4Y8VB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of acetyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Transferase
total genus 76
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4y8vB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4y8vB02
4O7YA 1BNCA 1OBGA 3RV4A 4MV6A 4IZOA 1VBGA 2FB9A 5J2UF 2DWCA 5HBRB 1BXRA 5DMXA 1GLVA 4I50F 2FPGB 4ZI7F 3QFFA 1SCUB 4HQ6A 3R5FA 4O7WA 2W6OA 4O7ZA 5JQWA 4XYMB 3G8CA 3WO1A 1KEEA 4O7SA 1EYZA 2SCUB 2YRWA 1T36A 1KJQA 5CB4F 2R7KA 1AUXA 2Z02A 4WD3A 3VPCA 2CQYA 1B6RA 4C5BA 2V58A 5BPHA 2YRXA 1W96A 3NUAA 4XYLB 1CQIB 4O2BF 2NU7B 4FFOA 1PX2A 4MV1A 4O7TA 2CNQA 4IHJF 3R9RA 5LOVF 1JKJB 3Q1KA 4DIMA 3AW8A 5LYJF 2VPQA 1VBHA 2QF7A 2V59A 4O7VA 3LP8A 1JLLB 1JDBB 4Y8VB 3TQTA 3JZFA 1M6VA 3Q2OA 4I55F 2YYAA 3VPBA 4FU0A 1IOWA 1AUVA 4MV4A 4YB8B 2R84A 4TV9F 5LA6F 3AX6A 3KAKA 5C1OA 1E4EA 2YZGA 1B6SA 5I47A 1VKZA 2DZDA 1GGOA 1A48A 2FP4B 2I87A 4O4LF 3U55A 4L1KA 3KALA 4HR7A 2DLNA 4FGRA 3U9TA 4O7LA 1KC7A 3JRWA 3G8DA 3MJFA 3VMMA 3DF7A 2R85A 1KJ8A 1KBLA 1GSOA 4O83A 3MWEA 4E4TA 4O84A 4MA0A 2GPWA 5IYZF 2VR1A 1CQJB 3OUZA 2YZMA 4C5AA 4IWYA 3RFCA 1UC9A 2R86A 4YAJB 3VA7A 3N8DA 3HB9A 5EZYF 1I7LA 5K2MA 3RV3A 1M0WA 4I4TF 4MV3A 2I8CA 2NU9B 4QSHA 2QK4A 4XX0B 2PN1A 5KKNB 4ZHQF 4XZ3B 3ORRA 2P0AA 3BG5A 4FFRA 4O81A 4YAKB 2OLSA 2CNUA 2ZDHA 4O7RA 1IOVA 4M9UA 4MA5A 4TV8F 2I80A 5LXTF 4ZOLF 3U9SA 3ORQA 4IIJF 4YJ2F 4C5CA 4IWXA 2HJWA 5HV6A 3HBLA 3JZIA 3HO8A 3V4ZA 3MWDA 3GIDA 4EGJA 1Z2NX 1Z2PX 4O4IF 4RZQA 3RUPA 3LWBA 4HNUA 3JRXA 2CNVA 3R23A 2W71A 4HNTA 5LP6F 1KUTA 5JQGF 3OUUA 1DIKA 5KX5F 4TUYF 1I7NA 4O4JF 2R7MA 2YS7A 2Z04A 3KAJA 5D8DA 4DLKA 5BPFA 2R87A 2R7NA 2YL2A 3ETHA 5JVDF 3I12A 3E5NA 2ZDQA 5FNVF 2W6QA 2YZNA 2YW2A 1KJJA 4ZQIA 4MAMA 2NUAB 5C1PA 2PBZA 2PVPA 2FPIB 3TW6A 3WO0A 3TINA 4O86A 5CAEB 4EG0A 1PK8A 5CA1F 1EUDB 1DV2A 5C8YF 2R6FA 3K5HA 3VPDA 2XD4A 5JVLA 2R82A 2FPPB 3TIGA 2GPSA 2J9GA 1A9XA 1GSAA 2X0SA 4FFMA 2GQRA 5GONF 1E4EB 1C30A 1OBDA 1JDEA 1GSHA 5BMVF 5JH7F 2IP4A 4O2AF 2HGSA 1W93A 1ULZA 2NU6B 2GQSA 3GLKA 4FFLA 4MV7A 4O82A 3WNZA 3TIIA 3V4SA 1KJ9A 2W6MA 2YS6A 3K5IA 2YWVA 2ZDGA 2CZGA 2W6NA 4YBZB 4MV8A 1EHIA 3VOTA 4FFPA 3U54A 4FE2A 4FFNA 4YJ3F 4EGQA 3R5HA 2WYOA 2V5AA 5CA0F 3SE7A 2W6PA 2DIKA 1CE8A 4O7NA 1DV1A 3K3PA 3KREA 3N6RA 1WR2A 2NU8B 2W6ZA 1Z2OX 2W70A 4ME6A 1CS0A 5H80A 5J2TF 1C3OA 2VQDA 3UFXB 1UC8A 2GLTA 2YZLA 1KJIA 3R5XA 1EZ1A 4NYEA 2R7LA 4O4HF 2XCLA 2C00A 1M0TA 3ETJA 4HNVA 1EUCB 4MV9A 4WBNF
chains in the Genus database with same CATH superfamily
5EOYA 2HGWA 2VA2A 3H4BA 4O7YA 5CR5A 5KFWA 2JA8G 4PDBA 5DQHA 1BNCA 2R93A 1OBGA 4TVIA 4ED3A 2BQ3A 4JI3H 2RGRA 3GTLA 3PFFA 3RV4A 4DR3H 3HOUG 4MV6A 1TWAA 1HR0H 4MTDA 4GKJH 5EWEA 1IBKH 4ECSA 3OHAA 4IZOA 1EKFA 4DV2H 1R9TA 1VBGA 1ZAUA 5CE8A 2FB9A 5J2UF 4FS2A 4ECYA 2PMZA 4JI7H 2DWCA 4TQRA 3CVZA 1HNXH 5HBRB 2UVWA 1HNZH 2XGQA 1BXRA 5K3WA 5DMXA 1I1KA 4PBCA 1GLVA 4I50F 4CKBA 2FPGB 4ZI7F 3QFFA 1SCUB 1EKVA 3RTXA 4RAZA 4HQ6A 3W1GA 2EJ3A 3R5FA 4O7WA 1WRVA 3GV7B 4A3IG 2UUBH 4LFCH 4BXXG 3FDSA 2W6OA 4O7ZA 5JQWA 4JI2H 3BA8A 4XYMB 2XC9A 5I5XA 2Q7DA 2V9WA 4K6NA 3G8CA 4DV1H 4F4XA 3WO1A 4NZOA 4TM5A 5D1PA 5KG0A 4EBEA 3OHBA 4RNNA 1KEEA 2F4VH 4O7SA 4O3RA 2UVVA 1EYZA 1S0MA 4QWAA 2SCUB 4YHHH 2YRWA 1T36A 1KJQA 2UVUA 1S68A 3RGZA 1S9FA 3IN5A 4ED2A 2JEJA 5I5UA 1WSCA 1N34H 3QWUA 3PW5A 1E4GT 5CB4F 3GIJA 4ECQA 1XNQH 2R7KA 4LH7A 5KT3A 5KFOA 4DV7H 3NGDA 1AUXA 3RB6A 1S10A 2Z02A 3PO2G 4AYBE 4WD3A 1TA8A 4Q45A 3VPCA 2VPSA 3RB0A 2CQYA 1B6RA 4C5BA 2W9AA 4DR4H 2V58A 5BPHA 3MR2A 4YP3A 4DV3H 3H4DA 2YRXA 1W96A 4DL4A 4LF6H 1OWTA 2C2RA 3NUAA 4FBUA 4XYLB 4DV4H 1CQIB 4K0KH 3EYYA 1A0GA 3TQ1A 2FLNA 3N6XA 4O2BF 5KFRA 2WAQE 2NU7B 1ZHQA 3RAQA 1P8LA 4FFOA 3EPIA 5KFQA 5KFCA 3BQ0A 1DAAA 4JYAH 3GIIA 5KS8A 4A2BA 2JEGA 1PX2A 1BGWA 4Q8FA 4MV1A 4O7TA 1IBLH 2CNQA 