4Y8VB

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
SSRDLLLKAKENGRKSLLEHEAKYFISSYGIPVTNIRLAKSEEEAVNFSREIGFPVVLKIVSPQVVHKSDVGGVKVNLRSEEEVRKAYREIIENVKRNVPNAEIEGILVQEFAPPGVELIIGLLRDPQFGPTVMFGLGGVFVELFRDVSFRVAPLSEQDAESMIKEVKAYKLLTGFRGMEPVDIEAIKDALIRAGRIGVENEEIAEMDLNPVIAYPKGIKVVDARIILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords alpha subunit of acetyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 76
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13549 ATP-grasp_5 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4y8vB01
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 4y8vB02
5CA1F 2XCLA 4I50F 3I12A 3U54A 2YYAA 2CNQA 4FFOA 3OUZA 2R86A 4O84A 4MV7A 5FNVF 2YZLA 1C30A 3HBLA 5JQWA 4TUYF 4IHJF 5C1OA 2R7LA 1E4EB 2R6FA 1EZ1A 4DIMA 1M0TA 4YBZB 4HNVA 4FFLA 1BNCA 2NU8B 2ZDHA 2R7NA 2W6QA 2W71A 4O7ZA 1SCUB 4FFRA 2V59A 4ZI7F 3K5HA 4O4HF 2PN1A 4YJ2F 4M9UA 2VPQA 5GONF 4O82A 1CQJB 3MWEA 3G8DA 1DV1A 1E4EA 5KKNB 3R5FA 1KJ8A 4MA0A 1C3OA 5J2TF 2R7MA 1DIKA 4EGJA 2W6OA 3WO0A 5J2UF 1AUXA 3RV3A 5JVLA 4EGQA 2J9GA 3LP8A 4O4LF 3TIIA 3R23A 3G8CA 1IOWA 1EYZA 1GGOA 3HO8A 2HGSA 4ME6A 4MAMA 3WO1A 4O7WA 5JVDF 2R84A 5HV6A 3KAJA 3VPCA 1DV2A 1PK8A 1CS0A 3ORRA 1KJQA 2CQYA 1EUCB 3VPDA 3U55A 3WNZA 5DMXA 4O2BF 3AX6A 5K2MA 1EHIA 2I80A 3JRXA 4FE2A 3MWDA 2VR1A 4MV9A 1Z2NX 2W70A 3U9TA 1CE8A 3LWBA 4MV8A 4O86A 4ZQIA 3N6RA 4O7YA 5C1PA 4FFPA 4QSHA 3TINA 3GLKA 2CNUA 1CQIB 5EZYF 1GLVA 5LP6F 3R9RA 4FU0A 1I7NA 1JKJB 1EUDB 2DZDA 4O4IF 1VKZA 2ZDQA 1M6VA 2OLSA 1Z2OX 4C5BA 3KAKA 5LYJF 4IZOA 1B6RA 5JH7F 5IYZF 4HQ6A 1JDBB 5C8YF 4ZOLF 4Y8VB 5I47A 2PBZA 3N8DA 3BG5A 4HNTA 2YZNA 2R85A 2ZDGA 2GQRA 1M0WA 3RV4A 3ETHA 3VMMA 3TW6A 2NU7B 5LA6F 1JDEA 2R7KA 4O83A 4O7RA 4FGRA 4IIJF 2CZGA 2P0AA 4O2AF 4EG0A 4MA5A 5CB4F 4MV1A 4XZ3B 2I87A 2GQSA 3Q1KA 3KALA 3R5XA 2VQDA 2FPPB 4YAJB 2FB9A 1W96A 3VA7A 1VBHA 1I7LA 5HBRB 2QK4A 1BXRA 5BPFA 4WBNF 4L1KA 1WR2A 2YS7A 3TIGA 2DLNA 2R87A 1OBDA 1GSAA 2GPWA 3OUUA 2W6ZA 3VOTA 2NU6B 3SE7A 4I55F 2DWCA 4O81A 5BPHA 3U9SA 4O7LA 1A9XA 4HR7A 2IP4A 1GSHA 3Q2OA 3JZIA 4RZQA 1PX2A 3RFCA 3KREA 2R82A 4I4TF 4E4TA 3HB9A 4YAKB 1GSOA 5KX5F 4IWYA 5JQGF 4DLKA 1KEEA 2PVPA 2V5AA 2DIKA 3ORQA 4MV6A 2Z04A 2FP4B 2V58A 2XD4A 4ZHQF 2NU9B 1KC7A 3E5NA 3RUPA 1B6SA 4C5AA 3QFFA 4NYEA 2I8CA 1Z2PX 3VPBA 5BMVF 4IWXA 1W93A 3R5HA 5CAEB 5H80A 5CA0F 4XX0B 1UC8A 4MV4A 4XYLB 3MJFA 1KUTA 1ULZA 1IOVA 2Z02A 3JZFA 4TV9F 4O7NA 2GPSA 2YL2A 3K5IA 3V4SA 2CNVA 1KJ9A 4WD3A 4C5CA 4TV8F 2QF7A 1KJIA 1UC9A 4O7TA 5D8DA 2C00A 3AW8A 1A48A 4MV3A 2SCUB 5LXTF 1AUVA 3GIDA 3JRWA 2FPGB 2GLTA 3ETJA 4HNUA 2YZMA 2YRXA 1KJJA 2HJWA 4YJ3F 1KBLA 1OBGA 3NUAA 5LOVF 4FFMA 2W6NA 2W6MA 4YB8B 2YS6A 1T36A 1JLLB 2W6PA 2YWVA 4O7VA 4XYMB 2YZGA 3K3PA 4O4JF 3TQTA 4O7SA 2YRWA 2FPIB 2WYOA 2X0SA 4FFNA 3UFXB 3V4ZA 2YW2A 3DF7A 1VBGA 2NUAB
chains in the Genus database with same CATH superfamily
4J9LA 3H40A 4NLGA 4ECZA 2V9WA 5CA1F 2XCLA 1XDNA 5BWTA 3TEKA 2O03A 2ODTX 3I12A 4I50F 3U54A 1Y1VA 1N34H 1I2LA 5KT2A 2YYAA 4LFAH 1KT8A 1M7JA 4DV5H 2CNQA 2HVRA 4FFOA 3NC0B 4RNNA 5KG7A 3OUZA 2R86A 3JAMW 4Q43A 3Q8RB 5L1KA 4CMDA 5KFVA 4O84A 4MV7A 5FNVF 2YZLA 1C30A 3HBLA 5JQWA 1IBMH 2JA6G 4TUYF 4IHJF 5C1OA 5KFEA 2R7LA 2HHHH 1E4EB 3RAXA 1Y1WG 2PMZA 2R6FA 2UVRA 4PZ8A 4Q8EA 4QWEA 2Y0SA 4U7CA 1EZ1A 4DIMA 3Q8PB 4FS1A 1M0TA 4YBZB 4DV2H 2HGXA 2PMZE 3QZ7A 3RGZA 4DV7H 4HNVA 4FFLA 1BNCA 5KFTA 3GB8B 2NU8B 4PWQA 2AGQA 4X65H 2ZDHA 3HT5A 5BWRA 1FVIA 5KFKA 2R7NA 2JEGA 3H0GA 4CC6A 2W6QA 2W71A 4EYIB 2UXDH 2UVWA 1HR0H 5KFFA 4GKKH 3T9FA 1N32H 4QIWA 4ECXA 1S9FA 4ED7A 3OHAA 3OTOH 4EQ5A 1S10A 4O7ZA 1SCUB 4R8UB 3RAQA 2VUMG 2R93A 2W57A 4FFRA 3RJ0A 3F8NA 2V59A 4QIWE 4O3RA 3TY5A 4ZI7F 4J9MA 4YHHH 4DR1H 3K5HA 5DGIA 4Q45A 4QWAA 4DL2A 4IR9A 4J9KA 4A3FG 2CFMA 4O4HF 2JA7A 4RNOA 5KFWA 2PN1A 4YJ2F 3N43B 4M9UA 3BJYA 1AN7A 2VPQA 5GONF 