4Y8VB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
b'SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of acetyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Transferase
total genus 76
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4y8vB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4y8vB02
5KX5F 4HNTA 5K2MA 2CNUA 5JQWA 2R7LA 2R84A 2YZNA 3WNZA 1SCUB 4TV9F 4IWXA 1KBLA 3R5HA 3AX6A 1JDBB 5FNVF 1JKJB 1IOVA 3E5NA 3VOTA 1AUVA 2YZLA 1T36A 3JZIA 2FB9A 1EUCB 5JH7F 5EZYF 3K5IA 3GIDA 2I8CA 1EUDB 2W6NA 1EHIA 2ZDGA 1OBDA 2XCLA 1PX2A 4O4IF 3U9TA 2HJWA 3HO8A 4WBNF 5JQGF 2I80A 4TUYF 2YS7A 1KJJA 3NUAA 2J9GA 1Z2PX 4MA5A 3LP8A 4O7LA 1EYZA 2QK4A 4MA0A 4O82A 2CNVA 1A48A 2PN1A 2V5AA 4MV3A 3JRXA 1DIKA 1PK8A 4MAMA 2NU9B 2GLTA 1JLLB 3TW6A 4MV6A 2W6OA 4MV8A 3OUUA 2W6PA 3QFFA 3ETJA 3UFXB 4ZI7F 1W96A 4ZHQF 2W6ZA 5HV6A 2R6FA 5LYJF 2X0SA 2VQDA 3U55A 2GPWA 2YRWA 1CS0A 2R82A 3HB9A 3KAKA 1BXRA 3RV3A 1KJIA 4O7WA 3VPBA 4FFPA 4Y8VB 5BPFA 2DLNA 2CNQA 2FPPB 2C00A 4M9UA 1E4EB 4YAJB 4EG0A 5BMVF 4DLKA 3KAJA 4O7SA 2GPSA 2VPQA 2NU6B 1JDEA 4O81A 3BG5A 3AW8A 4O2AF 1E4EA 4O7ZA 2NU7B 4O7YA 5HBRB 3WO1A 3RUPA 1AUXA 5C1OA 2YYAA 4E4TA 4I50F 2XD4A 3N8DA 4HR7A 4FE2A 3ETHA 2Z02A 2ZDHA 3KALA 2CQYA 4O2BF 4FFRA 3R5FA 3K3PA 1CE8A 5DMXA 1KJQA 5JVLA 1UC8A 1WR2A 1IOWA 5LA6F 1Z2NX 2R7MA 2VR1A 2FPIB 2DWCA 2R7KA 3VPDA 1KC7A 5C1PA 2I87A 2DZDA 5GONF 1BNCA 3TINA 2GQRA 3R9RA 2V58A 1VBHA 1C30A 4MV7A 3V4ZA 2DIKA 3GLKA 2HGSA 2YRXA 3R23A 4DIMA 1EZ1A 4EGJA 2ZDQA 1OBGA 2SCUB 2W71A 4O7NA 5D8DA 1B6SA 4ME6A 4TV8F 1M0TA 1M6VA 2CZGA 1C3OA 4XX0B 3U54A 5KKNB 2OLSA 1DV2A 2QF7A 3N6RA 3JZFA 4HNUA 5CA1F 4QSHA 1GSHA 4O7TA 5LP6F 3DF7A 4O4HF 5LOVF 3TQTA 2W70A 1VBGA 3G8CA 2YZMA 4XYMB 2NU8B 4FFOA 5CAEB 4IWYA 4ZQIA 4XYLB 4O86A 4C5BA 4EGQA 1Z2OX 2R86A 2YL2A 3RFCA 4MV9A 3Q1KA 4MV4A 3RV4A 4NYEA 4IHJF 5JVDF 1UC9A 4O4LF 3MJFA 4YJ3F 2W6QA 1CQJB 5LXTF 2WYOA 3Q2OA 4IIJF 2YZGA 3VPCA 1I7LA 5IYZF 4C5AA 4YJ2F 3K5HA 5C8YF 3SE7A 3HBLA 4I4TF 5I47A 4L1KA 4O7RA 2YW2A 2PBZA 1A9XA 2R87A 1W93A 1VKZA 2W6MA 3VA7A 3I12A 4WD3A 1KUTA 3MWDA 4YAKB 3G8DA 4FU0A 4C5CA 3V4SA 3JRWA 3TIGA 4O83A 1CQIB 4O7VA 3TIIA 2Z04A 3R5XA 2YS6A 4O4JF 2PVPA 3ORQA 4RZQA 1KJ9A 3LWBA 4MV1A 5BPHA 2FP4B 5CA0F 2YWVA 2IP4A 4HNVA 1GSOA 3OUZA 4YBZB 1GGOA 3ORRA 3U9SA 4FFNA 3KREA 4I55F 2GQSA 4HQ6A 1M0WA 1GLVA 4ZOLF 4YB8B 4FFMA 1KJ8A 1KEEA 1GSAA 3WO0A 3MWEA 1I7NA 4FFLA 4XZ3B 5J2UF 4O84A 2P0AA 5J2TF 1B6RA 2V59A 1ULZA 5CB4F 2R7NA 4IZOA 2FPGB 4FGRA 2NUAB 2R85A 3VMMA 1DV1A 5H80A
chains in the Genus database with same CATH superfamily
5KT2A 3AYHB 5KX5F 4HNTA 2W9BB 3I4NG 5E25A 1RJPA 2HDKA 5K2MA 2CNUA 4HN2A 5JQWA 2R7LA 2R84A 4J9SA 3T9CA 5DG7A 4JV1A 2YZNA 3WNZA 1SCUB 2E5LH 2DABA 4X65H 4TV9F 4IWXA 1KBLA 4QWBA 3R5HA 4JI6H 2JA6A 3BQ0A 3AX6A 1JDBB 1WSCA 3U0GA 2W9CA 4DRFA 5FNVF 3T5JA 1TWFA 1JKJB 1IOVA 2YU9A 4ECTA 4GLXA 3HKZE 4EFEA 3E5NA 4Q45A 1S0OA 4TQSA 2RGRA 1A0GA 2C2DA 1DAAA 4NXNH 2R8JA 2XCAA 4QWCA 3VOTA 1AUVA 2YZLA 5KFRA 2VUMG 3PO3G 1S97A 1T36A 3JZIA 1TWHA 4CKCA 5EDWA 4LMYA 4J9OA 2FB9A 1EUCB 1BJTA 3MR6A 3CVZA 5JH7F 2R93A 5EZYF 4PDBA 5KT7A 1S9FA 3K5IA 3GIDA 1RYRA 4IRDA 3RGZA 2I8CA 5KG4A 1EUDB 4BBRG 2W6NA 3W1GA 5DGBA 1EHIA 1XK5A 1RJRA 2ZDGA 3QQMA 1OBDA 3NBYB 3T9FA 2XCLA 1XNRH 2A1HA 5LMNH 1PX2A 3HT5A 4QW8A 2RDJA 4O4IF 3RIZA 3U9TA 3TEKA 2HJWA 1G2WA 3HO8A 5D1OB 2WB1A 4WBNF 2R8IA 3RB6A 4RNOA 2COGA 5JQGF 1O75A 3CQZA 4RAYA 3EPIA 4DL3A 5IYCG 2I80A 4RUAA 4RNMA 4TUYF 4QJFA 5L1JA 2YS7A 1KJJA 3NUAA 4QWAA 2ATLA 2B63A 2J9GA 1Z2PX 4MA5A 2AGPA 4DV1H 2CFMA 3PO2G 4DL6A 4QWEA 3WWJA 3LP8A 4O7LA 3NBZB 5I5XA 1EYZA 5A2QW 4FS2A 2JA8G 2QK4A 2HVRA 4MA0A 4O82A 5D1OA 3NGDA 5BYBA 3M9NB 2CNVA 2OH2A 1A48A 2CKZB 5BWWA 2R8HA 5KFNA 5KFFA 2PN1A 3SNOA 4JV5H 1HR0H 2V5AA 4MV3A 4DL4A 5EWGA 2E2HA 3JRXA 2UXDH 4CHIA 4F4YA 