1FKAH 4UCUA 2IA6A 1FVIA 4JI8H 5DISC 2JA5G 4R8UA 4IHJF 3R9RA 3PW2A 5LOVF 3GB8B 1Y1VA 3L4JA 3T5LA 2HVRA 5IP7G 1JKJB 3Q1KA 2UXCH 5KFUA 4DIMA 2VQEH 1DGSA 3AW8A 1KT8A 5LYJF 1V51A 4A3LG 2WTFA 5KFDA 1K1SA 1RK6A 1ZHSA 4Q4DA 2VPQA 3G6VA 5FD5A 1RYSA 4LSXA 4ED0A 1ZETA 1VBHA 2JA5A 3HT5A 3V6HA 3T5JA 1UNNC 2QF7A 3KHGA 2V59A 2COIA 1S0OA 4O7VA 1N48A 3LP8A 4O3NA 4O3OA 1S03G 3T5KA 4QIWE 4B3SH 4YR0A 5DAAA 1CKMA 1JLLB 1JDBB 4EFEA 5BYBA 1ZQ7A 2C2EA 2IMWP 3NBYB 4Y8VB 4NXMH 3TQTA 3JZFA 1V4YA 1M6VA 5DGHA 5FPOA 1RJRA 1SEIA 1N56A 4U7CA 4DV0H 5EWGA 2E5LH 2IBKA 2R8KA 3T9CA 4I7HA 4QWBA 4GKKH 3Q2OA 4I55F 2YYAA 3VPBA 3J81W 3BACA 3RBDA 4JV2A 4FU0A 2M05A 4OX9H 4ED7A 1TAEA 2PMZE 5KG2A 3PZPA 2BQUA 4A3CG 1IOWA 2B63G 2ZM6H 1AUVA 3CQZA 4RB2C 2EIYA 4MV4A 5F9NA 2J6UA 4DAAA 3HOYG 4YB8B 2R84A 3GTOA 2B63A 5BWXA 2HHFB 4TV9F 4CHIA 5LA6F 3N44B 3DTGA 5E25A 4EYIB 3RBEA 3MR6A 3PW4A 4Q0YA 3AX6A 4A3KG 3KAKA 3QZ8A 3RF2A 5D1OB 3GV5B 4HN2A 5DQIA 3HOWG 5C1OA 5KG1A 2ASDA 1E4EA 1MZBA 4J9OA 2V4QA 3IG0A 1I3QA 4QIWA 2QYZA 3JAMW 4UCRA 3H40A 4FBTA 3T9DA 4C2MA 2YZGA 1B6SA 2FK2A 5I47A 3MFIA 4EBCA 1VKZA 2DZDA 3W1BA 5KG4A 4ED1A 5BWVA 2WE6A 1GGOA 1A48A 2FP4B 2I87A 4O4LF 3U55A 1VAJA 1TWCA 3HKZE 4JV0A 4L1KA 5C44G 2XCAA 3KALA 2C22A 4HR7A 4A3FG 2DLNA 4UCOA 4LF7H 4FGRA 2HVSA 5I5YA 3U9TA 4O7LA 1KC7A 3JRWA 1VS0A 3G8DA 3LMLA 3MJFA 4JUZA 4ECUA 1P16A 3VMMA 4M7EA 3DF7A 4A3GG 2R85A 1KJ8A 2DPIA 2JA6G 1CKOA 1KBLA 4JI6H 1SYXB 2W9CA 1GSOA 5KFKA 4PZ6A 5I5TA 5KFHA 3GIKA 2RDIA 2AGPA 4O83A 4LF8H 3MWEA 4E4TA 4O84A 4MA0A 5BYAA 4F4ZA 1FJGH 2GPWA 1TWFA 5IYZF 1JXLA 2VR1A 3WWHA 1Y14B 1CQJB 3OUZA 4J9MA 2UUAH 4LFAH 4RCNA 2YZMA 2FKLA 4C5AA 4IWYA 3OSPA 5I5WA 3RFCA 2JA6A 4JI4H 1UC9A 5CM0A 2R86A 3NBZB 1JX4A 4A93G 4YAJB 4UCTA 3VA7A 4ETSA 3N8DA 3GIPA 3HKZA 2JEIA 3M9MB 3HB9A 3BA9A 1WCMG 5EZYF 1I7LA 5K2MA 2W7OA 5F9LA 3RJ0A 4WHXA 2KSWA 3RV3A 4TQSA 1M0WA 4I4TF 4MV3A 3UZOA 5I5VA 5KFSA 4YR2A 3JSLA 2R8IA 3N42B 4M0JA 1I1MA 2I8CA 3T9FA 2NU9B 1M7JA 1I2KA 2O03A 4QSHA 4RB3C 3BABA 3GJXB 3CEBA 4DUYH 3GIMA 4DL3A 2QK4A 2HGXA 3GILA 5KFZA 4NXNH 4BY7G 3RIZA 4XX0B 4JI0H 2PN1A 1WCMA 3G6YA 4BBSG 3T54A 1IYDA 5KKNB 4RB1A 3OSNA 2CW8A 1TWHA 2BR0A 5DG7A 5IYBG 4QW9A 4ZHQF 2VUGA 4XZ3B 3ORRA 5BWRA 3H0GG 2R8GA 3I4NG 4GC6A 3RB3A 3GQCA 2P0AA 4E6NA 3H3VH 3BG5A 4FFRA 5DLFA 4NLGA 4O81A 5KG5A 3NC0B 1WH2A 2MCTA 2AGQA 1K83A 2HIXA 4YAKB 2OLSA 3L2PA 1I50A 2ATLA 5C4XG 2W9BA 5BWUA 3PVXA 2CNUA 2ZDHA 5KFMA 4O7RA 1IOVA 4KHPH 5KFTA 5LL6b 4M9UA 4J9NA 2Y0SA 3BAAA 4MA5A 1XK5A 3H0GA 4RNMA 4TV8F 1Y1WG 3RR5A 3TW7A 2I80A 5LXTF 5A2QW 5T14A 1I94H 3HXLA 3N41B 4LFBH 3Q8PB 1L2ZA 2XGPA 4IR9A 4ZOLF 1I1LA 3TY5A 4CKEA 4ECXA 4FM9A 3U9SA 3ORQA 4O3SA 5FJ8G 4IIJF 4DV5H 4YJ2F 5KFXA 4C5CA 1T3NA 2RF4A 4LF9H 3GIQA 1N32H 3V6KA 4IWXA 2FLLA 2HJWA 1JIHA 2OH2A 2ZJTA 3T99A 5HV6A 4DR1H 3EPGA 4EFBA 2W8LA 3LQSA 3GTJA 4B3RH 3HBLA 5I5SA 1B04A 2FJZA 3JZIA 2YU9A 4JV5H 5IT9W 3HO8A 4GLWA 5DGAA 2JEFA 2COGA 3V4ZA 2E2HA 2CW7A 3MWDA 3T9EA 2C35B 3GIDA 4X64H 1BJTA 2OWOA 5IYCG 3MR5A 3KHRA 2AGOA 5KG7A 4EGJA 3FMAA 1HNWH 1CKNA 4F50A 1Z2NX 4A3JG 3JZ6A 3MWMA 4ED6A 4CC6A 5DG8A 1Z2PX 2V4RA 3UYYA 3N43B 3FKIG 4O4IF 4O3QA 2QB5A 3SI8A 4RZQA 5KT4A 3RUPA 4YR3A 4GLXA 2ASJA 4JI1H 3L4KA 2WB1A 1A3GA 3J80W 3LWBA 4UUGA 3JRXA 4HNUA 5BWWA 2CNVA 2Q2TA 5KG6A 3Q8RB 3R23A 3BQ2A 1J5EH 2W71A 3T9BA 3J7AK 3GDEA 4NZNA 4HNTA 5LP6F 1RJQA 3WWJA 4CKCA 4LF4H 1E4FT 3BJYA 1KUTA 2ALZA 5KFEA 5JQGF 1K1QA 3OUUA 2CKZB 3UZBA 4J9PA 4F4WA 4DR5H 2HDKA 4LF5H 3FKIA 3MR3A 5KT6A 2C28A 1DIKA 3GTMA 5KX5F 2J6TA 4TUYF 1I7NA 1V9PA 5KT7A 4O4JF 2R7MA 2YS7A 2VA3A 2Z04A 4DV6H 4B3MH 3H20A 3KAJA 5FR9A 2Q2UA 2FLPA 1Y1WA 5D8DA 4DLKA 5BPFA 2XIGA 5EWFA 4NZMA 2R87A 1B33N 2R7NA 4DL6A 2ODTX 1A0IA 4R8UB 4ED8A 4RUCA 3GTKA 4YQWA 4CMDA 2R8JA 3PO3G 5DGIA 1KTAA 3GV8B 3T5HA 2R92G 2YL2A 3KYHC 1XNRH 3ETHA 4BY1G 