1FVIA

Crystal structure of chlorella virus dna ligase-adenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
264
Chain Sequence
AITKPLLAATLENIEDVQFPCLATPKIAGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of eukaryotic DNA ligase-adenylate illuminates the mechanism of nick sensing and strand joining.
pubmed doi rcsb
source organism Chlorella virus
molecule tags Ligase
molecule keywords CHLORELLA VIRUS DNA LIGASE-ADENYLATE
total genus 72
structure length 264
sequence length 292
ec nomenclature ec 6.5.1.-:
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fviA02
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1fviA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1fviA01
5LMNW 4A3JG 4P71A 2MFIA 2ATWA 1VQAA 2RHQB 2XTIA 5DLQE 4LF5L 2YYZA 1A8VA 2K14A 1SLJA 4YHHL 1V9PA 2HVQA 1HNXQ 1XTDA 1SFOH 4GKKL 1H95A 2V1CC 1KC8C 5FLMH 3PO3G 3S2HH 1BBWA 3PUVA 5GAEC 3RLOA 1PH9A 3D0FA 4A93H 1CSPA 4JI8Q 1EIYB 2K4KA 4O0AA 4BY7H 1J6QA 4DV7Q 2KHJA 4P72A 3IRBA 2Z6KC 3U58A 4DR7Q 1TXYA 4GLAC 4LF8Q 1HNXL 3GTQH 1YHAA 1K0RA 2RHSB 1JMCA 3ICEA 1HNWQ 4A3EH 4EFBA 3F2BA 4JI4Q 2I5LX 1X54A 4A3BG 1X3FA 1E1OA 1A0IA 1NY4A 4JI8L 4APVA 3T1YQ 1IL2A 3S1RH 3HOYG 3K80C 4X6AH 1K8GA 5JEAG 1G291 4MZ9A 4OO1G 2HVSA 1YNXA 4YCVA 2NVQH 3KLWA 3CCJA 2IX1A 4LF5Q 2LXKA 2NN6I 3K81C 4QQBX 1C9OA 1DGSA 4BY1H 1TWHH 3HKZE 3NELA 1KIXA 3JAMi 3GTLH 3NBYB 1A63A 1KAWA 5FJ8H 4B3MQ 3JSLA 4DV2Q 4DV5Q 3W1GA 5LMUQ 4EFEA 2ID0A 4JI0L 3HOVH 3H0GH 4GOPC 4JI7L 2XGTA 3M4PA 1WI5A 1TWCH 4POFA 3CCQA 2E8GA 4DV4L 3HOWG 1FL0A 3CPFA 1S3OA 1I94Q 3UDIA 1UE6A 1MJEA 2OWOA 3GD7A 1AE2A 4YCUA 1YBYA 1NE3A 4A3CG 3CCEA 1EIFA 4NPSA 5ELNA 3NENA 4DKAC 4GNXA 3T1YL 1VQPA 5FPRA 1N33L 4PG3A 2JA8G 3TY8A 4AH6A 1QVCA 3MXNB 5IP7G 4LWCA 1L0WA 1RL2A 3STBD 4AYBG 2ZJQA 1SMXA 4GN5A 1BBUA 3CMAA 4DV4Q 1PA6A 3PO3H 3QWUA 3I4NH 1XMQL 4GNXC 5IYDH 1XDNA 1PH5A 2E2HH 3MEFA 3WWVA 4DUYQ 4L5RC 3F2DA 3ULPA 3FKIG 4DR7L 2C35B 4LF7L 4LNQA 5M5YH 1EQRA 2HIXA 4YHHQ 2E2JH 1BVSA 4R4CA 3CAMA 4YY3L 3F2CA 3FHWA 3W1BA 1XNRL 3UDXA 4IJLA 5FLMG 1LM0A 4DUYL 3HOYH 3NBZB 1K83H 1TWFH 2EIFA 4KHZA 2R93G 1X55A 2L15A 4YCWA 4LH6A 1OTCA 2UUCQ 2UUAL 5BR8L 4A75A 1YI2A 2B29A 1PV4A 1EQQA 2HVRA 1IBLL 4LUVA 1PH4A 2CWAA 4IOCA 4EEQA 1X56A 2Z0SA 4UP8A 2B63H 2R7ZG 2VY3A 4KHPL 3M85A 1JJCB 1IZ6A 2GVAA 2WAQE 4QIWE 2R92G 3EIVA 2ZM6L 1XPOA 4OWTB 3HOUH 2WB1E 4GOPA 1VQMA 2IX0A 4GLVB 4DR2L 4A3KG 1HNZQ 1TWGH 2VW9A 1Q12A 3PF5A 4OXPA 2UXCL 3K7AH 4E6NA 4LFCQ 3PCOB 1VQ8A 2UUBQ 1PH7A 2PNHA 5GAHC 4B3TL 1CSQA 2K5VA 4IJHA 2QEXA 4IO9A 1KRTA 3PN1A 4NXNL 1E24A 1L1OA 3U4VA 1HZAA 1TAEA 3SGIA 1K8AC 1WCMH 3A5ZB 3G48A 4DV0Q 1N34L 2HHHL 1VQCA 2A1AA 2MQHA 3RNUA 1IYJB 4OWWB 1S72A 4DR6L 2CKZB 3JSNA 3TY5A 3M9BA 1IBMQ 4FDBA 3UDFA 1YIJA 2KBNA 1MIUA 2VQEQ 1Q86C 1V1QA 4QJFA 1N34Q 4MTNA 2VUGA 1IBKQ 4LF8L 4JC0A 1B70B 1I50H 4GKJQ 1JE5A 4IPDA 4XTCS 1KXLA 3PUYA 4L5TA 4CC5A 5IYDG 4B3ML 1P16A 2VQEL 3AQQA 5C0XI 1GO3E 2VQFL 4LF7Q 2Q2HA 1E3PA 2H5XA 1A62A 2YTYA 1I94L 4KHPQ 1X65A 3G71A 4BY7G 3D31A 3PUWA 1O7IA 4A3CH 4IOAA 2N49A 2D0PA 1LYLA 5IYBH 5GADC 4HJAA 4A76A 1PH6A 1M1KC 2CCZA 2ES2A 4WJ3M 2IT1A 4A3KH 1UE7A 2AWOA 1VQOA 2PQAB 5IYBG 3I2ZA 3GTOH 3HOVG 4JV5Q 4UP7A 1MJCA 1VQEA 2R7DA 1VQ6A 2JE6I 2F4VQ 4UCSA 4LFCL 2VUMH 2VZAA 3UE1A 3KJOA 5M3FG 4A3IH 2K5HA 4A3FG 5C4XG 2PI2A 4AYBE 3E9HA 4AIMA 4UFZA 4NXML 3ERSX 2BH8A 2CWPA 4IPHA 4BBRH 1XNQL 2LXJA 3NC0B 4JI2L 3S17H 4OWXB 2F4VL 3OTOQ 1NTGA 1Q7YC 1BKBA 5C44G 4O2DA 3CW2C 4C3JH 3TS0A 4LF9L 1IBML 4JI3Q 4DR4L 5ELOA 1VQNA 3ULLA 1SROA 3S24A 5BR8Q 5IYCG 4X65L 4DV6L 1X6OA 1JJGA 1N36L 1VQGA 4YWMA 1D7QA 1YZ6A 3J80c 1K73C 4OONA 2B63G 5JJIA 4HIOA 3PF4A 1XPRA 4BXXG 3UQ8A 1EYGA 2JJQA 4PMWA 1WOCA 3PO2H 1HH2P 2AHOB 2ZM6Q 4LF6Q 2R7ZH 3TY9A 4X65Q 4DV6Q 2BA1A 3GTJH 3RTXA 5EAYA 4UCTA 4C3HH 2VS1A 3TS2A 1VQKA 3KFUA 3CMEA 1QUQB 1XNQQ 5K36G 4R4TA 1YHBA 3CCSA 2BH2A 3VNNA 3HFZB 4BA1I 1HR0Q 1FGUA 1VQBA 4B3RL 1JT8A 4EX5A 3EN2A 1HR0W 1CKNB 2N78A 1OXTA 3HKZG 4UPAA 3CC2A 4A3MG 3J7A5 4LFBL 3LGJA 3RLFA 5D1OA 4DPGA 4P73A 4DV0L 2HHHQ 3KYHC 5D1OB 4R4OA 1HNWL 2ZTEA 3M4QA 5LMNL 2Q2TA 1PH8A 3ULJA 1SR3A 1CKMA 4A3GH 5GQOA 2A19A 4LH7A 1XMQQ 3M7NA 5IE8A 5IP7H 1B8AA 4A3FH 2YU9H 1KL9A 1QVFA 4KLKA 4JYAL 3S1NH 1N32L 3OTOL 4CC6A 1PH1A 2YV5A 4GS3A 2VL6A 2KCMA 4YWLA 4LFAQ 3G4SA 4DR1Q 2NVTH 2R7FA 1U0LA 2LSSA 3BZKA 1M90C 4X64L 4JBKA 3AFPA 1HR0L 4B3RQ 3CCVA 1VQHA 1VQDA 4JG2A 5M3FH 4A3IG 3CP0A 2WB1G 4JYAQ 2PMZE 2EQSA 2CQOA 1G6PA 1OXVA 1VQIA 2ASBA 5LMUL 2UUCL 1D8LA 1YHQA 2HQLA 4JI2Q 1GD7A 1IBLQ 1Q1EA 3G6EA 3TRZA 4OO1I 4R4QA 4GKJL 1KQSA 2OQKA 3UDGA 4BA2I 5HGQA 4JI5L 3E9IA 2AWNA 2HIVA 5H1SE 1R9TH 4X62L 5IWAQ 3PIOA 3H15A 4RMFA 3CQZH 1VQJA 4DV1Q 3H3VI 3S1MH 4IFDI 3DM3A 1E1TA 2K75A 1J5EL 2MO1A 2WFWA 3RLNA 1Q82C 1T9HA 4H02A 1UWVA 3CPWA 1NMFA 2JK8A 4QY7A 3GB8B 4JI5Q 4PZ7A 4BXXH 1KD1C 3FP9A 2VUMG 4MNOA 1ASZA 1WYDA 2K50A 3B6YA 5FPOA 4LF6L 1Y14B 2EXDA 2JA5G 5GAGC 5FJ8G 4RG1A 1Y1VG 3A5UA 3KF6A 1W3SA 4NXNQ 3BABA 2YTVA 4YWKA 3J81j 2Q2IA 3KF6B 5IP9H 5LMNQ 2JA7G 3CCMA 3TQYA 3AEVA 3GTGH 4DUZL 4DR3Q 4IFDG 4DAYB 2B3GA 4K0KQ 3T1HQ 3ER0A 4B3SQ 4R1JA 4YY3Q 2Z6KA 1I5FA 1XNRQ 4KI0A 3J80i 2Q2UA 1NMGA 1PVOA 1FJGQ 1PFSA 4DR6Q 4Y52H 4A93G 4BBRG 2D62A 2NZHA 2Y0SE 1SE8A 1FVIA 2JA9A 3CCLA 3I4OA 3K8AA 2NVXH 2JA8H 3AFQA 4JOIC 2AMCB 1MKHA 4JCVE 4UCUA 2I0QA 5C4XH 4JBWA 1E22A 1WJJA 4J15A 1B7YB 5C0XG 4A3EG 1JJ2A 1KHIA 1VQ7A 4A4IA 1L2FA 2ZJPA 3I7FA 3CCRA 2E2IH 3A74A 5M5XH 1YITA 2D0OA 4LF9Q 3GTMH 4WJ4A 4DRFA 1K9MC 4NB3A 3KJPA 4EQ5A 4HIMA 3VDYA 1XMOL 4DR2Q 2VQFQ 4IFDJ 2RCNA 1VCIA 2E5LQ 4HJ7A 1X9NA 1N32Q 3GO5A 1QVGA 4LFAL 3RN2A 1NBWA 1K3RA 1Z47A 4LF4Q 2VNUD 4A3LH 1VQFA 4X62Q 2KHIA 2GVBA 3PO2G 4JI1L 4HIKA 3HOXG 2ZJRA 3KF8B 3CD6A 3CC4A 1AH9A 3DLLA 3OW2A 1C7YA 1GM5A 3M4OH 2Y0SG 4BBSG 1GVPA 2I5HA 2ZTCA 5HY6A 3TEHB 3J81c 3F8TA 4HIDA 3L7ZC 1VQLA 3HOZH 1Y1WG 1S68A 1CUKA 2UU9L 5M3MH 2A8VA 4A3DH 3J81i 2HT1A 3BAAA 3CF5A 3BA8A 5C3EH 5IWAL 2AKWB 3I55A 3I4MG 4GN4B 4A3MH 1ASYA 3GTKH 3BZCA 2DGYA 2PQAA 5C3EG 4DR1L 3I4MH 3PUXA 3L0OA 3S16H 3CCUA 4DNIA 3GJXB 3STBC 1EUJA 5IP9G 4DR5L 2JA7H 1PH3A 4GNXB 1OXXK 4POGA 4IPCA 4ALPA 1EFWA 4JI3L 3NEMA 4LF4L 3GTPH 2MO0A 2RF4A 2WAQG 4DR4Q 4JI1Q 2CFMA 2QA4A 1PYSB 4DK6C 4JOIA 2PI2E 5E7NA 4DK3C 1NJIC 2ZTDA 3RZOH 4GKKQ 5C44H 4UCOA 3I4NG 1PYBA 2NVYH 1I6HH 4PZ8A 1VQ4A 2NZOA 3F1ZA 4PZ6A 1HZ9A 2GN5A 4K0KL 2IHEA 3S14H 1OXSC 1UE5A 1X3GA 5C0XJ 5AJ3L 2K52A 2IHFA 2DUDA 2UXBQ 1YJWA 4OX9L 5IYCH 4GLXA 4AQYL 3FKIH 3Q8DA 1I3QH 1YVCA 4X66Q 2UXCQ 3JC66 1HJPA 1XJVA 4JI4L 1CKOA 4JV5L 3K7UC 2BA0A 2F3IA 4L5QA 4TVAB 4JBMA 2UUBL 1QZHA 2OCEA 4LUZA 1W2BA 4HJ5A 4DR5Q 3PUZA 4R4IA 4BY1G 2JA6G 5JJLA 1LTLA 1HZBA 4JBJA 2JA6H 1Q8KA 5C4JH 1G51A 1YEZA 1AE3A 1N9WA 1PH2A 4A3GG 1QUQA 3T1HL 1TA8A 1VS0A 4JI6Q 1RIPA 3KOJA 3M3YH 3BJUA 4LW1A 5IT9c 3HOWH 3H3VH 1S40A 4GOPB 2JA5H 2R6GA 3S2DH 2UUAQ 2NN6G 3H0GG 3CC7A 1CKNA 2I5MX 4QGUA 1Y1VH 2N3SA 4DV3Q 4TQUS 3BA9A 4X66L 4UY8C 1IXRA 5FLXc 4Y7NH 2JEAI 4UCRA 4HJ9A 1HZCA 4DUZQ 4DR3L 4A3JH 4B3SL 1L1OB 2YTXA 3HKSA 1N33Q 3U50C 3E0EA 5JJKA 2UXDQ 4IPGA 3S15H 1XMOQ 3KDFA 1C0AA 1Q1BA 1XK5A 2E5LL 3S1QH 1QZGA 3KDFB 4DAMA 4QL5A 3L2PA 4P75A 5JEAJ 4A3BH 3TREA 3PGZA 1WFQA 2K5NA 4UCVA 4LUOA 1EOVA 3K0XA 4JI6L 4XIGS 1Q46A 1YJNA 2UXDL 5GROA 3A0JA 2JEBI 1B04A 3OYYA 5M5WH 4OX9Q 1KRSA 3GDEA 4LFBQ 4DV7L 4DV1L 3J7ZC 1VQ9A 1OXUA 1J5EQ 3W5OA 2FXQA 3BU2A 4L5SA 2OTLA 1X3EA 1UEBA 2QGQA 1EWIA 5M3MG 1P8LA 4C3IH 2UU9Q 1E7ZA 1UE1A 4C2MH 1JB7A 1VQ5A 4NXMQ 1XPUA 2R93H 5IY0A 4DV2L 4DV5L 3HOZG 1V43A 3HOUG 4JI0Q 1LUZA 4JI7Q 4GN3B 1YJ9A 3I56A 3PIPA 1IBKL 2UXBL 1PHJA 1N8RC 4AQYQ 2WP8J 3RN5A 3PSIA 5J3BA 4BBSH 1SRUA 5D1PA 1Q81C 4A3LG 2IY5B 3EBEA 2R92H 4X64Q 3HOXH 3NBHB 2MNAA 1U5KA 2JQOA 2KENA 1HNZL 4A3DG 3U4ZA 4ME3A 4HJ8A 2ALYB 3AYHB 1GKHA 3ZJYC 1N36Q 1FJGL 1WCMG 1TWAH 4UP9A 3RZDH 1L1OC 1SN8A 4DV3L 3JAMc 5DISC 2N8NA 3CXCA 1Y1WH 3RR5A 2F52A 4P74A 2OQ0A 3PV0A 3UE0A 2OTJA 4B3TQ 1Z9FA 5AJ3Q 2KCTA
chains in the Genus database with same CATH superfamily
1I2LA 1VQAA 3MAQA 2K32A 4O82A 4MTDA 4YHHL 1SLJA 1V9PA 1XTDA 2O4XA 1L0YB 2NBFA 4C5BA 2AGPA 2I46A 5J1ZA 4DIMA 1Y8OB 3RLOA 2FFKB 1PH9A 2W9BB 3GTQB 3TQ1A 4LFAH 2K4KA 4O0AA 1CTMA 2FPPB 1JICA 2Z6KC 2G9HD 5CV9A 3GTQH 1K0RA 1HNWQ 1BBXC 4UHVA 5C0XH 4A3EH 3WWJA 2I5LX 3ETHA 1X54A 5KFEA 4JI8L 2ENBA 1JWUD 4X6AH 1VF7A 1XTCD 2YZMA 1J5EH 3NQTA 2A73B 3VR2A 4HN2A 1SEIA 4K5VA 3LX0A 1G291 3HEJA 4Q5VA 3V2TA 4APMA 1PXUA 2FPGB 4ECSA 2PNRC 4JI5H 3KF8A 2ASJA 2NN6I 4QQBX 5C4XB 1C9OA 1LT3D 4OELB 1MSHA 3KHHA 1BNCA 1KIXA 3GTLH 4AQYH 1AP0A 2RA4A 4H7BA 5FJ8H 4B3MQ 1NSNS 4DV5Q 2GQSA 5FOBB 3OSPA 1B50A 3H0GH 4GOPC 2XGTA 4QWEA 3M4PA 3QIAA 1Y8PB 4DV4L 1EKPA 1GSOA 1KJIA 1WSCA 4FF4A 3UDIA 2CQYA 2K04A 1AE2A 4HAEA 3TW7A 4QWAA 4A3CG 4NPSA 3T1YL 4IR9A 2JA8G 5E3FA 4LF4H 1QVCA 1KLGD 1L0WA 4MAMA 1RL2A 4Q8FA 4AYBG 3H20A 1PA6A 1S4ZA 1X3PA 3HXLA 4IWYA 1S03G 1UNSA 3AMUA 4B3MH 1XDNA 2E2HH 3M9MB 2XRQD 2DNEA 3PMFA 3ULPA 3T9EA 1I1MA 2EDGA 4DR7L 2C35B 1LV9A 2M00A 4LNQA 5E25A 2ZXRA 4YHHQ 2V4RA 4C3JG 3F2CA 3W1BA 2B2WA 3UDXA 5FLMG 3NBZB 1ZHSA 4J9MA 3NTHA 1GXDC 1K83H 2R93G 2R6FA 4YCWA 3NTIA 2MGSA 3T16A 1YI2A 1EQQA 4A93B 2K6AA 1PK8A 2EVBA 3X3NA 2R85A 2Z0SA 2B63H 5EZYF 4R9WA 3T9DA 5L1IA 4QIWE 5M9OA 2ZM6L 4U7CA 2JYOA 3NBIA 2WB1E 1TWAA 1ZXTA 2IX0A 5KNDA 5A2QW 1A3UA 2A69D 5DM73 2VW9A 2K01A 3PF5A 3KREA 4TM5A 4E6NA 2WIIB 3FDSA 1H9SB 3PCOB 3RB6A 2PNHA 5I9OA 2SCUB 1KRTA 1E24A 1S0OA 2JEGA 3DAAA 2F0FA 1WCMH 3G48A 4F7XA 1N34L 3DTGA 3M9OB 4Q45A 3L9AX 1Z7TA 3RNUA 4O2BF 4ZQIA 2ZT9C 4TRDA 4R8IA 4FDBA 3UDFA 2X5RA 2NVQB 5JVDF 2NB0A 4RAZA 3U54A 4LF8L 5ELEA 3S1RB 1MD2D 5C4ZA 2DABA 2NVTB 3PUYA 1X32A 4B3ML 1TWCB 2WINB 4LAAA 3KHRA 3VMMA 1SCUB 3I73A 3A8KE 1KJJA 2FLPA 2QEJC 1LTRD 3D31A 2VB3X 2N49A 1UUPA 2D0PA 3MFHA 3TZUA 2ES2A 5L1KA 2IT1A 2AWOA 3D4DA 1VQOA 4NW2A 2V59A 1R4QB 1RYRA 1OO9B 4YP3A 1FNUA 2NN6H 3D3RA 4JV5Q 1MJCA 2KUMA 2R7DA 2IJ0A 1VQ6A 2V4DA 1BNZA 2R92B 1HNZH 1RTNA 3KJOA 3UE1A 1ML0D 3Q22A 4BBSB 3MXGA 4CHIA 5I5XA 2O2LD 5FLXW 1W93A 3GTOA 2B8FA 1F2ZA 1ILPA 4CBVA 2F0KA 5DGAA 4IPHA 3OHAA 3WWHA 3OTOQ 1NTGA 4FXDA 4QMGA 3HOYB 3K0YA 4L63B 4C3JH 3TS0A 4O7LA 5ELOA 5BMVF 1RDPD 2MPMA 3ULLA 4LF6H 4DV6L 4O3PA 4C5CA 1AZQA 4A2BA 1CHQD 2XGQA 5K3WA 4YWMA 3S2DB 2PBZA 3T9AA 2PPBC 1Z2OX 5BYBA 3PF4A 2JJQA 1EYCA 2YL2A 2ZM6Q 5CR5A 3IG0A 1CHPD 1RD9D 2BA1A 3GTJH 3RTXA 5EAYA 1JDBB 5EPLA 2VS1A 4E4TA 5IGCA 3BVZA 1S10A 2SNMA 1QUQB 2SDFA 4M8AA 1XNRH 2VXWA 3NGDA 2IBKA 3CCSA 4O3QA 3VNNA 5KG1A 1HR0Q 1VQBA 1SDFA 4EX5A 1L0XB 1HR0W 2L4NA 2Y4RA 3GLKA 2K33A 4MA0A 2N78A 1OXTA 