4UCRA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 91
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucrA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucrA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucrA02
1ZAUA 4DRFA 4LH6A 4JI1B 4DV1B 1FVIA 5IWAB 1XNRB 3NBYB 1N33B 1DGSA 3T1YB 4DV4B 2E5LB 4UCOA 4CC6A 5BR8B 4JV5B 2F4VB 1IBLB 3BA9A 4LF7B 3BABA 1N36B 4AQYB 4B3RB 3RTXA 4GKKB 2Q2UA 3S24A 4EFBA 5LMUB 4DV0B 3KYHC 2UUBB 2UUCB 2VQFB 4UCVA 4JI3B 4LF6B 4EEQA 4DR5B 4UCSA 1CKNA 4DR6B 3W1GA 4EFEA 4UCRA 5LMNB 1X9NA 4KHPB 2VUGA 1XNQB 1B04A 4TOIA 2UXBB 2OWOA 4JI0B 4OX9B 4DR4B 2HVSA 1TA8A 4PZ6A 3BAAA 2UXDB 4PZ7A 1TAEA 1J5EB 4DR2B 4LF5B 1V9PA 2HVRA 4CC5A 4JI5B 4LF4B 1A0IA 3JSLA 3QWUA 3NBZB 4JI2B 4LFAB 2HHHB 2ZM6B 2VQEB 3PN1A 1XMOB 4X66B 4DUZB 4JI7B 4DV2B 5D1PA 3VNNA 4X64B 4UFZA 4GKJB 3TY8A 4DR7B 1XDNA 4X65B 1HNZB 4PZ8A 1XMQB 4LFBB 3GDEA 2HIXA 3L2PA 4DUYB 4LF8B 3NC0B 2UUAB 4UCUA 3RR5A 4YY3B 1IBMB 2CFMA 4B3SB 4JI6B 1CKMA 3SGIA 4EQ5A 1N34B 2Q2TA 3W5OA 4UCTA 1P8LA 4X62B 5D1OB 2UU9B 4DR1B 4DV7B 1I94B 1P16A 1HNWB 4JYAB 4YHHB 4LFCB 4NXNB 5FPRA 4GLXA 3TY5A 4DR3B 4DV3B 4LH7A 1CKOA 1IBKB 1S68A 1VS0A 1CKNB 2HIVA 4JI8B 3T1HB 5FPOA 4LF9B 4K0KB 4B3TB 1FJGB 5D1OA 1HNXB 3W1BA 4JI4B 3GB8B 4E6NA 1XK5A 3TY9A 4DV6B 3GJXB 1HR0B 4DV5B 4NXMB 3OTOB 1N32B 3JSNA 2UXCB 2HVQA 3BA8A 3UQ8A 5DISC 4B3MB
chains in the Genus database with same CATH superfamily
2RJZA 2B63G 1ROPA 2VS0A 2YSUB 4GX5A 3PW5A 1MG1A 2VPSA 1S77D 4DV1B 1SQQH 2D3OW 1KJQA 5F9LA 2BQ3A 3VPCA 2XAHA 2LFRA 2E5LB 4CC6A 5B66Z 3JAKB 1QQCA 2GTAA 2WA4A 4WFBV 3T5KA 3R65A 4CH4A 4UUJC 4WF9V 1AI7A 4I4TA 4O4LA 1KJ8A 3OMNB 2UXDO 1RM1C 2IH3C 3OTOO 4YJ2A 4JZGA 1FJGO 2LW7A 5J2UB 4MV4A 3B09A 4FS2A 5J2UF 1NBMG 1R3JC 1WPBA 3T1HH 4HNUA 4DR1H 2YCHA 4GYCB 5K1PA 4EFEA 2XAFA 4ZHQB 3I12A 1YI2V 5LMNB 2VR1A 2OIEA 4EBEA 2IU0A 4BBSG 4MW3A 5L3GA 2XAGA 1S5HC 4TOIA 4PELA 1AI4A 4TUYA 4I4TF 4O4LF 1V9PA 2YZLA 1A0IA 2EIJC 2F4VH 5KFGA 3VQVA 4I5SA 2HHFA 2LP7A 1E4EB 5KG1A 1N33H 1Y74B 2ZM6B 4O3QA 1XNRO 1XREA 3MFIA 2KSWA 1OZ0A 4FFBA 1KUQA 5A2QW 2P7TC 1DK1A 3OMAB 5EWEA 3KXYT 1CQIB 1JJ2U 4A5UB 3JAMW 4X62O 5KFHA 4P30A 4UUGA 1Y1VA 4FLTA 4MVSA 4J9MA 4LWSA 5DGHA 3AG7A 4LFAH 2QGNA 2W6NA 2XCAA 5L3FA 3HKZA 1ZLZA 2Q9LA 1N8RW 3OMIB 1BL8A 4F4LA 1CKMA 2RQ6A 3JCUZ 4JAAA 1J5EH 3JAKA 5IYZF 3OTOH 4PD4F 4JI1H 4UCTA 3IAYA 4JI6H 3B8NA 4IIJA 5KX5F 4LMYA 1I08A 1L0NH 5KG0A 4JAVA 4X66O 2WTFA 4DV2H 4O3PA 3JARB 2VQFH 1OCOB 4CS4A 3SPHA 2YIDA 2Y69B 2YWVA 1M1KW 2PYJA 3JD4A 1JMKC 4I55A 4NTYA 3L9DA 4O2BF 5BPFA 4O4IB 3KREA 1JFFA 1Z2PX 2NU7B 3J80N 3LDEA 3JYCA 3M8AA 2UUCO 2DAAA 4M0JA 4HNVA 1NVPB 1W0JG 5KFQA 2QWNB 2PN1A 2NVXA 1ZQ7A 5KA6A 4HNTA 1N4CA 1SYXB 4MTFA 4DW1A 1KKDA 5KT3A 4LFCH 4W4LA 1ZHSA 4B3MB 4O2AB 2WB1A 4LF9H 1WSCA 2ZE5A 3MR3A 1YEWA 2YEVA 3OEHG 5L3BA 2WLMA 3OT7A 1UC9A 3QTCA 2NN4A 4W4KA 3DTGA 4FFKA 2CE4A 3K9AA 3H01A 2Y0SA 2UU9O 4AQYO 1N36O 1F23A 4LF7B 2W6OA 3RYHB 2JS3A 1EUDB 1JKJB 3M99B 3RN4A 4XX0B 3G6YA 3HKZE 3H1JH 5BYAA 3GIJA 2WLLA 4MVQA 5LMUB 4DV0B 1S0NA 1R1BA 5KHGA 5C44G 3L72H 4O4JA 3H1LH 4O4IA 5DMXA 1FXKC 4EEQA 4FM9A 2RMKB 2I80A 1DF4A 4ZOLF 1YDXA 3Q8QB 4DV2O 1N34H 4I9QA 5CN0A 1SA0A 4DR2H 1RSOA 2B5UA 2UXBB 2UXDH 5JJNB 5DQGA 3FKIG 4FPPA 2LGQA 4FS1A 1AUXA 4QIWA 1G6UA 2J6TA 3SE7A 2EINC 4ECVA 5KG6A 1N0JA 4LSAA 2IW5A 1Q5OA 1H8EG 5LXTB 3ZN0A 2IJJA 4O7WA 1URFA 1AROP 2HHHB 5EWGA 2BTOA 4CMFA 1RP3B 2P90A 4ED1A 3QZ7A 1FXVA 1EUCB 2J6SA 1JQ0A 2EJ7A 2ZINA 4L1KA 5I5VA 4X64B 1K8AW 2VQFO 4PZ8A 1K1QA 4FM0A 3SYPA 3Q2OA 1G4YB 2XGQA 4LF8B 2UVRA 3SYQA 4F50A 3ETHA 2XTAA 3AG1C 4B3RO 2YI9A 3W7SA 1BMFG 5C5JA 2Q2TA 3NGDA 5CA0A 4J10A 3F5TA 1P8LA 1FD9A 3D3QA 1R3IC 5IJ0A 2ZE6A 4J9SA 4NXNB 4D7TA 1PNLA 3CCUV 4RB0A 5IWAH 1IBKB 4RZQA 3B2EE 1Y66A 5D5PA 2JA7A 4AQYH 2YW2A 5DN6G 2FYUH 5D8DA 3CRRA 3CMEV 1HNWO 4RB1A 2DPJA 3A8TA 4ECYA 2X7RB 2F66C 4PHZA 3GTGA 4PA9A 4BBRG 5CB4F 1AJQA 4JI8O 4H44B 1H2KA 5JVDA 2ASLA 3FB8C 4H0LB 2F4VO 5I47A 1NZ6A 4XYMB 4JASA 5C3EG 2FPPB 2M05A 3ZHRA 1GN2A 2NU6B 2DOSA 5DGBA 3KAKA 5KAIZ 4WD3A 4UV9A 3JASA 1QLEC 4GCZA 1VQ6V 4FFNA 4TV8F 2ZGIA 3T4ZA 2ZXWC 1B6RA 4JI2O 1IBMO 1MSWD 4U3JA 3RYHA 2N05A 4NXMH 1Z5VA 5H6QA 2OLSA 3AG4C 3CEBA 2GLTA 1VP7A 2YIBD 3RYCB 1FXKB 5LA6F 4DR5B 2MCTA 2QK4A 5B1AC 4K0KO 3ZHQA 3W1GA 1GGOA 1O9GA 3MR6A 3RV3A 2DN9A 1NTKH 1KMIZ 4HAMA 5C1OA 1TWAA 4AILC 3UT5A 4X62H 4DYLA 4NYKA 3AG2B 3ZMVA 2H3OA 5EBLC 4J9QA 2JA5A 1R9TA 1OWTA 2FE3A 1VF5B 3ZMTA 2A9HA 3A2FA 2O03A 2GSMB 4GKJH 3JSLA 4WFEA 1QNMA 5J2TB 3J7AK 2AZ2A 5EZYF 4DLKA 3ZRVA 2VQEB 4FLUA 2RDIA 2L6LA 4DUZB 4DV2B 4ZOLB 1WRVA 3A0RA 4YXWG 1MNGA 3VNNA 4A3CG 2WA3A 2X5RA 1XOUA 4DR7B 2IJHA 4DO2A 4GC7A 3TXQA 4RNNA 2PI5A 2HG5C 3HOZG 5CBGA 2KG7B 4DUYB 2AGOA 3V6HA 4R7RA 4XYLB 5EBMC 3X2QC 5LXTF 5KG4A 3JATA 5KT2A 3DC6A 2UXCO 4TQDA 2PY5A 3HOVG 2Y69C 2GV9A 1EM1A 5IT9N 2AGPA 2XT9A 3B4SA 1A3GA 3JASB 4DUYO 2YZMA 4FGRA 1I94B 3WB2A 4H13B 4YIPA 4JYAB 3UYYA 5EDWA 3GV5B 3CE2A 1SQXH 1SZXA 3VOTA 2X0LA 2CNQA 1OBGA 4DV3O 2E3CA 2OIGA 2H8PC 1E4EA 2DMXA 3N2GA 2HHFB 3G6BA 5KFUA 1S9FA 3L71H 3LSUA 1W96A 3OR7C 1HR0B 2DW4A 2DLNA 5D5QA 5EBWC 2OYQA 2CNUA 4C7UA 3CRCA 5KA5A 4MV1A 3KTMA 2ZR3A 3LP8A 4X64H 1IXBA 4AYBE 2OT5A 3RWRD 2EIJB 3CP1A 1B33N 1KJ9A 2WLNA 3T1YB 3RF2A 1Q8IA 2CW8A 2F23A 2DYRB 4NLGA 4G3IA 1MOFA 3UT5B 3UFXB 3CCLV 4YQWA 1BXRA 3GV7B 4LBEC 1BGWA 5JQGB 5KT5A 2QTSA 2H94A 3AK2A 3UO2A 3T1YO 3LSSA 1KU9A 3K08A 1TWFA 4TV9F 2V4RA 2Z0AA 4ABMA 5KUKA 4J9LA 1K83A 4B3RH 1PV0A 2X6AA 2ZR2A 3S3XA 2YRXA 3G8DA 4DR3H 1RJPA 5JQWA 1CKNA 2QWPB 4OPAA 5BWXA 3ASOB 1M4UA 2BOBC 1SFOA 1I1MA 3G6EV 4DW0A 5CA1A 3JZIA 4X1KB 2ZM6O 5KFYA 2OWOA 3UM7A 2R9AA 1PL4A 1Q82W 2WLLB 2XNDG 3FB7C 4DR5H 3FD9A 4DR4O 4NB5A 5CM0A 3HOYG 5CMUA 2R7LA 5EOYA 1TUEB 2IM9A 1H2NA 5TISZ 4FZ0A 3ZJZA 3K04A 4ECRA 1S97A 4MVMA 2JA7G 2HGXA 1RJQA 4YHHH 3SJQC 2JVDA 4ZOLA 5KFPA 3JAWB 2Q7HA 4RAIA 3TIIA 2C00A 1N34O 1XMQB 4EGQA 2OCCB 3SYOA 3BEHA 3TK1A 3ML0A 5K2MA 1S0MA 4PA6A 5LYJF 1XNQH 1T5EA 2UUAH 1G8MA 3KKYA 3TGUH 4KFMA 4X9QA 5B1BC 3HKDB 5J2TF 2JEGA 4NR1A 5IJ0B 4EEYA 4CBCA 1HDJA 3PO2G 4DR6O 1VQLV 3BHPA 2FB9A 2SCUB 4A3BG 4J9YB 1KC8W 1VQ5V 4LC1A 3AX6A 4TM5A 2V5AA 4B08A 4DV5O 5IP9G 4PI0A 1SEIA 1EKFA 3TY9A 4J9PA 1YCIA 3F5WC 4GX1A 4OGQB 1GYFA 4C5AA 3ETEA 2DJVA 3RGZA 5B3SC 3SDLA 2Y48A 5KAFZ 5H6RA 3VOUA 1S0OA 4PDLA 1XNRH 4BIZA 4PDBA 3RYIA 5KHKA 1N33B 4Q43A 1O9HA 4J7KA 4JYAO 4K6NA 3N2KB 1MZFA 1Y74A 4FMTA 4L87A 3TXSA 2BTQB 4LP8A 4NTWA 1FS0G 3RJ0A 5LHHA 3M9NB 2W6IG 2NU9B 2RGRA 2OH2A 1S76D 4LNUB 2QKAA 2F93B 2QM8A 3KCYA 3CWBH 2ITCC 4JPRA 2UUAO 1V55B 5LHGA 4ECWA 3HKBB 1NT2B 5LMNH 2WLJA 5KFWA 2Q4PA 3ORQA 5KFEA 5CAEB 2WLKA 2NLJC 1JX9A 1H2LA 3VPDA 1MMMA 1SETA 4EB6A 2F43G 3CCQV 4OPHA 1XL6A 3CX5F 4DR4B 2AQ4A 2KG7A 3K79A 5KFTA 1WPXA 1K9MW 2CTWA 1T36A 2R8IA 4QE7A 5LMUH 5L1JA 3LNMB 4FM2A 2PZSA 2Y4TA 2WSSG 1IOVA 1AJPA 4TUYF 4J9RA 3THOA 2FP4B 4FK5C 5KFFA 1VQ9V 4LFCO 1SS3A 3T9CA 4IRDA 2CKZB 4GKJB 3MWDA 3LULA 1NH2B 2YZNA 2R84A 3DF7A 1HWYA 2L35A 3APOA 5J2UA 5KX5A 4IIJF 4DK1A 1GO3F 1DV1A 2ZIOA 3OUUA 1E4GT 1A9XA 1KP2A 3T5JA 2RCVA 5LXTA 4DV6O 3JRXA 4YJ3F 4LF4H 4MV8A 4JI4O 3K0GA 3K3WA 2XAJA 5KHIA 2HJDA 3O65A 4A3GG 3RYFA 3CJHA 2V58A 4IHJF 1Z5WA 1YVWA 3QVNA 1XMQO 1KBLA 4MTXA 1IYEA 4JV5H 2Q7DA 3V4ZA 3PR4A 1YJWV 4LFCB 3MR2A 4GLXA 2PYLA 3W7TA 2ETNA 4DIMA 1VS0A 4WBNA 1WR2A 4J7JA 1UNNC 3GB7C 4DV7O 3QG5A 3QNEA 3ZRXA 1AR1B 2A7WA 5B1NA 4XDKA 3E8GA 3JZ6A 4A3KG 4J9OA 1JXLA 2GUZA 1HW7A 5LP6C 1IYDA 2W71A 1IURA 5IJ9B 3Q8PB 2RNBA 2W9BB 2XD4A 1SZTA 4QPKA 4YY3O 4CZZA 4QE9A 1OBDA 1O75A 3ZHUA 1L8DA 2ILMA 4RO2A 4WHXA 4ZI7A 4WCEV 3Q8SB 1XMOH 3AK1A 3H9VA 2UVVA 4QJFA 1BT8A 4DXWA 3RFRA 1K97A 2HJWA 3A0HZ 4OXSA 4APMA 4J0MA 1GTOA 1AR5A 5E79Z 3MHHC 2VA2A 3HPLC 1AJNA 4MV9A 5K1XA 3CXHF 5ITZA 4O7VA 2ASDA 2ZM6H 3CRAA 2PGGA 3H1HH 3CCMV 1I1LA 4AQYB 2UUBH 2UVWA 5CBHA 4B3RB 2VUMG 1HR0H 2QTOA 2KKWA 4O81A 4O2BA 