4Y8VB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Transferase
molecule keywords alpha subunit of acetyl-CoA synthetase (NDP forming)
total genus 76
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4y8vB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4y8vB02
3LWBA 1CQIB 5C8YF 1SCUB 2GQSA 2XCLA 2DIKA 4FFLA 5LYJF 5KX5F 2DLNA 1T36A 2W6PA 2I8CA 3V4SA 1GSHA 2J9GA 3HB9A 4O82A 3U9TA 4O7LA 4O7TA 4O4JF 3RV3A 4FGRA 4ZQIA 2CNQA 5CB4F 2CQYA 3WO1A 5D8DA 4HNTA 3JRWA 1UC8A 4O7RA 3OUZA 4XYMB 5JVLA 5BPHA 3KAJA 3TW6A 2PBZA 3WNZA 4O4HF 3G8DA 4C5AA 1EHIA 2YZGA 4FU0A 4MAMA 1EZ1A 1I7LA 4MV8A 3U9SA 5JQGF 1OBGA 1KJQA 4O7SA 2NU6B 1IOVA 4L1KA 4HR7A 3MJFA 2VR1A 4FFOA 2FB9A 1GGOA 2PVPA 3G8CA 3U55A 4O2AF 2YL2A 2YYAA 1CQJB 5CAEB 2IP4A 1JDBB 2HGSA 1B6SA 1VBHA 1KJ9A 5EZYF 5JVDF 1KJIA 2YS6A 4ZI7F 1JKJB 2V5AA 1KUTA 4MV1A 4XX0B 3TIIA 3HBLA 3VMMA 3Q2OA 4FFMA 2W6MA 4C5BA 2DZDA 2ZDGA 3R9RA 2I80A 2ZDQA 1Z2OX 2YRWA 4MV4A 2YS7A 4Y8VB 2QF7A 3AX6A 2R87A 3UFXB 4O84A 3R5FA 3KALA 1GLVA 2FPIB 2YW2A 2SCUB 4YAJB 4MV9A 1PX2A 1DV1A 2W6ZA 3K5HA 4FFNA 2R7LA 4XZ3B 4IHJF 5JH7F 1Z2PX 3R5HA 4MA0A 3N6RA 3BG5A 3ETJA 4XYLB 3ORQA 4MV7A 3TQTA 3RV4A 2P0AA 3V4ZA 4ZHQF 5C1PA 2CNUA 2FPGB 1KJ8A 1W93A 4C5CA 1ULZA 1KEEA 2HJWA 1DV2A 2V58A 2ZDHA 2W6NA 4O2BF 3JRXA 5HV6A 2GLTA 3VA7A 2YZMA 1VKZA 2GPWA 1UC9A 3N8DA 2R7KA 3WO0A 1AUXA 1EYZA 3GLKA 4YJ2F 4HQ6A 3SE7A 3JZIA 2YRXA 2R7NA 2Z02A 1IOWA 3VOTA 2FPPB 4I4TF 3TINA 5DMXA 4YB8B 4IWXA 3ORRA 3QFFA 1B6RA 3ETHA 2NU9B 3KREA 5HBRB 3AW8A 1C30A 3DF7A 1AUVA 3I12A 1CS0A 4E4TA 3RFCA 5CA1F 4O4LF 2NU8B 4ZOLF 5FNVF 4EGQA 3VPCA 1KBLA 1W96A 5J2UF 1OBDA 2W6QA 2R6FA 5H80A 1CE8A 4O7VA 4O4IF 2YZLA 3JZFA 1PK8A 2V59A 4O7NA 4MA5A 2DWCA 1BNCA 4HNVA 5LP6F 2W71A 4FFRA 4DIMA 3HO8A 2NUAB 4O83A 2OLSA 4O7YA 2YZNA 4O7ZA 4NYEA 2FP4B 3Q1KA 4FFPA 4MV3A 5K2MA 1M0TA 1DIKA 4IIJF 2R7MA 1M0WA 1GSAA 2W6OA 1E4EA 1A9XA 5J2TF 5BMVF 3OUUA 1BXRA 5JQWA 1Z2NX 1JLLB 4TV9F 4EGJA 1EUCB 5CA0F 4MV6A 2VQDA 1KJJA 3VPBA 1E4EB 2GPSA 2NU7B 1WR2A 2C00A 2R86A 1KC7A 5BPFA 4ME6A 4O86A 5LOVF 4I50F 4TV8F 2GQRA 3GIDA 3MWDA 4O7WA 4RZQA 1EUDB 4DLKA 3R23A 1I7NA 4WD3A 5C1OA 1GSOA 5IYZF 4YAKB 2CNVA 1JDEA 3E5NA 3K3PA 3R5XA 4O81A 5LXTF 2Z04A 4HNUA 4FE2A 4YBZB 2R82A 4TUYF 5LA6F 2CZGA 2X0SA 3U54A 2PN1A 2W70A 5I47A 4M9UA 2XD4A 3MWEA 3VPDA 4I55F 2R84A 4IZOA 1A48A 3KAKA 5GONF 2WYOA 2R85A 1VBGA 3NUAA 3RUPA 4WBNF 3K5IA 1C3OA 2I87A 4YJ3F 3TIGA 2QK4A 3LP8A 2VPQA 4QSHA 4EG0A 2YWVA 4IWYA 1M6VA 5KKNB
chains in the Genus database with same CATH superfamily
3LWBA 1CQIB 2HVSA 3BQ2A 4GC6A 3PW0A 2FLLA 5C8YF 4GC7A 4DL6A 5DG7A 1SCUB 2CW7A 4X65H 5IYCG 4FBTA 5DQHA 2ASJA 2ABJA 4DL3A 2GQSA 5DGBA 4PWQA 3GTKA 2XCLA 2DIKA 4FFLA 5LYJF 5KX5F 4BBSG 3PFFA 1TWHA 4CKCA 5KFWA 2NVXA 2DLNA 5C4XG 5DAAA 5IWAH 1CKNB 1T36A 4J9SA 1V4YA 2C2EA 2W6PA 2W9AA 3H40A 2I8CA 3V4SA 5DGIA 2UVRA 1VAJA 1I3QA 4Q4CA 4ETSA 5IP9G 1TA8A 3MWMA 1GSHA 2J9GA 2HG8A 1CKNA 4DAAA 4DUYH 4QW9A 4JV2A 2VUMA 3HB9A 4O82A 2UXBH 5KFPA 3U9TA 4ECXA 4O7LA 5CR5A 4O7TA 4O4JF 3RV3A 3MR5A 2UVWA 4FGRA 2HGWA 4RNOA 4ZQIA 2WB1E 1S97A 3RB6A 2CNQA 1G2WA 4ED7A 2E2HA 2W9BB 5CB4F 2CQYA 2W9BA 2VUGA 4J9NA 4FBUA 5KT3A 3WO1A 4EEYA 3GTLA 5DG8A 5D8DA 2ODTX 3BA8A 4HNTA 1UC8A 3JRWA 4TVIA 2AGQA 4O7RA 2UUCH 2Q2UA 3FKIA 2W9CB 5KT5A 3OUZA 4XYMB 5BYBA 5JVLA 4DR7H 5BPHA 3KAJA 2FLPA 2YU9A 3TW6A 2UXDH 2PBZA 3WNZA 3FDSA 4NXNH 2IA6A 4O4HF 1KT8A 1ZHQA 3L4JA 3G8DA 4B3SH 4C5AA 5KFJA 2J6TA 1EHIA 1M7JA 4IAJA 5KFVA 3GIKA 2YZGA 3BA9A 3GV5B 4OX9H 1B04A 4A3JG 4FU0A 3RIZA 4MAMA 5IYBG 3Q8QB 1EZ1A 4YR3A 3RR5A 2Y0SE 2JEJA 5BWXA 1I7LA 4MV8A 4HN2A 3U9SA 5JQGF 4LH7A 3AYHB 5KFQA 1OBGA 3DTFA 2WDTA 5KFRA 2V9WA 4A3KG 2JA7G 5KFXA 5L1KA 1KJQA 5L1LA 3N41B 4O7SA 1A3GA 2QB5A 4PBCA 2NU6B 4K6NA 4CKEA 1IOVA 1A0GA 4L1KA 1RJQA 4ECTA 2UUBH 2UVUA 2W57A 3KHGA 3PW7A 