1EUCB

Crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
394
structure length
393
Chain Sequence
b'MVNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTADPKVEAILVNIFGGIVNAIIANGITKACRELELKVPLVVRLEGTNVHEAQNILTNSGLPITSAVDLEDAAKKAVASVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 132
structure length 393
sequence length 394
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00549 Ligase_CoA CoA-ligase
B PF08442 ATP-grasp_2 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1eucB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1eucB02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eucB03
3R23A 4IWYA 4FGRA 1OBDA 4YB8B 2R85A 2R82A 1SCUA 2SCUB 1W96A 1CQJA 4MV1A 1KJIA 3KREA 4EGQA 2FPIB 4WBNF 1VBGA 4MV6A 3JZIA 1AUVA 3MWEA 3QFFA 1KJJA 1UC9A 2I80A 1SCUB 4TV9F 2XCLA 2CSUA 5LYJF 2R7NA 3ORRA 3R5HA 2R7MA 3UFXB 1KJ8A 2W71A 2YS7A 4FFPA 3VPDA 1KC7A 1GGOA 4YJ3F 5CA1F 2CNVA 1Z2NX 2Z02A 3GIDA 3JRXA 3TIIA 3E5NA 5JQGF 3NUAA 1OI7A 1IOVA 2YRWA 2NU6A 3U9SA 3MWDA 4FU0A 4XYMB 3TW6A 2C00A 2YYAA 4I50F 4O84A 4O7SA 2NU7A 2CNUA 2DIKA 1EYZA 3N6RA 5CA0F 5C1PA 4O2AF 1W93A 2W6PA 1KUTA 3HBLA 1T36A 5CAEB 4MA5A 3VPCA 3G8DA 1BNCA 4HNTA 1VBHA 2VPQA 2ZDGA 4O7VA 1IOWA 2GQRA 3DF7A 2YL2A 4I4TF 4ZQIA 3VOTA 3K5IA 2PVPA 3KAKA 3ORQA 4C5BA 5K2MA 2Z04A 1AUXA 4YB8A 5DMXA 4HNUA 4YBZB 2SCUA 4NYEA 2W6MA 1E4EB 2R7KA 1PX2A 3LP8A 1DIKA 5J2UF 4ZI7F 3HO8A 3G8CA 5BPHA 5JVDF 2J9GA 4MV3A 4MV4A 4O7WA 4O86A 1JKJA 3K3PA 3OUUA 3VA7A 3U9TA 2HGSA 1GSOA 2PN1A 4HQ6A 3UFXA 2CQYA 1EUDB 2QK4A 4YAJA 3V4ZA 3Q2OA 5CB4F 2CZGA 4O4HF 4DIMA 3R5FA 1GLVA 2HJWA 2WYOA 4O7YA 4HR7A 2I87A 1JKJB 4FFLA 4FE2A 1JDEA 2GLTA 3R5XA 1UC8A 4EGJA 4YAJB 3U54A 1C30A 2DLNA 4XYMA 1OBGA 1B6RA 5LA6F 3ETJA 1VKZA 2R86A 1I7NA 3U55A 2OLSA 1JDBB 1Z2PX 3OUZA 2CNQA 4C5CA 2YV1A 2FPGA 4O7LA 2GPWA 5H80A 1M0TA 2YW2A 5CAEA 1BXRA 1GSAA 3HB9A 5J2TF 3WO1A 4QSHA 4IIJF 3Q1KA 4E4TA 2FPGB 3JZFA 2NUAA 4Y8VB 3ETHA 3RUPA 3VPBA 2YZGA 4ZHQF 1ULZA 1EUCB 3RV4A 3LWBA 3I12A 3R9RA 2YV2A 5KX5F 1CE8A 3N8DA 4RZQA 2IP4A 1M0WA 3JRWA 2R6FA 2YZNA 5FNVF 2NUAB 4MV8A 1KBLA 4YBZA 2VR1A 1E4EA 2V59A 3K5HA 4I55F 4DLKA 5GONF 1CQIA 5HBRB 2V58A 3AW8A 2I8CA 2PBZA 4O2BF 1DV2A 2R7LA 4O4LF 1M6VA 1EUDA 2QF7A 2YZLA 1CQIB 1I7LA 4XYLB 4YAKB 5JVLA 4O81A 3SE7A 3WO0A 2X0SA 3RFCA 4TV8F 1B6SA 1C3OA 2FB9A 3DMYA 2W6OA 2NU9B 5LOVF 1CS0A 4L1KA 4MA0A 1JLLB 3V4SA 3RV3A 1WR2A 4FFOA 4MV9A 4XX0B 4O7TA 2ZDQA 2W6ZA 2FP4A 5C1OA 2YS6A 4O83A 4ME6A 4IZOA 4YJ2F 2VQDA 5I47A 1KJQA 4O7ZA 1KJ9A 3PFFA 5LP6F 1CQJB 2FPPA 4WD3A 4MAMA 2FP4B 4TUYF 2R84A 5HV6A 4FFNA 1A9XA 3MWEB 4Y8VA 2NU8A 1EHIA 1EUCA 3TIGA 4EG0A 2YWVA 2GQSA 3BG5A 3TINA 2FPPB 1KEEA 5D8DA 4FFRA 5EZYF 1Z2OX 1A48A 1PK8A 4O4JF 5JQWA 2NU8B 2V5AA 3GLKA 4C5AA 2XD4A 4XZ3A 5BMVF 2YZMA 2NU6B 5IYZF 2YRXA 5HBRA 4IHJF 1DV1A 4O7NA 4IWXA 3MWDB 4O7RA 5C8YF 4XZ3B 4ZOLF 1EZ1A 4O82A 2NU7B 2W6NA 3WNZA 4XYLA 4M9UA 3KAJA 5JH7F 4YAKA 2P0AA 4HNVA 5KKNB 2ZDHA 2DZDA 2NU9A 5BPFA 2R87A 2W70A 3TQTA 1JLLA 5LXTF 4MV7A 3VMMA 3AX6A 4XX0A 4O4IF 3MJFA 2W6QA 2FPIA 1GSHA 4FFMA 3KALA 2DWCA 2GPSA
chains in the Genus database with same CATH superfamily
1WZCA 1IHOA 5JFGA 1E2LA 4LJ7A 1A95A 3GPBA 3FBTA 1NPDA 3DWFA 3GJ8A 1RPZA 3QFFA 4R84A 2ZSHA 1QGOA 1Y6JA 2IZ7A 2V9ZA 1K27A 1U31A 1OBFO 2NVBA 4GBGA 1UXJA 3RAGA 3IQDB 3MRXA 2ACEA 3K2QA 4PO8A 3FHCB 1ULTA 4C2AA 4LJ6A 4IRXA 5K9ZA 3CF2A 2OE2A 4INJA 3TTUA 2KQUA 5LB2A 1HDEA 2PRYA 2I7CA 1BVUA 1T5HX 1JDNA 1ST2A 5CPBA 1LDEA 1N3IA 3U4DA 3PE4A 1NURA 3K0SA 5BXQC 2ZQYA 2WMOB 3TECE 1GZ6A 3RBVA 4QG7A 3BB1A 2YWEA 2AL7A 1D07A 1Y5IA 3NB0A 4F5EA 1OJLA 1A72A 4AWAA 2J87A 4WLEA 1N5RA 4U7PB 4IS2A 1MU0A 1SC3A 2ZSEA 4LS3A 4ZAGA 2XUKA 4QT0A 3H8VA 2VEOA 3IKLA 3VOTA 2GN8A 4WSOA 4MRMB 2KI5A 5JFOA 4FGUA 3VX3A 3A4MA 3RD5A 4XUGB 5AVJA 5CH3A 3G8CA 2YINC 5IJ0A 3GIIA 2OHOA 4M9RA 4CR8A 3NFYA 2BFBA 5C80A 1K92A 3QEMA 2ZUEA 2XCTB 4N5NA 5JNTA 1FP4B 2JLCA 4WHMA 2E55A 4NYIR 3MWKA 5ICMA 4O3PA 1KOJA 2CVOA 3Q5EA 4OXXA 4CF3A 2ZYHA 4RMJA 1SU6A 4LJAA 2PUEA 4CMIB 1P9WA 2PM8A 2R97A 2AOWA 1T9DA 2XZDA 4AJHA 3MR3A 1NOKA 4RWEA 1CRQA 3NUZA 5K4AA 3OLYA 1GU0A 4NVRA 1ABBA 2QNRA 1OGJA 1YQQA 4HAUA 3N2IA 1ZITA 3WR5A 2EFEB 5IBRA 4DSOA 4MJ7A 1PSWA 3PFCA 1EWQA 4J2HA 3TFOA 2P75A 4CKCB 2WFAA 1MB9A 3G2IA 3UG7A 2ZGVA 4ONEA 1CE8A 3NV9A 1Z17A 2O57A 1PG5A 1L4NA 3W5CA 4YMVA 3BJRA 4DYVA 4DA4A 4ZOEA 3PIRA 1NC1A 1V7QA 1SULA 4PE5B 1P7CA 5DOZA 2G07A 4R1MA 4Y6SA 1MB4A 4ZRMA 2O0KA 1NI4A 5BWCA 2IOHA 2VBIA 2O54A 5F1KA 2I7VA 2W2LA 2C2YA 3DEAA 4G5OA 2C2OA 1G3IA 4F5ZA 4J0IA 4C20A 1L1RA 1P17A 5FB3A 5U4QA 3BSFA 2IKQA 2ZIUB 3OZFA 3G5TA 3X1YA 4A7PA 4V0NA 1I5EA 1LX7A 4ZJYA 4B80A 3Q10A 2PKQP 2W90A 3FVTA 3OT5A 4IIVA 4PRKA 3VKGA 1N7IA 2XY4A 3L1IA 3OFSA 3UV3A 1ORWA 2WHEA 1NJ2A 5BSMA 4AMYA 1IRXA 2XBLA 4NNJA 4BV8A 1CF4A 1EINA 1E2KA 1Z2AA 2G9RA 2FG5A 5A9RA 3TW0A 2B63G 1WOYA 3U7FB 3NU1A 4JGIA 2XVAA 221PA 1E6MA 3AR9A 5DBFA 5HBRA 1ILWA 5FHRA 4CMEA 3VNUA 4E30A 4BU0A 2IK8A 1GTRA 1GN8A 4EGCB 4O8ZA 3VSBA 2H08A 1LF5A 3LDAA 3I9KA 4OXYA 1FTQA 4GQBA 3D7NA 5TARA 1N2CA 1JDBC 2C04A 2ATIA 4F11A 2RJNA 1T3HA 1V2HE 4V0SA 3VKUA 3CZQA 