4K6NA

Crystal structure of yeast 4-amino-4-deoxychorismate lyase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
352
structure length
352
Chain Sequence
b'PNFEVLATFRYDPGFARQSASKKEIFETPDPRLGLRDEDIRQQIINEDYSSYLRVREVNSGGDLLENIQHPDAWKHDCKTIVCQRVEDMLQVIYERFFLLDEQYQRIRIALSYFKIDFSTSLNDLLKLLVENLINCKEGNSEYHEKIQKMINERQCYKMRVLVSKTGDIRIEAIPMPMEPILKLTTDYDSVSTYFIKTMLNGFLIDSTINWDVVVSSEPLNASAFTSFKTTSRDHYARARVRMQTAINNLRGSEPTSSVSQCEILFSNKSGLLMEGSITNVAVIQKDPNGSKKYVTPRLATGCLCGTMRHYLLRLGLIEEGDIDIGSLTVGNEVLLFNGVMGCIKGTVKTKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxychorismate lyase
publication title Structure and catalytic mechanism of yeast 4-amino-4-deoxychorismate lyase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 120
structure length 352
sequence length 352
ec nomenclature ec 4.1.3.38: Aminodeoxychorismate lyase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 4k6nA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 4k6nA01
3UYYA 5BWVA 4CMDA 3DTGA 1IYDA 1G2WA 2HGXA 3CEBA 4DQNA 3HT5A 2COGA 1EKPA 1KTAA 5I5WA 3UZOA 4UUGA 1EKVA 3WWHA 2ABJA 5BWWA 5I5VA 2Y4RA 1A3GA 2HG8A 1I1LA 2ZGIA 2EJ3A 4M0JA 2DABA 2HDKA 5I5YA 5FR9A 5I5TA 4CMFA 3UZBA 5E25A 2EJ2A 5BWTA 1I1KA 5K3WA 5I60A 3WWJA 5HNEA 3QQMA 3LQSA 4WHXA 3DTFA 3WWIA 4TM5A 4PBCA 5I5SA 4TVIA 2HHFB 4CE5A 1DAAA 1IYEA 3LULA 5CM0A 3JZ6A 1EKFA 2COJA 5CR5A 4CHIA 2COIA 5BWXA 5CE8A 4JXUA 1ET0A 2HHFA 5BWUA 5BWRA 3DAAA 5I5XA 1WRVA 2HGWA 2EIYA 1I2LA 4K6NA 2EJ0A 2DAAA 1A0GA 1I1MA 1KT8A 1I2KA 4DAAA 5DAAA 3SNOA 5I5UA 2A1HA 3CSWA 3U0GA
chains in the Genus database with same CATH superfamily
3V4ZA 5HV6A 3UYYA 3AW8A 2W71A 4UCSA 5IYZF 3UQ8A 1G2WA 5LXTF 3BABA 2HGXA 4MV9A 2VR1A 2PN1A 1KTAA 1OBGA 2YWVA 3QWUA 4ZI7F 4MV4A 2PBZA 3GJXB 4FFPA 5GONF 2IP4A 3MJFA 5BWWA 3R5FA 1UC9A 2HG8A 1I1LA 1I7LA 2FB9A 2NU7B 1EUDB 2EJ3A 2W6ZA 3DF7A 2C00A 1CQIB 1CE8A 2HDKA 5FR9A 5I5TA 2V58A 1KEEA 3OUUA 