5FPOA

Structure of bacterial dna ligase with small-molecule ligand 1h- indazol-7-amine (at4213) in an alternate binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
307
structure length
305
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVENPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 100
structure length 305
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fpoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fpoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fpoA02
3W1GA 4UCRA 4UFZA 4DV5B 4LF9B 4X64B 4DUZB 4DV7B 4GKJB 4DV6B 4DV0B 4UCTA 3QWUA 2VUGA 4JI3B 4EQ5A 4X66B 4DV1B 1XNRB 2UUCB 4X65B 4JI1B 4GLXA 1N36B 3TY9A 5LMUB 4DR3B 1S68A 3BA9A 2UUBB 3W1BA 1TA8A 3OTOB 1IBKB 3BA8A 3W5OA 5FPRA 4E6NA 3GB8B 1CKNB 4YHHB 5D1OB 2Q2TA 2UXBB 3BABA 5LMNB 2UU9B 4LF6B 1ZAUA 4B3TB 1X9NA 4PZ6A 1I94B 3PN1A 1XMQB 4OX9B 3GJXB 2HVRA 2Q2UA 5FPOA 4DR2B 4DR4B 4LFAB 4JI2B 3S24A 4LF4B 4DR7B 1P8LA 3GDEA 2HIVA 4B3SB 1B04A 4KHPB 4DV3B 3TY8A 2OWOA 4LF8B 4EFBA 3NC0B 3RR5A 3RTXA 4B3MB 3T1HB 4JI4B 4AQYB 1V9PA 4DR6B 4JI7B 5DISC 4K0KB 1XK5A 3VNNA 2UUAB 4DRFA 4JI0B 3BAAA 1HR0B 4LH7A 4DUYB 1CKMA 4EFEA 4JI5B 1XMOB 4DR1B 3JSNA 4JYAB 1HNWB 2VQEB 1CKOA 2HHHB 4LF7B 3TY5A 4JI6B 4B3RB 1J5EB 1XDNA 1TAEA 1HNZB 5BR8B 4LF5B 4YY3B 5D1PA 1XNQB 2ZM6B 4PZ7A 2UXDB 3KYHC 4CC5A 4LFBB 4UCUA 2HIXA 1N32B 4DR5B 4LFCB 1A0IA 4X62B 4NXMB 4DV2B 1CKNA 4DV4B 1FVIA 1IBLB 5D1OA 2VQFB 4TOIA 4EEQA 2E5LB 1P16A 3L2PA 1N34B 3NBZB 2HVQA 1HNXB 4JV5B 2CFMA 3UQ8A 4LH6A 4NXNB 4GKKB 4UCOA 3SGIA 2HVSA 1DGSA 5IWAB 1IBMB 3NBYB 4UCSA 1FJGB 1N33B 3JSLA 3T1YB 4JI8B 4CC6A 4PZ8A 4UCVA 2UXCB 2F4VB 1VS0A
chains in the Genus database with same CATH superfamily
3LSUA 5J2TA 2JEJA 4GKKO 5KFFA 2VA2A 4FU0A 1LUVA 5JH7A 3STZC 2N05A 5KS8A 2JS5A 2IJJA 3ZRWA 5KAFZ 2XAJA 2UUBO 2QA4V 1WCMA 2ADQB 3HOWG 2DWCA 2AGAA 2UVVA 1LR1A 5FLXN 1SCUB 1AP6A 5GTIZ 3SNOA 5CB4F 4HR7A 5LA6F 2YEVA 5C5JA 1YCIA 2XAFA 1IYEA 4O3PA 1I5YA 4EB6A 4X64O 1EKFA 5CA3A 5KA6A 2J6SA 5B1AC 5JVDA 2CZGA 3D8CA 4C7UA 3BACA 2VPQA 4F4YA 1WH2A 4JYBA 2C35B 2M05A 2Q0OC 2RGRA 4RUAA 4I50B 1AROP 4D6TH 1FFTB 1YJ9V 4OX9B 4EGQA 2WB1E 3OTOO 1K1SA 2Y0IA 3UZOA 3G6YA 4O7SA 5IT9W 1L2ZA 2DWDC 4DR5H 5BXZA 2EZOA 2NU7B 1S0MA 2R85A 5L3DA 1E79G 5J2TB 3KAKA 2DE0X 1QU7A 3BHPA 5JH7B 3M99B 3RWRD 4JV2A 1M57C 1WA8A 2VQFH 4AYBA 3PW7A 3ZRWB 4JI4B 3DC6A 2KB1A 3CC7V 5KG7A 1KP3A 3B8NA 2C28A 2ASDA 4X66H 1EZ1A 2X0LA 3CEIA 2ZDQA 1BE3H 4ZBMA 4WCEV 4FFNA 1S97A 5B1AB 1FXKA 4O4JA 4FBUA 3RVZA 2YEVB 1Y67A 2O03A 5FNVA 3G6EV 3TETA 1CKOA 2ZE7A 1ZLZA 5EBWC 4EB6B 3QQMA 4JI7O 2YRXA 2ZNIA 5CM0A 2FMAA 3V4ZA 5KFJA 1JX9A 1WPBA 2GLTA 1I6UA 1FXKC 5JVDB 3CRRA 2ZR2A 4HYOA 2CTWA 4YIOA 1WB8A 5KFBA 2R70A 3CC2V 5DQHA 3RAXA 2UUCH 4JUZA 1HNXB 4JI1H 1M57B 4A93G 4X1KA 3CCVV 4NR1A 3HO8A 4Q45A 1JXLA 2AZ0A 1PNLA 4DR5O 5EDWA 1YIJV 5H5NA 3CCEV 1VQNV 4MA5A 4FE2A 3VPDA 3T9CA 4ED6A 2VQFO 4O3QA 1WA8B 1CPYA 4P30A 1AR1B 4LF6H 2RF4A 2V7QG 4B3TH 1GTOA 4WFFA 1Z2GA 1OCRB 5EIBC 5HBRB 3GIQA 2YIBD 1FXKB 1N48A 4O4JB 4FM0A 2EIYA 4O7NA 2I87A 2BTQA 5FNVB 3LNNA 4DV6B 1JJOA 4C5CA 3HKZA 2V4QA 2CTQA 4PA7A 3KAJA 4X65B 1OWTA 1Y1WA 3DTGA 4I7ZB 1A3GA 3KHRA 3W1BA 1MG1A 4H0LB 3FAVA 2QJ1A 1Q81W 2H94A 1CXZB 4TQFA 2OIEA 5I60A 3SYPA 2UUAH 3WU2Z 2UUCO 2XCAA 3JD2A 4JI1O 5FLMG 4J9RA 1TUBA 3RGXA 1CS0A 2W7OA 4J9ZB 4X1KB 3SPGA 4K35A 5ITZA 1KECA 4BW5A 5C4XG 2C2EA 2VQEH 1I2KA 2JJ2G 2JK5C 3ZRVA 1J5EH 2W6MA 3A0BZ 4W4LA 5EZYF 3JD1A 1F51A 1XNQH 1I08A 3S24A 2NLJC 3EXAA 4LF6O 1L8DA 3E8GA 4J10A 4B3TO 4LFCH 3GTLA 3HOYG 1SC5B 4LF8B 3IG0A 4DV2H 2IBZH 1IBLH 4UB6Z 2ODMA 3R5XA 2XNDG 1V9PA 4PDVA 2BTQB 4O4HA 4ECWA 2EBOA 1XBLA 1PK8A 4LH7A 4B7EA 5DG8A 4QWDA 3Q1KA 4NVPA 1GRJA 1JFFA 3HPLC 2LFRA 1N33H 3F5TA 4JI8H 1NKDA 2YI8A 3PJSK 3ZRXA 5EK0A 4HQ6A 5DGBA 3FAVB 4U7OA 2ZCEA 5KFMA 1OCCC 2UUAO 2YWVA 5BYBA 3MFHA 2XHBA 1Y1VA 3DGEA 1KD1W 1TUBB 2Z5UA 4O3OA 1EM1A 5ITZB 2VA3A 4ED1A 2VQEO 4RAIA 3R66A 4J7JA 5IYBO 5EOYA 1J5EO 1JKJB 5CE8A 3ABUA 1EZJA 3IAYA 1SFOA 1XNQO 3JAMW 1Q8IA 3AG1C 4MTOA 3B8MA 4EG0A 1M7JA 1F7YA 3ZS8C 4I55F 3MHHC 1Q6UA 2O57A 1Q43A 4AI8A 4LFCO 2ZT9B 2JJ1G 3NR7A 3CMEV 4O81A 5JQGA 1SQGA 1EN4A 4DV2O 1S77D 1CQJB 2FPGB 2E74B 4HNUA 1IBLO 4MV6A 4QJFA 4PELA 2R92A 3L73H 5LMNH 3GIJA 4GX2A 4FFBA 4O4HB 1SS3A 2W6IG 5B66Z 4ZHQF 1NZ6A 3R65A 1KUQA 1OCCB 4RO2A 4UFZA 5BWRA 3K5HA 3PVXA 4I5SA 3A8TA 1JFFB 1N33O 1VQ7V 4DUZB 4JI8O 4KXRA 2JS3A 2EJ2A 5JWPA 1B3QA 2E75B 2CTRA 2MCTA 2OCHA 2Q0AA 5FL7G 4C2MA 5GONA 3WFVA 3AG1B 3N43B 3GTKA 2BR0A 2HJWA 4ETSA 5JUMA 2NNUA 3RB6A 5C1PA 1JLLB 4NYKA 4K8ZA 1HNXH 1KT8A 4C5BA 3CRMA 4JYAH 2FK1A 4TWKA 5KFWA 3M8AA 3IC9A 5JQGB 2DOSA 3UCSC 4XDJA 4LFBH 1NTKH 3E83A 1I1KA 5F9LA 2DABA 4MTFA 4QJFB 5T14A 2ZD9A 5LMNO 3E86A 3T4ZA 5IDJA 4KHPB 3VMMA 3WWJA 4FFBB 4TUYA 2QWQB 1R3KC 5KFEA 3UO2A 2XAHA 4IRCA 3EVKA 5A2QW 3HBLA 3SYOA 1T5EA 3JZ6A 4CS2A 2EIJC 2R86A 1DIKA 1SESA 1G1XB 1BCCH 1GN3A 2BOCC 4RCNA 4NB5A 1IOWA 5KT4A 1S0NA 4YR3A 3OE7G 2P4KA 5GONB 2W57A 1SZTA 1I7LA 3NXSA 4ECQA 4DR6O 4TV9A 1Z5VA 2GBOA 2M6YA 2PMZA 1HW7A 3PW4A 2X5RA 4NLGA 2QB5A 1HNXO 3STLC 1TWAA 1NBMG 1S03G 1GO3E 1M0WA 3A2FA 4EBEA 4JYAO 3GIPA 4UV8A 2KQXA 4TOIA 1AVMA 2HVQA 4BIOA 5I5XA 1H2NA 2NN4A 2VS0A 2EIKC 2CFMA 2VUMA 3KG2A 4LFBO 4ICGA 2F1MA 4BW9A 3QFFA 2A3QA 3RYHA 1N32O 3MR6A 5KX5A 2AGQA 1DGSA 4TV8A 1NU1H 4UCSA 1VQ5V 1FJGB 4MV3A 2YI9A 1Y66A 3QVNA 4TUYB 5CR5A 3ZIAG 1O75A 2Q69A 1URFA 5HFLA 3RJ0A 2HVJC 2DYSC 2A7WA 3G4SV 4P9OA 2HR3A 1MZFA 3PW0A 1I94H 2YYAA 4IL6Z 1Q3EA 3L9DA 4F4LA 3MJFA 2HJDA 3GIMA 3E5NA 3T9AA 4DW1A 4O2BF 2C2AA 4EQ5A 4JI3B 3VQWA 1KBLA 5KFNA 1KU9A 2QM4A 4B3SH 1K97A 4TV9B 1E4EA 1TUEB 4DR3B 3HKEA 1AP5A 1KJIA 2EIKB 1A0GA 4A3KG 1VP7A 3KHLA 1SETA 2QYZA 4O7LA 4WFBV 4GYCB 4LWSA 3F7YC 4RUEA 4OPAA 2AGPA 3R5FA 2X7RB 2V9WA 1PNMA 5I5SA 4FMTA 4MV9A 2CKZB 2WB1A 1R6KA 4ECSA 3H0GA 3RYHB 3ETGA 3OUUA 2OH2A 5KX5B 5LBQA 1XMQB 2DYSB 4TV8B 1BNCA 3L74H 2XD4A 2DQ3A 1W0JG 4KUMA 1K7DA 3VQVA 4IIJF 1K92A 2BSKA 3ASOC 1A32A 4DRXA 3HKZE 5FJ8G 3X2QB 1K1QA 1RJRA 1M0TA 1RPOA 4WFGA 1S0VA 2JA6A 5IJ9A 4IHJF 1I94O 4YP3A 3K5MA 1TWGA 1NH2B 2FP4B 1VBHA 2VPSA 5BWXA 3UFXB 2KSWA 4R7CA 1FAFA 4PDRA 3S3WA 3G6XA 5LHGA 5HNEA 2W6JG 4B3SO 5IWAH 1E4EB 4DR1B 1UFIA 2COJA 1BMFG 5E1AC 3HKEB 3LSQA 4B3RB 4JF3A 4DO2A 3SJCC 5BWUA 3ABMC 4F4XA 3B77A 4LWSB 4FLYA 5DGAA 2HIXA 2BQUA 5LYJA 3ASOB 2Z04A 4L8JA 1SERA 5CA0A 4HAMA 5IYZF 4UUGA 1MZBA 1UNNC 5DN6G 2XC9A 2ZIMA 4O7WA 4DV0H 4EEQA 5KFXA 1N34B 1Y76A 4CMDA 2V59A 2BSKB 4JTCB 5EC1C 5LOVA 3AYHB 4CS3A 4DRXB 4MSWC 5KFPA 4HYKA 1X59A 3ZEDA 3FB5C 3VOUA 5IJ9B 1GSOA 1Y74A 2VWKA 2JEIA 4YHHH 3Q8RB 3WO0A 3K9AA 2F4VB 2A79B 1XL4A 2AZ2A 3DXRA 2B63G 3B4SA 3QO8A 3ABMB 1IURA 2FKLA 3E8HA 4DYLA 4FLUA 3FYEB 5IWAO 3P32A 4FM9A 5L1KA 4F4WA 4GKJB 3N6XA 3JATA 5L3GA 2HVKC 4FZ0A 2Y0SE 1U96A 4IZOA 2R82A 1AILA 5CB4A 2J9GA 5LA6A 1R6NA 5LYJB 3UYYA 1GK9A 5CA0B 5FPRA 5EBLC 4DV0O 3H9VA 1QLNA 3AG2C 1SRYA 1ZUQA 5IYBG 1Y76B 2YS8A 1ZHSA 2QKCA 3GTGA 5F2VO 2B9ZA 3U9SA 3D3QA 1XMOH 3Q2OA 4ZI7F 5LOVB 2AXTZ 3T5KA 2HLDG 1I7FA 2HHHH 3OEEG 2XUMA 4GC7A 1ZX3A 4LBEC 1BGWA 3E89A 1Y74B 4YHHO 1YF2A 3K5LA 3CHXA 5JJEB 4QE9A 4O84A 1NQTA 3DXRB 3RBDA 4ECVA 4ED7A 1BQZA 3CRCA 3ORQA 4X62H 4XDLA 5CBHA 3QTCA 2PGGA 3GLKA 1L1FA 2ZNJA 4O7ZA 1XK5A 3K57A 1F4MA 3VNNA 3JATB 2V58A 5L1IA 2NVYA 4P2ZA 2XIGA 3H01A 1GM8A 3AG2B 5CB4B 4JYYA 2R7ZA 2IA6A 5BMVA 5LA6B 1KJ9A 1KTAA 3UKMA 4FLTA 2X6CA 1HNZB 2W6OA 5CN0A 4ZKIA 1WNSA 1RSOA 5H80A 1P49A 4QW8A 1HR0O 2OLSA 4RWUA 2ZDHA 3SYAA 3THOA 5K2MA 2DPIA 2EINC 1M1KW 1XMOO 2UXNA 2LGQA 1L0NH 4FS2A 1Z2PX 1HNWO 3RYCA 1ZWIC 2GV9A 2HHHO 2JGDA 2EJ7A 3D36A 1WN7A 3OAAG 1B33N 4EBDA 5L9XA 4A2AA 4Z2WA 3GV7B 2BE3A 3B09A 1T36A 3APOA 2YDEA 4JYCA 3K5NA 4G3IA 5EIBD 3FMAA 1JMKC 4X62O 3T99A 4TQRA 1G8MA 3D36C 1C3OA 3K5IA 1R3JC 2D3OW 3DTFA 1QQCA 2ZXWC 4ZOLF 5CBGA 3Q8PB 4R7RA 2UXBH 2VR1A 1E1QG 4A3FG 4GT1A 4NXNO 2WLLA 1AI4A 4TQDA 2COIA 4NZOA 3K04A 4JAVA 