3IBCA 3GJTA 1QFZA 2L82A 3I01A 4U7CA 3EWIA 1XR3A 1T1RA 4XFKA 1DQPA 4R2LA 2G4LA 3CA8A 4DDWA 2QD4A 4IH1A 3W77A 4WNAA 4JC5A 3G6XA 1OZFA 1VPTA 2QI9F 2GBLA 2G36A 4WLVA 2XITA 2XIGA 3SJUA 2JVIA 1U5BB 2BHNA 2FEOA 5DB4A 4Q12A 3L40A 2QE7A 4M8SA 1GGOA 3VYVA 4RPHA 3IV7A 2PUVA 5JQGF 3BWCA 3JXEA 4JK3A 1Q7CA 2OSBA 3DEHA 3GD5A 1D2HA 2W2PA 1M2OA 5D86A 4QBKA 3JQCA 1L1FA 5DLQC 3D6JA 3BA1A 4OHRA 2HQOA 6LDHA 4HNRA 3LUFA 4OHFA 3RWOA 3EAQA 4H4EA 2H1WA 3B7WA 3ONNA 4D74A 3GOHA 3CLVA 3T5TA 4Q8EA 2XJ4A 4JBWA 3B53X 2D1RA 2RFLA 3JYOA 5D3ZA 4BO2A 4HDAA 1RJWA 3TLZA 1TUGA 1ESZA 4EVIA 3WL3A 3DE2X 4JXJA 1KVQA 3N43B 3RGXA 2Z6VA 4PCUA 5KYWA 3DDWA 1WVMA 2QRKA 2H1CA 4ZXPA 2A5FA 2CYBA 3VAYA 1ZD8A 3AUAA 4XEUA 4CMKA 2MINB 2WM9B 1QO0A 5AVZA 2OHXA 5EUCA 2UZ0A 4Y6PA 3LT0A 5LXTA 1YBMA 3L02A 1EVEA 1XNRH 2VPTA 1JNYA 1XZQA 1LC3A 3WP0A 4KVGA 4J9LA 4LCJA 3JVVA 4XYMA 2O8BA 3KXLA 4ETIA 4D9GA 4IGKA 1XTIA 3S1AB 1TEZA 2R86A 2NXWA 4G97A 2GK7A 4JJEA 5FDFA 2ZIAA 4EY6A 3HEBA 3IDQA 3LLSA 4NOLA 4IF4A 5KVVA 1KO7A 1Q15A 5KEIA 1C0PA 2XTAA 3GRZA 3H5LA 3HCPA 4BE7B 3PNPA 4GXNA 1T8RA 3FUUA 2VHEA 5CM2Z 4JJIA 4W82A 5EQFA 1ISMA 3UHJA 2AXNA 4IV5A 4S3MA 2NVUA 3DB2A 4JCCA 2I6QA 1QZZA 4ATNA 1FL9A 5NLLA 3V48A 2BMEA 3H99A 2ZJOA 3AF2A 3ZWQA 5JYEA 2M98A 4KIFA 2JATA 5DG8A 1CY4A 2I29A 1RC8A 4WY5A 3OCCA 4PQYA 3KKEA 1KFCB 4D41A 4Z4QA 4YAKB 5IBQA 4JNCA 4MRNA 2ZSKA 1CV2A 5FNVB 1ULUA 3RU9A 4YP5A 2WLSA 1IWBB 3HZOA 1I2LA 4ALLA 3QMMA 2VSXA 2XV1A 1P1IA 5ITVA 4J0CA 2P3LA 4KO8A 2RE8A 2RIRA 2PLNA 2FGKA 1LWNA 2FP4B 1PT8A 4UQOA 3BMQB 1R4NB 2H1VA 5DOVA 1UXGA 2WW8A 3KVRA 3ENNA 1NBAA 2FJPA 1W7AA 4FMDB 3FMFA 5CIQA 5IT9A 4MWGA 5DBGA 1P44A 4MPRA 2FPXA 4A0GA 2XD4A 3CVXA 5LP6A 2WU0A 3R0XA 4CPDA 3L7MA 1H8HD 4A3EG 2IW1A 4L7VA 1XK6A 1MOZA 2HLPA 5CE8A 5JZSA 3S5JA 1GILA 2F3SA 2V4UA 1WVGA 4TT3D 3CW9A 2D3TA 4GUDA 1RQXA 2HMVA 3OZGA 3KSRA 1XD2A 4UHCA 3T4XA 2HLDA 5BURA 3ZE7A 3EFBA 3ILSA 3L05A 5JXIA 2PZGA 4KOAA 5E25A 4J3JA 5CURA 5DDIP 5BPFA 1CUVA 4BJ3A 4O4IF 1YR7A 3B20A 3F8SA 4IG4A 4M7PA 4FFMA 2ZWAA 2J3IA 1HKHA 3QV2A 4F4YA 2BBWA 1DZ3A 3IP1A 1IAVA 4CI0B 5LKAA 1ADCA 1E9EA 3KLPX 4UBOA 2YWHA 2CVFA 3BA6A 2W98A 3AUYA 1FMLA 5K6RA 4C0QC 1SKBA 1O0BA 2V55B 3VPHA 1UC9A 1WPQA 1ZNZA 5CIYA 1A1VA 3WYNA 1JSLA 3Q3JB 4FYHA 3GFVA 3W05A 5LLTA 2RGDA 2VA9A 2LCFA 2EEZA 3WJ2A 1Z8DA 2IWHA 5A6VA 3OOJA 1FDUA 2OZVA 1KI4A 3LO5A 2RHJA 1I2AA 3RFUA 2OG1A 1AQIA 1SBHA 4HX2A 1NX9A 4DIFA 1N7HA 1UJ5A 2QLMA 4RUKA 3T5KA 1TU4A 5JNWA 2OHVA 1QONA 4WXMA 3DULA 3TBKA 4WE3A 5FWYB 1L7DA 1Z0ZA 2Q7DA 2D8AA 3TQSA 3GV8B 4ESHA 1DC5A 2Y68A 4QTXA 5ALPA 4OQFA 3E9ZA 4YCMA 3IX7A 1UJBA 4RYLA 1X7ZB 1W30A 3UICA 2I78A 1NMQA 4P4TA 4HZUA 4CQNA 2Y93A 5AI8A 3ROFA 1HDXA 1X19A 4H59A 3EIUA 1PF7E 3T5PA 3BDAA 3ICVA 4JBLA 1XN1A 4XIJA 5G1NA 3KDAA 2XQJA 4WKGA 5DBIA 2FFRA 1TADA 1F2TB 1TM4E 2WWIA 2OZLA 1JG2A 2AU0A 3MXTA 1PR4A 3P96A 2X5OA 3K70B 4FFLA 2VDJA 4NJEB 2BP7A 2QX9A 1KR2A 2YRFA 2PH3A 3DL2A 3L46A 4M98A 4E22A 1NW7A 1US8B 4PHGA 3DDOA 2CFIA 3C3BA 4UEOA 2CLFB 2FPGA 2YXEA 2WKQA 3DV9A 1XZAA 1A3GA 2MSKA 3RJMA 3AF0A 4RCZA 3F6BX 2JAOA 4JUAA 1V45E 2VDUE 4LHYA 5KFNA 3CEPB 4F4WA 4KGXA 2QXTA 2RH8A 3D8RA 1CRLA 5FBZA 1DZIA 3KNZA 4N0MA 3VQTA 1NVUQ 2E18A 1TF2A 1F5SA 4G41A 1DI0A 4PS1A 4DKXA 4FS8A 2F8SA 3L2OB 1NJSA 3O4HA 1SUEA 1D4AA 5KTOA 2ECQA 4E1AA 2WPNA 1AUQA 4JXXA 1Y9DA 4Y9SA 4UPVA 2NO9A 3PBKA 1G1MA 1RLMA 3ONWA 1Z82A 5EWMB 5I8ZA 3AERA 2G0TA 4UVIA 1A8IA 2Z1DA 4XARA 3EX7C 1KHTA 1YCHA 3JPWA 2Z0MA 3TZHA 1YL6A 2GESA 4J49A 2QT0A 1W0JA 5IBPA 3WL8A 3OSZA 4YAGA 2D00A 4BX2A 1SCNE 1CQJB 2OYSA 3ETNA 4BLQA 2O59A 3V1KA 4BKPA 4HFRA 4F3YA 1RC0A 4OHZA 2XQVA 3K2BA 3KETA 2NP6A 3UPTA 2P11A 4NJMB 2OD9A 1N6KA 1RJQA 5I7EA 1SRRA 3LGSA 2FKAA 1Y1LA 4C7OA 1Q17A 4A3GG 2FPRA 5HK8A 1UBHS 1E9FA 1JHAA 2R96A 5AKGA 2DKNA 3DMNA 2ZI6A 5JZMA 1J0XO 4I3GA 4IXDA 4UU8A 1JQBA 2F3QA 3BQ0A 4DV7H 2GEBA 1YJQA 4K6HA 1KY5A 2BGJA 2CHEA 1NOIA 3D1JA 3VH4A 2WU8A 1M10A 3UZBA 2KLHA 1LBTA 3KUKA 2YMMA 3GFRA 4D8YA 4EVQA 4BWYA 1X80B 4HYKA 3NHJA 2HBRA 2R3SA 1H2YA 4RAYA 1WZNA 3TCNA 1MO2A 3QZ7A 4O1MA 4CETA 1XDGA 1SCBA 4S0ZA 3H5OA 2QRVA 2HJHA 2FHSA 2QI9C 2NZUG 4XRGA 3ZBTA 1O96B 3GLIE 2C96A 2ZBRA 1H0SA 4Q7QA 3SSOA 1F5NA 3AC0A 1T15A 2VNAA 2HWUA 2UYCA 2BJWA 4CF7A 3QVWA 2X9LA 1CEEA 4C4XA 3RIGA 3CVOA 2EV9A 5G40A 4MW4A 1KYXA 3GVPA 4HTAA 4MWTA 4X1IA 3E1KA 3SFZA 2BE7A 3NC0B 1AUOA 6GPBA 2D3WA 1H2EA 2C7QA 4LVUA 1IU9A 1L7EA 3FD8A 1Y63A 3HVRA 1QYVA 4HJXA 3JAWA 1J4AA 1V16A 3ZY5A 3TR5A 3X1JA 4F92B 4LJ9A 4JR2A 5KFPA 4HUTA 1SD5A 5LMNH 4D43A 3PN1A 3RIEA 2Q8PA 4Y9DA 3DHNA 4EHIA 1FYDA 4H3SA 4LH7A 1O5TA 3MFQA 1PKXA 3TQCA 3SM9A 4WDRA 4EENA 4F4XA 5EAIA 4DV4H 3ETDA 1NV8A 2Q4TA 2W2VA 1VHLA 5EMHA 3G6YA 1CR1A 3ORQA 4NCNA 4X8LA 1CNFA 5DHRA 1I9CA 3QF4B 2NSDA 4I0WB 3AEKA 2QD1A 1P5ZB 1KAEA 2YKGA 3DTNA 2ECPA 1P1RA 1M6WA 3VYSB 2WIDA 3OQPA 1NG1A 1PJLA 3A0RB 4K9MA 1NW8A 1VFNA 2WUEA 3UIEA 4EDHA 1BEEA 2UXCH 2OOSA 3TZBA 3DBRA 4R1PA 4ZI7A 3I8SA 1IIBA 3VBCA 4GYKA 4OXNA 2X8WA 4Q1VA 4HNQA 3WLEA 2WDTA 1IZ0A 4Q7EA 2AQ8A 1EFVB 2IZ6A 4PG8A 1S9FA 4GIBA 5DNEA 3L0IB 5A3RA 4TTTS 1S68A 4NZNA 4DKJA 4LGVA 4LPKA 2OSVA 3A9CA 4F1WA 1FDTA 