4Y8VB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha subunit of acetyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
molecule tags Transferase
total genus 76
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4y8vB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4y8vB02
2YZNA 1E4EA 3VOTA 3VPBA 2GPWA 2W6OA 1DV2A 4HNVA 5IYZF 3TIGA 3R23A 1CQJB 3MWDA 4O7WA 3MJFA 3SE7A 3WO0A 4YAKB 4MV1A 1GSHA 1KJJA 4O4HF 3HBLA 2I87A 3OUZA 3JZFA 1JLLB 3UFXB 2YZMA 3V4SA 2I8CA 1EUCB 4FFNA 5JVDF 1KBLA 2PBZA 1M0WA 4MA5A 2DLNA 1SCUB 2YRXA 5H80A 2FPGB 2C00A 3K3PA 2XCLA 4RZQA 1CE8A 4XYMB 4MV7A 4Y8VB 3GLKA 2NU8B 5J2TF 2X0SA 4YAJB 4IWXA 2J9GA 3U55A 4O4LF 2QF7A 3WNZA 5DMXA 3RFCA 4O2BF 5LOVF 4NYEA 4O4IF 2FPIB 4ZHQF 2V58A 3G8CA 3TW6A 4TV8F 3HO8A 2YW2A 4MA0A 3U9SA 2YZGA 1JKJB 5JQGF 1KJ8A 2Z04A 3BG5A 3ORRA 5LP6F 4O7RA 3N6RA 5JVLA 2VQDA 4O7TA 2OLSA 2ZDHA 3I12A 4TUYF 2YS7A 5CA1F 4EGJA 4O82A 2YYAA 2CQYA 5EZYF 1OBGA 3Q2OA 2YS6A 1M0TA 2YWVA 2ZDGA 2R7MA 1B6SA 1VBHA 4IHJF 3LP8A 5I47A 4MAMA 4HQ6A 2P0AA 3G8DA 4YJ3F 1UC8A 3NUAA 2W6PA 4WBNF 2YRWA 1W93A 3DF7A 4O7LA 3AX6A 5JH7F 1Z2NX 4C5AA 1KJ9A 3KALA 4O84A 3K5IA 4O81A 4FFRA 1CQIB 2DIKA 5C1PA 2HJWA 3KAJA 5CB4F 2FPPB 3MWEA 1W96A 1DV1A 2I80A 3R5XA 3VA7A 1Z2PX 2XD4A 2NU7B 5C1OA 3JRXA 4ZOLF 4XZ3B 5LA6F 1EUDB 1BXRA 2R7NA 4XX0B 1C30A 1GLVA 1AUXA 5KX5F 3VPDA 2R7KA 1I7LA 1IOWA 2VPQA 1T36A 4O83A 1KEEA 5GONF 1GGOA 3AW8A 1EZ1A 3RV4A 1JDEA 4O7SA 2R7LA 3R5FA 3WO1A 2NU9B 4O7YA 4I50F 5HV6A 5K2MA 4O7NA 4MV9A 3HB9A 4YB8B 4M9UA 1PK8A 2GLTA 3RV3A 2QK4A 1OBDA 2CNQA 4ME6A 3U9TA 1UC9A 3TINA 4WD3A 2NU6B 5LXTF 3VMMA 2NUAB 4I55F 1I7NA 3TQTA 1B6RA 3ETJA 5J2UF 4EGQA 1JDBB 3KAKA 1DIKA 3LWBA 4L1KA 1BNCA 4IWYA 3ORQA 2R6FA 2WYOA 3ETHA 3GIDA 4I4TF 3JZIA 2W6ZA 1EHIA 1CS0A 2W6NA 1Z2OX 5JQWA 2HGSA 4ZI7F 4EG0A 3E5NA 1PX2A 2GQSA 2GPSA 3KREA 1VKZA 4C5BA 1E4EB 2DWCA 3QFFA 4O7VA 2VR1A 2PVPA 4O7ZA 4ZQIA 4FFPA 4FU0A 4FFMA 4DLKA 5CA0F 3N8DA 2CNVA 5BMVF 2SCUB 3Q1KA 4O86A 5BPFA 2V5AA 4FE2A 5D8DA 4QSHA 4IIJF 4MV6A 2ZDQA 2YZLA 2W71A 1ULZA 4TV9F 3K5HA 1EYZA 5FNVF 2PN1A 4IZOA 4FFOA 5BPHA 1GSAA 1VBGA 4YBZB 4DIMA 5CAEB 2YL2A 4MV3A 4HR7A 5C8YF 1WR2A 3RUPA 4C5CA 1IOVA 1GSOA 3VPCA 4O2AF 2R86A 4FGRA 5HBRB 3U54A 1A48A 3R5HA 1C3OA 2W70A 1KJQA 5KKNB 2R82A 4HNUA 4O4JF 2GQRA 4MV4A 2V59A 4MV8A 2W6MA 2CNUA 3V4ZA 3JRWA 3OUUA 1A9XA 2CZGA 1AUVA 1KC7A 4FFLA 4E4TA 2Z02A 4HNTA 2DZDA 2R87A 5LYJF 4YJ2F 2FB9A 1KUTA 3TIIA 1KJIA 2FP4B 1M6VA 2R85A 2IP4A 4XYLB 2R84A 2W6QA 3R9RA
chains in the Genus database with same CATH superfamily
2HIVA 4JI4H 5DGBA 2BR0A 3RB6A 1A0IA 5IP9G 2YZNA 1E4EA 3VOTA 3RR5A 3VPBA 4ECQA 1J5EH 3T9AA 2GPWA 4JV2A 1WRVA 3NBYB 4DV5H 2W6OA 3GIQA 3T5HA 5KG0A 1I2LA 3UQ8A 5KFMA 1DV2A 4GC6A 2JA5G 2R93G 4LH7A 2HVSA 3QZ8A 4LFCH 1Y1WA 2JA7A 5DQHA 2R8GA 4O3NA 4HNVA 4UUGA 5IYZF 4Q45A 1A0GA 3TIGA 4YY3H 3R23A 4UCVA 5F9NA 1CQJB 3MWDA 4AQYH 4GKKH 2EJ2A 4J9RA 5KFOA 3JSLA 1FVIA 4O7WA 3F8NA 3HKZE 4A3JG 3VNNA 4O3RA 3MJFA 3MR2A 4O3OA 3OSPA 5EWGA 1IBKH 3T9FA 3SE7A 2AGPA 3TY5A 3WO0A 4RNNA 4MTDA 5KFDA 4A3EG 1SFOA 2V4RA 5BWWA 3FDSA 4QJFA 4B3RH 4UCSA 4MV1A 4YAKB 5L1IA 1XNQH 1GSHA 1IYDA 1KJJA 4O4HF 1XMQH 2ASLA 3HBLA 2I87A 5KG4A 5L1JA 1CKOA 1E4GT 1V51A 2X5RA 3AYHB 3OUZA 3T1YH 2FLPA 3GTQA 3PVXA 2HHHH 3JZFA 2VPSA 1JLLB 3TEKA 5A2QW 2JA6A 3BA8A 3UFXB 3RBEA 5BWTA 1P8LA 4DAAA 5DGHA 3NGDA 4ETSA 2YZMA 1G2WA 4RCNA 4YQWA 4YR2A 4ECWA 4G3IA 2DABA 4A2BA 5KG3A 3V6KA 3V4SA 2I8CA 4AYBA 3T9CA 2B63G 4Q8FA 1EUCB 4FFNA 5KFPA 5KFZA 4FBTA 5JVDF 1X9NA 2WB1A 2E2HA 1KBLA 2PBZA 1M0WA 3GJXB 5KFBA 4DQNA 4UCTA 4YP3A 4MA5A 3GV8B 4JI8H 4GLXA 1N32H 4QWBA 2FK1A 2DLNA 1SCUB 2WAQE 2BQRA 4EFBA 4LF5H 2YRXA 5H80A 3N6XA 3LQSA 4I7HA 4JI0H 2FPGB 2C00A 3FKIA 1TWCA 1I94H 2C2EA 3G6VA 4X62H 3K3PA 1KT8A 2XCLA 2W57A 3JAMW 1SEIA 5FLXW 4RAYA 4DV4H 4DR6H 5EWEA 