5FPOA

Structure of bacterial dna ligase with small-molecule ligand 1h- indazol-7-amine (at4213) in an alternate binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
307
structure length
305
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVENPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 100
structure length 305
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fpoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fpoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fpoA02
3BA8A 3JSNA 4PZ8A 4EQ5A 1CKNB 1XNRB 2CFMA 1FJGB 1IBLB 4JI2B 1HR0B 5LMNB 1J5EB 1TAEA 3VNNA 3NBZB 3UQ8A 5LMUB 3GJXB 4DV5B 4PZ7A 4JI4B 4K0KB 1FVIA 4UCRA 4GLXA 4JYAB 4JI1B 4LF7B 4X66B 2HVQA 1HNWB 1X9NA 4PZ6A 1N33B 2UUBB 2UUCB 4LF9B 4CC6A 4LFCB 1N34B 3JSLA 4JI8B 3OTOB 1XMQB 4LFAB 4EFEA 5D1OB 3BABA 4DRFA 2F4VB 4JI6B 4UCSA 3T1YB 3KYHC 3SGIA 4LF6B 3GB8B 4DV7B 4EFBA 4DR1B 4UCOA 4YY3B 2OWOA 4NXMB 2E5LB 4B3MB 4LF4B 1P8LA 3RTXA 2HHHB 2HVRA 5IWAB 4DR7B 1HNZB 4UFZA 1S68A 4DR6B 3RR5A 4B3RB 1VS0A 4DV6B 4JI7B 3S24A 4DR3B 2UU9B 4LFBB 4EEQA 4JV5B 2ZM6B 2VQEB 4NXNB 2UXDB 4LF8B 5D1PA 2HVSA 4B3TB 4GKJB 4KHPB 5FPRA 1CKNA 4DV4B 4TOIA 4LH6A 4YHHB 4DR5B 3L2PA 4DUYB 3T1HB 1I94B 4DR4B 4DUZB 2Q2TA 3W1BA 4UCUA 3NBYB 3TY5A 1DGSA 4DV2B 1CKMA 4E6NA 4X62B 3TY8A 4JI3B 1N32B 4UCTA 1CKOA 4AQYB 1N36B 1ZAUA 4CC5A 3W5OA 5BR8B 1XMOB 2VUGA 2UXCB 4X65B 4OX9B 2HIXA 4LH7A 2VQFB 4DR2B 4DV3B 4DV0B 3PN1A 1HNXB 3QWUA 4JI0B 1XK5A 3W1GA 5FPOA 2UUAB 4JI5B 2Q2UA 4X64B 3BAAA 4LF5B 1XDNA 4B3SB 1B04A 1XNQB 1V9PA 1TA8A 5D1OA 4DV1B 1IBKB 3GDEA 1A0IA 3TY9A 4UCVA 4GKKB 1P16A 5DISC 2HIVA 1IBMB 3NC0B 3BA9A 2UXBB
chains in the Genus database with same CATH superfamily
1YTFB 1G8MA 3PR5B 1J95A 1CKNB 1SEIA 3K57A 5K1PA 3R23A 1S0NA 4I0XB 3E8FA 1P7GA 3V4SA 1FJGB 1IVSA 5KFMA 5LMNH 2LW7A 1G2WA 4ZI7F 3CE2A 2JJ1G 2C2AA 3RBEA 5H6QA 5LP6B 5I5YA 2OCCC 1PNKA 2NVXA 4JI4B 3VA7A 4UCRA 5KUKA 4JGSA 3H4DA 2PMZA 3ASNB 5B1BB 1HDJA 3P3PA 4DW0A 2Q69A 2A7WA 5BY1A 1I5YA 1P4RA 1K8AW 5KG1A 4A3BG 3SYOA 1A0GA 3OEEG 4IGGA 3VQYA 4E4TA 4O3OA 4JV1A 2JA7A 4EB6B 4APMA 5C1PA 5E25A 1H2GA 2OIEA 3HBLA 1RM1C 1EZ1A 4Y8VB 1Y74B 2JGDA 4DR1H 3UO2A 1J5EO 3TQ1A 3PZPA 3VPDA 2RCVA 4DO2A 2QKCA 5LL6Y 3B8MA 2CH7A 1IX9A 1YCIA 3QG5A 3BFRA 1HNZB 4DV5O 1GSAA 1S76D 3J7AU 2FJZA 2K1EA 3DTFA 4DV6H 2CNQA 2ZJTA 2DLNA 5C8YF 4LFBB 2N74A 4NYEA 4C2MA 2R8JA 5KX5F 4DV6O 5KFWA 1FFXA 2ZD9A 2ZM6H 2ATLA 5LA6B 3J80N 5D1PA 2HVSA 3CEIA 5CA0B 3EXAA 3M8AA 4DRXB 2E74B 1KQSU 2DQ3A 3J7AK 4CS4A 3DF7A 3KHGA 1JLLB 4TQSA 3PW0A 1S3JA 2OH2A 2KB1A 3RYFB 3T9EA 1RP3B 4YJ2B 1ZAUA 4FLYA 4CC5A 1AI7A 2E5LO 1XI1A 4EKWA 1CE8A 2RGVA 4O4IB 1YITV 2WLLA 3F5TA 3CS5A 4A3CG 4J9SA 2FK3A 2AGAA 5LXTF 4GZRB 1HNXO 5DECA 3CCVV 1KBLA 4LWSA 4JI5B 1S77D 3X2QB 4X64H 4O2AA 5IYCG 1FAFA 1KB9F 2R8IA 3E8HA 4YIPA 2COGA 4X64O 5D1OA 3GDEA 5GONF 1URFA 2DJVA 1NR7A 5EC2C 5EBMC 4J9RA 1AROP 3SYCA 3L4KA 4RB2C 3GTQA 4L8JA 1FD9A 4TV8A 2HP8A 4YXWG 3KHLA 3MR2A 1BNCA 5CBHA 4DXWA 1ULZA 2B63A 3JD3A 4UXNA 2PZSA 1XNRO 1I1LA 3JRXA 4MVQA 1SQBH 5BWXA 1Q90D 5DQIA 3DSQA 1I5XA 3HKCA 4RZQA 2FP4B 3T9AA 4J9YB 3JYCA 2R6FA 4GLXA 3T9BA 4ECVA 2HVQA 1ZHSA 1FS0G 5KG4A 3I4MG 1N33B 1KJIA 5J2UB 2YSUB 1CEZA 2YDEA 2AGOA 1YIJV 1PX2A 1YTFD 3OHBA 4W4KA 1PL4A 1SF9A 4WF9V 1GN6A 3VQWA 2ATKC 2ZNIA 2VPQA 1NQTA 5T14A 5IYDG 4BR6A 4HNUA 3GB8B 1VBHA 4YY3H 3GIKA 3L70H 1NTZH 4B3MB 1E4FT 4XDKA 5IWAB 4RAZA 1Y76B 5DEDA 2QA4V 4QWEA 1VS0A 3JAKB 4A2BA 3VBBA 2BQUA 4R50A 4JI7H 3MHSC 3AG1C 4TUYA 3RGZA 4JI7O 1AVMA 3ZEDA 2ZXWB 4LP8A 4NXNB 1H2LA 1EFRG 3CCSV 5IP9G 5HFLA 4DR5H 2P0AA 4HBNA 2J6SA 5KFJA 4IR1A 3ZHQA 1M57B 5KHIA 3HB3B 1TUBA 5BYAA 2FL4A 3L75H 4NTYA 4DR5O 5IYBG 3H4BA 2FLLA 3LMLA 1GM8A 5DM6V 3GTOA 4K3AA 5KT4A 2HEPA 1NVPD 4ZHQB 3T2MA 5KT2A 1XMOH 4YR0A 2UXCH 1NKDA 4HNVA 1Z2GA 4OX9B 1P49A 1HNZO 1XMOO 4I50F 5DGHA 2UXCO 5C1OA 4LFBO 3T9DA 2E3CA 4GX1A 2WAQE 1KUQA 1NU1H 4FLVA 4LR3A 2BSKB 1JX4A 3NGDA 4I0XA 1BZKA 1OCZC 3E22A 3E8BA 5K1XA 1QVGU 1WNSA 4X1IB 1XNQB 3TEKA 2BTOA 2SCUB 2XUMA 3IC7A 1IBKH 1K83A 4KP4A 5BYBA 4GKKB 3UYYA 2FLPA 1TVKB 4HNTA 1N0JA 5LP6A 4YB8B 1UC9A 1IBKO 4O3RA 2UXBH 3B2EE 1AI5A 1XHZA 2F95B 1A32A 2HJWA 1T3NA 4NZNA 4HAMA 5KFDA 2AU0A 2XIGA 5IJ9B 2P5OA 3U10A 1TWHA 2V9WA 4MV3A 4L1KA 1W0KG 1S10A 2ETNA 4MTXA 3QF7A 3GJXB 4RNMA 2OIGA 5BZBA 5EWGA 3GTGA 4JI5O 1FVIA 3RGXA 1O9GA 1EHIA 1FXHA 1Y74A 4FIPC 1KKCA 3N42B 2UUBH 2J6UA 1K1SA 1K5QA 2XCAA 1SYXB 3CHXA 2NUAB 5C5JA 2GUZB 2QB5A 4M0JA 1WP7A 1V54B 1Q86W 2LFSA 2QJ1A 1QLNA 1JA8A 3BPZA 3K3WA 4DK0A 5KHJA 3CMEV 2V4QA 2IJKA 3G6BA 3DXRB 4TM5A 4PD4F 1XMQO 2YWVA 3KCXA 5CBGA 3GTPA 5LA6A 5GTHZ 1JPXA 4X62H 3TK1A 3V6KA 4X88A 3K5OA 3RB3A 4IYIA 1GM7A 2R8GA 3DGEA 1DV2A 2Y4TA 5E79Z 3T4ZA 2IBKA 4DR7B 3OM3B 1BJTA 2F93B 1NTMH 3H1HH 3RYFA 5DN6G 4ME6A 2V59A 1QNMA 2N05A 5KFTA 2Q0AA 3K59A 3ZMTA 4JV5H 5JH7F 2ZE5A 2IU3A 5LHHA 5I47A 1DTOA 1ZETA 3Q2OA 3S3WA 3CMAV 1I6UA 4DR4H 1Y66A 1I94B 4JZ2A 3CD6V 4NZOA 5BWWA 4RB1A 4DV2B 2QTSA 4YP3A 3LSSA 4DR4O 3GIIA 4RB0A 1F23A 2VUMG 1R3LC 1PNMA 1Z5WA 3TETA 2Q4PA 4RO2A 3Q4HB 4GX5A 4DV3B 1LUWA 5KG2A 3G6YA 2F23A 1YSCA 3CRMA 2AZ0A 1QCEA 4YJ3F 1OWTA 2FTKA 1BS3A 3FAVB 4ECRA 2C00A 5EIBD 3TIIA 2WLJA 1FXKB 1VMGA 2UUAO 5CA1A 3TY9A 4B3SO 4KFMA 2QYZA 1SQFA 5JQGF 4N23A 4MVUA 3TW7A 2LGQA 5DGAA 2R92G 2M05A 2ZDQA 1KECA 5KG0A 5LOVA 2FPGB 2DAAA 5EWEA 1WP8A 2R87A 2JVDA 3JALB 4G3IA 1WJZA 4X1KA 4J9ZB 3OGCC 4IIJF 5H80A 1RJQA 4O3SA 4OX9O 1L1FA 4Q0YA 3UCSC 2HKOA 5KFQA 3H9VA 3AG4C 4QIWF 5J2TF 1N48A 1KU9A 3AW8A 2B5UA 2BQ3A 2XCLA 4CKBA 1GRJA 5KFKA 2D2CB 1B33N 4JTCB 3HKBB 4PDMA 1E4EA 3ASOB 3LQSA 3CXHF 5L3EA 1L0LH 4X66H 5DG7A 1HNWH 3T9FA 4DR3H 1JMKC 4GKKO 3WB1A 4X66O 1HNWO 2Z04A 5CB4F 1OCRC 2CDYA 1EKFA 3BQ0A 2R8HA 2VQDA 3JAKA 4CBCA 4O4JA 4B7KA 1W59A 4R8UB 2JS5A 3RIZA 1QR9A 3AG3C 4CH4A 4JI6B 5B3SB 3GTJA 3MFIA 2YIBD 2W9BA 1FFTB 3OMIB 4NXMH 4ZOLF 3OE7G 3C90A 4J7JA 3ABLB 3K08A 2JA5A 4NXMO 4B3RH 1W96A 2PUSA 5D5QA 3JD0A 4O4HB 2C2DA 3GWOA 1IYEA 2CTQA 4B3RO 3A0RA 4ECSA 4NTXA 4ZHQA 5IYZF 3HXLA 1GH6A 3OT7A 3ETDA 2VWJA 1PM9A 1XUQA 3T5LA 1DV1A 2YIAA 4DUZB 3SPJA 2R85A 4OPAA 4UCUA 1OCOB 2JJ2G 1I7NA 2EJ2A 4MV9A 2QKSA 1VF7A 1GN3A 1M56C 1M0TA 4FMTA 2R8KA 2Y4UA 2JA6G 2ZDGA 4A3LG 1Q6IA 4X1IA 3F7YC 4AI8A 3WFVA 4X65B 4BWAA 5I5SA 1S03G 4OXSA 4UVAA 3S3XA 2A79B 3KXYT 1VAJA 1TVKA 5L3FA 1XBLA 2YZGA 3MWDA 4JI0B 2PVPA 1P84F 3MDSA 4EBEA 2JEIA 4DW1A 5CR5A 2C2RA 4F4XA 4RCNA 5HBRB 2Q7GA 2EULA 1TA8A 5KG7A 2NU7B 4I5SA 1RJRA 2HIVA 4DV2O 4A3MG 5LHIA 3ZIAG 2QKAA 2Q0OC 1WCMG 3BA8A 3LDDA 4CKCA 1IBMO 2Q6AA 2PTMA 2NR5A 2LJ2A 1ZHQA 3RGBA 5JVDF 3G80A 4YR2A 1NR1A 3IC9A 3U0ZA 3J81W 5LGTA 4JI2H 2WAMA 2EBOA 3KALA 3CCLV 5LMNB 3SE7A 2CW7A 4DV3O 1XQ8A 2Y69C 4JI2O 3N8DA 3E83A 5EBLC 3PR4A 1M93A 5LMUH 3AX6A 4IHJF 2EIMB 2CTPA 5LMUO 4JI1H 2WLLB 1E79G 2UXNA 2ZDHA 4XDJA 2DPIA 4FK5C 3CEBA 4JI1O 4DL6A 5KG6A 3PJSK 5FLMG 3R65A 4J41A 2QDOA 1MSWD 3GV7B 3B09A 4ABMA 4EFEA 5D1OB 3H0GA 4DRFA 2WDTA 3LULA 5C8YB 2UXXA 1QU7A 4CZZA 2RF4A 4DR1B 2QWRB 3MD0A 2W70A 1Y1VG 2CNVA 1IYDA 4WHXA 3H01A 1IURA 2EIKB 3Q8SB 1WPXA 1GGOA 3CPWU 4DV6B 4ED3A 5EZYB 3S24A 4MTFA 1US6A 3W7WA 4ECXA 4BIZA 4J10A 1ZSPA 3ICXA 2ZM6B 1PPJH 1P7BA 3HKCB 4FLTA 5EC1C 2XD4A 2R9RB 3L4JA 4Q45A 4DV4H 3MHHC 1COWG 1PD3A 5TISZ 4F4LA 4Z2WA 3J80W 3L2PA 4Q4CA 4DV4O 2EIJB 4LC1A 2F1MA 3HPLC 1R6NA 3B8NA 2ZR2A 4J0MA 2FPIB 5LXTB 2ZT9B 1GO3F 1KP3A 1KJ9A 5C44G 5KT7A 1VQ5V 3V6JA 1GK9A 3JZIA 4ECUA 4M7EA 1TWFA 1HNXB 5GONB 3AK1A 4O7VA 3OTFA 4LBEC 2Q2UA 1JVMA 4J7KA 4X64B 1KJQA 2Y4RA 3C3SA 4WFEA 5HNEA 2PI5A 2O03A 4JV2A 1YJNV 4DV1H 2W8LA 1YI2V 3L72H 4Q8EA 1I1KA 2W8KA 5IY5C 1VQ7V 2QSAA 5DAAA 4WCEV 5L1JA 5EWFA 3CP1A 1UFIA 1XNRB 1I1MA 4H0LB 3V4ZA 3MR3A 1KP2A 4O3QA 2ZKOA 2A1HA 4E2LA 1HR0H 1TUBB 4FLWA 1VQ8V 3SDLA 1VQ9V 2NU9B 4FS2A 3VOUA 4YR3A 2YICA 1WR2A 3HOWG 4C5BA 3WO1A 1AP5A 1RPRA 4O2BF 5GW7A 2Z0AA 4K0KH 1B6RA 5KFYA 5KFXA 3T5JA 2HJDA 4K0KO 4MV7A 5EK0A 4TQDA 