5JVDF 3I12A 3E5NA 2ZDQA 5FNVF 2YCHA 2W6QA 2AU0A 2VUMG 3M4IA 4O3PA 4RAYA 2RGVA 2YZNA 3TEKA 4ECTA 2YW2A 1KJJA 3KTMA 4RZRA 4JV1A 2DAAA 4MAMA 4ZQIA 2NUAB 4QW8A 3HOVG 2RDJA 5IWAH 1AN7A 2W7PA 2E2IA 5C1PA 3K3VA 3DTFA 2ABJA 1IBMH 2PBZA 2PVPA 2FPIB 1RK5A 3KXYT 5KFGA 1RYRA 3T1HH 3TW6A 2DPJA 3WO0A 4DR7H 5KFYA 2R92A 4UCSA 3GTGA 3SNOA 3TINA 4QJFA 4U6PA 3HOXG 2HVQA 4O86A 4CC5A 1TWGA 5CAEB 3QZ7A 4GC7A 2VUMA 3BQ1A 4EG0A 5C5JA 4DL2A 1PK8A 2BQRA 5CA1F 4B3TH 1EUDB 1CKNB 5FPRA 2XCPA 2HG8A 1DV2A 5C8YF 2R6FA 5FD6A 5L1IA 2UVRA 3K5HA 2R7ZG 1I2LA 3VPDA 2XD4A 4A3EG 2Y0SE 3KHLA 4J9RA 5JVLA 4QWCA 2R82A 2FPPB 4G3IA 3TIGA 2W57A 2GPSA 2A1HA 3CSWA 2R8HA 5L1LA 2UU9H 4Q8EA 2J9GA 3TY9A 3T7AA 1A9XA 4ECZA 1GSAA 4PZ7A 2X0SA 4FFMA 4IR1A 4F4YA 2GQRA 3QQMA 3TY8A 5GONF 1O75A 5BWTA 5KFIA 5KFLA 4J0MA 4FS1A 4PWQA 4EQ5A 1E4EB 1C30A 2R7ZA 5KFJA 1OBDA 1JDEA 2FE3A 3PW7A 4QWDA 1GSHA 4A3DG 2CFMA 5KFAA 5DLGA 5DGBA 4Q4CA 4DL5A 5BMVF 3DAAA 2IP4A 5JH7F 5DG9A 1S97A 4O2AF 4APMA 2HHHH 2HGSA 4JXUA 2VOBA 3U0GA 3RB4A 1W93A 5KT5A 5I60A 2FMAA 1ULZA 3PR5B 5KFPA 1XMOH 2NU6B 2GQSA 2HHFA 4UCVA 4DUZH 3GLKA 4DR6H 2FK3A 2NVXA 4FFLA 3S24A 5D1OA 4HYKA 1ET0A 2WB1E 4UFZA 4MV7A 4O82A 2COJA 1T94A 3WNZA 1Y1VG 3TIIA 3V4SA 3N40P 5HNEA 5IYDG 2W9CB 1KJ9A 2W6MA 3JSNA 3Q8QB 2YS6A 3K5IA 4ECVA 5L1KA 2YWVA 2ZDGA 4LMYA 4EEYA 4X62H 1G2WA 4BWSC 5KFFA 2W8KA 2CZGA 5JUMA 2W6NA 3V6JA 4LSAA 4DL7A 4IAJA 4YBZB 5L1JA 4MV8A 1EHIA 2Y4RA 3VOTA 5L9XA 4FFPA 4IRCA 1GYFA 3HOZG 1I6UA 3U54A 4X65H 1SFOA 4FE2A 4J9LA 4QWEA 4EBDA 1IYEA 2WDTA 5LMUH 2UUCH 4FFNA 5FLMG 3F8NA 3G6XA 4J9SA 4EYHB 1GO3E 4YJ3F 4AYBA 4A3MG 4AQYH 4IRKA 4JI5H 3RGXA 4RB0A 4EGQA 3R5HA 1N33H 2WYOA 2V5AA 5CA0F 4R7RA 2NVYA 1N36H 4YY3H 5KT2A 3T9AA 5KFVA 3SE7A 2W6PA 2DIKA 2ASLA 5KG3A 1CE8A 4O7NA 4X66H 4J9KA 5IP9G 1DV1A 3K3PA 3KREA 3N6RA 4LH6A 3SGIA 1WR2A 4EEQA 1RJPA 3GTQA 4Q44A 2UXDH 2NU8B 2W6ZA 3LULA 2WAQA 4IRDA 2HIVA 1Z2OX 5LMNH 4CE5A 4A2AA 5KFNA 4J9QA 1S0NA 2X5RA 3AYHB 2UXBH 2W70A 4ME6A 1X9NA 1CS0A 3PW0A 2EJ0A 4ECWA 4Q43A 3KHHA 5H80A 5BR8H 2AQ4A 4CMFA 4A3BG 5KFBA 3WWIA 5J2TF 2JA7G 4ECRA 4RU9A 5EDWA 1C3OA 2VQDA 3UFXB 4DQNA 1UC8A 2GLTA 3Q8SB 3OTOH 5C3EG 3M9OB 5FLXW 4PZ8A 2VQFH 2YZLA 4MTEA 2FK1A 1KJIA 4BBRG 3R5XA 1EZ1A 4NYEA 3C0FB 4RNOA 3PR4A 3M9NB 3I4MG 2R7LA 5DQGA 2R93G 2W9BB 3VNNA 4DR2H 3PN1A 4RUAA 2DABA 1XDNA 3RAXA 3GTPA 3UQ8A 2C2DA 3T1YH 1XMQH 2EJ2A 2JA7A 3W5OA 4O4HF 2XCLA 2C00A 1M0TA 3ETJA 4HNVA 1EKPA 1EUCB 4MV9A 3MFHA 2J6SA 4DRFA 4WBNF 2ZGIA
chains in the Genus database with same CATH topology
4O7YA 1BNCA 1OBGA 3RV4A 4MV6A 4IZOA 1VBGA 2FB9A 5J2UF 2DWCA 5HBRB 1BXRA 5DMXA 1GLVA 4I50F 2FPGB 4ZI7F 3QFFA 1SCUB 4HQ6A 3R5FA 4O7WA 2W6OA 4O7ZA 5JQWA 4XYMB 3G8CA 3WO1A 1KEEA 4O7SA 1EYZA 2SCUB 2YRWA 1T36A 1KJQA 5CB4F 2R7KA 1AUXA 2Z02A 4WD3A 3VPCA 2CQYA 1B6RA 4C5BA 2V58A 5BPHA 2YRXA 1W96A 3NUAA 4XYLB 1CQIB 4O2BF 2NU7B 4FFOA 1PX2A 4MV1A 4O7TA 2CNQA 4IHJF 3R9RA 5LOVF 1JKJB 3Q1KA 4DIMA 3AW8A 5LYJF 2VPQA 1VBHA 2QF7A 2V59A 4O7VA 3LP8A 1JLLB 1JDBB 4Y8VB 3TQTA 3JZFA 1M6VA 3Q2OA 4I55F 2YYAA 3VPBA 4FU0A 1IOWA 1AUVA 4MV4A 4YB8B 2R84A 4TV9F 5LA6F 3AX6A 3KAKA 5C1OA 1E4EA 2YZGA 1B6SA 5I47A 1VKZA 2DZDA 1GGOA 1A48A 2FP4B 2I87A 4O4LF 3U55A 4L1KA 3KALA 4HR7A 2DLNA 4FGRA 3U9TA 4O7LA 1KC7A 3JRWA 3G8DA 3MJFA 3VMMA 3DF7A 2R85A 1KJ8A 1KBLA 1GSOA 4O83A 3MWEA 4E4TA 4O84A 4MA0A 2GPWA 5IYZF 2VR1A 1CQJB 3OUZA 2YZMA 4C5AA 4IWYA 3RFCA 1UC9A 2R86A 4YAJB 3VA7A 3N8DA 3HB9A 5EZYF 1I7LA 5K2MA 3RV3A 1M0WA 4I4TF 4MV3A 2I8CA 2NU9B 4QSHA 2QK4A 4XX0B 2PN1A 5KKNB 4ZHQF 4XZ3B 3ORRA 2P0AA 3BG5A 4FFRA 4O81A 4YAKB 2OLSA 2CNUA 2ZDHA 4O7RA 1IOVA 4M9UA 4MA5A 4TV8F 2I80A 5LXTF 4ZOLF 3U9SA 3ORQA 4IIJF 4YJ2F 4C5CA 4IWXA 2HJWA 5HV6A 3HBLA 3JZIA 3HO8A 3V4ZA 3MWDA 3GIDA 4EGJA 1Z2NX 1Z2PX 4O4IF 4RZQA 3RUPA 3LWBA 4HNUA 3JRXA 2CNVA 3R23A 2W71A 4HNTA 