4UCRA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 91
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucrA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucrA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucrA02
4JI1B 4OX9B 4UFZA 2HHHB 2UXDB 4UCTA 1IBKB 4LFCB 1IBLB 3SGIA 4LF9B 2UXCB 4E6NA 2F4VB 4DUYB 2OWOA 4CC5A 4DUZB 4JI6B 3KYHC 3JSNA 5D1OA 4GKKB 1VS0A 1CKOA 4LFBB 1V9PA 5DISC 1XNRB 4DV0B 1DGSA 4GKJB 3VNNA 4EFBA 4DV4B 2HIVA 2VQFB 1X9NA 2ZM6B 4DV3B 2CFMA 4DR7B 4JV5B 2HIXA 4DV5B 4B3TB 4DR4B 4TOIA 1N36B 4PZ6A 4LF5B 4NXNB 3JSLA 4JI3B 4JI2B 4EQ5A 1IBMB 2UUCB 4DV1B 2UUAB 3W1GA 3T1YB 4KHPB 4CC6A 1HR0B 1P8LA 4DRFA 3GB8B 1CKMA 1N32B 4B3RB 4JI8B 4JI4B 4LFAB 4JI0B 3BABA 4JI5B 3TY9A 2E5LB 3T1HB 3GJXB 4YHHB 3NC0B 5D1OB 4K0KB 3W5OA 4NXMB 2UXBB 2VQEB 5FPRA 4X64B 1FJGB 3L2PA 4UCSA 1I94B 4LF8B 4LF7B 5D1PA 4PZ8A 2VUGA 5FPOA 2HVRA 1HNZB 5BR8B 4X66B 1CKNB 4B3MB 3PN1A 3BA9A 4GLXA 5LMUB 4DR1B 2Q2TA 4LH7A 3TY8A 4X62B 4DR3B 1ZAUA 3W1BA 5IWAB 1A0IA 4LF4B 3NBZB 3BAAA 3NBYB 3RTXA 4EEQA 2UUBB 4DR2B 1XMOB 4JYAB 1XK5A 2HVQA 4JI7B 1FVIA 2UU9B 3UQ8A 4DV2B 3BA8A 4DV6B 1J5EB 3TY5A 1TA8A 3OTOB 3S24A 2HVSA 4DV7B 4LH6A 3RR5A 4AQYB 4UCOA 1N34B 1TAEA 4DR6B 1HNXB 1B04A 3QWUA 4B3SB 4UCRA 1HNWB 4LF6B 4UCVA 4UCUA 4PZ7A 4EFEA 1P16A 4YY3B 1XMQB 1S68A 1N33B 1CKNA 1XNQB 3GDEA 2Q2UA 5LMNB 1XDNA 4DR5B 4X65B
chains in the Genus database with same CATH superfamily
4X89A 1SA0A 3LDDA 4LF7O 4J9NA 4I55A 2R9IA 4MV9A 4DV4H 5EBMC 1YZBA 3WFVA 2DZDA 5LXTF 3K06A 4EBCA 3CCEV 5B5EZ 4RAYA 2EBOA 2UU9H 3K5NA 3I4NG 1MSWD 2R86A 2Q8VA 3B4SA 5KFRA 2CUGA 2XTAA 4I4TA 5FL7G 2RDIA 1QLEC 2W8LA 2DQ3A 2P22C 2W6PA 5KFHA 4JI7H 4ZHQA 4WBNA 5KFWA 1CE8A 1I08A 4R6ZA 3T9DA 3HOXG 4XDJA 3QNEA 3RYFB 4GT1A 4IIJB 1YF2A 3RJ0A 5IYCG 3OTOO 2JA6A 3JD1A 4JI3B 3V4SA 5KFTA 4DIMA 1FXVA 4IAJA 1GSHA 1VARA 2V59A 4NYEA 4DR2O 4B3RB 4O4JB 1OJHA 3GTOA 5KG3A 1Y74A 4LNUA 3CRAA 3CE2A 3VOTA 3D3IA 3RB3A 2EIMB 3RAQA 2PY5A 2P7TC 3CCRV 4JASA 2BTQA 3SPJA 4DV6O 1T36A 2WAQA 5C8YB 2R82A 3OFNG 5FPRA 3TETA 2QM7A 4DV3O 5LMNO 2Q69A 4UCSA 3IC7A 4B3MH 2UUCH 3M8AA 5LA6A 1SKVA 1JJOA 1SZXA 4CH5A 3PJSK 5J2TF 2HHFA 3AG4C 1AR4A 5D8DA 1S03G 1I7NA 4FZ0A 3A8TA 1QNMA 5J2UA 1BQZA 4JYCA 2H8PC 3K3WA 2AW9A 2JA7A 2GHYA 2RGRA 2UUAH 3O65A 5DG7A 4FBUA 4MVUA 3WB2A 5FLMG 2B1IA 2WAQE 1G2WA 5JQGF 3DC6A 3LUTB 5DECA 2CW7A 4NTXA 3KXYT 4JI0O 2PYLA 1B6QA 1C30A 3OHBA 5JWPA 2RDCA 2BCCH 3AG2B 4YY3O 4HNTA 3GIPA 5LL6b 4YR3A 5BYAA 2R8GA 3J7AK 1MNGA 3OD4A 1Q3EA 5BY1A 5LXTA 1J5EB 3KAKA 4FMTA 4LF8H 3EHBB 4YJ3A 1AI4A 2QF7A 3ETJA 4WFGA 5KT4A 1BS3A 4YJ2A 2CH7A 2A3QA 4XBFA 4G3IA 1TUBA 2OTJV 4UB6Z 4O7ZA 4X66O 3V6KA 1ZWIC 3BG5A 1AN7A 1EYZA 2D3OW 1M93A 3RN4A 4IRCA 2QB5A 1SRYA 1NS1A 1VQLV 3K9AA 5EBWC 3JYCA 2OWOA 5A9GA 1PX2A 4PHZA 3JRWA 3N40P 2HHFB 5BPFA 1L0NH 3HO8A 5LA6B 3BQ1A 4J9ZB 3JCZA 5FLXW 2LFSA 2Q0OC 3J81W 1XNRB 3BEHA 2DYRB 4OX9O 3RF2A 2ZXWC 1XILA 5CA0A 4MV6A 2GLTA 1CXZB 1VF6A 2P0AA 1X59A 2IBKA 4J80A 2R8JA 2COIA 4QIWA 4QIWE 3Q8RB 2CK3G 1M6VA 3AW8A 3JSLA 4J41A 1EN4A 4O4JA 3F7YC 1IBMB 3RGXA 4RB3C 1VIBA 4UUJC 4CS4A 2M7WA 3DSQA 1XNRO 1EM1A 3ETQA 3CCUV 4NZOA 1RFYA 4UVCA 4IHJF 2GPSA 4XYLB 5KFGA 1ZQ7A 4DR5O 2GQRA 2RF4A 2R84A 4LFAB 2C00A 4ABMA 3I12A 2X6CA 3ASOC 4G27B 4XZ3B 4F4WA 4IIJA 2ARHA 1FKAH 4PI0A 4GKKO 3RYFA 2ZIOA 3HPLC 3OT7A 4FFLA 4YHHB 2ZNIA 3CCJV 1KJ8A 3C3SA 4ZHQB 4DLKA 2N74A 2B63A 3JAMW 5CE8A 2C28A 1WA8B 1FJGB 1I94H 2XAFA 2YI8A 4X65O 1SERA 3RGBA 3RT3C 4J11A 2WYOA 3TXSA 2FKXA 4X64O 5C1OA 5KFZA 1OZ0A 2LW7A 4F4YA 2Q7GA 2FK3A 2AHYA 5KG7A 2MCTA 5BPHA 3EPIA 1FPOA 2Y69B 4FS1A 4DR1B 3N27A 1SA0B 4C5AA 3OGIB 3W7XA 3N2KA 4JI2O 1I2LA 1ZAUA 1AI5A 1PM9A 3H20A 2FPGB 1IBLH 2F95B 1VQ4V 2DABA 3GLKA 3NBZB 1RM1C 3UM7A 2JDIG 4FLTA 3BPZA 1S9FA 4J9OA 4DV0H 1RK6A 3AG1B 2R92A 4GUNA 4MVZA 3ZHVA 1NTZH 4JV5H 2V4QA 1QR9A 4R8UB 3L75H 3M9MB 2XAGA 4UCRA 3GTGA 4DL4A 4HN2A 4UCUA 3SE7A 4I50A 3PFFA 2M05A 3CD6V 4LFCO 5LMNB 5IY5B 5L3DA 3LWBA 3VQYA 2XAQA 3ZJZA 4JI8H 5EZYB 2QTSA 1YVWA 4UFZA 4A2AA 1RYSA 1R9TA 3FB5C 4CC5A 4YXWG 2ZD9A 1JDEA 4ICGA 4YIOA 4JI6B 4C5CA 4GC7A 1H8HG 1Q90D 2J6SA 4FU0A 3JSNA 1OCCC 1JVMA 2BSKB 5IYBO 5DGIA 2CQYA 5KA5A 4DR4O 3CCLV 1DGSA 4O3RA 2HHHH 3K5OA 4PD4F 4A3KG 3B8MA 3D8CA 3RFCA 5EOYA 3L71H 5E25A 5DG9A 3ABLB 3U0GA 5D5PA 5IJ0A 4J9MA 4ECYA 4QW9A 1BNCA 1GM8A 1V54B 2EJRA 4DR1O 2W6QA 3WWIA 1RK5A 4MV7A 4JZGA 2ZR3A 5KT7A 1W0KG 3AG7A 4MW3A 4KHPB 1SC5B 2EINB 4DUYH 2BR0A 2ZDGA 5CA0B 4MS2A 5A2QN 4RB2C 2VS0A 3AYHB 2AGPA 4CBCA 3IG0A 2CDYA 3QF7A 5EC1C 3NGDA 4LP8A 1BMFG 1CP9A 4C7UA 1JFFA 4J9LA 4PJ0Z 5IYZA 3X2QC 1XNQO 3G71V 3GTQA 2ZE8A 4JV0A 3MFIA 5D1PA 4DL7A 3SYOA 4PZ8A 2ZJTA 1M4UA 2PI4A 3HKDB 1N36H 2A7WA 4M0JA 5FR9A 3FKSG 1Q5OA 1Y1VA 2W7OA 3PW7A 2ZQMA 4GLXA 5I60A 3IC9A 4U7CA 4YQWA 4LF9H 2R92G 2JS3A 5JQGA 4K6NA 4LH7A 4PDMA 3I4MG 1AI7A 2J6UA 4YJ3B 1ORQC 4MV1A 1UPGA 3MJFA 4LF4B 2F43G 3G6XA 2V9WA 2WLJA 2YZLA 2GTSA 3OR7C 5DEDA 1EZ1A 5K3WA 1MA1A 3X2QB 2JEUA 1Q43A 3JASA 3ZMZA 3S24A 2YEVA 4ZOLF 3MWMA 4WBNF 3RR5A 2W71A 2X0LA 2Y4RA 1TAEA 1G6UA 2Q67A 5CA1A 2YIBA 3HKEA 4B3SB 4D7SA 3GQCA 1VQOV 2DE0X 3M9NB 5BR8O 2WDTA 5AG2A 5J2UB 2OCHA 1EKVA 4O4IF 1RJRA 4FLVA 2DQ0A 4LWSA 4RUEA 4TT3G 1QR8A 3HKCA 1R6TA 3TK1A 3LQSA 2PF4E 1M57B 1F51A 2ZDIA 3PW2A 4DUYB 4NXMO 2LJ2A 3DGEA 2FK2A 3K04A 4F6RA 5JH7B 2BTQB 1R6KA 1EN5A 1IBKO 3VA7A 5EWFA 1YJ9V 4LR3A 4B3TH 4MTFA 3N42B 2OIEA 4A2BA 2NU8B 1Y74B 4LNUB 1UC9A 4FS2A 2DWEC 2XOKG 3H4BA 3CS5A 1VF6C 4DW1A 4JI3O 1E4EB 2FPIB 3T9AA 5KFFA 4J9KA 3KZIZ 1D5NA 4PZ6A 3G6BA 2Z3YA 3JRXA 5BWUA 1OWTA 4I50F 2YXHA 5KFLA 2HFEC 2YRWA 1GK9A 3T2MA 1R3LC 4NLGA 1ZL8B 4O7LA 1GTOA 1EKPA 4FGRA 3KCXA 5JVDF 3K9SA 1Z2GA 5IY5C 5KFCA 3QO7A 2ZDQA 4AQYO 4IWYA 1JDBB 2Z0AA 1S77D 1RYRA 1S76D 5LYJF 4J9PA 4PI2A 2JEFA 2A79B 1E1RG 3OGCC 2XHBA 1TWGA 1YJWV 1MABG 2ZM6O 4IZOA 4ECRA 2KKWA 3L9DA 4PWQA 2ADQB 3B40A 1WN7A 2CE4A 4E4TA 2VA3A 4BXXG 1KBHA 3OM3B 2COGA 4LWSB 4Q0YA 3G67A 1SESA 4DUZO 5C44G 1K3EA 5LHHA 1SCUB 1J5EH 2AGAA 5DQIA 1KQSU 1V51A 1P7BA 2BQ3A 4FM1A 2E3CA 5CA1B 1K34A 4O7RA 2QA4V 4GKJO 1TWCA 1NQTA 3JASB 1KB9F 2BOBC 2CZGA 3KREA 1AR1B 2UXNA 2GTAA 3B09A 2KSWA 3VPBA 3R5FA 5KHHA 2ZDIC 4ZI7B 3ICXA 4NXNO 5LL6Y 4QWAA 1IDSA 3DXRB 1NZ6A 4GX5A 4U3JB 2Q7DA 4JGSA 3LNMB 1SQBH 4UCVA 2RCVA 4BR6A 3JATB 5LGTA 2DIKA 4YHHH 2KSDA 3HT5A 3GDEA 1MOFA 1XNQB 4R50A 4JYAO 3ZBHA 1YJNV 1I7LA 1XDNA 3G8DA 4NZMA 1ZLZA 1AP5A 3JAWB 1GAXA 4CHIA 1BHAA 4DQNA 5FNVB 3PR5B 1EBOA 1N56A 1V4YA 3ZCCA 4R8CA 4DL3A 4A3FG 2W6OA 2IM9A 4FM0A 3OEEG 3F5TA 2N04A 2I8CA 3SJQC 1Z5VA 4MW8A 5DISC 5EDWA 2W6IG 4W4KA 5EK0A 4DV0B 2HG5C 1IOVA 2VQFB 1X9NA 4ED7A 2ETNA 5JH7F 2R7ZA 4LF7H 3Q4HA 4JV5B 1IBMO 1AI6A 1M56B 3TCUA 4K35A 1VAJA 1QHTA 5E79Z 4I4TF 2GDSA 3J7AU 4HQ6A 4O7NA 3N2GB 4TSFG 4DK1A 3WB1A 4Q4CA 1NVPD 2A1HA 2LGQA 3WB0A 1FS0G 3SJBC 4TQFA 4LF6O 2ASDA 1FFXA 2YZNA 1WCMA 5KFEA 5K1XA 4K8XA 2UXBH 3S3WA 3RFRA 4A93G 5FLXN 5B3SC 3I55V 4A3MG 3MAQA 2C22A 3PVXA 4O3NA 1FJGH 2EIJC 1IBLO 1SZTA 2B9ZA 3RBDA 2OT5A 3UT5B 3KHGA 4TQSA 4QPKA 4DV7O 1EZVH 5L1LA 3H1IH 3V6JA 2P4VA 1BZKA 2HEPA 3T5LA 4LF8B 5KFIA 4A3EG 4PELA 4FFMA 3E5NA 4DR7H 2CAZC 4FLZA 1VQ7V 5FPOA 4L8JA 4RWUA 1HNZB 2JA7G 1QVGU 4O4LA 5KHGA 4B3SH 1KU9A 2JGUA 3BA9A 3M7MX 5KMGB 4LFCH 1OCZB 1TVKA 2DLNA 4APMA 3T5JA 5C8YF 4JI1H 1O75A 5L3CA 3OTFA 4NYKA 4FPPA 3ABTA 3RVYA 3CWBH 3OMIB 2UUBB 4IRDA 1OHHG 2W7PA 4HYOA 4RU9A 3BA8A 1WRVA 1TA8A 1KBLA 2IJHA 1NH2B 1UC8A 4BWAA 1YDXA 4MSWC 2UXDO 1HNXB 4AHCA 3N2KB 4O4HF 2VQFH 3H4DA 5JCOA 5L3FA 4WHXA 4D6TH 4DL5A 2ATLA 4EFEA 3H1HH 2RMKB 3SYPA 5BWVA 3C90A 2XCPA 2Y0IA 3JD0A 2Q2UA 2OLSA 2F93B 4JI0H 4QJFA 4IIJF 4CH6A 4X65B 1L8DA 2RN9A 2XCLA 2RDJA 4DR6H 4ED2A 5LGUA 2F66C 3ABUA 4O3QA 4TQRA 2XASA 1WA8A 1GN3A 4IT5A 1W96A 3K5LA 4DV2H 1JR9A 4AYBE 2CGNA 1H2LA 4FJCC 2F1MA 2IU0A 3WO1A 1FXKC 4MAMA 5B1OA 2L35A 2YDEA 4JYBA 2RGVA 4G2KA 1BCCH 3E35A 3SI8A 3HXLA 2GUZB 