4GLWA

Dna ligase a in complex with inhibitor
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
304
structure length
275
Chain Sequence
b'NKRMNERELVELETAYPEQVLADSPTHRVGGKVLDGFEKYSHQYPLYSLQDAFSREELDAFDARVRKEVAHPTYICELKIDGLSISLTYEKGILVAGVTRGDGSIGENITENLKRVKDIPLTLPEELDITVRGECYMPRASFDQVNQARQENGEPEFANPRNAAAGTLRQLDTAVVAKRNLATFLYQEASPSTRDSQEKGLKYLEQLGFVVNPKRILAENIDEIWNFIQEVGQERENLPYDIDGVVIKVNDLASQEELGFTVKAPKWAVAYKFPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure-guided design, synthesis and biological evaluation of novel DNA ligase inhibitors with in vitro and in vivo anti-staphylococcal activity.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Ligase/ligase inhibitor
total genus 73
structure length 275
sequence length 304
chains with identical sequence B
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.90 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 4glwA01
4GLWA 1ZAUA 3BACA 3SGIA
chains in the Genus database with same CATH superfamily
4XYMB 5JH7F 1X9NA 1VBGA 4FU0A 3OUZA 4JXUA 4HNVA 1B04A 4O4IF 1E4EB 3T54A 2I87A 3QFFA 2NU6B 2PBZA 2PN1A 2ABJA 2YZLA 3R23A 2HVQA 4E6NA 5BWVA 4CE5A 5BWTA 3Q1KA 4Y8VB 1WR2A 5BWRA 3PFFA 1CKMA 1I1LA 4TVIA 5JQWA 4O7ZA 5DGHA 1GSHA 1B6RA 3JZIA 4MV4A 2FPPB 2CNVA 5HV6A 3I12A 3N6RA 3TW7A 3RV3A 4CMDA 5BPFA 3T7AA 5C1PA 3JZ6A 3BA9A 2EJ0A 4O86A 5J2UF 4EGQA 2YL2A 2R7KA 2X5RA 5KS8A 1DV2A 4O7YA 2V59A 5GONF 4XX0B 5BWXA 3T9DA 2Y4RA 5I5XA 5LYJF 3V4SA 2XD4A 1C30A 2CFMA 3VPCA 2DWCA 2HVRA 4FFRA 4O7LA 4FGRA 3T9BA 1C3OA 1I2LA 1A0IA 1EHIA 1JLLB 2ZDQA 4IIJF 4O84A 5I5YA 1CKNB 2CNQA 1DGSA 2XCLA 3LWBA 4MA5A 2VQDA 1BNCA 1OBDA 4NZMA 2YZMA 4O2AF 4C5CA 3L2PA 4RZQA 4ME6A 3LP8A 2NU9B 5HNEA 1M0WA 1GSOA 3AW8A 3JSNA 1DAAA 1JDEA 3KALA 3ETJA 3HBLA 5CAEB 2FPGB 3K3PA 3BAAA 3DF7A 4YBZB 5CA1F 5CR5A 1I2KA 3WWHA 1SCUB 2P0AA 1A48A 5FR9A 1BXRA 1A9XA 3CSWA 2J9GA 3WNZA 5BWWA 1IOVA 5K3WA 4EQ5A 1W93A 2EIYA 5CB4F 1ET0A 2OLSA 3UZOA 2R7MA 2VUGA 1TA8A 1XK5A 2QK4A 1V9PA 3MWEA 3KYHC 4TUYF 3BG5A 