4UCRA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 91
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucrA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucrA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucrA02
4TOIA 3RR5A 3W1GA 3KYHC 5LMUB 4DR7B 1N33B 1P8LA 3BABA 1ZAUA 3OTOB 3JSNA 3T1HB 4K0KB 2HVRA 2Q2UA 4EEQA 1XNQB 1FVIA 1CKMA 2HIXA 5DISC 4YHHB 2Q2TA 2UXBB 4DV2B 4DR2B 3BAAA 4DV4B 4LF4B 1P16A 4UCTA 4LFAB 5D1PA 2E5LB 2UXCB 4LF9B 4GLXA 1I94B 4UCSA 4DV0B 4LH7A 4UFZA 4B3MB 1CKNA 4JI3B 2HHHB 1X9NA 2UUAB 2ZM6B 4LF6B 5D1OA 3GDEA 4DR1B 2OWOA 1DGSA 4JI1B 4KHPB 3L2PA 1N36B 2VQEB 2HIVA 4X62B 5LMNB 4DUZB 3TY5A 4DV3B 4DV1B 4DR4B 4DV6B 1N32B 1XK5A 4DV5B 2VUGA 3TY8A 4B3RB 3QWUA 2HVSA 4UCOA 4DR6B 3VNNA 4DR3B 4B3SB 1FJGB 3NBYB 4NXMB 3T1YB 4UCVA 5IWAB 4X65B 1TAEA 4LF5B 2CFMA 3NBZB 4PZ6A 4DUYB 1TA8A 3W5OA 1N34B 4UCRA 4JI4B 4JI5B 4EQ5A 4LH6A 4LFBB 1S68A 4JI0B 3RTXA 2UXDB 1B04A 4EFEA 1A0IA 4DR5B 2UU9B 3S24A 2VQFB 4EFBA 4NXNB 1XMOB 3PN1A 4JI2B 1VS0A 3GJXB 4DRFA 4JI7B 2F4VB 4PZ7A 1CKOA 3UQ8A 1HNZB 4JV5B 1XDNA 4LF8B 4CC5A 4CC6A 2HVQA 3W1BA 3GB8B 2UUBB 2UUCB 1IBLB 5FPOA 1XMQB 1IBKB 3BA9A 4YY3B 1HNWB 3BA8A 1HR0B 5FPRA 3TY9A 5BR8B 1IBMB 1CKNB 4JYAB 4LF7B 3NC0B 4DV7B 3SGIA 4B3TB 5D1OB 1HNXB 4LFCB 4UCUA 4GKJB 4X64B 4X66B 4JI8B 4JI6B 1J5EB 4AQYB 1XNRB 1V9PA 4GKKB 4E6NA 3JSLA 4OX9B 4PZ8A
chains in the Genus database with same CATH superfamily
3ZBHA 2W6OA 1QR8A 4DV2H 3LDDA 4DV4H 4RCNA 2D3OW 2RDJA 2IJKA 3K08A 4MVRA 4RNOA 1R3JC 5DM6V 5C5JA 1TVKA 1FFXA 3K03A 5H2FZ 2HIXA 1HDJA 3D36C 3L75H 2R7LA 4ZBMA 4NXNO 3GLKA 1BE3H 3GV7B 2ZXWC 3L74H 3GQCA 3PO3G 3EHBB 2AXTZ 3ZCCA 3CE2A 5KT2A 1SA0A 1K4DC 1I50A 3WU2Z 3HBLA 4I0XB 2EJRA 2V58A 3AEIA 4FGRA 1OV9A 1M90W 5C8YF 4R6ZA 5KG4A 1RM1B 3KREA 1WN7A 2WAQE 3OSNA 4O7VA 5IYCG 2LW7A 1MNGA 2Y4UA 2KSWA 2WYOA 1A0GA 4DV7O 5KFOA 3I5DA 4CH5A 1GH6A 2JA7A 2B1IA 3N6XA 4C2MA 3ZN1A 4IRKA 1YI2V 5IWAH 3SYCA 4O2BA 1ZTEA 3SYAA 4I7HA 3DGEA 4DR3B 4WFHA 3T9AA 4HZ3A 3P3PA 1EN5A 4DV7H 3E8HA 2NU8B 3W5OA 1WCMA 1ET0A 1QLEC 2JDIG 1XNRH 4FZ0A 5T14A 1XMOH 3GIDA 2JA5A 2AZ0A 5JVDF 3KHLA 1NR1A 3G6VA 4PDLA 4RO2A 3C3SA 3MHHC 5J2TB 1IBLH 3NUAA 2B5UA 3AG1B 1CKOA 5JVLA 4R50A 4NR1A 3T5LA 1K5QA 2PF4E 2WLNA 2HFEC 3JCZA 5FNVA 4JTAB 2WTFA 1JFFA 1N34O 5FPOA 4O4HF 1VQ5V 3K5MA 5DQIA 3PVXA 1VARA 2UXCH 2FK3A 2J6TA 1I6UA 5EK0A 3CPWU 3T2MA 4O81A 4IHJB 2YI8A 4RU9A 4B3TB 1HNXB 2FYUH 4G28B 5BWVA 4ZOLB 3DXRA 4GKJB 4H33A 1VQOV 2DQ0A 5K2MA 2Q73A 4YJ3A 1NBMG 4ED2A 3HKEB 3ETHA 4J9OA 4HNAA 3E83A 4X62H 2EILC 4UV9A 3I55V 1MA1A 1JQ0A 2WLLA 5LHHA 4FLYA 1GN2A 2C2AA 4QGPA 3JSNA 4I4TB 1WRVA 5BWRA 4K6NA 5LA6A 1I94H 2R6FA 2B63A 2C28A 1QLNA 3ZN0A 4R8UB 2I80A 4MV4A 2XGQA 3LSQA 1NTZH 1KJIA 4LF6H 3GTOA 2HEPA 2E5LB 2DN9A 3JD0A 4WHXA 5HBRB 4FFOA 4APMA 3UFXB 1GKFA 4XYMB 3K5NA 4FPPA 5EZYF 4M7EA 4IT5A 3LWBA 4D6TH 4ECWA 3N2GA 4DR4H 5EC2C 1MG1A 2BE3A 3UT5B 3P30A 1BQ0A 5LL6b 2UU9H 4O4JB 2X7RB 3C0FB 4PI2A 3G6EV 1HP8A 1M6VA 1I1MA 2R8KA 2AGPA 1JKJB 2R92A 1N8RW 1FJGH 1I0HA 1O9GA 4ZHQF 3RAXA 3H01A 3AG4C 5I5TA 2J9GA 2QKSA 3EXAA 4PDRA 5KG6A 3A0RA 5IJ0B 1S9FA 5DGIA 2CW8A 4IHJA 1NR7A 1TWGA 3EPIA 3Q8RB 4LF5B 5LYJB 1ZHQA 3PW7A 2Q7EA 4A93G 5KFPA 5IYZF 2R9IA 1D5AA 4JI5B 2QR4A 4NVPA 1KJJA 1PK8A 3U55A 2XNDG 3M7MX 2F4VH 1PL0A 4NTXA 4GX1A 2JA6A 4XBFA 2R7ZA 2DOSA 3HT5A 4OXSA 4X1YA 2FP4B 1KU9A 5CA0F 1Q90D 1DK1A 4I4TA 3CRMA 5KHJA 4UB6Z 1VBHA 2W9BB 4DL2A 3WWIA 1HNWH 4DR1O 1EKVA 1ZL8B 5KFBA 3GIMA 5A2QW 1IBKB 1AR1B 1CQIB 2M05A 5DG9A 2W6IG 1HR0B 4DV1O 2V1DA 4AQYH 3HKBB 4DV6O 1NKDA 1JA8A 1Y67A 3MDSA 4JF3A 2Q68A 3OT7A 3FB7C 4ECYA 4OPAA 1VF6A 4O2AA 5EYPA 1KJQA 1PPJH 2EZOA 2AZ2A 4O4JA 3UZBA 3ICXA 4RUAA 2Y0SE 5I5WA 1BHAA 4YP3A 5JQWA 4DV3H 2X6BA 1GTOA 4AI8A 2JK5C 4IYIA 4LF4H 3J7AK 3D36A 3WFVA 4LFBO 1N48A 1ZX3A 4EEQA 4YHHB 3QG5A 2ZDHA 2ZD9A 4DV2B 4DR2B 5LBQA 5IE9A 2GHYA 4DV4B 2VQFO 5IP7G 3N8DA 1CXZB 5LYJA 3KCXA 4ZQIA 1UPGA 2K9PA 4JV5O 4J42A 3CWBH 3PW5A 3LQSA 2B1GA 1Y1VG 2YZGA 1JDBB 2GSMB 3K57A 3MAQA 4F4ZA 3SR2C 2XAHA 4DUZH 5CMUA 3FB8C 3RBZA 2ODMA 5CA1A 3SYPA 5H5NA 2G38A 4NTWA 5LHIA 2EIMB 3OR6C 3APQA 2WPDG 2NN4A 2ILMA 2HIVA 1B33N 4J9PA 2DYRB 4EB6B 4B7KA 3CCJV 4O83A 5L9XA 3U11A 2YIBA 2VUGA 1RK5A 1I1LA 5IJ9B 5C4XG 3SJBC 4IIJF 4TV9B 3FKIG 3AG2C 5CM0A 4JAAA 3KALA 2CGOA 4ECQA 2E2HA 2Q4PA 3MJFA 1SQGA 5IWAB 1Y4MA 2HGSA 4O82A 1X59A 1VQKV 3I12A 1R73A 5BXZA 1S3JA 4PA6A 4A3JG 1OCZC 2ASLA 3N2KB 4DV5O 4IIJB 3M99B 2WLHA 1IURA 3RB4A 5FLMG 4X1KB 3MFHA 4H44B 3ZS8C 3ABMB 4N23A 1AJPA 4BBRG 4LF8H 2GQSA 3PR4A 5B66Z 3OE7G 4MVUA 4HNVA 3S24A 2ZE8A 1XMOB 4GCZA 2Z5UA 3T9FA 2UUAO 2ZM6O 3PZPA 5B1AB 3SNOA 1XDNA 3T54A 2YDEA 4WCEV 2IW5A 2HVKC 2EZPA 3G8DA 1IBLB 3GV8B 2UXBH 4QWCA 1GK9A 3E2EA 1VQ9V 3CCQV 1TUBA 3BFRA 4LFCH 5LMNO 2OLSA 2GV9A 1YTFB 4U3FH 4U3JA 4I55F 1G2WA 3KTMA 1TUEB 2R70A 2PYJA 4B3MH 4ICGA 2Q9LA 2NUAB 1TWCA 2VA2A 2ZM6H 2IU3A 1IOVA 4UCUA 4DR7H 1M57C 4GKKB 2WWWA 2ZE5A 2W57A 1DLBA 4O3RA 2B9ZA 3RVZA 5JJJB 2UUBO 3RJ0A 3STLC 2FJZA 4FFLA 4I55B 1OCRB 3LDEA 3T4DA 3MR5A 4GX0A 2OCCC 4FVMA 3E8BA 4DQNA 2XCAA 3BABA 1L0LH 2WSSG 3R23A 3OTOB 2CE4A 4LFAH 1SQXH 4ZI7F 4DIMA 5BPHA 4YR3A 1XNQB 3DTFA 1SS3A 2HJFC 1NVPD 5KG5A 4XX0B 3GV5B 5LGUA 4KHPH 4UVAA 3WB1A 1F51A 1I94B 3SPGA 1JDEA 5KS8A 1R9TA 2UVVA 4O4LF 4LF6B 1VMGA 2Y4TA 5LOVB 1AILA 2PMZA 2UXDH 4GLWA 4J41A 4O4IB 3ETJA 2Y69C 1Y76A 4LR3A 4PA7A 1FYJA 1S0MA 4NYKA 2IU0A 2YU9A 4DR4B 4IGGA 5KLVH 1JCHA 2V7QG 2V4QA 4X64O 3GTGA 4AYBA 4QWDA 3CJHB 4TQFA 1C3OA 4MTGA 5DQGA 1MABG 2YI9A 5BWXA 2R7KA 1RJQA 2C2DA 1FJGB 4LNUA 1MMMA 4FFMA 2PI4A 3ZX6A 4J9ZB 2QM4A 3JAMN 4O7LA 3QO8A 1FKAO 4LCUC 3Q8SB 2DW4A 4AILC 4DUYB 3N6RA 2WAMA 3U54A 3PW2A 3GTMA 3APOA 4GUNA 2A0LA 2QGNA 1N33H 2C2RA 4DR3O 2AU0A 2NVXA 1YCIA 3OUFA 1M0TA 4WD3A 2HHHO 5KFQA 2Z3YA 4JI7B 1AR5A 2F4VB 5DLFA 3PW4A 3BQ0A 2LFRA 1RJPA 5L3EA 1IBMH 4JYAH 4LF7H 2I87A 1R6KA 2DE0X 1W0JG 3RW0A 3STZC 2ZE7A 4TUYF 5KFHA 1K97A 2PUSA 4QIWF 3BA9A 1UC8A 3HKZE 1HNWB 1GM7A 4K8XA 2QK4A 4O7WA 5JH7A 1Z2OX 3WG7B 1BQZA 1N32O 3OEEG 4CS4A 1Y6XA 5A2QN 3S3XA 4DW1A 4DRXB 2ZE6A 5LOVA 2KG7B 3TGUH 4FZ1A 4IRCA 2VUMG 4AQYB 2BSKB 5LP6F 2QWQB 1Q86W 2CTRA 4UXNA 3CVZA 4MAMA 4X20A 3G4SV 2IMWP 3ETGA 2F43G 2EINC 1SESA 3RYIB 1JIHA 1BL8A 4CE5A 2R8IA 3ZHVA 3JCUZ 1SZTA 3HKDB 5I5XA 1SF9A 4GX5A 1PP9H 2JVDA 4CMDA 4B3TO 1SQFA 1GGOA 2RNBA 4LF9H 1M1KW 3I4NG 2EIKB 1EZJA 4LF4B 1QNMA 3EVKA 3UM7A 3FAVA 3KHRA 5KX5A 3RN4A 4PA4A 1KUTA 1VQ8V 4BWSC 3RAQA 1YJWV 2OCHA 3SDLA 1ZQ7A 1FFTB 1S10A 3LNNA 4C5AA 3IGAC 4WFEA 4FLUA 1I5XA 3JALA 3RYCB 2DZDA 5GTIZ 4GYCB 5BYAA 2JGUA 4I50F 1A48A 3D3QA 2WA4A 5BZBA 1B6QA 4DUZB 1B6RA 4DK0A 4M0JA 1FPOA 1AROP 4JTDB 5CBGA 4CKBA 3MWEA 2CAZC 4NTYA 1EUDB 3IG0A 1WPBA 2QTOA 2ZINA 4MV1A 1DF4A 2YEVA 2AGQA 3UO3A 1TAEA 2Q0OC 2JA7G 3NBZB 1US6A 4MVZA 2L35A 4MTFA 3ABKC 2FLPA 1N0NA 3OM3B 1RYRA 1JXLA 3B8MA 4TV8A 2P0AA 2XIGA 4W4KA 1B04A 4DR5B 2N05A 1RSOA 2XTAA 4JI3O 1WCMG 4JYYA 4CH6A 4A2AA 1J95A 1TVKB 1FFXB 2GTSA 3CC4V 4LF8B 4CMFA 3G6BA 3H9VA 3L70H 4CC6A 3K5OA 1I2KA 1N36O 3AG7A 5KA5A 2UUCB 3RFCA 3T99A 1JPXA 1EM1A 4CKCA 4DXWA 2Q69A 5CB4F 1GMGA 3U10A 1Q81W 5HV6A 5KFMA 5KG0A 5KUKA 1LR1A 1SA0B 1BHBA 3F5TA 3E8FA 3A0BZ 1NVPB 4EG0A 4OX9H 2CUGA 2EULA 3HPLC 4B3RO 2QJ1A 4LFCB 1GM9A 2YL2A 4O2BF 4J9YB 2A79B 2NU9B 4NLGA 1N36H 5IDJA 2W7OA 1L2ZA 2ZIOA 3T1YO 1P4RA 1VQ6V 3L71H 4ECSA 5L1LA 1UFIA 3TXSA 1IBKO 2Y0IA 4DR7B 1Q8IA 4Q43A 1NQTA 2ITCC 1P7BA 2NLJC 4M9UA 3F7YC 3K04A 3KZIZ 1EZVH 4O2BB 3CCMV 5BPFA 2ZNJA 2CNVA 1CKMA 1KP3A 3B8NA 3BACA 3ZRXA 1YVWA 4DL6A 4UCTA 3HR0A 4LFAB 2VRZA 4ECVA 1HNZO 1OCCB 1SCUB 2J6SA 4LBEC 1KKDA 3RB0A 5IP9G 2VQEH 1GN6A 3MWMA 5AG2A 1HWYA 2B63G 3JZ6A 4KHPB 3ABTA 1V54B 3ZJZA 2YIBD 3FDSA 3PW0A 3ABLB 4DR2O 2HP8A 2VWJA 4ED7A 2EBOA 1I7NA 2P67A 4NYEA 2VS0A 3V4ZA 5KG3A 5FNVB 1BZKA 4X66O 4JI8O 1S72V 1WPXA 3GWOA 1JFFB 2ZIMA 4XDKA 1XK5A 3K0GA 1M56B 2OH2A 2HLDG 2OIEA 3PJSK 