4CC6A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
b'ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 103
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc6A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc6A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc6A02
4CC5A 4LF7B 4NXMB 4DR6B 2CFMA 4DV7B 1B04A 2VQEB 4JI0B 3RTXA 4DV5B 1N34B 3NC0B 4PZ8A 1TAEA 5FPOA 1P16A 4JI6B 2UXDB 5IWAB 2HIXA 3GB8B 3GDEA 4X64B 2HIVA 3NBZB 4EFBA 1HR0B 4LF4B 2UXBB 4DV3B 4CC6A 3S24A 4KHPB 3TY9A 1A0IA 4E6NA 3TY5A 4UFZA 4X65B 4TOIA 4YY3B 4LF9B 4JI7B 1FVIA 3BA9A 3BAAA 1IBLB 1XNQB 4JYAB 3W1BA 2HHHB 4X66B 4DR4B 4UCUA 4JI3B 4EQ5A 1HNXB 4NXNB 2VQFB 5DISC 3JSLA 3W1GA 1P8LA 2Q2TA 1TA8A 3PN1A 3T1YB 5D1OA 4LFBB 4YHHB 3BABA 2UXCB 2ZM6B 4DV0B 1XMQB 1IBKB 1CKMA 1CKOA 4PZ7A 4DUYB 4X62B 1S68A 4DR5B 3T1HB 1ZAUA 4B3MB 1IBMB 4LFAB 4DV1B 4LFCB 1XMOB 4JI4B 3UQ8A 2UUBB 4K0KB 5D1OB 1DGSA 4B3SB 3OTOB 5FPRA 4DV6B 3VNNA 4DR1B 5LMNB 4EEQA 1X9NA 1I94B 4UCRA 2E5LB 3RR5A 4DV4B 2UU9B 2HVQA 3TY8A 3W5OA 4DR2B 4GKJB 3GJXB 3SGIA 4JI5B 1HNZB 3KYHC 4AQYB 4OX9B 3BA8A 1XDNA 3L2PA 4B3TB 4JI1B 4DRFA 2Q2UA 4JI2B 4JI8B 1CKNA 4GKKB 4GLXA 1V9PA 4UCTA 4LH7A 4DR3B 2UUAB 4PZ6A 3NBYB 5D1PA 1VS0A 4DV2B 4LF5B 1N33B 4UCSA 1XNRB 4DUZB 4JV5B 2HVRA 5LMUB 2F4VB 5BR8B 4B3RB 2UUCB 2HVSA 1CKNB 4EFEA 1N32B 4UCOA 4UCVA 4LF6B 2VUGA 4LH6A 1XK5A 1J5EB 1HNWB 1N36B 2OWOA 3JSNA 4LF8B 3QWUA 4DR7B 1FJGB
chains in the Genus database with same CATH superfamily
3FAVB 4X20B 4DRXA 3KAKA 3JARA 1BHAA 5B1BC 1SC5B 4GC7A 3JASB 3EPGA 3LDEA 4CH5A 1XNQO 3HR0A 2WPDG 2BQ3A 4DL3A 3GB8B 2W7OA 1NJIW 3IGAC 1QR9A 4G2KA 3G8DA 5LP6F 2PF4E 1C3OA 3N42B 4O7LA 1Q90D 4A3EG 2UVUA 3L73H 4FM0A 1YITV 4MS2A 3FD9A 1MABG 2F43G 3MR6A 5JVLA 4PWQA 4F4LA 3JATB 1MZEA 1AI4A 1EUCB 3Q4HA 1K33A 4ECWA 3K06A 1Y1VA 4QGPA 2UU9O 1IXMA 4RNOA 4YHHB 2J9GA 3CRAA 4RWUA 4IHJA 4DV0B 2WA4A 1H2MA 4ED8A 4GKJO 4JI7H 4PD4F 5IJ0A 3CCUV 5C3EG 4J9YB 3J7AU 1EN4A 1H8EG 3PR5B 1PM9A 4NXNH 1XMOB 3SPCA 4IWXA 3GIMA 3P3PA 4R50A 2QM7A 3T1YH 5B1AC 4L87A 2JIZG 3Q8SB 2W8KA 1M0TA 3RR5A 1IX9A 4JYYA 5CB4F 1B6QA 3V4SA 2LW7A 4JZ2A 1IYDA 1PV0A 1TWGA 2PY5A 5I5VA 3NXSA 4HAMA 4A3LG 1IVSA 3G80A 1YHQV 3CMEV 2Y0SA 4J9PA 4B3TB 2E75B 3ETJA 2BSKA 4UCTA 1WSCA 5GTHZ 5LP6B 5BWWA 2V4QA 2MW2B 2FMAA 2FTKA 4LF6H 4J9NA 4HQ6A 4H33A 5IJ9A 3ABMB 2XHBA 4QWDA 4FS2A 4RUEA 2F4VB 2HVKC 3HKDB 4ASUG 1DTOA 3AG2C 5KMGA 2CNVA 5KFIA 4NZNA 3K58A 3BRCA 1L1FA 4HYOA 2YIAA 4TSFG 2VUGA 2F66C 1SESA 3MFIA 1ZL8A 4HZ3A 2CH7A 4HNAB 3UZOA 1M7JA 1YTFD 5H2FZ 2RMKB 3L4JA 1VQ6V 3K08A 5JQGA 4WCEV 2FLLA 3GIPA 1KYOF 2BE3A 1N34B 3IC9A 1DIKA 1UJWB 2XAFA 2HIXA 5B1OA 5CA0F 1HNWH 1BGYH 1KD1W 2VQFO 1WB8A 1YDXA 2XAJA 5JUMA 4LF8H 3DAAA 4RUCA 2EILC 5K1XA 5AG2A 2UXCO 3OMNB 2BOCC 2XUMA 2ZM6O 5B66Z 2NU6B 2W6PA 1EFRG 5L1LA 4E6NA 2QKSA 2DMXA 2DYSB 1VIBA 2LQTA 2P06A 5F2VO 5CB4B 5KFKA 4R6ZA 1YJNV 3M9NB 2Q73A 1R9TA 1T3NA 1V55C 1XNQB 4O2AF 4NKGB 2KQXA 3SYOA 3CJHB 1EKFA 5KFUA 4A2AA 4KHPH 1PNMA 5C8YF 3T1HH 5LMNO 1OCCB 2KKWA 4DV1H 3OGIB 2Q2TA 4DR2O 1N4CA 4LNUB 4RNNA 2QWNB 1Q86W 1QLNA 3AG4B 4UUJC 1IOVA 5H6RA 3TJTA 4RAIA 2IJHA 1OBGA 4TQSA 3PJSK 2RDIA 3JAKA 1VF7A 1HWYA 2AQ4A 3F7VC 1M56C 2WSSG 1PPJH 1K83A 4U3JA 3ZIAG 3UQ8A 2IBKA 2A3QA 4GKKO 2OCCB 1FKAH 4RB0A 5LGUA 2XASA 4UB6Z 2Q7EA 5BMVA 1HNZH 2UU9B 2HVQA 5IP7G 5D8DA 1YIJV 2CE4A 2EINB 2NU7B 1W96A 2GPWA 1XQ8A 2UUCO 5L1JA 4GKJB 1GH6A 5CA3A 3K5LA 2NN4A 1KECA 3RGBA 1EBOA 4RUAA 2EIYA 4UB8Z 1UC9A 3HKCA 5CA0B 2YIDA 4H0LB 2QWRB 3GV7B 3IC7A 4DL4A 3ZMZA 2H8PC 1KU9A 4NXMO 4DV7O 2QYZA 4O7VA 5KUMA 1X59A 3TIGA 2V4DA 4UCSA 3CCMV 2CGNA 3E22A 2YS7A 4ETSA 1SKVA 3RN4A 3VBBA 2NUAB 3GILA 3FAVA 4X20A 3L9DA 2NLJC 4IRDA 4YAJB 4UUGA 1XDCA 5KFHA 3WFVA 3JASA 1VQ4V 4O2AB 1I7NA 4X89A 4JGSA 2FL4A 4DYLA 4TT3G 2ASLA 3APOA 3JSNA 3ZRVA 3WO1A 5C8YB 3A0HZ 2P6JA 5FR9A 2LJ2A 5KFBA 1NS1A 2UVVA 3LWBA 1HR0H 3RTXA 3B09A 5HFMA 5KT3A 4GCZA 4W4LA 4H13B 5FPOA 5ITZB 3ML0A 3GDEA 4IIJF 4A3IG 5B1NA 3VPCA 1RPOA 1KEEA 1K4CC 1N36H 5EYPB 4MV1A 1XOUA 3MHSC 4YXWG 3HT5A 4CKBA 5C5JA 5C44G 5IYCO 5EIBD 3T9FA 1M6VA 3JATA 2WAMA 1GLVA 4J11A 4OPHA 2B5UA 1VF5B 4ZI7F 2IBZH 3TY5A 1SZTA 1M90W 3T9CA 4EGJA 2CTPA 1DLBA 4X88A 4CBCA 1PKXA 1GKFA 4MVOA 4X8AA 1A3GA 5IYBO 3W1BA 2ARHA 3W7WA 2PUSA 1BXRA 4UCUA 3E8FA 3J80N 1IZ3A 3MHHC 2VQFB 3GIQA 3SNOA 1QU7A 2O03A 4I0XB 5L9XA 1VQ8V 4LFCH 2R70A 2UXCB 1PX2A 4ZOLF 1VBGA 2ZM6B 3T99A 1ZQ7A 4QPJA 5DG7A 1X4TA 1EN5A 4FLXA 2N04A 2Y48A 1I94H 3K3PA 4JI2O 2OIEA 5D1OB 1WP8A 3AEIA 4YHHH 1Q6IA 4DV0H 4F50A 1PD3A 5LMNB 2Z0AA 4UCRA 4OX9H 2M7WA 4DR2B 1A9XA 4CHIA 4BW9A 5LP6A 3OAAG 3IN5A 1A32A 4EBCA 3SDLA 4QSHA 5TISZ 4LF6O 2OTLV 3SJBC 1CXZB 2ZD9A 3HKDA 1W2BU 4JASA 4IIJB 3AK1A 4KL1A 1VF6A 5J9PC 4O86A 4GKKB 1I7LA 1Y67A 1R3KC 2YI8A 5D1PA 4HNAA 1I3QA 1V54B 5EWFA 3ZHTA 2HVRA 5BPHA 4ZI7B 2YL2A 4YR0A 2UUCB 3LDCA 2ZKOA 4B3TH 3R5XA 2AU0A 4IGGA 3JD2A 4DV5H 1WRVA 1VQKV 5LBQA 4EGQA 2YI9A 1W93A 2IA6A 2FB9A 3T4DA 4RQEA 3C3TA 2F4VH 4NXMB 4DV7B 5BYAA 5IDJA 3U10A 2EULA 1R73A 2EIJB 2O57A 4HBNA 4ZOLB 3JAMN 4ED2A 1GN3A 2ETNA 4A5UB 3ZMTA 3GVMA 2WWWA 3THOA 2W6ZA 2Q69A 5CB4A 2F1MA 4J9LA 4HNVA 1XHXA 4FFOA 1K5QA 4GZRB 2K9PA 4JAVA 3TY9A 2C00A 1BGWA 2HDKA 2ATKC 3ZHUA 3B4SA 4AILC 1N34H 5DG9A 3X2QB 4DL2A 3T1HO 1G8MA 1FS0G 4BY1G 2R7LA 3ZN0A 4DV1O 3WB2A 2COGA 4LNUA 1ORQC 2Q68A 1RK5A 1BE3H 2V7QG 4BIOA 1EN6A 2H3OA 5A2QW 4EQ5A 2FKLA 3Q8PB 3RAQA 3VA7A 2CNUA 3W1GA 1Y74B 4LFBB 2LFSA 2YUAA 4O7SA 3H0GA 3FFQA 1ROPA 1FKAO 1IURA 2XCPA 3E89A 2B9ZA 4O7ZA 4DV6H 5KFXA 3CXHF 1XNQH 3OGCC 1HNZO 4EBEA 4IAJA 3E86A 1S97A 3W7XA 5EIBC 1WCMG 2VOBA 4ED0A 3ZHSA 4F6RB 3LUTB 4FVMA 3UZBA 1AROP 1BSMA 1ET0A 5KG7A 3J81N 2R85A 2YZMA 1NVPD 2IP4A 2A1HA 2HKOA 4FZ0A 3L71H 5CMUA 1XNRO 5CA0A 2QM8A 3LSQA 5CE8A 2W57A 4TVIA 3BQ1A 3BACA 5DLFA 2XTAA 2ZNJA 2LP7A 1JJ2U 1Y14B 4I9QA 1WLEA 1I5YA 2QR4A 3VQVA 4X1KB 2DAAA 2F23A 2PGGA 2AZ0A 4J9MA 1I2KA 3TQ1A 1C30A 4K3AA 2WB1E 4JI2B 1FJGO 1Q8IA 3ETGA 3RFCA 4DLKA 5GTIZ 4DO2A 4JI0O 4O2AA 1R6TA 2AGPA 4P9PA 4YQWA 5C8YA 3CS5A 2PBZA 2HVJC 1ZHSA 3HOUG 4O4HF 2NVYA 3RW0A 2W6JG 4WFAV 4QWEA 4LF6B 1HR0O 2X5RA 3E8GA 3QZ7A 3QO5A 2QSAA 4D6TH 5L3BA 4DV3O 2HGWA 2Q7DA 5KFWA 5ITZA 2R7ZG 2QF7A 3RV4A 3APQA 4Z1VA 5EYPA 5C4XG 2XD4A 1B04A 4WBNF 2ZE7A 3D36A 3ABKC 1DF4A 3DTFA 3JAWB 5KFPA 3DC5A 4X66O 3U9TA 4FZ1A 1MA1A 3L4KA 4Q43A 2JA5A 3G6BA 2JS5A 3GTMA 2A79B 2X7RB 4YR3A 5J2TF 5CA1F 1SCUB 2CNQA 4J9QA 4J41A 5EK0A 1MOFA 1IBKO 3TETA 5EZYF 3K57A 4KXRA 4I0XA 4L8JA 4NYKA 1SQPH 5B3SB 2V59A 4LFCO 4I9WA 4J80A 2VUMA 5KFRA 3KKYA 3RYCB 4NB5A 2ITDC 2XAHA 3QNEA 2DZDA 1QHTA 4TM5A 3ABMC 2OT5A 3OTOO 2R7ZA 1LR1A 2YZLA 1I94O 1YJWV 4GX2A 1AJNA 2A7WA 5D1OA 3K59A 2EZOA 3F5WC 2WDTA 2ASJA 1CKMA 3T9EA 4DV0O 3T1HB 2OIGA 2ODTX 4DV1B 3U54A 4AYBE 1K8AW 4OX9O 4RO2A 4O4HB 2Z02A 4IWYA 2VQFH 3M9OB 4GC6A 2FKXA 5KHGA 4JI8O 3FDSA 1E79G 4O4JF 1BMFG 2C2EA 3AG1B 1WA8B 2B1IA 1DAAA 4MA5A 2UXCH 2ZM6H 2X6BA 5KFDA 5DQGA 4U7OA 4IIJA 5D5PA 1H2SB 1UPGA 2PI5A 3H4BA 1CPYA 3CE2A 1TWAA 1SQQH 4WBNB 2CZGA 2JEFA 1GSHA 2YU9A 3HOWG 2PZSA 4C2MA 3GWOA 1HNZB 4ZI7A 1WPBA 1J5EO 3KYHC 4MV3A 4DW0A 2Q7GA 1VMGA 4FM1A 4DRFA 4DL5A 5LMNH 3JALB 1KJQA 3CRQA 4B3TO 2UXNA 2CW7A 2BTOA 4DR2H 5J2TB 5CA1B 1VQOV 1F23A 4PA4A 1AUXA 4ECRA 2ZR3A 4DV5O 3TW7A 1XNRB 5BYBA 3OEHG 4JYBA 5EZYB 4PA7A 1KJ9A 4LCUC 3RVYA 2W8LA 2HEPA 1CKNB 4ZBMA 1M4UA 4WHXA 4ZOLA 3KCXA 3H9VA 2YEVB 2X6CA 1EZJA 5LL6b 4A3GG 4QW9A 3T5HA 3B8MA 4E4EA 3CC7V 3HXLA 2YRXA 2D3OW 3E83A 1FJGB 1R3LC 1CEZA 4LMYA 3T54A 2JRIA 4JI0B 2FP4B 1W0KG 1Q81W 2NNUA 2VA2A 3IFXA 2FPGB 4ME6A 2EIMB 1KP2A 4FMTA 1MNGA 4DL6A 2CTQA 4JF3A 1H2LA 3D8CA 2M6YA 5KUKA 1HR0B 1GO3F 2HGXA 1MMMA 4ABMA 3QVNA 4DV3B 5I47A 2COIA 4NXMH 4O4JB 2OLSA 2R8GA 3MDSA 3JZIA 4DUYO 4PA6A 5KT6A 4MTDA 1Y74A 5T14A 5FJ8G 5LYJF 1VQMV 1VQ9V 3RB6A 2JEJA 4JTDB 4ZQIA 4O3NA 4LSAA 3SJQC 2YZGA 4A93G 4X66B 2DWCA 4W4KA 2V4RA 3T9BA 4DV6O 1M57B 3OFNG 