3ULKA 2WIGA 3L6CA 1J33A 2BR3A 3BRWA 1RWMA 2DPIA 3BWVA 2HRRA 4FZ5A 3A1TA 1C3LA 4BC1A 1H3FA 1H1TA 4W1SA 1XKTA 4JDUA 2Z30A 3B51X 4J90A 2HLNA 3L8EA 4PAWA 2R44A 4YRRA 2HXSA 2VDQB 3T4EA 3V2IA 1KJNA 3VNRA 5GZ3A 2ZJ3A 2RONA 2AUMA 1MEEA 2VRNA 1M9NA 3NPMA 4LHZA 5SY9A 4BLWA 3U4MA 3OTQA 3EEQA 1W1WA 4N3AA 2Q9AA 3ZDYB 4HCJA 2V4RA 2Y1GA 2VH1A 1L9KA 4AC9A 2I4NA 1OJ7A 1BE1A 2P2GA 3WO0A 3CLTC 4HNAA 3BGDA 3NASA 3OE5A 2GYWA 3H11A 4M9XA 2XUIA 4BDTA 3O8RA 3ZS8A 4ALMA 1TKRA 3W9YA 2JEZA 1L5GB 2IYTA 1J21A 1UL1X 3KTFA 4MUFA 4COOA 1GPJA 1DWPA 3DNPA 4DV5H 4REQB 4TV8B 1DJPA 1P0CA 3KEOA 4MHOA 2HYIC 5LOVB 4GPZA 1GGJA 1ECGA 1O94D 4HGPA 3E7PA 4Q4CA 4IQ0A 1AV7A 5SICE 3L3BA 4F12A 5HA5A 1S3IA 1NGSA 4G1BA 1M73E 1CKNB 2Q6KA 3AEQA 5HOQA 4K05A 4EI8A 3L4BC 2AE2A 2GR9A 5ER6A 3A3NA 4IIJA 3GLUA 4F5YA 4CQMD 2PKQO 3T5MA 3IVCA 3AUFA 3J7AK 4D92A 1RABA 2W2TA 3CX8A 1TUBA 4IWNA 3MC1A 5FTNA 3R5KA 4KX5A 4DQXA 5LJIA 1HZZC 2XDQB 2QW8A 5EWJA 2QVCA 1ZVVA 3H86A 2QW0X 3EIEA 1BGVA 3CW8X 5CB6A 5JT1A 3PO3G 1E3WA 5EEHA 3PTZA 4OHBA 2PLFA 4FOTA 1FU8A 3D5TA 3G2HA 4B9AA 4AULA 3BRSA 2IF2A 3ZD6A 1YZFA 3DHYA 4IFEA 3AXTA 3VSCA 2UUCH 3JQBC 2QZSA 5F9MA 5EE1A 2O8CB 3OQNA 1NDHA 3FUXA 4V0KA 4KQKA 4KO4S 2W57A 1M1YB 3KRTA 5IVKA 1XVAA 5DYIA 1M76A 2ZE5A 3ZD7A 1I2BA 2BUAA 1QGUB 2ZI7A 1S4QA 1MR3F 4TMWA 1E8MA 1YB7A 1WUJS 3W7BA 4QPDA 3DM5A 1QHSA 2BKEA 4QWMA 2JFBA 2W6PA 2W9BA 1BQ4A 4ED3A 3MSCA 2JJQA 4ER5A 3VISA 3BYZA 4RZHA 4N03A 4QU8A 3EUEA 3GTLA 4R69A 3TGPA 2CHUA 3WVNA 3JQ9C 5GWXA 1KWGA 4RZIA 4ECVA 5ADVA 2YBDA 1UMBA 1E2GA 3HYLA 1Q1EA 5ICCA 1U2SA 3GZJA 3VGJA 5C3MA 4X1OA 3O7MA 3KT0A 3EIXA 1TK9A 4IHJB 5KQPA 5ITSA 2ZETA 3K3PA 4WJKB 2ASLA 3EY4A 1EXDA 3CRQA 1H8ED 4AI6A 4A3SA 4JI3H 4RVGA 3CZ5A 4R8UB 2CDNA 3BGOS 4Q47A 2JLBA 2OEPA 1LB1B 1ETUA 3EVZA 1W8DA 3CPJB 1GRVA 1B6RA 4XIIA 2EFGA 4ZV9A 1H66A 3ZHQA 1SNYA 4UZFA 4PYIA 1DOHA 3TMAA 4F5DA 3FROA 3C43A 3L6BA 1UKVY 2PT5A 4G0OA 3N5KA 3WMFA 3UGTA 1Q0SA 4UU7A 2HBZA 4NLGA 3ENKA 1PT6A 2GZMA 4WZZA 1S7CA 1TPZA 2C54A 3C39A 2OO7A 1RHMA 4OLBA 4B76A 1NWCA 4R1TA 2Z2KA 1H93A 4YXFA 2I33A 2MCTA 5CVEA 3UMRA 4L6CA 3MA0A 4WOJA 1EESA 4NKRA 1VHTA 1Q7EA 5JI3E 4ID3A 2IE8A 4PSVA 1NBHA 3TM5A 4S1NA 5KNDA 1TAQA 2RGAA 1TKBA 1LK0A 1V6SA 2C57A 2H0QA 4CM9D 1TJYA 1KI9A 4B3SH 3E9RA 4HWGA 2JIZA 3PNSA 3P2YA 1NQAO 4JH0A 2ONZA 4ARUA 1RI5A 3M5DA 5A5GA 4JJ4A 1JI0A 3U3KA 1F4VA 4BBAA 4BIIA 3VKVA 4IV8A 5ADHA 1WV1A 3RIMA 2Y1CA 4DY6A 1CBUA 3ZWYA 2A9JA 2ZUCA 5DWVA 3W2FA 3KZNA 4MQ5A 4BQQA 1S96A 1U0EA 4Y9UA 1CUUA 2X4DA 3C0FB 1QHIA 2RG7A 4ZRNA 2VJBA 2AI2A 1DKRA 3HZZA 4E2WA 5BYBA 3MWEB 1CB0A 3QXHA 4Z4HA 3GFSA 1SFOA 1KEEA 3BAFA 1YZYA 4HKTA 5F2OA 2OVFA 3GFQA 2YHIB 1D2RA 1CJTC 2H7XA 1JQJC 1WOMA 2JGFA 4JP5A 5BWNA 2VJCA 4ND8B 1YZVA 2R6GA 2X5JO 3AFOA 4N65A 2J1LA 4IUBS 3N44B 1YS1X 4QLAA 1HLFA 3TY9A 1YB5A 4WK2B 1PJTA 1ZM7A 3NUGA 5ENVA 3V1NA 3G9ZA 1J5EH 1AKNA 4FB5A 1NXQA 3MCZA 4Q9NA 3HKEA 4GPEA 3O3OB 3UHOA 2GBGA 5F2EA 1W5AA 2OM6A 1QGYA 1XMQB 3BH0A 4M7OA 4YCBA 2FWJA 3GFBA 4BVKA 2TRSB 3GVHA 4N41A 2A86A 1ZU4A 3RT7A 2O20A 4MGIR 2J7KA 2FPIA 1EFDN 1P33A 4N47A 2Z43A 5I9IA 2HNKA 4UBLA 4F2WA 5CDFA 3Q6IA 2WE7A 3K0AB 1GKIA 3IRVA 4V1CA 1JA0A 3BHIA 1JVNA 2VQFH 1FX1A 3M70A 1AUVA 1P4GA 1X7XA 4H18A 2GK6A 1A88A 1V11A 4HRYA 4BRZA 5CD1A 3N86A 3MT8A 3OCVA 3R5HA 1WRVA 1IHDA 4HAOA 4X7RA 5FOSA 4B32A 1AO0A 1RI1A 3VYTB 1YRQA 4GL2A 1R66A 3STYA 3F97A 4MYHA 2V65A 2E4UA 2H2GA 4TYMA 1D1SA 3EAFA 5HTKA 1LDYA 2GAOA 4BWVA 3ADOA 4X61A 2QT9A 1XQWA 1SQ0A 4EF4A 1XFAA 2O3JA 5EIOA 1S6YA 3OO0A 2DY0A 2NXCA 5TV2A 3KZKA 3SVZA 4YV7A 1C0IA 3RTCA 1O75A 5K6AC 1COWA 3A2NA 1XRPA 5IVIA 2WAQE 1HORA 4DR6H 3IAFA 3GLFE 3QFCA 1XE3A 1TQ6A 1P29A 4YBZB 1YZ3A 1GPLA 3PGJA 4OU4A 1ZOPA 4MQUA 1CUAA 3BMNA 2X6TA 2WNHA 2GK4A 4MX8A 2W2LD 2QTVA 4IXWA 1Z6TA 4OUDA 2C9ZA 4L27A 5KQSA 1NKSA 1ZUWA 5CD9A 2ZQZA 1SQ6A 4ARZA 2HB6A 1EUDB 5ECWA 3KJQA 5F64A 5I3ZA 3I5UA 2VP6A 1V4NA 3K7EA 3R5FA 3E9CA 4W8OA 5L1LA 1NVMB 1KK1A 1XKLA 1ZGAA 3HI4A 2AYYA 4UBMA 2WJWA 2IYLD 3BDIA 1Q92A 4TTSA 1KMHA 4KSBA 1R0LA 1N0WA 2EL9A 3HFGA 4WZBE 5FBQB 4WXHA 3OZTA 4TVBA 3ZW9A 1AHNA 1EWYA 2ISQA 2H4ZA 3N2GB 1U02A 4B34A 3TVTA 2G28A 2G5PA 5H3HA 5JD4A 2IWRA 4YCCA 4I7HA 2PX2A 4N12A 2IBKA 2G0AA 4ZEVA 3QELB 4GDMA 1EUCB 3QKRB 3V8BA 2YWJA 3KSUA 4RABA 3RYIA 1H1LA 2HKIA 4UE3S 1RNLA 4PG4A 3P71T 3FNRA 2J3MA 1YI0A 2QZ4A 2FOXA 1VC2A 4RW0A 1ZNYA 1P39A 3HJTA 3STHA 3RTBA 3NWEA 3W9SA 1QP4A 3OEWA 4OSOA 4LRUA 2PD4A 3BDVA 4S35A 1FP7A 5C7OO 2CVPA 3MRVA 4BVFA 4ED2A 4ARAA 2WHPB 3FNQA 4NU5A 4XQGA 4TYPA 4DPLA 5BR8H 1KP9A 3FUCA 1P1HA 3B2NA 3S7TA 4QQKA 1QVRA 2RAPA 2C99A 2B36A 4ZCIA 2MYTA 2DBQA 4LZNA 1G21A 1KI6B 1DSSG 2VUIB 4D6PA 3QTBA 4B4WA 1JXOA 3HWSA 1XA4A 3FHOA 2XZLA 3OBIA 4EFLA 2QE7D 2C2EA 5K3FB 4L8YA 1D9XA 3EW9A 1Y1VA 3AJEA 4CR7A 2Q5QA 2QY6A 1L5YA 4U9UA 1FS4A 3OP4A 4IIDA 3ITKA 2Z1NA 7AT1A 1DKNA 1ZAUA 2H1OA 3RTAA 3RJTA 1FFSA 4Q1DA 1OI4A 1POXA 5GZ6A 5IF9A 2FDRA 3WAKA 1P6QA 4TMXA 3OPQA 5K3AA 2WFLA 5BY2A 3VZRA 2YR0A 3SC2A 1D4OA 3VYUB 5FLYA 3BILA 4EB0A 5C4MA 1NF8A 3KSDO 1G0NA 4P5DA 3FKIG 2O2DA 4QX6A 2VHTA 1HDIA 4MTEA 3GPCA 5C53B 8ATCA 4YY3H 4CNBA 1N2OA 3L1JA 5EE9A 