2IH1C 4DR1H 2R9RB 2YCHA 5KFYA 4I4TF 3LULA 5DECA 2EINB 3VQYA 3VA7A 2R9IA 4J7ZA 3LSSA 5BMVB 1KJQA 2DIKA 4B3RH 3BQ2A 4LF4H 4NTXA 4DR7H 4OXSA 5DLFA 2DLNA 3WB2A 1N36B 1YVWA 1AR5A 2MW2B 1RSOB 1VIBA 5C8YA 1I5XA 4WFAV 3TW6A 3BA9A 3TK1A 2XOKG 2UVRA 2QR4A 3OTFA 5FLXW 4BY7G 4MTGA 3RYCB 3E35A 3MR3A 2JGDB 2CE4A 4MV7A 4ZQIA 1M9NA 3SYCA 4YJ3F 2GHYA 1N34H 5DM6V 2WAQE 3BABA 2FB9A 2ZXWB 4YJ2A 1E4FT 3C0FB 4CE5A 4Q0YA 3J81N 5IJ0A 4Y8VB 4YIPA 5FPOA 1D2DA 4YY3H 2XAGA 4A3MG 1K5SA 4JI2B 2HIVA 5CA1F 4MVUA 2CGNA 3U11A 2UXBO 3GIKA 4FLXA 4QPKA 2WE6A 2F66C 5DQGA 2WLLB 3S3XA 4EFBA 3VQXA 4DR1O 5KFQA 4DV4H 3RTXA 3VPBA 5BWTA 1V51A 1D5NA 4B3RO 2C00A 3LP8A 4LF4O 4DR7O 2AHZA 4LR3A 4JI0B 3EHBB 5KUMA 2W9BA 3WB1A 3NUAA 4ZIBA 2W71A 1PM9A 3Q4HA 1RK6A 2WAMA 3HKCA 1F4NA 3BY6A 5KFOA 5C8YB 2AGOA 4O7TA 4JI6B 4Q44A 3JD0A 1TAEA 3OMAB 4JV0A 4LF5B 2RGVA 5IYDO 2UXDB 1N34O 3KYHC 1BS3A 3WWHA 4WBNA 5KMGA 3RGZA 4YJ2B 1FXVA 4PJ0Z 3P30A 3SJBC 4RAZA 2DMXA 3BJYA 4N23A 4YY3O 3BQ0A 2XASA 1AR4A 1W0KG 3SYQA 5IJ0B 3AK1A 4JV5B 2CDYA 4LH6A 5LMUH 4X9QA 2ZR3A 4I55A 3JCZA 4BBSG 1PKXA 4BBRG 4DV4O 2R7KA 5CBFA 4A3EG 1OCRC 3CPWU 1RPRA 3LQSA 2UU9H 4GCZA 4FFMA 2W9BB 4A3BG 4UCRA 4ZHQA 3Q4HB 4DW0A 2P90A 1SQFA 2YXHA 4DV7B 3HKCB 4GLWA 1Z2NX 2DAAA 3ZHSA 1PD3A 3T9FA 2R84A 3RFRA 2HKOA 4UUJC 1UPGA 5D8DA 1Q6IA 1AI6A 3CCLV 2ITCC 1DF5A 4WBNB 2ARHA 4DL7A 1IBKB 5KMGB 3J7AK 1OCOC 3I12A 4F6RA 2E2HA 2G38A 4PD4F 3CSWA 4X66O 1R73A 2L35A 4DUYH 5LMUO 3AW8A 2HGWA 4EYHB 5H2FZ 1H8HG 2HJFC 5LP6F 4I55B 3EYYA 2Q8VA 1K73W 3HOZG 3F5WC 1HP8A 4HZ3A 4DR2B 1VQ9V 1OV9A 2ZM6H 4QPJA 2Q67A 3CRQA 3N2GA 2W7PA 3JAWA 2UU9O 2QE7G 3I5DA 2RN9A 3RVYA 4R50A 4DV3B 3NC0B 5H6RA 3KALA 4ZHQB 3W7XA 5C44G 4J9PA 5KT3A 2R8GA 4TSFG 4FVMA 4K8XA 2EJ0A 3HOXG 5B1NA 1VQMV 1OCOB 3N41B 3OD4A 3BAAA 1N36H 2HG8A 2DJVA 4I50F 1EN6A 3WWIA 1MSDA 3ABLC 3UZBA 3ICXA 3T9EA 2RQ6A 5EC2C 5I47A 5BR8B 3TEKA 2A1HA 3FKIG 4LCUC 4F6RB 2W6QA 1KQSU 1AN7A 1ZHQA 4DUYO 2WLHA 3D3IA 3JASA 4NZNA 2Y4UA 4DK1A 1JDEA 2WTFA 3E8BA 5LXTF 3T9DA 1KP2A 3NBZB 3FX7A 2ZM6O 1T3NA 3PO2G 2PVPA 4M9UA 3WO1A 3KKYA 2V4DA 1F23A 2LW7A 3RYIA 2WYOA 3N2GB 2EX3A 3SGIA 3JAWB 2FB5A 5KHGA 4FFOA 2ILMA 2P67A 1HDJA 4GZRB 2A0LA 3ABLB 3TQTA 3BRCA 1S5LZ 2IU3A 1ZTEA 4K3AA 4XZ3B 3W1GA 2D2CB 4BWSC 1NH2D 2K9PA 3IGAC 3SR2C 4HBNA 4KL1A 4DV5B 2UXXA 4OX9H 3K79A 2YIDA 3RN4A 2P5OA 3UO3A 2W70A 2Y0SA 3T54A 3N6RA 4JI6H 1R1BA 1R3LC 3L72H 2YW2A 2FK2A 4FBTA 1N0NA 1XNRB 2WLIA 4Q43A 2DW4A 4O2BA 2UXDH 4IAJA 1ZETA 2R72A 2ADPA 2GQSA 5EWFA 1BXRA 4JXUA 5LHHA 1V55C 2B5UA 2OT5A 3OMIB 3JASB 4JI4H 1K5QA 1BZKA 1MOFA 2Q2TA 3JD4A 1Q6HA 3VBBA 5KFZA 5J9PC 4O4JF 2Q7EA 5J2UF 2W9CA 5CAEB 3RYIB 4J9NA 3V6HA 1CQIB 2LGWA 3BG5A 4LSXA 1I7NA 1JQ0A 3OUFA 4DR4B 1M56C 5DGIA 4A5UB 4LFAB 3TINA 1NS1A 4W4KA 4O3NA 4IIJA 3UM7A 5KFTA 4JTDB 3RF2A 3QNEA 2JVDA 2OWOA 4QE7A 3V6JA 4OX9O 1EYZA 2FLNA 1WJZA 3E8FA 3H1IH 3T1HB 4B3MB 4AQYB 1V55B 4FFRA 2Q6AA 4HNTA 3OGIB 1O9HA 4ECYA 2DWEC 2R7MA 5JQWA 2N74A 2WLIB 4O2BB 2I8CA 1SEIA 3PW2A 4PA3A 4Z1VA 4XYLB 3CCJV 4FPPA 3ZHQA 2ODTX 3GTJA 3K0GA 4LF7B 1FYJA 1IBKH 2R87A 3JAKA 4JI4O 3N40P 3JARA 5C3EG 2CTPA 2KKWA 2Y4RA 4L87A 1M56B 1B6RA 2W8LA 1IX9A 4JPRA 4QSHA 2PF4E 4NXMB 1QNMA 1OBGA 4BAYA 2W9CB 1EKVA 5IYZA 2P4VA 3WG7C 4DV6H 3JRWA 1H2MA 1AB3A 4X65H 4RAYA 3TXSA 5KT5A 3RB0A 1XUQA 1MSWD 2JA5G 3ZHVA 2DQ0A 5L3CA 4IIJB 4RB2C 1K33A 1XOUA 4MV4A 4PWQA 2RMKB 1IBMB 3AK3A 3OMNB 5KKNB 3OEHG 3T1YB 1GGOA 4DXWA 5IP9G 1LUWA 2YXYA 2UXCB 4J7KA 1N0JA 3HOVG 4RNNA 4LP8A 1B6QA 2F93B 3TIGA 1VF7A 4PA6A 3G71V 4A3DG 1ZSPA 4LF9B 4JAAA 3C90A 3WB0A 3ZCCA 4EKWA 3M9NB 4OPHA 5KG0A 1EFRG 1P84F 1KBHA 2VUGA 2YS7A 2Y48A 4LSAA 4MV1A 4DV1B 3JAKB 2WWWA 3WG7B 5DGHA 3JARB 3SDLA 4J9KA 1GAXA 1N8RW 5IYDG 4LF8H 2B1IA 5A2QN 3BFRA 3JYCA 4CH5A 2PI4A 4O4IF 4HNAA 2XAQA 2WAQA 1E4GT 3M9MB 3O65A 4DV6O 3OSNA 4DIMA 4RU9A 5IYZB 2JRIA 2QSAA 4GX1A 5KHIA 4X65O 3ZHTA 4PDLA 4MTXA 2Q4PA 3ZMVA 1R9TA 1ZAUA 4KP4A 4O2AF 3GIDA 4MVOA 3E2EA 4ZI7A 3X2QC 2YU9A 1TGOA 3GTQA 2R7LA 2JEFA 1SQQH 3P3NA 4QWAA 3GIIA 4A3LG 1CP9A 1I1LA 3HB3B 1JIHA 4P9PA 1XHZA 2R8JA 5B5EZ 5KT6A 2ABJA 3ETEA 1AI5A 3ZMSA 1JA8A 2F23A 2YZGA 2FKXA 4EEYA 4CH4A 3CWBH 2R93G 2YRWA 2E2IA 1PL4A 1M90W 1DV1A 1TVKA 4M0JA 2WLKA 4GUNA 4J0MA 4K0KB 1DLBA 4IWYA 2ZKOA 1SKVA 1XNRH 1COWG 4CHIA 4FLWA 3U55A 4JI5B 3T5LA 4U7NA 1BQ0A 3P3PA 4LF8O 2EJ3A 3Q8QB 5K1XA 3SJQC 2I80A 4DL2A 2JDIG 1NTMH 3N42B 3GWOA 2YS6A 4HNAB 2W0FC 4O86A 3LDDA 1QR9A 4QGPA 4RZRA 4UVBA 1VEWA 1W2BU 1V4YA 1DAAA 3MFIA 2XGPA 4RB1A 2W9AA 3CCUV 4DUZH 1CKNA 2NU9B 4PV1B 5I5VA 2CQYA 4DL6A 4ZI7B 2E5LB 4O7VA 2GUZA 1GYFA 1KJ8A 1MNGA 2WDTA 4ED8A 4GKKB 3L4JA 2EULA 3BEHA 1K9MW 5BPHA 1ZQ7A 1WP8A 3MHSC 4X1YA 2W8KA 4O4LF 1VQPV 3DTUB 4G2KA 1TWCA 4IGGA 3U0GA 2QGNA 2V4RA 1TVKB 5KFSA 1GN2A 4J42A 2CW8A 2FE3A 1YSCA 3GTPA 5FR9A 5DG7A 3FB7C 3ZBHA 2FJZA 4X64B 1BHBA 5KFUA 2IP4A 1NR1A 3JRXA 1EZVH 1VQ6V 1P4RA 4I4TA 3ORRA 1SZXA 1RK5A 3F8NA 3HXLA 2DZDA 2CK3G 5L1JA 2R8KA 1H38A 4KHPH 4QIWF 4YXWG 4RQFA 1O9GA 4ABMA 1H2LA 3TY9A 5DG9A 5D5PA 3OTOB 4DL4A 3CCRV 2WA4A 4FFKA 1YHQV 4DUZO 2L6LA 1CKNB 2AU0A 4BXXG 3H1HH 3IN5A 2LO1A 1BL8A 3ASNC 4YJ3A 2GUZB 5EWGA 1S5HC 3W7TA 4MVRA 1Y4MA 3V4SA 2RDCA 3K03A 3KHHA 1KB9F 2IJIA 5KA5A 5KG4A 5L3FA 4O3RA 1H8EG 1JPXA 4X1YB 4MS2A 3LWBA 2FLPA 5CA1A 5KHJA 3RFCA 1WB7A 2HGSA 1KC8W 1VBGA 1MMMA 3MWEA 5IE9A 3RIZA 3U10A 3GTOA 4JZGA 3I4MG 4JI7B 3H4DA 4Q4DA 3R5HA 1UC9A 1M93A 5KFDA 3CQZA 2NU8B 4I4TB 4Q8FA 2ZDIA 4C5AA 2X0SA 5KX5F 2YIAA 4KHPO 3OGCC 5LGUA 3JSNA 1FJGH 3BQ1A 4FJCC 1S3JA 3ASNB 5KHKA 3OT7A 1XDNA 2ZDIC 3U0ZA 4I9WA 2FYUH 1KJJA 3H1LH 4CC5A 4FFLA 1A9XA 1XL6A 4DR5B 3TCUA 2Z0AA 5BY1A 1VARA 4YJ3B 1VQOV 1AJQA 3IFXA 2SCUB 3APQA 3K08A 5AG2A 2AQ4A 2VQFB 1T94A 3GVMA 4JI3H 4LNUA 2RJZA 3UT5A 1OZ0A 4DR3H 3OR7C 3QO5A 3K06A 2B63A 1P7BA 1U97A 5CA1B 5DMXA 3I4NG 3MAQA 2P06A 4CC6A 4MT8A 1NT2B 3KREA 1Q7YW 3PFFA 4FZ1A 4K0KH 1S72V 2XTAA 1VS0A 1ULZA 1WP7A 3FB6C 1GLVA 4WHXA 5B1BC 4JI5H 1XMQH 2FLLA 2JA7G 5DQIA 2OIGA 1FJGO 2Y69C 2Y0PA 1K3EA 2RCVA 2DPJA 2F95B 4MVZA 2UUCB 1BHAA 4JI1B 2NR5A 5L1LA 1WCMG 4A3GG 1RP3B 2QWPB 4O83A 3DAAA 3C3SA 1G6UA 2J6TA 2Z3YA 4CH6A 1GM9A 3SPJA 2QWRB 3GB8B 3C3TA 4QIWE 5JVLA 4JI3O 3SPIA 4ASUG 4UB8Z 3FKSG 4LNUB 4APMA 4LF6B 5FD6A 4B3TB 4GKKH 3UT5B 4DR3O 4A3JG 2ZDGA 5KFRA 1YXBA 3GJXB 1K4DC 4RB3C 4QWBA 1AJNA 5B1BB 5LP6A 5JJJB 2Y69B 2GPSA 3CCMV 1EKPA 3GDEA 5KFHA 2CAZC 5I5UA 3G6BA 2KG7A 1KKDA 1EBOA 3LUTB 3K5OA 1JCHA 4FLVA 4JI5O 1XMQO 1GN6A 1X4TA 2R9AA 5LP6C 1Z5WA 4O82A 1TWHA 1ORQC 2UUAB 5LOVF 3GWKC 2VOBA 2CW7A 1XHXA 4XX0B 1CKMA 3SI8A 1YJWV 3J80N 3KTMA 3ZX6A 4KFMA 2VQEB 3TJTA 2COGA 3TY5A 1NJIW 1J5EB 2IMWP 4X1IA 3OFNG 5EZYA 4J11A 5D1PA 2F4VH 4E4TA 1XNQB 5KFIA 5IY5C 4FIPC 2ATKC 2Q5ZA 4JGSA 4LFCB 4WFEA 3IJ4A 4DV2B 1RFYA 4UXNA 3FDSA 4GKJH 4RZQA 1DK1A 5D1OA 1IBLB 3K0DA 2F43G 5KHHA 3EPGA 5I5WA 4DL5A 4UV9A 2R8IA 5LP6B 2ZE5A 1JDBB 5LXTA 3UQ8A 5DEDA 5EBMC 1GSAA 1AUVA 1ZL8A 5KT7A 3NBYB 2KG7B 1N33B 5B1OA 4MAMA 1VQLV 4JI8B 3T4DA 4J9OA 3TGUH 3CRAA 4FGRA 4YAKB 3MWMA 4JI7H 4UCVA 2JA8G 1KUTA 4UVCA 1WLEA 3K59A 2W6NA 1Y14B 5C93A 3G8CA 4JZ2A 3RT3C 1WPXA 2GPWA 2Q73A 3ZRSA 3AK2A 3K3PA 5IY5B 2Y4TA 4GC6A 3OSPA 4Z1MG 4FS1A 1NVPB 2QK4A 5GTHZ 3H1JH 3M9OB 2E76B 3QWUA 4UCTA 4NZMA 2WLMA 4X1IB 2F4VO 2P0AA 3H40A 4CH3A 5EZYB 3RUPA 3NGDA 3G6VA 2JIZG 1YEWA 1FKAH 1MA1A 1M5IA 4RB0A 4MVMA 5HV6A 4ECXA 3BA8A 3QO7A 3ZMTA 4GKJO 1Y1WG 1W96A 2ZGIA 3CB2A 5D1OB 3ABTA 3VPCA 2JEGA 5LMNB 2QF7A 2IBKA 1GSHA 5LXTB 4EBCA 5IT9N 2HFEC 4IRDA 5BMVF 4HN2A 4PZ6A 5KUKA 3W7WA 5J2UA 2PBZA 4EYIB 1ZL8B 3ETHA 2Q2UA 4BIZA 1HNZH 1BSMA 2NUAB 3BCCH 1VKZA 4ED0A 4DK0A 3H4BA 1P8LA 4BWAA 3DSQA 2CUGA 2XT9A 1K83A 2YL2A 3CYOA 4X89A 4BY1G 2WSSG 1RYRA 1BGYH 2IU0A 1VQ4V 1YTFB 3RR5A 1S5JA 3RAQA 3H20A 4TQSA 4DR6B 5DISC 4CKEA 1BT8A 2C22A 4DRFA 2YZNA 1OJHA 3L70H 3ZHRA 1K8AW 2E3CA 1FKAO 4JYAB 2HHFA 2DYRC 4Q6GA 5DLGA 4O7YA 1QR8A 1M4UA 4J9QA 3GV8B 4PDBA 3QG5A 4DLKA 4PA9A 2ALZA 1IVSA 