4YB8B 3VA7A 2R84A 4GLXA 1KJIA 1CE8A 2HIVA 2YS6A 1M0TA 2GPWA 5C1OA 3DAAA 2R85A 4UFZA 5DAAA 5HBRB 2YRXA 4O4HF 3DTGA 3RUPA 5BMVF 5DMXA 2NUAB 4IWYA 5EZYF 4M0JA 1S68A 3QQMA 4GLWA 4O7SA 4MV7A 3K5HA 1VKZA 4NYEA 2WYOA 4FFPA 2R7NA 5BYBA 4M9UA 3WWIA 5IYZF 4TM5A 1GGOA 3SNOA 3TINA 4E4TA 3U9TA 3V4ZA 4UUGA 1B6SA 3VMMA 3AX6A 5KX5F 5JVLA 4K6NA 1UC9A 1OBGA 1UC8A 5FPRA 4C5BA 4EFEA 3U55A 4O7VA 2W6QA 2COIA 1I1MA 3R5FA 4PZ7A 4FE2A 1A3GA 4CHIA 3MWDA 1VBHA 2HHFA 2W6PA 4DRFA 2HHFB 1Z2OX 4TV8F 4UCVA 1AUXA 4FFOA 3GB8B 3TIGA 3RR5A 5D1OA 2W6ZA 5D1OB 4CKCA 1EZ1A 2ODTX 1W96A 1WRVA 2R82A 5DISC 4O2BF 4FFNA 2FPIB 5LP6F 4YJ2F 3U54A 3GDEA 2W6NA 2YZGA 5FNVF 3E5NA 4UCRA 1P16A 3K5IA 4TV9F 2V5AA 2Z04A 4XYLB 2OWOA 3KAJA 1CKOA 4MV6A 3TW6A 1JDBB 2A1HA 3JRXA 1KT8A 2NU7B 4I4TF 3LULA 2GQRA 4O7NA 1VS0A 5E25A 4HR7A 3W1GA 3GIDA 2EJ3A 1EUDB 3LQSA 4PBCA 3CEBA 4IHJF 3WO0A 2W6OA 4HNUA 4UCTA 3R5XA 2HJWA 3BA8A 4WBNF 1TAEA 4EEQA 3Q2OA 2VR1A 2W71A 5DGIA 2HIXA 2SCUB 2Q7DA 3NUAA 2HGWA 3VPBA 2COGA 1KJJA 4O82A 4XZ3B 2FB9A 1FVIA 2YWVA 2EJ2A 4IWXA 4O7RA 5K2MA 4QSHA 5I5UA 4O83A 1DV1A 3T99A 2CNUA 3TY8A 3G8CA 3HT5A 4HN2A 1DIKA 1Z2NX 5I5TA 2X0SA 1GSAA 5LXTF 4UCUA 4FFMA 2CZGA 2YRWA 4O4LF 3DTFA 3N8DA 2YZNA 1CQIB 2C00A 4LH7A 4ZI7F 3KREA 3JZFA 3TQTA 3JSLA 3RFCA 3BABA 2I8CA 4CKEA 2QF7A 3R5HA 4LH6A 4MA0A 3NBZB 1EYZA 5BPHA 4CKBA 2V58A 4YJ3F 4HQ6A 2HGSA 5CM0A 1ULZA 4YAJB 3TIIA 3KAKA 1KJ8A 3VNNA 2YW2A 4PZ8A 4CMFA 2DABA 2VPQA 3U9SA 3ETHA 1E4EA 4MV9A 4MAMA 4EGJA 2W70A 1KTAA 4DAAA 5BWUA 2R86A 3WWJA 2ZDGA 5CE8A 3OUUA 4UCSA 3VPDA 1KUTA 1P8LA 2Z02A 1PK8A 2FP4B 3HO8A 3ORRA 4Q4DA 5I5VA 3UZBA 2HVSA 1IYEA 2COJA 4DIMA 5C8YF 2DLNA 4O81A 2QB5A 3TEKA 4FFLA 1CS0A 4UCOA 1EUCB 4O4JF 3W5OA 4I55F 5H80A 1KEEA 3BACA 1GLVA 3NC0B 4ZOLF 5JVDF 4EFBA 2W6MA 3TY5A 1AUVA 4O7WA 1KBLA 3U0GA 5J2TF 4ZHQF 3GLKA 2Q2UA 2DZDA 4I50F 2DAAA 4NZOA 3WO1A 4NZNA 4CC5A 3T9FA 4IZOA 5I47A 2HGXA 3QWUA 1IYDA 2R87A 1Z2PX 3S24A 3SGIA 1A0GA 4MV3A 1JKJB 3G8DA 5D1PA 1KC7A 3W1BA 1CKNA 3RTXA 2YS7A 1EKVA 1I7NA 4YAKB 