4UCRA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
total genus 91
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucrA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucrA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucrA02
2UUBB 3TY8A 4DV2B 4JI5B 1IBLB 4JI7B 4K0KB 4DV6B 4LFBB 2CFMA 5IWAB 1P16A 1ZAUA 1I94B 1X9NA 3RR5A 1HNZB 1N32B 3RTXA 3NC0B 1VS0A 1DGSA 2Q2TA 3BABA 5LMUB 4UCSA 5FPOA 4DV7B 4B3MB 4JI4B 4LF4B 4DV5B 2VQEB 4DR6B 4B3RB 1N36B 4LH6A 3JSNA 4UCRA 1CKNB 4PZ8A 1A0IA 4DR4B 4PZ6A 1N34B 2E5LB 4EFEA 2F4VB 4UFZA 5D1PA 3VNNA 1HNXB 3S24A 1FJGB 2ZM6B 4YHHB 2UXDB 4DV1B 5D1OA 4LH7A 5D1OB 1IBKB 1XNQB 1FVIA 3L2PA 5FPRA 1HNWB 4LF7B 3TY5A 3OTOB 4AQYB 4UCTA 1IBMB 4B3SB 4JI0B 4LF9B 4LFAB 4DRFA 4UCOA 3PN1A 4DR2B 4DV4B 4JYAB 2HVRA 4NXNB 3BA9A 4JI6B 4DUYB 4CC6A 4LF6B 1S68A 2HVQA 4X65B 1B04A 2HIVA 3UQ8A 1TA8A 4GKKB 4GKJB 4DV0B 4E6NA 3GDEA 1TAEA 5LMNB 4JV5B 4JI1B 2HHHB 2VUGA 3W1BA 4LFCB 4UCUA 1XNRB 1V9PA 4X66B 3BAAA 2HVSA 2UXCB 4LF5B 4CC5A 3GB8B 4JI8B 2Q2UA 4TOIA 3T1HB 2UUAB 2UXBB 3SGIA 3NBYB 2OWOA 4LF8B 1CKNA 3QWUA 3GJXB 4EFBA 4OX9B 4DV3B 1P8LA 3W5OA 4X62B 4DUZB 2HIXA 1N33B 3JSLA 3NBZB 1XK5A 4JI2B 1HR0B 4EQ5A 4DR3B 1CKOA 2UUCB 4B3TB 4NXMB 4EEQA 5DISC 4KHPB 4DR7B 4YY3B 4UCVA 5BR8B 3W1GA 1XMOB 1XDNA 4JI3B 4X64B 3KYHC 1J5EB 4GLXA 1XMQB 3BA8A 4DR5B 4PZ7A 3TY9A 2VQFB 1CKMA 4DR1B 3T1YB 2UU9B
chains in the Genus database with same CATH superfamily
4DL5A 2UU9O 3TY8A 1MOFA 5GTHZ 5I5VA 4ZQIA 2W9AA 4DV3H 2XAGA 3L73H 4B08A 1U97A 3GTLA 1YZBA 2R72A 3ASNB 2N74A 4MTXA 2ASLA 1PL4A 3JD0A 2FL4A 3TINA 1SESA 3THOA 1VS0A 3SNOA 1Y1VG 1J95A 4CH4A 1T36A 4DV0H 2AGAA 5LMUO 4B3MB 5IYCG 4DV7O 4D6TH 3GTPA 1CKNB 2HHHH 4QIWE 1IYEA 5LP6A 2YXLA 4X20A 1RM1B 3EHBB 5ITZB 2M7WA 2ZDHA 3DTGA 5KFYA 3VNNA 5LYJA 4R7CA 5KG0A 3GTKA 5EBWC 4DR1H 2HVKC 1I50A 1A3GA 4LF7B 4OX9H 3TY5A 1GKFA 1FXKA 2QTSA 3K3PA 4MTGA 3OM3B 3JAWA 2OTJV 3R5FA 2P0AA 2HVJC 3CS5A 1IBMO 1AR4A 4K8XA 4TQSA 1BQZA 4I5SA 1OCRB 3UT5B 1I5XA 5KG5A 4E2LA 1IVSA 4FMTA 4FM9A 3V6HA 3JCZA 5B3SC 5I5TA 5L1LA 3D36C 5JVDF 4X65O 2YEVA 4ZI7A 1NJIW 2R8GA 2K1EA 2UXNA 4J9KA 1A9XA 3EPGA 3U0ZA 5CB4F 3WG7B 5LHGA 1ULZA 5LMNB 1H8HG 3BY6A 2GTAA 1FXVA 2ZDIA 3LUTB 4LFCO 4FFRA 3PW2A 3HPLC 5KT4A 2V1DA 3ZRXA 3JZ6A 2R8KA 1YIJV 2Q2UA 1Z2OX 3T1HB 2FP4B 3HKZA 2QWPB 3SGIA 1WAZA 5I5WA 1R6TA 3ZS8C 5JUMA 4JI4H 5EYPA 3TW7A 3I5DA 2SCUB 4BW9A 5DGBA 4TV8F 1SEIA 3ZRWA 2ZE5A 3ZHTA 1HR0B 4ED6A 3RYIA 5EZYF 5EWEA 2RGRA 3GIQA 1JPXA 3B4SA 3TXSA 4DL6A 1VBHA 1XNQH 3ASOC 1XDNA 5LL6Y 2B9ZA 1KJJA 4HYOA 3IJ4A 2C2RA 1K73W 1AR5A 3GIPA 4YXWG 2YIBD 3OMNB 4K6NA 3FYEB 3KHHA 2W8LA 4LF9H 1M56C 5JWPA 2PVPA 4X9QA 2QKSA 2VQFO 3T1YB 3CE2A 4L8JA 2DWEC 2F23A 4UV9A 3T1HH 2IJHA 3J80N 4JI7B 4RAYA 3SPJA 5IYBG 2EJ3A 3K08A 2XCLA 3J81W 4QPKA 5IWAO 3W7XA 2PBZA 4A3IG 1GMGA 5DMXA 2W6NA 1Z5WA 5HFMA 2LP7A 1HR0H 4IRDA 1K3EA 4X8AA 2E3CA 1AR1B 2EBOA 4LF4B 2KKWA 4QE7A 4DR6B 2OIGA 1E4GT 4OPHA 1NU1H 3T4ZA 4F4LA 2HJFC 3CCQV 1QLNA 4TV9B 4YB8B 2J9GA 3MWEA 1S76D 1EN5A 4I50B 2GBOA 2UXXA 4WFBV 4UB8Z 2PYJA 2V5AA 5KFDA 4MVQA 5LL6b 2UVRA 4OPAA 3T1YH 2ATLA 2AQ4A 4PDRA 3G67A 2PI4A 4BXXG 2ZGIA 3KAJA 5KHIA 3ZRVA 3I12A 4JI7H 4O4LB 3CCVV 5L3CA 4JXUA 3CC2V 3H9VA 1V54B 2QWOB 4DR2O 3SPHA 4RQEA 2Y0SE 4CMDA 2AHZA 4NXNB 1GN3A 2KSDA 1S68A 1SRYA 1WRVA 5DQGA 2Q0OC 1COWG 3ABKB 4PA4A 4N21A 5ITZA 4R50A 1AB3A 3OUUA 3DTUB 3RBDA 2BQ3A 2LFSA 4GKJO 4J11A 1K83A 1OHHG 2QDOA 1W2BU 3WB1A 1R3JC 2Q73A 3OTFA 1BQ0A 1AJNA 5KLVH 3U9SA 3MWMA 1D5NA 2JGDB 5GTIZ 3UT5A 2B5UA 4FFBB 4EGQA 2VRZA 2FPIB 2LW1A 1OBDA 4XYLB 3CJHB 4U7NA 1Y1VA 1M9NA 4DUZO 3OEHG 1F51A 3OUSA 3PW7A 4ED0A 3GTGA 3BVOA 1I1LA 2UUCB 5HV6A 2VWJA 3H4BA 2UXDH 1Q3EA 1H2GA 4TQDA 2E76B 1KKDA 5H80A 1KBLA 4MVMA 4C5AA 4J9QA 1Y74A 1QCEA 4XDKA 2YIAA 3KYHC 3K5LA 2JEUA 4B3SH 1W0JG 1THZA 3KHGA 5KFOA 3G80A 1QQCA 4YQWA 1VQMV 2UU9B 2JA5A 5KG4A 5C44G 2WSSG 3M9MB 4DV2O 2VUMG 1CS0A 4LF6H 3QF7A 2OCCC 5H6RA 5IYDG 2NU8B 3I56V 4QWCA 2I80A 1ENVA 4FS2A 3R5HA 3KHRA 4MTFA 3M99B 1GO3F 1T3NA 1B6QA 4NTYA 5F9LA 2HFEC 2IU0A 1YTFD 5LMUB 2ZJTA 3L4KA 2JEGA 4DV7B 3Q8SB 4IIJB 1XHXA 5K3WA 4PZ8A 4ED1A 3WWIA 1VQ8V 1N0JA 2HKOA 4F50A 2QA4V 1V51A 2YI9A 3ZHVA 3RB0A 4A3LG 1VQPV 3W7UA 2EINB 1VF5B 2UUAH 3GIMA 3K58A 2Q7DA 4JAVA 2NLJC 3P3PA 5J2TB 3RAXA 2UU9H 4X1KB 1VQ5V 4BW5A 4JTCB 5IY5C 5B1BC 5GONF 2CH7B 1IBMB 1HP8A 2W7PA 1OCOB 4NVPA 1N33H 2P06A 4UCOA 4JI0O 2V58A 3RVZA 1VKZA 1DAAA 4AYBA 1K33A 5E25A 3AK1A 3BA9A 3SJAC 1EUDB 5LMUH 1IX9A 1RP3B 3HKCA 4O7NA 4X65B 3ZMSA 4IZOA 2OYQA 4I50A 1ZL8B 1L0LH 1KJ9A 4ECSA 1R1BA 2QJ1A 5IYZF 2R86A 3JZFA 5H5NA 1K4DC 3TJTA 3M9OB 1SZXA 3IGAC 3VPCA 3L75H 3CCSV 3W1BA 4LFCB 4O4LA 4DV6H 4NTXA 2P5OA 4PHZA 2R8HA 2OTLV 4X66O 3BAAA 3CCUV 4J9RA 1VQOV 1MA1A 2LGWA 2IU3A 5IJ0A 1NQTA 2R7NA 3OSNA 1IBMH 4FM2A 4BWSC 1XILA 4U3JB 4FM0A 3P32A 4GLWA 1N0NA 3MR6A 3H1KH 5EC1C 3F7VC 3VQVA 3OUFA 1P4RA 3PR5B 3T4DA 2YZLA 5IJ9B 3K0GA 3DGEA 3PVXA 1I7LA 2QM8A 2YUAA 4U6PA 2F4VH 1I5YA 1V55B 3NBZB 1XK5A 2R7ZA 1QR8A 2LGQA 2AW9A 1BJTA 1ORQC 2PTMA 2COJA 2NUAB 4GUNA 2UVWA 1OCCB 4C7UA 1PNKA 1WNSA 1MG1A 1L1FA 3CEBA 3K3VA 1HDJA 4JGSA 2Z0AA 4MVUA 4P9OA 2KQXA 2VQFB 4MV7A 4YJ3F 3V4ZA 2Q6AA 4UV8A 3MD0A 3OR6C 5C93A 3CC4V 4I55F 4M0JA 1JJ2U 2NU7B 5LP6C 2QEXV 5DECA 1BHAA 2W0XA 4J7ZA 2ZE7A 4MV4A 5IWAB 2GQSA 4RWUA 2E75B 1KJ8A 3E35A 4A3DG 1KYOF 1DGSA 1H2LA 3K5OA 2IH1C 4MVSA 1I7FA 1KQSU 1FXKC 3ETJA 2C28A 1NKDA 1EZ1A 3QVNA 3QFFA 3E83A 1N36O 1GM8A 1X4TA 2Q67A 3ABLC 5GW7A 1AUVA 4ETSA 2JA8G 3GQCA 4I4TB 3QQMA 3A0HZ 1MSWD 1HNXO 2VQFH 2Y69C 3UYYA 4DV1O 2ZINA 5L3DA 5L3FA 4BY7G 5KS8A 4H13B 2A06H 3RFRA 4PD4F 1WP8A 5JH7F 4ECQA 3OTOO 1Q8IA 5CA0B 3HOZG 4ZKIA 1UPGA 2VWKA 3AG3C 3CRCA 4DR2B 4DR3H 2Q68A 2W6QA 4DV4O 2YL2A 4PBCA 1M57B 4B3MO 4RUCA 3L71H 2ZDIC 1MMMA 3QNEA 4EB6A 5J2UB 1TUEB 4O4JB 5H2FZ 1RYSA 2MCTA 1VAJA 2XCPA 3B77A 5KT2A 5I47A 5FNVB 2ATKC 2O03A 4O4HA 4GKJB 2QYZA 4A3MG 5K1PA 1RK6A 5CM0A 4X1KA 4X1YB 1MSDA 1UC8A 2PMZA 4A3JG 2F95B 4O3SA 2CH7A 2Q69A 1PPJH 3T9CA 4A2BA 2RDJA 2LO1A 3E5NA 3UKMA 4JUZA 2QKAA 4A3KG 2IH3C 4YJ2B 4DR2H 3OHAA 1H8EG 2XIGA 4XYMB 4Q0YA 1JA8A 3QWUA 2GPSA 1K1SA 5KHGA 2H94A 5LP6F 4H0LB 3RGZA 2EULA 2NN4A 4DUZB 3HB9A 1VQ7V 1RJQA 1KU9A 1K1QA 1WPBA 3DAAA 3KCXA 3OSPA 5KAFZ 5LYJF 5B1AC 1EM1A 3OGIB 2YWVA 4GKJH 4DR7O 2FLNA 5BYBA 4MV8A 1FXHA 2I8CA 4B7KA 2RF4A 4DO2A 4AI8A 3R9RA 1Y6XA 1DF5A 2DN9A 2W57A 3IAYA 3DTFA 2WLJA 5C8YB 1VQKV 4KXRA 2XT9A 1UNNC 4I7HA 2NNUA 4X89A 3M9NB 4DV2B 5KFNA 1VIBA 3KTMA 2V4QA 3T1CA 4WHXA 4ZI7F 4GYCB 3JASB 2PGGA 5D5PA 3VMMA 1JR9A 3ETGA 3G6YA 5A2QW 5DQHA 3SI8A 2QSAA 1WPXA 1XEQA 5FLXN 2R8JA 4UVBA 4IT5A 4JAUA 4JI1H 2XUMA 1FKAH 3JSNA 2FK1A 2DYSC 4LR3A 1VBGA 2HGSA 1MABG 3ZMUA 3CXCU 2WAQE 1JVMA 3S3XA 5D1PA 1JFFB 1KJIA 1KEEA 3G71V 1NI8A 1Q6UA 1QLEB 4LH7A 3RN4A 3SYQA 1VEWA 1SZTA 5CMUA 4DRXA 1WB7A 2RCVA 4WF9V 2WLMA 3AEIA 3J7AU 1YITV 4J42A 2P4VA 4JI0B 4LC1A 4A3GG 4DW1A 2CGOA 3RV4A 4JYAO 3ZHRA 3OMAB 3SYCA 1EYZA 3ZX6A 4MSWC 4J9MA 4JPRA 4CC6A 2ADQB 2PYLA 1H2KA 4OXSA 3TW6A 4NR1A 5CR5A 4FZ1A 5BMVA 3JCUZ 1WB8A 1OCRC 4NYKA 2OT5A 3JD3A 3K5MA 3VPBA 2R87A 4MTEA 4APMA 2XAJA 1TAEA 4O2BB 5LOVA 1EN4A 3HR0A 4X66B 3OMIB 2R6FA 5KMGA 4ECXA 4EBCA 3WG7C 1C3OA 2A7WA 2IM9A 1B33N 2FJZA 4M9UA 4ECYA 4NXNO 2P4KA 5CA1A 4B3RH 1AP6A 2CNQA 2HR3A 4FZ0A 1IXMA 3OAAG 3I55V 2Q4PA 3CMEV 2DW4A 2VPSA 2PY5A 3AX6A 1OZ0A 4DQNA 2ZNIA 5BWXA 5KFJA 2RGVA 2IJIA 2R7KA 1FPOA 3QO5A 3EVKA 4O2AB 3W1GA 2R93G 2ZXWB 5LA6B 4KUMA 3TK1A 4TQRA 3E8GA 1AN7A 2Y4RA 1NVPD 4Q6GA 1LUWA 2C00A 1AJQA 3K59A 2DPIA 5KX5B 4HN2A 3TY9A 1PP9H 3E8HA 1B6SA 1XDCA 5KA5A 1NH2B 4O81A 4RO2A 1CEZA 5JH7A 4ZHQB 2QM7A 5DEDA 3BPZA 4O7TA 4J9LA 2J6UA 3GTQA 1ZAUA 4QWEA 1I2LA 3P3NA 2O57A 2V59A 3L70H 4RNMA 3T9FA 5KG6A 3PO3G 1SA0A 1R73A 2CTRA 3H4DA 2EJ7A 1N36B 3TCUA 3WWHA 3E89A 2YXYA 4ZOLB 2Q7GA 1W59A 3LSSA 4N23A 1K9MW 5DGHA 3CX5F 5C8YA 4O7VA 1HNXB 1YXBA 3V6JA 3IG0A 