1G2QA 1WMBA 3BXZA 5B3KA 4R0VA 2JGAA 4XYGA 3WB1A 3HYRA 4IIHA 1V1RB 4X85A 1W85B 2OECA 1WMEA 1KIAA 2GBIA 4QW8A 1QO0D 1N56A 4DG5A 4X7BA 5KDLA 3SVLA 3V7YA 2Q0XA 2XTZA 3I9FA 3VR5A 1VBKA 2Q4RA 2EKLA 1AGXA 5DNCA 2XCUA 1AB5A 2IHJA 4D4GA 1FFCA 1D4FA 5L40A 2CNVA 3GGCA 3HFSA 4ZAZA 3TLGA 3BJMA 1W5SA 3U31A 1VIDA 1C30B 1PR5A 3HCNA 1FMTA 1ZK1A 2C9MA 5FUVA 5H3LA 4YDQA 4WL0A 1QXSA 3ZV3A 4GX2A 1PWZA 3ESCA 4EZBA 5D7NA 5EC8A 1EM8B 1CY0A 4WNYA 1TLTA 4PXSA 2YV4A 2XXBA 1CQZA 4LXQA 3BCRA 4L0CA 1Z13A 4DWOA 5FJIA 2QD2A 1KDRA 1KQ3A 3FNBA 5DMXA 4PAGA 3OSPA 4BFCA 3G0GA 3L8YA 3OQIA 4V03A 4HWSA 2C7RA 1E6WA 3P0IA 2G17A 4HPJB 1XRJA 1JXQA 2AG0A 2UYGA 4K3UA 3ZHOA 1LRJA 1C1HA 3RTEA 1SOWA 3HXQA 2B6HA 4DL5A 3P9ZA 1R8XA 5A3VA 1VGVA 1RAEA 1E32A 4PSCA 4XJVA 3FHTA 3LF2A 1GO2A 4QBTA 1ZJ6A 3B1VA 4I08A 3EJ6A 2XE7A 2EZTA 1MP0A 3GJ5A 1P1KA 1Z38A 5KYUA 1IE3A 3QFTA 4TS3A 1QP0A 2FN7A 4FKBA 4U7HA 5ALOA 5JCPA 3QWUA 3K0KA 4BKMA 2DPHA 2ADOA 5DLDA 1QO7A 3EMDA 3MPUA 4FFBA 4ECTA 1PZMA 3KVOA 2FSPA 3EDMA 2EBWA 4MARA 1PJCA 3O31A 1WNFA 1JF8A 3PICA 2FJZA 5FHQA 1JMYA 2GBFA 3LUJA 2GB4A 1EA5A 3NW9A 1CJKC 2XI4A 2FW6A 1XDSA 1RSZA 2TMGA 3UAXA 1D03A 4URHA 2E0IA 1JHMA 4BYGA 1U65A 5JY6A 3G2QA 4B3FX 4KQ9A 2DG2A 4IHQA 4YT5A 2HLDD 1P77A 3SR4A 3AW9A 4DR1B 2PV7A 5A4KA 4D6XA 1C80A 2GPTA 1OLUA 3FH0A 4F4ZA 1IZZA 3TLCA 5AQ1A 5T4FA 4K8OA 1QAMA 2Z9BA 3NJ4A 3F2VA 5I5UA 4ESVA 3ANMA 4OJYA 3SYMA 4CE6A 1ICIA 4CN9A 3UY4A 1PIWA 4AM8A 2OILA 2Q1TA 3A27A 3AIMA 4DV6B 4H08A 2QD5A 4IIGA 2ATEA 1EVIA 2GTPA 3HKBA 4J2TA 3EDRA 1A0OA 1RFGE 4MZXA 3OIFA 3EF0A 3Q2KA 1BH2A 4BMXA 1VLJA 3OQHA 1LDNA 4C2TA 3V97A 4J0DA 2CV2A 4J16C 4J03A 3LY5A 3A6DA 5KT3A 2VZEA 3GLKA 4BNMA 2NACA 5JEDA 2ECOA 4KPFC 2UZIR 3BXGA 4BQRA 4AO8A 4Z4EA 1K63A 5LU8A 4JJ8A 4ID9A 2FUNB 3B1WA 3O4FA 4MGEA 2EDAA 4AD8A 2OCDA 4YUVA 1A2BA 3IOCA 4DPKA 2A33A 4FX2A 4DQKA 1TO6A 2VUTA 3WKCA 2Y1DA 2A9KA 3C1UA 1BMDA 4RD3A 1AA9A 1MA0A 1EK0A 1QLHA 3AP3A 4H7KA 3T5DA 4J3NA 4Y0VA 1R0YA 3G5AA 5KYVA 4A3DG 1T0HB 3CRRA 2VF8A 1HDCA 2DCUA 3H8SA 1J97A 2HA2A 3CQZA 5DAAA 4RIIA 4N82A 3M4XA 4AQ7A 5A2QW 4DHEA 3QFRA 1NJGA 3QOFA 3RJZA 4OQQA 4G0XA 4DN6A 1RCFA 3KJHA 1X0VA 4ML3A 3TB6A 5DP1A 4QNMA 4Y30A 4E1VA 2O03A 4C4AA 3C97A 2GDJA 4TRNA 3V6LA 4LJYA 4RDXA 4PLCA 3GCGA 2DR0A 1HYHA 2Y0SE 4AN4A 5ESRA 4LF8H 4CF5A 3FDSA 4LPSA 4MDFA 1MXFA 1RM5A 3AHDA 5DYWA 3L8ZA 1M1NA 4GGOA 3H4DA 4IILA 1QVWA 1XO1A 3I3OA 2XOXA 1L7VC 3QPAA 3K6SB 2DPLA 2PMWB 3I1IA 2UYYA 3GEGA 1QX3A 4Q9DA 2GCNA 1WO8A 2CFMA 1Y4UA 4Y2HA 3F4KA 2VK4A 2DQ4A 3KLBA 4HXFB 4JUCA 3TMYA 1IYDA 2J9ZB 4DJAA 1E2DA 2N0SA 1AK2A 1CDDA 1AUXA 4DR3B 2VXBA 2QIOA 2Y6UA 1ODSA 2J45A 3HNPA 3GT4A 5DEIA 3E4DA 4ZOLA 4AZTA 1TA9A 3QUSA 1Q11A 4JR0A 3ZG6A 4QW9A 1CSEE 1E3JA 2GS9A 1SVKA 1KF0A 4PF1A 4UEWA 4PGHA 4X54A 5AQEA 3SFVA 2I6FA 2I4TA 4M6WA 4UCUA 4DIMA 1BDBA 2PMZA 3H7AA 4NG5A 1KI1A 2OBLA 5DFAA 1W0JD 4INOA 2W2KA 1V3VA 1USWA 2CUZA 4AY3A 2B6NA 4O25A 4D44A 1OXBB 1WP4A 1WAMA 4LZLA 4MJXA 2H48A 4XM0A 3E7DA 1QFJA 2Z2XA 2XUFA 1PNTA 5IM5A 3CONA 4FQ8A 1Y1KE 2GNPA 4HDMB 5LL6P 2RGNC 1BN6A 2KS6A 2YW2A 3THXA 3KT8A 5DBOA 4LISA 1GXSB 2VSOA 4H6VA 4WDQA 4X65H 5JNRA 2VDNB 4BZXA 2FEKA 4ND4A 1PL6A 4FNMA 5HOEA 5K0TA 5JD6A 2VZ8A 2FVYA 2R6FA 3MMSA 1QG2A 2B92A 1WPGA 4TXNA 4JVOA 5EMLA 1JZQA 1G8FA 1OBVA 2V59A 2B1JA 5CTJA 2C5EA 1XTVA 3LUCA 1ZJWA 2CLOB 1XWFA 1GDTA 1UJCA 3J81k 3ILVA 3USCS 4XUEA 4ZT6A 2YY6A 1JJBA 5IARA 4R8LA 5J1TB 2ZYIA 2OHHA 4ETMA 3OCXA 2V74B 4PZYA 4LYHA 3TRKA 3GRFA 1BKSB 3W79A 1J8DA 3BSWA 5HZKA 3LVQE 3MTBA 1EFPA 3IO5A 3SQNA 3ND8A 4QQRA 5HKKA 4Q4LA 2UU9H 2C4KA 4L5AA 1V6AA 1P18A 2OXTA 3HL0A 1D6SA 1FZQA 4TLBA 3MR5A 1DC3A 1T2AA 1QRRA 4DQLA 2CV0A 2J0VA 3FJ1A 2MYUA 3IR6A 1B7GO 3DUFB 5CYOA 1JILA 4FCCA 2W22A 5B1IA 1JJFA 1BCRB 3ZHSA 7MHTA 5JJ5A 4X62B 2CW8A 3OH8A 4J9PA 2WIBA 1S0NA 5E6SB 4G5XA 3FN4A 3G7UA 1KDZA 3SY8A 4J94A 4L2IB 5HFNA 4DAOA 3C1TA 2DLDA 4M8KA 1H4TA 4HMQA 4UZEA 3CUUA 4O7NA 5HZHA 3PNMA 2J30A 4F6CA 3EUAA 1R5NA 4ZIRB 4RC9A 4C05A 1O9GA 4FBUA 2V0CA 1JLSA 2QMHA 3RF2A 1G5HA 4BLUA 5EZYA 3U3MA 1G291 3M9XA 4QXRA 1NMXA 4PFSA 1OC2A 1KH3A 3JD2A 2E37A 3K31A 5I8PA 1NVGA 2XUPA 4NXMB 4ZDKA 3K1AA 4WLFA 2W00A 2JVJA 2GZ3A 2D8MA 5CT9A 4MCHA 4JT2A 3F9RA 4HDCA 5BN4A 2Z6UA 3ISTA 4J75A 3UANA 3O8OB 4RLHA 4ZDWA 5AW6A 1RRGA 1C2YA 1FYVA 5CNJA 4ZT5A 5K6AA 3LDUA 2VH2A 3DBHB 3NIWA 1Z08A 3WGMA 1P5RA 1PGOA 3N74A 5EJEA 4NU6A 2RK4A 5I3CA 2CSUA 4K03A 1Y3HA 3FPFA 3E3OA 1CUHA 2RDIA 3NHUA 1GUYA 2DULA 1X8KA 3KQPA 3SJCA 4JODA 2ZULA 4F1JA 3USES 5CB0A 2EXXA 3BXOA 5TGDA 3ND9A 3AJDA 4X94A 4AP5A 1MEOA 3FCXA 5D1NA 1N57A 2GAFA 3DFIA 3U80A 2X76A 3KQMA 2AOVA 1N1MA 5CA0F 4HGOA 1TCCA 2WJZB 3C7TA 4Y2GA 3B6IA 2LR0A 1U80A 4PR0A 4I46A 5LZ5A 3WWCA 1I8TA 1THMA 3BRWD 2VHWA 4FFDA 5BSFA 2Z2JA 2O23A 1KI2A 3J80A 2EZ4A 2AEEA 4DV0B 4U3JB 1NDQA 2I3GA 3ZXIA 1E63A 1Z4LA 4CRWB 5B6JA 4PYLA 4CV2A 1NBOA 4L4ZA 3HG7A 1VMDA 2H29A 1YDHA 4HEJA 1DEAA 4JNKA 3FCEA 2I2WA 3MUOA 1WKCA 3MD0A 3MQ4A 1I6UA 2QWXA 2EL7A 1O1YA 5MFPA 4HGZA 1P1JA 3AEXA 1G55A 2JZCA 2E49A 3QLUA 1UWCA 1X94A 2ZRCA 2R93A 3RS8A 2WB1A 1KZGB 4IDCA 2Q4BA 3OOHA 2P5UA 2H07A 5FPOA 1MJNA 3M8KA 1Q50A 3ZDXB 1YUBA 