1FVIA

Crystal structure of chlorella virus dna ligase-adenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
264
Chain Sequence
b'AITKPLLAATLENIEDVQFPCLATPKIAGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMPRFPVFIGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORELLA VIRUS DNA LIGASE-ADENYLATE
publication title Crystal structure of eukaryotic DNA ligase-adenylate illuminates the mechanism of nick sensing and strand joining.
pubmed doi rcsb
source organism Chlorella virus
molecule tags Ligase
total genus 72
structure length 264
sequence length 292
ec nomenclature ec 6.5.1.-:
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fviA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1fviA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1fviA01
1U5KA 3CF5A 1ASYA 3BA8A 3CCUA 3I7FA 3KYHC 1P8LA 1E7ZA 3KOJA 4IPDA 4DR6L 4YY3Q 3S24A 4JI7L 2NVXH 1PVOA 1VS0A 1Q12A 1X56A 1MJEA 2IY5B 1L1OB 4LFAL 4BBSH 2Z6KA 3OTOQ 3J81j 1IBML 3HOVH 4LUZA 2F4VQ 2N3SA 1BBUA 3UE0A 3S16H 4JI2L 3J80i 4DUYL 1CUKA 2JJQA 1VQMA 4FDBA 1YJNA 3RNUA 1KIXA 3ERSX 1I94Q 4TVAB 4P72A 4P71A 4YCVA 4EEQA 3J81i 4QL5A 3RR5A 5IWAQ 4A93G 4JYAQ 1SLJA 4DV4Q 4O0AA 4X65L 3W1BA 1XMQL 1PH2A 3ULPA 2K50A 3RZOH 4GN3B 4JOIC 4UFZA 4LF5Q 2VW9A 3I55A 3CMEA 1SFOH 4DV1Q 1VQ6A 1UEBA 3HKZE 2R92G 4YHHQ 2CKZB 2CCZA 3LGJA 4IPCA 4LF6L 3SGIA 1N32L 3CPWA 1I5FA 5K36G 2OQKA 4QJFA 3PF5A 1YJ9A 2E2JH 1IZ6A 2RHQB 4HJ9A 2NVQH 2VUMG 1QUQB 4NXNL 4DR3L 4EFBA 3I2ZA 2BH2A 5LMUL 1L0WA 3T1HL 3FHWA 3A5UA 3H3VH 2MO1A 4OWTB 5GROA 4A3EH 2IX0A 4GNXB 1YJWA 1X55A 4R4IA 1QVFA 3HOYH 2PNHA 5GAEC 3OW2A 3CMAA 5JJIA 5HGQA 2CQOA 2ZJQA 4LF4Q 4LH7A 2D0OA 2UUAQ 3BZCA 4JI3Q 4Y52H 1K83H 3RLNA 1FJGQ 4BY7G 1YITA 2BH8A 4DV5L 5IYBG 2XTIA 4NXMQ 4IOAA 3D31A 1L2FA 1R9TH 1N34Q 1VQGA 4YCUA 4OWXB 4A3GG 2KHIA 4DAYB 4LF7Q 3H3VI 4AIMA 4GKJQ 2WP8J 4LWCA 4P74A 2HQLA 5BR8L 1K8GA 3TY9A 2E2HH 4KHPL 5AJ3L 4XTCS 1H95A 5ELNA 1SMXA 1WJJA 2LSSA 2RCNA 3BZKA 3E9HA 1MIUA 2VY3A 3AFPA 3K7AH 3KLWA 3ULJA 1YIJA 1XPRA 3S17H 2OTJA 1KQSA 1A63A 1YHAA 4LFCL 2Q2UA 1UE7A 1MKHA 1RL2A 1HJPA 5M3MG 4DR2L 1HNXL 4IOCA 3HOWH 3KF6A 4DUZQ 1PH6A 5C3EH 3CCLA 2K52A 2YTYA 3NEMA 3CCQA 1C7YA 5FPRA 1EUJA 3BABA 4P75A 3TRZA 4A3KH 2HIVA 5JEAG 4BBRH 4JV5L 1S68A 3TY5A 1JJCB 2I5MX 4CC6A 4JOIA 2K75A 4AYBG 2ZJPA 3PF4A 4BA1I 1JJGA 2Y0SE 3HOXH 2QA4A 2JA9A 1KL9A 4PZ8A 4UCSA 1XTDA 1HR0L 2F52A 2JQOA 4JC0A 4X62L 4A3JH 1K73C 2WAQG 1JB7A 1TXYA 4OX9L 3PUZA 1K9MC 3K81C 3UDIA 1KRSA 5FJ8H 2ZJRA 1UE6A 2PI2A 4PMWA 5IT9c 3H0GG 4JI1Q 3CCJA 1WCMG 2ALYB 2A8VA 4B3TL 3RN5A 3HOZG 1UE5A 1VQLA 4R1JA 4X66Q 2R7FA 2PMZE 4GOPA 1HR0W 3PO3G 2NZOA 2YV5A 3NBYB 2KCMA 1OXSC 2AWOA 3BU2A 2HIXA 3W1GA 4IFDG 1T9HA 3CAMA 5JJLA 2NN6I 1Q8KA 2E5LQ 4IJLA 4JI8Q 3GTOH 1XDNA 5C44H 2JA5H 1BVSA 4A3MH 4UY8C 2KENA 1A0IA 1G6PA 2K5VA 1PH8A 2Q2TA 4GN5A 3NC0B 1QVCA 4DV0L 2QGQA 1IBKL 2R7ZG 4JI4Q 4AYBE 3PO2H 4UCOA 1E22A 5IP7G 4O2DA 3CP0A 1YI2A 3HKZG 3S1MH 4UCUA 2D0PA 3MEFA 2ZTCA 1Q7YC 4A3BG 4DR4Q 2JK8A 4QQBX 1KXLA 2HVSA 2B63G 1VQ9A 1KD1C 3F2BA 3GDEA 4DV3Q 4ALPA 4YWMA 2JA8H 5D1OA 2LXJA 1VQPA 3L7ZC 1AH9A 4YY3L 4BY1H 1E1OA 3GTKH 1I3QH 2CWAA 5IP9G 4IO9A 1PHJA 1QVGA 1FVIA 1JMCA 2JE6I 2CFMA 1VQAA 2A1AA 5IYDH 1VQKA 1NY4A 3OTOL 5DISC 5LMNQ 4POFA 2WFWA 2F4VL 2K5NA 4A3DH 2BA1A 1Y14B 3CCVA 1L1OC 3PGZA 2UXBQ 1SROA 2UXCQ 4JI0Q 1NMFA 1I94L 2VQFQ 1N33Q 2GVBA 3GTGH 2IT1A 2VQEL 5IWAL 1SRUA 1VQJA 2EQSA 2PI2E 2YTVA 5C0XJ 1JE5A 4HIKA 4MZ9A 4DV4L 1TAEA 1XNQQ 4A4IA 5FLMG 2RF4A 2JA6G 1P16A 3KJOA 1IBLL 1O7IA 5GAGC 3GTJH 2VZAA 4LF5L 1YHBA 5C3EG 3M9BA 3UDXA 1W3SA 3FP9A 2R93G 1RIPA 4E6NA 4Y7NH 4DR6Q 1CSQA 5C0XI 1XMOL 1EFWA 3CCSA 1J5EL 4LF9L 4OO1I 3CC7A 3M7NA 4POGA 1IBMQ 4DPGA 1XNRL 2ZM6L 2K5HA 1MJCA 5H1SE 3S1RH 1B70B 1OXTA 4JI2Q 1XK5A 2KHJA 1Y1VH 1WOCA 3TREA 4B3RQ 2I5LX 2OWOA 3F8TA 2NZHA 4DV7L 4HJ7A 5EAYA 4A3IH 3UE1A 4AH6A 1HNZQ 3I4MH 5E7NA 4AQYL 1XPOA 3U4VA 4C3HH 4GNXC 1N9WA 2VNUD 3TY8A 1WFQA 3CQZH 1OXXK 1HZAA 5J3BA 1XMQQ 1VQ5A 1PH3A 4LF4L 1I6HH 3IRBA 1Y1WH 4JI3L 5M5YH 2B3GA 1G51A 2PQAB 2Y0SG 3K7UC 1FJGL 2Z0SA 2E2IH 4LF6Q 1CKNB 2YYZA 3WWVA 5C4XG 4LW1A 3E0EA 3PIPA 3GTLH 2R7DA 1NE3A 2F3IA 3ER0A 3PIOA 4HJAA 1N34L 1TWAH 4K0KQ 2ZTEA 3M85A 2C35B 4A75A 1PH9A 1LYLA 3RN2A 3S1QH 3S2HH 4GKJL 3NBZB 4A3CG 1VQCA 3ZJYC 4GOPB 1SN8A 3G6EA 2A19A 2DUDA 1K0RA 2E8GA 4A3FG 3U50C 4B3ML 2JA7H 2UU9L 3FKIG 3K8AA 5IYCH 3NBHB 1SE8A 3PO2G 4PG3A 3M3YH 3HOUH 3S14H 1VCIA 4PZ6A 4R4CA 4A3LG 2QEXA 3STBC 3UDFA 4BXXG 2N8NA 1X3EA 1D7QA 1HH2P 3GB8B 2HHHQ 4PZ7A 3KJPA 1VQHA 1WI5A 2UUCL 5M3FG 1QZHA 4DV5Q 3JSNA 2VL6A 1EOVA 2OQ0A 4B3SQ 4CC5A 5IYDG 4JI6L 3UQ8A 1E1TA 1VQFA 4NB3A 5C0XG 4DR7Q 1N36L 4BBSG 4GKKL 3HKSA 3KFUA 4YWLA 1HZCA 5GQOA 5BR8Q 3A74A 1YBYA 2BA0A 4GLAC 4A93H 1WYDA 2ID0A 4DKAC 1S72A 2VS1A 1FGUA 1SR3A 4DV2Q 3H15A 1VQBA 3K0XA 3G48A 2Z6KC 5GAHC 4DR5L 2UUBQ 4JCVE 2R92H 2UXDQ 2K14A 2HVQA 4GNXA 3TS0A 3U4ZA 2E5LL 4JI8L 4JV5Q 1V43A 4JBKA 3HFZB 3F2DA 2VUMH 5DLQE 3CCEA 3JSLA 4JBMA 1CKOA 2B29A 4UP8A 1Z47A 1YZ6A 3PUVA 4UCRA 4LF8Q 4ME3A 1EIYB 4LFBQ 4JI4L 4OX9Q 1YNXA 2FXQA 4RMFA 4EX5A 1PA6A 3BA9A 4A3EG 1E3PA 2GN5A 4YWKA 1X9NA 1DGSA 1GD7A 4DR4L 4HIDA 3KDFA 2KCTA 4JI5L 2XGTA 1EYGA 3HOYG 3EIVA 1C9OA 3D0FA 3EBEA 4NPSA 4DV6Q 2WB1G 4BY7H 3RLOA 5IYBH 3KF8B 1X3GA 2I0QA 1PH7A 3T1YQ 1LTLA 4R4OA 2DGYA 1NTGA 1B7YB 1FL0A 4P73A 3CXCA 2YTXA 1S40A 1PH4A 3I4NH 5C4JH 4A3GH 3PN1A 2KBNA 3PV0A 1X3FA 5HY6A 4C2MH 4DK3C 1PH1A 3QWUA 4X64Q 5IY0A 1GKHA 4JBWA 3AFQA 3I4OA 2UXBL 2MNAA 3CW2C 2UXCL 3W5OA 4DV0Q 1N33L 3A5ZB 2HVRA 1JT8A 1HNWQ 1IBKQ 3PUXA 4DR1Q 3Q8DA 1TWHH 3TQYA 5M3MH 3HOVG 4L5TA 5LMNW 4JYAL 1EQRA 2JEAI 1VQNA 3HOWG 4OWWB 4L5RC 1A8VA 3MXNB 2VUGA 4YCWA 2YU9H 1N8RC 4C3JH 4GLVB 3JAMc 4DV1L 3CCRA 3K80C 3M4QA 3G71A 3PUYA 4YHHL 1NJIC 3B6YA 4A3KG 5IE8A 4JI7Q 4BBRG 1M1KC 1S3OA 2N49A 1BBWA 4LFAQ 1ASZA 4L5SA 1C0AA 3GTQH 4LH6A 2WB1E 2N78A 3KF6B 1X54A 2NN6G 3CPFA 1X65A 5JEAJ 4QGUA 2IHFA 3PCOB 3HOXG 1V1QA 4LNQA 4DUYQ 5FPOA 4JG2A 1IL2A 4B3RL 4IJHA 4UP9A 4A3JG 1HNZL 2VQEQ 1XMOQ 3H0GH 3NENA 4HJ5A 1Q81C 1WCMH 3HOZH 1EQQA 3ULLA 5FJ8G 4X65Q 1G291 1VQOA 1IBLQ 2Q2IA 2RHSB 4R4TA 4GS3A 3PO3H 3RTXA 2HT1A 3J80c 4GN4B 2UUAL 1XPUA 3G4SA 1I50H 3VNNA 1PYSB 1A62A 1NMGA 1N32Q 1PV4A 3AYHB 4UPAA 1IXRA 3TEHB 3J81c 1J5EQ 4LF9Q 4IPGA 4NXML 1YEZA 1QZGA 1HZ9A 3GO5A 5C44G 4KLKA 2ZM6Q 2JA5G 1XNRQ 1X6OA 3GD7A 4IFDJ 4LUOA 4EQ5A 4A3MG 1KC8C 2K4KA 3E9IA 4DR3Q 4LF7L 4NXNQ 2AKWB 2IX1A 3S1NH 1XJVA 1PH5A 2ES2A 2AMCB 5LMUQ 2R7ZH 3T1HQ 4KHZA 4OXPA 4GOPC 3VDYA 5IP7H 4DV7Q 2ATWA 4APVA 4A3BH 4EFEA 4AQYQ 3EN2A 1TWGH 1VQEA 2B63H 3NELA 1PFSA 1L1OA 4IFDI 4IPHA 2AWNA 1UE1A 2MO0A 4C3IH 4QY7A 1KRTA 4DUZL 4LUVA 2HHHL 3DM3A 1VQ8A 2GVAA 2ASBA 1W2BA 5IP9H 2MQHA 3I56A 2JA8G 3A0JA 3JC66 4TQUS 4MTNA 1Q1EA 3M4OH 1UWVA 4BY1G 4B3SL 5JJKA 3I4NG 4BA2I 2I5HA 3KDFB 4R4QA 4DR7L 2H5XA 4QIWE 1EWIA 1K8AC 1GO3E 4A3DG 1AE3A 1YVCA 4OO1G 5M5WH 4KHPQ 5AJ3Q 4L5QA 1HZBA 4B3MQ 1E24A 4MNOA 1Z9FA 1TA8A 5FLXc 1VQDA 2UU9Q 4UCTA 5D1OB 5FLMH 5M5XH 2D62A 4DV2L 2JA6H 1V9PA 1EIFA 1TWFH 3RZDH 3TS2A 1B04A 4JI1L 4LFCQ 2IHEA 3PSIA 4DR2Q 1HNXQ 4X6AH 3L2PA 1QUQA 1Q86C 2EXDA 1BKBA 3AQQA 4X66L 2UUBL 2R93H 2EIFA 2UXDL 1NBWA 4RG1A 5GADC 2UUCQ 1KAWA 3ICEA 4DRFA 3S2DH 5D1PA 2NVTH 1TWCH 1OXVA 3UDGA 3CC2A 1LM0A 4HIMA 2OCEA 4H02A 4OONA 3F2CA 1VQ4A 4JI6Q 3L0OA 2CWPA 1AE2A 1N36Q 1VQIA 4GKKQ 1PYBA 4UP7A 3DLLA 1OTCA 4JBJA 3OYYA 4J15A 5ELOA 1U0LA 2L15A 2PQAA 4X62Q 1HR0Q 2OTLA 4LF8L 3AEVA 4LFBL 1JJ2A 4DAMA 1CKNA 1Y1VG 3GTMH 2V1CC 4HJ8A 2LXKA 3BJUA 1CSPA 4XIGS 1B8AA 4A3IG 4K0KL 3I4MG 1Q46A 4DV6L 1CKMA 2Q2HA 2ZTDA 4B3TQ 3PUWA 4DR5Q 4A76A 1J6QA 3CD6A 1D8LA 4DV3L 4KI0A 1VQ7A 1Y1WG 3CCMA 1GM5A 1GVPA 3U58A 5C4XH 3T1YL 2NVYH 3STBD 3GTPH 1OXUA 3RLFA 4DNIA 1M90C 3S15H 4GLXA 2MFIA 4X64L 5LMNL 1Q82C 4A3CH 4WJ4A 1LUZA 3GJXB 3M4PA 2JEBI 3J7ZC 4A3FH 3BAAA 4DK6C 1HNWL 3JAMi 4JI0L 4WJ3M 4UCVA 4DR1L 3FKIH 2R6GA 2VQFL 4A3LH 3CC4A 2JA7G 4JI5Q 5IYCG 1XNQL 4BXXH 2AHOB 4HIOA 1IYJB 3HOUG 1KHIA 1YHQA 2WAQE 3J7A5 3F1ZA 1K3RA 5M3FH 1Q1BA
chains in the Genus database with same CATH superfamily
4Q4DA 2V59A 3CCUA 2EJ2A 2C2RA 4DR6L 3KOJA 2VB2X 5FLXL 3GTKB 3H6MA 4JI7L 1ZYRD 1VS0A 2IY5B 4O2BF 4LFAL 2C22A 2B2YC 3OTOQ 4LUZA 5ELDA 2CNUA 3OWFA 2F03A 2N3SA 1T94A 4JI2L 3J80i 4DUYL 2CVRA 4I7ZC 1B53A 5DGBA 4FDBA 3G6JB 3OUZA 1YJNA 1B4OA 3OSOA 5KFSA 4DL3A 4P72A 4EEQA 5G3LD 5FLXW 5DGAA 4JYAQ 5DM73 1JR0D 4LK1C 2A6HD 3W1BA 5KYIA 1XMQL 2IL8A 3VR4A 3WO0A 1DCZA 5IGDA 2RDGA 4LF5Q 1B3AA 2RQXA 2W6QA 4ECRA 4YHHQ 1SFOB 2CKZB 4LF6L 4IPCA 4LF8H 4OX9H 1WRVA 3R8BA 1WTVA 1G2TA 4YAJB 1XWEA 2E2JB 2QCPX 4Q0FA 2HGSA 4FM9A 1RODA 2FHTA 4IUQA 3IFTA 3M7GA 5LMUL 1L0WA 4HNVA 5I5TA 4DV6H 3NWTA 2MO1A 2IX0A 4QCLA 4FF1A 1QVFA 2CH4W 4O7NA 1E4FT 3CMAA 3V6HA 2CQOA 4LH7A 1RHPA 2D0OA 4J9KA 1Y1WB 3BDLA 1K83B 1V1PB 4FFMA 2BH8A 5CV7A 4DV5L 3SXHA 1U4PA 2E2IB 2R7MA 4N9TA 4DV0H 5C3WA 4IOAA 2YS6A 2CW7A 5KG0A 2VQFH 3MFYA 4EEYA 1R9TH 2A69D 3V05A 3VA5A 5ELFA 5IT9E 4DAYB 5KFNA 5I5SA 4P74A 5KNBA 1LT6D 2HQLA 2EYMA 1I4GA 2F0DA 5AJ3L 3JZ6A 2E2HB 3KHRA 1WJJA 2B2YA 3URYA 2YL2A 3ULJA 3K7AB 4B08A 1A63A 1AEXA 1KQSA 3NBIA 3S17B 4JI7H 3DWQA 1RL2A 5CMDA 1K8MA 5I6WA 2DAAA 4EBEA 2B2VC 4DUZQ 1CHQD 1KDBA 4BS9A 3CCLA 1ZAUA 3CCQA 4LFAH 1GYFA 4ZCKA 3R5HA 3FDSA 1PRTC 2BR0A 4JI2H 3TRZA 1KT8A 5T1IA 1MHWC 1KEEA 2XGPA 3CU7A 5JEAG 4DUYH 3FPUB 1K28A 1JJCB 4RGNA 2I5MX 2XIWA 1DV2A 3ETHA 4XQJA 3PW2A 1WCMA 4ODGA 1I6UA 1LABA 4F4ZA 1OWTA 3HOXH 2EYHA 3MWYW 2QA4A 5EGTA 2F52A 4ZOLF 5FO7B 3KALA 4YJ3F 1B2TA 1K9MC 5AFWA 1S4ZA 3QOLA 4G7OC 1UE6A 4PMWA 4RZQA 4LF9H 1LT5D 4JI1Q 1WCMG 3Q1KA 4R1JA 3PO3G 2NZOA 5KFJA 3S9WA 3BDCA 4HCEA 1OXSC 3BU2A 3J7YW 5LMUH 4DL7A 2EYLA 3GTOH 2JA5H 1M4VA 4CDCC 1BVSA 2NWGA 4ECVA 4YR2A 4A3MB 2KENA 1RJPA 3RF2A 1G6PA 5FNVF 3A8IE 1DOLA 3NC0B 1QVCA 4F87A 1IBKL 3RB3A 1E22A 5IP7G 3S1MH 1YI2A 4DV5H 4UCUA 2D0PA 2B8GA 4A3BG 1SNOA 1D2BA 1VQ9A 5K3WA 1ENFA 4FFLA 4DV3Q 4ALPA 5KFMA 3L7ZC 2K33A 2JA8B 4BY1H 4N8X1 5I5VA 4L8JA 3EPIA 3BA8A 4IO9A 4YIJA 1JMCA 2B2VA 2JE6I 2UU9H 4CDFC 3OTOL 5KT5A 1CA5A 4NZOA 5L1IA 2B2UC 4OO1H 5CE8A 1JKJB 1IKLA 2LY7A 2K05A 4CHTB 4DAVA 2IP4A 1K1QA 2FLPA 3GTGH 1TWHB 1SRUA 3OW7A 5C0XJ 1JE5A 2RF4A 1P16A 2K01A 5FR9A 4H7BA 3KJOA 3GTJH 4LF5L 3TMEA 5KT3A 3T54A 3UDXA 4O7SA 2QK4A 4H0LC 4E6NA 5C0XI 5DNFA 1EFWA 1CT1D 3CCSA 1E4EA 4FFRA 4RKLA 3CC7A 2F0VA 3M7NA 4POGA 4DPGA 1MJCA 1B70B 1ILPA 1OXTA 1SBBB 1BBXC 5C6AA 2ZXPA 1D5XC 1LTID 3TREA 2I5LX 2OWOA 2B2WC 3R5XA 5LHY1 2P0AA 3R3OA 1WD1A 1N9WA 2PVPA 2F0MA 3I4MB 4O1NA 3HB9A 5FD5A 3CQZB 4ZUJA 1I6HB 1O7LA 2KCCA 2B3GA 