4UCRA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
317
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 91
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucrA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucrA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucrA02
3TY5A 4CC6A 4DV5B 2HVQA 4UFZA 4LFAB 2UUBB 5LMNB 3PN1A 2Q2TA 3QWUA 1CKNB 2VQEB 3RTXA 4B3TB 1N33B 3NC0B 4LF7B 4E6NA 3GDEA 4OX9B 1X9NA 4DV0B 2E5LB 4LFBB 3OTOB 3W1GA 4AQYB 1A0IA 1TA8A 5FPOA 4GKJB 4DR2B 3BAAA 3JSLA 2HVSA 4EQ5A 4DR6B 2UUAB 4YHHB 5D1OB 2HIVA 1XK5A 3NBZB 2CFMA 4DV7B 4DR4B 4LF8B 4JI0B 4DUYB 1HR0B 3BABA 5BR8B 3BA9A 1CKNA 1VS0A 4UCUA 3TY8A 3SGIA 4DR7B 3TY9A 2ZM6B 4DR1B 4LF4B 4YY3B 1B04A 3T1HB 1XMOB 3GJXB 4TOIA 4X66B 4LF5B 5IWAB 1CKMA 4PZ6A 1FVIA 3VNNA 4PZ7A 1XMQB 1N32B 2HIXA 5FPRA 4DV3B 1DGSA 1I94B 4GLXA 5DISC 2VQFB 4KHPB 4UCOA 5D1OA 4JI6B 4B3RB 4DV6B 2HHHB 4JI2B 1HNXB 4PZ8A 2UU9B 4JI3B 4EFBA 4DR5B 5LMUB 4JI8B 4UCTA 4LF6B 4NXMB 3L2PA 3GB8B 1P16A 1TAEA 4DV4B 1CKOA 4B3SB 4K0KB 4JV5B 3BA8A 3UQ8A 4X65B 4JI5B 3JSNA 4GKKB 2UUCB 2UXCB 1XDNA 4B3MB 4DV2B 3NBYB 4X62B 1XNQB 1N34B 4LH7A 4X64B 4DV1B 1IBLB 1XNRB 4LH6A 4LF9B 4JYAB 1IBKB 1V9PA 4EEQA 2F4VB 4CC5A 4NXNB 1ZAUA 3RR5A 4DR3B 4DRFA 3KYHC 1HNZB 4UCSA 4JI4B 2Q2UA 4DUZB 2UXDB 1IBMB 2HVRA 1S68A 4UCVA 1J5EB 4EFEA 1N36B 5D1PA 3S24A 4UCRA 4LFCB 3W1BA 4JI1B 3W5OA 2UXBB 2VUGA 3T1YB 1FJGB 1P8LA 1HNWB 2OWOA 4JI7B
chains in the Genus database with same CATH superfamily
3T54A 4D7SA 4U7CA 1KKCA 1A3GA 4FPPA 5KX5B 4UVCA 2YZGA 3OM3B 5C8YF 2C22A 2R86A 2UVUA 1QVFU 2HVKC 5KFQA 2ATLA 5JQGF 1I08A 4DR4H 2EZOA 3LDCA 3U11A 1PD3A 4PJ0Z 1P49A 2AHYA 4NXNO 3JZIA 1VQOV 4HN2A 4FBTA 4Q6GA 5L1LA 2COIA 1OJHA 4NZOA 3FMAA 1IOWA 1VKZA 1I3QA 1K8AW 1I7FA 4EYIB 2OYQA 5KT4A 2R85A 2NN4A 1RSOB 1XK5A 1RK5A 5LP6B 3RJ0A 1BGYH 2A0LA 5B1BB 1V55B 3L72H 3MWEA 4WBNF 1SZXA 2IBKA 1Z5WA 3T9CA 4TQDA 1Q43A 3ZJZA 2FLLA 4TOIA 3AK1A 2PN1A 2R84A 3VA7A 5KFSA 2A9HA 3MR3A 2W6IG 4FFBA 4Q44A 5GONB 4O4HF 4GLXA 4C7UA 3RGBA 1OCOC 2DLNA 1AP5A 5KLVH 3L74H 4I55A 4A2AA 1URFA 3QZ8A 5DLFA 3M9MB 5KFZA 3LMLA 1R73A 2K9PA 4JYAH 4IGGA 4LNUA 2JJ1G 3DAAA 4J9RA 4J9NA 4DV5O 1XDNA 4NYEA 4DV7O 1I5YA 1F7YA 2HHFB 4LH7A 4X64B 3JRWA 3OR6C 2YUAA 4TQSA 2AU0A 3JALA 4LH6A 1H2NA 5J2UF 2WLLB 1JA8A 1Y1WG 1IX9A 3J7AU 4RB3C 2JRIA 4UCSA 4JI4B 1M5IA 3JAMW 4MA5A 4QWBA 5KAFZ 4PHZA 3KKYA 5KFLA 3MJFA 2VRZA 3SYCA 2ZE8A 1H2KA 3MWMA 2HG8A 1GSAA 4ECXA 1Z2GA 2HGWA 4JI0O 4J9OA 3ETQA 2LJ2A 2CGOA 2R93G 3H1JH 1Q86W 1QBZA 3KAJA 5IYCG 4TQRA 4JPRA 4ED2A 4FZ0A 3AG4B 3DXRA 2QTOA 4QNHB 5C5JA 4GKKO 4O4IB 4B3TB 1N33B 5I5YA 1S72V 2E5LB 3OTOB 2F1MA 2HGSA 4KHPO 2ALZA 3HKDA 2ZNJA 2W7PA 3A0BZ 5KUMA 4DLKA 3L75H 4I5SA 5DQIA 4LF4H 1OV9A 1YXBA 5KG5A 5IJ0B 5L1IA 4J9YB 2XD4A 2ASJA 2YIDA 3JD2A 2P4KA 5DGHA 1BE3H 1S5LZ 2JEGA 4UV9A 3G6EV 2COGA 1XMQH 4F4XA 2LGQA 2HJWA 2GQRA 2EJ0A 2ZM6B 3FB8C 2Z5UA 4WF9V 4DIMA 5BPHA 4IHJB 3AG1B 5FL7G 2YRXA 5F9LA 4GYCB 1CKMA 1DAAA 3SPGA 2CW7A 3QVNA 4IIJA 4ABMA 4I0XB 4PZ7A 5EOYA 1EZ1A 4ED0A 1DGSA 3DF7A 1I1LA 3K3WA 3HB3B 4X65H 2Y4TA 3GTOA 1UPGA 1GTOA 2N05A 1WCMG 3F5TA 1K4CC 4O2BA 2XAJA 4O4LB 1EN5A 1IBMO 2HHHB 4F4ZA 3ABMB 3GWKC 3H1LH 4MV9A 3ABLB 5IP7G 3RVYA 5LMUB 4FK5C 4C5BA 3Q8SB 2RDJA 3UO2A 3E35A 2QGNA 4CH5A 5C44G 4RB2C 2HG5C 4JI5B 2DWEC 5C1PA 1SS3A 4Q8FA 2ITDC 3HKEA 1M90W 4X8AA 1N8RW 3CX5F 1FKAO 5C3EG 2F95B 4LFAO 3WWJA 4X62B 1Y1VA 2YXHA 1YSCA 1KUTA 2Q7EA 3T9DA 2OIGA 1JJOA 1RM1B 1JX9A 4OX9O 1D5AA 4O3RA 1ZX3A 3TXSA 4DR3B 4JAVA 4U7NA 1YJ9V 3RBDA 3BG5A 1EM1A 1GK9A 1V54B 3W7TA 4MTOA 4OXSA 1Q5OA 3RGZA 4QJFB 3JD0A 4I55F 3PR4A 2J6TA 2FMLA 2QWOB 1FJGB 4DUYO 1MZBA 1IXMA 2RQ6A 3G71V 2KG7A 3K03A 1CPYA 1OBDA 2E75B 3WO0A 5KFUA 5LL6Y 4MTDA 3GIKA 3UKMA 2V9WA 4MW8A 4GKJH 5B3SC 2W9BB 4K8XA 1NVPB 3GDEA 2NU8B 5I47A 1UJWB 2FK3A 4UUJC 3IGAC 4DV1O 2CE4A 3H0GG 4DV3O 3MR6A 3HBLA 1HR0H 5DAAA 3PW5A 1C3OA 5FR9A 2O03A 3H40A 5JH7B 4ICGA 3GTGA 4EQ5A 1RJRA 4GX0A 3ZHVA 2UUAB 4BY1G 3OT7A 2CNQA 4LSAA 3I55V 3T5LA 2L35A 2FB5A 3OSPA 1NS1A 3O9OA 3CCQV 3OEEG 3T2MA 5H9CA 4EB6B 3GTMA 3WWHA 1JVMA 3R66A 2YW2A 1L8DA 4RWUA 4KP4A 3RBEA 2N04A 1R6KA 3PW7A 1WA8B 2LGWA 5GONF 5JWPA 1ZETA 2QSAA 4X66B 2BE3A 2A3QA 4FBUA 2O57A 2Y48A 5KA5A 4PA4A 1VIBA 4RO2A 3VNNA 4JI3H 2KKWA 2DABA 3WWIA 1HNZO 4WFAV 1K7DA 3FKSG 4B3SH 4TWKA 4YIPA 2DN9A 2VQFB 5CA0A 2X6BA 4LFBO 4FS1A 1TWAA 5JVDB 2X7RB 4H44B 5L3BA 2LW1A 3LULA 1MG1A 3RUPA 1F51A 3BY6A 3X2QB 2RN9A 4ZOLB 2AQ4A 5CA1B 1AI6A 2XAQA 2UXCB 1IYEA 3VPDA 3V6HA 4B3MB 4GUNA 4PA3A 4PBCA 3ZBHA 4RCNA 1AB3A 3K5NA 3CC2V 2Q0AA 2XAHA 2Q9LA 3R65A 2VWJA 1KJ9A 2IW5A 1FPOA 2R7LA 1N36H 2BCCH 3IJ4A 3FB6C 4LFCH 4NXNB 1Y76B 4IT5A 4HNAB 1WNSA 2IA6A 4RUAA 3RYFB 1ZSPA 3BPZA 5H6QA 5LL6b 3MWDA 4IIJF 4NZMA 3UT5A 3JAWA 2DYSC 3A0HZ 1I50A 3SJQC 3H1HH 4DUZB 2V59A 4Q4DA 2UXDB 2F66C 2P6JA 3K5MA 3GB7C 2AW9A 4O2BF 2ZT9B 3B4SA 2GPWA 2P0AA 1KB9F 2GSMB 1KECA 4O4JA 2QJ1A 2UU9O 1OCCC 5CB4A 3N2KA 4O4IF 1CQJB 4DR5O 2EIJB 1VQ6V 2ITCC 4RZRA 2JEXA 1S5JA 3G6VA 3E2EA 2DQ0A 4NVPA 3LWBA 4YJ3B 3GTQA 1M0WA 4O83A 4LWSB 1IBLO 2DOSA 3Q8QB 2DQ3A 3W1GA 2GQSA 2R7ZA 3OGIB 2YIBA 4RQEA 2XCPA 1XHZA 1ZHSA 4GX5A 1BQZA 4D6TH 3CXHF 3M7MX 3MDSA 4BW9A 1PL4A 3KCYA 4R8UA 1B06A 3JAMN 2KQXA 3K9AA 2AZ2A 2IBZH 4FJCC 2HIVA 5LOVA 3FD9A 5IWAH 2QE7G 3HO8A 4DV7B 3CSWA 4E2LA 2YZMA 2A79B 2YZNA 3BABA 1KC8W 2VPQA 5KFBA 1JCHA 4ZI7A 2PYJA 3AG2B 4F4LA 2Q67A 1KBLA 3T9EA 1RK6A 1B04A 3T1HB 1SCUB 5DG7A 1XMOB 1CE8A 3GJXB 4C5CA 2NVYA 3IAYA 3L70H 1Y6XA 2YEVA 3K06A 1TWCA 5C8YB 4LF6H 2X5RA 1N32B 2RGRA 5IT9W 1I94B 1GN3A 2M05A 5JQGB 3TQTA 1WP7A 5D1OA 3BVOA 2NR5A 2YS7A 2WLNA 5BWXA 2JA5A 2AGAA 2Y4RA 3RYIB 2ODTX 4JI8B 5B5EZ 1P16A 4LF9H 4WFBV 4JV5B 1TUBB 1SA0B 5EIBC 5L3CA 4YHHO 4MTGA 2IJIA 2EZPA 4GKKB 3RBZA 2UUCB 3SE7A 3LUTB 4WBNB 4PDVA 1FXKC 4DXWA 4J10A 1EUCB 2OTJV 4WCEV 2COJA 4RZQA 4RUEA 5IJ9B 1N33O 3TEKA 2E5LO 1QLNA 2F4VB 1BL8A 4JI1H 1MSWD 3OTOO 2B1IA 2EJRA 1N4CA 3R5XA 4FFNA 4QIWA 3G8DA 3E89A 3FX7A 4TV9A 1I2KA 2FP4B 4YJ2A 1Y74A 4CZZA 4AI8A 1XILA 2CUGA 5J2TB 3T7AA 3Q1KA 1OCOB 2Q7HA 4IWXA 5BWWA 5CA0F 2CK3G 2ATKC 3B77A 1I7NA 3ZIAG 4ZBMA 2E3CA 2VUGA 3RWRD 1HNXO 1M57C 4LMYA 2F23A 4O3PA 5KG0A 1TGOA 2Q8VA 1SKVA 4XZ3B 4K3AA 3R9RA 1YDXA 1L2ZA 2Q7GA 1AI4A 2IMWP 3E22B 2Q2TA 3A2FA 3AK2A 2CTQA 3O65A 3RT3C 4LF7B 3ZN1A 3ETHA 4RAIA 5J2UB 2DZDA 5BYBA 1RFYA 4UVAA 5LGNA 2A7WA 4QPJA 3ZCCA 4YAKB 2Q7DA 1EZVH 4JZGA 4Q4CA 4DR2B 1WR2A 5LYJB 2HHHO 2DIKA 5CN0A 2AGPA 4DL5A 2V4QA 1RYRA 5LMUO 2YRWA 3IC7A 4LF5H 4J9ZB 3NBZB 5KFKA 4ZHQA 3BFRA 2X6AA 3A8TA 3PVXA 2BSKB 4JI5O 2ZE5A 3FAVA 5L9XA 3FKIA 3PR5B 5KMGA 3T1YO 4O4JF 4X62O 2GV9A 4FLWA 3ICXA 3ZMTA 5CB4F 1M93A 3J81W 3DTUB 1B6RA 2WSSG 3MHSC 3ETJA 4Q45A 1KP3A 3SPHA 4PZ6A 1IVSA 5E1AC 4EG0A 4DR3O 1BJTA 1AP6A 1BHAA 2DAAA 4K0KH 2FJZA 4EGQA 4O7ZA 3RYCB 2DWCA 3JATB 2ZDHA 5BXZA 3V4ZA 2EIMB 4TQFA 5JJJB 1B6QA 3LQSA 2VA2A 2ARHA 4JASA 3N27A 1XNRH 4F50A 1FJGO 2ZR2A 3VOTA 3BA8A 3ASNC 3K3PA 3JASB 1R1BA 5LOVF 2R92A 4RUCA 1GN4A 1N34B 5EDWA 2P4VA 3RW0A 4DV1B 2IU3A 4DR7O 4ZI7F 3GQCA 1J5EH 3H4BA 2JS5A 3BEHA 2F93B 3GIMA 4L87A 3QTCA 4X1YA 1BNCA 2QWNB 4PI0A 2WLIA 4HBNA 5IYZA 2HJDA 1VF5B 1BHBA 2WLMA 4MA0A 4DYLA 2WE6A 2I80A 4L1KA 1DK1A 2B63G 1JFFA 2CGNA 4J7ZA 2UUAO 2VQEH 4BWAA 2R8KA 1S0OA 4BY7G 5DEDA 2DMXA 5DECA 2UXNA 5E25A 2GTAA 4A3MG 1EBOA 2JDIG 3OFNG 1UFIA 2OWOA 4YJ3F 3AG7A 3DGEA 3STZC 1AR5A 1JIHA 1ULZA 4AQYH 5EYPA 3LSQA 2W6QA 1QU7A 3W7UA 4X66O 5K2MA 3T99A 2XGQA 3BQ0A 3UCSC 4X88A 3WO1A 5FNVA 4LFBB 4DR6H 3ZEDA 2ZDGA 3G6XA 3CD6V 5KFVA 5CMUA 2HKOA 4LF8H 2VQFO 2VR1A 3EHBB 3OR7C 1KEEA 4IR1A 3D3IA 4FFBB 4X20A 1W0KG 4I4TA 2A1HA 4TV9F 2JS3A 1N56A 1NVPD 2XAFA 3CWBH 2X0LA 5IY5C 3L9DA 4I55B 3OUZA 5BR8B 3TY8A 3TIIA 4ED8A 2IM9A 2LQTA 4KL1A 4J9KA 4R7RA 2ZCEA 2UXCO 4OPAA 4CH6A 3MAQA 4B3MO 4LNUB 4NTYA 1HNWO 4B3RH 3L71H 4PDRA 4Y8VB 4JI2H 3BHPA 5H2FZ 1BCCH 2MCTA 3TXQA 5B3SB 5LMNO 3LDDA 