4CC6A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 103
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc6A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc6A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc6A02
4JYAB 3UQ8A 4JI5B 3BABA 2CFMA 4CC5A 4DR2B 3L2PA 5D1OB 3T1YB 5LMNB 3PN1A 4OX9B 3W5OA 5IWAB 1XMOB 3QWUA 4LF5B 3KYHC 4B3TB 4EFBA 4K0KB 2HVSA 1FVIA 2UXDB 1DGSA 4JI2B 1P16A 3NC0B 4DV0B 1S68A 4B3SB 1B04A 4CC6A 4X65B 4UCRA 3BA8A 4DUYB 2HIVA 4JV5B 1ZAUA 4LF8B 1XNRB 2HHHB 3OTOB 4PZ8A 1N32B 3GDEA 4DV7B 3RTXA 3RR5A 3TY9A 4UCSA 4JI6B 4LFCB 4DR1B 4LH6A 1IBLB 1X9NA 1XK5A 3BA9A 4UCUA 4DV5B 1XNQB 2ZM6B 4UCVA 4UCTA 2UUBB 1I94B 1FJGB 1J5EB 4AQYB 2UU9B 2UUAB 5D1OA 4JI7B 3JSNA 5FPOA 4YY3B 5LMUB 4X66B 2VUGA 3VNNA 5BR8B 4DR3B 1CKOA 4NXMB 4DR7B 4LF4B 1P8LA 3JSLA 4DRFA 1N34B 5DISC 4PZ7A 3GJXB 4GLXA 2F4VB 1TA8A 4UCOA 4GKKB 4LF6B 2E5LB 2UXCB 1XDNA 4DR5B 4JI0B 4UFZA 1A0IA 4DV6B 4PZ6A 1N33B 5D1PA 3NBYB 2HIXA 1HNZB 3TY8A 4X64B 4DR6B 4B3RB 4LH7A 4GKJB 4EQ5A 4LF7B 1HNWB 4KHPB 1IBMB 3W1BA 5FPRA 2HVRA 3GB8B 4JI1B 4DUZB 1HNXB 4DV3B 3W1GA 4DV2B 3TY5A 1TAEA 1CKNB 3SGIA 2VQFB 4NXNB 2HVQA 4DV4B 1V9PA 4TOIA 4EEQA 2UXBB 4B3MB 4X62B 4DV1B 4DR4B 4EFEA 2Q2TA 4LFBB 1CKNA 2OWOA 1CKMA 4YHHB 4LFAB 2UUCB 3S24A 3T1HB 1IBKB 1VS0A 1XMQB 4JI3B 2Q2UA 4LF9B 4E6NA 3NBZB 3BAAA 2VQEB 1HR0B 4JI8B 1N36B 4JI4B
chains in the Genus database with same CATH superfamily
1MNGA 2VQEO 2P67A 2OCCB 3KHLA 4J7KA 2E75B 3BABA 3KCXA 1QBZA 2HGWA 2XIGA 2Q7EA 1T3NA 1PNKA 3WWJA 4CS3A 2JEFA 3F7VC 3KREA 2YI8A 1Q90D 3ABLC 3RB3A 1M5IA 1ZLZA 1M56C 3WB1A 4ECUA 3K57A 1SKVA 3K5OA 4QJFB 4QGPA 3JD3A 4I9WA 1DF4A 5KFIA 2PYJA 1SA0A 4K0KH 3C0FB 5K1XA 4MS2A 1I7FA 3CVZA 2XTAA 1VQ9V 1AI4A 1EN4A 2ATKC 4P9OA 5LMUH 3TK1A 4MTOA 5C4XG 5JQGB 1IBLB 3OSPA 4LF4H 4X1KA 2Y4RA 2YEVB 3GB7C 2PY5A 4RO2A 1QR9A 1GAXA 2UXCH 1J5EB 1ZHQA 3CWBH 2DWEC 3LDEA 2FLNA 2X0LA 3GTKA 1AN7A 5C3EG 3Q4HA 2FKLA 1JPXA 2FKXA 3CJHA 5KFOA 2KSWA 5KG6A 1HNWH 3JSLA 2XC9A 1Z2GA 3AG4C 1FYJA 1FFXB 4I5SA 4YY3H 5J2TA 1NR7A 2IJIA 3F7YC 1L2ZA 4UCOA 1YIJV 2E5LB 5JVDA 2ZJTA 4MVOA 3CEBA 4JTCB 4DV6O 1KP3A 4HNAB 1N0NA 3U10A 3GIDA 3ETGA 5EYPA 4B3RB 3U0GA 2R82A 3GTGA 3N27A 3JCZA 2Y48A 4JV2A 1IBMB 2OTJV 1N33H 1YTFD 4MVQA 2R7NA 3ZMVA 1HNZH 4K35A 3O65A 2XUMA 4DUZO 1YDXA 4F4ZA 1EUCB 4A3MG 3PO3G 3AK1A 4DV4B 1NVPB 5CBFA 1E4EA 2R8IA 4DV3H 3JCUZ 1YJNV 1PKXA 4DR4B 4NTXA 1CKNA 1ROPA 1RM1C 3KG2A 2FL4A 2ZD9A 3UT5B 4YXWG 3ABKB 2UXBH 2DYSC 4LFAO 1TUEB 3JD4A 3VPBA 1WP8A 4A3EG 4OXSA 4MV1A 3AK2A 4LF9O 3JRWA 5KS8A 4MTGA 4I50A 1M1KW 4IRCA 4X8AA 3SYQA 1UJWB 3CCEV 1PX2A 3T99A 4JI8O 2QF7A 3JD1A 1F4NA 2QA4V 2CW7A 2NU6B 2ARHA 3J81N 4O84A 1I1LA 2XGQA 3CC7V 1JA8A 3TJTA 4PA7A 1EZJA 2CNQA 3I55V 1SA0B 2HVSA 1Z2OX 3F8NA 4OX9H 2W9CA 4MV8A 4EYIB 2FE3A 5FLMG 1QLEC 2JGUA 3BA8A 2GSMB 4UCRA 1I94H 1K3EA 2UXDH 5BR8O 2FLLA 5KFMA 1R73A 4Z2WA 4DV7B 1G4YB 5LGUA 3MD0A 1VQ4V 5IYBG 1JX9A 4LF8H 2R9IA 4YB8B 5H6RA 3STZC 4DV5O 4RAYA 1AI5A 3Q4HB 2CTRA 1EM1A 3L72H 3E22A 1VQPV 1FJGB 1Z2PX 4X64O 2CTQA 4FLWA 2A9HA 4PBCA 5KHGA 1M6VA 5FLXW 1VQMV 5DLGA 4ZI7F 4W4LA 1AVMA 2K9PA 1JVMA 3QNEA 3WO1A 4PA6A 2IJKA 5B3SC 2HGSA 2B5UA 1WCMG 4X66H 4ECRA 4C7UA 5EYPB 3GJXB 3FB7C 3KKYA 5KA6A 3HKDA 4GC6A 4DR7H 2W8KA 2UXNA 1VQNV 4PA3A 3K9SA 3G8CA 4MV3A 4PD4F 3NGDA 3R23A 5IYZF 3EVKA 4DR6B 5HNEA 4X62H 1V54B 4DR5H 2HVJC 5L3GA 3HKCA 3ASNC 2ASLA 5HFLA 1B3QA 1E4EB 4JI1B 4JI4O 2R85A 3EPIA 1FKAH 1R6KA 1UC9A 1CKNB 2R6FA 3TCUA 5J2UF 4G3IA 3R5FA 2ASDA 3QO8A 5GTIZ 3FYEB 2ZDIA 4DV1B 4NZNA 4DV2H 2Z3YA 4IYIA 3AG2C 4ED3A 5KFXA 1RJQA 4IZOA 1TWCA 3CB2A 2LQTA 4MV7A 1ZX3A 2BSKA 2GLTA 1Y74A 4E6NA 1N56A 3HKEB 2AHYA 3ZRWA 5CB4F 3CXHF 4H13B 1EYZA 1IZ3A 4JI3H 2C00A 2ASJA 3SPCA 4DIMA 5C1OA 3JAKA 5KT2A 2I87A 4UB6Z 1JFFB 1S5LZ 1WA8B 1HR0H 4X1IA 3RYIA 2PI4A 4IIJF 5IYCG 4IR9A 2XOKG 2A7WA 4LBEC 2W9BA 2FK1A 2IU3A 3VPCA 4JI2O 4JTAB 4A3IG 5LP6B 4EB6B 4IR1A 2NLJC 1F4MA 5DGBA 5B1AB 5KFYA 1XNRB 3L71H 2HEPA 4WCEV 3OTOB 2R86A 4YBZB 2BQ3A 2DQ3A 4RNOA 3K5LA 4Q4DA 1BHAA 2GV9A 4O81A 2Z04A 1W93A 4JI6B 3SYPA 1KUTA 1G2WA 2QM7A 4FGRA 1S03G 1X9NA 4MVMA 1QNMA 1UNNC 3JARA 5D5PA 4X1YA 5JWPA 2WAQA 3ABTA 3CXCU 3K03A 2YWVA 1YCIA 1IBLH 2UUBO 5B66Z 4AQYO 3NXSA 1VF6C 3UO3A 2IJJA 3H40A 3HKDB 2WB1A 2R72A 4ZI7A 2CGOA 4NTWA 2PBZA 2IBKA 3DF7A 4RUEA 1S77D 4Q43A 4H37A 4FM9A 3H1IH 3RJ0A 1Q6HA 1EBOA 4WFBV 2C2AA 4HBNA 2YRWA 3OM3B 4LSAA 3B2EE 1UPGA 3HKCB 2Q67A 4ICGA 3EYYA 1IX9A 5BWUA 3GIMA 4R50A 5IYZA 1SCUB 5KT3A 3CRMA 2E5LH 3GWOA 5FJ8G 3W1BA 2PI5A 5LOVA 3JATA 2W57A 1T5EA 2XAQA 3R5HA 3T1HH 3B77A 4B3RH 5BWVA 2XD4A 3ZBHA 1IBMH 3MFIA 3GTLA 2V9WA 4NXNB 1A0GA 3LSUA 4QWBA 1TVKA 3J7AU 1AI6A 2BSKB 2W70A 1Y74B 3RAXA 3UCSC 1GN4A 3KHRA 1NS1A 4DV4H 3ZRWB 2I80A 5IYBO 2L6LA 2RDJA 1HWYA 3JAKB 5F9NA 5B1BB 5A9GA 5JJNB 4DR4H 3GTJA 2BOBC 3RYIB 3RVYA 4P2ZA 1JQ0A 2M6YA 2RGVA 4O4HF 1N36O 2XAFA 4G28B 4JI5B 5L9XA 4U3JA 1BL8A 4BIZA 2W9BB 4X20A 1H2LA 1S9FA 4DXWA 3GQCA 2JEUA 3T1YO 3QQMA 5LMNO 4LSXA 2NVXA 2YDEA 4IWXA 3VA7A 5BMVA 3QF7A 4BW9A 2DWDC 4B3TB 1ZQ7A 4TM5A 4GLWA 4HAMA 1EN6A 2QK4A 1VF7A 3ETHA 3M9MB 5KKNB 4QW9A 4K8ZA 1BZKA 3ORRA 3ML0A 3V4SA 3EXAA 4DUYB 4A3JG 1XL6A 4PZ8A 1YEWA 1IOWA 1B6SA 3J81W 2ZQMA 4X1YB 3R66A 3I12A 4FBUA 3FMAA 2Q7HA 4UCSA 4D7TA 1NVPD 2DZDA 5CAEB 5KFCA 4RZRA 2R70A 1OCOB 3LNNA 3N8DA 4DV7H 1VQ8V 4UCVA 4FS1A 3CRAA 4RQFA 4EG0A 2KG7A 5IT9N 4ZI7B 2XAJA 3ETEA 3ZHSA 2UUAO 3OUUA 1R3JC 3UKMA 4O86A 3H3VH 4QWDA 5LMUB 1Q3EA 2CTPA 4LF4B 5LL6b 4ZHQF 1SQPH 4MW3A 4O7YA 2NU8B 4B7KA 1D5AA 4O4LA 2LP7A 5IYZB 1V4YA 3G6VA 1XL4A 2UXCB 1S5JA 4RAIA 2F1MA 2F23A 5JQWA 3N42B 3JATB 1KBHA 3HXLA 4YP3A 2EILB 3B8NA 3LMLA 3APQA 1Y67A 5DGAA 3ZX6A 3ZMZA 3U54A 3JYCA 1IURA 1HNWB 4KHPB 1ZHSA 3OD4A 2RDIA 4ECWA 5C44G 3EFFK 5J2UB 1JOYA 4O3SA 4M9UA 2J6TA 4DR6H 4ECZA 3E5NA 3QO5A 5C1PA 4U7CA 1S76D 3OFNG 2Y0PA 2ZR3A 2WE6A 2WAQE 5KHKA 3CS5A 1GM8A 4JI1H 2OIEA 4JYAH 4B3MB 3T4DA 3GV5B 4L8JA 2JGDA 3HPLC 2GUZB 5KFLA 4I55F 4GCZA 4FLYA 1MZBA 3CCUV 4B7EA 5KT4A 4RUFA 4RU9A 1XMQB 3CYOA 1FXKA 3RVZA 5CB4B 4DV1H 3ICXA 4U3JB 1COWG 2AGAA 1ZWIC 3BQ1A 3UM7A 3CMEV 4IIJB 1I0HA 2N74A 1XBLA 1QCEA 1WNSA 1IXBA 2FYUH 3L2PA 4CH5A 3H1LH 4A3CG 1K92A 3QWUA 4ED1A 1H2NA 4LF5O 2QDOA 1NI8A 4RB3C 2YICA 1SETA 3D36A 5FD5A 3QZ7A 1EHIA 2EZOA 1M57B 1FJGO 1TWAA 3SDLA 2WLJA 1B04A 1H8EG 3T9EA 4X65B 2HIVA 3TXQA 3JALA 2D2CB 4UXNA 1ZL8A 3RTXA 2JS5A 4DRXB 2EIYA 5DGIA 2EIKC 5BXZA 5EIBC 3J80W 1KJ8A 1XNQB 2ZM6B 4F50A 1KECA 1BSMA 4IT5A 3LULA 1I94B 2RJZA 4EBDA 2PF4E 4JI7B 2ATLA 3TXSA 3IAYA 4LP8A 4AHCA 2ZKOA 3A8TA 5FLXN 5DLFA 4LF7H 5DG8A 2YC0A 4NXMO 3IC9A 2COIA 2C28A 4J0MA 1SYXB 5KFFA 2VUMA 3JAWA 1M93A 1HP8A 4GLXA 2F4VB 5CA1F 4JI0B 4FBTA 2PMZE 3MHHC 2HP8A 1AUXA 3CRCA 4LWSA 5GONB 2WAMA 3LDCA 4QE9A 5FL7G 1QLEB 5JQGA 4GKJB 1SFOA 2R92G 2CW8A 3K06A 4FPPA 1QVGU 3H9VA 1QU7A 4Y8VB 1ENVA 3RGXA 2EJ7A 1MZEA 1WLEA 1KJQA 1BT8A 2KKWA 2JGDB 2ZDIC 2GDSA 3AG7A 4GYCB 4WHXA 3T5LA 5D8DA 3MR2A 3VQVA 4EEQA 4NVPA 3R5XA 1AR1B 4X62B 3RAQA 2DIKA 3Q8RB 3Q8SB 2FPIB 5KX5F 4DL3A 4J10A 2ZGIA 4NXNH 2HVKC 4QIWE 1IYDA 2WTFA 1FFXA 4ZOLF 2V4RA 5IDJA 4O4HB 4EKWA 3DGEA 1WSCA 5BY1A 3HKZE 2JA6A 4O7ZA 4DL5A 1XNRO 4ECXA 3OTOO 3UQ8A 2GTAA 1K5SA 2JA8G 2QM8A 1H38A 2JVDA 4PDLA 1J95A 2N04A 4FZ0A 4JI6O 4DR2O 4OGQB 4GZRB 4CH6A 1K97A 1XMOB 1IXMA 2HHFA 1IDSA 4JI5H 2FPGB 4IRDA 2QR4A 4ABMA 1MMMA 3L70H 1KJIA 1FVIA 3JALB 3RFRA 2CUGA 1VIBA 1JX4A 1PP9H 1QLNA 2E76B 2RQ6A 4JYCA 1H2SB 5L1IA 4O3RA 4NZMA 4B3SO 3MWEA 2QYZA 4B3TH 4CE5A 1GN3A 1OCZC 4FFMA 1ZAUA 3UT5A 1SERA 4I4TF 2B63G 5JCOA 1L1FA 5FR9A 4LFCB 4DUYH 2EZPA 1R3LC 3BA9A 4ED7A 4ECQA 1M4UA 4F4XA 1NTMH 4F4WA 3CCLV 3H0GG 1S0MA 4EBCA 3OHAA 5BPHA 4R7CA 5BWRA 1LR1A 2Q73A 4ZHQB 1S72V 3NUAA 4FJCC 5GW7A 4D7SA 3JAWB 1H8HG 3RB4A 1CKOA 2F43G 4A3KG 2QKCA 5LP6F 3BCCH 3KALA 4DRFA 1OCCB 4TT3G 3ORQA 2CH7B 4LWSB 1KTAA 2FP4B 3RWRD 1N34O 3SR2C 3WB0A 2LO1A 4LF6O 