4JI2H 3QZ8A 4ED0A 4HR7A 1N48A 4IRCA 2C28A 3Q8SB 3GTQA 1TWGA 1T3NA 2R8GA 4AYBE 1EKPA 4HYKA 3V6JA 3U0GA 1TAEA 3QQMA 3MR2A 3MJFA 4A3MG 5I5SA 2VR1A 3N44B 5KFUA 4DV6H 4FFOA 2FB9A 4IR9A 1HNZH 1GGOA 1RK5A 2PVPA 4R8UA 3N40P 4BY1G 4C2MA 4J9OA 3G8CA 3U55A 4DV1H 3J7AK 4O2AF 3Q8PB 4ECUA 4DL4A 5EOYA 2YL2A 2ATLA 1S0NA 4RB0A 1S9FA 4GLWA 4APMA 4QWEA 2YYAA 3GJXB 3WWIA 2W7PA 4CHIA 4QJFA 1HNXH 1N34H 1CQJB 1TWFA 4QIWA 3LULA 4GLXA 1O75A 3GTGA 5CAEB 5KFZA 5KG3A 2IP4A 5KFFA 3RTXA 4EBDA 3KTMA 3WWJA 4JI7H 4ED8A 2E2IA 1JDBB 2HGSA 1B6SA 1VBHA 5DQIA 2XC9A 1XNRH 1KJ9A 1Y1VG 4F50A 3CQZA 3GIQA 3GV7B 2HVRA 5I5VA 1V9PA 5HNEA 3H0GG 5EZYF 5JVDF 4UCSA 2HHHH 1KJIA 2YS6A 2DABA 3KXYT 1IBMH 4YHHH 3GQCA 4BY7G 4ZI7F 2Q2TA 3QZ7A 3MFHA 3TY9A 4JI5H 1JKJB 2V5AA 3T9EA 1KUTA 4MV1A 4XX0B 3OHAA 3PW5A 4YP3A 3TIIA 5KFIA 3HBLA 1JX4A 2UU9H 3VMMA 1EKFA 3FMAA 3Q2OA 4FFMA 2V4RA 2W6MA 1DGSA 4NXMH 4JUZA 4X62H 4U7CA 5KFYA 5DGHA 4MTDA 3GDEA 4LMYA 4C5BA 5D1OA 3TQ1A 2DZDA 1ZQ7A 4GKKH 2ZDGA 5KG4A 3OTOH 3R9RA 5EWEA 5FLMG 2EJ3A 2I80A 2ZDQA 1Z2OX 4QW8A 1Y1WG 4ECWA 2HVQA 5KT4A 2YRWA 4EEQA 4MV4A 3S24A 2YS7A 4RU9A 3TY5A 4Y8VB 3H4BA 2FK3A 2XGPA 3GILA 4LFCH 2Y0SA 3JSNA 4EYHB 3RBEA 4LFBH 2QF7A 4O3PA 3AX6A 3HXLA 1N33H 2R87A 3UFXB 4LSAA 4RB1A 5DLFA 2JA8G 4A3LG 1B33N 3BJYA 2AQ4A 3OHBA 2XGQA 4O84A 5BWUA 4YR2A 2VQFH 2C2RA 4JV1A 5KT2A 4A3DG 2VQEH 3BACA 3R5FA 3KALA 3V6KA 3M9MB 3IN5A 1GLVA 1I6UA 2FPIB 5I5TA 2FJZA 4R8UB 3MFIA 2YW2A 4UCOA 5D1PA 2SCUB 2R8KA 2VPSA 3BQ0A 4DR4H 3PO2G 4YAJB 4EBEA 4J9MA 5C44G 1XMQH 3PR5B 4J9RA 4IRDA 4MV9A 4QWCA 1PX2A 1DV1A 4F4WA 5I5UA 2J6SA 1CKMA 4PZ8A 2W6ZA 4CE5A 4LSXA 2VOBA 3RB4A 5CE8A 2B63G 1CKOA 5EWFA 4DL7A 3K5HA 5DLGA 4FFNA 1WH2A 5KFNA 1Y14B 1S03G 2R7LA 3PN1A 4XZ3B 1AN7A 4AYBA 3GTOA 4IHJF 4E6NA 5JH7F 4B3MH 1Z2PX 4Q8EA 1SFOA 3R5HA 2JA5A 5FR9A 3SGIA 3I4MG 3T99A 4MA0A 3N6RA 3H20A 5T14A 3EPIA 4DV4H 4DR2H 2R92A 4DV3H 3F8NA 4A2BA 5KFTA 5D1OB 3RGZA 5LL6b 4JYAH 3BG5A 4UUGA 5I5WA 3ETJA 4XYLB 1T94A 3ORQA 2ASLA 2R8JA 4KHPH 1L2ZA 4MV7A 2UXCH 1ET0A 3J81W 4ECYA 5KG2A 3J80W 3TQTA 4Q0YA 2W8KA 3RV4A 4YQWA 4A3FG 1S10A 2P0AA 3V4ZA 5KFHA 4ZHQF 3T5LA 4J9QA 5C1PA 4CKBA 3GIJA 2CNUA 3KHRA 2FPGB 3LMLA 1KJ8A 1WCMG 2W9CA 2X5RA 2FK2A 1XK5A 3T9CA 1W93A 3WWHA 4C5CA 4CC6A 2RGVA 3N42B 4DR3H 3GIIA 4ED6A 1N36H 1ULZA 2J6UA 4IRKA 1KEEA 4CC5A 2ZJTA 3CVZA 4B3RH 5FLXW 2RF4A 4RUAA 1K1SA 2M05A 2HJWA 5BWTA 1DV2A 2V58A 2ZDHA 2W6NA 2W8LA 4O2BF 3HOVG 3JRXA 2R93G 5HV6A 2GLTA 3TEKA 2JEFA 3VA7A 2YZMA 3I4NG 1RJRA 2HIVA 4DR1H 2Y4RA 3QWUA 4UCUA 4ED2A 2EIYA 1UC9A 1VKZA 2GPWA 4RB3C 2R7ZG 4DV5H 3N8DA 4BWSC 2R7KA 4NZOA 4JI3H 3WO0A 1AUXA 3BABA 4ED3A 1EYZA 4A3BG 5IYDG 4JI8H 5KFAA 2F4VH 2MCTA 5KFOA 5C3EG 2BQRA 3GLKA 4NZNA 3Q8RB 5FJ8G 3KHHA 4UFZA 2HHFB 5KFGA 3M9NB 3VNNA 4LFAH 3UQ8A 3CSWA 4J9LA 2RGRA 4NLGA 3HOWG 3JZ6A 4YJ2F 3NC0B 4HQ6A 3SE7A 4QWBA 2COJA 2O03A 1JIHA 1SEIA 2VUMG 3JZIA 2YRXA 2R7NA 5K3WA 5L9XA 3K3VA 2Z02A 3M4IA 3N43B 1RK6A 2EJ2A 4LH6A 3H4DA 2JEGA 5L1JA 1IOWA 4LF9H 1S0MA 3VOTA 2FPPB 4CMDA 4I4TF 3TINA 4O3OA 1UNNC 5DMXA 4X66H 3RF2A 4YB8B 2PMZE 4IWXA 2NVYA 3ORRA 1WSCA 4U6PA 4FM9A 2ASDA 3QFFA 1HNWH 4B3TH 1B6RA 5KFKA 5L1IA 2CKZB 2C22A 2EJ0A 4QIWE 4R7RA 1I50A 4J9KA 4DL2A 2UVVA 1TWCA 4BXXG 3ETHA 2CW8A 2NU9B 1ZETA 4F4YA 3GIMA 3KREA 3AW8A 1C30A 3DF7A 1AUVA 1I1KA 4UCTA 5HBRB 3I12A 1CS0A 4E4TA 3RFCA 2ZM6H 3T5JA 4EFBA 4A3GG 2DPJA 2XIGA 1XNQH 1RJPA 4M7EA 1BJTA 3LQSA 5CA1F 3MR6A 1IBKH 2WAQE 3EPGA 2AGPA 4O4LF 5IP7G 2NU8B 4DV0H 4ZOLF 5FNVF 4LF7H 2JEIA 3JSLA 4EGQA 3NGDA 3VPCA 1KBLA 3HKZA 4F4XA 3RB3A 3GB8B 1A0IA 1W96A 3TW7A 5BWWA 4Q45A 2V4QA 4LF6H 5J2UF 3G6VA 5DISC 2R8HA 4EQ5A 1OBDA 2W6QA 3CEBA 2IBKA 5DG9A 4BBRG 2R6FA 5H80A 5KG7A 1CE8A 4JXUA 2WAQA 1S0OA 4O7VA 2COGA 3RB0A 4O4IF 5KFCA 1EKVA 2HIXA 3PW4A 2YZLA 4RNNA 2C2DA 3JZFA 3HOUG 4UCRA 5FD6A 1PK8A 2HHFA 1IYEA 4J9PA 