1VBHA 4GX2A 3RN4A 4DV4H 3J7AK 1K83A 4Q20A 3JALB 3WB0A 2Y69B 3R23A 4DUZO 5L3EA 1YZBA 2UXDO 2FKXA 1G6UA 3LNNA 2ZE6A 3T9AA 3APOA 4FLXA 2UU9B 3EPGA 4ETSA 1OBGA 1I1KA 4DR5B 2EULA 2GUZA 4MVRA 4FU0A 4XX0B 3PO3G 1US6A 2Z3YA 2KSDA 3CSXA 5K1XA 3JSNA 5A2QW 1LNQA 4DL4A 3SYAA 4X89A 5L3DA 3ZRXA 4H37A 1IBLB 5KFTA 3PW0A 1THZA 2JEUA 4DK0A 4FM1A 1A0GA 5J2TF 4CMDA 1XEQA 3PZPA 1V9PA 1L0NH 3SYPA 2JEFA 3ASOC 4DRFA 3DXRB 1DV2A 5B1AB 4ASUG 3OUSA 4ED7A 3CRAA 4LR3A 4TT3G 3K04A 4A5UB 4DO2A 3JZ6A 1QLEB 2HFEC 2HEPA 2FYUH 4IYHA 1MOFA 1R3LC 4DV5H 3KCXA 5IT9N 4JYCA 1B3QA 1NKDA 5IYBO 4FFRA 3V4SA 1YVWA 4MV3A 2Q69A 3S24A 1W2BU 1KYOF 3HKDB 5IYDO 2R70A 4PWQA 5KFMA 5BMVA 1J95A 4N23A 2UXBB 5CR5A 3T9FA 3MD0A 5LA6A 1SF9A 3LSSA 4XBFA 2ASLA 1T36A 3UFXB 2ZXWC 4JI7B 3LSUA 3RGXA 2W57A 3RV4A 2CKZB 4DW1A 1EHIA 1U97A 2FPPB 4TSFG 3T1HO 3QO7A 1T5EA 1XMOO 3STLC 1KTAA 3RTXA 1AUXA 4UV8A 5HNEA 4G27B 4YIOA 2PI4A 5LYJF 4X1IA 1N32O 1GKFA 1K9MW 4QE9A 5FD6A 1I94O 3MFHA 2K1EA 5LHGA 1BXRA 2WAQA 4JI0H 5EK0A 4ED1A 2ZKOA 1ORQC 4L8JA 2V7QG 4IIJB 2W71A 5BWRA 3RVZA 2ZGIA 3RFCA 3KHLA 3BAAA 1VQMV 2DYSB 5EBMC 3KHHA 4F6RA 4JI8O 2HVSA 1FYJA 2VWKA 4YHHB 3HKCA 4DL7A 4JV5O 4O2BB 3K5IA 2AGQA 3EFFK 1Z5VA 3CJHA 1GH6A 1HW7A 3ZHUA 1NI8A 3TY9A 2UUCO 1OCCB 4DR1B 2R8HA 3OMNB 4UB6Z 1K1SA 4KHPH 3H20A 2DYRC 3N8DA 4JV0A 2QKSA 3CC7V 4B7EA 1A48A 4CKCA 4J11A 2W8KA 1E4EA 1QNMA 3HKEB 4R8CA 3NR7A 2F4VO 2B9ZA 2BQUA 5FPRA 2MW2B 5I60A 5L1KA 4FZ1A 3RFRA 3THOA 3ZS8C 3H4DA 5FNVF 2QTSA 3JAKA 4BIZA 4JI6B 2CDYA 5DN6G 2QM7A 3IN5A 1HNXB 4KFMA 3PJSK 2D3OW 5B66Z 4NXMB 3SYQA 1K92A 4GZRB 1PNLA 3OUUA 4I4TF 3KTMA 5T14A 1JKJB 1S5HC 5F2VO 4DAAA 2CAZC 4FS2A 1D5NA 5DQGA 1GO3E 5B1NA 3GIDA 4DV2B 4IRCA 1XNQB 3VBBA 2KG7B 2C28A 3Q8RB 1IBMH 4LF7O 3FB5C 4NR1A 4CH4A 4ED3A 3AK3A 3GWOA 3J81N 3WG7C 2Q68A 1H8EG 1NR7A 3SPJA 5JJEB 4O7YA 3KYHC 1KJ8A 3TCUA 2R7KA 2M7WA 4ZQIA 3SPIA 2AGOA 4EEYA 4U3FH 4DR2O 4A93G 5KHGA 1E4FT 4LFAH 2IU0A 1Q81W 3BJYA 2UUBH 1YTFD 3PW2A 1V4YA 4I50A 2LFSA 2QF7A 4HNTA 4A3EG 3T1YB 4YR3A 2GTSA 4OX9H 3T1CA 4Z1VA 3K57A 2WTFA 4G3IA 2HVQA 1LUVA 3E8BA 3E86A 4Q43A 5GTIZ 3CCLV 1VARA 3Q2OA 3QWUA 3JRXA 1X9NA 5I5VA 2RF4A 2HJFC 3N6RA 4LCUC 5EC2C 3LP8A 4DUYH 2WA3A 3T5KA 2DWDC 1XHXA 1GSHA 2FPGB 3BRCA 1WCMA 1KBHA 3MR2A 3ZN0A 5J9PC 5CA0B 2EINC 3D36A 5KHJA 1AJNA 2EIKC 1R6TA 2WDTA 2A06H 2XUMA 1M57B 1VQKV 4DR7B 2DJVA 4DV3H 2FKLA 4WFFA 5LA6F 2ABJA 1N34O 2Q6AA 4YY3B 4YAJB 1JX4A 1WN7A 4IHJA 4IL6Z 2Z04A 5KG3A 5EZYA 5BZBA 4U6PA 2YC0A 2JGUA 3RB0A 2GHYA 2C2AA 5A9GA 5KFAA 1MMMA 4YR0A 3L4JA 1F4MA 3U55A 1JOYA 2JA7A 1OZ0A 2W0XA 4DV6B 3QQMA 2FMAA 3HOZG 4F4YA 3Q4HA 2R7MA 1FXKA 1TUEB 4IYIA 4EFBA 3L2PA 4RQFA 3UT5B 3JAWB 2E74B 3HR0A 4JZ2A 4FLZA 1Q82W 2PYLA 5LP6C 1T3NA 1HNZH 3C3TA 1V55C 4FM0A 3P30A 1GO3F 3QFFA 3C90A 3PO2G 4O4JB 2CTPA 3W7SA 5CB4B 3N2KB 1MA1A 2W6OA 4ECYA 3GTKA 1KMIZ 1IBKB 3H3VH 3TQ1A 4M7EA 1YF2A 3IC9A 4EEQA 4EBCA 2XOKG 5H80A 3HOXG 2W8LA 3H0GA 5CBGA 1NTKH 1TVKA 5KT3A 4R7CA 2QM4A 3KAKA 1AUVA 2HR3A 1I1MA 3C3SA 1ZQ7A 1NTZH 5DM6V 3TW6A 4X1KA 4UCRA 2F43G 3W1BA 3CCRV 3SR2C 4FLUA 1SQGA 4IZOA 4PDBA 3B40A 2NU7B 4P9PA 4AILC 4FFLA 3AX6A 4QW8A 3RYHA 3CHXA 5BR8O 4Q0YA 4JI3O 4R8UB 1HNWB 2EJ2A 4O84A 4CC6A 3K5OA 1X4TA 5IDJA 3A0RA 3ASNB 3QF7A 3UZOA 5LOVB 4A3FG 2L6LA 1ET0A 3RIZA 5LMNB 2X0SA 3OTFA 2OT5A 5A2QN 4J9QA 3NC0B 4ZI7B 4E6NA 4H13B 2JVDA 4MS2A 2B1GA 1XOUA 4DV0B 1PP9H 1BS3A 4CS3A 5KG7A 2XCLA 1LUWA 1L1FA 2R7ZG 2YEVB 2IJKA 2EILC 5FPOA 3W7WA 1BMFG 1M6VA 5KFHA 4A3IG 3WFVA 4O2AA 4QSHA 3ZRWA 3L73H 4EKWA 1UC9A 5D1OB 1PV0A 2WLHA 4YXWG 1KKDA 4IWYA 3KALA 4DR4B 3BQ1A 4RNOA 1CKNA 3SGIA 2YS6A 3HOYG 4ECZA 3WB1A 2XHBA 2AZ0A 2YS8A 1MABG 5KFJA 4ECVA 5C93A 1L0LH 4JTAB 1QVGU 5HFMA 4GX1A 1S3JA 3AG4C 2ILMA 1NTMH 5JVLA 2PZSA 3SJCC 3AG3B 4DRXA 1ZHQA 4HR7A 3OHAA 1Y66A 1CQIB 4J9PA 4U3JA 4DQNA 4RB1A 1UNNC 2C2RA 2FLNA 1C30A 5GW7A 1SYXB 2EIYA 1NT2B 4X64H 4TV9B 4ECWA 4YJ2B 1FD9A 1Y74B 3KZIZ 2JA5G 4JAUA 2UXBO 1O9HA 1CKOA 2W6JG 1K73W 1CXZB 5I5WA 1KJJA 3ABKC 2QK4A 1FS0G 1N48A 3D36C 1OCZC 4JI7O 3QO8A 4J42A 3GTJA 1DTOA 4O7RA 4JI4H 4RNNA 2XNDG 1P7BA 3HPLC 1EKFA 1KT8A 2KB1A 3ZX6A 2AHZA 4JYAB 3GV5B 1P84F 5IYBG 3JARA 3AG1C 2NVXA 5EZYF 5CAEB 3CC4V 2ZQMA 5IYDG 2DW4A 2DE0X 4QWCA 2Q0OC 4IRKA 4QE7A 5KFYA 4H0LB 2V1DA 5LHHA 4MT8A 3WU2Z 5KFNA 2VUMA 5JQWA 4B3TH 3OGCC 1B6SA 1N33H 2R87A 3QNEA 4XDKA 1UC8A 2FTKA 2E5LH 3F5WC 2ODMA 3TY5A 3OTOH 4DR1O 1YTFB 2G38A 1IDSA 1O75A 5BWTA 2W7OA 3FAVB 4ECTA 1XL4A 5KMGB 3R5HA 3JYCA 3JD3A 2W9CA 2QWPB 1H2LA 1K5SA 3ASOB 2QR4A 2V58A 3WNZA 1XDCA 3H1IH 4WFHA 5EWFA 4JI6O 3TK1A 1PX2A 2ZM6H 3N2GA 2YWVA 4EYHB 3JSLA 2E76B 4CKEA 4NXMO 4O7SA 5IP9G 1VQ7V 3GLKA 1S77D 1R3JC 2BTQA 3CMEV 4FFOA 3HKBA 3LNMB 2LP7A 2Y4UA 2RJZA 4DV2O 2J9GA 1XNQO 2ZXWB 4LF4B 1M4UA 1JDEA 3FKIG 1G4YB 3ZHRA 1T94A 3GILA 1RYSA 5K3WA 3TIGA 1QR8A 2YL2A 2XC9A 2HHHH 2V5AA 3JD1A 3JD4A 3KHGA 5LMUH 1XMQB 4QIWE 2BQ3A 1S0VA 3GIPA 3B8MA 4BAYA 5EC1C 4I7ZB 3CRMA 4JI5H 3VQYA 4A2BA 2HVJC 2YU9A 1AJPA 4X1YB 3T1YH 3NXSA 4X62H 1EYZA 2WLIB 5IYZB 2RCVA 4YBZB 3TETA 3GB8B 1TUBA 4O2AF 3ZMUA 4E4TA 4IR9A 3K9SA 4X65B 2XIGA 3H9VA 4DR3H 5CE8A 1I7LA 5KT2A 2PTMA 1M7JA 1PM9A 3P32A 4JYBA 5D8DA 4JTDB 2R92G 5KFGA 3ZHQA 4JXUA 2DYRB 2ZNIA 1SESA 1AILA 3ZRVA 1I0HA 2H3OA 5L3FA 1Q8IA 1KUQA 1HDJA 5EYPB 4MTEA 4JUZA 3FDSA 1FJGH 1A9XA 4O4HA 1AI7A 4BIUA 4HNUA 2CTWA 3G8CA 3D3QA 5FNVB 1NH2D 1S68A 1Z2NX 1FFXB 4DW0A 2JGDA 3N44B 3MHHC 1QR9A 1YIJV 1P8LA 1H8HG 2EJ3A 4X20B 4I4TB 3GV8B 3X2QC 5I5XA 1ZL8A 2JA6G 1WRVA 4QGPA 4K0KO 5D5QA 5KA6A 2QM8A 4YY3O 3OHBA 1V51A 1JJ2U 2VOBA 2WAMA 1ZWIC 4O3NA 2BQRA 2R9AA 2UUAH 1ZTEA 3FYIB 1SEIA 1GRJA 3CB2A 1YCIA 3AYHB 3VQWA 1IXBA 4TVIA 4TUYA 2BR0A 3M99B 5EIBD 1GYFA 2LO1A 1M1KW 5BPFA 4GKJB 4KXRA 4BR6A 4DV6O 1WP8A 2V4RA 4DL3A 1YJWV 4TV8A 2WPDG 3L4KA 1KJIA 5EBLC 1GN6A 4X66H 1AROP 3SPCA 4G28B 1HR0B 4MVMA 1TWGA 4PD4F 4M9UA 3CPWU 1Q6IA 1IYDA 2Z02A 2R8GA 2GUZB 2PMZA 2VQFH 2JEIA 2QA4V 2QKCA 3ZMZA 1YJNV 1WB8A 1IBKO 4BWSC 1ZUQA 3IG0A 2YI9A 3LDEA 2WA4A 4QIWF 3OAAG 2FL4A 2H94A 1AR1B 2HGXA 3I12A 4YJ2F 2P7TC 5DISC 4AHCA 4F4WA 1K5QA 2FK2A 4J9LA 4FM2A 1K4DC 3MFIA 4ME6A 2UXCH 2XGPA 4B3MH 2IP4A 4JI3B 3G6YA 5KG2A 4GC6A 2YYAA 4YR2A 4B3SB 2EINB 2ZIMA 1F4NA 2WWWA 1FFTB 4XDLA 1WAZA 4NXNH 2FK1A 3V6KA 2EIKB 1N0JA 1PNKA 2UXXA 4CH3A 3HXLA 3E8GA 5BMVB 1I2LA 3NBYB 1B33N 3OUFA 3AG2C 2VS0A 1Y14B 5FLMG 4NLGA 4MV4A 5LA6B 3DC5A 1PL0A 5LXTA 2Q4PA 4GCZA 4DUZH 1I6UA 1VAJA 1EN6A 3U0ZA 1KD1W 4WHXA 1DLBA 4HQ6A 2PMZE 2UXDH 2RDCA 4DV0O 4M0JA 3RR5A 4CHIA 4X9QA 5KAIZ 1M9NA 2P90A 3E83A 1H38A 3KG2A 4MTFA 3SNOA 4FM9A 5EWGA 1HWYA 3OMAB 2J6UA 2OCHA 1SQBH 4A3BG 3RB3A 1VQNV 4C2MA 3I56V 4O7LA 4HYKA 5KFOA 4X1IB 2HVRA 4UCVA 1N36B 1RJPA 5DQHA 1G2WA 1FAFA 1Q7YW 4LFCB 2ASDA 2CH7A 4JV1A 4FFPA 4B3RO 4ZHQF 4JI2O 4FGRA 4DR4O 1D2DA 4MSWC 1M0TA 1SFOA 4EGJA 1KQSU 3EYYA 1G1XB 2YIAA 5ITZA 2MK3A 4LC1A 4F6RB 3H1KH 4DV4O 4O3QA 3K3VA 3HKCB 1VQ8V 1CS0A 3PN1A 2R6FA 1EZJA 3M9NB 2V4DA 3CJHB 2EX3A 1VBGA 2YIBD 4RU9A 4DV7H 3V6JA 1E4EB 1ROPA 1XUQA 4HYOA 4KUMA 3HB9A 5EBWC 3H01A 2R7NA 5BY1A 2Y0SA 1NR1A 3T1HH 1EN4A 5AG2A 1VF7A 4WFEA 3DC6A 4B08A 1XMOH 3NUAA 4HAMA 3JAKB 5CM0A 4MV6A 3HOVG 5KX5A 4JAAA 1GN2A 4MV7A 1N32H 4JTCB 1E4GT 4LP8A 1IZ3A 2DPIA 1E1QG 1I94H 3VPBA 1O9GA 1Q6UA 1K97A 4O3SA 4UB8Z 3B09A 3OSNA 1RPRA 1MSDA 2WB1A 4C5AA 4O82A 5IWAB 2JK5C 4MVUA 4JYAO 3K08A 4JI8H 3U10A 1VP7A 5I5UA 4ECQA 1S10A 4J80A 5KHHA 5IYZF 1M56C 2QWQB 3E8HA 4JV5H 4O7WA 1XQ8A 1QCEA 1RSOA 3M9OB 4R50A 1Q90D 1SRYA 4FE2A 5LP6A 5LGUA 3ORQA 4UUGA 2UUCH 2PBZA 3ZHTA 4PZ8A 4TUYF 1VMGA 2CW8A 1K34A 4U7OA 1SQPH 2EILB 5TISZ 2ZJTA 1N0NA 2IJJA 4NKGB 2W70A 4LF6B 4UCTA 3OD4A 3PFFA 2Y0SE 4Z2WA 4FLVA 3RB4A 2GDSA 2FLPA 2QWRB 4TV8F 2GBOA 3FFQA 4RAYA 2F4VH 3RB6A 2M6YA 1OWTA 3E5NA 3OEHG 4PV1B 4I50B 1SQQH 4WD3A 1Z2PX 5GONA 5FLXW 1BGWA 2D2CB 1Y1WA 4LF9B 1MZFA 1NBMG 4J7KA 4CC5A 2FPIB 2CQYA 2WB1E 2WAQE 2OCCC 3SYOA 5FD5A 5C4XG 1SQFA 2XTAA 