1WAZA 1K4DC 5CA1A 1XQ8A 5IT9W 3AG1B 1GLVA 2HIXA 3ZHVA 4XX0B 1BHBA 3HKBB 1CS0A 1VMGA 1KC7A 1HNXB 4DK0A 4C5BA 5H5NA 1LUWA 5B1NA 4KHPH 1AILA 4I55B 2VQFB 1JR9A 3X2QC 1JCHA 3MJFA 1AR5A 2YS7A 3JZIA 2OH2A 3HOWG 3FB5C 3CSWA 5EZYF 4DAAA 3GTPA 5E25A 3LP8A 4LFBO 5KX5A 3T1HB 2ZXWB 4A3FG 1VS0A 4F6RA 5KMGA 4B3MH 3AK3A 4JXUA 3BAAA 3AYHB 4J80A 2DQ0A 1A9XA 1US6A 4LMYA 1TUBB 2HHFB 5KFRA 1XMQH 1Q86W 4GC7A 2YSUB 1WN7A 4DL6A 4WF9V 3CCRV 5H2FZ 1AB3A 1NH2B 4UVCA 1RYSA 5IWAB 1AUVA 3KYHC 1M9NA 1QQCA 3K9AA 5LGNA 4JAAA 2CZGA 3ZHTA 2W6PA 2JA7A 3RBDA 1E4FT 5KFEA 4K0KO 2ITDC 3K58A 1XHZA 2ZCEA 4PDVA 4O2BF 4IRKA 3L73H 3AG3B 4TQRA 1BS3A 3D8CA 4JV5B 2DPJA 2IJHA 2AGPA 2X6AA 1N32B 3E8GA 4LF4O 2YXLA 4I4TA 2ABJA 2RDCA 3RR5A 4X65H 3AW8A 2MCTA 3HKEA 4CS2A 2M05A 2IMWP 1Z5WA 3A0HZ 2UXCO 3IN5A 1W59A 2GQRA 3BEHA 2FK2A 2W8LA 1VQOV 2DYRB 3A0RA 3K04A 5I5WA 1JFFA 1VQLV 2LGWA 1RFYA 2DMXA 5BYBA 1WA8A 4YR2A 5E79Z 3BHPA 3OT7A 2MK3A 3JSNA 1HNWO 1XNQH 4BXXG 2ZM6H 2ADQB 4DQNA 5L1KA 2FPPB 2R7ZG 4YY3O 1GN2A 2Q0AA 1SZXA 4MTXA 5CA1B 2XGPA 4JI7H 1THZA 1S3JA 2VR1A 1GMGA 5LP6A 4EB6A 1VQKV 3H1KH 4P30A 5KFPA 3K5NA 1SF9A 3RB0A 1A32A 2EINB 4FFKA 3CP1A 4E4TA 2NNUA 1N33O 5KAIZ 4O7WA 4YAKB 2RGRA 4K8XA 2KQXA 1GM9A 3DXRA 2YUAA 1YSCA 4Z1MG 1HNZO 5I47A 2FK3A 1R9TA 2F4VH 1FPOA 1C30A 4JI0H 5IY5B 2Y69C 3AX6A 3CRRA 1SQFA 2V1DA 2Z02A 1KUQA 5KT7A 3W1GA 4GKJH 3K59A 4DV3O 1W0KG 1S0VA 5KX5B 4C2MA 5CE8A 2UVRA 2N05A 2QM4A 4F6RB 5KMGB 4ZOLB 1Y1VG 1FXKC 1WB7A 3MHSC 1YITV 2UXBO 2Q2TA 2EIMB 1WB8A 2ILMA 5EZYA 1UC8A 1B06A 1NTKH 2V4QA 5HBRB 2OTLV 2JJ1G 3BY6A 5LXTF 2B9ZA 3UFXB 1KD1W 1PL4A 4JI2H 2A3QA 3T2MA 4YR3A 3HOYG 3ZN1A 4JYAB 1PD3A 2Z5UA 1ORQC 4H44B 2KSDA 2HLDG 4APMA 3PN1A 2HHHH 3D36C 3SPGA 4YR0A 1AR4A 3K3PA 1R3IC 1GO3E 4OX9O 5KFNA 2W0FC 4A5UB 3W7UA 5FD6A 4A3BG 5KFGA 4L87A 1AJNA 2XASA 5C8YF 4WFEA 1GKFA 3L74H 1Q8IA 3ZMTA 4DV0B 2UXDO 1XMOH 4I4TB 4FE2A 4XBFA 1NJIW 2BTQB 1Y1WA 3R9RA 3RBEA 1URFA 3FAVA 2I8CA 1S5HC 2AGQA 5EWFA 3WG7C 4J9SA 4LF8O 5L3BA 3ZHQA 2OCCC 2KB1A 3FKIG 5KHHA 5I5SA 3M9OB 3APOA 2BQUA 1XK5A 3MR3A 5I5XA 1A48A 2DPIA 2IA6A 4UCTA 4BW5A 3J80N 4LFCH 4RUCA 4GKKH 4QNHB 2UU9B 4A93G 2DW4A 4ETSA 3OMAB 2P90A 2PTMA 3BG5A 3KAKA 5EBMC 4FIPC 3T9AA 4X66O 4DR3B 2GQSA 3ZRSA 4XDLA 4DR7O 1K7DA 2P6JA 3STLC 3M4IA 2VQDA 4C5CA 3U11A 3DXRB 3LQSA 5AG2A 1XDNA 4N23A 4WFAV 4X62O 1DLBA 4DR5O 2HKOA 3KHGA 3SJCC 1K5QA 4ECYA 1VQ6V 4CBCA 1K34A 4XDJA 4LF7B 1WH2A 2EIJB 2IP4A 1FKAO 2PGGA 3DTUB 2HVRA 3ABMB 2R93A 3RGBA 3HOXG 1YHQV 3C3TA 1SEIA 1V55B 5EZYB 1BCCH 1FXHA 4DV2O 1VBGA 2SCUB 3SNOA 1L8DA 1TWFA 2LFSA 3VQWA 1H2GA 1KEEA 1O9GA 1RPOA 1HNXH 4YAJB 3GV8B 1PM9A 1WJZA 4LC1A 4IAJA 3BQ0A 4J11A 4UB8Z 3ZEDA 2YL2A 2VQFH 1SQGA 2WPDG 1X4TA 2UUCB 1Y76B 1IBKB 4Z1VA 1XILA 3W7SA 4O3NA 4GX2A 4JI3O 4ZKIA 1N48A 2VQEB 5LXTA 1HR0O 5GONF 2R7LA 3RGZA 2BTOA 2P5OA 1YVWA 5DAAA 4WFGA 3BPZA 2BR0A 3RW0A 3T9DA 1D2DA 1NQTA 5J2UA 4O7LA 3G6EV 1XUQA 4J9MA 2DJVA 4J9ZB 2ZDHA 1R1BA 2W6IG 4O2BB 4DR1H 4WBNF 3FB8C 1GSAA 3FAVB 4B08A 3A2FA 3LUTB 5IWAH 2NUAB 5C8YA 3L4JA 2DN9A 1NZ6A 1O9HA 2ZR2A 4FMTA 5ITZA 2GUZA 2JEGA 1DV1A 2W7OA 1TGOA 3WFVA 2UUAH 3G6YA 4TV8F 2R8GA 2NU9B 5CB4A 5F2VO 3OHBA 4X89A 1GN6A 5EK0A 4UUGA 3OUFA 1TWGA 4LH6A 4O7NA 4JV5H 5FNVF 2EX3A 4JZGA 4NLGA 1IBLO 1N32H 4IIJA 2QSAA 3MAQA 3VPDA 1TWHA 2HR3A 1EKPA 1NTZH 3ZHUA 1J5EO 1JIHA 1T94A 3U55A 2W0XA 1PL0A 3H1JH 1AROP 4L1KA 4Q8EA 4RWUA 3JAMN 2EJ2A 2Q7DA 4JAUA 3RYFA 1VF5B 2R84A 4TQFA 1XEQA 3TEKA 1NH2D 4RB2C 1EKFA 5T14A 1EN5A 3GIPA 1TA8A 3OEEG 2NU7B 3NR7A 3QVNA 3TQTA 1A0IA 2JA5A 4DV6B 2E5LO 3VBBA 4ZIBA 2R7KA 4DRXA 3T1HO 2FB9A 4B3RO 2CK3G 4JF3A 4OPAA 1OCRB 2WLMA 1IBMO 3ZS8C 3I4MG 1S97A 3GB8B 3RV3A 4DUZB 3TETA 1JLLB 2YW2A 3PW2A 4Q6GA 5L3DA 4U3FH 3GTOA 4EGQA 3RIZA 1AJQA 1I3QA 1F51A 3OGCC 2XT9A 5TISZ 4FS2A 1KJ9A 2O57A 4GX1A 4DV4O 3ABLB 2VOBA 4RZQA 1M56B 1SZTA 2QWOB 2HGXA 3WU2Z 1Z2NX 2W6ZA 1AP5A 2IM9A 3GTQA 3V6HA 4DR4O 5LXTB 1DTOA 5I5TA 4LFAB 3S24A 4DL4A 4XDKA 2WLNA 1QR8A 2RN9A 4LF9B 4F4YA 4ED0A 2C2DA 4MTFA 4MA5A 1BMFG 3CCMV 4I9QA 2YZNA 1RK5A 1V54C 4GX5A 3NBZB 2J9GA 2XCPA 2Q0OC 2Q7GA 3M8AA 4JI8B 2LW7A 3C90A 2HFEC 5GONA 3T4ZA 1N4CA 3LWBA 4DLKA 4PI0A 1VAJA 4CMFA 1Q6UA 2V7QG 2CNUA 4AI8A 1QVFU 3CPWU 3GV7B 1JMKC 2IU0A 5C8YB 4JASA 4I7ZB 3V4ZA 3JZFA 5JUMA 5ITZB 3Q8PB 5B1OA 3TIGA 2UXXA 4EFBA 4MVUA 4RB1A 3W7TA 2WYOA 2A06H 4CH4A 4WBNA 1P16A 4MV9A 4BY1G 5KFBA 1K8AW 3GIIA 5KG1A 2WB1E 2P4VA 3PVXA 1OJHA 4DW1A 2ZINA 4WFFA 4EBEA 3CQZA 1P7GA 2Q5ZA 4FLVA 3AG4B 3T54A 5KHIA 4DV0H 4TV8A 1MG1A 2XNDG 3GDEA 3PR4A 3KAJA 3BFRA 4O4HA 5L3FA 4DV7O 4ECVA 3TW7A 3B40A 4QSHA 1YI2V 5EDWA 2ZIMA 4YJ3F 3ZRXA 4DV5B 4J9OA 2CDYA 2AZ0A 1ET0A 3ZMSA 2Y0IA 2W6QA 3OSNA 4FLXA 5BWTA 3CCQV 4YJ2F 3IG0A 3RYFB 3FDSA 1XI1A 1MSDA 3P30A 4R8UB 5CM0A 1RP3B 4DL2A 3JASA 4KFMA 5DEDA 1BGWA 5B1AC 2XHBA 4KUMA 1EKVA 5L1JA 2UU9H 1P8LA 1A3GA 1GYFA 3G6BA 2ZDGA 2JEXA 3ASOC 3K0GA 3CEIA 4H0LB 3ETQA 3L9DA 4J7JA 4DR3H 1RM1B 2CNVA 3KZIZ 3THOA 3NBYB 4O4IF 2C35B 2DYSB 5LYJF 3FB6C 2W71A 3T5JA 1YZBA 2W6MA 2YXHA 4X9QA 3KHHA 4DR6O 2R87A 3HBLA 1M0WA 5KG7A 2FJZA 4RUAA 4FLZA 4YHHH 2PVPA 3UZBA 1YF2A 3N2KB 5DG9A 4JI1O 4JYAO 4U7NA 4PJ0Z 2ZNIA 4ZHQA 2QKAA 2FB5A 4O82A 5KFWA 1JDEA 2DOSA 1BQZA 2BCCH 3FFQA 4CS4A 2WSSG 4DV1O 5IP9G 1I2KA 3G8DA 1I7NA 3O9OA 1ZETA 2CH7A 3N40P 1KC8W 5I60A 3PO2G 2Y4UA 1PNLA 1DK1A 2UUCH 1H2MA 1IBKH 1FFTB 1EFRG 1VARA 2CFMA 1NR1A 2RF4A 2GPWA 4K3AA 4CKEA 5KFHA 4CZZA 2VQEH 3RYHB 4TSFG 3HKBA 4WBNB 3TW6A 4DYLA 1RJRA 1VEWA 5LHIA 4TVIA 4N21A 1CQJB 2VPSA 1JDBB 2W6OA 4ASUG 4O4JF 3G67A 4RCNA 3BJYA 4I55A 4JI2B 1G8MA 1MA1A 4QPJA 4TV8B 1WPBA 2EULA 1SC5B 1PK8A 1KYOF 2WLHA 5KUMA 3DAAA 1WCMA 1PV0A 3W7XA 1QHTA 2HHHB 4NYEA 4HYOA 5FNVB 5B3SB 3RBZA 3LSQA 1VF6A 3RYCB 1IYEA 5J2TF 3WWIA 3DSQA 4ECTA 2X6CA 3QO7A 5JVDF 1HDJA 1JXLA 2AU0A 4BIUA 4X88A 2V58A 1TUBA 1Y4MA 3T5KA 3Q1KA 3T7AA 3D3IA 1GH6A 2UUBB 3JASB 3OTFA 3EHBB 5KUKA 2V5AA 1OHHG 4AQYB 1ZUQA 1P4RA 3CHXA 3ASNB 2DWCA 4O3PA 3GIKA 1P84F 5GTHZ 1G1XB 4FM1A 2VUGA 1FAFA 3DTGA 3U0ZA 3GWKC 2CTWA 3FYIB 1XHXA 3L75H 2XCLA 2YIBD 4BR6A 2V4DA 5I5YA 4GKKB 2AGOA 3LNMB 1K33A 4JZ2A 5KFSA 3PW7A 3AG2B 1GSOA 2P7TC 1OCOC 3I5DA 2XAHA 3B09A 1WRVA 5LYJA 4I50F 4JYBA 3RUPA 2F95B 2JIZG 4GUNA 4DV6H 4NR1A 4HN2A 2W6JG 3JAMW 1CP9A 2CGNA 3ZN0A 3QG5A 4J7ZA 5EBLC 2WLKA 1SQVH 3DTFA 5KFJA 2PN1A 1TAEA 2R7MA 2E2HA 1FS0G 2ZE7A 3IC7A 4NXNO 2ODMA 4DUZH 3PW5A 4A3DG 4D6TH 1B33N 4HNTA 1N0JA 5DQHA 2HJFC 3SYOA 1X59A 4M0JA 5KG5A 2OIGA 1LUVA 1KQSU 2P0AA 4IGGA 3OGIB 4MVSA 2EILC 2CE4A 3CCJV 1JKJB 4RB0A 4LFAH 2QWQB 1N36B 4MAMA 2A1HA 4G2KA 3F5TA 1JJOA 4DK1A 2QEXV 3K08A 4NZOA 2QB5A 2OLSA 5KFAA 4ED6A 3HT5A 2CAZC 2P4KA 4JI5O 4UV9A 3M7MX 1B6RA 2LGQA 4BAYA 3T1YB 5D1OB 5LMNB 3AEIA 4JI8H 2HJDA 4YIOA 3CSXA 1GGOA 4B3TO 1DGSA 4O4JA 3P3PA 5CR5A 4J9PA 4PELA 1R6TA 4ZOLA 3CCVV 3CC4V 3K3VA 4DUYO 2C2EA 1SQXH 3RT3C 2GTSA 3CCSV 4YJ3B 3Q2OA 4U7OA 1Q6IA 3CE2A 3OAAG 3H4DA 4OPHA 5BR8H 2QGNA 4DR1B 4K6NA 3G4SV 4YJ2B 4GX0A 3DC5A 4FK5C 5HV6A 3KXYT 5DG7A 3VQXA 2CQYA 2EJRA 2UUAB 3MFHA 5E1AC 2WLLB 4DV5H 1W96A 4TUYF 1DAAA 3VOTA 1M57C 3N41B 5K2MA 1BQ0A 3P3NA 5KT5A 4X64H 5CA0B 3PFFA 5LMUO 4O2AF 4JAVA 3IFXA 2HG8A 4QE7A 5JH7F 4O4IB 1OBGA 2BTQA 5LYJB 5DISC 1DIKA 4PZ7A 1WPXA 1GSHA 3BVOA 1FD9A 4I0XA 3VMMA 3P32A 3WO0A 2VWJA 2WDTA 2A79B 5D1PA 4HR7A 1E4GT 5LBQA 3HO8A 3OE7G 4FFNA 1EZ1A 2IW5A 3SPHA 4EQ5A 3T1CA 1BXRA 4FZ1A 4BBRG 5CN0A 1Y6XA 1M90W 4KHPO 1DV2A 3K5MA 3GVMA 3JD2A 3ETDA 5IE9A 3ABUA 4ZBMA 1JJ2U 3WB2A 3TY5A 2WA4A 1OBDA 1V9PA 4TOIA 4JI4H 4C5AA 3R65A 1DF5A 2DAAA 3W7WA 5KFDA 3E86A 4EFEA 4B3MO 1Q81W 1VQ7V 3SPIA 5IYDG 2VUMG 5LL6Y 4Q4CA 2Q4PA 2ZIOA 3GIJA 1XMQO 3GILA 4MSWC 3OUSA 1K83A 3K79A 2BE3A 1CPYA 1OCRC 5K1PA 4X1KB 2YS8A 4YQWA 4Q44A 2F93B 2CKZB 1K73W 1Q43A 2L35A 2QWNB 2YZGA 1E79G 4O4JB 1NT2B 1ZSPA 4LF5B 3H01A 5CMUA 3RB6A 1YJ9V 1IOVA 2Q69A 3CJHB 1P7BA 4PV1B 5H6QA 2WWWA 2ZE5A 5L3CA 3CRQA 1S68A 4YIPA 