5LBQA 1V55C 3GV5B 4DR4B 4I55F 4KHPH 1WH2A 1MG1A 1S0VA 2QWOB 2HKOA 1VQ6V 4D7TA 1TGOA 3RYHA 4FM2A 2UUAB 1F23A 2X5RA 3KAJA 5DGHA 4FFKA 4ZKIA 5KUMA 1P8LA 4JI5O 4DRFA 3CXHF 3WNZA 5KHIA 2PGGA 1Q7YW 3CRRA 3UYYA 1WJZA 3HOVG 1I5YA 3EXAA 1OBGA 5KT6A 2HJFC 4TV9A 4RUFA 4E2LA 1TWHA 4L87A 2NU6B 5CR5A 2QK4A 4TV8F 5B1BC 2QR4A 3JARA 2PMZE 4DR3O 3JZIA 5KKNB 1Y4MA 3OSNA 4ED0A 2DWDC 1QU7A 2HVRA 3R66A 3K03A 3SJCC 2JRIA 2P6JA 2W6ZA 2Z04A 1FD9A 1Y66A 1H2KA 1FYJA 4H44B 1TUBB 5CA0F 4DV6H 2EJ7A 4GKKH 2CH7B 4PDRA 1CEZA 1P7GA 4LSAA 5EBLC 1CPYA 4B3MO 3H1JH 5HFLA 5IWAB 5DN6G 1M7JA 1NR7A 5LXTB 3E22A 1RSOA 3JZ6A 4X62O 1QQCA 4X88A 3WG7C 4JI7B 4EG0A 2XGPA 4BIOA 3HR0A 3H0GG 5LOVB 2JEIA 2XCAA 3BY6A 2YZMA 3AG1C 3SPCA 1DIKA 2QWQB 3SPHA 3A0BZ 3ZMTA 1XHZA 3KHRA 1B04A 2HR3A 2ASJA 4X1KA 3LP8A 5C3EG 2GPWA 1JJ2U 3PO3G 4Q8EA 2COJA 3K79A 3K57A 3G8CA 4HBNA 2VQEH 4DR5B 1H2MA 1N8RW 1KP2A 1HNZH 3G6YA 5CA1F 1N32H 2DWCA 3N43B 2EIKC 2R93G 1JQ0A 3T1HO 2UXCB 2V58A 4CKBA 3K3PA 2LFRA 5C8YA 4DR2H 3ZHSA 4JI4H 5H9CA 1E4FT 3Q8PB 2MK3A 4FIPC 4A3IG 4LBEC 1WP7A 4H37A 1B6SA 4JV1A 4LFAH 1FAFA 4JZ2A 3VNNA 3MR6A 1JMKC 4O3PA 1H2SB 2UUBO 1V54C 4K0KH 1ULZA 2R93A 3QQMA 3AG3C 3P3NA 5LGNA 1R1BA 5KFXA 4JI2B 1G1XB 2ODMA 2NU9B 5ITZB 2X6AA 4NB5A 3T1YB 2NUAB 1DF4A 4PV1B 3H3VH 5KT2A 1IYEA 1Q86W 4F6EA 2UUAO 5IYBG 3SYCA 4WBNB 2KG7A 3B2EE 4YAKB 4Q20A 3CRQA 4B08A 2R7ZG 2E5LH 2WPDG 1US6A 2DOSA 2IU3A 4P9OA 4I9QA 1Q81W 3PW0A 3W7UA 3DF7A 1K1SA 2WLIA 5JVDA 2VOBA 1LR1A 4RZRA 4YP3A 4Z2WA 3MR2A 1OCOB 2YCHA 1A0GA 2YW2A 5L3GA 4I55B 1ZHSA 1SQGA 3FB6C 4O2AA 3J81N 4GZRB 4A3CG 2JA6G 4YBZB 4FK5C 3FAVA 1VQKV 3VOUA 2Q2TA 1N34O 3E8GA 1X4TA 1W93A 1VMGA 1K9MW 1XMOO 1SETA 3NXSA 3OAAG 2UU9O 3ABLC 4EBDA 3T9BA 4O4IB 4J7JA 3BAAA 2QKAA 1K7DA 2WLNA 2HVQA 4RNNA 3JALB 1I1MA 4DRXA 3OTOB 2SCUB 4YIPA 4AQYB 4UCOA 2HGSA 1K4DC 4NZNA 4DL6A 3QWUA 1YXBA 3TGUH 3RUPA 3N6XA 4X9QA 2NN4A 1IOWA 5FD6A 2VQDA 3FFQA 5B1BB 1O9HA 1IXMA 2ADPA 3IGAC 3KCYA 1S68A 4L1KA 3QZ7A 4EBEA 3KTMA 4MV8A 1LUVA 2ZR2A 4A3GG 2RQ6A 2ZGIA 1BQ0A 2VWKA 4AI8A 3CRMA 3CHXA 2NVYA 5GONA 1VEWA 2ZNJA 3ASNC 2Q5ZA 5LYJB 5BYBA 1JXLA 4MA0A 3QZ8A 2DN9A 1VQ5V 5BMVB 4DUZB 1NH2D 1BGWA 3DC5A 5LMUO 1I0HA 3ML0A 4YY3H 3SR2C 2UXCO 4UVBA 4Z1VA 1R3JC 3VQWA 4O81A 5JQWA 1AILA 3WU2Z 2UVVA 5L1IA 1YIJV 3UO3A 2EILB 2CFMA 5KG6A 2IMWP 5KFKA 5CA3A 1A9XA 4DV7H 2HIXA 2YZGA 3SDLA 3T1YO 3U0ZA 1OCRB 5KHKA 4NXNB 2B63G 2JVDA 1GH6A 4DR7O 3JD2A 2WLLA 3CCMV 4Q4DA 5CBGA 1Z2OX 2R87A 4BBSG 3E8BA 2BTOA 4JAUA 2JGDB 2J9GA 3IAYA 4IL6Z 2HHHO 4J9QA 2QYZA 1T94A 1XMQO 4KFMA 1Y1WA 1TWFA 1KEEA 3K5HA 3ZRVA 5IWAO 1AUVA 4DR1H 3APOA 1PNMA 3ORRA 1R3IC 2AXTZ 4H33A 1EUDB 4K0KB 3D36A 4JI6O 3GTMA 2H3OA 2BQUA 3KG2A 2QEXV 2HDKA 3EFFK 1I94B 3L73H 2YYAA 4O4JF 1Z2PX 4RZQA 1SEIA 3SPGA 2V1DA 4OXSA 3T5HA 4ZOLA 4BAYA 3H40A 5GONB 2FE3A 4DYLA 2W6NA 3T9FA 4YR2A 2R8IA 5LMUB 4ECSA 4I9WA 3JD3A 4JI8O 5EZYF 4DR3B 1HDJA 1H2GA 3K0GA 1QCEA 5BZBA 3CXCU 1VKZA 2DYSC 5EYPA 3ABMB 2EULA 1KTAA 3AX6A 5IP7G 3TEKA 2X0SA 2ODTX 1GKFA 1XI1A 4RQEA 2N05A 1A48A 3RYIA 1HNWO 4EYHB 5I5VA 1OCCB 2FLLA 1GN6A 5CM0A 5B1AC 2W9CA 2W9AA 4FFBB 4LF4H 4RAIA 3TIIA 4GX1A 3TIGA 3WO0A 1XMQB 1N33B 5F2VO 5LP6A 4TV8A 4I0XB 5KG0A 4U7OA 1KP3A 2VUMA 1HR0O 3FAVB 3ZRWB 3STZC 4UCTA 1IBKB 2F4VB 2CTQA 1M0WA 2GBOA 4O2AB 3VPCA 2YIAA 2CTWA 4A5UB 3LDEA 4P30A 1JX9A 1CKOA 1OBDA 4R7CA 1GSOA 1JA8A 3D3QA 3M4IA 1V9PA 2ZXWB 4P9PA 4X66H 3CC4V 2R85A 4MVOA 1PPJH 2WLIB 1YHQV 2ABJA 2HIVA 3RV3A 1Q6IA 2PI5A 4LFBO 4IR9A 1M56C 2DW4A 4CZZA 4X64H 3F5WC 1K4CC 4X20A 1HNXO 4EQ5A 3RAXA 3W1GA 2PMZA 4MV3A 1B6RA 1Z5WA 1HR0B 1PNKA 2HGXA 3GB8B 1THZA 4ETSA 2FJZA 3R65A 3NUAA 3TJTA 4PA3A 5IE9A 4OX9H 2IJKA 1FFTB 2QKSA 4W4LA 5J2TB 2ALZA 2WAMA 2Y0SE 3EYYA 4BBRG 3ASOB 3UZBA 4TVIA 4DR4H 2R8KA 5T14A 3MWEA 5KFPA 3BQ0A 1ZX3A 4X64B 1M0TA 1I50A 5IYDO 3HOWG 4ZIBA 4JV2A 1NTKH 4QE7A 2WLKA 4JPRA 3HKBA 4LMYA 3T99A 1OCOC 4X66B 1CKNB 4CKEA 4QWDA 1FXKB 1KC8W 2WTFA 1JOYA 3H1KH 3PN1A 2IH1C 1H38A 4O7VA 4ED6A 1M90W 4LF5O 5J9PC 2AGOA 2K9PA 2PZSA 3CCSV 1MZBA 4Q43A 2JJ2G 3FX7A 4K8ZA 5I5SA 3TY8A 5KFVA 3STLC 5LMNH 4ED1A 4A3LG 1OCZC 3TW7A 3RYCB 5JCOC 4EYIB 3CEBA 4NTWA 1WP8A 2Y0SA 4YB8B 2W6JG 2I87A 5DGAA 1S0OA 4DUZH 4E4EA 5L1KA 1MMMA 4X1YA 3V6HA 1KMIZ 4J10A 3GV8B 2LO1A 1D5AA 3RGZA 2YXYA 1NJIW 2FKLA 4JI2H 4LF6B 1LNQA 1P16A 2IJIA 4N23A 3DTUB 2YU9A 3GTJA 1VF5B 4FVMA 1XEQA 4ZBMA 1I2KA 2QGNA 2VPQA 4JI1B 4IGGA 3M9OB 4ECVA 2UXDB 4LFCB 2LQTA 5H5NA 3J80N 4DK0A 5KFNA 2M6YA 4BW5A 4JAVA 3SYQA 5CBFA 3ORQA 2EJ0A 3KYHC 5H6QA 5CB4A 2VQFO 3I5DA 5JUMA 1VS0A 1YCIA 4EB6B 4BY7G 3FD9A 4DV5O 2A9HA 2V7QG 2ZM6B 3G4SV 1ZHQA 5C4XG 4KUMA 2EX3A 5IT9N 1E1QG 5KX5B 2HP8A 4DR5H 3LSQA 1O9GA 1WPBA 5DAAA 2R8HA 5C93A 5J2TA 4O86A 3GIIA 2OH2A 1GO3E 2R7NA 3R9RA 1IYDA 2HJDA 5BWWA 1QVFU 2EIYA 1VQPV 4ECQA 3GTPA 4DV4O 5JJNB 4FLYA 5KFMA 2Q7EA 3H1LH 2EJ2A 3U9TA 3RYHB 1I94O 4TUYB 1IBMH 1AJQA 5LOVF 1PKXA 4NXMH 4TV9F 5LHGA 1N33H 4O2AF 4B7EA 1SS3A 3ZRXA 4UB8Z 2Y0PA 2UVUA 3CCVV 1VBGA 1E79G 3QG5A 1GMGA 5KT5A 3SNOA 4O2BA 1NR1A 1IXBA 4ED3A 5I5WA 1KJJA 4MTGA 2XD4A 2R9AA 2ILMA 3ZMSA 2VUMG 3KKYA 4LF8O 2BE3A 4YHHO 4O7SA 2OCCB 3ZRWA 4IHJA 5KG5A 1AR5A 2ZE5A 3QVNA 4DV1H 2LGWA 5H2FZ 3SPIA 4I0XA 3ZHRA 1DV2A 4TV8B 2C2EA 2DMXA 1CS0A 1T3NA 5LP6B 2F4VO 2Q0AA 1IVSA 4F50A 5FNVF 4F4ZA 4J7KA 2R7LA 1RP3B 1XREA 2CW8A 4DR2B 1A32A 3T1CA 3UQ8A 2V4DA 2WWWA 4QW8A 2JJ1G 1N36O 3RYIB 5J2UF 5IYZF 3CPWU 4U7NA 2Y4UA 3DTFA 3PR4A 2CKZB 4X1IA 3LSUA 3E8FA 3CMAV 1GSAA 3AEIA 2YL2A 1R3KC 2GV9A 2XIGA 3CQZA 3CC2V 5KFQA 2B5UA 5KMGA 3FKIA 1KYOF 3MHSC 5GTIZ 2P90A 3BHPA 4HZ3A 2WSSG 2C35B 1Y76A 5DQGA 3OSPA 1C3OA 5KAIZ 2VWJA 4O2BB 1S97A 4OGQB 5DMXA 5BXZA 2DYRC 5IWAH 1AJNA 3HB9A 3GTLA 3ABKC 4FLWA 2FL4A 2IH3C 2VQEO 3CCQV 1BGYH 5KFAA 2C2AA 4TUYA 2ZE7A 3UT5A 4Q8FA 3C3TA 3CSXA 2UUCO 4OPHA 4TOIA 2V5AA 2QDOA 4MV4A 5KFSA 3RB6A 5KT3A 3HKZE 1NU1H 1DF5A 1FFXB 1MZFA 3FDSA 2W0XA 1GLVA 1QBZA 3OE7G 1LUWA 1RJPA 2A0LA 3UO2A 3QO5A 2WLLB 1KUQA 2EJ3A 2D2CB 1GN4A 4RUAA 3Q8SB 2QJ1A 4JI5B 2UUBH 3FYEB 4JTAB 5IJ9B 4EB6A 3ZX6A 2DJVA 5DGBA 5JJJB 3E89A 1S5JA 4NXMB 5FD5A 4RB1A 3K5IA 1G4YB 3OMAB 2WLHA 3BFRA 1EKFA 4J42A 3OTOH 2NVXA 1TUEB 2E2HA 3OHAA 4O7WA 1K5SA 4I7ZB 4DXWA 4C5BA 3ZRSA 4NKGB 4LCUC 3OUUA 5BR8B 1WB7A 4H13B 2Q7HA 1OV9A 5CBHA 3J80W 4KP4A 3JAWA 5E1AC 1RM1B 3MDSA 2FMLA 1VF7A 1YSCA 5F9LA 3MD0A 2E74B 1A0IA 3KALA 4X1YB 3CB2A 3CX5F 4EKWA 3LMLA 4JYYA 3RTXA 2XAJA 5BR8H 2CNUA 3NR7A 2F23A 3DXRA 2HVSA 1I1LA 5LP6F 4J0MA 4FFOA 2QSAA 3RYCA 1Y1VG 2YSUB 4DRXB 2FP4B 2AQ4A 1WCMG 1UFIA 4O2BF 3JZFA 4X65H 1K5QA 3G80A 4DL2A 3P3PA 1ZTEA 3ZN1A 1HNWB 1K1QA 1FXKA 1W59A 1Y6XA 1CKNA 2YWVA 2YI9A 1DLBA 1XNRH 3E8HA 1VQ9V 4J9YB 3ZIAG 2YIBD 2FK1A 4LF9B 1KKCA 4CS3A 1B3QA 2V4RA 3CJHA 3WWHA 5D1OA 4HNAA 4I7HA 4GKKB 3GILA 2JA5G 2E75B 5EIBD 4M9UA 4LFBB 5KHJA 5BWXA 3FB8C 4FZ1A 4RAZA 4MVSA 4RNMA 5L1JA 5JVDB 4FBTA 4JF3A 5I5TA 5D5QA 1SQFA 5KG4A 3T1HH 1ZETA 1NT2B 1OCRC 3T4DA 3UFXB 1MZEA 1W2BU 3W7TA 1AROP 1AP6A 4LF5B 3ZHQA 4PA4A 2X6BA 2C2DA 4X20B 4FLUA 4B3TO 1XNQH 2UXCH 5CMUA 1ZL8A 4ASUG 1JIHA 3MFHA 4DV3H 1JX4A 1N32B 3ZHTA 4UV8A 2JIZG 3ZN0A 2QM4A 1W0JG 1AB3A 2NR5A 4MVQA 5K1PA 4ZQIA 4HNAB 1E4EA 1WNSA 1ZUQA 3NC0B 5D1OB 3FYIB 5B3SB 4DO2A 2FYUH 2HLDG 4YJ2F 5KX5F 2LW1A 1HW7A 3CJHB 4QNHB 2HVKC 4U3FH 1BSMA 3TW6A 1EFRG 2Y4TA 1BXRA 3B77A 2NU7B 2Q9LA 1YI2V 4GC6A 2H94A 5LHIA 4MVMA 5JH7A 5B66Z 2AHZA 2ZCEA 1KJ9A 1N48A 2J6TA 3P32A 5KLVH 1IURA 4GX2A 3PZPA 4MTDA 4FFBA 1P4RA 3GB7C 2IBZH 1EUCB 4PDLA 2DAAA 2BQRA 4Q45A 1XDCA 2EZOA 1IZ3A 1ROPA 4DV2O 3AK2A 1XHXA 3JAMN 4UV9A 3L4JA 1Q6HA 1P84F 3HKEB 4X1KB 1XMOB 4JYAB 1PNLA 4Z1MG 3KHLA 3VPDA 2Q4PA 3VBBA 5IDJA 2ITCC 4LH6A 3OUZA 2YEVB 2JA8G 4ECTA 5LOVA 3K59A 5CN0A 4ME6A 2YICA 2PVPA 4EGJA 1NKDA 5B1AB 2R6FA 4QSHA 4FFNA 4NTYA 4JI1O 4GKJH 2Y69C 4EGQA 4ZOLB 3T4ZA 4A3DG 3N6RA 1I6UA 4PA7A 4JI7O 1R73A 3TY5A 1CQIB 3A0RA 4M7EA 1K83A 5JQGB 4NR1A 1L1FA 1AJPA 3BVOA 5C5JA 