4ECSA 3HKZE 2JA7A 4A2AA 5DGAA 3W5OA 5LMUH 2V59A 2JA5G 4RCNA 4YR0A 4O7NA 4DL5A 4MA5A 2DWCA 2VA3A 1S68A 5JUMA 4DUZH 1BNCA 3UZOA 4HNVA 1K1QA 1MZBA 5KG6A 4ECRA 2JA6G 5LP6F 2OH2A 3L2PA 1IBLH 2R92G 2XCAA 3W1BA 3GTMA 1VS0A 3BAAA 3UZBA 2AU0A 3C0FB 5I60A 5KFDA 4EFEA 2W71A 4TM5A 4FS2A 4FFRA 4DIMA 3DTGA 3HO8A 4Q43A 2NUAB 4PDBA 4O83A 2OLSA 4O7YA 5KT7A 1WCMA 2YZNA 5I5YA 4O7ZA 1GO3E 1OWTA 4NYEA 3OSNA 2VA2A 3GTPA 3T9FA 4WHXA 5EWGA 3W1GA 4YY3H 4F4ZA 5E25A 4DR6H 3MR3A 3T1HH 2WB1A 2FP4B 3Q1KA 4PZ7A 3NBZB 1N56A 3PZPA 3HT5A 3PVXA 1K83A 4FFPA 4RUCA 3HOYG 4A3CG 1RYSA 1P16A 3G6YA 4UCVA 5FPOA 4MV3A 5K2MA 3T7AA 1M0TA 4RAZA 1DIKA 4IIJF 2R7MA 2AGOA 1Y1VA 4MTEA 4LF5H 2R93A 1M0WA 1GSAA 5KS8A 3H0GA 2W6OA 4A3EG 1P8LA 4A93G 1E4EA 1A9XA 2WTFA 5J2TF 4ED1A 1J5EH 2W7OA 5BMVF 3OUUA 5CM0A 4JI6H 1BXRA 2R8IA 5KFMA 4RB2C 1ZAUA 4JV0A 5JQWA 3EYYA 1KTAA 1Z2NX 3SI8A 2R7ZA 1JLLB 4TV9F 4I7HA 2IMWP 2FE3A 4EGJA 1EUCB 5CA0F 4MV6A 1E4GT 2VQDA 1KJJA 3T54A 3RGXA 3VPBA 1E4EB 2COIA 2GPSA 4LF8H 2NU7B 3RAQA 1WR2A 1HR0H 2C00A 2R86A 1KC7A 3NBYB 2ZGIA 5BPFA 2WE6A 4O3NA 3PW2A 4ME6A 4O86A 4NZMA 4PZ6A 5LOVF 4M0JA 5FPRA 2FKLA 3T5HA 4LF4H 4I50F 3IG0A 1JXLA 4TV8F 4JI1H 2BQ3A 2FK1A 2E5LH 2GQRA 3SNOA 1Y1WA 2OWOA 3GIDA 3MWDA 5DQGA 1FKAH 3BQ1A 4J0MA 1I2LA 4O7WA 1FJGH 4RZQA 4ECZA 2DPIA 1SYXB 1BGWA 5KT6A 4EYIB 1RYRA 1V51A 3FKIG 5FD5A 1EUDB 4DLKA 3R23A 4DV2H 1I7NA 4WD3A 5C5JA 4ECQA 4DRFA 4O3RA 5BYAA 4TQRA 5C1OA 1GSOA 5KG1A 4AQYH 3T5KA 5IYZF 1XMOH 2YCHA 3TY8A 4YAKB 2CNVA 1R9TA 4QWDA 3HOZG 1JDEA 3E5NA 1X9NA 3K3PA 3R5XA 4O81A 2BR0A 5LXTF 2Z04A 5KFEA 4HNUA 5IT9W 4FE2A 4YBZB 3RBDA 4A3IG 4CMFA 4JI0H 3H3VH 4RZRA 2R82A 5KFBA 1WRVA 4TUYF 4ECVA 3HOXG 3GV8B 5LA6F 2CZGA 4IR1A 3G6XA 3T1YH 2X0SA 3U54A 2PN1A 2W70A 2HDKA 1ZHSA 2Q7DA 5I47A 2B63A 4M9UA 2KSWA 4FS1A 2BQUA 1XDNA 2XD4A 3PR4A 4Q8FA 2FMAA 2CFMA 5KG5A 3MWEA 1IYDA 3VPDA 3PO3G 3T9DA 3V6HA 4I55F 3OSPA 2R84A 3N6XA 4IZOA 2RDJA 3RJ0A 1A48A 1I1MA 3KAKA 2A1HA 5GONF 1FVIA 2PMZA 2UUAH 2ALZA 2WYOA 5F9NA 1GYFA 2R85A 1TWAA 1VBGA 5EDWA 3DAAA 2JA6A 4X64H 5I5XA 2QYZA 4Q4DA 2DAAA 2HGXA 3KHLA 3GTJA 5LMNH 3KYHC 5BR8H 4JV5H 3NUAA 3T9BA 1N32H 3RUPA 5KFSA 4WBNF 4DV7H 5BWRA 1I94H 3K5IA 4GKJH 2C35B 3L4KA 3UYYA 4DR5H 3M9OB 4TQSA 1E4FT 1DAAA 2XCPA 2RDIA 5A2QW 4G3IA 1C3OA 2I87A 4YJ3F 1I1LA 4RAYA 3RAXA 3TIGA 3GIPA 2QK4A 3LP8A 5KG0A 2VPQA 4RNMA 4O3SA 4DQNA 5KFLA 5F9LA 2FLNA 4QSHA 4QWAA 4EBCA 4JI4H 4EG0A 4O3QA 4K0KH 1I2KA 2YWVA 4IWYA 3T9AA 4Q44A 5BWVA 1M6VA 5KKNB 3JAMW
chains in the Genus database with same CATH topology
3LWBA 1CQIB 5C8YF 1SCUB 2GQSA 2XCLA 2DIKA 4FFLA 5LYJF 5KX5F 2DLNA 1T36A 2W6PA 2I8CA 3V4SA 1GSHA 2J9GA 3HB9A 4O82A 3U9TA 4O7LA 4O7TA 4O4JF 3RV3A 4FGRA 4ZQIA 2CNQA 5CB4F 2CQYA 3WO1A 5D8DA 4HNTA 3JRWA 1UC8A 4O7RA 3OUZA 4XYMB 5JVLA 5BPHA 3KAJA 3TW6A 2PBZA 3WNZA 4O4HF 3G8DA 4C5AA 1EHIA 2YZGA 4FU0A 4MAMA 1EZ1A 1I7LA 4MV8A 3U9SA 5JQGF 1OBGA 1KJQA 4O7SA 2NU6B 1IOVA 4L1KA 4HR7A 3MJFA 2VR1A 4FFOA 2FB9A 1GGOA 2PVPA 3G8CA 3U55A 4O2AF 2YL2A 2YYAA 1CQJB 5CAEB 2IP4A 1JDBB 2HGSA 1B6SA 1VBHA 1KJ9A 5EZYF 5JVDF 1KJIA 2YS6A 4ZI7F 1JKJB 2V5AA 1KUTA 4MV1A 4XX0B 3TIIA 3HBLA 3VMMA 3Q2OA 4FFMA 2W6MA 4C5BA 2DZDA 2ZDGA 3R9RA 2I80A 2ZDQA 1Z2OX 2YRWA 4MV4A 2YS7A 4Y8VB 2QF7A 3AX6A 2R87A 3UFXB 4O84A 3R5FA 3KALA 1GLVA 2FPIB 2YW2A 2SCUB 4YAJB 4MV9A 1PX2A 1DV1A 2W6ZA 3K5HA 4FFNA 2R7LA 4XZ3B 4IHJF 5JH7F 1Z2PX 3R5HA 4MA0A 3N6RA 3BG5A 3ETJA 4XYLB 3ORQA 4MV7A 3TQTA 3RV4A 2P0AA 3V4ZA 4ZHQF 5C1PA 2CNUA 2FPGB 1KJ8A 1W93A 4C5CA 1ULZA 1KEEA 2HJWA 1DV2A 2V58A 2ZDHA 2W6NA 4O2BF 3JRXA 5HV6A 2GLTA 3VA7A 2YZMA 1VKZA 2GPWA 1UC9A 3N8DA 2R7KA 3WO0A 1AUXA 1EYZA 3GLKA 4YJ2F 4HQ6A 3SE7A 3JZIA 2YRXA 2R7NA 2Z02A 1IOWA 3VOTA 2FPPB 4I4TF 3TINA 5DMXA 4YB8B 4IWXA 3ORRA 3QFFA 1B6RA 3ETHA 2NU9B 3KREA 5HBRB 3AW8A 1C30A 3DF7A 1AUVA 3I12A 1CS0A 4E4TA 