA 2CNVA 5LOVF 4I50F 4IIJF 4MV6A 2R6FA 2FPGB 2W6MA 2CZGA 1GSOA 2YZMA 2NUAB 3AW8A 1VBGA 2W71A 1I7LA 5LP6F 4MA5A 2FPIA 2NU6B 2J9GA 4YBZB 3V4SA 2X0SA 2R7NA 2R7MA 1CQIB 1GGOA 2YV1A 1EUDA
chains in the Genus database with same CATH superfamily
1V3QE 2Z2IA 4ZCTA 4YV0A 2JHFA 4OVKA 3NAQA 5FA5A 3PW5A 1XU7A 2O52A 5BNIA 2Q46A 4O86A 3AEKA 4OOFA 5KQSA 1G4HA 3U81A 4GZLA 3PJEA 4LNAA 3L7IA 1AOXA 5JXHA 1BCSA 1W6UA 2CV2A 4X00A 2IPLA 4O3NA 3EGVA 5KYYB 2DTDA 4IM7A 1FL9A 3S8EA 3A36A 1WHTA 1UK8A 3DE7X 3IVMA 2VUMG 1M75A 3LQQA 3A4VA 1FDVA 4JUIA 2VQEH 2FWJA 3IURA 4R1MA 3V4ZA 5KT5A 3QKSB 3D8UA 1YDMA 2OT3B 3RVLA 1FFAA 3L4KA 3C85A 4UW9A 2BI7A 3WNVA 4BLVA 4IIJB 1DLIA 4Z9BA 4J1QA 3GUCA 1QLWA 4YJHA 4F4DA 3PX2A 5FLMG 1JLKA 2WKPA 3GQBB 1LDGA 4HDKB 2OLSA 2VSOA 1QAQA 1F8YA 3M3PA 4TYPA 4HZUB 3B6JA 1KPIA 4KBGA 1B42A 4KCGA 3O3CA 1PSZA 1QTRA 2YYYA 1O95C 3Q8XB 1XA0A 3GAAA 4UNIA 1JAZA 4M0UA 3SKYA 4H0NA 4PWYA 1HYHA 5LR6A 4KE6A 1QU2A 4JYZA 3VHLB 3H6GA 4FMBB 1GGFA 1G8SA 1RMYA 2W8BA 4CMCA 2AJLI 3R3JA 3JWHA 1ZQ9A 2EHJA 4L08A 4E51A 4BO1A 1I1KA 3ZWNA 1BGWA 1RPTA 1G5QA 2TMGA 1L7DA 4RAOA 5DM2A 1E7WA 3GIDA 4JFAA 2XNCA 4V0LA 5KTKA 1TO1E 2BQ3A 1EP1B 3VUFA 4IGEA 4U2GA 3UMYA 4DSNA 3QYFA 4C2MA 2OCAA 3OZXA 1EP9A 5L6LB 5BP7A 3A4TA 2A5YB 1N3BA 1GTRA 2HCFA 1CVRA 5DTEA 1KK0A 2W22A 3BX1A 1RHMA 1VZ3A 2EBHX 2HX1A 4I3GA 2Y67A 1XTJA 4HYYA 4B2LA 4DV0B 1QZTA 2PV0A 2HF8A 4NMLA 5DBHX 5KQMA 2CF5A 3VDQA 1OC2A 3UW1A 1A8IA 2RBKA 4W5OA 1VCMA 1FJGH 3WGJA 5HV6A 2FJUA 2H3EA 3E9QA 3NPAA 5TIIA 3VPDA 5I7VA 3PUYA 3JZIA 1QONA 2JF0A 3Q3VA 4P3NA 3U1VA 4KSBA 4WE3A 3Q7RA 1MIOA 1MIHA 3VKUA 2NO4A 1ST2A 3L2OB 5L3SB 1RYNA 2MTBA 3I6QA 4U2CA 1FP6A 4JSRA 5ALTA 3NHUA 1FX0A 2VWGA 1KOJA 4AWAA 2VUIB 4TZTA 2X13A 2PKEA 3ZXIA 4C0AC 1ULSA 2HA6A 2XDWA 1L4KA 1NU6A 1YZ3A 3CR7A 4NH4A 3ZVMA 4B3MB 3H4IA 1FSPA 3A04A 2PDAA 1JBQA 3VYTB 1EX6A 4ERNA 2VP3A 3OY2A 4JYAB 1D6JA 1QE5A 3PNMA 5H59A 3FYUC 4BMPB 3JXEA 3V8MA 3SOPA 2PUEA 5BWRA 3PFKA 2H1OA 2H7XA 2PGLA 4X9XA 1D5CA 1PZMA 4WZAE 1GGEA 1IM2A 1Y3AA 1RAEA 4GDMA 4AULA 2QBYA 2FFHA 4EF5A 1ZGJA 1VKOA 2V7VA 3IUBA 2L69A 4D4MA 3PFWO 1PO7A 2JNWA 4K9DA 5KVCA 4PIMA 1T6BY 1ISIA 2IGBA 2FPGB 2KLHA 3W9SA 4UE2A 4KO2S 1RABA 2BEWA 3BHNA 2ZRQA 3FUVA 4YBZB 4ED3A 3STTA 2YH2A 1JQBA 1Q77A 5HJEA 1RBQA 2R7MA 3KYDA 2D1RA 3GAFA 3IJEB 2B8TA 3RDPA 3KPWA 3IRUA 2QMHA 4KIUA 3U7JA 1QOPB 2ZSJA 4G5YA 4CMGA 2F1KA 1WV1A 4TSRA 1O96A 4B0OA 2LUOA 4WFJA 2PQ2A 3GDGA 2CXRA 3HSKA 4FFPA 4CTMA 3O26A 3MJDA 1A0IA 2ZR0A 2HV9A 3C7KA 4L95C 4BNTA 3JVUA 1NHWA 4TLCA 2ZZKA 4B7ZA 4N18A 5MGBA 1Z5ZA 3DR3A 3F74A 4J91A 1T5BA 2QTRA 5LOVB 3IKTA 2QZZA 4DT1A 4GZ5A 5SY6A 3BFXA 1VBHA 4R0VA 3D64A 1L5QA 5C1IA 4DV4B 2EW1A 1TKRA 1USUA 4E33A 2HU2A 1H8HD 1EWVA 2UZ0A 1E4YA 3AP3A 4HOYA 5EZYA 4FGSA 2VZLA 4LOHA 3KVRA 1JNXX 1BO6A 1YDHA 3UUWA 2P2ZA 1OWTA 1KERA 3WGVA 3DAGA 3RTAA 2VSNA 4KOEC 3CLTD 2W6JD 3BMOB 3G5AA 2Z02A 4F4UA 5KJFA 5GGXA 2OWOA 4LRQA 3EEQA 4MW2A 2W9AA 2VQ3A 1KAMA 1ORTA 4WZAA 5KYVA 5J2TF 3FOEC 3ZHQA 3W06A 3KHHA 5KINB 2JI7A 2OCXA 3TL2A 3R9XA 2FG7C 3PQ2A 3WMRA 5BOSB 4ECEA 4CL2A 1VSUA 3OQBA 5KJEA 3PL5A 1FRFS 3E48A 3MXOA 3RKRA 3SPXA 4XD7A 2WP8J 3G8AA 5BQOA 3ER8A 4YT4A 1P61B 3NHZA 5H80A 1IUKA 2P5SA 1J0XO 4FFVA 2YMMA 2O1EA 2P2SA 3KT3A 1D2EA 5C3MA 3TOVA 2IEIA 1F2VA 5F7JA 1MO6A 2VCYA 3B3GA 5CDHA 1I14A 1W5BA 2IYNA 1KJIA 3HO6A 4XYLA 3NZEA 3A6KA 3IQZA 4QWBA 3RSGA 4N3BA 1OXBB 1XAHA 3E7PA 4II7A 1Z17A 4MWBA 4W1RA 1E2GA 4H17A 2LBPA 2FPIB 2NXJA 4XIGS 4WW0A 4GU5A 3L7LA 1N34H 3AEQA 2BEVB 4OQQA 3G0BA 3L0ZA 1NL3A 2IIPA 4GXQA 2RHCA 3GEPA 4ECXA 4MEBA 3RUAA 3GEDA 2CHVA 4LI0A 5I3ZA 2WFLB 2Q1YA 5KNDH 3T1HB 2FDRA 1C2YA 2OUKA 3KWFA 4QJBA 4YRQA 4L6AA 2PGOA 2R1VB 4Z53A 3DBIA 5K2OA 2Z57A 2ZR8A 4OK5A 1XDGA 3HXQA 5CVJA 1P18A 5AVTA 1MKYA 1A9XA 1FS5A 3EA5A 1KY2A 1CR6A 4FKZA 3LQ2A 4WLFA 1ZINA 4I08A 2QSZA 3S1AB 5KOHA 4GOXA 4Y2JA 4HNRA 1K68A 4I9NA 4MQEB 3EIFA 3AEZA 3BQ1A 1M7BA 1H9AA 4V38A 1IZ7A 1UC9A 2IH2A 3DL4A 3PI6A 3QQMA 2O07A 4E32A 3ZYZA 4KXUA 2ZLBA 1JKJA 1M74A 4XTCS 1BXGA 1FP2A 1X1EA 2IITA 3ZG6A 3W9YA 4ILEA 3EXEA 3EXHB 4NYIR 4TKMA 2VAMA 2Q3LA 4ZCIA 6YASA 2C5AA 3SSAA 4HDNA 1FDTA 4A8JB 1JZQA 2UVUA 1UMKA 5IJ9A 1W94A 4ID3A 4EO9A 5H8WA 3THYA 1H2HA 4JH0A 1DQNA 4GMGA 4L74A 4LJRA 5HM8A 1K8RA 2J9YB 1FRQA 2VQ6A 4JGBA 2DUUA 4ASUD 4YRLA 1U8UA 1RWXA 3FXAA 1ABEA 4J7CA 1NRXA 3AFHA 5CM8B 1CRLA 4D9JA 4RCYA 5HGXA 4PSDA 1QG0A 5HUJA 2X15A 1KSHA 4QAJA 1H2FA 3RIEA 1XMQB 2N0SA 3H2GA 3NGLA 4ZGBA 3L1UA 2R48A 3F3KA 1J9ZA 3OU2A 4HGOA 3GLHB 3RYCB 3TY9A 2JFBA 5EIFA 4F4WA 4O7YA 1G98A 1L5HA 2R65A 1RM5A 3EGIA 4RB1A 3H4MA 5JZMA 1SKYB 1QRRA 2RONA 4Q9LA 2IYEA 3U37A 4X65H 1P2FA 1ORHA 4HNVA 2OG2A 5DX1A 2AZTA 4UE3S 5IXYA 5A06A 2I29A 4CIXA 3B51X 4BNYA 2QQ5A 1EWQA 3BMCA 3QJYA 2IDZA 3ISVA 4DUYB 