1L2ZA 1DIKA 4RB0A 4J0MA 5FD5A 1PK8A 1I1LA 1K83A 2WE6A 2IMWP 4MAMA 4LF9H 2NU9B 2GLTA 1JLLB 3TW6A 5F9NA 4MV6A 5KFCA 3IN5A 2W6OA 5FPRA 4MV8A 3MWMA 3OUUA 5KFZA 3QZ7A 4Q8FA 5D1PA 1E4FT 3HXLA 1I3QA 2W6PA 1J5EH 1HNZH 3QFFA 4X66H 3GIIA 5FPOA 3EYYA 3F8NA 3ETJA 3UFXB 2QYZA 5BWVA 2J6TA 4CE5A 4ZI7F 3RF2A 3OHBA 4DL5A 1W96A 4J9QA 4EYHB 4IRKA 1EKFA 4ZHQF 2FE3A 2W6ZA 4TVIA 3CSWA 1TWGA 2CW7A 5HV6A 4JI7H 4JXUA 2R6FA 4FBTA 4Q44A 4M0JA 4EEQA 3J81W 3KYHC 1I94H 5LYJF 1RYSA 1N33H 4A3IG 4DV4H 1Y1VG 2X0SA 3FKIA 5KFVA 2VQDA 2DAAA 5FR9A 3U55A 3GTKA 1ZHSA 1A3GA 3TW7A 2GPWA 3MR3A 4YR3A 2YRWA 4O3SA 2UUCH 3Q8SB 4A3CG 1CS0A 3TY8A 4LH6A 1TWAA 2NVXA 4ED6A 2R82A 4Q4DA 4MTEA 2XGQA 3HB9A 3KAKA 1S10A 2JEJA 4ED0A 1BXRA 4A3BG 4JV2A 4GKJH 3RV3A 1KJIA 4BXXG 3N41B 1GO3E 1WH2A 3TY9A 4ECQA 3GTPA 5DG8A 4O7WA 2DPIA 1R9TA 4JI4H 5KS8A 3VPBA 4CMDA 4FFPA 4Y8VB 4JI8H 5BPFA 2Y0SE 2XC9A 2DLNA 1CKMA 2RDIA 1CKOA 3J7AK 4QIWA 5DQGA 5KFJA 3PW7A 4OX9H 4ECWA 2CNQA 3DTGA 2FPPB 2C00A 1CKNB 3GIQA 4A3MG 3RAQA 4AYBE 2IBKA 1XDNA 3OHAA 3H3VH 3VNNA 2JA7A 4M9UA 1E4EB 4YAJB 4DR1H 4EG0A 5BMVF 4DLKA 3Q8PB 4KHPH 2E2IA 5KFQA 3KAJA 4O7SA 2WAQA 1HNWH 2GPSA 3LULA 5EOYA 3N40P 5BWUA 5C3EG 4EBEA 2VPQA 3GTOA 2JEFA 4E6NA 2NU6B 2C35B 3H40A 4PWQA 1AN7A 1JDEA 4UCOA 2FLNA 2HHFA 3I4MG 2RF4A 5DQIA 4O81A 4A3FG 1I1MA 1ET0A 3BG5A 3AW8A 1CKNA 5I5SA 3T99A 5DG9A 4DV2H 5DLFA 1S03G 1S68A 4O2AF 1E4EA 4DUZH 4O7ZA 1OWTA 2NU7B 4O7YA 5HBRB 3WO1A 1Y14B 3PR4A 2HG8A 3GIJA 5DISC 5KFYA 3V6HA 1XMQH 2W9BA 4DV6H 1GYFA 4YR0A 3RUPA 5KT3A 3OSNA 1AUXA 3UQ8A 3M4IA 3JAMW 4FS1A 1TAEA 3KXYT 2ODTX 5C1OA 1JX4A 2UXBH 2YYAA 4E4TA 1Y1WA 3BA8A 3BAAA 3H0GA 2W8KA 5L1LA 4I50F 5FD6A 4ED7A 4RNNA 3W5OA 4EEYA 3RB0A 5KFUA 2XD4A 3BABA 3N8DA 4HR7A 4U7CA 4FE2A 3V6JA 2R92G 2VUGA 4CKBA 4J9NA 1V4YA 3ETHA 1Y1VA 3T1HH 3JZ6A 3UYYA 5F9LA 2Z02A 2ZDHA 2Q7DA 1IBKH 4GLWA 2JA5G 2HHHH 3KALA 2CQYA 4WHXA 4ETSA 4ED8A 4O2BF 3S24A 4FFRA 1TWCA 5KG1A 3R5FA 4YHHH 4UUGA 3K3PA 2R7ZG 3T5KA 4JI0H 5KFGA 1CE8A 5KFPA 2PMZA 3T54A 3N42B 5DMXA 2RGVA 1KJQA 1UC8A 4UCSA 5JVLA 1WR2A 1M7JA 3J80W 3GTMA 5I5WA 5KT4A 1IOWA 5KFXA 5KG5A 5LA6F 4ECZA 1WCMG 4O3PA 1Z2NX 2W9AA 5IT9W 2R7MA 5KFMA 2VR1A 2FPIB 2DWCA 5DQHA 4NZOA 1I1KA 2R7KA 3GV7B 3VPDA 3HOWG 1KC7A 4DV7H 5C1PA 2I87A 4A3KG 2DZDA 2ASJA 3JSNA 4JI5H 5LL6b 5I5UA 4BY1G 2FLLA 4DR6H 5GONF 1BNCA 1V51A 3TINA 4J9KA 3PVXA 5I5VA 2IA6A 2ZM6H 1K1QA 1UNNC 3GQCA 4F4ZA 5C44G 2GQRA 3R9RA 4DV3H 4JI3H 1FJGH 2V58A 1VBHA 1C30A 4DV0H 5KFBA 4MV7A 5HNEA 3Q8QB 3HKZA 4IR9A 2FK3A 5IYDG 2VQEH 3RAXA 3V4ZA 4RZRA 4DR3H 2DIKA 4PBCA 1I50A 3GLKA 3C0FB 2HGSA 2WTFA 5L1IA 2Y4RA 4PZ7A 2YRXA 3R23A 2C22A 2V4QA 5CM0A 1FVIA 1EZ1A 4DIMA 4EGJA 1VS0A 4DR2H 5KT6A 2ZDQA 1OBGA 2SCUB 2W71A 2COJA 4I7HA 5KFKA 1WRVA 2ALZA 3BQ2A 1DGSA 2JEIA 5KFDA 4PZ6A 2AGQA 2ABJA 4JV0A 2VUMA 4O7NA 1IYDA 5D8DA 3V6KA 4LF7H 4AQYH 4F4XA 3FMAA 3UZBA 2BQRA 1B6SA 4LF4H 4ME6A 4B3MH 2ZGIA 3NC0B 5IP9G 4RB2C 4TV8F 5KFWA 1T94A 3N6XA 1M0TA 3HOUG 4U6PA 3KTMA 1M6VA 4JI1H 2COIA 2CZGA 1C3OA 4XX0B 3HOYG 3SGIA 3U54A 5KKNB 2KSWA 4A3DG 4LSXA 1N32H 2OLSA 1N34H 2UXCH 4ED2A 1DV2A 4UCVA 2QF7A 3N6RA 5LMUH 3JZFA 4HNUA 4QW9A 5CA1F 4O3QA 4ECSA 4QSHA 1GSHA 1P8LA 4O7TA 5KFTA 4APMA 4J9MA 2AGOA 4UCRA 2W7OA 4LFAH 5LP6F 3DF7A 1XNQH 5KFIA 1N36H 1KTAA 2UVWA 2WB1E 3W1BA 4J9RA 1BGWA 5I5TA 5DGAA 2B63G 3JSLA 4O4HF 5LOVF 1SYXB 3TQTA 5KFOA 4RB3C 2W70A 4R7RA 4M7EA 4MTDA 3PR5B 3UZOA 3WWIA 3N43B 3KHLA 4IAJA 1VBGA 3RB4A 3G8CA 4FBUA 3QWUA 3HOVG 5BWRA 1KT8A 3PW0A 5DLGA 2YZMA 3GDEA 4XYMB 2NU8B 4DQNA 4FFOA 4YP3A 4DUYH 5C4XG 4ECXA 4B3TH 4CKEA 4DAAA 5KFSA 4LF6H 5CAEB 2W8LA 4IWYA 3GTLA 2Q2UA 1ZAUA 1TA8A 2J6SA 5C5JA 4ZQIA 1RK6A 5FLMG 4CMFA 1HNXH 4XYLB 3T9BA 4O86A 4C5BA 3RR5A 4F50A 4EGQA 1Z2OX 3Q8RB 2R86A 4J9PA 2AU0A 4GC7A 2HIVA 2YL2A 1RJQA 2UVRA 2JEGA 3RFCA 4MV9A 3GIMA 3Q1KA 4MV4A 4YY3H 3RV4A 4RAZA 