5FPOA

Structure of bacterial dna ligase with small-molecule ligand 1h- indazol-7-amine (at4213) in an alternate binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
307
structure length
305
Chain Sequence
DLSSRVNELHDLLNQYSYEYYVENPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 100
structure length 305
sequence length 307
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fpoA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5fpoA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 5fpoA02
3JSNA 2E5LB 2UXCB 4B3MB 4DV2B 4PZ6A 5D1OB 1HR0B 1CKOA 1B04A 4PZ7A 4DV7B 1VS0A 4DV0B 3W5OA 1HNWB 3GDEA 3UQ8A 3NBYB 3RR5A 1N33B 1DGSA 4LFCB 2UXDB 2UUAB 2UUBB 1XMQB 1FJGB 1TAEA 2OWOA 4JI7B 4JI6B 3W1GA 4JYAB 4YY3B 5BR8B 4B3RB 4GKKB 2HIXA 1X9NA 2UXBB 1N36B 3TY8A 3TY5A 1J5EB 4JI8B 1CKNB 3JSLA 2HVQA 4DR5B 5FPOA 1XNRB 1P8LA 3QWUA 1CKNA 4DV5B 3TY9A 1XDNA 4LF6B 4LF9B 4TOIA 4LF4B 2UUCB 3SGIA 3BABA 4B3SB 4PZ8A 3KYHC 3BAAA 4EFBA 2HVSA 4GKJB 5LMNB 4EFEA 5IWAB 2VQFB 4B3TB 4JV5B 1HNZB 3T1HB 3L2PA 3PN1A 3RTXA 4DV1B 4OX9B 2F4VB 3T1YB 4LFAB 1S68A 3W1BA 4DV6B 1FVIA 4DRFA 4UCSA 4UCUA 4UCOA 3OTOB 4LF8B 4X66B 4LH6A 4K0KB 5D1OA 4DR7B 2UU9B 4DV3B 4JI5B 3S24A 3BA8A 4YHHB 3GB8B 1IBMB 4GLXA 1XNQB 4DR1B 4UCRA 5DISC 4X65B 2VUGA 4JI3B 3BA9A 4CC5A 1TA8A 5D1PA 4EEQA 2HVRA 1IBKB 1N32B 4DR2B 4X64B 1IBLB 4LF7B 3NBZB 4UCVA 3NC0B 3VNNA 1P16A 4LFBB 4CC6A 2ZM6B 4KHPB 3GJXB 4DR4B 2CFMA 4JI4B 2Q2UA 4X62B 1CKMA 2Q2TA 4NXNB 2VQEB 4DUYB 4AQYB 1XK5A 1XMOB 5LMUB 1A0IA 2HHHB 4DR3B 1V9PA 4LF5B 4EQ5A 4DR6B 4DUZB 4E6NA 1ZAUA 5FPRA 4JI1B 4DV4B 4UFZA 4JI2B 4JI0B 2HIVA 4UCTA 1N34B 1I94B 1HNXB 4NXMB 4LH7A
chains in the Genus database with same CATH superfamily
3BVOA 3ABMC 2BQ3A 1ULZA 3G71V 1CKOA 2W6NA 3CCEV 4TQFA 4OPHA 1D2DA 2Q4PA 1JVMA 4DL6A 4RZRA 4JI6H 5KAIZ 3GQCA 4LF6O 4FPPA 2UXBH 1GRJA 1XL4A 5ITZA 3ASNC 5K1XA 3K3WA 3CCVV 1YJ9V 1FJGB 1J95A 1P7GA 4JF3A 1EBOA 4JYAB 2OH2A 3ZHUA 4OPAA 3FKSG 3O9OA 1N36B 4O4JB 1Q43A 5E1AC 3ORRA 4GT1A 4O2AB 5CB4A 1KECA 2W6ZA 4JI7H 1JFFB 1NH2B 2FPPB 2JS3A 4LF6B 4Q8FA 4ZKIA 1NTZH 1OZ0A 4LF9B 1ET0A 4GC6A 1HNZH 2UUCB 2W0FC 2YC0A 3RJ0A 3QQMA 3AG3B 2V4QA 3GILA 2AGQA 1CXZB 3ETGA 4HNTA 3N43B 3RTXA 4DLKA 1N34O 4ECWA 2N05A 1DV2A 2ZXWB 2F43G 2YICA 1BNCA 4C5BA 1E4GT 3HOWG 1EKPA 2PYLA 3LNMB 4D6TH 1BHAA 2JEFA 4O7RA 4CH3A 4XX0B 3HKZE 3T9CA 5GTIZ 1B6QA 4JI0O 5LA6F 1A48A 4DR4H 1IBKH 3WB0A 4TQSA 4BXXG 5DGHA 3N27A 3S3XA 4CS3A 1PM9A 4IIJF 5C1OA 2GV9A 3PW0A 2OCCB 5H6QA 1E4FT 4MSWC 1SRYA 4LF7B 1T94A 1P16A 4JYCA 4DL7A 5LYJB 2BOBC 3CRMA 2P6JA 3HOXG 3BQ2A 3HOVG 2OIGA 2GSMB 1UNNC 2A3QA 3DF7A 2Q2UA 5H6RA 3ZX6A 3GV7B 1EKVA 1VQ5V 5BMVF 3VBBA 2JRIA 5BMVA 1XK5A 4FBUA 2BTQA 2CDYA 4LF5B 2QWQB 5D8DA 1M4UA 4HNAA 3CCRV 2NU6B 2N04A 4TQRA 3EFFK 3M7MX 5KFYA 1BMFG 3WU2Z 1YEWA 2FTKA 2LW7A 1SETA 2O57A 1Q5OA 1FXVA 4ZOLF 2EINB 2WLNA 1CP9A 2RJZA 2VRZA 2I80A 3MD0A 3JCZA 1VF6A 4RUEA 4IRCA 1EHIA 5FD6A 3HOUG 1JMKC 1GN4A 2CK3G 2IW5A 1KJIA 4KL1A 3E22A 4UVBA 4O7VA 1S5HC 4MVSA 4LFBH 3RFRA 1I2LA 4Q4CA 4AHCA 4A3GG 2Y0PA 5IE9A 3TJTA 3L74H 3VOUA 4DQNA 4CE5A 5LYJF 1VMGA 1V54B 1PL4A 1A3GA 4NYEA 3CC2V 1SERA 1GO3E 1V54C 4K8ZA 4U7OA 4YHHO 2IH1C 3G67A 5L3DA 4QIWF 1H2KA 4DR1H 2JEJA 1BJTA 4I4TF 4TOIA 4X1KB 4X65H 3PO3G 2NNUA 3GTOA 1Y76A 3CVZA 2H8PC 5LGTA 2H3OA 4PHZA 2HKOA 4EFEA 4UV8A 2VPQA 3QO7A 2GPWA 1BGWA 2R7KA 3WG7B 4QJFA 2OYQA 1Q86W 4J0MA 5DQIA 4PA9A 1R3JC 3JAKA 5HFMA 5KT7A 1NBMG 1PKXA 2CW7A 2K9PA 1FKAH 2YDEA 5KHKA 2XNDG 4QE7A 1EZ1A 3B8NA 2V58A 5LP6C 2B5UA 3UT5A 2HHHH 3X2QC 5FJ8G 3W1BA 1Y1WG 1B06A 3ZHVA 3SYOA 1I1MA 3TEKA 2PMZE 4A3EG 3ABLC 2FMLA 2Q7HA 1Y74B 1RJPA 3X2QB 1I08A 4E4EA 2QTOA 3GIPA 5EWEA 4MW3A 1F51A 2P90A 3H4DA 1MSWD 2NLJC 2UUCO 3CRRA 3H9VA 2R7ZG 2F23A 4DR4O 1ZHQA 4Q43A 5H5NA 1SEIA 1JDBB 2YXYA 2VUGA 2DOSA 2UU9O 1P84F 2ZDQA 2FPGB 1BE3H 1N0NA 3K5NA 3UKMA 5D1PA 3OUUA 4EEQA 1EFRG 2QE7G 3K06A 3N6XA 4B3SH 5J9PC 4KXRA 1O9HA 3FB8C 4UCVA 2EJ3A 4O7ZA 4A3CG 1I1KA 3BCCH 4HQ6A 3E89A 3GB7C 4IRKA 1WP8A 4FK5C 2CFMA 4JI4B 2RDJA 3F8NA 2UUAH 1Y14B 3PW4A 4ECYA 4QWCA 3ASOC 3NGDA 4JTCB 4DV7O 1V9PA 2RGRA 1EZJA 1K1QA 2E5LO 1K5QA 2W70A 2Y69C 3CPWU 1S5JA 3HKDA 3KHHA 1GH6A 5FD5A 2JA6A 3DC5A 2XHBA 4CMFA 3CD6V 3QO8A 4PA3A 3T1HO 2FMAA 2PI4A 4GLWA 2CH7B 2PYJA 2AQ4A 5FL7G 2ALZA 2HGXA 3WB1A 1S77D 5B1AB 1VQ9V 2ARHA 4QNHB 2YXLA 3ABMB 4JI1O 2FB9A 4DXWA 2UXDB 1XBLA 3FB7C 3OE7G 2FPIB 1M90W 2MW2B 2Y4UA 5BXZA 2X0SA 1H38A 2OWOA 3OUZA 4J9MA 4JI6B 2P7TC 4YY3B 5DLGA 2OIEA 1JLLB 1YI2V 1CKNB 1R6NA 5K2MA 1Q6UA 1XMQO 4U3JB 3N2GA 1XNRB 5KX5B 5L3EA 4X1KA 1Q8IA 5KUMA 2UXDO 4NZNA 5KG1A 4J7KA 1L1FA 3IC9A 4RAZA 5FLXN 2ZD9A 1VARA 3U11A 1KBLA 5KG5A 1EYZA 2IMWP 2PVPA 3BABA 4YR3A 2XD4A 1H2LA 2JEGA 2UVRA 4DV0O 1VF7A 4M9UA 1HNZB 4B7EA 3T9AA 5KFTA 2F4VH 2HJDA 4IZOA 3L2PA 2ASLA 5D5QA 5BWWA 5CA1A 2QTSA 4F4LA 4HYOA 2EIJB 2AZ2A 3MHSC 4JZ2A 2PTMA 3AG2B 3W7TA 4N21A 2EIJC 5IDJA 4YJ2F 5KMGB 3OR7C 1IBLO 2BTOA 3Q1KA 4FLWA 1JDEA 4GUNA 3ZRWB 2JA7G 4TUYB 4WF9V 2W9BB 1X4TA 2GUZA 4JV2A 4KFMA 2XAGA 2QKCA 5DGIA 4WFHA 3CP1A 2ZJTA 5CA1F 1NR7A 5KT3A 4X20A 3BA8A 2RCVA 3DTGA 4O4IA 3R5HA 4LF7O 3B09A 2NU9B 3QG5A 2F95B 3RIZA 1TA8A 1I50A 2RQ6A 4QGPA 1IBKB 4RUFA 3HOYG 3CSWA 2A7WA 5I60A 4H37A 3M9MB 4ZI7B 3E83A 3L71H 2ASJA 2V59A 5C4XG 3APQA 3SJCC 3HOZG 1VF5B 2IA6A 5IYZB 2QA4V 3HKBA 5EOYA 4J9YB 2UVWA 2YIBD 3GTKA 3ZBHA 3GWOA 3LULA 2NVYA 3F7YC 4DR3B 2R85A 5JVDA 4UB8Z 4PBCA 2W6IG 5KHGA 5HV6A 2UVVA 2F66C 4YJ2B 3FB6C 2DLNA 4YJ2A 3GTJA 4PDLA 1IOWA 5I5YA 3F5WC 1HR0B 3JARB 1TGOA 5A9GA 4MTDA 4EGJA 4PJ0Z 1I94O 4O3SA 3ZHTA 4X64H 3FYEB 4P9OA 3OGIB 2EZOA 5LHIA 3UZOA 1RSOB 1LNQA 4FFBA 1VQPV 1XNQO 4MVUA 5EDWA 4E2LA 4ZHQB 3VA7A 4YJ3B 2R9AA 2XAQA 4JYYA 2LGWA 5KG3A 1X9NA 3NR7A 2FLPA 4R6ZA 1JX9A 3ZRVA 2OTLV 3V4SA 4RU9A 1P8LA 1OCZC 2R7MA 3E86A 3TCUA 4M0JA 3UZBA 3SPIA 2IU0A 5KX5A 3HB9A 3CSXA 4GC7A 1CPYA 3MFHA 3SGIA 4B3SB 5F2VO 2FE3A 3BAAA 3CRCA 1K7DA 1VKZA 4DV1H 1AJPA 5LMNB 2HDKA 3M9OB 5EBMC 3JCUZ 3EVKA 5I5UA 3RGZA 5B1BC 2CTRA 5LOVA 3ZN0A 4HNVA 4DR3H 3JAWA 5JWPA 2LW1A 5EWFA 4TV9A 4CZZA 1S68A 1FVIA 1S76D 4XZ3B 4FFOA 5AG2A 1SZXA 1Y67A 3GVMA 4MTGA 4X66B 3CEBA 2LFSA 2R6FA 2QEXV 5IJ9B 4DV3B 1AP5A 3H1JH 1I94H 1FFXB 4O4IF 1J5EH 2JGUA 2LGQA 4F50A 4U3FH 3RB0A 1JOYA 4U3JA 1QHTA 5KFJA 2ILMA 4I55B 1EZVH 3SPHA 2HVRA 5L1LA 5K1PA 3N8DA 3EPIA 4LFBB 5J2TA 2V5AA 1S9FA 2CAZC 4DV3O 1QLEC 4FZ1A 4O3QA 1IBMH 4NLGA 2M6YA 1W96A 4PV1B 5BMVB 1TWCA 5LHHA 2FK1A 4O2AA 2P06A 3SJAC 1KJ8A 3WO0A 5GONB 1LUWA 4LFAH 2CNVA 1AP6A 3HKEA 3Q2OA 4MV8A 1S0MA 5J2UB 3GIJA 3VPBA 4DV4B 5D5PA 3STZC 1HWYA 1JQ0A 5KFQA 3N44B 1M0WA 4MT8A 3HPLC 2Y48A 4J7ZA 3E35A 5KUKA 2WLIB 1AR4A 2EINC 1S0VA 2GTAA 1O9GA 1YZBA 5LXTA 3EXAA 4JZGA 4O81A 3D3IA 5JQWA 4DR6H 1XNQH 3ASOB 1IBLH 3JD0A 1YIJV 3CCUV 3BJYA 1NI8A 1KC7A 3A8TA 4A3DG 3ZMTA 3AG7A 1YVWA 4O4HF 3RAXA 4TT3G 4O4HA 3L9DA 2UUBB 2KKWA 4X62H 5DG8A 4DR2H 4RB3C 4JI8O 2ZXWC 3N41B 2EULA 1VQMV 3SDLA 5CA3A 2WAMA 1NZ6A 3GIDA 2UXBB 3TY8A 3OW2U 4JI8B 2Q7EA 4DYLA 2YXHA 3BEHA 3MFIA 1FJGH 4K0KH 5H2FZ 4IL6Z 2X5RA 3I4NG 3K9AA 2Q7DA 4DV1O 2W6QA 3KYHC 2VOBA 4EFBA 5J2TB 5HNEA 1Y4MA 5IWAB 2VQFB 1JJ2U 5EYPB 2NR5A 4BIOA 3WWHA 4I7HA 4JTAB 3IG0A 4O84A 2Q9LA 3ABTA 5BPFA 5C8YF 3PVXA 2ATLA 3DSQA 3E2EA 3W7UA 5LL6Y 3JD1A 1TWAA 4NXNH 1IDSA 4KP4A 3DC6A 2JJ2G 2VA3A 1IVSA 4UCOA 3SYCA 2WPDG 5IYBO 4JUZA 4JI1H 1RJRA 4LH6A 3CX5F 2YL2A 2R92G 3GTPA 2Z3YA 3RB6A 1B33N 5IJ9A 4EGQA 1K9MW 2Y0SE 4TV9F 2B63A 2AU0A 3R65A 2R84A 3SI8A 3OUFA 2YZGA 1KUQA 4ZHQA 4JASA 4X66H 1V4YA 5J2TF 3JAMN 4HYKA 4O4LF 4J9QA 3I55V 4R8UA 2Q2TA 2EIKB 1XMOB 1A0IA 4FFRA 4J9KA 1I7FA 1IXBA 2GQRA 5GONA 2COIA 2I87A 2R8IA 3KHRA 3HT5A 5JVDF 3KKYA 4MV9A 3MR5A 3HKDB 1ZAUA 1PNLA 1VIBA 4A5UB 4NXMO 1W0JG 3FD9A 4H44B 1N33H 3ZJZA 4YIPA 1Z2PX 3Q8RB 3AYHB 5IYBG 2ZNJA 1M1KW 5C5JA 4DUZO 1FKAO 4WBNF 4B3TO 2EJ7A 2WLMA 4ME6A 1I5YA 2D2CB 5C3EG 1KD1W 3QZ7A 2R93A 1N36O 3GV5B 3LNNA 4C5CA 4DR5H 2HLDG 