1IJBA 2O2IA 4HRVA 3ZJTA 3LAWA 2EZTA 2W2LA 4Q9DA 3QWAA 3ROPA 4XW2A 1KI3A 3D9QX 3TNFA 3DDOA 4LYDA 1R7RA 3TCNA 4YFYA 1G4AE 4QRDA 3GRUA 4IJKA 2JBAA 1M2EA 2QN9A 2JLYA 3VO1A 5KMGA 3MILA 1V6SA 2ERCA 3DE2X 4D4JA 1T5TA 1ONPA 2FA9A 4GP9A 5LSAA 3GY0A 1KFKB 1OE0A 3UV7A 2JGKA 4PVDA 2DE0X 1QQAA 4RY0A 1D4OA 2DEUA 3WYBA 4C4PA 4F6RA 4KAXA 4LE0A 4D9CA 4OD0A 3FNGA 4R71A 5FBVB 1PLJA 4S04A 4REMA 4U3JB 5HPYB 1SUAA 4XCVA 2HMSA 5JZ9A 3LUJA 4MJLA 2ZB7A 4EMTA 1P5FA 2A59A 5T4BA 1SD5A 4WUTA 3B9PA 3U1BA 2YHIB 1J1UA 2MSKA 1JXOA 2IXGA 3ZHOA 3CMMA 3VC3A 4LOLA 1GU1A 3CV3A 2JLAA 4B8WA 3NB0A 3VR3D 1FPQA 1BDHA 4MHOA 3L8YA 4JJZA 2JVKA 1H0HA 4HL6A 1F7UA 4LFCH 3BAFA 3OQVA 4F4IA 5J2TB 4J9KA 3KQNA 4BAZA 3GV7B 1RC0A 4ZOLF 4BNDA 4EG7A 4OGKA 3AHCA 3D4BA 5JANA 1GG8A 3IKMB 2AQ8A 1ENPA 4N8EA 4XQ9A 4AN1A 2W00A 2WAYA 3GGOA 3FOZA 2QT1A 4ZVRA 1C29B 1RKXA 4JELA 2QG6A 3DFMA 1AVTA 3GXBA 1RJ9B 3RJZA 3OTOH 2XYHA 1QFYA 2PQMA 1PTKA 1PD0A 1OT3A 4A0RA 2ODAA 1QRSA 5F4BA 5HTKA 4DMRA 3NAMA 4P2BA 1AKMA 2DJIA 1XQYA 2CHEA 5DGDA 4CEJB 4LG1A 4NU8X 4TTTS 5EWMA 4QOJA 1Z3IX 2NSLA 2HYIC 4HB3A 1YL7A 1Y37A 3TZQA 3OF2A 3TVYA 1DAOA 2Q0XA 1E96A 4PZ6A 2J5QA 4LJKA 4EZIA 4G5RA 1TM4E 4M83A 4G6ZA 5EFZA 2COGA 3H11B 1PV1A 3ZCTA 2BVNA 1RVDA 4LMAA 3LP6A 3F6BX 3HHPA 4CMDA 2QT0A 5KOIA 3AGQA 2J3MA 5IDVA 4EA6A 3EEYA 1F6WA 2FMTA 3OHBA 4QGAA 3RGGA 4HQFA 4D9MA 4C7XA 1P45A 3VZDA 3H5NA 4G5HA 1TXGA 5DHPA 2AZDA 2DPJA 2WHPA 4W8GA 1REQB 1PZFA 1DXOA 1EFUA 1D2HA 3GAMA 1ZH4A 4ZVLA 1CHNA 1C50A 1BQEA 1U3VA 3T3OA 4PF1A 2JIPA 3PD7A 1W5EA 1Y6RA 3E2IA 4ZALA 4RU1A 4DL5A 3QXCA 4BNWA 3GN1A 2E1RA 3PDIA 4Q15A 5B2EA 3GIQA 4MGHA 1V5WA 1BZYA 3R3YA 3JQPA 4BQRA 2QRMA 2PS1A 2WU8A 3K1YA 3WOVA 2C2WA 1JECA 3ADBA 4HAXA 4TKVB 3DSRA 3L7BA 3NHKA 2IYRA 1WMDA 3BD8A 4INJA 1HLDA 2XCUA 2W2TA 3JW8A 3TS1A 4N3AA 4TQGA 2F7SA 1GVNB 2NVOA 1Q1EA 1T6NA 1T0HB 2PY6A 1SVNA 1DQPA 5DHSA 7REQA 4MTLA 5BVGA 3C3CA 3I92A 1UCFA 3LQYA 1SIBE 2HRRA 4OXQA 1U7XA 2M6LA 2D7DA 4B3DA 2WJYA 1KY5A 4KFCA 1I3LA 4CLRB 3HKCB 4HX5A 3LX8A 2OORC 1RP7A 1UADA 4LRWA 1DCKA 5DM60 4FUTA 1G64A 1NN3A 2VJQA 4HGYA 3A4IA 3PXBA 1N5JA 2NV6A 1U1GA 2RH4A 2ANCA 2QI9C 4R1LA 3W3ZB 1ECGA 5BWCA 3IP5A 1H3EA 1Z6GA 1KQPA 5A3VA 4U00A 2E2IA 2QWXA 2IP4A 1XEFA 4Q1EA 3HCCA 4EY7A 3I2KA 3O1JC 1T3HA 1QHIA 3L7DA 1R4NA 4OJKA 5IX8A 1Q1AA 5FD5A 3HO1A 3EQ8A 2IBMA 5DMXA 2C82A 1U5CA 4GFDA 9LDBA 3QPBA 1LWOA 1Z7EA 5C0OE 1WCYA 1MF7A 2HPHA 2I54A 2QAIA 3LZDA 5I4KA 6ADHA 5IVDA 4IV8A 1E4VA 1PWEA 2FWPA 5K6TA 4X61A 3KB2A 4F5ZA 3GQVA 2ZUEA 4TTPA 4HDCA 1JIIA 1P4AA 4QFBA 3IS3A 2DH6A 1PJQA 1G0NA 1JWLA 1L5RA 4AYXA 4DILA 4B3JA 7AT1A 4DAAA 4J2OA 4PE5B 1P2BA 3H1TA 1AH2A 3K9LA 3UYKA 2ZJ6A 2QLMA 5HBRA 5JC8A 1V2HE 5H70A 1PBTA 4Q1FA 3FDFA 4P32A 4W5TA 2G63A 3Q2IA 4UMFA 3RT7A 3QYPA 4YDHB 3W2TA 2G09A 3GP3A 3HEMA 1PJLA 4IR7A 4X60A 2HJ9A 2RI0A 1RM3A 1QGDA 5JQGF 3EMDA 4KN5A 3WQRA 4G37A 3DTNA 4AO6A 5KPJA 2ZDHA 4W9RA 4O2AB 3KAJA 2Q3JA 4KR3A 4N3CA 1R5NA 1HDGO 3EZFA 4A3SA 4G81A 4GOND 2R60A 3IILA 1QS0B 1V11A 4HSEA 2AN9A 2P78A 3ZE2B 4E94A 4UUPA 3SC4A 4ALIA 3GTMA 3KHTA 3K1AB 4Q24A 1KKLA 2XSZA 4PZ7A 2NUTB 3CBQA 1W19A 4RQAA 4COKA 4FGKA 2BKAA 1J1IA 5HILA 2A9OA 1NKTA 1SCKA 4N8SA 1Q11A 2ZTSA 5C5CA 5DFAA 4LTNA 1YZLA 3PUWA 3PUHA 3DFIA 3N59A 3N42B 2B2XA 4PZAA 4JQSA 2GYUA 3BXXA 5CR9A 1KI4A 1S02A 1ZHFA 4ALNA 4E4RA 3G79A 4HNSA 3LZ6A 4CL3A 2V3WA 4O0MA 1Z15A 3KOZA 2Q2TA 1I0IA 3FDSA 1DCMA 1WBJB 4UBJA 1DJNA 2AVNA 3ZVNA 4U9HS 4BQOA 1SUWA 4L3VA 4E5VA 3N2LA 3KTAB 3SBOA 2O2YA 4A2QA 1XEXB 3WMWA 1A04A 1O97D 1DAPA 3LL4A 2QJFA 3DHEA 5ALZA 4KG7A 4QLAA 4R9SA 2CXNA 1F2TB 1VE3A 1GY8A 3T95A 3O8LA 1M8PA 1PFVA 1YR9A 5EVJA 1UOPA 3YASA 1A4RA 5KREA 2IYUA 3FYTA 1ECJA 1FP4A 4GDFA 4MVJM 4QDTA 2Q5EA 1B8VA 1E89A 4I55A 3ACCA 5TX7A 1MENA 3CPEA 5ARCA 4AQYH 3GRKA 1COZA 3KTOA 4BP9A 4H6VA 2NXWA 4IZ6A 1YFZA 3BA1A 1E2MA 3QFRA 4J0JA 3CIOA 5LUAA 4EFMA 1YS4A 1I30A 5LP6C 1TFRA 5J4KA 5TPZD 1U3TA 1L0BA 2IV2X 2Q27A 6NULA 5I5TA 3IAM6 4C3VA 3VPFA 1VHJA 3OCZA 2V4QA 1IUNA 1EVJA 1WVMA 2RGVA 4JBIA 1U4NA 3QVUA 1K8ZB 3P4YA 1J1ZA 1AY0A 4PWQA 4G0WA 1HFKA 4BC1A 1ZFNA 4BJHB 4LZPA 1U5BA 4GRDA 3PGXA 1P1IA 1XVIA 5K3OA 1DKMA 5TS3A 2WC1A 3HJUA 5ED0A 4OQZA 4RCZA 1ZZEA 3BFVA 4FGRA 1R16A 3V9PA 3ZTTA 1U2QA 4P2GA 2PS3A 1QUFA 1FX1A 1HNWH 3FDXA 4GR9A 4JJIA 3I01M 3BGVA 1D6NA 2COUA 1MDFA 4RCVA 3Q8SB 2V9PA 2YN2A 1HDXA 4CKCA 2RCYA 1V8BA 1NVKA 3FTNA 3I64A 3T99A 4TZ6A 4BNNA 4EAQA 4MGKR 1FXWF 1ZOSA 5LYYA 3RRNA 3NYWA 4NFHA 1A95A 3DULA 3PXCX 4MMZB 4U6SA 1JPNA 3PE3A 4BO0A 1DIKA 2VHQA 4D96A 4MDHA 1CKMA 3QW4B 3D1VA 3MTAA 3E0QA 5HOQA 4YDSA 3A4MA 1UXOA 2POQX 2XXAB 1MO5A 2QTTA 4PONA 3ZKAA 5B2FA 1EKFA 2H54A 2PWZA 4OLHA 5EIAA 4N5IX 5AKHA 2ZWMA 4Q3AA 4BQSA 4EGAA 1L6IA 1Q1BA 3GJQA 3MWYW 4YJ3A 1SVMA 3ZDFA 1VG1A 3RVPA 3NJRA 