1FVIA

Crystal structure of chlorella virus dna ligase-adenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
264
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIAGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of eukaryotic DNA ligase-adenylate illuminates the mechanism of nick sensing and strand joining.
pubmed doi rcsb
source organism Chlorella virus
molecule tags Ligase
molecule keywords CHLORELLA VIRUS DNA LIGASE-ADENYLATE
total genus 72
structure length 264
sequence length 292
ec nomenclature ec 6.5.1.-:
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fviA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1fviA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1fviA01
1X3FA 2UXDL 4DPGA 4EEQA 1VQ4A 2Q2HA 4A3JH 1K8AC 1IBMQ 1HZCA 4LF4L 1LYLA 1QZHA 2MQHA 1TXYA 4GN5A 3HOWG 1IL2A 1TWCH 4A3FG 1JB7A 4KHPQ 4JI0Q 1G6PA 4QGUA 3CCMA 1VQ7A 3GTMH 4UY8C 4EFBA 1PH7A 2UUCQ 3RLFA 1FJGQ 4LUVA 3RZDH 3QWUA 3D0FA 2UUBL 1H95A 2OCEA 1K83H 3CPFA 4NB3A 4OONA 4AIMA 3CCUA 4YY3L 1XJVA 1HR0L 3K8AA 2NN6I 3KF6B 1KD1C 1P16A 4B3TQ 1TWFH 4DR4L 3ULJA 5JJIA 2VW9A 2N8NA 3EIVA 1QZGA 4JI6L 4DV5Q 2F4VQ 1I94Q 4B3SL 3GTLH 1B70B 5BR8L 4Y7NH 3G6EA 3CMAA 1KAWA 2R7FA 4DR3Q 5C3EG 3GTGH 3F2BA 2NZOA 4C3HH 3AEVA 3FP9A 5IYDG 2IT1A 2R92H 1XDNA 3W5OA 3GD7A 4HIMA 3S1MH 2R93H 2KCMA 1VQBA 4P71A 4ALPA 3S1QH 2PQAA 3FHWA 1MIUA 4GKKQ 1XPRA 2JQOA 3NBYB 2VL6A 4H02A 4GLXA 5IWAQ 4JI7L 1UE6A 2B63H 4IFDJ 3CC7A 1VQ9A 4B3MQ 4GS3A 2K5VA 5IE8A 1VQPA 2AWNA 4A93H 4JYAL 4JI2Q 2K52A 1V43A 4QL5A 4JI1L 5BR8Q 3JC66 3HOVH 2AWOA 1CKNA 1CKMA 1XMOL 2E2IH 4OO1I 2JA6G 1J6QA 3M3YH 3MEFA 1NTGA 4JCVE 3GTQH 1N34Q 1HNWL 2L15A 3DLLA 3T1YL 1SLJA 3J81c 4JV5L 1FJGL 2CWPA 3UDIA 2UUCL 4P72A 3HOVG 2CQOA 2I5LX 3UQ8A 2EQSA 3F8TA 5GAHC 1VQKA 3PUYA 2HT1A 3GTKH 1O7IA 4DR2L 2HVSA 3OW2A 1VQEA 3RZOH 4E6NA 1K0RA 1BBUA 1WCMH 4QIWE 4C3IH 1VQ8A 4JI4Q 3HKSA 1QVCA 2K4KA 2PI2E 1LM0A 2QEXA 1V1QA 1YIJA 1JMCA 4IO9A 3HOZG 3S1RH 2CWAA 4A3DH 4A3BH 1CKNB 1GVPA 1VQMA 1Z47A 2MNAA 1XNRL 1VQAA 1TAEA 4JI3L 1L1OA 1IBKL 1KHIA 2AHOB 1N9WA 1OXUA 2HHHQ 5ELNA 5GQOA 1HH2P 3CCRA 5C0XI 1N36Q 5GAGC 1YJNA 2R7ZH 1S40A 4DV2L 3CC2A 1VQLA 3AYHB 2MO1A 1N33L 4Y52H 4JI7Q 5C44H 2QA4A 4CC5A 3PUVA 4GLVB 4R4TA 1VCIA 3ZJYC 5M3FG 2K14A 4A3DG 4POFA 3OTOL 4LFAQ 4HJAA 3OYYA 2N49A 1PH2A 4KLKA 3T1HQ 3W1BA 4JBMA 1XMQQ 4ME3A 1OXXK 4UCTA 1RIPA 1L1OB 4JI8L 4IOCA 4R4CA 4LFAL 4APVA 4XIGS 4X66L 3F2DA 1M90C 3Q8DA 3J80c 2RF4A 1S3OA 2E2JH 5M5WH 1PH5A 4O0AA 4BXXH 4DR7L 5C3EH 4IJLA 2R7DA 4DR1Q 2Q2UA 4IFDG 1GKHA 1VQFA 4EX5A 4A3KH 4DV4L 1HR0Q 2EXDA 1PH6A 1VQNA 2UXBL 1J5EL 2N3SA 5IP9G 4JV5Q 1N36L 4QJFA 5AJ3Q 3I55A 1TA8A 1L0WA 2E5LL 4CC6A 4DR5L 3KLWA 2UXBQ 3LGJA 4HIKA 4BY7H 3G48A 5J3BA 1X55A 4DV4Q 2D0PA 2BH2A 3CCEA 3STBD 3UDFA 5GADC 4JI3Q 2I0QA 5D1OB 1YVCA 4J15A 3PUXA 3KFUA 4DV1L 3STBC 4L5SA 2BA0A 1TWAH 2Y0SG 3BZKA 3M4QA 4JBWA 4LF7Q 3HOYH 4B3ML 2NVQH 2N78A 3KF6A 4B3RQ 1AE3A 2ID0A 2JEBI 4IPHA 4KHZA 1X3GA 1VQCA 3U58A 1MJEA 3J7A5 4BBSG 5DISC 1FGUA 1Q12A 3CQZH 4GKKL 5C4XG 1VQHA 1JJGA 1I50H 4LFBQ 3K81C 1OTCA 4OWWB 5HY6A 3ER0A 1R9TH 1W3SA 5C4XH 1XPOA 3E9IA 3T1YQ 4A3GH 3BAAA 4HJ8A 4LF9L 3TS2A 5FJ8G 4GNXB 1QUQA 4UCRA 2IX1A 4L5TA 1Q86C 1XMOQ 1HNZL 3ULPA 4DRFA 2F52A 3HOYG 5M5XH 3FKIG 2VQEL 2NVYH 1XTDA 2A1AA 2IHEA 2WB1E 1CKOA 5M5YH 1Q1EA 4DV5L 2ATWA 2B3GA 1B7YB 1G51A 3RR5A 3HOXG 2YTXA 4DKAC 1PFSA 2Q2IA 1I5FA 2ZM6L 1XNRQ 3TY9A 2JJQA 4LF8Q 3D31A 4GOPC 3PO2H 4QQBX 4NPSA 1BVSA 2KHJA 1BBWA 3KDFA 4LWCA 1SR3A 5FJ8H 3CC4A 3TY5A 4A3KG 5M3MH 3A5ZB 3KYHC 4P74A 1SMXA 3RTXA 3ULLA 2ZM6Q 3FKIH 2WAQG 3NC0B 1IBLL 2VUMH 4A3MG 5IP7H 4OXPA 2R92G 3GDEA 4NXNL 4OWXB 1EQRA 1YHBA 4UP7A 4RG1A 4DR2Q 1LTLA 1I94L 1N33Q 1EIFA 5FLXc 3M7NA 4BBSH 1K73C 2CKZB 2RHQB 3AFPA 4GNXC 1YHAA 2OQKA 5IYBG 2UU9L 2KBNA 1VS0A 1S68A 1WOCA 2JA5G 4YCUA 1QVGA 1KRTA 2Q2TA 1B04A 4BA1I 3PSIA 3TQYA 1A8VA 3I2ZA 3BABA 4A76A 1JE5A 3F2CA 4AQYQ 4JI1Q 3TS0A 1Y1VG 1KC8C 2HVQA 2AKWB 1YEZA 1D8LA 2PQAB 1YHQA 1PH3A 2ES2A 3I4MG 4DV3L 5IY0A 2Z0SA 4DV7Q 3I4NG 4DR7Q 3H0GH 1Q8KA 3H15A 1YBYA 4DV6Q 4LUOA 1E7ZA 1OXSC 4TQUS 4PMWA 2IHFA 3NENA 4LW1A 4JI8Q 1XK5A 3AFQA 3I4NH 4A4IA 3L0OA 4R4OA 4OX9L 1VQIA 2LXJA 2GVBA 4MNOA 4C2MH 5FLMH 3E9HA 4UPAA 4BA2I 4HIOA 3BZCA 5LMNL 2UU9Q 4MZ9A 4LF6L 4YHHQ 4KI0A 4RMFA 1ASZA 1Y14B 4DR6Q 4JI6Q 4JI2L 4WJ4A 3A5UA 3PO2G 2OWOA 3RLNA 4JI5Q 1SFOH 1Q46A 1Q82C 2R93G 2GVAA 1NY4A 3PCOB 4A3LG 3U50C 3M85A 5IYDH 3HOZH 3GTJH 1CSPA 3DM3A 1WI5A 4HJ7A 4X65Q 1K8GA 1EWIA 1N8RC 4L5RC 1QVFA 1A0IA 5C0XJ 4LFBL 3PO3H 2R7ZG 2UXCQ 3BA8A 4GOPB 1XMQL 4LF5Q 4LH7A 2JA8G 3HOUH 3M9BA 4MTNA 3G71A 3J80i 5IT9c 1KXLA 4A93G 4B3RL 3OTOQ 2JEAI 1U5KA 1VQJA 4BY7G 4PZ7A 5JEAJ 3PIOA 3L2PA 1PH8A 1E1TA 2NZHA 3BA9A 2JA7G 3CAMA 4DV3Q 1GO3E 4P75A 2ZTEA 3CF5A 4GOPA 1A63A 1C9OA 4PG3A 4UP9A 4JOIA 1VQOA 3CCJA 1YJ9A 1GM5A 4X65L 4LF9Q 1KL9A 1NBWA 1HJPA 1U0LA 2B29A 4A3EH 1W2BA 3EN2A 1CSQA 4NXML 1K3RA 3JSNA 4BXXG 2K5NA 1YITA 4IOAA 2RHSB 4WJ3M 1S72A 4R1JA 2OTJA 4YWLA 4YCVA 1WCMG 4X64L 2BA1A 3U4VA 4GN3B 1T9HA 3WWVA 3H3VH 2ALYB 2I5MX 3SGIA 5H1SE 4YHHL 1AH9A 3NEMA 3J7ZC 3S2DH 1X54A 3M4OH 1MJCA 3S15H 5D1OA 1JJ2A 3S17H 4HJ9A 4DK6C 3J81i 3ERSX 1Q81C 4NXNQ 4K0KQ 2UXDQ 2VQFQ 5IWAL 1UE5A 1EQQA 1ASYA 2R6GA 3T1HL 4A3CG 1X56A 1EFWA 2FXQA 1VQGA 1VQ5A 4IFDI 4IPCA 2VZAA 1OXTA 3A74A 1Y1WG 3EBEA 4DV6L 4UCSA 1M1KC 4A3LH 1X3EA 4LF8L 2UUAQ 3CPWA 3BJUA 5JEAG 4EQ5A 1N34L 1IZ6A 4DK3C 4HIDA 1DGSA 4A3JG 2D0OA 2YYZA 4GN4B 4C3JH 3MXNB 2F4VL 4DAMA 2PMZE 2UUAL 1JT8A 3S16H 3CCSA 2K50A 2JA7H 4DR6L 4LF6Q 4AH6A 2K5HA 3GTPH 1HNZQ 3TREA 1GD7A 3B6YA 1VQDA 1WJJA 1SROA 2HQLA 4JOIC 2LXKA 1X65A 3JAMc 1PVOA 4XTCS 5FLMG 4DUYL 4A75A 4OX9Q 3GTOH 1I6HH 4DAYB 1NE3A 2VQFL 4X62Q 4BY1H 5D1PA 1E1OA 1A62A 4FDBA 2VY3A 1UE1A 2K75A 3UDXA 1Z9FA 1IBLQ 2JK8A 2A8VA 3S24A 5IP9H 3JSLA 4X64Q 4DR3L 3S1NH 2JA8H 5JJLA 2IY5B 5JJKA 1XPUA 2HIXA 1B8AA 4DV1Q 4DUYQ 1PYBA 3A0JA 2YU9H 2HHHL 4L5QA 3H0GG 4PZ8A 3H3VI 1HNWQ 3BU2A 4DUZL 3GJXB 3S14H 4DR5Q 5GAEC 1Q1BA 3KJOA 3J81j 2YTYA 3IRBA 1I3QH 3F1ZA 3KOJA 1P8LA 3CMEA 5IYBH 5C0XG 1AE2A 2OQ0A 3AQQA 2VUMG 1WFQA 4KHPL 4YWMA 3I56A 4DNIA 1Y1WH 2WAQE 4A3EG 4JI4L 4PZ6A 2GN5A 2MO0A 3UDGA 1YJWA 1IBML 2ZJQA 4LF4Q 2NVTH 3NBHB 4GKJQ 4X6AH 5FPRA 1FVIA 4LF5L 3RNUA 5E7NA 4LFCQ 5IYCH 4UP8A 1Q7YC 1G291 1C7YA 3HKZG 3CXCA 1RL2A 3GB8B 1PH1A 3K0XA 3UE0A 1PH9A 1EIYB 2B63G 1XNQL 1KQSA 2QGQA 1X9NA 4UFZA 1UE7A 3RN2A 1LUZA 2E8GA 4BY1G 4BBRG 4B3SQ 2YV5A 4QY7A 2HVRA 2BH8A 1NMGA 4JYAQ 2LSSA 2WB1G 5EAYA 1JJCB 1WYDA 3HOUG 1EYGA 3RLOA 3CCLA 1C0AA 2DUDA 5GROA 4DV2Q 4HJ5A 5FPOA 4UCOA 5IYCG 3KF8B 1CUKA 5IP7G 3CD6A 1YZ6A 4IPDA 2ASBA 1K9MC 2PNHA 3CW2C 5LMUQ 1IXRA 4GNXA 1PHJA 1NMFA 1HNXL 3HOWH 3G4SA 4JC0A 1PYSB 1OXVA 2YTVA 1IYJB 2ZTCA 4A3IH 4DR1L 2CCZA 1UWVA 2AMCB 2JA9A 1E24A 4OO1G 4GKJL 2V1CC 3K80C 4A3MH 4JBKA 4DV7L 3HKZE 4IPGA 5C4JH 4UCUA 2F3IA 2JA5H 4K0KL 1QUQB 2EIFA 1D7QA 2I5HA 1PV4A 4DV0L 5HGQA 2KCTA 1UEBA 3PV0A 5M3FH 3PF5A 2A19A 1L1OC 4X62L 2IX0A 3HOXH 2Y0SE 3VDYA 3E0EA 3KJPA 4R4QA 2ZJRA 2Z6KC 4LNQA 1N32Q 4B3TL 3I4MH 2VQEQ 4DR4Q 4JG2A 3HFZB 2Z6KA 3U4ZA 1NJIC 5LMUL 1PH4A 1HNXQ 1SRUA 1J5EQ 2UUBQ 3VNNA 2E5LQ 3L7ZC 3K7UC 5K36G 5AJ3L 5M3MG 3PIPA 2OTLA 1TWHH 1V9PA 2H5XA 2PI2A 2CFMA 3M4PA 1HZAA 4AYBG 1MKHA 4JI0L 2D62A 5DLQE 4O2DA 2C35B 4DV0Q 1SN8A 4YWKA 4A3GG 1EUJA 1EOVA 4OWTB 1IBKQ 4LH6A 3TRZA 4LF7L 4X66Q 3ICEA 2WFWA 3NELA 4LUZA 2JA6H 4A3BG 1BKBA 4EFEA 1E3PA 1YI2A 1XNQQ 3K7AH 3CCVA 1X6OA 3W1GA 1E22A 3PF4A 3PN1A 3PGZA 3I4OA 1HR0W 2NN6G 2VNUD 2ZJPA 3NBZB 1FL0A 3PUZA 4LFCL 3GO5A 2NVXH 1SE8A 3CCQA 1Y1VH 2WP8J 4IJHA 4A3IG 2UXCL 3CP0A 1YNXA 1HZBA 3TEHB 4AYBE 5LMNW 2MFIA 1TWGH 1KIXA 2E2HH 2JE6I 4JI5L 3PUWA 2KENA 3S2HH 5C44G 5ELOA 1L2FA 4AQYL 4GLAC 2ZTDA 4JBJA 1PA6A 4TVAB 4R4IA 4A3FH 1HZ9A 4NXMQ 2KHIA 3PO3G 3JAMi 4A3CH 3KDFB 3RN5A 1KRSA 2HIVA 4DUZQ 3TY8A 5LMNQ 1N32L 2VUGA 2XGTA 3UE1A 4YY3Q 4YCWA 4BBRH 2RCNA 2VS1A 2XTIA 4POGA 4UCVA 4P73A 2DGYA 3I7FA 1VQ6A
chains in the Genus database with same CATH superfamily
3NBHA 1X3FA 4MA0A 5LYJF 1MI2A 2SNMA 4DPGA 1VDZA 2W6NA 4A3JH 1K8AC 5DGIA 1R9TB 2F0MA 4M8AA 5KG0A 4M7EA 4PQXA 3SK5A 2MQHA 3A7AB 1TXYA 1FGBD 4N9PA 1TWCH 1JB7A 4A3IB 3T5KA 2JXMB 1NR2A 3LULA 4LUVA 3I91A 3BS1A 2R3ZA 2UUBL 3TBIB 4NB3A 3CPFA 3OSNA 1D5ZC 4K6LA 2FJZA 3BG3A 3UZBA 3UZOA 1G2SA 2KECA 4B3TQ 2VQFH 4EBDA 1BNCA 5CORA 2N8NA 2WE6A 2RDGA 3TDQA 4JI6L 1LTSD 4O1NA 4DV5Q 4B3SL 2F4VQ 1XMQH 2B2VC 3G6EA 2J0TD 1MSGA 3DMUA 2QK4A 1M0WA 1IYVA 2EJ3A 1TWAA 1XYIA 5FD5A 3G6XA 2UUAH 3AEVA 5IYDG 4AYBB 2R93H 1VQBA 4OIKA 4GKKQ 4WORA 1PTOH 1KTKA 2JQOA 2WINB 5KYIA 4OO1H 3EA6A 4GLXA 4IFDJ 3U54A 1UE6A 2KQ3A 1TIID 4FFLA 3MJFA 5COYA 5EPJA 1VMCA 1VQPA 5IE8A 4A93H 4JI2Q 4FFOA 1LLRD 2L5TA 3JC66 2RKSA 3HOVH 1A3VA 3TSSA 4OO1I 4ECSA 1J6QA 1AP0A 2W6MA 3MEFA 3KTMA 3GTQH 4ECVA 1C48A 3EYYA 1MZBA 1WRVA 1SLJA 4FFRA 1RJRA 1FJGL 2W9BA 4DQNA 3GIMA 2EQSA 3MEHA 3PUYA 3JZ6A 5I9OA 1O7IA 1RKNA 3RZOH 2TSSA 3NPPA 2ZDGA 2M2LA 3A55A 1WCMH 1WH2A 4NXMH 1VQ8A 3QWNA 1B3AA 1ESFA 2DABA 5I5SA 2PI2E 2Z02A 2QEXA 5BWWA 3FKIA 1YIJA 1DJRD 1XXGA 4A3DH 3MA2B 3W3AA 3O13A 5M5XB 1Z47A 1K1SA 4HQ6A 3MC0B 3H09A 4JI3L 4NXNH 1EYAA 5LHY1 4O82A 3GIDA 1A0GA 1OXUA 3HOXB 2J6UA 5ELNA 4YP3A 4MV7A 1HH2P 3CCRA 3GTLA 3N43B 5KFXA 4GKJH 1OWTA 3LQSA 2WKDA 3AYHB 3GTGA 3PW0A 4JI7Q 3HP3A 2JEGA 2D9UA 1HXYD 4C5CA 3KBXA 3T51B 3JZFA 2W6OA 4FF2A 1CS0A 2XN9C 4HJAA 3OYYA 2Z8LA 4B3SH 5CC4A 2MJ8A 2X0SA 2PN1A 1GSHA 1AUXA 2K5WA 2HUGA 4QWCA 4ME3A 1OXXK 1JORA 4IOCA 1L1OB 3NUCA 1HNZH 2QF7A 4XIGS 3VR2A 5K5PA 1BBXC 1JC7A 4DFAA 1M90C 1EWHA 2FE3A 4JK1C 2F0NA 1I7LA 4G57A 1GUTA 1UC8A 4EX5A 4M9UA 3GTKB 2EXDA 1G6ZA 4O3PA 3QR8A 4F8MA 3J81E 5KT6A 5IP9G 2MPMA 4C3IG 3H0GB 4IALA 3KREA 3Q1KA 2LS01 4BY7H 3G48A 1D1IA 1X55A 1QNUA 2BH2A 3ND8A 1KJ9A 5BPFA 3STBD 2XIGA 5GADC 2I0QA 1YVCA 1LTGD 1DOKA 3PUXA 4J15A 4DV1L 3STBC 3KFUA 1RK6A 3X3NA 5GONF 2J7ZA 3BZDB 3KHLA 3M4QA 4DAAA 2WAQA 2QDBA 4QWDA 2V58A 2YWVA 1SEIA 3CRLC 4B3RQ 5I4DA 2ID0A 4BBSG 5DISC 1VQCA 1JQYD 1J5EH 4X3UA 3R23A 3EPGA 2BOSA 5HY6A 4OWWB 4A3JB 4K2LA 5KG2A 1R9TH 1EY5A 2KOLA 5C4XH 4V190 3BAAA 1PK8A 2XSCA 3GP7A 3EJIA 3EQLC 4L63B 4L5TA 2IX1A 1KDAA 1XMOQ 2L9HA 5KG5A 1XTDA 2A1AA 2IHEA 1EKPA 1CKOA 2ATWA 1IKLA 2EY2A 4Y8VB 1SYCA 3MR5A 1PTOF 3F2UA 1UUPA 3RR5A 4WD3A 1STEA 4BY1B 2J6SA 3OTOH 4XT1B 3D4WA 3GLKA 2ZM6L 1BCPD 4J9QA 3U9OA 2XD4A 3TY9A 5IT9W 4LF8Q 4PMBA 2WYOA 2FLPA 4CKCA 4C3JG 1D5MC 2KHJA 1Z7TA 4DV2H 2R7MA 2RDJA 2FKLA 3A5ZB 4YR2A 3ULLA 1EQTA 3P75A 5ELEA 4LF9H 3PO3B 2VUMH 2ZDHA 3GIQA 5IP7H 4RUCA 2F0UA 1DD2A 1EQRA 4UP7A 