3UQ8A

Structure of adenylation domain of haemophilus influenzae dna ligases bound to nad+ in adenylated state.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
NIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVARIEDRLILLPAPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQEELTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure Guided Understanding of NAD(+) Recognition in Bacterial DNA Ligases.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 106
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2011-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3uq8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3uq8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3uq8A02
4X62B 2HVQA 2UXBB 4X65B 4DR3B 1IBMB 3T1HB 2UUCB 4DV1B 4B3MB 4OX9B 4K0KB 4DR1B 2CFMA 3RTXA 2HVSA 3W5OA 4GKKB 4LFBB 1TA8A 4CC5A 1HNXB 4YY3B 4JI8B 2UXDB 3T1YB 4DRFA 3NC0B 3W1GA 1DGSA 4NXNB 1CKNB 1VS0A 1XDNA 4JYAB 4UCOA 4DV2B 3L2PA 4DV5B 4JI3B 4LF9B 4DR6B 4UCVA 2UXCB 5IWAB 4LFCB 4AQYB 3RR5A 3JSLA 1ZAUA 1IBKB 4NXMB 1XK5A 4DV4B 1FJGB 4JI2B 4LF4B 4JI4B 3BABA 2VQFB 4LF8B 1XNQB 3NBZB 4DV7B 4B3SB 2HIVA 4E6NA 4DR7B 2ZM6B 3GJXB 1X9NA 1N33B 4X64B 3PN1A 3GDEA 4JI0B 5D1OB 1XMQB 4GLXA 2Q2UA 5FPOA 3BA8A 1CKMA 3SGIA 4PZ8A 2UU9B 4UCTA 1HNZB 4GKJB 4PZ7A 3TY9A 1CKNA 2VUGA 3BAAA 2UUAB 1B04A 4DV0B 1A0IA 4B3TB 3BA9A 4KHPB 4CC6A 4JV5B 4UCRA 4DV6B 3TY5A 5BR8B 1J5EB 4EFBA 4EFEA 3JSNA 1XMOB 1N32B 2HVRA 4LFAB 1CKOA 3W1BA 3S24A 4YHHB 1TAEA 4UCUA 4JI5B 5FPRA 4LF5B 2VQEB 5LMUB 3KYHC 4JI6B 1IBLB 4DUYB 5D1PA 1V9PA 1HR0B 5D1OA 1HNWB 4DR2B 2Q2TA 4JI7B 4UFZA 3GB8B 3TY8A 4LF7B 4EEQA 2E5LB 4LF6B 4DR5B 1P8LA 3UQ8A 4DR4B 2UUBB 4LH7A 4UCSA 1FVIA 3VNNA 2HHHB 5LMNB 4DV3B 3NBYB 2OWOA 4PZ6A 5DISC 4B3RB 3QWUA 4LH6A 4X66B 3OTOB 2HIXA 4EQ5A 1S68A 2F4VB 1P16A 1I94B 1XNRB 4TOIA 1N34B 4JI1B 1N36B 4DUZB
chains in the Genus database with same CATH superfamily
1GSAA 3GV5B 3W7XA 4RAZA 2R87A 1IBMB 1WPBA 3RTXA 3I5DA 5FJ8G 4O7RA 4LNUB 5FLXW 3GTPA 2HHFA 4WHXA 3RVZA 4A3KG 4PA3A 4TUYA 2GTSA 3RJ0A 1AILA 1KKDA 4JI8B 3RB3A 4WD3A 1Y14B 3WG7C 4CMDA 4DV5H 4NXNB 3B4SA 2D2CB 2ZE7A 1AN7A 4YR2A 3WB1A 1EN5A 4IIJA 1JX4A 5CR5A 1R3JC 4MVZA 2BQUA 2M6YA 3R66A 3AG2B 3HOYG 3GTJA 3DXRB 2LW1A 2R7LA 4A3FG 1Q8IA 4DR1O 1COWG 1Y76B 4YJ2A 2KKWA 4TV8B 1IOWA 3VBBA 1S0VA 1DTOA 2HG5C 2GUZB 4IYHA 2ZM6B 4JAAA 2ASDA 1B6QA 3FMAA 2C2EA 4FLXA 4FK5C 4J7KA 2YWVA 1GK9A 4ZOLF 3SPHA 1CKMA 2HDKA 4UVCA 3G6XA 4U7NA 1TWCA 4YIPA 2EILB 4YAJB 1KQSU 4NXMO 1J5EH 2Y0PA 2RDCA 2VR1A 5D8DA 4J7ZA 2KQXA 1EZVH 3HKBB 2JA5A 1Y6XA 4JI2O 1XMOH 3RYFA 4CE5A 3G6VA 3U9TA 4DR7H 2EIKC 1NBMG 5BMVB 4DV7O 5JQGA 4QIWA 2Y0SE 2FK1A 3N2GA 3RGZA 1RK5A 3QTCA 3HKCB 4OXSA 1AUVA 3CVZA 3L74H 2WB1E 2QTSA 1VQOV 5KG4A 3I56V 1NS1A 3K0GA 1GLVA 3ZIAG 2PMZE 1S10A 3T2MA 3PR4A 4J10A 1IXBA 1JA8A 1MABG 2CTRA 5LYJA 3BVOA 5FPRA 3K0DA 2Q7EA 1C30A 2W6PA 4I0XB 2BE3A 1H2KA 1WB8A 4QWDA 5KFFA 4JZ2A 4KHPO 1Q3EA 4J0MA 2R92A 1FFXB 4LF7B 3R5XA 3B8MA 3FKSG 4WFFA 4LF6B 4O4JA 1Y1VA 5IP7G 3VQWA 1VMGA 1FVIA 1VAJA 4NZOA 5KFCA 4QE7A 2A06H 4MVQA 5FLXN 2Z5UA 4LP8A 5DISC 4B3RB 4UUJC 1JLLB 4F6EA 4JI1H 4YR3A 1R6KA 1IURA 1QLEB 2QSAA 2QM7A 5KG6A 3AG1B 1A3GA 2QGNA 4X65H 2JGDB 4DR3H 4B3MH 3ZRVA 4JI6O 2XC9A 4QGPA 4HNTA 2UVWA 3E5NA 3H20A 2GQRA 3FFQA 4OX9B 5KFIA 1M6VA 3OMNB 4LC1A 4R8UA 5JH7F 3KCXA 4NYEA 2QA4V 3SR2C 4J9ZB 3UFXB 5BYAA 1NR7A 3K5LA 2JS3A 4X66O 5CN0A 4MV8A 1ORQC 4DK0A 5JCOA 2L35A 5KHHA 1XOUA 4EGJA 3OSPA 4GX2A 3ABLB 1O9HA 1CE8A 5BWUA 4LMYA 3SJAC 1S76D 3TXQA 1N36O 2ODTX 5EOYA 1I2KA 4JI4H 4FLVA 1ZAUA 1KKCA 2QR4A 3WB0A 1KYOF 3ZRWB 2IBKA 2QWQB 3MWMA 4J9YB 5B1OA 1Z2GA 4O81A 2LO1A 3AG3B 4XDLA 2Y0IA 3MWEA 4EB6A 3OGIB 4TM5A 3M8AA 4JI0H 3VMMA 1H2GA 4P9OA 2YW2A 1ENVA 5JQWA 4X64B 1CXZB 1JOYA 4NXMH 2QWOB 2FTKA 1HNZB 3ASNB 1OCZC 2HKOA 1CKNA 4QE9A 5ITZA 1CQIB 5LP6B 2LFSA 4Y8VB 4IR9A 1B06A 4O4IF 2XAHA 2R6FA 5IJ9A 1SETA 1E1QG 2Q0AA 1R73A 2QWRB 2VQDA 2C2DA 4EBDA 5FD5A 3JYCA 3RYIA 2JGUA 2DIKA 3OAAG 1URFA 5LGUA 1DAAA 1M0TA 2GTAA 1YITV 3K04A 4O4LA 5KFAA 5LMUO 4LR3A 2CGOA 2OT5A 3KYHC 3ZMSA 1NVPD 1NH2B 4L8JA 1I7FA 3X2QB 3STLC 4U3FH 2Q68A 1JXLA 2X7RB 4IL6Z 1HR0B 2UUAO 4IGGA 2P90A 1NI8A 3AK2A 3SI8A 2JEFA 1YTFB 5KFZA 5BY1A 2FPPB 5BXZA 3V4SA 5CB4A 4GT1A 1CEZA 3FYIB 4DR5B 3N2KA 4QW8A 5C3EG 3AG7A 3VNNA 1D5NA 3D8CA 1JR9A 4EEYA 1S0OA 2XTAA 1EZ1A 3LMLA 4J9QA 1S9FA 1SQQH 4ZI7F 2E76B 4JAVA 4JI6H 1OJHA 2X6AA 3T9BA 1YI2V 4BWSC 2CNQA 3CCEV 1K1SA 1DF4A 2DMXA 2HGXA 4GKKH 3GWOA 3V4ZA 3QZ8A 3T1HB 2AHZA 4DV1B 2UUCB 1SERA 4JF3A 4LFBB 3K5HA 3H0GA 3LDCA 1EKVA 4O2BB 1P49A 5E1AC 1EBOA 1WP7A 3SJBC 4ZHQA 4Q8FA 2HHHO 5LMNO 5EDWA 3EPGA 4DR6H 4YB8B 2KB1A 1GKFA 3OTOO 2KG7B 3BJYA 4LFCH 4JAUA 2C35B 2UXNA 2Z04A 2BQ3A 1VQ9V 1N56A 3HKZE 4LF4H 3MFHA 1TWAA 4FU0A 5IYZA 2DWCA 4APMA 4K6NA 1FJGB 1K92A 1K5SA 3RB4A 3TXSA 1IVSA 4K0KO 2DABA 2BOCC 4IWYA 3RYCA 4BY7G 3BY6A 3NBZB 5B5EZ 4ECTA 2ZDQA 4F6RA 5KHIA 2WA3A 2VUMA 1OV9A 3RFCA 2ZDHA 2EJ7A 3V6HA 4O2AB 4BBRG 4FZ1A 4FFOA 4MW8A 1ZUQA 2YI8A 3FB5C 2J9GA 1P84F 4J9SA 3THOA 3T5JA 2VWKA 4UV9A 1B04A 2R9RB 1M90W 1MZBA 1Z5VA 3HB3B 3FB8C 3QVNA 4JV5O 1F51A 5A2QW 1SKVA 2XT9A 5L1LA 4X20A 4RWUA 5LA6F 2R9IA 1MOFA 4PV1B 1N32B 4MV9A 1GSOA 3MFIA 3TQ1A 4RCNA 5LMUH 2YEVA 4ZOLB 5KX5F 5EWGA 3LNNA 1D2DA 3BCCH 1OHHG 5EIBC 1M56C 3K06A 1N48A 2E3CA 1HNWH 2VQEB 3HXLA 1NTMH 2ZE6A 4GKJO 3RUPA 1L0LH 5D1PA 1ZTEA 2O03A 2K9PA 2UUBH 3HKEA 3GTMA 4RUFA 4UFZA 2LQTA 4WBNF 2CW8A 1T3NA 1JVMA 1VF7A 4DR4B 3H1HH 2WYOA 3HBLA 1GN3A 2IU0A 3WG7B 1LR1A 1A0GA 3BRCA 1I94H 2ZDIA 2OWOA 3BQ1A 1G8MA 5KAIZ 1AJNA 2LGWA 4JASA 4NZNA 1S72V 2ZIMA 4LBEC 3SJCC 1PNMA 4DUZH 4TV9F 4JI5O 4KUMA 1R3LC 3PJSK 4O86A 2Q73A 3OHBA 2Q7HA 1VQMV 2DOSA 2YYAA 2UXBB 3E22B 1A9XA 2ITDC 2QKAA 1HNXH 2CFMA 3C0FB 1N0JA 5EZYF 3CQZA 5CMUA 3OTFA 1GN4A 4CKCA 4CC5A 3TW6A 3OE7G 4TQRA 5FNVA 1I2LA 3OTOH 2RDJA 2COJA 3AG4C 4CS4A 4QIWE 4FFBA 1Q90D 3IC7A 3LULA 5DGHA 4EBEA 1N34O 1W93A 1JIHA 2Y0SA 3PW5A 1TWFA 3A2FA 2R9AA 2WB1A 5J2TA 3I4NG 2GV9A 2EIKB 2PMZA 5BWVA 1XL6A 5GONA 3T1YO 1SA0B 3CMEV 2HGWA 3LQSA 1BGWA 4DR7B 2XCAA 4CHIA 5A2QN 4FJCC 1F23A 1AI5A 4JYAO 3AX6A 2BQRA 3OEEG 4JI3O 4QWBA 4DV0H 2F66C 4I4TA 4JV5H 3PFFA 3MR6A 4MVUA 3SPIA 3TIIA 3GV7B 4TUYF 3TK1A 5JJJB 4FM2A 3Q4HA 4CC6A 2HP8A 5H80A 2BTQB 1PNKA 3KG2A 5BR8B 4A2BA 3J80N 2R93G 2QM4A 1QBZA 2KSWA 5KMGA 2GPWA 3P3PA 4TVIA 2RCVA 1WCMG 1XL4A 2NUAB 4DRXB 3FYEB 4IIJF 3KCYA 3WNZA 1SESA 3SYCA 4GKJH 1SQVH 3ABMC 1IXMA 4CH5A 4LF5B 5KFVA 3FDSA 1IBLB 1PM9A 3T9DA 4JUZA 1E4GT 4X1YA 4YJ2F 2XOKG 5H2FZ 2CNUA 2R86A 4U7CA 5IJ0B 1TUBA 2CTPA 1Y4MA 1KP2A 3T5LA 2JA5G 1XREA 1ZSPA 1EHIA 3KXYT 3Q8RB 5CA0B 1AR5A 5I5UA 3SYQA 4JI5H 3FB7C 4F4XA 3SYPA 1BZKA 3F5TA 2LW7A 3QO8A 2NU9B 4FLZA 3W7UA 5LOVB 1I7NA 2YDEA 1JFFB 1GTOA 1Y74A 4QIWF 5JQGF 4YY3H 4DR1B 3NGDA 3WU2Z 4O4HA 4F4LA 3DTUB 5L3DA 3AK1A 1FXKA 2HVKC 2W0FC 5CA3A 4ZI7B 2R92G 5KT2A 5KS8A 5LYJF 4LF9H 1YJWV 2UXCH 2XAGA 5IWAH 2WLLA 5KFQA 3OM3B 4ECQA 1Z2OX 4DV4H 2NR5A 4YR0A 3H1LH 5KUMA 2RGVA 1OCZB 4ECRA 4NXMB 1EKPA 3ETJA 2DQ3A 2W6NA 2RQ6A 3B8NA 4O4JF 4PWQA 1P7GA 4JI2B 4Q44A 2FLLA 5JVDA 1VQNV 3ETHA 2Q7DA 1M9NA 4MTFA 4DV7B 1JMKC 2IJKA 2HIVA 1OCRC 1DK1A 1XMQH 3VA7A 4X9QA 2YXLA 3BFRA 1OCCB 4UVAA 2Z02A 5BWRA 2V4RA 3ZHSA 1US6A 1KC8W 3N6XA 2ATLA 4H13B 4X88A 1JQ0A 5KFLA 4DV5O 3GV8B 2WE6A 4JTCB 1RJQA 2AZ0A 3TW7A 2ITCC 2XIGA 2IM9A 3E8BA 5F2VO 4WFGA 1M57C 4GCZA 1MA1A 4Q20A 4KHPB 2ARHA 3SPCA 4FFMA 4HN2A 4FLYA 5D5PA 3KALA 2NU8B 2OYQA 4RUEA 5EBMC 1FYJA 1PV0A 3JCZA 5FL7G 4J9NA 4LFAO 1ZX3A 4FM1A 3PW4A 5K1XA 2ZCEA 1I50A 2MK3A 4A3MG 5DLGA 2JDIG 2CH7A 3CCUV 4YJ3A 3CPWU 4X1IA 1Q6UA 4DR2H 3B2EE 4A5UB 3T99A 4R8CA 2JA8G 4JI6B 3A8TA 1XHXA 3STZC 5KFUA 3H40A 3GB8B 1RYRA 3GTGA 3FAVA 4IHJB 4OPHA 5B1AC 1J5EO 4FMTA 3JAKA 3WO0A 1K4CC 2A3QA 5KX5B 4I55B 1UNNC 4N23A 4IWXA 1XMOO 2OTLV 3L70H 4ED7A 1S5HC 1W59A 1XNRH 1LNQA 1H2NA 3HKZA 5F9NA 4J9MA 4X66B 4O3SA 3T54A 2HJFC 1QHTA 3PZPA 3SNOA 4A3LG 