1PX2A 4FHGA 4IFIA 4RIIA 4QQRA 2ZIXA 2PX8A 2IPXA 1YUNA 3ZV3A 1YRAA 3OTWA 3N76A 2HLPA 2Y1WA 2VEDA 4DIFA 1IBLB 3ETGA 4PO8A 1NW6A 1Q50A 1R8QA 2EBWA 1CKNA 3ZIAA 2H4JA 5IBRA 4Z9XA 1VHDA 1YS7A 1A3GA 4K46A 5A9SA 1WWKA 1Q6YA 3DEJA 3OPMA 5KNCA 2X2EA 2DPYA 2CLOB 4RNDB 3D3WA 4C04A 1Y34E 5JRJA 1DWQA 4L9WA 4JKIA 2QW1A 2H92A 1RU3A 3MINA 2Y1KA 5KS2A 4ZXPA 4D3ZA 5C5JA 3K30A 2HRDA 2EBUA 4Q4JB 2VJLA 4CIVA 3CVYA 1MABB 3C8HA 4D6XA 2VF8A 4GAEA 3NBQA 3B48A 1A9OA 1KC3A 1BX0A 4DRYA 3OCWA 2C54A 2A5JA 1PQPA 4FMPA 3HL0A 4C3ZA 4MA5A 2HJHA 2G1JA 1P2VA 1Q95A 4AS2A 5AXDA 4C0WA 2C9BA 1F5SA 5JQGB 3T5PA 1VI5A 1NGSA 4B2PA 3K16A 2VTBB 2HHFB 2JZOA 1V8DA 5CNMA 3UJAA 4D0SA 2VXBA 1YKFA 1ABBA 3K9WA 3PQ3A 3ONDA 4ND8A 4PR0A 5DLDA 2PVPA 4NAHA 1SK9A 4MO9A 2VJBA 1D1SA 1KQ3A 3I09A 4K1XA 3RBZA 4EHHA 4C6SA 1ZYUA 2R6HA 2WM8A 1K4KA 4H1WA 1YQUA 2VJNA 4OHOA 2GQSA 1GYFA 1CJUC 1DFGA 3F4KA 2QMUA 5HIKA 4X6UA 3K20A 5TNXA 2N75A 3KHUA 2A5GA 5HS4A 2F9FA 3PC6A 2XY4A 4XAQA 1EG2A 4L75A 1RQGA 1GFZA 3DWFA 1KAEA 4P54A 5JZSA 3LLUA 3O83A 3W5HA 3ZWYA 4URVR 1M2JA 3UHJA 3H6HA 4JASB 1SD2A 3Q7EA 2VBIA 2RGXA 1XHEA 2IOHA 3RG8A 4TQAA 1M6VB 1CT9A 5J1SB 2UVVA 3CE6A 2ZJ0A 3MRSA 4Z51A 3GJ3A 3BQ9A 5TQVA 4J3FA 4R1QA 3I12A 1E4FT 4C6RA 4Q3OA 4RE6A 5IKPA 4F06A 4TTJA 2MHCA 4B6OA 3ZU4A 2GEFA 1NIJA 1A8QA 1Z8FA 5J4YA 2CVZA 2C5SA 3K71B 3V2UA 2JAUA 2J07A 2VZ9A 2OKGA 3RJ0A 221PA 3LIIA 2AQKA 4RK0A 5FBHA 5IEJA 2X0RA 4KHPH 4LOJA 3AUKA 3QSYA 3QTBA 4AC9A 4D4LA 3KBBA 1YB5A 1E8MA 2YRWA 2ID7A 4M7OA 4XDGA 4MKZA 1AF4A 5GWXA 4W5HA 4QE3A 1N0UA 1R6TA 1HT3A 3ZWCA 4K6NA 2DECA 1T0IA 2VAXA 3RV3A 3H4VA 3S6JA 1SBIA 3I62A 3FWPA 1M0SA 3DBLB 1GOTA 2RHHA 1K0FA 3DQPA 1N48A 4MS3A 1GN9A 4MR8B 2Q49A 3ANXA 4AMVA 4OUDA 2PJDA 4MWDA 1NRWA 1WXGA 2AMYA 1NVTA 3BN3A 3ZZNA 1NVWQ 1BHJA 1Y1LA 5HDBB 4K6FA 2HJWA 2J5RA 3M7IA 3VNSA 5EJ5A 4ZQEA 2D7JA 4QOSA 5IHPA 1NOIA 4PVCA 1EIZA 4BCCA 1QGED 4GR5A 3GQCA 4TRMA 3FVVA 5HTOA 4QT0A 4PZDA 4OIFA 1Y14B 1PIWA 2F4NA 4ZDJA 1SC9A 1UBTS 2QRVA 3WLQA 2OP0A 5C1OA 4JLBA 2FUG6 4ECWA 2OZLB 1PEYA 2NXCA 4LCEA 1LD3A 3NFYA 4BLRA 2QRZA 2C3PA 3G89A 1EVQA 1VBFA 2C5GA 3KXPA 4JL8A 2RK6A 1WXHA 4MQ6A 5HZHA 5FJ8G 3ZU3A 1EGQA 5IT5A 1EFVB 4G8CA 1KR5A 3DZFA 5AYVA 3J80A 4EPRA 4W9MC 3WGZA 1SFOA 1F9AA 2BSQA 1JGTA 4FIZA 5C7LO 4XLTA 5UKDA 3EW7A 3N70A 4JJ6A 4J9VA 4YRRA 1UXGA 1MT0A 4IH4A 4K86A 1CJKC 4OHFA 2J87A 3O0DA 3IAS6 1RHQA 1IK6A 5JG7A 1Z0UA 2MT9A 3V7UA 3IVGA 4K40A 1ABFA 2WLSA 1TEVA 3MJSA 3D7KA 4GBGA 2FUG1 4E5UA 2YV1A 3OQPA 4QPCA 3N07A 2QD5A 4LFBH 3UGTA 4XR4A 4DS3A 5KFYA 2PWPA 2RK4A 2WUDA 2JLUA 1EFHA 4ICIA 1CWUA 4GI3A 5B30A 4S1TA 3ZK8A 3E3LA 3KR1A 1IOVA 1T36A 4ED2A 4GNKA 2RH8A 3GFFA 4KJXA 3FUUA 5TQ2B 4IS2A 4HH1A 3V1YA 2XMQA 1J24A 4MRMB 4OKIA 3P0EA 5IAJA 4F6LA 2QM8A 3F0TA 1E6KA 4J9SA 5DM0A 4RS4A 1EA7A 4OFXA 1JHDA 4ENSA 1I51A 5IYDG 1FBNA 1ZH8A 1GSIA 2IOQA 1LK7A 2O1SA 4DA6A 4FFOA 1P8LA 5CCDA 3K9CA 4G4SO 1XLVA 1O1YA 3SC2B 5FLXW 1TAGA 2WF7A 3OIWA 5ITSA 3LOUA 2WUGA 3RIGA 1OBVA 1BGXT 4G5OA 2YHUA 3HYCA 2V7UA 2QRPA 4X1IB 1FQKA 4Q18A 2FWNA 3GLUA 4LF4B 1OTXA 1ZI6A 3BB4A 3U0GA 1MNQA 1P2DA 1FC0A 2D13A 3R24A 1X87A 4L3WA 2AOTA 5EPOA 2D5IA 3QV1A 3RTDA 4AKTA 4E2FA 2QQEA 4BQPA 1CF9A 2BFOA 5AKEA 3KHSA 3I5XA 4LJ4A 1J23A 1ORDA 1UP4A 1PFUA 4H6WA 3ANYB 3G59A 2YWBA 2YNMD 3IAEA 3HMKA 5ICEA 2BBOA 3DEKA 2CVOA 2XOKD 1T4GA 5DW3A 4CQMA 4OAQA 3SHQA 5L3VA 3F3MA 1UXJA 4UHJA 1WSCA 4J9PA 1RZVA 4X3PA 1O5OA 3PGLA 4G0OA 1DQYA 4WLOA 4WBSA 2J09A 2E6KA 4ED7A 1F20A 4D9EA 1SUPA 4XWOA 3FHJA 1JLSA 1JF8A 2IHTA 4FMCB 4ENWA 3IDQA 2HPVA 5IULC 3QMMA 3T5CA 1RKBA 3RWOA 4E30A 2YZNA 3H5TA 3BT7A 1YQEA 2CFIA 4J90A 4FE2A 1A77A 3UOGA 3ROEA 5JAIA 1RXSA 3KQLA 3AILA 3QEJA 3TDKA 4MWEA 4CRWB 2IPOA 4NWIA 5KFUA 3CO0S 1IG0A 3TD6A 3ND8A 4YLGA 3MERA 3ZY5A 3LGAA 1X9IA 5C34B 5KDOA 5AM1A 4GSLA 1JSLA 3ONVA 3ODGA 3ZHRA 5IT0A 4Y6PA 3CNOA 5BSMA 1JDBC 2M1ZA 3QU4A 1XXLA 1N5RA 4L7VA 1QIJA 3M6IA 4A36A 3R7FA 5AJZA 2OK7A 2QK4A 3WRXC 1DG3A 1KPGA 1XZMA 1T29A 3EPKA 1CZNA 1T5SA 3U0VA 4ZC1A 3RLIA 1XZPA 2VHCA 4GYJA 4K6MA 4JXKA 2C1XA 5HF6A 2QS9A 1Y5MA 4OP3A 4LHVA 3A11A 4G36A 5TJ9A 3FZQA 2DUWA 3E8MA 5A05A 3NWOA 4NMHA 2R93G 1K0UA 4FZVA 4YALA 4C0HA 2X0FA 4Z4CA 2LNDA 4PXSA 4JU9A 4U2DA 3ZCPA 4G0ZA 1V4VA 4CN8A 1N32H 3R1IA 4PLCA 1ZVKA 1R8XA 3KVNA 4RA9B 4ANFA 2V7PA 5KTNA 2H8GA 3DQZA 2L42A 1JIHA 5C52B 4EENA 3FOCA 4KO8A 2I7XA 4AMYA 4CQLB 4NL4H 4PYNA 1HFEL 4AP9A 3B1ZA 4XRGA 1CR1A 3O7MA 4YUXA 3KKMA 1TD9A 2OOSA 2W71A 2OVFA 2HWYA 5AI9A 1EJ0A 4EQ6B 2E4AA 1QGZA 4G0VA 3CLUD 2D1QA 1HMPA 5HE8A 5TGZA 2C04A 4D25A 1WKBA 2QP4A 1HQKA 1JP7A 4IR1A 3I5UA 4JBXA 2F9LA 2P6UA 1SBTA 1WV0A 2E7ZA 3T4UA 1AKWA 1HDOA 4BMXA 4DCGA 3R3XA 1MJFA 4MVJP 3TR6A 2H1SA 5JW6A 4JHLA 1JQKA 3IP3A 2EJTA 2O3JA 1BFDA 3IPXA 2WUEA 3TY5A 3JQFC 4ZO9A 2GX6A 3OI7A 