3RFCA 5CA1F 4O4LF 2NU8B 4ZOLF 5FNVF 4EGQA 3VPCA 1KBLA 1W96A 5J2UF 1OBDA 2W6QA 2R6FA 5H80A 1CE8A 4O7VA 4O4IF 2YZLA 3JZFA 1PK8A 2V59A 4O7NA 4MA5A 2DWCA 1BNCA 4HNVA 5LP6F 2W71A 4FFRA 4DIMA 3HO8A 2NUAB 4O83A 2OLSA 4O7YA 2YZNA 4O7ZA 4NYEA 2FP4B 3Q1KA 4FFPA 4MV3A 5K2MA 1M0TA 1DIKA 4IIJF 2R7MA 1M0WA 1GSAA 2W6OA 1E4EA 1A9XA 5J2TF 5BMVF 3OUUA 1BXRA 5JQWA 1Z2NX 1JLLB 4TV9F 4EGJA 1EUCB 5CA0F 4MV6A 2VQDA 1KJJA 3VPBA 1E4EB 2GPSA 2NU7B 1WR2A 2C00A 2R86A 1KC7A 5BPFA 4ME6A 4O86A 5LOVF 4I50F 4TV8F 2GQRA 3GIDA 3MWDA 4O7WA 4RZQA 1EUDB 4DLKA 3R23A 1I7NA 4WD3A 5C1OA 1GSOA 5IYZF 4YAKB 2CNVA 1JDEA 3E5NA 3K3PA 3R5XA 4O81A 5LXTF 2Z04A 4HNUA 4FE2A 4YBZB 2R82A 4TUYF 5LA6F 2CZGA 2X0SA 3U54A 2PN1A 2W70A 5I47A 4M9UA 2XD4A 3MWEA 3VPDA 4I55F 2R84A 4IZOA 1A48A 3KAKA 5GONF 2WYOA 2R85A 1VBGA 3NUAA 3RUPA 4WBNF 3K5IA 1C3OA 2I87A 4YJ3F 3TIGA 2QK4A 3LP8A 2VPQA 4QSHA 4EG0A 2YWVA 4IWYA 1M6VA 5KKNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWB A;  1CQI B;  5C8Y F;  1SCU B;  2GQS A;  2XCL A;  2DIK A;  4FFL A;  5LYJ F;  5KX5 F;  2DLN A;  1T36 A;  2W6P A;  2I8C A;  3V4S A;  1GSH A;  2J9G A;  3HB9 A;  4O82 A;  3U9T A;  4O7L A;  4O7T A;  4O4J F;  3RV3 A;  4FGR A;  4ZQI A;  2CNQ A;  5CB4 F;  2CQY A;  3WO1 A;  5D8D A;  4HNT A;  3JRW A;  1UC8 A;  4O7R A;  3OUZ A;  4XYM B;  5JVL A;  5BPH A;  3KAJ A;  3TW6 A;  2PBZ A;  3WNZ A;  4O4H F;  3G8D A;  4C5A A;  1EHI A;  2YZG A;  4FU0 A;  4MAM A;  1EZ1 A;  1I7L A;  4MV8 A;  3U9S A;  5JQG F;  1OBG A;  1KJQ A;  4O7S A;  2NU6 B;  1IOV A;  4L1K A;  4HR7 A;  3MJF A;  2VR1 A;  4FFO A;  2FB9 A;  1GGO A;  2PVP A;  3G8C A;  3U55 A;  4O2A F;  2YL2 A;  2YYA A;  1CQJ B;  5CAE B;  2IP4 A;  1JDB B;  2HGS A;  1B6S A;  1VBH A;  1KJ9 A;  5EZY F;  5JVD F;  1KJI A;  2YS6 A;  4ZI7 F;  1JKJ B;  2V5A A;  1KUT A;  4MV1 A;  4XX0 B;  3TII A;  3HBL A;  3VMM A;  3Q2O A;  4FFM A;  2W6M A;  4C5B A;  2DZD A;  2ZDG A;  3R9R A;  2I80 A;  2ZDQ A;  1Z2O X;  2YRW A;  4MV4 A;  2YS7 A;  4Y8V B;  2QF7 A;  3AX6 A;  2R87 A;  3UFX B;  4O84 A;  3R5F A;  3KAL A;  1GLV A;  2FPI B;  2YW2 A;  2SCU B;  4YAJ B;  4MV9 A;  1PX2 A;  1DV1 A;  2W6Z A;  3K5H A;  4FFN A;  2R7L A;  4XZ3 B;  4IHJ F;  5JH7 F;  1Z2P X;  3R5H A;  4MA0 A;  3N6R A;  3BG5 A;  3ETJ A;  4XYL B;  3ORQ A;  4MV7 A;  3TQT A;  3RV4 A;  2P0A A;  3V4Z A;  4ZHQ F;  5C1P A;  2CNU A;  2FPG B;  1KJ8 A;  1W93 A;  4C5C A;  1ULZ A;  1KEE A;  2HJW A;  1DV2 A;  2V58 A;  2ZDH A;  2W6N A;  4O2B F;  3JRX A;  5HV6 A;  2GLT A;  3VA7 A;  2YZM A;  1VKZ A;  2GPW A;  1UC9 A;  3N8D A;  2R7K A;  3WO0 A;  1AUX A;  1EYZ A;  3GLK A;  4YJ2 F;  4HQ6 A;  3SE7 A;  3JZI A;  2YRX A;  2R7N A;  2Z02 A;  1IOW A;  3VOT A;  2FPP B;  4I4T F;  3TIN A;  5DMX A;  4YB8 B;  4IWX A;  3ORR A;  3QFF A;  1B6R A;  3ETH A;  2NU9 B;  3KRE A;  5HBR B;  3AW8 A;  1C30 A;  3DF7 A;  1AUV A;  3I12 A;  1CS0 A;  4E4T A;  3RFC A;  5CA1 F;  4O4L F;  2NU8 B;  4ZOL F;  5FNV F;  4EGQ A;  3VPC A;  1KBL A;  1W96 A;  5J2U F;  1OBD A;  2W6Q A;  2R6F A;  5H80 A;  1CE8 A;  4O7V A;  4O4I F;  2YZL A;  3JZF A;  1PK8 A;  2V59 A;  4O7N A;  4MA5 A;  2DWC A;  1BNC A;  4HNV A;  5LP6 F;  2W71 A;  4FFR A;  4DIM A;  3HO8 A;  2NUA B;  4O83 A;  2OLS A;  4O7Y A;  2YZN A;  4O7Z A;  4NYE A;  2FP4 B;  3Q1K A;  4FFP A;  4MV3 A;  5K2M A;  1M0T A;  1DIK A;  4IIJ F;  2R7M A;  1M0W A;  1GSA A;  2W6O A;  1E4E A;  1A9X A;  5J2T F;  5BMV F;  3OUU A;  1BXR A;  5JQW A;  1Z2N X;  1JLL B;  4TV9 F;  4EGJ A;  1EUC B;  5CA0 F;  4MV6 A;  2VQD A;  1KJJ A;  3VPB A;  1E4E B;  2GPS A;  2NU7 B;  1WR2 A;  2C00 A;  2R86 A;  1KC7 A;  5BPF A;  4ME6 A;  4O86 A;  5LOV F;  4I50 F;  4TV8 F;  2GQR A;  3GID A;  3MWD A;  4O7W A;  4RZQ A;  1EUD B;  4DLK A;  3R23 A;  1I7N A;  4WD3 A;  5C1O A;  1GSO A;  5IYZ F;  4YAK B;  2CNV A;  1JDE A;  3E5N A;  3K3P A;  3R5X A;  4O81 A;  5LXT F;  2Z04 A;  4HNU A;  4FE2 A;  4YBZ B;  2R82 A;  4TUY F;  5LA6 F;  2CZG A;  2X0S A;  3U54 A;  2PN1 A;  2W70 A;  5I47 A;  4M9U A;  2XD4 A;  3MWE A;  3VPD A;  4I55 F;  2R84 A;  4IZO A;  1A48 A;  3KAK A;  5GON F;  2WYO A;  2R85 A;  1VBG A;  3NUA A;  3RUP A;  4WBN F;  3K5I A;  1C3O A;  2I87 A;  4YJ3 F;  3TIG A;  2QK4 A;  3LP8 A;  2VPQ A;  4QSH A;  4EG0 A;  2YWV A;  4IWY A;  1M6V A;  5KKN B; 