3UT5A 1U97A 4ECVA 1L0NH 5LXTA 4X1KA 4OPAA 2X6BA 1N36B 4XYMB 1VQPV 3FKIA 2QB5A 3QQMA 4MTXA 4O7TA 5LL6b 3W5OA 4ED3A 5I5WA 1TA8A 1WJZA 4RUCA 4MV7A 4XYLB 4ED6A 5TISZ 5EWEA 4O4LF 2P7TC 5EBLC 1DGSA 2ALZA 3H3VH 2ILMA 2E2HA 2YU9A 1DIKA 1I5XA 4UVBA 4MAMA 4O84A 3L2PA 2GHYA 3N41B 3CCJV 4BY1G 4Q0YA 4JI1O 3HOWG 4LF8H 4IYIA 5EZYB 2ZINA 3KHRA 4FS2A 3I4MG 5CB4F 4ZQIA 4X65O 4DR3O 4B3SH 4B3MO 3HOUG 2X0LA 2FK3A 3K9SA 1OCOC 3ORRA 2UVRA 4B08A 4J41A 3TJTA 1H8HG 2B9ZA 1I3QA 4MS2A 3T9AA 3DF7A 1UC9A 3GJXB 5DM6V 2JEGA 1Y76A 3H0GG 1E4FT 4P30A 5D1OB 2LJ2A 5DMXA 4FBTA 1M56B 1ZHSA 5KT7A 2GUZA 3CSXA 2WLKA 3JARB 2AQ4A 1AUXA 4O3QA 1W0KG 5KFDA 4UCTA 3A0BZ 3IG0A 4A93G 3K5OA 1IBKO 4O3RA 2UUAB 5L3BA 5CBGA 4UV8A 3MJFA 4PDRA 3RYHB 2YIDA 4RB0A 4ZHQF 4JI4O 1VARA 1XNQO 5GTHZ 3SDLA 4LFAH 4GZRB 4DL5A 1I6UA 4L1KA 1LUVA 2GDSA 3RV4A 4YHHH 2WPDG 3HKBA 3DC6A 3IFXA 5IT9W 4JI0O 2HLDG 3T7AA 4IRKA 3CEIA 2HHFB 1SC5B 2I87A 5IYZF 3HKCA 1GN6A 2GBOA 1L8DA 2ZNJA 3T9CA 2PUSA 2UU9O 1Z2NX 3IGAC 2P0AA 1O75A 4QNHB 1RSOB 5KFYA 3PR5B 1A48A 3SE7A 4LWSB 2ZDIC 3JZ6A 4PDBA 1K5QA 2R72A 4DV6O 4I0XA 2ADPA 3D3QA 4JPRA 1DV2A 4IIJB 3T5KA 1NTKH 3RBEA 3K5NA 1DF5A 2IBZH 2HHHB 4H44B 3RVYA 5LMNB 5JUMA 1PL0A 5KG1A 1I5YA 5KG3A 5LGTA 3AG4B 2CQYA 3OTOB 4RAYA 4LSXA 4DL2A 5C8YB 5CA1B 4X62H 1RM1B 4HNVA 2WLJA 4I50A 1RJRA 3G8DA 4A3BG 4AHCA 3FD9A 4ETSA 2AGPA 5I5YA 5T14A 2OH2A 3M99B 4K0KB 3VQYA 1E79G 2JGDA 2RDIA 3RB0A 3T9FA 2N05A 4O7VA 1R1BA 1L2ZA 2JEXA 3GIMA 4DV2H 2F95B 3ZHRA 2DN9A 2F93B 4M7EA 4QPJA 1RFYA 3CCRV 5KFHA 2E2IA 2C22A 2X5RA 1ZETA 1SQGA 1M7JA 1V55C 2K1EA 3MD0A 2R7KA 3GTLA 4J9KA 3J81W 5CBFA 5JQGB 2QE7G 4F50A 3DSQA 2W8LA 2QKCA 1CPYA 4GKKO 3VOUA 1S97A 3H1JH 5LYJB 2FB5A 2A1HA 5J2UA 3R5FA 5KG0A 3G6BA 3ZRWA 3OW2U 1Q43A 1Y67A 2Q8VA 2B63A 3PN1A 3GDEA 2LP7A 1WH2A 3K5MA 3ABMB 4U6PA 1GM9A 5B1NA 1BNCA 1IBKH 2JK5C 2CGNA 4DYLA 3IAYA 4DR6O 4B3TH 4O4JB 4LFCO 4GKJB 5IT9N 4MW3A 3TY9A 2NVXA 3UZBA 1ZL8B 4DQNA 1XNQH 2FL4A 4MV4A 2EIYA 5KT3A 1EUDB 2PY5A 1YXBA 5FNVF 4LF4O 2RGRA 3SJQC 4RU9A 4F4YA 3U10A 5KFPA 4GX0A 2WAMA 5LP6A 1VQ7V 4BW9A 2F43G 2GQSA 3ORQA 1VBHA 2WLMA 5DGAA 3S24A 4ED0A 2C28A 2UU9H 3W7WA 4YQWA 4JI5B 5J9PC 3N40P 4DL4A 3AW8A 2IJJA 4DUYO 2EJRA 4RO2A 4R8UB 3R23A 2CK3G 5J2TF 5DEDA 2E5LH 4DV6H 2YIBA 2XCLA 5KFWA 3CS5A 3MR5A 5GONF 5BWWA 3M9MB 4FBUA 4P9PA 2CKZB 5IYCO 3K79A 1VP7A 3VPCA 3M7MX 3ETDA 3MR3A 4BAYA 2R84A 2R8GA 3CCSV 2UXXA 3GVMA 3TETA 4KFMA 2FMAA 5LHIA 4A3IG 4TSFG 5L3GA 2XAJA 4I4TF 3JD2A 3F8NA 3LP8A 3J7AK 1SF9A 4EB6B 1N34B 2W9AA 1FXKC 4D7SA 4GUNA 5KLVH 1HNWO 3MWDA 1H38A 3UKMA 2UXDH 4O7WA 1AP6A 3J81N 4M9UA 1QR8A 1FS0G 1T5EA 4PDMA 4R7CA 2UUBO 1OCRB 3A0RA 1KUTA 1AVMA 3T1YB 3GTOA 1XI1A 3CRCA 1EKFA 1CKNB 5ITZB 3DC5A 1KJJA 4AQYH 4JYAB 2YIAA 3P32A 2F4VO 5DGIA 2J6SA 1VKZA 1I94O 1YJNV 3W7SA 1I08A 3ASOB 4JI3B 4FFPA 5IJ9B 4B7EA 4P2ZA 3ZRXA 4DUZO 2JA7A 3ZJZA 2KG7A 1M57B 2DW4A 3RBDA 4JYCA 2YS6A 2VQFB 4O4LB 4PELA 2PYJA 3U55A 2XAFA 4FLUA 1HNXO 3HO8A 1SCUB 1WB7A 1V51A 4MVRA 3KAKA 2JRIA 3GQCA 4PDVA 3HKDB 1EN4A 2HJWA 3GIKA 2DJVA 3JZFA 5CB4B 1SRYA 3ZEDA 3SGIA 4PZ7A 1AR4A 1R6TA 2ZIOA 4MTGA 4GC6A 2BSKA 4O4HF 1Q81W 2EJ2A 1OWTA 4O2AA 1F4MA 4AILC 3JAWB 1IZ3A 5B1AB 4I7HA 4XDJA 2VA2A 4EFBA 2JIZG 1KUQA 5C1PA 4EFEA 1S0MA 5A9GA 4HNAB 1ZWIC 4K35A 4RQEA 3DTGA 5I5TA 1PPJH 2W6QA 3RT3C 4DUYH 4ZIBA 5KHGA 4AI8A 3E86A 5K3WA 2V1DA 3UO2A 4F4WA 3GIQA 1GO3E 5JVDF 2HEPA 3T4ZA 1B6RA 4ED8A 3EHBB 4U3JB 4DV0O 4N21A 2XCPA 1NU1H 4EEQA 4DV3H 1D5AA 2H3OA 3MDSA 1P8LA 3R9RA 2YIBD 1ZQ7A 4ICGA 3L75H 4K3AA 3ICXA 2C2AA 5IYZB 1SS3A 5KFNA 3GILA 1HW7A 2DYSC 3H9VA 4ABMA 1AP5A 5IYDO 3CCQV 2AHYA 2R7MA 4TQFA 1WAZA 3T1CA 1YTFD 2ZE8A 4QW9A 2W57A 1IBMH 4EBCA 3F5WC 3Q8SB 2WLIB 4MA0A 2VOBA 3VPDA 5EC1C 1HWYA 2AW9A 4F6RB 3UZOA 3JALA 4OX9O 3H1IH 2P4VA 2R8IA 4YIOA 2HVSA 3G6YA 1OCOB 4NXNH 3KAJA 5LGNA 4PJ0Z 3SPJA 1BE3H 4J9PA 2AZ2A 3ETQA 3HB9A 3NC0B 2F4VH 5B3SC 2R7ZG 4YJ3F 3ZRSA 4FGRA 2W6ZA 3OGCC 4DAAA 1X4TA 1NR1A 2HVJC 3CMAV 1MMMA 3LNMB 2CNVA 3LDEA 4DV5B 2IU3A 1KJ8A 2QWPB 1XDCA 1SQBH 2N74A 4UB6Z 2FB9A 2YRWA 2JA6A 2Y4TA 3JD0A 1YVWA 5C1OA 3WFVA 5IYCG 3OFNG 2YS8A 1WR2A 1XK5A 2PN1A 5CM0A 2YEVB 4PA6A 1XQ8A 2XUMA 2ABJA 3FKIG 2ZM6H 3FX7A 2BR0A 3RW0A 1VF6A 2PZSA 4DW1A 3KHLA 4YY3O 2GLTA 1FPOA 2B1GA 4ED1A 2X6CA 4WFEA 1KB9F 2WAQE 4MVOA 5DG9A 1Q7YW 5LXTF 3HKEB 2Q2UA 2VPQA 5L1JA 1XILA 1SA0A 2GSMB 2QJ1A 3BA8A 4LF9O 3KZIZ 2UXCO 5IWAO 4PZ8A 4D6TH 2QF7A 1OZ0A 2QKSA 4DV4O 3ABTA 5JH7B 3F7VC 4CS2A 3ZMVA 2W0XA 1J5EB 5KT5A 4G2KA 3KHGA 1FFTB 5E79Z 1XMOB 4HQ6A 5FLMG 2Q69A 5F9LA 4JYBA 4HNUA 3GIDA 3Q8PB 4QPKA 1XMQO 2XASA 1GN2A 3JD1A 4UCUA 3JAMW 4C7UA 4YXWG 3JASA 4Q45A 3RGXA 2Y4UA 4FFLA 1Q5OA 4DRXA 5FNVB 4LF7H 4LF6H 4GYCB 3JCUZ 4FS1A 3L73H 3GIPA 5AG2A 4YP3A 5CAEB 1K7DA 4B3RH 4FFBB 4CH4A 1ZHQA 1BS3A 2DZDA 3ZMUA 4PI2A 4RZQA 5IJ0A 1PP9H 3KREA 3D3IA 2RNBA 4IRDA 3HR0A 1V55B 5J2TB 4Q4DA 4FIPC 1V54C 5CA0A 1AI4A 4HYKA 5C5JA 4OX9H 4JTDB 4JI1B 4DL3A 1BMFG 2Y48A 3PW2A 4O4IB 3ML0A 4DR2O 2UUCO 4J11A 4X65B 4DR3B 4O3PA 4B3MB 4JI7O 4QWCA 4CKEA 5KFBA 4G28B 3P30A 4D7TA 5LOVA 1GAXA 2IH1C 1JFFA 2Q0OC 4J7JA 1P7BA 1RK6A 3ETGA 1XDNA 3Q4HB 4A2AA 2Z3YA 1XNRO 2KSDA 5KFMA 3UCSC 3SYAA 3TEKA 5KMGB 5B66Z 1IBKB 4QWEA 2XHBA 3JRWA 4CZZA 2COIA 1TUEB 1GM7A 4JI4B 3G71V 1XNQB 2W6OA 1SYXB 2W9BA 2ZKOA 2W9CA 4XDKA 4X64H 5IYDG 3JZIA 3H4BA 3CX5F 5JCOC 2W7PA 3C90A 3UYYA 3BHPA 1NT2B 1UFIA 1TWGA 2AGAA 2YC0A 3ZMZA 4JI0B 1Y1VG 3BPZA 4HBNA 1HNZH 4FFKA 5KHKA 4I50F 3PO2G 1WSCA 3GTQA 2JJ1G 4Q43A 2R8JA 2QWNB 2B1IA 2ZT9B 1G1XB 2UU9B 1M0WA 4OGQB 3K08A 3EVKA 4LSAA 1A0IA 3JAMN 1SEIA 3ZX6A 3ZMTA 4RAIA 1MZFA 5CBHA 4DV6B 4LF8O 3TY5A 4B3SO 1PX2A 2HVRA 5BWTA 2VS0A 2VRZA 2PGGA 1Y74B 3K3WA 3G80A 1HR0H 1K73W 4O4HB 1EN6A 2XAQA 4DW0A 1K83A 2B63G 3X2QC 1JKJB 2R8KA 1FXKB 2N04A 4QSHA 4DL6A 5KT6A 3JRXA 4DIMA 3JATA 5HV6A 4XZ3B 4NVPA 5J2UF 4J9LA 4A3EG 2EJ0A 2WLLB 5I5VA 2IJHA 2OCHA 4LH7A 3CRAA 3MR2A 1S03G 4EG0A 4ECSA 4UB8Z 2WSSG 4U7OA 1BSMA 2W6IG 2YZNA 3E8HA 4IHJA 2HIXA 3VQVA 4YHHO 3CJHB 2CUGA 1MZEA 1S5LZ 1WA8B 4I55A 5JVDB 5L1IA 3QG5A 2PI5A 5KFTA 1S5JA 1BHAA 2UUCH 4DV1H 3Q1KA 4C5AA 1I0HA 4JI7H 3M9NB 2HVQA 4LFBH 4YAKB 2OCCC 1F7YA 4EYIB 3PVXA 1W2BU 3ZHVA 5LP6F 4NZMA 4GKKB 3ZBHA 5LA6B 4I7ZB 2ASJA 2DPIA 1KT8A 1BGYH 5EYPB 2YXYA 5KFXA 1NTZH 3JD4A 2V5AA 4DRFA 3U0ZA 2Q6AA 1VQ8V 4ASUG 3E8FA 1GYFA 2L6LA 1FKAH 2JJ2G 1JDEA 3EYYA 4TWKA 3G8CA 1EM1A 4FFNA 2W6JG 1TVKB 1A32A 1AI6A 3UO3A 4NTWA 1LUWA 4DR6B 1Z2PX 3QFFA 2Q9LA 4QJFB 3OUZA 3KHHA 4LFCB 1MSDA 5L3FA 3MHSC 2YXHA 4WBNB 4X62O 3BQ2A 3H1KH 2PI4A 4A3GG 4LF4B 1R6NA 2P22C 2CH7B 3Q2OA 3CSWA 4K8XA 4X1IB 4GC7A 4NR1A 1G2WA 4GLWA 4TV9B 3OUUA 4LNUA 3OMIB 1Y66A 1VBGA 2ZXWC 4DV2O 2AGQA 2XGQA 5FPOA 1IYDA 4R6ZA 4CH6A 3JAKB 5KA5A 4NB5A 2CE4A 1Q82W 4FVMA 1E4EB 2A9HA 4BR6A 5KHJA 1UC8A 1NQTA 3QO7A 1N32H 2OIEA 2Q4PA 2JA7G 1Q86W 3UT5B 1VF5B 2C00A 2EX3A 3DXRA 4Z1VA 5KFKA 4X1KB 4Q6GA 3RYHA 4FZ0A 1YJ9V 4XX0B 1CKOA 2VQEH 2DYSB 3CD6V 1G6UA 4MV3A 3W1BA 4TV8A 1VQ6V 5IY5C 5IDJA 1OBGA 5K2MA 5LMUB 1IBLO 4UXNA 4HYOA 4HR7A 5E25A 2DAAA 4DR4H 1HNWB 4B3TO 3ZN1A 1WRVA 2Q2TA 2WDTA 1BT8A 4E4TA 3T9EA 5L9XA 1M93A 3U11A 4MVMA 3RGBA 4DO2A 4ZKIA 2UUBB 1BHBA 1AB3A 1RSOA 2W8KA 1FXHA 4LWSA 5B3SB 3BG5A 2G38A 3OUSA 3NBYB 4FPPA 2I80A 4LH6A 1KD1W 2P06A 5EBWC 4A3CG 5BMVA 2F4VB 2JS5A 1I94B 3CE2A 2UXBH 1WPXA 1AROP 1PL4A 4RNNA 3N6RA 4TUYB 1Y1WA 4O2AF 3T4DA 2P5OA 2VUMG 4DUZB 2CW7A 3GIJA 1I1MA 2R93A 4ECUA 4IRCA 5C8YA 2M7WA 5CA1A 4MV6A 2DQ0A 3ZHQA 4RB3C 5I47A 1WCMA 4C5CA 5DG7A 3EXAA 3NR7A 1I1KA 2E5LO 2WAQA 4JYYA 5H6RA 1HNXB 3LWBA 4O3NA 4MVSA 5DN6G 5LL6Y 3BACA 1W0JG 2IMWP 2P67A 2ZR3A 1FFXA 3S3WA 3A0HZ 3N43B 3HOXG 2Q5ZA 1VQLV 5HNEA 4YJ2B 5IYBO 5FR9A 4Q8EA 1VF6C 3JSLA 2YICA 5GTIZ 4MT8A 4EYHB 4RUAA 2J6UA 5KAFZ 2YZLA 1QCEA 3CP1A 3AYHB 2IP4A 1KP3A 3E89A 1BCCH 4E6NA 2UXDO 5LHGA 5C4XG 1C3OA 2HFEC 1T36A 4PBCA 5DQHA 3W7TA 1UJWB 1KBHA 3ZCCA 2XD4A 1H2MA 3RYFB 3S3XA 5KG5A 4AQYO 1CP9A 2OLSA 3ABKC 2CTWA 5BR8H 3N2GB 4DV0B 5LBQA 