4CC6A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 103
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc6A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc6A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc6A02
4TOIA 4X66B 1CKOA 4DV6B 3NBZB 4DR1B 3S24A 4DV7B 1FJGB 3RR5A 4PZ7A 1P16A 4UCSA 4JI4B 4JYAB 4JI5B 3TY5A 1A0IA 2UXDB 5BR8B 1HR0B 3W1BA 3BA9A 4LF6B 4LFAB 5LMUB 1P8LA 2UXCB 1IBMB 4UCTA 4B3MB 1TA8A 1CKNA 2OWOA 2Q2TA 4DV1B 3NC0B 1XDNA 4LF5B 4B3TB 1XMQB 3BA8A 4LF9B 2VQEB 4UCOA 2HIVA 4DR5B 4JI2B 5D1OB 1XNRB 4B3RB 4DR4B 2HIXA 2VUGA 3JSNA 5FPRA 4LF8B 4PZ8A 5D1OA 1XNQB 3GDEA 4JI0B 3SGIA 3OTOB 5DISC 3QWUA 4NXMB 1CKNB 2UU9B 4LFCB 2HVSA 4LF7B 1B04A 3T1HB 4OX9B 4DR3B 4AQYB 1CKMA 4GKKB 2VQFB 4DV2B 3T1YB 1X9NA 4DV3B 5IWAB 3KYHC 4DV4B 3BABA 3W1GA 4JV5B 4DUYB 4DV5B 4K0KB 5FPOA 4JI8B 2UXBB 1ZAUA 2Q2UA 4UCVA 4JI3B 4EFEA 4EFBA 4DR2B 1J5EB 4LH6A 4JI1B 2HVQA 4X64B 3TY9A 4EQ5A 5D1PA 4NXNB 1XMOB 3TY8A 1I94B 1VS0A 2HHHB 4UCRA 4LF4B 4EEQA 4X62B 1N36B 4B3SB 3GJXB 1XK5A 1N32B 2UUAB 5LMNB 4DR7B 1HNXB 4X65B 2UUBB 3VNNA 4CC6A 4DUZB 3RTXA 4GKJB 4JI7B 3JSLA 3PN1A 1N33B 4LH7A 4PZ6A 3NBYB 2ZM6B 3BAAA 4UFZA 1S68A 1IBKB 4YY3B 2HVRA 2F4VB 4JI6B 2UUCB 4YHHB 4UCUA 1V9PA 4CC5A 3UQ8A 1FVIA 3W5OA 2CFMA 1TAEA 1HNZB 1HNWB 4GLXA 4LFBB 1N34B 4KHPB 3L2PA 4DV0B 1IBLB 2E5LB 4E6NA 3GB8B 1DGSA 4DR6B 4DRFA
chains in the Genus database with same CATH superfamily
2EJ2A 4HNVA 3JAWB 5LXTF 2QEXV 1ZETA 5LP6F 1WB8A 2YEVA 4MTEA 4FIPC 4UB8Z 3FB8C 4RUAA 4EYHB 3APQA 5K2MA 4BXXG 2EINC 5KG0A 2UXCB 4PHZA 2DN9A 2SCUB 4FM2A 4ZBMA 3H4DA 3T1HH 3J80W 4JF3A 5KX5F 4JV5O 4JTCB 1GAXA 3OMNB 5KMGA 3ETHA 2B9ZA 1NR1A 2A79B 4UCOA 2HIVA 5LP6B 5CBGA 3OR6C 5E79Z 3RJ0A 3N42B 1L0NH 3CJHB 3H0GG 3T4ZA 4DV2O 4DV3H 1MZBA 2IA6A 2MK3A 2HG5C 3M99B 3WB1A 4TQFA 2QWNB 3ABTA 3VA7A 1UC9A 1R6TA 5KFOA 3L74H 1KC7A 1S97A 1V54B 2DWCA 1WSCA 3CVZA 4IRCA 2P6JA 5B66Z 4JI2O 1PKXA 4JUZA 2UU9B 4WBNB 1FXHA 4DV3O 2C35B 2HVSA 2QWQB 4EEYA 3JD2A 3GIMA 2ARHA 5H9CA 4O2AA 2A7WA 2P06A 4DR3O 2PN1A 3IN5A 4FZ0A 1OCCB 1K9MW 5GONB 2YRWA 3EYYA 5KFJA 3TGUH 2XIGA 4U3JA 5BMVF 3U0GA 4FM0A 2K9PA 1GO3E 2QKCA 4O2BF 2FJZA 3UT5B 2NN4A 4CS3A 1SRYA 4GCZA 1AROP 1WA8A 4RO2A 1Y74A 1NJIW 2J6UA 2IU0A 3WWHA 4ZHQB 4WFGA 2NU7B 1UC8A 2Q9LA 1T5EA 1Q6HA 2CQYA 3I5DA 2CW8A 2GUZB 5B1AB 3B09A 1VQ7V 5HFMA 1I94B 3FB5C 3JASB 1Q5OA 4ZOLB 1I3QA 3WWIA 3I4MG 2QK4A 1XUQA 2CTRA 5CA0A 3T5LA 3GTKA 3GJXB 4CE5A 4Q6GA 4MVMA 4DK1A 4IRDA 1QR8A 4IYIA 2ZR3A 1BE3H 3K5HA 3G6YA 1QNMA 1T94A 5EZYF 2WA3A 3UO3A 4KL1A 1O9HA 1I1LA 1TUEB 5LMNH 2JA5G 1I1MA 1Y76B 3BHPA 1N33B 4C5AA 3LP8A 2DYRB 2UUCH 4DV0O 2O57A 2QM7A 4O4IA 1KBHA 4MVQA 3JAMN 4WHXA 1WRVA 4K3AA 1VAJA 2HJWA 1FXVA 5CA1A 4ECUA 4TUYA 3ZRXA 1VQ5V 2FMAA 1OBDA 2XGQA 3HKBA 5HBRB 1Y4MA 4K6NA 1I7NA 4O7LA 4YY3O 1FJGB 1E4GT 3W7TA 4JI5B 5DM6V 2CNQA 2EILC 2UXNA 3C90A 4I50B 5EC1C 3T1YH 1PPJH 4LFAB 5LMUB 2WLLB 4XDLA 5I5VA 3V4SA 3BACA 2YIAA 2OWOA 2Y4RA 4DR3H 3WFVA 1F4NA 4JI1H 4LFCH 4DR2H 3QTCA 1GMGA 1WB7A 1SQFA 2NU9B 3IJ4A 1MSDA 2YZNA 2XUMA 5GTHZ 3CMEV 4K0KH 5KHHA 2XT9A 4P9OA 4YAJB 1IYDA 5KUKA 4LF5O 4DR4B 2ZNJA 4FFMA 2VUGA 3RBDA 3U9TA 1OCRC 3HOUG 2BSKA 1NH2D 2QWOB 4L87A 2C22A 4FE2A 1AI5A 4QNHB 3VQYA 4J9ZB 4TUYB 2ZINA 3T2MA 2UU9O 1W0JG 3CCQV 4EGQA 3L4JA 5DISC 2FKLA 4YR3A 2R9IA 5C3EG 1MABG 2UXDO 1S72V 3CSWA 4O7VA 3UFXB 1KP2A 3E22A 4PWQA 4DV2B 2RQ6A 2FK2A 2FLLA 1Q6UA 1O75A 5JVDB 2HFEC 1K73W 2PMZA 4OPAA 1QLNA 1ZLZA 2Z3YA 3RYFB 1GN3A 2R9AA 3QO5A 1E1RG 3ZS8C 4DR1O 3JRXA 4FZ1A 5LP6C 4DL5A 3MR2A 5J2TB 4TVIA 2QWRB 2IMWP 1FD9A 3ABLC 1QVFU 1FXKC 1IXMA 2W6JG 1Y14B 4ZHQA 5C1OA 1GYFA 3THOA 1NI8A 4QE9A 3MJFA 4AI8A 2B63A 4UVBA 3CD6V 3GTGA 2EZOA 3APOA 3JRWA 3TQTA 4X64O 1NS1A 1EZVH 3PR4A 3IC7A 4GKJB 1Q6IA 3A0BZ 3F5TA 1BQ0A 1JOYA 4GC7A 2ZM6B 2QE7G 1VQ8V 3FKIG 2GV9A 1M7JA 5LOVA 1SQBH 3BVOA 2XD4A 3W5OA 3G4SV 5F9LA 3ETDA 1MZFA 3AK1A 2NLJC 2WLLA 5LGTA 3ZMSA 5E1AC 3PO2G 5J2UB 1JFFA 2UUAH 1CKOA 1VMGA 5DLGA 2UXBH 4DR1B 4BY1G 2DAAA 5IT9N 1GSHA 2YIDA 2B1GA 4LF4H 3OSPA 2XTAA 3HKBB 4JYAB 5KFDA 2OCCC 4F6RA 1WNSA 2JK5C 3J7AU 3QF7A 3Q8QB 4QIWE 2Q2TA 2RGRA 2WWWA 1J5EH 4IL6Z 1Y76A 3OTFA 4O4IB 3SYOA 1AVMA 3CSXA 1N56A 3X2QB 2RGVA 2B1IA 1BSMA 4XBFA 5KLVH 2Z5UA 4O4JB 3LDCA 1IBLO 1KJJA 4QIWF 1SEIA 1K92A 4J9PA 3J80N 4OGQB 5IYZB 1QVGU 3GIIA 3H3VH 3GB7C 4ZOLA 1I94O 1OJHA 2NR5A 2GUZA 3AYHB 4DL6A 3MWDA 1PD3A 4DRXA 1CKNB 3AW8A 1WH2A 2AU0A 3O9OA 3N8DA 2WLNA 3HB9A 4JASA 2EILB 4AQYB 3Q1KA 2XCPA 5KT7A 4F6RB 1V55C 2Q0OC 2R7KA 3P30A 1VQPV 4KP4A 3QG5A 3MD0A 4O7WA 3KYHC 4JI1O 4O4JA 5C44G 4FS1A 3FB6C 2ZDGA 4DV7H 3HOXG 4I55A 4C7UA 4D6TH 1S0MA 1TVKB 4UCVA 1V51A 4FLWA 1GN6A 4LF5H 1H2LA 1CQJB 4JI7O 4R8UB 2E2HA 1N34H 2JA6A 1JDEA 5BYBA 2UVUA 5IYCG 4A3FG 4HR7A 4X88A 1IBKO 4F4WA 1VF6A 4TT3G 2Y69C 1NTMH 2ASDA 5IP7G 4LF4B 1W2BU 4P9PA 4JI3O 4JI6O 4KHPO 2W6OA 3K08A 4NB5A 4J9LA 5DN6G 5CA0F 4WF9V 3C0FB 1YJNV 1M57C 4K8ZA 3OHBA 4DQNA 2QWPB 2OIEA 2R82A 4DR7H 4X1IA 5H6RA 1VQNV 1SFOA 5H80A 1NKDA 3KCYA 4UFZA 1KJ9A 2JEUA 3K9AA 4UCUA 4YR0A 2P4KA 5DGBA 4X62O 1HNZB 3SYPA 1VBGA 5B1AC 1YDXA 2PMZE 3SJAC 4A3JG 1BZKA 1I7LA 2CUGA 1IXBA 4O3PA 4F4XA 3E83A 3CC7V 1BNCA 4JTDB 4LSXA 2JEFA 1RM1C 4PZ7A 3EPGA 1BCCH 2ODTX 3CRQA 2GLTA 3TY5A 2CAZC 4ED1A 5IWAH 2W9CB 5L1LA 2IH1C 5DG8A 1L8DA 4B3MB 5FD5A 2W0FC 1RK5A 2YIBD 4MV8A 1KMIZ 2B63G 4IIJA 5BMVB 4MTOA 5EBMC 3DTFA 1OCZB 4X9QA 4JI2B 2BQRA 1WA8B 3E35A 2Q8VA 3WU2Z 4LF9O 4X1YB 2GQSA 3JZIA 4LFBO 1FKAH 3GTLA 2QM8A 2C2AA 2IU3A 4X66O 4U7OA 1K8AW 2WSSG 1QHTA 2YRXA 3EHBB 3K0GA 5KFHA 4NVPA 1PNKA 3GDEA 4ZQIA 3ZEDA 1JPXA 4F50A 3OTOB 1H2MA 3OR7C 2HGSA 5EDWA 3T5KA 2CE4A 2LQTA 5CN0A 2D3OW 3QWUA 4LMYA 5KT5A 3NR7A 1EZJA 4P30A 2WLHA 3K3VA 2WB1A 4B3MH 5B3SB 4DIMA 4RAZA 4LF8H 1K97A 3K04A 1X9NA 3JALB 4JYBA 3CCRV 3CCMV 4DR5O 1RK6A 5L1JA 4H37A 4K0KB 2W6MA 2Q2UA 4I0XB 1WP7A 2X6CA 1SYXB 5H5NA 4CH5A 4RZRA 1IBLH 2OH2A 2R7LA 2WLIA 3PW0A 4MS2A 1R3KC 1RSOA 3BY6A 3GIPA 5C8YA 2EJ3A 4R8UA 5KFAA 4LFAH 5KKNB 3UZOA 3ZHUA 2R93G 4NZOA 1B33N 1VIBA 1Z2OX 1KJIA 2NU8B 3WO0A 5B1BC 5KFFA 4N23A 4X62B 4B3SB 2EIJC 3JCUZ 1HNXB 1VP7A 5LOVF 2XAQA 3RTXA 5LYJF 2W7OA 3CEBA 4GX1A 1PV0A 2CW7A 2N74A 3SYAA 2F4VO 1HNZH 5IJ9A 3BAAA 4I4TF 5BY1A 2YXLA 4FFLA 4DV7O 3HKZA 4JI6B 3SJCC 3UQ8A 1YSCA 4BR6A 3H40A 3D3IA 3N2GA 4R7CA 5KT6A 4LFBB 1N34B 3G6XA 3L73H 1VQKV 3OSNA 1RFYA 5LA6F 5D5PA 1GSOA 5HV6A 1VEWA 1Y66A 1HW7A 2R85A 2B5UA 4HN2A 1BQZA 2ZDHA 4F4LA 4DV7B 3RR5A 2YL2A 4QWBA 5GONA 3K5OA 3AG4C 4RUFA 1I0HA 4OX9O 3JASA 3JARA 2X6BA 2ZD9A 2VQEO 1K3EA 2DE0X 2LO1A 2UVRA 3RB0A 3LMLA 2Z02A 5C5JA 5KG3A 1M0WA 2RJZA 2HR3A 1HNXO 4B3TB 2UVWA 1ULZA 2YW2A 3QO7A 2JS5A 2HG8A 2X6AA 4DV5H 4B3RB 1JMKC 4FJCC 3NGDA 4HYOA 4XYMB 2BTOA 5C1PA 4QE7A 1AR5A 2RMKB 1NVPB 3AG1C 1AJQA 3BRCA 4O4LA 3E89A 1N4CA 1AB3A 2ILMA 5GONF 3SGIA 4R50A 3T1CA 4QWEA 3PO3G 3K3WA 1FFTB 4I7HA 5KX5A 2P0AA 2WDTA 3OHAA 5KFGA 1RJPA 4OX9B 2Y69B 3QZ7A 5KT4A 4Q8EA 1CQIB 1C30A 3ZMTA 4GKKB 3EXAA 3N41B 3A8TA 5KG4A 2GHYA 1SA0B 1HNWO 5LXTB 4DV3B 2ZDIA 5J2TF 4ED6A 5JQGB 1TVKA 2YICA 1KKCA 1VQ4V 4I55B 4J9QA 1B06A 2UXBB 4X1YA 3WO1A 3V6HA 3E8HA 4IYHA 4P2ZA 2ASJA 4TV9A 4BY7G 4KHPH 2BCCH 4LFBH 1FPOA 1MMMA 2YDEA 2UXCH 1SCUB 3MR5A 1Z5VA 3DXRB 3BQ1A 1AUVA 1K5SA 2OYQA 4LF7O 2AGAA 4GC6A 5GTIZ 1R73A 5BR8O 3I4NG 5ITZA 2E5LO 2UXCO 3K57A 2PUSA 2CH7A 3SNOA 1BXRA 2ZE5A 1GN4A 3AG2C 5IWAO 5F9NA 3RBEA 3VQWA 3L75H 4WFEA 3E22B 3X2QC 3VPCA 2WPDG 1A32A 4H0LB 1DK1A 3LWBA 4BBRG 2W57A 1QU7A 4YHHB 1ENVA 3L71H 2R7NA 4FFOA 1W93A 2BQUA 3ABKC 1VQ9V 1A3GA 4GKJH 2WLIB 3I55V 4ABMA 3ZRSA 5CB4F 5LGUA 2EULA 1TUBA 3F5WC 1IBLB 3GB8B 5KUMA 2R6FA 1DGSA 4DRFA 2R9RB 3CCEV 1UNNC 4A3BG 2DW4A 2QKSA 4BW5A 4DV6B 1Y6XA 1I2KA 4Q20A 2Y4UA 4W4KA 4JI4B 3U9SA 1KKDA 5JH7F 3BA9A 2Y0SA 3N40P 3G8DA 1DLBA 1AI4A 1BS3A 3T1HO 3H1KH 5L3FA 3OTOO 2CNUA 2DMXA 2QSAA 4D7SA 2Q7GA 5D5QA 5JJJB 3GILA 2ZT9B 2X0SA 4J0MA 5D1OB 4QGPA 