2ZDIA 2XAGA 3N43B 4ZIBA 5JUMA 4YB8B 5DGIA 4A3KG 3W7XA 3KREA 3JCZA 5D1PA 1MZEA 2EIMC 5BWVA 4F6EA 4JI1B 2W6PA 2R8JA 2R93A 4J9MA 3HOUG 4P30A 2R82A 4LF7H 2HHFA 1P4RA 5JCOC 1KC7A 2YDEA 1NH2B 4B7KA 4MW3A 1Z2OX 4PDMA 1Y1VG 3ABKB 2WLLA 4XYMB 1OCZB 4LF4O 2H8PC 4GKKH 1EFRG 3CYOA 2XASA 3BQ2A 4DR2H 1DF5A 1YITV 2LW7A 3N40P 3WB2A 5B1OA 2JJ2G 3RAXA 4BIOA 1TWFA 5L1JA 5LXTF 1XMQO 5BYAA 2N74A 3VQXA 1FKAH 2C00A 5EZYB 5KG6A 4GT1A 4MTXA 5KT7A 1BSMA 1AR4A 3CE2A 4E4EA 3G67A 5KKNB 1YI2V 2CTRA 1IOVA 1EUDB 3QG5A 4X65O 1AI5A 4G2KA 1RPOA 3BA9A 2FB9A 4O4IA 3Q4HB 3PW4A 1FXKB 3HOWG 4A3GG 5DG8A 1OCRC 4O3OA 4FVMA 1SETA 3TGUH 2I87A 4GC7A 2ZDQA 5H5NA 1IURA 4TM5A 2ZD9A 5DGBA 4LF5B 3KHRA 2C2DA 4LBEC 2X6CA 3JCUZ 1FVIA 2UUBO 5KFEA 4PDLA 4A3CG 3T5JA 4K6NA 4J9SA 5KS8A 3C0FB 5KFRA 5IJ0A 3K59A 3RF2A 3TINA 4JF3A 1WSCA 3U54A 3U0GA 4FMTA 4FFMA 2JA7G 1N34H 3CQZA 4DV1H 1TVKB 1PK8A 2CZGA 3G6BA 4P2ZA 4PELA 5L3GA 5BMVF 5CBHA 4EBDA 4J0MA 1KP2A 4K0KB 5K1PA 2NNUA 3U9TA 4X1KB 2BOBC 2E2IA 3GIQA 2Q5ZA 2R9RB 1R3IC 2WYOA 4I0XA 5KX5F 1S97A 3EPIA 3UYYA 3RYHB 4GLWA 3VMMA 1XNRB 3CCEV 3CCVV 2Y0IA 4BBRG 1GAXA 1ENVA 1P7GA 4O4LA 4O81A 1Y67A 1H2GA 4QWEA 4DL2A 1K3EA 4GKJO 1KU9A 2Y69C 3CCUV 3K79A 4YQWA 1J5EB 2QKAA 5KT5A 4Z1MG 5LP6F 5B1BC 2ETNA 1U96A 1HR0O 5CA3A 2XCAA 4LFBH 4O2AB 4CMFA 3SDLA 3ZRWB 4ZKIA 4RB0A 3ZHSA 1XREA 4UXNA 4RUFA 4O7NA 5KFPA 2R8IA 2CNVA 3DTGA 4P9OA 3K5HA 1CKNB 1VF6A 2VQEB 1YEWA 3F8NA 3S3XA 2I8CA 5KG1A 5KFXA 4EBEA 2UVWA 2R9IA 3J80W 1WB7A 1E79G 3OW2U 1WJZA 4A3DG 4QJFA 4AQYB 5BR8H 1A0IA 2PUSA 3P3NA 5B1AC 4XYLB 3T4DA 1XL6A 3APQA 3AEIA 4WFGA 1QLEC 2ZDIC 4DRXB 4H33A 4ECRA 1S76D 1GM9A 2ADQB 4O7TA 4U3JB 4DR6B 3VPCA 3P3PA 3QZ7A 2UVVA 4B3SO 3N41B 1K1QA 4LF8B 3ETDA 3IFXA 2NU9B 2W9BA 3ML0A 5BWUA 3GIIA 1RJQA 4YP3A 3UO3A 1F23A 3CMAV 2SCUB 3CEBA 3SJAC 2YXYA 1W59A 2QEXV 2ZIOA 5E79Z 5EWEA 4CBCA 3UM7A 2UU9H 2JA8G 4FLTA 4RAZA 4DR5H 5HBRB 3CRQA 2IH3C 2NU6B 3RV3A 5JH7A 4NYKA 4W4KA 1S0NA 3ZMSA 3DSQA 3JARB 5HFLA 4D7TA 1JPXA 1Y4MA 4NB5A 4XDJA 1VQPV 4J7JA 4B3RB 4JI2B 1N36O 4PA6A 3NGDA 4K8ZA 2W0FC 4EB6A 3R5FA 2Z0AA 2ZE7A 4LFCO 4FIPC 4I50F 1IBLH 3UZBA 1BZKA 2LFRA 3GTLA 4PI2A 1GM7A 4DV4B 1WA8A 2R72A 1SERA 1FXVA 3FB7C 1LR1A 1PKXA 5KFDA 1Q6HA 1W0JG 1QQCA 2JIZG 3D8CA 1WPBA 2WLKA 1KJQA 2PF4E 5DG9A 4BW5A 2HDKA 2VPSA 4ED6A 1S9FA 5JVDA 5KT6A 2CNUA 1S0MA 3G80A 5CBFA 2UXBH 2B5UA 3F7VC 2JEJA 4JI7H 4IRDA 3B2EE 2Q2UA 3VOUA 4ZOLA 2P22C 1CEZA 2EJ7A 2W9CB 5CA1A 3S3WA 2PGGA 5IY5B 3I4NG 1I5XA 3GV7B 4N21A 2VUMG 3N2GB 4JGSA 3CRCA 2QB5A 1WLEA 1XI1A 3BCCH 4DV5B 3MR5A 1Y76A 4HNAA 1G8MA 3TJTA 4IHJF 2BTQB 2YCHA 3RYFA 3HKBB 4CKBA 5IWAO 5F9NA 4OGQB 1GM8A 4I9WA 4UVBA 3N42B 4X64O 5FLXN 4HNVA 4YHHH 5IYCO 3OE7G 4MAMA 4CS4A 4O4LF 3ABMC 1TA8A 3GIJA 3ABLC 4DR1H 3RAQA 4JI4O 4BXXG 2XT9A 2QYZA 1H2MA 4LF6O 5GTHZ 4NTXA 1FXHA 1XBLA 2CFMA 4MV1A 4JI0B 5KFIA 1AJQA 4ZHQB 2C35B 1WH2A 1GSOA 1VS0A 2IH1C 4YJ3A 4A3JG 3M4IA 3SI8A 3ABTA 3ZMVA 4ECSA 5FJ8G 5IE9A 4LWSA 1RM1C 3I4MG 4JI6H 3ZRSA 3F7YC 1HNXH 4LF9O 1HP8A 4I7HA 1DF4A 3B8NA 5DMXA 5HV6A 4NXMH 2WLJA 1VF6C 4MVOA 2NUAB 4AYBA 4RNMA 3CCJV 4B3TO 1EKPA 5KG4A 1V54C 2P06A 4KHPB 3ETEA 1TWHA 4HZ3A 4DK1A 1E1RG 3CXCU 4DV2H 1R6NA 1XNQH 2RGVA 2AXTZ 4O4HB 5KFFA 1SZTA 4NTWA 4JI1O 4Q8EA 5LHIA 2RDIA 3AW8A 1SQXH 4APMA 1JDBB 1NU1H 2JGDB 3EXAA 1VEWA 4FFKA 5C8YA 2UVRA 2ZR3A 2HP8A 1K33A 5D5PA 5JQGA 4NZNA 2KSWA 1ZL8B 2ZM6O 3HKZA 4BBSG 3E8FA 1BQ0A 1PPJH 4O86A 3CRRA 2W9AA 1VQLV 1ZAUA 2RNBA 3CS5A 1JR9A 2VA3A 3Q8PB 5KUKA 3DTFA 3RYIA 2HLDG 3CCMV 1PNMA 1RP3B 4AYBE 1NZ6A 1M56B 4J41A 3VQVA 1S03G 1IBMB 5JJNB 1GGOA 1SA0A 5JH7F 4EFEA 1MNGA 4TUYB 2GPSA 1SQVH 1W93A 1JFFB 4WBNA 1CP9A 1VQ9V 5LGTA 5I5SA 2ZINA 1JLLB 5IJ9A 4TV8B 3N6XA 2YICA 4IAJA 3K0GA 2P67A 1H2SB 2OIEA 2W6NA 4UFZA 4FLYA 4LFAB 4MV8A 2UUBB 4CS2A 4MVSA 4MVQA 2PY5A 4LF5O 1AVMA 4OX9B 1Q3EA 5J2TA 1A32A 4QW9A 2ADPA 2YXLA 4OPHA 4DL6A 2YI8A 4MVZA 3HKZE 4PA9A 1W96A 3KXYT 5JVDF 2OCCB 3FYEB 1SC5B 1R3KC 4DR7H 3HT5A 5C1OA 2FE3A 3T5HA 5KFWA 4YY3H 3U9SA 3ABUA 4ZOLF 4K35A 2OLSA 5CA1F 2P5OA 1EKVA 5DGAA 1JXLA 4DUYB 5I5TA 3E22A 2PVPA 4QPKA 4UCUA 1VQ5V 1OHHG 3GVMA 1GMGA 5J2UA 4QWDA 3I5DA 1XNRO 2YZLA 3SJBC 2C2EA 4DV6H 3WG7B 3K5LA 4A3LG 2PI5A 3CCSV 2QDOA 2RMKB 3T4ZA 1QHTA 1JMKC 5LYJA 2HIXA 3ORRA 1DIKA 1R9TA 1BT8A 5LXTB 4DV3B 3CVZA 1X59A 5LBQA 1NQTA 3T9BA 4UCOA 5H6RA 3J80N 2Q73A 5DLGA 1AN7A 2IJHA 1J5EO 2BSKA 1NJIW 4JV2A 2GLTA 2VQDA 1TAEA 5KFCA 2OTLV 1WPXA 2EIJC 1VQ4V 4ECUA 1IBKH 3UQ8A 2Y0PA 4PA7A 4CE5A 2BOCC 3QO5A 2CH7B 3TW7A 2JA6A 2DPJA 4I9QA 1JQ0A 3G4SV 3GTPA 1OCRB 2E2HA 2NLJC 2VQEO 5ITZB 3RYCA 3JATA 3M8AA 3EVKA 4R6ZA 5KHIA 2W6MA 5KHKA 2BTOA 1HNZB 3K58A 3AG3C 1YHQV 4LSXA 4AQYO 1GLVA 2OH2A 1HNWH 5JCOA 1DV1A 3OMIB 2B63A 2YSUB 1FFXA 3JZFA 3BACA 1COWG 3JASA 4W4LA 4DR6O 4QWAA 5LMNH 2EBOA 3CEIA 3CP1A 3ETGA 3K0DA 3W5OA 1ZLZA 4JYYA 2W6ZA 4LF8O 4DV0H 2J6SA 4O7VA
chains in the Genus database with same CATH topology
1Z2OX 4D7SA 4CC6A 3K5OA 1X4TA 3QF7A 5LOVB 1L2ZA 2Q7GA 3RIZA 5LMNB 3E22B 3OTFA 5KX5B 3A2FA 2Q2TA 4DR2H 3NC0B 4ZI7B 3N40P 4LF7B 4E6NA 3WB2A 2JVDA 4DV0B 4CS3A 5J2UB 3VQXA 1FKAH 5EZYB 4DR4H 3U11A 1P49A 5FPOA 4DR2B 5LYJB 4Q6GA 4O2AA 3FMAA 1I7FA 2OYQA 3QG5A 5D1OB 4LF5H 1XK5A 3NBZB 3KALA 4ZHQA 5LP6B 4DR4B 3RJ0A 3BA9A 1CKNA 4O4IA 3SGIA 1Z5WA 3WB1A 2XHBA 5KMGA 4TQDA 4FVMA 2GV9A 4FLWA 3ICXA 1M93A 3J81W 1Q43A 4TOIA 4LF5B 4PZ6A 2PZSA 1FVIA 3SJCC 4FFBA 4DRXA 1BJTA 5GONB 1ZHQA 4K0KH 4GLXA 3RGBA 3C0FB 4U3JA 4RB1A 5IJ0A 3RYCB 3K59A 3JATB 1SYXB 3RF2A 4TQFA 4I55A 5JJJB 4A2AA 1NT2B 1N34H 4X64H 3LMLA 4TV9B 4DV1H 1TVKB 4YJ2B 1XNRH 1O9HA 1CKOA 4J0MA 4JYAH 4K0KB 4LNUA 5K1PA 3BA8A 3JASB 4X1KB 1XDNA 4JI4H 2WYOA 1N34B 4LH7A 4X64B 3RYHB 4DV1B 1XNRB 3JALA 4LH6A 1J5EH 2JS5A 4JYAB 3JARA 2F93B 4O4LA 3QTCA 4X1YA 4PI0A 4RB3C 4HBNA 4UCSA 4JI4B 5IYZA 1M5IA 3JAMW 2WE6A 1KU9A 4PHZA 1J5EB 1JFFA 3MWMA 2VQEH 4BWAA 4B3TH 1N33H 3ETQA 4LFBH 2E5LH 4O2AB 2OWOA 4RB0A 3TY5A 3OTOH 3KAJA 4AQYH 5EYPA 1O75A 1CKNB 2VQEB 4O4IB 4B3TB 1YEWA 1N33B 3F8NA 5KMGB 5FNVA 2E5LB 4LFBB 3J80W 4DR6H 3ZEDA 3OTOB 2F1MA 2HGSA 4LF8H 4AQYB 3HKDA 5BR8H 1A0IA 2PUSA 2ZNJA 4FFBB 4X20A 2ZM6H 4I4TA 4DRXB 3N2GA 4LF4H 3JSLA 4U3JB 4DR6B 5IJ0B 3N41B 4I55B 4LF8B 2BTQA 5BR8B 3TY8A 3HKBA 1XMQH 2IM9A 4KL1A 4R7RA 2ZCEA 3MAQA 4CH6A 2RJZA 2ZM6B 4LF4B 1M4UA 4LNUB 3SJAC 4IHJB 2ZIOA 4B3RH 4JI2H 2HHHH 3BHPA 4GYCB 1CKMA 2MCTA 2UU9H 4FLTA 2CW7A 4PZ7A 4IIJA 4RAZA 5LMUH 4DR5H 1XMQB 5EOYA 4DV4H 3J7AK 1DGSA 3DF7A 5JH7A 4X65H 3JALB 3WB0A 4JI5H 3VQYA 4D7TA 3DSQA 3JARB 4A2BA 4O2BA 4B3RB 4O4LB 3LNNA 1G6UA 2HHHB 4X1YB 4JI2B 4K8ZA 3T1YH 4X62H 4FLXA 4EB6A 2UU9B 4MV9A 4ETSA 5IYZB 4DR5B 5LMUB 1IBLH 3GB8B 4PI2A 4DV4B 1TUBA 4CH5A 2R72A 3CSXA 4X65B 4RB2C 5K1XA 2XIGA 4JI5B 3JSNA 4DR3H 5A2QW 1QQCA 3HKEA 1WPBA 2F95B 4X62B 2PTMA 2Q7EA 1IBLB 4DK0A 1JJOA 4FM1A 2ZNIA 2VPSA 1D5AA 1Q8IA 5JVDA 1V9PA 5EYPB 4MTEA 4DR3B 4DRFA 2UXBH 1FJGH 4O4HA 4LR3A 2HEPA 4JI7H 3B2EE 5FNVB 2Q2UA 4ZOLA 4DV5H 2P22C 1S68A 5CA1A 1Z2NX 1FFXB 1Q5OA 2PGGA 3RGZA 3N44B 3S24A 3HKDB 2R70A 5BMVA 2UXBB 1FJGB 1P8LA 5LA6A 1MZBA 4X20B 2RQ6A 4I4TB 3N2GB 4JI7B 3RGXA 1XI1A 2W57A 4DV5B 5D5QA 4MTDA 4HNAA 1T5EA 2YCHA 2BTQB 4GKJH 3RYFA 3HKBB 3RTXA 2VOBA 4K8XA 3GDEA 2R9AA 3N42B 2UUAH 4X1IA 4YHHH 1SEIA 5FD6A 3CB2A 3VQWA 4TUYA 4JI0H 1HR0H 4CS4A 5EIBD 1GYFA 1TA8A 4L8JA 4GKJB 4IIJB 4DR1H 2O03A 3BAAA 4TV8A 4F6RA 5JH7B 3L4KA 2HVSA 4EQ5A 2VWKA 2UUAB 4YHHB 4LSAA 4X66H 3HKCA 2CFMA 4O2BB 4JI0B 1HR0B 4ZHQB 1WH2A 1Z5VA 1VS0A 1HW7A 4EB6B 3TY9A 4YJ3A 1L8DA 3M4IA 4DR1B 2VQFH 4KHPH 3H20A 4JI6H 4X66B 1HNXH 3HKEB 4I7HA 3VNNA 4JI3H 4BWSC 4NXMH 2KKWA 3IG0A 2YI9A 5FPRA 4B3SH 3RFRA 3THOA 3ZS8C 5DISC 4AHCA 5CA0A 2VQFB 4KHPB 3JAKA 5JVDB 4FM2A 4DK1A 4JI6B 2UXCH 4B3MH 1HNXB 4DV2H 1XNQH 2RGVA 4O4HB 4JI3B 4NXMB 4B3SB 4ZOLB 2ZIMA 4APMA 5CA1B 4NXNH 2CAZC 2UXCB 4CH3A 3HXLA 5C8YA 5BMVB 4DV2B 4B3MB 3NBYB 1XNQB 3K5NA 5LA6B 5LXTA 2Q0AA 1I6UA 