2EJRA 1FXHA 3GB7C 4LFBB 3ZMZA 1N32B 3FB8C 5IYCO 4B7KA 4G27B 2QWOB 1IOVA 2KSDA 3CEBA 4ECTA 5KT2A 2QWNB 4U7CA 4PBCA 4AILC 5E79Z 1JJ2U 1UC8A 3JZIA 5J2UB 1HNZO 1Y1VG 2JEXA 3MR2A 1DV2A 2JGUA 1VQKV 4J41A 1OBDA 1GN4A 5C8YF 2BQ3A 3CX5F 4RNMA 3I56V 2X6AA 3K3WA 4JAUA 4UVAA 3ZN0A 1PNKA 2DYRB 3TXQA 4O3SA 5J2TF 1IZ3A 2P6JA 3TIIA 5JH7F 2IJKA 2BQRA 4YJ2F 1D5AA 3CE2A 3DF7A 1K4CC 4MVQA 1G2WA 2H8PC 4WFHA 4IWXA 2R92G 3T5JA 2FPPB 5CMUA 1Y6XA 1LNQA 1YITV 2HHFB 2GQRA 4JI2H 2P22C 3OM3B 1S9FA 4NKGB 4PHZA 4R6ZA 3R9RA 4RNOA 4MTDA 1WR2A 1S68A 4RUFA 4F6EA 1SQBH 4MA0A 4CKBA 4PI2A 5JVDF 1ROPA 2AHYA 4O4IA 1XEQA 4E4EA 4JI0H 2XCLA 3RYFA 1N36O 3G80A 1QCEA 2LP7A 3TW7A 2UVWA 5KG2A 1VQ8V 3RB4A 2YICA 2FL4A 4O2AA 1I94B 3KCXA 4LF5H 1N56A 1ET0A 2R8HA 1NTZH 2PUSA 2W6ZA 3AG3C 4NTYA 5KG5A 1E1RG 1GO3F 2QDOA 1UJWB 4B3SB 2YSUB 4WBNF 2Q7HA 2V1DA 4GX5A 4YAJB 2R7NA 1WRVA 3ZHUA 4MV8A 5L3BA 1DF4A 3LDCA 4JV5H 1H2SB 4JI2O 5KFGA 3RBEA 2EILC 1NI8A 3EPIA 1Q90D 3H3VH 3K58A 3RB3A 5D5QA 3ZJZA 5B3SC 4I7HA 2LQTA 5FNVF 3F7VC 3FKIA 2HDKA 3BPZA 4FLZA 2LFSA 3EFFK 1TWFA 3PO3G 2HEPA 2OTJV 1IDSA 3MWDA 2YZLA 2FMLA 4O4IB 3CS5A 4JI0O 3CD6V 3CMAV 3LNMB 4QWEA 3OHBA 1GMGA 3AG3B 3KZIZ 4Q20A 3RYFB 3JAMN 1AUXA 4H13B 1THZA 3JALA 2FTKA 1PPJH 4IHJA 5GW7A 2YXLA 4DV7H 3RGBA 2VRZA 4JI6O 4O2AB 4YBZB 4LF5O 1P16A 3L2PA 1US6A 4BR6A 4R8UA 2UXDO 3GILA 1FPOA 4A3CG 1EUDB 5KG3A 1KYOF 5KLVH 2HVSA 2EILB 5IWAB 2X6BA 3MDSA 2VUMG 1JVMA 5B3SB 4FFPA 4ECRA 1EUCB 3L4KA 4DR6H 5K1PA 4O4LA 3E22A 4OGQB 3IC7A 4JV5O 1W59A 1I50A 2H3OA 4PI0A 3MR5A 2PTMA 3U54A 2C2RA 4D7SA 3KXYT 1XDCA 4D7TA 3QZ7A 3N2KA 1Z2OX 2ZINA 2YIBA 1AJPA 3RV4A 4N21A 4DR2H 2WLJA 1JX4A 4JTAB 1IXMA 3CJHA 4AHCA 4DV0B 3HB9A 4YQWA 2QKAA 2RNBA 4LC1A 4EGJA 1B06A 3G67A 1I3QA 5HFMA 2RDJA 2A9HA 4DV3H 1N32H 1HWYA 3L75H 4QIWA 2N04A 1V54C 3JALB 2FPIB 4DV7O 4IHJB 2XGQA 4ECZA 4YHHB 3ZN1A 3CCSV 1PP9H 3TQ1A 4IR9A 4L1KA 3BVOA 4R8UB 3ETQA 1W93A 4J9MA 1J95A 1A48A 1KKCA 3Q8SB 3N27A 5BZBA 4ED2A 3CXHF 2HVRA 4U3JA 1IBKO 3HR0A 5DAAA 2Q68A 5LHIA 1OHHG 5BR8H 2GDSA 4NTWA 2Z02A 3H0GG 2OCCC 4O4LB 2ATLA 3E22B 1SQVH 4IYHA 4PA4A 2QKSA 4TVIA 1PL0A 2WPDG 3A0HZ 3N2KB 1QVGU 4O4HF 4DR2O 4IRKA 1V54B 2JA6G 2PYJA 4MW8A 3CJHB 4A2BA 4AYBE 5EWEA 2GTSA 5LGTA 3FYIB 4J9YB 1HR0B 3AG7A 1GM7A 4EFEA 4DV3O 1XMOB 2GTAA 2EIMC 1K34A 4CMFA 2Q7DA 2K1EA 1HNWB 2HHHB 1JR9A 2EIJB 3HKBA 2LJ2A 1SA0A 4IT5A 2ITDC 4DQNA 4M7EA 2IM9A 4UCUA 2M7WA 4DV5H 1XQ8A 2OCCB 1H2GA 4X62B 5KG6A 3JCUZ 2JA5A 3ETJA 4GX0A 4HNVA 4QNHB 4RQEA 1YJNV 2J6UA 5BR8O 4U3JB 2VWJA 5EYPA 1C30A 3PR5B 4QWCA 4NXNB 4ECUA 5JQGF 4R8CA 3L71H 1GKFA 3ETDA 4XDKA 1I1MA 3B2EE 1FD9A 4J9LA 3N8DA 4CBCA 2EIMB 2ZQMA 4Q8EA 2UVUA 5C1OA 4I9QA 3J7AU 1SQPH 3GV5B 4IR1A 2PI5A 3PR4A 5L3EA 4DR4H 2FK3A 4LFAH 3HKBB 1RYSA 1SA0B 3T1CA 5GONF 5IP7G 3K9SA 2YUAA 1S10A 1WAZA 3W7UA 2UUBB 4DV5O 5KFVA 1QBZA 2CNUA 5IYCG 4XBFA 4B3MH 3T1HH 3W5OA 4AQYH 2CNVA 1QLEC 1XILA 2ZJTA 4ZOLA 2ZIOA 3VOTA 3AEIA 1XNRO 2UXBB 3PZPA 5EYPB 4CKCA 3WNZA 2BTOA 1X9NA 2R6FA 4YR0A 3PN1A 4LF7H 2IH3C 3HKDA 4H33A 5E25A 4YR2A 3CC4V 5JJNB 1M6VA 1L0LH 2OTLV 3KHGA 4LF4B 4DR7B 4LMYA 2R93A 2B1GA 1ENVA 4WD3A 4X88A 4X20A 4TUYF 3JD3A 1DTOA 3TY8A 3KCYA 5KFKA 3DC5A 2ASLA 4NXMH 1VAJA 1FFXA 1YZBA 2Q9LA 3ML0A 2OYQA 5FD5A 1WSCA 2QM8A 2CGOA 4K6NA 1VF5B 4TT3G 4DR4O 4DAAA 1OCZC 2PYLA 4LFAO 4FM2A 3I55V 1PV0A 4FK5C 1IYDA 4TM5A 3T5HA 1MZEA 1QLEB 3QF7A 1NVPD 3B40A 1S0OA 2LW1A 1QHTA 1IBMH 1MABG 1CE8A 2XCPA 3T1YH 4MTEA 1H2KA 5LL6Y 1QVFU 3AX6A 1YDXA 4B3MO 3T1HO 4TV9F 2RDIA 2ASJA 4MVSA 4AQYO 4YY3B 5KFAA 2UXCH 3OUZA 4PZ7A 3LDEA 1RJQA 1SF9A 2R7ZG 1PX2A 4ZOLB 1B6SA 1BJTA 3CVZA 5I5YA 5BPFA 4LF9H 4WF9V 3RBZA 1KMIZ 3OUSA 3SPCA 1AI7A 2CH7A 3OHAA 4LF7O 4DV4B 1FVIA 3A0RA 2WA3A 4F4ZA 3HKDB 5F9NA 4DV1H 4PDMA 4JV1A 4ED3A 4CZZA 1XI1A 1GH6A 1OCZB 4UCOA 4TV8F 2IJHA 2QEXV 4CS4A 2PY5A 4X20B 4Q4CA 4J9SA 3GTMA 1Q82W 4NXMO 2CNQA 3JSLA 1FFXB 2NVXA 4PZ8A 1I2LA 3R23A 4A3IG 3RV3A 1YTFD 3U9TA 3N44B 1HR0H 3CP1A 1Q5OA 5KAIZ 3OW2U 1RM1C 1IBMO 2ETNA 2DN9A 4QW9A 1HNWH 2WLNA 3T1YO 3G8DA 2W6PA 4F50A 5LL6b 3AG4C 4X66B 2UXCO 1JOYA 4GLXA 1SQXH 3V6KA 5H9CA 3FD9A 1R6TA 2VQDA 5LMUB 3O9OA 1IXBA 3FFQA 4NYEA 4LF9O 1TA8A 5BWWA 3SE7A 5TISZ 3PW5A 3SJAC 2MK3A 4E6NA 5H6QA 2HGXA 3HT5A 2CH7B 2C2DA 2QM7A 3GQCA 4DV1O 4E2LA 2UU9B 1S76D 4MW3A 4NXNH 2V5AA 4J80A 4ME6A 1Q86W 1KEEA 3CXCU 4XYMB 2ZE8A 1R3IC 5KFLA 1SYXB 3T7AA 2A06H 4I0XA 1G4YB 1RM1B 5A9GA 4U6PA 2P7TC 4JASA 4DL3A 1B04A 2IW5A 5K3WA 5LGNA 4H37A 3AG4B 3M7MX 4X8AA 2BCCH 2ZE6A 3W7SA 1N4CA 2YZMA 3K3VA 2BOBC 4IYIA 2E5LH 2QTSA 2AW9A 1VF6A 4BIUA 1XREA 2HG5C 3M4IA 4YB8B 4RUCA 3CCQV 3HOUG 4DUYB 4O7RA 1FS0G 3ZMUA 2UUBH 3JZFA 4H44B 3CSXA 1P7GA 3ABKC 3QZ8A 1VF6C 3T2MA 3H1KH 4K0KO 2ZM6B 5BWVA 1NR7A 5LYJF 3J80W 3J81W 5CA0F 5I5TA 1VMGA 2Q7GA 2PMZE 1A0IA 4G28B 4X64H 2NU6B 1RJPA 5KG1A 3LMLA 3T9BA 2HP8A 1KC7A 2QTOA 1YI2V 3SPHA 5JCOA 3MD0A 2YC0A 3RW0A 2PN1A 4I0XB 4B08A 5BYAA 3OR6C 4I50A 4FM1A 2W0XA 2PZSA 3OTOH 5KFCA 2JEUA 1EN5A 2EZPA 2GSMB 4U3FH 5JCOC 2E5LO 2JA7A 1I0HA 1CEZA 1EHIA 3ABKB
chains in the Genus database with same CATH topology
2F93B 1VF7A 5J2TA 1D5AA 3DF7A 5JH7A 4FLUA 2JS5A 4LF9B 4FM9A 3WB0A 4GKJB 3N6XA 3JATA 4JI2H 2P22C 2VUGA 4LSAA 4DV1B 3JAKB 4PHZA 3JARB 4MTDA 5CB4A 5LA6A 1S68A 4LF8H 4CH5A 5LYJB 4EB6A 4PI2A 4HNAA 5CA0B 5FPRA 1E4GT 4O4IA 5IYZB 5JVDA 4JI0H 5KHIA 3RYFA 1ZHSA 1WH2A 1ZAUA 1XMOH 2RGRA 5LOVB 4I50B 1I7FA 4O2AA 1I94B 4ZI7A 4OX9B 2HHHH 1TGOA 4LF5H 2PUSA 1BGWA 3K5LA 5IT9W 3CHXA 1L2ZA 5JJEB 1XHZA 4B3SB 4DR5H 2Q7HA 4X62H 5J2TB 3KAKA 5JH7B 3BHPA 4CH4A 3QTCA 3RWRD 2PGGA 2VQFH 2ZNJA 4JI4B 1TVKA 4J0MA 4K0KB 1H2SB 3K57A 1XK5A 4JV5H 1SKVA 3VNNA 3JATB 4X66H 1XNRH 3K58A 5D5QA 2XIGA 4FLWA 4O4JA 4JI5B 4I7HA 5CB4B 2O03A 3BPZA 5K1XA 4FLZA 5BMVA 5FNVA 5LA6B 1CKOA 2HEPA 4FLTA 1HNZB 3N42B 4EB6B 4HNAB 2ZNIA 1WNSA 1RSOA 4O4IB 1WPBA 1P49A 1I6UA 5JVDB 3RYFB 3THOA 4RB1A 3JALA 4IHJA 1Z2PX 2YXLA 2R70A 3RYCA 4DUZH 2GV9A 3RGBA 1CKNA 4DV7H 4O2AB 4ZI7B 1WN7A 2E5LB 1P16A 3L2PA 2UUCH 1HNXB 4JI1H 1GYFA 4X1KA 4A2AA 2WDTA 4GKKB 3L4JA 2HVSA 3K5NA 5EIBD 5IWAB 3FMAA 1JMKC 4X1YA 3L4KA 1QQCA 4DR6H 5K1PA 4O4LA 3E22A 1TVKB 4R7RA 2UXBH 4LF6H 4B3TH 4PI0A 2PTMA 4TQDA 2CW8A 2FE3A 4D7SA 3KXYT 4D7TA 5EIBC 3N2KA 2YIBD 4DR1H 1Z2OX 2YCHA 4O4JB 2ZINA 4X64B 2YIBA 4FM0A 3VQYA 4DR2H 2BTQA 5BMVB 5FNVB 4B3RH 3LNNA 4I4TA 1JJOA 4DV0B 4AHCA 4DV6B 3F8NA 3HXLA 4LF4H 4DR7H 3KAJA 4X65B 3WB2A 1N36B 4KHPH 4DV3H 3TY9A 1N32H 1O9GA 5C8YA 3BA9A 3W1BA 5D5PA 3OTOB 3OTFA 5FLXW 3JALB 2QJ1A 4IHJB 3RYCB 1CKNB 4TQFA 4YHHB 4MV7A 1N34H 2UUAH 3BABA 1TUBA 4YJ3A 4YJ2A 3RGXA 3ETQA 4X1KB 5ITZA 1E4FT 2VQEH 2HVRA 3C0FB 4U3JA 1J5EH 4Q0YA 5IJ0A 5BR8H 4YY3H 5FPOA 4X1YB 1XNQH 4JI2B 3S24A 2HIVA 3U11A 4O4LB 4FLXA 3E22B 1L8DA 5CA1A 2WE6A 5KHJA 4LFCH 2HGSA 2F66C 4LF8B 3IG0A 4DV2H 4EFBA 3VQXA 3U10A 3RIZA 4DV4H 3N2KB 3RTXA 1IBLH 1V9PA 4JI7B 2BTQB 2PYJA 1M93A 4O4HA 4I4TB 4LR3A 4JI0B 4A2BA 3WB1A 1HR0B 4LH7A 4ZIBA 2YIAA 4NVPA 4EFEA 1XMOB 1JFFA 3JSNA 1FJGH 3HKCA 1N33H 1HNWB 5C8YB 2HHHB 4JI8H 2YI8A 3HKBA 4JI6B 5KHKA 1XDNA 1TAEA 1SA0A 4LF5B 2RGVA 3U0ZA 2ZCEA 2UXDB 3KYHC 4M7EA 4CC5A 2IM9A 4UCUA 2XHBA 4WBNA 4DR5B 4DV5H 5KMGA 1XQ8A 1TUBB 4YJ2B 4YJ3B 3RGZA 4X62B 5ITZB 3SJBC 5EOYA 4RAZA 2VQFB 4JI3H 4U3JB 3IAYA 4LNUA 2VWJA 5IJ0B 4JV5B 2RJZA 1Q8IA 3JAMW 5EYPA 3UT5A 4LH6A 3ZS8C 4NXNB 5LMUH 4DR3H 1Q43A 4I55A 3B2EE 5CA1B 5JQGA 1SQGA 3MAQA 4CC6A 1NT2B 4I9QA 4K0KH 1VS0A 5LMNH 2UU9H 4FFBA 4O4HB 4UCRA 4UFZA 4ZHQA 1XMQH 4JI5H 1JFFB 1SQFA 4DUZB 4DV7B 3HKCB 4DR4H 4LFAH 1Z2NX 3HKBB 2F95B 2UUCB 1SA0B 4JI1B 2MCTA 2Q0AA 3RFRA 5GONA 3N43B 2UUBB 4WBNB 4ETSA 1IBKB 1G6UA 5KMGB 3T1HH 3W5OA 4B3MH 3J7AK 4AQYH 4CH6A 4F6RA 3GB8B 2ZJTA 4ZOLA 2ZIOA 4K8ZA 1HNXH 2UXBB 4LNUB 4APMA 4LF6B 5FD6A 4B3TB 4DUYH 4GKKH 5EYPB 3UT5B 2BTOA 1X9NA 4JYAH 3PN1A 3GJXB 4RB3C 4LF7H 4I55B 3HKDA 3EYYA 5JQGB 5LP6A 5JJNB 5JJJB 4DR2B 2ZM6H 4LF4B 3N2GA 4DR7B 3GDEA 4LMYA 4LFBH 2CAZC 3JAWA 