1X9NA 2EJ0A 2CUGA 2W6IG 3J81N 2JIZG 2CZGA 5KS8A 3GILA 3U54A 3PW2A 3ASNC 4JYYA 4TSFG 5B1AC 3TGUH 2VS0A 3E22B 4O4HA 5BMVB 4DUYH 4RNOA 5KFIA 2FPPB 1N8RW 3K5HA 3KYHC 4DV7H 5LMNO 5KFAA 4YY3B 2V4DA 4MS2A 3OR7C 3QO5A 3EHBB 4TV9A 4U6PA 3OAAG 5IYCO 1EZJA 2HHHH 5KFSA 4DV7O 3BQ2A 2W6PA 3P32A 4QW8A 4DR6H 4Q44A 2E2HA 1AB3A 3HO8A 3U9TA 4JI7B 1MABG 4DR6O 1ZX3A 3ZHUA 2LW1A 3P3NA 2ODMA 5AG2A 2AW9A 3CCQV 2NN4A 2VQEH 4ED2A 1EN6A 4LF8H 4GKJH 1SETA 2DYRC 2GQRA 3D8CA 4MTOA 3ZRWA 4TOIA 2R72A 4LF8O 4DR5B 4GKJO 2EINC 4O7ZA 1GYFA 1DGSA 3E89A 4E6NA 2FE3A 4NB5A 3ETJA 2R7MA 2JDIG 2WLIA 1PKXA 3I55V 1SC5B 4DR1O 2DWEC 1VQOV 1XMOB 1AP6A 1R3JC 2AQ4A 2WA3A 1KD1W 1MOFA 2UXCB 4O7TA 3G6VA 2N04A 4IYHA 2Q68A 4DR2H 3IG0A 4ZI7A 2JEXA 3OMNB 2R7ZG 4DR2O 4H33A 4A3DG 5FPOA 4IL6Z 3F5WC 3AG2C 2ZM6O 2W57A 2FK1A 3K0GA 1B04A 3HKDB 5IYDO 4HR7A 1K9MW 1IBKB 3MFHA 1RYSA 3PW5A 4WFHA 1P16A 4FFRA 2PYLA 3OHAA 2WWWA 3P30A 1YF2A 4JTDB 2UXBB 5A2QN 1WB8A 4GLWA 2ABJA 1MA1A 1RM1B 4G2KA 2CFMA 4YAKB 3JD4A 4I4TF 3GV5B 4MV8A 4TV8F 1BSMA 4CMFA 4O3PA 2CGOA 3OUUA 1QHTA 3WG7B 1TWAA 1Y6XA 2XAGA 4F4WA 2ZIMA 4RUFA 1ROPA 2Z3YA 1A3GA 2GHYA 3SYAA 4JAUA 1GKFA 3IGAC 3HR0A 4C5CA 3HOXG 3CRCA 1CP9A 5I5XA 4BAYA 4MVSA 5L1KA 4LF7H 1RPOA 4FPPA 2R70A 5C8YA 1OJHA 5IYBO 4U7CA 5EOYA 2RMKB 5KX5A 3C0FB 3MR5A 1K5SA 3FX7A 3M99B 2UUBB 4LF7O 3SPCA 1VQ4V 1Z2OX 4Z1VA 4ED8A 3LDEA 4P9OA 1R9TA 4LFCH 3APQA 2EJRA 1M4UA 3GQCA 3OTOH 4LFAH 1XMQB 5EZYA 1K4CC 3K0DA 1H2MA 4LFCO 1D5AA 4YHHH 5CA1B 3OTOO 4FJCC 1YEWA 2BTQA 2ZGIA 2E76B 4MVRA 2X5RA 3PFFA 1N32H 3FD9A 1N36H 1RSOA 5LOVB 2IA6A 2GTAA 1Z5VA 4X1KB 3IAYA 4ZKIA 2GLTA 1E4GT 3H40A 2P90A 5KFPA 3RW0A 4C5AA 5LXTA 4JV0A 1QLEC 5EDWA 4ECTA 4JV5B 3TXQA 2UXDH 1BL8A 3H3VH 1KT8A 4KHPH 2RQ6A 1ORQC 2EZPA 4IWYA 4LH6A 2UXDO 2C2EA 3H1IH 1K33A 4DR4B 3HT5A 1E4EB 5LYJF 1AR5A 5GONA 1WA8B 1E1RG 2YRXA 3LP8A 1CKMA 2DABA 2X0SA 1SA0A 2ZE7A 4PDLA 3ZRXA 3TY8A 3I5DA 1CKOA 4AQYH 4JUZA 2WA4A 4YY3O 3WB2A 3W5OA 1Q5OA 1O75A 4AQYO 3BG5A 4TVIA 4O4JB 4UB6Z 1SQQH 1M90W 5I60A 1FJGH 4TQFA 1Z2NX 4RAIA 3N44B 3OUSA 2W9BB 4RZRA 1VQ6V 2UUAB 3JZ6A 4FFKA 1I3QA 4LF5H 3BAAA 1VARA 2W9CA 4B3SB 4ZIBA 3SYPA 4PA3A 4LMYA 3D36A 1V9PA 4P2ZA 2GPSA 4IIJB 3QVNA 3SPIA 2X6CA 1Q8IA 5KHGA 5LP6F 3ZMUA 5J2TB 5LGNA 3BQ1A 2ZINA 2V7QG 1K92A 3SJBC 3E35A 4O7NA 5DMXA 2C22A 3RAQA 3NUAA 1IBLH 2LFRA 2HHFA 3GIMA 4F50A 1M5IA 2DW4A 3WWJA 1S5JA 3A2FA 2OTJV 1FKAH 1SRYA 2X6AA 4NYKA 5JUMA 3GIDA 4FFNA 4AILC 3PO2G 3AG1B 3EVKA 1UC8A 1FKAO 1IXBA 4FFOA 4BY1G 5BMVA 4X66B 1HNWB 1K3EA 3ZS8C 2P4VA 5KFFA 3IFXA 5FNVF 2QM4A 2ZE8A 3K9SA 3BCCH 3U11A 2UXBO 5L9XA 1N34H 1C3OA 1S9FA 1ZL8B 5JQWA 3VMMA 3V6HA 2CKZB 1VEWA 4A3FG 2IH1C 1N34O 2YL2A 4ICGA 1Q43A 5I5WA 4RQFA 1G1XB 4MVMA 5F9LA 5KT5A 2EX3A 2IH3C 4QE9A 5EYPB 4NXMB 5LA6F 2HVRA 5KFGA 4W4LA 4RB3C 5CA0F 1DF5A 5FLXW 4I55B 3AK2A 4B3RB 4I50A 2YZNA 4JYCA 4WBNF 1PNLA 3ABMC 4A5UB 4FS1A 1OCZB 1MNGA 1LR1A 2UUBO 4YJ2F 1V55B 4J9PA 2YW2A 4B3TH 3ZHRA 1GSHA 3MJFA 1VQPV 3CXCU 2IMWP 1XDCA 4J42A 2ADQB 3PVXA 4B3TO 4O4IF 4Z1MG 2Q2TA 3H1LH 1SQVH 2W7PA 3TQTA 1WH2A 5IT9W 4X62O 1H2KA 5KT3A 4FBTA 3HKDA 5H5NA 4K8XA 3CRAA 2YS6A 1VQLV 3RB4A 2VQFH 4MT8A 4DV0H 3HOZG 1KJJA 4J7ZA 3U9SA 4O83A 1HW7A 1OCCC 4KUMA 4O86A 4WFGA 4DV0O 4JZGA 2RNBA 3M9MB 4JV5O 5JCOC 4MAMA 4UUJC 3RJ0A 5KFNA 4MA0A 3JAWA 2LP7A 2R9AA 2F66C 2WLNA 4K6NA 1WSCA 4CS3A 4U7OA 1IBMB 5KFEA 3ETQA 1N33H 2FMLA 1VQNV 3GB7C 1WB7A 4J11A 2P6JA 2Y0SA 4QIWE 2EIYA 5BPHA 4R7RA 2R92A 2YYAA 4JI2B 3UFXB 4GUNA 3WB0A 5KT6A 4G28B 1KKDA 4RQEA 4O7SA 5J2UF 1T36A 3CCMV 1VQKV 3TW6A 3T99A 2ZIOA 5LMUB 3GIPA 4PJ0Z 1AUVA 3LWBA 3W7SA 5ITZA 3KAKA 5IWAH 4XDLA 4KL1A 4JYAH 4QPJA 3RT3C 3K03A 4JI1B 4UUGA 3D3QA 4J9NA 1I08A 3SR2C 4JYAO 2UUCH 5BWRA 2HVKC 5JH7A 3Q8PB 4U3FH 2H94A 4GCZA 2UUCO 1JR9A 4TQRA 4D7TA 5DG8A 2C35B 1RYRA 4MTDA 1Y1WG 1A9XA 4QPKA 5KFBA 1R1BA 4AYBE 4I9QA 1A48A 4UCOA 4J9MA 1OBGA 2P67A 2OWOA 1G4YB 3L73H 4D7SA 4DQNA 1S5HC 5B3SC 3DC5A 3APOA 2ASDA 1WA8A 2MK3A 2NU8B 4DL3A 3ABTA 2QE7G 4A93G 4K8ZA 4QSHA 3B4SA 3RB0A 1JQ0A 3QO8A 4K35A 4NVPA 2R7NA 4YJ3A 1AI6A 3STLC 4DR3O 3A8TA 3ZMVA 3B77A 4MW8A 5FPRA 3VPBA 4DV4B 1DIKA 4F6EA 4DL2A 1NT2B 2R9IA 4QW9A 3Q8QB 1Q82W 2Z02A 4ECQA 4EBCA 5FLXN 4JYBA 5JQGA 5C3EG 2OLSA 4RNNA 4UCTA 4PV1B 3K5NA 2AGQA 5BPFA 1YZBA 4JASA 5B5EZ 3HKZE 1D2DA 3I56V 2ZE6A 2V58A 2XCPA 4ECYA 1CPYA 4ASUG 3HOYG 1VF5B 2IJHA 4IIJA 3JARB 1DK1A 2YXLA 4LCUC 3CX5F 1VF6C 3VQVA 1XK5A 3HB9A 1PV0A 5CAEB 3RV4A 4QIWA 5J2TA 3L74H 3HKEA 4TV9B 3W7XA 3K79A 4F6RA 1JDEA 4B08A 3W7UA 3D3IA 5JJJB 1KC8W 3W7TA 5IT9N 1OCRB 4H13B 4DV1B 4O84A 5I5UA 1OBDA 2HG8A 1IXMA 3OMAB 3T1CA 3ZHTA 5CB4A 4HYKA 1BMFG 1LNQA 3JSNA 5H2FZ 4BIOA 2EJ7A 3AG3B 3M7MX 1SQXH 1B6SA 3OSPA 3ZRWB 3EFFK 5FJ8G 4BBRG 1WCMA 2IBZH 4MW3A 1K97A 3GIQA 1HR0B 1SESA 4MA5A 5KFUA 1TAEA 5DGBA 4JXUA 4FE2A 2WLIB 4ZOLA 1ZL8A 5KFLA 1GM9A 1X4TA 4O3NA 3RBDA 4L87A 4K0KB 2GV9A 3IJ4A 2KKWA 5KAFZ 3B40A 3JASA 5IJ0A 2W6NA 4AYBA 2JEJA 1PK8A 1OZ0A 3N2GA 4ZI7B 5CBFA 3GVMA 4LF9H 1RFYA 2KG7B 3JATA 5EYPA 3JCUZ 4A2AA 4CH5A 1I2LA 2O57A 4I55A 4JI8H 2IM9A 1SZTA 2VWKA 2HGWA 1M56B 4JI8O 2F4VH 3T7AA 2PYJA 2X6BA 2RDJA 3RVYA 2W6MA 1FXVA 4LF6H 4DV7B 3ZJZA 4BY7G 4A3GG 2F4VO 3ZN0A 1P8LA 5C4XG 1NH2B 2HHHB 1ET0A 4X1YA 4WFAV 4DR6B 4WFFA 5L3BA 1Y1VA 4PWQA 3M9NB 4FZ1A 3HKZA 5KFCA 2ZNJA 4PDRA 4RU9A 2WLKA 3OUFA 3ETEA 4MSWC 2G38A 2VQEB 4LF8B 5IP7G 4GKJB 4BBSG 5KFOA 1GO3E 1S0OA 3RYIA 3T1HH 1WAZA 3ZHVA 1Q6HA 2B1GA 2Z5UA 2V4RA 5KX5B 1T94A 4OPHA 4XBFA 3RN4A 4D6TH 3T1HO 4JI3H 3RYHB 3WU2Z 3BEHA 3IN5A 4EYHB 2DYSC 3RAXA 3ML0A 4IRKA 4JI3O 2BQRA 4MTGA 5JVDA 2R93G 3ZRVA 4NTWA 2HGXA 2YCHA 1JX9A 3UZBA 2QTOA 4DR2B 3OR6C 3G71V 1I50A 4EGQA 2BTQB 1K34A 4O7YA 4NZMA 4CS2A 1K1QA 2JEFA 1RSOB 3VPCA 2HLDG 4X89A 4R6ZA 4U7NA 2WB1A 4B7EA 1AJNA 3RYCA 4UCVA 2DWDC 4H44B 3JD1A 3LNMB 2E2IA 3KHHA 1M0WA 4FM0A 4MV1A 2WE6A 1KTAA 2X7RB 5A2QW 2GQSA 5BWUA 1KYOF 4NLGA 3JD2A 5KAIZ 3CCUV 5JCOA 3UO3A 4CKEA 1AN7A 1SA0B 3CC7V 1EZVH 2WTFA 2RN9A 3ZRSA 3SJAC 1PP9H 2GBOA 1H2NA 1BT8A 1KC7A 1CQIB 5HFMA 1Y14B 4LF7B 5B1NA 2R7LA 4A3JG 2JGUA 4O4LF 4DV1O 3BRCA 2Q7DA 2H8PC 1Y4MA 2OT5A 2PN1A 3CQZA 3ABKC 3RVZA 4LFCB 2HFEC 1SZXA 3TINA 1TGOA 2W9CB 3OTOB 2EILC 5KFHA 4RUCA 4LFAB 2CAZC 1RJPA 2NU6B 2YXYA 3T1YH 1MZEA 1N4CA 1HR0O 3BJYA 3L9DA 3ZHSA 5FD6A 2DOSA 3LSQA 3T1YO 4LF4H 1XHXA 4ZBMA 2CTRA 3M4IA 3O9OA 5LP6C 4LF4O 4FFBB 5JJNB 4PI2A 3OUZA 4X8AA 2HHFB 4Q43A 1NZ6A 2YRWA 2ZCEA 5J9PC 3RV3A 3H1KH 4JI0H 3K58A 2A0LA 3JCZA 2XT9A 2UXDB 1WPBA 1T5EA 5B1BC 3OD4A 3SJQC 3SYQA 3STZC 4KHPB 3RUPA 5I5VA 1S97A 3JARA 4AHCA 3FKIG 1XILA 4X20B 5IY5B 5CM0A 2ODTX 1WN7A 4ZQIA 2F43G 2XNDG 5F9NA 2PY5A 4DUYO 3DAAA 2CTWA 1MSDA 5I5TA 4AQYB 4HYOA 2YUAA 4NKGB 2YZMA 4H37A 5BR8H 1GSOA 1NH2D 2HHHO 1B06A 5BR8O 2Y48A 2JA8G 2XC9A 2XHBA 3PN1A 3FYIB 4PDVA 2YZLA 1JFFB 2DPJA 2ADPA 3A0HZ 3OEHG 5K3WA 4O2BA 2VQEO 1S0MA 4LF5B 1Y67A 2FYUH 2R7ZA 3SNOA 4I50B 1ZWIC 5EBWC 2I80A 2XOKG 2WLMA 1EN5A 3QTCA 4UVCA 5B1AB 3K3VA 2IJIA 1NJIW 3EYYA 1EKVA 5DG9A 4PZ8A 2XAFA 3TXSA 2MCTA 4UV8A 1VF6A 1TWGA 2JRIA 4JPRA 2OCCB 4O81A 1IBLB 3K9AA 5KMGB 1GN4A 3N6RA 4M9UA 3N6XA 2KG7A 1J5EH 4PA9A 4F4ZA 3DTUB 5FNVB 1NVPB 5L3DA 3CJHA 3CRRA 4DV5H 1L0NH 1OV9A 3WG7C 4O2AF 3RWRD 2ZQMA 3AK3A 5K2MA 3TCUA 5LBQA 4QWBA 2DYRB 3X2QC 4MTEA 4BXXG 2DWCA 4ED6A 2CK3G 2YEVA 3GTLA 3Q8RB 3SPGA 2JA7G 3G67A 3JAMN 2EINB 4ED7A 2ASJA 3KREA 1KJ8A 1Q6UA 3JRWA 3DTGA 4OGQB 3N41B 1N34B 3JAWB 2RDIA 3E5NA 1BCCH 2DN9A 2QEXV 3BABA 5EZYF 3WWHA 5KFVA 1O9HA 4WBNB 3SGIA 2PI4A 4XZ3B 5L1LA 3LNNA 3NXSA 2IU0A 1NI8A 3RTXA 2E5LH 1QVFU 4J80A 3U0GA 1R73A 1V51A 1BQ0A 3RR5A 1I2KA 2Q7EA 3WWIA 1F7YA 3CCJV 2UU9H 3AG2B 2QF7A 3RYHA 5KG5A 1I0HA 4A3KG 4A3IG 2ZDIC 1HNXH 1IOVA 2UU9O 3E86A 1GMGA 5L1IA 4UB8Z 4B3TB 5H6RA 2BOBC 2XAQA 3MWEA 5ITZB 2W71A 4MV6A 4ED1A 2HR3A 4LFAO 4JAAA 3QQMA 2Q67A 4YHHO 4X62B 2P22C 4PI0A 5JH7B 4Q6GA 2GDSA 5KFRA 4DL7A 3G8DA 1GN2A 1N32O 3SPHA 1N36O 4I4TA 1JDBB 4GT1A 1XNRH 3ZMSA 