2EJ0A 2FPIB 3T4ZA 4F6RA 3TW6A 2ZDQA 3PW4A 3B8NA 4FJCC 3RWRD 4CS2A 1IBKB 2UUBH 3OM3B 1JX9A 1FXVA 4FPPA 4J0MA 3K3WA 5BZBA 3ZS8C 3VOTA 2FLNA 3A8TA 5CN0A 1F4MA 5KT7A 2CUGA 4FLYA 2GBOA 2ALZA 4LR3A 4JTCB 4LFCB 1JX4A 1EZVH 3CC4V 2ZDHA 5DEDA 2PTMA 3ABLB 1QLEB 5I5TA 3OEEG 4X1KA 2Y4RA 4FBTA 4LFBH 3OTOB 5L3EA 4QE9A 4F4WA 3ASOC 4BW5A 5I5SA 4JV5O 3SPIA 1I94B 3J7AK 5KHIA 1KTAA 2ODMA 4NZMA 3GTKA 2KSDA 2DWDC 3A0BZ 1HP8A 2AGAA 2P90A 1NR1A 1AJPA 2W9AA 5FLXW 1AVMA 2Q5ZA 3H1KH 3SGIA 3JD1A 2RNBA 5HBRB 2I80A 2YXHA 1XUQA 4YBZB 3W7UA 2UXXA 4OX9B 2JGUA 5FNVF 4O3RA 5KFJA 1L0NH 4AYBA 4PELA 1H2GA 4JI8B 3GTQA 3D3IA 1NH2B 1I7FA 4FM9A 3K9SA 1WP7A 5LA6F 2IJIA 3FYIB 2YCHA 1NTMH 4IZOA 4O4IF 4NLGA 3N40P 3CCQV 5LYJB 2GV9A 2FYUH 5C1PA 3CB2A 5FLXN 1KQSU 3JAWA 2UXBO 4JI2H 1XILA 2X0SA 1J5EB 2ILMA 4AHCA 3T7AA 4O3OA 4MTEA 3QWUA 4QNHB 1K5SA 2ZXWB 5HV6A 2CW8A 1KBLA 1NQTA 2R82A 4FFKA 4DV5B 2Q0AA 1CP9A 3H1JH 3OT7A 5LL6Y 3U55A 4I4TF 1KKDA 3FB8C 5KFVA 4N21A 3OW2U 4FLVA 1D5NA 1UNNC 1MZBA 3RYCA 3G67A 5KFAA 1RJQA 5KG3A 2EJ7A 3K5HA 2BQUA 1W0JG 2FPPB 4U3FH 3SE7A 1A0IA 3KHLA 4PI2A 4D7TA 3OD4A 4E4TA 4PHZA 2DOSA 2F95B 2IU0A 4DR5O 3ORQA 1EM1A 1TVKB 3FMAA 4TOIA 4K6NA 2ZE8A 1S5JA 3ZEDA 4QJFB 4A3KG 2JA7G 1XHZA 3AG3B 2H94A 3LSUA 2QGNA 1V54C 2R8HA 4M7EA 4ICGA 4O7YA 2DLNA 1Z5WA 4J9SA 2QA4V 2ZINA 1PNLA 3KTMA 1BNCA 4O4HA 1F4NA 4EKWA 5FNVB 2VQDA 1Q6HA 2E5LO 3RAXA 2EJ3A 1A0GA 1GO3E 4RU9A 4O84A 2M05A 3AG7A 3QQMA 1WA8A 2ABJA 3U11A 5LA6B 4DUYB 2QTSA 2P67A 1S68A 5BWVA 4Q45A 1S0MA 5IP9G 4O4IB 1ZAUA 1JFFB 2X0LA 3CCSV 4EYHB 4WBNA 1P84F 4DR3O 1S5HC 4DV6B 5FPRA 1M5IA 4CS3A 3H4DA 1JMKC 5JH7F 2NU9B 4RAZA 4FBUA 2R9IA 3BY6A 3JALA 2FK2A 3VQWA 5BR8O 5J2TA 3T5JA 5CA1A 2YXLA 1G1XB 4GLWA 1E4FT 2JA7A 1LUWA 3ZJZA 2GUZB 2R7KA 1IYEA 5EZYA 5I5WA 3HBLA 3C90A 3RIZA 1TWHA 1JIHA 3X2QC 1Y76B 2X6AA 4LWSB 3G6EV 4FLTA 3KHHA 4I4TB 1CKNA 4QIWE 4GLXA 3K9AA 1V9PA 2YEVA 4LH7A 4ZIBA 1WH2A 4FLZA 3K79A 2VQEO 4JV5B 3SR2C 4RB3C 1OHHG 3JD0A 1GSOA 3N41B 1COWG 3ZX6A 4YJ3F 4EFEA 1FFTB 3JCUZ 4UCVA 4MA0A 3K5OA 5EBLC 4FK5C 4I55F 1XNRH 2RGRA 4OGQB 3MWEA 3S3WA 2R93G 3SI8A 4Q4CA 5DAAA 4MVRA 2ZIMA 3NUAA 5IY5C 4O4JA 3A2FA 4BXXG 3NC0B 2PYJA 3CWBH 4NVPA 4BWSC 3G8CA 1KT8A 2BOBC 1OJHA 4PDBA 3HKZE 4O4LF 4EFBA 2KSWA 2UXBB 2P5OA 1FJGH 4O7WA 2D2CB 3RYFB 3S24A 5J2UF 3OMIB 1IBLH 4JI0H 2JA8G 2ZE5A 3SPGA 2HHHH 2Z5UA 3C3SA 5KG0A 4JUZA 5JH7B 3ABTA 2DYRC 3LP8A 5B1BB 1BL8A 3BQ2A 2UUBO 2W70A 4DV3H 4FLUA 1QQCA 2R87A 4UV9A 5KFNA 2Q4PA 4FLWA 4O7NA 1G6UA 2AZ2A 3N2GB 4WD3A 2AXTZ 1QVFU 1NI8A 3ZCCA 4ECXA 5EC2C 2R8KA 2R93A 4LFBO 2XGPA 2JDIG 4DR5B 2JVDA 1WJZA 3STZC 4DR1H 2C2AA 1BS3A 4X66H 5KFSA 1QCEA 5A9GA 1FXKB 3I55V 3WWHA 2Y4TA 4YJ3B 4G28B 3A0RA 3G71V 3F7YC 2W71A 5KFOA 3GTLA 1IBKH 5EWEA 1S0NA 1JXLA 3HO8A 4P30A 2E5LB 2P4VA 1FYJA 4ZHQF 4I55B 3MR3A 3JD3A 4YP3A 5KFMA 1S0OA 5CBHA 4MTFA 1B6SA 4MVQA 3T2MA 2SCUB 3GQCA 3CCEV 2RCVA 2R86A 3PW2A 3OSPA 2WLIB 1ZETA 4ECYA 2QKAA 2FE3A 3OTOH 4A3FG 3QFFA 3L2PA 2ZNIA 1ZHQA 5LMUH 5LYJA 1KC7A 2AHYA 4O4LB 4DR7O 4ECUA 3RBEA 4XDJA 4DR3B 2JJ1G 2QWQB 3T1CA 3H1LH 1VS0A 2AGQA 5B1AB 5J2UB 2R84A 1P49A 1MG1A 4XDLA 4MV6A 2WA3A 5BR8B 4RB1A 4JI6O 2YDEA 3ABUA 3TEKA 4O3SA 3OR6C 3B2EE 4EEYA 4DR6H 4LF4O 5KKNB 4JI8H 4PA3A 4FM2A 1NH2D 4WFFA 1QVGU 1JCHA 4WFBV 4FFLA 3M4IA 2GLTA 1FD9A 3CXCU 2QKCA 2UXDH 5IWAH 4J7JA 5L3GA 2ADPA 4CC5A 2CFMA 1JQ0A 5KFFA 2A9HA 2VQEB 2YWVA 4A3MG 2PN1A 5DGBA 3MAQA 2MCTA 3V6JA 3AG1C 1RPRA 2IH3C 3I56V 1TAEA 3OUSA 1UFIA 4TQDA 4MV4A 1TVKA 4DQNA 1J5EH 4MT8A 1NTZH 1P7GA 5JCOA 1HNXO 3IG0A 4JV0A 3PVXA 2B63G 4QJFA 5KFQA 2RDJA 1KMIZ 5IYZF 3OHAA 1Z5VA 3UM7A 2HJDA 3D3QA 3UYYA 3CCRV 3QZ8A 4X62O 3H20A 2K1EA 4LP8A 5FNVA 2COJA 4HN2A 5K3WA 2VA3A 1KKCA 4ZHQB 1MSDA 3L70H 1B33N 4O3QA 4QE7A 2LO1A 3K0DA 4JI4O 4ED3A 1OCOC 5LA6A 4MV9A 2W7PA 1RYRA 2XGQA 2GQSA 4Z2WA 4O4IA 5KT4A 3UKMA 4BR6A 1JFFA 2YZNA 2ZT9B 3OUZA 4GT1A 4MVSA 2LW1A 2HLDG 4MW8A 3PN1A 4PA9A 2DWEC 1OCRC 3FYEB 5CM0A 2LGWA 2QM4A 3WB0A 3CJHA 5BWTA 4Q44A 3WU2Z 3ZRXA 3ASNB 1MSWD 2QWOB 4MW3A 4R7RA 3N44B 2UUBB 2B63A 1V55B 3CSWA 3LNNA 2GUZA 1K1QA 2EIKC 4TQRA 3VNNA 2V9WA 2EIMC 3RB4A 1Y76A 2GTAA 3R65A 4DUYH 4LWSA 2NVXA 3GIKA 4I4TA 1NKDA 4TQFA 4MAMA 4ZKIA 1I2LA 4EBDA 2E2IA 2ZGIA 3S3XA 5DGIA 2BQRA 2IU3A 1K4DC 1JLLB 3STLC 2YIBA 3FKIG 4Z1MG 4RZRA 2R8JA 4J10A 4MTXA 5IYZB 4M9UA 3OHBA 2YSUB 5A2QN 1PL4A 4C5CA 4ED7A 2YW2A 1D2DA 3ZHVA 4MV7A 1RM1B 5GW7A 4X64O 2XOKG 4P9OA 3B40A 1RP3B 5BWRA 2GPSA 3OUUA 4BWAA 1BQZA 2HJWA 2QDOA 4M0JA 1M1KW 1JPXA 3ETHA 3VMMA 4PDLA 4DR7B 4JV5H 1RJRA 3RYFA 3FB5C 1CQJB 3K5NA 5FD6A 5JWPA 3HOXG 3CMAV 2YIBD 5H80A 1IBLO 2C35B 4JYAO 4YB8B 2XAGA 4NYEA 4JI6B 2HHHO 1ZSPA 5JH7A 3ZRSA 3RB0A 4LF4B 5KFYA 3JRWA 3OSNA 2DW4A 5FD5A 4YY3H 3HOVG 1WCMA 1MZFA 4RNMA 1FPOA 1AB3A 1JA8A 1THZA 2XC9A 2JA6G 3N27A 4BBRG 1IBMO 1KB9F 3CC2V 3N2GA 3CCJV 3AK3A 2R92G 4CMDA 2VWKA 3BAAA 2UXBH 4U7CA 1AR5A 1HNXB 5KHKA 4DR1O 4KP4A 3L75H 3JSLA 2WAQE 3WG7B 1JKJB 4ED6A 1FXKA 3CVZA 1SQBH 4YJ3A 1AI6A 3R5FA 5JQWA 2QB5A 3T5LA 3L72H 4X1IB 2E74B 1CKOA 4IR9A 5L1IA 4XYMB 4X62B 1S9FA 4IRKA 1Q5OA 1Q82W 4I55A 1JVMA 4UVCA 3TQTA 4CH4A 1G2WA 3RYHB 4JI4B 5F9NA 2Q9LA 5KX5F 5KFEA 2E3CA 3BHPA 1YTFB 4JYCA 3CX5F 1VQPV 1LUVA 5LP6C 3PO2G 1JJOA 3GIJA 3H01A 1BCCH 1R3IC 1T36A 5F9LA 1S76D 2WLIA 1S03G 4Q0YA 1R3JC 5LMUO 4O4LA 4DR5H 1Y1WG 2JA6A 5H5NA 4B08A 4EB6B 3KREA 4PDVA 3K0GA 1EYZA 1VF6C 1XL6A 5J2UA 2ZJTA 1Q6UA 2Y0PA 3RV3A 2ATLA 1NZ6A 4DV2H 4K8ZA 1YVWA 3H1HH 1AP6A 1NBMG 1ULZA 4L1KA 4PI0A 3UT5B 4FFNA 3RFRA 2E5LH 3OE7G 1BT8A 2HG5C 4DR6O 4PZ6A 5KAFZ 3DF7A 4ECQA 5HNEA 1CS0A 4KUMA 1KJJA 3LSSA 2B1GA 4IRCA 4JZGA 3LULA 1KC8W 5IWAO 2UXDO 1O75A 2EZPA 1SA0B 4FE2A 1XK5A 4DR3H 2R8IA 2Q6AA 3I4NG 5EOYA 4H44B 2ZR2A 3ZHRA 5LHIA 4OPAA 2WLMA 1K7DA 2DYSC 1OZ0A 3B77A 5BR8H 4JAAA 1Y1WA 3CSXA 3Q8RB 3U0GA 4GYCB 1H38A 4XDKA 1YCIA 2IMWP 4CS4A 4JI3O 4X64B 4ZHQA 3QG5A 4BIUA 3JD4A 1OCCC 1DV2A 2PVPA 2QE7G 4J42A 4CMFA 1K1SA 2XT9A 1FAFA 5KX5B 2CKZB 3E5NA 3MFHA 1FFXB 3AG4C 3QF7A 4O3PA 1XMQO 1GRJA 2VQEH 3ICXA 2LGQA 3FKSG 3DXRB 4JTAB 3I4MG 4RUFA 1QR8A 2EX3A 3RF2A 1RK6A 4UFZA 4QWBA 2NR5A 1R6KA 2WB1A 3PW5A 3NR7A 1IBLB 2QK4A 1Q7YW 4JYAB 2ITCC 3F5TA 2OCCC 2HHHB 2VR1A 2WTFA 4F4YA 3OUFA 3O65A 1KJ8A 2JS3A 4IL6Z 3GV5B 4FFMA 1YEWA 1TA8A 3N2KB 2EINC 4IYHA 1WB7A 1D5AA 1QNMA 2CDYA 1VQNV 5KG1A 4ECZA 1M0WA 3M7MX 1I5XA 3BCCH 1VQLV 2HP8A 5LGTA 1IBMB 5DMXA 4YIOA 1ENVA 5KFLA 3SYQA 1Z2GA 3MD0A 3WB1A 3SJCC 2JJ2G 4JI1O 3AW8A 5IE9A 3KHRA 2F93B 2V5AA 4NTYA 1FXHA 3I12A 3M99B 4JV2A 1OCZB 3KALA 1P7BA 4DR1B 4JI5H 3MWMA 1SF9A 1SRYA 4X9QA 1H2KA 2R6FA 4B3RO 5IYZA 2DJVA 1Y1VG 4G3IA 2VS0A 2CTWA 2NU8B 4LF5H 2IH1C 1R1BA 2Q2UA 1JOYA 5BWUA 1E1RG 1I0HA 4LF7O 4QIWF 1I1LA 4UVBA 3V6HA 1N32H 2RQ6A 4JAUA 2V1DA 4R8UB 4J9KA 5LMUB 4HNTA 1V51A 3G6VA 1BZKA 2IM9A 4HNUA 1T94A 4YAKB 3E8HA 4NTWA 1Y66A 1YXBA 3IJ4A 2WLHA 2OYQA 2W6QA 5LOVF 3D36C 1E1QG 5KA6A 2UVRA 3EHBB 4FIPC 1EZ1A 2WLLB 4O83A 1AN7A 3OTFA 5EBWC 3KXYT 4DR6B 4YJ2F 1FXKC 4X65O 1IOWA 5CR5A 4DIMA 3DTUB 5LGNA 4YY3O 4LF9O 2P0AA 4PZ8A 3I5DA 1YI2V 2I87A 3TCUA 4DR4O 5IWAB 2UXDB 3JZFA 3W7SA 2W9BB 4LC1A 1AILA 3RUPA 4DR7H 3AYHB 4CC6A 1K34A 5K2MA 2W6IG 2W6NA 3SPHA 2CQYA 4NTXA 1Z2OX 3K03A 1JDEA 1EKPA 1GMGA 4JI6H 5B5EZ 2P22C 3K5IA 3ABKB 4X1IA 1B06A 4X1YB 4LF4H 3EXAA 3RGXA 2BR0A 4K0KO 3PZPA 3TXQA 3Q2OA 1VP7A 4JI3B 1YJ9V 3MR2A 3RYHA 4LFAH 4AI8A 4BAYA 2WLNA 3BPZA 4I5SA 1XMQB 4C5AA 3GV8B 4NZOA 1WPXA 2RGVA 2VRZA 2YC0A 1EUDB 4TV9F 4B3SH 1SFOA 2BTQB 1L2ZA 1L8DA 1VAJA 4EB6A 4J7ZA 2ZDIA 1Q3EA 2GDSA 5LXTF 1HNXH 2R9AA 4DV4H 1U97A 2AHZA 5KS8A 3CYOA 1DV1A 4TV8F 5LOVB 1SQFA 2RF4A 4XYLB 1SQVH 3VPBA 4DV2O 1GN2A 3CEIA 4RB2C 1X9NA 4DUZO 4X62H 3RBDA 4ECVA 3UT5A 2Q67A 1AI7A 4YJ2B 4PV1B 2DPIA 1LNQA 5BXZA 1GSAA 4JI4H 1AR1B 1Y6XA 3CCVV 2N05A 1I1MA 3GTGA 2QJ1A 4JI1B 2HFEC 3CRRA 4O7RA 1NU1H 1PL0A 5DECA 2Q8VA 5KAIZ 1SA0A 3ZRWB 2N74A 2VWJA 4H37A 4UXNA 3CQZA 5D5QA 1VEWA 2EIJC 