1JC7A 3A7AB 4LFBL 2F0HA 2XVSA 3VPBA 3Q8RB 4N9TA 4RA8A 5D1OB 4JV2A 3WDNA 3N40P 2Q2TA 2J7ZA 3MFIA 3K3VA 1SR3A 4C3IB 1CKMA 4A3GH 1CE8A 1XMQQ 3M7NA 1VMPA 2F0DA 1E0BA 1LTBD 1KAAA 4RFBA 3GIJA 2UUAH 2KCMA 1CZWA 4DR1Q 4X62H 1HNWH 4CDFC 1U4PA 5DM63 3V05A 1I7LA 1Z6HA 5KFGA 4J9PA 2K5QA 4B3RQ 1OWTA 5DG9A 2JA7B 5M3FH 3V6JA 2ASLA 4MN3A 1SE3A 1YNJD 4J9NA 2WB1G 2PMZE 3TIIA 4EYHB 1OXVA 2QYZA 1VQIA 1RKNA 1KUTA 2W6QA 2HJWA 2HQLA 2JEFA 4RWSC 4PMBA 1Q1EA 4OO1I 2B2VA 2DWCA 2OQKA 3GV8B 2PCFB 1EQTA 2ASDA 2AWNA 2EYFA 4H13C 4P2CB 4X64H 2EY1A 3PIOA 4L6TB 3M4OB 3CQZH 1JE4A 3S1MH 4RB1A 5EOYA 3DM3A 1E1TA 2E5LH 2WFWA 4JV1A 4LK1C 1DOLA 3RLNA 5KT5A 4H02A 1NMFA 4QY7A 3TDQA 4BXXH 1KD1C 3FP9A 4MNOA 1WYDA 1SYDA 2K50A 4A3MB 1Q90A 5FPOA 4IURA 2JA5A 2JA5G 4NXNQ 4RNMA 3KF6A 4MV4A 2JA7G 2L1BA 3CCMA 4ED6A 2WB1B 4DUZL 3OOCA 4G4KA 3ER0A 4B3SQ 1G2TA 1PVOA 3J80i 1GUTA 2XCAA 2A6HC 5FKAC 1I4GA 5KFKA 1EKVA 1G2WA 2D62A 2NZHA 2Y0SE 2W7OA 3I4OA 2QDLA 4A2AA 1RHPA 2KECA 2FK1A 1NAPA 1M8AA 4WBNF 1J9OA 5LYJF 1S5DD 4C3IG 5IGBA 2W7PA 1DOKA 5C0XG 4A3EG 2GQRA 4I7HA 2F0VA 3I7FA 3CCRA 2E2IH 4NMZA 5M5XH 4WJ4A 4IWXA 1PRTB 1SMYD 2JXMB 2NU8B 2FLNA 3KJPA 1LACA 1EZ8A 5D8DA 4EBCA 1E2WA 1CZGA 3WOEA 3VDYA 2NWGA 1ZYRD 1STEA 2F0JA 3RF2A 1TT2A 4LF9H 2R7ZA 1Z47A 2W6OA 2VNUD 1VQFA 4X62Q 3J81E 2JA8B 4HIKA 1VKZA 1EYZA 5JQWA 2MP1A 2TMPA 2VQEH 2J6SA 3T53B 4DV2H 4O3OA 2IX3A 4XT1B 1C7YA 3FPUB 1QCBD 4ECYA 5HY6A 1V1PB 3J81c 4HIDA 4RH6A 3C2PA 5LOVF 1Y1WG 3RV4A 5FNVF 1S68A 3NWTA 4A3DH 4DV7H 2E2HA 3J81i 2EYLA 3BAAA 3CF5A 3GTKH 2H1EA 2DGYA 2NYZD 5C3EG 4DR1L 3QQMA 3RUZA 3EA6A 4DNIA 2R7KA 3GJXB 3STBC 2QDBA 5I5UA 1LABA 3WNZA 1OXXK 2Y0SA 1FR3A 1EFWA 4JI3L 4LF4L 4JI1Q 2AQ3B 4AYBA 2CFMA 2RGVA 2R82A 3V96A 4OIJA 1NJIC 4MV8A 4UCOA 3U0GA 3PW0A 4IR1A 4JI1H 1IHZA 3GTPA 3UI2A 5CV4A 4DK0A 4CGYB 3I4MB 2K52A 2F0MA 2DUDA 3P7JA 4AQYL 1PTOF 3Q8DA 1F2MA 3JC66 1HJPA 1NR4A 1TY0A 2AUKA 1XJVA 3RV3A 5C1PA 2BR0A 4KN7C 4DR6H 1STAA 1W2BA 3LWEA 4HJ5A 1WTPA 4R4IA 1B9NA 1I3QA 4DK1A 3GIDA 3OWFA 3WOFA 1I3QB 3C3LA 4O83A 1EKFA 2WAQB 2A69C 3T4AC 3TEKA 3MXUA 4K6NA 1RIPA 5IT9c 2CNVA 1RJQA 4IFDH 1S40A 2PMZA 2JA5H 1QOHA 2UUAQ 2XIGA 2I5MX 3DXJC 4O4LF 4X66L 3T9FA 1RJRA 5ELDA 4UCRA 4FFLA 4J0MA 1TS5A 3VR3A 2EJ3A 1KNAA 5JJKA 2UXDQ 1HXYD 4MV6A 3QG1A 1IBLH 3KDFA 1C0AA 2F0OA 3S9WA 1XK5A 3R5HA 3R2TA 5CE8A 3QOLA 2J4XA 5IODA 3S1QH 4DAMA 4OEMB 5JEAJ 2W6PA 4A3JB 4A3BH 3TREA 3PGZA 1WFQA 2K5NA 1EOVA 3K0XA 4XIGS 2I07B 2QILA 1I6HB 3T5LA 3OHXC 5KFAA 2MJ8A 2N55A 1U4RA 3L3OC 3JAME 1B04A 5KNBA 4K6LA 4OX9Q 1Z2PX 4DV7L 4DV1L 5E4WC 5KG0A 3PW5A 4L5SA 3NUAA 3OMGA 1UAPA 1UEBA 4Q4CA 4DL4A 2JEIA 1P8LA 1XPUA 1JB7A 1VQ5A 4NXMQ 5IY0A 4DV2L 5I60A 3EYYA 4Q4DA 3OSOA 4JI0Q 2WTFA 1YJ9A 3DWQA 5KFYA 4AQYQ 3RN5A 5A2QE 3D6CA 5DGHA 3BACA 5KT3A 1C30A 3NBHA 4A3LG 3EBEA 2R92H 4X64Q 5I47A 3HOXH 3RZOB 2TSSA 2MNAA 1H9RA 3H0GB 1IYVA 3HB9A 2LY7A 3IAYA 1FJGL 1N36Q 1PTOH 4OIKA 4UP9A 1TWFA 4RGTA 4DV3L 5DISC 2Z4IA 3RR5A 3C46A 4P74A 1S5CD 3PV0A 2OTJA 5I2YA 3BVMA 4UUGA 3RAQA 4DAYA 2I0QA 2KCTA 4B3RH 2FLLA 2KOLA 4G7ZC 4A3JG 1ESRA 2ATWA 3UYYA 2XTIA 4C1NK 1A8VA 2K14A 1EWHA 2L9HA 1HNXQ 5HGTA 3NP8A 1TS2A 2GPWA 5CV6A 3VPCA 4DV3H 3K5OA 4ZAIA 4DF7A 3UZBA 3SE0A 2KQ3A 1J6QA 2KHJA 4P72A 4I50F 3BQ1A 1TXYA 4GLAC 4LF8Q 1XXGA 1YHAA 2RHSB 4EFBA 1DXMA 1T94A 4JI4Q 4NZOA 1IL2A 1E1OA 4S3SA 1VMCA 4APVA 1AUXA 3K80C 4RB2C 1HA5A 2GPSA 1YNXA 2FB9A 3KLWA 3CCJA 1I1KA 2KCCA 3RGXA 2RDIA 1DOMA 1VBGA 4EBDA 1DV2A 1DGSA 3N6RA 3NQIA 3HKZE 4PV1C 3NELA 4OX9H 1A63A 4FS2A 1KAWA 4DR7H 5KYLA 4DV2Q 3JSLA 3KAKA 3W1GA 5LMUQ 4QWDA 4JI0L 1RTOA 4RKLA 3HOVH 3N8DA 1TS4A 3D4RA 2F0GA 5KT4A 3PW7A 3K5NA 3CCQA 2HUGA 2DIKA 2KVMA 2R7LA 1ONLA 3HOWG 3SK8A 2XSCA 3CPFA 4IZ8A 4X3UA 1CS0A 3ETJA 1O75A 4Q0YA 1T3NA 3AX6A 1YBYA 1QB5D 4R8NA 2AGQA 4GNXA 1N33L 4PDBA 5BPFA 3T13A 2NUCA 3NWSA 1EHIA 2ZJQA 1SMXA 5BWRA 2JSOA 3DEOA 4ECQA 3QWUA 3I4NH 1S0MA 3IN5A 5BPHA 4XZ3B 4XXEA 3WWVA 4DUYQ 4L5RC 3F2DA 2L11A 3GIMA 2PW5A 1GUNA 4KY6A 3J7AK 5G3LD 3E6ZX 2HIXA 3MVVA 2W8LA 2KHSA 1XNRL 3VYRA 1LM0A 3IFTA 1WR2A 2K28A 4KKSA 1TWFH 2ODTX 3GIPA 1X55A 5LL6b 1A6XA 3ORRA 2B29A 3MWEA 2FK3A 4JI8H 3JZIA 2HVRA 1KDCA 1PH4A 2CWAA 3SDZA 4IOCA 2B2WC 4H44C 1QE6A 4EG0A 4UP8A 4EVOA 5I5SA 4F4WA 2VY3A 4KHPL 2Q8IB 1ICFB 4M0JA 3A54A 2GVAA 1IZ6A 2WAQE 4ECTA 1GSHA 1STYA 3EIVA 1XYIA 4OWTB 1B53A 1MZBA 3HOUH 1UEAB 3U55A 1S97A 3M7GA 5EKKA 1TWGH 1Q12A 4J9SA 1IOVA 4EGJA 2Z8LA 3OSNA 5KFFA 2QKIC 4LFCQ 1U4LA 1HCZA 5GAHC 4IJHA 2K5VA 4IO9A 2CH4A 4PNYA 2QEXA 3GV7B 4J9QA 2K05A 3KAJA 1HZAA 2F0NA 5EBCA 3SGIA 4O86A 1NUCA 1K8AC 5IGFA 2PYKA 4C56C 1LTAD 4KTAA 5D65A 2PVPA 3MA2B 4OWWB 4OHJA 2XD4A 3TY5A 5T14A 3BYTB 1WTRA 1IBMQ 3EPGA 4RGOS 2EYOA 4X3TA 2KBNA 2EIYA 4FE2A 1MIUA 3R9RA 2FMMA 4ETSA 1V1QA 5JVG3 1N36H 1IBKQ 3RJ0A 2D9UA 4JC0A 4QUCA 1A0GA 4KY7A 3TIGA 4ECXA 5IT9E 1JE5A 2EY6A 4CC5A 4DL7A 2IP4A 2KJXA 5IYDG 2CW8A 3V6KA 2VQEL 5TSSA 1I4PA 2O03A 1E3PA 4ED7A 2YTYA 1B6RA 1DIKA 3G71A 4BY7G 2R93B 4NXMH 1O7IA 5IGEA 1GGOA 5KFDA 5CGKA 3CRKC 4IAJA 3AU7A 4HJAA 4A76A 2W6NA 1K1SA 1EYDA 1BCPF 3H0GA 5IYBG 1M6VA 3HOVG 4HCEA 4TUYF 5C3XA 5FO9B 2VUMH 1F9SA 4A3IH 2J0TD 2K5HA 3NHHA 4KK7A 1GUOA 4AYBE 4AIMA 4M9UA 1IYUA 2EXZA 3H6MA 2OEOA 1M0TA 2LS01 2BH8A 1PTOC 2EY2A 3NC0B 4I65A 3S17H 2F4VL 2PZTA 4ZOLF 4IUUA 2YW2A 5M3FB 1K8OA 4MV1A 4RKBA 3S2HB 3RAXA 5C44G 2WYOA 3HS0C 1EY0A 4O2DA 4OGQC 4ABNA 3LMLA 1WRVA 4ED0A 1D1IA 3LWUA 1VQNA 2W9BA 4X65L 1X6OA 4KMUC 3J80L 3GTMB 2FP4B 1HNXH 4LSAA 2CQAA 4OONA 2ABJA 4HIOA 3LQSA 3A8JE 1EYGA 3QZ8A 1WOCA 1HH2P 2AHOB 1ENFA 4LF6Q 2OXPA 3U9SA 4YR0A 2CNQA 3TS2A 1VQKA 2WAQA 2HQEA 1LT5D 2FINB 5K36G 2YS6A 4TV9F 2JN4A 1O80A 2KCNA 2PMZB 1JQYD 5DMXA 4QWCA 2XRSD 5CR3A 3J7A5 1NCVA 1TWGA 4K0KH 3KYHC 4Q8EA 4WRDA 1T5EA 1HNWL 1KC7A 1AN7A 2ZTEA 3H09A 3M4QA 5LMNL 3CRLC 4O3RA 2K7VA 1FNWA 1STGA 1SMYC 1JWMD 2IMWP 1B8AA 2RDGA 2OT2A 3T1YH 4JYAL 5H80A 1A3TA 5KFVA 3OTOL 4CC6A 1EY5A 4MTKA 1H9JA 1TIID 4GS3A 1PH1A 1E4EA 2NVTH 2LSSA 1BR9A 1M90C 2AQ4A 1H9MA 4A3BB 3AFPA 1BXRA 1HR0L 4DNRB 3CCVA 2WDTA 4FYDA 2G5DA 3CP0A 2JA7A 1G6PA 3BDOA 1M7JA 1ZETA 2ASBA 4JI4H 5C3EB 2UUCL 1D8LA 1SE4A 1H9KA 1YHQA 3BJYA 1C8CA 4ULLA 1IBLQ 2F3WA 3OMCA 4GKJL 5EKIA 3UDGA 5AFWA 4ID6A 3E9IA 5DEHA 4JI5L 5I2XA 5KG3A 1B33N 3H15A 5IWAQ 4CDEC 3H3VI 4O7NA 2W9CA 1J5EL 3DTFA 5KG5A 3BQ2A 3PVXA 4WJWA 2EJMA 1UWVA 3D4WA 4F4XA 3GB8B 1W96A 3VR6A 2VUMG 4L1KA 5JH7F 4DR3H 2NTTA 3RB4A 2NVYB 4LF6L 3JAML 4TQRA 3A5UA 2RSNA 2EYPA 4HR7A 2YTVA 4YWKA 2VUMA 4K6DA 2NUAB 5KFWA 3AEVA 2VOBA 2VUMB 5L9XA 2B3GA 4YHHH 4BY7H 1NMGA 2EYHA 4DR6Q 4Y52H 2YZGA 3OIPA 5E4XA 4BBRG 5CAEB 2PZUA 4YJ3F 5KFTA 3K8AA 2JA8H 4ED2A 2RDHA 4JCVE 4UCUA 3BG3A 2BCOA 2LKVA 2CVRA 1B3QA 1E22A 1QWYA 4J15A 4JBWA 3VYUA 5C4XH 1JJ2A 1AW7A 1KHIA 4A4IA 1VQ7A 1ZHQA 3GIIA 1L2FA 3RB3A 1PDQA 4EQOA 3A74A 4YIJA 2QW7A 2Z4HA 4DRFA 2VR1A 1S5FD 4PBCA 3GP7A 3KUPA 2XC9A 1TS3A 1GSAA 2VQFQ 2YYAA 3URYA 1SE2A 3KXYT 3GTLB 4A3GB 1LTSD 3TZDA 3SEBA 4X3SA 2KHIA 3NE5B 3LULA 2HD3A 4RCNA 1KJQA 3KLRA 3KF8B 4ZKCB 1AH9A 1PRTC 3DLLA 1EUDB 4DV5H 3V6HA 1OBGA 4J9OA 2Y0SG 1GVPA 5JVH3 4RHSA 5IGDA 5FO8B 3P20A 3L7ZC 3CVZA 4LF8H 4JW0A 2QF7A 4DGZA 2E2HB 1EL0A 3T7AA 2UVRA 3J7AF 2UVVA 3I55A 5IWAL 3I4MG 1FD7D 4H0LC 2PQAA 3V4ZA 2OLSA 3I4MH 3S16H 3L0OA 5T1GA 3R93A 1CA5A 2SNSA 2JA7H 4DR5L 4O7RA 1KDAA 4GNXB 1TR5A 4NZMA 4FS1A 3MXNA 5C5LA 4ALPA 3FVQA 3GTPH 4DR4Q 5COYA 2RF4A 2ZGIA 4XT3B 3S1MB 2RDFA 1IKLA 2PI2E 3K59A 4AYBB 4ZQ3A 3GTPB 1I6HH 2B63B 1VQ4A 4DLKA 2B2TA 1HZ9A 2B63A 4MV9A 1HHVA 4DV0H 2ATLA 1X3GA 3G6XA 4EEYA 4IUPA 4FFPA 2CW7A 4MA5A 2D5DA 1YJWA 5FD5A 4EQPA 3FKIH 1I3QH 3NXWA 2UXCQ 1EEID 4JI4L 1HUMA 3KLSA 4JV5L 2F0SA 2F3IA 4UAIA 5IT9W 1WD0A 2UUBL 1QZHA 2OCEA 4LMQD 4CDDC 2C22A 4FU0A 1V8QA 3PUZA 4BY1G 2JA6G 4ZHQF 1LTGD 4C5AA 5HURA 4JBJA 2JA6H 3JRXA 4RZQA 4CKCA 1G91A 5I5YA 2JP1A 1G8ZD 1G51A 1YEZA 1AE3A 4OO1H 4QCLA 3WO1A 1JX4A 1RYSA 4JYAH 1PFNA 1TA8A 3PO2B 4YR2A 3EPIA 4LW1A 2C9OA 5EPKA 3F2UA 2X6GA 3HOWH 2DZDA 2N88A 1CKNA 5I5TA 2M05A 4QGUA 4O4HF 2QK4A 1E4FT 4KJOA 2HCIA 3TN2A 3A56A 5FLXc 3MZ5A 4HJ9A 2C2EA 4YQWA 4A3JH 3RBDA 4M7EA 3BZDB 1N33Q 2YTXA 3HKSA 2J9GA 3U50C 2HCCA 3E0EA 1CA6A 4TKOB 3I3CA 3S15H 2OF1A 2RVLA 4K8JA 3LP8A 1QZGA 2YZNA 3M3YB 2W57A 3M4YA 4P75A 1HFNA 5BWXA 1RK6A 3ORQA 1BCPD 3A0JA 4MTEA 2KSWA 4JV5H 1I4HA 4LFBQ 2YU9B 3J7ZC 1VQ9A 1OXUA 5LMUH 4DL6A 3O13A 4LF7H 3D6WA 2Z02A 4X65H 2DJFC 2OTLA 3TP5A 5M3MG 4ZI7F 1E7ZA 1UE1A 2R93H 5KT2A 1IBKH 2V9WA 5KFMA 3TMEA 3L4JA 1JCKB 2R7NA 2FJ2A 4GN3B 3PIPA 4DA2A 5I4DA 4BWSC 1WTQA 3GV6A 4K14A 4O3NA 3K5MA 2R93A 2IPKD 4BBSH 2C5CA 5HV6A 3OUZA 4O4JF 2IY5B 4C3JB 1SYGA 2WKDA 1U5KA 2WV6D 2JQOA 2KENA 3ND8A 1A9XA 3U4ZA 1E2ZA 4HJ8A 1SBBB 3AYHB 1GKHA 3ZJYC 5JPMC 2WACA 1MHWC 1TWAH 1WCMG 1K83A 1L1OC 2R92A 2N8NA 3CXCA 1ZYRC 1K83B 2F52A 4NP5A 3UE0A 3UZOA 2E2DC 4ED8A 4A3IB 1Z9FA 1JORA 2V58A 3CQZA 5LMNW 1SFOB 1VAJA 2MFIA 4G7HC 5ELFA 1O78A 4B3TH 5DLQE 4LF5L 3NUCA 4L8JA 3QZ7A 2HVQA 3I70A 3NTKA 4QIWB 3H91A 1SFOH 4GKKL 1H95A 3HT5A 2YRWA 3PO3G 3FEWX 4O42A 3S2HH 1BBWA 3PUVA 5LA6F 5KFHA 5DG7A 3IFDA 2EOTA 3GTQA 4A93H 3D0FA 1CSPA 4JI8Q 3SR1A 1T5XD 3W3AA 4DV7Q 4Y8VB 3IRBA 1F2YA 1JMCA 2L5TA 3ICEA 4B08A 1WTVA 1JDEA 3DWAA 1EY9A 1JKJB 1PZKD 3CKIB 4A3BG 3RFCA 3VOTA 1A0IA 3G6VA 2F0TA 2B8GA 4MZ9A 4OO1G 2HVSA 4O7VA 3GQBA 4YCVA 2R87A 4FGRA 1SXTA 4ZLTF 3GV5B 2ZDHA 3V4SA 1PRTD 1OBDA 2E2IA 3NBYB 3JAMi 1DM0B 5CBAE 3I4LA 1TWGB 3SK4A 3PIO3 3K5HA 4J9RA 4EFEA 4KKTA 1SYFA 4KY5A 3FMCA 1CQJB 4HNTA 1W6KA 1WTXA 1TWCH 2C28A 2E8GA 3VYTA 1I94Q 2RBMA 3BYYB 3GV3A 5HBRB 1Q3LA 2OWOA 4YCUA 4XQQA 3I4NB 4DNTB 1NE3A 2L12A 4FXKC 5ELBA 5ELNA 3CCEA 3NENA 4HMIA 5FPRA 4KHPH 1PFMA 3PO3B 4CHTB 1I94H 4LWCA 4B3SH 3STBD 1QNUA 2PZWA 4J9KA 3P75A 2A6ED 4GN5A 3CMAA 2XWBB 4DV4Q 2F4IA 3PO3H 5CA1F 3GQCA 3R2IA 3WO0A 2XIWA 4QB4A 4GNXC 1W6JA 3ND9A 1XMQL 5IYDH 4JI7H 3MR3A 1RCVD 1HTLD 2DY7A 4V0BA 4XYMB 2VB2X 3FKIG 4LF7L 5KFJA 4XX0B 2UUCH 1F9QA 5FR9A 1LLRD 2E2JH 3T1HH 4R4CA 2DLNA 4YY3L 3FHWA 4IJLA 2X0SA 2EIFA 4LH6A 2L15A 3KK7A 5KFZA 1OTCA 3GTJA 3BS1A 2BQUA 3T56B 3HOUB 2COIA 1PV4A 4Q44A 1AFPA 4EEQA 1X56A 1KJ9A 1I2KA 1AZPA 3P1HA 4N8X1 2R7ZG 5JVLA 4MHEA 1XMOH 3M85A 5HNEA 5T1IA 2ICIA 1JOQA 1XPOA 5BN4A 3TW6A 1D5ZC 1HNZQ 3VA7A 1VQMA 4GLVB 4DR2L 1PFBA 2FHTA 4A3KG 2RSOA 2F3VA 1K0SA 4FF3A 2H4OA 3HZXA 3NPPA 1YNNC 2R84A 4ZK9B 2XN9C 2CW0D 4ZKBB 4FFRA 3MFYA 1I1LA 4NXNL 3U4VA 1L1OA 1M4VA 2IWHA 3JRWA 4F4YA 1I4RA 2HHHL 3L4KA 5LL6S 1FNVA 1VQCA 1F2LA 3TBIB 3TP6A 1S72A 3BDLA 2M9VA 2BE5D 2OH2A 4U68A 3GTKB 4QJFA 4F88A 5G3LF 4MTNA 1N34Q 2A1HA 2PN1A 2VUGA 4JV0A 3RIZA 2UVUA 2YU9A 