#chains in the Genus database with same CATH topology
 3LWB A;  1CQI B;  2HVS A;  3BQ2 A;  4GC6 A;  3PW0 A;  2FLL A;  5C8Y F;  4GC7 A;  4DL6 A;  5DG7 A;  1SCU B;  2CW7 A;  4X65 H;  5IYC G;  4FBT A;  5DQH A;  2ASJ A;  2ABJ A;  4DL3 A;  2GQS A;  5DGB A;  4PWQ A;  3GTK A;  2XCL A;  2DIK A;  4FFL A;  5LYJ F;  5KX5 F;  4BBS G;  3PFF A;  1TWH A;  4CKC A;  5KFW A;  2NVX A;  2DLN A;  5C4X G;  5DAA A;  5IWA H;  1CKN B;  1T36 A;  4J9S A;  1V4Y A;  2C2E A;  2W6P A;  2W9A A;  3H40 A;  2I8C A;  3V4S A;  5DGI A;  2UVR A;  1VAJ A;  1I3Q A;  4Q4C A;  4ETS A;  5IP9 G;  1TA8 A;  3MWM A;  1GSH A;  2J9G A;  2HG8 A;  1CKN A;  4DAA A;  4DUY H;  4QW9 A;  4JV2 A;  2VUM A;  3HB9 A;  4O82 A;  2UXB H;  5KFP A;  3U9T A;  4ECX A;  4O7L A;  5CR5 A;  4O7T A;  4O4J F;  3RV3 A;  3MR5 A;  2UVW A;  4FGR A;  2HGW A;  4RNO A;  4ZQI A;  2WB1 E;  1S97 A;  3RB6 A;  2CNQ A;  1G2W A;  4ED7 A;  2E2H A;  2W9B B;  5CB4 F;  2CQY A;  2W9B A;  2VUG A;  4J9N A;  4FBU A;  5KT3 A;  3WO1 A;  4EEY A;  3GTL A;  5DG8 A;  5D8D A;  2ODT X;  3BA8 A;  4HNT A;  1UC8 A;  3JRW A;  4TVI A;  2AGQ A;  4O7R A;  2UUC H;  2Q2U A;  3FKI A;  2W9C B;  5KT5 A;  3OUZ A;  4XYM B;  5BYB A;  5JVL A;  4DR7 H;  5BPH A;  3KAJ A;  2FLP A;  2YU9 A;  3TW6 A;  2UXD H;  2PBZ A;  3WNZ A;  3FDS A;  4NXN H;  2IA6 A;  4O4H F;  1KT8 A;  1ZHQ A;  3L4J A;  3G8D A;  4B3S H;  4C5A A;  5KFJ A;  2J6T A;  1EHI A;  1M7J A;  4IAJ A;  5KFV A;  3GIK A;  2YZG A;  3BA9 A;  3GV5 B;  4OX9 H;  1B04 A;  4A3J G;  4FU0 A;  3RIZ A;  4MAM A;  5IYB G;  3Q8Q B;  1EZ1 A;  4YR3 A;  3RR5 A;  2Y0S E;  2JEJ A;  5BWX A;  1I7L A;  4MV8 A;  4HN2 A;  3U9S A;  5JQG F;  4LH7 A;  3AYH B;  5KFQ A;  1OBG A;  3DTF A;  2WDT A;  5KFR A;  2V9W A;  4A3K G;  2JA7 G;  5KFX A;  5L1K A;  1KJQ A;  5L1L A;  3N41 B;  4O7S A;  1A3G A;  2QB5 A;  4PBC A;  2NU6 B;  4K6N A;  4CKE A;  1IOV A;  1A0G A;  4L1K A;  1RJQ A;  4ECT A;  2UUB H;  2UVU A;  2W57 A;  3KHG A;  3PW7 A;  4JI2 H;  3QZ8 A;  4ED0 A;  4HR7 A;  1N48 A;  4IRC A;  2C28 A;  3Q8S B;  3GTQ A;  1TWG A;  1T3N A;  2R8G A;  4AYB E;  1EKP A;  4HYK A;  3V6J A;  3U0G A;  1TAE A;  3QQM A;  3MR2 A;  3MJF A;  4A3M G;  5I5S A;  2VR1 A;  3N44 B;  5KFU A;  4DV6 H;  4FFO A;  2FB9 A;  4IR9 A;  1HNZ H;  1GGO A;  1RK5 A;  2PVP A;  4R8U A;  3N40 P;  4BY1 G;  4C2M A;  4J9O A;  3G8C A;  3U55 A;  4DV1 H;  3J7A K;  4O2A F;  3Q8P B;  4ECU A;  4DL4 A;  5EOY A;  2YL2 A;  2ATL A;  1S0N A;  4RB0 A;  1S9F A;  4GLW A;  4APM A;  4QWE A;  2YYA A;  3GJX B;  3WWI A;  2W7P A;  4CHI A;  4QJF A;  1HNX H;  1N34 H;  1CQJ B;  1TWF A;  4QIW A;  3LUL A;  4GLX A;  1O75 A;  3GTG A;  5CAE B;  5KFZ A;  5KG3 A;  2IP4 A;  5KFF A;  3RTX A;  4EBD A;  3KTM A;  3WWJ A;  4JI7 H;  4ED8 A;  2E2I A;  1JDB B;  2HGS A;  1B6S A;  1VBH A;  5DQI A;  2XC9 A;  1XNR H;  1KJ9 A;  1Y1V G;  4F50 A;  3CQZ A;  3GIQ A;  3GV7 B;  2HVR A;  5I5V A;  1V9P A;  5HNE A;  3H0G G;  5EZY F;  5JVD F;  4UCS A;  2HHH H;  1KJI A;  2YS6 A;  2DAB A;  3KXY T;  1IBM H;  4YHH H;  3GQC A;  4BY7 G;  4ZI7 F;  2Q2T A;  3QZ7 A;  3MFH A;  3TY9 A;  4JI5 H;  1JKJ B;  2V5A A;  3T9E A;  1KUT A;  4MV1 A;  4XX0 B;  3OHA A;  3PW5 A;  4YP3 A;  3TII A;  5KFI A;  3HBL A;  1JX4 A;  2UU9 H;  3VMM A;  1EKF A;  3FMA A;  3Q2O A;  4FFM A;  2V4R A;  2W6M A;  1DGS A;  4NXM H;  4JUZ A;  4X62 H;  4U7C A;  5KFY A;  5DGH A;  4MTD A;  