1G51A 2PQAB 2WKCA 1WD0A 3MFIA 2YYZA 3CHBD 3E0EA 2C28A 1IBKH 1LO5D 4HJAA 5JJZA 3DXJC 1TWAH 1PFBA 2G9HD 1RDPD 4A75A 2X6LA 1XXGA 3N44B 3ZJYC 3S2HB 1SN8A 4ULLA 3MXNA 4FF3A 1S03G 2R8HA 4I4TF 2DUDA 2A1HA 1FNWA 5LP6F 4R8UA 2QDBA 4DAAA 1VMPA 4BWGB 4P2CB 3V4ZA 4TQRA 2JA7B 4PZ6A 3LP8A 2F0KA 3S14B 2QEXA 4RA8A 3QFFA 3TW6A 1HFNA 3OTOH 3UDFA 4PZ7A 3KJPA 1EKVA 5GONF 5M3FG 3SE0A 1QZHA 3HEJA 3MEHA 1SNPA 3ND9A 1EOVA 2GPWA 4B3SQ 2J9GA 4JYAH 4DR7Q 1ESRA 2W9BB 2R82A 1GXDC 4MTEA 1D1KA 3KFUA 2COGA 2K7VA 3NTHA 3A55A 4FGRA 3DEPA 3K59A 1YBYA 4LF5H 4CKEA 5FOBB 4IN3A 4ZAIA 4O3OA 1OO9B 1QNKA 2ID0A 1S72A 2WYOA 1FGUA 4A93B 1EKFA 1XX8A 4DV2Q 4Q8FA 3DWAA 3G48A 2UVWA 5C4HA 2B2WA 2Z6KC 4DR5L 2UUBQ 3H20A 1H9KA 3Q24A 2K14A 4DF7A 2K28A 3U4ZA 3TS0A 2FB9A 5ISRA 1V43A 3HFZB 2RGRA 1CK1A 3OSPA 2VUMB 5DLQE 3CCEA 2HDKA 3CSWA 2B63A 3F2UA 4JBMA 4UP8A 1I4QA 4OEMB 3SDZA 2DPJA 4LFBQ 2XSCA 4RMFA 5JVG3 2G9DA 1DZ1A 4J9RA 2EOTA 4OGQC 1R9TA 2XGTA 5J22A 2Y0SB 1ET0A 3PW0A 2C2DA 4BY7H 5KFXA 2W9CA 2I0QA 1PH7A 1U4RA 2NVYB 4G7ZC 4DLKA 1LTLA 4R4OA 2IX3A 1SJHD 4P73A 1B7YB 3K3PA 3I4NH 5C4JH 4A3GH 5HY6A 4C2MH 4EGVA 5DAUA 1PYWD 2DJFC 4G4KA 1TWFA 5IY0A 4EGQA 4JBWA 2MNAA 4UDUC 3KLRA 4JXUA 4DUZH 1TS5A 3W5OA 2Z6BA 5C4ZA 4DR1Q 4DNTB 3AU7A 2R85A 4O82A 3P75A 3E5NA 4IHJF 1A3VA 3RV4A 2CW8A 1SYBA 4ECUA 1F2YA 2SNSA 2AUJD 1EQRA 3BQ1A 2JEAI 1VQNA 4G57A 4HR7A 4ED6A 1U4LA 3G7LA 3LULA 3CVZA 2GA4B 2EPBA 2YU9H 3Q8RB 4C3JH 4HTHA 5DLFA 3K80C 4K6DA 2RDJA 3B6YA 4ECWA 4KKSA 5IE8A 2ZJTA 1Q3LA 3LNNA 4BBSB 4PBCA 3G6YA 4L5SA 1C0AA 2CH4A 4JI1H 3KF6B 1PTOF 1I4RA 1LTTD 4NP5A 4LNQA 4HN2A 3HOXG 3PCOB 2R6FA 1PX2A 2WAQB 2FKLA 1OBDA 1EOTA 4FXGC 1GUOA 5TSSA 4EBDA 2R7LA 2VQEQ 2VPQA 3H0GH 4HJ5A 1Q81C 3OSNA 1IYUA 5JPNC 4IWXA 2FK1A 3GTOA 3SK8A 2JA5A 3N6RA 4WHXA 5BN3A 2HT1A 4BWSC 1KAAA 1XPUA 1EIHA 1I50H 3VNNA 2VPSA 3RUPA 1A62A 1PK8A 4UAIA 1I1KA 2FK3A 4UPAA 1J5EQ 1IXRA 1ET9A 2XRSD 4NXML 4IPGA 2IA6A 1YEZA 1BCPC 2RVLA 1HZ9A 2V9WA 3GO5A 3N42B 1CQIB 2ZM6Q 2JA5G 4IFDJ 1CZWA 3C3LA 2FP4B 4CJ2C 3S1NB 2R7ZH 3LQSA 4DV3H 4KHZA 4GOPC 3VDYA 3BG3A 1SNDA 2LS01 4EFEA 1X3PA 2EY5A 1SE3A 1TWGH 3K6OA 5CORA 5G3LF 4IFDI 4IPHA 4C3IH 5KFZA 2C2EA 1CE8A 1EY6A 4QY7A 1KRTA 1YNJC 4LMYA 1RTOA 1PZJD 1VQ8A 1ZETA 5COYA 5EZYF 1DM0B 2XD4A 2XWBB 5LL6X 4BY1G 4B3SL 3GTGA 2HHFA 1QILA 4DR7L 5KT4A 2H5XA 1GO3E 2J7ZA 3MWDA 3GTJA 2E76C 5M5WH 4OO1G 4ECSA 1HZBA 1B50A 4B3MQ 1E24A 4MNOA 5D1OB 2ENBA 1EYAA 5HGTA 2VXWA 1V9PA 4DV2L 2JA6H 4QWDA 4DN4M 4KJOA 4H44C 4DR2Q 2AUKA 5M9OA 3L2PA 1AUXA 1QUQA 2UUBL 1BKBA 2R93H 1NBWA 2H4OA 2KECA 3JAMW 4JV2A 4MTDA 1TWCH 3S2DB 4HIMA 2QILA 4JI6Q 1HPCA 1AE2A 3H40A 1NAPA 2CNQA 1FD7D 3DLLA 4J8QA 2KVMA 1HR0Q 3K5OA 4LFBL 4EQPA 1JJ2A 4DAMA 4QWCA 4XIGS 1S5BD 2O4XA 1IYVA 3AX6A 1BDOA 1CKMA 1KDAA 2Q2HA 4ABNA 1S5DD 4YR0A 2F0EA 2AGQA 4KI0A 1GVPA 3VPDA 5C4XH 2AGPA 3GTPH 3NBHA 2JEJA 1M90C 2DPIA 4R9WA 3MTSA 4A3CH 4WJ4A 1RD9D 5DG8A 1LUZA 1WTOA 1KBLA 4E6IA 3M4PA 2JEBI 1BO0A 3J7ZC 2ZDQA 4DK6C 1H9RA 1FNVA 4A3FB 3ONAB 4DR1L 3FKIH 2R87A 4IRDA 3CRKC 4IUVA 3PO2B 3CC4A 4ZKCB 1DXMA 3R2IA 4JI5Q 4B3SH 2AHOB 3NXWA 3VMMA 1IYJB 1IKMA 3J7A5 3F1ZA 4DR7H 4IIJF 1JQYD 1AZPA 3QO2A 1Q1BA 5CGKA 1U5KA 5EBDA 3CF5A 1VMCA 5F9LA 1P8LA 3V4SA 2NVXH 1PVOA 1Q12A 5C0XH 1MJEA 1L1OB 3DMUA 3J81j 1VBHA 5EQ0A 4DV2H 4J6HA 3WWHA 1BNCA 3O13A 2FJ2A 3H94A 2I8CA 1CUKA 1SEBD 5EOYA 1S0NA 4TVIA 2JJQA 2IBKA 2UUBH 2OLSA 3M4IA 1MSGA 2LMCB 1KIXA 3NPPA 1I94Q 4TVAB 4L1KA 4QL5A 4HSPA 5IWAQ 4HSVA 4YBZB 1SLJA 2YYAA 3NUCA 4DV4Q 4RH6A 1PH2A 4CDDC 3BG5A 4UFZA 2RSNA 2VW9A 3I55A 4O42A 1SFOH 1VQ6A 3MR6A 1UEBA 2NU9B 2PCFB 4U673 1VKZA 1OBGA 1I5FA 1U4MA 4LFBH 4QJFA 3PF5A 1JB3A 2E2JH 1O80A 2EJGC 2PNRC 1IZ6A 3NHHA 4CGYB 2NVQH 3N40P 2SOBA 3RAXA 1B6RA 1PZKD 2YWVA 3I2ZA 2IMWP 4RB1A 1KJQA 3SNOA 4EGJA 3OWEB 4OWTB 5GROA 1WTWA 1YJWA 2PNHA 2I46A 3HOYB 1B9MA 4H13C 3W2DA 1EY9A 5HGQA 5JJIA 1A0GA 4ZHQF 4C2MA 3SK4A 1HXYD 2WB1B 4ETSA 5KX5F 4NDXA 3IN5A 1K83H 2KCNA 1D5ZC 2Q8RE 5CR5A 4BY7G 1LTGD 1LACA 2XTIA 1G6ZA 4DR1H 3GTLB 4XZ3B 2TMPA 3D31A 2EZVA 1VQGA 4OWXB 4ZI7F 4A3GG 1HA6A 4RFBA 4CKBA 4LF7Q 3H3VI 1KJ8A 1TY2A 3T4AC 5BR8L 1K8GA 2E2HH 4I50F 3GV8B 2YU9A 5I9PA 3ORRA 4XTCS 5ELNA 5LL6S 2LSSA 3K7AH 1MIUA 2VY3A 3AFPA 1XPRA 3S17H 1UUPA 3Q22A 3HOVB 2OTJA 1MKHA 4DR2L 1HJPA 4IOCA 2JYOA 2YTYA 1C7YA 4O4HF 1UC8A 1EUJA 1S10A 4MV3A 4C3JG 2HIVA 5DG9A 4F4WA 2EJMA 2DLNA 3GILA 1NSNS 3H0GA 4AYBG 1JJGA 2NN6H 1AP0A 5HV6A 1EYCA 4UCSA 1HR0L 2EDGA 1BCPD 3DM1A 1K73C 1JB7A 1NCVA 2F0WA 4OX9L 3PUZA 1I50A 4O3SA 1SCUB 3NE5B 3UDIA 3J81L 2PI2A 5IT9c 1J5EH 3H0GG 2AQ3B 1PXUA 2ALYB 3CCJA 3RN5A 4QW9A 2ICIA 1VQLA 3IFDA 3RUZA 4QIWB 2PMZE 3PMFA 4HMJA 4M1UB 3UI2A 4X66Q 1HR0W 2NZ1D 2YV5A 3NBYB 2W8KA 1FKAH 5KGUA 3W1GA 2EE1A 2HDLA 1TVXA 5BWXA 1YNJD 5ELBA 1SEIA 1JXLA 2R7KA 3GV6A 1WSCA 5C5LA 5C44B 4A3MH 1TWGA 4APMA 3D3RA 5HURA 2NU6B 3KK7A 3H4DA 5KFQA 1S5ED 1D1IA 5BWTA 4DV0L 1W6KA 3KBGA 2QGQA 1JWSD 2R7ZG 1VAJA 3CP0A 4ZUIA 3MEFA 2UVVA 1YNNC 2HVSA 3MR3A 2HDMA 3K5NA 5KFCA 4V0BA 4DNRB 1KD1C 2W6PA 3V2TA 3W3AA 4IUNA 3GDEA 3QB3A 1BJTA 3OOCA 3TP7A 4DGZA 2JA8H 4TM5A 5KFVA 1EYDA 1AH9A 5BR8H 1E1OA 4DK0A 1I3QH 1ULZA 4B3MH 5CV5A 1FVIA 2CFMA 1VQAA 2JA6A 2RSOA 5LMNQ 1HTPA 2WFWA 3X3NA 2K5NA 1MZBA 4QWEA 4DR2H 1PDQA 3PGZA 4PMCA 2F0UA 1CM9A 2R93A 2UXCQ 5CV9A 1B9NA 4PQXA 4JI0Q 1GUSA 2FMCA 3NTIA 2FPIB 1I94L 3SR1A 4Y8VB 1I2KA 5KG3A 2GVBA 1RYSA 5NUCA 5IWAL 1VQJA 2EQSA 1TWCA 3T5JA 3HRZC 1TAEA 4MZ9A 4XQQA 4DV4L 1XNQQ 1GSOA 3MWMA 2JA6G 4RUAA 5EWGA 4JI6H 4K6LA 1B1ZA 1GUTA 1O7IA 5GAGC 5C3EG 3M9BA 5I60A 4JV0A 4RB3C 3FP9A 2R93G 4IZOA 1HR0H 1SMYC 5J39A 3KBXA 4LF9L 1IBMQ 5CR3A 2NU7B 2CQAA 5EKKA 2DABA 4QSHA 1PRTF 4HMIA 2YZLA 1JWMD 1F9SA 2KHJA 2W8LA 4F8MA 1K0SA 2W57A 1Y1VB 4X3TA 1EY0A 4HJ7A 1HNZQ 1X32A 3I4MH 5E7NA 4AQYL 4A3IB 3U4VA 4QUFA 1XPOA 2VNUD 3L4JA 1WFQA 3CQZH 1I6HH 5ELCA 4K5XA 1EUDB 1AW7A 4NMZA 2QB5A 2DNCA 5I2XA 4CHIA 5M5YB 4KTAA 2PMZA 1MSHA 5D14A 1CKNB 3FKIA 5C4XG 1NE3A 3PIOA 3HG9A 2ZTEA 2FPPB 3BYYB 3RN2A 3NBZB 3S2HH 5JQGF 3T56B 3Q0AA 4QWBA 4A3CG 5JVLA 2PPBC 4J9QA 4XYOA 1BOSA 3EPGA 3BVMA 3U50C 5F9NA 4RNMA 2JA7H 2UU9L 3FKIG 4MV4A 2MCTA 3NP8A 4HEDA 2NVXA 4PG3A 3S14H 1VCIA 5I2YA 3T9CA 4O7RA 3C0FB 4O81A 1HH2P 1GUNA 2HHHQ 2R3ZA 1WI5A 1HTLD 2HD3A 5LL6b 4YP3A 3A7AB 1DIKA 1JLLB 4YQWA 1I94H 2WIIB 5IYDG 3UQ8A 5IWAH 1E1TA 1L0YB 1I6VC 5C0XG 4DV4H 4KMUC 3HKSA 1HZCA 5EJWA 4PDBA 2EXZA 5C5JA 1SFOA 1S0MA 4A93H 5KG5A 2Z9HA 2D5DA 2VS1A 1ZQ7A 1SR3A 1EKPA 5KT2A 2HJWA 5IYZF 5T14A 2HG8A 4U6PA 5K36H 2R92B 3HO8A 2HVQA 5FKAC 1BNZA 4RB0A 4M0JA 4JV5Q 3NGDA 2NBFA 2QEJC 2JXMB 1J9OA 3K5IA 2VUMH 1C3OA 1A2UA 3X3MA 1GUWA 4AQYH 1JICA 2ZXRA 4OIKA 3PUVA 2XGQA 4UCRA 1V1PA 4ME3A 1EQTA 1PA6A 3NQTA 1X9NA 4C5AA 3BZDB 4HIDA 2W6NA 3VYRA 2DY8A 4ED3A 1VF7A 2R61A 3EBEA 1STNA 2ABJA 1Q90A 1B3QA 2BDOA 5IYBH 2E2HA 3KF8B 4RGTA 1LT3D 1X3GA 1KTKA 4I7HA 1WVLA 1NTGA 3CXCA 1PH4A 2FK2A 1S40A 2YTXA 3I90A 3K57A 3MFGA 3NQIA 1LV9A 2KBNA 3PN1A 3QWUA 2VA3A 4X64Q 1EWCA 5EPLA 1GKHA 2F0FA 3AFQA 4I55F 1QNUA 2UXCL 3K5LA 2D9UA 1F9PA 3EQLC 1JT8A 2HVRA 3T9EA 5DLGA 3Q8DA 4TKOB 3J81E 4L5TA 5M3MB 5LMNW 4JYAL 5KYLA 1EL0A 3DTFA 3Q8PB 3A56A 2DJGC 1QOHA 1A8VA 3MXNB 4DFAA 4YCWA 5BMVF 4GLVB 2V5AA 4Q8EA 3RBEA 1F2MA 4YHHL 5KFLA 2FJZA 1SDFA 2EY1A 1E4GT 4DL6A 3RMHA 3GTMA 1BBWA 4B9WA 1ASZA 3BQ0A 3GTQH 3FMCA 1A3GA 3FEWX 5JEAJ 1X54A 1ICFB 2NN6G 1U9RA 4XT3B 3R23A 4J9LA 5FPOA 2A5HA 1CS0A 1IL2A 4IJHA 2KEEA 5KFIA 2A68C 1HNZL 1SYXB 4FFPA 1XMOQ 1VF5C 2M05A 3HOZB 5E4XA 1VBGA 4X65Q 1IBLQ 4EYHB 3RTXA 4O7WA 5E1FA 4M8AA 3WWIA 4PNYA 1YNND 3RJ0A 2ZXOA 2Z4IA 1N32Q 1PV4A 1C4QA 4L63B 3OHBA 5FLXE 4RKBA 1DAAA 3IG0A 4MTKA 3MAQA 1XNRQ 5I5XA 4A3MG 1KC8C 1AN7A 2K4KA 3S1NH 4NXNQ 2AKWB 4KN7C 1XJVA 2ES2A 3QJYA 3K3VA 4N9PA 4OXPA 1JOOA 4DV7Q 4APVA 1I3QA 1MBYA 1VQEA 2B2UA 3JRWA 1F2LA 4UUGA 5LXTF 4CMDA 4FBUA 3Q23A 2B63B 3VPBA 5LMNH 3VYUA 4DUZL 2HHHL 3DM3A 2ASBA 1QJOA 1W2BA 2UXCH 1EY7A 2JA8G 4JI0H 2CZGA 5FD6A 1DJRD 3TEKA 2SCUB 4TV8F 5KFOA 5IODA 1XNQH 1EWIA 1SMYD 5I4DA 3OUUA 1A9XA 5BWUA 1AE3A 4RWSC 1YVCA 1EY8A 2PZUA 4KHPQ 2W9CB 5I5UA 1LT4D 3CRLC 4L5QA 3EYYA 3C2PA 4F88A 5FLMH 4DXGA 2D62A 4YHHH 1EIFA 4XQNA 1RJTA 5M5XB 3D4WA 3T7AA 1B04A 4JI1L 4LFCQ 4MV6A 1TWFB 2IHEA 3RZDB 5KFRA 1IBMH 2BOSA 1Q86C 2EYJA 1WTQA 2UUCQ 3HBLA 3ICEA 5DEHA 3S2DH 1WTRA 1OXVA 3UDGA 4ECQA 4J9MA 1E2WA 2V4DA 1HNZH 3M4YA 4Q0YA 4EYIB 1N36Q 4GKKQ 3CQZA 4J0MA 1OTCA 2V4QA 4C5CA 4QB4A 1HCZA 3OYYA 4J15A 5ELOA 2F0LA 5HNEA 1JWUD 1U0LA 2L15A 1PFMA 2PQAA 4X62Q 2IJ0A 4DAPA 2L55A 2OTLA 3TINA 2R8IA 1LTSD 2D2CC 2MUYA 2LXKA 1CSPA 4IQZA 1B8AA 2R7NA 1RJRA 1GUGA 4IZ8A 4CBVA 2PBZA 3I4MG 1C30A 1Q46A 4PMBA 2ZTDA 4IUUA 1ONLA 4B3TQ 3J7AK 1ZKOA 2PYKA 4A76A 1J6QA 3CD6A 4DV3L 2HGXA 3CCMA 1ILQA 2F0GA 1OXUA 4FP5D 2K5QA 1DONA 3OPOA 4DNIA 3GTOB 1WTPA 4GLXA 4X64L 1Q82C 3S15B 1H9JA 4Q45A 4EQNA 1Q8IA 4A3FH 3BAAA 1F9RA 4RAYA 3DHQA 2V58A 2HHHH 4WJ3M 4UCVA 2XCPA 1R4PB 1BCPF 4A3LH 1CTMA 2JA7G 4K5WA 2W9BA 4HIOA 3MHBA 2WAQE 5KG1A 1K3RA 4IR9A 4GC7A 3D8GA 1ASYA 5EKLA 4LSXA 3DUZA 3KYHC 4IPDA 3BACA 1S5FD 4YY3Q 3VOTA 3S24A 2EJ3A 3KAKA 2A6EC 3T5LA 4ILWA 5A35A 1X56A 3T5KA 2Z6KA 3SE7A 3D6WA 2F4VQ 1QE6A 1D6EC 1BBUA 1Y8NB 3UE0A 3S16H 4WD3A 2R84A 4R8IA 3MA2B 1TIID 3N8DA 5I5YA 3RNUA 2VOBA 2GLTA 3ERSX 1BF4A 5H80A 4YCVA 4IUPA 3RR5A 5FO8B 4A93G 2ASLA 4JV5H 4J9NA 3GIQA 4O0AA 4X65L 3A54A 2VUMA 1I4HA 3GIJA 1SYGA 3MJFA 2K50A 1TS2A 5D8DA 2HCIA 3RZOB 3V6KA 1E2VA 3CMEA 4K14A 4DV1Q 4R8NA 3HKZE 1EYZA 3M9OB 1SE4A 1N32L 5K36G 2OQKA 1YJ9A 3UFXB 4LAAA 2VUMG 1WR2A 1QUQB 2PO4A 4NXNL 4EFBA 5T1GA 2BH2A 2FFKB 5IOCA 3FHWA 5KFUA 3A5UA 3D4RA 1I7NA 4IAJA 4GNXB 4A3EB 3MXPA 1M0WA 4EQOA 3I12A 3G6XA 2QDLA 3HOYH 1UC9A 1HUNA 2ATLA 1JIHA 5L1JA 5GAEC 3HS0C 4IRCA 3E3XA 4X64H 2UUAQ 3BZCA 4JI3Q 3RLNA 3FMAA 4IALA 1FJGQ 4MA5A 4O86A 3EVQA 5IYBG 5A2QW 4IUTA 3L4KA 1L2FA 1N34Q 2QYZA 4YCUA 3TW7A 1V1OA 2JEGA 4GKJQ 5CC4A 3TY9A 2Z4HA 4KHPL 1H95A 4WBNF 3JAML 2WKDA 1SMXA 2RCNA 3HOVH 3E9HA 1BXRA 3HZXA 1YIJA 4HQ6A 2O5JC 4M7EA 2KA7A 2E74C 4LFCL 1UE7A 2F0JA 1PTOB 3HOWB 2EJFC 3KF6A 4NYEA 1PH6A 2A68D 3M9MB 3GTQA 5C3EH 2K52A 3NEMA 4HAEA 5FPRA 2WAQA 4FXDA 3BABA 4P75A 3Q8SB 3RAQA 2F0HA 4A3KB 3JZIA 3SEBA 4BBRB 2ZJPA 3PQIA 3PF4A 5E3FA 3TZUA 2JA9A 1KL9A 1N48A 4X65H 1NR2A 1IBLH 1XTDA 4XYQA 4X62L 4A3JH 3J80L 4FF4A 3P1HA 2WAQG 1F9QA 1TXYA 2E75C 1I1LA 4ZKBB 3LMLA 2RBMA 2ALZA 1SE2A 1KRSA 5FJ8H 3V96A 2ZJRA 1N32H 4FNFA 5IGCA 5JPMC 4O7VA 4B3TL 1EZ1A 2L5TA 1G2SA 1QWYA 1TWAA 5DQGA 1XNRH 4XX0B 3P7JA 4GOPA 1V4YA 4ECTA 3J80W 4NXNH 3UYYA 2QW7A 2AWOA 2WACA 2HIXA 1T9HA 3CAMA 1Q8KA 2E5LQ 3AW8A 1F77A 4JI8Q 4IWYA 