5D5PA 4DUZH 5JQGA 2KSWA 3U0ZA 2VWJA 1IBMH 2UXDH 1N36H 4CH4A 4LFCH 4NXNB 1ZAUA 5JJEB 3RR5A 4HNAB 3KYHC 1WNSA 4FM9A 3RYIA 3RYFB 3BPZA 5LL6b 3UT5A 3JAWA 5KHGA 4DUZB 4X1IB 3VQVA 1S03G 2UXDB 1IBMB 5JJNB 2F66C 1SA0A 4UCVA 4EFEA 1N36B 2HVRA 1E4FT 3K5MA 4LFAH 2UUBH 4TUYB 4LFCB 1JFFB 4I50A 4WBNA 3T1YB 4O4JA 1M0TA 2ZINA 2QJ1A 4OX9H 5CB4A 3N2KA 5IJ9A 3EYYA 4TV8B 2YIAA 5ITZA 4F6RB 3K57A 3N6XA 4IAJA 2HVQA 3K3VA 1H2SB 1S5JA 3HKCB 4UFZA 4FLYA 4LFAB 2UUBB 3PN1A 4CS2A 2V4DA 2PY5A 3QWUA 2EX3A 4NVPA 2YIBD 4YJ3B 4OX9B 1Q3EA 1X9NA 5J2TA 1M0WA 2YXLA 2YI8A 3W1GA 4DV7H 3KXYT 4DUYH 2YIBA 1XHZA 1XHXA 1ZHSA 4DR7H 2FE3A 3M7MX 3BRCA 4BW9A 4YY3H 3T1HH 4B08A 1VF7A 5CA0B 1XMOH 3JAKB 2HIVA 5LOVA 5IWAH 5KHJA 4DV7B 2P5OA 4DUYB 3E22A 5KX5A 2WDTA 3BABA 4MV7A 4UCUA 1N32H 1E4GT 4DR7B 4ZI7A 2PYJA 4DV3H 1I94H 1O9GA 5J2UA 4YY3B 1B04A 3T1HB 1WN7A 4IHJA 1XMOB 5EZYA 3SJBC 3GJXB 4DV6H 5IWAB 3IAYA 3K5LA 5C8YB 2JGUA 4JI8H 4LF6H 3U10A 1QHTA 1JMKC 5LYJA 1N32B 2HIXA 2RGRA 4DV3B 5LXTB 5IT9W 5KHHA 1I94B 3CVZA 4JV5H 5JQGB 1XQ8A 4UCOA 3L4JA 5D1OA 1RSOA 4GKKH 5LP6A 1AN7A 2UUCH 4DV6B 4PZ8A 2CW8A 2ZJTA 3RYIB 4EFBA 4JI8B 4LF6B 3L2PA 4UCTA 1P16A 1TAEA 3UT5B 3JAWB 4FLVA 4LF9H 1IBKH 4JV5B 1TUBB 3UQ8A 3FFQA 1SA0B 5EIBC 4FLZA 4RAYA 2F4VH 2PYLA 5LP6C 1HNZH 4GKKB 2UUCB 4FM0A 4I50B 4WBNB 4I9QA 1Z2PX 4O4JB 5GONA 5FLXW 5CB4B 3N2KB 5IJ9B 1BGWA 4RZQA 5ITZB 3RYCA 1KMIZ 4LF9B 3JATA 1IBKB 4M7EA 4EEQA 2F4VB 4CC5A 5KHIA 5KHKA 4JI1H 5FD5A 2BTOA 1HNZB 3K58A 1SQFA 4LSXA 4TV9A 3N43B 1TVKA 4YJ2A 4ZIBA 2QM4A 5JCOA 3KAKA 5J2TB 1HNWH 2Q7HA 1FFXA 5D1PA 3JASA 5LMNH 4X1KA 4UCRA 3W1BA 4JI1B 3SR2C 4FLUA 1SQGA 2E3CA 3W5OA 4PDBA 2VUGA 3RWRD 4LF7H 4AILC 4LMYA 3RYHA 5JCOC 3CHXA 4Q0YA 1TGOA 4DV0H 1SKVA 1HNWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TY5 A;  4CC6 A;  4DV5 B;  2HVQ A;  4UFZ A;  4LFA B;  2UUB B;  5LMN B;  3PN1 A;  2Q2T A;  3QWU A;  1CKN B;  2VQE B;  3RTX A;  4B3T B;  1N33 B;  3NC0 B;  4LF7 B;  4E6N A;  3GDE A;  4OX9 B;  1X9N A;  4DV0 B;  2E5L B;  4LFB B;  3OTO B;  3W1G A;  4AQY B;  1A0I A;  1TA8 A;  5FPO A;  4GKJ B;  4DR2 B;  3BAA A;  3JSL A;  2HVS A;  4EQ5 A;  4DR6 B;  2UUA B;  4YHH B;  5D1O B;  2HIV A;  1XK5 A;  3NBZ B;  2CFM A;  4DV7 B;  4DR4 B;  4LF8 B;  4JI0 B;  4DUY B;  1HR0 B;  3BAB A;  5BR8 B;  3BA9 A;  1CKN A;  1VS0 A;  4UCU A;  3TY8 A;  3SGI A;  4DR7 B;  3TY9 A;  2ZM6 B;  4DR1 B;  4LF4 B;  4YY3 B;  1B04 A;  3T1H B;  1XMO B;  3GJX B;  4TOI A;  4X66 B;  4LF5 B;  5IWA B;  1CKM A;  4PZ6 A;  1FVI A;  3VNN A;  4PZ7 A;  1XMQ B;  1N32 B;  2HIX A;  5FPR A;  4DV3 B;  1DGS A;  1I94 B;  4GLX A;  5DIS C;  2VQF B;  4KHP B;  4UCO A;  5D1O A;  4JI6 B;  4B3R B;  4DV6 B;  2HHH B;  4JI2 B;  1HNX B;  4PZ8 A;  2UU9 B;  4JI3 B;  4EFB A;  4DR5 B;  5LMU B;  4JI8 B;  4UCT A;  4LF6 B;  4NXM B;  3L2P A;  3GB8 B;  1P16 A;  1TAE A;  4DV4 B;  1CKO A;  4B3S B;  4K0K B;  4JV5 B;  3BA8 A;  3UQ8 A;  4X65 B;  4JI5 B;  3JSN A;  4GKK B;  2UUC B;  2UXC B;  1XDN A;  4B3M B;  4DV2 B;  3NBY B;  4X62 B;  1XNQ B;  1N34 B;  4LH7 A;  4X64 B;  4DV1 B;  1IBL B;  1XNR B;  4LH6 A;  4LF9 B;  4JYA B;  1IBK B;  1V9P A;  4EEQ A;  2F4V B;  4CC5 A;  4NXN B;  1ZAU A;  3RR5 A;  4DR3 B;  4DRF A;  3KYH C;  1HNZ B;  4UCS A;  4JI4 B;  2Q2U A;  4DUZ B;  2UXD B;  1IBM B;  2HVR A;  1S68 A;  4UCV A;  1J5E B;  4EFE A;  1N36 B;  5D1P A;  3S24 A;  4UCR A;  4LFC B;  3W1B A;  4JI1 B;  3W5O A;  2UXB B;  2VUG A;  3T1Y B;  1FJG B;  1P8L A;  1HNW B;  2OWO A;  4JI7 B; 
#chains in the Genus database with same CATH topology
 3T54 A;  4D7S A;  4U7C A;  1KKC A;  1A3G A;  4FPP A;  5KX5 B;  4UVC A;  2YZG A;  3OM3 B;  5C8Y F;  2C22 A;  2R86 A;  2UVU A;  1QVF U;  2HVK C;  5KFQ A;  2ATL A;  5JQG F;  1I08 A;  4DR4 H;  2EZO A;  3LDC A;  3U11 A;  1PD3 A;  4PJ0 Z;  1P49 A;  2AHY A;  4NXN O;  3JZI A;  1VQO V;  4HN2 A;  4FBT A;  4Q6G A;  5L1L A;  2COI A;  1OJH A;  4NZO A;  3FMA A;  1IOW A;  1VKZ A;  1I3Q A;  1K8A W;  1I7F A;  4EYI B;  2OYQ A;  5KT4 A;  2R85 A;  2NN4 A;  1RSO B;  1XK5 A;  1RK5 A;  5LP6 B;  3RJ0 A;  1BGY H;  2A0L A;  5B1B B;  1V55 B;  3L72 H;  3MWE A;  4WBN F;  1SZX A;  2IBK A;  1Z5W A;  3T9C A;  4TQD A;  1Q43 A;  3ZJZ A;  2FLL A;  4TOI A;  3AK1 A;  2PN1 A;  2R84 A;  3VA7 A;  5KFS A;  2A9H A;  3MR3 A;  2W6I G;  4FFB A;  4Q44 A;  5GON B;  4O4H F;  4GLX A;  4C7U A;  3RGB A;  1OCO C;  2DLN A;  1AP5 A;  5KLV H;  3L74 H;  4I55 A;  4A2A A;  1URF A;  3QZ8 A;  5DLF A;  3M9M B;  5KFZ A;  3LML A;  1R73 A;  2K9P A;  4JYA H;  4IGG A;  4LNU A;  2JJ1 G;  3DAA A;  4J9R A;  4J9N A;  4DV5 O;  1XDN A;  4NYE A;  4DV7 O;  1I5Y A;  1F7Y A;  2HHF B;  4LH7 A;  4X64 B;  3JRW A;  3OR6 C;  2YUA A;  4TQS A;  2AU0 A;  3JAL A;  4LH6 A;  1H2N A;  5J2U F;  2WLL B;  1JA8 A;  1Y1W G;  1IX9 A;  3J7A U;  4RB3 C;  2JRI A;  4UCS A;  4JI4 B;  1M5I A;  3JAM W;  4MA5 A;  4QWB A;  5KAF Z;  4PHZ A;  3KKY A;  5KFL A;  3MJF A;  2VRZ A;  3SYC A;  2ZE8 A;  1H2K A;  3MWM A;  2HG8 A;  1GSA A;  4ECX A;  1Z2G A;  2HGW A;  4JI0 O;  4J9O A;  3ETQ A;  2LJ2 A;  2CGO A;  2R93 G;  3H1J H;  1Q86 W;  1QBZ A;  3KAJ A;  5IYC G;  4TQR A;  4JPR A;  4ED2 A;  4FZ0 A;  3AG4 B;  3DXR A;  2QTO A;  4QNH B;  5C5J A;  4GKK O;  4O4I B;  4B3T B;  1N33 B;  5I5Y A;  1S72 V;  2E5L B;  3OTO B;  2F1M A;  2HGS A;  4KHP O;  2ALZ A;  3HKD A;  2ZNJ A;  2W7P A;  3A0B Z;  5KUM A;  4DLK A;  3L75 H;  4I5S A;  5DQI A;  4LF4 H;  1OV9 A;  1YXB A;  5KG5 A;  5IJ0 B;  5L1I A;  4J9Y B;  2XD4 A;  2ASJ A;  2YID A;  3JD2 A;  2P4K A;  5DGH A;  1BE3 H;  1S5L Z;  2JEG A;  4UV9 A;  3G6E V;  2COG A;  1XMQ H;  4F4X A;  2LGQ A;  2HJW A;  2GQR A;  2EJ0 A;  2ZM6 B;  3FB8 C;  2Z5U A;  4WF9 V;  4DIM A;  5BPH A;  4IHJ B;  3AG1 B;  5FL7 G;  2YRX A;  5F9L A;  4GYC B;  1CKM A;  1DAA A;  3SPG A;  2CW7 A;  3QVN A;  4IIJ A;  4ABM A;  4I0X B;  4PZ7 A;  5EOY A;  1EZ1 A;  4ED0 A;  1DGS A;  3DF7 A;  1I1L A;  3K3W A;  3HB3 B;  4X65 H;  2Y4T A;  3GTO A;  1UPG A;  1GTO A;  2N05 A;  1WCM G;  3F5T A;  1K4C C;  4O2B A;  2XAJ A;  4O4L B;  1EN5 A;  1IBM O;  2HHH B;  4F4Z A;  3ABM B;  3GWK C;  3H1L H;  4MV9 A;  3ABL B;  5IP7 G;  3RVY A;  5LMU B;  4FK5 C;  4C5B A;  3Q8S B;  2RDJ A;  3UO2 A;  3E35 A;  2QGN A;  4CH5 A;  5C44 G;  4RB2 C;  2HG5 C;  4JI5 B;  2DWE C;  5C1P A;  1SS3 A;  4Q8F A;  2ITD C;  3HKE A;  1M90 W;  4X8A A;  1N8R W;  3CX5 F;  1FKA O;  5C3E G;  2F95 B;  4LFA O;  3WWJ A;  4X62 B;  1Y1V A;  2YXH A;  1YSC A;  1KUT A;  2Q7E A;  3T9D A;  2OIG A;  1JJO A;  1RM1 B;  1JX9 A;  4OX9 O;  1D5A A;  4O3R A;  1ZX3 A;  3TXS A;  4DR3 B;  4JAV A;  4U7N A;  1YJ9 V;  3RBD A;  3BG5 A;  1EM1 A;  1GK9 A;  1V54 B;  3W7T A;  4MTO A;  4OXS A;  1Q5O A;  3RGZ A;  4QJF B;  3JD0 A;  4I55 F;  3PR4 A;  2J6T A;  2FML A;  2QWO B;  1FJG B;  4DUY O;  1MZB A;  1IXM A;  2RQ6 A;  3G71 V;  2KG7 A;  3K03 A;  1CPY A;  1OBD A;  2E75 B;  3WO0 A;  5KFU A;  5LL6 Y;  4MTD A;  3GIK A;  3UKM A;  2V9W A;  4MW8 A;  4GKJ H;  5B3S C;  2W9B B;  4K8X A;  1NVP B;  3GDE A;  2NU8 B;  5I47 A;  1UJW B;  2FK3 A;  4UUJ C;  3IGA C;  4DV1 O;  2CE4 A;  3H0G G;  4DV3 O;  3MR6 A;  3HBL A;  1HR0 H;  5DAA A;  3PW5 A;  1C3O A;  5FR9 A;  2O03 A;  3H40 A;  5JH7 B;  4ICG A;  3GTG A;  4EQ5 A;  1RJR A;  4GX0 A;  3ZHV A;  2UUA B;  4BY1 G;  3OT7 A;  2CNQ A;  4LSA A;  3I55 V;  3T5L A;  2L35 A;  2FB5 A;  3OSP A;  1NS1 A;  3O9O A;  3CCQ V;  3OEE G;  3T2M A;  5H9C A;  4EB6 B;  3GTM A;  3WWH A;  1JVM A;  3R66 A;  2YW2 A;  1L8D A;  4RWU A;  4KP4 A;  3RBE A;  2N04 A;  1R6K A;  3PW7 A;  1WA8 B;  2LGW A;  5GON F;  5JWP A;  1ZET A;  2QSA A;  4X66 B;  2BE3 A;  2A3Q A;  4FBU A;  2O57 A;  2Y48 A;  5KA5 A;  4PA4 A;  1VIB A;  4RO2 A;  3VNN A;  4JI3 H;  2KKW A;  2DAB A;  3WWI A;  1HNZ O;  4WFA V;  1K7D A;  3FKS G;  4B3S H;  4TWK A;  4YIP A;  2DN9 A;  2VQF B;  5CA0 A;  2X6B A;  4LFB O;  4FS1 A;  1TWA A;  5JVD B;  2X7R B;  