4X20A 4KHPB 3K5OA 4DV3B 3TY8A 4FLVA 4FFBB 4NXMH 4TUYA 1FFXA 5FD5A 3NC0B 1X4TA 2R9AA 2OYQA 5LP6C 3KALA 4ZHQB 1Z5WA 2PYLA 4FVMA 4K8XA 5A2QW 4FM2A 2UUAB 1T5EA 3N41B 4CS2A 3BAAA 2VOBA 1N36H 2CW7A 3QF7A 1XHXA 1CKMA 1QHTA 1IBMH 5GONB 3ICXA 2VQEB 2RQ6A 2W57A 4MTEA 3T1YH 3TY5A 1J5EB 4X1IA 5BR8B 4YY3B 5EZYA 2UXCH 4TV9A 1Z5VA 5D1PA 2F4VH 1XNQB 1HW7A 4PZ7A 4F6RB 1BJTA 4ZOLB 3CVZA 1AN7A 1ZHQA 4LFCB 4LF9H 1S03G 3JASA 3A2FA 1M0WA 4DV2B 1KMIZ 4DK1A 4GKJH 4RZQA 4DV4B 1FVIA 1IBLB 5D1OA 5KHHA 4TOIA 3HKDB 3NBZB 2HVQA 4DV1H 5LP6B 2CFMA 5LXTA 2V4DA 2F1MA 4BW9A 3UQ8A 3RYIA 3RYHA 1XI1A 3N2GB 4UCOA 2WYOA 2EX3A 5KX5A 3SGIA 3JAWB 1DGSA 4CS4A 5KHGA 3NBYB 2PY5A 4TV8A 4UCSA 4X20B 1FJGB 2YI9A 1N33B 3JSLA 4TUYB 4JI8B 1FFXB 3BRCA 4PZ8A 1O75A 3MWMA 4JI7H 4UCVA 3K59A 3W1GA 4BWSC 3RJ0A 3N44B 1HR0H 3SR2C 4HBNA 4KL1A 4DV5B 1I94H 1Q5OA 4OX9H 1Q3EA 2P5OA 1HNWH 4JI6H 3QWUA 4UCTA 4EQ5A 4JI3B 3VQWA 5LL6b 4X66B 4X1IB 1XNRB 1KU9A 2QM4A 4O2BA 5EZYB 4TV9B 4CH3A 4GLXA 4IAJA 4B3SH 2UXDH 2R72A 5LMUB 4DR3B 3HKEA 1YEWA 1FKAH 3FFQA 1M5IA 1TA8A 4RB0A 3BA8A 3SJAC 3JASB 4JI4H 4E6NA 4GYCB 3CB2A 5D1OB 2Q2TA 5LMNB 2UU9B 4MV9A 4NXNH 2Q7EA 5LXTB 3RYIB 3RYHB 4PZ6A 5KX5B 5J2UA 1XMQB 4LSXA 2Q2UA 4TV8B 1SYXB 1HNZH 4DR4B 3VQVA 4LFAB 4DK0A 1P8LA 4DRXA 4BWAA 3DSQA 4IIJA 1M0TA 1B04A 3RF2A 3M7MX 2JVDA 2OWOA 5IJ9A 3K3VA 3K5MA 1S5JA 3RR5A 4B3MB 3T1HB 2VPSA 3H20A 2E5LH 4AQYB 2KSWA 4DR6B 5DISC 3M4IA 4DRFA 1O9HA 4O2BB 4DUYB 1SEIA 5IWAH 4DR1B 2E3CA 4JYAB 2UUBH 3HKEB 4Q6GA 3CSXA 4LF7B 1IBKH 4B3RB 1M4UA 3JAKA 3N40P 3JARA 3SJCC 4PDBA 3QG5A 2KKWA 2ZM6B 4LFBB 4FLYA 3J80W 2HIXA 1N32B 3J81W 5LYJA 2Q7GA 4L8JA 1A0IA 5CA0A 4X64H 4NXMB 1MZBA 4AILC 3LMLA 5IYZA 2ZIMA 4DV6H 5J2UB 4DV0H 4EEQA 1N34B 5JCOA 4X65H 4RAYA 2JGUA 4B08A 5LOVA 4CS3A 4DRXB 4I50A 4FM1A 4IIJB 4RB2C 1IBMB 2PZSA 3OTOH 3ZEDA 3T1YB 5IJ9B 2VWKA 5JCOC 4YHHH 2UXCB 2F4VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1G A;  4UCR A;  4UFZ A;  4DV5 B;  4LF9 B;  4X64 B;  4DUZ B;  4DV7 B;  4GKJ B;  4DV6 B;  4DV0 B;  4UCT A;  3QWU A;  2VUG A;  4JI3 B;  4EQ5 A;  4X66 B;  4DV1 B;  1XNR B;  2UUC B;  4X65 B;  4JI1 B;  4GLX A;  1N36 B;  3TY9 A;  5LMU B;  4DR3 B;  1S68 A;  3BA9 A;  2UUB B;  3W1B A;  1TA8 A;  3OTO B;  1IBK B;  3BA8 A;  3W5O A;  5FPR A;  4E6N A;  3GB8 B;  1CKN B;  4YHH B;  5D1O B;  2Q2T A;  2UXB B;  3BAB A;  5LMN B;  2UU9 B;  4LF6 B;  1ZAU A;  4B3T B;  1X9N A;  4PZ6 A;  1I94 B;  3PN1 A;  1XMQ B;  4OX9 B;  3GJX B;  2HVR A;  2Q2U A;  5FPO A;  4DR2 B;  4DR4 B;  4LFA B;  4JI2 B;  3S24 A;  4LF4 B;  4DR7 B;  1P8L A;  3GDE A;  2HIV A;  4B3S B;  1B04 A;  4KHP B;  4DV3 B;  3TY8 A;  2OWO A;  4LF8 B;  4EFB A;  3NC0 B;  3RR5 A;  3RTX A;  4B3M B;  3T1H B;  4JI4 B;  4AQY B;  1V9P A;  4DR6 B;  4JI7 B;  5DIS C;  4K0K B;  1XK5 A;  3VNN A;  2UUA B;  4DRF A;  4JI0 B;  3BAA A;  1HR0 B;  4LH7 A;  4DUY B;  1CKM A;  4EFE A;  4JI5 B;  1XMO B;  4DR1 B;  3JSN A;  4JYA B;  1HNW B;  2VQE B;  1CKO A;  2HHH B;  4LF7 B;  3TY5 A;  4JI6 B;  4B3R B;  1J5E B;  1XDN A;  1TAE A;  1HNZ B;  5BR8 B;  4LF5 B;  4YY3 B;  5D1P A;  1XNQ B;  2ZM6 B;  4PZ7 A;  2UXD B;  3KYH C;  4CC5 A;  4LFB B;  4UCU A;  2HIX A;  1N32 B;  4DR5 B;  4LFC B;  1A0I A;  4X62 B;  4NXM B;  4DV2 B;  1CKN A;  4DV4 B;  1FVI A;  1IBL B;  5D1O A;  2VQF B;  4TOI A;  4EEQ A;  2E5L B;  1P16 A;  3L2P A;  1N34 B;  3NBZ B;  2HVQ A;  1HNX B;  4JV5 B;  2CFM A;  3UQ8 A;  4LH6 A;  4NXN B;  4GKK B;  4UCO A;  3SGI A;  2HVS A;  1DGS A;  5IWA B;  1IBM B;  3NBY B;  4UCS A;  1FJG B;  1N33 B;  3JSL A;  3T1Y B;  4JI8 B;  4CC6 A;  4PZ8 A;  4UCV A;  2UXC B;  2F4V B;  1VS0 A; 
#chains in the Genus database with same CATH topology
 3LSU A;  5J2T A;  2JEJ A;  4GKK O;  5KFF A;  2VA2 A;  4FU0 A;  1LUV A;  5JH7 A;  3STZ C;  2N05 A;  5KS8 A;  2JS5 A;  2IJJ A;  3ZRW A;  5KAF Z;  2XAJ A;  2UUB O;  2QA4 V;  1WCM A;  2ADQ B;  3HOW G;  2DWC A;  2AGA A;  2UVV A;  1LR1 A;  5FLX N;  1SCU B;  1AP6 A;  5GTI Z;  3SNO A;  5CB4 F;  4HR7 A;  5LA6 F;  2YEV A;  5C5J A;  1YCI A;  2XAF A;  1IYE A;  4O3P A;  1I5Y A;  4EB6 A;  4X64 O;  1EKF A;  5CA3 A;  5KA6 A;  2J6S A;  5B1A C;  5JVD A;  2CZG A;  3D8C A;  4C7U A;  3BAC A;  2VPQ A;  4F4Y A;  1WH2 A;  4JYB A;  2C35 B;  2M05 A;  2Q0O C;  2RGR A;  4RUA A;  4I50 B;  1ARO P;  4D6T H;  1FFT B;  1YJ9 V;  4OX9 B;  4EGQ A;  2WB1 E;  3OTO O;  1K1S A;  2Y0I A;  3UZO A;  3G6Y A;  4O7S A;  5IT9 W;  1L2Z A;  2DWD C;  4DR5 H;  5BXZ A;  2EZO A;  2NU7 B;  1S0M A;  2R85 A;  5L3D A;  1E79 G;  5J2T B;  3KAK A;  2DE0 X;  1QU7 A;  3BHP A;  5JH7 B;  3M99 B;  3RWR D;  4JV2 A;  1M57 C;  1WA8 A;  2VQF H;  4AYB A;  3PW7 A;  3ZRW B;  4JI4 B;  3DC6 A;  2KB1 A;  3CC7 V;  5KG7 A;  1KP3 A;  3B8N A;  2C28 A;  2ASD A;  4X66 H;  1EZ1 A;  2X0L A;  3CEI A;  2ZDQ A;  1BE3 H;  4ZBM A;  4WCE V;  4FFN A;  1S97 A;  5B1A B;  1FXK A;  4O4J A;  4FBU A;  3RVZ A;  2YEV B;  1Y67 A;  2O03 A;  5FNV A;  3G6E V;  3TET A;  1CKO A;  2ZE7 A;  1ZLZ A;  5EBW C;  4EB6 B;  3QQM A;  4JI7 O;  2YRX A;  2ZNI A;  5CM0 A;  2FMA A;  3V4Z A;  5KFJ A;  1JX9 A;  1WPB A;  2GLT A;  1I6U A;  1FXK C;  5JVD B;  3CRR A;  2ZR2 A;  4HYO A;  2CTW A;  4YIO A;  1WB8 A;  5KFB A;  2R70 A;  3CC2 V;  5DQH A;  3RAX A;  2UUC H;  4JUZ A;  1HNX B;  4JI1 H;  1M57 B;  4A93 G;  4X1K A;  3CCV V;  4NR1 A;  3HO8 A;  4Q45 A;  1JXL A;  2AZ0 A;  1PNL A;  4DR5 O;  5EDW A;  1YIJ V;  5H5N A;  3CCE V;  1VQN V;  4MA5 A;  4FE2 A;  3VPD A;  3T9C A;  4ED6 A;  2VQF O;  4O3Q A;  1WA8 B;  1CPY A;  4P30 A;  1AR1 B;  4LF6 H;  2RF4 A;  2V7Q G;  4B3T H;  1GTO A;  4WFF A;  1Z2G A;  1OCR B;  5EIB C;  5HBR B;  3GIQ A;  2YIB D;  1FXK B;  1N48 A;  4O4J B;  4FM0 A;  2EIY A;  4O7N A;  2I87 A;  2BTQ A;  5FNV B;  3LNN A;  4DV6 B;  1JJO A;  4C5C A;  3HKZ A;  2V4Q A;  2CTQ A;  4PA7 A;  3KAJ A;  4X65 B;  1OWT A;  1Y1W A;  3DTG A;  4I7Z B;  1A3G A;  3KHR A;  3W1B A;  1MG1 A;  4H0L B;  3FAV A;  2QJ1 A;  1Q81 W;  2H94 A;  1CXZ B;  4TQF A;  2OIE A;  5I60 A;  3SYP A;  2UUA H;  3WU2 Z;  2UUC O;  2XCA A;  3JD2 A;  4JI1 O;  5FLM G;  4J9R A;  1TUB A;  3RGX A;  1CS0 A;  2W7O A;  4J9Z B;  4X1K B;  3SPG A;  4K35 A;  5ITZ A;  1KEC A;  4BW5 A;  5C4X G;  2C2E A;  2VQE H;  1I2K A;  2JJ2 G;  2JK5 C;  3ZRV A;  1J5E H;  2W6M A;  3A0B Z;  4W4L A;  5EZY F;  3JD1 A;  1F51 A;  1XNQ H;  1I08 A;  3S24 A;  2NLJ C;  3EXA A;  4LF6 O;  1L8D A;  3E8G A;  4J10 A;  4B3T O;  4LFC H;  3GTL A;  3HOY G;  1SC5 B;  4LF8 B;  3IG0 A;  4DV2 H;  2IBZ H;  1IBL H;  4UB6 Z;  2ODM A;  3R5X A;  2XND G;  1V9P A;  4PDV A;  2BTQ B;  4O4H A;  4ECW A;  2EBO A;  1XBL A;  1PK8 A;  4LH7 A;  4B7E A;  5DG8 A;  4QWD A;  3Q1K A;  4NVP A;  1GRJ A;  1JFF A;  3HPL C;  2LFR A;  1N33 H;  3F5T A;  4JI8 H;  1NKD A;  2YI8 A;  3PJS K;  3ZRX A;  5EK0 A;  4HQ6 A;  5DGB A;  3FAV B;  4U7O A;  2ZCE A;  5KFM A;  1OCC C;  2UUA O;  2YWV A;  5BYB A;  3MFH A;  2XHB A;  1Y1V A;  3DGE A;  1KD1 W;  1TUB B;  2Z5U A;  4O3O A;  1EM1 A;  5ITZ B;  2VA3 A;  4ED1 A;  2VQE O;  4RAI A;  3R66 A;  4J7J A;  5IYB O;  5EOY A;  1J5E O;  1JKJ B;  5CE8 A;  3ABU A;  1EZJ A;  3IAY A;  1SFO A;  1XNQ O;  3JAM W;  1Q8I A;  3AG1 C;  4MTO A;  3B8M A;  4EG0 A;  1M7J A;  1F7Y A;  3ZS8 C;  4I55 F;  3MHH C;  1Q6U A;  2O57 A;  1Q43 A;  4AI8 A;  4LFC O;  2ZT9 B;  2JJ1 G;  3NR7 A;  3CME V;  4O81 A;  5JQG A;  1SQG A;  1EN4 A;  4DV2 O;  1S77 D;  1CQJ B;  2FPG B;  2E74 B;  4HNU A;  1IBL O;  4MV6 A;  4QJF A;  4PEL A;  2R92 A;  3L73 H;  5LMN H;  3GIJ A;  4GX2 A;  4FFB A;  4O4H B;  1SS3 A;  2W6I G;  5B66 Z;  4ZHQ F;  1NZ6 A;  3R65 A;  1KUQ A;  1OCC B;  4RO2 A;  4UFZ A;  5BWR A;  3K5H A;  3PVX A;  4I5S A;  3A8T A;  1JFF B;  1N33 O;  1VQ7 V;  4DUZ B;  4JI8 O;  4KXR A;  2JS3 A;  2EJ2 A;  5JWP A;  1B3Q A;  2E75 B;  2CTR A;  2MCT A;  2OCH A;  2Q0A A;  5FL7 G;  4C2M A;  5GON A;  3WFV A;  3AG1 B;  3N43 B;  3GTK A;  2BR0 A;  2HJW A;  4ETS A;  