3RBZA 3DSQA 4R7CA 3CRMA 2Y69B 1EHIA 5BY1A 1H8HG 3UFXB 4B3RB 1IDSA 2LFRA 3LQSA 2HVSA 4A3BG 1NTKH 5KG2A 4Y8VB 2DE0X 1BHBA 3V4ZA 2VPSA 4O2BF 5H9CA 1JR9A 4A3JG 5KFCA 3SYCA 3ZHQA 2OCHA 3IAYA 1ZX3A 1R6NA 3ASNC 1N56A 1RYSA 4LF7B 5KX5A 5LHHA 1FFXA 2R72A 2C2RA 2HHFB 2AGOA 5KA5A 3KHGA 3DXRA 3G6XA 4TV9B 2MK3A 1E4EB 4BY7G 2G38A 4CKEA 4E2LA 2HIVA 4C5BA 3NBZB 1WN7A 3C0FB 3E35A 5LXTB 1NVPB 1HDJA 5KG4A 2W6MA 2JEIA 4TV8B 2R7MA 1Y4MA 4WF9V 4F4XA 2PYLA 4F4ZA 4B3MO 2RN9A 4X65B 5DG8A 3N2KA 1SQGA 2E76B 4X64H 4YY3B 3FB6C 4DW1A 3UO3A 3BA9A 4LF9B 2WE6A 2OH2A 1I6UA 4U7NA 4DR4B 2J6SA 3TXSA 4DXWA 2KB1A 1J95A 5HFLA 3UCSC 1RM1C 1SQXH 2YRWA 1SS3A 4K35A 4GUNA 4JPRA 2RJZA 3GWKC 4B7EA 5CBFA 5EWGA 1WAZA 4JI5O 4YR2A 4JYAH 2CTRA 4EG0A 4AQYO 2UVWA 4KFMA 3VPDA 2C22A 1PP9H 4K0KB 1I50A 1DF5A 2C28A 2FK3A 4PJ0Z 1UC8A 2Y0IA 4J7KA 4O2BB 4HR7A 2GTSA 4LF5O 1N33O 1E4GT 4EEQA 3E2EA 3KAJA 3HOYG 2JGDB 3TY8A 3BG5A 1CE8A 2CGOA 2QEXV 1OWTA 1IBMH 3R9RA 3MR5A 2R9RB 3R23A 2DQ3A 3ETDA 3ORRA 2ZDGA 1N32O 2UUAH 3E8BA 1BJTA 1GM9A 4YIPA 4R8UA 5I5XA 4GX1A 3VQYA 5IYDO 3ZBHA 2PMZE 3GTPA 2V58A 3JCZA 5JJEB 5CAEB 1M9NA 4DV2B 2KG7B 2JEXA 4LSXA 3V6KA 1G4YB 4ED1A 3ASOB 2QTOA 4DUZB 4I7HA 3J80W 3KZIZ 2WLLA 1GN4A 1L0LH 3WG7C 4G27B 2FB5A 4MV8A 5GONF 4RZQA 4LH6A 2W0XA 2DIKA 5KT2A 4J9RA 3CCLV 1YSCA 3RT3C 3TK1A 2HGSA 2W9BA 1TUBB 2YS6A 1AUVA 2ASDA 5B3SC 1GAXA 4RAYA 2L35A 1S3JA 3ZMUA 4JI7O 5KFTA 1XBLA 3P30A 1BQ0A 3SYAA 5I5UA 5JVDF 2ZIOA 5EBMC 3O9OA 4A3DG 2WYOA 2IJJA 4NXNO 2ZDIC 4DAAA 5L1KA 3GIIA 4X1YA 3GTJA 1N48A 2R7NA 3HKEB 3T1YO 3ZMSA 1KBHA 5KG6A 3QO8A 2P7TC 5E79Z 4O81A 4HYKA 4WFEA 1K97A 5L3FA 3U0ZA 5DGAA 1AP5A 4I50F 4TUYF 4LFAO 1EKVA 3EYYA 4QIWA 3R66A 3P32A 2XNDG 2A0LA 2BTQA 4B3SO 3BVOA 4D7SA 3M9MB 1NR7A 5DISC 3AG2B 2PI4A 1P8LA 4DV4O 3RYIB 1XMOH 1RFYA 3OR7C 5LOVA 4PZ7A 4PBCA 3AK2A 3BEHA 5DGHA 3JYCA 4MSWC 4B3MB 3GIDA 3T5KA 2WLKA 3N8DA 2RDCA 2EJ2A 4JI3H 4YJ2A 4FFRA 5KT5A 2Q7HA 4QWCA 4LBEC 3RVZA 2EBOA 3PFFA 4RQFA 5GONB 3JAMW 3BJYA 5EC1C 1GTOA 3BQ0A 1XMQH 3DGEA 3SPJA 3VQXA 3JZ6A 4ECSA 3ETEA 4Q6GA 1S77D 3HKZA 2QWPB 3ZRWA 3Q1KA 4IT5A 3W7TA 3GLKA 4CH3A 2EILB 5C93A 1A48A 4U6PA 4Q4DA 4DK1A 1VBHA 4JI5B 1O9GA 1SEIA 5JVDB 1HNWO 4AQYB 3BA8A 4F6EA 1XDNA 1RSOB 4TWKA 1NT2B 4LF8O 3H0GG 4J9ZB 3K3VA 1S5LZ 2J6UA 4P2ZA 4BIZA 3NGDA 3NBYB 2HG8A 1F7YA 1Q43A 1AR4A 1VARA 3HPLC 4LF5B 1N33B 2IJKA 1W59A 3LMLA 4FU0A 5KFZA 3ETQA 2GSMB 4I50B 4TUYB 4JI1H 1N32B 2XIGA 4IHJF 2HHFA 4FS1A 1SYXB 2W6OA 3N43B 5I5YA 3MJFA 4MVZA 4TV9A 4KHPO 1E4EA 1I1KA 2FK1A 1KUQA 2CAZC 3HKBB 4MVUA 3JRXA 3GB7C 1M56B 4WFHA 2FLPA 5LXTA 2PMZA 3CP1A 4B3RH 3WO0A 4Q8EA 1SERA 3J81W 4TV8A 1GGOA 1OCZC 2W9CB 5I60A 3KCYA 4FFBB 1P4RA 2HJFC 1P16A 4MTOA 3G6YA 4WFGA 1M57C 2FMLA 1N8RW 3CEBA 2Z04A 1KP3A 1M93A 4DRXB 2GHYA 1XEQA 3DTGA 1PNKA 1N0JA 3K5MA 4CKCA 3JARB 5FLMG 4LF7H 3U9SA 1K3EA 3EVKA 2W0FC 3ZN1A 3F8NA 1B3QA 4QPKA 1ZUQA 2A06H 1TWCA 3WNZA 2YYAA 4O82A 4JI7B 3MWDA 5IY5B 3ABLC 4NR1A 5KG5A 1QLEC 1GM8A 3PW7A 4JXUA 5L3DA 4NXNB 1HW7A 1Z2NX 3H40A 1S10A 1ZLZA 1WR2A 4MVMA 4EYIB 1URFA 3T1YB 1RJPA 4ECTA 3VOUA 3BABA 4X65H 2JEGA 4DL7A 2DN9A 5LHGA 2J6TA 3FKIA 4LF9H 4O2BA 4GX0A 2JA5G 5CBGA 3KG2A 1PK8A 3T9DA 2JGDA 5C1OA 1OBDA 3Q4HB 4DR4H 4OXSA 4LFAB 3QTCA 1XREA 1TGOA 2DYRB 5JQGF 4A2BA 3HB3B 3CPWU 2UU9H 3PW0A 2XCLA 3N6RA 5IT9W 1K73W 4GX5A 1TUEB 4IHJB 2UUAO 1N0NA 4B3SB 1OV9A 2CK3G 1DK1A 2OTJV 4GKJH 3EPIA 2XAQA 2Z3YA 3H1IH 4APMA 5IJ0B 4Q8FA 3RGZA 2VUMG 2DQ0A 1F51A 4DV4B 3W5OA 2Q0OC 1KJIA 3WWIA 3CRCA 1IXBA 4Q20A 3GTOA 1CQIB 3G4SV 2IW5A 3FX7A 5DLGA 2KG7A 2Y4UA 2ZE6A 5DN6G 3GJXB 4UV8A 4K0KH 3M8AA 3CD6V 1ZWIC 1N36O 2YS8A 5KLVH 2ZXWC 1GK9A 3K04A 5E1AC 5IT9N 3DC6A 5E25A 1QBZA 3CHXA 3HB9A 3LDDA 1VQ7V 5JJJB 1TUBA 4O7TA 2L6LA 4RCNA 3QO7A 5K1PA 5DQHA 4UCOA 2BSKB 3T9AA 5DM6V 1VKZA 2R92A 2EJRA 1HNWB 1SETA 5IJ9B 4LF8B 1GN6A 4DUZH 5KMGB 4FGRA 5JCOC 1US6A 5KFGA 5DQIA 4CZZA 4MTGA 3HKEA 2YXYA 3AG3C 1VQ5V 1AI5A 1ZL8B 4FFPA 5H6QA 2ADQB 2CH7B 3Q8QB 5BMVF 2P4KA 2YICA 2GQRA 1YF2A 5JQGB 3LNMB 3EFFK 3TGUH 2C2DA 1SZXA 4IR1A 4IYIA 5FL7G 4YHHO 4KHPB 1GYFA 3H3VH 4PDMA 2ZQMA 4R8CA 5EDWA 1KUTA 5L3CA 1S0VA 3RYIA 1YZBA 2E2HA 1FVIA 3L74H 1XMOO 4XX0B 1XI1A 5JJNB 4PDRA 4B7KA 3HOZG 1U96A 2Y69C 3SYPA 4JV1A 4CE5A 5KHJA 5BPFA 2DPJA 1ZTEA 5GONA 1AJQA 1XL4A 3TIIA 5IYDG 1B6RA 4I7ZB 4CH6A 2ZCEA 2Y0SE 2JK5C 3BFRA 3FB7C 4UVAA 3ZMVA 2DABA 3WWJA 4QWAA 2HR3A 1JDBB 2AW9A 3AX6A 4N23A 4BBSG 2BCCH 1T5EA 1OCOB 4K8XA 2FJZA 1H2NA 1K92A 3P3NA 1DGSA 5BWXA 5JVDA 1O9HA 5IYCG 3JAKB 3SJAC 1RSOA 3UO2A 3PR4A 4DK0A 2F4VO 4B3MH 4A3CG 1OCRB 4U3JB 5KHHA 3RB3A 4GKKH 4C7UA 4XZ3B 1Z2PX 1TWFA 3TINA 5IYBG 4I50A 4TUYA 5BMVB 2I8CA 2UUAB 2UUCH 2EIKB 3R5HA 4XBFA 1K9MW 2JEUA 2WLJA 1S72V 1I08A 1GM7A 1N34O 3HKBA 3OMAB 3PO3G 4QW8A 2XCAA 2VPQA 3HKCB 2WAQA 4AQYH 1WNSA 3RJ0A 4DV7H 2W9CA 4FFBA 1V4YA 4J9OA 1N36B 2OWOA 1N33H 3E22B 3N6XA
chains in the Genus database with same CATH topology
4CC5A 4LF7B 4X20B 2CFMA 4DRXA 1B04A 5KX5A 3KAKA 2VQEB 3JARA 1FFXA 2R72A 3MAQA 2MCTA 3JAWB 3JASB 4CH5A 1TAEA 4TQDA 4TV9B 1TVKA 3GB8B 1J5EH 3L4KA 5JCOA 2HIVA 3IG0A 3NBZB 1WN7A 2JS5A 3C0FB 5LXTB 1KMIZ 3N42B 1Z5VA 4TV8B 3K57A 3H20A 5FNVA 2PYLA 4L8JA 4FM0A 4X65B 4ZHQB 3N2KA 1SQGA 4X64H 4YY3B 4LF9B 2WE6A 3BA9A 3RYCB 5LA6A 4MV9A 1I6UA 3JATB 4DR4B 4O4IA 1QHTA 1JFFA 3PN1A 5D1OA 4YHHB 3K59A 2WDTA 4IHJA 4DV0B 1CKMA 2QM4A 2RJZA 3WB0A 4JI7H 5IJ0A 3T1HB 4JYAH 4DV1B 4O4HB 4NXNH 1XMOB 2VQFH 4R7RA 3N44B 2UUBB 5KHGA 4K0KB 3LNNA 3T1YH 2UXCH 3VNNA 4O2BB 2ZM6H 4DUYH 1E4GT 4EEQA 1M0TA 3KAJA 3RR5A 3TY8A 4IIJA 4I4TA 5D5PA 1H2SB 4TQFA 1IBMH 4WBNB 2PY5A 2UUAH 2PZSA 1BJTA 1HNZB 4ZI7A 1WPBA 3VQYA 3KYHC 4FM1A 2Q7GA 4B3TB 4DRFA 5LMNH 3JALB 2YIBA 4UCTA 5LP6B 2CW7A 2BTOA 4DR2H 5J2TB 5CA1B 5IYZB 5JJEB 4LF6H 4DV2B 4LSXA 5IJ9A 2XHBA 4DUZB 1XNRB 5EZYB 4I7HA 3J80W 2F4VB 3HKDB 4MV7A 5KMGA 2HEPA 3K58A 3BRCA 1CKNB 1M4UA 4ZOLA 2VUGA 2YIAA 5LL6b 4RZQA 2F66C 4LH6A 4BWAA 4HNAB 3HXLA 2HGSA 3L4JA 4DR7B 4JV5H 1FJGB 1TUBB 5JQGA 4LMYA 3RYFA 4RAYA 3K5NA 4JI0B 5FD6A 1N34B 2YIBD 2ZIOA 4JI6B 2HIXA 2WYOA 5JH7A 1HNWH 1HR0B 4LF8H 4LF4B 4X1YA 4DV3B 5K1XA 5FD5A 4YY3H 3HKEB 4NXMH 4O4JB 4E6NA 4MTDA 3U0ZA 5CB4B 3N2GA 3EYYA 2VWKA 3BAAA 1XNQB 2UXBH 4LSAA 4X66B 2BTQA 4D7SA 4A2AA 1HNXB 4KHPH 5KHKA 3T1HH 5DISC 3JSLA 2KKWA 1P8LA 4DV1H 4F6RA 3CVZA 2Q2TA 3RYIB 4YJ3A 1XMOH 4CS2A 4LNUB 3RWRD 4X1IB 1IBKB 2UUBH 5LOVA 1CKOA 4PZ7A 4J0MA 3ZS8C 4X62B 3JAKA 1Q5OA 1VF7A 4FLYA 4B3MB 4LR3A 4I55A 4LFCB 4CH4A 4JI3H 3RYHB 4YJ2A 4JI4B 4U3JA 3UQ8A 2PTMA 2Q7HA 2E3CA 3BHPA 3JAMW 5GONB 4X1KA 5LP6C 1FKAH 1JJOA 4LFBH 3OTOB 4RB0A 1XMQH 1S03G 4Q0YA 2Q7EA 3VQXA 5BMVA 1HNZH 1I94B 3J7AK 5KHIA 4O4LA 4Q6GA 2UU9B 2HVQA 4DR5H 4EB6B 4B08A 1XQ8A 4CH3A 4GKJB 5FLXW 4DK1A 5J2UA 3K5LA 3SGIA 4JI5B 1O9GA 2ZJTA 3RGBA 1SEIA 5JVDB 4DV2H 4K8ZA 4AQYB 4OX9B 3BA8A 2JGUA 1XDNA 3HKCA 4PI0A 1NT2B 5CA0B 3K3VA 4JI8B 3UT5B 3RFRA 2E5LH 1I7FA 1KU9A 4PZ6A 3NBYB 4FM9A 1Q43A 3DF7A 4LF5B 1N33B 2YCHA 2V4DA 4UCSA 3LMLA 4ETSA 3E22A 1SKVA 3ETQA 3N40P 4X20A 4I50B 4TUYB 5LYJB 2GV9A 1O75A 4JI1H 1N32B 3CB2A 2XIGA 1SA0B 4JI2H 3JAWA 1SYXB 3JASA 1XK5A 4DR3H 3N43B 1J5EB 4O2AB 4TV9A 5EOYA 4AHCA 3JSNA 2CAZC 3HKBB 4MTEA 3QWUA 5C8YB 2CW8A 5LXTA 5BR8H 3CSXA 1HR0H 4B3RH 3RTXA 4DV5B 3J81W 4TV8A 2Q0AA 4FFBB 4GYCB 5FPOA 5ITZB 1P16A 4CS4A 3GDEA 4X64B 1N36H 4ZHQA 3QG5A 5EYPB 4FLVA 1MZBA 1M93A 3RYCA 4DRXB 5KX5B 5EIBD 4LF7H 3K5MA 3JATA 3JARB 1FFXB 2VQEH 3QF7A 1A0IA 3ICXA 4PI2A 3F8NA 4D7TA 4PHZA 3TY5A 2F95B 2EX3A 1TVKB 3RF2A 4UFZA 3FMAA 4TOIA 1S5JA 3ZEDA 1XHZA 4JI7B 1IBLB 3W1BA 4JYAB 2PUSA 2HHHB 4UCUA 4M7EA 1Z5WA 4NXNB 1HW7A 1Z2NX 2VQFB 2ZINA 4O4HA 2O03A 5FNVB 4LFCH 1YEWA 1TA8A 3N2KB 3T1YB 2R70A 3BABA 2UXCB 4X65H 1D5AA 2ZM6B 1M0WA 4O2BA 3U11A 5LA6B 4DUYB 4LF9H 1X4TA 1S68A 3M7MX 4O4IB 1ZAUA 4FLXA 1IBMB 4DR4H 4LFAB 1JFFB 3QTCA 1TGOA 4A2BA 3WB1A 1I94H 3SJCC 2UU9H 4WBNA 2F93B 5D1OB 5IT9W 4IHJB 4B3SB 