4NYEA 2X5RA 4IHJF 5JVDF 1E4GT 4TM5A 5KFHA 3GIKA 4EYIB 3SI8A 1A0IA 4O3RA 3HOZG 5FLXW 4RB1A 1UC9A 4GC6A 4DR7H 1B04A 4JUZA 4O4LF 3GTJA 4DR4H 4B3RH 3MJFA 4YJ3F 1XMOH 3MFIA 4DL7A 2W6QA 1CQJB 5LXTF 4A3JG 1FKAH 2WYOA 5KG6A 1JXLA 1RK5A 1I6UA 4ECYA 3Q2OA 4LF5H 4IIJF 3RBEA 3RTXA 2YZGA 3VPCA 3FKIG 2EJ0A 1JIHA 4CC5A 3H20A 2VOBA 1I7LA 2Q2TA 2V4RA 3KHRA 2ASDA 2UU9H 2XGPA 2BQ3A 2O03A 4QWDA 4K6NA 2QB5A 5DAAA 5IYZF 1K1SA 3OTOH 4C5AA 4YJ2F 4UCUA 1B33N 3K5HA 4RUCA 3BA9A 5C8YF 3SE7A 3H4BA 3T5LA 5BWXA 3HBLA 2Y0SA 5KFLA 4I4TF 1EKPA 5I47A 2MCTA 5IYBG 4RU9A 3QZ8A 4L1KA 4O7RA 2YW2A 3BACA 3T7AA 5I60A 1ZHQA 3K3VA 5KG2A 3MR2A 3GV5B 4Q43A 3RJ0A 4NZMA 3L4KA 1SEIA 2PBZA 3BJYA 1A9XA 4B3SH 2R87A 1W93A 1VKZA 4AYBA 2W6MA 3VA7A 2ZJTA 3I12A 4WD3A 5KFAA 4BY7G 4ED3A 1KUTA 4G3IA 4K0KH 1ZQ7A 2AQ4A 2VQFH 3LQSA 4EBCA 2C2EA 3TQ1A 3MWDA 4YAKB 3G8DA 1MZBA 2FK1A 4QIWE 5KT5A 2JA7G 4A3GG 2M05A 3GTGA 4ED1A 2EJ3A 2FJZA 4FU0A 4A2BA 5FJ8G 3IG0A 4C5CA 3GTQA 5KG0A 4A3EG 3V4SA 2EJ2A 3T9DA 1SFOA 4LFCH 3JRWA 3TIGA 1VAJA 3M9OB 3M9MB 4DR5H 4O83A 4IR1A 1CQIB 4Q8EA 2WAQE 2HIXA 4O7VA 3L4JA 3EPGA 2C2RA 4JYAH 3TIIA 2J6UA 4IRCA 2FK2A 3FDSA 5L1KA 1EKVA 2Z04A 3R5XA 2YS6A 2FKLA 2FMAA 2XIGA 3H4DA 4YQWA 4Q0YA 4O4JF 1S0NA 2PVPA 1ZETA 2UUAH 2HGXA 4JI2H 3ORQA 4YR2A 3GB8B 4RZQA 4EQ5A 1KJ9A 5CE8A 3LWBA 3RGXA 2WDTA 2VPSA 3KHHA 3PZPA 4MV1A 5BPHA 2BQUA 2FP4B 3MR5A 2F4VH 2W57A 5IP7G 5CA0F 1I2LA 2HGWA 3L2PA 2R8GA 2YWVA 1Y1WG 2IP4A 4HNVA 4RCNA 5IWAH 1N48A 2BR0A 3H0GG 3N44B 1I2KA 3T9EA 4X62H 3HOXG 4ECUA 1GSOA 3OUZA 4YBZB 1X9NA 3GILA 2VA3A 2R93G 3KHGA 4NZNA 5BYAA 4EBDA 4R8UB 2FLPA 3TY5A 4A3LG 1GGOA 2C28A 1N56A 1IBMH 2UVVA 3ORRA 3U9SA 4C2MA 4FFNA 4FM9A 3KREA 5DGHA 5DGIA 4CC6A 2YCHA 4I55F 2GQSA 2R92A 3PFFA 5BWTA 4A2AA 3G6VA 2UUBH 4HQ6A 2EIYA 2HVSA 2OWOA 4GKKH 2VA2A 1M0WA 1GLVA 3DAAA 4ZOLF 5JUMA 4YB8B 3G6XA 4FFMA 1KJ8A 4Q4CA 4O3OA 2W7PA 3PW4A 1KEEA 1GSAA 3WO0A 3MWEA 4X64H 2JA5A 1I7NA 4LH7A 3OSPA 3MFHA 4R8UA 2ASLA 4ECRA 1T3NA 4NXMH 3LMLA 4FFLA 3T9AA 4BBSG 5CR5A 3PN1A 4XZ3B 5I5YA 5J2UF 5BR8H 4O84A 4DL2A 2P0AA 2R7ZA 3GIPA 2DPJA 5J2TF 2V9WA 1B6RA 1V9PA 4O3NA 3T1YH 4UCTA 2V59A 3PW2A 1ULZA 2HVQA 3RBDA 3RB3A 2NVYA 5CB4F 2R8KA 4PZ8A 4LSAA 1P16A 2R7NA 4TQRA 3T5HA 4NLGA 4IZOA 5EWFA 2FPGB 3DTFA 3WWHA 1WCMA 4FGRA 4EFBA 2PMZE 1IYEA 4UFZA 2NUAB 4LFBH 3GJXB 5KFEA 2R85A 4A93G 2HHFB 2CW8A 4BWSC 2UVUA 4HYKA 2JA6G 3BQ1A 3VMMA 5T14A 4J9LA 1DV1A 5K3WA 3CEBA 2XCPA 3PW5A 3G6YA 4LF8H 5KG7A 4DV5H 4ECVA 5EWEA 1S0MA 5H80A 5L9XA 5KG3A 2W9CB 4F4WA 3GV8B 1IBLH
chains in the Genus database with same CATH topology
5KX5F 4HNTA 5K2MA 2CNUA 5JQWA 2R7LA 2R84A 2YZNA 3WNZA 1SCUB 4TV9F 4IWXA 1KBLA 3R5HA 3AX6A 1JDBB 5FNVF 1JKJB 1IOVA 3E5NA 3VOTA 1AUVA 2YZLA 1T36A 3JZIA 2FB9A 1EUCB 5JH7F 5EZYF 3K5IA 3GIDA 2I8CA 1EUDB 2W6NA 1EHIA 2ZDGA 1OBDA 2XCLA 1PX2A 4O4IF 3U9TA 2HJWA 3HO8A 4WBNF 5JQGF 2I80A 4TUYF 2YS7A 1KJJA 3NUAA 2J9GA 1Z2PX 4MA5A 3LP8A 4O7LA 1EYZA 2QK4A 4MA0A 4O82A 2CNVA 1A48A 2PN1A 2V5AA 4MV3A 3JRXA 1DIKA 1PK8A 4MAMA 2NU9B 2GLTA 1JLLB 3TW6A 4MV6A 2W6OA 4MV8A 3OUUA 2W6PA 3QFFA 3ETJA 3UFXB 4ZI7F 1W96A 4ZHQF 2W6ZA 5HV6A 2R6FA 5LYJF 2X0SA 2VQDA 3U55A 2GPWA 2YRWA 1CS0A 2R82A 3HB9A 3KAKA 1BXRA 3RV3A 1KJIA 4O7WA 3VPBA 4FFPA 4Y8VB 5BPFA 2DLNA 2CNQA 2FPPB 2C00A 4M9UA 1E4EB 4YAJB 4EG0A 5BMVF 4DLKA 3KAJA 4O7SA 2GPSA 2VPQA 2NU6B 1JDEA 4O81A 3BG5A 3AW8A 4O2AF 1E4EA 4O7ZA 2NU7B 4O7YA 5HBRB 3WO1A 3RUPA 1AUXA 5C1OA 2YYAA 4E4TA 4I50F 2XD4A 3N8DA 4HR7A 4FE2A 3ETHA 2Z02A 2ZDHA 3KALA 2CQYA 4O2BF 4FFRA 3R5FA 3K3PA 1CE8A 5DMXA 1KJQA 5JVLA 1UC8A 1WR2A 1IOWA 5LA6F 1Z2NX 2R7MA 2VR1A 2FPIB 2DWCA 2R7KA 3VPDA 1KC7A 5C1PA 2I87A 2DZDA 5GONF 1BNCA 3TINA 2GQRA 3R9RA 2V58A 1VBHA 1C30A 4MV7A 3V4ZA 2DIKA 3GLKA 2HGSA 2YRXA 3R23A 4DIMA 1EZ1A 4EGJA 2ZDQA 1OBGA 2SCUB 2W71A 4O7NA 5D8DA 1B6SA 4ME6A 4TV8F 1M0TA 