2PMZE 4DAAA 3SJAC 3FAVB 1JX4A 1F51A 1XNQO 1JFFB 5KG7A 3D3IA 1PP9H 1B6QA 4IR9A 1FAFA 2X6CA 3N42B 3HT5A 5KFKA 2J6UA 1JR9A 2YL2A 3M9OB 1GO3E 1XBLA 4MTGA 5I5XA 1I6UA 1H2SB 1VEWA 2HVSA 4G2KA 4DL7A 3ICXA 2JA6A 1TAEA 4EG0A 3VQYA 1DTOA 2E74B 4QGPA 1W2BU 3LQSA 1B3QA 3NBZB 4RAYA 1RPRA 4U7CA 2NVYA 2B1IA 3O9OA 5KFXA 1XMOB 4PA3A 4TV9B 4KHPO 2QEXV 4HR7A 4R8UA 4DR7H 2E5LH 2YZGA 4MV3A 3TY8A 1ZETA 1IZ3A 5B5EZ 4XZ3B 4O4IF 3J81N 3L2PA 2AHYA 2E75B 4YJ2F 5LMUO 1GM7A 3GTJA 1J5EO 1KUTA 1AB3A 4GX2A 5BY1A 2BOCC 4ECTA 1AR4A 2W6QA 4UXNA 4O3OA 1N34B 1EZJA 4DV1H 3L4JA 1F4MA 3GIIA 4X62B 3CHXA 2UU9B 3G80A 4TUYB 2W70A 3ZIAG 2HJFC 3IG0A 3N41B 4DUYH 1CKOA 1WNSA 5FNVB 4QWBA 1WCMG 4JI8B 2QWQB 3CC4V 4Q4DA 3QQMA 2R6FA 4DUZH 4LF7H 4GUNA 4TQSA 2P6JA 2UUBO 1KC7A 4YJ3B 4JZ2A 5CA3A 5KT4A 3U0GA 1RJRA 3K5OA 3N40P 1VKZA 4G27B 2ZDIC 4Q45A 3APQA 2EIMB 1LUVA 4NVPA 3C0FB 1P4RA 2IH1C 3JAMN 3RAQA 5LP6A 3PW7A 4QW8A 3M4IA 4DRFA 4CH6A 3PFFA 1XUQA 3K3PA 4O2AF 3H3VH 2EJRA 4JV5B 1M0TA 3T1CA 2EIYA 1GAXA 2VRZA 1XI1A 2R82A 4CS3A 5BWUA 1HNZH 1BQZA 4IR1A 5J9PC 4EFBA 1M6VA 1NVPD 4DV4H 3PJSK 2VQFB 2LFSA 5JCOC 1LR1A 3H40A 2ZKOA 3UO3A 1ZL8A 2BTQA 1QVGU 4DK0A 1AUVA 4DR3O 3W7XA 4EKWA 3J80W 1R6KA 2DQ3A 4E4EA 5L3DA 5KS8A 4FLXA 1HP8A 4LF5H 2K1EA 2WE6A 1E79G 4U7NA 3RB6A 4RCNA 4LWSB 1QLNA 3RB3A 1KKCA 1NI8A 1PPJH 1BHAA 3GVMA 4B3TH 1VF6A 3AG1B 4UVAA 1Y14B 4RUFA 5JWPA 2P4KA 1TWCA 5LOVB 2DWEC 3E8HA 1H38A 3LDDA 5KFOA 2WYOA 3QZ8A 5D1PA 4UFZA 3OFNG 1XDNA 4X65B 2CK3G 4O86A 4O4JF 4GKKH 4C2MA 4MV6A 2R93G 2N74A 3G6XA 1M9NA 3TEKA 3I4MG 3KZIZ 1F4NA 2DIKA 2C2EA 2GPWA 4O7LA 4LF7O 3H0GG 4UVCA 1K4DC 3FAVA 5H5NA 1VQKV 3AG3C 4O7YA 1HNZO 2YXYA 1Y1WA 1Q6UA 4I7ZB 4JTAB 1GH6A 1SQBH 2M7WA 3BPZA 3DGEA 4PDVA 2HLDG 4I50F 3JRWA 1PM9A 5BMVF 4JTDB 3HKEA 4WFHA 4Z2WA 2PI4A 1Y76A 1E1RG 3QFFA 5IYZB 4B3TB 3IGAC 3IC7A 5HBRB 5IY5B 1K4CC 2HKOA 2N04A 5BWTA 4DV5B 1RFYA 4MTOA 2JGUA 2W0XA 5KFZA 5GTIZ 2COGA 4QWCA 1PL0A 5BR8O 4ETSA 1XEQA 1HNXH 2EILC 4IGGA 5HFMA 2V1DA 5DISC 3CRMA 3CCRV 1XQ8A 2FK2A 1FYJA 2JGDB 3CCJV 1FVIA 1EBOA 4HQ6A 1P7GA 3PW0A 1S72V 3CCEV 3I55V 3PW2A 1Q7YW 1Z2GA 4J7ZA 3GQCA 1IBLB 1KT8A 4HN2A 4JAUA 3M7MX 1S10A 4X1IB 1XILA 3ABLB 3BCCH 2HGSA 1ORQC 4JI8H 3RTXA 1JOYA 5F9NA 2RDCA 4F4ZA 2A0LA 2MK3A 3TCUA 3BQ1A 2FB5A 4P2ZA 1WH2A 2P06A 1NKDA 4FLZA 2ZNIA 1Y1WG 4IYIA 1OCOC 1GSOA 2FMAA 2QWOB 4U3JB 3MFHA 4A3IG 3ZX6A 3JCZA 4CKEA 4J42A 2E2IA 5KG3A 4O4HB 3T9EA 4LF6H 1SKVA 1J5EB 1SCUB 3T2MA 2YRWA 3HKCA 4NKGB 3ZS8C 2EBOA 4L8JA 3ZBHA 1SRYA 3QWUA 3N44B 2Q0OC 4ED8A 4LFAB 3OGCC 1IBKO 3U54A 1B6SA 2CGOA 2J9GA 3HXLA 5CA1F 1NH2D 2QKSA 3CC2V 3OEEG 1A0GA 3DXRA 3FYEB 4EB6B 3IN5A 2JA6G 4J80A 1K7DA 2V4QA 3HKEB 2W6ZA 1GRJA 2Z3YA 3E8BA 3MWMA 2CFMA 4FFLA 1K1SA 4LF8O 4JI6B 5C93A 4YP3A 1RK6A 5CA1B 2YDEA 3SYCA 1AN7A 1YIJV 4JV0A 3RIZA 5D1OB 1THZA 1WP8A 5BR8H 3T1YH 2R85A 1Y67A 1L2ZA 5FPRA 2LO1A 2Q8VA 3TY5A 4J9KA 3L74H 4DV3B 5CA0B 3UZOA 5KFJA 4Q44A 4JYAH 2PTMA 2EIKC 1XL4A 2FJZA 2R87A 3T1HB 5FPOA 5KFRA 1LUWA 2ADPA 4DV3H 1ZX3A 3JALA 2RDJA 3NR7A 3U0ZA 1N0NA 2ITDC 4BIUA 3Q4HB 1QHTA 3HO8A 4PJ0Z 1YJ9V 4ME6A 1RM1B 2UXBO 1VIBA 3T4DA 3RVZA 4YR0A 3JD2A 5L1LA 4JUZA 4YR2A 3NXSA 3QO8A 5L9XA 5CB4B 3K5LA 1BQ0A 2ASJA 1JVMA 2KSDA 3ZMUA 4BR6A 5LMNO 1SQFA 1N33O 2XCLA 4I50B 3GLKA 1TWGA 5BMVB 3N8DA 4GX0A 4FFPA 3T9DA 1CPYA 3U10A 4FM1A 4MS2A 4ICGA 1I94H 1S03G 2EJ3A 4PV1B 1VBGA 1D5NA 1N36B 3S3WA 1MSDA 4ED2A 3QO5A 4U3FH 2R92G 4K8ZA 4X20B 1IBMH 3KYHC 4MVUA 4JI4H 4U7OA 4JYBA 2ZD9A 2HR3A 4DV4O 4LF6B 4XDLA 4B3TO 3H4DA 3SPIA 1CQJB 1QR9A 5FLMG 3TQTA 5IE9A 4HNAA 1OCCB 3ABTA 4FLWA 1GK9A 5L1KA 3L70H 3HR0A 3AYHB 5DAAA 5BXZA 3BFRA 4LF5O 4GKKO 3T9FA 3V4SA 4EBCA 1ZWIC 1LNQA 3RBZA 5LP6B 2Q0AA 3H4BA 5LYJB 1Y1VG 4U6PA 1GKFA 1WN7A 4WFAV 2HVRA 1EFRG 3LSQA 4UB6Z 4NZNA 4D6TH 3U9TA 2F95B 2JS5A 4F6RA 4UB8Z 4HZ3A 4DL5A 2R9IA 4GKJO 3HOXG 1AI5A 4X66B 2YS8A 2A1HA 2W9CA 5HNEA 3JZFA 1GN6A 3QF7A 3P3NA 3TINA 4M9UA 2Z02A 5CB4A 5HFLA 5KMGA 2W6JG 2UVUA 3MAQA 1Y4MA 3N6XA 5EWFA 2G38A 3W7UA 4YY3B 1IBMB 3VPBA 4CH5A 2LQTA 3ETQA 3Q4HA 1AI6A 1SQPH 2FMLA 4P9OA 4QIWE 1KYOF 5DG8A 3CC7V 3GWKC 1EN5A 1P7BA 3K0DA 4TV8A 4LFBO 4GLWA 1M57C 1QU7A 3STZC 3B8MA 2FPGB 5FL7G 2R86A 4K0KH 4RNOA 5KKNB 2QDOA 2BSKA 3VQXA 1HNWH 2PVPA 2WB1E 4H33A 1EZVH 2CUGA 3T9BA 5L1IA 1PNKA 2EZPA 4LF4O 4DV6H 3OW2U 4IHJA 5D1OA 1Z2OX 2ZT9B 5JH7B 3CSXA 4TV9A 3CS5A 3R5HA 3GTOA 5FLXW 3TJTA 2DABA 4O7SA 3SPGA 2B63A 3GTLA 4F6EA 3WU2Z 2Y4RA 2CAZC 2Z04A 3BA8A 1NS1A 3E8FA 4TSFG 1ZAUA 2GTSA 2LJ2A 1ZL8B 2EJ0A 4LH6A 2DQ0A 3GILA 3CPWU 5BR8B 2DYSB 3KHLA 4BIOA 2YXLA 5C8YA 3OUZA 3HOWG 1VQMV 1IXMA 2F1MA 2QM4A 2X0SA 3N6RA 4YB8B 2YS7A 1C30A 4GKKB 4X65H 1SESA 2ABJA 1J95A 2W8LA 3F7YC 3MWEA 2UUBB 2BE3A 3GTQA 4MVOA 4LF8H 1SQVH 2EULA 5DM6V 4DR6B 4F4XA 2BSKB 3VBBA 2JDIG 3ABUA 5DECA 3KALA 1CEZA 2VWJA 4YJ2B 2VUGA 1XNQB 5KFCA 4DRXA 4JI0B 1IX9A 4DR2O 4QWDA 1VQPV 1YZBA 2BQUA 4MV7A 2QJ1A 4Q8FA 4RUAA 3SR2C 1CP9A 2OTLV 3CQZA 1A48A 3GTPA 2W9BA 1K5SA 4QSHA 5KFNA 3ASNC 2ZDIA 4RZRA 2HG8A 2XC9A 2YUAA 2PBZA 3RB4A 4O3SA 1QR8A 5H9CA 3FMAA 4BWAA 4JI7B 3VA7A 2RGVA 1N48A 5KG2A 5LA6A 1X4TA 4IL6Z 1BCCH 4X66H 2JEIA 2X6BA 3TQ1A 1OCCC 3U11A 2UXCH 5KFLA 1S5LZ 4B3SO 3L75H 4Q8EA 4FFMA 4QPJA 4O7ZA 1D2DA 3DTFA 1P84F 2WAQA 3UCSC 1XMQH 5DG7A 3WO0A 3WO1A 3PR5B 3AEIA 1P16A 2ATKC 5GW7A 2FLPA 3RB0A 4DR3B 2QM7A 2CW7A 1S68A 3P30A 1Q43A 3WWIA 4RQFA 4KL1A 3OD4A 1I7LA 3Q8RB 4LF9B 1N32O 1BSMA 2EZOA 4B3MH 4TQRA 3IFXA 4JYYA 4G28B 1HNXB 1K34A 1JIHA 4LSXA 3ZHSA 4JI4B 2ZQMA 4EYHB 4FFBB 4JV2A 4MA0A 1MZEA 1JJOA 5CE8A 1I1KA 4QWAA 2IU3A 4JV5O 4A3EG 1AP6A 1E1QG 3VMMA 3BRCA 3QO7A 4O2AA 4XBFA 4A3LG 1KP3A 3ASNB 1YF2A 4FVMA 3CMAV 1G1XB 5BMVA 3BQ0A 1QCEA 5L3CA 1R73A 1DGSA 4LFAO 3ZEDA 2F4VB 3E83A 1M5IA 3BABA 1EKPA 1FJGH 3RVYA 1BS3A 2D2CB 2ADQB 1PNMA 5EK0A 1W93A 2UUCH 1QVFU 3G67A 2Q2UA 3JD1A 2ARHA 5I60A 2YI8A 3DSQA 3R66A 1PD3A 5C8YF 2VWKA 2ZJTA 2NU8B 2XOKG 2JJ1G 4UCSA 5EC1C 1JLLB 4TT3G 2DZDA 5LOVA 3MR5A 2DE0X 1MA1A 3ZMSA 2C35B 4X1YB 4IWXA 5EYPB 1UJWB 2DYSC 1ZHQA 3E22A 3OR6C 5CA0F 5JJJB 4PWQA 4QIWF 3LMLA 2B9ZA 4JI5B 2R9RB 5EYPA 1IBLO 2VOBA 1V54C 2NUAB 1V4YA 2QE7G 2RF4A 2JEJA 4WBNF 1BGYH 5FNVF 4PA4A 5JQGF 1RSOB 2QA4V 1T94A 2JA5G 2CZGA 3TW7A 2OCHA 4X88A 5KT7A 3I4NG 1K33A 4CE5A 4O7RA 3K5MA 4TWKA 4NZOA 5GTHZ 3NC0B 1SF9A 2W7OA 5IYDG 1ULZA 1GSAA 2JK5C 3X2QB 4KP4A 3F7VC 3RGBA 1WP7A 1IVSA 4FFOA 5GONA 4AHCA 1W0KG 1FPOA 1M7JA 1M57B 4MT8A 5DLGA 1E4FT 3ABLC 2ZE8A 5CR5A 4JTCB 4N21A 1VF7A 3FB5C 5KHHA 3GIDA 4NYEA 3FKIA 2OTJV 3BQ2A 5FNVA 1NJIW 2E2HA 2IJKA 4AYBA 2ZE7A 3LDCA 2AU0A 1Q3EA 4UVBA 2YS6A 4YAKB 4BW5A 2ATLA 1FKAH 1I7FA 2DPIA 4RUEA 1I5XA 3M9MB 1EN6A 2YC0A 2BCCH 3GB8B 3D36C 4I0XA 2XCPA 2GDSA 5FD6A 3AG2C 3I5DA 5E1AC 4IT5A 2EILB 4YR3A 2AW9A 2UXCB 2HP8A 2WDTA 1OCRC 4J9ZB 4WFFA 3C3SA 1M0WA 3CEIA 3T99A 1OCZC 5B1AB 3TETA 1PX2A 3R23A 5FR9A 4ED3A 5KUMA 4BWSC 3HKBA 1VQ4V 1Q86W 4MAMA 3N43B 3AG4B 4UCOA 3ORRA 5KFMA 5IYBG 4X20A 4B7EA 4CS2A 4UV8A 2EJ2A 2ZIMA 4X1YA 1TWHA 4ED6A 3HOUG 3DAAA 2M6YA 4PBCA 4O3RA 3P3PA 2YYAA 2ZXWB 4PA7A 1GN4A 3I56V 5JH7F 3AW8A 4IWYA 3S24A 1QLEB 4HBNA 4JXUA 4O83A 3EPGA 3AG3B 1IBKH 5LGTA 3ABKB 4JI3B 4O7NA 2Q73A 5JQGA 3OSPA 1Y76B 5KHJA 1GLVA 4ZHQF 3CB2A 4ECXA 1VBHA 1K3EA 1W59A 2FK1A 4CKBA 2R8HA 1FFXA 3MDSA 4UCRA 2WPDG 1KECA 3STLC 5BWRA 3ZCCA 4EBDA 4OX9B 1RYSA 3FB6C 2AGAA 1T3NA 3EVKA 2QYZA 3PO3G 1DV2A 4F4WA 4OX9O 4JI2B 5DQIA 5C8YB 3CD6V 4R8CA 3WNZA 5IYDO 3PN1A 2BR0A 3V6JA 3FYIB 1WA8A 1VQ7V 1YXBA 1DAAA 4NXNH 2W6MA 2Q69A 3GTMA 5DG9A 4ZI7B 1AVMA 2HHHO 4DL3A 2CTQA 1VAJA 4HYKA 2HIXA 2R7NA 2R7ZG 4FJCC 1BE3H 1BZKA 2P0AA 5ITZB 4QW9A 3RBEA 2EIKB 3SGIA 2Y4UA 3CRQA 1FFXB 5DQHA 1KJJA 5KFSA 2CNVA 2XGPA 1L1FA 5IWAO 1KB9F 1HNWB 4ECUA 3K58A 2AHZA 3BJYA 1BHBA 4C5CA 4JI3H 5KFBA 1PKXA 2R7ZA 4LH7A 4GZRB 4WBNB 4RU9A 1R3LC 4H37A 3EHBB 3J7AU 2YICA 1FXHA 1GN3A 1Y6XA 4JI5O 1P49A 2VQEH 2EINB 4FLYA 5DGIA 4YY3H 2R7KA 2GUZB 4IYHA 