1WA8B 2W6OA 4DV1B 3UCSC 1GLVA 2ZM6O 4I0XB 4LF8H 1XL6A 2ARHA 3JAKB 4CS3A 1JMKC 1GO3E 3AG4C 4QWDA 2Z3YA 1NS1A 1SETA 2FYUH 3X2QC 3OTOB 4X62H 5CN0A 4JI2H 3K06A 4ECTA 4DV4B 1QU7A 1VP7A 2HLDG 5JCOA 1SF9A 1TGOA 4FIPC 4J80A 1SQBH 2ODMA 5B1NA 3WNZA 4ASUG 5IP9G 2WA4A 2CW7A 3ABMB 4Q43A 2FB9A 4UVCA 1YHQV 3JAMW 1KB9F 4D7TA 4CKBA 2HGXA 4YAKB 2W6PA 1L8DA 3LSQA 3E8FA 2YC0A 2EIKB 2WA3A 3D3IA 5K1XA 1B3QA 2W70A 3PFFA 3ABKC 3SDLA 2IJKA 3FYIB 1I2KA 4BIZA 2BTQB 2B63G 4O3OA 2NVYA 3SJBC 3MFHA 1VQ4V 3L9DA 5IYDO 4DV4H 1NZ6A 3U10A 2Z02A 1EZJA 2UXBO 3I4MG 5KFWA 4B3MH 4EFBA 1S0NA 3OR7C 3DXRB 3IC7A 3S3WA 1JIHA 3M7MX 4DW0A 5CBGA 4B3TO 5KFZA 4DR7B 2QWQB 1VQ9V 4A3FG 1KP3A 2DQ3A 4LF7H 2FMAA 4QWAA 5C4XG 4DAAA 3W7SA 4LP8A 3FAVB 4LWSA 4KP4A 4GX5A 4IRKA 2Y4TA 1A0GA 3T9AA 1J5EO 3Q8RB 3GILA 1E1QG 1MNGA 3HOWG 2WAMA 3VQWA 3HKEA 2P22C 2LJ2A 2ITCC 4I7ZB 3T5KA 2VA3A 4DK0A 2R92G 4F6RB 1RSOB 3K9AA 3R23A 1TWGA 4HNAB 4I50F 1LR1A 4XZ3B 3RTXA 4RB2C 4Q8EA 4O2AA 2JJ2G 1TVKB 2I87A 1IXBA 4DR7H 3K04A 5LA6A 5LMNH 1JXLA 4Z1MG 3ORRA 1M0WA 4DV5O 2VQEO 4O4LF 4BBRG 2CNUA 1AI4A 1N34O 4MS2A 4O82A 5KX5A 4O7WA 2ZE8A 4ED7A 1TUBA 4QPJA 1BGWA 4PDBA 3PZPA 4MV9A 4YHHO 1XUQA 4O3NA 4CH5A 5KFIA 1BL8A 4O4IB 4IHJB 1KP2A 2GLTA 3A2FA 3VPDA 1MZBA 1OCZC 4WBNA 5H6QA 1Y76A 4MTOA 5C5JA 5EWGA 4DK1A 2WTFA 4DL2A 2AGPA 4C5BA 3VOUA 3JARA 3UO3A 3PN1A 2GV9A 3RIZA 4JYAB 4GC6A 3IC9A 4EGJA 5C1OA 2JVDA 4UUGA 5CB4B 4ECRA 3BHPA 2FPPB 1JX9A 2V7QG 4ZOLA 5EDWA 4R8UB 2AU0A 4TQFA 3SYOA 3HOVG 1WCMG 1E4EB 1SKVA 3FKSG 2X6BA 3RVYA 5JQGA 4GKKO 4RZRA 4YR2A 4I0XA 4E6NA 4FFLA 1C30A 1WJZA 4PDVA 1VMGA 1XNRO 2YU9A 3UM7A 5JJJB 5TISZ 4FLUA 2UXCO 4FBUA 4ECWA 3MJFA 2DMXA 2Q9LA 4JYAH 2OWOA 5EZYB 3HOUG 2HG5C 1CKNA 2PI5A 3OHBA 4LF4H 4DR6H 2JGUA 2W9BB 1BXRA 2E2HA 1R3IC 1IYDA 3PR4A 2W8KA 2J6TA 2EJRA 4EQ5A 3VQYA 3LDCA 3GTMA 4NXMO 1I08A 1A32A 3ABTA 1Q6HA 1XMOO 1RFYA 1S03G 4Q8FA 3H0GG 1L0NH 2X5RA 4A3CG 2BTQA 4JZ2A 3L4JA 2P67A 3BQ2A 1D2DA 1CKMA 1N56A 5KFGA 1K34A 1OCCC 4NXNH 1MZEA 4FLWA 1KJQA 2ASDA 3WFVA 3G6EV 1OWTA 3SPCA 1L2ZA 2X6CA 4K0KO 2RDCA 3C3TA 2NVXA 1P16A 4O3RA 3O65A 5B3SB 2EILB 4CH6A 3Q4HB 1VQ6V 2FMLA 4O4HF 2HGWA 2GQRA 2Q0AA 3GTOA 1BZKA 2MW2B 1E4FT 3H01A 2ZIMA 2WPDG 2UVVA 2HHFB 3UFXB 1IDSA 1X59A 2JEJA 4E4TA 3NGDA 3H1HH 4PI0A 2ZM6B 4J9SA 3ZHSA 4HAMA 2G38A 3JD1A 2B63A 3RB6A 4XX0B 2DLNA 4F6RA 3GLKA 5K2MA 1RSOA 2R9IA 4UCTA 5IT9N 4YR0A 2YS6A 1EBOA 3FB8C 4DRFA 5F9NA 2BE3A 2UUCH 1JLLB 1FD9A 2BQRA 1M90W 4WFHA 2ZR3A 2WLIB 3OD4A 4RB0A 3RYFB 3HKZE 4BR6A 5E1AC 5CBHA 4CH3A 3ASOB 3SPGA 4MT8A 3Q2OA 2JJ1G 5EBMC 4BBSG 1XOUA 2JK5C 5KKNB 1M56B 2A0LA 4O4IA 5L3BA 1EHIA 4BIUA 5KA6A 4QGPA 2QTOA 1YI2V 4PV1B 4LF5O 3ORQA 2QWNB 2XGQA 1R3KC 4IRCA 2UXBB 4H44B 3QG5A 3PW0A 3KAKA 5EBLC 4DV7H 4QIWF 1N48A 4U7CA 3TIGA 5KT3A 2CTWA 4TV9A 3H3VH 4TUYB 4YIOA 2IBZH 3DF7A 1QVGU 5KAIZ 1ZQ7A 4QWBA 2OLSA 2QF7A 4W4KA 1E4EA 3A8TA 3RW0A 2YZMA 4B3TB 1JDEA 5DISC 3RBZA 4PELA 1XHZA 4QSHA 2Z04A 5CAEB 5KT5A 4QJFB 4JF3A 2YRXA 4WFGA 4JI3O 3N8DA 1J5EB 2Q7HA 2F66C 3BA8A 2W6JG 3CMAV 4DR5O 1B06A 3DSQA 2B1GA 2W0FC 1NT2B 5KFSA 2BCCH 2UXBH 4JTAB 2UUBO 2FPGB 2CW8A 4JI5O 2ZE6A 2IW5A 1CXZB 2DE0X 4F4YA 1AJPA 4X65H 4WD3A 3ZMZA 1PKXA 5BMVF 2JS5A 3MAQA 4FPPA 1H2NA 1WLEA 4M7EA 1WP7A 2QR4A 1GN6A 2EIJC 1N32O 1NTZH 2L35A 3K0DA 1R3LC 4RU9A 5LOVF 4DV5B 2VQEB 4ED3A 4LFCH 4DR4B 2ZDQA 3L74H 3L72H 1N34B 3BJYA 1GN2A 3CCRV 1H2MA 1I3QA 3BACA 5KG2A 5JCOC 2JGDA 4YBZB 2D2CB 3IFXA 1RYRA 3MR5A 1XBLA 2EZOA 4FFBA 4YHHB 2ABJA 1FJGO 4F4WA 5CA1F 1IBKO 3E2EA 5KT7A 3CJHA 4JTDB 1Y1WG 4ME6A 4O4JF 4AQYO 5LGUA 5KFBA 3TQ1A 3SJCC 3E22B 3Q4HA 3CQZA 1QLEC 3CSWA 3CP1A 3J80W 2ZT9B 3WB2A 2GUZB 3NUAA 2VPQA 5IYZB 3V4SA 2COGA 4DUYO 2VQEH 4DV5H 2VA2A 5KHKA 3JD2A 1N34H 2R9RB 3CCJV 2R84A 4IR9A 2JA6G 1SQQH 3SYAA 5KFEA 1K8AW 4GKKB 3H0GA 4PA9A 1I6UA 1NH2D 4DV0O 2YZGA 5I5UA 3UO2A 3U0GA 4B7EA 2VUGA 2X6AA 1XNRB 4FM1A 2HHHO 5IWAH 3SJQC 3ETDA 2UXCB 3T9EA 1Z2GA 4CC5A 3MR3A 3T5JA 4FLYA 4HYKA 5I60A 4FGRA 2RN9A 4IL6Z 2HG8A 4IIJA 3N44B 3N41B 2AGQA 2NU6B 4P9PA 3RYFA 1P8LA 2C22A 3NR7A 2ODTX 4OX9O 2W71A 3V6KA 3E86A 2QE7G 3Q8PB 1EKPA 4O83A 5C8YF 4I9WA 4NXMB 2WB1A 4GKKH 1E1RG 4UCVA 5J2TA 4KHPO 1XMOB 5LGNA 1PNLA 4I9QA 2Y4UA 4I55B 2DZDA 2C35B 4MVRA 2F1MA 3SR2C 4Z1VA 4PZ7A 2XNDG 1XMQO 4A5UB 5IY5B 2VUMA 3ZEDA 2Q5ZA 3A0BZ 1BE3H 1SC5B 1US6A 2CTPA 5B5EZ 4K0KB 1H38A 1F4NA 3SYPA 4WCEV 4TUYA 4CE5A 1ZL8A 4YR3A 4XBFA 5JQWA 4G3IA 4GX1A 3RAQA 3M8AA 2GPWA 2PN1A 3H1LH 3BRCA 1KTAA 5LGTA 2COIA 3TQTA 1BT8A 4JI4O 3ETEA 4QJFA 4PI2A 4UCRA 3M4IA 4AYBE 2AGOA 1XMOH 1K92A 1JKJB 4WFFA 3AK3A 4FLXA 4U3JA 2C2AA 4GX0A 2VOBA 1IZ3A 3MFIA 3LDEA 1JQ0A 1FFXB 2CNVA 3RJ0A 5IP7G 3L2PA 4O7SA 1YTFB 5IJ9A 4A3BG 1XNQO 4UB6Z 3T9DA 4K0KH 4LSXA 4DUZH 3STLC 1S5JA 5BZBA 4LF9O 5DGIA 5KFXA 2W9CB 5KFLA 5KFRA 2L6LA 1YEWA 4A93G 3F5TA 1VARA 4QIWA 5AG2A 4PA7A 1TWFA 1UC9A 3AG7A 4HQ6A 3N40P 3TEKA 3ASNC 2ZD9A 3CWBH 2Y0PA 5KHHA 5EOYA 2XAHA 4NZNA 3HO8A 5DLGA 2HJDA 5KUMA 1IOWA 2XAQA 3LULA 1RM1C 4DV2H 4K8ZA 4FFMA 1GGOA 4JV5O 5H9CA 4RB3C 1KC8W 4J9NA 3E22A 5LP6B 3KREA 4GZRB 4LF5B 5BY1A 2RDIA 5KFMA 1KECA 3J81N 1ZHQA 3GIDA 4JI8O 4O2AF 4R6ZA 3FMAA 5LA6F 1URFA 3CRQA 3ABUA 2CZGA 2AXTZ 4CHIA 2R9AA 4JAAA 3JAWB 3GB7C 2EJ2A 1GK9A 5KX5F 4I4TA 4ZIBA 1CKOA 2JDIG 4FJCC 4EEQA 4IGGA 3ABLB 1Y4MA 1NTMH 2Y69B 5CA0A 4JI3B 5CA3A 4WBNF 5L9XA 1D5AA 1PNMA 4UVAA 4CS4A 4DR5B 4JI0H 1RJRA 2YEVB 4ZI7B 1K5QA 1O75A 1PD3A 1FS0G 3R5XA 4P2ZA 1DIKA 1RJPA 3QZ8A 4TSFG 1Y1WA 5D1OB 4EEYA 2UUBB 4DL4A 1DF4A 4JI5B 5J2UA 1IBLB 2A3QA 4O4JA 4ZOLF 3H20A 4JYCA 3ZRSA 2YYAA 2DPJA 1NTKH 3AW8A 2XGPA 5FNVA 2ITDC 3OW2U 2DJVA 5JQGF 1N32B 3KHLA 3RB3A 4PDMA 3FDSA 4X1YA 5KG3A 3GV8B 4ZBMA 4DLKA 4PZ6A 1YCIA 5KT6A 5EYPB 4X66H 4JI3H 1BNCA 2W6IG 2BQUA 4CZZA 4YJ2A 3ZRWB 1XL4A 3I4NG 2FB5A 2UVUA 2Q8VA 1FJGB 2EX3A 2UXDO 3HB3B 1IBKB 1M7JA 2QK4A 2UUBH 5IDJA 1BS3A 1QVFU 3LMLA 2DYRB 4AQYB 3N2KB 1BHBA 1ZWIC 2IP4A 5LXTB 4B3SO 3JRXA 1QNMA 2PMZE 1JCHA 4MVOA 3ETHA 3BQ0A 2BOCC 4J9ZB 1N32H 4JZGA 4H37A 2QB5A 5B1AB 4DUYB 5C3EG 1AROP 2QWRB 3U55A 4GX2A 4LF6O 3WO1A 2IMWP 5JJEB 2N05A 1B04A 3FB7C 4RQFA 1OBGA 3T54A 4NYEA 5L3GA 3ICXA 4MW8A 3G6XA 1FFXA 4DV0B 1FJGH 1K97A 2HEPA 2H3OA 1IBKH 1U96A 2HHHB 3Q8QB 3JASA 2YS7A 1V9PA 4AQYH 1Q7YW 1Z2PX 4UUJC 2Y0SA 1SQPH 4QW8A 2W9CA 4MV3A 4C5CA 2DWDC 3APQA 4DL7A 4MVZA 3SPIA 3GV5B 2WLLB 3PW5A 2UUAO 1BGYH 3AG2B 3G4SV 3OE7G 3GJXB 4OX9B 1N36H 3KALA 3CYOA 1YDXA 4DUYH 5KFPA 3RBEA 1V54C 1JFFA 3JSLA 3BQ1A 5L3EA 1N33O 2DYSB 5L1JA 4MAMA 1HNXH 4D7SA 4KHPB 2BSKB 2ZNJA 4DV1H 3APOA 3RYHB 3CEIA 3RB4A 4MTDA 2FLLA 3OTOH 1YF2A 3N6RA 1P7BA 4GLXA 1XMQB 5KG1A 1Q82W 3HBLA 3CC7V 4RUFA 1NBMG 3ZHUA 3VQXA 4RB1A 3RFCA 3TXQA 1ZHSA 3K79A 3FX7A 1DK1A 1W96A 1GM7A 1R6KA 3HKBB 2ZCEA 1BMFG 3U11A 5JJNB 3B40A 5CBFA 4DV6O 1FFTB 4LFBO 2JA5G 1UJWB 4FS1A 4H33A 5IE9A 4O3QA 3CXHF 3NC0B 4QNHB 2Q2TA 5EK0A 4O2BA 4KHPH 2R85A 4C2MA 3KXYT 4JI4B 4O4IF 4IHJF 2PUSA 5BYAA 2YIDA 1M5IA 3QTCA 2F93B 4FBTA 1S5LZ 4Q4DA 2EILC 4EFEA 3KKYA 1OV9A 4IYIA 2A79B 5DG8A 1NR1A 3JATB 2JA7G 2F4VO 1XMQH 1F4MA 2FKXA 3K9SA 4FLVA 4HZ3A 1B6RA 2VS0A 2QGNA 3ZHQA 4HNUA 5EIBD 4TT3G 5D1OA 3MHSC 3E8BA 3GIIA 1EUCB 1XNQB 4DXWA 3G6VA 2ZQMA 3AG1B 4TV9F 3H40A 1P49A 4L1KA 1Y74B 3BFRA 1GYFA 4LF9B 4FK5C 4HBNA 4LFAO 3HT5A 1HWYA 4TVIA 3GVMA 4O7ZA 2EIMB 1T94A 3RGBA 3BCCH 1N4CA 1SQFA 3FD9A 1KC7A 1S10A 4DR4O 2PF4E 1AILA 2R7LA 3K3WA 4U3FH 3G8CA 4RZQA 3RWRD 2LQTA 2R8IA 3RF2A 5BPFA 5FLXW 4PWQA 3CD6V 4A3EG 4GT1A 3AK2A 3GDEA 5KFVA 3LSUA 4ZHQA 2ZIOA 4JV5B 3GTJA 4UCUA 1O9HA 3N2KA 1A48A 5LXTA 2EINC 1ET0A 5JVDB 2HVSA 4J41A 2RQ6A 1SQGA 2GDSA 2YICA 5D8DA 4K35A 4X1IB 4MW3A 4JI8B 1IURA 3C3SA 3ZIAG 4WFEA 2CK3G 3T99A 2WLNA 1OCOC 3EFFK 4XDLA 4J9PA 2ZKOA 1Y66A 2M6YA 5E79Z 2XOKG 1I0HA 1GH6A 2P6JA 1G8MA 2RMKB 2HIXA 2R93A 4KL1A 1G2WA 2N04A 3TETA 5EIBC 1WA8A 4R7RA 5DM6V 4DR3O 1Q5OA 3LQSA 3JAKA 4JV1A 4ICGA 4YY3O 4ECVA 1G6UA 2FTKA 4CS2A 2ETNA 2R7ZG 4JV5H 1VQLV 2ZR2A 4TV8B 4X64O 3MHHC 2LW7A 3HKCB 3AG4B 4DL3A 2EIYA 3X2QB 3O9OA 4JYBA 3HXLA 3JD4A 5J9PC 4EYIB 2EZPA 5KFUA 2WE6A 4O3PA 2WLLA 4JI8H 1P84F 2JIZG 5KHJA 3N2GB 4F6EA 4IWXA 2P7TC 4NZMA 1CPYA 4FFPA 4TM5A 2RNBA 2FLPA 2CFMA 2GSMB 1F23A 4Z2WA 3UZBA 4JASA 3ZMVA 3A0RA 1NVPB 4K3AA 2DABA 2DIKA 1I94O 1AI5A 5IJ0B 5BPHA 2BSKA 1M4UA 3RYHA 3WWJA 2AHYA 3K5HA 3N6XA 5BWWA 1V55C 3ZCCA 4G2KA 3H1JH 1WR2A 4FLTA 2OH2A 2HP8A 3CCLV 2WDTA 3CVZA 4G27B 4E4EA 1GSAA 2UXDB 2CKZB 4IIJF 2K9PA 1AI6A 3DXRA 2VR1A 1DLBA 4NKGB 1M93A 1HNWO 1M0TA 3WU2Z 3N42B 3B09A 3HKBA 2IA6A 5DLFA 1DV1A 3B8MA 4B3SB 4EBDA 1ZETA 4J9YB 5HBRB 2XASA 2BTOA 1BSMA 2E2IA 1Y67A 5J2TF 1WH2A 3P30A 1KKCA 1XQ8A 5EWFA 4NLGA 3FAVA 3F7YC 3CCMV 1QR9A 2A9HA 4LF6B 4XDJA 3PO2G 4NTWA 2HVQA 1SQXH 1R9TA 2IJJA 1BCCH 1VF7A 3ZMTA 3JATA 5LBQA 3EPIA 1H2SB 1P7GA 4BY1G 5FJ8G 3F5WC 2YDEA 1N8RW 1JX4A 4J10A 4J7KA 3K5NA 1SCUB 2R82A 1GM9A 1Q6IA 3ETQA 4QW9A 4JI1O 4TUYF 3G8DA 4HNAA 1FKAO 1JOYA 4IR1A 2CDYA 2HDKA 4F4XA 2IBKA 2JEIA 4ECUA 4G28B 3GB8B 3RGXA 3DC5A 4ABMA 4CMFA 1TVKA 2UUAB 2AZ2A 1AUXA 1HW7A 3CRMA 1CE8A 4NZOA 4J9OA 5A2QN 1EFRG 2YXHA 4LNUB 2V4DA 3D3QA 3TIIA 1K7DA 3EYYA 2R70A 5KFAA 2XCAA 3JYCA 4PA6A 5I5SA 1M57C 4EKWA 2ILMA 1N33B 5BWVA 4RAIA 3CHXA 3Q1KA 3SE7A 4RNNA 2ZM6H 5LHHA 3JALB 4IHJA 5BR8O 4FLZA 3JRWA 2A1HA 2JA7A 2QM4A 1IOVA 4EB6B 1S0VA 5JVDA 1FAFA 5I5XA 5L1KA 1S97A 4JV2A 1S5HC 2V4RA 3CCEV 3T9BA 4X1IA 2R92A 2NR5A 1OCZB 4IWYA 4CKEA 3U9TA 5CB4A 3W7WA 4O4HB 4BIOA 5EC2C 1AI7A 1UFIA 1VF6A 2WLKA 4R8UA 4IAJA 4JYYA 4DV6B 4LFBB 3N43B 2BR0A 3NXSA 2JS3A 3HKDB 1HNZO 1EZVH 1DV2A 4UCSA 2W6MA 2DOSA 2J6SA 1S77D 2M05A 1SQVH 2H8PC 4B3RO 1RK5A 2ADPA 4TV8A 1SS3A 2E5LO 2F4VB 3LNNA 3FFQA 4UFZA 5BWUA 3PW4A 3FKIG 3RV3A 5EZYA 3UZOA 5DG9A 4O7LA 1Q43A 2OIEA 2YZNA 5BWRA 3N2GA 4PA3A 5FL7G 5FPRA 1ROPA 1IBLO 2W9BA 4EBEA 2GHYA 1QHTA 2JRIA 4HNVA 1SFOA 4O7RA 5FLMG 4LFBH 4I4TF 4LFAB 1TWHA 4B3TH 2HVRA 4ED2A 1M6VA 1WCMA 4LMYA 1O9GA 5CA0F 2WAQA 4JI6O 3B8NA 1YJ9V 5L1IA 5GONB 1J5EH 2HIVA 4FVMA 4L87A 1TA8A 1KUTA 1YVWA 1EN6A 3B2EE 1ZSPA 3EXAA 3OT7A 2ZDGA 4W4LA 4Q44A 5J2UF 5BWTA 2X7RB 1EKFA 3RUPA 4RNOA 4RUEA 2P90A 5FNVF 3QZ7A 2CE4A 1S0MA 3D36A 3KG2A 1Z5VA 4LFAH 4TOIA 2CQYA 2X0SA 3VOTA 3ZJZA 1WN7A 2HHFA 3GV7B 4LF8O 3W5OA 1GAXA 4DV3O 4DRXB 4LCUC 4DR4H 1K4CC 4X62O 4Q45A 2FE3A 5FD6A 5DQIA 4YJ2F 3PJSK 3D8CA 3R66A 4DR3B 1ZLZA 4JI2O 2W6ZA 3T5LA 3VA7A 3RYCB 4YHHH 4YY3B 1FYJA 4MA0A 5KFKA 4IYHA 1TWCA 3OGCC 5D5QA 4X64B 3K57A 4FFOA 4LSAA 2YW2A 3GWKC 2OCCB 3WO0A 3OFNG 4O86A 1GTOA 4FFKA 1RPOA 5BMVB 5KUKA 2C2EA 2WLIA 4DR1O 4Q4CA 2C2DA 3OUZA 1Q86W 2XTAA 4LNUA 1LNQA 5LOVB 4Q20A 1I94B 3F8NA 1G4YB 3FB6C 3JAMN 2Q7EA 2FK2A 4Y8VB 4TWKA 5KMGB 1I1KA 4YJ3B 2R7MA 2PZSA 3BABA 3JALA 5DAAA 5CE8A 5FPOA 4YY3H 2ALZA 4LH6A 4MA5A 3T7AA 5CA1B 3HOXG 3K5IA 1XNRH 3GIKA 4LBEC 4X64H 3MDSA 5B1BB 5DG7A 2KSWA 3JZIA 5KFQA 2UXCH 4YP3A 1PX2A 2ZXWC 1CQIB 1KD1W 3TGUH 1FVIA 1HNWB 4AILC 1OJHA 4DIMA 4LF7O 4BWAA 5C1PA 1TWAA 5KFCA 1V4YA 3ML0A 4FU0A 3HOYG 3HKDA 3RT3C 1I94H 4NXMH 2V9WA 4AHCA 3J7AK 2OCHA 1PK8A 1MZFA 5B1OA 4CKCA 4RUAA 2DYRC 2RJZA 1QBZA 1S3JA 3GIJA 5JH7B 2Z5UA 2XHBA 3W7TA 2Y0IA 3UQ8A 4J0MA 5T14A 5IYCO 4X88A 1Z2NX 1G1XB 2KG7B 1S0OA 2D3OW 2BOBC 3T2MA 4JI1B 5LMNO 1SA0B 1HNWH 1Q81W 2YIBA 3LP8A 3QO7A 2FK3A 1ZX3A 3IN5A 2E74B 1SERA 1W93A 4CBCA 5BXZA 4J7JA 1E79G 3T1HO 4O2BF 5KG7A 1YJNV 1I7NA 4A2AA 5IT9W 2EIJB 1F7YA 4R8CA 3CRRA 3LWBA 5GONA 4HNTA 2WLHA 5KFTA 3K03A 4BAYA 1PV0A 3N27A 2KB1A 3ZN1A 1HR0O 1KUQA 2YSUB 3AG2C 1PM9A 1GRJA 3KCYA 3CPWU 3ABMC 5BR8B 2JEFA 5FR9A 4RAZA 1RPRA 4DYLA 1LUVA 2CGNA 2GTSA 1EKVA 2CUGA 4GCZA 3FKIA 4X20B 5B66Z 1CP9A 2EIKC 1KMIZ 2YI8A 4FE2A 3MWDA 5LYJB 2GUZA 5I5YA 3DC6A 3T1YO 4O84A 4MV1A 5IYZA 1DTOA 4PDLA 2XD4A 3CSXA 4RCNA 5HNEA 1W0KG 4JI7O 1FXKB 1KT8A 3G6BA 2YRWA 3LNMB 3KZIZ 1Y14B 2FKLA 1GSHA 2EJ0A 1GSOA 1X9NA 3RR5A 1HNZB 3RYCA 3H1IH 1WSCA 1JDBB 5DN6G 4ZHQF 1XI1A 5DGAA 3U54A 5BR8H 4UXNA 4LF4O 4B3RB 1T5EA 4DR6O 1A0IA 3CRAA 1YSCA 2E5LB 2LFRA 5LXTF 3C0FB 3GWOA 4LF5H 3FB5C 2HJWA 5A9GA 5HFLA 4ED8A 2DQ0A 4FFNA 3S24A 3AG3B 3OEEG 3QO8A 2AZ0A 1JJOA 2JEXA 4PJ0Z 5JVLA 3ZN0A 2XC9A 3R65A 4LWSB 2MK3A 3LDDA 1S72V 4MV6A 4YJ3A 2X0LA 1HNZH 3AG1C 5IYBO 1NR7A 2JA6A 3HKEB 4I55A 4JI6B 3STZC 1GN4A 1YJWV 1VQNV 1AVMA 5KFFA 3C90A 2CTQA 4DR5H 2E5LH 2B1IA 5KFHA 2EIMC 1I1MA 2VQDA 3RYIB 1K5SA 4YIPA 3ZBHA 2XAFA 4U7OA 1AP5A 4JI5H 4YAJB 1IBLH 2DWCA 2WB1E 4WFAV 2Y48A 2ASJA 4P30A 1Q90D 3VBBA 3BG5A 4NB5A 4JV0A 2YCHA 5LHIA 4F4ZA 1ZUQA 4KFMA 3AYHB 2NU9B 1TUBB 3NBYB 3CB2A 4LF8B 1CQJB 3WB0A 2WYOA 4DV3B 1M1KW 1XREA 4X62B 1PL0A 5FD5A 4JI6H 3BEHA 4O7YA 2QKCA 3T5HA 4EG0A 4WBNB 4ECZA 4JI2B 1Y76B 3MR2A 2F43G 3JARB 2UUCO 1VF6C 4QE9A 2W7OA 2KG7A 5F2VO 1ZTEA 1SYXB 1KBHA 1S9FA 1R6NA 2YS8A 2WWWA 2DAAA 2CAZC 4EYHB 4OGQB 4DR1B 4HR7A 4GC7A 5JQGB
chains in the Genus database with same CATH topology
2UXBH 5KHJA 3TY8A 3N2GB 4DV2B 2CW8A 4DV3H 2CFMA 4X65H 4GYCB 3JASB 4B08A 2PGGA 2JS5A 2R72A 5D5PA 3MAQA 4M7EA 5IJ0B 5A2QW 3THOA 1VS0A 1M4UA 3RYHA 4CH4A 4DV0H 4B3MB 3N6XA 4DV5B 2VQEB 4JI1H 1CKNB 3JSNA 1FKAH 2HHHH 4LFCH 4DR4B 4LR3A 5LP6A 2YXLA 4X20A 1N34B 2HGSA 4FLTA 5ITZB 5JCOC 2WDTA 5D1PA 1JFFB 3VNNA 4FFBA 5LYJA 3CVZA 4YHHB 2UXDB 4DR1H 4LH7A 4DRXA 4LF7B 3TY5A 1M93A 4OX9H 1M0TA 3N42B 3HKBA 3JAWA 3SJCC 4B3SB 3E22B 4JI0B 4K8XA 2BTOA 1WH2A 3J80W 3UT5B 3WB2A 1XQ8A 5IYZB 4CC6A 4FM9A 2PYLA 4LF6B 2VQEH 4DV5H 2HVQA 5KHKA 4ZI7A 1VF7A 1N34H 3JATA 5BMVA 1H2SB 4GKKB 3U0ZA 3K5MA 1I6UA 4MTEA 4APMA 1TAEA 3K5NA 5LMNB 4O2BB 5LOVA 3ETQA 2VUGA 4HNAA 1XNRB 4FM1A 4X66B 5IWAH 2UXCB 4CC5A 5KMGA 4FLYA 3GB8B 3RGXA 2IM9A 1TVKA 2Q2UA 3T1HB 2UUAB 1Z2OX 3SGIA 1HW7A 4IIJA 3N44B 3N41B 3ZS8C 4JI4H 5CA1A 1P8LA 5EYPA 3RYFA 4B3RH 4LNUB 2V4DA 4BW9A 3EYYA 2R70A 1SEIA 1N33B 2VPSA 2PY5A 1HR0B 2ZNIA 3RYIA 3CHXA 4NXMB 2RGVA 2ZM6H 4GKKH 2RGRA 4UCVA 5J2TA 4O2AB 3JALB 4IHJA 3W1GA 4FLZA 1XMOB 5LA6B 1XDNA 1XNQH 4I9QA 1AN7A 2QM4A 4I55B 4EB6B 2YIBD 2F1MA 4Q6GA 3SR2C 5JVDA 4PZ7A 3K59A 4LF9H 5KX5B 3TY9A 3ZEDA 4X1IA 3T1YB 4L8JA 5CB4A 4O4HB 3T1HH 4JI7B 4K0KB 4RAYA 5JH7A 4ZHQB 4IAJA 4TUYA 4DV6B 4LFBB 3BPZA 3N43B 3J81W 1ZAUA 1Z5WA 3HKDB 1HR0H 3BRCA 2E3CA 4UCSA 1SA0A 4LF4B 2KKWA 4DR6B 1E4GT 1N36B 1XMOH 4PI2A 4UCRA 3M4IA 4ZOLB 4TV8A 4TV9B 2Q7GA 4FLXA 2F4VB 4U3JA 3LNNA 4I50B 3FFQA 4UFZA 5C8YA 2PYJA 1HNXB 5EZYA 3IG0A 2VOBA 5LL6b 4DV1B 1Q43A 3T1YH 4LF8H 1FFXB 3RJ0A 3L2PA 3N2GA 3JAKB 5FPRA 1JMKC 4CS3A 5IJ9A 3KAJA 5KHIA 1QHTA 3OTOB 4JI7H 4X62H 4K0KH 4O4LB 4LSXA 4DUZH 4LFBH 1S5JA 4LFAB 4JI2H 4DV4B 4B3TH 5JCOA 1YEWA 2HVRA 1TGOA 4NXNB 4LMYA 1O9GA 3N40P 2CW7A 1S68A 5GONB 3JAMW 1J5EH 5ITZA 5KHHA 4D7TA 5EOYA 2HIVA 4FVMA 1TA8A 1L8DA 3B2EE 4DV2H 5K1XA 4K8ZA 3WB1A 4RB3C 2BTQB 3OTFA 3E22A 5LP6B 4LF5B 3SJBC 1Z5VA 3MWMA 1ZHQA 4LFAH 4TOIA 3UT5A 3U10A 4DV4H 4FFBB 3FMAA 1WN7A 4B3MH 4EFBA 3W5OA 4DRXB 4DR4H 2R9AA 2FE3A 3M7MX 5FD6A 3JAWB 4I4TA 4ZIBA 4DR3B 1CKOA 2UUCB 4EEQA 3RYCB 2VWJA 4YHHH 4DR7B 1Q3EA 4TQDA 4YY3B 2UXDH 4LF7H 5CA0A 4JI3B 5D5QA 4X64B 3K57A 4LSAA 2YIAA 3KYHC 1D5AA 3K5LA 4B3SH 4CS4A 4DR5B 4JI0H 4ZI7B 1O75A 1QQCA 5BMVB 3VQWA 3HKEA 2UU9B 5D1OB 2P22C 2UUBB 4JI5B 5J2UA 1IBLB 4LNUA 4O4JA 4DK0A 4LF6H 3QF7A 4F6RB 5LOVB 3H20A 4HNAB 5FNVA 1I94B 3F8NA 2Q7EA 1N32B 3RTXA 4RB2C 5KMGB 4YJ3B 2PZSA 3L4KA 3BABA 4O2AA 3JALA 1TVKB 5LMUB 2ZJTA 4DR7H 5LA6A 5FPOA 4DV7B 4X1YA 4YY3H 5LMNH 1M0WA 4IIJB 1XHXA 4LH6A 4PZ8A 5CA1B 4PZ6A 1XNRH 5EYPB 4X66H 4JI3H 4X64H 2UXCH 2KSWA 5KX5A 2YI9A 4YJ2A 1TUBA 1BGWA 1FJGB 2UUAH 4PDBA 2EX3A 4MV9A 3K58A 1IBKB 1FVIA 4CH5A 5J2TB 1HNWB 2UU9H 2UUBH 4AILC 4O4IB 4IHJB 4X1KB 4BWAA 3A2FA 3LMLA 1MZBA 4AQYB 3N2KB 4WBNA 1IBMB 5LXTB 4NVPA 1N33H 4DK1A 4UCOA 3JARA 3HKDA 3PN1A 1I94H 2GV9A 4NXMH 3RIZA 4JYAB 4AHCA 3J7AK 1N32H 2JVDA 3BA9A 3SJAC 5LMUH 5CB4B 4DUYB 3BHPA 2RJZA 3HKCA 4ZOLA 5JH7B 4X65B 4TQFA 5JJEB 1B04A 2OYQA 4I50A 1SKVA 2XHBA 3UQ8A 4J0MA 