5FPOA

Structure of bacterial dna ligase with small-molecule ligand 1h- indazol-7-amine (at4213) in an alternate binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
307
structure length
305
Chain Sequence
b'DLSSRVNELHDLLNQYSYEYYVENPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
molecule tags Ligase
source organism Staphylococcus aureus
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
total genus 100
structure length 305
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fpoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fpoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fpoA02
4JI1B 3W5OA 4DRFA 3JSLA 1TA8A 3TY9A 2HIXA 3QWUA 4JI3B 1HNXB 2UXCB 4DUYB 2VQFB 4LF8B 2E5LB 3BA9A 4EFEA 4LF5B 1FJGB 1XK5A 4DV2B 1X9NA 4DR3B 2UUCB 4K0KB 4GKKB 1VS0A 4JI2B 4DV1B 5BR8B 4LFCB 4LFAB 4TOIA 4UFZA 4DUZB 2F4VB 1XMQB 2UXDB 1DGSA 1N36B 4JYAB 1N32B 4UCVA 4PZ8A 1XNQB 4X62B 3S24A 4EQ5A 4PZ6A 4E6NA 5D1OA 2HHHB 2HVRA 1CKOA 3NC0B 4LF7B 4LH7A 4UCTA 3KYHC 4DR4B 4NXMB 3NBYB 3GDEA 3RR5A 5D1OB 4X65B 5LMUB 1N33B 2UXBB 2HVSA 2UUBB 4B3MB 4JI5B 3GJXB 4JI0B 1XDNA 2HVQA 3TY8A 2OWOA 3W1BA 1I94B 1HNWB 4PZ7A 2ZM6B 4GLXA 3PN1A 3JSNA 3BAAA 1HNZB 3VNNA 4UCSA 4X64B 4EEQA 1TAEA 5FPOA 2UUAB 4CC5A 4DV3B 4JI4B 4UCUA 1IBKB 1P8LA 4DV0B 4UCRA 4LH6A 4JI7B 4B3RB 5DISC 4CC6A 3L2PA 2Q2UA 1ZAUA 4DV5B 4DR6B 1CKNB 5IWAB 2HIVA 4OX9B 3BABA 4JI8B 1CKMA 1FVIA 1B04A 3OTOB 4LF6B 1IBMB 1N34B 4AQYB 1P16A 4B3TB 4YHHB 2VQEB 4DR2B 4YY3B 4EFBA 4NXNB 4LF9B 1XMOB 4X66B 4B3SB 4GKJB 1A0IA 4DV7B 1XNRB 3W1GA 2VUGA 3SGIA 4DR5B 3T1HB 1V9PA 4LFBB 4DV4B 3T1YB 3RTXA 4JV5B 4KHPB 4DV6B 3TY5A 3NBZB 4DR1B 3GB8B 2CFMA 1S68A 3BA8A 5D1PA 4DR7B 1IBLB 1HR0B 4LF4B 3UQ8A 1J5EB 1CKNA 2Q2TA 2UU9B 5FPRA 4UCOA 5LMNB 4JI6B
chains in the Genus database with same CATH superfamily
4LF7H 4YP3A 4IIJA 3RYHA 4O7WA 3UFXB 5KA6A 3Q1KA 2A1HA 3ETGA 4NXMO 4BR6A 1W0JG 2YXYA 2YSUB 4X65O 1G8MA 5LHIA 2JRIA 2CQYA 3ASNB 4GLWA 4C5BA 1VF6C 1A32A 4JI1O 2XHBA 5BR8H 1QCEA 3CX5F 4H13B 1MSWD 3QO5A 2KG7B 5BMVA 2UXNA 3CXCU 4JGSA 5LP6C 5KFYA 3OEEG 2R84A 3DSQA 3HKDA 1SQBH 4H44B 4ED1A 1R6KA 1CQIB 4J7JA 2R92G 2XAJA 4N23A 4DV7H 4PELA 2WDTA 1H2NA 1XL4A 1C3OA 4O2BF 1OBGA 2C2AA 3E8GA 5LA6F 3JASB 2H3OA 1PNMA 3R5HA 1M90W 4DR2H 3H1KH 4DR5O 1F51A 1YHQV 4A3LG 3FYIB 4ZOLB 3DXRB 4KHPO 5CB4B 4Q4CA 4TUYF 1FS0G 5JCOC 1A48A 1NR7A 3JARA 3ZHVA 4ED2A 5CA0A 3GTOA 2FB5A 1YJ9V 1JDBB 3TINA 1ULZA 4DAAA 2A79B 1M7JA 1XREA 3KCYA 2ADQB 4FZ0A 2Q7GA 2J6SA 2NU6B 4OX9O 4DV0B 4JI4H 2UUAH 3KHLA 1T5EA 4X64H 5FD6A 3T5LA 1NJIW 3ASNC 5KT4A 2IM9A 4YAJB 4MV8A 4M0JA 1OCRB 4R7RA 4NTYA 1XMOO 4DR6B 4PHZA 4RB3C 4O4LF 1DAAA 2W7PA 1VAJA 4JI0H 3VA7A 2GUZA 5KFEA 5E79Z 3J80W 4J9ZB 4DV0H 5KT2A 4O4JB 2XGPA 4DR4H 3JAMW 1OWTA 3CMAV 1AN7A 1EFRG 4R6ZA 5CA1B 4FE2A 5KKNB 4I55A 3K5NA 3HT5A 1KYOF 5IYZA 3J7AU 1N33O 2QM4A 4WBNA 5BY1A 3SPCA 3C0FB 3BFRA 4R7CA 2B63A 2Z0AA 4D7TA 2PN1A 4O7SA 4DV1O 3ZHQA 3NBZB 5CB4F 3K58A 3L4KA 1GN6A 2CW7A 1KBHA 4EEYA 4WCEV 5FNVB 3MR3A 3Q4HA 1Q6HA 3BEHA 1JLLB 3T5KA 4DRFA 1Y1VG 3GWOA 4TV9B 2PYJA 1PNKA 3QWUA 2GBOA 4JI6H 4QPKA 2UXCH 2JA8G 3N41B 3BJYA 5EYPB 1L2ZA 5LOVB 3WU2Z 3THOA 3GB7C 2Y0PA 3OW2U 5JVDF 2LQTA 2PF4E 4UVBA 5K1XA 4YJ2F 4O4JF 5JUMA 1KTAA 5C5JA 3N2GA 2ZM6O 3M9OB 4LF4O 2F43G 4R8UB 3D3IA 3A2FA 5IJ9A 1E4FT 4UCTA 2YIAA 1PKXA 4LSAA 1N32O 2RNBA 3WWJA 4UVCA 4P30A 4QNHB 4O82A 3H1LH 2UXBB 1SRYA 3AG2B 4K6NA 4U7NA 2P7TC 4CH4A 2CAZC 2PYLA 1TWHA 3SYPA 3TY8A 4ZKIA 2CTPA 4PA3A 4PZ7A 3GIIA 5JQGB 1W2BU 4CBCA 3EFFK 4AHCA 2RCVA 3V6KA 3ZRSA 2M05A 1EM1A 4KXRA 2W6OA 1OV9A 4LP8A 1E4EB 2W9BA 1XEQA 4GX5A 4E4EA 1JFFB 3R23A 5KAIZ 4CS3A 2YZGA 1UJWB 4LF5O 2ZDQA 4IIJF 3ABKB 3HKDB 2D2CB 1BQ0A 2W70A 1N36O 1P49A 1K92A 5JJNB 4BAYA 1VF7A 4NKGB 4LF6B 5KT6A 3PW2A 2RGVA 2XAFA 3MR5A 3QVNA 3T4DA 4YHHB 4YY3B 1IBKH 5CMUA 2IBZH 5D5QA 2VUMA 5AG2A 2XT9A 4K35A 1S5LZ 3C3SA 3CCJV 4AILC 2ODTX 3M9NB 1S0MA 1FFXB 1TUBA 3K04A 4F6EA 4B3TO 4X62H 1JQ0A 2RDJA 3RYIB 2W71A 3AX6A 2NU9B 2QF7A 1YTFD 3H1JH 1X4TA 2KSDA 1GSAA 3GB8B 4HN2A 4IHJB 1WCMA 2GDSA 2ODMA 1I5YA 1TGOA 4G27B 1XHZA 5HV6A 1KP2A 1ZX3A 2YIBA 4X1KB 2YRWA 4LF9O 1S5JA 4HNUA 4LFAO 2JA6A 1EUCB 2NVXA 3T9BA 3K79A 3NR7A 1GGOA 2G38A 2GHYA 3CCVV 2W9AA 4O83A 3H0GA 3GIQA 2Z02A 4I4TA 2FE3A 3KTMA 1TWGA 1AP6A 3ABKC 3ZRVA 2R86A 3T9EA 1M1KW 1X9NA 2F4VH 4EB6A 2FLNA 2RQ6A 1KUQA 1EN6A 4K0KH 4JF3A 3K06A 3SR2C 4GX2A 1AI7A 4TV8B 2QSAA 2A0LA 4O3QA 2LJ2A 4X1IA 2QGNA 2F66C 3CE2A 3TW6A 2JGUA 4RO2A 3K57A 4O86A 5IYCG 3ZCCA 1UNNC 2YUAA 5KG3A 5JH7A 4YY3H 5D1OB 3HKCA 1XNQO 2HJDA 4HNTA 5KG7A 4LF6H 2JA5G 4HYKA 5JVLA 1D5AA 1DIKA 1R6NA 5DQHA 1BL8A 1W59A 4IGGA 5EWGA 4DV5H 3OT7A 2CUGA 1SA0B 4X62O 5DLGA 3BCCH 3H4DA 3ETDA 4UCSA 1PNLA 4MV3A 1K8AW 4NLGA 3RYIA 3UCSC 3TQTA 5T14A 5BMVF 4YAKB 4RNOA 1JJOA 2P4VA 4RZQA 3K5OA 4J9SA 2ARHA 1OCRC 2V59A 1QU7A 3PO3G 1VQ7V 3QF7A 1YJNV 4DO2A 5KG6A 2W7OA 3H1HH 5DMXA 1Q43A 3VQWA 1GSHA 4DR1O 3T1CA 3AG7A 3OTOB 4UB8Z 4D7SA 4L8JA 5KLVH 2W6NA 4U3FH 3RB6A 2XCLA 1V54C 4JYBA 2UVRA 1BGYH 1RJRA 2PI4A 3SPIA 2DWEC 4HNAA 2HGXA 1XNRB 5KUKA 4MTGA 3P30A 4TQDA 1O75A 1I7FA 1MA1A 2OLSA 3W7TA 4DV1H 4I55F 5KMGB 1RYSA 2UUBH 1SCUB 3QFFA 5KT5A 2W6IG 2ZDGA 1BHAA 4IT5A 3T54A 4Z1VA 2UXCB 1PM9A 3RVYA 2ASLA 1NQTA 4YJ3F 4JV5O 1TWAA 4YBZB 4W4LA 4P2ZA 4ED3A 2ZE7A 5CBHA 2ABJA 2DPJA 4DXWA 4MVRA 1KJ9A 1FKAH 1WN7A 1TWCA 3CCQV 4K0KB 2K9PA 4IL6Z 4BIUA 4F6RB 4UFZA 4OXSA 4UV9A 2F4VB 3J81N 2UXDB 2QKAA 4DV6H 5JH7F 5KAFZ 3Q8PB 4LF5H 2H94A 2IJIA 2IH3C 4X64O 2UU9O 1BZKA 5DM6V 3B8MA 2R7LA 2UXXA 3FMAA 4NYEA 5F9LA 1CPYA 4DR4B 3LDCA 5KHGA 3CHXA 1SZXA 3TCUA 3ZMSA 2BSKB 3AG2C 5LYJA 4L1KA 5LP6F 3RYHB 3CC4V 2J6UA 3S3WA 3QZ8A 1JMKC 3E8BA 5EBWC 4WBNB 4Q44A 2ASDA 4DV4H 4YJ3B 4DR4O 4NZNA 5I5VA 2YU9A 2HG5C 4ASUG 1Z2OX 5IE9A 4LC1A 1UFIA 3ORRA 2QEXV 3H3VH 3RFCA 3OMAB 4JZ2A 2NNUA 5EZYF 3G6YA 4O4HB 1IBKB 4IAJA 4WFBV 2JJ1G 2F93B 1N0JA 1IBMH 1Q6UA 3HOWG 1B06A 4LFBO 1I1MA 3V4SA 5GONA 3DAAA 3N40P 3UKMA 4ECXA 4JI0O 2YXHA 1B6RA 4GKJO 1Z2PX 2DMXA 5B1AB 3GIDA 5KFSA 1KKDA 4Q4DA 4A3BG 1LUWA 1SQPH 5EBLC 2FPIB 2X6BA 2IU0A 4DR2B 3U54A 3FAVA 3CRMA 1PL0A 5B1BB 3GVMA 3TETA 2FMAA 3SJQC 5KG4A 3W1GA 2EIMC 2JGDB 2WYOA 3GV7B 4AQYO 1U97A 4MVZA 5JH7B 3LNNA 2W9BB 5DQGA 2QTOA 4JV5B 1SQXH 4KHPB 5IWAO 1SA0A 2CZGA 3RYFA 5LYJF 2UVUA 5KHIA 3WNZA 3T9CA 4FM9A 4UUGA 4K3AA 4YR0A 1VF6A 1DF4A 3IJ4A 1GO3E 1M0TA 2CTQA 1HR0B 2HGSA 2WTFA 3TQ1A 2EIJB 4O4IF 4NTXA 2XCAA 5CB4A 1BNCA 3T99A 4ZQIA 2CGOA 4JXUA 4I50B 3QO8A 1K34A 4A3IG 4DR7H 2YZLA 4DLKA 1PL4A 4F50A 2A3QA 2R7MA 4HZ3A 3GTPA 2BCCH 5B1AC 2ETNA 1DGSA 4PA6A 3CRQA 1NVPB 2Q5ZA 3I55V 4LFBH 4I0XB 4DR7O 5KFBA 2HHFA 3RGXA 5LHHA 4E6NA 4IRCA 4NXNO 3CRAA 2VQDA 1WP8A 1Y74A 2ZINA 5GONB 5B1BC 2Q0OC 2JEXA 1IXMA 4IHJA 4LH7A 5LGTA 2EJ7A 2EIMB 1PK8A 4O81A 1T3NA 5DEDA 4CS4A 3CCEV 3RB4A 4JTCB 4X65B 3CJHA 1RFYA 1P4RA 4MT8A 4ECYA 4XBFA 1S10A 4FLXA 3U55A 1K83A 4ZIBA 2X0SA 1Q82W 1JIHA 3I5DA 3R5FA 5IWAH 2HVQA 3W1BA 2VUMG 2ZE5A 4TSFG 4FLTA 3TEKA 3BAAA 1I3QA 3OR7C 1SETA 4ECZA 1ZUQA 5DAAA 5I60A 2EIJC 1TWFA 4MV7A 5ITZA 4DV3B 2ZCEA 4OPHA 3K59A 4OGQB 1AVMA 2Q6AA 1VKZA 5KFQA 3K0DA 3OM3B 1N34O 3L2PA 3DTFA 2FKXA 1LNQA 3AG3B 5EWEA 3H40A 4U6PA 4GX0A 1J95A 1AUXA 1EYZA 1CE8A 3RFRA 3CSXA 1B04A 5I47A 1K97A 1JVMA 3ZMVA 4EBDA 1N34B 1V54B 2RGRA 1XBLA 5LMUH 1FXHA 4AQYB 3H0GG 4IRKA 1H2GA 1H38A 1S9FA 4EFBA 3T7AA 4B3SB 5JQGA 4FU0A 2YZMA 2UXBO 1NS1A 2ZE8A 2R7ZG 2CTRA 5KFOA 4EYIB 4A3MG 2JEFA 4CKCA 2HHFB 3HKCB 4B3SO 1Q90D 4JI5H 2AGPA 4J80A 2ILMA 3CCUV 5H9CA 4LF4B 4IWXA 3ZHSA 2I87A 1CKNA 4TQSA 1GRJA 3CJHB 5A9GA 5IP9G 1E1QG 1M4UA 2E76B 3JD1A 1VQNV 5KFRA 4Q45A 4DUYB 4O7VA 4B3RO 4DIMA 2KSWA 3JAMN 1MSDA 2ZDHA 3MD0A 5IJ0A 4YJ2A 1FJGB 5IP7G 5DGAA 1SERA 1NU1H 1VQPV 4B7KA 2GSMB 4GKKB 1VS0A 2HJWA 2WAQA 3F8NA 4DR1H 3LSSA 2E3CA 1XMQB 5KFWA 2EJ2A 1ZHSA 3E89A 2YS8A 3AW8A 3B4SA 4LF8O 5DG7A 4XYLB 1OCCB 2P0AA 2XUMA 2HHHB 4RZRA 2COJA 4GKJH 1G4YB 1RP3B 3BY6A 1AJPA 4YIOA 