3OGIB 5FLXN 1OHHG 2KQXA 3MD0A 1Q81W 4IHJB 4ECZA 1BNCA 4X1KA 3GV8B 4JI0O 5KX5B 5KMGB 1YTFD 3UZBA 1XHZA 2RN9A 2AGQA 4J41A 4EYIB 3N27A 4MTDA 2C28A 2GHYA 4X64O 2CTPA 4K3AA 2IBKA 1X59A 1VQ8V 1XHXA 2NNUA 4ASUG 1TVKA 3UKMA 4DV0H 4O4HF 1K5QA 4R50A 5T14A 4ECSA 4FLVA 2QB5A 4K35A 4GT1A 3T5HA 2P22C 4RB3C 4MVZA 1K73W 2B1GA 3LWBA 5JCOA 3U55A 1SC5B 3CYOA 4JI0H 4IAJA 3KCXA 2COJA 4B7KA 1QBZA 1C3OA 2V59A 3GIQA 3JAWA 1WB8A 4CMDA 4N23A 5DEDA 5EZYB 4YHHO 3T9AA 3WWHA 4Q0YA 5BPHA 1YHQV 3WWJA 2WAQE 4KUMA 5LYJA 1WCMA 4DV0O 4PDMA 3VQWA 2ZDGA 1EKVA 4X89A 3CVZA 5LL6b 4JYCA 5DLFA 1VF6C 5LGUA 3BY6A 3KHHA 4LR3A 5EC2C 5BYBA 2Z5UA 3N2KA 2VA3A 3H0GA 2WLHA 2XIGA 4HNAB 2FK3A 3RYIB 5LOVF 4A2AA 3OE7G 4XDJA 4ED7A 3SJCC 4DUZO 1GSHA 2VQEO 2WAMA 3E22B 5IY5C 3RW0A 1ZSPA 4LNUA 5I5WA 3R5XA 4CH3A 4FU0A 5KFAA 4EQ5A 4P9PA 2XASA 4GC6A 2IMWP 4MVRA 2FLNA 3JALB 3Q1KA 2Y0SE 4DR1B 4DV7B 5EIBD 3PVXA 4DRXB 3TW6A 3G4SV 3MJFA 4JI7O 4I55F 4ZI7F 5FJ8G 5I5UA 4E4TA 3RBDA 3CXCU 5FD5A 2XHBA 5H80A 4ZKIA 3OTFA 2I87A 2FKXA 3OUFA 4K0KB 4DR5O 1FJGB 3W1BA 3ABKC 4MSWC 2ZCEA 3RGXA 4BAYA 4DV6B 1RPOA 2QKCA 4TQFA 4JI2H 2C2AA 2GBOA 2Y0PA 1EZ1A 3HBLA 2W57A 1I0HA 4Q6GA 4YIOA 2QF7A 2A79B 1WLEA 1JCHA 1U96A 2VUMA 4DV1O 5IYCG 3CCVV 4F4YA 4OX9H 2JIZG 3N2GB 1OCZB 3V6KA 2YXHA 2JRIA 3NBYB 3RYCA 1H2MA 4DV4B 4LF6O 2ZNJA 4AI8A 3E2EA 3MHSC 1Q90D 2Q67A 1OCRB 4A3DG 4DL4A 3GIKA 4NXMO 1HR0O 1Z2NX 1WB7A 1NTZH 5B1OA 2HVKC 1B06A 4O4HA 1YJNV 4BW9A 3K59A 3EPIA 1TUBA 2R70A 1NQTA 1OJHA 4UCVA 1N56A 1OV9A 3JATB 2NR5A 4BXXG 5LBQA 4FE2A 2YIBA 4PDRA 3ZHTA 1WAZA 1KQSU 2ZDQA 3RV4A 1YSCA 5BWVA 2CH7A 3ZRSA 2W7PA 2AXTZ 3DC5A 4YAJB 3HB9A 1ZUQA 3HB3B 2Q68A 4B3SH 4NXNO 1ENVA 1EHIA 4TV8B 4QWEA 3DTUB 1H8HG 3RYFB 3CJHB 3ZRWA 3JD3A 3P32A 4BY1G 4PZ7A 2P5OA 2Q5ZA 4CC5A 4LF4B 3WG7B 2C2RA 5BZBA 5AG2A 1UPGA 3KAJA 5KLVH 1K92A 2EIMC 4NTXA 2E5LO 2CQYA 3BACA 4RUCA 3RT3C 2DWCA 2QWRB 1JDBB 2W9CB 4I9WA 4KXRA 2VPQA 2IA6A 3ABMC 1D5AA 1VMGA 2UU9H 2WWWA 1U97A 1N36H 2K9PA 3GDEA 2LW1A 2PMZA 1I5YA 5JVDF 4JV1A 2JEXA 3JARA 1V54B 5KFVA 3A0BZ 4CHIA 4HYOA 4JI5H 4X1IA 1YTFB 1M93A 2CH7B 3W5OA 1COWG 4LFBH 2FTKA 5I5YA 2R72A 3IC9A 1VQOV 4O3NA 4MA5A 4RB2C 4DR4H 2JJ2G 4A3JG 4DR6H 5IT9W 3EFFK 5K3WA 1KBHA 4Z1VA 5L3EA 5KFDA 3TIGA 4I7HA 2GQRA 1RYRA 5LHIA 2R7MA 1M56C 2HIVA 2COIA 3OM3B 1CXZB 5F2VO 4RQEA 2FLLA 1MABG 1GM8A 1HNXO 2CTRA 3ZN1A 3JSNA 4LF9O 1N32B 3LNNA 3SNOA 1F7YA 1I50A 4ED0A 3C3TA 1EN4A 1WA8B 2HDKA 3UQ8A 4DL2A 3C90A 4JI1O 2JA8G 4J11A 1I2LA 1NR1A 5HV6A 2R93A 4O7TA 1DLBA 4M7EA 3SYAA 4I50A 3RFCA 4FIPC 4DR1O 3L4KA 1XNRB 3WFVA 1DIKA 3GIPA 4ZHQA 1RK5A 3OAAG 4DL6A 4DV7H 5JH7A 3U9SA 3D8CA 1VARA 2O57A 1GMGA 4DQNA 4A93G 3KHRA 3T5LA 3WB1A 4RNMA 3SJBC 2ALZA 1ET0A 3FFQA 5B1BB 5A9GA 2PF4E 5BWWA 4Q20A 2UUCB 3E89A 2AZ0A 1UFIA 3K9SA 4Z1MG 1KTAA 5JVLA 2DWDC 2OCCC 3GIMA 4PI2A 1TVKB 1X9NA 4J9NA 3B40A 4KHPB 5J2TA 5A2QN 3OSNA 1A32A 1I3QA 1US6A 4FBTA 1ZTEA 2HEPA 3HKDA 1IOWA 5E25A 1YITV 5IJ9A 3D36A 3BAAA 1FFTB 3H1IH 2UXDB 3B77A 3ETJA 2UXBH 2P67A 1VQNV 2HFEC 4DR2B 4EGJA 3EYYA 5CBFA 2FL4A 2V9WA 3H20A 2CGNA 3T1HO 1S3JA 4A3MG 3H1KH 1BJTA 2UXXA 2I8CA 3R9RA 4F6RB 3RUPA 2IJIA 2Q6AA 1KJIA 3ZRWB 3DXRB 5LP6F 4E2LA 2R8JA 4JI7H 4IIJB 3K06A 3G71V 3WB0A 2MW2B 3BVOA 4FZ1A 5IYCO 4UCUA 3ASOC 3K5NA 4LCUC 5IYZA 5LL6Y 2HGWA 5KFIA 3KHGA 3HKCB 2PUSA 5IP7G 3IJ4A 1TUBB 4YJ3A 2P4VA 1WJZA 2JEUA 3G8CA 4O82A 4IRCA 4ZBMA 4FBUA 2C22A 5IDJA 2HVJC 2R92A 3PZPA 2DYRC 4TVIA 3CCSV 4CKCA 1CKNB 5JVDB 1I94O 5KG5A 4DV5H 1IDSA 3LUTB 4JF3A 3K57A 4Y8VB 4NZMA 4E6NA 5I5TA 1TGOA 3FDSA 1H2GA 4QNHB 3GJXB 3R5FA 1DF5A 5C1PA 3OTOB 4ZIBA 4ZQIA 3ZMZA 2HVQA 4IZOA 3K5IA 2V7QG 5C4XG 1G2WA 3ZHVA 4KHPH 4DR7O 4R6ZA 3AK3A 3NUAA 2FKLA 2Y0IA 2JGDA 1JA8A 4JI1B 1NTMH 3CSWA 4B3MO 3F8NA 5IWAB 3EXAA 4R8UB 4I55B 1N32H 2ODMA 1R6NA 3KG2A 2R8GA 3SPJA 3FX7A 1KEEA 3BA9A 3BG5A 1Q6IA 3E86A 3GTKA 4I4TB 4O4LB 1CE8A 4JI6O 4BY7G 2IBZH 5EIBC 4YBZB 4X8AA 2A3QA 2XAQA 5JJEB 3T54A 5KT6A 2CDYA 4ECQA 4A2BA 2W0FC 1JDEA 2JEFA 3ETGA 2LGWA 5IYBO 1V55C 1R3KC 3SI8A 3FKSG 1GM9A 2YU9A 4A3FG 2ZDHA 3OHAA 1B04A 1AP5A 1I2KA 1UC8A 4O84A 4O4JB 2HHHH 1TA8A 2W8KA 4PZ6A 3W7WA 4LF5B 3J81W 4FFRA 3GWOA 1KD1W 4R7CA 1NU1H 4WFGA 4C5BA 2BQRA 4MW8A 3K5HA 1M56B 1SA0B 5DGAA 3E5NA 1NR7A 2EX3A 3K03A 4I0XB 4RWUA 5B3SB 4QJFB 5LGNA 1R6TA 2QSAA 2C2DA 5EZYA 4JI3O 3E35A 3OHBA 1M90W 2YEVB 2R8KA 1HNZB 4JGSA 2VQDA 2QR4A 4LFBB 4O2BB 2UUAB 3OUSA 3RR5A 1JPXA 5H2FZ 2WLIA 2WLIB 1I7NA 4B3SB 1S0VA 1Q6HA 2FPIB 3SPCA 4K8XA 5GONB 3RAXA 4X65O 2W9AA 1L0LH 3K3VA 1PK8A 2W6PA 3ABMB 4D7SA 2V4DA 4Q4CA 1S5JA 4YHHB 2E76B 2XUMA 3ETDA 5I5SA 2UXNA 1SQGA 2ODTX 2Q7EA 1AILA 4RAZA 1XMOO 1MZBA 1FXKA 3WG7C 5GONF 4MTEA 1FKAO 1SERA 1V51A 2GQSA 3PW4A 5JUMA 1XK5A 1IBLH 1EYZA 3JD0A 4NXMB 1CS0A 4IRKA 1XDCA 5LA6B 2KB1A 2Q7GA 3G6VA 3T7AA 2GPSA 3L73H 2YIAA 2IP4A 2A06H
chains in the Genus database with same CATH topology
2RJZA 1SQFA 1XNRH 4I50B 4MTDA 5BMVB 2VPSA 4DV1B 4PDBA 3RYIA 3U10A 5KHKA 1XHXA 1N33B 1O9HA 1TVKA 4FM1A 4DV0H 2E5LB 3N2KB 4CC6A 3JAKB 1QQCA 1I94H 1S03G 4CH4A 2BTQB 3RJ0A 4I4TA 4O4LA 2RGRA 1N36B 4LNUB 2F93B 4YJ2A 4FLVA 4K8ZA 4X20B 1IBMH 5J2UB 3KYHC 2P22C 4RB3C 4JI4H 3HKBB 1NT2B 5LMNH 4LF6B 5JCOA 1WPBA 3T1HH 4DR1H 2YCHA 4GYCB 4JI0H 4HNAA 4EFEA 5K1PA 4IAJA 4ZHQB 5LMNB 4FLWA 4TOIA 3JAWA 5EZYB 4EB6A 4Q0YA 4TUYA 4DR4B 5LYJA 5LP6B 2Q0AA 5LYJB 1V9PA 3VQWA 1WN7A 2HVRA 3CVZA 1A0IA 5LMUH 5LL6b 2F4VH 4FM2A 3VQVA 2PZSA 1N33H 4LR3A 2F95B 2JS5A 4F6RA 3N2KA 2ZM6B 3THOA 2KSWA 2XIGA 4FFBA 4HNAB 5A2QW 4X66B 3RYIB 3KXYT 3QF7A 4GKJB 4A2AA 3JAMW 3SJCC 5CB4A 4FLTA 3DF7A 5KMGA 5J2UA 3E22B 5KX5A 4DK1A 4LFAH 3MAQA 2ZIOA 1E4GT 4LNUA 3N6XA 4YY3B 1IBMB 5LXTA 4LF4H 4CH5A 3ETQA 2RQ6A 4CH3A 1CKMA 1J5EH 4EQ5A 3JAKA 3OTOH 5KHIA 4JI1H 4UCTA 3JALB 3IAYA 4JI6H 4DR1B 3RYFA 5EIBD 4DV7B 1Z5WA 4IIJA 4TV8A 4DRXB 4LMYA 4JV5H 4LFCB 4DV2H 4GLXA 3JARB 2PYLA 2VQFH 4CS4A 4K0KH 1VS0A 4WBNA 5FD5A 3VQXA 2XHBA 1HNWH 2PYJA 3OTFA 1JMKC 4I55A 3QG5A 4K0KB 4O4IB 4DV6H 1JFFA 1Z2PX 4IHJA 1FJGB 5D1OA 3W1BA 1Z2OX 5JH7B 3CSXA 2ZCEA 4TV9A 1HW7A 3RGXA 5LP6C 4DV6B 5FLXW 4TQFA 5IJ9B 4JI2H 2W57A 1SYXB 4Q6GA 2CAZC 1O75A 4LFCH 3BA8A 1L8DA 1ZHSA 4B3MB 4O2AB 4LF9H 1YEWA 1ZAUA 4ZI7A 4OX9H 4LH6A 3QTCA 1XMOH 3N2GB 3NBYB 3RFRA 3RYCA 4J0MA 4APMA 4DV4B 2ZNJA 5BR8B 2YXLA 5C8YA 4MV9A 5K1XA 4LF7B 5ITZA 2F1MA 2ZM6H 2QM4A 1Z2NX 2PGGA 3RYHB 4AQYB 2UUBH 4B3RB 4GKKB 4X65H 1HR0H 4O4HA 2KKWA 4BW9A 3K59A 5LMUB 4DV0B 4O2BA 5KHGA 3SJAC 1TUBA 2R70A 4O4JA 2UUBB 4LF8H 4UCVA 1JFFB 4O4IA 4EEQA 3JATB 4FM9A 2YIBA 4DR6B 3KALA 3N42B 1N34H 2VWJA 4YJ2B 4I9QA 2VUGA 1SA0A 1XNQB 4B3SH 4DR2H 1RSOA 4TV8B 4DRXA 2UXBB 2UXDH 5JJNB 3RYFB 4JI0B 1I6UA 1H2SB 2HVSA 1G6UA 4PZ7A 3ICXA 2P5OA 1TAEA 4MV7A 4LSAA 2QJ1A 1Q5OA 3SR2C 4CC5A 5LXTB 3VQYA 4LF4B 3NBZB 4RAYA 2HHHB 2BTOA 3KAJA 1XMOB 4TV9B 4DUYH 3FMAA 4BWAA 4JI7B 2RGVA 4DR7H 2ZINA 2E5LH 4X64B 5LA6A 1X4TA 3TY8A 4PZ8A 1D5AA 4X66H 4FM0A 2UU9H 1N36H 3U11A 3GDEA 2UXCH 3L2PA 4LF8B 3JARA 4JI5H 2YI9A 4X1IA 1M93A 1N34B 2Q2TA 4DV1H 3W5OA 5CA0A 3L4JA 1XMQH 4LFBH 1P8LA 4X62B 3CHXA 2R72A 4DR4H 2UU9B 4DR6H 4TUYB 4RB2C 1P16A 5IT9W 5IJ0A 4NXNB 3IG0A 4DR3B 2CW7A 4D7TA 3N41B 4RB0A 1CKOA 1S68A 1IBKB 1WNSA 5FNVB 4RZQA 5IWAH 3B2EE 1Q43A 4I7HA 5D5PA 2HIVA 4JI8B 4KL1A 4AQYH 4LF9B 4B3MH 4DUZH 1HNXB 4LF7H 4RB1A 4LSXA 4JI4B 4FFBB 4YJ3B 1JJOA 2F66C 4PHZA 3K5OA 1N32B 3JSNA 3N40P 3LNNA 3BRCA 5JVDA 4NVPA 3C0FB 4O2AA 3UQ8A 5LP6A 4FVMA 3M4IA 4DRFA 4CH6A 5BMVA 4M7EA 4I50A 3L4KA 1XNRB 3KAKA 1DGSA 3JASA 3ZEDA 4ZHQA 4JV5B 2F4VB 1M0TA 4DV7H 5JH7A 1M5IA 3BABA 1FJGH 1XI1A 4U3JA 3RYHA 3WB1A 2UUCH 3SJBC 4CS3A 4NXMH 1HNZH 2Q2UA 1Z5VA 3FFQA 4EFBA 4DV4H 2YI8A 3DSQA 2UUCB 2YIBD 2VQFB 3RYCB 2VWKA 5JCOC 2ZJTA 4DR5B 2MCTA 4UCSA 2BTQA 3W1GA 4DK0A 5LOVA 1O9GA 4PI2A 1TVKB 1X9NA 3J80W 4KHPB 5J2TA 4FLXA 4LF5H 1KMIZ 2WE6A 2HEPA 3HKDA 4X1YB 5EYPB 4AILC 3UT5A 4X62H 1ZHQA 3E22A 5IJ9A 5JJJB 3BAAA 2UXDB 