5DISC 2C22A 4GLWA 1CQJB 4O82A 2WE6A 3MWEA 1BGWA 4EBDA 3GTKA 3G8DA 5L9XA 1DV1A 4BWSC 3HXLA 5I5VA 2CW7A 4YP3A 4YR3A 1E4EA 4DRFA 3QQMA 4PBCA 5KKNB 4A2BA 4AQYH 5DGAA 4EFEA 3R5FA 1KJ8A 4MA0A 1C3OA 4M7EA 2FLNA 2UUBH 2EIYA 4B3MH 4JI4H 4HN2A 1WH2A 2VPSA 3MR5A 4DR5H 4ED8A 5J2TF 5EOYA 4J9RA 3T5KA 1IBKH 4JV2A 2R7MA 3PFFA 3L4KA 2R8IA 5FPRA 4CMFA 4JI1H 3HOZG 1DIKA 4EGJA 2W6OA 2Q2TA 3WO0A 1I1LA 5J2UF 2RDIA 5KFQA 3GV5B 3V6HA 5KT4A 4QJFA 4HYKA 4A3MG 2R8GA 1FKAH 2R8JA 1AUXA 3RV3A 1N56A 5JVLA 2COGA 4EGQA 4DV6H 3I4NG 5KFBA 3T9EA 3V6KA 2QB5A 2J9GA 3LP8A 4O4LF 1OWTA 5KFXA 4U6PA 1XMOH 2RGRA 4ECSA 4NZOA 3TIIA 4CHIA 3IN5A 2WAQE 5DQHA 2HIXA 3R23A 3H20A 3G8CA 2ZGIA 4R8UA 2UUCH 1IOWA 1EYZA 4A2AA 3KHRA 4IAJA 1GGOA 3HO8A 5KG1A 4DV1H 4J9SA 3M9NB 2HGSA 5KG0A 4ME6A 4A3KG 4MAMA 4QWBA 3N6XA 5KFOA 1I2KA 3WO1A 1J5EH 5IWAH 4O7WA 4J9OA 5JVDF 2FMAA 3RBEA 2R84A 5HV6A 1TWAA 1TA8A 1RJRA 4BY1G 1SFOA 2DPJA 3KAJA 1RJQA 5FLXW 3VPCA 2HG8A 1TWFA 4DUYH 3NGDA 2ASDA 2E5LH 1TWHA 4LH7A 1XNRH 1DV2A 4UCRA 4KHPH 3WWJA 5KG3A 1PK8A 4TQSA 1CS0A 3ORRA 4IRDA 5KFGA 3PW0A 1KJQA 1E4FT 2CQYA 1EUCB 5LL6b 4PZ6A 2RGVA 3PR5B 3VPDA 5KT6A 2W8LA 2FK2A 1ZHQA 3FKIG 3RB0A 3U55A 3WNZA 5I5WA 1X9NA 2C2RA 1S97A 5DMXA 1TWGA 4LSAA 4O2BF 3AX6A 5F9NA 5K2MA 3BQ0A 1EHIA 2I80A 5CM0A 2COIA 2EJ0A 3JRXA 4FE2A 5DAAA 3RGXA 4RB2C 3MWDA 4UCTA 2VR1A 2HIVA 4MV9A 4LSXA 5EDWA 3SI8A 4IRKA 4LMYA 1Z2NX 2W70A 4O3PA 2DABA 5FR9A 5C3EG 3T1HH 3U9TA 5DQGA 1CE8A 4JI8H 4ECVA 4GKJH 2J6UA 1I6UA 4B3TH 3LWBA 3OHBA 4DL7A 4JI7H 5BWWA 3G6VA 1P8LA 4MV8A 4O86A 5KFAA 3KTMA 4ZQIA 1SYXB 3N6RA 4Q44A 4DV4H 3T1YH 4LF4H 3DTGA 3BAAA 3GIKA 4EFBA 4A3CG 3C0FB 4O7YA 2UU9H 4GLXA 3M4IA 5C1PA 4RB3C 2C2EA 4FFPA 1O75A 5DG8A 2JA5A 1UNNC 1B33N 5BYBA 4RCNA 4QSHA 5DGHA 3T7AA 3HKZA 1S0NA 4ECRA 3TINA 5BWUA 3N44B 4FM9A 3GLKA 2V4QA 4J0MA 2CNUA 1CQIB 3RTXA 4DL4A 5DLGA 1RYSA 3HKZE 5EZYF 1GLVA 4QWDA 4ECTA 3H3VH 1T94A 1A0IA 3PO2G 5LP6F 3R9RA 3T99A 2CKZB 4FU0A 2W7PA 4A3LG 1RJPA 1I7NA 1RK5A 1JKJB 3GIJA 4BBRG 3GQCA 4JI5H 1EUDB 2DZDA 4O4IF 2Y0SE 2J6TA 4BXXG 1VKZA 5I5XA 2ZDQA 1WCMG 2KSWA 2R92A 1TWCA 5KFDA 1B04A 4RB1A 1M6VA 4GC6A 3EYYA 4X62H 4A3EG 2OLSA 1Z2OX 4C5BA 2HDKA 4JI3H 1DAAA 5IT9W 3T5JA 3BA9A 4RZRA 3KAKA 3TW7A 3RR5A 4GC7A 4UCVA 3AYHB 5LYJF 3J7AK 4MTEA 4IZOA 1B6RA 4ECWA 5D1OB 3OSPA 5JH7F 4UCSA 5IYZF 4HQ6A 3N40P 1K83A 1IBLH 2JEJA 1JDBB 5KT7A 3BABA 4UCOA 1IYDA 5C8YF 2XGPA 4ZOLF 4A3BG 2B63G 4Y8VB 4K0KH 3CQZA 1EKVA 5I47A 2XCAA 2PBZA 4FBUA 3N8DA 2C28A 3PW7A 2JA6A 3LQSA 3BG5A 3QWUA 4HNTA 3T9BA 1G2WA 2YZNA 4X66H 3KHLA 4F4YA 4YR2A 5DGBA 4DR3H 2J6SA 4BY7G 1ZHSA 4TVIA 1Y1WA 2R85A 4JV5H 1TAEA 4F50A 3MR6A 4PZ7A 3J81W 4NZNA 1S0OA 2W9BB 2CW8A 3GIMA 2ZDGA 5K3WA 2GQRA 4X64H 2IMWP 5I5UA 1M0WA 3J80W 2R7ZG 4YY3H 2UXCH 3M9OB 1GO3E 4M0JA 4CKCA 3H4DA 3RV4A 3DAAA 3GILA 4O3NA 3UZBA 4EBCA 2BQUA 2UVUA 4LF5H 3ETHA 4A3IG 5I5YA 2AGOA 1I3QA 3RB3A 4LF6H 3VMMA 3CEBA 4A93G 1FJGH 2W7OA 2AGPA 4F4XA 5FLMG 4A3DG 4TM5A 2VQFH 1CKOA 2HGWA 3TW6A 4DR7H 2NU7B 5LA6F 1JDEA 4JI2H 3GTLA 1GYFA 2R7KA 2VUMA 4O83A 4UUGA 4RUCA 4O7RA 4FGRA 3T54A 2W8KA 3CSWA 5C4XG 3N41B 3TY9A 3HOVG 4QWCA 5D1OA 4ECYA 4LF8H 4IIJF 2QYZA 3BQ2A 1WSCA 2CZGA 2P0AA 4O2AF 5JUMA 5I5TA 4EG0A 4FBTA 3S24A 4MA5A 5CB4F 4LFBH 2E2HA 4MV1A 4XZ3B 2FE3A 2I87A 3KYHC 2GQSA 3T9AA 3Q1KA 1RK6A 5KG5A 3KHHA 1ZETA 1XNQH 3RF2A 2NVYA 2UVVA 5F9LA 2OWOA 3L2PA 3KALA 5T14A 1VS0A 4J9NA 3R5XA 2VQDA 4Q4CA 2FPPB 5KS8A 3FDSA 5KFYA 4YAJB 3CVZA 3NBYB 2W9CB 2FB9A 4AYBA 2R8HA 3T5LA 4UFZA 1EKFA 2JEFA 5FD6A 2W9BA 1Y14B 2HHFB 3UYYA 1W96A 3VA7A 1VBHA 2VA3A 1Y1VG 3KHGA 2VQEH 1I7LA 4DL3A 5HBRB 1IYEA 3PO3G 1N33H 3MFIA 2ATLA 2QK4A 5KFHA 1BXRA 5L1JA 5BPFA 3T9CA 4WBNF 4L1KA 2DPIA 3PW5A 4J9QA 1WR2A 2YS7A 2VA2A 3MFHA 3TIGA 5I5SA 4O3OA 2DLNA 3GJXB 1N48A 2R87A 4LH6A 1OBDA 1GSAA 2GPWA 3G6XA 3OUUA 4JXUA 4EBEA 2W6ZA 3GDEA 2NU6B 3SE7A 3VOTA 4LFCH 4RNMA 3PZPA 