1FVIA

Crystal structure of chlorella virus dna ligase-adenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
264
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIAGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of eukaryotic DNA ligase-adenylate illuminates the mechanism of nick sensing and strand joining.
pubmed doi rcsb
source organism Chlorella virus
molecule tags Ligase
molecule keywords CHLORELLA VIRUS DNA LIGASE-ADENYLATE
total genus 72
structure length 264
sequence length 292
ec nomenclature ec 6.5.1.-:
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fviA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1fviA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1fviA01
4X66Q 3KDFB 4CC6A 3HKSA 3ULLA 5C3EH 4UCSA 3CC7A 1TAEA 4E6NA 5IYCH 5IYDH 4GNXB 1HR0L 1Q81C 4HIDA 4BXXH 4XTCS 1HH2P 3L2PA 3PN1A 5D1PA 2E2JH 3W1BA 3CD6A 2YTVA 2NVTH 3CCLA 4IOAA 2F52A 3CCSA 3F1ZA 3HOZG 3PO3H 1J6QA 4HJAA 4LUZA 4A75A 4JV5L 2UU9L 3L7ZC 1UE1A 3JAMc 2D0PA 2ZJQA 1PH2A 4A3BH 1HZ9A 2B29A 3L0OA 4HIMA 4MZ9A 1XDNA 4A3MH 3HOVH 2HVSA 1TXYA 2F3IA 4UCOA 2EIFA 1G51A 2V1CC 4DR6Q 3T1HL 2AMCB 4C2MH 2R6GA 1AE3A 3F2BA 4NXNQ 1UEBA 5J3BA 4C3HH 3H0GH 4DV7L 4X62Q 3ER0A 4B3TQ 3CW2C 4OO1I 1VQLA 1N32L 3CCRA 2R93H 1NMFA 1K73C 1N36Q 1LTLA 1SROA 1KD1C 1Q12A 4JI3L 2VQEL 1VQKA 1Y1WG 2PI2A 4HJ8A 2JE6I 3S1NH 1E22A 1K0RA 2B3GA 5EAYA 4P71A 2ZJPA 5FLMG 3ERSX 4P75A 3U4ZA 4UFZA 5IE8A 3EN2A 3J80i 3G48A 3AFQA 3S24A 2JJQA 1E1TA 1PYBA 4QY7A 5FJ8G 3STBC 1EFWA 3UDXA 2A8VA 3NBHB 3PUWA 4UP8A 2L15A 1PH5A 1G291 4DV7Q 5LMNL 1BKBA 4P73A 1VQ4A 1JJCB 3GTLH 1CKOA 2PQAB 3H15A 3RN2A 3GTOH 3M4OH 4P74A 3WWVA 2OTLA 2MO0A 1QZGA 1PH7A 3K7AH 3G6EA 4JI7L 2JQOA 5GQOA 3GTMH 3D31A 4LF9L 1N32Q 3TREA 2JA8G 4A93H 3ZJYC 2YV5A 4BBSG 3PUXA 1WYDA 1PYSB 3HKZE 4LF5Q 4JI5L 1JMCA 3K7UC 1CKNA 2PI2E 1VQPA 2WFWA 1FJGQ 1E7ZA 4NPSA 4A3IG 1YNXA 1FGUA 5IY0A 2JA7H 2PNHA 1CUKA 3KF6A 2N3SA 4OWTB 1VQ5A 1UE6A 3J7ZC 2EXDA 3H3VH 3TRZA 4AQYL 1SE8A 2ZJRA 4BBSH 3UDIA 1S3OA 4DKAC 3HOYH 4BBRH 3DM3A 3KJPA 4C3IH 4EX5A 4JI8Q 2E5LL 4LF7Q 2UUAL 5LMNQ 1OXTA 2EQSA 5DISC 2KHJA 1TWHH 3M7NA 3PGZA 2CFMA 2UXDL 1D8LA 1TWAH 1XPUA 4X62L 2PMZE 3M3YH 2VUMH 3KF6B 3E9IA 4JCVE 1XMOL 2Q2TA 3HOWG 5E7NA 2YTYA 4QQBX 3AEVA 5IP7G 2VY3A 3PO2H 1V43A 4BA2I 2IHEA 1QUQB 4IPCA 3KLWA 4YWMA 5FJ8H 4OO1G 2UXCL 1JT8A 3CCMA 1XNRQ 3GD7A 1IBLL 3GTGH 2GVBA 1P16A 1M90C 3U58A 4AYBG 2BH2A 3GTKH 2K14A 3KFUA 1L0WA 1GD7A 3J81i 2N49A 1X54A 5M3FH 1RL2A 2CCZA 2JA6H 3S1QH 4B3RQ 1BBUA 3U4VA 2GN5A 3M4PA 2R93G 1Z9FA 3HFZB 1VQ6A 2HVRA 1HNWQ 1E3PA 1YBYA 2JA7G 3PF4A 1NBWA 2AWOA 3J80c 3PIPA 4PG3A 5IP9H 2MQHA 3BZKA 4GN4B 2I5MX 3KF8B 4JI8L 1B70B 1HJPA 2PQAA 3JAMi 4DUZL 2NVXH 4GKJQ 4Y52H 2JA8H 3OYYA 3PSIA 4XIGS 3CCQA 5C0XJ 2UU9Q 1MKHA 3K0XA 5LMUL 3TY8A 3HOVG 1TWFH 1YHBA 3RLNA 3MXNB 4OXPA 1Q82C 4LFAL 2JEAI 3QWUA 4MTNA 1S68A 3S17H 4AYBE 1X56A 4LWCA 4AIMA 4DAMA 4A3GG 2BA0A 3NELA 1FJGL 1VQDA 1X3EA 3HKZG 1AH9A 4BY1G 4DR4Q 2I0QA 1ASZA 3LGJA 1O7IA 1CKMA 2VQFQ 4A3LH 4UCUA 4DV5Q 1M1KC 5JJKA 4IFDI 1U5KA 5FPRA 5IWAQ 1IBLQ 2XTIA 1KAWA 2YYZA 4IPGA 4BXXG 4LH6A 4NXMQ 1UE7A 1MJCA 3CQZH 3PUZA 4UP7A 4A3JH 1N36L 1VQ9A 1HZBA 3M9BA 4HJ9A 3KDFA 2ES2A 2UUBQ 3EIVA 4X64L 1B04A 5C0XI 1LUZA 1B8AA 3CXCA 1A0IA 3D0FA 1I6HH 4ALPA 2F4VL 5GAGC 4UY8C 1QVGA 1A63A 1YEZA 1MJEA 4A3EH 1K8GA 4PZ7A 4LF8L 2UXBQ 4JBWA 3GTQH 1E1OA 4X65Q 3S2HH 2DUDA 1W2BA 2NN6G 3S16H 4H02A 4BY7G 2KHIA 4ME3A 5BR8L 4JI0Q 4A3KG 2R92G 5FPOA 3CAMA 4JG2A 4B3MQ 4KHZA 1BBWA 4IO9A 2HHHQ 4JV5Q 4IPHA 2VQEQ 4DAYB 1CSPA 4A3MG 1XPRA 4A3DG 2OTJA 1OXSC 2R7FA 2WAQE 1EWIA 1SN8A 3T1YL 1XNQQ 4LH7A 4OX9L 4GLXA 1XTDA 3I4NG 4B3TL 4DR1Q 3H3VI 2VS1A 2CKZB 3TQYA 3CC2A 3TEHB 1NTGA 4DV1L 4DV2L 3PO3G 3HOXH 4POFA 3HOZH 1IYJB 1L1OB 2N8NA 4JBJA 4JC0A 1YHQA 4LF4L 2ATWA 3J7A5 4WJ4A 4JI1Q 4DV3Q 1OXUA 4YY3Q 3GJXB 2Z6KA 4HJ7A 1JE5A 4LFBL 5GAHC 3A5UA 1A62A 2JA5G 4JOIC 5ELNA 5JEAJ 5C3EG 4GOPA 4KHPL 2AKWB 2OQKA 2LXJA 4OONA 3BAAA 3DLLA 4EEQA 3UQ8A 4DNIA 1EUJA 3OTOQ 3FP9A 2RHQB 3GDEA 4DR4L 1KC8C 3AFPA 2BH8A 1L1OC 1VQOA 1VQNA 2RF4A 3BA8A 3IRBA 5C4XH 1Q8KA 4GN5A 4GN3B 3T1YQ 1XNQL 4EFEA 3EBEA 3CPWA 2QEXA 1HR0Q 2WP8J 4DR5L 5LMUQ 4JI2L 2E8GA 2IX0A 3A74A 4YCVA 3CCEA 4K0KL 3I4MH 4A3FH 1HNXL 4L5QA 1IXRA 3A0JA 3AYHB 1Q7YC 2WB1E 4POGA 4IFDG 1VQ7A 3BJUA 2K5HA 4A3CH 2ZTEA 1WI5A 1HZCA 4LW1A 4B3SQ 3I4NH 1HNWL 3GB8B 4IFDJ 1J5EL 1HZAA 1OXVA 4JI4L 1IBKL 1Y1VH 3S1RH 4LF4Q 1VQGA 4A3DH 4DR3L 1N34L 4MNOA 1UWVA 1NY4A 3OTOL 2UUCL 2JA9A 1YZ6A 1VQ8A 2R92H 4A3FG 2R7DA 4DV6Q 4DV4Q 2LXKA 4TQUS 2KBNA 4A4IA 2E2IH 1PH6A 2QGQA 2R7ZH 4X6AH 3TY5A 3VNNA 3HOUH 4DK6C 1YIJA 3KJOA 1OTCA 4DV3L 4Y7NH 4AH6A 4EQ5A 1KRTA 1IBMQ 2WB1G 4NB3A 4LFCQ 4DR5Q 1FVIA 4JI6Q 3NBZB 2WAQG 2Q2IA 3VDYA 1E24A 3PIOA 2Z6KC 4DR2Q 4BA1I 4QIWE 3S15H 4GKKQ 1C9OA 1KHIA 4DUYQ 2JA5H 4A3JG 1X3FA 2HHHL 2Q2HA 1HNZL 2OCEA 4RMFA 2E5LQ 4LF7L 1S72A 1SRUA 1Q46A 5LMNW 3PV0A 5AJ3Q 1NMGA 4A3LG 3JSNA 3JSLA 4WJ3M 4DR7L 4KHPQ 1L1OA 4UPAA 2ZM6Q 1GM5A 2K5VA 2K5NA 4BY1H 3KOJA 1NJIC 4LF8Q 4A3GH 2UXBL 1W3SA 2I5HA 4LUVA 5M5YH 1VQMA 4R4OA 4LF6Q 3M85A 4JI6L 1X6OA 1XMQL 1L2FA 2ZTCA 4GLVB 5M3MH 4YHHQ 2OQ0A 3CCUA 2F4VQ 1XMQQ 4R4TA 1YI2A 1WCMH 3I4OA 2K50A 1YVCA 2IHFA 4A3KH 1K9MC 3RZOH 3PCOB 2QA4A 2Q2UA 3BZCA 4P72A 2KCMA 4JYAL 4QGUA 1VQFA 3W1GA 4GNXC 1YJ9A 4JYAQ 2HIXA 4LFBQ 2VZAA 2B63H 1MIUA 2K4KA 3J81j 4PMWA 2DGYA 1YITA 1N33Q 2HT1A 4DV2Q 4JI2Q 1PV4A 2C35B 3BA9A 3S14H 3B6YA 2BA1A 1I94L 4OX9Q 4O2DA 4YWKA 1V9PA 3CP0A 4CC5A 3I56A 2MFIA 2ZM6L 2E2HH 4C3JH 1D7QA 1VQBA 1N33L 1X65A 1SR3A 3K81C 3E0EA 3K8AA 4L5SA 4DV0Q 1SLJA 3ULPA 1PH9A 1P8LA 4DUYL 1GO3E 3CF5A 1GVPA 4QJFA 1YJNA 1XNRL 3GTPH 3RTXA 4DR2L 1EQQA 1PFSA 3RN5A 4IJLA 5IYBH 1XK5A 4B3RL 3ULJA 4QL5A 4UCTA 1RIPA 3RR5A 3F8TA 3PUVA 1XMOQ 1C7YA 4JI5Q 5D1OB 1LM0A 2LSSA 1KL9A 4HIOA 3STBD 4BBRG 4X64Q 2IY5B 1LYLA 1JJ2A 3HOYG 2RHSB 1EOVA 1YJWA 2NZOA 4LF9Q 2ALYB 3I2ZA 5IP9G 1V1QA 2K52A 2MO1A 1WJJA 4DR7Q 1G6PA 4LNQA 5IWAL 3TS2A 1H95A 3NENA 1VQCA 3UE0A 5FLXc 4L5TA 3UDFA 1N9WA 2Y0SG 5GADC 2JA6G 3CPFA 5M3FG 2HIVA 4X65L 3MEFA 2HVQA 1CSQA 2YTXA 1SFOH 4A93G 1KRSA 3GTJH 1WCMG 4HIKA 3AQQA 4YCWA 3CC4A 2A19A 1Y14B 4GOPC 3CMAA 1VQJA 1FL0A 2D62A 5M3MG 4DV0L 1PH8A 2UUAQ 1JJGA 1HNXQ 1AE2A 1B7YB 1GKHA 1I5FA 2IT1A 5IP7H 5IYBG 4GNXA 1S40A 3PO2G 4UCRA 3HOWH 3OW2A 1HNZQ 3ICEA 2UUBL 1KQSA 1TWGH 4IJHA 3S2DH 2VNUD 2VUMG 2IX1A 1QVCA 4NXML 4JI7Q 2KENA 1I94Q 1JB7A 4PZ6A 3GO5A 1VQHA 2Y0SE 4YWLA 3CCVA 1QUQA 4IOCA 2OWOA 3RLFA 2UUCQ 3G71A 5C4JH 5GROA 2B63G 5K36G 3I7FA 5IT9c 1VCIA 4JBKA 4LF6L 4DPGA 4DR1L 1VQIA 1XPOA 1I50H 4HJ5A 4GLAC 1WOCA 3PF5A 1PH1A 4UP9A 4LFAQ 1EQRA 2MNAA 3CCJA 1Y1WH 1QVFA 2NVQH 1VQEA 4IPDA 4DK3C 3TY9A 3CMEA 4JI1L 3E9HA 1IZ6A 3JC66 4DV6L 5AJ3L 4R1JA 2JK8A 2HQLA 2VQFL 1PH4A 4A3IH 1XJVA 5JJIA 1KXLA 2NVYH 4YHHL 3BABA 1U0LA 3H0GG 4LUOA 3UDGA 2H5XA 4AQYQ 5HY6A 1PH3A 1KIXA 4OWXB 1VQAA 5H1SE 1J5EQ 1NE3A 5JEAG 4JI4Q 5HGQA 2UXDQ 1I3QH 2YU9H 5GAEC 2VUGA 1BVSA 3K80C 3NC0B 2D0OA 1C0AA 2CQOA 4LFCL 3I55A 2VL6A 2RCNA 1IBML 1Y1VG 2AWNA 2ASBA 3BU2A 1PHJA 1Q1BA 3SGIA 1EYGA 1OXXK 4A3CG 1Q1EA 5JJLA 3J81c 2N78A 1K83H 3G4SA 4OWWB 2VW9A 2UXCQ 4YY3L 1N8RC 1PA6A 4DV4L 2A1AA 1WFQA 4YCUA 2NZHA 4FDBA 1X55A 1K8AC 1DGSA 1IL2A 4NXNL 2Z0SA 5IYDG 2GVAA 5C0XG 4EFBA 1Z47A 5IYCG 4GOPB 3W5OA 2K75A 5FLMH 1EIFA 2CWPA 4RG1A 1SMXA 3RZDH 1TWCH 4KI0A 1X3GA 4DV5L 5C44H 4K0KQ 3FHWA 4R4QA 4DUZQ 4DV1Q 3PUYA 4JBMA 4GKJL 4DR3Q 2CWAA 1HR0W 4L5RC 3TS0A 3HOUG 2XGTA 3F2CA 3FKIG 5ELOA 1IBKQ 4JI3Q 2R7ZG 3KYHC 1CKNB 3A5ZB 3S1MH 4GKKL 4UCVA 4B3SL 1PVOA 5DLQE 3RLOA 3NEMA 3HOXG 4R4IA 4B3ML 2FXQA 5M5WH 4LF5L 5BR8Q 2KCTA 4JI0L 3M4QA 4JOIA 4A3BG 4DRFA 1VS0A 4X66L 5D1OA 4DR6L 4PZ8A 2ID0A 1T9HA 4KLKA 2AHOB 1QZHA 4O0AA 3I4MG 1K3RA 3UE1A 3Q8DA 3F2DA 4TVAB 4R4CA 4BY7H 3FKIH 4J15A 3NBYB 1N34Q 1X9NA 1R9TH 1EIYB 4A76A 1A8VA 1TA8A 2JEBI 4A3EG 5C44G 3T1HQ 5M5XH 5C4XG 3RNUA 4GS3A 4APVA 2I5LX 1Q86C 3U50C 1ASYA 1YHAA 2NN6I 2ZTDA 1UE5A
chains in the Genus database with same CATH superfamily
2EYPA 4Q5VA 1HR0H 3HKSA 5C3EH 4RCNA 3BDOA 4E6NA 5IYDH 2YU9B 5FO9B 5M5WB 4GNXB 2JA8B 4LFCH 1EU4A 4BXXH 4XTCS 1HH2P 3L2PA 1LLRD 4B9XA 2QKIC 1S0NA 3SEBA 3N44B 2F52A 4LUZA 4A75A 4DIMA 4O7RA 4CJ2C 1PH2A 3L0OA 4K2KA 1JDEA 5L1KA 4MZ9A 4QUFA 4Q44A 4IUPA 2R7NA 4FFMA 2F3IA 3KLSA 4UCOA 2RKSA 1B44D 2V1CC 3MZ5A 3T1HL 3G7LA 5BMVF 5KG6A 4LSAA 2AMCB 5LHY1 5KFUA 4J9SA 1AE3A 4ZKCB 1FJGH 5KYLA 4ED6A 4C3HH 4DV7L 4X62Q 4LF5H 3DF7A 2C2EA 1VQLA 3CCRA 2R93H 1NMFA 5CBEE 3OW7A 1SROA 1KD1C 1W6JA 1K0RA 4IAJA 2B3GA 5L1JA 4JV1A 3OSOA 4O7YA 4C3JB 3HO8A 5IE8A 3S24A 3G48A 2COJA 2ABJA 2JJQA 2KHSA 1ZHSA 2R84A 2UVVA 4WORA 3STBC 1EFWA 4J9NA 2L15A 5LMNL 3ZYYX 2DWCA 3A55A 5CV8A 3I90A 3RN2A 2GQSA 3OHBA 1IKMA 3WWVA 2SCUB 3G6EA 4N9PA 2AQ4A 5GQOA 3GTMH 4RKBA 4CKEA 4I7AA 2I46A 3ZJYC 1B3AA 3MVVA 5G3LF 1IOWA 5I5VA 4TM5A 4JI5L 3GTLA 1PRTF 3CQZB 3OUZA 4ZHQF 2LMCB 5BWVA 2R61A 5IY0A 3G6VA 5C3EB 4BS9A 1I7NA 2D2CC 3HS0C 2N3SA 1VQ5A 3FKIB 4AQYL 1SE8A 3TW7A 2BR0A 4YJ3F 3T9BA 1EYAA 1SYEA 3I8ZA 2PCFB 1KJ8A 1UC9A 3FEWX 1FKAH 3KJPA 1SMYC 4GKJH 4FS1A 1LTAD 2E5LL 3QZ7A 2EY6A 1HCZA 2D5DA 3TQTA 3VR2A 1KEEA 3M7NA 2MCTA 1SNPA 3RD4A 2VQDA 2CW8A 4A3MB 1TS5A 3M3YH 1LTSD 2PMZE 2VUMH 5IGGA 5KG2A 1G91A 1CQJB 1WR2A 4A3GB 2MGSA 4ZI7F 3MXGA 5KFJA 3KTMA 2K7VA 5E7NA 3HOWG 3MA2B 5IP7G 2NU7B 4IZ8A 3S17B 2JEFA 5DG7A 1QUQB 3KLWA 1Y69U 2NU8B 4C3HB 4O7NA 2ICEC 2EVBA 1STHA 2IX3A 1P16A 4AYBG 4O3QA 1ZYRC 1L0WA 1TS2A 1RL2A 2CCZA 2KJXA 1A3VA 4IRDA 2GN5A 2R93G 1E3PA 1YBYA 2JA7G 2W6ZA 3PF4A 3J80W 1CQFA 1S5DD 1PLFA 4JI8L 2PQAA 1HJPA 4GKJQ 4FM9A 2NVXH 1D6EC 5KG5A 1M6VA 1TS3A 1TIID 4XIGS 3NQTA 1BCPD 3FPPA 5KFWA 4I4TF 1I4XA 3QWUA 4X3SA 4IWXA 2F0SA 4LFAL 4J9MA 4R9WA 1GUTA 4AIMA 4F87A 3FDTA 1FJGL 4RZQA 1SAPA 2W6MA 3JRXA 4DR4Q 3LGJA 1U4PA 1CKMA 3KLSX 2VQFQ 3ORQA 3NWTA 3KXYT 1IBLQ 2XTIA 4BXXG 3J7AK 5KFAA 3CQZH 3UYYA 4UP7A 2YWVA 4CMDA 3M9BA 3KDFA 2KVMA 3EIVA 2VPQA 1B04A 1HNXH 2VOBA 3A8JE 5C0XI 1K28A 3Q24A 1A0IA 3D0FA 4RUAA 1QVGA 3X3NA 2D9UA 4NXMH 1WSCA 2B2WC 4M0JA 4O3PA 3WOEA 2UUBH 3Q2OA 3UZBA 5FD6A 5DNFA 2EPBA 1M7JA 3S2HH 3S16H 2YYAA 3E6ZX 4ME3A 5DLFA 5BR8L 3NTHA 1XPRA 4DUYH 2R7FA 2WDTA 1EWIA 1XNQQ 4NZMA 1T94A 5KNCA 4OX9L 2C5CA 1ICFB 5HURA 4IUQA 4B3TL 3I4NG 3GTLB 4P2CB 2B39A 3H3VI 3KHGA 2M9VA 1NTGA 2NVYA 3SE0A 4POFA 1SNMA 5E4XA 1V51A 5A2QE 4DV3Q 2Z6KA 1KLGD 4HJ7A 3GV8B 1UC8A 3SHLA 5A35A 4F50A 3EROA 1I50B 4JOIC 5ELNA 4KHPL 2RDJA 2OQKA 3QOJA 5C3XA 4A3EB 1V4YA 1Z6HA 2KQ3A 3OTOQ 3FP9A 3GDEA 3MR2A 1GJXA 5KT5A 5DM63 2BH8A 2K1BA 5BPFA 3VR5A 4KMUC 1XNRH 