3WWHA 2VA3A 3T1HO 2R92A 3JAKA 3H20A 4B3MB 3GJXB 5L3FA 1I7NA 5L1LA 1ZQ7A 5J2UA 3GTLA 3OTFA 1BGWA 2V1DA 5FNVA 4KHPH 3SYQA 3RGBA 1EBOA 5KFUA 3CWBH 3PJSK 1D5NA 1I94B 2ZIOA 2R93G 3VNNA 4X9QA 2UUBO 1SF9A 1WCMG 1KC8W 1W96A 3IG0A 2CDYA 2W6MA 1K33A 3DC6A 2HFEC 3KZIZ 4YJ2B 3SYCA 5IJ0B 3N27A 4I4TF 5GTIZ 1TVKB 4CS2A 1VBGA 2EJRA 3M99B 2IMWP 5C8YB 4PV1B 4EBEA 2P67A 4RAZA 4PDLA 5LA6B 2VQEO 3G6XA 3KXYT 1HNWH 2DQ0A 4OX9H 1N56A 4I0XA 3J80N 2WLLA 4BY7G 4DW1A 1QR8A 3OMIB 1OCCC 5FJ8G 4W4KA 1IBMB 3AK2A 5JVDA 3W7UA 1IOWA 4B7EA 3L72H 3FKIG 4QWEA 3DTUB 2QK4A 4I4TB 1PD3A 4X1YB 2EIYA 5J9PC 1S0OA 5KHKA 4IYIA 2OTJV 1YJWV 5H2FZ 5L1IA 3A0BZ 1T36A 1E4GT 1OBDA 2JA7G 3T1YB 4RCNA 5KFJA 2DYRC 4JYAH 3APQA 2EINB 4ICGA 3K3VA 4DUZH 5BYBA 1Y66A 4FM1A 2Q7DA 1K4CC 1YXBA 4J7ZA 1WPBA 4LF6O 4I50F 5K3WA 2Q4PA 3W7XA 4DV4O 5BWWA 3ZMTA 3ZEDA 2I80A 4O3NA 2VWJA 4J9MA 5BR8O 4JI2O 2WA4A 3CRRA 4FMTA 4ZHQB 1LUVA 2Q68A 4CH6A 2R9IA 5IY5B 4WF9V 4LF8B 4LF5B 2UVWA 1MMMA 2X6AA 4GT1A 3OD4A 1ZTEA 2XAHA 4J41A 1XDCA 2XGQA 3CC7V 4R8CA 4JI2B 2C22A 3HOZG 1B3QA 2LFRA 5IYZB 2UUCH 1N36B 4MTFA 1QVGU 2R72A 4DL6A 3R9RA 4RAIA 4U7OA 1NH2D 2CH7A 5KFCA 1R6TA 2WLKA 4O3RA 4EQ5A 1RPOA 2WLHA 4FFRA 5I5YA 3K03A 4M9UA 1EKPA 3GIKA 2ZQMA 5KFTA 4J9PA 3LDDA 4B08A 5L9XA 4PA7A 4YHHH 1ZL8A 2DABA 3T9FA 3U0ZA 3ZIAG 3N6XA 2L6LA 4YXWG 4X89A 3MR6A 3GV5B 3F7VC 4FS1A 2BR0A 4JI8H 1K4DC 1RSOA 2WAMA 4FFNA 2AGOA 1HP8A 5EYPA 1I1LA 5KFGA 1VMGA 4F4XA 1Y4MA 3BQ1A 5KHJA 5EC1C 4TQRA 1OCOB 5KFKA 4BIOA 4A93G 5IY5C 1Y76B 2FTKA 3D36C 2WWWA 1XNRO 3FB7C 4JI7B 4TWKA 1EZVH 3AG3C 1KKCA 1GM9A 1RK5A 4FFOA 1GN4A 4J7KA 1VQOV 2ZM6H 3OR6C 1Q6IA 1WPXA 4K0KO 1ZSPA 3HBLA 2ZT9B 2FK3A 3EPIA 1BCCH 1JCHA 3KG2A 1MNGA 1VF5B 3VQXA 3Q2OA 1IBLO 1WNSA 1AROP 3WB0A 1P16A 3T4ZA 2UXCO 4ZBMA 3CVZA 3OE7G 3RYCB 4KL1A 5CA0B 5LYJB 2XD4A 3LSUA 1NH2B 2X7RB 4JAUA 1VQLV 4TUYA 5LXTB 5LMUO 5ITZB 4J10A 3SE7A 2VA2A 2CH7B 4P9PA 5H6RA 3FB8C 3MWDA 4ECSA 3GTMA 5EBMC 4BIZA 4LFAH 4Z2WA 4DR1B 1Q7YW 3HKEA 4U7CA 3HR0A 1J5EB 1FJGH 1AR4A 4AYBA 3PFFA 1MABG 3HOXG 3JRXA 3AG1C 2E2IA 2A9HA 3H1IH 1QQCA 1S03G 1SC5B 4O4IB 3TY9A 3JALA 1K1QA 1HNXB 5BXZA 3PW0A 3KCXA 4JYAO 2X0LA 3KHRA 3ZHRA 3I4MG 1XUQA 1ZLZA 2DN9A 3DGEA 3QTCA 2E5LB 4YJ3A 4EFEA 4GC7A 4DV2B 4LF4H 4PDRA 3CSWA 1N36H 4DR3B 5KX5F 5L3EA 4LFCH 4I55B 4H33A 4O4HF 4DL7A 5KFNA 3E5NA 1L8DA 1G6UA 2CGNA 3HKBB 3Q8RB 4LF8H 4NYKA 2R8JA 1L1FA 3CRCA 2R85A 4DRXB 3D8CA 2WB1A 1N8RW 3Q4HB 3RR5A 2K1EA 3ETJA 4CKEA 2GUZB 5KG2A 4QWBA 2UUAO 4JI0B 2P6JA 2PI5A 2QKCA 1SFOA 2YDEA 4DR6H 2PMZE 3APOA 4FBTA 1OCZC 2QDOA 4O4IA 2WLIA 3AG1B 2JEJA 4DR2O 2GPWA 5B3SB 5FPOA 2FL4A 3AK3A 3UO3A 2ITCC 2HDKA 5KX5B 4IR1A 5DISC 4FZ1A 3C90A 2FPPB 3OSNA 3EXAA 1HNZH 1ZAUA 2CKZB 5EC2C 4PD4F 4RQFA 2M6YA 2MCTA 1E79G 3V6JA 4LBEC 4FFMA 2PVPA 2EILC 4DV0O 3HKZA 1YCIA 4ZOLF 4Q0YA 3ZRWB 3RAQA 3N42B 3ZRXA 2BTQA 1HR0O 1KJ8A 4MA0A 1NTZH 1I7LA 2DAAA 2E75B 1AR5A 2P4KA 2WAQE 4O2AB 4NXNB 4QIWF 1UC9A 3HB9A 1XMOB 4DR6O 3FB6C 3U9SA 2W6ZA 3LP8A 3ZN1A 1BE3H 1O9GA 2O03A 1IVSA 4FLVA 1J5EO 2XIGA 5J2TB 1FXKA 4LFBB 4HR7A 2DYRB 1IXBA 2EINC 5CR5A 3FYEB 2QR4A 4ED6A 5HNEA 3UZOA 1SQVH 3ASOC 2HEPA 1OCZB 2W6PA 5BWRA 3VPBA 5EIBC 5C44G 1JX4A 4DR7B 3W7WA 2R70A 1JKJB 5LMNB 1CQJB 3K5MA 3MFHA 4FIPC 4JZGA 4BWSC 3RB0A 5CAEB 5H6QA 1SYXB 4QPJA 2VQFB 4JV0A 4NR1A 1XK5A 2HR3A 1XMQH 1AI6A 3CC2V 4KUMA 5D5PA 4O84A 3N8DA 4XDLA 2OCCB 1CP9A 5C1OA 2DWDC 3AG4B 2DW4A 5KFHA 3GTQA 1WAZA 5C4XG 3O9OA 2O57A 3BACA 3OUZA 2B63G 1ENVA 4JTAB 3OEHG 1EHIA 2D3OW 1Y1VA 1QR9A 4ZHQF 4WBNF 4ECUA 5DGHA 2WLNA 3WB2A 3X2QB 3JYCA 4TM5A 2ZNIA 1F4NA 2Y48A 3MHHC 5KFXA 1XMOH 4NXNH 1KU9A 2GLTA 1Z5WA 4ME6A 4C5AA 3RYFB 1ORQC 4CHIA 4L87A 3VBBA 4FLWA 3KAJA 3MJFA 2EZOA 3ASOB 1SZTA 5CA3A 3CCLV 4CMFA 4MW3A 3K3WA 3U0GA 2P90A 3WO1A 2RMKB 4TV8F 4DR5H 3JATB 3HPLC 1HNZB 5KT3A 3LMLA 3L73H 1OCOC 4R50A 4PI2A 4EEQA 1TAEA 3ETQA 1VQ4V 4ZI7B 4X66H 4IZOA 2P06A 1K1SA 4MV9A 4EGJA 4APMA 2PGGA 2MK3A 4RNNA 3OFNG 1GMGA 1V51A 4G28B 2B9ZA 1FJGO 4FGRA 5BYAA 2DQ3A 2VR1A 4ECWA 1THZA 5IYBO 4ECTA 3T2MA 4O7YA 3OGIB 1HWYA 1I6UA 1R3LC 1BHBA 4RNMA 3MAQA 4NVPA 4JPRA 2XAQA 3F5TA 1MZFA 3PO2G 3K08A 5LBQA 2B1IA 2QKSA 2KQXA 4DV3H 3JAKB 5CBGA 1A0IA 4BW5A 1ZHQA 1YDXA 1P7GA 3HXLA 5C3EG 2LW1A 2Z04A 3G71V 5DQIA 3JATA 1ZL8B 2IJHA 1L0NH 3E8FA 3CPWU 2OIGA 3F7YC 1BSMA 3RT3C 3G8CA 1N33H 4PWQA 3OUUA 4FM2A 3OUFA 4WFGA 1C30A 2NVYA 4O3SA 1H2SB 3LNMB 2YS6A 2E5LH 4JI1B 1HW7A 1NT2B 1VQMV 4MSWC 2COGA 4JTDB 4X66O 3Q8QB 5EK0A 2KB1A 1RJPA 3BA9A 2F95B 4YR3A 3RYCA 4QIWE 4I9WA 4Y8VB 1QLEB 2IBKA 4LFAB 2GTSA 2W6JG 3G80A 1N32B 1GAXA 2BQ3A 2YC0A 3UT5A 4X1YA 3GLKA 2VQFH 4QE7A 4O7TA 3JZIA 5KG0A 4IR9A 3DTGA 3NC0B 1TUEB 2HG8A 4LF7B 1GN2A 4JASA 1K5SA 1D2DA 4WFAV 2FP4B 4LWSA 1AJNA 1O9HA 2PY5A 2X6CA 3V6HA 1KC7A 1HR0H 2E74B 3WWIA 2HVSA 3CCRV 2ZR2A 4MTXA 4ECVA 5IYCO 3ABMB 3OUSA 2V5AA 4Q8EA 4J9LA 1U96A 4I50A 2EJ3A 3B09A 1NVPD 4DL2A 1IYEA 1IBMO 5FR9A 1I2LA 3TK1A 1Q3EA 2N05A 5B3SC 2OTLV 3ABTA 2DYSC 1TUBB 4CC5A 3A0RA 5LHGA 5IYDG 3RBDA 3JAWB 3VQYA 3K5LA 1P8LA 5L1KA 2Y4TA 2W9CB 2VOBA 4DUYO 4GCZA 2ZKOA 4B3RB 1QBZA 5L3DA 4FBUA 3J81W 3R66A 2P5OA 3S3XA 5IJ9B 3GTKA 2C35B 4DV5B 1QLEC 3SDLA 4B3MO 3RUPA 4DL5A 2EILB 4O4LB 3RF2A 2Y0SA 3ICXA 3NUAA 3AK1A 4IIJB 3IC9A 2WLJA 1RM1B 3IAYA 2HVKC 2V58A 4FJCC 1DK1A 1VQ8V 4B3TB 3VQVA 1KQSU 2ZGIA 1JOYA 2JA5A 2R87A 5LGUA 3BQ0A 4CH3A 1IDSA 1JJ2U 5I5XA 1W93A 3M9MB 3KKYA 1FFTB 1OHHG 3RN4A 3L75H 5C8YF 3B77A 3T1HB 2F23A 2Q8VA 3L74H 2X5RA 2JA7A 1N48A 2HLDG 1NKDA 2QWPB 4QW8A 2COIA 4JUZA 1GSOA 1SKVA 3U10A 4LR3A 3BQ2A 3L70H 1I94O 4Q20A 4U3JB 4LCUC 2IA6A 1GK9A 2QWOB 3BA8A 3RGZA 3JAWA 4I9QA 5FL7G 3P32A 1FPOA 1R73A 4UCOA 5D1OA 4A3CG 3LUTB 2XTAA 4FS2A 3PZPA 1M57B 5J2UF 2YCHA 4J0MA 4TV9F 2IW5A 3TGUH 4I7HA 4UUJC 4DQNA 3TXSA 4QGPA 3UZBA 4O4JA 3NGDA 2UXDH 2OCCC 2Y4UA 5JQWA 2R7KA 4LFCB 3AG4C 4TOIA 3RW0A 1R1BA 4DUZB 1YIJV 2DLNA 5KG1A 2CNQA 2CTWA 4ABMA 2V4QA 4DV2H 2QE7G 3VOTA 1XNQB 5F9NA 1QHTA 3T1HH 4FM0A 2YI8A 3E35A 3HOVG 5TISZ 4JI3H 3X2QC 1Y1WG 5BZBA 3L9DA 4DUZO 3KYHC 3U11A 2R9AA 3N44B 1J5EH 4IWYA 4Z1MG 1A3GA 5KFVA 1IBLH 4UXNA 3D3QA 4RUEA 2XOKG 4DK1A 1KP3A 1OJHA 4O7ZA 1G2WA 4RQEA 3O65A 4ED0A 2QWQB 2XASA 3W7SA 1HNWB 1FKAO 1SQFA 2J9GA 3LWBA 3FX7A 2AW9A 1XNRH 4B3RH 3PW5A 2DJVA 3TW7A 4MVOA 4A3JG 3CB2A 2PUSA 3H01A 1Y67A 5HFMA 2E2HA 4MV4A 1X59A 5CA0F 4QWAA 1HNWO 3NXSA 3HKBA 4LH6A 3M8AA 4MW8A 4F6RA 1VARA 5FD5A 5EWFA 2RJZA 4MTOA 2JEUA 3P3PA 2FB9A 4UB6Z 4DRXA 2IP4A 4YQWA 5C93A 2ATLA 1GM7A 2ADPA 4Q43A 1KMIZ 4GC6A 4RB0A 2ZDIC 1WA8A 1BJTA 5LGNA 4O2BA 4B3MH 3SYAA 1S0VA 1AP5A 2NLJC 2GQRA 2UXBH 3K9AA 1AI4A 4HBNA 4LNUB 5DG9A 3UO2A 1DV1A 4GKJB 3SNOA 4O3OA 3L4JA 5EZYB 4JV2A 2HKOA 3ETEA 3BHPA 1Q86W 5DECA 2VUGA 4IYHA 1DLBA 4ZI7A 3TIIA 2MW2B 4QIWA 1PPJH 5JWPA 3RIZA 5B1NA 1GKFA 1K3EA 1GO3F 2ZNJA 4H0LB 4JI3O 4ZI7F 4BWAA 4FFLA 2OH2A 4GKKH 3ZHUA 2Y4RA 1FXVA 2PBZA 4E4TA 1IBLB 3MDSA 2M7WA 2R82A 5BWXA 2Q2TA 1CXZB 1CS0A 3W5OA 3JCUZ 3RWRD 2R7NA 1TA8A 2YZNA 1VQ5V 2R8HA 4JI3B 2OYQA 3JD4A 2GTAA 2A06H 2CNUA 3JD2A 4O4LA 4A3EG 1K9MW 3K0GA 2W0FC 4PBCA 4WD3A 3SPGA 3JZFA 2BTQB 4JI2H 1QLNA 3T9AA 5E1AC 2ZXWC 3EVKA 1WSCA 4ED7A 5KX5A 5I5WA 4X20B 3FAVB 3CMEV 1MZBA 2FK2A 3E8HA 3BVOA 3A0HZ 3K5IA 4J9NA 5GW7A 2B1GA 5HFLA 2Q7HA 1VQ9V 1QNMA 4TUYB 2N74A 3ZJZA 3SI8A 4B3SH 2F4VO 4XX0B 3KAKA 1AJQA 1UC8A 5KT7A 2E5LO 4AQYH 5LMUB 3ABMC 1EN4A 2W57A 3RBEA 1Y1WA 4HNAB 2ZJTA 2C2RA 2EULA 5JJJB 2IU3A 3CEIA 3I12A 2AXTZ 3T1YH 1YZBA 2EIKC 5FLMG 4MV1A 1RK6A 2PMZA 3IC7A 1NZ6A 3GIPA 3DC5A 1BS3A 4GZRB 2DYSB 2YI9A 1RPRA 4JI6O 4J9QA 1R9TA 5L3BA 5J2TA 4JI4B 3GIMA 4EBCA 3STLC 1V55C 1Q5OA 2C00A 4MS2A 3T9DA 5K1PA 4QWCA 4EYHB 2LW7A 4CC6A 1WB8A 1P84F 4BW9A 5KUMA 1CKNB 3U9TA 3JRWA 2ZXWB 2F1MA 3BABA 4PJ0Z 2RN9A 2W6QA 4ECQA 4QW9A 1RM1C 2DZDA 5C1PA 1R3IC 1Y74B 4BXXG 3LSQA 4XYMB 2FMLA 3SPHA 5GTHZ 3I56V 2Y0IA 5LMNO 3RBZA 2KG7A 5BMVB 2JEGA 3LULA 2XCPA 4FPPA 2OIEA 3VPCA 3AYHB 5A2QW 4IRDA 4WFEA 2AGQA 3SGIA 1K5QA 4GUNA 3KHHA 