1T94A 4RZQA 4F4XA 1S0OA 1CE8A 4J9QA 3W1BA 4XYMB 2C22A 3PW0A 4MV7A 3RF2A 4J0MA 3GIKA 4OX9H 2JA8G 4Y8VB 4TM5A 3WWIA 4NZOA 3RAQA 4EBDA 3GLKA 3W1GA 2ASJA 5DGIA 2NU8B 1SYXB 5J2TF 1I3QA 2X0SA 3HT5A 2M05A 3RGXA 4IWXA 4YAJB 1RYRA 2J9GA 3U55A 4O4LF 3KHHA 3BQ2A 2QF7A 3WNZA 5DMXA 3RFCA 5KFHA 2UU9H 4A3CG 4BWSC 5FR9A 1HR0H 5KG1A 4O2BF 5LOVF 4DR3H 5LMNH 3OHAA 2UUBH 4NYEA 4DR1H 3PFFA 4O4IF 2FJZA 4JI2H 5F9LA 2FPIB 4ZHQF 1K83A 4DV6H 3PR5B 2V58A 4Q4CA 3G8CA 3GIMA 4A3KG 2W9CB 3BQ1A 2HG8A 4CC6A 4RZRA 3TW6A 4TV8F 3HO8A 2YW2A 4MA0A 3U9SA 1RJQA 5KFSA 2YZGA 2R8JA 1JKJB 5JQGF 4FM9A 2VQFH 5KT4A 2FKLA 3M4IA 1KJ8A 2Z04A 1UNNC 3DTGA 3BG5A 4IR9A 5IYCG 3ORRA 3QWUA 2COJA 4O3PA 2W9BA 4CKBA 4BY7G 4BXXG 3DTFA 4O7RA 5LP6F 4ECRA 5FJ8G 4Q8EA 3N6RA 5JVLA 2VQDA 4O7TA 3SNOA 2OLSA 2ZDHA 3I12A 5EWFA 2ALZA 4QWEA 4TUYF 2YS7A 5CA1F 1S68A 4EGJA 3M9NB 1DAAA 2CKZB 4TQRA 4O82A 2YYAA 5KFVA 2OH2A 2RGRA 5EDWA 4LF9H 4A93G 5BWXA 2CQYA 3T7AA 5I5WA 4RUAA 2Y4RA 2JA5A 2R93A 5DLGA 3PW7A 2W9BB 2Q2TA 5EZYF 3MFHA 4ED1A 5DLFA 2A1HA 1OBGA 3Q2OA 4HN2A 2YS6A 3PN1A 4M7EA 1I1MA 1M0TA 4CKCA 3RTXA 2ZGIA 2YWVA 2ZDGA 4J9SA 2R7MA 4BBSG 4A3FG 1B6SA 5BR8H 1VBHA 4IHJF 1WSCA 3HXLA 3LP8A 3OHBA 3L4JA 3HOZG 4CC5A 1VS0A 5I47A 3PW4A 1IBLH 4MAMA 4HQ6A 4Q44A 3EPGA 3MR6A 4UFZA 1I50A 4CKEA 2P0AA 3HOYG 5FPOA 3G8DA 1UC8A 4YJ3F 4K6NA 5HNEA 3NUAA 1N36H 4A3BG 2EIYA 4FBUA 2W6PA 4WBNF 2R8HA 2YCHA 4ED6A 4DL2A 3GILA 2UVUA 1V9PA 1S9FA 2YRWA 4WHXA 1W93A 1GYFA 4ECSA 3UZBA 1ZHQA 2COGA 4TQSA 4ECXA 3GB8B 3DF7A 3OTOH 4O7LA 4QIWE 4JV5H 3AX6A 5JH7F 4JV0A 5BWVA 4A3GG 1CKNA 3HOWG 3H0GG 4A3LG 1Z2NX 4C5AA 5KFYA 5I5XA 4YR3A 3H4DA 5BYAA 2JA7G 1KJ9A 1RJPA 4ECUA 2VQEH 3KALA 2PMZA 4O84A 4NLGA 1S97A 5CE8A 2B63A 3K5IA 3HOVG 3BABA 3IN5A 4O81A 1E4FT 4FFRA 4LSXA 2DPJA 1TAEA 1CQIB 4DV0H 5I60A 3GQCA 3G6YA 2DIKA 4ED2A 5KT2A 4GKJH 1CKNB 2E2IA 5C1PA 2HJWA 3KAJA 5CB4F 2Y0SE 5KFXA 4R8UB 4QWDA 2FPPB 2Q7DA 2C28A 3MWEA 1W96A 2UVRA 1DV1A 3KYHC 2I80A 3K3VA 5FD5A 2XC9A 4CHIA 4NXNH 1ZHSA 4RB0A 5DG8A 4B3SH 3GTGA 5BYBA 5LL6b 4DUZH 2CW7A 5FLMG 3R5XA 3VA7A 1Z2PX 2XD4A 3GDEA 5L9XA 2NU7B 4LFBH 3T9DA 5C1OA 4J9KA 3JRXA 3C0FB 4CE5A 3M9MB 5IYBG 2BQUA 3UZOA 4J9MA 5IT9W 4ZOLF 4GLWA 4XZ3B 1WH2A 5JUMA 3GTOA 5LA6F 2COIA 1EUDB 3N43B 1I2KA 1BXRA 4LF6H 2R7NA 4RU9A 3L4KA 1R9TA 5KG2A 5KS8A 1ZAUA 4XX0B 4RB2C 4FS1A 1RJRA 3GIPA 2HDKA 5KFCA 1C30A 4QWCA 1GLVA 1AUXA 2HIXA 5KX5F 3N44B 3VPDA 3J80W 5KFEA 2NVYA 3RB0A 2R7KA 1WCMG 1AN7A 2JEGA 1I7LA 5L1LA 1IOWA 3H4BA 4NXMH 1HNXH 2W9CA 5KFAA 1L2ZA 2FMAA 2RF4A 4LF7H 2VPQA 5KT7A 3U0GA 1T36A 3RB4A 4UCOA 3T5JA 5KG6A 1MZBA 4RB3C 4K0KH 4LH6A 3NBZB 4O83A 4Q43A 1KEEA 3GIJA 5GONF 1GGOA 3AW8A 1EZ1A 3RV4A 3H40A 1JDEA 4DL4A 5LMUH 1N34H 2DPIA 3WWJA 4O7SA 4J9LA 2R7LA 3N42B 3R5FA 1Y1VG 5KFWA 4Q4DA 4QIWA 3HKZA 2R92G 1TWHA 2FK2A 4RAZA 1A3GA 1TA8A 4LSAA 3WO1A 3SI8A 4IAJA 2NU9B 3I4MG 3T5LA 4O7YA 4I50F 5HV6A 3BACA 2EJ3A 3N41B 4BY1G 3Q8PB 5K2MA 3GTJA 4O7NA 2VUMG 3JZ6A 4MV9A 4IR1A 5BWUA 5I5UA 1BGWA 1S0NA 3HB9A 4YB8B 4M9UA 1PK8A 2UXDH 2GLTA 3RV3A 2UUCH 2F4VH 1T3NA 2W7PA 3GV5B 2QK4A 4F50A 1OBDA 4IRKA 4DR2H 2CNQA 4ME6A 1UC9A 3U9TA 4DL6A 4CMDA 1XDNA 3TINA 1HNZH 4WD3A 2NU6B 4F4WA 3PR4A 5D1PA 1EKFA 4U6PA 2VA3A 2HVQA 5KFJA 2VA2A 2QB5A 5LXTF 1V4YA 3RJ0A 1BJTA 4RNMA 3VMMA 3BAAA 2NUAB 2W7OA 4I55F 3TY9A 1S0MA 4KHPH 4LF8H 3KXYT 3H3VH 2ASDA 1XMOH 1I7NA 1S10A 5KFFA 3T1HH 5KT3A 4AYBE 3T99A 4RNOA 4JI1H 3GTLA 5DAAA 2DAAA 3LULA 3TQTA 1VAJA 1ZQ7A 4EBCA 1B6RA 5C4XG 2WAQA 3ETJA 2C35B 2WB1E 5CM0A 4A3IG 3PW5A 1N56A 3G6XA 5J2UF 3V6JA 2W8KA 4EGQA 5EOYA 2FLLA 1JDBB 3KAKA 5DISC 1DIKA 3MFIA 3LWBA 4ED8A 4L1KA 1BNCA 4IWYA 3ORQA 2R6FA 1I1KA 2WYOA 3H0GA 1HNWH 2UXCH 1O75A 3ETHA 2ZM6H 3GIDA 4I4TF 3WWHA 3JZIA 3RGZA 1K1QA 4EYIB 3CSWA 3Q8SB 3RB3A 2FK3A 5I5VA 2J6SA 5KT5A 2R7ZG 3J7AK 2W6ZA 3MR5A 4PZ8A 2CFMA 4IRCA 4R7RA 