2UXBH 3EYYA 4DR2B 2FE3A 3LMLA 3A2FA 2O03A 4JI5B 3H20A 4B3TH 5EYPA 4GKJH 3JSLA 2VOBA 1BJTA 5J2TB 3J7AK 2VQEB 4FLUA 4F6RB 5LOVB 4DUZB 2WYOA 4DV2B 4ZOLB 5D1PA 3VNNA 4UFZA 4DR7B 1XDNA 4IIJB 4X65B 4JI7H 4GKKH 3WB0A 3K5MA 4DUYB 3NC0B 4UCUA 3K5NA 4R7RA 5IYZA 3JATA 3HKCB 3RGBA 2PUSA 4TQDA 2PY5A 1TUBB 4YJ3A 2GV9A 5GONA 4AHCA 3JASB 1I94B 3WB2A 1E4FT 4JYAB 3BPZA 1VF7A 5KHHA 5FNVA 3HKEA 1CKNB 5JVDB 1Q3EA 2E3CA 4DV5H 1FKAH 3N2GA 1I7FA 5IYZB 4B3TB 3K57A 3GB8B 4E6NA 1TGOA 3GJXB 5FD6A 1HR0B 4DV5B 2JGUA 5D5QA 2OYQA 3OTOB 4ZIBA 2UXCB 2HVQA 2WDTA 4ETSA 1HNXH 4KHPH 4X64H 5DISC 1XQ8A 1M0WA 3RWRD 3F8NA 4JI1B 1FVIA 1N32H 5IWAB 4I55B 4BWSC 3HKBA 3N43B 3T1YB 4UCOA 3RF2A 1Q8IA 2CW8A 4X20A 1IBLB 4CS2A 3UT5B 2ZIMA 3BA9A 3M7MX 4X1YA 4X1IB 1BGWA 4I4TB 4O4LB 5JQGB 2HGSA 5EIBC 4JI8H 3RTXA 3S24A 1KU9A 4HBNA 5JJEB 1IBKH 4B3RH 4DR3H 4JI3B 4A2BA 5JQGA 5KHJA 3CB2A 1CKNA 1WH2A 1M4UA 4FLZA 2ZNIA 1FFXA 4UCRA 5CA1A 1B04A 4X1KB 4U3JB 2OWOA 4O4JB 2R9AA 4OX9B 2HHHH 1TA8A 4PZ6A 4DR5H 4O4HB 4LF6H 1SKVA 1J5EB 4LF5B 3J81W 3HKCA 3ZS8C 4L8JA 3N44B 3QWUA 4JI2B 4LFAB 1SA0B 5EOYA 5C8YB 2IM9A 3PN1A 2EX3A 3HXLA 4NXNH 4YHHH 2JVDA 4ZOLA 5EZYA 4EB6B 3JAWB 4ZI7B 2Q7HA 1HNZB 3HKEB 1XMQB 4LFBB 4O2BB 2HIXA 2UUAB 3RR5A 3MWMA 2CFMA 5ITZB 4B3SB 1T5EA 4JI6B 2UUAH 1XNQH 3SGIA 5CA1B 1FFXB 4K8XA 5GONB 1AN7A 3RIZA 5D1OB 3HKDB 3K3VA 1HNWB 4D7SA 3K58A 5BR8H 5IJ0B 2V4DA 3T1YH 1S5JA 4YHHB 1L2ZA 5FPRA 3TY5A 4JI3H 4DV3B 4LH7A 4WBNB 5CA0B 1SQGA 3BHPA 4JYAH 2PTMA 2Q7EA 4RAZA 1MZBA 3T1HB 5FPOA 4MTEA 4DV3H 1P49A 3JALA 4B08A 3U0ZA 4PI0A 1XK5A 1SEIA 2VQEH 3TY9A 1IBLH 4FLYA 4YY3H 1QHTA 4NXMB 1GYFA 5LA6B 2Q7GA 4IHJB 3RGZA 4X1KA 5KX5B 5KMGB 1XHZA 5CB4B 2YIAA 3K5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAU A;  4DRF A;  4LH6 A;  4JI1 B;  4DV1 B;  1FVI A;  5IWA B;  1XNR B;  3NBY B;  1N33 B;  1DGS A;  3T1Y B;  4DV4 B;  2E5L B;  4UCO A;  4CC6 A;  5BR8 B;  4JV5 B;  2F4V B;  1IBL B;  3BA9 A;  4LF7 B;  3BAB A;  1N36 B;  4AQY B;  4B3R B;  3RTX A;  4GKK B;  2Q2U A;  3S24 A;  4EFB A;  5LMU B;  4DV0 B;  3KYH C;  2UUB B;  2UUC B;  2VQF B;  4UCV A;  4JI3 B;  4LF6 B;  4EEQ A;  4DR5 B;  4UCS A;  1CKN A;  4DR6 B;  3W1G A;  4EFE A;  4UCR A;  5LMN B;  1X9N A;  4KHP B;  2VUG A;  1XNQ B;  1B04 A;  4TOI A;  2UXB B;  2OWO A;  4JI0 B;  4OX9 B;  4DR4 B;  2HVS A;  1TA8 A;  4PZ6 A;  3BAA A;  2UXD B;  4PZ7 A;  1TAE A;  1J5E B;  4DR2 B;  4LF5 B;  1V9P A;  2HVR A;  4CC5 A;  4JI5 B;  4LF4 B;  1A0I A;  3JSL A;  3QWU A;  3NBZ B;  4JI2 B;  4LFA B;  2HHH B;  2ZM6 B;  2VQE B;  3PN1 A;  1XMO B;  4X66 B;  4DUZ B;  4JI7 B;  4DV2 B;  5D1P A;  3VNN A;  4X64 B;  4UFZ A;  4GKJ B;  3TY8 A;  4DR7 B;  1XDN A;  4X65 B;  1HNZ B;  4PZ8 A;  1XMQ B;  4LFB B;  3GDE A;  2HIX A;  3L2P A;  4DUY B;  4LF8 B;  3NC0 B;  2UUA B;  4UCU A;  3RR5 A;  4YY3 B;  1IBM B;  2CFM A;  4B3S B;  4JI6 B;  1CKM A;  3SGI A;  4EQ5 A;  1N34 B;  2Q2T A;  3W5O A;  4UCT A;  1P8L A;  4X62 B;  5D1O B;  2UU9 B;  4DR1 B;  4DV7 B;  1I94 B;  1P16 A;  1HNW B;  4JYA B;  4YHH B;  4LFC B;  4NXN B;  5FPR A;  4GLX A;  3TY5 A;  4DR3 B;  4DV3 B;  4LH7 A;  1CKO A;  1IBK B;  1S68 A;  1VS0 A;  1CKN B;  2HIV A;  4JI8 B;  3T1H B;  5FPO A;  4LF9 B;  4K0K B;  4B3T B;  1FJG B;  5D1O A;  1HNX B;  3W1B A;  4JI4 B;  3GB8 B;  4E6N A;  1XK5 A;  3TY9 A;  4DV6 B;  3GJX B;  1HR0 B;  4DV5 B;  4NXM B;  3OTO B;  1N32 B;  3JSN A;  2UXC B;  2HVQ A;  3BA8 A;  3UQ8 A;  5DIS C;  4B3M B; 
#chains in the Genus database with same CATH topology
 2RJZ A;  2B63 G;  1ROP A;  2VS0 A;  2YSU B;  4GX5 A;  3PW5 A;  1MG1 A;  2VPS A;  1S77 D;  4DV1 B;  1SQQ H;  2D3O W;  1KJQ A;  5F9L A;  2BQ3 A;  3VPC A;  2XAH A;  2LFR A;  2E5L B;  4CC6 A;  5B66 Z;  3JAK B;  1QQC A;  2GTA A;  2WA4 A;  4WFB V;  3T5K A;  3R65 A;  4CH4 A;  4UUJ C;  4WF9 V;  1AI7 A;  4I4T A;  4O4L A;  1KJ8 A;  3OMN B;  2UXD O;  1RM1 C;  2IH3 C;  3OTO O;  4YJ2 A;  4JZG A;  1FJG O;  2LW7 A;  5J2U B;  4MV4 A;  3B09 A;  4FS2 A;  5J2U F;  1NBM G;  1R3J C;  1WPB A;  3T1H H;  4HNU A;  4DR1 H;  2YCH A;  4GYC B;  5K1P A;  4EFE A;  2XAF A;  4ZHQ B;  3I12 A;  1YI2 V;  5LMN B;  2VR1 A;  2OIE A;  4EBE A;  2IU0 A;  4BBS G;  4MW3 A;  5L3G A;  2XAG A;  1S5H C;  4TOI A;  4PEL A;  1AI4 A;  4TUY A;  4I4T F;  4O4L F;  1V9P A;  2YZL A;  1A0I A;  2EIJ C;  2F4V H;  5KFG A;  3VQV A;  4I5S A;  2HHF A;  2LP7 A;  1E4E B;  5KG1 A;  1N33 H;  1Y74 B;  2ZM6 B;  4O3Q A;  1XNR O;  1XRE A;  3MFI A;  2KSW A;  1OZ0 A;  4FFB A;  1KUQ A;  5A2Q W;  2P7T C;  1DK1 A;  3OMA B;  5EWE A;  3KXY T;  1CQI B;  1JJ2 U;  4A5U B;  3JAM W;  4X62 O;  5KFH A;  4P30 A;  4UUG A;  1Y1V A;  4FLT A;  4MVS A;  4J9M A;  4LWS A;  5DGH A;  3AG7 A;  4LFA H;  2QGN A;  2W6N A;  2XCA A;  5L3F A;  3HKZ A;  1ZLZ A;  2Q9L A;  1N8R W;  3OMI B;  1BL8 A;  4F4L A;  1CKM A;  2RQ6 A;  3JCU Z;  4JAA A;  1J5E H;  3JAK A;  5IYZ F;  3OTO H;  4PD4 F;  4JI1 H;  4UCT A;  3IAY A;  4JI6 H;  3B8N A;  4IIJ A;  5KX5 F;  4LMY A;  1I08 A;  1L0N H;  5KG0 A;  4JAV A;  4X66 O;  2WTF A;  4DV2 H;  4O3P A;  3JAR B;  2VQF H;  1OCO B;  4CS4 A;  3SPH A;  2YID A;  2Y69 B;  2YWV A;  1M1K W;  2PYJ A;  3JD4 A;  1JMK C;  4I55 A;  4NTY A;  3L9D A;  4O2B F;  5BPF A;  4O4I B;  3KRE A;  1JFF A;  1Z2P X;  2NU7 B;  3J80 N;  3LDE A;  3JYC A;  3M8A A;  2UUC O;  2DAA A;  4M0J A;  4HNV A;  1NVP B;  1W0J G;  5KFQ A;  2QWN B;  2PN1 A;  2NVX A;  1ZQ7 A;  5KA6 A;  4HNT A;  1N4C A;  1SYX B;  4MTF A;  4DW1 A;  1KKD A;  5KT3 A;  4LFC H;  4W4L A;  1ZHS A;  4B3M B;  4O2A B;  2WB1 A;  4LF9 H;  1WSC A;  2ZE5 A;  3MR3 A;  1YEW A;  2YEV A;  3OEH G;  5L3B A;  2WLM A;  3OT7 A;  1UC9 A;  3QTC A;  2NN4 A;  4W4K A;  3DTG A;  4FFK A;  2CE4 A;  3K9A A;  3H01 A;  2Y0S A;  2UU9 O;  4AQY O;  1N36 O;  1F23 A;  4LF7 B;  2W6O A;  3RYH B;  2JS3 A;  1EUD B;  1JKJ B;  3M99 B;  3RN4 A;  4XX0 B;  3G6Y A;  3HKZ E;  3H1J H;  5BYA A;  3GIJ A;  2WLL A;  4MVQ A;  5LMU B;  4DV0 B;  1S0N A;  1R1B A;  5KHG A;  5C44 G;  3L72 H;  4O4J A;  3H1L H;  4O4I A;  5DMX A;  1FXK C;  4EEQ A;  4FM9 A;  2RMK B;  2I80 A;  1DF4 A;  4ZOL F;  1YDX A;  3Q8Q B;  4DV2 O;  1N34 H;  4I9Q A;  5CN0 A;  1SA0 A;  4DR2 H;  1RSO A;  2B5U A;  2UXB B;  2UXD H;  5JJN B;  5DQG A;  3FKI G;  4FPP A;  2LGQ A;  4FS1 A;  1AUX A;  4QIW A;  1G6U A;  2J6T A;  3SE7 A;  2EIN C;  4ECV A;  5KG6 A;  1N0J A;  4LSA A;  2IW5 A;  1Q5O A;  1H8E G;  5LXT B;  3ZN0 A;  2IJJ A;  4O7W A;  1URF A;  1ARO P;  2HHH B;  5EWG A;  2BTO A;  4CMF A;  1RP3 B;  2P90 A;  4ED1 A;  3QZ7 A;  1FXV A;  1EUC B;  2J6S A;  1JQ0 A;  2EJ7 A;  2ZIN A;  4L1K A;  5I5V A;  4X64 B;  1K8A W;  2VQF O;  4PZ8 A;  1K1Q A;  4FM0 A;  3SYP A;  3Q2O A;  1G4Y B;  2XGQ A;  4LF8 B;  2UVR A;  3SYQ A;  4F50 A;  3ETH A;  2XTA A;  3AG1 C;  4B3R O;  2YI9 A;  3W7S A;  1BMF G;  5C5J A;  2Q2T A;  3NGD A;  5CA0 A;  4J10 A;  3F5T A;  1P8L A;  1FD9 A;  3D3Q A;  1R3I C;  5IJ0 A;  2ZE6 A;  4J9S A;  4NXN B;  4D7T A;  1PNL A;  3CCU V;  4RB0 A;  5IWA H;  1IBK B;  4RZQ A;  3B2E E;  1Y66 A;  5D5P A;  2JA7 A;  4AQY H;  2YW2 A;  5DN6 G;  2FYU H;  5D8D A;  3CRR A;  3CME V;  1HNW O;  4RB1 A;  2DPJ A;  3A8T A;  4ECY A;  2X7R B;  2F66 C;  4PHZ A;  3GTG A;  4PA9 A;  4BBR G;  5CB4 F;  1AJQ A;  4JI8 O;  4H44 B;  1H2K A;  5JVD A;  2ASL A;  3FB8 C;  4H0L B;  2F4V O;  5I47 A;  1NZ6 A;  4XYM B;  4JAS A;  5C3E G;  2FPP B;  2M05 A;  3ZHR A;  1GN2 A;  2NU6 B;  2DOS A;  5DGB A;  3KAK A;  5KAI Z;  4WD3 A;  4UV9 A;  3JAS A;  1QLE C;  4GCZ A;  1VQ6 V;  4FFN A;  4TV8 F;  2ZGI A;  3T4Z A;  2ZXW C;  1B6R A;  4JI2 O;  1IBM O;  1MSW D;  4U3J A;  3RYH A;  2N05 A;  4NXM H;  1Z5V A;  5H6Q A;  2OLS A;  3AG4 C;  3CEB A;  2GLT A;  1VP7 A;  2YIB D;  3RYC B;  1FXK B;  5LA6 F;  4DR5 B;  2MCT A;  2QK4 A;  5B1A C;  4K0K O;  3ZHQ A;  3W1G A;  1GGO A;  1O9G A;  3MR6 A;  3RV3 A;  2DN9 A;  1NTK H;  1KMI Z;  4HAM A;  