4IUTA 3WO1A 3RB3A 3BDOA 1EIFA 2OLSA 4ZRZA 1S5DD 3M7NA 1UC9A 1RYSA 2OQKA 4R8NA 5C0XH 3T53B 5JVG3 2NU6B 2ZJTA 4YCUA 1KRTA 2R61A 2VQDA 2TMPA 4BA1I 3KHRA 1A8VA 5IGEA 4A76A 4DR1H 1V8QA 5BWTA 4O3OA 1TS2A 2EYMA 2HVQA 3RV3A 5KKNB 2AKWB 2PQAB 5IGBA 1HNXH 3NQTA 4DV3L 1JX4A 2HJWA 3PIO3 4JV5H 1GJXA 5F9LA 4LUOA 4A3GB 3GILA 4DV4H 4HMIA 4O7WA 1XK5A 5I5VA 5C4JB 4EYHB 2OH2A 1I6VC 5FLMH 3E9HA 5DG9A 2H4OA 4BA2I 2SDFA 1EZ1A 3BZCA 2FK1A 1BXTA 5E3FA 4LF6L 1H9KA 5NUCA 1ASZA 5L37A 4WFN3 2K33A 4JI2L 4JI6Q 3I4MB 2R87A 2YL2A 4O7TA 3VPCA 1DZ1A 2B2TC 3R2TA 1Q82C 1X32A 3GQCA 3M85A 4F4ZA 3GTJH 1CSPA 1LTAD 1EWIA 1IHZA 2UXCQ 1DM0B 4LFBL 3RV4A 4LF5Q 3DWQA 4LH7A 1BGWA 2JA8G 1GUSA 1ZXTA 2PW7A 4JI2H 3AB9A 4DUZH 2R7KA 4IQZA 5KIXA 3OTOQ 5KFUA 3I8ZA 3L2PA 3K7AB 1I2KA 2JA7G 1PRTF 1RDPD 4O4LF 1SXTA 2V5AA 4X65L 1TKWB 4XZ3B 5A2QE 2YW2A 1HJPA 4A3EH 5I5TA 1CSQA 2K5NA 4WJ3M 1S5ED 3OWEB 2KEDA 2VB3X 4R1JA 4DR2H 3V6KA 4YCVA 4X64L 1W96A 4NW2A 1B9NA 1T9HA 3H3VH 1AH9A 3CHBD 3S2DH 4BY7B 1MJCA 3S15H 4WRDA 3S17H 4FFMA 2E75C 4HJ9A 4O83A 5D1OA 3ERSX 4Q0FA 4NXNQ 5L1KA 1S0NA 1Y1WA 5EZYF 4F4XA 1UE5A 1ASYA 5K2MA 2F4VH 2A68D 1X56A 1BCPB 2X6LA 2Z6BA 2FXQA 4CBVA 3SNOA 4AQYH 2A6HC 4U6PA 2VZAA 3A74A 3WWHA 1Y1WG 4YJ2F 5KFWA 4RAUC 2AGPA 5AFWA 4ZK9B 2JEFA 1M1KC 1SFOB 4A3LH 4FBUA 2YYAA 2EPBA 1CQVA 2NU9B 1PXUA 1DGSA 4A3JG 1ESRA 4H7BA 4F4WA 3SVMA 4GN4B 1VAJA 2F0JA 2ASDA 4YIJA 4KKUA 1EUCB 2PMZE 3T1HH 1OBDA 1TWHA 5DQIA 5IWAH 2JA7H 4DR6L 1KNAA 2PW5A 5DNFA 4LF6Q 3KAJA 2BQ3A 4RFBA 1HNZQ 2GPWA 1EU4A 1VQDA 5LA6F 1HCZA 2HQLA 2E76C 3GTOH 1WTRA 2ZXPA 1EFID 1BCPC 4X62Q 4XYLB 5FO7B 5D1PA 5CV7A 1HHVA 2EYOA 4J0MA 3IFTA 2FFKB 2K28A 3GTMB 2MUYA 2K75A 1AN8A 3JAML 4ZHQF 4K5VA 3Q8PB 1JOQA 2Y4RA 3JSLA 4DR3L 3D8GA 1LT5D 1EHIA 3N40P 2I07B 5JJZA 4RZQA 2J4XA 2JA8H 2IY5B 1XPUA 3QOLA 2E2HA 4C2MA 3C3LA 4C56C 5CAEB 2YU9H 1GHJA 4DGZA 2HHHL 2BE5D 3H3VI 1TQOA 1ZKOA 3KBGA 4G7HC 3TEKA 3GJXB 1PZID 4KKSA 1RJQA 3KJOA 3GTGB 3IRBA 1SFOA 1P8LA 2RQXA 5IYBH 1WFQA 1TS4A 4YWMA 4Q4CA 2WAQE 3S1QB 4JI4L 3H20A 1XWEA 1YJWA 2ZJQA 3UDGA 3GV8B 5KFPA 3T9EA 4ZLTF 4NYEA 5E4XA 4UAIA 4FS2A 2OXPA 5IYCH 4UP8A 3HKZG 2RDHA 3HEJA 4XT3B 4RZRA 3K0XA 3UE0A 1PH9A 3DXJC 3NWSA 2RSOA 1Z2OX 5KG4A 3RGXA 3S17B 3RN2A 1LUZA 1ENAA 1Q90A 2E8GA 3PQIA 3PR4A 2YV5A 2HVRA 1SNQA 4O7ZA 3HT5A 3MWDA 5EAYA 1JJCB 2I80A 3E3XA 5DGHA 4ILWA 5GROA 4QMGA 3V4ZA 3TIGA 3EPIA 2AQ1B 3E5NA 4OEMB 1JOOA 3N52A 1IXRA 3VPDA 3DTFA 4UUGA 1PYSB 1IYJB 1UWVA 2AMCB 5IYZF 3KHHA 4GKJL 1WTVA 5KT7A 3UYYA 4A3BB 4IPGA 4UCUA 1UAPA 1STYA 4K0KL 1QUQB 2R7NA 4N8X1 4OELB 2I5HA 2B2WC 2KCTA 3WOEA 3PF5A 1O75A 4JI3H 2A19A 1L1OC 5FO9B 2IX0A 4X62L 3OMCA 1LTRD 3K5NA 4LNQA 1T5EA 4DR4Q 3I4MH 2IWHA 2CNQA 2F0OA 1Y69U 3HFZB 2E2IA 2A69C 1NJIC 5LMUL 1HNXQ 3J81L 2E5LQ 2V59A 1SE3A 3K7UC 4B08A 5AJ3L 3LP8A 2H1EA 2JP1A 1V9PA 3Q22A 4AYBG 4JI0L 5FD6A 2K5DA 1BJTA 2D62A 1RTOA 2F0QA 4WHXA 5KFNA 4DUYH 3GTKA 5EKIA 1DCZA 4EGVA 4FVMA 4IUNA 3R3OA 2RGRA 3TRZA 4X66Q 3GV5B 2JA6H 4HN2A 2C28A 2LFNA 2W70A 1BKBA 3QQMA 2KEEA 1TWAB 4I7AA 4RH6A 1KNEA 5K36H 3PGZA 2YS6A 2NN6G 2ZJPA 1FL0A 4LFCL 5IGGA 1SE8A 3CCQA 4A3IG 2WP8J 4IJHA 3NGDA 1N34H 1J8IA 3DAAA 1YNXA 4NZNA 1HZBA 3TEHB 4AYBE 2DLNA 5K3WA 3I70A 2A73B 2AGQA 2F0KA 5C44G 4JVZA 1PA6A 4NXMQ 3PO3G 1QNKA 3KDFB 1W6KA 3TP8A 4FGRA 5LMNQ 1N32L 2JA5B 5M5YB 1PZJD 4CJ2C 4O3RA 1SEBD 4YCWA 4KN7C 3KLRA 4RUAA 3I7FA 3CQZB 1I1LA 2FMCA 3Q8QB 1EKVA 5LP6F 4EEQA 1VQ4A 1HZCA 4IIJF 5EWFA 1D6EC 4DN4M 4DAVA 5C4ZA 4A3FG 2CQYA 3I4LA 4KHPQ 1HA6A 4KN4C 4QGUA 4HR7A 1VQ7A 1WD0A 3GTMH 3RLFA 5DMXA 1AEXA 4QIWB 3FKIB 3D0FA 1WTXA 4IHJF 3CCUA 4OONA 3H3VC 1XJVA 5KG7A 2D2CC 4ZI7F 2W9BB 1P16A 2K6AA 5KNBA 1TWFH 4DR4L 3ULJA 5JJIA 2XCPA 1UNNC 3EIVA 5JH7F 1I94Q 3OHAA 5BR8L 4HNVA 1K28A 2GA4B 2VR1A 1JB3A 2KSWA 3F2BA 2HDKA 3FMCA 2F03A 4APMA 2K03A 3V6HA 2R92H 1XDNA 5I6YA 3S1QH 2G5DA 2JA8B 2PQAA 3V05A 1MIUA 4IURA 3OHBA 3AX6A 1XPRA 3IL8A 5HURA 1Q3LA 1KAAA 4H02A 4HCSA 4JI7L 1S5FD 1GLVA 1T94A 1IBKH 1I4XA 2K5VA 4JYAL 3QG1A 1BXRA 4I7ZC 1ZAUA 2EJ2A 2J9GA 1SNMA 2F0SA 4JI1L 4O7RA 4CE5A 3HKZA 2B2TA 2AWOA 2Z4IA 1SE2A 1CKMA 1XMOL 4DL7A 2B63A 3M3YH 2QEJC 5KEEA 2E2JB 5M5WB 1N34Q 4GZYC 4K2KA 1PFNA 3MVVA 3J81c 1WD1A 3UDIA 4MV4A 2UUCL 4ZQIA 3HOVG 2CQOA 3JZIA 5GAHC 4YAJB 5JAVA 5BN3A 2HT1A 3OW2A 1K1QA 1BBUA 1U4LA 3K3VA 4YR3A 4ED2A 4RHRA 4JI4Q 5C1OA 3T1YH 4L1KA 4RA8A 4MHEA 3BVZA 5KNDA 2Q7DA 1QVCA 5HGTA 1JWUD 1LM0A 5BPHA 1GUNA 4IO9A 4NMZA 1F77A 3S1RH 4MV3A 1S5CD 5LXTF 1B33N 2MNAA 3HOYB 1K83A 4QUCA 1VQAA 1TAEA 1I50A 1XX8A 3NSWA 4KMUC 2GPSA 1KHIA 2AHOB 1TWGA 2HHHQ 5GQOA 3LMLA 4XX0B 1SYGA 2F1MA 4O7NA 2R7ZH 3Q6SA 2DJGC 1EKFA 2MO1A 2N88A 4RKLA 2QA4A 2YZMA 4GLVB 4MTEA 4R4TA 5I47A 4KK7A 4DL6A 3SK4A 2EY6A 2WTFA 4JBMA 4DV5H 2C2EA 3NXWA 2FPIB 2W6QA 1L0YB 4B9XA 4LFAL 4APVA 4JXUA 1V51A 3FDTA 1GUWA 2RF4A 1S3OA 2XVSA 1H9SA 4OX9H 1PH5A 4O0AA 5FO8B 4DR7L 2PZUA 4DR1Q 1GKHA 4A3KH 2AU0A 3G7LA 1PH6A 1VQNA 3VYRA 3T56B 3D4DA 2N3SA 4CC6A 1TA8A 1L0WA 2IX3A 3M4YA 1ET6A 2E5LL 2EIYA 3D3RA 4B3MH 2UXBQ 4HIKA 3M4OB 4DV4Q 3UDFA 5D1OB 5DAAA 3GIIA 1KJIA 5KFKA 4QB4A 4L5SA 2BA0A 3T5HA 3BZKA 4JBWA 1G2WA 1QWYA 4B3ML 4QCLA 2NVQH 2N78A 4FBTA 5JVH3 3U58A 4IPHA 5EWEA 5CV6A 3PIP3 1IOWA 1Q12A 1CA5A 4E6NA 1JJGA 4QWAA 2R6FA 3K81C 3RZOB 4YR0A 3Q23A 3G6JB 1HFGA 4J9SA 4JI5H 3VR3A 2K32A 3T1YQ 4O4IF 4FXKC 1CHQD 1NR4A 3S1NB 1I2LA 5FJ8G 1Q8IA 1QUQA 2IA6A 2JEIA 3N8DA 4O84A 1HTLD 4DRFA 2F52A 3HOYG 5M5XH 3FKIG 1IL8A 1SJHD 5M5YH 4DV5L 5CM0A 1H9SB 1EOTA 2B3GA 1B7YB 2PMZB 3MR2A 3DWAA 4DKAC 4EQNA 3C1EA 2Q2IA 1SYEA 2FHTA 1V1PB 5A2QW 3D31A 5LOVF 4HCEA 1BVSA 1BBWA 3MFGA 1ZETA 3KYHC 4P74A 1SMXA 4IUVA 2ATLA 2BCOA 2RGVA 2VA3A 2Z9HA 4MV6A 3NC0B 1IBLL 2A68C 1RJTA 3DM1A 4OWXB 1N33Q 3V6JA 4RG1A 4DR2Q 1LTLA 1SNOA 5FLXc 5KS8A 3A8IE 4GNXC 3AFPA 1YHAA 2YRWA 3Q8SB 1O7YA 5J2TF 3NP8A 5D3IB 2DAAA 4RCOA 4J8QA 3BABA 5KFLA 2DPJA 4A3KB 1KC8C 1CTMA 4AQYQ 5KFMA 3TS0A 1Y1VG 3UI2A 3RF2A 5IODA 1YEZA 2VB2X 2GQRA 2UUCH 3I3CA 4GC6A 2E5LH 4DR7Q 5EBDA 3H0GH 3H15A 1A6XA 1YBYA 2UVUA 2V4RA 5C4XB 4DV6Q 4WJWA 1PYWD 2ALZA 4TQUS 3TP6A 2IHFA 4LW1A 4RB2C 4JI8Q 1STHA 5I5WA 4O7LA 4ED0A 2WB1B 1O78A 4R4OA 4OX9L 1VQIA 1TS3A 5FNVF 5KFJA 3GTQB 3PR5B 4EBEA 4B3RH 5LMNL 2B8GA 4YHHQ 2Z1CA 4KI0A 2BQUA 4DR6Q 1ET0A 5ELFA 2KCCA 2KCNA 3V2TA 4WJ4A 1HRJA 1PZKD 2W9AA 3RLNA 1Q46A 2R93G 2GVAA 3PCOB 4A3LG 1B50A 3K5HA 3ORQA 5IYDH 1BUVT 2VXWA 3J7AK 1B6SA 2SNSA 3DM3A 4HJ7A 1QVFA 4TQRA 1H9JA 1TWHB 2FLLA 3PO3H 4GOPB 4XDXA 1FYCA 4CMDA 1KTAA 3EROA 4A3DB 3RBDA 3J80i 5CR5A 1KXLA 1QILA 4X3KA 3J80W 4F4YA 2AQ3B 4J9MA 5KYLA 4PZ7A 5JEAJ 3PIOA 3BA9A 3BYTB 2P5ZX 3BVMA 1A63A 1R4QB 4FS1A 1C9OA 4UP9A 4MIUA 1VQOA 4UHVA 3CRKC 4MAMA 2EZVA 4LF9Q 3T54A 3T4AC 1NBWA 1U0LA 3JSNA 2I46A 3EN2A 1K3RA 5CBAE 3M9OB 2F0GA 3FPPA 2DY8A 2BQRA 1EY6A 2BA1A 1GSAA 4QWEA 3U4VA 1HQRD 3HKZB 1STBA 2I5MX 3NEMA 4ULLA 3J7ZC 3N42B 3M4OH 4LAAA 4RU9A 4K0KQ 2QW7A 2L55A 4RGMA 5I60A 1K8MA 1EQQA 1Y1VB 2XIWA 1T36A 4JI1H 1VQ5A 3G8CA 2FMAA 1S03G 5A35A 1OXTA 1ILPA 2CH4A 2NVTB 2VUMA 4DV6L 4LSXA 2QYZA 3R5FA 2JEJA 4JI7H 3WNZA 5HNEA 4EQ5A 1N34L 3TW7A 4EEYA 2FPPB 1E0BA 1F2MA 3K6OA 4PWQA 1L2ZA 1EUDB 3J80E 3MXNB 3MHBA 2QCPX 3GIJA 3K57A 2PNRC 4ZUIA 4CJ0B 5JQWA 3TP5A 1PFMA 3S16H 1EIGA 2G9HD 1I4QA 2K5HA 3K5MA 2XWJB 1E4EB 5BR8H 4YHHH 4TSSA 2LY7A 2CW7A 4A75A 4DUYL 1C30A 4OX9Q 2HDLA 4MTDA 4XQNA 2F0HA 1TS5A 4BY1H 4DR4H 2B2YA 2MHVA 1A62A 4FDBA 1ZHSA 2VY3A 3GTJB 1E2WA 3HBLA 2NTSA 2COGA 1KDBA 2A8VA 5IP9H 1BCPF 1V1OA 3S1NH 2K05A 2AQ4A 1E4FT 2EOTA 5JJLA 1QJOA 4F50A 5I5XA 5JJKA 3DEOA 2HIXA 4DV1Q 4ME6A 3A0JA 5EKKA 5EPKA 3G8DA 3H0GG 3NK9A 3ND9A 2VA2A 3Q0AA 3S14H 2EJFC 4EGJA 2PZTA 2C00A 1I3QH 3NUAA 3R2IA 2FJ2A 5KT5A 2VUMG 3AQQA 4DNIA 1JE4A 3VYSA 1CHPD 2B2UA 1QB5D 2MO0A 5IT9E 1N36H 1DAAA 3NBHB 1KT8A 4J9NA 5EWGA 4LFCQ 5IGCA 1C7YA 1G291 3S9WA 3VPBA 3CXCA 3MAQA 3PW4A 4NZMA 1EIYB 3H4BA 2JA6A 1STAA 1XNQL 5C8YF 1NNXA 4F87A 1X9NA 4BY1G 3L3OC 1EQVA 4B3SQ 2ZGIA 2WKCA 3T9DA 2WB1G 1I1KA 5CMDA 2A6EC 4HYKA 3RLOA 5H80A 1STGA 5E1FA 3CCLA 3U0GA 2DUDA 4DV2Q 5C5MA 4UCOA 2MP1A 5IYCG 2NU7B 1I7NA 1GOZA 5IP7G 3JRXA 3CD6A 1YZ6A 2ASBA 1K9MC 3RMHA 4C3IB 1PHJA 1AW7A 1PMRA 5D3DA 4JI0H 5CR3A 4O3SA 1EZ6A 1OXVA 2YTVA 2ZTCA 5LL6S 1N33H 1F9PA 1PTOC 3E6ZX 4OO1G 3TN2A 4A3MH 2RDIA 1A3TA 3RB0A 5TSSA 5C4JH 3T9FA 2F3IA 2F3WA 4DU9A 1LT4D 1NAPA 1RD9D 1Y8PB 4IR1A 5T14A 2XNAC 1UEBA 1OBGA 1O7ZA 2Y0SE 3NWTA 3E0EA 2Z6KC 1N32Q 4DL3A 4TRDA 4X62H 1WR2A 1I94H 2X5RA 4DR3H 2Z6KA 1TWCB 1CK1A 1PH4A 1SRUA 4K8JA 3L4JA 5C3EB 5K36G 5M3MG 5JPNC 1TWHH 4ZCKA 1HZAA 1I1MA 5DLQE 4RAZA 1CQFA 4O2DA 3ETHA 4IR9A 3GV6A 1MSHA 2C35B 1SN8A 5C5LA 4YWKA 4A3GG 3VOTA 1KC7A 1HNWH 2R86A 3GTOA 4DF7A 1WCMA 4LF7L 2RBMA 3CU7A 2WFWA 3NELA 4A3BG 4PDBA 1YI2A 1XNQQ 3K7AH 2QKIC 3W1GA 4ECZA 1SSOA 4ED7A 2FK2A 1UNSA 4CDCC 1HR0W 3NBZB 3GO5A 4DNTB 3SR1A 3LWUA 4DAPA 4H0LC 2UXCL 1NUCA 1GSOA 1U4PA 2JSOA 5LMNW 2PPBC 3R93A 2E2HH 2F0PA 4K6NA 3PUWA 2KENA 3S2HH 2ZT9C 5KFFA 2L4NA 1FR3A 5KFZA 2B39A 4AQYL 1JOKA 4GLAC 2W9CA 5FLXL 4TVAB 2X69A 4R4IA 2A69D 4ZKCB 2VOBA 2ZXRA 4JI4H 3KLSA 3TINA 4ECXA 1KRSA 5JOBA 2HGSA 3TY8A 4XXEA 1RODA 2B63B 4YY3Q 2C9OA 3HB9A 4J6HA 5EKLA 1Z2PX 4R7RA 2RCNA 2VS1A 2JA7B 4POGA 4DL4A 3TQ1A 2DGYA 2JA5A 4JYAQ 1VQ6A 2RDFA 2PMZA 2Q2HA 5KFDA 4UDUC 2HHHH 3QFFA 1QZHA 1EU3A 1A2UA 1E2VA 3Q24A 4GC7A 1N48A 2RSNA 3TP7A 4UY8C 1WCMB 3AU7A 4IUQA 2UUCQ 4DLKA 4J9RA 3RZDH 2XGPA 4FF1A 2CW8A 3MZ5A 2OCEA 2E2DC 3K8AA 4JI8H 2V4QA 2UXDH 2GQSA 3D4RA 3DEPA 2EJMA 4L6TB 1QZGA 3GTLH 1SYXB 1KLUD 1B70B 2R7LA 4Y7NH 3CMAA 2R7FA 3S14B 4DR3Q 2KVMA 5C3EG 3GTGH 4HEDA 1WTHA 2NZOA 1ZEQX 1T5XD 4C3HH 4DR6H 1K3BC 1QE6A 5DEHA 2WAQB 3NHHA 1B2TA 4XQQA 1UEAB 2IT1A 3N44B 5IGDA 3W5OA 4RGNA 4FYDA 4HIMA 2W8LA 5DLFA 1YNJD 2KCMA 1QG7A 4ALPA 3FHWA 3J7YW 4HSPA 3NBYB 3RUZA 1MHWC 2VL6A 5BWVA 4OGQC 4ED8A 2F0WA 3PVXA 2OF1A 5JVLA 5BR8Q 4QL5A 5L1IA 3N6RA 4MTKA 4AYBA 1CKNA 3T9AA 2NVYA 4IRDA 4FO2A 1NTGA 4Q4DA 3R9RA 2L15A 5BYAA 2HGWA 4JV5L 4RCNA 1EY8A 2SOBA 3VA5A 4P72A 4DV3H 2M05A 3GTKH 2PQEA 3F8TA 4X64H 2R8KA 2HG8A 4ID6A 4DR2L 2ZDQA 3I90A 3VYTA 1K0RA 1ZYRC 4H13C 1TWCA 1FNUA 2F0DA 1X3PA 4C3IH 3HKSA 4KD4A 3N6XA 2K4KA 4CHTB 5CV8A 4IUUA 3F8NA 4IRKA 3HOZG 2CWAA 5KT2A 1F9RA 1CA6A 3GV3A 1GVPA 5J39A 1VQMA 4A3BH 4FF3A 5CV4A 1N9WA 1FKAH 4J9OA 4JW0A 3OOCA 1N36Q 1U4MA 5FLXE 2NBFA 1TY0A 1S40A 4DV2L 3CC2A 2R92B 3BYYB 3MTSA 3ZJYC 2XRQD 5M3FG 2ZM6H 3OTOL 2FINB 4PMCA 5EOYA 4O3QA 4LFAQ 2HCCA 1SMYC 4JUZA 4S3SA 1PH2A 4KLKA 1Z6HA 4V0BA 4EQPA 5C4HA 1ILQA 3W1BA 5DAUA 4LJZC 3R8BA 1XTCD 5J1ZA 4BBSB 4MV8A 4JI8L 3H4DA 3OHXC 4LF6H 2FMMA 2P0AA 1CFMA 3Q8DA 3J80c 