3GDE A;  4LMY A;  4C5B A;  5D1O A;  3TQ1 A;  2DZD A;  1ZQ7 A;  4GKK H;  2ZDG A;  5KG4 A;  3OTO H;  3R9R A;  5EWE A;  5FLM G;  2EJ3 A;  2I80 A;  2ZDQ A;  1Z2O X;  4QW8 A;  1Y1W G;  4ECW A;  2HVQ A;  5KT4 A;  2YRW A;  4EEQ A;  4MV4 A;  3S24 A;  2YS7 A;  4RU9 A;  3TY5 A;  4Y8V B;  3H4B A;  2FK3 A;  2XGP A;  3GIL A;  4LFC H;  2Y0S A;  3JSN A;  4EYH B;  3RBE A;  4LFB H;  2QF7 A;  4O3P A;  3AX6 A;  3HXL A;  1N33 H;  2R87 A;  3UFX B;  4LSA A;  4RB1 A;  5DLF A;  2JA8 G;  4A3L G;  1B33 N;  3BJY A;  2AQ4 A;  3OHB A;  2XGQ A;  4O84 A;  5BWU A;  4YR2 A;  2VQF H;  2C2R A;  4JV1 A;  5KT2 A;  4A3D G;  2VQE H;  3BAC A;  3R5F A;  3KAL A;  3V6K A;  3M9M B;  3IN5 A;  1GLV A;  1I6U A;  2FPI B;  5I5T A;  2FJZ A;  4R8U B;  3MFI A;  2YW2 A;  4UCO A;  5D1P A;  2SCU B;  2R8K A;  2VPS A;  3BQ0 A;  4DR4 H;  3PO2 G;  4YAJ B;  4EBE A;  4J9M A;  5C44 G;  1XMQ H;  3PR5 B;  4J9R A;  4IRD A;  4MV9 A;  4QWC A;  1PX2 A;  1DV1 A;  4F4W A;  5I5U A;  2J6S A;  1CKM A;  4PZ8 A;  2W6Z A;  4CE5 A;  4LSX A;  2VOB A;  3RB4 A;  5CE8 A;  2B63 G;  1CKO A;  5EWF A;  4DL7 A;  3K5H A;  5DLG A;  4FFN A;  1WH2 A;  5KFN A;  1Y14 B;  1S03 G;  2R7L A;  3PN1 A;  4XZ3 B;  1AN7 A;  4AYB A;  3GTO A;  4IHJ F;  4E6N A;  5JH7 F;  4B3M H;  1Z2P X;  4Q8E A;  1SFO A;  3R5H A;  2JA5 A;  5FR9 A;  3SGI A;  3I4M G;  3T99 A;  4MA0 A;  3N6R A;  3H20 A;  5T14 A;  3EPI A;  4DV4 H;  4DR2 H;  2R92 A;  4DV3 H;  3F8N A;  4A2B A;  5KFT A;  5D1O B;  3RGZ A;  5LL6 b;  4JYA H;  3BG5 A;  4UUG A;  5I5W A;  3ETJ A;  4XYL B;  1T94 A;  3ORQ A;  2ASL A;  2R8J A;  4KHP H;  1L2Z A;  4MV7 A;  2UXC H;  1ET0 A;  3J81 W;  4ECY A;  5KG2 A;  3J80 W;  3TQT A;  4Q0Y A;  2W8K A;  3RV4 A;  4YQW A;  4A3F G;  1S10 A;  2P0A A;  3V4Z A;  5KFH A;  4ZHQ F;  3T5L A;  4J9Q A;  5C1P A;  4CKB A;  3GIJ A;  2CNU A;  3KHR A;  2FPG B;  3LML A;  1KJ8 A;  1WCM G;  2W9C A;  2X5R A;  2FK2 A;  1XK5 A;  3T9C A;  1W93 A;  3WWH A;  4C5C A;  4CC6 A;  2RGV A;  3N42 B;  4DR3 H;  3GII A;  4ED6 A;  1N36 H;  1ULZ A;  2J6U A;  4IRK A;  1KEE A;  4CC5 A;  2ZJT A;  3CVZ A;  4B3R H;  5FLX W;  2RF4 A;  4RUA A;  1K1S A;  2M05 A;  2HJW A;  5BWT A;  1DV2 A;  2V58 A;  2ZDH A;  2W6N A;  2W8L A;  4O2B F;  3HOV G;  3JRX A;  2R93 G;  5HV6 A;  2GLT A;  3TEK A;  2JEF A;  3VA7 A;  2YZM A;  3I4N G;  1RJR A;  2HIV A;  4DR1 H;  2Y4R A;  3QWU A;  4UCU A;  4ED2 A;  2EIY A;  1UC9 A;  1VKZ A;  2GPW A;  4RB3 C;  2R7Z G;  4DV5 H;  3N8D A;  4BWS C;  2R7K A;  4NZO A;  4JI3 H;  3WO0 A;  1AUX A;  3BAB A;  4ED3 A;  1EYZ A;  4A3B G;  5IYD G;  4JI8 H;  5KFA A;  2F4V H;  2MCT A;  5KFO A;  5C3E G;  2BQR A;  3GLK A;  4NZN A;  3Q8R B;  5FJ8 G;  3KHH A;  4UFZ A;  2HHF B;  5KFG A;  3M9N B;  3VNN A;  4LFA H;  3UQ8 A;  3CSW A;  4J9L A;  2RGR A;  4NLG A;  3HOW G;  3JZ6 A;  4YJ2 F;  3NC0 B;  4HQ6 A;  3SE7 A;  4QWB A;  2COJ A;  2O03 A;  1JIH A;  1SEI A;  2VUM G;  3JZI A;  2YRX A;  2R7N A;  5K3W A;  5L9X A;  3K3V A;  2Z02 A;  3M4I A;  3N43 B;  1RK6 A;  2EJ2 A;  4LH6 A;  3H4D A;  2JEG A;  5L1J A;  1IOW A;  4LF9 H;  1S0M A;  3VOT A;  2FPP B;  4CMD A;  4I4T F;  3TIN A;  4O3O A;  1UNN C;  5DMX A;  4X66 H;  3RF2 A;  4YB8 B;  2PMZ E;  4IWX A;  2NVY A;  3ORR A;  1WSC A;  4U6P A;  4FM9 A;  2ASD A;  3QFF A;  1HNW H;  4B3T H;  1B6R A;  5KFK A;  5L1I A;  2CKZ B;  2C22 A;  2EJ0 A;  4QIW E;  4R7R A;  1I50 A;  4J9K A;  4DL2 A;  2UVV A;  1TWC A;  4BXX G;  3ETH A;  2CW8 A;  2NU9 B;  1ZET A;  4F4Y A;  3GIM A;  3KRE A;  3AW8 A;  1C30 A;  3DF7 A;  1AUV A;  1I1K A;  4UCT A;  5HBR B;  3I12 A;  1CS0 A;  4E4T A;  3RFC A;  2ZM6 H;  3T5J A;  4EFB A;  4A3G G;  2DPJ A;  2XIG A;  1XNQ H;  1RJP A;  4M7E A;  1BJT A;  3LQS A;  5CA1 F;  3MR6 A;  1IBK H;  2WAQ E;  3EPG A;  2AGP A;  4O4L F;  5IP7 G;  2NU8 B;  4DV0 H;  4ZOL F;  5FNV F;  4LF7 H;  2JEI