4H44 B;  5L3B A;  2LW1 A;  3LUL A;  1MG1 A;  3RUP A;  1F51 A;  3BY6 A;  3X2Q B;  2RN9 A;  4ZOL B;  2AQ4 A;  5CA1 B;  1AI6 A;  2XAQ A;  2UXC B;  1IYE A;  3VPD A;  3V6H A;  4B3M B;  4GUN A;  4PA3 A;  4PBC A;  3ZBH A;  4RCN A;  1AB3 A;  3K5N A;  3CC2 V;  2Q0A A;  2XAH A;  2Q9L A;  3R65 A;  2VWJ A;  1KJ9 A;  2IW5 A;  1FPO A;  2R7L A;  1N36 H;  2BCC H;  3IJ4 A;  3FB6 C;  4LFC H;  4NXN B;  1Y76 B;  4IT5 A;  4HNA B;  1WNS A;  2IA6 A;  4RUA A;  3RYF B;  1ZSP A;  3BPZ A;  5H6Q A;  5LL6 b;  3MWD A;  4IIJ F;  4NZM A;  3UT5 A;  3JAW A;  2DYS C;  3A0H Z;  1I50 A;  3SJQ C;  3H1H H;  4DUZ B;  2V59 A;  4Q4D A;  2UXD B;  2F66 C;  2P6J A;  3K5M A;  3GB7 C;  2AW9 A;  4O2B F;  2ZT9 B;  3B4S A;  2GPW A;  2P0A A;  1KB9 F;  2GSM B;  1KEC A;  4O4J A;  2QJ1 A;  2UU9 O;  1OCC C;  5CB4 A;  3N2K A;  4O4I F;  1CQJ B;  4DR5 O;  2EIJ B;  1VQ6 V;  2ITC C;  4RZR A;  2JEX A;  1S5J A;  3G6V A;  3E2E A;  2DQ0 A;  4NVP A;  3LWB A;  4YJ3 B;  3GTQ A;  1M0W A;  4O83 A;  4LWS B;  1IBL O;  2DOS A;  3Q8Q B;  2DQ3 A;  3W1G A;  2GQS A;  2R7Z A;  3OGI B;  2YIB A;  4RQE A;  2XCP A;  1XHZ A;  1ZHS A;  4GX5 A;  1BQZ A;  4D6T H;  3CXH F;  3M7M X;  3MDS A;  4BW9 A;  1PL4 A;  3KCY A;  4R8U A;  1B06 A;  3JAM N;  2KQX A;  3K9A A;  2AZ2 A;  2IBZ H;  4FJC C;  2HIV A;  5LOV A;  3FD9 A;  5IWA H;  2QE7 G;  3HO8 A;  4DV7 B;  3CSW A;  4E2L A;  2YZM A;  2A79 B;  2YZN A;  3BAB A;  1KC8 W;  2VPQ A;  5KFB A;  1JCH A;  4ZI7 A;  2PYJ A;  3AG2 B;  4F4L A;  2Q67 A;  1KBL A;  3T9E A;  1RK6 A;  1B04 A;  3T1H B;  1SCU B;  5DG7 A;  1XMO B;  1CE8 A;  3GJX B;  4C5C A;  2NVY A;  3IAY A;  3L70 H;  1Y6X A;  2YEV A;  3K06 A;  1TWC A;  5C8Y B;  4LF6 H;  2X5R A;  1N32 B;  2RGR A;  5IT9 W;  1I94 B;  1GN3 A;  2M05 A;  5JQG B;  3TQT A;  1WP7 A;  5D1O A;  3BVO A;  2NR5 A;  2YS7 A;  2WLN A;  5BWX A;  2JA5 A;  2AGA A;  2Y4R A;  3RYI B;  2ODT X;  4JI8 B;  5B5E Z;  1P16 A;  4LF9 H;  4WFB V;  4JV5 B;  1TUB B;  1SA0 B;  5EIB C;  5L3C A;  4YHH O;  4MTG A;  2IJI A;  2EZP A;  4GKK B;  3RBZ A;  2UUC B;  3SE7 A;  3LUT B;  4WBN B;  4PDV A;  1FXK C;  4DXW A;  4J10 A;  1EUC B;  2OTJ V;  4WCE V;  2COJ A;  4RZQ A;  4RUE A;  5IJ9 B;  1N33 O;  3TEK A;  2E5L O;  1QLN A;  2F4V B;  1BL8 A;  4JI1 H;  1MSW D;  3OTO O;  2B1I A;  2EJR A;  1N4C A;  3R5X A;  4FFN A;  4QIW A;  3G8D A;  3E89 A;  3FX7 A;  4TV9 A;  1I2K A;  2FP4 B;  4YJ2 A;  1Y74 A;  4CZZ A;  4AI8 A;  1XIL A;  2CUG A;  5J2T B;  3T7A A;  3Q1K A;  1OCO B;  2Q7H A;  4IWX A;  5BWW A;  5CA0 F;  2CK3 G;  2ATK C;  3B77 A;  1I7N A;  3ZIA G;  4ZBM A;  2E3C A;  2VUG A;  3RWR D;  1HNX O;  1M57 C;  4LMY A;  2F23 A;  4O3P A;  5KG0 A;  1TGO A;  2Q8V A;  1SKV A;  4XZ3 B;  4K3A A;  3R9R A;  1YDX A;  1L2Z A;  2Q7G A;  1AI4 A;  2IMW P;  3E22 B;  2Q2T A;  3A2F A;  3AK2 A;  2CTQ A;  3O65 A;  3RT3 C;  4LF7 B;  3ZN1 A;  3ETH A;  4RAI A;  5J2U B;  2DZD A;  5BYB A;  1RFY A;  4UVA A;  5LGN A;  2A7W A;  4QPJ A;  3ZCC A;  4YAK B;  2Q7D A;  1EZV H;  4JZG A;  4Q4C A;  4DR2 B;  1WR2 A;  5LYJ B;  2HHH O;  2DIK A;  5CN0 A;  2AGP A;  4DL5 A;  2V4Q A;  1RYR A;  5LMU O;  2YRW A;  3IC7 A;  4LF5 H;  4J9Z B;  3NBZ B;  5KFK A;  4ZHQ A;  3BFR A;  2X6A A;  3A8T A;  3PVX A;  2BSK B;  4JI5 O;  2ZE5 A;  3FAV A;  5L9X A;  3FKI A;  3PR5 B;  5KMG A;  3T1Y O;  4O4J F;  4X62 O;  2GV9 A;  4FLW A;  3ICX A;  3ZMT A;  5CB4 F;  1M93 A;  3J81 W;  3DTU B;  1B6R A;  2WSS G;  3MHS C;  3ETJ A;  4Q45 A;  1KP3 A;  3SPH A;  4PZ6 A;  1IVS A;  5E1A C;  4EG0 A;  4DR3 O;  1BJT A;  1AP6 A;  1BHA A;  2DAA A;  4K0K H;  2FJZ A;  4EGQ A;  4O7Z A;  3RYC B;  2DWC A;  3JAT B;  2ZDH A;  5BXZ A;  3V4Z A;  2EIM B;  4TQF A;  5JJJ B;  1B6Q A;  3LQS A;  2VA2 A;  2ARH A;  4JAS A;  3N27 A;  1XNR H;  4F50 A;  1FJG O;  2ZR2 A;  3VOT A;  3BA8 A;  3ASN C;  3K3P A;  3JAS B;  1R1B A;  5LOV F;  2R92 A;  4RUC A;  1GN4 A;  1N34 B;  5EDW A;  2P4V A;  3RW0 A;  4DV1 B;  2IU3 A;  4DR7 O;  4ZI7 F;  3GQC A;  1J5E H;  3H4B A;  2JS5 A;  3BEH A;  2F93 B;  3GIM A;  4L87 A;  3QTC A;  4X1Y A;  1BNC A;  2QWN B;  4PI0 A;  2WLI A;  4HBN A;  5IYZ A;  2HJD A;  1VF5 B;  1BHB A;  2WLM A;  4MA0 A;  4DYL A;  2WE6 A;  2I80 A;  4L1K A;  1DK1 A;  2B63 G;  1JFF A;  2CGN A;  4J7Z A;  2UUA O;  2VQE H;  4BWA A;  2R8K A;  1S0O A;  4BY7 G;  5DED A;  2DMX A;  5DEC A;  2UXN A;  5E25 A;  2GTA A;  4A3M G;  1EBO A;  2JDI G;  3OFN G;  1UFI A;  2OWO A;  4YJ3 F;  3AG7 A;  3DGE A;  3STZ C;  1AR5 A;  1JIH A;  1ULZ A;  4AQY H;  5EYP A;  3LSQ A;  2W6Q A;  1QU7 A;  3W7U A;  4X66 O;  5K2M A;  3T99 A;  2XGQ A;  3BQ0 A;  3UCS C;  4X88 A;  3WO1 A;  5FNV A;  4LFB B;  4DR6 H;  3ZED A;  2ZDG A;  3G6X A;  3CD6 V;  5KFV A;  5CMU A;  2HKO A;  4LF8 H;  2VQF O;  2VR1 A;  3EHB B;  3OR7 C;  1KEE A;  4IR1 A;  3D3I A;  4FFB B;  4X20 A;  1W0K G;  4I4T A;  2A1H A;  4TV9 F;  2JS3 A;  1N56 A;  1NVP D;  2XAF A;  3CWB H;  2X0L A;  5IY5 C;  3L9D A;  4I55 B;  3OUZ A;  5BR8 B;  3TY8 A;  3TII A;  4ED8 A;  2IM9 A;  2LQT A;  4KL1 A;  4J9K A;  4R7R A;  2ZCE A;  2UXC O;  4OPA A;  4CH6 A;  3MAQ A;  4B3M O;  4LNU B;  4NTY A;  1HNW O;  4B3R H;  3L71 H;  4PDR A;  4Y8V B;  4JI2 H;  3BHP A;  5H2F Z;  1BCC H;  2MCT A;  3TXQ A;  5B3S B;  5LMN O;  3LDD A;  1VBH A;  4GX2 A;  3RN4 A;  4DV4 H;  3J7A K;  1K83 A;  4Q20 A;  3JAL B;  3WB0 A;  2Y69 B;  3R23 A;  4DUZ O;  5L3E A;  1YZB A;  2UXD O;  2FKX A;  1G6U A;  3LNN A;  2ZE6 A;  3T9A A;  3APO A;  4FLX A;  2UU9 B;  3EPG A;  4ETS A;  1OBG A;  1I1K A;  4DR5 B;  2EUL A;  2GUZ A;  4MVR A;  4FU0 A;  4XX0 B;  3PO3 G;  1US6 A;  2Z3Y A;  2KSD A;  3CSX A;  5K1X A;  3JSN A;  5A2Q W;  1LNQ A;  4DL4 A;  3SYA A;  4X89 A;  5L3D A;  3ZRX A;  4H37 A;  1IBL B;  5KFT A;  3PW0 A;  1THZ A;  2JEU A;  4DK0 A;  4FM1 A;  1A0G A;  5J2T F;  4CMD A;  1XEQ A;  3PZP A;  1V9P A;  1L0N H;  3SYP A;  2JEF A;  3ASO C;  4DRF A;  3DXR B;  1DV2 A;  5B1A B;  4ASU G;  3OUS A;  4ED7 A;  3CRA A;  4LR3 A;  4TT3 G;  3K04 A;  4A5U B;  4DO2 A;  3JZ6 A;  1QLE B;  2HFE C;  2HEP A;  2FYU H;  4IYH A;  1MOF A;  1R3L C;  4DV5 H;  3KCX A;  5IT9 N;  4JYC A;  1B3Q A;  1NKD A;  5IYB O;  4FFR A;  3V4S A;  1YVW A;  4MV3 A;  2Q69 A;  3S24 A;  1W2B U;  1KYO F;  3HKD B;  5IYD O;  2R70 A;  4PWQ A;  5KFM A;  5BMV A;  1J95 A;  4N23 A;  2UXB B;  5CR5 A;  3T9F A;  3MD0 A;  5LA6 A;  1SF9 A;  3LSS A;  4XBF A;  2ASL A;  1T36 A;  3UFX B;  2ZXW C;  4JI7 B;  3LSU A;  3RGX A;  2W57 A;  3RV4 A;  2CKZ B;  4DW1 A;  1EHI A;  1U97 A;  2FPP B;  4TSF G;  3T1H O;  3QO7 A;  1T5E A;  1XMO O;  3STL C;  1KTA A;  3RTX A;  1AUX A;  4UV8 A;  5HNE A;  4G27 B;  4YIO A;  2PI4 A;  5LYJ F;  4X1I A;  1N32 O;  1GKF A;  1K9M W;  4QE9 A;  5FD6 A;  1I94 O;  3MFH A;  2K1E A;  5LHG A;  1BXR A;  2WAQ A;  4JI0 H;  5EK0 A;  4ED1 A;  2ZKO A;  1ORQ C;  4L8J A;  2V7Q G;  4IIJ B;  2W71 A;  5BWR A;  3RVZ A;  2ZGI A;  3RFC A;  3KHL A;  3BAA A;  1VQM V;  2DYS B;  5EBM C;  3KHH A;  4F6R A;  4JI8 O;  2HVS A;  1FYJ A;  2VWK A;  4YHH B;  3HKC A;  4DL7 A;  4JV5 O;  4O2B B;  3K5I A;  2AGQ A;  3EFF K;  1Z5V A;  3CJH A;  1GH6 A;  1HW7 A;  3ZHU A;  1NI8 A;  3TY9 A;  2UUC O;  1OCC B;  4DR1 B;  2R8H A;  3OMN B;  4UB6 Z;  1K1S A;  4KHP H;  3H20 A;  2DYR C;  3N8D A;  4JV0 A;  2QKS A;  3CC7 V;  4B7E A;  1A48 A;  4CKC A;  4J11 A;  2W8K A;  1E4E A;  1QNM A;  3HKE B;  4R8C A;  3NR7 A;  2F4V O;  2B9Z A;  2BQU A;  5FPR A;  2MW2 B;  5I60 A;  5L1K A;  4FZ1 A;  3RFR A;  3THO A;  3ZS8 C;  3H4D A;  5FNV F;  2QTS A;  3JAK A;  4BIZ A;  4JI6 B;  2CDY A;  5DN6 G;  2QM7 A;  3IN5 A;  1HNX B;  4KFM A;  3PJS K;  2D3O W;  5B66 Z;  4NXM B;  3SYQ A;  1K92 A;  4GZR B;  1PNL A;  3OUU A;  4I4T F;  3KTM A;  5T14 A;  1JKJ B;  1S5H C;  5F2V O;  4DAA A;  2CAZ C;  4FS2 A;  1D5N A;  5DQG A;  1GO3 E;  5B1N A;  3GID A;  4DV2 B;  4IRC A;  1XNQ B;  3VBB A;  2KG7 B;  2C28 A;  3Q8R B;  1IBM H;  4LF7 O;  3FB5 C;  