1YTFB 5KFCA 1NZ6A 1KEEA 2GTAA 4EYIB 5JJNB 3B77A 2VQDA 1B6QA 2HJDA 1O9GA 1XNRO 3U10A 3OW2U 3UYYA 3RB3A 1TWCA 1R9TA 1SF9A 2ZXWB 2H3OA 4QWCA 3E5NA 1IYEA 1M57B 3D36C 4RQFA 1QR9A 1RPOA 1PP9H 2JEIA 1Q86W 3Q4HB 1TWFA 4R8CA 3CCLV 4ECTA 1VF7A 3BABA 5HNEA 3GWOA 3LSUA 1H8EG 3GLKA 1S5JA 1KYOF 4LC1A 2ZGIA 5KFZA 4X89A 2M05A 1HNZO 3AX6A 2YUAA 1Y1VA 3DAAA 2J6TA 5I5UA 3VBBA 3VMMA 1K34A 4B7EA 3RT3C 1JIHA 4NXNB 2QTOA 3PR5B 2ZE8A 3U54A 1KBLA 1AILA 3B2EE 2YIBA 3SPIA 4RUCA 2Q7DA 2YXHA 1GH6A 1XL6A 1H2GA 2W6PA 1ZQ7A 3M4IA 4CMFA 1LUWA 1ZSPA 5KG2A 5IYDG 5CB4A 3H9VA 4X1KB 1S9FA 1N33O 3ZHTA 4LF4O 2CGNA 5IY5C 4ED2A 5IYZF 5JQGA 5C8YF 4A3IG 1HNWH 5LXTA 2EINB 3KHLA 4YJ3A 4GT1A 1EKPA 3N2KB 3WG7C 3RB4A 3CMAV 2HVRA 3QVNA 3QFFA 4IHJA 3OMAB 2Y48A 5EZYB 1EHIA 5KX5B 3RGZA 1HP8A 4RNOA 4RNNA 3R9RA 5KFMA 3R5XA 3BCCH 4QWDA 4RQEA 4RB2C 1KB9F 5FNVA 2HHFB 5EC2C 1AJPA 4FPPA 3W7WA 3L4KA 4QJFB 1XL4A 3RYHA 5L1IA 4MTFA 2HGXA 1G4YB 2ZM6O 3FB7C 4FFPA 5JCOC 3LSQA 1XOUA 2ETNA 5DQGA 2FKXA 1MG1A 5KMGB 2DOSA 5BPFA 1TA8A 2DPJA 2VWKA 2AZ2A 5KG5A 4TUYF 2DYSC 3HXLA 4ASUG 1XHZA 1BJTA 2BOBC 1Y1WG 1IBMO 5JQGF 4JI8H 2FP4B 3JARB 4CKCA 1XNRB 1XI1A 4MAMA 5FR9A 4IR9A 2R93A 1AJNA 3JYCA 1XDCA 2Q4PA 1KTAA 1G1XB 4FFRA 4UUJC 1S5LZ 5KFKA 4NLGA 1FKAO 2ODMA 3J81W 3OAAG 3VPBA 3RW0A 4O3NA 4MVZA 4CMDA 4FLVA 1AUXA 1ET0A 3ZMVA 2D2CB 4HBNA 3HO8A 1LNQA 4RAIA 4Z1MG 5BZBA 1YIJV 3T1HB 1KJQA 1COWG 1I1KA 1I5XA 4XX0B 3HT5A 5FLXW 2WTFA 1GKFA 2VUMG 5DECA 4A3DG 4X20B 2DLNA 3W1GA 3G6VA 3HOYG 4ECRA 1MSWD 2UXXA 2WAQE 1YI2V 3UKMA 3VOUA 2XAHA 5DAAA 2NNUA 2HVQA 3DC6A 3ICXA 1R3IC 2JGDA 3TINA 1S0VA 5DG7A 2IP4A 1E4FT 4YAKB 3PW5A 1SZXA 3ABKB 3STZC 3BQ2A 4FBTA 3FFQA 3ZN0A 5LYJB 4O3OA 3F7YC 4EBDA 1RYRA 5L3EA 4EB6A 2PYJA 2L6LA 1S0NA 5CBHA 4BIZA 1EM1A 1N32B 4O7YA 4O4HF 2ZXWC 2Q5ZA 4A3KG 1ZUQA 1B6RA 4XZ3B 3ZHQA 4G27B 2IJHA 3JD0A 5D8DA 1N8RW 2Y0IA 3RV4A 2F1MA 1W59A 1WPXA 2ADQB 3JSLA 4Y8VB 2HJFC 3H0GA 3RIZA 3W7SA 4JI5O 4MA0A 2KG7B 2P90A 4TV8B 5CA1B 4RB3C 2PGGA 4YY3B 1FJGO 4CH6A 4FLZA 4L8JA 1EKFA 1RP3B 1KP3A 3GIJA 4YP3A 1WAZA 3L2PA 2R86A 3VQVA 4PELA 4AHCA 1GM7A 1V54C 1YXBA 3KG2A 4E4EA 2HLDG 4TQSA 2I87A 4LF6O 3PVXA 3LULA 2OTLV 5KFEA 3CRCA 1P16A 4PA4A 1Q3EA 1TWGA 2R7MA 2UXDB 4EG0A 5DEDA 4MSWC 4DUZO 3FMAA 2FE3A 3C3TA 3B8NA 4DW0A 4LF6B 5EWEA 4MV3A 4H13B 4NXNH 3K9SA 5KFSA 4OPHA 2W8LA 1G2WA 3K5LA 2WLKA 2CKZB 3KHRA 3SI8A 3CX5F 1AP5A 2E2IA 5KHJA 1ZL8B 1WCMG 3WG7B 2YS8A 2CZGA 1AN7A 1Z2PX 3OUSA 4O83A 2GSMB 4O82A 3FKIA 3H1HH 1Q81W 2X5RA 3R23A 1VARA 3IFXA 5FNVF 2P4VA 4A2AA 2YI8A 2Y0SE 4JGSA 4B3TO 4RAYA 4PJ0Z 1XMQH 4LWSA 4LFCB 4YJ2A 4U3FH 4IIJF 2OIGA 4IWXA 1P84F 2ADPA 3N43B 2CDYA 4WBNA 3LQSA 3VOTA 1UJWB 4DR3B 4A3EG 4NKGB 1BMFG 2ATLA 2R92A 2BTQB 3OUUA 4QW8A 4O2BA 4Z1VA 4DV1O 1I50A 4JI5H 4C2MA 4CH3A 3A0HZ 4HZ3A 3T9CA 3OEEG 2KQXA 5FNVB 5KFLA 4O4LF 5L1KA 3JD3A 3PW4A 2HP8A 4DK0A 4EFBA 4YQWA 2V4DA 1EZ1A 3KXYT 3PW2A 1D5AA 1N34O 4DV1H 5L3BA 2YS7A 4YBZB 2XGPA 1QLEC 5DLFA 2YCHA 1U97A 1H2KA 2LW7A 4ETSA 1XMOB 3AEIA 4DAAA 2XOKG 5L3CA 3OD4A 4I50A 2FB9A 3SR2C 4C5BA 3RYIA 4YY3H 1IBKH 4ME6A 4JI4H 2FYUH 1D2DA 2DWDC 1Q43A 2A0LA 1SC5B 4R6ZA 2UUBB 1KC8W 2JEGA 1ZL8A 3LNNA 4FMTA 1BHAA 3CXHF 4DV4O 1OWTA 2J6SA 4IIJB 2ZE7A 1A9XA 2IW5A 4O4HA 1YITV 1RJQA 4ED0A 3GTMA 3OE7G 1ROPA 3S3XA 3RF2A 1N36O 1OCOB 4X8AA 4ED3A 3CYOA 5KAIZ 4APMA 1Z2NX 4ICGA 3N44B 4CC5A 2XHBA 3Q8SB 1FXKB 3FYIB 1HWYA 3U11A 3P3NA 1FFXA 2IM9A 2FK1A 1JKJB 1XNQO 2VQFO 3ETJA 1B3QA 1S76D 4O7SA 2V59A 2RN9A 3S24A 2W8KA 3G80A 2OCHA 1YEWA 5H2FZ 3T9DA 3RB6A 1ZWIC 3V6JA 1CS0A 4KXRA 1EBOA 2PBZA 2COJA 5BR8B 3ABUA 1P8LA 4X65O 2R84A 4LNUA 2VQFH 3J7AK 1SKVA 2EIMB 4CKBA 3KAJA 5LHGA 2VA2A 1YF2A 1SQXH 4TV9B 4NYKA 2F23A 4PA9A 5KFIA 4M0JA 4WCEV 3ZBHA 4O4JF 2E74B 1WP8A 3SJBC 2GBOA 2OLSA 3IAYA 3GIDA 1WPBA 4C5CA 3H1JH 4Q43A 5D1OA 4IT5A 3IG0A 5T14A 1X4TA 4MW3A 4O2BB 2GQRA 3HKCA 4OX9H 3GTQA 2EX3A 1XNRH 1VF6C 4JI4O 3FKSG 4MV1A 2YZMA 3QQMA 2KSDA 3RGXA 4YJ2B 1P7BA 5J9PC 4JI0H 3KHHA 3J81N 1CKMA 5IY5B 2VQFB 5C93A 3L72H 4JAAA 3SYQA 4TQRA 3EPIA 1HR0H 5FJ8G 1MA1A 3O65A 2ALZA 4O86A 4IWYA 3GTPA 4DUYB 4DR5H 4JI8B 3RWRD 1TUBB 4H33A 2R8HA 4J7KA 2AGOA 3R66A 2MW2B 4LH6A 2FLPA 4BW9A 4B7KA 5FLXN 3L70H 4ZI7B 3CXCU 2EJRA 2QR4A 1M56B 2DQ3A 2CTPA 5DGHA 3U0ZA 4QWAA 1SQPH 1I5YA 3I56V 1VS0A 2UUBO 3BJYA 4YXWG 1FS0G 2VRZA 5DQHA 5IYBO 3TIGA 4ED7A 4HNAB 2UUCO 4JI7H 1LUVA 5CM0A 3AG3C 4LBEC 2F95B 5LGNA 3VNNA 1EUCB 2UUBH 1M90W 3RAXA 5FD6A 2EZPA 1RYSA 2Q69A 2V4QA 3NXSA 2R72A 3PN1A 5HFLA 1IBKB 1CPYA 3CHXA 3UCSC 2R8JA 3KREA 3M7MX 1HNWB 4ECZA 1OCZC 2JJ1G 4MV9A 4FS2A 4DUZH 2OT5A 1QLEB 4X1IB 3RYHB 3OFNG 4JI3H 5JQWA 2Q73A 4B3SH 4Q4CA 4LFCO 4RZQA 3K59A 5FLMG 3CCSV 1ZTEA 4AQYO 1C3OA 1V55B 4UCTA 5F2VO 2BOCC 1G8MA 1XMQO 3N2KA 3HR0A 5IT9W 4X64H 4RB0A 1XMQB 4A5UB 3MR6A 4FGRA 2W6QA 4NXMH 3TETA 2AQ4A 1L2ZA 1AI7A 4MVUA 3A2FA 1NTKH 5DGAA 2XAJA 4E4TA 2COIA 1GLVA 5DMXA 4PZ8A 3AK2A 3HB3B 4LF8B 3SPCA 4MV4A 1TWAA 1RM1B 1PNLA 3ZIAG 4I55F 2QJ1A 1US6A 2YWVA 1JR9A 4EGJA 2ASLA 4PBCA 3EVKA 4MTDA 2XC9A 2QGNA 4LWSB 4M9UA 3SYCA 1CEZA 3AK3A 4PI0A 1FAFA 3GIKA 3V4ZA 4LF7B 3ZRWA 2VPSA 3K79A 1XBLA 3FAVA 5EYPB 3FD9A 1WCMA 1E4EB 2CH7B 2HKOA 3HOZG 1I6UA 3LNMB 2IBZH 1S0OA 1NR7A 1G6UA 3GTJA 3K03A 2KSWA 1SS3A 2W0XA 5BWUA 4X66H 4J9OA 5KFQA 1R1BA 4BIUA 2IBKA 3DXRA 3M8AA 4LCUC 5EBLC 2DQ0A 4I9QA 3WNZA 2YS6A 4E2LA 4DR6O 3ASOB 2AZ0A 3TW6A 5A9GA 4B3SO 4GYCB 5JUMA 2R70A 4UCRA 3D8CA 1X59A 4MVSA 3DF7A 3G8CA 2EJ7A 5KT3A 1XK5A 3W7UA 3SE7A 4DV6H 3C3SA 5KFTA 3D36A 4DXWA 5JH7B 4QPJA 3JD4A 2HVKC 3P3PA 3L9DA 1F7YA 4DL2A 2HVJC 3RYIB 2VR1A 3TQ1A 4LH7A 1JQ0A 1S5HC 2CNVA 4JAUA 4G3IA 5I5XA 4WD3A 3RGBA 1NVPD 1FVIA 3IC9A 2N04A 3RVZA 5KFNA 4JAVA 2E3CA 4G28B 4BWAA 2W9BA 2YC0A 4DL4A 4XDJA 4IHJF 4FVMA 4JPRA 4E6NA 3HKCB 2JA8G 3ASNC 1JJOA 3RBZA 4X65H 2VPQA 3BEHA 2XASA 4TOIA 3NBZB 1SQGA 5KG6A 3JZ6A 1CP9A 3JD1A 4MTGA 5BWRA 4JV5H 4EB6B 3BG5A 2QDOA 2JVDA 3W1BA 2HHHO 1M1KW 4DYLA 2PI4A 2AGQA 5KHIA 4GKKH 3RFCA 2Q67A 1E79G 2V7QG 1XQ8A 2UXBO 1BHBA 4UV9A 3ZJZA 1P4RA 5GW7A 2HGWA 3T5JA 3SPJA 2CTQA 2R8IA 2JA6G 5IE9A 4M7EA 1KUTA 1YVWA 3RVYA 4I9WA 4K35A 3G6EV 2V1DA 2QB5A 4PDBA 3GV8B 4HNAA 3HOWG 1WLEA 2LW1A 3B40A 4JI0O 4CZZA 1JDBB 4F4ZA 2WAQA 2QM4A 4Q8FA 1XNQB 5LHIA 2DIKA 2W7PA 4HNTA 2R8KA 1PL0A 3JAKA 2VQEH 1EN5A 2A3QA 3N2GB 2PY5A 5KA6A 2ZDIC 1IOVA 1YJWV 3JAKB 2PZSA 3TEKA 3OM3B 1JVMA 5KA5A 4FBUA 4ZI7A 4UB6Z 4DL3A 2W6NA 1IBMH 1DIKA 4FM9A 4J9RA 2P7TC 3H1IH 3JCZA 2YYAA 4DV4B 1I2LA 4DV5B 3CQZA 2GPSA 2I8CA 4FLXA 1SZTA 1J95A 3TXSA 4K0KO 4ZIBA 1OBGA 1J5EB 1Y1WA 3TY9A 2RCVA 4QPKA 4A3LG 1D5NA 3HKDB 5CMUA 3K5NA 1RSOB 1YHQV 5I60A 3TY8A 5DG9A 3EFFK 2ZNIA 3RYCB 4YJ3B 5EK0A 4I7ZB 4EEQA 3SPHA 1K1QA 4CBCA 3OUZA 2FB5A 1JFFB 1OCCC 5I5SA 4JYAO 4X1KA 2V9WA 3CE2A 3UM7A 5DQIA 4MVOA 2W71A 2FPPB 4NZNA 2GPWA 2VS0A 3HBLA 1HNXH 1KECA 1KUQA 2BTQA 5EZYA 3E8FA 5LHHA 1R3LC 3R65A 3ZRVA 5DGIA 3OGCC 4WFAV 3T99A 4JI6H 4LNUB 5LA6B 5K1XA 3CCJV 1V9PA 4AILC 1TAEA 1V4YA 1WN7A 4UVAA 1GM8A 2H94A 3ABMC 1JX4A 4F4YA 3ORRA 1K83A 5BWXA 2XCAA 3E8GA 4YB8B 4J9NA 4FLYA 4I4TB 3K3PA 4A2BA 4FLUA 4X62H 3SJQC 5JVDA 4ED8A 3JAWA 2JDIG 5EWFA 1A0IA 5BWWA 1NH2B 1XILA 4JYCA 2HEPA 1E4EA 5I5YA 2DYRC 1M6VA 5EBWC 1CKNA 3H4BA 2N05A 4TWKA 5J2TA 2JEJA 1IX9A 4CS2A 1N0NA 4BBSG 4GX0A 2YZGA 2A9HA 1OHHG 1SESA 2W9CA 3T9AA 5KFWA 4O81A 1K33A 3ZMZA 1R3JC 4O3QA 1KT8A 5FPRA 5BPHA 1H8HG 1EUDB 3GV5B 3DC5A 3ZMUA 3H20A 4J42A 3N27A 1EN6A 2NU6B 2NVXA 3MR3A 4LSAA 4D7TA 1H2SB 4JI2H 2ZJTA 2R8GA 4LF7H 3JATA 4LF9H 1Y1VG 4A3MG 2CTWA 2CGOA 4UXNA 2BR0A 3OTOH 1B04A 5BWVA 3OGIB 1E1QG 2QA4V 4RNMA 4ZKIA 1RPRA 1S03G 3AG2B 4WFBV 1QQCA 3M9NB 4NTWA 4DR4H 1U96A 2PVPA 4BAYA 3ETEA 2HDKA 1KD1W 3CPWU 3MHSC 1ZAUA 5IDJA 4Q4DA 3CJHA 2XAFA 4B3MO 2PTMA 4DR2B 4LF8O 4JI1B 4X64B 4Q44A 2RDCA 3CP1A 4PDRA 4NYEA 3GWKC 2W6ZA 4CH4A 1Q90D 2XCLA 1T36A 2FTKA 1DF5A 1NTZH 2L35A 1N36B 1VBHA 5CAEB 3HOVG 1H2NA 4DR7B 1BL8A 5A2QN 