4TQDA 4ECWA 5GW7A 5IYDG 4RNOA 4IR1A 3T7AA 3HKDA 4MTEA 4RB0A 1K33A 1NVPB 1QLEB 1N33O 3GIJA 1Y14B 2OTLV 5IJ9A 1JCHA 3JARB 5IYZB 1MSDA 3U55A 5I5UA 1JFFB 2NNUA 2R72A 3K0DA 1DTOA 4DV3B 4B3RO 4DR7B 3IFXA 2FPPB 4IYHA 2JGDA 1VBHA 2B1GA 1GO3F 1JPXA 3UCSC 1WAZA 4J9SA 3LNNA 2IW5A 3P30A 3JCUZ 1FKAO 2IP4A 2Q73A 4DV1B 1BJTA 1B06A 4JUZA 4TM5A 3W7SA 1KT8A 3EVKA 2RJZA 3N41B 1V55B 4ED8A 5GONF 1S10A 3Q1KA 4JI0B 2PBZA 4GYCB 3TY9A 4CKCA 1I3QA 2F4VH 3Q2OA 5KFJA 1S72V 2OCCC 2OYQA 3GJXB 4MA5A 1SYXB 2GUZA 4XDLA 4QPJA 5DLGA 3LSSA 4LFAO 1HNXH 5IYCO 5IT9W 5BMVA 1K97A 1Y76B 1B33N 2BSKA 4FFPA 1YTFD 2C2RA 3K58A 4LF7B 2W70A 1GYFA 1GGOA 4RO2A 4WFHA 5HFMA 1N0NA 4G28B 1FJGO 3ETEA 4NXNH 1GRJA 4QGPA 4XYMB 4ECZA 3LULA 3BCCH 4X1IB 5LA6F 2VA2A 2IJJA 4PDVA 5KA6A 2CTPA 3IJ4A 3U10A 4X62B 4CMFA 2Y48A 2JA5A 3W1BA 3E86A 2JEGA 3ASNB 3A2FA 2YC0A 1L0LH 4EEQA 3JALA 1PL4A 1WB8A 4R8UA 5KS8A 1UNNC 4FFRA 3BACA 3CMEV 1SQXH 1BT8A 1XQ8A 2QWPB 3CP1A 2AZ0A 2UXXA 3LDCA 3K3VA 4IHJB 1VQMV 3G6VA 2PN1A 4B7KA 4IRKA 4O82A 4CS2A 1EHIA 1VQ8V 3CC7V 2WE6A 4DAAA 4OX9B 3QO8A 3HOUG 4WD3A 2HHHB 2KB1A 2UXDH 2VPSA 2MW2B 4DW0A 4ZHQF 3AK1A 4WFAV 2XNDG 3E2EA 5HV6A 5KFBA 2JS5A 5DLFA 2QWNB 4NVPA 3CYOA 4X8AA 5EIBC 1Y67A 3ZHUA 3L4KA 1H8EG 3CVZA 3RW0A 2E5LO 3HKZA 1PL0A 1EZJA 1GN2A 5DQHA 4O7TA 4XX0B 4GKJB 2KG7B 4EFBA 1YTFB 2HG8A 4J9RA 2UVRA 1K73W 2P67A 5I47A 3JD4A 1VQNV 3EPGA 3RBZA 1N36B 4TWKA 3F8NA 3CSWA 3BJYA 5DG8A 5ITZA 3OR6C 4BIUA 2LP7A 3AK3A 3T5KA 2ZIMA 3ZMVA 3OW2U 4JI4O 3GVMA 4FLXA 1Q6UA 5GTHZ 3WWJA 3AG3B 2W6MA 5KX5A 4KHPO 2CNQA 3BABA 2XUMA 1XL4A 1S0MA 2E5LB 4JAAA 4H0LB 3I56V 2FTKA 4Q44A 1D2DA 1H2NA 3Q4HB 3GWOA 3VMMA 5CB4B 3DAAA 3W5OA 1T5EA 2Q68A 4UXNA 4QWBA 3ABMC 1WR2A 5KG2A 3PW4A 4CE5A 4YR0A 2ITDC 3R5XA 3GIQA 2GSMB 2PUSA 3H01A 2JK5C 3S3XA 3UKMA 1F4NA 3FMAA 2CTRA 2YXLA 1M9NA 5JJEB 3T1YH 2G38A 4P2ZA 4TUYF 2W8KA 4DV0O 3ZEDA 5H80A 2EINC 1JLLB 4BIZA 5KFDA 1PD3A 5L3EA 4QWEA 5FNVA 1XBLA 4YAJB 1DK1A 3CRCA 3K08A 2CGOA 3D36C 2ZKOA 3MHHC 5LP6C 2QWRB 4AYBA 3N44B 1HP8A 3U54A 5BMVF 1HR0H 1U97A 3ETDA 3KHHA 3CEIA 3JATA 1ET0A 5I5XA 4MT8A 4HYKA 2XAHA 4YJ2B 2QE7G 4U6PA 1XK5A 1SF9A 1KUTA 4J7ZA 5C1PA 1RSOB 3E22B 2FB5A 3GWKC 2EIKB 4ZI7A 4O4LF 1KJQA 3GIDA 3AG4B 5EC2C 5HNEA 1Y1WG 4I5SA 4IYIA 1F4MA 3RB4A 1IBKH 3PO2G 4RUCA 3N8DA 3ETHA 3F7VC 1VP7A 2AGQA 3L72H 3WG7B 4B3SO 4YJ3F 1K8AW 4IWXA 3VQVA 1G8MA 5JVLA 3HKBB 3GIKA 4BWSC 1XMQH 2ZT9B 2FB9A 4GCZA 3RWRD 3SGIA 3TQTA 4K0KO 4O3SA 1NTMH 2UXBO 4ECUA 4O83A 3QTCA 3SJAC 2E76B 2O57A 4BY1G 1YITV 4AILC 1KD1W 4DUYO 1BL8A 4TV9B 1XL6A 1E4GT 2XGQA 1F7YA 1GM7A 4HR7A 4PA6A 5B1NA 1HNWH 4WFEA 4F4LA 4FE2A 3Q8QB 2K1EA 4DV5B 4B3TB 2P5OA 1R6NA 2HGWA 4EEYA 1ENVA 2VRZA 1RPRA 1QLNA 3ETGA 3TINA 5KG1A 3H9VA 2ZDHA 1J95A 3B8NA 2R70A 5L9XA 4QWCA 5LMUH 1I1KA 4CC6A 4DR3H 2DYSB 1CKMA 3ZMUA 1SQVH 4LSXA 3GIMA 2ZM6H 1BE3H 3HB3B 4F4XA 5HBRB 4JI4B 3RIZA 4N21A 1S0NA 5KFYA 3THOA 1I7FA 2W57A 4PDBA 3RB0A 1Q82W 1IX9A 3HBLA 1J5EO 1DAAA 2VQEB 1I5XA 4UVAA 5L3BA 2PTMA 5BWTA 4I4TB 1P49A 4XDKA 3QFFA 3UZOA 4RCNA 2QTOA 2QM8A 2WA3A 4LF4O 4F6RB 4PBCA 2Q6AA 4O3OA 1S5LZ 4C2MA 4WCEV 3OUSA 1SQPH 4CMDA 2RNBA 4CH4A 2WB1A 4QJFB 1KECA 4LF6H 1KKDA 4B3MB 1BHBA 3ABKB 3T54A 3W7WA 3HKCB 2X7RB 3K5MA 3H0GA 4JI5H 4DR6O 1U96A 3PW5A 5KUKA 1FXHA 3GV7B 2W9CB 4JI6H 2EIJB 1NI8A 2L6LA 5DM6V 3NBYB 1WSCA 2WA4A 2ASLA 1HNZO 1N32O 4QIWF 3RV4A 4JYAH 3JAKB 1FVIA 5EYPB 4DV2B 2A06H 4DV6B 1RPOA 1ZSPA 4DV7B 4KXRA 2ZE6A 3T9EA 3O9OA 2JEXA 5H6RA 1N34H 1N34B 2W9BB 3E83A 4DR6B 2FLPA 2XC9A 3A0HZ 1XMOH 4MTXA 4PA9A 2HVJC 1K92A 1TVKB 2EILC 4B3RH 1RJQA 3M99B 2YIDA 1WLEA 4YY3B 4O4LB 2DPJA 3APQA 5TISZ 5F9NA 2KQXA 5I5YA 4JI3H 3MR3A 2YS7A 5BWRA 5FJ8G 4HAMA 3MWDA 5KFUA 1IBLB 4E6NA 4WFFA 2DPIA 4K3AA 2YRXA 1M57C 1PV0A 1Q8IA 5A2QW 4O7YA 4A3JG 4JV5O 5EWEA 2PYJA 4JTCB 4OPAA 2YS8A 4MVRA 4O4HB 1TWAA 1YEWA 4MTOA 4DV4B 4JTDB 3AG2C 4HNVA 3BQ2A 4AQYH 1WPXA 3T9CA 2YS6A 4KL1A 3MR5A 3ZS8C 3U11A 2WB1E 1URFA 2NLJC 2FLNA 5KAFZ 2I80A 3RBEA 2JEJA 4RQFA 4WF9V 2WLMA 4CH3A 4Y8VB 3N2GA 3TXQA 4A3BG 3R23A 2UUCB 4WFBV 3L70H 2QKCA 3OMNB 4FM9A 4LF5H 4HNUA 1N0JA 3HOYG 4JI8B 4DV1O 4O84A 4ZI7F 1DV1A 1N4CA 2ATKC 3C0FB 2OIGA 1XUQA 1JKJB 2VR1A 2UVWA 5IJ0B 4LFBH 4ECXA 2ZINA 4X62H 3T1HB 2Z02A 1COWG 4JXUA 4DV5H 2UXBB 1Z2NX 3OUFA 3TQ1A 2EIMC 4O4HA 3HOZG 3VQXA 3RVZA 2HJWA 2R7MA 3L2PA 3G6EV 4GX0A 1SFOA 5LYJA 1SQQH 2P4KA 2Z5UA 3DTGA 2VUGA 1NBMG 1PK8A 1S5HC 1UJWB 3GTKA 1XOUA 1AUXA 1KJIA 4LC1A 2O03A 3R5HA 2W0FC 1L2ZA 5EWGA 5CAEB 1M1KW 5EZYA 4GLWA 1PP9H 3SYAA 1CQJB 2CNVA 1S3JA 2GQSA 2P06A 4Q6GA 4U3JA 3IN5A 3FB7C 4QE9A 4I50B 5KFOA 2E2IA 2IA6A 1HWYA 5CB4F 3FKIG 1AVMA 1M5IA 2UU9B 2AU0A 2XT9A 2FMAA 2YUAA 2W9BA 2BOCC 2R7KA 4O4IA 5K2MA 3U9SA 3L74H 3BRCA 1EN6A 1GM9A 2AZ2A 1A3GA 2EZPA 3V4ZA 3JAKA 3OEHG 4BW9A 4UUGA 2R9RB 4PZ7A 5IP9G 4R7RA 4LF9O 1KC7A
chains in the Genus database with same CATH topology
3JAWB 5JQGB 1SA0A 4I55A 4MV9A 4TQDA 4DV4H 5FNVB 4UCTA 1IBKB 2F4VB 1M0WA 4RAYA 2UU9H 3HKDA 4O2AB 3K5NA 2YIAA 2IM9A 4FM0A 4MTEA 4RB0A 1CKOA 4I4TA 5IJ9A 3JARB 1Z5VA 3M4IA 5IYZB 1V9PA 5DISC 4X66H 1JFFB 2P22C 2R72A 4DV0B 4JI7H 4ZHQA 4WBNA 2HIVA 2VQFB 1X9NA 4DV3B 4DR7B 4LF7H 4JV5B 3RYFB 4IIJB 1QHTA 3RJ0A 4X64H 3LNNA 4JI3B 4X20A 4EQ5A 3N2GB 4DK1A 3WB1A 4DV1B 3W1GA 4IAJA 1Z5WA 3WB0A 1BJTA 3SJBC 1HR0B 4TQFA 3GB8B 4ETSA 1FFXA 2RJZA 3N41B 4B3RB 4O4JB 4OX9H 5K1XA 4K8XA 2UXBH 3RFRA 4JI0B 4LNUA 4GYCB 5J2TB 3TY9A 3MAQA 2F4VH 1FJGH 2OYQA 3GJXB 1SYXB 3UT5B 3EYYA 2PY5A 4DR4H 2BTQA 1HNXH 5IT9W 5C8YB 5FPRA 4X64B 5BMVA 1M0TA 4ZIBA 4UCSA 2HEPA 4LF8B 4B3MH 2UUCH 5LA6A 3HKBA 3K58A 1SKVA 2CAZC 4FLZA 4LF7B 4LMYA 1JJOA 4DR7H 1GYFA 5FPOA 4CH5A 1S03G 4L8JA 1HNZB 4X66B 1CKNB 4O4LA 5J2UA 4NXNH 5KHGA 4B3SH 1KU9A 2JGUA 3PN1A 3BA9A 4X1IB 3M7MX 5KMGB 2RGRA 2UUAH 4LFCH 1TVKA 2PZSA 1MZBA 3WB2A 4K8ZA 3TY8A 4APMA 5LMNH 4JI1H 3U10A 4X62B 1O75A 3OTFA 3RYCB 5JCOC 2CW7A 3KXYT 3W1BA 2PYLA 3A2FA 4EEQA 3JALA 5LL6b 2UUBB 3J7AK 4DUZH 1Q3EA 3BA8A 1J5EB 5LXTA 3TY5A 1TA8A 4X1YA 1KMIZ 3KAKA 4LF8H 4BWAA 4YJ3A 1HNXB 1D5AA 4AHCA 3N2KB 3RGZA 1XQ8A 4YJ2A 2VQFH 5JCOA 4JI2H 4LF6B 3K3VA 1TUBA 4IHJB 4EFEA 1P16A 4JI0H 2Q2UA 2F93B 4CS2A 1AN7A 4FVMA 4CH6A 4X65B 2WE6A 1L8DA 1M93A 4JI1B 4OX9B 2HHHB 2UXDH 2VPSA 4DR6H 2UXDB 2F66C 4LFCB 2OWOA 4DK0A 4PHZA 3N40P 3K5LA 4DV2H 2JS5A 4NVPA 5EIBC 3KYHC 5CB4A 5LA6B 3L4KA 2F1MA 3CVZA 1VS0A 5FLXW 4EB6B 3J81W 1XNRB 4GKJB 4EFBA 3RF2A 2RGVA 2ZM6B 1ZHQA 5CA0A 3HXLA 2EX3A 4DR4B 5KX5B 4DR5H 4KHPH 1WH2A 1O9GA 1WPBA 1N36B 5J2TA 3F8NA 5ITZA 3JSLA 4D7TA 4O4JA 1IBMB 3RGXA 4RB3C 1TGOA 2ZIMA 3RYHA 4FM2A 2UUAB 4CS4A 4FLXA 3KAJA 3DSQA 1P8LA 4DRFA 3ETQA 5KHIA 2PGGA 5KX5A 5JJNB 4FLYA 2Q7EA 3RYHB 1IBMH 4TUYB 4NXMH 4LFAB 1N33H 3BABA 4IIJA 4TV9A 2E5LB 4PI0A 1FKAH 3RYFA 2ZIOA 4YHHB 2ZNIA 5CB4B 3QG5A 3W5OA 4ZHQB 1T5EA 4O2BA 3JAMW 3JARA 1FJGB 1I94H 2PUSA 2YI8A 3FMAA 2YXLA 5JJEB 3T1YH 3RGBA 2WYOA 2R9AA 2HVRA 3ZEDA 2Q7GA 3SJCC 5FNVA 1TUBB 4IHJA 2MCTA 4DV6H 4GKKH 4DV1H 4DR1B 1SA0B 5LP6C 4LSAA 3N44B 3N2KA 4TV8B 1HR0H 5LP6B 1ZAUA 2Q0AA 3H20A 5IWAB 3JATA 2F95B 3NBZB 1IBLH 5LXTB 3E22A 1RSOA 4YJ2B 2CW8A 4DR2B 4FLTA 3BPZA 1QQCA 1XK5A 4JI7B 3UQ8A 4DV0H 2V4DA 3E22B 5LOVB 3RYIB 4ZI7A 4JV5H 1XHZA 1B04A 4X1KA 4UCRA 4X1IA 4UCUA 4I50A 1IBKH 3K57A 5LMNB 4HBNA 2VQEH 2GV9A 3VQYA 4DR5B 2XIGA 1HNZH 4JI8H 5EZYB 1N32H 3VQVA 5KMGA 4UFZA 3HKBB 3N43B 3BHPA 4A2AA 4BWSC 1XMQH 2UXCB 3RWRD 3SGIA 4CC5A 2VWJA 4O2BB 4JI6B 5C8YA 4DR2H 3QTCA 3SJAC 4JI4H 3JSNA 1E4FT 4AILC 5IWAH 4TV9B 1E4GT 4LFAH 4FLWA 3VNNA 1DGSA 1HNWH 2HHHH 1JMKC 3K5OA 1H2SB 4TUYA 5EOYA 3UT5A 3CSXA 4DV5B 4B3TB 2P5OA 4K0KH 5D5PA 5IJ0A 4TOIA 4MV7A 4JI2B 2R70A 5LMUH 5ITZB 1FFXB 3T1YB 4KHPB 4CC6A 4DR3H 4DUYH 1CKMA 4LSXA 2ZM6H 5CA0B 4JI4B 3RIZA 4WBNB 3B2EE 4RB2C 2QJ1A 4JI5B 2UUBH 3THOA 5IJ9B 1I7FA 4B08A 4EB6A 2W57A 2E5LH 4PDBA 3IG0A 4I9QA 3QF7A 3DF7A 5JJJB 1S5JA 5JVDA 4NXMB 5FD5A 4RB1A 2VQEB 1JFFA 2VOBA 