3S24A 5KFUA 1EHIA 1CS0A 4APMA 3PW2A 2BQ3A 2W6NA 1JIHA 4Q0YA 4GC7A 1Z2OX 2XGQA 1EKPA 5JQWA 4F4YA 3T9EA 4DL7A 2HGSA 4M0JA 4ZI7F 2XCAA 4EG0A 3CQZA 1RK6A 2RDJA 4DV7H 3TW7A 2IMWP 4O3QA 3E5NA 1PX2A 2GQSA 1Y14B 4R8UA 1K1SA 5KFIA 5IWAH 3RBDA 2GPSA 3KREA 5T14A 2AGOA 5KFRA 5KFKA 2R8KA 1VKZA 4DL5A 3RAXA 2JEJA 4C5BA 2UVVA 3JSNA 3OSNA 1CKMA 2QYZA 1E4EB 2DWCA 3QFFA 4O7VA 5C3EG 3EPIA 2Q2UA 2VR1A 2PVPA 3H20A 5KFGA 4O7ZA 4ZQIA 4FFPA 4B3MH 2E5LH 1ZETA 5DG7A 3UYYA 4HYKA 2AQ4A 1EKVA 4YR0A 3PZPA 4EYHB 4ECZA 4DRFA 4DR4H 4PDBA 4FU0A 3T9BA 3L2PA 5DGAA 4FFMA 5D1OA 4DLKA 4DV3H 5CA0F 2O03A 1Y1WG 3N8DA 4EBEA 2CNVA 2HVRA 5E25A 2OWOA 2VOBA 2ABJA 5BMVF 2WE6A 2SCUB 3Q1KA 4A2AA 3J81W 2HGWA 3GTKA 4O86A 2XCPA 3W5OA 5BPFA 2C2DA 2V5AA 3DAAA 5C5JA 3M9OB 1OWTA 5KG7A 4YHHH 4JI3H 3TY8A 1WCMA 4FE2A 1DGSA 5D8DA 4LFAH 4LF4H 4QSHA 4CMFA 4IIJF 5IP7G 5D1OB 3KHGA 4MV6A 3QZ7A 5L1KA 1JX4A 2UUAH 5BWRA 4X65H 2ZDQA 4EEYA 2IA6A 5C44G 4EQ5A 1IBMH 3PO2G 3T54A 3BA9A 2YZLA 2W71A 2AGQA 1B04A 4NZNA 1ULZA 3T5KA 5KFNA 4TV9F 1GO3E 3MR3A 4ECYA 3BJYA 4ECVA 3K5HA 1EYZA 3NC0B 5FNVF 5KFQA 4J9OA 4DUYH 3SGIA 2ZJTA 3CVZA 2PN1A 3N40P 4IZOA 4J9PA 1Y1VA 4DV1H 4E6NA 5DQIA 3Q8QB 4NZMA 2JA6G 1TWAA 2EJ0A 4FFOA 5BPHA 2R92A 2AU0A 1GSAA 1VBGA 4A3MG 4YBZB 4DIMA 5FPRA 2ODTX 2V4QA 5CAEB 4DV2H 1FKAH 2YL2A 4MV3A 4FS2A 2JEFA 5DG9A 5KFLA 3GV7B 2UVWA 4HR7A 2J6UA 5C8YF 3HOXG 2VUMA 4JI6H 3Q8RB 2V9WA 1WR2A 2FE3A 3RUPA 4DR5H 4DR7H 5I5TA 4C5CA 2JEIA 2IBKA 2W9AA 1IOVA 1GSOA 3VPCA 4ED7A 3V6HA 1N33H 1B33N 2HHFA 4O2AF 2R86A 4FGRA 5HBRB 4UCRA 3U54A 3FMAA 2WTFA 4X66H 2W8LA 2ATLA 2NVXA 2WDTA 1A48A 3R5HA 1C3OA 1TWGA 4QW9A 4A3DG 5KT6A 1P16A 1JXLA 3FKIG 5KFTA 2W70A 4QW8A 4JI7H 5DQGA 5CR5A 4PWQA 1KJQA 5KKNB 2R82A 2KSWA 3KTMA 1N48A 4HNUA 4O4JF 2C2RA 2GQRA 4MV4A 4EEQA 4MTEA 3BQ0A 4RUCA 3MWMA 2HHFB 2V59A 4MV8A 5I5SA 4JYAH 4ED3A 4JV1A 2W6MA 2CNUA 3V4ZA 4UCUA 3RIZA 3JRWA 4JI5H 4PZ6A 2PMZE 3QQMA 3EYYA 2VUGA 3OUUA 2Y0SA 3KHLA 1A9XA 4C2MA 4F4ZA 1KTAA 3HOUG 4IRDA 1I1LA 3GTMA 4EFEA 4JXUA 5I5YA 4J9NA 2CZGA 5FD6A 1AUVA 2HGXA 4PZ7A 1KC7A 1XK5A 4FFLA 4PBCA 4E4TA 4ECTA 3GTPA 2Z02A 4HNTA 2DZDA 4DL3A 2R87A 5LYJF 1RK5A 2R7ZA 1IYEA 4U7CA 2XIGA 4ED0A 4RB1A 4YJ2F 1S03G 2MCTA 1FJGH 2FB9A 1KUTA 2FLNA 3PO3G 2J6TA 4TVIA 3TIIA 2XGPA 3GIIA 4X64H 1RYSA 3IG0A 2YU9A 3TQ1A 4JUZA 1TWFA 2RDIA 1KJIA 2R8IA 4B3TH 1XNRH 3I4NG 4BBRG 1I6UA 1ET0A 2FP4B 1M6VA 2R85A 2UXBH 2IP4A 3KHRA 4XYLB 3LMLA 2R84A 4QWAA 3CEBA 2W6QA 5K3WA 1M7JA 2RGVA 4LMYA 5KG5A 5IYDG 2CW8A 4O3SA 3R9RA
chains in the Genus database with same CATH topology
2YZNA 1E4EA 3VOTA 3VPBA 2GPWA 2W6OA 1DV2A 4HNVA 5IYZF 3TIGA 3R23A 1CQJB 3MWDA 4O7WA 3MJFA 3SE7A 3WO0A 4YAKB 4MV1A 1GSHA 1KJJA 4O4HF 3HBLA 2I87A 3OUZA 3JZFA 1JLLB 3UFXB 2YZMA 3V4SA 2I8CA 1EUCB 4FFNA 5JVDF 1KBLA 2PBZA 1M0WA 4MA5A 2DLNA 1SCUB 2YRXA 5H80A 2FPGB 2C00A 3K3PA 2XCLA 4RZQA 1CE8A 4XYMB 4MV7A 4Y8VB 3GLKA 2NU8B 5J2TF 2X0SA 4YAJB 4IWXA 2J9GA 3U55A 4O4LF 2QF7A 3WNZA 5DMXA 3RFCA 4O2BF 5LOVF 4NYEA 4O4IF 2FPIB 4ZHQF 2V58A 3G8CA 3TW6A 4TV8F 3HO8A 2YW2A 4MA0A 3U9SA 2YZGA 1JKJB 5JQGF 1KJ8A 2Z04A 3BG5A 3ORRA 5LP6F 4O7RA 3N6RA 5JVLA 2VQDA 4O7TA 2OLSA 2ZDHA 3I12A 4TUYF 2YS7A 5CA1F 4EGJA 4O82A 2YYAA 2CQYA 5EZYF 1OBGA 3Q2OA 2YS6A 1M0TA 2YWVA 2ZDGA 2R7MA 1B6SA 1VBHA 4IHJF 3LP8A 5I47A 4MAMA 4HQ6A 2P0AA 3G8DA 4YJ3F 1UC8A 3NUAA 2W6PA 4WBNF 2YRWA 1W93A 3DF7A 4O7LA 3AX6A 5JH7F 1Z2NX 4C5AA 1KJ9A 3KALA 4O84A 3K5IA 4O81A 4FFRA 1CQIB 2DIKA 5C1PA 2HJWA 3KAJA 5CB4F 2FPPB 3MWEA 1W96A 1DV1A 2I80A 3R5XA 3VA7A 1Z2PX 2XD4A 2NU7B 5C1OA 3JRXA 4ZOLF 4XZ3B 5LA6F 1EUDB 1BXRA 2R7NA 4XX0B 1C30A 1GLVA 1AUXA 5KX5F 3VPDA 2R7KA 1I7LA 1IOWA 2VPQA 1T36A 4O83A 1KEEA 5GONF 1GGOA 3AW8A 1EZ1A 3RV4A 1JDEA 4O7SA 2R7LA 3R5FA 3WO1A 2NU9B 4O7YA 4I50F 5HV6A 5K2MA 4O7NA 4MV9A 3HB9A 4YB8B 4M9UA 1PK8A 2GLTA 3RV3A 2QK4A 1OBDA 