5JQGF 1I94H 4EGQA 2JA6G 2JS5A 1XL6A 3AEIA 1WB7A 2BSKA 5CBFA 3HKZE 5KFAA 4AYBE 2UVVA 1M9NA 1B6SA 5CN0A 5C8YA 2CFMA 4TQFA 2DPIA 5KA5A 1KB9F 1BMFG 1M57C 4KP4A 2Q7EA 3CCSV 1K7DA 1V55B 1M6VA 2GV9A 2HJFC 1XI1A 2XNDG 3E22A 2UXDO 1Z2NX 5J2UB 3QQMA 4CMDA 4K8XA 2RF4A 5BWUA 3RV3A 5KS8A 2KKWA 5LMNH 4FVMA 1M5IA 4LMYA 2Q73A 3ZRWA 3E2EA 1DV2A 2ZD9A 1SQQH 4WFHA 3E83A 3T5JA 1A0GA 3UM7A 5DLFA 4JV5H 1WR2A 1COWG 1JFFA 1DTOA 2ATKC 3IFXA 3WG7B 3ZN0A 3CYOA 4DUYH 4PZ6A 4QWDA 4MA5A 2AQ4A 4HQ6A 4XZ3B 3CQZA 4A3DG 1N0NA 4JI5O 4X8AA 3K9SA 5KMGA 4QJFB 3F5WC 1FFXA 3OHBA 2H8PC 3MFIA 4D6TH 1GLVA 4NXMB 5KFZA 3GDEA 2Y69C 3T5HA 2WLLB 2EX3A 1N33B 1VEWA 4IHJF 1NTMH 5BWTA 2RDIA 4JI5B 2HHHO 1F4MA 4JI4O 4DV3O 2DWCA 4FLZA 2FLLA 5LXTA 5EOYA 3P3NA 2V9WA 2DE0X 3GV8B 2YIDA 2LGQA 3G67A 4EKWA 5EDWA 1PX2A 3CD6V 1PP9H 3HB3B 5JCOA 4MTEA 1RJQA 2IH1C 3ZHTA 1VQ6V 2WLIB 1N34H 2BE3A 2AU0A 4J42A 5DGBA 2FKLA 4G2KA 1WP7A 2YWVA 5DGIA 2CE4A 4M7EA 1FVIA 1H8EG 3KREA 4J9OA 1JX9A 2JK5C 5JJEB 1SEIA 3ZX6A 1HNZO 5LL6Y 5EIBD 1ZWIC 2PZSA 1RYRA 1EN5A 2YRXA 5KFMA 4FK5C 1GH6A 3JARB 1ZETA 4C2MA 4X88A 3SJAC 4X66B 1E1RG 1EKVA 1AILA 2Y69B 2NU7B 1P7BA 4R8UA 1W0KG 5L3GA 3LDEA 4DR5B 2IJKA 1V9PA 2HP8A 3ABLC 2R93A 1YF2A 4G3IA 4ETSA 4DV6B 5IYZF 4GYCB 4RB1A 4RWUA 4BBSG 2W0XA 3DXRA 2YEVA 4HAMA 5D1PA 4X65H 2BOBC 3UQ8A 1KT8A 4NXMH 5FPRA 1I1KA 4DV6O 1KJQA 5FLXW 4BBRG 1HNXH 4LF7O 4RAYA 1XMQO 2ZDIA 3MR2A 2LP7A 1RSOB 1S76D 2HHHH 1UPGA 4LNUA 2J6TA 2FJZA 4RU9A 4DV5O 4LSXA 1IZ3A 4DV1B 2GQSA 5BR8B 1KECA 2Q69A 4J9YB 4PZ8A 5LOVF 3ETHA 4MV6A 1R3KC 1WA8B 2BQUA 3JCZA 1KEEA 3HO8A 4JV1A 1CKOA 3R5XA 5KHHA 3GQCA 2FPGB 4U3JA 1WRVA 3FKIA 3HKEB 1PV0A 2NN4A 1EKFA 3CXHF 3STZC 4O2AA 1FAFA 5DN6G 5FNVF 5A2QN 3G6BA 1EUDB 4MVMA 3G6VA 5EZYA 5I5SA 3BRCA 3TXQA 2XAGA 2EIKB 5HBRB 2LFSA 1V4YA 4C5CA 2ZM6B 5CA1A 4GLXA 3PN1A 1CEZA 3V4ZA 1M56B 1Y14B 1S0NA 2R8KA 2R7ZA 1IURA 2JJ2G 3QZ7A 4C7UA 5KFPA 1KJIA 4JI7H 3WFVA 5B66Z 4UCUA 5CA1F 2NUAB 2AZ2A 1H2LA 2V4RA 1F23A 5KFLA 3N2KA 3WO0A 2NU8B 2YIBD 2DIKA 4FFKA 2QM7A 3HOYG 2WPDG 4CZZA 3N43B 4OPAA 1LR1A 1I08A 2HIVA 3KHGA 4F4WA 1JXLA 4LFCO 3TIGA 4JI8B 1CKMA 5BPHA 4FFBB 1IX9A 2WLMA 3FD9A 4NB5A 1H8HG 3PVXA 4MVSA 1KJJA 4A3GG 2VQEB 4LF9B 4Q6GA 2IJJA 5E25A 2HVJC 3JD3A 5LOVA 2WB1E 3FDSA 4JI8O 4ZOLA 1WLEA 3J7AK 3OHAA 1DF5A 3JZ6A 4QJFA 1R3JC 5B1OA 3OSPA 1XNQH 3SYOA 2BTOA 2L35A 2N04A 3IGAC 4DV4B 3FB5C 4RUCA 1JR9A 5F2VO 1NI8A 2W8LA 1XILA 4FFPA 3OMNB 4DYLA 3ABUA 1VQKV 3G4SV 5IDJA 4PI0A 4PDVA 2EZPA 1S68A 1L0LH 3PR4A 3HOUG 3A8TA 3VPDA 3T1YO 4YHHO 4KFMA 2LO1A 2OWOA 4GKKO 3ZMUA 4O2BB 1I2KA 1EZJA 5GONF 1FXKC 1S72V 4HNVA 3GWKC 1FYJA 5DG8A 5CM0A 4DL4A 1GN3A 5LL6b 1GTOA 4GX1A 1KD1W 2YXLA 5B5EZ 5I5TA 4MAMA 1TVKA 4F4ZA 1B6QA 1QVFU 2VPSA 3SJCC 4A3KG 4DR3H 1YSCA 4JYAB 5LA6A 4UCVA 3WG7C 5H80A 2A7WA 4DL3A 4X62B 2C2DA 3VOUA 2I8CA 1XOUA 2WSSG 4QE9A 1BQZA 1T94A 1Q81W 5KFIA 2AGAA 2XC9A 4DK0A 4YY3O 4NZMA 2DOSA 1NBMG 2Z3YA 4P9OA 2YL2A 3PW4A 2JGDA 3DF7A 5KFDA 4I5SA 5JVDB 2FYUH 3OAAG 3K3PA 2OT5A 2UU9H 3NBYB 2R8GA 2CW8A 4J9RA 4TT3G 4B3TH 4FFBA 4HYOA 4AI8A 3GILA 1AB3A 2UUBB 4CH5A 3QG5A 4ZHQA 3E22B 4H37A 2VPQA 4MVQA 3ZMZA 1KUTA 3TJTA 1Z5VA 1ET0A 2ZIMA 3EPGA 1GM8A 2ZE6A 4EB6B 4JAAA 1S5HC 3ZS8C 2YW2A 2BOCC 1FXKB 4ED8A 2VRZA 4J9KA 1YTFB 4UCRA 2Z5UA 3BPZA 3E86A 3VMMA 4QSHA 1URFA 5J2TF 1US6A 2P22C 2CK3G 1G1XB 3OTOH 2B5UA 4O3PA 4LWSB 2ZR3A 4PA9A 3G8DA 5D8DA 1WH2A 3SJBC 1JDEA 2QTSA 1SQGA 4CKBA 3JALB 2HGWA 4RUFA 3N6RA 4F4YA 4WHXA 2QWNB 3RV4A 1FD9A 1YITV 4YB8B 3RJ0A 3Q8SB 3B8NA 3CP1A 3MWEA 3UT5B 1IOVA 5KFFA 3GTJA 2Q0AA 4YIPA 4ECRA 3L71H 4X1IB 3IN5A 2FLPA 1SESA 3ORQA 2ALZA 3ABLB 1H2MA 1MG1A 3RB3A 3PW7A 2C2EA 4A3FG 4PA4A 1EZ1A 1Y76A 1NTKH 3JASA 2QA4V 4CE5A 4Q8FA 1N32H 3TY5A 3ML0A 4N21A 3I4NG 2SCUB 3M7MX 4O2AF 2PTMA 3OTOO 1AUVA 2V4DA 2R6FA 2UU9B 4A2BA 1VIBA 3WB1A 3N2KB 4A5UB 4JI6B 2UUCO 3G6EV 3JSLA 1BXRA 3KALA 2HIXA 4PDMA 3BG5A 2R9RB 1I0HA 5I5UA 4BY1G 4JI1H 4MVUA 1S3JA 1AI5A 2JVDA 3LQSA 4O4HA 2NR5A 5L3CA 5IT9W 5IYBG 1Y6XA 2RDCA 2UUCB 2BQRA 2JEIA 3M4IA 1M93A 4I7ZB 4WFFA 1I50A 1I5XA 4K8ZA 2QB5A 1NR1A 4TVIA 2VWKA 2EJ0A 1E4EA 2FK1A 4UV8A 1BT8A 2VQFO 4NTWA 3S24A 4DV2O 4XDKA 4O7RA 4DR3O 1ROPA 1SS3A 2LGWA 2GPSA 2HVRA 3QNEA 4YR2A 2JDIG 5LP6A 1IBKO 2Q67A 1M0WA 2YEVB 4F4LA 3FFQA 3R65A 1H2KA 5H5NA 2YICA 3ZBHA 3MWMA 1XQ8A 1HDJA 1A9XA 2ITDC 2QM8A 3GIJA 3D36A 4JYYA 5IYDO 3SPJA 1MOFA 2R8IA 3QO7A 5CE8A 4MTDA 1JA8A 3C3TA 3H9VA 3CCMV 5IT9N 1XDNA 2Y0SE 2AHYA 3EYYA 4JI7O 2VS0A 1M56C 4X1KA 3B2EE 2Q9LA 1VBHA 4X64B 2QYZA 3PR5B 1OZ0A 1Q8IA 2UUAB 2W8KA 1GYFA 2EBOA 5BWVA 4LF9H 2CNVA 1IYDA 2ASJA 2VQEH 1YVWA 2YYAA 3MHSC 5BPFA 4TV9A 1AR1B 3EHBB 2Q2UA 1K73W 1XHXA 3GTGA 4X20A 5IWAB 4OX9B 4XDJA 2QWRB 2JIZG 4JYCA 3B40A 1VP7A 3K5HA 4A2AA 4O7LA 1N4CA 4FLUA 1KBLA 4RUAA 5LP6B 4NZOA 2V7QG 1MZEA 1F7YA 2JS3A 2WE6A 2QJ1A 4DW0A 1S97A 1Z2GA 3FKSG 3N2GB 3H4BA 4UVAA 1YEWA 4DV7B 2YS7A 5KG5A 4PDBA 5FLXN 2OCHA 5K2MA 5LXTF 5L1JA 4J11A 3RTXA 4TV8A 4EG0A 2C28A 1S77D 2W9CA 1B33N 4E2LA 4JAVA 1YI2V 1HNXO 4DV7O 2AZ0A 4RB2C 3JD0A 4FLYA 3RAXA 4O7NA 3UYYA 3OGCC 1WJZA 2AHZA 3RVZA 3CEBA 1JPXA 2WA3A 3JSNA 3CS5A
chains in the Genus database with same CATH topology
4LF7H 4IIJA 3RYHA 2GV9A 4BWSC 1XI1A 5CB4A 3E22A 1SYXB 1Z2NX 5J2UB 2HHHH 4K8XA 2VQFB 2KKWA 4I50B 4FVMA 5LMNH 1XK5A 4DR7H 1M5IA 4LMYA 1XMQH 5D5PA 2XHBA 5BR8H 5BMVA 1DGSA 4JV5H 5LP6C 1JFFA 3DSQA 4LFBH 3HKDA 4DUYH 4PZ6A 3K5MA 4E6NA 3RGXA 2ZINA 4DV7H 5GONB 5KMGA 2WDTA 1FFXA 4IHJA 4LH7A 3WB2A 1XMOH 2ZNIA 4NXMB 3JASB 4CS4A 3GDEA 4NXNH 1KU9A 4DR2H 1Z5WA 4X65B 3RYFB 2EX3A 1N33B 4FLWA 3KAJA 4ZOLB 4JI5B 4FLXA 5CB4B 4ZIBA 4FLZA 5JCOC 5LXTA 3JARA 5IWAH 5CA0A 2HVQA 3W1BA 5EOYA 4FLTA 4DR5H 3BAAA 3JATB 1HNZB 3LMLA 4PI2A 4EEQA 5JCOA 2Q7GA 1TAEA 3ETQA 4MV7A 4ZI7B 5ITZA 4DV3B 2ZCEA 4MTEA 4X66H 3K59A 4DV0B 4JI4H 4MV9A 2UUAH 4APMA 2PGGA 1T5EA 4X64H 1N34H 5FD6A 3L2PA 2IM9A 4R7RA 4DR6B 4PHZA 4RB3C 3RFRA 4JI0H 1I6UA 4M7EA 1FVIA 3CSXA 1B04A 3MAQA 5LMNB 4NVPA 1SEIA 5JJEB 1N34B 2RGRA 5EIBD 4AQYB 2PZSA 5LMUH 3J80W 4DV0H 4EFBA 4O4JB 3JARB 4DR4H 3JAMW 3SJAC 4DV3H 4X66B 3JAKB 4B3SB 1AN7A 5CA1B 5JQGA 1A0IA 1ZHQA 4I55A 3K5NA 3HXLA 5IYZA 4DR5B 2QM4A 4WBNA 1V9PA 3C0FB 4D7TA 4ETSA 4DV6B 3JATA 3HKCB 4GYCB 4RB1A 3NBZB 4JI5H 3K58A 3L4KA 1N33H 5D1PA 2CW7A 4FM2A 4X65H 4LF4B 5FNVB 3UQ8A 1H2SB 1CKNA 4NXMH 5FPRA 2E5LH 4JI1B 4DRFA 1HW7A 5FLXW 1NT2B 4TV9B 1M4UA 2PYJA 1HNXH 3QWUA 4RAYA 4JI6H 4DUYB 2KSWA 2UXCH 3BA9A 2F95B 3N41B 1FJGB 5IJ0A 4YJ2A 5EYPB 4LNUA 3RYCA 5LOVB 3THOA 4LSXA 4GKKB 1VS0A 3F8NA 4DR1H 4DV1B 5BR8B 4LFAB 5K1XA 2E3CA 1XMQB 3N2GA 1ZHSA 1N32B 4PZ8A 3UT5A 4X1YA 2VQFH 2HHHB 3A2FA 5IJ9A 1CKOA 5KHHA 3NC0B 4GKJH 1E4FT 4U3JA 4LF7B 3HKEB 4UCTA 2YIAA 4LSAA 1O9HA 2PY5A 4O2AA 1HR0H 2UXBB 2HVSA 3JAKA 3H20A 4B3MB 5EZYA 3GJXB 3BRCA 5J2UA 3OTFA 1BGWA 5FNVA 4KHPH 4CH4A 2PYLA 2CAZC 4I50A 3RGBA 3TY8A 1I94B 4PZ7A 2ZM6B 5JQGB 2ZIOA 3PN1A 5CA1A 4AHCA 4GLXA 3VNNA 1Q3EA 4JI7H 3IG0A 1TUBB 4CC5A 4UCUA 4YJ2B 5IJ0B 3JAWB 3VQYA 1JFFB 3K5LA 1P8LA 2VOBA 1TVKB 4CS2A 4CS3A 3N2KA 4B3RB 2YIBD 3J81W 2P5OA 5IJ9B 5C8YB 4DV5B 4RAZA 5LA6B 3KXYT 3N43B 1HNWH 4OX9H 2HIVA 3HKDB 3RF2A 4O4LB 3ICXA 4JI8B 1CKMA 4IIJB 4FFBB 1P49A 3IAYA 5JJNB 1VF7A 4LF6B 1IBMB 5JVDA 2RGVA 4B3TB 4YHHB 2VQEB 3VQVA 4YY3B 4LF9B 4Q6GA 1IBKH 4I4TB 5LOVA 4X1YB 5D5QA 4CH3A 4ZOLA 5KHKA 4AILC 3J7AK 3T1HB 1E4GT 1FFXB 1TUBA 4X62H 1XNQH 2BTOA 4DV4B 3T1YB 3RYIB 4JYAH 3K3VA 4DUZH 1SKVA 3U10A 4LR3A 1X4TA 4PI0A 4FM1A 3GB8B 4U3JB 4IHJB 1S68A 3BA8A 3RGZA 3JAWA 4I9QA 1TGOA 1WPBA 1XHZA 1L2ZA 4UCOA 5D1OA 3ZEDA 2OWOA 2YIBA 4X1KB 2VWJA 2YCHA 1S5JA 4O2BB 4J0MA 4ZHQB 4CH6A 4LF8B 4I7HA 5LL6b 4LF5B 4O4JA 4I4TA 2YXLA 2FE3A 1X9NA 2UXDH 1TVKA 2F4VH 4EB6A 4JI2B 2RQ6A 2VPSA 4LFCB 4TOIA 3SJCC 4K0KH 5IYZB 4DUZB 2UUCH 4DR3H 1N36B 4JYAB 2R72A 5LA6A 4UCVA 3SR2C 4DV2H 1XNQB 4X62B 4TV8B 1QHTA 4EQ5A 4FM0A 3T1HH 2YI8A 4X1IA 2F66C 4DK0A 2JGUA 4JI3H 3K57A 3DF7A 5JVDB 5JH7A 3U11A 4B08A 3KYHC 