1KBLA 5J2TB 2MW2B 5JVDB 2YIAA 1T36A 4RNNA 4X65O 1Y76A 3SJBC 1AP6A 1MZFA 3TY9A 3SE7A 2VPQA 2H8PC 2JA6G 5KA5A 3M99B 1MOFA 2ZNJA 4R8CA 1KP2A 1U97A 5CBHA 4H33A 2P22C 4DL7A 5L3EA 3TGUH 1XNQO 3C3SA 2YIBA 2ZM6O 5C93A 2ZE6A 4UUJC 3FD9A 1ULZA 4DW0A 1I94O 1AJPA 5LOVF 2ZE8A 4TUYA 2AHZA 2AZ2A 4JI7O 2UVUA 1L0NH 2UUBH 4O2BA 2QWRB 4O3OA 2YI9A 4I0XB 4AQYH 4NXMB 5LHGA 4PDBA 4O2AA 1G6UA 1Q7YW 5KT6A 3GIQA 2DLNA 1B6QA 2H94A 5JH7A 1VP7A 3N6XA 4RAZA 2F4VO 2YZMA 4I50B 2JEJA 4NB5A 4JI0O 1E1QG 3FX7A 2NVYA 4ECSA 2OYQA 4WD3A 3ZMUA 2ADPA 4LNUA 4J9LA 2OT5A 1D5NA 1SQBH 3ZCCA 1K1QA 3BACA 4GKJO 3H20A 2E2IA 5FPRA 4RNMA 5KFQA 2ETNA 3I56V 2Y0SA 1M7JA 3K5HA 2W9AA 3OUZA 4O7RA 4E2LA 5DECA 5LA6F 4BIOA 2F66C 3FKSG 3QFFA 1I5XA 2W9CB 2YCHA 4JYYA 2QJ1A 5CBGA 5BMVF 1OCCC 3RFCA 4XYLB 5A2QW 2EBOA 2Q8VA 4BWSC 2OWOA 3BRCA 4YHHB 2YZLA 4JPRA 3AG1C 1XOUA 3D3QA 4J9YB 3DC6A 4PWQA 5DGHA 2YRXA 4JTDB 2O03A 4QWCA 3J7AK 4AILC 3ASOB 5KFVA 2HHHO 2XCAA 4CC5A 3K0DA 2EIKB 1NBMG 3E22B 4DR2B 2V59A 2EJ3A 1FXVA 4CH3A 3KCYA 1N36H 4J9QA 4MW8A 2R9RB 1O75A 1MABG 4A2BA 2Q9LA 1XMOO 2X7RB 1OZ0A 3LSSA 2FTKA 1Z5VA 3T1YH 4QIWF 5LMNH 4J9RA 1K1SA 2ZXWC 5C5JA 4BY7G 4B3SB 4BBSG 3TQ1A 1I2LA 1J5EH 3V6KA 2WLIA 4O4LF 4FLTA 3B8MA 4CHIA 3KTMA 2HDKA 4PDMA 4MTDA 4FFBA 1V51A 4QPKA 1KJJA 1S0OA 4LFCO 1KT8A 4O7TA 4GKKO 2R92A 3HB9A 3VOUA 4TUYB 1BNCA 2E3CA 1XDCA 3OMIB 2IBZH 2R9AA 4HNUA 2Q68A 4ED2A 1WR2A 5DMXA 4AYBA 4O2AB 2VS0A 5DQGA 5FPOA 3ABKC 2ITCC 1EZVH 5JH7B 2JA7G 5JCOC 4ZQIA 2IH1C 5IYDO 3AG3C 1I1MA 1KMIZ 1UFIA 3HOUG 1L0LH 3S3XA 4FFPA 4Q20A 2X0SA 1N34B 3SI8A 4EGJA 2GBOA 1PPJH 1AI7A 4LF6B 1GRJA 4LNUB 1CXZB 4UFZA 1W0JG 1SRYA 4I7HA 2E74B 4PHZA 4MVRA 2X5RA 3TY8A 1Q82W 2DYRC 3OR7C 2EJ0A 1BGYH 3GTMA 2RNBA 3F5WC 4MTEA 3WNZA 4IWYA 4X1IB 4IHJF 5EC1C 3BQ2A 3QZ8A 1I5YA 3PW0A 1KU9A 1VQ5V 3HOZG 1HNXO 4WFHA 4O7VA 4M7EA 2QE7G 2DABA 3G80A 1LNQA 4EEYA 5LA6A 2VQFO 3N43B 4R8UA 2DE0X 4TV9F 3SYCA 3HB3B 2B1IA 4LFBB 3E35A 3PJSK 3E2EA 2EINC 1P49A 2PMZA 3G71V 3H1HH 2Q2UA 4E4EA 2B63A 1R6NA 2A0LA 3ETJA 3U9TA 1OCZB 5EOYA 1E1RG 5DQIA 3JARB 2JS3A 5IY5C 4FFLA 5KFKA 3T9FA 3L4KA 3MWDA 4J9KA 3UYYA 4NYKA 4PA4A 3H0GA 3GLKA 4DR1O 2AW9A 2Y4TA 5BZBA 1U96A 3SJQC 2COGA 1GTOA 3N2KA 2PZSA 5IWAO 4FFRA 2P06A 4K0KB 2EIMC 3HR0A 2WLIB 5KFTA 1PNMA 1SESA 2HG5C 3NC0B 3T9CA 3U9SA 4QIWA 4LF5H 2VA3A 5BWXA 2Y0SE 4O7SA 4A2AA 2GPSA 4JUZA 4R6ZA 4CC6A 1YTFB 1N8RW 1KKDA 4FFBB 1FJGH 1XREA 2LJ2A 5DM6V 3ZIAG 2J6SA 3HKZA 4JV5O 5I5VA 4ED8A 4FM2A 3I4NG 1N32O 2JK5C 4PA9A 4UCUA 5DN6G 5EWEA 5LOVB 3PW4A 3EPGA 1RSOA 3UO2A 1GM7A 2NR5A 3A0BZ 5JJJB 5JQGF 4KXRA 3Q8QB 1I1KA 3RYHA 5IYCO 1H2KA 4IYHA 4UV8A 3N6RA 1TVKB 1CE8A 4YY3B 1RJPA 3JZ6A 3QTCA 3CD6V 3CMAV 5BR8B 5LHHA 2PUSA 3N44B 4QWAA 3X2QB 3OW2U 3UZOA 3K5IA 3RV4A 1MSWD 5IP7G 2COJA 1Y1WG 3MWMA 1Q5OA 4R7RA 4NXMH 1K9MW 3SPJA 2QTOA 5FNVA 4HZ3A 3RYCA 1F7YA 1N33B 4PZ6A 5EWGA 2R8HA 5EC2C 5KHJA 1CQIB 5JVLA 1HNZB 5KG0A 2LFRA 4X64B 5EBWC 3ZHRA 1RYRA 4LH7A 2X6BA 4F4LA 2M7WA 5K3WA 4LR3A 4X20B 2WA3A 4CKCA 5LA6B 3IGAC 4LCUC 4IHJA 4NKGB 5LP6C 3S3WA 5BMVB 4TQSA 4BWAA 3PR5B 4DV3B 2YS6A 1BE3H 3TIIA 2UVVA 5KG4A 1NKDA 3RN4A 1I50A 5IJ0A 5CA0F 2UXBB 2YYAA 4A3GG 5F9LA 2JJ2G 5B5EZ 5KLVH 3E8FA 4TV9A 4FLUA 4O3QA 1KKCA 3CX5F 3E83A 1OV9A 4XZ3B 2AXTZ 1CKMA 4AYBE 4GT1A 4UVAA 5LGTA 1RPRA 3WWHA 3N2GA 5KAFZ 5H9CA 4ME6A 1C3OA 5KG2A 4HYKA 2VWKA 5IJ9A 5KFZA 2EIJC 3SJAC 4JI4B 2FMLA 2W6NA 3ABMC 1W2BU 3MR5A 4EYHB 1ZTEA 4XYMB 4KL1A 5CA3A 3CC2V 5L1LA 5H80A 4JV0A 2R93G 2KG7B 4F6EA 1XNRH 1V55C 3OTOH 4OX9B 4TQDA 3W5OA 3H4BA 1BJTA 4Q45A 1KB9F 4JI6H 4DR2H 2GHYA 3MR6A 2R8KA 2R7ZA 4P9PA 4DO2A 2UXDB 2B1GA 4CKBA 5HFMA 4FU0A 4FVMA 4NTYA 2PYLA 5BPFA 4DV0O 4O4LB 1SS3A 5I5UA 5KFUA 2JDIG 1I6UA 2ODTX 4MA0A 2FMAA 4LF8B 5BYAA 2AQ4A 1I08A 1F23A 1GK9A 4QJFA 5KG3A 3V6JA 4B3SH 3IJ4A 1RSOB 3T5HA 1Y66A 2JEIA 2ZDQA 2FLPA 2BOCC 4QWEA 2G38A 3VQYA 2UVWA 1GO3F 4IL6Z 3ZRVA 2VA2A 3B4SA 3TINA 2RMKB 4J9NA 2LW1A 4LF9H 4QW8A 1S10A 5D1OA 1WP7A 1K4CC 4JV1A 2JRIA 2Y69B 2UU9O 3G6XA 2YEVA 4A3LG 4O83A 4FFOA 1HW7A 2ZT9B 2Z0AA 4PI2A 4G27B 4X66B 3VNNA 5B1BC 2QKSA 2QWPB 1M0TA 2H3OA 3JRXA 1Y1VA 2C2RA 4DR7B 1VKZA 2IH3C 4DR3O 5BWWA 4Q8FA 3HOVG 4RQEA 3RF2A 3K3WA 1I7LA 4KP4A 4MT8A 1FXKB 5EIBD 1RK6A 1VBHA 2K1EA 1R3KC 4HNVA 2RCVA 4DR5B 4CMDA 3M9NB 3PZPA 2YU9A 4YJ3A 1S0NA 5JJEB 3JD0A 1SQQH 4HQ6A 2Q6AA 3E89A 4MV6A 4IHJB 1N34H 4YHHO 2J6UA 3OR6C 4LF6H 2D3OW 3MDSA 1YXBA 4W4KA 4YJ2A 3OEHG 4LF7O 1NU1H 5IJ0B 4FM0A 1EUDB 3T9BA 4HNAA 2XAGA 4PDRA 4TV9B 4DV2B 2VRZA 2WLLA 2BQRA 3SGIA 2HVQA 2R8JA 4TWKA 1IVSA 4Q0YA 5D5QA 5CA0A 4JGSA 2QTSA 3E8BA 3LDDA 1Y14B 3N2GB 2YXYA 5IJ9B 4J41A 5A2QN 2W7PA 3E8HA 4O4IA 2OCHA 4JI3B 3SYAA 4J42A 2UUCO 2HJWA 4MV4A 1IBKO 1ZL8B 2NN4A 3ZJZA 5J9PC 4U6PA 2ALZA 2JA5G 2YIDA 3FKIA 4LFBH 2C22A 4UVBA 1HR0B 3OMNB 1YJWV 3WG7B 1CEZA 1OWTA 4MVZA
chains in the Genus database with same CATH topology
3RGZA 2F93B 2BTOA 4IIJB 2P5OA 3BABA 1Q43A 2Q7EA 2XIGA 3BPZA 1WNSA 3L2PA 4CS3A 4O4JB 4CH5A 5J2UA 1NT2B 3QWUA 4LF5B 2YI8A 1M5IA 4O2BB 3WB1A 4RB3C 4DR1H 3K57A 5FD5A 1SKVA 4B08A 3A2FA 3K5OA 5IWAH 5C8YA 3L4JA 1S68A 1O9HA 5ITZA 5J2TB 1B04A 2PYJA 1TGOA 1SA0A 4K0KH 4X65B 2HIVA 5JVDB 2YIAA 3C0FB 2UUAH 3JALA 3SJBC 5K1XA 1I7FA 5CB4A 3CVZA 3RTXA 3TY9A 5LMUH 2JS5A 4DRXB 4LH6A 5JQGB 1IBLB 4JV5H 2ZNJA 2EX3A 4LF4H 4X1KA 5EIBC 3J80W 1N32H 2PY5A 1XNQB 4IIJA 2P22C 2ZM6B 3MAQA 2YIBA 1I94B 2UXCH 1J5EB 1ZHQA 2RJZA 4JI7B 3IAYA 4TUYA 1AN7A 4AHCA 2UUBH 4O2BA 2YI9A 4AQYH 4NXMB 4LF7H 2KSWA 1HNWH 3JSLA 3RYFA 4PDBA 4O2AA 4TQFA 1G6UA 4J0MA 1FFXB 4YY3H 1SYXB 5J2TA 4RB2C 5JH7A 3JAWA 1L2ZA 1M93A 4GLXA 1TA8A 4UCOA 2F4VB 3N6XA 2E5LB 5JVDA 2ZJTA 4RAZA 4JI0B 4I50B 1A0IA 4DV6B 4HNAB 4ZIBA 3U10A 4DRXA 5GONB 5EYPA 2OYQA 4B3RB 5JQGA 4GKJB 4LNUA 2CW8A 1IBMB 3H20A 1N33H 5FPRA 3RGXA 3ZS8C 1HNZH 3GB8B 4DUZB 2KKWA 4Q6GA 3RIZA 4GYCB 4DV4B 2F66C 3VQVA 4EEQA 2YCHA 4NVPA 2QJ1A 2VOBA 4X62B 4RZQA 5A2QW 4DV3H 1Z2NX 4DR4B 2IM9A 4BWSC 1CKNA 4NXNH 2OWOA 5LXTB 3BRCA 4YHHB 4LFAB 3S24A 3UT5B 1FFXA 2UXBH 4LF9B 4O4HB 4I9QA 3NBZB 4I50A 2Q7GA 4JI8B 2O03A 3J7AK 4AILC 3UQ8A 5GONA 4PI0A 4CC5A 2JVDA 2CW7A 3E22B 4DR2B 4CH3A 1N36H 1O75A 4CH6A 1JMKC 5C8YB 4A2BA 1XMOB 4JI5H 5ITZB 1SA0B 4EFBA 4RB1A 1Z5VA 1FVIA 2HVSA 5LMNH 3JALB 3RFRA 3T1YH 1Z2OX 4CH4A 4WBNA 1P16A 2WYOA 3F8NA 4MV9A 4OX9H 4B3SB 2FE3A 2RQ6A 1H2SB 4B3TH 2JGUA 3BA8A 4UCRA 1I94H 1J5EH 2ZINA 1ZAUA 2UXDH 3UT5A 4FLVA 5KHIA 4DV0H 4TV8A 3GDEA 4FLTA 3KAJA 4DV7B 4O4HA 5JCOA 4MTDA 4LFCB 4DUYH 4FFBA 4LF8H 3BA9A 2ZIMA 1M4UA 4DV5B 4TUYB 4RAYA 2E3CA 4FLXA 3E22A 1FJGB 1Z2PX 2R9AA 3IG0A 4FLWA 3RYFB 5KHGA 5FLXW 4O2AB 1XI1A 5FPOA 4ZHQB 4D7SA 5JH7B 3JAWB 5JCOC 3JASA 1BGWA 2XHBA 2UU9H 1CKOA 1KMIZ 1P8LA 1GYFA 2HGSA 3KALA 4DRFA 1N34B 4X66H 5EYPB 3GJXB 3RWRD 3ETQA 4DR3H 4LF6B 3HKDA 4LNUB 3SR2C 3WB0A 4DR7H 4UFZA 4I7HA 3THOA 4PHZA 5CA1A 1XQ8A 3NBYB 5IT9W 2HIXA 3TY8A 4DR6B 4X62H 4DR5H 1M0WA 4MTEA 4X1IB 3HKCA 4FLZA 4YHHH 3HKBB 4JI1B 3N2KB 1HNXB 1FKAH 4DK0A 1KU9A 4KHPH 1CKNB 4I55B 2VQFB 4M7EA 2ZNIA 4ZHQA 5LA6A 3N43B 4DV1B 3FFQA 4CS4A 4DV2H 4LFBB 1P49A 5KX5A 3T1HB 3CB2A 1VS0A 2Q2UA 4MV7A 4F6RA 5KMGA 4B3MH 3N40P 4E6NA 3BAAA 3HKEB 5EOYA 2UUCH 4LMYA 3JARB 1TUBB 1IBKH 1XMQH 4JI3H 3JAKA 2CFMA 1WN7A 3L4KA 1JFFB 2VQEH 1HR0H 4X1IA 3RYIA 3RYHB 3HKBA 4WBNB 5IWAB 3KYHC 1QQCA 3N2KA 2PZSA 2VPSA 4K0KB 4I55A 1E4FT 4JI2B 3NC0B 3K58A 4TV8B 2ZCEA 1WPBA 1XHZA 4LF5H 5LP6B 4EB6B 4A2AA 4CC6A 1FJGH 4FFBB 4JV5B 1XNRB 1QHTA 2HEPA 2HHHB 3OTOB 5FNVB 1N32B 3RYCB 3K5LA 4FM2A 2YXLA 4I4TA 3DSQA 2GV9A 3RR5A 4JI6B 4X65H 1S03G 2MCTA 1X9NA 3HKEA 4CS2A 1Z5WA 4UCUA 3JARA 1TUBA 5D5PA 5LOVB 4X1YA 1RSOA 5JJJB 2UUBB 1JFFA 3JASB 3OTFA 1IBLH 4AQYB 3RYHA 3BHPA 3CHXA 3JSNA 1XNQH 2ZM6H 1TVKB 4YY3B 3QTCA 4FM1A 2VUGA 5BR8B 2PUSA 3N44B 3HKDB 2R72A 4ZI7A 2Q0AA 3U0ZA 3DF7A 1XHXA 5CA1B 4JI7H 2YIBD 4FM9A 3RJ0A 5LP6A 4EB6A 3MWMA 1Q5OA 2V4DA 4HBNA 3K5NA 4GKKB 4R7RA 4NXMH 