3H1LH 3K06A 3TIIA 5KHGA 5AG2A 5CBFA 1UFIA 1KQSU 1F4MA 4W4LA 2JRIA 5CA0B 3NBYB 1NQTA 2DYSB 1YJ9V 5CE8A 3G6BA 3B8MA 1NBMG 3ABLB 1OCRB 1IZ3A 3ASOC 4PDLA 2CFMA 4DRXB 4GLXA 4RU9A 4JXUA 4KHPB 3T9BA 4DV0B 2EJ0A 4MVRA 2W9AA 5IJ0B 4IRKA 4OXSA 2V5AA 2LFRA 2RDJA 5ITZB 2COGA 5IYZA 4CKEA 3Q4HA 2VA3A 1VQMV 2AW9A 1J5EO 2JA7G 2AXTZ 2K1EA 2ZQMA 2JJ2G 1KU9A 2JEXA 4JYYA 5L3GA 4O2AB 1IBMB 4O7TA 1R6KA 2RNBA 3TCUA 1EYZA 1GGOA 3OEHG 4KUMA 1XDNA 3KZIZ 4LF5B 4DR4O 4O84A 4ECWA 3P32A 1IDSA 1W0KG 3MDSA 4ECVA 3RFRA 4JZ2A 3ASNB 2HIXA 5E25A 4MTXA 3DTGA 3T7AA 3WB0A 3OMIB 4DW1A 4GKJO 3JSNA 2O03A 3T9FA 3A0RA 5LMUO 1QBZA 5KHKA 5JWPA 4TV9F 4QIWA 3PZPA 2FL4A 4B3RH 3ZHRA 4B08A 4JI0B 1GRJA 1S3JA 2GDSA 4HYKA 1AR1B 1F23A 4IAJA 4B3TH 4GX2A 3U55A 4O3SA 2YI9A 1EFRG 4O4IF 2DZDA 2C28A 4G2KA 4QSHA 5I5TA 5K1PA 3MWMA 5B1OA 2V4RA 2W6IG 1CE8A 3T54A 3T4DA 1VQ6V 3ORQA 1BGYH 5CB4B 2FPGB 1BT8A 1MOFA 4FFKA 1WR2A 2ZDQA 2WB1E 4J7ZA 3HKZE 2PYLA 3TXQA 2MCTA 5KFRA 5IYCO 1Q8IA 1IURA 1N0JA 2A1HA 4DV0H 2IJKA 3K0DA 5CR5A 4EQ5A 5D1PA 4PV1B 2C2EA 2YU9A 2A06H 3H01A 3CWBH 3GIQA 4Q0YA 4RUEA 3FDSA 3E86A 4PA7A 4UVCA 3CCUV 5LL6b 4O4HB 3MHHC 4Z2WA 5KFBA 5B1NA 1M93A 2UUAB 4YR2A 4MA5A 4KFMA 4RB1A 4X65B 4FLTA 4PDVA 1FFXB 3NUAA 3WB2A 1JJ2U 4HQ6A 4FFBA 2EIYA 4FU0A 3W7XA 2YZLA 2Z0AA 4J7JA 5EYPA 4JZGA 5BWTA 4TV8F 1N36H 2ABJA 2EIKC 4U7NA 3M9MB 4A93G 2R92G 2Z04A 2W70A 4RWUA 1Y67A 1GSAA 3E2EA 4DR2O 2M6YA 1HDJA 3T9EA 1VKZA 1XREA 4I5SA 3UT5A 2E5LB 4DR6B 3JAMW 5EIBC 1ZX3A 2GTSA 4J80A 4LFAO 3B4SA 4LP8A 1H38A 5I47A 4DLKA 1SQVH 2QYZA 2UUAO 5KS8A 4QJFA 4UCSA 3DTUB 5B1BB 5KAFZ 2DJVA 1K4CC 1M4UA 3GVMA 2R7ZA 4CHIA 1Z2GA 5LYJA 2X7RB 5KFVA 3NC0B 5KT2A 1SETA 4J41A 2FMLA 5L9XA 4ZOLF 2LFSA 4IZOA 4J9MA 2JGDB 4LF9B 2C00A 3UZBA 1DAAA 2JA5A 4O7NA 3ABMB 1PL4A 4YIOA 1KJ8A 3JALA 3TJTA 4DV2H 5LP6A 2F93B 5EWGA 3CRRA 2UVVA 4MW8A 3G71V 1M5IA 5JVDF 1F51A 3UO2A 1EKVA 2IJIA 5IYBG 4NXMB 3FX7A 3HKEA 5LBQA 4EBCA 1PM9A 2BE3A 1JXLA 3PJSK 3AG7A 1RJRA 3ML0A 3T1YB 5IWAB 1DTOA 3RYFA 3KCXA 1K7DA 1DV1A 1OV9A 5IJ0A 2G38A 1VF5B 1LR1A 3IGAC 2Q7EA 4BWSC 2C2RA 1YCIA 5JCOA 1S77D 3LDDA 3KHGA 1OCOC 3CS5A 1TGOA 2F43G 2E76B 3Q8RB 5K3WA 3ZRWB 1JLLB 5LMUH 4LF6H 1B6SA 3KKYA 2UXDH 1JA8A 2RDIA 1L1FA 4IR1A 2Q6AA 5CA3A 4XDKA 4U3JB 5LMNB 2P5OA 5KFPA 1NT2B 4DL7A 4I50F 4CC6A 2NVYA 2Y0PA 1NU1H 5LMNO 4DUZB 5I5WA 4J11A 1S10A 2HHFA 5C4XG 4JI7B 3ZHVA 2LJ2A 4PZ6A 3R5FA 5LA6A 4F6EA 5A2QW 4J9KA 3Q8PB 2F4VB 2UUCB 2KG7A 4TV8A 3GQCA 3ETGA 2AHYA 4JTAB 1N33H 2JIZG 4JV0A 4HNUA 1A48A 4NTXA 2FLNA 4GLWA 3CEIA 4DV5O 2YXYA 2DPIA 2EIJB 3I12A 3QO8A 1T3NA 1N32H 3MFHA 5JH7A 3AG1B 5H6QA 4X20A 1K5QA 4O3RA 3S3WA 4DV4H 4YJ2F 3T1YO 3RUPA 4H44B 1GK9A 4B3RO 1I94H 1HR0B 1SQQH 3CB2A 5B3SC 4MV7A 4YHHO 4O2AF 4AQYH 1P49A 3TW7A 3STLC 3JATB 3SPGA 5L3DA 4NXMO 2LGWA 4JV1A 3LDEA 2BQ3A 4YIPA 2VQEB 4DR5B 4AYBA 1L0LH 3CRAA 4DUYH 4U6PA 1XNQH 1IOWA 4BIOA 2F66C 4J9SA 3RN4A 5IYDO 4J9YB 4XYLB 1AP6A 3JZFA 3AG4B 1VQOV 2FK3A 3HPLC 2Q68A 1ZHQA 2UU9H 2DWEC 1I7FA 1FXKA 3K5MA 3FAVB 2EIMC 4FM1A 3ZN1A 3PW7A 2P22C 3HKEB 4PA3A 2NUAB 3KTMA 1W96A 1PX2A 1Y74B 2M7WA 4N21A 1MNGA 1I08A 1PK8A 5BR8H 1Z5WA 4UV8A 3K58A 4JYAH 2BSKB 4JV5B 3M9OB 5EOYA 4YJ3F 3CC2V 5FPOA 2IJJA 1SA0A 4DR1H 1K4DC 1DV2A 5J2UA 4GUNA 3GV7B 5KFXA 3K5IA 3TK1A 4ECSA 4JV2A 3CCVV 3OUFA 2C2DA 4IHJB 5C8YB 4PI2A 5LOVB 2QKAA 4L1KA 4MT8A 4O4LB 2ZM6H 3E8BA 1HR0O 1AR4A 4WFFA 2LGQA 3T5HA 1R6NA 3G67A 2KB1A 4RCNA 2W9BB 4K8XA 2WYOA 5FL7G 2QTSA 2F4VH 3ZHSA 2XNDG 2OTJV 3LSSA 4PA6A 1XEQA 1M9NA 1M56C 1IVSA 4O7RA 4IGGA 3ZX6A 2Q7HA 5B5EZ 1A0GA 1XHXA 2RF4A 1XMOO 2I80A 1ZHSA 5KG7A 4NR1A 4X66B 3KALA 4GZRB 3AG3B 4LR3A 2ZIOA 4PD4F 3F8NA 3ETQA 2YSUB 4R7RA 3V6KA 2ZE6A 4GX5A 2IH3C 3F7VC 4ECYA 2HHHH 2WLMA 3CRMA 2WE6A 4DO2A 1XMOH 1YZBA 2EIKB 2Q0AA 5BMVA 2ITCC 1ORQC 4DV1B 4QW9A 4GKKO 2J9GA 5JVLA 1AI6A 1YTFD 5IJ9B 2R87A 3BA8A 4FFNA 3LUTB 2XAGA 4A3CG 3QZ8A 1Q82W 3PFFA 3MAQA 1WJZA 4ZI7F 4NXNO 4ZHQF 3MFIA 4ECQA 4I4TA 4U7CA 4EKWA 3RAQA 4TM5A 2VUMA 2Y4TA 3RV3A 2H8PC 5IP9G 3CC4V 3ZCCA 3BFRA 4WBNF 4PDMA 5BXZA 1JCHA 4FK5C 2ZR2A 4A3GG 5KG1A 2FPIB 2JGUA 3N6XA 2PF4E 2ZKOA 1THZA 3BPZA 3R5HA 3WWJA 1SERA 4Q45A 2LP7A 2P67A 3MWEA 3Q2OA 2WAMA 2OCCB 2VOBA 4ECXA 1BGWA 4I0XA 3N6RA 3OT7A 2V58A 1QCEA 4J10A 1Q7YW 2DABA 1FJGH 3VPDA 2PI5A 2KKWA 3KAKA 2E75B 1M0TA 2ZIMA 2WA4A 3RYCA 3SDLA 4JI3B 4EFEA 1GM9A 2AHZA 1N48A 3DSQA 3DGEA 3FYEB 4WFHA 3GTOA 1P7GA 5CA1F 2QF7A 3HKDA 5J2UF 4TQDA 3QNEA 2JA7A 4CS4A 5LL6Y 4HAMA 2ZCEA 4UUGA 2HHHB 4MV6A 4EBEA 2R7ZG 2ATKC 1UPGA 3BQ0A 1VQLV 1DF4A 1GTOA 5KFYA 5TISZ 1JX9A 4FFBB 5JJEB 1MZEA 4TSFG 5KFUA 5BYAA 4DR6H 1URFA 2YEVB 2E5LH 3D3QA 5EIBD 4DR7O 4AYBE 1TWHA 2CK3G 2EBOA 3VQXA 1CXZB 2JS3A 4YHHH 4DV6O 2WLJA 1S68A 4NTYA 1GO3F 1FYJA 2VWJA 4NZMA 1N32O 2ITDC 1EN4A 2AGPA 1OZ0A 1PNMA 4JI8O 4O7ZA 1GN2A 1K1SA 2X0LA 4DUYO
chains in the Genus database with same CATH topology
3JAWB 1HW7A 5ITZB 5IYZA 3S24A 4DV7B 4MTEA 3RR5A 1YEWA 5GONA 3K5OA 5BR8B 1KU9A 3JASA 3JARA 4O2AB 1P8LA 2UXCB 1IBMB 4LNUA 4PHZA 2VQFH 3J7AK 1SKVA 4FM2A 3LMLA 3KAJA 3T1HH 1M0WA 1XDNA 4TV9B 4LF5B 2RJZA 3J80W 4B3TB 5KMGA 3RFRA 2JS5A 4UCOA 2HIVA 5LP6B 3RJ0A 4DV5H 4B3RB 3N42B 1JMKC 3SJBC 2HIXA 3WB0A 4DV3H 3IAYA 1MZBA 2BTOA 1WPBA 3JSNA 5D1OA 4TQFA 3WB1A 2O03A 3IG0A 3BRCA 1X4TA 5KHKA 4O4LA 4O2BB 3HKCA 4B08A 4OX9H 2EX3A 4JI0B 3SGIA 1XNRH 4B3RH 3CVZA 4IAJA 4I7HA 5KX5A 2UU9B 4WBNB 2HVSA 2WDTA 4B3TH 3RGXA 4YJ2B 4JI0H 4OX9B 2YI9A 1CKMA 4GKKB 2VQFB 3N41B 4O2AA 5K1PA 1SA0B 3MWMA 5LXTB 4DV3B 1HR0H 5JQGB 1TVKA 5GONB 3EYYA 2XIGA 4I55B 4U3JA 4DUYB 5CB4B 4FM0A 4DR5H 4JI8B 3RWRD 2UXBB 1TUBB 3UT5B 4CS3A 4X1YA 2PYLA 2MCTA 4LH6A 1Q8IA 4BW9A 4TV9A 4DV0H 4ZI7B 4EQ5A 4KHPH 4ZHQB 5D1PA 4LFBH 1T5EA 2UXCH 3U0ZA 2CW8A 1Z5VA 4Q0YA 1I94B 3JASB 1VS0A 1Q5OA 4ZOLB 2OYQA 5LL6b 4O4HB 5CA0A 3GJXB 1M93A 4Q6GA 4HNAB 4JI7H 2UUAB 4DK1A 5ITZA 4RB1A 4X65B 2F95B 2PUSA 3K57A 4FLTA 3VNNA 1FFXB 2UUBH 4KL1A 1O9HA 3WB2A 5FD6A 4FFBA 5LMNH 2R72A 3BHPA 5EYPA 1N33B 3PN1A 3VQWA 1N36H 3E22B 2UUCH 4O4IA 1IBKB 2W57A 3CHXA 4YHHB 3M7MX 1HNWB 4GKJH 5CA1A 4MV9A 1TUBA 3UT5A 1IBLB 2E5LB 4DUZH 4TUYA 3GB8B 4X1IB 1DGSA 4DR6B 3RYHB 4DRFA 4JI3H 3JAMW 5EIBC 3HKBA 4DV6B 4B3SH 1FJGB 1E4GT 4UCSA 4JI4B 4RZQA 4JI5B 3K59A 4I50B 3BA9A 3N40P 1M4UA 4LFAB 5LMUB 3T1YH 4UCTA 5LYJA 2YIAA 2OWOA 3N2KA 4DR3H 3NC0B 5IT9W 4X64H 4D7SA 4JI1H 4RB0A 4LFCH 4DR2H 2Q7GA 5D5QA 5JJJB 1XMQB 3QTCA 1SQFA 4NXMH 4LF9B 4J0MA 5D1OB 1L2ZA 4K0KH 5KHHA 3A2FA 4DR4B 2ZNJA 2VUGA 5JJNB 3JALA 4PZ8A 4LF8B 5LP6A 4DV2H 2F93B 1O9GA 3U10A 2QJ1A 3VQYA 1M5IA 4TUYB 2ZINA 4MTDA 3L4JA 5DISC 4NXMB 4PI0A 3HKEA 4LF7B 2VPSA 5EYPB 3E22A 4DV2B 2RQ6A 3T1YB 1I6UA 5IWAB 1O75A 3RYFA 5JVDB 1VF7A 3BABA 1G6UA 5IJ0A 1S5JA 2KSWA 4X66H 2Q7EA 3RYFB 2R9AA 4BWSC 3ZS8C 5LP6C 5JCOA 5J2TB 4I9QA 1TGOA 4NXNB 5LMUH 4LF6H 2UXDH 4ZHQA 3B2EE 4GYCB 2YIBA 2R70A 4UCRA 3DF7A 1GYFA 3THOA 1XK5A 4DV6H 4U3JB 5LMNB 2P5OA 3M4IA 1NT2B 5JH7B 4CC6A 5CB4A 4X1KB 4DUZB 5JQGA 3RYIB 4GKJB 4JI7B 1HNWH 5LXTA 4LH7A 4PZ6A 2ZM6B 4YJ3A 5LA6A 2GV9A 5A2QW 3N2KB 2HVRA 2F4VB 5LOVA 3RGBA 2UUCB 4TV8A 4IHJA 1FVIA 3W5OA 5EZYB 1N33H 5KX5B 3RGZA 2E3CA 4BWAA 4RB2C 4FVMA 4E6NA 3HKCB 5J2UB 5FNVA 1JJOA 4X65H 3L4KA 1JFFA 4TOIA 2UUAH 1CKOA 1N32H 2UXBH 3RYHA 4DR1B 3NBZB 5JH7A 1SQGA 4X20A 4LF4H 4JV5H 4JYAB 3HKBB 4DV4H 4EB6B 5JCOC 1I94H 1HR0B 2JVDA 3W1BA 3CB2A 4MV7A 4F6RA 1WNSA 5KMGB 5KHIA 4GKKH 1TA8A 4AQYH 1P49A 2VWKA 3QF7A 1XQ8A 2Q2TA 3JATB 3HXLA 2RGRA 1XHZA 1BJTA 1J5EH 3OTFA 4O4IB 2VQEB 4JI8H 3CSXA 4DR5B 3JARB 2RGVA 1XNRB 4DUYH 4M7EA 1XI1A 1XNQH 4O4JB 1SEIA 4PDBA 2F66C 4HNAA 5IYZB 2QM4A 3J81W 1XNQB 4ZOLA 1ZHQA 3JAKA 2VQEH 2UU9H 1I7FA 3N2GB 4DRXA 2PY5A 4FLVA 1CKNB 3K5MA 4FM1A 3JAKB 4HBNA 2PZSA 1WH2A 2P22C 3HKEB 3T1HB 4AQYB 4ZI7A 1IBMH 4F6RB 4FM9A 5BR8H 5FLXW 3QG5A 1Z5WA 3K58A 3KYHC 4X20B 4O4JA 4DV4B 4JV5B 3W1GA 4JYAH 4DV5B 5EOYA 4DV7H 5FPOA 4I55A 1SA0A 4DR1H 4FLXA 1TVKB 