5LP6F 1KUTA 5JQGF 3OUUA 1DIKA 5KX5F 4TUYF 1I7NA 4O4JF 2R7MA 2YS7A 2Z04A 3KAJA 5D8DA 4DLKA 5BPFA 2R87A 2R7NA 2YL2A 3ETHA 5JVDF 3I12A 3E5NA 2ZDQA 5FNVF 2W6QA 2YZNA 2YW2A 1KJJA 4ZQIA 4MAMA 2NUAB 5C1PA 2PBZA 2PVPA 2FPIB 3TW6A 3WO0A 3TINA 4O86A 5CAEB 4EG0A 1PK8A 5CA1F 1EUDB 1DV2A 5C8YF 2R6FA 3K5HA 3VPDA 2XD4A 5JVLA 2R82A 2FPPB 3TIGA 2GPSA 2J9GA 1A9XA 1GSAA 2X0SA 4FFMA 2GQRA 5GONF 1E4EB 1C30A 1OBDA 1JDEA 1GSHA 5BMVF 5JH7F 2IP4A 4O2AF 2HGSA 1W93A 1ULZA 2NU6B 2GQSA 3GLKA 4FFLA 4MV7A 4O82A 3WNZA 3TIIA 3V4SA 1KJ9A 2W6MA 2YS6A 3K5IA 2YWVA 2ZDGA 2CZGA 2W6NA 4YBZB 4MV8A 1EHIA 3VOTA 4FFPA 3U54A 4FE2A 4FFNA 4YJ3F 4EGQA 3R5HA 2WYOA 2V5AA 5CA0F 3SE7A 2W6PA 2DIKA 1CE8A 4O7NA 1DV1A 3K3PA 3KREA 3N6RA 1WR2A 2NU8B 2W6ZA 1Z2OX 2W70A 4ME6A 1CS0A 5H80A 5J2TF 1C3OA 2VQDA 3UFXB 1UC8A 2GLTA 2YZLA 1KJIA 3R5XA 1EZ1A 4NYEA 2R7LA 4O4HF 2XCLA 2C00A 1M0TA 3ETJA 4HNVA 1EUCB 4MV9A 4WBNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7Y A;  1BNC A;  1OBG A;  3RV4 A;  4MV6 A;  4IZO A;  1VBG A;  2FB9 A;  5J2U F;  2DWC A;  5HBR B;  1BXR A;  5DMX A;  1GLV A;  4I50 F;  2FPG B;  4ZI7 F;  3QFF A;  1SCU B;  4HQ6 A;  3R5F A;  4O7W A;  2W6O A;  4O7Z A;  5JQW A;  4XYM B;  3G8C A;  3WO1 A;  1KEE A;  4O7S A;  1EYZ A;  2SCU B;  2YRW A;  1T36 A;  1KJQ A;  5CB4 F;  2R7K A;  1AUX A;  2Z02 A;  4WD3 A;  3VPC A;  2CQY A;  1B6R A;  4C5B A;  2V58 A;  5BPH A;  2YRX A;  1W96 A;  3NUA A;  4XYL B;  1CQI B;  4O2B F;  2NU7 B;  4FFO A;  1PX2 A;  4MV1 A;  4O7T A;  2CNQ A;  4IHJ F;  3R9R A;  5LOV F;  1JKJ B;  3Q1K A;  4DIM A;  3AW8 A;  5LYJ F;  2VPQ A;  1VBH A;  2QF7 A;  2V59 A;  4O7V A;  3LP8 A;  1JLL B;  1JDB B;  4Y8V B;  3TQT A;  3JZF A;  1M6V A;  3Q2O A;  4I55 F;  2YYA A;  3VPB A;  4FU0 A;  1IOW A;  1AUV A;  4MV4 A;  4YB8 B;  2R84 A;  4TV9 F;  5LA6 F;  3AX6 A;  3KAK A;  5C1O A;  1E4E A;  2YZG A;  1B6S A;  5I47 A;  1VKZ A;  2DZD A;  1GGO A;  1A48 A;  2FP4 B;  2I87 A;  4O4L F;  3U55 A;  4L1K A;  3KAL A;  4HR7 A;  2DLN A;  4FGR A;  3U9T A;  4O7L A;  1KC7 A;  3JRW A;  3G8D A;  3MJF A;  3VMM A;  3DF7 A;  2R85 A;  1KJ8 A;  1KBL A;  1GSO A;  4O83 A;  3MWE A;  4E4T A;  4O84 A;  4MA0 A;  2GPW A;  5IYZ F;  2VR1 A;  1CQJ B;  3OUZ A;  2YZM A;  4C5A A;  4IWY A;  3RFC A;  1UC9 A;  2R86 A;  4YAJ B;  3VA7 A;  3N8D A;  3HB9 A;  5EZY F;  1I7L A;  5K2M A;  3RV3 A;  1M0W A;  4I4T F;  4MV3 A;  2I8C A;  2NU9 B;  4QSH A;  2QK4 A;  4XX0 B;  2PN1 A;  5KKN B;  4ZHQ F;  4XZ3 B;  3ORR A;  2P0A A;  3BG5 A;  4FFR A;  4O81 A;  4YAK B;  2OLS A;  2CNU A;  2ZDH A;  4O7R A;  1IOV A;  4M9U A;  4MA5 A;  4TV8 F;  2I80 A;  5LXT F;  4ZOL F;  3U9S A;  3ORQ A;  4IIJ F;  4YJ2 F;  4C5C A;  4IWX A;  2HJW A;  5HV6 A;  3HBL A;  3JZI A;  3HO8 A;  3V4Z A;  3MWD A;  3GID A;  4EGJ A;  1Z2N X;  1Z2P X;  4O4I F;  4RZQ A;  3RUP A;  3LWB A;  4HNU A;  3JRX A;  2CNV A;  3R23 A;  2W71 A;  4HNT A;  5LP6 F;  1KUT A;  5JQG F;  3OUU A;  1DIK A;  5KX5 F;  4TUY F;  1I7N A;  4O4J F;  2R7M A;  2YS7 A;  2Z04 A;  3KAJ A;  5D8D A;  4DLK A;  5BPF A;  2R87 A;  2R7N A;  2YL2 A;  3ETH A;  5JVD F;  3I12 A;  3E5N A;  2ZDQ A;  5FNV F;  2W6Q A;  2YZN A;  2YW2 A;  1KJJ A;  4ZQI A;  4MAM A;  2NUA B;  5C1P A;  2PBZ A;  2PVP A;  2FPI B;  3TW6 A;  3WO0 A;  3TIN A;  4O86 A;  5CAE B;  4EG0 A;  1PK8 A;  5CA1 F;  1EUD B;  1DV2 A;  5C8Y F;  2R6F A;  3K5H A;  3VPD A;  2XD4 A;  5JVL A;  2R82 A;  2FPP B;  3TIG A;  2GPS A;  2J9G A;  1A9X A;  1GSA A;  2X0S A;  4FFM A;  2GQR A;  5GON F;  1E4E B;  1C30 A;  1OBD A;  1JDE A;  1GSH A;  5BMV F;  5JH7 F;  2IP4 A;  4O2A F;  2HGS A;  1W93 A;  1ULZ A;  2NU6 B;  2GQS A;  3GLK A;  4FFL A;  4MV7 A;  4O82 A;  3WNZ A;  3TII A;  3V4S A;  1KJ9 A;  2W6M A;  2YS6 A;  3K5I A;  2YWV A;  2ZDG A;  2CZG A;  2W6N A;  4YBZ B;  4MV8 A;  1EHI A;  3VOT A;  4FFP A;  3U54 A;  4FE2 A;  4FFN A;  4YJ3 F;  4EGQ A;  3R5H A;  2WYO A;  2V5A A;  5CA0 F;  3SE7 A;  2W6P A;  2DIK A;  1CE8 A;  4O7N A;  1DV1 A;  3K3P A;  3KRE A;  3N6R A;  1WR2 A;  2NU8 B;  2W6Z A;  1Z2O X;  2W70 A;  4ME6 A;  1CS0 A;  5H80 A;  5J2T F;  1C3O A;  2VQD A;  3UFX B;  1UC8 A;  2GLT A;  2YZL A;  1KJI A;  3R5X A;  1EZ1 A;  4NYE A;  2R7L A;  4O4H F;  2XCL A;  2C00 A;  1M0T A;  3ETJ A;  4HNV A;  1EUC B;  4MV9 A;  4WBN F; 