1AJPA 4LH7A 2VQFB 2LGWA 2VR1A 4DV0B 3RF2A 1VP7A 3AEIA 3ZMZA 4FGRA 4TUYF 2COJA 2BOCC 3FB8C 5KHKA 2R7KA 2QR4A 4FBUA 4XYLB 1I7FA 3GV8B 3T5HA 1L8DA 2Q7HA 4KHPO 2RDCA 5EIBC 1R3KC 2ZXWC 4HNAA 3CCEV 3QZ7A 3QZ8A 3PW4A 1R6TA 1IZ3A 1VKZA 4U3JB 4YJ3B 1SS3A 1M57C 3KG2A 4Q8FA 2B63G 4J9OA 4JAVA 4QJFB 1AILA 2WYOA 3R5HA 2J6TA 5D8DA 4IR9A 4LNUB 4PELA 2ARHA 4IRDA 2W7OA 3Q1KA 5CE8A 5JQGB 1K4DC 1FJGO 1XL6A 1SFOA 4PA6A 3ZBHA 1VIBA 2RJZA 2W6JG 3CC2V 4JI4H 2ITCC 1QLEB 4QNHB 4LF5O 4JYAB 1M9NA 2A06H 2I8CA 2VOBA 4JI4O 1MG1A 4PZ6A 5BMVF 3UT5A 2AGPA 2YS8A 2UUCB 2Q9LA 3CVZA 3HKEB 1D5NA 3GIJA 4FVMA 4ECWA 2XGQA 4F6RB 4QWCA 4FFBA 2QM8A 3THOA 3R9RA 3LUTB 5LYJA 1N0NA 3AYHB 3N2KA 2YIDA 3K06A 1IBLO 2IP4A 1I7LA 4EFBA 5CB4B 4GX0A 4HQ6A 2ZR3A 3R5FA 1U97A 3WNZA 3A0BZ 3RB6A 2Y0SE 1HNZH 2PGGA 4UFZA 4X20A 2WPDG 2Q8VA 2OTLV 3JZFA 4Q4DA 3C3TA 3K04A 4DR3B 4LFBH 1F4MA 2DMXA 1KBHA 1NS1A 1YHQV 4ZOLB 2GSMB 2NVYA 3KHRA 1CKNA 1Q81W 1Q3EA 1GTOA 3TIGA 3JASB 5IJ0B 1V54C 3W1BA 1V55C 1MMMA 1SKVA 3N2GB 4TT3G 3TJTA 1JFFA 1H8HG 5BWVA 4N21A 2K9PA 3JATB 3I4NG 1CXZB 5IYZB 1M1KW 3CWBH 3G8CA 3ORQA 3K5IA 2AXTZ 4LSAA 2BE3A 5LGUA 1BXRA 4PHZA 4PBCA 4BWSC 4O7LA 2FK2A 3R5XA 2BCCH 2Y0IA 4PA4A 2ASLA 1XL4A 3K5LA 3KAJA 2GPWA 3PW7A 1BHBA 3SJCC 3RFCA 2J9GA 1X59A 1MZFA 4RWUA 1UJWB 3ZN1A 4CE5A 4JI5H 4QWDA 4X1YB 2JEUA 4EB6A 2YU9A 4PDBA 2E75B 5KHHA 5KMGA 1RK6A 1FPOA 1A0IA 4G27B 5LHGA 5DISC 1XREA 3BA9A 1BE3H 5FNVA 4I7ZB 2KSDA 2XAJA 3FYEB 1CS0A 1VBGA 4EQ5A 2VUMA 4DL5A 1SERA 5BWTA 5JJEB 1BGYH 3RYIB 1XMQH 2YI9A 2QWOB 3BHPA 2VQFO 3UZOA 3VOTA 2XAHA 3NBZB 3N43B 1LUVA 3UQ8A 4P30A 5CA0A 4BW5A 4DL4A 5JVDB 4DRXA 3ABMB 3FFQA 2DQ0A 4FM9A 5DGIA 1AI4A 3KKYA 1M7JA 4WBNA 5CA1F 1AUXA 3CCRV 3U55A 1FXKC 3H20A 2C28A 3OFNG 1JOYA 4LF9B 4MVOA 4YJ2A 2R86A 4UVBA 3CSWA 1N33O 5GTIZ 5H9CA 3WO0A 4IHJB 2HGSA 5LOVF 4JI8B 4MVZA 4CMDA 1NTKH 1N56A 4XYMB 4O4IA 5JWPA 4IAJA 2AZ2A 3RYCB 2F4VB 1BQZA 4GYCB 2FB9A 2WAQA 3G4SV 4LF6B 3R66A 2DE0X 1JIHA 3HOVG 2NLJC 1Z2PX 4B3MH 1BGWA 1K7DA 1Y1WA 3G6EV 4WD3A 3K5MA 2QGNA 1OCCB 4B3MO 2IJJA 2QM7A 2GTSA 2W9AA 5IWAO 5CMUA 2PBZA 5DQHA 1S5LZ 3KCYA 4YIOA 2CW8A 3UM7A 2WLHA 4EEQA 2Y0PA 4ED0A 4KXRA 3T9CA 4I7HA 3ASOC 5KG3A 4NXNH 2IW5A 1BHAA 2VA3A 4FFLA 3CYOA 2UUAH 3SI8A 4NXNO 1C30A 4TWKA 4WFBV 4B3SH 2XASA 3T1HB 1JJ2U 4O4JF 3OSNA 3NR7A 1EYZA 3N27A 2BR0A 4JI3B 1Q7YW 1HWYA 2B1IA 2W0XA 5DLGA 2UVRA 1WLEA 2DZDA 3K3PA 4YQWA 2ZDIA 1V4YA 4OX9H 3KZIZ 1R3IC 5DQGA 3GWKC 5A9GA 4EYIB 2YC0A 4U3JA 5J2UA 3ABLC 4HZ3A 1H38A 3W1GA 1M6VA 1RK5A 4ZHQF 1K73W 4QJFA 2ALZA 4R8CA 4LNUA 1XNQH 3EPGA 4ECZA 5KUMA 3T4DA 1KMIZ 1JCHA 3FB7C 4GKKH 1ENVA 1XNQO 4DLKA 4YBZB 4RUAA 1H2SB 1OCOC 3LDCA 5FR9A 1Y76A 3AG4B 2KSWA 3GLKA 4PA7A 2JA6A 4O4LB 1IOWA 1SQPH 3DC6A 2P06A 4GC7A 3MWMA 2HVJC 1EM1A 4J9LA 1AR1B 3GTKA 4P9PA 4EG0A 2UVUA 2CQYA 1KUTA 4E4EA 2DIKA 4PZ7A 2UVWA 5D5PA 2M7WA 1DF4A 4YAJB 2V5AA 5JVLA 3CC4V 5IE9A 3OW2U 2HG5C 5HV6A 5KFZA 4DYLA 4CC6A 3O65A 3ZCCA 1L2ZA 4O2BB 3JSLA 1EKPA 4I55F 2WB1E 3H1JH 4DK1A 2OYQA 1TUEB 1B3QA 3CB2A 4O82A 5B66Z 4UCSA 2ILMA 2JK5C 4QE7A 3T1YB 3RBZA 2JA5G 5KA6A 2NNUA 4BIUA 4LF4B 1XEQA 3UKMA 5BXZA 2BSKA 2EZOA 4QWAA 4DR7H 2FB5A 1H8EG 2AHYA 2W6ZA 2JEGA 1S0VA 4DR7O 4CH6A 4O7WA 2EIMC 3BACA 2EJ3A 5IYZA 2PF4E 4ETSA 2FKXA 2JGDB 3G6XA 4LF9O 1GAXA 3CJHB 3T5KA 4I9WA 1S72V 2Q5ZA 1JXLA 2CH7B 3EPIA 2FMAA 2QWQB 3QNEA 4DUYB 1I94H 5IJ9A 1B6QA 5FD5A 4DV2H 1FYJA 2YIBA 2YEVB 4FLZA 1I94O 1F51A 3ETHA 5IDJA 1IBMH 1QBZA 1AR4A 1FFXB 4BW9A 1OHHG 4QGPA 4LF6O 5BR8B 2A9HA 3FB6C 1DLBA 3QO7A 5CN0A 2HIXA 4C7UA 2W0FC 4EEYA 2QK4A 4DV3H 2EIKC 1YJWV 2I87A 4FU0A 3N40P 3QWUA 3BY6A 1W0JG 4RAYA 2R93A 1IDSA 2GUZA 2L35A 1F4NA 4O7RA 4X9QA 4J9KA 1E1QG 2VRZA 2YS7A 1XDNA 5E1AC 2OCHA 2P7TC 3MR6A 3DXRA 1ZQ7A 4F4YA 1THZA 5F2VO 2CNUA 3T54A 3NC0B 4GX2A 2VPSA 3LSUA 2EIJC 2P4KA 2UVVA 2COIA 2V1DA 2HJFC 1HP8A 2Y69B 1GLVA 4LWSB 1EN4A 4O2AB 2WSSG 1KEEA 3M9OB 2R82A 4JF3A 1ZLZA 3AG7A 1J5EB 3QFFA 4CH3A 3VNNA 5LL6b 1JKJB 2D3OW 2B9ZA 4IHJA 5FL7G 1YJ9V 3BVOA 1MZBA 2RGRA 4IT5A 1YVWA 4DV5B 1CQJB 1G6UA 4I4TB 2AHZA 4TV8B 2ITDC 2R84A 2MW2B 1DAAA 5C93A 2HDKA 3OGIB 3FMAA 3FKSG 4UV9A 1U96A 3CRQA 4EGJA 3H0GG 3PO3G 2W6OA 3JAMW 3GTMA 3F8NA 4IRCA 4Q20A 4HNAB 2KQXA 2M6YA 2VA2A 2CE4A 2DYSB 3L71H 3Q4HA 4RUEA 2FLNA 4JI6H 1ZUQA 4FLUA 2LO1A 2PMZE 1UPGA 2Q73A 2XTAA 3FAVA 4JI6O 5CA3A 3D36C 2E5LB 4IWXA 1FXKA 3FB5C 1S68A 4DAAA 1SQGA 1JJOA 2UU9B 1AJQA 1YXBA 3ABUA 2A3QA 5KLVH 4DIMA 1PL0A 4J9QA 1ZTEA 1QQCA 2QWPB 4R7CA 4FZ0A 3MAQA 5B1OA 1R6KA 1W2BU 2CGNA 3ETGA 4JTAB 3JALA 5KKNB 3I12A 4YHHB 3F7VC 4GC6A 1VQMV 4O4HF 4DUZH 5L3CA 3NBYB 3TY5A 3ZX6A 1XOUA 3UT5B 4EBDA 4A3EG 3E2EA 4DUZO 1N32B 4XX0B 2X0LA 4TUYB 1N36B 3FKIA 5DLFA 1EUCB 2W6QA 4FM1A 4HN2A 2H3OA 4TV9F 3FDSA 2YI8A 4MV4A 4NR1A 1W93A 3KTMA 2VUGA 1YDXA 3ORRA 4X65H 5LYJB 3HKBA 1QR8A 4LSXA 3HOUG 5L3GA 4X65O 1WRVA 3N2KB 2JS3A 2LQTA 4FFPA 1EUDB 4CHIA 1EBOA 4JI0O 1SCUB 3RFRA 3CSXA 4FLXA 4FFMA 1UNNC 2L6LA 4R8UA 1NBMG 4O4LA 3ABKB 5KA5A 2EILB 2FKLA 3E8GA 2YXHA 3VQXA 4FM2A 2QWNB 1TWCA 4IZOA 2XGPA
chains in the Genus database with same CATH topology
3BA8A 1CKNB 1SEIA 2PTMA 3K57A 5K1PA 1ZHQA 3RGBA 4R7RA 2WYOA 3J81W 1FJGB 3U0ZA 4LNUB 4JI2H 3KALA 4JI2B 5LMNH 3WB0A 5LMNB 2CW7A 5JQGB 1XQ8A 5LP6B 2RJZA 1M93A 2ZIOA 5LMUB 5LMUH 4JI4H 4JI4B 5ITZA 3KAKA 5IWAH 4KL1A 4JYAH 4UCRA 4JYAB 4JI1H 4JI1B 2VOBA 4PZ6A 3SR2C 3UT5A 2UUCH 2UUCB 3CVZA 5JH7A 3HKEB 3VQYA 4FVMA 4F6RB 4FFBA 4D7TA 4EB6B 3THOA 4APMA 5LYJA 4EFEA 5D1OB 4DRFA 2WDTA 4MTDA 5C8YB 3N2KA 4I9QA 4DR1H 4EFBA 5CB4B 4DR1B 4UCOA 2OWOA 4D7SA 3QG5A 1HNZH 2PGGA 4UFZA 4X20A 1HNZB 4DV6H 4DV6B 5EZYB 3S24A 2ZJTA 4DR3B 4K8ZA 4LFBH 4LFBB 4NVPA 1FFXA 4YJ3A 2ZM6H 2ZM6B 3ICXA 4ZOLB 5LA6B 5D1PA 4FLTA 3HKCB 2HVSA 5CA0B 3L4JA 5FPRA 1CKNA 4DV4H 4DV4B 4DRXB 1Q3EA 1NT2B 3J80W 3L2PA 3JASB 5IJ0B 3J7AK 4CS4A 3DF7A 3W1BA 1SKVA 2F1MA 3N2GB 1JFFA 3RYFB 5JQGA 3JATB 4YJ2B 4UCTA 4J0MA 5IYZB 3K5NA 5LXTB 1ZAUA 4LSAA 4FLYA 4CC5A 1XI1A 4PHZA 2RGVA 4BWSC 4O4IB 4IIJA 3JARB 4M7EA 3K5LA 2YXLA 5GONB 1HNXB 3KAJA 3VQVA 1XK5A 3SJCC 5J2TA 3HKEA 4TV9B 3OTFA 4JI5H 4JI5B 2Q2UA 4X64H 4X64B 4F6RA 4X1YB 4B08A 4O2AA 4EB6A 5JJJB 2O03A 4PDBA 5KHHA 5KMGA 4DV1H 5D1OA 4DV1B 3GDEA 1A0IA 5DISC 3BA9A 5CB4A 5FNVA 3L4KA 4RB2C 4L8JA 3JSNA 4TV8A 4EQ5A 3M7MX 1XNRB 5JJEB 3RYIB 1XMQH 2YI9A 2PZSA 1HR0H 1TUBB 4FLWA 1HR0B 3BHPA 1TAEA 3NBZB 3DSQA 3N43B 4ZOLA 3UQ8A 3HKCA 4RZQA 5CA0A 1X4TA 5JVDB 4DRXA 4K0KB 4K0KH 2GV9A 3FFQA 4GLXA 2KKWA 4FM9A 3JASA 5IJ0A 2HVQA 4WBNA 1ZHSA 1X9NA 4MV7A 4TQDA 4ZI7B 3N2GA 5J2UB 1N33B 3H20A 4LF9H 3JATA 4LF9B 5EYPA 4YJ2A 4A2AA 4CH5A 4IHJB 4I55A 2HGSA 4JI8H 4JI8B 3E22B 2IM9A 4O4HA 4O4IA 4IAJA 2VWKA 3VQWA 5BMVB 2ZNIA 3RYCB 2PYJA 2F4VB 4DUYH 2F4VH 4GYCB 3KYHC 4LF6H 4LF6B 4DV7H 3GB8B 4DV7B 4YY3H 4YY3B 2V4DA 1Z2PX 4TV9A 4B3MB 1P8LA 1BGWA 1E4FT 2HHHH 2HHHB 4B3MH 5IWAB 4RAZA 4X1YA 4DR6H 3K5MA 4DR6B 1VS0A 3JAKB 4A2BA 4JI7B 4JI7H 2CW8A 4TUYA 4EEQA 3RGZA 2ZNJA 3ZEDA 4I7HA 2VQEH 4NXNH 2VQEB 4NXNB 4LF8H 4LF8B 4GKJH 4GKJB 2UUAH 4TOIA 2R72A 4DR5H 4HBNA 4DR5B 3RYIA 3T1HH 4B3SH 3T1HB 5KHIA 1TUBA 1GYFA 1DGSA 4E6NA 5KX5B 2FE3A 4JI3H 4JI3B 3RYHB 3LMLA 2HEPA 4ZHQB 1XMOH 1XMOB 5JVDA 2UXCH 2UXCB 4OX9H 4OX9B 1P49A 2YCHA 4DR2H 3IG0A 4DR2B 4U3JA 4ZI7A 2BTQB 5J2UA 2E3CA 4CS2A 3W1GA 4FLVA 4LR3A 5FPOA 2W57A 3E22A 5K1XA 4LNUA 1XNQH 1B04A 1WNSA 3HKDB 4X1IB 2BTOA 1XNQB 1KMIZ 1IBKH 1IBKB 3RYCA 4GKKH 4UCVA 4GKKB 1TVKB 1P16A 2PYLA 5LP6A 2UXBH 2UXBB 1M0WA 3B2EE 1H2SB 4FM0A 1XHZA 2F95B 2WE6A 2CFMA 2KSWA 5A2QW 2XIGA 5IJ9B 2P5OA 1QHTA 5JCOA 3U10A 1AN7A 4O4LB 1SA0B 2ZIMA 3MWMA 3QF7A 3GJXB 3SJAC 4PZ7A 5D5PA 1FVIA 3RGXA 1O9GA 4LF7H 4LF7B 2R70A 5C8YA 5EOYA 2JGUA 3N42B 5KX5A 3C0FB 3BRCA 2UUBH 2UUBB 1Z2OX 1SYXB 3CHXA 4CC6A 1L2ZA 4LFCH 4LFCB 4O2BB 1M4UA 3JSLA 1TGOA 2QJ1A 3OTOB 3OTOH 4LFAH 1XMQB 4LFAB 3BPZA 5EZYA 4DK0A 5KHJA 4DK1A 2CAZC 2OYQA 1D5AA 4YHHH 5CA1B 3CB2A 3T1YH 4UCSA 1YEWA 2BTQA 3T1YB 5LA6A 4X62H 