2IA6A 2JA6G 1ZLZA 2QM8A 2PF4E 2EIMC 4JV5B 1KJQA 2AGOA 1NVPB 2J6TA 4KL1A 4G3IA 2NU6B 3L71H 1JX9A 2A0LA 2QDOA 1ZL8A 1KEEA 1SZXA 5EIBD 1MG1A 4I50B 1RPOA 1CQJB 4O83A 4LF5H 1N33O 5FD6A 3AK3A 1J95A 1IBLH 4ED2A 5KFRA 3UM7A 1V54B 3CRQA 1AJPA 4IT5A 3RIZA 2D3OW 1PK8A 2FKLA 4WF9V 4C2MA 3CB2A 1V9PA 2Y69C 3L4JA 4FLWA 5H6QA 3J7AU 2EZOA 3B77A 2W70A 2B5UA 1QNMA 2YS7A 3K3PA 4NYKA 1DLBA 4TT3G 4G27B 3BQ0A 1EFRG 5DG8A 5JVLA 2RF4A 4RQFA 2YCHA 5B1BC 3H01A 5EC2C 3QWUA 2DYRC 3HOVG 2VPSA 1GMGA 1GM8A 2Q67A 1DV1A 1JCHA 4M0JA 4PD4F 2Z0AA 5I5SA 4FFRA 5DQIA 2XNDG 4ME6A 3LUTB 4DR1H 5GW7A 5J2UB 5HFLA 4EGQA 2BCCH 3TCUA 3N8DA 1O9GA 3CRRA 1PKXA 4I9QA 5KG7A 2HJDA 4TQSA 4YBZB 4PA4A 4YY3B 4E4EA 2UVVA 4DV3O 1B6SA 2ZE5A 1FXVA 2FK2A 1VS0A 4BIOA 2V58A 3SYOA 3L72H 3OD4A 4Z2WA 4LF9B 5K1PA 1BQZA 1VQKV 2UXCB 4UUGA 5IWAB 4JI2H 1VIBA 1K97A 3LSUA 3WWIA 4PDLA 4O7ZA 4DV4B 4DV7H 2H94A 1IBMO 4K8ZA 2NVYA 3BABA 1KJ9A 3L4KA 1IDSA 4L87A 3E35A 5I5XA 3O65A 3M9OB 3IJ4A 5D5QA 2EIJC 4JI8O 2M05A 1M1KW 2ODMA 3GIIA 3OT7A 3PO3G 2ASLA 1OCCC 1R3KC 4BIUA 4NXNO 1X9NA 3I55V 4O82A 5CA0F 1XMQB 4JV1A 4IAJA 3PW0A 4O2BA 3RF2A 1OBDA 1I7LA 1BL8A 1Q6HA 1SZTA 4HAMA 4LCUC 2R85A 4KHPH 1BQ0A 5C93A 3HKDA 4AYBE 2VUGA 2ZGIA 3WWJA 3APOA 1YDXA 3RYIB 3DAAA 4FM0A 1GRJA 5LOVF 2PYLA 1X59A 1N33H 2W6MA 4Q4CA 2VWJA 5DECA 4BXXG 2DWEC 1Q6IA 2ZM6O 1TGOA 3JAWA 5IYBG 1S77D 3K03A 3N27A 2P4KA 1TAEA 2EINC 3RFRA 1CS0A 4CBCA 4HNAA 3RV3A 4R50A 4CKBA 4ECYA 5DGBA 1GGOA 3N2KB 2JEIA 1F4NA 2OCCB 1JDBB 4DR2B 3QF7A 3LDDA 4JI7B 3KKYA 2EZPA 3UQ8A 5CE8A 2ZD9A 4X66H 4U3JA 2HR3A 1RYSA 4HZ3A 3SPGA 4PZ6A 2BTOA 4RNMA 4JTAB 4EQ5A 1N36H 5BYBA 3LSQA 3F7YC 1XNRB 1H2LA 5KFJA 3CCVV 4TOIA 1MNGA 2CDYA 1WP8A 1W96A 3U9SA 4CH3A 2MW2B 2R8HA 3ABUA 2NN4A 4ZOLA 3MHHC 5EK0A 4ZHQB 4FLTA 4FE2A 4BBSG 1EZJA 1WLEA 2LGQA 1V4YA 3CXCU 3Q8QB 1BXRA 4LF7O 4WFBV 3D36A 2RMKB 2WLIA 4LF6O 1R9TA 2ZR2A 2GPSA 2QEXV 4JV2A 4PA9A 1AR1B 3TQTA 2YSUB 4B7KA 3W1GA 2P6JA 5L3EA 4O7SA 3IC9A 3RWRD 1NH2D 2BSKB 4WFHA 4I9WA 3RN4A 4B3RO 1VEWA 1ULZA 3TIGA 2DWDC 2ZXWB 4I5SA 3AEIA 1IYEA 4C5BA 5KKNB 2F23A 3RYCB 4MSWC 2BOBC 4JZGA 1THZA 3R5HA 2R7NA 3CYOA 2W7OA 4JI8H 4LF8B 3CXHF 4NTXA 4CS3A 2UVUA 4B3SB 4IHJF 1R3IC 3MAQA 3I12A 1KBLA 3E22A 4I55F 1B3QA 1AJQA 5IY5B 2SCUB 4DL7A 2PVPA 2NNUA 2UUAH 1PNLA 1XBLA 3WWHA 2V4DA 3J80W 4RB2C 3EFFK 2WTFA 3AG2C 4X20B 4Z1MG 1ROPA 2YI9A 3CCMV 4XBFA 5LHHA 3GTKA 1N0NA 3B09A 3CC4V 3WB2A 4UCRA 1M4UA 4RB1A 4J42A 3U0GA 4MTOA 5IP9G 4JGSA 1N8RW 5JH7A 1P4RA 2Y4RA 1YHQV 4LFAB 2W71A 4X64O 1IX9A 5KUKA 3JALB 4YHHB 3JD3A 1VQ5V 3L9DA 1HNZO 1YZBA 2EILC 2YUAA 3K9AA 4F4ZA 3ETEA 4GX1A 2R82A 1RPRA 4J80A 2YL2A 1YCIA 5KG2A 2HHHH 5LMNH 1B33N 1H2SB 3NXSA 1GO3F 4UCSA 5C44G 2WLHA 3G6EV 2JEUA 4FM9A 2BTQA 2CTQA 5JJEB 1RM1C 3CWBH 4K0KH 2IH3C 2COGA 1QR9A 5DQGA 2H8PC 4X62B 1HR0O 3K59A 3VOTA 4O3OA 3ZHUA 5DAAA 1NKDA 1RJPA 4DR5O 2A7WA 3GB7C 1M5IA 1SQPH 4O4IA 3EPIA 4H0LB 4DXWA 3NUAA 1YF2A 2ZNIA 1VQ4V 4TV8F 3VQXA 2C2RA 2F1MA 3C3TA 4UCOA 4DV2B 3K58A 5H9CA 2ETNA 1QLEC 1UPGA 1U96A 2CZGA 3AG1C 3TGUH 2QYZA 4MV1A 3H4DA 3QZ7A 3RR5A 2EBOA 3ABKB 4E2LA 5GONB 5DLFA 1EUCB 3T1HO 3VPBA 4DV1O 2NU7B 2EIMB 1Y1WG 2VQFO 2FPGB 3CRMA 3RAQA 4QWAA 2O57A 2EJ3A 4LFBO 5KFSA 2FKXA 3APQA 2V4QA 3JASB 2FLNA 4O7NA 4ECWA 5BMVF 3OMAB 3HT5A 4I4TB 4JV0A 1EYZA 2IW5A 3O9OA 4MA5A 2JVDA 1JJ2U 3U54A 1WNSA 1TWHA 2I8CA 2NLJC 3M4IA 3ZHTA 5BPHA 3G67A 5HBRB 2WLNA 5EWFA 1IOVA 1GH6A 4BIZA 1RP3B 3ABLC 4ZI7A 3K57A 1K8AW 1FKAO 5C8YF 5CA1F 3RAXA 1K34A 2Y69B 2FYUH 2ATKC 3HPLC 3BAAA 1K1QA 1FJGO 2WA4A 4B3TB 1T94A 3DGEA 2DE0X 3K5IA 3CC2V 3AG3C 2FJZA 4DLKA 3WO1A 4BW5A 3HOZG 3TINA 5B1BB 4W4KA 5I60A 2DYRB 4A3DG 4X1YB 1JPXA 2ZQMA 3RBZA 2V59A 3QNEA 1TUBB 4EKWA 4WFAV 2PTMA 2IJIA 1WN7A 3ASNC 4O7YA 4X8AA 1N4CA 5KFEA 5LP6C 2AXTZ 4R7RA 3V6KA 1YEWA 3CC7V 3T5HA 2E5LB 1S3JA 1XEQA 1KC7A 4H33A 4KXRA 5HFMA 1E1RG 1FD9A 5KFGA 1N32O 3LSSA 4MTDA 2FP4B 1N34H 3N42B 1XHZA 1P16A 5JJNB 4W4LA 3N44B 2VQEO 2W9BB 2JEJA 2W9CB 1MSWD 2AU0A 4RNOA 3DTFA 3E8GA 4GX5A 3KTMA 3GWKC 1SFOA 3CJHA 4DR5H 1WA8A 1QVGU 2QK4A 2ZDGA 5KFOA 3T1YH 3ZS8C 2XGPA 4H37A 4DR4O 4J9OA 2EIJB 3ZN0A 1KJIA 2UXDB 2YZMA 1PD3A 4WCEV 3E83A 3CEBA 4JYAH 1K33A 1JJOA 5BPFA 4JI3H 2ADQB 4IZOA 1YSCA 4RZRA 4AYBA 5LA6A 5L1KA 5EYPA 2DLNA 4O7LA 3ASOC 3G4SV 5KX5A 4UCVA 5H5NA 1K9MW 4AQYB 2E74B 3T1HH 3K3VA 1HDJA 1K3EA 2VQFH 3CHXA 2UXBO 3V6JA 2X0SA 1TVKA 1G4YB 4QJFA 4PHZA 1S0NA 4IR1A 2WWWA 4TQDA 4WBNA 4PI0A 1QQCA 3FB6C 2MCTA 5BZBA 2E75B 4ZBMA 2DPJA 1N33B 2FE3A 3BEHA 3RB6A 2EINB 3JATB 4GLXA 1YIJV 3OEHG 2R70A 2ZJTA 1Z5WA 1FJGH 4TV9A 2V9WA 3P3NA 3BA9A 2CAZC 5KA6A 2LFRA 2HG8A 1I1LA 1KU9A 2OIGA 4NTYA 4X89A 2R7ZA 2EULA 2YZGA 5JWPA 1FAFA 5L3CA 3OHAA 5EZYA 2Q7GA 3QO5A 4YJ3B 3JSNA 3CCLV 1E4EA 4PA7A 4DR7O 4NLGA 3R65A 1AI7A 2RJZA 2FPIB 4KP4A 4J9RA 1SQFA 1BJTA 1GSHA 1KTAA 2QTOA 1XUQA 3FAVB 4DUYB 3PW7A 2V7QG 4CMFA 5BWXA 1NJIW 1KMIZ 1HP8A 3OR7C 5D1OA 4ECZA 3IN5A 1K4DC 3GLKA 3TY8A 2RN9A 4NKGB 3JARA 5BR8O 3OSNA 2FMLA 1KECA 1L1FA 1ET0A 2HGSA 4DK1A 3C3SA 3OR6C 2PBZA 2FLPA 4MTEA 4DV3B 1QVFU 3OUFA 5LXTB 5IE9A 2OTJV 2YRXA 4O2BF 5KT4A 3B40A 4A3JG 1S68A 1H8EG 4BWAA 4JXUA 1QU7A 3E2EA 2VA3A 4LF5O 1SQXH 2A79B 3D36C 1QLNA 4ECXA 1NZ6A
chains in the Genus database with same CATH topology
5LOVB 4F6RB 3JALA 4RAZA 1IBMB 1JFFB 1WPBA 3RTXA 4YY3H 5FLXW 4LNUB 1O9GA 4DR1B 4I9QA 2HVSA 4O4HA 4TUYA 4NXNH 3KAJA 3RJ0A 4JI8B 4YY3B 4ZI7B 3ETQA 3NC0B 2F4VH 4DV5H 4NXNB 4LF9H 2UXCH 1VS0A 5IWAH 1X4TA 1AN7A 3WB1A 4IIJA 1Z2OX 4DV5B 4DV4H 4LF9B 5K1PA 2UXCB 5IWAB 4JI2H 2RGVA 4NXMB 1XK5A 4DV4B 4DV7H 2RQ6A 4JI2B 1Q8IA 5JVDA 4K8ZA 1XQ8A 4YJ2A 3BABA 2ZM6H 2KKWA 4TV8B 3L4KA 4DV7B 1JMKC 2PZSA 2HIVA 1XMQH 5D5QA 2YXLA 2ZM6B 1X9NA 3FMAA 1XMQB 4FLXA 3HKEB 4IAJA 2Q2UA 3N6XA 4O2BA 3RF2A 1SA0A 2QJ1A 3BA8A 1CKMA 2WE6A 4KHPH 4PZ8A 3HKDA 2XIGA 2VUGA 1J5EH 2IM9A 3RYIB 4FM0A 3HKBB 5JH7B 4KHPB 4CS2A 1XMOH 3RYFA 4FLYA 5D5PA 2PYLA 3KALA 2OYQA 1J5EB 4DR7H 5BMVB 5JQGA 1N33H 3N2GA 3RGZA 2VWJA 3QTCA 3HKCB 1XMOB 3CVZA 1TGOA 3JAWA 4FM1A 5K1XA 2ZCEA 1TAEA 4UCUA 3RFRA 3JAMW 5LYJA 4HNAA 4YJ3A 4X1IA 5FPRA 3JASA 2Q7EA 4DR2H 3B2EE 3RGXA 4JI6B 1Q5OA 4DRXA 3N2KB 5FNVB 1XHXA 4LF7H 4LF6H 4DR2B 3QF7A 4GYCB 4JI7B 1Q3EA 3GB8B 4J0MA 1FFXB 4IHJB 4LF7B 4LF6B 4O4JA 3UQ8A 3JAKA 3VQWA 4FFBB 4CH4A 1FVIA 4X66H 5KX5B 4I55B 4B3RH 4U3JA 1ZHQA 1XNRH 4PI2A 2BTOA 4PZ6A 5IJ0A 4RZQA 5DISC 4B3RB 4X66B 4JI1H 4EQ5A 1N36H 1QHTA 5J2TB 3UT5A 1XNRB 5CA0A 4X65H 4TOIA 4DR3H 5LXTA 4B3MH 4OX9H 4X1KA 4JI1B 1N36B 4CH3A 4ZOLA 4O4IB 4ZHQB 4FLTA 3H20A 4X65B 3FFQA 4DR3B 4B3MB 4OX9B 5LL6b 3W5OA 1TA8A 4D7TA 4MV7A 5LOVA 3SR2C 1JFFA 3W1GA 1DGSA 3RWRD 3K5LA 1XDNA 4DK0A 5JCOA 5KHHA 3N41B 4A2AA 3L2PA 1O9HA 4LMYA 3SJAC 3RYCB 4Q0YA 5EOYA 4JI4H 5KMGB 4FLVA 5EZYB 1ZAUA 1IBKB 4LF8H 2ZINA 3WB0A 2XHBA 3MWMA 4B3SH 4JI8H 4JI4B 4LF8B 1XNQB 1SYXB 4EB6A 4B08A 4X64H 4JI0H 4CS3A 5JCOC 4B3SB 3MAQA 3DF7A 3BHPA 1NT2B 3GJXB 3E22A 4X64B 1E4FT 4JI0B 5D1OB 3BPZA 4HBNA 1HNZH 5KHKA 1ZHSA 2UUAH 4NXMH 3CSXA 2V4DA 3JARB 3J80W 4RB2C 1M0WA 2UU9B 4UCTA 1HNZB 3IG0A 4X20B 3K5OA 1CKNA 4LSAA 5ITZA 2YI9A 5LP6B 2UUAB 1A0IA 1SEIA 3RYHB 4RB0A 3WB2A 4UCRA 4DV6B 3TY5A 1M4UA 5IJ9A 4LFAH 4RB1A 2Q0AA 5FD5A 1I6UA 4YHHH 3RYIA 2JGUA 2HVRA 3HKBA 5JH7A 5IT9W 4LFAB 1M0TA 2PGGA 3JALB 4YHHB 4O4LA 1HR0H 4LR3A 4O4HB 3HKCA 1L8DA 2ZNJA 3KYHC 4L8JA 1I7FA 2PUSA 1Z2NX 1O75A 1HR0B 3JATA 4NVPA 4PDBA 2R72A 2HHHH 5LMNH 5CB4A 1H2SB 4DR5B 3N2KA 4LH7A 4IIJB 4UCSA 1S03G 3K5NA 3VNNA 2HHHB 5LMNB 4FM9A 3LMLA 4IHJA 2BTQA 4RAYA 3OTOB 4LSXA 2HIXA 3VQVA 5C8YB 5JJEB 4JI6H 5CA1B 4X62H 4I55A 5JVDB 3QG5A 1S5JA 4BWSC 4I50A 4DV1H 2UUCH 4K0KH 4AHCA 4JI7H 4ETSA 4GKKH 4X62B 2HVQA 4LFBH 3K59A 3T1HB 2UUCB 4DV1B 4K0KB 3VQYA 4GKKB 5LA6B 4LFBB 1L2ZA 4O2BB 1P49A 5EYPB 3SJBC 1M5IA 4O4IA 4ZHQA 4DV2H 2F95B 3U0ZA 2ZNIA 4DRFA 3VQXA 2F93B 4M7EA 4DR6H 1GYFA 1FKAH 2F1MA 3EYYA 4LFCH 4UCOA 4DV2B 3K58A 1SQGA 1TVKB 1Z2PX 4DR6B 3J81W 4LFCB 5JQGB 4LF4H 3RR5A 5IYZA 5GONB 4WBNB 