4GKJH 4DV6B 5FPRA 1M5IA 4CS3A 3KALA 4DR1B 4YHHH 4DV0H 4APMA 5IJ0B 5LMNB 4JI5H 3MWMA 1JMKC 4RAZA 4UCRA 3RGZA 4DV4B 3JALA 3W5OA 4OX9H 3VQWA 4DR2B 4BW9A 5LP6A 5J2TA 5CA1A 2YXLA 5IYZA 1E4FT 3GJXB 4K0KH 5EZYA 3SJBC 4LF5H 3RIZA 3HKDA 2Q2UA 4FLTA 4IIJB 4I4TB 4KL1A 1CKNA 4GKKB 4GLXA 1V9PA 4ZIBA 4LH7A 1WH2A 4FLZA 2YI8A 5D1PA 1N32H 4HNAA 3CHXA 2RQ6A 4JV5B 2HVRA 5JJJB 5LMUB 3SR2C 4ZI7B 4RB3C 1TUBA 3N41B 2IM9A 2UUCB 4B3TH 4EFEA 5K1PA 4UCOA 4UCVA 2OYQA 3K5OA 4DV5H 1HNWB 5IJ9B 2YI9A 4LF8B 1AN7A 1XNRH 4DUZH 3OTFA 2RGRA 3KXYT 4DR6B 2F4VH 4NXMB 5KMGB 4DV7B 5JCOC 3U10A 3HKEA 2ZIMA 4ZOLB 4HBNA 4O4JA 3A2FA 3NC0B 2PYJA 4NVPA 4PZ8A 4BWSC 2UXDB 5IWAB 4PDBA 3THOA 5CB4A 2F1MA 4EFBA 2KSWA 5JQGB 2UXBB 4DR7H 2P5OA 1XHXA 1FJGH 4CC6A 3RYFB 3S24A 1GYFA 4KHPB 3TY9A 1IBLH 4JI0H 1BGWA 2HHHH 4AILC 1N34H 1Z2OX 5JH7B 4JI6H 3RYIA 3WB2A 2P22C 4LNUA 1FVIA 4X1IA 4X1YB 4LF4H 3RGXA 1XI1A 4DV3H 5A2QW 5JJNB 4FLUA 1QQCA 4JI3B 4EQ5A 4FLWA 3RYHA 3W1GA 1G6UA 5KHJA 4LFAH 4LFBB 3N2GB 5GONA 3BPZA 1XMQB 3FFQA 2RGVA 4CH6A 4B3SH 4DR5B 2JVDA 2ZCEA 4DV6H 2BTQB 1XNQH 4DR1H 1L2ZA 4X66H 1L8DA 4EB6A 4IAJA 1Q3EA 5EIBC 1HNXH 2R9AA 2VOBA 4DV4H 4F6RB 4FVMA 1T5EA 4YJ3B 4K8XA 1DGSA 5LOVB 1SQFA 5JVDA 1O9HA 1IBKH 3JAKB 3SJAC 1RSOA 1X9NA 4RB2C 5CA0A 2E5LB 4DK0A 2W57A 4X62H 4I55B 3UT5A 4B3MH 2ZNJA 4YJ2B 4U3JB 5KHHA 4I9QA 4GKKH 4JI4H 3VQVA 1Z2PX 4X1KB 2PGGA 2QJ1A 5IWAH 2FE3A 3OTOH 4I50A 4TUYA 4JI1B 5BMVB 2ZNIA 5LYJA 3L2PA 1ZHQA 5LMUH 4O4LB 4JI2B 4DR3B 1SA0A 1Q8IA 2UUAB 2UUCH 2VWJA 5D5QA 1VS0A 4O2AA 5J2UB 3DSQA 1P49A 3HKBA 5C8YA 5BR8B 1ZHSA 4RB1A 4B3RB 3HKCB 4AQYH 1WNSA 3B2EE 2HVSA 4DR6H 4LF6B 3RJ0A 4DV7H 4JI8H 2VPSA 4FM2A 4FFBA 5ITZA 1N36B 2OWOA 3IAYA 3M4IA 1N33H 3E22B 3N6XA 2UXDH 5EYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC5 A;  4LF7 B;  4NXM B;  4DR6 B;  2CFM A;  4DV7 B;  1B04 A;  2VQE B;  4JI0 B;  3RTX A;  4DV5 B;  1N34 B;  3NC0 B;  4PZ8 A;  1TAE A;  5FPO A;  1P16 A;  4JI6 B;  2UXD B;  5IWA B;  2HIX A;  3GB8 B;  3GDE A;  4X64 B;  2HIV A;  3NBZ B;  4EFB A;  1HR0 B;  4LF4 B;  2UXB B;  4DV3 B;  4CC6 A;  3S24 A;  4KHP B;  3TY9 A;  1A0I A;  4E6N A;  3TY5 A;  4UFZ A;  4X65 B;  4TOI A;  4YY3 B;  4LF9 B;  4JI7 B;  1FVI A;  3BA9 A;  3BAA A;  1IBL B;  1XNQ B;  4JYA B;  3W1B A;  2HHH B;  4X66 B;  4DR4 B;  4UCU A;  4JI3 B;  4EQ5 A;  1HNX B;  4NXN B;  2VQF B;  5DIS C;  3JSL A;  3W1G A;  1P8L A;  2Q2T A;  1TA8 A;  3PN1 A;  3T1Y B;  5D1O A;  4LFB B;  4YHH B;  3BAB A;  2UXC B;  2ZM6 B;  4DV0 B;  1XMQ B;  1IBK B;  1CKM A;  1CKO A;  4PZ7 A;  4DUY B;  4X62 B;  1S68 A;  4DR5 B;  3T1H B;  1ZAU A;  4B3M B;  1IBM B;  4LFA B;  4DV1 B;  4LFC B;  1XMO B;  4JI4 B;  3UQ8 A;  2UUB B;  4K0K B;  5D1O B;  1DGS A;  4B3S B;  3OTO B;  5FPR A;  4DV6 B;  3VNN A;  4DR1 B;  5LMN B;  4EEQ A;  1X9N A;  1I94 B;  4UCR A;  2E5L B;  3RR5 A;  4DV4 B;  2UU9 B;  2HVQ A;  3TY8 A;  3W5O A;  4DR2 B;  4GKJ B;  3GJX B;  3SGI A;  4JI5 B;  1HNZ B;  3KYH C;  4AQY B;  4OX9 B;  3BA8 A;  1XDN A;  3L2P A;  4B3T B;  4JI1 B;  4DRF A;  2Q2U A;  4JI2 B;  4JI8 B;  1CKN A;  4GKK B;  4GLX A;  1V9P A;  4UCT A;  4LH7 A;  4DR3 B;  2UUA B;  4PZ6 A;  3NBY B;  5D1P A;  1VS0 A;  4DV2 B;  4LF5 B;  1N33 B;  4UCS A;  1XNR B;  4DUZ B;  4JV5 B;  2HVR A;  5LMU B;  2F4V B;  5BR8 B;  4B3R B;  2UUC B;  2HVS A;  1CKN B;  4EFE A;  1N32 B;  4UCO A;  4UCV A;  4LF6 B;  2VUG A;  4LH6 A;  1XK5 A;  1J5E B;  1HNW B;  1N36 B;  2OWO A;  3JSN A;  4LF8 B;  3QWU A;  4DR7 B;  1FJG B; 
#chains in the Genus database with same CATH topology
 3FAV B;  4X20 B;  4DRX A;  3KAK A;  3JAR A;  1BHA A;  5B1B C;  1SC5 B;  4GC7 A;  3JAS B;  3EPG A;  3LDE A;  4CH5 A;  1XNQ O;  3HR0 A;  2WPD G;  2BQ3 A;  4DL3 A;  3GB8 B;  2W7O A;  1NJI W;  3IGA C;  1QR9 A;  4G2K A;  3G8D A;  5LP6 F;  2PF4 E;  1C3O A;  3N42 B;  4O7L A;  1Q90 D;  4A3E G;  2UVU A;  3L73 H;  4FM0 A;  1YIT V;  4MS2 A;  3FD9 A;  1MAB G;  2F43 G;  3MR6 A;  5JVL A;  4PWQ A;  4F4L A;  3JAT B;  1MZE A;  1AI4 A;  1EUC B;  3Q4H A;  1K33 A;  4ECW A;  3K06 A;  1Y1V A;  4QGP A;  2UU9 O;  1IXM A;  4RNO A;  4YHH B;  2J9G A;  3CRA A;  4RWU A;  4IHJ A;  4DV0 B;  2WA4 A;  1H2M A;  4ED8 A;  4GKJ O;  4JI7 H;  4PD4 F;  5IJ0 A;  3CCU V;  5C3E G;  4J9Y B;  3J7A U;  1EN4 A;  1H8E G;  3PR5 B;  1PM9 A;  4NXN H;  1XMO B;  3SPC A;  4IWX A;  3GIM A;  3P3P A;  4R50 A;  2QM7 A;  3T1Y H;  5B1A C;  4L87 A;  2JIZ G;  3Q8S B;  2W8K A;  1M0T A;  3RR5 A;  1IX9 A;  4JYY A;  5CB4 F;  1B6Q A;  3V4S A;  2LW7 A;  4JZ2 A;  1IYD A;  1PV0 A;  1TWG A;  2PY5 A;  5I5V A;  3NXS A;  4HAM A;  4A3L G;  1IVS A;  3G80 A;  1YHQ V;  3CME V;  2Y0S A;  4J9P A;  4B3T B;  2E75 B;  3ETJ A;  2BSK A;  4UCT A;  1WSC A;  5GTH Z;  5LP6 B;  5BWW A;  2V4Q A;  2MW2 B;  2FMA A;  2FTK A;  4LF6 H;  4J9N A;  4HQ6 A;  4H33 A;  5IJ9 A;  3ABM B;  2XHB A;  4QWD A;  4FS2 A;  4RUE A;  2F4V B;  2HVK C;  3HKD B;  4ASU G;  1DTO A;  3AG2 C;  5KMG A;  2CNV A;  5KFI A;  4NZN A;  3K58 A;  3BRC A;  1L1F A;  4HYO A;  2YIA A;  4TSF G;  2VUG A;  2F66 C;  1SES A;  3MFI A;  1ZL8 A;  4HZ3 A;  2CH7 A;  4HNA B;  3UZO A;  1M7J A;  1YTF D;  5H2F Z;  2RMK B;  3L4J A;  1VQ6 V;  3K08 A;  5JQG A;  4WCE V;  2FLL A;  3GIP A;  1KYO F;  2BE3 A;  1N34 B;  3IC9 A;  1DIK A;  1UJW B;  2XAF A;  2HIX A;  5B1O A;  5CA0 F;  1HNW H;  1BGY H;  1KD1 W;  2VQF O;  1WB8 A;  1YDX A;  2XAJ A;  5JUM A;  4LF8 H;  3DAA A;  4RUC A;  2EIL C;  5K1X A;  5AG2 A;  2UXC O;  3OMN B;  2BOC C;  2XUM A;  2ZM6 O;  5B66 Z;  2NU6 B;  2W6P A;  1EFR G;  5L1L A;  4E6N A;  2QKS A;  2DMX A;  2DYS B;  1VIB A;  2LQT A;  2P06 A;  5F2V O;  5CB4 B;  5KFK A;  4R6Z A;  1YJN V;  3M9N B;  2Q73 A;  1R9T A;  1T3N A;  1V55 C;  1XNQ B;  4O2A F;  4NKG B;  2KQX A;  3SYO A;  3CJH B;  1EKF A;  5KFU A;  4A2A A;  4KHP H;  1PNM A;  5C8Y F;  3T1H H;  5LMN O;  1OCC B;  2KKW A;  4DV1 H;  3OGI B;  2Q2T A;  4DR2 O;  1N4C A;  4LNU B;  4RNN A;  2QWN B;  1Q86 W;  1QLN A;  3AG4 B;  4UUJ C;  1IOV A;  5H6R A;  3TJT A;  4RAI A;  2IJH A;  1OBG A;  4TQS A;  3PJS K;  2RDI A;  3JAK A;  1VF7 A;  1HWY A;  2AQ4 A;  3F7V C;  1M56 C;  2WSS G;  1PPJ H;  1K83 A;  4U3J A;  3ZIA G;  3UQ8 A;  2IBK A;  2A3Q A;  4GKK O;  2OCC B;  1FKA H;  4RB0 A;  5LGU A;  2XAS A;  4UB6 Z;  2Q7E A;  5BMV A;  1HNZ H;  2UU9 B;  2HVQ A;  5IP7 G;  5D8D A;  1YIJ V;  2CE4 A;  2EIN B;  2NU7 B;  1W96 A;  2GPW A;  1XQ8 A;  2UUC O;  5L1J A;  4GKJ B;  1GH6 A;  5CA3 A;  3K5L A;  2NN4 A;  1KEC A;  3RGB A;  1EBO A;  4RUA A;  2EIY A;  4UB8 Z;  1UC9 A;  3HKC A;  5CA0 B;  2YID A;  4H0L B;  2QWR B;  3GV7 B;  3IC7 A;  4DL4 A;  3ZMZ A;  2H8P C;  1KU9 A;  4NXM O;  4DV7 O;  2QYZ A;  4O7V A;  5KUM A;  1X59 A;  3TIG A;  2V4D A;  4UCS A;  3CCM V;  2CGN A;  3E22 A;  2YS7 A;  4ETS A;  1SKV A;  3RN4 A;  3VBB A;  2NUA B;  3GIL A;  3FAV A;  4X20 A;  3L9D A;  2NLJ C;  4IRD A;  4YAJ B;  4UUG A;  1XDC A;  5KFH A;  3WFV A;  3JAS A;  1VQ4 V;  4O2A B;  1I7N A;  4X89 A;  4JGS A;  2FL4 A;  4DYL A;  4TT3 G;  2ASL A;  3APO A;  3JSN A;  3ZRV A;  3WO1 A;  5C8Y B;  3A0H Z;  2P6J A;  5FR9 A;  2LJ2 A;  5KFB A;  1NS1 A;  2UVV A;  3LWB A;  1HR0 H;  3RTX A;  3B09 A;  5HFM A;  5KT3 A;  4GCZ A;  4W4L A;  4H13 B;  5FPO A;  5ITZ B;  3ML0 A;  3GDE A;  4IIJ F;  4A3I G;  5B1N A;  3VPC A;  1RPO A;  1KEE A;  1K4C C;  1N36 H;  5EYP B;  4MV1 A;  1XOU A;  3MHS C;  4YXW G;  3HT5 A;  4CKB A;  5C5J A;  5C44 G;  5IYC O;  5EIB D;  3T9F A;  1M6V A;  3JAT A;  2WAM A;  1GLV A;  4J11 A;  4OPH A;  2B5U A;  1VF5 B;  4ZI7 F;  2IBZ H;  3TY5 A;  1SZT A;  1M90 W;  3T9C A;  4EGJ A;  2CTP A;  1DLB A;  4X88 A;  4CBC A;  1PKX A;  1GKF A;  4MVO A;  4X8A A;  1A3G A;  5IYB O;  3W1B A;  2ARH A;  3W7W A;  2PUS A;  1BXR A;  4UCU A;  3E8F A;  3J80 N;  1IZ3 A;  3MHH C;  2VQF B;  3GIQ A;  3SNO A;  1QU7 A;  2O03 A;  4I0X B;  5L9X A;  1VQ8 V;  4LFC H;  2R70 A;  2UXC B;  1PX2 A;  