4CC6A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 103
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc6A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc6A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc6A02
1N32B 4LH7A 1P8LA 4UCVA 3RTXA 1XNQB 1N33B 3NC0B 4JI8B 4JI5B 3BA8A 4JI3B 4DR6B 3L2PA 3W1GA 1V9PA 4CC6A 4DR1B 4EFBA 4YY3B 1XK5A 4X66B 5D1PA 4DRFA 2F4VB 1IBKB 4OX9B 1HR0B 1A0IA 1J5EB 2HIVA 4K0KB 4UCSA 1P16A 4JI2B 3PN1A 4DR4B 2VUGA 4DR5B 2UXDB 2OWOA 4DV6B 4DV3B 4DR7B 4B3MB 4KHPB 4DV1B 4LFCB 3GDEA 2HHHB 2HIXA 1HNXB 4LF4B 1IBMB 4NXMB 3W5OA 4JI4B 2Q2TA 4AQYB 4DUZB 2HVRA 4DV7B 2UU9B 5LMNB 4UCRA 1FVIA 4LH6A 4B3SB 4LF5B 4EQ5A 1XMQB 4JI1B 2UXCB 1S68A 3KYHC 1VS0A 4LFAB 2UUAB 4GLXA 3T1YB 5D1OB 4LF7B 4YHHB 2UUCB 3RR5A 3NBYB 4DR3B 4EFEA 3UQ8A 4NXNB 4PZ6A 4PZ7A 3VNNA 5D1OA 4UCTA 5DISC 1TA8A 3BAAA 4DV5B 2ZM6B 3NBZB 4DV2B 1DGSA 1CKNB 2E5LB 1IBLB 2HVQA 4B3RB 3QWUA 4GKKB 4LF8B 2CFMA 3TY5A 4LFBB 3SGIA 2UXBB 4JI7B 2VQEB 5IWAB 3BABA 3JSLA 4DR2B 5FPRA 5BR8B 1CKMA 3OTOB 5LMUB 4UFZA 2UUBB 1N34B 1B04A 4PZ8A 2HVSA 4UCUA 4CC5A 4X62B 4TOIA 1I94B 1HNZB 3JSNA 4DV0B 4DV4B 1HNWB 3S24A 1N36B 1CKNA 3GB8B 4B3TB 2VQFB 4X64B 5FPOA 3GJXB 4UCOA 1ZAUA 4JI6B 3TY9A 3BA9A 4LF6B 1TAEA 3T1HB 1XMOB 1XNRB 4GKJB 1CKOA 3TY8A 1X9NA 4EEQA 4DUYB 1XDNA 1FJGB 4JYAB 4X65B 2Q2UA 3W1BA 4JV5B 4E6NA 4LF9B 4JI0B
chains in the Genus database with same CATH superfamily
2JEGA 5I5WA 3JD2A 2W71A 1ZL8A 2WAQE 3NC0B 5B66Z 1RJRA 2ASDA 5LP6F 4RNMA 3UM7A 3K03A 4IRDA 3K9AA 1VF6C 3HT5A 5J2TB 1SEIA 5I5VA 4JAAA 1PNLA 3N40P 1KD1W 3JASA 5D1PA 4OXSA 1JDEA 3L72H 4U7CA 4JI2B 1IDSA 4Y8VB 3SPCA 2FLNA 4YJ2F 2Y0PA 3ZEDA 1KJ8A 4DV3H 3JARA 4A3BG 5K1XA 2ZXWB 4EB6A 3FKIA 5JH7B 4CH3A 4O81A 4JUZA 1K9MW 1URFA 4UVCA 2VQEO 4U3JB 1VBHA 2PBZA 3ASOC 2YW2A 4DUZB 1NI8A 4BWSC 2Y69C 5IJ0B 3RYHB 4MVSA 2XAGA 1XMQB 4R8UB 1FFTB 5KG4A 1Q6UA 1RSOB 2UVUA 4LFAB 4RAIA 2HLDG 4HR7A 5I5XA 4JV5H 1AUXA 2EIKB 1YVWA 4LF9H 5C93A 3WG7C 4O7VA 4X1YB 2R9AA 4MVRA 3H40A 5EOYA 1EBOA 5DLGA 1L1FA 1IBKO 4O4HA 1Y1VA 4PJ0Z 1EKVA 4J9ZB 3UZOA 4IR9A 3HOXG 4EG0A 5B1NA 2WYOA 1Z2NX 1I7LA 2GBOA 2JDIG 2UXBB 3Q1KA 1VF7A 2ODTX 1B3QA 5BYAA 4HN2A 2Q9LA 1W96A 4DR3O 3E8FA 4RQFA 3HR0A 3B8NA 3OM3B 3P3PA 4GZRB 4J11A 2XTAA 5JJJB 3OR7C 1HNXH 4C7UA 1M56B 1FKAH 3JALB 2Y4UA 5GONB 4JI7H 1KB9F 4FFMA 3K04A 5B1BC 1GLVA 4PDMA 4WFAV 4J9NA 2FLLA 3GQCA 3HKDB 2HDKA 3A2FA 4U6PA 4I0XB 3JRXA 3CC2V 4FJCC 4GX0A 1H38A 2R93G 4LF4O 2CW7A 3JASB 3N2KA 1ZAUA 3SJBC 5FNVB 3FKSG 4O4LB 2QB5A 2Q67A 4FM1A 3QF7A 3G6VA 1P49A 3OE7G 5FNVF 3N2GB 1JX4A 3CEIA 1DK1A 4L1KA 2RNBA 4CS2A 1GSAA 3RAXA 1KP3A 3JCUZ 1N48A 4ECTA 2UU9O 4O7WA 2OTLV 4LWSB 2WSSG 1ZETA 5CM0A 5LMUO 1XMOO 2UXBH 4FLYA 3GIPA 3J7AK 1GTOA 3OUZA 5KAFZ 1SERA 2RQ6A 4GKJO 2Q4PA 1WR2A 1Q5OA 1OBGA 5I47A 5BPFA 3KHHA 3CJHB 4YJ3A 4J9QA 1FXKC 1F4MA 3TETA 4RU9A 2WLLA 3T9CA 4RQEA 2FB5A 3LSSA 4MSWC 1OWTA 2ADPA 1GSHA 1AP5A 1FS0G 4BY7G 3WWIA 2JS5A 4A3MG 4UB6Z 1V55B 4LF5B 5B3SB 5LP6B 4QIWA 3CPWU 1N34O 2R84A 2UXCB 2V4RA 3HKEA 5LMNO 3P30A 5KFIA 4MT8A 2G38A 3N27A 2NLJC 5A2QW 4YY3O 1UC8A 2FK3A 5EZYA 3VNNA 5D1OA 4UCTA 4IWXA 4DV5B 4ZI7A 1MA1A 4DUZO 2M6YA 4QJFA 4DR1H 1UNNC 5KHIA 4DR2H 1P7BA 2JJ1G 3JAWA 5A9GA 3FB7C 4I4TA 2ZE7A 4JAVA 3W7XA 4FS2A 3DAAA 2B5UA 1I1MA 3RYIA 5FPRA 2BR0A 5LA6B 4DV6O 4O7NA 1N34B 4MVZA 5CBGA 5JWPA 3T9FA 1Q82W 3FX7A 3OD4A 1C3OA 4IIJF 3R9RA 4ZHQF 1EUDB 2VWKA 1TWAA 2PUSA 1S5JA 3JSNA 2R87A 1Y6XA 1F23A 3JCZA 3TXQA 4DV4B 1A3GA 3S24A 3PVXA 3C0FB 2R92A 3VA7A 3L75H 5JCOC 5EK0A 2XNDG 1FJGO 1WN7A 3TGUH 1S0NA 3CP1A 1D5NA 4QPKA 4LF6B 5LL6b 3E8BA 1N32O 4ZQIA 5E79Z 4DUYB 1RFYA 2N05A 1S10A 4JYAB 4DR7O 2Q2UA 4J9PA 5KX5F 3WWJA 2JA6A 4XZ3B 4FU0A 1L8DA 4FM0A 2XAFA 4B7KA 2EINC 5LGNA 5DQHA 4Q44A 1BJTA 3TINA 3AG7A 4MW3A 1ZHSA 3MR5A 3RYCA 4BIUA 5L1IA 4DR6H 5LA6F 3T9DA 1NBMG 4G27B 4QE7A 4PI0A 2KSDA 2FPIB 2UXDB 4PI2A 1E1RG 2DQ3A 4XBFA 4NZOA 2W0FC 2P0AA 3T9EA 3D36A 3H0GA 3J80W 1JIHA 2FLPA 1OHHG 4DV0H 1GM7A 2JGUA 4MV1A 2BTQA 2Q2TA 2F93B 4NR1A 1M0TA 3CCSV 4ZOLB 2UU9B 2O03A 1K4DC 5H6QA 4B3RO 2W9CA 1DAAA 3ZS8C 2W70A 5BWVA 3OR6C 5LYJA 2D2CB 1BCCH 1A0GA 1BGWA 3OSPA 3E35A 5BMVB 1NR1A 4BIOA 1K73W 2H3OA 2E5LH 1WNSA 4NTXA 2R8GA 3CCVV 4A3CG 5EWFA 5CA1B 5KFMA 3VOTA 4LMYA 4O4LF 4WD3A 5K1PA 4A2AA 4JYBA 3NBZB 1Z5VA 1M5IA 5B5EZ 2IBZH 4B3RB 1AI7A 5KUKA 4ECRA 1GKFA 4ED7A 4TV8A 5IYZB 1YSCA 2YICA 5IYCG 1JFFA 2E2IA 3MJFA 3JATA 4OPHA 1IZ3A 2R9RB 2Y0SE 4I50F 3CQZA 3BQ0A 2HHHO 4DR2B 5BR8B 1IURA 1RSOA 3LP8A 4O3NA 4NXMO 2OH2A 4TOIA 3RAQA 1NKDA 2FB9A 3LULA 1KMIZ 3D3IA 2SCUB 3PR5B 1Y14B 5CA1A 4JAUA 2DJVA 4O4JB 2DYSB 1CKNA 2PF4E 4N23A 5KT3A 1GN2A 4PDVA 4ZHQB 4DV6H 2E5LO 5FPOA 3GIIA 1NS1A 4TSFG 5IJ9A 1FXKB 2WAMA 2XOKG 5BMVA 3CHXA 2IM9A 2C2EA 3EVKA 3MR3A 2BSKB 2FPGB 2YS6A 3HKCB 4EEQA 1IXBA 1VF5B 3RBEA 2CH7B 4JI0B 4DYLA 2L6LA 4BW9A 4JI8H 4HNAA 3CMAV 3APQA 1BL8A 4DR6B 2X6BA 3OSNA 1BNCA 2QWOB 4FFBA 4TT3G 4F4YA 1GN4A 2R86A 3JAWB 1EN6A 4JASA 1GN6A 4K0KO 3PW4A 1NTMH 1QHTA 3W7UA 2GSMB 1J5EB 5CR5A 2AGOA 4X20B 4J7KA 3E8HA 3FD9A 4RWUA 5KFAA 3EXAA 4DV6B 4B3MB 5EC1C 4DR7H 2Y69B 5HNEA 1TUBA 1IBMB 2ZT9B 4Q8EA 3JAMN 1EZ1A 1T94A 3QZ8A 1YJ9V 5C44G 3AYHB 5LYJF 5KX5B 3T9BA 2VQDA 2R7MA 4J9LA 4UCRA 1EN4A 5DLFA 2VWJA 3KAJA 4J0MA 2QTSA 2I8CA 5LYJB 2A3QA 4MV3A 3QVNA 3TIIA 2CDYA 1I7NA 2JS3A 3BACA 4NXNB 3ZBHA 2YXLA 1OZ0A 4LC1A 2JJ2G 4PHZA 2F4VH 3RB0A 2F1MA 2ATLA 3K79A 2ATKC 3JATB 4CMDA 3FFQA 2W6NA 5I5SA 3A0RA 2RDCA 4JI7O 1SCUB 3ZHUA 2WDTA 1QBZA 3SGIA 3HB9A 4X1IB 2YZLA 3UT5B 2Q0AA 2DE0X 4UVBA 3RB4A 2R8JA 2JEFA 3S3WA 5CA0A 4ECVA 4O4HB 3KHRA 3IFXA 5KA5A 1I1LA 3ZN0A 2QWNB 4RNNA 3K08A 3MHSC 3JD1A 3N2KB 3PO2G 3TEKA 3R23A 5KFRA 4ZOLA 4FGRA 4FFKA 2YCHA 4BR6A 3HKZA 4QW8A 3HKCA 2ZKOA 3BA9A 3U0GA 5KT6A 4R8UA 1W2BU 2IU0A 2ZNIA 5JVDB 4O7LA 3W1BA 1ZLZA 4E6NA 1VAJA 4LF7H 3ZX6A 3O65A 1CEZA 1VQMV 4UCVA 4O2AB 2JK5C 2QKAA 2BOBC 4RB2C 2JA7G 1XEQA 1YTFB 1Y1VG 4LNUB 2OCCC 1NZ6A 3ETHA 1CQJB 2JVDA 3BA8A 2EILB 3T1YO 1DIKA 4EYHB 1JXLA 3K5NA 2IW5A 2QA4V 3FYIB 1H2NA 4EFBA 2Z02A 3OFNG 1XNRH 1WJZA 3ETQA 3CXCU 4X66H 3G6XA 2E3CA 3CYOA 1SQGA 1XBLA 2ZDIA 1WCMA 1BGYH 4R7CA 1SRYA 2W9BB 5DMXA 3V6HA 4C5CA 3GTGA 2ASJA 4CH6A 5JQGF 3MWEA 1I94H 3J80N 1B6RA 4K0KH 3H4DA 4X1KB 3T2MA 3ABTA 4JI4B 2QWQB 5TISZ 3RYHA 3C90A 3ZJZA 4LF6O 3RUPA 3H1IH 5IJ0A 5DQIA 3WB1A 4DUYH 2R70A 5J2UF 4DV7H 4U3JA 3P3NA 3SYAA 3CC4V 3ZMSA 4GKKO 3IC7A 2C28A 4TV8F 3MHHC 4J9KA 2DIKA 3T1YH 1GK9A 3TQTA 1T36A 4LF7B 1Q7YW 1DF5A 2P5OA 5JCOA 1HWYA 4LF8O 1TA8A 2GV9A 4QW9A 1KC8W 4DV5H 4PWQA 4JF3A 4FM9A 3E22B 1TWHA 1N33H 3ETEA 1QLEC 2CK3G 1SFOA 2OCHA 3ICXA 4I50B 4BBRG 4DL6A 3CVZA 4CHIA 1V55C 1YZBA 1OCCB 3AG1B 3F5WC 2V4QA 4Z1MG 3KHLA 1HNWO 5C1OA 4ZKIA 5LOVA 4NTYA 4HQ6A 2NUAB 2OIGA 1WCMG 1YCIA 2RCVA 3T9AA 2Q8VA 2YZMA 3TCUA 1JPXA 3OGCC 2C35B 2UXNA 1PNMA 5DN6G 2HKOA 4NKGB 4NXMH 1CQIB 4DL3A 1VQ7V 4O2BA 5D5PA 1H2MA 1ORQC 4X64B 4IHJA 4ED0A 4DAAA 3AG4B 4UCOA 4U3FH 4ZOLF 4HYKA 2ZDHA 1AJPA 1KKCA 4MAMA 1D5AA 4MS2A 2EIJB 4JI1H 4DIMA 3RFRA 3FYEB 4J9YB 4WBNA 3E8GA 4FLUA 1XK5A 2YC0A 4O2BB 2PMZA 4EB6B 3RTXA 3MR6A 4LSAA 1MSDA 2DMXA 3CC7V 1H2LA 5DG9A 1WA8B 5KT5A 4B3MO 2ZR2A 3HOWG 4GCZA 1E4EA 4YB8B 4K8XA 4LF7O 3CWBH 4Q0YA 1QNMA 5H6RA 3NGDA 3OUSA 1ENVA 1G2WA 3ORRA 2DPIA 2Q7GA 2JA8G 3E83A 3OW2U 4GT1A 2P6JA 2CQYA 3B09A 1GGOA 2ZIOA 3UT5A 1I5YA 3AEIA 4MVOA 4LCUC 1FPOA 5BR8H 1UJWB 3GTJA 4NYEA 4APMA 1NTZH 4DLKA 4P30A 3BG5A 4C5AA 2UUAH 5LMNB 2GTAA 4QNHB 1VQKV 3F5TA 4O2AF 2VPSA 2P06A 2UXCO 1MSWD 1N36O 5EYPA 4NZMA 4PV1B 4HZ3A 5IP7G 3SJAC 2LGWA 1E79G 4WBNB 5LP6A 2QM8A 2GDSA 1I6UA 1N56A 5CA3A 3HOVG 3SYQA 2LJ2A 1XNQH 4GX5A 4I9WA 3RV3A 5L3CA 5T14A 1OCZC 2ZE6A 1CKNB 3FAVA 5L3DA 5CBFA 2P7TC 4JI4O 4R8CA 3U11A 1BT8A 2FYUH 3ETJA 4EBCA 1M6VA 4MV8A 3CCMV 1RJPA 1LUWA 2FJZA 2R85A 4HNTA 1FYJA 1BHAA 3AG3B 4X1YA 1JMKC 5J2UB 3J81W 4PZ8A 3SDLA 4IR1A 1IBMH 4TV8B 1KBHA 3S3XA 2ZIMA 