2WA3A 2AZ0A 3K5IA 2YI8A 4JYAO 3RF2A 5L9XA 1MOFA 2EIMB 1RM1C 4F4ZA 1N4CA 4FFBB 2DIKA 3A0HZ 1F7YA 4IR9A 2DAAA 3RBDA 3F7VC 2O03A 4QPJA 1YCIA 3WWIA 2SCUB 4GYCB 4O2BB 1VQ8V 1F4MA 4O7YA 3D8CA 3B4SA 3MR6A 1KP2A 1WCMG 4BIUA 3EHBB 4AI8A 1IYDA 1Y76B 2NU8B 3TQTA 5J2UF 4O3PA 4G3IA 4LF4B 1VQ6V 4TVIA 4X66O 2ZQMA 2YU9A 3ETDA 2Q8VA 4X1IB 4FE2A 5HBRB 2QWNB 3T4ZA 4WBNA 4FFMA 4JV5B 4DV2O 1K4CC 4LSAA 4GX2A 4XBFA 3TETA 1SESA 1S10A 2QWRB 4QJFB 4PI0A 2JEUA 2D3OW 1BQZA 2QB5A 4LF5H 4AYBA 1S0NA 4IRDA 2ZGIA 1KBHA 1PK8A 2HVJC 3QZ8A 4JV5H 2WLLB 3D3QA 3JATB 3L72H 4QW8A 2W6JG 5IY5C 1V55C 5EC2C 3KTMA 5KFMA 1RP3B 2X0LA 5CE8A 1MZFA 2XT9A 2NU7B 4JI3H 2IM9A 2YS6A 3MWDA 2ZKOA 2Y69B 3LP8A 3RFCA 5DISC 2JEIA 3RUPA 1SQVH 5DECA 4CHIA 1Q7YW 5KLVH 3NXSA 1R9TA 4IIJB 4FS1A 1P7BA 1IOVA 1OCCB 4QWBA 2DQ0A 2AXTZ 3LUTB 3Q4HB 2V4RA 1FJGO 2JGDB 1IYEA 1XUQA 3L73H 5LBQA 4LFCH 1WB7A 4DRXA 3GJXB 4DR4B 2JVDA 1ENVA 3K0DA 1KUTA 5LGUA 1HNXH 2W6PA 2WLJA 4J9OA 2W57A 1PD3A 4FJCC 5KA6A 3S3WA 3VOTA 3PO2G 3BPZA 4NXMH 4CBCA 2UXCO 2B9ZA 1T36A 1TWHA 2DN9A 4IYIA 5KFXA 2DYSB 3UO2A 5TISZ 3RWRD 5C44G 5JCOA 4QWAA 5IWAH 3R23A 3R5FA 2VQFH 2VA2A 2CTPA 1XMOH 1H2MA 4PZ7A 4PA7A 5BWRA 2DPJA 4TV9B 4FFPA 4RB1A 4RQFA 3Q8SB 4MV3A 2HGSA 1M56C 3G6YA 1KT8A 1DK1A 1KTAA 1VAJA 3DTFA 1SQXH 3V4ZA 1GM8A 5KFRA 1TAEA 4TM5A 1OBDA 2C22A 4O4JA 3CYOA 4B3SO 2ZM6H 5L1KA 1MABG 2J6TA 4DR5B 3EPGA 5L1JA 4ED6A 1CKNA 3KCYA 2IJIA 4E4TA 1H2SB 2RMKB 1PP9H 3KCXA 4GCZA 2Y4RA 4O7WA 4Q4DA 2RDIA 3FKIG 2XC9A 2E2HA 2HR3A 2BE3A 3KHGA 2RDCA 4Y8VB 3DGEA 2ITDC 1QLNA 4J9RA 1FYJA 4MV7A 4G2KA 5JQGB 4DV7H 1G6UA 3H1LH 5LA6A 2EIYA 3OM3B 2R82A 4DUYO 3JAMW 3UT5B 3IAYA 2HJWA 3RN4A 4YP3A 1KQSU 3ETHA 1VQ7V 4LF8O 4J9PA 4LF4O 2R7NA 3T1YB 2A1HA 1GTOA 3RYCB 1PPJH 2CNQA 2CTQA 4RZQA 1I7LA 1AI7A 4TV8F 5CBGA 4RCNA 5KFBA 4LMYA 3GTLA 5DAAA 3TIGA 5E25A 1RK6A 3E8FA 4NYKA 1Z2OX 2UVUA 1AR1B 4O2BF 4GLXA 4MVQA 1VF6C 4A3IG 2RN9A 3ML0A 1AB3A 3N2KB 2PGGA 4UVAA 5JH7B 4W4LA 1IBLB 3U9SA 1YTFB 2DWCA 3H1KH 1HNXO 1OCRC 1YJWV 1CKMA 2BTQB 4O4LA 3T54A 3K3VA 3TQ1A 1QLEB 3JRXA 4DUYB 1GN6A 5LXTF 3ASNB 3ZHQA 4LBEC 3TW6A 1HNZO 4JPRA 1UFIA 3GIMA 3ETQA 1QQCA 4I55F 4FM1A 4O7SA 3A2FA 3PJSK 3H01A 1XREA 4I4TA 2MCTA 4WD3A 1M57B 4DUYH 4ED7A 5GTHZ 4LF9H 4MV4A 1VQKV 3MDSA 1D5NA 3JSNA 3K59A 5EZYF 4DR3O 3J7AU 3FYIB 3W5OA 1K33A 3SR2C 2WLLA 1B6RA 1R1BA 3NBYB 4H0LB 2MK3A 2XAFA 2XTAA 4IIJA 4XYLB 3SE7A 4RQEA 1RSOA 2YIDA 1VBHA 1B3QA 4DL5A 4Q45A 2FK2A 3B8MA 2GUZB 2ZE5A 3I56V 4GKKB 3TXSA 2IJHA 3JASB 2NN4A 4C7UA 3T99A 2EIKC 5KG7A 1Z2NX 1PX2A 1Y6XA 3O65A 1GGOA 3GLKA 2X6BA 2UUBH 1AJQA 3GWKC 2W71A 5B1AC 2PUSA 1KJ9A 4QSHA 4OX9O 5A2QN 4J9ZB 5KT2A 1ORQC 4JI2H 4IR1A 2Z5UA 4KUMA 3L75H 5L3BA 2X7RB 4LF4H 4B3MH 3HKBB 3PN1A 4EBCA 1ZLZA 1K73W 4DV1B 5JUMA 4LF9O 4DRFA 3P30A 3JZFA 1OV9A 3KAKA 4UUGA 5L1IA 4JYAH 5CR5A 4GKJO 3SYQA 3OSNA 5JJJB 2EX3A 4B3RO 4MA5A 5IYZF 4B3RH 2AGPA 4ECZA 3E22B 4UCRA 5EIBC 3JASA 5CB4B 4D7TA 4A2BA 3ETJA 1FXKB 4L1KA 3RGXA 4A3MG 4TV8A 5LYJA 4ZIBA 2ZT9B 3UM7A 2RF4A 3NC0B 3NBZB 3WNZA 1AI4A 4CC6A 1NR1A 4GKKH 1GYFA 1K97A 4RNMA 1GK9A 1XILA 2HG5C 2EJ2A 4K3AA 2YI9A 2AW9A 3CC7V 4Q0YA 4JI2O 4RO2A 3TXQA 1AR5A 1A32A 3THOA 4MA0A 4EQ5A 2R8HA 3Q8PB 3HKEB 3T5JA 2V1DA 2WSSG 2V9WA 4OX9H 3CB2A 4JI2B 1N33O 5I5TA 3TINA 1FAFA 4QWEA 1WAZA 4UCTA 1US6A 2YZLA 3K04A 2J6UA 3OGCC 4NXMB 4XYMB 1D5AA 3RYIA 2R7ZA 2P5OA 5D1OB 4BBSG 1R73A 2KG7A 4TQDA 2PI5A 5EBWC 5CMUA 2Q5ZA 3RGBA 4P30A 3GDEA 3RV3A 3UQ8A 4DIMA 1N33B 3JATA 4CKEA 2XOKG 4NTXA 4CKBA 1Y1VG 3FAVB 5JH7F 4YJ3A 3KZIZ 4I50F 3R9RA 2JIZG 4LWSA 1J5EO 1XL6A 2HGWA 2B1GA 3W1GA 4KHPH 5F9LA 1YXBA 3OSPA 2AHYA 4B3RB 4DL2A 2EZPA 3H0GG 1BS3A 1J5EB 3ABLB 2HEPA 2W7OA 3OMIB 4PDRA 1IBMO 4DV3H 2R72A 5CAEB 1FD9A 2WB1E 2JA5A 4EKWA 4Z2WA 5LP6A 2E5LH 1XNRH 2W9AA 5B66Z 4EYHB 1XEQA 5JJEB 1Q82W 5KFZA 4LF8H 3H3VH 5IYDO 3OMNB 4MS2A 2CGNA 2F4VO 2YS8A 2VQEO 3K79A 1HW7A 4MV1A 1E4EB 4OX9B 1OCZB 1A0GA 2F4VB 4LFAB 5E79Z 5KFCA 3TK1A 4UUJC 2EILC 5KMGA 5H80A 4F6RB 4ED0A 1QNMA 2YIBA 4MV6A 1ZHSA 1BHBA 1GSAA 5ITZB 3F5TA 3ZCCA 1IURA 2ZR2A 4NB5A 3NUAA 3K57A 2ETNA 2JA5G 5B1OA 1VP7A 4YHHB 2OLSA 4PWQA 4IWXA 1XNQB 4JTDB 4FVMA 4DR1B 3N40P 4IAJA 5FLXW 1SQPH 2AGOA 1K8AW 1I3QA 4FLYA 4JAVA 2VQDA 4OGQB 4DR2B 1AI6A 2LP7A 4GZRB 3WFVA 1K92A 1X59A 4J9LA 2QR4A 4R50A 3BQ0A 4CH5A 4M7EA 2WYOA 4GX0A 4DL3A 1RPRA 1R3LC 4LNUA 1W93A 3MR3A 3M8AA 4WFEA 3T2MA 2VQEB 4AQYB 3H20A 4O3NA 3JAWB 3R5XA 1BZKA 3OHAA 1M93A 4YR0A 5FPRA 2CKZB 4X1YA 5JJNB 3U10A 3K5OA 5KHHA 3U9TA 4DV0H 4ECXA 3K3PA 4Q20A 2I8CA 3K9SA 4K6NA 4EBDA 2DYRB 2W8KA 4UVCA 1T3NA 3ABKC 1MSDA 5GW7A 4QE9A 4DV4O 2UXNA 4O82A 3MWMA 4XDLA 2Y4TA 3PW2A 3I12A 1B04A 1B6SA 1KMIZ 4LR3A 1VS0A 4YQWA 2XIGA 3VPCA 3K03A 4IT5A 3R66A 1QR9A 3RB3A 2WLKA 1M7JA 1AUVA 3LSUA 3UFXB 2VWJA 1E1RG 4X9QA 3SPCA 3DTUB 5K3WA 3OEEG 4LF6H 1XMQB 4ECRA 1KJJA 2W9BA 3G6BA 3L70H 3AK3A 4MAMA 3AG2C 3TY5A 2BQUA 3U0GA 3ZMSA 3QWUA 5FPOA 3ZEDA 5DN6G 2PY5A 1LR1A 2ABJA 3JD3A 1SA0A 2XASA 5FNVB 2F93B 1NJIW 1DF4A 4I7ZB 3LDDA 2QM4A 4NR1A 2L6LA 4IHJA 4GKJB 1CEZA 4BBRG 4DRXB 1GN2A 1TUBA 4ETSA 2QGNA 1DAAA 1SZTA 2JA6G 4HBNA 3T1HB 4IGGA 3HKZA 2KB1A 4FLUA 1RPOA 2IJJA 5LMNH 2Y0IA 3GIQA 2DW4A 1VQNV 2QWOB 5C1PA 1E4EA 3CCJV 4APMA 3KREA 2WDTA 2YYAA 4RB2C 4IHJF 3MWEA 1GO3F 4TUYA 2W0XA 3JALA 4LF8B 3PR4A 2GBOA 4QIWE 2R8KA 4YY3O 2HJFC 1W0KG 3G8CA 5F9NA 2FP4B 2YCHA 3RAQA 1AI5A 3GB8B 1HP8A 4BAYA 2UUCH 1SYXB 1FXHA 1WR2A 5DG7A 4A2AA 4JI3B 2EIMC 3BA9A 3RVYA 1RM1B 4GKKO 2ZIOA 2VS0A 2V7QG 4X64B 3T9BA 2ZDGA 3OD4A 4DW1A 4X89A 3HXLA 1F4NA 4WHXA 4RUCA 4KHPB 3H4BA 3CCMV 1N32O 3CS5A 4BW9A 3WB2A 1EN5A 1WPXA 2P0AA 3V6KA 1A9XA 5KX5F 1ROPA 3CRQA 2GQSA 3ABKB 1XI1A 3PZPA 2A79B 5H9CA 5DG9A 1TVKB 4FFLA 5JVDB 5DQGA 5KFHA 3HBLA 1K3EA 2FYUH 1E1QG 1WJZA 3K5HA 1EUCB 2ZE7A 4EB6A 5EBLC 3JARA 4FM0A 2QF7A 1K4DC 2JA7A 4RAYA 1R3IC 2QYZA 5CN0A 1BQ0A 1CQIB 4L87A 4CS4A 2DWDC 1H2GA 1XDCA 4JI3O 4JGSA 3B40A 2P22C 2K1EA 2WAQE 3MAQA 1IXMA 4LFBO 3DXRB 1BL8A 1N36H 1ZUQA 5B1BB 1WB8A 5FR9A 3V6HA 3C3TA 2PZSA 4JI7B 1H2NA 2XUMA 5CA0A 3LWBA 3BACA 2NUAB 4QW9A 4K8XA 4F4WA 1WLEA 3RB4A 4PDVA 2Q6AA 4JI7O 2KSDA 4JYBA 2FL4A 2LO1A 4FMTA 3LDEA 5I5VA 1SQGA 5KFDA 2ZE6A 1RFYA 1SA0B 4O3RA 2XCLA 2VUMG 4MTFA 5JCOC 2HVSA 1SQQH 4ZOLB 2ADQB 4G27B 4A3KG 5KFPA 1SC5B 1VQ4V 1M5IA 1S72V 5BWXA 4Z1MG 3OEHG 2WB1A 2PN1A 1Y1WA 1ZQ7A 2EJ0A 3LDCA 5KFOA 4AILC 5KFIA 4F6RA 3Q8QB 3GV8B 2EBOA 1G1XB 4U6PA 1DV1A 2IBZH 2ZE8A 4GKJH 4XDKA 3LSSA 1XHZA 1ZETA 3D36C 4UCUA 2ZNIA 4BW5A 1Y1VA 5KFEA 5KT5A 4GX1A 3GIIA 3CMAV 5KFAA 4N23A 5BR8O 3K0GA 3ZMZA 4H33A 1NVPD 3OR6C 4JI5B 1JIHA 4DR6O 4QIWA 5EZYA 4IWYA 2ZDIA 5BPHA 3CWBH 1NVPB 4MVRA 4MW8A 2C2DA 1L0LH 4X65O 5DM6V 4ZHQF 3VQWA 5IY5B 2UXDH 4ASUG 3IC7A 1FXKC 5JH7A 4J7JA 1VQOV 1YJNV 4A3BG 2ZM6B 2JA8G 5IYZA 5CM0A 5KFUA 4EYIB 3T9FA 1I1LA 4X62B 5T14A 1QVGU 3OT7A 2ITCC 3T9DA 5EC1C 2W9CA 4ECTA 3OUSA 4FBTA 2KSWA 4DV2H 5KT4A 4R8CA 2DMXA 2AHZA 1ZL8B 1ZSPA 5IT9W 4UFZA 2R86A 1OCCC 2ATKC 4IHJB 1FPOA 5I5XA 1RYRA 4NZOA 1GKFA 1UPGA 1MZBA 1TVKA 2WTFA 1HNWH 2GHYA 3E8HA 4LH7A 4Q44A 3AG4C 2E5LB 1R6TA 2J9GA 4BY1G 3VQYA 4O7TA 1COWG 2X6AA 4DV7B 1YITV 3CJHA 1GSOA 4DV4H 3U54A 4YBZB 4EBEA 4RWUA 3CJHB 3QFFA 4JI4O 1MMMA 2J6SA 2R92A 2Q67A 5L3GA 2V4DA 2UUAB 4YXWG 4FFNA 1V51A 2H94A 1R6KA 4O4JF 4LWSB 5KFVA 5I47A 3K5MA 2HHFB 1SQFA 4O4IB 5BWUA 1G8MA 3M99B 4YR2A 1S97A 3H1HH 4EG0A 1JJOA 4YAJB 4JI5O 4QPKA 3TY9A 1XDNA 2WWWA 1N56A 2EJRA 2YWVA 4X1IA 4WFAV 2Q68A 4O86A 5DMXA 3K58A 3QTCA 4PI2A 5EYPA 4I9QA 1N34H 4B3TB 5KG0A 4DV6H 3E8BA 2CGOA 5LHGA 3T1YO 3OTOH 1Y66A 1MG1A 3STLC 2ODMA 1ZL8A 1WH2A 3OMAB 4UCSA 2VPSA 4JV5O 3ZRWA 4R7CA 3J81N 4X64O 2R93G 4MVMA 4FLZA 5EIBD 3IFXA 3LQSA 2UU9B 2E74B 2A0LA 4O3OA 2XAJA 5BY1A 1ZWIC 1AROP 2R87A 4PD4F 3HKCB 3G6VA 2XGQA 3CHXA 2Z04A 2QWPB 1N32B 1KKCA 1MNGA 2FKLA 3I4MG 4FZ0A 4NVPA 3ABUA 2E3CA 3IGAC 1EM1A 3UCSC 1I0HA 3Q4HA 1FFTB 5KFFA 4YHHH 2BSKA 2QKAA 4FLVA 1AVMA 1P49A 2ZDIC 2PBZA 3RV4A 2IH3C 3N2GB 