2CNQA 4ME6A 3U9TA 1UC9A 3TINA 4WD3A 2NU6B 5LXTF 3VMMA 2NUAB 4I55F 1I7NA 3TQTA 1B6RA 3ETJA 5J2UF 4EGQA 1JDBB 3KAKA 1DIKA 3LWBA 4L1KA 1BNCA 4IWYA 3ORQA 2R6FA 2WYOA 3ETHA 3GIDA 4I4TF 3JZIA 2W6ZA 1EHIA 1CS0A 2W6NA 1Z2OX 5JQWA 2HGSA 4ZI7F 4EG0A 3E5NA 1PX2A 2GQSA 2GPSA 3KREA 1VKZA 4C5BA 1E4EB 2DWCA 3QFFA 4O7VA 2VR1A 2PVPA 4O7ZA 4ZQIA 4FFPA 4FU0A 4FFMA 4DLKA 5CA0F 3N8DA 2CNVA 5BMVF 2SCUB 3Q1KA 4O86A 5BPFA 2V5AA 4FE2A 5D8DA 4QSHA 4IIJF 4MV6A 2ZDQA 2YZLA 2W71A 1ULZA 4TV9F 3K5HA 1EYZA 5FNVF 2PN1A 4IZOA 4FFOA 5BPHA 1GSAA 1VBGA 4YBZB 4DIMA 5CAEB 2YL2A 4MV3A 4HR7A 5C8YF 1WR2A 3RUPA 4C5CA 1IOVA 1GSOA 3VPCA 4O2AF 2R86A 4FGRA 5HBRB 3U54A 1A48A 3R5HA 1C3OA 2W70A 1KJQA 5KKNB 2R82A 4HNUA 4O4JF 2GQRA 4MV4A 2V59A 4MV8A 2W6MA 2CNUA 3V4ZA 3JRWA 3OUUA 1A9XA 2CZGA 1AUVA 1KC7A 4FFLA 4E4TA 2Z02A 4HNTA 2DZDA 2R87A 5LYJF 4YJ2F 2FB9A 1KUTA 3TIIA 1KJIA 2FP4B 1M6VA 2R85A 2IP4A 4XYLB 2R84A 2W6QA 3R9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZN A;  1E4E A;  3VOT A;  3VPB A;  2GPW A;  2W6O A;  1DV2 A;  4HNV A;  5IYZ F;  3TIG A;  3R23 A;  1CQJ B;  3MWD A;  4O7W A;  3MJF A;  3SE7 A;  3WO0 A;  4YAK B;  4MV1 A;  1GSH A;  1KJJ A;  4O4H F;  3HBL A;  2I87 A;  3OUZ A;  3JZF A;  1JLL B;  3UFX B;  2YZM A;  3V4S A;  2I8C A;  1EUC B;  4FFN A;  5JVD F;  1KBL A;  2PBZ A;  1M0W A;  4MA5 A;  2DLN A;  1SCU B;  2YRX A;  5H80 A;  2FPG B;  2C00 A;  3K3P A;  2XCL A;  4RZQ A;  1CE8 A;  4XYM B;  4MV7 A;  4Y8V B;  3GLK A;  2NU8 B;  5J2T F;  2X0S A;  4YAJ B;  4IWX A;  2J9G A;  3U55 A;  4O4L F;  2QF7 A;  3WNZ A;  5DMX A;  3RFC A;  4O2B F;  5LOV F;  4NYE A;  4O4I F;  2FPI B;  4ZHQ F;  2V58 A;  3G8C A;  3TW6 A;  4TV8 F;  3HO8 A;  2YW2 A;  4MA0 A;  3U9S A;  2YZG A;  1JKJ B;  5JQG F;  1KJ8 A;  2Z04 A;  3BG5 A;  3ORR A;  5LP6 F;  4O7R A;  3N6R A;  5JVL A;  2VQD A;  4O7T A;  2OLS A;  2ZDH A;  3I12 A;  4TUY F;  2YS7 A;  5CA1 F;  4EGJ A;  4O82 A;  2YYA A;  2CQY A;  5EZY F;  1OBG A;  3Q2O A;  2YS6 A;  1M0T A;  2YWV A;  2ZDG A;  2R7M A;  1B6S A;  1VBH A;  4IHJ F;  3LP8 A;  5I47 A;  4MAM A;  4HQ6 A;  2P0A A;  3G8D A;  4YJ3 F;  1UC8 A;  3NUA A;  2W6P A;  4WBN F;  2YRW A;  1W93 A;  3DF7 A;  4O7L A;  3AX6 A;  5JH7 F;  1Z2N X;  4C5A A;  1KJ9 A;  3KAL A;  4O84 A;  3K5I A;  4O81 A;  4FFR A;  1CQI B;  2DIK A;  5C1P A;  2HJW A;  3KAJ A;  5CB4 F;  2FPP B;  3MWE A;  1W96 A;  1DV1 A;  2I80 A;  3R5X A;  3VA7 A;  1Z2P X;  2XD4 A;  2NU7 B;  5C1O A;  3JRX A;  4ZOL F;  4XZ3 B;  5LA6 F;  1EUD B;  1BXR A;  2R7N A;  4XX0 B;  1C30 A;  1GLV A;  1AUX A;  5KX5 F;  3VPD A;  2R7K A;  1I7L A;  1IOW A;  2VPQ A;  1T36 A;  4O83 A;  1KEE A;  5GON F;  1GGO A;  3AW8 A;  1EZ1 A;  3RV4 A;  1JDE A;  4O7S A;  2R7L A;  3R5F A;  3WO1 A;  2NU9 B;  4O7Y A;  4I50 F;  5HV6 A;  5K2M A;  4O7N A;  4MV9 A;  3HB9 A;  4YB8 B;  4M9U A;  1PK8 A;  2GLT A;  3RV3 A;  2QK4 A;  1OBD A;  2CNQ A;  4ME6 A;  3U9T A;  1UC9 A;  3TIN A;  4WD3 A;  2NU6 B;  5LXT F;  3VMM A;  2NUA B;  4I55 F;  1I7N A;  3TQT A;  1B6R A;  3ETJ A;  5J2U F;  4EGQ A;  1JDB B;  3KAK A;  1DIK A;  3LWB A;  4L1K A;  1BNC A;  4IWY A;  3ORQ A;  2R6F A;  2WYO A;  3ETH A;  3GID A;  4I4T F;  3JZI A;  2W6Z A;  1EHI A;  1CS0 A;  2W6N A;  1Z2O X;  5JQW A;  2HGS A;  4ZI7 F;  4EG0 A;  3E5N A;  1PX2 A;  2GQS A;  2GPS A;  3KRE A;  1VKZ A;  4C5B A;  1E4E B;  2DWC A;  3QFF A;  4O7V A;  2VR1 A;  2PVP A;  4O7Z A;  4ZQI A;  4FFP A;  4FU0 A;  4FFM A;  4DLK A;  5CA0 F;  3N8D A;  2CNV A;  5BMV F;  2SCU B;  3Q1K A;  4O86 A;  5BPF A;  2V5A A;  4FE2 A;  5D8D A;  4QSH A;  4IIJ F;  4MV6 A;  2ZDQ A;  2YZL A;  2W71 A;  1ULZ A;  4TV9 F;  3K5H A;  1EYZ A;  5FNV F;  2PN1 A;  4IZO A;  4FFO A;  5BPH A;  1GSA A;  1VBG A;  4YBZ B;  4DIM A;  5CAE B;  2YL2 A;  4MV3 A;  4HR7 A;  5C8Y F;  1WR2 A;  3RUP A;  4C5C A;  1IOV A;  1GSO A;  3VPC A;  4O2A F;  2R86 A;  4FGR A;  5HBR B;  3U54 A;  1A48 A;  3R5H A;  1C3O A;  2W70 A;  1KJQ A;  5KKN B;  2R82 A;  4HNU A;  4O4J F;  2GQR A;  4MV4 A;  2V59 A;  4MV8 A;  2W6M A;  2CNU A;  3V4Z A;  3JRW A;  3OUU A;  1A9X A;  2CZG A;  1AUV A;  1KC7 A;  4FFL A;  4E4T A;  2Z02 A;  4HNT A;  2DZD A;  2R87 A;  5LYJ F;  4YJ2 F;  2FB9 A;  1KUT A;  3TII A;  1KJI A;  2FP4 B;  1M6V A;  2R85 A;  2IP4 A;  4XYL B;  2R84 A;  2W6Q A;  3R9R A; 