1MZBA 3OHAA 2ASJA 5LMUO 4NXMB 2COJA 4C7UA 4LSXA 5KFEA 4IYHA 1URFA 2R92G 1NH2D 3UZOA 3BVOA 3W7WA 4WBNA 2E74B 3DXRB 5GONA 3T1HO 4X66H 3ORRA 4YJ3B 3JARA 2UVWA 3RV4A 4MVSA 3GIKA 4NXNH 4KUMA 2AGOA 5H6QA 2YRXA 4HNAB 2DYSC 1Y1WA 3OMIB 3ETDA 1BGYH 4X1IA 3GTPA 2LFSA 4BWAA 1KYOF 2WLLB 4EFBA 1K7DA 4DV0O 5LXTA 4J9LA 4DL3A 3GJXB 5L3DA 1U97A 4NB5A 4DRFA 4J10A 1RFYA 2QTSA 3K9SA 1KP2A 2LO1A 5LA6B 1I2LA 4WFAV 2MK3A 1NZ6A 5DGHA 4MTDA 5J2TF 1K3EA 4EGQA 2JA6G 3THOA 3CXCU 4YBZB 2R7ZG 4IRDA 2AHZA 2FMLA 3MD0A 2BR0A 2E76B 3ZEDA 1IBMB 4JYAB 4LF7B 4MA5A 4OPHA 1OHHG 4O7YA 3AK3A 1M4UA 2V59A 3C3TA 3PR5B 3N2GB 4BW9A 4DR6O 3G6XA 5EBMC 2LQTA 2FLNA 4IHJF 3CC7V 4XDJA 3UO2A 1DV2A 4Q4CA 3BHPA 2H8PC 4TOIA 3ZMZA 3W1GA 2WDTA 3OHBA 3H40A 1K4CC 4ZOLF 1P8LA 1M9NA 4BIOA 1OJHA 5J2UA 1S0NA 5JJNB 1RP3B 2HVRA 1F4MA 3MR3A 4DR6H 2JIZG 1KTAA 5DISC 5DLGA 1F4NA 2P7TC 3ZMTA 4JASA 3BAAA 4YR2A 4GKKO 1P16A 1XOUA 5CA3A 4PD4F 4JI2O 4I4TF 4NKGB 4LF9B 2COIA 3BQ2A 2W6NA 1N34H 4P9PA 3M9NB 2N74A 1EN4A 1AUVA 3GTKA 2QEXV 5D1OA 1S5HC 1PL4A 1SQVH 3CXHF 2W6MA 5KFVA 3OTOO 2R82A 3TK1A 3MFIA 4X1YB 3VQXA 1XNQO 4RQEA 4YAJB 4EEYA 3CSWA 1SFOA 2P06A 3P3NA 5BR8O 4UB8Z 4CZZA 5DMXA 2EIJC 3V4SA 3J80W 4J9KA 3IJ4A 2QM8A 3A2FA 4A3DG 5HFMA 1YTFD 3LMLA 3LULA 5JQGB 2FPPB 4JI6O 1K92A 1GSOA 2R9RB 4BIUA 4O4JF 2RDIA 1K5SA 4FFBA 4MVOA 1TGOA 5BMVA 3TW7A 5KUMA 1VF5B 5F9LA 3B2EE 4MW8A 5ITZA 3KHHA 2WE6A 5IYBG 2EX3A 2E2IA 2RF4A 3BY6A 2D2CB 5IY5C 5C8YA 3CCRV 1W2BU 3HOVG 4O2AB 5EYPB 4K0KO 1BNCA 3TW6A 4Q0YA 2ABJA 4J0MA 4P30A 4BBSG 1KT8A 5LYJF 4EFEA 4I5SA 1K9MW 1V55C 3ASOC 3N40P 1ZETA 2YZMA 3QZ7A 3QFFA 5L3CA 3UQ8A 1BS3A 4K0KH 2ZXWB 3PO2G 5IYDO 2XAJA 4DUYO 2Q8VA 4LC1A 2XCLA 5DGBA 4JAUA 1XL6A 4J7JA 1XMQB 2ZDIC 3T9BA 3RWRD 4YY3B 2CGNA 1IOWA 3IN5A 5BWWA 3T5KA 5EBWC 1BJTA 4IZOA 2R8JA 4KXRA 3ASNC 2F95B 3WO1A 5JVDA 4A5UB 5KFLA 4JI7O 4RAIA 5CA1B 4B7EA 4YR0A 3OUSA 5B1NA 2IP4A 3FX7A 3GILA 1UC9A 4RZRA 4A3LG 4Y8VB 3U9TA 2JEJA 2EJ3A 1H2SB 4OX9B 3F7VC 1C30A 4MVQA 4X65O 1H2MA 5JQGA 2MCTA 2H94A 3L72H 4GC6A 4O4HA 2XHBA 3E22A 1FXKC 1W0KG 2Q7HA 1SZXA 1PNLA 4O7RA 4JI0O 2Q5ZA 3SYOA 2R8GA 3A8TA 3DC5A 2DAAA 1QLEB 2GUZA 1OCRC 4D7SA 5D1PA 3VPDA 4DR1H 1NTKH 3AG3C 4J9QA 4UCSA 3RVYA 2RGRA 4QIWE 1IXMA 1RPOA 1CKNA 2A9HA 1NH2B 2HR3A 1XI1A 2BTQA 4WFGA 2OWOA 4JI1B 4DV1H 2JRIA 4DV6H 3RIZA 3MHSC 2XT9A 4QSHA 4O84A 1NJIW 3VQWA 2VQEB 2CK3G 3KCYA 4YXWG 3UKMA 4QW8A 3CB2A 3TY8A 1YIJV 1TUBB 1KC7A 1W96A 4U3JB 3O65A 3JD4A 5KA6A 1JMKC 1I7FA 3CS5A 4O3OA 5E25A 4YJ2A 1YZBA 4LFBH 1VIBA 5IT9W 1JX4A 3DSQA 4MV6A 3EPGA 4TV9F 4FM2A 2E3CA 2P4KA 1FAFA 2EILB 2VQFH 1Z2NX 2PBZA 3R5XA 4QE7A 3CCSV 1JJ2U 5TISZ 1H2LA 4FE2A 4RB1A 4Q4DA 1RJRA 4JV5H 3OSPA 4ZHQA 4IWYA 3W7TA 5KHHA 1RK6A 4NXNB 3RGXA 3JATA 1IDSA 1FS0G 2RDCA 3WO0A 3T9EA 4CC5A 3RT3C 2HVQA 1K73W 2ZNIA 2BTOA 3K3PA 5CBHA 4FU0A 1H2KA 3B09A 1CP9A 3JD2A 4HYOA 2QKAA 1S5LZ 2YSUB 5CBFA 4F4YA 5IYZA 5KMGA 1EKPA 2CKZB 4DR5O 2RMKB 4DV7B 3RV3A 1T3NA 1WB7A 1XNRB 2CTQA 4B3SO 4Z1MG 2QWRB 4UVCA 1PM9A 5CA0A 2AHYA 3FD9A 2W6PA 3JAWA 1Y76B 2UUCO 2Y4RA 4Q8EA 4R7CA 2X6CA 2ZGIA 4MV9A 3AG4B 2DLNA 1TWAA 4YAKB 2RCVA 3TCUA 5KT7A 4JI4O 5EWEA 4DV5H 2OTLV 1PKXA 3BQ1A 2YC0A 4A2BA 2LP7A 2BQUA 1B6SA 1P84F 4DYLA 4PWQA 2Q2TA 1XDCA 1M7JA 4LNUB 5H80A 4Q44A 4ED1A 2Y0PA 1KJ9A 1F23A 1JR9A 5E79Z 4FBTA 3JASA 1GRJA 2UUAH 1WA8A 2UXCB 1R3IC 3K5IA 2PI5A 2EJ2A 1U96A 2NNUA 4PBCA 1VBGA 3ABUA 2HHFA 4RNMA 2QDOA 4ABMA 4QW9A 1XBLA 5LMNH 4G3IA 5LP6C 4TT3G 1UJWB 2COGA 4FLWA 5JCOC 3H3VH 1EKFA 2RJZA 4C5BA 3K5HA 3MWDA 1OCOC 3WNZA 4K8ZA 1VQMV 1YHQV 4QJFA 2J6UA 3TETA 2ZCEA 2CW7A 4X62B 1B3QA 3H1HH 3TY5A 5LOVF 1Q43A 3GTLA 2FK2A 4K35A 3OMAB 1J5EO 4RQFA 2F93B 4TQDA 1NU1H 3M8AA 2WAQA 2UUBH 2MW2B 4O4IF 4DLKA 3F5WC 3I56V 1P49A 1KBHA 5JH7B 5I5YA 4FLZA 3RYFA 5F2VO 1QBZA 3FB5C 3LSSA 2IJJA 4HBNA 1K83A 3JAKA 2ALZA 2JS3A 1TA8A 2ZT9B 4XZ3B 2KQXA 4X20B 2QM7A 4QWAA 4Q8FA 1GM8A 4J9RA 4BXXG 2R72A 3AK1A 3OMNB 4ECRA 1F7YA 5EBLC 2UU9B 4RB0A 3VMMA 4NXMO 4J9SA 4LSAA 4RNNA 4ZKIA 2W8KA 1E1QG 3T1CA 4EYHB 1WLEA 2ZDIA 3OUUA 4JGSA 1DV1A 4CH4A 1KC8W 3FAVB 3SYQA 1YJ9V 3CHXA 5KX5B 1IX9A 3ML0A 4ECUA 2V5AA 4QE9A 3VPCA 1Q6HA 4X64H 1E4EA 2M6YA 5FPRA 3G67A 1R6TA 3Q4HA 3GIQA 3ZHQA 3RB6A 3JALB 3H0GG 3ZHSA 2R9AA 3T5HA 2RN9A 2YZNA 3CQZA 4PELA 3E86A 5B1BC 2NU7B 4P2ZA 3ZHTA 4YQWA 1H8EG 1FKAH 2FLLA 2Y48A 1T36A 3X2QC 3GIJA 2WLIA 4YIPA 4LWSA 3AG2B 4RB3C 1CS0A 1VF7A 5EIBD 4F4WA 1VKZA 2XUMA 3DC6A 4B08A 1M93A 1I1KA 4L1KA 4DR3H 1VQPV 4CKEA 2Z04A 2YEVB 2DABA 2HHHH 1OCZB 5H6RA 2JEFA 4PV1B 2XAQA 1ZLZA 1S0VA 3LNMB 2PYLA 2Q6AA 3KKYA 2HGWA 5IYCO 2HG5C 4TV8B 4DR1B 4RUEA 1DGSA 3L2PA 4PA3A 3I4MG 3K59A 1N32H 3W7SA 1D5NA 1AI5A 4UUJC 3JZIA 1L1FA 1RSOB 1AR4A 4ETSA 5B3SC 2YXLA 4ZI7A 4FM1A 1HNXO 4MTEA 3CRQA 4DV1B 4DV3B 2DWCA 2YICA 3E8GA 4DV6B 2EIYA 3TINA 1T5EA 4GKJO 2KKWA 5DG7A 1Z5WA 1YSCA 3T7AA 2W9CA 1Y74A 1G8MA 2XCPA 4U6PA 3Q2OA 1COWG 1DIKA 2VOBA 2VPQA 3R5HA 4GC7A 1TWFA 1M57B 4O4LA 1IYEA 4MV3A 4LMYA 5KT5A 1LUVA 2P90A 3T4ZA 4B3TH 4AHCA 4ECXA 4GKJH 2OCCB 1W93A 2XC9A 4FMTA 2X6AA 4LFBB 3AW8A 3SPJA 2QB5A 3R5FA 1AI7A 4MV7A 3B4SA 5FD5A 3ETQA 3QF7A 4JUZA 4H13B 2E5LO 2ODTX 2M7WA 2YRWA 4PJ0Z 2VQFB 3SPHA 1PX2A 3FYIB 4DO2A 2P6JA 1RM1C 4JV5B 1S76D 1YITV 2R85A 2ZR2A 4FS1A 3NR7A 3D3IA 1MZFA 3CRAA 3R9RA 1Y1WG 2W6QA 3NXSA 3JD3A 2IBZH 3D8CA 4A3IG 3BA8A 5JWPA 2UXXA 4MSWC 1EUCB 1Z5VA 3G71V 5L3GA 3RBDA 3SGIA 5KFFA 2F1MA 4DL5A 2Y69B 3Q1KA 2QF7A 3JZFA 2HG8A 4I9WA 5C3EG 5A9GA 2FMAA 1E79G 2XASA 3ZIAG 2JA8G 1E4FT 2H3OA 1XMQO 4LF5O 3H0GA 5LL6Y 1R1BA 2XGPA 1QHTA 4YY3O 4ME6A 1QQCA 4JI5O 2WB1A 4TUYA 2A06H 2Y0SA 5GTHZ 2FK1A 2UXBB 2C22A 3JRXA 3HOZG 3AG1C 4JI3H 2EJ7A 1M5IA 3R66A 4CHIA 2YZLA 5FLXW 2JEXA 2BOBC 4MTXA 4WBNB 4LF5H 1CE8A 5GONB 4JV2A 4A3MG 4GLXA 3JARB 3IAYA 4UFZA 4B3MB 2ADPA 3WB0A 5JCOA 1A32A 4G2KA 2JGDA 4BIZA 2ZM6B 2UUAB 3ZHUA 4X1IB 4I9QA 1HR0O 1THZA 3JRWA 1DF5A 5LXTB 2NU6B 5C1OA 4B3RH 1EBOA 1PD3A 2W70A 5LMNB 4O7TA 2PTMA 4JPRA 5KFAA 3TQTA 2LW1A 5KFTA 3SPIA 1VP7A 3VQYA 3T1YH 2CH7A 2OIGA 4JTCB 4L87A 2AGAA 2X5RA 2X0SA 1IBKH 1K8AW 2PZSA 1WJZA 4PDMA 5FNVF 4JI1O 3MR2A 4BR6A 3OR7C 2VWKA 2DWEC 2PY5A 2FPIB 3E5NA 3N27A 2EINB 4O86A 3HO8A 4UCRA 4F6RA 4O3NA 4YHHO 2P5OA 3U0GA 4I50A 2YCHA 4DV2O 4DV4O 1S68A 4J9NA 1HNZH 2HKOA 2UXDB 1VQNV 3OFNG 1T94A 1VQ4V 3CEIA 4HQ6A 4YJ3F 5J2UB 1L0NH 3HKCA 1K34A 1AJQA 3L9DA 2YXYA 5C1PA 4YHHH 2FE3A 4DR2H 2R93A 3ZRVA 2ZDGA 4YIOA 1G4YB 1UNNC 4JI8H 1QCEA 5LA6F 4G27B 4A3FG 3J81W 5D1OB 3GIPA 2OYQA 2QWNB 4FIPC 3CEBA 2R87A 5BMVF 5LMUH 4X64B 2R86A 2BOCC 3IFXA 3H20A 1KBLA 4QNHB 2V4RA 2W6ZA 2VA3A 5IWAO 3T1HH 4EBCA 1N33B 4J7ZA 1I7LA 5CB4A 3L4JA 5KFSA 4FFBB 1ZAUA 5BMVB 3OGCC 4DAAA 5I5VA 5ITZB 2YWVA 5C44G 3ZRWA 4DV0H 1KMIZ 4MT8A 3ABKB 1XNRO 5KFXA 2QA4V 2VPSA 4A3CG 1GN3A 1XMOO 4K3AA 4ECZA 5C8YB 2W8LA 2PMZE 2Q67A 4UUGA 2EJ0A 5KFCA 3Q8QB 1VEWA 1SQPH 4I7ZB 1ZSPA 1LNQA 5LGTA 1MOFA 2HHHB 4H37A 3CRCA 2ADQB 4WF9V 1IBLO 1CQJB 3GTQA 3K3WA 4JYBA 1E1RG 3RYHA 1AJNA 3QNEA 5EWGA 4AYBE 4J11A 3CCLV 4HN2A 1JLLB 1SQBH 4O3QA 5D8DA 1AB3A 5KHIA 1PV0A 4DL7A 2UXCO 1N32B 4BY1G 4YB8B 2HJWA 4FK5C 1Q3EA 3GWKC 4Z2WA 2ZR3A 4ZIBA 4FLXA 3K9AA 1S5JA 2Q7DA 3OAAG 3VNNA 3ETEA 2IH3C 5CE8A 5JQGF 4EBEA 3DTGA 2HDKA 3HOXG 4CBCA 3VOUA 3OUZA 1K1SA 2NVYA 5JVDB 4U7NA 5EOYA 4XDLA 4X62O 3BCCH 4GKKH 3CRRA 1A3GA 4MA0A 2JS5A 1KD1W 4I0XA 4JI2H 4QWEA 4F50A 1Z2GA 3G8CA 1AI4A 4TM5A 5L3BA 1BSMA 5J9PC 3HOYG 4O2AF 4FFRA 3TIIA 1I94O 3LUTB 2GQRA 3V6HA 4WFBV 4O4HB 1LUWA 1GSAA 3E22B 5D5QA 2VQDA 3AYHB 2F66C 1YJNV 2YXHA 4JXUA 4LF6O 3OTOH 2QYZA 4RUFA 2PGGA 3UCSC 5KFDA 3KG2A 4MV8A 1XNQH 2YIDA 2EIMC 3L73H 3W1BA 5BR8H 3N43B 1CPYA 1I08A 1R6NA 2DYRC 2ZKOA 2JJ1G 1S0OA 2GUZB 1JOYA 1XUQA 3DTUB 1VQLV 3H1JH 5E1AC 2R7MA 4DR4O 4JI6H 1OZ0A 5FJ8G 1SKVA 3S3WA 4CS2A 3G6YA 4EYIB 1CKNB 3H1LH 2UU9O 4JAVA 1Q5OA 1XILA 2BTQB 4W4LA 1M0WA 1YXBA 2PN1A 1XEQA 1XREA 3TIGA 5DG8A 4FM9A 3HKZA 2FB5A 1Q7YW 3CCEV 