4ZOL F;  1VBG A;  2ZM6 B;  3T99 A;  1ZQ7 A;  4QPJ A;  5DG7 A;  1X4T A;  1EN5 A;  4FLX A;  2N04 A;  2Y48 A;  1I94 H;  3K3P A;  4JI2 O;  2OIE A;  5D1O B;  1WP8 A;  3AEI A;  4YHH H;  1Q6I A;  4DV0 H;  4F50 A;  1PD3 A;  5LMN B;  2Z0A A;  4UCR A;  4OX9 H;  2M7W A;  4DR2 B;  1A9X A;  4CHI A;  4BW9 A;  5LP6 A;  3OAA G;  3IN5 A;  1A32 A;  4EBC A;  3SDL A;  4QSH A;  5TIS Z;  4LF6 O;  2OTL V;  3SJB C;  1CXZ B;  2ZD9 A;  3HKD A;  1W2B U;  4JAS A;  4IIJ B;  3AK1 A;  4KL1 A;  1VF6 A;  5J9P C;  4O86 A;  4GKK B;  1I7L A;  1Y67 A;  1R3K C;  2YI8 A;  5D1P A;  4HNA A;  1I3Q A;  1V54 B;  5EWF A;  3ZHT A;  2HVR A;  5BPH A;  4ZI7 B;  2YL2 A;  4YR0 A;  2UUC B;  3LDC A;  2ZKO A;  4B3T H;  3R5X A;  2AU0 A;  4IGG A;  3JD2 A;  4DV5 H;  1WRV A;  1VQK V;  5LBQ A;  4EGQ A;  2YI9 A;  1W93 A;  2IA6 A;  2FB9 A;  3T4D A;  4RQE A;  3C3T A;  2F4V H;  4NXM B;  4DV7 B;  5BYA A;  5IDJ A;  3U10 A;  2EUL A;  1R73 A;  2EIJ B;  2O57 A;  4HBN A;  4ZOL B;  3JAM N;  4ED2 A;  1GN3 A;  2ETN A;  4A5U B;  3ZMT A;  3GVM A;  2WWW A;  3THO A;  2W6Z A;  2Q69 A;  5CB4 A;  2F1M A;  4J9L A;  4HNV A;  1XHX A;  4FFO A;  1K5Q A;  4GZR B;  2K9P A;  4JAV A;  3TY9 A;  2C00 A;  1BGW A;  2HDK A;  2ATK C;  3ZHU A;  3B4S A;  4AIL C;  1N34 H;  5DG9 A;  3X2Q B;  4DL2 A;  3T1H O;  1G8M A;  1FS0 G;  4BY1 G;  2R7L A;  3ZN0 A;  4DV1 O;  3WB2 A;  2COG A;  4LNU A;  1ORQ C;  2Q68 A;  1RK5 A;  1BE3 H;  2V7Q G;  4BIO A;  1EN6 A;  2H3O A;  5A2Q W;  4EQ5 A;  2FKL A;  3Q8P B;  3RAQ A;  3VA7 A;  2CNU A;  3W1G A;  1Y74 B;  4LFB B;  2LFS A;  2YUA A;  4O7S A;  3H0G A;  3FFQ A;  1ROP A;  1FKA O;  1IUR A;  2XCP A;  3E89 A;  2B9Z A;  4O7Z A;  4DV6 H;  5KFX A;  3CXH F;  1XNQ H;  3OGC C;  1HNZ O;  4EBE A;  4IAJ A;  3E86 A;  1S97 A;  3W7X A;  5EIB C;  1WCM G;  2VOB A;  4ED0 A;  3ZHS A;  4F6R B;  3LUT B;  4FVM A;  3UZB A;  1ARO P;  1BSM A;  1ET0 A;  5KG7 A;  3J81 N;  2R85 A;  2YZM A;  1NVP D;  2IP4 A;  2A1H A;  2HKO A;  4FZ0 A;  3L71 H;  5CMU A;  1XNR O;  5CA0 A;  2QM8 A;  3LSQ A;  5CE8 A;  2W57 A;  4TVI A;  3BQ1 A;  3BAC A;  5DLF A;  2XTA A;  2ZNJ A;  2LP7 A;  1JJ2 U;  1Y14 B;  4I9Q A;  1WLE A;  1I5Y A;  2QR4 A;  3VQV A;  4X1K B;  2DAA A;  2F23 A;  2PGG A;  2AZ0 A;  4J9M A;  1I2K A;  3TQ1 A;  1C30 A;  4K3A A;  2WB1 E;  4JI2 B;  1FJG O;  1Q8I A;  3ETG A;  3RFC A;  4DLK A;  5GTI Z;  4DO2 A;  4JI0 O;  4O2A A;  1R6T A;  2AGP A;  4P9P A;  4YQW A;  5C8Y A;  3CS5 A;  2PBZ A;  2HVJ C;  1ZHS A;  3HOU G;  4O4H F;  2NVY A;  3RW0 A;  2W6J G;  4WFA V;  4QWE A;  4LF6 B;  1HR0 O;  2X5R A;  3E8G A;  3QZ7 A;  3QO5 A;  2QSA A;  4D6T H;  5L3B A;  4DV3 O;  2HGW A;  2Q7D A;  5KFW A;  5ITZ A;  2R7Z G;  2QF7 A;  3RV4 A;  3APQ A;  4Z1V A;  5EYP A;  5C4X G;  2XD4 A;  1B04 A;  4WBN F;  2ZE7 A;  3D36 A;  3ABK C;  1DF4 A;  3DTF A;  3JAW B;  5KFP A;  3DC5 A;  4X66 O;  3U9T A;  4FZ1 A;  1MA1 A;  3L4K A;  4Q43 A;  2JA5 A;  3G6B A;  2JS5 A;  3GTM A;  2A79 B;  2X7R B;  4YR3 A;  5J2T F;  5CA1 F;  1SCU B;  2CNQ A;  4J9Q A;  4J41 A;  5EK0 A;  1MOF A;  1IBK O;  3TET A;  5EZY F;  3K57 A;  4KXR A;  4I0X A;  4L8J A;  4NYK A;  1SQP H;  5B3S B;  2V59 A;  4LFC O;  4I9W A;  4J80 A;  2VUM A;  5KFR A;  3KKY A;  3RYC B;  4NB5 A;  2ITD C;  2XAH A;  3QNE A;  2DZD A;  1QHT A;  4TM5 A;  3ABM C;  2OT5 A;  3OTO O;  2R7Z A;  1LR1 A;  2YZL A;  1I94 O;  1YJW V;  4GX2 A;  1AJN A;  2A7W A;  5D1O A;  3K59 A;  2EZO A;  3F5W C;  2WDT A;  2ASJ A;  1CKM A;  3T9E A;  4DV0 O;  3T1H B;  2OIG A;  2ODT X;  4DV1 B;  3U54 A;  4AYB E;  1K8A W;  4OX9 O;  4RO2 A;  4O4H B;  2Z02 A;  4IWY A;  2VQF H;  3M9O B;  4GC6 A;  2FKX A;  5KHG A;  4JI8 O;  3FDS A;  1E79 G;  4O4J F;  1BMF G;  2C2E A;  3AG1 B;  1WA8 B;  2B1I A;  1DAA A;  4MA5 A;  2UXC H;  2ZM6 H;  2X6B A;  5KFD A;  5DQG A;  4U7O A;  4IIJ A;  5D5P A;  1H2S B;  1UPG A;  2PI5 A;  3H4B A;  1CPY A;  3CE2 A;  1TWA A;  1SQQ H;  4WBN B;  2CZG A;  2JEF A;  1GSH A;  2YU9 A;  3HOW G;  2PZS A;  4C2M A;  3GWO A;  1HNZ B;  4ZI7 A;  1WPB A;  1J5E O;  3KYH C;  4MV3 A;  4DW0 A;  2Q7G A;  1VMG A;  4FM1 A;  4DRF A;  4DL5 A;  5LMN H;  3JAL B;  1KJQ A;  3CRQ A;  4B3T O;  2UXN A;  2CW7 A;  2BTO A;  4DR2 H;  5J2T B;  5CA1 B;  1VQO V;  1F23 A;  4PA4 A;  1AUX A;  4ECR A;  2ZR3 A;  4DV5 O;  3TW7 A;  1XNR B;  5BYB A;  3OEH G;  4JYB A;  5EZY B;  4PA7 A;  1KJ9 A;  4LCU C;  3RVY A;  2W8L A;  2HEP A;  1CKN B;  4ZBM A;  1M4U A;  4WHX A;  4ZOL A;  3KCX A;  3H9V A;  2YEV B;  2X6C A;  1EZJ A;  5LL6 b;  4A3G G;  4QW9 A;  3T5H A;  3B8M A;  4E4E A;  3CC7 V;  3HXL A;  2YRX A;  2D3O W;  3E83 A;  1FJG B;  1R3L C;  1CEZ A;  4LMY A;  3T54 A;  2JRI A;  4JI0 B;  2FP4 B;  1W0K G;  1Q81 W;  2NNU A;  2VA2 A;  3IFX A;  2FPG B;  4ME6 A;  2EIM B;  1KP2 A;  4FMT A;  1MNG A;  4DL6 A;  2CTQ A;  4JF3 A;  1H2L A;  3D8C A;  2M6Y A;  5KUK A;  1HR0 B;  1GO3 F;  2HGX A;  1MMM A;  4ABM A;  3QVN A;  4DV3 B;  5I47 A;  2COI A;  4NXM H;  4O4J B;  2OLS A;  2R8G A;  3MDS A;  3JZI A;  4DUY O;  4PA6 A;  5KT6 A;  4MTD A;  1Y74 A;  5T14 A;  5FJ8 G;  5LYJ F;  1VQM V;  1VQ9 V;  3RB6 A;  2JEJ A;  4JTD B;  4ZQI A;  4O3N A;  4LSA A;  3SJQ C;  2YZG A;  4A93 G;  4X66 B;  2DWC A;  4W4K A;  2V4R A;  3T9B A;  4DV6 O;  1M57 B;  3OFN G;  2EJ0 A;  2FPI B;  3T4Z A;  4F6R A;  3TW6 A;  2ZDQ A;  3PW4 A;  3B8N A;  4FJC C;  3RWR D;  4CS2 A;  1IBK B;  2UUB H;  3OM3 B;  1JX9 A;  1FXV A;  4FPP A;  4J0M A;  3K3W A;  5BZB A;  3ZS8 C;  3VOT A;  2FLN A;  3A8T A;  5CN0 A;  1F4M A;  5KT7 A;  2CUG A;  4FLY A;  2GBO A;  2ALZ A;  4LR3 A;  4JTC B;  4LFC B;  1JX4 A;  1EZV H;  3CC4 V;  2ZDH A;  5DED A;  2PTM A;  3ABL B;  1QLE B;  5I5T A;  3OEE G;  4X1K A;  2Y4R A;  4FBT A;  4LFB H;  3OTO B;  5L3E A;  4QE9 A;  4F4W A;  3ASO C;  4BW5 A;  5I5S A;  4JV5 O;  3SPI A;  1I94 B;  3J7A K;  5KHI A;  1KTA A;  2ODM A;  4NZM A;  3GTK A;  2KSD A;  2DWD C;  3A0B Z;  1HP8 A;  2AGA A;  2P90 A;  1NR1 A;  1AJP A;  2W9A A;  5FLX W;  1AVM A;  2Q5Z A;  3H1K H;  3SGI A;  3JD1 A;  2RNB A;  5HBR B;  2I80 A;  2YXH A;  1XUQ A;  4YBZ B;  3W7U A;  2UXX A;  4OX9 B;  2JGU A;  5FNV F;  4O3R A;  5KFJ A;  1L0N H;  4AYB A;  4PEL A;  1H2G A;  4JI8 B;  3GTQ A;  3D3I A;  1NH2 B;  1I7F A;  4FM9 A;  3K9S A;  1WP7 A;  5LA6 F;  2IJI A;  3FYI B;  2YCH A;  1NTM H;  4IZO A;  4O4I F;  4NLG A;  3N40 P;  3CCQ V;  5LYJ B;  2GV9 A;  2FYU H;  5C1P A;  3CB2 A;  5FLX N;  1KQS U;  3JAW A;  2UXB O;  4JI2 H;  1XIL A;  2X0S A;  1J5E B;  2ILM A;  4AHC A;  3T7A A;  4O3O A;  4MTE A;  3QWU A;  4QNH B;  1K5S A;  2ZXW B;  5HV6 A;  2CW8 A;  1KBL A;  1NQT A;  2R82 A;  4FFK A;  4DV5 B;  2Q0A A;  1CP9 A;  3H1J H;  3OT7 A;  5LL6 Y;  3U55 A;  4I4T F;  1KKD A;  3FB8 C;  5KFV A;  4N21 A;  3OW2 U;  4FLV A;  1D5N A;  1UNN C;  1MZB A;  3RYC A;  3G67 A;  5KFA A;  1RJQ A;  5KG3 A;  2EJ7 A;  3K5H A;  2BQU A;  1W0J G;  2FPP B;  4U3F H;  3SE7 A;  1A0I A;  3KHL A;  4PI2 A;  4D7T A;  3OD4 A;  4E4T A;  4PHZ A;  2DOS A;  2F95 B;  2IU0 A;  4DR5 O;  3ORQ A;  1EM1 A;  1TVK B;  3FMA A;  4TOI A;  4K6N A;  2ZE8 A;  1S5J A;  3ZED A;  4QJF B;  4A3K G;  2JA7 G;  1XHZ A;  3AG3 B;  2H94 A;  3LSU A;  2QGN A;  1V54 C;  2R8H A;  4M7E A;  4ICG A;  4O7Y A;  2DLN A;  1Z5W A;  4J9S A;  2QA4 V;  2ZIN A;  1PNL A;  3KTM A;  1BNC A;  4O4H A;  1F4N A;  4EKW A;  5FNV B;  2VQD A;  1Q6H A;  2E5L O;  3RAX A;  2EJ3 A;  1A0G A;  1GO3 E;  4RU9 A;  4O84 A;  2M05 A;  3AG7 A;  3QQM A;  1WA8 A;  2ABJ A;  3U11 A;  5LA6 B;  4DUY B;  2QTS A;  2P67 A;  1S68 A;  5BWV A;  4Q45 A;  1S0M A;  5IP9 G;  4O4I B;  1ZAU A;  1JFF B;  2X0L A;  3CCS V;  4EYH B;  4WBN A;  1P84 F;  4DR3 O;  1S5H C;  4DV6 B;  5FPR A;  1M5I A;  4CS3 A;  3H4D A;  1JMK C;  5JH7 F;  2NU9 B;  4RAZ A;  4FBU A;  2R9I A;  3BY6 A;  3JAL A;  2FK2 A;  3VQW A;  5BR8 O;  5J2T A;  3T5J A;  5CA1 A;  2YXL A;  1G1X B;  4GLW A;  1E4F T;  2JA7 A;  1LUW A;  3ZJZ A;  