2VWKA 4NXNB 1JFFA 5LMUB 4P9PA 2HHHB 2COJA 3CCLV 3JZIA 2C00A 4DUZB 1SS3A 4UV9A 1KB9F 3U55A 3WWJA 2BCCH 1NTMH 3CE2A 4EB6B 2N74A 4X1YB 1N34B 4C5AA 2FB5A 4F4YA 3C0FB 4FIPC 5CA1B 1SCUB 4LF5O 4I9WA 4X20B 1LUVA 1XMOO 3AK1A 2CH7A 4LC1A 3M4IA 2BOCC 1YTFD 4KHPO 1OBGA 3G4SV 1Z5VA 3APOA 5KKNB 2HG8A 4ZI7F 1S0OA 4HZ3A 3VPDA 3WG7C 2UXBO 1KEEA 3J80W 1I2KA 2UU9H 1WA8B 5CA0B 1WN7A 3G6EV 3MR2A 5FNVA 2XGPA 5FNVF 5KFGA 3N2KA 3OFNG 3OTFA 1DTOA 2OT5A 1Q6IA 5L3CA 4PZ8A 1CE8A 2JGDA 4A93G 1OCOB 2UXCH 2C28A 4ABMA 4TWKA 3T7AA 4RNOA 1Z5WA 4HN2A 2FJZA 1V55B 2ASDA 3AK2A 1HR0O 3BQ1A 1PNMA 4U7CA 4R8UB 4MTOA 5LMNO 5LOVF 2CUGA 1M9NA 4YIOA 2CZGA 5DGBA 3SYPA 2WA4A 2YEVB 5IP7G 3JAKB 1HNWO 2QSAA 1QVFU 1N48A 4HNAB 1HDJA 5DQHA 2RGVA 3ZN1A 5LMUO 3AG4B 1Y74A 5B3SB 4EEYA 2P4VA 5A2QW 4NTWA 3VQXA 2E75B 1S5LZ 4BR6A 4ED8A 2OTJV 4DR7B 2KG7B 4ED2A 1NU1H 3SJQC 5B3SC 2ZM6O 1Q6HA 3QVNA 4WFFA 1IBMB 1Q81W 4TSFG 1WCMA 4X65B 3U0ZA 1NS1A 3AX6A 5KHIA 5L3FA 4DV5H 2A06H 3ZHRA 2CQYA 3DXRA 1TWFA 4DR7H 1THZA 4I55A 3VNNA 1SQBH 5IYCO 2UUBO 1OHHG 1U96A 4IYHA 3VQVA 3MHHC 3GIKA 2DABA 3KALA 5C8YB 4J9SA 4FU0A 2UUAO 2YIAA 3ZRSA 4B3MO 3D36A 4E6NA 3B2EE 2VR1A 3KHLA 4JI0B 3ZMVA 1GAXA 1KP3A 2HIVA 3A0BZ 2VQEH 1I94B 1JPXA 4MTXA 2CTWA 5JQGA 1HNXB 4RUAA 2WLIA 1K34A 4B3MB 1O75A 4O7LA 4JI0H 3JYCA 4DV0B 4AQYO 2Q0OC 1F23A 1HNWB 2EILB 4J11A 5HFLA 4BY7G 4DUZH 3P32A 5BR8H 1S03G 2NVXA 2HVKC 3RYCA 1QCEA 2HP8A 3RR5A 2W7PA 2JK5C 2WE6A 4DO2A 1JCHA 2JS5A 4TV8B 2RNBA 4DR5O 4MVZA 3FFQA 3ORQA 4JI4H 1QU7A 1AN7A 3WO1A 5BR8B 3CEIA 2DE0X 3J81W 3SPGA 3SNOA 4YAKB 2W8LA 3RT3C 3T1CA 2AGAA 4FLTA 4D7SA 3JSLA 4F6EA 5KAFZ 2HVQA 4O7NA 5KG4A 5FLMG 2JEXA 2ZCEA 1K83A 4DV5B 4O2BA 1RJQA 3B77A 3C90A 4DR7O 1WSCA 4LFCO 1YHQV 2ZINA 3W7SA 3W7WA 5I5WA 3FX7A 3FKIA 4RNNA 4C2MA 1Z2GA 1EKFA 1M6VA 3L4KA 5KT6A 3UYYA 4J10A 5LA6B 1GM9A 2GDSA 2DQ3A 4LFAO 1NQTA 1WPBA 1DF5A 1JKJB 1SFOA 2W9CB 2Q0AA 1BT8A 1Q3EA 1JA8A 5LXTB 1DIKA 3J7AK 4PELA 5LMUH 4JAAA 5LL6b 2IU3A 4P2ZA 3UO3A 3RYHB 1QR8A 4CMDA 3CC4V 2Z0AA 1DLBA 2P67A 2ZDHA 3RYIB 3ZHSA 4DAAA 1H8EG 4LF7H 1U97A 4LCUC 4K0KB 4ECQA 5DGAA 3ZRXA 5EZYB 3S24A 4CKCA 3CXHF 3I5DA 1G2WA 1OCRB 1GMGA 2M7WA 4RAIA 3P3PA 1FS0G 1JX4A 4WFGA 3V6JA 1C30A 1JR9A 2XCAA 4B7KA 3KXYT 1WP7A 1W59A 5EK0A 2P4KA 4MVOA 4BWAA 2A9HA 1NKDA 1E79G 1BGYH 1XNRO 1EN6A 2UXXA 4UB6Z 4DL4A 1L2ZA 4LSXA 1RYSA 2M05A 1YDXA 1UC8A 5CBHA 5KG6A 4DW0A 1GLVA 3J80N 5BZBA 3OTOO 3T1YH 1C3OA 2YZNA 1HR0H 1KU9A 3BFRA 4L8JA 3CCQV 2DPIA 4JI1B 2Y0SA 2XAHA 3QO5A 4K35A 2FLLA 5EWGA 4Q6GA 1UJWB 5LP6F 1L8DA 4PA4A 3AG1B 2R7LA 4YB8B 1YSCA 3TW7A 3RYFA 3CCSV 2CNUA 4HNUA 3A0RA 4OXSA 4DV2B 1L0NH 3FB5C 4WCEV 2YEVA 3T4DA 3FMAA 5KFSA 4AQYH 4A3FG 4B3TH 5BWVA 1MA1A 4DK0A 1KYOF 4WFBV 3T9EA 3HO8A 2YRXA 3EYYA 4YY3H 3HKCA 1DGSA 3G6XA 4DK1A 4PDMA 4ECUA 3JD2A 4F4XA 3T5KA 3PR5B 1K5SA 4FFKA 3JALB 3N42B 4MTEA 2QDOA 3ZIAG 4YJ3F 2W6MA 1TUEB 5KG2A 2LQTA 2R9IA 3RBZA 5IJ0A 3H1IH 2HIXA 3K08A 2BSKB 3VMMA 3L4JA 3KAJA 3HB3B 1M0TA 1WA8A 3ICXA 2JDIG 3ZS8C 3SYAA 5CBFA 4GX5A 3E8GA 2OCCC 1Q90D 3K5LA 4I0XA 4ZOLA 2QKSA 3H40A 4A3LG 5C93A 2CW8A 1OJHA 4LNUB 4HR7A 2YW2A 4W4KA 3TIIA 4WBNB 1AJNA 4LP8A 5C8YA 2C2EA 2R8JA 3AW8A 2KQXA 4BIZA 2C2RA 4NZMA 4R7RA 1CS0A 5B5EZ 4G28B 1I7NA 4RB0A 1YF2A 4H13B 3C3SA 3OTOB 3FDSA 2ZR3A 1IBKO 4J41A 2C35B 5DLFA 5D1OA 4JV0A 1MZEA 1M57C 4JV1A 1WRVA 3ZMUA 2R8GA 4JXUA 3M9NB 2QK4A 3PW5A 1FFXA 3P3NA 4ZBMA 2QM7A 1AILA 1AUXA 4O83A 3H0GA 1ZTEA 2ODTX 3CMEV 1RK5A 4I50B 1GM7A 2OCHA 4AYBE 5KFKA 1K1SA 5IP9G 2F1MA 3KG2A 1R3KC 5BWTA 2B63G 4K0KO 2IP4A 5BYAA 3GTMA 2PF4E 1W2BU 1GSHA 2GTSA 3BY6A 4CH4A 5I5SA 2ADPA 2E2IA 3N6RA 3BG5A 3G80A 2R70A 1N32H 4XDJA 3AG1C 4A3JG 4FM9A 3GTQA 4DR6B 4ICGA 4X8AA 3CQZA 1GN3A 2Q73A 2YRWA 4FS2A 4ZQIA 2YSUB 5KFLA 4HAMA 4J80A 5IYCG 1KJQA 2UXCB 2QJ1A 1EUDB 3G8DA 4PZ6A 1XOUA 3SJBC 3T1HH 4FM2A 3JZ6A 3MJFA 2W6OA 3QF7A 3AEIA 4QWDA 5GONF 3RVZA 2DZDA 1T5EA 4X62O 3RYHA 2B1IA 4O4HB 4LFCB 4JI6O 4FLXA 4DV5O 1FXKA 1BSMA 4ED1A 2DYRC 1VQLV 5JVLA 1CQJB 2YS7A 5KS8A 4BWSC 5CA0F 1SKVA 2BR0A 5IJ0B 2JJ1G 5B1NA 5LGNA 2HHFA 5CB4F 1BCCH 1M56B 4JAUA 4NTYA 3IN5A 4ED3A 3CXCU 2YUAA 2DWEC 2VUMA 3RBEA 3PFFA 3SPJA 3PW7A 4I50A 1TUBB 2IJKA 2Z02A 5LP6B 1PV0A 4TUYF 4FGRA 4DR1O 5KFNA 3HR0A 1OCOC 5KA5A 5LOVB 3RYFB 5IWAO 2VQFO 5DEDA 1UC9A 1NT2B 1BXRA 1VEWA 4X88A 2DJVA 4U7NA 4ECSA 3OHBA 3CRAA 4Z1VA 5J2UA 4CS2A 2WLHA 4DV6B 1JXLA 1KC8W 1G4YB 1I6UA 2COGA 2HFEC 2FK3A 2L35A 2HHHO 3RW0A 5IYDG 1EN4A 3FAVA 2E76B 4NXNO 2BQRA 2PMZA 3BHPA 2ZIMA 1I5XA 3BRCA 4I5SA 1XQ8A 5KFWA 2QM8A 1SF9A 2IBKA 4PDBA 4PA6A 1N8RW 2GLTA 1PL0A 2LFRA 1H8HG 3OAAG 4JI8H 5IT9N 2CE4A 2G38A 4DR2O 4CC5A 1NH2D 1ZX3A 2XCPA 1P4RA 2Q69A 2LJ2A 4J42A 4ECVA 5BYBA 3JD4A 3QNEA 3JRWA 2YZMA 3AG3C 3TGUH 2X6CA 4I0XB 2GPSA 2Q7GA 3IJ4A 2DYSC 4ZI7A 3ETEA 1VBGA 5JQGF 4O4LB 4JI5H 1NTKH 1URFA 3DAAA 1N0JA 3LSQA 1XMQH 4O2AF 1TWGA 5KHJA 1IX9A 4UXNA 4B08A 1OWTA 2FKXA 2R9RB 4CH6A 2WAQA 3E5NA 1PNKA 3T5LA 1XHXA 1S3JA 4I4TB 2FLNA 4DV6O 2C2AA 3T5HA 1QBZA 4Q8EA 4J9NA 3LMLA 3GTGA 1IZ3A 1WNSA 4NKGB 1KKDA 3W7XA
chains in the Genus database with same CATH topology
1D5AA 3RYIA 3C0FB 2P5OA 5CA1B 5D1OB 1CKOA 4TQDA 5LXTA 1O9GA 4TQFA 4X20B 3RGBA 4DR6H 3GDEA 1XNQH 3UQ8A 1IBLH 3M4IA 4JI6H 1N33B 3JATA 2UXBH 4O4HA 1Z5VA 4YJ3A 2UUBB 5ITZA 2KKWA 5K1XA 4X62H 4DR2H 4RB3C 1FJGB 3W1GA 4JYAB 3N41B 4KHPH 3J80W 4B3RB 2UU9H 2UXBB 1N36B 4O4JB 5CA0B 1Q43A 3TY8A 1J5EB 4JI8B 1WN7A 4O2AB 2Q7EA 5CB4A 2HEPA 4JI7H 1FJGH 5FNVA 4DV3H 1JFFB 2R72A 4K0KH 4LF6B 3N2KA 3OTFA 4LF9B 1HNZH 2UUCB 5LP6A 4PZ8A 2E5LH 3KYHC 2VOBA 1XNRH 4EFBA 3RJ0A 2UXCH 5J2TB 1Z5WA 5JJEB 5IWAB 2VQFB 5EYPB 4LF8H 3N43B 3RTXA 1HW7A 3IG0A 4I7HA 3JAKB 3DSQA 4OX9B 1E4GT 2F4VB 2PYLA 4LFAB 4HNAB 4NXNH 2RGVA 5KMGA 4F6RB 4CH3A 2YIBA 4UCOA 1ZHSA 5ITZB 5A2QW 4JI1H 3VQXA 4LH6A 4DR7B 3K57A 4DR4H 1IBKH 4YHHB 3WB0A 1IBMB 3N40P 1XNQB 4FVMA 5IJ9A 4DR1B 4IAJA 5FLXW 4X65B 3U0ZA 4CS3A 5KHIA 4DV5H 2GV9A 4FLYA 1E4FT 4DR7H 4DR2B 4I55A 4LF7B 4ZHQA 3VNNA 4X66H 1P16A 5LYJB 4CH5A 4M7EA 3VQVA 2WYOA 2Q2UA 4LNUA 3DF7A 3KALA 2Q2TA 5BMVA 2VQEB 4AQYB 1XK5A 1XMOB 2BTQA 1A0IA 1I7FA 5C8YB 5GONA 3H20A 3JAWB 4LF5B 2YIAA 1M93A 4MV9A 3HKDB 1M4UA 1ZAUA 5FPRA 4HNAA 4E6NA 5JJNB 3B2EE 3U10A 4X1YA 5KHHA 3K5OA 4JI0B 3M7MX 4DV0H 1YEWA 1N33H 2HIVA 2VQEH 1Q5OA 1I94B 1Z2PX 5JQGA 1HNXB 2ZNJA 2RJZA 3MWMA 4B3MB 1O75A 4JI0H 1B04A 1KMIZ 4LR3A 4DV0B 1VS0A 5FD6A 1JMKC 2XIGA 4KL1A 3E22A 1HNWB 4DUZH 1S03G 5BR8H 3LNNA 3RYCA 4DR5H 3RR5A 2YI8A 3RFRA 4LFBH 2VWJA 4AHCA 2WE6A 3RF2A 4LF6H 2JS5A 4TV8B 4FFBB 1XMQB 3FFQA 4JI4H 1AN7A 5BR8B 3J81W 2O03A 4FLTA 3TY5A 4GYCB 4D7SA 3JSLA 2HVQA 4O2BB 4K8ZA 5FPOA 3ZEDA 3QWUA 2ZCEA 2PY5A 4DV5B 1SA0A 4O2BA 5FNVB 4DR1H 2ZINA 2F93B 1BJTA 4TOIA 4X1KB 4X65H 4LF4B 2QM4A 3CVZA 4X1IB 4IHJA 3L4KA 4GKJB 4PHZA 4ETSA 4DRXB 4EFEA 1TUBA 1BGWA 5LA6B 4WBNA 4JV5B 4LSAA 2OYQA 4HBNA 1WPBA 3T1HB 4J0MA 3JAKA 2CW7A 2Q0AA 4FLUA 1FKAH 4PI0A 5KHKA 1Q3EA 5LMNH 5LXTB 4LF5H 5LP6C 5LMUH 3J7AK 3UT5A 2HHHH 4APMA 3W1BA 2WDTA 5LL6b 4JV5H 3RYHB 4RB2C 3JATB 2Q7HA 4TUYA 3JALA 4LF8B 3RYIB 4JI3H 2IM9A 4LF7H 4K0KB 1ZHQA 5EZYB 2YCHA 3S24A 1SEIA 3GB8B 2UUCH 5DISC 1SYXB 2VUGA 4A2AA 4JI3B 3BA9A 3K5NA 4IIJB 5D1PA 4EEQA 3KXYT 2ZIOA 3N6XA 4B3SH 4BWAA 4X64B 1O9HA 4UCVA 4LFCH 3HXLA 1L2ZA 4LSXA 4KHPB 4DRXA 3GJXB 4DR4B 2JVDA 2CFMA 4JI4B 2UUAH 3F8NA 4BW9A 3WB2A 1HNXH 3T1YH 2W57A 1HR0H 1V9PA 2RGRA 1KU9A 4L8JA 1XI1A 3BPZA 4NXMH 4JI1B 1TVKB 5JVDB 1S5JA 3HKDA 4Q6GA 5FD5A 1L8DA 2XHBA 3RWRD 5JCOA 5IWAH 4EB6A 2VQFH 3RYFA 3JARA 4FM0A 4DV2B 3FMAA 4AQYH 1XMOH 4RAYA 4PZ7A 2PYJA 4B3TH 4DK0A 4TV9B 3WB1A 3EYYA 4RB1A 4CS4A 4YY3H 2HGSA 3HKCA 1DGSA 2YXLA 2P22C 4DK1A 2UXDB 3MAQA 3JALB 1N36H 3N42B 4MTEA 1TAEA 2PZSA 2OWOA 4JI7B 4JI6B 5IJ0A 4YY3B 4O4JA 5CA0A 2HIXA 2ZM6H 4K8XA 3L4JA 3KAJA 1CKNB 1M0TA 3ICXA 4DR5B 4U3JB 3N2GA 1XNRB 1CKNA 5KX5B 3ZS8C 4X1KA 1Q8IA 1H2SB 1SQGA 4RAZA 1SA0B 3U11A 3K5LA 3BABA 5JCOC 4ZOLA 2HVSA 4MV7A 4ZOLB 