5E25A 1L2ZA 4I55F 3Q8QB 2EJ3A 3TQ1A 1BJTA 3IG0A 2DWCA 3SNOA 2XIGA 1I1KA 1JXLA 4ED2A 4O81A 5BPHA 4DR2H 3PVXA 3WWHA 1I50A 3U9SA 4TQRA 4Q0YA 3GV8B 3WWIA 4O7LA 4K6NA 2HVSA 1ZQ7A 5DLFA 2ASLA 5LMNH 4UCUA 1MZBA 1A9XA 2WTFA 2V4RA 3KXYT 4HR7A 2IP4A 1GSHA 3Q2OA 3JZIA 3PW2A 2AQ4A 2F4VH 4RZQA 3HOUG 1V51A 3UZOA 4ETSA 1PX2A 5KT5A 3RFCA 3KREA 3MR3A 2R82A 4CKBA 4I4TF 2W9CA 1DGSA 4E4TA 2R93G 4B3RH 3FMAA 3GIIA 4ECQA 2HHFA 1ET0A 3HB9A 4YAKB 1GSOA 4F4WA 5KX5F 5IP9G 4IWYA 2C35B 5JQGF 5DG9A 3RBDA 3LMLA 2YU9A 3FKIA 3JZ6A 1RYRA 4JYAH 4DLKA 3GTPA 3T9DA 1KEEA 3OSNA 2YCHA 3V6JA 3H4BA 2NVXA 2X5RA 4CE5A 4I7HA 2JA7G 5BYAA 2PVPA 3RB6A 2V5AA 2DIKA 3ORQA 4MV6A 5KFIA 1S0MA 2Z04A 3SGIA 5CR5A 2FP4B 3W1GA 3PW4A 2R8KA 2V58A 2XD4A 4B3SH 4ZHQF 2NU9B 1JIHA 2FLPA 1A0GA 4R7RA 4NXNH 2Y4RA 3E5NA 1KC7A 3RUPA 2FLLA 1B6SA 4C5AA 1V4YA 2BR0A 1CKNB 4LF9H 3QFFA 2EJ2A 2HVQA 2FJZA 4MTDA 2XGQA 4NYEA 3G6YA 3GIPA 2JA8G 3I4MG 2I8CA 1Z2PX 4PDBA 2XCPA 4EEYA 2Q7DA 3VPBA 4IWXA 5BMVF 2RF4A 3BACA 2WB1A 4DR6H 3GTMA 3MWMA 1W93A 4CKEA 3R5HA 1T3NA 2IBKA 5CAEB 1UC8A 5H80A 4XX0B 5CA0F 5KG6A 3U0GA 1E4GT 2WB1E 3QZ8A 5KFMA 2JEIA 4JI0H 3W1BA 4MV4A 4XYLB 3M9MB 1JX4A 3MJFA 3VNNA 4C2MA 5KFCA 2FK1A 4JUZA 5KFLA 3PR4A 1KUTA 1ULZA 4E6NA 4OX9H 5KFJA 1IOVA 2Z02A 3JZFA 5L1LA 4A3GG 4JI6H 5KT3A 4O3QA 4TV9F 3W5OA 4O7NA 4ECUA 2UXBH 2IA6A 2ASJA 1I94H 1S68A 4Q8FA 4JV1A 2GPSA 2YL2A 3K5IA 4JV0A 5L1IA 4A3JG 2VOBA 3V4SA 4IR1A 3JSLA 3PN1A 2CNVA 1KTAA 3EPIA 1WCMA 2FKLA 4EEQA 5KG2A 1KJ9A 3HOXG 4DV0H 1K1QA 2M05A 4WD3A 4DL6A 4IRCA 3DTFA 4C5CA 1UC9A 2QF7A 1KJIA 4TV8F 2FK3A 4DV3H 1HNXH 4DQNA 4O7TA 5D8DA 2VUGA 1ZAUA 4EYHB 5FPOA 2C00A 5KFRA 2COJA 4DR4H 3AW8A 3Q8SB 4RU9A 3HOYG 1A48A 1R9TA 5IP7G 1HNZH 4MV3A 2SCUB 3GTGA 5LXTF 1AUVA 1CKMA 1I1MA 3GIDA 3JRWA 2XC9A 3GTJA 3GTQA 2BQ3A 1CKNA 1XMQH 3TY8A 3JSNA 3GV7B 5HNEA 2FPGB 5CE8A 5DQIA 2DAAA 2GLTA 3ETJA 5IYCG 4J9PA 2BQRA 4DAAA 4HNUA 1SEIA 2YZMA 3GIQA 1N36H 2UUAH 5BR8H 1V9PA 2YRXA 4LF7H 2B63A 1KJJA 2C2DA 2HJWA 4ED3A 4YJ3F 5BWXA 2WAQA 4WHXA 4YR0A 5I60A 2ALZA 5KFPA 2AU0A 4QW8A 3BQ1A 4ED6A 1KBLA 1OBGA 4QW9A 3NUAA 5LOVF 4FFMA 4F4ZA 4CC5A 5EWFA 2WDTA 4BBSG 2ABJA 3RB4A 3GTOA 3UQ8A 2OH2A 3MR2A 1EKPA 2W6NA 4ED0A 2R7ZA 3BA8A 5FD5A 2W6MA 5EWGA 1XK5A 2E2IA 4YB8B 5A2QW 5FJ8G 2YS6A 4AYBE 1HNWH 1T36A 5IYBG 2RDJA 1JLLB 5KFNA 2W6PA 2YWVA 4RB0A 4O7VA 2JA5G 5LMUH 4XYMB 2ZM6H 2YZGA 4APMA 3L4JA 5KFSA 4G3IA 3K3PA 5IYDG 1WRVA 4O4JF 3TQTA 2MCTA 2Q2UA 5BWVA 4O7SA 3HOWG 2YRWA 3NBZB 2FPIB 4ED1A 2WYOA 4YQWA 4NZMA 1A3GA 1VAJA 1S03G 4RAYA 2X0SA 4RUAA 2W9AA 2ZJTA 4FFNA 4DUZH 3N42B 4FS2A 5KFZA 3UFXB 4RAZA 5KG4A 3T5HA 3V4ZA 4O3SA 5C44G 2YW2A 1P16A 2A1HA 3LULA 3K3VA 5EWEA 4Q4DA 5C5JA 3DF7A 3RIZA 1K1SA 3H0GG 2R92G 4NXMH 1VBGA 5D1PA 4DL5A 5KFUA 3EPGA 2NUAB 5DG7A
chains in the Genus database with same CATH topology
5CA1F 2XCLA 4I50F 3I12A 3U54A 2YYAA 2CNQA 4FFOA 3OUZA 2R86A 4O84A 4MV7A 5FNVF 2YZLA 1C30A 3HBLA 5JQWA 4TUYF 4IHJF 5C1OA 2R7LA 1E4EB 2R6FA 1EZ1A 4DIMA 1M0TA 4YBZB 4HNVA 4FFLA 1BNCA 2NU8B 2ZDHA 2R7NA 2W6QA 2W71A 4O7ZA 1SCUB 4FFRA 2V59A 4ZI7F 3K5HA 4O4HF 2PN1A 4YJ2F 4M9UA 2VPQA 5GONF 4O82A 1CQJB 3MWEA 3G8DA 1DV1A 1E4EA 5KKNB 3R5FA 1KJ8A 4MA0A 1C3OA 5J2TF 2R7MA 1DIKA 4EGJA 2W6OA 3WO0A 5J2UF 1AUXA 3RV3A 5JVLA 4EGQA 2J9GA 3LP8A 4O4LF 3TIIA 3R23A 3G8CA 1IOWA 1EYZA 1GGOA 3HO8A 2HGSA 4ME6A 4MAMA 3WO1A 4O7WA 5JVDF 2R84A 5HV6A 3KAJA 3VPCA 1DV2A 1PK8A 1CS0A 3ORRA 1KJQA 2CQYA 1EUCB 3VPDA 3U55A 3WNZA 5DMXA 4O2BF 3AX6A 5K2MA 1EHIA 2I80A 3JRXA 4FE2A 3MWDA 2VR1A 4MV9A 1Z2NX 2W70A 3U9TA 1CE8A 3LWBA 4MV8A 4O86A 4ZQIA 3N6RA 4O7YA 5C1PA 4FFPA 4QSHA 3TINA 3GLKA 2CNUA 1CQIB 5EZYF 1GLVA 5LP6F 3R9RA 4FU0A 1I7NA 1JKJB 1EUDB 2DZDA 4O4IF 1VKZA 2ZDQA 1M6VA 2OLSA 1Z2OX 4C5BA 3KAKA 5LYJF 4IZOA 1B6RA 5JH7F 5IYZF 4HQ6A 1JDBB 5C8YF 4ZOLF 4Y8VB 5I47A 2PBZA 3N8DA 3BG5A 4HNTA 2YZNA 2R85A 2ZDGA 2GQRA 1M0WA 3RV4A 