3GTLA 3J7YW 1HQMC 1I50H 4GKJQ 3IKJA 1RJPA 4CJ2C 5C5MA 4IPDA 2NZ1D 4XTCS 4A3DB 2IL8A 2F0EA 4L5TA 2VQFH 1P16A 1CQFA 1TWCA 2NU9B 1GO3E 1BF4A 4LF7Q 2CH4W 1NNXA 2R8GA 4LMYA 2H5XA 5KEEA 1I94L 4KHPQ 1X65A 4HYKA 3PUWA 1TU2B 1LYLA 3EVQA 1JB3A 2V4QA 1M1KC 1EU3A 4WJ3M 4A3KH 2UXDH 2M2LA 3I2ZA 5C6AA 1VQEA 2I8CA 3FPPA 2JE6I 4UCSA 4LFCL 1JLLB 5JJZA 2VZAA 2Y0SB 2PW7A 5C4XG 3RGZA 4NXML 4K8IA 1TVXA 2E74C 2G9DA 1EZ1A 2DPJA 2CWPA 4CKEA 5IYZF 2Z04A 1XNQL 2LXJA 4JI2L 1IW7D 3OIQA 4OWXB 1KTAA 3GTGB 5KFNA 5DQIA 1IBML 4JI3Q 1CI3M 2BQ3A 3GTGA 2IA6A 1SROA 3S24A 4DAPA 3TP7A 2B2UA 4HNUA 5NUCA 2FMCA 1M0WA 1N36L 1Y8NB 3RMHA 1D7QA 2VPQA 3J80c 1K73C 4EGQA 1EY6A 1HQRD 4K2KA 4RGMA 5J22A 1SNPA 1XPRA 4RB3C 4CJ0B 2F0WA 4OL7A 4TVIA 3PO2H 2HDMA 3TY9A 2R7ZH 5BR8H 4BBRB 4DV6Q 1WD1A 4C3HH 1AN8A 3K6OA 3KFUA 3Q1KA 4HTHA 4C3HG 3CMEA 1YHBA 2BH2A 1U4MA 5KYIA 3HFZB 1FGUA 4NLGA 3MEHA 1WCMB 4XYLB 2XWJB 1WCMA 3HKZG 2HDLA 3CC2A 4X66H 1EIHA 3H94A 3J80W 3LGJA 3RLFA 5D1OA 2HHHQ 2I80A 1PZJD 3S15B 5GONF 1EEFD 4FO2A 4ECRA 3CU7A 5GQOA 4JI2H 2B2YC 4KD4A 1LO5D 5IE8A 2A68D 4A3FH 3I8ZA 2K1BA 1KL9A 1QVFA 1AUVA 4R7RA 5C1OA 1VF5C 3C1FA 1N32L 2YV5A 3G4SA 2VL6A 4A3FB 1RK5A 2EZVA 4FNFA 2F0QA 3HP3A 4DU9A 4RNNA 5J2UF 3BVGA 5KX5F 2PO4A 3TQTA 1VQDA 4JG2A 4A3IG 1QILA 1YNJC 4RB0A 2EQSA 2K5DA 2R8JA 1KEEA 5LMUL 3TINA 1EIGA 2B2UC 5DQGA 3H4BA 4YJ2F 4JI2Q 1GD7A 1VDZA 3GIKA 3TRZA 1S5ED 1V1OA 2VPSA 5IIFA 1HR0H 2HIVA 5H1SE 1R9TH 3SVMA 5E1FA 2K5WA 1U9RA 4J8QA 1VQJA 4DV1Q 4IFDI 3J81W 2K75A 4ZYSA 4GC7A 5ELCA 1EQVA 1S9FA 1Q82C 3ZYYX 4O7ZA 3CPWA 3Q24A 1N33H 2JK8A 1LTTD 3VR5A 4HSPA 1ASZA 3U9TA 5KFIA 5LMNH 2EXDA 1STBA 3N52A 4RG1A 1W3SA 5KFPA 3G7LA 4JI0H 3MR2A 5I6YA 5LMNQ 3TQYA 1GJXA 3T9BA 4RUAA 3C1EA 2HGXA 2EE1A 4IFDG 1JJGA 3PW4A 2HHHH 4FF1A 4R1JA 1XNRQ 2Z6KA 2HGWA 4KI0A 1H9SA 4DL2A 4QF4A 1FJGQ 4ME6A 1PFSA 4NXNH 4A93G 3S17B 5KS8A 4NDXA 3I90A 5I9PA 2JA9A 1PLFA 3CCLA 1MKHA 1WTOA 4I7ZC 1E4GT 1B7YB 4B9XA 5BWWA 4ZUJA 4Y7NB 4CDCC 2ZJPA 4DR2H 4CKBA 1YITA 4LF9Q 3GTMH 2D0OA 3R5XA 3Q8SB 4F87A 1IYEA 1K9MC 4NB3A 1RF2D 2BOSA 3Q23A 3ONAB 1XMOL 2W70A 5L1LA 2RCNA 1JOOA 1X9NA 1N32Q 1PYWD 5DGBA 3RN2A 4FBTA 4C2MB 1FYCA 1NBWA 3E0JA 5JPNC 3S1QB 4C2MA 1DYQA 2GVBA 3FRPB 3PO2G 2NVXB 3VYSA 4TV8F 4ECUA 3CC4A 5KGUA 3Q8QB 4J9LA 5CA0F 4HQ6A 2I5HA 2ZTCA 3TEHB 3QB3A 1BUVT 3HOZH 4XQJA 4FFNA 4Q43A 1CUKA 1STNA 5M3MH 2UU9L 2A8VA 3OUUA 4QUFA 3BA8A 5KFSA 5C3EH 2AKWB 3SHLA 4GZYC 5K36H 2Z9HA 2Q7DA 2WE6A 5IWAH 5L1JA 3PUXA 2A6EC 1EUJA 4ILWA 5IP9G 1PH3A 4O7SA 1O7LA 1JXLA 1Y1WB 4DL3A 2VA2A 5F9NA 2XCPA 4FBUA 3HO8A 2MO0A 4IUNA 1CT1D 3VPDA 2F0LA 3GTOB 2MHVA 2QA4A 3PW2A 2BDNA 3X3MA 4JOIA 2FMAA 5E7NA 3HOXB 3RZOH 4GKKQ 4JXUA 5KT7A 1LTID 4JUZA 2UXCH 4O7TA 4B9WA 2GN5A 4HMJA 3BQ0A 2IHEA 3S14H 3DF7A 1OXSC 5CMDA 1Z2NX 5C0XJ 2NU7B 5AJ3L 4ECWA 3Q0AA 2IHFA 1KJ8A 5IYCH 3DEPA 2BA0A 4L5QA 4LJZC 3Q8PB 4CMFA 4TQSA 3MXPA 4LUZA 3KHLA 3Q6SA 4DR5Q 5M5YB 5KG4A 2ICEC 5KNCA 1LTLA 4DUYH 1N9WA 2DNCA 5I5WA 2EJFC 4JI6Q 1TWHB 2KA7A 4RUCA 4V190 3M3YH 3BJUA 1BDOA 1EU4A 1ET9A 3H3VH 1TWAB 2NN6G 3MFGA 5C4JB 3CC7A 4TSSA 4IIJF 2B39A 4IRKA 2N3SA 3K58A 3SK6A 4TQUS 4BY7B 4LFBH 5LXTF 1FGBD 4UY8C 3GIQA 1IXRA 1R4PB 2JEAI 2RDJA 1K8MA 4IRDA 1S5BD 3QR8A 1HZCA 1EY4A 4DR3L 1EZ6A 4ED3A 2A68C 1GYFA 1L1OB 1HTPA 2YZLA 1XMOQ 1Q1BA 5KKNB 1DJRD 2ZDQA 1D5MC 1GLVA 5C5JA 4DQNA 4QL5A 3L2PA 3MR6A 4O1NA 1E4EB 4RNOA 4UCVA 4I4TF 3QJYA 4LUOA 3CEBA 1YJNA 3RUPA 2UXDL 5GROA 1FKAH 1Y1VB 2JEBI 3S1NB 5M5WH 1PZID 3GDEA 2UU9H 2SEBD 4A3KB 3FDTA 3W5OA 2FXQA 4DV6H 5EKLA 1X3EA 3F8NA 2EJ2A 1I50B 2QGQA 1EWIA 2UU9Q 4C3IH 2VA3A 1F9RA 4C2MH 4UFZA 3HOZG 3HOUG 2RCFA 3HBLA 1ZAUA 3RB0A 1WTWA 4IQZA 4JI7Q 3OTOH 1IBKL 1N8RC 2WP8J 5IGGA 5D1PA 3KHGA 1SRUA 3K5LA 4JI3H 1DONA 1Q81C 1UC9A 3HOZB 4UDUC 1KT8A 3EQLC 5DAUA 1HRJA 2KEEA 4A3DG 1HNZL 5CM0A 3J80E 4ME3A 1SJHD 2NVYA 2YCHA 1UC8A 3MC0B 5D3IB 3RZDH 1RJTA 1SEBD 3JAMc 1ILQA 4BWGB 1TWFB 2P0AA 4YR3A 1SAPA 2E76C 1SFOA 2AUJD 5AJ3Q 4BS9A 4R8UA 1F77A 4P71A 2JA6B 2RHQB 1EY8A 3CQZB 5I5VA 1BJTA 1ET6A 2YYZA 4XYOA 4JPBW 2V1CC 4J6HA 4IRCA 1KC8C 5FLMH 3G8DA 5GAEC 2L0CA 2R61A 5FLXE 5K5PA 1EIYB 4YB8B 3FKIB 1L2ZA 4KKUA 2RKSA 3FKIA 3U58A 3DMUA 4DR7Q 4DAAA 1HNXL 4NYEA 4E6IA 3F2BA 2F0IA 1B6SA 1KBLA 2I87A 4PWQA 1X3FA 1S0NA 1NY4A 2DJGC 3T1YQ 4ECZA 4ZCKA 3I91A 3S1RH 3HOYG 1HA6A 1K8GA 5JEAG 4G3IA 2HGSA 2F4VH 1MBYA 1Y69U 4C3HB 2NVXA 2Z1CA 1SYEA 2NVQH 3N44B 2IX1A 3KALA 2FKLA 4LF5Q 2LXKA 4RZRA 2UUBH 3HOWB 3K81C 5JOBA 5C8YF 5BWTA 2W9AA 4BY1H 1TWHH 3EJIA 4DXFA 4PMCA 2ID0A 4O7WA 4JI7L 5FK9C 1B1ZA 1WI5A 1KDBA 4Q0FA 4POFA 1FL0A 2ZM6H 3MR5A 1S3OA 1CQVA 1UE6A 1MJEA 1N32H 3GD7A 4XDXA 4EYIB 1EIFA 4DKAC 1D6EC 2B2VC 1VQPA 5DAAA 4LSXA 4PG3A 3TY8A 1SYBA 4AH6A 3MXNB 5IP7G 4YBZB 2YRXA 2C2RA 3R3OA 2W6ZA 5BN5A 1BBUA 2AQ2B 2P5ZX 3S14B 1JR0D 2R8HA 3VR4A 4IZOA 3OPOA 1PH5A 5CC4A 3MEFA 1SNDA 4CJ1B 1Q8IA 1WTHA 1V51A 4FXGC 2DPIA 1ENAA 3AB9A 4HCSA 1LT6D 3A8IE 1ET0A 5EQ0A 5M5YH 1EQRA 1IW7C 1BVSA 2Q8TA 1C4QA 1B9MA 3DUZA 3CAMA 1ENCA 1SNCA 3HOYH 4A3EB 4DUYL 5KFLA 4FM9A 1QG7A 4KHZA 2W9CB 1F9PA 1EUCB 5A2QL 2UUCQ 3I72A 5BR8L 4DXGA 4A75A 2UUAL 2B2TC 4O7YA 4RAUC 1IBLL 4LUVA 1G6ZA 5BYAA 1K1QA 3G8CA 5DG8A 1LT4D 1JJCB 2R92G 5IT9L 2EYMA 3UFXB 1MI2A 4HR7B 3PR5B 4GOPA 4HEDA 3K5IA 2FPIB 2HDKA 1EWCA 4OXPA 2UXCL 3K7AH 1STHA 4GKKH 5KFBA 4MV7A 1VQ8A 4QSHA 5FLXL 2UUBQ 4I7AA 1PH7A 4LF5H 4B3TL 1CSQA 3HRZC 3PN1A 1PRTF 4WD3A 2EJ0A 1TAEA 5CB4F 2SOBA 3EFXD 4IALA 3A5ZB 4DV0Q 1J8IA 2A1AA 2RGRA 2MQHA 3HG9A 2C2DA 1IYJB 1EYAA 3G6JB 4N8FA 1KLUD 4DR6L 2CKZB 2BDOA 3H3VC 3JSNA 3M9BA 2WKCA 3E5NA 5FD6A 1SNMA 1YIJA 3QWNA 2NU6B 2VQEQ 1Q86C 2QB5A 1Y1VA 4F4ZA 2A5HA 4NZNA 1BXTA 3GTKA 1B70B 2DY8A 1D5XC 3EROA 3J7AV 5I6WA 1I7NA 4O84A 1KXLA 4J1MA 2EPBA 1N48A 2CW0C 3IL8A 3AQQA 5C0XI 5JEAH 1V4YA 2VQFL 2Z6BA 2FK2A 2Q2HA 1A62A 1BCPB 4F8MA 3N43B 3DWPA 2YWVA 4A3CH 4BY1B 4RHRA 4IOAA 1PH6A 5IYBH 5GADC 4YAJB 2CCZA 3N41B 1UE7A 5EBDA 2PQAB 1AEXA 1JIHA 2A74C 2J6TA 2XNAC 3GTOH 4UP7A 2ZDGA 2F4VQ 3GILA 2HG8A 5M3FG 1TY2A 1I4XA 3T9CA 4A3FG 2PI2A 1WVLA 2B2YA 3E9HA 3ERSX 5DGIA 4QWBA 3RBEA 2AU0A 4MV3A 5KFCA 4BBRH 3Q2OA 2JA6A 4K5XA 4FFMA 1T36A 5CV7A 2R86A 1PX2A 4FP5D 1Q7YC 1BKBA 1A2UA 4HSVA 4G57A 1SNOA 3CW2C 5EWEA 4LF9L 4DR4L 1HFGA 5BR8Q 5KFQA 3T5HA 5IYCG 3GTMA 2GLTA 5M5XB 1VQGA 5KFXA 1K3BC 5DNFA 2X6LA 1YZ6A 1ESFA 2DAAA 2B63G 5JJIA 2LMCB 2XGPA 4BXXG 3UQ8A 3W2DA 2HHFB 4PMWA 2IW3A 5JAVA 3LWBA 4JI6H 2HHFA 4X65Q 3MJFA 4U673 5F2DA 3MHBA 2F03A 1ULZA 4UCTA 4U6PA 3H4DA 2RQXA 3RD4A 3DM1A 1XNQQ 1BGWA 4R4TA 4YY3H 4KV6A 4BA1I 4B3RL 5J39A 1JT8A 1X3QA 1XWEA 3EN2A 4KHVA 4DUZH 1CKNB 4UPAA 4A3MG 3WWIA 1GUGA 4P73A 4DPGA 4DV0L 1XMQH 4R4OA 4ECVA 1FJGH 5CORA 4C1NI 2COJA 1PH8A 3ULJA 2A19A 4LH7A 3N42B 2ZJTA 5IP7H 1ZKOA 3N6XA 2YU9H 5D14A 3MWDA 4F50A 4KLKA 2CNUA 3BG5A 3S1NH 3C0FB 4ED1A 3PR4A 2E75C 4M1UB 4YWLA 2W71A 4O4IF 4LFAQ 3T99A 4DR5H 2R7FA 1U0LA 5BWVA 3BZKA 4X64L 5KIXA 4JBKA 3KTMA 4RU9A 2L55A 1DCZA 1VQHA 2V5AA 1BOSA 3VA5A 5K2MA 4FFOA 4JYAQ 2ZXOA 2CQOA 1B44D 4IUVA 4DV1H 4FVMA 1I50A 4RCOA 3KBGA 3G6EA 4R4QA 3T51B 1KQSA 4BA2I 5HGQA 4WFN3 4O2AF 2FJZA 2DN8A 4X62L 4RMFA 3JAMW 3KLSX 3CSWA 5LL6X 2MO1A 5EDWA 3GTJB 3E5SA 1T9HA 1EOTA 5KFUA 1A2TA 3MWMA 4JI5Q 1GHJA 1SJED 4PZ7A 2W8KA 1GUSA 1ZQ7A 3K57A 4QW8A 1EFID 3B6YA 1Y14B 3ERQA 5LHY1 3T5JA 5GAGC 5D3DA 4XYQA 1Y1VG 5FJ8G 4RGNA 4XQNA 2O5IC 1VBHA 3BABA 5KG6A 1IBMH 3J81j 2Q2IA 3KF6B 5IP9H 2WB1A 5KFOA 1IOWA 1CFMA 3GTGH 4DR3Q 4DAYB 4K0KQ 3T1HQ 5L37A 5BN3A 4YY3Q 4IUTA 5DQHA 1I5FA 5KG2A 2Q2UA 1XNQH 4K2LA 2EYJA 3KBXA 1A15A 1SE8A 1FVIA 5IOCA 4QIWA 4HN7A 2NVXH 3K3PA 3AFQA 4JOIC 2AMCB 3SK5A 4LFCH 4CE5A 1WJJA 2BQRA 5LP6F 1G2SA 4EQNA 4ODGA 1BCPC 4IHJF 3M4IA 1GUWA 4EQ5A 3U9OA 3TP8A 3HKZB 2EY5A 3G6YA 4YAKB 4HIMA 4X3KA 4DR2Q 4IFDJ 1D1KA 4CMDA 1VCIA 2E5LQ 4HJ7A 3HKZA 5KG7A 5FO7B 3GO5A 2R7ZB 1A48A 1QVGA 4LFAL 4WORA 1ICWA 1QNKA 1K3RA 4O81A 1DZ1A 4LF4Q 1I4QA 4A3LH 4WHXA 2F0UA 4DFAA 3PQIA 4JI1L 3HOXG 5EGTA 1A3GA 2ZJRA 3CD6A 5C3WA 3I12A 4NKLA 3OW2A 3J81L 1KNEA 1GM5A 3M4OH 4BBSG 4GKJH 1DD2A 2LFNA 3CHBD 2UVWA 3A55A 3F8TA 2E2IB 5ISRA 1VQLA 4KN4C 1V1PA 2K03A 2PQEA 5A35A 1IYDA 2J6UA 3PIP3 1N56A 5C4HA 4G7OC 1HPCA 5CBEE 4IN3A 2HT1A 3OW7A 3SI8A 3D8GA 4DR1H 1WH2A 4GN4B 4A3MH 1ASYA 3BZCA 2MCTA 2CHBD 5F9LA 3E3XA 3CCUA 4FF2A 2AGOA 1K28A 1CM9A 1QJOA 2W6MA 1Y1WA 1BO0A 3HGBA 3OWEB 2X69A 4KJNA 1SSOA 5CYUA 1O7YA 4Z9CB 4MIUA 4HNVA 4POGA 2ZXPA 4IPCA 5C44B 3NEMA 5DLFA 2WAQG 2Q8RE 1JWSD 1PYSB 1CK1A 4ME5A 4DK6C 4DK3C 2UXBH 5EJWA 2ZTDA 3R8BA 2QCPX 5C44H 3I4NG 5BWUA 1NR2A 1E2VA 1PYBA 2NVYH 4PZ8A 2NZOA 3F1ZA 2FE3A 4PZ6A 3PFFA 4K0KL 1RODA 1UE5A 1PMRA 1CQIB 4K5WA 3QOJA 2R8KA 4ZRZA 1II3A 2UXBQ 2YS7A 1PTOB 4OX9L 4I55F 4GLXA 3M9NB 1YVCA 4X66Q 1CKOA 3K7UC 4TVAB 1R9TB 4JBMA 2F1MA 3SXHA 5CV8A 2AQ1B 1R9TA 4JVZA 4DL5A 1C48A 4RAYA 3ITPA 4DAVA 2C00A 2BE5C 1O7ZA 5JJLA 2R7MA 4KD3A 1B2TA 2JEJA 5CV5A 1HZBA 1N34H 3JZFA 1GOZA 1Q8KA 1IL8A 5C4JH 5EWGA 3MTSA 1PH2A 4A3GG 1QUQA 3T1HL 1VS0A 3KOJA 1SYXB 3K7AB 3T54A 1TWHA 2COGA 2A6HD 4JK1C 3RZDB 4GOPB 2R6GA 3S2DH 1BQQT 3QFFA 1YNND 3H0GG 2R3ZA 2NTSA 5KFRA 4DN4M 1Y1VH 5JQGF 5EPJA 5M5WB 4DV3Q 3BA9A 4Y7NH 3DHQA 3QO2A 2XCLA 1JOKA 2KEDA 4DUZQ 4QW9A 1XX8A 1I6UA 4B3SL 3R5FA 4ZUIA 4IPGA 1GHKA 1B3AA 1UNNC 5KT6A 2O5JC 5DLGA 2E5LL 3H40A 4EBEA 3T5KA 3KDFB 1EY7A 3MWYW 4PQXA 1C3OA 2D2CC 3BDCA 3JZ6A 3LNNA 4JI6L 1Q46A 1HUNA 1MSGA 2MUYA 3OYYA 1KRSA 3HOVB 1TKWB 1J5EQ 3BU2A 5J2TF 5KRUA 3TSSA 2EJGC 3OHBA 4DR4H 5JUMA 3S16B 4DV5L 3PZPA 1V43A 1I6VC 4GC6A 1SNQA 3AW8A 1LUZA 3SNOA 2VQDA 3I56A 3SE7A 3FMAA 3A7LA 2UXBL 1PHJA 1D2BA 3NSWA 2F0PA 3NK9A 3PSIA 5J3BA 5M3MB 2GA4B 1KTKA 1DAAA 3NBHB 4DV4H 2ALYB 1IKMA 1A3VA 1SYCA 1SN8A 1ZEQX 4EGVA 2JA5B 1MGSA 1TQOA 1Y1WH 3R23A 5EWFA 1DV1A 2R8IA 4N9PA 2OQ0A 1B4OA 1PTOD 2CZGA 4GLWA 1KABA 4B3TQ 2ALZA 4R8UB 4O3SA 2E2JB 4IUQA
chains in the Genus database with same CATH topology