2CW8A 1VF7A 5JQGB 4LNUB 1HNZB 1G6UA 4DV7H 2F4VH 3L2PA 5LA6A 4WBNB 1M5IA 5D5QA 3JAMW 3UT5B 5CA1A 3IAYA 5C8YA 4AILC 4F6RA 3T1YB 2PTMA 3RYCB 4RZQA 4R7RA 4GKJH 1XHZA 4UCUA 5KMGB 4RB0A 2ZNIA 2BTOA 3OTOB 4FLWA 4TUYB 4LMYA 1X4TA 5D1OA 2ZJTA 4JI5B 4X20A 3BA8A 1Z2OX 4O4IA 4GLXA 5EZYA 1FFXA 3QG5A 2F95B 3RIZA 1TA8A 2RQ6A 3N2KB 1IBKB 2PGGA 5JH7B 1IBLB 4ZI7B 3VQWA 4I50B 2UXDH 5JH7A 2F1MA 2ZM6B 5IYZA 3SJCC 4X62B 1CKMA 5IYZB 2BTQB 4O4LA 4CH4A 3HKBA 3K3VA 5EOYA 2YIBD 4DUYB 2R70A 2KSWA 4DV2H 4DR3B 1N32H 4FM9A 5JVDA 4DR6B 5KHGA 3ETQA 1QQCA 5IT9W 4FM1A 3A2FA 4UFZA 2F66C 4IHJB 4I4TA 2MCTA 1MZBA 4YJ2B 1TVKA 4DUYH 4LF9H 4YJ2A 1HNWH 4LH7A 3JSNA 2QJ1A 2E5LB 2UXCB 3VQYA 3SJBC 3K59A 4PZ6A 4FM2A 3T1HH 1HR0B 3JARB 1TGOA 4DV7B 4MTDA 3QF7A 3W5OA 4DV4H 4X64H 1T5EA 3RYHA 3SR2C 3NBYB 4O4HB 4LFCB 4IIJA 4FFBA 4FLXA 2V4DA 1RSOA 2UUAB 4ZHQB 4BWSC 4YJ3B 2R9AA 1SKVA 4GKKB 1X9NA 3K5MA 5IJ0B 1SQFA 4O4IB 3JASB 1P8LA 1Z2NX 1JJOA 3TY9A 1XDNA 2UUBH 5KX5A 2PUSA 3CSXA 4X1IA 3SGIA 4B3SB 3K58A 4I50A 1TUBB 3BAAA 3QTCA 2FE3A 4JI2H 4PI2A 4DV1H 5EYPA 5LP6B 5LMNB 4I9QA 1N34H 4B3TB 4DV6H 5LOVB 4LF4H 4B3MH 3RYFB 3OTOH 3HKBB 3RGZA 3PN1A 1NT2B 5LOVA 4DR3H 4DV1B 3JAWA 5J2UA 4TV9A 4CS2A 1S68A 4DRFA 4DV6B 1FVIA 1WH2A 4UCSA 2VPSA 1I6UA 3KAKA 4JYAH 5JJJB 3BHPA 2ZIMA 3BRCA 2EX3A 1XQ8A 4X66B 4PDBA 4FLZA 5EIBD 2UU9B 4B3RH 5IJ9B 4DV3B 1I94H 1FFXB 3E22B 2JGUA 1J5EH 4JI8H 4UCRA 5EIBC 3JASA 5CB4B 4D7TA 4U3JA 3HKCB 1QHTA 4A2BA 4CC5A 4I55B 3CHXA 2HVRA 3RGXA 4TV8A 1N32B 5LYJA 4ZIBA 5K1PA 4NVPA 3NC0B 3NBZB 2E3CA 4LFBB 5J2TA 2Q7GA 2CAZC 4CC6A 4ZI7A 4YHHH 4GKKH 1IBMH 1GYFA 4JI5H 4O4LB 5BMVB 4FLVA 1P49A 4O2AA 3SJAC 1XMQH 2YI9A 3N2GB 5GONB 5KHJA 4B08A 2VWKA 4NXNB 1JFFA 4LFAH 4CH6A 3HKEA 5LMUB 4Q0YA 2HHHB 4EQ5A 3THOA 4OX9H 3HKEB 5J2UB 1XHXA 4I4TB 3CB2A 4DUZB 4DV4B 4JI2B 5D5PA 4EB6B 4X1YB 3N44B 4UCTA 1N34B 3LMLA 1M0WA 1WNSA 4NXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSN A;  2E5L B;  2UXC B;  4B3M B;  4DV2 B;  4PZ6 A;  5D1O B;  1HR0 B;  1CKO A;  1B04 A;  4PZ7 A;  4DV7 B;  1VS0 A;  4DV0 B;  3W5O A;  1HNW B;  3GDE A;  3UQ8 A;  3NBY B;  3RR5 A;  1N33 B;  1DGS A;  4LFC B;  2UXD B;  2UUA B;  2UUB B;  1XMQ B;  1FJG B;  1TAE A;  2OWO A;  4JI7 B;  4JI6 B;  3W1G A;  4JYA B;  4YY3 B;  5BR8 B;  4B3R B;  4GKK B;  2HIX A;  1X9N A;  2UXB B;  1N36 B;  3TY8 A;  3TY5 A;  1J5E B;  4JI8 B;  1CKN B;  3JSL A;  2HVQ A;  4DR5 B;  5FPO A;  1XNR B;  1P8L A;  3QWU A;  1CKN A;  4DV5 B;  3TY9 A;  1XDN A;  4LF6 B;  4LF9 B;  4TOI A;  4LF4 B;  2UUC B;  3SGI A;  3BAB A;  4B3S B;  4PZ8 A;  3KYH C;  3BAA A;  4EFB A;  2HVS A;  4GKJ B;  5LMN B;  4EFE A;  5IWA B;  2VQF B;  4B3T B;  4JV5 B;  1HNZ B;  3T1H B;  3L2P A;  3PN1 A;  3RTX A;  4DV1 B;  4OX9 B;  2F4V B;  3T1Y B;  4LFA B;  1S68 A;  3W1B A;  4DV6 B;  1FVI A;  4DRF A;  4UCS A;  4UCU A;  4UCO A;  3OTO B;  4LF8 B;  4X66 B;  4LH6 A;  4K0K B;  5D1O A;  4DR7 B;  2UU9 B;  4DV3 B;  4JI5 B;  3S24 A;  3BA8 A;  4YHH B;  3GB8 B;  1IBM B;  4GLX A;  1XNQ B;  4DR1 B;  4UCR A;  5DIS C;  4X65 B;  2VUG A;  4JI3 B;  3BA9 A;  4CC5 A;  1TA8 A;  5D1P A;  4EEQ A;  2HVR A;  1IBK B;  1N32 B;  4DR2 B;  4X64 B;  1IBL B;  4LF7 B;  3NBZ B;  4UCV A;  3NC0 B;  3VNN A;  1P16 A;  4LFB B;  4CC6 A;  2ZM6 B;  4KHP B;  3GJX B;  4DR4 B;  2CFM A;  4JI4 B;  2Q2U A;  4X62 B;  1CKM A;  2Q2T A;  4NXN B;  2VQE B;  4DUY B;  4AQY B;  1XK5 A;  1XMO B;  5LMU B;  1A0I A;  2HHH B;  4DR3 B;  1V9P A;  4LF5 B;  4EQ5 A;  4DR6 B;  4DUZ B;  4E6N A;  1ZAU A;  5FPR A;  4JI1 B;  4DV4 B;  4UFZ A;  4JI2 B;  4JI0 B;  2HIV A;  4UCT A;  1N34 B;  1I94 B;  1HNX B;  4NXM B;  4LH7 A; 
#chains in the Genus database with same CATH topology
 3BVO A;  3ABM C;  2BQ3 A;  1ULZ A;  3G71 V;  1CKO A;  2W6N A;  3CCE V;  4TQF A;  4OPH A;  1D2D A;  2Q4P A;  1JVM A;  4DL6 A;  4RZR A;  4JI6 H;  5KAI Z;  3GQC A;  4LF6 O;  4FPP A;  2UXB H;  1GRJ A;  1XL4 A;  5ITZ A;  3ASN C;  5K1X A;  3K3W A;  3CCV V;  1YJ9 V;  1FJG B;  1J95 A;  1P7G A;  4JF3 A;  1EBO A;  4JYA B;  2OH2 A;  3ZHU A;  4OPA A;  3FKS G;  3O9O A;  1N36 B;  4O4J B;  1Q43 A;  5E1A C;  3ORR A;  4GT1 A;  4O2A B;  5CB4 A;  1KEC A;  2W6Z A;  4JI7 H;  1JFF B;  1NH2 B;  2FPP B;  2JS3 A;  4LF6 B;  4Q8F A;  4ZKI A;  1NTZ H;  1OZ0 A;  4LF9 B;  1ET0 A;  4GC6 A;  1HNZ H;  2UUC B;  2W0F C;  2YC0 A;  3RJ0 A;  3QQM A;  3AG3 B;  2V4Q A;  3GIL A;  2AGQ A;  1CXZ B;  3ETG A;  4HNT A;  3N43 B;  3RTX A;  4DLK A;  1N34 O;  4ECW A;  2N05 A;  1DV2 A;  2ZXW B;  2F43 G;  2YIC A;  1BNC A;  4C5B A;  1E4G T;  3HOW G;  1EKP A;  2PYL A;  3LNM B;  4D6T H;  1BHA A;  2JEF A;  4O7R A;  4CH3 A;  4XX0 B;  3HKZ E;  3T9C A;  5GTI Z;  1B6Q A;  4JI0 O;  5LA6 F;  1A48 A;  4DR4 H;  1IBK H;  3WB0 A;  4TQS A;  4BXX G;  5DGH A;  3N27 A;  3S3X A;  4CS3 A;  1PM9 A;  4IIJ F;  5C1O A;  2GV9 A;  3PW0 A;  2OCC B;  5H6Q A;  1E4F T;  4MSW C;  1SRY A;  4LF7 B;  1T94 A;  1P16 A;  4JYC A;  4DL7 A;  5LYJ B;  2BOB C;  3CRM A;  2P6J A;  3HOX G;  3BQ2 A;  3HOV G;  2OIG A;  2GSM B;  1UNN C;  2A3Q A;  3DF7 A;  2Q2U A;  5H6R A;  3ZX6 A;  3GV7 B;  1EKV A;  1VQ5 V;  5BMV F;  3VBB A;  2JRI A;  5BMV A;  1XK5 A;  4FBU A;  2BTQ A;  2CDY A;  4LF5 B;  2QWQ B;  5D8D A;  1M4U A;  4HNA A;  3CCR V;  2NU6 B;  2N04 A;  4TQR A;  3EFF K;  3M7M X;  5KFY A;  1BMF G;  3WU2 Z;  1YEW A;  2FTK A;  2LW7 A;  1SET A;  2O57 A;  1Q5O A;  1FXV A;  4ZOL F;  2EIN B;  2WLN A;  1CP9 A;  2RJZ A;  2VRZ A;  2I80 A;  3MD0 A;  3JCZ A;  1VF6 A;  4RUE A;  4IRC A;  1EHI A;  5FD6 A;  3HOU G;  1JMK C;  1GN4 A;  2CK3 G;  2IW5 A;  1KJI A;  4KL1 A;  3E22 A;  4UVB A;  4O7V A;  1S5H C;  4MVS A;  4LFB H;  3RFR A;  1I2L A;  4Q4C A;  4AHC A;  4A3G G;  2Y0P A;  5IE9 A;  3TJT A;  3L74 H;  3VOU A;  4DQN A;  4CE5 A;  5LYJ F;  1VMG A;  1V54 B;  1PL4 A;  1A3G A;  4NYE A;  3CC2 V;  1SER A;  1GO3 E;  1V54 C;  4K8Z A;  4U7O A;  4YHH O;  2IH1 C;  3G67 A;  5L3D A;  4QIW F;  1H2K A;  4DR1 H;  2JEJ A;  1BJT A;  4I4T F;  4TOI A;  4X1K B;  4X65 H;  3PO3 G;  2NNU A;  3GTO A;  1Y76 A;  3CVZ A;  2H8P C;  5LGT A;  2H3O A;  4PHZ A;  2HKO A;  4EFE A;  4UV8 A;  2VPQ A;  3QO7 A;  2GPW A;  1BGW A;  2R7K A;  3WG7 B;  4QJF A;  2OYQ A;  1Q86 W;  4J0M A;  5DQI A;  4PA9 A;  1R3J C;  3JAK A;  5HFM A;  5KT7 A;  1NBM G;  1PKX A;  2CW7 A;  2K9P A;  1FKA H;  2YDE A;  5KHK A;  2XND G;  4QE7 A;  1EZ1 A;  3B8N A;  2V58 A;  5LP6 C;  2B5U A;  3UT5 A;  2HHH H;  3X2Q C;  5FJ8 G;  3W1B A;  1Y1W G;  1B06 A;  3ZHV A;  3SYO A;  1I1M A;  3TEK A;  2PMZ E;  4A3E G;  3ABL C;  2FML A;  2Q7H A;  1Y74 B;  1RJP A;  3X2Q B;  1I08 A;  4E4E A;  2QTO A;  3GIP A;  5EWE A;  4MW3 A;  1F51 A;  2P90 A;  3H4D A;  1MSW D;  2NLJ C;  2UUC O;  3CRR A;  3H9V A;  2R7Z G;  2F23 A;  4DR4 O;  1ZHQ A;  4Q43 A;  5H5N A;  1SEI A;  1JDB B;  2YXY A;  2VUG A;  2DOS A;  2UU9 O;  1P84 F;  2ZDQ A;  2FPG B;  1BE3 H;  1N0N A;  3K5N A;  3UKM A;  5D1P A;  3OUU A;  4EEQ A;  1EFR G;  2QE7 G;  3K06 A;  3N6X A;  4B3S H;  5J9P C;  4KXR A;  1O9H A;  3FB8 C;  4UCV A;  2EJ3 A;  4O7Z A;  4A3C G;  1I1K A;  3BCC H;  4HQ6 A;  3E89 A;  3GB7 C;  4IRK A;  1WP8 A;  4FK5 C;  2CFM A;  4JI4 B;  2RDJ A;  3F8N A;  2UUA H;  1Y14 B;  3PW4 A;  4ECY A;  4QWC A;  3ASO C;  3NGD A;  4JTC B;  4DV7 O;  1V9P A;  2RGR A;  1EZJ A;  1K1Q A;  2E5L O;  1K5Q A;  2W70 A;  2Y69 C;  3CPW U;  1S5J A;  3HKD A;  3KHH A;  1GH6 A;  5FD5 A;  2JA6 A;  3DC5 A;  2XHB A;  4CMF A;  3CD6 V;  3QO8 A;  4PA3 A;  3T1H O;  2FMA A;  2PI4 A;  4GLW A;  2CH7 B;  2PYJ A;  2AQ4 A;  5FL7 G;  2ALZ A;  2HGX A;  3WB1 A;  1S77 D;  5B1A B;  1VQ9 V;  2ARH A;  4QNH B;  2YXL A;  3ABM B;  4JI1 O;  2FB9 A;  4DXW A;  2UXD B;  1XBL A;  3FB7 C;  3OE7 G;  2FPI B;  1M90 W;  2MW2 B;  2Y4U A;  5BXZ A;  2X0S A;  1H38 A;  2OWO A;  3OUZ A;  4J9M A;  4JI6 B;  2P7T C;  4YY3 B;  5DLG A;  2OIE A;  1JLL B;  1YI2 V;  1CKN B;  1R6N A;  5K2M A;  1Q6U A;  1XMQ O;  4U3J B;  3N2G A;  1XNR B;  5KX5 B;  5L3E A;  4X1K A;  1Q8I A;  5KUM A;  2UXD O;  4NZN A;  5KG1 A;  4J7K A;  1L1F A;  3IC9 A;  4RAZ A;  5FLX N;  2ZD9 A;  1VAR A;  3U11 A;  1KBL A;  5KG5 A;  1EYZ A;  2IMW P;  2PVP A;  3BAB A;  4YR3 A;  2XD4 A;  1H2L A;  2JEG A;  2UVR A;  4DV0 O;  1VF7 A;  4M9U A;  1HNZ B;  4B7E A;  3T9A A;  5KFT A;  2F4V H;  2HJD A;  4IZO A;  3L2P A;  2ASL A;  5D5Q A;  5BWW A;  5CA1 A;  2QTS A;  4F4L A;  4HYO A;  2EIJ B;  2AZ2 A;  3MHS C;  4JZ2 A;  2PTM A;  3AG2 B;  3W7T A;  4N21 A;  2EIJ C;  5IDJ A;  4YJ2 F;  5KMG B;  3OR7 C;  1IBL O;  2BTO A;  3Q1K A;  4FLW A;  1JDE A;  4GUN A;  3ZRW B;  2JA7 G;  4TUY B;  4WF9 V;  2W9B B;  1X4T A;  2GUZ A;  4JV2 A;  4KFM A;  2XAG A;  2QKC A;  5DGI A;  4WFH A;  3CP1 A;  2ZJT A;  5CA1 F;  1NR7 A;  5KT3 A;  4X20 A;  3BA8 A;  2RCV A;  3DTG A;  4O4I A;  3R5H A;  4LF7 O;  3B09 A;  2NU9 B;  3QG5 A;  2F95 B;  3RIZ A;  1TA8 A;  1I50 A;  2RQ6 A;  4QGP A;  1IBK B;  4RUF A;  3HOY G;  3CSW A;  2A7W A;  5I60 A;  4H37 A;  3M9M B;  4ZI7 B;  3E83 A;  3L71 H;  2ASJ A;  2V59 A;  5C4X G;  3APQ A;  3SJC C;  3HOZ G;  1VF5 B;  2IA6 A;  5IYZ B;  2QA4 V;  3HKB A;  5EOY A;  4J9Y B;  2UVW A;  2YIB D;  3GTK A;  3ZBH A;  3GWO A;  3LUL A;  2NVY A;  3F7Y C;  4DR3 B;  2R85 A;  5JVD A;  4UB8 Z;  4PBC A;  2W6I G;  5KHG A;  5HV6 A;  2UVV A;  2F66 C;  4YJ2 B;  3FB6 C;  2DLN A;  4YJ2 A;  3GTJ A;  4PDL A;  1IOW A;  5I5Y A;  3F5W C;  1HR0 B;  3JAR B;  1TGO A;  5A9G A;  4MTD A;  4EGJ A;  4PJ0 Z;  1I94 O;  4O3S A;  3ZHT A;  4X64 H;  3FYE B;  4P9O A;  3OGI B;  2EZO A;  5LHI A;  3UZO A;  1RSO B;  1LNQ A;  4FFB A;  1VQP V;  1XNQ O;  4MVU A;  5EDW A;  4E2L A;  4ZHQ B;  3VA7 A;  4YJ3 B;  2R9A A;  2XAQ A;  4JYY A;  2LGW A;  5KG3 A;  1X9N A;  3NR7 A;  2FLP A;  4R6Z A;  1JX9 A;  3ZRV A;  2OTL V;  3V4S A;  4RU9 A;  1P8L A;  1OCZ C;  2R7M A;  3E86 A;  3TCU A;  4M0J A;  3UZB A;  3SPI A;  2IU0 A;  5KX5 A;  3HB9 A;  3CSX A;  4GC7 A;  1CPY A;  3MFH A;  3SGI A;  4B3S B;  5F2V O;  2FE3 A;  3BAA A;  3CRC A;  1K7D A;  1VKZ A;  4DV1 H;  1AJP A;  5LMN B;  2HDK A;  3M9O B;  5EBM C;  3JCU Z;  3EVK A;  5I5U A;  3RGZ A;  5B1B C;  2CTR A;  5LOV A;  3ZN0 A;  4HNV A;  4DR3 H;  3JAW A;  5JWP A;  2LW1 A;  5EWF A;  4TV9 A;  4CZZ A;  1S68 A;  1FVI A;  1S76 D;  4XZ3 B;  4FFO A;  5AG2 A;  1SZX A;  1Y67 A;  3GVM A;  4MTG A;  4X66 B;  3CEB A;  2LFS A;  2R6F A;  2QEX V;  5IJ9 B;  4DV3 B;  1AP5 A;  3H1J H;  1I94 H;  1FFX B;  4O4I F;  1J5E H;  2JGU A;  2LGQ A;  4F50 A;  4U3F H;  3RB0 A;  1JOY A;  4U3J A;  1QHT A;  5KFJ A;  2ILM A;  4I55 B;  1EZV H;  3SPH A;  2HVR A;  5L1L A;  5K1P A;  3N8D A;  3EPI A;  4LFB B;  5J2T A;  2V5A A;  1S9F A;  2CAZ C;  4DV3 O;  1QLE C;  4FZ1 A;  4O3Q A;  1IBM H;  4NLG A;  2M6Y A;  1W96 A;  4PV1 B;  5BMV B;  1TWC A;  5LHH A;  2FK1 A;  4O2A A;  2P06 A;  3SJA C;  1KJ8 A;  3WO0 A;  5GON B;  1LUW A;  4LFA H;  2CNV A;  1AP6 A;  3HKE A;  3Q2O A;  4MV8 A;  1S0M A;  5J2U B;  3GIJ A;  3VPB A;  4DV4 B;  5D5P A;  3STZ C;  1HWY A;  1JQ0 A;  5KFQ A;  3N44 B;  1M0W A;  4MT8 A;  3HPL C;  2Y48 A;  4J7Z A;  3E35 A;  5KUK A;  2WLI B;  1AR4 A;  2EIN C;  1S0V A;  2GTA A;  1O9G A;  1YZB A;  5LXT A;  3EXA A;  4JZG A;  4O81 A;  3D3I A;  5JQW A;  4DR6 H;  1XNQ H;  3ASO B;  1IBL H;  3JD0 A;  1YIJ V;  3CCU V;  3BJY A;  1NI8 A;  1KC7 A;  3A8T A;  4A3D G;  3ZMT A;  3AG7 A;  1YVW A;  4O4H F;  3RAX A;  4TT3 G;  4O4H A;  3L9D A;  2UUB B;  2KKW A;  4X62 H;  5DG8 A;  4DR2 H;  4RB3 C;  4JI8 O;  2ZXW C;  3N41 B;  2EUL A;  1VQM V;  3SDL A;  5CA3 A;  2WAM A;  1NZ6 A;  3GID A;  2UXB B;  3TY8 A;  3OW2 U;  4JI8 B;  2Q7E A;  4DYL A;  2YXH A;  3BEH A;  3MFI A;  1FJG H;  4K0K H;  5H2F Z;  4IL6 Z;  2X5R A;  3I4N G;  3K9A A;  2Q7D A;  4DV1 O;  2W6Q A;  3KYH C;  2VOB A;  4EFB A;  5J2T B;  5HNE A;  1Y4M A;  5IWA B;  2VQF B;  1JJ2 U;  5EYP B;  2NR5 A;  4BIO A;  3WWH A;  4I7H A;  4JTA B;  3IG0 A;  4O84 A;  2Q9L A;  3ABT A;  5BPF A;  5C8Y F;  3PVX A;  2ATL A;  3DSQ A;  3E2E A;  3W7U A;  5LL6 Y;  3JD1 A;  1TWA A;  4NXN H;  1IDS A;  4KP4 A;  3DC6 A;  2JJ2 G;  2VA3 A;  1IVS A;  4UCO A;  3SYC A;  2WPD G;  5IYB O;  4JUZ A;  4JI1 H;  1RJR A;  4LH6 A;  3CX5 F;  2YL2 A;  2R92 G;  3GTP A;  2Z3Y A;  3RB6 A;  1B33 N;  5IJ9 A;  4EGQ A;  1K9M W;  2Y0S E;  4TV9 F;  2B63 A;  2AU0 A;  3R65 A;  2R84 A;  3SI8 A;  3OUF A;  2YZG A;  1KUQ A;  4ZHQ A;  4JAS A;  4X66 H;  1V4Y A;  5J2T F;  3JAM N;  4HYK A;  4O4L F;  4J9Q A;  3I55 V;  4R8U A;  2Q2T A;  2EIK B;  1XMO B;  1A0I A;  4FFR A;  4J9K A;  1I7F A;  1IXB A;  2GQR A;  5GON A;  2COI A;  2I87 A;  2R8I A;  3KHR A;  3HT5 A;  5JVD F;  3KKY A;  4MV9 A;  3MR5 A;  3HKD B;  1ZAU A;  1PNL A;  1VIB A;  4A5U B;  4NXM O;  1W0J G;  3FD9 A;  4H44 B;  1N33 H;  3ZJZ A;  4YIP A;  1Z2P X;  3Q8R B;  3AYH B;  5IYB G;  2ZNJ A;  1M1K W;  5C5J A;  4DUZ O;  1FKA O;  4WBN F;  4B3T O;  2EJ7 A;  2WLM A;  4ME6 A;  1I5Y A;  2D2C B;  5C3E G;  1KD1 W;  3QZ7 A;  2R93 A;  1N36 O;  3GV5 B;  3LNN A;  4C5C A;  4DR5 H;  2HLD G;  2WA3 A;  2AZ0 A;  3K5I A;  2YI8 A;  4JYA O;  3RF2 A;  5L9X A;  1MOF A;  2EIM B;  1RM1 C;  4F4Z A;  1N4C A;  4FFB B;  2DIK A;  3A0H Z;  1F7Y A;  4IR9 A;  2DAA A;  3RBD A;  3F7V C;  2O03 A;  4QPJ A;  1YCI A;  3WWI A;  2SCU B;  4GYC B;  4O2B B;  1VQ8 V;  1F4M A;  4O7Y A;  3D8C A;  3B4S A;  3MR6 A;  1KP2 A;  1WCM G;  4BIU A;  3EHB B;  4AI8 A;  1IYD A;  1Y76 B;  2NU8 B;  3TQT A;  5J2U F;  4O3P A;  4G3I A;  4LF4 B;  1VQ6 V;  4TVI A;  4X66 O;  2ZQM A;  2YU9 A;  3ETD A;  2Q8V A;  4X1I B;  4FE2 A;  5HBR B;  2QWN B;  3T4Z A;  4WBN A;  4FFM A;  4JV5 B;  4DV2 O;  1K4C C;  4LSA A;  4GX2 A;  4XBF A;  3TET A;  1SES A;  1S10 A;  2QWR B;  4QJF B;  4PI0 A;  2JEU A;  2D3O W;  1BQZ A;  2QB5 A;  4LF5 H;  4AYB A;  1S0N A;  4IRD A;  2ZGI A;  1KBH A;  1PK8 A;  2HVJ C;  3QZ8 A;  4JV5 H;  2WLL B;  3D3Q A;  3JAT B;  3L72 H;  4QW8 A;  2W6J G;  5IY5 C;  1V55 C;  5EC2 C;  3KTM A;  5KFM A;  1RP3 B;  2X0L A;  5CE8 A;  1MZF A;  2XT9 A;  2NU7 B;  4JI3 H;  2IM9 A;  2YS6 A;  3MWD A;  2ZKO A;  2Y69 B;  3LP8 A;  3RFC A;  5DIS C;  2JEI A;  3RUP A;  1SQV H;  5DEC A;  4CHI A;  1Q7Y W;  5KLV H;  3NXS A;  1R9T A;  4IIJ B;  4FS1 A;  1P7B A;  1IOV A;  1OCC B;  4QWB A;  2DQ0 A;  2AXT Z;  3LUT B;  3Q4H B;  2V4R A;  1FJG O;  2JGD B;  1IYE A;  1XUQ A;  3L73 H;  5LBQ A;  4LFC H;  1WB7 A;  4DRX A;  3GJX B;  4DR4 B;  2JVD A;  1ENV A;  3K0D A;  1KUT A;  5LGU A;  1HNX H;  2W6P A;  2WLJ A;  4J9O A;  2W57 A;  1PD3 A;  4FJC C;  5KA6 A;  3S3W A;  3VOT A;  3PO2 G;  3BPZ A;  4NXM H;  4CBC A;  2UXC O;  2B9Z A;  1T36 A;  1TWH A;  2DN9 A;  4IYI A;  5KFX A;  2DYS B;  3UO2 A;  5TIS Z;  3RWR D;  5C44 G;  5JCO A;  4QWA A;  5IWA H;  3R23 A;  3R5F A;  2VQF H;  2VA2 A;  2CTP A;  1XMO H;  1H2M A;  4PZ7 A;  4PA7 A;  5BWR A;  2DPJ A;  4TV9 B;  4FFP A;  4RB1 A;  4RQF A;  3Q8S B;  4MV3 A;  2HGS A;  1M56 C;  3G6Y A;  1KT8 A;  1DK1 A;  1KTA A;  1VAJ A;  3DTF A;  1SQX H;  3V4Z A;  1GM8 A;  5KFR A;  1TAE A;  4TM5 A;  1OBD A;  2C22 A;  4O4J A;  3CYO A;  4B3S O;  2ZM6 H;  5L1K A;  1MAB G;  2J6T A;  4DR5 B;  3EPG A;  5L1J A;  4ED6 A;  1CKN A;  3KCY A;  2IJI A;  4E4T A;  1H2S B;  2RMK B;  1PP9 H;  3KCX A;  4GCZ A;  2Y4R A;  4O7W A;  4Q4D A;  2RDI A;  3FKI G;  2XC9 A;  2E2H A;  2HR3 A;  2BE3 A;  3KHG A;  2RDC A;  4Y8V B;  3DGE A;  2ITD C;  1QLN A;  4J9R A;  1FYJ A;  4MV7 A;  4G2K A;  5JQG B;  4DV7 H;  1G6U A;  3H1L H;  5LA6 A;  2EIY A;  3OM3 B;  2R82 A;  4DUY O;  3JAM W;  3UT5 B;  3IAY A;  2HJW A;  3RN4 A;  4YP3 A;  1KQS U;  3ETH A;  1VQ7 V;  4LF8 O;  4J9P A;  4LF4 O;  2R7N A;  3T1Y B;  2A1H A;  1GTO A;  3RYC B;  1PPJ H;  2CNQ A;  2CTQ A;  4RZQ A;  1I7L A;  1AI7 A;  4TV8 F;  5CBG A;  4RCN A;  5KFB A;  4LMY A;  3GTL A;  5DAA A;  3TIG A;  5E25 A;  1RK6 A;  3E8F A;  4NYK A;  1Z2O X;  2UVU A;  1AR1 B;  4O2B F;  4GLX A;  4MVQ A;  1VF6 C;  