3ETHA 3VMMA 3TW6A 2NU7B 5LA6F 1JDEA 2R7KA 4O83A 4O7RA 4FGRA 4IIJF 2CZGA 2P0AA 4O2AF 4EG0A 4MA5A 5CB4F 4MV1A 4XZ3B 2I87A 2GQSA 3Q1KA 3KALA 3R5XA 2VQDA 2FPPB 4YAJB 2FB9A 1W96A 3VA7A 1VBHA 1I7LA 5HBRB 2QK4A 1BXRA 5BPFA 4WBNF 4L1KA 1WR2A 2YS7A 3TIGA 2DLNA 2R87A 1OBDA 1GSAA 2GPWA 3OUUA 2W6ZA 3VOTA 2NU6B 3SE7A 4I55F 2DWCA 4O81A 5BPHA 3U9SA 4O7LA 1A9XA 4HR7A 2IP4A 1GSHA 3Q2OA 3JZIA 4RZQA 1PX2A 3RFCA 3KREA 2R82A 4I4TF 4E4TA 3HB9A 4YAKB 1GSOA 5KX5F 4IWYA 5JQGF 4DLKA 1KEEA 2PVPA 2V5AA 2DIKA 3ORQA 4MV6A 2Z04A 2FP4B 2V58A 2XD4A 4ZHQF 2NU9B 1KC7A 3E5NA 3RUPA 1B6SA 4C5AA 3QFFA 4NYEA 2I8CA 1Z2PX 3VPBA 5BMVF 4IWXA 1W93A 3R5HA 5CAEB 5H80A 5CA0F 4XX0B 1UC8A 4MV4A 4XYLB 3MJFA 1KUTA 1ULZA 1IOVA 2Z02A 3JZFA 4TV9F 4O7NA 2GPSA 2YL2A 3K5IA 3V4SA 2CNVA 1KJ9A 4WD3A 4C5CA 4TV8F 2QF7A 1KJIA 1UC9A 4O7TA 5D8DA 2C00A 3AW8A 1A48A 4MV3A 2SCUB 5LXTF 1AUVA 3GIDA 3JRWA 2FPGB 2GLTA 3ETJA 4HNUA 2YZMA 2YRXA 1KJJA 2HJWA 4YJ3F 1KBLA 1OBGA 3NUAA 5LOVF 4FFMA 2W6NA 2W6MA 4YB8B 2YS6A 1T36A 1JLLB 2W6PA 2YWVA 4O7VA 4XYMB 2YZGA 3K3PA 4O4JF 3TQTA 4O7SA 2YRWA 2FPIB 2WYOA 2X0SA 4FFNA 3UFXB 3V4ZA 2YW2A 3DF7A 1VBGA 2NUAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CA1 F;  2XCL A;  4I50 F;  3I12 A;  3U54 A;  2YYA A;  2CNQ A;  4FFO A;  3OUZ A;  2R86 A;  4O84 A;  4MV7 A;  5FNV F;  2YZL A;  1C30 A;  3HBL A;  5JQW A;  4TUY F;  4IHJ F;  5C1O A;  2R7L A;  1E4E B;  2R6F A;  1EZ1 A;  4DIM A;  1M0T A;  4YBZ B;  4HNV A;  4FFL A;  1BNC A;  2NU8 B;  2ZDH A;  2R7N A;  2W6Q A;  2W71 A;  4O7Z A;  1SCU B;  4FFR A;  2V59 A;  4ZI7 F;  3K5H A;  4O4H F;  2PN1 A;  4YJ2 F;  4M9U A;  2VPQ A;  5GON F;  4O82 A;  1CQJ B;  3MWE A;  3G8D A;  1DV1 A;  1E4E A;  5KKN B;  3R5F A;  1KJ8 A;  4MA0 A;  1C3O A;  5J2T F;  2R7M A;  1DIK A;  4EGJ A;  2W6O A;  3WO0 A;  5J2U F;  1AUX A;  3RV3 A;  5JVL A;  4EGQ A;  2J9G A;  3LP8 A;  4O4L F;  3TII A;  3R23 A;  3G8C A;  1IOW A;  1EYZ A;  1GGO A;  3HO8 A;  2HGS A;  4ME6 A;  4MAM A;  3WO1 A;  4O7W A;  5JVD F;  2R84 A;  5HV6 A;  3KAJ A;  3VPC A;  1DV2 A;  1PK8 A;  1CS0 A;  3ORR A;  1KJQ A;  2CQY A;  1EUC B;  3VPD A;  3U55 A;  3WNZ A;  5DMX A;  4O2B F;  3AX6 A;  5K2M A;  1EHI A;  2I80 A;  3JRX A;  4FE2 A;  3MWD A;  2VR1 A;  4MV9 A;  1Z2N X;  2W70 A;  3U9T A;  1CE8 A;  3LWB A;  4MV8 A;  4O86 A;  4ZQI A;  3N6R A;  4O7Y A;  5C1P A;  4FFP A;  4QSH A;  3TIN A;  3GLK A;  2CNU A;  1CQI B;  5EZY F;  1GLV A;  5LP6 F;  3R9R A;  4FU0 A;  1I7N A;  1JKJ B;  1EUD B;  2DZD A;  4O4I F;  1VKZ A;  2ZDQ A;  1M6V A;  2OLS A;  1Z2O X;  4C5B A;  3KAK A;  5LYJ F;  4IZO A;  1B6R A;  5JH7 F;  5IYZ F;  4HQ6 A;  1JDB B;  5C8Y F;  4ZOL F;  4Y8V B;  5I47 A;  2PBZ A;  3N8D A;  3BG5 A;  4HNT A;  2YZN A;  2R85 A;  2ZDG A;  2GQR A;  1M0W A;  3RV4 A;  3ETH A;  3VMM A;  3TW6 A;  2NU7 B;  5LA6 F;  1JDE A;  2R7K A;  4O83 A;  4O7R A;  4FGR A;  4IIJ F;  2CZG A;  2P0A A;  4O2A F;  4EG0 A;  4MA5 A;  5CB4 F;  4MV1 A;  4XZ3 B;  2I87 A;  2GQS A;  3Q1K A;  3KAL A;  3R5X A;  2VQD A;  2FPP B;  4YAJ B;  2FB9 A;  1W96 A;  3VA7 A;  1VBH A;  1I7L A;  5HBR B;  2QK4 A;  1BXR A;  5BPF A;  4WBN F;  4L1K A;  1WR2 A;  2YS7 A;  3TIG A;  2DLN A;  2R87 A;  1OBD A;  1GSA A;  2GPW A;  3OUU A;  2W6Z A;  3VOT A;  2NU6 B;  3SE7 A;  4I55 F;  2DWC A;  4O81 A;  5BPH A;  3U9S A;  4O7L A;  1A9X A;  4HR7 A;  2IP4 A;  1GSH A;  3Q2O A;  3JZI A;  4RZQ A;  1PX2 A;  3RFC A;  3KRE A;  2R82 A;  4I4T F;  4E4T A;  3HB9 A;  4YAK B;  1GSO A;  5KX5 F;  4IWY A;  5JQG F;  4DLK A;  1KEE A;  2PVP A;  2V5A A;  2DIK A;  3ORQ A;  4MV6 A;  2Z04 A;  2FP4 B;  2V58 A;  2XD4 A;  4ZHQ F;  2NU9 B;  1KC7 A;  3E5N A;  3RUP A;  1B6S A;  4C5A A;  3QFF A;  4NYE A;  2I8C A;  1Z2P X;  3VPB A;  5BMV F;  4IWX A;  1W93 A;  3R5H A;  5CAE B;  5H80 A;  5CA0 F;  4XX0 B;  1UC8 A;  4MV4 A;  4XYL B;  3MJF A;  1KUT A;  1ULZ A;  1IOV A;  2Z02 A;  3JZF