4LSAA 5FNVA 3B2EE 3HKCB 3RYCA 1N33B 4PZ6A 5KHJA 3EYYA 1HNZB 2RGRA 5LYJA 4X64B 4K8XA 5IYZA 2F4VH 4LH7A 2E5LH 4JI0H 2F95B 4LR3A 3W1BA 4X20B 4DV6H 5LOVA 3JAMW 3JATA 2W57A 1T5EA 5LA6B 3QG5A 3T1HH 1SQFA 4IHJA 5LP6C 5BMVB 4B3RH 4BWAA 4DV3B 3W1GA 4GKJH 3K59A 1TAEA 1IBMH 4NXNB 5KX5B 5IJ0A 1TVKA 2UXBB 2QM4A 4F6RB 5KMGB 4DUZH 4ZOLB 4TV9A 4FLUA 2Q2TA 5EZYA 1CKMA 4DV4H 3JAKB 3N2GA 5JJNB 4DR4H 2VWKA 5IJ9A 4RB0A 3RYIB 3SJAC 1N36B 4JI2H 4LFAH 4JI4B 2RGVA 4JYAB 1JJOA 4KL1A 4DK1A 4LF9H 4JI5B 4U3JA 2CAZC 3M7MX 4X20A 5D1OB 3T1YB 4APMA 5LMNB 3PN1A 2HHHH 4JI8H 3OTOH 1XNRH 4OX9B 4TQDA 3W5OA 4LSXA 1BJTA 5BMVA 3QF7A 5FD6A 4JI6H 4BW9A 4B3TB 4DR2H 3CSXA 2UXDB 1DGSA 4O4JA 1Q8IA 4DV0B 1VF7A 1XMOH 4FVMA 4I4TB 4K8ZA 4ZOLA 2PYLA 4O4LB 2BTQB 4DUYB 1I6UA 4LF8B 3K3VA 4PZ8A 1YEWA 3J81W 4X1YB 4YJ3B 4B3SH 3FMAA 2Q7HA 5KHHA 4UCSA 4D7TA 5BR8H 4DR1B 2R70A 1XK5A 3VQYA 4YJ2B 3LNNA 4DV7H 4UCVA 4UCTA 3KXYT 3VQXA 4LFCH 4GKKH 4ZI7B 2UU9B 2UUAB 5D1OA 4DV5H 4ETSA 2PTMA 1HW7A 3KAKA 3N41B 4PI2A 5LMUB 4X66B 3VNNA 5CA0B 1Q3EA 4X64H 1M0TA 4DR3B 4DR7B 4LF4B 5LL6b 3RF2A 4O4IB 1D5AA 4O4LA 3M4IA 2BTQA 5LYJB 5DISC 5EIBD 3U11A 4PZ7A 5IYZB 2UXCB 1S5JA 1XDNA 4DR5B 2F1MA 2VWJA 2WDTA 5D1PA 4YJ3A 3JATB 5JJEB 1E4GT 3N42B 3SJCC 4IHJB 3HXLA 1N34H 3LMLA 4LF6H 4EQ5A 4LF7B 1WH2A 1HNWB 4KHPB 2PGGA 4YJ2A 1ZHSA 2HVRA 5IJ0B 5J2UB 3RGBA 4FM0A 4HNAA 3K5MA 4DR6H 4TV9B 4DV2B 3WB2A 3TY5A 1SEIA 5EZYB 3SGIA 2HVQA 1V9PA 4TOIA 2WE6A 1L8DA 5KHKA 4JI4H 3VQWA 4Q0YA 4JI1H 4JYAH 5D5QA 5CA0A 1O9GA 4B3MB 4L8JA 1HNXH 3N2GB 4IAJA 4EFEA 5IJ9B 4FLYA 1MZBA 3ZEDA 2VQFH 1SQGA 1X4TA 2UUCB 1IBKB 4O4IA 1XMQB 4JI3B 5CB4B 2ZIOA 4DV1H 3ICXA 4U3JB 4LFBH 2VQEB 1HR0B 5LXTA 5K1PA 4X1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA B;  3UQ8 A;  4JI5 B;  3BAB A;  2CFM A;  4CC5 A;  4DR2 B;  3L2P A;  5D1O B;  3T1Y B;  5LMN B;  3PN1 A;  4OX9 B;  3W5O A;  5IWA B;  1XMO B;  3QWU A;  4LF5 B;  3KYH C;  4B3T B;  4EFB A;  4K0K B;  2HVS A;  1FVI A;  2UXD B;  1DGS A;  4JI2 B;  1P16 A;  3NC0 B;  4DV0 B;  1S68 A;  4B3S B;  1B04 A;  4CC6 A;  4X65 B;  4UCR A;  3BA8 A;  4DUY B;  2HIV A;  4JV5 B;  1ZAU A;  4LF8 B;  1XNR B;  2HHH B;  3OTO B;  4PZ8 A;  1N32 B;  3GDE A;  4DV7 B;  3RTX A;  3RR5 A;  3TY9 A;  4UCS A;  4JI6 B;  4LFC B;  4DR1 B;  4LH6 A;  1IBL B;  1X9N A;  1XK5 A;  3BA9 A;  4UCU A;  4DV5 B;  1XNQ B;  2ZM6 B;  4UCV A;  4UCT A;  2UUB B;  1I94 B;  1FJG B;  1J5E B;  4AQY B;  2UU9 B;  2UUA B;  5D1O A;  4JI7 B;  3JSN A;  5FPO A;  4YY3 B;  5LMU B;  4X66 B;  2VUG A;  3VNN A;  5BR8 B;  4DR3 B;  1CKO A;  4NXM B;  4DR7 B;  4LF4 B;  1P8L A;  3JSL A;  4DRF A;  1N34 B;  5DIS C;  4PZ7 A;  3GJX B;  4GLX A;  2F4V B;  1TA8 A;  4UCO A;  4GKK B;  4LF6 B;  2E5L B;  2UXC B;  1XDN A;  4DR5 B;  4JI0 B;  4UFZ A;  1A0I A;  4DV6 B;  4PZ6 A;  1N33 B;  5D1P A;  3NBY B;  2HIX A;  1HNZ B;  3TY8 A;  4X64 B;  4DR6 B;  4B3R B;  4LH7 A;  4GKJ B;  4EQ5 A;  4LF7 B;  1HNW B;  4KHP B;  1IBM B;  3W1B A;  5FPR A;  2HVR A;  3GB8 B;  4JI1 B;  4DUZ B;  1HNX B;  4DV3 B;  3W1G A;  4DV2 B;  3TY5 A;  1TAE A;  1CKN B;  3SGI A;  2VQF B;  4NXN B;  2HVQ A;  4DV4 B;  1V9P A;  4TOI A;  4EEQ A;  2UXB B;  4B3M B;  4X62 B;  4DV1 B;  4DR4 B;  4EFE A;  2Q2T A;  4LFB B;  1CKN A;  2OWO A;  1CKM A;  4YHH B;  4LFA B;  2UUC B;  3S24 A;  3T1H B;  1IBK B;  1VS0 A;  1XMQ B;  4JI3 B;  2Q2U A;  4LF9 B;  4E6N A;  3NBZ B;  3BAA A;  2VQE B;  1HR0 B;  4JI8 B;  1N36 B;  4JI4 B; 
#chains in the Genus database with same CATH topology
 1MNG A;  2VQE O;  2P67 A;  2OCC B;  3KHL A;  4J7K A;  2E75 B;  3BAB A;  3KCX A;  1QBZ A;  2HGW A;  2XIG A;  2Q7E A;  1T3N A;  1PNK A;  3WWJ A;  4CS3 A;  2JEF A;  3F7V C;  3KRE A;  2YI8 A;  1Q90 D;  3ABL C;  3RB3 A;  1M5I A;  1ZLZ A;  1M56 C;  3WB1 A;  4ECU A;  3K57 A;  1SKV A;  3K5O A;  4QJF B;  4QGP A;  3JD3 A;  4I9W A;  1DF4 A;  5KFI A;  2PYJ A;  1SA0 A;  4K0K H;  3C0F B;  5K1X A;  4MS2 A;  1I7F A;  3CVZ A;  2XTA A;  1VQ9 V;  1AI4 A;  1EN4 A;  2ATK C;  4P9O A;  5LMU H;  3TK1 A;  4MTO A;  5C4X G;  5JQG B;  1IBL B;  3OSP A;  4LF4 H;  4X1K A;  2Y4R A;  2YEV B;  3GB7 C;  2PY5 A;  4RO2 A;  1QR9 A;  1GAX A;  2UXC H;  1J5E B;  1ZHQ A;  3CWB H;  2DWE C;  3LDE A;  2FLN A;  2X0L A;  3GTK A;  1AN7 A;  5C3E G;  3Q4H A;  2FKL A;  1JPX A;  2FKX A;  3CJH A;  5KFO A;  2KSW A;  5KG6 A;  1HNW H;  3JSL A;  2XC9 A;  1Z2G A;  3AG4 C;  1FYJ A;  1FFX B;  4I5S A;  4YY3 H;  5J2T A;  1NR7 A;  2IJI A;  3F7Y C;  1L2Z A;  4UCO A;  1YIJ V;  2E5L B;  5JVD A;  2ZJT A;  4MVO A;  3CEB A;  4JTC B;  4DV6 O;  1KP3 A;  4HNA B;  1N0N A;  3U10 A;  3GID A;  3ETG A;  5EYP A;  4B3R B;  3U0G A;  2R82 A;  3GTG A;  3N27 A;  3JCZ A;  2Y48 A;  4JV2 A;  1IBM B;  2OTJ V;  1N33 H;  1YTF D;  4MVQ A;  2R7N A;  3ZMV A;  1HNZ H;  4K35 A;  3O65 A;  2XUM A;  4DUZ O;  1YDX A;  4F4Z A;  1EUC B;  4A3M G;  3PO3 G;  3AK1 A;  4DV4 B;  1NVP B;  5CBF A;  1E4E A;  2R8I A;  4DV3 H;  3JCU Z;  1YJN V;  1PKX A;  4DR4 B;  4NTX A;  1CKN A;  1ROP A;  1RM1 C;  3KG2 A;  2FL4 A;  2ZD9 A;  3UT5 B;  4YXW G;  3ABK B;  2UXB H;  2DYS C;  4LFA O;  1TUE B;  3JD4 A;  3VPB A;  1WP8 A;  4A3E G;  4OXS A;  4MV1 A;  3AK2 A;  4LF9 O;  3JRW A;  5KS8 A;  4MTG A;  4I50 A;  1M1K W;  4IRC A;  4X8A A;  3SYQ A;  1UJW B;  3CCE V;  1PX2 A;  3T99 A;  4JI8 O;  2QF7 A;  3JD1 A;  1F4N A;  2QA4 V;  2CW7 A;  2NU6 B;  2ARH A;  3J81 N;  4O84 A;  1I1L A;  2XGQ A;  3CC7 V;  1JA8 A;  3TJT A;  4PA7 A;  1EZJ A;  2CNQ A;  3I55 V;  1SA0 B;  2HVS A;  1Z2O X;  3F8N A;  4OX9 H;  2W9C A;  4MV8 A;  4EYI B;  2FE3 A;  5FLM G;  1QLE C;  2JGU A;  3BA8 A;  2GSM B;  4UCR A;  1I94 H;  1K3E A;  2UXD H;  5BR8 O;  2FLL A;  5KFM A;  1R73 A;  4Z2W A;  4DV7 B;  1G4Y B;  5LGU A;  3MD0 A;  1VQ4 V;  5IYB G;  1JX9 A;  4LF8 H;  2R9I A;  4YB8 B;  5H6R A;  3STZ C;  4DV5 O;  4RAY A;  1AI5 A;  3Q4H B;  2CTR A;  1EM1 A;  3L72 H;  3E22 A;  1VQP V;  1FJG B;  1Z2P X;  4X64 O;  2CTQ A;  4FLW A;  2A9H A;  4PBC A;  5KHG A;  1M6V A;  5FLX W;  1VQM V;  5DLG A;  4ZI7 F;  4W4L A;  1AVM A;  2K9P A;  1JVM A;  3QNE A;  3WO1 A;  4PA6 A;  2IJK A;  5B3S C;  2HGS A;  2B5U A;  1WCM G;  4X66 H;  4ECR A;  4C7U A;  5EYP B;  3GJX B;  3FB7 C;  3KKY A;  5KA6 A;  3HKD A;  4GC6 A;  4DR7 H;  2W8K A;  2UXN A;  1VQN V;  4PA3 A;  3K9S A;  3G8C A;  4MV3 A;  4PD4 F;  3NGD A;  3R23 A;  5IYZ F;  3EVK A;  4DR6 B;  5HNE A;  4X62 H;  1V54 B;  4DR5 H;  2HVJ C;  5L3G A;  3HKC A;  3ASN C;  2ASL A;  5HFL A;  1B3Q A;  1E4E B;  4JI1 B;  4JI4 O;  2R85 A;  3EPI A;  1FKA H;  1R6K A;  1UC9 A;  1CKN B;  2R6F A;  3TCU A;  5J2U F;  4G3I A;  3R5F A;  2ASD A;  3QO8 A;  5GTI Z;  3FYE B;  2ZDI A;  4DV1 B;  4NZN A;  4DV2 H;  2Z3Y A;  4IYI A;  3AG2 C;  4ED3 A;  5KFX A;  1RJQ A;  4IZO A;  1TWC A;  3CB2 A;  2LQT A;  4MV7 A;  1ZX3 A;  2BSK A;  2GLT A;  1Y74 A;  4E6N A;  1N56 A;  3HKE B;  2AHY A;  3ZRW A;  5CB4 F;  3CXH F;  4H13 B;  1EYZ A;  1IZ3 A;  4JI3 H;  2C00 A;  2ASJ A;  3SPC A;  4DIM A;  5C1O A;  3JAK A;  5KT2 A;  2I87 A;  4UB6 Z;  1JFF B;  1S5L Z;  1WA8 B;  1HR0 H;  4X1I A;  3RYI A;  2PI4 A;  4IIJ F;  5IYC G;  4IR9 A;  2XOK G;  2A7W A;  4LBE C;  2W9B A;  2FK1 A;  2IU3 A;  3VPC A;  4JI2 O;  4JTA B;  4A3I G;  5LP6 B;  4EB6 B;  4IR1 A;  2NLJ C;  1F4M A;  5DGB A;  5B1A B;  5KFY A;  1XNR B;  3L71 H;  2HEP A;  4WCE V;  3OTO B;  2R86 A;  4YBZ B;  2BQ3 A;  2DQ3 A;  4RNO A;  3K5L A;  4Q4D A;  1BHA A;  2GV9 A;  4O81 A;  2Z04 A;  1W93 A;  4JI6 B;  3SYP A;  1KUT A;  1G2W A;  2QM7 A;  4FGR A;  1S03 G;  1X9N A;  4MVM A;  1QNM A;  1UNN C;  3JAR A;  5D5P A;  4X1Y A;  5JWP A;  2WAQ A;  3ABT A;  3CXC U;  3K03 A;  2YWV A;  1YCI A;  1IBL H;  2UUB O;  5B66 Z;  4AQY O;  3NXS A;  1VF6 C;  3UO3 A;  2IJJ A;  3H40 A;  3HKD B;  2WB1 A;  2R72 A;  4ZI7 A;  2CGO A;  4NTW A;  2PBZ A;  2IBK A;  3DF7 A;  4RUE A;  1S77 D;  4Q43 A;  4H37 A;  4FM9 A;  