2R9AA 3N44B 2UU9H 3NBYB 4YY3H 2CW8A 1J5EH 1IBLH 5D1OB 3HKCA 4FFBA 4YHHH 4B3TH 3U0ZA 4LF6H 4DK1A 2UUBB 3N6XA 4CH5A 3QG5A 4ZHQA 3E22B 1D5AA 4JI8H 1RSOA 1HNWB 5EYPA 1SQFA 1Z5VA 4DV5H 2ZIMA 1SA0B 4EB6B 1XNRH 4UCSA 5KHJA 3ZS8C 4B3RH 3CB2A 2PUSA 3RYIA 4UCRA 3BPZA 4LH6A 3HKBA 4JI7B 1JJOA 4RZQA 4F6RA 5FD5A 3K5OA 2RJZA 2P22C 4DRXA 3OTOH 3QF7A 2ZM6H 1KMIZ 4RB0A 1WH2A 3SJBC 1BJTA 1Q43A 3VQWA 4O2BA 3OTOB 1SQGA 3JALB 4B3MH 4D7SA 3VQXA 4L8JA 1WNSA 3WB0A 2UXBH 1P16A 3CVZA 3RJ0A 4LNUB 4HBNA 4KL1A 5CA0B 3UT5B 5LYJB 3RYCB 2Q0AA 4GKJB 4HNAA 3L4JA 4X1IB 5EZYB 1XNRB 3BHPA 2VUGA 4TUYA 5LXTB 4TQDA 1O75A 4ZI7A 5ITZB 1N32H 3JASA 1I7FA 3RIZA 3TY5A 2ZNJA 4LFAH 4DV1H 4DR1B 4BWAA 5KMGB 2UUBH 3M7MX 4GKKH 2PTMA 3HKEA 2V4DA 1IBLB 1J5EB 1FJGH 2Q2TA 2UU9B 4A2BA 3WB1A 2UXCB 3N2KB 4JI6B 3W5OA 3RWRD 3JSLA 1QQCA 1TA8A 4O4IB 3KALA 1S03G 3TY9A 2HIXA 3JALA 4JI3B 1HNXB 2OYQA 4JI1H 3QTCA 2E5LB 4YJ3A 2JVDA 4O4LA 4EFEA 4O4HA 4DV2B 4LF4H 1FKAH 5IT9W 1WN7A 1N36H 4DR3B 2UUCB 3M4IA 4K0KB 1M93A 4LFCH 4I55B 2BTQB 4JI2H 4F6RB 4K8ZA 4UFZA 2VWKA 2F4VB 4DV6H 2UXDB 5KX5A 4LF5H 4X20B 3S24A 1MZBA 1L8DA 1G6UA 3HKBB 4LF8H 2Q7HA 2HVRA 3FMAA 4DRXB 4TUYB 5LP6A 4B3SH 1M0WA 3KAKA 3FFQA 4DR4B 5KHGA 3RR5A 3MWMA 3CHXA 1XQ8A 5LYJA 4AQYH 5LMUB 3RYHB 2W57A 4HNAB 2ZJTA 4MTDA 5JJJB 4JI0B 1JMKC 4WBNB 1XDNA 3EYYA 4DV4H 4YJ3B 3T1YH 4DR6H 4X1KA 1Z2OX 3B2EE 4O4IA 2YI9A 4X64B 5FPOA 1Q8IA 2UUAB 5J2TA 4JI4B 4O4HB 1GYFA 1IBKB 4LF9H 5KX5B 4IAJA 1Q5OA 2VQEH 5DISC 5K1PA 2F93B 1IBMH 4TV9A 4CC6A 2Q2UA 1HNZH 5GONA 1ZAUA 1XHXA 3N40P 4BW9A 2MCTA 1CKNB 4X20A 5IWAB 4OX9B 2F1MA 3BABA 1Z2PX 4Q0YA 4A2AA 3N42B 4FLUA 2BTQA 5LP6B 2WE6A 2QJ1A 5BMVB 4DR2B 3N2GB 4O2AB 4NXNB 1XMOB 1YEWA 4DV7B 5A2QW 1O9GA 3W1GA 4PDBA 2O03A 3SGIA 4FLVA 2XIGA 2WYOA 5J2TB 4LFBB 1I94H 5JH7B 3LNNA 2JS5A 3RTXA 4TV8A 4JV5B 4KHPB 1SA0A 3RYFA 5KHIA 2HEPA 4FM9A 4RB2C 4FLYA 5EIBC 5C8YA 2CFMA 4TQFA 1M0TA 4DR7B 1HR0B 2R70A 2HGSA 3JSNA 2Q7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 B;  3W5O A;  4DRF A;  3JSL A;  1TA8 A;  3TY9 A;  2HIX A;  3QWU A;  4JI3 B;  1HNX B;  2UXC B;  4DUY B;  2VQF B;  4LF8 B;  2E5L B;  3BA9 A;  4EFE A;  4LF5 B;  1FJG B;  1XK5 A;  4DV2 B;  1X9N A;  4DR3 B;  2UUC B;  4K0K B;  4GKK B;  1VS0 A;  4JI2 B;  4DV1 B;  5BR8 B;  4LFC B;  4LFA B;  4TOI A;  4UFZ A;  4DUZ B;  2F4V B;  1XMQ B;  2UXD B;  1DGS A;  1N36 B;  4JYA B;  1N32 B;  4UCV A;  4PZ8 A;  1XNQ B;  4X62 B;  3S24 A;  4EQ5 A;  4PZ6 A;  4E6N A;  5D1O A;  2HHH B;  2HVR A;  1CKO A;  3NC0 B;  4LF7 B;  4LH7 A;  4UCT A;  3KYH C;  4DR4 B;  4NXM B;  3NBY B;  3GDE A;  3RR5 A;  5D1O B;  4X65 B;  5LMU B;  1N33 B;  2UXB B;  2HVS A;  2UUB B;  4B3M B;  4JI5 B;  3GJX B;  4JI0 B;  1XDN A;  2HVQ A;  3TY8 A;  2OWO A;  3W1B A;  1I94 B;  1HNW B;  4PZ7 A;  2ZM6 B;  4GLX A;  3PN1 A;  3JSN A;  3BAA A;  1HNZ B;  3VNN A;  4UCS A;  4X64 B;  4EEQ A;  1TAE A;  5FPO A;  2UUA B;  4CC5 A;  4DV3 B;  4JI4 B;  4UCU A;  1IBK B;  1P8L A;  4DV0 B;  4UCR A;  4LH6 A;  4JI7 B;  4B3R B;  5DIS C;  4CC6 A;  3L2P A;  2Q2U A;  1ZAU A;  4DV5 B;  4DR6 B;  1CKN B;  5IWA B;  2HIV A;  4OX9 B;  3BAB A;  4JI8 B;  1CKM A;  1FVI A;  1B04 A;  3OTO B;  4LF6 B;  1IBM B;  1N34 B;  4AQY B;  1P16 A;  4B3T B;  4YHH B;  2VQE B;  4DR2 B;  4YY3 B;  4EFB A;  4NXN B;  4LF9 B;  1XMO B;  4X66 B;  4B3S B;  4GKJ B;  1A0I A;  4DV7 B;  1XNR B;  3W1G A;  2VUG A;  3SGI A;  4DR5 B;  3T1H B;  1V9P A;  4LFB B;  4DV4 B;  3T1Y B;  3RTX A;  4JV5 B;  4KHP B;  4DV6 B;  3TY5 A;  3NBZ B;  4DR1 B;  3GB8 B;  2CFM A;  1S68 A;  3BA8 A;  5D1P A;  4DR7 B;  1IBL B;  1HR0 B;  4LF4 B;  3UQ8 A;  1J5E B;  1CKN A;  2Q2T A;  2UU9 B;  5FPR A;  4UCO A;  5LMN B;  4JI6 B; 
#chains in the Genus database with same CATH topology
 4LF7 H;  4YP3 A;  4IIJ A;  3RYH A;  4O7W A;  3UFX B;  5KA6 A;  3Q1K A;  2A1H A;  3ETG A;  4NXM O;  4BR6 A;  1W0J G;  2YXY A;  2YSU B;  4X65 O;  1G8M A;  5LHI A;  2JRI A;  2CQY A;  3ASN B;  4GLW A;  4C5B A;  1VF6 C;  1A32 A;  4JI1 O;  2XHB A;  5BR8 H;  1QCE A;  3CX5 F;  4H13 B;  1MSW D;  3QO5 A;  2KG7 B;  5BMV A;  2UXN A;  3CXC U;  4JGS A;  5LP6 C;  5KFY A;  3OEE G;  2R84 A;  3DSQ A;  3HKD A;  1SQB H;  4H44 B;  4ED1 A;  1R6K A;  1CQI B;  4J7J A;  2R92 G;  2XAJ A;  4N23 A;  4DV7 H;  4PEL A;  2WDT A;  1H2N A;  1XL4 A;  1C3O A;  4O2B F;  1OBG A;  2C2A A;  3E8G A;  5LA6 F;  3JAS B;  2H3O A;  1PNM A;  3R5H A;  1M90 W;  4DR2 H;  3H1K H;  4DR5 O;  1F51 A;  1YHQ V;  4A3L G;  3FYI B;  4ZOL B;  3DXR B;  4KHP O;  5CB4 B;  4Q4C A;  4TUY F;  1FS0 G;  5JCO C;  1A48 A;  1NR7 A;  3JAR A;  3ZHV A;  4ED2 A;  5CA0 A;  3GTO A;  2FB5 A;  1YJ9 V;  1JDB B;  3TIN A;  1ULZ A;  4DAA A;  2A79 B;  1M7J A;  1XRE A;  3KCY A;  2ADQ B;  4FZ0 A;  2Q7G A;  2J6S A;  2NU6 B;  4OX9 O;  4DV0 B;  4JI4 H;  2UUA H;  3KHL A;  1T5E A;  4X64 H;  5FD6 A;  3T5L A;  1NJI W;  3ASN C;  5KT4 A;  2IM9 A;  4YAJ B;  4MV8 A;  4M0J A;  1OCR B;  4R7R A;  4NTY A;  1XMO O;  4DR6 B;  4PHZ A;  4RB3 C;  4O4L F;  1DAA A;  2W7P A;  1VAJ A;  4JI0 H;  3VA7 A;  2GUZ A;  5KFE A;  5E79 Z;  3J80 W;  4J9Z B;  4DV0 H;  5KT2 A;  4O4J B;  2XGP A;  4DR4 H;  3JAM W;  1OWT A;  3CMA V;  1AN7 A;  1EFR G;  4R6Z A;  5CA1 B;  4FE2 A;  5KKN B;  4I55 A;  3K5N A;  3HT5 A;  1KYO F;  5IYZ A;  3J7A U;  1N33 O;  2QM4 A;  4WBN A;  5BY1 A;  3SPC A;  3C0F B;  3BFR A;  4R7C A;  2B63 A;  2Z0A A;  4D7T A;  2PN1 A;  4O7S A;  4DV1 O;  3ZHQ A;  3NBZ B;  5CB4 F;  3K58 A;  3L4K A;  1GN6 A;  2CW7 A;  1KBH A;  4EEY A;  4WCE V;  5FNV B;  3MR3 A;  3Q4H A;  1Q6H A;  3BEH A;  1JLL B;  3T5K A;  4DRF A;  1Y1V G;  3GWO A;  4TV9 B;  2PYJ A;  1PNK A;  3QWU A;  2GBO A;  4JI6 H;  4QPK A;  2UXC H;  2JA8 G;  3N41 B;  3BJY A;  5EYP B;  1L2Z A;  5LOV B;  3WU2 Z;  3THO A;  3GB7 C;  2Y0P A;  3OW2 U;  5JVD F;  2LQT A;  2PF4 E;  4UVB A;  5K1X A;  4YJ2 F;  4O4J F;  5JUM A;  1KTA A;  5C5J A;  3N2G A;  2ZM6 O;  3M9O B;  4LF4 O;  2F43 G;  4R8U B;  3D3I A;  3A2F A;  5IJ9 A;  1E4F T;  4UCT A;  2YIA A;  1PKX A;  4LSA A;  1N32 O;  2RNB A;  3WWJ A;  4UVC A;  4P30 A;  4QNH B;  4O82 A;  3H1L H;  2UXB B;  1SRY A;  3AG2 B;  4K6N A;  4U7N A;  2P7T C;  4CH4 A;  2CAZ C;  2PYL A;  1TWH A;  3SYP A;  3TY8 A;  4ZKI A;  2CTP A;  4PA3 A;  4PZ7 A;  3GII A;  5JQG B;  1W2B U;  4CBC A;  3EFF K;  4AHC A;  2RCV A;  3V6K A;  3ZRS A;  2M05 A;  1EM1 A;  4KXR A;  2W6O A;  1OV9 A;  4LP8 A;  1E4E B;  2W9B A;  1XEQ A;  4GX5 A;  4E4E A;  1JFF B;  3R23 A;  5KAI Z;  4CS3 A;  2YZG A;  1UJW B;  4LF5 O;  2ZDQ A;  4IIJ F;  3ABK B;  3HKD B;  2D2C B;  1BQ0 A;  2W70 A;  1N36 O;  1P49 A;  1K92 A;  5JJN B;  4BAY A;  1VF7 A;  4NKG B;  4LF6 B;  5KT6 A;  3PW2 A;  2RGV A;  2XAF A;  3MR5 A;  3QVN A;  3T4D A;  4YHH B;  4YY3 B;  1IBK H;  5CMU A;  2IBZ H;  5D5Q A;  2VUM A;  5AG2 A;  2XT9 A;  4K35 A;  1S5L Z;  3C3S A;  3CCJ V;  4AIL C;  2ODT X;  3M9N B;  1S0M A;  1FFX B;  1TUB A;  3K04 A;  4F6E A;  4B3T O;  4X62 H;  1JQ0 A;  2RDJ A;  3RYI B;  2W71 A;  3AX6 A;  2NU9 B;  2QF7 A;  1YTF D;  3H1J H;  1X4T A;  2KSD A;  1GSA A;  3GB8 B;  4HN2 A;  4IHJ B;  1WCM A;  2GDS A;  2ODM A;  1I5Y A;  1TGO A;  4G27 B;  1XHZ A;  5HV6 A;  1KP2 A;  1ZX3 A;  2YIB A;  4X1K B;  2YRW A;  4LF9 O;  1S5J A;  4HNU A;  4LFA O;  2JA6 A;  1EUC B;  2NVX A;  3T9B A;  3K79 A;  3NR7 A;  1GGO A;  2G38 A;  2GHY A;  3CCV V;  2W9A A;  4O83 A;  3H0G A;  3GIQ A;  2Z02 A;  4I4T A;  2FE3 A;  3KTM A;  1TWG A;  1AP6 A;  3ABK C;  3ZRV A;  2R86 A;  3T9E A;  1M1K W;  1X9N A;  2F4V H;  4EB6 A;  2FLN A;  2RQ6 A;  1KUQ A;  1EN6 A;  4K0K H;  4JF3 A;  3K06 A;  3SR2 C;  4GX2 A;  1AI7 A;  4TV8 B;  2QSA A;  2A0L A;  4O3Q A;  2LJ2 A;  4X1I A;  2QGN A;  2F66 C;  3CE2 A;  3TW6 A;  2JGU A;  4RO2 A;  3K57 A;  4O86 A;  5IYC G;  3ZCC A;  1UNN C;  2YUA A;  5KG3 A;  5JH7 A;  4YY3 H;  5D1O B;  3HKC A;  1XNQ O;  2HJD A;  4HNT A;  5KG7 A;  4LF6 H;  2JA5 G;  4HYK A;  5JVL A;  1D5A A;  