5C8YF 1VKZA 3BAAA 3KALA 4I55F 2YZLA 3UZBA 1T36A 1Z2PX 5LA6F 4DRFA 2NU8B 1I1KA 3V4SA 5K3WA 4UFZA 1GSHA 1OBDA 3PFFA 5BPFA 2QF7A 3LWBA 4XX0B 3W1GA 3WWIA 1VBHA 3K5HA 1S68A 2ODTX 3VA7A 4O7SA 4CE5A 1WR2A 1DAAA 3LULA 3JZ6A 3BG5A 2COJA 1EZ1A 2NU9B 3TIIA 2Q7DA 2HVSA 4O7WA 3KYHC 3TIGA 4PZ6A 2YS7A 4RZQA 2W6MA 3TY8A 4UCRA 3BACA 4EGQA 4E4TA 2R7NA 3NC0B 2YW2A 2W6QA 3VMMA 2FP4B 1W93A 4UCTA 3K5IA 2EIYA 1CKOA 5KS8A 2YRWA 3W5OA 2Z02A 1GLVA 4YJ3F 1JDEA 3Q2OA 3N8DA 4IHJF 4MA5A 1VBGA 3Q1KA 1I2KA 4MV6A 4DAAA 3SNOA 2YRXA 3CSWA 2FPPB 3U9SA 4UCUA 2XCLA 4YAJB 3U0GA 2DWCA 4CMDA 4O4LF 4O2BF 5BYAA 2PVPA 1KC7A 5I5WA 1EUCB 4CKCA 4HN2A 3HBLA 4TUYF 4XZ3B 2ZDGA 3KAKA 3RUPA 2GQRA 4FGRA 2ABJA 4RCNA 3JSNA 3GIDA 2Y4RA 5D1OB 5BYBA 4LH7A 4Q4CA 4M0JA 4ZHQF 1KBLA 2VQDA 3BA8A 5I5YA 4O4JF 3U54A 3U55A 3TW6A 3OUZA 5E25A 2X0SA 2EJ2A 1IOWA 3VNNA 1FVIA 5BWTA 5D1OA 3MWEA 5I60A 1AUVA 4O83A 3L2PA 4WBNF 1M0WA 5J2UF 4O7YA 1C3OA 2P0AA 4NZNA 3JZIA 4YB8B 4C5CA 3VOTA 4O7RA 3NUAA 2Q2TA 4TM5A 3KREA 3T7AA 3PN1A 4PZ8A 4TVIA 2HHFB 1DV2A 2YZNA 5DGIA 1Z2OX 5CM0A 4HNUA 5BMVF 4TV9F 1EKFA 4DLKA 2R86A 3VPDA 4UCVA 1A0IA 2ZDQA 4IIJF 1CKNB 2R7MA 4CHIA 2FPIB 2VPQA 5CA1F 4ME6A 1CS0A 2CZGA 5BWXA 3VPBA 3R5XA 4PZ7A 2HHFA 3R23A 2W6OA 1B6RA 4O7VA 5I5XA 1WRVA 3NBZB 3TINA 5CA0F 5JVLA 1CKNA 4NZOA 1V9PA 4K6NA 2VUGA 4O4IF 2EJ0A 4MV1A 2W6PA 5K2MA 2R87A 2FPGB 2J9GA 1KT8A 2HIVA 3G8DA 4XYMB 3JZFA 1GGOA 3DTGA 4M9UA 3I12A 4HNVA 2CFMA 3CEBA 3HT5A 2OWOA 2COGA 4FE2A 1EKPA 3E5NA 5BPHA 3UZOA 1DIKA 1SCUB 1B6SA 4NZMA 2Z04A 2DIKA 4FFNA 1EKVA 3WWHA 4FFLA 3RV4A 3N6RA 2ZDHA 5J2TF 4CC5A 2SCUB 1A3GA 2R7LA 3GDEA 1M6VA 3JSLA 4GLXA 4IZOA 3T9DA 2DZDA 2I87A 5LP6F 1UC8A 4LH6A 3TY9A 3VPCA 1KJJA 1IOVA 2GPWA 1B04A 1DGSA 3WNZA 4YAKB 3S24A 1PK8A 1BNCA 3T9FA 2GPSA 3AX6A 1KJIA 1TAEA 3GLKA 3QQMA 3LQSA 4WHXA 1M0TA 3W1BA 5DMXA 4E6NA 3UFXB 3K3PA 1XK5A 4O7NA 1I7NA 2XD4A 4ZQIA 4O7TA 5FPRA 3KAJA 2R82A 4MV7A 1JLLB 3R5HA 2OLSA 1W96A 