4FFNA 1RHPA 2E2JH 4BXXH 4O2AF 5C3EH 3PW5A 3ETJA 2R7DA 4IFDG 2Q2UA 3VR5A 5C1PA 4DV4L 3DTGA 1HR0Q 3J80L 1J5EL 1FNWA 3OSOA 4O4HF 4JV5Q 4PNYA 5EBCA 4RGOS 2UVRA 1G91A 3CVZA 3KLWA 4JV1A 2O03A 5J3BA 2Q8IB 4FXDA 2D0PA 2O4XA 3CCEA 5DG8A 2CW0D 4DV1H 3NBIA 4O2BF 1JICA 4HAEA 4FP5D 2YS7A 1TWAH 3PFFA 4LF7Q 3HOYH 3WWJA 2DZDA 1A2TA 3SDZA 2DPIA 2F0FA 1AE3A 2JEBI 5KRUA 3J7A5 1X3GA 1JWSD 1FGUA 3CQZH 2QILA 1M0TA 2PVPA 1VQHA 3K5IA 4TV8F 4LFBQ 4LK1C 1PDQA 2W6PA 2R7ZB 1W3SA 3GQBA 3E9IA 2WV6D 4KJNA 1S5BD 5KFYA 4ODGA 4LF9L 3MXNA 3TS2A 3ERQA 3OW7A 2SCUB 2DJFC 4UCRA 4K14A 1Q86C 3HG9A 1HNZL 5EJWA 3ULPA 4ECUA 2VQEL 2CVRA 3MXGA 2B63H 1TR5A 1SCUB 1B6RA 3SI8A 2B2UC 2C2RA 1G51A 3HOXG 1BF4A 3IKJA 3PZPA 1B3QA 3K5OA 2NYZD 3QOJA 1PFSA 4O42A 5FK9C 2COIA 4LMYA 3AMUA 1I5FA 5KFCA 2O5JC 3L9AX 2JJQA 4FXGC 1I4PA 4GOPC 2NTTA 3PO2H 5FLXW 2BR0A 3VR4A 5FJ8H 1SR3A 3KALA 2W7PA 3FKIH 2AGOA 4IN3A 4A3MG 2R92G 1D2BA 4NXNL 1I94L 4CHIA 4MN3A 4ECRA 4BBSH 1K73C 2CKZB 2DNEA 1IW7C 1S4ZA 2KHSA 1RYRA 1PRTB 1S68A 2JA5G 1B04A 1QVGA 2Q2TA 2YCHA 1BNZA 2R7ZA 5F9NA 3TQYA 1DV2A 3GTPA 2NVQB 5KFEA 1JE5A 3M3YB 3L4KA 2AUKA 3D6CA 1AZQA 1PH3A 5FKAC 4X3TA 2Z0SA 3I4NG 1FJGH 1Q8KA 1EIHA 3HOWB 4YBZB 4EGQA 3RIZA 1E7ZA 4QWBA 1OXSC 3TQTA 2B2VA 1JCKB 2FK3A 3VA7A 1SYFA 3IN5A 3SHLA 4A4IA 1JWMD 3L0OA 2GVBA 4MNOA 5KFSA 1NSNS 4UPAA 1DYQA 1SAPA 2CQAA 4HIOA 4ECTA 4MZ9A 4CDDC 4RMFA 1XNQH 1ET9A 1Y14B 1J9OA 3GV7B 1HTPA 2A1HA 1F9SA 2OT2A 2OWOA 2K01A 3FVQA 4JI5Q 1CE8A 1SFOH 1NY4A 2EJGC 3U50C 3V4SA 2C2DA 3LX0A 3IFDA 1G8ZD 4L5RC 4ZAIA 1K8GA 2VPSA 1N8RC 3J7AV 2YRXA 2DNCA 3BA8A 5C0XJ 2JA7A 2R7ZG 4RNOA 1XMQL 3QIAA 2AUJD 2K5QA 5I2YA 4KV6A 2F0VA 4G7OC 5KG6A 5E4WC 5CV9A 4R8IA 1R4PB 1SNPA 3MXPA 4RHSA 1EYZA 3TMEA 3VYUA 4XYMB 4BY7G 2PYKA 2PBZA 4I65A 1E1TA 2NZHA 3VMMA 1GO3E 4P2CB 4E4TA 4PG3A 1MGSA 1QOHA 4JOIA 3CCJA 1YJ9A 4FF4A 1TVXA 4KY5A 2L11A 1KL9A 1Y1WB 1W2BA 4NXML 3BDLA 1YITA 3MWYW 2RHSB 1BDOA 1S72A 3MR3A 4RKBA 1SJED 2DIKA 3WWVA 2ALYB 5CYUA 4YHHL 3C46A 3BJYA 3ORRA 2EXZA 3J81i 1Q81C 2UXDQ 2VQFQ 1LACA 2J6TA 5DQHA 4TKOB 3GIPA 2HDMA 4KJOA 2EY1A 1HUMA 1VQGA 3QB3A 2QB5A 3FMAA 4IPCA 1CM9A 3EBEA 5J22A 2CH4W 3T7AA 4UCSA 2COJA 3E5SA 4LF8L 1ML0D 2EYPA 3RFCA 3BJUA 5JEAG 4MV9A 4DV6H 4RGTA 2W9CB 4DK3C 4EG0A 4FU0A 5DG7A 4DL2A 2D0OA 2R85A 2YYZA 5G3LD 4C3JH 3QJYA 5T1GA 2UUAL 1IYUA 1JT8A 3CCSA 1LT3D 3P20A 2BDOA 4AH6A 2AQ2B 1GD7A 1WJJA 4JOIC 1II3A 3VR6A 2LXKA 1X65A 3JAMc 4O4JF 5FLMG 4JI6H 1M6VA 5JVDF 3Q8RB 2ASJA 5IGFA 2VQFL 1LTID 4QW8A 4ETSA 1E1OA 4O86A 3H0GA 2VQEH 1HQMC 1MD2D 4B9WA 4O81A 4ZYSA 2V4DA 1UE1A 3UDXA 1IBLQ 1Z9FA 3A8JE 2JK8A 2UUBH 3S24A 1VBHA 4R8UB 3DHQA 2NVXA 5EGTA 1U9RA 3V96A 4A3EB 3S1MB 2WIIB 3ITPA 4DNRB 1AUVA 2CHBD 5KT4A 1I4RA 2A6ED 1PTOB 1LO5D 4H44C 1B8AA 3H40A 1PYBA 1F9QA 4R9WA 4Q0YA 2M00A 3NTHA 1HNWQ 1PRTC 1KBLA 2QDLA 1FNVA 3J81j 2YTYA 4M1UB 1CZGA 1A3UA 3F1ZA 4Q45A 1O80A 3GIKA 3KUPA 4C1NI 2OQ0A 4DXFA 3UFXB 4KHPL 3P7JA 1PTOD 4JPBW 1Y1WH 5HBRB 1MBYA 4OL7A 4A3EG 2GN5A 1CI3M 1FVIA 3RNUA 5E7NA 3ONAB 1Q7YC 1TWGB 1EZ8A 1H9RA 1KQSA 2YZNA 1JIHA 4EQOA 4UFZA 1UE7A 1WSCA 2ZXOA 1JKJB 2JA6B 4QY7A 2O2LD 5DM63 1RF2D 3M7GA 2NWGA 3JRWA 4ZOLF 1M4VA 1EWCA 4ED3A 5FR9A 2LSSA 3OIPA 1JR0D 1WYDA 4IRCA 1KLGD 1EYGA 3RB4A 3QZ7A 1C0AA 1AFPA 3LWEA 4IFDH 1Y8OB 3K59A 5CGKA 1JDBB 2MGSA 1CUKA 1IBMH 2RA4A 1WTOA 1FD7D 1SNCA 3HOWH 1NMFA 4GLWA 3G4SA 5C3XA 4A3FB 4A3IH 2CCZA 2JA9A 2NU8B 1X3QA 2HHFA 2V1CC 2EE1A 3K80C 4JBKA 2R93A 3URYA 2R8GA 5D14A 3OSPA 2EIFA 1KUTA 3SK8A 3BVGA 4DV0L 5HGQA 5M3FH 1E2ZA 1YNJC 4B3TH 3SE0A 3HOXH 3VDYA 3KJPA 2ZJRA 4R4QA 3T5JA 1V4YA 2VQEQ 1KJJA 4RB0A 1I3QB 4JG2A 3GTMA 3U4ZA 1IBLH 4QUFA 3GTQA 1ICWA 3PMFA 3L7ZC 1DOMA 2K04A 5L1LA 4DV7H 1KJ8A 2OTLA 2H5XA 2PI2A 4DK0A 4K5WA 2CFMA 3M4PA 1MKHA 3ZYYX 1A9XA 1EUJA 1LABA 4OWTB 3R5XA 5G3LF 4LH6A 4TVIA 2HCIA 3ICEA 2LMCB 5LL6b 4EFEA 1E3PA 3X3MA 3CCVA 1X6OA 1DIKA 1E22A 1JDEA 4QW9A 3J81W 3PF4A 1B9MA 3RAQA 3HOVB 3I4OA 1HA5A 4K5XA 3IAYA 3PUZA 1L0XB 5CE8A 1Y1VH 2ENBA 3CP0A 3WO0A 1SYBA 4Q5VA 2MFIA 4CGYB 2MCTA 2JE6I 3K0YA 4JI5L 4LMQD 2XWBB 2YU9A 4LF5H 2ZTDA 4WBNF 1HZ9A 5T1IA 2EVBA 4I50F 4Q8EA 3JAMi 3HZXA 4A3CH 4A93B 3DUZA 2HIVA 3P1HA 4DUZQ 4YAKB 2NVYB 1D5XC 4KKTA 2OEOA 4UCVA 2XTIA 4P73A 1SBBB 5KG1A 2EY5A 2UXDL 5BWXA 5CV5A 4LSAA 4JV2A 1IBMQ 4LF4L 1LYLA 1CQIB 3BQ0A 3PW7A 1PLFA 4GN5A 4G7ZC 1IL2A 3HOWG 1G6PA 4JI0Q 3T16A 4O7SA 3CCMA 4EFBA 1PH7A 2XCAA 5EQ0A 1FJGQ 5KFTA 4DR7H 3QWUA 1H95A 1K83H 4AIMA 2EJ0A 3S16B 1HR0L 4YY3L 2YZGA 5M3FB 2NN6I 3KF6B 4DXGA 4LFAH 1KD1C 1F2LA 3NE5B 5ELDA 2VW9A 1BQQT 1PRTD 5BWUA 4ABNA 1KAWA 3U9SA 1ZYRD 2NN6H 1C8CA 4BWSC 5M3MB 4DIMA 4Q44A 1EY4A 3SK6A 3HRZC 2C5CA 3C0FB 4HNUA 3FP9A 3HGBA 2VUMB 1W93A 3MWMA 3GD7A 3S1MH 4P71A 1B4OA 3S2HB 4TV9F 1R9TA 2UXCH 5IWAQ 5KGUA 4FNFA 3CC7A 1VQ9A 4B3MQ 1GUOA 4GS3A 1KABA 2B2YC 2AWNA 5BMVF 2K52A 1F2ZA 1V43A 1VMPA 3A8KE 5KFGA 2E2IH 3LNNA 2B8FA 2JA6G 3JAMW 4JCVE 1GHKA 1EYCA 4LF7H 4DL5A 2F3VA 1HNWL 3DLLA 3T1YL 2YZLA 5IIFA 3HO8A 2CWPA 1M8AA 2I5LX 3UQ8A 1VQKA 3J7AF 2HVSA 2DWCA 1I50B 4O7YA 1VQEA 2CNUA 2NUAB 4RB1A 4QIWE 2W7OA 3RZDB 5D65A 5KFBA 1RK5A 1EEFD 1B53A 5EPLA 4I4TF 3N41B 1PX2A 3BQ1A 2PO4A 1V1QA 5CA1F 1JMCA 5KFQA 1XMOH 1N56A 1CKNB 3FEWX 3T99A 4JYAH 1XNRL 3CQZA 2WACA 4X3SA 1L1OA 3GTLB 1IBKL 5KFIA 2HD3A 3C1FA 5C0XI 1RTNA 5GAGC 1YJNA 4MV1A 2Q8TA 1N33L 3WOFA 4Y52H 4KD3A 4QSHA 5ISRA 5C44H 4CC5A 1K83B 3EVQA 3PUVA 2F0EA 1K8OA 2XGQA 1VCIA 2K14A 3TIIA 3A7LA 1STNA 4POFA 4A3DG 1I6UA 2R92A 1TT2A 1VF5C 2N49A 4XQJA 2A5HA 2F0LA 2W6ZA 3T1HQ 2NZ1D 3NQIA 1XMQQ 4UCTA 1RIPA 1IYEA 4R4CA 5KFVA 1YNNC 4C3HB 4X66L 3F2DA 2GLTA 3T5LA 4Q8FA 2Z04A 2W57A 4OHJA 4HNTA 4IWXA 2R8HA 5M5WH 3MXUA 2JYOA 4O7VA 4IAJA 4IJLA 1VQFA 1EEID 2L0CA 3DF7A 4GKKH 2UXBL 4JV0A 3M9MB 4J9LA 3IG0A 4HN7A 1N36L 4QJFA 5AJ3Q 3I55A 2E2HB 1TWFA 4DR5L 1S0MA 3LGJA 3KAKA 1S10A 1ULZA 1HPCA 5JEAH 4JI3Q 2E2IB 1ZHQA 3H94A 4BWGB 3S1RB 2Y0SG 4TM5A 1N32H 4DK1A 4DR5H 1ICFB 3KF6A 1MJEA 1I6HB 4KHZA 1IYDA 5BYBA 2UU9H 3SEBA 3KK7A 2F0TA 4GKKL 1I50H 1OTCA 5KT3A 1U4RA 1WTQA 3ER0A 3U9TA 4A2BA 1IW7D 1XPOA 2HGXA 4A3GH 4HJ8A 4ECQA 4GNXB 4LFCH 4A2AA 1M7JA 4K6DA 5A2QL 1EY0A 3GTPB 2I8CA 2Y0SB 2NVYH 2WB1E 1TY2A 1VBGA 1Q1EA 1VKZA 3HOUB 3T9CA 2DY7A 5KFOA 2YTXA 1ENCA 5EDWA 4L8JA 4TUYF 4J1MA 5BN5A 4IZ8A 1XNRQ 3K3PA 5C5JA 1KDCA 1LT6D 4PV1C 4QQBX 4NPSA 4ZKBB 3KDFA 4LWCA 5C44B 2F0IA 2Q8RE 3CC4A 3TY5A 5KFRA 4A3KG 5M3MH 2W8KA 3RTXA 4HSVA 2ZM6Q 1AZPA 1G2TA 2ICIA 2WAQG 1Z2NX 2RCFA 5LMUH 2WDTA 4NDXA 4U68A 4FM9A 4OXPA 2CZGA 3GDEA 3OWFA 1YHBA 2A6HD 3FRPB 4DAYA 5IOCA 2RHQB 1WTPA 5IYBG 2UVWA 1DXMA 3D6WA 2UU9L 3M4IA 4RAYA 2KBNA 1VS0A 3TZUA 1JLLB 3S2DB 1WOCA 4KTAA 4ED1A 4K0KH 2L1BA 2ABJA 3S15B 2M9VA 5L9XA 3PSIA 1WVLA 3I2ZA 3AW8A 1CZWA 2KJXA 2Z4HA 3F2CA 4JI1Q 4RNMA 1GUGA 2VPQA 1SDFA 1D8LA 1YHQA 2ES2A 3I4MG 5DGAA 5IY0A 4DV7Q 4FFPA 4FE2A 1B1ZA 4N9TA 1JXLA 2UXBH 5KFHA 1B44D 4PMWA 3OIQA 2PCFB 3NENA 2ODTX 5CA0F 5ELCA 3PW2A 2IP4A 3AFQA 1A15A 3I4NH 4YJ3F 2KA7A 3BDCA 2LXJA 4RNNA 4C2MH 2L12A 4X66H 4J9KA 4U7CA 4PBCA 2UU9Q 2IPKD 5KNCA 3G6VA 1RCVD 3H6MA 3A5UA 1I4HA 3OPOA 3GTOB 3PO2G 1E4GT 3R5HA 4XYQA 3U55A 4RB3C 4EYIB 3HOZH 1WI5A 4X65Q 3TW6A 1A0IA 1EL0A 1S97A 1A48A 5J2UF 3HOUH 3M9BA 1IOVA 2R82A 4MTNA 3G71A 5IT9c 1CT1D 2NB0A 5LMNH 4A93G 4B3RL 3RUPA 3MFIA 3HS0C 2JEAI 1TU2B 4YY3H 1U5KA 1VQJA 4U673 3LWBA 1YNND 1XNRH 1PH8A 3RJ0A 2EDGA 3CAMA 4DV3Q 4P75A 3CF5A 2ZTEA 4CKEA 1Y8NB 4GOPA 2XCLA 5KX5F 4C1NK 1GM5A 1VF7A 2B29A 1WTWA 3FDSA 4EBCA 1GXDC 4QIWA 4LF4H 1SYDA 4BXXG 4IOAA 3NTIA 4YB8B 1AN7A 4OIJA 2OTJA 3BQ2A 4YWLA 1WCMG 1ENFA 2YU9B 4GN3B 3SGIA 5H1SE 1ZQ7A 1X54A 3MFYA 1JJ2A 3DWPA 4DK6C 1SE4A 5IWAL 3RD4A 4BBRB 2NVXB 4XYOA 2R6GA 3T1HL 4A3CG 2Y0SA 1EFWA 2IW3A 4YQWA 1ONLA 3NTKA 4IFDI 1D1KA 1LTBD 2NUCA 3FPUB 4I55F 1X3EA 2UUAQ 3CPWA 5LL6X 2BE5C 3K5LA 1IZ6A 3TZDA 5DM73 4HIDA 2CNVA 2I87A 5M9OA 5E25A 3SE7A 3G6YA 3I4NB 2IBKA 1T3NA 2K7VA 2F4VL 4DAMA 5I5YA 3T9BA 3I73A 3GTJA 2K50A 5CBEE 4M0JA 2IL8A 3GTPH 5I2XA 3TREA 5ELBA 3K58A 3B6YA 5KFAA 1SROA 1PVOA 4XTCS 4KY6A 1I6HH 4DAYB 3RB6A 1NE3A 4NLGA 4CDEC 1RJPA 1O7LA 2R8IA 1EY7A 2RVLA 4NP5A 3W2DA 4ZQ3A 5C6AA 3A56A 1HR0H 2XC9A 4ME5A 4IZOA 3PO2B 4X65H 4X64Q 2WB1A 2R93B 2A74C 3CSWA 3KF8A 4R8UA 2K1BA 5DGBA 4ED6A 4Q43A 3SXHA 2EYHA 1HFNA 3BACA 4DUYQ 2FP4B 2E74C 4DV0H 4L5QA 5BWRA 4PZ8A 2UVVA 5D8DA 3BU2A 1PFBA 4DUZL 5L1JA 2F4IA 5HV6A 4DR5Q 2PZWA 5GAEC 3HXLA 1Q1BA 4ECYA 2D5DA 4I7HA 3QZ8A 3BG5A 2EYJA 3KOJA 4CKBA 3CMEA 4CMFA 5C0XG 1AE2A 1C4QA 4LFBH 1H9MA 5I9PA 3I56A 3CEBA 2JN4A 4PZ6A 2NVTH 5C4XG 4GKJQ 1IBML 4LF4Q 1IKMA 4X6AH 3CKIB 1NCVA 5FPRA 2IMWP 4LF5L 2ICEC 3GB8B 1RL2A 1PH1A 2B63G 2ASLA 2QGQA 5KG3A 3RBEA 3T13A 4BBRG 3C2PA 2BH8A 1NMGA 2FB9A 2DN8A 2IJ0A 4KY7A 1HUNA 1Y1VA 4F88A 1QCBD 4G4KA 3HOUG 1DV1A 3OUZA 4RWSC 1F2YA 4HJ5A 5FPOA 4C3HG 3KXYT 3KF8B 3RGZA 4G3IA 1W6JA 4IPDA 4IWYA 3CW2C 2PNHA 2BDNA 5LMUQ 4GNXA 1HNXL 1GYFA 2LKVA 4C3JB 5F2DA 4JC0A 4N8FA 3KHGA 4KHPH 3JAME 2KUMA 4NZOA 3WWIA 4KHVA 4DR1L 1S9FA 1E24A 1OO9B 5BN4A 3HOZB 4HTHA 2R84A 2FPGB 3Q2OA 4DV7L 3I12A 3HKZE 2C22A 4J9PA 2JA5H 3A54A 3OUUA 1D7QA 4C2MB 1PV4A 1GGOA 3MWEA 4K8IA 3PV0A 1BOSA 5C3WA 1S0OA 1VQLA 1K0SA 4ECWA 4EVOA 5I5UA 4B3TL 2W71A 4F7XA 1I4GA 4CDFC 1DOLA 2EYLA 2HQEA 5JPMC 5DLGA 3VNNA 1J5EQ 2UUBQ 3WDNA 1I3QA 5JUMA 2FLNA 4C5AA 4QF4A 3RAXA 1DONA 3PIPA 1LTTD 2O5IC 4NKLA 2HHFB 1LV9A 1SNDA 1E4EA 1EYDA 4BS9A 3EFXD 1CQJB 4CJ1B 5I6WA 4C5BA 1SMYD 4DV0Q 2V9WA 4MA5A 4E6IA 1EOVA 1TWFB 1BR9A 2XRSD 1IBKQ 1C3OA 3OMGA 1KJQA 3I72A 2SEBD 3M9NB 4LUZA 4Y7NB 1EY9A 1A3GA 2X6GA 1BO0A 3PN1A 3MR6A 2VNUD 4TQSA 3E0JA 3QO2A 2NVXH 4IUPA 3H91A 5FOBB 4LF8H 1TWGH 1KIXA 5DQGA 4HR7B 5ELOA 1L2FA 4HMJA 4JBJA 2B2WA 4A3FH 5CB4F 2KHIA 3KLSX 5IT9L 3RN5A 2R8JA 2N55A 4A3MB 5JQGF 2CW0C 2EYFA 4ZUJA 1KEEA 1V1PA 2VUGA 2XGTA 3UE1A 4BBRH 4Z9CB 4DA2A 3MFHA 2G9DA 4O3NA
chains in the Genus database with same CATH topology