1XDNA 3HKZA 1R4QB 5C44H 1KJJA 3OHAA 2OXPA 5ELEA 2NB0A 4N8FA 1A0IA 3BDOA 2RGVA 2K5VA 5DGIA 3U9SA 1PH8A 4FO2A 3WWJA 3KHLA 4JI4Q 2HCCA 4AYBE 4O2AF 4UCOA 4O2DA 3HKZG 2XRQD 2YZMA 1Q7YC 4DR4Q 1KXLA 5C1OA 2K04A 3RD4A 4G7HC 2CHBD 5I6YA 1JDEA 4YWMA 3N6XA 3MWEA 2LXJA 4YY3L 4KHPH 3GTKH 2Z1CA 2CWAA 5D1OA 3VPCA 1PHJA 4JUZA 4EG0A 3I4NB 4LJZC 5IYDH 5DISC 2C9OA 4QUCA 4POFA 2F4VL 2BA1A 1Y14B 3CCVA 1HRJA 4LFCH 2J6SA 4A3DB 1L1OC 3C1FA 5KNDA 2UXBQ 1SROA 1F2ZA 2W70A 5DQHA 3KHHA 1N33Q 2VQFQ 1J8IA 2VQEL 3JRXA 3MVVA 2PI2E 2YTVA 5I5WA 5FLMG 2FLLA 3KLSX 2KOLA 1N36H 4GKKH 1PMRA 3MXUA 5KEEA 4TQSA 1RIPA 1SNCA 4DR6Q 1Z2PX 3KTMA 1CSQA 4OHJA 1O75A 4X62H 1EU3A 3CKIB 4Y7NB 1J5EL 4OO1I 1EZ6A 2RDIA 2ZM6L 1E2ZA 2K5HA 5KFWA 4JI2Q 5EPJA 1ENCA 3S1RB 1XK5A 4B3TH 1Y1VH 1N56A 4R7RA 3TP6A 3F8TA 1WTXA 4MV8A 5EAYA 4A3IH 3UE1A 4AH6A 1S0OA 1SYEA 2YS7A 4MV7A 1VQ5A 1OXXK 5J3BA 4C3HB 1XMQQ 1PH3A 5J2TF 1KTAA 1IYEA 3IRBA 1Y1WH 4JI3L 1ICWA 5CV4A 5M5YH 1DV1A 4Q43A 1FJGL 1A6XA 2Z0SA 1SSOA 2E2IH 2K6AA 1DD2A 4LF6Q 3WWVA 1ESFA 4LW1A 3E0JA 3PIPA 4RNNA 2R7DA 1DOKA 2F3IA 1N34L 3G6VA 4J9PA 3M85A 1PH9A 2C35B 2XN9C 2MPMA 4ZRZA 4GKJL 3S1QB 5CB4F 2NU8B 1EWHA 2A6ED 3WDNA 1BQQT 1KLUD 1EHIA 2A19A 3LWBA 1STBA 1UNNC 2MP1A 4A3FG 4B3ML 4M9UA 3K8AA 5IYCH 3PO2G 4YY3H 2NUCA 4AYBA 4A3LG 4R4CA 3M3YB 3STBC 4C3IB 3HOUB 1RK6A 2O03A 3RFCA 2N8NA 1X3EA 1JE4A 1TS4A 1D7QA 3V6JA 2F4VH 2MHVA 1LTRD 2ICEC 3WOEA 5KT6A 2WTFA 4JPBW 1Y8OB 2WINB 5L37A 2CW0C 4DV5Q 4RNOA 3U55A 5BN5A 1T5EA 3JSNA 2VL6A 3R9RA 2VB3X 4I65A 1ENAA 4C5BA 4JI6L 4CC5A 2VQEH 3WNZA 1SAPA 4NB3A 4DIMA 4KV6A 1W96A 4ECYA 2DWCA 4JVZA 5F2DA 3TN2A 4DV1H 2F0IA 4DKAC 1K8OA 1H9MA 2JA6B 4MA0A 3H15A 1SYDA 3GLKA 1VQBA 4ME6A 3K0XA 2GQRA 4DL4A 2J6UA 5GAHC 1IYDA 2R93B 2ZM6H 4FS2A 2R92H 2UXDQ 3GQBA 5JVDF 2E5LL 2R7ZA 4JI8L 2DNEA 2Q8TA 4PWQA 4KHVA 1CKOA 2F0TA 2WB1A 1Z47A 4FYDA 2FLNA 1CQVA 1YZ6A 3LX0A 2DZDA 2UUAH 4JI3H 3PFFA 4JI4L 1YNXA 3JAME 4EX5A 1FJGH 1E3PA 2GN5A 4YWKA 5CYUA 1GD7A 4DR4L 1FYCA 3HXLA 3KDFA 2KCTA 4JI5L 3HOYG 4QWAA 1N34H 3EIVA 4NPSA 4GKJH 2WB1G 4HNTA 5C1PA 3PW4A 1XYIA 1B44D 3T1YQ 5KFFA 1FL0A 2XVSA 1PTOD 4O7TA 2I07B 1X3FA 1NUCA 1PH1A 3NK9A 2R8KA 1EIGA 4ED2A 2UXBL 4O7LA 3I4OA 3CW2C 2HUGA 1GHKA 4PV1C 1CZGA 3A5ZB 1N33L 1HNWQ 1IBKQ 2ASJA 3WOFA 3PUXA 3FRPB 3SHLA 1TWHH 3TQYA 3G8CA 3IL8A 2BE5D 5M3MH 3HOVG 3GIDA 5LA6F 2QKIC 1GOZA 2RDFA 4L5RC 2VUGA 1IL8A 2KJXA 1N8RC 2Z04A 1C8CA 3QOJA 1GSHA 3G71A 3M4QA 3PUYA 3D4DA 5KFEA 4E4TA 2NVXB 1M1KC 2N49A 1K1SA 4Q4CA 2L11A 4LH6A 1STAA 2N78A 4QIWA 1V1QA 4DK1A 4JG2A 4A3JG 4O7YA 1BUVT 1A15A 3NENA 3HOZH 3RGXA 2E5LH 4JI8H 3GTPA 3PZPA 1D5MC 1STGA 1WCMB 4DA2A 5FJ8G 5M3FH 2Q2IA 4R4TA 4GS3A 5JUMA 3OHXC 3PO3B 2JEFA 4GN4B 4IFDH 3PIO3 5J1ZA 2W7PA 5I47A 5KFDA 1PYSB 1STHA 2YZGA 1NMGA 3VR6A 3ZYYX 3Q2OA 3J81c 4ECZA 4JI4H 4FS1A 5C44G 4KLKA 1H9SA 2NVQB 4DR4H 3GD7A 2F0PA 4LF7L 2YRWA 4O4JF 4JI5H 1K3BC 2FPGB 4DR3Q 2M00A 4QMGA 2WE6A 2AMCB 1KC7A 3T1HQ 1CI3M 1M6VA 2ATWA 3GTKA 2I80A 5KG2A 1EZ8A 4A3BB 3EN2A 2XWJB 2B63H 3NELA 1PFSA 4XT1B 2MO0A 1TQOA 2VR1A 4CJ1B 1RTNA 2J0TD 2UXBH 2OEOA 3T53B 1GSAA 1CQFA 2MQHA 5IP9H 2ZT9C 3I56A 2K5DA 4TQUS 3U0GA 1I7LA 3KREA 3UZBA 1N33H 5DAAA 5CBAE 5K5PA 2GPSA 4BA2I 3M4OB 3PR5B 4FU0A 1RJQA 1K8AC 1KUTA 5CA1F 1AZQA 2NYZD 1Y8PB 4CDEC 1Z9FA 5FLXc 1EEID 4DR6H 1A3UA 5M5XH 3EA6A 1GLVA 1TWFH 3RZDH 3ERQA 1HNXQ 1M8AA 1PRTB 5BYBA 5KIXA 4J1MA 2EXDA 4X66L 3AQQA 5JVH3 1DYQA 2UXDL 1NR4A 5GADC 4K6NA 1KAWA 4RB2C 1Y1VA 5D1PA 4J9OA 2NVTB 4H02A 4OONA 2B39A 1VQ4A 3NTKA 2SEBD 1IW7C 2CWPA 5EBCA 1VQIA 1G91A 2BQ3A 5FO9B 4UP7A 1XMQH 5KG6A 4JBJA 5BPHA 1Y1WA 3A8KE 2F0OA 3AEVA 1CKNA 1Y1VG 1K83A 1Z2NX 2V1CC 3T5HA 2E2IA 5D3IB 3BJUA 4LF6H 1GJXA 3GTMB 1E4EB 1I1MA 3T9AA 4A3IG 5HBRB 1MI2A 2EJ0A 2V4RA 3RGZA 2RKSA 3NSWA 4DAYA 1JOKA 3PUWA 4DR5Q 2UVRA 1VQ7A 2UVUA 4ID6A 4MN3A 1Y1WG 4LF7H 2SDFA 3T1YL 2NVYH 3STBD 3IKJA 2W71A 1PLFA 2K5WA 2KUMA 3RLFA 5LYJF 4O4LF 3S15H 2EY6A 2MFIA 5LMNL 2WV6D 2AGOA 2CW0D 1EU4A 4RU9A 1TKWB 4FXKC 3K58A 2JSOA 1HNWL 4JI0L 2O5IC 5CV8A 2R6GA 3QQMA 1T3NA 4XDXA 3VR3A 4FE2A 4DU9A 5IYCG 1XNQL 4BXXH 1YHQA 3T9FA 1A48A 4WORA 4L6TB 3T9DA 5M3FB 2W6OA 3I7FA 2GQSA 3N43B 1E7ZA 4R8UB 4NZNA 5KFYA 1I3QB 3DWPA 1SYFA 4ECXA 1KNAA 3QWNA 3H09A 4BBSH 1IBML 2YCHA 2W6MA 3RB6A 2O2LD 1ZXTA 4KY6A 1VQMA 3U54A 4X66H 5IGBA 2R92A 3T99A 2BDNA 2A74C 4RHSA 3BVGA 2UXDH 4RGOS 4P71A 3ITPA 3J81i 3VYSA 5BWVA 2COIA 5KFBA 3ULPA 3RZOH 4GN3B 4JOIC 1TY0A 1O78A 2N88A 2R92G 4YJ2F 3L3OC 3LGJA 2CCZA 1M0TA 3SGIA 3VR2A 3CPWA 5CA0F 4ED1A 2PQEA 4RHRA 2RDHA 2Q7DA 2RHQB 5KS8A 4HJ9A 5KFPA 4DR3L 1S97A 3K5MA 3T1HL 2I87A 3KF8A 3QG1A 3DTGA 3H3VH 4A3EH 1PFNA 3A8JE 4XYLB 1X55A 4R4IA 3T1YH 3BYTB 2E2DC 3GIMA 3KAJA 4F4YA 3OW2A 5KFKA 1EFID 3RV3A 4O3QA 2ZJQA 4KKUA 4LF4Q 1RF2D 4S3SA 4Y52H 1KJIA 2XNAC 2JP1A 4KY5A 1HQMC 1YITA 3KXYT 1HNWH 4NXMQ 4JV1A 3UZOA 1TWHA 3TDQA 2Q8IB 4NLGA 2YW2A 1R9TB 2KHIA 1XTCD 3MR2A 2K1BA 4AIMA 2YRXA 1B33N 2WP8J 4LWCA 1AFPA 1ZHQA 2EIYA 4TUYF 3GP7A 3FDTA 4YAKB 4KN4C 2H1EA 3BZKA 5C3XA 3BS1A 3KLWA 1T36A 2CNVA 1BGWA 4FFOA 1YHAA 1PTOH 1SXTA 2Q2UA 3HOWH 5L1KA 1A3TA 5M3MG 1HNXL 1V51A 3WO1A 3I8ZA 2IPKD 3I91A 4LMQD 3TSSA 4X3KA 1HQRD 3NUAA 3BVZA 4A3KH 4BBRH 1KABA 4JV5L 1S68A 3TY5A 2COJA 4CC6A 4JOIA 2K75A 2M9VA 5DGHA 4BA1I 4JW0A 2Y0SE 4KY7A 2FINB 4HR7B 4KD3A 4PZ8A 1Y69U 3RBDA 3HOXB 5E25A 4XXEA 2JQOA 4JC0A 5DMXA 3I4LA 4NW2A 5KFGA 3GIPA 3R93A 3D6CA 3K81C 3M9NB 2A8VA 3HOZG 3KUPA 1UE5A 4F4XA 2R7FA 5I9OA 3ORQA 2ASDA 1RK5A 1UEAB 2XIGA 4DR3H 3U9OA 2KCMA 4TSSA 3C46A 4IFDG 5EDWA 3PR4A 5JJLA 3T1HH 2NN6I 3VA7A 4IJLA 4A2BA 2EVBA 2EYFA 1JX4A 2JA7A 5IGFA 1I4XA 2JA5B 4UY8C 1QB5D 4IR1A 2DN8A 1V8QA 4B9XA 4YB8B 3OIPA 5KRUA 3SK5A 3HT5A 5JH7F 2Q2TA 4GN5A 1DOMA 1QG7A 3OMCA 2CQYA 3PO2H 4ED8A 4WJWA 3BJYA 4QQBX 2ZTCA 3S1MB 1FGBD 2J4XA 2JK8A 3HP3A 2B63G 3F2BA 1IOVA 4RAZA 4MAMA 1VQPA 1JORA 2TSSA 5IP9G 1RCVD 1C48A 4K2LA 1QVGA 4BY1B 1M7JA 5KG7A 2A1AA 1VQKA 1NY4A 1PRTD 1AUVA 1KJ9A 4Q5VA 4A3DH 1HNXH 5CBEE 4WFN3 5EWFA 2PW5A 3ETJA 1HHVA 2F1MA 5DQIA 1NMFA 1IW7D 3OIQA 3EJIA 1JDBB 3QZ7A 2G5DA 2IT1A 4NZMA 2VA2A 1GHJA 1XMOL 3TIGA 4HIKA 3GTGB 2HHFB 4A4IA 2X69A 3K5HA 1IBLL 4X3SA 4LSAA 3EROA 2EYOA 2VZAA 3U9TA 2XCAA 1YHBA 3TP8A 3GTJB 3GV5B 1W3SA 4Y7NH 1ET6A 5LOVF 4TV9F 4I7AA 3J7AV 3R5FA 2LFNA 2Z02A 1E0BA 1XNRL 3QR8A 3GTQB 3IAYA 4G3IA 2JEIA 5H1SE 3S1RH 4IURA 2J6TA 2Y0SA 4DR5H 2HQEA 3MFHA 1WOCA 1TR5A 2ZDHA 4OL7A 4B3RQ 3RIZA 4GC6A 2VQDA 1STYA 2NVYA 2NZHA 4DV7L 3EFXD 5A2QL 1RYRA 5D65A 1T5XD 4C3HH 3TY8A 4GNXC 4K5VA 3H3VC 1HZAA 3AB9A 4LF4L 1KNEA 1HFGA 1HUMA 2KHSA 2Y0SG 3K7UC 3Q6SA 1MGSA 1TU2B 1BCPB 2K32A 3I73A 5CM0A 1CHPD 1EY4A 3GTLH 4K0KQ 3ER0A 4RCOA 3TIIA 5KFTA 2BQUA 3T9BA 3S1QH 4DXFA 1LYLA 3I70A 1TWAB 3H4BA 4CKCA 1VQCA 2K03A 4GOPB 3G6EA 2X6GA 1K0RA 4KKTA 2E8GA 4YR3A 4MV1A 4CMFA 3N41B 3HKZB 3NWSA 1MD2D 4JK1C 3T13A 3NBHB 1SE8A 1RKNA 3M3YH 3HOUH 2L12A 4HNUA 2B2TC 4BXXG 4F50A 2OF1A 3GB8B 1Z7TA 1PTOC 1VQHA 2R86A 2UUCL 3FPPA 5D3DA 3KLSA 4EBCA 2OQ0A 4RAUC 1XMOH 1VQFA 1PZID 1N36L 4BBSG 4GKKL 3GV7B 1ZHSA 4YWLA 5GQOA 5BR8Q 2BE5C 5DG7A 3A74A 4NKLA 2BA0A 3A7LA 3FVQA 4GLAC 1WYDA 2EYPA 1G2WA 2F3WA 2B8FA 3RB0A 4DL5A 3R2TA 2ODTX 1ZYRC 5C8YF 4DL2A 2W7OA 4JCVE 1WTHA 4CJ0B 2R8GA 1EUCB 4GNXA 1S5CD 4RCNA 3E6ZX 2EY2A 4JBKA 3GIIA 3F2DA 3H91A 4DV7H 4ZYSA 1II3A 1IOWA 4J9SA 2KQ3A 3JSLA 2IW3A 3L9AX 4KD4A 2B29A 2C00A 1ML0D 3LWEA 4LF4H 1SJED 2ZGIA 2A6HC 3TQTA 4A2AA 4LF8Q 1EIYB 5BN4A 4OX9Q 4ZQIA 2FXQA 2RA4A 3P20A 3BA9A 4A3EG 1DGSA 4RZRA 2Y4RA 4NXMH 4C56C 2XCLA 1EYGA 1C9OA 3D0FA 2NUAB 1TS3A 1CQJB 2BQRA 4DV6Q 4O3RA 2A73B 2AQ4A 1S9FA 5FK9C 4QF4A 3RLOA 4K2KA 4BY7B 1CA6A 2FE3A 2DGYA 2QF7A 5KT7A 2W9AA 2B2TA 3TQ1A 3F8NA 1I4PA 3PV0A 4DK3C 5C4JB 4A3GB 2W6ZA 5J2UF 1JCKB 2C5CA 1FNUA 4C2MB 1CFMA 4KJNA 4OELB 3Q8QB 1AN8A 3CEBA 4O3PA 5JOBA 2L0CA 4DV0Q 1BXTA 1JC7A 2UUCH 2PZWA 1QCBD 1HA5A 4Z9CB 4C1NI 1I2LA 1O7YA 4ZK9B 5EKIA 2R8JA 1KDCA 5EPKA 1LLRD 4OWWB 3HOWG 1Z2OX 3KHGA 2SNMA 2A69C 2X5RA 2YU9B 5JEAH 5KFHA 3JAMc 4C3JB 3CCRA 4DV1L 1NJIC 5L1LA 1A2TA 4A3KG 2OT2A 4JI7Q 1TT2A 4BBRG 4O84A 1S3OA 4AYBB 2FMAA 5IT9L 5KFAA 4LFAQ 3SVMA 1EQVA 4TRDA 3SI8A 4ZQ3A 2WB1E 1KLGD 5C5MA 5EWEA 3S16B 3CPFA 4ED7A 4QGUA 1X65A 2NTTA 3GQCA 2IHFA 4X3UA 4MHEA 4DUYQ 4KK7A 4XYMB 4B3RL 4UP9A 1SNQA 1O7ZA 1UNSA 1WCMH 5CV6A 3H0GB 1EQQA 3QIAA 3ULLA 4CE5A 2KSWA 5L9XA 5E4WC 2N55A 4Q44A 5IT9W 5IGEA 1G291 2PW7A 5KNCA 2RHSB 1VQOA 3PO3H 1W93A 1VDZA 1X3QA 3C1EA 3J80c 3PIP3 2UUAL 4GZYC 1BR9A 3G4SA 3TBIB 2NTSA 3I3CA 1I50B 4OIJA 4K0KL 3AYHB 4LF9Q 3TEHB 4IRKA 1QZGA 5JAVA 4HN7A 3GIKA 1X6OA 2MJ8A 4LUOA 1L0XB 3T51B 4EQ5A 3E9IA 3I72A 2IX1A 4FFNA 3SK6A 3DAAA 1PH5A 5CAEB 4UHVA 5LMUQ 3OMGA 2DY7A 2L1BA 3MC0B 2R7ZB 5IP7H 5K2MA 5BWRA 4ED0A 3PW5A 4A3BH 4FVMA 4AQYQ 4O3NA 2WDTA 1L2ZA 1L1OA 1B6SA 1TWGB 1UE1A 2AWNA 2YZNA 3MR5A 2AQ1B 4LUVA 2L9HA 2ZDGA 3JZFA 5KG4A 2GVAA 2AQ2B 3BQ2A 3N52A 3A0JA 3JC66 3E5SA 4MTNA 1LTBD 1W6JA 5BYAA 1Q1EA 3M4OH 1UWVA 5JJKA 4O83A 3I4NG 4MV9A 2I5HA 3KDFB 3PW7A 1UAPA 4R4QA 5JQWA 2HGWA 4QIWE 3T16A 1STEA 4A3DG 4HYKA 5AJ3Q 3MZ5A 5M5WB 2PZTA 4O7ZA 1TA8A 2X0SA 5BWWA 1VQDA 2UU9Q 3K0YA 4MIUA 2FMMA 4RGMA 5A2QE 2Z8LA 3TZDA 3TS2A 3DEOA 3PSIA 3J7AF 4X6AH 1JOQA 5BPFA 5C3EB 2F3VA 2EIFA 2F4IA 3DF7A 4RG1A 4DRFA 5DM63 4F7XA 3RB4A 2NVTH 3CC2A 4B3RH 1LM0A 1TWCB 4V190 2OCEA 2M2LA 3F2CA 5KKNB 3QZ8A 3MXGA 2OH2A 3L0OA 2DIKA 2F0NA 2AU0A 1PYBA 3AMUA 1G8ZD 4K8JA 1EEFD 4ZLTF 4C1NK 4A3JB 4LF8L 2LKVA 2IWHA 1LTAD 2F0QA 4O4IF 4EVOA 3GTMH 4HJ8A 2MGSA 3HGBA 4FF2A 4GLWA 1ZEQX 2L4NA 3GTLA 4K0KH 1SNMA 4HCSA 4DQNA 3GV3A 4C3HG 2BCOA 3LWUA 4DV6L 1NNXA 1D8LA 1IHZA 4K8IA 4WRDA 1GM5A 3U58A 4QW8A 3G8DA 4U7CA 3TP5A 5C4XB 1EY5A 3J81W 4U68A 1SYCA 3GTPB 3VR5A 2KEDA 2PN1A 4ME5A 3VYTA 3GJXB 4FBTA 1Z6HA 2JN4A 3JAMi 3ND8A 2PMZB 5IGGA 2RCFA 3J80E 2VQFL 3PVXA 3FKIB 1FR3A 1H9SB 1GGOA 4RUCA 2P5ZX 2XC9A 3HOUG 4C3IG 1KHIA 5IIFA 4UCTA 1WH2A 2F0SA
chains in the Genus database with same CATH topology