3RR5A 5KX5F 1EYZA 2COIA 4IWXA 2GLTA 1JKJB 4EFEA 5CE8A 4JXUA 1X9NA 2NU6B 3JRXA 4MA0A 2HGWA 5JH7F 1I2LA 1EHIA 4FFMA 3HB9A 3T9CA 4DIMA 2YYAA 2QK4A 1CQJB 2I80A 3T9EA 3T9BA 1TA8A 3U9TA 2HJWA 4HNTA 4HR7A 3ETJA 4I4TF 1A0GA 2YZGA 1JDBB 4Q4DA 5DISC 5DAAA 3TEKA 1A48A 2WYOA 3HO8A 4EG0A 5BWVA 4CKEA 4FU0A 2NUAB 3TW7A 3SE7A 4MV3A 1GSAA 4I50F 4ZOLF 4CC6A 1IYDA 3RTXA 2HVQA 4C5AA 4DQNA 1P16A 4FFRA 1KJ9A 4O84A 1C30A 4CKBA 4NYEA 1ZAUA 4UUGA 1AUXA 4IWYA 2YL2A 5I5VA 4L1KA 2CNQA 1ULZA 3NBYB 1Z2NX 2ZGIA 5JQGF 2DABA 3TQTA 3WO1A 2GQSA 1CKMA 5C1PA 4CMFA 4O2AF 4GLWA 1VS0A 5H80A 4UCOA 3SGIA 2YZMA 3QFFA 1E4EB 1KUTA 4O4HF 5D1PA 5HBRB 3T9AA 3WWJA 4O7LA 5HNEA 4FFOA 1KJQA 4C5BA 2HIXA 4XYLB 3G8CA 1BXRA 1PX2A 2YS6A 3DTFA 5LOVF 1A9XA 4Y8VB 3R9RA 3ETHA 3ORQA 4EQ5A 4PBCA 3LP8A 5JQWA 1P8LA 5I5SA 1E4EA 4QSHA 4EGJA 5FNVF 4HQ6A 3T54A 1IYEA 2CNVA 5EZYF 3TY5A 5CB4F 5JVDF 1XDNA 3T99A 3WO0A 2R84A 5CR5A 2HGSA 2V59A 2V5AA 5I47A 4MV8A 2HVRA 4EFBA 5FPOA 1ET0A 2W70A 4O81A 2X5RA 3BA9A 5BWUA 5BWRA 5C1OA 1GSOA 2DLNA 5DGHA 3DAAA 4YJ2F 3ORRA 4TV8F 5CAEB 4O82A 4O86A 3MWDA 1KJ8A 4EEQA 5KKNB 3JRWA 2QB5A 4O7ZA 3RFCA 5LYJF 2I8CA 2DAAA 2W6NA 5D8DA 2R7KA 1DV1A 1I1MA 4MAMA 2R85A 3GB8B 5I5UA 2A1HA 2CNUA 2Q2UA 4YBZB 3RV3A
chains in the Genus database with same CATH topology
3UYYA 5BWVA 4CKEA 3TW7A 4CMDA 3DTGA 1IYDA 1G2WA 5BYAA 2HGXA 3CEBA 4DQNA 3HT5A 2COGA 1EKPA 1KTAA 5I5WA 4CKCA 3UZOA 4HN2A 4CKBA 4NZMA 1ZAUA 4UUGA 1EKVA 3WWHA 2ABJA 4IWYA 4RCNA 5BWWA 5I5VA 2Y4RA 1UC9A 1A3GA 2HG8A 1I1LA 5BYBA 2ZGIA 2EJ3A 4Q4CA 4M0JA 2DABA 2HDKA 3T9DA 5I5YA 5FR9A 5I5TA 4CMFA 1UC8A 4GLWA 3SGIA 3UZBA 5E25A 2EJ2A 5BWTA 1I1KA 3T9AA 5K3WA 5I60A 3WWJA 3T9FA 3PFFA 5HNEA 3QQMA 3LQSA 4WHXA 4NZNA 3DTFA 3WWIA 4TM5A 4PBCA 2ODTX 3T7AA 5I5SA 4TVIA 2HHFB 4CE5A 1DAAA 1IYEA 5DGIA 3T54A 3LULA 5CM0A 3JZ6A 1EKFA 2COJA 3T99A 3VPDA 2Q7DA 5CR5A 4CHIA 2COIA 4IWXA 5I47A 5BWXA 5CE8A 4JXUA 1ET0A 2HHFA 2X5RA 3BACA 5BWUA 