2HJFC 1RM1C 5KFUA 1M90W 2ZGIA 3AG3C 3ZHRA 3KHGA 1TUEB 1XMQH 2VUMA 1AR4A 2PVPA 1I2LA 3GV5B 3LUTB 4WBNF 2YSUB 4E4EA 3K5OA 1AJQA 3KG2A 4BIZA 5BMVF 4DUZH 1VQLV 1PNKA 1K92A 4H44B 2CTPA 1AI4A 2GQRA 2EJRA 4W4KA 4X9QA 4I9QA 1P8LA 3NR7A 4DR3H 1M0WA 5IY5B 3U9SA 2AXTZ 4JI8B 4Q4CA 4PA7A 2ZR3A 3X2QB 3HKDA 3NXSA 1GH6A 5KFFA 4H37A 3GIKA 4XX0B 2V59A 2ALZA 1O9GA 3GTKA 2XGPA 3L9DA 2FPPB 5B1AB 1MZFA 3W7TA 4E2LA 2Y4RA 4I55B 3N43B 2H8PC 4YIPA 2ZDIC 3JZFA 3H3VH 1OV9A 3GB7C 2I80A 4NYKA 5KHHA 2QKSA 4UCSA 2LW1A 4CS4A 1ROPA 3SJQC 2AGAA 2HG5C 5FL7G 4JI2H 1I94O 4RB3C 2GUZB 3HPLC 4LFCB 2BQRA 4QGPA 2XC9A 4R50A 2H94A 5C1PA 2P22C 2UUBO 1C30A 2EIYA 3T1HH 5H9CA 2WPDG 2ZXWC 4Z2WA 3UKMA 2HP8A 2P67A 4MTDA 1COWG 2A9HA 4TUYB 4J41A 5KHJA 4D7TA 1FVIA 3SPGA 2UU9H 3EPGA 3I56V 2VR1A 3K5LA 1XMOH 3B77A 1S68A 2UXBO 4H0LB 2QEXV 2ASLA 2ZCEA 4IZOA 2E75B 2YL2A 3G71V 1WH2A 1AR1B 1BQ0A 2VRZA 3V4ZA 4PZ6A 3Q4HB 4LF9O 2B63G 4I7ZB 3BAAA 2ILMA 3CCLV 3GTMA 3JARB 1ZSPA 1TUBB 5ITZA 4BY1G 3E89A 2XCLA 3G80A 4DV4O 1AN7A 5CA1F 4AHCA 3KAKA 4LF8B 4JI2O 4TUYA 3ZHSA 3OUUA 1UPGA 2JEUA 1J5EH 1RYSA 1CP9A 3QNEA 1CS0A 3VPBA 1W59A 3OMIB 3G4SV 5CB4F 5KFXA 4UB8Z 3ZMZA 3UO2A 2R7ZA 4KUMA 4NZNA 3TW6A 2ZNJA 4CH4A 3QQMA 4LNUA 2A7WA 1EHIA 2J9GA 5H5NA 5DM6V 4QJFB 2QR4A 1K34A 4MA5A 4W4LA 1IYDA 4ECXA 1BE3H 3H9VA 4DR1O 3PW7A 4O3RA 1NQTA 4ECQA 2BSKA 4YAKB 1GM9A 2XCAA 4A3KG 1XMOB 3G8CA 1OCCC 3AG1C 5IJ9B 4F6RB 1NU1H 2W9CB 1VQOV 1KBLA 1AI6A 3BHPA 3K58A 1GO3F 1XHXA 2QWRB 5F9LA 4IT5A 3A0BZ 1HW7A 4R7RA 1AI5A 1I08A 1WPBA 1Q90D 2W6JG 2WLLB 4DV1O 4FFRA 3KREA 2Y0SA 1RYRA 2OIEA 1JX9A 1Y74B 4N21A 3N41B 3T5KA 1WSCA 2YI9A 2YU9A 1TWFA 5H80A 3JAMW 2PY5A 2LFRA 1JR9A 4M9UA 2N04A 1JJ2U 4OX9B 5C8YB 1JJOA 1ZWIC 3GWOA 3RV4A 4DRXA 2VQEH 4MTOA 3KKYA 3PN1A 2W8LA 3OMAB 3QO8A 5FD5A 2VPQA 5IYDG 1S0OA 2YIBA 5KLVH 3I4MG 5J2UA 3AG4C 2ETNA 2YRWA 4JV5O 3MFIA 1K33A 1Q6IA 4UV9A 3CRAA 4XDJA 2HVRA 3CCQV 2PMZE 1R6KA 4OX9O 3CCEV 2O57A 1YF2A 1H2SB 3E22A 3U0ZA 4EQ5A 1S76D 1HNWH 2W7PA 5GTIZ 1OCOC 3SYCA 2UXCH 3N6RA 1FKAO 2LGQA 2DABA 1GYFA 3ASNB 4O4LA 3RF2A 1N33O 5EBWC 4A3LG 1KP2A 2EBOA 1N0NA 4TWKA 2Y0IA 4PA6A 4DR2O 4M0JA 4B7EA 1XILA 4DV2B 3DXRA 2DAAA 4RZQA 4JV2A 4DK0A 2UUBH 3ZHTA 2AGPA 1XI1A 3E86A 2GPSA 3MDSA 4P9OA 1GMGA 3E2EA 4DR4H 1Y76A 2V1DA 1Y4MA 2R8HA 1S0MA 1KJJA 3GVMA 4CC5A 5IWAO 4OX9H 4A5UB 2C00A 2YEVA 3AK3A 1HNZB 5L1JA 1S03G 4YBZB 1TVKB 1AR5A 4OPAA 1JFFB 3G6EV 3ABMC 4LFAH 2HGSA 1RK6A 5I5YA 1EZJA 2ITCC 2Z5UA 2PI5A 2CZGA 1N0JA 5DGIA 4QWCA 2GHYA 4LF6H 3M8AA 5HFLA 2NVXA 4DV7O 2AU0A 1EN5A 1IX9A 2NR5A 2PGGA 3ZMVA 2A0LA 1J5EO 1M7JA 1K5SA 4LF9B 2YRXA 1N32B 4GKKH 5JUMA 4I7HA 4J7JA 3FMAA 5KFTA 5FLXW 2XAJA 4BAYA 5I60A 1HR0O 4O7YA 4O4JA 3KTMA 1E4FT 3FKIG 1MMMA 2QKCA 3OTFA 4YY3B 3GILA 4RUFA 4JYCA 1FXVA 1BSMA 3ZIAG 3THOA 5KX5A 4RCNA 5LOVF 1P16A 3SPJA 3I4NG 2VUGA 1I0HA 3EPIA 5KFCA 4HBNA 4KHPB 4DR7B 3T54A 2BTOA 4DV0O 5LHGA 3RGZA 3QO7A 2Z3YA 1S97A 4JI4H 1P4RA 4QIWE 5DEDA 3LDDA 2F95B 4UUJC 4F6EA 1Q6HA 4HNUA 5KFDA 2IJIA 1P7GA 1ET0A 2VQFH 2L35A 2ZJTA 5BWUA 4DL5A 2AQ4A 4JI1B 2NU8B 1IXMA 1XL6A 2DQ0A 1KQSU 5DG8A 5KFZA 3RYFB 1W0KG 4ETSA 1R9TA 3ZMTA 2ZINA 3ZCCA 1CE8A 1XREA 3CE2A 4LP8A 2ZD9A 2GPWA 2ZM6B 3U54A 1DGSA 2E5LB 1IBLB 4DL7A 2F43G 2EJ2A 4PA9A 4ZI7F 1OCRB 1I3QA 4GKKB 1N32H 2R7KA 4DR5H 3TY5A 1NR7A 4LFBB 1E1QG 3LDCA 3J7AU 4FS1A 4DW1A 5LMUH 4L87A 1I5XA 3WB0A 1BXRA 3SNOA 5LA6A 1G6UA 4EBDA 3BQ1A 3DTUB 1Q8IA 2GTSA 2KB1A 4DV2O 2CKZB 4IAJA 1K83A 3JD0A 4DK1A 3Q8RB 4ICGA 2W6ZA 5KFNA 3B2EE 3K57A 1N36B 3M9OB 1TVKA 4B3TB 5K2MA 5JQGA 2DOSA 3GJXB 1A32A 5JJEB 2NU9B 2YZNA 4CE5A 4B08A 2UXDO 4DL4A 5C3EG 4LF5H 2MCTA 1QR9A 3BJYA 2DWEC 4RAZA 4CZZA 1WLEA 1R6TA 2RGVA 4QWDA 4JYAH 4X65B 2HG8A 3RIZA 2J6TA 4LFBO 1PD3A 1VQPV 3M9MB 3RBZA 1R1BA 3DC5A 2C2RA 3KZIZ 5EC2C 1AJNA 5IT9W 5GONA 5B1OA 5IWAH 3WFVA 4JI8O 1PK8A 5HV6A 2COGA 1KYOF 1KECA 2E74B 1XNQO 4YY3H 2WA3A 3QFFA 4PA3A 2V4DA 4DRFA 4D6TH 1A0IA 3ABLC 1RPOA 2HIVA 4WFGA 3WU2Z 2AHZA 4A3GG 3H1HH 2LP7A 2VUMG 4X20A 3T4DA 2ITDC 3JAKB 2W6QA 1VQ9V 5B3SC 4K8ZA 2OWOA 4X65O 1JDBB 4LF4H 3K5MA 4WHXA 1AROP 3LMLA 3UZBA 4MTFA 4J9RA 4A2BA 3JD4A 1AP6A 4O86A 3VQWA 1FXHA 3MR2A 3ASNC 1GRJA 4TVIA 4BW5A 2DYSC 2WLKA 4MVUA 4LWSA 2HHHH 2FK1A 2IJJA 1ZQ7A 3CCJV 3OHBA 4TQDA 2QTOA 1VQ5V 1EM1A 3BEHA 4RB0A 3KYHC 3GV8B 1QLEB 4B3TH 3IAYA 1FJGH 5C5JA 3ZRWB 4DUYO 4DR3B 1XMQO 5KG2A 1TGOA 2YUAA 4EFEA 5IY5C 5EWGA 1KEEA 2B1IA 2KKWA 4WFEA 1K7DA 5EIBD 1JOYA 3IG0A 4X88A 1DLBA 3T5HA 2R82A 3CRCA 5IE9A 2W7OA 2DLNA 3R5XA 2VA3A 4FVMA 2NNUA 4JTAB 1OCOB 4JI7B 4MV9A 2IJKA 1Z2PX 3ZRXA 3MFHA 1M57C 4DV1H 3JZ6A 2IP4A 1SA0A 3K3PA 4HNVA 4UCUA 2WLIB 3OT7A 2FMAA 3UYYA 3CMEV 1NVPD 4DR5O 1GSOA 3QG5A 3OHAA 4JI6H 1KTAA 1U96A 5LOVB 2HHFB 3FDSA 1NTKH 1HNWB 2BQUA 2R9IA 3NUAA 5KFEA 3RT3C 1YEWA 3PFFA 1NJIW 2I87A 4AYBE 5E1AC 3A8TA 2ZE5A 4FLWA 3BFRA 3BVOA 4GKJB 5FNVA 2Q7DA 4C5BA 1V51A 1AVMA 5AG2A 3OGIB 1A9XA 2OT5A 4JI0O 1S9FA 4ED3A 2E76B 2V7QG 1YIJV 2Z04A 5FLMG 1SQPH 5EDWA 1EKFA 4JPRA 4AILC 1J95A 1XNQB 3GV7B 5KFYA 2J6UA 1S5HC 2BOCC 1FD9A 2IH1C 4JI3B 5LHHA 1Q86W 1HNXO 3D36C 3G6YA 3HKBB 2LFSA 4LBEC 3GTLA 4PA4A 1YJNV 3Q4HA 5J2TF 1B6SA 2P4KA 5ITZB 2R8IA 2HJDA 1BMFG 3MAQA 4DV4H 3GIQA 4AI8A 4RUEA 4I55F 1XL4A 3RW0A 4B3MH 2F4VO 4RUCA 2EJ3A 3RVZA 1TWGA 3ABMB 2AW9A 1K1SA 4YQWA 3P32A 2HHHB 3CJHA 3AG2B 4YJ3B 5JQGB 4LF4B 2YWVA 3WNZA 2QYZA 3W5OA 1S72V 2A06H 4TQFA 5JH7F 1X4TA 5KFKA 4RB1A 5IYZA 2V9WA 5CE8A 4X62O 4AQYB 4FFOA 3CRMA 2NN4A 1RM1B 2OYQA 2RN9A 4B3SB 5KG6A 1K97A 2F66C 1YDXA 4O84A 1VP7A 1A48A 1VIBA 4O2AA 2E2HA 2YYAA 3UO3A 2DZDA 4C2MA 3ZRSA 4TM5A 4O7ZA 3O9OA 2OTJV 4TUYF 2XGQA 3T1YB 4I50A 1MG1A 1K8AW 2EZPA 5EZYB 3HOZG 1PKXA 5L3BA 3H0GG 4YR0A 5KFVA 1EYZA 2QSAA 2CAZC 2P90A 4YIOA 2K1EA 3N44B 5JQWA 5JVDA 1YHQV 5L1LA 2CGNA 4GLWA 4Q20A 2EILC 3TXSA 1PX2A 2V5AA 5BR8O 4B3SO 2DYRB 3VPCA 1Q81W 1QVGU 4NB5A 3ABKC 3BQ2A 3WWHA 2HR3A 5DG7A 2BQ3A 3T1HO 3PZPA 4ECSA 4ECWA 1H8EG 3RYIB 1N36H 1B04A 2EIMB 2EJ7A 3BY6A 2MK3A 1AUVA 2RMKB 3HBLA 1YI2V 3RVYA 4WFHA 1FAFA 5K3WA 5LMNH 2WWWA 4IIJB 4CKCA 4NTWA 4X1KA 5KFLA 2YS8A 1PM9A 4JV0A 3QO5A 4X1IA 2UXDH 2PI4A 2VQFB 1ULZA 2MW2B 4ZBMA 4JI3O 3TY9A 5KKNB 3K5HA 3MD0A 4HYOA 3VMMA 1TAEA 1MZBA 1R3LC 4L8JA 4ECYA 3DF7A 1S0VA 1VARA 5EZYF 4DV3O 1IBLH 1SESA 1I2KA 5LGUA 2EX3A 5HFMA 1YTFD 4TQRA 2IBKA 4IYHA 4TQSA 3ABLB 4JYAO 1F7YA 3T99A 4J7ZA 1Z5WA 4LFBH 4NLGA 5KFOA 2X7RB 1RP3B 3CSXA 1V9PA 3KALA 2YIDA 4MVMA 2HVJC 3UFXB 3HO8A 4O83A 3V6JA 2ABJA 1IBKB 1VKZA 2R7LA 3R5FA 5HBRB 2WLMA 1QQCA 5L3FA 5DQGA 5EYPB 2D3OW 2M7WA 4DR5B 1IYEA 1GN3A 4YJ2B 4ABMA 4CBCA 4O7TA 3EYYA 4GX2A 3GDEA 2EIJC 5KS8A 3H1LH 2VOBA 2UXXA 1KJIA 3RJ0A 2B9ZA 2IA6A 1I50A 5KG1A 3T5LA 4FPPA 4ZIBA 5DECA 1EUCB 4X89A 2J6SA 1OBDA 3TQ1A 4EKWA 4FFBB 2YEVB 1HNZO 3AK1A 4ME6A 3R5HA 1G4YB 1KT8A 3TIGA 3HOYG 1US6A 3MWDA 2CW8A 3JAKA 2WE6A 3HKZE 4F4XA 4KFMA 2JEXA 5GW7A 1VS0A 2GQSA 2VA2A 4KXRA 2XCPA 4AQYH 2CH7A 4DR6O 3B40A 2JEIA 4QWEA 3HOUG 2ZE8A 3CS5A 3L4KA 2PYJA 4PZ7A 2CTRA 4FBUA 3STZC 2F23A 1UC9A 4RUAA 2Q7HA 2RF4A 3FB5C 5LL6Y 1WA8A 1NVPB 4O7RA 1GO3E 3QWUA 4ZHQA 4NXNO 3ZN1A 5BZBA 4LF5O 2KG7B 1XHZA 1R6NA 3BCCH 5DGHA 2W57A 3VBBA 2X6CA 3C3SA 4HAMA 1M9NA 4GYCB 4YHHO 1I7FA 2UUCO 1VEWA 4X8AA 5IWAB 1HR0H 3BABA 3JSLA 4F4WA 5CB4B 2YS7A 4QPJA 1KC7A 3WG7B 2X0SA 4OGQB 4JZ2A 3SE7A 4EGQA 5JVLA 4O3SA 4JI6O 2HVSA 4P9PA 2DW4A 1HNZH 2JEJA 3PR4A 3PW2A 1JCHA 1F4NA 1R3KC 3OTOH 3DSQA 4QWBA 4I4TF 2X6AA 1IBMO 3GIMA 1F51A 3GB8B 1QU7A 4J9OA 4EGJA 4Q43A 3IGAC 4P2ZA 2UVVA 4D7SA 4ECZA 1XDCA 3E5NA 3ML0A 1PL4A 2HGXA 4J9MA 4GKJH 4A3EG 4F4LA 3N2GA 5IT9N 3ETDA 1KKDA 2FTKA 1KUTA 1M57B 4WCEV 5C8YA 5B1AC 4U7NA 3KCYA 2JGDB 1ZL8B 5CMUA 2FMLA 5DAAA 4NXNH 5B1BB 5FJ8G 4LH7A 1KU9A 3Q2OA 4UV8A 3M4IA 5I5TA 1G1XB 4F4ZA 4JI3H 4QWAA 3DC6A 2JRIA 2AZ0A 2NVYA 1VQ4V 1YJWV 4JI5O 4J9SA 3F7YC 2WLJA 5F9NA 3CB2A 1QR8A 4ASUG 4UVAA 5LXTF 4IHJB 5BY1A 2OLSA 2YXHA 1L2ZA 2Q73A 5JJNB 