2PTMA 5IYZA 4I4TB 3OTOH 1P49A 2YCHA 4I55B 5D1PA 1ZHSA 2ZJTA 4F6RB 4PZ8A 1M4UA 1SQGA 3HKDB 4O2AA 4CH4A 5BR8B 1N36H 4LF6H 1Q5OA 4B3MB 2Q7HA 4GLXA 3J80W 4LF9H 4JI5H 3HKCB 3K5MA 2Q2TA 3JAWA 5JQGA 4LH7A 1X4TA 4JI6H 1VF7A 4YJ3B 1A0IA 4LF4B 4X1YB 4O4IB 3CB2A 3BAAA 3KALA 3NBYB 3LMLA 3RTXA 5BR8H 2HVQA 4JYAH 3JAKB 3JALB 1FVIA 5EYPB 4DRXA 4DV2B 3JASA 1Q43A 4DV6B 3OTOB 3S24A 2HVSA 3MWMA 4DV7B 4J0MA 3RR5A 4AQYB 1N34H 4UCOA 3RYCA 1N34B 1TAEA 2HGSA 1G6UA 4DRXB 5CA1A 2YIBA 4DR6B 1XMOH 3QWUA 4X65H 3HKEA 1TVKB 3N6XA 4B3SB 4B3RH 1HNWB 4D7SA 5FD6A 3FFQA 1O9HA 4YY3B 1S68A 2WDTA 4O4LB 5J2UB 1CKNA 2YI9A 4FLVA 2RQ6A 4JI3H 3HKCA 2VWKA 1XNRH 3CHXA 5GONA 2ZNJA 5LYJB 2YIBD 1IBLB 4LF9B 4E6NA 4CS3A 4DUYB 5BMVB 4DUZB 1BGWA 1Q8IA 4F6RA 5JH7B 2BTQB 5A2QW 5D1OA 4YY3H 4HNAA 3SR2C 4GKKB 4I7HA 4LR3A 2PYJA 5EIBD 4B3TH 3N42B 4LFBB 5KHJA 3VQWA 4O4HB 4A2BA 4LNUB 1YEWA 4RAZA 4DV4B 5JVDB 5D5QA 2CFMA 1SQFA 3T1HH 4AQYH 1NT2B 4DV7H 2HIXA 4KL1A 3ZS8C 3U11A 3U0ZA 4PZ6A 4LF5B 5KHKA 4NXNB 2JVDA 4CH3A 3N2GA 4X20B 4FLUA 2UUCB 1Z2OX 1XNQH 2UXCH 2BTOA 4FM9A 4LF5H 3IAYA 4DV3H 1N32B 4JI8B 3C0FB 2QM4A 4DR1H 5IJ0B 4LFBH 2ZINA 4X62H 5K1PA 3T1HB 4HNAB 4PI2A 1WNSA 3NC0B 5D1OB 4K0KB 4DV5H 2UXBB 1Z2NX 2XHBA 4O4HA 1HW7A 3VQXA 3L2PA 2KKWA 1WN7A 1I94B 5LYJA 1Z2PX 5JH7A 4RZQA 1SEIA 2VUGA 2ZCEA 4Q0YA 2O03A 4ZOLA 1L2ZA 5GONB 2FE3A 1J5EH 5LMUB 4MTDA 5EZYA 4FFBA 4FM1A 2E3CA 4Q6GA 5CA1B 4DR3B 4U3JA 4I50B 1XHXA 3JASB 3L4JA 5EYPA 3HKEB 4X1KB 1M5IA 1XMOB 4JYAB 2UU9B 2KSWA 5KHHA 1XI1A 4O4IA 4ZI7B 3BRCA 3ICXA 4LH6A 3RYIA 5LOVA 3K59A 4U3JB 3JAKA 4BW9A 4FFBB 4LF4H 4GKJH 4UCVA 4PZ7A 4YHHH 3JATB 4R7RA 4ZOLB 1I6UA 1XMQB 1N33B 3GDEA 5LP6A 1XNQB 4TV8A 1XDNA 4M7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 B;  4OX9 B;  4UFZ A;  2HHH B;  2UXD B;  4UCT A;  1IBK B;  4LFC B;  1IBL B;  3SGI A;  4LF9 B;  2UXC B;  4E6N A;  2F4V B;  4DUY B;  2OWO A;  4CC5 A;  4DUZ B;  4JI6 B;  3KYH C;  3JSN A;  5D1O A;  4GKK B;  1VS0 A;  1CKO A;  4LFB B;  1V9P A;  5DIS C;  1XNR B;  4DV0 B;  1DGS A;  4GKJ B;  3VNN A;  4EFB A;  4DV4 B;  2HIV A;  2VQF B;  1X9N A;  2ZM6 B;  4DV3 B;  2CFM A;  4DR7 B;  4JV5 B;  2HIX A;  4DV5 B;  4B3T B;  4DR4 B;  4TOI A;  1N36 B;  4PZ6 A;  4LF5 B;  4NXN B;  3JSL A;  4JI3 B;  4JI2 B;  4EQ5 A;  1IBM B;  2UUC B;  4DV1 B;  2UUA B;  3W1G A;  3T1Y B;  4KHP B;  4CC6 A;  1HR0 B;  1P8L A;  4DRF A;  3GB8 B;  1CKM A;  1N32 B;  4B3R B;  4JI8 B;  4JI4 B;  4LFA B;  4JI0 B;  3BAB A;  4JI5 B;  3TY9 A;  2E5L B;  3T1H B;  3GJX B;  4YHH B;  3NC0 B;  5D1O B;  4K0K B;  3W5O A;  4NXM B;  2UXB B;  2VQE B;  5FPR A;  4X64 B;  1FJG B;  3L2P A;  4UCS A;  1I94 B;  4LF8 B;  4LF7 B;  5D1P A;  4PZ8 A;  2VUG A;  5FPO A;  2HVR A;  1HNZ B;  5BR8 B;  4X66 B;  1CKN B;  4B3M B;  3PN1 A;  3BA9 A;  4GLX A;  5LMU B;  4DR1 B;  2Q2T A;  4LH7 A;  3TY8 A;  4X62 B;  4DR3 B;  1ZAU A;  3W1B A;  5IWA B;  1A0I A;  4LF4 B;  3NBZ B;  3BAA A;  3NBY B;  3RTX A;  4EEQ A;  2UUB B;  4DR2 B;  1XMO B;  4JYA B;  1XK5 A;  2HVQ A;  4JI7 B;  1FVI A;  2UU9 B;  3UQ8 A;  4DV2 B;  3BA8 A;  4DV6 B;  1J5E B;  3TY5 A;  1TA8 A;  3OTO B;  3S24 A;  2HVS A;  4DV7 B;  4LH6 A;  3RR5 A;  4AQY B;  4UCO A;  1N34 B;  1TAE A;  4DR6 B;  1HNX B;  1B04 A;  3QWU A;  4B3S B;  4UCR A;  1HNW B;  4LF6 B;  4UCV A;  4UCU A;  4PZ7 A;  4EFE A;  1P16 A;  4YY3 B;  1XMQ B;  1S68 A;  1N33 B;  1CKN A;  1XNQ B;  3GDE A;  2Q2U A;  5LMN B;  1XDN A;  4DR5 B;  4X65 B; 
#chains in the Genus database with same CATH topology
 4X89 A;  1SA0 A;  3LDD A;  4LF7 O;  4J9N A;  4I55 A;  2R9I A;  4MV9 A;  4DV4 H;  5EBM C;  1YZB A;  3WFV A;  2DZD A;  5LXT F;  3K06 A;  4EBC A;  3CCE V;  5B5E Z;  4RAY A;  2EBO A;  2UU9 H;  3K5N A;  3I4N G;  1MSW D;  2R86 A;  2Q8V A;  3B4S A;  5KFR A;  2CUG A;  2XTA A;  4I4T A;  5FL7 G;  2RDI A;  1QLE C;  2W8L A;  2DQ3 A;  2P22 C;  2W6P A;  5KFH A;  4JI7 H;  4ZHQ A;  4WBN A;  5KFW A;  1CE8 A;  1I08 A;  4R6Z A;  3T9D A;  3HOX G;  4XDJ A;  3QNE A;  3RYF B;  4GT1 A;  4IIJ B;  1YF2 A;  3RJ0 A;  5IYC G;  3OTO O;  2JA6 A;  3JD1 A;  4JI3 B;  3V4S A;  5KFT A;  4DIM A;  1FXV A;  4IAJ A;  1GSH A;  1VAR A;  2V59 A;  4NYE A;  4DR2 O;  4B3R B;  4O4J B;  1OJH A;  3GTO A;  5KG3 A;  1Y74 A;  4LNU A;  3CRA A;  3CE2 A;  3VOT A;  3D3I A;  3RB3 A;  2EIM B;  3RAQ A;  2PY5 A;  2P7T C;  3CCR V;  4JAS A;  2BTQ A;  3SPJ A;  4DV6 O;  1T36 A;  2WAQ A;  5C8Y B;  2R82 A;  3OFN G;  5FPR A;  3TET A;  2QM7 A;  4DV3 O;  5LMN O;  2Q69 A;  4UCS A;  3IC7 A;  4B3M H;  2UUC H;  3M8A A;  5LA6 A;  1SKV A;  1JJO A;  1SZX A;  4CH5 A;  3PJS K;  5J2T F;  2HHF A;  3AG4 C;  1AR4 A;  5D8D A;  1S03 G;  1I7N A;  4FZ0 A;  3A8T A;  1QNM A;  5J2U A;  1BQZ A;  4JYC A;  2H8P C;  3K3W A;  2AW9 A;  2JA7 A;  2GHY A;  2RGR A;  2UUA H;  3O65 A;  5DG7 A;  4FBU A;  4MVU A;  3WB2 A;  5FLM G;  2B1I A;  2WAQ E;  1G2W A;  5JQG F;  3DC6 A;  3LUT B;  5DEC A;  2CW7 A;  4NTX A;  3KXY T;  4JI0 O;  2PYL A;  1B6Q A;  1C30 A;  3OHB A;  5JWP A;  2RDC A;  2BCC H;  3AG2 B;  4YY3 O;  4HNT A;  3GIP A;  5LL6 b;  4YR3 A;  5BYA A;  2R8G A;  3J7A K;  1MNG A;  3OD4 A;  1Q3E A;  5BY1 A;  5LXT A;  1J5E B;  3KAK A;  4FMT A;  4LF8 H;  3EHB B;  4YJ3 A;  1AI4 A;  2QF7 A;  3ETJ A;  4WFG A;  5KT4 A;  1BS3 A;  4YJ2 A;  2CH7 A;  2A3Q A;  4XBF A;  4G3I A;  1TUB A;  2OTJ V;  4UB6 Z;  4O7Z A;  4X66 O;  3V6K A;  1ZWI C;  3BG5 A;  1AN7 A;  1EYZ A;  2D3O W;  1M93 A;  3RN4 A;  4IRC A;  2QB5 A;  1SRY A;  1NS1 A;  1VQL V;  3K9A A;  5EBW C;  3JYC A;  2OWO A;  5A9G A;  1PX2 A;  4PHZ A;  3JRW A;  3N40 P;  2HHF B;  5BPF A;  1L0N H;  3HO8 A;  5LA6 B;  3BQ1 A;  4J9Z B;  3JCZ A;  5FLX W;  2LFS A;  2Q0O C;  3J81 W;  1XNR B;  3BEH A;  2DYR B;  4OX9 O;  3RF2 A;  2ZXW C;  1XIL A;  5CA0 A;  4MV6 A;  2GLT A;  1CXZ B;  1VF6 A;  2P0A A;  1X59 A;  2IBK A;  4J80 A;  2R8J A;  2COI A;  4QIW A;  4QIW E;  3Q8R B;  2CK3 G;  1M6V A;  3AW8 A;  3JSL A;  4J41 A;  1EN4 A;  4O4J A;  3F7Y C;  1IBM B;  3RGX A;  4RB3 C;  1VIB A;  4UUJ C;  4CS4 A;  2M7W A;  3DSQ A;  1XNR O;  1EM1 A;  3ETQ A;  3CCU V;  4NZO A;  1RFY A;  4UVC A;  4IHJ F;  2GPS A;  4XYL B;  5KFG A;  1ZQ7 A;  4DR5 O;  2GQR A;  2RF4 A;  2R84 A;  4LFA B;  2C00 A;  4ABM A;  3I12 A;  2X6C A;  3ASO C;  4G27 B;  4XZ3 B;  4F4W A;  4IIJ A;  2ARH A;  1FKA H;  4PI0 A;  4GKK O;  3RYF A;  2ZIO A;  3HPL C;  3OT7 A;  4FFL A;  4YHH B;  2ZNI A;  3CCJ V;  1KJ8 A;  3C3S A;  4ZHQ B;  4DLK A;  2N74 A;  2B63 A;  3JAM W;  5CE8 A;  2C28 A;  1WA8 B;  1FJG B;  1I94 H;  2XAF A;  2YI8 A;  4X65 O;  1SER A;  3RGB A;  3RT3 C;  4J11 A;  2WYO A;  3TXS A;  2FKX A;  4X64 O;  5C1O A;  5KFZ A;  1OZ0 A;  2LW7 A;  4F4Y A;  2Q7G A;  2FK3 A;  2AHY A;  5KG7 A;  2MCT A;  5BPH A;  3EPI A;  1FPO A;  2Y69 B;  4FS1 A;  4DR1 B;  3N27 A;  1SA0 B;  4C5A A;  3OGI B;  3W7X A;  3N2K A;  4JI2 O;  1I2L A;  1ZAU A;  1AI5 A;  1PM9 A;  3H20 A;  2FPG B;  1IBL H;  2F95 B;  1VQ4 V;  2DAB A;  3GLK A;  3NBZ B;  1RM1 C;  3UM7 A;  2JDI G;  4FLT A;  3BPZ A;  1S9F A;  4J9O A;  4DV0 H;  1RK6 A;  3AG1 B;  2R92 A;  4GUN A;  4MVZ A;  3ZHV A;  1NTZ H;  4JV5 H;  2V4Q A;  1QR9 A;  4R8U B;  3L75 H;  3M9M B;  2XAG A;  4UCR A;  3GTG A;  4DL4 A;  4HN2 A;  4UCU A;  3SE7 A;  4I50 A;  3PFF A;  2M05 A;  3CD6 V;  4LFC O;  5LMN B;  5IY5 B;  5L3D A;  3LWB A;  3VQY A;  2XAQ A;  3ZJZ A;  4JI8 H;  5EZY B;  2QTS A;  1YVW A;  4UFZ A;  4A2A A;  1RYS A;  1R9T A;  3FB5 C;  4CC5 A;  4YXW G;  2ZD9 A;  1JDE A;  4ICG A;  4YIO A;  4JI6 B;  4C5C A;  4GC7 A;  1H8H G;  1Q90 D;  2J6S A;  4FU0 A;  3JSN A;  1OCC C;  1JVM A;  2BSK B;  5IYB O;  5DGI A;  2CQY A;  5KA5 A;  4DR4 O;  3CCL V;  1DGS A;  4O3R A;  2HHH H;  3K5O A;  4PD4 F;  4A3K G;  3B8M A;  3D8C A;  3RFC A;  5EOY A;  3L71 H;  5E25 A;  5DG9 A;  3ABL B;  3U0G A;  5D5P A;  5IJ0 A;  4J9M A;  4ECY A;  4QW9 A;  1BNC A;  1GM8 A;  1V54 B;  2EJR A;  