1DIK A;  1R6N A;  5DQH A;  1BL8 A;  1W59 A;  4IGG A;  5EWG A;  4DV5 H;  3OT7 A;  2CUG A;  1SA0 B;  4X62 O;  5DLG A;  3BCC H;  3H4D A;  3ETD A;  4UCS A;  1PNL A;  4MV3 A;  1K8A W;  4NLG A;  3RYI A;  3UCS C;  3TQT A;  5T14 A;  5BMV F;  4YAK B;  4RNO A;  1JJO A;  2P4V A;  4RZQ A;  3K5O A;  4J9S A;  2ARH A;  1OCR C;  2V59 A;  1QU7 A;  3PO3 G;  1VQ7 V;  3QF7 A;  1YJN V;  4DO2 A;  5KG6 A;  2W7O A;  3H1H H;  5DMX A;  1Q43 A;  3VQW A;  1GSH A;  4DR1 O;  3T1C A;  3AG7 A;  3OTO B;  4UB8 Z;  4D7S A;  4L8J A;  5KLV H;  2W6N A;  4U3F H;  3RB6 A;  2XCL A;  1V54 C;  4JYB A;  2UVR A;  1BGY H;  1RJR A;  2PI4 A;  3SPI A;  2DWE C;  4HNA A;  2HGX A;  1XNR B;  5KUK A;  4MTG A;  3P30 A;  4TQD A;  1O75 A;  1I7F A;  1MA1 A;  2OLS A;  3W7T A;  4DV1 H;  4I55 F;  5KMG B;  1RYS A;  2UUB H;  1SCU B;  3QFF A;  5KT5 A;  2W6I G;  2ZDG A;  1BHA A;  4IT5 A;  3T54 A;  4Z1V A;  2UXC B;  1PM9 A;  3RVY A;  2ASL A;  1NQT A;  4YJ3 F;  4JV5 O;  1TWA A;  4YBZ B;  4W4L A;  4P2Z A;  4ED3 A;  2ZE7 A;  5CBH A;  2ABJ A;  2DPJ A;  4DXW A;  4MVR A;  1KJ9 A;  1FKA H;  1WN7 A;  1TWC A;  3CCQ V;  4K0K B;  2K9P A;  4IL6 Z;  4BIU A;  4F6R B;  4UFZ A;  4OXS A;  4UV9 A;  2F4V B;  3J81 N;  2UXD B;  2QKA A;  4DV6 H;  5JH7 F;  5KAF Z;  3Q8P B;  4LF5 H;  2H94 A;  2IJI A;  2IH3 C;  4X64 O;  2UU9 O;  1BZK A;  5DM6 V;  3B8M A;  2R7L A;  2UXX A;  3FMA A;  4NYE A;  5F9L A;  1CPY A;  4DR4 B;  3LDC A;  5KHG A;  3CHX A;  1SZX A;  3TCU A;  3ZMS A;  2BSK B;  3AG2 C;  5LYJ A;  4L1K A;  5LP6 F;  3RYH B;  3CC4 V;  2J6U A;  3S3W A;  3QZ8 A;  1JMK C;  3E8B A;  5EBW C;  4WBN B;  4Q44 A;  2ASD A;  4DV4 H;  4YJ3 B;  4DR4 O;  4NZN A;  5I5V A;  2YU9 A;  2HG5 C;  4ASU G;  1Z2O X;  5IE9 A;  4LC1 A;  1UFI A;  3ORR A;  2QEX V;  3H3V H;  3RFC A;  3OMA B;  4JZ2 A;  2NNU A;  5EZY F;  3G6Y A;  4O4H B;  1IBK B;  4IAJ A;  4WFB V;  2JJ1 G;  2F93 B;  1N0J A;  1IBM H;  1Q6U A;  3HOW G;  1B06 A;  4LFB O;  1I1M A;  3V4S A;  5GON A;  3DAA A;  3N40 P;  3UKM A;  4ECX A;  4JI0 O;  2YXH A;  1B6R A;  4GKJ O;  1Z2P X;  2DMX A;  5B1A B;  3GID A;  5KFS A;  1KKD A;  4Q4D A;  4A3B G;  1LUW A;  1SQP H;  5EBL C;  2FPI B;  2X6B A;  2IU0 A;  4DR2 B;  3U54 A;  3FAV A;  3CRM A;  1PL0 A;  5B1B B;  3GVM A;  3TET A;  2FMA A;  3SJQ C;  5KG4 A;  3W1G A;  2EIM C;  2JGD B;  2WYO A;  3GV7 B;  4AQY O;  1U97 A;  4MVZ A;  5JH7 B;  3LNN A;  2W9B B;  5DQG A;  2QTO A;  4JV5 B;  1SQX H;  4KHP B;  5IWA O;  1SA0 A;  2CZG A;  3RYF A;  5LYJ F;  2UVU A;  5KHI A;  3WNZ A;  3T9C A;  4FM9 A;  4UUG A;  4K3A A;  4YR0 A;  1VF6 A;  1DF4 A;  3IJ4 A;  1GO3 E;  1M0T A;  2CTQ A;  1HR0 B;  2HGS A;  2WTF A;  3TQ1 A;  2EIJ B;  4O4I F;  4NTX A;  2XCA A;  5CB4 A;  1BNC A;  3T99 A;  4ZQI A;  2CGO A;  4JXU A;  4I50 B;  3QO8 A;  1K34 A;  4A3I G;  4DR7 H;  2YZL A;  4DLK A;  1PL4 A;  4F50 A;  2A3Q A;  2R7M A;  4HZ3 A;  3GTP A;  2BCC H;  5B1A C;  2ETN A;  1DGS A;  4PA6 A;  3CRQ A;  1NVP B;  2Q5Z A;  3I55 V;  4LFB H;  4I0X B;  4DR7 O;  5KFB A;  2HHF A;  3RGX A;  5LHH A;  4E6N A;  4IRC A;  4NXN O;  3CRA A;  2VQD A;  1WP8 A;  1Y74 A;  2ZIN A;  5GON B;  5B1B C;  2Q0O C;  2JEX A;  1IXM A;  4IHJ A;  4LH7 A;  5LGT A;  2EJ7 A;  2EIM B;  1PK8 A;  4O81 A;  1T3N A;  5DED A;  4CS4 A;  3CCE V;  3RB4 A;  4JTC B;  4X65 B;  3CJH A;  1RFY A;  1P4R A;  4MT8 A;  4ECY A;  4XBF A;  1S10 A;  4FLX A;  3U55 A;  1K83 A;  4ZIB A;  2X0S A;  1Q82 W;  1JIH A;  3I5D A;  3R5F A;  5IWA H;  2HVQ A;  3W1B A;  2VUM G;  2ZE5 A;  4TSF G;  4FLT A;  3TEK A;  3BAA A;  1I3Q A;  3OR7 C;  1SET A;  4ECZ A;  1ZUQ A;  5DAA A;  5I60 A;  2EIJ C;  1TWF A;  4MV7 A;  5ITZ A;  4DV3 B;  2ZCE A;  4OPH A;  3K59 A;  4OGQ B;  1AVM A;  2Q6A A;  1VKZ A;  5KFQ A;  3K0D A;  3OM3 B;  1N34 O;  3L2P A;  3DTF A;  2FKX A;  1LNQ A;  3AG3 B;  5EWE A;  3H40 A;  4U6P A;  4GX0 A;  1J95 A;  1AUX A;  1EYZ A;  1CE8 A;  3RFR A;  3CSX A;  1B04 A;  5I47 A;  1K97 A;  1JVM A;  3ZMV A;  4EBD A;  1N34 B;  1V54 B;  2RGR A;  1XBL A;  5LMU H;  1FXH A;  4AQY B;  3H0G G;  4IRK A;  1H2G A;  1H38 A;  1S9F A;  4EFB A;  3T7A A;  4B3S B;  5JQG A;  4FU0 A;  2YZM A;  2UXB O;  1NS1 A;  2ZE8 A;  2R7Z G;  2CTR A;  5KFO A;  4EYI B;  4A3M G;  2JEF A;  4CKC A;  2HHF B;  3HKC B;  4B3S O;  1Q90 D;  4JI5 H;  2AGP A;  4J80 A;  2ILM A;  3CCU V;  5H9C A;  4LF4 B;  4IWX A;  3ZHS A;  2I87 A;  1CKN A;  4TQS A;  1GRJ A;  3CJH B;  5A9G A;  5IP9 G;  1E1Q G;  1M4U A;  2E76 B;  3JD1 A;  1VQN V;  5KFR A;  4Q45 A;  4DUY B;  4O7V A;  4B3R O;  4DIM A;  2KSW A;  3JAM N;  1MSD A;  2ZDH A;  3MD0 A;  5IJ0 A;  4YJ2 A;  1FJG B;  5IP7 G;  5DGA A;  1SER A;  1NU1 H;  1VQP V;  4B7K A;  2GSM B;  4GKK B;  1VS0 A;  2HJW A;  2WAQ A;  3F8N A;  4DR1 H;  3LSS A;  2E3C A;  1XMQ B;  5KFW A;  2EJ2 A;  1ZHS A;  3E89 A;  2YS8 A;  3AW8 A;  3B4S A;  4LF8 O;  5DG7 A;  4XYL B;  1OCC B;  2P0A A;  2XUM A;  2HHH B;  4RZR A;  2COJ A;  4GKJ H;  1G4Y B;  1RP3 B;  3BY6 A;  1AJP A;  4YIO A;  3WWH A;  2VA3 A;  3T1H O;  2R92 A;  3JAK A;  3H20 A;  4B3M B;  3GJX B;  5L3F A;  1I7N A;  5L1L A;  1ZQ7 A;  5J2U A;  3GTL A;  3OTF A;  1BGW A;  2V1D A;  5FNV A;  4KHP H;  3SYQ A;  3RGB A;  1EBO A;  5KFU A;  3CWB H;  3PJS K;  1D5N A;  1I94 B;  2ZIO A;  2R93 G;  3VNN A;  4X9Q A;  2UUB O;  1SF9 A;  1WCM G;  1KC8 W;  1W96 A;  3IG0 A;  2CDY A;  2W6M A;  1K33 A;  3DC6 A;  2HFE C;  3KZI Z;  4YJ2 B;  3SYC A;  5IJ0 B;  3N27 A;  4I4T F;  5GTI Z;  1TVK B;  4CS2 A;  1VBG A;  2EJR A;  3M99 B;  2IMW P;  5C8Y B;  4PV1 B;  4EBE A;  2P67 A;  4RAZ A;  4PDL A;  5LA6 B;  2VQE O;  3G6X A;  3KXY T;  1HNW H;  2DQ0 A;  4OX9 H;  1N56 A;  4I0X A;  3J80 N;  2WLL A;  4BY7 G;  4DW1 A;  1QR8 A;  3OMI B;  1OCC C;  5FJ8 G;  4W4K A;  1IBM B;  3AK2 A;  5JVD A;  3W7U A;  1IOW A;  4B7E A;  3L72 H;  3FKI G;  4QWE A;  3DTU B;  2QK4 A;  4I4T B;  1PD3 A;  4X1Y B;  2EIY A;  5J9P C;  1S0O A;  5KHK A;  4IYI A;  2OTJ V;  1YJW V;  5H2F Z;  5L1I A;  3A0B Z;  1T36 A;  1E4G T;  1OBD A;  2JA7 G;  3T1Y B;  4RCN A;  5KFJ A;  2DYR C;  4JYA H;  3APQ A;  2EIN B;  4ICG A;  3K3V A;  4DUZ H;  5BYB A;  1Y66 A;  4FM1 A;  2Q7D A;  1K4C C;  1YXB A;  4J7Z A;  1WPB A;  4LF6 O;  4I50 F;  5K3W A;  2Q4P A;  3W7X A;  4DV4 O;  5BWW A;  3ZMT A;  3ZED A;  2I80 A;  4O3N A;  2VWJ A;  4J9M A;  5BR8 O;  4JI2 O;  2WA4 A;  3CRR A;  4FMT A;  4ZHQ B;  1LUV A;  2Q68 A;  4CH6 A;  2R9I A;  5IY5 B;  4WF9 V;  4LF8 B;  4LF5 B;  2UVW A;  1MMM A;  2X6A A;  4GT1 A;  3OD4 A;  1ZTE A;  2XAH A;  4J41 A;  1XDC A;  2XGQ A;  3CC7 V;  4R8C A;  4JI2 B;  2C22 A;  3HOZ G;  1B3Q A;  2LFR A;  5IYZ B;  2UUC H;  1N36 B;  4MTF A;  1QVG U;  2R72 A;  4DL6 A;  3R9R A;  4RAI A;  4U7O A;  1NH2 D;  2CH7 A;  5KFC A;  1R6T A;  2WLK A;  4O3R A;  4EQ5 A;  1RPO A;  2WLH A;  4FFR A;  5I5Y A;  3K03 A;  4M9U A;  1EKP A;  3GIK A;  2ZQM A;  5KFT A;  4J9P A;  3LDD A;  4B08 A;  5L9X A;  4PA7 A;  4YHH H;  1ZL8 A;  2DAB A;  3T9F A;  3U0Z A;  3ZIA G;  3N6X A;  2L6L A;  4YXW G;  4X89 A;  3MR6 A;  3GV5 B;  3F7V C;  4FS1 A;  2BR0 A;  4JI8 H;  1K4D C;  1RSO A;  2WAM A;  4FFN A;  2AGO A;  1HP8 A;  5EYP A;  1I1L A;  5KFG A;  1VMG A;  4F4X A;  1Y4M A;  3BQ1 A;  5KHJ A;  5EC1 C;  4TQR A;  1OCO B;  5KFK A;  4BIO A;  4A93 G;  5IY5 C;  1Y76 B;  2FTK A;  3D36 C;  2WWW A;  1XNR O;  3FB7 C;  4JI7 B;  4TWK A;  1EZV H;  3AG3 C;  1KKC A;  1GM9 A;  1RK5 A;  4FFO A;  1GN4 A;  4J7K A;  1VQO V;  2ZM6 H;  3OR6 C;  1Q6I A;  1WPX A;  4K0K O;  1ZSP A;  3HBL A;  2ZT9 B;  2FK3 A;  3EPI A;  1BCC H;  1JCH A;  3KG2 A;  1MNG A;  1VF5 B;  3VQX A;  3Q2O A;  1IBL O;  1WNS A;  1ARO P;  3WB0 A;  1P16 A;  3T4Z A;  2UXC O;  4ZBM A;  3CVZ A;  3OE7 G;  3RYC B;  4KL1 A;  5CA0 B;  5LYJ B;  2XD4 A;  3LSU A;  1NH2 B;  2X7R B;  4JAU A;  1VQL V;  4TUY A;  5LXT B;  5LMU O;  5ITZ B;  4J10 A;  3SE7 A;  2VA2 A;  2CH7 B;  4P9P A;  5H6R A;  3FB8 C;  3MWD A;  4ECS A;  3GTM A;  5EBM C;  4BIZ A;  4LFA H;  4Z2W