3TK1A 1U97A 3GWKC 1ZX3A 1B33N 2EZOA 2W6PA 1SZTA 4JTCB 2Q6AA 1UFIA 3DGEA 2CNVA 2W9AA 4UUGA 2NU6B 2QE7G 3IN5A 5BWWA 3Q8QB 3B8MA 4Z1VA 4FFPA 2R6FA 1WB7A 2COJA 4LSXA 1K4CC 2CNUA 1ZTEA 3K06A 5DGAA 3K5IA 3PO3G 1SQXH 2IU3A 2Y4TA 3APOA 1OJHA 3KCXA 4JGSA 2XHBA 2LO1A 2DWCA 1NH2D 5EBMC 5IYBG 2UUAB 5IDJA 2LW7A 4GLXA 5BWXA 3Q8SB 1B06A 4WF9V 5D5QA 4XYMB 2W0XA 1Y1WG 1MOFA 1X59A 5FLXN 3I12A 1OCRC 2JA6G 3V4SA 5KAIZ 2HVQA 4G2KA 3K3WA 2BE3A 2JA5A 5KG5A 1PP9H 2CUGA 4TV9F 2B1GA 2VQEB 3H20A 1B6QA 3HXLA 4O4IB 1CKMA 4K3AA 1S3JA 4KHPO 1HDJA 4UFZA 3N8DA 3T4ZA 5BPHA 4FFNA 4ECUA 2N74A 5KG3A 3AX6A 2RDIA 3IJ4A 4X62B 4AQYO 1PL0A 4KP4A 4O4IF 2WB1E 2DPJA 1WAZA 5IYCO 3LWBA 2AHYA 2QM4A 3LSUA 4J10A 1P84F 4FFLA 3M9NB 3VOUA 4TV9A 2EJ0A 4X65H 2IMWP 3L74H 1H2KA 2Q0OC 3RWRD 3CCUV 1R3IC 4I4TB 4ED8A 3ZHQA 3I55V 1FFXA 3TY8A 2WB1A 3TJTA 3GIJA 1FJGB 2JGDA 4CH5A 5BYBA 3ABUA 3GIDA 2C2DA 2DYRC 1JA8A 5I5UA 1Q3EA 3SPHA 3M7MX 3L2PA 5IYDO 4B3RH 2R93A 1VBGA 2FE3A 3JZIA 4JTDB 1WP7A 1CPYA 5FR9A 2R8KA 4DXWA 2IH3C 2WTFA 1SC5B 4FM2A 5DGBA 1SZXA 4K35A 3UCSC 4DV2H 3X2QC 2YIBD 5KFGA 4K0KB 2Q7EA 1IOVA 4DQNA 4GC6A 3K0DA 3BPZA 4MTGA 5GONF 1IVSA 4Q45A 4JYYA 2HJWA 4PDLA 5CB4A 3SJCC 5KFBA 3H4BA 3OEEG 5A2QN 1R73A 4NXMB 4X66O 1DV2A 1Z2GA 3OAAG 1WP8A 2KG7A 4X64O 2X5RA 5E25A 3JD3A 3STLC 3R65A 3RYCB 4DV7B 4O82A 4MTXA 3F8NA 5KFQA 4YR3A 3FB8C 1K1QA 5KFPA 1PV0A 3K59A 5BWTA 4FE2A 2COIA 1Y67A 3ZRWA 4PD4F 2XASA 5KFSA 3RB6A 4G3IA 3N6XA 4LFCO 4UXNA 1N4CA 1H8HG 4JXUA 3L70H 4MW8A 2WA4A 3UQ8A 2PTMA 3ABKB 2VQFO 3SPIA 3LSQA 3WO0A 5GTHZ 5IP9G 4IIJA 3G8DA 3L71H 4F50A 1YXBA 4YHHH 2UUCH 3PW0A 4GC7A 2HEPA 4DL2A 1AB3A 2CTQA 4Q4DA 1QVFU 4RZRA 5EIBC 1IBLO 3GTPA 1JKJB 4XYLB 5CBHA 5KG7A 1BZKA 5LMUB 4FLVA 2ADQB 1FXKA 1N8RW 4DR4O 3LNNA 1ZUQA 3RYFA 2UUAO 5EWEA 5LXTB 3CEBA 1IOWA 3CRQA 4LFAO 3GTOA 1QCEA 4YJ3F 2HVKC 3U55A 1N34H 3T7AA 2A1HA 2YIAA 5KUMA 4KHPH 3K9SA 1XQ8A 4LFCH 2LQTA 2XT9A 3W7WA 2CGOA 4JI6B 3OEHG 5LHIA 3L73H 1NH2B 3H1KH 1K3EA 3VQXA 1CKOA 1Y66A 1L0LH 1KJ9A 1SQBH 4CKEA 1T5EA 1O75A 2W9BA 4ZI7B 3U9TA 4HNAB 1S5LZ 5JVDF 1OCZB 2ARHA 4JV5B 4A3DG 4U7OA 1XNRB 3LNMB 4MV7A 3F7VC 4EEYA 3GTQA 2R7ZG 1RJQA 2V58A 2JA5G 5F2VO 4JI5H 1JQ0A 2M05A 5D8DA 2CNQA 4K6NA 2XD4A 4YR2A 2ZQMA 5L3EA 3W1GA 4CC6A 4DR1B 2UVWA 3D8CA 1VQ6V 3RGXA 4E4TA 4O3QA 1ZHQA 4I5SA 4Q8FA 3IC9A 4QE9A 4RO2A 5LP6C 5JH7A 4X66B 3PJSK 4DRXB 2F4VB 1SQVH 1HR0B 4CKBA 1E4GT 4MTEA 5C8YF 2Q5ZA 2P4VA 1V54B 2AGQA 1Z2OX 1H2GA 4O4IA 5C4XG 1JVMA 2FKXA 1VQNV 1R3JC 3A0HZ 3N42B 1TWCA 1Y74A 5KT7A 4DV1B 1WB8A 4GX1A 4FLXA 1HNXB 4IRCA 4A93G 4GUNA 3CSWA 3ETGA 3G67A 3ZHVA 3HB3B 3G6BA 1V4YA 2UVRA 3FB6C 2JIZG 3D3QA 3KXYT 2R92G 2XUMA 3ASOB 2QF7A 4M7EA 1G8MA 2BTQB 4BWAA 1LR1A 1XUQA 4CMFA 4QSHA 3RGBA 5CA0B 1DV1A 4QIWF 1MNGA 1QLNA 2KSWA 2BCCH 1XOUA 4IL6Z 2C2AA 3RR5A 3TW7A 4DV5O 4Q6GA 2FP4B 3ORQA 4O3OA 3T1CA 4ED2A 3GLKA 3B4SA 5IYZF 5DISC 5CAEB 1BQZA 4FIPC 2QGNA 4KL1A 2RDJA 3OUFA 5FD6A 2WLNA 1RK5A 2JA7A 1KUQA 1KJQA 4FZ1A 2W6OA 2FKLA 5CN0A 2ZDGA 2CFMA 3DXRB 1MABG 4PDBA 5IYBO 4AYBA 1L0NH 4WFBV 4YXWG 3RBDA 1W0JG 5H2FZ 3JRWA 4IHJF 1GAXA 3JYCA 1SQQH 1JLLB 4EBEA 2UUBB 3M99B 4X62H 2B63A 2YZGA 1THZA 4WFFA 1K5QA 1M4UA 1I94B 4PELA 3VQYA 5KMGB 4O4HF 1M56C 3V6KA 3PW5A 3RB3A 2RGRA 3J81N 4DW0A 3AG2C 4J80A 1W93A 3LQSA 4O3PA 1LUVA 4BXXG 5LGTA 2EULA 2WLHA 4LR3A 2PN1A 1M93A 1YITV 2QM7A 3AW8A 1V54C 1VF6A 2FL4A 3T1HB 4NVPA 4H33A 3AK2A 2HGWA 2Y48A 5KA6A 1X9NA 5BWRA 4EYIB 1EFRG 1XNRO 2FK2A 3U10A 1T3NA 2QWPB 5KG0A 4JZGA 1RPRA 1M1KW 2NU7B 4O2BF 1N33B 1SF9A 2CTWA 4JI5B 3FAVB 5L9XA 4BBSG 2EIKC 1VMGA 2EIMC 2GUZA 4MVQA 3DTGA 4FLZA 2PYLA 3OMNB 4JI0H 1FFXB 4PDRA 4G28B 4MV6A 1EKPA 2CE4A 3ZMUA 2W6IG 2PZSA 1PPJH 4IWYA 3WO1A 4FZ0A 4I55A 2XAQA 3VQVA 5LXTA 3CXHF 1E4EB 1GM8A 1Y76B 5BXZA 4DR4B 1NT2B 2K9PA 3CCRV 3L4JA 4LF8H 2A79B 2Z0AA 3HKBA 4DV3B 2WAQA 4JV1A 3SR2C 3JALA 3HKEB 4RNOA 1IBKH 3CX5F 2HIXA 3C3TA 1AILA 2Q68A 4H13B 4R6ZA 1Q43A 4XDKA 4A3IG 5J9PC 1DTOA 3BRCA 4YP3A 4FBTA 4YAJB 1SS3A 4LH6A 4X64H 5L1KA 2GLTA 3I5DA 5L3GA 3OTOO 4XDLA 4FLTA 3H1JH 1SKVA 1LNQA 3K0GA 4FK5C 2RJZA 1BHBA 4MA0A 2ODMA 1HP8A 2ZM6H 5LBQA 5D1OB 4FMTA 2C22A 3ZRVA 2DWDC 1SQFA 4YHHB 2UUCB 1D2DA 3NBYB 2OCCB 4B3TO 2QDOA 3Q8PB 1DF4A 3MWMA 5KHGA 2KQXA 2XAHA 2HHFA 3K3VA 2VS0A 3RN4A 5CA0F 2YDEA 4TV9B 2WLIA 4RAYA 1SA0B 2YXYA 4J42A 4IRKA 1SETA 4ED1A 3SI8A 4IGGA 1MZEA 1I1KA 4CS3A 4JI1O 2R7NA 4DO2A 2EINB 3CRRA 3EFFK 4YJ2A 3DTFA 2QJ1A 2ZDQA 1WRVA 3SYOA 1SYXB 3OTOB 4PBCA 5KFHA 1VQ8V 3WB2A 4MV4A 3QZ7A 2DN9A 4O7SA 3T5JA 3R66A 5KMGA 3CD6V 2W8KA 3EHBB 2W6MA 5KT4A 3SYPA 1BS3A 3W7SA 5KFWA 4A3JG 4A3FG 4DV0B 5EBLC 1Y1WA 5KFJA 2ZM6O 2X0LA 3VPDA 1CXZB 5KT2A 2IJHA 3QTCA 1WPXA 4I0XA 2R72A 4F6RA 2AZ2A 1S77D 5KHKA 2HFEC 4O4JF 4B3SH 5J2TA 2XIGA 1O9HA 4IYIA 2Q69A 2QK4A 1XDNA 1EZVH 4ED6A 3H01A 3LDEA 2YI8A 3RFCA
chains in the Genus database with same CATH topology
1N32B 4GKKH 4LH7A 1KU9A 4O2AB 4UCVA 4I7HA 4RB2C 3M4IA 3NC0B 3FMAA 4LNUB 4JI3H 5FLXW 2JVDA 3BA8A 3K5NA 4O4JA 4EFBA 1E4FT 4LF7H 3OTFA 4YY3B 5J2TB 1SEIA 1XNRH 3CB2A 3ETQA 3N40P 3JASA 4IHJB 5D1PA 4X66H 3THOA 5KX5A 1L2ZA 5JJNB 2E3CA 1SQGA 1P16A 4JI2B 2VUGA 4HBNA 4KHPB 4DR7B 2BTOA 3ZEDA 4DV3H 3JARA 3RGZA 5K1XA 4CH6A 1I94H 4JI4H 4K0KH 4EB6A 4LSXA 4X1KB 4JI4B 5JH7B 4CH3A 3RYHA 2F95B 4U3JB 5IJ0A 4DUYH 3WB1A 4DV7H 2R70A 4DUZB 4BWSC 4U3JA 5IJ0B 2VQFH 3RYHB 2ZJTA 2XHBA 1XMQB 4JI1B 4LFAB 3T1YH 2UUAB 3RYFB 4GLXA 4JV5H 4LF7B 4ETSA 4LF9H 2ZINA 5D5QA 2P5OA 4X1YB 5JCOA 2R9AA 1TA8A 5EOYA 2GV9A 2ZM6B 4DV5H 1DGSA 4O4HA 1IBLB 2E5LB 2HVQA 4FM9A 4GKKB 1N32H 4DR5H 3TY5A 2WYOA 3E22B 4LFBB 1N33H 1Z2NX 3ICXA 4I50B 2UXBB 2VQEB 3CVZA 3H20A 1VF7A 3HXLA 4O4IB 1CKMA 4UFZA 5LMUH 3WB0A 5LOVA 5LA6A 1G6UA 5JJJB 1HNXH 4X62B 1FKAH 3JALB 1Q8IA 5GONB 4IAJA 4JI7H 4DK1A 3B2EE 4NXMH 2QM4A 3HKDB 3A2FA 4O2BA 3K57A 5D5PA 1N36B 1TVKA 4B3TB 4TV9A 4X65H 5JQGA 2CW7A 4X64B 3JASB 4IHJA 3GJXB 3N2KA 4UCOA 1ZAUA 5JJEB 3SJBC 5FNVB 3RWRD 4B08A 4I4TB 4O4LB 4LF5H 1FFXA 1D5AA 4FM1A 2MCTA 3QF7A 3TY8A 4RAZA 4JI1H 4JYAH 1P49A 2RGVA 3RFRA 1FJGB 4CH5A 4X65B 3RIZA 4WBNA 4FLUA 1XK5A 3N2GB 4O2BB 4EB6B 3RTXA 4CS2A 4LSAA 1Q3EA 5IT9W 3M7MX 5GONA 3L2PA 5IWAH 4B3RH 2FE3A 4YY3H 4FM2A 2V4DA 4K8XA 4DRFA 2UXBH 4FLYA 1A0IA 4Q0YA 4DV2H 3J7AK 2YIBD 2HIVA 4K0KB 2Q7EA 2RQ6A 4X20A 2Q7GA 3JAKB 1Q5OA 3BPZA 4YJ3A 4K8ZA 2OWOA 2ZIOA 4LF4H 3UT5A 5CB4A 3SJCC 3K5MA 3LMLA 4NXMB 4A2BA 5BR8H 3VQWA 4APMA 2UUAH 3RYCB 3F8NA 4DV7B 5LMNB 2JS5A 2HHHH 2VPSA 3K59A 4LF5B 4TQDA 5EYPA 5LP6B 2UXCB 4RB0A 3KYHC 3SJAC 4B3TH 3HKEA 3IAYA 3N6XA 4WBNB 1FJGH 5LP6A 1I6UA 5A2QW 4DR3B 1TGOA 4EFEA 3UQ8A 1XNQH 2PTMA 5EZYA 3VNNA 5D1OA 4UCTA 4DV5B 2KKWA 4ZI7A 4DR1H 1CKNB 4IIJA 5KHIA 4DR2H 5EIBD 3IG0A 3JAWA 4YHHH 2UUCH 3U11A 2HEPA 4I4TA 4FVMA 5EIBC 4JI7B 4MV9A 3RYIA 1Z2PX 5FPRA 4X1YA 5LMUB 1JMKC 5LA6B 5J2UB 1N34B 3J81W 4PZ8A 4FLVA 4DV1H 1SA0A 3LNNA 3RYFA 4UCUA 5LXTB 1IBMH 3QG5A 4JI6H 2VWKA 2PUSA 1S5JA 3JSNA 4TV8B 5LOVB 4DV4B 1HNWB 3S24A 2ZIMA 3C0FB 1N34H 2YIAA 5JCOC 4KHPH 1YEWA 1XQ8A 4LFCH 1WN7A 4JI6B 1XMQH 4FLWA 4LF6B 5LL6b 3VQXA 4GKJB 1CKOA 5FNVA 1T5EA 3K5OA 4DUYB 4JYAB 2Q2UA 1O75A 4DUZH 4ZI7B 4HNAB 4JV5B 1XNRB 4I9QA 4MV7A 1P8LA 4DR3H 1L8DA 4FM0A 4AILC 1XNQB 1M0WA 4JI5H 4JI8B 4JI3B 3W1GA 3HKBB 3HKDA 4CC6A 4DR1B 3RGXA 1O9GA 1ZHQA 5LP6C 5JH7A 4X66B 1BJTA 3N43B 4I55B 4DRXB 5ITZB 2F4VB 1ZHSA 3RYCA 1HR0B 1E4GT 4DR6H 4MTEA 5KHHA 3MAQA 4DV4H 1Z2OX 4UCSA 4O4IA 4CS4A 4PI0A 4JI2H 3N42B 4B3MH 2UXDB 4RB3C 4PI2A 4DV1B 4LFCB 2HHHB 4YJ3B 4FLXA 5JQGB 1HNXB 4LF4B 3J80W 3W5OA 2P22C 3T1HH 4DV0H 2JGUA 2BTQA 2Q2TA 4TQFA 1X4TA 2F93B 4RB1A 1M0TA 5IYZA 4AQYB 3KXYT 4ZOLB 2UU9B 2O03A 4M7EA 4MTDA 4TUYB 2OYQA 3ZS8C 4D7TA 5KHJA 2BTQB 4BWAA 1FVIA 2UU9H 4B3SB 5LYJA 1BGWA 2F66C 5BMVB 3K5LA 4O2AA 1XMOH 1S68A 3RGBA 2ZCEA 5CA0B 2E5LH 1WNSA 3T1YB 4I50A 2KSWA 1WH2A 5EZYB 3RR5A 4Q6GA 2CAZC 5CA1B 4PZ6A 4LMYA 5DISC 3BAAA 4A2AA 5K1PA 3N44B 