1FJGO 1GO3E 4RB2C 5KFKA 1FXVA 4YJ2F 3B77A 4J7KA 3LSUA 4O7SA 2XAGA 1KUQA 1BGWA 3RGBA 5CA1F 5J2TA 2YS7A 3QQMA 2GPWA 4F6EA 4PI0A 3ABMC 5K3WA 4JZ2A 1IVSA 4L8JA 1WP8A 3FFQA 4YJ2B 3CCUV 3JAMW 5EZYB 4D7TA 5B1AC 1KEEA 2FL4A 1EFRG 2P4VA 2F4VO 2FKXA 2P22C 5KFRA 2DYSB 5HNEA 4DUYH 3MR6A 4U7OA 3E89A 3KXYT 4JI3B 1FXHA 4A3GG 3NGDA 5FLXN 2UXNA 5FL7G 3OD4A 4ZOLA 4ZHQB 1HNWO 1N36B 1V4YA 3LP8A 3P32A 4GX2A 2W0XA 1XHZA 4OGQB 4HNUA 4ED3A 3N44B 4NZOA 2PVPA 2W71A 3HB3B 3HKEA 3JATB 3ZMUA 1G1XB 1GYFA 3K58A 3CCVV 3QZ8A 4JI7H 3WWJA 5I5UA 2QKCA 1S97A 4MW3A 1H38A 3H1IH 4AQYO 3RB3A 1R3KC 2JEGA 4B3RB 2DPJA 4X65H 4UCOA 1BCCH 4XYLB 2DMXA 3GIIA 1QVGU 4EGJA 5IYZB 5KMGB 4IWXA 3AK2A 3NBYB 3KAJA 4E2LA 3T1YB 4R8UA 2W7PA 3C90A 4UCVA 1N56A 4JI0H 1OBDA 2A3QA 4U7CA 4DK1A 2CTWA 4DV3O 2E75B 1G6UA 5CA0B 4LH6A 3JAWB 4DL4A 4LF4O 2R84A 2W0FC 3DF7A 1H8HG 1ZWIC 1XQ8A 3UT5A 1BT8A 1ZUQA 5JJEB 1VQ7V 2WB1E 3GVMA 3DAAA 2NR5A 5KAIZ 1VS0A 2ATKC 3EYYA 4EKWA 1HNZB 1WH2A 3K06A 4J80A 3TJTA 2IM9A 4IL6Z 5F9NA 3GB8B 3WB2A 4DW0A 3CSXA 5EZYA 3JASB 1SYXB 3UYYA 1WA8B 3KAKA 4DUZO 5GW7A 3EFFK 2HHFB 5IJ0A 5KG7A 3K0DA 3N42B 1EYZA 3VA7A 3TXQA 2XAFA 3CX5F 4CH3A 2EIJB 5KT6A 1ORQC 4UV8A 2V4DA 4X66B 4JI8B 3OTFA 3ZRSA 1GLVA 3VOTA 5EWFA 2JEIA 2LGQA 2AW9A 1WAZA 4QJFB 3J81N 1S03G 1N0JA 2CNUA 5KKNB 1HW7A 2IJIA 5LMUB 2W9AA 3PFFA 2DIKA 2ITDC 2N04A 1GAXA 1AP6A 4F4LA 5KFWA 5B1OA 5B5EZ 3T1HB 1Q6IA 5IY5B 2W9BA 5LGNA 4JV1A 3HXLA 3IC9A 1K33A 2BQRA 1Q6UA 1MZEA 4GZRB 1KJ8A 1OWTA 1ZL8A 3RYFB 4MVMA 2YS8A 1E4GT 4RZQA 3JAKB 1I3QA 3WWHA 4DV0B 4LH7A 3HKBA 4LF8O 4BW5A 1V55B 2GLTA 3ASOB 2O57A 2Q0AA 1X9NA 2HGXA 3JD1A 3SI8A 2WA3A 1Z2PX 2RQ6A 4UVBA 4RUCA 3WG7C 1EZ1A 2R8HA 4DR5H 4TQRA 5L1KA 3QO5A 1B06A 2UXBO 4A3KG 1GN4A 1FD9A 1PNMA 4X8AA 4P9OA 4B3SH 4LFCO 1S77D 1W59A 4F4XA 1WNSA 5KHKA 2UUCH 3RGZA 2FB9A 4X89A 4B3MO 1YEWA 3ASNB 4DR6B 1E4EB 4ED0A 4JI4H 2CQYA 4DR7O 3Q4HB 4IR9A 3IC7A 2XD4A 1L8DA 1WB8A 1XHXA 1EN6A 1DTOA 2EIKC 3K5LA 1N34B 5JH7F 2ASDA 4EQ5A 5DGAA 1JJOA 4TVIA 4HR7A 2IBKA 4E4EA 3TQ1A 3TEKA 1FXKB 4LFAO 5KFZA 4A3EG 2WLIB 4LWSB 4RWUA 3BEHA 2Z02A 4JI2B 2C2EA 4H0LB 3J80N 4ED8A 5KFUA 2FTKA 4PZ7A 4EB6A 4O7NA 4EBDA 4ED6A 5KFJA 4KHPO 4LP8A 1AI6A 2QSAA 3AG3B 1H2NA 4MS2A 3CP1A 4PA9A 4PHZA 2IH1C 5DN6G 3A0HZ 3H4BA 5IYDG 5IJ9A 4X9QA 1GSHA 1GO3F 3RUPA 3KHGA 3BJYA 4TV9A 4RAZA 3R65A 1J5EH 3T9DA 3J7AU 3TY9A 5BR8B 4NZMA 2UXDO 1DAAA 5D5PA 3T9CA 2ZJTA 3NC0B 4Z1VA 4O7ZA 5BY1A 5KFNA 1KKCA 5KX5F 4TWKA 3W7XA 3CMEV 1AVMA 4E6NA 2RGVA 4JI6B 3CYOA 4E4TA 4FLVA 5FR9A 5L3FA 3N2KA 4IIJA 4X88A 4PZ8A 4ZI7B 4X1KA 2GPSA 2VR1A 2A1HA 3RR5A 2JJ2G 3SJQC 4FBUA 4N21A 3SJAC 2W9CB 1Y74B 2XOKG 1EHIA 3AX6A 5K1PA 1Y1VA 2YYAA 1Y66A 2R7NA 4K0KB 3ORQA 2Q2UA 2W6JG 2DJVA 2DQ3A 1ENVA 1PNKA 4NXMH 4O4LB 2CNQA 1YF2A 4KL1A 4CS3A 3RF2A 2X0LA 4KP4A 3ZMSA 1RYSA 5CN0A 1MSDA 2LJ2A 1N33O 4J9MA 1Q82W 4QWBA 2DPIA 1KECA 3OGIB 5L1JA 1FXKA 1ROPA 3QTCA 2DWDC 1ULZA 2GBOA 1OBGA 2HJDA 4Q6GA 4BAYA 2FPGB 5BWTA 3FKIA 3VBBA 1JVMA 5KFIA 4TQSA 3O9OA 3U0ZA 1IBMO 4JYAO 4LF7O 1N4CA 4I55A 4TV8F 3SE7A 5I5SA 1AN7A 1YDXA 4WFFA 1BXRA 4R8CA 1KB9F 3HOWG 2UVUA 1V51A 2LGWA 1SRYA 3CMAV 3V6JA 4X65B 2OTJV 3RFRA 2CFMA 4RAYA 4JYCA 4PZ6A 3N41B 2IJHA 5KT4A 4FLTA 3H4DA 1Y14B 1AUXA 3CD6V 4JI0B 1OCCC 2I8CA 3RTXA 3QVNA 3B40A 1SC5B 4LF9O 4TUYB 4O4IA 1KQSU 3QO7A 2YIAA 5EDWA 3HOUG 1V54C 2ARHA 5KAFZ 5L1IA 3LDCA 2YUAA 5KHGA 3OEHG 2WLMA 3ABLC 4PDBA 2CTPA 3BRCA 5LHGA 2K1EA 3CJHA 2YS6A 4FFNA 1K1QA 1HNXH 2ZQMA 3FMAA 1IZ3A 5LP6B 4O3PA 1M56C 5C93A 1D2DA 3CC2V 1NT2B 4HNTA 5I47A 2JGDB 1ZHSA 5IT9N 1OCOB 2Q7GA 5KT3A 4Q45A 2GDSA 5DQHA 3ZMVA 5I60A 5EIBC 2R93G 3K3VA 3FB6C 3JSLA 2YW2A 1NS1A 1TWHA 4MTOA 2JEUA 2GTAA 4JZGA 3KYHC 3FKSG 3VQVA 4BY7G 5BWUA 3SJCC 2QE7G 1MSWD 2CH7B 4TSFG 1RPRA 2E5LH 1O75A 1FVIA 2KSDA 2UVRA 1P7GA 1NI8A 4IR1A 4F6RB 5KG1A 3L4KA 4I50B 3GTJA 1WP7A 4HAMA 4ECTA 3SPCA 3T5JA 4FM0A 2ZDQA 3GDEA 4DRXA 4WBNF 1QR9A 1SETA 2KG7A 5GONF 2BSKA 3Q8PB 1O9HA 3V6KA 2AQ4A 2A7WA 3VPBA 2OT5A 3HKCB 4QIWA 2V9WA 2Z0AA 4FS2A 1IYDA 5CAEB 5HFLA 3M9OB 3BG5A 3E35A 3RYIA 4ASUG 3K79A 2C35B 2O03A 5EC1C 4DV5B 5H9CA 2QWOB 4GT1A 1QVFU 3HB9A 5LXTF 5DAAA 3W7UA 2FKLA 3QWUA 3HKDA 2HVSA 4PDVA 2BCCH 1IXBA 5IYBO 4OX9O 5FD6A 1XMQH 3OW2U 4YY3H 5LP6A 4B3SB 4KFMA 3GB7C 4JI5H 1QU7A 3M9MB 1A9XA 2JA5G 4NZNA 4FFKA 5B1BB 4FFPA 5JUMA 4HYKA 1SERA 3H1KH 1NTMH 5KFYA 3X2QB 2CZGA 4JI4B 1X4TA 5KG2A 3M4IA 2SCUB 2WLJA 2CDYA 3RYCA 2WLKA 2ATLA 4A3BG 1A0IA 1R3LC 1AP5A 4R7RA 5CB4B 3PN1A 3ZHRA 2L6LA 2F23A 1HR0H 5KFGA 4FJCC 3BPZA 3ZRWB 2C00A 1H2GA 3JYCA 5K1XA 2UUBB 5DEDA 1CEZA 5J2UF 2VUMA 3G80A 2VQEO 1WR2A 2BQ3A 1I5YA 3F8NA 4QPJA 2HVJC 4Q20A 5DECA 2IA6A 1XL4A 2ETNA 1WSCA 1VAJA 3RYHB 5B3SB 4JV0A 1JX9A 4JI1H 4QPKA 1SQQH 2QWPB 1J5EB 1V9PA 5CR5A 5BYBA 3U9SA 4C5CA 4O3SA 4IAJA 3RBEA 1BMFG 2KB1A 3FYEB 1SEIA 1VF6C
chains in the Genus database with same CATH topology
3RYIB 4MV9A 1BGWA 3RGBA 4DV2H 5J2TA 4DV4H 4DV5H 4A2BA 3HKDB 4PI0A 2JVDA 1TVKA 1SQFA 1FFXA 4L8JA 2HIXA 2Q2TA 4LF9H 4LNUB 3FFQA 4YJ2B 4LF4B 3JAMW 5EZYB 3JASA 4D7TA 2UUAH 5KX5A 4BWSC 2UXCB 2P22C 4DUYH 1SA0A 3LNNA 3KXYT 4FLUA 4JI3B 3JALA 3RYCB 5LMNH 5LP6C 4FLWA 4ZOLA 1WN7A 4GYCB 4ZHQB 1N36B 1XHZA 5JCOC 2JGUA 3N44B 2RJZA 3HKEA 3JATB 4K8ZA 1GYFA 2KSWA 2WYOA 3K58A 2ZCEA 2CW7A 4X62B 4DUZB 4JI7H 4DK0A 3TY5A 4CH5A 1Q43A 3N6XA 2F93B 4TQDA 2UUBH 4B3RB 5IWAH 2CAZC 4X65H 4UCOA 4O2BA 1P49A 5IYZB 1WPBA 5JH7B 5KMGB 4DR3B 2ZINA 3NBYB 3IG0A 4I7HA 3KAJA 3T1YB 4UCVA 4FLZA 3RYFA 1TAEA 4HBNA 4DV7H 4JI0H 3JAKA 3NBZB 3W5OA 1TA8A 4DK1A 1G6UA 1XNRH 5CA0B 1XMOH 4LH6A 3JAWB 4X20B 3DF7A 4TV8A 2XIGA 1B04A 1XQ8A 2R72A 3UT5A 4DR5B 5JJEB 4RB0A 2UU9B 5J2TB 1IBLH 1VS0A 4LSAA 1RSOA 4CH6A 1CKOA 3EYYA 1HNZB 4A2AA 1TVKB 1WH2A 1FFXB 2IM9A 4LF8B 5FNVA 4CC6A 3K5OA 3GB8B 3WB2A 2UUCB 1JFFA 3CSXA 4CH4A 5EZYA 5FPOA 3JASB 1SYXB 3CHXA 5KX5B 3K5MA 3U10A 3KAKA 2UXCH 4X64H 5FPRA 1I6UA 1SA0B 5IJ0A 3N42B 4IHJB 2YI8A 3JALB 4OX9H 4B3TB 1HNXB 4CH3A 2QJ1A 4LFCB 2R9AA 4ZOLB 2V4DA 4X66B 4JI8B 3OTFA 4GKJB 1N36H 4YJ3A 1L2ZA 2ZIOA 3HKEB 1FKAH 1S03G 4HNAA 4X62H 1HW7A 5LMUB 4DR7B 4RB3C 1VF7A 5EIBD 1Q8IA 4FLYA 4B08A 1M93A 3JSNA 4I4TB 4O2BB 3T1HB 2ZNJA 3HXLA 1CKMA 5LA6A 1I94H 4DR3H 3RYFB 2HHHH 4UCTA 4LF6H 4LFAB 2HEPA 2E5LB 1E4GT 4RZQA 3JAKB 4APMA 4DV0B 4LH7A 3HKBA 2PYLA 3K5NA 2Q0AA 1X9NA 2VQEH 1Z2PX 3MWMA 4M7EA 2RQ6A 4TV8B 4DR1B 3N2GA 4DR4H 1DGSA 4KHPB 3L2PA 3UT5B 3K59A 4DR5H 1N32H 2YIBD 5LL6b 2UU9H 4O4JB 3C0FB 4PI2A 2VWJA 4ETSA 2YXLA 4ZI7A 4FM1A 4MTEA 4DV3B 4DV1B 5FNVB 4DV6B 4B3SH 1T5EA 1FJGH 1O9GA 2KKWA 1XK5A 1WNSA 1Z5WA 1JFFB 2ZIMA 5KHKA 2UUCH 3RGZA 1YEWA 1MZBA 4DR6B 2VOBA 4JI4H 5IJ0B 4NXMB 4LSXA 2CW8A 4IHJA 4O4LA 4LMYA 1L8DA 1XHXA 4B3TH 4LF5B 4AHCA 4WBNA 5LYJB 1ZHQA 5GONA 2Q7EA 3K5LA 4GKJH 4X66H 1N34B 4YJ3B 3JARA 1D5AA 4JI5B 4EQ5A 1JJOA 4NXNH 4NVPA 4LFBB 3M7MX 4MV7A 2F4VH 4HNAB 5FD5A 3ETQA 3QF7A 4X1IA 4BWAA 4X1YA 2VQFB 1KU9A 4EFBA 5LXTA 4JI2B 3GJXB 4DRFA 4I4TA 4PZ7A 5KHJA 4EB6A 4JV5B 1HNWH 5LA6B 4MTDA 4PHZA 5A2QW 3THOA 5IJ9A 1IBKB 4TV9A 3BA8A 1HR0B 4RAZA 1J5EH 4AQYH 3HKBB 3TY9A 5BR8B 1Z5VA 3ZEDA 1IBMB 5D5PA 4LF7B 4JYAB 3NC0B 2ZJTA 3SGIA 2F1MA 1M4UA 3N2GB 4BW9A 4O2AA 5EYPA 2RGVA 4E6NA 4JI6B 4FLVA 4O4JA 3ICXA 3N2KA 4IIJA 4PZ8A 4ZI7B 4X1KA 1E4FT 3BHPA 4TOIA 3RR5A 3W1GA 2WDTA 4DV3H 1QHTA 1P8LA 1QQCA 3SJAC 4LF4H 5J2UA 3J7AK 4TUYA 5K1PA 5JJNB 4K0KB 2HVRA 2Q2UA 4EEQA 4DR6H 5DISC 4YHHB 3QG5A 2UXBB 4DV2B 4DR2B 4NXMH 3BAAA 4DV4B 4O4LB 4JI3H 1P16A 1M5IA 5FLXW 4KL1A 5LYJA 4CS3A 4WBNB 4LF5H 3RF2A 5GONB 4LF9B 4GLXA 3JARB 3IAYA 1N34H 4UFZA 4B3MB 3WB0A 5JCOA 3K57A 3MAQA 2UUAB 2ZM6B 5D1OA 3SR2C 4DUZH 3QTCA 4X1IB 4I9QA 5CA1A 4Q6GA 4X1YB 3VQXA 5LXTB 3U0ZA 4B3RH 2HIVA 3J80W 4EB6B 5LMNB 4I55A 3A2FA 2PTMA 1AN7A 3LMLA 3U11A 5JQGB 2YIBA 3VQYA 3T1YH 2VUGA 5IJ9B 4FFBA 3SJBC 5BMVA 1TGOA 1IBKH 4TV9B 3B2EE 5ITZA 2PZSA 2WE6A 3KALA 2EX3A 2VWKA 2PY5A 1SQGA 5IWAB 4X65B 5C8YA 