#chains in the Genus database with same CATH topology
 2HIV A;  4JI4 H;  5DGB A;  2BR0 A;  3RB6 A;  1A0I A;  5IP9 G;  2YZN A;  1E4E A;  3VOT A;  3RR5 A;  3VPB A;  4ECQ A;  1J5E H;  3T9A A;  2GPW A;  4JV2 A;  1WRV A;  3NBY B;  4DV5 H;  2W6O A;  3GIQ A;  3T5H A;  5KG0 A;  1I2L A;  3UQ8 A;  5KFM A;  1DV2 A;  4GC6 A;  2JA5 G;  2R93 G;  4LH7 A;  2HVS A;  3QZ8 A;  4LFC H;  1Y1W A;  2JA7 A;  5DQH A;  2R8G A;  4O3N A;  4HNV A;  4UUG A;  5IYZ F;  4Q45 A;  1A0G A;  3TIG A;  4YY3 H;  3R23 A;  4UCV A;  5F9N A;  1CQJ B;  3MWD A;  4AQY H;  4GKK H;  2EJ2 A;  4J9R A;  5KFO A;  3JSL A;  1FVI A;  4O7W A;  3F8N A;  3HKZ E;  4A3J G;  3VNN A;  4O3R A;  3MJF A;  3MR2 A;  4O3O A;  3OSP A;  5EWG A;  1IBK H;  3T9F A;  3SE7 A;  2AGP A;  3TY5 A;  3WO0 A;  4RNN A;  4MTD A;  5KFD A;  4A3E G;  1SFO A;  2V4R A;  5BWW A;  3FDS A;  4QJF A;  4B3R H;  4UCS A;  4MV1 A;  4YAK B;  5L1I A;  1XNQ H;  1GSH A;  1IYD A;  1KJJ A;  4O4H F;  1XMQ H;  2ASL A;  3HBL A;  2I87 A;  5KG4 A;  5L1J A;  1CKO A;  1E4G T;  1V51 A;  2X5R A;  3AYH B;  3OUZ A;  3T1Y H;  2FLP A;  3GTQ A;  3PVX A;  2HHH H;  3JZF A;  2VPS A;  1JLL B;  3TEK A;  5A2Q W;  2JA6 A;  3BA8 A;  3UFX B;  3RBE A;  5BWT A;  1P8L A;  4DAA A;  5DGH A;  3NGD A;  4ETS A;  2YZM A;  1G2W A;  4RCN A;  4YQW A;  4YR2 A;  4ECW A;  4G3I A;  2DAB A;  4A2B A;  5KG3 A;  3V6K A;  3V4S A;  2I8C A;  4AYB A;  3T9C A;  2B63 G;  4Q8F A;  1EUC B;  4FFN A;  5KFP A;  5KFZ A;  4FBT A;  5JVD F;  1X9N A;  2WB1 A;  2E2H A;  1KBL A;  2PBZ A;  1M0W A;  3GJX B;  5KFB A;  4DQN A;  4UCT A;  4YP3 A;  4MA5 A;  3GV8 B;  4JI8 H;  4GLX A;  1N32 H;  4QWB A;  2FK1 A;  2DLN A;  1SCU B;  2WAQ E;  2BQR A;  4EFB A;  4LF5 H;  2YRX A;  5H80 A;  3N6X A;  3LQS A;  4I7H A;  4JI0 H;  2FPG B;  2C00 A;  3FKI A;  1TWC A;  1I94 H;  2C2E A;  3G6V A;  4X62 H;  3K3P A;  1KT8 A;  2XCL A;  2W57 A;  3JAM W;  1SEI A;  5FLX W;  4RAY A;  4DV4 H;  4DR6 H;  5EWE A;  1T94 A;  4RZQ A;  4F4X A;  1S0O A;  1CE8 A;  4J9Q A;  3W1B A;  4XYM B;  2C22 A;  3PW0 A;  4MV7 A;  3RF2 A;  4J0M A;  3GIK A;  4OX9 H;  2JA8 G;  4Y8V B;  4TM5 A;  3WWI A;  4NZO A;  3RAQ A;  4EBD A;  3GLK A;  3W1G A;  2ASJ A;  5DGI A;  2NU8 B;  1SYX B;  5J2T F;  1I3Q A;  2X0S A;  3HT5 A;  2M05 A;  3RGX A;  4IWX A;  4YAJ B;  1RYR A;  2J9G A;  3U55 A;  4O4L F;  3KHH A;  3BQ2 A;  2QF7 A;  3WNZ A;  5DMX A;  3RFC A;  5KFH A;  2UU9 H;  4A3C G;  4BWS C;  5FR9 A;  1HR0 H;  5KG1 A;  4O2B F;  5LOV F;  4DR3 H;  5LMN H;  3OHA A;  2UUB H;  4NYE A;  4DR1 H;  3PFF A;  4O4I F;  2FJZ A;  4JI2 H;  5F9L A;  2FPI B;  4ZHQ F;  1K83 A;  4DV6 H;  3PR5 B;  2V58 A;  4Q4C A;  3G8C A;  3GIM A;  4A3K G;  2W9C B;  3BQ1 A;  2HG8 A;  4CC6 A;  4RZR A;  3TW6 A;  4TV8 F;  3HO8 A;  2YW2 A;  4MA0 A;  3U9S A;  1RJQ A;  5KFS A;  2YZG A;  2R8J A;  1JKJ B;  5JQG F;  4FM9 A;  2VQF H;  5KT4 A;  2FKL A;  3M4I A;  1KJ8 A;  2Z04 A;  1UNN C;  3DTG A;  3BG5 A;  4IR9 A;  5IYC G;  3ORR A;  3QWU A;  2COJ A;  4O3P A;  2W9B A;  4CKB A;  4BY7 G;  4BXX G;  3DTF A;  4O7R A;  5LP6 F;  4ECR A;  5FJ8 G;  4Q8E A;  3N6R A;  5JVL A;  2VQD A;  4O7T A;  3SNO A;  2OLS A;  2ZDH A;  3I12 A;  5EWF A;  2ALZ A;  4QWE A;  4TUY F;  2YS7 A;  5CA1 F;  1S68 A;  4EGJ A;  3M9N B;  1DAA A;  2CKZ B;  4TQR A;  4O82 A;  2YYA A;  5KFV A;  2OH2 A;  2RGR A;  5EDW A;  4LF9 H;  4A93 G;  5BWX A;  2CQY A;  3T7A