5JVDA 3JARB 1Z5VA 3NBZB 1TUBB 5ITZA 4KL1A 1M5IA 4B3RB 5FD6A 1AN7A 4TV8A 5IYZB 4AHCA 3KAKA 4LF8B 1JFFA 2CFMA 3JATA 4TUYA 4PDBA 1J5EH 4DR2B 5BR8B 1RSOA 2UUBB 1N36H 3RYIB 1B04A 4X62H 2ZNJA 5LMNH 4CH4A 4IIJB 4TOIA 1M4UA 1I94B 3VQYA 5KMGB 4LNUA 2RGRA 1KMIZ 5CA1A 4O4JB 4X1KA 1CKNA 4X1IA 2UXDH 4ZHQB 4DV6H 2VQFB 4LR3A 5FPOA 1M93A 3TY9A 5IJ9A 5BMVA 3CHXA 1TAEA 2IM9A 3T1HB 1XMOB 1MZBA 4L8JA 4NVPA 5IJ9B 3DF7A 3HKCB 4F6RB 1X9NA 4EEQA 3U10A 1IBLH 2EX3A 3BHPA 3K58A 1XHXA 4JI0B 1HW7A 4R7RA 4BW9A 4JI8H 1Z5WA 1WPBA 1N33B 4HNAA 4LFBH 4JI5B 4DR6B 3CSXA 1V9PA 3KALA 3N41B 4FLZA 4FFBA 2PYLA 4JI0H 1FFXB 2YI9A 3JAWB 3JAMW 2PY5A 1QHTA 1IBKB 2PZSA 4OX9B 5C8YB 1JJOA 1J5EB 4I55A 4X20B 1QQCA 3VQVA 4DRXA 5LXTA 2VQEH 3PN1A 4DR4B 1NT2B 5FD5A 3L4JA 5EYPB 4LF8H 4DR5B 3EYYA 4YJ2B 3HKBA 4DV3B 4DV6B 4B3MB 3SR2C 3JALA 3GDEA 3HKEB 4DR7H 1IBKH 2YIBA 2HIXA 1TUBA 2VOBA 3RJ0A 1IBMB 5J2UA 1Q43A 4ZIBA 3BRCA 5KX5B 4FFBB 2HVRA 4UCRA 3E22A 1H2SB 4LH6A 4X64H 3U0ZA 2VWJA 4EQ5A 3KAJA 2CW8A 3JAKA 2WE6A 4J0MA 4FLTA 1HNWH 1SKVA 2RJZA 5LYJB 2ZM6H 1VS0A 2UXCH 4AQYH 5D1OB 1GYFA 4YHHB 4O4LA 1SQFA 2UUCB 3NBYB 3RF2A 4NXNB 3MWMA 2YXLA 5KHGA 2PYJA 4PZ7A 3L4KA 3K3VA 4PHZA 2F4VH 2Q7HA 2F1MA 4TV9B 4DV2B 4RAYA 3JATB 1SA0B 3FFQA 4RZQA 3QWUA 4DK0A 4ZHQA 2UUBH 1XI1A 1XHZA 4CS3A 2W57A 2WDTA 4GYCB 3SGIA 1I7FA 4YJ2A 2QJ1A 5IWAB 1HR0H 3BABA 3JSLA 4X1IB 3UT5B 5CB4B 1SYXB 2Q0AA 4DR4H 3OTOB 3WB2A 5KMGA 5CA0A 2HVSA 4CC5A 1HNZH 4O4HB 4OX9H 1HNZB 1S03G 4DV0B 1TVKB 3OTOH 3DSQA 1JFFB 3N2KB 3GB8B 4LFAH 2HGSA 4ZOLA 2YCHA 4D7SA 3HKCA 3QTCA 4F6RA 2R72A 5KHKA 3BA9A 4GKJH 4B3SH 5J2TA 2XIGA 1O9HA 4LF6H 3N2GA 2ZNIA 1XDNA 2PGGA 5JVDB 5C8YA 2YI8A 3W1BA 4E6NA 4LF9B 4NXNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 B;  4LH7 A;  1P8L A;  4UCV A;  3RTX A;  1XNQ B;  1N33 B;  3NC0 B;  4JI8 B;  4JI5 B;  3BA8 A;  4JI3 B;  4DR6 B;  3L2P A;  3W1G A;  1V9P A;  4CC6 A;  4DR1 B;  4EFB A;  4YY3 B;  1XK5 A;  4X66 B;  5D1P A;  4DRF A;  2F4V B;  1IBK B;  4OX9 B;  1HR0 B;  1A0I A;  1J5E B;  2HIV A;  4K0K B;  4UCS A;  1P16 A;  4JI2 B;  3PN1 A;  4DR4 B;  2VUG A;  4DR5 B;  2UXD B;  2OWO A;  4DV6 B;  4DV3 B;  4DR7 B;  4B3M B;  4KHP B;  4DV1 B;  4LFC B;  3GDE A;  2HHH B;  2HIX A;  1HNX B;  4LF4 B;  1IBM B;  4NXM B;  3W5O A;  4JI4 B;  2Q2T A;  4AQY B;  4DUZ B;  2HVR A;  4DV7 B;  2UU9 B;  5LMN B;  4UCR A;  1FVI A;  4LH6 A;  4B3S B;  4LF5 B;  4EQ5 A;  1XMQ B;  4JI1 B;  2UXC B;  1S68 A;  3KYH C;  1VS0 A;  4LFA B;  2UUA B;  4GLX A;  3T1Y B;  5D1O B;  4LF7 B;  4YHH B;  2UUC B;  3RR5 A;  3NBY B;  4DR3 B;  4EFE A;  3UQ8 A;  4NXN B;  4PZ6 A;  4PZ7 A;  3VNN A;  5D1O A;  4UCT A;  5DIS C;  1TA8 A;  3BAA A;  4DV5 B;  2ZM6 B;  3NBZ B;  4DV2 B;  1DGS A;  1CKN B;  2E5L B;  1IBL B;  2HVQ A;  4B3R B;  3QWU A;  4GKK B;  4LF8 B;  2CFM A;  3TY5 A;  4LFB B;  3SGI A;  2UXB B;  4JI7 B;  2VQE B;  5IWA B;  3BAB A;  3JSL A;  4DR2 B;  5FPR A;  5BR8 B;  1CKM A;  3OTO B;  5LMU B;  4UFZ A;  2UUB B;  1N34 B;  1B04 A;  4PZ8 A;  2HVS A;  4UCU A;  4CC5 A;  4X62 B;  4TOI A;  1I94 B;  1HNZ B;  3JSN A;  4DV0 B;  4DV4 B;  1HNW B;  3S24 A;  1N36 B;  1CKN A;  3GB8 B;  4B3T B;  2VQF B;  4X64 B;  5FPO A;  3GJX B;  4UCO A;  1ZAU A;  4JI6 B;  3TY9 A;  3BA9 A;  4LF6 B;  1TAE A;  3T1H B;  1XMO B;  1XNR B;  4GKJ B;  1CKO A;  3TY8 A;  1X9N A;  4EEQ A;  4DUY B;  1XDN A;  1FJG B;  4JYA B;  4X65 B;  2Q2U A;  3W1B A;  4JV5 B;  4E6N A;  4LF9 B;  4JI0 B; 
#chains in the Genus database with same CATH topology
 2JEG A;  5I5W A;  3JD2 A;  2W71 A;  1ZL8 A;  2WAQ E;  3NC0 B;  5B66 Z;  1RJR A;  2ASD A;  5LP6 F;  4RNM A;  3UM7 A;  3K03 A;  4IRD A;  3K9A A;  1VF6 C;  3HT5 A;  5J2T B;  1SEI A;  5I5V A;  4JAA A;  1PNL A;  3N40 P;  1KD1 W;  3JAS A;  5D1P A;  4OXS A;  1JDE A;  3L72 H;  4U7C A;  4JI2 B;  1IDS A;  4Y8V B;  3SPC A;  2FLN A;  4YJ2 F;  2Y0P A;  3ZED A;  1KJ8 A;  4DV3 H;  3JAR A;  4A3B G;  5K1X A;  2ZXW B;  4EB6 A;  3FKI A;  5JH7 B;  4CH3 A;  4O81 A;  4JUZ A;  1K9M W;  1URF A;  4UVC A;  2VQE O;  4U3J B;  1VBH A;  2PBZ A;  3ASO C;  2YW2 A;  4DUZ B;  1NI8 A;  4BWS C;  2Y69 C;  5IJ0 B;  3RYH B;  4MVS A;  2XAG A;  1XMQ B;  4R8U B;  1FFT B;  5KG4 A;  1Q6U A;  1RSO B;  2UVU A;  4LFA B;  4RAI A;  2HLD G;  4HR7 A;  5I5X A;  4JV5 H;  1AUX A;  2EIK B;  1YVW A;  4LF9 H;  5C93 A;  3WG7 C;  4O7V A;  4X1Y B;  2R9A A;  4MVR A;  3H40 A;  5EOY A;  1EBO A;  5DLG A;  1L1F A;  1IBK O;  4O4H A;  1Y1V A;  4PJ0 Z;  1EKV A;  4J9Z B;  3UZO A;  4IR9 A;  3HOX G;  4EG0 A;  5B1N A;  2WYO A;  1Z2N X;  1I7L A;  2GBO A;  2JDI G;  2UXB B;  3Q1K A;  1VF7 A;  2ODT X;  1B3Q A;  5BYA A;  4HN2 A;  2Q9L A;  1W96 A;  4DR3 O;  3E8F A;  4RQF A;  3HR0 A;  3B8N A;  3OM3 B;  3P3P A;  4GZR B;  4J11 A;  2XTA A;  5JJJ B;  3OR7 C;  1HNX H;  4C7U A;  1M56 B;  1FKA H;  3JAL B;  2Y4U A;  5GON B;  4JI7 H;  1KB9 F;  4FFM A;  3K04 A;  5B1B C;  1GLV A;  4PDM A;  4WFA V;  4J9N A;  2FLL A;  3GQC A;  3HKD B;  2HDK A;  3A2F A;  4U6P A;  4I0X B;  3JRX A;  3CC2 V;  4FJC C;  4GX0 A;  1H38 A;  2R93 G;  4LF4 O;  2CW7 A;  3JAS B;  3N2K A;  1ZAU A;  3SJB C;  5FNV B;  3FKS G;  4O4L B;  2QB5 A;  2Q67 A;  4FM1 A;  3QF7 A;  3G6V A;  1P49 A;  3OE7 G;  5FNV F;  3N2G B;  1JX4 A;  3CEI A;  1DK1 A;  4L1K A;  2RNB A;  4CS2 A;  1GSA A;  3RAX A;  1KP3 A;  3JCU Z;  1N48 A;  4ECT A;  2UU9 O;  4O7W A;  2OTL V;  4LWS B;  2WSS G;  1ZET A;  5CM0 A;  5LMU O;  1XMO O;  2UXB H;  4FLY A;  3GIP A;  3J7A K;  1GTO A;  3OUZ A;  5KAF Z;  1SER A;  2RQ6 A;  4GKJ O;  2Q4P A;  1WR2 A;  1Q5O A;  1OBG A;  5I47 A;  5BPF A;  3KHH A;  3CJH B;  4YJ3 A;  4J9Q A;  1FXK C;  1F4M A;  3TET A;  4RU9 A;  2WLL A;  3T9C A;  4RQE A;  2FB5 A;  3LSS A;  4MSW C;  1OWT A;  2ADP A;  1GSH A;  1AP5 A;  1FS0 G;  4BY7 G;  3WWI A;  2JS5 A;  4A3M G;  4UB6 Z;  1V55 B;  4LF5 B;  5B3S B;  5LP6 B;  4QIW A;  3CPW U;  1N34 O;  2R84 A;  2UXC B;  2V4R A;  3HKE A;  5LMN O;  3P30 A;  5KFI A;  4MT8 A;  2G38 A;  3N27 A;  2NLJ C;  5A2Q W;  4YY3 O;  1UC8 A;  2FK3 A;  5EZY A;  3VNN A;  5D1O A;  4UCT A;  4IWX A;  4DV5 B;  4ZI7 A;  1MA1 A;  4DUZ O;  2M6Y A;  4QJF A;  4DR1 H;  1UNN C;  5KHI A;  4DR2 H;  1P7B A;  2JJ1 G;  3JAW A;  5A9G A;  3FB7 C;  4I4T A;  2ZE7 A;  4JAV A;  3W7X A;  4FS2 A;  3DAA A;  2B5U A;  1I1M A;  3RYI A;  5FPR A;  2BR0 A;  5LA6 B;  4DV6 O;  4O7N A;  1N34 B;  4MVZ A;  5CBG A;  5JWP A;  3T9F A;  1Q82 W;  3FX7 A;  3OD4 A;  1C3O A;  4IIJ F;  3R9R A;  4ZHQ F;  1EUD B;  2VWK A;  1TWA A;  2PUS A;  1S5J A;  3JSN A;  2R87 A;  1Y6X A;  1F23 A;  3JCZ A;  3TXQ A;  4DV4 B;  1A3G A;  3S24 A;  3PVX A;  3C0F B;  2R92 A;  3VA7 A;  3L75 H;  5JCO C;  5EK0 A;  2XND G;  1FJG O;  1WN7 A;  3TGU H;  1S0N A;  3CP1 A;  1D5N A;  4QPK A;  4LF6 B;  5LL6 b;  3E8B A;  1N32 O;  4ZQI A;  5E79 Z;  4DUY B;  1RFY A;  2N05 A;  1S10 A;  4JYA B;  4DR7 O;  2Q2U A;  4J9P A;  5KX5 F;  3WWJ A;  2JA6 A;  4XZ3 B;  4FU0 A;  1L8D A;  4FM0 A;  2XAF A;  4B7K A;  2EIN C;  5LGN A;  5DQH A;  4Q44 A;  1BJT A;  3TIN A;  3AG7 A;  4MW3 A;  1ZHS A;  3MR5 A;  3RYC A;  4BIU A;  5L1I A;  4DR6 H;  5LA6 F;  3T9D A;  1NBM G;  4G27 B;  4QE7 A;  4PI0 A;  2KSD A;  2FPI B;  2UXD B;  4PI2 A;  1E1R G;  2DQ3 A;  4XBF A;  4NZO A;  2W0F C;  2P0A A;  3T9E A;  3D36 A;  3H0G A;  3J80 W;  1JIH A;  2FLP A;  1OHH G;  4DV0 H;  1GM7 A;  2JGU A;  4MV1 A;  2BTQ A;  2Q2T A;  2F93 B;  4NR1 A;  1M0T A;  3CCS V;  4ZOL B;  2UU9 B;  2O03 A;  1K4D C;  5H6Q A;  4B3R O;  2W9C A;  1DAA A;  3ZS8 C;  2W70 A;  5BWV A;  3OR6 C;  5LYJ A;  2D2C B;  1BCC H;  1A0G A;  1BGW A;  3OSP A;  3E35 A;  5BMV B;  1NR1 A;  4BIO A;  1K73 W;  2H3O A;  2E5L H;  1WNS A;  4NTX A;  2R8G A;  3CCV V;  4A3C G;  5EWF A;  5CA1 B;  5KFM A;  3VOT A;  4LMY A;  4O4L F;  4WD3 A;  5K1P A;  4A2A A;  4JYB A;  3NBZ B;  1Z5V A;  1M5I A;  5B5E Z;  2IBZ H;  4B3R B;  1AI7 A;  5KUK A;  4ECR