1FVIA

Crystal structure of chlorella virus dna ligase-adenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
264
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIAGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords CHLORELLA VIRUS DNA LIGASE-ADENYLATE
publication title Crystal structure of eukaryotic DNA ligase-adenylate illuminates the mechanism of nick sensing and strand joining.
pubmed doi rcsb
source organism Chlorella virus
total genus 72
structure length 264
sequence length 292
ec nomenclature ec 6.5.1.-:
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fviA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1fviA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1fviA01
3HKSA 3PV0A 3BA9A 4B3TQ 3E0EA 3I4OA 3W1BA 4BA1I 2HVSA 4P75A 2UXBL 4DV5L 1NJIC 3RLNA 4IOCA 2WFWA 5DLQE 4DV3L 1V9PA 3TQYA 2MO1A 4HIOA 4A3IH 4NPSA 3J7A5 4KHZA 4B3RL 2RF4A 2DUDA 3PSIA 4BY1G 3PIPA 2B29A 4A3MH 3FKIG 4DV7Q 2JEBI 4LF4L 2K75A 4LF8Q 1TXYA 1NE3A 1YNXA 2D62A 2JA5H 1X55A 3AYHB 3K7AH 2UUAQ 2IHEA 4DR6Q 4P72A 3I4MG 1NY4A 5GAGC 4A3FG 3EBEA 1YEZA 1VQGA 2CKZB 3S14H 1VQOA 1M90C 2JK8A 2UU9L 1VQHA 5GADC 2MQHA 4DR7L 4YHHQ 4JI0L 4OONA 3CC2A 5HGQA 1I6HH 5D1OA 3KJOA 2HQLA 4A3JH 3GTGH 3J81i 5IYBH 2BA0A 3F1ZA 4QGUA 3D31A 1QUQA 1JB7A 4KI0A 2UXDQ 2XTIA 2HT1A 1XPOA 2LSSA 2Z0SA 2YYZA 3DLLA 3K0XA 4X62L 2RCNA 3NEMA 4QL5A 2AMCB 3STBD 1XJVA 2R93G 4BBRG 4OX9L 2KHIA 3RZDH 1PV4A 3S2HH 3H0GG 1YJNA 4LF7Q 2JA6H 1GKHA 1OXXK 3CMAA 2OTJA 4RMFA 3CCJA 2UUCL 1EUJA 1IBLQ 3GDEA 3A0JA 4R4QA 2A1AA 2GVBA 1L0WA 2E2HH 4BY1H 2EQSA 1N9WA 1E22A 3PO3G 3OYYA 4DV2Q 4JI2Q 3FKIH 1VQ7A 4LF5Q 3CQZH 5D1OB 4JOIA 1SROA 3CW2C 1HR0Q 4B3SL 5IE8A 3AFQA 4IPDA 1OXTA 1QUQB 1G51A 4X65L 3PF4A 3PUYA 1IZ6A 4IFDI 4UCOA 2WB1G 3K7UC 4B3MQ 5JEAG 4OWWB 4IPGA 5JJLA 4DV6L 5LMNQ 1SRUA 4DV0Q 4LFBL 3AFPA 3FP9A 4AQYL 1Q86C 1BBWA 3RLFA 1UWVA 4O0AA 4JI5L 4DR2Q 4A3KH 2IY5B 4DR1Q 3PUVA 3PCOB 1X3GA 2PMZE 4GLXA 3PO3H 1Q8KA 4UP8A 4YY3L 1ASZA 1BKBA 1X3FA 3M9BA 4XIGS 2K5HA 4DUYQ 1ASYA 3M4OH 4K0KL 1S68A 5M3MH 4LFAL 4YCVA 1E1TA 1SFOH 4JCVE 4JI4L 3H3VI 3QWUA 4GKKQ 3J81c 5IWAL 2EIFA 1XMOL 4DR4L 1I50H 5K36G 3WWVA 1C0AA 2Q2HA 4WJ4A 4DK3C 1EIFA 5IYCH 5BR8L 1WCMG 2UXBQ 1K0RA 4DV5Q 3M4PA 1VQJA 3A74A 4DPGA 1VQIA 5IP7G 1EIYB 4DV3Q 4TQUS 2RHQB 1VQEA 2V1CC 3K8AA 4A3DG 4B3RQ 2HIVA 5HY6A 4QQBX 2AKWB 4CC6A 1UE5A 1CUKA 2BA1A 3AQQA 1HZBA 1MKHA 4LF4Q 1E3PA 2K50A 4HJ8A 4A3LH 3S1RH 2JA9A 3I2ZA 1C7YA 4KLKA 3RNUA 5M3FH 1HNZQ 1S3OA 3F2BA 2Y0SG 1Y1WH 4NXML 3PO2G 4ME3A 4LFCQ 4JYAL 2YV5A 2MO0A 1X56A 4ALPA 1UE7A 1Y1VG 1PH3A 2UU9Q 4C2MH 1OTCA 4DR5Q 1CKNA 1YVCA 3UE1A 2Q2TA 4LUVA 4DR7Q 5H1SE 4JI0Q 3PF5A 1KQSA 2WAQG 3HFZB 2I5HA 2B63G 1VS0A 2VZAA 1V1QA 5C4XG 2ID0A 1I94L 4NXNL 3S17H 1KD1C 3T1HL 3NBYB 5C4JH 3S16H 4X66L 2BH2A 2HHHL 1HNWL 1GD7A 1U0LA 4OX9Q 1TWFH 4GKJL 4DR3L 3S1MH 2A19A 2K5VA 2IT1A 3U4ZA 4A76A 3M3YH 3M85A 3PIOA 4LF6L 1FGUA 2UUCQ 3HOVH 4IFDG 1CKNB 1VQDA 1XPRA 1RL2A 2VUMG 3T1YQ 2VS1A 3CCUA 1VQNA 2YU9H 4P71A 5FPRA 3L7ZC 3OW2A 2E8GA 2EXDA 1YIJA 2R6GA 3BZCA 4X65Q 1XNQL 3PO2H 1N8RC 3BA8A 1PH6A 1G291 4YCUA 5JEAJ 3F8TA 4UP7A 2VY3A 1QZGA 1A8VA 1SLJA 1MJCA 5IYDH 3U50C 1Y1VH 2N8NA 4R4CA 5JJKA 4R1JA 4DV6Q 2A8VA 2ZTEA 1G6PA 4JOIC 3CCQA 4X64L 5C44G 4A3GH 4AQYQ 1R9TH 3HOWG 3ICEA 4A93H 2VQEL 3RZOH 1IBKL 2AWNA 2D0PA 5GQOA 1QZHA 1N36L 2B63H 3PUWA 1Q1EA 4TVAB 1XDNA 4BY7G 2Z6KA 4Y52H 3MXNB 4LUZA 4LWCA 2GN5A 4YY3Q 5FJ8G 4UCSA 5ELOA 4LF9Q 4C3JH 1LM0A 4K0KQ 1TWAH 1OXVA 4HJ7A 4JV5L 1L2FA 4LFAQ 3CCSA 2E5LL 1WJJA 3PN1A 4JI4Q 1SR3A 4DAYB 2JA7G 3NENA 2WB1E 5IWAQ 2QA4A 1YHBA 1XMOQ 1LUZA 1MIUA 2NVYH 3BJUA 3CAMA 3H15A 4DR4Q 3HKZG 2VQFL 3L2PA 3VDYA 1QVFA 3OTOL 2UXCL 1TWGH 5BR8Q 2NZHA 4YWKA 2ATWA 1SE8A 4JI8L 2CFMA 2N49A 4H02A 4R4TA 3J7ZC 3BZKA 2R7ZG 3CC4A 3ULJA 1IYJB 1VQCA 2KCMA 4EX5A 2K4KA 2YTVA 3TREA 1Z9FA 1HH2P 1TWCH 1Q1BA 4HIMA 3CCLA 4QY7A 1D7QA 3GD7A 1Q46A 1WI5A 3I4NG 4QIWE 1C9OA 2UUBL 2CWAA 2ZTDA 3A5ZB 3KOJA 1PVOA 4NB3A 3I4MH 1KIXA 4GNXC 2ZTCA 3RN2A 4A3FH 4JYAQ 4X6AH 5C44H 2F52A 1IBML 3H3VH 3HOZG 3FHWA 2K14A 3HOWH 1QVCA 1VQLA 2I5LX 2KENA 4GOPB 2PI2A 3D0FA 4DR5L 4JC0A 1Y14B 2JQOA 1YITA 1HNXL 1NMGA 4BY7H 3A5UA 1B8AA 1JJCB 3GTPH 1RIPA 1E7ZA 3TY8A 4JBWA 1N33L 3TS2A 1A0IA 4GN5A 1PHJA 5LMUL 1I94Q 3CC7A 1X9NA 4NXNQ 3T1HQ 4OO1I 1SMXA 3J81j 1PA6A 4XTCS 1EQRA 3CXCA 2I0QA 2CWPA 2Y0SE 5C0XI 1K9MC 4JI3Q 1CSQA 4A3CG 5ELNA 4DUZL 5IT9c 2HHHQ 1HNWQ 2R93H 4BBRH 1XMQQ 1UEBA 3H0GH 3VNNA 3J80i 4L5RC 3UDXA 3CCMA 1V43A 3HOUG 4LF6Q 2XGTA 1HZ9A 2VW9A 4A3EG 2R7ZH 1AE2A 2NN6G 2WAQE 3NELA 3DM3A 1N34L 2QEXA 1GVPA 4A4IA 4GNXA 2ZJQA 1SN8A 1EOVA 4A3BG 1WFQA 5M5WH 1TWHH 5FLMG 2CQOA 4YHHL 1PFSA 3I4NH 2ZM6L 4LH6A 1XNQQ 1JJ2A 3CPFA 1K8GA 2JJQA 1FL0A 3CP0A 2CCZA 2AHOB 3BU2A 4GLAC 4PMWA 2ALYB 3KJPA 3CF5A 1PH1A 2ASBA 3G71A 3W5OA 4JI6L 2IX0A 1YBYA 2FXQA 1Q81C 2VQEQ 3SGIA 4POGA 3I56A 1VQBA 1BVSA 4FDBA 1IBKQ 1N36Q 5C3EG 3KF6A 4LF7L 3HOXG 1AE3A 1W3SA 3W1GA 4HIDA 4L5SA 2KHJA 4EFBA 4UCVA 1FJGL 2VUGA 4GNXB 4IOAA 2JA8H 1FVIA 3AEVA 1XNRL 4JV5Q 4YWMA 1PYSB 4JI2L 2E5LQ 1D8LA 1YZ6A 3KFUA 1HZAA 3PGZA 1P16A 4PZ7A 3RN5A 1QVGA 3M7NA 3E9HA 1X3EA 1HR0L 3K80C 3ULPA 1EYGA 3L0OA 2OCEA 4YWLA 4X62Q 4PZ6A 1UE1A 1KRSA 3OTOQ 2VQFQ 1YJ9A 4A3EH 4JI7L 3HOUH 4LW1A 2R7DA 1TAEA 2Z6KC 1P8LA 4YCWA 1N32L 1WCMH 4JI8Q 5IP7H 4B3ML 2NVQH 2JA5G 1X65A 4HJAA 1YI2A 1VQMA 2LXKA 1T9HA 1PH4A 2D0OA 2VNUD 3GB8B 3PUZA 4A3DH 1K3RA 4BA2I 2N78A 5FLMH 1JE5A 3KF6B 4DV0L 3TRZA 3J80c 1HR0W 4PZ8A 1M1KC 1OXUA 4GOPC 2R7FA 1B7YB 3HOYG 1A63A 1AH9A 1WOCA 3UDGA 3S15H 5FPOA 4B3SQ 2UUBQ 2F4VL 4A3JG 1XK5A 5IYBG 3HKZE 4GN4B 2DGYA 4GLVB 1IBMQ 2R92G 2NN6I 2B3GA 4AIMA 2YTYA 5LMNW 4A75A 1PH9A 4MNOA 4OO1G 1E1OA 3BAAA 1HJPA 5EAYA 5C0XG 4UCTA 1I3QH 4AYBG 3HOXH 4IJLA 5M5XH 4LNQA 4LFBQ 1HNXQ 4C3IH 1K83H 3S1QH 1PYBA 1VQ4A 3S24A 1N33Q 2JA6G 4JI5Q 4KHPL 1VQPA 1Z47A 2ZJRA 4DRFA 2OTLA 1I5FA 5C4XH 3F2DA 4JG2A 5LMUQ 1JT8A 4UCRA 2WP8J 2H5XA 4JBKA 3RR5A 1K73C 1PH5A 3MEFA 1GO3E 1VCIA 4UFZA 2JEAI 1LYLA 4R4IA 1L1OC 4DUZQ 2PNHA 3CPWA 1B04A 2NZOA 5IY0A 2L15A 1KXLA 4DV4L 3U4VA 1PH8A 4IJHA 1OXSC 2QGQA 1HNZL 1X54A 3TY9A 4GOPA 3E9IA 4LFCL 2Q2IA 3G48A 1IL2A 1N34Q 5IP9G 3BABA 1EWIA 4JI1L 4OWXB 3HOYH 1CKOA 5D1PA 2ZM6Q 3EIVA 5M5YH 3UDFA 3ERSX 2UXCQ 4IPHA 5E7NA 4JBMA 1HZCA 4GN3B 2NVTH 4A3KG 4P73A 4UY8C 2R92H 2HVRA 3RLOA 4J15A 5AJ3L 4NXMQ 1YJWA 4DV1L 1S72A 1VQ9A 1KL9A 3U58A 3IRBA 4P74A 2ES2A 4O2DA 4JI6Q 1KRTA 1KC8C 4QJFA 5M3MG 1TA8A 1O7IA 3F2CA 4BXXG 3Q8DA 3S1NH 1Q7YC 2PI2E 3I7FA 1Q82C 5GAEC 1GM5A 5DISC 2BH8A 3KF8B 3STBC 4E6NA 1UE6A 5JJIA 1L1OA 4B3TL 1FJGQ 5IYCG 3S2DH 3EN2A 3NBHB 4UP9A 4GS3A 4AH6A 5FJ8H 1JMCA 3JSLA 2Q2UA 3T1YL 2I5MX 1XNRQ 4OWTB 3TEHB 1S40A 1NTGA 1VQ8A 3GTOH 3G4SA 2JA7H 3CD6A 4OXPA 3CCVA 1WYDA 3K81C 4APVA 4MTNA 3CCRA 3ER0A 4X66Q 1J5EL 1J5EQ 4JI7Q 3PUXA 4DAMA 3GTKH 4GKJQ 4DV7L 2VL6A 1N32Q 2IHFA 4DR3Q 4A3LG 4LF8L 4C3HH 1X6OA 5IP9H 3NBZB 1BBUA 5M3FG 1IXRA 1Y1WG 2UUAL 4IFDJ 1YHAA 4DR6L 1CKMA 2C35B 3LGJA 4POFA 2JE6I 4L5TA 4PG3A 3ZJYC 3GTJH 3CCEA 2E2JH 1L1OB 1E24A 2AWOA 3KYHC 3I55A 2F4VQ 4DKAC 3GTQH 3GJXB 2N3SA 2K52A 4WJ3M 2NVXH 3JAMi 4LF9L 4Y7NH 2JA8G 3HOZH 3JC66 4RG1A 2UXDL 1VQKA 2RHSB 1VQFA 4BXXH 5C0XJ 3TS0A 4JBJA 4X64Q 2KCTA 1JJGA 1YHQA 3M4QA 4BBSG 2F3IA 1DGSA 2KBNA 4UCUA 3JSNA 1H95A 4KHPQ 4MZ9A 3UQ8A 4R4OA 3GO5A 3HOVG 3NC0B 1IBLL 1VQ6A 2K5NA 1B70B 2YTXA 1CSPA 4HJ5A 1LTLA 4DV2L 1NBWA 4A3CH 4LF5L 5J3BA 3ULLA 4A3IG 4CC5A 1U5KA 4DNIA 3KDFA 5GAHC 3G6EA 2PQAA 4HIKA 2MFIA 4DV4Q 1PH7A 4EEQA 3CMEA 1K8AC 1Q12A 4A3MG 4HJ9A 2HVQA 4AYBE 1A62A 1VQAA 4IPCA 3UE0A 3KLWA 5IYDG 3GTLH 4JI1Q 1EFWA 2HIXA 2E2IH 4A3BH 5LMNL 4A3GG 4EFEA 3B6YA 1KHIA 3GTMH 1J6QA 1XPUA 4A93G 1NMFA 2OQKA 5FLXc 1PH2A 2OQ0A 4L5QA 4LUOA 1VQ5A 4DR2L 2GVAA 4EQ5A 4IO9A 4DR1L 1EQQA 1XTDA 5AJ3Q 1MJEA 4DV1Q 3RTXA 2OWOA 5GROA 1KAWA 3KDFB 4UPAA 2PQAB 4JI3L 4DUYL 2ZJPA 4LH7A 3UDIA 4BBSH 2MNAA 2LXJA 4DK6C 2VUMH 4GKKL 2IX1A 1XMQL 1W2BA 5C3EH 3TY5A 3JAMc
chains in the Genus database with same CATH superfamily
3J81W 3TMEA 4B3TQ 1K8MA 3R5XA 1HR0H 4IUQA 3W1BA 3J7AK 1J5EH 4X66H 3OIPA 4KV6A 4ZRZA 3RLNA 4IOCA 2WFWA 5BWXA 4GKJH 5C6AA 4DV3L 1E0BA 1FNUA 1V9PA 2A69C 2L1BA 3TQYA 3J7A5 4B3RL 2DUDA 4BY1G 3C2PA 1RJQA 1TY2A 4ZKCB 4LF8Q 4QUCA 2D62A 1X55A 1NY4A 5KGUA 2F4VH 2R7ZA 2PZUA 3TSSA 2JK8A 3H40A 2VA3A 1VQHA 5DNFA 2W9BA 1B9MA 4JI0L 3S2DB 3CC2A 4RGMA 3EPGA 1B3QA 2EYOA 5FD5A 5HNEA 3Q8QB 5IYBH 4TSSA 3F1ZA 3D31A 1LTSD 5A35A 1GUNA 3AX6A 5C1PA 4RUCA 4MV9A 1XPOA 3LQSA 5C4HA 3DLLA 3JZ6A 2A6HD 2CQAA 3NEMA 3VR4A 2QYZA 2W6OA 4IHJF 3MFGA 2R7MA 4QSHA 3I73A 4BBRG 3RZDH 3H0GG 1D5ZC 4LF7Q 2JA6H 2Z04A 3KXYT 1CT1D 2ZT9C 3G6XA 2F0IA 3GDEA 1RK6A 5KNCA 4JV0A 3QIAA 2EQSA 2XRQD 4DV2Q 3RV4A 1VQ7A 3PQIA 3CQZH 1SROA 3D4WA 1GXDC 3GTQB 2AGQA 4NZMA 3A55A 2SEBD 3AFQA 4IPDA 1OXTA 1WD1A 4XQNA 4O3PA 2K04A 4DL7A 3HOZB 2B2TC 2BCOA 2FPPB 1RK5A 2DJFC 1CQFA 2H4OA 2A73B 4KHVA 2F0WA 3UFXB 5I60A 1SRUA 1ET0A 3W3AA 2F0LA 1BBWA 2A74C 1UWVA 3L4JA 4DR2Q 4J9PA 1CI3M 2MJ8A 5L1IA 4DFAA 1PFNA 4DR1Q 2GPWA 5C5JA 4GLXA 2QF7A 2F0KA 4ECSA 2R8GA 4UP8A 2PZTA 1BKBA 1X3FA 2QILA 2Q8IB 4B3TH 4RHSA 1HHVA 1S68A 2C9OA 1CFMA 3QWUA 4GKKQ 3J81c 3L3OC 1XMOL 4PWQA 1L0YB 1QOHA 2Q2HA 2RDHA 4DK3C 4CKBA 1EIFA 4KY6A 5IYCH 2R82A 4N8X1 1CQVA 3M4PA 1VQJA 4HEDA 2NU9B 2X0SA 4DV3Q 1O75A 4TQSA 4A3BB 2K05A 4ECVA 4LF8H 4A3DG 3K8AA 2NB0A 1EZ8A 4J6HA 4B3RQ 4XZ3B 4KKUA 1QNUA 1CUKA 4ZQIA 2BA1A 2F0NA 3A7LA 3AQQA 3N6RA 4A3LH 2JA9A 1W6JA 5LXTF 1PZID 1S3OA 3SI8A 4ME6A 3PO2G 4ECZA 4NXMH 4MIUA 2MO0A 3A8JE 2HG8A 1Y1VG 1PH3A 5C3EB 1OTCA 1Y1WA 4JI0Q 1STBA 1KQSA 4E6IA 4L8JA 3HFZB 2GQSA 2VZAA 1CHPD 4A3IB 2KA7A 5C4XG 1EY6A 4KJNA 4JUZA 2ID0A 4FFOA 1I94L 4LF7H 4NXNL 3S17H 3KBGA 4LMQD 1GUOA 4MV3A 3C1FA 1KBLA 1U0LA 1VF7A 1V4YA 1F9QA 4KK7A 5KRUA 4NKLA 4DR3L 4DV2H 4O7NA 4F4ZA 2IT1A 2IA6A 2JYOA 1STEA 3WWIA 2JA6A 4IFDG 5L1KA 1XPRA 3E5SA 4Q0YA 2J6TA 5JVLA 5EQ0A 1VQNA 2V5AA 5COYA 2YU9H 3T9EA 3MXNA 4K2KA 1F77A 5FPRA 3OW2A 1I6HB 3CQZA 2EXDA 1JQYD 1A2UA 2R61A 2CNQA 1YIJA 1W93A 5J2TF 1EWCA 4DAYA 1LTBD 1E4EA 3VR3A 5CV9A 2X6GA 3F8TA 1RD9D 2NU8B 1H9KA 1A8VA 1SLJA 1MJCA 5KFSA 4DR2H 4R4CA 5JJKA 3SK6A 1G6PA 5DGBA 2UVWA 4DR1H 5C44G 4I7AA 3S2HB 4V190 1BJTA 4A93H 2VQEL 3RZOH 2YYAA 4O42A 4MV4A 4IUTA 4TVAB 4GKKH 4K5VA 4LUZA 3WWJA 4QW8A 1ZQ7A 5ELOA 4IAJA 4LF9Q 4C3JH 1LM0A 1EYCA 1TWAH 3NHHA 4M7EA 3OHBA 1WJJA 4PV1C 5BWRA 3LMLA 4YP3A 3VR2A 2WB1E 4DV3H 1XMOQ 3BJUA 4EYIB 2L5TA 2NVYH 3V6JA 5DLFA 4B3RH 1TWGH 2NZHA 2F0TA 3OIQA 2R7KA 4K8JA 1SE8A 2XSCA 2DPJA 3K5LA 2PPBC 4C3HG 2CFMA 4LAAA 3NWSA 