4APMA 1FJGB 3DSQA 4LF4B 3RYCA 2P22C 3NBZB 5LYJB 4K8XA 5J2UA 4X1IB 3JASB 4F6RA 1Q43A 5KHIA 4I4TB 4TV9B 3PN1A 4LNUA 3GDEA 1WH2A 3K5MA 2JVDA 1WNSA 3M4IA 4O2AB 5FPOA 1IBKH 3IAYA 4B3TH 3K57A 2YI8A 4CH6A 4ZI7A 4O4JB 3JAKB 4GKJB 3THOA 3TY9A 2VWKA 1XNQH 3BAAA 1B04A 4FVMA 4B3TB 1MZBA 1Z5VA 5KHJA 2PY5A 5A2QW 1N32H 1SKVA 2RGRA 3U10A 4X20A 3UT5B 5LP6A 2EX3A 1N32B 4MV9A 4X1KB 4Q6GA 3RYHA 4BW9A 1CKOA 2VQEH 5LMUH 4ZOLB 1G6UA 3W1BA 3S24A 3LNNA 4TV8A 4X1YB 2UU9H 4JI5B 5EIBC 3N40P 1HNWH 2E3CA 2VQEB 5LMUB 3HXLA 1TUBB 2PTMA 5D1PA 1WN7A 2E5LH 4DV6H 4DR4H 2YIBA 1HNWB 2O03A 5LP6C 2UUBH 4R7RA 3HKEA 2WDTA 2Q2TA 4UFZA 1YEWA 2CW8A 1M93A 3U11A 2E5LB 1VF7A 4DR4B 3RGBA 2UUBB 2WYOA 3M7MX 1RSOA 3NBYB 3BRCA 1I94H 2OWOA 4MTDA 4LH6A 1N34H 2ZIMA 3SJCC 3N42B 4DUZH 5BMVA 2F4VB 1XHZA 1P16A 2JS5A 5JJNB 1I94B 3F8NA 2UXBH 3N44B 3J7AK 4EB6B 1N34B 4TUYB 2P5OA 4DUZB 2CW7A 2Q7HA 4D7SA 5C8YA 2UXBB 5CA1A 4DR5H 3E22B 4RB3C 1HNXH 2CFMA 3C0FB 2UXDH 3T1YH 3OTFA 3ZS8C 4CC5A 1T5EA 5FNVA 1HNXB 4JYAH 2UXDB 3T1YB 3OTOH 1JJOA 1XI1A 4JI3H 1CKNB 5ITZB 5LA6A 1FFXA 4AQYH 4JYAB 2YIAA 5EYPA 3N43B 4CS4A 4FFBA 4JI3B 5KX5A 4UCVA 5IJ9B 4YJ2B 4AQYB 3T1HH 3K3VA 3JSLA 2VQFH 3CHXA 3A2FA 2R9AA 1TVKA 5J2TA 4PHZA 2VQFB 2GV9A 4O4LB 2PYJA 4TQDA 5GONA 4WBNA 4PI0A 4FLUA 1QQCA 4E6NA 1SA0B 1BGWA 2MCTA 4DR7B 3KAKA 1N33B 2FE3A 3HKDB 3JATB 4GLXA 2R70A 4DV0H 2ZJTA 1Z5WA 5CB4B 3RYFB 3ZEDA 2F66C 3SGIA 1FJGH 4I4TA 4TV9A 4PZ7A 4JV5H 2ZIOA 5BR8H 3N2GB 4DV0B 5JJJB 4O2AA 3BA9A 4FM2A 2CAZC 4AILC 3JAWB 4CC6A 2BTQB 4JV5B 1KU9A 4KL1A 5BR8B 4I7HA 4A2BA 4EFBA 2QM4A 2KSWA 4EFEA 5EIBD 5KMGA 5EZYA 2Q7GA 4HNAB 4YJ3B 3JSNA 4I50B 4LF5H 2RJZA 4DRXB 5FD6A 4DUYH 1IBLH 4GKJH 1SQFA 4ZIBA 5KHGA 1BJTA 4CH5A 4LF5B 3RIZA 4DUYB 1IBLB 3CB2A 1V9PA 3L4JA 2HEPA 1E4GT 4X1YA 1KMIZ 5D1OA 4U3JB 4FLWA 3TY8A 5IJ0B 4EEQA 1TUBA 4DV3H 1D5AA 3JARA 1P8LA 2YIBD 3KXYT 2HGSA 4DK1A 5CA0B 4MTEA 2YCHA 4DV3B 5LXTB 4JI5H 3ICXA 5IYZB 1HW7A 3QWUA 2VPSA 1S68A 4BWAA 4TQFA 1IBMH 2W57A 4DR1H 2VOBA 4FLZA 5J2UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 B;  2HVQ A;  2UXB B;  4X65 B;  4DR3 B;  1IBM B;  3T1H B;  2UUC B;  4DV1 B;  4B3M B;  4OX9 B;  4K0K B;  4DR1 B;  2CFM A;  3RTX A;  2HVS A;  3W5O A;  4GKK B;  4LFB B;  1TA8 A;  4CC5 A;  1HNX B;  4YY3 B;  4JI8 B;  2UXD B;  3T1Y B;  4DRF A;  3NC0 B;  3W1G A;  1DGS A;  4NXN B;  1CKN B;  1VS0 A;  1XDN A;  4JYA B;  4UCO A;  4DV2 B;  3L2P A;  4DV5 B;  4JI3 B;  4LF9 B;  4DR6 B;  4UCV A;  2UXC B;  5IWA B;  4LFC B;  4AQY B;  3RR5 A;  3JSL A;  1ZAU A;  1IBK B;  4NXM B;  1XK5 A;  4DV4 B;  1FJG B;  4JI2 B;  4LF4 B;  4JI4 B;  3BAB A;  2VQF B;  4LF8 B;  1XNQ B;  3NBZ B;  4DV7 B;  4B3S B;  2HIV A;  4E6N A;  4DR7 B;  2ZM6 B;  3GJX B;  1X9N A;  1N33 B;  4X64 B;  3PN1 A;  3GDE A;  4JI0 B;  5D1O B;  1XMQ B;  4GLX A;  2Q2U A;  5FPO A;  3BA8 A;  1CKM A;  3SGI A;  4PZ8 A;  2UU9 B;  4UCT A;  1HNZ B;  4GKJ B;  4PZ7 A;  3TY9 A;  1CKN A;  2VUG A;  3BAA A;  2UUA B;  1B04 A;  4DV0 B;  1A0I A;  4B3T B;  3BA9 A;  4KHP B;  4CC6 A;  4JV5 B;  4UCR A;  4DV6 B;  3TY5 A;  5BR8 B;  1J5E B;  4EFB A;  4EFE A;  3JSN A;  1XMO B;  1N32 B;  2HVR A;  4LFA B;  1CKO A;  3W1B A;  3S24 A;  4YHH B;  1TAE A;  4UCU A;  4JI5 B;  5FPR A;  4LF5 B;  2VQE B;  5LMU B;  3KYH C;  4JI6 B;  1IBL B;  4DUY B;  5D1P A;  1V9P A;  1HR0 B;  5D1O A;  1HNW B;  4DR2 B;  2Q2T A;  4JI7 B;  4UFZ A;  3GB8 B;  3TY8 A;  4LF7 B;  4EEQ A;  2E5L B;  4LF6 B;  4DR5 B;  1P8L A;  3UQ8 A;  4DR4 B;  2UUB B;  4LH7 A;  4UCS A;  1FVI A;  3VNN A;  2HHH B;  5LMN B;  4DV3 B;  3NBY B;  2OWO A;  4PZ6 A;  5DIS C;  4B3R B;  3QWU A;  4LH6 A;  4X66 B;  3OTO B;  2HIX A;  4EQ5 A;  1S68 A;  2F4V B;  1P16 A;  1I94 B;  1XNR B;  4TOI A;  1N34 B;  4JI1 B;  1N36 B;  4DUZ B; 
#chains in the Genus database with same CATH topology
 1GSA A;  3GV5 B;  3W7X A;  4RAZ A;  2R87 A;  1IBM B;  1WPB A;  3RTX A;  3I5D A;  5FJ8 G;  4O7R A;  4LNU B;  5FLX W;  3GTP A;  2HHF A;  4WHX A;  3RVZ A;  4A3K G;  4PA3 A;  4TUY A;  2GTS A;  3RJ0 A;  1AIL A;  1KKD A;  4JI8 B;  3RB3 A;  4WD3 A;  1Y14 B;  3WG7 C;  4CMD A;  4DV5 H;  4NXN B;  3B4S A;  2D2C B;  2ZE7 A;  1AN7 A;  4YR2 A;  3WB1 A;  1EN5 A;  4IIJ A;  1JX4 A;  5CR5 A;  1R3J C;  4MVZ A;  2BQU A;  2M6Y A;  3R66 A;  3AG2 B;  3HOY G;  3GTJ A;  3DXR B;  2LW1 A;  2R7L A;  4A3F G;  1Q8I A;  4DR1 O;  1COW G;  1Y76 B;  4YJ2 A;  2KKW A;  4TV8 B;  1IOW A;  3VBB A;  1S0V A;  1DTO A;  2HG5 C;  2GUZ B;  4IYH A;  2ZM6 B;  4JAA A;  2ASD A;  1B6Q A;  3FMA A;  2C2E A;  4FLX A;  4FK5 C;  4J7K A;  2YWV A;  1GK9 A;  4ZOL F;  3SPH A;  1CKM A;  2HDK A;  4UVC A;  3G6X A;  4U7N A;  1TWC A;  4YIP A;  2EIL B;  4YAJ B;  1KQS U;  4NXM O;  1J5E H;  2Y0P A;  2RDC A;  2VR1 A;  5D8D A;  4J7Z A;  2KQX A;  1EZV H;  3HKB B;  2JA5 A;  1Y6X A;  4JI2 O;  1XMO H;  3RYF A;  4CE5 A;  3G6V A;  3U9T A;  4DR7 H;  2EIK C;  1NBM G;  5BMV B;  4DV7 O;  5JQG A;  4QIW A;  2Y0S E;  2FK1 A;  3N2G A;  3RGZ A;  1RK5 A;  3QTC A;  3HKC B;  4OXS A;  1AUV A;  3CVZ A;  3L74 H;  2WB1 E;  2QTS A;  1VQO V;  5KG4 A;  3I56 V;  1NS1 A;  3K0G A;  1GLV A;  3ZIA G;  2PMZ E;  1S10 A;  3T2M A;  3PR4 A;  4J10 A;  1IXB A;  1JA8 A;  1MAB G;  2CTR A;  5LYJ A;  3BVO A;  5FPR A;  3K0D A;  2Q7E A;  1C30 A;  2W6P A;  4I0X B;  2BE3 A;  1H2K A;  1WB8 A;  4QWD A;  5KFF A;  4JZ2 A;  4KHP O;  1Q3E A;  4J0M A;  2R92 A;  1FFX B;  4LF7 B;  3R5X A;  3B8M A;  3FKS G;  4WFF A;  4LF6 B;  4O4J A;  1Y1V A;  5IP7 G;  3VQW A;  1VMG A;  1FVI A;  1VAJ A;  4NZO A;  5KFC A;  4QE7 A;  2A06 H;  4MVQ A;  5FLX N;  2Z5U A;  4LP8 A;  5DIS C;  4B3R B;  4UUJ C;  1JLL B;  4F6E A;  4JI1 H;  4YR3 A;  1R6K A;  1IUR A;  1QLE B;  2QSA A;  2QM7 A;  5KG6 A;  3AG1 B;  1A3G A;  2QGN A;  4X65 H;  2JGD B;  4DR3 H;  4B3M H;  3ZRV A;  4JI6 O;  2XC9 A;  4QGP A;  4HNT A;  2UVW A;  3E5N A;  3H20 A;  2GQR A;  3FFQ A;  4OX9 B;  5KFI A;  1M6V A;  3OMN B;  4LC1 A;  4R8U A;  5JH7 F;  3KCX A;  4NYE A;  2QA4 V;  3SR2 C;  4J9Z B;  3UFX B;  5BYA A;  1NR7 A;  3K5L A;  2JS3 A;  4X66 O;  5CN0 A;  4MV8 A;  1ORQ C;  4DK0 A;  5JCO A;  2L35 A;  5KHH A;  1XOU A;  4EGJ A;  3OSP A;  4GX2 A;  3ABL B;  1O9H A;  1CE8 A;  5BWU A;  4LMY A;  3SJA C;  1S76 D;  3TXQ A;  1N36 O;  2ODT X;  5EOY A;  1I2K A;  4JI4 H;  4FLV A;  1ZAU A;  1KKC A;  2QR4 A;  3WB0 A;  1KYO F;  3ZRW B;  2IBK A;  2QWQ B;  3MWM A;  4J9Y B;  5B1O A;  1Z2G A;  4O81 A;  2LO1 A;  3AG3 B;  4XDL A;  2Y0I A;  3MWE A;  4EB6 A;  3OGI B;  4TM5 A;  3M8A A;  4JI0 H;  3VMM A;  1H2G A;  4P9O A;  2YW2 A;  1ENV A;  5JQW A;  4X64 B;  1CXZ B;  1JOY A;  4NXM H;  2QWO B;  2FTK A;  1HNZ B;  3ASN B;  1OCZ C;  2HKO A;  1CKN A;  4QE9 A;  5ITZ A;  1CQI B;  5LP6 B;  2LFS A;  4Y8V B;  4IR9 A;  1B06 A;  4O4I F;  2XAH A;  2R6F A;  5IJ9 A;  1SET A;  1E1Q G;  2Q0A A;  1R73 A;  2QWR B;  2VQD A;  2C2D A;  4EBD A;  5FD5 A;  3JYC A;  3RYI A;  2JGU A;  2DIK A;  3OAA G;  1URF A;  5LGU A;  1DAA A;  1M0T A;  2GTA A;  1YIT V;  3K04 A;  4O4L A;  5KFA A;  5LMU O;  4LR3 A;  2CGO A;  2OT5 A;  3KYH C;  3ZMS A;  1NVP D;  1NH2 B;  4L8J A;  1I7F A;  3X2Q B;  3STL C;  4U3F H;  2Q68 A;  1JXL A;  2X7R B;  4IL6 Z;  1HR0 B;  2UUA O;  4IGG A;  2P90 A;  1NI8 A;  3AK2 A;  3SI8 A;  2JEF A;  1YTF B;  5KFZ A;  5BY1 A;  2FPP B;  5BXZ A;  3V4S A;  5CB4 A;  4GT1 A;  1CEZ A;  3FYI B;  4DR5 B;  3N2K A;  4QW8 A;  5C3E G;  3AG7 A;  3VNN A;  1D5N A;  3D8C A;  1JR9 A;  4EEY A;  1S0O A;  2XTA A;  1EZ1 A;  3LML A;  4J9Q A;  1S9F A;  1SQQ H;  4ZI7 F;  2E76 B;  4JAV A;  4JI6 H;  1OJH A;  2X6A A;  3T9B A;  1YI2 V;  4BWS C;  2CNQ A;  3CCE V;  1K1S A;  1DF4 A;  2DMX A;  2HGX A;  4GKK H;  3GWO A;  3V4Z A;  3QZ8 A;  3T1H B;  2AHZ A;  4DV1 B;  2UUC B;  1SER A;  4JF3 A;  4LFB B;  3K5H A;  3H0G A;  3LDC A;  1EKV A;  4O2B B;  1P49 A;  5E1A C;  1EBO A;  1WP7 A;  3SJB C;  4ZHQ A;  4Q8F A;  2HHH O;  5LMN O;  5EDW A;  3EPG A;  4DR6 H;  4YB8 B;  2KB1 A;  