A;  1GKF A;  4ED7 A;  4TV8 A;  5IYZ B;  1YSC A;  2YIC A;  5IYC G;  1JFF A;  2E2I A;  3MJF A;  3JAT A;  4OPH A;  1IZ3 A;  2R9R B;  2Y0S E;  4I50 F;  3CQZ A;  3BQ0 A;  2HHH O;  4DR2 B;  5BR8 B;  1IUR A;  1RSO A;  3LP8 A;  4O3N A;  4NXM O;  2OH2 A;  4TOI A;  3RAQ A;  1NKD A;  2FB9 A;  3LUL A;  1KMI Z;  3D3I A;  2SCU B;  3PR5 B;  1Y14 B;  5CA1 A;  4JAU A;  2DJV A;  4O4J B;  2DYS B;  1CKN A;  2PF4 E;  4N23 A;  5KT3 A;  1GN2 A;  4PDV A;  4ZHQ B;  4DV6 H;  2E5L O;  5FPO A;  3GII A;  1NS1 A;  4TSF G;  5IJ9 A;  1FXK B;  2WAM A;  2XOK G;  5BMV A;  3CHX A;  2IM9 A;  2C2E A;  3EVK A;  3MR3 A;  2BSK B;  2FPG B;  2YS6 A;  3HKC B;  4EEQ A;  1IXB A;  1VF5 B;  3RBE A;  2CH7 B;  4JI0 B;  4DYL A;  2L6L A;  4BW9 A;  4JI8 H;  4HNA A;  3CMA V;  3APQ A;  1BL8 A;  4DR6 B;  2X6B A;  3OSN A;  1BNC A;  2QWO B;  4FFB A;  4TT3 G;  4F4Y A;  1GN4 A;  2R86 A;  3JAW B;  1EN6 A;  4JAS A;  1GN6 A;  4K0K O;  3PW4 A;  1NTM H;  1QHT A;  3W7U A;  2GSM B;  1J5E B;  5CR5 A;  2AGO A;  4X20 B;  4J7K A;  3E8H A;  3FD9 A;  4RWU A;  5KFA A;  3EXA A;  4DV6 B;  4B3M B;  5EC1 C;  4DR7 H;  2Y69 B;  5HNE A;  1TUB A;  1IBM B;  2ZT9 B;  4Q8E A;  3JAM N;  1EZ1 A;  1T94 A;  3QZ8 A;  1YJ9 V;  5C44 G;  3AYH B;  5LYJ F;  5KX5 B;  3T9B A;  2VQD A;  2R7M A;  4J9L A;  4UCR A;  1EN4 A;  5DLF A;  2VWJ A;  3KAJ A;  4J0M A;  2QTS A;  2I8C A;  5LYJ B;  2A3Q A;  4MV3 A;  3QVN A;  3TII A;  2CDY A;  1I7N A;  2JS3 A;  3BAC A;  4NXN B;  3ZBH A;  2YXL A;  1OZ0 A;  4LC1 A;  2JJ2 G;  4PHZ A;  2F4V H;  3RB0 A;  2F1M A;  2ATL A;  3K79 A;  2ATK C;  3JAT B;  4CMD A;  3FFQ A;  2W6N A;  5I5S A;  3A0R A;  2RDC A;  4JI7 O;  1SCU B;  3ZHU A;  2WDT A;  1QBZ A;  3SGI A;  3HB9 A;  4X1I B;  2YZL A;  3UT5 B;  2Q0A A;  2DE0 X;  4UVB A;  3RB4 A;  2R8J A;  2JEF A;  3S3W A;  5CA0 A;  4ECV A;  4O4H B;  3KHR A;  3IFX A;  5KA5 A;  1I1L A;  3ZN0 A;  2QWN B;  4RNN A;  3K08 A;  3MHS C;  3JD1 A;  3N2K B;  3PO2 G;  3TEK A;  3R23 A;  5KFR A;  4ZOL A;  4FGR A;  4FFK A;  2YCH A;  4BR6 A;  3HKZ A;  4QW8 A;  3HKC A;  2ZKO A;  3BA9 A;  3U0G A;  5KT6 A;  4R8U A;  1W2B U;  2IU0 A;  2ZNI A;  5JVD B;  4O7L A;  3W1B A;  1ZLZ A;  4E6N A;  1VAJ A;  4LF7 H;  3ZX6 A;  3O65 A;  1CEZ A;  1VQM V;  4UCV A;  4O2A B;  2JK5 C;  2QKA A;  2BOB C;  4RB2 C;  2JA7 G;  1XEQ A;  1YTF B;  1Y1V G;  4LNU B;  2OCC C;  1NZ6 A;  3ETH A;  1CQJ B;  2JVD A;  3BA8 A;  2EIL B;  3T1Y O;  1DIK A;  4EYH B;  1JXL A;  3K5N A;  2IW5 A;  2QA4 V;  3FYI B;  1H2N A;  4EFB A;  2Z02 A;  3OFN G;  1XNR H;  1WJZ A;  3ETQ A;  3CXC U;  4X66 H;  3G6X A;  2E3C A;  3CYO A;  1SQG A;  1XBL A;  2ZDI A;  1WCM A;  1BGY H;  4R7C A;  1SRY A;  2W9B B;  5DMX A;  3V6H A;  4C5C A;  3GTG A;  2ASJ A;  4CH6 A;  5JQG F;  3MWE A;  1I94 H;  3J80 N;  1B6R A;  4K0K H;  3H4D A;  4X1K B;  3T2M A;  3ABT A;  4JI4 B;  2QWQ B;  5TIS Z;  3RYH A;  3C90 A;  3ZJZ A;  4LF6 O;  3RUP A;  3H1I H;  5IJ0 A;  5DQI A;  3WB1 A;  4DUY H;  2R70 A;  5J2U F;  4DV7 H;  4U3J A;  3P3N A;  3SYA A;  3CC4 V;  3ZMS A;  4GKK O;  3IC7 A;  2C28 A;  4TV8 F;  3MHH C;  4J9K A;  2DIK A;  3T1Y H;  1GK9 A;  3TQT A;  1T36 A;  4LF7 B;  1Q7Y W;  1DF5 A;  2P5O A;  5JCO A;  1HWY A;  4LF8 O;  1TA8 A;  2GV9 A;  4QW9 A;  1KC8 W;  4DV5 H;  4PWQ A;  4JF3 A;  4FM9 A;  3E22 B;  1TWH A;  1N33 H;  3ETE A;  1QLE C;  2CK3 G;  1SFO A;  2OCH A;  3ICX A;  4I50 B;  4BBR G;  4DL6 A;  3CVZ A;  4CHI A;  1V55 C;  1YZB A;  1OCC B;  3AG1 B;  3F5W C;  2V4Q A;  4Z1M G;  3KHL A;  1HNW O;  5C1O A;  4ZKI A;  5LOV A;  4NTY A;  4HQ6 A;  2NUA B;  2OIG A;  1WCM G;  1YCI A;  2RCV A;  3T9A A;  2Q8V A;  2YZM A;  3TCU A;  1JPX A;  3OGC C;  2C35 B;  2UXN A;  1PNM A;  5DN6 G;  2HKO A;  4NKG B;  4NXM H;  1CQI B;  4DL3 A;  1VQ7 V;  4O2B A;  5D5P A;  1H2M A;  1ORQ C;  4X64 B;  4IHJ A;  4ED0 A;  4DAA A;  3AG4 B;  4UCO A;  4U3F H;  4ZOL F;  4HYK A;  2ZDH A;  1AJP A;  1KKC A;  4MAM A;  1D5A A;  4MS2 A;  2EIJ B;  4JI1 H;  4DIM A;  3RFR A;  3FYE B;  4J9Y B;  4WBN A;  3E8G A;  4FLU A;  1XK5 A;  2YC0 A;  4O2B B;  2PMZ A;  4EB6 B;  3RTX A;  3MR6 A;  4LSA A;  1MSD A;  2DMX A;  3CC7 V;  1H2L A;  5DG9 A;  1WA8 B;  5KT5 A;  4B3M O;  2ZR2 A;  3HOW G;  4GCZ A;  1E4E A;  4YB8 B;  4K8X A;  4LF7 O;  3CWB H;  4Q0Y A;  1QNM A;  5H6R A;  3NGD A;  3OUS A;  1ENV A;  1G2W A;  3ORR A;  2DPI A;  2Q7G A;  2JA8 G;  3E83 A;  3OW2 U;  4GT1 A;  2P6J A;  2CQY A;  3B09 A;  1GGO A;  2ZIO A;  3UT5 A;  1I5Y A;  3AEI A;  4MVO A;  4LCU C;  1FPO A;  5BR8 H;  1UJW B;  3GTJ A;  4NYE A;  4APM A;  1NTZ H;  4DLK A;  4P30 A;  3BG5 A;  4C5A A;  2UUA H;  5LMN B;  2GTA A;  4QNH B;  1VQK V;  3F5T A;  4O2A F;  2VPS A;  2P06 A;  2UXC O;  1MSW D;  1N36 O;  5EYP A;  4NZM A;  4PV1 B;  4HZ3 A;  5IP7 G;  3SJA C;  2LGW A;  1E79 G;  4WBN B;  5LP6 A;  2QM8 A;  2GDS A;  1I6U A;  1N56 A;  5CA3 A;  3HOV G;  3SYQ A;  2LJ2 A;  1XNQ H;  4GX5 A;  4I9W A;  3RV3 A;  5L3C A;  5T14 A;  1OCZ C;  2ZE6 A;  1CKN B;  3FAV A;  5L3D A;  5CBF A;  2P7T C;  4JI4 O;  4R8C A;  3U11 A;  1BT8 A;  2FYU H;  3ETJ A;  4EBC A;  1M6V A;  4MV8 A;  3CCM V;  1RJP A;  1LUW A;  2FJZ A;  2R85 A;  4HNT A;  1FYJ A;  1BHA A;  3AG3 B;  4X1Y A;  1JMK C;  5J2U B;  3J81 W;  4PZ8 A;  3SDL A;  4IR1 A;  1IBM H;  4TV8 B;  1KBH A;  3S3X A;  2ZIM A;  2HJF C;  1RM1 C;  5KFU A;  1M90 W;  2ZGI A;  3AG3 C;  3ZHR A;  3KHG A;  1TUE B;  1XMQ H;  2VUM A;  1AR4 A;  2PVP A;  1I2L A;  3GV5 B;  3LUT B;  4WBN F;  2YSU B;  4E4E A;  3K5O A;  1AJQ A;  3KG2 A;  4BIZ A;  5BMV F;  4DUZ H;  1VQL V;  1PNK A;  1K92 A;  4H44 B;  2CTP A;  1AI4 A;  2GQR A;  2EJR A;  4W4K A;  4X9Q A;  4I9Q A;  1P8L A;  3NR7 A;  4DR3 H;  1M0W A;  5IY5 B;  3U9S A;  2AXT Z;  4JI8 B;  4Q4C A;  4PA7 A;  2ZR3 A;  3X2Q B;  3HKD A;  3NXS A;  1GH6 A;  5KFF A;  4H37 A;  3GIK A;  4XX0 B;  2V59 A;  2ALZ A;  1O9G A;  3GTK A;  2XGP A;  3L9D A;  2FPP B;  5B1A B;  1MZF A;  3W7T A;  4E2L A;  2Y4R A;  4I55 B;  3N43 B;  2H8P C;  4YIP A;  2ZDI C;  3JZF A;  3H3V H;  1OV9 A;  3GB7 C;  2I80 A;  4NYK A;  5KHH A;  2QKS A;  4UCS A;  2LW1 A;  4CS4 A;  1ROP A;  3SJQ C;  2AGA A;  2HG5 C;  5FL7 G;  4JI2 H;  1I94 O;  4RB3 C;  2GUZ B;  3HPL C;  4LFC B;  2BQR A;  4QGP A;  2XC9 A;  4R50 A;  2H94 A;  5C1P A;  2P22 C;  2UUB O;  1C30 A;  2EIY A;  3T1H H;  5H9C A;  2WPD G;  2ZXW C;  4Z2W A;  3UKM A;  2HP8 A;  2P67 A;  4MTD A;  1COW G;  2A9H A;  4TUY B;  4J41 A;  5KHJ A;  4D7T A;  1FVI A;  3SPG A;  2UU9 H;  3EPG A;  3I56 V;  2VR1 A;  3K5L A;  1XMO H;  3B77 A;  1S68 A;  2UXB O;  4H0L B;  2QEX V;  2ASL A;  2ZCE A;  4IZO A;  2E75 B;  2YL2 A;  3G71 V;  1WH2 A;  1AR1 B;  1BQ0 A;  2VRZ A;  3V4Z A;  4PZ6 A;  3Q4H B;  4LF9 O;  2B63 G;  4I7Z B;  3BAA A;  2ILM A;  3CCL V;  3GTM A;  3JAR B;  1ZSP A;  1TUB B;  5ITZ A;  4BY1 G;  3E89 A;  2XCL A;  3G80 A;  4DV4 O;  1AN7 A;  5CA1 F;  4AHC A;  3KAK A;  4LF8 B;  4JI2 O;  4TUY A;  3ZHS A;  3OUU A;  1UPG A;  2JEU A;  1J5E H;  1RYS A;  1CP9 A;  3QNE A;  1CS0 A;  3VPB A;  1W59 A;  3OMI B;  3G4S V;  5CB4 F;  5KFX A;  4UB8 Z;  3ZMZ A;  3UO2 A;  2R7Z A;  4KUM A;  4NZN A;  3TW6 A;  2ZNJ A;  4CH4 A;  3QQM A;  4LNU A;  2A7W A;  1EHI A;  2J9G A;  5H5N A;  5DM6 V;  4QJF B;  2QR4 A;  1K34 A;  4MA5 A;  4W4L A;  1IYD A;  4ECX A;  1BE3 H;  3H9V A;  4DR1 O;  3PW7 A;  4O3R A;  1NQT A;  4ECQ A;  2BSK A;  4YAK B;  1GM9 A;  2XCA A;  4A3K G;  1XMO B;  3G8C A;  1OCC C;  3AG1 C;  5IJ9 B;  4F6R B;  1NU1 H;  2W9C B;  1VQO V;  1KBL A;  1AI6 A;  3BHP A;  3K58 A;  1GO3 F;  1XHX A;  2QWR B;  5F9L A;  4IT5 A;  3A0B Z;  1HW7 A;  4R7R A;  1AI5 A;  1I08 A;  1WPB A;  1Q90 D;  2W6J G;  2WLL B;  4DV1 O;  4FFR A;  3KRE A;  2Y0S A;  1RYR A;  2OIE A;  1JX9 A;  1Y74 B;  4N21 A;  3N41 B;  3T5K A;  1WSC A;  2YI9 A;  2YU9 A;  1TWF A;  5H80 A;  3JAM W;  2PY5 A;  2LFR A;  1JR9 A;  4M9U A;  2N04 A;  1JJ2 U;  4OX9 B;  5C8Y B;  1JJO