4TYWA 4OHMA 2W7PA 4D82A 1VLZA 4OBBA 2E4AA 2XUJA 2HFKA 2OFPA 1MQ8B 3IUEA 4UHHA 4QYTA 2YYSA 1ISHA 1W52X 2VQ6A 5PNTA 2JEYA 5FI0B 1XRNA 1QP8A 1WQ3A 3KELA 3P5SA 5J4VA 4PXAA 3M2PA 5AJVB 1C9NA 4BX0A 3VC1A 4R0NA 3DFFA 1PNOA 2CWWA 2WQ6A 2QTWB 3EG9A 1B0AA 1P0MA 3TX6A 4AYWA 2FKLA 4PG6A 4J0HA 1U0OC 2P5TB 2PO7A 2Z4SA 4DUZH 4OLAA 2M9MA 5CFNA 1RTTA 4Q5IA 2ZRMA 3DVQX 1QRAA 4GE0A 2CW5A 4EQZA 3ZHBA 3QVXA 2C8VA 1M8FA 4WOBA 4EG5A 1EDZA 4ZREA 2B7CA 1CZLA 1WLSA 4MEBA 2PR7A 4B85A 4AYTA 1JECA 3A6EA 4TXMA 2NO4A 4DLTA 4B8WA 4A5SA 2YJ4A 3PD7A 1DCKA 1DRUA 1Q0ZA 1WZ2A 1ZMTA 3GD7A 1FU7A 2E1PA 3FPLA 3WI7A 3WA6A 5HV6A 3JD1A 3CMMA 2XDYA 3A1CA 5CB4A 2PRKA 1A5TA 3BORA 3CF4G 1BX0A 1WB6A 1ZH8A 3HJNA 4EW2A 1RPJA 4P98A 1PK8A 1VSVA 1REQA 2P7HA 4UAJA 5EJIA 3N0VA 1WDLA 3KHKA 4N6GA 1SM4A 1OH7A 2PJZA 1CC1S 2HRZA 2PT9A 3UB2A 1LV8A 4REMA 4DM3A 5KTRA 2I6GA 1TT5A 4PYKA 1SBZA 4L6AA 2FR8C 4YFVA 4OQZA 4ZZ3A 1RWKA 2ZXFA 1M0SA 1XMOB 5KKNB 1OAOA 4X1YB 1K1QA 3NP9A 2YOGA 5EIXA 1Z7BA 4B46A 4PWYA 1CEXA 5AR1A 2PSJA 1S2DA 4GSKA 1ENPA 1E4OA 1SU8A 1HI9A 2Y66A 4IKPA 4NNPA 3MTJA 3FFXA 2DWUA 1K3FA 3B60A 1PCXA 3VNNA 4LHSA 4LE2A 3ZI7A 4C4ZA 2Z1MA 3H2IA 3RAEC 4FNOA 2JJYA 1D0VA 5FL7D 4X6UA 5JPCA 1DO0A 1JR2A 3T5AA 3JQ7B 4EFDA 1ZD9A 5AM1A 4N7JA 4L5IA 1TYEB 4Q3BA 1S0UA 3KFLA 3B3QA 2OXRA 1P4SA 1GGEA 2YN0A 3TLYA 1QHHB 4E6PA 1XZIA 5E7QA 1YU6A 2QL9A 2CV1A 1I5OA 4AF6A 2Z56A 5KWEA 4OOFA 3S8YA 4LTMA 1F2UA 1K0FA 3AF3A 5FJ8G 1C81A 3UUWA 3E3AA 5CXQA 4BUZA 3P7MA 4IZHA 4IYJA 3PX3A 2HRQA 2INGX 3LSTA 4PNZA 4TTRA 5KNDD 3S0JA 1M34A 4CMGA 2EJCA 1Z47A 1VI2A 4KUGA 4L50A 2RGEA 1CUEA 3T7EA 2JIZD 1SXJA 1TIBA 3UJ8A 4XWYA 4DBZA 4Z99A 2WI8A 3HZRA 2RGVA 2NUTA 4YP9A 3PWZA 4KRFA 2BFCB 1I80A 3UWSA 5KTTA 2WYOA 4UD6A 4D4HA 2JFQA 3SZUA 1TX4B 4DR2B 4YYZA 2IOYA 3B7GA 2H00A 4NCKA 2H16A 3RC7A 3S8MA 4LYDA 4L9AA 2PGLA 4X00A 1B8VA 3ND7A 2VJLA 5DN9A 3PPVA 4TLDA 1PTJA 5JC1A 1U2TA 3C41J 3T06B 1CKMA 1J8VA 1EIZA 1AH2A 3DONA 4RJLA 4XB2A 1DOZA 3K9CA 1T9ZA 4B09A 3INYA 4BAUA 1CERA 2FE4A 3GIWA 4X1KB 1M2FA 3PFGA 3GDFA 3JZFA 1JTEA 1XZ8A 1V3TA 1AMNA 3JSAA 3MGAA 1CQPA 1I1HA 1E5DA 3L6EA 1BC5A 3Q8QB 2F2TA 3VU0A 3GLHE 2NUAB 3V1YA 3EGVA 4DAEA 4EGFA 1ZXXA 4ZEMA 4CFZA 1UWLA 3OF2A 3B70A 4JHLA 1KMMA 2A5GA 2PAAA 4AIRA 3SS8A 1SXQA 1R27A 4RIHA 5FYDA 3EPLA 1L7XA 1Q44A 3DPSA 3QFHA 4IMPA 5E7IA 3VR1A 2EKZA 3GEIA 4CU5A 3IYLW 1HWYA 2AXEA 2J5BA 5C1OA 3GUUA 1VIVA 3N87A 3PS9A 4KN5A 4RGYA 3DAOA 2ZAGA 1CUZA 5JR3A 1U0HC 1PR1A 4IJUA 4C6TA 2W8KA 3U7JA 3B9QA 3NKVA 5EOYA 1KERA 2UUAB 3D6FA 2WQZA 2A1IA 3G6VA 4FWIB 5FOXA 2CBGA 1EK6A 3BA9A 1OBHA 4IIEA 1FX0B 3IELA 1KO5A 3DB1A 4PINA 2JI6A 3GNTA 3RVPA 4MW6A 3PXBA 4ZU6X 4AMVA 2OXIA 4MJLA 1PJ8A 1XPJA 4XZ3A 5JSZB 3BFKA 1AX9A 2HF2A 1TTPB 3N39C 4K9KA 2CHQA 3RYTC 2AF3C 4O7RA 3KQNA 5EE0A 4O82A 3FDZA 2GHRA 3K09C 3BFVA 5LNK6 1GG8A 1J1IA 2Q3DA 4A26A 4AJ9A 3E0QA 1IBKH 1V5GA 1D5CA 4I4CA 4KW7A 1COWD 3LYUA 4K6FA 2AQHA 3OT1A 3PX7A 3GCDA 5AT1A 1XZKA 4KU4A 3WHLA 3VV2A 3GLGB 1C50A 5DSTA 1QH9A 2DWQA 2P6RA 1X7GA 4H31A 3JQFC 4IVNA 3U3RA 4NMHA 3NIGB 3DD1A 1JKIA 1A9PA 4J9VA 4I9FA 4GYWA 2PGAA 4QHSA 3TDKA 4HUJA 2W4MA 4KXYA 4E07A 1PBTA 3QLTA 1LVGA 4QG3A 1T24A 3QW2A 4DMKA 2FK1A 3ORRA 4GU5A 1UM9B 3R3YA 2CD9A 2AFHA 2BTOA 1L4GA 1GKKA 2W43A 3SVTA 3BZUA 1Z2NX 1G8PA 3FR7A 3ZH9B 2YRWA 5I7AA 1C7JA 1H5QA 2PJRA 1GFSA 5A4AA 3DE6X 3ELYA 4GM1A 5KFWA 3L8FA 4KXXA 1Q0RA 4PR3A 3WL6A 1RWBA 3M0EA 4V2IA 4HGQA 2ZJ6A 4LA4A 3W2TA 2BFAA 3AETA 5AW0A 5DISC 2APJA 1NQWA 4Q7KA 1WW2A 1NLFA 4U9HS 3TI7A 1VKJA 1IAQA 2XMQA 4BX3A 4I8DA 3NTXA 1Z33A 3FDJA 2DTDA 1QTNA 1S1MA 3CR7A 4KUHA 4Q44A 4MNTA 2EX0A 4S1OA 1FSPA 4I2NA 1ZAYA 1QIFA 3STUA 4D9NA 1R6AA 2NO5A 2IPOA 5K4GA 3QLEA 3PJRA 2QDKA 4OXRA 2BFFB 1M2VA 3EASA 2C9YA 1UJMA 1XJCA 1TQDA 4JI0H 4ZT4A 3PGXA 3UJCA 5F2KA 1R6TA 4W5RA 2O7RA 5FD8A 1KEPA 1UPXA 3IGFA 3WYCA 3SHVA 1DKMA 3DV0B 4FTWA 4OQMA 1Y1PA 5B6IA 1GG2A 3A26A 3M6IA 4DCSA 3CKKA 2CE7A 3HKCA 4CLEA 1KI7A 4RSHA 1L5SA 1E8DA 1DKLA 3R5SA 2PL1A 1T4DA 5ALMA 3M2TA 4O2RA 4QM7A 2PSDA 4OB8A 3RHFA 4EF5A 4ARCA 2P5SA 3RU2A 3I92A 4NLLA 4CC6A 4IUDS 1UADA 4AJJA 3KQYA 2V7EA 2UVPB 4GRDA 4DR7B 2X0KA 1N6LA 1NQTA 1D6NA 5KS8A 5KJEA 2QRJA 1BCSA 2VUUA 4DIEA 1GNVA 3Q5DA 2Z9CA 2XQGA 2CDCA 1R0ZA 3DMYA 4JLMA 3CKLA 3IKJA 3H0CA 2BJHA 2RD2A 3GJYA 4TXHA 3UB3A 4KR9A 1K66A 2WD9A 1OF1A 1QFSA 5DT9A 1CJUC 1KP2A 1GZVA 2JIPA 2IKSA 4R1LA 3VR5D 2F4VH 1A9RA 1KARA 1FKAH 1SC6A 5AVSA 2QUKA 1JPUA 1MB3A 1GP2A 1MAHA 2G71A 4PZUA 1EX1A 1JXLA 3COPA 4NRDA 4FS3A 3WKBA 4BLTA 1QO9A 2OLKA 5H68A 4AJOA 3DOFA 2QW1A 4V3CA 3R6GA 2VTBB 3DG9A 4IJ5A 1XFDA 1JB1A 1U8FO 1YV9A 4LZZA 3V7NA 2AW5A 3SMQA 3LX6A 4B4KA 2OLJA 1W34A 1JFSA 2V4ZA 4A3IG 2A4KA 1MO3A 3JQ8A 3W1GA 1WG8A 1Z6ZA 3OLQA 4KODA 4NJOA 1YRLA 2ZSUA 1FRQA 1SCDA 4IVQA 1BD3A 4RVSA 2NTYC 4LBYA 2F4NA 5KX5A 1SG0A 2IYAA 4W7IA 3CRVA 4OMFG 1KYQA 5JPIA 4PX5A 1XMSA 4Y9TA 1Y89A 3QGMA 1GRRA 5KFLA 3GEEA 4ZU1X 3OJEA 5E7JA 3WK6A 3KKNA 4NE7A 2EW8A 1CNMA 4N9WA 3UZOA 1UK8A 1L7BA 4CHGA 1B3BA 4BX8A 3MILA 4ZQHA 2F8LA 2EC5A 3N1UA 5K8LA 5KJFA 4Q9KA 5FL7A 4MZDA 3IDOA 3CLTD 4JI2B 4RETA 1P7VA 3MR6A 1K7FB 3BVPA 4KXQA 4GC9A 3P32A 4QOGA 