A;  4DR1 B;  1Q7Y W;  3HKE A;  4U7C A;  3HR0 A;  1J5E B;  1FJG H;  1AR4 A;  4AYB A;  3PFF A;  1MAB G;  3HOX G;  3JRX A;  3AG1 C;  2E2I A;  2A9H A;  3H1I H;  1QQC A;  1S03 G;  1SC5 B;  4O4I B;  3TY9 A;  3JAL A;  1K1Q A;  1HNX B;  5BXZ A;  3PW0 A;  3KCX A;  4JYA O;  2X0L A;  3KHR A;  3ZHR A;  3I4M G;  1XUQ A;  1ZLZ A;  2DN9 A;  3DGE A;  3QTC A;  2E5L B;  4YJ3 A;  4EFE A;  4GC7 A;  4DV2 B;  4LF4 H;  4PDR A;  3CSW A;  1N36 H;  4DR3 B;  5KX5 F;  5L3E A;  4LFC H;  4I55 B;  4H33 A;  4O4H F;  4DL7 A;  5KFN A;  3E5N A;  1L8D A;  1G6U A;  2CGN A;  3HKB B;  3Q8R B;  4LF8 H;  4NYK A;  2R8J A;  1L1F A;  3CRC A;  2R85 A;  4DRX B;  3D8C A;  2WB1 A;  1N8R W;  3Q4H B;  3RR5 A;  2K1E A;  3ETJ A;  4CKE A;  2GUZ B;  5KG2 A;  4QWB A;  2UUA O;  4JI0 B;  2P6J A;  2PI5 A;  2QKC A;  1SFO A;  2YDE A;  4DR6 H;  2PMZ E;  3APO A;  4FBT A;  1OCZ C;  2QDO A;  4O4I A;  2WLI A;  3AG1 B;  2JEJ A;  4DR2 O;  2GPW A;  5B3S B;  5FPO A;  2FL4 A;  3AK3 A;  3UO3 A;  2ITC C;  2HDK A;  5KX5 B;  4IR1 A;  5DIS C;  4FZ1 A;  3C90 A;  2FPP B;  3OSN A;  3EXA A;  1HNZ H;  1ZAU A;  2CKZ B;  5EC2 C;  4PD4 F;  4RQF A;  2M6Y A;  2MCT A;  1E79 G;  3V6J A;  4LBE C;  4FFM A;  2PVP A;  2EIL C;  4DV0 O;  3HKZ A;  1YCI A;  4ZOL F;  4Q0Y A;  3ZRW B;  3RAQ A;  3N42 B;  3ZRX A;  2BTQ A;  1HR0 O;  1KJ8 A;  4MA0 A;  1NTZ H;  1I7L A;  2DAA A;  2E75 B;  1AR5 A;  2P4K A;  2WAQ E;  4O2A B;  4NXN B;  4QIW F;  1UC9 A;  3HB9 A;  1XMO B;  4DR6 O;  3FB6 C;  3U9S A;  2W6Z A;  3LP8 A;  3ZN1 A;  1BE3 H;  1O9G A;  2O03 A;  1IVS A;  4FLV A;  1J5E O;  2XIG A;  5J2T B;  1FXK A;  4LFB B;  4HR7 A;  2DYR B;  1IXB A;  2EIN C;  5CR5 A;  3FYE B;  2QR4 A;  4ED6 A;  5HNE A;  3UZO A;  1SQV H;  3ASO C;  2HEP A;  1OCZ B;  2W6P A;  5BWR A;  3VPB A;  5EIB C;  5C44 G;  1JX4 A;  4DR7 B;  3W7W A;  2R70 A;  1JKJ B;  5LMN B;  1CQJ B;  3K5M A;  3MFH A;  4FIP C;  4JZG A;  4BWS C;  3RB0 A;  5CAE B;  5H6Q A;  1SYX B;  4QPJ A;  2VQF B;  4JV0 A;  4NR1 A;  1XK5 A;  2HR3 A;  1XMQ H;  1AI6 A;  3CC2 V;  4KUM A;  5D5P A;  4O84 A;  3N8D A;  4XDL A;  2OCC B;  1CP9 A;  5C1O A;  2DWD C;  3AG4 B;  2DW4 A;  5KFH A;  3GTQ A;  1WAZ A;  5C4X G;  3O9O A;  2O57 A;  3BAC A;  3OUZ A;  2B63 G;  1ENV A;  4JTA B;  3OEH G;  1EHI A;  2D3O W;  1Y1V A;  1QR9 A;  4ZHQ F;  4WBN F;  4ECU A;  5DGH A;  2WLN A;  3WB2 A;  3X2Q B;  3JYC A;  4TM5 A;  2ZNI A;  1F4N A;  2Y48 A;  3MHH C;  5KFX A;  1XMO H;  4NXN H;  1KU9 A;  2GLT A;  1Z5W A;  4ME6 A;  4C5A A;  3RYF B;  1ORQ C;  4CHI A;  4L87 A;  3VBB A;  4FLW A;  3KAJ A;  3MJF A;  2EZO A;  3ASO B;  1SZT A;  5CA3 A;  3CCL V;  4CMF A;  4MW3 A;  3K3W A;  3U0G A;  2P90 A;  3WO1 A;  2RMK B;  4TV8 F;  4DR5 H;  3JAT B;  3HPL C;  1HNZ B;  5KT3 A;  3LML A;  3L73 H;  1OCO C;  4R50 A;  4PI2 A;  4EEQ A;  1TAE A;  3ETQ A;  1VQ4 V;  4ZI7 B;  4X66 H;  4IZO A;  2P06 A;  1K1S A;  4MV9 A;  4EGJ A;  4APM A;  2PGG A;  2MK3 A;  4RNN A;  3OFN G;  1GMG A;  1V51 A;  4G28 B;  2B9Z A;  1FJG O;  4FGR A;  5BYA A;  2DQ3 A;  2VR1 A;  4ECW A;  1THZ A;  5IYB O;  4ECT A;  3T2M A;  4O7Y A;  3OGI B;  1HWY A;  1I6U A;  1R3L C;  1BHB A;  4RNM A;  3MAQ A;  4NVP A;  4JPR A;  2XAQ A;  3F5T A;  1MZF A;  3PO2 G;  3K08 A;  5LBQ A;  2B1I A;  2QKS A;  2KQX A;  4DV3 H;  3JAK B;  5CBG A;  1A0I A;  4BW5 A;  1ZHQ A;  1YDX A;  1P7G A;  3HXL A;  5C3E G;  2LW1 A;  2Z04 A;  3G71 V;  5DQI A;  3JAT A;  1ZL8 B;  2IJH A;  1L0N H;  3E8F A;  3CPW U;  2OIG A;  3F7Y C;  1BSM A;  3RT3 C;  3G8C A;  1N33 H;  4PWQ A;  3OUU A;  4FM2 A;  3OUF A;  4WFG A;  1C30 A;  2NVY A;  4O3S A;  1H2S B;  3LNM B;  2YS6 A;  2E5L H;  4JI1 B;  1HW7 A;  1NT2 B;  1VQM V;  4MSW C;  2COG A;  4JTD B;  4X66 O;  3Q8Q B;  5EK0 A;  2KB1 A;  1RJP A;  3BA9 A;  2F95 B;  4YR3 A;  3RYC A;  4QIW E;  4I9W A;  4Y8V B;  1QLE B;  2IBK A;  4LFA B;  2GTS A;  2W6J G;  3G80 A;  1N32 B;  1GAX A;  2BQ3 A;  2YC0 A;  3UT5 A;  4X1Y A;  3GLK A;  2VQF H;  4QE7 A;  4O7T A;  3JZI A;  5KG0 A;  4IR9 A;  3DTG A;  3NC0 B;  1TUE B;  2HG8 A;  4LF7 B;  1GN2 A;  4JAS A;  1K5S A;  1D2D A;  4WFA V;  2FP4 B;  4LWS A;  1AJN A;  1O9H A;  2PY5 A;  2X6C A;  3V6H A;  1KC7 A;  1HR0 H;  2E74 B;  3WWI A;  2HVS A;  3CCR V;  2ZR2 A;  4MTX A;  4ECV A;  5IYC O;  3ABM B;  3OUS A;  2V5A A;  4Q8E A;  4J9L A;  1U96 A;  4I50 A;  2EJ3 A;  3B09 A;  1NVP D;  4DL2 A;  1IYE A;  1IBM O;  5FR9 A;  1I2L A;  3TK1 A;  1Q3E A;  2N05 A;  5B3S C;  2OTL V;  3ABT A;  2DYS C;  1TUB B;  4CC5 A;  3A0R A;  5LHG A;  5IYD G;  3RBD A;  3JAW B;  3VQY A;  3K5L A;  1P8L A;  5L1K A;  2Y4T A;  2W9C B;  2VOB A;  4DUY O;  4GCZ A;  2ZKO A;  4B3R B;  1QBZ A;  5L3D A;  4FBU A;  3J81 W;  3R66 A;  2P5O A;  3S3X A;  5IJ9 B;  3GTK A;  2C35 B;  4DV5 B;  1QLE C;  3SDL A;  4B3M O;  3RUP A;  4DL5 A;  2EIL B;  4O4L B;  3RF2 A;  2Y0S A;  3ICX A;  3NUA A;  3AK1 A;  4IIJ B;  3IC9 A;  2WLJ A;  1RM1 B;  3IAY A;  2HVK C;  2V58 A;  4FJC C;  1DK1 A;  1VQ8 V;  4B3T B;  3VQV A;  1KQS U;  2ZGI A;  1JOY A;  2JA5 A;  2R87 A;  5LGU A;  3BQ0 A;  4CH3 A;  1IDS A;  1JJ2 U;  5I5X A;  1W93 A;  3M9M B;  3KKY A;  1FFT B;  1OHH G;  3RN4 A;  3L75 H;  5C8Y F;  3B77 A;  3T1H B;  2F23 A;  2Q8V A;  3L74 H;  2X5R A;  2JA7 A;  1N48 A;  2HLD G;  1NKD A;  2QWP B;  4QW8 A;  2COI A;  4JUZ A;  1GSO A;  1SKV A;  3U10 A;  4LR3 A;  3BQ2 A;  3L70 H;  1I94 O;  4Q20 A;  4U3J B;  4LCU C;  2IA6 A;  1GK9 A;  2QWO B;  3BA8 A;  3RGZ A;  3JAW A;  4I9Q A;  5FL7 G;  3P32 A;  1FPO A;  1R73 A;  4UCO A;  5D1O A;  4A3C G;  3LUT B;  2XTA A;  4FS2 A;  3PZP A;  1M57 B;  5J2U F;  2YCH A;  4J0M A;  4TV9 F;  2IW5 A;  3TGU H;  4I7H A;  4UUJ C;  4DQN A;  3TXS A;  4QGP A;  3UZB A;  4O4J A;  3NGD A;  2UXD H;  2OCC C;  2Y4U A;  5JQW A;  2R7K A;  4LFC B;  3AG4 C;  4TOI A;  3RW0 A;  1R1B A;  4DUZ B;  1YIJ V;  2DLN A;  5KG1 A;  2CNQ A;  2CTW A;  4ABM A;  2V4Q A;  4DV2 H;  2QE7 G;  3VOT A;  1XNQ B;  5F9N A;  1QHT A;  3T1H H;  4FM0 A;  2YI8 A;  3E35 A;  3HOV G;  5TIS Z;  4JI3 H;  3X2Q C;  1Y1W G;  5BZB A;  3L9D A;  4DUZ O;  3KYH C;  3U11 A;  2R9A A;  3N44 B;  1J5E H;  4IWY A;  4Z1M G;  1A3G A;  5KFV A;  1IBL H;  4UXN A;  3D3Q A;  4RUE A;  2XOK G;  4DK1 A;  1KP3 A;  1OJH A;  4O7Z A;  1G2W A;  4RQE A;  3O65 A;  4ED0 A;  2QWQ B;  2XAS A;  3W7S A;  1HNW B;  1FKA O;  1SQF A;  2J9G A;  3LWB A;  3FX7 A;  2AW9 A;  1XNR H;  4B3R H;  3PW5 A;  2DJV A;  3TW7 A;  4MVO A;  4A3J G;  3CB2 A;  2PUS A;  3H01 A;  1Y67 A;  5HFM A;  2E2H A;  4MV4 A;  1X59 A;  5CA0 F;  4QWA A;  1HNW O;  3NXS A;  3HKB A;  4LH6 A;  3M8A A;  4MW8 A;  4F6R A;  1VAR A;  5FD5 A;  5EWF A;  2RJZ A;  4MTO A;  2JEU A;  3P3P A;  2FB9 A;  4UB6 Z;  4DRX A;  2IP4 A;  4YQW A;  5C93 A;  2ATL A;  1GM7 A;  2ADP A;  4Q43 A;  1KMI Z;  4GC6 A;  4RB0 A;  2ZDI C;  1WA8 A;  1BJT A;  5LGN A;  4O2B A;  4B3M H;  3SYA A;  1S0V A;  1AP5 A;  2NLJ C;  2GQR A;  2UXB H;  3K9A A;  1AI4 A;  4HBN A;  4LNU B;  5DG9 A;  3UO2 A;  1DV1 A;  4GKJ B;  3SNO A;  4O3O A;  3L4J A;  5EZY B;  4JV2 A;  2HKO A;  3ETE A;  3BHP A;  1Q86 W;  5DEC A;  2VUG A;  4IYH A;  1DLB A;  4ZI7 A;  3TII A;  2MW2 B;  4QIW A;  1PPJ H;  5JWP A;  3RIZ A;  5B1N A;  1GKF A;  1K3E A;  1GO3 F;  2ZNJ A;  4H0L B;  4JI3 O;  4ZI7 F;  4BWA A;  4FFL A;  2OH2 A;  4GKK H;  3ZHU A;  2Y4R A;  1FXV A;  2PBZ A;  4E4T A;  1IBL B;  3MDS A;  2M7W A;  2R82 A;  5BWX A;  2Q2T A;  1CXZ B;  1CS0 A;  3W5O A;  3JCU Z;  3RWR D;  2R7N A;  1TA8 A;  2YZN A;  1VQ5 V;  2R8H A;  4JI3 B;  2OYQ A;  3JD4 A;  2GTA A;  2A06 H;  2CNU A;  3JD2 A;  4O4L A;  4A3E G;  1K9M W;  3K0G A;  2W0F C;  4PBC A;  4WD3 A;  3SPG A;  3JZF A;  2BTQ B;  4JI2 H;  1QLN A;  3T9A A;  5E1A C;  2ZXW C;  3EVK A;  1WSC A;  4ED7 A;  5KX5 A;  5I5W A;  4X20 B;  3FAV B;  3CME V;  1MZB A;  2FK2 A;  3E8H A;  3BVO A;  3A0H Z;  3K5I A;  4J9N A;  5GW7 A;  2B1G A;  5HFL A;  2Q7H A;  1VQ9 V;  1QNM A;  4TUY B;  2N74 A;  3ZJZ A;  3SI8 A;  4B3S H;  