5C1O A;  1TWA A;  4AIL C;  3UT5 A;  4X62 H;  4DYL A;  4NYK A;  3AG2 B;  3ZMV A;  2H3O A;  5EBL C;  4J9Q A;  2JA5 A;  1R9T A;  1OWT A;  2FE3 A;  1VF5 B;  3ZMT A;  2A9H A;  3A2F A;  2O03 A;  2GSM B;  4GKJ H;  3JSL A;  4WFE A;  1QNM A;  5J2T B;  3J7A K;  2AZ2 A;  5EZY F;  4DLK A;  3ZRV A;  2VQE B;  4FLU A;  2RDI A;  2L6L A;  4DUZ B;  4DV2 B;  4ZOL B;  1WRV A;  3A0R A;  4YXW G;  1MNG A;  3VNN A;  4A3C G;  2WA3 A;  2X5R A;  1XOU A;  4DR7 B;  2IJH A;  4DO2 A;  4GC7 A;  3TXQ A;  4RNN A;  2PI5 A;  2HG5 C;  3HOZ G;  5CBG A;  2KG7 B;  4DUY B;  2AGO A;  3V6H A;  4R7R A;  4XYL B;  5EBM C;  3X2Q C;  5LXT F;  5KG4 A;  3JAT A;  5KT2 A;  3DC6 A;  2UXC O;  4TQD A;  2PY5 A;  3HOV G;  2Y69 C;  2GV9 A;  1EM1 A;  5IT9 N;  2AGP A;  2XT9 A;  3B4S A;  1A3G A;  3JAS B;  4DUY O;  2YZM A;  4FGR A;  1I94 B;  3WB2 A;  4H13 B;  4YIP A;  4JYA B;  3UYY A;  5EDW A;  3GV5 B;  3CE2 A;  1SQX H;  1SZX A;  3VOT A;  2X0L A;  2CNQ A;  1OBG A;  4DV3 O;  2E3C A;  2OIG A;  2H8P C;  1E4E A;  2DMX A;  3N2G A;  2HHF B;  3G6B A;  5KFU A;  1S9F A;  3L71 H;  3LSU A;  1W96 A;  3OR7 C;  1HR0 B;  2DW4 A;  2DLN A;  5D5Q A;  5EBW C;  2OYQ A;  2CNU A;  4C7U A;  3CRC A;  5KA5 A;  4MV1 A;  3KTM A;  2ZR3 A;  3LP8 A;  4X64 H;  1IXB A;  4AYB E;  2OT5 A;  3RWR D;  2EIJ B;  3CP1 A;  1B33 N;  1KJ9 A;  2WLN A;  3T1Y B;  3RF2 A;  1Q8I A;  2CW8 A;  2F23 A;  2DYR B;  4NLG A;  4G3I A;  1MOF A;  3UT5 B;  3UFX B;  3CCL V;  4YQW A;  1BXR A;  3GV7 B;  4LBE C;  1BGW A;  5JQG B;  5KT5 A;  2QTS A;  2H94 A;  3AK2 A;  3UO2 A;  3T1Y O;  3LSS A;  1KU9 A;  3K08 A;  1TWF A;  4TV9 F;  2V4R A;  2Z0A A;  4ABM A;  5KUK A;  4J9L A;  1K83 A;  4B3R H;  1PV0 A;  2X6A A;  2ZR2 A;  3S3X A;  2YRX A;  3G8D A;  4DR3 H;  1RJP A;  5JQW A;  1CKN A;  2QWP B;  4OPA A;  5BWX A;  3ASO B;  1M4U A;  2BOB C;  1SFO A;  1I1M A;  3G6E V;  4DW0 A;  5CA1 A;  3JZI A;  4X1K B;  2ZM6 O;  5KFY A;  2OWO A;  3UM7 A;  2R9A A;  1PL4 A;  1Q82 W;  2WLL B;  2XND G;  3FB7 C;  4DR5 H;  3FD9 A;  4DR4 O;  4NB5 A;  5CM0 A;  3HOY G;  5CMU A;  2R7L A;  5EOY A;  1TUE B;  2IM9 A;  1H2N A;  5TIS Z;  4FZ0 A;  3ZJZ A;  3K04 A;  4ECR A;  1S97 A;  4MVM A;  2JA7 G;  2HGX A;  1RJQ A;  4YHH H;  3SJQ C;  2JVD A;  4ZOL A;  5KFP A;  3JAW B;  2Q7H A;  4RAI A;  3TII A;  2C00 A;  1N34 O;  1XMQ B;  4EGQ A;  2OCC B;  3SYO A;  3BEH A;  3TK1 A;  3ML0 A;  5K2M A;  1S0M A;  4PA6 A;  5LYJ F;  1XNQ H;  1T5E A;  2UUA H;  1G8M A;  3KKY A;  3TGU H;  4KFM A;  4X9Q A;  5B1B C;  3HKD B;  5J2T F;  2JEG A;  4NR1 A;  5IJ0 B;  4EEY A;  4CBC A;  1HDJ A;  3PO2 G;  4DR6 O;  1VQL V;  3BHP A;  2FB9 A;  2SCU B;  4A3B G;  4J9Y B;  1KC8 W;  1VQ5 V;  4LC1 A;  3AX6 A;  4TM5 A;  2V5A A;  4B08 A;  4DV5 O;  5IP9 G;  4PI0 A;  1SEI A;  1EKF A;  3TY9 A;  4J9P A;  1YCI A;  3F5W C;  4GX1 A;  4OGQ B;  1GYF A;  4C5A A;  3ETE A;  2DJV A;  3RGZ A;  5B3S C;  3SDL A;  2Y48 A;  5KAF Z;  5H6R A;  3VOU A;  1S0O A;  4PDL A;  1XNR H;  4BIZ A;  4PDB A;  3RYI A;  5KHK A;  1N33 B;  4Q43 A;  1O9H A;  4J7K A;  4JYA O;  4K6N A;  3N2K B;  1MZF A;  1Y74 A;  4FMT A;  4L87 A;  3TXS A;  2BTQ B;  4LP8 A;  4NTW A;  1FS0 G;  3RJ0 A;  5LHH A;  3M9N B;  2W6I G;  2NU9 B;  2RGR A;  2OH2 A;  1S76 D;  4LNU B;  2QKA A;  2F93 B;  2QM8 A;  3KCY A;  3CWB H;  2ITC C;  4JPR A;  2UUA O;  1V55 B;  5LHG A;  4ECW A;  3HKB B;  1NT2 B;  5LMN H;  2WLJ A;  5KFW A;  2Q4P A;  3ORQ A;  5KFE A;  5CAE B;  2WLK A;  2NLJ C;  1JX9 A;  1H2L A;  3VPD A;  1MMM A;  1SET A;  4EB6 A;  2F43 G;  3CCQ V;  4OPH A;  1XL6 A;  3CX5 F;  4DR4 B;  2AQ4 A;  2KG7 A;  3K79 A;  5KFT A;  1WPX A;  1K9M W;  2CTW A;  1T36 A;  2R8I A;  4QE7 A;  5LMU H;  5L1J A;  3LNM B;  4FM2 A;  2PZS A;  2Y4T A;  2WSS G;  1IOV A;  1AJP A;  4TUY F;  4J9R A;  3THO A;  2FP4 B;  4FK5 C;  5KFF A;  1VQ9 V;  4LFC O;  1SS3 A;  3T9C A;  4IRD A;  2CKZ B;  4GKJ B;  3MWD A;  3LUL A;  1NH2 B;  2YZN A;  2R84 A;  3DF7 A;  1HWY A;  2L35 A;  3APO A;  5J2U A;  5KX5 A;  4IIJ F;  4DK1 A;  1GO3 F;  1DV1 A;  2ZIO A;  3OUU A;  1E4G T;  1A9X A;  1KP2 A;  3T5J A;  2RCV A;  5LXT A;  4DV6 O;  3JRX A;  4YJ3 F;  4LF4 H;  4MV8 A;  4JI4 O;  3K0G A;  3K3W A;  2XAJ A;  5KHI A;  2HJD A;  3O65 A;  4A3G G;  3RYF A;  3CJH A;  2V58 A;  4IHJ F;  1Z5W A;  1YVW A;  3QVN A;  1XMQ O;  1KBL A;  4MTX A;  1IYE A;  4JV5 H;  2Q7D A;  3V4Z A;  3PR4 A;  1YJW V;  4LFC B;  3MR2 A;  4GLX A;  2PYL A;  3W7T A;  2ETN A;  4DIM A;  1VS0 A;  4WBN A;  1WR2 A;  4J7J A;  1UNN C;  3GB7 C;  4DV7 O;  3QG5 A;  3QNE A;  3ZRX A;  1AR1 B;  2A7W A;  5B1N A;  4XDK A;  3E8G A;  3JZ6 A;  4A3K G;  4J9O A;  1JXL A;  2GUZ A;  1HW7 A;  5LP6 C;  1IYD A;  2W71 A;  1IUR A;  5IJ9 B;  3Q8P B;  2RNB A;  2W9B B;  2XD4 A;  1SZT A;  4QPK A;  4YY3 O;  4CZZ A;  4QE9 A;  1OBD A;  1O75 A;  3ZHU A;  1L8D A;  2ILM A;  4RO2 A;  4WHX A;  4ZI7 A;  4WCE V;  3Q8S B;  1XMO H;  3AK1 A;  3H9V A;  2UVV A;  4QJF A;  1BT8 A;  4DXW A;  3RFR A;  1K97 A;  2HJW A;  3A0H Z;  4OXS A;  4APM A;  4J0M A;  1GTO A;  1AR5 A;  5E79 Z;  3MHH C;  2VA2 A;  3HPL C;  1AJN A;  4MV9 A;  5K1X A;  3CXH F;  5ITZ A;  4O7V A;  2ASD A;  2ZM6 H;  3CRA A;  2PGG A;  3H1H H;  3CCM V;  1I1L A;  4AQY B;  2UUB H;  2UVW A;  5CBH A;  4B3R B;  2VUM G;  1HR0 H;  2QTO A;  2KKW A;  4O81 A;  4O2B A;  2PMZ E;  4DAA A;  3SJA C;  3FAV B;  1JX4 A;  1F51 A;  1XNQ O;  1JFF B;  5KG7 A;  3D3I A;  1PP9 H;  1B6Q A;  4IR9 A;  1FAF A;  2X6C A;  3N42 B;  3HT5 A;  5KFK A;  2J6U A;  1JR9 A;  2YL2 A;  3M9O B;  1GO3 E;  1XBL A;  4MTG A;  5I5X A;  1I6U A;  1H2S B;  1VEW A;  2HVS A;  4G2K A;  4DL7 A;  3ICX A;  2JA6 A;  1TAE A;  4EG0 A;  3VQY A;  1DTO A;  2E74 B;  4QGP A;  1W2B U;  3LQS A;  1B3Q A;  3NBZ B;  4RAY A;  1RPR A;  4U7C A;  2NVY A;  2B1I A;  3O9O A;  5KFX A;  1XMO B;  4PA3 A;  4TV9 B;  4KHP O;  2QEX V;  4HR7 A;  4R8U A;  4DR7 H;  2E5L H;  2YZG A;  4MV3 A;  3TY8 A;  1ZET A;  1IZ3 A;  5B5E Z;  4XZ3 B;  4O4I F;  3J81 N;  3L2P A;  2AHY A;  2E75 B;  4YJ2 F;  5LMU O;  1GM7 A;  3GTJ A;  1J5E O;  1KUT A;  1AB3 A;  4GX2 A;  5BY1 A;  2BOC C;  4ECT A;  1AR4 A;  2W6Q A;  4UXN A;  4O3O A;  1N34 B;  1EZJ A;  4DV1 H;  3L4J A;  1F4M A;  3GII A;  4X62 B;  3CHX A;  2UU9 B;  3G80 A;  4TUY B;  2W70 A;  3ZIA G;  2HJF C;  3IG0 A;  3N41 B;  4DUY H;  1CKO A;  1WNS A;  5FNV B;  4QWB A;  1WCM G;  4JI8 B;  2QWQ B;  3CC4 V;  4Q4D A;  3QQM A;  2R6F A;  4DUZ H;  4LF7 H;  4GUN A;  4TQS A;  2P6J A;  2UUB O;  1KC7 A;  4YJ3 B;  4JZ2 A;  5CA3 A;  5KT4 A;  3U0G A;  1RJR A;  3K5O A;  3N40 P;  1VKZ A;  4G27 B;  2ZDI C;  4Q45 A;  3APQ A;  2EIM B;  1LUV A;  4NVP A;  3C0F B;  1P4R A;  2IH1 C;  3JAM N;  3RAQ A;  5LP6 A;  3PW7 A;  4QW8 A;  3M4I A;  4DRF A;  4CH6 A;  3PFF A;  1XUQ A;  3K3P A;  4O2A F;  3H3V H;  2EJR A;  4JV5 B;  1M0T A;  3T1C A;  2EIY A;  1GAX A;  2VRZ A;  1XI1 A;  2R82 A;  4CS3 A;  5BWU A;  1HNZ H;  1BQZ A;  4IR1 A;  5J9P C;  4EFB A;  1M6V A;  1NVP D;  4DV4 H;  3PJS K;  2VQF B;  2LFS A;  5JCO C;  1LR1 A;  3H40 A;  2ZKO A;  3UO3 A;  1ZL8 A;  2BTQ A;  1QVG U;  4DK0 A;  1AUV A;  4DR3 O;  3W7X A;  4EKW A;  3J80 W;  1R6K A;  2DQ3 A;  4E4E A;  5L3D A;  5KS8 A;  4FLX A;  1HP8 A;  4LF5 H;  2K1E A;  2WE6 A;  1E79 G;  4U7N A;  3RB6 A;  4RCN A;  4LWS B;  1QLN A;  3RB3 A;  1KKC A;  1NI8 A;  1PPJ H;  1BHA A;  3GVM A;  4B3T H;  1VF6 A;  3AG1 B;  4UVA A;  1Y14 B;  4RUF A;  5JWP A;  2P4K A;  1TWC A;  5LOV B;  2DWE C;  3E8H A;  1H38 A;  3LDD A;  5KFO A;  2WYO A;  3QZ8 A;  5D1P A;  4UFZ A;  3OFN G;  1XDN A;  4X65 B;  2CK3 G;  4O86 A;  4O4J F;  4GKK H;  4C2M A;  4MV6 A;  2R93 G;  2N74 A;  3G6X A;  1M9N A;  3TEK A;  3I4M G;  3KZI Z;  1F4N A;  2DIK A;  2C2E A;  2GPW A;  4O7L A;  4LF7 O;  3H0G G;  4UVC A;  1K4D C;  3FAV A;  5H5N A;  1VQK V;  3AG3 C;  4O7Y A;  1HNZ O;  2YXY A;  1Y1W A;  1Q6U A;  4I7Z B;  4JTA B;  1GH6 A;  1SQB H;  2M7W A;  