4DR1 O;  2W6Q A;  3WWI A;  1RK5 A;  4MV7 A;  4JZG A;  2ZR3 A;  5KT7 A;  1W0K G;  3AG7 A;  4MW3 A;  4KHP B;  1SC5 B;  2EIN B;  4DUY H;  2BR0 A;  2ZDG A;  5CA0 B;  4MS2 A;  5A2Q N;  4RB2 C;  2VS0 A;  3AYH B;  2AGP A;  4CBC A;  3IG0 A;  2CDY A;  3QF7 A;  5EC1 C;  3NGD A;  4LP8 A;  1BMF G;  1CP9 A;  4C7U A;  1JFF A;  4J9L A;  4PJ0 Z;  5IYZ A;  3X2Q C;  1XNQ O;  3G71 V;  3GTQ A;  2ZE8 A;  4JV0 A;  3MFI A;  5D1P A;  4DL7 A;  3SYO A;  4PZ8 A;  2ZJT A;  1M4U A;  2PI4 A;  3HKD B;  1N36 H;  2A7W A;  4M0J A;  5FR9 A;  3FKS G;  1Q5O A;  1Y1V A;  2W7O A;  3PW7 A;  2ZQM A;  4GLX A;  5I60 A;  3IC9 A;  4U7C A;  4YQW A;  4LF9 H;  2R92 G;  2JS3 A;  5JQG A;  4K6N A;  4LH7 A;  4PDM A;  3I4M G;  1AI7 A;  2J6U A;  4YJ3 B;  1ORQ C;  4MV1 A;  1UPG A;  3MJF A;  4LF4 B;  2F43 G;  3G6X A;  2V9W A;  2WLJ A;  2YZL A;  2GTS A;  3OR7 C;  5DED A;  1EZ1 A;  5K3W A;  1MA1 A;  3X2Q B;  2JEU A;  1Q43 A;  3JAS A;  3ZMZ A;  3S24 A;  2YEV A;  4ZOL F;  3MWM A;  4WBN F;  3RR5 A;  2W71 A;  2X0L A;  2Y4R A;  1TAE A;  1G6U A;  2Q67 A;  5CA1 A;  2YIB A;  3HKE A;  4B3S B;  4D7S A;  3GQC A;  1VQO V;  2DE0 X;  3M9N B;  5BR8 O;  2WDT A;  5AG2 A;  5J2U B;  2OCH A;  1EKV A;  4O4I F;  1RJR A;  4FLV A;  2DQ0 A;  4LWS A;  4RUE A;  4TT3 G;  1QR8 A;  3HKC A;  1R6T A;  3TK1 A;  3LQS A;  2PF4 E;  1M57 B;  1F51 A;  2ZDI A;  3PW2 A;  4DUY B;  4NXM O;  2LJ2 A;  3DGE A;  2FK2 A;  3K04 A;  4F6R A;  5JH7 B;  2BTQ B;  1R6K A;  1EN5 A;  1IBK O;  3VA7 A;  5EWF A;  1YJ9 V;  4LR3 A;  4B3T H;  4MTF A;  3N42 B;  2OIE A;  4A2B A;  2NU8 B;  1Y74 B;  4LNU B;  1UC9 A;  4FS2 A;  2DWE C;  2XOK G;  3H4B A;  3CS5 A;  1VF6 C;  4DW1 A;  4JI3 O;  1E4E B;  2FPI B;  3T9A A;  5KFF A;  4J9K A;  3KZI Z;  1D5N A;  4PZ6 A;  3G6B A;  2Z3Y A;  3JRX A;  5BWU A;  1OWT A;  4I50 F;  2YXH A;  5KFL A;  2HFE C;  2YRW A;  1GK9 A;  3T2M A;  1R3L C;  4NLG A;  1ZL8 B;  4O7L A;  1GTO A;  1EKP A;  4FGR A;  3KCX A;  5JVD F;  3K9S A;  1Z2G A;  5IY5 C;  5KFC A;  3QO7 A;  2ZDQ A;  4AQY O;  4IWY A;  1JDB B;  2Z0A A;  1S77 D;  1RYR A;  1S76 D;  5LYJ F;  4J9P A;  4PI2 A;  2JEF A;  2A79 B;  1E1R G;  3OGC C;  2XHB A;  1TWG A;  1YJW V;  1MAB G;  2ZM6 O;  4IZO A;  4ECR A;  2KKW A;  3L9D A;  4PWQ A;  2ADQ B;  3B40 A;  1WN7 A;  2CE4 A;  4E4T A;  2VA3 A;  4BXX G;  1KBH A;  3OM3 B;  2COG A;  4LWS B;  4Q0Y A;  3G67 A;  1SES A;  4DUZ O;  5C44 G;  1K3E A;  5LHH A;  1SCU B;  1J5E H;  2AGA A;  5DQI A;  1KQS U;  1V51 A;  1P7B A;  2BQ3 A;  4FM1 A;  2E3C A;  5CA1 B;  1K34 A;  4O7R A;  2QA4 V;  4GKJ O;  1TWC A;  1NQT A;  3JAS B;  1KB9 F;  2BOB C;  2CZG A;  3KRE A;  1AR1 B;  2UXN A;  2GTA A;  3B09 A;  2KSW A;  3VPB A;  3R5F A;  5KHH A;  2ZDI C;  4ZI7 B;  3ICX A;  4NXN O;  5LL6 Y;  4QWA A;  1IDS A;  3DXR B;  1NZ6 A;  4GX5 A;  4U3J B;  2Q7D A;  4JGS A;  3LNM B;  1SQB H;  4UCV A;  2RCV A;  4BR6 A;  3JAT B;  5LGT A;  2DIK A;  4YHH H;  2KSD A;  3HT5 A;  3GDE A;  1MOF A;  1XNQ B;  4R50 A;  4JYA O;  3ZBH A;  1YJN V;  1I7L A;  1XDN A;  3G8D A;  4NZM A;  1ZLZ A;  1AP5 A;  3JAW B;  1GAX A;  4CHI A;  1BHA A;  4DQN A;  5FNV B;  3PR5 B;  1EBO A;  1N56 A;  1V4Y A;  3ZCC A;  4R8C A;  4DL3 A;  4A3F G;  2W6O A;  2IM9 A;  4FM0 A;  3OEE G;  3F5T A;  2N04 A;  2I8C A;  3SJQ C;  1Z5V A;  4MW8 A;  5DIS C;  5EDW A;  2W6I G;  4W4K A;  5EK0 A;  4DV0 B;  2HG5 C;  1IOV A;  2VQF B;  1X9N A;  4ED7 A;  2ETN A;  5JH7 F;  2R7Z A;  4LF7 H;  3Q4H A;  4JV5 B;  1IBM O;  1AI6 A;  1M56 B;  3TCU A;  4K35 A;  1VAJ A;  1QHT A;  5E79 Z;  4I4T F;  2GDS A;  3J7A U;  4HQ6 A;  4O7N A;  3N2G B;  4TSF G;  4DK1 A;  3WB1 A;  4Q4C A;  1NVP D;  2A1H A;  2LGQ A;  3WB0 A;  1FS0 G;  3SJB C;  4TQF A;  4LF6 O;  2ASD A;  1FFX A;  2YZN A;  1WCM A;  5KFE A;  5K1X A;  4K8X A;  2UXB H;  3S3W A;  3RFR A;  4A93 G;  5FLX N;  5B3S C;  3I55 V;  4A3M G;  3MAQ A;  2C22 A;  3PVX A;  4O3N A;  1FJG H;  2EIJ C;  1IBL O;  1SZT A;  2B9Z A;  3RBD A;  2OT5 A;  3UT5 B;  3KHG A;  4TQS A;  4QPK A;  4DV7 O;  1EZV H;  5L1L A;  3H1I H;  3V6J A;  2P4V A;  1BZK A;  2HEP A;  3T5L A;  4LF8 B;  5KFI A;  4A3E G;  4PEL A;  4FFM A;  3E5N A;  4DR7 H;  2CAZ C;  4FLZ A;  1VQ7 V;  5FPO A;  4L8J A;  4RWU A;  1HNZ B;  2JA7 G;  1QVG U;  4O4L A;  5KHG A;  4B3S H;  1KU9 A;  2JGU A;  3BA9 A;  3M7M X;  5KMG B;  4LFC H;  1OCZ B;  1TVK A;  2DLN A;  4APM A;  3T5J A;  5C8Y F;  4JI1 H;  1O75 A;  5L3C A;  3OTF A;  4NYK A;  4FPP A;  3ABT A;  3RVY A;  3CWB H;  3OMI B;  2UUB B;  4IRD A;  1OHH G;  2W7P A;  4HYO A;  4RU9 A;  3BA8 A;  1WRV A;  1TA8 A;  1KBL A;  2IJH A;  1NH2 B;  1UC8 A;  4BWA A;  1YDX A;  4MSW C;  2UXD O;  1HNX B;  4AHC A;  3N2K B;  4O4H F;  2VQF H;  3H4D A;  5JCO A;  5L3F A;  4WHX A;  4D6T H;  4DL5 A;  2ATL A;  4EFE A;  3H1H H;  2RMK B;  3SYP A;  5BWV A;  3C90 A;  2XCP A;  2Y0I A;  3JD0 A;  2Q2U A;  2OLS A;  2F93 B;  4JI0 H;  4QJF A;  4IIJ F;  4CH6 A;  4X65 B;  1L8D A;  2RN9 A;  2XCL A;  2RDJ A;  4DR6 H;  4ED2 A;  5LGU A;  2F66 C;  3ABU A;  4O3Q A;  4TQR A;  2XAS A;  1WA8 A;  1GN3 A;  4IT5 A;  1W96 A;  3K5L A;  4DV2 H;  1JR9 A;  4AYB E;  2CGN A;  1H2L A;  4FJC C;  2F1M A;  2IU0 A;  3WO1 A;  1FXK C;  4MAM A;  5B1O A;  2L35 A;  2YDE A;  4JYB A;  2RGV A;  4G2K A;  1BCC H;  3E35 A;  3SI8 A;  3HXL A;  2GUZ B;  5LBQ A;  1V55 C;  3GV5 B;  4DR4 B;  4I55 F;  4KHP H;  1WH2 A;  1MG1 A;  1S0V A;  2QWO B;  2HKO A;  1VQ6 V;  4D7T A;  1TGO A;  3RYH A;  4FM2 A;  2UUA B;  1F23 A;  2X5R A;  3KAJ A;  5DGH A;  4FFK A;  4ZKI A;  5KUM A;  1P8L A;  4JI5 O;  4DRF A;  3CXH F;  3WNZ A;  5KHI A;  2PGG A;  1Q7Y W;  3CRR A;  3UYY A;  1WJZ A;  3HOV G;  1I5Y A;  3EXA A;  1OBG A;  5KT6 A;  2HJF C;  4TV9 A;  4RUF A;  4E2L A;  1TWH A;  4L87 A;  2NU6 B;  5CR5 A;  2QK4 A;  4TV8 F;  5B1B C;  2QR4 A;  3JAR A;  2PMZ E;  4DR3 O;  3JZI A;  5KKN B;  1Y4M A;  3OSN A;  4ED0 A;  2DWD C;  1QU7 A;  2HVR A;  3R66 A;  3K03 A;  3SJC C;  2JRI A;  2P6J A;  2W6Z A;  2Z04 A;  1FD9 A;  1Y66 A;  1H2K A;  1FYJ A;  4H44 B;  1TUB B;  5CA0 F;  4DV6 H;  2EJ7 A;  4GKK H;  2CH7 B;  4PDR A;  1CEZ A;  1P7G A;  4LSA A;  5EBL C;  1CPY A;  4B3M O;  3H1J H;  5HFL A;  5IWA B;  5DN6 G;  1M7J A;  1NR7 A;  5LXT B;  3E22 A;  1RSO A;  3JZ6 A;  4X62 O;  1QQC A;  4X88 A;  3WG7 C;  4JI7 B;  4EG0 A;  2XGP A;  4BIO A;  3HR0 A;  3H0G G;  5LOV B;  2JEI A;  2XCA A;  3BY6 A;  2YZM A;  3AG1 C;  3SPC A;  1DIK A;  2QWQ B;  3SPH A;  3A0B Z;  3ZMT A;  1XHZ A;  3KHR A;  1B04 A;  2HR3 A;  2ASJ A;  4X1K A;  3LP8 A;  5C3E G;  2GPW A;  1JJ2 U;  3PO3 G;  4Q8E A;  2COJ A;  3K79 A;  3K57 A;  3G8C A;  4HBN A;  2VQE H;  4DR5 B;  1H2M A;  1N8R W;  1KP2 A;  1HNZ H;  3G6Y A;  5CA1 F;  1N32 H;  2DWC A;  3N43 B;  2EIK C;  2R93 G;  1JQ0 A;  3T1H O;  2UXC B;  2V58 A;  4CKB A;  3K3P A;  2LFR A;  5C8Y A;  4DR2 H;  3ZHS A;  4JI4 H;  5H9C A;  1E4F T;  3Q8P B;  2MK3 A;  4FIP C;  4A3I G;  4LBE C;  1WP7 A;  4H37 A;  1B6S A;  4JV1 A;  4LFA H;  1FAF A;  4JZ2 A;  3VNN A;  3MR6 A;  1JMK C;  4O3P A;  1H2S B;  2UUB O;  1V54 C;  4K0K H;  1ULZ A;  2R93 A;  3QQM A;  3AG3 C;  3P3N A;  5LGN A;  1R1B A;  5KFX A;  4JI2 B;  1G1X B;  2ODM A;  2NU9 B;  5ITZ B;  2X6A A;  4NB5 A;  3T1Y B;  2NUA B;  1DF4 A;  4PV1 B;  3H3V H;  5KT2 A;  1IYE A;  1Q86 W;  4F6E A;  2UUA O;  5IYB G;  3SYC A;  4WBN B;  2KG7 A;  3B2E E;  4YAK B;  4Q20 A;  3CRQ A;  4B08 A;  2R7Z G;  2E5L H;  2WPD G;  1US6 A;  2DOS A;  2IU3 A;  4P9O A;  4I9Q A;  1Q81 W;  3PW0 A;  3W7U A;  3DF7 A;  1K1S A;  2WLI A;  5JVD A;  2VOB A;  1LR1 A;  4RZR A;  4YP3 A;  4Z2W A;  3MR2 A;  1OCO B;  2YCH A;  1A0G A;  2YW2 A;  5L3G A;  4I55 B;  1ZHS A;  1SQG A;  3FB6 C;  4O2A A;  3J81 N;  4GZR B;  4A3C G;  2JA6 G;  4YBZ B;  4FK5 C;  3FAV A;  1VQK V;  3VOU A;  2Q2T A;  1N34 O;  3E8G A;  1X4T A;  1W93 A;  1VMG A;  1K9M W;  1XMO O;  1SET A;  3NXS A;  3OAA G;  2UU9 O;  3ABL C;  4EBD A;  3T9B