3PW5A 3T13A 1EUDB 3DAAA 4RUCA 2ASDA 3T1YQ 1JWUD 4IQZA 4M9UA 4RB2C 3HP3A 3EQLC 4M1UB 1HR0Q 2W6OA 4O81A 2ZGIA 3I4MH 1HNXL 1SYCA 4NW2A 4L5QA 5BN3A 3Q8RB 4POGA 4IFDG 1S0OA 1G2WA 1RD9D 3BJUA 4MV1A 2LKVA 1W93A 4F88A 4B3SQ 1WI5A 3KBXA 2X6GA 4LW1A 1B1ZA 3GB8B 1UNNC 2UXDH 4JI4L 1HZAA 1FNUA 4LF8H 2B2WA 5E25A 1N34L 1ICWA 3FRPB 4K8IA 3OTOL 1PZKD 2R92H 2R7DA 4DV4Q 5KNBA 5IYZF 5JEAH 5C4JB 4A4IA 5C3WA 2ATLA 1IL8A 1A6XA 4O4IF 5LL6b 1YIJA 4DV3L 5JH7F 1M4VA 3MHBA 1PFBA 2PNRC 1BDOA 2OT2A 2MP1A 2Q2IA 1E24A 3PIOA 2Z6KC 4DR2Q 2DABA 2K04A 4BA1I 1NAPA 2ZXOA 3S15H 1SXTA 1V8QA 4GKKQ 4A3JG 5IGBA 3FDSA 3OMCA 1X3FA 5K36H 2RDGA 4RMFA 2M2LA 5D65A 4DL7A 1ZETA 3PV0A 2L5TA 3GP7A 5AJ3Q 4A3LG 3JSLA 4DAPA 3HOZB 1L1OA 2ZM6Q 1ENCA 3W2DA 4BY1H 4DV3H 3EJIA 4A3GH 5IOCA 1GSAA 4LUVA 3MWDA 2K32A 2JSOA 3M85A 4J8QA 4RHRA 1X6OA 2ZTCA 4HCEA 1EIHA 4LJZC 2WINB 4YHHQ 2L11A 2R86A 2RDIA 2RQXA 1Q3LA 2YRXA 2QA4A 2I07B 2IMWP 4MV4A 4P72A 2KCMA 4TV9F 4TQSA 4GNXC 4RNOA 2B63H 1IW7D 3ORRA 4JI2Q 1PV4A 5FKAC 4JI3H 2JA7A 4KY6A 1PYWD 2PN1A 5KFVA 3S9WA 4FXDA 2BA1A 4OX9Q 3U55A 4O2DA 1GUWA 2R7LA 3U0GA 1JICA 2E2HH 1D7QA 1SEIA 1X65A 3K81C 3E0EA 5F9LA 2L1BA 4L5SA 2QDBA 1PH9A 1V1PA 3GTPB 2KCCA 3IG0A 4ECWA 4N8FA 4RFBA 1XNRL 4ED0A 3GTPH 3RTXA 1XX8A 1EQQA 3RN5A 2EYMA 1XYIA 3GTMB 4B3RL 5CV9A 5JPNC 4FO2A 3RR5A 4FFPA 3PUVA 1HUMA 2LSSA 1KL9A 3GLKA 3DTGA 4KJOA 1CA6A 3HOYG 4XYLB 2RHSB 2FLPA 1IBKH 2K52A 3CEBA 1E0BA 1WJJA 3WWIA 1KJJA 2DPJA 3K5LA 5KFRA 5FLXc 2L0CA 2O5JC 3OMGA 3CPFA 2WKCA 4X65L 1C3OA 1NNXA 4DL6A 5LOVF 1RYSA 4DV4H 1A3TA 3LX0A 2ZJTA 1WCMG 4DK1A 1TWCA 4FBTA 2A19A 4GOPC 1VQJA 2EY1A 5M3MG 1BCPF 1S40A 5IYBG 4JI1H 5IP7H 5KT3A 3HOWH 3L4JA 1BR9A 3Q0AA 2UUBL 2BE5C 2XCAA 3G6YA 2VUMG 4NXML 3RZOB 5FLXL 1VMCA 4DR2H 1K8MA 4LAAA 3AX6A 3RB4A 5EWGA 2VA3A 3GO5A 3HBLA 1B9MA 3GV6A 1QUQA 3K5OA 5JJZA 4IOCA 3G71A 2QYZA 5IIFA 3I7FA 2O2LD 4JBKA 4LF6L 4FF1A 4J9OA 2V58A 2EYHA 1I50H 1TWHA 1QNUA 1PH1A 3JAML 1TU2B 2A6EC 5KG4A 4X3TA 1SBBB 1Y1WH 1EL0A 1QVFA 1VQEA 2K6AA 1UEAB 3CMEA 1TQOA 4JI1L 4R8IA 2R6FA 4R1JA 2JK8A 1PH4A 1KXLA 1TWAB 4YHHL 1U0LA 2NU9B 1F9RA 2EJFC 2YCHA 3GIJA 1J5EQ 3IFTA 5H1SE 2CW7A 3NK9A 5HGQA 5C1PA 1I3QH 2YU9H 5I9OA 1BVSA 4BBRB 4Q0FA 1WD1A 1BQQT 3MR6A 1Y1VG 1KDBA 4LMYA 3A8IE 3N8DA 2ASBA 3BU2A 4IZOA 2EYJA 1EYGA 4L63B 1ZHQA 4OWWB 4O7ZA 3MXNA 2VW9A 5CA0F 4J1MA 4YY3L 5IT9E 1N36H 5I6WA 1WFQA 4ZYSA 3RUZA 3C2PA 2GVAA 3DXJC 4BWGB 5IYCG 2FLNA 2DZDA 2COGA 3GIIA 4I55F 1KABA 2CWPA 4O1NA 3CU7A 1G6ZA 5DAAA 3DHQA 2K33A 4YR2A 1KDCA 4ED8A 3ND8A 4N9TA 3FVQA 2KEDA 1SE3A 4J9RA 4DL2A 4EGVA 4DUZQ 4C3HG 2CWAA 5F2DA 3TS0A 3SXHA 5KFFA 1DV1A 3HGBA 1IBKQ 4ILWA 4JI3Q 1A9XA 1CKNB 3A5ZB 4A2AA 5EPKA 4FFOA 2KCNA 3HOXG 2DIKA 3HOVB 3VR4A 3LP8A 5BR8Q 2KCTA 3TZUA 4JOIA 3NXWA 2YL2A 3V4SA 4DR6L 3K3VA 2IA6A 5BWWA 4ZOLF 5DAUA 2R8JA 1QZHA 4LF4H 4ZAIA 3SVMA 5C4HA 5CMDA 2NN6H 4TVAB 2GPSA 1HTLD 1SDFA 1R9TH 1EEID 5BYBA 4PMBA 1DD2A 2HD3A 5LL6S 4A3EG 4QWCA 4APVA 2NZ1D 3QG1A 2EYFA 1LTTD 1UE5A 4DAVA 3K0YA 2EY2A 2Z1CA 3VPDA 4CC6A 4DGZA 3NUCA 1WTOA 2ZXRA 3ULLA 2P5ZX 4ZRZA 5NUCA 2EJ0A 5IYCH 3I72A 4Q4DA 1LTRD 3RIZA 3I3CA 4EEYA 3RV3A 1K0SA 1F2ZA 5HBRB 3A8KE 3W1BA 3CD6A 4CE5A 2XGPA 4IOAA 3PO3H 1FD7D 1LT6D 4A3BB 3KHHA 2UU9L 3L7ZC 1GUNA 5I47A 1UE1A 2ZJQA 2J9GA 4A3BH 1CZGA 1HZ9A 3RGXA 3U54A 1R4QB 1G2TA 4A3MH 4LSXA 2OXPA 5BWUA 1TXYA 5T1IA 2F0DA 2EIFA 4C5BA 4ECTA 5KYIA 3OWFA 3OIQA 2CW0D 2PVPA 2K5WA 3VR3A 1I4PA 3SR1A 5K3WA 4Q8FA 5LMUH 3F2BA 4NXNQ 5DGAA 5J3BA 4BBSB 3BDLA 5KFDA 4OO1I 3CW2C 1N36Q 2W9AA 2XGQA 1LTLA 2VQEL 3ITPA 1Y1WG 2PI2A 3S1NH 1TVXA 1E22A 4Z9CB 5EAYA 1TY0A 1BXTA 4O42A 1SCUB 3K5IA 3VPBA 4JV2A 3K3PA 1U4LA 2B2VC 4Q0YA 4BWSC 4CGYB 4HNUA 2TMPA 3EN2A 4OO1H 5FJ8G 5EKIA 1JC7A 1IKLA 3UDXA 2A8VA 3NBHB 4K6NA 1I1LA 3ETJA 4V0BA 3H40A 1BKBA 1D1KA 3OSNA 2F0KA 3BYYB 3UQ8A 1JJCB 3M3YB 1CKOA 2JP1A 1F2YA 2GA4B 2PQAB 4ECRA 4P74A 1MBYA 2OTLA 2UXCH 4EBCA 3CHBD 4LF9L 3GTQA 3C1FA 5D8DA 1B50A 1TY2A 4K2LA 1PYSB 2PBZA 4RGOS 1SMYD 3K7UC 5CORA 1JMCA 2Z04A 2WFWA 5I2YA 1E7ZA 2Z02A 1KAAA 2FK3A 1FGUA 1M0WA 4XDXA 4JI0H 4HR7B 2PNHA 2YU9A 3KF6A 2AQ2B 4OWTB 4R8UA 1UE6A 3J7YW 1J9OA 3D8GA 4RZRA 2W8KA 3LQSA 4DKAC 3HOYH 1LTID 5C6AA 4LF7Q 1HUNA 1DM0B 1I3QB 2UUAL 2R8IA 2F0TA 5IGFA 3WO0A 1OXTA 3WWHA 5DISC 1SFOA 5BWXA 1ENAA 3PGZA 2CFMA 2UXDL 4DNTB 2Q8IB 2BDNA 2C28A 4X62L 1STNA 1VDZA 2Z8LA 3E9IA 5J1ZA 1XMOL 5DMXA 4FXGC 2XD4A 2MHVA 4UUGA 4RB1A 2G9HD 1RDPD 3D4RA 3S1RB 4QQBX 3MR3A 4BA2I 2VY3A 1IBLH 1V43A 2DY7A 4IPCA 4TQRA 2KUMA 2FKLA 2FMMA 3PZPA 3T16A 2BH2A 5I5UA 3RAXA 3U58A 3GV7B 4PBCA 1CT1D 2K14A 4UDUC 1JORA 1CQIB 3J81i 2N49A 5M3FH 4I7ZC 5EWEA 2F4VH 2MPMA 4B3RQ 1GUOA 1CS0A 5CR5A 1Z9FA 1VQ6A 2WE6A 1HNWQ 3MFYA 1NBWA 2AWOA 4L1KA 2J4XA 3PIPA 4PG3A 1M8AA 2I5MX 3KF8B 4DUZL 2JA7B 4Y52H 2JA8H 3OYYA 3PSIA 2UU9Q 1MKHA 2C2DA 5KFHA 5I4DA 3HOVG 1TWFH 3MFGA 3MXNB 3S17H 4AYBE 1X56A 4K6DA 3EPIA 4OX9H 2J7ZA 4A3GG 5ELCA 3NELA 1VQDA 3HKZG 1AH9A 4BY1G 1I4QA 4KY7A 1A48A 4RKLA 4A3LH 3ETHA 5IWAQ 4U7CA 4MV9A 3RV4A 4LH6A 1AZPA 2YYZA 4RAUC 4NXMQ 2HQEA 4A3JH 3T56B 4EGJA 1HZBA 1QG7A 2ES2A 2UUBQ 2AUJD 3TN2A 4X64L 3PO2B 3G8CA 5KFKA 1B8AA 4YQWA 3K5MA 4KKUA 2F4VL 4UY8C 2XRQD 3F2UA 1YEZA 1SNCA 4LF8L 2UXBQ 2AGQA 4ABNA 2UUCH 4J9LA 2DPIA 2DUDA 1QCBD 2PMZB 4MV6A 4JI0Q 3MWMA 2R92G 3CAMA 1RJTA 1ET6A 1BBWA 4IO9A 4JV5Q 1TWFA 4IPHA 2K5QA 3GTQB 2LFNA 5CE8A 2EJGC 5CV6A 3T9FA 2WAQE 4A3KB 2DAAA 2XNAC 4ED2A 2VS1A 4JI5H 1KJ9A 1CHQD 2FHTA 3RJ0A 3HOZH 5K5PA 3BQ2A 4IFDH 1PFMA 4ECXA 2N8NA 3DUZA 1EYCA 1A0GA 4ODGA 1OXUA 1JE5A 1WCMB 3Q8QB 2JYOA 5CGKA 2COIA 5GAHC 1C8CA 1PTOH 3A5UA 1A62A 1M0TA 4O4JF 1C30A 1DYQA 5JEAJ 1EZ8A 5KT2A 1DOLA 2LXJA 3DEOA 3DLLA 2W6PA 4DR7H 1MGSA 4G4KA 1S4ZA 1STEA 3A7LA 4DFAA 4DN4M 4DK0A 1BBXC 3BA8A 1E4FT 2A68C 5JQGF 3Q6SA 3BQ1A 4GN5A 2C22A 4GKKH 4I65A 4C2MB 4B08A 1STBA 2WP8J 5LMUQ 4JI2L 3J80L 4RH6A 3ND9A 4KD4A 2EZVA 4YR0A 4U673 3MTSA 2WB1E 2A68D 4EBEA 3E0JA 3GQBA 4A3CH 1HZCA 1PRTD 2RDHA 3I4NH 1HNWL 3H20A 1J5EL 4IWYA 4YHHH 4LF4Q 1VQGA 3FPUB 1B6SA 1CK1A 1WTHA 2F1MA 4DLKA 1NY4A 2UUCL 5BPHA 3PW7A 1DV2A 1VQ8A 2R7ZB 4EQOA 1X32A 4TQUS 2E2IH 1PH6A 2R7ZH 3VNNA 1V1PB 3KK7A 3R5HA 3GTPA 3CRKC 4DK6C 4K5WA 5J2TF 3PW0A 1JWSD 2R93B 1AN7A 1D1IA 3TP8A 4EQ5A 1KRTA 3R5FA 1IBMQ 3K5NA 4LFCQ 2F0NA 4A3JB 1HNZH 2R8KA 1NUCA 3N6RA 2SEBD 1GUSA 5IGEA 2JA5H 3QR8A 4YB8B 3FMAA 2AU0A 2XN9C 5L1LA 1SFOB 1O78A 2YW2A 4LF7L 5LMNW 1Y8NB 1Y8OB 3CVZA 5C4XB 3I4LA 3JSNA 1E2VA 3D4DA 4WJ3M 4DR7L 3MC0B 1HQMC 3RMHA 2C00A 5D3DA 3T5JA 1GM5A 4HN7A 5KFBA 3KOJA 4QSHA 1NJIC 1GSOA 5CR3A 1K1SA 2F03A 4R4OA 1HPCA 3GTOB 5LL6X 4GLVB 1VBHA 4DL4A 1SE2A 4R4TA 3C46A 2K50A 1YVCA 2CQAA 1F9SA 3RZOH 3H4DA 4R8UB 3JRWA 5KX5F 3BZCA 4MV7A 4OGQC 4OEMB 1GHJA 1I7LA 1LT5D 5M3FB 2HT1A 1YITA 1U9RA 1N33Q 5EWFA 3DWAA 2FJ2A 1J8IA 4M7EA 4YR3A 3BA9A 3R2IA 1GYFA 3K58A 1H9SA 3B6YA 1LV9A 1F77A 1QOHA 3T1HH 3CP0A 3I56A 1E4EB 3C0FB 5J2UF 4RHSA 1RJRA 3NQIA 2B2UA 4LF7H 1SR3A 3D6CA 2E5LH 4HMJA 2OF1A 3VMMA 3DEPA 3ULPA 3HKZB 4KHPH 3R5XA 5FLXW 2ZXPA 4KD3A 4DR2L 2KECA 1OO9B 1AUVA 4QL5A 4UCTA 4C3JG 2W7OA 1RIPA 5D1OB 2EJMA 3F8TA 5KFOA 3UZOA 1LM0A 1SNOA 5ELFA 1IOVA 3STBD 2I8CA 2IY5B 4O84A 1LYLA 1JJ2A 4A2BA 1EOVA 1YJWA 2NZOA 3Q1KA 2BQUA 4LF9Q 2ALYB 3I2ZA 2OH2A 2KOLA 1IHZA 2EOTA 1EWHA 2G5DA 3OPOA 3NENA 1HHVA 1RYRA 1WH2A 2JA6G 1EZ6A 1DJRD 3D6WA 3S16B 4HNTA 1HNWH 1AN8A 4QF4A 2M00A 3E3XA 2HVQA 1CQVA 1KNAA 3HOWB 5BWTA 5HGTA 4HIKA 2TSSA 3U9OA 1C48A 3CC4A 1Y14B 2D62A 1DONA 1JJGA 4DV0L 1HNXQ 1CE8A 3KAKA 3NHHA 3PO2G 2CVRA 3OW2A 1HNZQ 1AP0A 5EKLA 4RAZA 1RTOA 3BS1A 2IX1A 2FP4B 3T9AA 2PZUA 4GLWA 4JI7Q 1I94Q 5M5XB 5CV5A 3BDCA 4PZ6A 1X3PA 1T36A 2A74C 2E76C 4CJ0B 3GTKA 4LFBH 3RLFA 1RKNA 1WTRA 4H44C 3S1NB 4JV5H 1VCIA 5KFYA 1GSHA 4C1NK 1B33N 2F4IA 3LWUA 1XPOA 5A2QW 1KTKA 3PF5A 5FLXE 2FK1A 1EQRA 5CYUA 2MNAA 3CCJA 2NVQH 3Q8SB 1VF7A 1SSOA 4O7LA 2Y0SB 2PO4A 1FR3A 4A3IH 2NVYH 3LWEA 2H5XA 4DQNA 1PH3A 3IFDA 4ME5A 4G7HC 4JI4Q 1VQAA 1O75A 5KFZA 1NE3A 3R2TA 5E4WC 4NYEA 2VUGA 5GAEC 1CHPD 3K80C 2D0OA 4YAKB 4EYHB 3R3OA 4R7RA 2AWNA 5IWAH 3HT5A 4GC7A 1EIGA 1Q1BA 3SGIA 3URYA 3VA5A 1WTXA 1ZQ7A 1Q1EA 5JJLA 3OHAA 3N40P 2N78A 1K83H 2PYKA 4FP5D 1N8RC 2W71A 4FDBA 1X55A 1K8OA 1IL2A 5IYDG 1S03G 1EY9A 4GOPB 3D3RA 3W5OA 2K75A 3K59A 1I50A 4ED3A 3G8DA 1ESRA 4O2AF 3T5KA 3KUPA 4RG1A 4OHJA 1PZJD 1QJOA 3RZDH 3JZ6A 1H9SB 1TR5A 2Z6BA 4DV7H 2K03A 2OLSA 1D2BA 4PNYA 2EE1A 1X3GA 5C5LA 2VQFH 4K0KQ 3FHWA 2JN4A 4GKJL 4DR3Q 3F2CA 4LF9H 2R7ZG 5DGHA 1KBLA 2CH4A 3CQZA 3TMEA 3EA6A 1PVOA 1LTBD 3NEMA 3NBIA 3PFFA 1K83B 1I4GA 3JZFA 4ZUIA 4DRFA 2FE3A 5D1OA 2A6HD 5E3FA 2ID0A 5IT9L 1DOKA 1T9HA 3QZ8A 2B2YA 4KLKA 3V6HA 2AHOB 2WACA 4O2BF 1NR4A 1STAA 4O0AA 5KT4A 4BY7H 4J15A 3TP6A 2RGRA 1N34Q 1X9NA 5I5SA 4A76A 5KFXA 5JPMC 2JEBI 3M4IA 4JK1C 1TWGA 5KEEA 4I7HA 3MJFA 3QFFA 2PZTA 4DXFA 1Q86C 3U50C 1ASYA 4YIJA 2NN6I 2FMCA 2CNQA 1A3GA 1LACA 2PPBC 4NZNA 3OSPA 4UCSA 4C5CA 4FXKC 3CC7A 3M9NB 1H9RA 1Q81C 2JXMB 3MFIA 3R93A 5D1PA 1NR2A 3PIO3 3I12A 3PN1A 2IL8A 4O83A 2UUAH 5IODA 2NVTH 1DAAA 3HOZG 3F1ZA 2QK4A 1UNSA 2C9OA 4U6PA 1JCKB 1OBGA 1PRTB 3PQIA 2B29A 3K6OA 5BWRA 4HIMA 1S5ED 5KFTA 1XDNA 1Z2OX 3M4OB 4PWQA 1EY0A 4C56C 5J39A 2HVSA 3IL8A 3NE5B 1G51A 5CV4A 3RUPA 4G7ZC 2N55A 4V190 4ECVA 4Q8EA 4CMFA 2WKDA 4K5XA 5LP6F 1PRTC 1Y1WB 3GIMA 1RJQA 2Z4HA 3TSSA 2A73B 1B2TA 2W8LA 3WWJA 3RBEA 1Q12A 3BYTB 4JI3L 1VQKA 4HJ8A 4HN2A 2HHFB 3TQ1A 4FF3A 4NMZA 2ZJPA 5FLMG 5JVH3 3ERSX 4P75A 4XZ3B 4UFZA 3OTOH 4DAAA 4LMQD 5KFNA 1O7LA 1E1TA 4EG0A 4QY7A 2G9DA 1B9NA 4RGTA 3PUWA 4UP8A 5IGDA 3UFXB 1G291 2LY7A 4K6LA 4DV7Q 1EHIA 1S97A 2O4XA 4P73A 3R9RA 1VQ4A 4S3SA 3EYYA 3M4OH 3FKIA 3GTOH 3TEKA 2A6ED 4GZYC 1I6HB 2MO0A 1QZGA 1PH7A 3K7AH 4JI7L 3G6XA 1T5EA 1I6UA 2B2UC 3D31A 5CB4F 3TREA 2JA8G 4A93H 3H0GB 3VYSA 2YV5A 4ZCKA 4JXUA 4BBSG 3PUXA 2HGXA 2HHHH 3QJYA 2HDKA 4EQNA 4WJWA 4CDCC 1BF4A 4RNNA 2NVXB 4NPSA 1I6VC 1I94H 3H3VH 2EXDA 4A3IB 2YRWA 4C3IB 4NLGA 4BBSH 4QB4A 3UDIA 4DUZH 1I1MA 1JOQA 4C3IH 1EU3A 2F0PA 3H94A 4JI8Q 1WTPA 3VYUA 3S2HB 3KALA 4O7WA 5LMNQ 4MA5A 5JQWA 1BCPB 1K3BC 2EYOA 1TWHH 2KHJA 1WRVA 1GOZA 5FD5A 2VA2A 4PQXA 3GTGA 1D8LA 3UI2A 4TUYF 1PDQA 4FF4A 4HR7A 3KF6B 2W6NA 4FFLA 2W9CA 3OUUA 4A93B 4BY1B 2YTYA 2IHEA 1BOSA 4JI7H 5KFQA 1BCPC 3GD7A 1WTWA 1RF2D 1IBLL 2UVWA 2FINB 2GVBA 4DAYA 1ENFA 1GD7A 2J6UA 1H9KA 5FOBB 1H9JA 3S1QH 1BBUA 1O7YA 3M4PA 2W70A 1FNWA 2HVRA 4CHTB 1HXYD 1S9FA 5IP9H 2MQHA 3BZKA 1S5CD 4ECYA 4RAYA 3GIKA 1KJQA 2PQEA 5C0XJ 4XXEA 3K0XA 5LMUL 2KSWA 4IALA 2JEAI 1YHBA 3RLNA 4JI2H 4OXPA 4ZK9B 1Q82C 5KFGA 4MV3A 4MTNA 2RVLA 1S68A 4MA0A 5FR9A 1ILQA 4DAMA 4FFNA 4CHIA 