3PN1A 2HDKA 5LA6F 3T9AA 4PZ6A 5FPOA 1M6VA 1XDNA 3UYYA 4MV8A 3VOTA 4ZQIA 3ORQA 5CA0F 1IOWA 2GLTA 2R7LA 2GQSA 3UFXB 1T36A 4WHXA 2ZDHA 3T9CA 3UQ8A 3TY9A 4MV1A 2IP4A 4RCNA 1CQJB 4L1KA 5I60A 1ZAUA 5LOVF 4DLKA 1EKPA 3RV4A 4HNTA 2PVPA 1I1KA 5JQGF 5KKNB 2ZGIA 4Q4CA 5BYAA 1EKFA 2Q2TA 1PX2A 1KJ9A 4CC6A 3GJXB 4C5AA 3T9EA 3MJFA 2DIKA 2I80A 2HG8A 1G2WA 3JRWA 5I5SA 3HB9A 3SE7A 4EG0A 2YYAA 3NBYB 3R9RA 2GPSA 5I5WA 1KJQA 1I7LA 5D8DA 4DQNA 2NU8B 4O7TA
chains in the Genus database with same CATH topology
2QB5A 5FR9A 3TEKA 3CSWA 4JXUA 2A1HA 3T54A 5BWWA 1KT8A 3BACA 5K3WA 2EIYA 3LULA 1ET0A 2ABJA 5E25A 3UZOA 3U0GA 2EJ3A 5BWVA 3LQSA 4PBCA 4CE5A 5BWTA 4NZOA 2DAAA 3CEBA 4NZNA 5BWRA 3PFFA 3T9FA 5I47A 4TVIA 1I1LA 2HGXA 1IYDA 5DGHA 3SGIA 1A0GA 3TW7A 3DAAA 5DGIA 2Q7DA 5DAAA 4CMDA 3T7AA 2HGWA 3DTGA 3JZ6A 4IWYA 2COGA 2EJ0A 3QQMA 4GLWA 4M0JA 1EKVA 2EJ2A 4IWXA 2X5RA 5KS8A 5K2MA 5I5UA 2HDKA 3T99A 3T9AA 3HT5A 4HN2A 5BYBA 3WWIA 5I5TA 3UYYA 5BWXA 3T9DA 2Y4RA 5I5XA 4TM5A 3SNOA 3DTFA 4UUGA 4WHXA 3T9BA 3T9CA 4K6NA 1I2LA 1UC9A 4CKEA 1UC8A 5I5YA 4RCNA 5I60A 1ZAUA 2COIA 4CKBA 1I1MA 1EKPA 4CHIA 5CM0A 1A3GA 1I1KA 4NZMA 2HHFA 2ZGIA 4Q4CA 2HHFB 5BYAA 1EKFA 4CMFA 2DABA 1KTAA 4DAAA 5BWUA 4CKCA 2ODTX 3WWJA 1WRVA 3T9EA 5CE8A 3VPDA 2HG8A 1G2WA 1DAAA 5I5SA 4Q4DA 5I5VA 3UZBA 1IYEA 5I5WA 2COJA 5CR5A 1I2KA 3WWHA 4DQNA 5HNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLW A;  1ZAU A;  3BAC A;  3SGI A; 
#chains in the Genus database with same CATH topology
 4XYM B;  5JH7 F;  1X9N A;  1VBG A;  4FU0 A;  3OUZ A;  4JXU A;  4HNV A;  1B04 A;  4O4I F;  1E4E B;  3T54 A;  2I87 A;  3QFF A;  2NU6 B;  2PBZ A;  2PN1 A;  2ABJ A;  2YZL A;  3R23 A;  2HVQ A;  4E6N A;  5BWV A;  4CE5 A;  5BWT A;  3Q1K A;  4Y8V B;  1WR2 A;  5BWR A;  3PFF A;  1CKM A;  1I1L A;  4TVI A;  5JQW A;  4O7Z A;  5DGH A;  1GSH A;  1B6R A;  3JZI A;  4MV4 A;  2FPP B;  2CNV A;  5HV6 A;  3I12 A;  3N6R A;  3TW7 A;  3RV3 A;  4CMD A;  5BPF A;  3T7A A;  5C1P A;  3JZ6 A;  3BA9 A;  2EJ0 A;  4O86 A;  