5FPOA

Structure of bacterial dna ligase with small-molecule ligand 1h- indazol-7-amine (at4213) in an alternate binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
307
structure length
305
Chain Sequence
b'DLSSRVNELHDLLNQYSYEYYVENPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 100
structure length 305
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fpoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fpoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fpoA02
4YHHB 4LF7B 1HNXB 1CKMA 4EFBA 4JI8B 1X9NA 2VQEB 3NBZB 4DRFA 4DR7B 4JV5B 4LF4B 1FJGB 2UU9B 5FPRA 3PN1A 2E5LB 2OWOA 4LH6A 4X64B 4PZ6A 4UCTA 3JSNA 4EFEA 4DR4B 3TY9A 4DV3B 4DUYB 4JI3B 4NXNB 1CKNB 1J5EB 4LFAB 4DR2B 2HVSA 1HNWB 4JYAB 3BAAA 3GJXB 3RTXA 2HVQA 4LFCB 4PZ8A 4DV1B 1IBMB 1N33B 4JI6B 3TY8A 1XNQB 5D1OB 4DV4B 1ZAUA 1TA8A 1IBLB 4B3MB 1A0IA 4X65B 4K0KB 3S24A 4TOIA 4UCRA 1XNRB 5IWAB 4X62B 4UCSA 2UXDB 3GDEA 3TY5A 4B3SB 5D1OA 3BABA 3W5OA 1N34B 4GKJB 5LMUB 4DV7B 3T1YB 3NC0B 4LF5B 3KYHC 4B3RB 4PZ7A 4YY3B 3QWUA 4DR1B 1B04A 5BR8B 2UUBB 4B3TB 1XDNA 1DGSA 4DV6B 1P8LA 1P16A 4NXMB 1CKNA 4LF6B 1HNZB 1N36B 1CKOA 4UCOA 4DR3B 3VNNA 2Q2UA 1XMOB 4JI1B 5DISC 2CFMA 2HIXA 2HIVA 4UCUA 2UXBB 4DV2B 4KHPB 3SGIA 4X66B 4AQYB 3GB8B 2UUAB 4JI4B 3RR5A 5LMNB 4GKKB 1XK5A 1IBKB 3OTOB 3BA8A 4LFBB 3L2PA 4LF8B 3W1GA 2UXCB 2F4VB 4JI7B 4LH7A 1VS0A 2HVRA 5D1PA 1XMQB 1HR0B 2VQFB 4GLXA 4DUZB 1TAEA 3BA9A 4E6NA 4CC5A 4JI0B 5FPOA 4EQ5A 1I94B 4DV0B 3UQ8A 2ZM6B 4LF9B 4UFZA 4JI5B 4DV5B 1N32B 4JI2B 4EEQA 2HHHB 4OX9B 4UCVA 2UUCB 3JSLA 4DR5B 1V9PA 1S68A 2Q2TA 3T1HB 4DR6B 4CC6A 1FVIA 3W1BA 2VUGA 3NBYB
chains in the Genus database with same CATH superfamily
4YHHB 1IOWA 3RAQA 3N8DA 1ZQ7A 1YJNV 3OD4A 3T9AA 1OWTA 1RJQA 4H37A 3K5OA 1NTMH 2OCHA 3FYIB 2UUBO 4DRFA 2RCVA 3CJHB 2QJ1A 4LFCO 3RGZA 4O4IF 2ZDHA 4DV3H 3K5LA 5J2TB 1BHBA 1E4EB 2W6ZA 3T9DA 1RJPA 3A0HZ 2W6PA 5L3GA 3SI8A 2WLIA 5KMGB 3LSQA 1S3JA 3WWJA 1CE8A 5I5XA 1IYEA 2Y0PA 3ORQA 4P2ZA 3DXRA 2YXLA 1RSOA 3CMEV 4DV2O 1N34O 1VQ4V 4DL3A 5CR5A 3BQ0A 4JI4O 2HFEC 4IR9A 3U0GA 3BHPA 1Y76A 3K59A 5DGIA 4DV1B 4PHZA 4J9KA 3ZHSA 4O4JB 3TY8A 2JA5G 1SZXA 1MSDA 4H13B 2ASLA 4WBNB 5KUMA 5FLMG 2A06H 5FLXN 5C8YA 4TQDA 4MVMA 4LF6O 1I94O 2WWWA 3MHSC 3APQA 4K8ZA 4BIOA 3V6KA 5KA6A 2D3OW 3B77A 3L4KA 2OCCC 4I4TF 2PI4A 4AYBA 1NH2B 4TT3G 3G6BA 3RYIA 3WWHA 2QK4A 1VMGA 1SKVA 4TQSA 4O2BB 4NTYA 1B6SA 2GUZA 5KMGA 4YHHO 1FS0G 1SETA 4ED0A 1AP6A 5LA6B 2R87A 3OUZA 1TWHA 3FMAA 5JJNB 2UXXA 3HT5A 1O75A 1HR0O 2GTAA 3Q2OA 4YP3A 4XDJA 2UVVA 2CFMA 2J9GA 4MV4A 3U54A 1JX4A 1US6A 2Q9LA 3K5NA 3GIDA 1V55B 3OTOH 1KB9F 5KA5A 3AX6A 4RB3C 4FGRA 2UXCH 4O7VA 3N42B 3S3XA 4LF8B 1JDEA 5K3WA 5BWRA 4EG0A 4F6RB 2WA4A 3RV3A 4O7SA 4E6NA 2VPQA 5KG1A 4DV5H 2YU9A 2JA8G 3G6YA 4O7TA 5LOVB 1O9HA 1YJ9V 3QFFA 2FMLA 4N21A 3MDSA 4Q8FA 1I0HA 2EIKC 5B1NA 4OX9B 1HNWH 4PI0A 5LA6A 2Q2TA 4TQFA 4MV1A 1R3LC 4Q6GA 5CA1A 3NBYB 1B6RA 4EYHB 1Q3EA 4BAYA 4JI8B 5KT7A 3AK3A 1BNCA 2WLHA 3E8HA 3RBZA 2DLNA 2R86A 3GV5B 2XD4A 5IYBG 4FBUA 2DAAA 4EFEA 1KECA 2J6UA 4X89A 3HOVG 4R8UB 2YXYA 2Q69A 2RN9A 2QGNA 1RJRA 4DR2H 4IZOA 4F6RA 2HVKC 4UUGA 3SYPA 3LWBA 2YXHA 2VA2A 3MR3A 3J7AU 5FD5A 3JRWA 3H4DA 2BQRA 3MHHC 1HNWB 3GTPA 2BQUA 1MZEA 1ZHSA 1N0JA 3LDDA 1K5SA 2BTQB 1UJWB 3KKYA 3AW8A 2IU0A 5I5VA 1R6NA 1ZAUA 4LBEC 4X65B 5L3DA 3TCUA 4AI8A 4IRDA 3CEIA 4LSAA 2QKSA 1GM9A 2O57A 5E79Z 2VS0A 1PKXA 3G71V 5LP6A 2JDIG 2R7ZA 1CS0A 2LFSA 2FB9A 1E4FT 4OX9O 3T1YB 1YIJV 4CMFA 1N8RW 4O7ZA 3MFHA 2PTMA 4JTDB 3T2MA 5L1JA 1S97A 4O4JF 1H2LA 4B3TB 3M9NB 4BWSC 3JARA 1GN4A 4EKWA 2UXCO 5IYCG 2XGQA 2DYRC 2HGSA 3EPGA 2ZE7A 1M57C 1W2BU 5GTHZ 5KG6A 1YI2V 1S0VA 2JGDB 2JA7G 3X2QB 2Q67A 3GIPA 4NZMA 4IT5A 1SERA 2B1GA 4MVRA 2UXBB 1SQFA 3ZEDA 3BJYA 1GN3A 3OW2U 2JGUA 1JOYA 1N56A 2Y0IA 4CKCA 5EDWA 4AQYB 2NU8B 4MTFA 1NBMG 2N05A 4AILC 3AK2A 2Q0AA 2YIAA 1HNWO 5K1PA 1VS0A 4JI0H 4O7WA 5D1PA 3LQSA 3WG7B 1VAJA 2WLNA 1AILA 1SQXH 3K9AA 3BA9A 1RM1C 2Q68A 4JI2H 5DQHA 2EINB 2YZLA 4ED7A 4X65O 2UUCH 3HKEA 4DR5H 4UFZA 5LHHA 1XBLA 2WSSG 5BMVB 2EJ0A 4YJ2F 5LYJB 2W9BA 2W8KA 1WR2A 2I80A 4DK0A 1QVGU 5GONF 1TGOA 2YYAA 1RYSA 5KHKA 3BQ1A 3AG7A 1HNXH 1SESA 2JGDA 2BQ3A 4IIJF 4DR2O 2P0AA 1ZUQA 3K04A 5JQGA 5F9NA 4O84A 3NBZB 4B3TO 3G8CA 3OUFA 3PW4A 5JUMA 3HB3B 4X64B 2CUGA 2EULA 4ME6A 3ZRWB 1DV2A 4C2MA 4NR1A 1SQGA 3LDCA 4LFAH 2UVUA 4JI3B 3TIGA 3G6EV 3DC5A 1X59A 4IYIA 2UXBO 1R6TA 4UVAA 4U3FH 4O3RA 3SYQA 1YSCA 3JATB 5KS8A 4GX5A 3QZ7A 2EILB 1I6UA 2OIGA 5KUKA 2Y48A 3G67A 1XQ8A 2ILMA 1BL8A 1A9XA 4KUMA 4TOIA 1XNRB 2DYSB 2Q7DA 3K3WA 1E4GT 4O7NA 4QJFB 4GKJH 5LMUH 3J80W 1N0NA 1K92A 3PR5B 5KG3A 2HDKA 3NUAA 2PMZA 3BRCA 4PDLA 2FKLA 2ASDA 1KQSU 2ABJA 4XDKA 5IJ9A 3JCUZ 5E1AC 1VQKV 4B3RB 4PZ7A 4OGQB 3QWUA 3ZIAG 1OCRC 4HYOA 4J7ZA 4XDLA 5EYPA 4ZQIA 1DGSA 2PI5A 3J81W 1G4YB 4K6NA 1P16A 2WYOA 4JI1H 3BVOA 3MAQA 5L1IA 3L9DA 4XYMB 4ZOLF 5B1AB 2ZDIA 1DK1A 4JI0O 1KTAA 3C90A 1V4YA 4J9PA 4X66H 4BY1G 2UUAH 5FNVA 2EIYA 4JI2O 2VWJA 4MS2A 2UUCO 3ZS8C 4DR5O 1QVFU 1LR1A 4DLKA 3OFNG 4FLTA 1MABG 2HVRA 3V6HA 4A3KG 1S0MA 1CQIB 4JV2A 5B3SB 3ZMUA 2RDJA 2AHYA 3K0DA 5BXZA 2ITDC 1I2KA 3JD1A 1XNRO 2QB5A 2CH7A 2WB1E 3R65A 1Y66A 2RMKB 5LL6Y 1AP5A 1ZL8B 3ICXA 2GQRA 2XIGA 4I9WA 5CB4A 2GV9A 2JVDA 5KFNA 1R73A 3JD3A 1JX9A 3RAXA 4A3GG 5BY1A 4FFRA 4A2BA 3K5MA 2KB1A 3W1BA 1S10A 2VQEH 2VQDA 4JV5H 3TINA 3QG5A 2VPSA 4XZ3B 4NTXA 1I50A 2FTKA 3UO2A 4DR4H 1TVKB 4JUZA 5DLGA 2VA3A 2FPGB 3PR4A 4LH6A 5DG9A 4X8AA 5LYJF 2LW7A 4PD4F 4BW9A 3B4SA 2Z04A 3GTGA 3JD4A 3FYEB 4NXNB 4JYAH 1Q6HA 1X4TA 1ENVA 4IL6Z 1W0JG 3UFXB 2XAFA 3JAMN 2NUAB 3E22B 5H6RA 2UVRA 2R8KA 3QTCA 2GPWA 5LXTF 1XNQB 5IWAH 3ETEA 4H0LB 3ABMB 2LO1A 2IP4A 3GIMA 3KHHA 3ZHUA 1D2DA 3LDEA 2HKOA 4UB6Z 2FK2A 4B3SH 4MTEA 3E8FA 1P7GA 2Q8VA 3AG4C 1H38A 5HNEA 4MVOA 4GC6A 4EBEA 3VBBA 2W6JG 1WH2A 5IYZF 4LSXA 4ZHQF 2YS8A 3OUUA 4U7CA 3VQXA 5EWGA 4MTXA 4LF5H 5KHHA 1R1BA 2RDCA 3NC0B 4WCEV 3E83A 4G27B 4RNMA 5D5PA 4X66O 2UUAO 4RB0A 2XOKG 3W7SA 4DR1B 2GLTA 4MTGA 1L0LH 1M56B 1KUQA 2F66C 3VQYA 1VQ9V 3MJFA 5DGBA 4HN2A 3CE2A 4XYLB 3CRRA 2W70A 1D5AA 2F1MA 4JF3A 1TWFA 2HP8A 4I50A 3IAYA 2EZPA 4U3JA 2HG8A 1LUVA 4B08A 5IDJA 2DE0X 4NXNO 1KBLA 1XOUA 4FU0A 5KG4A 3KHGA 3CP1A 4J9SA 2XCLA 5LL6b 1GM8A 2QR4A 2CE4A 2LFRA 3AG3C 1BSMA 3CRCA 3RYHB 4QIWE 1W59A 5C1PA 3W7UA 2EIJB 3K03A 2V7QG 4WFBV 4D7SA 4LF9H 1XNQO 2ALZA 1GO3E 3SE7A 4JV5O 4LCUC 3A0RA 1MNGA 3UM7A 2Y4RA 2HHHB 4DR6H 1UPGA 1QU7A 3N2GB 2DIKA 5FLXW 1VF6C 5L9XA 1AI5A 2EBOA 1GM7A 4J9MA 4RUCA 4X88A 1K83A 4YBZB 5T14A 4DR1O 3T4ZA 3HKZE 1AR5A 2E5LH 4FJCC 5IP9G 4DR7B 1OCCB 1DF5A 3CMAV 3MWDA 3ZN0A 1FXKC 4DUYH 4OPHA 4K3AA 5B1BB 4JZGA 3PW2A 3FB5C 2QWQB 3IJ4A 2JEJA 1Q6IA 5IY5B 3J81N 3VPCA 4FFMA 1IBMH 1JXLA 2HVQA 4RUEA 2QE7G 5IP7G 4YJ3A 4LF5O 2C2EA 2CTQA 4FFLA 3QZ8A 3N2GA 1SYXB 2ZT9B 3N2KA 1QLEC 3SJAC 3KHLA 1FKAH 3OM3B 3ETHA 2P4KA 3QF7A 4MW3A 1EKFA 4O86A 4LWSB 3FB8C 2BOBC 4DAAA 3FX7A 2X0SA 1M93A 1NZ6A 1VF5B 5JJJB 2HHHO 3OMNB 2Y4TA 1WN7A 1XI1A 1NQTA 2UUBH 3EPIA 3JZ6A 2YC0A 1GTOA 3I5DA 1Z2PX 3ZRXA 1RP3B 3HKBA 2G38A 1KP3A 3WB2A 4UVBA 1K34A 4NXMB 3GQCA 4Q4CA 1R3IC 1N36B 1CKOA 1R9TA 4DR7O 3T9CA 2IU3A 2QTOA 2X6AA 3ASNB 1YEWA 3JAKB 3VOTA 3HBLA 2W6NA 4DV2H 2UVWA 2HIXA 3T1CA 1I7NA 4JI4H 4LF9O 1V54C 1AROP 2KKWA 1IBKH 3RF2A 2H94A 4KHPB 4O4IA 3R5HA 2W9CB 5D5QA 1MG1A 3WG7C 4MT8A 2X0LA 4ASUG 4AYBE 4HQ6A 2R70A 2RF4A 4LFBB 4JI7B 4YAKB 1ULZA 1I94H 3AG2B 4TV8F 5I5YA 5EWEA 3TQ1A 2Q0OC 1WB7A 2WPDG 2XASA 5CA0B 1PL4A 2ZM6B 4ZI7F 2E5LO 1F51A 3ABTA 4O3PA 1NTKH 2NNUA 1S5JA 3JSLA 4DW0A 3H20A 5C4XG 2HJDA 4YHHH 5KFIA 3CRAA 4GUNA 2JEFA 4QWCA 2GQSA 2OIEA 3OHAA 1ZX3A 2WLIB 1X9NA 1MA1A 1FXHA 2EJRA 5E25A 2FLLA 1FJGB 2C28A 3ABUA 3RFRA 3ABKC 4ETSA 2W9CA 2R85A 4YB8B 5IYDG 3DXRB 1RSOB 1N36O 2A9HA 2R84A 3H1IH 4CH4A 4UB8Z 2FPIB 1QR8A 1Y76B 2IBZH 4OXSA 2XCPA 4FS1A 4UXNA 4PV1B 1T36A 4F4YA 4IYHA 4MV3A 1F4MA 3M7MX 1PD3A 4TUYA 2Q7HA 1VQPV 2NU6B 