5LMNW 4A3JG 4P71A 2MFIA 2ATWA 1VQAA 2RHQB 4B3TH 1BJTA 2XTIA 5DLQE 4LF5L 2YYZA 4MTDA 1A8VA 2K14A 1SLJA 4YHHL 1V9PA 2HVQA 1HNXQ 1XTDA 1SFOH 4GKKL 1H95A 2V1CC 1KC8C 5FLMH 3PO3G 3S2HH 1BBWA 3PUVA 5GAEC 3RLOA 4DV3H 1PH9A 3D0FA 4A93H 1CSPA 4JI8Q 1EIYB 4LFAH 2K4KA 1L2ZA 4O0AA 4BY7H 1J6QA 4DV7Q 2KHJA 4P72A 3IRBA 2Z6KC 3U58A 4DR7Q 1TXYA 4GLAC 4LF8Q 1HNXL 3GTQH 1YHAA 1K0RA 2RHSB 1JMCA 3ICEA 1HNWQ 4A3EH 4EFBA 3F2BA 4JI4Q 2I5LX 1X54A 4A3BG 1X3FA 1E1OA 1A0IA 1NY4A 4JI8L 4APVA 3T1YQ 1IL2A 3S1RH 3HOYG 3K80C 4X6AH 1J5EH 1SEIA 4RB2C 1K8GA 5JEAG 1G291 4MZ9A 2HGSA 4APMA 2F4VH 4OO1G 2HVSA 4JI5H 1YNXA 4YCVA 2NVQH 3N44B 3KLWA 3CCJA 2IX1A 4LF5Q 2LXKA 3KALA 3RGXA 2UUBH 2NN6I 3K81C 4QQBX 1C9OA 1DGSA 4BY1H 1XNQH 1TWHH 3HKZE 3NELA 1KIXA 3JAMi 3GTLH 3NBYB 4AQYH 1A63A 4OX9H 1KAWA 5FJ8H 4DR7H 4B3MQ 3JSLA 4DV2Q 4DV5Q 3KAKA 3W1GA 5LMUQ 4EFEA 2ID0A 4JI0L 3HOVH 3H0GH 4GOPC 4JI7L 2XGTA 3M4PA 1WI5A 1TWCH 4POFA 3CCQA 2E8GA 4DV4L 3HOWG 1FL0A 2ZM6H 3CPFA 1S3OA 1I94Q 3UDIA 1O75A 4Q0YA 1UE6A 1MJEA 2OWOA 3GD7A 1AE2A 4YCUA 1N32H 1YBYA 1NE3A 4A3CG 3CCEA 1EIFA 4NPSA 5ELNA 3NENA 4DKAC 4GNXA 3T1YL 1VQPA 5FPRA 4LSXA 1N33L 4PG3A 2JA8G 3TY8A 4AH6A 1I94H 4LF4H 1QVCA 3MXNB 5IP7G 4LWCA 1L0WA 1RL2A 3STBD 4AYBG 2ZJQA 4B3SH 1SMXA 4GN5A 1BBUA 3CMAA 4DV4Q 1PA6A 3PO3H 3H20A 4YHHH 3QWUA 3HXLA 3I4NH 1S03G 4DR4H 1XMQL 4GNXC 5IYDH 1XDNA 1PH5A 2E2HH 4B3MH 3MEFA 4JI7H 3WWVA 4DUYQ 4L5RC 3F2DA 3ULPA 3FKIG 4DR7L 2C35B 4LF7L 4LNQA 3J7AK 2UUCH 5M5YH 1EQRA 4DR5H 2HIXA 4YHHQ 2E2JH 1BVSA 3T1HH 4R4CA 3CAMA 4YY3L 3F2CA 3FHWA 3W1BA 1XNRL 3UDXA 4IJLA 5FLMG 1LM0A 4DUYL 3HOYH 3NBZB 1ZHSA 1K83H 1TWFH 2EIFA 4KHZA 2R93G 1X55A 2L15A 4YCWA 4LH6A 1OTCA 2UUCQ 5LL6b 2UUAL 5BR8L 4A75A 1YI2A 2B29A 4JI8H 1PV4A 1EQQA 2HVRA 1IBLL 4LUVA 1PH4A 2CWAA 4IOCA 4EEQA 1X56A 2Z0SA 4UP8A 2B63H 2R7ZG 2VY3A 4KHPL 1XMOH 3M85A 1JJCB 1IZ6A 2GVAA 2WAQE 4QIWE 2R92G 3EIVA 2ZM6L 1XPOA 4OWTB 1MZBA 3HOUH 2WB1E 4GOPA 1VQMA 2IX0A 4GLVB 4DR2L 4A3KG 1HNZQ 5A2QW 1TWGH 2VW9A 1Q12A 3PF5A 4OXPA 2UXCL 3K7AH 4E6NA 4GKKH 4MV7A 4LFCQ 3PCOB 1VQ8A 2UUBQ 4LF5H 1PH7A 2PNHA 5GAHC 4B3TL 1CSQA 2K5VA 4IJHA 2QEXA 4IO9A 1KRTA 3PN1A 4NXNL 1E24A 1L1OA 3U4VA 1HZAA 1TAEA 3KAJA 3SGIA 1K8AC 1WCMH 3A5ZB 3G48A 4DV0Q 1N34L 2HHHL 1VQCA 2A1AA 3L4KA 2RGRA 2MQHA 3RNUA 1IYJB 4OWWB 1S72A 4DR6L 2CKZB 3JSNA 3TY5A 3M9BA 1IBMQ 5FD6A 4FDBA 3UDFA 1YIJA 2KBNA 1MIUA 2VQEQ 1Q86C 4ETSA 2HHHH 1V1QA 4QJFA 1N34Q 4MTNA 2VUGA 1IBKQ 4RAZA 3RIZA 4LF8L 3RJ0A 4JC0A 1N36H 1B70B 1I50H 4GKJQ 1JE5A 4IPDA 4XTCS 1KXLA 3PUYA 4L5TA 4CC5A 2VQFH 5IYDG 4B3ML 1P16A 2CW8A 2VQEL 3AQQA 5C0XI 1GO3E 2VQFL 4LF7Q 2O03A 2Q2HA 4LMYA 1E3PA 2H5XA 1A62A 2YTYA 1I94L 4KHPQ 1X65A 3G71A 4BY7G 3N43B 4NXMH 3D31A 3PUWA 1O7IA 4A3CH 4IOAA 4IAJA 2N49A 2D0PA 1LYLA 5IYBH 5GADC 4HJAA 4A76A 1PH6A 1M1KC 2CCZA 2ES2A 4WJ3M 2IT1A 4A3KH 1UE7A 2AWOA 1VQOA 2PQAB 5IYBG 3N41B 3I2ZA 2UXDH 3GTOH 3HOVG 4JV5Q 4UP7A 1MJCA 1VQEA 2R7DA 1VQ6A 2JE6I 2F4VQ 4UCSA 4LFCL 2VUMH 1HNZH 2VZAA 3UE1A 3KJOA 5M3FG 4A3IH 2K5HA 4A3FG 5C4XG 2PI2A 5FLXW 4AYBE 3E9HA 4AIMA 4UFZA 4NXML 3RGZA 3ERSX 1M0TA 2BH8A 2CWPA 4IPHA 4BBRH 1XNQL 2LXJA 3NC0B 4JI2L 3S17H 4OWXB 2F4VL 3OTOQ 1NTGA 1Q7YC 1BKBA 5C44G 2WYOA 4O2DA 3CW2C 4C3JH 3TS0A 4LF9L 1IBML 4JI3Q 4DR4L 5ELOA 3LMLA 1VQNA 3ULLA 1SROA 3S24A 5BR8Q 5IYCG 4X65L 4DV6L 1X6OA 1JJGA 1M0WA 4A2BA 1N36L 1VQGA 1HNXH 4YWMA 1D7QA 1YZ6A 3J80c 1K73C 4LSAA 4OONA 2B63G 5JJIA 1Z2OX 4HIOA 3PF4A 1XPRA 4BXXG 3UQ8A 4RB3C 1EYGA 2JJQA 4PMWA 1WOCA 4JI6H 3PO2H 1HH2P 2AHOB 2ZM6Q 4LF6Q 2R7ZH 3TY9A 3IG0A 4X65Q 4DV6Q 5BR8H 2BA1A 3GTJH 3RTXA 5EAYA 4UCTA 4C3HH 2VS1A 3TS2A 1VQKA 3KFUA 3CMEA 1QUQB 1XNQQ 5K36G 1BGWA 4R4TA 4YY3H 1XNRH 1YHBA 3CCSA 2BH2A 3VNNA 3HFZB 4BA1I 1HR0Q 1FGUA 1VQBA 4B3RL 1JT8A 4EX5A 3EN2A 1HR0W 4DUZH 1CKNB 2N78A 1OXTA 3HKZG 4UPAA 3CC2A 4A3MG 3J7A5 4LFBL 4X66H 3J80W 3LGJA 3RLFA 5D1OA 4DPGA 4P73A 4DV0L 2HHHQ 4K0KH 3KYHC 5D1OB 1XMQH 4R4OA 1FJGH 1HNWL 1AN7A 2ZTEA 3M4QA 5LMNL 2Q2TA 1PH8A 3ULJA 1SR3A 3K3VA 3N40P 1CKMA 4A3GH 5GQOA 4JI2H 2A19A 4LH7A 3N42B 1XMQQ 2ZJTA 3M7NA 5IE8A 5IP7H 3N6XA 1B8AA 4A3FH 2YU9H 1KL9A 1QVFA 3T1YH 4KLKA 4JYAL 4R7RA 3S1NH 3C0FB 1N32L 3OTOL 4CC6A 1PH1A 2UUAH 2YV5A 4GS3A 2VL6A 2KCMA 4YWLA 4LFAQ 3G4SA 4DR1Q 2NVTH 2R7FA 1U0LA 2LSSA 3BZKA 1M90C 4X64L 4JBKA 4X62H 1HNWH 3AFPA 1HR0L 4B3RQ 3CCVA 1VQHA 2WDTA 1VQDA 4JG2A 5M3FH 4A3IG 3CP0A 2WB1G 4JYAQ 2PMZE 2EQSA 4RB0A 2CQOA 1G6PA 1OXVA 4JI4H 1VQIA 2ASBA 5LMUL 2UUCL 1D8LA 4DV1H 1YHQA 2HQLA 4JI2Q 1GD7A 1IBLQ 1Q1EA 3G6EA 3TRZA 4OO1I 2VPSA 4R4QA 4GKJL 1KQSA 2OQKA 3UDGA 4BA2I 5HGQA 1HR0H 4JI5L 3E9IA 2AWNA 2HIVA 5H1SE 1R9TH 4X64H 4X62L 5IWAQ 3PIOA 3H15A 4RMFA 3CQZH 1VQJA 4DV1Q 3H3VI 3S1MH 4IFDI 5EOYA 3DM3A 1E1TA 2K75A 1J5EL 2MO1A 2WFWA 4RB1A 3J81W 2E5LH 3RLNA 1Q82C 1T9HA 4H02A 1UWVA 3CPWA 1N33H 1NMFA 2JK8A 4QY7A 3GB8B 3MWMA 4JI5Q 4PZ7A 4BXXH 1KD1C 3FP9A 2VUMG 4MNOA 1ASZA 4DR3H 1WYDA 2K50A 3B6YA 5FPOA 5LMNH 4LF6L 1Y14B 2EXDA 2JA5G 5GAGC 5FJ8G 4RG1A 1Y1VG 3A5UA 3KF6A 1W3SA 4NXNQ 3BABA 1IBKH 2YTVA 1IBMH 4YWKA 3J81j 2Q2IA 3KF6B 5IP9H 5LMNQ 2JA7G 3CCMA 3TQYA 4JI0H 3AEVA 3GTGH 2VOBA 4DUZL 4DR3Q 4IFDG 4DAYB 2B3GA 4K0KQ 3T1HQ 3ER0A 4B3SQ 4R1JA 4YY3Q 2Z6KA 1I5FA 1XNRQ 4KI0A 3J80i 2Q2UA 1NMGA 1PVOA 1FJGQ 1PFSA 4DR6Q 4Y52H 4NXNH 4A93G 4BBRG 2D62A 2NZHA 2Y0SE 1SE8A 1FVIA 2JA9A 3CCLA 3I4OA 3K8AA 2NVXH 2JA8H 3AFQA 4JOIC 2AMCB 4A2AA 1MKHA 4JCVE 4UCUA 2I0QA 4LFCH 5C4XH 4JBWA 1E22A 1WJJA 4J15A 1B7YB 5C0XG 4A3EG 1JJ2A 1KHIA 1VQ7A 4A4IA 1E4GT 1ZHQA 4I7HA 1L2FA 2ZJPA 3I7FA 3CCRA 2E2IH 3A74A 5M5XH 1YITA 2D0OA 4LF9Q 3GTMH 4WJ4A 4DRFA 3M4IA 1K9MC 4NB3A 3KJPA 4EQ5A 4HIMA 3VDYA 1XMOL 4DR2Q 2VQFQ 4IFDJ 2RCNA 1VCIA 2E5LQ 4HJ7A 1X9NA 1N32Q 3KXYT 3GO5A 1QVGA 4LFAL 3RF2A 3RN2A 1NBWA 1K3RA 4LF9H 4KHPH 1Z47A 4LF4Q 2VNUD 4A3LH 1VQFA 4X62Q 2KHIA 2GVBA 3PO2G 4JI1L 4HIKA 2VQEH 3HOXG 2ZJRA 3KF8B 3CD6A 3CC4A 1AH9A 3DLLA 3OW2A 4DV2H 4DV5H 1C7YA 1GM5A 3M4OH 2Y0SG 4BBSG 1GVPA 2I5HA 2ZTCA 4GKJH 5HY6A 3TEHB 3J81c 3F8TA 4HIDA 3L7ZC 1VQLA 3HOZH 1Y1WG 3CVZA 4LF8H 1S68A 1CUKA 2UU9L 5M3MH 2A8VA 4A3DH 4DV7H 3J81i 2HT1A 3BAAA 3CF5A 3BA8A 5C3EH 5IWAL 2AKWB 3I55A 3I4MG 4GN4B 4A3MH 1ASYA 3GTKH 3BZCA 1WH2A 2DGYA 2PQAA 2MCTA 2WE6A 5C3EG 4DR1L 3I4MH 3PUXA 3L0OA 3S16H 3CCUA 5IWAH 4DNIA 3GJXB 3STBC 1EUJA 5IP9G 4DR5L 2JA7H 1PH3A 4GNXB 1OXXK 4POGA 4IPCA 4ALPA 1EFWA 4JI3L 3NEMA 4LF4L 3GTPH 2MO0A 2RF4A 2WAQG 4DR4Q 4JI1Q 2CFMA 2QA4A 1PYSB 4DK6C 2RGVA 4JOIA 2PI2E 5E7NA 4DK3C 1NJIC 2ZTDA 3RZOH 4GKKQ 5C44H 4UCOA 2UXBH 3I4NG 1PYBA 2NVYH 1I6HH 4PZ8A 1VQ4A 4JI1H 2UXCH 2NZOA 3F1ZA 2FE3A 4PZ6A 1HZ9A 4MV9A 2GN5A 4K0KL 2IHEA 3S14H 3DF7A 4DV0H 1OXSC 1Z2NX 1UE5A 1X3GA 5C0XJ 5AJ3L 2K52A 2IHFA 2DUDA 2UXBQ 2CW7A 5FD5A 1YJWA 4OX9L 5IYCH 4GLXA 4AQYL 3FKIH 3Q8DA 1I3QH 1YVCA 4X66Q 2UXCQ 3JC66 1HJPA 1XJVA 4JI4L 1CKOA 4JV5L 3K7UC 2BA0A 2F3IA 4L5QA 4TVAB 4JBMA 5IT9W 2UUBL 1QZHA 2OCEA 4LUZA 4DR6H 1W2BA 4HJ5A 4DR5Q 4RAYA 3PUZA 4R4IA 4BY1G 4LF6H 2JA6G 5JJLA 1LTLA 1HZBA 1N34H 4JBJA 2JA6H 4RZQA 3JAMW 1Q8KA 5C4JH 4DUYH 1G51A 1YEZA 1AE3A 1N9WA 4JYAH 1PH2A 4A3GG 1QUQA 3T1HL 1TA8A 1VS0A 4JI6Q 1RIPA 3KOJA 1SYXB 3M3YH 3BJUA 4LW1A 5IT9c 3HOWH 3H3VH 1S40A 4GOPB 2JA5H 2R6GA 3S2DH 2UUAQ 2NN6G 2XIGA 3H0GG 3CC7A 1CKNA 2I5MX 4QGUA 1E4FT 1Y1VH 2N3SA 4DV3Q 4TQUS 3BA9A 4X66L 4LFBH 4UY8C 1IXRA 5FLXc 4Y7NH 2JEAI 4UCRA 4HJ9A 1HZCA 4DUZQ 4DR3L 4A3JH 4J0MA 1I6UA 4M7EA 4B3SL 1GYFA 1L1OB 2YTXA 3HKSA 1N33Q 3U50C 3E0EA 5JJKA 2UXDQ 4IPGA 3S15H 1XMOQ 1IBLH 3KDFA 1C0AA 4FM9A 1Q1BA 1XK5A 2E5LL 3S1QH 1QZGA 3KDFB 4DAMA 2W57A 4QL5A 3L2PA 4P75A 5JEAJ 4A3BH 3TREA 3PGZA 1WFQA 2K5NA 4UCVA 4LUOA 1EOVA 3K0XA 4JI6L 4XIGS 1Q46A 1YJNA 2UXDL 5GROA 3A0JA 4MTEA 1FKAH 2JEBI 1B04A 3OYYA 5M5WH 2KSWA 4OX9Q 4JV5H 1KRSA 3GDEA 4LFBQ 4DV7L 1Z2PX 4DV1L 3J7ZC 1VQ9A 2UU9H 1OXUA 5LMUH 1J5EQ 4PDBA 3W5OA 2FXQA 3BU2A 4L5SA 4X65H 4DV6H 4LF7H 2OTLA 1X3EA 3F8NA 1UEBA 2QGQA 1EWIA 5M3MG 1P8LA 4C3IH 2UU9Q 1E7ZA 1UE1A 4C2MH 1JB7A 1VQ5A 4NXMQ 1XPUA 2R93H 5IY0A 4DV2L 4DV5L 3HOZG 1V43A 3HOUG 3EYYA 3L4JA 4JI0Q 1LUZA 4JI7Q 4GN3B 1YJ9A 3I56A 3PIPA 3FMAA 1IBKL 2UXBL 3OTOH 1PHJA 4BWSC 1N8RC 4AQYQ 2WP8J 3RN5A 3PSIA 5J3BA 4BBSH 1SRUA 5D1PA 4JI3H 1Q81C 4A3LG 2IY5B 3EBEA 2R92H 4X64Q 3HOXH 3NBHB 2MNAA 1U5KA 2JQOA 2KENA 1HNZL 4A3DG 3U4ZA 4ME3A 4HJ8A 2ALYB 3AYHB 1GKHA 3ZJYC 1N36Q 1FJGL 2YCHA 4DV4H 4DR2H 1WCMG 1TWAH 4UP9A 3RZDH 1L1OC 1SN8A 4DV3L 3JAMc 5DISC 2N8NA 3CXCA 1Y1WH 3RR5A 2F52A 4P74A 2OQ0A 3PV0A 3UE0A 2OTJA 4DR1H 4B3TQ 1Z9FA 5AJ3Q 2KCTA 4B3RH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN W;  4A3J G;  4P71 A;  2MFI A;  2ATW A;  1VQA A;  2RHQ B;  2XTI A;  5DLQ E;  4LF5 L;  2YYZ A;  1A8V A;  2K14 A;  1SLJ A;  4YHH L;  1V9P A;  2HVQ A;  1HNX Q;  1XTD A;  1SFO H;  4GKK L;  1H95 A;  2V1C C;  1KC8 C;  5FLM H;  3PO3 G;  3S2H H;  1BBW A;  3PUV A;  5GAE C;  3RLO A;  1PH9 A;  3D0F A;  4A93 H;  1CSP A;  4JI8 Q;  1EIY B;  2K4K A;  4O0A A;  4BY7 H;  1J6Q A;  4DV7 Q;  2KHJ A;  4P72 A;  3IRB A;  2Z6K C;  3U58 A;  4DR7 Q;  1TXY A;  4GLA C;  4LF8 Q;  1HNX L;  3GTQ H;  1YHA A;  1K0R A;  2RHS B;  1JMC A;  3ICE A;  1HNW Q;  4A3E H;  4EFB A;  3F2B A;  4JI4 Q;  2I5L X;  1X54 A;  4A3B G;  1X3F A;  1E1O A;  1A0I A;  1NY4 A;  4JI8 L;  4APV A;  3T1Y Q;  1IL2 A;  3S1R H;  3HOY G;  3K80 C;  4X6A H;  1K8G A;  5JEA G;  1G29 1;  4MZ9 A;  4OO1 G;  2HVS A;  1YNX A;  4YCV A;  2NVQ H;  3KLW A;  3CCJ A;  2IX1 A;  4LF5 Q;  2LXK A;  2NN6 I;  3K81 C;  4QQB X;  1C9O A;  1DGS A;  4BY1 H;  1TWH H;  3HKZ E;  3NEL A;  1KIX A;  3JAM i;  3GTL H;  3NBY B;  1A63 A;  1KAW A;  5FJ8 H;  4B3M Q;  3JSL A;  4DV2 Q;  4DV5 Q;  3W1G A;  5LMU Q;  4EFE A;  2ID0 A;  4JI0 L;  3HOV H;  3H0G H;  4GOP C;  4JI7 L;  2XGT A;  3M4P A;  1WI5 A;  1TWC H;  4POF A;  3CCQ A;  2E8G A;  4DV4 L;  3HOW G;  1FL0 A;  3CPF A;  1S3O A;  1I94 Q;  3UDI A;  1UE6 A;  1MJE A;  2OWO A;  3GD7 A;  1AE2 A;  4YCU A;  1YBY A;  1NE3 A;  4A3C G;  3CCE A;  1EIF A;  4NPS A;  5ELN A;  3NEN A;  4DKA C;  4GNX A;  3T1Y L;  1VQP A;  5FPR A;  1N33 L;  4PG3 A;  2JA8 G;  3TY8 A;  4AH6 A;  1QVC A;  3MXN B;  5IP7 G;  4LWC A;  1L0W A;  1RL2 A;  3STB D;  4AYB G;  2ZJQ A;  1SMX A;  4GN5 A;  1BBU A;  3CMA A;  4DV4 Q;  1PA6 A;  3PO3 H;  3QWU A;  3I4N H;  1XMQ L;  4GNX C;  5IYD H;  1XDN A;  1PH5 A;  2E2H H;  3MEF A;  3WWV A;  4DUY Q;  4L5R C;  3F2D A;  3ULP A;  3FKI G;  4DR7 L;  2C35 B;  4LF7 L;  4LNQ A;  5M5Y H;  1EQR A;  2HIX A;  4YHH Q;  2E2J H;  1BVS A;  4R4C A;  3CAM A;  4YY3 L;  3F2C A;  3FHW A;  3W1B A;  1XNR L;  3UDX A;  4IJL A;  5FLM G;  1LM0 A;  4DUY L;  3HOY H;  3NBZ B;  1K83 H;  1TWF H;  2EIF A;  4KHZ A;  2R93 G;  1X55 A;  2L15 A;  4YCW A;  4LH6 A;  1OTC A;  2UUC Q;  2UUA L;  5BR8 L;  4A75 A;  1YI2 A;  2B29 A;  1PV4 A;  1EQQ A;  2HVR A;  1IBL L;  4LUV A;  1PH4 A;  2CWA A;  4IOC A;  4EEQ A;  1X56 A;  2Z0S A;  4UP8 A;  2B63 H;  2R7Z G;  2VY3 A;  4KHP L;  3M85 A;  1JJC B;  1IZ6 A;  2GVA A;  2WAQ E;  4QIW E;  2R92 G;  3EIV A;  2ZM6 L;  1XPO A;  4OWT B;  3HOU H;  2WB1 E;  4GOP A;  1VQM A;  2IX0 A;  4GLV B;  4DR2 L;  4A3K G;  1HNZ Q;  1TWG H;  2VW9 A;  1Q12 A;  3PF5 A;  4OXP A;  2UXC L;  3K7A H;  4E6N A;  4LFC Q;  3PCO B;  1VQ8 A;  2UUB Q;  1PH7 A;  2PNH A;  5GAH C;  4B3T L;  1CSQ A;  2K5V A;  4IJH A;  2QEX A;  