A;  4TV9 F;  4O7N A;  2GPS A;  2YL2 A;  3K5I A;  3V4S A;  2CNV A;  1KJ9 A;  4WD3 A;  4C5C A;  4TV8 F;  2QF7 A;  1KJI A;  1UC9 A;  4O7T A;  5D8D A;  2C00 A;  3AW8 A;  1A48 A;  4MV3 A;  2SCU B;  5LXT F;  1AUV A;  3GID A;  3JRW A;  2FPG B;  2GLT A;  3ETJ A;  4HNU A;  2YZM A;  2YRX A;  1KJJ A;  2HJW A;  4YJ3 F;  1KBL A;  1OBG A;  3NUA A;  5LOV F;  4FFM A;  2W6N A;  2W6M A;  4YB8 B;  2YS6 A;  1T36 A;  1JLL B;  2W6P A;  2YWV A;  4O7V A;  4XYM B;  2YZG A;  3K3P A;  4O4J F;  3TQT A;  4O7S A;  2YRW A;  2FPI B;  2WYO A;  2X0S A;  4FFN A;  3UFX B;  3V4Z A;  2YW2 A;  3DF7 A;  1VBG A;  2NUA B; 
#chains in the Genus database with same CATH topology
 4J9L A;  3H40 A;  4NLG A;  4ECZ A;  2V9W A;  5CA1 F;  2XCL A;  1XDN A;  5BWT A;  3TEK A;  2O03 A;  2ODT X;  3I12 A;  4I50 F;  3U54 A;  1Y1V A;  1N34 H;  1I2L A;  5KT2 A;  2YYA A;  4LFA H;  1KT8 A;  1M7J A;  4DV5 H;  2CNQ A;  2HVR A;  4FFO A;  3NC0 B;  4RNN A;  5KG7 A;  3OUZ A;  2R86 A;  3JAM W;  4Q43 A;  3Q8R B;  5L1K A;  4CMD A;  5KFV A;  4O84 A;  4MV7 A;  5FNV F;  2YZL A;  1C30 A;  3HBL A;  5JQW A;  1IBM H;  2JA6 G;  4TUY F;  4IHJ F;  5C1O A;  5KFE A;  2R7L A;  2HHH H;  1E4E B;  3RAX A;  1Y1W G;  2PMZ A;  2R6F A;  2UVR A;  4PZ8 A;  4Q8E A;  4QWE A;  2Y0S A;  4U7C A;  1EZ1 A;  4DIM A;  3Q8P B;  4FS1 A;  1M0T A;  4YBZ B;  4DV2 H;  2HGX A;  2PMZ E;  3QZ7 A;  3RGZ A;  4DV7 H;  4HNV A;  4FFL A;  1BNC A;  5KFT A;  3GB8 B;  2NU8 B;  4PWQ A;  2AGQ A;  4X65 H;  2ZDH A;  3HT5 A;  5BWR A;  1FVI A;  5KFK A;  2R7N A;  2JEG A;  3H0G A;  4CC6 A;  2W6Q A;  2W71 A;  4EYI B;  2UXD H;  2UVW A;  1HR0 H;  5KFF A;  4GKK H;  3T9F A;  1N32 H;  4QIW A;  4ECX A;  1S9F A;  4ED7 A;  3OHA A;  3OTO H;  4EQ5 A;  1S10 A;  4O7Z A;  1SCU B;  4R8U B;  3RAQ A;  2VUM G;  2R93 A;  2W57 A;  4FFR A;  3RJ0 A;  3F8N A;  2V59 A;  4QIW E;  4O3R A;  3TY5 A;  4ZI7 F;  4J9M A;  4YHH H;  4DR1 H;  3K5H A;  5DGI A;  4Q45 A;  4QWA A;  4DL2 A;  4IR9 A;  4J9K A;  4A3F G;  2CFM A;  4O4H F;  2JA7 A;  4RNO A;  5KFW A;  2PN1 A;  4YJ2 F;  3N43 B;  4M9U A;  3BJY A;  1AN7 A;  2VPQ A;  5GON F;  5DIS C;  2C22 A;  4GLW A;  1CQJ B;  4O82 A;  2WE6 A;  3MWE A;  1BGW A;  4EBD A;  3GTK A;  3G8D A;  5L9X A;  1DV1 A;  4BWS C;  3HXL A;  5I5V A;  2CW7 A;  4YP3 A;  4YR3 A;  1E4E A;  4DRF A;  3QQM A;  4PBC A;  5KKN B;  4A2B A;  4AQY H;  5DGA A;  4EFE A;  3R5F A;  1KJ8 A;  4MA0 A;  1C3O A;  4M7E A;  2FLN A;  2UUB H;  2EIY A;  4B3M H;  4JI4 H;  4HN2 A;  1WH2 A;  2VPS A;  3MR5 A;  4DR5 H;  4ED8 A;  5J2T F;  5EOY A;  4J9R A;  3T5K A;  1IBK H;  4JV2 A;  2R7M A;  3PFF A;  3L4K A;  2R8I A;  5FPR A;  4CMF A;  4JI1 H;  3HOZ G;  1DIK A;  4EGJ A;  2W6O A;  2Q2T A;  3WO0 A;  1I1L A;  5J2U F;  2RDI A;  5KFQ A;  3GV5 B;  3V6H A;  5KT4 A;  4QJF A;  4HYK A;  4A3M G;  2R8G A;  1FKA H;  2R8J A;  1AUX A;  3RV3 A;  1N56 A;  5JVL A;  2COG A;  4EGQ A;  4DV6 H;  3I4N G;  5KFB A;  3T9E A;  3V6K A;  2QB5 A;  2J9G A;  3LP8 A;  4O4L F;  1OWT A;  5KFX A;  4U6P A;  1XMO H;  2RGR A;  4ECS A;  4NZO A;  3TII A;  4CHI A;  3IN5 A;  2WAQ E;  5DQH A;  2HIX A;  3R23 A;  3H20 A;  3G8C A;  2ZGI A;  4R8U A;  2UUC H;  1IOW A;  1EYZ A;  4A2A A;  3KHR A;  4IAJ A;  1GGO A;  3HO8 A;  5KG1 A;  4DV1 H;  4J9S A;  3M9N B;  2HGS A;  5KG0 A;  4ME6 A;  4A3K G;  4MAM A;  4QWB A;  3N6X A;  5KFO A;  1I2K A;  3WO1 A;  1J5E H;  5IWA H;  4O7W A;  4J9O A;  5JVD F;  2FMA A;  3RBE A;  2R84 A;  5HV6 A;  1TWA A;  1TA8 A;  1RJR A;  4BY1 G;  1SFO A;  2DPJ A;  3KAJ A;  1RJQ A;  5FLX W;  3VPC A;  2HG8 A;  1TWF A;  4DUY H;  3NGD A;  2ASD A;  2E5L H;  1TWH A;  4LH7 A;  1XNR H;  1DV2 A;  4UCR A;  4KHP H;  3WWJ A;  5KG3 A;  1PK8 A;  4TQS A;  1CS0 A;  3ORR A;  4IRD A;  5KFG A;  3PW0 A;  1KJQ A;  1E4F T;  2CQY A;  1EUC B;  5LL6 b;  4PZ6 A;  2RGV A;  3PR5 B;  3VPD A;  5KT6 A;  2W8L A;  2FK2 A;  1ZHQ A;  3FKI G;  3RB0 A;  3U55 A;  3WNZ A;  5I5W A;  1X9N A;  2C2R A;  1S97 A;  5DMX A;  1TWG A;  4LSA A;  4O2B F;  3AX6 A;  5F9N A;  5K2M A;  3BQ0 A;  1EHI A;  2I80 A;  5CM0 A;  2COI A;  2EJ0 A;  3JRX A;  4FE2 A;  5DAA A;  3RGX A;  4RB2 C;  3MWD A;  4UCT A;  2VR1 A;  2HIV A;  4MV9 A;  4LSX A;  5EDW A;  3SI8 A;  4IRK A;  4LMY A;  1Z2N X;  2W70 A;  4O3P A;  2DAB A;  5FR9 A;  5C3E G;  3T1H H;  3U9T A;  5DQG A;  1CE8 A;  4JI8 H;  4ECV A;  4GKJ H;  2J6U A;  1I6U A;  4B3T H;  3LWB A;  3OHB A;  4DL7 A;  4JI7 H;  5BWW A;  3G6V A;  1P8L A;  4MV8 A;  4O86 A;  5KFA A;  3KTM A;  4ZQI A;  1SYX B;  3N6R A;  4Q44 A;  4DV4 H;  3T1Y H;  4LF4 H;  3DTG A;  3BAA A;  3GIK A;  4EFB A;  4A3C G;  3C0F B;  4O7Y A;  2UU9 H;  4GLX A;  3M4I A;  5C1P A;  4RB3 C;  2C2E A;  4FFP A;  1O75 A;  5DG8 A;  2JA5 A;  1UNN C;  1B33 N;  5BYB A;  4RCN A;  4QSH A;  5DGH A;  3T7A A;  3HKZ A;  1S0N A;  4ECR A;  3TIN A;  5BWU A;  3N44 B;  4FM9 A;  3GLK A;  2V4Q A;  4J0M A;  2CNU A;  1CQI B;  3RTX A;  4DL4 A;  5DLG A;  1RYS A;  3HKZ E;  5EZY F;  1GLV A;  4QWD A;  4ECT A;  3H3V H;  1T94 A;  1A0I A;  3PO2 G;  5LP6 F;  3R9R A;  3T99 A;  2CKZ B;  4FU0 A;  2W7P A;  4A3L G;  1RJP A;  1I7N A;  1RK5 A;  1JKJ B;  3GIJ A;  4BBR G;  3GQC A;  4JI5 H;  1EUD B;  2DZD A;  4O4I F;  2Y0S E;  2J6T A;  4BXX G;  1VKZ A;  5I5X A;  2ZDQ A;  1WCM G;  2KSW A;  2R92 A;  1TWC A;  5KFD A;  1B04 A;  4RB1 A;  1M6V A;  4GC6 A;  3EYY A;  4X62 H;  4A3E G;  2OLS A;  1Z2O X;  4C5B A;  2HDK A;  4JI3 H;  1DAA A;  5IT9 W;  3T5J A;  3BA9 A;  4RZR A;  3KAK A;  3TW7 A;  3RR5 A;  4GC7 A;  4UCV A;  3AYH B;  5LYJ F;  3J7A K;  4MTE A;  4IZO A;  1B6R A;  4ECW A;  5D1O B;  3OSP A;  5JH7 F;  4UCS A;  5IYZ F;  4HQ6 A;  3N40 P;  1K83 A;  1IBL H;  2JEJ A;  1JDB B;  5KT7 A;  3BAB A;  4UCO A;  1IYD A;  5C8Y F;  2XGP A;  4ZOL F;  4A3B G;  2B63 G;  4Y8V B;  4K0K H;  3CQZ A;  1EKV A;  5I47 A;  2XCA A;  2PBZ A;  4FBU A;  3N8D A;  2C28 A;  3PW7 A;  2JA6 A;  3LQS A;  3BG5 A;  3QWU A;  4HNT A;  3T9B A;  1G2W A;  2YZN A;  4X66 H;  3KHL A;  4F4Y A;  4YR2 A;  5DGB A;  4DR3 H;  2J6S A;  4BY7 G;  1ZHS A;  4TVI A;  1Y1W A;  2R85 A;  4JV5 H;  1TAE A;  4F50 A;  3MR6 A;  4PZ7 A;  3J81 W;  4NZN A;  1S0O A;  2W9B B;  2CW8 A;  3GIM A;  2ZDG A;  5K3W A;  2GQR A;  4X64 H;  2IMW P;  5I5U A;  1M0W A;  3J80 W;  2R7Z G;  4YY3 H;  2UXC H;  3M9O B;  1GO3 E;  4M0J A;  4CKC A;  3H4D A;  3RV4 A;  3DAA A;  3GIL A;  4O3N A;  3UZB A;  4EBC A;  2BQU A;  2UVU A;  4LF5 H;  3ETH A;  4A3I G;  5I5Y A;  2AGO A;  1I3Q A;  3RB3 A;  4LF6 H;  3VMM A;  3CEB A;  4A93 G;  1FJG H;  2W7O A;  2AGP A;  4F4X A;  5FLM G;  4A3D G;  4TM5 A;  2VQF H;  1CKO A;  2HGW A;  3TW6 A;  4DR7 H;  2NU7 B;  5LA6 F;  1JDE A;  4JI2 H;  3GTL A;  1GYF A;  2R7K A;  2VUM A;  4O83 A;  4UUG A;  4RUC A;  4O7R A;  4FGR A;  3T54 A;  2W8K A;  3CSW A;  5C4X G;  3N41 B;  3TY9 A;  3HOV G;  4QWC A;  5D1O A;  4ECY A;  4LF8 H;  4IIJ F;  2QYZ A;  3BQ2 A;  1WSC A;  2CZG A;  2P0A A;  4O2A F;  5JUM A;  5I5T A;  4EG0 A;  4FBT A;  3S24 A;  4MA5 A;  5CB4 F;  4LFB H;  2E2H A;  4MV1 A;  4XZ3 B;  2FE3 A;  2I87 A;  3KYH C;  2GQS A;  3T9A A;  3Q1K A;  1RK6 A;  5KG5 A;  3KHH A;  1ZET A;  1XNQ H;  3RF2 A;  2NVY A;  2UVV A;  5F9L A;  2OWO A;  3L2P A;  3KAL A;  5T14 A;  1VS0 A;  4J9N A;  3R5X A;  2VQD A;  4Q4C A;  2FPP B;  5KS8 A;  3FDS A;  5KFY A;  4YAJ B;  3CVZ A;  3NBY B;  2W9C B;  2FB9 A;  4AYB A;  2R8H A;  3T5L A;  4UFZ A;  1EKF A;  2JEF A;  5FD6 A;  2W9B A;  1Y14 B;  2HHF B;  3UYY A;  1W96 A;  3VA7 A;  1VBH A;  2VA3 A;  1Y1V G;  3KHG A;  2VQE H;  1I7L A;  4DL3 A;  5HBR B;  1IYE A;  3PO3 G;  1N33 H;  3MFI A;  2ATL A;  2QK4 A;  5KFH A;  1BXR A;  5L1J A;  5BPF A;  3T9C A;  4WBN F;  4L1K A;  2DPI A;  3PW5 A;  4J9Q A;  1WR2 A;  2YS7 A;  2VA2 A;  3MFH A;  3TIG A;  5I5S A;  4O3O A;  2DLN A;  