4A3I G;  2RN9 A;  3ML0 A;  1AB3 A;  3N2K B;  2PGG A;  4UVA A;  5JH7 B;  4W4L A;  1IBL B;  3U9S A;  1YTF B;  2DWC A;  3H1K H;  1HNX O;  1OCR C;  1YJW V;  1CKM A;  2BTQ B;  4O4L A;  3T54 A;  3K3V A;  3TQ1 A;  1QLE B;  3JRX A;  4DUY B;  1GN6 A;  5LXT F;  3ASN B;  3ZHQ A;  4LBE C;  3TW6 A;  1HNZ O;  4JPR A;  1UFI A;  3GIM A;  3ETQ A;  1QQC A;  4I55 F;  4FM1 A;  4O7S A;  3A2F A;  3PJS K;  3H01 A;  1XRE A;  4I4T A;  2MCT A;  4WD3 A;  1M57 B;  4DUY H;  4ED7 A;  5GTH Z;  4LF9 H;  4MV4 A;  1VQK V;  3MDS A;  1D5N A;  3JSN A;  3K59 A;  5EZY F;  4DR3 O;  3J7A U;  3FYI B;  3W5O A;  1K33 A;  3SR2 C;  2WLL A;  1B6R A;  1R1B A;  3NBY B;  4H0L B;  2MK3 A;  2XAF A;  2XTA A;  4IIJ A;  4XYL B;  3SE7 A;  4RQE A;  1RSO A;  2YID A;  1VBH A;  1B3Q A;  4DL5 A;  4Q45 A;  2FK2 A;  3B8M A;  2GUZ B;  2ZE5 A;  3I56 V;  4GKK B;  3TXS A;  2IJH A;  3JAS B;  2NN4 A;  4C7U A;  3T99 A;  2EIK C;  5KG7 A;  1Z2N X;  1PX2 A;  1Y6X A;  3O65 A;  1GGO A;  3GLK A;  2X6B A;  2UUB H;  1AJQ A;  3GWK C;  2W71 A;  5B1A C;  2PUS A;  1KJ9 A;  4QSH A;  4OX9 O;  5A2Q N;  4J9Z B;  5KT2 A;  1ORQ C;  4JI2 H;  4IR1 A;  2Z5U A;  4KUM A;  3L75 H;  5L3B A;  2X7R B;  4LF4 H;  4B3M H;  3HKB B;  3PN1 A;  4EBC A;  1ZLZ A;  1K73 W;  4DV1 B;  5JUM A;  4LF9 O;  4DRF A;  3P30 A;  3JZF A;  1OV9 A;  3KAK A;  4UUG A;  5L1I A;  4JYA H;  5CR5 A;  4GKJ O;  3SYQ A;  3OSN A;  5JJJ B;  2EX3 A;  4B3R O;  4MA5 A;  5IYZ F;  4B3R H;  2AGP A;  4ECZ A;  3E22 B;  4UCR A;  5EIB C;  3JAS A;  5CB4 B;  4D7T A;  4A2B A;  3ETJ A;  1FXK B;  4L1K A;  3RGX A;  4A3M G;  4TV8 A;  5LYJ A;  4ZIB A;  2ZT9 B;  3UM7 A;  2RF4 A;  3NC0 B;  3NBZ B;  3WNZ A;  1AI4 A;  4CC6 A;  1NR1 A;  4GKK H;  1GYF A;  1K97 A;  4RNM A;  1GK9 A;  1XIL A;  2HG5 C;  2EJ2 A;  4K3A A;  2YI9 A;  2AW9 A;  3CC7 V;  4Q0Y A;  4JI2 O;  4RO2 A;  3TXQ A;  1AR5 A;  1A32 A;  3THO A;  4MA0 A;  4EQ5 A;  2R8H A;  3Q8P B;  3HKE B;  3T5J A;  2V1D A;  2WSS G;  2V9W A;  4OX9 H;  3CB2 A;  4JI2 B;  1N33 O;  5I5T A;  3TIN A;  1FAF A;  4QWE A;  1WAZ A;  4UCT A;  1US6 A;  2YZL A;  3K04 A;  2J6U A;  3OGC C;  4NXM B;  4XYM B;  1D5A A;  3RYI A;  2R7Z A;  2P5O A;  5D1O B;  4BBS G;  1R73 A;  2KG7 A;  4TQD A;  2PI5 A;  5EBW C;  5CMU A;  2Q5Z A;  3RGB A;  4P30 A;  3GDE A;  3RV3 A;  3UQ8 A;  4DIM A;  1N33 B;  3JAT A;  4CKE A;  2XOK G;  4NTX A;  4CKB A;  1Y1V G;  3FAV B;  5JH7 F;  4YJ3 A;  3KZI Z;  4I50 F;  3R9R A;  2JIZ G;  4LWS A;  1J5E O;  1XL6 A;  2HGW A;  2B1G A;  3W1G A;  4KHP H;  5F9L A;  1YXB A;  3OSP A;  2AHY A;  4B3R B;  4DL2 A;  2EZP A;  3H0G G;  1BS3 A;  1J5E B;  3ABL B;  2HEP A;  2W7O A;  3OMI B;  4PDR A;  1IBM O;  4DV3 H;  2R72 A;  5CAE B;  1FD9 A;  2WB1 E;  2JA5 A;  4EKW A;  4Z2W A;  5LP6 A;  2E5L H;  1XNR H;  2W9A A;  5B66 Z;  4EYH B;  1XEQ A;  5JJE B;  1Q82 W;  5KFZ A;  4LF8 H;  3H3V H;  5IYD O;  3OMN B;  4MS2 A;  2CGN A;  2F4V O;  2YS8 A;  2VQE O;  3K79 A;  1HW7 A;  4MV1 A;  1E4E B;  4OX9 B;  1OCZ B;  1A0G A;  2F4V B;  4LFA B;  5E79 Z;  5KFC A;  3TK1 A;  4UUJ C;  2EIL C;  5KMG A;  5H80 A;  4F6R B;  4ED0 A;  1QNM A;  2YIB A;  4MV6 A;  1ZHS A;  1BHB A;  1GSA A;  5ITZ B;  3F5T A;  3ZCC A;  1IUR A;  2ZR2 A;  4NB5 A;  3NUA A;  3K57 A;  2ETN A;  2JA5 G;  5B1O A;  1VP7 A;  4YHH B;  2OLS A;  4PWQ A;  4IWX A;  1XNQ B;  4JTD B;  4FVM A;  4DR1 B;  3N40 P;  4IAJ A;  5FLX W;  1SQP H;  2AGO A;  1K8A W;  1I3Q A;  4FLY A;  4JAV A;  2VQD A;  4OGQ B;  4DR2 B;  1AI6 A;  2LP7 A;  4GZR B;  3WFV A;  1K92 A;  1X59 A;  4J9L A;  2QR4 A;  4R50 A;  3BQ0 A;  4CH5 A;  4M7E A;  2WYO A;  4GX0 A;  4DL3 A;  1RPR A;  1R3L C;  4LNU A;  1W93 A;  3MR3 A;  3M8A A;  4WFE A;  3T2M A;  2VQE B;  4AQY B;  3H20 A;  4O3N A;  3JAW B;  3R5X A;  1BZK A;  3OHA A;  1M93 A;  4YR0 A;  5FPR A;  2CKZ B;  4X1Y A;  5JJN B;  3U10 A;  3K5O A;  5KHH A;  3U9T A;  4DV0 H;  4ECX A;  3K3P A;  4Q20 A;  2I8C A;  3K9S A;  4K6N A;  4EBD A;  2DYR B;  2W8K A;  4UVC A;  1T3N A;  3ABK C;  1MSD A;  5GW7 A;  4QE9 A;  4DV4 O;  2UXN A;  4O82 A;  3MWM A;  4XDL A;  2Y4T A;  3PW2 A;  3I12 A;  1B04 A;  1B6S A;  1KMI Z;  4LR3 A;  1VS0 A;  4YQW A;  2XIG A;  3VPC A;  3K03 A;  4IT5 A;  3R66 A;  1QR9 A;  3RB3 A;  2WLK A;  1M7J A;  1AUV A;  3LSU A;  3UFX B;  2VWJ A;  1E1R G;  4X9Q A;  3SPC A;  3DTU B;  5K3W A;  3OEE G;  4LF6 H;  1XMQ B;  4ECR A;  1KJJ A;  2W9B A;  3G6B A;  3L70 H;  3AK3 A;  4MAM A;  3AG2 C;  3TY5 A;  2BQU A;  3U0G A;  3ZMS A;  3QWU A;  5FPO A;  3ZED A;  5DN6 G;  2PY5 A;  1LR1 A;  2ABJ A;  3JD3 A;  1SA0 A;  2XAS A;  5FNV B;  2F93 B;  1NJI W;  1DF4 A;  4I7Z B;  3LDD A;  2QM4 A;  4NR1 A;  2L6L A;  4IHJ A;  4GKJ B;  1CEZ A;  4BBR G;  4DRX B;  1GN2 A;  1TUB A;  4ETS A;  2QGN A;  1DAA A;  1SZT A;  2JA6 G;  4HBN A;  3T1H B;  4IGG A;  3HKZ A;  2KB1 A;  4FLU A;  1RPO A;  2IJJ A;  5LMN H;  2Y0I A;  3GIQ A;  2DW4 A;  1VQN V;  2QWO B;  5C1P A;  1E4E A;  3CCJ V;  4APM A;  3KRE A;  2WDT A;  2YYA A;  4RB2 C;  4IHJ F;  3MWE A;  1GO3 F;  4TUY A;  2W0X A;  3JAL A;  4LF8 B;  3PR4 A;  2GBO A;  4QIW E;  2R8K A;  4YY3 O;  2HJF C;  1W0K G;  3G8C A;  5F9N A;  2FP4 B;  2YCH A;  3RAQ A;  1AI5 A;  3GB8 B;  1HP8 A;  4BAY A;  2UUC H;  1SYX B;  1FXH A;  1WR2 A;  5DG7 A;  4A2A A;  4JI3 B;  2EIM C;  3BA9 A;  3RVY A;  1RM1 B;  4GKK O;  2ZIO A;  2VS0 A;  2V7Q G;  4X64 B;  3T9B A;  2ZDG A;  3OD4 A;  4DW1 A;  4X89 A;  3HXL A;  1F4N A;  4WHX A;  4RUC A;  4KHP B;  3H4B A;  3CCM V;  1N32 O;  3CS5 A;  4BW9 A;  3WB2 A;  1EN5 A;  1WPX A;  2P0A A;  3V6K A;  1A9X A;  5KX5 F;  1ROP A;  3CRQ A;  2GQS A;  3ABK B;  1XI1 A;  3PZP A;  2A79 B;  5H9C A;  5DG9 A;  1TVK B;  4FFL A;  5JVD B;  5DQG A;  5KFH A;  3HBL A;  1K3E A;  2FYU H;  1E1Q G;  1WJZ A;  3K5H A;  1EUC B;  2ZE7 A;  4EB6 A;  5EBL C;  3JAR A;  4FM0 A;  2QF7 A;  1K4D C;  2JA7 A;  4RAY A;  1R3I C;  2QYZ A;  5CN0 A;  1BQ0 A;  1CQI B;  4L87 A;  4CS4 A;  2DWD C;  1H2G A;  1XDC A;  4JI3 O;  4JGS A;  3B40 A;  2P22 C;  2K1E A;  2WAQ E;  3MAQ A;  1IXM A;  4LFB O;  3DXR B;  1BL8 A;  1N36 H;  1ZUQ A;  5B1B B;  1WB8 A;  5FR9 A;  3V6H A;  3C3T A;  2PZS A;  4JI7 B;  1H2N A;  2XUM A;  5CA0 A;  3LWB A;  3BAC A;  2NUA B;  4QW9 A;  4K8X A;  4F4W A;  1WLE A;  3RB4 A;  4PDV A;  2Q6A A;  4JI7 O;  2KSD A;  4JYB A;  2FL4 A;  2LO1 A;  4FMT A;  3LDE A;  5I5V A;  1SQG A;  5KFD A;  2ZE6 A;  1RFY A;  1SA0 B;  4O3R A;  2XCL A;  2VUM G;  4MTF A;  5JCO C;  2HVS A;  1SQQ H;  4ZOL B;  2ADQ B;  4G27 B;  4A3K G;  5KFP A;  1SC5 B;  1VQ4 V;  1M5I A;  1S72 V;  5BWX A;  4Z1M G;  3OEH G;  2WB1 A;  2PN1 A;  1Y1W A;  1ZQ7 A;  2EJ0 A;  3LDC A;  5KFO A;  4AIL C;  5KFI A;  4F6R A;  3Q8Q B;  3GV8 B;  2EBO A;  1G1X B;  4U6P A;  1DV1 A;  2IBZ H;  2ZE8 A;  4GKJ H;  4XDK A;  3LSS A;  1XHZ A;  1ZET A;  3D36 C;  4UCU A;  2ZNI A;  4BW5 A;  1Y1V A;  5KFE A;  5KT5 A;  4GX1 A;  3GII A;  3CMA V;  5KFA A;  4N23 A;  5BR8 O;  3K0G A;  3ZMZ A;  4H33 A;  1NVP D;  3OR6 C;  4JI5 B;  1JIH A;  4DR6 O;  4QIW A;  5EZY A;  4IWY A;  2ZDI A;  5BPH A;  3CWB H;  1NVP B;  4MVR A;  4MW8 A;  2C2D A;  1L0L H;  4X65 O;  5DM6 V;  4ZHQ F;  3VQW A;  5IY5 B;  2UXD H;  4ASU G;  3IC7 A;  1FXK C;  5JH7 A;  4J7J A;  1VQO V;  1YJN V;  4A3B G;  2ZM6 B;  2JA8 G;  5IYZ A;  5CM0 A;  5KFU A;  4EYI B;  3T9F A;  1I1L A;  4X62 B;  5T14 A;  1QVG U;  3OT7 A;  2ITC C;  3T9D A;  5EC1 C;  2W9C A;  4ECT A;  3OUS A;  4FBT A;  2KSW A;  4DV2 H;  5KT4 A;  4R8C A;  2DMX A;  2AHZ A;  1ZL8 B;  1ZSP A;  5IT9 W;  4UFZ A;  2R86 A;  1OCC C;  2ATK C;  4IHJ B;  1FPO A;  5I5X A;  1RYR A;  4NZO A;  1GKF A;  1UPG A;  1MZB A;  1TVK A;  2WTF A;  1HNW H;  2GHY A;  3E8H A;  4LH7 A;  4Q44 A;  3AG4 C;  2E5L B;  1R6T A;  2J9G A;  4BY1 G;  3VQY A;  4O7T A;  1COW G;  2X6A A;  4DV7 B;  1YIT V;  3CJH A;  1GSO A;  4DV4 H;  3U54 A;  4YBZ B;  4EBE A;  4RWU A;  3CJH B;  3QFF A;  4JI4 O;  1MMM A;  2J6S A;  2R92 A;  2Q67 A;  5L3G