5JUM A;  2NNU A;  3RB6 A;  5C1P A;  1JLL B;  4NYK A;  4K8Z A;  1HNX H;  1KT8 A;  4C5B A;  3CRM A;  4JYA H;  2FK1 A;  4TWK A;  5KFW A;  3M8A A;  3IC9 A;  5JQG B;  2DOS A;  3UCS C;  4XDJ A;  4LFB H;  1NTK H;  3E83 A;  1I1K A;  5F9L A;  2DAB A;  4MTF A;  4QJF B;  5T14 A;  2ZD9 A;  5LMN O;  3E86 A;  3T4Z A;  5IDJ A;  4KHP B;  3VMM A;  3WWJ A;  4FFB B;  4TUY A;  2QWQ B;  1R3K C;  5KFE A;  3UO2 A;  2XAH A;  4IRC A;  3EVK A;  5A2Q W;  3HBL A;  3SYO A;  1T5E A;  3JZ6 A;  4CS2 A;  2EIJ C;  2R86 A;  1DIK A;  1SES A;  1G1X B;  1BCC H;  1GN3 A;  2BOC C;  4RCN A;  4NB5 A;  1IOW A;  5KT4 A;  1S0N A;  4YR3 A;  3OE7 G;  2P4K A;  5GON B;  2W57 A;  1SZT A;  1I7L A;  3NXS A;  4ECQ A;  4DR6 O;  4TV9 A;  1Z5V A;  2GBO A;  2M6Y A;  2PMZ A;  1HW7 A;  3PW4 A;  2X5R A;  4NLG A;  2QB5 A;  1HNX O;  3STL C;  1TWA A;  1NBM G;  1S03 G;  1GO3 E;  1M0W A;  3A2F A;  4EBE A;  4JYA O;  3GIP A;  4UV8 A;  2KQX A;  4TOI A;  1AVM A;  2HVQ A;  4BIO A;  5I5X A;  1H2N A;  2NN4 A;  2VS0 A;  2EIK C;  2CFM A;  2VUM A;  3KG2 A;  4LFB O;  4ICG A;  2F1M A;  4BW9 A;  3QFF A;  2A3Q A;  3RYH A;  1N32 O;  3MR6 A;  5KX5 A;  2AGQ A;  1DGS A;  4TV8 A;  1NU1 H;  4UCS A;  1VQ5 V;  1FJG B;  4MV3 A;  2YI9 A;  1Y66 A;  3QVN A;  4TUY B;  5CR5 A;  3ZIA G;  1O75 A;  2Q69 A;  1URF A;  5HFL A;  3RJ0 A;  2HVJ C;  2DYS C;  2A7W A;  3G4S V;  4P9O A;  2HR3 A;  1MZF A;  3PW0 A;  1I94 H;  2YYA A;  4IL6 Z;  1Q3E A;  3L9D A;  4F4L A;  3MJF A;  2HJD A;  3GIM A;  3E5N A;  3T9A A;  4DW1 A;  4O2B F;  2C2A A;  4EQ5 A;  4JI3 B;  3VQW A;  1KBL A;  5KFN A;  1KU9 A;  2QM4 A;  4B3S H;  1K97 A;  4TV9 B;  1E4E A;  1TUE B;  4DR3 B;  3HKE A;  1AP5 A;  1KJI A;  2EIK B;  1A0G A;  4A3K G;  1VP7 A;  3KHL A;  1SET A;  2QYZ A;  4O7L A;  4WFB V;  4GYC B;  4LWS A;  3F7Y C;  4RUE A;  4OPA A;  2AGP A;  3R5F A;  2X7R B;  2V9W A;  1PNM A;  5I5S A;  4FMT A;  4MV9 A;  2CKZ B;  2WB1 A;  1R6K A;  4ECS A;  3H0G A;  3RYH B;  3ETG A;  3OUU A;  2OH2 A;  5KX5 B;  5LBQ A;  1XMQ B;  2DYS B;  4TV8 B;  1BNC A;  3L74 H;  2XD4 A;  2DQ3 A;  1W0J G;  4KUM A;  1K7D A;  3VQV A;  4IIJ F;  1K92 A;  2BSK A;  3ASO C;  1A32 A;  4DRX A;  3HKZ E;  5FJ8 G;  3X2Q B;  1K1Q A;  1RJR A;  1M0T A;  1RPO A;  4WFG A;  1S0V A;  2JA6 A;  5IJ9 A;  4IHJ F;  1I94 O;  4YP3 A;  3K5M A;  1TWG A;  1NH2 B;  2FP4 B;  1VBH A;  2VPS A;  5BWX A;  3UFX B;  2KSW A;  4R7C A;  1FAF A;  4PDR A;  3S3W A;  3G6X A;  5LHG A;  5HNE A;  2W6J G;  4B3S O;  5IWA H;  1E4E B;  4DR1 B;  1UFI A;  2COJ A;  1BMF G;  5E1A C;  3HKE B;  3LSQ A;  4B3R B;  4JF3 A;  4DO2 A;  3SJC C;  5BWU A;  3ABM C;  4F4X A;  3B77 A;  4LWS B;  4FLY A;  5DGA A;  2HIX A;  2BQU A;  5LYJ A;  3ASO B;  2Z04 A;  4L8J A;  1SER A;  5CA0 A;  4HAM A;  5IYZ F;  4UUG A;  1MZB A;  1UNN C;  5DN6 G;  2XC9 A;  2ZIM A;  4O7W A;  4DV0 H;  4EEQ A;  5KFX A;  1N34 B;  1Y76 A;  4CMD A;  2V59 A;  2BSK B;  4JTC B;  5EC1 C;  5LOV A;  3AYH B;  4CS3 A;  4DRX B;  4MSW C;  5KFP A;  4HYK A;  1X59 A;  3ZED A;  3FB5 C;  3VOU A;  5IJ9 B;  1GSO A;  1Y74 A;  2VWK A;  2JEI A;  4YHH H;  3Q8R B;  3WO0 A;  3K9A A;  2F4V B;  2A79 B;  1XL4 A;  2AZ2 A;  3DXR A;  2B63 G;  3B4S A;  3QO8 A;  3ABM B;  1IUR A;  2FKL A;  3E8H A;  4DYL A;  4FLU A;  3FYE B;  5IWA O;  3P32 A;  4FM9 A;  5L1K A;  4F4W A;  4GKJ B;  3N6X A;  3JAT A;  5L3G A;  2HVK C;  4FZ0 A;  2Y0S E;  1U96 A;  4IZO A;  2R82 A;  1AIL A;  5CB4 A;  2J9G A;  5LA6 A;  1R6N A;  5LYJ B;  3UYY A;  1GK9 A;  5CA0 B;  5FPR A;  5EBL C;  4DV0 O;  3H9V A;  1QLN A;  3AG2 C;  1SRY A;  1ZUQ A;  5IYB G;  1Y76 B;  2YS8 A;  1ZHS A;  2QKC A;  3GTG A;  5F2V O;  2B9Z A;  3U9S A;  3D3Q A;  1XMO H;  3Q2O A;  4ZI7 F;  5LOV B;  2AXT Z;  3T5K A;  2HLD G;  1I7F A;  2HHH H;  3OEE G;  2XUM A;  4GC7 A;  1ZX3 A;  4LBE C;  1BGW A;  3E89 A;  1Y74 B;  4YHH O;  1YF2 A;  3K5L A;  3CHX A;  5JJE B;  4QE9 A;  4O84 A;  1NQT A;  3DXR B;  3RBD A;  4ECV A;  4ED7 A;  1BQZ A;  3CRC A;  3ORQ A;  4X62 H;  4XDL A;  5CBH A;  3QTC A;  2PGG A;  3GLK A;  1L1F A;  2ZNJ A;  4O7Z A;  1XK5 A;  3K57 A;  1F4M A;  3VNN A;  3JAT B;  2V58 A;  5L1I A;  2NVY A;  4P2Z A;  2XIG A;  3H01 A;  1GM8 A;  3AG2 B;  5CB4 B;  4JYY A;  2R7Z A;  2IA6 A;  5BMV A;  5LA6 B;  1KJ9 A;  1KTA A;  3UKM A;  4FLT A;  2X6C A;  1HNZ B;  2W6O A;  5CN0 A;  4ZKI A;  1WNS A;  1RSO A;  5H80 A;  1P49 A;  4QW8 A;  1HR0 O;  2OLS A;  4RWU A;  2ZDH A;  3SYA A;  3THO A;  5K2M A;  2DPI A;  2EIN C;  1M1K W;  1XMO O;  2UXN A;  2LGQ A;  1L0N H;  4FS2 A;  1Z2P X;  1HNW O;  3RYC A;  1ZWI C;  2GV9 A;  2HHH O;  2JGD A;  2EJ7 A;  3D36 A;  1WN7 A;  3OAA G;  1B33 N;  4EBD A;  5L9X A;  4A2A A;  4Z2W A;  3GV7 B;  2BE3 A;  3B09 A;  1T36 A;  3APO A;  2YDE A;  4JYC A;  3K5N A;  4G3I A;  5EIB D;  3FMA A;  1JMK C;  4X62 O;  3T99 A;  4TQR A;  1G8M A;  3D36 C;  1C3O A;  3K5I A;  1R3J C;  2D3O W;  3DTF A;  1QQC A;  2ZXW C;  4ZOL F;  5CBG A;  3Q8P B;  4R7R A;  2UXB H;  2VR1 A;  1E1Q G;  4A3F G;  4GT1 A;  4NXN O;  2WLL A;  1AI4 A;  4TQD A;  2COI A;  4NZO A;  3K04 A;  4JAV A;  2IH1 C;  4DR1 H;  2R9R B;  2YCH A;  5KFY A;  4I4T F;  3LUL A;  5DEC A;  2EIN B;  3VQY A;  3VA7 A;  2R9I A;  4J7Z A;  3LSS A;  5BMV B;  1KJQ A;  2DIK A;  4B3R H;  3BQ2 A;  4LF4 H;  4NTX A;  4DR7 H;  4OXS A;  5DLF A;  2DLN A;  3WB2 A;  1N36 B;  1YVW A;  1AR5 A;  2MW2 B;  1RSO B;  1VIB A;  5C8Y A;  1I5X A;  4WFA V;  3TW6 A;  3BA9 A;  3TK1 A;  2XOK G;  2UVR A;  2QR4 A;  3OTF A;  5FLX W;  4BY7 G;  4MTG A;  3RYC B;  3E35 A;  3MR3 A;  2JGD B;  2CE4 A;  4MV7 A;  4ZQI A;  1M9N A;  3SYC A;  4YJ3 F;  2GHY A;  1N34 H;  5DM6 V;  2WAQ E;  3BAB A;  2FB9 A;  2ZXW B;  4YJ2 A;  1E4F T;  3C0F B;  4CE5 A;  4Q0Y A;  3J81 N;  5IJ0 A;  4Y8V B;  4YIP A;  5FPO A;  1D2D A;  4YY3 H;  2XAG A;  4A3M G;  1K5S A;  4JI2 B;  2HIV A;  5CA1 F;  4MVU A;  2CGN A;  3U11 A;  2UXB O;  3GIK A;  4FLX A;  4QPK A;  2WE6 A;  2F66 C;  5DQG A;  2WLL B;  3S3X A;  4EFB A;  3VQX A;  4DR1 O;  5KFQ A;  4DV4 H;  3RTX A;  3VPB A;  5BWT A;  1V51 A;  1D5N A;  4B3R O;  2C00 A;  3LP8 A;  4LF4 O;  4DR7 O;  2AHZ A;  4LR3 A;  4JI0 B;  3EHB B;  5KUM A;  2W9B A;  3WB1 A;  3NUA A;  4ZIB A;  2W71 A;  1PM9 A;  3Q4H A;  1RK6 A;  2WAM A;  3HKC A;  1F4N A;  3BY6 A;  5KFO A;  5C8Y B;  2AGO A;  4O7T A;  4JI6 B;  4Q44 A;  3JD0 A;  1TAE A;  3OMA B;  4JV0 A;  4LF5 B;  2RGV A;  5IYD O;  2UXD B;  1N34 O;  3KYH C;  1BS3 A;  3WWH A;  4WBN A;  5KMG A;  3RGZ A;  4YJ2 B;  1FXV A;  4PJ0 Z;  3P30 A;  3SJB C;  4RAZ A;  2DMX A;  3BJY A;  4N23 A;  4YY3 O;  3BQ0 A;  2XAS A;  1AR4 A;  1W0K G;  3SYQ A;  5IJ0 B;  3AK1 A;  4JV5 B;  2CDY A;  4LH6 A;  5LMU H;  4X9Q A;  2ZR3 A;  4I55 A;  3JCZ A;  4BBS G;  1PKX A;  4BBR G;  4DV4 O;  2R7K A;  5CBF A;  4A3E G;  1OCR C;  3CPW U;  1RPR A;  3LQS A;  2UU9 H;  4GCZ A;  4FFM A;  2W9B B;  4A3B G;  4UCR A;  4ZHQ A;  3Q4H B;  4DW0 A;  2P90 A;  1SQF A;  2YXH A;  4DV7 B;  3HKC B;  4GLW A;  1Z2N X;  2DAA A;  3ZHS A;  1PD3 A;  3T9F A;  2R84 A;  3RFR A;  2HKO A;  4UUJ C;  1UPG A;  5D8D A;  1Q6I A;  1AI6 A;  3CCL V;  2ITC C;  1DF5 A;  4WBN B;  2ARH A;  4DL7 A;  1IBK B;  5KMG B;  3J7A K;  1OCO C;  3I12 A;  4F6R A;  2E2H A;  2G38 A;  4PD4 F;  3CSW A;  4X66 O;  1R73 A;  2L35 A;  4DUY H;  5LMU O;  3AW8 A;  2HGW A;  4EYH B;  5H2F Z;  1H8H G;  2HJF C;  5LP6 F;  4I55 B;  3EYY A;  2Q8V A;  1K73 W;  3HOZ G;  3F5W C;  1HP8 A;  4HZ3 A;  4DR2 B;  1VQ9 V;  1OV9 A;  2ZM6 H;  4QPJ A;  2Q67 A;  3CRQ A;  3N2G A;  2W7P A;  3JAW A;  2UU9 O;  2QE7 G;  3I5D A;  2RN9 A;  3RVY A;  4R50 A;  4DV3 B;  3NC0 B;  5H6R A;  3KAL A;  4ZHQ B;  3W7X A;  5C44 G;  4J9P A;  5KT3 A;  2R8G A;  4TSF G;  4FVM A;  4K8X A;  2EJ0 A;  3HOX G;  5B1N A;  1VQM V;  1OCO B;  3N41 B;  3OD4 A;  3BAA A;  1N36 H;  2HG8 A;  2DJV A;  4I50 F;  1EN6 A;  3WWI A;  1MSD A;  3ABL C;  3UZB A;  3ICX A;  3T9E A;  2RQ6 A;  5EC2 C;  5I47 A;  5BR8 B;  3TEK A;  