3BPZ A;  3DGE A;  4PDV A;  2HLD G;  4I50 F;  3JRW A;  1PM9 A;  5BMV F;  4JTD B;  3HKE A;  4WFH A;  4Z2W A;  2PI4 A;  1Y76 A;  1E1R G;  3QFF A;  5IYZ B;  4B3T B;  3IGA C;  3IC7 A;  5HBR B;  5IY5 B;  1K4C C;  2HKO A;  2N04 A;  5BWT A;  4DV5 B;  1RFY A;  4MTO A;  2JGU A;  2W0X A;  5KFZ A;  5GTI Z;  2COG A;  4QWC A;  1PL0 A;  5BR8 O;  4ETS A;  1XEQ A;  1HNX H;  2EIL C;  4IGG A;  5HFM A;  2V1D A;  5DIS C;  3CRM A;  3CCR V;  1XQ8 A;  2FK2 A;  1FYJ A;  2JGD B;  3CCJ V;  1FVI A;  1EBO A;  4HQ6 A;  1P7G A;  3PW0 A;  1S72 V;  3CCE V;  3I55 V;  3PW2 A;  1Q7Y W;  1Z2G A;  4J7Z A;  3GQC A;  1IBL B;  1KT8 A;  4HN2 A;  4JAU A;  3M7M X;  1S10 A;  4X1I B;  1XIL A;  3ABL B;  3BCC H;  2HGS A;  1ORQ C;  4JI8 H;  3RTX A;  1JOY A;  5F9N A;  2RDC A;  4F4Z A;  2A0L A;  2MK3 A;  3TCU A;  3BQ1 A;  2FB5 A;  4P2Z A;  1WH2 A;  2P06 A;  1NKD A;  4FLZ A;  2ZNI A;  1Y1W G;  4IYI A;  1OCO C;  1GSO A;  2FMA A;  2QWO B;  4U3J B;  3MFH A;  4A3I G;  3ZX6 A;  3JCZ A;  4CKE A;  4J42 A;  2E2I A;  5KG3 A;  4O4H B;  3T9E A;  4LF6 H;  1SKV A;  1J5E B;  1SCU B;  3T2M A;  2YRW A;  3HKC A;  4NKG B;  3ZS8 C;  2EBO A;  4L8J A;  3ZBH A;  1SRY A;  3QWU A;  3N44 B;  2Q0O C;  4ED8 A;  4LFA B;  3OGC C;  1IBK O;  3U54 A;  1B6S A;  2CGO A;  2J9G A;  3HXL A;  5CA1 F;  1NH2 D;  2QKS A;  3CC2 V;  3OEE G;  1A0G A;  3DXR A;  3FYE B;  4EB6 B;  3IN5 A;  2JA6 G;  4J80 A;  1K7D A;  2V4Q A;  3HKE B;  2W6Z A;  1GRJ A;  2Z3Y A;  3E8B A;  3MWM A;  2CFM A;  4FFL A;  1K1S A;  4LF8 O;  4JI6 B;  5C93 A;  4YP3 A;  1RK6 A;  5CA1 B;  2YDE A;  3SYC A;  1AN7 A;  1YIJ V;  4JV0 A;  3RIZ A;  5D1O B;  1THZ A;  1WP8 A;  5BR8 H;  3T1Y H;  2R85 A;  1Y67 A;  1L2Z A;  5FPR A;  2LO1 A;  2Q8V A;  3TY5 A;  4J9K A;  3L74 H;  4DV3 B;  5CA0 B;  3UZO A;  5KFJ A;  4Q44 A;  4JYA H;  2PTM A;  2EIK C;  1XL4 A;  2FJZ A;  2R87 A;  3T1H B;  5FPO A;  5KFR A;  1LUW A;  2ADP A;  4DV3 H;  1ZX3 A;  3JAL A;  2RDJ A;  3NR7 A;  3U0Z A;  1N0N A;  2ITD C;  4BIU A;  3Q4H B;  1QHT A;  3HO8 A;  4PJ0 Z;  1YJ9 V;  4ME6 A;  1RM1 B;  2UXB O;  1VIB A;  3T4D A;  3RVZ A;  4YR0 A;  3JD2 A;  5L1L A;  4JUZ A;  4YR2 A;  3NXS A;  3QO8 A;  5L9X A;  5CB4 B;  3K5L A;  1BQ0 A;  2ASJ A;  1JVM A;  2KSD A;  3ZMU A;  4BR6 A;  5LMN O;  1SQF A;  1N33 O;  2XCL A;  4I50 B;  3GLK A;  1TWG A;  5BMV B;  3N8D A;  4GX0 A;  4FFP A;  3T9D A;  1CPY A;  3U10 A;  4FM1 A;  4MS2 A;  4ICG A;  1I94 H;  1S03 G;  2EJ3 A;  4PV1 B;  1VBG A;  1D5N A;  1N36 B;  3S3W A;  1MSD A;  4ED2 A;  3QO5 A;  4U3F H;  2R92 G;  4K8Z A;  4X20 B;  1IBM H;  3KYH C;  4MVU A;  4JI4 H;  4U7O A;  4JYB A;  2ZD9 A;  2HR3 A;  4DV4 O;  4LF6 B;  4XDL A;  4B3T O;  3H4D A;  3SPI A;  1CQJ B;  1QR9 A;  5FLM G;  3TQT A;  5IE9 A;  4HNA A;  1OCC B;  3ABT A;  4FLW A;  1GK9 A;  5L1K A;  3L70 H;  3HR0 A;  3AYH B;  5DAA A;  5BXZ A;  3BFR A;  4LF5 O;  4GKK O;  3T9F A;  3V4S A;  4EBC A;  1ZWI C;  1LNQ A;  3RBZ A;  5LP6 B;  2Q0A A;  3H4B A;  5LYJ B;  1Y1V G;  4U6P A;  1GKF A;  1WN7 A;  4WFA V;  2HVR A;  1EFR G;  3LSQ A;  4UB6 Z;  4NZN A;  4D6T H;  3U9T A;  2F95 B;  2JS5 A;  4F6R A;  4UB8 Z;  4HZ3 A;  4DL5 A;  2R9I A;  4GKJ O;  3HOX G;  1AI5 A;  4X66 B;  2YS8 A;  2A1H A;  2W9C A;  5HNE A;  3JZF A;  1GN6 A;  3QF7 A;  3P3N A;  3TIN A;  4M9U A;  2Z02 A;  5CB4 A;  5HFL A;  5KMG A;  2W6J G;  2UVU A;  3MAQ A;  1Y4M A;  3N6X A;  5EWF A;  2G38 A;  3W7U A;  4YY3 B;  1IBM B;  3VPB A;  4CH5 A;  2LQT A;  3ETQ A;  3Q4H A;  1AI6 A;  1SQP H;  2FML A;  4P9O A;  4QIW E;  1KYO F;  5DG8 A;  3CC7 V;  3GWK C;  1EN5 A;  1P7B A;  3K0D A;  4TV8 A;  4LFB O;  4GLW A;  1M57 C;  1QU7 A;  3STZ C;  3B8M A;  2FPG B;  5FL7 G;  2R86 A;  4K0K H;  4RNO A;  5KKN B;  2QDO A;  2BSK A;  3VQX A;  1HNW H;  2PVP A;  2WB1 E;  4H33 A;  1EZV H;  2CUG A;  3T9B A;  5L1I A;  1PNK A;  2EZP A;  4LF4 O;  4DV6 H;  3OW2 U;  4IHJ A;  5D1O A;  1Z2O X;  2ZT9 B;  5JH7 B;  3CSX A;  4TV9 A;  3CS5 A;  3R5H A;  3GTO A;  5FLX W;  3TJT A;  2DAB A;  4O7S A;  3SPG A;  2B63 A;  3GTL A;  4F6E A;  3WU2 Z;  2Y4R A;  2CAZ C;  2Z04 A;  3BA8 A;  1NS1 A;  3E8F A;  4TSF G;  1ZAU A;  2GTS A;  2LJ2 A;  1ZL8 B;  2EJ0 A;  4LH6 A;  2DQ0 A;  3GIL A;  3CPW U;  5BR8 B;  2DYS B;  3KHL A;  4BIO A;  2YXL A;  5C8Y A;  3OUZ A;  3HOW G;  1VQM V;  1IXM A;  2F1M A;  2QM4 A;  2X0S A;  3N6R A;  4YB8 B;  2YS7 A;  1C30 A;  4GKK B;  4X65 H;  1SES A;  2ABJ A;  1J95 A;  2W8L A;  3F7Y C;  3MWE A;  2UUB B;  2BE3 A;  3GTQ A;  4MVO A;  4LF8 H;  1SQV H;  2EUL A;  5DM6 V;  4DR6 B;  4F4X A;  2BSK B;  3VBB A;  2JDI G;  3ABU A;  5DEC A;  3KAL A;  1CEZ A;  2VWJ A;  4YJ2 B;  2VUG A;  1XNQ B;  5KFC A;  4DRX A;  4JI0 B;  1IX9 A;  4DR2 O;  4QWD A;  1VQP V;  1YZB A;  2BQU A;  4MV7 A;  2QJ1 A;  4Q8F A;  4RUA A;  3SR2 C;  1CP9 A;  2OTL V;  3CQZ A;  1A48 A;  3GTP A;  2W9B A;  1K5S A;  4QSH A;  5KFN A;  3ASN C;  2ZDI A;  4RZR A;  2HG8 A;  2XC9 A;  2YUA A;  2PBZ A;  3RB4 A;  4O3S A;  1QR8 A;  5H9C A;  3FMA A;  4BWA A;  4JI7 B;  3VA7 A;  2RGV A;  1N48 A;  5KG2 A;  5LA6 A;  1X4T A;  4IL6 Z;  1BCC H;  4X66 H;  2JEI A;  2X6B A;  3TQ1 A;  1OCC C;  3U11 A;  2UXC H;  5KFL A;  1S5L Z;  4B3S O;  3L75 H;  4Q8E A;  4FFM A;  4QPJ A;  4O7Z A;  1D2D A;  3DTF A;  1P84 F;  2WAQ A;  3UCS C;  1XMQ H;  5DG7 A;  3WO0 A;  3WO1 A;  3PR5 B;  3AEI A;  1P16 A;  2ATK C;  5GW7 A;  2FLP A;  3RB0 A;  4DR3 B;  2QM7 A;  2CW7 A;  1S68 A;  3P30 A;  1Q43 A;  3WWI A;  4RQF A;  4KL1 A;  3OD4 A;  1I7L A;  3Q8R B;  4LF9 B;  1N32 O;  1BSM A;  2EZO A;  4B3M H;  4TQR A;  3IFX A;  4JYY A;  4G28 B;  1HNX B;  1K34 A;  1JIH A;  4LSX A;  3ZHS A;  4JI4 B;  2ZQM A;  4EYH B;  4FFB B;  4JV2 A;  4MA0 A;  1MZE A;  1JJO A;  5CE8 A;  1I1K A;  4QWA A;  2IU3 A;  4JV5 O;  4A3E G;  1AP6 A;  1E1Q G;  3VMM A;  3BRC A;  3QO7 A;  4O2A A;  4XBF A;  4A3L G;  1KP3 A;  3ASN B;  1YF2 A;  4FVM A;  3CMA V;  1G1X B;  5BMV A;  3BQ0 A;  1QCE A;  5L3C A;  1R73 A;  1DGS A;  4LFA O;  3ZED A;  2F4V B;  3E83 A;  1M5I A;  3BAB A;  1EKP A;  1FJG H;  3RVY A;  1BS3 A;  2D2C B;  2ADQ B;  1PNM A;  5EK0 A;  1W93 A;  2UUC H;  1QVF U;  3G67 A;  2Q2U A;  3JD1 A;  2ARH A;  5I60 A;  2YI8 A;  3DSQ A;  3R66 A;  1PD3 A;  5C8Y F;  2VWK A;  2ZJT A;  2NU8 B;  2XOK G;  2JJ1 G;  4UCS A;  5EC1 C;  1JLL B;  4TT3 G;  2DZD A;  5LOV A;  3MR5 A;  2DE0 X;  1MA1 A;  3ZMS A;  2C35 B;  4X1Y B;  4IWX A;  5EYP B;  1UJW B;  2DYS C;  1ZHQ A;  3E22 A;  3OR6 C;  5CA0 F;  5JJJ B;  4PWQ A;  4QIW F;  3LML A;  2B9Z A;  4JI5 B;  2R9R B;  5EYP A;  1IBL O;  2VOB A;  1V54 C;  2NUA B;  1V4Y A;  2QE7 G;  2RF4 A;  2JEJ A;  4WBN F;  1BGY H;  5FNV F;  4PA4 A;  5JQG F;  1RSO B;  2QA4 V;  1T94 A;  2JA5 G;  2CZG A;  3TW7 A;  2OCH A;  4X88 A;  5KT7 A;  3I4N G;  1K33 A;  4CE5 A;  4O7R A;  3K5M A;  4TWK A;  4NZO A;  5GTH Z;  3NC0 B;  1SF9 A;  2W7O A;  5IYD G;  1ULZ A;  1GSA A;  2JK5 C;  3X2Q B;  4KP4 A;  3F7V C;  3RGB A;  1WP7 A;  1IVS A;  4FFO A;  5GON A;  4AHC A;  1W0K G;  1FPO A;  1M7J A;  1M57 B;  4MT8 A;  5DLG A;  1E4F T;  3ABL C;  2ZE8 A;  5CR5 A;  4JTC B;  4N21 A;  1VF7 A;  3FB5 C;  5KHH A;  3GID A;  4NYE A;  3FKI A;  2OTJ V;  3BQ2 A;  5FNV A;  1NJI W;  2E2H A;  2IJK A;  4AYB A;  2ZE7 A;  3LDC A;  2AU0 A;  1Q3E A;  4UVB A;  2YS6 A;  4YAK B;  4BW5 A;  2ATL A;  1FKA H;  1I7F A;  2DPI A;  4RUE A;  1I5X A;  3M9M B;  1EN6 A;  2YC0 A;  2BCC H;  3GB8 B;  3D36 C;  4I0X A;  2XCP A;  2GDS A;  5FD6 A;  3AG2 C;  3I5D A;  5E1A C;  4IT5 A;  2EIL B;  4YR3 A;  2AW9 A;  2UXC B;  2HP8 A;  2WDT A;  1OCR C;  4J9Z B;  4WFF A;  3C3S A;  1M0W A;  3CEI A;  3T99 A;  1OCZ C;  5B1A B;  3TET A;  1PX2 A;  3R23 A;  5FR9 A;  4ED3 A;  5KUM A;  4BWS C;  3HKB A;  1VQ4 V;  1Q86 W;  4MAM A;  3N43 B;  3AG4 B;  4UCO A;  3ORR A;  5KFM A;  5IYB G;  4X20 A;  4B7E A;  4CS2 A;  4UV8 A;  2EJ2 A;  2ZIM A;  4X1Y A;  1TWH A;  4ED6 A;  3HOU G;  3DAA A;  2M6Y