#chains in the Genus database with same CATH topology
 5EOY A;  2HGW A;  2VA2 A;  3H4B A;  4O7Y A;  5CR5 A;  5KFW A;  2JA8 G;  4PDB A;  5DQH A;  1BNC A;  2R93 A;  1OBG A;  4TVI A;  4ED3 A;  2BQ3 A;  4JI3 H;  2RGR A;  3GTL A;  3PFF A;  3RV4 A;  4DR3 H;  3HOU G;  4MV6 A;  1TWA A;  1HR0 H;  4MTD A;  4GKJ H;  5EWE A;  1IBK H;  4ECS A;  3OHA A;  4IZO A;  1EKF A;  4DV2 H;  1R9T A;  1VBG A;  1ZAU A;  5CE8 A;  2FB9 A;  5J2U F;  4FS2 A;  4ECY A;  2PMZ A;  4JI7 H;  2DWC A;  4TQR A;  3CVZ A;  1HNX H;  5HBR B;  2UVW A;  1HNZ H;  2XGQ A;  1BXR A;  5K3W A;  5DMX A;  1I1K A;  4PBC A;  1GLV A;  4I50 F;  4CKB A;  2FPG B;  4ZI7 F;  3QFF A;  1SCU B;  1EKV A;  3RTX A;  4RAZ A;  4HQ6 A;  3W1G A;  2EJ3 A;  3R5F A;  4O7W A;  1WRV A;  3GV7 B;  4A3I G;  2UUB H;  4LFC H;  4BXX G;  3FDS A;  2W6O A;  4O7Z A;  5JQW A;  4JI2 H;  3BA8 A;  4XYM B;  2XC9 A;  5I5X A;  2Q7D A;  2V9W A;  4K6N A;  3G8C A;  4DV1 H;  4F4X A;  3WO1 A;  4NZO A;  4TM5 A;  5D1P A;  5KG0 A;  4EBE A;  3OHB A;  4RNN A;  1KEE A;  2F4V H;  4O7S A;  4O3R A;  2UVV A;  1EYZ A;  1S0M A;  4QWA A;  2SCU B;  4YHH H;  2YRW A;  1T36 A;  1KJQ A;  2UVU A;  1S68 A;  3RGZ A;  1S9F A;  3IN5 A;  4ED2 A;  2JEJ A;  5I5U A;  1WSC A;  1N34 H;  3QWU A;  3PW5 A;  1E4G T;  5CB4 F;  3GIJ A;  4ECQ A;  1XNQ H;  2R7K A;  4LH7 A;  5KT3 A;  5KFO A;  4DV7 H;  3NGD A;  1AUX A;  3RB6 A;  1S10 A;  2Z02 A;  3PO2 G;  4AYB E;  4WD3 A;  1TA8 A;  4Q45 A;  3VPC A;  2VPS A;  3RB0 A;  2CQY A;  1B6R A;  4C5B A;  2W9A A;  4DR4 H;  2V58 A;  5BPH A;  3MR2 A;  4YP3 A;  4DV3 H;  3H4D A;  2YRX A;  1W96 A;  4DL4 A;  4LF6 H;  1OWT A;  2C2R A;  3NUA A;  4FBU A;  4XYL B;  4DV4 H;  1CQI B;  4K0K H;  3EYY A;  1A0G A;  3TQ1 A;  2FLN A;  3N6X A;  4O2B F;  5KFR A;  2WAQ E;  2NU7 B;  1ZHQ A;  3RAQ A;  1P8L A;  4FFO A;  3EPI A;  5KFQ A;  5KFC A;  3BQ0 A;  1DAA A;  4JYA H;  3GII A;  5KS8 A;  4A2B A;  2JEG A;  1PX2 A;  1BGW A;  4Q8F A;  4MV1 A;  4O7T A;  1IBL H;  2CNQ A;  1FKA H;  4UCU A;  2IA6 A;  1FVI A;  4JI8 H;  5DIS C;  2JA5 G;  4R8U A;  4IHJ F;  3R9R A;  3PW2 A;  5LOV F;  3GB8 B;  1Y1V A;  3L4J A;  3T5L A;  2HVR A;  5IP7 G;  1JKJ B;  3Q1K A;  2UXC H;  5KFU A;  4DIM A;  2VQE H;  1DGS A;  3AW8 A;  1KT8 A;  5LYJ F;  1V51 A;  4A3L G;  2WTF A;  5KFD A;  1K1S A;  1RK6 A;  1ZHS A;  4Q4D A;  2VPQ A;  3G6V A;  5FD5 A;  1RYS A;  4LSX A;  4ED0 A;  1ZET A;  1VBH A;  2JA5 A;  3HT5 A;  3V6H A;  3T5J A;  1UNN C;  2QF7 A;  3KHG A;  2V59 A;  2COI A;  1S0O A;  4O7V A;  1N48 A;  3LP8 A;  4O3N A;  4O3O A;  1S03 G;  3T5K A;  4QIW E;  4B3S H;  4YR0 A;  5DAA A;  1CKM A;  1JLL B;  1JDB B;  4EFE A;  5BYB A;  1ZQ7 A;  2C2E A;  2IMW P;  3NBY B;  4Y8V B;  4NXM H;  3TQT A;  3JZF A;  1V4Y A;  1M6V A;  5DGH A;  5FPO A;  1RJR A;  1SEI A;  1N56 A;  4U7C A;  4DV0 H;  5EWG A;  2E5L H;  2IBK A;  2R8K A;  3T9C A;  4I7H A;  4QWB A;  4GKK H;  3Q2O A;  4I55 F;  2YYA A;  3VPB A;  3J81 W;  3BAC A;  3RBD A;  4JV2 A;  4FU0 A;  2M05 A;  4OX9 H;  4ED7 A;  1TAE A;  2PMZ E;  5KG2 A;  3PZP A;  2BQU A;  4A3C G;  1IOW A;  2B63 G;  2ZM6 H;  1AUV A;  3CQZ A;  4RB2 C;  2EIY A;  4MV4 A;  5F9N A;  2J6U A;  4DAA A;  3HOY G;  4YB8 B;  2R84 A;  3GTO A;  2B63 A;  5BWX A;  2HHF B;  4TV9 F;  4CHI A;  5LA6 F;  3N44 B;  3DTG A;  5E25 A;  4EYI B;  3RBE A;  3MR6 A;  3PW4 A;  4Q0Y A;  3AX6 A;  4A3K G;  3KAK A;  3QZ8 A;  3RF2 