2A1H A;  3FKI G;  4LCU C;  4F6R B;  2W6Q A;  1KQS U;  1AN7 A;  1ZHQ A;  4DUY O;  2WLH A;  3D3I A;  3JAS A;  4NZN A;  2Y4U A;  4DK1 A;  1JDE A;  2WTF A;  3E8B A;  5LXT F;  3T9D A;  1KP2 A;  3NBZ B;  3FX7 A;  2ZM6 O;  1T3N A;  3PO2 G;  2PVP A;  4M9U A;  3WO1 A;  3KKY A;  2V4D A;  1F23 A;  2LW7 A;  3RYI A;  2WYO A;  3N2G B;  2EX3 A;  3SGI A;  3JAW B;  2FB5 A;  5KHG A;  4FFO A;  2ILM A;  2P67 A;  1HDJ A;  4GZR B;  2A0L A;  3ABL B;  3TQT A;  3BRC A;  1S5L Z;  2IU3 A;  1ZTE A;  4K3A A;  4XZ3 B;  3W1G A;  2D2C B;  4BWS C;  1NH2 D;  2K9P A;  3IGA C;  3SR2 C;  4HBN A;  4KL1 A;  4DV5 B;  2UXX A;  4OX9 H;  3K79 A;  2YID A;  3RN4 A;  2P5O A;  3UO3 A;  2W70 A;  2Y0S A;  3T54 A;  3N6R A;  4JI6 H;  1R1B A;  1R3L C;  3L72 H;  2YW2 A;  2FK2 A;  4FBT A;  1N0N A;  1XNR B;  2WLI A;  4Q43 A;  2DW4 A;  4O2B A;  2UXD H;  4IAJ A;  1ZET A;  2R72 A;  2ADP A;  2GQS A;  5EWF A;  1BXR A;  4JXU A;  5LHH A;  1V55 C;  2B5U A;  2OT5 A;  3OMI B;  3JAS B;  4JI4 H;  1K5Q A;  1BZK A;  1MOF A;  2Q2T A;  3JD4 A;  1Q6H A;  3VBB A;  5KFZ A;  5J9P C;  4O4J F;  2Q7E A;  5J2U F;  2W9C A;  5CAE B;  3RYI B;  4J9N A;  3V6H A;  1CQI B;  2LGW A;  3BG5 A;  4LSX A;  1I7N A;  1JQ0 A;  3OUF A;  4DR4 B;  1M56 C;  5DGI A;  4A5U B;  4LFA B;  3TIN A;  1NS1 A;  4W4K A;  4O3N A;  4IIJ A;  3UM7 A;  5KFT A;  4JTD B;  3RF2 A;  3QNE A;  2JVD A;  2OWO A;  4QE7 A;  3V6J A;  4OX9 O;  1EYZ A;  2FLN A;  1WJZ A;  3E8F A;  3H1I H;  3T1H B;  4B3M B;  4AQY B;  1V55 B;  4FFR A;  2Q6A A;  4HNT A;  3OGI B;  1O9H A;  4ECY A;  2DWE C;  2R7M A;  5JQW A;  2N74 A;  2WLI B;  4O2B B;  2I8C A;  1SEI A;  3PW2 A;  4PA3 A;  4Z1V A;  4XYL B;  3CCJ V;  4FPP A;  3ZHQ A;  2ODT X;  3GTJ A;  3K0G A;  4LF7 B;  1FYJ A;  1IBK H;  2R87 A;  3JAK A;  4JI4 O;  3N40 P;  3JAR A;  5C3E G;  2CTP A;  2KKW A;  2Y4R A;  4L87 A;  1M56 B;  1B6R A;  2W8L A;  1IX9 A;  4JPR A;  4QSH A;  2PF4 E;  4NXM B;  1QNM A;  1OBG A;  4BAY A;  2W9C B;  1EKV A;  5IYZ A;  2P4V A;  3WG7 C;  4DV6 H;  3JRW A;  1H2M A;  1AB3 A;  4X65 H;  4RAY A;  3TXS A;  5KT5 A;  3RB0 A;  1XUQ A;  1MSW D;  2JA5 G;  3ZHV A;  2DQ0 A;  5L3C A;  4IIJ B;  4RB2 C;  1K33 A;  1XOU A;  4MV4 A;  4PWQ A;  2RMK B;  1IBM B;  3AK3 A;  3OMN B;  5KKN B;  3OEH G;  3T1Y B;  1GGO A;  4DXW A;  5IP9 G;  1LUW A;  2YXY A;  2UXC B;  4J7K A;  1N0J A;  3HOV G;  4RNN A;  4LP8 A;  1B6Q A;  2F93 B;  3TIG A;  1VF7 A;  4PA6 A;  3G71 V;  4A3D G;  1ZSP A;  4LF9 B;  4JAA A;  3C90 A;  3WB0 A;  3ZCC A;  4EKW A;  3M9N B;  4OPH A;  5KG0 A;  1EFR G;  1P84 F;  1KBH A;  2VUG A;  2YS7 A;  2Y48 A;  4LSA A;  4MV1 A;  4DV1 B;  3JAK B;  2WWW A;  3WG7 B;  5DGH A;  3JAR B;  3SDL A;  4J9K A;  1GAX A;  1N8R W;  5IYD G;  4LF8 H;  2B1I A;  5A2Q N;  3BFR A;  3JYC A;  4CH5 A;  2PI4 A;  4O4I F;  4HNA A;  2XAQ A;  2WAQ A;  1E4G T;  3M9M B;  3O65 A;  4DV6 O;  3OSN A;  4DIM A;  4RU9 A;  5IYZ B;  2JRI A;  2QSA A;  4GX1 A;  5KHI A;  4X65 O;  3ZHT A;  4PDL A;  4MTX A;  2Q4P A;  3ZMV A;  1R9T A;  1ZAU A;  4KP4 A;  4O2A F;  3GID A;  4MVO A;  3E2E A;  4ZI7 A;  3X2Q C;  2YU9 A;  1TGO A;  3GTQ A;  2R7L A;  2JEF A;  1SQQ H;  3P3N A;  4QWA A;  3GII A;  4A3L G;  1CP9 A;  1I1L A;  3HB3 B;  1JIH A;  4P9P A;  1XHZ A;  2R8J A;  5B5E Z;  5KT6 A;  2ABJ A;  3ETE A;  1AI5 A;  3ZMS A;  1JA8 A;  2F23 A;  2YZG A;  2FKX A;  4EEY A;  4CH4 A;  3CWB H;  2R93 G;  2YRW A;  2E2I A;  1PL4 A;  1M90 W;  1DV1 A;  1TVK A;  4M0J A;  2WLK A;  4GUN A;  4J0M A;  4K0K B;  1DLB A;  4IWY A;  2ZKO A;  1SKV A;  1XNR H;  1COW G;  4CHI A;  4FLW A;  3U55 A;  4JI5 B;  3T5L A;  4U7N A;  1BQ0 A;  3P3P A;  4LF8 O;  2EJ3 A;  3Q8Q B;  5K1X A;  3SJQ C;  2I80 A;  4DL2 A;  2JDI G;  1NTM H;  3N42 B;  3GWO A;  2YS6 A;  4HNA B;  2W0F C;  4O86 A;  3LDD A;  1QR9 A;  4QGP A;  4RZR A;  4UVB A;  1VEW A;  1W2B U;  1V4Y A;  1DAA A;  3MFI A;  2XGP A;  4RB1 A;  2W9A A;  3CCU V;  4DUZ H;  1CKN A;  2NU9 B;  4PV1 B;  5I5V A;  2CQY A;  4DL6 A;  4ZI7 B;  2E5L B;  4O7V A;  2GUZ A;  1GYF A;  1KJ8 A;  1MNG A;  2WDT A;  4ED8 A;  4GKK B;  3L4J A;  2EUL A;  3BEH A;  1K9M W;  5BPH A;  1ZQ7 A;  1WP8 A;  3MHS C;  4X1Y A;  2W8K A;  4O4L F;  1VQP V;  3DTU B;  4G2K A;  1TWC A;  4IGG A;  3U0G A;  2QGN A;  2V4R A;  1TVK B;  5KFS A;  1GN2 A;  4J42 A;  2CW8 A;  2FE3 A;  1YSC A;  3GTP A;  5FR9 A;  5DG7 A;  3FB7 C;  3ZBH A;  2FJZ A;  4X64 B;  1BHB A;  5KFU A;  2IP4 A;  1NR1 A;  3JRX A;  1EZV H;  1VQ6 V;  1P4R A;  4I4T A;  3ORR A;  1SZX A;  1RK5 A;  3F8N A;  3HXL A;  2DZD A;  2CK3 G;  5L1J A;  2R8K A;  1H38 A;  4KHP H;  4QIW F;  4YXW G;  4RQF A;  1O9G A;  4ABM A;  1H2L A;  3TY9 A;  5DG9 A;  5D5P A;  3OTO B;  4DL4 A;  3CCR V;  2WA4 A;  4FFK A;  1YHQ V;  4DUZ O;  2L6L A;  1CKN B;  2AU0 A;  4BXX G;  3H1H H;  3IN5 A;  2LO1 A;  1BL8 A;  3ASN C;  4YJ3 A;  2GUZ B;  5EWG A;  1S5H C;  3W7T A;  4MVR A;  1Y4M A;  3V4S A;  2RDC A;  3K03 A;  3KHH A;  1KB9 F;  2IJI A;  5KA5 A;  5KG4 A;  5L3F A;  4O3R A;  1H8E G;  1JPX A;  4X1Y B;  4MS2 A;  3LWB A;  2FLP A;  5CA1 A;  5KHJ A;  3RFC A;  1WB7 A;  2HGS A;  1KC8 W;  1VBG A;  1MMM A;  3MWE A;  5IE9 A;  3RIZ A;  3U10 A;  3GTO A;  4JZG A;  3I4M G;  4JI7 B;  3H4D A;  4Q4D A;  3R5H A;  1UC9 A;  1M93 A;  5KFD A;  3CQZ A;  2NU8 B;  4I4T B;  4Q8F A;  2ZDI A;  4C5A A;  2X0S A;  5KX5 F;  2YIA A;  4KHP O;  3OGC C;  5LGU A;  3JSN A;  1FJG H;  3BQ1 A;  4FJC C;  1S3J A;  3ASN B;  5KHK A;  3OT7 A;  1XDN A;  2ZDI C;  3U0Z A;  4I9W A;  2FYU H;  1KJJ A;  3H1L H;  4CC5 A;  4FFL A;  1A9X A;  1XL6 A;  4DR5 B;  3TCU A;  2Z0A A;  5BY1 A;  1VAR A;  4YJ3 B;  1VQO V;  1AJQ A;  3IFX A;  2SCU B;  3APQ A;  3K08 A;  5AG2 A;  2AQ4 A;  2VQF B;  1T94 A;  3GVM A;  4JI3 H;  4LNU A;  2RJZ A;  3UT5 A;  1OZ0 A;  4DR3 H;  3OR7 C;  3QO5 A;  3K06 A;  2B63 A;  1P7B A;  1U97 A;  5CA1 B;  5DMX A;  3I4N G;  3MAQ A;  2P06 A;  4CC6 A;  4MT8 A;  1NT2 B;  3KRE A;  1Q7Y W;  3PFF A;  4FZ1 A;  4K0K H;  1S72 V;  2XTA A;  1VS0 A;  1ULZ A;  1WP7 A;  3FB6 C;  1GLV A;  4WHX A;  5B1B C;  4JI5 H;  1XMQ H;  2FLL A;  2JA7 G;  5DQI A;  2OIG A;  1FJG O;  2Y69 C;  2Y0P A;  1K3E A;  2RCV A;  2DPJ A;  2F95 B;  4MVZ A;  2UUC B;  1BHA A;  4JI1 B;  2NR5 A;  5L1L A;  1WCM G;  4A3G G;  1RP3 B;  2QWP B;  4O83 A;  3DAA A;  3C3S A;  1G6U A;  2J6T A;  2Z3Y A;  4CH6 A;  1GM9 A;  3SPJ A;  2QWR B;  3GB8 B;  3C3T A;  4QIW E;  5JVL A;  4JI3 O;  3SPI A;  4ASU G;  4UB8 Z;  3FKS G;  4LNU B;  4APM A;  4LF6 B;  5FD6 A;  4B3T B;  4GKK H;  3UT5 B;  4DR3 O;  4A3J G;  2ZDG A;  5KFR A;  1YXB A;  3GJX B;  1K4D C;  4RB3 C;  4QWB A;  1AJN A;  5B1B B;  5LP6 A;  5JJJ B;  2Y69 B;  2GPS A;  3CCM V;  1EKP A;  3GDE A;  5KFH A;  2CAZ C;  5I5U A;  3G6B A;  2KG7 A;  1KKD A;  1EBO A;  3LUT B;  3K5O A;  1JCH A;  4FLV A;  4JI5 O;  1XMQ O;  1GN6 A;  1X4T A;  2R9A A;  5LP6 C;  1Z5W A;  4O82 A;  1TWH A;  1ORQ C;  2UUA B;  5LOV F;  3GWK C;  2VOB A;  2CW7 A;  1XHX A;  4XX0 B;  1CKM A;  3SI8 A;  1YJW V;  3J80 N;  3KTM A;  3ZX6 A;  4KFM A;  2VQE B;  3TJT A;  2COG A;  3TY5 A;  1NJI W;  1J5E B;  2IMW P;  4X1I A;  3OFN G;  5EZY A;  4J11 A;  5D1P A;  2F4V H;  4E4T A;  1XNQ B;  5KFI A;  5IY5 C;  4FIP C;  2ATK C;  2Q5Z A;  4JGS A;  4LFC B;  4WFE A;  3IJ4 A;  4DV2 B;  1RFY A;  4UXN A;  3FDS A;  4GKJ H;  4RZQ A;  1DK1 A;  5D1O A;  1IBL B;  3K0D A;  2F43 G;  5KHH A;  3EPG A;  5I5W A;  4DL5 A;  4UV9 A;  2R8I A;  5LP6 B;  2ZE5 A;  1JDB B;  5LXT A;  3UQ8 A;  5DED A;  5EBM C;  1GSA A;  1AUV A;  1ZL8 A;  5KT7 A;  3NBY B;  2KG7 B;  1N33 B;  5B1O A;  4MAM A;  1VQL V;  4JI8 B;  3T4D A;  4J9O A;  3TGU H;  3CRA A;  4FGR A;  4YAK B;  3MWM A;  4JI7 H;  4UCV A;  2JA8 G;  1KUT A;  4UVC A;  1WLE A;  3K59 A;  2W6N A;  1Y14 B;  5C93 A;  3G8C A;  4JZ2 A;  3RT3 C;  1WPX A;  2GPW A;  2Q73 A;  3ZRS A;  3AK2 A;  3K3P A;  5IY5 B;  2Y4T A;  4GC6 A;  3OSP A;  4Z1M G;  4FS1 A;  1NVP B;  2QK4 A;  5GTH Z;  3H1J H;  