1X3FA 2UXDL 4DPGA 4EEQA 1VQ4A 4LSAA 2Q2HA 4A3JH 1K8AC 1IBMQ 1HZCA 4LF4L 4M7EA 1LYLA 1QZHA 2HHHH 2MQHA 1TXYA 4GN5A 3HOWG 1IL2A 1TWCH 4A3FG 1JB7A 4KHPQ 4JI0Q 1G6PA 4QGUA 3CCMA 1VQ7A 3GTMH 4UY8C 4EFBA 1PH7A 2UUCQ 3RLFA 1FJGQ 4LUVA 3RZDH 4DR7H 3QWUA 3D0FA 2CW8A 2UUBL 1H95A 2OCEA 1K83H 3CPFA 4NB3A 4OONA 4AIMA 3CCUA 4YY3L 1XJVA 1HR0L 3K8AA 2NN6I 3KF6B 4LFAH 4JI8H 1KD1C 1P16A 2UXDH 4B3TQ 1TWFH 4DR4L 3ULJA 5JJIA 2VQFH 2VW9A 4B3TH 2N8NA 2WE6A 3EIVA 1QZGA 4JI6L 4DV5Q 2F4VQ 1I94Q 4B3SL 3GTLH 1B70B 1SYXB 5BR8L 1XMQH 4Y7NH 3G6EA 3CMAA 1KAWA 2R7FA 2KSWA 4DR3Q 5C3EG 3GTGH 3F2BA 1M0WA 4BWSC 2NZOA 4C3HH 4DR6H 5FD5A 3C0FB 4APMA 2UUAH 3AEVA 3FP9A 5IYDG 2IT1A 2R92H 3N44B 1XDNA 3W5OA 3MWMA 3GD7A 4HIMA 3S1MH 2R93H 2KCMA 1VQBA 4P71A 4ALPA 3S1QH 2PQAA 3FHWA 1MIUA 4GKKQ 1XPRA 2JQOA 3NBYB 2VL6A 4H02A 4GLXA 5IWAQ 4JI7L 1UE6A 2B63H 4IFDJ 1IBKH 2UXCH 3CC7A 1VQ9A 4B3MQ 4GS3A 2K5VA 5IE8A 1VQPA 2AWNA 4A93H 4JYAL 4JI2Q 2K52A 1V43A 4QL5A 4JI1L 5BR8Q 3JC66 3HOVH 2AWOA 1CKNA 1CKMA 1XMOL 2E2IH 4OO1I 2JA6G 1J6QA 3M3YH 3JAMW 3MEFA 1NTGA 4JCVE 3GTQH 4LF7H 3EYYA 1N34Q 1HNWL 1MZBA 2L15A 3DLLA 3T1YL 1SLJA 3J81c 4JV5L 1FJGL 2CWPA 3UDIA 2UUCL 4P72A 3HOVG 2CQOA 4DV3H 2I5LX 3UQ8A 2EQSA 3F8TA 5GAHC 1VQKA 3PUYA 2HT1A 3GTKH 4X64H 1O7IA 4DR2L 2HVSA 3OW2A 1VQEA 3RZOH 4E6NA 1K0RA 4RB1A 1BBUA 1WCMH 1WH2A 3K3VA 4QIWE 3T1YH 4NXMH 4C3IH 1VQ8A 4JI4Q 3HKSA 3N6XA 1QVCA 2K4KA 2PI2E 3N41B 1LM0A 2QEXA 1V1QA 1YIJA 1JMCA 3F8NA 4IO9A 1XMOH 3HOZG 3S1RH 2CWAA 4A3DH 4A3BH 1CKNB 1GVPA 1VQMA 1Z47A 2MNAA 4JYAH 1XNRL 1VQAA 1TAEA 4JI3L 4NXNH 1L1OA 1IBKL 1KHIA 2AHOB 1N9WA 1OXUA 2HHHQ 1FKAH 5ELNA 5GQOA 3LMLA 4MV7A 1HH2P 3CCRA 5C0XI 3N43B 1N36Q 4GKJH 5GAGC 1YJNA 2R7ZH 1S40A 4DV2L 3CC2A 1VQLA 3AYHB 2MO1A 1N33L 4Y52H 4DV2H 4JI7Q 5C44H 2QA4A 4CC5A 2E5LH 3PUVA 4GLVB 4MTEA 4R4TA 1VCIA 3ZJYC 5M3FG 2ZM6H 2K14A 4A3DG 4POFA 1I6UA 3OTOL 5EOYA 4LFAQ 4HJAA 3OYYA 2N49A 1PH2A 4B3SH 4KLKA 3T1HQ 3W1BA 4JBMA 4DV5H 1XMQQ 4ME3A 1OXXK 4UCTA 1RIPA 1L1OB 4JI8L 4IOCA 1HNZH 4R4CA 4LFAL 4LF6H 4APVA 4XIGS 4X66L 3F2DA 1M90C 3Q8DA 3J80c 2W57A 2RF4A 1S3OA 2E2JH 5M5WH 2FE3A 4OX9H 1PH5A 4O0AA 4BXXH 4DR7L 4IAJA 5C3EH 4IJLA 2R7DA 4DR1Q 2Q2UA 4IFDG 1GKHA 1VQFA 4EX5A 4A3KH 4DV4L 1HR0Q 3DF7A 2EXDA 1PH6A 1VQNA 2UXBL 4GKKH 1J5EL 3IG0A 2N3SA 5IP9G 4JV5Q 1N36L 4QJFA 5AJ3Q 3I55A 1TA8A 1L0WA 2E5LL 4CC6A 4DR5L 3KLWA 3CVZA 4B3MH 2UXBQ 3LGJA 4HIKA 4BY7H 3G48A 3KAKA 2O03A 5J3BA 1X55A 4DV4Q 2D0PA 2BH2A 3CCEA 2XIGA 3STBD 3UDFA 5GADC 4JI3Q 2I0QA 5D1OB 1YVCA 4J15A 3PUXA 1ZHQA 3KFUA 4DV1L 3STBC 4LF4H 4L5SA 2BA0A 1TWAH 2Y0SG 3BZKA 3M4QA 4JBWA 1N32H 4LF7Q 3HOYH 4B3ML 4DR5H 1SEIA 2NVQH 2N78A 3KF6A 4B3RQ 1AE3A 2ID0A 2JEBI 4IPHA 4KHZA 1X3GA 1VQCA 3U58A 1MJEA 3J7A5 4BBSG 5DISC 1J5EH 2UU9H 1FGUA 1Q12A 3CQZH 4GKKL 5C4XG 1VQHA 1JJGA 1I50H 4LFBQ 3K81C 1OTCA 1M0TA 4OWWB 5HY6A 4JI5H 3ER0A 1R9TH 1W3SA 5C4XH 1XPOA 3E9IA 4A2BA 3T1YQ 4A3GH 3BAAA 4HJ8A 4LF9L 3TS2A 5FJ8G 4GNXB 4LFCH 1QUQA 4A2AA 4UCRA 2IX1A 4L5TA 1Q86C 1XMOQ 1HNZL 3ULPA 4DRFA 2F52A 3HOYG 5M5XH 3FKIG 2VQEL 2NVYH 1XTDA 2A1AA 2IHEA 2WB1E 1CKOA 5M5YH 1Q1EA 4DV5L 2ATWA 2B3GA 1B7YB 1G51A 3RR5A 3HOXG 2YTXA 4DKAC 3OTOH 1PFSA 4LMYA 2Q2IA 1I5FA 2ZM6L 5IT9W 1XNRQ 3TY9A 2JJQA 5A2QW 4LF8Q 3D31A 4GOPC 3PO2H 2WYOA 4QQBX 4NPSA 1BVSA 5FLXW 2KHJA 1BBWA 3KDFA 4LWCA 1SR3A 5FJ8H 3CC4A 3TY5A 3KALA 4A3KG 5M3MH 3A5ZB 3KYHC 4P74A 1SMXA 3RTXA 2RGVA 3ULLA 2ZM6Q 4LF9H 3FKIH 2WAQG 3NC0B 1Z2NX 5LMUH 1IBLL 2VUMH 4A3MG 2WDTA 5IP7H 4FM9A 4OXPA 2R92G 3GDEA 4NXNL 4OWXB 1EQRA 1YHBA 4UP7A 4RG1A 4DR2Q 1LTLA 1I94L 1N33Q 1EIFA 5FLXc 3M7NA 4BBSH 1K73C 2CKZB 2RHQB 3AFPA 4GNXC 1YHAA 2OQKA 5IYBG 4DV1H 2UU9L 3M4IA 4RAYA 2KBNA 1VS0A 1S68A 1WOCA 2ZJTA 4K0KH 2JA5G 4YCUA 1QVGA 1KRTA 2Q2TA 1B04A 2YCHA 4BA1I 3PSIA 3TQYA 1A8VA 3I2ZA 3BABA 4A76A 4DR1H 1JE5A 3F2CA 4AQYQ 4JI1Q 3TS0A 1Y1VG 1KC8C 2HVQA 3RF2A 3L4KA 2AKWB 1YEZA 1D8LA 2PQAB 1YHQA 1PH3A 2ES2A 3I4MG 1HNXH 4DV3L 5IY0A 2Z0SA 4DV7Q 2VPSA 3I4NG 4DR7Q 5BR8H 3H0GH 1Q8KA 3H15A 4YHHH 1FJGH 1YBYA 4JV5H 4DV6Q 3RIZA 4LUOA 1E7ZA 2UXBH 1OXSC 4TQUS 4PMWA 2IHFA 3NENA 4LW1A 4RB2C 4DV4H 4JI8Q 1XK5A 3AFQA 3I4NH 4A4IA 3L0OA 4R4OA 4OX9L 1VQIA 2LXJA 2GVBA 4MNOA 4C2MH 5FLMH 3E9HA 4X66H 4UPAA 4BA2I 4HIOA 3BZCA 4B3RH 5LMNL 2UU9Q 4MZ9A 4LF6L 4YHHQ 4KI0A 4RMFA 1XNQH 1ASZA 1Y14B 4DR6Q 4JI6Q 4JI2L 4WJ4A 3A5UA 3PO2G 2OWOA 3RLNA 4JI5Q 1SFOH 1E4GT 1Q46A 1Q82C 2R93G 2GVAA 1NY4A 3PCOB 4A3LG 3U50C 4RB3C 3M85A 5IYDH 3HOZH 3J7AK 3GTJH 1CSPA 3DM3A 1WI5A 4HJ7A 4X65Q 1K8GA 1EWIA 1N8RC 4L5RC 1QVFA 1A0IA 5C0XJ 4LFBL 3PO3H 2R7ZG 2UXCQ 3BA8A 4GOPB 1XMQL 4LF5Q 4LH7A 2JA8G 1BGWA 3HOUH 1O75A 3M9BA 4MTNA 4JI2H 3G71A 3J80i 5IT9c 1XNRH 4DUZH 1KXLA 5LMNH 4A93G 4B3RL 3J80W 3OTOQ 2JEAI 4YY3H 1U5KA 1VQJA 4BY7G 4PZ7A 5JEAJ 3PIOA 3L2PA 1PH8A 3RJ0A 1E1TA 2NZHA 3BA9A 2JA7G 3CAMA 4DV3Q 1GO3E 4P75A 2ZTEA 3CF5A 4GOPA 1A63A 1C9OA 4PG3A 4UP9A 4JOIA 1VQOA 3CCJA 1YJ9A 1GM5A 4X65L 4LF9Q 1KL9A 1NBWA 1HJPA 1U0LA 2B29A 4A3EH 1W2BA 3EN2A 1CSQA 4NXML 1K3RA 3JSNA 4BXXG 2K5NA 1YITA 4IOAA 2RHSB 4WJ3M 1AN7A 1S72A 4R1JA 2OTJA 4DR2H 4YWLA 4YCVA 1WCMG 4X64L 2BA1A 3U4VA 4GN3B 1T9HA 3WWVA 3H3VH 2ALYB 2I5MX 3SGIA 5H1SE 4YHHL 1AH9A 3NEMA 3J7ZC 3S2DH 1X54A 3N42B 3M4OH 1MJCA 3S15H 5D1OA 1JJ2A 3S17H 4HJ9A 4DK6C 3J81i 3ERSX 1Q81C 4NXNQ 4K0KQ 2UXDQ 2VQFQ 5IWAL 1UE5A 1EQQA 1ASYA 2R6GA 3T1HL 4A3CG 1X56A 2F4VH 1EFWA 4AQYH 4JI1H 2FXQA 1VQGA 1VQ5A 4IFDI 3FMAA 4IPCA 2VZAA 1OXTA 3A74A 1Y1WG 1S03G 3EBEA 4DV6L 4UCSA 4LSXA 1M1KC 4A3LH 1X3EA 4LF8L 2UUAQ 3CPWA 4JI7H 3BJUA 5JEAG 4MV9A 4EQ5A 1N34L 1IZ6A 4DV6H 4DK3C 4HIDA 1DGSA 4A3JG 2D0OA 2YYZA 1L2ZA 4GN4B 4C3JH 3MXNB 2F4VL 4DAMA 2PMZE 3T1HH 2UUAL 1JT8A 5IWAH 3S16H 3CCSA 2K50A 2JA7H 4DR6L 4LF6Q 4AH6A 2K5HA 3GTPH 3KAJA 1HNZQ 3TREA 1GD7A 3B6YA 1VQDA 1WJJA 1SROA 2HQLA 4JOIC 2LXKA 1X65A 3JAMc 1PVOA 2CW7A 4XTCS 5FLMG 4DUYL 4A75A 4OX9Q 3GTOH 1I6HH 4DAYB 4MTDA 4JI6H 1NE3A 2VQFL 4X62Q 4BY1H 4ETSA 5D1PA 1E1OA 2VQEH 4DR4H 1A62A 4FDBA 4J0MA 1ZHSA 2VY3A 1HR0H 1UE1A 2K75A 3UDXA 1Z9FA 1IBLQ 2JK8A 2A8VA 2UUBH 3S24A 4X65H 5IP9H 3JSLA 4X64Q 4DR3L 3S1NH 3N40P 1E4FT 4RZQA 2JA8H 5JJLA 2IY5B 5JJKA 1XPUA 2HIXA 1B8AA 4DV1Q 4DUYQ 1PYBA 3A0JA 2YU9H 2HHHL 4DV0H 4L5QA 3H0GG 4Q0YA 4PZ8A 3H3VI 1HNWQ 3BU2A 4DUZL 3GJXB 3S14H 3HXLA 4DR5Q 5GAEC 1Q1BA 3KJOA 3J81j 2YTYA 3IRBA 4I7HA 1I3QH 3F1ZA 3KOJA 1P8LA 3CMEA 5IYBH 5C0XG 1AE2A 2OQ0A 3AQQA 2VUMG 1WFQA 4KHPL 4LFBH 4YWMA 3I56A 4DNIA 1Y1WH 2WAQE 4A3EG 4JI4L 3H20A 4PZ6A 2GN5A 2MO0A 3UDGA 1YJWA 1IBML 2ZJQA 4LF4Q 2NVTH 3NBHB 4GKJQ 4X6AH 5FPRA 1N36H 1FVIA 4LF5L 3RNUA 5E7NA 4LFCQ 5IYCH 4UP8A 1Q7YC 1G291 1C7YA 3HKZG 3CXCA 1RL2A 3GB8B 1PH1A 3K0XA 3UE0A 1PH9A 1EIYB 2B63G 1Z2OX 1XNQL 1KQSA 3RGXA 2QGQA 1X9NA 4UFZA 1UE7A 3RN2A 1LUZA 2E8GA 4BY1G 4BBRG 4B3SQ 2YV5A 4QY7A 2HVRA 2BH8A 1NMGA 4JYAQ 2LSSA 2WB1G 5EAYA 1JJCB 1WYDA 3HOUG 1EYGA 3RLOA 3CCLA 1C0AA 2DUDA 5GROA 4DV2Q 4HJ5A 5FPOA 4UCOA 5IYCG 3KF8B 3KXYT 1CUKA 3RGZA 1IBMH 5IP7G 3CD6A 1YZ6A 4IPDA 2ASBA 1K9MC 2PNHA 3CW2C 5LMUQ 1IXRA 4GNXA 1PHJA 1NMFA 1HNXL 3HOWH 3G4SA 4JC0A 4JI0H 4KHPH 1GYFA 1PYSB 1OXVA 2YTVA 1IYJB 2ZTCA 4A3IH 4DR1L 2CCZA 1UWVA 2AMCB 2JA9A 1N33H 1E24A 4OO1G 4GKJL 2V1CC 3K80C 4A3MH 4JBKA 4DV7L 3HKZE 4IPGA 5C4JH 4UCUA 2F3IA 2JA5H 4K0KL 1QUQB 2EIFA 1D7QA 2I5HA 1PV4A 4DV0L 5HGQA 2KCTA 1UEBA 3PV0A 5M3FH 3PF5A 2A19A 1L1OC 4X62L 2IX0A 3HOXH 2Y0SE 3VDYA 3E0EA 3KJPA 4R4QA 2ZJRA 2Z6KC 4LNQA 1N32Q 4B3TL 3I4MH 2VQEQ 4DR4Q 4X62H 1I94H 4RB0A 4JG2A 3HFZB 4DR3H 2Z6KA 3U4ZA 1IBLH 1NJIC 5LMUL 1PH4A 1HNXQ 1SRUA 1J5EQ 2UUBQ 3VNNA 3L4JA 2E5LQ 4DV7H 3L7ZC 3K7UC 5K36G 5AJ3L 5M3MG 3PIPA 2OTLA 1TWHH 1V9PA 2H5XA 2PI2A 2CFMA 3M4PA 1HZAA 4AYBG 1MKHA 4JI0L 1BJTA 5FD6A 2D62A 5DLQE 4RAZA 4DUYH 4O2DA 2C35B 4DV0Q 1SN8A 4YWKA 4A3GG 1EUJA 1EOVA 4OWTB 1IBKQ 4LH6A 2RGRA 1HNWH 3TRZA 4LF7L 4X66Q 3ICEA 2WFWA 3NELA 4LUZA 2JA6H 4A3BG 5LL6b 1BKBA 4EFEA 4PDBA 1E3PA 1YI2A 1XNQQ 3K7AH 3CCVA 1X6OA 3W1GA 1E22A 3J81W 3PF4A 3PN1A 3PGZA 3I4OA 1HR0W 2NN6G 2VNUD 2ZJPA 3NBZB 1FL0A 3PUZA 4LFCL 3GO5A 2NVXH 1SE8A 3CCQA 1Y1VH 2WP8J 4IJHA 4A3IG 1N34H 2UXCL 3CP0A 4LF8H 1YNXA 1HZBA 3TEHB 4AYBE 5LMNW 2MFIA 1TWGH 1KIXA 2MCTA 2E2HH 2UUCH 2JE6I 4JI5L 3PUWA 2KENA 3S2HH 5C44G 5ELOA 1L2FA 4LF5H 4AQYL 4GLAC 2ZTDA 4JBJA 1PA6A 4TVAB 4R4IA 4A3FH 2VOBA 1HZ9A 4JI3H 4NXMQ 2KHIA 3PO3G 4JI4H 3JAMi 4A3CH 3KDFB 3RN5A 1KRSA 2HIVA 4DUZQ 2HGSA 3TY8A 5LMNQ 1N32L 2VUGA 2XGTA 3UE1A 4YY3Q 4R7RA 4YCWA 4BBRH 2RCNA 2VS1A 2XTIA 4POGA 4UCVA 4P73A 1Z2PX 2DGYA 3I7FA 1VQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3F A;  2UXD L;  4DPG A;  4EEQ A;  1VQ4 A;  2Q2H A;  4A3J H;  1K8A C;  1IBM Q;  1HZC A;  4LF4 L;  1LYL A;  1QZH A;  2MQH A;  1TXY A;  4GN5 A;  3HOW G;  1IL2 A;  1TWC H;  4A3F G;  1JB7 A;  4KHP Q;  4JI0 Q;  1G6P A;  4QGU A;  3CCM A;  1VQ7 A;  3GTM H;  4UY8 C;  4EFB A;  1PH7 A;  2UUC Q;  3RLF A;  1FJG Q;  4LUV A;  3RZD H;  3QWU A;  3D0F A;  2UUB L;  1H95 A;  2OCE A;  1K83 H;  3CPF A;  4NB3 A;  4OON A;  4AIM A;  3CCU A;  4YY3 L;  1XJV A;  1HR0 L;  3K8A A;  2NN6 I;  3KF6 B;  1KD1 C;  1P16 A;  4B3T Q;  1TWF H;  4DR4 L;  3ULJ A;  5JJI A;  2VW9 A;  2N8N A;  3EIV A;  1QZG A;  4JI6 L;  4DV5 Q;  2F4V Q;  1I94 Q;  4B3S L;  3GTL H;  1B70 B;  5BR8 L;  4Y7N H;  3G6E A;  3CMA A;  1KAW A;  2R7F A;  4DR3 Q;  5C3E G;  3GTG H;  3F2B A;  2NZO A;  4C3H H;  3AEV A;  3FP9 A;  5IYD G;  2IT1 A;  2R92 H;  1XDN A;  3W5O A;  3GD7 A;  4HIM A;  3S1M H;  2R93 H;  2KCM A;  1VQB A;  4P71 A;  4ALP A;  3S1Q H;  2PQA A;  3FHW A;  1MIU A;  4GKK Q;  1XPR A;  2JQO A;  3NBY B;  2VL6 A;  4H02 A;  4GLX A;  5IWA Q;  4JI7 L;  1UE6 A;  2B63 H;  4IFD J;  3CC7 A;  1VQ9 A;  4B3M Q;  4GS3 A;  2K5V A;  5IE8 A;  1VQP A;  2AWN A;  4A93 H;  4JYA L;  4JI2 Q;  2K52 A;  1V43 A;  4QL5 A;  4JI1 L;  5BR8 Q;  3JC6 6;  3HOV H;  2AWO A;  1CKN A;  1CKM A;  1XMO L;  2E2I H;  4OO1 I;  2JA6 G;  1J6Q A;  3M3Y H;  3MEF A;  1NTG A;  4JCV E;  3GTQ H;  1N34 Q;  1HNW L;  2L15 A;  3DLL A;  3T1Y L;  1SLJ A;  3J81 c;  4JV5 L;  1FJG L;  2CWP A;  3UDI A;  2UUC L;  4P72 A;  3HOV G;  2CQO A;  2I5L X;  3UQ8 A;  2EQS A;  3F8T A;  5GAH C;  1VQK A;  3PUY A;  2HT1 A;  3GTK H;  1O7I A;  4DR2 L;  2HVS A;  3OW2 A;  1VQE A;  3RZO H;  4E6N A;  1K0R A;  1BBU A;  1WCM H;  4QIW E;  4C3I H;  1VQ8 A;  4JI4 Q;  3HKS A;  1QVC A;  2K4K A;  2PI2 E;  1LM0 A;  2QEX A;  1V1Q A;  1YIJ A;  1JMC A;  4IO9 A;  3HOZ G;  3S1R H;  2CWA A;  4A3D H;  4A3B H;  1CKN B;  1GVP A;  1VQM A;  1Z47 A;  2MNA A;  1XNR L;  1VQA A;  1TAE A;  4JI3 L;  1L1O A;  1IBK L;  1KHI A;  2AHO B;  1N9W A;  1OXU A;  2HHH Q;  5ELN A;  5GQO A;  1HH2 P;  3CCR A;  5C0X I;  1N36 Q;  5GAG C;  1YJN A;  2R7Z H;  1S40 A;  4DV2 L;  3CC2 A;  1VQL A;  3AYH B;  2MO1 A;  1N33 L;  4Y52 H;  4JI7 Q;  5C44 H;  2QA4 A;  4CC5 A;  3PUV A;  4GLV B;  4R4T A;  1VCI A;  3ZJY C;  5M3F G;  2K14 A;  4A3D G;  4POF A;  3OTO L;  4LFA Q;  4HJA A;  3OYY A;  2N49 A;  1PH2 A;  4KLK A;  3T1H Q;  3W1B A;  4JBM A;  1XMQ Q;  4ME3 A;  1OXX K;  4UCT A;  1RIP A;  1L1O B;  4JI8 L;  4IOC A;  4R4C A;  4LFA L;  4APV A;  4XIG S;  4X66 L;  3F2D A;  1M90 C;  3Q8D A;  3J80 c;  2RF4 A;  1S3O A;  2E2J H;  5M5W H;  1PH5 A;  4O0A A;  4BXX H;  4DR7 L;  5C3E H;  4IJL A;  2R7D A;  4DR1 Q;  2Q2U A;  4IFD G;  1GKH