5FD6A 3K5OA 1N32H 4LF4H 4LF4B 1XHXA 1RSOA 5LOVB 1N36H 3M4IA 4DR7H 4DR7B 1Z5VA 4X1KB 5LP6C 4FFBB 5JJNB 3IAYA 1E4GT 4PI2A 1BJTA 2F93B 4CH6A 3RYFA 2Q0AA 5IYZA 5LXTA 2ZCEA 3K59A 4JV5H 4JV5B 4ETSA 4JI0H 3K58A 2UXDH 2UXDB 1WPBA 1T5EA 4KHPH 2RQ6A 4KHPB 4LH6A 3JARA 4AHCA 4DR4H 1I94H 4X20B 4DUYB 1I94B 4DR4B 1I6UA 5GONA 5IJ9A 5FD5A 4DV2H 4RB1A 1WN7A 4DV2B 1CKMA 2YIBA 1SA0A 4FLZA 2PY5A 3TY8A 4RB0A 4AQYH 1CKOA 4AQYB 1FFXB 1IBMH 4BW9A 3WB2A 3W5OA 1Q5OA 1O75A 5BR8B 5BR8H 1Z5WA 2HIXA 4O4JB 4DV3H 1FJGH 4DV3B 4TQFA 1Z2NX 2XHBA 3PN1A 3N40P 3QWUA 3N44B 4RAYA 1JFFB 2UUAB 5EIBD 4O2BA 4LF5H 4LF5B 3BAAA 1XDNA 4B3SB 4ZIBA 4LMYA 1V9PA 4I50B 5CA1A 4IIJB 3TY9A 3QTCA 1SQFA 3K3VA 3NC0B 2VPSA 1Q8IA 5KHGA 5J2TB 3EYYA 2ZINA 5LOVA 4PZ8A 2MCTA 2JVDA 3JALB 3SJBC 4X1KA 4O2AB 1IBLH 1IBLB 4Q0YA 5KMGB 3N6XA 1M5IA 1J5EH 1J5EB 3VNNA 4CH3A 1S5JA 5LL6b 3A2FA 2RGRA 4IHJA 1FKAH 1MZBA 1KU9A 5FNVB 4DV5H 4DV5B 4AILC 1G6UA 4I4TB 4TV8B 5BMVA 3RWRD 3HKBB 4X66H 4X66B 1HNWH 1HNWB 3ZS8C 4MTEA 4DR3H 1JMKC 3FMAA 3WB1A 2QM4A 3U11A 3N41B 1N34H 1N34B 3JAWB 3JAMW 3JAKA 3F8NA 4O4JA 4HNAB 2JS5A 3RIZA 3BABA 4CH4A 1Q43A 4JI6H 1O9HA 4JI6B 4FLUA 4WBNB 3SGIA 2EX3A 2YIBD 3LNNA 4NXMH 5EYPB 4NXMB 2E5LB 3RTXA 2HVRA 2E5LH 4RB3C 5FLXW 4I55B 1S68A 3RR5A 4B3RH 2Q7EA 2PUSA 4B3RB 5D5QA 1SQGA 4I50A 1JJOA 4O4HB 2UU9H 2UU9B 3RYHA 1QQCA 1HNXH 3MAQA 4ZHQA 3HXLA 4B3TH 4B3TB 2VWJA 5ITZB 3JALA 4YHHB 2YIAA 4DUZH 4DUZB 2Q2TA 4UCUA 3NBYB 3TY5A 3UT5B 4X62B 2P22C 4PI0A 4MV9A 5JH7B 4Q6GA 1N32B 1VF7A 4TUYB 1WH2A 1N36B 5IT9W 1M0TA 4FM1A 2YI8A 3HKDA 4X1IA 4I4TA 2VUGA 4X65H 4X65B 1S03G 4BWAA 1XNRH 4K8XA 5LYJB 3HKBA 2VQFH 3KXYT 4LH7A 2VQFB 1TVKA 4LSXA 4DV0H 4DV0B 3RF2A 3N2KB 1HW7A 4JI0B 5KHKA 5JCOC 1I7FA 3RFRA 3RJ0A 3CSXA 4FLXA 1L8DA 3JAWA 2Q7HA 2Q7GA 5EIBC 4HNAA 1TA8A 2R9AA 4O4LA 2F66C 4CS3A 2HIVA 4U3JB 1IBMB 1N33H 3ETQA 4YJ3B 3VQXA 4FM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BA8 A;  3JSN A;  4PZ8 A;  4EQ5 A;  1CKN B;  1XNR B;  2CFM A;  1FJG B;  1IBL B;  4JI2 B;  1HR0 B;  5LMN B;  1J5E B;  1TAE A;  3VNN A;  3NBZ B;  3UQ8 A;  5LMU B;  3GJX B;  4DV5 B;  4PZ7 A;  4JI4 B;  4K0K B;  1FVI A;  4UCR A;  4GLX A;  4JYA B;  4JI1 B;  4LF7 B;  4X66 B;  2HVQ A;  1HNW B;  1X9N A;  4PZ6 A;  1N33 B;  2UUB B;  2UUC B;  4LF9 B;  4CC6 A;  4LFC B;  1N34 B;  3JSL A;  4JI8 B;  3OTO B;  1XMQ B;  4LFA B;  4EFE A;  5D1O B;  3BAB A;  4DRF A;  2F4V B;  4JI6 B;  4UCS A;  3T1Y B;  3KYH C;  3SGI A;  4LF6 B;  3GB8 B;  4DV7 B;  4EFB A;  4DR1 B;  4UCO A;  4YY3 B;  2OWO A;  4NXM B;  2E5L B;  4B3M B;  4LF4 B;  1P8L A;  3RTX A;  2HHH B;  2HVR A;  5IWA B;  4DR7 B;  1HNZ B;  4UFZ A;  1S68 A;  4DR6 B;  3RR5 A;  4B3R B;  1VS0 A;  4DV6 B;  4JI7 B;  3S24 A;  4DR3 B;  2UU9 B;  4LFB B;  4EEQ A;  4JV5 B;  2ZM6 B;  2VQE B;  4NXN B;  2UXD B;  4LF8 B;  5D1P A;  2HVS A;  4B3T B;  4GKJ B;  4KHP B;  5FPR A;  1CKN A;  4DV4 B;  4TOI A;  4LH6 A;  4YHH B;  4DR5 B;  3L2P A;  4DUY B;  3T1H B;  1I94 B;  4DR4 B;  4DUZ B;  2Q2T A;  3W1B A;  4UCU A;  3NBY B;  3TY5 A;  1DGS A;  4DV2 B;  1CKM A;  4E6N A;  4X62 B;  3TY8 A;  4JI3 B;  1N32 B;  4UCT A;  1CKO A;  4AQY B;  1N36 B;  1ZAU A;  4CC5 A;  3W5O A;  5BR8 B;  1XMO B;  2VUG A;  2UXC B;  4X65 B;  4OX9 B;  2HIX A;  4LH7 A;  2VQF B;  4DR2 B;  4DV3 B;  4DV0 B;  3PN1 A;  1HNX B;  3QWU A;  4JI0 B;  1XK5 A;  3W1G A;  5FPO A;  2UUA B;  4JI5 B;  2Q2U A;  4X64 B;  3BAA A;  4LF5 B;  1XDN A;  4B3S B;  1B04 A;  1XNQ B;  1V9P A;  1TA8 A;  5D1O A;  4DV1 B;  1IBK B;  3GDE A;  1A0I A;  3TY9 A;  4UCV A;  4GKK B;  1P16 A;  5DIS C;  2HIV A;  1IBM B;  3NC0 B;  3BA9 A;  2UXB B; 
#chains in the Genus database with same CATH topology
 1YTF B;  1G8M A;  3PR5 B;  1J95 A;  1CKN B;  1SEI A;  3K57 A;  5K1P A;  3R23 A;  1S0N A;  4I0X B;  3E8F A;  1P7G A;  3V4S A;  1FJG B;  1IVS A;  5KFM A;  5LMN H;  2LW7 A;  1G2W A;  4ZI7 F;  3CE2 A;  2JJ1 G;  2C2A A;  3RBE A;  5H6Q A;  5LP6 B;  5I5Y A;  2OCC C;  1PNK A;  2NVX A;  4JI4 B;  3VA7 A;  4UCR A;  5KUK A;  4JGS A;  3H4D A;  2PMZ A;  3ASN B;  5B1B B;  1HDJ A;  3P3P A;  4DW0 A;  2Q69 A;  2A7W A;  5BY1 A;  1I5Y A;  1P4R A;  1K8A W;  5KG1 A;  4A3B G;  3SYO A;  1A0G A;  3OEE G;  4IGG A;  3VQY A;  4E4T A;  4O3O A;  4JV1 A;  2JA7 A;  4EB6 B;  4APM A;  5C1P A;  5E25 A;  1H2G A;  2OIE A;  3HBL A;  1RM1 C;  1EZ1 A;  4Y8V B;  1Y74 B;  2JGD A;  4DR1 H;  3UO2 A;  1J5E O;  3TQ1 A;  3PZP A;  3VPD A;  2RCV A;  4DO2 A;  2QKC A;  5LL6 Y;  3B8M A;  2CH7 A;  1IX9 A;  1YCI A;  3QG5 A;  3BFR A;  1HNZ B;  4DV5 O;  1GSA A;  1S76 D;  3J7A U;  2FJZ A;  2K1E A;  3DTF A;  4DV6 H;  2CNQ A;  2ZJT A;  2DLN A;  5C8Y F;  4LFB B;  2N74 A;  4NYE A;  4C2M A;  2R8J A;  5KX5 F;  4DV6 O;  5KFW A;  1FFX A;  2ZD9 A;  2ZM6 H;  2ATL A;  5LA6 B;  3J80 N;  5D1P A;  2HVS A;  3CEI A;  5CA0 B;  3EXA A;  3M8A A;  4DRX B;  2E74 B;  1KQS U;  2DQ3 A;  3J7A K;  4CS4 A;  3DF7 A;  3KHG A;  1JLL B;  4TQS A;  3PW0 A;  1S3J A;  2OH2 A;  2KB1 A;  3RYF B;  3T9E A;  1RP3 B;  4YJ2 B;  1ZAU A;  4FLY A;  4CC5 A;  1AI7 A;  2E5L O;  1XI1 A;  4EKW A;  1CE8 A;  2RGV A;  4O4I B;  1YIT V;  2WLL A;  3F5T A;  3CS5 A;  4A3C G;  4J9S A;  2FK3 A;  2AGA A;  5LXT F;  4GZR B;  1HNX O;  5DEC A;  3CCV V;  1KBL A;  4LWS A;  4JI5 B;  1S77 D;  3X2Q B;  4X64 H;  4O2A A;  5IYC G;  1FAF A;  1KB9 F;  2R8I A;  3E8H A;  4YIP A;  2COG A;  4X64 O;  5D1O A;  3GDE A;  5GON F;  1URF A;  2DJV A;  1NR7 A;  5EC2 C;  5EBM C;  4J9R A;  1ARO P;  3SYC A;  3L4K A;  4RB2 C;  3GTQ A;  4L8J A;  1FD9 A;  4TV8 A;  2HP8 A;  4YXW G;  3KHL A;  3MR2 A;  1BNC A;  5CBH A;  4DXW A;  1ULZ A;  2B63 A;  3JD3 A;  4UXN A;  2PZS A;  1XNR O;  1I1L A;  3JRX A;  4MVQ A;  1SQB H;  5BWX A;  1Q90 D;  5DQI A;  3DSQ A;  1I5X A;  3HKC A;  4RZQ A;  2FP4 B;  3T9A A;  4J9Y B;  3JYC A;  2R6F A;  4GLX A;  3T9B A;  4ECV A;  2HVQ A;  1ZHS A;  1FS0 G;  5KG4 A;  3I4M G;  1N33 B;  1KJI A;  5J2U B;  2YSU B;  1CEZ A;  2YDE A;  2AGO A;  1YIJ V;  1PX2 A;  1YTF D;  3OHB A;  4W4K A;  1PL4 A;  1SF9 A;  4WF9 V;  1GN6 A;  3VQW A;  2ATK C;  2ZNI A;  2VPQ A;  1NQT A;  5T14 A;  5IYD G;  4BR6 A;  4HNU A;  3GB8 B;  1VBH A;  4YY3 H;  3GIK A;  3L70 H;  1NTZ H;  4B3M B;  1E4F T;  4XDK A;  5IWA B;  4RAZ A;  1Y76 B;  5DED A;  2QA4 V;  4QWE A;  1VS0 A;  3JAK B;  4A2B A;  3VBB A;  2BQU A;  4R50 A;  4JI7 H;  3MHS C;  3AG1 C;  4TUY A;  3RGZ A;  4JI7 O;  1AVM A;  3ZED A;  2ZXW B;  4LP8 A;  4NXN B;  1H2L A;  1EFR G;  3CCS V;  5IP9 G;  5HFL A;  4DR5 H;  2P0A A;  4HBN A;  2J6S A;  5KFJ A;  4IR1 A;  3ZHQ A;  1M57 B;  5KHI A;  3HB3 B;  1TUB A;  5BYA A;  2FL4 A;  3L75 H;  4NTY A;  4DR5 O;  5IYB G;  3H4B A;  2FLL A;  3LML A;  1GM8 A;  5DM6 V;  3GTO A;  4K3A A;  5KT4 A;  2HEP A;  1NVP D;  4ZHQ B;  3T2M A;  5KT2 A;  1XMO H;  4YR0 A;  2UXC H;  1NKD A;  4HNV A;  1Z2G A;  4OX9 B;  1P49 A;  1HNZ O;  1XMO O;  4I50 F;  5DGH A;  2UXC O;  5C1O A;  4LFB O;  3T9D A;  2E3C A;  4GX1 A;  2WAQ E;  1KUQ A;  1NU1 H;  4FLV A;  4LR3 A;  2BSK B;  1JX4 A;  3NGD A;  4I0X A;  1BZK A;  1OCZ C;  3E22 A;  3E8B A;  5K1X A;  1QVG U;  1WNS A;  4X1I B;  1XNQ B;  3TEK A;  2BTO A;  2SCU B;  2XUM A;  3IC7 A;  1IBK H;  1K83 A;  4KP4 A;  5BYB A;  4GKK B;  3UYY A;  2FLP A;  1TVK B;  4HNT A;  1N0J A;  5LP6 A;  4YB8 B;  1UC9 A;  1IBK O;  4O3R A;  2UXB H;  3B2E E;  1AI5 A;  1XHZ A;  2F95 B;  1A32 A;  2HJW A;  1T3N A;  4NZN A;  4HAM A;  5KFD A;  2AU0 A;  2XIG A;  5IJ9 B;  2P5O A;  3U10 A;  1TWH A;  2V9W A;  4MV3 A;  4L1K A;  1W0K G;  1S10 A;  2ETN A;  4MTX A;  3QF7 A;  3GJX B;  4RNM A;  2OIG A;  5BZB A;  5EWG A;  3GTG A;  4JI5 O;  1FVI A;  3RGX A;  1O9G A;  1EHI A;  1FXH A;  1Y74 A;  4FIP C;  1KKC A;  3N42 B;  2UUB H;  2J6U A;  1K1S A;  1K5Q A;  2XCA A;  1SYX B;  3CHX A;  2NUA B;  5C5J A;  2GUZ B;  2QB5 A;  4M0J A;  1WP7 A;  1V54 B;  1Q86 W;  2LFS A;  2QJ1 A;  1QLN A;  1JA8 A;  3BPZ A;  3K3W A;  