3CCUA 4DR6L 3KOJA 4JI7L 1VS0A 2IY5B 4LFAL 3OTOQ 4LUZA 2N3SA 4JI2L 3J80i 4DUYL 4FDBA 1YJNA 4P72A 4EEQA 5FLXW 4JYAQ 3W1BA 1XMQL 4LF5Q 4YHHQ 2CKZB 4LF6L 4IPCA 4LF8H 4OX9H 2HGSA 4FM9A 5LMUL 1L0WA 4DV6H 2MO1A 2IX0A 1QVFA 1E4FT 3CMAA 2CQOA 4LH7A 2D0OA 2BH8A 4DV5L 4DV0H 4IOAA 2CW7A 2VQFH 1R9TH 4DAYB 4P74A 2HQLA 5AJ3L 1WJJA 3ULJA 1A63A 1KQSA 4JI7H 1RL2A 4DUZQ 4LFAH 3CCLA 1GYFA 3CCQA 4JI2H 3TRZA 4DUYH 5JEAG 1JJCB 2I5MX 1I6UA 3HOXH 2QA4A 2F52A 3KALA 1K9MC 1UE6A 4PMWA 4RZQA 4LF9H 4JI1Q 1WCMG 4R1JA 3PO3G 2NZOA 1OXSC 3BU2A 5LMUH 3GTOH 2JA5H 1BVSA 2KENA 3RF2A 1G6PA 3NC0B 1QVCA 1IBKL 1E22A 5IP7G 3S1MH 1YI2A 4DV5H 4UCUA 2D0PA 4A3BG 1VQ9A 4DV3Q 4ALPA 3L7ZC 4BY1H 3BA8A 4IO9A 1JMCA 2JE6I 2UU9H 3OTOL 3GTGH 1SRUA 5C0XJ 1JE5A 2RF4A 1P16A 3KJOA 3GTJH 4LF5L 3UDXA 4E6NA 5C0XI 1EFWA 3CCSA 3CC7A 3M7NA 4POGA 4DPGA 1MJCA 1B70B 1OXTA 3TREA 2I5LX 2OWOA 1N9WA 5FD5A 2B3GA 1G51A 2PQAB 2YYZA 3E0EA 1IBKH 4HJAA 1TWAH 4A75A 3N44B 3ZJYC 1SN8A 1S03G 2DUDA 4PZ6A 2QEXA 3OTOH 3UDFA 4PZ7A 3KJPA 5M3FG 1QZHA 1EOVA 4B3SQ 4JYAH 4DR7Q 4MTEA 3KFUA 4LF5H 1YBYA 2ID0A 1S72A 2WYOA 1FGUA 4DV2Q 3G48A 2Z6KC 4DR5L 2UUBQ 3H20A 2K14A 3TS0A 3U4ZA 1V43A 3HFZB 2RGRA 5DLQE 3CCEA 4JBMA 4UP8A 4LFBQ 4RMFA 2XGTA 4BY7H 2I0QA 1PH7A 1LTLA 4R4OA 4P73A 1B7YB 3I4NH 5C4JH 4A3GH 5HY6A 4C2MH 5IY0A 4JBWA 2MNAA 4DUZH 3W5OA 4DR1Q 2CW8A 1EQRA 2JEAI 1VQNA 3CVZA 2YU9H 4C3JH 3K80C 3B6YA 5IE8A 2ZJTA 4L5SA 1C0AA 4JI1H 3KF6B 4LNQA 3HOXG 3PCOB 2VQEQ 3H0GH 4HJ5A 1Q81C 2HT1A 4BWSC 1XPUA 1I50H 3VNNA 2VPSA 1A62A 4UPAA 1J5EQ 1IXRA 4NXML 4IPGA 1YEZA 1HZ9A 3GO5A 3N42B 2ZM6Q 2JA5G 4IFDJ 2R7ZH 4DV3H 4KHZA 4GOPC 3VDYA 4EFEA 1TWGH 4IFDI 4IPHA 4C3IH 4QY7A 1KRTA 4LMYA 1VQ8A 4BY1G 4B3SL 4DR7L 2H5XA 1GO3E 4OO1G 5M5WH 1HZBA 4B3MQ 1E24A 4MNOA 5D1OB 2JA6H 4DV2L 1V9PA 4DR2Q 3L2PA 1QUQA 2UUBL 1BKBA 2R93H 1NBWA 3JAMW 4MTDA 1TWCH 4HIMA 4JI6Q 1AE2A 3DLLA 1HR0Q 4LFBL 1JJ2A 4DAMA 4XIGS 1CKMA 2Q2HA 4KI0A 1GVPA 5C4XH 3GTPH 1M90C 4A3CH 4WJ4A 1LUZA 3M4PA 2JEBI 3J7ZC 4DK6C 4DR1L 3FKIH 3CC4A 4JI5Q 4B3SH 2AHOB 1IYJB 3J7A5 3F1ZA 4DR7H 1Q1BA 1U5KA 3CF5A 1P8LA 2NVXH 1PVOA 1Q12A 1MJEA 1L1OB 3J81j 4DV2H 5EOYA 1CUKA 2JJQA 2UUBH 3M4IA 1KIXA 1I94Q 4TVAB 4QL5A 5IWAQ 1SLJA 4DV4Q 1PH2A 4UFZA 2VW9A 3I55A 1SFOH 1VQ6A 1UEBA 4LFBH 1I5FA 4QJFA 3PF5A 2E2JH 1IZ6A 2NVQH 3N40P 3I2ZA 4RB1A 4OWTB 5GROA 1YJWA 2PNHA 5JJIA 5HGQA 4ETSA 1K83H 4BY7G 2XTIA 4DR1H 3D31A 1VQGA 4OWXB 4A3GG 4LF7Q 3H3VI 5BR8L 1K8GA 2E2HH 4XTCS 5ELNA 2LSSA 3K7AH 1MIUA 2VY3A 3AFPA 1XPRA 3S17H 2OTJA 1MKHA 4DR2L 1HJPA 4IOCA 2YTYA 1C7YA 1EUJA 2HIVA 4AYBG 1JJGA 4UCSA 1HR0L 1K73C 1JB7A 4OX9L 3PUZA 3UDIA 2PI2A 5IT9c 1J5EH 3H0GG 3CCJA 2ALYB 3RN5A 1VQLA 4X66Q 2PMZE 1HR0W 2YV5A 3NBYB 1FKAH 3W1GA 1SEIA 4A3MH 4APMA 4DV0L 2QGQA 2R7ZG 3CP0A 3MEFA 2HVSA 1KD1C 1BJTA 3GDEA 2JA8H 1AH9A 5BR8H 1E1OA 1I3QH 4B3MH 1FVIA 2CFMA 1VQAA 5LMNQ 2WFWA 2K5NA 1MZBA 4DR2H 3PGZA 2UXCQ 4JI0Q 1I94L 2GVBA 5IWAL 1VQJA 2EQSA 1TAEA 4MZ9A 4DV4L 1XNQQ 3MWMA 2JA6G 4JI6H 1O7IA 5GAGC 5C3EG 3M9BA 4RB3C 3FP9A 2R93G 1HR0H 4LF9L 1IBMQ 2KHJA 2W57A 4HJ7A 1HNZQ 3I4MH 5E7NA 4AQYL 1XPOA 3U4VA 3L4JA 2VNUD 1WFQA 3CQZH 1I6HH 1CKNB 5C4XG 1NE3A 3PIOA 2ZTEA 3RN2A 3NBZB 3S2HH 4A3CG 3U50C 2JA7H 2UU9L 3FKIG 2MCTA 4PG3A 3S14H 1VCIA 3C0FB 1HH2P 2HHHQ 1WI5A 5LL6b 1I94H 5IYDG 3UQ8A 5IWAH 1E1TA 5C0XG 4DV4H 3HKSA 1HZCA 4PDBA 4A93H 2VS1A 1SR3A 2HVQA 4RB0A 4JV5Q 2VUMH 4AQYH 3PUVA 4UCRA 4ME3A 1PA6A 1X9NA 4HIDA 3EBEA 5IYBH 3KF8B 1X3GA 4I7HA 1NTGA 3CXCA 1PH4A 1S40A 2YTXA 3PN1A 2KBNA 3QWUA 4X64Q 1GKHA 3AFQA 2UXCL 2HVRA 1JT8A 3Q8DA 4L5TA 5LMNW 4JYAL 1A8VA 3MXNB 4YCWA 4GLVB 4YHHL 1E4GT 1BBWA 1ASZA 3GTQH 5JEAJ 1X54A 2NN6G 5FPOA 1IL2A 4IJHA 1SYXB 1HNZL 1XMOQ 4X65Q 1IBLQ 3RTXA 3RJ0A 1N32Q 1PV4A 3IG0A 1XNRQ 4A3MG 1KC8C 1AN7A 2K4KA 3S1NH 4NXNQ 2AKWB 1XJVA 2ES2A 3K3VA 4OXPA 4DV7Q 4APVA 1VQEA 5LMNH 4DUZL 2HHHL 3DM3A 2ASBA 1W2BA 2UXCH 2JA8G 4JI0H 5FD6A 1XNQH 1EWIA 1AE3A 1YVCA 4KHPQ 4L5QA 3EYYA 5FLMH 2D62A 4YHHH 1EIFA 1B04A 4JI1L 4LFCQ 2IHEA 1IBMH 1Q86C 2UUCQ 3ICEA 3S2DH 1OXVA 3UDGA 1HNZH 4Q0YA 1N36Q 4GKKQ 4J0MA 1OTCA 3OYYA 4J15A 5ELOA 1U0LA 2L15A 2PQAA 4X62Q 2OTLA 2LXKA 1CSPA 1B8AA 3I4MG 1Q46A 2ZTDA 4B3TQ 3J7AK 4A76A 1J6QA 3CD6A 4DV3L 3CCMA 1OXUA 4DNIA 4GLXA 4X64L 1Q82C 4A3FH 3BAAA 4RAYA 2HHHH 4WJ3M 4UCVA 4A3LH 2JA7G 4HIOA 2WAQE 1K3RA 1ASYA 4LSXA 3KYHC 4IPDA 4YY3Q 3S24A 3KAKA 1X56A 2Z6KA 2F4VQ 3S16H 1BBUA 3UE0A 2VOBA 3RNUA 3ERSX 4YCVA 3RR5A 4A93G 4JV5H 4O0AA 4X65L 2K50A 3CMEA 4DV1Q 3HKZE 1N32L 5K36G 2OQKA 1YJ9A 2VUMG 1QUQB 4NXNL 4EFBA 2BH2A 3FHWA 3A5UA 4IAJA 4GNXB 1M0WA 3HOYH 5GAEC 4X64H 2UUAQ 3BZCA 4JI3Q 3RLNA 3FMAA 1FJGQ 5IYBG 5A2QW 3L4KA 1L2FA 1N34Q 4YCUA 4GKJQ 3TY9A 4KHPL 1H95A 1SMXA 2RCNA 3HOVH 3E9HA 1YIJA 4M7EA 4LFCL 1UE7A 3KF6A 1PH6A 5C3EH 2K52A 3NEMA 5FPRA 3BABA 4P75A 2ZJPA 3PF4A 2JA9A 1KL9A 4X65H 1IBLH 1XTDA 4X62L 4A3JH 2WAQG 1TXYA 3LMLA 1KRSA 5FJ8H 2ZJRA 1N32H 4B3TL 1XNRH 4GOPA 3J80W 4NXNH 2AWOA 2HIXA 1T9HA 3CAMA 1Q8KA 2E5LQ 4JI8Q 1XDNA 5C44H 1A0IA 2RGVA 2K5VA 1PH8A 4JI4Q 4AYBE 4UCOA 4O2DA 3HKZG 1Q7YC 4DR4Q 1KXLA 4YWMA 3N6XA 2LXJA 4YY3L 4KHPH 3GTKH 2CWAA 5D1OA 1PHJA 5DISC 5IYDH 4POFA 2F4VL 2BA1A 1Y14B 3CCVA 4LFCH 1L1OC 2UXBQ 1SROA 1N33Q 2VQFQ 2VQEL 2PI2E 2YTVA 5FLMG 1N36H 4GKKH 1RIPA 4DR6Q 1Z2PX 4X62H 1CSQA 1O75A 1J5EL 4OO1I 2ZM6L 2K5HA 4JI2Q 1XK5A 4B3TH 1Y1VH 4R7RA 3F8TA 5EAYA 4A3IH 3UE1A 4AH6A 4MV7A 1VQ5A 1OXXK 5J3BA 1XMQQ 1PH3A 3IRBA 1Y1WH 4JI3L 5M5YH 1FJGL 2Z0SA 2E2IH 4LF6Q 3WWVA 4LW1A 3PIPA 2R7DA 2F3IA 1N34L 3M85A 1PH9A 2C35B 4GKJL 2A19A 4A3FG 4B3ML 3K8AA 5IYCH 3PO2G 4YY3H 4A3LG 4R4CA 3STBC 2O03A 2N8NA 1X3EA 1D7QA 2F4VH 4DV5Q 3JSNA 2VL6A 4CC5A 4JI6L 2VQEH 4NB3A 4DV1H 4DKAC 3H15A 1VQBA 3K0XA 5GAHC 2ZM6H 2R92H 2UXDQ 2E5LL 4JI8L 1CKOA 1Z47A 1YZ6A 2UUAH 4JI3H 4JI4L 1YNXA 1FJGH 4EX5A 1E3PA 2GN5A 4YWKA 1GD7A 4DR4L 3HXLA 3KDFA 2KCTA 4JI5L 3HOYG 1N34H 3EIVA 4NPSA 4GKJH 2WB1G 3T1YQ 1FL0A 1X3FA 1PH1A 2UXBL 3I4OA 3CW2C 1N33L 3A5ZB 1HNWQ 1IBKQ 3PUXA 1TWHH 3TQYA 5M3MH 3HOVG 4L5RC 2VUGA 1N8RC 3G71A 3M4QA 3PUYA 1M1KC 2N49A 4LH6A 2N78A 1V1QA 4JG2A 4A3JG 3NENA 3HOZH 3RGXA 2E5LH 4JI8H 5FJ8G 2Q2IA 4R4TA 4GS3A 4GN4B 1PYSB 1NMGA 3J81c 4JI4H 5C44G 4KLKA 4DR4H 3GD7A 4LF7L 4JI5H 4DR3Q 2WE6A 2AMCB 3T1HQ 2ATWA 3EN2A 2B63H 3NELA 1PFSA 2MO0A 2UXBH 5IP9H 2MQHA 3I56A 4TQUS 1N33H 4BA2I 1K8AC 1Z9FA 5FLXc 4DR6H 5M5XH 1TWFH 3RZDH 1HNXQ 2EXDA 4X66L 3AQQA 2UXDL 5GADC 1KAWA 4RB2C 5D1PA 4H02A 4OONA 1VQ4A 2CWPA 1VQIA 4UP7A 1XMQH 4JBJA 3AEVA 1CKNA 1Y1VG 1Z2NX 2V1CC 3BJUA 4LF6H 4A3IG 3RGZA 3PUWA 4DR5Q 1VQ7A 4LF7H 1Y1WG 3T1YL 2NVYH 3STBD 3RLFA 3S15H 2MFIA 5LMNL 1HNWL 4JI0L 2R6GA 5IYCG 1XNQL 4BXXH 1YHQA 3I7FA 3N43B 1E7ZA 4BBSH 1IBML 2YCHA 1VQMA 4X66H 2UXDH 4P71A 3J81i 3ULPA 3RZOH 4GN3B 4JOIC 2R92G 2CCZA 3LGJA 1M0TA 3SGIA 3CPWA 2RHQB 4HJ9A 4DR3L 3T1HL 3H3VH 4A3EH 1X55A 4R4IA 3T1YH 3KAJA 3OW2A 2ZJQA 4LF4Q 4Y52H 1YITA 3KXYT 1HNWH 4NXMQ 2KHIA 4AIMA 1ZHQA 2WP8J 4LWCA 3BZKA 3KLWA 1BGWA 1YHAA 2Q2UA 3HOWH 5M3MG 1HNXL 4A3KH 4BBRH 4JV5L 1S68A 3TY5A 4CC6A 4JOIA 2K75A 4BA1I 2Y0SE 4PZ8A 2JQOA 4JC0A 3K81C 2A8VA 3HOZG 1UE5A 2R7FA 2XIGA 4DR3H 2KCMA 4IFDG 3T1HH 5JJLA 2NN6I 4IJLA 4A2BA 4UY8C 2Q2TA 4GN5A 3PO2H 4QQBX 2ZTCA 2JK8A 2B63G 3F2BA 4RAZA 1VQPA 5IP9G 1QVGA 2A1AA 1VQKA 1NY4A 4A3DH 1HNXH 1NMFA 2IT1A 1XMOL 4HIKA 4A4IA 1IBLL 4LSAA 2VZAA 1YHBA 1W3SA 4Y7NH 1XNRL 5H1SE 3S1RH 4DR5H 1WOCA 4B3RQ 3RIZA 2NZHA 4DV7L 4C3HH 3TY8A 4GNXC 1HZAA 4LF4L 2Y0SG 3K7UC 3GTLH 4K0KQ 3ER0A 3S1QH 1LYLA 1VQCA 4GOPB 3G6EA 1K0RA 2E8GA 3N41B 3NBHB 1SE8A 3M3YH 3HOUH 4BXXG 3GB8B 1VQHA 2UUCL 2OQ0A 1XMOH 1VQFA 1N36L 4BBSG 4GKKL 1ZHSA 4YWLA 5GQOA 5BR8Q 3A74A 2BA0A 4GLAC 1WYDA 4JCVE 4GNXA 4JBKA 3F2DA 4DV7H 3JSLA 2B29A 4LF4H 4A2AA 4LF8Q 1EIYB 4OX9Q 2FXQA 3BA9A 4A3EG 1DGSA 4NXMH 1EYGA 1C9OA 3D0FA 4DV6Q 3RLOA 2FE3A 2DGYA 3F8NA 3PV0A 4DK3C 4DV0Q 2UUCH 3HOWG 4OWWB 1Z2OX 3JAMc 4DV1L 3CCRA 1NJIC 4A3KG 4JI7Q 4BBRG 1S3OA 4LFAQ 2WB1E 3CPFA 4QGUA 1X65A 2IHFA 4DUYQ 4B3RL 4UP9A 1WCMH 1EQQA 3ULLA 2KSWA 5IT9W 1G291 1VQOA 2RHSB 3PO3H 3J80c 2UUAL 3G4SA 4K0KL 3AYHB 4LF9Q 3TEHB 1QZGA 1X6OA 4LUOA 4EQ5A 3E9IA 2IX1A 1PH5A 5LMUQ 5IP7H 4A3BH 4AQYQ 2WDTA 1L2ZA 1L1OA 2AWNA 1UE1A 4LUVA 2GVAA 3A0JA 3JC66 4MTNA 1Q1EA 3M4OH 1UWVA 5JJKA 3I4NG 4MV9A 2I5HA 3KDFB 4R4QA 4QIWE 4A3DG 5AJ3Q 1TA8A 1VQDA 2UU9Q 3TS2A 3PSIA 4X6AH 2EIFA 3DF7A 4RG1A 4DRFA 2NVTH 3CC2A 4B3RH 1LM0A 2OCEA 3F2CA 3L0OA 1PYBA 4LF8L 3GTMH 4HJ8A 4K0KH 4DV6L 1D8LA 1GM5A 3U58A 3J81W 3GJXB 3JAMi 2VQFL 3HOUG 1KHIA 4UCTA 1WH2A 5M3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5K A;  3CF5 A;  1ASY A;  3BA8 A;  3CCU A;  3I7F A;  3KYH C;  1P8L A;  1E7Z A;  3KOJ A;  4IPD A;  4DR6 L;  4YY3 Q;  3S24 A;  4JI7 L;  2NVX H;  1PVO A;  1VS0 A;  1Q12 A;  1X56 A;  1MJE A;  2IY5 B;  1L1O B;  4LFA L;  4BBS H;  2Z6K A;  3OTO Q;  3J81 j;  1IBM L;  3HOV H;  4LUZ A;  2F4V Q;  2N3S A;  1BBU A;  3UE0 A;  3S16 H;  4JI2 L;  3J80 i;  4DUY L;  1CUK A;  2JJQ A;  1VQM A;  4FDB A;  1YJN A;  3RNU A;  1KIX A;  3ERS X;  1I94 Q;  4TVA B;  4P72 A;  4P71 A;  4YCV A;  4EEQ A;  3J81 i;  4QL5 A;  3RR5 A;  5IWA Q;  4A93 G;  4JYA Q;  1SLJ A;  4DV4 Q;  4O0A A;  4X65 L;  3W1B A;  1XMQ L;  1PH2 A;  3ULP A;  2K50 A;  3RZO H;  4GN3 B;  4JOI C;  4UFZ A;  4LF5 Q;  2VW9 A;  3I55 A;  3CME A;  1SFO H;  4DV1 Q;  1VQ6 A;  1UEB A;  3HKZ E;  2R92 G;  4YHH Q;  2CKZ B;  2CCZ A;  3LGJ A;  4IPC A;  4LF6 L;  3SGI A;  1N32 L;  3CPW A;  1I5F A;  5K36 G;  2OQK A;  4QJF A;  3PF5 A;  1YJ9 A;  2E2J H;  1IZ6 A;  2RHQ B;  4HJ9 A;  2NVQ H;  2VUM G;  1QUQ B;  4NXN L;  4DR3 L;  4EFB A;  3I2Z A;  2BH2 A;  5LMU L;  1L0W A;  3T1H L;  3FHW A;  3A5U A;  3H3V H;  2MO1 A;  4OWT B;  5GRO A;  4A3E H;  2IX0 A;  4GNX B;  1YJW A;  1X55 A;  4R4I A;  1QVF A;  3HOY H;  2PNH A;  5GAE C;  3OW2 A;  3CMA A;  5JJI A;  5HGQ A;  2CQO A;  2ZJQ A;  4LF4 Q;  4LH7 A;  2D0O A;  2UUA Q;  3BZC A;  4JI3 Q;  4Y52 H;  1K83 H;  3RLN A;  1FJG Q;  4BY7 G;  1YIT A;  2BH8 A;  4DV5 L;  5IYB G;  2XTI A;  4NXM Q;  4IOA A;  3D31 A;  1L2F A;  1R9T H;  1N34 Q;  1VQG A;  4YCU A;  4OWX B;  4A3G G;  2KHI A;  4DAY B;  4LF7 Q;  3H3V I;  4AIM A;  4GKJ Q;  2WP8 J;  4LWC A;  4P74 A;  2HQL A;  5BR8 L;  1K8G A;  3TY9 A;  2E2H H;  4KHP L;  5AJ3 L;  4XTC S;  1H95 A;  5ELN A;  1SMX A;  1WJJ A;  2LSS A;  2RCN A;  3BZK A;  3E9H A;  1MIU A;  2VY3 A;  3AFP A;  3K7A H;  3KLW A;  3ULJ A;  1YIJ A;  1XPR A;  3S17 H;  2OTJ A;  1KQS A;  1A63 A;  1YHA A;  4LFC L;  2Q2U A;  1UE7 A;  1MKH A;  1RL2 A;  1HJP A;  5M3M G;  4DR2 L;  1HNX L;  4IOC A;  3HOW H;  3KF6 A;  4DUZ Q;  1PH6 A;  5C3E H;  3CCL A;  2K52 A;  2YTY A;  3NEM A;  3CCQ A;  1C7Y A;  5FPR A;  1EUJ A;  3BAB A;  4P75 A;  3TRZ A;  4A3K H;  2HIV A;  5JEA G;  4BBR H;  4JV5 L;  1S68 A;  3TY5 A;  1JJC B;  2I5M X;  4CC6 A;  4JOI A;  2K75 A;  4AYB G;  2ZJP A;  3PF4 A;  4BA1 I;  1JJG A;  2Y0S E;  3HOX H;  2QA4 A;  2JA9 A;  1KL9 A;  4PZ8 A;  4UCS A;  1XTD A;  1HR0 L;  2F52 A;  2JQO A;  4JC0 A;  4X62 L;  4A3J H;  1K73 C;  2WAQ G;  1JB7 A;  1TXY A;  4OX9 L;  3PUZ A;  1K9M C;  3K81 C;  3UDI A;  1KRS A;  5FJ8 H;  2ZJR A;  1UE6 A;  2PI2 A;  4PMW A;  5IT9 c;  3H0G G;  4JI1 Q;  3CCJ A;  1WCM G;  2ALY B;  2A8V A;  4B3T L;  3RN5 A;  3HOZ G;  1UE5 A;  1VQL A;  4R1J A;  4X66 Q;  2R7F A;  2PMZ E;  4GOP A;  1HR0 W;  3PO3 G;  2NZO A;  2YV5 A;  3NBY B;  2KCM A;  1OXS C;  2AWO A;  3BU2 A;  2HIX A;  3W1G A;  4IFD G;  1T9H A;  3CAM A;  5JJL A;  2NN6 I;  1Q8K A;  2E5L Q;  4IJL A;  4JI8 Q;  3GTO H;  1XDN A;  5C44 H;  2JA5 H;  1BVS A;  4A3M H;  4UY8 C;  2KEN A;  1A0I A;  1G6P A;  2K5V A;  1PH8 A;  2Q2T A;  4GN5 A;  3NC0 B;  1QVC A;  4DV0 L;  2QGQ A;  1IBK L;  2R7Z G;  4JI4 Q;  4AYB E;  3PO2 H;  4UCO A;  1E22 A;  5IP7 G;  4O2D A;  3CP0 A;  1YI2 A;  3HKZ G;  3S1M H;  4UCU A;  2D0P A;  3MEF A;  2ZTC A;  1Q7Y C;  4A3B G;  4DR4 Q;  2JK8 A;  4QQB X;  1KXL A;  2HVS A;  2B63 G;  1VQ9 A;  1KD1 C;  3F2B A;  3GDE A;  4DV3 Q;  4ALP A;  4YWM A;  2JA8 H;  5D1O A;  2LXJ A;  1VQP A;  3L7Z C;  1AH9 A;  4YY3 L;  4BY1 H;  1E1O A;  3GTK H;  1I3Q H;  2CWA A;  5IP9 G;  4IO9 A;  1PHJ A;  1QVG A;  1FVI A;  1JMC A;  2JE6 I;  2CFM A;  1VQA A;  2A1A A;  5IYD H;  1VQK A;  1NY4 A;  3OTO L;  5DIS C;  5LMN Q;  4POF A;  2WFW A;  2F4V L;  2K5N A;  4A3D H;  2BA1 A;  1Y14 B;  3CCV A;  1L1O C;  3PGZ A;  2UXB Q;  1SRO A;  2UXC Q;  4JI0 Q;  1NMF A;  1I94 L;  2VQF Q;  1N33 Q;  2GVB A;  3GTG H;  2IT1 A;  2VQE L;  5IWA L;  1SRU A;  1VQJ A;  2EQS A;  2PI2 E;  2YTV A;  5C0X J;  1JE5 A;  4HIK A;  4MZ9 A;  4DV4 L;  1TAE A;  1XNQ Q;  4A4I A;  5FLM G;  2RF4 A;  2JA6 G;  1P16 A;  3KJO A;  1IBL L;  1O7I A;  5GAG C;  3GTJ H;  2VZA A;  4LF5 L;  1YHB A;  5C3E G;  3M9B A;  3UDX A;  1W3S A;  3FP9 A;  2R93 G;  1RIP A;  4E6N A;  4Y7N H;  4DR6 Q;  1CSQ A;  5C0X I;  1XMO L;  1EFW A;  3CCS A;  1J5E L;  4LF9 L;  4OO1 I;  3CC7 A;  3M7N A;  4POG A;  1IBM Q;  4DPG A;  1XNR L;  2ZM6 L;  2K5H A;  1MJC A;  5H1S E;  3S1R H;  1B70 B;  1OXT A;  4JI2 Q;  1XK5 A;  2KHJ A;  1Y1V H;  1WOC A;  3TRE A;  4B3R Q;  2I5L X;  2OWO A;  3F8T A;  2NZH A;  4DV7 L;  4HJ7 A;  5EAY A;  4A3I H;  3UE1 A;  4AH6 A;  1HNZ Q;  3I4M H;  5E7N A;  4AQY L;  1XPO A;  3U4V A;  4C3H H;  4GNX C;  1N9W A;  2VNU D;  3TY8 A;  1WFQ A;  3CQZ H;  1OXX K;  1HZA A;  5J3B A;  1XMQ Q;  1VQ5 A;  1PH3 A;  4LF4 L;  1I6H H;  3IRB A;  1Y1W H;  4JI3 L;  5M5Y H;  2B3G A;  1G51 A;  2PQA B;  2Y0S G;  3K7U C;  1FJG L;  2Z0S A;  2E2I H;  4LF6 Q;  1CKN B;  2YYZ A;  3WWV A;  5C4X G;  4LW1 A;  3E0E A;  3PIP A;  3GTL H;  2R7D A;  1NE3 A;  2F3I A;  3ER0 A;  3PIO A;  4HJA A;  1N34 L;  1TWA H;  4K0K Q;  2ZTE A;  3M85 A;  2C35 B;  4A75 A;  1PH9 A;  1LYL A;  3RN2 A;  3S1Q H;  3S2H H;  4GKJ L;  3NBZ B;  4A3C G;  1VQC A;  3ZJY C;  4GOP B;  1SN8 A;  3G6E A;  2A19 A;  2DUD A;  1K0R A;  2E8G A;  4A3F G;  3U50 C;  4B3M L;  2JA7 H;  2UU9 L;  3FKI G;  3K8A A;  5IYC H;  3NBH B;  1SE8 A;  3PO2 G;  4PG3 A;  3M3Y H;  3HOU H;  3S14 H;  1VCI A;  4PZ6 A;  4R4C A;  4A3L G;  2QEX A;  3STB C;  3UDF A;  4BXX G;  2N8N A;  1X3E A;  1D7Q A;  1HH2 P;  3GB8 B;  2HHH Q;  4PZ7 A;  3KJP A;  1VQH A;  1WI5 A;  2UUC L;  5M3F G;  1QZH A;  4DV5 Q;  3JSN A;  2VL6 A;  1EOV A;  2OQ0 A;  4B3S Q;  4CC5 A;  5IYD G;  4JI6 L;  3UQ8 A;  1E1T A;  1VQF A;  4NB3 A;  5C0X G;  4DR7 Q;  1N36 L;  4BBS G;  4GKK L;  3HKS A;  3KFU A;  4YWL A;  1HZC A;  5GQO A;  5BR8 Q;  3A74 A;  1YBY A;  2BA0 A;  4GLA C;  4A93 H;  1WYD A;  2ID0 A;  4DKA C;  1S72 A;  2VS1 A;  1FGU A;  1SR3 A;  4DV2 Q;  3H15 A;  1VQB A;  3K0X A;  3G48 A;  2Z6K C;  5GAH C;  4DR5 L;  2UUB Q;  4JCV E;  2R92 H;  2UXD Q;  2K14 A;  2HVQ A;  4GNX A;  3TS0 A;  3U4Z A;  2E5L L;  4JI8 L;  4JV5 Q;  1V43 A;  4JBK A;  3HFZ B;  3F2D A;  2VUM H;  5DLQ E;  3CCE A;  3JSL A;  4JBM A;  1CKO A;  2B29 A;  4UP8 A;  1Z47 A;  1YZ6 A;  3PUV A;  4UCR A;  4LF8 Q;  4ME3 A;  1EIY B;  4LFB Q;  4JI4 L;  4OX9 Q;  1YNX A;  2FXQ A;  4RMF A;  4EX5 A;  1PA6 A;  3BA9 A;  4A3E G;  1E3P A;  2GN5 A;  4YWK A;  1X9N A;  1DGS A;  1GD7 A;  4DR4 L;  4HID A;  3KDF A;  2KCT A;  4JI5 L;  2XGT A;  1EYG A;  3HOY G;  3EIV A;  1C9O A;  3D0F A;  3EBE A;  4NPS A;  4DV6 Q;  2WB1 G;  4BY7 H;  3RLO A;  5IYB H;  3KF8 B;  1X3G A;  2I0Q A;  1PH7 A;  3T1Y Q;  1LTL A;  4R4O A;  2DGY A;  1NTG A;  1B7Y B;  1FL0 A;  4P73 A;  3CXC A;  2YTX A;  1S40 A;  1PH4 A;  3I4N H;  5C4J H;  4A3G H;  3PN1 A;  2KBN A;  3PV0 A;  1X3F A;  5HY6 A;  4C2M H;  4DK3 C;  1PH1 A;  3QWU A;  4X64 Q;  5IY0 A;  1GKH A;  4JBW A;  3AFQ A;  3I4O A;  2UXB L;  2MNA A;  3CW2 C;  2UXC L;  3W5O A;  4DV0 Q;  1N33 L;  3A5Z B;  2HVR A;  1JT8 A;  1HNW Q;  1IBK Q;  3PUX A;  4DR1 Q;  3Q8D A;  1TWH H;  3TQY A;  5M3M H;  3HOV G;  4L5T A;  5LMN W;  4JYA L;  1EQR A;  2JEA I;  1VQN A;  3HOW G;  4OWW B;  4L5R C;  1A8V A;  3MXN B;  2VUG A;  4YCW A;  2YU9 H;  1N8R C;  4C3J H;  4GLV B;  3JAM c;  4DV1 L;  3CCR A;  3K80 C;  3M4Q A;  3G71 A;  3PUY A;  4YHH L;  1NJI C;  3B6Y A;  4A3K G;  5IE8 A;  4JI7 Q;  4BBR G;  1M1K C;  1S3O A;  2N49 A;  1BBW A;  4LFA Q;  1ASZ A;  4L5S A;  1C0A A;  3GTQ H;  4LH6 A;  2WB1 E;  2N78 A;  3KF6 B;  1X54 A;  2NN6 G;  3CPF A;  1X65 A;  5JEA J;  4QGU A;  2IHF A;  3PCO B;  3HOX G;  1V1Q A;  4LNQ A;  4DUY Q;  5FPO A;  4JG2 A;  1IL2 A;  4B3R L;  4IJH A;  4UP9 A;  4A3J G;  1HNZ L;  2VQE Q;  1XMO Q;  3H0G H;  3NEN A;  4HJ5 A;  1Q81 C;  1WCM H;  3HOZ H;  1EQQ A;  3ULL A;  5FJ8 G;  4X65 Q;  1G29 1;  1VQO A;  1IBL Q;  2Q2I A;  2RHS B;  4R4T A;  4GS3 A;  3PO3 H;  3RTX A;  2HT1 A;  3J80 c;  4GN4 B;  2UUA L;  1XPU A;  3G4S A;  1I50 H;  3VNN A;  1PYS B;  1A62 A;  1NMG A;  1N32 Q;  1PV4 A;  3AYH B;  4UPA A;  1IXR A;  3TEH B;  3J81 c;  1J5E Q;  4LF9 Q;  4IPG A;  4NXM L;  1YEZ A;  1QZG A;  1HZ9 A;  3GO5 A;  5C44 G;  4KLK A;  2ZM6 Q;  2JA5 G;  1XNR Q;  1X6O A;  3GD7 A;  4IFD J;  4LUO A;  4EQ5 A;  4A3M G;  1KC8 C;  2K4K A;  3E9I A;  4DR3 Q;  4LF7 L;  4NXN Q;  2AKW B;  2IX1 A;  3S1N H;  1XJV A;  1PH5 A;  2ES2 A;  2AMC B;  5LMU Q;  2R7Z H;  3T1H Q;  4KHZ A;  4OXP A;  4GOP C;  3VDY A;  5IP7 H;  4DV7 Q;  2ATW A;  4APV A;  4A3B H;  4EFE A;  4AQY Q;  3EN2 A;  1TWG H;  1VQE A;  2B63 H;  3NEL A;  1PFS A;  1L1O A;  4IFD I;  4IPH A;  2AWN A;  1UE1 A;  2MO0 A;  4C3I H;  4QY7 A;  1KRT A;  4DUZ L;  4LUV A;  2HHH L;  3DM3 A;  1VQ8 A;  2GVA A;  2ASB A;  1W2B A;  5IP9 H;  2MQH A;  3I56 A;  2JA8 G;  3A0J A;  3JC6 6;  4TQU S;  4MTN A;  1Q1E A;  3M4O H;  1UWV A;  4BY1 G;  4B3S L;  5JJK A;  3I4N G;  4BA2 I;  2I5H A;  3KDF B;  4R4Q A;  4DR7 L;  2H5X A;  4QIW E;  1EWI A;  1K8A C;  1GO3 E;  4A3D G;  1AE3 A;  1YVC A;  4OO1 G;  5M5W H;  4KHP Q;  5AJ3 Q;  4L5Q A;  1HZB A;  4B3M Q;  1E24 A;  4MNO A;  1Z9F A;  1TA8 A;  5FLX c;  1VQD A;  2UU9 Q;  4UCT A;  5D1O B;  5FLM H;  5M5X H;  2D62 A;  4DV2 L;  2JA6 H;  1V9P A;  1EIF A;  1TWF H;  3RZD H;  3TS2 A;  1B04 A;  4JI1 L;  4LFC Q;  2IHE A;  3PSI A;  4DR2 Q;  1HNX Q;  4X6A H;  3L2P A;  1QUQ A;  1Q86 C;  2EXD A;  1BKB A;  3AQQ A;  4X66 L;  2UUB L;  2R93 H;  2EIF A;  2UXD L;  1NBW A;  4RG1 A;  5GAD C;  2UUC Q;  1KAW A;  3ICE A;  4DRF A;  3S2D H;  5D1P A;  2NVT H;  1TWC H;  1OXV A;  3UDG A;  3CC2 A;  1LM0 A;  4HIM A;  2OCE A;  4H02 A;  4OON A;  3F2C A;  1VQ4 A;  4JI6 Q;  3L0O A;  2CWP A;  1AE2 A;  1N36 Q;  1VQI A;  4GKK Q;  1PYB A;  4UP7 A;  3DLL A;  1OTC A;  4JBJ A;  3OYY A;  4J15 A;  5ELO A;  1U0L A;  2L15 A;  2PQA A;  4X62 Q;  1HR0 Q;  2OTL A;  4LF8 L;  3AEV A;  4LFB L;  1JJ2 A;  4DAM A;  1CKN A;  1Y1V G;  3GTM H;  2V1C C;  4HJ8 A;  2LXK A;  3BJU A;  1CSP A;  4XIG S;  1B8A A;  4A3I G;  4K0K L;  3I4M G;  1Q46 A;  4DV6 L;  1CKM A;  2Q2H A;  2ZTD A;  4B3T Q;  3PUW A;  4DR5 Q;  4A76 A;  1J6Q A;  3CD6 A;  1D8L A;  4DV3 L;  4KI0 A;  1VQ7 A;  1Y1W G;  3CCM A;  1GM5 A;  1GVP A;  3U58 A;  5C4X H;  3T1Y L;  2NVY H;  3STB D;  3GTP H;  1OXU A;  3RLF A;  4DNI A;  1M90 C;  3S15 H;  4GLX A;  2MFI A;  4X64 L;  5LMN L;  1Q82 C;  4A3C H;  4WJ4 A;  1LUZ A;  3GJX B;  3M4P A;  2JEB I;  3J7Z C;  4A3F H;  3BAA A;  4DK6 C;  1HNW L;  3JAM i;  4JI0 L;  4WJ3 M;  4UCV A;  4DR1 L;  3FKI H;  2R6G A;  2VQF L;  4A3L H;  3CC4 A;  2JA7 G;  4JI5 Q;  5IYC G;  1XNQ L;  4BXX H;  2AHO B;  4HIO A;  1IYJ B;  3HOU G;  1KHI A;  1YHQ A;  2WAQ E;  3J7A 5;  3F1Z A;  1K3R A;  5M3F H;  1Q1B A; 
#chains in the Genus database with same CATH topology
 4Q4D A;  2V59 A;  3CCU A;  2EJ2 A;  2C2R A;  4DR6 L;  3KOJ A;  2VB2 X;  5FLX L;  3GTK B;  3H6M A;  4JI7 L;  1ZYR D;  1VS0 A;  2IY5 B;  4O2B F;  4LFA L;  2C22 A;  2B2Y C;  3OTO Q;  4LUZ A;  5ELD A;  2CNU A;  3OWF A;  2F03 A;  2N3S A;  1T94 A;  4JI2 L;  3J80 i;  4DUY L;  2CVR A;  4I7Z C;  1B53 A;  5DGB A;  4FDB A;  3G6J B;  3OUZ A;  1YJN A;  1B4O A;  3OSO A;  5KFS A;  4DL3 A;  4P72 A;  4EEQ A;  5G3L D;  5FLX W;  5DGA A;  4JYA Q;  5DM7 3;  1JR0 D;  4LK1 C;  2A6H D;  3W1B A;  5KYI A;  1XMQ L;  2IL8 A;  3VR4 A;  3WO0 A;  1DCZ A;  5IGD A;  2RDG A;  4LF5 Q;  1B3A A;  2RQX A;  2W6Q A;  4ECR A;  4YHH Q;  1SFO B;  2CKZ B;  4LF6 L;  4IPC A;  4LF8 H;  4OX9 H;  1WRV A;  3R8B A;  1WTV A;  1G2T A;  4YAJ B;  1XWE A;  2E2J B;  2QCP X;  4Q0F A;  2HGS A;  4FM9 A;  1ROD A;  2FHT A;  4IUQ A;  3IFT A;  3M7G A;  5LMU L;  1L0W A;  4HNV A;  5I5T A;  4DV6 H;  3NWT A;  2MO1 A;  2IX0 A;  4QCL A;  4FF1 A;  1QVF A;  2CH4 W;  4O7N A;  1E4F T;  3CMA A;  3V6H A;  2CQO A;  4LH7 A;  1RHP A;  2D0O A;  4J9K A;  1Y1W B;  3BDL A;  1K83 B;  1V1P B;  4FFM A;  2BH8 A;  5CV7 A;  4DV5 L;  3SXH A;  1U4P A;  2E2I B;  2R7M A;  4N9T A;  4DV0 H;  5C3W A;  4IOA A;  2YS6 A;  2CW7 A;  5KG0 A;  2VQF H;  3MFY A;  4EEY A;  1R9T H;  2A69 D;  3V05 A;  3VA5 A;  5ELF A;  5IT9 E;  4DAY B;  5KFN A;  5I5S A;  4P74 A;  5KNB A;  1LT6 D;  2HQL A;  2EYM A;  1I4G A;  2F0D A;  5AJ3 L;  3JZ6 A;  2E2H B;  3KHR A;  1WJJ A;  2B2Y A;  3URY A;  2YL2 A;  3ULJ A;  3K7A B;  4B08 A;  1A63 A;  1AEX A;  1KQS A;  3NBI A;  3S17 B;  4JI7 H;  3DWQ A;  1RL2 A;  5CMD A;  1K8M A;  5I6W A;  2DAA A;  4EBE A;  2B2V C;  4DUZ Q;  1CHQ D;  1KDB A;  4BS9 A;  3CCL A;  1ZAU A;  3CCQ A;  4LFA H;  1GYF A;  4ZCK A;  3R5H A;  3FDS A;  1PRT C;  2BR0 A;  4JI2 H;  3TRZ A;  1KT8 A;  5T1I A;  1MHW C;  1KEE A;  2XGP A;  3CU7 A;  5JEA G;  4DUY H;  3FPU B;  1K28 A;  1JJC B;  4RGN A;  2I5M X;  2XIW A;  1DV2 A;  3ETH A;  4XQJ A;  3PW2 A;  1WCM A;  4ODG A;  1I6U A;  1LAB A;  4F4Z A;  1OWT A;  3HOX H;  2EYH A;  3MWY W;  2QA4 A;  5EGT A;  2F52 A;  4ZOL F;  5FO7 B;  3KAL A;  4YJ3 F;  1B2T A;  1K9M C;  5AFW A;  1S4Z A;  3QOL A;  4G7O C;  1UE6 A;  4PMW A;  4RZQ A;  4LF9 H;  1LT5 D;  4JI1 Q;  1WCM G;  3Q1K A;  4R1J A;  3PO3 G;  2NZO A;  5KFJ A;  3S9W A;  3BDC A;  4HCE A;  1OXS C;  3BU2 A;  3J7Y W;  5LMU H;  4DL7 