5ISMA 1MZPA 3L1UA 2V8OA 5FLKA 4MLCA 1II9A 3VR6A 3FTEA 3H1GA 1XEWX 3ROZA 4ZOQI 4MUJA 1CUXA 4OG2A 4G0NA 2Q2UA 2R65A 2OQVA 3F96A 1TF7A 1YMQA 3N7AA 2WHYA 3WX0A 1RP1A 1TCVA 2BGWA 4NV1A 3OZRA 3CJQA 4Q02A 3SYRA 1TM2A 5ED4A 4ECRA 4PLFA 3JALB 3MQFA 2QAIA 1H6DA 4IIYA 4W5QA 2D2EA 4QTTB 3AZOA 4F60A 1QAOA 1T3LA 4DC9A 3K3VA 4ODIA 3F9IA 1G20A 2O48X 5IKMA 3BJZA 5I5GA 1W46A 3ICOA 3D3WB 3IAS6 2OBMA 3KU1A 4EW6A 2P77A 1XRMA 4ZVQA 4GLWA 2VPIA 3T7DA 1XEAA 3LBAA 4Q3EA 1L2TA 2ETXA 4Z49A 2DUMA 2ATLA 3I2JA 4BX9A 1TTTA 3SC4A 1G66A 1R0XA 5T5QA 5KOJB 3Q8KA 2SKEA 1SAYA 2QVXX 3OUZA 4MQFB 2X2OA 3GP5A 4O7LA 3ST7A 1QG4A 3A2LA 4U7DA 4RV5A 1N0VC 1GKLA 3LIIA 4H0FA 2ZKIA 3GLQA 5L3SA 4TTIA 4RCNA 1TTHA 2VKTA 4W8GA 3V6MA 1VI5A 1UEIA 3ADPA 3QSGA 1XD8A 5JZVA 3A10A 3IT2A 1VQ1A 3KYJB 2FXVA 1Q7GA 1CE8B 2D7JA 3HFJA 3IG0A 1NBWB 4PLGA 4XPZA 3LMKA 2GD0A 1BQEA 3C4VA 1T5TA 4MWDA 4FE7A 1AZTA 4KHZA 2QRMA 1HDYA 4CLXA 1C1XB 3W7VA 5BR4A 4JUBA 3ISVA 2Q3JA 5LMUB 5D85A 1CETA 1M6NA 1LBEA 1JLLB 3B6ZA 4QBFA 3GNSA 3SGLA 3SLKA 1G8HA 3GDWA 3ZK8A 4MVJD 3B3JA 3QY9A 4FIZA 1Q22A 3EHDA 3VJKA 3HNOA 3K35A 1K75A 1G8AA 2WF9A 2Z83A 3LUAA 1I3OA 5AW8A 1EMDA 5HHTA 1K6MA 2W8ZA 3ZWXA 3KOWA 2FF5A 1IK4A 2Z08A 4RF4A 3LW8A 1GLNA 4LOJA 3T3HA 5HK9A 1I6WA 3NDIA 3WGLA 5E1DA 4QTYA 3SX0A 1HFKA 4WVFA 4CM8A 4DBVO 1ZGBA 1CW2B 1PT5A 2A1UA 2C7OA 1HT2E 1Q0PA 1CZHA 1U3GA 4M99A 4IYRA 3DFMA 4MI9A 3Q0TA 4RADA 3O6VA 5HIKA 3NTOA 4DIKA 1G2IA 3IQGX 2PZJA 2V98A 1CFJA 3V80A 1PLLA 2BHTA 1BS9A 1E1KA 4BZZA 4BN5A 5DWQA 4NE2A 3TTVA 3WIUA 1VKOA 2VYQA 2GCPA 1H9AA 4QWDA 3OM9A 3AM3A 4B3TB 1HT1E 1TT7A 1E2QA 5TQ0A 4EGQA 4MCJA 1F1BA 3FWNA 3GCXA 1TVCA 4IS3A 4M0LA 1N33B 3U3OA 3DYIA 1A8UA 5AM0A 3FKQA 1CVIA 2PT6A 2W93A 3P9KA 1K3UB 4MWEA 2DHEA 2HY7A 4WNAB 2X1LA 2JK0A 1X9HA 3WWIA 2XUAA 3ZY2A 4MYRA 1LI7A 3AM5A 2IH4A 1C5KA 2ILVA 3O4GA 3EPGA 3EY9A 3KJXA 4BRSA 3HK2A 2JFOA 2ZYSA 3TSOA 3YASA 3FMGA 4P32A 3D6TB 3N6RA 4FLFA 2ATVA 4E32A 1VCHA 1QMGA 1QRTA 2FMIA 2ZCUA 3GTMA 1JX6A 1E0DA 4LC0A 3GEHA 1THZA 4F50A 4M0CA 1UDWA 1VBHA 1XNJA 3V42A 1RJEA 3LJKA 1S8OA 4EYQA 3JZAA 1BYUA 4JJFA 2IS6A 1BN7A 4HJRA 1NLYA 4B48A 2WA2A 2IYFA 5M3BA 3Q7IA 4A92A 2C3MA 3ASYA 5MHTA 4Y1RA 2ODEA 3UW1A 4DBLC 4NIMA 1A4IA 5KYWB 8ABPA 3TQHA 2Q6TA 4JOQA 5KNBH 3M4IA 1U1CA 2PMDA 4DPMA 2NTEA 4PHHA 1Z83A 2J67A 3Q40A 3UFXA 1K3TA 1F6WA 3S99A 3GB8B 4AU1A 3UUEA 5HKKD 1X70A 1GGNA 5DTJA 1NA5A 2BFMA 4I4TB 5K1ZA 2C1EA 1QTQA 3ZZNA 4TZ0A 3R5XA 1RJRA 4NPCA 1QKKA 1TD1A 3U09A 4EO7A 3DPUA 3BSYA 4YPVA 2O0HA 3EFHA 1DIOB 1M7JA 3E9QA 1JIKA 3OD1A 4O02B 4ZD6A 2Q4DA 3OKFA 3WQHA 1GAEO 3CNEA 3KS9A 4U63A 4W1RA 1DJMA 5IAOA 1LRKA 1JKXA 4GRAA 4X66B 3EEOA 1BU8A 4EH1A 2Q7OE 4MUXA 2GVNA 2PWPA 2GRJA 2HA7A 3CISA 2X7JA 2YV2A 2QSZA 3GAZA 5JQGA 2P0YA 3DV2A 3WRXC 1G8JA 3DZDA 3M89A 1H2AS 2Q1UA 3S6JA 2A1TS 4O2BF 3AR4A 3A06A 1L8XA 3TIXB 5HILA 4EY3A 4MP6A 4F06A 2IYQA 1Z2CA 3RWBA 4Q4JB 2VUMA 1QFXA 1SB8A 4GUAA 1VMIA 4POOA 1B6SA 2RH9B 3DJYA 3DEFA 2Q5FA 5LQDA 3V4SA 3MLEA 3UH1A 5AM3A 4IDGA 1FFDA 1Z9BA 2LPMA 1HT3A 2AFRA 5ILQA 2JD2A 1JNXX 3GEPA 2R66A 1GQQA 1KJQA 3SQOA 5BQXA 1X9IA 2A0KA 3P2EA 5EN4A 2JASA 1ATIA 4MS1A 4HDKA 4LJKA 1CJSA 4JOBA 2YOFA 4K87A 5K8UA 3NH6A 3IQXA 3FWYA 3MOSA 1CD5A 1Z2OX 3LQSA 1RC1A 1H0KA 2Z4TA 5E1MA 5DNUA 1HSOA 5HIIA 1KVRA 2XTNA 1L8QA 1YR2A 2P3SA 4M0JA 4MLDA 5IEBA 2WA1A 2HHHB 5KU1A 1F8UA 1WVIA 4LX8A 1DV1A 4WUVA 3DKPA 2UYQA 2QPOA 1C29B 3RB4A 5IJ9A 5LP6B 4KGDA 3NJ8A 4QO7A 3H04A 1XXHE 5JSQA 4WQMA 3HJFA 2TMDA 3EWNA 4D26A 5AK4A 3H18A 2A1HA 5I01A 3LK6A 3L4EA 6YASA 1IEVA 4ZYZA 2EJ2A 2RB5A 4MUMA 1LJ8A 1XD2B 4EYEA 5DLGA 4ALKA 3VU9A 1QWSA 2AGOA 4DCOA 1FP1D 3T0FA 2GZRA 4L9WA 1VJ1A 3REFA 3KV1A 2HSDA 3ESYA 1HZJA 2H0AA 1VLMA 1IZYA 3PUZA 4OLHA 1QGDA 4IH9A 1VPVA 2B99A 4MGKR 4C1BA 2XKAA 2DFKB 3R8CA 4YFYA 2JKVA 4ZALA 3R7FA 4MRSA 2JGEA 4D3ZA 1Y4SA 3RRBA 4HDSA 3N5CA 1OXUA 1NRIA 2WQ7A 4AKIA 3WDSA 5B1EA 3GP3A 4YJKA 1QGZA 4E33A 4GVXA 3ILYA 2DBRA 1DBIA 2RK3A 2VF4X 4US2R 5HW0A 2JHCA 5JRDS 1PGJA 2DT8A 4AFNA 5CFMA 1N1GA 2IGBA 3ZKWB 5CGZA 4P36A 4XVRA 2VO1A 2ZUTA 1Y8RA 1YNOA 3GELA 1D0SA 3N76A 4RFLA 1DTWB 4J7CA 1TA4A 3EPIA 2WSBA 1EVKA 1A82A 3OZSA 1IM5A 3EYYA 4MV3A 3MNFA 1EX6A 2UXDB 2RMKA 1FRZA 4HZUB 5ELXA 3F5DA 3L4BA 4TLAA 1YIOA 4RVUA 3CU5A 1Z29A 3W5UA 4O4HF 1NVXQ 2B98A 4OX9B 4O4IA 4OM7A 1DLJA 2QTMA 4RTRA 1S4MA 1RYNA 1T43A 1HZZA 1WE2A 1A9SA 1O03A 2FDCA 3PHCA 2QBYA 3OFND 4EB6B 4P4NA 5K0GA 5I5WA 2BP7B 1N1DA 1OR8A 3A9VA 5KFIA 5BN5A 2RHOA 1A5BB 3TTYA 3DZFA 2FPGB 1CJVC 1Y0BA 3F5SA 2HREA 2HU2A 2NZ2A 4QELA 3OZDA 4MLZA 2YBEA 5LM3A 3TW4A 1LPMA 2XRZA 5IVDA 3JQBA 4PQFA 3FETA 4A3BG 2QA5A 3NVKI 2A1TR 4G1EB 4C6RA 4WECA 3BWBA 5AK3A 4NTZA 5EG5A 1SUPA 3DTGA 3RYHB 3C8HA 3HYNA 5JNVA 4HAIA 5IPFA 2PVSA 4C4YA 4O4LF 2P4HX 2RG1A 2BQUA 2P1RA 2I7TA 2RI6A 5EXPA 1E1RD 3TZ6A 1OASA 4GI3A 2LZ0A 3KJZA 1LTKA 1NP7A 2FB9A 1PJBA 1OD6A 1WCMA 2ZR8A 1H05A 2F3TA 3AERB 3LX4A 2GCGA 2Y92A 3HLKA 2AK2A 2GAAA 3PXXA 1OOEA 4PRYA 1KO4A 2Q7XA 1P0PA 4MVJA 2WIJA 3NHYA 4Y98A 4D3FA 5KFDA 1K9VF 3JQ9A 3MHPA 4I55B 2VDLB 4RVDA 1GZ7A 4EFNA 4H1WA 2Y1XA 2HV8A 1KDVA 3CUEF 2IBMA 1YKFA 3DVRX 1PV1A 1ET0A 1XVLA 1KZ7B 