A;  1ZWI C;  3GWO A;  3RV4 A;  4DRX A;  2VQE H;  4MTO A;  3KKY A;  3PN1 A;  2W8L A;  3OMA B;  3QO8 A;  5FD5 A;  2VPQ A;  5IYD G;  1S0O A;  2YIB A;  5KLV H;  3I4M G;  5J2U A;  3AG4 C;  2ETN A;  2YRW A;  4JV5 O;  3MFI A;  1K33 A;  1Q6I A;  4UV9 A;  3CRA A;  4XDJ A;  2HVR A;  3CCQ V;  2PMZ E;  1R6K A;  4OX9 O;  3CCE V;  2O57 A;  1YF2 A;  1H2S B;  3E22 A;  3U0Z A;  4EQ5 A;  1S76 D;  1HNW H;  2W7P A;  5GTI Z;  1OCO C;  3SYC A;  2UXC H;  3N6R A;  1FKA O;  2LGQ A;  2DAB A;  1GYF A;  3ASN B;  4O4L A;  3RF2 A;  1N33 O;  5EBW C;  4A3L G;  1KP2 A;  2EBO A;  1N0N A;  4TWK A;  2Y0I A;  4PA6 A;  4DR2 O;  4M0J A;  4B7E A;  1XIL A;  4DV2 B;  3DXR A;  2DAA A;  4RZQ A;  4JV2 A;  4DK0 A;  2UUB H;  3ZHT A;  2AGP A;  1XI1 A;  3E86 A;  2GPS A;  3MDS A;  4P9O A;  1GMG A;  3E2E A;  4DR4 H;  1Y76 A;  2V1D A;  1Y4M A;  2R8H A;  1S0M A;  1KJJ A;  3GVM A;  4CC5 A;  5IWA O;  4OX9 H;  4A5U B;  2C00 A;  2YEV A;  3AK3 A;  1HNZ B;  5L1J A;  1S03 G;  4YBZ B;  1TVK B;  1AR5 A;  4OPA A;  1JFF B;  3G6E V;  3ABM C;  4LFA H;  2HGS A;  1RK6 A;  5I5Y A;  1EZJ A;  2ITC C;  2Z5U A;  2PI5 A;  2CZG A;  1N0J A;  5DGI A;  4QWC A;  2GHY A;  4LF6 H;  3M8A A;  5HFL A;  2NVX A;  4DV7 O;  2AU0 A;  1EN5 A;  1IX9 A;  2NR5 A;  2PGG A;  3ZMV A;  2A0L A;  1J5E O;  1M7J A;  1K5S A;  4LF9 B;  2YRX A;  1N32 B;  4GKK H;  5JUM A;  4I7H A;  4J7J A;  3FMA A;  5KFT A;  5FLX W;  2XAJ A;  4BAY A;  5I60 A;  1HR0 O;  4O7Y A;  4O4J A;  3KTM A;  1E4F T;  3FKI G;  1MMM A;  2QKC A;  3OTF A;  4YY3 B;  3GIL A;  4RUF A;  4JYC A;  1FXV A;  1BSM A;  3ZIA G;  3THO A;  5KX5 A;  4RCN A;  5LOV F;  1P16 A;  3SPJ A;  3I4N G;  2VUG A;  1I0H A;  3EPI A;  5KFC A;  4HBN A;  4KHP B;  4DR7 B;  3T54 A;  2BTO A;  4DV0 O;  5LHG A;  3RGZ A;  3QO7 A;  2Z3Y A;  1S97 A;  4JI4 H;  1P4R A;  4QIW E;  5DED A;  3LDD A;  2F95 B;  4UUJ C;  4F6E A;  1Q6H A;  4HNU A;  5KFD A;  2IJI A;  1P7G A;  1ET0 A;  2VQF H;  2L35 A;  2ZJT A;  5BWU A;  4DL5 A;  2AQ4 A;  4JI1 B;  2NU8 B;  1IXM A;  1XL6 A;  2DQ0 A;  1KQS U;  5DG8 A;  5KFZ A;  3RYF B;  1W0K G;  4ETS A;  1R9T A;  3ZMT A;  2ZIN A;  3ZCC A;  1CE8 A;  1XRE A;  3CE2 A;  4LP8 A;  2ZD9 A;  2GPW A;  2ZM6 B;  3U54 A;  1DGS A;  2E5L B;  1IBL B;  4DL7 A;  2F43 G;  2EJ2 A;  4PA9 A;  4ZI7 F;  1OCR B;  1I3Q A;  4GKK B;  1N32 H;  2R7K A;  4DR5 H;  3TY5 A;  1NR7 A;  4LFB B;  1E1Q G;  3LDC A;  3J7A U;  4FS1 A;  4DW1 A;  5LMU H;  4L87 A;  1I5X A;  3WB0 A;  1BXR A;  3SNO A;  5LA6 A;  1G6U A;  4EBD A;  3BQ1 A;  3DTU B;  1Q8I A;  2GTS A;  2KB1 A;  4DV2 O;  2CKZ B;  4IAJ A;  1K83 A;  3JD0 A;  4DK1 A;  3Q8R B;  4ICG A;  2W6Z A;  5KFN A;  3B2E E;  3K57 A;  1N36 B;  3M9O B;  1TVK A;  4B3T B;  5K2M A;  5JQG A;  2DOS A;  3GJX B;  1A32 A;  5JJE B;  2NU9 B;  2YZN A;  4CE5 A;  4B08 A;  2UXD O;  4DL4 A;  5C3E G;  4LF5 H;  2MCT A;  1QR9 A;  3BJY A;  2DWE C;  4RAZ A;  4CZZ A;  1WLE A;  1R6T A;  2RGV A;  4QWD A;  4JYA H;  4X65 B;  2HG8 A;  3RIZ A;  2J6T A;  4LFB O;  1PD3 A;  1VQP V;  3M9M B;  3RBZ A;  1R1B A;  3DC5 A;  2C2R A;  3KZI Z;  5EC2 C;  1AJN A;  5IT9 W;  5GON A;  5B1O A;  5IWA H;  3WFV A;  4JI8 O;  1PK8 A;  5HV6 A;  2COG A;  1KYO F;  1KEC A;  2E74 B;  1XNQ O;  4YY3 H;  2WA3 A;  3QFF A;  4PA3 A;  2V4D A;  4DRF A;  4D6T H;  1A0I A;  3ABL C;  1RPO A;  2HIV A;  4WFG A;  3WU2 Z;  2AHZ A;  4A3G G;  3H1H H;  2LP7 A;  2VUM G;  4X20 A;  3T4D A;  2ITD C;  3JAK B;  2W6Q A;  1VQ9 V;  5B3S C;  4K8Z A;  2OWO A;  4X65 O;  1JDB B;  4LF4 H;  3K5M A;  4WHX A;  1ARO P;  3LML A;  3UZB A;  4MTF A;  4J9R A;  4A2B A;  3JD4 A;  1AP6 A;  4O86 A;  3VQW A;  1FXH A;  3MR2 A;  3ASN C;  1GRJ A;  4TVI A;  4BW5 A;  2DYS C;  2WLK A;  4MVU A;  4LWS A;  2HHH H;  2FK1 A;  2IJJ A;  1ZQ7 A;  3CCJ V;  3OHB A;  4TQD A;  2QTO A;  1VQ5 V;  1EM1 A;  3BEH A;  4RB0 A;  3KYH C;  3GV8 B;  1QLE B;  4B3T H;  3IAY A;  1FJG H;  5C5J A;  3ZRW B;  4DUY O;  4DR3 B;  1XMQ O;  5KG2 A;  1TGO A;  2YUA A;  4EFE A;  5IY5 C;  5EWG A;  1KEE A;  2B1I A;  2KKW A;  4WFE A;  1K7D A;  5EIB D;  1JOY A;  3IG0 A;  4X88 A;  1DLB A;  3T5H A;  2R82 A;  3CRC A;  5IE9 A;  2W7O A;  2DLN A;  3R5X A;  2VA3 A;  4FVM A;  2NNU A;  4JTA B;  1OCO B;  4JI7 B;  4MV9 A;  2IJK A;  1Z2P X;  3ZRX A;  3MFH A;  1M57 C;  4DV1 H;  3JZ6 A;  2IP4 A;  1SA0 A;  3K3P A;  4HNV A;  4UCU A;  2WLI B;  3OT7 A;  2FMA A;  3UYY A;  3CME V;  1NVP D;  4DR5 O;  1GSO A;  3QG5 A;  3OHA A;  4JI6 H;  1KTA A;  1U96 A;  5LOV B;  2HHF B;  3FDS A;  1NTK H;  1HNW B;  2BQU A;  2R9I A;  3NUA A;  5KFE A;  3RT3 C;  1YEW A;  3PFF A;  1NJI W;  2I87 A;  4AYB E;  5E1A C;  3A8T A;  2ZE5 A;  4FLW A;  3BFR A;  3BVO A;  4GKJ B;  5FNV A;  2Q7D A;  4C5B A;  1V51 A;  1AVM A;  5AG2 A;  3OGI B;  1A9X A;  2OT5 A;  4JI0 O;  1S9F A;  4ED3 A;  2E76 B;  2V7Q G;  1YIJ V;  2Z04 A;  5FLM G;  1SQP H;  5EDW A;  1EKF A;  4JPR A;  4AIL C;  1J95 A;  1XNQ B;  3GV7 B;  5KFY A;  2J6U A;  1S5H C;  2BOC C;  1FD9 A;  2IH1 C;  4JI3 B;  5LHH A;  1Q86 W;  1HNX O;  3D36 C;  3G6Y A;  3HKB B;  2LFS A;  4LBE C;  3GTL A;  4PA4 A;  1YJN V;  3Q4H A;  5J2T F;  1B6S A;  2P4K A;  5ITZ B;  2R8I A;  2HJD A;  1BMF G;  3MAQ A;  4DV4 H;  3GIQ A;  4AI8 A;  4RUE A;  4I55 F;  1XL4 A;  3RW0 A;  4B3M H;  2F4V O;  4RUC A;  2EJ3 A;  3RVZ A;  1TWG A;  3ABM B;  2AW9 A;  1K1S A;  4YQW A;  3P32 A;  2HHH B;  3CJH A;  3AG2 B;  4YJ3 B;  5JQG B;  4LF4 B;  2YWV A;  3WNZ A;  2QYZ A;  3W5O A;  1S72 V;  2A06 H;  4TQF A;  5JH7 F;  1X4T A;  5KFK A;  4RB1 A;  5IYZ A;  2V9W A;  5CE8 A;  4X62 O;  4AQY B;  4FFO A;  3CRM A;  2NN4 A;  1RM1 B;  2OYQ A;  2RN9 A;  4B3S B;  5KG6 A;  1K97 A;  2F66 C;  1YDX A;  4O84 A;  1VP7 A;  1A48 A;  1VIB A;  4O2A A;  2E2H A;  2YYA A;  3UO3 A;  2DZD A;  4C2M A;  3ZRS A;  4TM5 A;  4O7Z A;  3O9O A;  2OTJ V;  4TUY F;  2XGQ A;  3T1Y B;  4I50 A;  1MG1 A;  1K8A W;  2EZP A;  5EZY B;  3HOZ G;  1PKX A;  5L3B A;  3H0G G;  4YR0 A;  5KFV A;  1EYZ A;  2QSA A;  2CAZ C;  2P90 A;  4YIO A;  2K1E A;  3N44 B;  5JQW A;  5JVD A;  1YHQ V;  5L1L A;  2CGN A;  4GLW A;  4Q20 A;  2EIL C;  3TXS A;  1PX2 A;  2V5A A;  5BR8 O;  4B3S O;  2DYR B;  3VPC A;  1Q81 W;  1QVG U;  4NB5 A;  3ABK C;  3BQ2 A;  3WWH A;  2HR3 A;  5DG7 A;  2BQ3 A;  3T1H O;  3PZP A;  4ECS A;  4ECW A;  1H8E G;  3RYI B;  1N36 H;  1B04 A;  2EIM B;  2EJ7 A;  3BY6 A;  2MK3 A;  1AUV A;  2RMK B;  3HBL A;  1YI2 V;  3RVY A;  4WFH A;  1FAF A;  5K3W A;  5LMN H;  2WWW A;  4IIJ B;  4CKC A;  4NTW A;  4X1K A;  5KFL A;  2YS8 A;  1PM9 A;  4JV0 A;  3QO5 A;  4X1I A;  2UXD H;  2PI4 A;  2VQF B;  1ULZ A;  2MW2 B;  4ZBM A;  4JI3 O;  3TY9 A;  5KKN B;  3K5H A;  3MD0 A;  4HYO A;  3VMM A;  1TAE A;  1MZB A;  1R3L C;  4L8J A;  4ECY A;  3DF7 A;  1S0V A;  1VAR A;  5EZY F;  4DV3 O;  1IBL H;  1SES A;  1I2K A;  5LGU A;  2EX3 A;  5HFM A;  1YTF D;  4TQR A;  2IBK A;  4IYH A;  4TQS A;  3ABL B;  4JYA O;  1F7Y A;  3T99 A;  4J7Z A;  1Z5W A;  4LFB H;  4NLG A;  5KFO A;  2X7R B;  1RP3 B;  3CSX A;  1V9P A;  3KAL A;  2YID A;  4MVM A;  2HVJ C;  3UFX B;  3HO8 A;  4O83 A;  3V6J A;  2ABJ A;  1IBK B;  1VKZ A;  2R7L A;  3R5F A;  5HBR B;  2WLM A;  1QQC A;  5L3F A;  5DQG A;  5EYP B;  2D3O W;  2M7W A;  4DR5 B;  1IYE A;  1GN3 A;  4YJ2 B;  4ABM A;  4CBC A;  4O7T A;  3EYY A;  4GX2 A;  3GDE A;  2EIJ C;  5KS8 A;  3H1L H;  2VOB A;  2UXX A;  1KJI A;  3RJ0 A;  2B9Z A;  2IA6 A;  1I50 A;  5KG1 A;  3T5L A;  4FPP A;  4ZIB A;  5DEC A;  1EUC B;  4X89 A;  2J6S A;  1OBD A;  3TQ1 A;  4EKW A;  4FFB B;  2YEV B;  1HNZ O;  3AK1 A;  4ME6 A;  3R5H A;  1G4Y B;  1KT8 A;  3TIG A;  3HOY G;  1US6 A;  3MWD A;  2CW8 A;  3JAK A;  2WE6 A;  3HKZ E;  4F4X A;  4KFM A;  2JEX A;  5GW7 A;  1VS0 A;  2GQS A;  2VA2 A;  4KXR A;  2XCP A;  4AQY H;  2CH7 A;  4DR6 O;  3B40 A;  2JEI A;  4QWE A;  3HOU G;  2ZE8 A;  3CS5 A;  3L4K A;  2PYJ A;  4PZ7 A;  2CTR A;  4FBU A;  3STZ C;  2F23 