2GUZ B;  2R7K A;  1IYE A;  5EZY A;  5I5W A;  3HBL A;  3C90 A;  3RIZ A;  1TWH A;  1JIH A;  3X2Q C;  1Y76 B;  2X6A A;  4LWS B;  3G6E V;  4FLT A;  3KHH A;  4I4T B;  1CKN A;  4QIW E;  4GLX A;  3K9A A;  1V9P A;  2YEV A;  4LH7 A;  4ZIB A;  1WH2 A;  4FLZ A;  3K79 A;  2VQE O;  4JV5 B;  3SR2 C;  4RB3 C;  1OHH G;  3JD0 A;  1GSO A;  3N41 B;  1COW G;  3ZX6 A;  4YJ3 F;  4EFE A;  1FFT B;  3JCU Z;  4UCV A;  4MA0 A;  3K5O A;  5EBL C;  4FK5 C;  4I55 F;  1XNR H;  2RGR A;  4OGQ B;  3MWE A;  3S3W A;  2R93 G;  3SI8 A;  4Q4C A;  5DAA A;  4MVR A;  2ZIM A;  3NUA A;  5IY5 C;  4O4J A;  3A2F A;  4BXX G;  3NC0 B;  2PYJ A;  3CWB H;  4NVP A;  4BWS C;  3G8C A;  1KT8 A;  2BOB C;  1OJH A;  4PDB A;  3HKZ E;  4O4L F;  4EFB A;  2KSW A;  2UXB B;  2P5O A;  1FJG H;  4O7W A;  2D2C B;  3RYF B;  3S24 A;  5J2U F;  3OMI B;  1IBL H;  4JI0 H;  2JA8 G;  2ZE5 A;  3SPG A;  2HHH H;  2Z5U A;  3C3S A;  5KG0 A;  4JUZ A;  5JH7 B;  3ABT A;  2DYR C;  3LP8 A;  5B1B B;  1BL8 A;  3BQ2 A;  2UUB O;  2W70 A;  4DV3 H;  4FLU A;  1QQC A;  2R87 A;  4UV9 A;  5KFN A;  2Q4P A;  4FLW A;  4O7N A;  1G6U A;  2AZ2 A;  3N2G B;  4WD3 A;  2AXT Z;  1QVF U;  1NI8 A;  3ZCC A;  4ECX A;  5EC2 C;  2R8K A;  2R93 A;  4LFB O;  2XGP A;  2JDI G;  4DR5 B;  2JVD A;  1WJZ A;  3STZ C;  4DR1 H;  2C2A A;  1BS3 A;  4X66 H;  5KFS A;  1QCE A;  5A9G A;  1FXK B;  3I55 V;  3WWH A;  2Y4T A;  4YJ3 B;  4G28 B;  3A0R A;  3G71 V;  3F7Y C;  2W71 A;  5KFO A;  3GTL A;  1IBK H;  5EWE A;  1S0N A;  1JXL A;  3HO8 A;  4P30 A;  2E5L B;  2P4V A;  1FYJ A;  4ZHQ F;  4I55 B;  3MR3 A;  3JD3 A;  4YP3 A;  5KFM A;  1S0O A;  5CBH A;  4MTF A;  1B6S A;  4MVQ A;  3T2M A;  2SCU B;  3GQC A;  3CCE V;  2RCV A;  2R86 A;  3PW2 A;  3OSP A;  2WLI B;  1ZET A;  4ECY A;  2QKA A;  2FE3 A;  3OTO H;  4A3F G;  3QFF A;  3L2P A;  2ZNI A;  1ZHQ A;  5LMU H;  5LYJ A;  1KC7 A;  2AHY A;  4O4L B;  4DR7 O;  4ECU A;  3RBE A;  4XDJ A;  4DR3 B;  2JJ1 G;  2QWQ B;  3T1C A;  3H1L H;  1VS0 A;  2AGQ A;  5B1A B;  5J2U B;  2R84 A;  1P49 A;  1MG1 A;  4XDL A;  4MV6 A;  2WA3 A;  5BR8 B;  4RB1 A;  4JI6 O;  2YDE A;  3ABU A;  3TEK A;  4O3S A;  3OR6 C;  3B2E E;  4EEY A;  4DR6 H;  4LF4 O;  5KKN B;  4JI8 H;  4PA3 A;  4FM2 A;  1NH2 D;  4WFF A;  1QVG U;  1JCH A;  4WFB V;  4FFL A;  3M4I A;  2GLT A;  1FD9 A;  3CXC U;  2QKC A;  2UXD H;  5IWA H;  4J7J A;  5L3G A;  2ADP A;  4CC5 A;  2CFM A;  1JQ0 A;  5KFF A;  2A9H A;  2VQE B;  2YWV A;  4A3M G;  2PN1 A;  5DGB A;  3MAQ A;  2MCT A;  3V6J A;  3AG1 C;  1RPR A;  2IH3 C;  3I56 V;  1TAE A;  3OUS A;  1UFI A;  4TQD A;  4MV4 A;  1TVK A;  4DQN A;  1J5E H;  4MT8 A;  1NTZ H;  1P7G A;  5JCO A;  1HNX O;  3IG0 A;  4JV0 A;  3PVX A;  2B63 G;  4QJF A;  5KFQ A;  2RDJ A;  1KMI Z;  5IYZ F;  3OHA A;  1Z5V A;  3UM7 A;  2HJD A;  3D3Q A;  3UYY A;  3CCR V;  3QZ8 A;  4X62 O;  3H20 A;  2K1E A;  4LP8 A;  5FNV A;  2COJ A;  4HN2 A;  5K3W A;  2VA3 A;  1KKC A;  4ZHQ B;  1MSD A;  3L70 H;  1B33 N;  4O3Q A;  4QE7 A;  2LO1 A;  3K0D A;  4JI4 O;  4ED3 A;  1OCO C;  5LA6 A;  4MV9 A;  2W7P A;  1RYR A;  2XGQ A;  2GQS A;  4Z2W A;  4O4I A;  5KT4 A;  3UKM A;  4BR6 A;  1JFF A;  2YZN A;  2ZT9 B;  3OUZ A;  4GT1 A;  4MVS A;  2LW1 A;  2HLD G;  4MW8 A;  3PN1 A;  4PA9 A;  2DWE C;  1OCR C;  3FYE B;  5CM0 A;  2LGW A;  2QM4 A;  3WB0 A;  3CJH A;  5BWT A;  4Q44 A;  3WU2 Z;  3ZRX A;  3ASN B;  1MSW D;  2QWO B;  4MW3 A;  4R7R A;  3N44 B;  2UUB B;  2B63 A;  1V55 B;  3CSW A;  3LNN A;  2GUZ A;  1K1Q A;  2EIK C;  4TQR A;  3VNN A;  2V9W A;  2EIM C;  3RB4 A;  1Y76 A;  2GTA A;  3R65 A;  4DUY H;  4LWS A;  2NVX A;  3GIK A;  4I4T A;  1NKD A;  4TQF A;  4MAM A;  4ZKI A;  1I2L A;  4EBD A;  2E2I A;  2ZGI A;  3S3X A;  5DGI A;  2BQR A;  2IU3 A;  1K4D C;  1JLL B;  3STL C;  2YIB A;  3FKI G;  4Z1M G;  4RZR A;  2R8J A;  4J10 A;  4MTX A;  5IYZ B;  4M9U A;  3OHB A;  2YSU B;  5A2Q N;  1PL4 A;  4C5C A;  4ED7 A;  2YW2 A;  1D2D A;  3ZHV A;  4MV7 A;  1RM1 B;  5GW7 A;  4X64 O;  2XOK G;  4P9O A;  3B40 A;  1RP3 B;  5BWR A;  2GPS A;  3OUU A;  4BWA A;  1BQZ A;  2HJW A;  2QDO A;  4M0J A;  1M1K W;  1JPX A;  3ETH A;  3VMM A;  4PDL A;  4DR7 B;  4JV5 H;  1RJR A;  3RYF A;  3FB5 C;  1CQJ B;  3K5N A;  5FD6 A;  5JWP A;  3HOX G;  3CMA V;  2YIB D;  5H80 A;  1IBL O;  2C35 B;  4JYA O;  4YB8 B;  2XAG A;  4NYE A;  4JI6 B;  2HHH O;  1ZSP A;  5JH7 A;  3ZRS A;  3RB0 A;  4LF4 B;  5KFY A;  3JRW A;  3OSN A;  2DW4 A;  5FD5 A;  4YY3 H;  3HOV G;  1WCM A;  1MZF A;  4RNM A;  1FPO A;  1AB3 A;  1JA8 A;  1THZ A;  2XC9 A;  2JA6 G;  3N27 A;  4BBR G;  1IBM O;  1KB9 F;  3CC2 V;  3N2G A;  3CCJ V;  3AK3 A;  2R92 G;  4CMD A;  2VWK A;  3BAA A;  2UXB H;  4U7C A;  1AR5 A;  1HNX B;  5KHK A;  4DR1 O;  4KP4 A;  3L75 H;  3JSL A;  2WAQ E;  3WG7 B;  1JKJ B;  4ED6 A;  1FXK A;  3CVZ A;  1SQB H;  4YJ3 A;  1AI6 A;  3R5F A;  5JQW A;  2QB5 A;  3T5L A;  3L72 H;  4X1I B;  2E74 B;  1CKO A;  4IR9 A;  5L1I A;  4XYM B;  4X62 B;  1S9F A;  4IRK A;  1Q5O A;  1Q82 W;  4I55 A;  1JVM A;  4UVC A;  3TQT A;  4CH4 A;  1G2W A;  3RYH B;  4JI4 B;  5F9N A;  2Q9L A;  5KX5 F;  5KFE A;  2E3C A;  3BHP A;  1YTF B;  4JYC A;  3CX5 F;  1VQP V;  1LUV A;  5LP6 C;  3PO2 G;  1JJO A;  3GIJ A;  3H01 A;  1BCC H;  1R3I C;  1T36 A;  5F9L A;  1S76 D;  2WLI A;  1S03 G;  4Q0Y A;  1R3J C;  5LMU O;  4O4L A;  4DR5 H;  1Y1W G;  2JA6 A;  5H5N A;  4B08 A;  4EB6 B;  3KRE A;  4PDV A;  3K0G A;  1EYZ A;  1VF6 C;  1XL6 A;  5J2U A;  2ZJT A;  1Q6U A;  2Y0P A;  3RV3 A;  2ATL A;  1NZ6 A;  4DV2 H;  4K8Z A;  1YVW A;  3H1H H;  1AP6 A;  1NBM G;  1ULZ A;  4L1K A;  4PI0 A;  3UT5 B;  4FFN A;  3RFR A;  2E5L H;  3OE7 G;  1BT8 A;  2HG5 C;  4DR6 O;  4PZ6 A;  5KAF Z;  3DF7 A;  4ECQ A;  5HNE A;  1CS0 A;  4KUM A;  1KJJ A;  3LSS A;  2B1G A;  4IRC A;  4JZG A;  3LUL A;  1KC8 W;  5IWA O;  2UXD O;  1O75 A;  2EZP A;  1SA0 B;  4FE2 A;  1XK5 A;  4DR3 H;  2R8I A;  2Q6A A;  3I4N G;  5EOY A;  4H44 B;  2ZR2 A;  3ZHR A;  5LHI A;  4OPA A;  2WLM A;  1K7D A;  2DYS C;  1OZ0 A;  3B77 A;  5BR8 H;  4JAA A;  1Y1W A;  3CSX A;  3Q8R B;  3U0G A;  4GYC B;  1H38 A;  4XDK A;  1YCI A;  2IMW P;  4CS4 A;  4JI3 O;  4X64 B;  4ZHQ A;  3QG5 A;  4BIU A;  3JD4 A;  1OCC C;  1DV2 A;  2PVP A;  2QE7 G;  4J42 A;  4CMF A;  1K1S A;  2XT9 A;  1FAF A;  5KX5 B;  2CKZ B;  3E5N A;  3MFH A;  1FFX B;  3AG4 C;  3QF7 A;  4O3P A;  1XMQ O;  1GRJ A;  2VQE H;  3ICX A;  2LGQ A;  3FKS G;  3DXR B;  4JTA B;  3I4M G;  4RUF A;  1QR8 A;  2EX3 A;  3RF2 A;  1RK6 A;  4UFZ A;  4QWB A;  2NR5 A;  1R6K A;  2WB1 A;  3PW5 A;  3NR7 A;  1IBL B;  2QK4 A;  1Q7Y W;  4JYA B;  2ITC C;  3F5T A;  2OCC C;  2HHH B;  2VR1 A;  2WTF A;  4F4Y A;  3OUF A;  3O65 A;  1KJ8 A;  2JS3 A;  4IL6 Z;  3GV5 B;  4FFM A;  1YEW A;  1TA8 A;  3N2K B;  2EIN C;  4IYH A;  1WB7 A;  1D5A A;  1QNM A;  2CDY A;  1VQN V;  5KG1 A;  4ECZ A;  1M0W A;  3M7M X;  1I5X A;  3BCC H;  1VQL V;  2HP8 A;  5LGT A;  1IBM B;  5DMX A;  4YIO A;  1ENV A;  5KFL A;  3SYQ A;  1Z2G A;  3MD0 A;  3WB1 A;  3SJC C;  2JJ2 G;  4JI1 O;  3AW8 A;  5IE9 A;  3KHR A;  2F93 B;  2V5A A;  4NTY A;  1FXH A;  3I12 A;  3M99 B;  4JV2 A;  1OCZ B;  3KAL A;  1P7B A;  4DR1 B;  4JI5 H;  3MWM A;  1SF9 A;  1SRY A;  4X9Q A;  1H2K A;  2R6F A;  4B3R O;  5IYZ A;  2DJV A;  1Y1V G;  4G3I A;  2VS0 A;  2CTW A;  2NU8 B;  4LF5 H;  2IH1 C;  1R1B A;  2Q2U A;  1JOY A;  5BWU A;  1E1R G;  1I0H A;  4LF7 O;  4QIW F;  1I1L A;  4UVB A;  3V6H A;  1N32 H;  2RQ6 A;  4JAU A;  2V1D A;  4R8U B;  4J9K A;  5LMU B;  4HNT A;  1V51 A;  3G6V A;  1BZK A;  2IM9 A;  4HNU A;  1T94 A;  4YAK B;  3E8H A;  4NTW A;  1Y66 A;  1YXB A;  3IJ4 A;  2WLH A;  2OYQ A;  2W6Q A;  5LOV F;  3D36 C;  1E1Q G;  5KA6 A;  2UVR A;  3EHB B;  4FIP C;  1EZ1 A;  2WLL B;  4O83 A;  1AN7 A;  3OTF A;  5EBW C;  3KXY T;  4DR6 B;  4YJ2 F;  1FXK C;  4X65 O;  1IOW A;  5CR5 A;  4DIM A;  3DTU B;  5LGN A;  4YY3 O;  4LF9 O;  2P0A A;  4PZ8 A;  3I5D A;  