A;  4O4I B;  4J7J A;  3BAA A;  2QKA A;  1K7D A;  2WLN A;  2HVQ A;  4RNN A;  3JAL B;  1I1M A;  4DRX A;  3OTO B;  2SCU B;  4YIP A;  4AQY B;  4UCO A;  2HGS A;  1K4D C;  4NZN A;  4DL6 A;  3QWU A;  1YXB A;  3TGU H;  3RUP A;  3N6X A;  4X9Q A;  2NN4 A;  1IOW A;  5FD6 A;  2VQD A;  3FFQ A;  5B1B B;  1O9H A;  1IXM A;  2ADP A;  3IGA C;  3KCY A;  1S68 A;  4L1K A;  3QZ7 A;  4EBE A;  3KTM A;  4MV8 A;  1LUV A;  2ZR2 A;  4A3G G;  2RQ6 A;  2ZGI A;  1BQ0 A;  2VWK A;  4AI8 A;  3CRM A;  3CHX A;  2NVY A;  5GON A;  1VEW A;  2ZNJ A;  3ASN C;  2Q5Z A;  5LYJ B;  5BYB A;  1JXL A;  4MA0 A;  3QZ8 A;  2DN9 A;  1VQ5 V;  5BMV B;  4DUZ B;  1NH2 D;  1BGW A;  3DC5 A;  5LMU O;  1I0H A;  3ML0 A;  4YY3 H;  3SR2 C;  2UXC O;  4UVB A;  4Z1V A;  1R3J C;  3VQW A;  4O81 A;  5JQW A;  1AIL A;  3WU2 Z;  2UVV A;  5L1I A;  1YIJ V;  3UO3 A;  2EIL B;  2CFM A;  5KG6 A;  2IMW P;  5KFK A;  5CA3 A;  1A9X A;  4DV7 H;  2HIX A;  2YZG A;  3SDL A;  3T1Y O;  3U0Z A;  1OCR B;  5KHK A;  4NXN B;  2B63 G;  2JVD A;  1GH6 A;  4DR7 O;  3JD2 A;  2WLL A;  3CCM V;  4Q4D A;  5CBG A;  1Z2O X;  2R87 A;  4BBS G;  3E8B A;  2BTO A;  4JAU A;  2JGD B;  2J9G A;  3IAY A;  4IL6 Z;  2HHH O;  4J9Q A;  2QYZ A;  1T94 A;  1XMQ O;  4KFM A;  1Y1W A;  1TWF A;  1KEE A;  3K5H A;  3ZRV A;  5IWA O;  1AUV A;  4DR1 H;  3APO A;  1PNM A;  3ORR A;  1R3I C;  2AXT Z;  4H33 A;  1EUD B;  4K0K B;  3D36 A;  4JI6 O;  3GTM A;  2H3O A;  2BQU A;  3KG2 A;  2QEX V;  2HDK A;  3EFF K;  1I94 B;  3L73 H;  2YYA A;  4O4J F;  1Z2P X;  4RZQ A;  1SEI A;  3SPG A;  2V1D A;  4OXS A;  3T5H A;  4ZOL A;  4BAY A;  3H40 A;  5GON B;  2FE3 A;  4DYL A;  2W6N A;  3T9F A;  4YR2 A;  2R8I A;  5LMU B;  4ECS A;  4I9W A;  3JD3 A;  4JI8 O;  5EZY F;  4DR3 B;  1HDJ A;  1H2G A;  3K0G A;  1QCE A;  5BZB A;  3CXC U;  1VKZ A;  2DYS C;  5EYP A;  3ABM B;  2EUL A;  1KTA A;  3AX6 A;  5IP7 G;  3TEK A;  2X0S A;  2ODT X;  1GKF A;  1XI1 A;  4RQE A;  2N05 A;  1A48 A;  3RYI A;  1HNW O;  4EYH B;  5I5V A;  1OCC B;  2FLL A;  1GN6 A;  5CM0 A;  5B1A C;  2W9C A;  2W9A A;  4FFB B;  4LF4 H;  4RAI A;  3TII A;  4GX1 A;  3TIG A;  3WO0 A;  1XMQ B;  1N33 B;  5F2V O;  5LP6 A;  4TV8 A;  4I0X B;  5KG0 A;  4U7O A;  1KP3 A;  2VUM A;  1HR0 O;  3FAV B;  3ZRW B;  3STZ C;  4UCT A;  1IBK B;  2F4V B;  2CTQ A;  1M0W A;  2GBO A;  4O2A B;  3VPC A;  2YIA A;  2CTW A;  4A5U B;  3LDE A;  4P30 A;  1JX9 A;  1CKO A;  1OBD A;  4R7C A;  1GSO A;  1JA8 A;  3D3Q A;  3M4I A;  1V9P A;  2ZXW B;  4P9P A;  4X66 H;  3CC4 V;  2R85 A;  4MVO A;  1PPJ H;  2WLI B;  1YHQ V;  2ABJ A;  2HIV A;  3RV3 A;  1Q6I A;  2PI5 A;  4LFB O;  4IR9 A;  1M56 C;  2DW4 A;  4CZZ A;  4X64 H;  3F5W C;  1K4C C;  4X20 A;  1HNX O;  4EQ5 A;  3RAX A;  3W1G A;  2PMZ A;  4MV3 A;  1B6R A;  1Z5W A;  1HR0 B;  1PNK A;  2HGX A;  3GB8 B;  1THZ A;  4ETS A;  2FJZ A;  3R65 A;  3NUA A;  3TJT A;  4PA3 A;  5IE9 A;  4OX9 H;  2IJK A;  1FFT B;  2QKS A;  4W4L A;  5J2T B;  2ALZ A;  2WAM A;  2Y0S E;  3EYY A;  4BBR G;  3ASO B;  3UZB A;  4TVI A;  4DR4 H;  2R8K A;  5T14 A;  3MWE A;  5KFP A;  3BQ0 A;  1ZX3 A;  4X64 B;  1M0T A;  1I50 A;  5IYD O;  3HOW G;  4ZIB A;  4JV2 A;  1NTK H;  4QE7 A;  2WLK A;  4JPR A;  3HKB A;  4LMY A;  3T99 A;  1OCO C;  4X66 B;  1CKN B;  4CKE A;  4QWD A;  1FXK B;  1KC8 W;  2WTF A;  1JOY A;  3H1K H;  3PN1 A;  2IH1 C;  1H38 A;  4O7V A;  4ED6 A;  1M90 W;  4LF5 O;  5J9P C;  2AGO A;  2K9P A;  2PZS A;  3CCS V;  1MZB A;  4Q43 A;  2JJ2 G;  3FX7 A;  4K8Z A;  5I5S A;  3TY8 A;  5KFV A;  3STL C;  5LMN H;  4ED1 A;  4A3L G;  1OCZ C;  3TW7 A;  3RYC B;  5JCO C;  4EYI B;  3CEB A;  4NTW A;  1WP8 A;  2Y0S A;  4YB8 B;  2W6J G;  2I87 A;  5DGA A;  1S0O A;  4DUZ H;  4E4E A;  5L1K A;  1MMM A;  4X1Y A;  3V6H A;  1KMI Z;  4J10 A;  3GV8 B;  2LO1 A;  1D5A A;  3RGZ A;  2YXY A;  1NJI W;  2FKL A;  4JI2 H;  4LF6 B;  1LNQ A;  1P16 A;  2IJI A;  4N23 A;  3DTU B;  2YU9 A;  3GTJ A;  1VF5 B;  4FVM A;  1XEQ A;  4ZBM A;  1I2K A;  2QGN A;  2VPQ A;  4JI1 B;  4IGG A;  3M9O B;  4ECV A;  2UXD B;  4LFC B;  2LQT A;  5H5N A;  3J80 N;  4DK0 A;  5KFN A;  2M6Y A;  4BW5 A;  4JAV A;  3SYQ A;  5CBF A;  3ORQ A;  2EJ0 A;  3KYH C;  5H6Q A;  5CB4 A;  2VQF O;  3I5D A;  5JUM A;  1VS0 A;  1YCI A;  4EB6 B;  4BY7 G;  3FD9 A;  4DV5 O;  2A9H A;  2V7Q G;  2ZM6 B;  3G4S V;  1ZHQ A;  5C4X G;  4KUM A;  2EX3 A;  5IT9 N;  1E1Q G;  5KX5 B;  2HP8 A;  4DR5 H;  3LSQ A;  1O9G A;  1WPB A;  5DAA A;  2R8H A;  5C93 A;  5J2T A;  4O86 A;  3GII A;  2OH2 A;  1GO3 E;  2R7N A;  3R9R A;  1IYD A;  2HJD A;  5BWW A;  1QVF U;  2EIY A;  1VQP V;  4ECQ A;  3GTP A;  4DV4 O;  5JJN B;  4FLY A;  5KFM A;  2Q7E A;  3H1L H;  2EJ2 A;  3U9T A;  3RYH B;  1I94 O;  4TUY B;  1IBM H;  1AJQ A;  5LOV F;  1PKX A;  4NXM H;  4TV9 F;  5LHG A;  1N33 H;  4O2A F;  4B7E A;  1SS3 A;  3ZRX A;  4UB8 Z;  2Y0P A;  2UVU A;  3CCV V;  1VBG A;  1E79 G;  3QG5 A;  1GMG A;  5KT5 A;  3SNO A;  4O2B A;  1NR1 A;  1IXB A;  4ED3 A;  5I5W A;  1KJJ A;  4MTG A;  2XD4 A;  2R9A A;  2ILM A;  3ZMS A;  2VUM G;  3KKY A;  4LF8 O;  2BE3 A;  4YHH O;  4O7S A;  2OCC B;  3ZRW A;  4IHJ A;  5KG5 A;  1AR5 A;  2ZE5 A;  3QVN A;  4DV1 H;  2LGW A;  5H2F Z;  3SPI A;  4I0X A;  3ZHR A;  1DV2 A;  4TV8 B;  2C2E A;  2DMX A;  1CS0 A;  1T3N A;  5LP6 B;  2F4V O;  2Q0A A;  1IVS A;  4F50 A;  5FNV F;  4F4Z A;  4J7K A;  2R7L A;  1RP3 B;  1XRE A;  2CW8 A;  4DR2 B;  1A32 A;  3T1C A;  3UQ8 A;  2V4D A;  2WWW A;  4QW8 A;  2JJ1 G;  1N36 O;  3RYI B;  5J2U F;  5IYZ F;  3CPW U;  4U7N A;  2Y4U A;  3DTF A;  3PR4 A;  2CKZ B;  4X1I A;  3LSU A;  3E8F A;  3CMA V;  1GSA A;  3AEI A;  2YL2 A;  1R3K C;  2GV9 A;  2XIG A;  3CQZ A;  3CC2 V;  5KFQ A;  2B5U A;  5KMG A;  3FKI A;  1KYO F;  3MHS C;  5GTI Z;  2P90 A;  3BHP A;  4HZ3 A;  2WSS G;  2C35 B;  1Y76 A;  5DQG A;  3OSP A;  1C3O A;  5KAI Z;  2VWJ A;  4O2B B;  1S97 A;  4OGQ B;  5DMX A;  5BXZ A;  2DYR C;  5IWA H;  1AJN A;  3HB9 A;  3GTL A;  3ABK C;  4FLW A;  2FL4 A;  2IH3 C;  2VQE O;  3CCQ V;  1BGY H;  5KFA A;  2C2A A;  4TUY A;  2ZE7 A;  3UT5 A;  4Q8F A;  3C3T A;  3CSX A;  2UUC O;  4OPH A;  4TOI A;  2V5A A;  2QDO A;  4MV4 A;  5KFS A;  3RB6 A;  5KT3 A;  3HKZ E;  1NU1 H;  1DF5 A;  1FFX B;  1MZF A;  3FDS A;  2W0X A;  1GLV A;  1QBZ A;  3OE7 G;  1LUW A;  1RJP A;  2A0L A;  3UO2 A;  3QO5 A;  2WLL B;  1KUQ A;  2EJ3 A;  2D2C B;  1GN4 A;  4RUA A;  3Q8S B;  2QJ1 A;  4JI5 B;  2UUB H;  3FYE B;  4JTA B;  5IJ9 B;  4EB6 A;  3ZX6 A;  2DJV A;  5DGB A;  5JJJ B;  3E89 A;  1S5J A;  4NXM B;  5FD5 A;  4RB1 A;  3K5I A;  1G4Y B;  3OMA B;  2WLH A;  3BFR A;  1EKF A;  4J42 A;  3OTO H;  2NVX A;  1TUE B;  2E2H A;  3OHA A;  4O7W A;  1K5S A;  4I7Z B;  4DXW A;  4C5B A;  3ZRS A;  4NKG B;  4LCU C;  3OUU A;  5BR8 B;  1WB7 A;  4H13 B;  2Q7H A;  1OV9 A;  5CBH A;  3J80 W;  4KP4 A;  3JAW A;  5E1A C;  1RM1 B;  3MDS A;  2FML A;  1VF7 A;  1YSC A;  5F9L A;  3MD0 A;  2E74 B;  1A0I A;  3KAL A;  4X1Y B;  3CB2 A;  3CX5 F;  4EKW A;  3LML A;  4JYY A;  3RTX A;  2XAJ A;  5BR8 H;  2CNU A;  3NR7 A;  2F23 A;  3DXR A;  2HVS A;  1I1L A;  5LP6 F;  4J0M A;  4FFO A;  2QSA A;  3RYC A;  1Y1V G;  2YSU B;  4DRX B;  2FP4 B;  2AQ4 A;  1WCM G;  1UFI A;  4O2B F;  3JZF A;  4X65 H;  1K5Q A;  3G80 A;  4DL2 A;  3P3P A;  1ZTE A;  3ZN1 A;  1HNW B;  1K1Q A;  1FXK A;  1W59 A;  1Y6X A;  1CKN A;  2YWV A;  2YI9 A;  1DLB A;  1XNR H;  3E8H A;  1VQ9 V;  4J9Y B;  3ZIA G;  2YIB D;  2FK1 A;  4LF9 B;  1KKC A;  4CS3 A;  1B3Q A;  2V4R A;  3CJH A;  3WWH A;  5D1O A;  4HNA A;  4I7H A;  4GKK B;  3GIL A;  2JA5 G;  2E75 B;  5EIB D;  4M9U A;  4LFB B;  5KHJ A;  5BWX A;  3FB8 C;  4FZ1 A;  4RAZ A;  4MVS A;  4RNM A;  5L1J A;  5JVD B;  4FBT A;  4JF3 A;  5I5T A;  5D5Q A;  1SQF A;  5KG4 A;  3T1H H;  1ZET A;  1NT2 B;  1OCR C;  3T4D A;  3UFX B;  1MZE A;  1W2B U;  3W7T A;  1ARO P;  1AP6 A;  4LF5 B;  3ZHQ A;  4PA4 A;  2X6B A;  2C2D A;  4X20 B;  4FLU