A;  1VQF A;  4EX5 A;  4A3K H;  4DV4 L;  1HR0 Q;  2EXD A;  1PH6 A;  1VQN A;  2UXB L;  1J5E L;  2N3S A;  5IP9 G;  4JV5 Q;  1N36 L;  4QJF A;  5AJ3 Q;  3I55 A;  1TA8 A;  1L0W A;  2E5L L;  4CC6 A;  4DR5 L;  3KLW A;  2UXB Q;  3LGJ A;  4HIK A;  4BY7 H;  3G48 A;  5J3B A;  1X55 A;  4DV4 Q;  2D0P A;  2BH2 A;  3CCE A;  3STB D;  3UDF A;  5GAD C;  4JI3 Q;  2I0Q A;  5D1O B;  1YVC A;  4J15 A;  3PUX A;  3KFU A;  4DV1 L;  3STB C;  4L5S A;  2BA0 A;  1TWA H;  2Y0S G;  3BZK A;  3M4Q A;  4JBW A;  4LF7 Q;  3HOY H;  4B3M L;  2NVQ H;  2N78 A;  3KF6 A;  4B3R Q;  1AE3 A;  2ID0 A;  2JEB I;  4IPH A;  4KHZ A;  1X3G A;  1VQC A;  3U58 A;  1MJE A;  3J7A 5;  4BBS G;  5DIS C;  1FGU A;  1Q12 A;  3CQZ H;  4GKK L;  5C4X G;  1VQH A;  1JJG A;  1I50 H;  4LFB Q;  3K81 C;  1OTC A;  4OWW B;  5HY6 A;  3ER0 A;  1R9T H;  1W3S A;  5C4X H;  1XPO A;  3E9I A;  3T1Y Q;  4A3G H;  3BAA A;  4HJ8 A;  4LF9 L;  3TS2 A;  5FJ8 G;  4GNX B;  1QUQ A;  4UCR A;  2IX1 A;  4L5T A;  1Q86 C;  1XMO Q;  1HNZ L;  3ULP A;  4DRF A;  2F52 A;  3HOY G;  5M5X H;  3FKI G;  2VQE L;  2NVY H;  1XTD A;  2A1A A;  2IHE A;  2WB1 E;  1CKO A;  5M5Y H;  1Q1E A;  4DV5 L;  2ATW A;  2B3G A;  1B7Y B;  1G51 A;  3RR5 A;  3HOX G;  2YTX A;  4DKA C;  1PFS A;  2Q2I A;  1I5F A;  2ZM6 L;  1XNR Q;  3TY9 A;  2JJQ A;  4LF8 Q;  3D31 A;  4GOP C;  3PO2 H;  4QQB X;  4NPS A;  1BVS A;  2KHJ A;  1BBW A;  3KDF A;  4LWC A;  1SR3 A;  5FJ8 H;  3CC4 A;  3TY5 A;  4A3K G;  5M3M H;  3A5Z B;  3KYH C;  4P74 A;  1SMX A;  3RTX A;  3ULL A;  2ZM6 Q;  3FKI H;  2WAQ G;  3NC0 B;  1IBL L;  2VUM H;  4A3M G;  5IP7 H;  4OXP A;  2R92 G;  3GDE A;  4NXN L;  4OWX B;  1EQR A;  1YHB A;  4UP7 A;  4RG1 A;  4DR2 Q;  1LTL A;  1I94 L;  1N33 Q;  1EIF A;  5FLX c;  3M7N A;  4BBS H;  1K73 C;  2CKZ B;  2RHQ B;  3AFP A;  4GNX C;  1YHA A;  2OQK A;  5IYB G;  2UU9 L;  2KBN A;  1VS0 A;  1S68 A;  1WOC A;  2JA5 G;  4YCU A;  1QVG A;  1KRT A;  2Q2T A;  1B04 A;  4BA1 I;  3PSI A;  3TQY A;  1A8V A;  3I2Z A;  3BAB A;  4A76 A;  1JE5 A;  3F2C A;  4AQY Q;  4JI1 Q;  3TS0 A;  1Y1V G;  1KC8 C;  2HVQ A;  2AKW B;  1YEZ A;  1D8L A;  2PQA B;  1YHQ A;  1PH3 A;  2ES2 A;  3I4M G;  4DV3 L;  5IY0 A;  2Z0S A;  4DV7 Q;  3I4N G;  4DR7 Q;  3H0G H;  1Q8K A;  3H15 A;  1YBY A;  4DV6 Q;  4LUO A;  1E7Z A;  1OXS C;  4TQU S;  4PMW A;  2IHF A;  3NEN A;  4LW1 A;  4JI8 Q;  1XK5 A;  3AFQ A;  3I4N H;  4A4I A;  3L0O A;  4R4O A;  4OX9 L;  1VQI A;  2LXJ A;  2GVB A;  4MNO A;  4C2M H;  5FLM H;  3E9H A;  4UPA A;  4BA2 I;  4HIO A;  3BZC A;  5LMN L;  2UU9 Q;  4MZ9 A;  4LF6 L;  4YHH Q;  4KI0 A;  4RMF A;  1ASZ A;  1Y14 B;  4DR6 Q;  4JI6 Q;  4JI2 L;  4WJ4 A;  3A5U A;  3PO2 G;  2OWO A;  3RLN A;  4JI5 Q;  1SFO H;  1Q46 A;  1Q82 C;  2R93 G;  2GVA A;  1NY4 A;  3PCO B;  4A3L G;  3U50 C;  3M85 A;  5IYD H;  3HOZ H;  3GTJ H;  1CSP A;  3DM3 A;  1WI5 A;  4HJ7 A;  4X65 Q;  1K8G A;  1EWI A;  1N8R C;  4L5R C;  1QVF A;  1A0I A;  5C0X J;  4LFB L;  3PO3 H;  2R7Z G;  2UXC Q;  3BA8 A;  4GOP B;  1XMQ L;  4LF5 Q;  4LH7 A;  2JA8 G;  3HOU H;  3M9B A;  4MTN A;  3G71 A;  3J80 i;  5IT9 c;  1KXL A;  4A93 G;  4B3R L;  3OTO Q;  2JEA I;  1U5K A;  1VQJ A;  4BY7 G;  4PZ7 A;  5JEA J;  3PIO A;  3L2P A;  1PH8 A;  1E1T A;  2NZH A;  3BA9 A;  2JA7 G;  3CAM A;  4DV3 Q;  1GO3 E;  4P75 A;  2ZTE A;  3CF5 A;  4GOP A;  1A63 A;  1C9O A;  4PG3 A;  4UP9 A;  4JOI A;  1VQO A;  3CCJ A;  1YJ9 A;  1GM5 A;  4X65 L;  4LF9 Q;  1KL9 A;  1NBW A;  1HJP A;  1U0L A;  2B29 A;  4A3E H;  1W2B A;  3EN2 A;  1CSQ A;  4NXM L;  1K3R A;  3JSN A;  4BXX G;  2K5N A;  1YIT A;  4IOA A;  2RHS B;  4WJ3 M;  1S72 A;  4R1J A;  2OTJ A;  4YWL A;  4YCV A;  1WCM G;  4X64 L;  2BA1 A;  3U4V A;  4GN3 B;  1T9H A;  3WWV A;  3H3V H;  2ALY B;  2I5M X;  3SGI A;  5H1S E;  4YHH L;  1AH9 A;  3NEM A;  3J7Z C;  3S2D H;  1X54 A;  3M4O H;  1MJC A;  3S15 H;  5D1O A;  1JJ2 A;  3S17 H;  4HJ9 A;  4DK6 C;  3J81 i;  3ERS X;  1Q81 C;  4NXN Q;  4K0K Q;  2UXD Q;  2VQF Q;  5IWA L;  1UE5 A;  1EQQ A;  1ASY A;  2R6G A;  3T1H L;  4A3C G;  1X56 A;  1EFW A;  2FXQ A;  1VQG A;  1VQ5 A;  4IFD I;  4IPC A;  2VZA A;  1OXT A;  3A74 A;  1Y1W G;  3EBE A;  4DV6 L;  4UCS A;  1M1K C;  4A3L H;  1X3E A;  4LF8 L;  2UUA Q;  3CPW A;  3BJU A;  5JEA G;  4EQ5 A;  1N34 L;  1IZ6 A;  4DK3 C;  4HID A;  1DGS A;  4A3J G;  2D0O A;  2YYZ A;  4GN4 B;  4C3J H;  3MXN B;  2F4V L;  4DAM A;  2PMZ E;  2UUA L;  1JT8 A;  3S16 H;  3CCS A;  2K50 A;  2JA7 H;  4DR6 L;  4LF6 Q;  4AH6 A;  2K5H A;  3GTP H;  1HNZ Q;  3TRE A;  1GD7 A;  3B6Y A;  1VQD A;  1WJJ A;  1SRO A;  2HQL A;  4JOI C;  2LXK A;  1X65 A;  3JAM c;  1PVO A;  4XTC S;  5FLM G;  4DUY L;  4A75 A;  4OX9 Q;  3GTO H;  1I6H H;  4DAY B;  1NE3 A;  2VQF L;  4X62 Q;  4BY1 H;  5D1P A;  1E1O A;  1A62 A;  4FDB A;  2VY3 A;  1UE1 A;  2K75 A;  3UDX A;  1Z9F A;  1IBL Q;  2JK8 A;  2A8V A;  3S24 A;  5IP9 H;  3JSL A;  4X64 Q;  4DR3 L;  3S1N H;  2JA8 H;  5JJL A;  2IY5 B;  5JJK A;  1XPU A;  2HIX A;  1B8A A;  4DV1 Q;  4DUY Q;  1PYB A;  3A0J A;  2YU9 H;  2HHH L;  4L5Q A;  3H0G G;  4PZ8 A;  3H3V I;  1HNW Q;  3BU2 A;  4DUZ L;  3GJX B;  3S14 H;  4DR5 Q;  5GAE C;  1Q1B A;  3KJO A;  3J81 j;  2YTY A;  3IRB A;  1I3Q H;  3F1Z A;  3KOJ A;  1P8L A;  3CME A;  5IYB H;  5C0X G;  1AE2 A;  2OQ0 A;  3AQQ A;  2VUM G;  1WFQ A;  4KHP L;  4YWM A;  3I56 A;  4DNI A;  1Y1W H;  2WAQ E;  4A3E G;  4JI4 L;  4PZ6 A;  2GN5 A;  2MO0 A;  3UDG A;  1YJW A;  1IBM L;  2ZJQ A;  4LF4 Q;  2NVT H;  3NBH B;  4GKJ Q;  4X6A H;  5FPR A;  1FVI A;  4LF5 L;  3RNU A;  5E7N A;  4LFC Q;  5IYC H;  4UP8 A;  1Q7Y C;  1G29 1;  1C7Y A;  3HKZ G;  3CXC A;  1RL2 A;  3GB8 B;  1PH1 A;  3K0X A;  3UE0 A;  1PH9 A;  1EIY B;  2B63 G;  1XNQ L;  1KQS A;  2QGQ A;  1X9N A;  4UFZ A;  1UE7 A;  3RN2 A;  1LUZ A;  2E8G A;  4BY1 G;  4BBR G;  4B3S Q;  2YV5 A;  4QY7 A;  2HVR A;  2BH8 A;  1NMG A;  4JYA Q;  2LSS A;  2WB1 G;  5EAY A;  1JJC B;  1WYD A;  3HOU G;  1EYG A;  3RLO A;  3CCL A;  1C0A A;  2DUD A;  5GRO A;  4DV2 Q;  4HJ5 A;  5FPO A;  4UCO A;  5IYC G;  3KF8 B;  1CUK A;  5IP7 G;  3CD6 A;  1YZ6 A;  4IPD A;  2ASB A;  1K9M C;  2PNH A;  3CW2 C;  5LMU Q;  1IXR A;  4GNX A;  1PHJ A;  1NMF A;  1HNX L;  3HOW H;  3G4S A;  4JC0 A;  1PYS B;  1OXV A;  2YTV A;  1IYJ B;  2ZTC A;  4A3I H;  4DR1 L;  2CCZ A;  1UWV A;  2AMC B;  2JA9 A;  1E24 A;  4OO1 G;  4GKJ L;  2V1C C;  3K80 C;  4A3M H;  4JBK A;  4DV7 L;  3HKZ E;  4IPG A;  5C4J H;  4UCU A;  2F3I A;  2JA5 H;  4K0K L;  1QUQ B;  2EIF A;  1D7Q A;  2I5H A;  1PV4 A;  4DV0 L;  5HGQ A;  2KCT A;  1UEB A;  3PV0 A;  5M3F H;  3PF5 A;  2A19 A;  1L1O C;  4X62 L;  2IX0 A;  3HOX H;  2Y0S E;  3VDY A;  3E0E A;  3KJP A;  4R4Q A;  2ZJR A;  2Z6K C;  4LNQ A;  1N32 Q;  4B3T L;  3I4M H;  2VQE Q;  4DR4 Q;  4JG2 A;  3HFZ B;  2Z6K A;  3U4Z A;  1NJI C;  5LMU L;  1PH4 A;  1HNX Q;  1SRU A;  1J5E Q;  2UUB Q;  3VNN A;  2E5L Q;  3L7Z C;  3K7U C;  5K36 G;  5AJ3 L;  5M3M G;  3PIP A;  2OTL A;  1TWH H;  1V9P A;  2H5X A;  2PI2 A;  2CFM A;  3M4P A;  1HZA A;  4AYB G;  1MKH A;  4JI0 L;  2D62 A;  5DLQ E;  4O2D A;  2C35 B;  4DV0 Q;  1SN8 A;  4YWK A;  4A3G G;  1EUJ A;  1EOV A;  4OWT B;  1IBK Q;  4LH6 A;  3TRZ A;  4LF7 L;  4X66 Q;  3ICE A;  2WFW A;  3NEL A;  4LUZ A;  2JA6 H;  4A3B G;  1BKB A;  4EFE A;  1E3P A;  1YI2 A;  1XNQ Q;  3K7A H;  3CCV A;  1X6O A;  3W1G A;  1E22 A;  3PF4 A;  3PN1 A;  3PGZ A;  3I4O A;  1HR0 W;  2NN6 G;  2VNU D;  2ZJP A;  3NBZ B;  1FL0 A;  3PUZ A;  4LFC L;  3GO5 A;  2NVX H;  1SE8 A;  3CCQ A;  1Y1V H;  2WP8 J;  4IJH A;  4A3I G;  2UXC L;  3CP0 A;  1YNX A;  1HZB A;  3TEH B;  4AYB E;  5LMN W;  2MFI A;  1TWG H;  1KIX A;  2E2H H;  2JE6 I;  4JI5 L;  3PUW A;  2KEN A;  3S2H H;  5C44 G;  5ELO A;  1L2F A;  4AQY L;  4GLA C;  2ZTD A;  4JBJ A;  1PA6 A;  4TVA B;  4R4I A;  4A3F H;  1HZ9 A;  4NXM Q;  2KHI A;  3PO3 G;  3JAM i;  4A3C H;  3KDF B;  3RN5 A;  1KRS A;  2HIV A;  4DUZ Q;  3TY8 A;  5LMN Q;  1N32 L;  2VUG A;  2XGT A;  3UE1 A;  4YY3 Q;  4YCW A;  4BBR H;  2RCN A;  2VS1 A;  2XTI A;  4POG A;  4UCV A;  4P73 A;  2DGY A;  3I7F A;  1VQ6 A; 
#chains in the Genus database with same CATH topology
 3NBH A;  1X3F A;  4MA0 A;  5LYJ F;  1MI2 A;  2SNM A;  4DPG A;  1VDZ A;  2W6N A;  4A3J H;  1K8A C;  5DGI A;  1R9T B;  2F0M A;  4M8A A;  5KG0 A;  4M7E A;  4PQX A;  3SK5 A;  2MQH A;  3A7A B;  1TXY A;  1FGB D;  4N9P A;  1TWC H;  1JB7 A;  4A3I B;  3T5K A;  2JXM B;  1NR2 A;  3LUL A;  4LUV A;  3I91 A;  3BS1 A;  2R3Z A;  2UUB L;  3TBI B;  4NB3 A;  3CPF A;  3OSN A;  1D5Z C;  4K6L A;  2FJZ A;  3BG3 A;  3UZB A;  3UZO A;  1G2S A;  2KEC A;  4B3T Q;  2VQF H;  4EBD A;  1BNC A;  5COR A;  2N8N A;  2WE6 A;  2RDG A;  3TDQ A;  4JI6 L;  1LTS D;  4O1N A;  4DV5 Q;  4B3S L;  2F4V Q;  1XMQ H;  2B2V C;  3G6E A;  2J0T D;  1MSG A;  3DMU A;  2QK4 A;  1M0W A;  1IYV A;  2EJ3 A;  1TWA A;  1XYI A;  5FD5 A;  3G6X A;  2UUA H;  3AEV A;  5IYD G;  4AYB B;  2R93 H;  1VQB A;  4OIK A;  4GKK Q;  4WOR A;  1PTO H;  1KTK A;  2JQO A;  2WIN B;  5KYI A;  4OO1 H;  3EA6 A;  4GLX A;  4IFD J;  3U54 A;  1UE6 A;  2KQ3 A;  1TII D;  4FFL A;  3MJF A;  5COY A;  5EPJ A;  1VMC A;  1VQP A;  5IE8 A;  4A93 H;  4JI2 Q;  4FFO A;  1LLR D;  2L5T A;  3JC6 6;  2RKS A;  3HOV H;  1A3V A;  3TSS A;  4OO1 I;  4ECS A;  1J6Q A;  1AP0 A;  2W6M A;  3MEF A;  3KTM A;  3GTQ H;  4ECV A;  1C48 A;  3EYY A;  1MZB A;  1WRV A;  1SLJ A;  4FFR A;  1RJR A;  1FJG L;  2W9B A;  4DQN A;  3GIM A;  2EQS A;  3MEH A;  3PUY A;  3JZ6 A;  5I9O A;  1O7I A;  1RKN A;  3RZO H;  2TSS A;  3NPP A;  2ZDG A;  2M2L A;  3A55 A;  1WCM H;  1WH2 A;  4NXM H;  1VQ8 A;  3QWN A;  1B3A A;  1ESF A;  2DAB A;  5I5S A;  2PI2 E;  2Z02 A;  2QEX A;  5BWW A;  3FKI A;  1YIJ A;  1DJR D;  1XXG A;  4A3D H;  3MA2 B;  3W3A A;  3O13 A;  5M5X B;  1Z47 A;  1K1S A;  4HQ6 A;  3MC0 B;  3H09 A;  4JI3 L;  4NXN H;  1EYA A;  5LHY 1;  4O82 A;  3GID A;  1A0G A;  1OXU A;  3HOX B;  2J6U A;  5ELN A;  4YP3 A;  4MV7 A;  1HH2 P;  3CCR A;  3GTL A;  3N43 B;  5KFX A;  4GKJ H;  1OWT A;  3LQS A;  2WKD A;  3AYH B;  3GTG A;  3PW0 A;  4JI7 Q;  3HP3 A;  2JEG A;  2D9U A;  1HXY D;  4C5C A;  3KBX A;  3T51 B;  3JZF A;  2W6O A;  4FF2 A;  1CS0 A;  2XN9 C;  4HJA A;  3OYY A;  2Z8L A;  4B3S H;  5CC4 A;  2MJ8 A;  2X0S A;  2PN1 A;  1GSH A;  1AUX A;  2K5W A;  2HUG A;  4QWC A;  4ME3 A;  1OXX K;  1JOR A;  4IOC A;  1L1O B;  3NUC A;  1HNZ H;  2QF7 A;  4XIG S;  3VR2 A;  5K5P A;  1BBX C;  1JC7 A;  4DFA A;  1M90 C;  1EWH A;  2FE3 A;  4JK1 C;  2F0N A;  1I7L A;  4G57 A;  1GUT A;  1UC8 A;  4EX5 A;  4M9U A;  3GTK B;  2EXD A;  