A;  1UC9 A;  4RUA A;  2Q7H A;  2RF4 A;  3FB5 C;  5LL6 Y;  1WA8 A;  1NVP B;  4O7R A;  1GO3 E;  3QWU A;  4ZHQ A;  4NXN O;  3ZN1 A;  5BZB A;  4LF5 O;  2KG7 B;  1XHZ A;  1R6N A;  3BCC H;  5DGH A;  2W57 A;  3VBB A;  2X6C A;  3C3S A;  4HAM A;  1M9N A;  4GYC B;  4YHH O;  1I7F A;  2UUC O;  1VEW A;  4X8A A;  5IWA B;  1HR0 H;  3BAB A;  3JSL A;  4F4W A;  5CB4 B;  2YS7 A;  4QPJ A;  1KC7 A;  3WG7 B;  2X0S A;  4OGQ B;  4JZ2 A;  3SE7 A;  4EGQ A;  5JVL A;  4O3S A;  4JI6 O;  2HVS A;  4P9P A;  2DW4 A;  1HNZ H;  2JEJ A;  3PR4 A;  3PW2 A;  1JCH A;  1F4N A;  1R3K C;  3OTO H;  3DSQ A;  4QWB A;  4I4T F;  2X6A A;  1IBM O;  3GIM A;  1F51 A;  3GB8 B;  1QU7 A;  4J9O A;  4EGJ A;  4Q43 A;  3IGA C;  4P2Z A;  2UVV A;  4D7S A;  4ECZ A;  1XDC A;  3E5N A;  3ML0 A;  1PL4 A;  2HGX A;  4J9M A;  4GKJ H;  4A3E G;  4F4L A;  3N2G A;  5IT9 N;  3ETD A;  1KKD A;  2FTK A;  1KUT A;  1M57 B;  4WCE V;  5C8Y A;  5B1A C;  4U7N A;  3KCY A;  2JGD B;  1ZL8 B;  5CMU A;  2FML A;  5DAA A;  4NXN H;  5B1B B;  5FJ8 G;  4LH7 A;  1KU9 A;  3Q2O A;  4UV8 A;  3M4I A;  5I5T A;  1G1X B;  4F4Z A;  4JI3 H;  4QWA A;  3DC6 A;  2JRI A;  2AZ0 A;  2NVY A;  1VQ4 V;  1YJW V;  4JI5 O;  4J9S A;  3F7Y C;  2WLJ A;  5F9N A;  3CB2 A;  1QR8 A;  4ASU G;  4UVA A;  5LXT F;  4IHJ B;  5BY1 A;  2OLS A;  2YXH A;  1L2Z A;  2Q73 A;  5JJN B;  3TK1 A;  1U97 A;  3GWK C;  1ZX3 A;  1B33 N;  2EZO A;  2W6P A;  1SZT A;  4JTC B;  2Q6A A;  1UFI A;  3DGE A;  2CNV A;  2W9A A;  4UUG A;  2NU6 B;  2QE7 G;  3IN5 A;  5BWW A;  3Q8Q B;  3B8M A;  4Z1V A;  4FFP A;  2R6F A;  1WB7 A;  2COJ A;  4LSX A;  1K4C C;  2CNU A;  1ZTE A;  3K06 A;  5DGA A;  3K5I A;  3PO3 G;  1SQX H;  2IU3 A;  2Y4T A;  3APO A;  1OJH A;  3KCX A;  4JGS A;  2XHB A;  2LO1 A;  2DWC A;  1NH2 D;  5EBM C;  5IYB G;  2UUA B;  5IDJ A;  2LW7 A;  4GLX A;  5BWX A;  3Q8S B;  1B06 A;  4WF9 V;  5D5Q A;  4XYM B;  2W0X A;  1Y1W G;  1MOF A;  1X59 A;  5FLX N;  3I12 A;  1OCR C;  2JA6 G;  3V4S A;  5KAI Z;  2HVQ A;  4G2K A;  3K3W A;  2BE3 A;  2JA5 A;  5KG5 A;  1PP9 H;  2CUG A;  4TV9 F;  2B1G A;  2VQE B;  3H20 A;  1B6Q A;  3HXL A;  4O4I B;  1CKM A;  4K3A A;  1S3J A;  4KHP O;  1HDJ A;  4UFZ A;  3N8D A;  3T4Z A;  5BPH A;  4FFN A;  4ECU A;  2N74 A;  5KG3 A;  3AX6 A;  2RDI A;  3IJ4 A;  4X62 B;  4AQY O;  1PL0 A;  4KP4 A;  4O4I F;  2WB1 E;  2DPJ A;  1WAZ A;  5IYC O;  3LWB A;  2AHY A;  2QM4 A;  3LSU A;  4J10 A;  1P84 F;  4FFL A;  3M9N B;  3VOU A;  4TV9 A;  2EJ0 A;  4X65 H;  2IMW P;  3L74 H;  1H2K A;  2Q0O C;  3RWR D;  3CCU V;  1R3I C;  4I4T B;  4ED8 A;  3ZHQ A;  3I55 V;  1FFX A;  3TY8 A;  2WB1 A;  3TJT A;  3GIJ A;  1FJG B;  2JGD A;  4CH5 A;  5BYB A;  3ABU A;  3GID A;  2C2D A;  2DYR C;  1JA8 A;  5I5U A;  1Q3E A;  3SPH A;  3M7M X;  3L2P A;  5IYD O;  4B3R H;  2R93 A;  1VBG A;  2FE3 A;  3JZI A;  4JTD B;  1WP7 A;  1CPY A;  5FR9 A;  2R8K A;  4DXW A;  2IH3 C;  2WTF A;  1SC5 B;  4FM2 A;  5DGB A;  1SZX A;  4K35 A;  3UCS C;  4DV2 H;  3X2Q C;  2YIB D;  5KFG A;  4K0K B;  2Q7E A;  1IOV A;  4DQN A;  4GC6 A;  3K0D A;  3BPZ A;  4MTG A;  5GON F;  1IVS A;  4Q45 A;  4JYY A;  2HJW A;  4PDL A;  5CB4 A;  3SJC C;  5KFB A;  3H4B A;  3OEE G;  5A2Q N;  1R73 A;  4NXM B;  4X66 O;  1DV2 A;  1Z2G A;  3OAA G;  1WP8 A;  2KG7 A;  4X64 O;  2X5R A;  5E25 A;  3JD3 A;  3STL C;  3R65 A;  3RYC B;  4DV7 B;  4O82 A;  4MTX A;  3F8N A;  5KFQ A;  4YR3 A;  3FB8 C;  1K1Q A;  5KFP A;  1PV0 A;  3K59 A;  5BWT A;  4FE2 A;  2COI A;  1Y67 A;  3ZRW A;  4PD4 F;  2XAS A;  5KFS A;  3RB6 A;  4G3I A;  3N6X A;  4LFC O;  4UXN A;  1N4C A;  1H8H G;  4JXU A;  3L70 H;  4MW8 A;  2WA4 A;  3UQ8 A;  2PTM A;  3ABK B;  2VQF O;  3SPI A;  3LSQ A;  3WO0 A;  5GTH Z;  5IP9 G;  4IIJ A;  3G8D A;  3L71 H;  4F50 A;  1YXB A;  4YHH H;  2UUC H;  3PW0 A;  4GC7 A;  2HEP A;  4DL2 A;  1AB3 A;  2CTQ A;  4Q4D A;  1QVF U;  4RZR A;  5EIB C;  1IBL O;  3GTP A;  1JKJ B;  4XYL B;  5CBH A;  5KG7 A;  1BZK A;  5LMU B;  4FLV A;  2ADQ B;  1FXK A;  1N8R W;  4DR4 O;  3LNN A;  1ZUQ A;  3RYF A;  2UUA O;  5EWE A;  5LXT B;  3CEB A;  1IOW A;  3CRQ A;  4LFA O;  3GTO A;  1QCE A;  4YJ3 F;  2HVK C;  3U55 A;  1N34 H;  3T7A A;  2A1H A;  2YIA A;  5KUM A;  4KHP H;  3K9S A;  1XQ8 A;  4LFC H;  2LQT A;  2XT9 A;  3W7W A;  2CGO A;  4JI6 B;  3OEH G;  5LHI A;  3L73 H;  1NH2 B;  3H1K H;  1K3E A;  3VQX A;  1CKO A;  1Y66 A;  1L0L H;  1KJ9 A;  1SQB H;  4CKE A;  1T5E A;  1O75 A;  2W9B A;  4ZI7 B;  3U9T A;  4HNA B;  1S5L Z;  5JVD F;  1OCZ B;  2ARH A;  4JV5 B;  4A3D G;  4U7O A;  1XNR B;  3LNM B;  4MV7 A;  3F7V C;  4EEY A;  3GTQ A;  2R7Z G;  1RJQ A;  2V58 A;  2JA5 G;  5F2V O;  4JI5 H;  1JQ0 A;  2M05 A;  5D8D A;  2CNQ A;  4K6N A;  2XD4 A;  4YR2 A;  2ZQM A;  5L3E A;  3W1G A;  4CC6 A;  4DR1 B;  2UVW A;  3D8C A;  1VQ6 V;  3RGX A;  4E4T A;  4O3Q A;  1ZHQ A;  4I5S A;  4Q8F A;  3IC9 A;  4QE9 A;  4RO2 A;  5LP6 C;  5JH7 A;  4X66 B;  3PJS K;  4DRX B;  2F4V B;  1SQV H;  1HR0 B;  4CKB A;  1E4G T;  4MTE A;  5C8Y F;  2Q5Z A;  2P4V A;  1V54 B;  2AGQ A;  1Z2O X;  1H2G A;  4O4I A;  5C4X G;  1JVM A;  2FKX A;  1VQN V;  1R3J C;  3A0H Z;  3N42 B;  1TWC A;  1Y74 A;  5KT7 A;  4DV1 B;  1WB8 A;  4GX1 A;  4FLX A;  1HNX B;  4IRC A;  4A93 G;  4GUN A;  3CSW A;  3ETG A;  3G67 A;  3ZHV A;  3HB3 B;  3G6B A;  1V4Y A;  2UVR A;  3FB6 C;  2JIZ G;  3D3Q A;  3KXY T;  2R92 G;  2XUM A;  3ASO B;  2QF7 A;  4M7E A;  1G8M A;  2BTQ B;  4BWA A;  1LR1 A;  1XUQ A;  4CMF A;  4QSH A;  3RGB A;  5CA0 B;  1DV1 A;  4QIW F;  1MNG A;  1QLN A;  2KSW A;  2BCC H;  1XOU A;  4IL6 Z;  2C2A A;  3RR5 A;  3TW7 A;  4DV5 O;  4Q6G A;  2FP4 B;  3ORQ A;  4O3O A;  3T1C A;  4ED2 A;  3GLK A;  3B4S A;  5IYZ F;  5DIS C;  5CAE B;  1BQZ A;  4FIP C;  2QGN A;  4KL1 A;  2RDJ A;  3OUF A;  5FD6 A;  2WLN A;  1RK5 A;  2JA7 A;  1KUQ A;  1KJQ A;  4FZ1 A;  2W6O A;  2FKL A;  5CN0 A;  2ZDG A;  2CFM A;  3DXR B;  1MAB G;  4PDB A;  5IYB O;  4AYB A;  1L0N H;  4WFB V;  4YXW G;  3RBD A;  1W0J G;  5H2F Z;  3JRW A;  4IHJ F;  1GAX A;  3JYC A;  1SQQ H;  1JLL B;  4EBE A;  2UUB B;  3M99 B;  4X62 H;  2B63 A;  2YZG A;  1THZ A;  4WFF A;  1K5Q A;  1M4U A;  1I94 B;  4PEL A;  3VQY A;  5KMG B;  4O4H F;  1M56 C;  3V6K A;  3PW5 A;  3RB3 A;  2RGR A;  3J81 N;  4DW0 A;  3AG2 C;  4J80 A;  1W93 A;  3LQS A;  4O3P A;  1LUV A;  4BXX G;  5LGT A;  2EUL A;  2WLH A;  4LR3 A;  2PN1 A;  1M93 A;  1YIT V;  2QM7 A;  3AW8 A;  1V54 C;  1VF6 A;  2FL4 A;  3T1H B;  4NVP A;  4H33 A;  3AK2 A;  2HGW A;  2Y48 A;  5KA6 A;  1X9N A;  5BWR A;  4EYI B;  1EFR G;  1XNR O;  2FK2 A;  3U10 A;  1T3N A;  2QWP B;  5KG0 A;  4JZG A;  1RPR A;  1M1K W;  2NU7 B;  4O2B F;  1N33 B;  1SF9 A;  2CTW A;  4JI5 B;  3FAV B;  5L9X A;  4BBS G;  2EIK C;  1VMG A;  2EIM C;  2GUZ A;  4MVQ A;  3DTG A;  4FLZ A;  2PYL A;  3OMN B;  4JI0 H;  1FFX B;  4PDR A;  4G28 B;  4MV6 A;  1EKP A;  2CE4 A;  3ZMU A;  2W6I G;  2PZS A;  1PPJ H;  4IWY A;  3WO1 A;  4FZ0 A;  4I55 A;  2XAQ A;  3VQV A;  5LXT A;  3CXH F;  1E4E B;  1GM8 A;  1Y76 B;  5BXZ A;  4DR4 B;  1NT2 B;  2K9P A;  3CCR V;  3L4J A;  4LF8 H;  2A79 B;  2Z0A A;  3HKB A;  4DV3 B;  2WAQ A;  4JV1 A;  3SR2 C;  3JAL A;  3HKE B;  4RNO A;  1IBK H;  3CX5 F;  2HIX A;  3C3T A;  1AIL A;  2Q68 A;  4H13 B;  4R6Z A;  1Q43 A;  4XDK A;  4A3I G;  5J9P C;  1DTO A;  3BRC A;  4YP3 A;  4FBT A;  4YAJ B;  1SS3 A;  4LH6 A;  4X64 H;  5L1K A;  2GLT A;  3I5D A;  5L3G A;  3OTO O;  4XDL A;  4FLT A;  3H1J H;  1SKV A;  1LNQ A;  3K0G A;  4FK5 C;  2RJZ A;  1BHB A;  4MA0 A;  2ODM A;  1HP8 A;  2ZM6 H;  5LBQ A;  5D1O B;  4FMT A;  2C22 A;  3ZRV A;  2DWD C;  1SQF A;  4YHH B;  2UUC B;  1D2D A;  3NBY B;  2OCC B;  4B3T O;  2QDO A;  3Q8P B;  1DF4 A;  3MWM A;  5KHG A;  2KQX A;  2XAH A;  2HHF A;  3K3V A;  2VS0 A;  3RN4 A;  5CA0 F;  2YDE A;  4TV9 B;  2WLI A;  4RAY A;  1SA0 B;  2YXY A;  4J42 A;  4IRK A;  1SET A;  4ED1 A;  3SI8 A;  4IGG A;  1MZE A;  1I1K A;  4CS3 A;  4JI1 O;  2R7N A;  4DO2 A;  2EIN B;  3CRR A;  3EFF K;  4YJ2 A;  3DTF A;  2QJ1 A;  2ZDQ A;  1WRV A;  3SYO A;  1SYX B;  3OTO B;  4PBC A;  5KFH A;  1VQ8 V;  3WB2 A;  4MV4 A;  3QZ7 A;  2DN9 A;  4O7S A;  3T5J A;  3R66 A;  5KMG A;  3CD6 V;  2W8K A;  3EHB B;  2W6M A;  5KT4 A;  3SYP A;  1BS3 A;  3W7S A;  5KFW A;  4A3J G;  4A3F G;  4DV0 B;  5EBL C;  1Y1W A;  5KFJ A;  2ZM6 O;  2X0L A;  3VPD A;  1CXZ B;  5KT2 A;  2IJH A;  3QTC A;  1WPX A;  4I0X A;  2R72 A;  4F6R A;  2AZ2 A;  1S77 D;  5KHK A;  2HFE C;  4O4J F;  4B3S H;  5J2T A;  2XIG A;  1O9H A;  4IYI A;  2Q69 A;  2QK4 A;  1XDN A;  1EZV H;  4ED6 A;  3H01 A;  3LDE A;  2YI8 A;  3RFC A; 