4NR1 A;  4CH4 A;  4ED3 A;  3AK3 A;  3GWO A;  3J81 N;  3WG7 C;  2Q68 A;  1H8E G;  1NR7 A;  3SPJ A;  5JJE B;  4O7Y A;  3KYH C;  1KJ8 A;  3TCU A;  2R7K A;  2M7W A;  4ZQI A;  3SPI A;  2AGO A;  4EEY A;  4U3F H;  4DR2 O;  4A93 G;  5KHG A;  1E4F T;  4LFA H;  2IU0 A;  1Q81 W;  3BJY A;  2UUB H;  1YTF D;  3PW2 A;  1V4Y A;  4I50 A;  2LFS A;  2QF7 A;  4HNT A;  4A3E G;  3T1Y B;  4YR3 A;  2GTS A;  4OX9 H;  3T1C A;  4Z1V A;  3K57 A;  2WTF A;  4G3I A;  2HVQ A;  1LUV A;  3E8B A;  3E86 A;  4Q43 A;  5GTI Z;  3CCL V;  1VAR A;  3Q2O A;  3QWU A;  3JRX A;  1X9N A;  5I5V A;  2RF4 A;  2HJF C;  3N6R A;  4LCU C;  5EC2 C;  3LP8 A;  4DUY H;  2WA3 A;  3T5K A;  2DWD C;  1XHX A;  1GSH A;  2FPG B;  3BRC A;  1WCM A;  1KBH A;  3MR2 A;  3ZN0 A;  5J9P C;  5CA0 B;  2EIN C;  3D36 A;  5KHJ A;  1AJN A;  2EIK C;  1R6T A;  2WDT A;  2A06 H;  2XUM A;  1M57 B;  1VQK V;  4DR7 B;  2DJV A;  4DV3 H;  2FKL A;  4WFF A;  5LA6 F;  2ABJ A;  1N34 O;  2Q6A A;  4YY3 B;  4YAJ B;  1JX4 A;  1WN7 A;  4IHJ A;  4IL6 Z;  2Z04 A;  5KG3 A;  5EZY A;  5BZB A;  4U6P A;  2YC0 A;  2JGU A;  3RB0 A;  2GHY A;  2C2A A;  5A9G A;  5KFA A;  1MMM A;  4YR0 A;  3L4J A;  1F4M A;  3U55 A;  1JOY A;  2JA7 A;  1OZ0 A;  2W0X A;  4DV6 B;  3QQM A;  2FMA A;  3HOZ G;  4F4Y A;  3Q4H A;  2R7M A;  1FXK A;  1TUE B;  4IYI A;  4EFB A;  3L2P A;  4RQF A;  3UT5 B;  3JAW B;  2E74 B;  3HR0 A;  4JZ2 A;  4FLZ A;  1Q82 W;  2PYL A;  5LP6 C;  1T3N A;  1HNZ H;  3C3T A;  1V55 C;  4FM0 A;  3P30 A;  1GO3 F;  3QFF A;  3C90 A;  3PO2 G;  4O4J B;  2CTP A;  3W7S A;  5CB4 B;  3N2K B;  1MA1 A;  2W6O A;  4ECY A;  3GTK A;  1KMI Z;  1IBK B;  3H3V H;  3TQ1 A;  4M7E A;  1YF2 A;  3IC9 A;  4EEQ A;  4EBC A;  2XOK G;  5H80 A;  3HOX G;  2W8L A;  3H0G A;  5CBG A;  1NTK H;  1TVK A;  5KT3 A;  4R7C A;  2QM4 A;  3KAK A;  1AUV A;  2HR3 A;  1I1M A;  3C3S A;  1ZQ7 A;  1NTZ H;  5DM6 V;  3TW6 A;  4X1K A;  4UCR A;  2F43 G;  3W1B A;  3CCR V;  3SR2 C;  4FLU A;  1SQG A;  4IZO A;  4PDB A;  3B40 A;  2NU7 B;  4P9P A;  4AIL C;  4FFL A;  3AX6 A;  4QW8 A;  3RYH A;  3CHX A;  5BR8 O;  4Q0Y A;  4JI3 O;  4R8U B;  1HNW B;  2EJ2 A;  4O84 A;  4CC6 A;  3K5O A;  1X4T A;  5IDJ A;  3A0R A;  3ASN B;  3QF7 A;  3UZO A;  5LOV B;  4A3F G;  2L6L A;  1ET0 A;  3RIZ A;  5LMN B;  2X0S A;  3OTF A;  2OT5 A;  5A2Q N;  4J9Q A;  3NC0 B;  4ZI7 B;  4E6N A;  4H13 B;  2JVD A;  4MS2 A;  2B1G A;  1XOU A;  4DV0 B;  1PP9 H;  1BS3 A;  4CS3 A;  5KG7 A;  2XCL A;  1LUW A;  1L1F A;  2R7Z G;  2YEV B;  2IJK A;  2EIL C;  5FPO A;  3W7W A;  1BMF G;  1M6V A;  5KFH A;  4A3I G;  3WFV A;  4O2A A;  4QSH A;  3ZRW A;  3L73 H;  4EKW A;  1UC9 A;  5D1O B;  1PV0 A;  2WLH A;  4YXW G;  1KKD A;  4IWY A;  3KAL A;  4DR4 B;  3BQ1 A;  4RNO A;  1CKN A;  3SGI A;  2YS6 A;  3HOY G;  4ECZ A;  3WB1 A;  2XHB A;  2AZ0 A;  2YS8 A;  1MAB G;  5KFJ A;  4ECV A;  5C93 A;  1L0L H;  4JTA B;  1QVG U;  5HFM A;  4GX1 A;  1S3J A;  3AG4 C;  2ILM A;  1NTM H;  5JVL A;  2PZS A;  3SJC C;  3AG3 B;  4DRX A;  1ZHQ A;  4HR7 A;  3OHA A;  1Y66 A;  1CQI B;  4J9P A;  4U3J A;  4DQN A;  4RB1 A;  1UNN C;  2C2R A;  2FLN A;  1C30 A;  5GW7 A;  1SYX B;  2EIY A;  1NT2 B;  4X64 H;  4TV9 B;  4ECW A;  4YJ2 B;  1FD9 A;  1Y74 B;  3KZI Z;  2JA5 G;  4JAU A;  2UXB O;  1O9H A;  1CKO A;  2W6J G;  1K73 W;  1CXZ B;  5I5W A;  1KJJ A;  3ABK C;  2QK4 A;  1FS0 G;  1N48 A;  3D36 C;  1OCZ C;  4JI7 O;  3QO8 A;  4J42 A;  3GTJ A;  1DTO A;  4O7R A;  4JI4 H;  4RNN A;  2XND G;  1P7B A;  3HPL C;  1EKF A;  1KT8 A;  2KB1 A;  3ZX6 A;  2AHZ A;  4JYA B;  3GV5 B;  1P84 F;  5IYB G;  3JAR A;  3AG1 C;  2NVX A;  5EZY F;  5CAE B;  3CC4 V;  2ZQM A;  5IYD G;  2DW4 A;  2DE0 X;  4QWC A;  2Q0O C;  4IRK A;  4QE7 A;  5KFY A;  4H0L B;  2V1D A;  5LHH A;  4MT8 A;  3WU2 Z;  5KFN A;  2VUM A;  5JQW A;  4B3T H;  3OGC C;  1B6S A;  1N33 H;  2R87 A;  3QNE A;  4XDK A;  1UC8 A;  2FTK A;  2E5L H;  3F5W C;  2ODM A;  3TY5 A;  3OTO H;  4DR1 O;  1YTF B;  2G38 A;  1IDS A;  1O75 A;  5BWT A;  2W7O A;  3FAV B;  4ECT A;  1XL4 A;  5KMG B;  3R5H A;  3JYC A;  3JD3 A;  2W9C A;  2QWP B;  1H2L A;  1K5S A;  3ASO B;  2QR4 A;  2V58 A;  3WNZ A;  1XDC A;  3H1I H;  4WFH A;  5EWF A;  4JI6 O;  3TK1 A;  1PX2 A;  2ZM6 H;  3N2G A;  2YWV A;  4EYH B;  3JSL A;  2E76 B;  4CKE A;  4NXM O;  4O7S A;  5IP9 G;  1VQ7 V;  3GLK A;  1S77 D;  1R3J C;  2BTQ A;  3CME V;  4FFO A;  3HKB A;  3LNM B;  2LP7 A;  2Y4U A;  2RJZ A;  4DV2 O;  2J9G A;  1XNQ O;  2ZXW B;  4LF4 B;  1M4U A;  1JDE A;  3FKI G;  1G4Y B;  3ZHR A;  1T94 A;  3GIL A;  1RYS A;  5K3W A;  3TIG A;  1QR8 A;  2YL2 A;  2XC9 A;  2HHH H;  2V5A A;  3JD1 A;  3JD4 A;  3KHG A;  5LMU H;  1XMQ B;  4QIW E;  2BQ3 A;  1S0V A;  3GIP A;  3B8M A;  4BAY A;  5EC1 C;  4I7Z B;  3CRM A;  4JI5 H;  3VQY A;  4A2B A;  2HVJ C;  2YU9 A;  1AJP A;  4X1Y B;  3T1Y H;  3NXS A;  4X62 H;  1EYZ A;  2WLI B;  5IYZ B;  2RCV A;  4YBZ B;  3TET A;  3GB8 B;  1TUB A;  4O2A F;  3ZMU A;  4E4T A;  4IR9 A;  3K9S A;  4X65 B;  2XIG A;  3H9V A;  4DR3 H;  5CE8 A;  1I7L A;  5KT2 A;  2PTM A;  1M7J A;  1PM9 A;  3P32 A;  4JYB A;  5D8D A;  4JTD B;  2R92 G;  5KFG A;  3ZHQ A;  4JXU A;  2DYR B;  2ZNI A;  1SES A;  1AIL A;  3ZRV A;  1I0H A;  2H3O A;  5L3F A;  1Q8I A;  1KUQ A;  1HDJ A;  5EYP B;  4MTE A;  4JUZ A;  3FDS A;  1FJG H;  1A9X A;  4O4H A;  1AI7 A;  4BIU A;  4HNU A;  2CTW A;  3G8C A;  3D3Q A;  5FNV B;  1NH2 D;  1S68 A;  1Z2N X;  1FFX B;  4DW0 A;  2JGD A;  3N44 B;  3MHH C;  1QR9 A;  1YIJ V;  1P8L A;  1H8H G;  2EJ3 A;  4X20 B;  4I4T B;  3GV8 B;  3X2Q C;  5I5X A;  1ZL8 A;  2JA6 G;  1WRV A;  4QGP A;  4K0K O;  5D5Q A;  5KA6 A;  2QM8 A;  4YY3 O;  3OHB A;  1V51 A;  1JJ2 U;  2VOB A;  2WAM A;  1ZWI C;  4O3N A;  2BQR A;  2R9A A;  2UUA H;  1ZTE A;  3FYI B;  1SEI A;  1GRJ A;  3CB2 A;  1YCI A;  3AYH B;  3VQW A;  1IXB A;  4TVI A;  4TUY A;  2BR0 A;  3M99 B;  5EIB D;  1GYF A;  2LO1 A;  1M1K W;  5BPF A;  4GKJ B;  4KXR A;  4BR6 A;  4DV6 O;  1WP8 A;  2V4R A;  4DL3 A;  1YJW V;  4TV8 A;  2WPD G;  3L4K A;  1KJI A;  5EBL C;  1GN6 A;  4X66 H;  1ARO P;  3SPC A;  4G28 B;  1HR0 B;  4MVM A;  1TWG A;  4PD4 F;  4M9U A;  3CPW U;  1Q6I A;  1IYD A;  2Z02 A;  2R8G A;  2GUZ B;  2PMZ A;  2VQF H;  2JEI A;  2QA4 V;  2QKC A;  3ZMZ A;  1YJN V;  1WB8 A;  1IBK O;  4BWS C;  1ZUQ A;  3IG0 A;  2YI9 A;  3LDE A;  2WA4 A;  4QIW F;  3OAA G;  2FL4 A;  2H94 A;  1AR1 B;  2HGX A;  3I12 A;  4YJ2 F;  2P7T C;  5DIS C;  4AHC A;  4F4W A;  1K5Q A;  2FK2 A;  4J9L A;  4FM2 A;  1K4D C;  3MFI A;  4ME6 A;  2UXC H;  2XGP A;  4B3M H;  2IP4 A;  4JI3 B;  3G6Y A;  5KG2 A;  4GC6 A;  2YYA A;  4YR2 A;  4B3S B;  2EIN B;  2ZIM A;  1F4N A;  2WWW A;  1FFT B;  4XDL A;  1WAZ A;  4NXN H;  2FK1 A;  3V6K A;  2EIK B;  1N0J A;  1PNK A;  2UXX A;  4CH3 A;  3HXL A;  3E8G A;  5BMV B;  1I2L A;  3NBY B;  1B33 N;  3OUF A;  3AG2 C;  2VS0 A;  1Y14 B;  5FLM G;  4NLG A;  4MV4 A;  5LA6 B;  3DC5 A;  1PL0 A;  5LXT A;  2Q4P A;  4GCZ A;  4DUZ H;  1I6U A;  1VAJ A;  1EN6 A;  3U0Z A;  1KD1 W;  4WHX A;  1DLB A;  4HQ6 A;  2PMZ E;  2UXD H;  2RDC A;  4DV0 O;  4M0J A;  3RR5 A;  4CHI A;  4X9Q A;  5KAI Z;  1M9N A;  2P90 A;  3E83 A;  1H38 A;  3KG2 A;  4MTF A;  3SNO A;  4FM9 A;  5EWG A;  1HWY A;  3OMA B;  2J6U A;  2OCH A;  1SQB H;  4A3B G;  3RB3 A;  1VQN V;  4C2M A;  3I56 V;  4O7L A;  4HYK A;  5KFO A;  4X1I B;  2HVR A;  4UCV A;  1N36 B;  1RJP A;  5DQH A;  1G2W A;  1FAF A;  1Q7Y W;  4LFC B;  2ASD A;  2CH7 A;  4JV1 A;  4FFP A;  4B3R O;  4ZHQ F;  4JI2 O;  4FGR A;  4DR4 O;  1D2D A;  4MSW C;  1M0T A;  1SFO A;  4EGJ A;  1KQS U;  3EYY A;  1G1X B;  2YIA A;  5ITZ A;  2MK3 A;  4LC1 A;  4F6R B;  3H1K H;  4DV4 O;  4O3Q A;  3K3V A;  3HKC B;  1VQ8 V;  1CS0 A;  3PN1 A;  2R6F A;  1EZJ A;  3M9N B;  2V4D A;  3CJH B;  2EX3 A;  1VBG A;  2YIB D;  4RU9 A;  4DV7 H;  3V6J A;  1E4E B;  1ROP A;  1XUQ A;  4HYO A;  4KUM A;  3HB9 A;  5EBW C;  3H01 A;  2R7N A;  