4UCVA 5J2UA 4ZIBA 4FLWA 1J5EB 2HVQA 4LF5H 3ICXA 3TY9A 1N34H 1E4FT 3HKDB 4IHJB 5C8YB 4PI2A 5LOVB 3FFQA 3K5NA 3TY8A 5LYJB 4O4LB 2ZNIA 3RYCB 4YJ3B 4EB6A 4LF4B 2PYJA 4EEQA 2ZM6H 1N32B 1JFFB 4X1KA 3C0FB 4K8ZA 1HNXH 4DR7H 4K8XA 4X1IA 2WYOA 2F1MA 2BTQA 3JSLA 3RIZA 5EZYA 4JI6H 4UFZA 4TV8B 4RB3C 5CA1B 2F4VH 2PGGA 4YY3B 4CH6A 4LNUB 5LA6B 5K1XA 4L8JA 4FLZA 4UCUA 1V9PA 4AILC 1TAEA 1HNZB 2Q7HA 1WN7A 3SJAC 3L2PA 1XHXA 3VQVA 4AHCA 1ZHSA 4FLYA 4I4TB 4X66B 3KALA 4A2BA 4LR3A 2ZIOA 4LSXA 4FLUA 3F8NA 3ETQA 4X62H 4PZ7A 1P16A 4R7RA 5JVDA 3JAWA 1Q3EA 2HHHH 3TY5A 2CAZC 1A0IA 3FMAA 2UXDB 5IWAH 2WE6A 2FE3A 4LF6B 2HEPA 1XMOH 4NXNH 1L8DA 4B3MB 5FD5A 2Q0AA 5BMVA 1CKNA 2YIBD 4DV1B 1KMIZ 5J2TA 5IJ9B 3K5LA 4CS2A 3BA8A 4IIJA 5BMVB 5KHJA 3MAQA 4JI2B 1AN7A 4X1YB 1Z2PX 4I4TA 1FKAH 5FPRA 1QHTA 3H20A 4NVPA 4A2AA 3GDEA 2YI8A 3ZEDA 4D7TA 1H2SB 4JI2H 3OTOB 2ZJTA 4LSAA 2HGSA 4LF7H 3JATA 4LF9H 3QWUA 4RAYA 4LMYA 2JGUA 1XMQH 4LFCB 4YJ2A 3N6XA 3OTOH 3N43B 1B04A 4WBNA 3BPZA 4DR3B 3K3VA 4B3MH 4RAZA 4LF8H 1S03G 2BTQB 1QQCA 1X9NA 4O2BA 2VOBA 3JALB 1BGWA 4DR4H 4JI5H 4CH3A 5FNVB 4K0KB 1FJGH 2KKWA 1ZAUA 2Q2UA 3KAKA 1M0TA 2ZIMA 3RYCA 4DK0A 4EFBA 4JI3B 2PTMA 2V4DA 4EFEA 4DR2B 3DSQA 1SYXB 3KXYT 1D5AA 4JI1B 4X64B 4CH5A 1IBLH 4DV1H 3HKDA 2YCHA 1RSOA 4TQDA 4ETSA 5C8YA 1XMOB 4CH4A 4CS4A 4LFAH 2ZCEA 4I50A 2HHHB 3SR2C 1Z2OX 3RYIA 4YY3H 1IBKH 4JI4H 4X62B 1N36B 4B3SB 4FFBB 4DR7B 5JJEB 1HNXB 1Q43A 4DR6H 2UUBB 2E5LH 5EIBD 3LNNA 5KHGA 3RTXA 3VQXA 4IIJB 2CW7A 1HNZH 4O4HA 5CA0B 5IJ9A 3NBYB 4YHHH 3BAAA 3RF2A 2YXLA 1S68A 2VWJA 4JI6B 4APMA 3SJCC 1Z2NX 3N44B 4CC5A 3UQ8A 2XHBA 2CFMA 3N2GA 4DRXB 4GLXA 4LFBB 1N34B 4KHPB 4DV0B 3U11A 1FFXA 2IM9A 5D5PA 5IJ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOI A;  4X66 B;  1CKO A;  4DV6 B;  3NBZ B;  4DR1 B;  3S24 A;  4DV7 B;  1FJG B;  3RR5 A;  4PZ7 A;  1P16 A;  4UCS A;  4JI4 B;  4JYA B;  4JI5 B;  3TY5 A;  1A0I A;  2UXD B;  5BR8 B;  1HR0 B;  3W1B A;  3BA9 A;  4LF6 B;  4LFA B;  5LMU B;  1P8L A;  2UXC B;  1IBM B;  4UCT A;  4B3M B;  1TA8 A;  1CKN A;  2OWO A;  2Q2T A;  4DV1 B;  3NC0 B;  1XDN A;  4LF5 B;  4B3T B;  1XMQ B;  3BA8 A;  4LF9 B;  2VQE B;  4UCO A;  2HIV A;  4DR5 B;  4JI2 B;  5D1O B;  1XNR B;  4B3R B;  4DR4 B;  2HIX A;  2VUG A;  3JSN A;  5FPR A;  4LF8 B;  4PZ8 A;  5D1O A;  1XNQ B;  3GDE A;  4JI0 B;  3SGI A;  3OTO B;  5DIS C;  3QWU A;  4NXM B;  1CKN B;  2UU9 B;  4LFC B;  2HVS A;  4LF7 B;  1B04 A;  3T1H B;  4OX9 B;  4DR3 B;  4AQY B;  1CKM A;  4GKK B;  2VQF B;  4DV2 B;  3T1Y B;  1X9N A;  4DV3 B;  5IWA B;  3KYH C;  4DV4 B;  3BAB A;  3W1G A;  4JV5 B;  4DUY B;  4DV5 B;  4K0K B;  5FPO A;  4JI8 B;  2UXB B;  1ZAU A;  2Q2U A;  4UCV A;  4JI3 B;  4EFE A;  4EFB A;  4DR2 B;  1J5E B;  4LH6 A;  4JI1 B;  2HVQ A;  4X64 B;  3TY9 A;  4EQ5 A;  5D1P A;  4NXN B;  1XMO B;  3TY8 A;  1I94 B;  1VS0 A;  2HHH B;  4UCR A;  4LF4 B;  4EEQ A;  4X62 B;  1N36 B;  4B3S B;  3GJX B;  1XK5 A;  1N32 B;  2UUA B;  5LMN B;  4DR7 B;  1HNX B;  4X65 B;  2UUB B;  3VNN A;  4CC6 A;  4DUZ B;  3RTX A;  4GKJ B;  4JI7 B;  3JSL A;  3PN1 A;  1N33 B;  4LH7 A;  4PZ6 A;  3NBY B;  2ZM6 B;  3BAA A;  4UFZ A;  1S68 A;  1IBK B;  4YY3 B;  2HVR A;  2F4V B;  4JI6 B;  2UUC B;  4YHH B;  4UCU A;  1V9P A;  4CC5 A;  3UQ8 A;  1FVI A;  3W5O A;  2CFM A;  1TAE A;  1HNZ B;  1HNW B;  4GLX A;  4LFB B;  1N34 B;  4KHP B;  3L2P A;  4DV0 B;  1IBL B;  2E5L B;  4E6N A;  3GB8 B;  1DGS A;  4DR6 B;  4DRF A; 
#chains in the Genus database with same CATH topology
 2EJ2 A;  4HNV A;  3JAW B;  5LXT F;  2QEX V;  1ZET A;  5LP6 F;  1WB8 A;  2YEV A;  4MTE A;  4FIP C;  4UB8 Z;  3FB8 C;  4RUA A;  4EYH B;  3APQ A;  5K2M A;  4BXX G;  2EIN C;  5KG0 A;  2UXC B;  4PHZ A;  2DN9 A;  2SCU B;  4FM2 A;  4ZBM A;  3H4D A;  3T1H H;  3J80 W;  4JF3 A;  5KX5 F;  4JV5 O;  4JTC B;  1GAX A;  3OMN B;  5KMG A;  3ETH A;  2B9Z A;  1NR1 A;  2A79 B;  4UCO A;  2HIV A;  5LP6 B;  5CBG A;  3OR6 C;  5E79 Z;  3RJ0 A;  3N42 B;  1L0N H;  3CJH B;  3H0G G;  3T4Z A;  4DV2 O;  4DV3 H;  1MZB A;  2IA6 A;  2MK3 A;  2HG5 C;  3M99 B;  3WB1 A;  4TQF A;  2QWN B;  3ABT A;  3VA7 A;  1UC9 A;  1R6T A;  5KFO A;  3L74 H;  1KC7 A;  1S97 A;  1V54 B;  2DWC A;  1WSC A;  3CVZ A;  4IRC A;  2P6J A;  5B66 Z;  4JI2 O;  1PKX A;  4JUZ A;  2UU9 B;  4WBN B;  1FXH A;  4DV3 O;  2C35 B;  2HVS A;  2QWQ B;  4EEY A;  3JD2 A;  3GIM A;  2ARH A;  5H9C A;  4O2A A;  2A7W A;  2P06 A;  4DR3 O;  2PN1 A;  3IN5 A;  4FZ0 A;  1OCC B;  1K9M W;  5GON B;  2YRW A;  3EYY A;  5KFJ A;  3TGU H;  2XIG A;  4U3J A;  5BMV F;  3U0G A;  4FM0 A;  2K9P A;  1GO3 E;  2QKC A;  4O2B F;  2FJZ A;  3UT5 B;  2NN4 A;  4CS3 A;  1SRY A;  4GCZ A;  1ARO P;  1WA8 A;  4RO2 A;  1Y74 A;  1NJI W;  2J6U A;  2IU0 A;  3WWH A;  4ZHQ B;  4WFG A;  2NU7 B;  1UC8 A;  2Q9L A;  1T5E A;  1Q6H A;  2CQY A;  3I5D A;  2CW8 A;  2GUZ B;  5B1A B;  3B09 A;  1VQ7 V;  5HFM A;  1I94 B;  3FB5 C;  3JAS B;  1Q5O A;  4ZOL B;  1I3Q A;  3WWI A;  3I4M G;  2QK4 A;  1XUQ A;  2CTR A;  5CA0 A;  3T5L A;  3GTK A;  3GJX B;  4CE5 A;  4Q6G A;  4MVM A;  4DK1 A;  4IRD A;  1QR8 A;  4IYI A;  2ZR3 A;  1BE3 H;  3K5H A;  3G6Y A;  1QNM A;  1T94 A;  5EZY F;  2WA3 A;  3UO3 A;  4KL1 A;  1O9H A;  1I1L A;  1TUE B;  5LMN H;  2JA5 G;  1I1M A;  1Y76 B;  3BHP A;  1N33 B;  4C5A A;  3LP8 A;  2DYR B;  2UUC H;  4DV0 O;  2O57 A;  2QM7 A;  4O4I A;  1KBH A;  4MVQ A;  3JAM N;  4WHX A;  1WRV A;  4K3A A;  1VAJ A;  2HJW A;  1FXV A;  5CA1 A;  4ECU A;  4TUY A;  3ZRX A;  1VQ5 V;  2FMA A;  1OBD A;  2XGQ A;  3HKB A;  5HBR B;  1Y4M A;  4K6N A;  1I7N A;  4O7L A;  4YY3 O;  1FJG B;  1E4G T;  3W7T A;  4JI5 B;  5DM6 V;  2CNQ A;  2EIL C;  2UXN A;  3C90 A;  4I50 B;  5EC1 C;  3T1Y H;  1PPJ H;  4LFA B;  5LMU B;  2WLL B;  4XDL A;  5I5V A;  3V4S A;  3BAC A;  2YIA A;  2OWO A;  2Y4R A;  4DR3 H;  3WFV A;  1F4N A;  4JI1 H;  4LFC H;  4DR2 H;  3QTC A;  1GMG A;  1WB7 A;  1SQF A;  2NU9 B;  3IJ4 A;  1MSD A;  2YZN A;  2XUM A;  5GTH Z;  3CME V;  4K0K H;  5KHH A;  2XT9 A;  4P9O A;  4YAJ B;  1IYD A;  5KUK A;  4LF5 O;  4DR4 B;  2ZNJ A;  4FFM A;  2VUG A;  3RBD A;  3U9T A;  1OCR C;  3HOU G;  2BSK A;  1NH2 D;  2QWO B;  4L87 A;  2C22 A;  4FE2 A;  1AI5 A;  4QNH B;  3VQY A;  4J9Z B;  4TUY B;  2ZIN A;  3T2M A;  2UU9 O;  1W0J G;  3CCQ V;  4EGQ A;  3L4J A;  5DIS C;  2FKL A;  4YR3 A;  2R9I A;  5C3E G;  1MAB G;  2UXD O;  1S72 V;  3CSW A;  4O7V A;  3UFX B;  1KP2 A;  3E22 A;  4PWQ A;  4DV2 B;  2RQ6 A;  2FK2 A;  2FLL A;  1Q6U A;  1O75 A;  5JVD B;  2HFE C;  1K73 W;  2PMZ A;  4OPA A;  1QLN A;  1ZLZ A;  2Z3Y A;  3RYF B;  1GN3 A;  2R9A A;  3QO5 A;  1E1R G;  3ZS8 C;  4DR1 O;  3JRX A;  4FZ1 A;  5LP6 C;  4DL5 A;  3MR2 A;  5J2T B;  4TVI A;  2QWR B;  2IMW P;  1FD9 A;  3ABL C;  1QVF U;  1FXK C;  1IXM A;  2W6J G;  1Y14 B;  4ZHQ A;  5C1O A;  1GYF A;  3THO A;  1NI8 A;  4QE9 A;  3MJF A;  4AI8 A;  2B63 A;  4UVB A;  3CD6 V;  3GTG A;  2EZO A;  3APO A;  3JRW A;  3TQT A;  4X64 O;  1NS1 A;  1EZV H;  3PR4 A;  3IC7 A;  4GKJ B;  1Q6I A;  3A0B Z;  3F5T A;  1BQ0 A;  1JOY A;  4GC7 A;  2ZM6 B;  2QE7 G;  1VQ8 V;  3FKI G;  2GV9 A;  1M7J A;  5LOV A;  1SQB H;  3BVO A;  2XD4 A;  3W5O A;  3G4S V;  5F9L A;  3ETD A;  1MZF A;  3AK1 A;  2NLJ C;  2WLL A;  5LGT A;  3ZMS A;  5E1A C;  3PO2 G;  5J2U B;  1JFF A;  2UUA H;  1CKO A;  1VMG A;  5DLG A;  2UXB H;  4DR1 B;  4BY1 G;  2DAA A;  5IT9 N;  1GSH A;  2YID A;  2B1G A;  4LF4 H;  3OSP A;  2XTA A;  3HKB B;  4JYA B;  5KFD A;  2OCC C;  4F6R A;  1WNS A;  2JK5 C;  3J7A U;  3QF7 A;  3Q8Q B;  4QIW E;  2Q2T A;  2RGR A;  2WWW A;  1J5E H;  4IL6 Z;  1Y76 A;  3OTF A;  4O4I B;  3SYO A;  1AVM A;  3CSX A;  1N56 A;  3X2Q B;  2RGV A;  2B1I A;  1BSM A;  4XBF A;  5KLV H;  2Z5U A;  4O4J B;  3LDC A;  1IBL O;  1KJJ A;  4QIW F;  1SEI A;  1K92 A;  4J9P A;  3J80 N;  4OGQ B;  5IYZ B;  1QVG U;  3GII A;  3H3V H;  3GB7 C;  4ZOL A;  1I94 O;  