4TTRA 4Y7CA 4CM4A 4FS2A 1NJ2A 4H35A 3LCUA 4E4YA 3N7TA 3SVTA 1BWRA 1FVOA 4I1VA 2F43B 3OZRA 2CQYA 4O7SA 2ORIA 2L82A 4CZ2A 4MQMA 3AXSA 3RYFB 3WWIA 2CUNA 4N5HX 4R05A 4O5AA 5C8ZA 1CEEA 4GM4A 3RC9A 5IVPA 2WYUA 4MINA 5A0VA 3U4HA 1Z45A 1LKZA 3IB6A 3ICVA 4YJ2B 4EP1A 3RIMA 4DCOA 4FFRA 4NKRA 3MTQA 5CDTA 1J39A 1ZISA 1F0PA 2XZTA 5ANRB 4MK4A 4RHXA 5CK5A 4AP6A 2E48A 2CUKA 3RFVA 2RK3A 3RS5A 4ERXA 3QMPA 1HV8A 4O83A 2RGUA 3Q6IA 3TLGA 2Z0MA 2FW8A 1J5EH 1FOEB 1K7YA 4BO4A 2C4NA 1TYDE 2QU8A 2RE8A 5CXXA 4NCIA 4FB4A 3WWEA 2BFBB 5JAMA 2H16A 3GJXC 3K9QO 4ETWA 4DC1A 4AZ0A 4CIYA 2P6NA 2G82A 3O82A 2GPYA 2JA6G 4B7CA 2WYOA 1TTPB 1RYBA 4PINA 1FFCA 1RWPA 2A35A 3CUEF 3CVOA 3DMTC 4FFMA 3K92A 3DTGA 3ONEA 4GEGA 2WU1A 3MT8A 4K3UA 1O87A 4IIGA 2CXOA 2IZ0A 4XIJA 3SYMA 3SG0A 2I4MA 3T41A 1FCJA 2RAUA 3STVA 3ET4A 2VKTA 4JDPA 1SKMA 4J9OA 3U1TA 3N05A 1E94E 3PC4A 3WHIA 1IHXA 4IFBA 4B5KA 1TUIA 3GYBA 5D3KA 3TG2A 3WGYA 5LD2C 3OMWA 1G8PA 2G4CA 4L0DA 3MAJA 1VXOA 3VHRA 3GO4A 4M49A 3A6ZA 2R8IA 4PQRA 3EFHA 3IPRA 2Q50A 5DEIA 1CJBA 2NIPA 2QEQA 3QENA 3AL2A 1H93A 2YY7A 4B4UA 5IN5A 4NBVA 1S5PA 1T1GA 4OO3A 4O4JA 4UTNA 4YQZA 1S8OA 2JGDA 3J80W 1LPPA 3QMWA 4R1NA 1B41A 1JFFB 5H9WA 3IT1A 5KFSA 1NZJA 2D5BA 2Q5IA 2FZGA 5ALPA 1EX7A 1YVPA 1W36C 5EEHA 2O48X 1SC6A 2HRBA 1LSOA 3ILHA 4KWTA 5DHAA 1EE2A 3FIJA 4WEQA 5JI3E 3C39A 1SA0B 4XM0A 1IHYA 2PZBA 2FR1A 1ZHSA 4OA8A 2Q0QA 4QYIB 1VZ2A 3VKFA 3D1JA 5KFDA 2P77A 1LY1A 2YCBA 5AM2A 3RASA 4Q1BA 5TPWB 3PR4A 5JAHA 2W2VA 1VLMA 2ONKA 3EGDB 1TA8A 4JQCA 1J07A 2A84A 1YB6A 3ITEA 3RC1A 4B3SB 1Q7TA 3LG2A 4RF5A 4H7EA 1HRDA 4BV2A 4NK5A 4UD2A 1S8AA 2R6GA 2V7EA 2G4LA 4ABTA 1H1TA 2K87A 5JWOA 4YYEA 2HG8A 2ERXA 4DUPA 3IQIX 4F2WA 4JENA 3R5SA 3OLQA 2AEFA 3R7LA 3P97A 2YV5A 1I7LA 2DABA 3C0KA 3PR2B 2IYAA 3QVWA 5BO5A 2GLXA 3D81A 3NP7A 2HGXA 3W2EA 2H0AA 3QFCA 4AJIA 5CH8A 1P7CA 3U3MA 2A9RA 1JG7A 1QR6A 1NNLA 3TQFA 2O14A 4IPTA 5KTTA 2X1VA 5GZ1A 3T3GA 2WB2A 2IYPA 3N8DA 2Q0HA 4KWCA 4IW3B 1T91A 2P6MA 1RTTA 2PCJA 1YR1A 3WSVA 1OXXK 5CLQA 2VP9A 3TECE 1MGOA 1S9DA 1TUGA 3SJBA 4MS4A 3WK9A 1LRKA 4MLPA 1CE8A 3PKJA 4YQWA 5TF4A 1EVYA 3ABIA 3QBVA 4OFBA 1NDHA 3O6VA 3GT4A 4HC4A 4ZAXA 3SC3A 2AKYA 2C20A 5I47A 4PPQA 1RYFA 3MTBA 1E9DA 4XLLA 3ISJA 3MCVA 2A0FA 1F8GA 1KU0A 1A5ZA 3HXKA 2VOEA 1AK2A 2VWHA 2DGDA 1R2QA 2FEMA 2C7QA 2PX4A 1IAVA 3AETB 1ML3A 3THRA 4FBUA 2YWGA 3IQFA 1YC5A 2CNQA 5HJ2A 3S1LA 1QO0D 2FPLA 3AYHB 4Y2RA 1DTEA 5KFWA 3NCHA 1YZUA 3DOHA 3KKKA 5EGSA 1HNXH 2R7ZA 3B9QA 4C9BA 3T06B 3FYDA 2Z4SA 4XI9A 3PITA 1TUBB 1XFDA 3CEAA 6PFKA 4BEBA 4QREA 3DUFA 1JHOA 4PHCA 3KSMA 4DMFA 1N2SA 1Y1QA 3B1FA 2B1QA 3UATA 3QLUC 4TMTA 1WULS 5EMJA 3LKVA 3DBHB 1ZK3A 3HBLA 1DIBA 3KSUA 3DKKA 2GBPA 4L8YA 2PSEA 1A7JA 4HY3A 4DL9A 4J7AA 2XUDA 2IEGA 3JQCA 2IGTA 1GPAA 3DE6X 4NZ9A 2VOBA 1L5MA 1M6EX 4NYEA 5BSVA 3GLFE 3IB3A 2HW8A 3BTOA 2XCOA 1ZD1A 5DN6D 1OXVA 4MVCA 5CP8A 4A1FA 2F6RA 4FCWA 4RV4A 5BVHA 3R20A 4BS9A 1G5PA 4C7OB 2I4TA 2H2AA 3O92A 3RVOA 5B1SA 3AO0B 2L18A 4RF2A 3WHPA 1M2NA 4LRUA 2DXIA 3JQBA 1P1CA 4LHYA 3CRRA 4WXHA 1P4RA 4ND3A 4OJYA 2D62A 1KBZA 3PFHA 3TIGA 1TWGA 4A0HA 4FP9A 3Q7IA 2M1XA 4KITB 2OEPA 1P1KA 3AV0B 4G41A 2XTNA 1CZLA 1KRXA 1P91A 2WJAA 3F1KA 4QHTA 3OFVA 2BYTA 1RK5A 3MQ2A 3RRBA 5HKKA 1Y3FE 1X77A 5FI5A 1EX1A 3O4HA 1RNLA 1KY3A 4N7RA 4ZPJA 3W9UA 3BIOA 2RGGA 5GQSA 3A4NA 5EMHA 4FFNA 4QVKA 3UTCA 5DRTA 3N39C 4QOEA 1G38A 3PRJA 1KF0A 1OH7A 1L8QA 3GTGA 1GDHA 1VI6A 5BW6B 3HCFA 1Y9DA 5FA6A 2FQXA 5EE0A 3F6EX 7GPBA 4CODB 1OJLA 4Y7DA 1T8RA 4DR1B 4XZ3A 4X62H 2J3HA 1KK2A 4M3NA 1RJGA 3ZGVA 8GPBA 1QC5B 4R0MA 1K75A 2IS2A 3SBXA 1YQWA 4HWSA 3IERA 3WTBA 1WZIA 4Q93A 4EGQA 1E3IA 4CI0B 1BXRB 2FGJA 4O25A 3QLVA 4X54A 2VK4A 2PANA 1Q0LA 3CNNA 3S99A 1JHXA 3AR2A 4W4TA 4AF7A 5CA0A 5LJIA 3AOEC 1XRLA 1D2RA 1HYEA 1F4VA 2V7XA 1XHLA 4DV2B 5E0OA 2BCEA 1HG0A 4DUGA 4ZVTA 3FUWA 2CB0A 2AU0A 1M66A 3RB4A 4CMFA 4RTRA 2OR3A 1CQIB 2VHZA 2L2QA 1RYEA 3PFNA 3B36A 3TOSA 5F1PA 2GLUA 4PYOA 1G6OA 1WZNA 2DZDA 3GLFA 4FNAA 1H1LB 1E32A 2CLHB 1FY2A 2ZJFA 2Z8YA 1DEXA 1V7ZA 4E3WA 4CW7A 3MA0A 4Y6GB 3BULA 1TM5E 2C4WA 4ZVPA 1KEKA 3TNYA 5J59A 4Y2GA 2OZEA 3RADC 2V6JA 1UBFA 4QARA 1G60A 1U0BB 1JVSA 3WLSA 1LCIA 4AL4A 1NHGA 4CT0A 3LHFA 4TQ9A 3FN4A 2VSYA 3ICPA 1XRSB 4Z54A 4X3OA 5ECDA 3Q7PA 3DGEC 4D26A 4GKKB 2VDNB 4JUZA 1DB3A 3GNQA 1KY4A 1CUAA 4FC7A 1RRFA 3QTLA 3JQRA 2LPMA 1QQTA 4EWLA 1TRKA 4WASA 1DKNA 1T9GR 4KLAA 2XZDA 1HZZA 1V1MB 1FRZA 2HDNB 2I22A 3RBAA 2WWIA 1IU9A 1GPWB 2Y0EA 1VLLA 2VDLB 1X6VA 2FFAA 1U1CA 1PJRA 2J4FA 3FRHA 1KRWA 3QBEA 4DAEA 2NU6A 4J0HA 3D6FA 1QYRA 2QUAA 4CC5A 1SN7A 2ZDGA 2H3HA 1XRPA 1Y3DE 5KG1A 1Z07A 4BO6A 2JLSA 2XUFA 3RTCA 2HZBA 3RS8A 1CU1A 3FDZB 4WOJA 3N7UA 1BVYF 4NS1A 1YR7A 3KV1A 3QPAA 5KG4A 4BLOA 1NW3A 2RGYA 2XW6A 1XPOA 2PN1A 3OQIA 