5BY1 A;  2Y0S A;  1NR1 A;  3T1H H;  1EN4 A;  5AG2 A;  1VF7 A;  4WFE A;  3DC6 A;  4B08 A;  1XMO H;  3NUA A;  4HAM A;  3JAK B;  5CM0 A;  4MV6 A;  3HOV G;  5KX5 A;  4JAA A;  1GN2 A;  4MV7 A;  1N32 H;  4JTC B;  1E4G T;  4LP8 A;  1IZ3 A;  2DPI A;  1E1Q G;  1I94 H;  3VPB A;  1O9G A;  1Q6U A;  1K97 A;  4O3S A;  4UB8 Z;  3B09 A;  3OSN A;  1RPR A;  1MSD A;  2WB1 A;  4C5A A;  4O82 A;  5IWA B;  2JK5 C;  4MVU A;  4JYA O;  3K08 A;  4JI8 H;  3U10 A;  1VP7 A;  5I5U A;  4ECQ A;  1S10 A;  4J80 A;  5KHH A;  5IYZ F;  1M56 C;  2QWQ B;  3E8H A;  4JV5 H;  4O7W A;  1XQ8 A;  1QCE A;  1RSO A;  3M9O B;  4R50 A;  1Q90 D;  1SRY A;  4FE2 A;  5LP6 A;  5LGU A;  3ORQ A;  4UUG A;  2UUC H;  2PBZ A;  3ZHT A;  4PZ8 A;  4TUY F;  1VMG A;  2CW8 A;  1K34 A;  4U7O A;  1SQP H;  2EIL B;  5TIS Z;  2ZJT A;  1N0N A;  2IJJ A;  4NKG B;  2W70 A;  4LF6 B;  4UCT A;  3OD4 A;  3PFF A;  2Y0S E;  4Z2W A;  4FLV A;  3RB4 A;  2GDS A;  2FLP A;  2QWR B;  4TV8 F;  2GBO A;  3FFQ A;  4RAY A;  2F4V H;  3RB6 A;  2M6Y A;  1OWT A;  3E5N A;  3OEH G;  4PV1 B;  4I50 B;  1SQQ H;  4WD3 A;  1Z2P X;  5GON A;  5FLX W;  1BGW A;  2D2C B;  1Y1W A;  4LF9 B;  1MZF A;  1NBM G;  4J7K A;  4CC5 A;  2FPI B;  2CQY A;  2WB1 E;  2WAQ E;  2OCC C;  3SYO A;  5FD5 A;  5C4X G;  1SQF A;  2XTA A;  2ZDI A;  2XAG A;  3N43 B;  4ZIB A;  5JUM A;  4YB8 B;  5DGI A;  4A3K G;  3W7X A;  3KRE A;  3JCZ A;  5D1P A;  1MZE A;  2EIM C;  5BWV A;  4F6E A;  4JI1 B;  2W6P A;  2R8J A;  2R93 A;  4J9M A;  3HOU G;  4P30 A;  2R82 A;  4LF7 H;  2HHF A;  1P4R A;  5JCO C;  1KC7 A;  2YDE A;  1NH2 B;  4B7K A;  4MW3 A;  1Z2O X;  4PDM A;  1Y1V G;  3ABK B;  2WLL A;  4XYM B;  1OCZ B;  4LF4 O;  2H8P C;  4GKK H;  1EFR G;  3CYO A;  2XAS A;  3BQ2 A;  4DR2 H;  1DF5 A;  1YIT V;  2LW7 A;  3N40 P;  3WB2 A;  5B1O A;  2JJ2 G;  3RAX A;  4BIO A;  1TWF A;  5L1J A;  5LXT F;  1XMQ O;  5BYA A;  2N74 A;  3VQX A;  1FKA H;  2C00 A;  5EZY B;  5KG6 A;  4GT1 A;  4MTX A;  5KT7 A;  1BSM A;  1AR4 A;  3CE2 A;  4E4E A;  3G67 A;  5KKN B;  1YI2 V;  2CTR A;  1IOV A;  1EUD B;  3QG5 A;  4X65 O;  1AI5 A;  4G2K A;  1RPO A;  3BA9 A;  2FB9 A;  4O4I A;  3Q4H B;  3PW4 A;  1FXK B;  3HOW G;  4A3G G;  5DG8 A;  1OCR C;  4O3O A;  4FVM A;  1SET A;  3TGU H;  2I87 A;  4GC7 A;  2ZDQ A;  5H5N A;  1IUR A;  4TM5 A;  2ZD9 A;  5DGB A;  4LF5 B;  3KHR A;  2C2D A;  4LBE C;  2X6C A;  3JCU Z;  1FVI A;  2UUB O;  5KFE A;  4PDL A;  4A3C G;  3T5J A;  4K6N A;  4J9S A;  5KS8 A;  3C0F B;  5KFR A;  5IJ0 A;  3K59 A;  3RF2 A;  3TIN A;  4JF3 A;  1WSC A;  3U54 A;  3U0G A;  4FMT A;  4FFM A;  2JA7 G;  1N34 H;  3CQZ A;  4DV1 H;  1TVK B;  1PK8 A;  2CZG A;  3G6B A;  4P2Z A;  4PEL A;  5L3G A;  5BMV F;  5CBH A;  4EBD A;  4J0M A;  1KP2 A;  4K0K B;  5K1P A;  2NNU A;  3U9T A;  4X1K B;  2BOB C;  2E2I A;  3GIQ A;  2Q5Z A;  2R9R B;  1R3I C;  2WYO A;  4I0X A;  5KX5 F;  1S97 A;  3EPI A;  3UYY A;  3RYH B;  4GLW A;  3VMM A;  1XNR B;  3CCE V;  3CCV V;  2Y0I A;  4BBR G;  1GAX A;  1ENV A;  1P7G A;  4O4L A;  4O81 A;  1Y67 A;  1H2G A;  4QWE A;  4DL2 A;  1K3E A;  4GKJ O;  1KU9 A;  2Y69 C;  3CCU V;  3K79 A;  4YQW A;  1J5E B;  2QKA A;  5KT5 A;  4Z1M G;  5LP6 F;  5B1B C;  2ETN A;  1U96 A;  1HR0 O;  5CA3 A;  2XCA A;  4LFB H;  4O2A B;  4CMF A;  3SDL A;  3ZRW B;  4ZKI A;  4RB0 A;  3ZHS A;  1XRE A;  4UXN A;  4RUF A;  4O7N A;  5KFP A;  2R8I A;  2CNV A;  3DTG A;  4P9O A;  3K5H A;  1CKN B;  1VF6 A;  2VQE B;  1YEW A;  3F8N A;  3S3X A;  2I8C A;  5KG1 A;  5KFX A;  4EBE A;  2UVW A;  2R9I A;  3J80 W;  1WB7 A;  1E79 G;  3OW2 U;  1WJZ A;  4A3D G;  4QJF A;  4AQY B;  5BR8 H;  1A0I A;  2PUS A;  3P3N A;  5B1A C;  4XYL B;  3T4D A;  1XL6 A;  3APQ A;  3AEI A;  4WFG A;  1QLE C;  2ZDI C;  4DRX B;  4H33 A;  4ECR A;  1S76 D;  1GM9 A;  2ADQ B;  4O7T A;  4U3J B;  4DR6 B;  3VPC A;  3P3P A;  3QZ7 A;  2UVV A;  4B3S O;  3N41 B;  1K1Q A;  4LF8 B;  3ETD A;  3IFX A;  2NU9 B;  2W9B A;  3ML0 A;  5BWU A;  3GII A;  1RJQ A;  4YP3 A;  3UO3 A;  1F23 A;  3CMA V;  2SCU B;  3CEB A;  3SJA C;  2YXY A;  1W59 A;  2QEX V;  2ZIO A;  5E79 Z;  5EWE A;  4CBC A;  3UM7 A;  2UU9 H;  2JA8 G;  4FLT A;  4RAZ A;  4DR5 H;  5HBR B;  3CRQ A;  2IH3 C;  2NU6 B;  3RV3 A;  5JH7 A;  4NYK A;  4W4K A;  1S0N A;  3ZMS A;  3DSQ A;  3JAR B;  5HFL A;  4D7T A;  1JPX A;  1Y4M A;  4NB5 A;  4XDJ A;  1VQP V;  4J7J A;  4B3R B;  4JI2 B;  1N36 O;  4PA6 A;  3NGD A;  4K8Z A;  2W0F C;  4EB6 A;  3R5F A;  2Z0A A;  2ZE7 A;  4LFC O;  4FIP C;  4I50 F;  1IBL H;  3UZB A;  1BZK A;  2LFR A;  3GTL A;  4PI2 A;  1GM7 A;  4DV4 B;  1WA8 A;  2R72 A;  1SER A;  1FXV A;  3FB7 C;  1LR1 A;  1PKX A;  5KFD A;  1Q6H A;  1W0J G;  1QQC A;  2JIZ G;  3D8C A;  1WPB A;  2WLK A;  1KJQ A;  2PF4 E;  5DG9 A;  4BW5 A;  2HDK A;  2VPS A;  4ED6 A;  1S9F A;  5JVD A;  5KT6 A;  2CNU A;  1S0M A;  3G80 A;  5CBF A;  2UXB H;  2B5U A;  3F7V C;  2JEJ A;  4JI7 H;  4IRD A;  3B2E E;  2Q2U A;  3VOU A;  4ZOL A;  2P22 C;  1CEZ A;  2EJ7 A;  2W9C B;  5CA1 A;  3S3W A;  2PGG A;  5IY5 B;  3I4N G;  1I5X A;  3GV7 B;  4N21 A;  2VUM G;  3N2G B;  4JGS A;  3CRC A;  2QB5 A;  1WLE A;  1XI1 A;  3BCC H;  4DV5 B;  3MR5 A;  1Y76 A;  4HNA A;  1G8M A;  3TJT A;  4IHJ F;  2BTQ B;  2YCH A;  3RYF A;  3HKB B;  4CKB A;  5IWA O;  5F9N A;  4OGQ B;  1GM8 A;  4I9W A;  4UVB A;  3N42 B;  4X64 O;  5FLX N;  4HNV A;  4YHH H;  5IYC O;  3OE7 G;  4MAM A;  4CS4 A;  4O4L F;  3ABM C;  1TA8 A;  3GIJ A;  3ABL C;  4DR1 H;  3RAQ A;  4JI4 O;  4BXX G;  2XT9 A;  2QYZ A;  1H2M A;  4LF6 O;  5GTH Z;  4NTX A;  1FXH A;  1XBL A;  2CFM A;  4MV1 A;  4JI0 B;  5KFI A;  1AJQ A;  4ZHQ B;  2C35 B;  1WH2 A;  1GSO A;  1VS0 A;  2IH1 C;  4YJ3 A;  4A3J G;  3M4I A;  3SI8 A;  3ABT A;  3ZMV A;  4ECS A;  5FJ8 G;  5IE9 A;  4LWS A;  1RM1 C;  3I4M G;  4JI6 H;  3ZRS A;  3F7Y C;  1HNX H;  4LF9 O;  1HP8 A;  4I7H A;  1DF4 A;  3B8N A;  5DMX A;  5HV6 A;  4NXM H;  2WLJ A;  1VF6 C;  4MVO A;  2NUA B;  4AYB A;  4RNM A;  3CCJ V;  4B3T O;  1EKP A;  5KG4 A;  1V54 C;  2P06 A;  4KHP B;  3ETE A;  1TWH A;  4HZ3 A;  4DK1 A;  1E1R G;  3CXC U;  4DV2 H;  1R6N A;  1XNQ H;  2RGV A;  2AXT Z;  4O4H B;  5KFF A;  1SZT A;  4NTW A;  4JI1 O;  4Q8E A;  5LHI A;  2RDI A;  3AW8 A;  1SQX H;  4APM A;  1JDB B;  1NU1 H;  2JGD B;  3EXA A;  1VEW A;  4FFK A;  5C8Y A;  2UVR A;  2ZR3 A;  2HP8 A;  1K33 A;  5D5P A;  5JQG A;  4NZN A;  2KSW A;  1ZL8 B;  2ZM6 O;  3HKZ A;  4BBS G;  3E8F A;  1BQ0 A;  1PPJ H;  4O86 A;  3CRR A;  2W9A A;  1VQL V;  1ZAU A;  2RNB A;  3CS5 A;  1JR9 A;  2VA3 A;  3Q8P B;  5KUK A;  3DTF A;  3RYI A;  2HLD G;  3CCM V;  1PNM A;  1RP3 B;  4AYB E;  1NZ6 A;  1M56 B;  4J41 A;  3VQV A;  1S03 G;  1IBM B;  5JJN B;  1GGO A;  1SA0 A;  5JH7 F;  4EFE A;  1MNG A;  4TUY B;  2GPS A;  1SQV H;  1W93 A;  1JFF B;  4WBN A;  1CP9 A;  1VQ9 V;  5LGT A;  5I5S A;  2ZIN A;  1JLL B;  5IJ9 A;  4TV8 B;  3N6X A;  2YIC A;  4IAJ A;  3K0G A;  2P67 A;  1H2S B;  2OIE A;  2W6N A;  4UFZ A;  4FLY A;  4LFA B;  4MV8 A;  2UUB B;  4CS2 A;  4MVS A;  4MVQ A;  2PY5 A;  4LF5 O;  1AVM A;  4OX9 B;  1Q3E A;  5J2T A;  1A32 A;  4QW9 A;  2ADP A;  2YXL A;  4OPH A;  4DL6 A;  2YI8 A;  4MVZ A;  3HKZ E;  4PA9 A;  1W96 A;  3KXY T;  5JVD F;  2OCC B;  3FYE B;  1SC5 B;  1R3K C;  4DR7 H;  3HT5 A;  5C1O A;  2FE3 A;  3T5H A;  5KFW A;  4YY3 H;  3U9S A;  3ABU A;  4ZOL F;  4K35 A;  2OLS A;  5CA1 F;  2P5O A;  1EKV A;  5DGA A;  1JXL A;  4DUY B;  5I5T A;  3E22 A;  2PVP A;  4QPK A;  4UCU A;  1VQ5 V;  1OHH G;  3GVM A;  1GMG A;  5J2U A;  4QWD A;  3I5D A;  1XNR O;  2YZL A;  3SJB C;  2C2E A;  4DV6 H;  3WG7 B;  3K5L A;  4A3L G;  2PI5 A;  3CCS V;  2QDO A;  2RMK B;  3T4Z A;  1QHT A;  1JMK C;  5LYJ A;  2HIX A;  3ORR A;  1DIK A;  1R9T A;  1BT8 A;  5LXT B;  4DV3 B;  3CVZ A;  1X59 A;  5LBQ A;  1NQT A;  3T9B A;  4UCO A;  5H6R A;  3J80 N;  2Q73 A;  5DLG A;  1AN7 A;  2IJH A;  1J5E O;  2BSK A;  1NJI W;  4JV2 A;  2GLT A;  2VQD A;  1TAE A;  5KFC A;  2OTL V;  1WPX A;  2EIJ C;  1VQ4 V;  4ECU A;  1IBK H;  3UQ8 A;  2Y0P A;  4PA7 A;  4CE5 A;  2BOC C;  3QO5 A;  2CH7 B;  3TW7 A;  2JA6 A;  2DPJ A;  4I9Q A;  1JQ0 A;  3G4S V;  3GTP A;  1OCR B;  2E2H A;  2NLJ C;  2VQE O;  5ITZ B;  3RYC A;  3JAT A;  3M8A A;  3EVK A;  4R6Z A;  5KHI A;  2W6M A;  5KHK A;  2BTO A;  1HNZ B;  3K58 A;  3AG3 C;  1YHQ V;  4LSX A;  4AQY O;  1GLV A;  2OH2 A;  1HNW H;  5JCO A;  1DV1 A;  3OMI B;  2B63 A;  2YSU B;  1FFX A;  3JZF A;  3BAC A;  1COW G;  3JAS A;  4W4L A;  4DR6 O;  4QWA A;  5LMN H;  2EBO A;  3CEI A;  3CP1 A;  3ETG A;  3K0D A;  3W5O A;  1ZLZ A;  4JYY A;  2W6Z A;  4LF8 O;  4DV0 H;  2J6S A;  4O7V A; 