4KHPO 5L3EA 5LBQA 3Q8PB 3KAJA 4DV1H 3BAAA 5CA0A 1HW7A 4RUFA 1YCIA 5C44G 4MW8A 3RGXA 5C93A 2XAGA 1K33A 4LFBO 3OHBA 2A3QA 5JH7A 1TA8A 2ZNIA 3SYCA 1A0IA 4NZNA 3RYIB 1WP8A 4B7EA 2C35B 2HVJC 5A2QW 2GUZB 2CW7A 2R72A 3VA7A 2HJWA 2QM7A 4IR1A 2GTSA 4ECUA 4RQEA 3JYCA 2I8CA 5KFFA 4XBFA 3TEKA 3B8NA 2NR5A 4ECZA 2BTOA 5B1AC 5ITZB 1IBKO 1IYDA 2RJZA 5KHGA 1F23A 4DV6B 2EJ3A 5DG7A 3SPGA 2CW8A 4EGQA 4Q8EA 1WJZA 4UCOA 4MTDA 4DR3B 1FJGO 3SJCC 5BYBA 2EJ7A 1ET0A 5FR9A 4J42A 3DTFA 1GO3F 3QNEA 2V5AA 3JRXA 2K1EA 4U7OA 1VQOV 1Q86W 4LF8H 5B3SC 4GKKB 1AJNA 3R23A 1EBOA 3ZHRA 4FLYA 2BOCC 1MMMA 2M6YA 4QPJA 1XREA 4CMDA 3P3PA 4E2LA 3LP8A 2R8IA 2CGNA 1XHZA 1TAEA 5BZBA 1VQ5V 4OX9H 4ECXA 2P90A 5CA1B 3J7AK 2OTJV 2DPIA 2VRZA 5H2FZ 5ITZA 3F5WC 5IYDO 1Q6UA 4UCVA 3L4JA 2QWPB 1JVMA 2P6JA 5JVDF 1QQCA 4RU9A 4JI8H 2JEGA 4DIMA 2R7ZG 2XUMA 2YICA 2AGPA 2R92A 1CKMA 2AGOA 2AW9A 3HPLC 1Q7YW 1M5IA 1VQ6V 1WAZA 4TV9B 5KX5F 4DV1O 4N23A 3ETQA 4DV6O 2HHFB 5KFGA 3ZMTA 3H1KH 1O9GA 1IOVA 1FFXB 5KFOA 1K5QA 3CC4V 1S5HC 2QKAA 4DR3O 4G28B 3N6RA 2HGWA 1KEEA 4QNHB 1EFRG 2HG5C 1I08A 5LGNA 2AZ2A 2Y69C 3KG2A 4HNAB 5KFBA 3WO1A 4O83A 4X1IB 4A3IG 3GJXB 4GKKO 3RTXA 1OCOC 3TIIA 4X65H 5LP6B 5CAEB 4DW1A 4MTOA 3U0ZA 4DV4B 4F50A 1BXRA 4F4ZA 1UC9A 2IMWP 3GIJA 2E2HA 3U9SA 2R6FA 1RK5A 2DWCA 4A3JG 4Z1VA 3T1YH 4YR2A 1N4CA 1KKDA 3VPDA 4IRCA 3PZPA 3JARB 4TV9A 2FB5A 4KL1A 1BQZA 5DM6V 2HHFA 5C8YF 1KC7A 1XDCA 5H9CA 4B3TH 1FFXA 3MWEA 3BEHA 3AG1C 3HOZG 2FLNA 3CVZA 4X1KA 2OTLV 2R7LA 3AYHB 1PNKA 4HNAA 4LF8O 2AZ0A 1BCCH 2CKZB 3G6VA 1EZVH 4X1IA 2R9AA 2V9WA 3HOWG 5J2TF 3VNNA 2LP7A 1BQ0A 3BFRA 3RBEA 4IIJA 1K73W 2UXBH 2DJVA 2I87A 5DISC 1Y1WG 5EIBD 3TXQA 4AQYH 4FLUA 4EBDA 3PW5A 2XTAA 3MR6A 2ZXWC 3CX5F 4O4LA 2PMZE 3CCRV 1M0TA 4PWQA 2BR0A 3OAAG 4GC7A 1G2WA 2DWEC 3ZHQA 3HKEB 3L2PA 1EM1A 2D2CB 5EZYA 2W9BB 1TUBA 4WBNF 3BPZA 1SS3A 4DUZB 4JI8O 1NTZH 4CC5A 4DV4O 3JAMW 3S3WA 2BCCH 4JYYA 1KT8A 5KFLA 5EC2C 1AI6A 1I5YA 4HBNA 4EYIB 1A32A 5JQGB 3T5HA 1V9PA 2F93B 1NR1A 4YIOA 1SA0A 2JA6A 4JTCB 2P06A 2F23A 4MVSA 4TQRA 1WPBA 1OCCC 2RDIA 4J10A 4GCZA 4U7NA 1SRYA 1RPOA 4O2BF 4LF7B 5C1OA 4IWXA 5CBGA 3F7VC 1JLLB 1VF7A 1FXKA 2HR3A 5LA6F 5A2QN 4X64H 2C2DA 2NU9B 4IHJB 4DL6A 4FFPA 5CA1F 4RNNA 2RNBA 4JYBA 2DMXA 5CBFA 4PZ6A 1M6VA 5LHIA 4JI3H 4PBCA 1V51A 1JQ0A 1M9NA 4GZRB 3BACA 4Q44A 5IYBO 5I47A 2JIZG 5JCOA 2CAZC 4D7TA 4ZOLA 4O3QA 3T1YO 4JV0A 5CBHA 1B6QA 5A9GA 5KFXA 4ECWA 3WB1A 5FD6A 4ED6A 1COWG 4FMTA 3VOUA 4UV8A 1XNRH 2EZOA 1Y1WA 1JR9A 3UO3A 2UXNA 4DK1A 1IBLB 3OR6C 4OPAA 4O2AA 5LOVF 5IJ9B 5B66Z 4K35A 2QWNB 4UCRA 4DUZO 5KFMA 4NVPA 3TW6A 5L3BA 2Z5UA 1PPJH 3LUTB 5D1OA 3ABLB 2ZGIA 5EYPB 4B3RH 4J7JA 4IWYA 3RUPA 4IHJA 4KFMA 3HXLA 1EKPA 1VBGA 3JALA 2XT9A 3L72H 4AQYO 4YY3B 5J2UA 3KXYT 4APMA 4NTWA 1K97A 2E3CA 5B5EZ 1K7DA 3D36A 2E75B 4RAIA 1K1SA 5KT6A 2J6SA 3RB0A 3CEBA 5CA3A 5FNVB 5CM0A 1T3NA 1ORQC 4GT1A 2R7MA 2DQ0A 4YAJB 2EIMB 4EGJA 5IYCO 5DN6G 1R3KC 1XILA 4J80A 3QVNA 4NB5A 5KAFZ 4X20B 4E4EA 1Z2GA 4X1YA 3SYAA 2YIBA 2ADPA 2WAQA 2MK3A 3FAVA 3JASA 5C5JA 1XEQA 3BA8A 5BWWA 1L0NH 1H8EG 3RT3C 2CH7B 2ZE8A 4PDMA 4F4XA 1CEZA 1DV1A 1P4RA 1XMQB 1E1QG 2VQFB 1KP2A 5CB4B 1JIHA 3OEEG 5FPOA 1ZTEA 4I55A 4EQ5A 3E86A 3TW7A 4A93G 4JI5B 5BPFA 2R93G 4X64O 4DL2A 2W8LA 1IZ3A 1BZKA 4JV1A 1I1MA 1IX9A 4DL7A 2XC9A 4TSFG 1S76D 4Q20A 3BCCH 3T1HB 2ASJA 2GDSA 2Q7GA 3HR0A 4J9ZB 4JI3O 2W57A 3DGEA 3IG0A 4R8CA 4PDVA 3ZJZA 2GBOA 1I1LA 2OT5A 1NI8A 1VARA 4PJ0Z 3R66A 4ZHQA 4X20A 1TWAA 3DF7A 3GIQA 1U97A 4FLWA 2P4VA 3STZC 4C5BA 2QYZA 3RGBA 2ARHA 2M7WA 1EHIA 5KFJA 1RYRA 3SPCA 3ZHTA 4NXNH 5JQGF 1SF9A 2V1DA 4O3SA 1MZBA 3NXSA 2AU0A 1CKNB 1J5EB 3QO5A 2ZINA 5TISZ 4PDBA 4HNUA 1M4UA 1RK6A 1XNQH 1K4DC 2OCCB 4Z1MG 1Q81W 4RUAA 1K4CC 4B3RO 2DZDA 1Y4MA 3QQMA 2C22A 4DQNA 2IA6A 2B63G 3H0GA 3TQTA 2CGOA 2VQFO 4K0KB 1WRVA 4X9QA 2V59A 1OHHG 4ZBMA 4X62B 1JA8A 5BMVF 3EVKA 5FJ8G 1Z2OX 2DWDC 3V4ZA 2IH1C 1G1XB 2RQ6A 3D3IA 4DR1H 3RFCA 1ZLZA 1B3QA 2OH2A 3U55A 4I50B 2O03A 2QDOA 2R93A 1U96A 4MVQA 1PX2A 4U3JB 3OTFA 4DXWA 1Q8IA 1HNZB 1NKDA 1CKNA 3ETJA 3WNZA 3LNMB 1TWGA 1XMOB 4CKBA 4Q4DA 3CSXA 2ADQB 3CB2A 4RQFA 2HIVA 4O4HA 1KJ8A 1E1RG 1I7FA 3ZX6A 3M9OB 2EIKB 2Q73A 4LC1A 3UZBA 1DTOA 1ZSPA 3AEIA 1WNSA 4RB2C 4GLWA 5KAIZ 3CCLV 4DRXA 2RGVA 3ETGA 2X6CA 1F7YA 1WSCA 3CCVV 5BWUA 1AVMA 5B1OA 4ABMA 2HHHH 1V55C 1H2KA 2GHYA 1N32B 2ZDQA 4JAAA 3T54A 4YQWA 1DLBA 2A0LA 4I9QA 1NR7A 4WHXA 4GX1A 1G8MA 4FK5C 4CH5A 2B63A 5I5WA 4CBCA 2Z0AA 2YS6A 4DR7H 2IJIA 5KFRA 1S0OA 5CB4F 2JEIA 3T7AA 1I1KA 1W93A 4LF4B 4GX2A 4QWDA 3W7WA 3PN1A 2AQ4A 4UUJC 3HOYG 2ITCC 1S03G 1XMOO 5KFQA 1KYOF 3GTQA 4YJ3B 4FLVA 4M0JA 4IAJA 1Y14B 3TK1A 3MFIA 1KJ9A 4EB6A 3OGIB 2PGGA 3P30A 3OSNA 2WAMA 3N2KB 2CTWA 3GVMA 4QWAA 4J9OA 2RGRA 5I5SA 4CH6A 4L87A 4FM9A 1SQBH 3HKCA 2KG7A 1N33B 4JYCA 5F2VO 4B3MB 4J9YB 3V4SA 5D8DA 2YSUB 4H44B 3MD0A 1VEWA 4PA3A 2DYRB 3GTLA 3W7XA 3K06A 3HKBB 1N32O 3VMMA 3JD2A 3CCSV 1KMIZ 1Q5OA 4DV7B 1HDJA 4K8XA 2W9AA 2X7RB 1VIBA 3Q8QB 2GSMB 2ZDGA 3RW0A 4ZI7A 2W0FC 3SJQC 1S72V 4NXMH 3OUSA 2JS3A 1N36H 1FYJA 3VQWA 4DYLA 4WFEA 4O4IB 1B06A 4G3IA 5KFHA 3HKDA 2YIBD 4ZKIA 3GIIA 4I0XA 1KJJA 4I7HA 4KHPH 3P3NA 5CMUA 2YL2A 1NVPD 3STLC 4A3CG 2XHBA 1KKCA 5IT9W 4LFBH 3C3TA 1AR1B 4JI7H 2COGA 1D5NA 3CS5A 3ORRA 2QM8A 2LW1A 4PA6A 4I50F 1NS1A 1PP9H 2B5UA 3X2QC 2ZE5A 3I55V 4C5AA 1I7LA 5KFCA 3CRMA 3IC7A 4FVMA 3UYYA 1A0GA 4LMYA 2W0XA 5DEDA 4GLXA 1N33O 2ZM6H 3GTMA 4JXUA 4CKEA 4B3MO 4D6TH 2NVYA 1H2MA 4CE5A 1TWCA 3SPHA 2XAJA 3PW7A 2YDEA 2FMAA 5IE9A 2KQXA 4FLXA 1GN2A 1M1KW 2PY5A 3GB7C 4PDRA 2WLLB 1YVWA 4DV7O 2VUGA 5JVLA 4ICGA 4A3FG 4JAUA 1FJGH 1YF2A 2EINC 3LSSA 2QA4V 2QWRB 3CXCU 1PV0A 3GLKA 1VQMV 4TUYB 2IM9A 4J11A 4G2KA 2BE3A 1WA8A 4RNOA 1LNQA 2OWOA 2ZNJA 3TY9A 5I5UA 4B7KA 2WLMA 1EUDB 3KREA 3FB7C 2V4RA 3RB3A 1AR4A 1H8HG 3UKMA 5KFSA 5JH7B 2QEXV 3ETDA 3B8MA 2ZD9A 1A3GA 3QO7A 1XHXA 4J9QA 1P84F 2XGPA 5EBMC 4LFCB 5BYAA 5KT2A 4JI6B 3RYFA 1PK8A 1MOFA 4I4TA 3K0GA 1QNMA 1OCRB 1Y6XA 2WLLA 3RIZA 2XAHA 4NXMO 2R7KA 3KALA 1BE3H 3VQVA 1S77D 2PN1A 2UXDB 2R8GA 3H1JH 5LMNH 3Q4HA 4M7EA 4WFHA 2W6IG 2ZDIC 4Q0YA 3T4DA 2EILC 1N34B 1NT2B 5KFKA 5KFZA 1S9FA 2QM4A 3B2EE 1VQ7V 1PM9A 1YDXA 2Y0SA 1EZJA 2YI9A 4BIZA 4DV6H 5EOYA 1DIKA 1B04A 1YXBA 5BR8B 2JJ2G 3ZRVA 3TXSA 1ROPA 2DYSC 3L71H 5DECA 2N74A 1XDNA 4DR3H 1FD9A 2EIMC 2K9PA 4JI7O 4LF6B 4ECVA 4R6ZA 5EBLC 3LMLA 2Q2UA 3E2EA 1R3JC 1C3OA 4EEYA 2R92G 5KT5A 4MVUA 4TWKA 3KZIZ 4JPRA 2MW2B 4LNUB 1JFFA 4FFNA 2ZM6O 1JPXA 4UCUA 3CD6V 3M4IA 4WD3A 3MR5A 4AHCA 5KX5A 4RAZA 3T5JA 1GH6A 4FM0A 4GKKH 3N43B 1C30A 1BGYH 5BWTA 1DF4A 5LMNB 1XK5A 4A3MG 2FPPB 2GPSA 1YTFB 3JZIA 3C0FB 4O7YA 2W7OA 2UU9H 3T9FA 2F4VB 3B09A 1HR0B 2R82A 1I3QA 4JI6O 4MV9A 3A0BZ 2XNDG 4QIWF 4DV0B 4CS4A 2R8JA 3UQ8A 2CQYA 1Z5WA 1CPYA 1HP8A 4A5UB 3CPWU 1KU9A 2UXDO 3C3SA 1S68A 2AGAA 2B1IA 1EN6A 3M99B 4C5CA 2ODTX 3RV4A 2W6QA 5DAAA 5L1LA 4P9PA 1GSHA 2PBZA 1F4NA 1VQLV 4BBRG 2Y4UA 5JQWA 3N27A 4LNUA 3ZRSA 3CCJV 3KHRA 5BR8O 3I4MG 4RZRA 2PZSA 2UU9B 2X5RA 5FPRA 3CC7V 3GIKA 3ML0A 2R8HA 2OLSA 1M7JA 1MZFA 4DV3B 2YEVB 3MWMA 1QBZA 1KBHA 4BY7G 3Q8RB 3CJHA 3T5KA 4R50A 3AG4B 3JZFA 5J2TA 4J9LA 1E4EA 3AK1A 2FK1A 4WFGA 3RYCB 5DG8A 4NLGA 3E8GA 3FKIA 5LMNO 3R5XA 1LUWA 2E74B 4DV4H 3DTGA 3WFVA 3L70H 4PZ8A 1R6KA 1AI4A 4MVZA 4J9NA 2F4VO 4TUYF 2YRWA 2VUMG 4QE9A 3O65A 2C00A 2ZR3A 1EN5A 4BWAA 5IT9N 5CA0F 4R7RA 4DV0O 3E35A 4YJ2B 3SPJA 5KFVA 4O4JA 1FXVA 2E2IA 3BABA 3W5OA 5JH7F 4Z2WA 4X1KB 4WBNA 2IJKA 1XL4A 3OR7C 2LQTA 5GONB 1KUTA 2BSKB 1GSOA 4WFAV 4PA4A 2JRIA 3ABMC 4IIJB 3K9SA 2YEVA 3O9OA 3ZCCA 2JA6G 1YITV 4ECTA 3U11A 3KCYA 3Q1KA 2FL4A 1P8LA 3AG3B 2H3OA 4FFOA 4CS2A 2P5OA 2W71A 3SYOA 1QR9A 3P32A 3D8CA 1M90W 1SQPH 2IJJA 4O4LB 3DC6A 4O2BA 3RYCA 2UU9O 2FYUH 4ED1A 2JEXA 1TUEB 1Z2NX 3N6XA 3SPIA 4DV3O 5EZYB 1TUBB 1K9MW 3H01A 2JA5A 4JZ2A 4A3DG 1M56C 3ZMZA 1YJWV 3OTOB 3K58A 4LP8A 1AB3A 3V6JA 4F6EA 4JGSA 3N44B 4DL4A 1SQVH 5KFTA 4YJ2A 2UXCB 5BWXA 4DUZH 