A;  5D1O B;  3GV5 B;  4HN2 A;  5DQI A;  3HOW G;  5C1O A;  5KG1 A;  2ASD A;  1E4E A;  1MZB A;  4J9O A;  2V4Q A;  3IG0 A;  1I3Q A;  4QIW A;  2QYZ A;  3JAM W;  4UCR A;  3H40 A;  4FBT A;  3T9D A;  4C2M A;  2YZG A;  1B6S A;  2FK2 A;  5I47 A;  3MFI A;  4EBC A;  1VKZ A;  2DZD A;  3W1B A;  5KG4 A;  4ED1 A;  5BWV A;  2WE6 A;  1GGO A;  1A48 A;  2FP4 B;  2I87 A;  4O4L F;  3U55 A;  1VAJ A;  1TWC A;  3HKZ E;  4JV0 A;  4L1K A;  5C44 G;  2XCA A;  3KAL A;  2C22 A;  4HR7 A;  4A3F G;  2DLN A;  4UCO A;  4LF7 H;  4FGR A;  2HVS A;  5I5Y A;  3U9T A;  4O7L A;  1KC7 A;  3JRW A;  1VS0 A;  3G8D A;  3LML A;  3MJF A;  4JUZ A;  4ECU A;  1P16 A;  3VMM A;  4M7E A;  3DF7 A;  4A3G G;  2R85 A;  1KJ8 A;  2DPI A;  2JA6 G;  1CKO A;  1KBL A;  4JI6 H;  1SYX B;  2W9C A;  1GSO A;  5KFK A;  4PZ6 A;  5I5T A;  5KFH A;  3GIK A;  2RDI A;  2AGP A;  4O83 A;  4LF8 H;  3MWE A;  4E4T A;  4O84 A;  4MA0 A;  5BYA A;  4F4Z A;  1FJG H;  2GPW A;  1TWF A;  5IYZ F;  1JXL A;  2VR1 A;  3WWH A;  1Y14 B;  1CQJ B;  3OUZ A;  4J9M A;  2UUA H;  4LFA H;  4RCN A;  2YZM A;  2FKL A;  4C5A A;  4IWY A;  3OSP A;  5I5W A;  3RFC A;  2JA6 A;  4JI4 H;  1UC9 A;  5CM0 A;  2R86 A;  3NBZ B;  1JX4 A;  4A93 G;  4YAJ B;  4UCT A;  3VA7 A;  4ETS A;  3N8D A;  3GIP A;  3HKZ A;  2JEI A;  3M9M B;  3HB9 A;  3BA9 A;  1WCM G;  5EZY F;  1I7L A;  5K2M A;  2W7O A;  5F9L A;  3RJ0 A;  4WHX A;  2KSW A;  3RV3 A;  4TQS A;  1M0W A;  4I4T F;  4MV3 A;  3UZO A;  5I5V A;  5KFS A;  4YR2 A;  3JSL A;  2R8I A;  3N42 B;  4M0J A;  1I1M A;  2I8C A;  3T9F A;  2NU9 B;  1M7J A;  1I2K A;  2O03 A;  4QSH A;  4RB3 C;  3BAB A;  3GJX B;  3CEB A;  4DUY H;  3GIM A;  4DL3 A;  2QK4 A;  2HGX A;  3GIL A;  5KFZ A;  4NXN H;  4BY7 G;  3RIZ A;  4XX0 B;  4JI0 H;  2PN1 A;  1WCM A;  3G6Y A;  4BBS G;  3T54 A;  1IYD A;  5KKN B;  4RB1 A;  3OSN A;  2CW8 A;  1TWH A;  2BR0 A;  5DG7 A;  5IYB G;  4QW9 A;  4ZHQ F;  2VUG A;  4XZ3 B;  3ORR A;  5BWR A;  3H0G G;  2R8G A;  3I4N G;  4GC6 A;  3RB3 A;  3GQC A;  2P0A A;  4E6N A;  3H3V H;  3BG5 A;  4FFR A;  5DLF A;  4NLG A;  4O81 A;  5KG5 A;  3NC0 B;  1WH2 A;  2MCT A;  2AGQ A;  1K83 A;  2HIX A;  4YAK B;  2OLS A;  3L2P A;  1I50 A;  2ATL A;  5C4X G;  2W9B A;  5BWU A;  3PVX A;  2CNU A;  2ZDH A;  5KFM A;  4O7R A;  1IOV A;  4KHP H;  5KFT A;  5LL6 b;  4M9U A;  4J9N A;  2Y0S A;  3BAA A;  4MA5 A;  1XK5 A;  3H0G A;  4RNM A;  4TV8 F;  1Y1W G;  3RR5 A;  3TW7 A;  2I80 A;  5LXT F;  5A2Q W;  5T14 A;  1I94 H;  3HXL A;  3N41 B;  4LFB H;  3Q8P B;  1L2Z A;  2XGP A;  4IR9 A;  4ZOL F;  1I1L A;  3TY5 A;  4CKE A;  4ECX A;  4FM9 A;  3U9S A;  3ORQ A;  4O3S A;  5FJ8 G;  4IIJ F;  4DV5 H;  4YJ2 F;  5KFX A;  4C5C A;  1T3N A;  2RF4 A;  4LF9 H;  3GIQ A;  1N32 H;  3V6K A;  4IWX A;  2FLL A;  2HJW A;  1JIH A;  2OH2 A;  2ZJT A;  3T99 A;  5HV6 A;  4DR1 H;  3EPG A;  4EFB A;  2W8L A;  3LQS A;  3GTJ A;  4B3R H;  3HBL A;  5I5S A;  1B04 A;  2FJZ A;  3JZI A;  2YU9 A;  4JV5 H;  5IT9 W;  3HO8 A;  4GLW A;  5DGA A;  2JEF A;  2COG A;  3V4Z A;  2E2H A;  2CW7 A;  3MWD A;  3T9E A;  2C35 B;  3GID A;  4X64 H;  1BJT A;  2OWO A;  5IYC G;  3MR5 A;  3KHR A;  2AGO A;  5KG7 A;  4EGJ A;  3FMA A;  1HNW H;  1CKN A;  4F50 A;  1Z2N X;  4A3J G;  3JZ6 A;  3MWM A;  4ED6 A;  4CC6 A;  5DG8 A;  1Z2P X;  2V4R A;  3UYY A;  3N43 B;  3FKI G;  4O4I F;  4O3Q A;  2QB5 A;  3SI8 A;  4RZQ A;  5KT4 A;  3RUP A;  4YR3 A;  4GLX A;  2ASJ A;  4JI1 H;  3L4K A;  2WB1 A;  1A3G A;  3J80 W;  3LWB A;  4UUG A;  3JRX A;  4HNU A;  5BWW A;  2CNV A;  2Q2T A;  5KG6 A;  3Q8R B;  3R23 A;  3BQ2 A;  1J5E H;  2W71 A;  3T9B A;  3J7A K;  3GDE A;  4NZN A;  4HNT A;  5LP6 F;  1RJQ A;  3WWJ A;  4CKC A;  4LF4 H;  1E4F T;  3BJY A;  1KUT A;  2ALZ A;  5KFE A;  5JQG F;  1K1Q A;  3OUU A;  2CKZ B;  3UZB A;  4J9P A;  4F4W A;  4DR5 H;  2HDK A;  4LF5 H;  3FKI A;  