3RFRA 2HGSA 2CFMA 4RAYA 4O2AB 5EYPB 4PZ6A 3N41B 4UCRA 4F6RA 4FLTA 2P5OA 4I50A 2YCHA 3N2KB 1S68A 4IIJB 4JI0B 4X1KB 4Q0YA 1HNZH 4J0MA 3ZS8C 3RTXA 2UXDB 4LF8H 4EFEA 3S24A 3N40P 5J2UB 1XMOB 4TUYB 4O4IA 2YIAA 3HKCA 3UQ8A 4K0KH 1XDNA 5KHGA 4YHHH 4PDBA 2FE3A 2UXBH 3BRCA 1IBLB 4DR2H 1HNXH 1XMQB 1TUBA 3FMAA 3RWRD 4YY3B 4LFCH 2GV9A 5LP6B 4U3JA 1BJTA 4JI8H 2R70A 2PYJA 3J81W 4B3MH 1NT2B 1ZHSA 2F95B 5D1OB 5JVDA 2Q7GA 2OYQA 2ZM6H 4UCUA 5LMUH 4X64B 5EIBC 5CA1B 4DR7H 4GKKB 3K3VA 3JSLA 2W57A 3H20A 1H2SB 5JJJB 4OX9B 3RJ0A 3T1HH 4I55B 3KYHC 3VQVA 1N33B 5JQGA 2MCTA 4FVMA 3SJCC 3BABA 4O4HA 5CB4A 2XHBA 3L4JA 3E22A 4FFBB 1ZAUA 2Q7HA 5BMVB 3OTOB 4LFAH 2E5LH 5ITZB 1XNQB 1FVIA 1O75A 4DV0H 1KMIZ 2VPSA 5C8YB 4D7SA 5D1PA 4DR1H 4KHPH 3WB1A 4F6RB 4UCSA 1I94B 2RGRA 3L4KA 4I50B 1CKNA 2HHHB 4LF6B 4FM0A 3GDEA 1XI1A 2BTQA 4DRXA 2OWOA 4JI1B 3RYHA 5LOVB 4DV1H 4DV6H 2UXDH 3RIZA 1O9HA 4O4IB 3VQWA 2VQEB 3HKCB 4LR3A 3RYIA 5KHIA 4DR4B 2O03A 1N32B 4DV5B 3CB2A 1Q3EA 3TY8A 4FLXA 3HKDA 4ZIBA 3QWUA 2HVSA 4TQFA 5FD6A 1S5JA 1TUBB 1XMQH 2YI9A 3VNNA 4YY3H 5LP6A 4U3JB 4B3SB 1FJGB 4LNUA 1JMKC 1I7FA 4JI5H 4YJ2A 4LFBH 2QM4A 5IT9W 5JVDB 3DSQA 4AILC 4DUYB 2E3CA 4FM2A 5EOYA 4JI4B 1X4TA 4GKKH 2VQFH 1Z2NX 3M4IA 2JS5A 4JI2H 3RYCA 4RB1A 4JV5H 1A0IA 4ZHQA 1N33H 5KHHA 4R7RA 4NXNB 5CB4B 4O4HB 3PN1A 3RGXA 3JATA 3E22B 1M0TA 5D5QA 4JI7B 2F4VB 2F66C 3OTOH 2PGGA 1HR0H 1XNQH 3BPZA 4CC5A 2HVQA 2ZNIA 2BTOA 3W1BA 5K1XA 3N43B 5BR8H 2UUBB 1IBMH 4JYAH 4LF7H 2PUSA 3BA9A 1HNWB 4K8XA 5IYZA 5KMGA 5JH7A 3F8NA 1Z2OX 4JI6H 1SKVA 4CS2A 1CKNB 4CS4A 4DV7B 1Q5OA 2BTQB 4DRXB 1M0WA 5LOVA 3RYHB 4JI1H 1J5EB 4AQYB 1XNRB 1V9PA 4FM9A 4IAJA 5CA0A 3CVZA 4RB2C 3JAWA 4X20A 1SEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOI A;  3RR5 A;  3W1G A;  3KYH C;  5LMU B;  4DR7 B;  1N33 B;  1P8L A;  3BAB A;  1ZAU A;  3OTO B;  3JSN A;  3T1H B;  4K0K B;  2HVR A;  2Q2U A;  4EEQ A;  1XNQ B;  1FVI A;  1CKM A;  2HIX A;  5DIS C;  4YHH B;  2Q2T A;  2UXB B;  4DV2 B;  4DR2 B;  3BAA A;  4DV4 B;  4LF4 B;  1P16 A;  4UCT A;  4LFA B;  5D1P A;  2E5L B;  2UXC B;  4LF9 B;  4GLX A;  1I94 B;  4UCS A;  4DV0 B;  4LH7 A;  4UFZ A;  4B3M B;  1CKN A;  4JI3 B;  2HHH B;  1X9N A;  2UUA B;  2ZM6 B;  4LF6 B;  5D1O A;  3GDE A;  4DR1 B;  2OWO A;  1DGS A;  4JI1 B;  4KHP B;  3L2P A;  1N36 B;  2VQE B;  2HIV A;  4X62 B;  5LMN B;  4DUZ B;  3TY5 A;  4DV3 B;  4DV1 B;  4DR4 B;  4DV6 B;  1N32 B;  1XK5 A;  4DV5 B;  2VUG A;  3TY8 A;  4B3R B;  3QWU A;  2HVS A;  4UCO A;  4DR6 B;  3VNN A;  4DR3 B;  4B3S B;  1FJG B;  3NBY B;  4NXM B;  3T1Y B;  4UCV A;  5IWA B;  4X65 B;  1TAE A;  4LF5 B;  2CFM A;  3NBZ B;  4PZ6 A;  4DUY B;  1TA8 A;  3W5O A;  1N34 B;  4UCR A;  4JI4 B;  4JI5 B;  4EQ5 A;  4LH6 A;  4LFB B;  1S68 A;  4JI0 B;  3RTX A;  2UXD B;  1B04 A;  4EFE A;  1A0I A;  4DR5 B;  2UU9 B;  3S24 A;  2VQF B;  4EFB A;  4NXN B;  1XMO B;  3PN1 A;  4JI2 B;  1VS0 A;  3GJX B;  4DRF A;  4JI7 B;  2F4V B;  4PZ7 A;  1CKO A;  3UQ8 A;  1HNZ B;  4JV5 B;  1XDN A;  4LF8 B;  4CC5 A;  4CC6 A;  2HVQ A;  3W1B A;  3GB8 B;  2UUB B;  2UUC B;  1IBL B;  5FPO A;  1XMQ B;  1IBK B;  3BA9 A;  4YY3 B;  1HNW B;  3BA8 A;  1HR0 B;  5FPR A;  3TY9 A;  5BR8 B;  1IBM B;  1CKN B;  4JYA B;  4LF7 B;  3NC0 B;  4DV7 B;  3SGI A;  4B3T B;  5D1O B;  1HNX B;  4LFC B;  4UCU A;  4GKJ B;  4X64 B;  4X66 B;  4JI8 B;  4JI6 B;  1J5E B;  4AQY B;  1XNR B;  1V9P A;  4GKK B;  4E6N A;  3JSL A;  4OX9 B;  4PZ8 A; 
#chains in the Genus database with same CATH topology
 3ZBH A;  2W6O A;  1QR8 A;  4DV2 H;  3LDD A;  4DV4 H;  4RCN A;  2D3O W;  2RDJ A;  2IJK A;  3K08 A;  4MVR A;  4RNO A;  1R3J C;  5DM6 V;  5C5J A;  1TVK A;  1FFX A;  3K03 A;  5H2F Z;  2HIX A;  1HDJ A;  3D36 C;  3L75 H;  2R7L A;  4ZBM A;  4NXN O;  3GLK A;  1BE3 H;  3GV7 B;  2ZXW C;  3L74 H;  3GQC A;  3PO3 G;  3EHB B;  2AXT Z;  3ZCC A;  3CE2 A;  5KT2 A;  1SA0 A;  1K4D C;  1I50 A;  3WU2 Z;  3HBL A;  4I0X B;  2EJR A;  2V58 A;  3AEI A;  4FGR A;  1OV9 A;  1M90 W;  5C8Y F;  4R6Z A;  5KG4 A;  1RM1 B;  3KRE A;  1WN7 A;  2WAQ E;  3OSN A;  4O7V A;  5IYC G;  2LW7 A;  1MNG A;  2Y4U A;  2KSW A;  2WYO A;  1A0G A;  4DV7 O;  5KFO A;  3I5D A;  4CH5 A;  1GH6 A;  2JA7 A;  2B1I A;  3N6X A;  4C2M A;  3ZN1 A;  4IRK A;  1YI2 V;  5IWA H;  3SYC A;  4O2B A;  1ZTE A;  3SYA A;  4I7H A;  3DGE A;  4DR3 B;  4WFH A;  3T9A A;  4HZ3 A;  3P3P A;  1EN5 A;  4DV7 H;  3E8H A;  2NU8 B;  3W5O A;  1WCM A;  1ET0 A;  1QLE C;  2JDI G;  1XNR H;  4FZ0 A;  5T14 A;  1XMO H;  3GID A;  2JA5 A;  2AZ0 A;  5JVD F;  3KHL A;  1NR1 A;  3G6V A;  4PDL A;  4RO2 A;  3C3S A;  3MHH C;  5J2T B;  1IBL H;  3NUA A;  2B5U A;  3AG1 B;  1CKO A;  5JVL A;  4R50 A;  4NR1 A;  3T5L A;  1K5Q A;  2PF4 E;  2WLN A;  2HFE C;  3JCZ A;  5FNV A;  4JTA B;  2WTF A;  1JFF A;  1N34 O;  5FPO A;  4O4H F;  1VQ5 V;  3K5M A;  5DQI A;  3PVX A;  1VAR A;  2UXC H;  2FK3 A;  2J6T A;  1I6U A;  5EK0 A;  3CPW U;  3T2M A;  4O81 A;  4IHJ B;  2YI8 A;  4RU9 A;  4B3T B;  1HNX B;  2FYU H;  4G28 B;  5BWV A;  4ZOL B;  3DXR A;  4GKJ B;  4H33 A;  1VQO V;  2DQ0 A;  5K2M A;  2Q73 A;  4YJ3 A;  1NBM G;  4ED2 A;  3HKE B;  3ETH A;  4J9O A;  4HNA A;  3E83 A;  4X62 H;  2EIL C;  4UV9 A;  3I55 V;  1MA1 A;  1JQ0 A;  2WLL A;  5LHH A;  4FLY A;  1GN2 A;  2C2A A;  4QGP A;  3JSN A;  4I4T B;  1WRV A;  5BWR A;  4K6N A;  5LA6 A;  1I94 H;  2R6F A;  2B63 A;  2C28 A;  1QLN A;  3ZN0 A;  4R8U B;  2I80 A;  4MV4 A;  2XGQ A;  3LSQ A;  1NTZ H;  1KJI A;  4LF6 H;  3GTO A;  2HEP A;  2E5L B;  2DN9 A;  3JD0 A;  4WHX A;  5HBR B;  4FFO A;  4APM A;  3UFX B;  1GKF A;  4XYM B;  3K5N A;  4FPP A;  5EZY F;  4M7E A;  4IT5 A;  3LWB A;  4D6T H;  4ECW A;  3N2G A;  4DR4 H;  5EC2 C;  1MG1 A;  2BE3 A;  3UT5 B;  3P30 A;  1BQ0 A;  5LL6 b;  2UU9 H;  4O4J B;  2X7R B;  3C0F B;  4PI2 A;  3G6E V;  1HP8 A;  1M6V A;  1I1M A;  2R8K A;  2AGP A;  1JKJ B;  2R92 A;  1N8R W;  1FJG H;  1I0H A;  1O9G A;  4ZHQ F;  3RAX A;  3H01 A;  3AG4 C;  5I5T A;  2J9G A;  2QKS A;  3EXA A;  4PDR A;  5KG6 A;  3A0R A;  5IJ0 B;  1S9F A;  5DGI A;  2CW8 A;  4IHJ A;  1NR7 A;  1TWG A;  3EPI A;  3Q8R B;  4LF5 B;  5LYJ B;  1ZHQ A;  3PW7 A;  2Q7E A;  4A93 G;  5KFP A;  5IYZ F;  2R9I A;  1D5A A;  4JI5 B;  2QR4 A;  4NVP A;  1KJJ A;  1PK8 A;  3U55 A;  2XND G;  3M7M X;  2F4V H;  1PL0 A;  4NTX A;  4GX1 A;  2JA6 A;  4XBF A;  2R7Z A;  2DOS A;  3HT5 A;  4OXS A;  4X1Y A;  2FP4 B;  1KU9 A;  5CA0 F;  1Q90 D;  1DK1 A;  4I4T A;  3CRM A;  5KHJ A;  4UB6 Z;  1VBH A;  2W9B B;  4DL2 A;  3WWI A;  1HNW H;  4DR1 O;  1EKV A;  1ZL8 B;  5KFB A;  3GIM A;  5A2Q W;  1IBK B;  1AR1 B;  1CQI B;  2M05 A;  5DG9 A;  2W6I G;  1HR0 B;  4DV1 O;  2V1D A;  4AQY H;  3HKB B;  4DV6 O;  1NKD A;  1JA8 A;  1Y67 A;  3MDS A;  4JF3 A;  2Q68 A;  3OT7 A;  3FB7 C;  4ECY A;  4OPA A;  1VF6 A;  4O2A A;  5EYP A;  1KJQ A;  1PPJ H;  2EZO A;  2AZ2 A;  4O4J A;  3UZB A;  3ICX A;  4RUA A;  2Y0S E;  5I5W A;  1BHA A;  4YP3 A;  5JQW A;  4DV3 H;  2X6B A;  1GTO A;  4AI8 A;  2JK5 C;  4IYI A;  4LF4 H;  3J7A K;  3D36 A;  3WFV A;  4LFB O;  1N48 A;  1ZX3 A;  4EEQ A;  4YHH B;  3QG5 A;  2ZDH A;  2ZD9 A;  4DV2 B;  4DR2 B;  5LBQ A;  5IE9 A;  2GHY A;  4DV4 B;  2VQF O;  5IP7 G;  3N8D A;  1CXZ B;  5LYJ A;  3KCX A;  4ZQI A;  1UPG A;  2K9P A;  4JV5 O;  4J42 A;  3CWB H;  3PW5 A;  3LQS A;  2B1G A;  1Y1V G;  2YZG A;  1JDB B;  2GSM B;  3K57 A;  3MAQ A;  4F4Z A;  3SR2 C;  2XAH A;  4DUZ H;  5CMU A;  3FB8 C;  3RBZ A;  2ODM A;  5CA1 A;  3SYP A;  5H5N A;  2G38 A;  4NTW A;  5LHI A;  2EIM B;  3OR6 C;  3APQ A;  2WPD G;  2NN4 A;  2ILM A;  2HIV A;  1B33 N;  4J9P A;  2DYR B;  4EB6 B;  4B7K A;  3CCJ V;  4O83 A;  5L9X A;  3U11 A;  2YIB A;  2VUG A;  1RK5 A;  1I1L A;  5IJ9 B;  5C4X G;  3SJB C;  4IIJ F;  4TV9 B;  3FKI G;  3AG2 C;  5CM0 A;  4JAA A;  3KAL A;  2CGO A;  4ECQ A;  2E2H A;  2Q4P A;  3MJF A;  1SQG A;  5IWA B;  1Y4M A;  