4KXRA 4LH7A 4MSWC 3BG5A 4GX0A 4DO2A 1EN4A 1BHAA 1SZTA 2ODMA 2COIA 2YI8A 4NZOA 1Q43A 1SA0B 4O3OA 5GONA 2BSKA 3U10A 4O7RA 3JAWB 1CP9A 4DV5B 4QPKA 3OT7A 5KFYA 3OEHG 2JK5C 3G80A 1FXKB 4NKGB 5DGHA 4LF7H 4O82A 2Z3YA 5LOVA 1FVIA 2HGXA 1OBDA 2NLJC 4J9RA 2EIJC 5LGTA 1Q82W 3GILA 2WAQE 2VUMA 1AI7A 4I7ZB 3R5FA 1NJIW 3T9BA 4A3EG 2IW5A 1WCMG 1GKFA 1XL6A 2L35A 2KSWA 2FP4B 3CXHF 3ZMVA 4BR6A 2QKCA 2PF4E 1Y67A 2W6OA 3VPBA 3D3QA 1BMFG 5L3CA 4DL5A 3TETA 4FM2A 5GTIZ 4ZOLB 3H40A 3B40A 4MAMA 1W0KG 3T99A 1QLEB 4QWBA 4UV9A 5KLVH 3PO2G 5KT4A 4TVIA 5EWFA 1VF6A 3F5TA 3WWIA 3N40P 4DR2B 2DABA 3Q8SB 4L8JA 2HVSA 4O2AB 2ATLA 4JASA 1IXMA 4FZ0A 3GWKC 4R8UA 3JAWA 3OTOO 3CCMV 1IBLH 3DTUB 3RWRD 4P9OA 5D1OB 1OCZB 4ED3A 5B1BC 2DN9A 5EBWC 2LJ2A 3KAKA 2SCUB 1QHTA 3WB0A 5KHJA 5K2MA 4FZ1A 5IY5C 3JALB 4RAYA 2BTQA 5JWPA 5J2UB 5HFLA 4DV5O 1FAFA 2FK3A 5HBRB 3K5HA 5KFWA 1VQNV 4BBSG 4YY3H 4M9UA 4Y8VB 3RN4A 3KYHC 5HV6A 5KG0A 1IDSA 1V54B 4BW5A 3HO8A 3OSPA 4CS3A 2MCTA 2PUSA 1GK9A 1T5EA 5EIBC 3DSQA 3RVZA 1IURA 4TV9F 4FBTA 3GWOA 4X1YB 4YIPA 1N48A 2DQ3A 2VOBA 4MA5A 3FAVB 3JASB 2QWOB 3TJTA 5I5TA 1BJTA 1NVPB 3MR2A 4PELA 3M9MB 3IN5A 1BGWA 1WCMA 2DW4A 1H2NA 3RR5A 3IFXA 2P22C 1PNLA 4I55B 3JCZA 2A79B 3T9EA 4A3BG 1XMQH 2VQFH 3L74H 3ASOB 5LP6F 3PO3G 5LXTB 3ASNC 4LF7O 4HAMA 3CC2V 4ECSA 1GSAA 3DAAA 4JI0B 2R9IA 1SQQH 3IC9A 4O4LF 4JI5H 4IRKA 5H6QA 1JJ2U 3K5IA 2WE6A 5DLFA 5KG5A 2YWVA 4HZ3A 4JI2B 3ABKB 5EZYF 3T1HH 3H0GG 2UUCB 1JMKC 4ZIBA 5IYZB 4DR5B 4ZHQB 2W6MA 3OMAB 1WP7A 2QF7A 4XX0B 1QCEA 3AG2C 1SC5B 2JEUA 4QWEA 5BMVA 4W4KA 2VR1A 5LYJA 2JA7A 3CWBH 1HNXB 1YTFD 4HNVA 5KFAA 2HJFC 4JAVA 3NGDA 2ZJTA 1K3EA 1B33N 1JCHA 3T5LA 1YHQV 4UCTA 3JSNA 1IBLO 3E89A 2YCHA 2DPJA 2JS5A 5LXTA 1J5EH 2C2AA 1VBHA 2F43G 2YS7A 4LFAB 2ZCEA 2PYJA 1AUVA 2CNUA 4ECYA 1JJOA 1CXZB 3PJSK 2Q4PA 3SR2C 2R9RB 3ZRWA 3N41B 5DQIA 4CHIA 4QW9A 1ZETA 4W4LA 1Y1VG 5AG2A 3THOA 2Q5ZA 4YY3O 5IYZA 4K0KH 2A1HA 4X62H 3JATA 3EYYA 3S24A 4O3NA 2LGWA 3G8DA 4NYEA 1QLNA 3WO0A 1SCUB 3W7TA 1J95A 1KJQA 1DAAA 5DGAA 4FS2A 4GKJB 5LMUB 3U9TA 1Z5VA 2NVXA 4O2AF 1NH2D 1KC8W 2YRXA 4QJFA 3BQ2A 4TM5A 4FE2A 2YZMA 2OYQA 2P7TC 4PA9A 2YUAA 2ETNA 1HNZH 1EKVA 4RO2A 4RCNA 2Q6AA 4O4HB 1HNXO 4A2AA 3GV8B 1XMOH 3K3VA 4IHJF 3H1HH 3H9VA 1UNNC 1XMQO 3K3PA 3G6XA 2AHZA 4JI1B 2DOSA 5J2UF 2IBKA 4I5SA 4UVCA 2F95B 4JI5O 4DRXB 3GTJA 5IJ0B 2QTSA 3LNNA 4X66B 3GB8B 2UUAB 5H80A 5F9LA 2HLDG 4ECQA 2ZIOA 4LFAO 3T1HO 1H2SB 1WPXA 3SJBC 1W96A 5BPHA 3PVXA 4FFBB 2ZIMA 2FLPA 1N32H 2YW2A 2NN4A 1SFOA 2WA3A 1OBGA 2WLKA 3L73H 2KSDA 1HWYA 5K1XA 5LHGA 3HB9A 4CH3A 1KJIA 3E8BA 1CQJB 1Y1VA 3K57A 3OMIB 4I55F 4GKJO 5LMUO 2Q7EA 4FFKA 3CSWA 2P67A 3LULA 2XCAA 5BWVA 4RB1A 4HYKA 1H2GA 1J5EO 2Y69B 5L1KA 4LF4H 4EFBA 1ZL8A 5KT3A 3ZHVA 2VQEB 2CZGA 2IJHA 2EJ2A 5FNVF 4JV5B 5KKNB 2WLJA 5IJ0A 1OJHA 4EB6B 4RWUA 1OCOB 3CCQV 2X6BA 1IVSA 5EC1C 2YZGA 2IH3C 4DR4B 4JTAB 3RVYA 4K0KO 4JI1O 3A2FA 1RPRA 3PFFA 4X62O 2PYLA 4O7LA 1I5XA 3HKCB 4L1KA 2LGQA 3ZN1A 3GV7B 2KG7B 1TVKA 4FFBA 1YZBA 2B9ZA 3TGUH 3H4BA 3K79A 4FIPC 1JDBB 2CDYA 4NYKA 4JYAB 4ECRA 5KHIA 1N33H 4B3MH 5EK0A 3EHBB 2AGQA 1EUCB 1I2LA 4TV8B 4FM1A 2WDTA 3RB6A 3UZOA 1S5LZ 3AG1B 1UFIA 3E22A 5IWAB 1AUXA 3SNOA 1HNZO 2EX3A 4ZI7B 4YR0A 3CCEV 2HEPA 4Q43A 3GDEA 4DV7H 2L6LA 5GW7A 1VQ8V 4B3SB 1G6UA 2VWKA 2XAQA 1E79G 3CYOA 1WLEA 2CNVA 4GYCB 1EZ1A 1Y74B 1L8DA 5LP6C 4LF5B 1GMGA 2N04A 3HKDB 4I0XB 4E4TA 1GLVA 2ZXWB 2COJA 4A3LG 2E76B 5KFPA 1RFYA 3RJ0A 2VQEO 2R7NA 1AJPA 4U6PA 2QSAA 2WB1A 2C2RA 2YIDA 4MV7A 3M8AA 5KFUA 3R9RA 4DR4O 5LGUA 1M57B 4TV8A 3SGIA 4WF9V 2W7PA 5L3FA 3OGCC 1ZHQA 4FPPA 3CQZA 2ZR2A 1GN6A 4LR3A 1L1FA 4MA0A 1ZWIC 4QE7A 4RZQA 4JYAO 3W1GA 4O4HF 2Y0SE 1GGOA 4YXWG 3H3VH 3J80N 2ZKOA 3KTMA 4BXXG 4EBCA 3OE7G 3LSUA 1EYZA 3GTOA 3I56V 1S0NA 2PVPA 1Y74A 3RYHA 4LF4O 1OZ0A 3FB6C 3PW0A 4WFFA 4LF9B 4PA7A 5IWAO 4J41A 1URFA 4MV8A 3WU2Z 1JKJB 1GYFA 4HNTA 2FJZA 1RM1B 3KCXA 4B3SO 3K08A 4QSHA 1K1QA 1XUQA 3CRQA 2FE3A 4DR6B 4CC6A 3CCUV 3BY6A 1WA8B 2CTRA 3EXAA 1OV9A 5JCOC 3H1LH 2V4DA 5HFMA 1K8AW 4KP4A 2Z02A 5FL7G 4O81A 2ZQMA 3JD0A 5KG7A 2E5LB 1THZA 4F4LA 4QGPA 1NU1H 4R7CA 3UCSC 3NR7A 3ZMSA 2V4QA 4QW8A 1T94A 4DUYB 2V58A 3F7YC 5H5NA 4P30A 3RYFB 4H33A 1AN7A 4I4TB 1A48A 1OCZC 4LFCH 5KFDA 4JI6H 2YZNA 3CHXA 4F4WA 2ATKC 1FPOA 3HOUG 3GTKA 3QO8A 1IBMB 3Q4HB 3UT5B 5CN0A 3D36C 2UXDH 2CK3G 1PL0A 5DMXA 3E5NA 2WTFA 1N34H 2CTPA 4UCSA 3HOXG 3TY5A 2FKXA 2NU7B 5DQGA 3RB4A 2H8PC 2CNQA 1PNMA 4HR7A 3IGAC 3FD9A 4QIWA 4Q45A 5BR8H 5JVDB 1VKZA 4DR6O 1VP7A 4LWSA 5JJEB 2AXTZ 2UUBB 4LF6H 1JFFB 5KX5B 3F8NA 1M0WA 1AJQA 1UC8A 3ABLC 1WB8A 3I4NG 2ZE6A 3EFFK 1FFTB 3SDLA 5KG2A 5KFEA 4YJ3F 3ZBHA 3FDSA 1L2ZA 4YR3A 4IGGA 5CE8A 3G4SV 3UT5A 1BS3A 1BT8A 3ASOC 2JJ1G 4DUYO 4DV2B 4PI2A 4JI4B 2J6TA 2F4VH 1IBKB 3JAKA 5C3EG 1HR0H 3HKZA 1Q90D 3APOA 3A8TA 1SEIA 4DV0H 4J7KA 1P7BA 1IBMO 4CZZA 1IXBA 3I12A 3RBDA 3FKIG 1I94B 5JVDA 3FKSG 4FLZA 1MSWD 4ED8A 4J0MA 4ED2A 1GRJA 4EEQA 1P49A 1KD1W 4BIUA 1FKAO 4C7UA 3L75H 2M05A 5C8YB 4MV6A 2A7WA 5J9PC 5I60A 3FFQA 1GAXA
chains in the Genus database with same CATH topology
4YHHB 2KSWA 4ZHQA 4X20A 3K5OA 2E5LH 3DF7A 4DRFA 4DR7B 3RGZA 2QJ1A 4FLWA 4DV3H 3RGBA 5J2TB 3K5LA 4FM2A 4ZOLB 4DUYH 4NXNH 5KMGB 1MZBA 1CKNB 3N40P 1J5EB 2YXLA 1RSOA 4DR2B 2ZINA 4L8JA 2HVSA 4O2AB 4PDBA 1M4UA 1IBMH 1XNQH 2HVQA 3JAWA 3BHPA 4YJ3A 1IBLH 3K59A 4DV1B 4PHZA 4O4JB 3RWRD 3TY8A 5D1OB 3N2GA 1SYXB 4WBNB 3N2KA 5C8YA 3KAKA 4K0KB 1QHTA 3SJAC 4TQDA 3WB0A 4X62B 1FKAH 3QF7A 5KHJA 4RAYA 3JALB 2BTQA 5J2UB 4K8ZA 1M93A 1Z2OX 5JJJB 3L4KA 2RQ6A 4YY3H 3RYIA 4DR1H 1WN7A 1XI1A 2UUBH 3KYHC 1SKVA 4O2BB 1Z2PX 4CS3A 2MCTA 2PUSA 3HKBA 5KMGA 1T5EA 5EIBC 4I50B 3DSQA 2O03A 5LA6B 3WB2A 3FMAA 4X1YB 4NXMB 4U3JB 3OTFA 1CKNA 1Q8IA 5JJNB 1N36B 1HNZB 1CKOA 1O75A 2VOBA 1XMOB 3JASB 1YEWA 3JAKB 1BJTA 2CFMA 3CSXA 4DV2H 3CB2A 2HIXA 2HIVA 4O4HA 4JI4H 3K5NA 2KKWA 1IBKH 1BGWA 3OTOH 3RF2A 4KHPB 1I7FA 4O4IA 4RB3C 5D5QA 3RR5A 2UXCH 2P22C 4I55B 3N42B 2R70A 1XMQH 4LFBB 4LF8B 1WNSA 2VQFH 4RB2C 4JI7B 5LXTB 1I94H 4DRXA 2RGVA 4F6RB 4E6NA 4JI0B 4JI5H 4DV5H 2HHHH 5LOVB 2WE6A 1O9HA 5CA0B 2ZM6B 1N32B 4JI2B 1S5JA 4OX9B 3T1HH 1HNWH 2UUCB 1JMKC 3JSLA 4PI0A 4ZIBA 5LA6A 4ZHQB 5IYZB 4DR5B 3H20A 4I9QA 2Q2TA 4TQFA 4YHHH 4Q6GA 4CH5A 5CA1A 3NBYB 5BMVA 1Q3EA 5LYJA 4DR7H 1HNXB 4JI8B 1X9NA 2ZJTA 4LF4B 1FJGB 3RFRA 4ETSA 3PN1A 4UCTA 3JSNA 2YCHA 4EFEA 1S03G 4CH4A 2JS5A 4YJ3B 4FLVA 4IAJA 5LXTA 1J5EH 4DR2H 4F6RA 3M7MX 4TUYA 2Q7HA 4EB6A 2PGGA 4LFAB 2ZCEA 3N2KB 2PYJA 5FD5A 2RGRA 1HNWB 1JJOA 3KAJA 3SR2C 3N41B 4DV1H 3BAAA 5CA0A 1HW7A 4CH6A 1ZHSA 4FM9A 2BTQB 3HKCA 3THOA 3RGXA 1N33B 4K0KH 5IYZA 5JH7A 4X62H 1TA8A 1ZAUA 2ZNIA 4B3MB 1A0IA 3JATA 4X65B 3EYYA 3S24A 3RYIB 4LSAA 5A2QW 5LP6A 2CW7A 2R72A 3HKBB 1E4FT 4GKJB 5LMUB 1KMIZ 1Q5OA 1Z5VA 4DV7B 3T1YB 4K8XA 4ZI7A 2PTMA 2OYQA 4NXMH 2BTOA 5ITZB 1HNZH 4B3TB 1N36H 3VQWA 2RJZA 4O4HB 4BWSC 3JARA 5KHGA 4DV6B 4A2AA 1XMOH 3K3VA 2CW8A 2HGSA 4UCOA 4O4IB 4MTDA 4DR3B 3HKDA 2YIBD 3SJCC 4JI1B 4I7HA 4KHPH 2F95B 2UXBB 1SQFA 3ZEDA 4DRXB 2JGUA 2XHBA 5IJ0B 5IT9W 4X66B 3LNNA 4AQYB 3GB8B 2UUAB 4LFBH 4LF8H 4GKKB 4JI7H 2ZIOA 4AILC 2YIAA 1H2SB 2Q0AA 4FLYA 3SJBC 5K1PA 1VS0A 4JI0H 5D1PA 4FVMA 4FFBB 4LMYA 2ZIMA 4GLXA 1XHZA 1TAEA 3BA9A 2ZM6H 1N32H 4JI2H 4OX9H 2UUCH 3HKEA 5CA1B 4DR5H 3J7AK 4UFZA 5BMVB 5K1XA 5LYJB 5ITZA 4CH3A 4UCVA 4DK0A 3L4JA 3K57A 4FLXA 1TGOA 2PY5A 2Q7EA 5KHKA 1QQCA 1HNXH 4RB1A 4JI8H 2VUGA 4LF4H 1FJGH 1CKMA 5JQGA 4EFBA 2VQEB 1M5IA 3NBZB 4TV9B 4JV5B 5IJ0A 3ETQA 2IM9A 4TUYB 4EB6B 2OWOA 4X64B 1O9GA 1FFXB 2ZNJA 4DR4B 3TY9A 3A2FA 1SQGA 2PYLA 4LFAH 3HKCB 4JI3B 1TVKA 4FFBA 4HNAB 5JH7B 4X1IB 3JATB 4JYAB 1N33H 5KHIA 3GJXB 3RTXA 1I6UA 1XHXA 4B3MH 4LFCB 4X65H 5LP6B 4JI6B 3RYFA 1XQ8A 4DV4B 3U0ZA 4TV8B 4I4TA 4FM1A 2WDTA 4TOIA 3E22A 5IWAB 1XNRB 3RIZA 1E4GT 3KALA 4GKJH 2EX3A 4ZI7B 3J80W 3VQVA 5LMUH 2HEPA 2UXDB 3GDEA 4DV7H 3T1YH 5LMNH 4B3SB 4M7EA 4Q0YA 1N34B 1NT2B 1G6UA 2VWKA 3BRCA 