3MR3 A;  5KT6 A;  2C28 A;  1DIK A;  3GTM A;  5KX5 F;  2J6T A;  4TUY F;  1I7N A;  1V9P A;  5KT7 A;  4O4J F;  2R7M A;  2YS7 A;  2VA3 A;  2Z04 A;  4DV6 H;  4B3M H;  3H20 A;  3KAJ A;  5FR9 A;  2Q2U A;  2FLP A;  1Y1W A;  5D8D A;  4DLK A;  5BPF A;  2XIG A;  5EWF A;  4NZM A;  2R87 A;  1B33 N;  2R7N A;  4DL6 A;  2ODT X;  1A0I A;  4R8U B;  4ED8 A;  4RUC A;  3GTK A;  4YQW A;  4CMD A;  2R8J A;  3PO3 G;  5DGI A;  1KTA A;  3GV8 B;  3T5H A;  2R92 G;  2YL2 A;  3KYH C;  1XNR H;  3ETH A;  4BY1 G;  5JVD F;  3I12 A;  3E5N A;  2ZDQ A;  5FNV F;  2YCH A;  2W6Q A;  2AU0 A;  2VUM G;  3M4I A;  4O3P A;  4RAY A;  2RGV A;  2YZN A;  3TEK A;  4ECT A;  2YW2 A;  1KJJ A;  3KTM A;  4RZR A;  4JV1 A;  2DAA A;  4MAM A;  4ZQI A;  2NUA B;  4QW8 A;  3HOV G;  2RDJ A;  5IWA H;  1AN7 A;  2W7P A;  2E2I A;  5C1P A;  3K3V A;  3DTF A;  2ABJ A;  1IBM H;  2PBZ A;  2PVP A;  2FPI B;  1RK5 A;  3KXY T;  5KFG A;  1RYR A;  3T1H H;  3TW6 A;  2DPJ A;  3WO0 A;  4DR7 H;  5KFY A;  2R92 A;  4UCS A;  3GTG A;  3SNO A;  3TIN A;  4QJF A;  4U6P A;  3HOX G;  2HVQ A;  4O86 A;  4CC5 A;  1TWG A;  5CAE B;  3QZ7 A;  4GC7 A;  2VUM A;  3BQ1 A;  4EG0 A;  5C5J A;  4DL2 A;  1PK8 A;  2BQR A;  5CA1 F;  4B3T H;  1EUD B;  1CKN B;  5FPR A;  2XCP A;  2HG8 A;  1DV2 A;  5C8Y F;  2R6F A;  5FD6 A;  5L1I A;  2UVR A;  3K5H A;  2R7Z G;  1I2L A;  3VPD A;  2XD4 A;  4A3E G;  2Y0S E;  3KHL A;  4J9R A;  5JVL A;  4QWC A;  2R82 A;  2FPP B;  4G3I A;  3TIG A;  2W57 A;  2GPS A;  2A1H A;  3CSW A;  2R8H A;  5L1L A;  2UU9 H;  4Q8E A;  2J9G A;  3TY9 A;  3T7A A;  1A9X A;  4ECZ A;  1GSA A;  4PZ7 A;  2X0S A;  4FFM A;  4IR1 A;  4F4Y A;  2GQR A;  3QQM A;  3TY8 A;  5GON F;  1O75 A;  5BWT A;  5KFI A;  5KFL A;  4J0M A;  4FS1 A;  4PWQ A;  4EQ5 A;  1E4E B;  1C30 A;  2R7Z A;  5KFJ A;  1OBD A;  1JDE A;  2FE3 A;  3PW7 A;  4QWD A;  1GSH A;  4A3D G;  2CFM A;  5KFA A;  5DLG A;  5DGB A;  4Q4C A;  4DL5 A;  5BMV F;  3DAA A;  2IP4 A;  5JH7 F;  5DG9 A;  1S97 A;  4O2A F;  4APM A;  2HHH H;  2HGS A;  4JXU A;  2VOB A;  3U0G A;  3RB4 A;  1W93 A;  5KT5 A;  5I60 A;  2FMA A;  1ULZ A;  3PR5 B;  5KFP A;  1XMO H;  2NU6 B;  2GQS A;  2HHF A;  4UCV A;  4DUZ H;  3GLK A;  4DR6 H;  2FK3 A;  2NVX A;  4FFL A;  3S24 A;  5D1O A;  4HYK A;  1ET0 A;  2WB1 E;  4UFZ A;  4MV7 A;  4O82 A;  2COJ A;  1T94 A;  3WNZ A;  1Y1V G;  3TII A;  3V4S A;  3N40 P;  5HNE A;  5IYD G;  2W9C B;  1KJ9 A;  2W6M A;  3JSN A;  3Q8Q B;  2YS6 A;  3K5I A;  4ECV A;  5L1K A;  2YWV A;  2ZDG A;  4LMY A;  4EEY A;  4X62 H;  1G2W A;  4BWS C;  5KFF A;  2W8K A;  2CZG A;  5JUM A;  2W6N A;  3V6J A;  4LSA A;  4DL7 A;  4IAJ A;  4YBZ B;  5L1J A;  4MV8 A;  1EHI A;  2Y4R A;  3VOT A;  5L9X A;  4FFP A;  4IRC A;  1GYF A;  3HOZ G;  1I6U A;  3U54 A;  4X65 H;  1SFO A;  4FE2 A;  4J9L A;  4QWE A;  4EBD A;  1IYE A;  2WDT A;  5LMU H;  2UUC H;  4FFN A;  5FLM G;  3F8N A;  3G6X A;  4J9S A;  4EYH B;  1GO3 E;  4YJ3 F;  4AYB A;  4A3M G;  4AQY H;  4IRK A;  4JI5 H;  3RGX A;  4RB0 A;  4EGQ A;  3R5H A;  1N33 H;  2WYO A;  2V5A A;  5CA0 F;  4R7R A;  2NVY A;  1N36 H;  4YY3 H;  5KT2 A;  3T9A A;  5KFV A;  3SE7 A;  2W6P A;  2DIK A;  2ASL A;  5KG3 A;  1CE8 A;  4O7N A;  4X66 H;  4J9K A;  5IP9 G;  1DV1 A;  3K3P A;  3KRE A;  3N6R A;  4LH6 A;  3SGI A;  1WR2 A;  4EEQ A;  1RJP A;  3GTQ A;  4Q44 A;  2UXD H;  2NU8 B;  2W6Z A;  3LUL A;  2WAQ A;  4IRD A;  2HIV A;  1Z2O X;  5LMN H;  4CE5 A;  4A2A A;  5KFN A;  4J9Q A;  1S0N A;  2X5R A;  3AYH B;  2UXB H;  2W70 A;  4ME6 A;  1X9N A;  1CS0 A;  3PW0 A;  2EJ0 A;  4ECW A;  4Q43 A;  3KHH A;  5H80 A;  5BR8 H;  2AQ4 A;  4CMF A;  4A3B G;  5KFB A;  3WWI A;  5J2T F;  2JA7 G;  4ECR A;  4RU9 A;  5EDW A;  1C3O A;  2VQD A;  3UFX B;  4DQN A;  1UC8 A;  2GLT A;  3Q8S B;  3OTO H;  5C3E G;  3M9O B;  5FLX W;  4PZ8 A;  2VQF H;  2YZL A;  4MTE A;  2FK1 A;  1KJI A;  4BBR G;  3R5X A;  1EZ1 A;  4NYE A;  3C0F B;  4RNO A;  3PR4 A;  3M9N B;  3I4M G;  2R7L A;  5DQG A;  2R93 G;  2W9B B;  3VNN A;  4DR2 H;  3PN1 A;  4RUA A;  2DAB A;  1XDN A;  3RAX A;  3GTP A;  3UQ8 A;  2C2D A;  3T1Y H;  1XMQ H;  2EJ2 A;  2JA7 A;  3W5O A;  4O4H F;  2XCL A;  2C00 A;  1M0T A;  3ETJ A;  4HNV A;  1EKP A;  1EUC B;  4MV9 A;  3MFH A;  2J6S A;  4DRF A;  4WBN F;  2ZGI A; 