3M9O B;  2E76 B;  3QWU A;  4UCT A;  4NZM A;  2WLM A;  4X1I B;  2F4V O;  2P0A A;  3H40 A;  4CH3 A;  5EZY B;  3RUP A;  3NGD A;  3G6V A;  2JIZ G;  1YEW A;  1FKA H;  1MA1 A;  1M5I A;  4RB0 A;  4MVM A;  5HV6 A;  4ECX A;  3BA8 A;  3QO7 A;  3ZMT A;  4GKJ O;  1Y1W G;  1W96 A;  2ZGI A;  3CB2 A;  5D1O B;  3ABT A;  3VPC A;  2JEG A;  5LMN B;  2QF7 A;  2IBK A;  1GSH A;  5LXT B;  4EBC A;  5IT9 N;  2HFE C;  4IRD A;  5BMV F;  4HN2 A;  4PZ6 A;  5KUK A;  3W7W A;  5J2U A;  2PBZ A;  4EYI B;  1ZL8 B;  3ETH A;  2Q2U A;  4BIZ A;  1HNZ H;  1BSM A;  2NUA B;  3BCC H;  1VKZ A;  4ED0 A;  4DK0 A;  3H4B A;  1P8L A;  4BWA A;  3DSQ A;  2CUG A;  2XT9 A;  1K83 A;  2YL2 A;  3CYO A;  4X89 A;  4BY1 G;  2WSS G;  1RYR A;  1BGY H;  2IU0 A;  1VQ4 V;  1YTF B;  3RR5 A;  1S5J A;  3RAQ A;  3H20 A;  4TQS A;  4DR6 B;  5DIS C;  4CKE A;  1BT8 A;  2C22 A;  4DRF A;  2YZN A;  1OJH A;  3L70 H;  3ZHR A;  1K8A W;  2E3C A;  1FKA O;  4JYA B;  2HHF A;  2DYR C;  4Q6G A;  5DLG A;  4O7Y A;  1QR8 A;  1M4U A;  4J9Q A;  3GV8 B;  4PDB A;  3QG5 A;  4DLK A;  4PA9 A;  2ALZ A;  1IVS A;  2EJR A;  1FXH A;  3GB7 C;  4LFB B;  3ZMZ A;  1N32 B;  3FB8 C;  5IYC O;  4B7K A;  4G27 B;  2QWO B;  1IOV A;  2KSD A;  3CEB A;  4ECT A;  5KT2 A;  2QWN B;  4U7C A;  4PBC A;  4AIL C;  5E79 Z;  1JJ2 U;  1UC8 A;  3JZI A;  5J2U B;  1HNZ O;  1Y1V G;  2JEX A;  3MR2 A;  1DV2 A;  2JGU A;  1VQK V;  4J41 A;  1OBD A;  1GN4 A;  5C8Y F;  2BQ3 A;  3CX5 F;  4RNM A;  3I56 V;  2X6A A;  3K3W A;  4JAU A;  4UVA A;  3ZN0 A;  1PNK A;  2DYR B;  3TXQ A;  4O3S A;  5J2T F;  1IZ3 A;  2P6J A;  3TII A;  5JH7 F;  2IJK A;  2BQR A;  4YJ2 F;  1D5A A;  3CE2 A;  3DF7 A;  1K4C C;  4MVQ A;  1G2W A;  2H8P C;  4WFH A;  4IWX A;  2R92 G;  3T5J A;  2FPP B;  5CMU A;  1Y6X A;  1LNQ A;  1YIT V;  2HHF B;  2GQR A;  4JI2 H;  2P22 C;  3OM3 B;  1S9F A;  4NKG B;  4PHZ A;  4R6Z A;  3R9R A;  4RNO A;  4MTD A;  1WR2 A;  1S68 A;  4RUF A;  4F6E A;  1SQB H;  4MA0 A;  4CKB A;  4PI2 A;  5JVD F;  1ROP A;  2AHY A;  4O4I A;  1XEQ A;  4E4E A;  4JI0 H;  2XCL A;  3RYF A;  1N36 O;  3G80 A;  1QCE A;  2LP7 A;  3TW7 A;  2UVW A;  5KG2 A;  1VQ8 V;  3RB4 A;  2YIC A;  2FL4 A;  4O2A A;  1I94 B;  3KCX A;  4LF5 H;  1N56 A;  1ET0 A;  2R8H A;  1NTZ H;  2PUS A;  2W6Z A;  3AG3 C;  4NTY A;  5KG5 A;  1E1R G;  1GO3 F;  2QDO A;  1UJW B;  4B3S B;  2YSU B;  4WBN F;  2Q7H A;  2V1D A;  4GX5 A;  4YAJ B;  2R7N A;  1WRV A;  3ZHU A;  4MV8 A;  5L3B A;  1DF4 A;  3LDC A;  4JV5 H;  1H2S B;  4JI2 O;  5KFG A;  3RBE A;  2EIL C;  1NI8 A;  3EPI A;  1Q90 D;  3H3V H;  3K58 A;  3RB3 A;  5D5Q A;  3ZJZ A;  5B3S C;  4I7H A;  2LQT A;  5FNV F;  3F7V C;  3FKI A;  2HDK A;  3BPZ A;  4FLZ A;  2LFS A;  3EFF K;  1TWF A;  3PO3 G;  2HEP A;  2OTJ V;  1IDS A;  3MWD A;  2YZL A;  2FML A;  4O4I B;  3CS5 A;  4JI0 O;  3CD6 V;  3CMA V;  3LNM B;  4QWE A;  3OHB A;  1GMG A;  3AG3 B;  3KZI Z;  4Q20 A;  3RYF B;  3JAM N;  1AUX A;  4H13 B;  1THZ A;  3JAL A;  2FTK A;  1PPJ H;  4IHJ A;  5GW7 A;  2YXL A;  4DV7 H;  3RGB A;  2VRZ A;  4JI6 O;  4O2A B;  4YBZ B;  4LF5 O;  1P16 A;  3L2P A;  1US6 A;  4BR6 A;  4R8U A;  2UXD O;  3GIL A;  1FPO A;  4A3C G;  1EUD B;  5KG3 A;  1KYO F;  5KLV H;  2HVS A;  2EIL B;  5IWA B;  2X6B A;  3MDS A;  2VUM G;  1JVM A;  5B3S B;  4FFP A;  4ECR A;  1EUC B;  3L4K A;  4DR6 H;  5K1P A;  4O4L A;  3E22 A;  4OGQ B;  3IC7 A;  4JV5 O;  1W59 A;  1I50 A;  2H3O A;  4PI0 A;  3MR5 A;  2PTM A;  3U54 A;  2C2R A;  4D7S A;  3KXY T;  1XDC A;  4D7T A;  3QZ7 A;  3N2K A;  1Z2O X;  2ZIN A;  2YIB A;  1AJP A;  3RV4 A;  4N21 A;  4DR2 H;  2WLJ A;  1JX4 A;  4JTA B;  1IXM A;  3CJH A;  4AHC A;  4DV0 B;  3HB9 A;  4YQW A;  2QKA A;  2RNB A;  4LC1 A;  4EGJ A;  1B06 A;  3G67 A;  1I3Q A;  5HFM A;  2RDJ A;  2A9H A;  4DV3 H;  1N32 H;  1HWY A;  3L75 H;  4QIW A;  2N04 A;  1V54 C;  3JAL B;  2FPI B;  4DV7 O;  4IHJ B;  2XGQ A;  4ECZ A;  4YHH B;  3ZN1 A;  3CCS V;  1PP9 H;  3TQ1 A;  4IR9 A;  4L1K A;  3BVO A;  4R8U B;  3ETQ A;  1W93 A;  4J9M A;  1J95 A;  1A48 A;  1KKC A;  3Q8S B;  3N27 A;  5BZB A;  4ED2 A;  3CXH F;  2HVR A;  4U3J A;  1IBK O;  3HR0 A;  5DAA A;  2Q68 A;  5LHI A;  1OHH G;  5BR8 H;  2GDS A;  4NTW A;  2Z02 A;  3H0G G;  2OCC C;  4O4L B;  2ATL A;  3E22 B;  1SQV H;  4IYH A;  4PA4 A;  2QKS A;  4TVI A;  1PL0 A;  2WPD G;  3A0H Z;  3N2K B;  1QVG U;  4O4H F;  4DR2 O;  4IRK A;  1V54 B;  2JA6 G;  2PYJ A;  4MW8 A;  3CJH B;  4A2B A;  4AYB E;  5EWE A;  2GTS A;  5LGT A;  3FYI B;  4J9Y B;  1HR0 B;  3AG7 A;  1GM7 A;  4EFE A;  4DV3 O;  1XMO B;  2GTA A;  2EIM C;  1K34 A;  4CMF A;  2Q7D A;  2K1E A;  1HNW B;  2HHH B;  1JR9 A;  2EIJ B;  3HKB A;  2LJ2 A;  1SA0 A;  4IT5 A;  2ITD C;  4DQN A;  4M7E A;  2IM9 A;  4UCU A;  2M7W A;  4DV5 H;  1XQ8 A;  2OCC B;  1H2G A;  4X62 B;  5KG6 A;  3JCU Z;  2JA5 A;  3ETJ A;  4GX0 A;  4HNV A;  4QNH B;  4RQE A;  1YJN V;  2J6U A;  5BR8 O;  4U3J B;  2VWJ A;  5EYP A;  1C30 A;  3PR5 B;  4QWC A;  4NXN B;  4ECU A;  5JQG F;  4R8C A;  3L71 H;  1GKF A;  3ETD A;  4XDK A;  1I1M A;  3B2E E;  1FD9 A;  4J9L A;  3N8D A;  4CBC A;  2EIM B;  2ZQM A;  4Q8E A;  2UVU A;  5C1O A;  4I9Q A;  3J7A U;  1SQP H;  3GV5 B;  4IR1 A;  2PI5 A;  3PR4 A;  5L3E A;  4DR4 H;  2FK3 A;  4LFA H;  3HKB B;  1RYS A;  1SA0 B;  3T1C A;  5GON F;  5IP7 G;  3K9S A;  2YUA A;  1S10 A;  1WAZ A;  3W7U A;  2UUB B;  4DV5 O;  5KFV A;  1QBZ A;  2CNU A;  5IYC G;  4XBF A;  4B3M H;  3T1H H;  3W5O A;  4AQY H;  2CNV A;  1QLE C;  1XIL A;  2ZJT A;  4ZOL A;  2ZIO A;  3VOT A;  3AEI A;  1XNR O;  2UXB B;  3PZP A;  5EYP B;  4CKC A;  3WNZ A;  2BTO A;  1X9N A;  2R6F A;  4YR0 A;  3PN1 A;  4LF7 H;  2IH3 C;  3HKD A;  4H33 A;  5E25 A;  4YR2 A;  3CC4 V;  5JJN B;  1M6V A;  1L0L H;  2OTL V;  3KHG A;  4LF4 B;  4DR7 B;  4LMY A;  2R93 A;  2B1G A;  1ENV A;  4WD3 A;  4X88 A;  4X20 A;  4TUY F;  3JD3 A;  1DTO A;  3TY8 A;  3KCY A;  5KFK A;  3DC5 A;  2ASL A;  4NXM H;  1VAJ A;  1FFX A;  1YZB A;  2Q9L A;  3ML0 A;  2OYQ A;  5FD5 A;  1WSC A;  2QM8 A;  2CGO A;  4K6N A;  1VF5 B;  4TT3 G;  4DR4 O;  4DAA A;  1OCZ C;  2PYL A;  4LFA O;  4FM2 A;  3I55 V;  1PV0 A;  4FK5 C;  1IYD A;  4TM5 A;  3T5H A;  1MZE A;  1QLE B;  3QF7 A;  1NVP D;  3B40 A;  1S0O A;  2LW1 A;  1QHT A;  1IBM H;  1MAB G;  1CE8 A;  2XCP A;  3T1Y H;  4MTE A;  1H2K A;  5LL6 Y;  1QVF U;  3AX6 A;  1YDX A;  4B3M O;  3T1H O;  4TV9 F;  2RDI A;  2ASJ A;  4MVS A;  4AQY O;  4YY3 B;  5KFA A;  2UXC H;  3OUZ A;  4PZ7 A;  3LDE A;  1RJQ A;  1SF9 A;  2R7Z G;  1PX2 A;  4ZOL B;  1B6S A;  1BJT A;  3CVZ A;  5I5Y A;  5BPF A;  4LF9 H;  4WF9 V;  3RBZ A;  1KMI Z;  3OUS A;  3SPC A;  1AI7 A;  2CH7 A;  3OHA A;  4LF7 O;  4DV4 B;  1FVI A;  3A0R A;  2WA3 A;  4F4Z A;  3HKD B;  5F9N A;  4DV1 H;  4PDM A;  4JV1 A;  4ED3 A;  4CZZ A;  1XI1 A;  1GH6 A;  1OCZ B;  4UCO A;  4TV8 F;  2IJH A;  2QEX V;  4CS4 A;  2PY5 A;  4X20 B;  4Q4C A;  4J9S A;  3GTM A;  1Q82 W;  4NXM O;  2CNQ A;  3JSL A;  1FFX B;  2NVX A;  4PZ8 A;  1I2L A;  3R23 A;  4A3I G;  3RV3 A;  1YTF D;  3U9T A;  3N44 B;  1HR0 H;  3CP1 A;  1Q5O A;  5KAI Z;  3OW2 U;  1RM1 C;  1IBM O;  2ETN A;  2DN9 A;  4QW9 A;  1HNW H;  2WLN A;  3T1Y O;  3G8D A;  2W6P A;  4F50 A;  5LL6 b;  3AG4 C;  4X66 B;  2UXC O;  1JOY A;  4GLX A;  1SQX H;  3V6K A;  5H9C A;  3FD9 A;  1R6T A;  2VQD A;  5LMU B;  3O9O A;  1IXB A;  3FFQ A;  4NYE A;  4LF9 O;  1TA8 A;  5BWW A;  3SE7 A;  5TIS Z;  3PW5 A;  3SJA C;  2MK3 A;  4E6N A;  5H6Q A;  2HGX A;  3HT5 A;  2CH7 B;  2C2D A;  2QM7 A;  3GQC A;  4DV1 O;  4E2L A;  2UU9 B;  1S76 D;  4MW3 A;  4NXN H;  2V5A A;  4J80 A;  4ME6 A;  1Q86 W;  1KEE A;  3CXC U;  4XYM B;  2ZE8 A;  1R3I C;  5KFL A;  1SYX B;  3T7A A;  2A06 H;  4I0X A;  1G4Y B;  1RM1 B;  5A9G A;  4U6P A;  2P7T C;  4JAS A;  4DL3 A;  1B04 A;  2IW5 A;  5K3W A;  5LGN A;  4H37 A;  3AG4 B;  3M7M X;  4X8A A;  2BCC H;  2ZE6 A;  3W7S A;  1N4C A;  2YZM A;  3K3V A;  2BOB C;  4IYI A;  2E5L H;  2QTS A;  2AW9 A;  1VF6 A;  4BIU A;  1XRE A;  2HG5 C;  3M4I A;  4YB8 B;  4RUC A;  3CCQ V;  3HOU G;  4DUY B;  4O7R A;  1FS0 G;  3ZMU A;  2UUB H;  3JZF A;  4H44 B;  3CSX A;  1P7G A;  3ABK C;  3QZ8 A;  1VF6 C;  3T2M A;  3H1K H;  4K0K O;  2ZM6 B;  5BWV A;  1NR7 A;  5LYJ F;  3J80 W;  3J81 W;  5CA0 F;  5I5T A;  1VMG A;  2Q7G A;  2PMZ E;  1A0I A;  4G28 B;  4X64 H;  2NU6 B;  1RJP A;  5KG1 A;  3LML A;  3T9B A;  2HP8 A;  1KC7 A;  2QTO A;  1YI2 V;  3SPH A;  5JCO A;  3MD0 A;  2YC0 A;  3RW0 A;  2PN1 A;  4I0X B;  4B08 A;  5BYA A;  3OR6 C;  4I50 A;  4FM1 A;  2W0X A;  2PZS A;  3OTO H;  5KFC A;  2JEU A;  1EN5 A;  2EZP A;  2GSM B;  4U3F H;  5JCO C;  2E5L O;  2JA7 A;  1I0H A;  1CEZ A;  1EHI A;  3ABK B; 