A;  5I5W A;  4RUA A;  2Y4R A;  2JA5 A;  2R93 A;  5DLG A;  3PW7 A;  2W9B B;  2Q2T A;  5EZY F;  3MFH A;  4ED1 A;  5DLF A;  2A1H A;  1OBG A;  3Q2O A;  4HN2 A;  2YS6 A;  3PN1 A;  4M7E A;  1I1M A;  1M0T A;  4CKC A;  3RTX A;  2ZGI A;  2YWV A;  2ZDG A;  4J9S A;  2R7M A;  4BBS G;  4A3F G;  1B6S A;  5BR8 H;  1VBH A;  4IHJ F;  1WSC A;  3HXL A;  3LP8 A;  3OHB A;  3L4J A;  3HOZ G;  4CC5 A;  1VS0 A;  5I47 A;  3PW4 A;  1IBL H;  4MAM A;  4HQ6 A;  4Q44 A;  3EPG A;  3MR6 A;  4UFZ A;  1I50 A;  4CKE A;  2P0A A;  3HOY G;  5FPO A;  3G8D A;  1UC8 A;  4YJ3 F;  4K6N A;  5HNE A;  3NUA A;  1N36 H;  4A3B G;  2EIY A;  4FBU A;  2W6P A;  4WBN F;  2R8H A;  2YCH A;  4ED6 A;  4DL2 A;  3GIL A;  2UVU A;  1V9P A;  1S9F A;  2YRW A;  4WHX A;  1W93 A;  1GYF A;  4ECS A;  3UZB A;  1ZHQ A;  2COG A;  4TQS A;  4ECX A;  3GB8 B;  3DF7 A;  3OTO H;  4O7L A;  4QIW E;  4JV5 H;  3AX6 A;  5JH7 F;  4JV0 A;  5BWV A;  4A3G G;  1CKN A;  3HOW G;  3H0G G;  4A3L G;  1Z2N X;  4C5A A;  5KFY A;  5I5X A;  4YR3 A;  3H4D A;  5BYA A;  2JA7 G;  1KJ9 A;  1RJP A;  4ECU A;  2VQE H;  3KAL A;  2PMZ A;  4O84 A;  4NLG A;  1S97 A;  5CE8 A;  2B63 A;  3K5I A;  3HOV G;  3BAB A;  3IN5 A;  4O81 A;  1E4F T;  4FFR A;  4LSX A;  2DPJ A;  1TAE A;  1CQI B;  4DV0 H;  5I60 A;  3GQC A;  3G6Y A;  2DIK A;  4ED2 A;  5KT2 A;  4GKJ H;  1CKN B;  2E2I A;  5C1P A;  2HJW A;  3KAJ A;  5CB4 F;  2Y0S E;  5KFX A;  4R8U B;  4QWD A;  2FPP B;  2Q7D A;  2C28 A;  3MWE A;  1W96 A;  2UVR A;  1DV1 A;  3KYH C;  2I80 A;  3K3V A;  5FD5 A;  2XC9 A;  4CHI A;  4NXN H;  1ZHS A;  4RB0 A;  5DG8 A;  4B3S H;  3GTG A;  5BYB A;  5LL6 b;  4DUZ H;  2CW7 A;  5FLM G;  3R5X A;  3VA7 A;  1Z2P X;  2XD4 A;  3GDE A;  5L9X A;  2NU7 B;  4LFB H;  3T9D A;  5C1O A;  4J9K A;  3JRX A;  3C0F B;  4CE5 A;  3M9M B;  5IYB G;  2BQU A;  3UZO A;  4J9M A;  5IT9 W;  4ZOL F;  4GLW A;  4XZ3 B;  1WH2 A;  5JUM A;  3GTO A;  5LA6 F;  2COI A;  1EUD B;  3N43 B;  1I2K A;  1BXR A;  4LF6 H;  2R7N A;  4RU9 A;  3L4K A;  1R9T A;  5KG2 A;  5KS8 A;  1ZAU A;  4XX0 B;  4RB2 C;  4FS1 A;  1RJR A;  3GIP A;  2HDK A;  5KFC A;  1C30 A;  4QWC A;  1GLV A;  1AUX A;  2HIX A;  5KX5 F;  3N44 B;  3VPD A;  3J80 W;  5KFE A;  2NVY A;  3RB0 A;  2R7K A;  1WCM G;  1AN7 A;  2JEG A;  1I7L A;  5L1L A;  1IOW A;  3H4B A;  4NXM H;  1HNX H;  2W9C A;  5KFA A;  1L2Z A;  2FMA A;  2RF4 A;  4LF7 H;  2VPQ A;  5KT7 A;  3U0G A;  1T36 A;  3RB4 A;  4UCO A;  3T5J A;  5KG6 A;  1MZB A;  4RB3 C;  4K0K H;  4LH6 A;  3NBZ B;  4O83 A;  4Q43 A;  1KEE A;  3GIJ A;  5GON F;  1GGO A;  3AW8 A;  1EZ1 A;  3RV4 A;  3H40 A;  1JDE A;  4DL4 A;  5LMU H;  1N34 H;  2DPI A;  3WWJ A;  4O7S A;  4J9L A;  2R7L A;  3N42 B;  3R5F A;  1Y1V G;  5KFW A;  4Q4D A;  4QIW A;  3HKZ A;  2R92 G;  1TWH A;  2FK2 A;  4RAZ A;  1A3G A;  1TA8 A;  4LSA A;  3WO1 A;  3SI8 A;  4IAJ A;  2NU9 B;  3I4M G;  3T5L A;  4O7Y A;  4I50 F;  5HV6 A;  3BAC A;  2EJ3 A;  3N41 B;  4BY1 G;  3Q8P B;  5K2M A;  3GTJ A;  4O7N A;  2VUM G;  3JZ6 A;  4MV9 A;  4IR1 A;  5BWU A;  5I5U A;  1BGW A;  1S0N A;  3HB9 A;  4YB8 B;  4M9U A;  1PK8 A;  2UXD H;  2GLT A;  3RV3 A;  2UUC H;  2F4V H;  1T3N A;  2W7P A;  3GV5 B;  2QK4 A;  4F50 A;  1OBD A;  4IRK A;  4DR2 H;  2CNQ A;  4ME6 A;  1UC9 A;  3U9T A;  4DL6 A;  4CMD A;  1XDN A;  3TIN A;  1HNZ H;  4WD3 A;  2NU6 B;  4F4W A;  3PR4 A;  5D1P A;  1EKF A;  4U6P A;  2VA3 A;  2HVQ A;  5KFJ A;  2VA2 A;  2QB5 A;  5LXT F;  1V4Y A;  3RJ0 A;  1BJT A;  4RNM A;  3VMM A;  3BAA A;  2NUA B;  2W7O A;  4I55 F;  3TY9 A;  1S0M A;  4KHP H;  4LF8 H;  3KXY T;  3H3V H;  2ASD A;  1XMO H;  1I7N A;  1S10 A;  5KFF A;  3T1H H;  5KT3 A;  4AYB E;  3T99 A;  4RNO A;  4JI1 H;  3GTL A;  5DAA A;  2DAA A;  3LUL A;  3TQT A;  1VAJ A;  1ZQ7 A;  4EBC A;  1B6R A;  5C4X G;  2WAQ A;  3ETJ A;  2C35 B;  2WB1 E;  5CM0 A;  4A3I G;  