5FNVF 3N75A 1C7RA 1P80A 3S2EA 1ZD3A 2R6AA 4IF6A 5JCJD 5H16A 3FJ1A 3M0EA 3EHDA 4BAUA 3LHKA 1L5FA 3TH5A 3E7XA 3G68A 4L6CA 2AKEA 4AURA 1SK8A 2VEOA 4FOTA 3MS4A 1YR6A 2X3YA 2R7LA 2HHAA 4MI3A 2GILA 4B5LA 3Q7QA 4LZLA 1ZU5A 4EG8A 1J5XA 1DO2A 2XBLA 2JIZA 4BIMA 1QYIA 2C9DA 1YAJA 4DJAA 4LTDA 3TEFA 2ZUVA 3HY4A 4EX7A 1I8TA 2IEBA 1IJKA 5JU6A 4K9NA 3HKDA 3U7RA 2NSJA 5F78A 3OQJA 2R5FA 1R0YA 3AI7A 3CR3C 4HYEA 1UZNA 1IBCA 4KC0A 2MDTA 4ZOBA 4AS3A 3V4VB 1WP4A 5DCUA 1W73A 3K6RA 1S2GA 2NVUB 3OHPA 1SHUX 5FUWA 1NNSA 4FHEA 5E3JA 1AO3A 4MW1A 4O4LA 4Z49A 3LPAA 3JQAB 1V16B 2H1VA 4EKNB 3GGPA 5FQNA 2NTVA 2C0QA 4C2BA 2VPTA 1NQTA 4DJEC 3Q9SA 3LUDA 4FSHA 4NBUA 3ZLJA 4JR2A 3H6KA 2EL7A 4PBRA 3C6ZA 3K4HA 1SCAA 4HH0A 4ZAGA 4NZMA 3KBOA 2SBTA 4XTRA 2EWMA 5ULLA 4RW0A 3ASUA 5HF9A 1PSDA 1Y81A 3ZWWA 1YVUA 3HOWG 1PFKA 2XVYA 4JI7B 4FFBA 5E25A 1L4EA 1RXUA 2GVDC 1ZHQA 1WW3A 3IPLA 4TTSA 3FX2A 3IDFA 2Q8QA 3WICA 1BW9B 5J23A 4GVPA 3HJCA 1UKVY 4PY2A 2OC4A 1ZGCA 4IHJA 2FUCA 3DQQA 2ENWA 1AURA 2W9BB 5AXBA 2FXVA 1DJMA 4Q03A 3I4LA 3IXLA 1XAIA 2BGNA 4EPWA 1Y1KE 2R96A 2BBWA 2VK1A 3CF0A 4AJ2A 2O2GA 4O7ZA 1RLTA 4ETNA 3E7WA 1FSSA 5CHEA 4JBHA 1VQ1A 5BWTA 3HI4A 3ZD6A 3PSAA 4UM7A 4ZDKA 3STXA 1K6IA 1JNYA 1CRZA 1NBWB 3UUEA 3QVLA 1T8UA 2ZUUA 1X7YA 2MSEB 1XRMA 3BYZA 3D1LA 1Q7EA 4EEZA 4MXDA 3FPEA 2HVQA 3MWEB 5A1JA 4FINA 2RGDA 1L7RA 3UV6A 3IDOA 3I9NA 1S7GA 1NM5A 3K35A 4MNTA 1U2PA 1B6RA 4CJXA 1ENOA 3DB2A 1X42A 4IDHA 1SC3A 5DXAA 3CJTA 3VRHA 4DPMA 1Y8ZA 3JQ9A 2AS0A 2CVFA 1SVWA 1KHHA 3P27A 4KBFA 1R3DA 5JBIA 2XMGA 3E1GA 1Y6QA 3TSZA 1T24A 1Q0ZA 4R9RA 1TFUA 5BW8A 2VR1A 1C9MA 1NOKA 4DCCA 4LY0A 5J5CA 4BLTA 2KE5A 1YL6A 3HHEA 5C4IA 2EW2A 2GNPA 3R0VA 1HT1E 3ROZA 3H5IA 3V6LA 3ET5A 1TQ4A 3MMPA 1IFXA 1E79D 3OE7A 4QWCA 3JSNA 2QN8A 3DYVA 2QL9A 4KX5A 2GO1A 2GLTA 4G24A 1QIEA 3AR7A 3FNBA 1ZRHA 2HBRA 3H2BA 3BMNB 2RCNA 1QG6A 3U4QA 4PG5A 1E4OA 3EPRA 4U6QA 5TMPA 4A3BG 4WD3A 2ATCA 4EJSC 2HDWA 4DARA 3QWUA 4N0DA 1KIAA 1W4AA 3CSUA 3HE3A 3JPWA 3V1NA 1BD3A 3E1SA 5IYBG 1SXJC 4Q1VA 3CZ5A 2ATIA 5LQAA 2PSHA 3GF4A 1GUFA 4YAOA 1THZA 4XGRA 1NMZA 3GMDA 3KZ1E 3C3KA 4KWIA 1YNSA 2ATVA 4XFKA 4ZOLB 1RAIA 3QEMB 1YVDA 1F4PA 1Y4SA 4LF7H 4F1JA 4BNKA 4EBDA 2E5LH 3VH4A 1TW2A 3QOXA 2V4UA 1E3WA 3AGPA 1XMSA 1AKTA 3SZRA 4BV8A 3PXEA 2QDKA 1RQ2A 5ALMA 3NTLA 1GTL1 3F7OA 1P44A 2PA0A 4I1IA 1JEOA 5FNVB 1E1RD 4Q6WA 3VGPA 1YDFA 3ZE9A 3CEPB 4W6ZA 2A67A 1FZQA 1E5DA 5GPBA 4TYQA 4DLUA 3RFUA 2B7CA 2C78A 3BDVA 4ZREA 4HLUC 4CT5A 3GJ8A 1GNQA 3T7EA 1Z63A 2ZSDA 4F50A 2FPOA 2C2RA 3DGFC 4YXWA 2H1IA 2PGDA 2GPSA 2AT1A 5K03A 2P75A 2UZ3A 5CA1A 1EUCB 5ESWA 3OFSA 3VSEA 2BI8A 1H1DA 2WM2A 1Y9JA 5B58T 3TKAA 4F4ZA 1T5OA 1AGNA 2CNVA 5ERXA 1TZKA 1E1CA 4P33A 1KZHA 4YRPA 2ZJZA 3O8OB 2MSLA 3WGUA 3F5FA 2CMFA 5DK6A 3RRJA 3V4SA 3JAWB 5LZ7A 2V0CA 3CX3A 3X1ZA 1CVIA 4YRBA 3SVLA 3W5VA 3FE2A 4ENRA 4IQ8A 1YNOA 2PT9A 2G9NA 2YBEA 1NPTO 1DBPA 3WWPA 2QAGA 4UM9B 1HFJA 3JQAD 4N3NA 4KZKA 4AO8A 5A02A 1SKQA 2ZM6H 2C92A 2WE7A 2BTQB 4UVIA 4F93B 2BUCA 2ADMA 1E2UA 1ZWLA 4X1KB 1NBOA 5FWYB 3QXXA 2QNBA 2HPZA 1N5LA 4HH3C 1MQAA 4RZ3A 5FLXA 1WCXA 1E8NA 4DR2H 1E0DA 3CUYA 5M2QA 1YF3A 1X38A 1Y4DE 3AEUA 3P26A 1U2DC 1Q2XA 2W7TA 5BMVF 5DTIA 5HVNA 4YAJA 1USKA 5AQEA 7ABPA 2J1LA 5SYAA 4BXOA 3AQ4A 3RUDA 3ES9A 5L6MB 3IAM1 4P4SA 3RAPR 1JAXA 2FPMA 3MWMA 1VYVA 4UTPA 1RRGA 4Q1AA 5JD5A 1II8B 2ZR7A 4TWIA 5KFBA 1ZOLA 5C1BA 3SEQA 3ANSA 2IBTA 5K2MA 1OLXB 1OTHA 2XVMA 3CW2A 3HVUA 2OGZA 3NP9A 3NEYA 1F60A 1BIFA 4FGWA 2QA5A 5E7IA 4E0BA 2HMYB 1YZHA 1XJQA 3ADDA 1T9ZA 4U7CA 3B3QA 1P6XA 2C9YA 5E4TA 1RLMA 3WIBA 3QKIA 4EABA 4ZJYA 5FTKA 4M8KA 1JHYA 1W0KA 5AO9A 5E1OA 2B4KA 1N0IA 2Z1NA 1QH1B 2O2XA 5H4GA 4DLBA 4WESB 3DMNA 3I37X 4JR0A 3P9CA 5E4FA 3DDHA 2QSUA 3BRQA 3RKSA 3UAZA 4KV7A 1YZNA 4JLJA 4CM9A 4R40A 2Y6VA 2FPSA 1NV9A 2IX9A 4CKXA 2RMKA 3B5EA 2QPOA 1B23P 3DE0X 3BSFA 3ZGOA 5KNDA 1GN8A 4LJSA 2C2GA 4XIFA 1NG9A 1SPXA 5FKJA 4B6PA 4LJ7A 1TYZA 1ESNA 1EFPA 4C4SA 2WINI 4LAFA 4RVNA 1KDYA 4XJVA 3HCOA 5CLHA 4ZK2A 4MLDA 1OU0A 5JFGA 1TGVA 4BNMA 5K0FA 4ITVA 1CUWA 3EXFB 1OREA 5A5GA 2ON6A 2UKDA 3FOAA 3HJAA 3NTQA 2VA2A 5AHWA 5EE3A 3FVWA 1A0OA 5IUKC 1PG2A 1QRAA 2O4UX 3KQQA 4TRRA 4Y9TA 4C01A 2NU8B 2I4IA 1EXNA 4CUKA 1NUSA 2WPDD 3A9UA 1GFWA 1QHNA 2UYOA 1UOOA 1QP4A 3OPYA 5HK9A 1KAQA 1C81A 3VNAA 2EKQA 3KUUA 1IBMH 1R15A 4JJAA 4LXQA 2B8EA 2GZ3A 4PTZA 3L7JA 1Z5OA 2GT1A 2PA3A 4WGGA 4Q4HA 3TM5A 1N2EA 2IE8A 2NO9A 2FR0A 4LKRA 1M2OB 4NP6A 1IXSB 2QVYX 1LA2A 4ECYA 3A1DA 3S2FA 4GECA 1JALA 2JCXA 5EIOA 3IQWA 4OK6A 2OESA 2H5JA 1OZHA 3AR3A 1RHUA 4AICA 4PYJA 1PQYA 3EK2A 2EX4A 3CNEA 3K2IA 1AGRA 5HDQA 3C1UA 2AFIE 1Q3TA 5T4HA 4LOKA 3KTDA 3KDSE 4N1AA 1PL6A 1R18A 1KI1A 3H04A 4NYMR 5AIAA 2XOEA 2WA1A 4FBTA 3P9PA 2QOEA 5E6UA 3GFQA 2W2MA 1PG5A 5B64A 1TJ4A 5B53A 