1YI2 V;  2I87 A;  3TCU A;  4DR4 O;  5IWA B;  2UXD B;  3JZF A;  3W7S A;  2W9B B;  4LC1 A;  1AIL A;  3RUP A;  4DR7 H;  3AYH B;  4CC6 A;  1K34 A;  5K2M A;  2W6I G;  2W6N A;  3SPH A;  2CQY A;  4NTX A;  1Z2O X;  3K03 A;  1JDE A;  1EKP A;  1GMG A;  4JI6 H;  5B5E Z;  2P22 C;  3K5I A;  3ABK B;  4X1I A;  1B06 A;  4X1Y B;  4LF4 H;  3EXA A;  3RGX A;  2BR0 A;  4K0K O;  3PZP A;  3TXQ A;  3Q2O A;  1VP7 A;  4JI3 B;  1YJ9 V;  3MR2 A;  3RYH A;  4LFA H;  4AI8 A;  4BAY A;  2WLN A;  3BPZ A;  4I5S A;  1XMQ B;  4C5A A;  3GV8 B;  4NZO A;  1WPX A;  2RGV A;  2VRZ A;  2YC0 A;  1EUD B;  4TV9 F;  4B3S H;  1SFO A;  2BTQ B;  1L2Z A;  1L8D A;  1VAJ A;  4EB6 A;  4J7Z A;  2ZDI A;  1Q3E A;  2GDS A;  5LXT F;  1HNX H;  2R9A A;  4DV4 H;  1U97 A;  2AHZ A;  5KS8 A;  3CYO A;  1DV1 A;  4TV8 F;  5LOV B;  1SQF A;  2RF4 A;  4XYL B;  1SQV H;  3VPB A;  4DV2 O;  1GN2 A;  3CEI A;  4RB2 C;  1X9N A;  4DUZ O;  4X62 H;  3RBD A;  4ECV A;  3UT5 A;  2Q67 A;  1AI7 A;  4YJ2 B;  4PV1 B;  2DPI A;  1LNQ A;  5BXZ A;  1GSA A;  4JI4 H;  1AR1 B;  1Y6X A;  3CCV V;  2N05 A;  1I1M A;  3GTG A;  2QJ1 A;  4JI1 B;  2HFE C;  3CRR A;  4O7R A;  1NU1 H;  1PL0 A;  5DEC A;  2Q8V A;  5KAI Z;  1SA0 A;  3ZRW B;  2N74 A;  2VWJ A;  4H37 A;  4UXN A;  3CQZ A;  5D5Q A;  1VEW A;  2EIJ C;  3RBZ A;  3DSQ A;  4R7C A;  3CRM A;  2Y69 B;  1EHI A;  5BY1 A;  1H8H G;  3UFX B;  4B3R B;  1IDS A;  2LFR A;  3LQS A;  2HVS A;  4A3B G;  1NTK H;  5KG2 A;  4Y8V B;  2DE0 X;  1BHB A;  3V4Z A;  2VPS A;  4O2B F;  5H9C A;  1JR9 A;  4A3J G;  5KFC A;  3SYC A;  3ZHQ A;  2OCH A;  3IAY A;  1ZX3 A;  1R6N A;  3ASN C;  1N56 A;  1RYS A;  4LF7 B;  5KX5 A;  5LHH A;  1FFX A;  2R72 A;  2C2R A;  2HHF B;  2AGO A;  5KA5 A;  3KHG A;  3DXR A;  3G6X A;  4TV9 B;  2MK3 A;  1E4E B;  4BY7 G;  2G38 A;  4CKE A;  4E2L A;  2HIV A;  4C5B A;  3NBZ B;  1WN7 A;  3C0F B;  3E35 A;  5LXT B;  1NVP B;  1HDJ A;  5KG4 A;  2W6M A;  2JEI A;  4TV8 B;  2R7M A;  1Y4M A;  4WF9 V;  4F4X A;  2PYL A;  4F4Z A;  4B3M O;  2RN9 A;  4X65 B;  5DG8 A;  3N2K A;  1SQG A;  2E76 B;  4X64 H;  4YY3 B;  3FB6 C;  4DW1 A;  3UO3 A;  3BA9 A;  4LF9 B;  2WE6 A;  2OH2 A;  1I6U A;  4U7N A;  4DR4 B;  2J6S A;  3TXS A;  4DXW A;  2KB1 A;  1J95 A;  5HFL A;  3UCS C;  1RM1 C;  1SQX H;  2YRW A;  1SS3 A;  4K35 A;  4GUN A;  4JPR A;  2RJZ A;  3GWK C;  4B7E A;  5CBF A;  5EWG A;  1WAZ A;  4JI5 O;  4YR2 A;  4JYA H;  2CTR A;  4EG0 A;  4AQY O;  2UVW A;  4KFM A;  3VPD A;  2C22 A;  1PP9 H;  4K0K B;  1I50 A;  1DF5 A;  2C28 A;  2FK3 A;  4PJ0 Z;  1UC8 A;  2Y0I A;  4J7K A;  4O2B B;  4HR7 A;  2GTS A;  4LF5 O;  1N33 O;  1E4G T;  4EEQ A;  3E2E A;  3KAJ A;  3HOY G;  2JGD B;  3TY8 A;  3BG5 A;  1CE8 A;  2CGO A;  2QEX V;  1OWT A;  1IBM H;  3R9R A;  3MR5 A;  2R9R B;  3R23 A;  2DQ3 A;  3ETD A;  3ORR A;  2ZDG A;  1N32 O;  2UUA H;  3E8B A;  1BJT A;  1GM9 A;  4YIP A;  4R8U A;  5I5X A;  4GX1 A;  3VQY A;  5IYD O;  3ZBH A;  2PMZ E;  3GTP A;  2V58 A;  3JCZ A;  5JJE B;  5CAE B;  1M9N A;  4DV2 B;  2KG7 B;  2JEX A;  4LSX A;  3V6K A;  1G4Y B;  4ED1 A;  3ASO B;  2QTO A;  4DUZ B;  4I7H A;  3J80 W;  3KZI Z;  2WLL A;  1GN4 A;  1L0L H;  3WG7 C;  4G27 B;  2FB5 A;  4MV8 A;  5GON F;  4RZQ A;  4LH6 A;  2W0X A;  2DIK A;  5KT2 A;  4J9R A;  3CCL V;  1YSC A;  3RT3 C;  3TK1 A;  2HGS A;  2W9B A;  1TUB B;  2YS6 A;  1AUV A;  2ASD A;  5B3S C;  1GAX A;  4RAY A;  2L35 A;  1S3J A;  3ZMU A;  4JI7 O;  5KFT A;  1XBL A;  3P30 A;  1BQ0 A;  3SYA A;  5I5U A;  5JVD F;  2ZIO A;  5EBM C;  3O9O A;  4A3D G;  2WYO A;  2IJJ A;  4NXN O;  2ZDI C;  4DAA A;  5L1K A;  3GII A;  4X1Y A;  3GTJ A;  1N48 A;  2R7N A;  3HKE B;  3T1Y O;  3ZMS A;  1KBH A;  5KG6 A;  3QO8 A;  2P7T C;  5E79 Z;  4O81 A;  4HYK A;  4WFE A;  1K97 A;  5L3F A;  3U0Z A;  5DGA A;  1AP5 A;  4I50 F;  4TUY F;  4LFA O;  1EKV A;  3EYY A;  4QIW A;  3R66 A;  3P32 A;  2XND G;  2A0L A;  2BTQ A;  4B3S O;  3BVO A;  4D7S A;  3M9M B;  1NR7 A;  5DIS C;  3AG2 B;  2PI4 A;  1P8L A;  4DV4 O;  3RYI B;  1XMO H;  1RFY A;  3OR7 C;  5LOV A;  4PZ7 A;  4PBC A;  3AK2 A;  3BEH A;  5DGH A;  3JYC A;  4MSW C;  4B3M B;  3GID A;  3T5K A;  2WLK A;  3N8D A;  2RDC A;  2EJ2 A;  4JI3 H;  4YJ2 A;  4FFR A;  5KT5 A;  2Q7H A;  4QWC A;  4LBE C;  3RVZ A;  2EBO A;  3PFF A;  4RQF A;  5GON B;  3JAM W;  3BJY A;  5EC1 C;  1GTO A;  3BQ0 A;  1XMQ H;  3DGE A;  3SPJ A;  3VQX A;  3JZ6 A;  4ECS A;  3ETE A;  4Q6G A;  1S77 D;  3HKZ A;  2QWP B;  3ZRW A;  3Q1K A;  4IT5 A;  3W7T A;  3GLK A;  4CH3 A;  2EIL B;  5C93 A;  1A48 A;  4U6P A;  4Q4D A;  4DK1 A;  1VBH A;  4JI5 B;  1O9G A;  1SEI A;  5JVD B;  1HNW O;  4AQY B;  3BA8 A;  4F6E A;  1XDN A;  1RSO B;  4TWK A;  1NT2 B;  4LF8 O;  3H0G G;  4J9Z B;  3K3V A;  1S5L Z;  2J6U A;  4P2Z A;  4BIZ A;  3NGD A;  3NBY B;  2HG8 A;  1F7Y A;  1Q43 A;  1AR4 A;  1VAR A;  3HPL C;  4LF5 B;  1N33 B;  2IJK A;  1W59 A;  3LML A;  4FU0 A;  5KFZ A;  3ETQ A;  2GSM B;  4I50 B;  4TUY B;  4JI1 H;  1N32 B;  2XIG A;  4IHJ F;  2HHF A;  4FS1 A;  1SYX B;  2W6O A;  3N43 B;  5I5Y A;  3MJF A;  4MVZ A;  4TV9 A;  4KHP O;  1E4E A;  1I1K A;  2FK1 A;  1KUQ A;  2CAZ C;  3HKB B;  4MVU A;  3JRX A;  3GB7 C;  1M56 B;  4WFH A;  2FLP A;  5LXT A;  2PMZ A;  3CP1 A;  4B3R H;  3WO0 A;  4Q8E A;  1SER A;  3J81 W;  4TV8 A;  1GGO A;  1OCZ C;  2W9C B;  5I60 A;  3KCY A;  4FFB B;  1P4R A;  2HJF C;  1P16 A;  4MTO A;  3G6Y A;  4WFG A;  1M57 C;  2FML A;  1N8R W;  3CEB A;  2Z04 A;  1KP3 A;  1M93 A;  4DRX B;  2GHY A;  1XEQ A;  3DTG A;  1PNK A;  1N0J A;  3K5M A;  4CKC A;  3JAR B;  5FLM G;  4LF7 H;  3U9S A;  1K3E A;  3EVK A;  2W0F C;  3ZN1 A;  3F8N A;  1B3Q A;  4QPK A;  1ZUQ A;  2A06 H;  1TWC A;  3WNZ A;  2YYA A;  4O82 A;  4JI7 B;  3MWD A;  5IY5 B;  3ABL C;  4NR1 A;  5KG5 A;  1QLE C;  1GM8 A;  3PW7 A;  4JXU A;  5L3D A;  4NXN B;  1HW7 A;  1Z2N X;  3H40 A;  1S10 A;  1ZLZ A;  1WR2 A;  4MVM A;  4EYI B;  1URF A;  3T1Y B;  1RJP A;  4ECT A;  3VOU A;  3BAB A;  4X65 H;  2JEG A;  4DL7 A;  2DN9 A;  5LHG A;  2J6T A;  3FKI A;  4LF9 H;  4O2B A;  4GX0 A;  2JA5 G;  5CBG A;  3KG2 A;  1PK8 A;  3T9D A;  2JGD A;  5C1O A;  1OBD A;  3Q4H B;  4DR4 H;  4OXS A;  4LFA B;  3QTC A;  1XRE A;  1TGO A;  2DYR B;  5JQG F;  4A2B A;  3HB3 B;  3CPW U;  2UU9 H;  3PW0 A;  2XCL A;  3N6R A;  5IT9 W;  1K73 W;  4GX5 A;  1TUE B;  4IHJ B;  2UUA O;  1N0N A;  4B3S B;  1OV9 A;  2CK3 G;  1DK1 A;  2OTJ V;  4GKJ H;  3EPI A;  2XAQ A;  2Z3Y A;  3H1I H;  4APM A;  5IJ0 B;  4Q8F A;  3RGZ A;  2VUM G;  2DQ0 A;  1F51 A;  4DV4 B;  3W5O A;  2Q0O C;  1KJI A;  3WWI A;  3CRC A;  1IXB A;  4Q20 A;  3GTO A;  1CQI B;  3G4S V;  2IW5 A;  3FX7 A;  5DLG A;  2KG7 A;  2Y4U A;  2ZE6 A;  5DN6 G;  3GJX B;  4UV8 A;  4K0K H;  3M8A A;  3CD6 V;  1ZWI C;  1N36 O;  2YS8 A;  5KLV H;  2ZXW C;  1GK9 A;  3K04 A;  5E1A C;  5IT9 N;  3DC6 A;  5E25 A;  1QBZ A;  3CHX A;  3HB9 A;  3LDD A;  1VQ7 V;  5JJJ B;  1TUB A;  4O7T A;  2L6L A;  4RCN A;  3QO7 A;  5K1P A;  5DQH A;  4UCO A;  2BSK B;  3T9A A;  5DM6 V;  1VKZ A;  2R92 A;  2EJR A;  1HNW B;  1SET A;  5IJ9 B;  4LF8 B;  1GN6 A;  4DUZ H;  5KMG B;  4FGR A;  5JCO C;  1US6 A;  5KFG A;  5DQI A;  4CZZ A;  4MTG A;  3HKE A;  2YXY A;  3AG3 C;  1VQ5 V;  1AI5 A;  1ZL8 B;  4FFP A;  5H6Q A;  2ADQ B;  2CH7 B;  3Q8Q B;  5BMV F;  2P4K A;  2YIC A;  2GQR A;  1YF2 A;  5JQG B;  3LNM B;  3EFF K;  3TGU H;  2C2D A;  1SZX A;  4IR1 A;  4IYI A;  5FL7 G;  4YHH O;  4KHP B;  1GYF A;  3H3V H;  4PDM A;  2ZQM A;  4R8C A;  5EDW A;  1KUT A;  5L3C A;  1S0V A;  3RYI A;  1YZB A;  2E2H A;  1FVI A;  3L74 H;  1XMO O;  4XX0 B;  1XI1 A;  5JJN B;  4PDR A;  4B7K A;  3HOZ G;  1U96 A;  2Y69 C;  3SYP A;  4JV1 A;  4CE5 A;  5KHJ A;  5BPF A;  2DPJ A;  1ZTE A;  5GON A;  1AJQ A;  1XL4 A;  3TII A;  5IYD G;  1B6R A;  4I7Z B;  4CH6 A;  2ZCE A;  2Y0S E;  2JK5 C;  3BFR A;  3FB7 C;  4UVA A;  3ZMV A;  2DAB A;  3WWJ A;  4QWA A;  2HR3 A;  1JDB B;  2AW9 A;  3AX6 A;  4N23 A;  4BBS G;  2BCC H;  1T5E A;  1OCO B;  4K8X A;  2FJZ A;  1H2N A;  1K92 A;  3P3N A;  1DGS A;  5BWX A;  5JVD A;  1O9H A;  5IYC G;  3JAK B;  3SJA C;  1RSO A;  3UO2 A;  3PR4 A;  4DK0 A;  2F4V O;  4B3M H;  4A3C G;  1OCR B;  4U3J B;  5KHH A;  3RB3 A;  4GKK H;  4C7U A;  4XZ3 B;  1Z2P X;  1TWF A;  3TIN A;  5IYB G;  4I50 A;  4TUY A;  5BMV B;  2I8C A;  2UUA B;  2UUC H;  2EIK B;  3R5H A;  4XBF A;  1K9M W;  2JEU A;  2WLJ A;  1S72 V;  1I08 A;  1GM7 A;  1N34 O;  3HKB A;  3OMA B;  3PO3 G;  4QW8 A;  2XCA A;  2VPQ A;  3HKC B;  2WAQ A;  4AQY H;  1WNS A;  3RJ0 A;  4DV7 H;  2W9C A;  4FFB A;  1V4Y A;  4J9O A;  1N36 B;  2OWO A;  1N33 H;  3E22 B;  3N6X A; 