5JQGA 2QJ1A 3ICXA 1Z2NX 1FFXA 4DV0B 4E6NA 1FJGH 2HEPA 4JI1B 1IBKH 1SA0B 2HHHB 3W1BA 1HNWH 4LFCB 3JASA 4O4LA 4DV6H 1V9PA 2P5OA 2YIBA 4PHZA 4AQYH 3BAAA 1Z2PX 5JJJB 1IBMH 4FLUA 5IJ0A 4FM2A 4BWSC 4U3JB 4FM0A 4JYAH 2OWOA 5EZYB 1CKNA 3VQVA 3GJXB 4LF4H 4A2AA 4DR6H 4OX9B 5IT9W 2JGUA 1N36H 3KALA 5IJ9B 4DUYH 5GONA 2F4VH 1JFFA 3JSLA 3NBZB 1XK5A 4EQ5A 3VQYA 1HNXH 4D7SA 4KHPB 2ZNJA 1BJTA 4DV1H 5BR8B 3RYHB 2PTMA 4RAZA 4MTDA 1S03G 1WNSA 3OTOH 3K3VA 2BTQA 4X20B 3L4JA 4GLXA 1XMQB 1KMIZ 2YI8A 2VQFB 1CKMA 4MV7A 5LYJB 3VQXA 4RB1A 5IYZA 4NXNH 3CSXA 4FLWA 1ZHSA 5LP6C 1L2ZA 3HKBB 2ZCEA 3U11A 5IWAB 1P16A 5JJNB 4CH6A 1X9NA 3RR5A 1HNZB 3RYCA 3NC0B 1DGSA 2Q0AA 3K5OA 2Q2TA 1E4FT 4O2BA 1I7FA 2ZIMA 1XI1A 4KHPH 3KXYT 4JI4B 5BR8H 2PUSA 4B3RB 1M5IA 1T5EA 3QTCA 1A0IA 2F93B 1X4TA 2E5LB 4EFEA 3C0FB 4LF5H 3JATB 4ETSA 1XMQH 4PI0A 4FLVA 4I4TB 3S24A 5EIBD 2ZM6B 2VQFH 5D1OA 2ZINA 1XNQB 3RFRA 1JJOA 4F6RA 1RSOA 4UCTA 1Q8IA 1P49A 5CA0B 1GYFA 4DRFA 4LF9B 2VWKA 4HBNA 4DR2B 4DR3H 2UUCH 4YJ3A 1HNZH 3RGBA 3HKEB 4I55A 1SQFA 4JI6B 4RB0A 3RYFB 4EB6A 5J2UB 4CH3A 4O4JB 4DR5H 2MCTA 4RZQA 2E5LH 3RWRD 3RF2A 3RYIB 5FNVB 5FLXW 2O03A 4O4HA 4GKJB 3GDEA 4JI5H 4ZHQA 5K1PA 2ZIOA 4JV5B 4O4IA 1IBLH 4X1KA 4X1YB 4UCUA 1O9HA 2F95B 3N2KA 5LXTA 2YCHA 5JVDB 2HVSA 4A2BA 2RQ6A 1SQGA 4X1IB 4JI8B 4YJ2B 2UXBB 4DR2H 1TUBB 2XIGA 3QG5A 3NBYB 3CB2A 4Q0YA 4LF8B 3KAKA 3WB0A 3QWUA 4DV7H 5KHGA 2WYOA 4DV3B 4TV9A 4JI6H 4X62B 5FD5A 4TUYB 3RGZA 3DF7A 4DUZB 1KU9A 2HIXA 1WPBA 4KL1A 4WBNB 4JI2B 5EIBC 4R7RA 4B3TB 1Q5OA 5DISC 3JARB 3JAKA 4GKJH 1XHZA 1G6UA 4CS2A 1SYXB 4JV5H 4TV8B 3HKCB 1J5EB 2CAZC 2F66C 2Q7HA 3BA8A 3IAYA 2W57A 3HXLA 3DSQA 5C8YB 1NT2B 4DR1B 2WE6A 4JI8H 4I7HA 5JQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB B;  3TY8 A;  4DV2 B;  4JI5 B;  1IBL B;  4JI7 B;  4K0K B;  4DV6 B;  4LFB B;  2CFM A;  5IWA B;  1P16 A;  1ZAU A;  1I94 B;  1X9N A;  3RR5 A;  1HNZ B;  1N32 B;  3RTX A;  3NC0 B;  1VS0 A;  1DGS A;  2Q2T A;  3BAB A;  5LMU B;  4UCS A;  5FPO A;  4DV7 B;  4B3M B;  4JI4 B;  4LF4 B;  4DV5 B;  2VQE B;  4DR6 B;  4B3R B;  1N36 B;  4LH6 A;  3JSN A;  4UCR A;  1CKN B;  4PZ8 A;  1A0I A;  4DR4 B;  4PZ6 A;  1N34 B;  2E5L B;  4EFE A;  2F4V B;  4UFZ A;  5D1P A;  3VNN A;  1HNX B;  3S24 A;  1FJG B;  2ZM6 B;  4YHH B;  2UXD B;  4DV1 B;  5D1O A;  4LH7 A;  5D1O B;  1IBK B;  1XNQ B;  1FVI A;  3L2P A;  5FPR A;  1HNW B;  4LF7 B;  3TY5 A;  3OTO B;  4AQY B;  4UCT A;  1IBM B;  4B3S B;  4JI0 B;  4LF9 B;  4LFA B;  4DRF A;  4UCO A;  3PN1 A;  4DR2 B;  4DV4 B;  4JYA B;  2HVR A;  4NXN B;  3BA9 A;  4JI6 B;  4DUY B;  4CC6 A;  4LF6 B;  1S68 A;  2HVQ A;  4X65 B;  1B04 A;  2HIV A;  3UQ8 A;  1TA8 A;  4GKK B;  4GKJ B;  4DV0 B;  4E6N A;  3GDE A;  1TAE A;  5LMN B;  4JV5 B;  4JI1 B;  2HHH B;  2VUG A;  3W1B A;  4LFC B;  4UCU A;  1XNR B;  1V9P A;  4X66 B;  3BAA A;  2HVS A;  2UXC B;  4LF5 B;  4CC5 A;  3GB8 B;  4JI8 B;  2Q2U A;  4TOI A;  3T1H B;  2UUA B;  2UXB B;  3SGI A;  3NBY B;  2OWO A;  4LF8 B;  1CKN A;  3QWU A;  3GJX B;  4EFB A;  4OX9 B;  4DV3 B;  1P8L A;  3W5O A;  4X62 B;  4DUZ B;  2HIX A;  1N33 B;  3JSL A;  3NBZ B;  1XK5 A;  4JI2 B;  1HR0 B;  4EQ5 A;  4DR3 B;  1CKO A;  2UUC B;  4B3T B;  4NXM B;  4EEQ A;  5DIS C;  4KHP B;  4DR7 B;  4YY3 B;  4UCV A;  5BR8 B;  3W1G A;  1XMO B;  1XDN A;  4JI3 B;  4X64 B;  3KYH C;  1J5E B;  4GLX A;  1XMQ B;  3BA8 A;  4DR5 B;  4PZ7 A;  3TY9 A;  2VQF B;  1CKM A;  4DR1 B;  3T1Y B;  2UU9 B; 
#chains in the Genus database with same CATH topology
 4DL5 A;  2UU9 O;  3TY8 A;  1MOF A;  5GTH Z;  5I5V A;  4ZQI A;  2W9A A;  4DV3 H;  2XAG A;  3L73 H;  4B08 A;  1U97 A;  3GTL A;  1YZB A;  2R72 A;  3ASN B;  2N74 A;  4MTX A;  2ASL A;  1PL4 A;  3JD0 A;  2FL4 A;  3TIN A;  1SES A;  3THO A;  1VS0 A;  3SNO A;  1Y1V G;  1J95 A;  4CH4 A;  1T36 A;  4DV0 H;  2AGA A;  5LMU O;  4B3M B;  5IYC G;  4DV7 O;  4D6T H;  3GTP A;  1CKN B;  2HHH H;  4QIW E;  1IYE A;  5LP6 A;  2YXL A;  4X20 A;  1RM1 B;  3EHB B;  5ITZ B;  2M7W A;  2ZDH A;  3DTG A;  5KFY A;  3VNN A;  5LYJ A;  4R7C A;  5KG0 A;  3GTK A;  5EBW C;  4DR1 H;  2HVK C;  1I50 A;  1A3G A;  4LF7 B;  4OX9 H;  3TY5 A;  1GKF A;  1FXK A;  2QTS A;  3K3P A;  4MTG A;  3OM3 B;  3JAW A;  2OTJ V;  3R5F A;  2P0A A;  2HVJ C;  3CS5 A;  1IBM O;  1AR4 A;  4K8X A;  4TQS A;  1BQZ A;  4I5S A;  1OCR B;  3UT5 B;  1I5X A;  5KG5 A;  4E2L A;  1IVS A;  4FMT A;  4FM9 A;  3V6H A;  3JCZ A;  5B3S C;  5I5T A;  5L1L A;  3D36 C;  5JVD F;  4X65 O;  2YEV A;  4ZI7 A;  1NJI W;  2R8G A;  2K1E A;  2UXN A;  4J9K A;  1A9X A;  3EPG A;  3U0Z A;  5CB4 F;  3WG7 B;  5LHG A;  1ULZ A;  5LMN B;  1H8H G;  3BY6 A;  2GTA A;  1FXV A;  2ZDI A;  3LUT B;  4LFC O;  4FFR A;  3PW2 A;  3HPL C;  5KT4 A;  2V1D A;  3ZRX A;  3JZ6 A;  2R8K A;  1YIJ V;  2Q2U A;  1Z2O X;  3T1H B;  2FP4 B;  3HKZ A;  2QWP B;  3SGI A;  1WAZ A;  5I5W A;  1R6T A;  3ZS8 C;  5JUM A;  4JI4 H;  5EYP A;  3TW7 A;  3I5D A;  2SCU B;  4BW9 A;  5DGB A;  4TV8 F;  1SEI A;  3ZRW A;  2ZE5 A;  3ZHT A;  1HR0 B;  4ED6 A;  3RYI A;  5EZY F;  5EWE A;  2RGR A;  3GIQ A;  1JPX A;  3B4S A;  3TXS A;  4DL6 A;  1VBH A;  1XNQ H;  3ASO C;  1XDN A;  5LL6 Y;  2B9Z A;  1KJJ A;  4HYO A;  3IJ4 A;  2C2R A;  1K73 W;  1AR5 A;  3GIP A;  4YXW G;  2YIB D;  3OMN B;  4K6N A;  3FYE B;  3KHH A;  2W8L A;  4LF9 H;  1M56 C;  5JWP A;  2PVP A;  4X9Q A;  2QKS A;  2VQF O;  3T1Y B;  3CE2 A;  4L8J A;  2DWE C;  2F23 A;  4UV9 A;  3T1H H;  2IJH A;  3J80 N;  4JI7 B;  4RAY A;  3SPJ A;  5IYB G;  2EJ3 A;  3K08 A;  2XCL A;  3J81 W;  4QPK A;  5IWA O;  3W7X A;  2PBZ A;  4A3I G;  1GMG A;  5DMX A;  2W6N A;  1Z5W A;  5HFM A;  2LP7 A;  1HR0 H;  4IRD A;  1K3E A;  4X8A A;  2E3C A;  1AR1 B;  2EBO A;  4LF4 B;  2KKW A;  4QE7 A;  4DR6 B;  2OIG A;  1E4G T;  4OPH A;  1NU1 H;  3T4Z A;  4F4L A;  2HJF C;  3CCQ V;  1QLN A;  4TV9 B;  4YB8 B;  2J9G A;  3MWE A;  1S76 D;  1EN5 A;  4I50 B;  2GBO A;  2UXX A;  4WFB V;  4UB8 Z;  2PYJ A;  2V5A A;  5KFD A;  4MVQ A;  5LL6 b;  2UVR A;  4OPA A;  3T1Y H;  2ATL A;  2AQ4 A;  4PDR A;  3G67 A;  2PI4 A;  4BXX G;  2ZGI A;  3KAJ A;  5KHI A;  3ZRV A;  3I12 A;  4JI7 H;  4O4L B;  3CCV V;  5L3C A;  4JXU A;  3CC2 V;  3H9V A;  1V54 B;  2QWO B;  4DR2 O;  3SPH A;  4RQE A;  2Y0S E;  4CMD A;  2AHZ A;  4NXN B;  1GN3 A;  2KSD A;  1S68 A;  1SRY A;  1WRV A;  5DQG A;  2Q0O C;  1COW G;  3ABK B;  4PA4 A;  4N21 A;  5ITZ A;  4R50 A;  1AB3 A;  3OUU A;  3DTU B;  3RBD A;  2BQ3 A;  2LFS A;  4GKJ O;  4J11 A;  1K83 A;  1OHH G;  2QDO A;  1W2B U;  3WB1 A;  1R3J C;  2Q73 A;  3OTF A;  1BQ0 A;  1AJN A;  5KLV H;  3U9S A;  3MWM A;  1D5N A;  2JGD B;  5GTI Z;  3UT5 A;  2B5U A;  4FFB B;  4EGQ A;  2VRZ A;  2FPI B;  2LW1 A;  1OBD A;  4XYL B;  3CJH B;  4U7N A;  1Y1V A;  1M9N A;  4DUZ O;  3OEH G;  1F51 A;  3OUS A;  3PW7 A;  4ED0 A;  3GTG A;  3BVO A;  1I1L A;  2UUC B;  5HV6 A;  2VWJ A;  3H4B A;  2UXD H;  1Q3E A;  1H2G A;  4TQD A;  2E76 B;  1KKD A;  5H80 A;  1KBL A;  4MVM A;  4C5A A;  4J9Q A;  1Y74 A;  1QCE A;  4XDK A;  2YIA A;  3KYH C;  3K5L A;  2JEU A;  4B3S H;  1W0J G;  1THZ A;  3KHG A;  5KFO A;  3G80 A;  1QQC A;  4YQW A;  1VQM V;  2UU9 B;  2JA5 A;  5KG4 A;  5C44 G;  2WSS G;  3M9M B;  4DV2 O;  2VUM G;  1CS0 A;  4LF6 H;  3QF7 A;  2OCC C;  5H6R A;  5IYD G;  2NU8 B;  3I56 V;  4QWC A;  2I80 A;  1ENV A;  4FS2 A;  3R5H A;  3KHR A;  4MTF A;  3M99 B;  1GO3 F;  1T3N A;  1B6Q A;  4NTY A;  5F9L A;  2HFE C;  2IU0 A;  1YTF D;  5LMU B;  2ZJT A;  3L4K A;  2JEG A;  4DV7 B;  3Q8S B;  4IIJ B;  1XHX A;  5K3W A;  4PZ8 A;  4ED1 A;  3WWI A;  1VQ8 V;  1N0J A;  2HKO A;  4F50 A;  2QA4 V;  1V51 A;  2YI9 A;  3ZHV A;  3RB0 A;  4A3L G;  1VQP V;  3W7U A;  2EIN B;  1VF5 B;  2UUA H;  3GIM A;  3K58 A;  2Q7D A;  4JAV A;  2NLJ C;  3P3P A;  5J2T B;  3RAX A;  2UU9 H;  4X1K B;  1VQ5 V;  4BW5 A;  4JTC B;  5IY5 C;  5B1B C;  5GON F;  2CH7 B;  1IBM B;  1HP8 