3HRZC 2W7PA 4Q45A 4ZLTF 2RGVA 1KUTA 2I0QA 2KA7A 4IUUA 4XQJA 1O7IA 1ASZA 4ULLA 1M1KC 1U5KA 2XIGA 4IPGA 3J7AF 1UE7A 1MJCA 2HG8A 2R8HA 3P1HA 4HJ9A 2V4RA 1FGBD 2R87A 4CKBA 1I6HH 2FB9A 5LMNH 4QW8A 2GLTA 1A63A 2R7ZA 2NVYB 3BZDB 2W9BA 1WTQA 4ED7A 4PZ7A 2YZNA 4JBWA 2ASLA 3SI8A 4IR9A 4X65Q 1RTNA 3MWEA 2AQ3B 4BY7G 1QWYA 4YP3A 2KHIA 3WO1A 4A3KG 2BCOA 3TP7A 4B3MQ 5KNDA 2HHHQ 1ZEQX 3RGZA 2AGOA 2NYZD 2VQEQ 3T9CA 1CSPA 4A3MG 3GIPA 2OTJA 1I1KA 4IRKA 4PMCA 3T1YL 1BXRA 4CDFC 4GLXA 1XTDA 5DLGA 4DR1Q 3V4ZA 3PMFA 4A3FB 1XXGA 3TQYA 2XC9A 2A5HA 3J81E 1FYCA 4DV1L 3PO3G 4DV2L 3H0GA 1L0XB 3LNNA 1TWGB 3AU7A 1V1OA 1TS4A 4JBJA 3J7A5 4JI1Q 1MSGA 3L3OC 4LFBL 3GJXB 3KHRA 3CRLC 3Q23A 3TINA 5M9OA 1DIKA 4GOPA 5LYJF 2AKWB 2V5AA 1GXDC 5T14A 4DNIA 5KFPA 4MN3A 1EUJA 1MSHA 1RHPA 2RHQB 5KFSA 1S10A 5ELDA 1KC8C 1VQOA 2RF4A 1OBDA 3P7JA 4GN3B 1XNQL 3N42B 3RAQA 3D4WA 3HOYB 3Q22A 1JKJB 2Q7DA 2E8GA 2IX0A 2E2DC 4YCVA 4IIJF 4K0KL 2X5RA 2NVTB 4A3FH 4FFRA 2FK2A 1IXRA 1Q7YC 1J5EH 1VQ7A 1RCVD 2DJFC 5I9PA 5KG0A 1N32H 4IFDJ 2PW7A 1OXVA 5JVG3 4TVIA 3TW6A 3S1RH 3N6XA 4A3DH 5ELBA 2NVQB 1ML0D 1CM9A 4MNOA 4KKSA 2JA9A 4J0MA 4XT3B 4MAMA 4A3FG 4DV6Q 2KBNA 3A54A 3TY5A 2QGQA 3H91A 5CV7A 4QW9A 3DMUA 3KJOA 2HGWA 4Y7NH 3R8BA 5JAVA 1Q8IA 4KY5A 3J81W 2WB1G 4NKLA 4RA8A 1G2SA 2VQEH 2PMZA 3NBZB 1XMOH 4DV2H 1KJIA 3VDYA 3QOLA 5KG7A 1O80A 4F7XA 4H0LC 2HUGA 2Y4RA 3NTKA 4TV8F 1D5ZC 4QIWE 5KG1A 1BNZA 1KHIA 3MXUA 2OCEA 2E5LQ 5ISRA 1S72A 2R85A 2BE5D 1WCMA 5JVDF 3PW4A 3H09A 5DQGA 4LFAH 2K5VA 3MWYW 5CBAE 3NTIA 2P0AA 3BJYA 4XT1B 4HQ6A 2O03A 1W3SA 2I5HA 5M5YH 4LF6Q 4K5VA 5J22A 2E75C 1L2FA 1JQYD 3CCUA 2OQ0A 3TZDA 1XMQQ 1YI2A 1ET9A 2ODTX 4GC6A 4A3KH 1E2WA 1SYBA 4IRCA 1VBGA 5IGCA 4O7TA 4B3TH 2ENBA 4JYAQ 3SNOA 4LFBQ 1KDAA 2VZAA 2K4KA 4PMWA 4DV2Q 3RFCA 4C1NI 2C35B 2YZGA 4OIKA 4ECZA 3S14H 4KK7A 2NUAB 1I94L 2WB1B 2VXWA 4YWKA 1V9PA 1EEFD 4CC5A 5I2XA 4ETSA 5L1IA 2ZM6L 3GTJA 4C3JH 2E2JB 1N33L 5K2MA 3VYTA 3T5HA 4KN7C 3H3VC 1SLJA 2R7MA 1RK6A 4DUYL 1STYA 1YJNA 1GVPA 2ZT9C 4R8NA 2E2HB 1L2ZA 5BYAA 2EJ2A 3KHLA 5IYBH 3ULJA 1SYGA 3X3MA 1C7YA 4JI5Q 1XMOQ 5DGIA 4HIOA 3BVGA 4JW0A 4BBRG 2F3VA 1IYEA 3SK4A 1XWEA 4JYAH 2SNSA 5IP9G 1V1QA 2XCPA 2MO1A 3P20A 1F2MA 4IN3A 4DR7Q 2VB2X 1G6PA 1H95A 2GQRA 1AFPA 4ZKBB 1VQCA 1II3A 1F9PA 3V05A 5HV6A 2IBKA 2CW0C 1EZ1A 2Y0SG 4MHEA 3C1EA 2HIVA 5KFCA 2F0QA 4ID6A 1PK8A 1ZAUA 4JI8H 3MEFA 1CSQA 2YTXA 1RJPA 1YNJD 5C44B 3GTJH 3PR4A 3AQQA 2DNCA 1TWHB 4YCWA 1PH8A 1TWAA 1FL0A 1SE4A 2UVUA 1AUXA 4G57A 3R23A 1AE2A 1B7YB 1GKHA 1I5FA 4UCRA 4CKCA 3A7AB 2R82A 2JEJA 1TKWB 4U68A 3PVXA 3S2DH 2VNUD 3U9SA 3P75A 4XQQA 1QVCA 3KBGA 3PO3B 4X66H 1T3NA 3K5HA 3IKJA 4YWLA 2A1HA 2XRSD 2UUCQ 5C4JH 5GROA 4MTEA 4YAJB 5IT9c 4BY7B 4HYKA 4C3IG 4DR1L 1BO0A 4HJ5A 4O3RA 1ESFA 4DV6H 4UP9A 2X69A 2IW3A 1VAJA 4LFAQ 1W96A 5BN4A 4DK3C 5HNEA 5KG3A 1IZ6A 3JC66 2Q8TA 1MI2A 5AJ3L 2B63G 2HQLA 2JA6B 1E4EA 1XJVA 5D14A 2B8GA 3BABA 2B2YC 1LO5D 3H0GG 3UDGA 3KAJA 3I4MB 2UXDQ 4EGQA 5A2QL 3V6JA 1MZBA 3SK5A 1T5XD 2F0EA 3S2DB 1C0AA 1JXLA 1D5MC 4LFCL 3G6JB 2QILA 1IBML 2F0UA 1PHJA 5M3MB 1IYVA 4A3CG 1OXXK 2ZDHA 5JVLA 2WTFA 1KTAA 3G4SA 2R93A 1DOMA 5T1GA 2UXCQ 5LXTF 1EY8A 1PA6A 5C8YF 2W9CB 5AFWA 2A1AA 4DV4L 2JEIA 2CQYA 5KFEA 4YCUA 2NZHA 1IYUA 1JE4A 2F0VA 1E4GT 4ECSA 5FK9C 1K8AC 1DGSA 4O86A 4EFBA 2VR1A 4XX0B 2YS7A 4K0KH 1QE6A 5FLMH 2K05A 1EIFA 2XWJB 4FBUA 1ZKOA 1SMXA 3QWNA 2Q8RE 3PIP3 2WB1A 5EOYA 3VR6A 4DV5L 4HTHA 1WD0A 5C44H 3GTJB 3LWBA 4R4QA 1DCZA 4DV1Q 3PUYA 4AYBB 4L5RC 5EPLA 5E1FA 1ZYRD 3AB9A 3FKIG 5ELOA 4UCVA 4GKKL 3KYHC 5FO8B 4RGMA 3S1MH 4B3MH 5F9NA 2F0IA 3DTFA 1E2ZA 3GTMA 3RLOA 4O3NA 1STGA 2K28A 4B3ML 2FXQA 1ET0A 5M5WH 4LF5L 2UU9H 1O7ZA 1EKPA 1PFNA 4X66L 3M7GA 4PZ8A 4WHXA 4DR3H 1Y1VB 3NP8A 2HJWA 3GIDA 1D5XC 4MV8A 3WNZA 3RB6A 5I6YA 3I4MG 1K3RA 2VB3X 1DXMA 2B2TC 4LK1C 1QILA 3FKIH 3T7AA 3NBYB 2BOSA 2Y0SA 1KLUD 2B63B 5C44G 1I2KA 2SOBA 5M5XH 3GV5B 3RNUA 4UHVA 1SYFA 1YHAA 2WV6D 2Z4IA 2ZTDA 5IT9W 5G3LD 1CTMA 4X66Q 1JB3A 3IAYA 3KDFB 4TRDA 3VYRA 1UAPA 1VF5C 2VUMB 1TAEA 1EY4A 5CC4A 3A56A 1HR0L 1DZ1A 4HIDA 3M9OB 1CFMA 4MIUA 4O82A 2JA5A 4MTKA 3T53B 2E2JH 4NZOA 2YTVA 4JV0A 1EWCA 1Z7TA 3CCLA 2XIWA 3CCSA 4JV5L 1J6QA 4HJAA 1EY7A 3W3AA 4H13C 2RCFA 3KF8A 1G8ZD 3JAMc 2D0PA 3HG9A 1AW7A 4TKOB 1I2LA 2AGPA 1CI3M 3HOVH 2ZM6H 2XCLA 4DR6Q 2NBFA 2F0LA 2NU6B 4C2MH 2R6GA 4F4ZA 1S0MA 1UEBA 4N8X1 2FJZA 3H0GH 4CBVA 1PX2A 2DJGC 1B53A 3ER0A 4B3TQ 1N32L 2A69D 1K83A 2MJ8A 1K73C 4FF2A 2B8FA 4OELB 3DWQA 3S1QB 3RB3A 1W6KA 3S14B 4FGRA 2ZDGA 2JE6I 1JOOA 4ECUA 4K8JA 4P71A 5DG8A 3OWEB 1GGOA 3L4KA 2IPKD 2NTSA 4KV6A 3U4ZA 2HCIA 4RCOA 4J9PA 1HA5A 5EKKA 3J80i 3AFQA 1PYBA 3TIGA 4IHJF 1JR0D 1AEXA 3K7AB 1BJTA 5I60A 4IUNA 1PH5A 1MHWC 3GTLH 4DL5A 3H15A 4O7VA 4J9KA 4B3SH 4DXGA 2JQOA 4E4TA 2R92B 1B4OA 4L6TB 2H1EA 2QF7A 1N32Q 4FS2A 1A2TA 2FFKB 1WYDA 3HKZE 4LF5Q 4X62H 4QWAA 4IUVA 1CKNA 2PI2E 1EOTA 1VQPA 2QDLA 4A3IG 1FJGQ 2JA7H 1YNXA 5JJIA 3N43B 1JOKA 4RWSC 3T1YH 1CUKA 4XYOA 3NWSA 3J7ZC 1YNND 3TRZA 2WAQA 2V4DA 4RU9A 2ZJRA 2R3ZA 1Z2NX 2NTTA 5EBCA 1Z2PX 1S3OA 2WIIB 3CKIB 1UUPA 3MXPA 3V2TA 4BBRH 3DM3A 3DM1A 3T9EA 4EX5A 3F8NA 2RBMA 5H80A 5DQIA 4DF7A 1WTVA 2R8GA 5EJWA 3PR5B 4DV0H 2EQSA 1A2UA 2WYOA 2HDMA 4KHVA 1Y1VA 4WD3A 2SDFA 1TWAH 1XPUA 2YS6A 2B2TA 2CNVA 4JCVE 4XYMB 3KREA 2Q2TA 3AEVA 3QB3A 3PO2H 4HSPA 3V96A 3WDNA 5FJ8H 4OO1G 1JT8A 4YWMA 4X3KA 2UXCL 3QQMA 2W57A 1L0YB 5BN5A 3CCMA 1XNRQ 1ONLA 5EPJA 3GTKB 4X3UA 2E2IB 3GTGH 4HNVA 4HCSA 1XNQH 4EYIB 1M90C 3GTKH 2X6LA 4FNFA 2L9HA 3KFUA 2EJ3A 2FLLA 3GTGB 4DR5H 1X54A 2JA6H 1IBMH 4JPBW 1N34H 3U4VA 1KT8A 2FPIB 3HFZB 4Y7NB 4DR6H 4AYBA 4Q43A 3J80c 1SJED 3QO2A 4GN4B 1EY6A 3JAMi 1B70B 4Y8VB 3N41B 1WVLA 3TIIA 2F0FA 4B3RH 3CCQA 4ME6A 2DY8A 3GIQA 3TY8A 3IN5A 1TT2A 4HMIA 2NWGA 1SNQA 4LWCA 1K1QA 4FYDA 2BA0A 4XQNA 1X3EA 2F0MA 3HOUB 2NUCA 3I4NB 4DV1H 5GONF 1IYDA 3M4YA 5EZYF 4DL3A 2XWBB 4UCUA 5FPRA 4DV5Q 1JLLB 5JJKA 1B3QA 4IFDI 3N52A 3E5NA 1KAWA 5I5XA 1R9TB 4QIWA 1JIHA 3PUZA 4KKTA 1N36L 1VQ9A 1Y1WA 2R7KA 1BNCA 5EGTA 4ZUJA 4DA2A 1EYDA 1LUZA 1SYXB 3CXCA 5KFLA 3GTOA 4ALPA 3OHXC 5EBDA 3M9MB 2K5DA 5GAGC 2SNMA 4OL7A 4O4LF 4KJNA 4M8AA 4QWEA 4A3EH 1K8GA 1AZQA 3OOCA 2FPGB 4ZQ3A 3GTQH 1E1OA 3T51B 1N56A 3V6KA 2QB5A 4KTAA 1N48A 1W2BA 2NN6G 4H02A 5EDWA 2ALZA 5TSSA 5FPOA 3BG3A 3BVZA 4JG2A 1PTOD 4KHZA 3VPCA 2V9WA 2GPWA 2PW5A 2RSOA 2HCCA 4DAYB 4A3DG 2XVSA 4LH7A 1OXSC 1S5BD 1SN8A 1VMPA 2B2VA 4O3OA 3U9TA 5JUMA 3RB0A 2IJ0A 4KN4C 3TBIB 2CKZB 3CC2A 3TEHB 2W9BB 1A3UA 2B63A 3HOXH 1IYJB 4O7SA 1L1OB 1PTOC 4JC0A 1YHQA 4LF4L 2ATWA 4IUTA 4WJ4A 4JUZA 4YY3Q 3HOXB 2VPSA 2EDGA 4AQYH 4XYQA 5KKNB 3E5SA 2F3WA 5I5TA 4LF6H 2ICIA 2JA5G 4APMA 1LT4D 5C3EG 1FNVA 2WAQB 4OONA 3BAAA 4FU0A 4EEQA 2NB0A 5DQHA 1F2LA 4DR4L 3AFPA 4YBZB 1L1OC 1PTOB 1VQNA 2XSCA 1JWMD 3IRBA 5C4XH 1Q8KA 4EFEA 3EBEA 3CPWA 2QEXA 1HQRD 4DR5L 3NSWA 1SEBD 3A74A 3CCEA 3NGDA 5KT7A 1U4RA 4X64H 3A0JA 3S15B 3AYHB 4JI4H 4NXNH 3RBDA 2H4OA 2K5HA 1U4MA 4B9WA 1LABA 2ZTEA 4HSVA 1JDBB 1IBKL 1Y1VH 3RF2A 2M05A 1H9MA 4DR3L 3C3LA 4H7BA 1UWVA 5I5WA 1PXUA 1YZ6A 4YY3H 4OIJA 3NUAA 2LXKA 4UAIA 5LA6F 4C5AA 4X6AH 2Z9HA 2CZGA 3HOUH 2RDFA 3T9DA 5KIXA 1EQVA 4CDDC 1OTCA 3S1MB 4AH6A 4FE2A 5C1OA 4YJ2F 4C2MA 1MD2D 3EPGA 4CDEC 5FNVF 4NP5A 1PMRA 1YNNC 5KFMA 4NB3A 3VA7A 4DR5Q 1FVIA 4JI6Q 2I87A 2WAQG 4ZQIA 2HGSA 4DV5H 2HHFA 3AMUA 1C9OA 4DU9A 4DUYQ 3JZIA 5C0XH 3J7AV 2VUMA 2IWHA 2HHHL 2Q2HA 2AQ1B 1HNZL 1SRUA 1Q46A 2L55A 3LMLA 1NMGA 4A3DB 4KHPQ 1SJHD 5KFIA 4UPAA 4EQPA 2K5NA 2F0HA 1EKVA 4DNRB 2CH4W 4RGNA 3ONAB 5BR8H 4LF8Q 2UXBL 1BUVT 3DWPA 1VQMA 3T99A 2F0GA 5DEHA 5C5MA 4JI6L 2ZDQA 1XMQL 3HXLA 5M3MH 2F4VQ 4IURA 2C2RA 2X0SA 1WCMH 3I4OA 1GUGA 2BQ3A 2IHFA 1N33H 1K9MC 2EYLA 1VKZA 3PCOB 4QWBA 2Q2UA 4JYAL 4QGUA 2A6HC 1VQFA 3W1GA 1YJ9A 5KS8A 3EFXD 4I50F 2HIXA 2NVXA 1MIUA 2PZWA 3J81j 4F4XA 2DGYA 1X3QA 2CNUA 1QNKA 4NDXA 3RZDB 2UXBH 2J6TA 1NSNS 1NCVA 3QIAA 1BGWA 5KRUA 3J80E 2MFIA 4MTDA 1IW7C 1VQBA 3FMCA 1ILPA 3K8AA 4DV0Q 3MEHA 3HB9A 2RSNA 2JA5B 3MR5A 1P8LA 1EFID 2E2IA 1GO3E 1PTOF 3I91A 4QJFA 3CF5A 2K01A 2KEEA 2DN8A 2QEJC 3I73A 1PFSA 5ELEA 4IJLA 3TP5A 5DM73 4E6IA 2QCPX 1XK5A 3CSWA 5L9XA 3T54A 2J6SA 3Q8PB 1R4PB 4FVMA 3GV3A 4X64Q 1LT3D 4J6HA 2ASJA 4WFN3 1RODA 4QUCA 1C4QA 2MUYA 4LNQA 5IWAL 3TS2A 3UE0A 4EVOA 3HKZA 2A69C 1SYDA 4L5TA 2EXZA 3UDFA 2F0OA 1N9WA 5GADC 5D3IB 5M3FG 4HAEA 3BACA 1EUCB 3KLRA 1SFOH 4A93G 2DNEA 2RA4A 1KRSA 4J9QA 1I3QA 2J0TD 5DGBA 3T4AC 5FO7B 1MJEA 3CMAA 2UUAQ 4EBDA 2IT1A 4GNXA 3SK8A 4L8JA 4WRDA 4QIWB 1R9TA 5C5JA 3ICEA 1F9QA 1KQSA 4PV1C 3HZXA 1TWGH 2F0WA 2OEOA 4IJHA 4JI6H 5EQ0A 4QWDA 3JAME 2AUKA 2KENA 3H6MA 1JB7A 1VQHA 2Y0SE 3CCVA 2OWOA 1HA6A 3MFHA 5K36G 1QB5D 4X65H 5C4ZA 3I70A 1SNDA 1ULZA 1OWTA 2LS01 4K14A 4QMGA 2FMAA 4DPGA 2CHBD 2R92A 1VQIA 3WOFA 4GLAC 1WOCA 3VOTA 1EY5A 5L37A 2FPPB 4CJ1B 1S5FD 4ED1A 2EY5A 4IPDA 2YZMA 3TY9A 4RB0A 4RB3C 4O3SA 3E9HA 4DV6L 1I4HA 2VQFL 1Q90A 3GQCA 2N88A 3SK6A 4LUOA 1HFNA 4AQYQ 1EYZA 1HTPA 5HY6A 1KIXA 3T5LA 4OWXB 1CZWA 3NPPA 5JEAG 3OIPA 2IP4A 3NC0B 1A15A 2CQOA 3I55A 4F8MA 5KT6A 2VL6A 2RCNA 1KNEA 5CA1F 3SDZA 1YNJC 3SE7A 4G3IA 2W6QA 4ECQA 3PW2A 3EVQA 5M5YB 3J81c 2L4NA 4PDBA 3TDQA 3ERQA 3BVMA 1XMQH 2I80A 5COYA 4IR1A 4NXNL 2Z0SA 5KGUA 5C0XG 4F4YA 1Z47A 3L9AX 3K57A 4WBNF 1I4RA 4HEDA 1TWCB 3H4BA 2E74C 3JAMW 2BQRA 1EKFA 2YZLA 1JX4A 2HDLA 1TWCH 4KI0A 1PZID 4F4WA 2BDOA 3GILA 3HEJA 4DR4H 1ZXTA 4JBMA 4RNMA 1HR0W 5I5YA 2V59A 3HOUG 3AW8A 2XGTA 1KC7A 5JOBA 2DLNA 4B3SL 4DR1H 3BG5A 5DLQE 1TWFB 4Q4CA 5DG9A 4R4IA 1LTGD 4TSSA 2E2HA 4JI0L 3M4QA 1XTCD 3MAQA 4A3BG 1VS0A 2F0JA 1GLVA 3BQ0A 1CA5A 5CM0A 3O13A 4O4HF 2JEGA 1B6RA 2QW7A 5CAEB 1HRJA 3F2DA 3UE1A 3Q8DA 4R4CA 3LULA 3NBHA 3J81L 1HFGA 2V4QA 1EIYB 4G7OC 2JA6A 1A8VA 1EQTA 1TA8A 1Y8PB 3T1HQ 5C4XG 1RK5A 2EIYA 2UVRA 4GS3A 4JVZA 1GHKA 2I5LX 2L12A 4QCLA 2O5IC
chains in the Genus database with same CATH topology