A;  4B3T O;  1XNQ H;  2UXC H;  5CMU A;  1ZL8 A;  4ASU G;  1JIH A;  3MFH A;  4DV3 H;  1JX4 A;  1N32 B;  3ZHT A;  4UV8 A;  2JIZ G;  3ZN0 A;  2QM4 A;  1W0J G;  1AB3 A;  2NR5 A;  4MVQ A;  5K1P A;  4ZQI A;  4HNA B;  1E4E A;  1WNS A;  1ZUQ A;  3NC0 B;  5D1O B;  3FYI B;  5B3S B;  4DO2 A;  2FYU H;  2HLD G;  4YJ2 F;  5KX5 F;  2LW1 A;  1HW7 A;  3CJH B;  4QNH B;  2HVK C;  4U3F H;  1BSM A;  3TW6 A;  1EFR G;  2Y4T A;  1BXR A;  3B77 A;  2NU7 B;  2Q9L A;  1YI2 V;  4GC6 A;  2H94 A;  5LHI A;  4MVM A;  5JH7 A;  5B66 Z;  2AHZ A;  2ZCE A;  1KJ9 A;  1N48 A;  2J6T A;  3P32 A;  5KLV H;  1IUR A;  4GX2 A;  3PZP A;  4MTD A;  4FFB A;  1P4R A;  3GB7 C;  2IBZ H;  1EUC B;  4PDL A;  2DAA A;  2BQR A;  4Q45 A;  1XDC A;  2EZO A;  1IZ3 A;  1ROP A;  4DV2 O;  3AK2 A;  1XHX A;  3JAM N;  4UV9 A;  3L4J A;  1Q6H A;  1P84 F;  3HKE B;  4X1K B;  1XMO B;  4JYA B;  1PNL A;  4Z1M G;  3KHL A;  3VPD A;  2Q4P A;  3VBB A;  5IDJ A;  2ITC C;  4LH6 A;  3OUZ A;  2YEV B;  2JA8 G;  4ECT A;  5LOV A;  3K59 A;  5CN0 A;  4ME6 A;  2YIC A;  2PVP A;  4EGJ A;  1NKD A;  5B1A B;  2R6F A;  4QSH A;  4FFN A;  4NTY A;  4JI1 O;  4GKJ H;  2Y69 C;  4EGQ A;  4ZOL B;  3T4Z A;  4A3D G;  3N6R A;  1I6U A;  4PA7 A;  4JI7 O;  1R73 A;  3TY5 A;  1CQI B;  3A0R A;  4M7E A;  1K83 A;  5JQG B;  4NR1 A;  1L1F A;  1AJP A;  3BVO A;  5C5J A;  4TQD A;  4ECW A;  5GW7 A;  5IYD G;  4RNO A;  4IR1 A;  3T7A A;  3HKD A;  4MTE A;  4RB0 A;  1K33 A;  1NVP B;  1QLE B;  1N33 O;  3GIJ A;  1Y14 B;  2OTL V;  5IJ9 A;  1JCH A;  3JAR B;  5IYZ B;  1MSD A;  3U55 A;  5I5U A;  1JFF B;  2NNU A;  2R72 A;  3K0D A;  1DTO A;  4DV3 B;  4B3R O;  4DR7 B;  3IFX A;  2FPP B;  4IYH A;  2JGD A;  1VBH A;  2B1G A;  1GO3 F;  1JPX A;  3UCS C;  1WAZ A;  4J9S A;  3LNN A;  2IW5 A;  3P30 A;  3JCU Z;  1FKA O;  2IP4 A;  2Q73 A;  4DV1 B;  1BJT A;  1B06 A;  4JUZ A;  4TM5 A;  3W7S A;  1KT8 A;  3EVK A;  2RJZ A;  3N41 B;  1V55 B;  4ED8 A;  5GON F;  1S10 A;  3Q1K A;  4JI0 B;  2PBZ A;  4GYC B;  3TY9 A;  4CKC A;  1I3Q A;  2F4V H;  3Q2O A;  5KFJ A;  1S72 V;  2OCC C;  2OYQ A;  3GJX B;  4MA5 A;  1SYX B;  2GUZ A;  4XDL A;  4QPJ A;  5DLG A;  3LSS A;  4LFA O;  1HNX H;  5IYC O;  5IT9 W;  5BMV A;  1K97 A;  1Y76 B;  1B33 N;  2BSK A;  4FFP A;  1YTF D;  2C2R A;  3K58 A;  4LF7 B;  2W70 A;  1GYF A;  1GGO A;  4RO2 A;  4WFH A;  5HFM A;  1N0N A;  4G28 B;  1FJG O;  3ETE A;  4NXN H;  1GRJ A;  4QGP A;  4XYM B;  4ECZ A;  3LUL A;  3BCC H;  4X1I B;  5LA6 F;  2VA2 A;  2IJJ A;  4PDV A;  5KA6 A;  2CTP A;  3IJ4 A;  3U10 A;  4X62 B;  4CMF A;  2Y48 A;  2JA5 A;  3W1B A;  3E86 A;  2JEG A;  3ASN B;  3A2F A;  2YC0 A;  1L0L H;  4EEQ A;  3JAL A;  1PL4 A;  1WB8 A;  4R8U A;  5KS8 A;  1UNN C;  4FFR A;  3BAC A;  3CME V;  1SQX H;  1BT8 A;  1XQ8 A;  2QWP B;  3CP1 A;  2AZ0 A;  2UXX A;  3LDC A;  3K3V A;  4IHJ B;  1VQM V;  3G6V A;  2PN1 A;  4B7K A;  4IRK A;  4O82 A;  4CS2 A;  1EHI A;  1VQ8 V;  3CC7 V;  2WE6 A;  4DAA A;  4OX9 B;  3QO8 A;  3HOU G;  4WD3 A;  2HHH B;  2KB1 A;  2UXD H;  2VPS A;  2MW2 B;  4DW0 A;  4ZHQ F;  3AK1 A;  4WFA V;  2XND G;  3E2E A;  5HV6 A;  5KFB A;  2JS5 A;  5DLF A;  2QWN B;  4NVP A;  3CYO A;  4X8A A;  5EIB C;  1Y67 A;  3ZHU A;  3L4K A;  1H8E G;  3CVZ A;  3RW0 A;  2E5L O;  3HKZ A;  1PL0 A;  1EZJ A;  1GN2 A;  5DQH A;  4O7T A;  4XX0 B;  4GKJ B;  2KG7 B;  4EFB A;  1YTF B;  2HG8 A;  4J9R A;  2UVR A;  1K73 W;  2P67 A;  5I47 A;  3JD4 A;  1VQN V;  3EPG A;  3RBZ A;  1N36 B;  4TWK A;  3F8N A;  3CSW A;  3BJY A;  5DG8 A;  5ITZ A;  3OR6 C;  4BIU A;  2LP7 A;  3AK3 A;  3T5K A;  2ZIM A;  3ZMV A;  3OW2 U;  4JI4 O;  3GVM A;  4FLX A;  1Q6U A;  5GTH Z;  3WWJ A;  3AG3 B;  2W6M A;  5KX5 A;  4KHP O;  2CNQ A;  3BAB A;  2XUM A;  1XL4 A;  1S0M A;  2E5L B;  4JAA A;  4H0L B;  3I56 V;  2FTK A;  4Q44 A;  1D2D A;  1H2N A;  3Q4H B;  3GWO A;  3VMM A;  5CB4 B;  3DAA A;  3W5O A;  1T5E A;  2Q68 A;  4UXN A;  4QWB A;  3ABM C;  1WR2 A;  5KG2 A;  3PW4 A;  4CE5 A;  4YR0 A;  2ITD C;  3R5X A;  3GIQ A;  2GSM B;  2PUS A;  3H01 A;  2JK5 C;  3S3X A;  3UKM A;  1F4N A;  3FMA A;  2CTR A;  2YXL A;  1M9N A;  5JJE B;  3T1Y H;  2G38 A;  4P2Z A;  4TUY F;  2W8K A;  4DV0 O;  3ZED A;  5H80 A;  2EIN C;  1JLL B;  4BIZ A;  5KFD A;  1PD3 A;  5L3E A;  4QWE A;  5FNV A;  1XBL A;  4YAJ B;  1DK1 A;  3CRC A;  3K08 A;  2CGO A;  3D36 C;  2ZKO A;  3MHH C;  5LP6 C;  2QWR B;  4AYB A;  3N44 B;  1HP8 A;  3U54 A;  5BMV F;  1HR0 H;  1U97 A;  3ETD A;  3KHH A;  3CEI A;  3JAT A;  1ET0 A;  5I5X A;  4MT8 A;  4HYK A;  2XAH A;  4YJ2 B;  2QE7 G;  4U6P A;  1XK5 A;  1SF9 A;  1KUT A;  4J7Z A;  5C1P A;  1RSO B;  3E22 B;  2FB5 A;  3GWK C;  2EIK B;  4ZI7 A;  4O4L F;  1KJQ A;  3GID A;  3AG4 B;  5EC2 C;  5HNE A;  1Y1W G;  4I5S A;  4IYI A;  1F4M A;  3RB4 A;  1IBK H;  3PO2 G;  4RUC A;  3N8D A;  3ETH A;  3F7V C;  1VP7 A;  2AGQ A;  3L72 H;  3WG7 B;  4B3S O;  4YJ3 F;  1K8A W;  4IWX A;  3VQV A;  1G8M A;  5JVL A;  3HKB B;  3GIK A;  4BWS C;  1XMQ H;  2ZT9 B;  2FB9 A;  4GCZ A;  3RWR D;  3SGI A;  3TQT A;  4K0K O;  4O3S A;  1NTM H;  2UXB O;  4ECU A;  4O83 A;  3QTC A;  3SJA C;  2E76 B;  2O57 A;  4BY1 G;  1YIT V;  4AIL C;  1KD1 W;  4DUY O;  1BL8 A;  4TV9 B;  1XL6 A;  1E4G T;  2XGQ A;  1F7Y A;  1GM7 A;  4HR7 A;  4PA6 A;  5B1N A;  1HNW H;  4WFE A;  4F4L A;  4FE2 A;  3Q8Q B;  2K1E A;  4DV5 B;  4B3T B;  2P5O A;  1R6N A;  2HGW A;  4EEY A;  1ENV A;  2VRZ A;  1RPR A;  1QLN A;  3ETG A;  3TIN A;  5KG1 A;  3H9V A;  2ZDH A;  1J95 A;  3B8N A;  2R70 A;  5L9X A;  4QWC A;  5LMU H;  1I1K A;  4CC6 A;  4DR3 H;  2DYS B;  1CKM A;  3ZMU A;  1SQV H;  4LSX A;  3GIM A;  2ZM6 H;  1BE3 H;  3HB3 B;  4F4X A;  5HBR B;  4JI4 B;  3RIZ A;  4N21 A;  1S0N A;  5KFY A;  3THO A;  1I7F A;  2W57 A;  4PDB A;  3RB0 A;  1Q82 W;  1IX9 A;  3HBL A;  1J5E O;  1DAA A;  2VQE B;  1I5X A;  4UVA A;  5L3B A;  2PTM A;  5BWT A;  4I4T B;  1P49 A;  4XDK A;  3QFF A;  3UZO A;  4RCN A;  2QTO A;  2QM8 A;  2WA3 A;  4LF4 O;  4F6R B;  4PBC A;  2Q6A A;  4O3O A;  1S5L Z;  4C2M A;  4WCE V;  3OUS A;  1SQP H;  4CMD A;  2RNB A;  4CH4 A;  2WB1 A;  4QJF B;  1KEC A;  4LF6 H;  1KKD A;  4B3M B;  1BHB A;  3ABK B;  3T54 A;  3W7W A;  3HKC B;  2X7R B;  3K5M A;  3H0G A;  4JI5 H;  4DR6 O;  1U96 A;  3PW5 A;  5KUK A;  1FXH A;  3GV7 B;  2W9C B;  4JI6 H;  2EIJ B;  1NI8 A;  2L6L A;  5DM6 V;  3NBY B;  1WSC A;  2WA4 A;  2ASL A;  1HNZ O;  1N32 O;  4QIW F;  3RV4 A;  4JYA H;  3JAK B;  1FVI A;  5EYP B;  4DV2 B;  2A06 H;  4DV6 B;  1RPO A;  1ZSP A;  4DV7 B;  4KXR A;  2ZE6 A;  3T9E A;  3O9O A;  2JEX A;  5H6R A;  1N34 H;  1N34 B;  2W9B B;  3E83 A;  4DR6 B;  2FLP A;  2XC9 A;  3A0H Z;  1XMO H;  4MTX A;  4PA9 A;  2HVJ C;  1K92 A;  1TVK B;  2EIL C;  4B3R H;  1RJQ A;  3M99 B;  2YID A;  1WLE A;  4YY3 B;  4O4L B;  2DPJ A;  3APQ A;  5TIS Z;  5F9N A;  2KQX A;  5I5Y A;  4JI3 H;  3MR3 A;  2YS7 A;  5BWR A;  5FJ8 G;  4HAM A;  3MWD A;  5KFU A;  1IBL B;  4E6N A;  4WFF A;  2DPI A;  4K3A A;  2YRX A;  1M57 C;  1PV0 A;  1Q8I A;  5A2Q W;  4O7Y A;  4A3J G;  4JV5 O;  5EWE A;  2PYJ A;  4JTC B;  4OPA A;  2YS8 A;  4MVR A;  4O4H B;  1TWA A;  1YEW A;  4MTO A;  4DV4 B;  4JTD B;  3AG2 C;  4HNV A;  3BQ2 A;  4AQY H;  1WPX A;  3T9C A;  2YS6 A;  4KL1 A;  3MR5 A;  3ZS8 C;  3U11 A;  2WB1 E;  1URF A;  2NLJ C;  2FLN A;  5KAF Z;  2I80 A;  3RBE A;  2JEJ A;  4RQF A;  4WF9 V;  2WLM A;  4CH3 A;  4Y8V B;  3N2G A;  3TXQ A;  4A3B G;  3R23 A;  2UUC B;  4WFB V;  3L70 H;  2QKC A;  3OMN B;  4FM9 A;  4LF5 H;  4HNU A;  1N0J A;  3HOY G;  4JI8 B;  4DV1 O;  4O84 A;  4ZI7 F;  1DV1 A;  1N4C A;  2ATK C;  3C0F B;  2OIG A;  1XUQ A;  1JKJ B;  2VR1 A;  2UVW A;  5IJ0 B;  4LFB H;  4ECX A;  2ZIN A;  4X62 H;  3T1H B;  2Z02 A;  1COW G;  4JXU A;  4DV5 H;  2UXB B;  1Z2N X;  3OUF A;  3TQ1 A;  2EIM C;  4O4H A;  3HOZ G;  3VQX A;  3RVZ A;  2HJW A;  2R7M A;  3L2P A;  3G6E V;  4GX0 A;  1SFO A;  5LYJ A;  1SQQ H;  2P4K A;  2Z5U A;  3DTG A;  2VUG A;  1NBM G;  1PK8 A;  1S5H C;  1UJW B;  3GTK A;  1XOU A;  1AUX A;  1KJI A;  4LC1 A;  2O03 A;  3R5H A;  2W0F C;  1L2Z A;  5EWG A;  5CAE B;  1M1K W;  5EZY A;  4GLW A;  1PP9 H;  3SYA A;  1CQJ B;  2CNV A;  1S3J A;  2GQS A;  2P06 A;  4Q6G A;  4U3J A;  3IN5 A;  3FB7 C;  4QE9 A;  4I50 B;  5KFO A;  2E2I A;  2IA6 A;  1HWY A;  5CB4 F;  3FKI G;  1AVM A;  1M5I A;  2UU9 B;  2AU0 A;  2XT9 A;  2FMA A;  2YUA A;  2W9B A;  2BOC C;  2R7K A;  4O4I A;  5K2M A;  3U9S A;  3L74 H;  3BRC A;  1EN6 A;  1GM9 A;  2AZ2 A;  1A3G A;  2EZP A;  3V4Z A;  3JAK A;  3OEH G;  4BW9 A;  4UUG A;  2R9R B;  4PZ7 A;  5IP9 G;  4R7R A;  4LF9 O;  1KC7 A; 