1OJH A;  2NR5 A;  2GUZ A;  3AYH B;  4DL6 A;  3MWD A;  1PD3 A;  4DRX A;  1CKN B;  3AW8 A;  1WH2 A;  2AU0 A;  3O9O A;  3N8D A;  2WLN A;  3HB9 A;  4JAS A;  2EIL B;  4AQY B;  3Q1K A;  2XCP A;  5KT7 A;  4F6R B;  1V55 C;  2Q0O C;  2R7K A;  3P30 A;  1VQP V;  4KP4 A;  3QG5 A;  3MD0 A;  4O7W A;  3KYH C;  4JI1 O;  4O4J A;  5C44 G;  4FS1 A;  3FB6 C;  2ZDG A;  4DV7 H;  3HOX G;  4I55 A;  4C7U A;  4D6T H;  1S0M A;  1TVK B;  4UCV A;  1V51 A;  4FLW A;  1GN6 A;  4LF5 H;  1H2L A;  1CQJ B;  4JI7 O;  4R8U B;  2E2H A;  1N34 H;  2JA6 A;  1JDE A;  5BYB A;  2UVU A;  5IYC G;  4A3F G;  4HR7 A;  4X88 A;  1IBK O;  4F4W A;  1VF6 A;  4TT3 G;  2Y69 C;  1NTM H;  2ASD A;  5IP7 G;  4LF4 B;  1W2B U;  4P9P A;  4JI3 O;  4JI6 O;  4KHP O;  2W6O A;  3K08 A;  4NB5 A;  4J9L A;  5DN6 G;  5CA0 F;  4WF9 V;  3C0F B;  1YJN V;  1M57 C;  4K8Z A;  3OHB A;  4DQN A;  2QWP B;  2OIE A;  2R82 A;  4DR7 H;  4X1I A;  5H6R A;  1VQN V;  1SFO A;  5H80 A;  1NKD A;  3KCY A;  4UFZ A;  1KJ9 A;  2JEU A;  3K9A A;  4UCU A;  4YR0 A;  2P4K A;  5DGB A;  4X62 O;  1HNZ B;  3SYP A;  1VBG A;  5B1A C;  1YDX A;  2PMZ E;  3SJA C;  4A3J G;  1BZK A;  1I7L A;  2CUG A;  1IXB A;  4O3P A;  4F4X A;  3E83 A;  3CC7 V;  1BNC A;  4JTD B;  4LSX A;  2JEF A;  1RM1 C;  4PZ7 A;  3EPG A;  1BCC H;  2ODT X;  3CRQ A;  2GLT A;  3TY5 A;  2CAZ C;  4ED1 A;  5IWA H;  2W9C B;  5L1L A;  2IH1 C;  5DG8 A;  1L8D A;  4B3M B;  5FD5 A;  2W0F C;  1RK5 A;  2YIB D;  4MV8 A;  1KMI Z;  2B63 G;  4IIJ A;  5BMV B;  4MTO A;  5EBM C;  3DTF A;  1OCZ B;  4X9Q A;  4JI2 B;  2BQR A;  1WA8 B;  3E35 A;  2Q8V A;  3WU2 Z;  4LF9 O;  4X1Y B;  2GQS A;  3JZI A;  4LFB O;  1FKA H;  3GTL A;  2QM8 A;  2C2A A;  2IU3 A;  4X66 O;  4U7O A;  1K8A W;  2WSS G;  1QHT A;  2YRX A;  3EHB B;  3K0G A;  5KFH A;  4NVP A;  1PNK A;  3GDE A;  4ZQI A;  3ZED A;  1JPX A;  4F50 A;  3OTO B;  1H2M A;  3OR7 C;  2HGS A;  5EDW A;  3T5K A;  2CE4 A;  2LQT A;  5CN0 A;  2D3O W;  3QWU A;  4LMY A;  5KT5 A;  3NR7 A;  1EZJ A;  4P30 A;  2WLH A;  3K3V A;  2WB1 A;  4B3M H;  5B3S B;  4DIM A;  4RAZ A;  4LF8 H;  1K97 A;  3K04 A;  1X9N A;  3JAL B;  4JYB A;  3CCR V;  3CCM V;  4DR5 O;  1RK6 A;  5L1J A;  4H37 A;  4K0K B;  2W6M A;  2Q2U A;  4I0X B;  1WP7 A;  2X6C A;  1SYX B;  5H5N A;  4CH5 A;  4RZR A;  1IBL H;  2OH2 A;  2R7L A;  2WLI A;  3PW0 A;  4MS2 A;  1R3K C;  1RSO A;  3BY6 A;  3GIP A;  5C8Y A;  2EJ3 A;  4R8U A;  5KFA A;  4LFA H;  5KKN B;  3UZO A;  3ZHU A;  2R93 G;  4NZO A;  1B33 N;  1VIB A;  1Z2O X;  1KJI A;  2NU8 B;  3WO0 A;  5B1B C;  5KFF A;  4N23 A;  4X62 B;  4B3S B;  2EIJ C;  3JCU Z;  1HNX B;  1VP7 A;  5LOV F;  2XAQ A;  3RTX A;  5LYJ F;  2W7O A;  3CEB A;  4GX1 A;  1PV0 A;  2CW7 A;  2N74 A;  3SYA A;  2F4V O;  1HNZ H;  5IJ9 A;  3BAA A;  4I4T F;  5BY1 A;  2YXL A;  4FFL A;  4DV7 O;  3HKZ A;  4JI6 B;  3SJC C;  3UQ8 A;  1YSC A;  4BR6 A;  3H40 A;  3D3I A;  3N2G A;  4R7C A;  5KT6 A;  4LFB B;  1N34 B;  3G6X A;  3L73 H;  1VQK V;  3OSN A;  1RFY A;  5LA6 F;  5D5P A;  1GSO A;  5HV6 A;  1VEW A;  1Y66 A;  1HW7 A;  2R85 A;  2B5U A;  4HN2 A;  1BQZ A;  2ZDH A;  4F4L A;  4DV7 B;  3RR5 A;  2YL2 A;  4QWB A;  5GON A;  3K5O A;  3AG4 C;  4RUF A;  1I0H A;  4OX9 O;  3JAS A;  3JAR A;  2X6B A;  2ZD9 A;  2VQE O;  1K3E A;  2DE0 X;  2LO1 A;  2UVR A;  3RB0 A;  3LML A;  2Z02 A;  5C5J A;  5KG3 A;  1M0W A;  2RJZ A;  2HR3 A;  1HNX O;  4B3T B;  2UVW A;  1ULZ A;  2YW2 A;  3QO7 A;  2JS5 A;  2HG8 A;  2X6A A;  4DV5 H;  4B3R B;  1JMK C;  4FJC C;  3NGD A;  4HYO A;  4XYM B;  2BTO A;  5C1P A;  4QE7 A;  1AR5 A;  2RMK B;  1NVP B;  3AG1 C;  1AJQ A;  3BRC A;  4O4L A;  3E89 A;  1N4C A;  1AB3 A;  2ILM A;  5GON F;  3SGI A;  4R50 A;  3T1C A;  4QWE A;  3PO3 G;  3K3W A;  1FFT B;  4I7H A;  5KX5 A;  2P0A A;  2WDT A;  3OHA A;  5KFG A;  1RJP A;  4OX9 B;  2Y69 B;  3QZ7 A;  5KT4 A;  4Q8E A;  1CQI B;  1C30 A;  3ZMT A;  4GKK B;  3EXA A;  3N41 B;  3A8T A;  5KG4 A;  2GHY A;  1SA0 B;  1HNW O;  5LXT B;  4DV3 B;  2ZDI A;  5J2T F;  4ED6 A;  5JQG B;  1TVK A;  2YIC A;  1KKC A;  1VQ4 V;  4I55 B;  4J9Q A;  1B06 A;  2UXB B;  4X1Y A;  3WO1 A;  3V6H A;  3E8H A;  4IYH A;  4P2Z A;  2ASJ A;  4TV9 A;  4BY7 G;  4KHP H;  2BCC H;  4LFB H;  1FPO A;  1MMM A;  2YDE A;  2UXC H;  1SCU B;  3MR5 A;  1Z5V A;  3DXR B;  3BQ1 A;  1AUV A;  1K5S A;  2OYQ A;  4LF7 O;  2AGA A;  4GC6 A;  5GTI Z;  1R73 A;  5BR8 O;  3I4N G;  5ITZ A;  2E5L O;  2UXC O;  3K57 A;  2PUS A;  2CH7 A;  3SNO A;  1BXR A;  2ZE5 A;  1GN4 A;  3AG2 C;  5IWA O;  5F9N A;  3RBE A;  3VQW A;  3L75 H;  4WFE A;  3E22 B;  3X2Q C;  3VPC A;  2WPD G;  1A32 A;  4H0L B;  1DK1 A;  3LWB A;  4BBR G;  2W57 A;  1QU7 A;  4YHH B;  1ENV A;  3L71 H;  2R7N A;  4FFO A;  1W93 A;  2BQU A;  3ABK C;  1VQ9 V;  1A3G A;  4GKJ H;  2WLI B;  3I55 V;  4ABM A;  3ZRS A;  5CB4 F;  5LGU A;  2EUL A;  1TUB A;  3F5W C;  1IBL B;  3GB8 B;  5KUM A;  2R6F A;  1DGS A;  4DRF A;  2R9R B;  3CCE V;  1UNN C;  4A3B G;  2DW4 A;  2QKS A;  4BW5 A;  4DV6 B;  1Y6X A;  1I2K A;  4Q20 A;  2Y4U A;  4W4K A;  4JI4 B;  3U9S A;  1KKD A;  5JH7 F;  3BA9 A;  2Y0S A;  3N40 P;  3G8D A;  1DLB A;  1AI4 A;  1BS3 A;  3T1H O;  3H1K H;  5L3F A;  3OTO O;  2CNU A;  2DMX A;  2QSA A;  4D7S A;  2Q7G A;  5D5Q A;  5JJJ B;  3GIL A;  2ZT9 B;  2X0S A;  4J0M A;  5D1O B;  4QGP A;  1YTF B;  5KFC A;  1NZ6 A;  1KEE A;  2GTA A;  4EYI B;  5JJN B;  3B77 A;  2VQD A;  1B6Q A;  2HJD A;  1O9G A;  1XNR O;  3U10 A;  3OW2 U;  3UYY A;  3RB3 A;  1TWC A;  1R9T A;  1SF9 A;  2ZXW B;  2H3O A;  4QWC A;  3E5N A;  1IYE A;  1M57 B;  3D36 C;  4RQF A;  1QR9 A;  1RPO A;  1PP9 H;  2JEI A;  1Q86 W;  3Q4H B;  1TWF A;  4R8C A;  3CCL V;  4ECT A;  1VF7 A;  3BAB A;  5HNE A;  3GWO A;  3LSU A;  1H8E G;  3GLK A;  1S5J A;  1KYO F;  4LC1 A;  2ZGI A;  5KFZ A;  4X89 A;  2M05 A;  1HNZ O;  3AX6 A;  2YUA A;  1Y1V A;  3DAA A;  2J6T A;  5I5U A;  3VBB A;  3VMM A;  1K34 A;  4B7E A;  3RT3 C;  1JIH A;  4NXN B;  2QTO A;  3PR5 B;  2ZE8 A;  3U54 A;  1KBL A;  1AIL A;  3B2E E;  2YIB A;  3SPI A;  4RUC A;  2Q7D A;  2YXH A;  1GH6 A;  1XL6 A;  1H2G A;  2W6P A;  1ZQ7 A;  3M4I A;  4CMF A;  1LUW A;  1ZSP A;  5KG2 A;  5IYD G;  5CB4 A;  3H9V A;  4X1K B;  1S9F A;  1N33 O;  3ZHT A;  4LF4 O;  2CGN A;  5IY5 C;  4ED2 A;  5IYZ F;  5JQG A;  5C8Y F;  4A3I G;  1HNW H;  5LXT A;  2EIN B;  3KHL A;  4YJ3 A;  4GT1 A;  1EKP A;  3N2K B;  3WG7 C;  3RB4 A;  3CMA V;  2HVR A;  3QVN A;  3QFF A;  4IHJ A;  3OMA B;  2Y48 A;  5EZY B;  1EHI A;  5KX5 B;  3RGZ A;  1HP8 A;  4RNO A;  4RNN A;  3R9R A;  5KFM A;  3R5X A;  3BCC H;  4QWD A;  4RQE A;  4RB2 C;  1KB9 F;  5FNV A;  2HHF B;  5EC2 C;  1AJP A;  4FPP A;  3W7W A;  3L4K A;  4QJF B;  1XL4 A;  3RYH A;  5L1I A;  4MTF A;  2HGX A;  1G4Y B;  2ZM6 O;  3FB7 C;  4FFP A;  5JCO C;  3LSQ A;  1XOU A;  2ETN A;  5DQG A;  2FKX A;  1MG1 A;  5KMG B;  2DOS A;  5BPF A;  1TA8 A;  2DPJ A;  2VWK A;  2AZ2 A;  5KG5 A;  4TUY F;  2DYS C;  3HXL A;  4ASU G;  1XHZ A;  1BJT A;  2BOB C;  1Y1W G;  1IBM O;  5JQG F;  4JI8 H;  2FP4 B;  3JAR B;  4CKC A;  1XNR B;  1XI1 A;  4MAM A;  5FR9 A;  4IR9 A;  2R93 A;  1AJN A;  3JYC A;  1XDC A;  2Q4P A;  1KTA A;  1G1X B;  4FFR A;  4UUJ C;  1S5L Z;  5KFK A;  4NLG A;  1FKA O;  2ODM A;  3J81 W;  3OAA G;  3VPB A;  3RW0 A;  4O3N A;  4MVZ A;  4CMD A;  4FLV A;  1AUX A;  1ET0 A;  3ZMV A;  2D2C B;  4HBN A;  3HO8 A;  1LNQ A;  4RAI A;  4Z1M G;  5BZB A;  1YIJ V;  3T1H B;  1KJQ A;  1COW G;  1I1K A;  1I5X A;  4XX0 B;  3HT5 A;  5FLX W;  2WTF A;  1GKF A;  2VUM G;  5DEC A;  4A3D G;  4X20 B;  2DLN A;  3W1G A;  3G6V A;  3HOY G;  4ECR A;  1MSW D;  2UXX A;  2WAQ E;  1YI2 V;  3UKM A;  3VOU A;  2XAH A;  5DAA A;  2NNU A;  2HVQ A;  3DC6 A;  3ICX A;  1R3I C;  2JGD A;  3TIN A;  1S0V A;  5DG7 A;  2IP4 A;  1E4F T;  4YAK B;  3PW5 A;  1SZX A;  3ABK B;  3STZ C;  3BQ2 A;  4FBT A;  3FFQ A;  3ZN0 A;  5LYJ B;  4O3O A;  3F7Y C;  4EBD A;  1RYR