A;  2W7P A;  1OCO B;  4NVP A;  1N33 H;  2P06 A;  4UCO A;  4JI0 O;  2V58 A;  3RVZ A;  1VKZ A;  1DAA A;  4AYB A;  1K33 A;  5E25 A;  3AK1 A;  3BA9 A;  3SJA C;  1EUD B;  5LMU H;  1IX9 A;  1RP3 B;  3HKC A;  4O7N A;  4X65 B;  3ZMS A;  4IZO A;  2OYQ A;  4I50 A;  1ZL8 B;  1L0L H;  1KJ9 A;  4ECS A;  1R1B A;  2QJ1 A;  5IYZ F;  2R86 A;  3JZF A;  5H5N A;  1K4D C;  3TJT A;  3M9O B;  1SZX A;  3IGA C;  3VPC A;  3L75 H;  3CCS V;  3W1B A;  4LFC B;  4O4L A;  4DV6 H;  4NTX A;  2P5O A;  4PHZ A;  2R8H A;  2OTL V;  4X66 O;  3BAA A;  3CCU V;  4J9R A;  1VQO V;  1MA1 A;  2LGW A;  2IU3 A;  5IJ0 A;  1NQT A;  2R7N A;  3OSN A;  1IBM H;  4FM2 A;  4BWS C;  1XIL A;  4U3J B;  4FM0 A;  3P32 A;  4GLW A;  1N0N A;  3MR6 A;  3H1K H;  5EC1 C;  3F7V C;  3VQV A;  3OUF A;  1P4R A;  3PR5 B;  3T4D A;  2YZL A;  5IJ9 B;  3K0G A;  3DGE A;  3PVX A;  1I7L A;  2QM8 A;  2YUA A;  4U6P A;  2F4V H;  1I5Y A;  1V55 B;  3NBZ B;  1XK5 A;  2R7Z A;  1QR8 A;  2LGQ A;  2AW9 A;  1BJT A;  1ORQ C;  2PTM A;  2COJ A;  2NUA B;  4GUN A;  2UVW A;  1OCC B;  4C7U A;  1PNK A;  1WNS A;  1MG1 A;  1L1F A;  3CEB A;  3K3V A;  1HDJ A;  4JGS A;  2Z0A A;  4MVU A;  4P9O A;  2KQX A;  2VQF B;  4MV7 A;  4YJ3 F;  3V4Z A;  2Q6A A;  4UV8 A;  3MD0 A;  3OR6 C;  5C93 A;  3CC4 V;  4I55 F;  4M0J A;  1JJ2 U;  2NU7 B;  5LP6 C;  2QEX V;  5DEC A;  1BHA A;  2W0X A;  4J7Z A;  2ZE7 A;  4MV4 A;  5IWA B;  2GQS A;  4RWU A;  2E75 B;  1KJ8 A;  3E35 A;  4A3D G;  1KYO F;  1DGS A;  1H2L A;  3K5O A;  2IH1 C;  4MVS A;  1I7F A;  1KQS U;  1FXK C;  3ETJ A;  2C28 A;  1NKD A;  1EZ1 A;  3QVN A;  3QFF A;  3E83 A;  1N36 O;  1GM8 A;  1X4T A;  2Q67 A;  3ABL C;  5GW7 A;  1AUV A;  4ETS A;  2JA8 G;  3GQC A;  4I4T B;  3QQM A;  3A0H Z;  1MSW D;  1HNX O;  2VQF H;  2Y69 C;  3UYY A;  4DV1 O;  2ZIN A;  5L3D A;  5L3F A;  4BY7 G;  5KS8 A;  4H13 B;  2A06 H;  3RFR A;  4PD4 F;  1WP8 A;  5JH7 F;  4ECQ A;  3OTO O;  1Q8I A;  5CA0 B;  3HOZ G;  4ZKI A;  1UPG A;  2VWK A;  3AG3 C;  3CRC A;  4DR2 B;  4DR3 H;  2Q68 A;  2W6Q A;  4DV4 O;  2YL2 A;  4PBC A;  1M57 B;  4B3M O;  4RUC A;  3L71 H;  2ZDI C;  1MMM A;  3QNE A;  4EB6 A;  5J2U B;  1TUE B;  4O4J B;  5H2F Z;  1RYS A;  2MCT A;  1VAJ A;  2XCP A;  3B77 A;  5KT2 A;  5I47 A;  5FNV B;  2ATK C;  2O03 A;  4O4H A;  4GKJ B;  2QYZ A;  4A3M G;  5K1P A;  1RK6 A;  5CM0 A;  4X1K A;  4X1Y B;  1MSD A;  1UC8 A;  2PMZ A;  4A3J G;  2F95 B;  4O3S A;  2CH7 A;  2Q69 A;  1PPJ H;  3T9C A;  4A2B A;  2RDJ A;  2LO1 A;  3E5N A;  3UKM A;  4JUZ A;  2QKA A;  4A3K G;  2IH3 C;  4YJ2 B;  4DR2 H;  3OHA A;  1H8E G;  2XIG A;  4XYM B;  4Q0Y A;  1JA8 A;  3QWU A;  2GPS A;  1K1S A;  5KHG A;  2H94 A;  5LP6 F;  4H0L B;  3RGZ A;  2EUL A;  2NN4 A;  4DUZ B;  3HB9 A;  1VQ7 V;  1RJQ A;  1KU9 A;  1K1Q A;  1WPB A;  3DAA A;  3KCX A;  3OSP A;  5KAF Z;  5LYJ F;  5B1A C;  1EM1 A;  3OGI B;  2YWV A;  4GKJ H;  4DR7 O;  2FLN A;  5BYB A;  4MV8 A;  1FXH A;  2I8C A;  4B7K A;  2RF4 A;  4DO2 A;  4AI8 A;  3R9R A;  1Y6X A;  1DF5 A;  2DN9 A;  2W57 A;  3IAY A;  3DTF A;  2WLJ A;  5C8Y B;  1VQK V;  4KXR A;  2XT9 A;  1UNN C;  4I7H A;  2NNU A;  4X89 A;  3M9N B;  4DV2 B;  5KFN A;  1VIB A;  3KTM A;  2V4Q A;  3T1C A;  4WHX A;  4ZI7 F;  4GYC B;  3JAS B;  2PGG A;  5D5P A;  3VMM A;  1JR9 A;  3ETG A;  3G6Y A;  5A2Q W;  5DQH A;  3SI8 A;  2QSA A;  1WPX A;  1XEQ A;  5FLX N;  2R8J A;  4UVB A;  4IT5 A;  4JAU A;  4JI1 H;  2XUM A;  1FKA H;  3JSN A;  2FK1 A;  2DYS C;  4LR3 A;  1VBG A;  2HGS A;  1MAB G;  3ZMU A;  3CXC U;  2WAQ E;  1JVM A;  3S3X A;  5D1P A;  1JFF B;  1KJI A;  1KEE A;  3G71 V;  1NI8 A;  1Q6U A;  1QLE B;  4LH7 A;  3RN4 A;  3SYQ A;  1VEW A;  1SZT A;  5CMU A;  4DRX A;  1WB7 A;  2RCV A;  4WF9 V;  2WLM A;  3AEI A;  3J7A U;  1YIT V;  4J42 A;  2P4V A;  4JI0 B;  4LC1 A;  4A3G G;  4DW1 A;  2CGO A;  3RV4 A;  4JYA O;  3ZHR A;  3OMA B;  3SYC A;  1EYZ A;  3ZX6 A;  4MSW C;  4J9M A;  4JPR A;  4CC6 A;  2ADQ B;  2PYL A;  1H2K A;  4OXS A;  3TW6 A;  4NR1 A;  5CR5 A;  4FZ1 A;  5BMV A;  3JCU Z;  1WB8 A;  1OCR C;  4NYK A;  2OT5 A;  3JD3 A;  3K5M A;  3VPB A;  2R87 A;  4MTE A;  4APM A;  2XAJ A;  1TAE A;  4O2B B;  5LOV A;  1EN4 A;  3HR0 A;  4X66 B;  3OMI B;  2R6F A;  5KMG A;  4ECX A;  4EBC A;  3WG7 C;  1C3O A;  2A7W A;  2IM9 A;  1B33 N;  2FJZ A;  4M9U A;  4ECY A;  4NXN O;  2P4K A;  5CA1 A;  4B3R H;  1AP6 A;  2CNQ A;  2HR3 A;  4FZ0 A;  1IXM A;  3OAA G;  3I55 V;  2Q4P A;  3CME V;  2DW4 A;  2VPS A;  2PY5 A;  3AX6 A;  1OZ0 A;  4DQN A;  2ZNI A;  5BWX A;  5KFJ A;  2RGV A;  2IJI A;  2R7K A;  1FPO A;  3QO5 A;  3EVK A;  4O2A B;  3W1G A;  2R93 G;  2ZXW B;  5LA6 B;  4KUM A;  3TK1 A;  4TQR A;  3E8G A;  1AN7 A;  2Y4R A;  1NVP D;  4Q6G A;  1LUW A;  2C00 A;  1AJQ A;  3K59 A;  2DPI A;  5KX5 B;  4HN2 A;  3TY9 A;  1PP9 H;  3E8H A;  1B6S A;  1XDC A;  5KA5 A;  1NH2 B;  4O81 A;  4RO2 A;  1CEZ A;  5JH7 A;  4ZHQ B;  2QM7 A;  5DED A;  3BPZ A;  4O7T A;  4J9L A;  2J6U A;  3GTQ A;  1ZAU A;  4QWE A;  1I2L A;  3P3N A;  2O57 A;  2V59 A;  3L70 H;  4RNM A;  3T9F A;  5KG6 A;  3PO3 G;  1SA0 A;  1R73 A;  2CTR A;  3H4D A;  2EJ7 A;  1N36 B;  3TCU A;  3WWH A;  3E89 A;  2YXY A;  4ZOL B;  2Q7G A;  1W59 A;  3LSS A;  4N23 A;  1K9M W;  5DGH A;  3CX5 F;  5C8Y A;  4O7V A;  1HNX B;  1YXB A;  3V6J A;  3IG0 A;  1WA8 B;  2W6O A;  4DV1 B;  3UCS C;  1GLV A;  2ZM6 O;  4I0X B;  4LF8 H;  1XL6 A;  2ARH A;  3JAK B;  4CS3 A;  1JMK C;  1GO3 E;  3AG4 C;  4QWD A;  2Z3Y A;  1NS1 A;  1SET A;  2FYU H;  3X2Q C;  3OTO B;  4X62 H;  5CN0 A;  4JI2 H;  3K06 A;  4ECT A;  4DV4 B;  1QU7 A;  1VP7 A;  2HLD G;  5JCO A;  1SF9 A;  1TGO A;  4FIP C;  4J80 A;  1SQB H;  2ODM A;  5B1N A;  3WNZ A;  4ASU G;  5IP9 G;  2WA4 A;  2CW7 A;  3ABM B;  4Q43 A;  2FB9 A;  4UVC A;  1YHQ V;  3JAM W;  1KB9 F;  4D7T A;  4CKB A;  2HGX A;  4YAK B;  2W6P A;  1L8D A;  3LSQ A;  3E8F A;  2YC0 A;  2EIK B;  2WA3 A;  3D3I A;  5K1X A;  1B3Q A;  2W70 A;  3PFF A;  3ABK C;  3SDL A;  2IJK A;  3FYI B;  1I2K A;  4BIZ A;  2BTQ B;  2B63 G;  4O3O A;  2NVY A;  3SJB C;  3MFH A;  1VQ4 V;  3L9D A;  5IYD O;  4DV4 H;  1NZ6 A;  3U10 A;  2Z02 A;  1EZJ A;  2UXB O;  3I4M G;  5KFW A;  4B3M H;  4EFB A;  1S0N A;  3OR7 C;  3DXR B;  3IC7 A;  3S3W A;  1JIH A;  3M7M X;  4DW0 A;  5CBG A;  4B3T O;  5KFZ A;  4DR7 B;  2QWQ B;  1VQ9 V;  4A3F G;  1KP3 A;  2DQ3 A;  4LF7 H;  2FMA A;  4QWA A;  5C4X G;  4DAA A;  3W7S A;  4LP8 A;  3FAV B;  4LWS A;  4KP4 A;  4GX5 A;  4IRK A;  2Y4T A;  1A0G A;  3T9A A;  1J5E O;  3Q8R B;  3GIL A;  1E1Q G;  1MNG A;  3HOW G;  2WAM A;  3VQW A;  3HKE A;  2P22 C;  2LJ2 A;  2ITC C;  4I7Z B;  3T5K A;  2VA3 A;  4DK0 A;  2R92 G;  4F6R B;  1RSO B;  3K9A A;  3R23 A;  1TWG A;  4HNA B;  4I50 F;  1LR1 A;  4XZ3 B;  3RTX A;  4RB2 C;  4Q8E A;  4O2A A;  2JJ2 G;  1TVK B;  2I87 A;  1IXB A;  4DR7 H;  3K04 A;  5LA6 A;  5LMN H;  1JXL A;  4Z1M G;  3ORR A;  1M0W A;  4DV5 O;  2VQE O;  4O4L F;  4BBR G;  2CNU A;  1AI4 A;  1N34 O;  4MS2 A;  4O82 A;  5KX5 A;  4O7W A;  2ZE8 A;  4ED7 A;  1TUB A;  4QPJ A;  1BGW A;  4PDB A;  3PZP A;  4MV9 A;  4YHH O;  1XUQ A;  4O3N A;  4CH5 A;  5KFI A;  1BL8 A;  4O4I B;  4IHJ B;  1KP2 A;  2GLT A;  3A2F A;  3VPD A;  1MZB A;  1OCZ C;  4WBN A;  5H6Q A;  1Y76 A;  4MTO A;  5C5J A;  5EWG A;  4DK1 A;  2WTF A;  4DL2 A;  2AGP A;  4C5B A;  3VOU A;  3JAR A;  3UO3 A;  3PN1 A;  2GV9 A;  3RIZ A;  4JYA B;  4GC6 A;  3IC9 A;  4EGJ A;  5C1O A;  2JVD A;  4UUG A;  5CB4 B;  4ECR A;  3BHP A;  2FPP B;  1JX9 A;  2V7Q G;  4ZOL A;  5EDW A;  4R8U B;  2AU0 A;  4TQF A;  3SYO A;  3HOV G;  1WCM G;  1E4E B;  1SKV A;  3FKS G;  2X6B A;  3RVY A;  5JQG A;  4GKK O;  4RZR A;  4YR2 A;  4I0X A;  4E6N A;  4FFL A;  1C30 A;  1WJZ A;  4PDV A;  1VMG A;  1XNR O;  2YU9 A;  3UM7 A;  5JJJ B;  5TIS Z;  4FLU A;  2UXC O;  4FBU A;  4ECW A;  3MJF A;  2DMX A;  2Q9L A;  4JYA H;  2OWO A;  5EZY B;  3HOU G;  2HG5 C;  1CKN A;  2PI5 A;  