5B6IA 1DAAA 3A27A 1GCOA 2GQ0A 2DFTA 4B3XA 3KEQA 1QGYA 1ISPA 4MMYB 4CL0A 3HBJA 1Z82A 3WAJA 4DV5H 1YE5A 1VI2A 1NLMA 1P4JA 2FEWB 4IX9A 2ZVJA 1BS1A 5DGBA 1VL8A 4KE9A 4DR4H 3D5TA 1DU4A 2HSWA 3ESZA 3HQ4O 1QF9A 3MN1A 3WL8A 1TGYA 3UV3A 3EG9B 5FOXA 1QQ6A 1DIGA 3BL5A 4Z3OA 3B9RA 4WNCA 2OQRA 2XB6A 4K6OA 3RGWS 3PSHA 2MINB 3RTGA 2C3MA 1T26A 1QJ4A 1GDDA 4IILA 1JLMA 4HLDA 1HMYA 4A16A 4ZRDA 2EQAA 1C30A 5AI5A 1LI4A 2IW1A 4D8YA 1EFDN 4NJEA 2WV7A 1AKVA 1JYEA 1YONA 1OA1A 2YV3A 3DF9A 4J9MA 1YZFA 1GTZA 4E15A 3TD2A 4AQDA 1QE0A 2X4IA 4UM9D 1Z8HA 1BJTA 1A5SB 3LHIA 3NDJA 4DCPA 3TTTA 3U7QB 4IICA 3ZLUA 4DCSA 3GLIB 2XKKA 3B8EA 2AZXA 3BF7A 3DZJA 3AR4A 4TSFA 1FFHA 1XXHB 1GZUA 1W8IA 5GV7A 1CUBA 1O5IA 3SLRA 1NXQA 3PICA 3U5TA 2BF7A 5I5VA 2GKSA 1XKTA 2ESRA 2AFIA 1Y8AA 1QLHA 4HX2A 1XEWX 3QLTA 3G0GA 1FDIA 1I1LA 3AI1A 1XYYA 4MR9B 1MEEA 1UM9B 3AJ9A 4ISBA 4ALLA 1N3IA 5B1DA 5G41A 2AFVA 1L2ZA 5HEKA 1KJ9A 3V7NA 5BMVB 1V5IA 3T1YH 4JCOA 4BVAA 1V45E 3U13A 3L0SA 4MWSA 4GWLA 1PNQA 3BKWA 1NVVQ 4CM1A 2IL1A 1ZEMA 2C94A 3GMSA 3IUEA 1NJFA 4O3FA 2QNRA 1P33A 4KGXA 4NFSA 1FFWA 3GV0A 2ZYRA 1B0ZA 3F2IA 4AJHA 1M2VB 1E5LA 5NLLA 3MUFA 5CT9A 1QVRA 3QELA 1W30A 1QFJA 4JZKA 2OAQ1 4O3OA 1EUYA 1W6RA 2YXBA 1KYYA 1IB6A 2WTFA 1GAQA 2VQFH 5K6AA 2ATLA 1H2XA 1GZSA 4I50A 3AOGA 2ZAYA 3OQ6A 3M5WA 3PJRA 3KVYA 3WRYC 5CJPA 4JV0A 4QTUB 4G85A 1OWOA 3QITA 5DNYB 3WLJA 3UH1A 1WKCA 2AW5A 2XKBA 5L95A 2HR1A 1I2AA 1CUEA 3PTAA 3PC7A 1O9BA 2WVHA 4EELA 2ZG6A 3G6KA 2MR5A 4JA0A 3EOBI 3CKKA 1J5PA 3C6KA 1PQWA 2IHVA 1EFLA 3V7FA 1ODFA 2XUGA 3C0FB 1E7SA 2PZLA 3JATB 1HE1C 2FB9A 3NDIA 5FORA 2ZQYA 3E8XA 1PK9A 4MMXB 4GO1A 2VFAA 4RJKA 4IEFB 7MDHA 1ZSYA 1CQJB 2DYKA 2CFSA 3BA9A 1WTAA 1QIHA 4OMFG 4ZO7A 1DKPA 2ISQA 2XB4A 1NBHA 3WKCA 3U3JA 1ZC4A 2W83A 3A25A 2XGGA 5KEIA 1UJCA 3S28A 5DG8A 1IN7A 3OHMA 2HYDA 3N58A 2HRCA 4A6XA 2W2XA 1OAOA 3L6UA 1K3TA 3IAS1 4BQQA 5HKLA 1Y82A 4Q7EA 2VDRB 2GCOA 2V97A 4A2PA 2FLLA 3GT3A 1XDNA 1PUJA 4QXPA 4J0IA 1BJRE 5A2GA 4Y2YA 1OBHA 3W1EA 3V2GA 1VL2A 3AUFA 2ZJ1A 1B26A 2OCIA 2FMXA 2O5EA 3TE6A 1KEUA 1Z68A 2ZIWB 5TR9A 4DM4A 1VE7A 5LDHA 4MS1B 1FQOA 4HVAA 4FYIA 4HWGA 5D1OA 1CEXA 2PPLA 3DDNA 3EH2A 3C5EA 2HK8A 1S2DA 1HM5A 1JLRA 4BO3A 4H7FA 4E21A 1SU4A 4BO5A 3BMQA 1U90A 3RLFA 1U8EA 4TVIA 1DXHA 5LBTA 1KJZA 3A10A 3N1UA 5G0SA 4WGFA 5E1BA 3KLMX 1Y8CA 3CS3A 2O3UA 5GY7A 3NLLA 3VI4B 2XMBA 4WNAA 1FIUA 4UXJA 5HWSA 4RVFA 2ZSAA 4CV3A 1MZVA 3UT5B 3OZSA 4EDFA 3IHTA 5F2KA 3FIUA 1B73A 2YJ5A 2FK1A 3LVRE 4OH1A 4QJ5A 1JIVA 1IXRC 2HHHB 2NU9A 1NG1A 2EF0A 5I6DA 1QVAA 2X9GA 4KDCA 3R0ZA 2DQSA 4PNEA 5JSZA 4HBGA 4IKEA 2JA5A 1EZ1A 4PC7A 1DZ3A 3N2EA 4GE3A 4JDUA 5AW3A 3UT0A 1UDXA 1BS2A 3UTDA 5JZVA 5HG0A 1UKYA 3E03A 4P93A 2CB9A 4JLSA 3SE7A 3VH3A 3QF4B 2D2FA 1S2LA 2HHLA 4DTCA 5D7NA 3HUUA 4LV5B 2DBYA 3HG7A 4YQFA 1S0OA 5KWIA 1UPCA 3OZUA 4QOIA 4LXGA 3TW8A 1Y8RA 3C8MA 4FYMA 4H7KA 2W2KA 5FLEX 2JRLA 3VR6D 2ZTLA 4QKQA 1MVOA 3WJAA 3UMJA 5FJJA 1ETHA 2VSXA 4A5OA 3RAGA 1AN0A 5I3CA 1I6WA 1U11A 3T9DA 4M7PA 3LYUA 3N6RA 3KHRA 3UGQA 4UUAA 4U6NA 1SUIA 1DG1G 4BQNA 5GVSA 2GCPA 5B7NA 5JS7A 3I4CA 2DBVO 2DFKB 4NRDA 1KJNA 2IRWA 3WY9A 4N5DA 4C6TB 1UFOA 2OV6A 1HYGA 4AQ7A 4PYMA 1PWYE 3DF7A 1PGOA 2UUCB 2RKWA 4XCXA 2FSVC 1BC5A 4L4SA 1SCUA 1CDEA 4E13A 1YOVA 3C4QA 3ENQA 4CMKA 1TJYA 4XIIA 1NUHA 3B6EA 4L4ZA 4G23A 2VP0A 3A9VA 5D1PA 2HWKA 1SAYA 1OR8A 1TMKA 3KB8A 4J0GA 2G6TA 4CLHA 1L8LA 1Z0JA 1A50B 3B70A 2QIOA 2SICE 1NVAA 2FK8A 2C28A 5FRDA 3IE1A 4MZXA 3TCKA 5KSOA 1K06A 3NOOA 3AYZB 2Q6VA 1RK6A 2X14A 5ITVA 4UTXA 4ILKA 1P2TA 2ZS9A 1ORWA 3I8XA 4UPVA 4KH0A 2PMDA 1T4MA 3S8YA 2V59A 1BQ4A 3SR0A 4PNHA 5EIWA 2QP9X 1PS9A 3SC6A 4A03A 2P2CA 2J6IA 4HS4A 2FWAA 3FJYA 3NIGB 4OSEA 1BA3A 2C42A 4NXMH 3ZH2A 4XUEA 1ULHA 5JBNA 3BGSA 4CKEA 2CNDA 2H07A 1SQ5A 2BGLA 4ZTBA 1GKKA 5LUBA 1F5NA 2HEGA 4RCNA 1R74A 4UPDA 3LLSA 1RI2A 4BC0A 3STHA 2IHUA 3ORHA 3U7EB 3N41B 2EJUA 1BEEA 2YWXA 3G2MA 4IMIB 4FFDA 2BP7B 2C2XA 1OJ7A 1C80A 4OX9B 2YVLA 4AD8A 2D59A 1T1JA 4WV3A 1O6FA 2P65A 3LSYA 1HQCA 3VOSA 2HY7A 1CUJA 1BMFD 3TXYA 4LS3A 2QLBA 2FMHA 4B8YA 1ZO8A 3KQSA 4MP8A 2D00A 3SF0A 2W6MA 2N1BA 2W42A 1QH9A 4WFQA 3GRCA 3DONA 1Q12A 3FCEA 5T67A 1G17A 1F12A 3RIYA 1PL0A 4PYIA 3KPYA 1Z4PX 1IE3A 2DHDA 4KQ2A 3JQ6A 1HOXA 2X1MA 1N1DA 4CEHB 4BJ5A 3ENZA 3HU1A 4PLGA 3CISA 1I4DD 2HSJA 4PAMA 1ZRMA 3KM0A 3VNUA 3RVQA 1W1UA 1MOPA 2ODQA 2YQ5A 4MUGA 4NG5A 4X5OA 3WTCA 4M86A 1K63A 4YAGA 5C4XG 2K2WA 3D3EA 4UUMA 3BCRA 2WG0A 4DLZA 1LLDA 2PNFA 3UO8B 4MW0A 2VBGA 2YKGA 5BSFA 8ATCA 5LA6F 3T5MA 4CHGA 1G8FA 5FD8A 4QYWA 4DLVA 2B3TA 2R6JA 3T5LA 2B92A 1CPYA 1XCLA 4YRAA 1ZNZA 1OX4A 1GGHA 1TT5B 2MYPA 3RSHA 3WZLA 1H85A 2WWXA 4WCFB 1SCDA 3PUVA 1C3LA 3UJPA 1CD5A 3CINA 1Q21A 3HWWA 2D8AA 4WOBA 3E23A 2RHBA 2IP2A 1C7EA 4JA2A 4ZYXA 1E1NA 