A;  5L3E A;  4EB6 A;  2PYJ A;  2L6L A;  1S0N A;  5CBH A;  4BIZ A;  1EM1 A;  1N32 B;  4O7Y A;  4O4H F;  2ZXW C;  2Q5Z A;  4A3K G;  1ZUQ A;  1B6R A;  4XZ3 B;  3ZHQ A;  4G27 B;  2IJH A;  3JD0 A;  5D8D A;  1N8R W;  2Y0I A;  3RV4 A;  2F1M A;  1W59 A;  1WPX A;  2ADQ B;  3JSL A;  4Y8V B;  2HJF C;  3H0G A;  3RIZ A;  3W7S A;  4JI5 O;  4MA0 A;  2KG7 B;  2P90 A;  4TV8 B;  5CA1 B;  4RB3 C;  2PGG A;  4YY3 B;  1FJG O;  4CH6 A;  4FLZ A;  4L8J A;  1EKF A;  1RP3 B;  1KP3 A;  3GIJ A;  4YP3 A;  1WAZ A;  3L2P A;  2R86 A;  3VQV A;  4PEL A;  4AHC A;  1GM7 A;  1V54 C;  1YXB A;  3KG2 A;  4E4E A;  2HLD G;  4TQS A;  2I87 A;  4LF6 O;  3PVX A;  3LUL A;  2OTL V;  5KFE A;  3CRC A;  1P16 A;  4PA4 A;  1Q3E A;  1TWG A;  2R7M A;  2UXD B;  4EG0 A;  5DED A;  4MSW C;  4DUZ O;  3FMA A;  2FE3 A;  3C3T A;  3B8N A;  4DW0 A;  4LF6 B;  5EWE A;  4MV3 A;  4H13 B;  4NXN H;  3K9S A;  5KFS A;  4OPH A;  2W8L A;  1G2W A;  3K5L A;  2WLK A;  2CKZ B;  3KHR A;  3SI8 A;  3CX5 F;  1AP5 A;  2E2I A;  5KHJ A;  1ZL8 B;  1WCM G;  3WG7 B;  2YS8 A;  2CZG A;  1AN7 A;  1Z2P X;  3OUS A;  4O83 A;  2GSM B;  4O82 A;  3FKI A;  3H1H H;  1Q81 W;  2X5R A;  3R23 A;  1VAR A;  3IFX A;  5FNV F;  2P4V A;  4A2A A;  2YI8 A;  2Y0S E;  4JGS A;  4B3T O;  4RAY A;  4PJ0 Z;  1XMQ H;  4LWS A;  4LFC B;  4YJ2 A;  4U3F H;  4IIJ F;  2OIG A;  4IWX A;  1P84 F;  2ADP A;  3N43 B;  2CDY A;  4WBN A;  3LQS A;  3VOT A;  1UJW B;  4DR3 B;  4A3E G;  4NKG B;  1BMF G;  2ATL A;  2R92 A;  2BTQ B;  3OUU A;  4QW8 A;  4O2B A;  4Z1V A;  4DV1 O;  1I50 A;  4JI5 H;  4C2M A;  4CH3 A;  3A0H Z;  4HZ3 A;  3T9C A;  3OEE G;  2KQX A;  5FNV B;  5KFL A;  4O4L F;  5L1K A;  3JD3 A;  3PW4 A;  2HP8 A;  4DK0 A;  4EFB A;  4YQW A;  2V4D A;  1EZ1 A;  3KXY T;  3PW2 A;  1D5A A;  1N34 O;  4DV1 H;  5L3B A;  2YS7 A;  4YBZ B;  2XGP A;  1QLE C;  5DLF A;  2YCH A;  1U97 A;  1H2K A;  2LW7 A;  4ETS A;  1XMO B;  3AEI A;  4DAA A;  2XOK G;  5L3C A;  3OD4 A;  4I50 A;  2FB9 A;  3SR2 C;  4C5B A;  3RYI A;  4YY3 H;  1IBK H;  4ME6 A;  4JI4 H;  2FYU H;  1D2D A;  2DWD C;  1Q43 A;  2A0L A;  1SC5 B;  4R6Z A;  2UUB B;  1KC8 W;  2JEG A;  1ZL8 A;  3LNN A;  4FMT A;  1BHA A;  3CXH F;  4DV4 O;  1OWT A;  2J6S A;  4IIJ B;  2ZE7 A;  1A9X A;  2IW5 A;  4O4H A;  1YIT V;  1RJQ A;  4ED0 A;  3GTM A;  3OE7 G;  1ROP A;  3S3X A;  3RF2 A;  1N36 O;  1OCO B;  4X8A A;  4ED3 A;  3CYO A;  5KAI Z;  4APM A;  1Z2N X;  4ICG A;  3N44 B;  4CC5 A;  2XHB A;  3Q8S B;  1FXK B;  3FYI B;  1HWY A;  3U11 A;  3P3N A;  1FFX A;  2IM9 A;  2FK1 A;  1JKJ B;  1XNQ O;  2VQF O;  3ETJ A;  1B3Q A;  1S76 D;  4O7S A;  2V59 A;  2RN9 A;  3S24 A;  2W8K A;  3G80 A;  2OCH A;  1YEW A;  5H2F Z;  3T9D A;  3RB6 A;  1ZWI C;  3V6J A;  1CS0 A;  4KXR A;  1EBO A;  2PBZ A;  2COJ A;  5BR8 B;  3ABU A;  1P8L A;  4X65 O;  2R84 A;  4LNU A;  2VQF H;  3J7A K;  1SKV A;  2EIM B;  4CKB A;  3KAJ A;  5LHG A;  2VA2 A;  1YF2 A;  1SQX H;  4TV9 B;  4NYK A;  2F23 A;  4PA9 A;  5KFI A;  4M0J A;  4WCE V;  3ZBH A;  4O4J F;  2E74 B;  1WP8 A;  3SJB C;  2GBO A;  2OLS A;  3IAY A;  3GID A;  1WPB A;  4C5C A;  3H1J H;  4Q43 A;  5D1O A;  4IT5 A;  3IG0 A;  5T14 A;  1X4T A;  4MW3 A;  4O2B B;  2GQR A;  3HKC A;  4OX9 H;  3GTQ A;  2EX3 A;  1XNR H;  1VF6 C;  4JI4 O;  3FKS G;  4MV1 A;  2YZM A;  3QQM A;  2KSD A;  3RGX A;  4YJ2 B;  1P7B A;  5J9P C;  4JI0 H;  3KHH A;  3J81 N;  1CKM A;  5IY5 B;  2VQF B;  5C93 A;  3L72 H;  4JAA A;  3SYQ A;  4TQR A;  3EPI A;  1HR0 H;  5FJ8 G;  1MA1 A;  3O65 A;  2ALZ A;  4O86 A;  4IWY A;  3GTP A;  4DUY B;  4DR5 H;  4JI8 B;  3RWR D;  1TUB B;  4H33 A;  2R8H A;  4J7K A;  2AGO A;  3R66 A;  2MW2 B;  4LH6 A;  2FLP A;  4BW9 A;  4B7K A;  5FLX N;  3L70 H;  4ZI7 B;  3CXC U;  2EJR A;  2QR4 A;  1M56 B;  2DQ3 A;  2CTP A;  5DGH A;  3U0Z A;  4QWA A;  1SQP H;  1I5Y A;  3I56 V;  1VS0 A;  2UUB O;  3BJY A;  4YXW G;  1FS0 G;  2VRZ A;  5DQH A;  5IYB O;  3TIG A;  4ED7 A;  4HNA B;  2UUC O;  4JI7 H;  1LUV A;  5CM0 A;  3AG3 C;  4LBE C;  2F95 B;  5LGN A;  3VNN A;  1EUC B;  2UUB H;  1M90 W;  3RAX A;  5FD6 A;  2EZP A;  1RYS A;  2Q69 A;  2V4Q A;  3NXS A;  2R72 A;  3PN1 A;  5HFL A;  1IBK B;  1CPY A;  3CHX A;  3UCS C;  2R8J A;  3KRE A;  3M7M X;  1HNW B;  4ECZ A;  1OCZ C;  2JJ1 G;  4MV9 A;  4FS2 A;  4DUZ H;  2OT5 A;  1QLE B;  4X1I B;  3RYH B;  3OFN G;  4JI3 H;  5JQW A;  2Q73 A;  4B3S H;  4Q4C A;  4LFC O;  4RZQ A;  3K59 A;  5FLM G;  3CCS V;  1ZTE A;  4AQY O;  1C3O A;  1V55 B;  4UCT A;  5F2V O;  2BOC C;  1G8M A;  1XMQ O;  3N2K A;  3HR0 A;  5IT9 W;  4X64 H;  4RB0 A;  1XMQ B;  4A5U B;  3MR6 A;  4FGR A;  2W6Q A;  4NXM H;  3TET A;  2AQ4 A;  1L2Z A;  1AI7 A;  4MVU A;  3A2F A;  1NTK H;  5DGA A;  2XAJ A;  4E4T A;  2COI A;  1GLV A;  5DMX A;  4PZ8 A;  3AK2 A;  3HB3 B;  4LF8 B;  3SPC A;  4MV4 A;  1TWA A;  1RM1 B;  1PNL A;  3ZIA G;  4I55 F;  2QJ1 A;  1US6 A;  2YWV A;  1JR9 A;  4EGJ A;  2ASL A;  4PBC A;  3EVK A;  4MTD A;  2XC9 A;  2QGN A;  4LWS B;  4M9U A;  3SYC A;  1CEZ A;  3AK3 A;  4PI0 A;  1FAF A;  3GIK A;  3V4Z A;  4LF7 B;  3ZRW A;  2VPS A;  3K79 A;  1XBL A;  3FAV A;  5EYP B;  3FD9 A;  1WCM A;  1E4E B;  2CH7 B;  2HKO A;  3HOZ G;  1I6U A;  3LNM B;  2IBZ H;  1S0O A;  1NR7 A;  1G6U A;  3GTJ A;  3K03 A;  2KSW A;  1SS3 A;  2W0X A;  5BWU A;  4X66 H;  4J9O A;  5KFQ A;  1R1B A;  4BIU A;  2IBK A;  3DXR A;  3M8A A;  4LCU C;  5EBL C;  2DQ0 A;  4I9Q A;  3WNZ A;  2YS6 A;  4E2L A;  4DR6 O;  3ASO B;  2AZ0 A;  3TW6 A;  5A9G A;  4B3S O;  4GYC B;  5JUM A;  2R70 A;  4UCR A;  3D8C A;  1X59 A;  4MVS A;  3DF7 A;  3G8C A;  2EJ7 A;  5KT3 A;  1XK5 A;  3W7U A;  3SE7 A;  4DV6 H;  3C3S A;  5KFT A;  3D36 A;  4DXW A;  5JH7 B;  4QPJ A;  3JD4 A;  2HVK C;  3P3P A;  3L9D A;  1F7Y A;  4DL2 A;  2HVJ C;  3RYI B;  2VR1 A;  3TQ1 A;  4LH7 A;  1JQ0 A;  1S5H C;  2CNV A;  4JAU A;  4G3I A;  5I5X A;  4WD3 A;  3RGB A;  1NVP D;  1FVI A;  3IC9 A;  2N04 A;  3RVZ A;  5KFN A;  4JAV A;  2E3C A;  4G28 B;  4BWA A;  2W9B A;  2YC0 A;  4DL4 A;  4XDJ A;  4IHJ F;  4FVM A;  4JPR A;  4E6N A;  3HKC B;  2JA8 G;  3ASN C;  1JJO A;  3RBZ A;  4X65 H;  2VPQ A;  3BEH A;  2XAS A;  4TOI A;  3NBZ B;  1SQG A;  5KG6 A;  3JZ6 A;  1CP9 A;  3JD1 A;  4MTG A;  5BWR A;  4JV5 H;  4EB6 B;  3BG5 A;  2QDO A;  2JVD A;  3W1B A;  2HHH O;  1M1K W;  4DYL A;  2PI4 A;  2AGQ A;  5KHI A;  4GKK H;  3RFC A;  2Q67 A;  1E79 G;  2V7Q G;  1XQ8 A;  2UXB O;  1BHB A;  4UV9 A;  3ZJZ A;  1P4R A;  5GW7 A;  2HGW A;  3T5J A;  3SPJ A;  2CTQ A;  2R8I A;  2JA6 G;  5IE9 A;  4M7E A;  1KUT A;  1YVW A;  3RVY A;  4I9W A;  4K35 A;  3G6E V;  2V1D A;  2QB5 A;  4PDB A;  3GV8 B;  4HNA A;  3HOW G;  1WLE A;  2LW1 A;  3B40 A;  4JI0 O;  4CZZ A;  1JDB B;  4F4Z A;  2WAQ A;  2QM4 A;  4Q8F A;  1XNQ B;  5LHI A;  2DIK A;  2W7P A;  4HNT A;  2R8K A;  1PL0 A;  3JAK A;  2VQE H;  1EN5 A;  2A3Q A;  3N2G B;  2PY5 A;  5KA6 A;  2ZDI C;  1IOV A;  1YJW V;  3JAK B;  2PZS A;  3TEK A;  3OM3 B;  1JVM A;  5KA5 A;  4FBU A;  4ZI7 A;  4UB6 Z;  4DL3 A;  2W6N A;  1IBM H;  1DIK A;  4FM9 A;  4J9R A;  2P7T C;  3H1I H;  3JCZ A;  2YYA A;  4DV4 B;  1I2L A;  4DV5 B;  3CQZ A;  2GPS A;  2I8C A;  4FLX A;  1SZT A;  1J95 A;  3TXS A;  4K0K O;  4ZIB A;  1OBG A;  1J5E B;  1Y1W A;  3TY9 A;  2RCV A;  4QPK A;  4A3L G;  1D5N A;  3HKD B;  5CMU A;  3K5N A;  1RSO B;  1YHQ V;  5I60 A;  3TY8 A;  5DG9 A;  3EFF K;  2ZNI A;  3RYC B;  4YJ3 B;  5EK0 A;  4I7Z B;  4EEQ A;  3SPH A;  1K1Q A;  4CBC A;  3OUZ A;  2FB5 A;  1JFF B;  1OCC C;  5I5S A;  4JYA O;  4X1K A;  2V9W A;  3CE2 A;  3UM7 A;  5DQI A;  4MVO A;  2W71 A;  2FPP B;  4NZN A;  2GPW A;  2VS0 A;  3HBL A;  1HNX H;  1KEC A;  1KUQ A;  2BTQ A;  5EZY A;  3E8F A;  5LHH A;  1R3L C;  3R65 A;  3ZRV A;  5DGI A;  3OGC C;  4WFA V;  3T99 A;  4JI6 H;  4LNU B;  5LA6 B;  5K1X A;  3CCJ V;  1V9P A;  4AIL C;  1TAE A;  1V4Y A;  1WN7 A;  4UVA A;  1GM8 A;  2H94 A;  3ABM C;  1JX4 A;  4F4Y