1GKF A;  3OTO O;  2KG7 B;  3BJY A;  4LFC H;  4JAU A;  2C35 B;  2UXN A;  2Z04 A;  2BQ3 A;  1VQ9 V;  1N56 A;  3HKZ E;  4LF4 H;  3MFH A;  1TWA A;  4FU0 A;  5IYZ A;  2DWC A;  4APM A;  4K6N A;  1FJG B;  1K92 A;  1K5S A;  3RB4 A;  3TXS A;  1IVS A;  4K0K O;  2DAB A;  2BOC C;  4IWY A;  3RYC A;  4BY7 G;  3BY6 A;  3NBZ B;  5B5E Z;  4ECT A;  2ZDQ A;  4F6R A;  5KHI A;  2WA3 A;  2VUM A;  1OV9 A;  3RFC A;  2ZDH A;  2EJ7 A;  3V6H A;  4O2A B;  4BBR G;  4FZ1 A;  4FFO A;  4MW8 A;  1ZUQ A;  2YI8 A;  3FB5 C;  2J9G A;  1P84 F;  4J9S A;  3THO A;  3T5J A;  2VWK A;  4UV9 A;  1B04 A;  2R9R B;  1M90 W;  1MZB A;  1Z5V A;  3HB3 B;  3FB8 C;  3QVN A;  4JV5 O;  1F51 A;  5A2Q W;  1SKV A;  2XT9 A;  5L1L A;  4X20 A;  4RWU A;  5LA6 F;  2R9I A;  1MOF A;  4PV1 B;  1N32 B;  4MV9 A;  1GSO A;  3MFI A;  3TQ1 A;  4RCN A;  5LMU H;  2YEV A;  4ZOL B;  5KX5 F;  5EWG A;  3LNN A;  1D2D A;  3BCC H;  1OHH G;  5EIB C;  1M56 C;  3K06 A;  1N48 A;  2E3C A;  1HNW H;  2VQE B;  3HXL A;  1NTM H;  2ZE6 A;  4GKJ O;  3RUP A;  1L0L H;  5D1P A;  1ZTE A;  2O03 A;  2K9P A;  2UUB H;  3HKE A;  3GTM A;  4RUF A;  4UFZ A;  2LQT A;  4WBN F;  2CW8 A;  1T3N A;  1JVM A;  1VF7 A;  4DR4 B;  3H1H H;  2WYO A;  3HBL A;  1GN3 A;  2IU0 A;  3WG7 B;  1LR1 A;  1A0G A;  3BRC A;  1I94 H;  2ZDI A;  2OWO A;  3BQ1 A;  1G8M A;  5KAI Z;  1AJN A;  2LGW A;  4JAS A;  4NZN A;  1S72 V;  2ZIM A;  4LBE C;  3SJC C;  1PNM A;  4DUZ H;  4TV9 F;  4JI5 O;  4KUM A;  1R3L C;  3PJS K;  4O86 A;  2Q73 A;  3OHB A;  2Q7H A;  1VQM V;  2DOS A;  2YYA A;  2UXB B;  3E22 B;  1A9X A;  2ITD C;  2QKA A;  1HNX H;  2CFM A;  3C0F B;  1N0J A;  5EZY F;  3CQZ A;  5CMU A;  3OTF A;  1GN4 A;  4CKC A;  4CC5 A;  3TW6 A;  3OE7 G;  4TQR A;  5FNV A;  1I2L A;  3OTO H;  2RDJ A;  2COJ A;  3AG4 C;  4CS4 A;  4QIW E;  4FFB A;  1Q90 D;  3IC7 A;  3LUL A;  5DGH A;  4EBE A;  1N34 O;  1W93 A;  1JIH A;  2Y0S A;  3PW5 A;  1TWF A;  3A2F A;  2R9A A;  2WB1 A;  5J2T A;  3I4N G;  2GV9 A;  2EIK B;  2PMZ A;  5BWV A;  1XL6 A;  5GON A;  3T1Y O;  1SA0 B;  3CME V;  2HGW A;  3LQS A;  1BGW A;  4DR7 B;  2XCA A;  4CHI A;  5A2Q N;  4FJC C;  1F23 A;  1AI5 A;  4JYA O;  3AX6 A;  2BQR A;  3OEE G;  4JI3 O;  4QWB A;  4DV0 H;  2F66 C;  4I4T A;  4JV5 H;  3PFF A;  3MR6 A;  4MVU A;  3SPI A;  3TII A;  3GV7 B;  4TUY F;  3TK1 A;  5JJJ B;  4FM2 A;  3Q4H A;  4CC6 A;  2HP8 A;  5H80 A;  2BTQ B;  1PNK A;  3KG2 A;  5BR8 B;  4A2B A;  3J80 N;  2R93 G;  2QM4 A;  1QBZ A;  2KSW A;  5KMG A;  2GPW A;  3P3P A;  4TVI A;  2RCV A;  1WCM G;  1XL4 A;  2NUA B;  4DRX B;  3FYE B;  4IIJ F;  3KCY A;  3WNZ A;  1SES A;  3SYC A;  4GKJ H;  1SQV H;  3ABM C;  1IXM A;  4CH5 A;  4LF5 B;  5KFV A;  3FDS A;  1IBL B;  1PM9 A;  3T9D A;  4JUZ A;  1E4G T;  4X1Y A;  4YJ2 F;  2XOK G;  5H2F Z;  2CNU A;  2R86 A;  4U7C A;  5IJ0 B;  1TUB A;  2CTP A;  1Y4M A;  1KP2 A;  3T5L A;  2JA5 G;  1XRE A;  1ZSP A;  1EHI A;  3KXY T;  3Q8R B;  5CA0 B;  1AR5 A;  5I5U A;  3SYQ A;  4JI5 H;  3FB7 C;  4F4X A;  3SYP A;  1BZK A;  3F5T A;  2LW7 A;  3QO8 A;  2NU9 B;  4FLZ A;  3W7U A;  5LOV B;  1I7N A;  2YDE A;  1JFF B;  1GTO A;  1Y74 A;  4QIW F;  5JQG F;  4YY3 H;  4DR1 B;  3NGD A;  3WU2 Z;  4O4H A;  4F4L A;  3DTU B;  5L3D A;  3AK1 A;  1FXK A;  2HVK C;  2W0F C;  5CA3 A;  4ZI7 B;  2R92 G;  5KT2 A;  5KS8 A;  5LYJ F;  4LF9 H;  1YJW V;  2UXC H;  2XAG A;  5IWA H;  2WLL A;  5KFQ A;  3OM3 B;  4ECQ A;  1Z2O X;  4DV4 H;  2NR5 A;  4YR0 A;  3H1L H;  5KUM A;  2RGV A;  1OCZ B;  4ECR A;  4NXM B;  1EKP A;  3ETJ A;  2DQ3 A;  2W6N A;  2RQ6 A;  3B8N A;  4O4J F;  4PWQ A;  1P7G A;  4JI2 B;  4Q44 A;  2FLL A;  5JVD A;  1VQN V;  3ETH A;  2Q7D A;  1M9N A;  4MTF A;  4DV7 B;  1JMK C;  2IJK A;  2HIV A;  1OCR C;  1DK1 A;  1XMQ H;  3VA7 A;  4X9Q A;  2YXL A;  3BFR A;  1OCC B;  4UVA A;  2Z02 A;  5BWR A;  2V4R A;  3ZHS A;  1US6 A;  1KC8 W;  3N6X A;  2ATL A;  4H13 B;  4X88 A;  1JQ0 A;  5KFL A;  4DV5 O;  3GV8 B;  2WE6 A;  4JTC B;  1RJQ A;  2AZ0 A;  3TW7 A;  2ITC C;  2XIG A;  2IM9 A;  3E8B A;  5F2V O;  4WFG A;  1M57 C;  4GCZ A;  1MA1 A;  4Q20 A;  4KHP B;  2ARH A;  3SPC A;  4FFM A;  4HN2 A;  4FLY A;  5D5P A;  3KAL A;  2NU8 B;  2OYQ A;  4RUE A;  5EBM C;  1FYJ A;  1PV0 A;  3JCZ A;  5FL7 G;  4J9N A;  4LFA O;  1ZX3 A;  4FM1 A;  3PW4 A;  5K1X A;  2ZCE A;  1I50 A;  2MK3 A;  4A3M G;  5DLG A;  2JDI G;  2CH7 A;  3CCU V;  4YJ3 A;  3CPW U;  4X1I A;  1Q6U A;  4DR2 H;  3B2E E;  4A5U B;  3T99 A;  4R8C A;  2JA8 G;  4JI6 B;  3A8T A;  1XHX A;  3STZ C;  5KFU A;  3H40 A;  3GB8 B;  1RYR A;  3GTG A;  3FAV A;  4IHJ B;  4OPH A;  5B1A C;  1J5E O;  4FMT A;  3JAK A;  3WO0 A;  1K4C C;  2A3Q A;  5KX5 B;  4I55 B;  1UNN C;  4N23 A;  4IWX A;  1XMO O;  2OTL V;  3L70 H;  4ED7 A;  1S5H C;  1W59 A;  1XNR H;  1LNQ A;  1H2N A;  3HKZ A;  5F9N A;  4J9M A;  4X66 B;  4O3S A;  3T54 A;  2HJF C;  1QHT A;  3PZP A;  3SNO A;  4A3L G;  3UT5 A;  1U97 A;  4ECV A;  1L0N H;  5LXT A;  4X1K A;  4OPA A;  2X6B A;  1N36 B;  4XYM B;  1VQP V;  3FKI A;  2QB5 A;  3QQM A;  4MTX A;  4O7T A;  5LL6 b;  3W5O A;  4ED3 A;  5I5W A;  1TA8 A;  1WJZ A;  4RUC A;  4MV7 A;  4XYL B;  4ED6 A;  5TIS Z;  5EWE A;  4O4L F;  2P7T C;  5EBL C;  1DGS A;  2ALZ A;  3H3V H;  2ILM A;  2E2H A;  2YU9 A;  1DIK A;  1I5X A;  4UVB A;  4MAM A;  4O84 A;  3L2P A;  2GHY A;  3N41 B;  3CCJ V;  4BY1 G;  4Q0Y A;  4JI1 O;  3HOW G;  4LF8 H;  4IYI A;  5EZY B;  2ZIN A;  3KHR A;  4FS2 A;  3I4M G;  5CB4 F;  4ZQI A;  4X65 O;  4DR3 O;  4B3S H;  4B3M O;  3HOU G;  2X0L A;  2FK3 A;  3K9S A;  1OCO C;  3ORR A;  2UVR A;  4B08 A;  4J41 A;  3TJT A;  1H8H G;  2B9Z A;  1I3Q A;  4MS2 A;  3T9A A;  3DF7 A;  1UC9 A;  3GJX B;  5DM6 V;  2JEG A;  1Y76 A;  3H0G G;  1E4F T;  4P30 A;  5D1O B;  2LJ2 A;  5DMX A;  4FBT A;  1M56 B;  1ZHS A;  5KT7 A;  2GUZ A;  3CSX A;  2WLK A;  3JAR B;  2AQ4 A;  1AUX A;  4O3Q A;  1W0K G;  5KFD A;  4UCT A;  3A0B Z;  3IG0 A;  4A93 G;  3K5O A;  1IBK O;  4O3R A;  2UUA B;  5L3B A;  5CBG A;  4UV8 A;  3MJF A;  4PDR A;  3RYH B;  2YID A;  4RB0 A;  4ZHQ F;  4JI4 O;  1VAR A;  1XNQ O;  5GTH Z;  3SDL A;  4LFA H;  4GZR B;  4DL5 A;  1I6U A;  4L1K A;  1LUV A;  2GDS A;  3RV4 A;  4YHH H;  2WPD G;  3HKB A;  3DC6 A;  3IFX A;  5IT9 W;  4JI0 O;  2HLD G;  3T7A A;  4IRK A;  3CEI A;  2HHF B;  1SC5 B;  2I87 A;  5IYZ F;  3HKC A;  1GN6 A;  2GBO A;  1L8D A;  2ZNJ A;  3T9C A;  2PUS A;  2UU9 O;  1Z2N X;  3IGA C;  2P0A A;  1O75 A;  4QNH B;  1RSO B;  5KFY A;  3PR5 B;  1A48 A;  3SE7 A;  4LWS B;  2ZDI C;  3JZ6 A;  4PDB A;  1K5Q A;  2R72 A;  4DV6 O;  4I0X A;  2ADP A;  3D3Q A;  4JPR A;  1DV2 A;  4IIJ B;  3T5K A;  1NTK H;  3RBE A;  3K5N A;  1DF5 A;  2IBZ H;  2HHH B;  4H44 B;  3RVY A;  5LMN B;  5JUM A;  1PL0 A;  5KG1 A;  1I5Y A;  5KG3 A;  5LGT A;  3AG4 B;  2CQY A;  3OTO B;  4RAY A;  4LSX A;  4DL2 A;  5C8Y B;  5CA1 B;  4X62 H;  1RM1 B;  4HNV A;  2WLJ A;  4I50 A;  1RJR A;  3G8D A;  4A3B G;  4AHC A;  3FD9 A;  4ETS A;  2AGP A;  5I5Y A;  5T14 A;  2OH2 A;  3M99 B;  4K0K B;  3VQY A;  1E79 G;  2JGD A;  2RDI A;  3RB0 A;  3T9F A;  2N05 A;  4O7V A;  1R1B A;  1L2Z A;  2JEX A;  3GIM A;  4DV2 H;  2F95 B;  3ZHR A;  2DN9 A;  2F93 B;  4M7E A;  4QPJ A;  1RFY A;  3CCR V;  5KFH A;  2E2I A;  2C22 A;  2X5R A;  1ZET A;  1SQG A;  1M7J A;  1V55 C;  2K1E A;  3MD0 A;  2R7K A;  3GTL A;  4J9K A;  3J81 W;  5CBF A;  5JQG B;  2QE7 G;  4F50 A;  3DSQ A;  2W8L A;  2QKC A;  1CPY A;  4GKK O;  3VOU A;  1S97 A;  3H1J H;  5LYJ B;  2FB5 A;  2A1H A;  5J2U A;  3R5F A;  5KG0 A;  3G6B A;  3ZRW A;  3OW2 U;  1Q43 A;  1Y67 A;  2Q8V A;  2B63 A;  3PN1 A;  3GDE A;  2LP7 A;  1WH2 A;  3K5M A;  3ABM B;  4U6P A;  1GM9 A;  5B1N A;  1BNC A;  1IBK H;  2JK5 C;  2CGN A;  4DYL A;  3IAY A;  4DR6 O;  4B3T H;  4O4J B;  4LFC O;  4GKJ B;  5IT9 N;  4MW3 A;  3TY9 A;  2NVX A;  3UZB A;  1ZL8 B;  4DQN A;  1XNQ H;  2FL4 A;  4MV4 A;  2EIY A;  5KT3 A;  1EUD B;  2PY5 A;  1YXB A;  5FNV F;  4LF4 O;  2RGR A;  3SJQ C;  4RU9 