#chains in the Genus database with same CATH homology
 3JAW B;  5JQG B;  1SA0 A;  4I55 A;  4MV9 A;  4TQD A;  4DV4 H;  5FNV B;  4UCT A;  1IBK B;  2F4V B;  1M0W A;  4RAY A;  2UU9 H;  3HKD A;  4O2A B;  3K5N A;  2YIA A;  2IM9 A;  4FM0 A;  4MTE A;  4RB0 A;  1CKO A;  4I4T A;  5IJ9 A;  3JAR B;  1Z5V A;  3M4I A;  5IYZ B;  1V9P A;  5DIS C;  4X66 H;  1JFF B;  2P22 C;  2R72 A;  4DV0 B;  4JI7 H;  4ZHQ A;  4WBN A;  2HIV A;  2VQF B;  1X9N A;  4DV3 B;  4DR7 B;  4LF7 H;  4JV5 B;  3RYF B;  4IIJ B;  1QHT A;  3RJ0 A;  4X64 H;  3LNN A;  4JI3 B;  4X20 A;  4EQ5 A;  3N2G B;  4DK1 A;  3WB1 A;  4DV1 B;  3W1G A;  4IAJ A;  1Z5W A;  3WB0 A;  1BJT A;  3SJB C;  1HR0 B;  4TQF A;  3GB8 B;  4ETS A;  1FFX A;  2RJZ A;  3N41 B;  4B3R B;  4O4J B;  4OX9 H;  5K1X A;  4K8X A;  2UXB H;  3RFR A;  4JI0 B;  4LNU A;  4GYC B;  5J2T B;  3TY9 A;  3MAQ A;  2F4V H;  1FJG H;  2OYQ A;  3GJX B;  1SYX B;  3UT5 B;  3EYY A;  2PY5 A;  4DR4 H;  2BTQ A;  1HNX H;  5IT9 W;  5C8Y B;  5FPR A;  4X64 B;  5BMV A;  1M0T A;  4ZIB A;  4UCS A;  2HEP A;  4LF8 B;  4B3M H;  2UUC H;  5LA6 A;  3HKB A;  3K58 A;  1SKV A;  2CAZ C;  4FLZ A;  4LF7 B;  4LMY A;  1JJO A;  4DR7 H;  1GYF A;  5FPO A;  4CH5 A;  1S03 G;  4L8J A;  1HNZ B;  4X66 B;  1CKN B;  4O4L A;  5J2U A;  4NXN H;  5KHG A;  4B3S H;  1KU9 A;  2JGU A;  3PN1 A;  3BA9 A;  4X1I B;  3M7M X;  5KMG B;  2RGR A;  2UUA H;  4LFC H;  1TVK A;  2PZS A;  1MZB A;  3WB2 A;  4K8Z A;  3TY8 A;  4APM A;  5LMN H;  4JI1 H;  3U10 A;  4X62 B;  1O75 A;  3OTF A;  3RYC B;  5JCO C;  2CW7 A;  3KXY T;  3W1B A;  2PYL A;  3A2F A;  4EEQ A;  3JAL A;  5LL6 b;  2UUB B;  3J7A K;  4DUZ H;  1Q3E A;  3BA8 A;  1J5E B;  5LXT A;  3TY5 A;  1TA8 A;  4X1Y A;  1KMI Z;  3KAK A;  4LF8 H;  4BWA A;  4YJ3 A;  1HNX B;  1D5A A;  4AHC A;  3N2K B;  3RGZ A;  1XQ8 A;  4YJ2 A;  2VQF H;  5JCO A;  4JI2 H;  4LF6 B;  3K3V A;  1TUB A;  4IHJ B;  4EFE A;  1P16 A;  4JI0 H;  2Q2U A;  2F93 B;  4CS2 A;  1AN7 A;  4FVM A;  4CH6 A;  4X65 B;  2WE6 A;  1L8D A;  1M93 A;  4JI1 B;  4OX9 B;  2HHH B;  2UXD H;  2VPS A;  4DR6 H;  2UXD B;  2F66 C;  4LFC B;  2OWO A;  4DK0 A;  4PHZ A;  3N40 P;  3K5L A;  4DV2 H;  2JS5 A;  4NVP A;  5EIB C;  3KYH C;  5CB4 A;  5LA6 B;  3L4K A;  2F1M A;  3CVZ A;  1VS0 A;  5FLX W;  4EB6 B;  3J81 W;  1XNR B;  4GKJ B;  4EFB A;  3RF2 A;  2RGV A;  2ZM6 B;  1ZHQ A;  5CA0 A;  3HXL A;  2EX3 A;  4DR4 B;  5KX5 B;  4DR5 H;  4KHP H;  1WH2 A;  1O9G A;  1WPB A;  1N36 B;  5J2T A;  3F8N A;  5ITZ A;  3JSL A;  4D7T A;  4O4J A;  1IBM B;  3RGX A;  4RB3 C;  1TGO A;  2ZIM A;  3RYH A;  4FM2 A;  2UUA B;  4CS4 A;  4FLX A;  3KAJ A;  3DSQ A;  1P8L A;  4DRF A;  3ETQ A;  5KHI A;  2PGG A;  5KX5 A;  5JJN B;  4FLY A;  2Q7E A;  3RYH B;  1IBM H;  4TUY B;  4NXM H;  4LFA B;  1N33 H;  3BAB A;  4IIJ A;  4TV9 A;  2E5L B;  4PI0 A;  1FKA H;  3RYF A;  2ZIO A;  4YHH B;  2ZNI A;  5CB4 B;  3QG5 A;  3W5O A;  4ZHQ B;  1T5E A;  4O2B A;  3JAM W;  3JAR A;  1FJG B;  1I94 H;  2PUS A;  2YI8 A;  3FMA A;  2YXL A;  5JJE B;  3T1Y H;  3RGB A;  2WYO A;  2R9A A;  2HVR A;  3ZED A;  2Q7G A;  3SJC C;  5FNV A;  1TUB B;  4IHJ A;  2MCT A;  4DV6 H;  4GKK H;  4DV1 H;  4DR1 B;  1SA0 B;  5LP6 C;  4LSA A;  3N44 B;  3N2K A;  4TV8 B;  1HR0 H;  5LP6 B;  1ZAU A;  2Q0A A;  3H20 A;  5IWA B;  3JAT A;  2F95 B;  3NBZ B;  1IBL H;  5LXT B;  3E22 A;  1RSO A;  4YJ2 B;  2CW8 A;  4DR2 B;  4FLT A;  3BPZ A;  1QQC A;  1XK5 A;  4JI7 B;  3UQ8 A;  4DV0 H;  2V4D A;  3E22 B;  5LOV B;  3RYI B;  4ZI7 A;  4JV5 H;  1XHZ A;  1B04 A;  4X1K A;  4UCR A;  4X1I A;  4UCU A;  4I50 A;  1IBK H;  3K57 A;  5LMN B;  4HBN A;  2VQE H;  2GV9 A;  3VQY A;  4DR5 B;  2XIG A;  1HNZ H;  4JI8 H;  5EZY B;  1N32 H;  3VQV A;  5KMG A;  4UFZ A;  3HKB B;  3N43 B;  3BHP A;  4A2A A;  4BWS C;  1XMQ H;  2UXC B;  3RWR D;  3SGI A;  4CC5 A;  2VWJ A;  4O2B B;  4JI6 B;  5C8Y A;  4DR2 H;  3QTC A;  3SJA C;  4JI4 H;  3JSN A;  1E4F T;  4AIL C;  5IWA H;  4TV9 B;  1E4G T;  4LFA H;  4FLW A;  3VNN A;  1DGS A;  1HNW H;  2HHH H;  1JMK C;  3K5O A;  1H2S B;  4TUY A;  5EOY A;  3UT5 A;  3CSX A;  4DV5 B;  4B3T B;  2P5O A;  4K0K H;  5D5P A;  5IJ0 A;  4TOI A;  4MV7 A;  4JI2 B;  2R70 A;  5LMU H;  5ITZ B;  1FFX B;  3T1Y B;  4KHP B;  4CC6 A;  4DR3 H;  4DUY H;  1CKM A;  4LSX A;  2ZM6 H;  5CA0 B;  4JI4 B;  3RIZ A;  4WBN B;  3B2E E;  4RB2 C;  2QJ1 A;  4JI5 B;  2UUB H;  3THO A;  5IJ9 B;  1I7F A;  4B08 A;  4EB6 A;  2W57 A;  2E5L H;  4PDB A;  3IG0 A;  4I9Q A;  3QF7 A;  3DF7 A;  5JJJ B;  1S5J A;  5JVD A;  4NXM B;  5FD5 A;  4RB1 A;  2VQE B;  1JFF A;  2VOB A;  2PTM A;  5IYZ A;  4I4T B;  3OTO H;  1P49 A;  2YCH A;  4I55 B;  5D1P A;  1ZHS A;  2ZJT A;  4F6R B;  4PZ8 A;  1M4U A;  1SQG A;  3HKD B;  4O2A A;  4CH4 A;  5BR8 B;  1N36 H;  4LF6 H;  1Q5O A;  4B3M B;  2Q7H A;  4GLX A;  3J80 W;  4LF9 H;  4JI5 H;  3HKC B;  3K5M A;  2Q2T A;  3JAW A;  5JQG A;  4LH7 A;  1X4T A;  4JI6 H;  1VF7 A;  4YJ3 B;  1A0I A;  4LF4 B;  4X1Y B;  4O4I B;  3CB2 A;  3BAA A;  3KAL A;  3NBY B;  3LML A;  3RTX A;  5BR8 H;  2HVQ A;  4JYA H;  3JAK B;  3JAL B;  1FVI A;  5EYP B;  4DRX A;  4DV2 B;  3JAS A;  1Q43 A;  4DV6 B;  3OTO B;  3S24 A;  2HVS A;  3MWM A;  4DV7 B;  4J0M A;  3RR5 A;  4AQY B;  1N34 H;  4UCO A;  3RYC A;  1N34 B;  1TAE A;  2HGS A;  1G6U A;  4DRX B;  5CA1 A;  2YIB A;  4DR6 B;  1XMO H;  3QWU A;  4X65 H;  3HKE A;  1TVK B;  3N6X A;  4B3S B;  4B3R H;  1HNW B;  4D7S A;  5FD6 A;  3FFQ A;  1O9H A;  4YY3 B;  1S68 A;  2WDT A;  4O4L B;  5J2U B;  1CKN A;  2YI9 A;  4FLV A;  2RQ6 A;  4JI3 H;  3HKC A;  2VWK A;  1XNR H;  3CHX A;  5GON A;  2ZNJ A;  5LYJ B;  2YIB D;  1IBL B;  4LF9 B;  4E6N A;  4CS3 A;  4DUY B;  5BMV B;  4DUZ B;  1BGW A;  1Q8I A;  4F6R A;  5JH7 B;  2BTQ B;  5A2Q W;  5D1O A;  4YY3 H;  4HNA A;  3SR2 C;  4GKK B;  4I7H A;  4LR3 A;  2PYJ A;  5EIB D;  4B3T H;  3N42 B;  4LFB B;  5KHJ A;  3VQW A;  4O4H B;  4A2B A;  4LNU B;  1YEW A;  4RAZ A;  4DV4 B;  5JVD B;  5D5Q A;  2CFM A;  1SQF A;  3T1H H;  4AQY H;  1NT2 B;  4DV7 H;  2HIX A;  4KL1 A;  3ZS8 C;  3U11 A;  3U0Z A;  4PZ6 A;  4LF5 B;  5KHK A;  4NXN B;  2JVD A;  4CH3 A;  3N2G A;  4X20 B;  4FLU A;  2UUC B;  1Z2O X;  1XNQ H;  2UXC H;  2BTO A;  4FM9 A;  4LF5 H;  3IAY A;  4DV3 H;  1N32 B;  4JI8 B;  3C0F B;  2QM4 A;  4DR1 H;  5IJ0 B;  4LFB H;  2ZIN A;  4X62 H;  5K1P A;  3T1H B;  4HNA B;  4PI2 A;  1WNS A;  3NC0 B;  5D1O B;  4K0K B;  4DV5 H;  2UXB B;  1Z2N X;  2XHB A;  4O4H A;  1HW7 A;  3VQX A;  3L2P A;  2KKW A;  1WN7 A;  1I94 B;  5LYJ A;  1Z2P X;  5JH7 A;  4RZQ A;  1SEI A;  2VUG A;  2ZCE A;  4Q0Y A;  2O03 A;  4ZOL A;  1L2Z A;  5GON B;  2FE3 A;  1J5E H;  5LMU B;  4MTD A;  5EZY A;  4FFB A;  4FM1 A;  2E3C A;  4Q6G A;  5CA1 B;  4DR3 B;  4U3J A;  4I50 B;  1XHX A;  3JAS B;  3L4J A;  5EYP A;  3HKE B;  4X1K B;  1M5I A;  1XMO B;  4JYA B;  2UU9 B;  2KSW A;  5KHH A;  1XI1 A;  4O4I A;  4ZI7 B;  3BRC A;  3ICX A;  4LH6 A;  3RYI A;  5LOV A;  3K59 A;  4U3J B;  3JAK A;  4BW9 A;  4FFB B;  4LF4 H;  4GKJ H;  4UCV A;  4PZ7 A;  4YHH H;  3JAT B;  4R7R A;  4ZOL B;  1I6U A;  1XMQ B;  1N33 B;  3GDE A;  5LP6 A;  1XNQ B;  4TV8 A;  1XDN A;  4M7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...