A;  3ORR A;  1K83 A;  5BWX A;  2XCA A;  3E8G A;  4YB8 B;  4J9N A;  4FLY A;  4I4T B;  3K3P A;  4A2B A;  4FLU A;  4X62 H;  3SJQ C;  5JVD A;  4ED8 A;  3JAW A;  2JDI G;  5EWF A;  1A0I A;  5BWW A;  1NH2 B;  1XIL A;  4JYC A;  2HEP A;  1E4E A;  5I5Y A;  2DYR C;  1M6V A;  5EBW C;  1CKN A;  3H4B A;  2N05 A;  4TWK A;  5J2T A;  2JEJ A;  1IX9 A;  4CS2 A;  1N0N A;  4BBS G;  4GX0 A;  2YZG A;  2A9H A;  1OHH G;  1SES A;  2W9C A;  3T9A A;  5KFW A;  4O81 A;  1K33 A;  3ZMZ A;  1R3J C;  4O3Q A;  1KT8 A;  5FPR A;  5BPH A;  1H8H G;  1EUD B;  3GV5 B;  3DC5 A;  3ZMU A;  3H20 A;  4J42 A;  3N27 A;  1EN6 A;  2NU6 B;  2NVX A;  3MR3 A;  4LSA A;  4D7T A;  1H2S B;  4JI2 H;  2ZJT A;  2R8G A;  4LF7 H;  3JAT A;  4LF9 H;  1Y1V G;  4A3M G;  2CTW A;  2CGO A;  4UXN A;  2BR0 A;  3OTO H;  1B04 A;  5BWV A;  3OGI B;  1E1Q G;  2QA4 V;  4RNM A;  4ZKI A;  1RPR A;  1S03 G;  3AG2 B;  4WFB V;  1QQC A;  3M9N B;  4NTW A;  4DR4 H;  1U96 A;  2PVP A;  4BAY A;  3ETE A;  2HDK A;  1KD1 W;  3CPW U;  3MHS C;  1ZAU A;  5IDJ A;  4Q4D A;  3CJH A;  2XAF A;  4B3M O;  2PTM A;  4DR2 B;  4LF8 O;  4JI1 B;  4X64 B;  4Q44 A;  2RDC A;  3CP1 A;  4PDR A;  4NYE A;  3GWK C;  2W6Z A;  4CH4 A;  1Q90 D;  2XCL A;  1T36 A;  2FTK A;  1DF5 A;  1NTZ H;  2L35 A;  1N36 B;  1VBH A;  5CAE B;  3HOV G;  1H2N A;  4DR7 B;  1BL8 A;  5A2Q N;  3H1L H;  3K06 A;  3TII A;  5KHG A;  5AG2 A;  5CBF A;  1UFI A;  1KQS U;  1F4M A;  4W4L A;  2JRI A;  5CA0 B;  3NBY B;  1NQT A;  2DYS B;  1YJ9 V;  5CE8 A;  3G6B A;  3B8M A;  1NBM G;  3ABL B;  1OCR B;  1IZ3 A;  3ASO C;  4PDL A;  2CFM A;  4DRX B;  4GLX A;  4RU9 A;  4JXU A;  4KHP B;  3T9B A;  4DV0 B;  2EJ0 A;  4MVR A;  2W9A A;  5IJ0 B;  4IRK A;  4OXS A;  2V5A A;  2LFR A;  2RDJ A;  5ITZ B;  2COG A;  5IYZ A;  4CKE A;  3Q4H A;  2VA3 A;  1VQM V;  2AW9 A;  1J5E O;  2JA7 G;  2AXT Z;  2K1E A;  2ZQM A;  2JJ2 G;  1KU9 A;  2JEX A;  4JYY A;  5L3G A;  4O2A B;  1IBM B;  4O7T A;  1R6K A;  2RNB A;  3TCU A;  1EYZ A;  1GGO A;  3OEH G;  4KUM A;  1XDN A;  3KZI Z;  4LF5 B;  4DR4 O;  4O84 A;  4ECW A;  3P32 A;  1IDS A;  1W0K G;  3MDS A;  4ECV A;  3RFR A;  4JZ2 A;  3ASN B;  2HIX A;  5E25 A;  4MTX A;  3DTG A;  3T7A A;  3WB0 A;  3OMI B;  4DW1 A;  4GKJ O;  3JSN A;  2O03 A;  3T9F A;  3A0R A;  5LMU O;  1QBZ A;  5KHK A;  5JWP A;  4TV9 F;  4QIW A;  3PZP A;  2FL4 A;  4B3R H;  3ZHR A;  4B08 A;  4JI0 B;  1GRJ A;  1S3J A;  2GDS A;  4HYK A;  1AR1 B;  1F23 A;  4IAJ A;  4B3T H;  4GX2 A;  3U55 A;  4O3S A;  2YI9 A;  1EFR G;  4O4I F;  2DZD A;  2C28 A;  4G2K A;  4QSH A;  5I5T A;  5K1P A;  3MWM A;  5B1O A;  2V4R A;  2W6I G;  1CE8 A;  3T54 A;  3T4D A;  1VQ6 V;  3ORQ A;  1BGY H;  5CB4 B;  2FPG B;  1BT8 A;  1MOF A;  4FFK A;  1WR2 A;  2ZDQ A;  2WB1 E;  4J7Z A;  3HKZ E;  2PYL A;  3TXQ A;  2MCT A;  5KFR A;  5IYC O;  1Q8I A;  1IUR A;  1N0J A;  2A1H A;  4DV0 H;  2IJK A;  3K0D A;  5CR5 A;  4EQ5 A;  5D1P A;  4PV1 B;  2C2E A;  2YU9 A;  2A06 H;  3H01 A;  3CWB H;  3GIQ A;  4Q0Y A;  4RUE A;  3FDS A;  3E86 A;  4PA7 A;  4UVC A;  3CCU V;  5LL6 b;  4O4H B;  3MHH C;  4Z2W A;  5KFB A;  5B1N A;  1M93 A;  2UUA B;  4YR2 A;  4MA5 A;  4KFM A;  4RB1 A;  4X65 B;  4FLT A;  4PDV A;  1FFX B;  3NUA A;  3WB2 A;  1JJ2 U;  4HQ6 A;  4FFB A;  2EIY A;  4FU0 A;  3W7X A;  2YZL A;  2Z0A A;  4J7J A;  5EYP A;  4JZG A;  5BWT A;  4TV8 F;  1N36 H;  2ABJ A;  2EIK C;  4U7N A;  3M9M B;  4A93 G;  2R92 G;  2Z04 A;  2W70 A;  4RWU A;  1Y67 A;  1GSA A;  3E2E A;  4DR2 O;  2M6Y A;  1HDJ A;  3T9E A;  1VKZ A;  1XRE A;  4I5S A;  3UT5 A;  2E5L B;  4DR6 B;  3JAM W;  5EIB C;  1ZX3 A;  2GTS A;  4J80 A;  4LFA O;  3B4S A;  4LP8 A;  1H38 A;  5I47 A;  4DLK A;  1SQV H;  2QYZ A;  2UUA O;  5KS8 A;  4QJF A;  4UCS A;  3DTU B;  5B1B B;  5KAF Z;  2DJV A;  1K4C C;  1M4U A;  3GVM A;  2R7Z A;  4CHI A;  1Z2G A;  5LYJ A;  2X7R B;  5KFV A;  3NC0 B;  5KT2 A;  1SET A;  4J41 A;  2FML A;  5L9X A;  4ZOL F;  2LFS A;  4IZO A;  4J9M A;  2JGD B;  4LF9 B;  2C00 A;  3UZB A;  1DAA A;  2JA5 A;  4O7N A;  3ABM B;  1PL4 A;  4YIO A;  1KJ8 A;  3JAL A;  3TJT A;  4DV2 H;  5LP6 A;  2F93 B;  5EWG A;  3CRR A;  2UVV A;  4MW8 A;  3G71 V;  1M5I A;  5JVD F;  1F51 A;  3UO2 A;  1EKV A;  2IJI A;  5IYB G;  4NXM B;  3FX7 A;  3HKE A;  5LBQ A;  4EBC A;  1PM9 A;  2BE3 A;  1JXL A;  3PJS K;  3AG7 A;  1RJR A;  3ML0 A;  3T1Y B;  5IWA B;  1DTO A;  3RYF A;  3KCX A;  1K7D A;  1DV1 A;  1OV9 A;  5IJ0 A;  2G38 A;  1VF5 B;  1LR1 A;  3IGA C;  2Q7E A;  4BWS C;  2C2R A;  1YCI A;  5JCO A;  1S77 D;  3LDD A;  3KHG A;  1OCO C;  3CS5 A;  1TGO A;  2F43 G;  2E76 B;  3Q8R B;  5K3W A;  3ZRW B;  1JLL B;  5LMU H;  4LF6 H;  1B6S A;  3KKY A;  2UXD H;  1JA8 A;  2RDI A;  1L1F A;  4IR1 A;  2Q6A A;  5CA3 A;  4XDK A;  4U3J B;  5LMN B;  2P5O A;  5KFP A;  1NT2 B;  4DL7 A;  4I50 F;  4CC6 A;  2NVY A;  2Y0P A;  1NU1 H;  5LMN O;  4DUZ B;  5I5W A;  4J11 A;  1S10 A;  2HHF A;  5C4X G;  4JI7 B;  3ZHV A;  2LJ2 A;  4PZ6 A;  3R5F A;  5LA6 A;  4F6E A;  5A2Q W;  4J9K A;  3Q8P B;  2F4V B;  2UUC B;  2KG7 A;  4TV8 A;  3GQC A;  3ETG A;  2AHY A;  4JTA B;  1N33 H;  2JIZ G;  4JV0 A;  4HNU A;  1A48 A;  4NTX A;  2FLN A;  4GLW A;  3CEI A;  4DV5 O;  2YXY A;  2DPI A;  2EIJ B;  3I12 A;  3QO8 A;  1T3N A;  1N32 H;  3MFH A;  5JH7 A;  3AG1 B;  5H6Q A;  4X20 A;  1K5Q A;  4O3R A;  3S3W A;  4DV4 H;  4YJ2 F;  3T1Y O;  3RUP A;  4H44 B;  1GK9 A;  4B3R O;  1I94 H;  1HR0 B;  1SQQ H;  3CB2 A;  5B3S C;  4MV7 A;  4YHH O;  4O2A F;  4AQY H;  1P49 A;  3TW7 A;  3STL C;  3JAT B;  3SPG A;  5L3D A;  4NXM O;  2LGW A;  4JV1 A;  3LDE A;  2BQ3 A;  4YIP A;  2VQE B;  4DR5 B;  4AYB A;  1L0L H;  3CRA A;  4DUY H;  4U6P A;  1XNQ H;  1IOW A;  4BIO A;  2F66 C;  4J9S A;  3RN4 A;  5IYD O;  4J9Y B;  4XYL B;  1AP6 A;  3JZF A;  3AG4 B;  1VQO V;  2FK3 A;  3HPL C;  2Q68 A;  1ZHQ A;  2UU9 H;  2DWE C;  1I7F A;  1FXK A;  3K5M A;  3FAV B;  2EIM C;  4FM1 A;  3ZN1 A;  3PW7 A;  2P22 C;  3HKE B;  4PA3 A;  2NUA B;  3KTM A;  1W96 A;  1PX2 A;  1Y74 B;  2M7W A;  4N21 A;  1MNG A;  1I08 A;  1PK8 A;  5BR8 H;  1Z5W A;  4UV8 A;  3K58 A;  4JYA H;  2BSK B;  4JV5 B;  3M9O B;  5EOY A;  4YJ3 F;  3CC2 V;  5FPO A;  2IJJ A;  1SA0 A;  4DR1 H;  1K4D C;  1DV2 A;  5J2U A;  4GUN A;  3GV7 B;  5KFX A;  3K5I A;  3TK1 A;  4ECS A;  4JV2 A;  3CCV V;  3OUF A;  2C2D A;  4IHJ B;  5C8Y B;  4PI2 A;  5LOV B;  2QKA A;  4L1K A;  4MT8 A;  4O4L B;  2ZM6 H;  3E8B A;  1HR0 O;  1AR4 A;  4WFF A;  2LGQ A;  3T5H A;  1R6N A;  3G67 A;  2KB1 A;  4RCN A;  2W9B B;  4K8X A;  2WYO A;  5FL7 G;  2QTS A;  2F4V H;  3ZHS A;  2XND G;  2OTJ V;  3LSS A;  4PA6 A;  1XEQ A;  1M9N A;  1M56 C;  1IVS A;  4O7R A;  4IGG A;  3ZX6 A;  2Q7H A;  5B5E Z;  1A0G A;  1XHX A;  2RF4 A;  1XMO O;  2I80 A;  1ZHS A;  5KG7 A;  4NR1 A;  4X66 B;  3KAL A;  4GZR B;  3AG3 B;  4LR3 A;  2ZIO A;  4PD4 F;  3F8N A;  3ETQ A;  2YSU B;  4R7R A;  3V6K A;  2ZE6 A;  4GX5 A;  2IH3 C;  3F7V C;  4ECY A;  2HHH H;  2WLM A;  3CRM A;  2WE6 A;  4DO2 A;  1XMO H;  1YZB A;  2EIK B;  2Q0A A;  5BMV A;  2ITC C;  1ORQ C;  4DV1 B;  4QW9 A;  4GKK O;  2J9G A;  5JVL A;  1AI6 A;  1YTF D;  5IJ9 B;  2R87 A;  3BA8 A;  4FFN A;  3LUT B;  2XAG A;  4A3C G;  3QZ8 A;  1Q82 W;  3PFF A;  3MAQ A;  1WJZ A;  4ZI7 F;  4NXN O;  4ZHQ F;  3MFI A;  4ECQ A;  4I4T A;  4U7C A;  4EKW A;  3RAQ A;  4TM5 A;  2VUM A;  2Y4T A;  3RV3 A;  2H8P C;  5IP9 G;  3CC4 V;  3ZCC A;  3BFR A;  4WBN F;  4PDM A;  5BXZ A;  1JCH A;  4FK5 C;  2ZR2 A;  4A3G G;  5KG1 A;  2FPI B;  2JGU A;  3N6X A;  2PF4 E;  2ZKO A;  1THZ A;  3BPZ A;  3R5H A;  3WWJ A;  1SER A;  4Q45 A;  2LP7 A;  2P67 A;  3MWE A;  3Q2O A;  2WAM A;  2OCC B;  2VOB A;  4ECX A;  1BGW A;  4I0X A;  3N6R A;  3OT7 A;  2V58 A;  1QCE A;  4J10 A;  1Q7Y W;  2DAB A;  1FJG H;  3VPD A;  2PI5 A;  2KKW A;  3KAK A;  2E75 B;  1M0T A;  2ZIM A;  2WA4 A;  3RYC A;  3SDL A;  4JI3 B;  4EFE A;  1GM9 A;  2AHZ A;  1N48 A;  3DSQ A;  3DGE A;  3FYE B;  4WFH A;  3GTO A;  1P7G A;  5CA1 F;  2QF7 A;  3HKD A;  5J2U F;  4TQD A;  3QNE A;  2JA7 A;  4CS4 A;  5LL6 Y;  4HAM A;  2ZCE A;  4UUG A;  2HHH B;  4MV6 A;  4EBE A;  2R7Z G;  2ATK C;  1UPG A;  3BQ0 A;  1VQL V;  1DF4 A;  1GTO A;  5KFY A;  5TIS Z;  1JX9 A;  4FFB B;  5JJE B;  1MZE A;  4TSF G;  5KFU A;  5BYA A;  4DR6 H;  1URF A;  2YEV B;  2E5L H;  3D3Q A;  5EIB D;  4DR7 O;  4AYB E;  1TWH A;  2CK3 G;  2EBO A;  3VQX A;  1CXZ B;  2JS3 A;  4YHH H;  4DV6 O;  2WLJ A;  1S68 A;  4NTY A;  1GO3 F;  1FYJ A;  2VWJ A;  4NZM A;  1N32 O;  2ITD C;  1EN4 A;  2AGP A;  1OZ0 A;  1PNM A;  4JI8 O;  4O7Z A;  1GN2 A;  1K1S A;  2X0L A;  4DUY O; 