5J2U F;  4EGQ A;  2YL2 A;  2R7K A;  2X5R A;  5KS8 A;  1DV2 A;  4O7Y A;  2V59 A;  5GON F;  4XX0 B;  5BWX A;  3T9D A;  2Y4R A;  5I5X A;  5LYJ F;  3V4S A;  2XD4 A;  1C30 A;  2CFM A;  3VPC A;  2DWC A;  2HVR A;  4FFR A;  4O7L A;  4FGR A;  3T9B A;  1C3O A;  1I2L A;  1A0I A;  1EHI A;  1JLL B;  2ZDQ A;  4IIJ F;  4O84 A;  5I5Y A;  1CKN B;  2CNQ A;  1DGS A;  2XCL A;  3LWB A;  4MA5 A;  2VQD A;  1BNC A;  1OBD A;  4NZM A;  2YZM A;  4O2A F;  4C5C A;  3L2P A;  4RZQ A;  4ME6 A;  3LP8 A;  2NU9 B;  5HNE A;  1M0W A;  1GSO A;  3AW8 A;  3JSN A;  1DAA A;  1JDE A;  3KAL A;  3ETJ A;  3HBL A;  5CAE B;  2FPG B;  3K3P A;  3BAA A;  3DF7 A;  4YBZ B;  5CA1 F;  5CR5 A;  1I2K A;  3WWH A;  1SCU B;  2P0A A;  1A48 A;  5FR9 A;  1BXR A;  1A9X A;  3CSW A;  2J9G A;  3WNZ A;  5BWW A;  1IOV A;  5K3W A;  4EQ5 A;  1W93 A;  2EIY A;  5CB4 F;  1ET0 A;  2OLS A;  3UZO A;  2R7M A;  2VUG A;  1TA8 A;  1XK5 A;  2QK4 A;  1V9P A;  3MWE A;  3KYH C;  4TUY F;  3BG5 A;  4YB8 B;  3VA7 A;  2R84 A;  4GLX A;  1KJI A;  1CE8 A;  2HIV A;  2YS6 A;  1M0T A;  2GPW A;  5C1O A;  3DAA A;  2R85 A;  4UFZ A;  5DAA A;  5HBR B;  2YRX A;  4O4H F;  3DTG A;  3RUP A;  5BMV F;  5DMX A;  2NUA B;  4IWY A;  5EZY F;  4M0J A;  1S68 A;  3QQM A;  4GLW A;  4O7S A;  4MV7 A;  3K5H A;  1VKZ A;  4NYE A;  2WYO A;  4FFP A;  2R7N A;  5BYB A;  4M9U A;  3WWI A;  5IYZ F;  4TM5 A;  1GGO A;  3SNO A;  3TIN A;  4E4T A;  3U9T A;  3V4Z A;  4UUG A;  1B6S A;  3VMM A;  3AX6 A;  5KX5 F;  5JVL A;  4K6N A;  1UC9 A;  1OBG A;  1UC8 A;  5FPR A;  4C5B A;  4EFE A;  3U55 A;  4O7V A;  2W6Q A;  2COI A;  1I1M A;  3R5F A;  4PZ7 A;  4FE2 A;  1A3G A;  4CHI A;  3MWD A;  1VBH A;  2HHF A;  2W6P A;  4DRF A;  2HHF B;  1Z2O X;  4TV8 F;  4UCV A;  1AUX A;  4FFO A;  3GB8 B;  3TIG A;  3RR5 A;  5D1O A;  2W6Z A;  5D1O B;  4CKC A;  1EZ1 A;  2ODT X;  1W96 A;  1WRV A;  2R82 A;  5DIS C;  4O2B F;  4FFN A;  2FPI B;  5LP6 F;  4YJ2 F;  3U54 A;  3GDE A;  2W6N A;  2YZG A;  5FNV F;  3E5N A;  4UCR A;  1P16 A;  3K5I A;  4TV9 F;  2V5A