1SE4A 3SHLA 1H9SA 1ZXTA 3I3CA 4HIMA 3D4RA 3J80W 2FJZA 2ATLA 5CBAE 2LFNA 1JX4A 4QMGA 1TT2A 3FPUB 2P5ZX 4PBCA 3OWFA 2CWAA 4FBUA 4JI0H 4Q0FA 4NB3A 3RN2A 2VB2X 1SFOB 2F52A 3LP8A 1KNEA 3OSOA 3HOWH 2I5LX 5DEHA 3JZFA 2JQOA 3UZBA 1HNXL 2F0DA 5D65A 4BY7H 1S5FD 2FPGB 1E7ZA 2YL2A 1AN8A 1I4PA 2OT2A 1S5BD 3U9SA 4MTKA 2X5RA 2MUYA 5LMUL 1I94Q 3CC7A 4NXNQ 2G9HD 1SMXA 2COGA 2NUAB 4JI3Q 4NZOA 2CWPA 1BCPB 4ID6A 5C0XI 1CSQA 2R6FA 1TVXA 3D6CA 4DUZL 1WTWA 4BBRH 3K58A 4L1KA 1XMQQ 3H0GH 5JAVA 2XCLA 3S9WA 1HTPA 3M9MB 3NQIA 2XGTA 3GIPA 1D1IA 2RSNA 4O7YA 3BQ0A 2ASLA 2YW2A 5HV6A 3OSPA 2COIA 2YS6A 4C2MB 1DOMA 4IIJF 2ICIA 1ULZA 3R5HA 1G2WA 4GNXA 1ENAA 1SN8A 4TV8F 2YU9A 1WFQA 5M5WH 3ETJA 1PFSA 1VAJA 1JC7A 3RD4A 1JJ2A 4K6DA 1A6XA 3G8DA 1EWHA 1FL0A 5KG7A 5CYUA 3BU2A 4GLAC 2RA4A 4ZUJA 3G71A 2IX0A 5EGTA 3OW7A 5IGCA 1JIHA 2FXQA 1TWFB 2J4XA 1VBGA 1E2VA 3Q6SA 3VYSA 5BN5A 3K5OA 5T1GA 2VQEQ 3S1MB 1BVSA 5KKNB 4QWBA 2VXWA 4LF9H 3HOXG 3ND8A 2R7NA 2KSWA 4EFBA 4ZKBB 1I7LA 1FJGL 1XMOH 2FMMA 2VUGA 4IOAA 4O81A 1XNRL 1K3BC 4KY7A 4JI2L 1D8LA 1YZ6A 3H20A 1HZAA 1P16A 1TWAA 4HSVA 1A3VA 1ESFA 1II3A 3M7NA 2Z8LA 1B1ZA 3TP8A 2SCUB 5LYJF 3K80C 3ULPA 4YWLA 3HOUH 4JI7L 3PO2B 3BABA 4LW1A 4YCWA 1TWGA 4O3NA 1R4QB 4CE5A 2CVRA 1DCZA 2JA5G 1YI2A 2LXKA 2V4QA 2C5CA 1E2WA 3L9AX 4A3DH 1R9TB 2N78A 4NDXA 5KFFA 3J80c 3QJYA 1LO5D 4GOPC 4TM5A 2R7FA 3HOYG 1A63A 3H09A 1IYDA 3S15H 1DZ1A 3ZYYX 5CAEB 4J9MA 3W2DA 3GIIA 4XX0B 1B6RA 4GLVB 2F0OA 5LMNW 4A75A 1F9RA 1PTOH 1QCBD 1JICA 4AYBG 4ED2A 3MEHA 1I94H 4IJLA 5M5XH 4LNQA 4NXNH 1HNXQ 3L4KA 1K83H 4G4KA 4IWYA 4JI3H 5FOBB 3IFTA 3TP7A 2AUJD 5CBEE 4KHPL 1JB3A 5C4XH 1XMQH 4DR3H 5LMUQ 4IUVA 3RR5A 4RU9A 1TWCB 3MEFA 1V1PA 1PH5A 4RH6A 5JQGF 4DUZQ 1L1OC 2PNHA 1UNNC 1NR4A 1ET9A 4IJHA 1BBXC 5EKLA 4DNRB 1HNZL 3H0GA 4JV2A 3QG1A 5C44B 3E9IA 5FLXL 1FNVA 4IFDH 2Q2IA 4IZOA 4QUFA 3G48A 3PW2A 2FP4B 4F4YA 5M5YH 1S0MA 3UDFA 1C30A 3LWUA 4U7CA 1RF2D 3BDOA 1CA5A 3V4ZA 1EKVA 4A3KG 2VQEH 2R92H 2EXZA 3RLOA 3PO3G 1JWSD 1KRTA 1KC8C 3T7AA 5M3MG 3VMMA 2QDBA 5E25A 3T99A 4BXXG 3Q8DA 1Q7YC 2PI2E 2EZVA 1Q82C 5GAEC 3MFHA 2BH8A 1CHQD 3STBC 3Q8RB 2AGPA 2CZGA 3G8CA 1SYEA 1Z7TA 1FJGQ 3NBHB 4GS3A 3U0GA 2CW0D 1XNRQ 3GTOH 1Z2PX 4OWTB 5KFQA 1PX2A 1TWHB 2RGRA 1B2TA 4Q5VA 3TP5A 4APVA 4MTNA 4JI7Q 4DAMA 1EQTA 2WB1B 4C3HH 3MAQA 4RB2C 1SYGA 3V05A 2UUAL 5DG9A 3KHRA 1EL0A 2O5IC 2JE6I 1LABA 4PG3A 3GTJH 2B2YC 3CCEA 1E24A 3K3VA 3O13A 3E0JA 3MWDA 4C5BA 2O4XA 3GJXB 3JRXA 1XYIA 4YAJB 1HNXH 5JVG3 3JAMi 2NVXH 3C0FB 2AQ1B 3JC66 1CE8A 1G8ZD 1VQKA 2RHSB 1VQFA 4X3UA 4HMIA 3GV6A 3TS0A 1Y1VA 4JBJA 5LMUH 1JJGA 1GHKA 2F3IA 1DGSA 1D1KA 3M3YB 3JSNA 4K6NA 4UCUA 1K83A 3PIO3 4KHPQ 4DUZH 3DM1A 3FDTA 1SYDA 3HOVG 3MA2B 1IBLL 5KFWA 1JXLA 3BJYA 4YQWA 1CSPA 1CZWA 5I2YA 4YAKB 2V58A 5HURA 1TIID 1KEEA 4J0MA 2PQAA 5I5SA 3DWQA 5NUCA 4EEQA 3CMEA 4ETSA 1Q12A 1ILPA 4HJ9A 2VA2A 1Q8IA 3DMUA 3KLSX 3KLWA 5IYDG 1OWTA 3I12A 4EGQA 1NNXA 2L11A 2YCHA 3TZDA 1U4PA 4EFEA 3B6YA 1KHIA 4J9NA 1WR2A 3J81L 1VQ5A 1JDBB 2K6AA 4FS1A 4FFNA 1QNKA 2Z02A 2HGSA 2OWOA 5E1FA 4GZYC 4FF3A 3GV3A 3KDFB 2CQYA 4S3SA 4XXEA 2W6ZA 1FJGH 2ZJPA 4LH7A 5EBCA 4BBSH 2MNAA 3HEJA 1IYUA 1S5CD 1X3QA 2LXJA 1XNRH 2Q8RE 4DR5Q 2W7OA 3NQTA 3I4OA 4BA1I 2HVSA 2C00A 3Q2OA 4JI7H 1JOKA 2XNAC 3FPPA 3HOYB 3KTMA 1I4RA 5BYBA 3GTOA 4KHZA 3PSIA 4G57A 4JV1A 3SE0A 1FYCA 2NVTB 2K5WA 3RMHA 1RKNA 5JVH3 2K75A 2RDIA 2JA5H 3AYHB 2VPSA 2UUAQ 4N8FA 1EU3A 4P72A 1M4VA 4EQNA 5KFKA 2C2DA 3EBEA 1VKZA 3S14H 1CTMA 1M90C 3NTIA 3GTJA 1S5ED 4N9TA 3NBHA 2UU9L 5ELCA 5GADC 3KAKA 4DR7L 4YHHQ 5BWTA 4J9QA 4O7LA 1IW7C 2HQLA 3J81i 3T9DA 4XQQA 1QUQA 1AFPA 4KI0A 2NVXA 4PMCA 1EY0A 2HT1A 4KHPH 4RA8A 2Z0SA 3QO2A 2YYZA 5D3IB 2FMCA 3ORRA 5KYLA 4DAAA 3K0XA 4X62L 4QL5A 3STBD 1EZ1A 4OX9L 1EIGA 4YIJA 2A6HC 1YJNA 2R7ZB 3CMAA 4PQXA 3EVQA 3TIIA 4I50F 5IGEA 1IBLQ 2E2JB 2YZGA 2OEOA 4R4QA 1HNZH 2E2HH 2W9BB 1N9WA 1EUCB 3H91A 3IKJA 4QF4A 1GGOA 3FKIH 4RKBA 1KJ9A 2W8LA 4I7HA 4JOIA 2BQRA 3CW2C 3EROA 3K5IA 1A3TA 1HR0Q 5IE8A 3HBLA 2SOBA 3K5MA 2FKLA 4DL4A 3PF4A 4Y7NB 2KECA 3PUYA 1BNCA 3K5NA 4IZ8A 2QB5A 3K7UC 4B3MQ 4HSPA 1G6ZA 4IPGA 4HNVA 4PDBA 3HS0C 2IW3A 5K2MA 1KTAA 1BDOA 1TS3A 5BWWA 4O3RA 4LFBL 2R8JA 3FP9A 4AQYL 1MGSA 5DAAA 3N41B 4HYKA 4O0AA 4A3KH 3PUVA 3PO3H 2JA8B 5KT5A 4FS2A 4YY3L 1FKAH 1ASZA 5EWFA 1XTCD 4XIGS 2EJ0A 1A3UA 4K0KL 4IUPA 5M3MH 2FE3A 4YBZB 1E1TA 5G3LD 4IUUA 4LK1C 5KNBA 5IWAL 5ISRA 4DR4L 1I50H 3JZIA 4A3EB 2ABJA 2TMPA 5KFNA 2F0FA 5BR8L 2HJWA 1S0NA 3KHHA 5JPMC 5KG2A 5IP7G 2PVPA 3A74A 3IG0A 1O78A 1EIYB 1B53A 2IP4A 1VQEA 2B2TA 4MV6A 1GJXA 2UUAH 1I7NA 5HY6A 2AKWB 4CC6A 1UE5A 2FLPA 3SVMA 1HZBA 3WO1A 4HJ8A 4J9KA 1C7YA 2RQXA 4KLKA 5JEAH 3RNUA 4NXML 1M0WA 5EZYF 5KT6A 3HGBA 4YHHH 5KFBA 2IPKD 4DL2A 2JA5A 1I1MA 5CC4A 1SNPA 1X56A 3E5NA 3EQLC 2DJGC 2UU9Q 1YVCA 5CR3A 4DR7Q 1CK1A 4A2BA 5CA1F 4MV7A 1KC7A 4C3IG 1C8CA 3U55A 4ED8A 4O82A 4RZRA 1VS0A 4JVZA 2B8FA 5DQHA 3T1HL 2OXPA 2KEEA 4ZI7F 1EFID 3S16H 1IBLH 2BH2A 4AYBA 1GD7A 2W6NA 4OX9Q 1SAPA 2O5JC 2A19A 5IT9W 2K5VA 4WJWA 5J39A 3U9OA 1SEBD 1AZPA 3HOVH 2IL8A 4UHVA 1VQDA 5CGKA 3OOCA 4X3TA 1DYQA 3T1YQ 4P71A 5EJWA 4B3MH 3L7ZC 3T9AA 4XYOA 4G7ZC 3MR3A 2R6GA 3BZCA 4HQ6A 2UVRA 1N8RC 3BA8A 3EYYA 1G291 3QOJA 4YCUA 4O86A 5IYDH 1MSHA 2N8NA 1J8IA 1I4GA 1ZYRD 4JOIC 3T54A 3VR6A 4X64L 3RZDB 3E3XA 4AQYQ 3HOWG 3EJIA 4DL5A 2JA6B 2EYJA 5F9NA 2AWNA 1IW7D 3PUWA 4YB8B 1XDNA 5CM0A 4CBVA 4BY7G 2Z6KA 3R2TA 3MXNB 4YY3Q 4LWCA 4UCSA 3CQZB 4K0KQ 4JV5L 2W7PA 1OXVA 2EY5A 4U673 3I91A 4MV1A 3QB3A 5DMXA 1PMRA 4DAYB 2JA7G 4CMFA 4Q8FA 5IWAQ 3C46A 1UEAB 1YHBA 2QA4A 4DR4Q 1E4EB 2IMWP 5E4WC 3H15A 2UXCL 3HKZG 3J80L 3OTOL 1I50A 5BR8Q 4RWSC 2ATWA 5KFHA 2N49A 1ZAUA 4FP5D 4R4TA 2EYFA 1V8QA 3CC4A 3PVXA 1IYJB 1VQCA 1CS0A 2K4KA 2YTVA 4O2AF 2Z4IA 1Q1BA 1BQQT 2Z4HA 3VYUA 3GD7A 1Q46A 4I65A 2AQ4A 2UUBL 1C9OA 2W6QA 2UU9H 1GUGA 2F0HA 4K5WA 4O3QA 3FRPB 1TY0A 2ZTDA 3A5ZB 1CZGA 3KOJA 5IGFA 5A2QL 1E4FT 4DR7H 1GUTA 1KIXA 1PLFA 3K0YA 1KT8A 4GOPB 2KENA 2XRSD 2FB9A 2PI2A 2XC9A 4JC0A 1QE6A 2H1EA 2A68D 1NMGA 3A5UA 1B8AA 2XD4A 1X32A 1DD2A 3TY8A 2YRXA 1A0IA 2KHSA 4OX9H 1H9SB 3NBIA 4GN5A 1PHJA 1WRVA 2XVSA 3WDNA 4QWEA 2UVVA 3T1HQ 4O7SA 1PA6A 4NMZA 4XTCS 2FK2A 2TSSA 4YR2A 4ME5A 3V2TA 5IT9c 4IUNA 3T1YH 1UEBA 3Q8SB 3VNNA 3P1HA 4IN3A 2AQ2B 3J80i 3UDXA 3CCMA 1V43A 4L5RC 3HOUG 1UC9A 1HZ9A 2VW9A 5H80A 2DPIA 1PRTB 1OO9B 5BN4A 3ORQA 4KMUC 5KFZA 4I7ZC 3TN2A 2QEXA 5GONF 1DJRD 4PMBA 2EIYA 1SNOA 2ZJQA 1YNJD 1LTRD 2G9DA 1F2MA 5KFRA 4LFBH 4DN4M 4XYMB 4AQYH 3CPFA 1B50A 1Z2OX 2W9CA 3S17B 2JJQA 3CP0A 2RKSA 1RCVD 2AHOB 4ZAIA 1ZEQX 4PMWA 1JOOA 3W5OA 4YY3H 3NSWA 3SGIA 2VUMG 3I56A 4K0KH 1L0XB 1LV9A 1A9XA 5F9LA 3KF6A 1AE3A 1W3SA 3RBDA 4HIDA 2V4DA 4L5SA 2KHJA 1V1OA 5IWAH 3OPOA 4DR4H 4GNXB 2NTSA 2YU9B 3AEVA 2PQEA 5ELEA 4JV5Q 1PYSB 5BR8H 5EDWA 3R3OA 3R23A 1I4HA 5CV6A 3JRWA 4FNFA 1ZETA 4A3MB 1TS4A 3L0OA 2UXCQ 4Y52H 4FVMA 1KRSA 3OTOQ 1TAEA 1U9RA 2Z6KC 1LT5D 1N32L 1RJRA 4ABNA 3N43B 5IP7H 1LTGD 4HJAA 1VQMA 4K5XA 2D0OA 1EZ6A 2R8IA 3HB9A 2IX3A 4BA2I 5FLMH 4DV0L 3TRZA 1TQOA 4A93B 4G7OC 3RZOB 1AUVA 4PNYA 4F7XA 4E4TA 3IL8A 5L9XA 1EEFD 1AH9A 1E2ZA 1SE2A 5KG1A 1GSAA 2UUBQ 2M9VA 5KT2A 4A3JG 1IKLA 2B2UA 1MI2A 4C3JB 1TWAB 3X3NA 4GN4B 4J8QA 3H94A 3Q24A 2R92G 1QWYA 4ZYSA 4MNOA 2FJ2A 5EAYA 5C0XG 3Q8PB 3UI2A 5FO8B 1TWGB 2NU6B 4C3IH 3T1HH 3MWYW 3S1QH 4EBCA 4EGJA 4WHXA 4O4JF 2ZJRA 5M9OA 1I5FA 3I70A 1I4XA 2ASDA 4BY1B 5AFWA 2W6PA 1D5MC 4HCSA 4NP5A 2PN1A 1VCIA 1EYAA 2JEJA 3HP3A 4R4IA 3CPWA 1KXLA 1S4ZA 3SXHA 1E4GT 4DV4L 3U4VA 4O4HF 2KEDA 2J6UA 1X54A 3TY9A 4GOPA 4IWXA 4RB0A 4LFCL 3HOWB 1IL2A 1M8AA 4FGRA 2CHBD 3NTHA 1PYWD 2XN9C 4MTEA 4HNTA 4Q44A 4G7HC 3LULA 2V9WA 4RCOA 2E2DC 3MFIA 1CKOA 3LX0A 4BY7B 3D3RA 4OIKA 5I5YA 1QILA 2CNVA 2LS01 5HBRB 1RTOA 4X64H 3K3PA 2VB3X 1HZCA 4GN3B 1V1PB 4P73A 4UY8C 3RUPA 1O7LA 4CDCC 4J15A 1VQ9A 4DV1L 1S72A 1KL9A 3IRBA 4P74A 3SK8A 3NE5B 4BBRB 4DK1A 1G2TA 4U68A 3H0GB 1YNND 4JV5H 3I7FA 1CQIB 4DLKA 4E6NA 2K1BA 5JJIA 1L1OA 2R84A 2J9GA 3CVZA 3EN2A 4UP9A 1WVLA 2UXCH 3N8DA 2EJMA 4IRKA 3OTOH 2Q2UA 3MJFA 1VQ8A 5M5WB 3HT5A 3HRZC 2CW0C 2JA7H 3CD6A 4A2AA 5KT3A 5IIFA 1DOKA 1WYDA 3GIKA 1GYFA 4Z9CB 3M7GA 3GTKH 1B33N 2HDMA 2N88A 4DV7L 1N32Q 4DR3Q 2L4NA 3NWTA 4OHJA 5M3FG 1IXRA 1Y1WG 5DG7A 4IFDJ 2SDFA 1CKMA 2Q7DA 2UUBH 1STGA 2C35B 3LGJA 3R8BA 3I4LA 3ZJYC 3D8GA 4X3KA 1RJPA 3MWEA 2RDFA 1LTAD 4ZUIA 3PW5A 2C22A 4C1NI 2ICEC 1A15A 2N3SA 4FFMA 1DM0B 4O3SA 3URYA 1JWMD 3FMAA 2UXDL 5KFIA 4C5AA 5C0XJ 3MR6A 3HOUB 2KCTA 1YHQA 4BBSG 5G3LF 3P7JA 2KBNA 2B2UC 5J22A 1JCKB 4A3DB 1O7ZA 2HHFA 3NC0B 5TSSA 2EY1A 4CDEC 2DN8A 1VQ6A 1LTLA 4GLWA 3S15B 5LP6F 3ULLA 1U5KA 4DNIA 3T5JA 2BR0A 2B2YA 4DV4Q 3OHAA 1K8AC 3IAYA 2HGWA 1B3AA 4AYBE 2NVYA 5KFXA 4QWCA 1R4PB 2L0CA 1PTOB 1Y1VB 3TQ1A 3BDLA 3GTLH 3M9OB 4H44C 1EFWA 1LT3D 3ITPA 2MGSA 5M5XB 2E2IH 1F9SA 2Q8TA 1K83B 2KOLA 5FD6A 3T53B 4A3GG 3GTMH 2OQ0A 3NUCA 3ERQA 4L5QA 5FLXE 5C4XB 2VOBA 4EQ5A 2BOSA 1EQQA 1XTDA 2JEIA 4F50A 4DV1Q 4EVOA 1PDQA 5KFJA 5GROA 1RODA 1GHJA 3VPCA 4UPAA 4DUYL 2PQAB 4QB4A 3LWBA 4O7WA 5L1JA 2VUMH 1KDCA 2F3VA 1BR9A 2CH4A 1W2BA 2RSOA 4DL3A 4O1NA 3HKSA 3PV0A 4KTAA 3JAME 4B08A 3QOLA 4P75A 2W6MA 2UXBL 4DV5L 1NJIC 5DAUA 5DLQE 4O7TA 1N32H 4DXGA 4NPSA 5M5YB 2K5QA 2RF4A 1KJQA 2JN4A 3ONAB 2JA7A 4R9WA 1JOQA 3FKIG 4RFBA 3NPPA 4DV7Q 5EPLA 4LF4L 3HKZA 4F4XA 1SEIA 3BVMA 3GTKA 1TXYA 1U4LA 1NE3A 3WNZA 3K7AH 2IHEA 3I4MG 5GAGC 4A3FG 2VPQA 1VQGA 1VQOA 1IHZA 4M9UA 4LMYA 1HPCA 4UUGA 4OONA 2W71A 5HGQA 5D1OA 3MHBA 3MXGA 2WKCA 3KJOA 4A3JH 3GTGH 1TS2A 5FK9C 4C5CA 5DLGA 3GTOB 5JOBA 1RTNA 2BA0A 2J6SA 2UXDQ 2YZNA 4HNUA 3SNOA 1A2TA 5K3WA 4DQNA 5C0XH 5BPFA 4KN4C 3BS1A 2CW8A 2RCNA 3DTFA 2AMCB 1XJVA 4F8MA 2R93G 4O4IF 4C3HB 2KHIA 1GKHA 1U4MA 4RMFA 2UUCL 3GTJB 4DV4H 4IR9A 2A1AA 2GVBA 3AB9A 4ED1A 2QKIC 1E22A 3TW6A 4JW0A 4JI2Q 4H0LC 3NP8A 2FPIB 4B3SL 1B4OA 1BO0A 1NAPA 2OF1A 1QUQB 4HR7A 1G51A 2F0SA 1XXGA 2NVXB 5BYAA 4X65L 1SJED 1IZ6A 1TR5A 3NXWA 4UCOA 4ECUA 5JEAG 4OWWB 5EOYA 1B44D 1HA6A 3GTLA 4ED3A 1LT6D 2F0PA 2B8GA 3AFPA 4DV1H 2E2IA 2D2CC 4LJZC 1Q86C 3RGZA 4R8UA 3GTMA 2JXMB 3RLFA 4JI5L 5CR5A 2IY5B 1PFBA 4FBTA 1EOTA 1IOVA 4EEYA 2ZXPA 5HGTA 1G2SA 5I6WA 1DONA 2VQDA 5CB4F 3IFDA 1UUPA 3BACA 5CMDA 3M9BA 4DUYQ 3M4OH 1ASYA 3TBIB 2FINB 1I4QA 4LFAL 4FXKC 4JCVE 3H3VI 5BN3A 1KNAA 4L63B 3J81E 2VUMA 5K36G 3WWVA 1C0AA 4NLGA 3T56B 2ZDQA 4J9SA 1WCMG 2UXBQ 1K0RA 4DV5Q 2LY7A 5DGIA 1K1QA 2RCFA 4DV7H 1F9PA 1SNDA 2E74C 5KG5A 4TQUS 5DQIA 2R8HA 2RHQB 5CORA 2WE6A 1BXTA 3ETHA 3OSNA 4KJOA 5I9PA 2XGQA 3J7AF 1Y8NB 4LF4Q 2HD3A 3DHQA 1E3PA 3S1RH 3I2ZA 4FFLA 5M3FH 1HNZQ 