3H1I H;  3RJ0 A;  1Q6H A;  1EBO A;  4WFB V;  2C2A A;  4HBN A;  2YRW A;  3OM3 B;  4LSA A;  3B2E E;  1UPG A;  3HKC B;  2Q67 A;  4ICG A;  3EYY A;  1IX9 A;  5BWU A;  3GIM A;  4R50 A;  5IYZ A;  1SCU B;  5KT3 A;  3CRM A;  2E5L H;  3GWO A;  5FJ8 G;  3W1B A;  2PI5 A;  5LOV A;  3JAT A;  2W57 A;  1T5E A;  2XAQ A;  3R5H A;  3T1H H;  3B77 A;  4B3R H;  5BWV A;  2XD4 A;  3ZBH A;  1IBM H;  3MFI A;  3GTL A;  2V9W A;  4NXN B;  1A0G A;  3LSU A;  4QWB A;  1TVK A;  3J7A U;  1AI6 A;  2BSK B;  2W70 A;  1Y74 B;  3RAX A;  3UCS C;  1GN4 A;  3KHR A;  1NS1 A;  4DV4 H;  3ZRW B;  2I80 A;  5IYB O;  2L6L A;  2RDJ A;  1HWY A;  3JAK B;  5F9N A;  5B1B B;  5A9G A;  5JJN B;  4DR4 H;  3GTJ A;  2BOB C;  3RYI B;  3RVY A;  4P2Z A;  1JQ0 A;  2M6Y A;  2RGV A;  4O4H F;  1N36 O;  2XAF A;  4G28 B;  4JI5 B;  5L9X A;  4U3J A;  1BL8 A;  4BIZ A;  2W9B B;  4X20 A;  1H2L A;  1S9F A;  4DXW A;  3GQC A;  2JEU A;  3T1Y O;  3QQM A;  5LMN O;  4LSX A;  2NVX A;  2YDE A;  4IWX A;  3VA7 A;  5BMV A;  3QF7 A;  4BW9 A;  2DWD C;  4B3T B;  1ZQ7 A;  4TM5 A;  4GLW A;  4HAM A;  1EN6 A;  2QK4 A;  1VF7 A;  3ETH A;  3M9M B;  5KKN B;  4QW9 A;  4K8Z A;  1BZK A;  3ORR A;  3ML0 A;  3V4S A;  3EXA A;  4DUY B;  4A3J G;  1XL6 A;  4PZ8 A;  1YEW A;  1IOW A;  1B6S A;  3J81 W;  2ZQM A;  4X1Y B;  3R66 A;  3I12 A;  4FBU A;  3FMA A;  2Q7H A;  4UCS A;  4D7T A;  1NVP D;  2DZD A;  5CAE B;  5KFC A;  4RZR A;  2R70 A;  1OCO B;  3LNN A;  3N8D A;  4DV7 H;  1VQ8 V;  4UCV A;  4FS1 A;  3CRA A;  4RQF A;  4EG0 A;  2KG7 A;  5IT9 N;  4ZI7 B;  2XAJ A;  3ETE A;  3ZHS A;  2UUA O;  3OUU A;  1R3J C;  3UKM A;  4O86 A;  3H3V H;  4QWD A;  5LMU B;  1Q3E A;  2CTP A;  4LF4 B;  5LL6 b;  4ZHQ F;  1SQP H;  4MW3 A;  4O7Y A;  2NU8 B;  4B7K A;  1D5A A;  4O4L A;  2LP7 A;  5IYZ B;  1V4Y A;  3G6V A;  1XL4 A;  2UXC B;  1S5J A;  4RAI A;  2F1M A;  2F23 A;  5JQW A;  3N42 B;  3JAT B;  1KBH A;  3HXL A;  4YP3 A;  2EIL B;  3B8N A;  3LML A;  3APQ A;  1Y67 A;  5DGA A;  3ZX6 A;  3ZMZ A;  3U54 A;  3JYC A;  1IUR A;  1HNW B;  4KHP B;  1ZHS A;  3OD4 A;  2RDI A;  4ECW A;  5C44 G;  3EFF K;  5J2U B;  1JOY A;  4O3S A;  4M9U A;  2J6T A;  4DR6 H;  4ECZ A;  3E5N A;  3QO5 A;  5C1P A;  4U7C A;  1S76 D;  3OFN G;  2Y0P A;  2ZR3 A;  2WE6 A;  2WAQ E;  5KHK A;  3CS5 A;  1GM8 A;  4JI1 H;  2OIE A;  4JYA H;  4B3M B;  3T4D A;  3GV5 B;  4L8J A;  2JGD A;  3HPL C;  2GUZ B;  5KFL A;  4I55 F;  4GCZ A;  4FLY A;  1MZB A;  3CCU V;  4B7E A;  5KT4 A;  4RUF A;  4RU9 A;  1XMQ B;  3CYO A;  1FXK A;  3RVZ A;  5CB4 B;  4DV1 H;  3ICX A;  4U3J B;  1COW G;  2AGA A;  1ZWI C;  3BQ1 A;  3UM7 A;  3CME V;  4IIJ B;  1I0H A;  2N74 A;  1XBL A;  1QCE A;  1WNS A;  1IXB A;  2FYU H;  3L2P A;  4CH5 A;  3H1L H;  4A3C G;  1K92 A;  3QWU A;  4ED1 A;  1H2N A;  4LF5 O;  2QDO A;  1NI8 A;  4RB3 C;  2YIC A;  1SET A;  3D36 A;  5FD5 A;  3QZ7 A;  1EHI A;  2EZO A;  1M57 B;  1FJG O;  1TWA A;  3SDL A;  2WLJ A;  1B04 A;  1H8E G;  3T9E A;  4X65 B;  2HIV A;  3TXQ A;  3JAL A;  2D2C B;  4UXN A;  1ZL8 A;  3RTX A;  2JS5 A;  4DRX B;  2EIY A;  5DGI A;  2EIK C;  5BXZ A;  5EIB C;  3J80 W;  1KJ8 A;  1XNQ B;  2ZM6 B;  4F50 A;  1KEC A;  1BSM A;  4IT5 A;  3LUL A;  1I94 B;  2RJZ A;  4EBD A;  2PF4 E;  4JI7 B;  2ATL A;  3TXS A;  3IAY A;  4LP8 A;  4AHC A;  2ZKO A;  3A8T A;  5FLX N;  5DLF A;  4LF7 H;  5DG8 A;  2YC0 A;  4NXM O;  3IC9 A;  2COI A;  2C28 A;  4J0M A;  1SYX B;  5KFF A;  2VUM A;  3JAW A;  1M93 A;  1HP8 A;  4GLX A;  2F4V B;  5CA1 F;  4JI0 B;  4FBT A;  2PMZ E;  3MHH C;  2HP8 A;  1AUX A;  3CRC A;  4LWS A;  5GON B;  2WAM A;  3LDC A;  4QE9 A;  5FL7 G;  1QLE B;  5JQG A;  4GKJ B;  1SFO A;  2R92 G;  2CW8 A;  3K06 A;  4FPP A;  1QVG U;  3H9V A;  1QU7 A;  4Y8V B;  1ENV A;  3RGX A;  2EJ7 A;  1MZE A;  1WLE A;  1KJQ A;  1BT8 A;  2KKW A;  2JGD B;  2ZDI C;  2GDS A;  3AG7 A;  4GYC B;  4WHX A;  3T5L A;  5D8D A;  3MR2 A;  3VQV A;  4EEQ A;  4NVP A;  3R5X A;  1AR1 B;  4X62 B;  3RAQ A;  2DIK A;  3Q8R B;  3Q8S B;  2FPI B;  5KX5 F;  4DL3 A;  4J10 A;  2ZGI A;  4NXN H;  2HVK C;  4QIW E;  1IYD A;  2WTF A;  1FFX A;  4ZOL F;  2V4R A;  5IDJ A;  4O4H B;  4EKW A;  3DGE A;  1WSC A;  5BY1 A;  3HKZ E;  2JA6 A;  4O7Z A;  4DL5 A;  1XNR O;  4ECX A;  3OTO O;  3UQ8 A;  2GTA A;  1K5S A;  2JA8 G;  2QM8 A;  1H38 A;  2JVD A;  4PDL A;  1J95 A;  2N04 A;  4FZ0 A;  4JI6 O;  4DR2 O;  4OGQ B;  4GZR B;  4CH6 A;  1K97 A;  1XMO B;  1IXM A;  2HHF A;  1IDS A;  4JI5 H;  2FPG B;  4IRD A;  2QR4 A;  4ABM A;  1MMM A;  3L70 H;  1KJI A;  1FVI A;  3JAL B;  3RFR A;  2CUG A;  1VIB A;  1JX4 A;  1PP9 H;  1QLN A;  2E76 B;  2RQ6 A;  4JYC A;  1H2S B;  5L1I A;  4O3R A;  4NZM A;  4B3S O;  3MWE A;  2QYZ A;  4B3T H;  4CE5 A;  1GN3 A;  1OCZ C;  4FFM A;  1ZAU A;  3UT5 A;  1SER A;  4I4T F;  2B63 G;  5JCO A;  1L1F A;  5FR9 A;  4LFC B;  4DUY H;  2EZP A;  1R3L C;  3BA9 A;  4ED7 A;  4ECQ A;  1M4U A;  4F4X A;  1NTM H;  4F4W A;  3CCL V;  3H0G G;  1S0M A;  4EBC A;  3OHA A;  5BPH A;  4R7C A;  5BWR A;  1LR1 A;  2Q73 A;  4ZHQ B;  1S72 V;  3NUA A;  4FJC C;  5GW7 A;  4D7S A;  3JAW B;  1H8H G;  3RB4 A;  1CKO A;  2F43 G;  4A3K G;  2QKC A;  5LP6 F;  3BCC H;  3KAL A;  4DRF A;  1OCC B;  4TT3 G;  3ORQ A;  2CH7 B;  4LWS B;  1KTA A;  2FP4 B;  3RWR D;  1N34 O;  3SR2 C;  3WB0 A;  2LO1 A;  4LF6 O;  1WAZ A;  1K4D C;  5CA1 A;  1XQ8 A;  5IT9 W;  3AG1 B;  1GLV A;  2HIX A;  3ZHV A;  4XX0 B;  1BHB A;  3HKB B;  1CS0 A;  1VMG A;  1KC7 A;  1HNX B;  4DK0 A;  4C5B A;  5H5N A;  1LUW A;  5B1N A;  4KHP H;  1AIL A;  4I55 B;  2VQF B;  1JR9 A;  3X2Q C;  1JCH A;  3MJF A;  1AR5 A;  2YS7 A;  3JZI A;  2OH2 A;  3HOW G;  3FB5 C;  3CSW A;  5EZY F;  4DAA A;  3GTP A;  5E25 A;  3LP8 A;  4LFB O;  5KX5 A;  3T1H B;  2ZXW B;  4A3F G;  1VS0 A;  4F6R A;  5KMG A;  4B3M H;  3AK3 A;  4JXU A;  3BAA A;  3AYH B;  4J80 A;  2DQ0 A;  1A9X A;  1US6 A;  4LMY A;  1TUB B;  2HHF B;  5KFR A;  1XMQ H;  1Q86 W;  4GC7 A;  2YSU B;  1WN7 A;  4DL6 A;  4WF9 V;  3CCR V;  5H2F Z;  1AB3 A;  1NH2 B;  4UVC A;  1RYS A;  5IWA B;  1AUV A;  3KYH C;  1M9N A;  1QQC A;  3K9A A;  5LGN A;  4JAA A;  2CZG A;  3ZHT A;  2W6P A;  2JA7 A;  3RBD A;  1E4F T;  5KFE A;  4K0K O;  2ITD C;  3K58 A;  1XHZ A;  2ZCE A;  4PDV A;  4O2B F;  4IRK A;  3L73 H;  3AG3 B;  4TQR A;  1BS3 A;  3D8C A;  4JV5 B;  2DPJ A;  2IJH A;  2AGP A;  2X6A A;  1N32 B;  3E8G A;  4LF4 O;  2YXL A;  4I4T A;  2ABJ A;  2RDC A;  3RR5 A;  4X65 H;  3AW8 A;  2MCT A;  3HKE A;  4CS2 A;  2M05 A;  2IMW P;  1Z5W A;  3A0H Z;  2UXC O;  3IN5 A;  1W59 A;  2GQR A;  3BEH A;  2FK2 A;  2W8L A;  1VQO V;  2DYR B;  3A0R A;  3K04 A;  5I5W A;  1JFF A;  1VQL V;  2LGW A;  1RFY A;  2DMX A;  5BYB A;  1WA8 A;  4YR2 A;  5E79 Z;  3BHP A;  3OT7 A;  2MK3 A;  3JSN A;  1HNW O;  1XNQ H;  4BXX G;  2ZM6 H;  2ADQ B;  4DQN A;  5L1K A;  2FPP B;  2R7Z G;  4YY3 O;  1GN2 A;  2Q0A A;  1SZX A;  4MTX A;  5CA1 B;  2XGP A;  4JI7 H;  1THZ A;  1S3J A;  2VR1 A;  1GMG A;  5LP6 A;  4EB6 A;  1VQK V;  3H1K H;  4P30 A;  5KFP A;  3K5N A;  1SF9 A;  3RB0 A;  1A32 A;  2EIN B;  4FFK A;  3CP1 A;  4E4T A;  2NNU A;  1N33 O;  5KAI Z;  4O7W A;  4YAK B;  2RGR A;  4K8X A;  2KQX A;  1GM9 A;  3DXR A;  2YUA A;  1YSC A;  4Z1M G;  1HNZ O;  5I47 A;  2FK3 A;  1R9T A;  2F4V H;  1FPO A;  1C30 A;  4JI0 H;  5IY5 B;  2Y69 C;  3AX6 A;  3CRR A;  1SQF A;  2V1D A;  2Z02 A;  1KUQ A;  5KT7 A;  3W1G A;  4GKJ H;  3K59 A;  4DV3 O;  1W0K G;  1S0V A;  5KX5 B;  4C2M A;  5CE8 A;  2UVR A;  2N05 A;  2QM4 A;  4F6R B;  5KMG B;  4ZOL B;  1Y1V G;  1FXK C;  1WB7 A;  3MHS C;  1YIT V;  2UXB O;  2Q2T A;  2EIM B;  1WB8 A;  2ILM A;  5EZY A;  1UC8 A;  1B06 A;  1NTK H;  2V4Q A;  5HBR B;  2OTL V;  2JJ1 G;  3BY6 A;  5LXT F;  2B9Z A;  3UFX B;  1KD1 W;  1PL4 A;  4JI2 H;  2A3Q A;  3T2M A;  4YR3 A;  3HOY G;  3ZN1 A;  4JYA B;  1PD3 A;  2Z5U A;  1ORQ C;  4H44 B;  2KSD A;  2HLD G;  4APM A;  3PN1 A;  2HHH H;  3D36 C;  3SPG A;  4YR0 A;  1AR4 A;  3K3P A;  1R3I C;  1GO3 E;  4OX9 O;  5KFN A;  2W0F C;  4A5U B;  3W7U A;  5FD6 A;  4A3B G;  5KFG A;  4L87 A;  1AJN A;  2XAS A;  5C8Y F;  4WFE A;  1GKF A;  3L74 H;  1Q8I A;  3ZMT A;  4DV0 B;  2UXD O;  1XMO H;  4I4T B;  4FE2 A;  4XBF A;  1NJI W;  2BTQ B;  1Y1W A;  3R9R A;  3RBE A;  1URF A;  3FAV A;  2I8C A;  1S5H C;  2AGQ A;  5EWF A;  3WG7 C;  4J9S A;  4LF8 O;  5L3B A;  3ZHQ A;  2OCC C;  2KB1 A;  3FKI G;  5KHH A;  5I5S A;  3M9O B;  3APO A;  2BQU A;  1XK5 A;  3MR3 A;  5I5X A;  1A48 A;  2DPI A;  2IA6 A;  4UCT A;  4BW5 A;  3J80 N;  4LFC H;  4RUC A;  4GKK H;  4QNH B;  2UU9 B;  4A93 G;  2DW4 A;  4ETS A;  3OMA B;  2P90 A;  2PTM A;  3BG5 A;  3KAK A;  5EBM C;  4FIP C;  3T9A A;  4X66 O;  4DR3 B;  2GQS A;  3ZRS A;  4XDL A;  4DR7 O;  1K7D A;  2P6J A;  3STL C;  3M4I A;  2VQD A;  4C5C A;  3U11 A;  3DXR B;  3LQS A;  5AG2 A;  1XDN A;  4N23 A;  4WFA V;  4X62 O;  1DLB A;  4DR5 O;  2HKO A;  3KHG A;  3SJC C;  1K5Q A;  4ECY A;  1VQ6 V;  4CBC A;  1K34 A;  4XDJ A;  4LF7 B;  1WH2 A;  2EIJ B;  2IP4 A;  1FKA O;  2PGG A;  3DTU B;  2HVR A;  3ABM B;  2R93 A;  3RGB A;  3HOX G;  1YHQ V;  3C3T A;  1SEI A;  1V55 B;  5EZY B;  1BCC H;  1FXH A;  4DV2 O;  1VBG A;  2SCU B;  3SNO A;  1L8D A;  1TWF A;  2LFS A;  3VQW A;  1H2G A;  1KEE A;  1O9G A;  1RPO A;  1HNX H;  4YAJ B;  3GV8 B;  1PM9 A;  1WJZ A;  4LC1 A;  4IAJ A;  3BQ0 A;  4J11 A;  4UB8 Z;  3ZED A;  2YL2 A;  2VQF H;  1SQG A;  2WPD G;  1X4T A;  2UUC B;  1Y76 B;  1IBK B;  4Z1V A;  1XIL A;  3W7S A;  4O3N A;  4GX2 A;  4JI3 O;  4ZKI A;  1N48 A;  2VQE B;  5LXT A;  1HR0 O;  5GON F;  2R7L A;  3RGZ A;  2BTO A;  2P5O A;  1YVW A;  5DAA A;  4WFG A;  3BPZ A;  2BR0 A;  3RW0 A;  3T9D A;  1D2D A;  1NQT A;  5J2U A;  4O7L A;  3G6E V;  1XUQ A;  4J9M A;  2DJV A;  4J9Z B;  2ZDH A;  1R1B A;  2W6I G;  4O2B B;  4DR1 H;  4WBN F;  3FB8 C;  1GSA A;  3FAV B;  4B08 A;  3A2F A;  3LUT B;  5IWA H;  2NUA B;  5C8Y A;  3L4J A;  2DN9 A;  1NZ6 A;  1O9H A;  2ZR2 A;  4FMT A;  5ITZ A;  2GUZ A;  2JEG A;  1DV1 A;  2W7O A;  1TGO A;  3WFV A;  2UUA H;  3G6Y A;  4TV8 F;  2R8G A;  2NU9 B;  5CB4 A;  5F2V O;  3OHB A;  4X89 A;  1GN6 A;  5EK0 A;  4UUG A;  3OUF A;  1TWG A;  4LH6 A;  4O7N A;  4JV5 H;  5FNV F;  2EX3 A;  4JZG A;  4NLG A;  1IBL O;  1N32 H;  4IIJ A;  2QSA A;  3MAQ A;  3VPD A;  1TWH A;  2HR3 A;  1EKP A;  1NTZ H;  3ZHU A;  1J5E O;  1JIH A;  1T94 A;  3U55 A;  2W0X A;  1PL0 A;  3H1J H;  1ARO P;  4L1K A;  4Q8E A;  4RWU A;  3JAM N;  2EJ2 A;  2Q7D A;  4JAU A;  3RYF A;  1VF5 B;  2R84 A;  4TQF A;  1XEQ A;  3TEK A;  1NH2 D;  4RB2 C;  1EKF A;  5T14 A;  1EN5 A;  3GIP A;  1TA8 A;  3OEE G;  2NU7 B;  3NR7 A;  3QVN A;  3TQT A;  1A0I A;  2JA5 A;  4DV6 B;  2E5L O;  3VBB A;  4ZIB A;  2R7K A;  4DRX A;  3T1H O;  2FB9 A;  4B3R O;  2CK3 G;  4JF3 A;  4OPA A;  1OCR B;  2WLM A;  1IBM O;  3ZS8 C;  3I4M G;  1S97 A;  3GB8 B;  3RV3 A;  4DUZ B;  3TET A;  1JLL B;  2YW2 A;  3PW2 A;  4Q6G A;  5L3D A;  4U3F H;  3GTO A;  4EGQ A;  3RIZ A;  1AJQ A;  1I3Q A;  1F51 A;  3OGC C;  2XT9 A;  5TIS Z;  4FS2 A;  1KJ9 A;  2O57 A;  4GX1 A;  4DV4 O;  3ABL B;  2VOB A;  4RZQ A;  1M56 B;  1SZT A;  2QWO B;  2HGX A;  3WU2 Z;  1Z2N X;  2W6Z A;  1AP5 A;  2IM9 A;  3GTQ A;  3V6H A;  4DR4 O;  5LXT B;  1DTO A;  5I5T A;  4LFA B;  3S24 A;  4DL4 A;  4XDK A;  2WLN A;  1QR8 A;  2RN9 A;  4LF9 B;  4F4Y A;  4ED0 A;  2C2D A;  4MTF A;  4MA5 A;  1BMF G;  3CCM V;  4I9Q A;  2YZN A;  1RK5 A;  1V54 C;  4GX5 A;  3NBZ B;  2J9G A;  2XCP A;  2Q0O C;  2Q7G A;  3M8A A;  4JI8 B;  2LW7 A;  3C90 A;  2HFE C;  5GON A;  3T4Z A;  1N4C A;  3LWB A;  4DLK A;  4PI0 A;  1VAJ A;  4CMF A;  1Q6U A;  2V7Q G;  2CNU A;  4AI8 A;  1QVF U;  3CPW U;  3GV7 B;  1JMK C;  2IU0 A;  5C8Y B;  4JAS A;  4I7Z B;  3V4Z A;  3JZF A;  5JUM A;  5ITZ B;  3Q8P B;  5B1O A;  3TIG A;  2UXX A;  4EFB A;  4MVU A;  4RB1 A;  3W7T A;  2WYO A;  2A06 H;  4CH4 A;  4WBN A;  1P16 A;  4MV9 A;  4BY1 G;  5KFB A;  1K8A W;  3GII A;  5KG1 A;  2WB1 E;  2P4V A;  3PVX A;  1OJH A;  4DW1 A;  2ZIN A;  4WFF A;  4EBE A;  3CQZ A;  1P7G A;  2Q5Z A;  4FLV A;  3AG4 B;  3T54 A;  5KHI A;  4DV0 H;  4TV8 A;  1MG1 A;  2XND G;  3GDE A;  3PR4 A;  3KAJ A;  3BFR A;  4O4H A;  5L3F A;  4DV7 O;  4ECV A;  3TW7 A;  3B40 A;  4QSH A;  1YI2 V;  5EDW A;  2ZIM A;  4YJ3 F;  3ZRX A;  4DV5 B;  4J9O A;  2CDY A;  2AZ0 A;  1ET0 A;  3ZMS A;  2Y0I A;  2W6Q A;  3OSN A;  4FLX A;  5BWT A;  3CCQ V;  4YJ2 F;  3IG0 A;  3RYF B;  3FDS A;  1XI1 A;  1MSD A;  3P30 A;  4R8U B;  5CM0 A;  1RP3 B;  4DL2 A;  3JAS A;  4KFM A;  5DED A;  1BGW A;  5B1A C;  2XHB A;  4KUM A;  1EKV A;  5L1J A;  2UU9 H;  1P8L A;  1A3G A;  1GYF A;  3G6B A;  2ZDG A;  2JEX A;  3ASO C;  3K0G A;  3CEI A;  4H0L B;  3ETQ A;  3L9D A;  4J7J A;  4DR3 H;  1RM1 B;  2CNV A;  3KZI Z;  3THO A;  3NBY B;  4O4I F;  2C35 B;  2DYS B;  5LYJ F;  3FB6 C;  2W71 A;  3T5J A;  1YZB A;  2W6M A;  2YXH A;  4X9Q A;  3KHH A;  4DR6 O;  2R87 A;  3HBL A;  1M0W A;  5KG7 A;  2FJZ A;  4RUA A;  4FLZ A;  4YHH H;  2PVP A;  3UZB A;  1YF2 A;  3N2K B;  5DG9 A;  4JI1 O;  4JYA O;  4U7N A;  4PJ0 Z;  2ZNI A;  4ZHQ A;  2QKA A;  2FB5 A;  4O82 A;  5KFW A;  1JDE A;  2DOS A;  1BQZ A;  2BCC H;  3FFQ A;  4CS4 A;  2WSS G;  4DV1 O;  5IP9 G;  1I2K A;  3G8D A;  1I7N A;  3O9O A;  1ZET A;  2CH7 A;  3N40 P;  1KC8 W;  5I60 A;  3PO2 G;  2Y4U A;  1PNL A;  1DK1 A;  2UUC H;  1H2M A;  1IBK H;  1FFT B;  1EFR G;  1VAR A;  2CFM A;  1NR1 A;  2RF4 A;  2GPW A;  4K3A A;  4CKE A;  5KFH A;  4CZZ A;  2VQE H;  3RYH B;  4TSF G;  3HKB A;  4WBN B;  3TW6 A;  4DYL A;  1RJR A;  1VEW A;  5LHI A;  4TVI A;  4N21 A;  1CQJ B;  2VPS A;  1JDB B;  2W6O A;  4ASU G;  4O4J F;  3G67 A;  4RCN A;  3BJY A;  4I55 A;  4JI2 B;  1G8M A;  1MA1 A;  4QPJ A;  4TV8 B;  1WPB A;  2EUL A;  1SC5 B;  1PK8 A;  1KYO F;  2WLH A;  5KUM A;  3DAA A;  1WCM A;  1PV0 A;  3W7X A;  1QHT A;  2HHH B;  4NYE A;  4HYO A;  5FNV B;  5B3S B;  3RBZ A;  3LSQ A;  1VF6 A;  3RYC B;  1IYE A;  5J2T F;  3WWI A;  3DSQ A;  4ECT A;  2X6C A;  3QO7 A;  5JVD F;  1HDJ A;  1JXL A;  2AU0 A;  4BIU A;  4X88 A;  2V58 A;  1TUB A;  1Y4M A;  3T5K A;  3Q1K A;  3T7A A;  3D3I A;  1GH6 A;  2UUB B;  3JAS B;  3OTF A;  3EHB B;  5KUK A;  2V5A A;  1OHH G;  4AQY B;  1ZUQ A;  1P4R A;  3CHX A;  3ASN B;  2DWC A;  4O3P A;  3GIK A;  1P84 F;  5GTH Z;  1G1X B;  4FM1 A;  2VUG A;  1FAF A;  3DTG A;  3U0Z A;  3GWK C;  2CTW A;  3FYI B;  1XHX A;  3L75 H;  2XCL A;  2YIB D;  4BR6 A;  2V4D A;  5I5Y A;  4GKK B;  2AGO A;  3LNM B;  1K33 A;  4JZ2 A;  5KFS A;  3PW7 A;  3AG2 B;  1GSO A;  2P7T C;  1OCO C;  3I5D A;  2XAH A;  3B09 A;  1WRV A;  5LYJ A;  4I50 F;  4JYB A;  3RUP A;  2F95 B;  2JIZ G;  4GUN A;  4DV6 H;  4NR1 A;  4HN2 A;  2W6J G;  3JAM W;  1CP9 A;  2CGN A;  3ZN0 A;  3QG5 A;  4J7Z A;  5EBL C;  2WLK A;  1SQV H;  3DTF A;  5KFJ A;  2PN1 A;  1TAE A;  2R7M A;  2E2H A;  1FS0 G;  2ZE7 A;  3IC7 A;  4NXN O;  2ODM A;  4DUZ H;  3PW5 A;  4A3D G;  4D6T H;  1B33 N;  4HNT A;  1N0J A;  5DQH A;  2HJF C;  3SYO A;  1X59 A;  4M0J A;  5KG5 A;  2OIG A;  1LUV A;  1KQS U;  2P0A A;  4IGG A;  3OGI B;  4MVS A;  2EIL C;  2CE4 A;  3CCJ V;  1JKJ B;  4RB0 A;  4LFA H;  2QWQ B;  1N36 B;  4MAM A;  2A1H A;  4G2K A;  3F5T A;  1JJO A;  4DK1 A;  2QEX V;  3K08 A;  4NZO A;  2QB5 A;  2OLS A;  5KFA A;  4ED6 A;  3HT5 A;  2CAZ C;  2P4K A;  4JI5 O;  4UV9 A;  3M7M X;  1B6R A;  2LGQ A;  4BAY A;  3T1Y B;  5D1O B;  5LMN B;  3AEI A;  4JI8 H;  2HJD A;  4YIO A;  3CSX A;  1GGO A;  4B3T O;  1DGS A;  4O4J A;  3P3P A;  5CR5 A;  4J9P A;  4PEL A;  1R6T A;  4ZOL A;  3CCV V;  3CC4 V;  3K3V A;  4DUY O;  2C2E A;  1SQX H;  3RT3 C;  2GTS A;  3CCS V;  4YJ3 B;  3Q2O A;  4U7O A;  1Q6I A;  3CE2 A;  3OAA G;  3H4D A;  4OPH A;  5BR8 H;  2QGN A;  4DR1 B;  4K6N A;  3G4S V;  4YJ2 B;  4GX0 A;  3DC5 A;  4FK5 C;  5HV6 A;  3KXY T;  5DG7 A;  3VQX