5BWRA 5DGHA 3DAAA 5I5XA 1WRVA 2HGWA 2EIYA 5KS8A 4NZOA 1I2LA 3T9CA 4K6NA 2QB5A 2EJ0A 3T9EA 3T9BA 5K2MA 2DAAA 1A0GA 1I1MA 1KT8A 4Q4DA 1I2KA 4DAAA 5DAAA 3SNOA 5I5UA 2A1HA 3CSWA 3TEKA 3U0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UYY A;  5BWV A;  4CMD A;  3DTG A;  1IYD A;  1G2W A;  2HGX A;  3CEB A;  4DQN A;  3HT5 A;  2COG A;  1EKP A;  1KTA A;  5I5W A;  3UZO A;  4UUG A;  1EKV A;  3WWH A;  2ABJ A;  5BWW A;  5I5V A;  2Y4R A;  1A3G A;  2HG8 A;  1I1L A;  2ZGI A;  2EJ3 A;  4M0J A;  2DAB A;  2HDK A;  5I5Y A;  5FR9 A;  5I5T A;  4CMF A;  3UZB A;  5E25 A;  2EJ2 A;  5BWT A;  1I1K A;  5K3W A;  5I60 A;  3WWJ A;  5HNE A;  3QQM A;  3LQS A;  4WHX A;  3DTF A;  3WWI A;  4TM5 A;  4PBC A;  5I5S A;  4TVI A;  2HHF B;  4CE5 A;  1DAA A;  1IYE A;  3LUL A;  5CM0 A;  3JZ6 A;  1EKF A;  2COJ A;  5CR5 A;  4CHI A;  2COI A;  5BWX A;  5CE8 A;  4JXU A;  1ET0 A;  2HHF A;  5BWU A;  5BWR A;  3DAA A;  5I5X A;  1WRV A;  2HGW A;  2EIY A;  1I2L A;  4K6N A;  2EJ0 A;  2DAA A;  1A0G A;  1I1M A;  1KT8 A;  1I2K A;  4DAA A;  5DAA A;  3SNO A;  5I5U A;  2A1H A;  3CSW A;  3U0G A; 
#chains in the Genus database with same CATH topology
 3V4Z A;  5HV6 A;  3UYY A;  3AW8 A;  2W71 A;  4UCS A;  5IYZ F;  3UQ8 A;  1G2W A;  5LXT F;  3BAB A;  2HGX A;  4MV9 A;  2VR1 A;  2PN1 A;  1KTA A;  1OBG A;  2YWV A;  3QWU A;  4ZI7 F;  4MV4 A;  2PBZ A;  3GJX B;  4FFP A;  5GON F;  2IP4 A;  3MJF A;  5BWW A;  3R5F A;  1UC9 A;  2HG8 A;  1I1L A;  1I7L A;  2FB9 A;  2NU7 B;  1EUD B;  2EJ3 A;  2W6Z A;  3DF7 A;  2C00 A;  1CQI B;  1CE8 A;  2HDK A;  5FR9 A;  5I5T A;  2V58 A;  1KEE A;  3OUU A;  5C8Y F;  1VKZ A;  3BAA A;  3KAL A;  4I55 F;  2YZL A;  3UZB A;  1T36 A;  1Z2P X;  5LA6 F;  4DRF A;  2NU8 B;  1I1K A;  3V4S A;  5K3W A;  4UFZ A;  1GSH A;  1OBD A;  3PFF A;  5BPF A;  2QF7 A;  3LWB A;  4XX0 B;  3W1G A;  3WWI A;  1VBH A;  3K5H A;  1S68 A;  2ODT X;  3VA7 A;  4O7S A;  4CE5 A;  1WR2 A;  1DAA