3NGDA 2Y0SG 4F87A 1Y1WH 1A3GA 4ME3A 4JYAL 3BG3A 1BOSA 4BBSB 4BS9A 4ALPA 1UE7A 2ZDHA 2ZJTA 2WKDA 3HOXB 1CKNA 3UE1A 2X69A 3G6YA 2Q2TA 4LUVA 1PXUA 2UXDH 1HFNA 2F0UA 2KJXA 3PF5A 2WAQG 2W70A 1WTPA 3N42B 4UAIA 5IT9L 1FGBD 1V1QA 3GTGA 5JQWA 3T51B 2BDNA 4RUAA 3GQBA 5BMVF 3CKIB 1D6EC 1KD1C 5F2DA 1T94A 2C2RA 2R92A 5I5WA 4RGNA 3NBYB 5C4JH 4X66L 3K59A 5KFUA 1LLRD 3C1EA 3TDQA 4GKJL 2L12A 1EEID 4HTHA 1QJOA 2JA5B 4JI2H 2EJ2A 3M3YH 1UAPA 4L6TB 1FGUA 2UUCQ 3S14B 2PNRC 4CJ0B 1AP0A 1EYDA 3GIJA 5I2XA 4IR1A 4FFRA 4TKOB 2PW5A 5KG3A 4Q45A 4J9OA 3QWNA 4X65Q 3SK5A 1XNQL 3RJ0A 1H9RA 3KAJA 1PH6A 3Q23A 4ECYA 5JEAJ 3RGXA 1QB5D 3BDCA 4AYBB 4R1JA 2A8VA 3SEBA 3PFFA 2GPSA 4A3GH 1SYFA 3S1NB 3V4SA 4DUYH 1ZYRC 1IBKL 5GQOA 2D0PA 2B63H 3GP7A 1N36L 2MCTA 2SNSA 3CHBD 5LHY1 2QK4A 2EYHA 1Q1EA 2AU0A 4KD3A 3K57A 1EHIA 3RV3A 2E2HB 4FFPA 2GN5A 4UDUC 3FKIB 4MA0A 2K33A 2DZDA 1L2FA 4LFAQ 3DF7A 4DV5H 1LTTD 1KABA 5EKKA 1SR3A 4RGOS 3PN1A 2UXBH 1LUZA 5BWUA 1FR3A 2EOTA 3VDYA 2O2LD 2XWBB 4I4TF 4FXGC 2EVBA 4H02A 4JXUA 4LF4H 4CKCA 3ULJA 2EDGA 1WTOA 4RB3C 2KCMA 4EX5A 4O84A 2M2LA 2ZDGA 3RF2A 4TQRA 2WYOA 1Z9FA 1HH2P 4DAVA 4QY7A 1D7QA 4A3KB 1WI5A 2C2EA 4HN7A 3PO3B 1ML0D 1W96A 3OWEB 2AGOA 1ILQA 5IYZF 4QWAA 4WFN3 1PVOA 4CDFC 5LL6S 3I4MH 2R3ZA 2ZTCA 5M3MB 4A3FH 4JYAQ 1MD2D 3DWAA 4X6AH 3WOFA 5C3WA 3H3VH 3HOZG 4P2CB 3FHWA 2K14A 1K8OA 1QVCA 1VQLA 1I50B 1CM9A 3GV7B 3NTKA 1DAAA 3RAQA 2EJ3A 4MN3A 1YITA 3CRKC 4RNMA 4MAMA 3JAMW 1HCZA 3GTPH 2XIGA 3KK7A 1S10A 1N33L 5KFOA 3TS2A 1VBHA 2A68C 2EY2A 1W6KA 3QZ7A 4NW2A 4OO1I 3WO0A 3CXCA 1EQRA 2UUCH 1K9MC 1NUCA 4K2LA 4F88A 4A3CG 4HMJA 5ELNA 2R93H 4GC6A 2JEFA 4DA2A 1ESRA 4LSAA 2R7ZH 3MZ5A 1AE2A 3Q1KA 3NELA 4RAUC 2DLNA 1N34L 3RIZA 1WTQA 4X65H 2XGPA 1GVPA 3P75A 2QEJC 4DGZA 4YJ3F 4EGVA 3TP6A 4A3BG 5FLMG 3QQMA 2CQOA 4EQOA 3I4NH 3T9FA 1Q90A 3QFFA 2PMZA 1I1LA 4LH6A 1YNJC 5DM73 1XNQQ 3BQ2A 5KFVA 2L9HA 4JI5H 3CF5A 2ASBA 3S16B 4JI6L 3HG9A 1YBYA 2NTTA 1I1KA 3DEPA 3I90A 4POGA 1IBKQ 1VQBA 2PBZA 4RZQA 1N36Q 5C3EG 4LF7L 1T36A 4LFAH 2V4RA 5JJZA 3W1GA 3HOVB 4UCVA 2KVMA 2JEGA 5C3XA 3EFXD 3FMCA 3Q0AA 2JA8H 2CW7A 4O7VA 1M0TA 4Q4CA 4BWGB 2SNMA 1S0OA 3C3LA 5KNDA 3PGZA 3RN5A 4PZ7A 3WOEA 3E9HA 1X3EA 1EYGA 4X62Q 2HCIA 5K36H 4PZ6A 1UE1A 2W9CB 4A3EH 4M1UB 1SNCA 3K6OA 1WCMH 2NVQH 4WD3A 3BG5A 4K6LA 1X65A 3PW4A 1PH4A 1T9HA 1NCVA 3GB8B 3PUZA 2LMCB 1K3RA 2V59A 3OMGA 3KF6B 1JE4A 1HR0W 4PZ8A 3J80E 1M1KC 1OXUA 4JYAH 2E2HA 5FPOA 1B7YB 1KLGD 2F0EA 3VYTA 3UDGA 1IYVA 3FKIA 5JVDF 1XK5A 1STAA 3GILA 3HKZE 2RDJA 1DXMA 2YTYA 4RKLA 1BCPD 2Z6BA 1E1OA 1HJPA 1HUMA 2PW7A 1I3QH 5LA6F 3OUZA 1MZBA 4MHEA 4LFBQ 5KT4A 5EPKA 2BE5D 1Q3LA 1RHPA 5A2QE 3S24A 5KFGA 1N33Q 1KDAA 1VQPA 1Z47A 4C56C 1WSCA 5KFDA 2OTLA 3GTPA 4UCRA 2ENBA 2WP8J 2EY6A 1GO3E 5T1IA 5IGDA 1XWEA 3GQCA 2IJ0A 2NZOA 4YR3A 4EYHB 4C1NK 2R93A 1PH8A 1TS5A 1LT4D 1OXSC 1ENCA 1GSOA 2XWJB 3KF8A 3V96A 1STNA 1N34Q 3IN5A 2WDTA 1XNQH 1C48A 3BYTB 3FVQA 1EWIA 4JI1L 5IGGA 2DWCA 4OWXB 3UZOA 5CV7A 2R7LA 5JPNC 3EIVA 3ERSX 4IPHA 4JBMA 2QW7A 2HDLA 1IBKH 4Q43A 1N36H 4NXMQ 4OO1H 1YJWA 4HCEA 4O3OA 3U58A 4JI6Q 4O2DA 2B2VC 4RHRA 1SYBA 1VMPA 3LWEA 1TA8A 2FLLA 2B39A 4FO2A 2QDLA 4Q8EA 5DISC 4OL7A 5KFPA 5C1OA 1RYRA 4XT1B 3PW0A 1PTOD 4WORA 4QWDA 4ZOLF 1YNNC 3S2DH 4ECRA 4X62H 3T5KA 2I5MX 1S40A 3TEHB 1NTGA 3T4AC 3FDSA 2W8KA 4RGTA 3RB0A 4MA5A 2EJFC 4OXPA 3QR8A 4QIWA 3CCRA 1EQVA 4K14A 1GLVA 2VL6A 1EY7A 4ZLTF 4TUYF 1V51A 1X6OA 4XYQA 2EJGC 5IP9H 1BBUA 3P20A 3VA5A 5K5PA 1WCMA 3SDZA 4DR6L 1EYZA 1ICWA 3BVGA 4POFA 4L5TA 3WWHA 1ZHQA 4FF4A 1SBBB 1EY4A 4KD4A 1L1OB 1H9JA 1I6VC 2F1MA 3FEWX 3LNNA 3I55A 3GTQH 3R5FA 1G91A 2K52A 4WJ3M 1JORA 5DG8A 1A0GA 4LF9L 2Y0SA 5FKAC 1PK8A 3G6VA 3HOZH 1N33H 5FO7B 1SNMA 1Z6HA 4TVIA 3EA6A 4X64Q 2ODTX 1AW7A 1I3QA 3M4QA 3A7AB 2WAQA 1AEXA 4DAPA 3TZUA 2D5DA 1EKFA 3GO5A 3CEBA 4WRDA 3H3VC 2A6EC 5EWGA 1B70B 4IRCA 2YTXA 4HJ5A 4A3CH 1NBWA 4LF5L 5J3BA 1N34H 1HUNA 2QCPX 5GAHC 3G6EA 2MFIA 2EYMA 1PH7A 3MTSA 4FE2A 2HVQA 4TRDA 1FNWA 3T16A 1A62A 1VQAA 3V6HA 4IPCA 2F0VA 1RYSA 1L2ZA 2K7VA 1DIKA 2BQ3A 4YJ2F 4JI1Q 4OIJA 2L55A 2YRWA 4C3IB 4A3BH 5LMNL 3S1QB 1J6QA 1XPUA 4JI6H 1NMFA 3MR5A 2HHFB 1PH2A 4LUOA 4WBNF 2K01A 4RCNA 1OBGA 4RB1A 2GVAA 1EU4A 3GV8B 5L37A 3RB6A 2ZXRA 1GUWA 1KAWA 2R85A 4JI3L 1FD7D 3MR2A 1VDZA 1HXYD 3UDIA 1HQRD 4DK6C 2NVYB 1XMQL 1DV2A 5C3EH 1SYCA 3F8NA 3BA9A 3E0EA 3T9BA 1BGWA 2A69D 5KFMA 1Z2NX 3PW7A 4NYEA 4JK1C 4HIOA 2MO1A 4A3IH 2EYPA 3PIPA 3CRLC 1KUTA 2B29A 4A3MH 4K8IA 2JEBI 5E3FA 2PCFB 1YNXA 1WH2A 3VPDA 4DR6Q 3MVVA 5CV5A 1C3OA 4KY5A 2G5DA 3GV5B 4OEMB 1IKMA 1YEZA 2CKZB 5EPJA 3F2UA 3N6XA 2I46A 3TQTA 2MQHA 4FXDA 2WACA 1EY5A 1I6HH 3DTGA 3GTQA 3M4YA 1PRTF 4QGUA 1JB7A 2HCCA 2JA7B 5BWVA 2R86A 2XTIA 1IYEA 2NUCA 2LSSA 3MFYA 3HKZB 1F2LA 2CNUA 3DAAA 5C5MA 3T13A 2J0TD 3GTKB 2XCPA 1S9FA 5KG4A 2FK3A 1NSNS 3S2HH 1PV4A 2M00A 2CH4W 1OXXK 4Y8VB 2Y4RA 2OTJA 2M05A 2HQEA 4M8AA 3X3MA 3CCJA 2C28A 1EUJA 3A0JA 2RGVA 1L0WA 4BY1H 4V0BA 3OYYA 5D1OB 5EWEA 4LF5Q 4APMA 3AU7A 2F0JA 4JI1H 1VF5C 3G7LA 1K0SA 3AMUA 3DWPA 2VR1A 2ZXOA 3BZDB 4IFDI 2ASJA 2WB1G 2IBKA 5JJLA 3TINA 4DV6L 5D3DA 1IOWA 3I8ZA 2RDGA 5LMNQ 4DV0Q 5A2QW 1QG7A 4DNTB 3A8KE 4HAEA 1ZKOA 4B9XA 3PCOB 1O7YA 2GA4B 1X3GA 2PMZE 5DM63 1Q8KA 2F4IA 3RB4A 2N55A 4ECQA 4GC7A 1F2YA 1F2ZA 2K5HA 4O2BF 4YCVA 4HR7B 1SFOH 4JI4L 4LSXA 2EIFA 1S97A 4WJ4A 3D4DA 1BF4A 1RJTA 3GTLB 1IL8A 2A6ED 1VQIA 4DPGA 5I5XA 2E2IB 2BQUA 1EUDB 2V1CC 2O03A 2YZLA 4R8UB 1D5XC 3GTMB 2HIVA 3RUZA 1SDFA 2ALZA 4DR6H 1S03G 2RVLA 2F3WA 1MKHA 2K50A 5DGHA 2X6LA 2BDOA 3MXUA 3F2BA 1DV1A 5KIXA 1LACA 5JH7F 5KFAA 4LFCQ 2YV5A 3PR4A 4DF7A 2VUMB 1WTHA 5BPHA 4C2MH 3A54A 3G6JB 4XQJA 1ZHSA 5H1SE 3R2IA 2I5HA 2B63G 3VOTA 5D8DA 4EBDA 3DUZA 2XIWA 2HGXA 3PIP3 1K1SA 3KBXA 4R8NA 2W57A 1LTID 4IURA 2HHHL 1BXRA 1HNWL 1TWFH 1TU2B 1STHA 4ED6A 3K7AB 3S1MH 5I5VA 3PR5B 3SR1A 3U4ZA 4A76A 4LF5H 3J7AV 3M85A 3KLSA 3PMFA 3PIOA 4LF6L 3HXLA 4O7RA 1CKNB 1WTRA 1RL2A 3OHXC 2VS1A 3CCUA 3U54A 3MWMA 3MC0B 1JDEA 2E8GA 4XYLB 4A3JB 1SJHD 1CA6A 3GTGB 5LMNH 4DV0H 1MSGA 3PO2H 2R92B 4UP7A 2VY3A 1QZGA 2PZWA 1ENFA 3U50C 1Y1VH 1J9OA 1O80A 1WTXA 4DV6Q 2I07B 3GLKA 2ZTEA 5DGAA 3CCQA 4BWSC 2DABA 2W9AA 1R9TH 3ICEA 1NR2A 5I6YA 1BCPF 1QZHA 3M9NB 3PZPA 3T5HA 3R9RA 3R93A 4CJ1B 5CE8A 1PRTC 3BYYB 5FJ8G 3QZ8A 5JUMA 2K28A 2LKVA 4HJ7A 3CCSA 2E5LL 3J7YW 1C4QA 4JI4Q 3NENA 4FU0A 2DNCA 1SFOA 3CAMA 1MIUA 2PYKA 2JSOA 1QVFA 2VQFL 2AUKA 3L2PA 3RFCA 5KFTA 4YWKA 4CHIA 5I47A 4JI8L 1OBDA 2HDKA 1AN7A 4DK0A 1H9MA 3J7ZC 3BZKA 2R7ZG 2A5HA 2NZ1D 2I8CA 4H13C 2R87A 4M0JA 2K5DA 4N9PA 4RNNA 1KTKA 1M6VA 3TREA 1TWCH 3CCLA 4LFCH 1ONLA 4FYDA 1B6SA 2PO4A 3I4NG 3JAML 4QIWE 4KN7C 5C5LA 4OGQC 4R8IA 3M4OB 4IRDA 4GNXC 5C44H 5KEEA 2F0QA 3ND9A 1IBML 3UYYA 1DOLA 1WTVA 4FM9A 2NBFA 4ED0A 3D0FA 3VYRA 1PFMA 4DR5L 1T3NA 4C2MA 3V6KA 1Y14B 5FR9A 2B2WA 5I5TA 1JJCB 4QCLA 1RIPA 3N40P 2AQ3B 4JBWA 2MHVA 1KLUD 2F0MA 2I80A 1PTOF 2KCNA 1X9NA 3KUPA 5KYIA 3J81j 2JA8G 1HRJA 2I0QA 4IALA 2IWHA 2Y0SE 5KG6A 2FFKB 1CQJB 2HHHQ 1HNWQ 3S1RB 5IT9E 1JWUD 5M3FB 1Y1WB 1TWFA 4QW9A 1XX8A 4LF6Q 1MBYA 4A3EG 1SYXB 5KT7A 1STYA 2NN6G 2WAQE 4F4WA 3DM3A 1JLLB 5IOCA 4A4IA 3HZXA 1EOVA 4YHHL 1EIHA 1TWHH 5KFYA 1SMYC 2DNEA 2ZM6L 4DV6H 4CDDC 5KFEA 2DAAA 3RB3A 2WTFA 1K8GA 2CCZA 2DIKA 3A8IE 3KJPA 2ALYB 5FNVF 4ULLA 5C4JB 1PH1A 3TEKA 3BQ1A 1VMCA 4ODGA 1Q81C 4DL6A 3SE7A 4RAZA 2A1HA 1GOZA 4XT3B 4R7RA 2MP1A 4FDBA 1R9TA 5IGBA 5KFLA 2DY8A 3GIQA 1MHWC 4JI4H 4KKTA 2GQRA 5KFCA 4RNOA 4J9LA 1GUSA 1FVIA 1N48A 4YWMA 2YS7A 2E5LQ 3KFUA 4O7ZA 4G3IA 2PMZB 1QVGA 3N52A 5ELBA 1HR0L 1J5EL 2OCEA 1HA5A 2VQFQ 1YJ9A 3KREA 4JPBW 2ZGIA 1S5DD 2NWGA 2R7DA 1P8LA 4JI8Q 2I87A 4B3ML 3AW8A 2Z9HA 2VNUD 3HO8A 1UC8A 4A3GB 3H4BA 5I5UA 1JE5A 2B63B 2OLSA 1RDPD 1TWCA 1WOCA 2K32A 4B3SQ 2F4VL 1WD0A 2R8KA 1KJ8A 5IYBG 5D14A 5I4DA 3H6MA 5IODA 2WINB 3VA7A 2DGYA 4ECXA 1IBMQ 4ZQ3A 3NK9A 2NN6I 3KLRA 1Y8PB 2B3GA 1KAAA 4AIMA 4OELB 4EQPA 2HUGA 1PH9A 4OO1G 3BAAA 4UCTA 3T5LA 3HOXH 3I72A 3TIGA 1BCPC 4MTDA 1PYBA 1VQ4A 2OH2A 3U9TA 4ECTA 2KQ3A 1UNSA 2JA6G 1PRTD 4JI5Q 2HHHH 3CSWA 4DRFA 2BE5C 1HNWH 3F2DA 4JG2A 1JT8A 4CHTB 2E76C 2H5XA 4JBKA 1K73C 1Y8OB 4LF6H 4UFZA 4ED7A 1SNQA 2NYZD 2JEAI 1LYLA 2B2WC 2KUMA 1B04A 2UVUA 4FF2A 2DY7A 5IY0A 2L15A 2NU7B 3BVZA 1KDBA 2COJA 2F03A 4RAYA 4KKSA 2QGQA 3I4MB 1KJJA 4A3FB 2XCAA 3KHLA 1AUXA 5CV4A 4XDXA 3K5HA 5IP9G 1M7JA 2EYLA 1U4RA 3TW7A 3KALA 4U6PA 1B9NA 4H7BA 3HOYH 2EPBA 2E75C 5C8YF 5D1PA 4CJ2C 3GTPB 2ZM6Q 1TWHA 2MPMA 1HQMC 3DXJC 3NUAA 4TV9F 5E7NA 2NVTH 5FLXW 5C4ZA 2YZMA 2HVRA 3RBEA 5AJ3L 4ECWA 1T5XD 2WB1A 4B9WA 1ICFB 3E6ZX 1BNZA 2ES2A 1SCUB 4QJFA 3OMCA 3VR5A 2R93B 3N44B 1O7IA 3F2CA 1EKPA 3MXPA 4DIMA 3S1NH 5KX5F 1GM5A 2E5LH 5ELDA 2YWVA 3KF8B 5FO9B 1UE6A 1AZQA 4B3TL 1PZJD 2FK1A 5IYCG 2WV6D 5LL6X 4J9RA 4AH6A 5FJ8H 1JMCA 3JSLA 2VQFH 1SE3A 3DEOA 1PTOC 3T1YL 1TKWB 4YR0A 2FHTA 5T14A 4JI8H 3I4NB 2P0AA 3G4SA 2WIIB 4DXFA 4J1MA 3CCVA 3K81C 4ZHQF 1J5EQ 5J1ZA 5KS8A 3ER0A 4X66Q 3PUXA 1EY8A 4GKJQ 1A48A 3H4DA 2IHFA 1K28A 4A3LG 4LF8L 3NBZB 5LOVF 2JP1A 1YHAA 4B3SH 2E2JH 5KG0A 5DQGA 1PZKD 2J7ZA 1SMYD 5LL6b 1I2KA 2FMAA 1IBMH 5CV8A 1JR0D 2B2VA 2AWOA 3KYHC 4DU9A 2RBMA 2K03A 2F4VQ 4DKAC 4DR5H 4ZCKA 1X3PA 1I6UA 3RAXA 4X3SA 4Y7NH 4QIWB 3VPBA 5EBDA 4RG1A 4ILWA 4BXXH 3T9CA 1ET6A 3D6WA 4CMDA 4IQZA 4FF1A 3EPIA 1WCMB 4HN2A 2NVQB 2GLTA 5ELFA 2EE1A 1H95A 2B63A 4MZ9A 4CKEA 3UQ8A 3KHGA 4R4OA 1I2LA 2D9UA 3SK4A 5I9OA 5E4XA 2F0GA 2K5NA 4EBEA 4MV8A 2FLNA 4DV2L 1D2BA 4CC5A 4A3IG 1SSOA 2KCCA 3KDFA 4CGYB 4HIKA 5J2UF 1HTLD 2Y0SB 1T5EA 1BUVT 4A3MG 3GIDA 4I55F 4NZNA 3Q22A 1Y69U 2ZM6H 3GIMA 2NN6H 3M4IA 3UE0A 1SXTA 3CU7A 1GSHA 1I3QB 2HIXA 3OUUA 2WAQB 1EY9A 2Z1CA 4A93G 2OQKA 3A56A 5FLXc 4O4LF 5EKIA 4DR2L 1N56A 4IO9A 4DR1L 5AJ3Q 1MJEA 1JKJB 3RTXA 1KJIA 4O83A 4Q4DA 4C3JG 5L1LA 1HFGA 4EG0A 4GKKL 2IX1A 4ZK9B 4QQBX 5CA0F 3TY5A 3JAMc
chains in the Genus database with same CATH topology