3GJX B;  1N48 A;  2R87 A;  4LH6 A;  1OBD A;  1GSA A;  2GPW A;  3G6X A;  3OUU A;  4JXU A;  4EBE A;  2W6Z A;  3GDE A;  2NU6 B;  3SE7 A;  3VOT A;  4LFC H;  4RNM A;  3PZP A;  5E25 A;  1L2Z A;  4I55 F;  3Q8Q B;  2EJ3 A;  3TQ1 A;  1BJT A;  3IG0 A;  2DWC A;  3SNO A;  2XIG A;  1I1K A;  1JXL A;  4ED2 A;  4O81 A;  5BPH A;  4DR2 H;  3PVX A;  3WWH A;  1I50 A;  3U9S A;  4TQR A;  4Q0Y A;  3GV8 B;  3WWI A;  4O7L A;  4K6N A;  2HVS A;  1ZQ7 A;  5DLF A;  2ASL A;  5LMN H;  4UCU A;  1MZB A;  1A9X A;  2WTF A;  2V4R A;  3KXY T;  4HR7 A;  2IP4 A;  1GSH A;  3Q2O A;  3JZI A;  3PW2 A;  2AQ4 A;  2F4V H;  4RZQ A;  3HOU G;  1V51 A;  3UZO A;  4ETS A;  1PX2 A;  5KT5 A;  3RFC A;  3KRE A;  3MR3 A;  2R82 A;  4CKB A;  4I4T F;  2W9C A;  1DGS A;  4E4T A;  2R93 G;  4B3R H;  3FMA A;  3GII A;  4ECQ A;  2HHF A;  1ET0 A;  3HB9 A;  4YAK B;  1GSO A;  4F4W A;  5KX5 F;  5IP9 G;  4IWY A;  2C35 B;  5JQG F;  5DG9 A;  3RBD A;  3LML A;  2YU9 A;  3FKI A;  3JZ6 A;  1RYR A;  4JYA H;  4DLK A;  3GTP A;  3T9D A;  1KEE A;  3OSN A;  2YCH A;  3V6J A;  3H4B A;  2NVX A;  2X5R A;  4CE5 A;  4I7H A;  2JA7 G;  5BYA A;  2PVP A;  3RB6 A;  2V5A A;  2DIK A;  3ORQ A;  4MV6 A;  5KFI A;  1S0M A;  2Z04 A;  3SGI A;  5CR5 A;  2FP4 B;  3W1G A;  3PW4 A;  2R8K A;  2V58 A;  2XD4 A;  4B3S H;  4ZHQ F;  2NU9 B;  1JIH A;  2FLP A;  1A0G A;  4R7R A;  4NXN H;  2Y4R A;  3E5N A;  1KC7 A;  3RUP A;  2FLL A;  1B6S A;  4C5A A;  1V4Y A;  2BR0 A;  1CKN B;  4LF9 H;  3QFF A;  2EJ2 A;  2HVQ A;  2FJZ A;  4MTD A;  2XGQ A;  4NYE A;  3G6Y A;  3GIP A;  2JA8 G;  3I4M G;  2I8C A;  1Z2P X;  4PDB A;  2XCP A;  4EEY A;  2Q7D A;  3VPB A;  4IWX A;  5BMV F;  2RF4 A;  3BAC A;  2WB1 A;  4DR6 H;  3GTM A;  3MWM A;  1W93 A;  4CKE A;  3R5H A;  1T3N A;  2IBK A;  5CAE B;  1UC8 A;  5H80 A;  4XX0 B;  5CA0 F;  5KG6 A;  3U0G A;  1E4G T;  2WB1 E;  3QZ8 A;  5KFM A;  2JEI A;  4JI0 H;  3W1B A;  4MV4 A;  4XYL B;  3M9M B;  1JX4 A;  3MJF A;  3VNN A;  4C2M A;  5KFC A;  2FK1 A;  4JUZ A;  5KFL A;  3PR4 A;  1KUT A;  1ULZ A;  4E6N A;  4OX9 H;  5KFJ A;  1IOV A;  2Z02 A;  3JZF A;  5L1L A;  4A3G G;  4JI6 H;  5KT3 A;  4O3Q A;  4TV9 F;  3W5O A;  4O7N A;  4ECU A;  2UXB H;  2IA6 A;  2ASJ A;  1I94 H;  1S68 A;  4Q8F A;  4JV1 A;  2GPS A;  2YL2 A;  3K5I A;  4JV0 A;  5L1I A;  4A3J G;  2VOB A;  3V4S A;  4IR1 A;  3JSL A;  3PN1 A;  2CNV A;  1KTA A;  3EPI A;  1WCM A;  2FKL A;  4EEQ A;  5KG2 A;  1KJ9 A;  3HOX G;  4DV0 H;  1K1Q A;  2M05 A;  4WD3 A;  4DL6 A;  4IRC A;  3DTF A;  4C5C A;  1UC9 A;  2QF7 A;  1KJI A;  4TV8 F;  2FK3 A;  4DV3 H;  1HNX H;  4DQN A;  4O7T A;  5D8D A;  2VUG A;  1ZAU A;  4EYH B;  5FPO A;  2C00 A;  5KFR A;  2COJ A;  4DR4 H;  3AW8 A;  3Q8S B;  4RU9 A;  3HOY G;  1A48 A;  1R9T A;  5IP7 G;  1HNZ H;  4MV3 A;  2SCU B;  3GTG A;  5LXT F;  1AUV A;  1CKM A;  1I1M A;  3GID A;  3JRW A;  2XC9 A;  3GTJ A;  3GTQ A;  2BQ3 A;  1CKN A;  1XMQ H;  3TY8 A;  3JSN A;  3GV7 B;  5HNE A;  2FPG B;  5CE8 A;  5DQI A;  2DAA A;  2GLT A;  3ETJ A;  5IYC G;  4J9P A;  2BQR A;  4DAA A;  4HNU A;  1SEI A;  2YZM A;  3GIQ A;  1N36 H;  2UUA H;  5BR8 H;  1V9P A;  2YRX A;  4LF7 H;  2B63 A;  1KJJ A;  2C2D A;  2HJW A;  4ED3 A;  4YJ3 F;  5BWX A;  2WAQ A;  4WHX A;  4YR0 A;  5I60 A;  2ALZ A;  5KFP A;  2AU0 A;  4QW8 A;  3BQ1 A;  4ED6 A;  1KBL A;  1OBG A;  4QW9 A;  3NUA A;  5LOV F;  4FFM A;  4F4Z A;  4CC5 A;  5EWF A;  2WDT A;  4BBS G;  2ABJ A;  3RB4 A;  3GTO A;  3UQ8 A;  2OH2 A;  3MR2 A;  1EKP A;  2W6N A;  4ED0 A;  2R7Z A;  3BA8 A;  5FD5 A;  2W6M A;  5EWG A;  1XK5 A;  2E2I A;  4YB8 B;  5A2Q W;  5FJ8 G;  2YS6 A;  4AYB E;  1HNW H;  1T36 A;  5IYB G;  2RDJ A;  1JLL B;  5KFN A;  2W6P A;  2YWV A;  4RB0 A;  4O7V A;  2JA5 G;  5LMU H;  4XYM B;  2ZM6 H;  2YZG A;  4APM A;  3L4J A;  5KFS A;  4G3I A;  3K3P A;  5IYD G;  1WRV A;  4O4J F;  3TQT A;  2MCT A;  2Q2U A;  5BWV A;  4O7S A;  3HOW G;  2YRW A;  3NBZ B;  2FPI B;  4ED1 A;  2WYO A;  4YQW A;  4NZM A;  1A3G A;  1VAJ A;  1S03 G;  4RAY A;  2X0S A;  4RUA A;  2W9A A;  2ZJT A;  4FFN A;  4DUZ H;  3N42 B;  4FS2 A;  5KFZ A;  3UFX B;  4RAZ A;  5KG4 A;  3T5H A;  3V4Z A;  4O3S A;  5C44 G;  2YW2 A;  1P16 A;  2A1H A;  3LUL A;  3K3V A;  5EWE A;  4Q4D A;  5C5J A;  3DF7 A;  3RIZ A;  1K1S A;  3H0G G;  2R92 G;  4NXM H;  1VBG A;  5D1P A;  4DL5 A;  5KFU A;  3EPG A;  2NUA B;  5DG7 A; 