A;  4F4Y A;  3U10 A;  5KFP A;  4GX0 A;  2WAM A;  5LP6 A;  1VQ7 V;  4BW9 A;  2F43 G;  2GQS A;  3ORQ A;  1VBH A;  2WLM A;  5DGA A;  3S24 A;  4ED0 A;  2C28 A;  2UU9 H;  3W7W A;  4YQW A;  4JI5 B;  5J9P C;  3N40 P;  4DL4 A;  3AW8 A;  2IJJ A;  4DUY O;  2EJR A;  4RO2 A;  4R8U B;  3R23 A;  2CK3 G;  5J2T F;  5DED A;  2E5L H;  4DV6 H;  2YIB A;  2XCL A;  5KFW A;  3CS5 A;  3MR5 A;  5GON F;  5BWW A;  3M9M B;  4FBU A;  4P9P A;  2CKZ B;  5IYC O;  3K79 A;  1VP7 A;  3VPC A;  3M7M X;  3ETD A;  3MR3 A;  4BAY A;  2R84 A;  2R8G A;  3CCS V;  2UXX A;  3GVM A;  3TET A;  4KFM A;  2FMA A;  5LHI A;  4A3I G;  4TSF G;  5L3G A;  2XAJ A;  4I4T F;  3JD2 A;  3F8N A;  3LP8 A;  3J7A K;  1SF9 A;  4EB6 B;  1N34 B;  2W9A A;  1FXK C;  4D7S A;  4GUN A;  5KLV H;  1HNW O;  3MWD A;  1H38 A;  3UKM A;  2UXD H;  4O7W A;  1AP6 A;  3J81 N;  4M9U A;  1QR8 A;  1FS0 G;  1T5E A;  4PDM A;  4R7C A;  2UUB O;  1OCR B;  3A0R A;  1KUT A;  1AVM A;  3T1Y B;  3GTO A;  1XI1 A;  3CRC A;  1EKF A;  1CKN B;  5ITZ B;  3DC5 A;  1KJJ A;  4AQY H;  4JYA B;  2YIA A;  3P32 A;  2F4V O;  5DGI A;  2J6S A;  1VKZ A;  1I94 O;  1YJN V;  3W7S A;  1I08 A;  3ASO B;  4JI3 B;  4FFP A;  5IJ9 B;  4B7E A;  4P2Z A;  3ZRX A;  4DUZ O;  2JA7 A;  3ZJZ A;  2KG7 A;  1M57 B;  2DW4 A;  3RBD A;  4JYC A;  2YS6 A;  2VQF B;  4O4L B;  4PEL A;  2PYJ A;  3U55 A;  2XAF A;  4FLU A;  1HNX O;  3HO8 A;  1SCU B;  1WB7 A;  1V51 A;  4MVR A;  3KAK A;  2JRI A;  3GQC A;  4PDV A;  3HKD B;  1EN4 A;  2HJW A;  3GIK A;  2DJV A;  3JZF A;  5CB4 B;  1SRY A;  3ZED A;  3SGI A;  4PZ7 A;  1AR4 A;  1R6T A;  2ZIO A;  4MTG A;  4GC6 A;  2BSK A;  4O4H F;  1Q81 W;  2EJ2 A;  1OWT A;  4O2A A;  1F4M A;  4AIL C;  3JAW B;  1IZ3 A;  5B1A B;  4I7H A;  4XDJ A;  2VA2 A;  4EFB A;  2JIZ G;  1KUQ A;  5C1P A;  4EFE A;  1S0M A;  5A9G A;  4HNA B;  1ZWI C;  4K35 A;  4RQE A;  3DTG A;  5I5T A;  1PPJ H;  2W6Q A;  3RT3 C;  4DUY H;  4ZIB A;  5KHG A;  4AI8 A;  3E86 A;  5K3W A;  2V1D A;  3UO2 A;  4F4W A;  3GIQ A;  1GO3 E;  5JVD F;  2HEP A;  3T4Z A;  1B6R A;  4ED8 A;  3EHB B;  4U3J B;  4DV0 O;  4N21 A;  2XCP A;  1NU1 H;  4EEQ A;  4DV3 H;  1D5A A;  2H3O A;  3MDS A;  1P8L A;  3R9R A;  2YIB D;  1ZQ7 A;  4ICG A;  3L75 H;  4K3A A;  3ICX A;  2C2A A;  5IYZ B;  1SS3 A;  5KFN A;  3GIL A;  1HW7 A;  2DYS C;  3H9V A;  4ABM A;  1AP5 A;  5IYD O;  3CCQ V;  2AHY A;  2R7M A;  4TQF A;  1WAZ A;  3T1C A;  1YTF D;  2ZE8 A;  4QW9 A;  2W57 A;  1IBM H;  4EBC A;  3F5W C;  3Q8S B;  2WLI B;  4MA0 A;  2VOB A;  3VPD A;  5EC1 C;  1HWY A;  2AW9 A;  4F6R B;  3UZO A;  3JAL A;  4OX9 O;  3H1I H;  2P4V A;  2R8I A;  4YIO A;  2HVS A;  3G6Y A;  1OCO B;  4NXN H;  3KAJ A;  5LGN A;  4PJ0 Z;  3SPJ A;  1BE3 H;  4J9P A;  2AZ2 A;  3ETQ A;  3HB9 A;  3NC0 B;  2F4V H;  5B3S C;  2R7Z G;  4YJ3 F;  3ZRS A;  4FGR A;  2W6Z A;  3OGC C;  4DAA A;  1X4T A;  1NR1 A;  2HVJ C;  3CMA V;  1MMM A;  3LNM B;  2CNV A;  3LDE A;  4DV5 B;  2IU3 A;  1KJ8 A;  2QWP B;  1XDC A;  1SQB H;  2N74 A;  4UB6 Z;  2FB9 A;  2YRW A;  2JA6 A;  2Y4T A;  3JD0 A;  1YVW A;  5C1O A;  3WFV A;  5IYC G;  3OFN G;  2YS8 A;  1WR2 A;  1XK5 A;  2PN1 A;  5CM0 A;  2YEV B;  4PA6 A;  1XQ8 A;  2XUM A;  2ABJ A;  3FKI G;  2ZM6 H;  3FX7 A;  2BR0 A;  3RW0 A;  1VF6 A;  2PZS A;  4DW1 A;  3KHL A;  4YY3 O;  2GLT A;  1FPO A;  2B1G A;  4ED1 A;  2X6C A;  4WFE A;  1KB9 F;  2WAQ E;  4MVO A;  5DG9 A;  1Q7Y W;  5LXT F;  3HKE B;  2Q2U A;  2VPQ A;  5L1J A;  1XIL A;  1SA0 A;  2GSM B;  2QJ1 A;  3BA8 A;  4LF9 O;  3KZI Z;  2UXC O;  5IWA O;  4PZ8 A;  4D6T H;  2QF7 A;  1OZ0 A;  2QKS A;  4DV4 O;  3ABT A;  5JH7 B;  3F7V C;  4CS2 A;  3ZMV A;  2W0X A;  1J5E B;  5KT5 A;  4G2K A;  3KHG A;  1FFT B;  5E79 Z;  1XMO B;  4HQ6 A;  5FLM G;  2Q69 A;  5F9L A;  4JYB A;  4HNU A;  3GID A;  3Q8P B;  4QPK A;  1XMQ O;  2XAS A;  1GN2 A;  3JD1 A;  4UCU A;  3JAM W;  4C7U A;  4YXW G;  3JAS A;  4Q45 A;  3RGX A;  2Y4U A;  4FFL A;  1Q5O A;  4DRX A;  5FNV B;  4LF7 H;  4LF6 H;  4GYC B;  3JCU Z;  4FS1 A;  3L73 H;  3GIP A;  5AG2 A;  4YP3 A;  5CAE B;  1K7D A;  4B3R H;  4FFB B;  4CH4 A;  1ZHQ A;  1BS3 A;  2DZD A;  3ZMU A;  4PI2 A;  4RZQ A;  5IJ0 A;  1PP9 H;  3KRE A;  3D3I A;  2RNB A;  4IRD A;  3HR0 A;  1V55 B;  5J2T B;  4Q4D A;  4FIP C;  1V54 C;  5CA0 A;  1AI4 A;  4HYK A;  5C5J A;  4OX9 H;  4JTD B;  4JI1 B;  4DL3 A;  1BMF G;  2Y48 A;  3PW2 A;  4O4I B;  3ML0 A;  4DR2 O;  2UUC O;  4J11 A;  4X65 B;  4DR3 B;  4O3P A;  4B3M B;  4JI7 O;  4QWC A;  4CKE A;  5KFB A;  4G28 B;  3P30 A;  4D7T A;  5LOV A;  1GAX A;  2IH1 C;  1JFF A;  2Q0O C;  4J7J A;  1P7B A;  1RK6 A;  3ETG A;  1XDN A;  3Q4H B;  4A2A A;  2Z3Y A;  1XNR O;  2KSD A;  5KFM A;  3UCS C;  3SYA A;  3TEK A;  5KMG B;  5B66 Z;  1IBK B;  4QWE A;  2XHB A;  3JRW A;  4CZZ A;  2COI A;  1TUE B;  1GM7 A;  4JI4 B;  3G71 V;  1XNQ B;  2W6O A;  1SYX B;  2W9B A;  2ZKO A;  2W9C A;  4XDK A;  4X64 H;  5IYD G;  3JZI A;  3H4B A;  3CX5 F;  5JCO C;  2W7P A;  3C90 A;  3UYY A;  3BHP A;  1NT2 B;  1UFI A;  1TWG A;  2AGA A;  2YC0 A;  3ZMZ A;  4JI0 B;  1Y1V G;  3BPZ A;  4HBN A;  1HNZ H;  4FFK A;  5KHK A;  4I50 F;  3PO2 G;  1WSC A;  3GTQ A;  2JJ1 G;  4Q43 A;  2R8J A;  2QWN B;  2B1I A;  2ZT9 B;  1G1X B;  2UU9 B;  1M0W A;  4OGQ B;  3K08 A;  3EVK A;  4LSA A;  1A0I A;  3JAM N;  1SEI A;  3ZX6 A;  3ZMT A;  4RAI A;  1MZF A;  5CBH A;  4DV6 B;  4LF8 O;  3TY5 A;  4B3S O;  1PX2 A;  2HVR A;  5BWT A;  2VS0 A;  2VRZ A;  2PGG A;  1Y74 B;  3K3W A;  3G80 A;  1HR0 H;  1K73 W;  4O4H B;  1EN6 A;  2XAQ A;  4DW0 A;  1K83 A;  2B63 G;  3X2Q C;  1JKJ B;  2R8K A;  1FXK B;  2N04 A;  4QSH A;  4DL6 A;  5KT6 A;  3JRX A;  4DIM A;  3JAT A;  5HV6 A;  4XZ3 B;  4NVP A;  5J2U F;  4J9L A;  4A3E G;  2EJ0 A;  2WLL B;  5I5V A;  2IJH A;  2OCH A;  4LH7 A;  3CRA A;  3MR2 A;  1S03 G;  4EG0 A;  4ECS A;  4UB8 Z;  2WSS G;  4U7O A;  1BSM A;  2W6I G;  2YZN A;  3E8H A;  4IHJ A;  2HIX A;  3VQV A;  4YHH O;  3CJH B;  2CUG A;  1MZE A;  1S5L Z;  1WA8 B;  4I55 A;  5JVD B;  5L1I A;  3QG5 A;  2PI5 A;  5KFT A;  1S5J A;  1BHA A;  2UUC H;  4DV1 H;  3Q1K A;  4C5A A;  1I0H A;  4JI7 H;  3M9N B;  2HVQ A;  4LFB H;  4YAK B;  2OCC C;  1F7Y A;  4EYI B;  3PVX A;  1W2B U;  3ZHV A;  5LP6 F;  4NZM A;  4GKK B;  3ZBH A;  5LA6 B;  4I7Z B;  2ASJ A;  2DPI A;  1KT8 A;  1BGY H;  5EYP B;  2YXY A;  5KFX A;  1NTZ H;  3JD4 A;  2V5A A;  4DRF A;  3U0Z A;  2Q6A A;  1VQ8 V;  4ASU G;  3E8F A;  1GYF A;  2L6L A;  1FKA H;  2JJ2 G;  1JDE A;  3EYY A;  4TWK A;  3G8C A;  1EM1 A;  4FFN A;  2W6J G;  1TVK B;  1A32 A;  1AI6 A;  3UO3 A;  4NTW A;  1LUW A;  4DR6 B;  1Z2P X;  3QFF A;  2Q9L A;  4QJF B;  3OUZ A;  3KHH A;  4LFC B;  1MSD A;  5L3F A;  3MHS C;  2YXH A;  4WBN B;  4X62 O;  3BQ2 A;  3H1K H;  2PI4 A;  4A3G G;  4LF4 B;  1R6N A;  2P22 C;  2CH7 B;  3Q2O A;  3CSW A;  4K8X A;  4X1I B;  4GC7 A;  4NR1 A;  1G2W A;  4GLW A;  4TV9 B;  3OUU A;  4LNU A;  3OMI B;  1Y66 A;  1VBG A;  2ZXW C;  4DV2 O;  2AGQ A;  2XGQ A;  5FPO A;  1IYD A;  4R6Z A;  4CH6 A;  3JAK B;  5KA5 A;  4NB5 A;  2CE4 A;  1Q82 W;  4FVM A;  1E4E B;  2A9H A;  4BR6 A;  5KHJ A;  1UC8 A;  1NQT A;  3QO7 A;  1N32 H;  2OIE A;  2Q4P A;  2JA7 G;  1Q86 W;  3UT5 B;  1VF5 B;  2C00 A;  2EX3 A;  3DXR A;  4Z1V A;  5KFK A;  4X1K B;  4Q6G A;  3RYH A;  4FZ0 A;  1YJ9 V;  4XX0 B;  1CKO A;  2VQE H;  2DYS B;  3CD6 V;  1G6U A;  4MV3 A;  3W1B A;  4TV8 A;  1VQ6 V;  5IY5 C;  5IDJ A;  1OBG A;  5K2M A;  5LMU B;  1IBL O;  4UXN A;  4HYO A;  4HR7 A;  5E25 A;  2DAA A;  4DR4 H;  1HNW B;  4B3T O;  3ZN1 A;  1WRV A;  2Q2T A;  2WDT A;  1BT8 A;  4E4T A;  3T9E A;  5L9X A;  1M93 A;  3U11 A;  4MVM A;  3RGB A;  4DO2 A;  4ZKI A;  2UUB B;  1BHB A;  1AB3 A;  1RSO A;  2W8K A;  1FXH A;  4LWS A;  5B3S B;  3BG5 A;  2G38 A;  3OUS A;  3NBY B;  4FPP A;  2I80 A;  4LH6 A;  1KD1 W;  2P06 A;  5EBW C;  4A3C G;  5BMV A;  2F4V B;  2JS5 A;  1I94 B;  3CE2 A;  2UXB H;  1WPX A;  1ARO P;  1PL4 A;  4RNN A;  3N6R A;  4TUY B;  1Y1W A;  4O2A