2HGS A;  4O82 A;  1X59 A;  1VQK V;  3I12 A;  1R73 A;  5BXZ A;  1S3J A;  4PA6 A;  4A3J G;  1OCZ C;  2ASL A;  3N2K B;  4DV5 O;  4IIJ B;  3M99 B;  2WLH A;  1IUR A;  3RB4 A;  5FLM G;  4X1K B;  3MFH A;  4H44 B;  3ZS8 C;  3ABM B;  4N23 A;  1AJP A;  4BBR G;  4LF8 H;  2GQS A;  3PR4 A;  5B66 Z;  3OE7 G;  4MVU A;  4HNV A;  3S24 A;  2ZE8 A;  1XMO B;  4GCZ A;  2Z5U A;  3T9F A;  2UUA O;  2ZM6 O;  3PZP A;  5B1A B;  3SNO A;  1XDN A;  3T54 A;  2YDE A;  4WCE V;  2IW5 A;  2HVK C;  2EZP A;  3G8D A;  1IBL B;  3GV8 B;  2UXB H;  4QWC A;  1GK9 A;  3E2E A;  1VQ9 V;  3CCQ V;  1TUB A;  3BFR A;  4LFC H;  5LMN O;  2OLS A;  2GV9 A;  1YTF B;  4U3F H;  4U3J A;  4I55 F;  1G2W A;  3KTM A;  1TUE B;  2R70 A;  2PYJ A;  4B3M H;  4ICG A;  2Q9L A;  2NUA B;  1TWC A;  2VA2 A;  2ZM6 H;  2IU3 A;  1IOV A;  4UCU A;  4DR7 H;  1M57 C;  4GKK B;  2WWW A;  2ZE5 A;  2W57 A;  1DLB A;  4O3R A;  2B9Z A;  3RVZ A;  5JJJ B;  2UUB O;  3RJ0 A;  3STL C;  2FJZ A;  4FFL A;  4I55 B;  1OCR B;  3LDE A;  3T4D A;  3MR5 A;  4GX0 A;  2OCC C;  4FVM A;  3E8B A;  4DQN A;  2XCA A;  3BAB A;  1L0L H;  2WSS G;  3R23 A;  3OTO B;  2CE4 A;  4LFA H;  1SQX H;  4ZI7 F;  4DIM A;  5BPH A;  4YR3 A;  1XNQ B;  3DTF A;  1SS3 A;  2HJF C;  1NVP D;  5KG5 A;  4XX0 B;  3GV5 B;  5LGU A;  4KHP H;  4UVA A;  3WB1 A;  1F51 A;  1I94 B;  3SPG A;  1JDE A;  5KS8 A;  1R9T A;  2UVV A;  4O4L F;  4LF6 B;  1VMG A;  2Y4T A;  5LOV B;  1AIL A;  2PMZ A;  2UXD H;  4GLW A;  4J41 A;  4O4I B;  3ETJ A;  2Y69 C;  1Y76 A;  4LR3 A;  4PA7 A;  1FYJ A;  1S0M A;  4NYK A;  2IU0 A;  2YU9 A;  4DR4 B;  4IGG A;  5KLV H;  1JCH A;  2V7Q G;  2V4Q A;  4X64 O;  3GTG A;  4AYB A;  4QWD A;  3CJH B;  4TQF A;  1C3O A;  4MTG A;  5DQG A;  1MAB G;  2YI9 A;  5BWX A;  2R7K A;  1RJQ A;  2C2D A;  1FJG B;  4LNU A;  1MMM A;  4FFM A;  2PI4 A;  3ZX6 A;  4J9Z B;  2QM4 A;  3JAM N;  4O7L A;  3QO8 A;  1FKA O;  4LCU C;  3Q8S B;  2DW4 A;  4AIL C;  4DUY B;  3N6R A;  2WAM A;  3U54 A;  3PW2 A;  3GTM A;  3APO A;  4GUN A;  2A0L A;  2QGN A;  1N33 H;  2C2R A;  4DR3 O;  2AU0 A;  2NVX A;  1YCI A;  3OUF A;  1M0T A;  4WD3 A;  2HHH O;  5KFQ A;  2Z3Y A;  4JI7 B;  1AR5 A;  2F4V B;  5DLF A;  3PW4 A;  3BQ0 A;  2LFR A;  1RJP A;  5L3E A;  1IBM H;  4JYA H;  4LF7 H;  2I87 A;  1R6K A;  2DE0 X;  1W0J G;  3RW0 A;  3STZ C;  2ZE7 A;  4TUY F;  5KFH A;  1K97 A;  2PUS A;  4QIW F;  3BA9 A;  1UC8 A;  3HKZ E;  1HNW B;  1GM7 A;  4K8X A;  2QK4 A;  4O7W A;  5JH7 A;  1Z2O X;  3WG7 B;  1BQZ A;  1N32 O;  3OEE G;  4CS4 A;  1Y6X A;  5A2Q N;  3S3X A;  4DW1 A;  4DRX B;  2ZE6 A;  5LOV A;  2KG7 B;  3TGU H;  4FZ1 A;  4IRC A;  2VUM G;  4AQY B;  2BSK B;  5LP6 F;  2QWQ B;  1Q86 W;  2CTR A;  4UXN A;  3CVZ A;  4MAM A;  4X20 A;  3G4S V;  2IMW P;  3ETG A;  2F43 G;  2EIN C;  1SES A;  3RYI B;  1JIH A;  1BL8 A;  4CE5 A;  2R8I A;  3ZHV A;  3JCU Z;  1SZT A;  3HKD B;  5I5X A;  1SF9 A;  4GX5 A;  1PP9 H;  2JVD A;  4CMD A;  4B3T O;  1SQF A;  1GGO A;  2RNB A;  4LF9 H;  1M1K W;  3I4N G;  2EIK B;  1EZJ A;  4LF4 B;  1QNM A;  3EVK A;  3UM7 A;  3FAV A;  3KHR A;  5KX5 A;  3RN4 A;  4PA4 A;  1KUT A;  1VQ8 V;  4BWS C;  3RAQ A;  1YJW V;  2OCH A;  3SDL A;  1ZQ7 A;  1FFT B;  1S10 A;  3LNN A;  4C5A A;  3IGA C;  4WFE A;  4FLU A;  1I5X A;  3JAL A;  3RYC B;  2DZD A;  5GTI Z;  4GYC B;  5BYA A;  2JGU A;  4I50 F;  1A48 A;  3D3Q A;  2WA4 A;  5BZB A;  1B6Q A;  4DUZ B;  1B6R A;  4DK0 A;  4M0J A;  1FPO A;  1ARO P;  4JTD B;  5CBG A;  4CKB A;  3MWE A;  2CAZ C;  4NTY A;  1EUD B;  3IG0 A;  1WPB A;  2QTO A;  2ZIN A;  4MV1 A;  1DF4 A;  2YEV A;  2AGQ A;  3UO3 A;  1TAE A;  2Q0O C;  2JA7 G;  3NBZ B;  1US6 A;  4MVZ A;  2L35 A;  4MTF A;  3ABK C;  2FLP A;  1N0N A;  3OM3 B;  1RYR A;  1JXL A;  3B8M A;  4TV8 A;  2P0A A;  2XIG A;  4W4K A;  1B04 A;  4DR5 B;  2N05 A;  1RSO A;  2XTA A;  4JI3 O;  1WCM G;  4JYY A;  4CH6 A;  4A2A A;  1J95 A;  1TVK B;  1FFX B;  2GTS A;  3CC4 V;  4LF8 B;  4CMF A;  3G6B A;  3H9V A;  3L70 H;  4CC6 A;  3K5O A;  1I2K A;  1N36 O;  3AG7 A;  5KA5 A;  2UUC B;  3RFC A;  3T99 A;  1JPX A;  1EM1 A;  4CKC A;  4DXW A;  2Q69 A;  5CB4 F;  1GMG A;  3U10 A;  1Q81 W;  5HV6 A;  5KFM A;  5KG0 A;  5KUK A;  1LR1 A;  1SA0 B;  1BHB A;  3F5T A;  3E8F A;  3A0B Z;  1NVP B;  4EG0 A;  4OX9 H;  2CUG A;  2EUL A;  3HPL C;  4B3R O;  2QJ1 A;  4LFC B;  1GM9 A;  2YL2 A;  4O2B F;  4J9Y B;  2A79 B;  2NU9 B;  4NLG A;  1N36 H;  5IDJ A;  2W7O A;  1L2Z A;  2ZIO A;  3T1Y O;  1P4R A;  1VQ6 V;  3L71 H;  4ECS A;  5L1L A;  1UFI A;  3TXS A;  1IBK O;  2Y0I A;  4DR7 B;  1Q8I A;  4Q43 A;  1NQT A;  2ITC C;  1P7B A;  2NLJ C;  4M9U A;  3F7Y C;  3K04 A;  3KZI Z;  1EZV H;  4O2B B;  3CCM V;  5BPF A;  2ZNJ A;  2CNV A;  1CKM A;  1KP3 A;  3B8N A;  3BAC A;  3ZRX A;  1YVW A;  4DL6 A;  4UCT A;  3HR0 A;  4LFA B;  2VRZ A;  4ECV A;  1HNZ O;  1OCC B;  1SCU B;  2J6S A;  4LBE C;  1KKD A;  3RB0 A;  5IP9 G;  2VQE H;  1GN6 A;  3MWM A;  5AG2 A;  1HWY A;  2B63 G;  3JZ6 A;  4KHP B;  3ABT A;  1V54 B;  3ZJZ A;  2YIB D;  3FDS A;  3PW0 A;  3ABL B;  4DR2 O;  2HP8 A;  2VWJ A;  4ED7 A;  2EBO A;  1I7N A;  2P67 A;  4NYE A;  2VS0 A;  3V4Z A;  5KG3 A;  5FNV B;  1BZK A;  4X66 O;  4JI8 O;  1S72 V;  1WPX A;  3GWO A;  1JFF B;  2ZIM A;  4XDK A;  1XK5 A;  3K0G A;  1M56 B;  2OH2 A;  2HLD G;  2OIE A;  3PJS K;  1MZB A;  3OHA A;  2ASJ A;  5LMU O;  4NXM B;  2COJ A;  4C7U A;  4LSX A;  5KFE A;  4IYH A;  1URF A;  2R92 G;  1NH2 D;  3UZO A;  3BVO A;  3W7W A;  4WBN A;  2E74 B;  3DXR B;  5GON A;  3T1H O;  4X66 H;  3ORR A;  4YJ3 B;  3JAR A;  2UVW A;  3RV4 A;  4MVS A;  3GIK A;  4NXN H;  4KUM A;  2AGO A;  5H6Q A;  2YRX A;  4HNA B;  2DYS C;  1Y1W A;  3OMI B;  3ETD A;  1BGY H;  4X1I A;  3GTP A;  2LFS A;  4BWA A;  1KYO F;  2WLL B;  4EFB A;  1K7D A;  4DV0 O;  5LXT A;  4J9L A;  4DL3 A;  3GJX B;  5L3D A;  1U97 A;  4NB5 A;  4DRF A;  4J10 A;  1RFY A;  2QTS A;  3K9S A;  1KP2 A;  2LO1 A;  5LA6 B;  1I2L A;  4WFA V;  2MK3 A;  1NZ6 A;  5DGH A;  4MTD A;  5J2T F;  1K3E A;  4EGQ A;  2JA6 G;  3THO A;  3CXC U;  4YBZ B;  2R7Z G;  4IRD A;  2AHZ A;  2FML A;  3MD0 A;  2BR0 A;  2E76 B;  3ZED A;  1IBM B;  4JYA B;  4LF7 B;  4MA5 A;  4OPH A;  1OHH G;  4O7Y A;  3AK3 A;  1M4U A;  2V59 A;  3C3T A;  3PR5 B;  3N2G B;  4BW9 A;  4DR6 O;  3G6X A;  5EBM C;  2LQT A;  2FLN A;  4IHJ F;  3CC7 V;  4XDJ A;  3UO2 A;  1DV2 A;  4Q4C A;  3BHP A;  2H8P C;  4TOI A;  3ZMZ A;  3W1G A;  2WDT A;  3OHB A;  3H40 A;  1K4C C;  4ZOL F;  1P8L A;  1M9N A;  4BIO A;  1OJH A;  5J2U A;  1S0N A;  5JJN B;  1RP3 B;  2HVR A;  1F4M A;  3MR3 A;  4DR6 H;  2JIZ G;  1KTA A;  5DIS C;  5DLG A;  1F4N A;  2P7T C;  3ZMT A;  4JAS A;  3BAA A;  4YR2 A;  4GKK O;  1P16 A;  1XOU A;  5CA3 A;  4PD4 F;  4JI2 O;  4I4T F;  4NKG B;  4LF9 B;  2COI A;  3BQ2 A;  2W6N A;  1N34 H;  4P9P A;  3M9N B;  2N74 A;  1EN4 A;  1AUV A;  3GTK A;  2QEX V;  5D1O A;  1S5H C;  1PL4 A;  1SQV H;  3CXH F;  2W6M A;  5KFV A;  3OTO O;  2R82 A;  3TK1 A;  3MFI A;  4X1Y B;  3VQX A;  1XNQ O;  4RQE A;  4YAJ B;  4EEY A;  3CSW A;  1SFO A;  2P06 A;  3P3N A;  5BR8 O;  4UB8 Z;  4CZZ A;  5DMX A;  2EIJ C;  3V4S A;  3J80 W;  4J9K A;  3IJ4 A;  2QM8 A;  3A2F A;  4A3D G;  5HFM A;  1YTF D;  3LML A;  3LUL A;  5JQG B;  2FPP B;  4JI6 O;  1K92 A;  1GSO A;  2R9R B;  4BIU A;  4O4J F;  2RDI A;  1K5S A;  4FFB A;  4MVO A;  1TGO A;  5BMV A;  3TW7 A;  5KUM A;  1VF5 B;  5F9L A;  3B2E E;  4MW8 A;  5ITZ A;  3KHH A;  2WE6 A;  5IYB G;  2EX3 A;  2E2I A;  2RF4 A;  3BY6 A;  2D2C B;  5IY5 C;  5C8Y A;  3CCR V;  1W2B U;  3HOV G;  4O2A B;  5EYP B;  4K0K O;  1BNC A;  3TW6 A;  4Q0Y A;  2ABJ A;  4J0M A;  4P30 A;  4BBS G;  1KT8 A;  5LYJ F;  4EFE A;  4I5S A;  1K9M W;  1V55 C;  3ASO C;  3N40 P;  1ZET A;  2YZM A;  3QZ7 A;  3QFF A;  5L3C A;  3UQ8 A;  1BS3 A;  4K0K H;  2ZXW B;  3PO2 G;  5IYD O;  2XAJ A;  4DUY O;  2Q8V A;  4LC1 A;  2XCL A;  5DGB A;  4JAU A;  1XL6 A;  