4DK0 A;  5KHJ A;  3CME V;  2V4Q A;  2IJK A;  3G6B A;  3DXR B;  4TM5 A;  4PD4 F;  1XMQ O;  2YWV A;  3KCX A;  5CBG A;  3GTP A;  5LA6 A;  5GTH Z;  1JPX A;  4X62 H;  3TK1 A;  3V6K A;  4X88 A;  3K5O A;  3RB3 A;  4IYI A;  1GM7 A;  2R8G A;  3DGE A;  1DV2 A;  2Y4T A;  5E79 Z;  3T4Z A;  2IBK A;  4DR7 B;  3OM3 B;  1BJT A;  2F93 B;  1NTM H;  3H1H H;  3RYF A;  5DN6 G;  4ME6 A;  2V59 A;  1QNM A;  2N05 A;  5KFT A;  2Q0A A;  3K59 A;  3ZMT A;  4JV5 H;  5JH7 F;  2ZE5 A;  2IU3 A;  5LHH A;  5I47 A;  1DTO A;  1ZET A;  3Q2O A;  3S3W A;  3CMA V;  1I6U A;  4DR4 H;  1Y66 A;  1I94 B;  4JZ2 A;  3CD6 V;  4NZO A;  5BWW A;  4RB1 A;  4DV2 B;  2QTS A;  4YP3 A;  3LSS A;  4DR4 O;  3GII A;  4RB0 A;  1F23 A;  2VUM G;  1R3L C;  1PNM A;  1Z5W A;  3TET A;  2Q4P A;  4RO2 A;  3Q4H B;  4GX5 A;  4DV3 B;  1LUW A;  5KG2 A;  3G6Y A;  2F23 A;  1YSC A;  3CRM A;  2AZ0 A;  1QCE A;  4YJ3 F;  1OWT A;  2FTK A;  1BS3 A;  3FAV B;  4ECR A;  2C00 A;  5EIB D;  3TII A;  2WLJ A;  1FXK B;  1VMG A;  2UUA O;  5CA1 A;  3TY9 A;  4B3S O;  4KFM A;  2QYZ A;  1SQF A;  5JQG F;  4N23 A;  4MVU A;  3TW7 A;  2LGQ A;  5DGA A;  2R92 G;  2M05 A;  2ZDQ A;  1KEC A;  5KG0 A;  5LOV A;  2FPG B;  2DAA A;  5EWE A;  1WP8 A;  2R87 A;  2JVD A;  3JAL B;  4G3I A;  1WJZ A;  4X1K A;  4J9Z B;  3OGC C;  4IIJ F;  5H80 A;  1RJQ A;  4O3S A;  4OX9 O;  1L1F A;  4Q0Y A;  3UCS C;  2HKO A;  5KFQ A;  3H9V A;  3AG4 C;  4QIW F;  5J2T F;  1N48 A;  1KU9 A;  3AW8 A;  2B5U A;  2BQ3 A;  2XCL A;  4CKB A;  1GRJ A;  5KFK A;  2D2C B;  1B33 N;  4JTC B;  3HKB B;  4PDM A;  1E4E A;  3ASO B;  3LQS A;  3CXH F;  5L3E A;  1L0L H;  4X66 H;  5DG7 A;  1HNW H;  3T9F A;  4DR3 H;  1JMK C;  4GKK O;  3WB1 A;  4X66 O;  1HNW O;  2Z04 A;  5CB4 F;  1OCR C;  2CDY A;  1EKF A;  3BQ0 A;  2R8H A;  2VQD A;  3JAK A;  4CBC A;  4O4J A;  4B7K A;  1W59 A;  4R8U B;  2JS5 A;  3RIZ A;  1QR9 A;  3AG3 C;  4CH4 A;  4JI6 B;  5B3S B;  3GTJ A;  3MFI A;  2YIB D;  2W9B A;  1FFT B;  3OMI B;  4NXM H;  4ZOL F;  3OE7 G;  3C90 A;  4J7J A;  3ABL B;  3K08 A;  2JA5 A;  4NXM O;  4B3R H;  1W96 A;  2PUS A;  5D5Q A;  3JD0 A;  4O4H B;  2C2D A;  3GWO A;  1IYE A;  2CTQ A;  4B3R O;  3A0R A;  4ECS A;  4NTX A;  4ZHQ A;  5IYZ F;  3HXL A;  1GH6 A;  3OT7 A;  3ETD A;  2VWJ A;  1PM9 A;  1XUQ A;  3T5L A;  1DV1 A;  2YIA A;  4DUZ B;  3SPJ A;  2R85 A;  4OPA A;  4UCU A;  1OCO B;  2JJ2 G;  1I7N A;  2EJ2 A;  4MV9 A;  2QKS A;  1VF7 A;  1GN3 A;  1M56 C;  1M0T A;  4FMT A;  2R8K A;  2Y4U A;  2JA6 G;  2ZDG A;  4A3L G;  1Q6I A;  4X1I A;  3F7Y C;  4AI8 A;  3WFV A;  4X65 B;  4BWA A;  5I5S A;  1S03 G;  4OXS A;  4UVA A;  3S3X A;  2A79 B;  3KXY T;  1VAJ A;  1TVK A;  5L3F A;  1XBL A;  2YZG A;  3MWD A;  4JI0 B;  2PVP A;  1P84 F;  3MDS A;  4EBE A;  2JEI A;  4DW1 A;  5CR5 A;  2C2R A;  4F4X A;  4RCN A;  5HBR B;  2Q7G A;  2EUL A;  1TA8 A;  5KG7 A;  2NU7 B;  4I5S A;  1RJR A;  2HIV A;  4DV2 O;  4A3M G;  5LHI A;  3ZIA G;  2QKA A;  2Q0O C;  1WCM G;  3BA8 A;  3LDD A;  4CKC A;  1IBM O;  2Q6A A;  2PTM A;  2NR5 A;  2LJ2 A;  1ZHQ A;  3RGB A;  5JVD F;  3G80 A;  4YR2 A;  1NR1 A;  3IC9 A;  3U0Z A;  3J81 W;  5LGT A;  4JI2 H;  2WAM A;  2EBO A;  3KAL A;  3CCL V;  5LMN B;  3SE7 A;  2CW7 A;  4DV3 O;  1XQ8 A;  2Y69 C;  4JI2 O;  3N8D A;  3E83 A;  5EBL C;  3PR4 A;  1M93 A;  5LMU H;  3AX6 A;  4IHJ F;  2EIM B;  2CTP A;  5LMU O;  4JI1 H;  2WLL B;  1E79 G;  2UXN A;  2ZDH A;  4XDJ A;  2DPI A;  4FK5 C;  3CEB A;  4JI1 O;  4DL6 A;  5KG6 A;  3PJS K;  5FLM G;  3R65 A;  4J41 A;  2QDO A;  1MSW D;  3GV7 B;  3B09 A;  4ABM A;  4EFE A;  5D1O B;  3H0G A;  4DRF A;  2WDT A;  3LUL A;  5C8Y B;  2UXX A;  1QU7 A;  4CZZ A;  2RF4 A;  4DR1 B;  2QWR B;  3MD0 A;  2W70 A;  1Y1V G;  2CNV A;  1IYD A;  4WHX A;  3H01 A;  1IUR A;  2EIK B;  3Q8S B;  1WPX A;  1GGO A;  3CPW U;  4DV6 B;  4ED3 A;  5EZY B;  3S24 A;  4MTF A;  1US6 A;  3W7W A;  4ECX A;  4BIZ A;  4J10 A;  1ZSP A;  3ICX A;  2ZM6 B;  1PPJ H;  1P7B A;  3HKC B;  4FLT A;  5EC1 C;  2XD4 A;  2R9R B;  3L4J A;  4Q45 A;  4DV4 H;  3MHH C;  1COW G;  1PD3 A;  5TIS Z;  4F4L A;  4Z2W A;  3J80 W;  3L2P A;  4Q4C A;  4DV4 O;  2EIJ B;  4LC1 A;  2F1M A;  3HPL C;  1R6N A;  3B8N A;  2ZR2 A;  4J0M A;  2FPI B;  5LXT B;  2ZT9 B;  1GO3 F;  1KP3 A;  1KJ9 A;  5C44 G;  5KT7 A;  1VQ5 V;  3V6J A;  1GK9 A;  3JZI A;  4ECU A;  4M7E A;  1TWF A;  1HNX B;  5GON B;  3AK1 A;  4O7V A;  3OTF A;  4LBE C;  2Q2U A;  1JVM A;  4J7K A;  4X64 B;  1KJQ A;  2Y4R A;  3C3S A;  4WFE A;  5HNE A;  2PI5 A;  2O03 A;  4JV2 A;  1YJN V;  4DV1 H;  2W8L A;  1YI2 V;  3L72 H;  4Q8E A;  1I1K A;  2W8K A;  5IY5 C;  1VQ7 V;  2QSA A;  5DAA A;  4WCE V;  5L1J A;  5EWF A;  3CP1 A;  1UFI A;  1XNR B;  1I1M A;  4H0L B;  3V4Z A;  3MR3 A;  1KP2 A;  4O3Q A;  2ZKO A;  2A1H A;  4E2L A;  1HR0 H;  1TUB B;  4FLW A;  1VQ8 V;  3SDL A;  1VQ9 V;  2NU9 B;  4FS2 A;  3VOU A;  4YR3 A;  2YIC A;  1WR2 A;  3HOW G;  4C5B A;  3WO1 A;  1AP5 A;  1RPR A;  4O2B F;  5GW7 A;  2Z0A A;  4K0K H;  1B6R A;  5KFY A;  5KFX A;  3T5J A;  2HJD A;  4K0K O;  4MV7 A;  5EK0 A;  4TQD A;  1X9N A;  2EJ0 A;  2CUG A;  2W6I G;  3J81 N;  2JIZ G;  2CZG A;  5KS8 A;  3GIL A;  3U54 A;  3PW2 A;  3ASN C;  4JYY A;  4TSF G;  5B1A C;  3TGU H;  2VS0 A;  3E22 B;  4O4H A;  5BMV B;  4DUY H;  4RNO A;  5KFI A;  2FPP B;  1N8R W;  3K5H A;  3KYH C;  4DV7 H;  5LMN O;  5KFA A;  4YY3 B;  2V4D A;  4MS2 A;  3OR7 C;  3QO5 A;  3EHB B;  4TV9 A;  4U6P A;  3OAA G;  5IYC O;  1EZJ A;  2HHH H;  5KFS A;  4DV7 O;  3BQ2 A;  2W6P A;  3P32 A;  4QW8 A;  4DR6 H;  4Q44 A;  2E2H A;  1AB3 A;  3HO8 A;  3U9T A;  4JI7 B;  1MAB G;  4DR6 O;  1ZX3 A;  3ZHU A;  2LW1 A;  3P3N A;  2ODM A;  5AG2 A;  2AW9 A;  3CCQ V;  2NN4 A;  2VQE H;  4ED2 A;  1EN6 A;  4LF8 H;  4GKJ H;  1SET A;  2DYR C;  2GQR A;  3D8C A;  4MTO A;  3ZRW A;  4TOI A;  2R72 A;  4LF8 O;  4DR5 B;  4GKJ O;  2EIN C;  4O7Z A;  1GYF A;  1DGS A;  3E89 A;  4E6N A;  2FE3 A;  4NB5 A;  3ETJ A;  2R7M A;  2JDI G;  2WLI A;  1PKX A;  3I55 V;  1SC5 B;  4DR1 O;  2DWE C;  1VQO V;  1XMO B;  1AP6 A;  1R3J C;  2AQ4 A;  2WA3 A;  1KD1 W;  1MOF A;  2UXC B;  4O7T A;  3G6V A;  2N04 A;  4IYH A;  2Q68 A;  4DR2 H;  3IG0 A;  4ZI7 A;  2JEX A;  3OMN B;  2R7Z G;  4DR2 O;  4H33 A;  4A3D G;  5FPO A;  4IL6 Z;  3F5W C;  3AG2 C;  2ZM6 O;  2W57 A;  2FK1 A;  3K0G A;  1B04 A;  3HKD B;  5IYD O;  4HR7 A;  1K9M W;  1IBK B;  3MFH A;  1RYS A;  3PW5 A;  4WFH A;  1P16 A;  4FFR A;  2PYL A;  3OHA A;  2WWW A;  3P30 A;  1YF2 A;  4JTD B;  2UXB B;  5A2Q N;  1WB8 A;  4GLW A;  2ABJ A;  1MA1 A;  1RM1 B;  4G2K A;  2CFM A;  4YAK B;  3JD4 A;  4I4T F;  3GV5 B;  4MV8 A;  4TV8 F;  1BSM A;  4CMF A;  4O3P A;  2CGO A;  3OUU A;  1QHT A;  3WG7 B;  1TWA A;  1Y6X A;  2XAG A;  4F4W A;  2ZIM A;  4RUF A;  1ROP A;  2Z3Y A;  1A3G A;  2GHY A;  3SYA A;  4JAU A;  1GKF A;  3IGA C;  3HR0 A;  4C5C A;  3HOX G;  3CRC A;  1CP9 A;  5I5X A;  4BAY A;  4MVS A;  5L1K A;  4LF7 H;  1RPO A;  4FPP A;  2R70 A;  5C8Y A;  1OJH A;  5IYB O;  4U7C A;  5EOY A;  2RMK B;  5KX5 A;  3C0F B;  3MR5 A;  1K5S A;  3FX7 A;  3M99 B;  2UUB B;  4LF7 O;  3SPC A;  1VQ4 V;  1Z2O X;  4Z1V A;  4ED8 A;  3LDE A;  4P9O A;  1R9T A;  4LFC H;  3APQ A;  2EJR A;  1M4U A;  3GQC A;  3OTO H;  4LFA H;  1XMQ B;  5EZY A;  1K4C C;  3K0D A;  1H2M A;  4LFC O;  1D5A A;  4YHH H;  5CA1 B;  3OTO O;  4FJC C;  1YEW A;  2BTQ A;  2ZGI A;  2E76 B;  4MVR A;  2X5R A;  3PFF A;  1N32 H;  3FD9 A;  1N36 H;  1RSO A;  5LOV B;  2IA6 A;  2GTA A;  1Z5V A;  4X1K B;  3IAY A;  4ZKI A;  2GLT A;  1E4G T;  3H40 A;  2P90 A;  5KFP A;  3RW0 A;  4C5A A;  5LXT A;  4JV0 A;  1QLE C;  5EDW A;  4ECT A;  4JV5 B;  3TXQ A;  2UXD H;  1BL8 A;  3H3V H;  1KT8 A;  4KHP H;  2RQ6 A;  1ORQ C;  2EZP A;  4IWY A;  4LH6 A;  2UXD O;  2C2E A;  3H1I H;  1K33 A;  4DR4 B;  3HT5 A;  1E4E B;  5LYJ F;  1AR5 A;  5GON A;  1WA8 B;  1E1R G;  2YRX A;  3LP8 A;  1CKM A;  2DAB A;  2X0S A;  1SA0 A;  2ZE7 A;  