1M6VA 2CZGA 1C3OA 4XX0B 3U54A 5KKNB 2OLSA 1DV2A 2QF7A 3N6RA 3JZFA 4HNUA 5CA1F 4QSHA 1GSHA 4O7TA 5LP6F 3DF7A 4O4HF 5LOVF 3TQTA 2W70A 1VBGA 3G8CA 2YZMA 4XYMB 2NU8B 4FFOA 5CAEB 4IWYA 4ZQIA 4XYLB 4O86A 4C5BA 4EGQA 1Z2OX 2R86A 2YL2A 3RFCA 4MV9A 3Q1KA 4MV4A 3RV4A 4NYEA 4IHJF 5JVDF 1UC9A 4O4LF 3MJFA 4YJ3F 2W6QA 1CQJB 5LXTF 2WYOA 3Q2OA 4IIJF 2YZGA 3VPCA 1I7LA 5IYZF 4C5AA 4YJ2F 3K5HA 5C8YF 3SE7A 3HBLA 4I4TF 5I47A 4L1KA 4O7RA 2YW2A 2PBZA 1A9XA 2R87A 1W93A 1VKZA 2W6MA 3VA7A 3I12A 4WD3A 1KUTA 3MWDA 4YAKB 3G8DA 4FU0A 4C5CA 3V4SA 3JRWA 3TIGA 4O83A 1CQIB 4O7VA 3TIIA 2Z04A 3R5XA 2YS6A 4O4JF 2PVPA 3ORQA 4RZQA 1KJ9A 3LWBA 4MV1A 5BPHA 2FP4B 5CA0F 2YWVA 2IP4A 4HNVA 1GSOA 3OUZA 4YBZB 1GGOA 3ORRA 3U9SA 4FFNA 3KREA 4I55F 2GQSA 4HQ6A 1M0WA 1GLVA 4ZOLF 4YB8B 4FFMA 1KJ8A 1KEEA 1GSAA 3WO0A 3MWEA 1I7NA 4FFLA 4XZ3B 5J2UF 4O84A 2P0AA 5J2TF 1B6RA 2V59A 1ULZA 5CB4F 2R7NA 4IZOA 2FPGB 4FGRA 2NUAB 2R85A 3VMMA 1DV1A 5H80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KX5 F;  4HNT A;  5K2M A;  2CNU A;  5JQW A;  2R7L A;  2R84 A;  2YZN A;  3WNZ A;  1SCU B;  4TV9 F;  4IWX A;  1KBL A;  3R5H A;  3AX6 A;  1JDB B;  5FNV F;  1JKJ B;  1IOV A;  3E5N A;  3VOT A;  1AUV A;  2YZL A;  1T36 A;  3JZI A;  2FB9 A;  1EUC B;  5JH7 F;  5EZY F;  3K5I A;  3GID A;  2I8C A;  1EUD B;  2W6N A;  1EHI A;  2ZDG A;  1OBD A;  2XCL A;  1PX2 A;  4O4I F;  3U9T A;  2HJW A;  3HO8 A;  4WBN F;  5JQG F;  2I80 A;  4TUY F;  2YS7 A;  1KJJ A;  3NUA A;  2J9G A;  1Z2P X;  4MA5 A;  3LP8 A;  4O7L A;  1EYZ A;  2QK4 A;  4MA0 A;  4O82 A;  2CNV A;  1A48 A;  2PN1 A;  2V5A A;  4MV3 A;  3JRX A;  1DIK A;  1PK8 A;  4MAM A;  2NU9 B;  2GLT A;  1JLL B;  3TW6 A;  4MV6 A;  2W6O A;  4MV8 A;  3OUU A;  2W6P A;  3QFF A;  3ETJ A;  3UFX B;  4ZI7 F;  1W96 A;  4ZHQ F;  2W6Z A;  5HV6 A;  2R6F A;  5LYJ F;  2X0S A;  2VQD A;  3U55 A;  2GPW A;  2YRW A;  1CS0 A;  2R82 A;  3HB9 A;  3KAK A;  1BXR A;  3RV3 A;  1KJI A;  4O7W A;  3VPB A;  4FFP A;  4Y8V B;  5BPF A;  2DLN A;  2CNQ A;  2FPP B;  2C00 A;  4M9U A;  1E4E B;  4YAJ B;  4EG0 A;  5BMV F;  4DLK A;  3KAJ A;  4O7S A;  2GPS A;  2VPQ A;  2NU6 B;  1JDE A;  4O81 A;  3BG5 A;  3AW8 A;  4O2A F;  1E4E A;  4O7Z A;  2NU7 B;  4O7Y A;  5HBR B;  3WO1 A;  3RUP A;  1AUX A;  5C1O A;  2YYA A;  4E4T A;  4I50 F;  2XD4 A;  3N8D A;  4HR7 A;  4FE2 A;  3ETH A;  2Z02 A;  2ZDH A;  3KAL A;  2CQY A;  4O2B F;  4FFR A;  3R5F A;  3K3P A;  1CE8 A;  5DMX A;  1KJQ A;  5JVL A;  1UC8 A;  1WR2 A;  1IOW A;  5LA6 F;  1Z2N X;  2R7M A;  2VR1 A;  2FPI B;  2DWC A;  2R7K A;  3VPD A;  1KC7 A;  5C1P A;  2I87 A;  2DZD A;  5GON F;  1BNC A;  3TIN A;  2GQR A;  3R9R A;  2V58 A;  1VBH A;  1C30 A;  4MV7 A;  3V4Z A;  2DIK A;  3GLK A;  2HGS A;  2YRX A;  3R23 A;  4DIM A;  1EZ1 A;  4EGJ A;  2ZDQ A;  1OBG A;  2SCU B;  2W71 A;  4O7N A;  5D8D A;  1B6S A;  4ME6 A;  4TV8 F;  1M0T A;  1M6V A;  2CZG A;  1C3O A;  4XX0 B;  3U54 A;  5KKN B;  2OLS A;  1DV2 A;  2QF7 A;  3N6R A;  3JZF A;  4HNU A;  5CA1 F;  4QSH A;  1GSH A;  4O7T A;  5LP6 F;  3DF7 A;  4O4H F;  5LOV F;  3TQT A;  2W70 A;  1VBG A;  3G8C A;  2YZM A;  4XYM B;  2NU8 B;  4FFO A;  5CAE B;  4IWY A;  4ZQI A;  4XYL B;  4O86 A;  4C5B A;  4EGQ A;  1Z2O X;  2R86 A;  2YL2 A;  3RFC A;  4MV9 A;  3Q1K A;  4MV4 A;  3RV4 A;  4NYE A;  4IHJ F;  5JVD F;  1UC9 A;  4O4L F;  3MJF A;  4YJ3 F;  2W6Q A;  1CQJ B;  5LXT F;  2WYO A;  3Q2O A;  4IIJ F;  2YZG A;  3VPC A;  1I7L A;  5IYZ F;  4C5A A;  4YJ2 F;  3K5H A;  5C8Y F;  3SE7 A;  3HBL A;  4I4T F;  5I47 A;  4L1K A;  4O7R A;  2YW2 A;  2PBZ A;  1A9X A;  2R87 A;  1W93 A;  1VKZ A;  2W6M A;  3VA7 A;  3I12 A;  4WD3 A;  1KUT A;  3MWD A;  4YAK B;  3G8D A;  4FU0 A;  4C5C A;  3V4S A;  3JRW A;  3TIG A;  4O83 A;  1CQI B;  4O7V A;  3TII A;  2Z04 A;  3R5X A;  2YS6 A;  4O4J F;  2PVP A;  3ORQ A;  4RZQ A;  1KJ9 A;  3LWB A;  4MV1 A;  5BPH A;  2FP4 B;  5CA0 F;  2YWV A;  2IP4 A;  4HNV A;  1GSO A;  3OUZ A;  4YBZ B;  1GGO A;  3ORR A;  3U9S A;  4FFN A;  3KRE A;  4I55 F;  2GQS A;  4HQ6 A;  1M0W A;  1GLV A;  4ZOL F;  4YB8 B;  4FFM A;  1KJ8 A;  1KEE A;  1GSA A;  3WO0 A;  3MWE A;  1I7N A;  4FFL A;  4XZ3 B;  5J2U F;  4O84 A;  2P0A A;  5J2T F;  1B6R A;  2V59 A;  1ULZ A;  5CB4 F;  2R7N A;  4IZO A;  2FPG B;  4FGR A;  2NUA B;  2R85 A;  3VMM A;  1DV1 A;  5H80 A; 