3J81W 4B3TQ 1HR0H 3J7AK 3W1BA 1J5EH 4X66H 3RLNA 4IOCA 2WFWA 4GKJH 4DV3L 1V9PA 3TQYA 3J7A5 4B3RL 2DUDA 4BY1G 4LF8Q 2D62A 1X55A 1NY4A 2F4VH 2JK8A 1VQHA 4JI0L 3CC2A 5FD5A 5IYBH 3F1ZA 3D31A 4MV9A 1XPOA 3DLLA 3NEMA 4BBRG 3RZDH 3H0GG 4LF7Q 2JA6H 3KXYT 3GDEA 2EQSA 4DV2Q 1VQ7A 3CQZH 1SROA 3AFQA 4IPDA 1OXTA 1SRUA 1BBWA 1UWVA 3L4JA 4DR2Q 4DR1Q 4GLXA 4UP8A 1BKBA 1X3FA 4B3TH 1S68A 3QWUA 4GKKQ 3J81c 1XMOL 2Q2HA 4DK3C 1EIFA 5IYCH 3M4PA 1VQJA 4DV3Q 1O75A 4LF8H 4A3DG 3K8AA 4B3RQ 1CUKA 2BA1A 3AQQA 4A3LH 2JA9A 1S3OA 3PO2G 2MO0A 1Y1VG 1PH3A 1OTCA 4JI0Q 1KQSA 3HFZB 2VZAA 5C4XG 2ID0A 1I94L 4LF7H 4NXNL 3S17H 1U0LA 4DR3L 4DV2H 2IT1A 4IFDG 1XPRA 4Q0YA 1VQNA 2YU9H 5FPRA 3OW2A 2EXDA 1YIJA 3F8TA 1A8VA 1SLJA 1MJCA 4DR2H 4R4CA 5JJKA 1G6PA 4DR1H 5C44G 1BJTA 4A93H 2VQEL 3RZOH 4TVAB 4GKKH 4LUZA 5ELOA 4IAJA 4LF9Q 4C3JH 1LM0A 4M7EA 1TWAH 1WJJA 3LMLA 2WB1E 4DV3H 1XMOQ 3BJUA 2NVYH 4B3RH 1TWGH 2NZHA 1SE8A 2CFMA 4HIMA 3J80W 2CWAA 4JI0H 4NB3A 3RN2A 2F52A 3HOWH 2I5LX 2JQOA 1HNXL 4BY7H 1E7ZA 5LMUL 1I94Q 3CC7A 4NXNQ 1SMXA 4JI3Q 2CWPA 5C0XI 1CSQA 4DUZL 4BBRH 1XMQQ 3H0GH 2XGTA 4GNXA 1SN8A 1WFQA 5M5WH 1PFSA 1JJ2A 1FL0A 3BU2A 4GLAC 3G71A 2IX0A 2FXQA 2VQEQ 4LF9H 1BVSA 3HOXG 2KSWA 4EFBA 1FJGL 1XMOH 2VUGA 4IOAA 1XNRL 4JI2L 3H20A 1D8LA 1YZ6A 1HZAA 1P16A 3M4IA 3M7NA 3K80C 3ULPA 4YWLA 3HOUH 4JI7L 3BABA 4LW1A 4YCWA 2JA5G 1YI2A 2LXKA 4A3DH 2N78A 3J80c 4GOPC 2R7FA 3HOYG 1A63A 3S15H 4GLVB 5LMNW 4A75A 4AYBG 1I94H 4IJLA 5M5XH 4LNQA 4NXNH 1HNXQ 3L4KA 1K83H 4JI3H 4KHPL 5C4XH 1XMQH 4DR3H 5LMUQ 3RR5A 1PH5A 3MEFA 4DUZQ 1L1OC 2PNHA 4IJHA 1HNZL 3E9IA 2Q2IA 3G48A 5M5YH 3UDFA 4A3KG 2VQEH 2R92H 3PO3G 3RLOA 1KRTA 1KC8C 5M3MG 4BXXG 3Q8DA 1Q7YC 2PI2E 1Q82C 5GAEC 2BH8A 3STBC 1FJGQ 3NBHB 4GS3A 1XNRQ 3GTOH 1Z2PX 4OWTB 2RGRA 4APVA 4MTNA 4JI7Q 4DAMA 4C3HH 4RB2C 2UUAL 2JE6I 4PG3A 3GTJH 3CCEA 1E24A 3K3VA 3GJXB 1HNXH 2NVXH 3JAMi 3C0FB 3JC66 1VQKA 2RHSB 1VQFA 3TS0A 4JBJA 5LMUH 1JJGA 2F3IA 1DGSA 4UCUA 3JSNA 4KHPQ 4DUZH 3HOVG 1IBLL 1CSPA 4J0MA 2PQAA 4EEQA 3CMEA 4ETSA 1Q12A 4HJ9A 3KLWA 5IYDG 2YCHA 4EFEA 3B6YA 1KHIA 1VQ5A 2HGSA 2OWOA 3KDFB 1FJGH 2ZJPA 4LH7A 4BBSH 2MNAA 2LXJA 1XNRH 4DR5Q 3I4OA 4BA1I 2HVSA 4JI7H 4KHZA 3PSIA 2K75A 2JA5H 3AYHB 2VPSA 2UUAQ 4P72A 3EBEA 3S14H 1M90C 2UU9L 5GADC 3KAKA 4DR7L 4YHHQ 2HQLA 3J81i 1QUQA 4KI0A 2HT1A 4KHPH 2Z0SA 2YYZA 3K0XA 4X62L 4QL5A 3STBD 4OX9L 1YJNA 3CMAA 1IBLQ 4R4QA 1HNZH 2E2HH 1N9WA 3FKIH 4I7HA 4JOIA 3CW2C 1HR0Q 5IE8A 3PF4A 3PUYA 3K7UC 4B3MQ 4IPGA 4PDBA 4LFBL 3FP9A 4AQYL 3N41B 4O0AA 4A3KH 3PUVA 3PO3H 4YY3L 1FKAH 1ASZA 4XIGS 4K0KL 5M3MH 2FE3A 1E1TA 5IWAL 4DR4L 1I50H 5BR8L 5IP7G 3A74A 3IG0A 1EIYB 1VQEA 2UUAH 5HY6A 2AKWB 4CC6A 1UE5A 1HZBA 4HJ8A 1C7YA 4KLKA 3RNUA 4NXML 1M0WA 4YHHH 1X56A 2UU9Q 1YVCA 4DR7Q 4A2BA 4MV7A 1VS0A 3T1HL 3S16H 1IBLH 2BH2A 1GD7A 4OX9Q 5IT9W 2A19A 2K5VA 3HOVH 1VQDA 3T1YQ 4P71A 4B3MH 3L7ZC 2R6GA 3BZCA 1N8RC 3BA8A 3EYYA 1G291 4YCUA 5IYDH 2N8NA 4JOIC 4X64L 4AQYQ 3HOWG 2AWNA 3PUWA 1XDNA 4BY7G 2Z6KA 3MXNB 4YY3Q 4LWCA 4UCSA 4K0KQ 4JV5L 1OXVA 2JA7G 4DAYB 5IWAQ 2QA4A 1YHBA 4DR4Q 3H15A 2UXCL 3HKZG 3OTOL 5BR8Q 2ATWA 2N49A 4R4TA 3CC4A 1IYJB 1VQCA 2K4KA 2YTVA 1Q1BA 3GD7A 1Q46A 2UU9H 2UUBL 1C9OA 2ZTDA 3A5ZB 3KOJA 4DR7H 1E4FT 1KIXA 4GOPB 2KENA 2PI2A 4JC0A 1NMGA 3A5UA 1B8AA 3TY8A 1A0IA 4OX9H 4GN5A 1PHJA 3T1HQ 1PA6A 4XTCS 5IT9c 3T1YH 1UEBA 3VNNA 3J80i 4L5RC 3UDXA 3CCMA 1V43A 3HOUG 1HZ9A 2VW9A 2QEXA 2ZJQA 4LFBH 4AQYH 3CPFA 1Z2OX 2JJQA 3CP0A 2AHOB 4PMWA 3W5OA 4YY3H 2VUMG 3SGIA 3I56A 4K0KH 3KF6A 1AE3A 1W3SA 4HIDA 4L5SA 2KHJA 5IWAH 4DR4H 4GNXB 3AEVA 5BR8H 4JV5Q 1PYSB 3L0OA 2UXCQ 4Y52H 1KRSA 3OTOQ 1TAEA 2Z6KC 1N32L 3N43B 5IP7H 4HJAA 1VQMA 2D0OA 4BA2I 3F8NA 5FLMH 4DV0L 3TRZA 4NXMH 1AH9A 2UUBQ 4A3JG 4GN4B 2R92G 4MNOA 5EAYA 5C0XG 4C3IH 3T1HH 3S1QH 2ZJRA 1I5FA 1VCIA 4R4IA 3CPWA 1KXLA 1E4GT 4DV4L 3U4VA 1X54A 3TY9A 4GOPA 4RB0A 4LFCL 1IL2A 4MTEA 1CKOA 4X64H 1HZCA 4GN3B 4P73A 4UY8C 4J15A 1VQ9A 4DV1L 1S72A 1KL9A 3IRBA 4P74A 4JV5H 3I7FA 4E6NA 5JJIA 1L1OA 3CVZA 3EN2A 4UP9A 2UXCH 3OTOH 2Q2UA 1VQ8A 2JA7H 3CD6A 4A2AA 1WYDA 1GYFA 3GTKH 4DV7L 1N32Q 4DR3Q 5M3FG 1IXRA 1Y1WG 4IFDJ 1CKMA 2UUBH 2C35B 3LGJA 3ZJYC 2N3SA 3FMAA 2UXDL 5C0XJ 2KCTA 1YHQA 4BBSG 2KBNA 3NC0B 1VQ6A 1LTLA 3ULLA 1U5KA 4DNIA 4DV4Q 1K8AC 4AYBE 3GTLH 1EFWA 2E2IH 5FD6A 4A3GG 3GTMH 2OQ0A 4L5QA 2VOBA 4EQ5A 1EQQA 1XTDA 4DV1Q 5GROA 4UPAA 4DUYL 2PQAB 2VUMH 1W2BA 3HKSA 3PV0A 4P75A 2UXBL 4DV5L 1NJIC 5DLQE 1N32H 4NPSA 2RF4A 3FKIG 4DV7Q 4LF4L 1SEIA 1TXYA 1NE3A 3K7AH 2IHEA 3I4MG 5GAGC 4A3FG 1VQGA 1VQOA 4LMYA 4OONA 5HGQA 5D1OA 3KJOA 4A3JH 3GTGH 2BA0A 2UXDQ 2CW8A 2RCNA 2AMCB 1XJVA 2R93G 2KHIA 1GKHA 4RMFA 2UUCL 4DV4H 2A1AA 2GVBA 1E22A 4JI2Q 4B3SL 1QUQB 1G51A 4X65L 1IZ6A 4UCOA 5JEAG 4OWWB 5EOYA 3AFPA 4DV1H 1Q86C 3RGZA 3RLFA 4JI5L 2IY5B 3M9BA 4DUYQ 3M4OH 1ASYA 4LFAL 4JCVE 3H3VI 5K36G 3WWVA 1C0AA 1WCMG 2UXBQ 1K0RA 4DV5Q 4DV7H 4TQUS 2RHQB 2WE6A 4LF4Q 1E3PA 3S1RH 3I2ZA 5M3FH 1HNZQ 2Y0SG 1Y1WH 4ME3A 4JYAL 4ALPA 1UE7A 2ZJTA 1CKNA 3UE1A 2Q2TA 4LUVA 2UXDH 3PF5A 2WAQG 3N42B 1V1QA 1KD1C 3NBYB 5C4JH 4X66L 4GKJL 4JI2H 3M3YH 1FGUA 2UUCQ 4X65Q 1XNQL 3RJ0A 3KAJA 1PH6A 5JEAJ 3RGXA 4R1JA 2A8VA 4A3GH 4DUYH 1IBKL 5GQOA 2D0PA 2B63H 1N36L 2MCTA 1Q1EA 2GN5A 1L2FA 4LFAQ 3DF7A 4DV5H 3PN1A 2UXBH 1SR3A 1LUZA 3VDYA 4H02A 4LF4H 3ULJA 4RB3C 2KCMA 4EX5A 3RF2A 2WYOA 1Z9FA 1HH2P 4QY7A 1D7QA 1WI5A 1PVOA 3I4MH 2ZTCA 4A3FH 4JYAQ 4X6AH 3HOZG 3H3VH 3FHWA 2K14A 1QVCA 1VQLA 1YITA 3JAMW 3GTPH 2XIGA 1N33L 3TS2A 4OO1I 3CXCA 1EQRA 2UUCH 1K9MC 4A3CG 5ELNA 2R93H 4LSAA 2R7ZH 1AE2A 3NELA 1N34L 3RIZA 4X65H 1GVPA 4A3BG 5FLMG 2CQOA 3I4NH 4LH6A 1XNQQ 4JI5H 3CF5A 2ASBA 4JI6L 1YBYA 4POGA 4RZQA 1VQBA 1IBKQ 1N36Q 5C3EG 4LF7L 4LFAH 3W1GA 4UCVA 2CW7A 2JA8H 1M0TA 3PGZA 3RN5A 4PZ7A 3E9HA 1X3EA 1EYGA 4X62Q 4PZ6A 1UE1A 4A3EH 1WCMH 2NVQH 1X65A 1PH4A 1T9HA 3GB8B 3PUZA 1K3RA 3KF6B 1HR0W 4PZ8A 1M1KC 4JYAH 1OXUA 5FPOA 1B7YB 3UDGA 1XK5A 3HKZE 2YTYA 1E1OA 1HJPA 1I3QH 1MZBA 4LFBQ 3S24A 1N33Q 1VQPA 1Z47A 2OTLA 4UCRA 2WP8J 1GO3E 2NZOA 1PH8A 1OXSC 1N34Q 2WDTA 1XNQH 1EWIA 4JI1L 4OWXB 3EIVA 3ERSX 4IPHA 4JBMA 1IBKH 1N36H 4NXMQ 1YJWA 3U58A 4JI6Q 4O2DA 1TA8A 5DISC 3S2DH 4X62H 2I5MX 1S40A 3TEHB 1NTGA 4OXPA 3CCRA 2VL6A 1X6OA 5IP9H 1BBUA 4DR6L 4POFA 4L5TA 1ZHQA 1L1OB 3I55A 3GTQH 2K52A 4WJ3M 4LF9L 3HOZH 1N33H 4X64Q 3M4QA 3GO5A 1B70B 2YTXA 4HJ5A 4A3CH 1NBWA 4LF5L 5J3BA 1N34H 3G6EA 5GAHC 2MFIA 1PH7A 2HVQA 1A62A 1VQAA 4IPCA 1L2ZA 4JI1Q 4A3BH 5LMNL 1J6QA 1XPUA 4JI6H 1NMFA 1PH2A 4LUOA 4RB1A 2GVAA 1KAWA 4JI3L 3UDIA 4DK6C 1XMQL 5C3EH 3BA9A 3E0EA 1BGWA 1Z2NX 4HIOA 2MO1A 4A3IH 3PIPA 2B29A 4A3MH 2JEBI 1YNXA 1WH2A 4DR6Q 1YEZA 2CKZB 3N6XA 2MQHA 1I6HH 4QGUA 1JB7A 2XTIA 2LSSA 3S2HH 1PV4A 1OXXK 2OTJA 3CCJA 1EUJA 3A0JA 2RGVA 1L0WA 4BY1H 3OYYA 5D1OB 4LF5Q 4APMA 4JI1H 4IFDI 2WB1G 5JJLA 4DV6L 5LMNQ 4DV0Q 5A2QW 3PCOB 1X3GA 2PMZE 1Q8KA 2K5HA 4YCVA 1SFOH 4JI4L 4LSXA 2EIFA 4WJ4A 4DPGA 1VQIA 2O03A 2V1CC 2HIVA 4DR6H 1S03G 1MKHA 2K50A 3F2BA 4LFCQ 2YV5A 4C2MH 1ZHSA 5H1SE 2I5HA 2B63G 2W57A 2HHHL 1HNWL 1TWFH 3S1MH 3U4ZA 4A76A 4LF5H 3M85A 3PIOA 4LF6L 3HXLA 1CKNB 1RL2A 2VS1A 3CCUA 3MWMA 2E8GA 5LMNH 4DV0H 3PO2H 4UP7A 2VY3A 1QZGA 3U50C 1Y1VH 4DV6Q 2ZTEA 3CCQA 4BWSC 1R9TH 3ICEA 1QZHA 5FJ8G 4HJ7A 3CCSA 2E5LL 4JI4Q 3NENA 3CAMA 1MIUA 1QVFA 2VQFL 3L2PA 4YWKA 4JI8L 1AN7A 3J7ZC 3BZKA 2R7ZG 3TREA 1TWCH 3CCLA 4LFCH 3I4NG 4QIWE 4GNXC 5C44H 1IBML 4FM9A 3D0FA 4DR5L 1Y14B 1JJCB 1RIPA 3N40P 4JBWA 1X9NA 3J81j 2JA8G 2I0QA 2Y0SE 2HHHQ 1HNWQ 4LF6Q 4A3EG 1SYXB 2NN6G 2WAQE 3DM3A 4A4IA 1EOVA 4YHHL 1TWHH 4DV6H 2ZM6L 1K8GA 2CCZA 3KJPA 2ALYB 1PH1A 1Q81C 4RAZA 4R7RA 4FDBA 4JI4H 1FVIA 4YWMA 2E5LQ 3KFUA 1QVGA 1HR0L 1J5EL 2OCEA 2VQFQ 1YJ9A 2R7DA 1P8LA 4JI8Q 4B3ML 2VNUD 1JE5A 1WOCA 4B3SQ 2F4VL 5IYBG 2DGYA 1IBMQ 2NN6I 2B3GA 4AIMA 1PH9A 4OO1G 3BAAA 4UCTA 3HOXH 4MTDA 1PYBA 1VQ4A 2JA6G 4JI5Q 2HHHH 4DRFA 1HNWH 3F2DA 4JG2A 1JT8A 2H5XA 4JBKA 1K73C 4LF6H 4UFZA 2JEAI 1LYLA 1B04A 5IY0A 2L15A 4RAYA 2QGQA 5IP9G 3KALA 3HOYH 5D1PA 2ZM6Q 5E7NA 2NVTH 5FLXW 2HVRA 5AJ3L 2ES2A 4QJFA 3N44B 1O7IA 3F2CA 3S1NH 1GM5A 2E5LH 3KF8B 1UE6A 4B3TL 5IYCG 4AH6A 5FJ8H 1JMCA 3JSLA 2VQFH 3T1YL 4JI8H 3G4SA 3CCVA 3K81C 1J5EQ 3ER0A 4X66Q 3PUXA 4GKJQ 2IHFA 4A3LG 4LF8L 3NBZB 1YHAA 4B3SH 2E2JH 5LL6b 1IBMH 2AWOA 3KYHC 2F4VQ 4DKAC 4DR5H 1I6UA 4Y7NH 4RG1A 4BXXH 1H95A 4MZ9A 3UQ8A 4R4OA 2K5NA 4DV2L 4CC5A 4A3IG 3KDFA 4HIKA 4A3MG 2ZM6H 3UE0A 2HIXA 4A93G 2OQKA 5FLXc 4DR2L 4IO9A 4DR1L 5AJ3Q 1MJEA 3RTXA 4GKKL 2IX1A 4QQBX 3TY5A 3JAMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKS A;  3PV0 A;  3BA9 A;  4B3T Q;  3E0E A;  3I4O A;  3W1B A;  4BA1 I;  2HVS A;  4P75 A;  2UXB L;  4DV5 L;  1NJI C;  3RLN A;  4IOC A;  2WFW A;  5DLQ E;  4DV3 L;  1V9P A;  3TQY A;  2MO1 A;  4HIO A;  4A3I H;  4NPS A;  3J7A 5;  4KHZ A;  4B3R L;  2RF4 A;  2DUD A;  3PSI A;  4BY1 G;  3PIP A;  2B29 A;  4A3M H;  3FKI G;  4DV7 Q;  2JEB I;  4LF4 L;  2K75 A;  4LF8 Q;  1TXY A;  1NE3 A;  1YNX A;  2D62 A;  2JA5 H;  1X55 A;  3AYH B;  3K7A H;  2UUA Q;  2IHE A;  4DR6 Q;  4P72 A;  3I4M G;  1NY4 A;  5GAG C;  4A3F G;  3EBE A;  1YEZ A;  1VQG A;  2CKZ B;  3S14 H;  1VQO A;  1M90 C;  2JK8 A;  2UU9 L;  1VQH A;  5GAD C;  2MQH A;  4DR7 L;  4YHH Q;  4JI0 L;  4OON A;  3CC2 A;  5HGQ A;  1I6H H;  5D1O A;  3KJO A;  2HQL A;  4A3J H;  3GTG H;  3J81 i;  5IYB H;  2BA0 A;  3F1Z A;  4QGU A;  3D31 A;  1QUQ A;  1JB7 A;  4KI0 A;  2UXD Q;  2XTI A;  2HT1 A;  1XPO A;  2LSS A;  2Z0S A;  2YYZ A;  3DLL A;  3K0X A;  4X62 L;  2RCN A;  3NEM A;  4QL5 A;  2AMC B;  3STB D;  1XJV A;  2R93 G;  4BBR G;  4OX9 L;  2KHI A;  3RZD H;  1PV4 A;  3S2H H;  3H0G G;  1YJN A;  4LF7 Q;  2JA6 H;  1GKH A;  1OXX K;  3CMA A;  2OTJ A;  4RMF A;  3CCJ A;  2UUC L;  1EUJ A;  1IBL Q;  3GDE A;  3A0J A;  4R4Q A;  2A1A A;  2GVB A;  1L0W A;  2E2H H;  4BY1 H;  2EQS A;  1N9W A;  1E22 A;  3PO3 G;  3OYY A;  4DV2 Q;  4JI2 Q;  3FKI H;  1VQ7 A;  4LF5 Q;  3CQZ H;  5D1O B;  4JOI A;  1SRO A;  3CW2 C;  1HR0 Q;  4B3S L;  5IE8 A;  3AFQ A;  4IPD A;  1OXT A;  1QUQ B;  1G51 A;  4X65 L;  3PF4 A;  3PUY A;  1IZ6 A;  4IFD I;  4UCO A;  2WB1 G;  3K7U C;  4B3M Q;  5JEA G;  4OWW B;  4IPG A;  5JJL A;  4DV6 L;  5LMN Q;  1SRU A;  4DV0 Q;  4LFB L;  3AFP A;  3FP9 A;  4AQY L;  1Q86 C;  1BBW A;  3RLF A;  1UWV A;  4O0A A;  4JI5 L;  4DR2 Q;  4A3K H;  2IY5 B;  4DR1 Q;  3PUV A;  3PCO B;  1X3G A;  2PMZ E;  4GLX A;  3PO3 H;  1Q8K A;  4UP8 A;  4YY3 L;  1ASZ A;  1BKB A;  1X3F A;  3M9B A;  4XIG S;  2K5H A;  4DUY Q;  1ASY A;  3M4O H;  4K0K L;  1S68 A;  5M3M H;  4LFA L;  4YCV A;  1E1T A;  1SFO H;  4JCV E;  4JI4 L;  3H3V I;  3QWU A;  4GKK Q;  3J81 c;  5IWA L;  2EIF A;  1XMO L;  4DR4 L;  1I50 H;  5K36 G;  3WWV A;  1C0A A;  2Q2H A;  4WJ4 A;  4DK3 C;  1EIF A;  5IYC H;  5BR8 L;  1WCM G;  2UXB Q;  1K0R A;  4DV5 Q;  3M4P A;  1VQJ A;  3A74 A;  4DPG A;  1VQI A;  5IP7 G;  1EIY B;  4DV3 Q;  4TQU S;  2RHQ B;  1VQE A;  2V1C C;  3K8A A;  4A3D G;  4B3R Q;  2HIV A;  5HY6 A;  4QQB X;  2AKW B;  4CC6 A;  1UE5 A;  1CUK A;  2BA1 A;  3AQQ A;  1HZB A;  1MKH A;  4LF4 Q;  1E3P A;  2K50 A;  4HJ8 A;  4A3L H;  3S1R H;  2JA9 A;  3I2Z A;  1C7Y A;  4KLK A;  3RNU A;  5M3F H;  1HNZ Q;  1S3O A;  3F2B A;  2Y0S G;  1Y1W H;  4NXM L;  3PO2 G;  4ME3 A;  4LFC