1HR0H 4X66Q 3KDFB 4CC6A 3HKSA 3ULLA 5C3EH 4UCSA 3CC7A 1TAEA 4E6NA 5IYCH 5IYDH 4GNXB 1HR0L 1Q81C 4HIDA 3RIZA 4BXXH 4LFCH 4XTCS 1HH2P 3L2PA 3PN1A 5D1PA 2E2JH 3W1BA 3CD6A 2YTVA 2NVTH 3N44B 3CCLA 4IOAA 2UUAH 2F52A 3CCSA 3F1ZA 3HOZG 3PO3H 1J6QA 4HJAA 4LUZA 4A75A 4JV5L 2UU9L 3L7ZC 1UE1A 3JAMc 2D0PA 2ZJQA 1PH2A 4A3BH 1HZ9A 2B29A 3L0OA 4HIMA 3RGXA 4MZ9A 1XDNA 4A3MH 1Z2OX 4LSXA 3HOVH 2HVSA 2ZM6H 1TXYA 2F3IA 4UCOA 2EIFA 1G51A 2V1CC 4DR6Q 3T1HL 4LSAA 2AMCB 4C2MH 2R6GA 1AE3A 5LMUH 3F2BA 4NXNQ 1UEBA 1FJGH 5J3BA 4C3HH 3H0GH 4DV7L 4X62Q 4LF5H 3ER0A 4B3TQ 3CW2C 4OO1I 1VQLA 1N32L 3CCRA 2R93H 3DF7A 1NMFA 1K73C 1N36Q 1LTLA 1SROA 1KD1C 1Q12A 4JI3L 2VQEL 1VQKA 1Y1WG 2PI2A 4HJ8A 2JE6I 3S1NH 1E22A 1K0RA 2B3GA 5EAYA 4IAJA 4P71A 2ZJPA 5FLMG 3L4KA 4Q0YA 4BWSC 3ERSX 4P75A 3U4ZA 4UFZA 3OTOH 5IE8A 3EN2A 2UXDH 3J80i 3G48A 3AFQA 3S24A 2JJQA 1ZHSA 1E1TA 1PYBA 4QY7A 5FJ8G 3STBC 1EFWA 3UDXA 2A8VA 3NBHB 3PUWA 4UP8A 2L15A 1BJTA 1PH5A 1G291 4DV7Q 5LMNL 1BKBA 4P73A 1VQ4A 1JJCB 3GTLH 1CKOA 2PQAB 3H15A 3RN2A 3GTOH 3M4OH 4P74A 3EYYA 3WWVA 2OTLA 2MO0A 1QZGA 1PH7A 3K7AH 3G6EA 4JI7L 4B3SH 2UXCH 2JQOA 1I6UA 5GQOA 3GTMH 3D31A 4LF9L 1N32Q 3TREA 2JA8G 4A93H 3ZJYC 2YV5A 4BBSG 3PUXA 1WYDA 1N32H 1PYSB 3HKZE 4LF5Q 4X62H 4JI5L 2HHHH 1JMCA 3K7UC 1CKNA 2PI2E 1VQPA 2WFWA 1FJGQ 1E7ZA 4NPSA 4A3IG 1YNXA 1FGUA 5IY0A 2JA7H 1M0WA 3N43B 2PNHA 3T1YH 1CUKA 1I94H 3KF6A 2N3SA 4OWTB 1VQ5A 1UE6A 3J7ZC 2EXDA 3H3VH 3TRZA 4AQYL 1SE8A 2ZJRA 1Z2NX 4BBSH 3UDIA 1Z2PX 1S3OA 4DKAC 3HOYH 4DUZH 1FKAH 4BBRH 3DM3A 3KJPA 4C3IH 4EX5A 3F8NA 4JI8Q 2E5LL 4LF7Q 3KALA 4GKJH 2UUAL 5LMNQ 1OXTA 4DV0H 2EQSA 5DISC 2KHJA 1TWHH 5FD5A 2WYOA 3M7NA 2MCTA 3PGZA 2CFMA 2CW8A 2UXDL 1D8LA 1TWAH 1XPUA 4X62L 2PMZE 3M3YH 2VUMH 3KF6B 3E9IA 4JCVE 1XMOL 4RB1A 2Q2TA 3HOWG 5E7NA 2YTYA 4QQBX 3AEVA 5IP7G 2VY3A 3PO2H 1V43A 4BA2I 1IBLH 2IHEA 1QUQB 4IPCA 3KLWA 4YWMA 5FJ8H 4OO1G 2UXCL 1JT8A 2W57A 4DUYH 4JI7H 3CCMA 1XNRQ 3GD7A 1IBLL 3GTGH 1XNQH 2GVBA 1P16A 1M90C 3U58A 4AYBG 2BH2A 3GTKH 2K14A 3KFUA 1L0WA 1GD7A 3J81i 2N49A 4DR5H 1X54A 5M3FH 1RL2A 2CCZA 4JI0H 2F4VH 2JA6H 1IBMH 1N34H 3S1QH 4B3RQ 1BBUA 3U4VA 2GN5A 3M4PA 2R93G 1Z9FA 3HFZB 1VQ6A 2WE6A 2HVRA 1HNWQ 1E3PA 1YBYA 2JA7G 4DR6H 3PF4A 1NBWA 2AWOA 3J80c 3J80W 3PIPA 4PG3A 5IP9H 2MQHA 3BZKA 4GN4B 2I5MX 3KF8B 4JI8L 1B70B 1HJPA 2PQAA 3JAMi 4DUZL 2NVXH 4GKJQ 4Y52H 2JA8H 3N41B 3OYYA 3PSIA 4XIGS 3CCQA 5C0XJ 4B3RH 2UU9Q 1MKHA 3K0XA 5LMUL 3TY8A 2KSWA 3HOVG 1TWFH 1YHBA 3RLNA 3MXNB 4OXPA 1Q82C 4LFAL 2JEAI 3QWUA 4MTNA 1S68A 3S17H 4AYBE 1X56A 4LWCA 4AIMA 4DAMA 4FM9A 4A3GG 4OX9H 2BA0A 3NELA 1FJGL 1VQDA 1X3EA 3HKZG 1AH9A 4RZQA 4BY1G 2RGVA 4DR4Q 4DV1H 2I0QA 1ASZA 3LGJA 1O7IA 1CKMA 2VQFQ 4A3LH 4UCUA 4DV5Q 1M1KC 5JJKA 4IFDI 1U5KA 5FPRA 5IWAQ 2XIGA 3KXYT 1IBLQ 2XTIA 1KAWA 2YYZA 4IPGA 4BXXG 4LH6A 4MV9A 4NXMQ 3J7AK 1UE7A 1MJCA 3CQZH 3PUZA 4UP7A 4A3JH 1N36L 1VQ9A 1HZBA 3M9BA 4HJ9A 3KDFA 2ES2A 2UUBQ 3EIVA 4X64L 1B04A 1HNXH 1SYXB 5C0XI 1LUZA 2VOBA 1B8AA 3CXCA 1A0IA 3D0FA 1I6HH 5LMNH 4ALPA 2F4VL 5GAGC 4UY8C 1QVGA 4NXMH 1A63A 1YEZA 1MJEA 4A3EH 1K8GA 4PZ7A 4LF8L 2UXBQ 2UUBH 4JBWA 5FD6A 3GTQH 1E1OA 4X65Q 2UUCH 3S2HH 2DUDA 1W2BA 2NN6G 3S16H 4H02A 4BY7G 2KHIA 4ME3A 5BR8L 4JI0Q 4A3KG 3MWMA 2R92G 5FPOA 3CAMA 4JG2A 4B3MQ 4KHZA 1BBWA 4IO9A 2HHHQ 4JV5Q 3RGZA 4IPHA 2VQEQ 4DAYB 1CSPA 4A3MG 1XPRA 4A3DG 2OTJA 1OXSC 2R7FA 2WAQE 1EWIA 1SN8A 3T1YL 1XNQQ 4LH7A 4OX9L 2WDTA 4GLXA 1XTDA 3I4NG 4B3TL 4DR1Q 3H3VI 2VS1A 4JI5H 2CKZB 3TQYA 3CC2A 3TEHB 1NTGA 4DV1L 4DV2L 3PO3G 3HOXH 4POFA 3HOZH 3RJ0A 1IYJB 1L1OB 2N8NA 4JBJA 4JC0A 1YHQA 4LF4L 2ATWA 3J7A5 4WJ4A 4JI1Q 4DV3Q 1OXUA 4YY3Q 3GJXB 2Z6KA 4HJ7A 1JE5A 4LFBL 2VPSA 4AQYH 5GAHC 3A5UA 1M0TA 1A62A 4LF6H 2JA5G 4JOIC 5ELNA 5JEAJ 5C3EG 4GOPA 4KHPL 2AKWB 2OQKA 4APMA 2LXJA 4OONA 3BAAA 3DLLA 4EEQA 4DR7H 3UQ8A 4DNIA 1EUJA 3OTOQ 3FP9A 2RHQB 3GDEA 4DR4L 1KC8C 3AFPA 2BH8A 1L1OC 1XNRH 1VQOA 1VQNA 2RF4A 3BA8A 1E4FT 3IRBA 4GKKH 5C4XH 1Q8KA 4GN5A 4GN3B 3T1YQ 1XNQL 4EFEA 3N42B 3EBEA 4RB2C 3CPWA 2QEXA 1HR0Q 2WP8J 4DR5L 5LMUQ 4JI2L 2E8GA 2IX0A 3A74A 4YCVA 3CCEA 4K0KL 3I4MH 4LFBH 4A3FH 1HNXL 4X64H 4L5QA 1IXRA 3A0JA 3AYHB 1Q7YC 2WB1E 4POGA 4IFDG 1VQ7A 1J5EH 3BJUA 4NXNH 2K5HA 4A3CH 2ZTEA 1WI5A 1HZCA 4LW1A 4B3SQ 3I4NH 1HNWL 3GB8B 3H20A 4IFDJ 1J5EL 1HZAA 1OXVA 4JI4L 1IBKL 1Y1VH 3RF2A 4LF8H 4YHHH 3S1RH 3N6XA 4LF4Q 1VQGA 4A3DH 4DR3L 1N34L 4MNOA 1UWVA 1NY4A 3OTOL 2UUCL 2JA9A 1YZ6A 1VQ8A 4J0MA 2R92H 4YY3H 4A3FG 2R7DA 4DV6Q 4DV4Q 2LXKA 4TQUS 2KBNA 4A4IA 2E2IH 1PH6A 2QGQA 2R7ZH 4X6AH 3TY5A 3VNNA 3HOUH 4DK6C 5LL6b 1YIJA 3KJOA 1OTCA 1AN7A 4DV3L 4Y7NH 4AH6A 4EQ5A 1KRTA 3J81W 1IBMQ 2WB1G 2VQEH 4NB3A 4LFCQ 4DR5Q 1FVIA 4JI6Q 3NBZB 2WAQG 4DV2H 2HGSA 1XMOH 2Q2IA 3VDYA 1E24A 4DV5H 3PIOA 1HNZH 2Z6KC 4DR2Q 4BA1I 4QIWE 3S15H 4GKKQ 1C9OA 1KHIA 4DUYQ 2JA5H 3FMAA 4A3JG 1X3FA 2HHHL 2Q2HA 1HNZL 2OCEA 4RMFA 2E5LQ 4LF7L 1S72A 1SRUA 1Q46A 5LMNW 3PV0A 5AJ3Q 3CVZA 1NMGA 3LMLA 4A3LG 3JSNA 3JSLA 4WJ3M 4DR7L 4DR4H 4KHPQ 1L1OA 4UPAA 2ZM6Q 1GM5A 4LFAH 2K5VA 2K5NA 4BY1H 3KOJA 4DV3H 1NJIC 4LF8Q 4A3GH 2UXBL 2O03A 1W3SA 2I5HA 4LUVA 5M5YH 1VQMA 4R4OA 4LF6Q 3M85A 5BR8H 4JI6L 1X6OA 1XMQL 1L2FA 2ZTCA 4GLVB 5M3MH 4YHHQ 2OQ0A 3CCUA 2F4VQ 3HXLA 1XMQQ 4R4TA 1YI2A 1WCMH 3I4OA 2K50A 1YVCA 2IHFA 4A3KH 1N33H 1K9MC 3RZOH 3PCOB 2QA4A 2Q2UA 3BZCA 4MV7A 4P72A 2KCMA 4JYAL 4QGUA 4B3TH 1VQFA 3W1GA 4GNXC 1YJ9A 4JYAQ 2HIXA 4LFBQ 2VZAA 2B63H 1MIUA 2K4KA 3J81j 4PMWA 2DGYA 1YITA 1N33Q 2HT1A 4DV2Q 4JI2Q 1PV4A 4M7EA 4JI3H 2C35B 3BA9A 4JI4H 1GYFA 2UXBH 3S14H 3B6YA 2BA1A 1I94L 4OX9Q 4O2DA 4YWKA 1V9PA 3CP0A 4CC5A 3I56A 1BGWA 3T1HH 4ETSA 2MFIA 2ZM6L 3C0FB 4MTDA 2E2HH 4C3JH 1D7QA 1VQBA 1SEIA 1N33L 1X65A 4LF7H 1SR3A 3K81C 3E0EA 3K8AA 4L5SA 2E5LH 4DV0Q 1SLJA 3ULPA 1PH9A 1P8LA 3IG0A 4DUYL 4KHPH 5FLXW 1GO3E 3CF5A 1GVPA 4QJFA 1YJNA 1XNRL 3GTPH 3RTXA 1L2ZA 4DR2L 1EQQA 1PFSA 3RN5A 4IJLA 5IYBH 1XK5A 4B3RL 3ULJA 4QL5A 4UCTA 1RIPA 3RR5A 3F8TA 3PUVA 1XMOQ 1C7YA 4JI5Q 5D1OB 1LM0A 2LSSA 1KL9A 4HIOA 3STBD 4BBRG 4X64Q 2IY5B 1LYLA 1JJ2A 3HOYG 2RHSB 4A2BA 1EOVA 1YJWA 4JYAH 2NZOA 4LF9Q 2ALYB 3I2ZA 5IP9G 1O75A 1V1QA 2K52A 1IBKH 2MO1A 1WJJA 4DR7Q 1G6PA 4LNQA 5IWAL 3TS2A 1H95A 3NENA 1VQCA 3UE0A 5FLXc 4L5TA 1WH2A 3UDFA 1N9WA 2Y0SG 5GADC 2JA6G 3CPFA 5M3FG 2HIVA 4X65L 1HNWH 4JI8H 3MEFA 2HVQA 1CSQA 2YTXA 1SFOH 4A93G 4DV4H 1KRSA 2ZJTA 3GTJH 1WCMG 4HIKA 3AQQA 4YCWA 3CC4A 2A19A 1Y14B 4GOPC 3CMAA 1VQJA 1FL0A 2D62A 5M3MG 4DV0L 1PH8A 2UUAQ 1JJGA 1HNXQ 1AE2A 3KAKA 1B7YB 1GKHA 1I5FA 2IT1A 5IP7H 5IYBG 4GNXA 1S40A 3PO2G 4UCRA 3HOWH 3OW2A 1HNZQ 3ICEA 3L4JA 2UUBL 1KQSA 4RAZA 1TWGH 4IJHA 3S2DH 2VNUD 4JI6H 2VUMG 2IX1A 1QVCA 4NXML 4JI7Q 4DR2H 2KENA 1I94Q 1JB7A 4X66H 4PZ6A 3GO5A 1VQHA 2Y0SE 4YWLA 3CCVA 1QUQA 4IOCA 2OWOA 3RLFA 2UUCQ 3G71A 5C4JH 5GROA 2B63G 5K36G 4MTEA 4X65H 3I7FA 4JV5H 5IT9c 1VCIA 4JBKA 4LF6L 4DPGA 4DR1L 1VQIA 1XPOA 1I50H 4HJ5A 4GLAC 1WOCA 5A2QW 3PF5A 1PH1A 4UP9A 4DV6H 4LFAQ 1EQRA 2MNAA 3CCJA 1Y1WH 1QVFA 2NVQH 1VQEA 4IPDA 4DK3C 3TY9A 4RB0A 3CMEA 4JI2H 4RB3C 4JI1L 3E9HA 1IZ6A 3JC66 4DV6L 5AJ3L 4R1JA 2JK8A 2HQLA 2VQFL 1PH4A 4A3IH 1XJVA 5JJIA 1KXLA 2NVYH 4YHHL 3BABA 1U0LA 3H0GG 4LUOA 2YCHA 3UDGA 2H5XA 4AQYQ 3KAJA 5HY6A 1PH3A 1KIXA 4OWXB 1VQAA 5H1SE 1J5EQ 1NE3A 5JEAG 4JI4Q 5HGQA 2UXDQ 1I3QH 2YU9H 5GAEC 2VUGA 1MZBA 2CW7A 1BVSA 3K80C 3NC0B 2D0OA 1C0AA 2CQOA 4LFCL 3I55A 2VL6A 2RCNA 1IBML 1Y1VG 4R7RA 2AWNA 4LMYA 5IWAH 2ASBA 3BU2A 1PHJA 1Q1BA 3SGIA 1EYGA 1OXXK 4A3CG 1Q1EA 5JJLA 1ZHQA 3J81c 2N78A 1K83H 3G4SA 4OWWB 3N40P 4PDBA 2VW9A 2UXCQ 1N36H 4YY3L 1N8RC 1PA6A 4DV4L 2A1AA 1WFQA 4YCUA 2NZHA 1E4GT 4FDBA 1X55A 1XMQH 1K8AC 1DGSA 1IL2A 4NXNL 2Z0SA 5IYDG 2GVAA 5C0XG 4EFBA 1S03G 1Z47A 5IYCG 4GOPB 3W5OA 2K75A 4K0KH 5FLMH 1EIFA 2CWPA 4RG1A 1SMXA 3RZDH 3JAMW 4DV7H 5EOYA 1TWCH 4KI0A 1X3GA 4DV5L 2VQFH 5C44H 4LF9H 4K0KQ 3FHWA 4R4QA 4DUZQ 4DV1Q 3PUYA 4JBMA 4GKJL 4DR3Q 2CWAA 1HR0W 4L5RC 3TS0A 3HOUG 2XGTA 3F2CA 3FKIG 5ELOA 1IBKQ 4JI3Q 2R7ZG 3KYHC 1CKNB 3A5ZB 3S1MH 4GKKL 4UCVA 4A2AA 4B3MH 4DR1H 4B3SL 1PVOA 5DLQE 3RLOA 3NEMA 3HOXG 4R4IA 4B3ML 2FXQA 4JI1H 2UU9H 5M5WH 4LF5L 5BR8Q 2KCTA 4JI0L 3M4QA 4JOIA 4A3BG 4DRFA 1VS0A 2FE3A 4X66L 5D1OA 4DR6L 3K3VA 4PZ8A 4DR3H 2ID0A 1T9HA 4KLKA 2AHOB 1QZHA 4LF4H 4O0AA 3I4MG 1K3RA 3UE1A 3Q8DA 3F2DA 4TVAB 4R4CA 4BY7H 3FKIH 4J15A 3NBYB 2RGRA 1N34Q 1X9NA 1R9TH 1EIYB 4A76A 1A8VA 1TA8A 2JEBI 3M4IA 4A3EG 5C44G 3T1HQ 5M5XH 5C4XG 4I7HA 3RNUA 4GS3A 4APVA 2I5LX 1Q86C 3U50C 1ASYA 1YHAA 2NN6I 2ZTDA 4RAYA 5IT9W 1UE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 Q;  3KDF B;  4CC6 A;  3HKS A;  3ULL A;  5C3E H;  4UCS A;  3CC7 A;  1TAE A;  4E6N A;  5IYC H;  5IYD H;  4GNX B;  1HR0 L;  1Q81 C;  4HID A;  4BXX H;  4XTC S;  1HH2 P;  3L2P A;  3PN1 A;  5D1P A;  2E2J H;  3W1B A;  3CD6 A;  2YTV A;  2NVT H;  3CCL A;  4IOA A;  2F52 A;  3CCS A;  3F1Z A;  3HOZ G;  3PO3 H;  1J6Q A;  4HJA A;  4LUZ A;  4A75 A;  4JV5 L;  2UU9 L;  3L7Z C;  1UE1 A;  3JAM c;  2D0P A;  2ZJQ A;  1PH2 A;  4A3B H;  1HZ9 A;  2B29 A;  3L0O A;  4HIM A;  4MZ9 A;  1XDN A;  4A3M H;  3HOV H;  2HVS A;  1TXY A;  2F3I A;  4UCO A;  2EIF A;  1G51 A;  2V1C C;  4DR6 Q;  3T1H L;  2AMC B;  4C2M H;  2R6G A;  1AE3 A;  3F2B A;  4NXN Q;  1UEB A;  5J3B A;  4C3H H;  3H0G H;  4DV7 L;  4X62 Q;  3ER0 A;  4B3T Q;  3CW2 C;  4OO1 I;  1VQL A;  1N32 L;  3CCR A;  2R93 H;  1NMF A;  1K73 C;  1N36 Q;  1LTL A;  1SRO A;  1KD1 C;  1Q12 A;  4JI3 L;  2VQE L;  1VQK A;  1Y1W G;  2PI2 A;  4HJ8 A;  2JE6 I;  3S1N H;  1E22 A;  1K0R A;  2B3G A;  5EAY A;  4P71 A;  2ZJP A;  5FLM G;  3ERS X;  4P75 A;  3U4Z A;  4UFZ A;  5IE8 A;  3EN2 A;  3J80 i;  3G48 A;  3AFQ A;  3S24 A;  2JJQ A;  1E1T A;  1PYB A;  4QY7 A;  5FJ8 G;  3STB C;  1EFW A;  3UDX A;  2A8V A;  3NBH B;  3PUW A;  4UP8 A;  2L15 A;  1PH5 A;  1G29 1;  4DV7 Q;  5LMN L;  1BKB A;  4P73 A;  1VQ4 A;  1JJC B;  3GTL H;  1CKO A;  2PQA B;  3H15 A;  3RN2 A;  3GTO H;  3M4O H;  4P74 A;  3WWV A;  2OTL A;  2MO0 A;  1QZG A;  1PH7 A;  3K7A H;  3G6E A;  4JI7 L;  2JQO A;  5GQO A;  3GTM H;  3D31 A;  4LF9 L;  1N32 Q;  3TRE A;  2JA8 G;  4A93 H;  3ZJY C;  2YV5 A;  4BBS G;  3PUX A;  1WYD A;  1PYS B;  3HKZ E;  4LF5 Q;  4JI5 L;  1JMC A;  3K7U C;  1CKN A;  2PI2 E;  1VQP A;  2WFW A;  1FJG Q;  1E7Z A;  4NPS A;  4A3I G;  1YNX A;  1FGU A;  5IY0 A;  2JA7 H;  2PNH A;  1CUK A;  3KF6 A;  2N3S A;  4OWT B;  1VQ5 A;  1UE6 A;  3J7Z C;  2EXD A;  3H3V H;  3TRZ A;  4AQY L;  1SE8 A;  2ZJR A;  4BBS H;  3UDI A;  1S3O A;  4DKA C;  3HOY H;  4BBR H;  3DM3 A;  3KJP A;  4C3I H;  4EX5 A;  4JI8 Q;  2E5L L;  4LF7 Q;  2UUA L;  5LMN Q;  1OXT A;  2EQS A;  5DIS C;  2KHJ A;  1TWH H;  3M7N A;  3PGZ A;  2CFM A;  2UXD L;  1D8L A;  1TWA H;  1XPU A;  4X62 L;  2PMZ E;  3M3Y H;  2VUM H;  3KF6 B;  3E9I A;  4JCV E;  1XMO L;  2Q2T A;  3HOW G;  5E7N A;  2YTY A;  4QQB X;  3AEV A;  5IP7 G;  2VY3 A;  3PO2 H;  1V43 A;  4BA2 I;  2IHE A;  1QUQ B;  4IPC A;  3KLW A;  4YWM A;  5FJ8 H;  4OO1 G;  2UXC L;  1JT8 A;  3CCM A;  1XNR Q;  3GD7 A;  1IBL L;  3GTG H;  2GVB A;  1P16 A;  1M90 C;  3U58 A;  4AYB G;  2BH2 A;  3GTK H;  2K14 A;  3KFU A;  1L0W A;  1GD7 A;  3J81 i;  2N49 A;  1X54 A;  5M3F H;  1RL2 A;  2CCZ A;  2JA6 H;  3S1Q H;  4B3R Q;  1BBU A;  3U4V A;  2GN5 A;  3M4P A;  2R93 G;  1Z9F A;  3HFZ B;  1VQ6 A;  2HVR A;  1HNW Q;  1E3P A;  1YBY A;  2JA7 G;  3PF4 A;  1NBW A;  2AWO A;  3J80 c;  3PIP A;  4PG3 A;  5IP9 H;  2MQH A;  3BZK A;  4GN4 B;  2I5M X;  3KF8 B;  4JI8 L;  1B70 B;  1HJP A;  2PQA A;  3JAM i;  4DUZ L;  2NVX H;  4GKJ Q;  4Y52 H;  2JA8 H;  3OYY A;  3PSI A;  4XIG S;  3CCQ A;  5C0X J;  2UU9 Q;  1MKH A;  3K0X A;  5LMU L;  3TY8 A;  3HOV G;  1TWF H;  1YHB A;  3RLN A;  3MXN B;  4OXP A;  1Q82 C;  4LFA L;  2JEA I;  3QWU A;  4MTN A;  1S68 A;  3S17 H;  4AYB E;  1X56 A;  4LWC A;  4AIM A;  4DAM A;  4A3G G;  2BA0 A;  3NEL A;  1FJG L;  1VQD A;  1X3E A;  3HKZ G;  1AH9 A;  4BY1 G;  4DR4 Q;  2I0Q A;  1ASZ A;  3LGJ A;  1O7I A;  1CKM A;  2VQF Q;  4A3L H;  4UCU A;  4DV5 Q;  1M1K C;  5JJK A;  4IFD I;  1U5K A;  5FPR A;  5IWA Q;  1IBL Q;  2XTI A;  1KAW A;  2YYZ A;  4IPG A;  4BXX G;  4LH6 A;  4NXM Q;  1UE7 A;  1MJC A;  3CQZ H;  3PUZ A;  4UP7 A;  4A3J H;  1N36 L;  1VQ9 A;  1HZB A;  3M9B A;  4HJ9 A;  3KDF A;  2ES2 A;  2UUB Q;  3EIV A;  4X64 L;  1B04 A;  5C0X I;  1LUZ A;  1B8A A;  3CXC A;  1A0I A;  3D0F A;  1I6H H;  4ALP A;  2F4V L;  5GAG C;  4UY8 C;  1QVG A;  1A63 A;  1YEZ A;  1MJE A;  4A3E H;  1K8G A;  4PZ7 A;  4LF8 L;  2UXB Q;  4JBW A;  3GTQ H;  1E1O A;  4X65 Q;  3S2H H;  2DUD A;  1W2B A;  2NN6 G;  3S16 H;  4H02 A;  4BY7 G;  2KHI A;  4ME3 A;  5BR8 L;  4JI0 Q;  4A3K G;  2R92 G;  5FPO A;  3CAM A;  4JG2 A;  4B3M Q;  4KHZ A;  1BBW A;  4IO9 A;  2HHH Q;  4JV5 Q;  4IPH A;  2VQE Q;  4DAY B;  1CSP A;  4A3M G;  1XPR A;  4A3D G;  2OTJ A;  1OXS C;  2R7F A;  2WAQ E;  1EWI A;  1SN8 A;  3T1Y L;  1XNQ Q;  4LH7 A;  4OX9 L;  4GLX A;  1XTD A;  3I4N G;  4B3T L;  4DR1 Q;  3H3V I;  2VS1 A;  2CKZ B;  3TQY A;  3CC2 A;  3TEH B;  1NTG A;  4DV1 L;  4DV2 L;  3PO3 G;  3HOX H;  4POF A;  3HOZ H;  1IYJ B;  1L1O B;  2N8N A;  4JBJ A;  4JC0 A;  1YHQ A;  4LF4 L;  2ATW A;  3J7A 5;  4WJ4 A;  4JI1 Q;  4DV3 Q;  1OXU A;  4YY3 Q;  3GJX B;  2Z6K A;  4HJ7 A;  1JE5 A;  4LFB L;  5GAH C;  3A5U A;  1A62 A;  2JA5 G;  4JOI C;  5ELN A;  5JEA J;  5C3E G;  4GOP A;  4KHP L;  2AKW B;  2OQK A;  2LXJ A;  4OON A;  3BAA A;  3DLL A;  4EEQ A;  3UQ8 A;  4DNI A;  1EUJ A;  3OTO Q;  3FP9 A;  2RHQ B;  3GDE A;  4DR4 L;  1KC8 C;  3AFP A;  2BH8 A;  1L1O C;  1VQO A;  1VQN A;  2RF4 A;  3BA8 A;  3IRB A;  5C4X H;  1Q8K A;  4GN5 A;  4GN3 B;  3T1Y Q;  1XNQ L;  4EFE A;  3EBE A;  3CPW A;  2QEX A;  1HR0 Q;  2WP8 J;  4DR5 L;  5LMU Q;  4JI2 L;  2E8G A;  2IX0 A;  3A74 A;  4YCV A;  3CCE A;  4K0K L;  3I4M H;  4A3F H;  1HNX L;  4L5Q A;  1IXR A;  3A0J A;  3AYH B;  1Q7Y C;  2WB1 E;  4POG A;  4IFD G;  1VQ7 A;  3BJU A;  2K5H A;  4A3C H;  2ZTE A;  1WI5 A;  1HZC A;  4LW1 A;  4B3S Q;  3I4N H;  1HNW L;  3GB8 B;  4IFD J;  1J5E L;  1HZA A;  1OXV A;  4JI4 L;  1IBK L;  1Y1V H;  3S1R H;  4LF4 Q;  1VQG A;  4A3D H;  4DR3 L;  1N34 L;  4MNO A;  1UWV A;  1NY4 A;  3OTO L;  2UUC L;  2JA9 A;  1YZ6 A;  1VQ8 A;  2R92 H;  4A3F G;  2R7D A;  4DV6 Q;  4DV4 Q;  2LXK A;  4TQU S;  2KBN A;  4A4I A;  2E2I H;  1PH6 A;  2QGQ A;  2R7Z H;  4X6A H;  3TY5 A;  3VNN A;  3HOU H;  4DK6 C;  1YIJ A;  3KJO A;  1OTC A;  4DV3 L;  4Y7N H;  4AH6 A;  4EQ5 A;  1KRT A;  1IBM Q;  2WB1 G;  4NB3 A;  4LFC Q;  4DR5 Q;  1FVI A;  4JI6 Q;  3NBZ B;  2WAQ G;  2Q2I A;  3VDY A;  1E24 A;  3PIO A;  2Z6K C;  4DR2 Q;  4BA1 I;  4QIW E;  3S15 H;  4GKK Q;  1C9O A;  1KHI A;  4DUY Q;  2JA5 H;  4A3J G;  1X3F A;  2HHH L;  2Q2H A;  1HNZ L;  2OCE A;  4RMF A;  2E5L Q;  4LF7 L;  1S72 A;  1SRU A;  1Q46 A;  5LMN W;  3PV0 A;  5AJ3 Q;  1NMG A;  4A3L G;  3JSN A;  3JSL A;  4WJ3 M;  4DR7 L;  4KHP Q;  1L1O A;  4UPA A;  2ZM6 Q;  1GM5 A;  2K5V A;  2K5N A;  4BY1 H;  3KOJ A;  1NJI C;  4LF8 Q;  4A3G H;  2UXB L;  1W3S A;  2I5H A;  4LUV A;  5M5Y H;  1VQM A;  4R4O A;  4LF6 Q;  3M85 A;  4JI6 L;  1X6O A;  1XMQ L;  1L2F A;  2ZTC A;  4GLV B;  5M3M H;  4YHH Q;  2OQ0 A;  3CCU A;  2F4V Q;  1XMQ Q;  4R4T A;  1YI2 A;  1WCM H;  3I4O A;  2K50 A;  1YVC A;  2IHF A;  4A3K H;  1K9M C;  3RZO H;  3PCO B;  2QA4 A;  2Q2U A;  3BZC A;  4P72 A;  2KCM A;  4JYA L;  4QGU A;  1VQF A;  3W1G A;  4GNX C;  1YJ9 A;  4JYA Q;  2HIX A;  4LFB Q;  2VZA A;  2B63 H;  1MIU A;  2K4K A;  3J81 j;  4PMW A;  2DGY A;  1YIT A;  1N33 Q;  2HT1 A;  4DV2 Q;  4JI2 Q;  1PV4 A;  2C35 B;  3BA9 A;  3S14 H;  3B6Y A;  2BA1 A;  1I94 L;  4OX9 Q;  4O2D A;  4YWK A;  1V9P A;  3CP0 A;  4CC5 A;  3I56 A;  2MFI A;  2ZM6 L;  2E2H H;  4C3J H;  1D7Q A;  1VQB A;  1N33 L;  1X65 A;  1SR3 A;  3K81 C;  3E0E A;  3K8A A;  4L5S A;  4DV0 Q;  1SLJ A;  3ULP A;  1PH9 A;  1P8L A;  4DUY L;  1GO3 E;  3CF5 A;  1GVP A;  4QJF A;  1YJN A;  1XNR L;  3GTP H;  3RTX A;  4DR2 L;  1EQQ A;  1PFS A;  3RN5 A;  4IJL A;  5IYB H;  1XK5 A;  4B3R L;  3ULJ A;  4QL5 A;  4UCT A;  1RIP A;  3RR5 A;  3F8T A;  3PUV A;  1XMO Q;  1C7Y A;  4JI5 Q;  5D1O B;  1LM0 A;  2LSS A;  1KL9 A;  4HIO A;  3STB D;  4BBR G;  4X64 Q;  2IY5 B;  1LYL A;  1JJ2 A;  3HOY G;  2RHS B;  1EOV A;  1YJW A;  2NZO A;  4LF9 Q;  2ALY B;  3I2Z A;  5IP9 G;  1V1Q A;  2K52 A;  2MO1 A;  1WJJ A;  4DR7 Q;  1G6P A;  4LNQ A;  5IWA L;  3TS2 A;  1H95 A;  3NEN A;  1VQC A;  3UE0 A;  5FLX c;  4L5T A;  3UDF A;  1N9W A;  2Y0S G;  5GAD C;  2JA6 G;  3CPF A;  5M3F G;  2HIV A;  4X65 L;  3MEF A;  2HVQ A;  1CSQ A;  2YTX A;  1SFO H;  4A93 G;  1KRS A;  3GTJ H;  1WCM G;  4HIK A;  3AQQ A;  4YCW A;  3CC4 A;  2A19 A;  1Y14 B;  4GOP C;  3CMA A;  1VQJ A;  1FL0 A;  2D62 A;  5M3M G;  4DV0 L;  1PH8 A;  2UUA Q;  1JJG A;  1HNX Q;  1AE2 A;  1B7Y B;  1GKH A;  1I5F A;  2IT1 A;  5IP7 H;  5IYB G;  4GNX A;  1S40 A;  3PO2 G;  4UCR A;  3HOW H;  3OW2 A;  1HNZ Q;  3ICE A;  2UUB L;  1KQS A;  1TWG H;  4IJH A;  3S2D H;  2VNU D;  2VUM G;  2IX1 A;  1QVC A;  4NXM L;  4JI7 Q;  2KEN A;  1I94 Q;  1JB7 A;  4PZ6 A;  3GO5 A;  1VQH A;  2Y0S E;  4YWL A;  3CCV A;  1QUQ A;  4IOC A;  2OWO A;  3RLF A;  2UUC Q;  3G71 A;  5C4J H;  5GRO A;  2B63 G;  5K36 G;  3I7F A;  5IT9 c;  1VCI A;  4JBK A;  4LF6 L;  4DPG A;  4DR1 L;  1VQI A;  1XPO A;  1I50 H;  4HJ5 A;  4GLA C;  1WOC A;  3PF5 A;  1PH1 A;  4UP9 A;  4LFA Q;  1EQR A;  2MNA A;  3CCJ A;  1Y1W H;  1QVF A;  2NVQ H;  1VQE A;  4IPD A;  4DK3 C;  3TY9 A;  3CME A;  4JI1 L;  3E9H A;  1IZ6 A;  3JC6 6;  4DV6 L;  5AJ3 L;  4R1J A;  2JK8 A;  2HQL A;  2VQF L;  1PH4 A;  4A3I H;  1XJV A;  5JJI A;  1KXL A;  2NVY H;  4YHH L;  3BAB A;  1U0L A;  3H0G G;  4LUO A;  3UDG A;  2H5X A;  4AQY Q;  5HY6 A;  1PH3 A;  1KIX A;  4OWX B;  1VQA A;  5H1S E;  1J5E Q;  1NE3 A;  5JEA G;  4JI4 Q;  5HGQ A;  2UXD Q;  1I3Q H;  2YU9 H;  5GAE C;  2VUG A;  1BVS A;  3K80 C;  3NC0 B;  2D0O A;  1C0A A;  2CQO A;  4LFC L;  3I55 A;  2VL6 A;  2RCN A;  1IBM L;  1Y1V G;  2AWN A;  2ASB A;  3BU2 A;  1PHJ A;  1Q1B A;  3SGI A;  1EYG A;  1OXX K;  4A3C G;  1Q1E A;  5JJL A;  3J81 c;  2N78 A;  1K83 H;  3G4S A;  4OWW B;  2VW9 A;  2UXC Q;  4YY3 L;  1N8R C;  1PA6 A;  4DV4 L;  2A1A A;  1WFQ A;  4YCU A;  2NZH A;  4FDB A;  1X55 A;  1K8A C;  1DGS A;  1IL2 A;  4NXN L;  2Z0S A;  5IYD G;  2GVA A;  5C0X G;  4EFB A;  1Z47 A;  5IYC G;  4GOP B;  3W5O A;  2K75 A;  5FLM H;  1EIF A;  2CWP A;  4RG1 A;  1SMX A;  3RZD H;  1TWC H;  4KI0 A;  1X3G A;  4DV5 L;  5C44 H;  4K0K Q;  3FHW A;  4R4Q A;  4DUZ Q;  4DV1 Q;  3PUY A;  4JBM A;  4GKJ L;  4DR3 Q;  2CWA A;  1HR0 W;  4L5R C;  3TS0 A;  3HOU G;  2XGT A;  3F2C A;  3FKI G;  5ELO A;  1IBK Q;  4JI3 Q;  2R7Z G;  3KYH C;  1CKN B;  3A5Z B;  3S1M H;  4GKK L;  4UCV A;  4B3S L;  1PVO A;  5DLQ E;  3RLO A;  3NEM A;  3HOX G;  4R4I A;  4B3M L;  2FXQ A;  5M5W H;  4LF5 L;  5BR8 Q;  2KCT A;  4JI0 L;  3M4Q A;  4JOI A;  4A3B G;  4DRF A;  1VS0 A;  4X66 L;  5D1O A;  4DR6 L;  4PZ8 A;  2ID0 A;  1T9H A;  4KLK A;  2AHO B;  1QZH A;  4O0A A;  3I4M G;  1K3R A;  3UE1 A;  3Q8D A;  3F2D A;  4TVA B;  4R4C A;  4BY7 H;  3FKI H;  4J15 A;  3NBY B;  1N34 Q;  1X9N A;  1R9T H;  1EIY B;  4A76 A;  1A8V A;  1TA8 A;  2JEB I;  4A3E G;  5C44 G;  3T1H Q;  5M5X H;  5C4X G;  3RNU A;  4GS3 A;  4APV A;  2I5L X;  1Q86 C;  3U50 C;  1ASY A;  1YHA A;  2NN6 I;  2ZTD A;  1UE5 A; 
#chains in the Genus database with same CATH topology
 2EYP A;  4Q5V A;  1HR0 H;  3HKS A;  5C3E H;  4RCN A;  3BDO A;  4E6N A;  5IYD H;  2YU9 B;  5FO9 B;  5M5W B;  4GNX B;  2JA8 B;  4LFC H;  1EU4 A;  4BXX H;  4XTC S;  1HH2 P;  3L2P A;  1LLR D;  4B9X A;  2QKI C;  1S0N A;  3SEB A;  3N44 B;  2F52 A;  4LUZ A;  4A75 A;  4DIM A;  4O7R A;  4CJ2 C;  1PH2 A;  3L0O A;  4K2K A;  1JDE A;  5L1K A;  4MZ9 A;  4QUF A;  4Q44 A;  4IUP A;  2R7N A;  4FFM A;  2F3I A;  3KLS A;  4UCO A;  2RKS A;  1B44 D;  2V1C C;  3MZ5 A;  3T1H L;  3G7L A;  5BMV F;  5KG6 A;  4LSA A;  2AMC B;  5LHY 1;  5KFU A;  4J9S A;  1AE3 A;  4ZKC B;  1FJG H;  5KYL A;  4ED6 A;  4C3H H;  4DV7 L;  4X62 Q;  4LF5 H;  3DF7 A;  2C2E A;  1VQL A;  3CCR A;  2R93 H;  1NMF A;  5CBE E;  3OW7 A;  1SRO A;  1KD1 C;  1W6J A;  1K0R A;  4IAJ A;  2B3G A;  5L1J A;  4JV1 A;  3OSO A;  4O7Y A;  4C3J B;  3HO8 A;  5IE8 A;  3S24 A;  3G48 A;  2COJ A;  2ABJ A;  2JJQ A;  2KHS A;  1ZHS A;  2R84 A;  2UVV A;  4WOR A;  3STB C;  1EFW A;  4J9N A;  2L15 A;  5LMN L;  3ZYY X;  2DWC A;  3A55 A;  5CV8 A;  3I90 A;  3RN2 A;  2GQS A;  3OHB A;  1IKM A;  3WWV A;  2SCU B;  3G6E A;  4N9P A;  2AQ4 A;  5GQO A;  3GTM H;  4RKB A;  4CKE A;  4I7A A;  2I46 A;  3ZJY C;  1B3A A;  3MVV A;  5G3L F;  1IOW A;  5I5V A;  4TM5 A;  4JI5 L;  3GTL A;  1PRT F;  3CQZ B;  3OUZ A;  4ZHQ F;  2LMC B;  5BWV A;  2R61 A;  5IY0 A;  3G6V A;  5C3E B;  4BS9 A;  1I7N A;  2D2C C;  3HS0 C;  2N3S A;  1VQ5 A;  3FKI B;  4AQY L;  1SE8 A;  3TW7 A;  2BR0 A;  4YJ3 F;  3T9B A;  1EYA A;  1SYE A;  3I8Z A;  2PCF B;  1KJ8 A;  1UC9 A;  3FEW X;  1FKA H;  3KJP A;  1SMY C;  4GKJ H;  4FS1 A;  1LTA D;  2E5L L;  3QZ7 A;  2EY6 A;  1HCZ A;  2D5D A;  3TQT A;  3VR2 A;  1KEE A;  3M7N A;  2MCT A;  1SNP A;  3RD4 A;  2VQD A;  2CW8 A;  4A3M B;  1TS5 A;  3M3Y H;  1LTS D;  2PMZ E;  2VUM H;  5IGG A;  5KG2 A;  1G91 A;  1CQJ B;  1WR2 A;  4A3G B;  2MGS A;  4ZI7 F;  3MXG A;  5KFJ A;  3KTM A;  2K7V A;  5E7N A;  3HOW G;  3MA2 B;  5IP7 G;  2NU7 B;  4IZ8 A;  3S17 B;  2JEF A;  5DG7 A;  1QUQ B;  3KLW A;  1Y69 U;  2NU8 B;  4C3H B;  4O7N A;  2ICE C;  2EVB A;  1STH A;  2IX3 A;  1P16 A;  4AYB G;  4O3Q A;  1ZYR C;  1L0W A;  1TS2 A;  1RL2 A;  2CCZ A;  2KJX A;  1A3V A;  4IRD A;  2GN5 A;  2R93 G;  1E3P A;  1YBY A;  2JA7 G;  2W6Z A;  3PF4 A;  3J80 W;  1CQF A;  1S5D D;  1PLF A;  4JI8 L;  2PQA A;  1HJP A;  4GKJ Q;  4FM9 A;  2NVX H;  1D6E C;  5KG5 A;  1M6V A;  1TS3 A;  1TII D;  4XIG S;  