#chains in the Genus database with same CATH topology
 5KT2 A;  3AYH B;  5KX5 F;  4HNT A;  2W9B B;  3I4N G;  5E25 A;  1RJP A;  2HDK A;  5K2M A;  2CNU A;  4HN2 A;  5JQW A;  2R7L A;  2R84 A;  4J9S A;  3T9C A;  5DG7 A;  4JV1 A;  2YZN A;  3WNZ A;  1SCU B;  2E5L H;  2DAB A;  4X65 H;  4TV9 F;  4IWX A;  1KBL A;  4QWB A;  3R5H A;  4JI6 H;  2JA6 A;  3BQ0 A;  3AX6 A;  1JDB B;  1WSC A;  3U0G A;  2W9C A;  4DRF A;  5FNV F;  3T5J A;  1TWF A;  1JKJ B;  1IOV A;  2YU9 A;  4ECT A;  4GLX A;  3HKZ E;  4EFE A;  3E5N A;  4Q45 A;  1S0O A;  4TQS A;  2RGR A;  1A0G A;  2C2D A;  1DAA A;  4NXN H;  2R8J A;  2XCA A;  4QWC A;  3VOT A;  1AUV A;  2YZL A;  5KFR A;  2VUM G;  3PO3 G;  1S97 A;  1T36 A;  3JZI A;  1TWH A;  4CKC A;  5EDW A;  4LMY A;  4J9O A;  2FB9 A;  1EUC B;  1BJT A;  3MR6 A;  3CVZ A;  5JH7 F;  2R93 A;  5EZY F;  4PDB A;  5KT7 A;  1S9F A;  3K5I A;  3GID A;  1RYR A;  4IRD A;  3RGZ A;  2I8C A;  5KG4 A;  1EUD B;  4BBR G;  2W6N A;  3W1G A;  5DGB A;  1EHI A;  1XK5 A;  1RJR A;  2ZDG A;  3QQM A;  1OBD A;  3NBY B;  3T9F A;  2XCL A;  1XNR H;  2A1H A;  5LMN H;  1PX2 A;  3HT5 A;  4QW8 A;  2RDJ A;  4O4I F;  3RIZ A;  3U9T A;  3TEK A;  2HJW A;  1G2W A;  3HO8 A;  5D1O B;  2WB1 A;  4WBN F;  2R8I A;  3RB6 A;  4RNO A;  2COG A;  5JQG F;  1O75 A;  3CQZ A;  4RAY A;  3EPI A;  4DL3 A;  5IYC G;  2I80 A;  4RUA A;  4RNM A;  4TUY F;  4QJF A;  5L1J A;  2YS7 A;  1KJJ A;  3NUA A;  4QWA A;  2ATL A;  2B63 A;  2J9G A;  1Z2P X;  4MA5 A;  2AGP A;  4DV1 H;  2CFM A;  3PO2 G;  4DL6 A;  4QWE A;  3WWJ A;  3LP8 A;  4O7L A;  3NBZ B;  5I5X A;  1EYZ A;  5A2Q W;  4FS2 A;  2JA8 G;  2QK4 A;  2HVR A;  4MA0 A;  4O82 A;  5D1O A;  3NGD A;  5BYB A;  3M9N B;  2CNV A;  2OH2 A;  1A48 A;  2CKZ B;  5BWW A;  2R8H A;  5KFN A;  5KFF A;  2PN1 A;  3SNO A;  4JV5 H;  1HR0 H;  2V5A A;  4MV3 A;  4DL4 A;  5EWG A;  2E2H A;  3JRX A;  2UXD H;  4CHI A;  4F4Y A;  1L2Z A;  1DIK A;  4RB0 A;  4J0M A;  5FD5 A;  1PK8 A;  1I1L A;  1K83 A;  2WE6 A;  2IMW P;  4MAM A;  4LF9 H;  2NU9 B;  2GLT A;  1JLL B;  3TW6 A;  5F9N A;  4MV6 A;  5KFC A;  3IN5 A;  2W6O A;  5FPR A;  4MV8 A;  3MWM A;  3OUU A;  5KFZ A;  3QZ7 A;  4Q8F A;  5D1P A;  1E4F T;  3HXL A;  1I3Q A;  2W6P A;  1J5E H;  1HNZ H;  3QFF A;  4X66 H;  3GII A;  5FPO A;  3EYY A;  3F8N A;  3ETJ A;  3UFX B;  2QYZ A;  5BWV A;  2J6T A;  4CE5 A;  4ZI7 F;  3RF2 A;  3OHB A;  4DL5 A;  1W96 A;  4J9Q A;  4EYH B;  4IRK A;  1EKF A;  4ZHQ F;  2FE3 A;  2W6Z A;  4TVI A;  3CSW A;  1TWG A;  2CW7 A;  5HV6 A;  4JI7 H;  4JXU A;  2R6F A;  4FBT A;  4Q44 A;  4M0J A;  4EEQ A;  3J81 W;  3KYH C;  1I94 H;  5LYJ F;  1RYS A;  1N33 H;  4A3I G;  4DV4 H;  1Y1V G;  2X0S A;  3FKI A;  5KFV A;  2VQD A;  2DAA A;  5FR9 A;  3U55 A;  3GTK A;  1ZHS A;  1A3G A;  3TW7 A;  2GPW A;  3MR3 A;  4YR3 A;  2YRW A;  4O3S A;  2UUC H;  3Q8S B;  4A3C G;  1CS0 A;  3TY8 A;  4LH6 A;  1TWA A;  2NVX A;  4ED6 A;  2R82 A;  4Q4D A;  4MTE A;  2XGQ A;  3HB9 A;  3KAK A;  1S10 A;  2JEJ A;  4ED0 A;  1BXR A;  4A3B G;  4JV2 A;  4GKJ H;  3RV3 A;  1KJI A;  4BXX G;  3N41 B;  1GO3 E;  1WH2 A;  3TY9 A;  4ECQ A;  3GTP A;  5DG8 A;  4O7W A;  2DPI A;  1R9T A;  4JI4 H;  5KS8 A;  3VPB A;  4CMD A;  4FFP A;  4Y8V B;  4JI8 H;  5BPF A;  2Y0S E;  2XC9 A;  2DLN A;  1CKM A;  2RDI A;  1CKO A;  3J7A K;  4QIW A;  5DQG A;  5KFJ A;  3PW7 A;  4OX9 H;  4ECW A;  2CNQ A;  