A;  2EYL A;  3GTO H;  2JA5 H;  1M4V A;  4CDC C;  1BVS A;  2NWG A;  4ECV A;  4YR2 A;  4A3M B;  2KEN A;  1RJP A;  3RF2 A;  1G6P A;  5FNV F;  3A8I E;  1DOL A;  3NC0 B;  1QVC A;  4F87 A;  1IBK L;  3RB3 A;  1E22 A;  5IP7 G;  3S1M H;  1YI2 A;  4DV5 H;  4UCU A;  2D0P A;  2B8G A;  4A3B G;  1SNO A;  1D2B A;  1VQ9 A;  5K3W A;  1ENF A;  4FFL A;  4DV3 Q;  4ALP A;  5KFM A;  3L7Z C;  2K33 A;  2JA8 B;  4BY1 H;  4N8X 1;  5I5V A;  4L8J A;  3EPI A;  3BA8 A;  4IO9 A;  4YIJ A;  1JMC A;  2B2V A;  2JE6 I;  2UU9 H;  4CDF C;  3OTO L;  5KT5 A;  1CA5 A;  4NZO A;  5L1I A;  2B2U C;  4OO1 H;  5CE8 A;  1JKJ B;  1IKL A;  2LY7 A;  2K05 A;  4CHT B;  4DAV A;  2IP4 A;  1K1Q A;  2FLP A;  3GTG H;  1TWH B;  1SRU A;  3OW7 A;  5C0X J;  1JE5 A;  2RF4 A;  1P16 A;  2K01 A;  5FR9 A;  4H7B A;  3KJO A;  3GTJ H;  4LF5 L;  3TME A;  5KT3 A;  3T54 A;  3UDX A;  4O7S A;  2QK4 A;  4H0L C;  4E6N A;  5C0X I;  5DNF A;  1EFW A;  1CT1 D;  3CCS A;  1E4E A;  4FFR A;  4RKL A;  3CC7 A;  2F0V A;  3M7N A;  4POG A;  4DPG A;  1MJC A;  1B70 B;  1ILP A;  1OXT A;  1SBB B;  1BBX C;  5C6A A;  2ZXP A;  1D5X C;  1LTI D;  3TRE A;  2I5L X;  2OWO A;  2B2W C;  3R5X A;  5LHY 1;  2P0A A;  3R3O A;  1WD1 A;  1N9W A;  2PVP A;  2F0M A;  3I4M B;  4O1N A;  3HB9 A;  5FD5 A;  3CQZ B;  4ZUJ A;  1I6H B;  1O7L A;  2KCC A;  2B3G A;  1G51 A;  2PQA B;  2WKC A;  1WD0 A;  3MFI A;  2YYZ A;  3CHB D;  3E0E A;  2C28 A;  1IBK H;  1LO5 D;  4HJA A;  5JJZ A;  3DXJ C;  1TWA H;  1PFB A;  2G9H D;  1RDP D;  4A75 A;  2X6L A;  1XXG A;  3N44 B;  3ZJY C;  3S2H B;  1SN8 A;  4ULL A;  3MXN A;  4FF3 A;  1S03 G;  2R8H A;  4I4T F;  2DUD A;  2A1H A;  1FNW A;  5LP6 F;  4R8U A;  2QDB A;  4DAA A;  1VMP A;  4BWG B;  4P2C B;  3V4Z A;  4TQR A;  2JA7 B;  4PZ6 A;  3LP8 A;  2F0K A;  3S14 B;  2QEX A;  4RA8 A;  3QFF A;  3TW6 A;  1HFN A;  3OTO H;  3UDF A;  4PZ7 A;  3KJP A;  1EKV A;  5GON F;  5M3F G;  3SE0 A;  1QZH A;  3HEJ A;  3MEH A;  1SNP A;  3ND9 A;  1EOV A;  2GPW A;  4B3S Q;  2J9G A;  4JYA H;  4DR7 Q;  1ESR A;  2W9B B;  2R82 A;  1GXD C;  4MTE A;  1D1K A;  3KFU A;  2COG A;  2K7V A;  3NTH A;  3A55 A;  4FGR A;  3DEP A;  3K59 A;  1YBY A;  4LF5 H;  4CKE A;  5FOB B;  4IN3 A;  4ZAI A;  4O3O A;  1OO9 B;  1QNK A;  2ID0 A;  1S72 A;  2WYO A;  1FGU A;  4A93 B;  1EKF A;  1XX8 A;  4DV2 Q;  4Q8F A;  3DWA A;  3G48 A;  2UVW A;  5C4H A;  2B2W A;  2Z6K C;  4DR5 L;  2UUB Q;  3H20 A;  1H9K A;  3Q24 A;  2K14 A;  4DF7 A;  2K28 A;  3U4Z A;  3TS0 A;  2FB9 A;  5ISR A;  1V43 A;  3HFZ B;  2RGR A;  1CK1 A;  3OSP A;  2VUM B;  5DLQ E;  3CCE A;  2HDK A;  3CSW A;  2B63 A;  3F2U A;  4JBM A;  4UP8 A;  1I4Q A;  4OEM B;  3SDZ A;  2DPJ A;  4LFB Q;  2XSC A;  4RMF A;  5JVG 3;  2G9D A;  1DZ1 A;  4J9R A;  2EOT A;  4OGQ C;  1R9T A;  2XGT A;  5J22 A;  2Y0S B;  1ET0 A;  3PW0 A;  2C2D A;  4BY7 H;  5KFX A;  2W9C A;  2I0Q A;  1PH7 A;  1U4R A;  2NVY B;  4G7Z C;  4DLK A;  1LTL A;  4R4O A;  2IX3 A;  1SJH D;  4P73 A;  1B7Y B;  3K3P A;  3I4N H;  5C4J H;  4A3G H;  5HY6 A;  4C2M H;  4EGV A;  5DAU A;  1PYW D;  2DJF C;  4G4K A;  1TWF A;  5IY0 A;  4EGQ A;  4JBW A;  2MNA A;  4UDU C;  3KLR A;  4JXU A;  4DUZ H;  1TS5 A;  3W5O A;  2Z6B A;  5C4Z A;  4DR1 Q;  4DNT B;  3AU7 A;  2R85 A;  4O82 A;  3P75 A;  3E5N A;  4IHJ F;  1A3V A;  3RV4 A;  2CW8 A;  1SYB A;  4ECU A;  1F2Y A;  2SNS A;  2AUJ D;  1EQR A;  3BQ1 A;  2JEA I;  1VQN A;  4G57 A;  4HR7 A;  4ED6 A;  1U4L A;  3G7L A;  3LUL A;  3CVZ A;  2GA4 B;  2EPB A;  2YU9 H;  3Q8R B;  4C3J H;  4HTH A;  5DLF A;  3K80 C;  4K6D A;  2RDJ A;  3B6Y A;  4ECW A;  4KKS A;  5IE8 A;  2ZJT A;  1Q3L A;  3LNN A;  4BBS B;  4PBC A;  3G6Y A;  4L5S A;  1C0A A;  2CH4 A;  4JI1 H;  3KF6 B;  1PTO F;  1I4R A;  1LTT D;  4NP5 A;  4LNQ A;  4HN2 A;  3HOX G;  3PCO B;  2R6F A;  1PX2 A;  2WAQ B;  2FKL A;  1OBD A;  1EOT A;  4FXG C;  1GUO A;  5TSS A;  4EBD A;  2R7L A;  2VQE Q;  2VPQ A;  3H0G H;  4HJ5 A;  1Q81 C;  3OSN A;  1IYU A;  5JPN C;  4IWX A;  2FK1 A;  3GTO A;  3SK8 A;  2JA5 A;  3N6R A;  4WHX A;  5BN3 A;  2HT1 A;  4BWS C;  1KAA A;  1XPU A;  1EIH A;  1I50 H;  3VNN A;  2VPS A;  3RUP A;  1A62 A;  1PK8 A;  4UAI A;  1I1K A;  2FK3 A;  4UPA A;  1J5E Q;  1IXR A;  1ET9 A;  2XRS D;  4NXM L;  4IPG A;  2IA6 A;  1YEZ A;  1BCP C;  2RVL A;  1HZ9 A;  2V9W A;  3GO5 A;  3N42 B;  1CQI B;  2ZM6 Q;  2JA5 G;  4IFD J;  1CZW A;  3C3L A;  2FP4 B;  4CJ2 C;  3S1N B;  2R7Z H;  3LQS A;  4DV3 H;  4KHZ A;  4GOP C;  3VDY A;  3BG3 A;  1SND A;  2LS0 1;  4EFE A;  1X3P A;  2EY5 A;  1SE3 A;  1TWG H;  3K6O A;  5COR A;  5G3L F;  4IFD I;  4IPH A;  4C3I H;  5KFZ A;  2C2E A;  1CE8 A;  1EY6 A;  4QY7 A;  1KRT A;  1YNJ C;  4LMY A;  1RTO A;  1PZJ D;  1VQ8 A;  1ZET A;  5COY A;  5EZY F;  1DM0 B;  2XD4 A;  2XWB B;  5LL6 X;  4BY1 G;  4B3S L;  3GTG A;  2HHF A;  1QIL A;  4DR7 L;  5KT4 A;  2H5X A;  1GO3 E;  2J7Z A;  3MWD A;  3GTJ A;  2E76 C;  5M5W H;  4OO1 G;  4ECS A;  1HZB A;  1B50 A;  4B3M Q;  1E24 A;  4MNO A;  5D1O B;  2ENB A;  1EYA A;  5HGT A;  2VXW A;  1V9P A;  4DV2 L;  2JA6 H;  4QWD A;  4DN4 M;  4KJO A;  4H44 C;  4DR2 Q;  2AUK A;  5M9O A;  3L2P A;  1AUX A;  1QUQ A;  2UUB L;  1BKB A;  2R93 H;  1NBW A;  2H4O A;  2KEC A;  3JAM W;  4JV2 A;  4MTD A;  1TWC H;  3S2D B;  4HIM A;  2QIL A;  4JI6 Q;  1HPC A;  1AE2 A;  3H40 A;  1NAP A;  2CNQ A;  1FD7 D;  3DLL A;  4J8Q A;  2KVM A;  1HR0 Q;  3K5O A;  4LFB L;  4EQP A;  1JJ2 A;  4DAM A;  4QWC A;  4XIG S;  1S5B D;  2O4X A;  1IYV A;  3AX6 A;  1BDO A;  1CKM A;  1KDA A;  2Q2H A;  4ABN A;  1S5D D;  4YR0 A;  2F0E A;  2AGQ A;  4KI0 A;  1GVP A;  3VPD A;  5C4X H;  2AGP A;  3GTP H;  3NBH A;  2JEJ A;  1M90 C;  2DPI A;  4R9W A;  3MTS A;  4A3C H;  4WJ4 A;  1RD9 D;  5DG8 A;  1LUZ A;  1WTO A;  1KBL A;  4E6I A;  3M4P A;  2JEB I;  1BO0 A;  3J7Z C;  2ZDQ A;  4DK6 C;  1H9R A;  1FNV A;  4A3F B;  3ONA B;  4DR1 L;  3FKI H;  2R87 A;  4IRD A;  3CRK C;  4IUV A;  3PO2 B;  3CC4 A;  4ZKC B;  1DXM A;  3R2I A;  4JI5 Q;  4B3S H;  2AHO B;  3NXW A;  3VMM A;  1IYJ B;  1IKM A;  3J7A 5;  3F1Z A;  4DR7 H;  4IIJ F;  1JQY D;  1AZP A;  3QO2 A;  1Q1B A;  5CGK A;  1U5K A;  5EBD A;  3CF5 A;  1VMC A;  5F9L A;  1P8L A;  3V4S A;  2NVX H;  1PVO A;  1Q12 A;  5C0X H;  1MJE A;  1L1O B;  3DMU A;  3J81 j;  1VBH A;  5EQ0 A;  4DV2 H;  4J6H A;  3WWH A;  1BNC A;  3O13 A;  2FJ2 A;  3H94 A;  2I8C A;  1CUK A;  1SEB D;  5EOY A;  1S0N A;  4TVI A;  2JJQ A;  2IBK A;  2UUB H;  2OLS A;  3M4I A;  1MSG A;  2LMC B;  1KIX A;  3NPP A;  1I94 Q;  4TVA B;  4L1K A;  4QL5 A;  4HSP A;  5IWA Q;  4HSV A;  4YBZ B;  1SLJ A;  2YYA A;  3NUC A;  4DV4 Q;  4RH6 A;  1PH2 A;  4CDD C;  3BG5 A;  4UFZ A;  2RSN A;  2VW9 A;  3I55 A;  4O42 A;  1SFO H;  1VQ6 A;  3MR6 A;  1UEB A;  2NU9 B;  2PCF B;  4U67 3;  1VKZ A;  1OBG A;  1I5F A;  1U4M A;  4LFB H;  4QJF A;  3PF5 A;  1JB3 A;  2E2J H;  1O80 A;  2EJG C;  2PNR C;  1IZ6 A;  3NHH A;  4CGY B;  2NVQ H;  3N40 P;  2SOB A;  3RAX A;  1B6R A;  1PZK D;  2YWV A;  3I2Z A;  2IMW P;  4RB1 A;  1KJQ A;  3SNO A;  4EGJ A;  3OWE B;  4OWT B;  5GRO A;  1WTW A;  1YJW A;  2PNH A;  2I46 A;  3HOY B;  1B9M A;  4H13 C;  3W2D A;  1EY9 A;  5HGQ A;  5JJI A;  1A0G A;  4ZHQ F;  4C2M A;  3SK4 A;  1HXY D;  2WB1 B;  4ETS A;  5KX5 F;  4NDX A;  3IN5 A;  1K83 H;  2KCN A;  1D5Z C;  2Q8R E;  5CR5 A;  4BY7 G;  1LTG D;  1LAC A;  2XTI A;  1G6Z A;  4DR1 H;  3GTL B;  4XZ3 B;  2TMP A;  3D31 A;  2EZV A;  1VQG A;  4OWX B;  4ZI7 F;  4A3G G;  1HA6 A;  4RFB A;  4CKB A;  4LF7 Q;  3H3V I;  1KJ8 A;  1TY2 A;  3T4A C;  5BR8 L;  1K8G A;  2E2H H;  4I50 F;  3GV8 B;  2YU9 A;  5I9P A;  3ORR A;  4XTC S;  5ELN A;  5LL6 S;  2LSS A;  3K7A H;  1MIU A;  2VY3 A;  3AFP A;  1XPR A;  3S17 H;  1UUP A;  3Q22 A;  3HOV B;  2OTJ A;  1MKH A;  4DR2 L;  1HJP A;  4IOC A;  2JYO A;  2YTY A;  1C7Y A;  4O4H F;  1UC8 A;  1EUJ A;  1S10 A;  4MV3 A;  4C3J G;  2HIV A;  5DG9 A;  4F4W A;  2EJM A;  2DLN A;  3GIL A;  1NSN S;  3H0G A;  4AYB G;  1JJG A;  2NN6 H;  1AP0 A;  5HV6 A;  1EYC A;  4UCS A;  1HR0 L;  2EDG A;  1BCP D;  3DM1 A;  1K73 C;  1JB7 A;  1NCV A;  2F0W A;  4OX9 L;  3PUZ A;  1I50 A;  4O3S A;  1SCU B;  3NE5 B;  3UDI A;  3J81 L;  2PI2 A;  5IT9 c;  1J5E H;  3H0G G;  2AQ3 B;  1PXU A;  2ALY B;  3CCJ A;  3RN5 A;  4QW9 A;  2ICI A;  1VQL A;  3IFD A;  3RUZ A;  4QIW B;  2PMZ E;  3PMF A;  4HMJ A;  4M1U B;  3UI2 A;  4X66 Q;  1HR0 W;  2NZ1 D;  2YV5 A;  3NBY B;  2W8K A;  1FKA H;  5KGU A;  3W1G A;  2EE1 A;  2HDL A;  1TVX A;  5BWX A;  1YNJ D;  5ELB A;  1SEI A;  1JXL A;  2R7K A;  3GV6 A;  1WSC A;  5C5L A;  5C44 B;  4A3M H;  1TWG A;  4APM A;  3D3R A;  5HUR A;  2NU6 B;  3KK7 A;  3H4D A;  5KFQ A;  1S5E D;  1D1I A;  5BWT A;  4DV0 L;  1W6K A;  3KBG A;  2QGQ A;  1JWS D;  2R7Z G;  1VAJ A;  3CP0 A;  4ZUI A;  3MEF A;  2UVV A;  1YNN C;  2HVS A;  3MR3 A;  2HDM A;  3K5N A;  5KFC A;  4V0B A;  4DNR B;  1KD1 C;  2W6P A;  3V2T A;  3W3A A;  4IUN A;  3GDE A;  3QB3 A;  1BJT A;  3OOC A;  3TP7 A;  4DGZ A;  2JA8 H;  4TM5 A;  5KFV A;  1EYD A;  1AH9 A;  5BR8 H;  1E1O A;  4DK0 A;  1I3Q H;  1ULZ A;  4B3M H;  5CV5 A;  1FVI A;  2CFM A;  1VQA A;  2JA6 A;  2RSO A;  5LMN Q;  1HTP A;  2WFW A;  3X3N A;  2K5N A;  1MZB A;  4QWE A;  4DR2 H;  1PDQ A;  3PGZ A;  4PMC A;  2F0U A;  1CM9 A;  2R93 A;  2UXC Q;  5CV9 A;  1B9N A;  4PQX A;  4JI0 Q;  1GUS A;  2FMC A;  3NTI A;  2FPI B;  1I94 L;  3SR1 A;  4Y8V B;  1I2K A;  5KG3 A;  2GVB A;  1RYS A;  5NUC A;  5IWA L;  1VQJ A;  2EQS A;  1TWC A;  3T5J A;  3HRZ C;  1TAE A;  4MZ9 A;  4XQQ A;  4DV4 L;  1XNQ Q;  1GSO A;  3MWM A;  2JA6 G;  4RUA A;  5EWG A;  4JI6 H;  4K6L A;  1B1Z A;  1GUT A;  1O7I A;  5GAG C;  5C3E G;  3M9B A;  5I60 A;  4JV0 A;  4RB3 C;  3FP9 A;  2R93 G;  4IZO A;  1HR0 H;  1SMY C;  5J39 A;  3KBX A;  4LF9 L;  1IBM Q;  5CR3 A;  2NU7 B;  2CQA A;  5EKK A;  2DAB A;  4QSH A;  1PRT F;  4HMI A;  2YZL A;  1JWM D;  1F9S A;  2KHJ A;  2W8L A;  4F8M A;  1K0S A;  2W57 A;  1Y1V B;  4X3T A;  1EY0 A;  4HJ7 A;  1HNZ Q;  1X32 A;  3I4M H;  5E7N A;  4AQY L;  4A3I B;  3U4V A;  4QUF A;  1XPO A;  2VNU D;  3L4J A;  1WFQ A;  3CQZ H;  1I6H H;  5ELC A;  4K5X A;  1EUD B;  1AW7 A;  4NMZ A;  2QB5 A;  2DNC A;  5I2X A;  4CHI A;  5M5Y B;  4KTA A;  2PMZ A;  1MSH A;  5D14 A;  1CKN B;  3FKI A;  5C4X G;  1NE3 A;  3PIO A;  3HG9 A;  2ZTE A;  2FPP B;  3BYY B;  3RN2 A;  3NBZ B;  3S2H H;  5JQG F;  3T56 B;  3Q0A A;  4QWB A;  4A3C G;  5JVL A;  2PPB C;  4J9Q A;  4XYO A;  1BOS A;  3EPG A;  3BVM A;  3U50 C;  5F9N A;  4RNM A;  2JA7 H;  2UU9 L;  3FKI G;  4MV4 A;  2MCT A;  3NP8 A;  4HED A;  2NVX A;  4PG3 A;  3S14 