3JARB 4KL1A 4TV9A 2QM4A 4GYCB 3B2EE 5IJ9A 5LP6C 1L8DA 4LF5B 4B3TH 1FFXA 2YI9A 4B3RB 4PZ7A 3HKDB 4DV6H 3QWUA 5EOYA 1B04A 5BR8B 5EYPA 3CVZA 4X1KA 1DGSA 1XDNA 3J81W 4DR3H 4HNAA 1P16A 2WYOA 3RJ0A 4JI1H 4X1IA 4LF6B 2R9AA 3MAQA 3LMLA 3VNNA 2Q2UA 4IIJA 2UXBH 4MV7A 5DISC 5EIBD 4LNUB 4X66H 1JFFA 4AQYH 2UUAH 4FLUA 4UCUA 3M4IA 4GKKH 4AHCA 5FNVA 5KX5A 4TV8A 4RAZA 4FM0A 3N43B 3SGIA 2VWJA 3ZS8C 1ZHQA 4O4LA 5LMNB 1XK5A 1M0TA 4LR3A 4RZQA 3HKEB 3L2PA 3W1GA 3C0FB 2UU9H 2F4VB 4FLTA 5EZYA 2HVRA 1TUBA 1HR0B 3BPZA 4DUZB 4MV9A 4CC5A 3JAMW 4DV0B 3RYHA 4CS4A 3UQ8A 4LF9B 1Z5WA 4HBNA 1GYFA 1KU9A 5JQGB 3ICXA 2XIGA 1V9PA 2F93B 5CB4A 1S68A 2GV9A 1SA0A 2JVDA 2FE3A 4DR6B 4CC6A 4A2BA 1WPBA 3K5MA 3W1BA 2VQEH 4LF7B 5JCOC 4JV5H 1VF7A 3QG5A 2V4DA 4LNUA 2VPSA 4X64H 4DR4H 1TVKB 2PZSA 4IHJB 2UU9B 5FPRA 2E5LB 4LH6A 4PZ6A 4JI3H 4DV3B 4BW9A 3MWMA 4DUYB 4NXNB 4JYAH 3RYFB 1X4TA 2CAZC 4I4TB 4D7TA 5JCOA 5J2TA 1AN7A 4ZOLA 4LFCH 3RYCB 3E22B 4JI6H 3CHXA 4DV4H 3WB1A 5FD6A 3QTCA 4PZ8A 1IBMB 1XNQB 1XNRH 3UT5B 5IWAH 4DK1A 1IBLB 4O2AA 2UXDH 5IJ9B 4UCRA 4B3SH 4MTEA 4BWAA 4NVPA 4R7RA 1N34H 4UCSA 4YJ2B 1WH2A 4O4JA 3TY5A 5D1OA 4LSXA 3BABA 3W5OA 4LF5H 5EYPB 3VQXA 4X1KB 4WBNA 5KHHA 4B3RH 4IHJA 3NC0B 5GONB 5BR8H 5JVDB 3HXLA 3JALA 5D5PA 5JJEB 4YY3B 5J2UA 4IIJB 4RB0A 4DR1B 3KXYT 4APMA 2UUBB 2E3CA 4LF6H 1JFFB 3U11A 2F66C 3VQYA 1P8LA 5KX5B 5FNVB 4CS2A 2P5OA 1M0WA 3F8NA 1D5AA 2F1MA 4O4LB 4O2BA 3RYCA 1Z2NX 3N6XA 4I50A 1L2ZA 3IAYA 4X20B 4X1YA 5EZYB 1TUBB 4U3JA 3UT5A 2YIBA 4DV2B 4B08A 4PI2A 4JI4B 3JASA 2F4VH 1IBKB 3JAKA 3OTOB 3K58A 3RYHB 5LL6b 3BA8A 3N44B 1HR0H 4YJ2A 2UXCB 4DUZH 4LH7A 4DV0H 1SEIA 1XMQB 2VQFB 4D7SA 2YI8A 5CB4B 1Q43A 1SA0B 4LF9H 5GONA 5FPOA 4I55A 4EQ5A 1I94B 5JVDA 4FLZA 3U10A 4J0MA 3JAWB 4JI5B 4DV5B 4EEQA 2HHHB 1P49A 4DR6H 5FLXW 3N2GB 4LF7H 3T1HB 5C8YB 5LOVA 1FVIA 2Q7GA 2W57A 3FFQA 3IG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH B;  4LF7 B;  1HNX B;  1CKM A;  4EFB A;  4JI8 B;  1X9N A;  2VQE B;  3NBZ B;  4DRF A;  4DR7 B;  4JV5 B;  4LF4 B;  1FJG B;  2UU9 B;  5FPR A;  3PN1 A;  2E5L B;  2OWO A;  4LH6 A;  4X64 B;  4PZ6 A;  4UCT A;  3JSN A;  4EFE A;  4DR4 B;  3TY9 A;  4DV3 B;  4DUY B;  4JI3 B;  4NXN B;  1CKN B;  1J5E B;  4LFA B;  4DR2 B;  2HVS A;  1HNW B;  4JYA B;  3BAA A;  3GJX B;  3RTX A;  2HVQ A;  4LFC B;  4PZ8 A;  4DV1 B;  1IBM B;  1N33 B;  4JI6 B;  3TY8 A;  1XNQ B;  5D1O B;  4DV4 B;  1ZAU A;  1TA8 A;  1IBL B;  4B3M B;  1A0I A;  4X65 B;  4K0K B;  3S24 A;  4TOI A;  4UCR A;  1XNR B;  5IWA B;  4X62 B;  4UCS A;  2UXD B;  3GDE A;  3TY5 A;  4B3S B;  5D1O A;  3BAB A;  3W5O A;  1N34 B;  4GKJ B;  5LMU B;  4DV7 B;  3T1Y B;  3NC0 B;  4LF5 B;  3KYH C;  4B3R B;  4PZ7 A;  4YY3 B;  3QWU A;  4DR1 B;  1B04 A;  5BR8 B;  2UUB B;  4B3T B;  1XDN A;  1DGS A;  4DV6 B;  1P8L A;  1P16 A;  4NXM B;  1CKN A;  4LF6 B;  1HNZ B;  1N36 B;  1CKO A;  4UCO A;  4DR3 B;  3VNN A;  2Q2U A;  1XMO B;  4JI1 B;  5DIS C;  2CFM A;  2HIX A;  2HIV A;  4UCU A;  2UXB B;  4DV2 B;  4KHP B;  3SGI A;  4X66 B;  4AQY B;  3GB8 B;  2UUA B;  4JI4 B;  3RR5 A;  5LMN B;  4GKK B;  1XK5 A;  1IBK B;  3OTO B;  3BA8 A;  4LFB B;  3L2P A;  4LF8 B;  3W1G A;  2UXC B;  2F4V B;  4JI7 B;  4LH7 A;  1VS0 A;  2HVR A;  5D1P A;  1XMQ B;  1HR0 B;  2VQF B;  4GLX A;  4DUZ B;  1TAE A;  3BA9 A;  4E6N A;  4CC5 A;  4JI0 B;  5FPO A;  4EQ5 A;  1I94 B;  4DV0 B;  3UQ8 A;  2ZM6 B;  4LF9 B;  4UFZ A;  4JI5 B;  4DV5 B;  1N32 B;  4JI2 B;  4EEQ A;  2HHH B;  4OX9 B;  4UCV A;  2UUC B;  3JSL A;  4DR5 B;  1V9P A;  1S68 A;  2Q2T A;  3T1H B;  4DR6 B;  4CC6 A;  1FVI A;  3W1B A;  2VUG A;  3NBY B; 
#chains in the Genus database with same CATH topology
 4YHH B;  1IOW A;  3RAQ A;  3N8D A;  1ZQ7 A;  1YJN V;  3OD4 A;  3T9A A;  1OWT A;  1RJQ A;  4H37 A;  3K5O A;  1NTM H;  2OCH A;  3FYI B;  2UUB O;  4DRF A;  2RCV A;  3CJH B;  2QJ1 A;  4LFC O;  3RGZ A;  4O4I F;  2ZDH A;  4DV3 H;  3K5L A;  5J2T B;  1BHB A;  1E4E B;  2W6Z A;  3T9D A;  1RJP A;  3A0H Z;  2W6P A;  5L3G A;  3SI8 A;  2WLI A;  5KMG B;  3LSQ A;  1S3J A;  3WWJ A;  1CE8 A;  5I5X A;  1IYE A;  2Y0P A;  3ORQ A;  4P2Z A;  3DXR A;  2YXL A;  1RSO A;  3CME V;  4DV2 O;  1N34 O;  1VQ4 V;  4DL3 A;  5CR5 A;  3BQ0 A;  4JI4 O;  2HFE C;  4IR9 A;  3U0G A;  3BHP A;  1Y76 A;  3K59 A;  5DGI A;  4DV1 B;  4PHZ A;  4J9K A;  3ZHS A;  4O4J B;  3TY8 A;  2JA5 G;  1SZX A;  1MSD A;  4H13 B;  2ASL A;  4WBN B;  5KUM A;  5FLM G;  2A06 H;  5FLX N;  5C8Y A;  4TQD A;  4MVM A;  4LF6 O;  1I94 O;  2WWW A;  3MHS C;  3APQ A;  4K8Z A;  4BIO A;  3V6K A;  5KA6 A;  2D3O W;  3B77 A;  3L4K A;  2OCC C;  4I4T F;  2PI4 A;  4AYB A;  1NH2 B;  4TT3 G;  3G6B A;  3RYI A;  3WWH A;  2QK4 A;  1VMG A;  1SKV A;  4TQS A;  4O2B B;  4NTY A;  1B6S A;  2GUZ A;  5KMG A;  4YHH O;  1FS0 G;  1SET A;  4ED0 A;  1AP6 A;  5LA6 B;  2R87 A;  3OUZ A;  1TWH A;  3FMA A;  5JJN B;  2UXX A;  3HT5 A;  1O75 A;  1HR0 O;  2GTA A;  3Q2O A;  4YP3 A;  4XDJ A;  2UVV A;  2CFM A;  2J9G A;  4MV4 A;  3U54 A;  1JX4 A;  1US6 A;  2Q9L A;  3K5N A;  3GID A;  1V55 B;  3OTO H;  1KB9 F;  5KA5 A;  3AX6 A;  4RB3 C;  4FGR A;  2UXC H;  4O7V A;  3N42 B;  3S3X A;  4LF8 B;  1JDE A;  5K3W A;  5BWR A;  4EG0 A;  4F6R B;  2WA4 A;  3RV3 A;  4O7S A;  4E6N A;  2VPQ A;  5KG1 A;  4DV5 H;  2YU9 A;  2JA8 G;  3G6Y A;  4O7T A;  5LOV B;  1O9H A;  1YJ9 V;  3QFF A;  2FML A;  4N21 A;  3MDS A;  4Q8F A;  1I0H A;  2EIK C;  5B1N A;  4OX9 B;  1HNW H;  4PI0 A;  5LA6 A;  2Q2T A;  4TQF A;  4MV1 A;  1R3L C;  4Q6G A;  5CA1 A;  3NBY B;  1B6R A;  4EYH B;  1Q3E A;  4BAY A;  4JI8 B;  5KT7 A;  3AK3 A;  1BNC A;  2WLH A;  3E8H A;  3RBZ A;  2DLN A;  2R86 A;  3GV5 B;  2XD4 A;  5IYB G;  4FBU A;  2DAA A;  4EFE A;  1KEC A;  2J6U A;  4X89 A;  3HOV G;  4R8U B;  2YXY A;  2Q69 A;  2RN9 A;  2QGN A;  1RJR A;  4DR2 H;  4IZO A;  4F6R A;  2HVK C;  4UUG A;  3SYP A;  3LWB A;  2YXH A;  2VA2 A;  3MR3 A;  3J7A U;  5FD5 A;  3JRW A;  3H4D A;  2BQR A;  3MHH C;  1HNW B;  3GTP A;  2BQU A;  1MZE A;  1ZHS A;  1N0J A;  3LDD A;  1K5S A;  2BTQ B;  1UJW B;  3KKY A;  3AW8 A;  2IU0 A;  5I5V A;  1R6N A;  1ZAU A;  4LBE C;  4X65 B;  5L3D A;  3TCU A;  4AI8 A;  4IRD A;  3CEI A;  4LSA A;  2QKS A;  1GM9 A;  2O57 A;  5E79 Z;  2VS0 A;  1PKX A;  3G71 V;  5LP6 A;  2JDI G;  2R7Z A;  1CS0 A;  2LFS A;  2FB9 A;  1E4F T;  4OX9 O;  3T1Y B;  1YIJ V;  4CMF A;  1N8R W;  4O7Z A;  3MFH A;  2PTM A;  4JTD B;  3T2M A;  5L1J A;  1S97 A;  4O4J F;  1H2L A;  4B3T B;  3M9N B;  4BWS C;  3JAR A;  1GN4 A;  4EKW A;  2UXC O;  5IYC G;  2XGQ A;  2DYR C;  2HGS A;  3EPG A;  2ZE7 A;  1M57 C;  1W2B U;  5GTH Z;  5KG6 A;  1YI2 V;  1S0V A;  2JGD B;  2JA7 G;  3X2Q B;  2Q67 A;  3GIP A;  4NZM A;  4IT5 A;  1SER A;  2B1G A;  4MVR A;  2UXB B;  1SQF A;  3ZED A;  3BJY A;  1GN3 A;  3OW2 U;  2JGU A;  1JOY A;  1N56 A;  2Y0I A;  4CKC A;  5EDW A;  4AQY B;  2NU8 B;  4MTF A;  1NBM G;  2N05 A;  4AIL C;  3AK2 A;  2Q0A A;  2YIA A;  1HNW O;  5K1P A;  1VS0 A;  4JI0 H;  4O7W A;  5D1P A;  3LQS A;  3WG7 B;  1VAJ A;  2WLN A;  1AIL A;  1SQX H;  3K9A A;  3BA9 A;  1RM1 C;  2Q68 A;  4JI2 H;  5DQH A;  2EIN B;  2YZL A;  4ED7 A;  4X65 O;  2UUC H;  3HKE A;  4DR5 H;  4UFZ A;  5LHH A;  1XBL A;  2WSS G;  5BMV B;  2EJ0 A;  4YJ2 F;  5LYJ B;  2W9B A;  2W8K A;  1WR2 A;  2I80 A;  4DK0 A;  1QVG U;  5GON F;  1TGO A;  2YYA A;  1RYS A;  5KHK A;  3BQ1 A;  3AG7 A;  1HNX H;  1SES A;  2JGD A;  2BQ3 A;  4IIJ F;  4DR2 O;  2P0A A;  1ZUQ A;  3K04 A;  5JQG A;  5F9N A;  4O84 A;  3NBZ B;  4B3T O;  3G8C A;  3OUF A;  3PW4 A;  5JUM A;  3HB3 B;  4X64 B;  2CUG A;  2EUL A;  4ME6 A;  3ZRW B;  1DV2 A;  4C2M A;  4NR1 A;  1SQG A;  3LDC A;  4LFA H;  2UVU A;  4JI3 B;  3TIG A;  3G6E V;  3DC5 A;  1X59 A;  4IYI A;  2UXB O;  1R6T A;  4UVA A;  4U3F H;  4O3R A;  3SYQ A;  1YSC A;  3JAT B;  5KS8 A;  4GX5 A;  3QZ7 A;  2EIL B;  1I6U A;  2OIG A;  5KUK A;  2Y48 A;  3G67 A;  1XQ8 A;  2ILM A;  