A;  2Z04 A;  4XYL B;  2OWO A;  3KAJ A;  1CKO A;  4MV6 A;  3TW6 A;  1JDB B;  2A1H A;  3JRX A;  1KT8 A;  2NU7 B;  4I4T F;  3LUL A;  2GQR A;  4O7N A;  1VS0 A;  5E25 A;  4HR7 A;  3W1G A;  3GID A;  2EJ3 A;  1EUD B;  3LQS A;  4PBC A;  3CEB A;  4IHJ F;  3WO0 A;  2W6O A;  4HNU A;  4UCT A;  3R5X A;  2HJW A;  3BA8 A;  4WBN F;  1TAE A;  4EEQ A;  3Q2O A;  2VR1 A;  2W71 A;  5DGI A;  2HIX A;  2SCU B;  2Q7D A;  3NUA A;  2HGW A;  3VPB A;  2COG A;  1KJJ A;  4O82 A;  4XZ3 B;  2FB9 A;  1FVI A;  2YWV A;  2EJ2 A;  4IWX A;  4O7R A;  5K2M A;  4QSH A;  5I5U A;  4O83 A;  1DV1 A;  3T99 A;  2CNU A;  3TY8 A;  3G8C A;  3HT5 A;  4HN2 A;  1DIK A;  1Z2N X;  5I5T A;  2X0S A;  1GSA A;  5LXT F;  4UCU A;  4FFM A;  2CZG A;  2YRW A;  4O4L F;  3DTF A;  3N8D A;  2YZN A;  1CQI B;  2C00 A;  4LH7 A;  4ZI7 F;  3KRE A;  3JZF A;  3TQT A;  3JSL A;  3RFC A;  3BAB A;  2I8C A;  4CKE A;  2QF7 A;  3R5H A;  4LH6 A;  4MA0 A;  3NBZ B;  1EYZ A;  5BPH A;  4CKB A;  2V58 A;  4YJ3 F;  4HQ6 A;  2HGS A;  5CM0 A;  1ULZ A;  4YAJ B;  3TII A;  3KAK A;  1KJ8 A;  3VNN A;  2YW2 A;  4PZ8 A;  4CMF A;  2DAB A;  2VPQ A;  3U9S A;  3ETH A;  1E4E A;  4MV9 A;  4MAM A;  4EGJ A;  2W70 A;  1KTA A;  4DAA A;  5BWU A;  2R86 A;  3WWJ A;  2ZDG A;  5CE8 A;  3OUU A;  4UCS A;  3VPD A;  1KUT A;  1P8L A;  2Z02 A;  1PK8 A;  2FP4 B;  3HO8 A;  3ORR A;  4Q4D A;  5I5V A;  3UZB A;  2HVS A;  1IYE A;  2COJ A;  4DIM A;  5C8Y F;  2DLN A;  4O81 A;  2QB5 A;  3TEK A;  4FFL A;  1CS0 A;  4UCO A;  1EUC B;  4O4J F;  3W5O A;  4I55 F;  5H80 A;  1KEE A;  3BAC A;  1GLV A;  3NC0 B;  4ZOL F;  5JVD F;  4EFB A;  2W6M A;  3TY5 A;  1AUV A;  4O7W A;  1KBL A;  3U0G A;  5J2T F;  4ZHQ F;  3GLK A;  2Q2U A;  2DZD A;  4I50 F;  2DAA A;  4NZO A;  3WO1 A;  4NZN A;  4CC5 A;  3T9F A;  4IZO A;  5I47 A;  2HGX A;  3QWU A;  1IYD A;  2R87 A;  1Z2P X;  3S24 A;  3SGI A;  1A0G A;  4MV3 A;  1JKJ B;  3G8D A;  5D1P A;  1KC7 A;  3W1B A;  1CKN A;  3RTX A;  2YS7 A;  1EKV A;  1I7N A;  4YAK B;  3PN1 A;  2HDK A;  5LA6 F;  3T9A A;  