Q;  4JYA L;  2YV5 A;  2MO0 A;  1X56 A;  4ALP A;  1UE7 A;  1Y1V G;  1PH3 A;  2UU9 Q;  4C2M H;  1OTC A;  4DR5 Q;  1CKN A;  1YVC A;  3UE1 A;  2Q2T A;  4LUV A;  4DR7 Q;  5H1S E;  4JI0 Q;  3PF5 A;  1KQS A;  2WAQ G;  3HFZ B;  2I5H A;  2B63 G;  1VS0 A;  2VZA A;  1V1Q A;  5C4X G;  2ID0 A;  1I94 L;  4NXN L;  3S17 H;  1KD1 C;  3T1H L;  3NBY B;  5C4J H;  3S16 H;  4X66 L;  2BH2 A;  2HHH L;  1HNW L;  1GD7 A;  1U0L A;  4OX9 Q;  1TWF H;  4GKJ L;  4DR3 L;  3S1M H;  2A19 A;  2K5V A;  2IT1 A;  3U4Z A;  4A76 A;  3M3Y H;  3M85 A;  3PIO A;  4LF6 L;  1FGU A;  2UUC Q;  3HOV H;  4IFD G;  1CKN B;  1VQD A;  1XPR A;  1RL2 A;  2VUM G;  3T1Y Q;  2VS1 A;  3CCU A;  1VQN A;  2YU9 H;  4P71 A;  5FPR A;  3L7Z C;  3OW2 A;  2E8G A;  2EXD A;  1YIJ A;  2R6G A;  3BZC A;  4X65 Q;  1XNQ L;  3PO2 H;  1N8R C;  3BA8 A;  1PH6 A;  1G29 1;  4YCU A;  5JEA J;  3F8T A;  4UP7 A;  2VY3 A;  1QZG A;  1A8V A;  1SLJ A;  1MJC A;  5IYD H;  3U50 C;  1Y1V H;  2N8N A;  4R4C A;  5JJK A;  4R1J A;  4DV6 Q;  2A8V A;  2ZTE A;  1G6P A;  4JOI C;  3CCQ A;  4X64 L;  5C44 G;  4A3G H;  4AQY Q;  1R9T H;  3HOW G;  3ICE A;  4A93 H;  2VQE L;  3RZO H;  1IBK L;  2AWN A;  2D0P A;  5GQO A;  1QZH A;  1N36 L;  2B63 H;  3PUW A;  1Q1E A;  4TVA B;  1XDN A;  4BY7 G;  2Z6K A;  4Y52 H;  3MXN B;  4LUZ A;  4LWC A;  2GN5 A;  4YY3 Q;  5FJ8 G;  4UCS A;  5ELO A;  4LF9 Q;  4C3J H;  1LM0 A;  4K0K Q;  1TWA H;  1OXV A;  4HJ7 A;  4JV5 L;  1L2F A;  4LFA Q;  3CCS A;  2E5L L;  1WJJ A;  3PN1 A;  4JI4 Q;  1SR3 A;  4DAY B;  2JA7 G;  3NEN A;  2WB1 E;  5IWA Q;  2QA4 A;  1YHB A;  1XMO Q;  1LUZ A;  1MIU A;  2NVY H;  3BJU A;  3CAM A;  3H15 A;  4DR4 Q;  3HKZ G;  2VQF L;  3L2P A;  3VDY A;  1QVF A;  3OTO L;  2UXC L;  1TWG H;  5BR8 Q;  2NZH A;  4YWK A;  2ATW A;  1SE8 A;  4JI8 L;  2CFM A;  2N49 A;  4H02 A;  4R4T A;  3J7Z C;  3BZK A;  2R7Z G;  3CC4 A;  3ULJ A;  1IYJ B;  1VQC A;  2KCM A;  4EX5 A;  2K4K A;  2YTV A;  3TRE A;  1Z9F A;  1HH2 P;  1TWC H;  1Q1B A;  4HIM A;  3CCL A;  4QY7 A;  1D7Q A;  3GD7 A;  1Q46 A;  1WI5 A;  3I4N G;  4QIW E;  1C9O A;  2UUB L;  2CWA A;  2ZTD A;  3A5Z B;  3KOJ A;  1PVO A;  4NB3 A;  3I4M H;  1KIX A;  4GNX C;  2ZTC A;  3RN2 A;  4A3F H;  4JYA Q;  4X6A H;  5C44 H;  2F52 A;  1IBM L;  3H3V H;  3HOZ G;  3FHW A;  2K14 A;  3HOW H;  1QVC A;  1VQL A;  2I5L X;  2KEN A;  4GOP B;  2PI2 A;  3D0F A;  4DR5 L;  4JC0 A;  1Y14 B;  2JQO A;  1YIT A;  1HNX L;  1NMG A;  4BY7 H;  3A5U A;  1B8A A;  1JJC B;  3GTP H;  1RIP A;  1E7Z A;  3TY8 A;  4JBW A;  1N33 L;  3TS2 A;  1A0I A;  4GN5 A;  1PHJ A;  5LMU L;  1I94 Q;  3CC7 A;  1X9N A;  4NXN Q;  3T1H Q;  4OO1 I;  1SMX A;  3J81 j;  1PA6 A;  4XTC S;  1EQR A;  3CXC A;  2I0Q A;  2CWP A;  2Y0S E;  5C0X I;  1K9M C;  4JI3 Q;  1CSQ A;  4A3C G;  5ELN A;  4DUZ L;  5IT9 c;  2HHH Q;  1HNW Q;  2R93 H;  4BBR H;  1XMQ Q;  1UEB A;  3H0G H;  3VNN A;  3J80 i;  4L5R C;  3UDX A;  3CCM A;  1V43 A;  3HOU G;  4LF6 Q;  2XGT A;  1HZ9 A;  2VW9 A;  4A3E G;  2R7Z H;  1AE2 A;  2NN6 G;  2WAQ E;  3NEL A;  3DM3 A;  1N34 L;  2QEX A;  1GVP A;  4A4I A;  4GNX A;  2ZJQ A;  1SN8 A;  1EOV A;  4A3B G;  1WFQ A;  5M5W H;  1TWH H;  5FLM G;  2CQO A;  4YHH L;  1PFS A;  3I4N H;  2ZM6 L;  4LH6 A;  1XNQ Q;  1JJ2 A;  3CPF A;  1K8G A;  2JJQ A;  1FL0 A;  3CP0 A;  2CCZ A;  2AHO B;  3BU2 A;  4GLA C;  4PMW A;  2ALY B;  3KJP A;  3CF5 A;  1PH1 A;  2ASB A;  3G71 A;  3W5O A;  4JI6 L;  2IX0 A;  1YBY A;  2FXQ A;  1Q81 C;  2VQE Q;  3SGI A;  4POG A;  3I56 A;  1VQB A;  1BVS A;  4FDB A;  1IBK Q;  1N36 Q;  5C3E G;  3KF6 A;  4LF7 L;  3HOX G;  1AE3 A;  1W3S A;  3W1G A;  4HID A;  4L5S A;  2KHJ A;  4EFB A;  4UCV A;  1FJG L;  2VUG A;  4GNX B;  4IOA A;  2JA8 H;  1FVI A;  3AEV A;  1XNR L;  4JV5 Q;  4YWM A;  1PYS B;  4JI2 L;  2E5L Q;  1D8L A;  1YZ6 A;  3KFU A;  1HZA A;  3PGZ A;  1P16 A;  4PZ7 A;  3RN5 A;  1QVG A;  3M7N A;  3E9H A;  1X3E A;  1HR0 L;  3K80 C;  3ULP A;  1EYG A;  3L0O A;  2OCE A;  4YWL A;  4X62 Q;  4PZ6 A;  1UE1 A;  1KRS A;  3OTO Q;  2VQF Q;  1YJ9 A;  4A3E H;  4JI7 L;  3HOU H;  4LW1 A;  2R7D A;  1TAE A;  2Z6K C;  1P8L A;  4YCW A;  1N32 L;  1WCM H;  4JI8 Q;  5IP7 H;  4B3M L;  2NVQ H;  2JA5 G;  1X65 A;  4HJA A;  1YI2 A;  1VQM A;  2LXK A;  1T9H A;  1PH4 A;  2D0O A;  2VNU D;  3GB8 B;  3PUZ A;  4A3D H;  1K3R A;  4BA2 I;  2N78 A;  5FLM H;  1JE5 A;  3KF6 B;  4DV0 L;  3TRZ A;  3J80 c;  1HR0 W;  4PZ8 A;  1M1K C;  1OXU A;  4GOP C;  2R7F A;  1B7Y B;  3HOY G;  1A63 A;  1AH9 A;  1WOC A;  3UDG A;  3S15 H;  5FPO A;  4B3S Q;  2UUB Q;  2F4V L;  4A3J G;  1XK5 A;  5IYB G;  3HKZ E;  4GN4 B;  2DGY A;  4GLV B;  1IBM Q;  2R92 G;  2NN6 I;  2B3G A;  4AIM A;  2YTY A;  5LMN W;  4A75 A;  1PH9 A;  4MNO A;  4OO1 G;  1E1O A;  3BAA A;  1HJP A;  5EAY A;  5C0X G;  4UCT A;  1I3Q H;  4AYB G;  3HOX H;  4IJL A;  5M5X H;  4LNQ A;  4LFB Q;  1HNX Q;  4C3I H;  1K83 H;  3S1Q H;  1PYB A;  1VQ4 A;  3S24 A;  1N33 Q;  2JA6 G;  4JI5 Q;  4KHP L;  1VQP A;  1Z47 A;  2ZJR A;  4DRF A;  2OTL A;  1I5F A;  5C4X H;  3F2D A;  4JG2 A;  5LMU Q;  1JT8 A;  4UCR A;  2WP8 J;  2H5X A;  4JBK A;  3RR5 A;  1K73 C;  1PH5 A;  3MEF A;  1GO3 E;  1VCI A;  4UFZ A;  2JEA I;  1LYL A;  4R4I A;  1L1O C;  4DUZ Q;  2PNH A;  3CPW A;  1B04 A;  2NZO A;  5IY0 A;  2L15 A;  1KXL A;  4DV4 L;  3U4V A;  1PH8 A;  4IJH A;  1OXS C;  2QGQ A;  1HNZ L;  1X54 A;  3TY9 A;  4GOP A;  3E9I A;  4LFC L;  2Q2I A;  3G48 A;  1IL2 A;  1N34 Q;  5IP9 G;  3BAB A;  1EWI A;  4JI1 L;  4OWX B;  3HOY H;  1CKO A;  5D1P A;  2ZM6 Q;  3EIV A;  5M5Y H;  3UDF A;  3ERS X;  2UXC Q;  4IPH A;  5E7N A;  4JBM A;  1HZC A;  4GN3 B;  2NVT H;  4A3K G;  4P73 A;  4UY8 C;  2R92 H;  2HVR A;  3RLO A;  4J15 A;  5AJ3 L;  4NXM Q;  1YJW A;  4DV1 L;  1S72 A;  1VQ9 A;  1KL9 A;  3U58 A;  3IRB A;  4P74 A;  2ES2 A;  4O2D A;  4JI6 Q;  1KRT A;  1KC8 C;  4QJF A;  5M3M G;  1TA8 A;  1O7I A;  3F2C A;  4BXX G;  3Q8D A;  3S1N H;  1Q7Y C;  2PI2 E;  3I7F A;  1Q82 C;  5GAE C;  1GM5 A;  5DIS C;  2BH8 A;  3KF8 B;  3STB C;  4E6N A;  1UE6 A;  5JJI A;  1L1O A;  4B3T L;  1FJG Q;  5IYC G;  3S2D H;  3EN2 A;  3NBH B;  4UP9 A;  4GS3 A;  4AH6 A;  5FJ8 H;  1JMC A;  3JSL A;  2Q2U A;  3T1Y L;  2I5M X;  1XNR Q;  4OWT B;  3TEH B;  1S40 A;  1NTG A;  1VQ8 A;  3GTO H;  3G4S A;  2JA7 H;  3CD6 A;  4OXP A;  3CCV A;  1WYD A;  3K81 C;  4APV A;  4MTN A;  3CCR A;  3ER0 A;  4X66 Q;  1J5E L;  1J5E Q;  4JI7 Q;  3PUX A;  4DAM A;  3GTK H;  4GKJ Q;  4DV7 L;  2VL6 A;  1N32 Q;  2IHF A;  4DR3 Q;  4A3L G;  4LF8 L;  4C3H H;  1X6O A;  5IP9 H;  3NBZ B;  1BBU A;  5M3F G;  1IXR A;  1Y1W G;  2UUA L;  4IFD J;  1YHA A;  4DR6 L;  1CKM A;  2C35 B;  3LGJ A;  4POF A;  2JE6 I;  4L5T A;  4PG3 A;  3ZJY C;  3GTJ H;  3CCE A;  2E2J H;  1L1O B;  1E24 A;  2AWO A;  3KYH C;  3I55 A;  2F4V Q;  4DKA C;  3GTQ H;  3GJX B;  2N3S A;  2K52 A;  4WJ3 M;  2NVX H;  3JAM i;  4LF9 L;  4Y7N H;  2JA8 G;  3HOZ H;  3JC6 6;  4RG1 A;  2UXD L;  1VQK A;  2RHS B;  1VQF A;  4BXX H;  5C0X J;  3TS0 A;  4JBJ A;  4X64 Q;  2KCT A;  1JJG A;  1YHQ A;  3M4Q A;  4BBS G;  2F3I A;  1DGS A;  2KBN A;  4UCU A;  3JSN A;  1H95 A;  4KHP Q;  4MZ9 A;  3UQ8 A;  4R4O A;  3GO5 A;  3HOV G;  3NC0 B;  1IBL L;  1VQ6 A;  2K5N A;  1B70 B;  2YTX A;  1CSP A;  4HJ5 A;  1LTL A;  4DV2 L;  1NBW A;  4A3C H;  4LF5 L;  5J3B A;  3ULL A;  4A3I G;  4CC5 A;  1U5K A;  4DNI A;  3KDF A;  5GAH C;  3G6E A;  2PQA A;  4HIK A;  2MFI A;  4DV4 Q;  1PH7 A;  4EEQ A;  3CME A;  1K8A C;  1Q12 A;  4A3M G;  4HJ9 A;  2HVQ A;  4AYB E;  1A62 A;  1VQA A;  4IPC A;  3UE0 A;  3KLW A;  5IYD G;  3GTL H;  4JI1 Q;  1EFW A;  2HIX A;  2E2I H;  4A3B H;  5LMN L;  4A3G G;  4EFE A;  3B6Y A;  1KHI A;  3GTM H;  1J6Q A;  1XPU A;  4A93 G;  1NMF A;  2OQK A;  5FLX c;  1PH2 A;  2OQ0 A;  4L5Q A;  4LUO A;  1VQ5 A;  4DR2 L;  2GVA A;  4EQ5 A;  4IO9 A;  4DR1 L;  1EQQ A;  1XTD A;  5AJ3 Q;  1MJE A;  4DV1 Q;  3RTX A;  2OWO A;  5GRO A;  1KAW A;  3KDF B;  4UPA A;  2PQA B;  4JI3 L;  4DUY L;  2ZJP A;  4LH7 A;  3UDI A;  4BBS H;  2MNA A;  2LXJ A;  4DK6 C;  2VUM H;  4GKK L;  2IX1 A;  1XMQ L;  1W2B A;  5C3E H;  3TY5 A;  3JAM c; 
#chains in the Genus database with same CATH topology
 3J81 W;  3TME A;  4B3T Q;  1K8M A;  3R5X A;  1HR0 H;  4IUQ A;  3W1B A;  3J7A K;  1J5E H;  4X66 H;  3OIP A;  4KV6 A;  4ZRZ A;  3RLN A;  4IOC A;  2WFW A;  5BWX A;  4GKJ H;  5C6A A;  4DV3 L;  1E0B A;  1FNU A;  1V9P A;  2A69 C;  2L1B A;  3TQY A;  3J7A 5;  4B3R L;  2DUD A;  4BY1 G;  3C2P A;  1RJQ A;  1TY2 A;  4ZKC B;  4LF8 Q;  4QUC A;  2D62 A;  1X55 A;  1NY4 A;  5KGU A;  2F4V H;  2R7Z A;  2PZU A;  3TSS A;  2JK8 A;  3H40 A;  2VA3 A;  1VQH A;  5DNF A;  2W9B A;  1B9M A;  4JI0 L;  3S2D B;  3CC2 A;  4RGM A;  3EPG A;  1B3Q A;  2EYO A;  5FD5 A;  5HNE A;  3Q8Q B;  5IYB H;  4TSS A;  3F1Z A;  3D31 A;  1LTS D;  5A35 A;  1GUN A;  3AX6 A;  5C1P A;  4RUC A;  4MV9 A;  1XPO A;  3LQS A;  5C4H A;  3DLL A;  3JZ6 A;  2A6H D;  2CQA A;  3NEM A;  3VR4 A;  2QYZ A;  2W6O A;  4IHJ F;  3MFG A;  2R7M A;  4QSH A;  3I73 A;  4BBR G;  3RZD H;  3H0G G;  1D5Z C;  4LF7 Q;  2JA6 H;  2Z04 A;  3KXY T;  1CT1 D;  2ZT9 C;  3G6X A;  2F0I A;  3GDE A;  1RK6 A;  5KNC A;  4JV0 A;  3QIA A;  2EQS A;  2XRQ D;  4DV2 Q;  3RV4 A;  1VQ7 A;  3PQI A;  3CQZ H;  1SRO A;  3D4W A;  1GXD C;  3GTQ B;  2AGQ A;  4NZM A;  3A55 A;  2SEB D;  3AFQ A;  4IPD A;  1OXT A;  1WD1 A;  4XQN A;  4O3P A;  2K04 A;  4DL7 A;  3HOZ B;  2B2T C;  2BCO A;  2FPP B;  1RK5 A;  2DJF C;  1CQF A;  2H4O A;  2A73 B;  4KHV A;  2F0W A;  3UFX B;  5I60 A;  1SRU A;  1ET0 A;  3W3A A;  2F0L A;  1BBW A;  2A74 C;  1UWV A;  3L4J A;  4DR2 Q;  4J9P A;  1CI3 M;  2MJ8 A;  5L1I A;  4DFA A;  1PFN A;  4DR1 Q;  2GPW A;  5C5J A;  4GLX A;  2QF7 A;  2F0K A;  4ECS A;  2R8G A;  4UP8 A;  2PZT A;  1BKB A;  1X3F A;  2QIL A;  2Q8I B;  4B3T H;  4RHS A;  1HHV A;  1S68 A;  2C9O A;  1CFM A;  3QWU A;  4GKK Q;  3J81 c;  3L3O C;  1XMO L;  4PWQ A;  1L0Y B;  1QOH A;  2Q2H A;  2RDH A;  4DK3 C;  4CKB A;  1EIF A;  4KY6 A;  5IYC H;  2R82 A;  4N8X 1;  1CQV A;  3M4P A;  1VQJ A;  4HED A;  2NU9 B;  2X0S A;  4DV3 Q;  1O75 A;  4TQS A;  4A3B B;  2K05 A;  4ECV A;  4LF8 H;  4A3D G;  3K8A A;  2NB0 A;  1EZ8 A;  4J6H A;  4B3R Q;  4XZ3 B;  4KKU A;  1QNU A;  1CUK A;  4ZQI A;  2BA1 A;  2F0N A;  3A7L A;  3AQQ A;  3N6R A;  4A3L H;  2JA9 A;  1W6J A;  5LXT F;  1PZI D;  1S3O A;  3SI8 A;  4ME6 A;  3PO2 G;  4ECZ A;  4NXM H;  4MIU A;  2MO0 A;  3A8J E;  2HG8 A;  1Y1V G;  1PH3 A;  5C3E B;  1OTC A;  1Y1W A;  4JI0 Q;  1STB A;  1KQS A;  4E6I A;  4L8J A;  3HFZ B;  2GQS A;  2VZA