1BL8 A;  1A9X A;  4KUM A;  4TOI A;  1XNR B;  2DYS B;  2Q7D A;  3K3W A;  1E4G T;  4O7N A;  4QJF B;  4GKJ H;  5LMU H;  3J80 W;  1N0N A;  1K92 A;  3PR5 B;  5KG3 A;  2HDK A;  3NUA A;  2PMZ A;  3BRC A;  4PDL A;  2FKL A;  2ASD A;  1KQS U;  2ABJ A;  4XDK A;  5IJ9 A;  3JCU Z;  5E1A C;  1VQK V;  4B3R B;  4PZ7 A;  4OGQ B;  3QWU A;  3ZIA G;  1OCR C;  4HYO A;  4J7Z A;  4XDL A;  5EYP A;  4ZQI A;  1DGS A;  2PI5 A;  3J81 W;  1G4Y B;  4K6N A;  1P16 A;  2WYO A;  4JI1 H;  3BVO A;  3MAQ A;  5L1I A;  3L9D A;  4XYM B;  4ZOL F;  5B1A B;  2ZDI A;  1DK1 A;  4JI0 O;  1KTA A;  3C90 A;  1V4Y A;  4J9P A;  4X66 H;  4BY1 G;  2UUA H;  5FNV A;  2EIY A;  4JI2 O;  2VWJ A;  4MS2 A;  2UUC O;  3ZS8 C;  4DR5 O;  1QVF U;  1LR1 A;  4DLK A;  3OFN G;  4FLT A;  1MAB G;  2HVR A;  3V6H A;  4A3K G;  1S0M A;  1CQI B;  4JV2 A;  5B3S B;  3ZMU A;  2RDJ A;  2AHY A;  3K0D A;  5BXZ A;  2ITD C;  1I2K A;  3JD1 A;  1XNR O;  2QB5 A;  2CH7 A;  2WB1 E;  3R65 A;  1Y66 A;  2RMK B;  5LL6 Y;  1AP5 A;  1ZL8 B;  3ICX A;  2GQR A;  2XIG A;  4I9W A;  5CB4 A;  2GV9 A;  2JVD A;  5KFN A;  1R73 A;  3JD3 A;  1JX9 A;  3RAX A;  4A3G G;  5BY1 A;  4FFR A;  4A2B A;  3K5M A;  2KB1 A;  3W1B A;  1S10 A;  2VQE H;  2VQD A;  4JV5 H;  3TIN A;  3QG5 A;  2VPS A;  4XZ3 B;  4NTX A;  1I50 A;  2FTK A;  3UO2 A;  4DR4 H;  1TVK B;  4JUZ A;  5DLG A;  2VA3 A;  2FPG B;  3PR4 A;  4LH6 A;  5DG9 A;  4X8A A;  5LYJ F;  2LW7 A;  4PD4 F;  4BW9 A;  3B4S A;  2Z04 A;  3GTG A;  3JD4 A;  3FYE B;  4NXN B;  4JYA H;  1Q6H A;  1X4T A;  1ENV A;  4IL6 Z;  1W0J G;  3UFX B;  2XAF A;  3JAM N;  2NUA B;  3E22 B;  5H6R A;  2UVR A;  2R8K A;  3QTC A;  2GPW A;  5LXT F;  1XNQ B;  5IWA H;  3ETE A;  4H0L B;  3ABM B;  2LO1 A;  2IP4 A;  3GIM A;  3KHH A;  3ZHU A;  1D2D A;  3LDE A;  2HKO A;  4UB6 Z;  2FK2 A;  4B3S H;  4MTE A;  3E8F A;  1P7G A;  2Q8V A;  3AG4 C;  1H38 A;  5HNE A;  4MVO A;  4GC6 A;  4EBE A;  3VBB A;  2W6J G;  1WH2 A;  5IYZ F;  4LSX A;  4ZHQ F;  2YS8 A;  3OUU A;  4U7C A;  3VQX A;  5EWG A;  4MTX A;  4LF5 H;  5KHH A;  1R1B A;  2RDC A;  3NC0 B;  4WCE V;  3E83 A;  4G27 B;  4RNM A;  5D5P A;  4X66 O;  2UUA O;  4RB0 A;  2XOK G;  3W7S A;  4DR1 B;  2GLT A;  4MTG A;  1L0L H;  1M56 B;  1KUQ A;  2F66 C;  3VQY A;  1VQ9 V;  3MJF A;  5DGB A;  4HN2 A;  3CE2 A;  4XYL B;  3CRR A;  2W70 A;  1D5A A;  2F1M A;  4JF3 A;  1TWF A;  2HP8 A;  4I50 A;  3IAY A;  2EZP A;  4U3J A;  2HG8 A;  1LUV A;  4B08 A;  5IDJ A;  2DE0 X;  4NXN O;  1KBL A;  1XOU A;  4FU0 A;  5KG4 A;  3KHG A;  3CP1 A;  4J9S A;  2XCL A;  5LL6 b;  1GM8 A;  2QR4 A;  2CE4 A;  2LFR A;  3AG3 C;  1BSM A;  3CRC A;  3RYH B;  4QIW E;  1W59 A;  5C1P A;  3W7U A;  2EIJ B;  3K03 A;  2V7Q G;  4WFB V;  4D7S A;  4LF9 H;  1XNQ O;  2ALZ A;  1GO3 E;  3SE7 A;  4JV5 O;  4LCU C;  3A0R A;  1MNG A;  3UM7 A;  2Y4R A;  2HHH B;  4DR6 H;  1UPG A;  1QU7 A;  3N2G B;  2DIK A;  5FLX W;  1VF6 C;  5L9X A;  1AI5 A;  2EBO A;  1GM7 A;  4J9M A;  4RUC A;  4X88 A;  1K83 A;  4YBZ B;  5T14 A;  4DR1 O;  3T4Z A;  3HKZ E;  1AR5 A;  2E5L H;  4FJC C;  5IP9 G;  4DR7 B;  1OCC B;  1DF5 A;  3CMA V;  3MWD A;  3ZN0 A;  1FXK C;  4DUY H;  4OPH A;  4K3A A;  5B1B B;  4JZG A;  3PW2 A;  3FB5 C;  2QWQ B;  3IJ4 A;  2JEJ A;  1Q6I A;  5IY5 B;  3J81 N;  3VPC A;  4FFM A;  1IBM H;  1JXL A;  2HVQ A;  4RUE A;  2QE7 G;  5IP7 G;  4YJ3 A;  4LF5 O;  2C2E A;  2CTQ A;  4FFL A;  3QZ8 A;  3N2G A;  1SYX B;  2ZT9 B;  3N2K A;  1QLE C;  3SJA C;  3KHL A;  1FKA H;  3OM3 B;  3ETH A;  2P4K A;  3QF7 A;  4MW3 A;  1EKF A;  4O86 A;  4LWS B;  3FB8 C;  2BOB C;  4DAA A;  3FX7 A;  2X0S A;  1M93 A;  1NZ6 A;  1VF5 B;  5JJJ B;  2HHH O;  3OMN B;  2Y4T A;  1WN7 A;  1XI1 A;  1NQT A;  2UUB H;  3EPI A;  3JZ6 A;  2YC0 A;  1GTO A;  3I5D A;  1Z2P X;  3ZRX A;  1RP3 B;  3HKB A;  2G38 A;  1KP3 A;  3WB2 A;  4UVB A;  1K34 A;  4NXM B;  3GQC A;  4Q4C A;  1R3I C;  1N36 B;  1CKO A;  1R9T A;  4DR7 O;  3T9C A;  2IU3 A;  2QTO A;  2X6A A;  3ASN B;  1YEW A;  3JAK B;  3VOT A;  3HBL A;  2W6N A;  4DV2 H;  2UVW A;  2HIX A;  3T1C A;  1I7N A;  4JI4 H;  4LF9 O;  1V54 C;  1ARO P;  2KKW A;  1IBK H;  3RF2 A;  2H94 A;  4KHP B;  4O4I A;  3R5H A;  2W9C B;  5D5Q A;  1MG1 A;  3WG7 C;  4MT8 A;  2X0L A;  4ASU G;  4AYB E;  4HQ6 A;  2R70 A;  2RF4 A;  4LFB B;  4JI7 B;  4YAK B;  1ULZ A;  1I94 H;  3AG2 B;  4TV8 F;  5I5Y A;  5EWE A;  3TQ1 A;  2Q0O C;  1WB7 A;  2WPD G;  2XAS A;  5CA0 B;  1PL4 A;  2ZM6 B;  4ZI7 F;  2E5L O;  1F51 A;  3ABT A;  4O3P A;  1NTK H;  2NNU A;  1S5J A;  3JSL A;  4DW0 A;  3H20 A;  5C4X G;  2HJD A;  4YHH H;  5KFI A;  3CRA A;  4GUN A;  2JEF A;  4QWC A;  2GQS A;  2OIE A;  3OHA A;  1ZX3 A;  2WLI B;  1X9N A;  1MA1 A;  1FXH A;  2EJR A;  5E25 A;  2FLL A;  1FJG B;  2C28 A;  3ABU A;  3RFR A;  3ABK C;  4ETS A;  2W9C A;  2R85 A;  4YB8 B;  5IYD G;  3DXR B;  1RSO B;  1N36 O;  2A9H A;  2R84 A;  3H1I H;  4CH4 A;  4UB8 Z;  2FPI B;  1QR8 A;  1Y76 B;  2IBZ H;  4OXS A;  2XCP A;  4FS1 A;  4UXN A;  4PV1 B;  1T36 A;  4F4Y A;  4IYH A;  4MV3 A;  1F4M A;  3M7M X;  1PD3 A;  4TUY A;  2Q7H A;  1VQP V;  2NU6 B;  4KHP O;  5L3E A;  5LBQ A;  3Q8P B;  3KAJ A;  4DV1 H;  3BAA A;  5CA0 A;  1HW7 A;  4RUF A;  1YCI A;  5C44 G;  4MW8 A;  3RGX A;  5C93 A;  2XAG A;  1K33 A;  4LFB O;  3OHB A;  2A3Q A;  5JH7 A;  1TA8 A;  2ZNI A;  3SYC A;  1A0I A;  4NZN A;  3RYI B;  1WP8 A;  4B7E A;  2C35 B;  2HVJ C;  5A2Q W;  2GUZ B;  2CW7 A;  2R72 A;  3VA7 A;  2HJW A;  2QM7 A;  4IR1 A;  2GTS A;  4ECU A;  4RQE A;  3JYC A;  2I8C A;  5KFF A;  4XBF A;  3TEK A;  3B8N A;  2NR5 A;  4ECZ A;  2BTO A;  5B1A C;  5ITZ B;  1IBK O;  1IYD A;  2RJZ A;  5KHG A;  1F23 A;  4DV6 B;  2EJ3 A;  5DG7 A;  3SPG A;  2CW8 A;  4EGQ A;  4Q8E A;  1WJZ A;  4UCO A;  4MTD A;  4DR3 B;  1FJG O;  3SJC C;  5BYB A;  2EJ7 A;  1ET0 A;  5FR9 A;  4J42 A;  3DTF A;  1GO3 F;  3QNE A;  2V5A A;  3JRX A;  2K1E A;  4U7O A;  1VQO V;  1Q86 W;  4LF8 H;  5B3S C;  4GKK B;  1AJN A;  3R23 A;  1EBO A;  3ZHR A;  4FLY A;  2BOC C;  1MMM A;  2M6Y A;  4QPJ A;  1XRE A;  4CMD A;  3P3P A;  4E2L A;  3LP8 A;  2R8I A;  2CGN A;  1XHZ A;  1TAE A;  5BZB A;  1VQ5 V;  4OX9 H;  4ECX A;  2P90 A;  5CA1 B;  3J7A K;  2OTJ V;  2DPI A;  2VRZ A;  5H2F Z;  5ITZ A;  3F5W C;  5IYD O;  1Q6U A;  4UCV A;  3L4J A;  2QWP B;  1JVM A;  2P6J A;  5JVD F;  1QQC A;  4RU9 A;  4JI8 H;  2JEG A;  4DIM A;  2R7Z G;  2XUM A;  2YIC A;  2AGP A;  2R92 A;  1CKM A;  2AGO A;  2AW9 A;  3HPL C;  1Q7Y W;  1M5I A;  1VQ6 V;  1WAZ A;  4TV9 B;  5KX5 F;  4DV1 O;  4N23 A;  3ETQ A;  4DV6 O;  2HHF B;  5KFG A;  3ZMT A;  3H1K H;  1O9G A;  1IOV A;  1FFX B;  5KFO A;  1K5Q A;  3CC4 V;  1S5H C;  2QKA A;  4DR3 O;  4G28 B;  3N6R A;  2HGW A;  1KEE A;  4QNH B;  1EFR G;  2HG5 C;  1I08 A;  5LGN A;  2AZ2 A;  2Y69 C;  3KG2 A;  4HNA B;  5KFB A;  3WO1 A;  4O83 A;  4X1I B;  4A3I G;  3GJX B;  4GKK O;  3RTX A;  1OCO C;  3TII A;  4X65 H;  5LP6 B;  5CAE B;  4DW1 A;  4MTO A;  3U0Z A;  4DV4 B;  4F50 A;  1BXR A;  4F4Z A;  1UC9 A;  2IMW P;  3GIJ A;  2E2H A;  3U9S A;  2R6F A;  1RK5 A;  2DWC A;  4A3J G;  4Z1V A;  3T1Y H;  4YR2 A;  1N4C A;  1KKD A;  3VPD A;  4IRC A;  3PZP A;  3JAR B;  4TV9 A;  2FB5 A;  4KL1 A;  1BQZ A;  5DM6 V;  2HHF A;  5C8Y F;  1KC7 A;  1XDC A;  5H9C A;  4B3T H;  1FFX A;  3MWE A;  3BEH A;  3AG1 C;  3HOZ G;  2FLN A;  3CVZ A;  4X1K A;  2OTL V;  2R7L A;  3AYH B;  1PNK A;  4HNA A;  4LF8 O;  2AZ0 A;  1BCC H;  2CKZ B;  3G6V A;  1EZV H;  4X1I A;  2R9A A;  2V9W A;  3HOW G;  5J2T F;  3VNN A;  2LP7 A;  1BQ0 A;  3BFR A;  3RBE A;  4IIJ A;  1K73 W;  2UXB H;  2DJV A;  2I87 A;  5DIS C;  1Y1W G;  5EIB D;  3TXQ A;  4AQY H;  4FLU A;  4EBD A;  3PW5 A;  2XTA A;  3MR6 A;  2ZXW C;  3CX5 F;  4O4L A;  2PMZ E;  3CCR V;  1M0T A;  4PWQ A;  2BR0 A;  3OAA G;  4GC7 A;  1G2W A;  2DWE C;  3ZHQ A;  3HKE B;  3L2P A;  1EM1 A;  2D2C B;  5EZY A;  2W9B B;  1TUB A;  4WBN F;  3BPZ A;  1SS3 A;  4DUZ B;  4JI8 O;  1NTZ H;  4CC5 A;  