3PW5 A;  1N56 A;  3G6X A;  5J2U F;  3V6J A;  2W8K A;  4EGQ A;  5EOY A;  2FLL A;  1JDB B;  3KAK A;  5DIS C;  1DIK A;  3MFI A;  3LWB A;  4ED8 A;  4L1K A;  1BNC A;  4IWY A;  3ORQ A;  2R6F A;  1I1K A;  2WYO A;  3H0G A;  1HNW H;  2UXC H;  1O75 A;  3ETH A;  2ZM6 H;  3GID A;  4I4T F;  3WWH A;  3JZI A;  3RGZ A;  1K1Q A;  4EYI B;  3CSW A;  3Q8S B;  3RB3 A;  2FK3 A;  5I5V A;  2J6S A;  5KT5 A;  2R7Z G;  3J7A K;  2W6Z A;  3MR5 A;  4PZ8 A;  2CFM A;  4IRC A;  4R7R A;  3S24 A;  5KFU A;  1EHI A;  1CS0 A;  4APM A;  3PW2 A;  2BQ3 A;  2W6N A;  1JIH A;  4Q0Y A;  4GC7 A;  1Z2O X;  2XGQ A;  1EKP A;  5JQW A;  4F4Y A;  3T9E A;  4DL7 A;  2HGS A;  4M0J A;  4ZI7 F;  2XCA A;  4EG0 A;  3CQZ A;  1RK6 A;  2RDJ A;  4DV7 H;  3TW7 A;  2IMW P;  4O3Q A;  3E5N A;  1PX2 A;  2GQS A;  1Y14 B;  4R8U A;  1K1S A;  5KFI A;  5IWA H;  3RBD A;  2GPS A;  3KRE A;  5T14 A;  2AGO A;  5KFR A;  5KFK A;  2R8K A;  1VKZ A;  4DL5 A;  3RAX A;  2JEJ A;  4C5B A;  2UVV A;  3JSN A;  3OSN A;  1CKM A;  2QYZ A;  1E4E B;  2DWC A;  3QFF A;  4O7V A;  5C3E G;  3EPI A;  2Q2U A;  2VR1 A;  2PVP A;  3H20 A;  5KFG A;  4O7Z A;  4ZQI A;  4FFP A;  4B3M H;  2E5L H;  1ZET A;  5DG7 A;  3UYY A;  4HYK A;  2AQ4 A;  1EKV A;  4YR0 A;  3PZP A;  4EYH B;  4ECZ A;  4DRF A;  4DR4 H;  4PDB A;  4FU0 A;  3T9B A;  3L2P A;  5DGA A;  4FFM A;  5D1O A;  4DLK A;  4DV3 H;  5CA0 F;  2O03 A;  1Y1W G;  3N8D A;  4EBE A;  2CNV A;  2HVR A;  5E25 A;  2OWO A;  2VOB A;  2ABJ A;  5BMV F;  2WE6 A;  2SCU B;  3Q1K A;  4A2A A;  3J81 W;  2HGW A;  3GTK A;  4O86 A;  2XCP A;  3W5O A;  5BPF A;  2C2D A;  2V5A A;  3DAA A;  5C5J A;  3M9O B;  1OWT A;  5KG7 A;  4YHH H;  4JI3 H;  3TY8 A;  1WCM A;  4FE2 A;  1DGS A;  5D8D A;  4LFA H;  4LF4 H;  4QSH A;  4CMF A;  4IIJ F;  5IP7 G;  5D1O B;  3KHG A;  4MV6 A;  3QZ7 A;  5L1K A;  1JX4 A;  2UUA H;  5BWR A;  4X65 H;  2ZDQ A;  4EEY A;  2IA6 A;  5C44 G;  4EQ5 A;  1IBM H;  3PO2 G;  3T54 A;  3BA9 A;  2YZL A;  2W71 A;  2AGQ A;  1B04 A;  4NZN A;  1ULZ A;  3T5K A;  5KFN A;  4TV9 F;  1GO3 E;  3MR3 A;  4ECY A;  3BJY A;  4ECV A;  3K5H A;  1EYZ A;  3NC0 B;  5FNV F;  5KFQ A;  4J9O A;  4DUY H;  3SGI A;  2ZJT A;  3CVZ A;  2PN1 A;  3N40 P;  4IZO A;  4J9P A;  1Y1V A;  4DV1 H;  4E6N A;  5DQI A;  3Q8Q B;  4NZM A;  2JA6 G;  1TWA A;  2EJ0 A;  4FFO A;  5BPH A;  2R92 A;  2AU0 A;  1GSA A;  1VBG A;  4A3M G;  4YBZ B;  4DIM A;  5FPR A;  2ODT X;  2V4Q A;  5CAE B;  4DV2 H;  1FKA H;  2YL2 A;  4MV3 A;  4FS2 A;  2JEF A;  5DG9 A;  5KFL A;  3GV7 B;  2UVW A;  4HR7 A;  2J6U A;  5C8Y F;  3HOX G;  2VUM A;  4JI6 H;  3Q8R B;  2V9W A;  1WR2 A;  2FE3 A;  3RUP A;  4DR5 H;  4DR7 H;  5I5T A;  4C5C A;  2JEI A;  2IBK A;  2W9A A;  1IOV A;  1GSO A;  3VPC A;  4ED7 A;  3V6H A;  1N33 H;  1B33 N;  2HHF A;  4O2A F;  2R86 A;  4FGR A;  5HBR B;  4UCR A;  3U54 A;  3FMA A;  2WTF A;  4X66 H;  2W8L A;  2ATL A;  2NVX A;  2WDT A;  1A48 A;  3R5H A;  1C3O A;  1TWG A;  4QW9 A;  4A3D G;  5KT6 A;  1P16 A;  1JXL A;  3FKI G;  5KFT A;  2W70 A;  4QW8 A;  4JI7 H;  5DQG A;  5CR5 A;  4PWQ A;  1KJQ A;  5KKN B;  2R82 A;  2KSW A;  3KTM A;  1N48 A;  4HNU A;  4O4J F;  2C2R A;  2GQR A;  4MV4 A;  4EEQ A;  4MTE A;  3BQ0 A;  4RUC A;  3MWM A;  2HHF B;  2V59 A;  4MV8 A;  5I5S A;  4JYA H;  4ED3 A;  4JV1 A;  2W6M A;  2CNU A;  3V4Z A;  4UCU A;  3RIZ A;  3JRW A;  4JI5 H;  4PZ6 A;  2PMZ E;  3QQM A;  3EYY A;  2VUG A;  3OUU A;  2Y0S A;  3KHL A;  1A9X A;  4C2M A;  4F4Z A;  1KTA A;  3HOU G;  4IRD A;  1I1L A;  3GTM A;  4EFE A;  4JXU A;  5I5Y A;  4J9N A;  2CZG A;  5FD6 A;  1AUV A;  2HGX A;  4PZ7 A;  1KC7 A;  1XK5 A;  4FFL A;  4PBC A;  4E4T A;  4ECT A;  3GTP A;  2Z02 A;  4HNT A;  2DZD A;  4DL3 A;  2R87 A;  5LYJ F;  1RK5 A;  2R7Z A;  1IYE A;  4U7C A;  2XIG A;  4ED0 A;  4RB1 A;  4YJ2 F;  1S03 G;  2MCT A;  1FJG H;  2FB9 A;  1KUT A;  2FLN A;  3PO3 G;  2J6T A;  4TVI A;  3TII A;  2XGP A;  3GII A;  4X64 H;  1RYS A;  3IG0 A;  2YU9 A;  3TQ1 A;  4JUZ A;  1TWF A;  2RDI A;  1KJI A;  2R8I A;  4B3T H;  1XNR H;  3I4N G;  4BBR G;  1I6U A;  1ET0 A;  2FP4 B;  1M6V A;  2R85 A;  2UXB H;  2IP4 A;  3KHR A;  4XYL B;  3LML A;  2R84 A;  4QWA A;  3CEB A;  2W6Q A;  5K3W A;  1M7J A;  2RGV A;  4LMY A;  5KG5 A;  5IYD G;  2CW8 A;  4O3S A;  3R9R A; 