A;  2CQY A;  2EJR A;  2UUA B;  3MFH A;  5E1A C;  2WLL B;  4DV5 H;  1W96 A;  4TUY F;  1DAA A;  3VOT A;  1M57 C;  3N41 B;  5K2M A;  1BQ0 A;  3P3N A;  5KT5 A;  4X64 H;  5CA0 B;  3PFF A;  5LMU O;  4O2A F;  4JAV A;  3IFX A;  2HG8 A;  4QE7 A;  5JH7 F;  4O4I B;  1OBG A;  2BTQ A;  5LYJ B;  5DIS C;  1DIK A;  4PZ7 A;  1WPX A;  1GSH A;  3BVO A;  1FD9 A;  4I0X A;  3VMM A;  3P32 A;  3WO0 A;  2VWJ A;  2WDT A;  2A79 B;  5D1P A;  4HR7 A;  1E4G T;  5LBQ A;  3HO8 A;  3OE7 G;  4FFN A;  1EZ1 A;  2IW5 A;  3SPH A;  4EQ5 A;  3T1C A;  1BXR A;  4FZ1 A;  4BBR G;  5CN0 A;  1Y6X A;  1M90 W;  4KHP O;  1DV2 A;  3K5M A;  3GVM A;  3JD2 A;  3ETD A;  5IE9 A;  3ABU A;  4ZBM A;  1JJ2 U;  3WB2 A;  3TY5 A;  2WA4 A;  1OBD A;  1V9P A;  4TOI A;  4JI4 H;  4C5A A;  3R65 A;  1DF5 A;  2DAA A;  3W7W A;  5KFD A;  3E86 A;  4EFE A;  4B3M O;  1Q81 W;  1VQ7 V;  3SPI A;  5IYD G;  2VUM G;  5LL6 Y;  4Q4C A;  2Q4P A;  2ZIO A;  3GIJ A;  1XMQ O;  3GIL A;  4MSW C;  3OUS A;  1K83 A;  3K79 A;  2BE3 A;  1CPY A;  1OCR C;  5K1P A;  4X1K B;  2YS8 A;  4YQW A;  4Q44 A;  2F93 B;  2CKZ B;  1K73 W;  1Q43 A;  2L35 A;  2QWN B;  2YZG A;  1E79 G;  4O4J B;  1NT2 B;  1ZSP A;  4LF5 B;  3H01 A;  5CMU A;  3RB6 A;  1YJ9 V;  1IOV A;  2Q69 A;  3CJH B;  1P7B A;  4PV1 B;  5H6Q A;  2WWW A;  2ZE5 A;  5L3C A;  3CRQ A;  1S68 A;  4YIP A;  1KBL A;  5J2T B;  2MW2 B;  5JVD B;  2YIA A;  1T36 A;  4RNN A;  4X65 O;  1Y76 A;  3SJB C;  1AP6 A;  1MZF A;  3TY9 A;  3SE7 A;  2VPQ A;  2H8P C;  2JA6 G;  5KA5 A;  3M99 B;  1MOF A;  2ZNJ A;  4R8C A;  1KP2 A;  1U97 A;  5CBH A;  4H33 A;  2P22 C;  4DL7 A;  5L3E A;  3TGU H;  1XNQ O;  3C3S A;  2YIB A;  2ZM6 O;  5C93 A;  2ZE6 A;  4UUJ C;  3FD9 A;  1ULZ A;  4DW0 A;  1I94 O;  1AJP A;  5LOV F;  2ZE8 A;  4TUY A;  2AHZ A;  2AZ2 A;  4JI7 O;  2UVU A;  1L0N H;  2UUB H;  4O2B A;  2QWR B;  4O3O A;  2YI9 A;  4I0X B;  4AQY H;  4NXM B;  5LHG A;  4PDB A;  4O2A A;  1G6U A;  1Q7Y W;  5KT6 A;  3GIQ A;  2DLN A;  1B6Q A;  2H94 A;  5JH7 A;  1VP7 A;  3N6X A;  4RAZ A;  2F4V O;  2YZM A;  4I50 B;  2JEJ A;  4NB5 A;  4JI0 O;  1E1Q G;  3FX7 A;  2NVY A;  4ECS A;  2OYQ A;  4WD3 A;  3ZMU A;  2ADP A;  4LNU A;  4J9L A;  2OT5 A;  1D5N A;  1SQB H;  3ZCC A;  1K1Q A;  3BAC A;  4GKJ O;  3H20 A;  2E2I A;  5FPR A;  4RNM A;  5KFQ A;  2ETN A;  3I56 V;  2Y0S A;  1M7J A;  3K5H A;  2W9A A;  3OUZ A;  4O7R A;  4E2L A;  5DEC A;  5LA6 F;  4BIO A;  2F66 C;  3FKS G;  3QFF A;  1I5X A;  2W9C B;  2YCH A;  4JYY A;  2QJ1 A;  5CBG A;  5BMV F;  1OCC C;  3RFC A;  4XYL B;  5A2Q W;  2EBO A;  2Q8V A;  4BWS C;  2OWO A;  3BRC A;  4YHH B;  2YZL A;  4JPR A;  3AG1 C;  1XOU A;  3D3Q A;  4J9Y B;  3DC6 A;  4PWQ A;  5DGH A;  2YRX A;  4JTD B;  2O03 A;  4QWC A;  3J7A K;  4AIL C;  3ASO B;  5KFV A;  2HHH O;  2XCA A;  4CC5 A;  3K0D A;  2EIK B;  1NBM G;  3E22 B;  4DR2 B;  2V59 A;  2EJ3 A;  1FXV A;  4CH3 A;  3KCY A;  1N36 H;  4J9Q A;  4MW8 A;  2R9R B;  1O75 A;  1MAB G;  4A2B A;  2Q9L A;  1XMO O;  2X7R B;  1OZ0 A;  3LSS A;  2FTK A;  1Z5V A;  3T1Y H;  4QIW F;  5LMN H;  4J9R A;  1K1S A;  2ZXW C;  5C5J A;  4BY7 G;  4B3S B;  4BBS G;  3TQ1 A;  1I2L A;  1J5E H;  3V6K A;  2WLI A;  4O4L F;  4FLT A;  3B8M A;  4CHI A;  3KTM A;  2HDK A;  4PDM A;  4MTD A;  4FFB A;  1V51 A;  4QPK A;  1KJJ A;  1S0O A;  4LFC O;  1KT8 A;  4O7T A;  4GKK O;  2R92 A;  3HB9 A;  3VOU A;  4TUY B;  1BNC A;  2E3C A;  1XDC A;  3OMI B;  2IBZ H;  2R9A A;  4HNU A;  2Q68 A;  4ED2 A;  1WR2 A;  5DMX A;  4AYB A;  4O2A B;  2VS0 A;  5DQG A;  5FPO A;  3ABK C;  2ITC C;  1EZV H;  5JH7 B;  2JA7 G;  5JCO C;  4ZQI A;  2IH1 C;  5IYD O;  3AG3 C;  1I1M A;  1KMI Z;  1UFI A;  3HOU G;  1L0L H;  3S3X A;  4FFP A;  4Q20 A;  2X0S A;  1N34 B;  3SI8 A;  4EGJ A;  2GBO A;  1PPJ H;  1AI7 A;  4LF6 B;  1GRJ A;  4LNU B;  1CXZ B;  4UFZ A;  1W0J G;  1SRY A;  4I7H A;  2E74 B;  4PHZ A;  4MVR A;  2X5R A;  3TY8 A;  1Q82 W;  2DYR C;  3OR7 C;  2EJ0 A;  1BGY H;  3GTM A;  2RNB A;  3F5W C;  4MTE A;  3WNZ A;  4IWY A;  4X1I B;  4IHJ F;  5EC1 C;  3BQ2 A;  3QZ8 A;  1I5Y A;  3PW0 A;  1KU9 A;  1VQ5 V;  3HOZ G;  1HNX O;  4WFH A;  4O7V A;  4M7E A;  2QE7 G;  2DAB A;  3G80 A;  1LNQ A;  4EEY A;  5LA6 A;  2VQF O;  3N43 B;  4R8U A;  2DE0 X;  4TV9 F;  3SYC A;  3HB3 B;  2B1I A;  4LFB B;  3E35 A;  3PJS K;  3E2E A;  2EIN C;  1P49 A;  2PMZ A;  3G71 V;  3H1H H;  2Q2U A;  4E4E A;  2B63 A;  1R6N A;  2A0L A;  3ETJ A;  3U9T A;  1OCZ B;  5EOY A;  1E1R G;  5DQI A;  3JAR B;  2JS3 A;  5IY5 C;  4FFL A;  5KFK A;  3T9F A;  3L4K A;  3MWD A;  4J9K A;  3UYY A;  4NYK A;  4PA4 A;  3H0G A;  3GLK A;  4DR1 O;  2AW9 A;  2Y4T A;  5BZB A;  1U96 A;  3SJQ C;  2COG A;  1GTO A;  3N2K A;  2PZS A;  5IWA O;  4FFR A;  2P06 A;  4K0K B;  2EIM C;  3HR0 A;  2WLI B;  5KFT A;  1PNM A;  1SES A;  2HG5 C;  3NC0 B;  3T9C A;  3U9S A;  4QIW A;  4LF5 H;  2VA3 A;  5BWX A;  2Y0S E;  4O7S A;  4A2A A;  2GPS A;  4JUZ A;  4R6Z A;  4CC6 A;  1YTF B;  1N8R W;  1KKD A;  4FFB B;  1FJG H;  1XRE A;  2LJ2 A;  5DM6 V;  3ZIA G;  2J6S A;  3HKZ A;  4JV5 O;  5I5V A;  4ED8 A;  4FM2 A;  3I4N G;  1N32 O;  2JK5 C;  4PA9 A;  4UCU A;  5DN6 G;  5EWE A;  5LOV B;  3PW4 A;  3EPG A;  1RSO A;  3UO2 A;  1GM7 A;  2NR5 A;  3A0B Z;  5JJJ B;  5JQG F;  4KXR A;  3Q8Q B;  1I1K A;  3RYH A;  5IYC O;  1H2K A;  4IYH A;  4UV8 A;  3N6R A;  1TVK B;  1CE8 A;  4YY3 B;  1RJP A;  3JZ6 A;  3QTC A;  3CD6 V;  3CMA V;  5BR8 B;  5LHH A;  2PUS A;  3N44 B;  4QWA A;  3X2Q B;  3OW2 U;  3UZO A;  3K5I A;  3RV4 A;  1MSW D;  5IP7 G;  2COJ A;  1Y1W G;  3MWM A;  1Q5O A;  4R7R A;  4NXM H;  1K9M W;  3SPJ A;  2QTO A;  5FNV A;  4HZ3 A;  3RYC A;  1F7Y A;  1N33 B;  4PZ6 A;  5EWG A;  2R8H A;  5EC2 C;  5KHJ A;  1CQI B;  5JVL A;  1HNZ B;  5KG0 A;  2LFR A;  4X64 B;  5EBW C;  3ZHR A;  1RYR A;  4LH7 A;  2X6B A;  4F4L A;  2M7W A;  5K3W A;  4LR3 A;  4X20 B;  2WA3 A;  4CKC A;  5LA6 B;  3IGA C;  4LCU C;  4IHJ A;  4NKG B;  5LP6 C;  3S3W A;  5BMV B;  4TQS A;  4BWA A;  3PR5 B;  4DV3 B;  2YS6 A;  1BE3 H;  3TII A;  2UVV A;  5KG4 A;  1NKD A;  3RN4 A;  1I50 A;  5IJ0 A;  5CA0 F;  2UXB B;  2YYA A;  4A3G G;  5F9L A;  2JJ2 G;  5B5E Z;  5KLV H;  3E8F A;  4TV9 A;  4FLU A;  4O3Q A;  1KKC A;  3CX5 F;  3E83 A;  1OV9 A;  4XZ3 B;  2AXT Z;  1CKM A;  4AYB E;  4GT1 A;  4UVA A;  5LGT A;  1RPR A;  3WWH A;  3N2G A;  5KAF Z;  5H9C A;  4ME6 A;  1C3O A;  5KG2 A;  4HYK A;  2VWK A;  5IJ9 A;  5KFZ A;  2EIJ C;  3SJA C;  4JI4 B;  2FML A;  2W6N A;  3ABM C;  1W2B U;  3MR5 A;  4EYH B;  1ZTE A;  4XYM B;  4KL1 A;  5CA3 A;  3CC2 V;  5L1L A;  5H80 A;  4JV0 A;  2R93 G;  2KG7 B;  4F6E A;  1XNR H;  1V55 C;  3OTO H;  4OX9 B;  4TQD A;  3W5O A;  3H4B A;  1BJT A;  4Q45 A;  1KB9 F;  4JI6 H;  4DR2 H;  2GHY A;  3MR6 A;  2R8K A;  2R7Z A;  4P9P A;  4DO2 A;  2UXD B;  2B1G A;  4CKB A;  5HFM A;  4FU0 A;  4FVM A;  4NTY A;  2PYL A;  5BPF A;  4DV0 O;  4O4L B;  1SS3 A;  5I5U A;  5KFU A;  2JDI G;  1I6U A;  2ODT X;  4MA0 A;  2FMA A;  4LF8 B;  5BYA A;  2AQ4 A;  1I08 A;  1F23 A;  1GK9 A;  4QJF A;  5KG3 A;  3V6J A;  4B3S H;  3IJ4 A;  1RSO B;  3T5H A;  1Y66 A;  2JEI A;  2ZDQ A;  2FLP A;  2BOC C;  4QWE A;  2G38 A;  3VQY A;  2UVW A;  1GO3 F;  4IL6 Z;  3ZRV A;  2VA2 A;  3B4S A;  3TIN A;  2RMK B;  4J9N A;  2LW1 A;  4LF9 H;  4QW8 A;  1S10 A;  5D1O A;  1WP7 A;  1K4C C;  4JV1 A;  2JRI A;  2Y69 B;  2UU9 O;  3G6X A;  2YEV A;  4A3L G;  4O83 A;  4FFO A;  1HW7 A;  2ZT9 B;  2Z0A A;  4PI2 A;  4G27 B;  4X66 B;  3VNN A;  5B1B C;  2QKS A;  2QWP B;  1M0T A;  2H3O A;  3JRX A;  1Y1V A;  2C2R A;  4DR7 B;  1VKZ A;  2IH3 C;  4DR3 O;  5BWW A;  4Q8F A;  3HOV G;  4RQE A;  3RF2 A;  3K3W A;  1I7L A;  4KP4 A;  4MT8 A;  1FXK B;  5EIB D;  1RK6 A;  1VBH A;  2K1E A;  1R3K C;  4HNV A;  2RCV A;  4DR5 B;  4CMD A;  3M9N B;  3PZP A;  2YU9 A;  4YJ3 A;  1S0N A;  5JJE B;  3JD0 A;  1SQQ H;  4HQ6 A;  2Q6A A;  3E89 A;  4MV6 A;  4IHJ B;  1N34 H;  4YHH O;  2J6U A;  3OR6 C;  4LF6 H;  2D3O W;  3MDS A;  1YXB A;  4W4K A;  4YJ2 A;  3OEH G;  4LF7 O;  1NU1 H;  5IJ0 B;  4FM0 A;  1EUD B;  3T9B A;  4HNA A;  2XAG A;  4PDR A;  4TV9 B;  4DV2 B;  2VRZ A;  2WLL A;  2BQR A;  3SGI A;  2HVQ A;  2R8J A;  4TWK A;  1IVS A;  4Q0Y A;  5D5Q A;  5CA0 A;  4JGS A;  2QTS A;  3E8B A;  3LDD A;  1Y14 B;  3N2G B;  2YXY A;  5IJ9 B;  4J41 A;  5A2Q N;  2W7P A;  3E8H A;  4O4I A;  2OCH A;  4JI3 B;  3SYA A;  4J42 A;  2UUC O;  2HJW A;  4MV4 A;  1IBK O;  1ZL8 B;  2NN4 A;  3ZJZ A;  5J9P C;  4U6P A;  2ALZ A;  2JA5 G;  2YID A;  3FKI A;  4LFB H;  2C22 A;  4UVB A;  1HR0 B;  3OMN B;  1YJW V;  3WG7 B;  1CEZ A;  1OWT A;  4MVZ A; 