A;  4PBC A;  4O3R A;  3P3P A;  2YYA A;  2ZXW B;  4PA7 A;  1GN4 A;  3I56 V;  5JH7 F;  3AW8 A;  4IWY A;  3S24 A;  1QLE B;  4HBN A;  4JXU A;  4O83 A;  3EPG A;  3AG3 B;  1IBK H;  5LGT A;  3ABK B;  4JI3 B;  4O7N A;  2Q73 A;  5JQG A;  3OSP A;  1Y76 B;  5KHJ A;  1GLV A;  4ZHQ F;  3CB2 A;  4ECX A;  1VBH A;  1K3E A;  1W59 A;  2FK1 A;  4CKB A;  2R8H A;  1FFX A;  3MDS A;  4UCR A;  2WPD G;  1KEC A;  3STL C;  5BWR A;  3ZCC A;  4EBD A;  4OX9 B;  1RYS A;  3FB6 C;  2AGA A;  1T3N A;  3EVK A;  2QYZ A;  3PO3 G;  1DV2 A;  4F4W A;  4OX9 O;  4JI2 B;  5DQI A;  5C8Y B;  3CD6 V;  4R8C A;  3WNZ A;  5IYD O;  3PN1 A;  2BR0 A;  3V6J A;  3FYI B;  1WA8 A;  1VQ7 V;  1YXB A;  1DAA A;  4NXN H;  2W6M A;  2Q69 A;  3GTM A;  5DG9 A;  4ZI7 B;  1AVM A;  2HHH O;  4DL3 A;  2CTQ A;  1VAJ A;  4HYK A;  2HIX A;  2R7N A;  2R7Z G;  4FJC C;  1BE3 H;  1BZK A;  2P0A A;  5ITZ B;  4QW9 A;  3RBE A;  2EIK B;  3SGI A;  2Y4U A;  3CRQ A;  1FFX B;  5DQH A;  1KJJ A;  5KFS A;  2CNV A;  2XGP A;  1L1F A;  5IWA O;  1KB9 F;  1HNW B;  4ECU A;  3K58 A;  2AHZ A;  3BJY A;  1BHB A;  4C5C A;  4JI3 H;  5KFB A;  1PKX A;  2R7Z A;  4LH7 A;  4GZR B;  4WBN B;  4RU9 A;  1R3L C;  4H37 A;  3EHB B;  3J7A U;  2YIC A;  1FXH A;  1GN3 A;  1Y6X A;  4JI5 O;  1P49 A;  2VQE H;  2EIN B;  4FLY A;  5DGI A;  4YY3 H;  2R7K A;  2GUZ B;  4IYH A;  3OGI B;  5FLX N;  1OHH G;  2KQX A;  3MD0 A;  1Q81 W;  4IHJ B;  4ECZ A;  1BNC A;  4X1K A;  3GV8 B;  4JI0 O;  5KX5 B;  5KMG B;  1YTF D;  3UZB A;  1XHZ A;  2RN9 A;  2AGQ A;  4J41 A;  4EYI B;  3N27 A;  4MTD A;  2C28 A;  2GHY A;  4X64 O;  2CTP A;  4K3A A;  2IBK A;  1X59 A;  1VQ8 V;  1XHX A;  2NNU A;  4ASU G;  1TVK A;  3UKM A;  4DV0 H;  4O4H F;  1K5Q A;  4R50 A;  5T14 A;  4ECS A;  4FLV A;  2QB5 A;  4K35 A;  4GT1 A;  3T5H A;  2P22 C;  4RB3 C;  4MVZ A;  1K73 W;  2B1G A;  3LWB A;  5JCO A;  3U55 A;  1SC5 B;  3CYO A;  4JI0 H;  4IAJ A;  3KCX A;  2COJ A;  4B7K A;  1QBZ A;  1C3O A;  2V59 A;  3GIQ A;  3JAW A;  1WB8 A;  4CMD A;  4N23 A;  5DED A;  5EZY B;  4YHH O;  3T9A A;  3WWH A;  4Q0Y A;  5BPH A;  1YHQ V;  3WWJ A;  2WAQ E;  4KUM A;  5LYJ A;  1WCM A;  4DV0 O;  4PDM A;  3VQW A;  2ZDG A;  1EKV A;  4X89 A;  3CVZ A;  5LL6 b;  4JYC A;  5DLF A;  1VF6 C;  5LGU A;  3BY6 A;  3KHH A;  4LR3 A;  5EC2 C;  5BYB A;  2Z5U A;  3N2K A;  2VA3 A;  3H0G A;  2WLH A;  2XIG A;  4HNA B;  2FK3 A;  3RYI B;  5LOV F;  4A2A A;  3OE7 G;  4XDJ A;  4ED7 A;  3SJC C;  4DUZ O;  1GSH A;  2VQE O;  2WAM A;  3E22 B;  5IY5 C;  3RW0 A;  1ZSP A;  4LNU A;  5I5W A;  3R5X A;  4CH3 A;  4FU0 A;  5KFA A;  4EQ5 A;  4P9P A;  2XAS A;  4GC6 A;  2IMW P;  4MVR A;  2FLN A;  3JAL B;  3Q1K A;  2Y0S E;  4DR1 B;  4DV7 B;  5EIB D;  3PVX A;  4DRX B;  3TW6 A;  3G4S V;  3MJF A;  4JI7 O;  4I55 F;  4ZI7 F;  5FJ8 G;  5I5U A;  4E4T A;  3RBD A;  3CXC U;  5FD5 A;  2XHB A;  5H80 A;  4ZKI A;  3OTF A;  2I87 A;  2FKX A;  3OUF A;  4K0K B;  4DR5 O;  1FJG B;  3W1B A;  3ABK C;  4MSW C;  2ZCE A;  3RGX A;  4BAY A;  4DV6 B;  1RPO A;  2QKC A;  4TQF A;  4JI2 H;  2C2A A;  2GBO A;  2Y0P A;  1EZ1 A;  3HBL A;  2W57 A;  1I0H A;  4Q6G A;  4YIO A;  2QF7 A;  2A79 B;  1WLE A;  1JCH A;  1U96 A;  2VUM A;  4DV1 O;  5IYC G;  3CCV V;  4F4Y A;  4OX9 H;  2JIZ G;  3N2G B;  1OCZ B;  3V6K A;  2YXH A;  2JRI A;  3NBY B;  3RYC A;  1H2M A;  4DV4 B;  4LF6 O;  2ZNJ A;  4AI8 A;  3E2E A;  3MHS C;  1Q90 D;  2Q67 A;  1OCR B;  4A3D G;  4DL4 A;  3GIK A;  4NXM O;  1HR0 O;  1Z2N X;  1WB7 A;  1NTZ H;  5B1O A;  2HVK C;  1B06 A;  4O4H A;  1YJN V;  4BW9 A;  3K59 A;  3EPI A;  1TUB A;  2R70 A;  1NQT A;  1OJH A;  4UCV A;  1N56 A;  1OV9 A;  3JAT B;  2NR5 A;  4BXX G;  5LBQ A;  4FE2 A;  2YIB A;  4PDR A;  3ZHT A;  1WAZ A;  1KQS U;  2ZDQ A;  3RV4 A;  1YSC A;  5BWV A;  2CH7 A;  3ZRS A;  2W7P A;  2AXT Z;  3DC5 A;  4YAJ B;  3HB9 A;  1ZUQ A;  3HB3 B;  2Q68 A;  4B3S H;  4NXN O;  1ENV A;  1EHI A;  4TV8 B;  4QWE A;  3DTU B;  1H8H G;  3RYF B;  3CJH B;  3ZRW A;  3JD3 A;  3P32 A;  4BY1 G;  4PZ7 A;  2P5O A;  2Q5Z A;  4CC5 A;  4LF4 B;  3WG7 B;  2C2R A;  5BZB A;  5AG2 A;  1UPG A;  3KAJ A;  5KLV H;  1K92 A;  2EIM C;  4NTX A;  2E5L O;  2CQY A;  3BAC A;  4RUC A;  3RT3 C;  2DWC A;  2QWR B;  1JDB B;  2W9C B;  4I9W A;  4KXR A;  2VPQ A;  2IA6 A;  3ABM C;  1D5A A;  1VMG A;  2UU9 H;  2WWW A;  1U97 A;  1N36 H;  2K9P A;  3GDE A;  2LW1 A;  2PMZ A;  1I5Y A;  5JVD F;  4JV1 A;  2JEX A;  3JAR A;  1V54 B;  5KFV A;  3A0B Z;  4CHI A;  4HYO A;  4JI5 H;  4X1I A;  1YTF B;  1M93 A;  2CH7 B;  3W5O A;  1COW G;  4LFB H;  2FTK A;  5I5Y A;  2R72 A;  3IC9 A;  1VQO V;  4O3N A;  4MA5 A;  4RB2 C;  4DR4 H;  2JJ2 G;  4A3J G;  4DR6 H;  5IT9 W;  3EFF K;  5K3W A;  1KBH A;  4Z1V A;  5L3E A;  5KFD A;  3TIG A;  4I7H A;  2GQR A;  1RYR A;  5LHI A;  2R7M A;  1M56 C;  2HIV A;  2COI A;  3OM3 B;  1CXZ B;  5F2V O;  4RQE A;  2FLL A;  1MAB G;  1GM8 A;  1HNX O;  2CTR A;  3ZN1 A;  3JSN A;  4LF9 O;  1N32 B;  3LNN A;  3SNO A;  1F7Y A;  1I50 A;  4ED0 A;  3C3T A;  1EN4 A;  1WA8 B;  2HDK A;  3UQ8 A;  4DL2 A;  3C90 A;  4JI1 O;  2JA8 G;  4J11 A;  1I2L A;  1NR1 A;  5HV6 A;  2R93 A;  4O7T A;  1DLB A;  4M7E A;  3SYA A;  4I50 A;  3RFC A;  4FIP C;  4DR1 O;  3L4K A;  1XNR B;  3WFV A;  1DIK A;  3GIP A;  4ZHQ A;  1RK5 A;  3OAA G;  4DL6 A;  4DV7 H;  5JH7 A;  3U9S A;  3D8C A;  1VAR A;  2O57 A;  1GMG A;  4DQN A;  4A93 G;  3KHR A;  3T5L A;  3WB1 A;  4RNM A;  3SJB C;  2ALZ A;  1ET0 A;  3FFQ A;  5B1B B;  5A9G A;  2PF4 E;  5BWW A;  4Q20 A;  2UUC B;  3E89 A;  2AZ0 A;  1UFI A;  3K9S A;  4Z1M G;  1KTA A;  5JVL A;  2DWD C;  2OCC C;  3GIM A;  4PI2 A;  1TVK B;  1X9N A;  4J9N A;  3B40 A;  4KHP B;  5J2T A;  5A2Q N;  3OSN A;  1A32 A;  1I3Q A;  1US6 A;  4FBT A;  1ZTE A;  2HEP A;  3HKD A;  1IOW A;  5E25 A;  1YIT V;  5IJ9 A;  3D36 A;  3BAA A;  1FFT B;  3H1I H;  2UXD B;  3B77 A;  3ETJ A;  2UXB H;  2P67 A;  1VQN V;  2HFE C;  4DR2 B;  4EGJ A;  3EYY A;  5CBF A;  2FL4 A;  2V9W A;  3H20 A;  2CGN A;  3T1H O;  1S3J A;  4A3M G;  3H1K H;  1BJT A;  2UXX A;  2I8C A;  3R9R A;  4F6R B;  3RUP A;  2IJI A;  2Q6A A;  1KJI A;  3ZRW B;  3DXR B;  5LP6 F;  4E2L A;  2R8J A;  4JI7 H;  4IIJ B;  3K06 A;  3G71 V;  3WB0 A;  2MW2 B;  3BVO A;  4FZ1 A;  5IYC O;  4UCU A;  3ASO C;  3K5N A;  4LCU C;  5IYZ A;  5LL6 Y;  2HGW A;  5KFI A;  3KHG A;  3HKC B;  2PUS A;  5IP7 G;  3IJ4 A;  1TUB B;  4YJ3 A;  2P4V A;  1WJZ A;  2JEU A;  3G8C A;  4O82 A;  4IRC A;  4ZBM A;  4FBU A;  2C22 A;  5IDJ A;  2HVJ C;  2R92 A;  3PZP A;  2DYR C;  4TVI A;  3CCS V;  4CKC A;  1CKN B;  5JVD B;  1I94 O;  5KG5 A;  4DV5 H;  1IDS A;  3LUT B;  4JF3 A;  3K57 A;  4Y8V B;  4NZM A;  4E6N A;  5I5T A;  1TGO A;  3FDS A;  1H2G A;  4QNH B;  3GJX B;  3R5F A;  1DF5 A;  5C1P A;  3OTO B;  4ZIB A;  4ZQI A;  3ZMZ A;  2HVQ A;  4IZO A;  3K5I A;  2V7Q G;  5C4X G;  1G2W A;  3ZHV A;  4KHP H;  4DR7 O;  4R6Z A;  3AK3 A;  3NUA A;  2FKL A;  2Y0I A;  2JGD A;  1JA8 A;  4JI1 B;  1NTM H;  3CSW A;  4B3M O;  3F8N A;  5IWA B;  3EXA A;  4R8U B;  4I55 B;  1N32 H;  2ODM A;  1R6N A;  3KG2 A;  2R8G A;  3SPJ A;  3FX7 A;  1KEE A;  3BA9 A;  3BG5 A;  1Q6I A;  3E86 A;  3GTK A;  4I4T B;  4O4L B;  1CE8 A;  4JI6 O;  4BY7 G;  2IBZ H;  5EIB C;  4YBZ B;  4X8A A;  2A3Q A;  2XAQ A;  5JJE B;  3T54 A;  5KT6 A;  2CDY A;  4ECQ A;  4A2B A;  2W0F C;  1JDE A;  2JEF A;  3ETG A;  2LGW A;  5IYB O;  1V55 C;  1R3K C;  3SI8 A;  3FKS G;  1GM9 A;  2YU9 A;  4A3F G;  2ZDH A;  3OHA A;  1B04 A;  1AP5 A;  1I2K A;  1UC8 A;  4O84 A;  4O4J B;  2HHH H;  1TA8 A;  2W8K A;  4PZ6 A;  3W7W A;  4LF5 B;  3J81 W;  4FFR A;  3GWO A;  1KD1 W;  4R7C A;  1NU1 H;  4WFG A;  4C5B A;  2BQR A;  4MW8 A;  3K5H A;  1M56 B;  1SA0 B;  5DGA A;  3E5N A;  1NR7 A;  2EX3 A;  3K03 A;  4I0X B;  4RWU A;  5B3S B;  4QJF B;  5LGN A;  1R6T A;  2QSA A;  2C2D A;  5EZY A;  4JI3 O;  3E35 A;  3OHB A;  1M90 W;  2YEV B;  2R8K A;  1HNZ B;  4JGS A;  2VQD A;  2QR4 A;  4LFB B;  4O2B B;  2UUA B;  3OUS A;  3RR5 A;  1JPX A;  5H2F Z;  2WLI A;  2WLI B;  1I7N A;  4B3S B;  1S0V A;  1Q6H A;  2FPI B;  3SPC A;  4K8X A;  5GON B;  3RAX A;  4X65 O;  2W9A A;  1L0L H;  3K3V A;  1PK8 A;  2W6P A;  3ABM B;  4D7S A;  2V4D A;  4Q4C A;  1S5J A;  4YHH B;  2E76 B;  2XUM A;  3ETD A;  5I5S A;  2UXN A;  1SQG A;  2ODT X;  2Q7E A;  1AIL A;  4RAZ A;  1XMO O;  1MZB A;  1FXK A;  3WG7 C;  5GON F;  4MTE A;  1FKA O;  1SER A;  1V51 A;  2GQS A;  3PW4 A;  5JUM A;  1XK5 A;  1IBL H;  1EYZ A;  3JD0 A;  4NXM B;  1CS0 A;  4IRK A;  1XDC A;  5LA6 B;  2KB1 A;  2Q7G A;  3G6V A;  3T7A A;  2GPS A;  3L73 H;  2YIA A;  2IP4 A;  2A06 H; 