#chains in the Genus database with same CATH homology
 2YZN A;  1E4E A;  3VOT A;  3VPB A;  2GPW A;  2W6O A;  1DV2 A;  4HNV A;  5IYZ F;  3TIG A;  3R23 A;  1CQJ B;  3MWD A;  4O7W A;  3MJF A;  3SE7 A;  3WO0 A;  4YAK B;  4MV1 A;  1GSH A;  1KJJ A;  4O4H F;  3HBL A;  2I87 A;  3OUZ A;  3JZF A;  1JLL B;  3UFX B;  2YZM A;  3V4S A;  2I8C A;  1EUC B;  4FFN A;  5JVD F;  1KBL A;  2PBZ A;  1M0W A;  4MA5 A;  2DLN A;  1SCU B;  2YRX A;  5H80 A;  2FPG B;  2C00 A;  3K3P A;  2XCL A;  4RZQ A;  1CE8 A;  4XYM B;  4MV7 A;  4Y8V B;  3GLK A;  2NU8 B;  5J2T F;  2X0S A;  4YAJ B;  4IWX A;  2J9G A;  3U55 A;  4O4L F;  2QF7 A;  3WNZ A;  5DMX A;  3RFC A;  4O2B F;  5LOV F;  4NYE A;  4O4I F;  2FPI B;  4ZHQ F;  2V58 A;  3G8C A;  3TW6 A;  4TV8 F;  3HO8 A;  2YW2 A;  4MA0 A;  3U9S A;  2YZG A;  1JKJ B;  5JQG F;  1KJ8 A;  2Z04 A;  3BG5 A;  3ORR A;  5LP6 F;  4O7R A;  3N6R A;  5JVL A;  2VQD A;  4O7T A;  2OLS A;  2ZDH A;  3I12 A;  4TUY F;  2YS7 A;  5CA1 F;  4EGJ A;  4O82 A;  2YYA A;  2CQY A;  5EZY F;  1OBG A;  3Q2O A;  2YS6 A;  1M0T A;  2YWV A;  2ZDG A;  2R7M A;  1B6S A;  1VBH A;  4IHJ F;  3LP8 A;  5I47 A;  4MAM A;  4HQ6 A;  2P0A A;  3G8D A;  4YJ3 F;  1UC8 A;  3NUA A;  2W6P A;  4WBN F;  2YRW A;  1W93 A;  3DF7 A;  4O7L A;  3AX6 A;  5JH7 F;  1Z2N X;  4C5A A;  1KJ9 A;  3KAL A;  4O84 A;  3K5I A;  4O81 A;  4FFR A;  1CQI B;  2DIK A;  5C1P A;  2HJW A;  3KAJ A;  5CB4 F;  2FPP B;  3MWE A;  1W96 A;  1DV1 A;  2I80 A;  3R5X A;  3VA7 A;  1Z2P X;  2XD4 A;  2NU7 B;  5C1O A;  3JRX A;  4ZOL F;  4XZ3 B;  5LA6 F;  1EUD B;  1BXR A;  2R7N A;  4XX0 B;  1C30 A;  1GLV A;  1AUX A;  5KX5 F;  3VPD A;  2R7K A;  1I7L A;  1IOW A;  2VPQ A;  1T36 A;  4O83 A;  1KEE A;  5GON F;  1GGO A;  3AW8 A;  1EZ1 A;  3RV4 A;  1JDE A;  4O7S A;  2R7L A;  3R5F A;  3WO1 A;  2NU9 B;  4O7Y A;  4I50 F;  5HV6 A;  5K2M A;  4O7N A;  4MV9 A;  3HB9 A;  4YB8 B;  4M9U A;  1PK8 A;  2GLT A;  3RV3 A;  2QK4 A;  1OBD A;  2CNQ A;  4ME6 A;  3U9T A;  1UC9 A;  3TIN A;  4WD3 A;  2NU6 B;  5LXT F;  3VMM A;  2NUA B;  4I55 F;  1I7N A;  3TQT A;  1B6R A;  3ETJ A;  5J2U F;  4EGQ A;  1JDB B;  3KAK A;  1DIK A;  3LWB A;  4L1K A;  1BNC A;  4IWY A;  3ORQ A;  2R6F A;  2WYO A;  3ETH A;  3GID A;  4I4T F;  3JZI A;  2W6Z A;  1EHI A;  1CS0 A;  2W6N A;  1Z2O X;  5JQW A;  2HGS A;  4ZI7 F;  4EG0 A;  3E5N A;  1PX2 A;  2GQS A;  2GPS A;  3KRE A;  1VKZ A;  4C5B A;  1E4E B;  2DWC A;  3QFF A;  4O7V A;  2VR1 A;  2PVP A;  4O7Z A;  4ZQI A;  4FFP A;  4FU0 A;  4FFM A;  4DLK A;  5CA0 F;  3N8D A;  2CNV A;  5BMV F;  2SCU B;  3Q1K A;  4O86 A;  5BPF A;  2V5A A;  4FE2 A;  5D8D A;  4QSH A;  4IIJ F;  4MV6 A;  2ZDQ A;  2YZL A;  2W71 A;  1ULZ A;  4TV9 F;  3K5H A;  1EYZ A;  5FNV F;  2PN1 A;  4IZO A;  4FFO A;  5BPH A;  1GSA A;  1VBG A;  4YBZ B;  4DIM A;  5CAE B;  2YL2 A;  4MV3 A;  4HR7 A;  5C8Y F;  1WR2 A;  3RUP A;  4C5C A;  1IOV A;  1GSO A;  3VPC A;  4O2A F;  2R86 A;  4FGR A;  5HBR B;  3U54 A;  1A48 A;  3R5H A;  1C3O A;  2W70 A;  1KJQ A;  5KKN B;  2R82 A;  4HNU A;  4O4J F;  2GQR A;  4MV4 A;  2V59 A;  4MV8 A;  2W6M A;  2CNU A;  3V4Z A;  3JRW A;  3OUU A;  1A9X A;  2CZG A;  1AUV A;  1KC7 A;  4FFL A;  4E4T A;  2Z02 A;  4HNT A;  2DZD A;  2R87 A;  5LYJ F;  4YJ2 F;  2FB9 A;  1KUT A;  3TII A;  1KJI A;  2FP4 B;  1M6V A;  2R85 A;  2IP4 A;  4XYL B;  2R84 A;  2W6Q A;  3R9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...