#chains in the Genus database with same CATH homology
 5CA1 F;  2XCL A;  4I50 F;  3I12 A;  3U54 A;  2YYA A;  2CNQ A;  4FFO A;  3OUZ A;  2R86 A;  4O84 A;  4MV7 A;  5FNV F;  2YZL A;  1C30 A;  3HBL A;  5JQW A;  4TUY F;  4IHJ F;  5C1O A;  2R7L A;  1E4E B;  2R6F A;  1EZ1 A;  4DIM A;  1M0T A;  4YBZ B;  4HNV A;  4FFL A;  1BNC A;  2NU8 B;  2ZDH A;  2R7N A;  2W6Q A;  2W71 A;  4O7Z A;  1SCU B;  4FFR A;  2V59 A;  4ZI7 F;  3K5H A;  4O4H F;  2PN1 A;  4YJ2 F;  4M9U A;  2VPQ A;  5GON F;  4O82 A;  1CQJ B;  3MWE A;  3G8D A;  1DV1 A;  1E4E A;  5KKN B;  3R5F A;  1KJ8 A;  4MA0 A;  1C3O A;  5J2T F;  2R7M A;  1DIK A;  4EGJ A;  2W6O A;  3WO0 A;  5J2U F;  1AUX A;  3RV3 A;  5JVL A;  4EGQ A;  2J9G A;  3LP8 A;  4O4L F;  3TII A;  3R23 A;  3G8C A;  1IOW A;  1EYZ A;  1GGO A;  3HO8 A;  2HGS A;  4ME6 A;  4MAM A;  3WO1 A;  4O7W A;  5JVD F;  2R84 A;  5HV6 A;  3KAJ A;  3VPC A;  1DV2 A;  1PK8 A;  1CS0 A;  3ORR A;  1KJQ A;  2CQY A;  1EUC B;  3VPD A;  3U55 A;  3WNZ A;  5DMX A;  4O2B F;  3AX6 A;  5K2M A;  1EHI A;  2I80 A;  3JRX A;  4FE2 A;  3MWD A;  2VR1 A;  4MV9 A;  1Z2N X;  2W70 A;  3U9T A;  1CE8 A;  3LWB A;  4MV8 A;  4O86 A;  4ZQI A;  3N6R A;  4O7Y A;  5C1P A;  4FFP A;  4QSH A;  3TIN A;  3GLK A;  2CNU A;  1CQI B;  5EZY F;  1GLV A;  5LP6 F;  3R9R A;  4FU0 A;  1I7N A;  1JKJ B;  1EUD B;  2DZD A;  4O4I F;  1VKZ A;  2ZDQ A;  1M6V A;  2OLS A;  1Z2O X;  4C5B A;  3KAK A;  5LYJ F;  4IZO A;  1B6R A;  5JH7 F;  5IYZ F;  4HQ6 A;  1JDB B;  5C8Y F;  4ZOL F;  4Y8V B;  5I47 A;  2PBZ A;  3N8D A;  3BG5 A;  4HNT A;  2YZN A;  2R85 A;  2ZDG A;  2GQR A;  1M0W A;  3RV4 A;  3ETH A;  3VMM A;  3TW6 A;  2NU7 B;  5LA6 F;  1JDE A;  2R7K A;  4O83 A;  4O7R A;  4FGR A;  4IIJ F;  2CZG A;  2P0A A;  4O2A F;  4EG0 A;  4MA5 A;  5CB4 F;  4MV1 A;  4XZ3 B;  2I87 A;  2GQS A;  3Q1K A;  3KAL A;  3R5X A;  2VQD A;  2FPP B;  4YAJ B;  2FB9 A;  1W96 A;  3VA7 A;  1VBH A;  1I7L A;  5HBR B;  2QK4 A;  1BXR A;  5BPF A;  4WBN F;  4L1K A;  1WR2 A;  2YS7 A;  3TIG A;  2DLN A;  2R87 A;  1OBD A;  1GSA A;  2GPW A;  3OUU A;  2W6Z A;  3VOT A;  2NU6 B;  3SE7 A;  4I55 F;  2DWC A;  4O81 A;  5BPH A;  3U9S A;  4O7L A;  1A9X A;  4HR7 A;  2IP4 A;  1GSH A;  3Q2O A;  3JZI A;  4RZQ A;  1PX2 A;  3RFC A;  3KRE A;  2R82 A;  4I4T F;  4E4T A;  3HB9 A;  4YAK B;  1GSO A;  5KX5 F;  4IWY A;  5JQG F;  4DLK A;  1KEE A;  2PVP A;  2V5A A;  2DIK A;  3ORQ A;  4MV6 A;  2Z04 A;  2FP4 B;  2V58 A;  2XD4 A;  4ZHQ F;  2NU9 B;  1KC7 A;  3E5N A;  3RUP A;  1B6S A;  4C5A A;  3QFF A;  4NYE A;  2I8C A;  1Z2P X;  3VPB A;  5BMV F;  4IWX A;  1W93 A;  3R5H A;  5CAE B;  5H80 A;  5CA0 F;  4XX0 B;  1UC8 A;  4MV4 A;  4XYL B;  3MJF A;  1KUT A;  1ULZ A;  1IOV A;  2Z02 A;  3JZF A;  4TV9 F;  4O7N A;  2GPS A;  2YL2 A;  3K5I A;  3V4S A;  2CNV A;  1KJ9 A;  4WD3 A;  4C5C A;  4TV8 F;  2QF7 A;  1KJI A;  1UC9 A;  4O7T A;  5D8D A;  2C00 A;  3AW8 A;  1A48 A;  4MV3 A;  2SCU B;  5LXT F;  1AUV A;  3GID A;  3JRW A;  2FPG B;  2GLT A;  3ETJ A;  4HNU A;  2YZM A;  2YRX A;  1KJJ A;  2HJW A;  4YJ3 F;  1KBL A;  1OBG A;  3NUA A;  5LOV F;  4FFM A;  2W6N A;  2W6M A;  4YB8 B;  2YS6 A;  1T36 A;  1JLL B;  2W6P A;  2YWV A;  4O7V A;  4XYM B;  2YZG A;  3K3P A;  4O4J F;  3TQT A;  4O7S A;  2YRW A;  2FPI B;  2WYO A;  2X0S A;  4FFN A;  3UFX B;  3V4Z A;  2YW2 A;  3DF7 A;  1VBG A;  2NUA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...