A;  3LUL A;  3JZ6 A;  3BG5 A;  2COJ A;  1EZ1 A;  2NU9 B;  3TII A;  2Q7D A;  2HVS A;  4O7W A;  3KYH C;  3TIG A;  4PZ6 A;  2YS7 A;  4RZQ A;  2W6M A;  3TY8 A;  4UCR A;  3BAC A;  4EGQ A;  4E4T A;  2R7N A;  3NC0 B;  2YW2 A;  2W6Q A;  3VMM A;  2FP4 B;  1W93 A;  4UCT A;  3K5I A;  2EIY A;  1CKO A;  5KS8 A;  2YRW A;  3W5O A;  2Z02 A;  1GLV A;  4YJ3 F;  1JDE A;  3Q2O A;  3N8D A;  4IHJ F;  4MA5 A;  1VBG A;  3Q1K A;  1I2K A;  4MV6 A;  4DAA A;  3SNO A;  2YRX A;  3CSW A;  2FPP B;  3U9S A;  4UCU A;  2XCL A;  4YAJ B;  3U0G A;  2DWC A;  4CMD A;  4O4L F;  4O2B F;  5BYA A;  2PVP A;  1KC7 A;  5I5W A;  1EUC B;  4CKC A;  4HN2 A;  3HBL A;  4TUY F;  4XZ3 B;  2ZDG A;  3KAK A;  3RUP A;  2GQR A;  4FGR A;  2ABJ A;  4RCN A;  3JSN A;  3GID A;  2Y4R A;  5D1O B;  5BYB A;  4LH7 A;  4Q4C A;  4M0J A;  4ZHQ F;  1KBL A;  2VQD A;  3BA8 A;  5I5Y A;  4O4J F;  3U54 A;  3U55 A;  3TW6 A;  3OUZ A;  5E25 A;  2X0S A;  2EJ2 A;  1IOW A;  3VNN A;  1FVI A;  5BWT A;  5D1O A;  3MWE A;  5I60 A;  1AUV A;  4O83 A;  3L2P A;  4WBN F;  1M0W A;  5J2U F;  4O7Y A;  1C3O A;  2P0A A;  4NZN A;  3JZI A;  4YB8 B;  4C5C A;  3VOT A;  4O7R A;  3NUA A;  2Q2T A;  4TM5 A;  3KRE A;  3T7A A;  3PN1 A;  4PZ8 A;  4TVI A;  2HHF B;  1DV2 A;  2YZN A;  5DGI A;  1Z2O X;  5CM0 A;  4HNU A;  5BMV F;  4TV9 F;  1EKF A;  4DLK A;  2R86 A;  3VPD A;  4UCV A;  1A0I A;  2ZDQ A;  4IIJ F;  1CKN B;  2R7M A;  4CHI A;  2FPI B;  2VPQ A;  5CA1 F;  4ME6 A;  1CS0 A;  2CZG A;  5BWX A;  3VPB A;  3R5X A;  4PZ7 A;  2HHF A;  3R23 A;  2W6O A;  1B6R A;  4O7V A;  5I5X A;  1WRV A;  3NBZ B;  3TIN A;  5CA0 F;  5JVL A;  1CKN A;  4NZO A;  1V9P A;  4K6N A;  2VUG A;  4O4I F;  2EJ0 A;  4MV1 A;  2W6P A;  5K2M A;  2R87 A;  2FPG B;  2J9G A;  1KT8 A;  2HIV A;  3G8D A;  4XYM B;  3JZF A;  1GGO A;  3DTG A;  4M9U A;  3I12 A;  4HNV A;  2CFM A;  3CEB A;  3HT5 A;  2OWO A;  2COG A;  4FE2 A;  1EKP A;  3E5N A;  5BPH A;  3UZO A;  1DIK A;  1SCU