A;  3JSL A;  4EGQ A;  3NGD A;  3VPC A;  1KBL A;  3HKZ A;  4F4X A;  3RB3 A;  3GB8 B;  1A0I A;  1W96 A;  3TW7 A;  5BWW A;  4Q45 A;  2V4Q A;  4LF6 H;  5J2U F;  3G6V A;  5DIS C;  2R8H A;  4EQ5 A;  1OBD A;  2W6Q A;  3CEB A;  2IBK A;  5DG9 A;  4BBR G;  2R6F A;  5H80 A;  5KG7 A;  1CE8 A;  4JXU A;  2WAQ A;  1S0O A;  4O7V A;  2COG A;  3RB0 A;  4O4I F;  5KFC A;  1EKV A;  2HIX A;  3PW4 A;  2YZL A;  4RNN A;  2C2D A;  3JZF A;  3HOU G;  4UCR A;  5FD6 A;  1PK8 A;  2HHF A;  1IYE A;  4J9P A;  4ECS A;  3HKZ E;  2JA7 A;  4A2A A;  5DGA A;  3W5O A;  5LMU H;  2V59 A;  2JA5 G;  4RCN A;  4YR0 A;  4O7N A;  4DL5 A;  4MA5 A;  2DWC A;  2VA3 A;  1S68 A;  5JUM A;  4DUZ H;  1BNC A;  3UZO A;  4HNV A;  1K1Q A;  1MZB A;  5KG6 A;  4ECR A;  2JA6 G;  5LP6 F;  2OH2 A;  3L2P A;  1IBL H;  2R92 G;  2XCA A;  3W1B A;  3GTM A;  1VS0 A;  3BAA A;  3UZB A;  2AU0 A;  3C0F B;  5I60 A;  5KFD A;  4EFE A;  2W71 A;  4TM5 A;  4FS2 A;  4FFR A;  4DIM A;  3DTG A;  3HO8 A;  4Q43 A;  2NUA B;  4PDB A;  4O83 A;  2OLS A;  4O7Y A;  5KT7 A;  1WCM A;  2YZN A;  5I5Y A;  4O7Z A;  1GO3 E;  1OWT A;  4NYE A;  3OSN A;  2VA2 A;  3GTP A;  3T9F A;  4WHX A;  5EWG A;  3W1G A;  4YY3 H;  4F4Z A;  5E25 A;  4DR6 H;  3MR3 A;  3T1H H;  2WB1 A;  2FP4 B;  3Q1K A;  4PZ7 A;  3NBZ B;  1N56 A;  3PZP A;  3HT5 A;  3PVX A;  1K83 A;  4FFP A;  4RUC A;  3HOY G;  4A3C G;  1RYS A;  1P16 A;  3G6Y A;  4UCV A;  5FPO A;  4MV3 A;  5K2M A;  3T7A A;  1M0T A;  4RAZ A;  1DIK A;  4IIJ F;  2R7M A;  2AGO A;  1Y1V A;  4MTE A;  4LF5 H;  2R93 A;  1M0W A;  1GSA A;  5KS8 A;  3H0G A;  2W6O A;  4A3E G;  1P8L A;  4A93 G;  1E4E A;  1A9X A;  2WTF A;  5J2T F;  4ED1 A;  1J5E H;  2W7O A;  5BMV F;  3OUU A;  5CM0 A;  4JI6 H;  1BXR A;  2R8I A;  5KFM A;  4RB2 C;  1ZAU A;  4JV0 A;  5JQW A;  3EYY A;  1KTA A;  1Z2N X;  3SI8 A;  2R7Z A;  1JLL B;  4TV9 F;  4I7H A;  2IMW P;  2FE3 A;  4EGJ A;  1EUC B;  5CA0 F;  4MV6 A;  1E4G T;  2VQD A;  1KJJ A;  3T54 A;  3RGX A;  3VPB A;  1E4E B;  2COI A;  2GPS A;  4LF8 H;  2NU7 B;  3RAQ A;  1WR2 A;  1HR0 H;  2C00 A;  2R86 A;  1KC7 A;  3NBY B;  2ZGI A;  5BPF A;  2WE6 A;  4O3N A;  3PW2 A;  4ME6 A;  4O86 A;  4NZM A;  4PZ6 A;  5LOV F;  4M0J A;  5FPR A;  2FKL A;  3T5H A;  4LF4 H;  4I50 F;  3IG0 A;  1JXL A;  4TV8 F;  4JI1 H;  2BQ3 A;  2FK1 A;  2E5L H;  2GQR A;  3SNO A;  1Y1W A;  2OWO A;  3GID A;  3MWD A;  5DQG A;  1FKA H;  3BQ1 A;  4J0M A;  1I2L A;  4O7W A;  1FJG H;  4RZQ A;  4ECZ A;  2DPI A;  1SYX B;  1BGW A;  5KT6 A;  4EYI B;  1RYR A;  1V51 A;  3FKI G;  5FD5 A;  1EUD B;  4DLK A;  3R23 A;  4DV2 H;  1I7N A;  4WD3 A;  5C5J A;  4ECQ A;  4DRF A;  4O3R A;  5BYA A;  4TQR A;  5C1O A;  1GSO A;  5KG1 A;  4AQY H;  3T5K A;  5IYZ F;  1XMO H;  2YCH A;  3TY8 A;  4YAK B;  2CNV A;  1R9T A;  4QWD A;  3HOZ G;  1JDE A;  3E5N A;  1X9N A;  3K3P A;  3R5X A;  4O81 A;  2BR0 A;  5LXT F;  2Z04 A;  5KFE A;  4HNU A;  5IT9 W;  4FE2 A;  4YBZ B;  3RBD A;  4A3I G;  4CMF A;  4JI0 H;  3H3V H;  4RZR A;  2R82 A;  5KFB A;  1WRV A;  4TUY F;  4ECV A;  3HOX G;  3GV8 B;  5LA6 F;  2CZG A;  4IR1 A;  3G6X A;  3T1Y H;  2X0S A;  3U54 A;  2PN1 A;  2W70 A;  2HDK A;  1ZHS A;  2Q7D A;  5I47 A;  2B63 A;  4M9U A;  2KSW A;  4FS1 A;  2BQU A;  1XDN A;  2XD4 A;  3PR4 A;  4Q8F A;  2FMA A;  2CFM A;  5KG5 A;  3MWE A;  1IYD A;  3VPD A;  3PO3 G;  3T9D A;  3V6H A;  4I55 F;  3OSP A;  2R84 A;  3N6X A;  4IZO A;  2RDJ A;  3RJ0 A;  1A48 A;  1I1M A;  3KAK A;  2A1H A;  5GON F;  1FVI A;  2PMZ A;  2UUA H;  2ALZ A;  2WYO A;  5F9N A;  1GYF A;  2R85 A;  1TWA A;  1VBG A;  5EDW A;  3DAA A;  2JA6 A;  4X64 H;  5I5X A;  2QYZ A;  4Q4D A;  2DAA A;  2HGX A;  3KHL A;  3GTJ A;  5LMN H;  3KYH C;  5BR8 H;  4JV5 H;  3NUA A;  3T9B A;  1N32 H;  3RUP A;  5KFS A;  4WBN F;  4DV7 H;  5BWR A;  1I94 H;  3K5I A;  4GKJ H;  2C35 B;  3L4K A;  3UYY A;  4DR5 H;  3M9O B;  4TQS A;  1E4F T;  1DAA A;  2XCP A;  2RDI A;  5A2Q W;  4G3I A;  1C3O A;  2I87 A;  4YJ3 F;  1I1L A;  4RAY A;  3RAX A;  3TIG A;  3GIP A;  2QK4 A;  3LP8 A;  5KG0 A;  2VPQ A;  4RNM A;  4O3S A;  4DQN A;  5KFL A;  5F9L A;  2FLN A;  4QSH A;  4QWA A;  4EBC A;  4JI4 H;  4EG0 A;  4O3Q A;  4K0K H;  1I2K A;  2YWV A;  4IWY A;  3T9A A;  4Q44 A;  5BWV A;  1M6V A;  5KKN B;  3JAM W; 