#chains in the Genus database with same CATH homology
 1Z2O X;  4D7S A;  4CC6 A;  3K5O A;  1X4T A;  3QF7 A;  5LOV B;  1L2Z A;  2Q7G A;  3RIZ A;  5LMN B;  3E22 B;  3OTF A;  5KX5 B;  3A2F A;  2Q2T A;  4DR2 H;  3NC0 B;  4ZI7 B;  3N40 P;  4LF7 B;  4E6N A;  3WB2 A;  2JVD A;  4DV0 B;  4CS3 A;  5J2U B;  3VQX A;  1FKA H;  5EZY B;  4DR4 H;  3U11 A;  1P49 A;  5FPO A;  4DR2 B;  5LYJ B;  4Q6G A;  4O2A A;  3FMA A;  1I7F A;  2OYQ A;  3QG5 A;  5D1O B;  4LF5 H;  1XK5 A;  3NBZ B;  3KAL A;  4ZHQ A;  5LP6 B;  4DR4 B;  3RJ0 A;  3BA9 A;  1CKN A;  4O4I A;  3SGI A;  1Z5W A;  3WB1 A;  2XHB A;  5KMG A;  4TQD A;  4FVM A;  2GV9 A;  4FLW A;  3ICX A;  1M93 A;  3J81 W;  1Q43 A;  4TOI A;  4LF5 B;  4PZ6 A;  2PZS A;  1FVI A;  3SJC C;  4FFB A;  4DRX A;  1BJT A;  5GON B;  1ZHQ A;  4K0K H;  4GLX A;  3RGB A;  3C0F B;  4U3J A;  4RB1 A;  5IJ0 A;  3RYC B;  3K59 A;  3JAT B;  1SYX B;  3RF2 A;  4TQF A;  4I55 A;  5JJJ B;  4A2A A;  1NT2 B;  1N34 H;  4X64 H;  3LML A;  4TV9 B;  4DV1 H;  1TVK B;  4YJ2 B;  1XNR H;  1O9H A;  1CKO A;  4J0M A;  4JYA H;  4K0K B;  4LNU A;  5K1P A;  3BA8 A;  3JAS B;  4X1K B;  1XDN A;  4JI4 H;  2WYO A;  1N34 B;  4LH7 A;  4X64 B;  3RYH B;  4DV1 B;  1XNR B;  3JAL A;  4LH6 A;  1J5E H;  2JS5 A;  4JYA B;  3JAR A;  2F93 B;  4O4L A;  3QTC A;  4X1Y A;  4PI0 A;  4RB3 C;  4HBN A;  4UCS A;  4JI4 B;  5IYZ A;  1M5I A;  3JAM W;  2WE6 A;  1KU9 A;  4PHZ A;  1J5E B;  1JFF A;  3MWM A;  2VQE H;  4BWA A;  4B3T H;  1N33 H;  3ETQ A;  4LFB H;  2E5L H;  4O2A B;  2OWO A;  4RB0 A;  3TY5 A;  3OTO H;  3KAJ A;  4AQY H;  5EYP A;  1O75 A;  1CKN B;  2VQE B;  4O4I B;  4B3T B;  1YEW A;  1N33 B;  3F8N A;  5KMG B;  5FNV A;  2E5L B;  4LFB B;  3J80 W;  4DR6 H;  3ZED A;  3OTO B;  2F1M A;  2HGS A;  4LF8 H;  4AQY B;  3HKD A;  5BR8 H;  1A0I A;  2PUS A;  2ZNJ A;  4FFB B;  4X20 A;  2ZM6 H;  4I4T A;  4DRX B;  3N2G A;  4LF4 H;  3JSL A;  4U3J B;  4DR6 B;  5IJ0 B;  3N41 B;  4I55 B;  4LF8 B;  2BTQ A;  5BR8 B;  3TY8 A;  3HKB A;  1XMQ H;  2IM9 A;  4KL1 A;  4R7R A;  2ZCE A;  3MAQ A;  4CH6 A;  2RJZ A;  2ZM6 B;  4LF4 B;  1M4U A;  4LNU B;  3SJA C;  4IHJ B;  2ZIO A;  4B3R H;  4JI2 H;  2HHH H;  3BHP A;  4GYC B;  1CKM A;  2MCT A;  2UU9 H;  4FLT A;  2CW7 A;  4PZ7 A;  4IIJ A;  4RAZ A;  5LMU H;  4DR5 H;  1XMQ B;  5EOY A;  4DV4 H;  3J7A K;  1DGS A;  3DF7 A;  5JH7 A;  4X65 H;  3JAL B;  3WB0 A;  4JI5 H;  3VQY A;  4D7T A;  3DSQ A;  3JAR B;  4A2B A;  4O2B A;  4B3R B;  4O4L B;  3LNN A;  1G6U A;  2HHH B;  4X1Y B;  4JI2 B;  4K8Z A;  3T1Y H;  4X62 H;  4FLX A;  4EB6 A;  2UU9 B;  4MV9 A;  4ETS A;  5IYZ B;  4DR5 B;  5LMU B;  1IBL H;  3GB8 B;  4PI2 A;  4DV4 B;  1TUB A;  4CH5 A;  2R72 A;  3CSX A;  4X65 B;  4RB2 C;  5K1X A;  2XIG A;  4JI5 B;  3JSN A;  4DR3 H;  5A2Q W;  1QQC A;  3HKE A;  1WPB A;  2F95 B;  4X62 B;  2PTM A;  2Q7E A;  1IBL B;  4DK0 A;  1JJO A;  4FM1 A;  2ZNI A;  2VPS A;  1D5A A;  1Q8I A;  5JVD A;  1V9P A;  5EYP B;  4MTE A;  4DR3 B;  4DRF A;  2UXB H;  1FJG H;  4O4H A;  4LR3 A;  2HEP A;  4JI7 H;  3B2E E;  5FNV B;  2Q2U A;  4ZOL A;  4DV5 H;  2P22 C;  1S68 A;  5CA1 A;  1Z2N X;  1FFX B;  1Q5O A;  2PGG A;  3RGZ A;  3N44 B;  3S24 A;  3HKD B;  2R70 A;  5BMV A;  2UXB B;  1FJG B;  1P8L A;  5LA6 A;  1MZB A;  4X20 B;  2RQ6 A;  4I4T B;  3N2G B;  4JI7 B;  3RGX A;  1XI1 A;  2W57 A;  4DV5 B;  5D5Q A;  4MTD A;  4HNA A;  1T5E A;  2YCH A;  2BTQ B;  4GKJ H;  3RYF A;  3HKB B;  3RTX A;  2VOB A;  4K8X A;  3GDE A;  2R9A A;  3N42 B;  2UUA H;  4X1I A;  4YHH H;  1SEI A;  5FD6 A;  3CB2 A;  3VQW A;  4TUY A;  4JI0 H;  1HR0 H;  4CS4 A;  5EIB D;  1GYF A;  1TA8 A;  4L8J A;  4GKJ B;  4IIJ B;  4DR1 H;  2O03 A;  3BAA A;  4TV8 A;  4F6R A;  5JH7 B;  3L4K A;  2HVS A;  4EQ5 A;  2VWK A;  2UUA B;  4YHH B;  4LSA A;  4X66 H;  3HKC A;  2CFM A;  4O2B B;  4JI0 B;  1HR0 B;  4ZHQ B;  1WH2 A;  1Z5V A;  1VS0 A;  1HW7 A;  4EB6 B;  3TY9 A;  4YJ3 A;  1L8D A;  3M4I A;  4DR1 B;  2VQF H;  4KHP H;  3H20 A;  4JI6 H;  4X66 B;  1HNX H;  3HKE B;  4I7H A;  3VNN A;  4JI3 H;  4BWS C;  4NXM H;  2KKW A;  3IG0 A;  2YI9 A;  5FPR A;  4B3S H;  3RFR A;  3THO A;  3ZS8 C;  5DIS C;  4AHC A;  5CA0 A;  2VQF B;  4KHP B;  3JAK A;  5JVD B;  4FM2 A;  4DK1 A;  4JI6 B;  2UXC H;  4B3M H;  1HNX B;  4DV2 H;  1XNQ H;  2RGV A;  4O4H B;  4JI3 B;  4NXM B;  4B3S B;  4ZOL B;  2ZIM A;  4APM A;  5CA1 B;  4NXN H;  2CAZ C;  2UXC B;  4CH3 A;  3HXL A;  5C8Y A;  5BMV B;  4DV2 B;  4B3M B;  3NBY B;  1XNQ B;  3K5N A;  5LA6 B;  5LXT A;  2Q0A A;  1I6U A;  5D5P A;  4DUZ H;  5JQG A;  2KSW A;  3U0Z A;  2VWJ A;  1IBM H;  2UXD H;  1N36 H;  4CH4 A;  4LFC H;  4NXN B;  1ZAU A;  5JJE B;  3RR5 A;  4HNA B;  3KYH C;  1WNS A;  4FM9 A;  3RYI A;  3RYF B;  3BPZ A;  5LL6 b;  3UT5 A;  3JAW A;  5KHG A;  4DUZ B;  4X1I B;  3VQV A;  1S03 G;  2UXD B;  1IBM B;  5JJN B;  2F66 C;  1SA0 A;  4UCV A;  4EFE A;  1N36 B;  2HVR A;  1E4F T;  3K5M A;  4LFA H;  2UUB H;  4TUY B;  4LFC B;  1JFF B;  4I50 A;  4WBN A;  3T1Y B;  4O4J A;  1M0T A;  2ZIN A;  2QJ1 A;  4OX9 H;  5CB4 A;  3N2K A;  5IJ9 A;  3EYY A;  4TV8 B;  2YIA A;  5ITZ A;  4F6R B;  3K57 A;  3N6X A;  4IAJ A;  2HVQ A;  3K3V A;  1H2S B;  1S5J A;  3HKC B;  4UFZ A;  4FLY A;  4LFA B;  2UUB B;  3PN1 A;  4CS2 A;  2V4D A;  2PY5 A;  3QWU A;  2EX3 A;  4NVP A;  2YIB D;  4YJ3 B;  4OX9 B;  1Q3E A;  1X9N A;  5J2T A;  1M0W A;  2YXL A;  2YI8 A;  3W1G A;  4DV7 H;  3KXY T;  4DUY H;  2YIB A;  1XHZ A;  1XHX A;  1ZHS A;  4DR7 H;  2FE3 A;  3M7M X;  3BRC A;  4BW9 A;  4YY3 H;  3T1H H;  4B08 A;  1VF7 A;  5CA0 B;  1XMO H;  3JAK B;  2HIV A;  5LOV A;  5IWA H;  5KHJ A;  4DV7 B;  2P5O A;  4DUY B;  3E22 A;  5KX5 A;  2WDT A;  3BAB A;  4MV7 A;  4UCU A;  1N32 H;  1E4G T;  4DR7 B;  4ZI7 A;  2PYJ A;  4DV3 H;  1I94 H;  1O9G A;  5J2U A;  4YY3 B;  1B04 A;  3T1H B;  1WN7 A;  4IHJ A;  1XMO B;  5EZY A;  3SJB C;  3GJX B;  4DV6 H;  5IWA B;  3IAY A;  3K5L A;  5C8Y B;  2JGU A;  4JI8 H;  4LF6 H;  3U10 A;  1QHT A;  1JMK C;  5LYJ A;  1N32 B;  2HIX A;  2RGR A;  4DV3 B;  5LXT B;  5IT9 W;  5KHH A;  1I94 B;  3CVZ A;  4JV5 H;  5JQG B;  1XQ8 A;  4UCO A;  3L4J A;  5D1O A;  1RSO A;  4GKK H;  5LP6 A;  1AN7 A;  2UUC H;  4DV6 B;  4PZ8 A;  2CW8 A;  2ZJT A;  3RYI B;  4EFB A;  4JI8 B;  4LF6 B;  3L2P A;  4UCT A;  1P16 A;  1TAE A;  3UT5 B;  3JAW B;  4FLV A;  4LF9 H;  1IBK H;  4JV5 B;  1TUB B;  3UQ8 A;  3FFQ A;  1SA0 B;  5EIB C;  4FLZ A;  4RAY A;  2F4V H;  2PYL A;  5LP6 C;  1HNZ H;  4GKK B;  2UUC B;  4FM0 A;  4I50 B;  4WBN B;  4I9Q A;  1Z2P X;  4O4J B;  5GON A;  5FLX W;  5CB4 B;  3N2K B;  5IJ9 B;  1BGW A;  4RZQ A;  5ITZ B;  3RYC A;  1KMI Z;  4LF9 B;  3JAT A;  1IBK B;  4M7E A;  4EEQ A;  2F4V B;  4CC5 A;  5KHI A;  5KHK A;  4JI1 H;  5FD5 A;  2BTO A;  1HNZ B;  3K58 A;  1SQF A;  4LSX A;  4TV9 A;  3N43 B;  1TVK A;  4YJ2 A;  4ZIB A;  2QM4 A;  5JCO A;  3KAK A;  5J2T B;  1HNW H;  2Q7H A;  1FFX A;  5D1P A;  3JAS A;  5LMN H;  4X1K A;  4UCR A;  3W1B A;  4JI1 B;  3SR2 C;  4FLU A;  1SQG A;  2E3C A;  3W5O A;  4PDB A;  2VUG A;  3RWR D;  4LF7 H;  4AIL C;  4LMY A;  3RYH A;  5JCO C;  3CHX A;  4Q0Y A;  1TGO A;  4DV0 H;  1SKV A;  1HNW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...