3DTG A;  2FPP B;  2C00 A;  1CKN B;  3GIQ A;  4A3M G;  3RAQ A;  4AYB E;  2IBK A;  1XDN A;  3OHA A;  3H3V H;  3VNN A;  2JA7 A;  4M9U A;  1E4E B;  4YAJ B;  4DR1 H;  4EG0 A;  5BMV F;  4DLK A;  3Q8P B;  4KHP H;  2E2I A;  5KFQ A;  3KAJ A;  4O7S A;  2WAQ A;  1HNW H;  2GPS A;  3LUL A;  5EOY A;  3N40 P;  5BWU A;  5C3E G;  4EBE A;  2VPQ A;  3GTO A;  2JEF A;  4E6N A;  2NU6 B;  2C35 B;  3H40 A;  4PWQ A;  1AN7 A;  1JDE A;  4UCO A;  2FLN A;  2HHF A;  3I4M G;  2RF4 A;  5DQI A;  4O81 A;  4A3F G;  1I1M A;  1ET0 A;  3BG5 A;  3AW8 A;  1CKN A;  5I5S A;  3T99 A;  5DG9 A;  4DV2 H;  5DLF A;  1S03 G;  1S68 A;  4O2A F;  1E4E A;  4DUZ H;  4O7Z A;  1OWT A;  2NU7 B;  4O7Y A;  5HBR B;  3WO1 A;  1Y14 B;  3PR4 A;  2HG8 A;  3GIJ A;  5DIS C;  5KFY A;  3V6H A;  1XMQ H;  2W9B A;  4DV6 H;  1GYF A;  4YR0 A;  3RUP A;  5KT3 A;  3OSN A;  1AUX A;  3UQ8 A;  3M4I A;  3JAM W;  4FS1 A;  1TAE A;  3KXY T;  2ODT X;  5C1O A;  1JX4 A;  2UXB H;  2YYA A;  4E4T A;  1Y1W A;  3BA8 A;  3BAA A;  3H0G A;  2W8K A;  5L1L A;  4I50 F;  5FD6 A;  4ED7 A;  4RNN A;  3W5O A;  4EEY A;  3RB0 A;  5KFU A;  2XD4 A;  3BAB A;  3N8D A;  4HR7 A;  4U7C A;  4FE2 A;  3V6J A;  2R92 G;  2VUG A;  4CKB A;  4J9N A;  1V4Y A;  3ETH A;  1Y1V A;  3T1H H;  3JZ6 A;  3UYY A;  5F9L A;  2Z02 A;  2ZDH A;  2Q7D A;  1IBK H;  4GLW A;  2JA5 G;  2HHH H;  3KAL A;  2CQY A;  4WHX A;  4ETS A;  4ED8 A;  4O2B F;  3S24 A;  4FFR A;  1TWC A;  5KG1 A;  3R5F A;  4YHH H;  4UUG A;  3K3P A;  2R7Z G;  3T5K A;  4JI0 H;  5KFG A;  1CE8 A;  5KFP A;  2PMZ A;  3T54 A;  3N42 B;  5DMX A;  2RGV A;  1KJQ A;  1UC8 A;  4UCS A;  5JVL A;  1WR2 A;  1M7J A;  3J80 W;  3GTM A;  5I5W A;  5KT4 A;  1IOW A;  5KFX A;  5KG5 A;  5LA6 F;  4ECZ A;  1WCM G;  4O3P A;  1Z2N X;  2W9A A;  5IT9 W;  2R7M A;  5KFM A;  2VR1 A;  2FPI B;  2DWC A;  5DQH A;  4NZO A;  1I1K A;  2R7K A;  3GV7 B;  3VPD A;  3HOW G;  1KC7 A;  4DV7 H;  5C1P A;  2I87 A;  4A3K G;  2DZD A;  2ASJ A;  3JSN A;  4JI5 H;  5LL6 b;  5I5U A;  4BY1 G;  2FLL A;  4DR6 H;  5GON F;  1BNC A;  1V51 A;  3TIN A;  4J9K A;  3PVX A;  5I5V A;  2IA6 A;  2ZM6 H;  1K1Q A;  1UNN C;  3GQC A;  4F4Z A;  5C44 G;  2GQR A;  3R9R A;  4DV3 H;  4JI3 H;  1FJG H;  2V58 A;  1VBH A;  1C30 A;  4DV0 H;  5KFB A;  4MV7 A;  5HNE A;  3Q8Q B;  3HKZ A;  4IR9 A;  2FK3 A;  5IYD G;  2VQE H;  3RAX A;  3V4Z A;  4RZR A;  4DR3 H;  2DIK A;  4PBC A;  1I50 A;  3GLK A;  3C0F B;  2HGS A;  2WTF A;  5L1I A;  2Y4R A;  4PZ7 A;  2YRX A;  3R23 A;  2C22 A;  2V4Q A;  5CM0 A;  1FVI A;  1EZ1 A;  4DIM A;  4EGJ A;  1VS0 A;  4DR2 H;  5KT6 A;  2ZDQ A;  1OBG A;  2SCU B;  2W71 A;  2COJ A;  4I7H A;  5KFK A;  1WRV A;  2ALZ A;  3BQ2 A;  1DGS A;  2JEI A;  5KFD A;  4PZ6 A;  2AGQ A;  2ABJ A;  4JV0 A;  2VUM A;  4O7N A;  1IYD A;  5D8D A;  3V6K A;  4LF7 H;  4AQY H;  4F4X A;  3FMA A;  3UZB A;  2BQR A;  1B6S A;  4LF4 H;  4ME6 A;  4B3M H;  2ZGI A;  3NC0 B;  5IP9 G;  4RB2 C;  4TV8 F;  5KFW A;  1T94 A;  3N6X A;  1M0T A;  3HOU G;  4U6P A;  3KTM A;  1M6V A;  4JI1 H;  2COI A;  2CZG A;  1C3O A;  4XX0 B;  3HOY G;  3SGI A;  3U54 A;  5KKN B;  2KSW A;  4A3D G;  4LSX A;  1N32 H;  2OLS A;  1N34 H;  2UXC H;  4ED2 A;  1DV2 A;  4UCV A;  2QF7 A;  3N6R A;  5LMU H;  3JZF A;  4HNU A;  4QW9 A;  5CA1 F;  4O3Q A;  4ECS A;  4QSH A;  1GSH A;  1P8L A;  4O7T A;  5KFT A;  4APM A;  4J9M A;  2AGO A;  4UCR A;  2W7O A;  4LFA H;  5LP6 F;  3DF7 A;  1XNQ H;  5KFI A;  1N36 H;  1KTA A;  2UVW A;  2WB1 E;  3W1B A;  4J9R A;  1BGW A;  5I5T A;  5DGA A;  2B63 G;  3JSL A;  4O4H F;  5LOV F;  1SYX B;  3TQT A;  5KFO A;  4RB3 C;  2W70 A;  4R7R A;  4M7E A;  4MTD A;  3PR5 B;  3UZO A;  3WWI A;  3N43 B;  3KHL A;  4IAJ A;  1VBG A;  3RB4 A;  3G8C A;  4FBU A;  3QWU A;  3HOV G;  5BWR A;  1KT8 A;  3PW0 A;  5DLG A;  2YZM A;  3GDE A;  4XYM B;  2NU8 B;  4DQN A;  4FFO A;  