4DV4 O;  3JAM W;  3S3W A;  2BCC H;  4JYY A;  1KT8 A;  5KFL A;  5EC2 C;  1AI6 A;  1I5Y A;  4HBN A;  4EYI B;  1A32 A;  5JQG B;  3T5H A;  1V9P A;  2F93 B;  1NR1 A;  4YIO A;  1SA0 A;  2JA6 A;  4JTC B;  2P06 A;  2F23 A;  4MVS A;  4TQR A;  1WPB A;  1OCC C;  2RDI A;  4J10 A;  4GCZ A;  4U7N A;  1SRY A;  1RPO A;  4O2B F;  4LF7 B;  5C1O A;  4IWX A;  5CBG A;  3F7V C;  1JLL B;  1VF7 A;  1FXK A;  2HR3 A;  5LA6 F;  5A2Q N;  4X64 H;  2C2D A;  2NU9 B;  4IHJ B;  4DL6 A;  4FFP A;  5CA1 F;  4RNN A;  2RNB A;  4JYB A;  2DMX A;  5CBF A;  4PZ6 A;  1M6V A;  5LHI A;  4JI3 H;  4PBC A;  1V51 A;  1JQ0 A;  1M9N A;  4GZR B;  3BAC A;  4Q44 A;  5IYB O;  5I47 A;  2JIZ G;  5JCO A;  2CAZ C;  4D7T A;  4ZOL A;  4O3Q A;  3T1Y O;  4JV0 A;  5CBH A;  1B6Q A;  5A9G A;  5KFX A;  4ECW A;  3WB1 A;  5FD6 A;  4ED6 A;  1COW G;  4FMT A;  3VOU A;  4UV8 A;  1XNR H;  2EZO A;  1Y1W A;  1JR9 A;  3UO3 A;  2UXN A;  4DK1 A;  1IBL B;  3OR6 C;  4OPA A;  4O2A A;  5LOV F;  5IJ9 B;  5B66 Z;  4K35 A;  2QWN B;  4UCR A;  4DUZ O;  5KFM A;  4NVP A;  3TW6 A;  5L3B A;  2Z5U A;  1PPJ H;  3LUT B;  5D1O A;  3ABL B;  2ZGI A;  5EYP B;  4B3R H;  4J7J A;  4IWY A;  3RUP A;  4IHJ A;  4KFM A;  3HXL A;  1EKP A;  1VBG A;  3JAL A;  2XT9 A;  3L72 H;  4AQY O;  4YY3 B;  5J2U A;  3KXY T;  4APM A;  4NTW A;  1K97 A;  2E3C A;  5B5E Z;  1K7D A;  3D36 A;  2E75 B;  4RAI A;  1K1S A;  5KT6 A;  2J6S A;  3RB0 A;  3CEB A;  5CA3 A;  5FNV B;  5CM0 A;  1T3N A;  1ORQ C;  4GT1 A;  2R7M A;  2DQ0 A;  4YAJ B;  2EIM B;  4EGJ A;  5IYC O;  5DN6 G;  1R3K C;  1XIL A;  4J80 A;  3QVN A;  4NB5 A;  5KAF Z;  4X20 B;  4E4E A;  1Z2G A;  4X1Y A;  3SYA A;  2YIB A;  2ADP A;  2WAQ A;  2MK3 A;  3FAV A;  3JAS A;  5C5J A;  1XEQ A;  3BA8 A;  5BWW A;  1L0N H;  1H8E G;  3RT3 C;  2CH7 B;  2ZE8 A;  4PDM A;  4F4X A;  1CEZ A;  1DV1 A;  1P4R A;  1XMQ B;  1E1Q G;  2VQF B;  1KP2 A;  5CB4 B;  1JIH A;  3OEE G;  5FPO A;  1ZTE A;  4I55 A;  4EQ5 A;  3E86 A;  3TW7 A;  4A93 G;  4JI5 B;  5BPF A;  2R93 G;  4X64 O;  4DL2 A;  2W8L A;  1IZ3 A;  1BZK A;  4JV1 A;  1I1M A;  1IX9 A;  4DL7 A;  2XC9 A;  4TSF G;  1S76 D;  4Q20 A;  3BCC H;  3T1H B;  2ASJ A;  2GDS A;  2Q7G A;  3HR0 A;  4J9Z B;  4JI3 O;  2W57 A;  3DGE A;  3IG0 A;  4R8C A;  4PDV A;  3ZJZ A;  2GBO A;  1I1L A;  2OT5 A;  1NI8 A;  1VAR A;  4PJ0 Z;  3R66 A;  4ZHQ A;  4X20 A;  1TWA A;  3DF7 A;  3GIQ A;  1U97 A;  4FLW A;  2P4V A;  3STZ C;  4C5B A;  2QYZ A;  3RGB A;  2ARH A;  2M7W A;  1EHI A;  5KFJ A;  1RYR A;  3SPC A;  3ZHT A;  4NXN H;  5JQG F;  1SF9 A;  2V1D A;  4O3S A;  1MZB A;  3NXS A;  2AU0 A;  1CKN B;  1J5E B;  3QO5 A;  2ZIN A;  5TIS Z;  4PDB A;  4HNU A;  1M4U A;  1RK6 A;  1XNQ H;  1K4D C;  2OCC B;  4Z1M G;  1Q81 W;  4RUA A;  1K4C C;  4B3R O;  2DZD A;  1Y4M A;  3QQM A;  2C22 A;  4DQN A;  2IA6 A;  2B63 G;  3H0G A;  3TQT A;  2CGO A;  2VQF O;  4K0K B;  1WRV A;  4X9Q A;  2V59 A;  1OHH G;  4ZBM A;  4X62 B;  1JA8 A;  5BMV F;  3EVK A;  5FJ8 G;  1Z2O X;  2DWD C;  3V4Z A;  2IH1 C;  1G1X B;  2RQ6 A;  3D3I A;  4DR1 H;  3RFC A;  1ZLZ A;  1B3Q A;  2OH2 A;  3U55 A;  4I50 B;  2O03 A;  2QDO A;  2R93 A;  1U96 A;  4MVQ A;  1PX2 A;  4U3J B;  3OTF A;  4DXW A;  1Q8I A;  1HNZ B;  1NKD A;  1CKN A;  3ETJ A;  3WNZ A;  3LNM B;  1TWG A;  1XMO B;  4CKB A;  4Q4D A;  3CSX A;  2ADQ B;  3CB2 A;  4RQF A;  2HIV A;  4O4H A;  1KJ8 A;  1E1R G;  1I7F A;  3ZX6 A;  3M9O B;  2EIK B;  2Q73 A;  4LC1 A;  3UZB A;  1DTO A;  1ZSP A;  3AEI A;  1WNS A;  4RB2 C;  4GLW A;  5KAI Z;  3CCL V;  4DRX A;  2RGV A;  3ETG A;  2X6C A;  1F7Y A;  1WSC A;  3CCV V;  5BWU A;  1AVM A;  5B1O A;  4ABM A;  2HHH H;  1V55 C;  1H2K A;  2GHY A;  1N32 B;  2ZDQ A;  4JAA A;  3T54 A;  4YQW A;  1DLB A;  2A0L A;  4I9Q A;  1NR7 A;  4WHX A;  4GX1 A;  1G8M A;  4FK5 C;  4CH5 A;  2B63 A;  5I5W A;  4CBC A;  2Z0A A;  2YS6 A;  4DR7 H;  2IJI A;  5KFR A;  1S0O A;  5CB4 F;  2JEI A;  3T7A A;  1I1K A;  1W93 A;  4LF4 B;  4GX2 A;  4QWD A;  3W7W A;  3PN1 A;  2AQ4 A;  4UUJ C;  3HOY G;  2ITC C;  1S03 G;  1XMO O;  5KFQ A;  1KYO F;  3GTQ A;  4YJ3 B;  4FLV A;  4M0J A;  4IAJ A;  1Y14 B;  3TK1 A;  3MFI A;  1KJ9 A;  4EB6 A;  3OGI B;  2PGG A;  3P30 A;  3OSN A;  2WAM A;  3N2K B;  2CTW A;  3GVM A;  4QWA A;  4J9O A;  2RGR A;  5I5S A;  4CH6 A;  4L87 A;  4FM9 A;  1SQB H;  3HKC A;  2KG7 A;  1N33 B;  4JYC A;  5F2V O;  4B3M B;  4J9Y B;  3V4S A;  5D8D A;  2YSU B;  4H44 B;  3MD0 A;  1VEW A;  4PA3 A;  2DYR B;  3GTL A;  3W7X A;  3K06 A;  3HKB B;  1N32 O;  3VMM A;  3JD2 A;  3CCS V;  1KMI Z;  1Q5O A;  4DV7 B;  1HDJ A;  4K8X A;  2W9A A;  2X7R B;  1VIB A;  3Q8Q B;  2GSM B;  2ZDG A;  3RW0 A;  4ZI7 A;  2W0F C;  3SJQ C;  1S72 V;  4NXM H;  3OUS A;  2JS3 A;  1N36 H;  1FYJ A;  3VQW A;  4DYL A;  4WFE A;  4O4I B;  1B06 A;  4G3I A;  5KFH A;  3HKD A;  2YIB D;  4ZKI A;  3GII A;  4I0X A;  1KJJ A;  4I7H A;  4KHP H;  3P3N A;  5CMU A;  2YL2 A;  1NVP D;  3STL C;  4A3C G;  2XHB A;  1KKC A;  5IT9 W;  4LFB H;  3C3T A;  1AR1 B;  4JI7 H;  2COG A;  1D5N A;  3CS5 A;  3ORR A;  2QM8 A;  2LW1 A;  4PA6 A;  4I50 F;  1NS1 A;  1PP9 H;  2B5U A;  3X2Q C;  2ZE5 A;  3I55 V;  4C5A A;  1I7L A;  5KFC A;  3CRM A;  3IC7 A;  4FVM A;  3UYY A;  1A0G A;  4LMY A;  2W0X A;  5DED A;  4GLX A;  1N33 O;  2ZM6 H;  3GTM A;  4JXU A;  4CKE A;  4B3M O;  4D6T H;  2NVY A;  1H2M A;  4CE5 A;  1TWC A;  3SPH A;  2XAJ A;  3PW7 A;  2YDE A;  2FMA A;  5IE9 A;  2KQX A;  4FLX A;  1GN2 A;  1M1K W;  2PY5 A;  3GB7 C;  4PDR A;  2WLL B;  1YVW A;  4DV7 O;  2VUG A;  5JVL A;  4ICG A;  4A3F G;  4JAU A;  1FJG H;  1YF2 A;  2EIN C;  3LSS A;  2QA4 V;  2QWR B;  3CXC U;  1PV0 A;  3GLK A;  1VQM V;  4TUY B;  2IM9 A;  4J11 A;  4G2K A;  2BE3 A;  1WA8 A;  4RNO A;  1LNQ A;  2OWO A;  2ZNJ A;  3TY9 A;  5I5U A;  4B7K A;  2WLM A;  1EUD B;  3KRE A;  3FB7 C;  2V4R A;  3RB3 A;  1AR4 A;  1H8H G;  3UKM A;  5KFS A;  5JH7 B;  2QEX V;  3ETD A;  3B8M A;  2ZD9 A;  1A3G A;  3QO7 A;  1XHX A;  4J9Q A;  1P84 F;  2XGP A;  5EBM C;  4LFC B;  5BYA A;  5KT2 A;  4JI6 B;  3RYF A;  1PK8 A;  1MOF A;  4I4T A;  3K0G A;  1QNM A;  1OCR B;  1Y6X A;  2WLL A;  3RIZ A;  2XAH A;  4NXM O;  2R7K A;  3KAL A;  1BE3 H;  3VQV A;  1S77 D;  2PN1 A;  2UXD B;  2R8G A;  3H1J H;  5LMN H;  3Q4H A;  4M7E A;  4WFH A;  2W6I G;  2ZDI C;  4Q0Y A;  3T4D A;  2EIL C;  1N34 B;  1NT2 B;  5KFK A;  5KFZ A;  1S9F A;  2QM4 A;  3B2E E;  1VQ7 V;  1PM9 A;  1YDX A;  2Y0S A;  1EZJ A;  2YI9 A;  4BIZ A;  4DV6 H;  5EOY A;  1DIK A;  1B04 A;  1YXB A;  5BR8 B;  2JJ2 G;  3ZRV A;  3TXS A;  1ROP A;  2DYS C;  3L71 H;  5DEC A;  2N74 A;  1XDN A;  4DR3 H;  1FD9 A;  2EIM C;  2K9P A;  4JI7 O;  4LF6 B;  4ECV A;  4R6Z A;  5EBL C;  3LML A;  2Q2U A;  3E2E A;  1R3J C;  1C3O A;  4EEY A;  2R92 G;  5KT5 A;  4MVU A;  4TWK A;  3KZI Z;  4JPR A;  2MW2 B;  4LNU B;  1JFF A;  4FFN A;  2ZM6 O;  1JPX A;  4UCU A;  3CD6 V;  3M4I A;  4WD3 A;  3MR5 A;  4AHC A;  5KX5 A;  4RAZ A;  3T5J A;  1GH6 A;  4FM0 A;  4GKK H;  3N43 B;  1C30 A;  1BGY H;  5BWT A;  1DF4 A;  5LMN B;  1XK5 A;  4A3M G;  2FPP B;  2GPS A;  1YTF B;  3JZI A;  3C0F B;  4O7Y A;  2W7O A;  2UU9 H;  3T9F A;  2F4V B;  3B09 A;  1HR0 B;  2R82 A;  1I3Q A;  4JI6 O;  4MV9 A;  3A0B Z;  2XND G;  4QIW F;  4DV0 B;  4CS4 A;  2R8J A;  3UQ8 A;  2CQY A;  1Z5W A;  1CPY A;  1HP8 A;  4A5U B;  3CPW U;  1KU9 A;  2UXD O;  3C3S A;  1S68 A;  2AGA A;  2B1I A;  1EN6 A;  3M99 B;  4C5C A;  2ODT X;  3RV4 A;  2W6Q A;  5DAA A;  5L1L A;  4P9P A;  1GSH A;  2PBZ A;  1F4N A;  1VQL V;  4BBR G;  2Y4U A;  5JQW A;  3N27 A;  4LNU A;  3ZRS A;  3CCJ V;  3KHR A;  5BR8 O;  3I4M G;  4RZR A;  2PZS A;  2UU9 B;  2X5R A;  5FPR A;  3CC7 V;  3GIK A;  3ML0 A;  2R8H A;  2OLS A;  1M7J A;  1MZF A;  4DV3 B;  2YEV B;  3MWM A;  1QBZ A;  1KBH A;  4BY7 G;  3Q8R B;  3CJH A;  3T5K A;  4R50 A;  3AG4 B;  3JZF A;  5J2T A;  4J9L A;  1E4E A;  3AK1 A;  2FK1 A;  4WFG A;  3RYC B;  5DG8 A;  4NLG A;  3E8G A;  3FKI