3OHB A;  4LF4 H;  4DR6 H;  2JGU A;  2W9B B;  1BXR A;  2E2H A;  1R3I C;  1IYD A;  3PR4 A;  2W8K A;  2J6T A;  2EJR A;  4EQ5 A;  3VQY A;  3LDC A;  3GTM A;  4NXM O;  1I08 A;  1A32 A;  3ABT A;  1Q6H A;  1XMO O;  1RFY A;  1S03 G;  4Q8F A;  3H0G G;  1L0N H;  2X5R A;  4A3C G;  2BTQ A;  4JZ2 A;  3L4J A;  2P67 A;  3BQ2 A;  1D2D A;  1CKM A;  1N56 A;  5KFG A;  1K34 A;  1OCC C;  4NXN H;  1MZE A;  4FLW A;  1KJQ A;  2ASD A;  3WFV A;  3G6E V;  1OWT A;  3SPC A;  1L2Z A;  2X6C A;  4K0K O;  2RDC A;  3C3T A;  2NVX A;  1P16 A;  4O3R A;  3O65 A;  5B3S B;  2EIL B;  4CH6 A;  3Q4H B;  1VQ6 V;  2FML A;  4O4H F;  2HGW A;  2GQR A;  2Q0A A;  3GTO A;  1BZK A;  2MW2 B;  1E4F T;  3H01 A;  2ZIM A;  2WPD G;  2UVV A;  2HHF B;  3UFX B;  1IDS A;  1X59 A;  2JEJ A;  4E4T A;  3NGD A;  3H1H H;  4PI0 A;  2ZM6 B;  4J9S A;  3ZHS A;  4HAM A;  2G38 A;  3JD1 A;  2B63 A;  3RB6 A;  4XX0 B;  2DLN A;  4F6R A;  3GLK A;  5K2M A;  1RSO A;  2R9I A;  4UCT A;  5IT9 N;  4YR0 A;  2YS6 A;  1EBO A;  3FB8 C;  4DRF A;  5F9N A;  2BE3 A;  2UUC H;  1JLL B;  1FD9 A;  2BQR A;  1M90 W;  4WFH A;  2ZR3 A;  2WLI B;  3OD4 A;  4RB0 A;  3RYF B;  3HKZ E;  4BR6 A;  5E1A C;  5CBH A;  4CH3 A;  3ASO B;  3SPG A;  4MT8 A;  3Q2O A;  2JJ1 G;  5EBM C;  4BBS G;  1XOU A;  2JK5 C;  5KKN B;  1M56 B;  2A0L A;  4O4I A;  5L3B A;  1EHI A;  4BIU A;  5KA6 A;  4QGP A;  2QTO A;  1YI2 V;  4PV1 B;  4LF5 O;  3ORQ A;  2QWN B;  2XGQ A;  1R3K C;  4IRC A;  2UXB B;  4H44 B;  3QG5 A;  3PW0 A;  3KAK A;  5EBL C;  4DV7 H;  4QIW F;  1N48 A;  4U7C A;  3TIG A;  5KT3 A;  2CTW A;  4TV9 A;  3H3V H;  4TUY B;  4YIO A;  2IBZ H;  3DF7 A;  1QVG U;  5KAI Z;  1ZQ7 A;  4QWB A;  2OLS A;  2QF7 A;  4W4K A;  1E4E A;  3A8T A;  3RW0 A;  2YZM A;  4B3T B;  1JDE A;  5DIS C;  3RBZ A;  4PEL A;  1XHZ A;  4QSH A;  2Z04 A;  5CAE B;  5KT5 A;  4QJF B;  4JF3 A;  2YRX A;  4WFG A;  4JI3 O;  3N8D A;  1J5E B;  2Q7H A;  2F66 C;  3BA8 A;  2W6J G;  3CMA V;  4DR5 O;  1B06 A;  3DSQ A;  2B1G A;  2W0F C;  1NT2 B;  5KFS A;  2BCC H;  2UXB H;  4JTA B;  2UUB O;  2FPG B;  2CW8 A;  4JI5 O;  2ZE6 A;  2IW5 A;  1CXZ B;  2DE0 X;  4F4Y A;  1AJP A;  4X65 H;  4WD3 A;  3ZMZ A;  1PKX A;  5BMV F;  2JS5 A;  3MAQ A;  4FPP A;  1H2N A;  1WLE A;  4M7E A;  1WP7 A;  2QR4 A;  1GN6 A;  2EIJ C;  1N32 O;  1NTZ H;  2L35 A;  3K0D A;  1R3L C;  4RU9 A;  5LOV F;  4DV5 B;  2VQE B;  4ED3 A;  4LFC H;  4DR4 B;  2ZDQ A;  3L74 H;  3L72 H;  1N34 B;  3BJY A;  1GN2 A;  3CCR V;  1H2M A;  1I3Q A;  3BAC A;  5KG2 A;  5JCO C;  2JGD A;  4YBZ B;  2D2C B;  3IFX A;  1RYR A;  3MR5 A;  1XBL A;  2EZO A;  4FFB A;  4YHH B;  2ABJ A;  1FJG O;  4F4W A;  5CA1 F;  1IBK O;  3E2E A;  5KT7 A;  3CJH A;  4JTD B;  1Y1W G;  4ME6 A;  4O4J F;  4AQY O;  5LGU A;  5KFB A;  3TQ1 A;  3SJC C;  3E22 B;  3Q4H A;  3CQZ A;  1QLE C;  3CSW A;  3CP1 A;  3J80 W;  2ZT9 B;  3WB2 A;  2GUZ B;  3NUA A;  2VPQ A;  5IYZ B;  3V4S A;  2COG A;  4DUY O;  2VQE H;  4DV5 H;  2VA2 A;  5KHK A;  3JD2 A;  1N34 H;  2R9R B;  3CCJ V;  2R84 A;  4IR9 A;  2JA6 G;  1SQQ H;  3SYA A;  5KFE A;  1K8A W;  4GKK B;  3H0G A;  4PA9 A;  1I6U A;  1NH2 D;  4DV0 O;  2YZG A;  5I5U A;  3UO2 A;  3U0G A;  4B7E A;  2VUG A;  2X6A A;  1XNR B;  4FM1 A;  2HHH O;  5IWA H;  3SJQ C;  3ETD A;  2UXC B;  3T9E A;  1Z2G A;  4CC5 A;  3MR3 A;  3T5J A;  4FLY A;  4HYK A;  5I60 A;  4FGR A;  2RN9 A;  4IL6 Z;  2HG8 A;  4IIJ A;  3N44 B;  3N41 B;  2AGQ A;  2NU6 B;  4P9P A;  3RYF A;  1P8L A;  2C22 A;  3NR7 A;  2ODT X;  4OX9 O;  2W71 A;  3V6K A;  3E86 A;  2QE7 G;  3Q8P B;  1EKP A;  4O83 A;  5C8Y F;  4I9W A;  4NXM B;  2WB1 A;  4GKK H;  1E1R G;  4UCV A;  5J2T A;  4KHP O;  1XMO B;  5LGN A;  1PNL A;  4I9Q A;  2Y4U A;  4I55 B;  2DZD A;  2C35 B;  4MVR A;  2F1M A;  3SR2 C;  4Z1V A;  4PZ7 A;  2XND G;  1XMQ O;  4A5U B;  5IY5 B;  2VUM A;  3ZED A;  2Q5Z A;  3A0B Z;  1BE3 H;  1SC5 B;  1US6 A;  2CTP A;  5B5E Z;  4K0K B;  1H38 A;  1F4N A;  3SYP A;  4WCE V;  4TUY A;  4CE5 A;  1ZL8 A;  4YR3 A;  4XBF A;  5JQW A;  4G3I A;  4GX1 A;  3RAQ A;  3M8A A;  2GPW A;  2PN1 A;  3H1L H;  3BRC A;  1KTA A;  5LGT A;  2COI A;  3TQT A;  1BT8 A;  4JI4 O;  3ETE A;  4QJF A;  4PI2 A;  4UCR A;  3M4I A;  4AYB E;  2AGO A;  1XMO H;  1K92 A;  1JKJ B;  4WFF A;  3AK3 A;  4FLX A;  4U3J A;  2C2A A;  4GX0 A;  2VOB A;  1IZ3 A;  3MFI A;  3LDE A;  1JQ0 A;  1FFX B;  2CNV A;  3RJ0 A;  5IP7 G;  3L2P A;  4O7S A;  1YTF B;  5IJ9 A;  4A3B G;  1XNQ O;  4UB6 Z;  3T9D A;  4K0K H;  4LSX A;  4DUZ H;  3STL C;  1S5J A;  5BZB A;  4LF9 O;  5DGI A;  5KFX A;  2W9C B;  5KFL A;  5KFR A;  2L6L A;  1YEW A;  4A93 G;  3F5T A;  1VAR A;  4QIW A;  5AG2 A;  4PA7 A;  1TWF A;  1UC9 A;  3AG7 A;  4HQ6 A;  3N40 P;  3TEK A;  3ASN C;  2ZD9 A;  3CWB H;  2Y0P A;  5KHH A;  5EOY A;  2XAH A;  4NZN A;  3HO8 A;  5DLG A;  2HJD A;  5KUM A;  1IOW A;  2XAQ A;  3LUL A;  1RM1 C;  4DV2 H;  4K8Z A;  4FFM A;  1GGO A;  4JV5 O;  5H9C A;  4RB3 C;  1KC8 W;  4J9N A;  3E22 A;  5LP6 B;  3KRE A;  4GZR B;  4LF5 B;  5BY1 A;  2RDI A;  5KFM A;  1KEC A;  3J81 N;  1ZHQ A;  3GID A;  4JI8 O;  4O2A F;  4R6Z A;  3FMA A;  5LA6 F;  1URF A;  3CRQ A;  3ABU A;  2CZG A;  2AXT Z;  4CHI A;  2R9A A;  4JAA A;  3JAW B;  3GB7 C;  2EJ2 A;  1GK9 A;  5KX5 F;  4I4T A;  4ZIB A;  1CKO A;  2JDI G;  4FJC C;  4EEQ A;  4IGG A;  3ABL B;  1Y4M A;  1NTM H;  2Y69 B;  5CA0 A;  4JI3 B;  5CA3 A;  4WBN F;  5L9X A;  1D5A A;  1PNM A;  4UVA A;  4CS4 A;  4DR5 B;  4JI0 H;  1RJR A;  2YEV B;  4ZI7 B;  1K5Q A;  1O75 A;  1PD3 A;  1FS0 G;  3R5X A;  4P2Z A;  1DIK A;  1RJP A;  3QZ8 A;  4TSF G;  1Y1W A;  5D1O B;  4EEY A;  2UUB B;  4DL4 A;  1DF4 A;  4JI5 B;  5J2U A;  1IBL B;  2A3Q A;  4O4J A;  4ZOL F;  3H20 A;  4JYC A;  3ZRS A;  2YYA A;  2DPJ A;  1NTK H;  3AW8 A;  2XGP A;  5FNV A;  2ITD C;  3OW2 U;  2DJV A;  5JQG F;  1N32 B;  3KHL A;  3RB3 A;  4PDM A;  3FDS A;  4X1Y A;  5KG3 A;  3GV8 B;  4ZBM A;  4DLK A;  4PZ6 A;  1YCI A;  5KT6 A;  5EYP B;  4X66 H;  4JI3 H;  1BNC A;  2W6I G;  2BQU A;  4CZZ A;  4YJ2 A;  3ZRW B;  1XL4 A;  3I4N G;  2FB5 A;  2UVU A;  2Q8V A;  1FJG B;  2EX3 A;  2UXD O;  3HB3 B;  1IBK B;  1M7J A;  2QK4 A;  2UUB H;  5IDJ A;  1BS3 A;  1QVF U;  3LML A;  2DYR B;  4AQY B;  3N2K B;  1BHB A;  1ZWI C;  2IP4 A;  5LXT B;  4B3S O;  3JRX A;  1QNM A;  2PMZ E;  1JCH A;  4MVO A;  3ETH A;  3BQ0 A;  2BOC C;  4J9Z B;  1N32 H;  4JZG A;  4H37 A;  2QB5 A;  5B1A B;  4DUY B;  5C3E G;  1ARO P;  2QWR B;  3U55 A;  4GX2 A;  4LF6 O;  3WO1 A;  2IMW P;  5JJE B;  2N05 A;  1B04 A;  3FB7 C;  4RQF A;  1OBG A;  3T54 A;  4NYE A;  5L3G A;  3ICX A;  4MW8 A;  3G6X A;  1FFX A;  4DV0 B;  1FJG H;  1K97 A;  2HEP A;  2H3O A;  1IBK H;  1U96 A;  2HHH B;  3Q8Q B;  3JAS A;  2YS7 A;  1V9P A;  4AQY H;  1Q7Y W;  1Z2P X;  4UUJ C;  2Y0S A;  1SQP H;  4QW8 A;  2W9C A;  4MV3 A;  4C5C A;  2DWD C;  3APQ A;  4DL7 A;  4MVZ A;  3SPI A;  3GV5 B;  2WLL B;  3PW5 A;  2UUA O;  1BGY H;  3AG2 B;  3G4S V;  3OE7 G;  3GJX B;  4OX9 B;  1N36 H;  3KAL A;  3CYO A;  1YDX A;  4DUY H;  5KFP A;  3RBE A;  1V54 C;  1JFF A;  3JSL A;  3BQ1 A;  5L3E A;  1N33 O;  2DYS B;  5L1J A;  4MAM A;  1HNX H;  4D7S A;  4KHP B;  2BSK B;  2ZNJ A;  4DV1 H;  3APO A;  3RYH B;  3CEI A;  3RB4 A;  4MTD A;  2FLL A;  3OTO H;  1YF2 A;  3N6R A;  1P7B A;  4GLX A;  1XMQ B;  5KG1 A;  1Q82 W;  3HBL A;  3CC7 V;  4RUF A;  1NBM G;  3ZHU A;  3VQX A;  4RB1 A;  3RFC A;  3TXQ A;  1ZHS A;  3K79 A;  3FX7 A;  1DK1 A;  1W96 A;  1GM7 A;  1R6K A;  3HKB B;  2ZCE A;  1BMF G;  3U11 A;  5JJN B;  3B40 A;  5CBF A;  4DV6 O;  1FFT B;  4LFB O;  2JA5 G;  1UJW B;  4FS1 A;  4H33 A;  5IE9 A;  4O3Q A;  3CXH F;  3NC0 B;  4QNH B;  2Q2T A;  5EK0 A;  4O2B A;  4KHP H;  2R85 A;  4C2M A;  3KXY T;  4JI4 B;  4O4I F;  4IHJ F;  2PUS A;  5BYA A;  2YID A;  1M5I A;  3QTC A;  2F93 B;  4FBT A;  1S5L Z;  4Q4D A;  2EIL C;  4EFE A;  3KKY A;  1OV9 A;  4IYI A;  2A79 B;  5DG8 A;  