4EG0A 4IF6A 2LD4A 2YN2A 3B3AA 2OAP1 3C7AA 4E3ZA 1QE3A 2C0QA 2ZPTX 1ZVKA 1P5JA 1AGNA 3WGUA 3MFHA 1ZMXA 1VP9A 2GN0A 4FGJA 5U1PA 4HATA 4QYXA 2QQGA 1AIPA 3QHAA 3LL4A 1ACLA 1H5UA 1XMQH 2DY1A 4CG2A 4ER7A 4AYXA 4YO7A 3WNZA 1VL8A 4PTYA 4NBWA 2JH9A 1U1DA 1WKVA 1ZGCA 2OFFA 3RJ0A 3QKSA 2P2NA 3KEFA 1GU7A 1SOUA 2G83A 1OWPA 3AEUB 3ZCRA 1A9ZA 1SXJD 3FUWA 5DNVA 1TYDE 1E3TA 4TTAA 5H83A 2QYZA 2Q9UA 3PLNA 1R6XA 1SCUA 2ZI4A 5D1HA 4QYIA 3GIPA 3ESDA 2FG6C 3M4JA 5I5SA 1DFHA 3NWOA 3TD6A 1FCJA 3MMZA 4WOKA 1WTAA 1J2TA 3LSYA 3BCSA 2JRLA 4Z0PA 1OXXK 1VL0A 1T8YA 2CUTA 1EGAA 2AK3A 4LYGA 1BMFD 1CYDA 4FYJA 3NM4A 4K1XA 4M2LA 3PZBA 2BZSA 2WKPA 4HOYA 4X1IB 1Q74A 3AKDA 1V2GA 4GOXA 5FJJA 1MRNA 4HVAA 5AUOB 2NV6A 3VC2A 1N3BA 3PKIA 3LYLA 4PO9A 3R7SA 4R2HA 3JAWB 2VSYA 5DI3A 1RWOA 2WTNA 3TOZA 1JR6A 3GIQA 4EK9A 1ELOA 1NVVQ 1OFIA 4CBVA 2VIIA 3OU7A 1B0PA 3UWKA 4W99A 4LNUA 5EWFA 1KBZA 3ODGA 4NZZA 3U0BA 2GD6A 1X86B 2VVTA 3H4MA 2F1OA 4C6HA 4HNUA 1ZUD1 1U2PA 2DQSA 4B4OA 1C9JA 3D1VA 3W6ZA 1AY0A 3T7TA 4XH9B 4XJSA 4URYR 3HUDA 1PFUA 3AEKB 5AK0A 1SVNA 2HGSA 2VOJA 1FP6A 3PCXA 3GG9A 1VLLA 2OM2A 1UP4A 1OILA 3GT0A 2BJVA 4FOLA 1RWXA 4CGYA 3P2IA 4EY7A 5KG7A 4MKFA 2MMCA 2IIQA 4RVNA 3ML1A 2VXCA 3EXIA 1L5NA 4EGJA 3UTCA 2PZFA 3N53A 4ZICA 4WCFC 4NEHB 5LA6F 1E5XA 1P81A 2DJ5A 4RGBA 3DBRB 2ISCA 3TR0A 4ZI7B 1TWGA 1GQSA 3MEQA 4FMCB 2RSLA 4FONA 1JBEA 4ER3A 4RVOA 3EXEA 4CKEA 4KIWA 5K0CA 5LFAA 3DC7A 3Q1KA 3JWGA 1BXZA 1VL2A 2FPMA 3ETHA 1KAQA 2WSYB 1GARA 5D3MB 5H81A 3D6VA 5AHXA 4BV9A 3CR3C 2ZS7A 3GQBB 4L5BA 4BOYA 1B6GA 3NI2A 3HEMA 1RWPA 3N0TA 1HO3A 2ZVPX 1SXPA 4WGGA 1YVPA 2V7TA 2Z2YA 2R8HA 2AIRA 1JJVA 1KJWA 1Q3HA 3PR1A 1W4CA 4KFCA 2Q29A 1H2RS 1Z0DA 5JARA 2NSLA 3IRUA 5E38A 1VJ0A 3HGQA 4WMLA 2BCJQ 2NUPA 1G4AE 2DPGA 3LQ2A 4KE8A 5AM4A 3H16A 2F67A 3MTEA 3AFGA 4E5SA 4JV0A 3EVNA 1BW9A 3EGOA 3IMGA 5IFKA 3SYLA 2I62A 4JENA 4MAAA 2CEKA 3BCUA 5EWGA 5BSWA 4QUBA 4DG8A 5TS2A 4LAFA 2RH4A 2O5EA 1T2EA 4PZ6A 1TYCA 1FOEB 4JJKA 1LSUA 3MBOA 5GOZA 4S2EA 1NSTA 2C31A 3L7DA 1KRXA 3Q7SA 1USGA 4RPGA 5C1DA 4U8GA 3NTQA 4R1SA 3KWJA 5A71A 4HB0A 1X14A 1Z0UA 3JWPA 2FRXA 3F73A 5C8YF 4ROSA 4E4YA 3A2KA 2GMWA 2O1SA 1Y1WG 3UC5A 3DAAA 4O6VA 4WNIA 2WP8J 1V25A 2AJCA 4DRZA 5KO2A 1P75A 1VMKA 4JKOA 1L6RA 4AQDA 4B40A 4G36A 2I2XB 1RVDA 3RPEA 2P5YA 3FZGA 4ZVPA 4UARA 3R9WA 1Q57A 4PPQA 4D2IA 5I7RA 1EX7A 5I6DA 3MJFA 2ZJ4A 3F90A 3B38A 2FRVA 1OZAA 4I66A 1TUBB 1HETA 4UAVA 3EGEA 5IWAB 1V9PA 3QJYA 5SY6A 4HN2A 2J6CA 3PVZA 2CKMA 2SCUB 1SEVA 1ADFA 4CTKA 1IMJA 1CTQA 4DIUA 4IXNA 5KVSA 3FNIA 1ZOLA 3WJAA 1E3WB 2ZBPA 3G7NA 1TQHA 1PVDA 3GH3A 5DCYA 1TJ5A 4U8HA 2D1QA 5DO9A 3AWIA 1ONOA 3DZHA 5AUPB 3L43A 4APMA 4QREA 4QOEA 2BFWA 3WB0A 3JR7A 3RF7A 4EX7A 3FSJX 4IDBA 2C00A 3OPYI 1YMUA 1P31A 3HR7A 5I9NA 4Q43A 4NY1A 2TECE 4IIFA 2GXUA 3ESQA 2E4XA 3KIPA 2V6IA 4KI0A 1PJZA 2A92A 3K1TA 3PDIB 1F8FA 2CNLA 3O82A 4KH1A 4DY4A 2HXGA 1U3UA 2H3HA 1U7PA 3PLAE 2IYUA 1NW5A 4BNJA 5HDQA 3FFTA 4OHUA 1P1FA 5EKSA 5ALEA 4QXAA 4MR8A 3T1QA 4QT4A 4OMCA 4TQSA 2D5CA 4P33A 4Z7JA 1W48A 3UH0A 3I1FA 4BQSA 1QFMA 5JVDF 1WQ1R 3I05A 1K83A 3DE7X 2IHVA 3HSKA 4URVR 8OHMA 2JNWA 2IUYA 2B82A 4JP8A 2HBYA 1DC8A 1OC4A 1CY7A 3SOPA 1GLVA 2ZTLA 3ZNNA 4ENTA 3AXSA 3CGWA 2XGSA 2VT7A 2C5FA 3OSUA 2XNKA 3WNVA 3VHRA 4S0XA 1WWKA 3MERA 3OFNA 3WTBA 2FETA 3FJOA 1Z7WA 2R751 1DQRA 1YL7A 4NX2A 3LT5A 3RE1A 2HGXA 5L6LB 3M33A 3UAWA 3KE8A 2EW2A 1PN3A 4P31A 1TFUA 3NLLA 4BNNA 2VEDA 1S1CA 3QUAA 4W6QA 4LF9B 4E5KA 2OYCA 3WNQA 4X45A 1YHYA 2WOJA 4DR1H 3AR6A 1DADA 4M1MA 3OX2A 2IEBA 3JSXA 2Y1LA 1EJBA 3IDAA 4IZ6A 2NADA 3BT7A 3ANNA 5LNK1 3H83A 4GLXA 1Q3TA 5H82A 2CE2X 4KXFB 5BWXA 2W7TA 5J2TB 3R1IA 4CL8A 2C2WA 1JXAA 3OZIA 4I6JA 1MKYA 2NAFA 1E1RA 1GFWA 2C8KA 3AHIA 1Z7YA 2R8ZA 3NGDA 5D3KA 3GCZA 1QF6A 1D6JA 3FDFA 3E27A 4JQZA 4JB2A 4RHFA 2WJAA 1S10A 3DQQA 2QM7A 4O7TA 3TL6A 4NBLA 2XADA 2C77A 3ZBUA 4D0GA 4C22A 3DKRA 4JELA 1RE1A 1I36A 4YR0A 3FYUB 3IO3A 2ZJ2A 2BISA 1MABA 3T5LA 4IDNA 3TW7A 2ZIXA 4LGYA 4RWZA 3TJRA 4DDKA 2EJ0A 4KGZA 2WIKA 3MZ0A 2PWAA 2WTAA 1GJRA 2JJ2D 3MJEA 1W44A 1XROA 4P4GA 2OHFA 5KU7A 1PT9A 2H57A 1J5XA 1FY2A 4WXEA 3VR6D 1O7JA 3THYA 2H8GA 5KQRA 2QRHA 4TWIA 1NW4A 3M9NB 1WEKA 2NU7B 4LZJA 4MPJA 5GY7A 4ZYUA 4DNOA 4CLHA 3EPJA 2KW5A 4PM4A 3H19A 5KG0A 3M9LA 1PJRA 4E0BA 5BQOA 2QX6A 2SBTA 4RGQA 2PMEA 2X19A 4W1QA 3JQAA 3S2FA 1TU0A 3WYEA 2R87A 2VAMA 1S2MA 1J5PA 3EPKA 5SZKB 1L8AA 4RKRA 3GBPA 5GGXA 3V8NA 1UEXC 2ZAOA 4MV1A 1U3DA 3DMGA 3VOBA 3NHRA 3WTCA 2FPIB 3E1GA 2VF2A 5A6SB 4YHHB 1HC7A 3K1YA 4RU9A 4G8JA 1TOAA 3QU5A 4GXRA 3L8HA 4DEXA 1CKEA 2GFQA 2ERYA 4YC7A 1EQUA 3RVSA 1U8YA 1YFLA 1BMFA 3NT5A 4KR3A 3PUHA 3JRXA 2VK2A 1OX4A 4QJ3A 3ZCUA 2RC6A 4UEQA 3L0CA 1WR8A 1ZCFA 4CF4A 2RHCA 3GK3A 5A4DA 5DX0A 4JC4A 2COJA 2IHKA 3NPAA 3DOJA 1MH1A 3UAOA 1PR3A 4BAZA 2IHUA 3KTMA 4DR3H 3HLYA 2FSGA 2EWVA 2JEIA 3EWAA 2P9BA 1ADBA 1V8BA 2YL2A 3H9QA 4P8RA 1VAJA 2BV3A 2PAFA 4J16A 2XE8A 1N5IA 2RGGA 3VRHA 1VL5A 4Y6RA 1I13A 2VJMA 5G0SA 4C0HA 2ZRJA 5A62A 4LSWA 5BSRA 3IVMA 5KAPA 1ZM2A 4XYBA 4W8HA 4O2AB 3KDSE 3FWKA 1D1QA 4Z4CA 4RPCA 1ZK3A 4JBYA 3BMNB 3FCUB 5FUMA 4G3XA 4DCJA 1XDDA 2IRWA 4BNXA 3TMKA 