H;  1VCI A;  5I2Y A;  3T9C A;  4O7R A;  3C0F B;  4O81 A;  1HH2 P;  1GUN A;  2HHH Q;  2R3Z A;  1WI5 A;  1HTL D;  2HD3 A;  5LL6 b;  4YP3 A;  3A7A B;  1DIK A;  1JLL B;  4YQW A;  1I94 H;  2WII B;  5IYD G;  3UQ8 A;  5IWA H;  1E1T A;  1L0Y B;  1I6V C;  5C0X G;  4DV4 H;  4KMU C;  3HKS A;  1HZC A;  5EJW A;  4PDB A;  2EXZ A;  5C5J A;  1SFO A;  1S0M A;  4A93 H;  5KG5 A;  2Z9H A;  2D5D A;  2VS1 A;  1ZQ7 A;  1SR3 A;  1EKP A;  5KT2 A;  2HJW A;  5IYZ F;  5T14 A;  2HG8 A;  4U6P A;  5K36 H;  2R92 B;  3HO8 A;  2HVQ A;  5FKA C;  1BNZ A;  4RB0 A;  4M0J A;  4JV5 Q;  3NGD A;  2NBF A;  2QEJ C;  2JXM B;  1J9O A;  3K5I A;  2VUM H;  1C3O A;  1A2U A;  3X3M A;  1GUW A;  4AQY H;  1JIC A;  2ZXR A;  4OIK A;  3PUV A;  2XGQ A;  4UCR A;  1V1P A;  4ME3 A;  1EQT A;  1PA6 A;  3NQT A;  1X9N A;  4C5A A;  3BZD B;  4HID A;  2W6N A;  3VYR A;  2DY8 A;  4ED3 A;  1VF7 A;  2R61 A;  3EBE A;  1STN A;  2ABJ A;  1Q90 A;  1B3Q A;  2BDO A;  5IYB H;  2E2H A;  3KF8 B;  4RGT A;  1LT3 D;  1X3G A;  1KTK A;  4I7H A;  1WVL A;  1NTG A;  3CXC A;  1PH4 A;  2FK2 A;  1S40 A;  2YTX A;  3I90 A;  3K57 A;  3MFG A;  3NQI A;  1LV9 A;  2KBN A;  3PN1 A;  3QWU A;  2VA3 A;  4X64 Q;  1EWC A;  5EPL A;  1GKH A;  2F0F A;  3AFQ A;  4I55 F;  1QNU A;  2UXC L;  3K5L A;  2D9U A;  1F9P A;  3EQL C;  1JT8 A;  2HVR A;  3T9E A;  5DLG A;  3Q8D A;  4TKO B;  3J81 E;  4L5T A;  5M3M B;  5LMN W;  4JYA L;  5KYL A;  1EL0 A;  3DTF A;  3Q8P B;  3A56 A;  2DJG C;  1QOH A;  1A8V A;  3MXN B;  4DFA A;  4YCW A;  5BMV F;  4GLV B;  2V5A A;  4Q8E A;  3RBE A;  1F2M A;  4YHH L;  5KFL A;  2FJZ A;  1SDF A;  2EY1 A;  1E4G T;  4DL6 A;  3RMH A;  3GTM A;  1BBW A;  4B9W A;  1ASZ A;  3BQ0 A;  3GTQ H;  3FMC A;  1A3G A;  3FEW X;  5JEA J;  1X54 A;  1ICF B;  2NN6 G;  1U9R A;  4XT3 B;  3R23 A;  4J9L A;  5FPO A;  2A5H A;  1CS0 A;  1IL2 A;  4IJH A;  2KEE A;  5KFI A;  2A68 C;  1HNZ L;  1SYX B;  4FFP A;  1XMO Q;  1VF5 C;  2M05 A;  3HOZ B;  5E4X A;  1VBG A;  4X65 Q;  1IBL Q;  4EYH B;  3RTX A;  4O7W A;  5E1F A;  4M8A A;  3WWI A;  4PNY A;  1YNN D;  3RJ0 A;  2ZXO A;  2Z4I A;  1N32 Q;  1PV4 A;  1C4Q A;  4L63 B;  3OHB A;  5FLX E;  4RKB A;  1DAA A;  3IG0 A;  4MTK A;  3MAQ A;  1XNR Q;  5I5X A;  4A3M G;  1KC8 C;  1AN7 A;  2K4K A;  3S1N H;  4NXN Q;  2AKW B;  4KN7 C;  1XJV A;  2ES2 A;  3QJY A;  3K3V A;  4N9P A;  4OXP A;  1JOO A;  4DV7 Q;  4APV A;  1I3Q A;  1MBY A;  1VQE A;  2B2U A;  3JRW A;  1F2L A;  4UUG A;  5LXT F;  4CMD A;  4FBU A;  3Q23 A;  2B63 B;  3VPB A;  5LMN H;  3VYU A;  4DUZ L;  2HHH L;  3DM3 A;  2ASB A;  1QJO A;  1W2B A;  2UXC H;  1EY7 A;  2JA8 G;  4JI0 H;  2CZG A;  5FD6 A;  1DJR D;  3TEK A;  2SCU B;  4TV8 F;  5KFO A;  5IOD A;  1XNQ H;  1EWI A;  1SMY D;  5I4D A;  3OUU A;  1A9X A;  5BWU A;  1AE3 A;  4RWS C;  1YVC A;  1EY8 A;  2PZU A;  4KHP Q;  2W9C B;  5I5U A;  1LT4 D;  3CRL C;  4L5Q A;  3EYY A;  3C2P A;  4F88 A;  5FLM H;  4DXG A;  2D62 A;  4YHH H;  1EIF A;  4XQN A;  1RJT A;  5M5X B;  3D4W A;  3T7A A;  1B04 A;  4JI1 L;  4LFC Q;  4MV6 A;  1TWF B;  2IHE A;  3RZD B;  5KFR A;  1IBM H;  2BOS A;  1Q86 C;  2EYJ A;  1WTQ A;  2UUC Q;  3HBL A;  3ICE A;  5DEH A;  3S2D H;  1WTR A;  1OXV A;  3UDG A;  4ECQ A;  4J9M A;  1E2W A;  2V4D A;  1HNZ H;  3M4Y A;  4Q0Y A;  4EYI B;  1N36 Q;  4GKK Q;  3CQZ A;  4J0M A;  1OTC A;  2V4Q A;  4C5C A;  4QB4 A;  1HCZ A;  3OYY A;  4J15 A;  5ELO A;  2F0L A;  5HNE A;  1JWU D;  1U0L A;  2L15 A;  1PFM A;  2PQA A;  4X62 Q;  2IJ0 A;  4DAP A;  2L55 A;  2OTL A;  3TIN A;  2R8I A;  1LTS D;  2D2C C;  2MUY A;  2LXK A;  1CSP A;  4IQZ A;  1B8A A;  2R7N A;  1RJR A;  1GUG A;  4IZ8 A;  4CBV A;  2PBZ A;  3I4M G;  1C30 A;  1Q46 A;  4PMB A;  2ZTD A;  4IUU A;  1ONL A;  4B3T Q;  3J7A K;  1ZKO A;  2PYK A;  4A76 A;  1J6Q A;  3CD6 A;  4DV3 L;  2HGX A;  3CCM A;  1ILQ A;  2F0G A;  1OXU A;  4FP5 D;  2K5Q A;  1DON A;  3OPO A;  4DNI A;  3GTO B;  1WTP A;  4GLX A;  4X64 L;  1Q82 C;  3S15 B;  1H9J A;  4Q45 A;  4EQN A;  1Q8I A;  4A3F H;  3BAA A;  1F9R A;  4RAY A;  3DHQ A;  2V58 A;  2HHH H;  4WJ3 M;  4UCV A;  2XCP A;  1R4P B;  1BCP F;  4A3L H;  1CTM A;  2JA7 G;  4K5W A;  2W9B A;  4HIO A;  3MHB A;  2WAQ E;  5KG1 A;  1K3R A;  4IR9 A;  4GC7 A;  3D8G A;  1ASY A;  5EKL A;  4LSX A;  3DUZ A;  3KYH C;  4IPD A;  3BAC A;  1S5F D;  4YY3 Q;  3VOT A;  3S24 A;  2EJ3 A;  3KAK A;  2A6E C;  3T5L A;  4ILW A;  5A35 A;  1X56 A;  3T5K A;  2Z6K A;  3SE7 A;  3D6W A;  2F4V Q;  1QE6 A;  1D6E C;  1BBU A;  1Y8N B;  3UE0 A;  3S16 H;  4WD3 A;  2R84 A;  4R8I A;  3MA2 B;  1TII D;  3N8D A;  5I5Y A;  3RNU A;  2VOB A;  2GLT A;  3ERS X;  1BF4 A;  5H80 A;  4YCV A;  4IUP A;  3RR5 A;  5FO8 B;  4A93 G;  2ASL A;  4JV5 H;  4J9N A;  3GIQ A;  4O0A A;  4X65 L;  3A54 A;  2VUM A;  1I4H A;  3GIJ A;  1SYG A;  3MJF A;  2K50 A;  1TS2 A;  5D8D A;  2HCI A;  3RZO B;  3V6K A;  1E2V A;  3CME A;  4K14 A;  4DV1 Q;  4R8N A;  3HKZ E;  1EYZ A;  3M9O B;  1SE4 A;  1N32 L;  5K36 G;  2OQK A;  1YJ9 A;  3UFX B;  4LAA A;  2VUM G;  1WR2 A;  1QUQ B;  2PO4 A;  4NXN L;  4EFB A;  5T1G A;  2BH2 A;  2FFK B;  5IOC A;  3FHW A;  5KFU A;  3A5U A;  3D4R A;  1I7N A;  4IAJ A;  4GNX B;  4A3E B;  3MXP A;  1M0W A;  4EQO A;  3I12 A;  3G6X A;  2QDL A;  3HOY H;  1UC9 A;  1HUN A;  2ATL A;  1JIH A;  5L1J A;  5GAE C;  3HS0 C;  4IRC A;  3E3X A;  4X64 H;  2UUA Q;  3BZC A;  4JI3 Q;  3RLN A;  3FMA A;  4IAL A;  1FJG Q;  4MA5 A;  4O86 A;  3EVQ A;  5IYB G;  5A2Q W;  4IUT A;  3L4K A;  1L2F A;  1N34 Q;  2QYZ A;  4YCU A;  3TW7 A;  1V1O A;  2JEG A;  4GKJ Q;  5CC4 A;  3TY9 A;  2Z4H A;  4KHP L;  1H95 A;  4WBN F;  3JAM L;  2WKD A;  1SMX A;  2RCN A;  3HOV H;  3E9H A;  1BXR A;  3HZX A;  1YIJ A;  4HQ6 A;  2O5J C;  4M7E A;  2KA7 A;  2E74 C;  4LFC L;  1UE7 A;  2F0J A;  1PTO B;  3HOW B;  2EJF C;  3KF6 A;  4NYE A;  1PH6 A;  2A68 D;  3M9M B;  3GTQ A;  5C3E H;  2K52 A;  3NEM A;  4HAE A;  5FPR A;  2WAQ A;  4FXD A;  3BAB A;  4P75 A;  3Q8S B;  3RAQ A;  2F0H A;  4A3K B;  3JZI A;  3SEB A;  4BBR B;  2ZJP A;  3PQI A;  3PF4 A;  5E3F A;  3TZU A;  2JA9 A;  1KL9 A;  1N48 A;  4X65 H;  1NR2 A;  1IBL H;  1XTD A;  4XYQ A;  4X62 L;  4A3J H;  3J80 L;  4FF4 A;  3P1H A;  2WAQ G;  1F9Q A;  1TXY A;  2E75 C;  1I1L A;  4ZKB B;  3LML A;  2RBM A;  2ALZ A;  1SE2 A;  1KRS A;  5FJ8 H;  3V96 A;  2ZJR A;  1N32 H;  4FNF A;  5IGC A;  5JPM C;  4O7V A;  4B3T L;  1EZ1 A;  2L5T A;  1G2S A;  1QWY A;  1TWA A;  5DQG A;  1XNR H;  4XX0 B;  3P7J A;  4GOP A;  1V4Y A;  4ECT A;  3J80 W;  4NXN H;  3UYY A;  2QW7 A;  2AWO A;  2WAC A;  2HIX A;  1T9H A;  3CAM A;  1Q8K A;  2E5L Q;  3AW8 A;  1F77 A;  4JI8 Q;  4IWY A;  1XDN A;  3HKZ A;  1R4Q B;  5C44 H;  1KJJ A;  3OHA A;  2OXP A;  5ELE A;  2NB0 A;  4N8F A;  1A0I A;  3BDO A;  2RGV A;  2K5V A;  5DGI A;  3U9S A;  1PH8 A;  4FO2 A;  3WWJ A;  3KHL A;  4JI4 Q;  2HCC A;  4AYB E;  4O2A F;  4UCO A;  4O2D A;  3HKZ G;  2XRQ D;  2YZM A;  1Q7Y C;  4DR4 Q;  1KXL A;  5C1O A;  2K04 A;  3RD4 A;  4G7H C;  2CHB D;  5I6Y A;  1JDE A;  4YWM A;  3N6X A;  3MWE A;  2LXJ A;  4YY3 L;  4KHP H;  3GTK H;  2Z1C A;  2CWA A;  5D1O A;  3VPC A;  1PHJ A;  4JUZ A;  4EG0 A;  3I4N B;  4LJZ C;  5IYD H;  5DIS C;  2C9O A;  4QUC A;  4POF A;  2F4V L;  2BA1 A;  1Y14 B;  3CCV A;  1HRJ A;  4LFC H;  2J6S A;  4A3D B;  1L1O C;  3C1F A;  5KND A;  2UXB Q;  1SRO A;  1F2Z A;  2W70 A;  5DQH A;  3KHH A;  1N33 Q;  2VQF Q;  1J8I A;  2VQE L;  3JRX A;  3MVV A;  2PI2 E;  2YTV A;  5I5W A;  5FLM G;  2FLL A;  3KLS X;  2KOL A;  1N36 H;  4GKK H;  1PMR A;  3MXU A;  5KEE A;  4TQS A;  1RIP A;  1SNC A;  4DR6 Q;  1Z2P X;  3KTM A;  1CSQ A;  4OHJ A;  1O75 A;  4X62 H;  1EU3 A;  3CKI B;  4Y7N B;  1J5E L;  4OO1 I;  1EZ6 A;  2RDI A;  2ZM6 L;  1E2Z A;  2K5H A;  5KFW A;  4JI2 Q;  5EPJ A;  1ENC A;  3S1R B;  1XK5 A;  4B3T H;  1Y1V H;  1N56 A;  4R7R A;  3TP6 A;  3F8T A;  1WTX A;  4MV8 A;  5EAY A;  4A3I H;  3UE1 A;  4AH6 A;  1S0O A;  1SYE A;  2YS7 A;  4MV7 A;  1VQ5 A;  1OXX K;  5J3B A;  4C3H B;  1XMQ Q;  1PH3 A;  5J2T F;  1KTA A;  1IYE A;  3IRB A;  1Y1W H;  4JI3 L;  1ICW A;  5CV4 A;  5M5Y H;  1DV1 A;  4Q43 A;  1FJG L;  1A6X A;  2Z0S A;  1SSO A;  2E2I H;  2K6A A;  1DD2 A;  4LF6 Q;  3WWV A;  1ESF A;  4LW1 A;  3E0J A;  3PIP A;  4RNN A;  2R7D A;  1DOK A;  2F3I A;  1N34 L;  3G6V A;  4J9P A;  3M85 A;  1PH9 A;  2C35 B;  2XN9 C;  2MPM A;  4ZRZ A;  4GKJ L;  3S1Q B;  5CB4 F;  2NU8 B;  1EWH A;  2A6E D;  3WDN A;  1BQQ T;  1KLU D;  1EHI A;  2A19 A;  3LWB A;  1STB A;  1UNN C;  2MP1 A;  4A3F G;  4B3M L;  4M9U A;  3K8A A;  5IYC H;  3PO2 G;  4YY3 H;  2NUC A;  4AYB A;  4A3L G;  4R4C A;  3M3Y B;  3STB C;  4C3I B;  3HOU B;  1RK6 A;  2O03 A;  3RFC A;  2N8N A;  1X3E A;  1JE4 A;  1TS4 A;  1D7Q A;  3V6J A;  2F4V H;  2MHV A;  1LTR D;  2ICE C;  3WOE A;  5KT6 A;  2WTF A;  4JPB W;  1Y8O B;  2WIN B;  5L37 A;  2CW0 C;  4DV5 Q;  4RNO A;  3U55 A;  5BN5 A;  1T5E A;  3JSN A;  2VL6 A;  3R9R A;  2VB3 X;  4I65 A;  1ENA A;  4C5B A;  4JI6 L;  4CC5 A;  2VQE H;  3WNZ A;  1SAP A;  4NB3 A;  4DIM A;  4KV6 A;  1W96 A;  4ECY A;  2DWC A;  4JVZ A;  5F2D A;  3TN2 A;  4DV1 H;  2F0I A;  4DKA C;  1K8O A;  1H9M A;  2JA6 B;  4MA0 A;  3H15 A;  1SYD A;  3GLK A;  1VQB A;  4ME6 A;  3K0X A;  2GQR A;  4DL4 A;  2J6U A;  5GAH C;  1IYD A;  2R93 B;  2ZM6 H;  4FS2 A;  2R92 H;  2UXD Q;  3GQB A;  5JVD F;  2E5L L;  2R7Z A;  4JI8 L;  2DNE A;  2Q8T A;  4PWQ A;  4KHV A;  1CKO A;  2F0T A;  2WB1 A;  1Z47 A;  4FYD A;  2FLN A;  1CQV A;  1YZ6 A;  3LX0 A;  2DZD A;  2UUA H;  4JI3 H;  3PFF A;  4JI4 L;  1YNX A;  3JAM E;  4EX5 A;  1FJG H;  1E3P A;  2GN5 A;  4YWK A;  5CYU A;  1GD7 A;  4DR4 L;  1FYC A;  3HXL A;  3KDF A;  2KCT A;  4JI5 L;  3HOY G;  4QWA A;  1N34 H;  3EIV A;  4NPS A;  4GKJ H;  2WB1 G;  4HNT A;  5C1P A;  3PW4 A;  1XYI A;  1B44 D;  3T1Y Q;  5KFF A;  1FL0 A;  2XVS A;  1PTO D;  4O7T A;  2I07 B;  1X3F A;  1NUC A;  1PH1 A;  3NK9 A;  2R8K A;  1EIG A;  4ED2 A;  2UXB L;  4O7L A;  3I4O A;  3CW2 C;  2HUG A;  1GHK A;  4PV1 C;  1CZG A;  3A5Z B;  1N33 L;  1HNW Q;  1IBK Q;  2ASJ A;  3WOF A;  3PUX A;  3FRP B;  3SHL A;  1TWH H;  3TQY A;  3G8C A;  3IL8 A;  2BE5 D;  5M3M H;  3HOV G;  3GID A;  5LA6 F;  2QKI C;  1GOZ A;  2RDF A;  4L5R C;  2VUG A;  1IL8 A;  2KJX A;  1N8R C;  2Z04 A;  1C8C A;  3QOJ A;  1GSH A;  3G71 A;  3M4Q A;  3PUY A;  3D4D A;  5KFE A;  4E4T A;  2NVX B;  1M1K C;  2N49 A;  1K1S A;  4Q4C A;  2L11 A;  4LH6 A;  1STA A;  2N78 A;  4QIW A;  1V1Q A;  4DK1 A;  4JG2 A;  4A3J G;  4O7Y A;  1BUV T;  1A15 A;  3NEN A;  3HOZ H;  3RGX A;  2E5L H;  4JI8 H;  3GTP A;  3PZP