#chains in the Genus database with same CATH homology
 4O7Y A;  1BNC A;  1OBG A;  3RV4 A;  4MV6 A;  4IZO A;  1VBG A;  2FB9 A;  5J2U F;  2DWC A;  5HBR B;  1BXR A;  5DMX A;  1GLV A;  4I50 F;  2FPG B;  4ZI7 F;  3QFF A;  1SCU B;  4HQ6 A;  3R5F A;  4O7W A;  2W6O A;  4O7Z A;  5JQW A;  4XYM B;  3G8C A;  3WO1 A;  1KEE A;  4O7S A;  1EYZ A;  2SCU B;  2YRW A;  1T36 A;  1KJQ A;  5CB4 F;  2R7K A;  1AUX A;  2Z02 A;  4WD3 A;  3VPC A;  2CQY A;  1B6R A;  4C5B A;  2V58 A;  5BPH A;  2YRX A;  1W96 A;  3NUA A;  4XYL B;  1CQI B;  4O2B F;  2NU7 B;  4FFO A;  1PX2 A;  4MV1 A;  4O7T A;  2CNQ A;  4IHJ F;  3R9R A;  5LOV F;  1JKJ B;  3Q1K A;  4DIM A;  3AW8 A;  5LYJ F;  2VPQ A;  1VBH A;  2QF7 A;  2V59 A;  4O7V A;  3LP8 A;  1JLL B;  1JDB B;  4Y8V B;  3TQT A;  3JZF A;  1M6V A;  3Q2O A;  4I55 F;  2YYA A;  3VPB A;  4FU0 A;  1IOW A;  1AUV A;  4MV4 A;  4YB8 B;  2R84 A;  4TV9 F;  5LA6 F;  3AX6 A;  3KAK A;  5C1O A;  1E4E A;  2YZG A;  1B6S A;  5I47 A;  1VKZ A;  2DZD A;  1GGO A;  1A48 A;  2FP4 B;  2I87 A;  4O4L F;  3U55 A;  4L1K A;  3KAL A;  4HR7 A;  2DLN A;  4FGR A;  3U9T A;  4O7L A;  1KC7 A;  3JRW A;  3G8D A;  3MJF A;  3VMM A;  3DF7 A;  2R85 A;  1KJ8 A;  1KBL A;  1GSO A;  4O83 A;  3MWE A;  4E4T A;  4O84 A;  4MA0 A;  2GPW A;  5IYZ F;  2VR1 A;  1CQJ B;  3OUZ A;  2YZM A;  4C5A A;  4IWY A;  3RFC A;  1UC9 A;  2R86 A;  4YAJ B;  3VA7 A;  3N8D A;  3HB9 A;  5EZY F;  1I7L A;  5K2M A;  3RV3 A;  1M0W A;  4I4T F;  4MV3 A;  2I8C A;  2NU9 B;  4QSH A;  2QK4 A;  4XX0 B;  2PN1 A;  5KKN B;  4ZHQ F;  4XZ3 B;  3ORR A;  2P0A A;  3BG5 A;  4FFR A;  4O81 A;  4YAK B;  2OLS A;  2CNU A;  2ZDH A;  4O7R A;  1IOV A;  4M9U A;  4MA5 A;  4TV8 F;  2I80 A;  5LXT F;  4ZOL F;  3U9S A;  3ORQ A;  4IIJ F;  4YJ2 F;  4C5C A;  4IWX A;  2HJW A;  5HV6 A;  3HBL A;  3JZI A;  3HO8 A;  3V4Z A;  3MWD A;  3GID A;  4EGJ A;  1Z2N X;  1Z2P X;  4O4I F;  4RZQ A;  3RUP A;  3LWB A;  4HNU A;  3JRX A;  2CNV A;  3R23 A;  2W71 A;  4HNT A;  5LP6 F;  1KUT A;  5JQG F;  3OUU A;  1DIK A;  5KX5 F;  4TUY F;  1I7N A;  4O4J F;  2R7M A;  2YS7 A;  2Z04 A;  3KAJ A;  5D8D A;  4DLK A;  5BPF A;  2R87 A;  2R7N A;  2YL2 A;  3ETH A;  5JVD F;  3I12 A;  3E5N A;  2ZDQ A;  5FNV F;  2W6Q A;  2YZN A;  2YW2 A;  1KJJ A;  4ZQI A;  4MAM A;  2NUA B;  5C1P A;  2PBZ A;  2PVP A;  2FPI B;  3TW6 A;  3WO0 A;  3TIN A;  4O86 A;  5CAE B;  4EG0 A;  1PK8 A;  5CA1 F;  1EUD B;  1DV2 A;  5C8Y F;  2R6F A;  3K5H A;  3VPD A;  2XD4 A;  5JVL A;  2R82 A;  2FPP B;  3TIG A;  2GPS A;  2J9G A;  1A9X A;  1GSA A;  2X0S A;  4FFM A;  2GQR A;  5GON F;  1E4E B;  1C30 A;  1OBD A;  1JDE A;  1GSH A;  5BMV F;  5JH7 F;  2IP4 A;  4O2A F;  2HGS A;  1W93 A;  1ULZ A;  2NU6 B;  2GQS A;  3GLK A;  4FFL A;  4MV7 A;  4O82 A;  3WNZ A;  3TII A;  3V4S A;  1KJ9 A;  2W6M A;  2YS6 A;  3K5I A;  2YWV A;  2ZDG A;  2CZG A;  2W6N A;  4YBZ B;  4MV8 A;  1EHI A;  3VOT A;  4FFP A;  3U54 A;  4FE2 A;  4FFN A;  4YJ3 F;  4EGQ A;  3R5H A;  2WYO A;  2V5A A;  5CA0 F;  3SE7 A;  2W6P A;  2DIK A;  1CE8 A;  4O7N A;  1DV1 A;  3K3P A;  3KRE A;  3N6R A;  1WR2 A;  2NU8 B;  2W6Z A;  1Z2O X;  2W70 A;  4ME6 A;  1CS0 A;  5H80 A;  5J2T F;  1C3O A;  2VQD A;  3UFX B;  1UC8 A;  2GLT A;  2YZL A;  1KJI A;  3R5X A;  1EZ1 A;  4NYE A;  2R7L A;  4O4H F;  2XCL A;  2C00 A;  1M0T A;  3ETJ A;  4HNV A;  1EUC B;  4MV9 A;  4WBN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...