4PDL A;  3ZRX A;  3TY8 A;  3I5D A;  1CKO A;  4AQY H;  4JUZ A;  2WA4 A;  4YY3 O;  3WB2 A;  3W5O A;  1Q5O A;  1O75 A;  4AQY O;  3BG5 A;  4TVI A;  4O4J B;  4UB6 Z;  1SQQ H;  1M90 W;  5I60 A;  1FJG H;  4TQF A;  1Z2N X;  4RAI A;  3N44 B;  3OUS A;  2W9B B;  4RZR A;  1VQ6 V;  2UUA B;  3JZ6 A;  4FFK A;  1I3Q A;  4LF5 H;  3BAA A;  1VAR A;  2W9C A;  4B3S B;  4ZIB A;  3SYP A;  4PA3 A;  4LMY A;  3D36 A;  1V9P A;  4P2Z A;  2GPS A;  4IIJ B;  3QVN A;  3SPI A;  2X6C A;  1Q8I A;  5KHG A;  5LP6 F;  3ZMU A;  5J2T B;  5LGN A;  3BQ1 A;  2ZIN A;  2V7Q G;  1K92 A;  3SJB C;  3E35 A;  4O7N A;  5DMX A;  2C22 A;  3RAQ A;  3NUA A;  1IBL H;  2LFR A;  2HHF A;  3GIM A;  4F50 A;  1M5I A;  2DW4 A;  3WWJ A;  1S5J A;  3A2F A;  2OTJ V;  1FKA H;  1SRY A;  2X6A A;  4NYK A;  5JUM A;  3GID A;  4FFN A;  4AIL C;  3PO2 G;  3AG1 B;  3EVK A;  1UC8 A;  1FKA O;  1IXB A;  4FFO A;  4BY1 G;  5BMV A;  4X66 B;  1HNW B;  1K3E A;  3ZS8 C;  2P4V A;  5KFF A;  3IFX A;  5FNV F;  2QM4 A;  2ZE8 A;  3K9S A;  3BCC H;  3U11 A;  2UXB O;  5L9X A;  1N34 H;  1C3O A;  1S9F A;  1ZL8 B;  5JQW A;  3VMM A;  3V6H A;  2CKZ B;  1VEW A;  4A3F G;  2IH1 C;  1N34 O;  2YL2 A;  4ICG A;  1Q43 A;  5I5W A;  4RQF A;  1G1X B;  4MVM A;  5F9L A;  5KT5 A;  2EX3 A;  2IH3 C;  4QE9 A;  5EYP B;  4NXM B;  5LA6 F;  2HVR A;  5KFG A;  4W4L A;  4RB3 C;  5CA0 F;  1DF5 A;  5FLX W;  4I55 B;  3AK2 A;  4B3R B;  4I50 A;  2YZN A;  4JYC A;  4WBN F;  1PNL A;  3ABM C;  4A5U B;  4FS1 A;  1OCZ B;  1MNG A;  1LR1 A;  2UUB O;  4YJ2 F;  1V55 B;  4J9P A;  2YW2 A;  4B3T H;  3ZHR A;  1GSH A;  3MJF A;  1VQP V;  3CXC U;  2IMW P;  1XDC A;  4J42 A;  2ADQ B;  3PVX A;  4B3T O;  4O4I F;  4Z1M G;  2Q2T A;  3H1L H;  1SQV H;  2W7P A;  3TQT A;  1WH2 A;  5IT9 W;  4X62 O;  1H2K A;  5KT3 A;  4FBT A;  3HKD A;  5H5N A;  4K8X A;  3CRA A;  2YS6 A;  1VQL V;  3RB4 A;  2VQF H;  4MT8 A;  4DV0 H;  3HOZ G;  1KJJ A;  4J7Z A;  3U9S A;  4O83 A;  1HW7 A;  1OCC C;  4KUM A;  4O86 A;  4WFG A;  4DV0 O;  4JZG A;  2RNB A;  3M9M B;  4JV5 O;  5JCO C;  4MAM A;  4UUJ C;  3RJ0 A;  5KFN A;  4MA0 A;  3JAW A;  2LP7 A;  2R9A A;  2F66 C;  2WLN A;  4K6N A;  1WSC A;  4CS3 A;  4U7O A;  1IBM B;  5KFE A;  3ETQ A;  1N33 H;  2FML A;  1VQN V;  3GB7 C;  1WB7 A;  4J11 A;  2P6J A;  2Y0S A;  4QIW E;  2EIY A;  5BPH A;  4R7R A;  2R92 A;  2YYA A;  4JI2 B;  3UFX B;  4GUN A;  3WB0 A;  5KT6 A;  4G28 B;  1KKD A;  4RQE A;  4O7S A;  5J2U F;  1T36 A;  3CCM V;  1VQK V;  3TW6 A;  3T99 A;  2ZIO A;  5LMU B;  3GIP A;  4PJ0 Z;  1AUV A;  3LWB A;  3W7S A;  5ITZ A;  3KAK A;  5IWA H;  4XDL A;  4KL1 A;  4JYA H;  4QPJ A;  3RT3 C;  3K03 A;  4JI1 B;  4UUG A;  3D3Q A;  4J9N A;  1I08 A;  3SR2 C;  4JYA O;  2UUC H;  5BWR A;  2HVK C;  5JH7 A;  3Q8P B;  4U3F H;  2H94 A;  4GCZ A;  2UUC O;  1JR9 A;  4TQR A;  4D7T A;  5DG8 A;  2C35 B;  1RYR A;  4MTD A;  1Y1W G;  1A9X A;  4QPK A;  5KFB A;  1R1B A;  4AYB E;  4I9Q A;  1A48 A;  4UCO A;  4J9M A;  1OBG A;  2P67 A;  2OWO A;  1G4Y B;  3L73 H;  4D7S A;  4DQN A;  1S5H C;  5B3S C;  3DC5 A;  3APO A;  2ASD A;  1WA8 A;  2MK3 A;  2NU8 B;  4DL3 A;  3ABT A;  2QE7 G;  4A93 G;  4K8Z A;  4QSH A;  3B4S A;  3RB0 A;  1JQ0 A;  3QO8 A;  4K35 A;  4NVP A;  2R7N A;  4YJ3 A;  1AI6 A;  3STL C;  4DR3 O;  3A8T A;  3ZMV A;  3B77 A;  4MW8 A;  5FPR A;  3VPB A;  4DV4 B;  1DIK A;  4F6E A;  4DL2 A;  1NT2 B;  2R9I A;  4QW9 A;  3Q8Q B;  1Q82 W;  2Z02 A;  4ECQ A;  4EBC A;  5FLX N;  4JYB A;  5JQG A;  5C3E G;  2OLS A;  4RNN A;  4UCT A;  4PV1 B;  3K5N A;  2AGQ A;  5BPF A;  1YZB A;  4JAS A;  5B5E Z;  3HKZ E;  1D2D A;  3I56 V;  2ZE6 A;  2V58 A;  2XCP A;  4ECY A;  1CPY A;  4ASU G;  3HOY G;  1VF5 B;  2IJH A;  4IIJ A;  3JAR B;  1DK1 A;  2YXL A;  4LCU C;  3CX5 F;  1VF6 C;  3VQV A;  1XK5 A;  3HB9 A;  1PV0 A;  5CAE B;  3RV4 A;  4QIW A;  5J2T A;  3L74 H;  3HKE A;  4TV9 B;  3W7X A;  3K79 A;  4F6R A;  1JDE A;  4B08 A;  3W7U A;  3D3I A;  5JJJ B;  1KC8 W;  3W7T A;  5IT9 N;  1OCR B;  4H13 B;  4DV1 B;  4O84 A;  5I5U A;  1OBD A;  2HG8 A;  1IXM A;  3OMA B;  3T1C A;  3ZHT A;  5CB4 A;  4HYK A;  1BMF G;  1LNQ A;  3JSN A;  5H2F Z;  4BIO A;  2EJ7 A;  3AG3 B;  3M7M X;  1SQX H;  1B6S A;  3OSP A;  3ZRW B;  3EFF K;  5FJ8 G;  4BBR G;  1WCM A;  2IBZ H;  4MW3 A;  1K97 A;  3GIQ A;  1HR0 B;  1SES A;  4MA5 A;  5KFU A;  1TAE A;  5DGB A;  4JXU A;  4FE2 A;  2WLI B;  4ZOL A;  1ZL8 A;  5KFL A;  1GM9 A;  1X4T A;  4O3N A;  3RBD A;  4L87 A;  4K0K B;  2GV9 A;  3IJ4 A;  2KKW A;  5KAF Z;  3B40 A;  3JAS A;  5IJ0 A;  2W6N A;  4AYB A;  2JEJ A;  1PK8 A;  1OZ0 A;  3N2G A;  4ZI7 B;  5CBF A;  3GVM A;  4LF9 H;  1RFY A;  2KG7 B;  3JAT A;  5EYP A;  3JCU Z;  4A2A A;  4CH5 A;  1I2L A;  2O57 A;  4I55 A;  4JI8 H;  2IM9 A;  1SZT A;  2VWK A;  2HGW A;  1M56 B;  4JI8 O;  2F4V H;  3T7A A;  2PYJ A;  2X6B A;  2RDJ A;  3RVY A;  2W6M A;  1FXV A;  4LF6 H;  4DV7 B;  3ZJZ A;  4BY7 G;  4A3G G;  2F4V O;  3ZN0 A;  1P8L A;  5C4X G;  1NH2 B;  2HHH B;  1ET0 A;  4X1Y A;  4WFA V;  4DR6 B;  4WFF A;  5L3B A;  1Y1V A;  4PWQ A;  3M9N B;  4FZ1 A;  3HKZ A;  5KFC A;  2ZNJ A;  4PDR A;  4RU9 A;  2WLK A;  3OUF A;  3ETE A;  4MSW C;  2G38 A;  2VQE B;  4LF8 B;  5IP7 G;  4GKJ B;  4BBS G;  5KFO A;  1GO3 E;  1S0O A;  3RYI A;  3T1H H;  1WAZ A;  3ZHV A;  1Q6H A;  2B1G A;  2Z5U A;  2V4R A;  5KX5 B;  1T94 A;  4OPH A;  4XBF A;  3RN4 A;  4D6T H;  3T1H O;  4JI3 H;  3RYH B;  3WU2 Z;  3BEH A;  3IN5 A;  4EYH B;  2DYS C;  3RAX A;  3ML0 A;  4IRK A;  4JI3 O;  2BQR A;  4MTG A;  5JVD A;  2R93 G;  3ZRV A;  4NTW A;  2HGX A;  2YCH A;  1JX9 A;  3UZB A;  2QTO A;  4DR2 B;  3OR6 C;  3G71 V;  1I50 A;  4EGQ A;  2BTQ B;  1K34 A;  4O7Y A;  4NZM A;  4CS2 A;  1K1Q A;  2JEF A;  1RSO B;  3VPC A;  2HLD G;  4X89 A;  4R6Z A;  4U7N A;  2WB1 A;  4B7E A;  1AJN A;  3RYC A;  4UCV A;  2DWD C;  4H44 B;  3JD1 A;  3LNM B;  2E2I A;  3KHH A;  1M0W A;  4FM0 A;  4MV1 A;  2WE6 A;  1KTA A;  2X7R B;  5A2Q W;  2GQS A;  5BWU A;  1KYO F;  4NLG A;  3JD2 A;  5KAI Z;  3CCU V;  5JCO A;  3UO3 A;  4CKE A;  1AN7 A;  1SA0 B;  3CC7 V;  1EZV H;  2WTF A;  2RN9 A;  3ZRS A;  3SJA C;  1PP9 H;  2GBO A;  1H2N A;  1BT8 A;  1KC7 A;  1CQI B;  5HFM A;  1Y14 B;  4LF7 B;  5B1N A;  2R7L A;  4A3J G;  2JGU A;  4O4L F;  4DV1 O;  3BRC A;  2Q7D A;  2H8P C;  1Y4M A;  2OT5 A;  2PN1 A;  3CQZ A;  3ABK C;  3RVZ A;  4LFC B;  2HFE C;  1SZX A;  3TIN A;  1TGO A;  2W9C B;  3OTO B;  2EIL C;  5KFH A;  4RUC A;  4LFA B;  2CAZ C;  1RJP A;  2NU6 B;  2YXY A;  3T1Y H;  1MZE A;  1N4C A;  1HR0 O;  3BJY A;  3L9D A;  3ZHS A;  5FD6 A;  2DOS A;  3LSQ A;  3T1Y O;  4LF4 H;  1XHX A;  4ZBM A;  2CTR A;  3M4I A;  3O9O A;  5LP6 C;  4LF4 O;  4FFB B;  5JJN B;  4PI2 A;  3OUZ A;  4X8A A;  2HHF B;  4Q43 A;  1NZ6 A;  2YRW A;  2ZCE A;  5J9P C;  3RV3 A;  3H1K H;  4JI0 H;  3K58 A;  2A0L A;  3JCZ A;  2XT9 A;  2UXD B;  1WPB A;  1T5E A;  5B1B C;  3OD4 A;  3SJQ C;  3SYQ A;  3STZ C;  4KHP B;  3RUP A;  5I5V A;  1S97 A;  3JAR A;  4AHC A;  3FKI G;  1XIL A;  4X20 B;  5IY5 B;  5CM0 A;  2ODT X;  1WN7 A;  4ZQI A;  2F43 G;  2XND G;  5F9N A;  2PY5 A;  4DUY O;  3DAA A;  2CTW A;  1MSD A;  5I5T A;  4AQY B;  4HYO A;  2YUA A;  4NKG B;  2YZM A;  4H37 A;  5BR8 H;  1GSO A;  1NH2 D;  2HHH O;  1B06 A;  5BR8 O;  2Y48 A;  2JA8 G;  2XC9 A;  2XHB A;  3PN1 A;  3FYI B;  4PDV A;  2YZL A;  1JFF B;  2DPJ A;  2ADP A;  3A0H Z;  3OEH G;  5K3W A;  4O2B A;  2VQE O;  1S0M A;  4LF5 B;  1Y67 A;  2FYU H;  2R7Z A;  3SNO A;  4I50 B;  1ZWI C;  5EBW C;  2I80 A;  2XOK G;  2WLM A;  1EN5 A;  3QTC A;  4UVC A;  5B1A B;  3K3V A;  2IJI A;  1NJI W;  3EYY A;  1EKV A;  5DG9 A;  4PZ8 A;  2XAF A;  3TXS A;  2MCT A;  4UV8 A;  1VF6 A;  1TWG A;  2JRI A;  4JPR A;  2OCC B;  4O81 A;  1IBL B;  3K9A A;  5KMG B;  1GN4 A;  3N6R A;  4M9U A;  3N6X A;  2KG7 A;  1J5E H;  4PA9 A;  4F4Z A;  3DTU B;  5FNV B;  1NVP B;  5L3D A;  3CJH A;  3CRR A;  4DV5 H;  1L0N H;  1OV9 A;  3WG7 C;  4O2A F;  