3NQT A;  1BCP D;  3FPP A;  5KFW A;  4I4T F;  1I4X A;  3QWU A;  4X3S A;  4IWX A;  2F0S A;  4LFA L;  4J9M A;  4R9W A;  1GUT A;  4AIM A;  4F87 A;  3FDT A;  1FJG L;  4RZQ A;  1SAP A;  2W6M A;  3JRX A;  4DR4 Q;  3LGJ A;  1U4P A;  1CKM A;  3KLS X;  2VQF Q;  3ORQ A;  3NWT A;  3KXY T;  1IBL Q;  2XTI A;  4BXX G;  3J7A K;  5KFA A;  3CQZ H;  3UYY A;  4UP7 A;  2YWV A;  4CMD A;  3M9B A;  3KDF A;  2KVM A;  3EIV A;  2VPQ A;  1B04 A;  1HNX H;  2VOB A;  3A8J E;  5C0X I;  1K28 A;  3Q24 A;  1A0I A;  3D0F A;  4RUA A;  1QVG A;  3X3N A;  2D9U A;  4NXM H;  1WSC A;  2B2W C;  4M0J A;  4O3P A;  3WOE A;  2UUB H;  3Q2O A;  3UZB A;  5FD6 A;  5DNF A;  2EPB A;  1M7J A;  3S2H H;  3S16 H;  2YYA A;  3E6Z X;  4ME3 A;  5DLF A;  5BR8 L;  3NTH A;  1XPR A;  4DUY H;  2R7F A;  2WDT A;  1EWI A;  1XNQ Q;  4NZM A;  1T94 A;  5KNC A;  4OX9 L;  2C5C A;  1ICF B;  5HUR A;  4IUQ A;  4B3T L;  3I4N G;  3GTL B;  4P2C B;  2B39 A;  3H3V I;  3KHG A;  2M9V A;  1NTG A;  2NVY A;  3SE0 A;  4POF A;  1SNM A;  5E4X A;  1V51 A;  5A2Q E;  4DV3 Q;  2Z6K A;  1KLG D;  4HJ7 A;  3GV8 B;  1UC8 A;  3SHL A;  5A35 A;  4F50 A;  3ERO A;  1I50 B;  4JOI C;  5ELN A;  4KHP L;  2RDJ A;  2OQK A;  3QOJ A;  5C3X A;  4A3E B;  1V4Y A;  1Z6H A;  2KQ3 A;  3OTO Q;  3FP9 A;  3GDE A;  3MR2 A;  1GJX A;  5KT5 A;  5DM6 3;  2BH8 A;  2K1B A;  5BPF A;  3VR5 A;  4KMU C;  1XNR H;  3PW5 A;  3T13 A;  1EUD B;  3DAA A;  4RUC A;  2ASD A;  3T1Y Q;  1JWU D;  4IQZ A;  4M9U A;  4RB2 C;  3HP3 A;  3EQL C;  4M1U B;  1HR0 Q;  2W6O A;  4O81 A;  2ZGI A;  3I4M H;  1HNX L;  1SYC A;  4NW2 A;  4L5Q A;  5BN3 A;  3Q8R B;  4POG A;  4IFD G;  1S0O A;  1G2W A;  1RD9 D;  3BJU A;  4MV1 A;  2LKV A;  1W93 A;  4F88 A;  4B3S Q;  1WI5 A;  3KBX A;  2X6G A;  4LW1 A;  1B1Z A;  3GB8 B;  1UNN C;  2UXD H;  4JI4 L;  1HZA A;  1FNU A;  4LF8 H;  2B2W A;  5E25 A;  1N34 L;  1ICW A;  3FRP B;  4K8I A;  3OTO L;  1PZK D;  2R92 H;  2R7D A;  4DV4 Q;  5KNB A;  5IYZ F;  5JEA H;  5C4J B;  4A4I A;  5C3W A;  2ATL A;  1IL8 A;  1A6X A;  4O4I F;  5LL6 b;  1YIJ A;  4DV3 L;  5JH7 F;  1M4V A;  3MHB A;  1PFB A;  2PNR C;  1BDO A;  2OT2 A;  2MP1 A;  2Q2I A;  1E24 A;  3PIO A;  2Z6K C;  4DR2 Q;  2DAB A;  2K04 A;  4BA1 I;  1NAP A;  2ZXO A;  3S15 H;  1SXT A;  1V8Q A;  4GKK Q;  4A3J G;  5IGB A;  3FDS A;  3OMC A;  1X3F A;  5K36 H;  2RDG A;  4RMF A;  2M2L A;  5D65 A;  4DL7 A;  1ZET A;  3PV0 A;  2L5T A;  3GP7 A;  5AJ3 Q;  4A3L G;  3JSL A;  4DAP A;  3HOZ B;  1L1O A;  2ZM6 Q;  1ENC A;  3W2D A;  4BY1 H;  4DV3 H;  3EJI A;  4A3G H;  5IOC A;  1GSA A;  4LUV A;  3MWD A;  2K32 A;  2JSO A;  3M85 A;  4J8Q A;  4RHR A;  1X6O A;  2ZTC A;  4HCE A;  1EIH A;  4LJZ C;  2WIN B;  4YHH Q;  2L11 A;  2R86 A;  2RDI A;  2RQX A;  1Q3L A;  2YRX A;  2QA4 A;  2I07 B;  2IMW P;  4MV4 A;  4P72 A;  2KCM A;  4TV9 F;  4TQS A;  4GNX C;  4RNO A;  2B63 H;  1IW7 D;  3ORR A;  4JI2 Q;  1PV4 A;  5FKA C;  4JI3 H;  2JA7 A;  4KY6 A;  1PYW D;  2PN1 A;  5KFV A;  3S9W A;  4FXD A;  2BA1 A;  4OX9 Q;  3U55 A;  4O2D A;  1GUW A;  2R7L A;  3U0G A;  1JIC A;  2E2H H;  1D7Q A;  1SEI A;  1X65 A;  3K81 C;  3E0E A;  5F9L A;  2L1B A;  4L5S A;  2QDB A;  1PH9 A;  1V1P A;  3GTP B;  2KCC A;  3IG0 A;  4ECW A;  4N8F A;  4RFB A;  1XNR L;  4ED0 A;  3GTP H;  3RTX A;  1XX8 A;  1EQQ A;  3RN5 A;  2EYM A;  1XYI A;  3GTM B;  4B3R L;  5CV9 A;  5JPN C;  4FO2 A;  3RR5 A;  4FFP A;  3PUV A;  1HUM A;  2LSS A;  1KL9 A;  3GLK A;  3DTG A;  4KJO A;  1CA6 A;  3HOY G;  4XYL B;  2RHS B;  2FLP A;  1IBK H;  2K52 A;  3CEB A;  1E0B A;  1WJJ A;  3WWI A;  1KJJ A;  2DPJ A;  3K5L A;  5KFR A;  5FLX c;  2L0C A;  2O5J C;  3OMG A;  3CPF A;  2WKC A;  4X65 L;  1C3O A;  1NNX A;  4DL6 A;  5LOV F;  1RYS A;  4DV4 H;  1A3T A;  3LX0 A;  2ZJT A;  1WCM G;  4DK1 A;  1TWC A;  4FBT A;  2A19 A;  4GOP C;  1VQJ A;  2EY1 A;  5M3M G;  1BCP F;  1S40 A;  5IYB G;  4JI1 H;  5IP7 H;  5KT3 A;  3HOW H;  3L4J A;  1BR9 A;  3Q0A A;  2UUB L;  2BE5 C;  2XCA A;  3G6Y A;  2VUM G;  4NXM L;  3RZO B;  5FLX L;  1VMC A;  4DR2 H;  1K8M A;  4LAA A;  3AX6 A;  3RB4 A;  5EWG A;  2VA3 A;  3GO5 A;  3HBL A;  1B9M A;  3GV6 A;  1QUQ A;  3K5O A;  5JJZ A;  4IOC A;  3G71 A;  2QYZ A;  5IIF A;  3I7F A;  2O2L D;  4JBK A;  4LF6 L;  4FF1 A;  4J9O A;  2V58 A;  2EYH A;  1I50 H;  1TWH A;  1QNU A;  1PH1 A;  3JAM L;  1TU2 B;  2A6E C;  5KG4 A;  4X3T A;  1SBB B;  1Y1W H;  1EL0 A;  1QVF A;  1VQE A;  2K6A A;  1UEA B;  3CME A;  1TQO A;  4JI1 L;  4R8I A;  2R6F A;  4R1J A;  2JK8 A;  1PH4 A;  1KXL A;  1TWA B;  4YHH L;  1U0L A;  2NU9 B;  1F9R A;  2EJF C;  2YCH A;  3GIJ A;  1J5E Q;  3IFT A;  5H1S E;  2CW7 A;  3NK9 A;  5HGQ A;  5C1P A;  1I3Q H;  2YU9 H;  5I9O A;  1BVS A;  4BBR B;  4Q0F A;  1WD1 A;  1BQQ T;  3MR6 A;  1Y1V G;  1KDB A;  4LMY A;  3A8I E;  3N8D A;  2ASB A;  3BU2 A;  4IZO A;  2EYJ A;  1EYG A;  4L63 B;  1ZHQ A;  4OWW B;  4O7Z A;  3MXN A;  2VW9 A;  5CA0 F;  4J1M A;  4YY3 L;  5IT9 E;  1N36 H;  5I6W A;  1WFQ A;  4ZYS A;  3RUZ A;  3C2P A;  2GVA A;  3DXJ C;  4BWG B;  5IYC G;  2FLN A;  2DZD A;  2COG A;  3GII A;  4I55 F;  1KAB A;  2CWP A;  4O1N A;  3CU7 A;  1G6Z A;  5DAA A;  3DHQ A;  2K33 A;  4YR2 A;  1KDC A;  4ED8 A;  3ND8 A;  4N9T A;  3FVQ A;  2KED A;  1SE3 A;  4J9R A;  4DL2 A;  4EGV A;  4DUZ Q;  4C3H G;  2CWA A;  5F2D A;  3TS0 A;  3SXH A;  5KFF A;  1DV1 A;  3HGB A;  1IBK Q;  4ILW A;  4JI3 Q;  1A9X A;  1CKN B;  3A5Z B;  4A2A A;  5EPK A;  4FFO A;  2KCN A;  3HOX G;  2DIK A;  3HOV B;  3VR4 A;  3LP8 A;  5BR8 Q;  2KCT A;  3TZU A;  4JOI A;  3NXW A;  2YL2 A;  3V4S A;  4DR6 L;  3K3V A;  2IA6 A;  5BWW A;  4ZOL F;  5DAU A;  2R8J A;  1QZH A;  4LF4 H;  4ZAI A;  3SVM A;  5C4H A;  5CMD A;  2NN6 H;  4TVA B;  2GPS A;  1HTL D;  1SDF A;  1R9T H;  1EEI D;  5BYB A;  4PMB A;  1DD2 A;  2HD3 A;  5LL6 S;  4A3E G;  4QWC A;  4APV A;  2NZ1 D;  3QG1 A;  2EYF A;  1LTT D;  1UE5 A;  4DAV A;  3K0Y A;  2EY2 A;  2Z1C A;  3VPD A;  4CC6 A;  4DGZ A;  3NUC A;  1WTO A;  2ZXR A;  3ULL A;  2P5Z X;  4ZRZ A;  5NUC A;  2EJ0 A;  5IYC H;  3I72 A;  4Q4D A;  1LTR D;  3RIZ A;  3I3C A;  4EEY A;  3RV3 A;  1K0S A;  1F2Z A;  5HBR B;  3A8K E;  3W1B A;  3CD6 A;  4CE5 A;  2XGP A;  4IOA A;  3PO3 H;  1FD7 D;  1LT6 D;  4A3B B;  3KHH A;  2UU9 L;  3L7Z C;  1GUN A;  5I47 A;  1UE1 A;  2ZJQ A;  2J9G A;  4A3B H;  1CZG A;  1HZ9 A;  3RGX A;  3U54 A;  1R4Q B;  1G2T A;  4A3M H;  4LSX A;  2OXP A;  5BWU A;  1TXY A;  5T1I A;  2F0D A;  2EIF A;  4C5B A;  4ECT A;  5KYI A;  3OWF A;  3OIQ A;  2CW0 D;  2PVP A;  2K5W A;  3VR3 A;  1I4P A;  3SR1 A;  5K3W A;  4Q8F A;  5LMU H;  3F2B A;  4NXN Q;  5DGA A;  5J3B A;  4BBS B;  3BDL A;  5KFD A;  4OO1 I;  3CW2 C;  1N36 Q;  2W9A A;  2XGQ A;  1LTL A;  2VQE L;  3ITP A;  1Y1W G;  2PI2 A;  3S1N H;  1TVX A;  1E22 A;  4Z9C B;  5EAY A;  1TY0 A;  1BXT A;  4O42 A;  1SCU B;  3K5I A;  3VPB A;  4JV2 A;  3K3P A;  1U4L A;  2B2V C;  4Q0Y A;  4BWS C;  4CGY B;  4HNU A;  2TMP A;  3EN2 A;  4OO1 H;  5FJ8 G;  5EKI A;  1JC7 A;  1IKL A;  3UDX A;  2A8V A;  3NBH B;  4K6N A;  1I1L A;  3ETJ A;  4V0B A;  3H40 A;  1BKB A;  1D1K A;  3OSN A;  2F0K A;  3BYY B;  3UQ8 A;  1JJC B;  3M3Y B;  1CKO A;  2JP1 A;  1F2Y A;  2GA4 B;  2PQA B;  4ECR A;  4P74 A;  1MBY A;  2OTL A;  2UXC H;  4EBC A;  3CHB D;  4LF9 L;  3GTQ A;  3C1F A;  5D8D A;  1B50 A;  1TY2 A;  4K2L A;  1PYS B;  2PBZ A;  4RGO S;  1SMY D;  3K7U C;  5COR A;  1JMC A;  2Z04 A;  2WFW A;  5I2Y A;  1E7Z A;  2Z02 A;  1KAA A;  2FK3 A;  1FGU A;  1M0W A;  4XDX A;  4JI0 H;  4HR7 B;  2PNH A;  2YU9 A;  3KF6 A;  2AQ2 B;  4OWT B;  4R8U A;  1UE6 A;  3J7Y W;  1J9O A;  3D8G A;  4RZR A;  2W8K A;  3LQS A;  4DKA C;  3HOY H;  1LTI D;  5C6A A;  4LF7 Q;  1HUN A;  1DM0 B;  1I3Q B;  2UUA L;  2R8I A;  2F0T A;  5IGF A;  3WO0 A;  1OXT A;  3WWH A;  5DIS C;  1SFO A;  5BWX A;  1ENA A;  3PGZ A;  2CFM A;  2UXD L;  4DNT B;  2Q8I B;  2BDN A;  2C28 A;  4X62 L;  1STN A;  1VDZ A;  2Z8L A;  3E9I A;  5J1Z A;  1XMO L;  5DMX A;  4FXG C;  2XD4 A;  2MHV A;  4UUG A;  4RB1 A;  2G9H D;  1RDP D;  3D4R A;  3S1R B;  4QQB X;  3MR3 A;  4BA2 I;  2VY3 A;  1IBL H;  1V43 A;  2DY7 A;  4IPC A;  4TQR A;  2KUM A;  2FKL A;  2FMM A;  3PZP A;  3T16 A;  2BH2 A;  5I5U A;  3RAX A;  3U58 A;  3GV7 B;  4PBC A;  1CT1 D;  2K14 A;  4UDU C;  1JOR A;  1CQI B;  3J81 i;  2N49 A;  5M3F H;  4I7Z C;  5EWE A;  2F4V H;  2MPM A;  4B3R Q;  1GUO A;  1CS0 A;  5CR5 A;  1Z9F A;  1VQ6 A;  2WE6 A;  1HNW Q;  3MFY A;  1NBW A;  2AWO A;  4L1K A;  2J4X A;  3PIP A;  4PG3 A;  1M8A A;  2I5M X;  3KF8 B;  4DUZ L;  2JA7 B;  4Y52 H;  2JA8 H;  3OYY A;  3PSI A;  2UU9 Q;  1MKH A;  2C2D A;  5KFH A;  5I4D A;  3HOV G;  1TWF H;  3MFG A;  3MXN B;  3S17 H;  4AYB E;  1X56 A;  4K6D A;  3EPI A;  4OX9 H;  2J7Z A;  4A3G G;  5ELC A;  3NEL A;  1VQD A;  3HKZ G;  1AH9 A;  4BY1 G;  1I4Q A;  4KY7 A;  1A48 A;  4RKL A;  4A3L H;  3ETH A;  5IWA Q;  4U7C A;  4MV9 A;  3RV4 A;  4LH6 A;  1AZP A;  2YYZ A;  4RAU C;  4NXM Q;  2HQE A;  4A3J H;  3T56 B;  4EGJ A;  1HZB A;  1QG7 A;  2ES2 A;  2UUB Q;  2AUJ D;  3TN2 A;  4X64 L;  3PO2 B;  3G8C A;  5KFK A;  1B8A A;  4YQW A;  3K5M A;  4KKU A;  2F4V L;  4UY8 C;  2XRQ D;  3F2U A;  1YEZ A;  1SNC A;  4LF8 L;  2UXB Q;  2AGQ A;  4ABN A;  2UUC H;  4J9L A;  2DPI A;  2DUD A;  1QCB D;  2PMZ B;  4MV6 A;  4JI0 Q;  3MWM A;  2R92 G;  3CAM A;  1RJT A;  1ET6 A;  1BBW A;  4IO9 A;  4JV5 Q;  1TWF A;  4IPH A;  2K5Q A;  3GTQ B;  2LFN A;  5CE8 A;  2EJG C;  5CV6 A;  3T9F A;  2WAQ E;  4A3K B;  2DAA A;  2XNA C;  4ED2 A;  2VS1 A;  4JI5 H;  1KJ9 A;  1CHQ D;  2FHT A;  3RJ0 A;  3HOZ H;  5K5P A;  3BQ2 A;  4IFD H;  1PFM A;  4ECX A;  2N8N A;  3DUZ A;  1EYC A;  1A0G A;  4ODG A;  1OXU A;  1JE5 A;  1WCM B;  3Q8Q B;  2JYO A;  5CGK A;  2COI A;  5GAH C;  1C8C A;  1PTO H;  3A5U A;  1A62 A;  1M0T A;  4O4J F;  1C30 A;  1DYQ A;  5JEA J;  1EZ8 A;  5KT2 A;  1DOL A;  2LXJ A;  3DEO A;  3DLL A;  2W6P A;  4DR7 H;  1MGS A;  4G4K A;  1S4Z A;  1STE A;  3A7L A;  4DFA A;  4DN4 M;  4DK0 A;  1BBX C;  3BA8 A;  1E4F T;  2A68 C;  5JQG F;  3Q6S A;  3BQ1 A;  4GN5 A;  2C22 A;  4GKK H;  4I65 A;  4C2M B;  4B08 A;  1STB A;  2WP8 J;  5LMU Q;  4JI2 L;  3J80 L;  4RH6 A;  3ND9 A;  4KD4 A;  2EZV A;  4YR0 A;  4U67 3;  3MTS A;  2WB1 E;  2A68 D;  4EBE A;  3E0J A;  3GQB A;  4A3C H;  1HZC A;  1PRT D;  2RDH A;  3I4N H;  1HNW L;  3H20 A;  1J5E L;  4IWY A;  4YHH H;  4LF4 Q;  1VQG A;  3FPU B;  1B6S A;  1CK1 A;  1WTH A;  2F1M A;  4DLK A;  1NY4 A;  2UUC L;  5BPH A;  3PW7 A;  1DV2 A;  1VQ8 A;  2R7Z B;  4EQO A;  1X32 A;  4TQU S;  2E2I H;  1PH6 A;  2R7Z H;  3VNN A;  