1G6Z A;  4O3P A;  3QR8 A;  4F8M A;  3J81 E;  5KT6 A;  5IP9 G;  2MPM A;  4C3I G;  3H0G B;  4IAL A;  3KRE A;  3Q1K A;  2LS0 1;  4BY7 H;  3G48 A;  1D1I A;  1X55 A;  1QNU A;  2BH2 A;  3ND8 A;  1KJ9 A;  5BPF A;  3STB D;  2XIG A;  5GAD C;  2I0Q A;  1YVC A;  1LTG D;  1DOK A;  3PUX A;  4J15 A;  4DV1 L;  3STB C;  3KFU A;  1RK6 A;  3X3N A;  5GON F;  2J7Z A;  3BZD B;  3KHL A;  3M4Q A;  4DAA A;  2WAQ A;  2QDB A;  4QWD A;  2V58 A;  2YWV A;  1SEI A;  3CRL C;  4B3R Q;  5I4D A;  2ID0 A;  4BBS G;  5DIS C;  1VQC A;  1JQY D;  1J5E H;  4X3U A;  3R23 A;  3EPG A;  2BOS A;  5HY6 A;  4OWW B;  4A3J B;  4K2L A;  5KG2 A;  1R9T H;  1EY5 A;  2KOL A;  5C4X H;  4V19 0;  3BAA A;  1PK8 A;  2XSC A;  3GP7 A;  3EJI A;  3EQL C;  4L63 B;  4L5T A;  2IX1 A;  1KDA A;  1XMO Q;  2L9H A;  5KG5 A;  1XTD A;  2A1A A;  2IHE A;  1EKP A;  1CKO A;  2ATW A;  1IKL A;  2EY2 A;  4Y8V B;  1SYC A;  3MR5 A;  1PTO F;  3F2U A;  1UUP A;  3RR5 A;  4WD3 A;  1STE A;  4BY1 B;  2J6S A;  3OTO H;  4XT1 B;  3D4W A;  3GLK A;  2ZM6 L;  1BCP D;  4J9Q A;  3U9O A;  2XD4 A;  3TY9 A;  5IT9 W;  4LF8 Q;  4PMB A;  2WYO A;  2FLP A;  4CKC A;  4C3J G;  1D5M C;  2KHJ A;  1Z7T A;  4DV2 H;  2R7M A;  2RDJ A;  2FKL A;  3A5Z B;  4YR2 A;  3ULL A;  1EQT A;  3P75 A;  5ELE A;  4LF9 H;  3PO3 B;  2VUM H;  2ZDH A;  3GIQ A;  5IP7 H;  4RUC A;  2F0U A;  1DD2 A;  1EQR A;  4UP7 A;  4IUT A;  3WO1 A;  3RB3 A;  3BDO A;  1EIF A;  2OLS A;  4ZRZ A;  1S5D D;  3M7N A;  1UC9 A;  1RYS A;  2OQK A;  4R8N A;  5C0X H;  3T53 B;  5JVG 3;  2NU6 B;  2ZJT A;  4YCU A;  1KRT A;  2R61 A;  2VQD A;  2TMP A;  4BA1 I;  3KHR A;  1A8V A;  5IGE A;  4A76 A;  4DR1 H;  1V8Q A;  5BWT A;  4O3O A;  1TS2 A;  2EYM A;  2HVQ A;  3RV3 A;  5KKN B;  2AKW B;  2PQA B;  5IGB A;  1HNX H;  3NQT A;  4DV3 L;  1JX4 A;  2HJW A;  3PIO 3;  4JV5 H;  1GJX A;  5F9L A;  4LUO A;  4A3G B;  3GIL A;  4DV4 H;  4HMI A;  4O7W A;  1XK5 A;  5I5V A;  5C4J B;  4EYH B;  2OH2 A;  1I6V C;  5FLM H;  3E9H A;  5DG9 A;  2H4O A;  4BA2 I;  2SDF A;  1EZ1 A;  3BZC A;  2FK1 A;  1BXT A;  5E3F A;  4LF6 L;  1H9K A;  5NUC A;  1ASZ A;  5L37 A;  4WFN 3;  2K33 A;  4JI2 L;  4JI6 Q;  3I4M B;  2R87 A;  2YL2 A;  4O7T A;  3VPC A;  1DZ1 A;  2B2T C;  3R2T A;  1Q82 C;  1X32 A;  3GQC A;  3M85 A;  4F4Z A;  3GTJ H;  1CSP A;  1LTA D;  1EWI A;  1IHZ A;  2UXC Q;  1DM0 B;  4LFB L;  3RV4 A;  4LF5 Q;  3DWQ A;  4LH7 A;  1BGW A;  2JA8 G;  1GUS A;  1ZXT A;  2PW7 A;  4JI2 H;  3AB9 A;  4DUZ H;  2R7K A;  4IQZ A;  5KIX A;  3OTO Q;  5KFU A;  3I8Z A;  3L2P A;  3K7A B;  1I2K A;  2JA7 G;  1PRT F;  1RDP D;  4O4L F;  1SXT A;  2V5A A;  4X65 L;  1TKW B;  4XZ3 B;  5A2Q E;  2YW2 A;  1HJP A;  4A3E H;  5I5T A;  1CSQ A;  2K5N A;  4WJ3 M;  1S5E D;  3OWE B;  2KED A;  2VB3 X;  4R1J A;  4DR2 H;  3V6K A;  4YCV A;  4X64 L;  1W96 A;  4NW2 A;  1B9N A;  1T9H A;  3H3V H;  1AH9 A;  3CHB D;  3S2D H;  4BY7 B;  1MJC A;  3S15 H;  4WRD A;  3S17 H;  4FFM A;  2E75 C;  4HJ9 A;  4O83 A;  5D1O A;  3ERS X;  4Q0F A;  4NXN Q;  5L1K A;  1S0N A;  1Y1W A;  5EZY F;  4F4X A;  1UE5 A;  1ASY A;  5K2M A;  2F4V H;  2A68 D;  1X56 A;  1BCP B;  2X6L A;  2Z6B A;  2FXQ A;  4CBV A;  3SNO A;  4AQY H;  2A6H C;  4U6P A;  2VZA A;  3A74 A;  3WWH A;  1Y1W G;  4YJ2 F;  5KFW A;  4RAU C;  2AGP A;  5AFW A;  4ZK9 B;  2JEF A;  1M1K C;  1SFO B;  4A3L H;  4FBU A;  2YYA A;  2EPB A;  1CQV A;  2NU9 B;  1PXU A;  1DGS A;  4A3J G;  1ESR A;  4H7B A;  4F4W A;  3SVM A;  4GN4 B;  1VAJ A;  2F0J A;  2ASD A;  4YIJ A;  4KKU A;  1EUC B;  2PMZ E;  3T1H H;  1OBD A;  1TWH A;  5DQI A;  5IWA H;  2JA7 H;  4DR6 L;  1KNA A;  2PW5 A;  5DNF A;  4LF6 Q;  3KAJ A;  2BQ3 A;  4RFB A;  1HNZ Q;  2GPW A;  1EU4 A;  1VQD A;  5LA6 F;  1HCZ A;  2HQL A;  2E76 C;  3GTO H;  1WTR A;  2ZXP A;  1EFI D;  1BCP C;  4X62 Q;  4XYL B;  5FO7 B;  5D1P A;  5CV7 A;  1HHV A;  2EYO A;  4J0M A;  3IFT A;  2FFK B;  2K28 A;  3GTM B;  2MUY A;  2K75 A;  1AN8 A;  3JAM L;  4ZHQ F;  4K5V A;  3Q8P B;  1JOQ A;  2Y4R A;  3JSL A;  4DR3 L;  3D8G A;  1LT5 D;  1EHI A;  3N40 P;  2I07 B;  5JJZ A;  4RZQ A;  2J4X A;  2JA8 H;  2IY5 B;  1XPU A;  3QOL A;  2E2H A;  4C2M A;  3C3L A;  4C56 C;  5CAE B;  2YU9 H;  1GHJ A;  4DGZ A;  2HHH L;  2BE5 D;  3H3V I;  1TQO A;  1ZKO A;  3KBG A;  4G7H C;  3TEK A;  3GJX B;  1PZI D;  4KKS A;  1RJQ A;  3KJO A;  3GTG B;  3IRB A;  1SFO A;  1P8L A;  2RQX A;  5IYB H;  1WFQ A;  1TS4 A;  4YWM A;  4Q4C A;  2WAQ E;  3S1Q B;  4JI4 L;  3H20 A;  1XWE A;  1YJW A;  2ZJQ A;  3UDG A;  3GV8 B;  5KFP A;  3T9E A;  4ZLT F;  4NYE A;  5E4X A;  4UAI A;  4FS2 A;  2OXP A;  5IYC H;  4UP8 A;  3HKZ G;  2RDH A;  3HEJ A;  4XT3 B;  4RZR A;  3K0X A;  3UE0 A;  1PH9 A;  3DXJ C;  3NWS A;  2RSO A;  1Z2O X;  5KG4 A;  3RGX A;  3S17 B;  3RN2 A;  1LUZ A;  1ENA A;  1Q90 A;  2E8G A;  3PQI A;  3PR4 A;  2YV5 A;  2HVR A;  1SNQ A;  4O7Z A;  3HT5 A;  3MWD A;  5EAY A;  1JJC B;  2I80 A;  3E3X A;  5DGH A;  4ILW A;  5GRO A;  4QMG A;  3V4Z A;  3TIG A;  3EPI A;  2AQ1 B;  3E5N A;  4OEM B;  1JOO A;  3N52 A;  1IXR A;  3VPD A;  3DTF A;  4UUG A;  1PYS B;  1IYJ B;  1UWV A;  2AMC B;  5IYZ F;  3KHH A;  4GKJ L;  1WTV A;  5KT7 A;  3UYY A;  4A3B B;  4IPG A;  4UCU A;  1UAP A;  1STY A;  4K0K L;  1QUQ B;  2R7N A;  4N8X 1;  4OEL B;  2I5H A;  2B2W C;  2KCT A;  3WOE A;  3PF5 A;  1O75 A;  4JI3 H;  2A19 A;  1L1O C;  5FO9 B;  2IX0 A;  4X62 L;  3OMC A;  1LTR D;  3K5N A;  4LNQ A;  1T5E A;  4DR4 Q;  3I4M H;  2IWH A;  2CNQ A;  2F0O A;  1Y69 U;  3HFZ B;  2E2I A;  2A69 C;  1NJI C;  5LMU L;  1HNX Q;  3J81 L;  2E5L Q;  2V59 A;  1SE3 A;  3K7U C;  4B08 A;  5AJ3 L;  3LP8 A;  2H1E A;  2JP1 A;  1V9P A;  3Q22 A;  4AYB G;  4JI0 L;  5FD6 A;  2K5D A;  1BJT A;  2D62 A;  1RTO A;  2F0Q A;  4WHX A;  5KFN A;  4DUY H;  3GTK A;  5EKI A;  1DCZ A;  4EGV A;  4FVM A;  4IUN A;  3R3O A;  2RGR A;  3TRZ A;  4X66 Q;  3GV5 B;  2JA6 H;  4HN2 A;  2C28 A;  2LFN A;  2W70 A;  1BKB A;  3QQM A;  2KEE A;  1TWA B;  4I7A A;  4RH6 A;  1KNE A;  5K36 H;  3PGZ A;  2YS6 A;  2NN6 G;  2ZJP A;  1FL0 A;  4LFC L;  5IGG A;  1SE8 A;  3CCQ A;  4A3I G;  2WP8 J;  4IJH A;  3NGD A;  1N34 H;  1J8I A;  3DAA A;  1YNX A;  4NZN A;  1HZB A;  3TEH B;  4AYB E;  2DLN A;  5K3W A;  3I70 A;  2A73 B;  2AGQ A;  2F0K A;  5C44 G;  4JVZ A;  1PA6 A;  4NXM Q;  3PO3 G;  1QNK A;  3KDF B;  1W6K A;  3TP8 A;  4FGR A;  5LMN Q;  1N32 L;  2JA5 B;  5M5Y B;  1PZJ D;  4CJ2 C;  4O3R A;  1SEB D;  4YCW A;  4KN7 C;  3KLR A;  4RUA A;  3I7F A;  3CQZ B;  1I1L A;  2FMC A;  3Q8Q B;  1EKV A;  5LP6 F;  4EEQ A;  1VQ4 A;  1HZC A;  4IIJ F;  5EWF A;  1D6E C;  4DN4 M;  4DAV A;  5C4Z A;  4A3F G;  2CQY A;  3I4L A;  4KHP Q;  1HA6 A;  4KN4 C;  4QGU A;  4HR7 A;  1VQ7 A;  1WD0 A;  3GTM H;  3RLF A;  5DMX A;  1AEX A;  4QIW B;  3FKI B;  3D0F A;  1WTX A;  4IHJ F;  3CCU A;  4OON A;  3H3V C;  1XJV A;  5KG7 A;  2D2C C;  4ZI7 F;  2W9B B;  1P16 A;  2K6A A;  5KNB A;  1TWF H;  4DR4 L;  3ULJ A;  5JJI A;  2XCP A;  1UNN C;  3EIV A;  5JH7 F;  1I94 Q;  3OHA A;  5BR8 L;  4HNV A;  1K28 A;  2GA4 B;  2VR1 A;  1JB3 A;  2KSW A;  3F2B A;  2HDK A;  3FMC A;  2F03 A;  4APM A;  2K03 A;  3V6H A;  2R92 H;  1XDN A;  5I6Y A;  3S1Q H;  2G5D A;  2JA8 B;  2PQA A;  3V05 A;  1MIU A;  4IUR A;  3OHB A;  3AX6 A;  1XPR A;  3IL8 A;  5HUR A;  1Q3L A;  1KAA A;  4H02 A;  4HCS A;  4JI7 L;  1S5F D;  1GLV A;  1T94 A;  1IBK H;  1I4X A;  2K5V A;  4JYA L;  3QG1 A;  1BXR A;  4I7Z C;  1ZAU A;  2EJ2 A;  2J9G A;  1SNM A;  2F0S A;  4JI1 L;  4O7R A;  4CE5 A;  3HKZ A;  2B2T A;  2AWO A;  2Z4I A;  1SE2 A;  1CKM A;  1XMO L;  4DL7 A;  2B63 A;  3M3Y H;  2QEJ C;  5KEE A;  2E2J B;  5M5W B;  1N34 Q;  4GZY C;  4K2K A;  1PFN A;  3MVV A;  3J81 c;  1WD1 A;  3UDI A;  4MV4 A;  2UUC L;  4ZQI A;  3HOV G;  2CQO A;  3JZI A;  5GAH C;  4YAJ B;  5JAV A;  5BN3 A;  2HT1 A;  3OW2 A;  1K1Q A;  1BBU A;  1U4L A;  3K3V A;  4YR3 A;  4ED2 A;  4RHR A;  4JI4 Q;  5C1O A;  3T1Y H;  4L1K A;  4RA8 A;  4MHE A;  3BVZ A;  5KND A;  2Q7D A;  1QVC A;  5HGT A;  1JWU D;  1LM0 A;  5BPH A;  1GUN A;  4IO9 A;  4NMZ A;  1F77 A;  3S1R H;  4MV3 A;  1S5C D;  5LXT F;  1B33 N;  2MNA A;  3HOY B;  1K83 A;  4QUC A;  1VQA A;  1TAE A;  1I50 A;  1XX8 A;  3NSW A;  4KMU C;  2GPS A;  1KHI A;  2AHO B;  1TWG A;  2HHH Q;  5GQO A;  3LML A;  4XX0 B;  1SYG A;  2F1M A;  4O7N A;  2R7Z H;  3Q6S A;  2DJG C;  1EKF A;  2MO1 A;  2N88 A;  4RKL A;  2QA4 A;  2YZM A;  4GLV B;  4MTE A;  4R4T A;  5I47 A;  4KK7 A;  4DL6 A;  3SK4 A;  2EY6 A;  2WTF A;  4JBM A;  4DV5 H;  2C2E A;  3NXW A;  2FPI B;  2W6Q A;  1L0Y B;  4B9X A;  4LFA L;  4APV A;  4JXU A;  1V51 A;  3FDT A;  1GUW A;  2RF4 A;  1S3O A;  2XVS A;  1H9S A;  4OX9 H;  1PH5 A;  4O0A A;  5FO8 B;  4DR7 L;  2PZU A;  4DR1 Q;  1GKH A;  4A3K H;  2AU0 A;  3G7L A;  1PH6 A;  1VQN A;  3VYR A;  3T56 B;  3D4D A;  2N3S A;  4CC6 A;  1TA8 A;  1L0W A;  2IX3 A;  3M4Y A;  1ET6 A;  2E5L L;  2EIY A;  3D3R A;  4B3M H;  2UXB Q;  4HIK A;  3M4O B;  4DV4 Q;  3UDF A;  5D1O B;  5DAA A;  3GII A;  1KJI A;  5KFK A;  4QB4 A;  4L5S A;  2BA0 A;  3T5H A;  3BZK A;  4JBW A;  1G2W A;  1QWY A;  4B3M L;  4QCL A;  2NVQ H;  2N78 A;  4FBT A;  5JVH 3;  3U58 A;  4IPH A;  5EWE A;  5CV6 A;  3PIP 3;  1IOW A;  1Q12 A;  1CA5 A;  4E6N A;  1JJG A;  4QWA A;  2R6F A;  3K81 C;  3RZO B;  4YR0 A;  3Q23 A;  3G6J B;  1HFG A;  4J9S A;  4JI5 H;  3VR3 A;  2K32 A;  3T1Y Q;  4O4I F;  4FXK C;  1CHQ D;  1NR4 A;  3S1N B;  1I2L A;  5FJ8 G;  1Q8I A;  1QUQ A;  2IA6 A;  2JEI A;  3N8D A;  4O84 A;  1HTL D;  4DRF A;  2F52 A;  3HOY G;  5M5X H;  3FKI G;  1IL8 A;  1SJH D;  5M5Y H;  4DV5 L;  5CM0 A;  1H9S B;  1EOT A;  2B3G A;  1B7Y B;  2PMZ B;  3MR2 A;  3DWA A;  4DKA C;  4EQN A;  3C1E A;  2Q2I A;  1SYE A;  2FHT A;  1V1P B;  5A2Q W;  3D31 A;  5LOV F;  4HCE A;  1BVS A;  1BBW A;  3MFG A;  1ZET A;  3KYH C;  4P74 A;  1SMX A;  4IUV A;  2ATL A;  2BCO A;  2RGV A;  2VA3 A;  2Z9H A;  4MV6 A;  3NC0 B;  1IBL L;  2A68 C;  1RJT A;  3DM1 A;  4OWX B;  1N33 Q;  3V6J A;  4RG1 A;  4DR2 Q;  1LTL A;  1SNO A;  5FLX c;  5KS8 A;  3A8I E;  4GNX C;  3AFP A;  1YHA A;  2YRW A;  3Q8S B;  1O7Y A;  5J2T F;  3NP8 A;  5D3I B;  2DAA A;  4RCO A;  4J8Q A;  3BAB A;  5KFL A;  2DPJ A;  4A3K B;  1KC8 C;  1CTM A;  4AQY Q;  5KFM A;  3TS0 A;  1Y1V G;  3UI2 A;  3RF2 A;  5IOD A;  1YEZ A;  2VB2 X;  2GQR A;  2UUC H;  3I3C A;  4GC6 A;  2E5L H;  4DR7 Q;  5EBD A;  3H0G H;  3H15 A;  1A6X A;  1YBY A;  2UVU A;  2V4R A;  5C4X B;  4DV6 Q;  4WJW A;  1PYW D;  2ALZ A;  4TQU S;  3TP6 A;  2IHF A;  4LW1 A;  4RB2 C;  4JI8 Q;  1STH A;  5I5W A;  4O7L A;  4ED0 A;  2WB1 B;  