A;  2V4D A;  2UUA B;  4YXW G;  4FFN A;  1V51 A;  2H94 A;  1R6K A;  4O4J F;  4LWS B;  5KFV A;  5I47 A;  3K5M A;  2HHF B;  1SQF A;  4O4I B;  5BWU A;  1G8M A;  3M99 B;  4YR2 A;  1S97 A;  3H1H H;  4EG0 A;  1JJO A;  4YAJ B;  4JI5 O;  4QPK A;  3TY9 A;  1XDN A;  2WWW A;  1N56 A;  2EJR A;  2YWV A;  4X1I A;  4WFA V;  2Q68 A;  4O86 A;  5DMX A;  3K58 A;  3QTC A;  4PI2 A;  5EYP A;  4I9Q A;  1N34 H;  4B3T B;  5KG0 A;  4DV6 H;  3E8B A;  2CGO A;  5LHG A;  3T1Y O;  3OTO H;  1Y66 A;  1MG1 A;  3STL C;  2ODM A;  1ZL8 A;  1WH2 A;  3OMA B;  4UCS A;  2VPS A;  4JV5 O;  3ZRW A;  4R7C A;  3J81 N;  4X64 O;  2R93 G;  4MVM A;  4FLZ A;  5EIB D;  3IFX A;  3LQS A;  2UU9 B;  2E74 B;  2A0L A;  4O3O A;  2XAJ A;  5BY1 A;  1ZWI C;  1ARO P;  2R87 A;  4PD4 F;  3HKC B;  3G6V A;  2XGQ A;  3CHX A;  2Z04 A;  2QWP B;  1N32 B;  1KKC A;  1MNG A;  2FKL A;  3I4M G;  4FZ0 A;  4NVP A;  3ABU A;  2E3C A;  3IGA C;  1EM1 A;  3UCS C;  1I0H A;  3Q4H A;  1FFT B;  5KFF A;  4YHH H;  2BSK A;  2QKA A;  4FLV A;  1AVM A;  1P49 A;  2ZDI C;  2PBZ A;  3RV4 A;  2IH3 C;  3N2G B;  2VWK A;  4NXN B;  1JFF A;  5LMU B;  4P9P A;  2HHH B;  2COJ A;  3CCL V;  3JZI A;  2C00 A;  4DUZ B;  1SS3 A;  4UV9 A;  1KB9 F;  3U55 A;  3WWJ A;  2BCC H;  1NTM H;  3CE2 A;  4EB6 B;  2N74 A;  4X1Y B;  1N34 B;  4C5A A;  2FB5 A;  4F4Y A;  3C0F B;  4FIP C;  5CA1 B;  1SCU B;  4LF5 O;  4I9W A;  4X20 B;  1LUV A;  1XMO O;  3AK1 A;  2CH7 A;  4LC1 A;  3M4I A;  2BOC C;  1YTF D;  4KHP O;  1OBG A;  3G4S V;  1Z5V A;  3APO A;  5KKN B;  2HG8 A;  4ZI7 F;  1S0O A;  4HZ3 A;  3VPD A;  3WG7 C;  2UXB O;  1KEE A;  3J80 W;  1I2K A;  2UU9 H;  1WA8 B;  5CA0 B;  1WN7 A;  3G6E V;  3MR2 A;  5FNV A;  2XGP A;  5FNV F;  5KFG A;  3N2K A;  3OFN G;  3OTF A;  1DTO A;  2OT5 A;  1Q6I A;  5L3C A;  4PZ8 A;  1CE8 A;  2JGD A;  4A93 G;  1OCO B;  2UXC H;  2C28 A;  4ABM A;  4TWK A;  3T7A A;  4RNO A;  1Z5W A;  4HN2 A;  2FJZ A;  1V55 B;  2ASD A;  3AK2 A;  1HR0 O;  3BQ1 A;  1PNM A;  4U7C A;  4R8U B;  4MTO A;  5LMN O;  5LOV F;  2CUG A;  1M9N A;  4YIO A;  2CZG A;  5DGB A;  3SYP A;  2WA4 A;  2YEV B;  5IP7 G;  3JAK B;  1HNW O;  2QSA A;  1QVF U;  1N48 A;  4HNA B;  1HDJ A;  5DQH A;  2RGV A;  3ZN1 A;  5LMU O;  3AG4 B;  1Y74 A;  5B3S B;  4EEY A;  2P4V A;  5A2Q W;  4NTW A;  3VQX A;  2E75 B;  1S5L Z;  4BR6 A;  4ED8 A;  2OTJ V;  4DR7 B;  2KG7 B;  4ED2 A;  1NU1 H;  3SJQ C;  5B3S C;  2ZM6 O;  1Q6H A;  3QVN A;  4WFF A;  1IBM B;  1Q81 W;  4TSF G;  1WCM A;  4X65 B;  3U0Z A;  1NS1 A;  3AX6 A;  5KHI A;  5L3F A;  4DV5 H;  2A06 H;  3ZHR A;  2CQY A;  3DXR A;  1TWF A;  4DR7 H;  1THZ A;  4I55 A;  3VNN A;  1SQB H;  5IYC O;  2UUB O;  1OHH G;  1U96 A;  4IYH A;  3VQV A;  3MHH C;  3GIK A;  2DAB A;  3KAL A;  5C8Y B;  4J9S A;  4FU0 A;  2UUA O;  2YIA A;  3ZRS A;  4B3M O;  3D36 A;  4E6N A;  3B2E E;  2VR1 A;  3KHL A;  4JI0 B;  3ZMV A;  1GAX A;  1KP3 A;  2HIV A;  3A0B Z;  2VQE H;  1I94 B;  1JPX A;  4MTX A;  2CTW A;  5JQG A;  1HNX B;  4RUA A;  2WLI A;  1K34 A;  4B3M B;  1O75 A;  4O7L A;  4JI0 H;  3JYC A;  4DV0 B;  4AQY O;  2Q0O C;  1F23 A;  1HNW B;  2EIL B;  4J11 A;  5HFL A;  4BY7 G;  4DUZ H;  3P32 A;  5BR8 H;  1S03 G;  2NVX A;  2HVK C;  3RYC A;  1QCE A;  2HP8 A;  3RR5 A;  2W7P A;  2JK5 C;  2WE6 A;  4DO2 A;  1JCH A;  2JS5 A;  4TV8 B;  2RNB A;  4DR5 O;  4MVZ A;  3FFQ A;  3ORQ A;  4JI4 H;  1QU7 A;  1AN7 A;  3WO1 A;  5BR8 B;  3CEI A;  2DE0 X;  3J81 W;  3SPG A;  3SNO A;  4YAK B;  2W8L A;  3RT3 C;  3T1C A;  2AGA A;  4FLT A;  4D7S A;  3JSL A;  4F6E A;  5KAF Z;  2HVQ A;  4O7N A;  5KG4 A;  5FLM G;  2JEX A;  2ZCE A;  1K83 A;  4DV5 B;  4O2B A;  1RJQ A;  3B77 A;  3C90 A;  4DR7 O;  1WSC A;  4LFC O;  1YHQ V;  2ZIN A;  3W7S A;  3W7W A;  5I5W A;  3FX7 A;  3FKI A;  4RNN A;  4C2M A;  1Z2G A;  1EKF A;  1M6V A;  3L4K A;  5KT6 A;  3UYY A;  4J10 A;  5LA6 B;  1GM9 A;  2GDS A;  2DQ3 A;  4LFA O;  1NQT A;  1WPB A;  1DF5 A;  1JKJ B;  1SFO A;  2W9C B;  2Q0A A;  1BT8 A;  1Q3E A;  1JA8 A;  5LXT B;  1DIK A;  3J7A K;  4PEL A;  5LMU H;  4JAA A;  5LL6 b;  2IU3 A;  4P2Z A;  3UO3 A;  3RYH B;  1QR8 A;  4CMD A;  3CC4 V;  2Z0A A;  1DLB A;  2P67 A;  2ZDH A;  3RYI B;  3ZHS A;  4DAA A;  1H8E G;  4LF7 H;  1U97 A;  4LCU C;  4K0K B;  4ECQ A;  5DGA A;  3ZRX A;  5EZY B;  3S24 A;  4CKC A;  3CXH F;  3I5D A;  1G2W A;  1OCR B;  1GMG A;  2M7W A;  4RAI A;  3P3P A;  1FS0 G;  1JX4 A;  4WFG A;  3V6J A;  1C30 A;  1JR9 A;  2XCA A;  4B7K A;  3KXY T;  1WP7 A;  1W59 A;  5EK0 A;  2P4K A;  4MVO A;  4BWA A;  2A9H A;  1NKD A;  1E79 G;  1BGY H;  1XNR O;  1EN6 A;  2UXX A;  4UB6 Z;  4DL4 A;  1L2Z A;  4LSX A;  1RYS A;  2M05 A;  1YDX A;  1UC8 A;  5CBH A;  5KG6 A;  4DW0 A;  1GLV A;  3J80 N;  5BZB A;  3OTO O;  3T1Y H;  1C3O A;  2YZN A;  1HR0 H;  1KU9 A;  3BFR A;  4L8J A;  3CCQ V;  2DPI A;  4JI1 B;  2Y0S A;  2XAH A;  3QO5 A;  4K35 A;  2FLL A;  5EWG A;  4Q6G A;  1UJW B;  5LP6 F;  1L8D A;  4PA4 A;  3AG1 B;  2R7L A;  4YB8 B;  1YSC A;  3TW7 A;  3RYF A;  3CCS V;  2CNU A;  4HNU A;  3A0R A;  4OXS A;  4DV2 B;  1L0N H;  3FB5 C;  4WCE V;  2YEV A;  3T4D A;  3FMA A;  5KFS A;  4AQY H;  4A3F G;  4B3T H;  5BWV A;  1MA1 A;  4DK0 A;  1KYO F;  4WFB V;  3T9E A;  3HO8 A;  2YRX A;  3EYY A;  4YY3 H;  3HKC A;  1DGS A;  3G6X A;  4DK1 A;  4PDM A;  4ECU A;  3JD2 A;  4F4X A;  3T5K A;  3PR5 B;  1K5S A;  4FFK A;  3JAL B;  3N42 B;  4MTE A;  2QDO A;  3ZIA G;  4YJ3 F;  2W6M A;  1TUE B;  5KG2 A;  2LQT A;  2R9I A;  3RBZ A;  5IJ0 A;  3H1I H;  2HIX A;  3K08 A;  2BSK B;  3VMM A;  3L4J A;  3KAJ A;  3HB3 B;  1M0T A;  1WA8 A;  3ICX A;  2JDI G;  3ZS8 C;  3SYA A;  5CBF A;  4GX5 A;  3E8G A;  2OCC C;  1Q90 D;  3K5L A;  4I0X A;  4ZOL A;  2QKS A;  3H40 A;  4A3L G;  5C93 A;  2CW8 A;  1OJH A;  4LNU B;  4HR7 A;  2YW2 A;  4W4K A;  3TII A;  4WBN B;  1AJN A;  4LP8 A;  5C8Y A;  2C2E A;  2R8J A;  3AW8 A;  2KQX A;  4BIZ A;  2C2R A;  4NZM A;  4R7R A;  1CS0 A;  5B5E Z;  4G28 B;  1I7N A;  4RB0 A;  1YF2 A;  4H13 B;  3C3S A;  3OTO B;  3FDS A;  2ZR3 A;  1IBK O;  4J41 A;  2C35 B;  5DLF A;  5D1O A;  4JV0 A;  1MZE A;  1M57 C;  4JV1 A;  1WRV A;  3ZMU A;  2R8G A;  4JXU A;  3M9N B;  2QK4 A;  3PW5 A;  1FFX A;  3P3N A;  4ZBM A;  2QM7 A;  1AIL A;  1AUX A;  4O83 A;  3H0G A;  1ZTE A;  2ODT X;  3CME V;  1RK5 A;  4I50 B;  1GM7 A;  2OCH A;  4AYB E;  5KFK A;  1K1S A;  5IP9 G;  2F1M A;  3KG2 A;  1R3K C;  5BWT A;  2B63 G;  4K0K O;  2IP4 A;  5BYA A;  3GTM A;  2PF4 E;  1W2B U;  1GSH A;  2GTS A;  3BY6 A;  4CH4 A;  5I5S A;  2ADP A;  2E2I A;  3N6R A;  3BG5 A;  3G80 A;  2R70 A;  1N32 H;  4XDJ A;  3AG1 C;  4A3J G;  4FM9 A;  3GTQ A;  4DR6 B;  4ICG A;  4X8A A;  3CQZ A;  1GN3 A;  2Q73 A;  2YRW A;  4FS2 A;  4ZQI A;  2YSU B;  5KFL A;  4HAM A;  4J80 A;  5IYC G;  1KJQ A;  2UXC B;  2QJ1 A;  1EUD B;  3G8D A;  4PZ6 A;  1XOU A;  3SJB C;  3T1H H;  4FM2 A;  3JZ6 A;  3MJF A;  2W6O A;  3QF7 A;  3AEI A;  4QWD A;  5GON F;  3RVZ A;  2DZD A;  1T5E A;  4X62 O;  3RYH A;  2B1I A;  4O4H B;  4LFC B;  4JI6 O;  4FLX A;  4DV5 O;  1FXK A;  1BSM A;  4ED1 A;  2DYR C;  1VQL V;  5JVL A;  1CQJ B;  2YS7 A;  5KS8 A;  4BWS C;  5CA0 F;  1SKV A;  2BR0 A;  5IJ0 B;  2JJ1 G;  5B1N A;  5LGN A;  2HHF A;  5CB4 F;  1BCC H;  1M56 B;  4JAU A;  4NTY A;  3IN5 A;  4ED3 A;  3CXC U;  2YUA A;  2DWE C;  2VUM A;  3RBE A;  3PFF A;  3SPJ A;  3PW7 A;  4I50 A;  1TUB B;  2IJK A;  2Z02 A;  5LP6 B;  1PV0 A;  4TUY F;  4FGR A;  4DR1 O;  5KFN A;  3HR0 A;  1OCO C;  5KA5 A;  5LOV B;  3RYF B;  5IWA O;  2VQF O;  5DED A;  1UC9 A;  1NT2 B;  1BXR A;  1VEW A;  4X88 A;  2DJV A;  4U7N A;  4ECS A;  3OHB A;  3CRA A;  4Z1V A;  5J2U A;  4CS2 A;  2WLH A;  4DV6 B;  1JXL A;  1KC8 W;  1G4Y B;  1I6U A;  2COG A;  2HFE C;  2FK3 A;  2L35 A;  2HHH O;  3RW0 A;  5IYD G;  1EN4 A;  3FAV A;  2E76 B;  4NXN O;  2BQR A;  2PMZ A;  3BHP A;  2ZIM A;  1I5X A;  3BRC A;  4I5S A;  1XQ8 A;  5KFW A;  2QM8 A;  1SF9 A;  2IBK A;  4PDB A;  4PA6 A;  1N8R W;  2GLT A;  1PL0 A;  2LFR A;  1H8H G;  3OAA G;  4JI8 H;  5IT9 N;  2CE4 A;  2G38 A;  4DR2 O;  4CC5 A;  1NH2 D;  1ZX3 A;  2XCP A;  1P4R A;  2Q69 A;  2LJ2 A;  4J42 A;  4ECV A;  5BYB A;  3JD4 A;  3QNE A;  3JRW A;  2YZM A;  3AG3 C;  3TGU H;  2X6C A;  4I0X B;  2GPS A;  2Q7G A;  3IJ4 A;  2DYS C;  4ZI7 A;  3ETE A;  1VBG A;  5JQG F;  4O4L B;  4JI5 H;  1NTK H;  1URF A;  3DAA A;  1N0J A;  3LSQ A;  1XMQ H;  4O2A F;  1TWG A;  5KHJ A;  1IX9 A;  4UXN A;  4B08 A;  1OWT A;  2FKX A;  2R9R B;  4CH6 A;  2WAQ A;  3E5N A;  1PNK A;  3T5L A;  1XHX A;  1S3J A;  4I4T B;  2FLN A;  4DV6 O;  2C2A A;  3T5H A;  1QBZ A;  4Q8E A;  4J9N A;  3LML A;  3GTG A;  1IZ3 A;  1WNS A;  4NKG B;  1KKD A;  3W7X A; 