B;  1B6S A;  4NZM A;  2Z04 A;  2DIK A;  4FFN A;  1EKV A;  3WWH A;  4FFL A;  3RV4 A;  3N6R A;  2ZDH A;  5J2T F;  4CC5 A;  2SCU B;  1A3G A;  2R7L A;  3GDE A;  1M6V A;  3JSL A;  4GLX A;  4IZO A;  3T9D A;  2DZD A;  2I87 A;  5LP6 F;  1UC8 A;  4LH6 A;  3TY9 A;  3VPC A;  1KJJ A;  1IOV A;  2GPW A;  1B04 A;  1DGS A;  3WNZ A;  4YAK B;  3S24 A;  1PK8 A;  1BNC A;  3T9F A;  2GPS A;  3AX6 A;  1KJI A;  1TAE A;  3GLK A;  3QQM A;  3LQS A;  4WHX A;  1M0T A;  3W1B A;  5DMX A;  4E6N A;  3UFX B;  3K3P A;  1XK5 A;  4O7N A;  1I7N A;  2XD4 A;  4ZQI A;  4O7T A;  5FPR A;  3KAJ A;  2R82 A;  4MV7 A;  1JLL B;  3R5H A;  2OLS A;  1W96 A;  3RR5 A;  5KX5 F;  1EYZ A;  2COI A;  4IWX A;  2GLT A;  1JKJ B;  4EFE A;  5CE8 A;  4JXU A;  1X9N A;  2NU6 B;  3JRX A;  4MA0 A;  2HGW A;  5JH7 F;  1I2L A;  1EHI A;  4FFM A;  3HB9 A;  3T9C A;  4DIM A;  2YYA A;  2QK4 A;  1CQJ B;  2I80 A;  3T9E A;  3T9B A;  1TA8 A;  3U9T A;  2HJW A;  4HNT A;  4HR7 A;  3ETJ A;  4I4T F;  1A0G A;  2YZG A;  1JDB B;  4Q4D A;  5DIS C;  5DAA A;  3TEK A;  1A48 A;  2WYO A;  3HO8 A;  4EG0 A;  5BWV A;  4CKE A;  4FU0 A;  2NUA B;  3TW7 A;  3SE7 A;  4MV3 A;  1GSA A;  4I50 F;  4ZOL F;  4CC6 A;  1IYD A;  3RTX A;  2HVQ A;  4C5A A;  4DQN A;  1P16 A;  4FFR A;  1KJ9 A;  4O84 A;  1C30 A;  4CKB A;  4NYE A;  1ZAU A;  4UUG A;  1AUX A;  4IWY A;  2YL2 A;  5I5V A;  4L1K A;  2CNQ A;  1ULZ A;  3NBY B;  1Z2N X;  2ZGI A;  5JQG F;  2DAB A;  3TQT A;  3WO1 A;  2GQS A;  1CKM A;  5C1P A;  4CMF A;  4O2A F;  4GLW A;  1VS0 A;  5H80 A;  4UCO A;  3SGI A;  2YZM A;  3QFF A;  1E4E B;  1KUT A;  4O4H F;  5D1P A;  5HBR B;  3T9A A;  3WWJ A;  4O7L A;  5HNE A;  4FFO A;  1KJQ A;  4C5B A;  2HIX A;  4XYL B;  3G8C A;  1BXR A;  1PX2 A;  2YS6 A;  3DTF A;  5LOV F;  1A9X A;  4Y8V B;  3R9R A;  3ETH A;  3ORQ A;  4EQ5 A;  4PBC A;  3LP8 A;  5JQW A;  1P8L A;  5I5S A;  1E4E A;  4QSH A;  4EGJ A;  5FNV F;  4HQ6 A;  3T54 A;  1IYE A;  2CNV A;  