4IO9 A;  1KRT A;  3PN1 A;  4NXN L;  1E24 A;  1L1O A;  3U4V A;  1HZA A;  1TAE A;  3SGI A;  1K8A C;  1WCM H;  3A5Z B;  3G48 A;  4DV0 Q;  1N34 L;  2HHH L;  1VQC A;  2A1A A;  2MQH A;  3RNU A;  1IYJ B;  4OWW B;  1S72 A;  4DR6 L;  2CKZ B;  3JSN A;  3TY5 A;  3M9B A;  1IBM Q;  4FDB A;  3UDF A;  1YIJ A;  2KBN A;  1MIU A;  2VQE Q;  1Q86 C;  1V1Q A;  4QJF A;  1N34 Q;  4MTN A;  2VUG A;  1IBK Q;  4LF8 L;  4JC0 A;  1B70 B;  1I50 H;  4GKJ Q;  1JE5 A;  4IPD A;  4XTC S;  1KXL A;  3PUY A;  4L5T A;  4CC5 A;  5IYD G;  4B3M L;  1P16 A;  2VQE L;  3AQQ A;  5C0X I;  1GO3 E;  2VQF L;  4LF7 Q;  2Q2H A;  1E3P A;  2H5X A;  1A62 A;  2YTY A;  1I94 L;  4KHP Q;  1X65 A;  3G71 A;  4BY7 G;  3D31 A;  3PUW A;  1O7I A;  4A3C H;  4IOA A;  2N49 A;  2D0P A;  1LYL A;  5IYB H;  5GAD C;  4HJA A;  4A76 A;  1PH6 A;  1M1K C;  2CCZ A;  2ES2 A;  4WJ3 M;  2IT1 A;  4A3K H;  1UE7 A;  2AWO A;  1VQO A;  2PQA B;  5IYB G;  3I2Z A;  3GTO H;  3HOV G;  4JV5 Q;  4UP7 A;  1MJC A;  1VQE A;  2R7D A;  1VQ6 A;  2JE6 I;  2F4V Q;  4UCS A;  4LFC L;  2VUM H;  2VZA A;  3UE1 A;  3KJO A;  5M3F G;  4A3I H;  2K5H A;  4A3F G;  5C4X G;  2PI2 A;  4AYB E;  3E9H A;  4AIM A;  4UFZ A;  4NXM L;  3ERS X;  2BH8 A;  2CWP A;  4IPH A;  4BBR H;  1XNQ L;  2LXJ A;  3NC0 B;  4JI2 L;  3S17 H;  4OWX B;  2F4V L;  3OTO Q;  1NTG A;  1Q7Y C;  1BKB A;  5C44 G;  4O2D A;  3CW2 C;  4C3J H;  3TS0 A;  4LF9 L;  1IBM L;  4JI3 Q;  4DR4 L;  5ELO A;  1VQN A;  3ULL A;  1SRO A;  3S24 A;  5BR8 Q;  5IYC G;  4X65 L;  4DV6 L;  1X6O A;  1JJG A;  1N36 L;  1VQG A;  4YWM A;  1D7Q A;  1YZ6 A;  3J80 c;  1K73 C;  4OON A;  2B63 G;  5JJI A;  4HIO A;  3PF4 A;  1XPR A;  4BXX G;  3UQ8 A;  1EYG A;  2JJQ A;  4PMW A;  1WOC A;  3PO2 H;  1HH2 P;  2AHO B;  2ZM6 Q;  4LF6 Q;  2R7Z H;  3TY9 A;  4X65 Q;  4DV6 Q;  2BA1 A;  3GTJ H;  3RTX A;  5EAY A;  4UCT A;  4C3H H;  2VS1 A;  3TS2 A;  1VQK A;  3KFU A;  3CME A;  1QUQ B;  1XNQ Q;  5K36 G;  4R4T A;  1YHB A;  3CCS A;  2BH2 A;  3VNN A;  3HFZ B;  4BA1 I;  1HR0 Q;  1FGU A;  1VQB A;  4B3R L;  1JT8 A;  4EX5 A;  3EN2 A;  1HR0 W;  1CKN B;  2N78 A;  1OXT A;  3HKZ G;  4UPA A;  3CC2 A;  4A3M G;  3J7A 5;  4LFB L;  3LGJ A;  3RLF A;  5D1O A;  4DPG A;  4P73 A;  4DV0 L;  2HHH Q;  3KYH C;  5D1O B;  4R4O A;  1HNW L;  2ZTE A;  3M4Q A;  5LMN L;  2Q2T A;  1PH8 A;  3ULJ A;  1SR3 A;  1CKM A;  4A3G H;  5GQO A;  2A19 A;  4LH7 A;  1XMQ Q;  3M7N A;  5IE8 A;  5IP7 H;  1B8A A;  4A3F H;  2YU9 H;  1KL9 A;  1QVF A;  4KLK A;  4JYA L;  3S1N H;  1N32 L;  3OTO L;  4CC6 A;  1PH1 A;  2YV5 A;  4GS3 A;  2VL6 A;  2KCM A;  4YWL A;  4LFA Q;  3G4S A;  4DR1 Q;  2NVT H;  2R7F A;  1U0L A;  2LSS A;  3BZK A;  1M90 C;  4X64 L;  4JBK A;  3AFP A;  1HR0 L;  4B3R Q;  3CCV A;  1VQH A;  1VQD A;  4JG2 A;  5M3F H;  4A3I G;  3CP0 A;  2WB1 G;  4JYA Q;  2PMZ E;  2EQS A;  2CQO A;  1G6P A;  1OXV A;  1VQI A;  2ASB A;  5LMU L;  2UUC L;  1D8L A;  1YHQ A;  2HQL A;  4JI2 Q;  1GD7 A;  1IBL Q;  1Q1E A;  3G6E A;  3TRZ A;  4OO1 I;  4R4Q A;  4GKJ L;  1KQS A;  2OQK A;  3UDG A;  4BA2 I;  5HGQ A;  4JI5 L;  3E9I A;  2AWN A;  2HIV A;  5H1S E;  1R9T H;  4X62 L;  5IWA Q;  3PIO A;  3H15 A;  4RMF A;  3CQZ H;  1VQJ A;  4DV1 Q;  3H3V I;  3S1M H;  4IFD I;  3DM3 A;  1E1T A;  2K75 A;  1J5E L;  2MO1 A;  2WFW A;  3RLN A;  1Q82 C;  1T9H A;  4H02 A;  1UWV A;  3CPW A;  1NMF A;  2JK8 A;  4QY7 A;  3GB8 B;  4JI5 Q;  4PZ7 A;  4BXX H;  1KD1 C;  3FP9 A;  2VUM G;  4MNO A;  1ASZ A;  1WYD A;  2K50 A;  3B6Y A;  5FPO A;  4LF6 L;  1Y14 B;  2EXD A;  2JA5 G;  5GAG C;  5FJ8 G;  4RG1 A;  1Y1V G;  3A5U A;  3KF6 A;  1W3S A;  4NXN Q;  3BAB A;  2YTV A;  4YWK A;  3J81 j;  2Q2I A;  3KF6 B;  5IP9 H;  5LMN Q;  2JA7 G;  3CCM A;  3TQY A;  3AEV A;  3GTG H;  4DUZ L;  4DR3 Q;  4IFD G;  4DAY B;  2B3G A;  4K0K Q;  3T1H Q;  3ER0 A;  4B3S Q;  4R1J A;  4YY3 Q;  2Z6K A;  1I5F A;  1XNR Q;  4KI0 A;  3J80 i;  2Q2U A;  1NMG A;  1PVO A;  1FJG Q;  1PFS A;  4DR6 Q;  4Y52 H;  4A93 G;  4BBR G;  2D62 A;  2NZH A;  2Y0S E;  1SE8 A;  1FVI A;  2JA9 A;  3CCL A;  3I4O A;  3K8A A;  2NVX H;  2JA8 H;  3AFQ A;  4JOI C;  2AMC B;  1MKH A;  4JCV E;  4UCU A;  2I0Q A;  5C4X H;  4JBW A;  1E22 A;  1WJJ A;  4J15 A;  1B7Y B;  5C0X G;  4A3E G;  1JJ2 A;  1KHI A;  1VQ7 A;  4A4I A;  1L2F A;  2ZJP A;  3I7F A;  3CCR A;  2E2I H;  3A74 A;  5M5X H;  1YIT A;  2D0O A;  4LF9 Q;  3GTM H;  4WJ4 A;  4DRF A;  1K9M C;  4NB3 A;  3KJP A;  4EQ5 A;  4HIM A;  3VDY A;  1XMO L;  4DR2 Q;  2VQF Q;  4IFD J;  2RCN A;  1VCI A;  2E5L Q;  4HJ7 A;  1X9N A;  1N32 Q;  3GO5 A;  1QVG A;  4LFA L;  3RN2 A;  1NBW A;  1K3R A;  1Z47 A;  4LF4 Q;  2VNU D;  4A3L H;  1VQF A;  4X62 Q;  2KHI A;  2GVB A;  3PO2 G;  4JI1 L;  4HIK A;  3HOX G;  2ZJR A;  3KF8 B;  3CD6 A;  3CC4 A;  1AH9 A;  3DLL A;  3OW2 A;  1C7Y A;  1GM5 A;  3M4O H;  2Y0S G;  4BBS G;  1GVP A;  2I5H A;  2ZTC A;  5HY6 A;  3TEH B;  3J81 c;  3F8T A;  4HID A;  3L7Z C;  1VQL A;  3HOZ H;  1Y1W G;  1S68 A;  1CUK A;  2UU9 L;  5M3M H;  2A8V A;  4A3D H;  3J81 i;  2HT1 A;  3BAA A;  3CF5 A;  3BA8 A;  5C3E H;  5IWA L;  2AKW B;  3I55 A;  3I4M G;  4GN4 B;  4A3M H;  1ASY A;  3GTK H;  3BZC A;  2DGY A;  2PQA A;  5C3E G;  4DR1 L;  3I4M H;  3PUX A;  3L0O A;  3S16 H;  3CCU A;  4DNI A;  3GJX B;  3STB C;  1EUJ A;  5IP9 G;  4DR5 L;  2JA7 H;  1PH3 A;  4GNX B;  1OXX K;  4POG A;  4IPC A;  4ALP A;  1EFW A;  4JI3 L;  3NEM A;  4LF4 L;  3GTP H;  2MO0 A;  2RF4 A;  2WAQ G;  4DR4 Q;  4JI1 Q;  2CFM A;  2QA4 A;  1PYS B;  4DK6 C;  4JOI A;  2PI2 E;  5E7N A;  4DK3 C;  1NJI C;  2ZTD A;  3RZO H;  4GKK Q;  5C44 H;  4UCO A;  3I4N G;  1PYB A;  2NVY H;  1I6H H;  4PZ8 A;  1VQ4 A;  2NZO A;  3F1Z A;  4PZ6 A;  1HZ9 A;  2GN5 A;  4K0K L;  2IHE A;  3S14 H;  1OXS C;  1UE5 A;  1X3G A;  5C0X J;  5AJ3 L;  2K52 A;  2IHF A;  2DUD A;  2UXB Q;  1YJW A;  4OX9 L;  5IYC H;  4GLX A;  4AQY L;  3FKI H;  3Q8D A;  1I3Q H;  1YVC A;  4X66 Q;  2UXC Q;  3JC6 6;  1HJP A;  1XJV A;  4JI4 L;  1CKO A;  4JV5 L;  3K7U C;  2BA0 A;  2F3I A;  4L5Q A;  4TVA B;  4JBM A;  2UUB L;  1QZH A;  2OCE A;  4LUZ A;  1W2B A;  4HJ5 A;  4DR5 Q;  3PUZ A;  4R4I A;  4BY1 G;  2JA6 G;  5JJL A;  1LTL A;  1HZB A;  4JBJ A;  2JA6 H;  1Q8K A;  5C4J H;  1G51 A;  1YEZ A;  1AE3 A;  1N9W A;  1PH2 A;  4A3G G;  1QUQ A;  3T1H L;  1TA8 A;  1VS0 A;  4JI6 Q;  1RIP A;  3KOJ A;  3M3Y H;  3BJU A;  4LW1 A;  5IT9 c;  3HOW H;  3H3V H;  1S40 A;  4GOP B;  2JA5 H;  2R6G A;  3S2D H;  2UUA Q;  2NN6 G;  3H0G G;  3CC7 A;  1CKN A;  2I5M X;  4QGU A;  1Y1V H;  2N3S A;  4DV3 Q;  4TQU S;  3BA9 A;  4X66 L;  4UY8 C;  1IXR A;  5FLX c;  4Y7N H;  2JEA I;  4UCR A;  4HJ9 A;  1HZC A;  4DUZ Q;  4DR3 L;  4A3J H;  4B3S L;  1L1O B;  2YTX A;  3HKS A;  1N33 Q;  3U50 C;  3E0E A;  5JJK A;  2UXD Q;  4IPG A;  3S15 H;  1XMO Q;  3KDF A;  1C0A A;  1Q1B A;  1XK5 A;  2E5L L;  3S1Q H;  1QZG A;  3KDF B;  4DAM A;  4QL5 A;  3L2P A;  4P75 A;  5JEA J;  4A3B H;  3TRE A;  3PGZ A;  1WFQ A;  2K5N A;  4UCV A;  4LUO A;  1EOV A;  3K0X A;  4JI6 L;  4XIG S;  1Q46 A;  1YJN A;  2UXD L;  5GRO A;  3A0J A;  2JEB I;  1B04 A;  3OYY A;  5M5W H;  4OX9 Q;  1KRS A;  3GDE A;  4LFB Q;  4DV7 L;  4DV1 L;  3J7Z C;  1VQ9 A;  1OXU A;  1J5E Q;  3W5O A;  2FXQ A;  3BU2 A;  4L5S A;  2OTL A;  1X3E A;  1UEB A;  2QGQ A;  1EWI A;  5M3M G;  1P8L A;  4C3I H;  2UU9 Q;  1E7Z A;  1UE1 A;  4C2M H;  1JB7 A;  1VQ5 A;  4NXM Q;  1XPU A;  2R93 H;  5IY0 A;  4DV2 L;  4DV5 L;  3HOZ G;  1V43 A;  3HOU G;  4JI0 Q;  1LUZ A;  4JI7 Q;  4GN3 B;  1YJ9 A;  3I56 A;  3PIP A;  1IBK L;  2UXB L;  1PHJ A;  1N8R C;  4AQY Q;  2WP8 J;  3RN5 A;  3PSI A;  5J3B A;  4BBS H;  1SRU A;  5D1P A;  1Q81 C;  4A3L G;  2IY5 B;  3EBE A;  2R92 H;  4X64 Q;  3HOX H;  3NBH B;  2MNA A;  1U5K A;  2JQO A;  2KEN A;  1HNZ L;  4A3D G;  3U4Z A;  4ME3 A;  4HJ8 A;  2ALY B;  3AYH B;  1GKH A;  3ZJY C;  1N36 Q;  1FJG L;  1WCM G;  1TWA H;  4UP9 A;  3RZD H;  1L1O C;  1SN8 A;  4DV3 L;  3JAM c;  5DIS C;  2N8N A;  3CXC A;  1Y1W H;  3RR5 A;  2F52 A;  4P74 A;  2OQ0 A;  3PV0 A;  3UE0 A;  2OTJ A;  4B3T Q;  1Z9F A;  5AJ3 Q;  2KCT A; 
#chains in the Genus database with same CATH topology
 1I2L A;  1VQA A;  3MAQ A;  2K32 A;  4O82 A;  4MTD A;  4YHH L;  1SLJ A;  1V9P A;  1XTD A;  2O4X A;  1L0Y B;  2NBF A;  4C5B A;  2AGP A;  2I46 A;  5J1Z A;  4DIM A;  1Y8O B;  3RLO A;  2FFK B;  1PH9 A;  2W9B B;  3GTQ B;  3TQ1 A;  4LFA H;  2K4K A;  4O0A A;  1CTM A;  2FPP B;  1JIC A;  2Z6K C;  2G9H D;  5CV9 A;  3GTQ H;  1K0R A;  1HNW Q;  1BBX C;  4UHV A;  5C0X H;  4A3E H;  3WWJ A;  2I5L X;  3ETH A;  1X54 A;  5KFE A;  4JI8 L;  2ENB A;  1JWU D;  4X6A H;  1VF7 A;  1XTC D;  2YZM A;  1J5E H;  3NQT A;  2A73 B;  3VR2 A;  4HN2 A;  1SEI A;  4K5V A;  3LX0 A;  1G29 1;  3HEJ A;  4Q5V A;  3V2T A;  4APM A;  1PXU A;  2FPG B;  4ECS A;  2PNR C;  4JI5 H;  3KF8 A;  2ASJ A;  2NN6 I;  4QQB X;  5C4X B;  1C9O A;  1LT3 D;  4OEL B;  1MSH A;  3KHH A;  1BNC A;  1KIX A;  3GTL H;  4AQY H;  1AP0 A;  2RA4 A;  4H7B A;  5FJ8 H;  4B3M Q;  1NSN S;  4DV5 Q;  2GQS A;  5FOB B;  3OSP A;  1B50 A;  3H0G H;  4GOP C;  2XGT A;  4QWE A;  3M4P A;  3QIA A;  1Y8P B;  4DV4 L;  1EKP A;  1GSO A;  1KJI A;  1WSC A;  4FF4 A;  3UDI A;  2CQY A;  2K04 A;  1AE2 A;  4HAE A;  3TW7 A;  4QWA A;  4A3C G;  4NPS A;  3T1Y L;  4IR9 A;  2JA8 G;  5E3F A;  4LF4 H;  1QVC A;  1KLG D;  1L0W A;  4MAM A;  1RL2 A;  4Q8F A;  4AYB G;  3H20 A;  1PA6 A;  1S4Z A;  1X3P A;  3HXL A;  4IWY A;  1S03 G;  1UNS A;  3AMU A;  4B3M H;  1XDN A;  2E2H H;  3M9M B;  2XRQ D;  2DNE A;  3PMF A;  3ULP A;  3T9E A;  1I1M A;  2EDG A;  4DR7 L;  2C35 B;  1LV9 A;  2M00 A;  4LNQ A;  5E25 A;  2ZXR A;  4YHH Q;  2V4R A;  4C3J G;  3F2C A;  3W1B A;  2B2W A;  3UDX A;  5FLM G;  3NBZ B;  1ZHS A;  4J9M A;  3NTH A;  1GXD C;  1K83 H;  2R93 G;  2R6F A;  4YCW A;  3NTI A;  2MGS A;  3T16 A;  1YI2 A;  1EQQ A;  4A93 B;  2K6A A;  1PK8 A;  2EVB A;  3X3N A;  2R85 A;  2Z0S A;  2B63 H;  5EZY F;  4R9W A;  3T9D A;  5L1I A;  4QIW E;  5M9O A;  2ZM6 L;  4U7C A;  2JYO A;  3NBI A;  2WB1 E;  1TWA A;  1ZXT A;  2IX0 A;  5KND A;  5A2Q W;  1A3U A;  2A69 D;  5DM7 3;  2VW9 A;  2K01 A;  3PF5 A;  3KRE A;  4TM5 A;  4E6N A;  2WII B;  3FDS A;  1H9S B;  3PCO B;  3RB6 A;  2PNH A;  5I9O A;  2SCU B;  1KRT A;  1E24 A;  1S0O A;  2JEG A;  3DAA A;  2F0F A;  1WCM H;  3G48 A;  4F7X A;  1N34 L;  3DTG A;  3M9O B;  4Q45 A;  3L9A X;  1Z7T A;  3RNU A;  4O2B F;  4ZQI A;  2ZT9 C;  4TRD A;  4R8I A;  4FDB A;  3UDF A;  2X5R A;  2NVQ B;  5JVD F;  2NB0 A;  4RAZ A;  3U54 A;  4LF8 L;  5ELE A;  3S1R B;  1MD2 D;  5C4Z A;  2DAB