4J7J A;  1XMQ B;  2ZDI C;  3T9B A;  3RWR D;  4YY3 B;  2CGN A;  1IOW A;  3IN5 A;  5BWW A;  3T5K A;  5EBW C;  1BJT A;  4IZO A;  2R8J A;  4KXR A;  3ASN C;  2F95 B;  3WO1 A;  5JVD A;  4A5U B;  5KFL A;  4JI7 O;  4RAI A;  5CA1 B;  4B7E A;  4YR0 A;  3OUS A;  5B1N A;  2IP4 A;  3FX7 A;  3GIL A;  1UC9 A;  4RZR A;  4A3L G;  4Y8V B;  3U9T A;  2JEJ A;  2EJ3 A;  1H2S B;  4OX9 B;  3F7V C;  1C30 A;  4MVQ A;  4X65 O;  1H2M A;  5JQG A;  2MCT A;  2H94 A;  3L72 H;  4GC6 A;  4O4H A;  2XHB A;  3E22 A;  1FXK C;  1W0K G;  2Q7H A;  1SZX A;  1PNL A;  4O7R A;  4JI0 O;  2Q5Z A;  3SYO A;  2R8G A;  3A8T A;  3DC5 A;  2DAA A;  1QLE B;  2GUZ A;  1OCR C;  4D7S A;  5D1P A;  3VPD A;  4DR1 H;  1NTK H;  3AG3 C;  4J9Q A;  4UCS A;  3RVY A;  2RGR A;  4QIW E;  1IXM A;  1RPO A;  1CKN A;  2A9H A;  1NH2 B;  2HR3 A;  1XI1 A;  2BTQ A;  4WFG A;  2OWO A;  4JI1 B;  4DV1 H;  2JRI A;  4DV6 H;  3RIZ A;  3MHS C;  2XT9 A;  4QSH A;  4O84 A;  1NJI W;  3VQW A;  2VQE B;  2CK3 G;  3KCY A;  4YXW G;  3UKM A;  4QW8 A;  3CB2 A;  3TY8 A;  1YIJ V;  1TUB B;  1KC7 A;  1W96 A;  4U3J B;  3O65 A;  3JD4 A;  5KA6 A;  1JMK C;  1I7F A;  3CS5 A;  4O3O A;  5E25 A;  4YJ2 A;  1YZB A;  4LFB H;  1VIB A;  5IT9 W;  1JX4 A;  3DSQ A;  4MV6 A;  3EPG A;  4TV9 F;  4FM2 A;  2E3C A;  2P4K A;  1FAF A;  2EIL B;  2VQF H;  1Z2N X;  2PBZ A;  3R5X A;  4QE7 A;  3CCS V;  1JJ2 U;  5TIS Z;  1H2L A;  4FE2 A;  4RB1 A;  4Q4D A;  1RJR A;  4JV5 H;  3OSP A;  4ZHQ A;  4IWY A;  3W7T A;  5KHH A;  1RK6 A;  4NXN B;  3RGX A;  3JAT A;  1IDS A;  1FS0 G;  2RDC A;  3WO0 A;  3T9E A;  4CC5 A;  3RT3 C;  2HVQ A;  1K73 W;  2ZNI A;  2BTO A;  3K3P A;  5CBH A;  4FU0 A;  1H2K A;  3B09 A;  1CP9 A;  3JD2 A;  4HYO A;  2QKA A;  1S5L Z;  2YSU B;  5CBF A;  4F4Y A;  5IYZ A;  5KMG A;  1EKP A;  2CKZ B;  4DR5 O;  2RMK B;  4DV7 B;  3RV3 A;  1T3N A;  1WB7 A;  1XNR B;  2CTQ A;  4B3S O;  4Z1M G;  2QWR B;  4UVC A;  1PM9 A;  5CA0 A;  2AHY A;  3FD9 A;  2W6P A;  3JAW A;  1Y76 B;  2UUC O;  2Y4R A;  4Q8E A;  4R7C A;  2X6C A;  2ZGI A;  4MV9 A;  3AG4 B;  2DLN A;  1TWA A;  4YAK B;  2RCV A;  3TCU A;  5KT7 A;  4JI4 O;  5EWE A;  4DV5 H;  2OTL V;  1PKX A;  3BQ1 A;  2YC0 A;  4A2B A;  2LP7 A;  2BQU A;  1B6S A;  1P84 F;  4DYL A;  4PWQ A;  2Q2T A;  1XDC A;  1M7J A;  4LNU B;  5H80 A;  4Q44 A;  4ED1 A;  2Y0P A;  1KJ9 A;  1F23 A;  1JR9 A;  5E79 Z;  4FBT A;  3JAS A;  1GRJ A;  2UUA H;  1WA8 A;  2UXC B;  1R3I C;  3K5I A;  2PI5 A;  2EJ2 A;  1U96 A;  2NNU A;  4PBC A;  1VBG A;  3ABU A;  2HHF A;  4RNM A;  2QDO A;  4ABM A;  4QW9 A;  1XBL A;  5LMN H;  4G3I A;  5LP6 C;  4TT3 G;  1UJW B;  2COG A;  4FLW A;  5JCO C;  3H3V H;  1EKF A;  2RJZ A;  4C5B A;  3K5H A;  3MWD A;  1OCO C;  3WNZ A;  4K8Z A;  1VQM V;  1YHQ V;  4QJF A;  2J6U A;  3TET A;  2ZCE A;  2CW7 A;  4X62 B;  1B3Q A;  3H1H H;  3TY5 A;  5LOV F;  1Q43 A;  3GTL A;  2FK2 A;  4K35 A;  3OMA B;  1J5E O;  4RQF A;  2F93 B;  4TQD A;  1NU1 H;  3M8A A;  2WAQ A;  2UUB H;  2MW2 B;  4O4I F;  4DLK A;  3F5W C;  3I56 V;  1P49 A;  1KBH A;  5JH7 B;  5I5Y A;  4FLZ A;  3RYF A;  5F2V O;  1QBZ A;  3FB5 C;  3LSS A;  2IJJ A;  4HBN A;  1K83 A;  3JAK A;  2ALZ A;  2JS3 A;  1TA8 A;  2ZT9 B;  4XZ3 B;  2KQX A;  4X20 B;  2QM7 A;  4QWA A;  4Q8F A;  1GM8 A;  4J9R A;  4BXX G;  2R72 A;  3AK1 A;  3OMN B;  4ECR A;  1F7Y A;  5EBL C;  2UU9 B;  4RB0 A;  3VMM A;  4NXM O;  4J9S A;  4LSA A;  4RNN A;  4ZKI A;  2W8K A;  1E1Q G;  3T1C A;  4EYH B;  1WLE A;  2ZDI A;  3OUU A;  4JGS A;  1DV1 A;  4CH4 A;  1KC8 W;  3FAV B;  3SYQ A;  1YJ9 V;  3CHX A;  5KX5 B;  1IX9 A;  3ML0 A;  4ECU A;  2V5A A;  4QE9 A;  3VPC A;  1Q6H A;  4X64 H;  1E4E A;  2M6Y A;  5FPR A;  3G67 A;  1R6T A;  3Q4H A;  3GIQ A;  3ZHQ A;  3RB6 A;  3JAL B;  3H0G G;  3ZHS A;  2R9A A;  3T5H A;  2RN9 A;  2YZN A;  3CQZ A;  4PEL A;  3E86 A;  5B1B C;  2NU7 B;  4P2Z A;  3ZHT A;  4YQW A;  1H8E G;  1FKA H;  2FLL A;  2Y48 A;  1T36 A;  3X2Q C;  3GIJ A;  2WLI A;  4YIP A;  4LWS A;  3AG2 B;  4RB3 C;  1CS0 A;  1VF7 A;  5EIB D;  4F4W A;  1VKZ A;  2XUM A;  3DC6 A;  4B08 A;  1M93 A;  1I1K A;  4L1K A;  4DR3 H;  1VQP V;  4CKE A;  2Z04 A;  2YEV B;  2DAB A;  2HHH H;  1OCZ B;  5H6R A;  2JEF A;  4PV1 B;  2XAQ A;  1ZLZ A;  1S0V A;  3LNM B;  2PYL A;  2Q6A A;  3KKY A;  2HGW A;  5IYC O;  2HG5 C;  4TV8 B;  4DR1 B;  4RUE A;  1DGS A;  3L2P A;  4PA3 A;  3I4M G;  3K59 A;  1N32 H;  3W7S A;  1D5N A;  1AI5 A;  4UUJ C;  3JZI A;  1L1F A;  1RSO B;  1AR4 A;  4ETS A;  5B3S C;  2YXL A;  4ZI7 A;  4FM1 A;  1HNX O;  4MTE A;  3CRQ A;  4DV1 B;  4DV3 B;  2DWC A;  2YIC A;  3E8G A;  4DV6 B;  2EIY A;  3TIN A;  1T5E A;  4GKJ O;  2KKW A;  5DG7 A;  1Z5W A;  1YSC A;  3T7A A;  2W9C A;  1Y74 A;  1G8M A;  2XCP A;  4U6P A;  3Q2O A;  1COW G;  1DIK A;  2VOB A;  2VPQ A;  3R5H A;  4GC7 A;  1TWF A;  1M57 B;  4O4L A;  1IYE A;  4MV3 A;  4LMY A;  5KT5 A;  1LUV A;  2P90 A;  3T4Z A;  4B3T H;  4AHC A;  4ECX A;  4GKJ H;  2OCC B;  1W93 A;  2XC9 A;  4FMT A;  2X6A A;  4LFB B;  3AW8 A;  3SPJ A;  2QB5 A;  3R5F A;  1AI7 A;  4MV7 A;  3B4S A;  5FD5 A;  3ETQ A;  3QF7 A;  4JUZ A;  4H13 B;  2E5L O;  2ODT X;  2M7W A;  2YRW A;  4PJ0 Z;  2VQF B;  3SPH A;  1PX2 A;  3FYI B;  4DO2 A;  2P6J A;  1RM1 C;  4JV5 B;  1S76 D;  1YIT V;  2R85 A;  2ZR2 A;  4FS1 A;  3NR7 A;  3D3I A;  1MZF A;  3CRA A;  3R9R A;  1Y1W G;  2W6Q A;  3NXS A;  3JD3 A;  2IBZ H;  3D8C A;  4A3I G;  3BA8 A;  5JWP A;  2UXX A;  4MSW C;  1EUC B;  1Z5V A;  3G71 V;  5L3G A;  3RBD A;  3SGI A;  5KFF A;  2F1M A;  4DL5 A;  2Y69 B;  3Q1K A;  2QF7 A;  3JZF A;  2HG8 A;  4I9W A;  5C3E G;  5A9G A;  2FMA A;  1E79 G;  2XAS A;  3ZIA G;  2JA8 G;  1E4F T;  2H3O A;  1XMQ O;  4LF5 O;  3H0G A;  5LL6 Y;  1R1B A;  2XGP A;  1QHT A;  4YY3 O;  4ME6 A;  1QQC A;  4JI5 O;  2WB1 A;  4TUY A;  2A06 H;  2Y0S A;  5GTH Z;  2FK1 A;  2UXB B;  2C22 A;  3JRX A;  3HOZ G;  3AG1 C;  4JI3 H;  2EJ7 A;  1M5I A;  3R66 A;  4CHI A;  2YZL A;  5FLX W;  2JEX A;  2BOB C;  4MTX A;  4WBN B;  4LF5 H;  1CE8 A;  5GON B;  4JV2 A;  4A3M G;  4GLX A;  3JAR B;  3IAY A;  4UFZ A;  4B3M B;  2ADP A;  3WB0 A;  5JCO A;  1A32 A;  4G2K A;  2JGD A;  4BIZ A;  2ZM6 B;  2UUA B;  3ZHU A;  4X1I B;  4I9Q A;  1HR0 O;  1THZ A;  3JRW A;  1DF5 A;  5LXT B;  2NU6 B;  5C1O A;  4B3R H;  1EBO A;  1PD3 A;  2W70 A;  5LMN B;  4O7T A;  2PTM A;  4JPR A;  5KFA A;  3TQT A;  2LW1 A;  5KFT A;  3SPI A;  1VP7 A;  3VQY A;  3T1Y H;  2CH7 A;  2OIG A;  4JTC B;  4L87 A;  2AGA A;  2X5R A;  2X0S A;  1IBK H;  1K8A W;  2PZS A;  1WJZ A;  4PDM A;  5FNV F;  4JI1 O;  3MR2 A;  4BR6 A;  3OR7 C;  2VWK A;  2DWE C;  2PY5 A;  2FPI B;  3E5N A;  3N27 A;  2EIN B;  4O86 A;  3HO8 A;  4UCR A;  4F6R A;  4O3N A;  4YHH O;  2P5O A;  3U0G A;  4I50 A;  2YCH A;  4DV2 O;  4DV4 O;  1S68 A;  4J9N A;  1HNZ H;  2HKO A;  2UXD B;  1VQN V;  3OFN G;  1T94 A;  1VQ4 V;  3CEI A;  4HQ6 A;  4YJ3 F;  5J2U B;  1L0N H;  3HKC A;  1K34 A;  1AJQ A;  3L9D A;  2YXY A;  5C1P A;  4YHH H;  2FE3 A;  4DR2 H;  2R93 A;  3ZRV A;  2ZDG A;  4YIO A;  1G4Y B;  1UNN C;  4JI8 H;  1QCE A;  5LA6 F;  4G27 B;  4A3F G;  3J81 W;  5D1O B;  3GIP A;  2OYQ A;  2QWN B;  4FIP C;  3CEB A;  2R87 A;  5BMV F;  5LMU H;  4X64 B;  2R86 A;  2BOC C;  3IFX A;  3H20 A;  1KBL A;  4QNH B;  2V4R A;  2W6Z A;  2VA3 A;  5IWA O;  3T1H H;  4EBC A;  1N33 B;  4J7Z A;  1I7L A;  5CB4 A;  3L4J A;  5KFS A;  4FFB B;  1ZAU A;  5BMV B;  3OGC C;  4DAA A;  5I5V A;  5ITZ B;  2YWV A;  5C44 G;  3ZRW A;  4DV0 H;  1KMI Z;  4MT8 A;  3ABK B;  1XNR O;  5KFX A;  2QA4 V;  2VPS A;  4A3C G;  1GN3 A;  1XMO O;  4K3A A;  4ECZ A;  5C8Y B;  2W8L A;  2PMZ E;  2Q67 A;  4UUG A;  2EJ0 A;  5KFC A;  3Q8Q B;  1VEW A;  1SQP H;  4I7Z B;  1ZSP A;  1LNQ A;  5LGT A;  1MOF A;  2HHH B;  4H37 A;  3CRC A;  2ADQ B;  4WF9 V;  1IBL O;  1CQJ B;  3GTQ A;  3K3W A;  4JYB A;  1E1R G;  3RYH A;  1AJN A;  3QNE A;  5EWG A;  4AYB E;  4J11 A;  3CCL V;  4HN2 