1O78 A;  4R4O A;  4OX9 L;  1VQI A;  1TS3 A;  5FNV F;  5KFJ A;  3GTQ B;  3PR5 B;  4EBE A;  4B3R H;  5LMN L;  2B8G A;  4YHH Q;  2Z1C A;  4KI0 A;  2BQU A;  4DR6 Q;  1ET0 A;  5ELF A;  2KCC A;  2KCN A;  3V2T A;  4WJ4 A;  1HRJ A;  1PZK D;  2W9A A;  3RLN A;  1Q46 A;  2R93 G;  2GVA A;  3PCO B;  4A3L G;  1B50 A;  3K5H A;  3ORQ A;  5IYD H;  1BUV T;  2VXW A;  3J7A K;  1B6S A;  2SNS A;  3DM3 A;  4HJ7 A;  1QVF A;  4TQR A;  1H9J A;  1TWH B;  2FLL A;  3PO3 H;  4GOP B;  4XDX A;  1FYC A;  4CMD A;  1KTA A;  3ERO A;  4A3D B;  3RBD A;  3J80 i;  5CR5 A;  1KXL A;  1QIL A;  4X3K A;  3J80 W;  4F4Y A;  2AQ3 B;  4J9M A;  5KYL A;  4PZ7 A;  5JEA J;  3PIO A;  3BA9 A;  3BYT B;  2P5Z X;  3BVM A;  1A63 A;  1R4Q B;  4FS1 A;  1C9O A;  4UP9 A;  4MIU A;  1VQO A;  4UHV A;  3CRK C;  4MAM A;  2EZV A;  4LF9 Q;  3T54 A;  3T4A C;  1NBW A;  1U0L A;  3JSN A;  2I46 A;  3EN2 A;  1K3R A;  5CBA E;  3M9O B;  2F0G A;  3FPP A;  2DY8 A;  2BQR A;  1EY6 A;  2BA1 A;  1GSA A;  4QWE A;  3U4V A;  1HQR D;  3HKZ B;  1STB A;  2I5M X;  3NEM A;  4ULL A;  3J7Z C;  3N42 B;  3M4O H;  4LAA A;  4RU9 A;  4K0K Q;  2QW7 A;  2L55 A;  4RGM A;  5I60 A;  1K8M A;  1EQQ A;  1Y1V B;  2XIW A;  1T36 A;  4JI1 H;  1VQ5 A;  3G8C A;  2FMA A;  1S03 G;  5A35 A;  1OXT A;  1ILP A;  2CH4 A;  2NVT B;  2VUM A;  4DV6 L;  4LSX A;  2QYZ A;  3R5F A;  2JEJ A;  4JI7 H;  3WNZ A;  5HNE A;  4EQ5 A;  1N34 L;  3TW7 A;  4EEY A;  2FPP B;  1E0B A;  1F2M A;  3K6O A;  4PWQ A;  1L2Z A;  1EUD B;  3J80 E;  3MXN B;  3MHB A;  2QCP X;  3GIJ A;  3K57 A;  2PNR C;  4ZUI A;  4CJ0 B;  5JQW A;  3TP5 A;  1PFM A;  3S16 H;  1EIG A;  2G9H D;  1I4Q A;  2K5H A;  3K5M A;  2XWJ B;  1E4E B;  5BR8 H;  4YHH H;  4TSS A;  2LY7 A;  2CW7 A;  4A75 A;  4DUY L;  1C30 A;  4OX9 Q;  2HDL A;  4MTD A;  4XQN A;  2F0H A;  1TS5 A;  4BY1 H;  4DR4 H;  2B2Y A;  2MHV A;  1A62 A;  4FDB A;  1ZHS A;  2VY3 A;  3GTJ B;  1E2W A;  3HBL A;  2NTS A;  2COG A;  1KDB A;  2A8V A;  5IP9 H;  1BCP F;  1V1O A;  3S1N H;  2K05 A;  2AQ4 A;  1E4F T;  2EOT A;  5JJL A;  1QJO A;  4F50 A;  5I5X A;  5JJK A;  3DEO A;  2HIX A;  4DV1 Q;  4ME6 A;  3A0J A;  5EKK A;  5EPK A;  3G8D A;  3H0G G;  3NK9 A;  3ND9 A;  2VA2 A;  3Q0A A;  3S14 H;  2EJF C;  4EGJ A;  2PZT A;  2C00 A;  1I3Q H;  3NUA A;  3R2I A;  2FJ2 A;  5KT5 A;  2VUM G;  3AQQ A;  4DNI A;  1JE4 A;  3VYS A;  1CHP D;  2B2U A;  1QB5 D;  2MO0 A;  5IT9 E;  1N36 H;  1DAA A;  3NBH B;  1KT8 A;  4J9N A;  5EWG A;  4LFC Q;  5IGC A;  1C7Y A;  1G29 1;  3S9W A;  3VPB A;  3CXC A;  3MAQ A;  3PW4 A;  4NZM A;  1EIY B;  3H4B A;  2JA6 A;  1STA A;  1XNQ L;  5C8Y F;  1NNX A;  4F87 A;  1X9N A;  4BY1 G;  3L3O C;  1EQV A;  4B3S Q;  2ZGI A;  2WKC A;  3T9D A;  2WB1 G;  1I1K A;  5CMD A;  2A6E C;  4HYK A;  3RLO A;  5H80 A;  1STG A;  5E1F A;  3CCL A;  3U0G A;  2DUD A;  4DV2 Q;  5C5M A;  4UCO A;  2MP1 A;  5IYC G;  2NU7 B;  1I7N A;  1GOZ A;  5IP7 G;  3JRX A;  3CD6 A;  1YZ6 A;  2ASB A;  1K9M C;  3RMH A;  4C3I B;  1PHJ A;  1AW7 A;  1PMR A;  5D3D A;  4JI0 H;  5CR3 A;  4O3S A;  1EZ6 A;  1OXV A;  2YTV A;  2ZTC A;  5LL6 S;  1N33 H;  1F9P A;  1PTO C;  3E6Z X;  4OO1 G;  3TN2 A;  4A3M H;  2RDI A;  1A3T A;  3RB0 A;  5TSS A;  5C4J H;  3T9F A;  2F3I A;  2F3W A;  4DU9 A;  1LT4 D;  1NAP A;  1RD9 D;  1Y8P B;  4IR1 A;  5T14 A;  2XNA C;  1UEB A;  1OBG A;  1O7Z A;  2Y0S E;  3NWT A;  3E0E A;  2Z6K C;  1N32 Q;  4DL3 A;  4TRD A;  4X62 H;  1WR2 A;  1I94 H;  2X5R A;  4DR3 H;  2Z6K A;  1TWC B;  1CK1 A;  1PH4 A;  1SRU A;  4K8J A;  3L4J A;  5C3E B;  5K36 G;  5M3M G;  5JPN C;  1TWH H;  4ZCK A;  1HZA A;  1I1M A;  5DLQ E;  4RAZ A;  1CQF A;  4O2D A;  3ETH A;  4IR9 A;  3GV6 A;  1MSH A;  2C35 B;  1SN8 A;  5C5L A;  4YWK A;  4A3G G;  3VOT A;  1KC7 A;  1HNW H;  2R86 A;  3GTO A;  4DF7 A;  1WCM A;  4LF7 L;  2RBM A;  3CU7 A;  2WFW A;  3NEL A;  4A3B G;  4PDB A;  1YI2 A;  1XNQ Q;  3K7A H;  2QKI C;  3W1G A;  4ECZ A;  1SSO A;  4ED7 A;  2FK2 A;  1UNS A;  4CDC C;  1HR0 W;  3NBZ B;  3GO5 A;  4DNT B;  3SR1 A;  3LWU A;  4DAP A;  4H0L C;  2UXC L;  1NUC A;  1GSO A;  1U4P A;  2JSO A;  5LMN W;  2PPB C;  3R93 A;  2E2H H;  2F0P A;  4K6N A;  3PUW A;  2KEN A;  3S2H H;  2ZT9 C;  5KFF A;  2L4N A;  1FR3 A;  5KFZ A;  2B39 A;  4AQY L;  1JOK A;  4GLA C;  2W9C A;  5FLX L;  4TVA B;  2X69 A;  4R4I A;  2A69 D;  4ZKC B;  2VOB A;  2ZXR A;  4JI4 H;  3KLS A;  3TIN A;  4ECX A;  1KRS A;  5JOB A;  2HGS A;  3TY8 A;  4XXE A;  1ROD A;  2B63 B;  4YY3 Q;  2C9O A;  3HB9 A;  4J6H A;  5EKL A;  1Z2P X;  4R7R A;  2RCN A;  2VS1 A;  2JA7 B;  4POG A;  4DL4 A;  3TQ1 A;  2DGY A;  2JA5 A;  4JYA Q;  1VQ6 A;  2RDF A;  2PMZ A;  2Q2H A;  5KFD A;  4UDU C;  2HHH H;  3QFF A;  1QZH A;  1EU3 A;  1A2U A;  1E2V A;  3Q24 A;  4GC7 A;  1N48 A;  2RSN A;  3TP7 A;  4UY8 C;  1WCM B;  3AU7 A;  4IUQ A;  2UUC Q;  4DLK A;  4J9R A;  3RZD H;  2XGP A;  4FF1 A;  2CW8 A;  3MZ5 A;  2OCE A;  2E2D C;  3K8A A;  4JI8 H;  2V4Q A;  2UXD H;  2GQS A;  3D4R A;  3DEP A;  2EJM A;  4L6T B;  1QZG A;  3GTL H;  1SYX B;  1KLU D;  1B70 B;  2R7L A;  4Y7N H;  3CMA A;  2R7F A;  3S14 B;  4DR3 Q;  2KVM A;  5C3E G;  3GTG H;  4HED A;  1WTH A;  2NZO A;  1ZEQ X;  1T5X D;  4C3H H;  4DR6 H;  1K3B C;  1QE6 A;  5DEH A;  2WAQ B;  3NHH A;  1B2T A;  4XQQ A;  1UEA B;  2IT1 A;  3N44 B;  5IGD A;  3W5O A;  4RGN A;  4FYD A;  4HIM A;  2W8L A;  5DLF A;  1YNJ D;  2KCM A;  1QG7 A;  4ALP A;  3FHW A;  3J7Y W;  4HSP A;  3NBY B;  3RUZ A;  1MHW C;  2VL6 A;  5BWV A;  4OGQ C;  4ED8 A;  2F0W A;  3PVX A;  2OF1 A;  5JVL A;  5BR8 Q;  4QL5 A;  5L1I A;  3N6R A;  4MTK A;  4AYB A;  1CKN A;  3T9A A;  2NVY A;  4IRD A;  4FO2 A;  1NTG A;  4Q4D A;  3R9R A;  2L15 A;  5BYA A;  2HGW A;  4JV5 L;  4RCN A;  1EY8 A;  2SOB A;  3VA5 A;  4P72 A;  4DV3 H;  2M05 A;  3GTK H;  2PQE A;  3F8T A;  4X64 H;  2R8K A;  2HG8 A;  4ID6 A;  4DR2 L;  2ZDQ A;  3I90 A;  3VYT A;  1K0R A;  1ZYR C;  4H13 C;  1TWC A;  1FNU A;  2F0D A;  1X3P A;  4C3I H;  3HKS A;  4KD4 A;  3N6X A;  2K4K A;  4CHT B;  5CV8 A;  4IUU A;  3F8N A;  4IRK A;  3HOZ G;  2CWA A;  5KT2 A;  1F9R A;  1CA6 A;  3GV3 A;  1GVP A;  5J39 A;  1VQM A;  4A3B H;  4FF3 A;  5CV4 A;  1N9W A;  1FKA H;  4J9O A;  4JW0 A;  3OOC A;  1N36 Q;  1U4M A;  5FLX E;  2NBF A;  1TY0 A;  1S40 A;  4DV2 L;  3CC2 A;  2R92 B;  3BYY B;  3MTS A;  3ZJY C;  2XRQ D;  5M3F G;  2ZM6 H;  3OTO L;  2FIN B;  4PMC A;  5EOY A;  4O3Q A;  4LFA Q;  2HCC A;  1SMY C;  4JUZ A;  4S3S A;  1PH2 A;  4KLK A;  1Z6H A;  4V0B A;  4EQP A;  5C4H A;  1ILQ A;  3W1B A;  5DAU A;  4LJZ C;  3R8B A;  1XTC D;  5J1Z A;  4BBS B;  4MV8 A;  4JI8 L;  3H4D A;  3OHX C;  4LF6 H;  2FMM A;  2P0A A;  1CFM A;  3Q8D A;  3J80 c;  4FFN A;  1RHP A;  2E2J H;  4BXX H;  4O2A F;  5C3E H;  3PW5 A;  3ETJ A;  2R7D A;  4IFD G;  2Q2U A;  3VR5 A;  5C1P A;  4DV4 L;  3DTG A;  1HR0 Q;  3J80 L;  1J5E L;  1FNW A;  3OSO A;  4O4H F;  4JV5 Q;  4PNY A;  5EBC A;  4RGO S;  2UVR A;  1G91 A;  3CVZ A;  3KLW A;  4JV1 A;  2O03 A;  5J3B A;  2Q8I B;  4FXD A;  2D0P A;  2O4X A;  3CCE A;  5DG8 A;  2CW0 D;  4DV1 H;  3NBI A;  4O2B F;  1JIC A;  4HAE A;  4FP5 D;  2YS7 A;  1TWA H;  3PFF A;  4LF7 Q;  3HOY H;  3WWJ A;  2DZD A;  1A2T A;  3SDZ A;  2DPI A;  2F0F A;  1AE3 A;  2JEB I;  5KRU A;  3J7A 5;  1X3G A;  1JWS D;  1FGU A;  3CQZ H;  2QIL A;  1M0T A;  2PVP A;  1VQH A;  3K5I A;  4TV8 F;  4LFB Q;  4LK1 C;  1PDQ A;  2W6P A;  2R7Z B;  1W3S A;  3GQB A;  3E9I A;  2WV6 D;  4KJN A;  1S5B D;  5KFY A;  4ODG A;  4LF9 L;  3MXN A;  3TS2 A;  3ERQ A;  3OW7 A;  2SCU B;  2DJF C;  4UCR A;  4K14 A;  1Q86 C;  3HG9 A;  1HNZ L;  5EJW A;  3ULP A;  4ECU A;  2VQE L;  2CVR A;  3MXG A;  2B63 H;  1TR5 A;  1SCU B;  1B6R A;  3SI8 A;  2B2U C;  2C2R A;  1G51 A;  3HOX G;  1BF4 A;  3IKJ A;  3PZP A;  1B3Q A;  3K5O A;  2NYZ D;  3QOJ A;  1PFS A;  4O42 A;  5FK9 C;  2COI A;  4LMY A;  3AMU A;  1I5F A;  5KFC A;  2O5J C;  3L9A X;  2JJQ A;  4FXG C;  1I4P A;  4GOP C;  2NTT A;  3PO2 H;  5FLX W;  2BR0 A;  3VR4 A;  5FJ8 H;  1SR3 A;  3KAL A;  2W7P A;  3FKI H;  2AGO A;  4IN3 A;  4A3M G;  2R92 G;  1D2B A;  4NXN L;  1I94 L;  4CHI A;  4MN3 A;  4ECR A;  4BBS H;  1K73 C;  2CKZ B;  2DNE A;  1IW7 C;  1S4Z A;  2KHS A;  1RYR A;  1PRT B;  1S68 A;  2JA5 G;  1B04 A;  1QVG A;  2Q2T A;  2YCH A;  1BNZ A;  2R7Z A;  5F9N A;  3TQY A;  1DV2 A;  3GTP A;  2NVQ B;  5KFE A;  1JE5 A;  3M3Y B;  3L4K A;  2AUK A;  3D6C A;  1AZQ A;  1PH3 A;  5FKA C;  4X3T A;  2Z0S A;  3I4N G;  1FJG H;  1Q8K A;  1EIH A;  3HOW B;  4YBZ B;  4EGQ A;  3RIZ A;  1E7Z A;  4QWB A;  1OXS C;  3TQT A;  2B2V A;  1JCK B;  2FK3 A;  3VA7 A;  1SYF A;  3IN5 A;  3SHL A;  4A4I A;  1JWM D;  3L0O A;  2GVB A;  4MNO A;  5KFS A;  1NSN S;  4UPA A;  1DYQ A;  1SAP A;  2CQA A;  4HIO A;  4ECT A;  4MZ9 A;  4CDD C;  4RMF A;  1XNQ H;  1ET9 A;  1Y14 B;  1J9O A;  3GV7 B;  1HTP A;  2A1H A;  1F9S A;  2OT2 A;  2OWO A;  2K01 A;  3FVQ A;  4JI5 Q;  1CE8 A;  1SFO H;  1NY4 A;  2EJG C;  3U50 C;  3V4S A;  2C2D A;  3LX0 A;  3IFD A;  1G8Z D;  4L5R C;  4ZAI A;  1K8G A;  2VPS A;  1N8R C;  3J7A V;  2YRX A;  2DNC A;  3BA8 A;  5C0X J;  2JA7 A;  2R7Z G;  4RNO A;  1XMQ L;  3QIA A;  2AUJ D;  2K5Q A;  5I2Y A;  4KV6 A;  2F0V A;  4G7O C;  5KG6 A;  5E4W C;  5CV9 A;  4R8I A;  1R4P B;  1SNP A;  3MXP A;  4RHS A;  1EYZ A;  3TME A;  3VYU A;  4XYM B;  4BY7 G;  2PYK A;  2PBZ A;  4I65 A;  1E1T A;  2NZH A;  3VMM A;  1GO3 E;  4P2C B;  4E4T A;  4PG3 A;  1MGS A;  1QOH A;  4JOI A;  3CCJ A;  1YJ9 A;  4FF4 A;  1TVX A;  4KY5 A;  2L11 A;  1KL9 A;  1Y1W B;  1W2B A;  4NXM L;  3BDL A;  1YIT A;  3MWY W;  2RHS B;  1BDO A;  1S72 A;  3MR3 A;  4RKB A;  1SJE D;  2DIK A;  3WWV A;  2ALY B;  5CYU A;  4YHH L;  3C46 A;  3BJY A;  3ORR A;  2EXZ A;  3J81 i;  1Q81 C;  2UXD Q;  2VQF Q;  1LAC A;  2J6T A;  5DQH A;  4TKO B;  3GIP A;  2HDM A;  4KJO A;  2EY1 A;  1HUM A;  1VQG A;  3QB3 A;  2QB5 A;  3FMA A;  4IPC A;  1CM9 A;  3EBE A;  5J22 A;  2CH4 W;  3T7A A;  4UCS A;  2COJ A;  3E5S A;  4LF8 L;  1ML0 D;  2EYP A;  3RFC A;  3BJU A;  5JEA G;  4MV9 A;  4DV6 H;  4RGT A;  2W9C B;  4DK3 C;  4EG0 A;  4FU0 A;  5DG7 A;  4DL2 A;  2D0O A;  2R85 A;  2YYZ A;  5G3L D;  4C3J H;  3QJY A;  5T1G A;  2UUA L;  1IYU A;  1JT8 A;  3CCS A;  1LT3 D;  3P20 A;  2BDO A;  4AH6 A;  2AQ2 B;  1GD7 A;  1WJJ A;  4JOI C;  1II3 A;  3VR6 A;  2LXK A;  1X65 A;  3JAM c;  4O4J F;  5FLM G;  4JI6 H;  1M6V A;  5JVD F;  3Q8R B;  2ASJ A;  5IGF A;  2VQF L;  1LTI D;  4QW8 A;  4ETS A;  1E1O A;  4O86 A;  3H0G A;  2VQE H;  1HQM C;  1MD2 D;  4B9W A;  4O81 A;  4ZYS A;  2V4D A;  1UE1 A;  3UDX A;  1IBL