4YP3 A;  4DUY H;  5C4X G;  4ECX A;  4B3T H;  4CKE A;  4DAA A;  5KFS A;  4LF6 H;  5CAE B;  2W8L A;  4IWY A;  3GTL A;  2Q2U A;  1ZAU A;  1TA8 A;  2J6S A;  5C5J A;  4ZQI A;  1RK6 A;  5FLM G;  4CMF A;  1HNX H;  4XYL B;  3T9B A;  4O86 A;  4C5B A;  3RR5 A;  4F50 A;  4EGQ A;  1Z2O X;  3Q8R B;  2R86 A;  4J9P A;  2AU0 A;  4GC7 A;  2HIV A;  2YL2 A;  1RJQ A;  2UVR A;  2JEG A;  3RFC A;  4MV9 A;  3GIM A;  3Q1K A;  4MV4 A;  4YY3 H;  3RV4 A;  4RAZ A;  4NYE A;  2X5R A;  4IHJ F;  5JVD F;  1E4G T;  4TM5 A;  5KFH A;  3GIK A;  4EYI B;  3SI8 A;  1A0I A;  4O3R A;  3HOZ G;  5FLX W;  4RB1 A;  1UC9 A;  4GC6 A;  4DR7 H;  1B04 A;  4JUZ A;  4O4L F;  3GTJ A;  4DR4 H;  4B3R H;  3MJF A;  4YJ3 F;  1XMO H;  3MFI A;  4DL7 A;  2W6Q A;  1CQJ B;  5LXT F;  4A3J G;  1FKA H;  2WYO A;  5KG6 A;  1JXL A;  1RK5 A;  1I6U A;  4ECY A;  3Q2O A;  4LF5 H;  4IIJ F;  3RBE A;  3RTX A;  2YZG A;  3VPC A;  3FKI G;  2EJ0 A;  1JIH A;  4CC5 A;  3H20 A;  2VOB A;  1I7L A;  2Q2T A;  2V4R A;  3KHR A;  2ASD A;  2UU9 H;  2XGP A;  2BQ3 A;  2O03 A;  4QWD A;  4K6N A;  2QB5 A;  5DAA A;  5IYZ F;  1K1S A;  3OTO H;  4C5A A;  4YJ2 F;  4UCU A;  1B33 N;  3K5H A;  4RUC A;  3BA9 A;  5C8Y F;  3SE7 A;  3H4B A;  3T5L A;  5BWX A;  3HBL A;  2Y0S A;  5KFL A;  4I4T F;  1EKP A;  5I47 A;  2MCT A;  5IYB G;  4RU9 A;  3QZ8 A;  4L1K A;  4O7R A;  2YW2 A;  3BAC A;  3T7A A;  5I60 A;  1ZHQ A;  3K3V A;  5KG2 A;  3MR2 A;  3GV5 B;  4Q43 A;  3RJ0 A;  4NZM A;  3L4K A;  1SEI A;  2PBZ A;  3BJY A;  1A9X A;  4B3S H;  2R87 A;  1W93 A;  1VKZ A;  4AYB A;  2W6M A;  3VA7 A;  2ZJT A;  3I12 A;  4WD3 A;  5KFA A;  4BY7 G;  4ED3 A;  1KUT A;  4G3I A;  4K0K H;  1ZQ7 A;  2AQ4 A;  2VQF H;  3LQS A;  4EBC A;  2C2E A;  3TQ1 A;  3MWD A;  4YAK B;  3G8D A;  1MZB A;  2FK1 A;  4QIW E;  5KT5 A;  2JA7 G;  4A3G G;  2M05 A;  3GTG A;  4ED1 A;  2EJ3 A;  2FJZ A;  4FU0 A;  4A2B A;  5FJ8 G;  3IG0 A;  4C5C A;  3GTQ A;  5KG0 A;  4A3E G;  3V4S A;  2EJ2 A;  3T9D A;  1SFO A;  4LFC H;  3JRW A;  3TIG A;  1VAJ A;  3M9O B;  3M9M B;  4DR5 H;  4O83 A;  4IR1 A;  1CQI B;  4Q8E A;  2WAQ E;  2HIX A;  4O7V A;  3L4J A;  3EPG A;  2C2R A;  4JYA H;  3TII A;  2J6U A;  4IRC A;  2FK2 A;  3FDS A;  5L1K A;  1EKV A;  2Z04 A;  3R5X A;  2YS6 A;  2FKL A;  2FMA A;  2XIG A;  3H4D A;  4YQW A;  4Q0Y A;  4O4J F;  1S0N A;  2PVP A;  1ZET A;  2UUA H;  2HGX A;  4JI2 H;  3ORQ A;  4YR2 A;  3GB8 B;  4RZQ A;  4EQ5 A;  1KJ9 A;  5CE8 A;  3LWB A;  3RGX A;  2WDT A;  2VPS A;  3KHH A;  3PZP A;  4MV1 A;  5BPH A;  2BQU A;  2FP4 B;  3MR5 A;  2F4V H;  2W57 A;  5IP7 G;  5CA0 F;  1I2L A;  2HGW A;  3L2P A;  2R8G A;  2YWV A;  1Y1W G;  2IP4 A;  4HNV A;  4RCN A;  5IWA H;  1N48 A;  2BR0 A;  3H0G G;  3N44 B;  1I2K A;  3T9E A;  4X62 H;  3HOX G;  4ECU A;  1GSO A;  3OUZ A;  4YBZ B;  1X9N A;  3GIL A;  2VA3 A;  2R93 G;  3KHG A;  4NZN A;  5BYA A;  4EBD A;  4R8U B;  2FLP A;  3TY5 A;  4A3L G;  1GGO A;  2C28 A;  1N56 A;  1IBM H;  2UVV A;  3ORR A;  3U9S A;  4C2M A;  4FFN A;  4FM9 A;  3KRE A;  5DGH A;  5DGI A;  4CC6 A;  2YCH A;  4I55 F;  2GQS A;  2R92 A;  3PFF A;  5BWT A;  4A2A A;  3G6V A;  2UUB H;  4HQ6 A;  2EIY A;  2HVS A;  2OWO A;  4GKK H;  2VA2 A;  1M0W A;  1GLV A;  3DAA A;  4ZOL F;  5JUM A;  4YB8 B;  3G6X A;  4FFM A;  1KJ8 A;  4Q4C A;  4O3O A;  2W7P A;  3PW4 A;  1KEE A;  1GSA A;  3WO0 A;  3MWE A;  4X64 H;  2JA5 A;  1I7N A;  4LH7 A;  3OSP A;  3MFH A;  4R8U A;  2ASL A;  4ECR A;  1T3N A;  4NXM H;  3LML A;  4FFL A;  3T9A A;  4BBS G;  5CR5 A;  3PN1 A;  4XZ3 B;  5I5Y A;  5J2U F;  5BR8 H;  4O84 A;  4DL2 A;  2P0A A;  2R7Z A;  3GIP A;  2DPJ A;  5J2T F;  2V9W A;  1B6R A;  1V9P A;  4O3N A;  3T1Y H;  4UCT A;  2V59 A;  3PW2 A;  1ULZ A;  2HVQ A;  3RBD A;  3RB3 A;  2NVY A;  5CB4 F;  2R8K A;  4PZ8 A;  4LSA A;  1P16 A;  2R7N A;  4TQR A;  3T5H A;  4NLG A;  4IZO A;  5EWF A;  2FPG B;  3DTF A;  3WWH A;  1WCM A;  4FGR A;  4EFB A;  2PMZ E;  1IYE A;  4UFZ A;  2NUA B;  4LFB H;  3GJX B;  5KFE A;  2R85 A;  4A93 G;  2HHF B;  2CW8 A;  4BWS C;  2UVU A;  4HYK A;  2JA6 G;  3BQ1 A;  3VMM A;  5T14 A;  4J9L A;  1DV1 A;  5K3W A;  3CEB A;  2XCP A;  3PW5 A;  3G6Y A;  4LF8 H;  5KG7 A;  4DV5 H;  4ECV A;  5EWE A;  1S0M A;  5H80 A;  5L9X A;  5KG3 A;  2W9C B;  4F4W A;  3GV8 B;  1IBL H; 