3RWR D;  2ZQM A;  3AK3 A;  5K2M A;  3TCU A;  5LBQ A;  4QWB A;  2DYR B;  3X2Q C;  4MTE A;  4BXX G;  2DWC A;  4ED6 A;  2CK3 G;  2YEV A;  3GTL A;  3Q8R B;  3SPG A;  2JA7 G;  3G67 A;  3JAM N;  2EIN B;  4ED7 A;  2ASJ A;  3KRE A;  1KJ8 A;  1Q6U A;  3JRW A;  3DTG A;  4OGQ B;  3N41 B;  1N34 B;  3JAW B;  2RDI A;  3E5N A;  1BCC H;  2DN9 A;  2QEX V;  3BAB A;  5EZY F;  3WWH A;  5KFV A;  1O9H A;  4WBN B;  3SGI A;  2PI4 A;  4XZ3 B;  5L1L A;  3LNN A;  3NXS A;  2IU0 A;  1NI8 A;  3RTX A;  2E5L H;  1QVF U;  4J80 A;  3U0G A;  1R73 A;  1V51 A;  1BQ0 A;  3RR5 A;  1I2K A;  2Q7E A;  3WWI A;  1F7Y A;  3CCJ V;  2UU9 H;  3AG2 B;  2QF7 A;  3RYH A;  5KG5 A;  1I0H A;  4A3K G;  4A3I G;  2ZDI C;  1HNX H;  1IOV A;  2UU9 O;  3E86 A;  1GMG A;  5L1I A;  4UB8 Z;  4B3T B;  5H6R A;  2BOB C;  2XAQ A;  3MWE A;  5ITZ B;  2W71 A;  4MV6 A;  4ED1 A;  2HR3 A;  4LFA O;  4JAA A;  3QQM A;  2Q67 A;  4YHH O;  4X62 B;  2P22 C;  4PI0 A;  5JH7 B;  4Q6G A;  2GDS A;  5KFR A;  4DL7 A;  3G8D A;  1GN2 A;  1N32 O;  3SPH A;  1N36 O;  4I4T A;  1JDB B;  4GT1 A;  1XNR H;  3ZMS A;  1AJP A;  4LH7 A;  2VQF B;  2LGW A;  2VR1 A;  4DV0 B;  3RF2 A;  1VP7 A;  3AEI A;  3ZMZ A;  4FGR A;  4TUY F;  2COJ A;  2BOC C;  3FB8 C;  5KHK A;  2R7K A;  2QR4 A;  4FBU A;  4XYL B;  1I7F A;  3GV8 B;  3T5H A;  1L8D A;  2Q7H A;  4KHP O;  2RDC A;  5EIB C;  1R3K C;  2ZXW C;  4HNA A;  3CCE V;  3QZ7 A;  3QZ8 A;  3PW4 A;  1R6T A;  1IZ3 A;  1VKZ A;  4U3J B;  4YJ3 B;  1SS3 A;  1M57 C;  3KG2 A;  4Q8F A;  2B63 G;  4J9O A;  4JAV A;  4QJF B;  1AIL A;  2WYO A;  3R5H A;  2J6T A;  5D8D A;  4IR9 A;  4LNU B;  4PEL A;  2ARH A;  4IRD A;  2W7O A;  3Q1K A;  5CE8 A;  5JQG B;  1K4D C;  1FJG O;  1XL6 A;  1SFO A;  4PA6 A;  3ZBH A;  1VIB A;  2RJZ A;  2W6J G;  3CC2 V;  4JI4 H;  2ITC C;  1QLE B;  4QNH B;  4LF5 O;  4JYA B;  1M9N A;  2A06 H;  2I8C A;  2VOB A;  4JI4 O;  1MG1 A;  4PZ6 A;  5BMV F;  3UT5 A;  2AGP A;  2YS8 A;  2UUC B;  2Q9L A;  3CVZ A;  3HKE B;  1D5N A;  3GIJ A;  4FVM A;  4ECW A;  2XGQ A;  4F6R B;  4QWC A;  4FFB A;  2QM8 A;  3THO A;  3R9R A;  3LUT B;  5LYJ A;  1N0N A;  3AYH B;  3N2K A;  2YID A;  3K06 A;  1IBL O;  2IP4 A;  1I7L A;  4EFB A;  5CB4 B;  4GX0 A;  4HQ6 A;  2ZR3 A;  3R5F A;  1U97 A;  3WNZ A;  3A0B Z;  3RB6 A;  2Y0S E;  1HNZ H;  2PGG A;  4UFZ A;  4X20 A;  2WPD G;  2Q8V A;  2OTL V;  3JZF A;  4Q4D A;  3C3T A;  3K04 A;  4DR3 B;  4LFB H;  1F4M A;  2DMX A;  1KBH A;  1NS1 A;  1YHQ V;  4ZOL B;  2GSM B;  2NVY A;  3KHR A;  1CKN A;  1Q81 W;  1Q3E A;  1GTO A;  3TIG A;  3JAS B;  5IJ0 B;  1V54 C;  3W1B A;  1V55 C;  1MMM A;  1SKV A;  3N2G B;  4TT3 G;  3TJT A;  1JFF A;  1H8H G;  5BWV A;  4N21 A;  2K9P A;  3JAT B;  3I4N G;  1CXZ B;  5IYZ B;  1M1K W;  3CWB H;  3G8C A;  3ORQ A;  3K5I A;  2AXT Z;  4LSA A;  2BE3 A;  5LGU A;  1BXR A;  4PHZ A;  4PBC A;  4BWS C;  4O7L A;  2FK2 A;  3R5X A;  2BCC H;  2Y0I A;  4PA4 A;  2ASL A;  1XL4 A;  3K5L A;  3KAJ A;  2GPW A;  3PW7 A;  1BHB A;  3SJC C;  3RFC A;  2J9G A;  1X59 A;  1MZF A;  4RWU A;  1UJW B;  3ZN1 A;  4CE5 A;  4JI5 H;  4QWD A;  4X1Y B;  2JEU A;  4EB6 A;  2YU9 A;  4PDB A;  2E75 B;  5KHH A;  5KMG A;  1RK6 A;  1FPO A;  1A0I A;  4G27 B;  5LHG A;  5DIS C;  1XRE A;  3BA9 A;  1BE3 H;  5FNV A;  4I7Z B;  2KSD A;  2XAJ A;  3FYE B;  1CS0 A;  1VBG A;  4EQ5 A;  2VUM A;  4DL5 A;  1SER A;  5BWT A;  5JJE B;  1BGY H;  3RYI B;  1XMQ H;  2YI9 A;  2QWO B;  3BHP A;  2VQF O;  3UZO A;  3VOT A;  2XAH A;  3NBZ B;  3N43 B;  1LUV A;  3UQ8 A;  4P30 A;  5CA0 A;  4BW5 A;  4DL4 A;  5JVD B;  4DRX A;  3ABM B;  3FFQ A;  2DQ0 A;  4FM9 A;  5DGI A;  1AI4 A;  3KKY A;  1M7J A;  4WBN A;  5CA1 F;  1AUX A;  3CCR V;  3U55 A;  1FXK C;  3H20 A;  2C28 A;  3OFN G;  1JOY A;  4LF9 B;  4MVO A;  4YJ2 A;  2R86 A;  4UVB A;  3CSW A;  1N33 O;  5GTI Z;  5H9C A;  3WO0 A;  4IHJ B;  2HGS A;  5LOV F;  4JI8 B;  4MVZ A;  4CMD A;  1NTK H;  1N56 A;  4XYM B;  4O4I A;  5JWP A;  4IAJ A;  2AZ2 A;  3RYC B;  2F4V B;  1BQZ A;  4GYC B;  2FB9 A;  2WAQ A;  3G4S V;  4LF6 B;  3R66 A;  2DE0 X;  1JIH A;  3HOV G;  2NLJ C;  1Z2P X;  4B3M H;  1BGW A;  1K7D A;  1Y1W A;  3G6E V;  4WD3 A;  3K5M A;  2QGN A;  1OCC B;  4B3M O;  2IJJ A;  2QM7 A;  2GTS A;  2W9A A;  5IWA O;  5CMU A;  2PBZ A;  5DQH A;  1S5L Z;  3KCY A;  4YIO A;  2CW8 A;  3UM7 A;  2WLH A;  4EEQ A;  2Y0P A;  4ED0 A;  4KXR A;  3T9C A;  4I7H A;  3ASO C;  5KG3 A;  4NXN H;  2IW5 A;  1BHA A;  2VA3 A;  4FFL A;  3CYO A;  2UUA H;  3SI8 A;  4NXN O;  1C30 A;  4TWK A;  4WFB V;  4B3S H;  2XAS A;  3T1H B;  1JJ2 U;  4O4J F;  3OSN A;  3NR7 A;  1EYZ A;  3N27 A;  2BR0 A;  4JI3 B;  1Q7Y W;  1HWY A;  2B1I A;  2W0X A;  5DLG A;  2UVR A;  1WLE A;  2DZD A;  3K3P A;  4YQW A;  2ZDI A;  1V4Y A;  4OX9 H;  3KZI Z;  1R3I C;  5DQG A;  3GWK C;  5A9G A;  4EYI B;  2YC0 A;  4U3J A;  5J2U A;  3ABL C;  4HZ3 A;  1H38 A;  3W1G A;  1M6V A;  1RK5 A;  4ZHQ F;  1K73 W;  4QJF A;  2ALZ A;  4R8C A;  4LNU A;  1XNQ H;  3EPG A;  4ECZ A;  5KUM A;  3T4D A;  1KMI Z;  1JCH A;  3FB7 C;  4GKK H;  1ENV A;  1XNQ O;  4DLK A;  4YBZ B;  4RUA A;  1H2S B;  1OCO C;  3LDC A;  5FR9 A;  1Y76 A;  3AG4 B;  2KSW A;  3GLK A;  4PA7 A;  2JA6 A;  4O4L B;  1IOW A;  1SQP H;  3DC6 A;  2P06 A;  4GC7 A;  3MWM A;  2HVJ C;  1EM1 A;  4J9L A;  1AR1 B;  3GTK A;  4P9P A;  4EG0 A;  2UVU A;  2CQY A;  1KUT A;  4E4E A;  2DIK A;  4PZ7 A;  2UVW A;  5D5P A;  2M7W A;  1DF4 A;  4YAJ B;  2V5A A;  5JVL A;  3CC4 V;  5IE9 A;  3OW2 U;  2HG5 C;  5HV6 A;  5KFZ A;  4DYL A;  4CC6 A;  3O65 A;  3ZCC A;  1L2Z A;  4O2B B;  3JSL A;  1EKP A;  4I55 F;  2WB1 E;  3H1J H;  4DK1 A;  2OYQ A;  1TUE B;  1B3Q A;  3CB2 A;  4O82 A;  5B66 Z;  4UCS A;  2ILM A;  2JK5 C;  4QE7 A;  3T1Y B;  3RBZ A;  2JA5 G;  5KA6 A;  2NNU A;  4BIU A;  4LF4 B;  1XEQ A;  3UKM A;  5BXZ A;  2BSK A;  2EZO A;  4QWA A;  4DR7 H;  2FB5 A;  1H8E G;  2AHY A;  2W6Z A;  2JEG A;  1S0V A;  4DR7 O;  4CH6 A;  4O7W A;  2EIM C;  3BAC A;  2EJ3 A;  5IYZ A;  2PF4 E;  4ETS A;  2FKX A;  2JGD B;  3G6X A;  4LF9 O;  1GAX A;  3CJH B;  3T5K A;  4I9W A;  1S72 V;  2Q5Z A;  1JXL A;  2CH7 B;  3EPI A;  2FMA A;  2QWQ B;  3QNE A;  4DUY B;  1I94 H;  5IJ9 A;  1B6Q A;  5FD5 A;  4DV2 H;  1FYJ A;  2YIB A;  2YEV B;  4FLZ A;  1I94 O;  1F51 A;  3ETH A;  5IDJ A;  1IBM H;  1QBZ A;  1AR4 A;  1FFX B;  4BW9 A;  1OHH G;  4QGP A;  4LF6 O;  5BR8 B;  2A9H A;  3FB6 C;  1DLB A;  3QO7 A;  5CN0 A;  2HIX A;  4C7U A;  2W0F C;  4EEY A;  2QK4 A;  4DV3 H;  2EIK C;  1YJW V;  2I87 A;  4FU0 A;  3N40 P;  3QWU A;  3BY6 A;  1W0J G;  4RAY A;  2R93 A;  1IDS A;  2GUZ A;  2L35 A;  1F4N A;  4O7R A;  4X9Q A;  4J9K A;  1E1Q G;  2VRZ A;  2YS7 A;  1XDN A;  5E1A C;  2OCH A;  2P7T C;  3MR6 A;  3DXR A;  1ZQ7 A;  4F4Y A;  1THZ A;  5F2V O;  2CNU A;  3T54 A;  3NC0 B;  4GX2 A;  2VPS A;  3LSU A;  2EIJ C;  2P4K A;  2UVV A;  2COI A;  2V1D A;  2HJF C;  1HP8 A;  2Y69 B;  1GLV A;  4LWS B;  1EN4 A;  4O2A B;  2WSS G;  1KEE A;  3M9O B;  2R82 A;  4JF3 A;  1ZLZ A;  3AG7 A;  1J5E B;  3QFF A;  4CH3 A;  3VNN A;  5LL6 b;  1JKJ B;  2D3O W;  2B9Z A;  4IHJ A;  5FL7 G;  1YJ9 V;  3BVO A;  1MZB A;  2RGR A;  4IT5 A;  1YVW A;  4DV5 B;  1CQJ B;  1G6U A;  4I4T B;  2AHZ A;  4TV8 B;  2ITD C;  2R84 A;  2MW2 B;  1DAA A;  5C93 A;  2HDK A;  3OGI B;  3FMA A;  3FKS G;  4UV9 A;  1U96 A;  3CRQ A;  4EGJ A;  3H0G G;  3PO3 G;  2W6O A;  3JAM W;  3GTM A;  3F8N A;  4IRC A;  4Q20 A;  4HNA B;  2KQX A;  2M6Y A;  2VA2 A;  2CE4 A;  2DYS B;  3L71 H;  3Q4H A;  4RUE A;  2FLN A;  4JI6 H;  1ZUQ A;  4FLU A;  2LO1 A;  2PMZ E;  1UPG A;  2Q73 A;  2XTA A;  3FAV A;  4JI6 O;  5CA3 A;  3D36 C;  2E5L B;  4IWX A;  1FXK A;  3FB5 C;  1S68 A;  4DAA A;  1SQG A;  1JJO A;  2UU9 B;  1AJQ A;  1YXB A;  3ABU A;  2A3Q A;  5KLV H;  4DIM A;  1PL0 A;  4J9Q A;  1ZTE A;  1QQC A;  2QWP B;  4R7C A;  4FZ0 A;  3MAQ A;  5B1O A;  1R6K A;  1W2B U;  2CGN A;  3ETG A;  4JTA B;  3JAL A;  5KKN B;  3I12 A;  4YHH B;  3F7V C;  4GC6 A;  1VQM V;  4O4H F;  4DUZ H;  5L3C A;  3NBY B;  3TY5 A;  3ZX6 A;  1XOU A;  3UT5 B;  4EBD A;  4A3E G;  3E2E A;  4DUZ O;  1N32 B;  4XX0 B;  2X0L A;  4TUY B;  1N36 B;  3FKI A;  5DLF A;  1EUC B;  2W6Q A;  4FM1 A;  4HN2 A;  2H3O A;  4TV9 F;  3FDS A;  2YI8 A;  4MV4 A;  4NR1 A;  1W93 A;  3KTM A;  2VUG A;  1YDX A;  3ORR A;  4X65 H;  5LYJ B;  3HKB A;  1QR8 A;  4LSX A;  3HOU G;  5L3G A;  4X65 O;  1WRV A;  3N2K B;  2JS3 A;  2LQT A;  4FFP A;  1EUD B;  4CHI A;  1EBO A;  4JI0 O;  1SCU B;  3RFR A;  3CSX A;  4FLX A;  4FFM A;  1UNN C;  2L6L A;  4R8U A;  1NBM G;  4O4L A;  3ABK B;  5KA5 A;  2EIL B;  2FKL A;  3E8G A;  2YXH A;  3VQX A;  4FM2 A;  2QWN B;  1TWC A;  4IZO A;  2XGP A; 