2F4V O;  4XX0 B;  3KAK A;  1AJQ A;  1UC8 A;  5KT7 A;  2E5L O;  4AQY H;  5LMU B;  3ABM C;  1EN4 A;  2W57 A;  3RBE A;  1Y1W A;  4HNA B;  2ZJT A;  2C2R A;  2EUL A;  5JJJ B;  2IU3 A;  3CEI A;  3I12 A;  2AXT Z;  3T1Y H;  1YZB A;  2EIK C;  5FLM G;  4MV1 A;  1RK6 A;  2PMZ A;  3IC7 A;  1NZ6 A;  3GIP A;  3DC5 A;  1BS3 A;  4GZR B;  2DYS B;  2YI9 A;  1RPR A;  4JI6 O;  4J9Q A;  1R9T A;  5L3B A;  5J2T A;  4JI4 B;  3GIM A;  4EBC A;  3STL C;  1V55 C;  1Q5O A;  2C00 A;  4MS2 A;  3T9D A;  5K1P A;  4QWC A;  4EYH B;  2LW7 A;  4CC6 A;  1WB8 A;  1P84 F;  4BW9 A;  5KUM A;  1CKN B;  3U9T A;  3JRW A;  2ZXW B;  2F1M A;  3BAB A;  4PJ0 Z;  2RN9 A;  2W6Q A;  4ECQ A;  4QW9 A;  1RM1 C;  2DZD A;  5C1P A;  1R3I C;  1Y74 B;  4BXX G;  3LSQ A;  4XYM B;  2FML A;  3SPH A;  5GTH Z;  3I56 V;  2Y0I A;  5LMN O;  3RBZ A;  2KG7 A;  5BMV B;  2JEG A;  3LUL A;  2XCP A;  4FPP A;  2OIE A;  3VPC A;  3AYH B;  5A2Q W;  4IRD A;  4WFE A;  2AGQ A;  3SGI A;  1K5Q A;  4GUN A;  3KHH A;  5JQG F;  1I94 H;  4EGQ A;  2JA6 G;  2JS5 A;  1XL6 A;  3AEI A;  1WB7 A;  2BSK A;  5CBF A;  3HKZ E;  5KFA A;  4AYB E;  2UVV A;  1M9N A;  1B6S A;  5CN0 A;  5C8Y A;  2CFM A;  4TQF A;  2DPI A;  5KA5 A;  1KB9 F;  1BMF G;  1M57 C;  4KP4 A;  2Q7E A;  3CCS V;  1K7D A;  1V55 B;  1M6V A;  2GV9 A;  2HJF C;  1XI1 A;  2XND G;  3E22 A;  2UXD O;  1Z2N X;  5J2U B;  3QQM A;  4CMD A;  4K8X A;  2RF4 A;  5BWU A;  3RV3 A;  5KS8 A;  2KKW A;  5LMN H;  4FVM A;  1M5I A;  4LMY A;  2Q73 A;  3ZRW A;  3E2E A;  1DV2 A;  2ZD9 A;  1SQQ H;  4WFH A;  3E83 A;  3T5J A;  1A0G A;  3UM7 A;  5DLF A;  4JV5 H;  1WR2 A;  1COW G;  1JFF A;  1DTO A;  2ATK C;  3IFX A;  3WG7 B;  3ZN0 A;  3CYO A;  4DUY H;  4PZ6 A;  4QWD A;  4MA5 A;  2AQ4 A;  4HQ6 A;  4XZ3 B;  3CQZ A;  4A3D G;  1N0N A;  4JI5 O;  4X8A A;  3K9S A;  5KMG A;  4QJF B;  3F5W C;  1FFX A;  3OHB A;  2H8P C;  3MFI A;  4D6T H;  1GLV A;  4NXM B;  5KFZ A;  3GDE A;  2Y69 C;  3T5H A;  2WLL B;  2EX3 A;  1N33 B;  1VEW A;  4IHJ F;  1NTM H;  5BWT A;  2RDI A;  4JI5 B;  2HHH O;  1F4M A;  4JI4 O;  4DV3 O;  2DWC A;  4FLZ A;  2FLL A;  5LXT A;  5EOY A;  3P3N A;  2V9W A;  2DE0 X;  3GV8 B;  2YID A;  2LGQ A;  3G67 A;  4EKW A;  5EDW A;  1PX2 A;  3CD6 V;  1PP9 H;  3HB3 B;  5JCO A;  4MTE A;  1RJQ A;  2IH1 C;  3ZHT A;  1VQ6 V;  2WLI B;  1N34 H;  2BE3 A;  2AU0 A;  4J42 A;  5DGB A;  2FKL A;  4G2K A;  1WP7 A;  2YWV A;  5DGI A;  2CE4 A;  4M7E A;  1FVI A;  1H8E G;  3KRE A;  4J9O A;  1JX9 A;  2JK5 C;  5JJE B;  1SEI A;  3ZX6 A;  1HNZ O;  5LL6 Y;  5EIB D;  1ZWI C;  2PZS A;  1RYR A;  1EN5 A;  2YRX A;  5KFM A;  4FK5 C;  1GH6 A;  3JAR B;  1ZET A;  4C2M A;  4X88 A;  3SJA C;  4X66 B;  1E1R G;  1EKV A;  1AIL A;  2Y69 B;  2NU7 B;  1P7B A;  4R8U A;  1W0K G;  5L3G A;  3LDE A;  4DR5 B;  2IJK A;  1V9P A;  2HP8 A;  3ABL C;  2R93 A;  1YF2 A;  4G3I A;  4ETS A;  4DV6 B;  5IYZ F;  4GYC B;  4RB1 A;  4RWU A;  4BBS G;  2W0X A;  3DXR A;  2YEV A;  4HAM A;  5D1P A;  4X65 H;  2BOB C;  3UQ8 A;  1KT8 A;  4NXM H;  5FPR A;  1I1K A;  4DV6 O;  1KJQ A;  5FLX W;  4BBR G;  1HNX H;  4LF7 O;  4RAY A;  1XMQ O;  2ZDI A;  3MR2 A;  2LP7 A;  1RSO B;  1S76 D;  2HHH H;  1UPG A;  4LNU A;  2J6T A;  2FJZ A;  4RU9 A;  4DV5 O;  4LSX A;  1IZ3 A;  4DV1 B;  2GQS A;  5BR8 B;  1KEC A;  2Q69 A;  4J9Y B;  4PZ8 A;  5LOV F;  3ETH A;  4MV6 A;  1R3K C;  1WA8 B;  2BQU A;  3JCZ A;  1KEE A;  3HO8 A;  4JV1 A;  1CKO A;  3R5X A;  5KHH A;  3GQC A;  2FPG B;  4U3J A;  1WRV A;  3FKI A;  3HKE B;  1PV0 A;  2NN4 A;  1EKF A;  3CXH F;  3STZ C;  4O2A A;  1FAF A;  5DN6 G;  5FNV F;  5A2Q N;  3G6B A;  1EUD B;  4MVM A;  3G6V A;  5EZY A;  5I5S A;  3BRC A;  3TXQ A;  2XAG A;  2EIK B;  5HBR B;  2LFS A;  1V4Y A;  4C5C A;  2ZM6 B;  5CA1 A;  4GLX A;  3PN1 A;  1CEZ A;  3V4Z A;  1M56 B;  1Y14 B;  1S0N A;  2R8K A;  2R7Z A;  1IUR A;  2JJ2 G;  3QZ7 A;  4C7U A;  5KFP A;  1KJI A;  4JI7 H;  3WFV A;  5B66 Z;  4UCU A;  5CA1 F;  2NUA B;  2AZ2 A;  1H2L A;  2V4R A;  1F23 A;  5KFL A;  3N2K A;  3WO0 A;  2NU8 B;  2YIB D;  2DIK A;  4FFK A;  2QM7 A;  3HOY G;  2WPD G;  4CZZ A;  3N43 B;  4OPA A;  1LR1 A;  1I08 A;  2HIV A;  3KHG A;  4F4W A;  1JXL A;  4LFC O;  3TIG A;  4JI8 B;  1CKM A;  5BPH A;  4FFB B;  1IX9 A;  2WLM A;  3FD9 A;  4NB5 A;  1H8H G;  3PVX A;  4MVS A;  1KJJ A;  4A3G G;  2VQE B;  4LF9 B;  4Q6G A;  2IJJ A;  5E25 A;  2HVJ C;  3JD3 A;  5LOV A;  2WB1 E;  3FDS A;  4JI8 O;  4ZOL A;  1WLE A;  3J7A K;  3OHA A;  1DF5 A;  3JZ6 A;  4QJF A;  1R3J C;  5B1O A;  3OSP A;  1XNQ H;  3SYO A;  2BTO A;  2L35 A;  2N04 A;  3IGA C;  4DV4 B;  3FB5 C;  4RUC A;  1JR9 A;  5F2V O;  1NI8 A;  2W8L A;  1XIL A;  4FFP A;  3OMN B;  4DYL A;  3ABU A;  1VQK V;  3G4S V;  5IDJ A;  4PI0 A;  4PDV A;  2EZP A;  1S68 A;  1L0L H;  3PR4 A;  3HOU G;  3A8T A;  3VPD A;  3T1Y O;  4YHH O;  4KFM A;  2LO1 A;  2OWO A;  4GKK O;  3ZMU A;  4O2B B;  1I2K A;  1EZJ A;  5GON F;  1FXK C;  1S72 V;  4HNV A;  3GWK C;  1FYJ A;  5DG8 A;  5CM0 A;  4DL4 A;  1GN3 A;  5LL6 b;  1GTO A;  4GX1 A;  1KD1 W;  2YXL A;  5B5E Z;  5I5T A;  4MAM A;  1TVK A;  4F4Z A;  1B6Q A;  1QVF U;  2VPS A;  3SJC C;  4A3K G;  4DR3 H;  1YSC A;  4JYA B;  5LA6 A;  4UCV A;  3WG7 C;  5H80 A;  2A7W A;  4DL3 A;  4X62 B;  2C2D A;  3VOU A;  2I8C A;  1XOU A;  2WSS G;  4QE9 A;  1BQZ A;  1T94 A;  1Q81 W;  5KFI A;  2AGA A;  2XC9 A;  4DK0 A;  4YY3 O;  4NZM A;  2DOS A;  1NBM G;  2Z3Y A;  4P9O A;  2YL2 A;  3PW4 A;  2JGD A;  3DF7 A;  5KFD A;  4I5S A;  5JVD B;  2FYU H;  3OAA G;  3K3P A;  2OT5 A;  2UU9 H;  3NBY B;  2R8G A;  2CW8 A;  4J9R A;  4TT3 G;  4B3T H;  4FFB A;  4HYO A;  4AI8 A;  3GIL A;  1AB3 A;  2UUB B;  4CH5 A;  3QG5 A;  4ZHQ A;  3E22 B;  4H37 A;  2VPQ A;  4MVQ A;  3ZMZ A;  1KUT A;  3TJT A;  1Z5V A;  1ET0 A;  2ZIM A;  3EPG A;  1GM8 A;  2ZE6 A;  4EB6 B;  4JAA A;  1S5H C;  3ZS8 C;  2YW2 A;  2BOC C;  1FXK B;  4ED8 A;  2VRZ A;  4J9K A;  1YTF B;  4UCR A;  2Z5U A;  3BPZ A;  3E86 A;  3VMM A;  4QSH A;  1URF A;  5J2T F;  1US6 A;  2P22 C;  2CK3 G;  1G1X B;  3OTO H;  2B5U A;  4O3P A;  4LWS B;  2ZR3 A;  4PA9 A;  3G8D A;  5D8D A;  1WH2 A;  3SJB C;  1JDE A;  2QTS A;  1SQG A;  4CKB A;  3JAL B;  2HGW A;  4RUF A;  3N6R A;  4F4Y A;  4WHX A;  2QWN B;  3RV4 A;  1FD9 A;  1YIT V;  4YB8 B;  3RJ0 A;  3Q8S B;  3B8N A;  3CP1 A;  3MWE A;  3UT5 B;  1IOV A;  5KFF A;  3GTJ A;  2Q0A A;  4YIP A;  4ECR A;  3L71 H;  4X1I B;  3IN5 A;  2FLP A;  1SES A;  3ORQ A;  2ALZ A;  3ABL B;  1H2M A;  1MG1 A;  3RB3 A;  3PW7 A;  2C2E A;  4A3F G;  4PA4 A;  1EZ1 A;  1Y76 A;  1NTK H;  3JAS A;  2QA4 V;  4CE5 A;  4Q8F A;  1N32 H;  3TY5 A;  3ML0 A;  4N21 A;  3I4N G;  2SCU B;  3M7M X;  4O2A F;  2PTM A;  3OTO O;  1AUV A;  2V4D A;  2R6F A;  2UU9 B;  4A2B A;  1VIB A;  3WB1 A;  3N2K B;  4A5U B;  4JI6 B;  2UUC O;  3G6E V;  3JSL A;  1BXR A;  3KAL A;  2HIX A;  4PDM A;  3BG5 A;  2R9R B;  1I0H A;  5I5U A;  4BY1 G;  4JI1 H;  4MVU A;  1S3J A;  1AI5 A;  2JVD A;  3LQS A;  4O4H A;  2NR5 A;  5L3C A;  5IT9 W;  5IYB G;  1Y6X A;  2RDC A;  2UUC B;  2BQR A;  2JEI A;  3M4I A;  1M93 A;  4I7Z B;  4WFF A;  1I50 A;  1I5X A;  4K8Z A;  2QB5 A;  1NR1 A;  4TVI A;  2VWK A;  2EJ0 A;  1E4E A;  2FK1 A;  4UV8 A;  1BT8 A;  2VQF O;  4NTW A;  3S24 A;  4DV2 O;  4XDK A;  4O7R A;  4DR3 O;  1ROP A;  1SS3 A;  2LGW A;  2GPS A;  2HVR A;  3QNE A;  4YR2 A;  2JDI G;  5LP6 A;  1IBK O;  2Q67 A;  1M0W A;  2YEV B;  4F4L A;  3FFQ A;  3R65 A;  1H2K A;  5H5N A;  2YIC A;  3ZBH A;  3MWM A;  1XQ8 A;  1HDJ A;  1A9X A;  2ITD C;  2QM8 A;  3GIJ A;  3D36 A;  4JYY A;  5IYD O;  3SPJ A;  1MOF A;  2R8I A;  3QO7 A;  5CE8 A;  4MTD A;  1JA8 A;  3C3T A;  3H9V A;  3CCM V;  5IT9 N;  1XDN A;  2Y0S E;  2AHY A;  3EYY A;  4JI7 O;  2VS0 A;  1M56 C;  4X1K A;  3B2E E;  2Q9L A;  1VBH A;  4X64 B;  2QYZ A;  3PR5 B;  1OZ0 A;  1Q8I A;  2UUA B;  2W8K A;  1GYF A;  2EBO A;  5BWV A;  4LF9 H;  2CNV A;  1IYD A;  2ASJ A;  2VQE H;  1YVW A;  2YYA A;  3MHS C;  5BPF A;  4TV9 A;  1AR1 B;  3EHB B;  2Q2U A;  1K73 W;  1XHX A;  3GTG A;  4X20 A;  5IWA B;  4OX9 B;  4XDJ A;  2QWR B;  2JIZ G;  4JYC A;  3B40 A;  1VP7 A;  3K5H A;  4A2A A;  4O7L A;  1N4C A;  4FLU A;  1KBL A;  4RUA A;  5LP6 B;  4NZO A;  2V7Q G;  1MZE A;  1F7Y A;  2JS3 A;  2WE6 A;  2QJ1 A;  4DW0 A;  1S97 A;  1Z2G A;  3FKS G;  3N2G B;  3H4B A;  4UVA A;  1YEW A;  4DV7 B;  2YS7 A;  5KG5 A;  4PDB A;  5FLX N;  2OCH A;  5K2M A;  5LXT F;  5L1J A;  4J11 A;  3RTX A;  4TV8 A;  4EG0 A;  2C28 A;  1S77 D;  2W9C A;  1B33 N;  4E2L A;  4JAV A;  1YI2 V;  1HNX O;  4DV7 O;  2AZ0 A;  4RB2 C;  3JD0 A;  4FLY A;  3RAX A;  4O7N A;  3UYY A;  3OGC C;  1WJZ A;  2AHZ A;  3RVZ A;  3CEB A;  1JPX A;  2WA3 A;  3JSN A;  3CS5 A; 