5EZY F;  3TY5 A;  5CB4 F;  5JVD F;  1XDN A;  3T99 A;  3WO0 A;  2R84 A;  5CR5 A;  2HGS A;  2V59 A;  2V5A A;  5I47 A;  4MV8 A;  2HVR A;  4EFB A;  5FPO A;  1ET0 A;  2W70 A;  4O81 A;  2X5R A;  3BA9 A;  5BWU A;  5BWR A;  5C1O A;  1GSO A;  2DLN A;  5DGH A;  3DAA A;  4YJ2 F;  3ORR A;  4TV8 F;  5CAE B;  4O82 A;  4O86 A;  3MWD A;  1KJ8 A;  4EEQ A;  5KKN B;  3JRW A;  2QB5 A;  4O7Z A;  3RFC A;  5LYJ F;  2I8C A;  2DAA A;  2W6N A;  5D8D A;  2R7K A;  1DV1 A;  1I1M A;  4MAM A;  2R85 A;  3GB8 B;  5I5U A;  2A1H A;  2CNU A;  2Q2U A;  4YBZ B;  3RV3 A; 
#chains in the Genus database with same CATH homology
 3UYY A;  5BWV A;  4CKE A;  3TW7 A;  4CMD A;  3DTG A;  1IYD A;  1G2W A;  5BYA A;  2HGX A;  3CEB A;  4DQN A;  3HT5 A;  2COG A;  1EKP A;  1KTA A;  5I5W A;  4CKC A;  3UZO A;  4HN2 A;  4CKB A;  4NZM A;  1ZAU A;  4UUG A;  1EKV A;  3WWH A;  2ABJ A;  4IWY A;  4RCN A;  5BWW A;  5I5V A;  2Y4R A;  1UC9 A;  1A3G A;  2HG8 A;  1I1L A;  5BYB A;  2ZGI A;  2EJ3 A;  4Q4C A;  4M0J A;  2DAB A;  2HDK A;  3T9D A;  5I5Y A;  5FR9 A;  5I5T A;  4CMF A;  1UC8 A;  4GLW A;  3SGI A;  3UZB A;  5E25 A;  2EJ2 A;  5BWT A;  1I1K A;  3T9A A;  5K3W A;  5I60 A;  3WWJ A;  3T9F A;  3PFF A;  5HNE A;  3QQM A;  3LQS A;  4WHX A;  4NZN A;  3DTF A;  3WWI A;  4TM5 A;  4PBC A;  2ODT X;  3T7A A;  5I5S A;  4TVI A;  2HHF B;  4CE5 A;  1DAA A;  1IYE A;  5DGI A;  3T54 A;  3LUL A;  5CM0 A;  3JZ6 A;  1EKF A;  2COJ A;  3T99 A;  3VPD A;  2Q7D A;  5CR5 A;  4CHI A;  2COI A;  4IWX A;  5I47 A;  5BWX A;  5CE8 A;  4JXU A;  1ET0 A;  2HHF A;  2X5R A;  3BAC A;  5BWU A;  5BWR A;  5DGH A;  3DAA A;  5I5X A;  1WRV A;  2HGW A;  2EIY A;  5KS8 A;  4NZO A;  1I2L A;  3T9C A;  4K6N A;  2QB5 A;  2EJ0 A;  3T9E A;  3T9B A;  5K2M A;  2DAA A;  1A0G A;  1I1M A;  1KT8 A;  4Q4D A;  1I2K A;  4DAA A;  5DAA A;  3SNO A;  5I5U A;  2A1H A;  3CSW A;  3TEK A;  3U0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...