#chains in the Genus database with same CATH homology
 3RGZ A;  2F93 B;  2BTO A;  4IIJ B;  2P5O A;  3BAB A;  1Q43 A;  2Q7E A;  2XIG A;  3BPZ A;  1WNS A;  3L2P A;  4CS3 A;  4O4J B;  4CH5 A;  5J2U A;  1NT2 B;  3QWU A;  4LF5 B;  2YI8 A;  1M5I A;  4O2B B;  3WB1 A;  4RB3 C;  4DR1 H;  3K57 A;  5FD5 A;  1SKV A;  4B08 A;  3A2F A;  3K5O A;  5IWA H;  5C8Y A;  3L4J A;  1S68 A;  1O9H A;  5ITZ A;  5J2T B;  1B04 A;  2PYJ A;  1TGO A;  1SA0 A;  4K0K H;  4X65 B;  2HIV A;  5JVD B;  2YIA A;  3C0F B;  2UUA H;  3JAL A;  3SJB C;  5K1X A;  1I7F A;  5CB4 A;  3CVZ A;  3RTX A;  3TY9 A;  5LMU H;  2JS5 A;  4DRX B;  4LH6 A;  5JQG B;  1IBL B;  4JV5 H;  2ZNJ A;  2EX3 A;  4LF4 H;  4X1K A;  5EIB C;  3J80 W;  1N32 H;  2PY5 A;  1XNQ B;  4IIJ A;  2P22 C;  2ZM6 B;  3MAQ A;  2YIB A;  1I94 B;  2UXC H;  1J5E B;  1ZHQ A;  2RJZ A;  4JI7 B;  3IAY A;  4TUY A;  1AN7 A;  4AHC A;  2UUB H;  4O2B A;  2YI9 A;  4AQY H;  4NXM B;  4LF7 H;  2KSW A;  1HNW H;  3JSL A;  3RYF A;  4PDB A;  4O2A A;  4TQF A;  1G6U A;  4J0M A;  1FFX B;  4YY3 H;  1SYX B;  5J2T A;  4RB2 C;  5JH7 A;  3JAW A;  1L2Z A;  1M93 A;  4GLX A;  1TA8 A;  4UCO A;  2F4V B;  3N6X A;  2E5L B;  5JVD A;  2ZJT A;  4RAZ A;  4JI0 B;  4I50 B;  1A0I A;  4DV6 B;  4HNA B;  4ZIB A;  3U10 A;  4DRX A;  5GON B;  5EYP A;  2OYQ A;  4B3R B;  5JQG A;  4GKJ B;  4LNU A;  2CW8 A;  1IBM B;  3H20 A;  1N33 H;  5FPR A;  3RGX A;  3ZS8 C;  1HNZ H;  3GB8 B;  4DUZ B;  2KKW A;  4Q6G A;  3RIZ A;  4GYC B;  4DV4 B;  2F66 C;  3VQV A;  4EEQ A;  2YCH A;  4NVP A;  2QJ1 A;  2VOB A;  4X62 B;  4RZQ A;  5A2Q W;  4DV3 H;  1Z2N X;  4DR4 B;  2IM9 A;  4BWS C;  1CKN A;  4NXN H;  2OWO A;  5LXT B;  3BRC A;  4YHH B;  4LFA B;  3S24 A;  3UT5 B;  1FFX A;  2UXB H;  4LF9 B;  4O4H B;  4I9Q A;  3NBZ B;  4I50 A;  2Q7G A;  4JI8 B;  2O03 A;  3J7A K;  4AIL C;  3UQ8 A;  5GON A;  4PI0 A;  4CC5 A;  2JVD A;  2CW7 A;  3E22 B;  4DR2 B;  4CH3 A;  1N36 H;  1O75 A;  4CH6 A;  1JMK C;  5C8Y B;  4A2B A;  1XMO B;  4JI5 H;  5ITZ B;  1SA0 B;  4EFB A;  4RB1 A;  1Z5V A;  1FVI A;  2HVS A;  5LMN H;  3JAL B;  3RFR A;  3T1Y H;  1Z2O X;  4CH4 A;  4WBN A;  1P16 A;  2WYO A;  3F8N A;  4MV9 A;  4OX9 H;  4B3S B;  2FE3 A;  2RQ6 A;  1H2S B;  4B3T H;  2JGU A;  3BA8 A;  4UCR A;  1I94 H;  1J5E H;  2ZIN A;  1ZAU A;  2UXD H;  3UT5 A;  4FLV A;  5KHI A;  4DV0 H;  4TV8 A;  3GDE A;  4FLT A;  3KAJ A;  4DV7 B;  4O4H A;  5JCO A;  4MTD A;  4LFC B;  4DUY H;  4FFB A;  4LF8 H;  3BA9 A;  2ZIM A;  1M4U A;  4DV5 B;  4TUY B;  4RAY A;  2E3C A;  4FLX A;  3E22 A;  1FJG B;  1Z2P X;  2R9A A;  3IG0 A;  4FLW A;  3RYF B;  5KHG A;  5FLX W;  4O2A B;  1XI1 A;  5FPO A;  4ZHQ B;  4D7S A;  5JH7 B;  3JAW B;  5JCO C;  3JAS A;  1BGW A;  2XHB A;  2UU9 H;  1CKO A;  1KMI Z;  1P8L A;  1GYF A;  2HGS A;  3KAL A;  4DRF A;  1N34 B;  4X66 H;  5EYP B;  3GJX B;  3RWR D;  3ETQ A;  4DR3 H;  4LF6 B;  3HKD A;  4LNU B;  3SR2 C;  3WB0 A;  4DR7 H;  4UFZ A;  4I7H A;  3THO A;  4PHZ A;  5CA1 A;  1XQ8 A;  3NBY B;  5IT9 W;  2HIX A;  3TY8 A;  4DR6 B;  4X62 H;  4DR5 H;  1M0W A;  4MTE A;  4X1I B;  3HKC A;  4FLZ A;  4YHH H;  3HKB B;  4JI1 B;  3N2K B;  1HNX B;  1FKA H;  4DK0 A;  1KU9 A;  4KHP H;  1CKN B;  4I55 B;  2VQF B;  4M7E A;  2ZNI A;  4ZHQ A;  5LA6 A;  3N43 B;  4DV1 B;  3FFQ A;  4CS4 A;  4DV2 H;  4LFB B;  1P49 A;  5KX5 A;  3T1H B;  3CB2 A;  1VS0 A;  2Q2U A;  4MV7 A;  4F6R A;  5KMG A;  4B3M H;  3N40 P;  4E6N A;  3BAA A;  3HKE B;  5EOY A;  2UUC H;  4LMY A;  3JAR B;  1TUB B;  1IBK H;  1XMQ H;  4JI3 H;  3JAK A;  2CFM A;  1WN7 A;  3L4K A;  1JFF B;  2VQE H;  1HR0 H;  4X1I A;  3RYI A;  3RYH B;  3HKB A;  4WBN B;  5IWA B;  3KYH C;  1QQC A;  3N2K A;  2PZS A;  2VPS A;  4K0K B;  4I55 A;  1E4F T;  4JI2 B;  3NC0 B;  3K58 A;  4TV8 B;  2ZCE A;  1WPB A;  1XHZ A;  4LF5 H;  5LP6 B;  4EB6 B;  4A2A A;  4CC6 A;  1FJG H;  4FFB B;  4JV5 B;  1XNR B;  1QHT A;  2HEP A;  2HHH B;  3OTO B;  5FNV B;  1N32 B;  3RYC B;  3K5L A;  4FM2 A;  2YXL A;  4I4T A;  3DSQ A;  2GV9 A;  3RR5 A;  4JI6 B;  4X65 H;  1S03 G;  2MCT A;  1X9N A;  3HKE A;  4CS2 A;  1Z5W A;  4UCU A;  3JAR A;  1TUB A;  5D5P A;  5LOV B;  4X1Y A;  1RSO A;  5JJJ B;  2UUB B;  1JFF A;  3JAS B;  3OTF A;  1IBL H;  4AQY B;  3RYH A;  3BHP A;  3CHX A;  3JSN A;  1XNQ H;  2ZM6 H;  1TVK B;  4YY3 B;  3QTC A;  4FM1 A;  2VUG A;  5BR8 B;  2PUS A;  3N44 B;  3HKD B;  2R72 A;  4ZI7 A;  2Q0A A;  3U0Z A;  3DF7 A;  1XHX A;  5CA1 B;  4JI7 H;  2YIB D;  4FM9 A;  3RJ0 A;  5LP6 A;  4EB6 A;  3MWM A;  1Q5O A;  2V4D A;  4HBN A;  3K5N A;  4GKK B;  4R7R A;  4NXM H;  4LSA A;  5FNV A;  3B2E E;  3HKC B;  3RYC A;  1N33 B;  4PZ6 A;  5KHJ A;  3EYY A;  1HNZ B;  2RGR A;  5LYJ A;  4X64 B;  4K8X A;  5IYZ A;  2F4V H;  4LH7 A;  2E5L H;  4JI0 H;  2F95 B;  4LR3 A;  3W1B A;  4X20 B;  4DV6 H;  5LOV A;  3JAM W;  3JAT A;  2W57 A;  1T5E A;  5LA6 B;  3QG5 A;  3T1H H;  1SQF A;  4IHJ A;  5LP6 C;  5BMV B;  4B3R H;  4BWA A;  4DV3 B;  3W1G A;  4GKJ H;  3K59 A;  1TAE A;  1IBM H;  4NXN B;  5KX5 B;  5IJ0 A;  1TVK A;  2UXB B;  2QM4 A;  4F6R B;  5KMG B;  4DUZ H;  4ZOL B;  4TV9 A;  4FLU A;  2Q2T A;  5EZY A;  1CKM A;  4DV4 H;  3JAK B;  3N2G A;  5JJN B;  4DR4 H;  2VWK A;  5IJ9 A;  4RB0 A;  3RYI B;  3SJA C;  1N36 B;  4JI2 H;  4LFA H;  4JI4 B;  2RGV A;  4JYA B;  1JJO A;  4KL1 A;  4DK1 A;  4LF9 H;  4JI5 B;  4U3J A;  2CAZ C;  3M7M X;  4X20 A;  5D1O B;  3T1Y B;  4APM A;  5LMN B;  3PN1 A;  2HHH H;  4JI8 H;  3OTO H;  1XNR H;  4OX9 B;  4TQD A;  3W5O A;  4LSX A;  1BJT A;  5BMV A;  3QF7 A;  5FD6 A;  4JI6 H;  4BW9 A;  4B3T B;  4DR2 H;  3CSX A;  2UXD B;  1DGS A;  4O4J A;  1Q8I A;  4DV0 B;  1VF7 A;  1XMO H;  4FVM A;  4I4T B;  4K8Z A;  4ZOL A;  2PYL A;  4O4L B;  2BTQ B;  4DUY B;  1I6U A;  4LF8 B;  3K3V A;  4PZ8 A;  1YEW A;  3J81 W;  4X1Y B;  4YJ3 B;  4B3S H;  3FMA A;  2Q7H A;  5KHH A;  4UCS A;  4D7T A;  5BR8 H;  4DR1 B;  2R70 A;  1XK5 A;  3VQY A;  4YJ2 B;  3LNN A;  4DV7 H;  4UCV A;  4UCT A;  3KXY T;  3VQX A;  4LFC H;  4GKK H;  4ZI7 B;  2UU9 B;  2UUA B;  5D1O A;  4DV5 H;  4ETS A;  2PTM A;  1HW7 A;  3KAK A;  3N41 B;  4PI2 A;  5LMU B;  4X66 B;  3VNN A;  5CA0 B;  1Q3E A;  4X64 H;  1M0T A;  4DR3 B;  4DR7 B;  4LF4 B;  5LL6 b;  3RF2 A;  4O4I B;  1D5A A;  4O4L A;  3M4I A;  2BTQ A;  5LYJ B;  5DIS C;  5EIB D;  3U11 A;  4PZ7 A;  5IYZ B;  2UXC B;  1S5J A;  1XDN A;  4DR5 B;  2F1M A;  2VWJ A;  2WDT A;  5D1P A;  4YJ3 A;  3JAT B;  5JJE B;  1E4G T;  3N42 B;  3SJC C;  4IHJ B;  3HXL A;  1N34 H;  3LML A;  4LF6 H;  4EQ5 A;  4LF7 B;  1WH2 A;  1HNW B;  4KHP B;  2PGG A;  4YJ2 A;  1ZHS A;  2HVR A;  5IJ0 B;  5J2U B;  3RGB A;  4FM0 A;  4HNA A;  3K5M A;  4DR6 H;  4TV9 B;  4DV2 B;  3WB2 A;  3TY5 A;  1SEI A;  5EZY B;  3SGI A;  2HVQ A;  1V9P A;  4TOI A;  2WE6 A;  1L8D A;  5KHK A;  4JI4 H;  3VQW A;  4Q0Y A;  4JI1 H;  4JYA H;  5D5Q A;  5CA0 A;  1O9G A;  4B3M B;  4L8J A;  1HNX H;  3N2G B;  4IAJ A;  4EFE A;  5IJ9 B;  4FLY A;  1MZB A;  3ZED A;  2VQF H;  1SQG A;  1X4T A;  2UUC B;  1IBK B;  4O4I A;  1XMQ B;  4JI3 B;  5CB4 B;  2ZIO A;  4DV1 H;  3ICX A;  4U3J B;  4LFB H;  2VQE B;  1HR0 B;  5LXT A;  5K1P A;  4X1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...