#chains in the Genus database with same CATH homology
 2RJZ A;  1SQF A;  1XNR H;  4I50 B;  4MTD A;  5BMV B;  2VPS A;  4DV1 B;  4PDB A;  3RYI A;  3U10 A;  5KHK A;  1XHX A;  1N33 B;  1O9H A;  1TVK A;  4FM1 A;  4DV0 H;  2E5L B;  3N2K B;  4CC6 A;  3JAK B;  1QQC A;  1I94 H;  1S03 G;  4CH4 A;  2BTQ B;  3RJ0 A;  4I4T A;  4O4L A;  2RGR A;  1N36 B;  4LNU B;  2F93 B;  4YJ2 A;  4FLV A;  4K8Z A;  4X20 B;  1IBM H;  5J2U B;  3KYH C;  2P22 C;  4RB3 C;  4JI4 H;  3HKB B;  1NT2 B;  5LMN H;  4LF6 B;  5JCO A;  1WPB A;  3T1H H;  4DR1 H;  2YCH A;  4GYC B;  4JI0 H;  4HNA A;  4EFE A;  5K1P A;  4IAJ A;  4ZHQ B;  5LMN B;  4FLW A;  4TOI A;  3JAW A;  5EZY B;  4EB6 A;  4Q0Y A;  4TUY A;  4DR4 B;  5LYJ A;  5LP6 B;  2Q0A A;  5LYJ B;  1V9P A;  3VQW A;  1WN7 A;  2HVR A;  3CVZ A;  1A0I A;  5LMU H;  5LL6 b;  2F4V H;  4FM2 A;  3VQV A;  2PZS A;  1N33 H;  4LR3 A;  2F95 B;  2JS5 A;  4F6R A;  3N2K A;  2ZM6 B;  3THO A;  2KSW A;  2XIG A;  4FFB A;  4HNA B;  5A2Q W;  4X66 B;  3RYI B;  3KXY T;  3QF7 A;  4GKJ B;  4A2A A;  3JAM W;  3SJC C;  5CB4 A;  4FLT A;  3DF7 A;  5KMG A;  5J2U A;  3E22 B;  5KX5 A;  4DK1 A;  4LFA H;  3MAQ A;  2ZIO A;  1E4G T;  4LNU A;  3N6X A;  4YY3 B;  1IBM B;  5LXT A;  4LF4 H;  4CH5 A;  3ETQ A;  2RQ6 A;  4CH3 A;  1CKM A;  1J5E H;  4EQ5 A;  3JAK A;  3OTO H;  5KHI A;  4JI1 H;  4UCT A;  3JAL B;  3IAY A;  4JI6 H;  4DR1 B;  3RYF A;  5EIB D;  4DV7 B;  1Z5W A;  4IIJ A;  4TV8 A;  4DRX B;  4LMY A;  4JV5 H;  4LFC B;  4DV2 H;  4GLX A;  3JAR B;  2PYL A;  2VQF H;  4CS4 A;  4K0K H;  1VS0 A;  4WBN A;  5FD5 A;  3VQX A;  2XHB A;  1HNW H;  2PYJ A;  3OTF A;  1JMK C;  4I55 A;  3QG5 A;  4K0K B;  4O4I B;  4DV6 H;  1JFF A;  1Z2P X;  4IHJ A;  1FJG B;  5D1O A;  3W1B A;  1Z2O X;  5JH7 B;  3CSX A;  2ZCE A;  4TV9 A;  1HW7 A;  3RGX A;  5LP6 C;  4DV6 B;  5FLX W;  4TQF A;  5IJ9 B;  4JI2 H;  2W57 A;  1SYX B;  4Q6G A;  2CAZ C;  1O75 A;  4LFC H;  3BA8 A;  1L8D A;  1ZHS A;  4B3M B;  4O2A B;  4LF9 H;  1YEW A;  1ZAU A;  4ZI7 A;  4OX9 H;  4LH6 A;  3QTC A;  1XMO H;  3N2G B;  3NBY B;  3RFR A;  3RYC A;  4J0M A;  4APM A;  4DV4 B;  2ZNJ A;  5BR8 B;  2YXL A;  5C8Y A;  4MV9 A;  5K1X A;  4LF7 B;  5ITZ A;  2F1M A;  2ZM6 H;  2QM4 A;  1Z2N X;  2PGG A;  3RYH B;  4AQY B;  2UUB H;  4B3R B;  4GKK B;  4X65 H;  1HR0 H;  4O4H A;  2KKW A;  4BW9 A;  3K59 A;  5LMU B;  4DV0 B;  4O2B A;  5KHG A;  3SJA C;  1TUB A;  2R70 A;  4O4J A;  2UUB B;  4LF8 H;  4UCV A;  1JFF B;  4O4I A;  4EEQ A;  3JAT B;  4FM9 A;  2YIB A;  4DR6 B;  3KAL A;  3N42 B;  1N34 H;  2VWJ A;  4YJ2 B;  4I9Q A;  2VUG A;  1SA0 A;  1XNQ B;  4B3S H;  4DR2 H;  1RSO A;  4TV8 B;  4DRX A;  2UXB B;  2UXD H;  5JJN B;  3RYF B;  4JI0 B;  1I6U A;  1H2S B;  2HVS A;  1G6U A;  4PZ7 A;  3ICX A;  2P5O A;  1TAE A;  4MV7 A;  4LSA A;  2QJ1 A;  1Q5O A;  3SR2 C;  4CC5 A;  5LXT B;  3VQY A;  4LF4 B;  3NBZ B;  4RAY A;  2HHH B;  2BTO A;  3KAJ A;  1XMO B;  4TV9 B;  4DUY H;  3FMA A;  4BWA A;  4JI7 B;  2RGV A;  4DR7 H;  2ZIN A;  2E5L H;  4X64 B;  5LA6 A;  1X4T A;  3TY8 A;  4PZ8 A;  1D5A A;  4X66 H;  4FM0 A;  2UU9 H;  1N36 H;  3U11 A;  3GDE A;  2UXC H;  3L2P A;  4LF8 B;  3JAR A;  4JI5 H;  2YI9 A;  4X1I A;  1M93 A;  1N34 B;  2Q2T A;  4DV1 H;  3W5O A;  5CA0 A;  3L4J A;  1XMQ H;  4LFB H;  1P8L A;  4X62 B;  3CHX A;  2R72 A;  4DR4 H;  2UU9 B;  4DR6 H;  4TUY B;  4RB2 C;  1P16 A;  5IT9 W;  5IJ0 A;  4NXN B;  3IG0 A;  4DR3 B;  2CW7 A;  4D7T A;  3N41 B;  4RB0 A;  1CKO A;  1S68 A;  1IBK B;  1WNS A;  5FNV B;  4RZQ A;  5IWA H;  3B2E E;  1Q43 A;  4I7H A;  5D5P A;  2HIV A;  4JI8 B;  4KL1 A;  4AQY H;  4LF9 B;  4B3M H;  4DUZ H;  1HNX B;  4LF7 H;  4RB1 A;  4LSX A;  4JI4 B;  4FFB B;  4YJ3 B;  1JJO A;  2F66 C;  4PHZ A;  3K5O A;  1N32 B;  3JSN A;  3N40 P;  3LNN A;  3BRC A;  5JVD A;  4NVP A;  3C0F B;  4O2A A;  3UQ8 A;  5LP6 A;  4FVM A;  3M4I A;  4DRF A;  4CH6 A;  5BMV A;  4M7E A;  4I50 A;  3L4K A;  1XNR B;  3KAK A;  1DGS A;  3JAS A;  3ZED A;  4ZHQ A;  4JV5 B;  2F4V B;  1M0T A;  4DV7 H;  5JH7 A;  1M5I A;  3BAB A;  1FJG H;  1XI1 A;  4U3J A;  3RYH A;  3WB1 A;  2UUC H;  3SJB C;  4CS3 A;  4NXM H;  1HNZ H;  2Q2U A;  1Z5V A;  3FFQ A;  4EFB A;  4DV4 H;  2YI8 A;  3DSQ A;  2UUC B;  2YIB D;  2VQF B;  3RYC B;  2VWK A;  5JCO C;  2ZJT A;  4DR5 B;  2MCT A;  4UCS A;  2BTQ A;  3W1G A;  4DK0 A;  5LOV A;  1O9G A;  4PI2 A;  1TVK B;  1X9N A;  3J80 W;  4KHP B;  5J2T A;  4FLX A;  4LF5 H;  1KMI Z;  2WE6 A;  2HEP A;  3HKD A;  4X1Y B;  5EYP B;  4AIL C;  3UT5 A;  4X62 H;  1ZHQ A;  3E22 A;  5IJ9 A;  5JJJ B;  3BAA A;  2UXD B;  2UXB H;  3EYY A;  4DR2 B;  2FE3 A;  3LML A;  3A2F A;  2O03 A;  4JI5 B;  3H20 A;  4B3T H;  5EYP A;  4GKJ H;  3JSL A;  2VOB A;  1BJT A;  5J2T B;  3J7A K;  2VQE B;  4FLU A;  4F6R B;  5LOV B;  4DUZ B;  2WYO A;  4DV2 B;  4ZOL B;  5D1P A;  3VNN A;  4UFZ A;  4DR7 B;  1XDN A;  4IIJ B;  4X65 B;  4JI7 H;  4GKK H;  3WB0 A;  3K5M A;  4DUY B;  3NC0 B;  4UCU A;  3K5N A;  4R7R A;  5IYZ A;  3JAT A;  3HKC B;  3RGB A;  2PUS A;  4TQD A;  2PY5 A;  1TUB B;  4YJ3 A;  2GV9 A;  5GON A;  4AHC A;  3JAS B;  1I94 B;  3WB2 A;  1E4F T;  4JYA B;  3BPZ A;  1VF7 A;  5KHH A;  5FNV A;  3HKE A;  1CKN B;  5JVD B;  1Q3E A;  2E3C A;  4DV5 H;  1FKA H;  3N2G A;  1I7F A;  5IYZ B;  4B3T B;  3K57 A;  3GB8 B;  4E6N A;  1TGO A;  3GJX B;  5FD6 A;  1HR0 B;  4DV5 B;  2JGU A;  5D5Q A;  2OYQ A;  3OTO B;  4ZIB A;  2UXC B;  2HVQ A;  2WDT A;  4ETS A;  1HNX H;  4KHP H;  4X64 H;  5DIS C;  1XQ8 A;  1M0W A;  3RWR D;  3F8N A;  4JI1 B;  1FVI A;  1N32 H;  5IWA B;  4I55 B;  4BWS C;  3HKB A;  3N43 B;  3T1Y B;  4UCO A;  3RF2 A;  1Q8I A;  2CW8 A;  4X20 A;  1IBL B;  4CS2 A;  3UT5 B;  2ZIM A;  3BA9 A;  3M7M X;  4X1Y A;  4X1I B;  1BGW A;  4I4T B;  4O4L B;  5JQG B;  2HGS A;  5EIB C;  4JI8 H;  3RTX A;  3S24 A;  1KU9 A;  4HBN A;  5JJE B;  1IBK H;  4B3R H;  4DR3 H;  4JI3 B;  4A2B A;  5JQG A;  5KHJ A;  3CB2 A;  1CKN A;  1WH2 A;  1M4U A;  4FLZ A;  2ZNI A;  1FFX A;  4UCR A;  5CA1 A;  1B04 A;  4X1K B;  4U3J B;  2OWO A;  4O4J B;  2R9A A;  4OX9 B;  2HHH H;  1TA8 A;  4PZ6 A;  4DR5 H;  4O4H B;  4LF6 H;  1SKV A;  1J5E B;  4LF5 B;  3J81 W;  3HKC A;  3ZS8 C;  4L8J A;  3N44 B;  3QWU A;  4JI2 B;  4LFA B;  1SA0 B;  5EOY A;  5C8Y B;  2IM9 A;  3PN1 A;  2EX3 A;  3HXL A;  4NXN H;  4YHH H;  2JVD A;  4ZOL A;  5EZY A;  4EB6 B;  3JAW B;  4ZI7 B;  2Q7H A;  1HNZ B;  3HKE B;  1XMQ B;  4LFB B;  4O2B B;  2HIX A;  2UUA B;  3RR5 A;  3MWM A;  2CFM A;  5ITZ B;  4B3S B;  1T5E A;  4JI6 B;  2UUA H;  1XNQ H;  3SGI A;  5CA1 B;  1FFX B;  4K8X A;  5GON B;  1AN7 A;  3RIZ A;  5D1O B;  3HKD B;  3K3V A;  1HNW B;  4D7S A;  3K58 A;  5BR8 H;  5IJ0 B;  2V4D A;  3T1Y H;  1S5J A;  4YHH B;  1L2Z A;  5FPR A;  3TY5 A;  4JI3 H;  4DV3 B;  4LH7 A;  4WBN B;  5CA0 B;  1SQG A;  3BHP A;  4JYA H;  2PTM A;  2Q7E A;  4RAZ A;  1MZB A;  3T1H B;  5FPO A;  4MTE A;  4DV3 H;  1P49 A;  3JAL A;  4B08 A;  3U0Z A;  4PI0 A;  1XK5 A;  1SEI A;  2VQE H;  3TY9 A;  1IBL H;  4FLY A;  4YY3 H;  1QHT A;  4NXM B;  1GYF A;  5LA6 B;  2Q7G A;  4IHJ B;  3RGZ A;  4X1K A;  5KX5 B;  5KMG B;  1XHZ A;  5CB4 B;  2YIA A;  3K5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...