A;  5LMN O;  3R5X A;  1LUW A;  2E74 B;  4DV4 H;  3DTG A;  3WFV A;  3L70 H;  4PZ8 A;  1R6K A;  1AI4 A;  4MVZ A;  4J9N A;  2F4V O;  4TUY F;  2YRW A;  2VUM G;  4QE9 A;  3O65 A;  2C00 A;  2ZR3 A;  1EN5 A;  4BWA A;  5IT9 N;  5CA0 F;  4R7R A;  4DV0 O;  3E35 A;  4YJ2 B;  3SPJ A;  5KFV A;  4O4J A;  1FXV A;  2E2I A;  3BAB A;  3W5O A;  5JH7 F;  4Z2W A;  4X1K B;  4WBN A;  2IJK A;  1XL4 A;  3OR7 C;  2LQT A;  5GON B;  1KUT A;  2BSK B;  1GSO A;  4WFA V;  4PA4 A;  2JRI A;  3ABM C;  4IIJ B;  3K9S A;  2YEV A;  3O9O A;  3ZCC A;  2JA6 G;  1YIT V;  4ECT A;  3U11 A;  3KCY A;  3Q1K A;  2FL4 A;  1P8L A;  3AG3 B;  2H3O A;  4FFO A;  4CS2 A;  2P5O A;  2W71 A;  3SYO A;  1QR9 A;  3P32 A;  3D8C A;  1M90 W;  1SQP H;  2IJJ A;  4O4L B;  3DC6 A;  4O2B A;  3RYC A;  2UU9 O;  2FYU H;  4ED1 A;  2JEX A;  1TUE B;  1Z2N X;  3N6X A;  3SPI A;  4DV3 O;  5EZY B;  1TUB B;  1K9M W;  3H01 A;  2JA5 A;  4JZ2 A;  4A3D G;  1M56 C;  3ZMZ A;  1YJW V;  3OTO B;  3K58 A;  4LP8 A;  1AB3 A;  3V6J A;  4F6E A;  4JGS A;  3N44 B;  4DL4 A;  1SQV H;  5KFT A;  4YJ2 A;  2UXC B;  5BWX A;  4DUZ H;  4KXR A;  4LH7 A;  4MSW C;  3BG5 A;  4GX0 A;  4DO2 A;  1EN4 A;  1BHA A;  1SZT A;  2ODM A;  2COI A;  2YI8 A;  4NZO A;  1Q43 A;  1SA0 B;  4O3O A;  5GON A;  2BSK A;  3U10 A;  4O7R A;  3JAW B;  1CP9 A;  4DV5 B;  4QPK A;  3OT7 A;  5KFY A;  3OEH G;  2JK5 C;  3G80 A;  1FXK B;  4NKG B;  5DGH A;  4LF7 H;  4O82 A;  2Z3Y A;  5LOV A;  1FVI A;  2HGX A;  1OBD A;  2NLJ C;  4J9R A;  2EIJ C;  5LGT A;  1Q82 W;  3GIL A;  2WAQ E;  2VUM A;  1AI7 A;  4I7Z B;  3R5F A;  1NJI W;  3T9B A;  4A3E G;  2IW5 A;  1WCM G;  1GKF A;  1XL6 A;  2L35 A;  2KSW A;  2FP4 B;  3CXH F;  3ZMV A;  4BR6 A;  2QKC A;  2PF4 E;  1Y67 A;  2W6O A;  3VPB A;  3D3Q A;  1BMF G;  5L3C A;  4DL5 A;  3TET A;  4FM2 A;  5GTI Z;  4ZOL B;  3H40 A;  3B40 A;  4MAM A;  1W0K G;  3T99 A;  1QLE B;  4QWB A;  4UV9 A;  5KLV H;  3PO2 G;  5KT4 A;  4TVI A;  5EWF A;  1VF6 A;  3F5T A;  3WWI A;  3N40 P;  4DR2 B;  2DAB A;  3Q8S B;  4L8J A;  2HVS A;  4O2A B;  2ATL A;  4JAS A;  1IXM A;  4FZ0 A;  3GWK C;  4R8U A;  3JAW A;  3OTO O;  3CCM V;  1IBL H;  3DTU B;  3RWR D;  4P9O A;  5D1O B;  1OCZ B;  4ED3 A;  5B1B C;  2DN9 A;  5EBW C;  2LJ2 A;  3KAK A;  2SCU B;  1QHT A;  3WB0 A;  5KHJ A;  5K2M A;  4FZ1 A;  5IY5 C;  3JAL B;  4RAY A;  2BTQ A;  5JWP A;  5J2U B;  5HFL A;  4DV5 O;  1FAF A;  2FK3 A;  5HBR B;  3K5H A;  5KFW A;  1VQN V;  4BBS G;  4YY3 H;  4M9U A;  4Y8V B;  3RN4 A;  3KYH C;  5HV6 A;  5KG0 A;  1IDS A;  1V54 B;  4BW5 A;  3HO8 A;  3OSP A;  4CS3 A;  2MCT A;  2PUS A;  1GK9 A;  1T5E A;  5EIB C;  3DSQ A;  3RVZ A;  1IUR A;  4TV9 F;  4FBT A;  3GWO A;  4X1Y B;  4YIP A;  1N48 A;  2DQ3 A;  2VOB A;  4MA5 A;  3FAV B;  3JAS B;  2QWO B;  3TJT A;  5I5T A;  1BJT A;  1NVP B;  3MR2 A;  4PEL A;  3M9M B;  3IN5 A;  1BGW A;  1WCM A;  2DW4 A;  1H2N A;  3RR5 A;  3IFX A;  2P22 C;  1PNL A;  4I55 B;  3JCZ A;  2A79 B;  3T9E A;  4A3B G;  1XMQ H;  2VQF H;  3L74 H;  3ASO B;  5LP6 F;  3PO3 G;  5LXT B;  3ASN C;  4LF7 O;  4HAM A;  3CC2 V;  4ECS A;  1GSA A;  3DAA A;  4JI0 B;  2R9I A;  1SQQ H;  3IC9 A;  4O4L F;  4JI5 H;  4IRK A;  5H6Q A;  1JJ2 U;  3K5I A;  2WE6 A;  5DLF A;  5KG5 A;  2YWV A;  4HZ3 A;  4JI2 B;  3ABK B;  5EZY F;  3T1H H;  3H0G G;  2UUC B;  1JMK C;  4ZIB A;  5IYZ B;  4DR5 B;  4ZHQ B;  2W6M A;  3OMA B;  1WP7 A;  2QF7 A;  4XX0 B;  1QCE A;  3AG2 C;  1SC5 B;  2JEU A;  4QWE A;  5BMV A;  4W4K A;  2VR1 A;  5LYJ A;  2JA7 A;  3CWB H;  1HNX B;  1YTF D;  4HNV A;  5KFA A;  2HJF C;  4JAV A;  3NGD A;  2ZJT A;  1K3E A;  1B33 N;  1JCH A;  3T5L A;  1YHQ V;  4UCT A;  3JSN A;  1IBL O;  3E89 A;  2YCH A;  2DPJ A;  2JS5 A;  5LXT A;  1J5E H;  2C2A A;  1VBH A;  2F43 G;  2YS7 A;  4LFA B;  2ZCE A;  2PYJ A;  1AUV A;  2CNU A;  4ECY A;  1JJO A;  1CXZ B;  3PJS K;  2Q4P A;  3SR2 C;  2R9R B;  3ZRW A;  3N41 B;  5DQI A;  4CHI A;  4QW9 A;  1ZET A;  4W4L A;  1Y1V G;  5AG2 A;  3THO A;  2Q5Z A;  4YY3 O;  5IYZ A;  4K0K H;  2A1H A;  4X62 H;  3JAT A;  3EYY A;  3S24 A;  4O3N A;  2LGW A;  3G8D A;  4NYE A;  1QLN A;  3WO0 A;  1SCU B;  3W7T A;  1J95 A;  1KJQ A;  1DAA A;  5DGA A;  4FS2 A;  4GKJ B;  5LMU B;  3U9T A;  1Z5V A;  2NVX A;  4O2A F;  1NH2 D;  1KC8 W;  2YRX A;  4QJF A;  3BQ2 A;  4TM5 A;  4FE2 A;  2YZM A;  2OYQ A;  2P7T C;  4PA9 A;  2YUA A;  2ETN A;  1HNZ H;  1EKV A;  4RO2 A;  4RCN A;  2Q6A A;  4O4H B;  1HNX O;  4A2A A;  3GV8 B;  1XMO H;  3K3V A;  4IHJ F;  3H1H H;  3H9V A;  1UNN C;  1XMQ O;  3K3P A;  3G6X A;  2AHZ A;  4JI1 B;  2DOS A;  5J2U F;  2IBK A;  4I5S A;  4UVC A;  2F95 B;  4JI5 O;  4DRX B;  3GTJ A;  5IJ0 B;  2QTS A;  3LNN A;  4X66 B;  3GB8 B;  2UUA B;  5H80 A;  5F9L A;  2HLD G;  4ECQ A;  2ZIO A;  4LFA O;  3T1H O;  1H2S B;  1WPX A;  3SJB C;  1W96 A;  5BPH A;  3PVX A;  4FFB B;  2ZIM A;  2FLP A;  1N32 H;  2YW2 A;  2NN4 A;  1SFO A;  2WA3 A;  1OBG A;  2WLK A;  3L73 H;  2KSD A;  1HWY A;  5K1X A;  5LHG A;  3HB9 A;  4CH3 A;  1KJI A;  3E8B A;  1CQJ B;  1Y1V A;  3K57 A;  3OMI B;  4I55 F;  4GKJ O;  5LMU O;  2Q7E A;  4FFK A;  3CSW A;  2P67 A;  3LUL A;  2XCA A;  5BWV A;  4RB1 A;  4HYK A;  1H2G A;  1J5E O;  2Y69 B;  5L1K A;  4LF4 H;  4EFB A;  1ZL8 A;  5KT3 A;  3ZHV A;  2VQE B;  2CZG A;  2IJH A;  2EJ2 A;  5FNV F;  4JV5 B;  5KKN B;  2WLJ A;  5IJ0 A;  1OJH A;  4EB6 B;  4RWU A;  1OCO B;  3CCQ V;  2X6B A;  1IVS A;  5EC1 C;  2YZG A;  2IH3 C;  4DR4 B;  4JTA B;  3RVY A;  4K0K O;  4JI1 O;  3A2F A;  1RPR A;  3PFF A;  4X62 O;  2PYL A;  4O7L A;  1I5X A;  3HKC B;  4L1K A;  2LGQ A;  3ZN1 A;  3GV7 B;  2KG7 B;  1TVK A;  4FFB A;  1YZB A;  2B9Z A;  3TGU H;  3H4B A;  3K79 A;  4FIP C;  1JDB B;  2CDY A;  4NYK A;  4JYA B;  4ECR A;  5KHI A;  1N33 H;  4B3M H;  5EK0 A;  3EHB B;  2AGQ A;  1EUC B;  1I2L A;  4TV8 B;  4FM1 A;  2WDT A;  3RB6 A;  3UZO A;  1S5L Z;  3AG1 B;  1UFI A;  3E22 A;  5IWA B;  1AUX A;  3SNO A;  1HNZ O;  2EX3 A;  4ZI7 B;  4YR0 A;  3CCE V;  2HEP A;  4Q43 A;  3GDE A;  4DV7 H;  2L6L A;  5GW7 A;  1VQ8 V;  4B3S B;  1G6U A;  2VWK A;  2XAQ A;  1E79 G;  3CYO A;  1WLE A;  2CNV A;  4GYC B;  1EZ1 A;  1Y74 B;  1L8D A;  5LP6 C;  4LF5 B;  1GMG A;  2N04 A;  3HKD B;  4I0X B;  4E4T A;  1GLV A;  2ZXW B;  2COJ A;  4A3L G;  2E76 B;  5KFP A;  1RFY A;  3RJ0 A;  2VQE O;  2R7N A;  1AJP A;  4U6P A;  2QSA A;  2WB1 A;  2C2R A;  2YID A;  4MV7 A;  3M8A A;  5KFU A;  3R9R A;  4DR4 O;  5LGU A;  1M57 B;  4TV8 A;  3SGI A;  4WF9 V;  2W7P A;  5L3F A;  3OGC C;  1ZHQ A;  4FPP A;  3CQZ A;  2ZR2 A;  1GN6 A;  4LR3 A;  1L1F A;  4MA0 A;  1ZWI C;  4QE7 A;  4RZQ A;  4JYA O;  3W1G A;  4O4H F;  2Y0S E;  1GGO A;  4YXW G;  3H3V H;  3J80 N;  2ZKO A;  3KTM A;  4BXX G;  4EBC A;  3OE7 G;  3LSU A;  1EYZ A;  3GTO A;  3I56 V;  1S0N A;  2PVP A;  1Y74 A;  3RYH A;  4LF4 O;  1OZ0 A;  3FB6 C;  3PW0 A;  4WFF A;  4LF9 B;  4PA7 A;  5IWA O;  4J41 A;  1URF A;  4MV8 A;  3WU2 Z;  1JKJ B;  1GYF A;  4HNT A;  2FJZ A;  1RM1 B;  3KCX A;  4B3S O;  3K08 A;  4QSH A;  1K1Q A;  1XUQ A;  3CRQ A;  2FE3 A;  4DR6 B;  4CC6 A;  3CCU V;  3BY6 A;  1WA8 B;  2CTR A;  3EXA A;  1OV9 A;  5JCO C;  3H1L H;  2V4D A;  5HFM A;  1K8A W;  4KP4 A;  2Z02 A;  5FL7 G;  4O81 A;  2ZQM A;  3JD0 A;  5KG7 A;  2E5L B;  1THZ A;  4F4L A;  4QGP A;  1NU1 H;  4R7C A;  3UCS C;  3NR7 A;  3ZMS A;  2V4Q A;  4QW8 A;  1T94 A;  4DUY B;  2V58 A;  3F7Y C;  5H5N A;  4P30 A;  3RYF B;  4H33 A;  1AN7 A;  4I4T B;  1A48 A;  1OCZ C;  4LFC H;  5KFD A;  4JI6 H;  2YZN A;  3CHX A;  4F4W A;  2ATK C;  1FPO A;  3HOU G;  3GTK A;  3QO8 A;  1IBM B;  3Q4H B;  3UT5 B;  5CN0 A;  3D36 C;  2UXD H;  2CK3 G;  1PL0 A;  5DMX A;  3E5N A;  2WTF A;  1N34 H;  2CTP A;  4UCS A;  3HOX G;  3TY5 A;  2FKX A;  2NU7 B;  5DQG A;  3RB4 A;  2H8P C;  2CNQ A;  1PNM A;  4HR7 A;  3IGA C;  3FD9 A;  4QIW A;  4Q45 A;  5BR8 H;  5JVD B;  1VKZ A;  4DR6 O;  1VP7 A;  4LWS A;  5JJE B;  2AXT Z;  2UUB B;  4LF6 H;  1JFF B;  5KX5 B;  3F8N A;  1M0W A;  1AJQ A;  1UC8 A;  3ABL C;  1WB8 A;  3I4N G;  2ZE6 A;  3EFF K;  1FFT B;  3SDL A;  5KG2 A;  5KFE A;  4YJ3 F;  3ZBH A;  3FDS A;  1L2Z A;  4YR3 A;  4IGG A;  5CE8 A;  3G4S V;  3UT5 A;  1BS3 A;  1BT8 A;  3ASO C;  2JJ1 G;  4DUY O;  4DV2 B;  4PI2 A;  4JI4 B;  2J6T A;  2F4V H;  1IBK B;  3JAK A;  5C3E G;  1HR0 H;  3HKZ A;  1Q90 D;  3APO A;  3A8T A;  1SEI A;  4DV0 H;  4J7K A;  1P7B A;  1IBM O;  4CZZ A;  1IXB A;  3I12 A;  3RBD A;  3FKI G;  1I94 B;  5JVD A;  3FKS G;  4FLZ A;  1MSW D;  4ED8 A;  4J0M A;  4ED2 A;  1GRJ A;  4EEQ A;  1P49 A;  1KD1 W;  4BIU A;  1FKA O;  4C7U A;  3L75 H;  2M05 A;  5C8Y B;  4MV6 A;  2A7W A;  5J9P C;  5I60 A;  3FFQ A;  1GAX A; 