1V1P B;  3KK7 A;  3R5H A;  3GTP A;  3CRK C;  4DK6 C;  4K5W A;  5J2T F;  3PW0 A;  1JWS D;  2R93 B;  1AN7 A;  1D1I A;  3TP8 A;  4EQ5 A;  1KRT A;  3R5F A;  1IBM Q;  3K5N A;  4LFC Q;  2F0N A;  4A3J B;  1HNZ H;  2R8K A;  1NUC A;  3N6R A;  2SEB D;  1GUS A;  5IGE A;  2JA5 H;  3QR8 A;  4YB8 B;  3FMA A;  2AU0 A;  2XN9 C;  5L1L A;  1SFO B;  1O78 A;  2YW2 A;  4LF7 L;  5LMN W;  1Y8N B;  1Y8O B;  3CVZ A;  5C4X B;  3I4L A;  3JSN A;  1E2V A;  3D4D A;  4WJ3 M;  4DR7 L;  3MC0 B;  1HQM C;  3RMH A;  2C00 A;  5D3D A;  3T5J A;  1GM5 A;  4HN7 A;  5KFB A;  3KOJ A;  4QSH A;  1NJI C;  1GSO A;  5CR3 A;  1K1S A;  2F03 A;  4R4O A;  1HPC A;  3GTO B;  5LL6 X;  4GLV B;  1VBH A;  4DL4 A;  1SE2 A;  4R4T A;  3C46 A;  2K50 A;  1YVC A;  2CQA A;  1F9S A;  3RZO H;  3H4D A;  4R8U B;  3JRW A;  5KX5 F;  3BZC A;  4MV7 A;  4OGQ C;  4OEM B;  1GHJ A;  1I7L A;  1LT5 D;  5M3F B;  2HT1 A;  1YIT A;  1U9R A;  1N33 Q;  5EWF A;  3DWA A;  2FJ2 A;  1J8I A;  4M7E A;  4YR3 A;  3BA9 A;  3R2I A;  1GYF A;  3K58 A;  1H9S A;  3B6Y A;  1LV9 A;  1F77 A;  1QOH A;  3T1H H;  3CP0 A;  3I56 A;  1E4E B;  3C0F B;  5J2U F;  4RHS A;  1RJR A;  3NQI A;  2B2U A;  4LF7 H;  1SR3 A;  3D6C A;  2E5L H;  4HMJ A;  2OF1 A;  3VMM A;  3DEP A;  3ULP A;  3HKZ B;  4KHP H;  3R5X A;  5FLX W;  2ZXP A;  4KD3 A;  4DR2 L;  2KEC A;  1OO9 B;  1AUV A;  4QL5 A;  4UCT A;  4C3J G;  2W7O A;  1RIP A;  5D1O B;  2EJM A;  3F8T A;  5KFO A;  3UZO A;  1LM0 A;  1SNO A;  5ELF A;  1IOV A;  3STB D;  2I8C A;  2IY5 B;  4O84 A;  1LYL A;  1JJ2 A;  4A2B A;  1EOV A;  1YJW A;  2NZO A;  3Q1K A;  2BQU A;  4LF9 Q;  2ALY B;  3I2Z A;  2OH2 A;  2KOL A;  1IHZ A;  2EOT A;  1EWH A;  2G5D A;  3OPO A;  3NEN A;  1HHV A;  1RYR A;  1WH2 A;  2JA6 G;  1EZ6 A;  1DJR D;  3D6W A;  3S16 B;  4HNT A;  1HNW H;  1AN8 A;  4QF4 A;  2M00 A;  3E3X A;  2HVQ A;  1CQV A;  1KNA A;  3HOW B;  5BWT A;  5HGT A;  4HIK A;  2TSS A;  3U9O A;  1C48 A;  3CC4 A;  1Y14 B;  2D62 A;  1DON A;  1JJG A;  4DV0 L;  1HNX Q;  1CE8 A;  3KAK A;  3NHH A;  3PO2 G;  2CVR A;  3OW2 A;  1HNZ Q;  1AP0 A;  5EKL A;  4RAZ A;  1RTO A;  3BS1 A;  2IX1 A;  2FP4 B;  3T9A A;  2PZU A;  4GLW A;  4JI7 Q;  1I94 Q;  5M5X B;  5CV5 A;  3BDC A;  4PZ6 A;  1X3P A;  1T36 A;  2A74 C;  2E76 C;  4CJ0 B;  3GTK A;  4LFB H;  3RLF A;  1RKN A;  1WTR A;  4H44 C;  3S1N B;  4JV5 H;  1VCI A;  5KFY A;  1GSH A;  4C1N K;  1B33 N;  2F4I A;  3LWU A;  1XPO A;  5A2Q W;  1KTK A;  3PF5 A;  5FLX E;  2FK1 A;  1EQR A;  5CYU A;  2MNA A;  3CCJ A;  2NVQ H;  3Q8S B;  1VF7 A;  1SSO A;  4O7L A;  2Y0S B;  2PO4 A;  1FR3 A;  4A3I H;  2NVY H;  3LWE A;  2H5X A;  4DQN A;  1PH3 A;  3IFD A;  4ME5 A;  4G7H C;  4JI4 Q;  1VQA A;  1O75 A;  5KFZ A;  1NE3 A;  3R2T A;  5E4W C;  4NYE A;  2VUG A;  5GAE C;  1CHP D;  3K80 C;  2D0O A;  4YAK B;  4EYH B;  3R3O A;  4R7R A;  2AWN A;  5IWA H;  3HT5 A;  4GC7 A;  1EIG A;  1Q1B A;  3SGI A;  3URY A;  3VA5 A;  1WTX A;  1ZQ7 A;  1Q1E A;  5JJL A;  3OHA A;  3N40 P;  2N78 A;  1K83 H;  2PYK A;  4FP5 D;  1N8R C;  2W71 A;  4FDB A;  1X55 A;  1K8O A;  1IL2 A;  5IYD G;  1S03 G;  1EY9 A;  4GOP B;  3D3R A;  3W5O A;  2K75 A;  3K59 A;  1I50 A;  4ED3 A;  3G8D A;  1ESR A;  4O2A F;  3T5K A;  3KUP A;  4RG1 A;  4OHJ A;  1PZJ D;  1QJO A;  3RZD H;  3JZ6 A;  1H9S B;  1TR5 A;  2Z6B A;  4DV7 H;  2K03 A;  2OLS A;  1D2B A;  4PNY A;  2EE1 A;  1X3G A;  5C5L A;  2VQF H;  4K0K Q;  3FHW A;  2JN4 A;  4GKJ L;  4DR3 Q;  3F2C A;  4LF9 H;  2R7Z G;  5DGH A;  1KBL A;  2CH4 A;  3CQZ A;  3TME A;  3EA6 A;  1PVO A;  1LTB D;  3NEM A;  3NBI A;  3PFF A;  1K83 B;  1I4G A;  3JZF A;  4ZUI A;  4DRF A;  2FE3 A;  5D1O A;  2A6H D;  5E3F A;  2ID0 A;  5IT9 L;  1DOK A;  1T9H A;  3QZ8 A;  2B2Y A;  4KLK A;  3V6H A;  2AHO B;  2WAC A;  4O2B F;  1NR4 A;  1STA A;  4O0A A;  5KT4 A;  4BY7 H;  4J15 A;  3TP6 A;  2RGR A;  1N34 Q;  1X9N A;  5I5S A;  4A76 A;  5KFX A;  5JPM C;  2JEB I;  3M4I A;  4JK1 C;  1TWG A;  5KEE A;  4I7H A;  3MJF A;  3QFF A;  2PZT A;  4DXF A;  1Q86 C;  3U50 C;  1ASY A;  4YIJ A;  2NN6 I;  2FMC A;  2CNQ A;  1A3G A;  1LAC A;  2PPB C;  4NZN A;  3OSP A;  4UCS A;  4C5C A;  4FXK C;  3CC7 A;  3M9N B;  1H9R A;  1Q81 C;  2JXM B;  3MFI A;  3R93 A;  5D1P A;  1NR2 A;  3PIO 3;  3I12 A;  3PN1 A;  2IL8 A;  4O83 A;  2UUA H;  5IOD A;  2NVT H;  1DAA A;  3HOZ G;  3F1Z A;  2QK4 A;  1UNS A;  2C9O A;  4U6P A;  1JCK B;  1OBG A;  1PRT B;  3PQI A;  2B29 A;  3K6O A;  5BWR A;  4HIM A;  1S5E D;  5KFT A;  1XDN A;  1Z2O X;  3M4O B;  4PWQ A;  1EY0 A;  4C56 C;  5J39 A;  2HVS A;  3IL8 A;  3NE5 B;  1G51 A;  5CV4 A;  3RUP A;  4G7Z C;  2N55 A;  4V19 0;  4ECV A;  4Q8E A;  4CMF A;  2WKD A;  4K5X A;  5LP6 F;  1PRT C;  1Y1W B;  3GIM A;  1RJQ A;  2Z4H A;  3TSS A;  2A73 B;  1B2T A;  2W8L A;  3WWJ A;  3RBE A;  1Q12 A;  3BYT B;  4JI3 L;  1VQK A;  4HJ8 A;  4HN2 A;  2HHF B;  3TQ1 A;  4FF3 A;  4NMZ A;  2ZJP A;  5FLM G;  5JVH 3;  3ERS X;  4P75 A;  4XZ3 B;  4UFZ A;  3OTO H;  4DAA A;  4LMQ D;  5KFN A;  1O7L A;  1E1T A;  4EG0 A;  4QY7 A;  2G9D A;  1B9N A;  4RGT A;  3PUW A;  4UP8 A;  5IGD A;  3UFX B;  1G29 1;  2LY7 A;  4K6L A;  4DV7 Q;  1EHI A;  1S97 A;  2O4X A;  4P73 A;  3R9R A;  1VQ4 A;  4S3S A;  3EYY A;  3M4O H;  3FKI A;  3GTO H;  3TEK A;  2A6E D;  4GZY C;  1I6H B;  2MO0 A;  1QZG A;  1PH7 A;  3K7A H;  4JI7 L;  3G6X A;  1T5E A;  1I6U A;  2B2U C;  3D31 A;  5CB4 F;  3TRE A;  2JA8 G;  4A93 H;  3H0G B;  3VYS A;  2YV5 A;  4ZCK A;  4JXU A;  4BBS G;  3PUX A;  2HGX A;  2HHH H;  3QJY A;  2HDK A;  4EQN A;  4WJW A;  4CDC C;  1BF4 A;  4RNN A;  2NVX B;  4NPS A;  1I6V C;  1I94 H;  3H3V H;  2EXD A;  4A3I B;  2YRW A;  4C3I B;  4NLG A;  4BBS H;  4QB4 A;  3UDI A;  4DUZ H;  1I1M A;  1JOQ A;  4C3I H;  1EU3 A;  2F0P A;  3H94 A;  4JI8 Q;  1WTP A;  3VYU A;  3S2H B;  3KAL A;  4O7W A;  5LMN Q;  4MA5 A;  5JQW A;  1BCP B;  1K3B C;  2EYO A;  1TWH H;  2KHJ A;  1WRV A;  1GOZ A;  5FD5 A;  2VA2 A;  4PQX A;  3GTG A;  1D8L A;  3UI2 A;  4TUY F;  1PDQ A;  4FF4 A;  4HR7 A;  3KF6 B;  2W6N A;  4FFL A;  2W9C A;  3OUU A;  4A93 B;  4BY1 B;  2YTY A;  2IHE A;  1BOS A;  4JI7 H;  5KFQ A;  1BCP C;  3GD7 A;  1WTW A;  1RF2 D;  1IBL L;  2UVW A;  2FIN B;  2GVB A;  4DAY A;  1ENF A;  1GD7 A;  2J6U A;  1H9K A;  5FOB B;  1H9J A;  3S1Q H;  1BBU A;  1O7Y A;  3M4P A;  2W70 A;  1FNW A;  2HVR A;  4CHT B;  1HXY D;  1S9F A;  5IP9 H;  2MQH A;  3BZK A;  1S5C D;  4ECY A;  4RAY A;  3GIK A;  1KJQ A;  2PQE A;  5C0X J;  4XXE A;  3K0X A;  5LMU L;  2KSW A;  4IAL A;  2JEA I;  1YHB A;  3RLN A;  4JI2 H;  4OXP A;  4ZK9 B;  1Q82 C;  5KFG A;  4MV3 A;  4MTN A;  2RVL A;  1S68 A;  4MA0 A;  5FR9 A;  1ILQ A;  4DAM A;  4FFN A;  4CHI A;  3HRZ C;  2W7P A;  4Q45 A;  4ZLT F;  2RGV A;  1KUT A;  2I0Q A;  2KA7 A;  4IUU A;  4XQJ A;  1O7I A;  1ASZ A;  4ULL A;  1M1K C;  1U5K A;  2XIG A;  4IPG A;  3J7A F;  1UE7 A;  1MJC A;  2HG8 A;  2R8H A;  3P1H A;  4HJ9 A;  2V4R A;  1FGB D;  2R87 A;  4CKB A;  1I6H H;  2FB9 A;  5LMN H;  4QW8 A;  2GLT A;  1A63 A;  2R7Z A;  2NVY B;  3BZD B;  2W9B A;  1WTQ A;  4ED7 A;  4PZ7 A;  2YZN A;  4JBW A;  2ASL A;  3SI8 A;  4IR9 A;  4X65 Q;  1RTN A;  3MWE A;  2AQ3 B;  4BY7 G;  1QWY A;  4YP3 A;  2KHI A;  3WO1 A;  4A3K G;  2BCO A;  3TP7 A;  4B3M Q;  5KND A;  2HHH Q;  1ZEQ X;  3RGZ A;  2AGO A;  2NYZ D;  2VQE Q;  3T9C A;  1CSP A;  4A3M G;  3GIP A;  2OTJ A;  1I1K A;  4IRK A;  4PMC A;  3T1Y L;  1BXR A;  4CDF C;  4GLX A;  1XTD A;  5DLG A;  4DR1 Q;  3V4Z A;  3PMF A;  4A3F B;  1XXG A;  3TQY A;  2XC9 A;  2A5H A;  3J81 E;  1FYC A;  4DV1 L;  3PO3 G;  4DV2 L;  3H0G A;  1L0X B;  3LNN A;  1TWG B;  3AU7 A;  1V1O A;  1TS4 A;  4JBJ A;  3J7A 5;  4JI1 Q;  1MSG A;  3L3O C;  4LFB L;  3GJX B;  3KHR A;  3CRL C;  3Q23 A;  3TIN A;  5M9O A;  1DIK A;  4GOP A;  5LYJ F;  2AKW B;  2V5A A;  1GXD C;  5T14 A;  4DNI A;  5KFP A;  4MN3 A;  1EUJ A;  1MSH A;  1RHP A;  2RHQ B;  5KFS A;  1S10 A;  5ELD A;  1KC8 C;  1VQO A;  2RF4 A;  1OBD A;  3P7J A;  4GN3 B;  1XNQ L;  3N42 B;  3RAQ A;  3D4W A;  3HOY B;  3Q22 A;  1JKJ B;  2Q7D A;  2E8G A;  2IX0 A;  2E2D C;  4YCV A;  4IIJ F;  4K0K L;  2X5R A;  2NVT B;  4A3F H;  4FFR A;  2FK2 A;  1IXR A;  1Q7Y C;  1J5E H;  1VQ7 A;  1RCV D;  2DJF C;  5I9P A;  5KG0 A;  1N32 H;  4IFD J;  2PW7 A;  1OXV A;  5JVG 3;  4TVI A;  3TW6 A;  3S1R H;  3N6X A;  4A3D H;  5ELB A;  2NVQ B;  1ML0 D;  1CM9 A;  4MNO A;  4KKS A;  2JA9 A;  4J0M A;  4XT3 B;  4MAM A;  4A3F G;  4DV6 Q;  2KBN A;  3A54 A;  3TY5 A;  2QGQ A;  3H91 A;  5CV7 A;  4QW9 A;  3DMU A;  3KJO A;  2HGW A;  4Y7N H;  3R8B A;  5JAV A;  1Q8I A;  4KY5 A;  3J81 W;  2WB1 G;  4NKL A;  4RA8 A;  1G2S A;  2VQE H;  2PMZ A;  3NBZ B;  1XMO H;  4DV2 H;  1KJI A;  3VDY A;  3QOL A;  5KG7 A;  1O80 A;  4F7X A;  4H0L C;  2HUG A;  2Y4R A;  3NTK A;  4TV8 F;  1D5Z C;  4QIW E;  5KG1 A;  1BNZ A;  1KHI A;  3MXU A;  2OCE A;  2E5L Q;  5ISR A;  1S72 A;  2R85 A;  2BE5 D;  1WCM A;  5JVD F;  3PW4 A;  3H09 A;  5DQG A;  4LFA H;  2K5V A;  3MWY W;  5CBA E;  3NTI A;  2P0A A;  3BJY A;  4XT1 B;  4HQ6 A;  2O03 A;  1W3S A;  2I5H A;  5M5Y H;  4LF6 Q;  4K5V A;  5J22 A;  2E75 C;  1L2F A;  1JQY D;  3CCU A;  2OQ0 A;  3TZD A;  1XMQ Q;  1YI2 A;  1ET9 A;  2ODT X;  4GC6 A;  4A3K H;  1E2W A;  1SYB A;  4IRC A;  1VBG A;  5IGC A;  4O7T A;  4B3T H;  2ENB A;  4JYA Q;  3SNO A;  4LFB Q;  1KDA A;  2VZA A;  2K4K A;  4PMW A;  4DV2 Q;  3RFC A;  4C1N I;  2C35 B;  2YZG A;  4OIK A;  4ECZ A;  3S14 H;  4KK7 A;  2NUA B;  1I94 L;  2WB1 B;  2VXW A;  4YWK A;  1V9P A;  1EEF D;  4CC5 A;  5I2X A;  4ETS A;  5L1I A;  2ZM6 L;  3GTJ A;  4C3J H;  2E2J B;  1N33 L;  5K2M A;  3VYT A;  3T5H A;  4KN7 C;  3H3V C;  1SLJ A;  2R7M A;  1RK6 A;  4DUY L;  1STY A;  1YJN A;  1GVP A;  2ZT9 C;  4R8N A;  2E2H B;  1L2Z A;  5BYA A;  2EJ2 A;  3KHL A;  5IYB H;  3ULJ A;  1SYG A;  3X3M A;  1C7Y A;  4JI5 Q;  1XMO Q;  5DGI A;  4HIO A;  3BVG A;  4JW0 A;  4BBR G;  2F3V A;  1IYE A;  3SK4 A;  1XWE A;  4JYA H;  2SNS A;  5IP9 G;  1V1Q A;  2XCP A;  2MO1 A;  3P20 A;  1F2M A;  4IN3 A;  4DR7 Q;  2VB2 X;  1G6P A;  1H95 A;  2GQR A;  1AFP A;  4ZKB B;  1VQC A;  1II3 A;  1F9P A;  3V05 A;  5HV6 A;  2IBK A;  2CW0 C;  1EZ1 A;  2Y0S G;  4MHE A;  3C1E A;  2HIV A;  5KFC A;  2F0Q A;  4ID6 A;  1PK8 A;  1ZAU A;  4JI8 H;  3MEF A;  1CSQ A;  2YTX A;  1RJP A;  1YNJ D;  5C44 B;  3GTJ H;  3PR4 A;  3AQQ A;  2DNC A;  1TWH B;  4YCW A;  1PH8 A;  1TWA A;  1FL0 A;  1SE4 A;  2UVU A;  1AUX A;  4G57 A;  3R23 A;  1AE2 A;  1B7Y B;  1GKH A;  1I5F A;  4UCR A;  4CKC A;  3A7A B;  2R82 A;  2JEJ A;  1TKW B;  4U68 A;  3PVX A;  3S2D