A;  1D5M C;  1STG A;  1WCM B;  4DA2 A;  5FJ8 G;  5M3F H;  2Q2I A;  4R4T A;  4GS3 A;  5JUM A;  3OHX C;  3PO3 B;  2JEF A;  4GN4 B;  4IFD H;  3PIO 3;  5J1Z A;  2W7P A;  5I47 A;  5KFD A;  1PYS B;  1STH A;  2YZG A;  1NMG A;  3VR6 A;  3ZYY X;  3Q2O A;  3J81 c;  4ECZ A;  4JI4 H;  4FS1 A;  5C44 G;  4KLK A;  1H9S A;  2NVQ B;  4DR4 H;  3GD7 A;  2F0P A;  4LF7 L;  2YRW A;  4O4J F;  4JI5 H;  1K3B C;  2FPG B;  4DR3 Q;  2M00 A;  4QMG A;  2WE6 A;  2AMC B;  1KC7 A;  3T1H Q;  1CI3 M;  1M6V A;  2ATW A;  3GTK A;  2I80 A;  5KG2 A;  1EZ8 A;  4A3B B;  3EN2 A;  2XWJ B;  2B63 H;  3NEL A;  1PFS A;  4XT1 B;  2MO0 A;  1TQO A;  2VR1 A;  4CJ1 B;  1RTN A;  2J0T D;  2UXB H;  2OEO A;  3T53 B;  1GSA A;  1CQF A;  2MQH A;  5IP9 H;  2ZT9 C;  3I56 A;  2K5D A;  4TQU S;  3U0G A;  1I7L A;  3KRE A;  3UZB A;  1N33 H;  5DAA A;  5CBA E;  5K5P A;  2GPS A;  4BA2 I;  3M4O B;  3PR5 B;  4FU0 A;  1RJQ A;  1K8A C;  1KUT A;  5CA1 F;  1AZQ A;  2NYZ D;  1Y8P B;  4CDE C;  1Z9F A;  5FLX c;  1EEI D;  4DR6 H;  1A3U A;  5M5X H;  3EA6 A;  1GLV A;  1TWF H;  3RZD H;  3ERQ A;  1HNX Q;  1M8A A;  1PRT B;  5BYB A;  5KIX A;  4J1M A;  2EXD A;  4X66 L;  3AQQ A;  5JVH 3;  1DYQ A;  2UXD L;  1NR4 A;  5GAD C;  4K6N A;  1KAW A;  4RB2 C;  1Y1V A;  5D1P A;  4J9O A;  2NVT B;  4H02 A;  4OON A;  2B39 A;  1VQ4 A;  3NTK A;  2SEB D;  1IW7 C;  2CWP A;  5EBC A;  1VQI A;  1G91 A;  2BQ3 A;  5FO9 B;  4UP7 A;  1XMQ H;  5KG6 A;  4JBJ A;  5BPH A;  1Y1W A;  3A8K E;  2F0O A;  3AEV A;  1CKN A;  1Y1V G;  1K83 A;  1Z2N X;  2V1C C;  3T5H A;  2E2I A;  5D3I B;  3BJU A;  4LF6 H;  1GJX A;  3GTM B;  1E4E B;  1I1M A;  3T9A A;  4A3I G;  5HBR B;  1MI2 A;  2EJ0 A;  2V4R A;  3RGZ A;  2RKS A;  3NSW A;  4DAY A;  1JOK A;  3PUW A;  4DR5 Q;  2UVR A;  1VQ7 A;  2UVU A;  4ID6 A;  4MN3 A;  1Y1W G;  4LF7 H;  2SDF A;  3T1Y L;  2NVY H;  3STB D;  3IKJ A;  2W71 A;  1PLF A;  2K5W A;  2KUM A;  3RLF A;  5LYJ F;  4O4L F;  3S15 H;  2EY6 A;  2MFI A;  5LMN L;  2WV6 D;  2AGO A;  2CW0 D;  1EU4 A;  4RU9 A;  1TKW B;  4FXK C;  3K58 A;  2JSO A;  1HNW L;  4JI0 L;  2O5I C;  5CV8 A;  2R6G A;  3QQM A;  1T3N A;  4XDX A;  3VR3 A;  4FE2 A;  4DU9 A;  5IYC G;  1XNQ L;  4BXX H;  1YHQ A;  3T9F A;  1A48 A;  4WOR A;  4L6T B;  3T9D A;  5M3F B;  2W6O A;  3I7F A;  2GQS A;  3N43 B;  1E7Z A;  4R8U B;  4NZN A;  5KFY A;  1I3Q B;  3DWP A;  1SYF A;  4ECX A;  1KNA A;  3QWN A;  3H09 A;  4BBS H;  1IBM L;  2YCH A;  2W6M A;  3RB6 A;  2O2L D;  1ZXT A;  4KY6 A;  1VQM A;  3U54 A;  4X66 H;  5IGB A;  2R92 A;  3T99 A;  2BDN A;  2A74 C;  4RHS A;  3BVG A;  2UXD H;  4RGO S;  4P71 A;  3ITP A;  3J81 i;  3VYS A;  5BWV A;  2COI A;  5KFB A;  3ULP A;  3RZO H;  4GN3 B;  4JOI C;  1TY0 A;  1O78 A;  2N88 A;  2R92 G;  4YJ2 F;  3L3O C;  3LGJ A;  2CCZ A;  1M0T A;  3SGI A;  3VR2 A;  3CPW A;  5CA0 F;  4ED1 A;  2PQE A;  4RHR A;  2RDH A;  2Q7D A;  2RHQ B;  5KS8 A;  4HJ9 A;  5KFP A;  4DR3 L;  1S97 A;  3K5M A;  3T1H L;  2I87 A;  3KF8 A;  3QG1 A;  3DTG A;  3H3V H;  4A3E H;  1PFN A;  3A8J E;  4XYL B;  1X55 A;  4R4I A;  3T1Y H;  3BYT B;  2E2D C;  3GIM A;  3KAJ A;  4F4Y A;  3OW2 A;  5KFK A;  1EFI D;  3RV3 A;  4O3Q A;  2ZJQ A;  4KKU A;  4LF4 Q;  1RF2 D;  4S3S A;  4Y52 H;  1KJI A;  2XNA C;  2JP1 A;  4KY5 A;  1HQM C;  1YIT A;  3KXY T;  1HNW H;  4NXM Q;  4JV1 A;  3UZO A;  1TWH A;  3TDQ A;  2Q8I B;  4NLG A;  2YW2 A;  1R9T B;  2KHI A;  1XTC D;  3MR2 A;  2K1B A;  4AIM A;  2YRX A;  1B33 N;  2WP8 J;  4LWC A;  1AFP A;  1ZHQ A;  2EIY A;  4TUY F;  3GP7 A;  3FDT A;  4YAK B;  4KN4 C;  2H1E A;  3BZK A;  5C3X A;  3BS1 A;  3KLW A;  1T36 A;  2CNV A;  1BGW A;  4FFO A;  1YHA A;  1PTO H;  1SXT A;  2Q2U A;  3HOW H;  5L1K A;  1A3T A;  5M3M G;  1HNX L;  1V51 A;  3WO1 A;  3I8Z A;  2IPK D;  3I91 A;  4LMQ D;  3TSS A;  4X3K A;  1HQR D;  3NUA A;  3BVZ A;  4A3K H;  4BBR H;  1KAB A;  4JV5 L;  1S68 A;  3TY5 A;  2COJ A;  4CC6 A;  4JOI A;  2K75 A;  2M9V A;  5DGH A;  4BA1 I;  4JW0 A;  2Y0S E;  4KY7 A;  2FIN B;  4HR7 B;  4KD3 A;  4PZ8 A;  1Y69 U;  3RBD A;  3HOX B;  5E25 A;  4XXE A;  2JQO A;  4JC0 A;  5DMX A;  3I4L A;  4NW2 A;  5KFG A;  3GIP A;  3R93 A;  3D6C A;  3K81 C;  3M9N B;  2A8V A;  3HOZ G;  3KUP A;  1UE5 A;  4F4X A;  2R7F A;  5I9O A;  3ORQ A;  2ASD A;  1RK5 A;  1UEA B;  2XIG A;  4DR3 H;  3U9O A;  2KCM A;  4TSS A;  3C46 A;  4IFD G;  5EDW A;  3PR4 A;  5JJL A;  3T1H H;  2NN6 I;  3VA7 A;  4IJL A;  4A2B A;  2EVB A;  2EYF A;  1JX4 A;  2JA7 A;  5IGF A;  1I4X A;  2JA5 B;  4UY8 C;  1QB5 D;  4IR1 A;  2DN8 A;  1V8Q A;  4B9X A;  4YB8 B;  3OIP A;  5KRU A;  3SK5 A;  3HT5 A;  5JH7 F;  2Q2T A;  4GN5 A;  1DOM A;  1QG7 A;  3OMC A;  2CQY A;  3PO2 H;  4ED8 A;  4WJW A;  3BJY A;  4QQB X;  2ZTC A;  3S1M B;  1FGB D;  2J4X A;  2JK8 A;  3HP3 A;  2B63 G;  3F2B A;  1IOV A;  4RAZ A;  4MAM A;  1VQP A;  1JOR A;  2TSS A;  5IP9 G;  1RCV D;  1C48 A;  4K2L A;  1QVG A;  4BY1 B;  1M7J A;  5KG7 A;  2A1A A;  1VQK A;  1NY4 A;  1PRT D;  1AUV A;  1KJ9 A;  4Q5V A;  4A3D H;  1HNX H;  5CBE E;  4WFN 3;  5EWF A;  2PW5 A;  3ETJ A;  1HHV A;  2F1M A;  5DQI A;  1NMF A;  1IW7 D;  3OIQ A;  3EJI A;  1JDB B;  3QZ7 A;  2G5D A;  2IT1 A;  4NZM A;  2VA2 A;  1GHJ A;  1XMO L;  3TIG A;  4HIK A;  3GTG B;  2HHF B;  4A4I A;  2X69 A;  3K5H A;  1IBL L;  4X3S A;  4LSA A;  3ERO A;  2EYO A;  2VZA A;  3U9T A;  2XCA A;  1YHB A;  3TP8 A;  3GTJ B;  3GV5 B;  1W3S A;  4Y7N H;  1ET6 A;  5LOV F;  4TV9 F;  4I7A A;  3J7A V;  3R5F A;  2LFN A;  2Z02 A;  1E0B A;  1XNR L;  3QR8 A;  3GTQ B;  3IAY A;  4G3I A;  2JEI A;  5H1S E;  3S1R H;  4IUR A;  2J6T A;  2Y0S A;  4DR5 H;  2HQE A;  3MFH A;  1WOC A;  1TR5 A;  2ZDH A;  4OL7 A;  4B3R Q;  3RIZ A;  4GC6 A;  2VQD A;  1STY A;  2NVY A;  2NZH A;  4DV7 L;  3EFX D;  5A2Q L;  1RYR A;  5D65 A;  1T5X D;  4C3H H;  3TY8 A;  4GNX C;  4K5V A;  3H3V C;  1HZA A;  3AB9 A;  4LF4 L;  1KNE A;  1HFG A;  1HUM A;  2KHS A;  2Y0S G;  3K7U C;  3Q6S A;  1MGS A;  1TU2 B;  1BCP B;  2K32 A;  3I73 A;  5CM0 A;  1CHP D;  1EY4 A;  3GTL H;  4K0K Q;  3ER0 A;  4RCO A;  3TII A;  5KFT A;  2BQU A;  3T9B A;  3S1Q H;  4DXF A;  1LYL A;  3I70 A;  1TWA B;  3H4B A;  4CKC A;  1VQC A;  2K03 A;  4GOP B;  3G6E A;  2X6G A;  1K0R A;  4KKT A;  2E8G A;  4YR3 A;  4MV1 A;  4CMF A;  3N41 B;  3HKZ B;  3NWS A;  1MD2 D;  4JK1 C;  3T13 A;  3NBH B;  1SE8 A;  1RKN A;  3M3Y H;  3HOU H;  2L12 A;  4HNU A;  2B2T C;  4BXX G;  4F50 A;  2OF1 A;  3GB8 B;  1Z7T A;  1PTO C;  1VQH A;  2R86 A;  2UUC L;  3FPP A;  5D3D A;  3KLS A;  4EBC A;  2OQ0 A;  4RAU C;  1XMO H;  1VQF A;  1PZI D;  1N36 L;  4BBS G;  4GKK L;  3GV7 B;  1ZHS A;  4YWL A;  5GQO A;  5BR8 Q;  2BE5 C;  5DG7 A;  3A74 A;  4NKL A;  2BA0 A;  3A7L A;  3FVQ A;  4GLA C;  1WYD A;  2EYP A;  1G2W A;  2F3W A;  2B8F A;  3RB0 A;  4DL5 A;  3R2T A;  2ODT X;  1ZYR C;  5C8Y F;  4DL2 A;  2W7O A;  4JCV E;  1WTH A;  4CJ0 B;  2R8G A;  1EUC B;  4GNX A;  1S5C D;  4RCN A;  3E6Z X;  2EY2 A;  4JBK A;  3GII A;  3F2D A;  3H91 A;  4DV7 H;  4ZYS A;  1II3 A;  1IOW A;  4J9S A;  2KQ3 A;  3JSL A;  2IW3 A;  3L9A X;  4KD4 A;  2B29 A;  2C00 A;  1ML0 D;  3LWE A;  4LF4 H;  1SJE D;  2ZGI A;  2A6H C;  3TQT A;  4A2A A;  4LF8 Q;  1EIY B;  5BN4 A;  4OX9 Q;  4ZQI A;  2FXQ A;  2RA4 A;  3P20 A;  3BA9 A;  4A3E G;  1DGS A;  4RZR A;  2Y4R A;  4NXM H;  4C56 C;  2XCL A;  1EYG A;  1C9O A;  3D0F A;  2NUA B;  1TS3 A;  1CQJ B;  2BQR A;  4DV6 Q;  4O3R A;  2A73 B;  2AQ4 A;  1S9F A;  5FK9 C;  4QF4 A;  3RLO A;  4K2K A;  4BY7 B;  1CA6 A;  2FE3 A;  2DGY A;  2QF7 A;  5KT7 A;  2W9A A;  2B2T A;  3TQ1 A;  3F8N A;  1I4P A;  3PV0 A;  4DK3 C;  5C4J B;  4A3G B;  2W6Z A;  5J2U F;  1JCK B;  2C5C A;  1FNU A;  4C2M B;  1CFM A;  4KJN A;  4OEL B;  3Q8Q B;  1AN8 A;  3CEB A;  4O3P A;  5JOB A;  2L0C A;  4DV0 Q;  1BXT A;  1JC7 A;  2UUC H;  2PZW A;  1QCB D;  1HA5 A;  4Z9C B;  4C1N I;  1I2L A;  1O7Y A;  4ZK9 B;  5EKI A;  2R8J A;  1KDC A;  5EPK A;  1LLR D;  4OWW B;  3HOW G;  1Z2O X;  3KHG A;  2SNM A;  2A69 C;  2X5R A;  2YU9 B;  5JEA H;  5KFH A;  3JAM c;  4C3J B;  3CCR A;  4DV1 L;  1NJI C;  5L1L A;  1A2T A;  4A3K G;  2OT2 A;  4JI7 Q;  1TT2 A;  4BBR G;  4O84 A;  1S3O A;  4AYB B;  2FMA A;  5IT9 L;  5KFA A;  4LFA Q;  3SVM A;  1EQV A;  4TRD A;  3SI8 A;  4ZQ3 A;  2WB1 E;  1KLG D;  5C5M A;  5EWE A;  3S16 B;  3CPF A;  4ED7 A;  4QGU A;  1X65 A;  2NTT A;  3GQC A;  2IHF A;  4X3U A;  4MHE A;  4DUY Q;  4KK7 A;  4XYM B;  4B3R L;  4UP9 A;  1SNQ A;  1O7Z A;  1UNS A;  1WCM H;  5CV6 A;  3H0G B;  1EQQ A;  3QIA A;  3ULL A;  4CE5 A;  2KSW A;  5L9X A;  5E4W C;  2N55 A;  4Q44 A;  5IT9 W;  5IGE A;  1G29 1;  2PW7 A;  5KNC A;  2RHS B;  1VQO A;  3PO3 H;  1W93 A;  1VDZ A;  1X3Q A;  3C1E A;  3J80 c;  3PIP 3;  2UUA L;  4GZY C;  1BR9 A;  3G4S A;  3TBI B;  2NTS A;  3I3C A;  1I50 B;  4OIJ A;  4K0K L;  3AYH B;  4LF9 Q;  3TEH B;  4IRK A;  1QZG A;  5JAV A;  4HN7 A;  3GIK A;  1X6O A;  2MJ8 A;  4LUO A;  1L0X B;  3T51 B;  4EQ5 A;  3E9I A;  3I72 A;  2IX1 A;  4FFN A;  3SK6 A;  3DAA A;  1PH5 A;  5CAE B;  4UHV A;  5LMU Q;  3OMG A;  2DY7 A;  2L1B A;  3MC0 B;  2R7Z B;  5IP7 H;  5K2M A;  5BWR A;  4ED0 A;  3PW5 A;  4A3B H;  4FVM A;  4AQY Q;  4O3N A;  2WDT A;  1L2Z A;  1L1O A;  1B6S A;  1TWG B;  1UE1 A;  2AWN A;  2YZN A;  3MR5 A;  2AQ1 B;  4LUV A;  2L9H A;  2ZDG A;  3JZF A;  5KG4 A;  2GVA A;  2AQ2 B;  3BQ2 A;  3N52 A;  3A0J A;  3JC6 6;  3E5S A;  4MTN A;  1LTB D;  1W6J A;  5BYA A;  1Q1E A;  3M4O H;  1UWV A;  5JJK A;  4O83 A;  3I4N G;  4MV9 A;  2I5H A;  3KDF B;  3PW7 A;  1UAP A;  4R4Q A;  5JQW A;  2HGW A;  4QIW E;  3T16 A;  1STE A;  4A3D G;  4HYK A;  5AJ3 Q;  3MZ5 A;  5M5W B;  2PZT A;  4O7Z A;  1TA8 A;  2X0S A;  5BWW A;  1VQD A;  2UU9 Q;  3K0Y A;  4MIU A;  2FMM A;  4RGM A;  5A2Q E;  2Z8L A;  3TZD A;  3TS2 A;  3DEO A;  3PSI A;  3J7A F;  4X6A H;  1JOQ A;  5BPF A;  5C3E B;  2F3V A;  2EIF A;  2F4I A;  3DF7 A;  4RG1 A;  4DRF A;  5DM6 3;  4F7X A;  3RB4 A;  2NVT H;  3CC2 A;  4B3R H;  1LM0 A;  1TWC B;  4V19 0;  2OCE A;  2M2L A;  3F2C A;  5KKN B;  3QZ8 A;  3MXG A;  2OH2 A;  3L0O A;  2DIK A;  2F0N A;  2AU0 A;  1PYB A;  3AMU A;  1G8Z D;  4K8J A;  1EEF D;  4ZLT F;  4C1N K;  4A3J B;  4LF8 L;  2LKV A;  2IWH A;  1LTA D;  2F0Q A;  4O4I F;  4EVO A;  3GTM H;  4HJ8 A;  2MGS A;  3HGB A;  4FF2 A;  4GLW A;  1ZEQ X;  2L4N A;  3GTL A;  4K0K H;  1SNM A;  4HCS A;  4DQN A;  3GV3 A;  4C3H G;  2BCO A;  3LWU A;  4DV6 L;  1NNX A;  1D8L A;  1IHZ A;  4K8I A;  4WRD A;  1GM5 A;  3U58 A;  4QW8 A;  3G8D A;  4U7C A;  3TP5 A;  5C4X B;  1EY5 A;  3J81 W;  4U68 A;  1SYC A;  3GTP B;  3VR5 A