1NR1 A;  3JAT B;  2JA7 G;  2F4V O;  1XMQ H;  1F4M A;  2FKX A;  3K9S A;  4FLV A;  4HZ3 A;  1B6R A;  2VS0 A;  2QGN A;  3ZHQ A;  4HNU A;  5EIB D;  4TT3 G;  5D1O A;  3MHS C;  3E8B A;  3GII A;  1EUC B;  1XNQ B;  4DXW A;  3G6V A;  2ZQM A;  3AG1 B;  4TV9 F;  3H40 A;  1P49 A;  4L1K A;  1Y74 B;  3BFR A;  1GYF A;  4LF9 B;  4FK5 C;  4HBN A;  4LFA O;  3HT5 A;  1HWY A;  4TVI A;  3GVM A;  4O7Z A;  2EIM B;  1T94 A;  3RGB A;  3BCC H;  1N4C A;  1SQF A;  3FD9 A;  1KC7 A;  1S10 A;  4DR4 O;  2PF4 E;  1AIL A;  2R7L A;  3K3W A;  4U3F H;  3G8C A;  4RZQ A;  3RWR D;  2LQT A;  2R8I A;  3RF2 A;  5BPF A;  5FLX W;  4PWQ A;  3CD6 V;  4A3E G;  4GT1 A;  3AK2 A;  3GDE A;  5KFV A;  3LSU A;  4ZHQ A;  2ZIO A;  4JV5 B;  3GTJ A;  4UCU A;  1O9H A;  3N2K A;  1A48 A;  5LXT A;  2EIN C;  1ET0 A;  5JVD B;  2HVS A;  4J41 A;  2RQ6 A;  1SQG A;  2GDS A;  2YIC A;  5D8D A;  4K35 A;  4X1I B;  4MW3 A;  4JI8 B;  1IUR A;  3C3S A;  3ZIA G;  4WFE A;  2CK3 G;  3T99 A;  2WLN A;  1OCO C;  3EFF K;  4XDL A;  4J9P A;  2ZKO A;  1Y66 A;  2M6Y A;  5E79 Z;  2XOK G;  1I0H A;  1GH6 A;  2P6J A;  1G8M A;  2RMK B;  2HIX A;  2R93 A;  4KL1 A;  1G2W A;  2N04 A;  3TET A;  5EIB C;  1WA8 A;  4R7R A;  5DM6 V;  4DR3 O;  1Q5O A;  3LQS A;  3JAK A;  4JV1 A;  4ICG A;  4YY3 O;  4ECV A;  1G6U A;  2FTK A;  4CS2 A;  2ETN A;  2R7Z G;  4JV5 H;  1VQL V;  2ZR2 A;  4TV8 B;  4X64 O;  3MHH C;  2LW7 A;  3HKC B;  3AG4 B;  4DL3 A;  2EIY A;  3X2Q B;  3O9O A;  4JYB A;  3HXL A;  3JD4 A;  5J9P C;  4EYI B;  2EZP A;  5KFU A;  2WE6 A;  4O3P A;  2WLL A;  4JI8 H;  1P84 F;  2JIZ G;  5KHJ A;  3N2G B;  4F6E A;  4IWX A;  2P7T C;  4NZM A;  1CPY A;  4FFP A;  4TM5 A;  2RNB A;  2FLP A;  2CFM A;  2GSM B;  1F23 A;  4Z2W A;  3UZB A;  4JAS A;  3ZMV A;  3A0R A;  1NVP B;  4K3A A;  2DAB A;  2DIK A;  1I94 O;  1AI5 A;  5IJ0 B;  5BPH A;  2BSK A;  1M4U A;  3RYH A;  3WWJ A;  2AHY A;  3K5H A;  3N6X A;  5BWW A;  1V55 C;  3ZCC A;  4G2K A;  3H1J H;  1WR2 A;  4FLT A;  2OH2 A;  2HP8 A;  3CCL V;  2WDT A;  3CVZ A;  4G27 B;  4E4E A;  1GSA A;  2UXD B;  2CKZ B;  4IIJ F;  2K9P A;  1AI6 A;  3DXR A;  2VR1 A;  1DLB A;  4NKG B;  1M93 A;  1HNW O;  1M0T A;  3WU2 Z;  3N42 B;  3B09 A;  3HKB A;  2IA6 A;  5DLF A;  1DV1 A;  3B8M A;  4B3S B;  4EBD A;  1ZET A;  4J9Y B;  5HBR B;  2XAS A;  2BTO A;  1BSM A;  2E2I A;  1Y67 A;  5J2T F;  1WH2 A;  3P30 A;  1KKC A;  1XQ8 A;  5EWF A;  4NLG A;  3FAV A;  3F7Y C;  3CCM V;  1QR9 A;  2A9H A;  4LF6 B;  4XDJ A;  3PO2 G;  4NTW A;  2HVQ A;  1SQX H;  1R9T A;  2IJJ A;  1BCC H;  1VF7 A;  3ZMT A;  3JAT A;  5LBQ A;  3EPI A;  1H2S B;  1P7G A;  4BY1 G;  5FJ8 G;  3F5W C;  2YDE A;  1N8R W;  1JX4 A;  4J10 A;  4J7K A;  3K5N A;  1SCU B;  2R82 A;  1GM9 A;  1Q6I A;  3ETQ A;  4QW9 A;  4JI1 O;  4TUY F;  3G8D A;  4HNA A;  1FKA O;  1JOY A;  4IR1 A;  2CDY A;  2HDK A;  4F4X A;  2IBK A;  2JEI A;  4ECU A;  4G28 B;  3GB8 B;  3RGX A;  3DC5 A;  4ABM A;  4CMF A;  1TVK A;  2UUA B;  2AZ2 A;  1AUX A;  1HW7 A;  3CRM A;  1CE8 A;  4NZO A;  4J9O A;  5A2Q N;  1EFR G;  2YXH A;  4LNU B;  2V4D A;  3D3Q A;  3TII A;  1K7D A;  3EYY A;  2R70 A;  5KFA A;  2XCA A;  3JYC A;  4PA6 A;  5I5S A;  1M57 C;  4EKW A;  2ILM A;  1N33 B;  5BWV A;  4RAI A;  3CHX A;  3Q1K A;  3SE7 A;  4RNN A;  2ZM6 H;  5LHH A;  3JAL B;  4IHJ A;  5BR8 O;  4FLZ A;  3JRW A;  2A1H A;  2JA7 A;  2QM4 A;  1IOV A;  4EB6 B;  1S0V A;  5JVD A;  1FAF A;  5I5X A;  5L1K A;  1S97 A;  4JV2 A;  1S5H C;  2V4R A;  3CCE V;  3T9B A;  4X1I A;  2R92 A;  2NR5 A;  1OCZ B;  4IWY A;  4CKE A;  3U9T A;  5CB4 A;  3W7W A;  4O4H B;  4BIO A;  5EC2 C;  1AI7 A;  1UFI A;  1VF6 A;  2WLK A;  4R8U A;  4IAJ A;  4JYY A;  4DV6 B;  4LFB B;  3N43 B;  2BR0 A;  3NXS A;  2JS3 A;  3HKD B;  1HNZ O;  1EZV H;  1DV2 A;  4UCS A;  2W6M A;  2DOS A;  2J6S A;  1S77 D;  2M05 A;  1SQV H;  2H8P C;  4B3R O;  1RK5 A;  2ADP A;  4TV8 A;  1SS3 A;  2E5L O;  2F4V B;  3LNN A;  3FFQ A;  4UFZ A;  5BWU A;  3PW4 A;  3FKI G;  3RV3 A;  5EZY A;  3UZO A;  5DG9 A;  4O7L A;  1Q43 A;  2OIE A;  2YZN A;  5BWR A;  3N2G A;  4PA3 A;  5FL7 G;  5FPR A;  1ROP A;  1IBL O;  2W9B A;  4EBE A;  2GHY A;  1QHT A;  2JRI A;  4HNV A;  1SFO A;  4O7R A;  5FLM G;  4LFB H;  4I4T F;  4LFA B;  1TWH A;  4B3T H;  2HVR A;  4ED2 A;  1M6V A;  1WCM A;  4LMY A;  1O9G A;  5CA0 F;  2WAQ A;  4JI6 O;  3B8N A;  1YJ9 V;  5L1I A;  5GON B;  1J5E H;  2HIV A;  4FVM A;  4L87 A;  1TA8 A;  1KUT A;  1YVW A;  1EN6 A;  3B2E E;  1ZSP A;  3EXA A;  3OT7 A;  2ZDG A;  4W4L A;  4Q44 A;  5J2U F;  5BWT A;  2X7R B;  1EKF A;  3RUP A;  4RNO A;  4RUE A;  2P90 A;  5FNV F;  3QZ7 A;  2CE4 A;  1S0M A;  3D36 A;  3KG2 A;  1Z5V A;  4LFA H;  4TOI A;  2CQY A;  2X0S A;  3VOT A;  3ZJZ A;  1WN7 A;  2HHF A;  3GV7 B;  4LF8 O;  3W5O A;  1GAX A;  4DV3 O;  4DRX B;  4LCU C;  4DR4 H;  1K4C C;  4X62 O;  4Q45 A;  2FE3 A;  5FD6 A;  5DQI A;  4YJ2 F;  3PJS K;  3D8C A;  3R66 A;  4DR3 B;  1ZLZ A;  4JI2 O;  2W6Z A;  3T5L A;  3VA7 A;  3RYC B;  4YHH H;  4YY3 B;  1FYJ A;  4MA0 A;  5KFK A;  4IYH A;  1TWC A;  3OGC C;  5D5Q A;  4X64 B;  3K57 A;  4FFO A;  4LSA A;  2YW2 A;  3GWK C;  2OCC B;  3WO0 A;  3OFN G;  4O86 A;  1GTO A;  4FFK A;  1RPO A;  5BMV B;  5KUK A;  2C2E A;  2WLI A;  4DR1 O;  4Q4C A;  2C2D A;  3OUZ A;  1Q86 W;  2XTA A;  4LNU A;  1LNQ A;  5LOV B;  4Q20 A;  1I94 B;  3F8N A;  1G4Y B;  3FB6 C;  3JAM N;  2Q7E A;  2FK2 A;  4Y8V B;  4TWK A;  5KMG B;  1I1K A;  4YJ3 B;  2R7M A;  2PZS A;  3BAB A;  3JAL A;  5DAA A;  5CE8 A;  5FPO A;  4YY3 H;  2ALZ A;  4LH6 A;  4MA5 A;  3T7A A;  5CA1 B;  3HOX G;  3K5I A;  1XNR H;  3GIK A;  4LBE C;  4X64 H;  3MDS A;  5B1B B;  5DG7 A;  2KSW A;  3JZI A;  5KFQ A;  2UXC H;  4YP3 A;  1PX2 A;  2ZXW C;  1CQI B;  1KD1 W;  3TGU H;  1FVI A;  1HNW B;  4AIL C;  1OJH A;  4DIM A;  4LF7 O;  4BWA A;  5C1P A;  1TWA A;  5KFC A;  1V4Y A;  3ML0 A;  4FU0 A;  3HOY G;  3HKD A;  3RT3 C;  1I94 H;  4NXM H;  2V9W A;  4AHC A;  3J7A K;  2OCH A;  1PK8 A;  1MZF A;  5B1O A;  4CKC A;  4RUA A;  2DYR C;  2RJZ A;  1QBZ A;  1S3J A;  3GIJ A;  5JH7 B;  2Z5U A;  2XHB A;  3W7T A;  2Y0I A;  3UQ8 A;  4J0M A;  5T14 A;  5IYC O;  4X88 A;  1Z2N X;  1G1X B;  2KG7 B;  1S0O A;  2D3O W;  2BOB C;  3T2M A;  4JI1 B;  5LMN O;  1SA0 B;  1HNW H;  1Q81 W;  2YIB A;  3LP8 A;  3QO7 A;  2FK3 A;  1ZX3 A;  3IN5 A;  2E74 B;  1SER A;  1W93 A;  4CBC A;  5BXZ A;  4J7J A;  1E79 G;  3T1H O;  4O2B F;  5KG7 A;  1YJN V;  1I7N A;  4A2A A;  5IT9 W;  2EIJ B;  1F7Y A;  4R8C A;  3CRR A;  3LWB A;  5GON A;  4HNT A;  2WLH A;  5KFT A;  3K03 A;  4BAY A;  1PV0 A;  3N27 A;  2KB1 A;  3ZN1 A;  1HR0 O;  1KUQ A;  2YSU B;  3AG2 C;  1PM9 A;  1GRJ A;  3KCY A;  3CPW U;  3ABM C;  5BR8 B;  2JEF A;  5FR9 A;  4RAZ A;  1RPR A;  4DYL A;  1LUV A;  2CGN A;  2GTS A;  1EKV A;  2CUG A;  4GCZ A;  3FKI A;  4X20 B;  5B66 Z;  1CP9 A;  2EIK C;  1KMI Z;  2YI8 A;  4FE2 A;  3MWD A;  5LYJ B;  2GUZ A;  5I5Y A;  3DC6 A;  3T1Y O;  4O84 A;  4MV1 A;  5IYZ A;  1DTO A;  4PDL A;  2XD4 A;  3CSX A;  4RCN A;  5HNE A;  1W0K G;  4JI7 O;  1FXK B;  1KT8 A;  3G6B A;  2YRW A;  3LNM B;  3KZI Z;  1Y14 B;  2FKL A;  1GSH A;  2EJ0 A;  1GSO A;  1X9N A;  3RR5 A;  1HNZ B;  3RYC A;  3H1I H;  1WSC A;  1JDB B;  5DN6 G;  4ZHQ F;  1XI1 A;  5DGA A;  3U54 A;  5BR8 H;  4UXN A;  4LF4 O;  4B3R B;  1T5E A;  4DR6 O;  1A0I A;  3CRA A;  1YSC A;  2E5L B;  2LFR A;  5LXT F;  3C0F B;  3GWO A;  4LF5 H;  3FB5 C;  2HJW A;  5A9G A;  5HFL A;  4ED8 A;  2DQ0 A;  4FFN A;  3S24 A;  3AG3 B;  3OEE G;  3QO8 A;  2AZ0 A;  1JJO A;  2JEX A;  4PJ0 Z;  5JVL A;  3ZN0 A;  2XC9 A;  3R65 A;  4LWS B;  2MK3 A;  3LDD A;  1S72 V;  4MV6 A;  4YJ3 A;  2X0L A;  1HNZ H;  3AG1 C;  5IYB O;  1NR7 A;  2JA6 A;  3HKE B;  4I55 A;  4JI6 B;  3STZ C;  1GN4 A;  1YJW V;  1VQN V;  1AVM A;  5KFF A;  3C90 A;  2CTQ A;  4DR5 H;  2E5L H;  2B1I A;  5KFH A;  2EIM C;  1I1M A;  2VQD A;  3RYI B;  1K5S A;  4YIP A;  3ZBH A;  2XAF A;  4U7O A;  1AP5 A;  4JI5 H;  4YAJ B;  1IBL H;  2DWC A;  2WB1 E;  4WFA V;  2Y48 A;  2ASJ A;  4P30 A;  1Q90 D;  3VBB A;  3BG5 A;  4NB5 A;  4JV0 A;  2YCH A;  5LHI A;  4F4Z A;  1ZUQ A;  4KFM A;  3AYH B;  2NU9 B;  1TUB B;  3NBY B;  3CB2 A;  4LF8 B;  1CQJ B;  3WB0 A;  2WYO A;  4DV3 B;  1M1K W;  1XRE A;  4X62 B;  1PL0 A;  5FD5 A;  4JI6 H;  3BEH A;  4O7Y A;  2QKC A;  3T5H A;  4EG0 A;  4WBN B;  4ECZ A;  4JI2 B;  1Y76 B;  3MR2 A;  2F43 G;  3JAR B;  2UUC O;  1VF6 C;  4QE9 A;  2W7O A;  2KG7 A;  5F2V O;  1ZTE A;  1SYX B;  1KBH A;  1S9F A;  1R6N A;  2YS8 A;  2WWW A;  2DAA A;  2CAZ C;  4EYH B;  4OGQ B;  4DR1 B;  4HR7 A;  4GC7 A;  5JQG B; 