4M7EA 2RD2A 1E2PA 2CXSA 2O57A 3OAAA 2A7XA 5EXSA 4ARIA 5ER9A 3BQNB 3GEGA 3GR6A 5JFTA 5JMWA 3LT4A 1P0PA 5KFXA 1YBAA 4TS3A 5FUMA 4WN9A 4OXIA 4F85A 3EF3A 3SJAA 4W63A 5B58C 2F8LA 3MMZA 4Q02A 3A6JA 3DC7A 4HTFA 5K3AA 1OILA 3BWMA 1PZEA 4CMEA 5KVVA 1ULZA 3SQXA 6ABPA 3W4IA 4UUQA 1KPHA 3E9YA 2YFQA 2JDID 2BQRA 1TL7C 4M0LA 2XIGA 1L7AA 2F3UA 4FEGA 2VDVE 5EJMA 2DY0A 1Y0BA 1UEXC 1VJTA 4S1PA 3NUAA 1G8AA 4UAJA 3L3BA 3UK0A 1Y1WA 3L6BA 3OLCX 3BH0A 1DJPA 5CX1A 4H7IA 4D9HA 3MF4A 2Q4TA 2ZAOA 4HNUA 1POXA 1UP7A 4P58A 1K1EA 4QXRA 2BR4A 3DD1A 3OWHA 3T0GA 2R68A 3EVCA 3GDFA 3HJTA 2CYCA 3HA2A 2COKA 5EJ4A 5DNDA 1YJAA 4XX0A 4MVWA 3P0RA 3T1QA 3GLSA 3VR2D 5BXYA 2NQ2C 2V6IA 3Q8LA 3JQ8B 4WH0A 4OQDA 4Y6OA 3TKYA 4W9NC 121PA 2EWVA 4IGKA 4NONA 3WL4A 1GR1A 3GX1A 1VHLA 1ET0A 4QYTA 2X5NA 4FJ1A 2EKZA 5K3FA 1WDLA 4B09A 4IOMA 4Z8XA 1G21E 1G5RA 3K0CC 2QSYA 4LGCA 4Q4DA 2WD7A 2UXDB 4D0LB 4ZWNA 4MHTA 3L18A 4BEVA 4NCKA 1H8EA 1T9GS 1DKOA 3V42A 2HWXA 3V8EA 4HBZA 4K9PA 4F4HA 3BQ2A 1FNMA 4REOA 2YZ2A 1HTTA 5G0VA 5AUOB 3RFCA 4PU0A 4INZA 1K92A 2Z2KA 1JDPA 1OYWA 3P9XA 4YHBA 5KFJA 5C37A 1PTJC 5REQB 2Y4OA 2I3ZA 2V7BA 5AJXA 4JI5B 4QFDA 3M6WA 1NLYA 1Z5GA 4IEIA 5I5SA 4BGEA 3BXEA 5D1HA 1VBGA 2G9ZA 2I3BA 2W6IA 4IFEA 5DQIA 4X20A 4IYRA 1A2KC 3GRZA 3MYYA 4U7PB 2M05A 2ID4A 3V8RA 5KFCA 4EARA 1GGOA 4WEOA 3F3YA 3KWMA 4YRZA 2NTYC 3LVBA 5ADWA 2FE4A 2C4TA 2C5LA 1EFRA 2MJLA 5CEJA 1DINA 3VUEA 2WJ3A 5TMEA 3D8RA 3RRYA 1Q0RA 4RVDA 3LFTA 1K6XA 1ZD8A 3UGJA 2H65A 4DNFA 1IB0A 4AZ3A 1NSFA 4V1CA 4JV2A 4PO1A 3K8YA 1C4KA 4FNOA 5JRDS 3AX6A 1I6KA 4YTEA 3P0HA 5HFNA 1ML4A 4ZYYA 4NOJA 5KFFA 2LD4A 1HXHA 1Y7LA 3B1WA 1NW9B 1OYVA 4HT3B 1JBEA 4PPYA 3OQMA 3O4VA 1O6CA 2VPWA 5FEUA 1XAGA 1LW6E 3WMXA 4G8JA 2EWWA 4ZXFA 2DBRA 5IK2A 1LBHA 1Z7GA 5IKEA 4BMDA 1M2HA 1G21A 3WA6A 1G6Q1 4PCLA 3ELUA 1PFYA 4L85A 2L0XA 4PICA 2FGKA 4KPUB 4JXZA 1ITZA 2C3OA 1GAJA 1GEEA 1TTQB 1JMVA 2MCFA 4RTOA 3AR8A 3OKCA 4US0R 2NUAA 1HUQA 1ZRSA 3QNUA 3U7FB 4KQ9A 3KE9A 2DFPA 4TLAA 1UKAA 4P3PA 1VIYA 1A9YA 4WBXC 3T7RA 3EUWA 4WK0B 2JFWA 1EKVA 4DL6A 4UMVA 1MUUA 2P8JA 5K0EA 4QUBA 1JXQA 4YPOA 5G1OA 2BISA 2R92A 2QTFA 4MB6A 4LEIA 4LDRA 4AN4A 4EOGA 3QNMA 2OD7A 1CSEE 3S70A 1Z33A 2WM3A 5EYPB 3T4PA 3A3YA 4KR9A 5DBIA 2IH5A 4GLWA 1R6DA 1MG0A 2C3YA 2IZZA 2CXPA 5B1YA 1GQQA 4TVKA 2FFRA 2VOJA 1Z0DA 1YL5A 2NM0A 4CTKA 2Q3FA 3QU9A 1H2ZA 1XT6A 1W88A 3BC1A 3KETA 1EI9A 2AFHE 3ST7A 3BGWA 1V7QA 3BFKA 5CPBA 4C21A 2XRYA 3LLCA 1S9HA 1YQDA 3EQZA 2G08A 2PXXA 3LE8A 1ULBA 3AM1A 3L0OA 4LE2A 2HMTA 3A1UA 5I8PA 3B1JA 1R66A 2C2DA 2ZXFA 3V7WA 5GOZA 3M34A 3HRKA 3IKJA 4EYGA 2JLCA 4OLBA 1DWOA 4CMAA 2VL7A 1XELA 1AUPA 1X9NA 3FFAA 2HCTA 2RIRA 2RGNA 3AC0A 2PS0A 2JI8A 1XIVA 1RWOA 1QZ3A 4NOLA 4G9BA 4AWXA 1OA0A 5IKOA 2XQIA 5DIFA 4G26A 2IYLD 1XMXA 2R00A 2WMDA 3G5UA 3O4FA 1L3CA 2VDUE 4TYYA 4G5GA 2BHRA 2RJNA 2PMKA 3G82C 3C3AA 1I2BA 2YUTA 3V46A 3EDCA 3F8WA 4GLBA 3DL7A 2JEZA 1EVLA 5HE9A 2ZSBA 5CAEA 2C22A 3ZXUB 4BMOB 2H57A 1KE1A 2VP2A 2XBMA 3SS9X 3HXMA 4O4HF 3D7MA 4D4HA 2ZDQA 1K4YA 4X1YB 3WXMA 3PXAA 5D01A 4M1SA 4R9NA 5AHKA 4ZV4A 1A5BB 2X7XA 3I9MA 2B6HA 4TROA 5C7YA 5A6SB 3CT4A 1E3TA 3CPSA 2HF2A 2OYSA 1K6MA 2CLKB 2HNBA 3RF7A 3MFIA 2OM6A 1RPNA 2HLDA 1ONNA 2JAOA 3KALA 1QG2A 1DUSA 4R8UA 4OXYA 4OGGA 4B3HA 1D0IA 2IPAB 3ELWA 2J0UA 3QTTA 2CY0A 3RJ5A 5ICFA 2D0PB 3RVKA 2OXFA 4FLFA 4FOSA 4IIYA 4TOIA 1XMOB 4B4DA 1GITA 3OF5A 3BMXA 4NENA 1H42A 5TT1A 1BE0A 2VJDA 5EESA 4RSGA 2YZGA 3P0IA 3V8VA 4OQFA 3M83A 2BFAA 1VJ0A 2AFHA 3SIWA 5JZBA 2R2AA 5IMBA 2MU1A 5HIMA 3KZOA 1IBKB 3JAKA 1UJ2A 4QM7A 3X3HA 3LYHA 1FZTA 4B6RA 3L0BA 4MRRA 1BN6A 3R7WA 1DGQA 2AOUA 2XUQA 2XIQA 3DLBA 1J22A 4DQDA 3CQZA 1WU8A 4AX8A 3CH7A 3EA4A 3PUKA 3JQGA 3ND7A 1OH6A 5A0TA 4R8SA 5CVCA 1CP3A 1L5VA 1JI0A 4W1PA 5JH7A 3RS4A 4ND2A 2X8JA 1NP3A 2KQUA 4GYKA 3H9JA 3TI7A 2QTHA 1B14A 3ZZ0A 3QX3A 3VYSB 3EDYA 4H60A 1FE8A 3ETLA 2PX2A 4I5DA 1R9TA 3T0IA 2OCLA 1GRVA 4HUQB 2A9JA 3AUXA 2ZYSA 4RIGA 1Z5NA 2V6GA 2DWQA 4REQA 5KHOC 1KFEB 3H83A 5TVKA 4HZGA 3FPLA 3DFUA 3O2SB 3O03A 2O59A 2GJ8A 4QWEA 2AL7A 1TMYA 2AKAB 3SAJA 5T57A 2I3AA 4E3ZA 1RXWA 5C7IO 4XWTA 2RC5A 1EK6A 2ASLA 3PF9A 1Q3HA 5JFOA 1V8FA 1YZGA 2Y27A 4KAJA 4XGKA 3GJ7A 2N42A 1IQPA 3UQZA 2SCUB 4R4JA 4ZZ2A 4LX8A 2KPOA 4CTJA 1O97C 1NJ6A 1U6JA 5EXPA 2Z04A 5I7SA 2ZVQX 3PQFA 4LWQA 4LJ9A 5G1PA 1ADBA 2AC4A 3RBDA 1R50A 3OM1A 2NV0A 3AUJB 2OWEA 4HR7A 2ZYVX 1VA5A 1E9CA 1O94C 2AMVA 4AMZA 5J63A 5K8LA 2VPQA 2QM0A 4JUCA 3RHFA 1RQ7A 4PDBA 4PBTA 3DWEX 4KNVA 3ND9A 4XR9A 1VP3A 2GEBA 3OA2A 5PGMA 5LJLA 1LNZA 2IELA 1UKCA 2DR2A 3TQ1A 4BUZA 2XCAA 3ZUPA 3D4NA 5KT3A 2I1VB 5AVKA 4LV8B 3B1YA 2HLHA 3T4XA 2PIDA 2WZCA 3HCNA 4TUYF 1CZOA 3OJWA 8MHTA 2YZLA 1SGWA 2OG1A 3GNLA 4CI9A 2GDZA 3A1TA 1G9TA 1U3UA 1PLLA 3LQFA 1KI6B 3STWA 4JL6A 3CXRA 