A;  2NVT B;  3PUY A;  1X32 A;  4B3M L;  1TWC B;  2WIN B;  4LAA A;  3KHR A;  3VMM A;  1SCU B;  3I73 A;  3A8K E;  1KJJ A;  2FLP A;  2QEJ C;  1LTR D;  3D31 A;  2VB3 X;  2N49 A;  1UUP A;  2D0P A;  3MFH A;  3TZU A;  2ES2 A;  5L1K A;  2IT1 A;  2AWO A;  3D4D A;  1VQO A;  4NW2 A;  2V59 A;  1R4Q B;  1RYR A;  1OO9 B;  4YP3 A;  1FNU A;  2NN6 H;  3D3R A;  4JV5 Q;  1MJC A;  2KUM A;  2R7D A;  2IJ0 A;  1VQ6 A;  2V4D A;  1BNZ A;  2R92 B;  1HNZ H;  1RTN A;  3KJO A;  3UE1 A;  1ML0 D;  3Q22 A;  4BBS B;  3MXG A;  4CHI A;  5I5X A;  2O2L D;  5FLX W;  1W93 A;  3GTO A;  2B8F A;  1F2Z A;  1ILP A;  4CBV A;  2F0K A;  5DGA A;  4IPH A;  3OHA A;  3WWH A;  3OTO Q;  1NTG A;  4FXD A;  4QMG A;  3HOY B;  3K0Y A;  4L63 B;  4C3J H;  3TS0 A;  4O7L A;  5ELO A;  5BMV F;  1RDP D;  2MPM A;  3ULL A;  4LF6 H;  4DV6 L;  4O3P A;  4C5C A;  1AZQ A;  4A2B A;  1CHQ D;  2XGQ A;  5K3W A;  4YWM A;  3S2D B;  2PBZ A;  3T9A A;  2PPB C;  1Z2O X;  5BYB A;  3PF4 A;  2JJQ A;  1EYC A;  2YL2 A;  2ZM6 Q;  5CR5 A;  3IG0 A;  1CHP D;  1RD9 D;  2BA1 A;  3GTJ H;  3RTX A;  5EAY A;  1JDB B;  5EPL A;  2VS1 A;  4E4T A;  5IGC A;  3BVZ A;  1S10 A;  2SNM A;  1QUQ B;  2SDF A;  4M8A A;  1XNR H;  2VXW A;  3NGD A;  2IBK A;  3CCS A;  4O3Q A;  3VNN A;  5KG1 A;  1HR0 Q;  1VQB A;  1SDF A;  4EX5 A;  1L0X B;  1HR0 W;  2L4N A;  2Y4R A;  3GLK A;  2K33 A;  4MA0 A;  2N78 A;  1OXT A;  1JC7 A;  3A7A B;  4LFB L;  2F0H A;  2XVS A;  3VPB A;  3Q8R B;  4N9T A;  4RA8 A;  5D1O B;  4JV2 A;  3WDN A;  3N40 P;  2Q2T A;  2J7Z A;  3MFI A;  3K3V A;  1SR3 A;  4C3I B;  1CKM A;  4A3G H;  1CE8 A;  1XMQ Q;  3M7N A;  1VMP A;  2F0D A;  1E0B A;  1LTB D;  1KAA A;  4RFB A;  3GIJ A;  2UUA H;  2KCM A;  1CZW A;  4DR1 Q;  4X62 H;  1HNW H;  4CDF C;  1U4P A;  5DM6 3;  3V05 A;  1I7L A;  1Z6H A;  5KFG A;  4J9P A;  2K5Q A;  4B3R Q;  1OWT A;  5DG9 A;  2JA7 B;  5M3F H;  3V6J A;  2ASL A;  4MN3 A;  1SE3 A;  1YNJ D;  4J9N A;  2WB1 G;  2PMZ E;  3TII A;  4EYH B;  1OXV A;  2QYZ A;  1VQI A;  1RKN A;  1KUT A;  2W6Q A;  2HJW A;  2HQL A;  2JEF A;  4RWS C;  4PMB A;  1Q1E A;  4OO1 I;  2B2V A;  2DWC A;  2OQK A;  3GV8 B;  2PCF B;  1EQT A;  2ASD A;  2AWN A;  2EYF A;  4H13 C;  4P2C B;  4X64 H;  2EY1 A;  3PIO A;  4L6T B;  3M4O B;  3CQZ H;  1JE4 A;  3S1M H;  4RB1 A;  5EOY A;  3DM3 A;  1E1T A;  2E5L H;  2WFW A;  4JV1 A;  4LK1 C;  1DOL A;  3RLN A;  5KT5 A;  4H02 A;  1NMF A;  4QY7 A;  3TDQ A;  4BXX H;  1KD1 C;  3FP9 A;  4MNO A;  1WYD A;  1SYD A;  2K50 A;  4A3M B;  1Q90 A;  5FPO A;  4IUR A;  2JA5 A;  2JA5 G;  4NXN Q;  4RNM A;  3KF6 A;  4MV4 A;  2JA7 G;  2L1B A;  3CCM A;  4ED6 A;  2WB1 B;  4DUZ L;  3OOC A;  4G4K A;  3ER0 A;  4B3S Q;  1G2T A;  1PVO A;  3J80 i;  1GUT A;  2XCA A;  2A6H C;  5FKA C;  1I4G A;  5KFK A;  1EKV A;  1G2W A;  2D62 A;  2NZH A;  2Y0S E;  2W7O A;  3I4O A;  2QDL A;  4A2A A;  1RHP A;  2KEC A;  2FK1 A;  1NAP A;  1M8A A;  4WBN F;  1J9O A;  5LYJ F;  1S5D D;  4C3I G;  5IGB A;  2W7P A;  1DOK A;  5C0X G;  4A3E G;  2GQR A;  4I7H A;  2F0V A;  3I7F A;  3CCR A;  2E2I H;  4NMZ A;  5M5X H;  4WJ4 A;  4IWX A;  1PRT B;  1SMY D;  2JXM B;  2NU8 B;  2FLN A;  3KJP A;  1LAC A;  1EZ8 A;  5D8D A;  4EBC A;  1E2W A;  1CZG A;  3WOE A;  3VDY A;  2NWG A;  1ZYR D;  1STE A;  2F0J A;  3RF2 A;  1TT2 A;  4LF9 H;  2R7Z A;  1Z47 A;  2W6O A;  2VNU D;  1VQF A;  4X62 Q;  3J81 E;  2JA8 B;  4HIK A;  1VKZ A;  1EYZ A;  5JQW A;  2MP1 A;  2TMP A;  2VQE H;  2J6S A;  3T53 B;  4DV2 H;  4O3O A;  2IX3 A;  4XT1 B;  1C7Y A;  3FPU B;  1QCB D;  4ECY A;  5HY6 A;  1V1P B;  3J81 c;  4HID A;  4RH6 A;  3C2P A;  5LOV F;  1Y1W G;  3RV4 A;  5FNV F;  1S68 A;  3NWT A;  4A3D H;  4DV7 H;  2E2H A;  3J81 i;  2EYL A;  3BAA A;  3CF5 A;  3GTK H;  2H1E A;  2DGY A;  2NYZ D;  5C3E G;  4DR1 L;  3QQM A;  3RUZ A;  3EA6 A;  4DNI A;  2R7K A;  3GJX B;  3STB C;  2QDB A;  5I5U A;  1LAB A;  3WNZ A;  1OXX K;  2Y0S A;  1FR3 A;  1EFW A;  4JI3 L;  4LF4 L;  4JI1 Q;  2AQ3 B;  4AYB A;  2CFM A;  2RGV A;  2R82 A;  3V96 A;  4OIJ A;  1NJI C;  4MV8 A;  4UCO A;  3U0G A;  3PW0 A;  4IR1 A;  4JI1 H;  1IHZ A;  3GTP A;  3UI2 A;  5CV4 A;  4DK0 A;  4CGY B;  3I4M B;  2K52 A;  2F0M A;  2DUD A;  3P7J A;  4AQY L;  1PTO F;  3Q8D A;  1F2M A;  3JC6 6;  1HJP A;  1NR4 A;  1TY0 A;  2AUK A;  1XJV A;  3RV3 A;  5C1P A;  2BR0 A;  4KN7 C;  4DR6 H;  1STA A;  1W2B A;  3LWE A;  4HJ5 A;  1WTP A;  4R4I A;  1B9N A;  1I3Q A;  4DK1 A;  3GID A;  3OWF A;  3WOF A;  1I3Q B;  3C3L A;  4O83 A;  1EKF A;  2WAQ B;  2A69 C;  3T4A C;  3TEK A;  3MXU A;  4K6N A;  1RIP A;  5IT9 c;  2CNV A;  1RJQ A;  4IFD H;  1S40 A;  2PMZ A;  2JA5 H;  1QOH A;  2UUA Q;  2XIG A;  2I5M X;  3DXJ C;  4O4L F;  4X66 L;  3T9F A;  1RJR A;  5ELD A;  4UCR A;  4FFL A;  4J0M A;  1TS5 A;  3VR3 A;  2EJ3 A;  1KNA A;  5JJK A;  2UXD Q;  1HXY D;  4MV6 A;  3QG1 A;  1IBL H;  3KDF A;  1C0A A;  2F0O A;  3S9W A;  1XK5 A;  3R5H A;  3R2T A;  5CE8 A;  3QOL A;  2J4X A;  5IOD A;  3S1Q H;  4DAM A;  4OEM B;  5JEA J;  2W6P A;  4A3J B;  4A3B H;  3TRE A;  3PGZ A;  1WFQ A;  2K5N A;  1EOV A;  3K0X A;  4XIG S;  2I07 B;  2QIL A;  1I6H B;  3T5L A;  3OHX C;  5KFA A;  2MJ8 A;  2N55 A;  1U4R A;  3L3O C;  3JAM E;  1B04 A;  5KNB A;  4K6L A;  4OX9 Q;  1Z2P X;  4DV7 L;  4DV1 L;  5E4W C;  5KG0 A;  3PW5 A;  4L5S A;  3NUA A;  3OMG A;  1UAP A;  1UEB A;  4Q4C A;  4DL4 A;  2JEI A;  1P8L A;  1XPU A;  1JB7 A;  1VQ5 A;  4NXM Q;  5IY0 A;  4DV2 L;  5I60 A;  3EYY A;  4Q4D A;  3OSO A;  4JI0 Q;  2WTF A;  1YJ9 A;  3DWQ A;  5KFY A;  4AQY Q;  3RN5 A;  5A2Q E;  3D6C A;  5DGH A;  3BAC A;  5KT3 A;  1C30 A;  3NBH A;  4A3L G;  3EBE A;  2R92 H;  4X64 Q;  5I47 A;  3HOX H;  3RZO B;  2TSS A;  2MNA A;  1H9R A;  3H0G B;  1IYV A;  3HB9 A;  2LY7 A;  3IAY A;  1FJG L;  1N36 Q;  1PTO H;  4OIK A;  4UP9 A;  1TWF A;  4RGT A;  4DV3 L;  5DIS C;  2Z4I A;  3RR5 A;  3C46 A;  4P74 A;  1S5C D;  3PV0 A;  2OTJ A;  5I2Y A;  3BVM A;  4UUG A;  3RAQ A;  4DAY A;  2I0Q A;  2KCT A;  4B3R H;  2FLL A;  2KOL A;  4G7Z C;  4A3J G;  1ESR A;  2ATW A;  3UYY A;  2XTI A;  4C1N K;  1A8V A;  2K14 A;  1EWH A;  2L9H A;  1HNX Q;  5HGT A;  3NP8 A;  1TS2 A;  2GPW A;  5CV6 A;  3VPC A;  4DV3 H;  3K5O A;  4ZAI A;  4DF7 A;  3UZB A;  3SE0 A;  2KQ3 A;  1J6Q A;  2KHJ A;  4P72 A;  4I50 F;  3BQ1 A;  1TXY A;  4GLA C;  4LF8 Q;  1XXG A;  1YHA A;  2RHS B;  4EFB A;  1DXM A;  1T94 A;  4JI4 Q;  4NZO A;  1IL2 A;  1E1O A;  4S3S A;  1VMC A;  4APV A;  1AUX A;  3K80 C;  4RB2 C;  1HA5 A;  2GPS A;  1YNX A;  2FB9 A;  3KLW A;  3CCJ A;  1I1K A;  2KCC A;  3RGX A;  2RDI A;  1DOM A;  1VBG A;  4EBD A;  1DV2 A;  1DGS A;  3N6R A;  3NQI A;  3HKZ E;  4PV1 C;  3NEL A;  4OX9 H;  1A63 A;  4FS2 A;  1KAW A;  4DR7 H;  5KYL A;  4DV2 Q;  3JSL A;  3KAK A;  3W1G A;  5LMU Q;  4QWD A;  4JI0 L;  1RTO A;  4RKL A;  3HOV H;  3N8D A;  1TS4 A;  3D4R A;  2F0G A;  5KT4 A;  3PW7 A;  3K5N A;  3CCQ A;  2HUG A;  2DIK A;  2KVM A;  2R7L A;  1ONL A;  3HOW G;  3SK8 A;  2XSC A;  3CPF A;  4IZ8 A;  4X3U A;  1CS0 A;  3ETJ A;  1O75 A;  4Q0Y A;  1T3N A;  3AX6 A;  1YBY A;  1QB5 D;  4R8N A;  2AGQ A;  4GNX A;  1N33 L;  4PDB A;  5BPF A;  3T13 A;  2NUC A;  3NWS A;  1EHI A;  2ZJQ A;  1SMX A;  5BWR A;  2JSO A;  3DEO A;  4ECQ A;  3QWU A;  3I4N H;  1S0M A;  3IN5 A;  5BPH A;  4XZ3 B;  4XXE A;  3WWV A;  4DUY Q;  4L5R C;  3F2D A;  2L11 A;  3GIM A;  2PW5 A;  1GUN A;  4KY6 A;  3J7A K;  5G3L D;  3E6Z X;  2HIX A;  3MVV A;  2W8L A;  2KHS A;  1XNR L;  3VYR A;  1LM0 A;  3IFT A;  1WR2 A;  2K28 A;  4KKS A;  1TWF H;  2ODT X;  3GIP A;  1X55 A;  5LL6 b;  1A6X A;  3ORR A;  2B29 A;  3MWE A;  2FK3 A;  4JI8 H;  3JZI A;  2HVR A;  1KDC A;  1PH4 A;  2CWA A;  3SDZ A;  4IOC A;  2B2W C;  4H44 C;  1QE6 A;  4EG0 A;  4UP8 A;  4EVO A;  5I5S A;  4F4W A;  2VY3 A;  4KHP L;  2Q8I B;  1ICF B;  4M0J A;  3A54 A;  2GVA A;  1IZ6 A;  2WAQ E;  4ECT A;  1GSH A;  1STY A;  3EIV A;  1XYI A;  4OWT B;  1B53 A;  1MZB A;  3HOU H;  1UEA B;  3U55 A;  1S97 A;  3M7G A;  5EKK A;  1TWG H;  1Q12 A;  4J9S A;  1IOV A;  4EGJ A;  2Z8L A;  3OSN A;  5KFF A;  2QKI C;  4LFC Q;  1U4L A;  1HCZ A;  5GAH C;  4IJH A;  2K5V A;  4IO9 A;  2CH4 A;  4PNY A;  2QEX A;  3GV7 B;  4J9Q A;  2K05 A;  3KAJ A;  1HZA A;  2F0N A;  5EBC A;  3SGI A;  4O86 A;  1NUC A;  1K8A C;  5IGF A;  2PYK A;  4C56 C;  1LTA D;  4KTA A;  5D65 A;  2PVP A;  3MA2 B;  4OWW B;  4OHJ A;  2XD4 A;  3TY5 A;  5T14 A;  3BYT B;  1WTR A;  1IBM Q;  3EPG A;  4RGO S;  2EYO A;  4X3T A;  2KBN A;  2EIY A;  4FE2 A;  1MIU A;  3R9R A;  2FMM A;  4ETS A;  1V1Q A;  5JVG 3;  1N36 H;  1IBK Q;  3RJ0 A;  2D9U A;  4JC0 A;  4QUC A;  1A0G A;  4KY7 A;  3TIG A;  4ECX A;  5IT9 E;  1JE5 A;  2EY6 A;  4CC5 A;  4DL7 A;  2IP4 A;  2KJX A;  5IYD G;  2CW8 A;  3V6K A;  2VQE L;  5TSS A;  1I4P A;  2O03 A;  1E3P A;  4ED7 A;  2YTY A;  1B6R A;  1DIK A;  3G71 A;  4BY7 G;  2R93 B;  4NXM H;  1O7I A;  5IGE A;  1GGO A;  5KFD A;  5CGK A;  3CRK C;  4IAJ A;  3AU7 A;  4HJA A;  4A76 A;  2W6N A;  1K1S A;  1EYD A;  1BCP F;  3H0G A;  5IYB G;  1M6V A;  3HOV G;  4HCE A;  4TUY F;  5C3X A;  5FO9 B;  2VUM H;  1F9S A;  4A3I H;  2J0T D;  2K5H A;  3NHH A;  4KK7 A;  1GUO A;  4AYB E;  4AIM A;  4M9U A;  1IYU A;  2EXZ A;  3H6M A;  2OEO A;  1M0T A;  2LS0 1;  2BH8 A;  1PTO C;  2EY2 A;  3NC0 B;  4I65 A;  3S17 H;  2F4V L;  2PZT A;  4ZOL F;  4IUU A;  2YW2 A;  5M3F B;  1K8O A;  4MV1 A;  4RKB A;  3S2H B;  3RAX A;  5C44 G;  2WYO A;  3HS0 C;  1EY0 A;  4O2D A;  4OGQ C;  4ABN A;  3LML A;  1WRV A;  4ED0 A;  1D1I A;  3LWU A;  1VQN A;  2W9B A;  4X65 L;  1X6O A;  4KMU C;  3J80 L;  3GTM B;  2FP4 B;  1HNX H;  4LSA A;  2CQA A;  4OON A;  2ABJ A;  4HIO A;  3LQS A;  3A8J E;  1EYG A;  3QZ8 A;  1WOC A;  1HH2 P;  2AHO B;  1ENF A;  4LF6 Q;  2OXP A;  3U9S A;  4YR0 A;  2CNQ A;  3TS2 A;  1VQK A;  2WAQ A;  2HQE A;  1LT5 D;  2FIN B;  5K36 G;  2YS6 A;  4TV9 F;  2JN4 A;  1O80 A;  2KCN A;  2PMZ B;  1JQY D;  5DMX A;  4QWC A;  2XRS D;  5CR3 A;  3J7A 5;  1NCV A;  1TWG A;  4K0K H;  3KYH C;  4Q8E A;  4WRD A;  1T5E A;  1HNW L;  1KC7 A;  1AN7 A;  2ZTE A;  3H09 A;  3M4Q A;  5LMN L;  3CRL C;  4O3R A;  2K7V A;  1FNW A;  1STG A;  1SMY C;  1JWM D;  2IMW P;  1B8A A;  2RDG A;  2OT2 A;  3T1Y H;  4JYA L;  5H80 A;  1A3T A;  5KFV A;  3OTO L;  4CC6 A;  1EY5 A;  4MTK A;  1H9J A;  1TII D;  4GS3 A;  1PH1 A;  1E4E A;  2NVT H;  2LSS A;  1BR9 A;  1M90 C;  2AQ4 A;  1H9M A;  4A3B B;  3AFP A;  1BXR A;  1HR0 L;  4DNR B;  3CCV A;  2WDT A;  4FYD A;  2G5D A;  3CP0 A;  2JA7 A;  1G6P A;  3BDO A;  1M7J A;  1ZET A;  2ASB A;  4JI4 H;  5C3E B;  2UUC L;  