#chains in the Genus database with same CATH homology
 1N32 B;  4GKK H;  4LH7 A;  1KU9 A;  4O2A B;  4UCV A;  4I7H A;  4RB2 C;  3M4I A;  3NC0 B;  3FMA A;  4LNU B;  4JI3 H;  5FLX W;  2JVD A;  3BA8 A;  3K5N A;  4O4J A;  4EFB A;  1E4F T;  4LF7 H;  3OTF A;  4YY3 B;  5J2T B;  1SEI A;  1XNR H;  3CB2 A;  3ETQ A;  3N40 P;  3JAS A;  4IHJ B;  5D1P A;  4X66 H;  3THO A;  5KX5 A;  1L2Z A;  5JJN B;  2E3C A;  1SQG A;  1P16 A;  4JI2 B;  2VUG A;  4HBN A;  4KHP B;  4DR7 B;  2BTO A;  3ZED A;  4DV3 H;  3JAR A;  3RGZ A;  5K1X A;  4CH6 A;  1I94 H;  4JI4 H;  4K0K H;  4EB6 A;  4LSX A;  4X1K B;  4JI4 B;  5JH7 B;  4CH3 A;  3RYH A;  2F95 B;  4U3J B;  5IJ0 A;  4DUY H;  3WB1 A;  4DV7 H;  2R70 A;  4DUZ B;  4BWS C;  4U3J A;  5IJ0 B;  2VQF H;  3RYH B;  2ZJT A;  2XHB A;  1XMQ B;  4JI1 B;  4LFA B;  3T1Y H;  2UUA B;  3RYF B;  4GLX A;  4JV5 H;  4LF7 B;  4ETS A;  4LF9 H;  2ZIN A;  5D5Q A;  2P5O A;  4X1Y B;  5JCO A;  2R9A A;  1TA8 A;  5EOY A;  2GV9 A;  2ZM6 B;  4DV5 H;  1DGS A;  4O4H A;  1IBL B;  2E5L B;  2HVQ A;  4FM9 A;  4GKK B;  1N32 H;  4DR5 H;  3TY5 A;  2WYO A;  3E22 B;  4LFB B;  1N33 H;  1Z2N X;  3ICX A;  4I50 B;  2UXB B;  2VQE B;  3CVZ A;  3H20 A;  1VF7 A;  3HXL A;  4O4I B;  1CKM A;  4UFZ A;  5LMU H;  3WB0 A;  5LOV A;  5LA6 A;  1G6U A;  5JJJ B;  1HNX H;  4X62 B;  1FKA H;  3JAL B;  1Q8I A;  5GON B;  4IAJ A;  4JI7 H;  4DK1 A;  3B2E E;  4NXM H;  2QM4 A;  3HKD B;  3A2F A;  4O2B A;  3K57 A;  5D5P A;  1N36 B;  1TVK A;  4B3T B;  4TV9 A;  4X65 H;  5JQG A;  2CW7 A;  4X64 B;  3JAS B;  4IHJ A;  3GJX B;  3N2K A;  4UCO A;  1ZAU A;  5JJE B;  3SJB C;  5FNV B;  3RWR D;  4B08 A;  4I4T B;  4O4L B;  4LF5 H;  1FFX A;  1D5A A;  4FM1 A;  2MCT A;  3QF7 A;  3TY8 A;  4RAZ A;  4JI1 H;  4JYA H;  1P49 A;  2RGV A;  3RFR A;  1FJG B;  4CH5 A;  4X65 B;  3RIZ A;  4WBN A;  4FLU A;  1XK5 A;  3N2G B;  4O2B B;  4EB6 B;  3RTX A;  4CS2 A;  4LSA A;  1Q3E A;  5IT9 W;  3M7M X;  5GON A;  3L2P A;  5IWA H;  4B3R H;  2FE3 A;  4YY3 H;  4FM2 A;  2V4D A;  4K8X A;  4DRF A;  2UXB H;  4FLY A;  1A0I A;  4Q0Y A;  4DV2 H;  3J7A K;  2YIB D;  2HIV A;  4K0K B;  2Q7E A;  2RQ6 A;  4X20 A;  2Q7G A;  3JAK B;  1Q5O A;  3BPZ A;  4YJ3 A;  4K8Z A;  2OWO A;  2ZIO A;  4LF4 H;  3UT5 A;  5CB4 A;  3SJC C;  3K5M A;  3LML A;  4NXM B;  4A2B A;  5BR8 H;  3VQW A;  4APM A;  2UUA H;  3RYC B;  3F8N A;  4DV7 B;  5LMN B;  2JS5 A;  2HHH H;  2VPS A;  3K59 A;  4LF5 B;  4TQD A;  5EYP A;  5LP6 B;  2UXC B;  4RB0 A;  3KYH C;  3SJA C;  4B3T H;  3HKE A;  3IAY A;  3N6X A;  4WBN B;  1FJG H;  5LP6 A;  1I6U A;  5A2Q W;  4DR3 B;  1TGO A;  4EFE A;  3UQ8 A;  1XNQ H;  2PTM A;  5EZY A;  3VNN A;  5D1O A;  4UCT A;  4DV5 B;  2KKW A;  4ZI7 A;  4DR1 H;  1CKN B;  4IIJ A;  5KHI A;  4DR2 H;  5EIB D;  3IG0 A;  3JAW A;  4YHH H;  2UUC H;  3U11 A;  2HEP A;  4I4T A;  4FVM A;  5EIB C;  4JI7 B;  4MV9 A;  3RYI A;  1Z2P X;  5FPR A;  4X1Y A;  5LMU B;  1JMK C;  5LA6 B;  5J2U B;  1N34 B;  3J81 W;  4PZ8 A;  4FLV A;  4DV1 H;  1SA0 A;  3LNN A;  3RYF A;  4UCU A;  5LXT B;  1IBM H;  3QG5 A;  4JI6 H;  2VWK A;  2PUS A;  1S5J A;  3JSN A;  4TV8 B;  5LOV B;  4DV4 B;  1HNW B;  3S24 A;  2ZIM A;  3C0F B;  1N34 H;  2YIA A;  5JCO C;  4KHP H;  1YEW A;  1XQ8 A;  4LFC H;  1WN7 A;  4JI6 B;  1XMQ H;  4FLW A;  4LF6 B;  5LL6 b;  3VQX A;  4GKJ B;  1CKO A;  5FNV A;  1T5E A;  3K5O A;  4DUY B;  4JYA B;  2Q2U A;  1O75 A;  4DUZ H;  4ZI7 B;  4HNA B;  4JV5 B;  1XNR B;  4I9Q A;  4MV7 A;  1P8L A;  4DR3 H;  1L8D A;  4FM0 A;  4AIL C;  1XNQ B;  1M0W A;  4JI5 H;  4JI8 B;  4JI3 B;  3W1G A;  3HKB B;  3HKD A;  4CC6 A;  4DR1 B;  3RGX A;  1O9G A;  1ZHQ A;  5LP6 C;  5JH7 A;  4X66 B;  1BJT A;  3N43 B;  4I55 B;  4DRX B;  5ITZ B;  2F4V B;  1ZHS A;  3RYC A;  1HR0 B;  1E4G T;  4DR6 H;  4MTE A;  5KHH A;  3MAQ A;  4DV4 H;  1Z2O X;  4UCS A;  4O4I A;  4CS4 A;  4PI0 A;  4JI2 H;  3N42 B;  4B3M H;  2UXD B;  4RB3 C;  4PI2 A;  4DV1 B;  4LFC B;  2HHH B;  4YJ3 B;  4FLX A;  5JQG B;  1HNX B;  4LF4 B;  3J80 W;  3W5O A;  2P22 C;  3T1H H;  4DV0 H;  2JGU A;  2BTQ A;  2Q2T A;  4TQF A;  1X4T A;  2F93 B;  4RB1 A;  1M0T A;  5IYZ A;  4AQY B;  3KXY T;  4ZOL B;  2UU9 B;  2O03 A;  4M7E A;  4MTD A;  4TUY B;  2OYQ A;  3ZS8 C;  4D7T A;  5KHJ A;  2BTQ B;  4BWA A;  1FVI A;  2UU9 H;  4B3S B;  5LYJ A;  1BGW A;  2F66 C;  5BMV B;  3K5L A;  4O2A A;  1XMO H;  1S68 A;  3RGB A;  2ZCE A;  5CA0 B;  2E5L H;  1WNS A;  3T1Y B;  4I50 A;  2KSW A;  1WH2 A;  5EZY B;  3RR5 A;  4Q6G A;  2CAZ C;  5CA1 B;  4PZ6 A;  4LMY A;  5DIS C;  3BAA A;  4A2A A;  5K1P A;  3N44 B;  5JVD A;  3JAR B;  1Z5V A;  3NBZ B;  1TUB B;  5ITZ A;  4KL1 A;  1M5I A;  4B3R B;  5FD6 A;  1AN7 A;  4TV8 A;  5IYZ B;  4AHC A;  3KAK A;  4LF8 B;  1JFF A;  2CFM A;  3JAT A;  4TUY A;  4PDB A;  1J5E H;  4DR2 B;  5BR8 B;  1RSO A;  2UUB B;  1N36 H;  3RYI B;  1B04 A;  4X62 H;  2ZNJ A;  5LMN H;  4CH4 A;  4IIJ B;  4TOI A;  1M4U A;  1I94 B;  3VQY A;  5KMG B;  4LNU A;  2RGR A;  1KMI Z;  5CA1 A;  4O4J B;  4X1K A;  1CKN A;  4X1I A;  2UXD H;  4ZHQ B;  4DV6 H;  2VQF B;  4LR3 A;  5FPO A;  1M93 A;  3TY9 A;  5IJ9 A;  5BMV A;  3CHX A;  1TAE A;  2IM9 A;  3T1H B;  1XMO B;  1MZB A;  4L8J A;  4NVP A;  5IJ9 B;  3DF7 A;  3HKC B;  4F6R B;  1X9N A;  4EEQ A;  3U10 A;  1IBL H;  2EX3 A;  3BHP A;  3K58 A;  1XHX A;  4JI0 B;  1HW7 A;  4R7R A;  4BW9 A;  4JI8 H;  1Z5W A;  1WPB A;  1N33 B;  4HNA A;  4LFB H;  4JI5 B;  4DR6 B;  3CSX A;  1V9P A;  3KAL A;  3N41 B;  4FLZ A;  4FFB A;  2PYL A;  4JI0 H;  1FFX B;  2YI9 A;  3JAW B;  3JAM W;  2PY5 A;  1QHT A;  1IBK B;  2PZS A;  4OX9 B;  5C8Y B;  1JJO A;  1J5E B;  4I55 A;  4X20 B;  1QQC A;  3VQV A;  4DRX A;  5LXT A;  2VQE H;  3PN1 A;  4DR4 B;  1NT2 B;  5FD5 A;  3L4J A;  5EYP B;  4LF8 H;  4DR5 B;  3EYY A;  4YJ2 B;  3HKB A;  4DV3 B;  4DV6 B;  4B3M B;  3SR2 C;  3JAL A;  3GDE A;  3HKE B;  4DR7 H;  1IBK H;  2YIB A;  2HIX A;  1TUB A;  2VOB A;  3RJ0 A;  1IBM B;  5J2U A;  1Q43 A;  4ZIB A;  3BRC A;  5KX5 B;  4FFB B;  2HVR A;  4UCR A;  3E22 A;  1H2S B;  4LH6 A;  4X64 H;  3U0Z A;  2VWJ A;  4EQ5 A;  3KAJ A;  2CW8 A;  3JAK A;  2WE6 A;  4J0M A;  4FLT A;  1HNW H;  1SKV A;  2RJZ A;  5LYJ B;  2ZM6 H;  1VS0 A;  2UXC H;  4AQY H;  5D1O B;  1GYF A;  4YHH B;  4O4L A;  1SQF A;  2UUC B;  3NBY B;  3RF2 A;  4NXN B;  3MWM A;  2YXL A;  5KHG A;  2PYJ A;  4PZ7 A;  3L4K A;  3K3V A;  4PHZ A;  2F4V H;  2Q7H A;  2F1M A;  4TV9 B;  4DV2 B;  4RAY A;  3JAT B;  1SA0 B;  3FFQ A;  4RZQ A;  3QWU A;  4DK0 A;  4ZHQ A;  2UUB H;  1XI1 A;  1XHZ A;  4CS3 A;  2W57 A;  2WDT A;  4GYC B;  3SGI A;  1I7F A;  4YJ2 A;  2QJ1 A;  5IWA B;  1HR0 H;  3BAB A;  3JSL A;  4X1I B;  3UT5 B;  5CB4 B;  1SYX B;  2Q0A A;  4DR4 H;  3OTO B;  3WB2 A;  5KMG A;  5CA0 A;  2HVS A;  4CC5 A;  1HNZ H;  4O4H B;  4OX9 H;  1HNZ B;  1S03 G;  4DV0 B;  1TVK B;  3OTO H;  3DSQ A;  1JFF B;  3N2K B;  3GB8 B;  4LFA H;  2HGS A;  4ZOL A;  2YCH A;  4D7S A;  3HKC A;  3QTC A;  4F6R A;  2R72 A;  5KHK A;  3BA9 A;  4GKJ H;  4B3S H;  5J2T A;  2XIG A;  1O9H A;  4LF6 H;  3N2G A;  2ZNI A;  1XDN A;  2PGG A;  5JVD B;  5C8Y A;  2YI8 A;  3W1B A;  4E6N A;  4LF9 B;  4NXN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...