#chains in the Genus database with same CATH homology
 4YHH B;  2KSW A;  4ZHQ A;  4X20 A;  3K5O A;  2E5L H;  3DF7 A;  4DRF A;  4DR7 B;  3RGZ A;  2QJ1 A;  4FLW A;  4DV3 H;  3RGB A;  5J2T B;  3K5L A;  4FM2 A;  4ZOL B;  4DUY H;  4NXN H;  5KMG B;  1MZB A;  1CKN B;  3N40 P;  1J5E B;  2YXL A;  1RSO A;  4DR2 B;  2ZIN A;  4L8J A;  2HVS A;  4O2A B;  4PDB A;  1M4U A;  1IBM H;  1XNQ H;  2HVQ A;  3JAW A;  3BHP A;  4YJ3 A;  1IBL H;  3K59 A;  4DV1 B;  4PHZ A;  4O4J B;  3RWR D;  3TY8 A;  5D1O B;  3N2G A;  1SYX B;  4WBN B;  3N2K A;  5C8Y A;  3KAK A;  4K0K B;  1QHT A;  3SJA C;  4TQD A;  3WB0 A;  4X62 B;  1FKA H;  3QF7 A;  5KHJ A;  4RAY A;  3JAL B;  2BTQ A;  5J2U B;  4K8Z A;  1M93 A;  1Z2O X;  5JJJ B;  3L4K A;  2RQ6 A;  4YY3 H;  3RYI A;  4DR1 H;  1WN7 A;  1XI1 A;  2UUB H;  3KYH C;  1SKV A;  4O2B B;  1Z2P X;  4CS3 A;  2MCT A;  2PUS A;  3HKB A;  5KMG A;  1T5E A;  5EIB C;  4I50 B;  3DSQ A;  2O03 A;  5LA6 B;  3WB2 A;  3FMA A;  4X1Y B;  4NXM B;  4U3J B;  3OTF A;  1CKN A;  1Q8I A;  5JJN B;  1N36 B;  1HNZ B;  1CKO A;  1O75 A;  2VOB A;  1XMO B;  3JAS B;  1YEW A;  3JAK B;  1BJT A;  2CFM A;  3CSX A;  4DV2 H;  3CB2 A;  2HIX A;  2HIV A;  4O4H A;  4JI4 H;  3K5N A;  2KKW A;  1IBK H;  1BGW A;  3OTO H;  3RF2 A;  4KHP B;  1I7F A;  4O4I A;  4RB3 C;  5D5Q A;  3RR5 A;  2UXC H;  2P22 C;  4I55 B;  3N42 B;  2R70 A;  1XMQ H;  4LFB B;  4LF8 B;  1WNS A;  2VQF H;  4RB2 C;  4JI7 B;  5LXT B;  1I94 H;  4DRX A;  2RGV A;  4F6R B;  4E6N A;  4JI0 B;  4JI5 H;  4DV5 H;  2HHH H;  5LOV B;  2WE6 A;  1O9H A;  5CA0 B;  2ZM6 B;  1N32 B;  4JI2 B;  1S5J A;  4OX9 B;  3T1H H;  1HNW H;  2UUC B;  1JMK C;  3JSL A;  4PI0 A;  4ZIB A;  5LA6 A;  4ZHQ B;  5IYZ B;  4DR5 B;  3H20 A;  4I9Q A;  2Q2T A;  4TQF A;  4YHH H;  4Q6G A;  4CH5 A;  5CA1 A;  3NBY B;  5BMV A;  1Q3E A;  5LYJ A;  4DR7 H;  1HNX B;  4JI8 B;  1X9N A;  2ZJT A;  4LF4 B;  1FJG B;  3RFR A;  4ETS A;  3PN1 A;  4UCT A;  3JSN A;  2YCH A;  4EFE A;  1S03 G;  4CH4 A;  2JS5 A;  4YJ3 B;  4FLV A;  4IAJ A;  5LXT A;  1J5E H;  4DR2 H;  4F6R A;  3M7M X;  4TUY A;  2Q7H A;  4EB6 A;  2PGG A;  4LFA B;  2ZCE A;  3N2K B;  2PYJ A;  5FD5 A;  2RGR A;  1HNW B;  1JJO A;  3KAJ A;  3SR2 C;  3N41 B;  4DV1 H;  3BAA A;  5CA0 A;  1HW7 A;  4CH6 A;  1ZHS A;  4FM9 A;  2BTQ B;  3HKC A;  3THO A;  3RGX A;  1N33 B;  4K0K H;  5IYZ A;  5JH7 A;  4X62 H;  1TA8 A;  1ZAU A;  2ZNI A;  4B3M B;  1A0I A;  3JAT A;  4X65 B;  3EYY A;  3S24 A;  3RYI B;  4LSA A;  5A2Q W;  5LP6 A;  2CW7 A;  2R72 A;  3HKB B;  1E4F T;  4GKJ B;  5LMU B;  1KMI Z;  1Q5O A;  1Z5V A;  4DV7 B;  3T1Y B;  4K8X A;  4ZI7 A;  2PTM A;  2OYQ A;  4NXM H;  2BTO A;  5ITZ B;  1HNZ H;  4B3T B;  1N36 H;  3VQW A;  2RJZ A;  4O4H B;  4BWS C;  3JAR A;  5KHG A;  4DV6 B;  4A2A A;  1XMO H;  3K3V A;  2CW8 A;  2HGS A;  4UCO A;  4O4I B;  4MTD A;  4DR3 B;  3HKD A;  2YIB D;  3SJC C;  4JI1 B;  4I7H A;  4KHP H;  2F95 B;  2UXB B;  1SQF A;  3ZED A;  4DRX B;  2JGU A;  2XHB A;  5IJ0 B;  5IT9 W;  4X66 B;  3LNN A;  4AQY B;  3GB8 B;  2UUA B;  4LFB H;  4LF8 H;  4GKK B;  4JI7 H;  2ZIO A;  4AIL C;  2YIA A;  1H2S B;  2Q0A A;  4FLY A;  3SJB C;  5K1P A;  1VS0 A;  4JI0 H;  5D1P A;  4FVM A;  4FFB B;  4LMY A;  2ZIM A;  4GLX A;  1XHZ A;  1TAE A;  3BA9 A;  2ZM6 H;  1N32 H;  4JI2 H;  4OX9 H;  2UUC H;  3HKE A;  5CA1 B;  4DR5 H;  3J7A K;  4UFZ A;  5BMV B;  5K1X A;  5LYJ B;  5ITZ A;  4CH3 A;  4UCV A;  4DK0 A;  3L4J A;  3K57 A;  4FLX A;  1TGO A;  2PY5 A;  2Q7E A;  5KHK A;  1QQC A;  1HNX H;  4RB1 A;  4JI8 H;  2VUG A;  4LF4 H;  1FJG H;  1CKM A;  5JQG A;  4EFB A;  2VQE B;  1M5I A;  3NBZ B;  4TV9 B;  4JV5 B;  5IJ0 A;  3ETQ A;  2IM9 A;  4TUY B;  4EB6 B;  2OWO A;  4X64 B;  1O9G A;  1FFX B;  2ZNJ A;  4DR4 B;  3TY9 A;  3A2F A;  1SQG A;  2PYL A;  4LFA H;  3HKC B;  4JI3 B;  1TVK A;  4FFB A;  4HNA B;  5JH7 B;  4X1I B;  3JAT B;  4JYA B;  1N33 H;  5KHI A;  3GJX B;  3RTX A;  1I6U A;  1XHX A;  4B3M H;  4LFC B;  4X65 H;  5LP6 B;  4JI6 B;  3RYF A;  1XQ8 A;  4DV4 B;  3U0Z A;  4TV8 B;  4I4T A;  4FM1 A;  2WDT A;  4TOI A;  3E22 A;  5IWA B;  1XNR B;  3RIZ A;  1E4G T;  3KAL A;  4GKJ H;  2EX3 A;  4ZI7 B;  3J80 W;  3VQV A;  5LMU H;  2HEP A;  2UXD B;  3GDE A;  4DV7 H;  3T1Y H;  5LMN H;  4B3S B;  4M7E A;  4Q0Y A;  1N34 B;  1NT2 B;  1G6U A;  2VWK A;  3BRC A;  3JAR B;  4KL1 A;  4TV9 A;  2QM4 A;  4GYC B;  3B2E E;  5IJ9 A;  5LP6 C;  1L8D A;  4LF5 B;  4B3T H;  1FFX A;  2YI9 A;  4B3R B;  4PZ7 A;  3HKD B;  4DV6 H;  3QWU A;  5EOY A;  1B04 A;  5BR8 B;  5EYP A;  3CVZ A;  4X1K A;  1DGS A;  1XDN A;  3J81 W;  4DR3 H;  4HNA A;  1P16 A;  2WYO A;  3RJ0 A;  4JI1 H;  4X1I A;  4LF6 B;  2R9A A;  3MAQ A;  3LML A;  3VNN A;  2Q2U A;  4IIJ A;  2UXB H;  4MV7 A;  5DIS C;  5EIB D;  4LNU B;  4X66 H;  1JFF A;  4AQY H;  2UUA H;  4FLU A;  4UCU A;  3M4I A;  4GKK H;  4AHC A;  5FNV A;  5KX5 A;  4TV8 A;  4RAZ A;  4FM0 A;  3N43 B;  3SGI A;  2VWJ A;  3ZS8 C;  1ZHQ A;  4O4L A;  5LMN B;  1XK5 A;  1M0T A;  4LR3 A;  4RZQ A;  3HKE B;  3L2P A;  3W1G A;  3C0F B;  2UU9 H;  2F4V B;  4FLT A;  5EZY A;  2HVR A;  1TUB A;  1HR0 B;  3BPZ A;  4DUZ B;  4MV9 A;  4CC5 A;  3JAM W;  4DV0 B;  3RYH A;  4CS4 A;  3UQ8 A;  4LF9 B;  1Z5W A;  4HBN A;  1GYF A;  1KU9 A;  5JQG B;  3ICX A;  2XIG A;  1V9P A;  2F93 B;  5CB4 A;  1S68 A;  2GV9 A;  1SA0 A;  2JVD A;  2FE3 A;  4DR6 B;  4CC6 A;  4A2B A;  1WPB A;  3K5M A;  3W1B A;  2VQE H;  4LF7 B;  5JCO C;  4JV5 H;  1VF7 A;  3QG5 A;  2V4D A;  4LNU A;  2VPS A;  4X64 H;  4DR4 H;  1TVK B;  2PZS A;  4IHJ B;  2UU9 B;  5FPR A;  2E5L B;  4LH6 A;  4PZ6 A;  4JI3 H;  4DV3 B;  4BW9 A;  3MWM A;  4DUY B;  4NXN B;  4JYA H;  3RYF B;  1X4T A;  2CAZ C;  4I4T B;  4D7T A;  5JCO A;  5J2T A;  1AN7 A;  4ZOL A;  4LFC H;  3RYC B;  3E22 B;  4JI6 H;  3CHX A;  4DV4 H;  3WB1 A;  5FD6 A;  3QTC A;  4PZ8 A;  1IBM B;  1XNQ B;  1XNR H;  3UT5 B;  5IWA H;  4DK1 A;  1IBL B;  4O2A A;  2UXD H;  5IJ9 B;  4UCR A;  4B3S H;  4MTE A;  4BWA A;  4NVP A;  4R7R A;  1N34 H;  4UCS A;  4YJ2 B;  1WH2 A;  4O4J A;  3TY5 A;  5D1O A;  4LSX A;  3BAB A;  3W5O A;  4LF5 H;  5EYP B;  3VQX A;  4X1K B;  4WBN A;  5KHH A;  4B3R H;  4IHJ A;  3NC0 B;  5GON B;  5BR8 H;  5JVD B;  3HXL A;  3JAL A;  5D5P A;  5JJE B;  4YY3 B;  5J2U A;  4IIJ B;  4RB0 A;  4DR1 B;  3KXY T;  4APM A;  2UUB B;  2E3C A;  4LF6 H;  1JFF B;  3U11 A;  2F66 C;  3VQY A;  1P8L A;  5KX5 B;  5FNV B;  4CS2 A;  2P5O A;  1M0W A;  3F8N A;  1D5A A;  2F1M A;  4O4L B;  4O2B A;  3RYC A;  1Z2N X;  3N6X A;  4I50 A;  1L2Z A;  3IAY A;  4X20 B;  4X1Y A;  5EZY B;  1TUB B;  4U3J A;  3UT5 A;  2YIB A;  4DV2 B;  4B08 A;  4PI2 A;  4JI4 B;  3JAS A;  2F4V H;  1IBK B;  3JAK A;  3OTO B;  3K58 A;  3RYH B;  5LL6 b;  3BA8 A;  3N44 B;  1HR0 H;  4YJ2 A;  2UXC B;  4DUZ H;  4LH7 A;  4DV0 H;  1SEI A;  1XMQ B;  2VQF B;  4D7S A;  2YI8 A;  5CB4 B;  1Q43 A;  1SA0 B;  4LF9 H;  5GON A;  5FPO A;  4I55 A;  4EQ5 A;  1I94 B;  5JVD A;  4FLZ A;  3U10 A;  4J0M A;  3JAW B;  4JI5 B;  4DV5 B;  4EEQ A;  2HHH B;  1P49 A;  4DR6 H;  5FLX W;  3N2G B;  4LF7 H;  3T1H B;  5C8Y B;  5LOV A;  1FVI A;  2Q7G A;  2W57 A;  3FFQ A;  3IG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...