1D8L A;  1SE4 A;  1H9K A;  1YHQ A;  3BJY A;  1C8C A;  4ULL A;  1IBL Q;  2F3W A;  3OMC A;  4GKJ L;  5EKI A;  3UDG A;  5AFW A;  4ID6 A;  3E9I A;  5DEH A;  4JI5 L;  5I2X A;  5KG3 A;  1B33 N;  3H15 A;  5IWA Q;  4CDE C;  3H3V I;  4O7N A;  2W9C A;  1J5E L;  3DTF A;  5KG5 A;  3BQ2 A;  3PVX A;  4WJW A;  2EJM A;  1UWV A;  3D4W A;  4F4X A;  3GB8 B;  1W96 A;  3VR6 A;  2VUM G;  4L1K A;  5JH7 F;  4DR3 H;  2NTT A;  3RB4 A;  2NVY B;  4LF6 L;  3JAM L;  4TQR A;  3A5U A;  2RSN A;  2EYP A;  4HR7 A;  2YTV A;  4YWK A;  2VUM A;  4K6D A;  2NUA B;  5KFW A;  3AEV A;  2VOB A;  2VUM B;  5L9X A;  2B3G A;  4YHH H;  4BY7 H;  1NMG A;  2EYH A;  4DR6 Q;  4Y52 H;  2YZG A;  3OIP A;  5E4X A;  4BBR G;  5CAE B;  2PZU A;  4YJ3 F;  5KFT A;  3K8A A;  2JA8 H;  4ED2 A;  2RDH A;  4JCV E;  4UCU A;  3BG3 A;  2BCO A;  2LKV A;  2CVR A;  1B3Q A;  1E22 A;  1QWY A;  4J15 A;  4JBW A;  3VYU A;  5C4X H;  1JJ2 A;  1AW7 A;  1KHI A;  4A4I A;  1VQ7 A;  1ZHQ A;  3GII A;  1L2F A;  3RB3 A;  1PDQ A;  4EQO A;  3A74 A;  4YIJ A;  2QW7 A;  2Z4H A;  4DRF A;  2VR1 A;  1S5F D;  4PBC A;  3GP7 A;  3KUP A;  2XC9 A;  1TS3 A;  1GSA A;  2VQF Q;  2YYA A;  3URY A;  1SE2 A;  3KXY T;  3GTL B;  4A3G B;  1LTS D;  3TZD A;  3SEB A;  4X3S A;  2KHI A;  3NE5 B;  3LUL A;  2HD3 A;  4RCN A;  1KJQ A;  3KLR A;  3KF8 B;  4ZKC B;  1AH9 A;  1PRT C;  3DLL A;  1EUD B;  4DV5 H;  3V6H A;  1OBG A;  4J9O A;  2Y0S G;  1GVP A;  5JVH 3;  4RHS A;  5IGD A;  5FO8 B;  3P20 A;  3L7Z C;  3CVZ A;  4LF8 H;  4JW0 A;  2QF7 A;  4DGZ A;  2E2H B;  1EL0 A;  3T7A A;  2UVR A;  3J7A F;  2UVV A;  3I55 A;  5IWA L;  3I4M G;  1FD7 D;  4H0L C;  2PQA A;  3V4Z A;  2OLS A;  3I4M H;  3S16 H;  3L0O A;  5T1G A;  3R93 A;  1CA5 A;  2SNS A;  2JA7 H;  4DR5 L;  4O7R A;  1KDA A;  4GNX B;  1TR5 A;  4NZM A;  4FS1 A;  3MXN A;  5C5L A;  4ALP A;  3FVQ A;  3GTP H;  4DR4 Q;  5COY A;  2RF4 A;  2ZGI A;  4XT3 B;  3S1M B;  2RDF A;  1IKL A;  2PI2 E;  3K59 A;  4AYB B;  4ZQ3 A;  3GTP B;  1I6H H;  2B63 B;  1VQ4 A;  4DLK A;  2B2T A;  1HZ9 A;  2B63 A;  4MV9 A;  1HHV A;  4DV0 H;  2ATL A;  1X3G A;  3G6X A;  4EEY A;  4IUP A;  4FFP A;  2CW7 A;  4MA5 A;  2D5D A;  1YJW A;  5FD5 A;  4EQP A;  3FKI H;  1I3Q H;  3NXW A;  2UXC Q;  1EEI D;  4JI4 L;  1HUM A;  3KLS A;  4JV5 L;  2F0S A;  2F3I A;  4UAI A;  5IT9 W;  1WD0 A;  2UUB L;  1QZH A;  2OCE A;  4LMQ D;  4CDD C;  2C22 A;  4FU0 A;  1V8Q A;  3PUZ A;  4BY1 G;  2JA6 G;  4ZHQ F;  1LTG D;  4C5A A;  5HUR A;  4JBJ A;  2JA6 H;  3JRX A;  4RZQ A;  4CKC A;  1G91 A;  5I5Y A;  2JP1 A;  1G8Z D;  1G51 A;  1YEZ A;  1AE3 A;  4OO1 H;  4QCL A;  3WO1 A;  1JX4 A;  1RYS A;  4JYA H;  1PFN A;  1TA8 A;  3PO2 B;  4YR2 A;  3EPI A;  4LW1 A;  2C9O A;  5EPK A;  3F2U A;  2X6G A;  3HOW H;  2DZD A;  2N88 A;  1CKN A;  5I5T A;  2M05 A;  4QGU A;  4O4H F;  2QK4 A;  1E4F T;  4KJO A;  2HCI A;  3TN2 A;  3A56 A;  5FLX c;  3MZ5 A;  4HJ9 A;  2C2E A;  4YQW A;  4A3J H;  3RBD A;  4M7E A;  3BZD B;  1N33 Q;  2YTX A;  3HKS A;  2J9G A;  3U50 C;  2HCC A;  3E0E A;  1CA6 A;  4TKO B;  3I3C A;  3S15 H;  2OF1 A;  2RVL A;  4K8J A;  3LP8 A;  1QZG A;  2YZN A;  3M3Y B;  2W57 A;  3M4Y A;  4P75 A;  1HFN A;  5BWX A;  1RK6 A;  3ORQ A;  1BCP D;  3A0J A;  4MTE A;  2KSW A;  4JV5 H;  1I4H A;  4LFB Q;  2YU9 B;  3J7Z C;  1VQ9 A;  1OXU A;  5LMU H;  4DL6 A;  3O13 A;  4LF7 H;  3D6W A;  2Z02 A;  4X65 H;  2DJF C;  2OTL A;  3TP5 A;  5M3M G;  4ZI7 F;  1E7Z A;  1UE1 A;  2R93 H;  5KT2 A;  1IBK H;  2V9W A;  5KFM A;  3TME A;  3L4J A;  1JCK B;  2R7N A;  2FJ2 A;  4GN3 B;  3PIP A;  4DA2 A;  5I4D A;  4BWS C;  1WTQ A;  3GV6 A;  4K14 A;  4O3N A;  3K5M A;  2R93 A;  2IPK D;  4BBS H;  2C5C A;  5HV6 A;  3OUZ A;  4O4J F;  2IY5 B;  4C3J B;  1SYG A;  2WKD A;  1U5K A;  2WV6 D;  2JQO A;  2KEN A;  3ND8 A;  1A9X A;  3U4Z A;  1E2Z A;  4HJ8 A;  1SBB B;  3AYH B;  1GKH A;  3ZJY C;  5JPM C;  2WAC A;  1MHW C;  1TWA H;  1WCM G;  1K83 A;  1L1O C;  2R92 A;  2N8N A;  3CXC A;  1ZYR C;  1K83 B;  2F52 A;  4NP5 A;  3UE0 A;  3UZO A;  2E2D C;  4ED8 A;  4A3I B;  1Z9F A;  1JOR A;  2V58 A;  3CQZ A;  5LMN W;  1SFO B;  1VAJ A;  2MFI A;  4G7H C;  5ELF A;  1O78 A;  4B3T H;  5DLQ E;  4LF5 L;  3NUC A;  4L8J A;  3QZ7 A;  2HVQ A;  3I70 A;  3NTK A;  4QIW B;  3H91 A;  1SFO H;  4GKK L;  1H95 A;  3HT5 A;  2YRW A;  3PO3 G;  3FEW X;  4O42 A;  3S2H H;  1BBW A;  3PUV A;  5LA6 F;  5KFH A;  5DG7 A;  3IFD A;  2EOT A;  3GTQ A;  4A93 H;  3D0F A;  1CSP A;  4JI8 Q;  3SR1 A;  1T5X D;  3W3A A;  4DV7 Q;  4Y8V B;  3IRB A;  1F2Y A;  1JMC A;  2L5T A;  3ICE A;  4B08 A;  1WTV A;  1JDE A;  3DWA A;  1EY9 A;  1JKJ B;  1PZK D;  3CKI B;  4A3B G;  3RFC A;  3VOT A;  1A0I A;  3G6V A;  2F0T A;  2B8G A;  4MZ9 A;  4OO1 G;  2HVS A;  4O7V A;  3GQB A;  4YCV A;  2R87 A;  4FGR A;  1SXT A;  4ZLT F;  3GV5 B;  2ZDH A;  3V4S A;  1PRT D;  1OBD A;  2E2I A;  3NBY B;  3JAM i;  1DM0 B;  5CBA E;  3I4L A;  1TWG B;  3SK4 A;  3PIO 3;  3K5H A;  4J9R A;  4EFE A;  4KKT A;  1SYF A;  4KY5 A;  3FMC A;  1CQJ B;  4HNT A;  1W6K A;  1WTX A;  1TWC H;  2C28 A;  2E8G A;  3VYT A;  1I94 Q;  2RBM A;  3BYY B;  3GV3 A;  5HBR B;  1Q3L A;  2OWO A;  4YCU A;  4XQQ A;  3I4N B;  4DNT B;  1NE3 A;  2L12 A;  4FXK C;  5ELB A;  5ELN A;  3CCE A;  3NEN A;  4HMI A;  5FPR A;  4KHP H;  1PFM A;  3PO3 B;  4CHT B;  1I94 H;  4LWC A;  4B3S H;  3STB D;  1QNU A;  2PZW A;  4J9K A;  3P75 A;  2A6E D;  4GN5 A;  3CMA A;  2XWB B;  4DV4 Q;  2F4I A;  3PO3 H;  5CA1 F;  3GQC A;  3R2I A;  3WO0 A;  2XIW A;  4QB4 A;  4GNX C;  1W6J A;  3ND9 A;  1XMQ L;  5IYD H;  4JI7 H;  3MR3 A;  1RCV D;  1HTL D;  2DY7 A;  4V0B A;  4XYM B;  2VB2 X;  3FKI G;  4LF7 L;  5KFJ A;  4XX0 B;  2UUC H;  1F9Q A;  5FR9 A;  1LLR D;  2E2J H;  3T1H H;  4R4C A;  2DLN A;  4YY3 L;  3FHW A;  4IJL A;  2X0S A;  2EIF A;  4LH6 A;  2L15 A;  3KK7 A;  5KFZ A;  1OTC A;  3GTJ A;  3BS1 A;  2BQU A;  3T56 B;  3HOU B;  2COI A;  1PV4 A;  4Q44 A;  1AFP A;  4EEQ A;  1X56 A;  1KJ9 A;  1I2K A;  1AZP A;  3P1H A;  4N8X 1;  2R7Z G;  5JVL A;  4MHE A;  1XMO H;  3M85 A;  5HNE A;  5T1I A;  2ICI A;  1JOQ A;  1XPO A;  5BN4 A;  3TW6 A;  1D5Z C;  1HNZ Q;  3VA7 A;  1VQM A;  4GLV B;  4DR2 L;  1PFB A;  2FHT A;  4A3K G;  2RSO A;  2F3V A;  1K0S A;  4FF3 A;  2H4O A;  3HZX A;  3NPP A;  1YNN C;  2R84 A;  4ZK9 B;  2XN9 C;  2CW0 D;  4ZKB B;  4FFR A;  3MFY A;  1I1L A;  4NXN L;  3U4V A;  1L1O A;  1M4V A;  2IWH A;  3JRW A;  4F4Y A;  1I4R A;  2HHH L;  3L4K A;  5LL6 S;  1FNV A;  1VQC A;  1F2L A;  3TBI B;  3TP6 A;  1S72 A;  3BDL A;  2M9V A;  2BE5 D;  2OH2 A;  4U68 A;  3GTK B;  4QJF A;  4F88 A;  5G3L F;  4MTN A;  1N34 Q;  2A1H A;  2PN1 A;  2VUG A;  4JV0 A;  3RIZ A;  2UVU A;  2YU9 A;  3GTL A;  3J7Y W;  1HQM C;  1I50 H;  4GKJ Q;  3IKJ A;  1RJP A;  4CJ2 C;  5C5M A;  4IPD A;  2NZ1 D;  4XTC S;  4A3D B;  2IL8 A;  2F0E A;  4L5T A;  2VQF H;  1P16 A;  1CQF A;  1TWC A;  2NU9 B;  1GO3 E;  1BF4 A;  4LF7 Q;  2CH4 W;  1NNX A;  2R8G A;  4LMY A;  2H5X A;  5KEE A;  1I94 L;  4KHP Q;  1X65 A;  4HYK A;  3PUW A;  1TU2 B;  1LYL A;  3EVQ A;  1JB3 A;  2V4Q A;  1M1K C;  1EU3 A;  4WJ3 M;  4A3K H;  2UXD H;  2M2L A;  3I2Z A;  5C6A A;  1VQE A;  2I8C A;  3FPP A;  2JE6 I;  4UCS A;  4LFC L;  1JLL B;  5JJZ A;  2VZA A;  2Y0S B;  2PW7 A;  5C4X G;  3RGZ A;  4NXM L;  4K8I A;  1TVX A;  2E74 C;  2G9D A;  1EZ1 A;  2DPJ A;  2CWP A;  4CKE A;  5IYZ F;  2Z04 A;  1XNQ L;  2LXJ A;  4JI2 L;  1IW7 D;  3OIQ A;  4OWX B;  1KTA A;  3GTG B;  5KFN A;  5DQI A;  1IBM L;  4JI3 Q;  1CI3 M;  2BQ3 A;  3GTG A;  2IA6 A;  1SRO A;  3S24 A;  4DAP A;  3TP7 A;  2B2U A;  4HNU A;  5NUC A;  2FMC A;  1M0W A;  1N36 L;  1Y8N B;  3RMH A;  1D7Q A;  2VPQ A;  3J80 c;  1K73 C;  4EGQ A;  1EY6 A;  1HQR D;  4K2K A;  4RGM A;  5J22 A;  1SNP A;  1XPR A;  4RB3 C;  4CJ0 B;  2F0W A;  4OL7 A;  4TVI A;  3PO2 H;  2HDM A;  3TY9 A;  2R7Z H;  5BR8 H;  4BBR B;  4DV6 Q;  1WD1 A;  4C3H H;  1AN8 A;  3K6O A;  3KFU A;  3Q1K A;  4HTH A;  4C3H G;  3CME A;  1YHB A;  2BH2 A;  1U4M A;  5KYI A;  3HFZ B;  1FGU A;  4NLG A;  3MEH A;  1WCM B;  4XYL B;  2XWJ B;  1WCM A;  3HKZ G;  2HDL A;  3CC2 A;  4X66 H;  1EIH A;  3H94 A;  3J80 W;  3LGJ A;  3RLF A;  5D1O A;  2HHH Q;  2I80 A;  1PZJ D;  3S15 B;  5GON F;  1EEF D;  4FO2 A;  4ECR A;  3CU7 A;  5GQO A;  4JI2 H;  2B2Y C;  4KD4 A;  1LO5 D;  5IE8 A;  2A68 D;  4A3F H;  3I8Z A;  2K1B A;  1KL9 A;  1QVF A;  1AUV A;  4R7R A;  5C1O A;  1VF5 C;  3C1F A;  1N32 L;  2YV5 A;  3G4S A;  2VL6 A;  4A3F B;  1RK5 A;  2EZV A;  4FNF A;  2F0Q A;  3HP3 A;  4DU9 A;  4RNN A;  5J2U F;  3BVG A;  5KX5 F;  2PO4 A;  3TQT A;  1VQD A;  4JG2 A;  4A3I G;  1QIL A;  1YNJ C;  4RB0 A;  2EQS A;  2K5D A;  2R8J A;  1KEE A;  5LMU L;  3TIN A;  1EIG A;  2B2U C;  5DQG A;  3H4B A;  4YJ2 F;  4JI2 Q;  1GD7 A;  1VDZ A;  3GIK A;  3TRZ A;  1S5E D;  1V1O A;  2VPS A;  5IIF A;  1HR0 H;  2HIV A;  5H1S E;  1R9T H;  3SVM A;  5E1F A;  2K5W A;  1U9R A;  4J8Q A;  1VQJ A;  4DV1 Q;  4IFD I;  3J81 W;  2K75 A;  4ZYS A;  4GC7 A;  5ELC A;  1EQV A;  1S9F A;  1Q82 C;  3ZYY X;  4O7Z A;  3CPW A;  3Q24 A;  1N33 H;  2JK8 A;  1LTT D;  3VR5 A;  4HSP A;  1ASZ A;  3U9T A;  5KFI A;  5LMN H;  2EXD A;  1STB A;  3N52 A;  4RG1 A;  1W3S A;  5KFP A;  3G7L A;  4JI0 H;  3MR2 A;  5I6Y A;  5LMN Q;  3TQY A;  1GJX A;  3T9B A;  4RUA A;  3C1E A;  2HGX A;  2EE1 A;  4IFD G;  1JJG A;  3PW4 A;  2HHH H;  4FF1 A;  4R1J A;  1XNR Q;  2Z6K A;  2HGW A;  4KI0 A;  1H9S A;  4DL2 A;  4QF4 A;  1FJG Q;  4ME6 A;  1PFS A;  4NXN H;  4A93 G;  3S17 B;  5KS8 A;  4NDX A;  3I90 A;  5I9P A;  2JA9 A;  1PLF A;  3CCL A;  1MKH A;  1WTO A;  4I7Z C;  1E4G T;  1B7Y B;  4B9X A;  5BWW A;  4ZUJ A;  4Y7N B;  4CDC C;  2ZJP A;  4DR2 H;  4CKB A;  1YIT A;  4LF9 Q;  3GTM H;  2D0O A;  3R5X A;  3Q8S B;  4F87 A;  1IYE A;  1K9M C;  4NB3 A;  1RF2 D;  2BOS A;  3Q23 A;  3ONA B;  1XMO L;  2W70 A;  5L1L A;  2RCN A;  1JOO A;  1X9N A;  1N32 Q;  1PYW D;  5DGB A;  3RN2 A;  4FBT A;  4C2M B;  1FYC A;  1NBW A;  3E0J A;  5JPN C;  3S1Q B;  4C2M A;  1DYQ A;  2GVB A;  3FRP B;  3PO2 G;  2NVX B;  3VYS A;  4TV8 F;  4ECU A;  3CC4 A;  5KGU A;  3Q8Q B;  4J9L A;  5CA0 F;  4HQ6 A;  2I5H A;  2ZTC A;  3TEH B;  3QB3 A;  1BUV T;  3HOZ H;  4XQJ A;  4FFN A;  4Q43 A;  1CUK A;  1STN A;  5M3M H;  2UU9 L;  2A8V A;  3OUU A;  4QUF A;  3BA8 A;  5KFS A;  5C3E H;  2AKW B;  3SHL A;  4GZY C;  5K36 H;  2Z9H A;  2Q7D A;  2WE6 A;  5IWA H;  5L1J A;  3PUX A;  2A6E C;  1EUJ A;  4ILW A;  5IP9 G;  1PH3 A;  4O7S A;  1O7L A;  1JXL A;  1Y1W B;  4DL3 A;  2VA2 A;  5F9N A;  2XCP A;  4FBU A;  3HO8 A;  2MO0 A;  4IUN