Q;  1Z9F A;  3A8J E;  2JK8 A;  2UUB H;  3S24 A;  1VBH A;  4R8U B;  3DHQ A;  2NVX A;  5EGT A;  1U9R A;  3V96 A;  4A3E B;  3S1M B;  2WII B;  3ITP A;  4DNR B;  1AUV A;  2CHB D;  5KT4 A;  1I4R A;  2A6E D;  1PTO B;  1LO5 D;  4H44 C;  1B8A A;  3H40 A;  1PYB A;  1F9Q A;  4R9W A;  4Q0Y A;  2M00 A;  3NTH A;  1HNW Q;  1PRT C;  1KBL A;  2QDL A;  1FNV A;  3J81 j;  2YTY A;  4M1U B;  1CZG A;  1A3U A;  3F1Z A;  4Q45 A;  1O80 A;  3GIK A;  3KUP A;  4C1N I;  2OQ0 A;  4DXF A;  3UFX B;  4KHP L;  3P7J A;  1PTO D;  4JPB W;  1Y1W H;  5HBR B;  1MBY A;  4OL7 A;  4A3E G;  2GN5 A;  1CI3 M;  1FVI A;  3RNU A;  5E7N A;  3ONA B;  1Q7Y C;  1TWG B;  1EZ8 A;  1H9R A;  1KQS A;  2YZN A;  1JIH A;  4EQO A;  4UFZ A;  1UE7 A;  1WSC A;  2ZXO A;  1JKJ B;  2JA6 B;  4QY7 A;  2O2L D;  5DM6 3;  1RF2 D;  3M7G A;  2NWG A;  3JRW A;  4ZOL F;  1M4V A;  1EWC A;  4ED3 A;  5FR9 A;  2LSS A;  3OIP A;  1JR0 D;  1WYD A;  4IRC A;  1KLG D;  1EYG A;  3RB4 A;  3QZ7 A;  1C0A A;  1AFP A;  3LWE A;  4IFD H;  1Y8O B;  3K59 A;  5CGK A;  1JDB B;  2MGS A;  1CUK A;  1IBM H;  2RA4 A;  1WTO A;  1FD7 D;  1SNC A;  3HOW H;  1NMF A;  4GLW A;  3G4S A;  5C3X A;  4A3F B;  4A3I H;  2CCZ A;  2JA9 A;  2NU8 B;  1X3Q A;  2HHF A;  2V1C C;  2EE1 A;  3K80 C;  4JBK A;  2R93 A;  3URY A;  2R8G A;  5D14 A;  3OSP A;  2EIF A;  1KUT A;  3SK8 A;  3BVG A;  4DV0 L;  5HGQ A;  5M3F H;  1E2Z A;  1YNJ C;  4B3T H;  3SE0 A;  3HOX H;  3VDY A;  3KJP A;  2ZJR A;  4R4Q A;  3T5J A;  1V4Y A;  2VQE Q;  1KJJ A;  4RB0 A;  1I3Q B;  4JG2 A;  3GTM A;  3U4Z A;  1IBL H;  4QUF A;  3GTQ A;  1ICW A;  3PMF A;  3L7Z C;  1DOM A;  2K04 A;  5L1L A;  4DV7 H;  1KJ8 A;  2OTL A;  2H5X A;  2PI2 A;  4DK0 A;  4K5W A;  2CFM A;  3M4P A;  1MKH A;  3ZYY X;  1A9X A;  1EUJ A;  1LAB A;  4OWT B;  3R5X A;  5G3L F;  4LH6 A;  4TVI A;  2HCI A;  3ICE A;  2LMC B;  5LL6 b;  4EFE A;  1E3P A;  3X3M A;  3CCV A;  1X6O A;  1DIK A;  1E22 A;  1JDE A;  4QW9 A;  3J81 W;  3PF4 A;  1B9M A;  3RAQ A;  3HOV B;  3I4O A;  1HA5 A;  4K5X A;  3IAY A;  3PUZ A;  1L0X B;  5CE8 A;  1Y1V H;  2ENB A;  3CP0 A;  3WO0 A;  1SYB A;  4Q5V A;  2MFI A;  4CGY B;  2MCT A;  2JE6 I;  3K0Y A;  4JI5 L;  4LMQ D;  2XWB B;  2YU9 A;  4LF5 H;  2ZTD A;  4WBN F;  1HZ9 A;  5T1I A;  2EVB A;  4I50 F;  4Q8E A;  3JAM i;  3HZX A;  4A3C H;  4A93 B;  3DUZ A;  2HIV A;  3P1H A;  4DUZ Q;  4YAK B;  2NVY B;  1D5X C;  4KKT A;  2OEO A;  4UCV A;  2XTI A;  4P73 A;  1SBB B;  5KG1 A;  2EY5 A;  2UXD L;  5BWX A;  5CV5 A;  4LSA A;  4JV2 A;  1IBM Q;  4LF4 L;  1LYL A;  1CQI B;  3BQ0 A;  3PW7 A;  1PLF A;  4GN5 A;  4G7Z C;  1IL2 A;  3HOW G;  1G6P A;  4JI0 Q;  3T16 A;  4O7S A;  3CCM A;  4EFB A;  1PH7 A;  2XCA A;  5EQ0 A;  1FJG Q;  5KFT A;  4DR7 H;  3QWU A;  1H95 A;  1K83 H;  4AIM A;  2EJ0 A;  3S16 B;  1HR0 L;  4YY3 L;  2YZG A;  5M3F B;  2NN6 I;  3KF6 B;  4DXG A;  4LFA H;  1KD1 C;  1F2L A;  3NE5 B;  5ELD A;  2VW9 A;  1BQQ T;  1PRT D;  5BWU A;  4ABN A;  1KAW A;  3U9S A;  1ZYR D;  2NN6 H;  1C8C A;  4BWS C;  5M3M B;  4DIM A;  4Q44 A;  1EY4 A;  3SK6 A;  3HRZ C;  2C5C A;  3C0F B;  4HNU A;  3FP9 A;  3HGB A;  2VUM B;  1W93 A;  3MWM A;  3GD7 A;  3S1M H;  4P71 A;  1B4O A;  3S2H B;  4TV9 F;  1R9T A;  2UXC H;  5IWA Q;  5KGU A;  4FNF A;  3CC7 A;  1VQ9 A;  4B3M Q;  1GUO A;  4GS3 A;  1KAB A;  2B2Y C;  2AWN A;  5BMV F;  2K52 A;  1F2Z A;  1V43 A;  1VMP A;  3A8K E;  5KFG A;  2E2I H;  3LNN A;  2B8F A;  2JA6 G;  3JAM W;  4JCV E;  1GHK A;  1EYC A;  4LF7 H;  4DL5 A;  2F3V A;  1HNW L;  3DLL A;  3T1Y L;  2YZL A;  5IIF A;  3HO8 A;  2CWP A;  1M8A A;  2I5L X;  3UQ8 A;  1VQK A;  3J7A F;  2HVS A;  2DWC A;  1I50 B;  4O7Y A;  1VQE A;  2CNU A;  2NUA B;  4RB1 A;  4QIW E;  2W7O A;  3RZD B;  5D65 A;  5KFB A;  1RK5 A;  1EEF D;  1B53 A;  5EPL A;  4I4T F;  3N41 B;  1PX2 A;  3BQ1 A;  2PO4 A;  1V1Q A;  5CA1 F;  1JMC A;  5KFQ A;  1XMO H;  1N56 A;  1CKN B;  3FEW X;  3T99 A;  4JYA H;  1XNR L;  3CQZ A;  2WAC A;  4X3S A;  1L1O A;  3GTL B;  1IBK L;  5KFI A;  2HD3 A;  3C1F A;  5C0X I;  1RTN A;  5GAG C;  1YJN A;  4MV1 A;  2Q8T A;  1N33 L;  3WOF A;  4Y52 H;  4KD3 A;  4QSH A;  5ISR A;  5C44 H;  4CC5 A;  1K83 B;  3EVQ A;  3PUV A;  2F0E A;  1K8O A;  2XGQ A;  1VCI A;  2K14 A;  3TII A;  3A7L A;  1STN A;  4POF A;  4A3D G;  1I6U A;  2R92 A;  1TT2 A;  1VF5 C;  2N49 A;  4XQJ A;  2A5H A;  2F0L A;  2W6Z A;  3T1H Q;  2NZ1 D;  3NQI A;  1XMQ Q;  4UCT A;  1RIP A;  1IYE A;  4R4C A;  5KFV A;  1YNN C;  4C3H B;  4X66 L;  3F2D A;  2GLT A;  3T5L A;  4Q8F A;  2Z04 A;  2W57 A;  4OHJ A;  4HNT A;  4IWX A;  2R8H A;  5M5W H;  3MXU A;  2JYO A;  4O7V A;  4IAJ A;  4IJL A;  1VQF A;  1EEI D;  2L0C A;  3DF7 A;  4GKK H;  2UXB L;  4JV0 A;  3M9M B;  4J9L A;  3IG0 A;  4HN7 A;  1N36 L;  4QJF A;  5AJ3 Q;  3I55 A;  2E2H B;  1TWF A;  4DR5 L;  1S0M A;  3LGJ A;  3KAK A;  1S10 A;  1ULZ A;  1HPC A;  5JEA H;  4JI3 Q;  2E2I B;  1ZHQ A;  3H94 A;  4BWG B;  3S1R B;  2Y0S G;  4TM5 A;  1N32 H;  4DK1 A;  4DR5 H;  1ICF B;  3KF6 A;  1MJE A;  1I6H B;  4KHZ A;  1IYD A;  5BYB A;  2UU9 H;  3SEB A;  3KK7 A;  2F0T A;  4GKK L;  1I50 H;  1OTC A;  5KT3 A;  1U4R A;  1WTQ A;  3ER0 A;  3U9T A;  4A2B A;  1IW7 D;  1XPO A;  2HGX A;  4A3G H;  4HJ8 A;  4ECQ A;  4GNX B;  4LFC H;  4A2A A;  1M7J A;  4K6D A;  5A2Q L;  1EY0 A;  3GTP B;  2I8C A;  2Y0S B;  2NVY H;  2WB1 E;  1TY2 A;  1VBG A;  1Q1E A;  1VKZ A;  3HOU B;  3T9C A;  2DY7 A;  5KFO A;  2YTX A;  1ENC A;  5EDW A;  4L8J A;  4TUY F;  4J1M A;  5BN5 A;  4IZ8 A;  1XNR Q;  3K3P A;  5C5J A;  1KDC A;  1LT6 D;  4PV1 C;  4QQB X;  4NPS A;  4ZKB B;  3KDF A;  4LWC A;  5C44 B;  2F0I A;  2Q8R E;  3CC4 A;  3TY5 A;  5KFR A;  4A3K G;  5M3M H;  2W8K A;  3RTX A;  4HSV A;  2ZM6 Q;  1AZP A;  1G2T A;  2ICI A;  2WAQ G;  1Z2N X;  2RCF A;  5LMU H;  2WDT A;  4NDX A;  4U68 A;  4FM9 A;  4OXP A;  2CZG A;  3GDE A;  3OWF A;  1YHB A;  2A6H D;  3FRP B;  4DAY A;  5IOC A;  2RHQ B;  1WTP A;  5IYB G;  2UVW A;  1DXM A;  3D6W A;  2UU9 L;  3M4I A;  4RAY A;  2KBN A;  1VS0 A;  3TZU A;  1JLL B;  3S2D B;  1WOC A;  4KTA A;  4ED1 A;  4K0K H;  2L1B A;  2ABJ A;  3S15 B;  2M9V A;  5L9X A;  3PSI A;  1WVL A;  3I2Z A;  3AW8 A;  1CZW A;  2KJX A;  2Z4H A;  3F2C A;  4JI1 Q;  4RNM A;  1GUG A;  2VPQ A;  1SDF A;  1D8L A;  1YHQ A;  2ES2 A;  3I4M G;  5DGA A;  5IY0 A;  4DV7 Q;  4FFP A;  4FE2 A;  1B1Z A;  4N9T A;  1JXL A;  2UXB H;  5KFH A;  1B44 D;  4PMW A;  3OIQ A;  2PCF B;  3NEN A;  2ODT X;  5CA0 F;  5ELC A;  3PW2 A;  2IP4 A;  3AFQ A;  1A15 A;  3I4N H;  4YJ3 F;  2KA7 A;  3BDC A;  2LXJ A;  4RNN A;  4C2M H;  2L12 A;  4X66 H;  4J9K A;  4U7C A;  4PBC A;  2UU9 Q;  2IPK D;  5KNC A;  3G6V A;  1RCV D;  3H6M A;  3A5U A;  1I4H A;  3OPO A;  3GTO B;  3PO2 G;  1E4G T;  3R5H A;  4XYQ A;  3U55 A;  4RB3 C;  4EYI B;  3HOZ H;  1WI5 A;  4X65 Q;  3TW6 A;  1A0I A;  1EL0 A;  1S97 A;  1A48 A;  5J2U F;  3HOU H;  3M9B A;  1IOV A;  2R82 A;  4MTN A;  3G71 A;  5IT9 c;  1CT1 D;  2NB0 A;  5LMN H;  4A93 G;  4B3R L;  3RUP A;  3MFI A;  3HS0 C;  2JEA I;  1TU2 B;  4YY3 H;  1U5K A;  1VQJ A;  4U67 3;  3LWB A;  1YNN D;  1XNR H;  1PH8 A;  3RJ0 A;  2EDG A;  3CAM A;  4DV3 Q;  4P75 A;  3CF5 A;  2ZTE A;  4CKE A;  1Y8N B;  4GOP A;  2XCL A;  5KX5 F;  4C1N K;  1GM5 A;  1VF7 A;  2B29 A;  1WTW A;  3FDS A;  4EBC A;  1GXD C;  4QIW A;  4LF4 H;  1SYD A;  4BXX G;  4IOA A;  3NTI A;  4YB8 B;  1AN7 A;  4OIJ A;  2OTJ A;  3BQ2 A;  4YWL A;  1WCM G;  1ENF A;  2YU9 B;  4GN3 B;  3SGI A;  5H1S E;  1ZQ7 A;  1X54 A;  3MFY A;  1JJ2 A;  3DWP A;  4DK6 C;  1SE4 A;  5IWA L;  3RD4 A;  4BBR B;  2NVX B;  4XYO A;  2R6G A;  3T1H L;  4A3C G;  2Y0S A;  1EFW A;  2IW3 A;  4YQW A;  1ONL A;  3NTK A;  4IFD I;  1D1K A;  1LTB D;  2NUC A;  3FPU B;  4I55 F;  1X3E A;  2UUA Q;  3CPW A;  5LL6 X;  2BE5 C;  3K5L A;  1IZ6 A;  3TZD A;  5DM7 3;  4HID A;  2CNV A;  2I87 A;  5M9O A;  5E25 A;  3SE7 A;  3G6Y A;  3I4N B;  2IBK A;  1T3N A;  2K7V A;  2F4V L;  4DAM A;  5I5Y A;  3T9B A;  3I73 A;  3GTJ A;  2K50 A;  5CBE E;  4M0J A;  2IL8 A;  3GTP H;  5I2X A;  3TRE A;  5ELB A;  3K58 A;  3B6Y A;  5KFA A;  1SRO A;  1PVO A;  4XTC S;  4KY6 A;  1I6H H;  4DAY B;  3RB6 A;  1NE3 A;  4NLG A;  4CDE C;  1RJP A;  1O7L A;  2R8I A;  1EY7 A;  2RVL A;  4NP5 A;  3W2D A;  4ZQ3 A;  5C6A A;  3A56 A;  1HR0 H;  2XC9 A;  4ME5 A;  4IZO A;  3PO2 B;  4X65 H;  4X64 Q;  2WB1 A;  2R93 B;  2A74 C;  3CSW A;  3KF8 A;  4R8U A;  2K1B A;  5DGB A;  4ED6 A;  4Q43 A;  3SXH A;  2EYH A;  1HFN A;  3BAC A;  4DUY Q;  2FP4 B;  2E74 C;  4DV0 H;  4L5Q A;  5BWR A;  4PZ8 A;  2UVV A;  5D8D A;  3BU2 A;  1PFB A;  4DUZ L;  5L1J A;  2F4I A;  5HV6 A;  4DR5 Q;  2PZW A;  5GAE C;  3HXL A;  1Q1B A;  4ECY A;  2D5D A;  4I7H A;  3QZ8 A;  3BG5 A;  2EYJ A;  3KOJ A;  4CKB A;  3CME A;  4CMF A;  5C0X G;  1AE2 A;  1C4Q A;  4LFB H;  1H9M A;  5I9P A;  3I56 A;  3CEB A;  2JN4 A;  4PZ6 A;  2NVT H;  5C4X G;  4GKJ Q;  1IBM L;  4LF4 Q;  1IKM A;  4X6A H;  3CKI B;  1NCV A;  5FPR A;  2IMW P;  4LF5 L;  2ICE C;  3GB8 B;  1RL2 A;  1PH1 A;  2B63 G;  2ASL A;  2QGQ A;  5KG3 A;  3RBE A;  3T13 A;  4BBR G;  3C2P A;  2BH8 A;  1NMG A;  2FB9 A;  2DN8 A;  2IJ0 A;  4KY7 A;  1HUN A;  1Y1V A;  4F88 A;  1QCB D;  4G4K A;  3HOU G;  1DV1 A;  3OUZ A;  4RWS C;  1F2Y A;  4HJ5 A;  5FPO A;  4C3H G;  3KXY T;  3KF8 B;  3RGZ A;  4G3I A;  1W6J A;  4IPD A;  4IWY A;  3CW2 C;  2PNH A;  2BDN A;  5LMU Q;  4GNX A;  1HNX L;  1GYF A;  2LKV A;  4C3J B;  5F2D A;  4JC0 A;  4N8F A;  3KHG A;  4KHP H;  3JAM E;  2KUM A;  4NZO A;  3WWI A;  4KHV A;  4DR1 L;  1S9F A;  1E24 A;  1OO9 B;  5BN4 A;  3HOZ B;  4HTH A;  2R84 A;  2FPG B;  3Q2O A;  4DV7 L;  3I12 A;  3HKZ E;  2C22 A;  4J9P A;  2JA5 H;  3A54 A;  3OUU A;  1D7Q A;  4C2M B;  1PV4 A;  1GGO A;  3MWE A;  4K8I A;  3PV0 A;  1BOS A;  5C3W A;  1S0O A;  1VQL A;  1K0S A;  4ECW A;  4EVO A;  5I5U A;  4B3T L;  2W71 A;  4F7X A;  1I4G A;  4CDF C;  1DOL A;  2EYL A;  2HQE A;  5JPM C;  5DLG A;  3VNN A;  1J5E Q;  2UUB Q;  3WDN A;  1I3Q A;  5JUM A;  2FLN A;  4C5A A;  4QF4 A;  3RAX A;  1DON A;  3PIP A;  1LTT D;  2O5I C;  4NKL A;  2HHF B;  1LV9 A;  1SND A;  1E4E A;  1EYD A;  4BS9 A;  3EFX D;  1CQJ B;  4CJ1 B;  5I6W A;  4C5B A;  1SMY D;  4DV0 Q;  2V9W A;  4MA5 A;  4E6I A;  1EOV A;  1TWF B;  1BR9 A;  2XRS D;  1IBK Q;  1C3O A;  3OMG A;  1KJQ A;  3I72 A;  2SEB D;  3M9N B;  4LUZ A;  4Y7N B;  1EY9 A;  1A3G A;  2X6G A;  1BO0 A;  3PN1 A;  3MR6 A;  2VNU D;  4TQS A;  3E0J A;  3QO2 A;  2NVX H;  4IUP A;  3H91 A;  5FOB B;  4LF8 H;  1TWG H;  1KIX A;  5DQG A;  4HR7 B;  5ELO A;  1L2F A;  4HMJ A;  4J