1N5IA 3WRWA 3KX2A 2VQSA 3VH1A 2GCGA 3U55A 3RT1A 1I3KA 3DE3X 3ZR4B 4QEDA 4JI4B 2V65A 5TQ0B 2OV3A 4GZMA 1WA5A 3IXQA 1SRRA 2R8KA 1QHHA 2HRZA 1AQLA 1YJQA 4D56A 4IUDS 3QVJA 4K9KA 2MSWA 1NW4A 1HC7A 1LK0A 1TK3A 2GHQA 3MRXA 2EBFX 4HXEB 1VIMA 5KYUA 4DLWA 3U7GA 3ZHXA 4RJ2A 4UQLA 1IN8A 1X13A 2Q7DA 2WIFA 1S2IA 3UWPA 1JIQA 4PR3A 3MAAC 1G63A 3B89A 4YAWA 1Y3CE 5B3AA 3UCXA 5FOWA 4J0FA 3CRQA 2QMZA 1KO7A 5E6RA 4F46A 1DIHA 1JE0A 4Z4HA 1ONSA 5L53A 5LYJA 4I4TA 3GIWA 4NI5A 3VR4D 4DBZA 4ZI5A 2QNIA 3C14C 1H5UA 2X19A 4AZSA 2BMJA 1DE0A 1UM8A 2D8MA 5IJ0A 1OIWA 3C3PA 1RKVA 3EZ2A 4O5OA 4R51A 4YR9A 3QVOA 4FEAA 4TRNA 3VZCA 4RDXA 1HETA 3DMYA 3LIPA 1N7GA 2VSQA 4LZAA 3ED1A 4NECA 4Y8VB 3S1SA 1AK1A 4AZWA 1F2UA 3FMGA 3GFRA 4HN4B 4ZI3A 1LTKA 3LQSA 4RKRA 3B3JA 2DWPA 2CEAA 1JG6A 4X64B 4YA6A 4NY1A 5EFOA 1PGJA 4H18A 1N33B 3N2IA 2WUVA 3ESCA 2HTEA 1WTCA 4KO4S 3TLJA 2CD9A 4CKZA 3SJCA 2DFDA 4P4NA 1V41E 3VDRA 4CU2A 3K1ZA 1H2WA 3PQ4A 1ZK1A 4RGQA 3FETA 3MIIA 1V9CA 1EKPA 3SQLA 4NOMA 4BLUA 4DSAA 1DX4A 5IBPA 1F3LA 4PLTA 1RCUA 2VJCA 5EZ6B 3RI3A 1C1DA 3G7NA 3U4IA 4A6PA 3R4CA 2CV0A 2WVGA 4X93A 3BE8A 1YZVA 4Q7LA 4PSAA 3HUDA 3ADOA 4FQ8A 2GDJA 2OLKA 1GDTA 3B53X 3MGCA 2GAOA 3FJOA 4ZN6A 2A0KA 3IQGX 1QMPA 2C5HA 3OJLA 4JP8A 3WQHA 2PX0A 3IPAA 3MCTA 3B6IA 1F51E 5DCLA 3UJDA 3LBNA 5KOJA 1XQ1A 1EPUA 3PFBA 2PTGA 1SCIA 2WAQE 2N9UA 2GKGA 4DGQA 4Z4EA 2Q9CA 3REFA 2P27A 2ISSD 2W6QA 3KQWA 2PXCA 3VH2A 4EM6A 3LMLA 2NZXA 2DHRA 5F77A 3GLRA 5JC1A 4JI3B 4WXYB 5KTYA 2VAPA 3L49A 1F8FA 1E3SA 3M6AA 2OYCA 4OB6A 2AN1A 5D5QA 3AHFA 1UBJS 3GEHA 3G02A 4JOBA 2FDXA 1YAHA 4EB8A 4C2TA 3GZNA 4D6YA 3EGOA 5CFNA 2ZIVB 1JWAB 1E9SA 5BNWA 1N2OA 3ZGLA 4PSVA 2OP1A 2HXGA 5KYNA 2Q8NA 1UDAA 1BE8A 5F5LA 1QORA 2ZRBA 4Y18A 3D3JA 1YS9A 4PCVA 3COWA 1N6OA 4MGIR 3Q4GA 3A1VA 1FDUA 3T4EA 3L1VA 2JL1A 5LU9A 4EKYA 4EQZA 4U6PA 1VL6A 1I5EA 5BNZA 3THOA 4QO7A 4AAYA 1LDMA 5KSYA 4D0GA 4BY9E 2GN2A 2MCTA 3KIPA 4IDGA 1WE2A 3OP4A 4HJXA 4PRZA 1BROA 3T5BA 4I8XA 4LF6B 5B57C 2VT6A 5FPOA 3EB9A 5M5BA 2QM3A 4RIFA 3E4DA 5JDCC 3QYJA 1TKAA 1MNAA 1LJ8A 4RK6A 1KYTA 3W8NA 5G2OA 2GM4A 4WI1A 5ICMA 5FULA 2WWTA 2TYSB 3L4JA 2XCLA 1V95A 3KQTA 1NQVA 1M1YB 4IH1A 3HY3A 4ZAZA 1U2GC 3TL6A 4HATA 3GWGA 3ZKWB 4PIPA 4AKGA 4L50A 4WCVA 2H1CA 2I0FA 2P35A 4OH7A 4R1TA 3BUSA 5K0CA 3V6JA 2NU7B 1PR1A 5K0ZA 1L4MA 1UBGA 3M1AA 3HCPA 3WDSA 1Z13A 2KI5A 4E31A 5BOVA 1A9ZA 1NYLA 5T4EA 1QGAA 3O8QA 3QU5A 3B3FA 2WAQA 4RLHA 3W5OA 2FQYA 3KXYT 2FZWA 2ZGVA 4M89A 2A14A 1F6DA 1SEPA 3WV5A 3DBRA 3EQ6A 2A78A 3NBZC 4TUYB 4U1RA 3GGGA 5JNRA 4L27A 2JS7A 4GMHA 4NTZA 2LE0A 3AHHA 5I9MA 1A2QA 3P52A 5JASA 4MV0A 3K32A 3L07A 1LNSA 4K3VA 4DG8A 3I0MA 1AXEA 1XROA 4EX6A 5AQ1A 2LCIA 3ID6C 1JXAA 3LQRA 4AO7A 2ZITA 2J3QA 3NC1C 2Q7XA 4QUAA 2DFNA 4RELA 1N2CB 1CY8A 2PEYA 2J0EA 4YK7A 3TJRA 2RGCA 3R7BA 1THMA 4PZZA 2REBA 3V4RA 3WYDA 1N6HA 5KFIA 1ZUNA 1QX3A 4B82A 4MI6A 3T5AA 4H0CA 4I7EA 5I60A 1GL9B 4RPLA 3HR8A 3Q3HA 1UBLS 4I2VA 1N36B 2VHYA 3DVQX 2CXHA 4OF4A 3O1LA 3CWQA 2HIAA 4DYDA 3MGAA 2A2ZA 2UYQA 4HV4A 1S3GA 2BLLA 4W82A 1KMHA 3E84A 1J8QA 4GGOA 3Q8RB 2Z3WA 1VFNA 3AFOA 5HKAA 4M38A 2VDKB 1L1QA 1R5BA 3NETA 4RK7A 3GCWA 1DBWA 3VHXA 2JC3A 4OL9A 2P3LA 2JJ8A 3ITKA 2YJ4A 3KT6A 3JAMA 3H4DA 3RUIA 5EZSA 2YDXA 4LDZA 1LPBB 5F64A 1Q92A 2A0WA 2P9JA 1EUQA 3B1VA 2VHXA 1K5GA 2RG7A 3U31A 4HG2A 2W8KA 3T5GA 3PNKA 3U3DA 1Q1NA 2VPYA 3CKYA 4YRCA 1PDVA 1O4VA 3PA8A 1VB3A 2ETVA 3GAZA 3LPMA 4L57A 1DEAA 1OXMA 1WEHA 5BN4A 1XZDA 3FWKA 4R0NA 4URWR 5L7TA 2XDQB 3JU3A 4OI1A 2GPJA 3AERA 1QF6A 2Q3MA 1XDDA 4TXHA 4J7XA 4O33A 4S1WA 5DSXA 1ZX1A 2G72A 4PXYA 2JJ1D 4UHKA 1ULUA 2C8VA 3KFLA 1GRRA 2FN4A 4H9GA 2QUKA 1RTKA 5KS8A 4RGVA 1JTVA 3DTTA 1N6NA 4HNAB 3QXSA 4BXXG 4EKDA 3TGLA 3DTVA 5CGQB 4L72A 3BHIA 4WL0A 4KIGA 3LTNC 5DG7A 5EUQB 3N0WA 3ZE0B 4ZKDA 5LQSA 2M6RA 4QSHA 3TPCA 4BPRA 3JALA 2O2HA 5EKTA 2PBZA 1N7HA 4WPGA 1Q2UA 1T2CA 2EATA 3JX9A 3IELA 1DTWA 1ETUA 4GW3A 1CR4A 4OHWA 1A88A 2JIQA 2C4MA 4H1TA 1KZ9A 2EX0A 2WWVD 3PPVA 2UVDA 1PVOA 4OAPA 2OTCA 5I7FA 3THXB 4GOOD 3Q98A 2R8BA 3AF6A 1C7JA 2JFPA 5JE8A 5DBOA 2C4UA 1IY1A 1WOYA 1Z4OA 2X5XA 4H27A 4YRTA 3DEIA 3SNHA 4M9RA 1K7XB 5EHIA 4EQ5A 5AKLA 2ZANA 1KYXA 4RMNA 1TLTA 3OZEA 3RR2A 3V2HA 1ZEJA 1WUKS 4EHKA 2WQ7A 1JPUA 2Q3HA 5KFQA 3V6HA 3W5UA 5IBQA 2X2PA 3TLCA 3UCFA 4BGUA 4BJ6A 5FUYA 2P0EA 4EITA 4G0PA 1QB7A 3EVNA 2XOXA 4US1R 3LUGA 3N0VA 4F3NA 4PGMA 2H1HA 1QPZA 1X7ZA 1VHQA 3EPHA 1OVGA 1KWGA 1CNFA 1YU6A 3HNOA 4I5GA 5KNLA 3ITNA 1F2DA 1I7QB 4M1KA 5TMDA 2GTHA 4JP5A 4DMKA 4EHIA 3AIOA 5BV1A 5FOQA 4G5QA 3LRTA 4BMYA 2AR9A 5P21A 4YPFA 3UXEA 2R7NA 3LF2A 2FK2A 1X8JA 4DR3H 4CYMA 3P96A 3EXG2 4I81A 3PTZA 3W8EA 3B5JA 4AVYA 5FR2A 2WKQA 1CDOA 4C7MA 4PYKA 5ALWA 1MB2A 2ZT5A 5L1JA 2Z6AA 1FXUA 1GSHA 1JA0A 1B3RA 2CD7A 2QUIA 4GR4A 2O8C<