A;  1JLL B;  1SQB H;  4O3Q A;  5D8D A;  1AB3 A;  5KHI A;  1PV0 A;  4DL7 A;  2UXC O;  1N32 B;  4BY1 G;  4YB8 B;  2HJW A;  4FK5 C;  1Q3E A;  3GWK C;  4Z2W A;  2ZR3 A;  4ZIB A;  4FLX A;  3K9A A;  1S5J A;  2Q7D A;  3OAA G;  3VNN A;  3ETE A;  2IH3 C;  5CE8 A;  5JQG F;  4EBE A;  3DTG A;  2HDK A;  3HOX G;  4CBC A;  3VOU A;  3OUZ A;  1K1S A;  2NVY A;  5JVD B;  4U7N A;  5EOY A;  4XDL A;  4X62 O;  3BCC H;  4GKK H;  3CRR A;  1A3G A;  4MA0 A;  2JS5 A;  1KD1 W;  4I0X A;  4JI2 H;  4QWE A;  4F50 A;  1Z2G A;  3G8C A;  1AI4 A;  4TM5 A;  5L3B A;  1BSM A;  5J9P C;  3HOY G;  4O2A F;  4FFR A;  3TII A;  1I94 O;  3LUT B;  2GQR A;  3V6H A;  4WFB V;  4O4H B;  1LUW A;  1GSA A;  3E22 B;  5D5Q A;  2VQD A;  3AYH B;  2F66 C;  1YJN V;  2YXH A;  4JXU A;  4LF6 O;  3OTO H;  2QYZ A;  4RUF A;  2PGG A;  3UCS C;  5KFD A;  3KG2 A;  4MV8 A;  1XNQ H;  2YID A;  2EIM C;  3L73 H;  3W1B A;  5BR8 H;  3N43 B;  1CPY A;  1I08 A;  1R6N A;  2DYR C;  2ZKO A;  2JJ1 G;  1S0O A;  2GUZ B;  1JOY A;  1XUQ A;  3DTU B;  1VQL V;  3H1J H;  5E1A C;  2R7M A;  4DR4 O;  4JI6 H;  1OZ0 A;  5FJ8 G;  1SKV A;  3S3W A;  4CS2 A;  3G6Y A;  4EYI B;  1CKN B;  3H1L H;  2UU9 O;  4JAV A;  1Q5O A;  1XIL A;  2BTQ B;  4W4L A;  1M0W A;  1YXB A;  2PN1 A;  1XEQ A;  1XRE A;  3TIG A;  5DG8 A;  4FM9 A;  3HKZ A;  2FB5 A;  1Q7Y W;  3CCE V;  1FJG O;  1GO3 E;  4RB2 C;  5KFK A;  1FXV A;  4YJ2 F;  3B77 A;  4J7K A;  3LSU A;  4O7S A;  2XAG A;  1KUQ A;  1BGW A;  3RGB A;  5CA1 F;  5J2T A;  2YS7 A;  3QQM A;  2GPW A;  4F6E A;  4PI0 A;  3ABM C;  5K3W A;  4JZ2 A;  1IVS A;  4L8J A;  1WP8 A;  3FFQ A;  4YJ2 B;  3CCU V;  3JAM W;  5EZY B;  4D7T A;  5B1A C;  1KEE A;  2FL4 A;  1EFR G;  2P4V A;  2F4V O;  2FKX A;  2P22 C;  5KFR A;  2DYS B;  5HNE A;  4DUY H;  3MR6 A;  4U7O A;  3E89 A;  3KXY T;  4JI3 B;  1FXH A;  4A3G G;  3NGD A;  5FLX N;  2UXN A;  5FL7 G;  3OD4 A;  4ZOL A;  4ZHQ B;  1HNW O;  1N36 B;  1V4Y A;  3LP8 A;  3P32 A;  4GX2 A;  2W0X A;  1XHZ A;  4OGQ B;  4HNU A;  4ED3 A;  3N44 B;  4NZO A;  2PVP A;  2W71 A;  3HB3 B;  3HKE A;  3JAT B;  3ZMU A;  1G1X B;  1GYF A;  3K58 A;  3CCV V;  3QZ8 A;  4JI7 H;  3WWJ A;  5I5U A;  2QKC A;  1S97 A;  4MW3 A;  1H38 A;  3H1I H;  4AQY O;  3RB3 A;  1R3K C;  2JEG A;  4B3R B;  2DPJ A;  4X65 H;  4UCO A;  1BCC H;  4XYL B;  2DMX A;  3GII A;  1QVG U;  4EGJ A;  5IYZ B;  5KMG B;  4IWX A;  3AK2 A;  3NBY B;  3KAJ A;  4E2L A;  3T1Y B;  4R8U A;  2W7P A;  3C90 A;  4UCV A;  1N56 A;  4JI0 H;  1OBD A;  2A3Q A;  4U7C A;  4DK1 A;  2CTW A;  4DV3 O;  2E75 B;  1G6U A;  5CA0 B;  4LH6 A;  3JAW B;  4DL4 A;  4LF4 O;  2R84 A;  2W0F C;  3DF7 A;  1H8H G;  1ZWI C;  1XQ8 A;  3UT5 A;  1BT8 A;  1ZUQ A;  5JJE B;  1VQ7 V;  2WB1 E;  3GVM A;  3DAA A;  2NR5 A;  5KAI Z;  1VS0 A;  2ATK C;  3EYY A;  4EKW A;  1HNZ B;  1WH2 A;  3K06 A;  4J80 A;  3TJT A;  2IM9 A;  4IL6 Z;  5F9N A;  3GB8 B;  3WB2 A;  4DW0 A;  3CSX A;  5EZY A;  3JAS B;  1SYX B;  3UYY A;  1WA8 B;  3KAK A;  4DUZ O;  5GW7 A;  3EFF K;  2HHF B;  5IJ0 A;  5KG7 A;  3K0D A;  3N42 B;  1EYZ A;  3VA7 A;  3TXQ A;  2XAF A;  3CX5 F;  4CH3 A;  2EIJ B;  5KT6 A;  1ORQ C;  4UV8 A;  2V4D A;  4X66 B;  4JI8 B;  3OTF A;  3ZRS A;  1GLV A;  3VOT A;  5EWF A;  2JEI A;  2LGQ A;  2AW9 A;  1WAZ A;  4QJF B;  3J81 N;  1S03 G;  1N0J A;  2CNU A;  5KKN B;  1HW7 A;  2IJI A;  5LMU B;  2W9A A;  3PFF A;  2DIK A;  2ITD C;  2N04 A;  1GAX A;  1AP6 A;  4F4L A;  5KFW A;  5B1O A;  5B5E Z;  3T1H B;  1Q6I A;  5IY5 B;  2W9B A;  5LGN A;  4JV1 A;  3HXL A;  3IC9 A;  1K33 A;  2BQR A;  1Q6U A;  1MZE A;  4GZR B;  1KJ8 A;  1OWT A;  1ZL8 A;  3RYF B;  4MVM A;  2YS8 A;  1E4G T;  4RZQ A;  3JAK B;  1I3Q A;  3WWH A;  4DV0 B;  4LH7 A;  3HKB A;  4LF8 O;  4BW5 A;  1V55 B;  2GLT A;  3ASO B;  2O57 A;  2Q0A A;  1X9N A;  2HGX A;  3JD1 A;  3SI8 A;  2WA3 A;  1Z2P X;  2RQ6 A;  4UVB A;  4RUC A;  3WG7 C;  1EZ1 A;  2R8H A;  4DR5 H;  4TQR A;  5L1K A;  3QO5 A;  1B06 A;  2UXB O;  4A3K G;  1GN4 A;  1FD9 A;  1PNM A;  4X8A A;  4P9O A;  4B3S H;  4LFC O;  1S77 D;  1W59 A;  4F4X A;  1WNS A;  5KHK A;  2UUC H;  3RGZ A;  2FB9 A;  4X89 A;  4B3M O;  1YEW A;  3ASN B;  4DR6 B;  1E4E B;  4ED0 A;  4JI4 H;  2CQY A;  4DR7 O;  3Q4H B;  4IR9 A;  3IC7 A;  2XD4 A;  1L8D A;  1WB8 A;  1XHX A;  1EN6 A;  1DTO A;  2EIK C;  3K5L A;  1N34 B;  5JH7 F;  2ASD A;  4EQ5 A;  5DGA A;  1JJO A;  4TVI A;  4HR7 A;  2IBK A;  4E4E A;  3TQ1 A;  3TEK A;  1FXK B;  4LFA O;  5KFZ A;  4A3E G;  2WLI B;  4LWS B;  4RWU A;  3BEH A;  2Z02 A;  4JI2 B;  2C2E A;  4H0L B;  3J80 N;  4ED8 A;  5KFU A;  2FTK A;  4PZ7 A;  4EB6 A;  4O7N A;  4EBD A;  4ED6 A;  5KFJ A;  4KHP O;  4LP8 A;  1AI6 A;  2QSA A;  3AG3 B;  1H2N A;  4MS2 A;  3CP1 A;  4PA9 A;  4PHZ A;  2IH1 C;  5DN6 G;  3A0H Z;  3H4B A;  5IYD G;  5IJ9 A;  4X9Q A;  1GSH A;  1GO3 F;  3RUP A;  3KHG A;  3BJY A;  4TV9 A;  4RAZ A;  3R65 A;  1J5E H;  3T9D A;  3J7A U;  3TY9 A;  5BR8 B;  4NZM A;  2UXD O;  1DAA A;  5D5P A;  3T9C A;  2ZJT A;  3NC0 B;  4Z1V A;  4O7Z A;  5BY1 A;  5KFN A;  1KKC A;  5KX5 F;  4TWK A;  3W7X A;  3CME V;  1AVM A;  4E6N A;  2RGV A;  4JI6 B;  3CYO A;  4E4T A;  4FLV A;  5FR9 A;  5L3F A;  3N2K A;  4IIJ A;  4X88 A;  4PZ8 A;  4ZI7 B;  4X1K A;  2GPS A;  2VR1 A;  2A1H A;  3RR5 A;  2JJ2 G;  3SJQ C;  4FBU A;  4N21 A;  3SJA C;  2W9C B;  1Y74 B;  2XOK G;  1EHI A;  3AX6 A;  5K1P A;  1Y1V A;  2YYA A;  1Y66 A;  2R7N A;  4K0K B;  3ORQ A;  2Q2U A;  2W6J G;  2DJV A;  2DQ3 A;  1ENV A;  1PNK A;  4NXM H;  4O4L B;  2CNQ A;  1YF2 A;  4KL1 A;  4CS3 A;  3RF2 A;  2X0L A;  4KP4 A;  3ZMS A;  1RYS A;  5CN0 A;  1MSD A;  2LJ2 A;  1N33 O;  4J9M A;  1Q82 W;  4QWB A;  2DPI A;  1KEC A;  3OGI B;  5L1J A;  1FXK A;  1ROP A;  3QTC A;  2DWD C;  1ULZ A;  2GBO A;  1OBG A;  2HJD A;  4Q6G A;  4BAY A;  2FPG B;  5BWT A;  3FKI A;  3VBB A;  1JVM A;  5KFI A;  4TQS A;  3O9O A;  3U0Z A;  1IBM O;  4JYA O;  4LF7 O;  1N4C A;  4I55 A;  4TV8 F;  3SE7 A;  5I5S A;  1AN7 A;  1YDX A;  4WFF A;  1BXR A;  4R8C A;  1KB9 F;  3HOW G;  2UVU A;  1V51 A;  2LGW A;  1SRY A;  3CMA V;  3V6J A;  4X65 B;  2OTJ V;  3RFR A;  2CFM A;  4RAY A;  4JYC A;  4PZ6 A;  3N41 B;  2IJH A;  5KT4 A;  4FLT A;  3H4D A;  1Y14 B;  1AUX A;  3CD6 V;  4JI0 B;  1OCC C;  2I8C A;  3RTX A;  3QVN A;  3B40 A;  1SC5 B;  4LF9 O;  4TUY B;  4O4I A;  1KQS U;  3QO7 A;  2YIA A;  5EDW A;  3HOU G;  1V54 C;  2ARH A;  5KAF Z;  5L1I A;  3LDC A;  2YUA A;  5KHG A;  3OEH G;  2WLM A;  3ABL C;  4PDB A;  2CTP A;  3BRC A;  5LHG A;  2K1E A;  3CJH A;  2YS6 A;  4FFN A;  1K1Q A;  1HNX H;  2ZQM A;  3FMA A;  1IZ3 A;  5LP6 B;  4O3P A;  1M56 C;  5C93 A;  1D2D A;  3CC2 V;  1NT2 B;  4HNT A;  5I47 A;  2JGD B;  1ZHS A;  5IT9 N;  1OCO B;  2Q7G A;  5KT3 A;  4Q45 A;  2GDS A;  5DQH A;  3ZMV A;  5I60 A;  5EIB C;  2R93 G;  3K3V A;  3FB6 C;  3JSL A;  2YW2 A;  1NS1 A;  1TWH A;  4MTO A;  2JEU A;  2GTA A;  4JZG A;  3KYH C;  3FKS G;  3VQV A;  4BY7 G;  5BWU A;  3SJC C;  2QE7 G;  1MSW D;  2CH7 B;  4TSF G;  1RPR A;  2E5L H;  1O75 A;  1FVI A;  2KSD A;  2UVR A;  1P7G A;  1NI8 A;  4IR1 A;  4F6R B;  5KG1 A;  3L4K A;  4I50 B;  3GTJ A;  1WP7 A;  4HAM A;  4ECT A;  3SPC A;  3T5J A;  4FM0 A;  2ZDQ A;  3GDE A;  4DRX A;  4WBN F;  1QR9 A;  1SET A;  2KG7 A;  5GON F;  2BSK A;  3Q8P B;  1O9H A;  3V6K A;  2AQ4 A;  2A7W A;  3VPB A;  2OT5 A;  3HKC B;  4QIW A;  2V9W A;  2Z0A A;  4FS2 A;  1IYD A;  5CAE B;  5HFL A;  3M9O B;  3BG5 A;  3E35 A;  3RYI A;  4ASU G;  3K79 A;  2C35 B;  2O03 A;  5EC1 C;  4DV5 B;  5H9C A;  2QWO B;  4GT1 A;  1QVF U;  3HB9 A;  5LXT F;  5DAA A;  3W7U A;  2FKL A;  3QWU A;  3HKD A;  2HVS A;  4PDV A;  2BCC H;  1IXB A;  5IYB O;  4OX9 O;  5FD6 A;  1XMQ H;  3OW2 U;  4YY3 H;  5LP6 A;  4B3S B;  4KFM A;  3GB7 C;  4JI5 H;  1QU7 A;  3M9M B;  1A9X A;  2JA5 G;  4NZN A;  4FFK A;  5B1B B;  4FFP A;  5JUM A;  4HYK A;  1SER A;  3H1K H;  1NTM H;  5KFY A;  3X2Q B;  2CZG A;  4JI4 B;  1X4T A;  5KG2 A;  3M4I A;  2SCU B;  2WLJ A;  2CDY A;  3RYC A;  2WLK A;  2ATL A;  4A3B G;  1A0I A;  1R3L C;  1AP5 A;  4R7R A;  5CB4 B;  3PN1 A;  3ZHR A;  2L6L A;  2F23 A;  1HR0 H;  5KFG A;  4FJC C;  3BPZ A;  3ZRW B;  2C00 A;  1H2G A;  3JYC A;  5K1X A;  2UUB B;  5DED A;  1CEZ A;  5J2U F;  2VUM A;  3G80 A;  2VQE O;  1WR2 A;  2BQ3 A;  1I5Y A;  3F8N A;  4QPJ A;  2HVJ C;  4Q20 A;  5DEC A;  2IA6 A;  1XL4 A;  2ETN A;  1WSC A;  1VAJ A;  3RYH B;  5B3S B;  4JV0 A;  1JX9 A;  4JI1 H;  4QPK A;  1SQQ H;  2QWP B;  1J5E B;  1V9P A;  5CR5 A;  5BYB A;  3U9S A;  4C5C A;  4O3S A;  4IAJ A;  3RBE A;  1BMF G;  2KB1 A;  3FYE B;  1SEI A;  1VF6 C; 