#chains in the Genus database with same CATH homology
 4LF7 H;  4IIJ A;  3RYH A;  2GV9 A;  4BWS C;  1XI1 A;  5CB4 A;  3E22 A;  1SYX B;  1Z2N X;  5J2U B;  2HHH H;  4K8X A;  2VQF B;  2KKW A;  4I50 B;  4FVM A;  5LMN H;  1XK5 A;  4DR7 H;  1M5I A;  4LMY A;  1XMQ H;  5D5P A;  2XHB A;  5BR8 H;  5BMV A;  1DGS A;  4JV5 H;  5LP6 C;  1JFF A;  3DSQ A;  4LFB H;  3HKD A;  4DUY H;  4PZ6 A;  3K5M A;  4E6N A;  3RGX A;  2ZIN A;  4DV7 H;  5GON B;  5KMG A;  2WDT A;  1FFX A;  4IHJ A;  4LH7 A;  3WB2 A;  1XMO H;  2ZNI A;  4NXM B;  3JAS B;  4CS4 A;  3GDE A;  4NXN H;  1KU9 A;  4DR2 H;  1Z5W A;  4X65 B;  3RYF B;  2EX3 A;  1N33 B;  4FLW A;  3KAJ A;  4ZOL B;  4JI5 B;  4FLX A;  5CB4 B;  4ZIB A;  4FLZ A;  5JCO C;  5LXT A;  3JAR A;  5IWA H;  5CA0 A;  2HVQ A;  3W1B A;  5EOY A;  4FLT A;  4DR5 H;  3BAA A;  3JAT B;  1HNZ B;  3LML A;  4PI2 A;  4EEQ A;  5JCO A;  2Q7G A;  1TAE A;  3ETQ A;  4MV7 A;  4ZI7 B;  5ITZ A;  4DV3 B;  2ZCE A;  4MTE A;  4X66 H;  3K59 A;  4DV0 B;  4JI4 H;  4MV9 A;  2UUA H;  4APM A;  2PGG A;  1T5E A;  4X64 H;  1N34 H;  5FD6 A;  3L2P A;  2IM9 A;  4R7R A;  4DR6 B;  4PHZ A;  4RB3 C;  3RFR A;  4JI0 H;  1I6U A;  4M7E A;  1FVI A;  3CSX A;  1B04 A;  3MAQ A;  5LMN B;  4NVP A;  1SEI A;  5JJE B;  1N34 B;  2RGR A;  5EIB D;  4AQY B;  2PZS A;  5LMU H;  3J80 W;  4DV0 H;  4EFB A;  4O4J B;  3JAR B;  4DR4 H;  3JAM W;  3SJA C;  4DV3 H;  4X66 B;  3JAK B;  4B3S B;  1AN7 A;  5CA1 B;  5JQG A;  1A0I A;  1ZHQ A;  4I55 A;  3K5N A;  3HXL A;  5IYZ A;  4DR5 B;  2QM4 A;  4WBN A;  1V9P A;  3C0F B;  4D7T A;  4ETS A;  4DV6 B;  3JAT A;  3HKC B;  4GYC B;  4RB1 A;  3NBZ B;  4JI5 H;  3K58 A;  3L4K A;  1N33 H;  5D1P A;  2CW7 A;  4FM2 A;  4X65 H;  4LF4 B;  5FNV B;  3UQ8 A;  1H2S B;  1CKN A;  4NXM H;  5FPR A;  2E5L H;  4JI1 B;  4DRF A;  1HW7 A;  5FLX W;  1NT2 B;  4TV9 B;  1M4U A;  2PYJ A;  1HNX H;  3QWU A;  4RAY A;  4JI6 H;  4DUY B;  2KSW A;  2UXC H;  3BA9 A;  2F95 B;  3N41 B;  1FJG B;  5IJ0 A;  4YJ2 A;  5EYP B;  4LNU A;  3RYC A;  5LOV B;  3THO A;  4LSX A;  4GKK B;  1VS0 A;  3F8N A;  4DR1 H;  4DV1 B;  5BR8 B;  4LFA B;  5K1X A;  2E3C A;  1XMQ B;  3N2G A;  1ZHS A;  1N32 B;  4PZ8 A;  3UT5 A;  4X1Y A;  2VQF H;  2HHH B;  3A2F A;  5IJ9 A;  1CKO A;  5KHH A;  3NC0 B;  4GKJ H;  1E4F T;  4U3J A;  4LF7 B;  3HKE B;  4UCT A;  2YIA A;  4LSA A;  1O9H A;  2PY5 A;  4O2A A;  1HR0 H;  2UXB B;  2HVS A;  3JAK A;  3H20 A;  4B3M B;  5EZY A;  3GJX B;  3BRC A;  5J2U A;  3OTF A;  1BGW A;  5FNV A;  4KHP H;  4CH4 A;  2PYL A;  2CAZ C;  4I50 A;  3RGB A;  3TY8 A;  1I94 B;  4PZ7 A;  2ZM6 B;  5JQG B;  2ZIO A;  3PN1 A;  5CA1 A;  4AHC A;  4GLX A;  3VNN A;  1Q3E A;  4JI7 H;  3IG0 A;  1TUB B;  4CC5 A;  4UCU A;  4YJ2 B;  5IJ0 B;  3JAW B;  3VQY A;  1JFF B;  3K5L A;  1P8L A;  2VOB A;  1TVK B;  4CS2 A;  4CS3 A;  3N2K A;  4B3R B;  2YIB D;  3J81 W;  2P5O A;  5IJ9 B;  5C8Y B;  4DV5 B;  4RAZ A;  5LA6 B;  3KXY T;  3N43 B;  1HNW H;  4OX9 H;  2HIV A;  3HKD B;  3RF2 A;  4O4L B;  3ICX A;  4JI8 B;  1CKM A;  4IIJ B;  4FFB B;  1P49 A;  3IAY A;  5JJN B;  1VF7 A;  4LF6 B;  1IBM B;  5JVD A;  2RGV A;  4B3T B;  4YHH B;  2VQE B;  3VQV A;  4YY3 B;  4LF9 B;  4Q6G A;  1IBK H;  4I4T B;  5LOV A;  4X1Y B;  5D5Q A;  4CH3 A;  4ZOL A;  5KHK A;  4AIL C;  3J7A K;  3T1H B;  1E4G T;  1FFX B;  1TUB A;  4X62 H;  1XNQ H;  2BTO A;  4DV4 B;  3T1Y B;  3RYI B;  4JYA H;  3K3V A;  4DUZ H;  1SKV A;  3U10 A;  4LR3 A;  1X4T A;  4PI0 A;  4FM1 A;  3GB8 B;  4U3J B;  4IHJ B;  1S68 A;  3BA8 A;  3RGZ A;  3JAW A;  4I9Q A;  1TGO A;  1WPB A;  1XHZ A;  1L2Z A;  4UCO A;  5D1O A;  3ZED A;  2OWO A;  2YIB A;  4X1K B;  2VWJ A;  2YCH A;  1S5J A;  4O2B B;  4J0M A;  4ZHQ B;  4CH6 A;  4LF8 B;  4I7H A;  5LL6 b;  4LF5 B;  4O4J A;  4I4T A;  2YXL A;  2FE3 A;  1X9N A;  2UXD H;  1TVK A;  2F4V H;  4EB6 A;  4JI2 B;  2RQ6 A;  2VPS A;  4LFC B;  4TOI A;  3SJC C;  4K0K H;  5IYZ B;  4DUZ B;  2UUC H;  4DR3 H;  1N36 B;  4JYA B;  2R72 A;  5LA6 A;  4UCV A;  3SR2 C;  4DV2 H;  1XNQ B;  4X62 B;  4TV8 B;  1QHT A;  4EQ5 A;  4FM0 A;  3T1H H;  2YI8 A;  4X1I A;  2F66 C;  4DK0 A;  2JGU A;  4JI3 H;  3K57 A;  3DF7 A;  5JVD B;  5JH7 A;  3U11 A;  4B08 A;  3KYH C;  2R9A A;  3N44 B;  2UU9 H;  3NBY B;  4YY3 H;  2CW8 A;  1J5E H;  1IBL H;  5D1O B;  3HKC A;  4FFB A;  4YHH H;  4B3T H;  3U0Z A;  4LF6 H;  4DK1 A;  2UUB B;  3N6X A;  4CH5 A;  3QG5 A;  4ZHQ A;  3E22 B;  1D5A A;  4JI8 H;  1RSO A;  1HNW B;  5EYP A;  1SQF A;  1Z5V A;  4DV5 H;  2ZIM A;  1SA0 B;  4EB6 B;  1XNR H;  4UCS A;  5KHJ A;  3ZS8 C;  4B3R H;  3CB2 A;  2PUS A;  3RYI A;  4UCR A;  3BPZ A;  4LH6 A;  3HKB A;  4JI7 B;  1JJO A;  4RZQ A;  4F6R A;  5FD5 A;  3K5O A;  2RJZ A;  2P22 C;  4DRX A;  3OTO H;  3QF7 A;  2ZM6 H;  1KMI Z;  4RB0 A;  1WH2 A;  3SJB C;  1BJT A;  1Q43 A;  3VQW A;  4O2B A;  3OTO B;  1SQG A;  3JAL B;  4B3M H;  4D7S A;  3VQX A;  4L8J A;  1WNS A;  3WB0 A;  2UXB H;  1P16 A;  3CVZ A;  3RJ0 A;  4LNU B;  4HBN A;  4KL1 A;  5CA0 B;  3UT5 B;  5LYJ B;  3RYC B;  2Q0A A;  4GKJ B;  4HNA A;  3L4J A;  4X1I B;  5EZY B;  1XNR B;  3BHP A;  2VUG A;  4TUY A;  5LXT B;  4TQD A;  1O75 A;  4ZI7 A;  5ITZ B;  1N32 H;  3JAS A;  1I7F A;  3RIZ A;  3TY5 A;  2ZNJ A;  4LFA H;  4DV1 H;  4DR1 B;  4BWA A;  5KMG B;  2UUB H;  3M7M X;  4GKK H;  2PTM A;  3HKE A;  2V4D A;  1IBL B;  1J5E B;  1FJG H;  2Q2T A;  2UU9 B;  4A2B A;  3WB1 A;  2UXC B;  3N2K B;  4JI6 B;  3W5O A;  3RWR D;  3JSL A;  1QQC A;  1TA8 A;  4O4I B;  3KAL A;  1S03 G;  3TY9 A;  2HIX A;  3JAL A;  4JI3 B;  1HNX B;  2OYQ A;  4JI1 H;  3QTC A;  2E5L B;  4YJ3 A;  2JVD A;  4O4L A;  4EFE A;  4O4H A;  4DV2 B;  4LF4 H;  1FKA H;  5IT9 W;  1WN7 A;  1N36 H;  4DR3 B;  2UUC B;  3M4I A;  4K0K B;  1M93 A;  4LFC H;  4I55 B;  2BTQ B;  4JI2 H;  4F6R B;  4K8Z A;  4UFZ A;  2VWK A;  2F4V B;  4DV6 H;  2UXD B;  5KX5 A;  4LF5 H;  4X20 B;  3S24 A;  1MZB A;  1L8D A;  1G6U A;  3HKB B;  4LF8 H;  2Q7H A;  2HVR A;  3FMA A;  4DRX B;  4TUY B;  5LP6 A;  4B3S H;  1M0W A;  3KAK A;  3FFQ A;  4DR4 B;  5KHG A;  3RR5 A;  3MWM A;  3CHX A;  1XQ8 A;  5LYJ A;  4AQY H;  5LMU B;  3RYH B;  2W57 A;  4HNA B;  2ZJT A;  4MTD A;  5JJJ B;  4JI0 B;  1JMK C;  4WBN B;  1XDN A;  3EYY A;  4DV4 H;  4YJ3 B;  3T1Y H;  4DR6 H;  4X1K A;  1Z2O X;  3B2E E;  4O4I A;  2YI9 A;  4X64 B;  5FPO A;  1Q8I A;  2UUA B;  5J2T A;  4JI4 B;  4O4H B;  1GYF A;  1IBK B;  4LF9 H;  5KX5 B;  4IAJ A;  1Q5O A;  2VQE H;  5DIS C;  5K1P A;  2F93 B;  1IBM H;  4TV9 A;  4CC6 A;  2Q2U A;  1HNZ H;  5GON A;  1ZAU A;  1XHX A;  3N40 P;  4BW9 A;  2MCT A;  1CKN B;  4X20 A;  5IWA B;  4OX9 B;  2F1M A;  3BAB A;  1Z2P X;  4Q0Y A;  4A2A A;  3N42 B;  4FLU A;  2BTQ A;  5LP6 B;  2WE6 A;  2QJ1 A;  5BMV B;  4DR2 B;  3N2G B;  4O2A B;  4NXN B;  1XMO B;  1YEW A;  4DV7 B;  5A2Q W;  1O9G A;  3W1G A;  4PDB A;  2O03 A;  3SGI A;  4FLV A;  2XIG A;  2WYO A;  5J2T B;  4LFB B;  1I94 H;  5JH7 B;  3LNN A;  2JS5 A;  3RTX A;  4TV8 A;  4JV5 B;  4KHP B;  1SA0 A;  3RYF A;  5KHI A;  2HEP A;  4FM9 A;  4RB2 C;  4FLY A;  5EIB C;  5C8Y A;  2CFM A;  4TQF A;  1M0T A;  4DR7 B;  1HR0 B;  2R70 A;  2HGS A;  3JSN A;  2Q7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...