A;  1CT1 D;  3VPD A;  2F0L A;  3GTO B;  2MHV A;  2QA4 A;  3PW2 A;  2BDN A;  3X3M A;  4JOI A;  2FMA A;  5E7N A;  3HOX B;  3RZO H;  4GKK Q;  4JXU A;  5KT7 A;  1LTI D;  4JUZ A;  2UXC H;  4O7T A;  4B9W A;  2GN5 A;  4HMJ A;  3BQ0 A;  2IHE A;  3S14 H;  3DF7 A;  1OXS C;  5CMD A;  1Z2N X;  5C0X J;  2NU7 B;  5AJ3 L;  4ECW A;  3Q0A A;  2IHF A;  1KJ8 A;  5IYC H;  3DEP A;  2BA0 A;  4L5Q A;  4LJZ C;  3Q8P B;  4CMF A;  4TQS A;  3MXP A;  4LUZ A;  3KHL A;  3Q6S A;  4DR5 Q;  5M5Y B;  5KG4 A;  2ICE C;  5KNC A;  1LTL A;  4DUY H;  1N9W A;  2DNC A;  5I5W A;  2EJF C;  4JI6 Q;  1TWH B;  2KA7 A;  4RUC A;  4V19 0;  3M3Y H;  3BJU A;  1BDO A;  1EU4 A;  1ET9 A;  3H3V H;  1TWA B;  2NN6 G;  3MFG A;  5C4J B;  3CC7 A;  4TSS A;  4IIJ F;  2B39 A;  4IRK A;  2N3S A;  3K58 A;  3SK6 A;  4TQU S;  4BY7 B;  4LFB H;  5LXT F;  1FGB D;  4UY8 C;  3GIQ A;  1IXR A;  1R4P B;  2JEA I;  2RDJ A;  1K8M A;  4IRD A;  1S5B D;  3QR8 A;  1HZC A;  1EY4 A;  4DR3 L;  1EZ6 A;  4ED3 A;  2A68 C;  1GYF A;  1L1O B;  1HTP A;  2YZL A;  1XMO Q;  1Q1B A;  5KKN B;  1DJR D;  2ZDQ A;  1D5M C;  1GLV A;  5C5J A;  4DQN A;  4QL5 A;  3L2P A;  3MR6 A;  4O1N A;  1E4E B;  4RNO A;  4UCV A;  4I4T F;  3QJY A;  4LUO A;  3CEB A;  1YJN A;  3RUP A;  2UXD L;  5GRO A;  1FKA H;  1Y1V B;  2JEB I;  3S1N B;  5M5W H;  1PZI D;  3GDE A;  2UU9 H;  2SEB D;  4A3K B;  3FDT A;  3W5O A;  2FXQ A;  4DV6 H;  5EKL A;  1X3E A;  3F8N A;  2EJ2 A;  1I50 B;  2QGQ A;  1EWI A;  2UU9 Q;  4C3I H;  2VA3 A;  1F9R A;  4C2M H;  4UFZ A;  3HOZ G;  3HOU G;  2RCF A;  3HBL A;  1ZAU A;  3RB0 A;  1WTW A;  4IQZ A;  4JI7 Q;  3OTO H;  1IBK L;  1N8R C;  2WP8 J;  5IGG A;  5D1P A;  3KHG A;  1SRU A;  3K5L A;  4JI3 H;  1DON A;  1Q81 C;  1UC9 A;  3HOZ B;  4UDU C;  1KT8 A;  3EQL C;  5DAU A;  1HRJ A;  2KEE A;  4A3D G;  1HNZ L;  5CM0 A;  3J80 E;  4ME3 A;  1SJH D;  2NVY A;  2YCH A;  1UC8 A;  3MC0 B;  5D3I B;  3RZD H;  1RJT A;  1SEB D;  3JAM c;  1ILQ A;  4BWG B;  1TWF B;  2P0A A;  4YR3 A;  1SAP A;  2E76 C;  1SFO A;  2AUJ D;  5AJ3 Q;  4BS9 A;  4R8U A;  1F77 A;  4P71 A;  2JA6 B;  2RHQ B;  1EY8 A;  3CQZ B;  5I5V A;  1BJT A;  1ET6 A;  2YYZ A;  4XYO A;  4JPB W;  2V1C C;  4J6H A;  4IRC A;  1KC8 C;  5FLM H;  3G8D A;  5GAE C;  2L0C A;  2R61 A;  5FLX E;  5K5P A;  1EIY B;  4YB8 B;  3FKI B;  1L2Z A;  4KKU A;  2RKS A;  3FKI A;  3U58 A;  3DMU A;  4DR7 Q;  4DAA A;  1HNX L;  4NYE A;  4E6I A;  3F2B A;  2F0I A;  1B6S A;  1KBL A;  2I87 A;  4PWQ A;  1X3F A;  1S0N A;  1NY4 A;  2DJG C;  3T1Y Q;  4ECZ A;  4ZCK A;  3I91 A;  3S1R H;  3HOY G;  1HA6 A;  1K8G A;  5JEA G;  4G3I A;  2HGS A;  2F4V H;  1MBY A;  1Y69 U;  4C3H B;  2NVX A;  2Z1C A;  1SYE A;  2NVQ H;  3N44 B;  2IX1 A;  3KAL A;  2FKL A;  4LF5 Q;  2LXK A;  4RZR A;  2UUB H;  3HOW B;  3K81 C;  5JOB A;  5C8Y F;  5BWT A;  2W9A A;  4BY1 H;  1TWH H;  3EJI A;  4DXF A;  4PMC A;  2ID0 A;  4O7W A;  4JI7 L;  5FK9 C;  1B1Z A;  1WI5 A;  1KDB A;  4Q0F A;  4POF A;  1FL0 A;  2ZM6 H;  3MR5 A;  1S3O A;  1CQV A;  1UE6 A;  1MJE A;  1N32 H;  3GD7 A;  4XDX A;  4EYI B;  1EIF A;  4DKA C;  1D6E C;  2B2V C;  1VQP A;  5DAA A;  4LSX A;  4PG3 A;  3TY8 A;  1SYB A;  4AH6 A;  3MXN B;  5IP7 G;  4YBZ B;  2YRX A;  2C2R A;  3R3O A;  2W6Z A;  5BN5 A;  1BBU A;  2AQ2 B;  2P5Z X;  3S14 B;  1JR0 D;  2R8H A;  3VR4 A;  4IZO A;  3OPO A;  1PH5 A;  5CC4 A;  3MEF A;  1SND A;  4CJ1 B;  1Q8I A;  1WTH A;  1V51 A;  4FXG C;  2DPI A;  1ENA A;  3AB9 A;  4HCS A;  1LT6 D;  3A8I E;  1ET0 A;  5EQ0 A;  5M5Y H;  1EQR A;  1IW7 C;  1BVS A;  2Q8T A;  1C4Q A;  1B9M A;  3DUZ A;  3CAM A;  1ENC A;  1SNC A;  3HOY H;  4A3E B;  4DUY L;  5KFL A;  4FM9 A;  1QG7 A;  4KHZ A;  2W9C B;  1F9P A;  1EUC B;  5A2Q L;  2UUC Q;  3I72 A;  5BR8 L;  4DXG A;  4A75 A;  2UUA L;  2B2T C;  4O7Y A;  4RAU C;  1IBL L;  4LUV A;  1G6Z A;  5BYA A;  1K1Q A;  3G8C A;  5DG8 A;  1LT4 D;  1JJC B;  2R92 G;  5IT9 L;  2EYM A;  3UFX B;  1MI2 A;  4HR7 B;  3PR5 B;  4GOP A;  4HED A;  3K5I A;  2FPI B;  2HDK A;  1EWC A;  4OXP A;  2UXC L;  3K7A H;  1STH A;  4GKK H;  5KFB A;  4MV7 A;  1VQ8 A;  4QSH A;  5FLX L;  2UUB Q;  4I7A A;  1PH7 A;  4LF5 H;  4B3T L;  1CSQ A;  3HRZ C;  3PN1 A;  1PRT F;  4WD3 A;  2EJ0 A;  1TAE A;  5CB4 F;  2SOB A;  3EFX D;  4IAL A;  3A5Z B;  4DV0 Q;  1J8I A;  2A1A A;  2RGR A;  2MQH A;  3HG9 A;  2C2D A;  1IYJ B;  1EYA A;  3G6J B;  4N8F A;  1KLU D;  4DR6 L;  2CKZ B;  2BDO A;  3H3V C;  3JSN A;  3M9B A;  2WKC A;  3E5N A;  5FD6 A;  1SNM A;  1YIJ A;  3QWN A;  2NU6 B;  2VQE Q;  1Q86 C;  2QB5 A;  1Y1V A;  4F4Z A;  2A5H A;  4NZN A;  1BXT A;  3GTK A;  1B70 B;  2DY8 A;  1D5X C;  3ERO A;  3J7A V;  5I6W A;  1I7N A;  4O84 A;  1KXL A;  4J1M A;  2EPB A;  1N48 A;  2CW0 C;  3IL8 A;  3AQQ A;  5C0X I;  5JEA H;  1V4Y A;  2VQF L;  2Z6B A;  2FK2 A;  2Q2H A;  1A62 A;  1BCP B;  4F8M A;  3N43 B;  3DWP A;  2YWV A;  4A3C H;  4BY1 B;  4RHR A;  4IOA A;  1PH6 A;  5IYB H;  5GAD C;  4YAJ B;  2CCZ A;  3N41 B;  1UE7 A;  5EBD A;  2PQA B;  1AEX A;  1JIH A;  2A74 C;  2J6T A;  2XNA C;  3GTO H;  4UP7 A;  2ZDG A;  2F4V Q;  3GIL A;  2HG8 A;  5M3F G;  1TY2 A;  1I4X A;  3T9C A;  4A3F G;  2PI2 A;  1WVL A;  2B2Y A;  3E9H A;  3ERS X;  5DGI A;  4QWB A;  3RBE A;  2AU0 A;  4MV3 A;  5KFC A;  4BBR H;  3Q2O A;  2JA6 A;  4K5X A;  4FFM A;  1T36 A;  5CV7 A;  2R86 A;  1PX2 A;  4FP5 D;  1Q7Y C;  1BKB A;  1A2U A;  4HSV A;  4G57 A;  1SNO A;  3CW2 C;  5EWE A;  4LF9 L;  4DR4 L;  1HFG A;  5BR8 Q;  5KFQ A;  3T5H A;  5IYC G;  3GTM A;  2GLT A;  5M5X B;  1VQG A;  5KFX A;  1K3B C;  5DNF A;  2X6L A;  1YZ6 A;  1ESF A;  2DAA A;  2B63 G;  5JJI A;  2LMC B;  2XGP A;  4BXX G;  3UQ8 A;  3W2D A;  2HHF B;  4PMW A;  2IW3 A;  5JAV A;  3LWB A;  4JI6 H;  2HHF A;  4X65 Q;  3MJF A;  4U67 3;  5F2D A;  3MHB A;  2F03 A;  1ULZ A;  4UCT A;  4U6P A;  3H4D A;  2RQX A;  3RD4 A;  3DM1 A;  1XNQ Q;  1BGW A;  4R4T A;  4YY3 H;  4KV6 A;  4BA1 I;  4B3R L;  5J39 A;  1JT8 A;  1X3Q A;  1XWE A;  3EN2 A;  4KHV A;  4DUZ H;  1CKN B;  4UPA A;  4A3M G;  3WWI A;  1GUG A;  4P73 A;  4DPG A;  4DV0 L;  1XMQ H;  4R4O A;  4ECV A;  1FJG H;  5COR A;  4C1N I;  2COJ A;  1PH8 A;  3ULJ A;  2A19 A;  4LH7 A;  3N42 B;  2ZJT A;  5IP7 H;  1ZKO A;  3N6X A;  2YU9 H;  5D14 A;  3MWD A;  4F50 A;  4KLK A;  2CNU A;  3BG5 A;  3S1N H;  3C0F B;  4ED1 A;  3PR4 A;  2E75 C;  4M1U B;  4YWL A;  2W71 A;  4O4I F;  4LFA Q;  3T99 A;  4DR5 H;  2R7F A;  1U0L A;  5BWV A;  3BZK A;  4X64 L;  5KIX A;  4JBK A;  3KTM A;  4RU9 A;  2L55 A;  1DCZ A;  1VQH A;  2V5A A;  1BOS A;  3VA5 A;  5K2M A;  4FFO A;  4JYA Q;  2ZXO A;  2CQO A;  1B44 D;  4IUV A;  4DV1 H;  4FVM A;  1I50 A;  4RCO A;  3KBG A;  3G6E A;  4R4Q A;  3T51 B;  1KQS A;  4BA2 I;  5HGQ A;  4WFN 3;  4O2A F;  2FJZ A;  2DN8 A;  4X62 L;  4RMF A;  3JAM W;  3KLS X;  3CSW A;  5LL6 X;  2MO1 A;  5EDW A;  3GTJ B;  3E5S A;  1T9H A;  1EOT A;  5KFU A;  1A2T A;  3MWM A;  4JI5 Q;  1GHJ A;  1SJE D;  4PZ7 A;  2W8K A;  1GUS A;  1ZQ7 A;  3K57 A;  4QW8 A;  1EFI D;  3B6Y A;  1Y14 B;  3ERQ A;  5LHY 1;  3T5J A;  5GAG C;  5D3D A;  4XYQ A;  1Y1V G;  5FJ8 G;  4RGN A;  4XQN A;  2O5I C;  1VBH A;  3BAB A;  5KG6 A;  1IBM H;  3J81 j;  2Q2I A;  3KF6 B;  5IP9 H;  2WB1 A;  5KFO A;  1IOW A;  1CFM A;  3GTG H;  4DR3 Q;  4DAY B;  4K0K Q;  3T1H Q;  5L37 A;  5BN3 A;  4YY3 Q;  4IUT A;  5DQH A;  1I5F A;  5KG2 A;  2Q2U A;  1XNQ H;  4K2L A;  2EYJ A;  3KBX A;  1A15 A;  1SE8 A;  1FVI A;  5IOC A;  4QIW A;  4HN7 A;  2NVX H;  3K3P A;  3AFQ A;  4JOI C;  2AMC B;  3SK5 A;  4LFC H;  4CE5 A;  1WJJ A;  2BQR A;  5LP6 F;  1G2S A;  4EQN A;  4ODG A;  1BCP C;  4IHJ F;  3M4I A;  1GUW A;  4EQ5 A;  3U9O A;  3TP8 A;  3HKZ B;  2EY5 A;  3G6Y A;  4YAK B;  4HIM A;  4X3K A;  4DR2 Q;  4IFD J;  1D1K A;  4CMD A;  1VCI A;  2E5L Q;  4HJ7 A;  3HKZ A;  5KG7 A;  5FO7 B;  3GO5 A;  2R7Z B;  1A48 A;  1QVG A;  4LFA L;  4WOR A;  1ICW A;  1QNK A;  1K3R A;  4O81 A;  1DZ1 A;  4LF4 Q;  1I4Q A;  4A3L H;  4WHX A;  2F0U A;  4DFA A;  3PQI A;  4JI1 L;  3HOX G;  5EGT A;  1A3G A;  2ZJR A;  3CD6 A;  5C3W A;  3I12 A;  4NKL A;  3OW2 A;  3J81 L;  1KNE A;  1GM5 A;  3M4O H;  4BBS G;  4GKJ H;  1DD2 A;  2LFN A;  3CHB D;  2UVW A;  3A55 A;  3F8T A;  2E2I B;  5ISR A;  1VQL A;  4KN4 C;  1V1P A;  2K03 A;  2PQE A;  5A35 A;  1IYD A;  2J6U A;  3PIP 3;  1N56 A;  5C4H A;  4G7O C;  1HPC A;  5CBE E;  4IN3 A;  2HT1 A;  3OW7 A;  3SI8 A;  3D8G A;  4DR1 H;  1WH2 A;  4GN4 B;  4A3M H;  1ASY A;  3BZC A;  2MCT A;  2CHB D;  5F9L A;  3E3X A;  3CCU A;  4FF2 A;  2AGO A;  1K28 A;  1CM9 A;  1QJO A;  2W6M A;  1Y1W A;  1BO0 A;  3HGB A;  3OWE B;  2X69 A;  4KJN A;  1SSO A;  5CYU A;  1O7Y A;  4Z9C B;  4MIU A;  4HNV A;  4POG A;  2ZXP A;  4IPC A;  5C44 B;  3NEM A;  5DLF A;  2WAQ G;  2Q8R E;  1JWS D;  1PYS B;  1CK1 A;  4ME5 A;  4DK6 C;  4DK3 C;  2UXB H;  5EJW A;  2ZTD A;  3R8B A;  2QCP X;  5C44 H;  3I4N G;  5BWU A;  1NR2 A;  1E2V A;  1PYB A;  2NVY H;  4PZ8 A;  2NZO A;  3F1Z A;  2FE3 A;  4PZ6 A;  3PFF A;  4K0K L;  1ROD A;  1UE5 A;  1PMR A;  1CQI B;  4K5W A;  3QOJ A;  2R8K A;  4ZRZ A;  1II3 A;  2UXB Q;  2YS7 A;  1PTO B;  4OX9 L;  4I55 F;  4GLX A;  3M9N B;  1YVC A;  4X66 Q;  1CKO A;  3K7U C;  4TVA B;  1R9T B;  4JBM A;  2F1M A;  3SXH A;  5CV8 A;  2AQ1 B;  1R9T A;  4JVZ A;  4DL5 A;  1C48 A;  4RAY A;  3ITP A;  4DAV A;  2C00 A;  2BE5 C;  1O7Z A;  5JJL A;  2R7M A;  4KD3 A;  1B2T A;  2JEJ A;  5CV5 A;  1HZB A;  1N34 H;  3JZF A;  1GOZ A;  1Q8K A;  1IL8 A;  5C4J H;  5EWG A;  3MTS A;  1PH2 A;  4A3G G;  1QUQ A;  3T1H L;  1VS0 A;  3KOJ A;  1SYX B;  3K7A B;  3T54 A;  1TWH A;  2COG A;  2A6H D;  4JK1 C;  3RZD B;  4GOP B;  2R6G A;  3S2D H;  1BQQ T;  3QFF A;  1YNN D;  3H0G G;  2R3Z A;  2NTS A;  5KFR A;  4DN4 M;  1Y1V H;  5JQG F;  5EPJ A;  5M5W B;  4DV3 Q;  3BA9 A;  4Y7N H;  3DHQ A;  3QO2 A;  2XCL A;  1JOK A;  2KED A;  4DUZ Q;  4QW9 A;  1XX8 A;  1I6U A;  4B3S L;  3R5F A;  4ZUI A;  4IPG A;  1GHK A;  1B3A A;  1UNN C;  5KT6 A;  2O5J C;  5DLG A;  2E5L L;  3H40 A;  4EBE A;  3T5K A;  3KDF B;  1EY7 A;  3MWY W;  4PQX A;  1C3O A;  2D2C C;  3BDC A;  3JZ6 A;  3LNN A;  4JI6 L;  1Q46 A;  1HUN A;  1MSG A;  2MUY A;  3OYY A;  1KRS A;  3HOV B;  1TKW B;  1J5E Q;  3BU2 A;  5J2T F;  5KRU A;  3TSS A;  2EJG C;  3OHB A;  4DR4 H;  5JUM A;  3S16 B;  4DV5 L;  3PZP A;  1V43 A;  1I6V C;  4GC6 A;  1SNQ A;  3AW8 A;  1LUZ A;  3SNO A;  2VQD A;  3I56 A;  3SE7 A;  3FMA A;  3A7L A;  2UXB L;  1PHJ A;  1D2B A;  3NSW A;  2F0P A;  3NK9 A;  3PSI A;  5J3B A;  5M3M B;  2GA4 B;  1KTK A;  1DAA A;  3NBH B;  4DV4 H;  2ALY B;  1IKM A;  1A