3RS5A 3Q15C 2EP8A 1YJ8A 2C4VA 1PJQA 4ARZB 2IUTA 1UKAA 2Q5CA 4TKLA 3AZQA 4Y2XA 3UK0A 3RVLA 3AUUA 4S1TA 2J4DA 5L7WA 1QIEA 1SOMA 1YZLA 4OBWA 1VYTA 3N0RA 3A14A 4YRDA 3KXPA 1I10A 1NPTO 3V2HA 1OI3A 3LBYA 4GRIA 1X15A 3KHLA 2CJWA 5C8DA 1F20A 3JZDA 1LD3A 1CQXA 1ZISA 4JVMA 3BBPA 4J0QA 4AS1A 3E8MA 3ZXXA 4Y8VB 1A1SA 3IT0A 4H77A 3L77A 4D99A 4HO1X 3ODPA 2HAEA 1G42A 2BGLA 1IK6A 1WNTA 1I33A 3BMXA 2B25A 4XCVA 1UFOA 1Y7HA 1M5TA 4PZ9A 4WHXA 4D02A 1YRHA 3DOEA 3NFRA 2KB0A 1QPBA 2BZ0A 3I42A 1CUYA 4M76B 4MUNA 4OFXA 2OAGA 4O59O 2QTCA 3MT7A 3IOEA 2IY8A 1Y81A 2QU8A 2Q6LA 3DDNA 3PR2B 5JAOA 2Y0BA 1M7BA 4DUPA 1ZCBA 2FZGA 3EZ9A 3AFHA 3CSWA 2A3RA 4C0JA 3I4LA 2CYAA 5JECA 3ESZA 3NEAA 4DCNA 3O8CA 4LHWA 3SBEA 5BT8A 3PE6A 2P65A 4RNMA 3MJCA 4X62H 2QL6A 4TUYF 4LSAA 4II2A 3OCWA 3MMXA 4XUCA 2FN3A 5FUBA 4B73A 4MUAA 1SKAA 4CEIB 2HDKA 1E2BA 2VNSA 1DAPA 4IEEA 4N1AA 3ZIAA 2P91A 4QYSA 3ANYB 1XMJA 1QV6A 4DQUA 2IUEA 1B23P 3U7HB 2JHFA 1R8YA 1RLOA 1GTMA 3U7EB 4Z4GA 5J43A 2HCRA 5DLYA 1JL3A 2ZM6B 2BFNA 5ALJA 5CBPB 4ICIA 5FLEX 3EIWA 4NXMH 4L5CA 2CY0A 5EHQA 2WV9A 4IGAA 2E5LB 2RGNA 4Z8YA 1T9KA 2VCHA 1S2OA 5BR1A 1ZHFA 4WXPA 4CQMB 3FKJA 2VDMB 1T6ZA 3QUBA 1N75A 2HT6A 3SC2B 4DUYB 3TS1A 4DLLA 5DXFA 1RBMA 1H2HA 1Y1RA 1NJ6A 3C6YA 4RAQA 4XDYA 2D4HA 1NZDA 2X13A 5LQKA 3QTLA 1II8A 4Z5XA 1OFGA 3U7GA 4CDGA 5JMPA 4G4SP 4P3PA 4P82A 1Q83A 1GCUA 1ZW6A 3A6PC 3V4VB 4XB6B 3IAS1 5CCDA 4G37A 2MOKA 4I6GA 1A9YA 1SHTX 3NNNA 3K1JA 2VA3A 3S1SA 3LXXA 4EUKA 5JV5A 2X42A 4U02A 3VR2A 2CNNA 2WKWA 3OPYB 5J1SB 2C2ZA 4L07A 3ZE8A 2L17A 3SG0A 3Q3GE 2GBPA 3BXEA 1CR6A 4DV0H 4LDPA 4P22A 3P9XA 1S2GA 4NFYA 2IIVA 4I5FA 2QUAA 5BYKA 2XKKA 4G56A 4B3XA 3DCIA 5BYAA 1O57A 4HLQB 1MJ5A 3EPPA 121PA 4B4VA 1GD1O 1C14A 4I1YA 1WF3A 5KAMA 4MDYA 1EGQA 4K9NA 1L1EA 1KHHA 3NDBB 5DQHA 1NVBA 1MRZA 1JTFA 1ZESA 1L5MA 3ZLUA 2C0CA 1TE2A 5TE9A 4XIFA 5EP1A 2HTFA 2J6TA 2G4VA 4YONB 3HBJA 1NSFA 4GBJA 2J08A 4C03A 4XVUA 2AC4A 3WIOA 3H2BA 1BMTA 4HDRA 1SC9A 4PLVA 1PGQA 4DV3B 2IA5A 3KWFA 4L4RA 2OD7A 3RK1A 1ZL2A 3LDGA 1VE6A 1DNPA 3SC6A 1B8PA 2M1ZA 4BTEA 4IDAA 3QNUA 3EFOA 1C4OA 3ZCTA 2AFIA 4KYUA 3MB5A 1FJ2A 3WK8A 3WGZA 4K8RB 1FE8A 1Q1GA 5A4FS 1BTOA 5BWVA 3HB9A 4C7JA 1GCGA 3U5ZB 2Y0EA 3VPBA 4FFBB 4HWOA 3ZQUA 4DARA 5LIPA 1EFLA 4WZAB 2Q4OA 5G1PA 4H1HA 2O1WA 2R79A 5A0FA 3LCJA 3ZZTA 2XMZA 3BTOA 1XTQA 1GZSA 1F38A 1Q0UA 2L19A 4PZPA 2RBGA 4J4BA 1GPDG 3GUCA 5K7SA 5EIEA 1W5BA 1NRJB 1N2EA 2CJFA 4Q0MA 5K3OA 1QQTA 3NGLA 4LCBA 3RQIA 3PEWA 3PRHA 2Q50A 3P9IA 2QRLA 3VNSA 5KFMA 2WM3A 3ZGNA 3H1FA 2PPLA 3V4RA 1R1DA 1E1YA 1OLUB 1HFWA 1I4EB 1TMGE 4MQBA 2VH5R 3T1OA 4L4SA 3UT5A 3AT1A 4TS4A 3DZJA 1L4BA 2X8AA 2A9OA 2IYVA 3KYDA 4K28A 5H0IA 3WBKA 4RXUA 4ILEA 3R9KA 2VPWA 2JAHA 5FFFA 3T0GA 2NWQA 1YDGA 2XMDA 4AB1A 3HKBB 3BH6A 2AMLA 4HDQB 5TJ9A 3ZNOA 1XC7A 1MJGA 3RUFA 2FY8A 3R4VA 2V5UA 2YHUA 4C06A 1EH5A 4Y2QA 2JJ2A 4KACA 4BEWA 1EU1A 4ETWA 4V39A 2JAQA 4OP1A 4WOCA 1XPOA 3CM0A 2V7WA 1I7SB 1USIA 2J09A 2O2YA 4JZKA 4QPZA 3TB4A 4FBGA 1IJFA 1F0KA 1UZLA 1JEEA 5CEFA 2DFNA 3R9XA 4B35A 4K40A 1T0UA 1T9BA 3LG2A 4MKRA 4YX9A 1VG9B 1VJTA 1HE3A 4N8EA 3BM5A 2E4ZA 2R8XA 3PO2G 3C6MA 4ZCRA 4D5GA 5EE3A 4QOSA 4CHIA 3QU2A 4OCZA 2VBCA 3D6UA 4JQYA 3OLXA 2IJGX 2Y2UA 1FIUA 2ICAA 1WF6A 3KO8A 4B3HA 4HLDA 2WWXA 4NHEA 2XOKA 3ZWWA 2AD1A 4W9RA 2OQRA 4N9QA 1T10A 3BXHA 5KSOA 2G7ZA 3QA9A 3T9FA 4XSHA 5IJ0B 3NBYB 1XTUA 5ALIA 3LZCA 1ZEMA 2BFBB 5BQFA 4UMDA 3E9EA 3QEMB 4DLSA 5COBA 2CL0X 1S2NA 2G77B 1K5GA 3OEYA 4CQLA 1R6DA 1F6BA 1O4WA 1G9TA 1FVXA 2B5VA 1HYGA 1W75A 4M46A 3E5NA 3A9UA 3L7YA 1D0IA 3A70A 3Q3IA 1IDN1 4D8UA 3SXUA 1TC2A 6ABPA 2OB1A 3R3UA 4XQEA 1BJTA 5DF1A 1P3DA 5JJCA 1GA4A 4IZIA 4JLSA 3Q88A 5MN6A 1SUWA 1LTHR 2B8JA 3AM1A 3CV3A 3BC1A 3F6PA 5D01A 5BQ5A 1N32B 2Q1XA 3HSSA 4HFNA 1C8KA 1NN3A 3MW8A 4M8NE 4M49A 5JS7A 4EX6A 4NFLA 1VHDA 3UVEA 5CW1A 5BSVA 4OHWA 4Q00A 2FE3A 3CLHA 2FEWB 1MLDA 4C3ZA 1SCIA 1JALA 3HDGA 2J6SA 1RYDA 3SBDA 5JS1A 3LP8A 5J2UF 4ZT2A 2FZVA 2D5IA 2VTEA 4G84A 5JAMA 2I71A 4NEQA 1HEUA 2CUKA 5CRIA 1NI4B 1B43A 4ZOLB 4DR2H 2FR8A 5L1IA 2XCRB 3MGBA 2WJIA 2HK9A 5DE3A 4CL2A 1QCZA 4G5QA 4V2UA 3LUBA 4QEDA 3VC7A 3HKZE 3L0OA 3U6KA 1A0IA 4FW9A 2VHJA 4C0WA 4KMRA 5JXHA 1ODIA 2AFVA 4EPWA 2AN3A 2FQQA 1AHPA 1VZ3A 4K9LA 1WXXA 3VFDA 4HH1A 2PGDA 3R6TA 1J9ZA 2C5HA 3RC8A 5KT4A 4PSDA 4ERNA 1U9JA 2YXDA 4OPMA 2X1MA 1A5AB 4MXDA 1HQDA 1L5KA 3QOWA 4E03A 1ULZA 4IQFA 2XB9A 3THXB 1T35A 5F5LA 5D00A 3RRFA 3ZGZA 1MXHA 2BMWA 5SYNA 3G23A 3AHCA 3C7KA 3OFKA 5CJ2A 3FLAA 4ZCSA 5DT2A 3SHOA 1W29A 4KLCA 1VSQA 3P19A 3AZPA 4PG7A 1KVUA 3UEOA 2QGZA 2CCGA 5HBRB 4NU0A 1IOZA 1VB3A 4Z9XA 2W0SA 2XXAA 2I1LA 1BJKA 1F2DA 2TYSB 5C8XA 3OFVA 4OJNA 4AJEA 4HFJA 1T3GA 4OBEA 3ZUPA 4QXQA 4HT3B 4QWEA 3N58A 3CUWA 2ZRIA 4ECSA 1N2CB 1FFXA 1CY1A 1WW8A 2JA6A 1T13A 4JI6B 3ZVLA 5DJ5A 1UJ2A 3BA8A 3R09A 2QMOA 1GL7A 4URFA 2XWJI 1E96A 4JLOA 5IDXA 2ROQA 1Z8HA 3UJ6A 2HM7A 4BCCA 2G5TA 2FPPA 3CR8A 1EA7A 1O2DA 2MYNA 4B3IA 1B76A 2IUSA 2R1UA 2AG6A 2AOTA 2CFSA 2JLSA 3UENA 3B5JA 1CJCA 4PTZA 2DSTA 5GIOE 3H13A 3HBFA 5EE5B 4FYIA 1XZDA 2K7ZA 5HE9A 2E4YA 5HKBA 3PPXA 3U62A 4DV1B 1S0MA 1TLLA 1E4GT 4X97A 3EG5A