F;  3T4D A;  2P5O A;  2VUM G;  4DUZ B;  2CW7 A;  3GIJ A;  1I1M A;  2R93 A;  4ECU A;  4IRC A;  5C8Y A;  2M7W A;  5CA1 A;  4MV6 A;  2DQ0 A;  3ZHQ A;  4RB3 C;  5I47 A;  1WCM A;  4C5C A;  5DG7 A;  3EXA A;  3NR7 A;  1I1K A;  2E5L O;  2WAQ A;  4JYY A;  5H6R A;  1HNX B;  3LWB A;  4O3N A;  4MVS A;  5DN6 G;  5LL6 Y;  3BAC A;  1W0J G;  2IMW P;  2P67 A;  2ZR3 A;  1FFX A;  3S3W A;  3A0H Z;  3N43 B;  3HOX G;  2Q5Z A;  1VQL V;  5HNE A;  4YJ2 B;  5IYB O;  5FR9 A;  4Q8E A;  1VF6 C;  3JSL A;  2YIC A;  5GTI Z;  4MT8 A;  4EYH B;  4RUA A;  2J6U A;  5KAF Z;  2YZL A;  1QCE A;  3CP1 A;  3AYH B;  2IP4 A;  1KP3 A;  3E89 A;  1BCC H;  4E6N A;  2UXD O;  5LHG A;  5C4X G;  1C3O A;  2HFE C;  1T36 A;  4PBC A;  5DQH A;  3W7T A;  1UJW B;  1KBH A;  3ZCC A;  2XD4 A;  1H2M A;  3RYF B;  3S3X A;  5KG5 A;  4AQY O;  1CP9 A;  2OLS A;  3ABK C;  2CTW A;  5BR8 H;  3N2G B;  4DV0 B;  5LBQ A;  2IA6 A;  2JA6 G;  1ZLZ A;  2QM8 A;  2PF4 E;  2EIM C;  4JV5 B;  1KJQ A;  2AGO A;  1NVP B;  2J6T A;  4KL1 A;  4G3I A;  2NU6 B;  3L71 H;  1JX9 A;  2A0L A;  2QDO A;  1ZL8 A;  1KEE A;  1SZX A;  5EIB D;  1MG1 A;  4I50 B;  1RPO A;  1CQJ B;  4O83 A;  4LF5 H;  1N33 O;  5FD6 A;  3AK3 A;  1J95 A;  1IBL H;  4ED2 A;  5KFR A;  3UM7 A;  1V54 B;  3CRQ A;  1AJP A;  4IT5 A;  3RIZ A;  2D3O W;  1PK8 A;  2FKL A;  4WF9 V;  4C2M A;  3CB2 A;  1V9P A;  2Y69 C;  3L4J A;  4FLW A;  5H6Q A;  3J7A U;  2EZO A;  3B77 A;  2W70 A;  2B5U A;  1QNM A;  2YS7 A;  3K3P A;  4NYK A;  1DLB A;  4TT3 G;  4G27 B;  3BQ0 A;  1EFR G;  5DG8 A;  5JVL A;  2RF4 A;  4RQF A;  2YCH A;  5B1B C;  3H01 A;  5EC2 C;  3QWU A;  2DYR C;  3HOV G;  2VPS A;  1GMG A;  1GM8 A;  2Q67 A;  1DV1 A;  1JCH A;  4M0J A;  4PD4 F;  2Z0A A;  5I5S A;  4FFR A;  5DQI A;  2XND G;  4ME6 A;  3LUT B;  4DR1 H;  5GW7 A;  5J2U B;  5HFL A;  4EGQ A;  2BCC H;  3TCU A;  3N8D A;  1O9G A;  3CRR A;  1PKX A;  4I9Q A;  5KG7 A;  2HJD A;  4TQS A;  4YBZ B;  4PA4 A;  4YY3 B;  4E4E A;  2UVV A;  4DV3 O;  1B6S A;  2ZE5 A;  1FXV A;  2FK2 A;  1VS0 A;  4BIO A;  2V58 A;  3SYO A;  3L72 H;  3OD4 A;  4Z2W A;  4LF9 B;  5K1P A;  1BQZ A;  1VQK V;  2UXC B;  4UUG A;  5IWA B;  4JI2 H;  1VIB A;  1K97 A;  3LSU A;  3WWI A;  4PDL A;  4O7Z A;  4DV4 B;  4DV7 H;  2H94 A;  1IBM O;  4K8Z A;  2NVY A;  3BAB A;  1KJ9 A;  3L4K A;  1IDS A;  4L87 A;  3E35 A;  5I5X A;  3O65 A;  3M9O B;  3IJ4 A;  5D5Q A;  2EIJ C;  4JI8 O;  2M05 A;  1M1K W;  2ODM A;  3GII A;  3OT7 A;  3PO3 G;  2ASL A;  1OCC C;  1R3K C;  4BIU A;  4NXN O;  1X9N A;  3I55 V;  4O82 A;  5CA0 F;  1XMQ B;  4JV1 A;  4IAJ A;  3PW0 A;  4O2B A;  3RF2 A;  1OBD A;  1I7L A;  1BL8 A;  1Q6H A;  1SZT A;  4HAM A;  4LCU C;  2R85 A;  4KHP H;  1BQ0 A;  5C93 A;  3HKD A;  4AYB E;  2VUG A;  2ZGI A;  3WWJ A;  3APO A;  1YDX A;  3RYI B;  3DAA A;  4FM0 A;  1GRJ A;  5LOV F;  2PYL A;  1X59 A;  1N33 H;  2W6M A;  4Q4C A;  2VWJ A;  5DEC A;  4BXX G;  2DWE C;  1Q6I A;  2ZM6 O;  1TGO A;  3JAW A;  5IYB G;  1S77 D;  3K03 A;  3N27 A;  2P4K A;  1TAE A;  2EIN C;  3RFR A;  1CS0 A;  4CBC A;  4HNA A;  3RV3 A;  4R50 A;  4CKB A;  4ECY A;  5DGB A;  1GGO A;  3N2K B;  2JEI A;  1F4N A;  2OCC B;  1JDB B;  4DR2 B;  3QF7 A;  3LDD A;  4JI7 B;  3KKY A;  2EZP A;  3UQ8 A;  5CE8 A;  2ZD9 A;  4X66 H;  4U3J A;  2HR3 A;  1RYS A;  4HZ3 A;  3SPG A;  4PZ6 A;  2BTO A;  4RNM A;  4JTA B;  4EQ5 A;  1N36 H;  5BYB A;  3LSQ A;  3F7Y C;  1XNR B;  1H2L A;  5KFJ A;  3CCV V;  4TOI A;  1MNG A;  2CDY A;  1WP8 A;  1W96 A;  3U9S A;  4CH3 A;  2MW2 B;  2R8H A;  3ABU A;  2NN4 A;  4ZOL A;  3MHH C;  5EK0 A;  4ZHQ B;  4FLT A;  4FE2 A;  4BBS G;  1EZJ A;  1WLE A;  2LGQ A;  1V4Y A;  3CXC U;  3Q8Q B;  1BXR A;  4LF7 O;  4WFB V;  3D36 A;  2RMK B;  2WLI A;  4LF6 O;  1R9T A;  2ZR2 A;  2GPS A;  2QEX V;  4JV2 A;  4PA9 A;  1AR1 B;  3TQT A;  2YSU B;  4B7K A;  3W1G A;  2P6J A;  5L3E A;  4O7S A;  3IC9 A;  3RWR D;  1NH2 D;  2BSK B;  4WFH A;  4I9W A;  3RN4 A;  4B3R O;  1VEW A;  1ULZ A;  3TIG A;  2DWD C;  2ZXW B;  4I5S A;  3AEI A;  1IYE A;  4C5B A;  5KKN B;  2F23 A;  3RYC B;  4MSW C;  2BOB C;  4JZG A;  1THZ A;  3R5H A;  2R7N A;  3CYO A;  2W7O A;  4JI8 H;  4LF8 B;  3CXH F;  4NTX A;  4CS3 A;  2UVU A;  4B3S B;  4IHJ F;  1R3I C;  3MAQ A;  3I12 A;  1KBL A;  3E22 A;  4I55 F;  1B3Q A;  1AJQ A;  5IY5 B;  2SCU B;  4DL7 A;  2PVP A;  2NNU A;  2UUA H;  1PNL A;  1XBL A;  3WWH A;  2V4D A;  3J80 W;  4RB2 C;  3EFF K;  2WTF A;  3AG2 C;  4X20 B;  4Z1M G;  1ROP A;  2YI9 A;  3CCM V;  4XBF A;  5LHH A;  3GTK A;  1N0N A;  3B09 A;  3CC4 V;  3WB2 A;  4UCR A;  1M4U A;  4RB1 A;  4J42 A;  3U0G A;  4MTO A;  5IP9 G;  4JGS A;  1N8R W;  5JH7 A;  1P4R A;  2Y4R A;  1YHQ V;  4LFA B;  2W71 A;  4X64 O;  1IX9 A;  5KUK A;  3JAL B;  4YHH B;  3JD3 A;  1VQ5 V;  3L9D A;  1HNZ O;  1YZB A;  2EIL C;  2YUA A;  3K9A A;  4F4Z A;  3ETE A;  4GX1 A;  2R82 A;  1RPR A;  4J80 A;  2YL2 A;  1YCI A;  5KG2 A;  2HHH H;  5LMN H;  1B33 N;  1H2S B;  3NXS A;  1GO3 F;  4UCS A;  5C44 G;  2WLH A;  3G6E V;  2JEU A;  4FM9 A;  2BTQ A;  2CTQ A;  5JJE B;  1RM1 C;  3CWB H;  4K0K H;  2IH3 C;  2COG A;  1QR9 A;  5DQG A;  2H8P C;  4X62 B;  1HR0 O;  3K59 A;  3VOT A;  4O3O A;  3ZHU A;  5DAA A;  1NKD A;  1RJP A;  4DR5 O;  2A7W A;  3GB7 C;  1M5I A;  1SQP H;  4O4I A;  3EPI A;  4H0L B;  4DXW A;  3NUA A;  1YF2 A;  2ZNI A;  1VQ4 V;  4TV8 F;  3VQX A;  2C2R A;  2F1M A;  3C3T A;  4UCO A;  4DV2 B;  3K58 A;  5H9C A;  2ETN A;  1QLE C;  1UPG A;  1U96 A;  2CZG A;  3AG1 C;  3TGU H;  2QYZ A;  4MV1 A;  3H4D A;  3QZ7 A;  3RR5 A;  2EBO A;  3ABK B;  4E2L A;  5GON B;  5DLF A;  1EUC B;  3T1H O;  3VPB A;  4DV1 O;  2NU7 B;  2EIM B;  1Y1W G;  2VQF O;  2FPG B;  3CRM A;  3RAQ A;  4QWA A;  2O57 A;  2EJ3 A;  4LFB O;  5KFS A;  2FKX A;  3APQ A;  2V4Q A;  3JAS B;  2FLN A;  4O7N A;  4ECW A;  5BMV F;  3OMA B;  3HT5 A;  4I4T B;  4JV0 A;  1EYZ A;  2IW5 A;  3O9O A;  4MA5 A;  2JVD A;  1JJ2 U;  3U54 A;  1WNS A;  1TWH A;  2I8C A;  2NLJ C;  3M4I A;  3ZHT A;  5BPH A;  3G67 A;  5HBR B;  2WLN A;  5EWF A;  1IOV A;  1GH6 A;  4BIZ A;  1RP3 B;  3ABL C;  4ZI7 A;  3K57 A;  1K8A W;  1FKA O;  5C8Y F;  5CA1 F;  3RAX A;  1K34 A;  2Y69 B;  2FYU H;  2ATK C;  3HPL C;  3BAA A;  1K1Q A;  1FJG O;  2WA4 A;  4B3T B;  1T94 A;  3DGE A;  2DE0 X;  3K5I A;  3CC2 V;  3AG3 C;  2FJZ A;  4DLK A;  3WO1 A;  4BW5 A;  3HOZ G;  3TIN A;  5B1B B;  4W4K A;  5I60 A;  2DYR B;  4A3D G;  4X1Y B;  1JPX A;  2ZQM A;  3RBZ A;  2V59 A;  3QNE A;  1TUB B;  4EKW A;  4WFA V;  2PTM A;  2IJI A;  1WN7 A;  3ASN C;  4O7Y A;  4X8A A;  1N4C A;  5KFE A;  5LP6 C;  2AXT Z;  4R7R A;  3V6K A;  1YEW A;  3CC7 V;  3T5H A;  2E5L B;  1S3J A;  1XEQ A;  1KC7 A;  4H33 A;  4KXR A;  5HFM A;  1E1R G;  1FD9 A;  5KFG A;  1N32 O;  3LSS A;  4MTD A;  2FP4 B;  1N34 H;  3N42 B;  1XHZ A;  1P16 A;  5JJN B;  4W4L A;  3N44 B;  2VQE O;  2W9B B;  2JEJ A;  2W9C B;  1MSW D;  2AU0 A;  4RNO A;  3DTF A;  3E8G A;  4GX5 A;  3KTM A;  3GWK C;  1SFO A;  3CJH A;  4DR5 H;  1WA8 A;  1QVG U;  2QK4 A;  2ZDG A;  5KFO A;  3T1Y H;  3ZS8 C;  2XGP A;  4H37 A;  4DR4 O;  4J9O A;  2EIJ B;  3ZN0 A;  1KJI A;  2UXD B;  2YZM A;  1PD3 A;  4WCE V;  3E83 A;  3CEB A;  4JYA H;  1K33 A;  1JJO A;  5BPF A;  4JI3 H;  2ADQ B;  4IZO A;  1YSC A;  4RZR A;  4AYB A;  5LA6 A;  5L1K A;  5EYP A;  2DLN A;  4O7L A;  3ASO C;  3G4S V;  5KX5 A;  4UCV A;  5H5N A;  1K9M W;  4AQY B;  2E74 B;  3T1H H;  3K3V A;  1HDJ A;  1K3E A;  2VQF H;  3CHX A;  2UXB O;  3V6J A;  2X0S A;  1TVK A;  1G4Y B;  4QJF A;  4PHZ A;  1S0N A;  4IR1 A;  2WWW A;  4TQD A;  4WBN A;  4PI0 A;  1QQC A;  3FB6 C;  2MCT A;  5BZB A;  2E75 B;  4ZBM A;  2DPJ A;  1N33 B;  2FE3 A;  3BEH A;  3RB6 A;  2EIN B;  3JAT B;  4GLX A;  1YIJ V;  3OEH G;  2R70 A;  2ZJT A;  1Z5W A;  1FJG H;  4TV9 A;  2V9W A;  3P3N A;  3BA9 A;  2CAZ C;  5KA6 A;  2LFR A;  2HG8 A;  1I1L A;  1KU9 A;  2OIG A;  4NTY A;  4X89 A;  2R7Z A;  2EUL A;  2YZG A;  5JWP A;  1FAF A;  5L3C A;  3OHA A;  5EZY A;  2Q7G A;  3QO5 A;  4YJ3 B;  3JSN A;  3CCL V;  1E4E A;  4PA7 A;  4DR7 O;  4NLG A;  3R65 A;  1AI7 A;  2RJZ A;  2FPI B;  4KP4 A;  4J9R A;  1SQF A;  1BJT A;  1GSH A;  1KTA A;  2QTO A;  1XUQ A;  3FAV B;  4DUY B;  3PW7 A;  2V7Q G;  4CMF A;  5BWX A;  1NJI W;  1KMI Z;  1HP8 A;  3OR7 C;  5D1O A;  4ECZ A;  3IN5 A;  1K4D C;  3GLK A;  3TY8 A;  2RN9 A;  4NKG B;  3JAR A;  5BR8 O;  3OSN A;  2FML A;  1KEC A;  1L1F A;  1ET0 A;  2HGS A;  4DK1 A;  3C3S A;  3OR6 C;  2PBZ A;  2FLP A;  4MTE A;  4DV3 B;  1QVF U;  3OUF A;  5LXT B;  5IE9 A;  2OTJ V;  2YRX A;  4O2B F;  5KT4 A;  3B40 A;  4A3J G;  1S68 A;  1H8E G;  4BWA A;  4JXU A;  1QU7 A;  3E2E A;  2VA3 A;  4LF5 O;  1SQX H;  2A79 B;  3D36 C;  1QLN A;  4ECX A;  1NZ6 A; 