A;  1CHP D;  4A3I B;  2KA7 A;  5C4X G;  1EY6 A;  4KJN A;  4JUZ A;  2ID0 A;  4FFO A;  1I94 L;  4LF7 H;  4NXN L;  3S17 H;  3KBG A;  4LMQ D;  1GUO A;  4MV3 A;  3C1F A;  1KBL A;  1U0L A;  1VF7 A;  1V4Y A;  1F9Q A;  4KK7 A;  5KRU A;  4NKL A;  4DR3 L;  4DV2 H;  4O7N A;  4F4Z A;  2IT1 A;  2IA6 A;  2JYO A;  1STE A;  3WWI A;  2JA6 A;  4IFD G;  5L1K A;  1XPR A;  3E5S A;  4Q0Y A;  2J6T A;  5JVL A;  5EQ0 A;  1VQN A;  2V5A A;  5COY A;  2YU9 H;  3T9E A;  3MXN A;  4K2K A;  1F77 A;  5FPR A;  3OW2 A;  1I6H B;  3CQZ A;  2EXD A;  1JQY D;  1A2U A;  2R61 A;  2CNQ A;  1YIJ A;  1W93 A;  5J2T F;  1EWC A;  4DAY A;  1LTB D;  1E4E A;  3VR3 A;  5CV9 A;  2X6G A;  3F8T A;  1RD9 D;  2NU8 B;  1H9K A;  1A8V A;  1SLJ A;  1MJC A;  5KFS A;  4DR2 H;  4R4C A;  5JJK A;  3SK6 A;  1G6P A;  5DGB A;  2UVW A;  4DR1 H;  5C44 G;  4I7A A;  3S2H B;  4V19 0;  1BJT A;  4A93 H;  2VQE L;  3RZO H;  2YYA A;  4O42 A;  4MV4 A;  4IUT A;  4TVA B;  4GKK H;  4K5V A;  4LUZ A;  3WWJ A;  4QW8 A;  1ZQ7 A;  5ELO A;  4IAJ A;  4LF9 Q;  4C3J H;  1LM0 A;  1EYC A;  1TWA H;  3NHH A;  4M7E A;  3OHB A;  1WJJ A;  4PV1 C;  5BWR A;  3LML A;  4YP3 A;  3VR2 A;  2WB1 E;  4DV3 H;  1XMO Q;  3BJU A;  4EYI B;  2L5T A;  2NVY H;  3V6J A;  5DLF A;  4B3R H;  1TWG H;  2NZH A;  2F0T A;  3OIQ A;  2R7K A;  4K8J A;  1SE8 A;  2XSC A;  2DPJ A;  3K5L A;  2PPB C;  4C3H G;  2CFM A;  4LAA A;  3NWS A;  1SE4 A;  3SHL A;  1H9S A;  1ZXT A;  3I3C A;  4HIM A;  3D4R A;  3J80 W;  2FJZ A;  2ATL A;  5CBA E;  2LFN A;  1JX4 A;  4QMG A;  1TT2 A;  3FPU B;  2P5Z X;  4PBC A;  3OWF A;  2CWA A;  4FBU A;  4JI0 H;  4Q0F A;  4NB3 A;  3RN2 A;  2VB2 X;  1SFO B;  2F52 A;  3LP8 A;  1KNE A;  3OSO A;  3HOW H;  2I5L X;  5DEH A;  3JZF A;  2JQO A;  3UZB A;  1HNX L;  2F0D A;  5D65 A;  4BY7 H;  1S5F D;  2FPG B;  1E7Z A;  2YL2 A;  1AN8 A;  1I4P A;  2OT2 A;  1S5B D;  3U9S A;  4MTK A;  2X5R A;  2MUY A;  5LMU L;  1I94 Q;  3CC7 A;  4NXN Q;  2G9H D;  1SMX A;  2COG A;  2NUA B;  4JI3 Q;  4NZO A;  2CWP A;  1BCP B;  4ID6 A;  5C0X I;  1CSQ A;  2R6F A;  1TVX A;  3D6C A;  4DUZ L;  1WTW A;  4BBR H;  3K58 A;  4L1K A;  1XMQ Q;  3H0G H;  5JAV A;  2XCL A;  3S9W A;  1HTP A;  3M9M B;  3NQI A;  2XGT A;  3GIP A;  1D1I A;  2RSN A;  4O7Y A;  3BQ0 A;  2ASL A;  2YW2 A;  5HV6 A;  3OSP A;  2COI A;  2YS6 A;  4C2M B;  1DOM A;  4IIJ F;  2ICI A;  1ULZ A;  3R5H A;  1G2W A;  4GNX A;  1ENA A;  1SN8 A;  4TV8 F;  2YU9 A;  1WFQ A;  5M5W H;  3ETJ A;  1PFS A;  1VAJ A;  1JC7 A;  3RD4 A;  1JJ2 A;  4K6D A;  1A6X A;  3G8D A;  1EWH A;  1FL0 A;  5KG7 A;  5CYU A;  3BU2 A;  4GLA C;  2RA4 A;  4ZUJ A;  3G71 A;  2IX0 A;  5EGT A;  3OW7 A;  5IGC A;  1JIH A;  2FXQ A;  1TWF B;  2J4X A;  1VBG A;  1E2V A;  3Q6S A;  3VYS A;  5BN5 A;  3K5O A;  5T1G A;  2VQE Q;  3S1M B;  1BVS A;  5KKN B;  4QWB A;  2VXW A;  4LF9 H;  3HOX G;  3ND8 A;  2R7N A;  2KSW A;  4EFB A;  4ZKB B;  1I7L A;  1FJG L;  1XMO H;  2FMM A;  2VUG A;  4IOA A;  4O81 A;  1XNR L;  1K3B C;  4KY7 A;  4JI2 L;  1D8L A;  1YZ6 A;  3H20 A;  1HZA A;  1P16 A;  1TWA A;  4HSV A;  1A3V A;  1ESF A;  1II3 A;  3M7N A;  2Z8L A;  1B1Z A;  3TP8 A;  2SCU B;  5LYJ F;  3K80 C;  3ULP A;  4YWL A;  3HOU H;  4JI7 L;  3PO2 B;  3BAB A;  4LW1 A;  4YCW A;  1TWG A;  4O3N A;  1R4Q B;  4CE5 A;  2CVR A;  1DCZ A;  2JA5 G;  1YI2 A;  2LXK A;  2V4Q A;  2C5C A;  1E2W A;  3L9A X;  4A3D H;  1R9T B;  2N78 A;  4NDX A;  5KFF A;  3J80 c;  3QJY A;  1LO5 D;  4GOP C;  4TM5 A;  2R7F A;  3HOY G;  1A63 A;  3H09 A;  1IYD A;  3S15 H;  1DZ1 A;  3ZYY X;  5CAE B;  4J9M A;  3W2D A;  3GII A;  4XX0 B;  1B6R A;  4GLV B;  2F0O A;  5LMN W;  4A75 A;  1F9R A;  1PTO H;  1QCB D;  1JIC A;  4AYB G;  4ED2 A;  3MEH A;  1I94 H;  4IJL A;  5M5X H;  4LNQ A;  4NXN H;  1HNX Q;  3L4K A;  1K83 H;  4G4K A;  4IWY A;  4JI3 H;  5FOB B;  3IFT A;  3TP7 A;  2AUJ D;  5CBE E;  4KHP L;  1JB3 A;  5C4X H;  1XMQ H;  4DR3 H;  5LMU Q;  4IUV A;  3RR5 A;  4RU9 A;  1TWC B;  3MEF A;  1V1P A;  1PH5 A;  4RH6 A;  5JQG F;  4DUZ Q;  1L1O C;  2PNH A;  1UNN C;  1NR4 A;  1ET9 A;  4IJH A;  1BBX C;  5EKL A;  4DNR B;  1HNZ L;  3H0G A;  4JV2 A;  3QG1 A;  5C44 B;  3E9I A;  5FLX L;  1FNV A;  4IFD H;  2Q2I A;  4IZO A;  4QUF A;  3G48 A;  3PW2 A;  2FP4 B;  4F4Y A;  5M5Y H;  1S0M A;  3UDF A;  1C30 A;  3LWU A;  4U7C A;  1RF2 D;  3BDO A;  1CA5 A;  3V4Z A;  1EKV A;  4A3K G;  2VQE H;  2R92 H;  2EXZ A;  3RLO A;  3PO3 G;  1JWS D;  1KRT A;  1KC8 C;  3T7A A;  5M3M G;  3VMM A;  2QDB A;  5E25 A;  3T99 A;  4BXX G;  3Q8D A;  1Q7Y C;  2PI2 E;  2EZV A;  1Q82 C;  5GAE C;  3MFH A;  2BH8 A;  1CHQ D;  3STB C;  3Q8R B;  2AGP A;  2CZG A;  3G8C A;  1SYE A;  1Z7T A;  1FJG Q;  3NBH B;  4GS3 A;  3U0G A;  2CW0 D;  1XNR Q;  3GTO H;  1Z2P X;  4OWT B;  5KFQ A;  1PX2 A;  1TWH B;  2RGR A;  1B2T A;  4Q5V A;  3TP5 A;  4APV A;  4MTN A;  4JI7 Q;  4DAM A;  1EQT A;  2WB1 B;  4C3H H;  3MAQ A;  4RB2 C;  1SYG A;  3V05 A;  2UUA L;  5DG9 A;  3KHR A;  1EL0 A;  2O5I C;  2JE6 I;  1LAB A;  4PG3 A;  3GTJ H;  2B2Y C;  3CCE A;  1E24 A;  3K3V A;  3O13 A;  3E0J A;  3MWD A;  4C5B A;  2O4X A;  3GJX B;  3JRX A;  1XYI A;  4YAJ B;  1HNX H;  5JVG 3;  3JAM i;  2NVX H;  3C0F B;  2AQ1 B;  3JC6 6;  1CE8 A;  1G8Z D;  1VQK A;  2RHS B;  1VQF A;  4X3U A;  4HMI A;  3GV6 A;  3TS0 A;  1Y1V A;  4JBJ A;  5LMU H;  1JJG A;  1GHK A;  2F3I A;  1DGS A;  1D1K A;  3M3Y B;  3JSN A;  4K6N A;  4UCU A;  1K83 A;  3PIO 3;  4KHP Q;  4DUZ H;  3DM1 A;  3FDT A;  1SYD A;  3HOV G;  3MA2 B;  1IBL L;  5KFW A;  1JXL A;  3BJY A;  4YQW A;  1CSP A;  1CZW A;  5I2Y A;  4YAK B;  2V58 A;  5HUR A;  1TII D;  1KEE A;  4J0M A;  2PQA A;  5I5S A;  3DWQ A;  5NUC A;  4EEQ A;  3CME A;  4ETS A;  1Q12 A;  1ILP A;  4HJ9 A;  2VA2 A;  1Q8I A;  3DMU A;  3KLS X;  3KLW A;  5IYD G;  1OWT A;  3I12 A;  4EGQ A;  1NNX A;  2L11 A;  2YCH A;  3TZD A;  1U4P A;  4EFE A;  3B6Y A;  1KHI A;  4J9N A;  1WR2 A;  3J81 L;  1VQ5 A;  1JDB B;  2K6A A;  4FS1 A;  4FFN A;  1QNK A;  2Z02 A;  2HGS A;  2OWO A;  5E1F A;  4GZY C;  4FF3 A;  3GV3 A;  3KDF B;  2CQY A;  4S3S A;  4XXE A;  2W6Z A;  1FJG H;  2ZJP A;  4LH7 A;  5EBC A;  4BBS H;  2MNA A;  3HEJ A;  1IYU A;  1S5C D;  1X3Q A;  2LXJ A;  1XNR H;  2Q8R E;  4DR5 Q;  2W7O A;  3NQT A;  3I4O A;  4BA1 I;  2HVS A;  2C00 A;  3Q2O A;  4JI7 H;  1JOK A;  2XNA C;  3FPP A;  3HOY B;  3KTM A;  1I4R A;  5BYB A;  3GTO A;  4KHZ A;  3PSI A;  4G57 A;  4JV1 A;  3SE0 A;  1FYC A;  2NVT B;  2K5W A;  3RMH A;  1RKN A;  5JVH 3;  2K75 A;  2RDI A;  2JA5 H;  3AYH B;  2VPS A;  2UUA Q;  4N8F A;  1EU3 A;  4P72 A;  1M4V A;  4EQN A;  5KFK A;  2C2D A;  3EBE A;  1VKZ A;  3S14 H;  1CTM A;  1M90 C;  3NTI A;  3GTJ A;  1S5E D;  4N9T A;  3NBH A;  2UU9 L;  5ELC A;  5GAD C;  3KAK A;  4DR7 L;  4YHH Q;  5BWT A;  4J9Q A;  4O7L A;  1IW7 C;  2HQL A;  3J81 i;  3T9D A;  4XQQ A;  1QUQ A;  1AFP A;  4KI0 A;  2NVX A;  4PMC A;  1EY0 A;  2HT1 A;  4KHP H;  4RA8 A;  2Z0S A;  3QO2 A;  2YYZ A;  5D3I B;  2FMC A;  3ORR A;  5KYL A;  4DAA A;  3K0X A;  4X62 L;  4QL5 A;  3STB D;  1EZ1 A;  4OX9 L;  1EIG A;  4YIJ A;  2A6H C;  1YJN A;  2R7Z B;  3CMA A;  4PQX A;  3EVQ A;  3TII A;  4I50 F;  5IGE A;  1IBL Q;  2E2J B;  2YZG A;  2OEO A;  4R4Q A;  1HNZ H;  2E2H H;  2W9B B;  1N9W A;  1EUC B;  3H91 A;  3IKJ A;  4QF4 A;  1GGO A;  3FKI H;  4RKB A;  1KJ9 A;  2W8L A;  4I7H A;  4JOI A;  2BQR A;  3CW2 C;  3ERO A;  3K5I A;  1A3T A;  1HR0 Q;  5IE8 A;  3HBL A;  2SOB A;  3K5M A;  2FKL A;  4DL4 A;  3PF4 A;  4Y7N B;  2KEC A;  3PUY A;  1BNC A;  3K5N A;  4IZ8 A;  2QB5 A;  3K7U C;  4B3M Q;  4HSP A;  1G6Z A;  4IPG A;  4HNV A;  4PDB A;  3HS0 C;  2IW3 A;  5K2M A;  1KTA A;  1BDO A;  1TS3 A;  5BWW A;  4O3R A;  4LFB L;  2R8J A;  3FP9 A;  4AQY L;  1MGS A;  5DAA A;  3N41 B;  4HYK A;  4O0A A;  4A3K H;  3PUV A;  3PO3 H;  2JA8 B;  5KT5 A;  4FS2 A;  4YY3 L;  1FKA H;  1ASZ A;  5EWF A;  1XTC D;  4XIG S;  2EJ0 A;  1A3U A;  4K0K L;  4IUP A;  5M3M H;  2FE3 A;  4YBZ B;  1E1T A;  5G3L D;  4IUU A;  4LK1 C;  5KNB A;  5IWA L;  5ISR A;  4DR4 L;  1I50 H;  3JZI A;  4A3E B;  2ABJ A;  2TMP A;  5KFN A;  2F0F A;  5BR8 L;  2HJW A;  1S0N A;  3KHH A;  5JPM C;  5KG2 A;  5IP7 G;  2PVP A;  3A74 A;  3IG0 A;  1O78 A;  1EIY B;  1B53 A;  2IP4 A;  1VQE A;  2B2T A;  4MV6 A;  1GJX A;  2UUA H;  1I7N A;  5HY6 A;  2AKW B;  4CC6 A;  1UE5 A;  2FLP A;  3SVM A;  1HZB A;  3WO1 A;  4HJ8 A;  4J9K A;  1C7Y A;  2RQX A;  4KLK A;  5JEA H;  3RNU A;  4NXM L;  1M0W A;  5EZY F;  5KT6 A;  3HGB A;  4YHH H;  5KFB A;  2IPK D;  4DL2 A;  2JA5 A;  1I1M A;  5CC4 A;  1SNP A;  1X56 A;  3E5N A;  3EQL C;  2DJG C;  2UU9 Q;  1YVC A;  5CR3 A;  4DR7 Q;  1CK1 A;  4A2B A;  5CA1 F;  4MV7 A;  1KC7 A;  4C3I G;  1C8C A;  3U55 A;  4ED8 A;  4O82 A;  4RZR A;  1VS0 A;  4JVZ A;  2B8F A;  5DQH A;  3T1H L;  2OXP A;  2KEE A;  4ZI7 F;  1EFI D;  3S16 H;  1IBL H;  2BH2 A;  4AYB A;  1GD7 A;  2W6N A;  4OX9 Q;  1SAP A;  2O5J C;  2A19 A;  5IT9 W;  2K5V A;  4WJW A;  5J39 A;  3U9O A;  1SEB D;  1AZP A;  3HOV H;  2IL8 A;  4UHV A;  1VQD A;  5CGK A;  3OOC A;  4X3T A;  1DYQ A;  3T1Y Q;  4P71 A;  5EJW A;  4B3M H;  3L7Z C;  3T9A A;  4XYO A;  4G7Z C;  3MR3 A;  2R6G A;  3BZC A;  4HQ6 A;  2UVR A;  1N8R C;  3BA8 A;  3EYY A;  1G29 1;  3QOJ A;  4YCU A;  4O86 A;  5IYD H;  1MSH A;  2N8N A;  1J8I A;  1I4G A;  1ZYR D;  4JOI C;  3T54 A;  3VR6 A;  4X64 L;  3RZD B;  3E3X A;  4AQY Q;  3HOW G;  3EJI A;  4DL5 A;  2JA6 B;  2EYJ A;  5F9N A;  2AWN A;  1IW7 D;  3PUW A;  4YB8 B;  1XDN A;  5CM0 A;  4CBV A;  4BY7 G;  2Z6K A;  3R2T A;  3MXN B;  4YY3 Q;  4LWC A;  4UCS A;  3CQZ B;  4K0K Q;  4JV5 L;  2W7P A;  1OXV A;  2EY5 A;  4U67 3;  3I91 A;  4MV1 A;  3QB3 A;  5DMX A;  1PMR A;  4DAY B;  2JA7 G;  4CMF A;  4Q8F A;  5IWA Q;  3C46 A;  1UEA B;  1YHB A;  2QA4 A;  4DR4 Q;  1E4E B;  2IMW P;  5E4W C;  3H15 A;  2UXC L;  3HKZ G;  3J80 L;  3OTO L;  1I50 A;  5BR8 Q;  4RWS C;  2ATW A;  5KFH A;  2N49 A;  1ZAU A;  4FP5 D;  4R4T A;  2EYF A;  1V8Q A;  3CC4 A;  3PVX A;  1IYJ B;  1VQC A;  1CS0 A;  2K4K A;  2YTV A;  4O2A F;  2Z4I A;  1Q1B A;  1BQQ T;  2Z4H A;  3VYU A;  3GD7 A;  1Q46 A;  4I65 A;  2AQ4 A;  2UUB L;  1C9O A;  2W6Q A;  2UU9 H;  1GUG A;  2F0H A;  4K5W A;  4O3Q A;  3FRP B;  1TY0 A;  2ZTD A;  3A5Z B;  1CZG A;  3KOJ A;  5IGF A;  5A2Q L;  1E4F T;  4DR7 H;  1GUT A;  1KIX A;  1PLF A;  3K0Y A;  1KT8 A;  4GOP B;  2KEN A;  2XRS D;  2FB9 A;  2PI2 A;  2XC9 A;  4JC0 A;  1QE6 A;  2H1E A;  2A68 D;  1NMG A;  3A5U A;  1B8A A;  2XD4 A;  1X32 A;  1DD2 A;  3TY8 A;  2YRX A;  1A0I A;  2KHS A;  4OX9 H;  1H9S B;  3NBI