#chains in the Genus database with same CATH homology
 3LWB A;  1CQI B;  5C8Y F;  1SCU B;  2GQS A;  2XCL A;  2DIK A;  4FFL A;  5LYJ F;  5KX5 F;  2DLN A;  1T36 A;  2W6P A;  2I8C A;  3V4S A;  1GSH A;  2J9G A;  3HB9 A;  4O82 A;  3U9T A;  4O7L A;  4O7T A;  4O4J F;  3RV3 A;  4FGR A;  4ZQI A;  2CNQ A;  5CB4 F;  2CQY A;  3WO1 A;  5D8D A;  4HNT A;  3JRW A;  1UC8 A;  4O7R A;  3OUZ A;  4XYM B;  5JVL A;  5BPH A;  3KAJ A;  3TW6 A;  2PBZ A;  3WNZ A;  4O4H F;  3G8D A;  4C5A A;  1EHI A;  2YZG A;  4FU0 A;  4MAM A;  1EZ1 A;  1I7L A;  4MV8 A;  3U9S A;  5JQG F;  1OBG A;  1KJQ A;  4O7S A;  2NU6 B;  1IOV A;  4L1K A;  4HR7 A;  3MJF A;  2VR1 A;  4FFO A;  2FB9 A;  1GGO A;  2PVP A;  3G8C A;  3U55 A;  4O2A F;  2YL2 A;  2YYA A;  1CQJ B;  5CAE B;  2IP4 A;  1JDB B;  2HGS A;  1B6S A;  1VBH A;  1KJ9 A;  5EZY F;  5JVD F;  1KJI A;  2YS6 A;  4ZI7 F;  1JKJ B;  2V5A A;  1KUT A;  4MV1 A;  4XX0 B;  3TII A;  3HBL A;  3VMM A;  3Q2O A;  4FFM A;  2W6M A;  4C5B A;  2DZD A;  2ZDG A;  3R9R A;  2I80 A;  2ZDQ A;  1Z2O X;  2YRW A;  4MV4 A;  2YS7 A;  4Y8V B;  2QF7 A;  3AX6 A;  2R87 A;  3UFX B;  4O84 A;  3R5F A;  3KAL A;  1GLV A;  2FPI B;  2YW2 A;  2SCU B;  4YAJ B;  4MV9 A;  1PX2 A;  1DV1 A;  2W6Z A;  3K5H A;  4FFN A;  2R7L A;  4XZ3 B;  4IHJ F;  5JH7 F;  1Z2P X;  3R5H A;  4MA0 A;  3N6R A;  3BG5 A;  3ETJ A;  4XYL B;  3ORQ A;  4MV7 A;  3TQT A;  3RV4 A;  2P0A A;  3V4Z A;  4ZHQ F;  5C1P A;  2CNU A;  2FPG B;  1KJ8 A;  1W93 A;  4C5C A;  1ULZ A;  1KEE A;  2HJW A;  1DV2 A;  2V58 A;  2ZDH A;  2W6N A;  4O2B F;  3JRX A;  5HV6 A;  2GLT A;  3VA7 A;  2YZM A;  1VKZ A;  2GPW A;  1UC9 A;  3N8D A;  2R7K A;  3WO0 A;  1AUX A;  1EYZ A;  3GLK A;  4YJ2 F;  4HQ6 A;  3SE7 A;  3JZI A;  2YRX A;  2R7N A;  2Z02 A;  1IOW A;  3VOT A;  2FPP B;  4I4T F;  3TIN A;  5DMX A;  4YB8 B;  4IWX A;  3ORR A;  3QFF A;  1B6R A;  3ETH A;  2NU9 B;  3KRE A;  5HBR B;  3AW8 A;  1C30 A;  3DF7 A;  1AUV A;  3I12 A;  1CS0 A;  4E4T A;  3RFC A;  5CA1 F;  4O4L F;  2NU8 B;  4ZOL F;  5FNV F;  4EGQ A;  3VPC A;  1KBL A;  1W96 A;  5J2U F;  1OBD A;  2W6Q A;  2R6F A;  5H80 A;  1CE8 A;  4O7V A;  4O4I F;  2YZL A;  3JZF A;  1PK8 A;  2V59 A;  4O7N A;  4MA5 A;  2DWC A;  1BNC A;  4HNV A;  5LP6 F;  2W71 A;  4FFR A;  4DIM A;  3HO8 A;  2NUA B;  4O83 A;  2OLS A;  4O7Y A;  2YZN A;  4O7Z A;  4NYE A;  2FP4 B;  3Q1K A;  4FFP A;  4MV3 A;  5K2M A;  1M0T A;  1DIK A;  4IIJ F;  2R7M A;  1M0W A;  1GSA A;  2W6O A;  1E4E A;  1A9X A;  5J2T F;  5BMV F;  3OUU A;  1BXR A;  5JQW A;  1Z2N X;  1JLL B;  4TV9 F;  4EGJ A;  1EUC B;  5CA0 F;  4MV6 A;  2VQD A;  1KJJ A;  3VPB A;  1E4E B;  2GPS A;  2NU7 B;  1WR2 A;  2C00 A;  2R86 A;  1KC7 A;  5BPF A;  4ME6 A;  4O86 A;  5LOV F;  4I50 F;  4TV8 F;  2GQR A;  3GID A;  3MWD A;  4O7W A;  4RZQ A;  1EUD B;  4DLK A;  3R23 A;  1I7N A;  4WD3 A;  5C1O A;  1GSO A;  5IYZ F;  4YAK B;  2CNV A;  1JDE A;  3E5N A;  3K3P A;  3R5X A;  4O81 A;  5LXT F;  2Z04 A;  4HNU A;  4FE2 A;  4YBZ B;  2R82 A;  4TUY F;  5LA6 F;  2CZG A;  2X0S A;  3U54 A;  2PN1 A;  2W70 A;  5I47 A;  4M9U A;  2XD4 A;  3MWE A;  3VPD A;  4I55 F;  2R84 A;  4IZO A;  1A48 A;  3KAK A;  5GON F;  2WYO A;  2R85 A;  1VBG A;  3NUA A;  3RUP A;  4WBN F;  3K5I A;  1C3O A;  2I87 A;  4YJ3 F;  3TIG A;  2QK4 A;  3LP8 A;  2VPQ A;  4QSH A;  4EG0 A;  2YWV A;  4IWY A;  1M6V A;  5KKN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...