#chains in the Genus database with same CATH homology
 3JAW B;  1HW7 A;  5ITZ B;  5IYZ A;  3S24 A;  4DV7 B;  4MTE A;  3RR5 A;  1YEW A;  5GON A;  3K5O A;  5BR8 B;  1KU9 A;  3JAS A;  3JAR A;  4O2A B;  1P8L A;  2UXC B;  1IBM B;  4LNU A;  4PHZ A;  2VQF H;  3J7A K;  1SKV A;  4FM2 A;  3LML A;  3KAJ A;  3T1H H;  1M0W A;  1XDN A;  4TV9 B;  4LF5 B;  2RJZ A;  3J80 W;  4B3T B;  5KMG A;  3RFR A;  2JS5 A;  4UCO A;  2HIV A;  5LP6 B;  3RJ0 A;  4DV5 H;  4B3R B;  3N42 B;  1JMK C;  3SJB C;  2HIX A;  3WB0 A;  4DV3 H;  3IAY A;  1MZB A;  2BTO A;  1WPB A;  3JSN A;  5D1O A;  4TQF A;  3WB1 A;  2O03 A;  3IG0 A;  3BRC A;  1X4T A;  5KHK A;  4O4L A;  4O2B B;  3HKC A;  4B08 A;  4OX9 H;  2EX3 A;  4JI0 B;  3SGI A;  1XNR H;  4B3R H;  3CVZ A;  4IAJ A;  4I7H A;  5KX5 A;  2UU9 B;  4WBN B;  2HVS A;  2WDT A;  4B3T H;  3RGX A;  4YJ2 B;  4JI0 H;  4OX9 B;  2YI9 A;  1CKM A;  4GKK B;  2VQF B;  3N41 B;  4O2A A;  5K1P A;  1SA0 B;  3MWM A;  5LXT B;  4DV3 B;  1HR0 H;  5JQG B;  1TVK A;  5GON B;  3EYY A;  2XIG A;  4I55 B;  4U3J A;  4DUY B;  5CB4 B;  4FM0 A;  4DR5 H;  4JI8 B;  3RWR D;  2UXB B;  1TUB B;  3UT5 B;  4CS3 A;  4X1Y A;  2PYL A;  2MCT A;  4LH6 A;  1Q8I A;  4BW9 A;  4TV9 A;  4DV0 H;  4ZI7 B;  4EQ5 A;  4KHP H;  4ZHQ B;  5D1P A;  4LFB H;  1T5E A;  2UXC H;  3U0Z A;  2CW8 A;  1Z5V A;  4Q0Y A;  1I94 B;  3JAS B;  1VS0 A;  1Q5O A;  4ZOL B;  2OYQ A;  5LL6 b;  4O4H B;  5CA0 A;  3GJX B;  1M93 A;  4Q6G A;  4HNA B;  4JI7 H;  2UUA B;  4DK1 A;  5ITZ A;  4RB1 A;  4X65 B;  2F95 B;  2PUS A;  3K57 A;  4FLT A;  3VNN A;  1FFX B;  2UUB H;  4KL1 A;  1O9H A;  3WB2 A;  5FD6 A;  4FFB A;  5LMN H;  2R72 A;  3BHP A;  5EYP A;  1N33 B;  3PN1 A;  3VQW A;  1N36 H;  3E22 B;  2UUC H;  4O4I A;  1IBK B;  2W57 A;  3CHX A;  4YHH B;  3M7M X;  1HNW B;  4GKJ H;  5CA1 A;  4MV9 A;  1TUB A;  3UT5 A;  1IBL B;  2E5L B;  4DUZ H;  4TUY A;  3GB8 B;  4X1I B;  1DGS A;  4DR6 B;  3RYH B;  4DRF A;  4JI3 H;  3JAM W;  5EIB C;  3HKB A;  4DV6 B;  4B3S H;  1FJG B;  1E4G T;  4UCS A;  4JI4 B;  4RZQ A;  4JI5 B;  3K59 A;  4I50 B;  3BA9 A;  3N40 P;  1M4U A;  4LFA B;  5LMU B;  3T1Y H;  4UCT A;  5LYJ A;  2YIA A;  2OWO A;  3N2K A;  4DR3 H;  3NC0 B;  5IT9 W;  4X64 H;  4D7S A;  4JI1 H;  4RB0 A;  4LFC H;  4DR2 H;  2Q7G A;  5D5Q A;  5JJJ B;  1XMQ B;  3QTC A;  1SQF A;  4NXM H;  4LF9 B;  4J0M A;  5D1O B;  1L2Z A;  4K0K H;  5KHH A;  3A2F A;  4DR4 B;  2ZNJ A;  2VUG A;  5JJN B;  3JAL A;  4PZ8 A;  4LF8 B;  5LP6 A;  4DV2 H;  2F93 B;  1O9G A;  3U10 A;  2QJ1 A;  3VQY A;  1M5I A;  4TUY B;  2ZIN A;  4MTD A;  3L4J A;  5DIS C;  4NXM B;  4PI0 A;  3HKE A;  4LF7 B;  2VPS A;  5EYP B;  3E22 A;  4DV2 B;  2RQ6 A;  3T1Y B;  1I6U A;  5IWA B;  1O75 A;  3RYF A;  5JVD B;  1VF7 A;  3BAB A;  1G6U A;  5IJ0 A;  1S5J A;  2KSW A;  4X66 H;  2Q7E A;  3RYF B;  2R9A A;  4BWS C;  3ZS8 C;  5LP6 C;  5JCO A;  5J2T B;  4I9Q A;  1TGO A;  4NXN B;  5LMU H;  4LF6 H;  2UXD H;  4ZHQ A;  3B2E E;  4GYC B;  2YIB A;  2R70 A;  4UCR A;  3DF7 A;  1GYF A;  3THO A;  1XK5 A;  4DV6 H;  4U3J B;  5LMN B;  2P5O A;  3M4I A;  1NT2 B;  5JH7 B;  4CC6 A;  5CB4 A;  4X1K B;  4DUZ B;  5JQG A;  3RYI B;  4GKJ B;  4JI7 B;  1HNW H;  5LXT A;  4LH7 A;  4PZ6 A;  2ZM6 B;  4YJ3 A;  5LA6 A;  2GV9 A;  5A2Q W;  3N2K B;  2HVR A;  2F4V B;  5LOV A;  3RGB A;  2UUC B;  4TV8 A;  4IHJ A;  1FVI A;  3W5O A;  5EZY B;  1N33 H;  5KX5 B;  3RGZ A;  2E3C A;  4BWA A;  4RB2 C;  4FVM A;  4E6N A;  3HKC B;  5J2U B;  5FNV A;  1JJO A;  4X65 H;  3L4K A;  1JFF A;  4TOI A;  2UUA H;  1CKO A;  1N32 H;  2UXB H;  3RYH A;  4DR1 B;  3NBZ B;  5JH7 A;  1SQG A;  4X20 A;  4LF4 H;  4JV5 H;  4JYA B;  3HKB B;  4DV4 H;  4EB6 B;  5JCO C;  1I94 H;  1HR0 B;  2JVD A;  3W1B A;  3CB2 A;  4MV7 A;  4F6R A;  1WNS A;  5KMG B;  5KHI A;  4GKK H;  1TA8 A;  4AQY H;  1P49 A;  2VWK A;  3QF7 A;  1XQ8 A;  2Q2T A;  3JAT B;  3HXL A;  2RGR A;  1XHZ A;  1BJT A;  1J5E H;  3OTF A;  4O4I B;  2VQE B;  4JI8 H;  3CSX A;  4DR5 B;  3JAR B;  2RGV A;  1XNR B;  4DUY H;  4M7E A;  1XI1 A;  1XNQ H;  4O4J B;  1SEI A;  4PDB A;  2F66 C;  4HNA A;  5IYZ B;  2QM4 A;  3J81 W;  1XNQ B;  4ZOL A;  1ZHQ A;  3JAK A;  2VQE H;  2UU9 H;  1I7F A;  3N2G B;  4DRX A;  2PY5 A;  4FLV A;  1CKN B;  3K5M A;  4FM1 A;  3JAK B;  4HBN A;  2PZS A;  1WH2 A;  2P22 C;  3HKE B;  3T1H B;  4AQY B;  4ZI7 A;  1IBM H;  4F6R B;  4FM9 A;  5BR8 H;  5FLX W;  3QG5 A;  1Z5W A;  3K58 A;  3KYH C;  4X20 B;  4O4J A;  4DV4 B;  4JV5 B;  3W1G A;  4JYA H;  4DV5 B;  5EOY A;  4DV7 H;  5FPO A;  4I55 A;  1SA0 A;  4DR1 H;  4FLX A;  1TVK B;  4UCV A;  5J2U A;  4ZIB A;  4FLW A;  1J5E B;  2HVQ A;  4LF5 H;  3ICX A;  3TY9 A;  1N34 H;  1E4F T;  3HKD B;  4IHJ B;  5C8Y B;  4PI2 A;  5LOV B;  3FFQ A;  3K5N A;  3TY8 A;  5LYJ B;  4O4L B;  2ZNI A;  3RYC B;  4YJ3 B;  4EB6 A;  4LF4 B;  2PYJ A;  4EEQ A;  2ZM6 H;  1N32 B;  1JFF B;  4X1K A;  3C0F B;  4K8Z A;  1HNX H;  4DR7 H;  4K8X A;  4X1I A;  2WYO A;  2F1M A;  2BTQ A;  3JSL A;  3RIZ A;  5EZY A;  4JI6 H;  4UFZ A;  4TV8 B;  4RB3 C;  5CA1 B;  2F4V H;  2PGG A;  4YY3 B;  4CH6 A;  4LNU B;  5LA6 B;  5K1X A;  4L8J A;  4FLZ A;  4UCU A;  1V9P A;  4AIL C;  1TAE A;  1HNZ B;  2Q7H A;  1WN7 A;  3SJA C;  3L2P A;  1XHX A;  3VQV A;  4AHC A;  1ZHS A;  4FLY A;  4I4T B;  4X66 B;  3KAL A;  4A2B A;  4LR3 A;  2ZIO A;  4LSX A;  4FLU A;  3F8N A;  3ETQ A;  4X62 H;  4PZ7 A;  1P16 A;  4R7R A;  5JVD A;  3JAW A;  1Q3E A;  2HHH H;  3TY5 A;  2CAZ C;  1A0I A;  3FMA A;  2UXD B;  5IWA H;  2WE6 A;  2FE3 A;  4LF6 B;  2HEP A;  1XMO H;  4NXN H;  1L8D A;  4B3M B;  5FD5 A;  2Q0A A;  5BMV A;  1CKN A;  2YIB D;  4DV1 B;  1KMI Z;  5J2T A;  5IJ9 B;  3K5L A;  4CS2 A;  3BA8 A;  4IIJ A;  5BMV B;  5KHJ A;  3MAQ A;  4JI2 B;  1AN7 A;  4X1Y B;  1Z2P X;  4I4T A;  1FKA H;  5FPR A;  1QHT A;  3H20 A;  4NVP A;  4A2A A;  3GDE A;  2YI8 A;  3ZED A;  4D7T A;  1H2S B;  4JI2 H;  3OTO B;  2ZJT A;  4LSA A;  2HGS A;  4LF7 H;  3JAT A;  4LF9 H;  3QWU A;  4RAY A;  4LMY A;  2JGU A;  1XMQ H;  4LFC B;  4YJ2 A;  3N6X A;  3OTO H;  3N43 B;  1B04 A;  4WBN A;  3BPZ A;  4DR3 B;  3K3V A;  4B3M H;  4RAZ A;  4LF8 H;  1S03 G;  2BTQ B;  1QQC A;  1X9N A;  4O2B A;  2VOB A;  3JAL B;  1BGW A;  4DR4 H;  4JI5 H;  4CH3 A;  5FNV B;  4K0K B;  1FJG H;  2KKW A;  1ZAU A;  2Q2U A;  3KAK A;  1M0T A;  2ZIM A;  3RYC A;  4DK0 A;  4EFB A;  4JI3 B;  2PTM A;  2V4D A;  4EFE A;  4DR2 B;  3DSQ A;  1SYX B;  3KXY T;  1D5A A;  4JI1 B;  4X64 B;  4CH5 A;  1IBL H;  4DV1 H;  3HKD A;  2YCH A;  1RSO A;  4TQD A;  4ETS A;  5C8Y A;  1XMO B;  4CH4 A;  4CS4 A;  4LFA H;  2ZCE A;  4I50 A;  2HHH B;  3SR2 C;  1Z2O X;  3RYI A;  4YY3 H;  1IBK H;  4JI4 H;  4X62 B;  1N36 B;  4B3S B;  4FFB B;  4DR7 B;  5JJE B;  1HNX B;  1Q43 A;  4DR6 H;  2UUB B;  2E5L H;  5EIB D;  3LNN A;  5KHG A;  3RTX A;  3VQX A;  4IIJ B;  2CW7 A;  1HNZ H;  4O4H A;  5CA0 B;  5IJ9 A;  3NBY B;  4YHH H;  3BAA A;  3RF2 A;  2YXL A;  1S68 A;  2VWJ A;  4JI6 B;  4APM A;  3SJC C;  1Z2N X;  3N44 B;  4CC5 A;  3UQ8 A;  2XHB A;  2CFM A;  3N2G A;  4DRX B;  4GLX A;  4LFB B;  1N34 B;  4KHP B;  4DV0 B;  3U11 A;  1FFX A;  2IM9 A;  5D5P A;  5IJ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...