A;  4GN5 A;  1PHJ A;  1WRV A;  2XVS A;  3WDN A;  4QWE A;  2UVV A;  3T1H Q;  4O7S A;  1PA6 A;  4NMZ A;  4XTC S;  2FK2 A;  2TSS A;  4YR2 A;  4ME5 A;  3V2T A;  5IT9 c;  4IUN A;  3T1Y H;  1UEB A;  3Q8S B;  3VNN A;  3P1H A;  4IN3 A;  2AQ2 B;  3J80 i;  3UDX A;  3CCM A;  1V43 A;  4L5R C;  3HOU G;  1UC9 A;  1HZ9 A;  2VW9 A;  5H80 A;  2DPI A;  1PRT B;  1OO9 B;  5BN4 A;  3ORQ A;  4KMU C;  5KFZ A;  4I7Z C;  3TN2 A;  2QEX A;  5GON F;  1DJR D;  4PMB A;  2EIY A;  1SNO A;  2ZJQ A;  1YNJ D;  1LTR D;  2G9D A;  1F2M A;  5KFR A;  4LFB H;  4DN4 M;  4XYM B;  4AQY H;  3CPF A;  1B50 A;  1Z2O X;  2W9C A;  3S17 B;  2JJQ A;  3CP0 A;  2RKS A;  1RCV D;  2AHO B;  4ZAI A;  1ZEQ X;  4PMW A;  1JOO A;  3W5O A;  4YY3 H;  3NSW A;  3SGI A;  2VUM G;  3I56 A;  4K0K H;  1L0X B;  1LV9 A;  1A9X A;  5F9L A;  3KF6 A;  1AE3 A;  1W3S A;  3RBD A;  4HID A;  2V4D A;  4L5S A;  2KHJ A;  1V1O A;  5IWA H;  3OPO A;  4DR4 H;  4GNX B;  2NTS A;  2YU9 B;  3AEV A;  2PQE A;  5ELE A;  4JV5 Q;  1PYS B;  5BR8 H;  5EDW A;  3R3O A;  3R23 A;  1I4H A;  5CV6 A;  3JRW A;  4FNF A;  1ZET A;  4A3M B;  1TS4 A;  3L0O A;  2UXC Q;  4Y52 H;  4FVM A;  1KRS A;  3OTO Q;  1TAE A;  1U9R A;  2Z6K C;  1LT5 D;  1N32 L;  1RJR A;  4ABN A;  3N43 B;  5IP7 H;  1LTG D;  4HJA A;  1VQM A;  4K5X A;  2D0O A;  1EZ6 A;  2R8I A;  3HB9 A;  2IX3 A;  4BA2 I;  5FLM H;  4DV0 L;  3TRZ A;  1TQO A;  4A93 B;  4G7O C;  3RZO B;  1AUV A;  4PNY A;  4F7X A;  4E4T A;  3IL8 A;  5L9X A;  1EEF D;  1AH9 A;  1E2Z A;  1SE2 A;  5KG1 A;  1GSA A;  2UUB Q;  2M9V A;  5KT2 A;  4A3J G;  1IKL A;  2B2U A;  1MI2 A;  4C3J B;  1TWA B;  3X3N A;  4GN4 B;  4J8Q A;  3H94 A;  3Q24 A;  2R92 G;  1QWY A;  4ZYS A;  4MNO A;  2FJ2 A;  5EAY A;  5C0X G;  3Q8P B;  3UI2 A;  5FO8 B;  1TWG B;  2NU6 B;  4C3I H;  3T1H H;  3MWY W;  3S1Q H;  4EBC A;  4EGJ A;  4WHX A;  4O4J F;  2ZJR A;  5M9O A;  1I5F A;  3I70 A;  1I4X A;  2ASD A;  4BY1 B;  5AFW A;  2W6P A;  1D5M C;  4HCS A;  4NP5 A;  2PN1 A;  1VCI A;  1EYA A;  2JEJ A;  3HP3 A;  4R4I A;  3CPW A;  1KXL A;  1S4Z A;  3SXH A;  1E4G T;  4DV4 L;  3U4V A;  4O4H F;  2KED A;  2J6U A;  1X54 A;  3TY9 A;  4GOP A;  4IWX A;  4RB0 A;  4LFC L;  3HOW B;  1IL2 A;  1M8A A;  4FGR A;  2CHB D;  3NTH A;  1PYW D;  2XN9 C;  4MTE A;  4HNT A;  4Q44 A;  4G7H C;  3LUL A;  2V9W A;  4RCO A;  2E2D C;  3MFI A;  1CKO A;  3LX0 A;  4BY7 B;  3D3R A;  4OIK A;  5I5Y A;  1QIL A;  2CNV A;  2LS0 1;  5HBR B;  1RTO A;  4X64 H;  3K3P A;  2VB3 X;  1HZC A;  4GN3 B;  1V1P B;  4P73 A;  4UY8 C;  3RUP A;  1O7L A;  4CDC C;  4J15 A;  1VQ9 A;  4DV1 L;  1S72 A;  1KL9 A;  3IRB A;  4P74 A;  3SK8 A;  3NE5 B;  4BBR B;  4DK1 A;  1G2T A;  4U68 A;  3H0G B;  1YNN D;  4JV5 H;  3I7F A;  1CQI B;  4DLK A;  4E6N A;  2K1B A;  5JJI A;  1L1O A;  2R84 A;  2J9G A;  3CVZ A;  3EN2 A;  4UP9 A;  1WVL A;  2UXC H;  3N8D A;  2EJM A;  4IRK A;  3OTO H;  2Q2U A;  3MJF A;  1VQ8 A;  5M5W B;  3HT5 A;  3HRZ C;  2CW0 C;  2JA7 H;  3CD6 A;  4A2A A;  5KT3 A;  5IIF A;  1DOK A;  1WYD A;  3GIK A;  1GYF A;  4Z9C B;  3M7G A;  3GTK H;  1B33 N;  2HDM A;  2N88 A;  4DV7 L;  1N32 Q;  4DR3 Q;  2L4N A;  3NWT A;  4OHJ A;  5M3F G;  1IXR A;  1Y1W G;  5DG7 A;  4IFD J;  2SDF A;  1CKM A;  2Q7D A;  2UUB H;  1STG A;  2C35 B;  3LGJ A;  3R8B A;  3I4L A;  3ZJY C;  3D8G A;  4X3K A;  1RJP A;  3MWE A;  2RDF A;  1LTA D;  4ZUI A;  3PW5 A;  2C22 A;  4C1N I;  2ICE C;  1A15 A;  2N3S A;  4FFM A;  1DM0 B;  4O3S A;  3URY A;  1JWM D;  3FMA A;  2UXD L;  5KFI A;  4C5A A;  5C0X J;  3MR6 A;  3HOU B;  2KCT A;  1YHQ A;  4BBS G;  5G3L F;  3P7J A;  2KBN A;  2B2U C;  5J22 A;  1JCK B;  4A3D B;  1O7Z A;  2HHF A;  3NC0 B;  5TSS A;  2EY1 A;  4CDE C;  2DN8 A;  1VQ6 A;  1LTL A;  4GLW A;  3S15 B;  5LP6 F;  3ULL A;  1U5K A;  4DNI A;  3T5J A;  2BR0 A;  2B2Y A;  4DV4 Q;  3OHA A;  1K8A C;  3IAY A;  2HGW A;  1B3A A;  4AYB E;  2NVY A;  5KFX A;  4QWC A;  1R4P B;  2L0C A;  1PTO B;  1Y1V B;  3TQ1 A;  3BDL A;  3GTL H;  3M9O B;  4H44 C;  1EFW A;  1LT3 D;  3ITP A;  2MGS A;  5M5X B;  2E2I H;  1F9S A;  2Q8T A;  1K83 B;  2KOL A;  5FD6 A;  3T53 B;  4A3G G;  3GTM H;  2OQ0 A;  3NUC A;  3ERQ A;  4L5Q A;  5FLX E;  5C4X B;  2VOB A;  4EQ5 A;  2BOS A;  1EQQ A;  1XTD A;  2JEI A;  4F50 A;  4DV1 Q;  4EVO A;  1PDQ A;  5KFJ A;  5GRO A;  1ROD A;  1GHJ A;  3VPC A;  4UPA A;  4DUY L;  2PQA B;  4QB4 A;  3LWB A;  4O7W A;  5L1J A;  2VUM H;  1KDC A;  2F3V A;  1BR9 A;  2CH4 A;  1W2B A;  2RSO A;  4DL3 A;  4O1N A;  3HKS A;  3PV0 A;  4KTA A;  3JAM E;  4B08 A;  3QOL A;  4P75 A;  2W6M A;  2UXB L;  4DV5 L;  1NJI C;  5DAU A;  5DLQ E;  4O7T A;  1N32 H;  4DXG A;  4NPS A;  5M5Y B;  2K5Q A;  2RF4 A;  1KJQ A;  2JN4 A;  3ONA B;  2JA7 A;  4R9W A;  1JOQ A;  3FKI G;  4RFB A;  3NPP A;  4DV7 Q;  5EPL A;  4LF4 L;  3HKZ A;  4F4X A;  1SEI A;  3BVM A;  3GTK A;  1TXY A;  1U4L A;  1NE3 A;  3WNZ A;  3K7A H;  2IHE A;  3I4M G;  5GAG C;  4A3F G;  2VPQ A;  1VQG A;  1VQO A;  1IHZ A;  4M9U A;  4LMY A;  1HPC A;  4UUG A;  4OON A;  2W71 A;  5HGQ A;  5D1O A;  3MHB A;  3MXG A;  2WKC A;  3KJO A;  4A3J H;  3GTG H;  1TS2 A;  5FK9 C;  4C5C A;  5DLG A;  3GTO B;  5JOB A;  1RTN A;  2BA0 A;  2J6S A;  2UXD Q;  2YZN A;  4HNU A;  3SNO A;  1A2T A;  5K3W A;  4DQN A;  5C0X H;  5BPF A;  4KN4 C;  3BS1 A;  2CW8 A;  2RCN A;  3DTF A;  2AMC B;  1XJV A;  4F8M A;  2R93 G;  4O4I F;  4C3H B;  2KHI A;  1GKH A;  1U4M A;  4RMF A;  2UUC L;  3GTJ B;  4DV4 H;  4IR9 A;  2A1A A;  2GVB A;  3AB9 A;  4ED1 A;  2QKI C;  1E22 A;  3TW6 A;  4JW0 A;  4JI2 Q;  4H0L C;  3NP8 A;  2FPI B;  4B3S L;  1B4O A;  1BO0 A;  1NAP A;  2OF1 A;  1QUQ B;  4HR7 A;  1G51 A;  2F0S A;  1XXG A;  2NVX B;  5BYA A;  4X65 L;  1SJE D;  1IZ6 A;  1TR5 A;  3NXW A;  4UCO A;  4ECU A;  5JEA G;  4OWW B;  5EOY A;  1B44 D;  1HA6 A;  3GTL A;  4ED3 A;  1LT6 D;  2F0P A;  2B8G A;  3AFP A;  4DV1 H;  2E2I A;  2D2C C;  4LJZ C;  1Q86 C;  3RGZ A;  4R8U A;  3GTM A;  2JXM B;  3RLF A;  4JI5 L;  5CR5 A;  2IY5 B;  1PFB A;  4FBT A;  1EOT A;  1IOV A;  4EEY A;  2ZXP A;  5HGT A;  1G2S A;  5I6W A;  1DON A;  2VQD A;  5CB4 F;  3IFD A;  1UUP A;  3BAC A;  5CMD A;  3M9B A;  4DUY Q;  3M4O H;  1ASY A;  3TBI B;  2FIN B;  1I4Q A;  4LFA L;  4FXK C;  4JCV E;  3H3V I;  5BN3 A;  1KNA A;  4L63 B;  3J81 E;  2VUM A;  5K36 G;  3WWV A;  1C0A A;  4NLG A;  3T56 B;  2ZDQ A;  4J9S A;  1WCM G;  2UXB Q;  1K0R A;  4DV5 Q;  2LY7 A;  5DGI A;  1K1Q A;  2RCF A;  4DV7 H;  1F9P A;  1SND A;  2E74 C;  5KG5 A;  4TQU S;  5DQI A;  2R8H A;  2RHQ B;  5COR A;  2WE6 A;  1BXT A;  3ETH A;  3OSN A;  4KJO A;  5I9P A;  2XGQ A;  3J7A F;  1Y8N B;  4LF4 Q;  2HD3 A;  3DHQ A;  1E3P A;  3S1R H;  3I2Z A;  4FFL A;  5M3F H;  1HNZ Q;  3NGD A;  2Y0S G;  4F87 A;  1Y1W H;  1A3G A;  4ME3 A;  4JYA L;  3BG3 A;  1BOS A;  4BBS B;  4BS9 A;  4ALP A;  1UE7 A;  2ZDH A;  2ZJT A;  2WKD A;  3HOX B;  1CKN A;  3UE1 A;  2X69 A;  3G6Y A;  2Q2T A;  4LUV A;  1PXU A;  2UXD H;  1HFN A;  2F0U A;  2KJX A;  3PF5 A;  2WAQ G;  2W70 A;  1WTP A;  3N42 B;  4UAI A;  5IT9 L;  1FGB D;  1V1Q A;  3GTG A;  5JQW A;  3T51 B;  2BDN A;  4RUA A;  3GQB A;  5BMV F;  3CKI B;  1D6E C;  1KD1 C;  5F2D A;  1T94 A;  2C2R A;  2R92 A;  5I5W A;  4RGN A;  3NBY B;  5C4J H;  4X66 L;  3K59 A;  5KFU A;  1LLR D;  3C1E A;  3TDQ A;  4GKJ L;  2L12 A;  1EEI D;  4HTH A;  1QJO A;  2JA5 B;  4JI2 H;  2EJ2 A;  3M3Y H;  1UAP A;  4L6T B;  1FGU A;  2UUC Q;  3S14 B;  2PNR C;  4CJ0 B;  1AP0 A;  1EYD A;  3GIJ A;  5I2X A;  4IR1 A;  4FFR A;  4TKO B;  2PW5 A;  5KG3 A;  4Q45 A;  4J9O A;  3QWN A;  4X65 Q;  3SK5 A;  1XNQ L;  3RJ0 A;  1H9R A;  3KAJ A;  1PH6 A;  3Q23 A;  4ECY A;  5JEA J;  3RGX A;  1QB5 D;  3BDC A;  4AYB B;  4R1J A;  2A8V A;  3SEB A;  3PFF A;  2GPS A;  4A3G H;  1SYF A;  3S1N B;  3V4S A;  4DUY H;  1ZYR C;  1IBK L;  5GQO A;  2D0P A;  2B63 H;  3GP7 A;  1N36 L;  2MCT A;  2SNS A;  3CHB D;  5LHY 1;  2QK4 A;  2EYH A;  1Q1E A;  2AU0 A;  4KD3 A;  3K57 A;  1EHI A;  3RV3 A;  2E2H B;  4FFP A;  2GN5 A;  4UDU C;  3FKI B;  4MA0 A;  2K33 A;  2DZD A;  1L2F A;  4LFA Q;  3DF7 A;  4DV5 H;  1LTT D;  1KAB A;  5EKK A;  1SR3 A;  4RGO S;  3PN1 A;  2UXB H;  1LUZ A;  5BWU A;  1FR3 A;  2EOT A;  3VDY A;  2O2L D;  2XWB B;  4I4T F;  4FXG C;  2EVB A;  4H02 A;  4JXU A;  4LF4 H;  4CKC A;  3ULJ A;  2EDG A;  1WTO A;  4RB3 C;  2KCM A;  4EX5 A;  4O84 A;  2M2L A;  2ZDG A;  3RF2 A;  4TQR A;  2WYO A;  1Z9F A;  1HH2 P;  4DAV A;  4QY7 A;  1D7Q A;  4A3K B;  1WI5 A;  2C2E A;  4HN7 A;  3PO3 B;  1ML0 D;  1W96 A;  3OWE B;  2AGO A;  1ILQ A;  5IYZ F;  4QWA A;  4WFN 3;  1PVO A;  4CDF C;  5LL6 S;  3I4M H;  2R3Z A;  2ZTC A;  5M3M B;  4A3F H;  4JYA Q;  1MD2 D;  3DWA A;  4X6A H;  3WOF A;  5C3W A;  3H3V H;  3HOZ G;  4P2C B;  3FHW A;  2K14 A;  1K8O A;  1QVC A;  1VQL A;  1I50 B;  1CM9 A;  3GV7 B;  3NTK A;  1DAA A;  3RAQ A;  2EJ3 A;  4MN3 A;  1YIT A;  3CRK C;  4RNM A;  4MAM A;  3JAM W;  1HCZ A;  3GTP H;  2XIG A;  3KK7 A;  1S10 A;  1N33 L;  5KFO A;  3TS2 A;  1VBH A;  2A68 C;  2EY2 A;  1W6K A;  3QZ7 A;  4NW2 A;  4OO1 I;  3WO0 A;  3CXC A;  1EQR A;  2UUC H;  1K9M C;  1NUC A;  4K2L A;  4F88 A;  4A3C G;  4HMJ A;  5ELN A;  2R93 H;  4GC6 A;  2JEF A;  4DA2 A;  1ESR A;  4LSA A;  2R7Z H;  3MZ5 A;  1AE2 A;  3Q1K A;  3NEL A;  4RAU C;  2DLN A;  1N34 L;  3RIZ A;  1WTQ A;  4X65 H;  2XGP A;  1GVP A;  3P75 A;  2QEJ C;  4DGZ A;  4YJ3 F;  4EGV A;  3TP6 A;  4A3B G;  5FLM G;  3QQM A;  2CQO A;  4EQO A;  3I4N H;  3T9F A;  1Q90 A;  3QFF A;  2PMZ A;  1I1L A;  4LH6 A;  1YNJ C;  5DM7 3;  1XNQ Q;  3BQ2 A;  5KFV A;  2L9H A;  4JI5 H;  3CF5 A;  2ASB A;  3S16 B;  4JI6 L;  3HG9 A;  1YBY A;  2NTT A;  1I1K A;  3DEP A;  3I90 A;  4POG A;  1IBK Q;  1VQB A;  2PBZ A;  4RZQ A;  1N36 Q;  5C3E G;  4LF7 L;  1T36 A;  4LFA H;  2V4R A;  5JJZ A;  3W1G A;  3HOV B;  4UCV A;  2KVM A;  2JEG A;  5C3X A;  3EFX D;  3FMC A;  3Q0A A;  2JA8 H;  2CW7 A;  4O7V A;  1M0T A;  4Q4C A;  4BWG B;  2SNM A;  1S0O A;  3C3L A;  5KND A;  3PGZ A;  3RN5 A;  4PZ7 A;  3WOE A;  3E9H A;  1X3E A;  1EYG A;  4X62 Q;  2HCI A;  5K36 H;  4PZ6 A;  1UE1 A;  2W9C B;  4A3E H;  4M1U B;  1SNC A;  3K6O A;  1WCM H;  2NVQ H;  4WD3 A;  3BG5 A;  4K6L A;  1X65 A;  3PW4 A;  1PH4 A;  1T9H A;  1NCV A;  3GB8 B;  3PUZ A;  2LMC B;  1K3R A;  2V59 A;  3OMG A;  3KF6 B;  1JE4 A;  1HR0 W;  4PZ8 A;  3J80 E;  1M1K C;  1OXU A;  4JYA H;  2E2H A;  5FPO A;  1B7Y B;  1KLG D;  2F0E A;  3VYT A;  3UDG A;  1IYV A;  3FKI A;  5JVD F;  1XK5 A;  1STA A;  3GIL A;  3HKZ E;  2RDJ A;  1DXM A;  2YTY A;  4RKL A;  1BCP D;  2Z6B A;  1E1O A;  1HJP