#chains in the Genus database with same CATH homology
 2UXB H;  5KHJ A;  3TY8 A;  3N2G B;  4DV2 B;  2CW8 A;  4DV3 H;  2CFM A;  4X65 H;  4GYC B;  3JAS B;  4B08 A;  2PGG A;  2JS5 A;  2R72 A;  5D5P A;  3MAQ A;  4M7E A;  5IJ0 B;  5A2Q W;  3THO A;  1VS0 A;  1M4U A;  3RYH A;  4CH4 A;  4DV0 H;  4B3M B;  3N6X A;  4DV5 B;  2VQE B;  4JI1 H;  1CKN B;  3JSN A;  1FKA H;  2HHH H;  4LFC H;  4DR4 B;  4LR3 A;  5LP6 A;  2YXL A;  4X20 A;  1N34 B;  2HGS A;  4FLT A;  5ITZ B;  5JCO C;  2WDT A;  5D1P A;  1JFF B;  3VNN A;  4FFB A;  5LYJ A;  3CVZ A;  4YHH B;  2UXD B;  4DR1 H;  4LH7 A;  4DRX A;  4LF7 B;  3TY5 A;  1M93 A;  4OX9 H;  1M0T A;  3N42 B;  3HKB A;  3JAW A;  3SJC C;  4B3S B;  3E22 B;  4JI0 B;  4K8X A;  2BTO A;  1WH2 A;  3J80 W;  3UT5 B;  3WB2 A;  1XQ8 A;  5IYZ B;  4CC6 A;  4FM9 A;  2PYL A;  4LF6 B;  2VQE H;  4DV5 H;  2HVQ A;  5KHK A;  4ZI7 A;  1VF7 A;  1N34 H;  3JAT A;  5BMV A;  1H2S B;  4GKK B;  3U0Z A;  3K5M A;  1I6U A;  4MTE A;  4APM A;  1TAE A;  3K5N A;  5LMN B;  4O2B B;  5LOV A;  3ETQ A;  2VUG A;  4HNA A;  1XNR B;  4FM1 A;  4X66 B;  5IWA H;  2UXC B;  4CC5 A;  5KMG A;  4FLY A;  3GB8 B;  3RGX A;  2IM9 A;  1TVK A;  2Q2U A;  3T1H B;  2UUA B;  1Z2O X;  3SGI A;  1HW7 A;  4IIJ A;  3N44 B;  3N41 B;  3ZS8 C;  4JI4 H;  5CA1 A;  1P8L A;  5EYP A;  3RYF A;  4B3R H;  4LNU B;  2V4D A;  4BW9 A;  3EYY A;  2R70 A;  1SEI A;  1N33 B;  2VPS A;  2PY5 A;  1HR0 B;  2ZNI A;  3RYI A;  3CHX A;  4NXM B;  2RGV A;  2ZM6 H;  4GKK H;  2RGR A;  4UCV A;  5J2T A;  4O2A B;  3JAL B;  4IHJ A;  3W1G A;  4FLZ A;  1XMO B;  5LA6 B;  1XDN A;  1XNQ H;  4I9Q A;  1AN7 A;  2QM4 A;  4I55 B;  4EB6 B;  2YIB D;  2F1M A;  4Q6G A;  3SR2 C;  5JVD A;  4PZ7 A;  3K59 A;  4LF9 H;  5KX5 B;  3TY9 A;  3ZED A;  4X1I A;  3T1Y B;  4L8J A;  5CB4 A;  4O4H B;  3T1H H;  4JI7 B;  4K0K B;  4RAY A;  5JH7 A;  4ZHQ B;  4IAJ A;  4TUY A;  4DV6 B;  4LFB B;  3BPZ A;  3N43 B;  3J81 W;  1ZAU A;  1Z5W A;  3HKD B;  1HR0 H;  3BRC A;  2E3C A;  4UCS A;  1SA0 A;  4LF4 B;  2KKW A;  4DR6 B;  1E4G T;  1N36 B;  1XMO H;  4PI2 A;  4UCR A;  3M4I A;  4ZOL B;  4TV8 A;  4TV9 B;  2Q7G A;  4FLX A;  2F4V B;  4U3J A;  3LNN A;  4I50 B;  3FFQ A;  4UFZ A;  5C8Y A;  2PYJ A;  1HNX B;  5EZY A;  3IG0 A;  2VOB A;  5LL6 b;  4DV1 B;  1Q43 A;  3T1Y H;  4LF8 H;  1FFX B;  3RJ0 A;  3L2P A;  3N2G A;  3JAK B;  5FPR A;  1JMK C;  4CS3 A;  5IJ9 A;  3KAJ A;  5KHI A;  1QHT A;  3OTO B;  4JI7 H;  4X62 H;  4K0K H;  4O4L B;  4LSX A;  4DUZ H;  4LFB H;  1S5J A;  4LFA B;  4JI2 H;  4DV4 B;  4B3T H;  5JCO A;  1YEW A;  2HVR A;  1TGO A;  4NXN B;  4LMY A;  1O9G A;  3N40 P;  2CW7 A;  1S68 A;  5GON B;  3JAM W;  1J5E H;  5ITZ A;  5KHH A;  4D7T A;  5EOY A;  2HIV A;  4FVM A;  1TA8 A;  1L8D A;  3B2E E;  4DV2 H;  5K1X A;  4K8Z A;  3WB1 A;  4RB3 C;  2BTQ B;  3OTF A;  3E22 A;  5LP6 B;  4LF5 B;  3SJB C;  1Z5V A;  3MWM A;  1ZHQ A;  4LFA H;  4TOI A;  3UT5 A;  3U10 A;  4DV4 H;  4FFB B;  3FMA A;  1WN7 A;  4B3M H;  4EFB A;  3W5O A;  4DRX B;  4DR4 H;  2R9A A;  2FE3 A;  3M7M X;  5FD6 A;  3JAW B;  4I4T A;  4ZIB A;  4DR3 B;  1CKO A;  2UUC B;  4EEQ A;  3RYC B;  2VWJ A;  4YHH H;  4DR7 B;  1Q3E A;  4TQD A;  4YY3 B;  2UXD H;  4LF7 H;  5CA0 A;  4JI3 B;  5D5Q A;  4X64 B;  3K57 A;  4LSA A;  2YIA A;  3KYH C;  1D5A A;  3K5L A;  4B3S H;  4CS4 A;  4DR5 B;  4JI0 H;  4ZI7 B;  1O75 A;  1QQC A;  5BMV B;  3VQW A;  3HKE A;  2UU9 B;  5D1O B;  2P22 C;  2UUB B;  4JI5 B;  5J2U A;  1IBL B;  4LNU A;  4O4J A;  4DK0 A;  4LF6 H;  3QF7 A;  4F6R B;  5LOV B;  3H20 A;  4HNA B;  5FNV A;  1I94 B;  3F8N A;  2Q7E A;  1N32 B;  3RTX A;  4RB2 C;  5KMG B;  4YJ3 B;  2PZS A;  3L4K A;  3BAB A;  4O2A A;  3JAL A;  1TVK B;  5LMU B;  2ZJT A;  4DR7 H;  5LA6 A;  5FPO A;  4DV7 B;  4X1Y A;  4YY3 H;  5LMN H;  1M0W A;  4IIJ B;  1XHX A;  4LH6 A;  4PZ8 A;  5CA1 B;  4PZ6 A;  1XNR H;  5EYP B;  4X66 H;  4JI3 H;  4X64 H;  2UXC H;  2KSW A;  5KX5 A;  2YI9 A;  4YJ2 A;  1TUB A;  1BGW A;  1FJG B;  2UUA H;  4PDB A;  2EX3 A;  4MV9 A;  3K58 A;  1IBK B;  1FVI A;  4CH5 A;  5J2T B;  1HNW B;  2UU9 H;  2UUB H;  4AIL C;  4O4I B;  4IHJ B;  4X1K B;  4BWA A;  3A2F A;  3LML A;  1MZB A;  4AQY B;  3N2K B;  4WBN A;  1IBM B;  5LXT B;  4NVP A;  1N33 H;  4DK1 A;  4UCO A;  3JAR A;  3HKD A;  3PN1 A;  1I94 H;  2GV9 A;  4NXM H;  3RIZ A;  4JYA B;  4AHC A;  3J7A K;  1N32 H;  2JVD A;  3BA9 A;  3SJA C;  5LMU H;  5CB4 B;  4DUY B;  3BHP A;  2RJZ A;  3HKC A;  4ZOL A;  5JH7 B;  4X65 B;  4TQF A;  5JJE B;  1B04 A;  2OYQ A;  4I50 A;  1SKV A;  2XHB A;  3UQ8 A;  4J0M A;  5JQG A;  2QJ1 A;  3ICX A;  1Z2N X;  1FFX A;  4DV0 B;  4E6N A;  1FJG H;  2HEP A;  4JI1 B;  1IBK H;  1SA0 B;  2HHH B;  3W1B A;  1HNW H;  4LFC B;  3JAS A;  4O4L A;  4DV6 H;  1V9P A;  2P5O A;  2YIB A;  4PHZ A;  4AQY H;  3BAA A;  1Z2P X;  5JJJ B;  1IBM H;  4FLU A;  5IJ0 A;  4FM2 A;  4BWS C;  4U3J B;  4FM0 A;  4JYA H;  2OWO A;  5EZY B;  1CKN A;  3VQV A;  3GJX B;  4LF4 H;  4A2A A;  4DR6 H;  4OX9 B;  5IT9 W;  2JGU A;  1N36 H;  3KAL A;  5IJ9 B;  4DUY H;  5GON A;  2F4V H;  1JFF A;  3JSL A;  3NBZ B;  1XK5 A;  4EQ5 A;  3VQY A;  1HNX H;  4D7S A;  4KHP B;  2ZNJ A;  1BJT A;  4DV1 H;  5BR8 B;  3RYH B;  2PTM A;  4RAZ A;  4MTD A;  1S03 G;  1WNS A;  3OTO H;  3K3V A;  2BTQ A;  4X20 B;  3L4J A;  4GLX A;  1XMQ B;  1KMI Z;  2YI8 A;  2VQF B;  1CKM A;  4MV7 A;  5LYJ B;  3VQX A;  4RB1 A;  5IYZ A;  4NXN H;  3CSX A;  4FLW A;  1ZHS A;  5LP6 C;  1L2Z A;  3HKB B;  2ZCE A;  3U11 A;  5IWA B;  1P16 A;  5JJN B;  4CH6 A;  1X9N A;  3RR5 A;  1HNZ B;  3RYC A;  3NC0 B;  1DGS A;  2Q0A A;  3K5O A;  2Q2T A;  1E4F T;  4O2B A;  1I7F A;  2ZIM A;  1XI1 A;  4KHP H;  3KXY T;  4JI4 B;  5BR8 H;  2PUS A;  4B3R B;  1M5I A;  1T5E A;  3QTC A;  1A0I A;  2F93 B;  1X4T A;  2E5L B;  4EFE A;  3C0F B;  4LF5 H;  3JAT B;  4ETS A;  1XMQ H;  4PI0 A;  4FLV A;  4I4T B;  3S24 A;  5EIB D;  2ZM6 B;  2VQF H;  5D1O A;  2ZIN A;  1XNQ B;  3RFR A;  1JJO A;  4F6R A;  1RSO A;  4UCT A;  1Q8I A;  1P49 A;  5CA0 B;  1GYF A;  4DRF A;  4LF9 B;  2VWK A;  4HBN A;  4DR2 B;  4DR3 H;  2UUC H;  4YJ3 A;  1HNZ H;  3RGB A;  3HKE B;  4I55 A;  1SQF A;  4JI6 B;  4RB0 A;  3RYF B;  4EB6 A;  5J2U B;  4CH3 A;  4O4J B;  4DR5 H;  2MCT A;  4RZQ A;  2E5L H;  3RWR D;  3RF2 A;  3RYI B;  5FNV B;  5FLX W;  2O03 A;  4O4H A;  4GKJ B;  3GDE A;  4JI5 H;  4ZHQ A;  5K1P A;  2ZIO A;  4JV5 B;  4O4I A;  1IBL H;  4X1K A;  4X1Y B;  4UCU A;  1O9H A;  2F95 B;  3N2K A;  5LXT A;  2YCH A;  5JVD B;  2HVS A;  4A2B A;  2RQ6 A;  1SQG A;  4X1I B;  4JI8 B;  4YJ2 B;  2UXB B;  4DR2 H;  1TUB B;  2XIG A;  3QG5 A;  3NBY B;  3CB2 A;  4Q0Y A;  4LF8 B;  3KAK A;  3WB0 A;  3QWU A;  4DV7 H;  5KHG A;  2WYO A;  4DV3 B;  4TV9 A;  4JI6 H;  4X62 B;  5FD5 A;  4TUY B;  3RGZ A;  3DF7 A;  4DUZ B;  1KU9 A;  2HIX A;  1WPB A;  4KL1 A;  4WBN B;  4JI2 B;  5EIB C;  4R7R A;  4B3T B;  1Q5O A;  5DIS C;  3JAR B;  3JAK A;  4GKJ H;  1XHZ A;  1G6U A;  4CS2 A;  1SYX B;  4JV5 H;  4TV8 B;  3HKC B;  1J5E B;  2CAZ C;  2F66 C;  2Q7H A;  3BA8 A;  3IAY A;  2W57 A;  3HXL A;  3DSQ A;  5C8Y B;  1NT2 B;  4DR1 B;  2WE6 A;  4JI8 H;  4I7H A;  5JQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...