#chains in the Genus database with same CATH homology
 3RYI B;  4MV9 A;  1BGW A;  3RGB A;  4DV2 H;  5J2T A;  4DV4 H;  4DV5 H;  4A2B A;  3HKD B;  4PI0 A;  2JVD A;  1TVK A;  1SQF A;  1FFX A;  4L8J A;  2HIX A;  2Q2T A;  4LF9 H;  4LNU B;  3FFQ A;  4YJ2 B;  4LF4 B;  3JAM W;  5EZY B;  3JAS A;  4D7T A;  2UUA H;  5KX5 A;  4BWS C;  2UXC B;  2P22 C;  4DUY H;  1SA0 A;  3LNN A;  3KXY T;  4FLU A;  4JI3 B;  3JAL A;  3RYC B;  5LMN H;  5LP6 C;  4FLW A;  4ZOL A;  1WN7 A;  4GYC B;  4ZHQ B;  1N36 B;  1XHZ A;  5JCO C;  2JGU A;  3N44 B;  2RJZ A;  3HKE A;  3JAT B;  4K8Z A;  1GYF A;  2KSW A;  2WYO A;  3K58 A;  2ZCE A;  2CW7 A;  4X62 B;  4DUZ B;  4JI7 H;  4DK0 A;  3TY5 A;  4CH5 A;  1Q43 A;  3N6X A;  2F93 B;  4TQD A;  2UUB H;  4B3R B;  5IWA H;  2CAZ C;  4X65 H;  4UCO A;  4O2B A;  1P49 A;  5IYZ B;  1WPB A;  5JH7 B;  5KMG B;  4DR3 B;  2ZIN A;  3NBY B;  3IG0 A;  4I7H A;  3KAJ A;  3T1Y B;  4UCV A;  4FLZ A;  3RYF A;  1TAE A;  4HBN A;  4DV7 H;  4JI0 H;  3JAK A;  3NBZ B;  3W5O A;  1TA8 A;  4DK1 A;  1G6U A;  1XNR H;  5CA0 B;  1XMO H;  4LH6 A;  3JAW B;  4X20 B;  3DF7 A;  4TV8 A;  2XIG A;  1B04 A;  1XQ8 A;  2R72 A;  3UT5 A;  4DR5 B;  5JJE B;  4RB0 A;  2UU9 B;  5J2T B;  1IBL H;  1VS0 A;  4LSA A;  1RSO A;  4CH6 A;  1CKO A;  3EYY A;  1HNZ B;  4A2A A;  1TVK B;  1WH2 A;  1FFX B;  2IM9 A;  4LF8 B;  5FNV A;  4CC6 A;  3K5O A;  3GB8 B;  3WB2 A;  2UUC B;  1JFF A;  3CSX A;  4CH4 A;  5EZY A;  5FPO A;  3JAS B;  1SYX B;  3CHX A;  5KX5 B;  3K5M A;  3U10 A;  3KAK A;  2UXC H;  4X64 H;  5FPR A;  1I6U A;  1SA0 B;  5IJ0 A;  3N42 B;  4IHJ B;  2YI8 A;  3JAL B;  4OX9 H;  4B3T B;  1HNX B;  4CH3 A;  2QJ1 A;  4LFC B;  2R9A A;  4ZOL B;  2V4D A;  4X66 B;  4JI8 B;  3OTF A;  4GKJ B;  1N36 H;  4YJ3 A;  1L2Z A;  2ZIO A;  3HKE B;  1FKA H;  1S03 G;  4HNA A;  4X62 H;  1HW7 A;  5LMU B;  4DR7 B;  4RB3 C;  1VF7 A;  5EIB D;  1Q8I A;  4FLY A;  4B08 A;  1M93 A;  3JSN A;  4I4T B;  4O2B B;  3T1H B;  2ZNJ A;  3HXL A;  1CKM A;  5LA6 A;  1I94 H;  4DR3 H;  3RYF B;  2HHH H;  4UCT A;  4LF6 H;  4LFA B;  2HEP A;  2E5L B;  1E4G T;  4RZQ A;  3JAK B;  4APM A;  4DV0 B;  4LH7 A;  3HKB A;  2PYL A;  3K5N A;  2Q0A A;  1X9N A;  2VQE H;  1Z2P X;  3MWM A;  4M7E A;  2RQ6 A;  4TV8 B;  4DR1 B;  3N2G A;  4DR4 H;  1DGS A;  4KHP B;  3L2P A;  3UT5 B;  3K59 A;  4DR5 H;  1N32 H;  2YIB D;  5LL6 b;  2UU9 H;  4O4J B;  3C0F B;  4PI2 A;  2VWJ A;  4ETS A;  2YXL A;  4ZI7 A;  4FM1 A;  4MTE A;  4DV3 B;  4DV1 B;  5FNV B;  4DV6 B;  4B3S H;  1T5E A;  1FJG H;  1O9G A;  2KKW A;  1XK5 A;  1WNS A;  1Z5W A;  1JFF B;  2ZIM A;  5KHK A;  2UUC H;  3RGZ A;  1YEW A;  1MZB A;  4DR6 B;  2VOB A;  4JI4 H;  5IJ0 B;  4NXM B;  4LSX A;  2CW8 A;  4IHJ A;  4O4L A;  4LMY A;  1L8D A;  1XHX A;  4B3T H;  4LF5 B;  4AHC A;  4WBN A;  5LYJ B;  1ZHQ A;  5GON A;  2Q7E A;  3K5L A;  4GKJ H;  4X66 H;  1N34 B;  4YJ3 B;  3JAR A;  1D5A A;  4JI5 B;  4EQ5 A;  1JJO A;  4NXN H;  4NVP A;  4LFB B;  3M7M X;  4MV7 A;  2F4V H;  4HNA B;  5FD5 A;  3ETQ A;  3QF7 A;  4X1I A;  4BWA A;  4X1Y A;  2VQF B;  1KU9 A;  4EFB A;  5LXT A;  4JI2 B;  3GJX B;  4DRF A;  4I4T A;  4PZ7 A;  5KHJ A;  4EB6 A;  4JV5 B;  1HNW H;  5LA6 B;  4MTD A;  4PHZ A;  5A2Q W;  3THO A;  5IJ9 A;  1IBK B;  4TV9 A;  3BA8 A;  1HR0 B;  4RAZ A;  1J5E H;  4AQY H;  3HKB B;  3TY9 A;  5BR8 B;  1Z5V A;  3ZED A;  1IBM B;  5D5P A;  4LF7 B;  4JYA B;  3NC0 B;  2ZJT A;  3SGI A;  2F1M A;  1M4U A;  3N2G B;  4BW9 A;  4O2A A;  5EYP A;  2RGV A;  4E6N A;  4JI6 B;  4FLV A;  4O4J A;  3ICX A;  3N2K A;  4IIJ A;  4PZ8 A;  4ZI7 B;  4X1K A;  1E4F T;  3BHP A;  4TOI A;  3RR5 A;  3W1G A;  2WDT A;  4DV3 H;  1QHT A;  1P8L A;  1QQC A;  3SJA C;  4LF4 H;  5J2U A;  3J7A K;  4TUY A;  5K1P A;  5JJN B;  4K0K B;  2HVR A;  2Q2U A;  4EEQ A;  4DR6 H;  5DIS C;  4YHH B;  3QG5 A;  2UXB B;  4DV2 B;  4DR2 B;  4NXM H;  3BAA A;  4DV4 B;  4O4L B;  4JI3 H;  1P16 A;  1M5I A;  5FLX W;  4KL1 A;  5LYJ A;  4CS3 A;  4WBN B;  4LF5 H;  3RF2 A;  5GON B;  4LF9 B;  4GLX A;  3JAR B;  3IAY A;  1N34 H;  4UFZ A;  4B3M B;  3WB0 A;  5JCO A;  3K57 A;  3MAQ A;  2UUA B;  2ZM6 B;  5D1O A;  3SR2 C;  4DUZ H;  3QTC A;  4X1I B;  4I9Q A;  5CA1 A;  4Q6G A;  4X1Y B;  3VQX A;  5LXT B;  3U0Z A;  4B3R H;  2HIV A;  3J80 W;  4EB6 B;  5LMN B;  4I55 A;  3A2F A;  2PTM A;  1AN7 A;  3LML A;  3U11 A;  5JQG B;  2YIB A;  3VQY A;  3T1Y H;  2VUG A;  5IJ9 B;  4FFB A;  3SJB C;  5BMV A;  1TGO A;  1IBK H;  4TV9 B;  3B2E E;  5ITZ A;  2PZS A;  2WE6 A;  3KAL A;  2EX3 A;  2VWK A;  2PY5 A;  1SQG A;  5IWA B;  4X65 B;  5C8Y A;  3RFR A;  2HGS A;  2CFM A;  4RAY A;  4O2A B;  5EYP B;  4PZ6 A;  3N41 B;  4UCR A;  4F6R A;  4FLT A;  2P5O A;  4I50 A;  2YCH A;  3N2K B;  1S68 A;  4IIJ B;  4JI0 B;  4X1K B;  4Q0Y A;  1HNZ H;  4J0M A;  3ZS8 C;  3RTX A;  2UXD B;  4LF8 H;  4EFE A;  3S24 A;  3N40 P;  5J2U B;  1XMO B;  4TUY B;  4O4I A;  2YIA A;  3HKC A;  3UQ8 A;  4K0K H;  1XDN A;  5KHG A;  4YHH H;  4PDB A;  2FE3 A;  2UXB H;  3BRC A;  1IBL B;  4DR2 H;  1HNX H;  1XMQ B;  1TUB A;  3FMA A;  3RWR D;  4YY3 B;  4LFC H;  2GV9 A;  5LP6 B;  4U3J A;  1BJT A;  4JI8 H;  2R70 A;  2PYJ A;  3J81 W;  4B3M H;  1NT2 B;  1ZHS A;  2F95 B;  5D1O B;  5JVD A;  2Q7G A;  2OYQ A;  2ZM6 H;  4UCU A;  5LMU H;  4X64 B;  5EIB C;  5CA1 B;  4DR7 H;  4GKK B;  3K3V A;  3JSL A;  2W57 A;  3H20 A;  1H2S B;  5JJJ B;  4OX9 B;  3RJ0 A;  3T1H H;  4I55 B;  3KYH C;  3VQV A;  1N33 B;  5JQG A;  2MCT A;  4FVM A;  3SJC C;  3BAB A;  4O4H A;  5CB4 A;  2XHB A;  3L4J A;  3E22 A;  4FFB B;  1ZAU A;  2Q7H A;  5BMV B;  3OTO B;  4LFA H;  2E5L H;  5ITZ B;  1XNQ B;  1FVI A;  1O75 A;  4DV0 H;  1KMI Z;  2VPS A;  5C8Y B;  4D7S A;  5D1P A;  4DR1 H;  4KHP H;  3WB1 A;  4F6R B;  4UCS A;  1I94 B;  2RGR A;  3L4K A;  4I50 B;  1CKN A;  2HHH B;  4LF6 B;  4FM0 A;  3GDE A;  1XI1 A;  2BTQ A;  4DRX A;  2OWO A;  4JI1 B;  3RYH A;  5LOV B;  4DV1 H;  4DV6 H;  2UXD H;  3RIZ A;  1O9H A;  4O4I B;  3VQW A;  2VQE B;  3HKC B;  4LR3 A;  3RYI A;  5KHI A;  4DR4 B;  2O03 A;  1N32 B;  4DV5 B;  3CB2 A;  1Q3E A;  3TY8 A;  4FLX A;  3HKD A;  4ZIB A;  3QWU A;  2HVS A;  4TQF A;  5FD6 A;  1S5J A;  1TUB B;  1XMQ H;  2YI9 A;  3VNN A;  4YY3 H;  5LP6 A;  4U3J B;  4B3S B;  1FJG B;  4LNU A;  1JMK C;  1I7F A;  4JI5 H;  4YJ2 A;  4LFB H;  2QM4 A;  5IT9 W;  5JVD B;  3DSQ A;  4AIL C;  4DUY B;  2E3C A;  4FM2 A;  5EOY A;  4JI4 B;  1X4T A;  4GKK H;  2VQF H;  1Z2N X;  3M4I A;  2JS5 A;  4JI2 H;  3RYC A;  4RB1 A;  4JV5 H;  1A0I A;  4ZHQ A;  1N33 H;  5KHH A;  4R7R A;  4NXN B;  5CB4 B;  4O4H B;  3PN1 A;  3RGX A;  3JAT A;  3E22 B;  1M0T A;  5D5Q A;  4JI7 B;  2F4V B;  2F66 C;  3OTO H;  2PGG A;  1HR0 H;  1XNQ H;  3BPZ A;  4CC5 A;  2HVQ A;  2ZNI A;  2BTO A;  3W1B A;  5K1X A;  3N43 B;  5BR8 H;  2UUB B;  1IBM H;  4JYA H;  4LF7 H;  2PUS A;  3BA9 A;  1HNW B;  4K8X A;  5IYZ A;  5KMG A;  5JH7 A;  3F8N A;  1Z2O X;  4JI6 H;  1SKV A;  4CS2 A;  1CKN B;  4CS4 A;  4DV7 B;  1Q5O A;  2BTQ B;  4DRX B;  1M0W A;  5LOV A;  3RYH B;  4JI1 H;  1J5E B;  4AQY B;  1XNR B;  1V9P A;  4FM9 A;  4IAJ A;  5CA0 A;  3CVZ A;  4RB2 C;  3JAW A;  4X20 A;  1SEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...