#chains in the Genus database with same CATH homology
 5KX5 F;  4HNT A;  5K2M A;  2CNU A;  5JQW A;  2R7L A;  2R84 A;  2YZN A;  3WNZ A;  1SCU B;  4TV9 F;  4IWX A;  1KBL A;  3R5H A;  3AX6 A;  1JDB B;  5FNV F;  1JKJ B;  1IOV A;  3E5N A;  3VOT A;  1AUV A;  2YZL A;  1T36 A;  3JZI A;  2FB9 A;  1EUC B;  5JH7 F;  5EZY F;  3K5I A;  3GID A;  2I8C A;  1EUD B;  2W6N A;  1EHI A;  2ZDG A;  1OBD A;  2XCL A;  1PX2 A;  4O4I F;  3U9T A;  2HJW A;  3HO8 A;  4WBN F;  5JQG F;  2I80 A;  4TUY F;  2YS7 A;  1KJJ A;  3NUA A;  2J9G A;  1Z2P X;  4MA5 A;  3LP8 A;  4O7L A;  1EYZ A;  2QK4 A;  4MA0 A;  4O82 A;  2CNV A;  1A48 A;  2PN1 A;  2V5A A;  4MV3 A;  3JRX A;  1DIK A;  1PK8 A;  4MAM A;  2NU9 B;  2GLT A;  1JLL B;  3TW6 A;  4MV6 A;  2W6O A;  4MV8 A;  3OUU A;  2W6P A;  3QFF A;  3ETJ A;  3UFX B;  4ZI7 F;  1W96 A;  4ZHQ F;  2W6Z A;  5HV6 A;  2R6F A;  5LYJ F;  2X0S A;  2VQD A;  3U55 A;  2GPW A;  2YRW A;  1CS0 A;  2R82 A;  3HB9 A;  3KAK A;  1BXR A;  3RV3 A;  1KJI A;  4O7W A;  3VPB A;  4FFP A;  4Y8V B;  5BPF A;  2DLN A;  2CNQ A;  2FPP B;  2C00 A;  4M9U A;  1E4E B;  4YAJ B;  4EG0 A;  5BMV F;  4DLK A;  3KAJ A;  4O7S A;  2GPS A;  2VPQ A;  2NU6 B;  1JDE A;  4O81 A;  3BG5 A;  3AW8 A;  4O2A F;  1E4E A;  4O7Z A;  2NU7 B;  4O7Y A;  5HBR B;  3WO1 A;  3RUP A;  1AUX A;  5C1O A;  2YYA A;  4E4T A;  4I50 F;  2XD4 A;  3N8D A;  4HR7 A;  4FE2 A;  3ETH A;  2Z02 A;  2ZDH A;  3KAL A;  2CQY A;  4O2B F;  4FFR A;  3R5F A;  3K3P A;  1CE8 A;  5DMX A;  1KJQ A;  5JVL A;  1UC8 A;  1WR2 A;  1IOW A;  5LA6 F;  1Z2N X;  2R7M A;  2VR1 A;  2FPI B;  2DWC A;  2R7K A;  3VPD A;  1KC7 A;  5C1P A;  2I87 A;  2DZD A;  5GON F;  1BNC A;  3TIN A;  2GQR A;  3R9R A;  2V58 A;  1VBH A;  1C30 A;  4MV7 A;  3V4Z A;  2DIK A;  3GLK A;  2HGS A;  2YRX A;  3R23 A;  4DIM A;  1EZ1 A;  4EGJ A;  2ZDQ A;  1OBG A;  2SCU B;  2W71 A;  4O7N A;  5D8D A;  1B6S A;  4ME6 A;  4TV8 F;  1M0T A;  1M6V A;  2CZG A;  1C3O A;  4XX0 B;  3U54 A;  5KKN B;  2OLS A;  1DV2 A;  2QF7 A;  3N6R A;  3JZF A;  4HNU A;  5CA1 F;  4QSH A;  1GSH A;  4O7T A;  5LP6 F;  3DF7 A;  4O4H F;  5LOV F;  3TQT A;  2W70 A;  1VBG A;  3G8C A;  2YZM A;  4XYM B;  2NU8 B;  4FFO A;  5CAE B;  4IWY A;  4ZQI A;  4XYL B;  4O86 A;  4C5B A;  4EGQ A;  1Z2O X;  2R86 A;  2YL2 A;  3RFC A;  4MV9 A;  3Q1K A;  4MV4 A;  3RV4 A;  4NYE A;  4IHJ F;  5JVD F;  1UC9 A;  4O4L F;  3MJF A;  4YJ3 F;  2W6Q A;  1CQJ B;  5LXT F;  2WYO A;  3Q2O A;  4IIJ F;  2YZG A;  3VPC A;  1I7L A;  5IYZ F;  4C5A A;  4YJ2 F;  3K5H A;  5C8Y F;  3SE7 A;  3HBL A;  4I4T F;  5I47 A;  4L1K A;  4O7R A;  2YW2 A;  2PBZ A;  1A9X A;  2R87 A;  1W93 A;  1VKZ A;  2W6M A;  3VA7 A;  3I12 A;  4WD3 A;  1KUT A;  3MWD A;  4YAK B;  3G8D A;  4FU0 A;  4C5C A;  3V4S A;  3JRW A;  3TIG A;  4O83 A;  1CQI B;  4O7V A;  3TII A;  2Z04 A;  3R5X A;  2YS6 A;  4O4J F;  2PVP A;  3ORQ A;  4RZQ A;  1KJ9 A;  3LWB A;  4MV1 A;  5BPH A;  2FP4 B;  5CA0 F;  2YWV A;  2IP4 A;  4HNV A;  1GSO A;  3OUZ A;  4YBZ B;  1GGO A;  3ORR A;  3U9S A;  4FFN A;  3KRE A;  4I55 F;  2GQS A;  4HQ6 A;  1M0W A;  1GLV A;  4ZOL F;  4YB8 B;  4FFM A;  1KJ8 A;  1KEE A;  1GSA A;  3WO0 A;  3MWE A;  1I7N A;  4FFL A;  4XZ3 B;  5J2U F;  4O84 A;  2P0A A;  5J2T F;  1B6R A;  2V59 A;  1ULZ A;  5CB4 F;  2R7N A;  4IZO A;  2FPG B;  4FGR A;  2NUA B;  2R85 A;  3VMM A;  1DV1 A;  5H80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...