#chains in the Genus database with same CATH homology
 2F93 B;  1VF7 A;  5J2T A;  1D5A A;  3DF7 A;  5JH7 A;  4FLU A;  2JS5 A;  4LF9 B;  4FM9 A;  3WB0 A;  4GKJ B;  3N6X A;  3JAT A;  4JI2 H;  2P22 C;  2VUG A;  4LSA A;  4DV1 B;  3JAK B;  4PHZ A;  3JAR B;  4MTD A;  5CB4 A;  5LA6 A;  1S68 A;  4LF8 H;  4CH5 A;  5LYJ B;  4EB6 A;  4PI2 A;  4HNA A;  5CA0 B;  5FPR A;  1E4G T;  4O4I A;  5IYZ B;  5JVD A;  4JI0 H;  5KHI A;  3RYF A;  1ZHS A;  1WH2 A;  1ZAU A;  1XMO H;  2RGR A;  5LOV B;  4I50 B;  1I7F A;  4O2A A;  1I94 B;  4ZI7 A;  4OX9 B;  2HHH H;  1TGO A;  4LF5 H;  2PUS A;  1BGW A;  3K5L A;  5IT9 W;  3CHX A;  1L2Z A;  5JJE B;  1XHZ A;  4B3S B;  4DR5 H;  2Q7H A;  4X62 H;  5J2T B;  3KAK A;  5JH7 B;  3BHP A;  4CH4 A;  3QTC A;  3RWR D;  2PGG A;  2VQF H;  2ZNJ A;  4JI4 B;  1TVK A;  4J0M A;  4K0K B;  1H2S B;  3K57 A;  1XK5 A;  4JV5 H;  1SKV A;  3VNN A;  3JAT B;  4X66 H;  1XNR H;  3K58 A;  5D5Q A;  2XIG A;  4FLW A;  4O4J A;  4JI5 B;  4I7H A;  5CB4 B;  2O03 A;  3BPZ A;  5K1X A;  4FLZ A;  5BMV A;  5FNV A;  5LA6 B;  1CKO A;  2HEP A;  4FLT A;  1HNZ B;  3N42 B;  4EB6 B;  4HNA B;  2ZNI A;  1WNS A;  1RSO A;  4O4I B;  1WPB A;  1P49 A;  1I6U A;  5JVD B;  3RYF B;  3THO A;  4RB1 A;  3JAL A;  4IHJ A;  1Z2P X;  2YXL A;  2R70 A;  3RYC A;  4DUZ H;  2GV9 A;  3RGB A;  1CKN A;  4DV7 H;  4O2A B;  4ZI7 B;  1WN7 A;  2E5L B;  1P16 A;  3L2P A;  2UUC H;  1HNX B;  4JI1 H;  1GYF A;  4X1K A;  4A2A A;  2WDT A;  4GKK B;  3L4J A;  2HVS A;  3K5N A;  5EIB D;  5IWA B;  3FMA A;  1JMK C;  4X1Y A;  3L4K A;  1QQC A;  4DR6 H;  5K1P A;  4O4L A;  3E22 A;  1TVK B;  4R7R A;  2UXB H;  4LF6 H;  4B3T H;  4PI0 A;  2PTM A;  4TQD A;  2CW8 A;  2FE3 A;  4D7S A;  3KXY T;  4D7T A;  5EIB C;  3N2K A;  2YIB D;  4DR1 H;  1Z2O X;  2YCH A;  4O4J B;  2ZIN A;  4X64 B;  2YIB A;  4FM0 A;  3VQY A;  4DR2 H;  2BTQ A;  5BMV B;  5FNV B;  4B3R H;  3LNN A;  4I4T A;  1JJO A;  4DV0 B;  4AHC A;  4DV6 B;  3F8N A;  3HXL A;  4LF4 H;  4DR7 H;  3KAJ A;  4X65 B;  3WB2 A;  1N36 B;  4KHP H;  4DV3 H;  3TY9 A;  1N32 H;  1O9G A;  5C8Y A;  3BA9 A;  3W1B A;  5D5P A;  3OTO B;  3OTF A;  5FLX W;  3JAL B;  2QJ1 A;  4IHJ B;  3RYC B;  1CKN B;  4TQF A;  4YHH B;  4MV7 A;  1N34 H;  2UUA H;  3BAB A;  1TUB A;  4YJ3 A;  4YJ2 A;  3RGX A;  3ETQ A;  4X1K B;  5ITZ A;  1E4F T;  2VQE H;  2HVR A;  3C0F B;  4U3J A;  1J5E H;  4Q0Y A;  5IJ0 A;  5BR8 H;  4YY3 H;  5FPO A;  4X1Y B;  1XNQ H;  4JI2 B;  3S24 A;  2HIV A;  3U11 A;  4O4L B;  4FLX A;  3E22 B;  1L8D A;  5CA1 A;  2WE6 A;  5KHJ A;  4LFC H;  2HGS A;  2F66 C;  4LF8 B;  3IG0 A;  4DV2 H;  4EFB A;  3VQX A;  3U10 A;  3RIZ A;  4DV4 H;  3N2K B;  3RTX A;  1IBL H;  1V9P A;  4JI7 B;  2BTQ B;  2PYJ A;  1M93 A;  4O4H A;  4I4T B;  4LR3 A;  4JI0 B;  4A2B A;  3WB1 A;  1HR0 B;  4LH7 A;  4ZIB A;  2YIA A;  4NVP A;  4EFE A;  1XMO B;  1JFF A;  3JSN A;  1FJG H;  3HKC A;  1N33 H;  1HNW B;  5C8Y B;  2HHH B;  4JI8 H;  2YI8 A;  3HKB A;  4JI6 B;  5KHK A;  1XDN A;  1TAE A;  1SA0 A;  4LF5 B;  2RGV A;  3U0Z A;  2ZCE A;  2UXD B;  3KYH C;  4M7E A;  4CC5 A;  2IM9 A;  4UCU A;  2XHB A;  4WBN A;  4DR5 B;  4DV5 H;  5KMG A;  1XQ8 A;  1TUB B;  4YJ2 B;  4YJ3 B;  3RGZ A;  4X62 B;  5ITZ B;  3SJB C;  5EOY A;  4RAZ A;  2VQF B;  4JI3 H;  4U3J B;  3IAY A;  4LNU A;  2VWJ A;  5IJ0 B;  4JV5 B;  2RJZ A;  1Q8I A;  3JAM W;  5EYP A;  3UT5 A;  4LH6 A;  3ZS8 C;  4NXN B;  5LMU H;  4DR3 H;  1Q43 A;  4I55 A;  3B2E E;  5CA1 B;  5JQG A;  1SQG A;  3MAQ A;  4CC6 A;  1NT2 B;  4I9Q A;  4K0K H;  1VS0 A;  5LMN H;  2UU9 H;  4FFB A;  4O4H B;  4UCR A;  4UFZ A;  4ZHQ A;  1XMQ H;  4JI5 H;  1JFF B;  1SQF A;  4DUZ B;  4DV7 B;  3HKC B;  4DR4 H;  4LFA H;  1Z2N X;  3HKB B;  2F95 B;  2UUC B;  1SA0 B;  4JI1 B;  2MCT A;  2Q0A A;  3RFR A;  5GON A;  3N43 B;  2UUB B;  4WBN B;  4ETS A;  1IBK B;  1G6U A;  5KMG B;  3T1H H;  3W5O A;  4B3M H;  3J7A K;  4AQY H;  4CH6 A;  4F6R A;  3GB8 B;  2ZJT A;  4ZOL A;  2ZIO A;  4K8Z A;  1HNX H;  2UXB B;  4LNU B;  4APM A;  4LF6 B;  5FD6 A;  4B3T B;  4DUY H;  4GKK H;  5EYP B;  3UT5 B;  2BTO A;  1X9N A;  4JYA H;  3PN1 A;  3GJX B;  4RB3 C;  4LF7 H;  4I55 B;  3HKD A;  3EYY A;  5JQG B;  5LP6 A;  5JJN B;  5JJJ B;  4DR2 B;  2ZM6 H;  4LF4 B;  3N2G A;  4DR7 B;  3GDE A;  4LMY A;  4LFB H;  2CAZ C;  3JAW A;  4X20 A;  4KHP B;  3K5O A;  4DV3 B;  3TY8 A;  4FLV A;  4FFB B;  4NXM H;  4TUY A;  1FFX A;  5FD5 A;  3NC0 B;  1X4T A;  2R9A A;  2OYQ A;  5LP6 C;  3KAL A;  4ZHQ B;  1Z5W A;  2PYL A;  4FVM A;  4K8X A;  5A2Q W;  4FM2 A;  2UUA B;  1T5E A;  3N41 B;  4CS2 A;  3BAA A;  2VOB A;  1N36 H;  2CW7 A;  3QF7 A;  1XHX A;  1CKM A;  1QHT A;  1IBM H;  5GON B;  3ICX A;  2VQE B;  2RQ6 A;  2W57 A;  4MTE A;  3T1Y H;  3TY5 A;  1J5E B;  4X1I A;  5BR8 B;  4YY3 B;  5EZY A;  2UXC H;  4TV9 A;  1Z5V A;  5D1P A;  2F4V H;  1XNQ B;  1HW7 A;  4PZ7 A;  4F6R B;  1BJT A;  4ZOL B;  3CVZ A;  1AN7 A;  1ZHQ A;  4LFC B;  4LF9 H;  1S03 G;  3JAS A;  3A2F A;  1M0W A;  4DV2 B;  1KMI Z;  4DK1 A;  4GKJ H;  4RZQ A;  4DV4 B;  1FVI A;  1IBL B;  5D1O A;  5KHH A;  4TOI A;  3HKD B;  3NBZ B;  2HVQ A;  4DV1 H;  5LP6 B;  2CFM A;  5LXT A;  2V4D A;  2F1M A;  4BW9 A;  3UQ8 A;  3RYI A;  3RYH A;  1XI1 A;  3N2G B;  4UCO A;  2WYO A;  2EX3 A;  5KX5 A;  3SGI A;  3JAW B;  1DGS A;  4CS4 A;  5KHG A;  3NBY B;  2PY5 A;  4TV8 A;  4UCS A;  4X20 B;  1FJG B;  2YI9 A;  1N33 B;  3JSL A;  4TUY B;  4JI8 B;  1FFX B;  3BRC A;  4PZ8 A;  1O75 A;  3MWM A;  4JI7 H;  4UCV A;  3K59 A;  3W1G A;  4BWS C;  3RJ0 A;  3N44 B;  1HR0 H;  3SR2 C;  4HBN A;  4KL1 A;  4DV5 B;  1I94 H;  1Q5O A;  4OX9 H;  1Q3E A;  2P5O A;  1HNW H;  4JI6 H;  3QWU A;  4UCT A;  4EQ5 A;  4JI3 B;  3VQW A;  5LL6 b;  4X66 B;  4X1I B;  1XNR B;  1KU9 A;  2QM4 A;  4O2B A;  5EZY B;  4TV9 B;  4CH3 A;  4GLX A;  4IAJ A;  4B3S H;  2UXD H;  2R72 A;  5LMU B;  4DR3 B;  3HKE A;  1YEW A;  1FKA H;  3FFQ A;  1M5I A;  1TA8 A;  4RB0 A;  3BA8 A;  3SJA C;  3JAS B;  4JI4 H;  4E6N A;  4GYC B;  3CB2 A;  5D1O B;  2Q2T A;  5LMN B;  2UU9 B;  4MV9 A;  4NXN H;  2Q7E A;  5LXT B;  3RYI B;  3RYH B;  4PZ6 A;  5KX5 B;  5J2U A;  1XMQ B;  4LSX A;  2Q2U A;  4TV8 B;  1SYX B;  1HNZ H;  4DR4 B;  3VQV A;  4LFA B;  4DK0 A;  1P8L A;  4DRX A;  4BWA A;  3DSQ A;  4IIJ A;  1M0T A;  1B04 A;  3RF2 A;  3M7M X;  2JVD A;  2OWO A;  5IJ9 A;  3K3V A;  3K5M A;  1S5J A;  3RR5 A;  4B3M B;  3T1H B;  2VPS A;  3H20 A;  2E5L H;  4AQY B;  2KSW A;  4DR6 B;  5DIS C;  3M4I A;  4DRF A;  1O9H A;  4O2B B;  4DUY B;  1SEI A;  5IWA H;  4DR1 B;  2E3C A;  4JYA B;  2UUB H;  3HKE B;  4Q6G A;  3CSX A;  4LF7 B;  1IBK H;  4B3R B;  1M4U A;  3JAK A;  3N40 P;  3JAR A;  3SJC C;  4PDB A;  3QG5 A;  2KKW A;  2ZM6 B;  4LFB B;  4FLY A;  3J80 W;  2HIX A;  1N32 B;  3J81 W;  5LYJ A;  2Q7G A;  4L8J A;  1A0I A;  5CA0 A;  4X64 H;  4NXM B;  1MZB A;  4AIL C;  3LML A;  5IYZ A;  2ZIM A;  4DV6 H;  5J2U B;  4DV0 H;  4EEQ A;  1N34 B;  5JCO A;  4X65 H;  4RAY A;  2JGU A;  4B08 A;  5LOV A;  4CS3 A;  4DRX B;  4I50 A;  4FM1 A;  4IIJ B;  4RB2 C;  1IBM B;  2PZS A;  3OTO H;  3ZED A;  3T1Y B;  5IJ9 B;  2VWK A;  5JCO C;  4YHH H;  2UXC B;  2F4V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...