#chains in the Genus database with same CATH homology
 1D5A A;  3RYI A;  3C0F B;  2P5O A;  5CA1 B;  5D1O B;  1CKO A;  4TQD A;  5LXT A;  1O9G A;  4TQF A;  4X20 B;  3RGB A;  4DR6 H;  3GDE A;  1XNQ H;  3UQ8 A;  1IBL H;  3M4I A;  4JI6 H;  1N33 B;  3JAT A;  2UXB H;  4O4H A;  1Z5V A;  4YJ3 A;  2UUB B;  5ITZ A;  2KKW A;  5K1X A;  4X62 H;  4DR2 H;  4RB3 C;  1FJG B;  3W1G A;  4JYA B;  3N41 B;  4KHP H;  3J80 W;  4B3R B;  2UU9 H;  2UXB B;  1N36 B;  4O4J B;  5CA0 B;  1Q43 A;  3TY8 A;  1J5E B;  4JI8 B;  1WN7 A;  4O2A B;  2Q7E A;  5CB4 A;  2HEP A;  4JI7 H;  1FJG H;  5FNV A;  4DV3 H;  1JFF B;  2R72 A;  4K0K H;  4LF6 B;  3N2K A;  3OTF A;  4LF9 B;  1HNZ H;  2UUC B;  5LP6 A;  4PZ8 A;  2E5L H;  3KYH C;  2VOB A;  1XNR H;  4EFB A;  3RJ0 A;  2UXC H;  5J2T B;  1Z5W A;  5JJE B;  5IWA B;  2VQF B;  5EYP B;  4LF8 H;  3N43 B;  3RTX A;  1HW7 A;  3IG0 A;  4I7H A;  3JAK B;  3DSQ A;  4OX9 B;  1E4G T;  2F4V B;  2PYL A;  4LFA B;  4HNA B;  4NXN H;  2RGV A;  5KMG A;  4F6R B;  4CH3 A;  2YIB A;  4UCO A;  1ZHS A;  5ITZ B;  5A2Q W;  4JI1 H;  3VQX A;  4LH6 A;  4DR7 B;  3K57 A;  4DR4 H;  1IBK H;  4YHH B;  3WB0 A;  1IBM B;  3N40 P;  1XNQ B;  4FVM A;  5IJ9 A;  4DR1 B;  4IAJ A;  5FLX W;  4X65 B;  3U0Z A;  4CS3 A;  5KHI A;  4DV5 H;  2GV9 A;  4FLY A;  1E4F T;  4DR7 H;  4DR2 B;  4I55 A;  4LF7 B;  4ZHQ A;  3VNN A;  4X66 H;  1P16 A;  5LYJ B;  4CH5 A;  4M7E A;  3VQV A;  2WYO A;  2Q2U A;  4LNU A;  3DF7 A;  3KAL A;  2Q2T A;  5BMV A;  2VQE B;  4AQY B;  1XK5 A;  1XMO B;  2BTQ A;  1A0I A;  1I7F A;  5C8Y B;  5GON A;  3H20 A;  3JAW B;  4LF5 B;  2YIA A;  1M93 A;  4MV9 A;  3HKD B;  1M4U A;  1ZAU A;  5FPR A;  4HNA A;  4E6N A;  5JJN B;  3B2E E;  3U10 A;  4X1Y A;  5KHH A;  3K5O A;  4JI0 B;  3M7M X;  4DV0 H;  1YEW A;  1N33 H;  2HIV A;  2VQE H;  1Q5O A;  1I94 B;  1Z2P X;  5JQG A;  1HNX B;  2ZNJ A;  2RJZ A;  3MWM A;  4B3M B;  1O75 A;  4JI0 H;  1B04 A;  1KMI Z;  4LR3 A;  4DV0 B;  1VS0 A;  5FD6 A;  1JMK C;  2XIG A;  4KL1 A;  3E22 A;  1HNW B;  4DUZ H;  1S03 G;  5BR8 H;  3LNN A;  3RYC A;  4DR5 H;  3RR5 A;  2YI8 A;  3RFR A;  4LFB H;  2VWJ A;  4AHC A;  2WE6 A;  3RF2 A;  4LF6 H;  2JS5 A;  4TV8 B;  4FFB B;  1XMQ B;  3FFQ A;  4JI4 H;  1AN7 A;  5BR8 B;  3J81 W;  2O03 A;  4FLT A;  3TY5 A;  4GYC B;  4D7S A;  3JSL A;  2HVQ A;  4O2B B;  4K8Z A;  5FPO A;  3ZED A;  3QWU A;  2ZCE A;  2PY5 A;  4DV5 B;  1SA0 A;  4O2B A;  5FNV B;  4DR1 H;  2ZIN A;  2F93 B;  1BJT A;  4TOI A;  4X1K B;  4X65 H;  4LF4 B;  2QM4 A;  3CVZ A;  4X1I B;  4IHJ A;  3L4K A;  4GKJ B;  4PHZ A;  4ETS A;  4DRX B;  4EFE A;  1TUB A;  1BGW A;  5LA6 B;  4WBN A;  4JV5 B;  4LSA A;  2OYQ A;  4HBN A;  1WPB A;  3T1H B;  4J0M A;  3JAK A;  2CW7 A;  2Q0A A;  4FLU A;  1FKA H;  4PI0 A;  5KHK A;  1Q3E A;  5LMN H;  5LXT B;  4LF5 H;  5LP6 C;  5LMU H;  3J7A K;  3UT5 A;  2HHH H;  4APM A;  3W1B A;  2WDT A;  5LL6 b;  4JV5 H;  3RYH B;  4RB2 C;  3JAT B;  2Q7H A;  4TUY A;  3JAL A;  4LF8 B;  3RYI B;  4JI3 H;  2IM9 A;  4LF7 H;  4K0K B;  1ZHQ A;  5EZY B;  2YCH A;  3S24 A;  1SEI A;  3GB8 B;  2UUC H;  5DIS C;  1SYX B;  2VUG A;  4A2A A;  4JI3 B;  3BA9 A;  3K5N A;  4IIJ B;  5D1P A;  4EEQ A;  3KXY T;  2ZIO A;  3N6X A;  4B3S H;  4BWA A;  4X64 B;  1O9H A;  4UCV A;  4LFC H;  3HXL A;  1L2Z A;  4LSX A;  4KHP B;  4DRX A;  3GJX B;  4DR4 B;  2JVD A;  2CFM A;  4JI4 B;  2UUA H;  3F8N A;  4BW9 A;  3WB2 A;  1HNX H;  3T1Y H;  2W57 A;  1HR0 H;  1V9P A;  2RGR A;  1KU9 A;  4L8J A;  1XI1 A;  3BPZ A;  4NXM H;  4JI1 B;  1TVK B;  5JVD B;  1S5J A;  3HKD A;  4Q6G A;  5FD5 A;  1L8D A;  2XHB A;  3RWR D;  5JCO A;  5IWA H;  4EB6 A;  2VQF H;  3RYF A;  3JAR A;  4FM0 A;  4DV2 B;  3FMA A;  4AQY H;  1XMO H;  4RAY A;  4PZ7 A;  2PYJ A;  4B3T H;  4DK0 A;  4TV9 B;  3WB1 A;  3EYY A;  4RB1 A;  4CS4 A;  4YY3 H;  2HGS A;  3HKC A;  1DGS A;  2YXL A;  2P22 C;  4DK1 A;  2UXD B;  3MAQ A;  3JAL B;  1N36 H;  3N42 B;  4MTE A;  1TAE A;  2PZS A;  2OWO A;  4JI7 B;  4JI6 B;  5IJ0 A;  4YY3 B;  4O4J A;  5CA0 A;  2HIX A;  2ZM6 H;  4K8X A;  3L4J A;  3KAJ A;  1CKN B;  1M0T A;  3ICX A;  4DR5 B;  4U3J B;  3N2G A;  1XNR B;  1CKN A;  5KX5 B;  3ZS8 C;  4X1K A;  1Q8I A;  1H2S B;  1SQG A;  4RAZ A;  1SA0 B;  3U11 A;  3K5L A;  3BAB A;  5JCO C;  4ZOL A;  2HVS A;  4MV7 A;  4ZOL B;  2CW8 A;  1VF7 A;  5JQG B;  4LNU B;  1HNZ B;  1G6U A;  4DV7 H;  2F4V H;  3L2P A;  5LA6 A;  4WBN B;  1M5I A;  5D5Q A;  3JAM W;  3UT5 B;  5CA1 A;  3IAY A;  5C8Y A;  4AIL C;  4F6R A;  3T1Y B;  2PTM A;  3RYC B;  4RZQ A;  4R7R A;  4GKJ H;  1XHZ A;  4UCU A;  5KMG B;  4RB0 A;  2ZNI A;  2BTO A;  3OTO B;  4FLW A;  4TUY B;  4LMY A;  1X4T A;  5D1O A;  2ZJT A;  4JI5 B;  4X20 A;  3BA8 A;  1Z2O X;  4O4I A;  4GLX A;  5EZY A;  1FFX A;  3QG5 A;  2F95 B;  3RIZ A;  1TA8 A;  2RQ6 A;  3N2K B;  1IBK B;  2PGG A;  5JH7 B;  1IBL B;  4ZI7 B;  3VQW A;  4I50 B;  2UXD H;  5JH7 A;  2F1M A;  2ZM6 B;  5IYZ A;  3SJC C;  4X62 B;  1CKM A;  5IYZ B;  2BTQ B;  4O4L A;  4CH4 A;  3HKB A;  3K3V A;  5EOY A;  2YIB D;  4DUY B;  2R70 A;  2KSW A;  4DV2 H;  4DR3 B;  1N32 H;  4FM9 A;  5JVD A;  4DR6 B;  5KHG A;  3ETQ A;  1QQC A;  5IT9 W;  4FM1 A;  3A2F A;  4UFZ A;  2F66 C;  4IHJ B;  4I4T A;  2MCT A;  1MZB A;  4YJ2 B;  1TVK A;  4DUY H;  4LF9 H;  4YJ2 A;  1HNW H;  4LH7 A;  3JSN A;  2QJ1 A;  2E5L B;  2UXC B;  3VQY A;  3SJB C;  3K59 A;  4PZ6 A;  4FM2 A;  3T1H H;  1HR0 B;  3JAR B;  1TGO A;  4DV7 B;  4MTD A;  3QF7 A;  3W5O A;  4DV4 H;  4X64 H;  1T5E A;  3RYH A;  3SR2 C;  3NBY B;  4O4H B;  4LFC B;  4IIJ A;  4FFB A;  4FLX A;  2V4D A;  1RSO A;  2UUA B;  4ZHQ B;  4BWS C;  4YJ3 B;  2R9A A;  1SKV A;  4GKK B;  1X9N A;  3K5M A;  5IJ0 B;  1SQF A;  4O4I B;  3JAS B;  1P8L A;  1Z2N X;  1JJO A;  3TY9 A;  1XDN A;  2UUB H;  5KX5 A;  2PUS A;  3CSX A;  4X1I A;  3SGI A;  4B3S B;  3K58 A;  4I50 A;  1TUB B;  3BAA A;  3QTC A;  2FE3 A;  4JI2 H;  4PI2 A;  4DV1 H;  5EYP A;  5LP6 B;  5LMN B;  4I9Q A;  1N34 H;  4B3T B;  4DV6 H;  5LOV B;  4LF4 H;  4B3M H;  3RYF B;  3OTO H;  3HKB B;  3RGZ A;  3PN1 A;  1NT2 B;  5LOV A;  4DR3 H;  4DV1 B;  3JAW A;  5J2U A;  4TV9 A;  4CS2 A;  1S68 A;  4DRF A;  4DV6 B;  1FVI A;  1WH2 A;  4UCS A;  2VPS A;  1I6U A;  3KAK A;  4JYA H;  5JJJ B;  3BHP A;  2ZIM A;  3BRC A;  2EX3 A;  1XQ8 A;  4X66 B;  4PDB A;  4FLZ A;  5EIB D;  2UU9 B;  4B3R H;  5IJ9 B;  4DV3 B;  1I94 H;  1FFX B;  3E22 B;  2JGU A;  1J5E H;  4JI8 H;  4UCR A;  5EIB C;  3JAS A;  5CB4 B;  4D7T A;  4U3J A;  3HKC B;  1QHT A;  4A2B A;  4CC5 A;  4I55 B;  3CHX A;  2HVR A;  3RGX A;  4TV8 A;  1N32 B;  5LYJ A;  4ZIB A;  5K1P A;  4NVP A;  3NC0 B;  3NBZ B;  2E3C A;  4LFB B;  5J2T A;  2Q7G A;  2CAZ C;  4CC6 A;  4ZI7 A;  4YHH H;  4GKK H;  1IBM H;  1GYF A;  4JI5 H;  4O4L B;  5BMV B;  4FLV A;  1P49 A;  4O2A A;  3SJA C;  1XMQ H;  2YI9 A;  3N2G B;  5GON B;  5KHJ A;  4B08 A;  2VWK A;  4NXN B;  1JFF A;  4LFA H;  4CH6 A;  3HKE A;  5LMU B;  4Q0Y A;  2HHH B;  4EQ5 A;  3THO A;  4OX9 H;  3HKE B;  5J2U B;  1XHX A;  4I4T B;  3CB2 A;  4DUZ B;  4DV4 B;  4JI2 B;  5D5P A;  4EB6 B;  4X1Y B;  3N44 B;  4UCT A;  1N34 B;  3LML A;  1M0W A;  1WNS A;  4NXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...