A;  1HUM A;  2PW7 A;  1I3Q H;  5LA6 F;  3OUZ A;  1MZB A;  4MHE A;  4LFB Q;  5KT4 A;  5EPK A;  2BE5 D;  1Q3L A;  1RHP A;  5A2Q E;  3S24 A;  5KFG A;  1N33 Q;  1KDA A;  1VQP A;  1Z47 A;  4C56 C;  1WSC A;  5KFD A;  2OTL A;  3GTP A;  4UCR A;  2ENB A;  2WP8 J;  2EY6 A;  1GO3 E;  5T1I A;  5IGD A;  1XWE A;  3GQC A;  2IJ0 A;  2NZO A;  4YR3 A;  4EYH B;  4C1N K;  2R93 A;  1PH8 A;  1TS5 A;  1LT4 D;  1OXS C;  1ENC A;  1GSO A;  2XWJ B;  3KF8 A;  3V96 A;  1STN A;  1N34 Q;  3IN5 A;  2WDT A;  1XNQ H;  1C48 A;  3BYT B;  3FVQ A;  1EWI A;  4JI1 L;  5IGG A;  2DWC A;  4OWX B;  3UZO A;  5CV7 A;  2R7L A;  5JPN C;  3EIV A;  3ERS X;  4IPH A;  4JBM A;  2QW7 A;  2HDL A;  1IBK H;  4Q43 A;  1N36 H;  4NXM Q;  4OO1 H;  1YJW A;  4HCE A;  4O3O A;  3U58 A;  4JI6 Q;  4O2D A;  2B2V C;  4RHR A;  1SYB A;  1VMP A;  3LWE A;  1TA8 A;  2FLL A;  2B39 A;  4FO2 A;  2QDL A;  4Q8E A;  5DIS C;  4OL7 A;  5KFP A;  5C1O A;  1RYR A;  4XT1 B;  3PW0 A;  1PTO D;  4WOR A;  4QWD A;  4ZOL F;  1YNN C;  3S2D H;  4ECR A;  4X62 H;  3T5K A;  2I5M X;  1S40 A;  3TEH B;  1NTG A;  3T4A C;  3FDS A;  2W8K A;  4RGT A;  3RB0 A;  4MA5 A;  2EJF C;  4OXP A;  3QR8 A;  4QIW A;  3CCR A;  1EQV A;  4K14 A;  1GLV A;  2VL6 A;  1EY7 A;  4ZLT F;  4TUY F;  1V51 A;  1X6O A;  4XYQ A;  2EJG C;  5IP9 H;  1BBU A;  3P20 A;  3VA5 A;  5K5P A;  1WCM A;  3SDZ A;  4DR6 L;  1EYZ A;  1ICW A;  3BVG A;  4POF A;  4L5T A;  3WWH A;  1ZHQ A;  4FF4 A;  1SBB B;  1EY4 A;  4KD4 A;  1L1O B;  1H9J A;  1I6V C;  2F1M A;  3FEW X;  3LNN A;  3I55 A;  3GTQ H;  3R5F A;  1G91 A;  2K52 A;  4WJ3 M;  1JOR A;  5DG8 A;  1A0G A;  4LF9 L;  2Y0S A;  5FKA C;  1PK8 A;  3G6V A;  3HOZ H;  1N33 H;  5FO7 B;  1SNM A;  1Z6H A;  4TVI A;  3EA6 A;  4X64 Q;  2ODT X;  1AW7 A;  1I3Q A;  3M4Q A;  3A7A B;  2WAQ A;  1AEX A;  4DAP A;  3TZU A;  2D5D A;  1EKF A;  3GO5 A;  3CEB A;  4WRD A;  3H3V C;  2A6E C;  5EWG A;  1B70 B;  4IRC A;  2YTX A;  4HJ5 A;  4A3C H;  1NBW A;  4LF5 L;  5J3B A;  1N34 H;  1HUN A;  2QCP X;  5GAH C;  3G6E A;  2MFI A;  2EYM A;  1PH7 A;  3MTS A;  4FE2 A;  2HVQ A;  4TRD A;  1FNW A;  3T16 A;  1A62 A;  1VQA A;  3V6H A;  4IPC A;  2F0V A;  1RYS A;  1L2Z A;  2K7V A;  1DIK A;  2BQ3 A;  4YJ2 F;  4JI1 Q;  4OIJ A;  2L55 A;  2YRW A;  4C3I B;  4A3B H;  5LMN L;  3S1Q B;  1J6Q A;  1XPU A;  4JI6 H;  1NMF A;  3MR5 A;  2HHF B;  1PH2 A;  4LUO A;  4WBN F;  2K01 A;  4RCN A;  1OBG A;  4RB1 A;  2GVA A;  1EU4 A;  3GV8 B;  5L37 A;  3RB6 A;  2ZXR A;  1GUW A;  1KAW A;  2R85 A;  4JI3 L;  1FD7 D;  3MR2 A;  1VDZ A;  1HXY D;  3UDI A;  1HQR D;  4DK6 C;  2NVY B;  1XMQ L;  1DV2 A;  5C3E H;  1SYC A;  3F8N A;  3BA9 A;  3E0E A;  3T9B A;  1BGW A;  2A69 D;  5KFM A;  1Z2N X;  3PW7 A;  4NYE A;  4JK1 C;  4HIO A;  2MO1 A;  4A3I H;  2EYP A;  3PIP A;  3CRL C;  1KUT A;  2B29 A;  4A3M H;  4K8I A;  2JEB I;  5E3F A;  2PCF B;  1YNX A;  1WH2 A;  3VPD A;  4DR6 Q;  3MVV A;  5CV5 A;  1C3O A;  4KY5 A;  2G5D A;  3GV5 B;  4OEM B;  1IKM A;  1YEZ A;  2CKZ B;  5EPJ A;  3F2U A;  3N6X A;  2I46 A;  3TQT A;  2MQH A;  4FXD A;  2WAC A;  1EY5 A;  1I6H H;  3DTG A;  3GTQ A;  3M4Y A;  1PRT F;  4QGU A;  1JB7 A;  2HCC A;  2JA7 B;  5BWV A;  2R86 A;  2XTI A;  1IYE A;  2NUC A;  2LSS A;  3MFY A;  3HKZ B;  1F2L A;  2CNU A;  3DAA A;  5C5M A;  3T13 A;  2J0T D;  3GTK B;  2XCP A;  1S9F A;  5KG4 A;  2FK3 A;  1NSN S;  3S2H H;  1PV4 A;  2M00 A;  2CH4 W;  1OXX K;  4Y8V B;  2Y4R A;  2OTJ A;  2M05 A;  2HQE A;  4M8A A;  3X3M A;  3CCJ A;  2C28 A;  1EUJ A;  3A0J A;  2RGV A;  1L0W A;  4BY1 H;  4V0B A;  3OYY A;  5D1O B;  5EWE A;  4LF5 Q;  4APM A;  3AU7 A;  2F0J A;  4JI1 H;  1VF5 C;  3G7L A;  1K0S A;  3AMU A;  3DWP A;  2VR1 A;  2ZXO A;  3BZD B;  4IFD I;  2ASJ A;  2WB1 G;  2IBK A;  5JJL A;  3TIN A;  4DV6 L;  5D3D A;  1IOW A;  3I8Z A;  2RDG A;  5LMN Q;  4DV0 Q;  5A2Q W;  1QG7 A;  4DNT B;  3A8K E;  4HAE A;  1ZKO A;  4B9X A;  3PCO B;  1O7Y A;  2GA4 B;  1X3G A;  2PMZ E;  5DM6 3;  1Q8K A;  2F4I A;  3RB4 A;  2N55 A;  4ECQ A;  4GC7 A;  1F2Y A;  1F2Z A;  2K5H A;  4O2B F;  4YCV A;  4HR7 B;  1SFO H;  4JI4 L;  4LSX A;  2EIF A;  1S97 A;  4WJ4 A;  3D4D A;  1BF4 A;  1RJT A;  3GTL B;  1IL8 A;  2A6E D;  1VQI A;  4DPG A;  5I5X A;  2E2I B;  2BQU A;  1EUD B;  2V1C C;  2O03 A;  2YZL A;  4R8U B;  1D5X C;  3GTM B;  2HIV A;  3RUZ A;  1SDF A;  2ALZ A;  4DR6 H;  1S03 G;  2RVL A;  2F3W A;  1MKH A;  2K50 A;  5DGH A;  2X6L A;  2BDO A;  3MXU A;  3F2B A;  1DV1 A;  5KIX A;  1LAC A;  5JH7 F;  5KFA A;  4LFC Q;  2YV5 A;  3PR4 A;  4DF7 A;  2VUM B;  1WTH A;  5BPH A;  4C2M H;  3A54 A;  3G6J B;  4XQJ A;  1ZHS A;  5H1S E;  3R2I A;  2I5H A;  2B63 G;  3VOT A;  5D8D A;  4EBD A;  3DUZ A;  2XIW A;  2HGX A;  3PIP 3;  1K1S A;  3KBX A;  4R8N A;  2W57 A;  1LTI D;  4IUR A;  2HHH L;  1BXR A;  1HNW L;  1TWF H;  1TU2 B;  1STH A;  4ED6 A;  3K7A B;  3S1M H;  5I5V A;  3PR5 B;  3SR1 A;  3U4Z A;  4A76 A;  4LF5 H;  3J7A V;  3M85 A;  3KLS A;  3PMF A;  3PIO A;  4LF6 L;  3HXL A;  4O7R A;  1CKN B;  1WTR A;  1RL2 A;  3OHX C;  2VS1 A;  3CCU A;  3U54 A;  3MWM A;  3MC0 B;  1JDE A;  2E8G A;  4XYL B;  4A3J B;  1SJH D;  1CA6 A;  3GTG B;  5LMN H;  4DV0 H;  1MSG A;  3PO2 H;  2R92 B;  4UP7 A;  2VY3 A;  1QZG A;  2PZW A;  1ENF A;  3U50 C;  1Y1V H;  1J9O A;  1O80 A;  1WTX A;  4DV6 Q;  2I07 B;  3GLK A;  2ZTE A;  5DGA A;  3CCQ A;  4BWS C;  2DAB A;  2W9A A;  1R9T H;  3ICE A;  1NR2 A;  5I6Y A;  1BCP F;  1QZH A;  3M9N B;  3PZP A;  3T5H A;  3R9R A;  3R93 A;  4CJ1 B;  5CE8 A;  1PRT C;  3BYY B;  5FJ8 G;  3QZ8 A;  5JUM A;  2K28 A;  2LKV A;  4HJ7 A;  3CCS A;  2E5L L;  3J7Y W;  1C4Q A;  4JI4 Q;  3NEN A;  4FU0 A;  2DNC A;  1SFO A;  3CAM A;  1MIU A;  2PYK A;  2JSO A;  1QVF A;  2VQF L;  2AUK A;  3L2P A;  3RFC A;  5KFT A;  4YWK A;  4CHI A;  5I47 A;  4JI8 L;  1OBD A;  2HDK A;  1AN7 A;  4DK0 A;  1H9M A;  3J7Z C;  3BZK A;  2R7Z G;  2A5H A;  2NZ1 D;  2I8C A;  4H13 C;  2R87 A;  4M0J A;  2K5D A;  4N9P A;  4RNN A;  1KTK A;  1M6V A;  3TRE A;  1TWC H;  3CCL A;  4LFC H;  1ONL A;  4FYD A;  1B6S A;  2PO4 A;  3I4N G;  3JAM L;  4QIW E;  4KN7 C;  5C5L A;  4OGQ C;  4R8I A;  3M4O B;  4IRD A;  4GNX C;  5C44 H;  5KEE A;  2F0Q A;  3ND9 A;  1IBM L;  3UYY A;  1DOL A;  1WTV A;  4FM9 A;  2NBF A;  4ED0 A;  3D0F A;  3VYR A;  1PFM A;  4DR5 L;  1T3N A;  4C2M A;  3V6K A;  1Y14 B;  5FR9 A;  2B2W A;  5I5T A;  1JJC B;  4QCL A;  1RIP A;  3N40 P;  2AQ3 B;  4JBW A;  2MHV A;  1KLU D;  2F0M A;  2I80 A;  1PTO F;  2KCN A;  1X9N A;  3KUP A;  5KYI A;  3J81 j;  2JA8 G;  1HRJ A;  2I0Q A;  4IAL A;  2IWH A;  2Y0S E;  5KG6 A;  2FFK B;  1CQJ B;  2HHH Q;  1HNW Q;  3S1R B;  5IT9 E;  1JWU D;  5M3F B;  1Y1W B;  1TWF A;  4QW9 A;  1XX8 A;  4LF6 Q;  1MBY A;  4A3E G;  1SYX B;  5KT7 A;  1STY A;  2NN6 G;  2WAQ E;  4F4W A;  3DM3 A;  1JLL B;  5IOC A;  4A4I A;  3HZX A;  1EOV A;  4YHH L;  1EIH A;  1TWH H;  5KFY A;  1SMY C;  2DNE A;  2ZM6 L;  4DV6 H;  4CDD C;  5KFE A;  2DAA A;  3RB3 A;  2WTF A;  1K8G A;  2CCZ A;  2DIK A;  3A8I E;  3KJP A;  2ALY B;  5FNV F;  4ULL A;  5C4J B;  1PH1 A;  3TEK A;  3BQ1 A;  1VMC A;  4ODG A;  1Q81 C;  4DL6 A;  3SE7 A;  4RAZ A;  2A1H A;  1GOZ A;  4XT3 B;  4R7R A;  2MP1 A;  4FDB A;  1R9T A;  5IGB A;  5KFL A;  2DY8 A;  3GIQ A;  1MHW C;  4JI4 H;  4KKT A;  2GQR A;  5KFC A;  4RNO A;  4J9L A;  1GUS A;  1FVI A;  1N48 A;  4YWM A;  2YS7 A;  2E5L Q;  3KFU A;  4O7Z A;  4G3I A;  2PMZ B;  1QVG A;  3N52 A;  5ELB A;  1HR0 L;  1J5E L;  2OCE A;  1HA5 A;  2VQF Q;  1YJ9 A;  3KRE A;  4JPB W;  2ZGI A;  1S5D D;  2NWG A;  2R7D A;  1P8L A;  4JI8 Q;  2I87 A;  4B3M L;  3AW8 A;  2Z9H A;  2VNU D;  3HO8 A;  1UC8 A;  4A3G B;  3H4B A;  5I5U A;  1JE5 A;  2B63 B;  2OLS A;  1RDP D;  1TWC A;  1WOC A;  2K32 A;  4B3S Q;  2F4V L;  1WD0 A;  2R8K A;  1KJ8 A;  5IYB G;  5D14 A;  5I4D A;  3H6M A;  5IOD A;  2WIN B;  3VA7 A;  2DGY A;  4ECX A;  1IBM Q;  4ZQ3 A;  3NK9 A;  2NN6 I;  3KLR A;  1Y8P B;  2B3G A;  1KAA A;  4AIM A;  4OEL B;  4EQP A;  2HUG A;  1PH9 A;  4OO1 G;  3BAA A;  4UCT A;  3T5L A;  3HOX H;  3I72 A;  3TIG A;  1BCP C;  4MTD A;  1PYB A;  1VQ4 A;  2OH2 A;  3U9T A;  4ECT A;  2KQ3 A;  1UNS A;  2JA6 G;  1PRT D;  4JI5 Q;  2HHH H;  3CSW A;  4DRF A;  2BE5 C;  1HNW H;  3F2D A;  4JG2 A;  1JT8 A;  4CHT B;  2E76 C;  2H5X A;  4JBK A;  1K73 C;  1Y8O B;  4LF6 H;  4UFZ A;  4ED7 A;  1SNQ A;  2NYZ D;  2JEA I;  1LYL A;  2B2W C;  2KUM A;  1B04 A;  2UVU A;  4FF2 A;  2DY7 A;  5IY0 A;  2L15 A;  2NU7 B;  3BVZ A;  1KDB A;  2COJ A;  2F03 A;  4RAY A;  4KKS A;  2QGQ A;  3I4M B;  1KJJ A;  4A3F B;  2XCA A;  3KHL A;  1AUX A;  5CV4 A;  4XDX A;  3K5H A;  5IP9 G;  1M7J A;  2EYL A;  1U4R A;  3TW7 A;  3KAL A;  4U6P A;  1B9N A;  4H7B A;  3HOY H;  2EPB A;  2E75 C;  5C8Y F;  5D1P A;  4CJ2 C;  3GTP B;  2ZM6 Q;  1TWH A;  2MPM A;  1HQM C;  3DXJ C;  3NUA A;  4TV9 F;  5E7N A;  2NVT H;  5FLX W;  5C4Z A;  2YZM A;  2HVR A;  3RBE A;  5AJ3 L;  4ECW A;  1T5X D;  2WB1 A;  4B9W A;  1ICF B;  3E6Z X;  1BNZ A;  2ES2 A;  1SCU B;  4QJF A;  3OMC A;  3VR5 A;  2R93 B;  3N44 B;  1O7I A;  3F2C A;  1EKP A;  3MXP A;  4DIM A;  3S1N H;  5KX5 F;  1GM5 A;  2E5L H;  5ELD A;  2YWV A;  3KF8 B;  5FO9 B;  1UE6 A;  1AZQ A;  4B3T L;  1PZJ D;  2FK1 A;  5IYC G;  2WV6 D;  5LL6 X;  4J9R A;  4AH6 A;  5FJ8 H;  1JMC A;  3JSL A;  2VQF H;  1SE3 A;  3DEO A;  1PTO C;  3T1Y L;  1TKW B;  4YR0 A;  2FHT A;  5T14 A;  4JI8 H;  3I4N B;  2P0A A;  3G4S A;  2WII B;  4DXF A;  4J1M A;  3CCV A;  3K81 C;  4ZHQ F;  1J5E Q;  5J1Z A;  5KS8 A;  3ER0 A;  4X66 Q;  3PUX A;  1EY8 A;  4GKJ Q;  1A48 A;  3H4D A;  2IHF A;  1K28 A;  4A3L G;  4LF8 L;  3NBZ B;  5LOV F;  2JP1 A;  1YHA A;  4B3S H;  2E2J H;  5KG0 A;  5DQG A;  1PZK D;  2J7Z A;  1SMY D;  5LL6 b;  1I2K A;  2FMA A;  1IBM H;  5CV8 A;  1JR0 D;  2B2V A;  2AWO A;  3KYH C;  4DU9 A;  2RBM A;  2K03 A;  2F4V Q;  4DKA C;  4DR5 H;  4ZCK A;  1X3P A;  1I6U A;  3RAX A;  4X3S A;  4Y7N H;  4QIW B;  3VPB A;  5EBD A;  4RG1 A;  4ILW A;  4BXX H;  3T9C A;  1ET6 A;  3D6W A;  4CMD A;  4IQZ A;  4FF1 A;  3EPI A;  1WCM B;  4HN2 A;  2NVQ B;  2GLT A;  5ELF A;  2EE1 A;  1H95 A;  2B63 A;  4MZ9 A;  4CKE A;  3UQ8 A;  3KHG A;  4R4O A;  1I2L A;  2D9U A;  3SK4 A;  5I9O A;  5E4X A;  2F0G A;  2K5N A;  4EBE A;  4MV8 A;  2FLN A;  4DV2 L;  1D2B A;  4CC5 A;  4A3I G;  1SSO A;  2KCC A;  3KDF A;  4CGY B;  4HIK A;  5J2U F;  1HTL D;  2Y0S B;  1T5E A;  1BUV T;  4A3M G;  3GID A;  4I55 F;  4NZN A;  3Q22 A;  1Y69 U;  2ZM6 H;  3GIM A;  2NN6 H;  3M4I A;  3UE0 A;  1SXT A;  3CU7 A;  1GSH A;  1I3Q B;  2HIX A;  3OUU A;