#chains in the Genus database with same CATH homology
 3BA8 A;  1CKN B;  1SEI A;  2PTM A;  3K57 A;  5K1P A;  1ZHQ A;  3RGB A;  4R7R A;  2WYO A;  3J81 W;  1FJG B;  3U0Z A;  4LNU B;  4JI2 H;  3KAL A;  4JI2 B;  5LMN H;  3WB0 A;  5LMN B;  2CW7 A;  5JQG B;  1XQ8 A;  5LP6 B;  2RJZ A;  1M93 A;  2ZIO A;  5LMU B;  5LMU H;  4JI4 H;  4JI4 B;  5ITZ A;  3KAK A;  5IWA H;  4KL1 A;  4JYA H;  4UCR A;  4JYA B;  4JI1 H;  4JI1 B;  2VOB A;  4PZ6 A;  3SR2 C;  3UT5 A;  2UUC H;  2UUC B;  3CVZ A;  5JH7 A;  3HKE B;  3VQY A;  4FVM A;  4F6R B;  4FFB A;  4D7T A;  4EB6 B;  3THO A;  4APM A;  5LYJ A;  4EFE A;  5D1O B;  4DRF A;  2WDT A;  4MTD A;  5C8Y B;  3N2K A;  4I9Q A;  4DR1 H;  4EFB A;  5CB4 B;  4DR1 B;  4UCO A;  2OWO A;  4D7S A;  3QG5 A;  1HNZ H;  2PGG A;  4UFZ A;  4X20 A;  1HNZ B;  4DV6 H;  4DV6 B;  5EZY B;  3S24 A;  2ZJT A;  4DR3 B;  4K8Z A;  4LFB H;  4LFB B;  4NVP A;  1FFX A;  4YJ3 A;  2ZM6 H;  2ZM6 B;  3ICX A;  4ZOL B;  5LA6 B;  5D1P A;  4FLT A;  3HKC B;  2HVS A;  5CA0 B;  3L4J A;  5FPR A;  1CKN A;  4DV4 H;  4DV4 B;  4DRX B;  1Q3E A;  1NT2 B;  3J80 W;  3L2P A;  3JAS B;  5IJ0 B;  3J7A K;  4CS4 A;  3DF7 A;  3W1B A;  1SKV A;  2F1M A;  3N2G B;  1JFF A;  3RYF B;  5JQG A;  3JAT B;  4YJ2 B;  4UCT A;  4J0M A;  5IYZ B;  3K5N A;  5LXT B;  1ZAU A;  4LSA A;  4FLY A;  4CC5 A;  1XI1 A;  4PHZ A;  2RGV A;  4BWS C;  4O4I B;  4IIJ A;  3JAR B;  4M7E A;  3K5L A;  2YXL A;  5GON B;  1HNX B;  3KAJ A;  3VQV A;  1XK5 A;  3SJC C;  5J2T A;  3HKE A;  4TV9 B;  3OTF A;  4JI5 H;  4JI5 B;  2Q2U A;  4X64 H;  4X64 B;  4F6R A;  4X1Y B;  4B08 A;  4O2A A;  4EB6 A;  5JJJ B;  2O03 A;  4PDB A;  5KHH A;  5KMG A;  4DV1 H;  5D1O A;  4DV1 B;  3GDE A;  1A0I A;  5DIS C;  3BA9 A;  5CB4 A;  5FNV A;  3L4K A;  4RB2 C;  4L8J A;  3JSN A;  4TV8 A;  4EQ5 A;  3M7M X;  1XNR B;  5JJE B;  3RYI B;  1XMQ H;  2YI9 A;  2PZS A;  1HR0 H;  1TUB B;  4FLW A;  1HR0 B;  3BHP A;  1TAE A;  3NBZ B;  3DSQ A;  3N43 B;  4ZOL A;  3UQ8 A;  3HKC A;  4RZQ A;  5CA0 A;  1X4T A;  5JVD B;  4DRX A;  4K0K B;  4K0K H;  2GV9 A;  3FFQ A;  4GLX A;  2KKW A;  4FM9 A;  3JAS A;  5IJ0 A;  2HVQ A;  4WBN A;  1ZHS A;  1X9N A;  4MV7 A;  4TQD A;  4ZI7 B;  3N2G A;  5J2U B;  1N33 B;  3H20 A;  4LF9 H;  3JAT A;  4LF9 B;  5EYP A;  4YJ2 A;  4A2A A;  4CH5 A;  4IHJ B;  4I55 A;  2HGS A;  4JI8 H;  4JI8 B;  3E22 B;  2IM9 A;  4O4H A;  4O4I A;  4IAJ A;  2VWK A;  3VQW A;  5BMV B;  2ZNI A;  3RYC B;  2PYJ A;  2F4V B;  4DUY H;  2F4V H;  4GYC B;  3KYH C;  4LF6 H;  4LF6 B;  4DV7 H;  3GB8 B;  4DV7 B;  4YY3 H;  4YY3 B;  2V4D A;  1Z2P X;  4TV9 A;  4B3M B;  1P8L A;  1BGW A;  1E4F T;  2HHH H;  2HHH B;  4B3M H;  5IWA B;  4RAZ A;  4X1Y A;  4DR6 H;  3K5M A;  4DR6 B;  1VS0 A;  3JAK B;  4A2B A;  4JI7 B;  4JI7 H;  2CW8 A;  4TUY A;  4EEQ A;  3RGZ A;  2ZNJ A;  3ZED A;  4I7H A;  2VQE H;  4NXN H;  2VQE B;  4NXN B;  4LF8 H;  4LF8 B;  4GKJ H;  4GKJ B;  2UUA H;  4TOI A;  2R72 A;  4DR5 H;  4HBN A;  4DR5 B;  3RYI A;  3T1H H;  4B3S H;  3T1H B;  5KHI A;  1TUB A;  1GYF A;  1DGS A;  4E6N A;  5KX5 B;  2FE3 A;  4JI3 H;  4JI3 B;  3RYH B;  3LML A;  2HEP A;  4ZHQ B;  1XMO H;  1XMO B;  5JVD A;  2UXC H;  2UXC B;  4OX9 H;  4OX9 B;  1P49 A;  2YCH A;  4DR2 H;  3IG0 A;  4DR2 B;  4U3J A;  4ZI7 A;  2BTQ B;  5J2U A;  2E3C A;  4CS2 A;  3W1G A;  4FLV A;  4LR3 A;  5FPO A;  2W57 A;  3E22 A;  5K1X A;  4LNU A;  1XNQ H;  1B04 A;  1WNS A;  3HKD B;  4X1I B;  2BTO A;  1XNQ B;  1KMI Z;  1IBK H;  1IBK B;  3RYC A;  4GKK H;  4UCV A;  4GKK B;  1TVK B;  1P16 A;  2PYL A;  5LP6 A;  2UXB H;  2UXB B;  1M0W A;  3B2E E;  1H2S B;  4FM0 A;  1XHZ A;  2F95 B;  2WE6 A;  2CFM A;  2KSW A;  5A2Q W;  2XIG A;  5IJ9 B;  2P5O A;  1QHT A;  5JCO A;  3U10 A;  1AN7 A;  4O4L B;  1SA0 B;  2ZIM A;  3MWM A;  3QF7 A;  3GJX B;  3SJA C;  4PZ7 A;  5D5P A;  1FVI A;  3RGX A;  1O9G A;  4LF7 H;  4LF7 B;  2R70 A;  5C8Y A;  5EOY A;  2JGU A;  3N42 B;  5KX5 A;  3C0F B;  3BRC A;  2UUB H;  2UUB B;  1Z2O X;  1SYX B;  3CHX A;  4CC6 A;  1L2Z A;  4LFC H;  4LFC B;  4O2B B;  1M4U A;  3JSL A;  1TGO A;  2QJ1 A;  3OTO B;  3OTO H;  4LFA H;  1XMQ B;  4LFA B;  3BPZ A;  5EZY A;  4DK0 A;  5KHJ A;  4DK1 A;  2CAZ C;  2OYQ A;  1D5A A;  4YHH H;  5CA1 B;  3CB2 A;  3T1Y H;  4UCS A;  1YEW A;  2BTQ A;  3T1Y B;  5LA6 A;  4X62 H;  5FD6 A;  3K5O A;  1N32 H;  4LF4 H;  4LF4 B;  1XHX A;  1RSO A;  5LOV B;  1N36 H;  3M4I A;  4DR7 H;  4DR7 B;  1Z5V A;  4X1K B;  5LP6 C;  4FFB B;  5JJN B;  3IAY A;  1E4G T;  4PI2 A;  1BJT A;  2F93 B;  4CH6 A;  3RYF A;  2Q0A A;  5IYZ A;  5LXT A;  2ZCE A;  3K59 A;  4JV5 H;  4JV5 B;  4ETS A;  4JI0 H;  3K58 A;  2UXD H;  2UXD B;  1WPB A;  1T5E A;  4KHP H;  2RQ6 A;  4KHP B;  4LH6 A;  3JAR A;  4AHC A;  4DR4 H;  1I94 H;  4X20 B;  4DUY B;  1I94 B;  4DR4 B;  1I6U A;  5GON A;  5IJ9 A;  5FD5 A;  4DV2 H;  4RB1 A;  1WN7 A;  4DV2 B;  1CKM A;  2YIB A;  1SA0 A;  4FLZ A;  2PY5 A;  3TY8 A;  4RB0 A;  4AQY H;  1CKO A;  4AQY B;  1FFX B;  1IBM H;  4BW9 A;  3WB2 A;  3W5O A;  1Q5O A;  1O75 A;  5BR8 B;  5BR8 H;  1Z5W A;  2HIX A;  4O4J B;  4DV3 H;  1FJG H;  4DV3 B;  4TQF A;  1Z2N X;  2XHB A;  3PN1 A;  3N40 P;  3QWU A;  3N44 B;  4RAY A;  1JFF B;  2UUA B;  5EIB D;  4O2B A;  4LF5 H;  4LF5 B;  3BAA A;  1XDN A;  4B3S B;  4ZIB A;  4LMY A;  1V9P A;  4I50 B;  5CA1 A;  4IIJ B;  3TY9 A;  3QTC A;  1SQF A;  3K3V A;  3NC0 B;  2VPS A;  1Q8I A;  5KHG A;  5J2T B;  3EYY A;  2ZIN A;  5LOV A;  4PZ8 A;  2MCT A;  2JVD A;  3JAL B;  3SJB C;  4X1K A;  4O2A B;  1IBL H;  1IBL B;  4Q0Y A;  5KMG B;  3N6X A;  1M5I A;  1J5E H;  1J5E B;  3VNN A;  4CH3 A;  1S5J A;  5LL6 b;  3A2F A;  2RGR A;  4IHJ A;  1FKA H;  1MZB A;  1KU9 A;  5FNV B;  4DV5 H;  4DV5 B;  4AIL C;  1G6U A;  4I4T B;  4TV8 B;  5BMV A;  3RWR D;  3HKB B;  4X66 H;  4X66 B;  1HNW H;  1HNW B;  3ZS8 C;  4MTE A;  4DR3 H;  1JMK C;  3FMA A;  3WB1 A;  2QM4 A;  3U11 A;  3N41 B;  1N34 H;  1N34 B;  3JAW B;  3JAM W;  3JAK A;  3F8N A;  4O4J A;  4HNA B;  2JS5 A;  3RIZ A;  3BAB A;  4CH4 A;  1Q43 A;  4JI6 H;  1O9H A;  4JI6 B;  4FLU A;  4WBN B;  3SGI A;  2EX3 A;  2YIB D;  3LNN A;  4NXM H;  5EYP B;  4NXM B;  2E5L B;  3RTX A;  2HVR A;  2E5L H;  4RB3 C;  5FLX W;  4I55 B;  1S68 A;  3RR5 A;  4B3R H;  2Q7E A;  2PUS A;  4B3R B;  5D5Q A;  1SQG A;  4I50 A;  1JJO A;  4O4H B;  2UU9 H;  2UU9 B;  3RYH A;  1QQC A;  1HNX H;  3MAQ A;  4ZHQ A;  3HXL A;  4B3T H;  4B3T B;  2VWJ A;  5ITZ B;  3JAL A;  4YHH B;  2YIA A;  4DUZ H;  4DUZ B;  2Q2T A;  4UCU A;  3NBY B;  3TY5 A;  3UT5 B;  4X62 B;  2P22 C;  4PI0 A;  4MV9 A;  5JH7 B;  4Q6G A;  1N32 B;  1VF7 A;  4TUY B;  1WH2 A;  1N36 B;  5IT9 W;  1M0T A;  4FM1 A;  2YI8 A;  3HKD A;  4X1I A;  4I4T A;  2VUG A;  4X65 H;  4X65 B;  1S03 G;  4BWA A;  1XNR H;  4K8X A;  5LYJ B;  3HKB A;  2VQF H;  3KXY T;  4LH7 A;  2VQF B;  1TVK A;  4LSX A;  4DV0 H;  4DV0 B;  3RF2 A;  3N2K B;  1HW7 A;  4JI0 B;  5KHK A;  5JCO C;  1I7F A;  3RFR A;  3RJ0 A;  3CSX A;  4FLX A;  1L8D A;  3JAW A;  2Q7H A;  2Q7G A;  5EIB C;  4HNA A;  1TA8 A;  2R9A A;  4O4L A;  2F66 C;  4CS3 A;  2HIV A;  4U3J B;  1IBM B;  1N33 H;  3ETQ A;  4YJ3 B;  3VQX A;  4FM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...