#chains in the Genus database with same CATH homology
 5LOV B;  4F6R B;  3JAL A;  4RAZ A;  1IBM B;  1JFF B;  1WPB A;  3RTX A;  4YY3 H;  5FLX W;  4LNU B;  1O9G A;  4DR1 B;  4I9Q A;  2HVS A;  4O4H A;  4TUY A;  4NXN H;  3KAJ A;  3RJ0 A;  4JI8 B;  4YY3 B;  4ZI7 B;  3ETQ A;  3NC0 B;  2F4V H;  4DV5 H;  4NXN B;  4LF9 H;  2UXC H;  1VS0 A;  5IWA H;  1X4T A;  1AN7 A;  3WB1 A;  4IIJ A;  1Z2O X;  4DV5 B;  4DV4 H;  4LF9 B;  5K1P A;  2UXC B;  5IWA B;  4JI2 H;  2RGV A;  4NXM B;  1XK5 A;  4DV4 B;  4DV7 H;  2RQ6 A;  4JI2 B;  1Q8I A;  5JVD A;  4K8Z A;  1XQ8 A;  4YJ2 A;  3BAB A;  2ZM6 H;  2KKW A;  4TV8 B;  3L4K A;  4DV7 B;  1JMK C;  2PZS A;  2HIV A;  1XMQ H;  5D5Q A;  2YXL A;  2ZM6 B;  1X9N A;  3FMA A;  1XMQ B;  4FLX A;  3HKE B;  4IAJ A;  2Q2U A;  3N6X A;  4O2B A;  3RF2 A;  1SA0 A;  2QJ1 A;  3BA8 A;  1CKM A;  2WE6 A;  4KHP H;  4PZ8 A;  3HKD A;  2XIG A;  2VUG A;  1J5E H;  2IM9 A;  3RYI B;  4FM0 A;  3HKB B;  5JH7 B;  4KHP B;  4CS2 A;  1XMO H;  3RYF A;  4FLY A;  5D5P A;  2PYL A;  3KAL A;  2OYQ A;  1J5E B;  4DR7 H;  5BMV B;  5JQG A;  1N33 H;  3N2G A;  3RGZ A;  2VWJ A;  3QTC A;  3HKC B;  1XMO B;  3CVZ A;  1TGO A;  3JAW A;  4FM1 A;  5K1X A;  2ZCE A;  1TAE A;  4UCU A;  3RFR A;  3JAM W;  5LYJ A;  4HNA A;  4YJ3 A;  4X1I A;  5FPR A;  3JAS A;  2Q7E A;  4DR2 H;  3B2E E;  3RGX A;  4JI6 B;  1Q5O A;  4DRX A;  3N2K B;  5FNV B;  1XHX A;  4LF7 H;  4LF6 H;  4DR2 B;  3QF7 A;  4GYC B;  4JI7 B;  1Q3E A;  3GB8 B;  4J0M A;  1FFX B;  4IHJ B;  4LF7 B;  4LF6 B;  4O4J A;  3UQ8 A;  3JAK A;  3VQW A;  4FFB B;  4CH4 A;  1FVI A;  4X66 H;  5KX5 B;  4I55 B;  4B3R H;  4U3J A;  1ZHQ A;  1XNR H;  4PI2 A;  2BTO A;  4PZ6 A;  5IJ0 A;  4RZQ A;  5DIS C;  4B3R B;  4X66 B;  4JI1 H;  4EQ5 A;  1N36 H;  1QHT A;  5J2T B;  3UT5 A;  1XNR B;  5CA0 A;  4X65 H;  4TOI A;  4DR3 H;  5LXT A;  4B3M H;  4OX9 H;  4X1K A;  4JI1 B;  1N36 B;  4CH3 A;  4ZOL A;  4O4I B;  4ZHQ B;  4FLT A;  3H20 A;  4X65 B;  3FFQ A;  4DR3 B;  4B3M B;  4OX9 B;  5LL6 b;  3W5O A;  1TA8 A;  4D7T A;  4MV7 A;  5LOV A;  3SR2 C;  1JFF A;  3W1G A;  1DGS A;  3RWR D;  3K5L A;  1XDN A;  4DK0 A;  5JCO A;  5KHH A;  3N41 B;  4A2A A;  3L2P A;  1O9H A;  4LMY A;  3SJA C;  3RYC B;  4Q0Y A;  5EOY A;  4JI4 H;  5KMG B;  4FLV A;  5EZY B;  1ZAU A;  1IBK B;  4LF8 H;  2ZIN A;  3WB0 A;  2XHB A;  3MWM A;  4B3S H;  4JI8 H;  4JI4 B;  4LF8 B;  1XNQ B;  1SYX B;  4EB6 A;  4B08 A;  4X64 H;  4JI0 H;  4CS3 A;  5JCO C;  4B3S B;  3MAQ A;  3DF7 A;  3BHP A;  1NT2 B;  3GJX B;  3E22 A;  4X64 B;  1E4F T;  4JI0 B;  5D1O B;  3BPZ A;  4HBN A;  1HNZ H;  5KHK A;  1ZHS A;  2UUA H;  4NXM H;  3CSX A;  2V4D A;  3JAR B;  3J80 W;  4RB2 C;  1M0W A;  2UU9 B;  4UCT A;  1HNZ B;  3IG0 A;  4X20 B;  3K5O A;  1CKN A;  4LSA A;  5ITZ A;  2YI9 A;  5LP6 B;  2UUA B;  1A0I A;  1SEI A;  3RYH B;  4RB0 A;  3WB2 A;  4UCR A;  4DV6 B;  3TY5 A;  1M4U A;  5IJ9 A;  4LFA H;  4RB1 A;  2Q0A A;  5FD5 A;  1I6U A;  4YHH H;  3RYI A;  2JGU A;  2HVR A;  3HKB A;  5JH7 A;  5IT9 W;  4LFA B;  1M0T A;  2PGG A;  3JAL B;  4YHH B;  4O4L A;  1HR0 H;  4LR3 A;  4O4H B;  3HKC A;  1L8D A;  2ZNJ A;  3KYH C;  4L8J A;  1I7F A;  2PUS A;  1Z2N X;  1O75 A;  1HR0 B;  3JAT A;  4NVP A;  4PDB A;  2R72 A;  2HHH H;  5LMN H;  5CB4 A;  1H2S B;  4DR5 B;  3N2K A;  4LH7 A;  4IIJ B;  4UCS A;  1S03 G;  3K5N A;  3VNN A;  2HHH B;  5LMN B;  4FM9 A;  3LML A;  4IHJ A;  2BTQ A;  4RAY A;  3OTO B;  4LSX A;  2HIX A;  3VQV A;  5C8Y B;  5JJE B;  4JI6 H;  5CA1 B;  4X62 H;  4I55 A;  5JVD B;  3QG5 A;  1S5J A;  4BWS C;  4I50 A;  4DV1 H;  2UUC H;  4K0K H;  4AHC A;  4JI7 H;  4ETS A;  4GKK H;  4X62 B;  2HVQ A;  4LFB H;  3K59 A;  3T1H B;  2UUC B;  4DV1 B;  4K0K B;  3VQY A;  4GKK B;  5LA6 B;  4LFB B;  1L2Z A;  4O2B B;  1P49 A;  5EYP B;  3SJB C;  1M5I A;  4O4I A;  4ZHQ A;  4DV2 H;  2F95 B;  3U0Z A;  2ZNI A;  4DRF A;  3VQX A;  2F93 B;  4M7E A;  4DR6 H;  1GYF A;  1FKA H;  2F1M A;  3EYY A;  4LFC H;  4UCO A;  4DV2 B;  3K58 A;  1SQG A;  1TVK B;  1Z2P X;  4DR6 B;  3J81 W;  4LFC B;  5JQG B;  4LF4 H;  3RR5 A;  5IYZ A;  5GON B;  4WBN B;  4APM A;  1FJG B;  3DSQ A;  4LF4 B;  3RYC A;  2P22 C;  3NBZ B;  5LYJ B;  4K8X A;  5J2U A;  4X1I B;  3JAS B;  4F6R A;  1Q43 A;  5KHI A;  4I4T B;  4TV9 B;  3PN1 A;  4LNU A;  3GDE A;  1WH2 A;  3K5M A;  2JVD A;  1WNS A;  3M4I A;  4O2A B;  5FPO A;  1IBK H;  3IAY A;  4B3T H;  3K57 A;  2YI8 A;  4CH6 A;  4ZI7 A;  4O4J B;  3JAK B;  4GKJ B;  3THO A;  3TY9 A;  2VWK A;  1XNQ H;  3BAA A;  1B04 A;  4FVM A;  4B3T B;  1MZB A;  1Z5V A;  5KHJ A;  2PY5 A;  5A2Q W;  1N32 H;  1SKV A;  2RGR A;  3U10 A;  4X20 A;  3UT5 B;  5LP6 A;  2EX3 A;  1N32 B;  4MV9 A;  4X1K B;  4Q6G A;  3RYH A;  4BW9 A;  1CKO A;  2VQE H;  5LMU H;  4ZOL B;  1G6U A;  3W1B A;  3S24 A;  3LNN A;  4TV8 A;  4X1Y B;  2UU9 H;  4JI5 B;  5EIB C;  3N40 P;  1HNW H;  2E3C A;  2VQE B;  5LMU B;  3HXL A;  1TUB B;  2PTM A;  5D1P A;  1WN7 A;  2E5L H;  4DV6 H;  4DR4 H;  2YIB A;  1HNW B;  2O03 A;  5LP6 C;  2UUB H;  4R7R A;  3HKE A;  2WDT A;  2Q2T A;  4UFZ A;  1YEW A;  2CW8 A;  1M93 A;  3U11 A;  2E5L B;  1VF7 A;  4DR4 B;  3RGB A;  2UUB B;  2WYO A;  3M7M X;  1RSO A;  3NBY B;  3BRC A;  1I94 H;  2OWO A;  4MTD A;  4LH6 A;  1N34 H;  2ZIM A;  3SJC C;  3N42 B;  4DUZ H;  5BMV A;  2F4V B;  1XHZ A;  1P16 A;  2JS5 A;  5JJN B;  1I94 B;  3F8N A;  2UXB H;  3N44 B;  3J7A K;  4EB6 B;  1N34 B;  4TUY B;  2P5O A;  4DUZ B;  2CW7 A;  2Q7H A;  4D7S A;  5C8Y A;  2UXB B;  5CA1 A;  4DR5 H;  3E22 B;  4RB3 C;  1HNX H;  2CFM A;  3C0F B;  2UXD H;  3T1Y H;  3OTF A;  3ZS8 C;  4CC5 A;  1T5E A;  5FNV A;  1HNX B;  4JYA H;  2UXD B;  3T1Y B;  3OTO H;  1JJO A;  1XI1 A;  4JI3 H;  1CKN B;  5ITZ B;  5LA6 A;  1FFX A;  4AQY H;  4JYA B;  2YIA A;  5EYP A;  3N43 B;  4CS4 A;  4FFB A;  4JI3 B;  5KX5 A;  4UCV A;  5IJ9 B;  4YJ2 B;  4AQY B;  3T1H H;  3K3V A;  3JSL A;  2VQF H;  3CHX A;  3A2F A;  2R9A A;  1TVK A;  5J2T A;  4PHZ A;  2VQF B;  2GV9 A;  4O4L B;  2PYJ A;  4TQD A;  5GON A;  4WBN A;  4PI0 A;  4FLU A;  1QQC A;  4E6N A;  1SA0 B;  1BGW A;  2MCT A;  4DR7 B;  3KAK A;  1N33 B;  2FE3 A;  3HKD B;  3JAT B;  4GLX A;  2R70 A;  4DV0 H;  2ZJT A;  1Z5W A;  5CB4 B;  3RYF B;  3ZED A;  2F66 C;  3SGI A;  1FJG H;  4I4T A;  4TV9 A;  4PZ7 A;  4JV5 H;  2ZIO A;  5BR8 H;  3N2G B;  4DV0 B;  5JJJ B;  4O2A A;  3BA9 A;  4FM2 A;  2CAZ C;  4AIL C;  3JAW B;  4CC6 A;  2BTQ B;  4JV5 B;  1KU9 A;  4KL1 A;  5BR8 B;  4I7H A;  4A2B A;  4EFB A;  2QM4 A;  2KSW A;  4EFE A;  5EIB D;  5KMG A;  5EZY A;  2Q7G A;  4HNA B;  4YJ3 B;  3JSN A;  4I50 B;  4LF5 H;  2RJZ A;  4DRX B;  5FD6 A;  4DUY H;  1IBL H;  4GKJ H;  1SQF A;  4ZIB A;  5KHG A;  1BJT A;  4CH5 A;  4LF5 B;  3RIZ A;  4DUY B;  1IBL B;  3CB2 A;  1V9P A;  3L4J A;  2HEP A;  1E4G T;  4X1Y A;  1KMI Z;  5D1O A;  4U3J B;  4FLW A;  3TY8 A;  5IJ0 B;  4EEQ A;  1TUB A;  4DV3 H;  1D5A A;  3JAR A;  1P8L A;  2YIB D;  3KXY T;  2HGS A;  4DK1 A;  5CA0 B;  4MTE A;  2YCH A;  4DV3 B;  5LXT B;  4JI5 H;  3ICX A;  5IYZ B;  1HW7 A;  3QWU A;  2VPS A;  1S68 A;  4BWA A;  4TQF A;  1IBM H;  2W57 A;  4DR1 H;  2VOB A;  4FLZ A;  5J2U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...