H;  2VNU D;  3U9S A;  3P75 A;  4XQQ A;  1QVC A;  3KBG A;  3PO3 B;  4X66 H;  1T3N A;  3K5H A;  3IKJ A;  4YWL A;  2A1H A;  2XRS D;  2UUC Q;  5C4J H;  5GRO A;  4MTE A;  4YAJ B;  5IT9 c;  4BY7 B;  4HYK A;  4C3I G;  4DR1 L;  1BO0 A;  4HJ5 A;  4O3R A;  1ESF A;  4DV6 H;  4UP9 A;  2X69 A;  2IW3 A;  1VAJ A;  4LFA Q;  1W96 A;  5BN4 A;  4DK3 C;  5HNE A;  5KG3 A;  1IZ6 A;  3JC6 6;  2Q8T A;  1MI2 A;  5AJ3 L;  2B63 G;  2HQL A;  2JA6 B;  1E4E A;  1XJV A;  5D14 A;  2B8G A;  3BAB A;  2B2Y C;  1LO5 D;  3H0G G;  3UDG A;  3KAJ A;  3I4M B;  2UXD Q;  4EGQ A;  5A2Q L;  3V6J A;  1MZB A;  3SK5 A;  1T5X D;  2F0E A;  3S2D B;  1C0A A;  1JXL A;  1D5M C;  4LFC L;  3G6J B;  2QIL A;  1IBM L;  2F0U A;  1PHJ A;  5M3M B;  1IYV A;  4A3C G;  1OXX K;  2ZDH A;  5JVL A;  2WTF A;  1KTA A;  3G4S A;  2R93 A;  1DOM A;  5T1G A;  2UXC Q;  5LXT F;  1EY8 A;  1PA6 A;  5C8Y F;  2W9C B;  5AFW A;  2A1A A;  4DV4 L;  2JEI A;  2CQY A;  5KFE A;  4YCU A;  2NZH A;  1IYU A;  1JE4 A;  2F0V A;  1E4G T;  4ECS A;  5FK9 C;  1K8A C;  1DGS A;  4O86 A;  4EFB A;  2VR1 A;  4XX0 B;  2YS7 A;  4K0K H;  1QE6 A;  5FLM H;  2K05 A;  1EIF A;  2XWJ B;  4FBU A;  1ZKO A;  1SMX A;  3QWN A;  2Q8R E;  3PIP 3;  2WB1 A;  5EOY A;  3VR6 A;  4DV5 L;  4HTH A;  1WD0 A;  5C44 H;  3GTJ B;  3LWB A;  4R4Q A;  1DCZ A;  4DV1 Q;  3PUY A;  4AYB B;  4L5R C;  5EPL A;  5E1F A;  1ZYR D;  3AB9 A;  3FKI G;  5ELO A;  4UCV A;  4GKK L;  3KYH C;  5FO8 B;  4RGM A;  3S1M H;  4B3M H;  5F9N A;  2F0I A;  3DTF A;  1E2Z A;  3GTM A;  3RLO A;  4O3N A;  1STG A;  2K28 A;  4B3M L;  2FXQ A;  1ET0 A;  5M5W H;  4LF5 L;  2UU9 H;  1O7Z A;  1EKP A;  1PFN A;  4X66 L;  3M7G A;  4PZ8 A;  4WHX A;  4DR3 H;  1Y1V B;  3NP8 A;  2HJW A;  3GID A;  1D5X C;  4MV8 A;  3WNZ A;  3RB6 A;  5I6Y A;  3I4M G;  1K3R A;  2VB3 X;  1DXM A;  2B2T C;  4LK1 C;  1QIL A;  3FKI H;  3T7A A;  3NBY B;  2BOS A;  2Y0S A;  1KLU D;  2B63 B;  5C44 G;  1I2K A;  2SOB A;  5M5X H;  3GV5 B;  3RNU A;  4UHV A;  1SYF A;  1YHA A;  2WV6 D;  2Z4I A;  2ZTD A;  5IT9 W;  5G3L D;  1CTM A;  4X66 Q;  1JB3 A;  3IAY A;  3KDF B;  4TRD A;  3VYR A;  1UAP A;  1VF5 C;  2VUM B;  1TAE A;  1EY4 A;  5CC4 A;  3A56 A;  1HR0 L;  1DZ1 A;  4HID A;  3M9O B;  1CFM A;  4MIU A;  4O82 A;  2JA5 A;  4MTK A;  3T53 B;  2E2J H;  4NZO A;  2YTV A;  4JV0 A;  1EWC A;  1Z7T A;  3CCL A;  2XIW A;  3CCS A;  4JV5 L;  1J6Q A;  4HJA A;  1EY7 A;  3W3A A;  4H13 C;  2RCF A;  3KF8 A;  1G8Z D;  3JAM c;  2D0P A;  3HG9 A;  1AW7 A;  4TKO B;  1I2L A;  2AGP A;  1CI3 M;  3HOV H;  2ZM6 H;  2XCL A;  4DR6 Q;  2NBF A;  2F0L A;  2NU6 B;  4C2M H;  2R6G A;  4F4Z A;  1S0M A;  1UEB A;  4N8X 1;  2FJZ A;  3H0G H;  4CBV A;  1PX2 A;  2DJG C;  1B53 A;  3ER0 A;  4B3T Q;  1N32 L;  2A69 D;  1K83 A;  2MJ8 A;  1K73 C;  4FF2 A;  2B8F A;  4OEL B;  3DWQ A;  3S1Q B;  3RB3 A;  1W6K A;  3S14 B;  4FGR A;  2ZDG A;  2JE6 I;  1JOO A;  4ECU A;  4K8J A;  4P71 A;  5DG8 A;  3OWE B;  1GGO A;  3L4K A;  2IPK D;  2NTS A;  4KV6 A;  3U4Z A;  2HCI A;  4RCO A;  4J9P A;  1HA5 A;  5EKK A;  3J80 i;  3AFQ A;  1PYB A;  3TIG A;  4IHJ F;  1JR0 D;  1AEX A;  3K7A B;  1BJT A;  5I60 A;  4IUN A;  1PH5 A;  1MHW C;  3GTL H;  4DL5 A;  3H15 A;  4O7V A;  4J9K A;  4B3S H;  4DXG A;  2JQO A;  4E4T A;  2R92 B;  1B4O A;  4L6T B;  2H1E A;  2QF7 A;  1N32 Q;  4FS2 A;  1A2T A;  2FFK B;  1WYD A;  3HKZ E;  4LF5 Q;  4X62 H;  4QWA A;  4IUV A;  1CKN A;  2PI2 E;  1EOT A;  1VQP A;  2QDL A;  4A3I G;  1FJG Q;  2JA7 H;  1YNX A;  5JJI A;  3N43 B;  1JOK A;  4RWS C;  3T1Y H;  1CUK A;  4XYO A;  3NWS A;  3J7Z C;  1YNN D;  3TRZ A;  2WAQ A;  2V4D A;  4RU9 A;  2ZJR A;  2R3Z A;  1Z2N X;  2NTT A;  5EBC A;  1Z2P X;  1S3O A;  2WII B;  3CKI B;  1UUP A;  3MXP A;  3V2T A;  4BBR H;  3DM3 A;  3DM1 A;  3T9E A;  4EX5 A;  3F8N A;  2RBM A;  5H80 A;  5DQI A;  4DF7 A;  1WTV A;  2R8G A;  5EJW A;  3PR5 B;  4DV0 H;  2EQS A;  1A2U A;  2WYO A;  2HDM A;  4KHV A;  1Y1V A;  4WD3 A;  2SDF A;  1TWA H;  1XPU A;  2YS6 A;  2B2T A;  2CNV A;  4JCV E;  4XYM B;  3KRE A;  2Q2T A;  3AEV A;  3QB3 A;  3PO2 H;  4HSP A;  3V96 A;  3WDN A;  5FJ8 H;  4OO1 G;  1JT8 A;  4YWM A;  4X3K A;  2UXC L;  3QQM A;  2W57 A;  1L0Y B;  5BN5 A;  3CCM A;  1XNR Q;  1ONL A;  5EPJ A;  3GTK B;  4X3U A;  2E2I B;  3GTG H;  4HNV A;  4HCS A;  1XNQ H;  4EYI B;  1M90 C;  3GTK H;  2X6L A;  4FNF A;  2L9H A;  3KFU A;  2EJ3 A;  2FLL A;  3GTG B;  4DR5 H;  1X54 A;  2JA6 H;  1IBM H;  4JPB W;  1N34 H;  3U4V A;  1KT8 A;  2FPI B;  3HFZ B;  4Y7N B;  4DR6 H;  4AYB A;  4Q43 A;  3J80 c;  1SJE D;  3QO2 A;  4GN4 B;  1EY6 A;  3JAM i;  1B70 B;  4Y8V B;  3N41 B;  1WVL A;  3TII A;  2F0F A;  4B3R H;  3CCQ A;  4ME6 A;  2DY8 A;  3GIQ A;  3TY8 A;  3IN5 A;  1TT2 A;  4HMI A;  2NWG A;  1SNQ A;  4LWC A;  1K1Q A;  4FYD A;  2BA0 A;  4XQN A;  1X3E A;  2F0M A;  3HOU B;  2NUC A;  3I4N B;  4DV1 H;  5GON F;  1IYD A;  3M4Y A;  5EZY F;  4DL3 A;  2XWB B;  4UCU A;  5FPR A;  4DV5 Q;  1JLL B;  5JJK A;  1B3Q A;  4IFD I;  3N52 A;  3E5N A;  1KAW A;  5I5X A;  1R9T B;  4QIW A;  1JIH A;  3PUZ A;  4KKT A;  1N36 L;  1VQ9 A;  1Y1W A;  2R7K A;  1BNC A;  5EGT A;  4ZUJ A;  4DA2 A;  1EYD A;  1LUZ A;  1SYX B;  3CXC A;  5KFL A;  3GTO A;  4ALP A;  3OHX C;  5EBD A;  3M9M B;  2K5D A;  5GAG C;  2SNM A;  4OL7 A;  4O4L F;  4KJN A;  4M8A A;  4QWE A;  4A3E H;  1K8G A;  1AZQ A;  3OOC A;  2FPG B;  4ZQ3 A;  3GTQ H;  1E1O A;  3T51 B;  1N56 A;  3V6K A;  2QB5 A;  4KTA A;  1N48 A;  1W2B A;  2NN6 G;  4H02 A;  5EDW A;  2ALZ A;  5TSS A;  5FPO A;  3BG3 A;  3BVZ A;  4JG2 A;  1PTO D;  4KHZ A;  3VPC A;  2V9W A;  2GPW A;  2PW5 A;  2RSO A;  2HCC A;  4DAY B;  4A3D G;  2XVS A;  4LH7 A;  1OXS C;  1S5B D;  1SN8 A;  1VMP A;  2B2V A;  4O3O A;  3U9T A;  5JUM A;  3RB0 A;  2IJ0 A;  4KN4 C;  3TBI B;  2CKZ B;  3CC2 A;  3TEH B;  2W9B B;  1A3U A;  2B63 A;  3HOX H;  1IYJ B;  4O7S A;  1L1O B;  1PTO C;  4JC0 A;  1YHQ A;  4LF4 L;  2ATW A;  4IUT A;  4WJ4 A;  4JUZ A;  4YY3 Q;  3HOX B;  2VPS A;  2EDG A;  4AQY H;  4XYQ A;  5KKN B;  3E5S A;  2F3W A;  5I5T A;  4LF6 H;  2ICI A;  2JA5 G;  4APM A;  1LT4 D;  5C3E G;  1FNV A;  2WAQ B;  4OON A;  3BAA A;  4FU0 A;  4EEQ A;  2NB0 A;  5DQH A;  1F2L A;  4DR4 L;  3AFP A;  4YBZ B;  1L1O C;  1PTO B;  1VQN A;  2XSC A;  1JWM D;  3IRB A;  5C4X H;  1Q8K A;  4EFE A;  3EBE A;  3CPW A;  2QEX A;  1HQR D;  4DR5 L;  3NSW A;  1SEB D;  3A74 A;  3CCE A;  3NGD A;  5KT7 A;  1U4R A;  4X64 H;  3A0J A;  3S15 B;  3AYH B;  4JI4 H;  4NXN H;  3RBD A;  2H4O A;  2K5H A;  1U4M A;  4B9W A;  1LAB A;  2ZTE A;  4HSV A;  1JDB B;  1IBK L;  1Y1V H;  3RF2 A;  2M05 A;  1H9M A;  4DR3 L;  3C3L A;  4H7B A;  1UWV A;  5I5W A;  1PXU A;  1YZ6 A;  4YY3 H;  4OIJ A;  3NUA A;  2LXK A;  4UAI A;  5LA6 F;  4C5A A;  4X6A H;  2Z9H A;  2CZG A;  3HOU H;  2RDF A;  3T9D A;  5KIX A;  1EQV A;  4CDD C;  1OTC A;  3S1M B;  4AH6 A;  4FE2 A;  5C1O A;  4YJ2 F;  4C2M A;  1MD2 D;  3EPG A;  4CDE C;  5FNV F;  4NP5 A;  1PMR A;  1YNN C;  5KFM A;  4NB3 A;  3VA7 A;  4DR5 Q;  1FVI A;  4JI6 Q;  2I87 A;  2WAQ G;  4ZQI A;  2HGS A;  4DV5 H;  2HHF A;  3AMU A;  1C9O A;  4DU9 A;  4DUY Q;  3JZI A;  5C0X H;  3J7A V;  2VUM A;  2IWH A;  2HHH L;  2Q2H A;  2AQ1 B;  1HNZ L;  1SRU A;  1Q46 A;  2L55 A;  3LML A;  1NMG A;  4A3D B;  4KHP Q;  1SJH D;  5KFI A;  4UPA A;  4EQP A;  2K5N A;  2F0H A;  1EKV A;  4DNR B;  2CH4 W;  4RGN A;  3ONA B;  5BR8 H;  4LF8 Q;  2UXB L;  1BUV T;  3DWP A;  1VQM A;  3T99 A;  2F0G A;  5DEH A;  5C5M A;  4JI6 L;  2ZDQ A;  1XMQ L;  3HXL A;  5M3M H;  2F4V Q;  4IUR A;  2C2R A;  2X0S A;  1WCM H;  3I4O A;  1GUG A;  2BQ3 A;  2IHF A;  1N33 H;  1K9M C;  2EYL A;  1VKZ A;  3PCO B;  4QWB A;  2Q2U A;  4JYA L;  4QGU A;  2A6H C;  1VQF A;  3W1G A;  1YJ9 A;  5KS8 A;  3EFX D;  4I50 F;  2HIX A;  2NVX A;  1MIU A;  2PZW A;  3J81 j;  4F4X A;  2DGY A;  1X3Q A;  2CNU A;  1QNK A;  4NDX A;  3RZD B;  2UXB H;  2J6T A;  1NSN S;  1NCV A;  3QIA A;  1BGW A;  5KRU A;  3J80 E;  2MFI A;  4MTD A;  1IW7 C;  1VQB A;  3FMC A;  1ILP A;  3K8A A;  4DV0 Q;  3MEH A;  3HB9 A;  2RSN A;  2JA5 B;  3MR5 A;  1P8L A;  1EFI D;  2E2I A;  1GO3 E;  1PTO F;  3I91 A;  4QJF A;  3CF5 A;  2K01 A;  2KEE A;  2DN8 A;  2QEJ C;  3I73 A;  1PFS A;  5ELE A;  4IJL A;  3TP5 A;  5DM7 3;  4E6I A;  2QCP X;  1XK5 A;  3CSW A;  5L9X A;  3T54 A;  2J6S A;  3Q8P B;  1R4P B;  4FVM A;  3GV3 A;  4X64 Q;  1LT3 D;  4J6H A;  2ASJ A;  4WFN 3;  1ROD A;  4QUC A;  1C4Q A;  2MUY A;  4LNQ A;  5IWA L;  3TS2 A;  3UE0 A;  4EVO A;  3HKZ A;  2A69 C;  1SYD A;  4L5T A;  2EXZ A;  3UDF A;  2F0O A;  1N9W A;  5GAD C;  5D3I B;  5M3F G;  4HAE A;  3BAC A;  1EUC B;  3KLR A;  1SFO H;  4A93 G;  2DNE A;  2RA4 A;  1KRS A;  4J9Q A;  1I3Q A;  2J0T D;  5DGB A;  3T4A C;  5FO7 B;  1MJE A;  3CMA A;  2UUA Q;  4EBD A;  2IT1 A;  4GNX A;  3SK8 A;  4L8J A;  4WRD A;  4QIW B;  1R9T A;  5C5J A;  3ICE A;  1F9Q A;  1KQS A;  4PV1 C;  3HZX A;  1TWG H;  2F0W A;  2OEO A;  4IJH A;  4JI6 H;  5EQ0 A;  4QWD A;  3JAM E;  2AUK A;  2KEN A;  3H6M A;  1JB7 A;  1VQH A;  2Y0S E;  3CCV A;  2OWO A;  1HA6 A;  3MFH A;  5K36 G;  1QB5 D;  4X65 H;  5C4Z A;  3I70 A;  1SND A;  1ULZ A;  1OWT A;  2LS0 1;  4K14 A;  4QMG A;  2FMA A;  4DPG A;  2CHB D;  2R92 A;  1VQI A;  3WOF A;  4GLA C;  1WOC A;  3VOT A;  1EY5 A;  5L37 A;  2FPP B;  4CJ1 B;  1S5F D;  4ED1 A;  2EY5 A;  4IPD A;  2YZM A;  3TY9 A;  4RB0 A;  4RB3 C;  4O3S A;  3E9H A;  4DV6 L;  1I4H A;  2VQF L;  1Q90 A;  3GQC A;  2N88 A;  3SK6 A;  4LUO A;  1HFN A;  4AQY Q;  1EYZ A;  1HTP A;  5HY6 A;  1KIX A;  3T5L A;  4OWX B;  1CZW A;  3NPP A;  5JEA G;  3OIP A;  2IP4 A;  3NC0 B;  1A15 A;  2CQO A;  3I55 A;  4F8M A;  5KT6 A;  2VL6 A;  2RCN A;  1KNE A;  5CA1 F;  3SDZ A;  1YNJ C;  3SE7 A;  4G3I A;  2W6Q A;  4ECQ A;  3PW2 A;  3EVQ A;  5M5Y B;  3J81 c;  2L4N A;  4PDB A;  3TDQ A;  3ERQ A;  3BVM A;  1XMQ H;  2I80 A;  5COY A;  4IR1 A;  4NXN L;  2Z0S A;  5KGU A;  5C0X G;  4F4Y A;  1Z47 A;  3L9A X;  3K57 A;  4WBN F;  1I4R A;  4HED A;  1TWC B;  3H4B A;  2E74 C;  3JAM W;  2BQR A;  1EKF A;  2YZL A;  1JX4 A;  2HDL A;  1TWC H;  4KI0 A;  1PZI D;  4F4W A;  2BDO A;  3GIL A;  3HEJ A;  4DR4 H;  1ZXT A;  4JBM A;  4RNM A;  1HR0 W;  5I5Y A;  2V59 A;  3HOU G;  3AW8 A;  2XGT A;  1KC7 A;  5JOB A;  2DLN A;  4B3S L;  4DR1 H;  3BG5 A;  5DLQ E;  1TWF B;  4Q4C A;  5DG9 A;  4R4I A;  1LTG D;  4TSS A;  2E2H A;  4JI0 L;  3M4Q A;  1XTC D;  3MAQ A;  4A3B G;  1VS0 A;  2F0J A;  1GLV A;  3BQ0 A;  1CA5 A;  5CM0 A;  3O13 A;  4O4H F;  2JEG A;  1B6R A;  2QW7 A;  5CAE B;  1HRJ A;  3F2D A;  3UE1 A;  3Q