4PZ6 A;  5FPO A;  1M6V A;  1XDN A;  3UYY A;  4MV8 A;  3VOT A;  4ZQI A;  3ORQ A;  5CA0 F;  1IOW A;  2GLT A;  2R7L A;  2GQS A;  3UFX B;  1T36 A;  4WHX A;  2ZDH A;  3T9C A;  3UQ8 A;  3TY9 A;  4MV1 A;  2IP4 A;  4RCN A;  1CQJ B;  4L1K A;  5I60 A;  1ZAU A;  5LOV F;  4DLK A;  1EKP A;  3RV4 A;  4HNT A;  2PVP A;  1I1K A;  5JQG F;  5KKN B;  2ZGI A;  4Q4C A;  5BYA A;  1EKF A;  2Q2T A;  1PX2 A;  1KJ9 A;  4CC6 A;  3GJX B;  4C5A A;  3T9E A;  3MJF A;  2DIK A;  2I80 A;  2HG8 A;  1G2W A;  3JRW A;  5I5S A;  3HB9 A;  3SE7 A;  4EG0 A;  2YYA A;  3NBY B;  3R9R A;  2GPS A;  5I5W A;  1KJQ A;  1I7L A;  5D8D A;  4DQN A;  2NU8 B;  4O7T A; 
#chains in the Genus database with same CATH homology
 2QB5 A;  5FR9 A;  3TEK A;  3CSW A;  4JXU A;  2A1H A;  3T54 A;  5BWW A;  1KT8 A;  3BAC A;  5K3W A;  2EIY A;  3LUL A;  1ET0 A;  2ABJ A;  5E25 A;  3UZO A;  3U0G A;  2EJ3 A;  5BWV A;  3LQS A;  4PBC A;  4CE5 A;  5BWT A;  4NZO A;  2DAA A;  3CEB A;  4NZN A;  5BWR A;  3PFF A;  3T9F A;  5I47 A;  4TVI A;  1I1L A;  2HGX A;  1IYD A;  5DGH A;  3SGI A;  1A0G A;  3TW7 A;  3DAA A;  5DGI A;  2Q7D A;  5DAA A;  4CMD A;  3T7A A;  2HGW A;  3DTG A;  3JZ6 A;  4IWY A;  2COG A;  2EJ0 A;  3QQM A;  4GLW A;  4M0J A;  1EKV A;  2EJ2 A;  4IWX A;  2X5R A;  5KS8 A;  5K2M A;  5I5U A;  2HDK A;  3T99 A;  3T9A A;  3HT5 A;  4HN2 A;  5BYB A;  3WWI A;  5I5T A;  3UYY A;  5BWX A;  3T9D A;  2Y4R A;  5I5X A;  4TM5 A;  3SNO A;  3DTF A;  4UUG A;  4WHX A;  3T9B A;  3T9C A;  4K6N A;  1I2L A;  1UC9 A;  4CKE A;  1UC8 A;  5I5Y A;  4RCN A;  5I60 A;  1ZAU A;  2COI A;  4CKB A;  1I1M A;  1EKP A;  4CHI A;  5CM0 A;  1A3G A;  1I1K A;  4NZM A;  2HHF A;  2ZGI A;  4Q4C A;  2HHF B;  5BYA A;  1EKF A;  4CMF A;  2DAB A;  1KTA A;  4DAA A;  5BWU A;  4CKC A;  2ODT X;  3WWJ A;  1WRV A;  3T9E A;  5CE8 A;  3VPD A;  2HG8 A;  1G2W A;  1DAA A;  5I5S A;  4Q4D A;  5I5V A;  3UZB A;  1IYE A;  5I5W A;  2COJ A;  5CR5 A;  1I2K A;  3WWH A;  4DQN A;  5HNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...