#chains in the Genus database with same CATH homology
 4CC5 A;  4LF7 B;  4X20 B;  2CFM A;  4DRX A;  1B04 A;  5KX5 A;  3KAK A;  2VQE B;  3JAR A;  1FFX A;  2R72 A;  3MAQ A;  2MCT A;  3JAW B;  3JAS B;  4CH5 A;  1TAE A;  4TQD A;  4TV9 B;  1TVK A;  3GB8 B;  1J5E H;  3L4K A;  5JCO A;  2HIV A;  3IG0 A;  3NBZ B;  1WN7 A;  2JS5 A;  3C0F B;  5LXT B;  1KMI Z;  3N42 B;  1Z5V A;  4TV8 B;  3K57 A;  3H20 A;  5FNV A;  2PYL A;  4L8J A;  4FM0 A;  4X65 B;  4ZHQ B;  3N2K A;  1SQG A;  4X64 H;  4YY3 B;  4LF9 B;  2WE6 A;  3BA9 A;  3RYC B;  5LA6 A;  4MV9 A;  1I6U A;  3JAT B;  4DR4 B;  4O4I A;  1QHT A;  1JFF A;  3PN1 A;  5D1O A;  4YHH B;  3K59 A;  2WDT A;  4IHJ A;  4DV0 B;  1CKM A;  2QM4 A;  2RJZ A;  3WB0 A;  4JI7 H;  5IJ0 A;  3T1H B;  4JYA H;  4DV1 B;  4O4H B;  4NXN H;  1XMO B;  2VQF H;  4R7R A;  3N44 B;  2UUB B;  5KHG A;  4K0K B;  3LNN A;  3T1Y H;  2UXC H;  3VNN A;  4O2B B;  2ZM6 H;  4DUY H;  1E4G T;  4EEQ A;  1M0T A;  3KAJ A;  3RR5 A;  3TY8 A;  4IIJ A;  4I4T A;  5D5P A;  1H2S B;  4TQF A;  1IBM H;  4WBN B;  2PY5 A;  2UUA H;  2PZS A;  1BJT A;  1HNZ B;  4ZI7 A;  1WPB A;  3VQY A;  3KYH C;  4FM1 A;  2Q7G A;  4B3T B;  4DRF A;  5LMN H;  3JAL B;  2YIB A;  4UCT A;  5LP6 B;  2CW7 A;  2BTO A;  4DR2 H;  5J2T B;  5CA1 B;  5IYZ B;  5JJE B;  4LF6 H;  4DV2 B;  4LSX A;  5IJ9 A;  2XHB A;  4DUZ B;  1XNR B;  5EZY B;  4I7H A;  3J80 W;  2F4V B;  3HKD B;  4MV7 A;  5KMG A;  2HEP A;  3K58 A;  3BRC A;  1CKN B;  1M4U A;  4ZOL A;  2VUG A;  2YIA A;  5LL6 b;  4RZQ A;  2F66 C;  4LH6 A;  4BWA A;  4HNA B;  3HXL A;  2HGS A;  3L4J A;  4DR7 B;  4JV5 H;  1FJG B;  1TUB B;  5JQG A;  4LMY A;  3RYF A;  4RAY A;  3K5N A;  4JI0 B;  5FD6 A;  1N34 B;  2YIB D;  2ZIO A;  4JI6 B;  2HIX A;  2WYO A;  5JH7 A;  1HNW H;  1HR0 B;  4LF8 H;  4LF4 B;  4X1Y A;  4DV3 B;  5K1X A;  5FD5 A;  4YY3 H;  3HKE B;  4NXM H;  4O4J B;  4E6N A;  4MTD A;  3U0Z A;  5CB4 B;  3N2G A;  3EYY A;  2VWK A;  3BAA A;  1XNQ B;  2UXB H;  4LSA A;  4X66 B;  2BTQ A;  4D7S A;  4A2A A;  1HNX B;  4KHP H;  5KHK A;  3T1H H;  5DIS C;  3JSL A;  2KKW A;  1P8L A;  4DV1 H;  4F6R A;  3CVZ A;  2Q2T A;  3RYI B;  4YJ3 A;  1XMO H;  4CS2 A;  4LNU B;  3RWR D;  4X1I B;  1IBK B;  2UUB H;  5LOV A;  1CKO A;  4PZ7 A;  4J0M A;  3ZS8 C;  4X62 B;  3JAK A;  1Q5O A;  1VF7 A;  4FLY A;  4B3M B;  4LR3 A;  4I55 A;  4LFC B;  4CH4 A;  4JI3 H;  3RYH B;  4YJ2 A;  4JI4 B;  4U3J A;  3UQ8 A;  2PTM A;  2Q7H A;  2E3C A;  3BHP A;  3JAM W;  5GON B;  4X1K A;  5LP6 C;  1FKA H;  1JJO A;  4LFB H;  3OTO B;  4RB0 A;  1XMQ H;  1S03 G;  4Q0Y A;  2Q7E A;  3VQX A;  5BMV A;  1HNZ H;  1I94 B;  3J7A K;  5KHI A;  4O4L A;  4Q6G A;  2UU9 B;  2HVQ A;  4DR5 H;  4EB6 B;  4B08 A;  1XQ8 A;  4CH3 A;  4GKJ B;  5FLX W;  4DK1 A;  5J2U A;  3K5L A;  3SGI A;  4JI5 B;  1O9G A;  2ZJT A;  3RGB A;  1SEI A;  5JVD B;  4DV2 H;  4K8Z A;  4AQY B;  4OX9 B;  3BA8 A;  2JGU A;  1XDN A;  3HKC A;  4PI0 A;  1NT2 B;  5CA0 B;  3K3V A;  4JI8 B;  3UT5 B;  3RFR A;  2E5L H;  1I7F A;  1KU9 A;  4PZ6 A;  3NBY B;  4FM9 A;  1Q43 A;  3DF7 A;  4LF5 B;  1N33 B;  2YCH A;  2V4D A;  4UCS A;  3LML A;  4ETS A;  3E22 A;  1SKV A;  3ETQ A;  3N40 P;  4X20 A;  4I50 B;  4TUY B;  5LYJ B;  2GV9 A;  1O75 A;  4JI1 H;  1N32 B;  3CB2 A;  2XIG A;  1SA0 B;  4JI2 H;  3JAW A;  1SYX B;  3JAS A;  1XK5 A;  4DR3 H;  3N43 B;  1J5E B;  4O2A B;  4TV9 A;  5EOY A;  4AHC A;  3JSN A;  2CAZ C;  3HKB B;  4MTE A;  3QWU A;  5C8Y B;  2CW8 A;  5LXT A;  5BR8 H;  3CSX A;  1HR0 H;  4B3R H;  3RTX A;  4DV5 B;  3J81 W;  4TV8 A;  2Q0A A;  4FFB B;  4GYC B;  5FPO A;  5ITZ B;  1P16 A;  4CS4 A;  3GDE A;  4X64 B;  1N36 H;  4ZHQ A;  3QG5 A;  5EYP B;  4FLV A;  1MZB A;  1M93 A;  3RYC A;  4DRX B;  5KX5 B;  5EIB D;  4LF7 H;  3K5M A;  3JAT A;  3JAR B;  1FFX B;  2VQE H;  3QF7 A;  1A0I A;  3ICX A;  4PI2 A;  3F8N A;  4D7T A;  4PHZ A;  3TY5 A;  2F95 B;  2EX3 A;  1TVK B;  3RF2 A;  4UFZ A;  3FMA A;  4TOI A;  1S5J A;  3ZED A;  1XHZ A;  4JI7 B;  1IBL B;  3W1B A;  4JYA B;  2PUS A;  2HHH B;  4UCU A;  4M7E A;  1Z5W A;  4NXN B;  1HW7 A;  1Z2N X;  2VQF B;  2ZIN A;  4O4H A;  2O03 A;  5FNV B;  4LFC H;  1YEW A;  1TA8 A;  3N2K B;  3T1Y B;  2R70 A;  3BAB A;  2UXC B;  4X65 H;  1D5A A;  2ZM6 B;  1M0W A;  4O2B A;  3U11 A;  5LA6 B;  4DUY B;  4LF9 H;  1X4T A;  1S68 A;  3M7M X;  4O4I B;  1ZAU A;  4FLX A;  1IBM B;  4DR4 H;  4LFA B;  1JFF B;  3QTC A;  1TGO A;  4A2B A;  3WB1 A;  1I94 H;  3SJC C;  2UU9 H;  4WBN A;  2F93 B;  5D1O B;  5IT9 W;  4IHJ B;  4B3S B;  4GKJ H;  4DV6 B;  5FPR A;  1M5I A;  4CS3 A;  3KAL A;  4DR1 B;  4YHH H;  4DV0 H;  4APM A;  5IJ0 B;  5LMN B;  4JI5 H;  3MWM A;  1JMK C;  4RAZ A;  4UCR A;  3RGZ A;  4DV4 B;  3JAL A;  3W5O A;  4OX9 H;  3VQW A;  4DR2 B;  4BW9 A;  5LP6 A;  5J2T A;  5CA1 A;  2YXL A;  5IYZ A;  1E4F T;  3GJX B;  4K0K H;  5EZY A;  3SJB C;  4LF5 H;  3RIZ A;  3HKD A;  2Q2U A;  4FLT A;  4IIJ B;  4I4T B;  4KL1 A;  1CKN A;  4GKK B;  4GLX A;  1V9P A;  4ZIB A;  4LH7 A;  1WH2 A;  4FLZ A;  2YI8 A;  5D1P A;  1N32 H;  4HNA A;  3CHX A;  2RQ6 A;  4JV5 B;  2HVR A;  5JJJ B;  5LMU B;  3SR2 C;  4ZI7 B;  4RB3 C;  1TUB A;  3N41 B;  2IM9 A;  2UUC B;  4B3T H;  4EFE A;  5K1P A;  4UCO A;  4UCV A;  2OYQ A;  3K5O A;  4DV5 H;  1HNW B;  5IJ9 B;  2YI9 A;  4LF8 B;  1AN7 A;  1XNR H;  4DUZ H;  3OTF A;  2RGR A;  3KXY T;  4DR6 B;  2F4V H;  4NXM B;  5KMG B;  4DV7 B;  5JCO C;  3U10 A;  3HKE A;  2ZIM A;  4ZOL B;  4HBN A;  4O4J A;  3A2F A;  3NC0 B;  2PYJ A;  4NVP A;  4PZ8 A;  4BWS C;  2UXD B;  5IWA B;  4PDB A;  3THO A;  5CB4 A;  2F1M A;  4EFB A;  2KSW A;  5JQG B;  2UXB B;  4DR7 H;  2P5O A;  1XHX A;  1FJG H;  4CC6 A;  3RYF B;  3S24 A;  1GYF A;  4KHP B;  3TY9 A;  1IBL H;  4JI0 H;  1BGW A;  2HHH H;  4AIL C;  1N34 H;  1Z2O X;  5JH7 B;  4JI6 H;  3RYI A;  3WB2 A;  2P22 C;  4LNU A;  1FVI A;  4X1I A;  4X1Y B;  4LF4 H;  3RGX A;  1XI1 A;  4DV3 H;  5A2Q W;  5JJN B;  4FLU A;  1QQC A;  4JI3 B;  4EQ5 A;  4FLW A;  3RYH A;  3W1G A;  1G6U A;  5KHJ A;  4LFA H;  4LFB B;  3N2G B;  5GON A;  3BPZ A;  1XMQ B;  3FFQ A;  2RGV A;  4CH6 A;  4B3S H;  4DR5 B;  2JVD A;  2ZCE A;  4DV6 H;  2BTQ B;  1XNQ H;  4DR1 H;  1L2Z A;  4X66 H;  1L8D A;  4EB6 A;  4IAJ A;  1Q3E A;  5EIB C;  1HNX H;  2R9A A;  2VOB A;  4DV4 H;  4F6R B;  4FVM A;  1T5E A;  4YJ3 B;  4K8X A;  1DGS A;  5LOV B;  1SQF A;  5JVD A;  1O9H A;  1IBK H;  3JAK B;  3SJA C;  1RSO A;  1X9N A;  4RB2 C;  5CA0 A;  2E5L B;  4DK0 A;  2W57 A;  4X62 H;  4I55 B;  3UT5 A;  4B3M H;  2ZNJ A;  4YJ2 B;  4U3J B;  5KHH A;  4I9Q A;  4GKK H;  4JI4 H;  3VQV A;  1Z2P X;  4X1K B;  2PGG A;  2QJ1 A;  5IWA H;  2FE3 A;  3OTO H;  4I50 A;  4TUY A;  4JI1 B;  5BMV B;  2ZNI A;  5LYJ A;  3L2P A;  1ZHQ A;  5LMU H;  4O4L B;  4JI2 B;  4DR3 B;  1SA0 A;  1Q8I A;  2UUA B;  2UUC H;  2VWJ A;  5D5Q A;  1VS0 A;  4O2A A;  5J2U B;  3DSQ A;  1P49 A;  3HKB A;  5C8Y A;  5BR8 B;  1ZHS A;  4RB1 A;  4B3R B;  3HKC B;  4AQY H;  1WNS A;  3B2E E;  2HVS A;  4DR6 H;  4LF6 B;  3RJ0 A;  4DV7 H;  4JI8 H;  2VPS A;  4FM2 A;  4FFB A;  5ITZ A;  1N36 B;  2OWO A;  3IAY A;  3M4I A;  1N33 H;  3E22 B;  3N6X A;  2UXD H;  5EYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...