3UQ8A

Structure of adenylation domain of haemophilus influenzae dna ligases bound to nad+ in adenylated state.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
NIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVARIEDRLILLPAPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQEELTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Understanding of NAD(+) Recognition in Bacterial DNA Ligases.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA ligase
total genus 106
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2011-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3uq8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3uq8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3uq8A02
2HIVA 1B04A 1TA8A 1N33B 4PZ6A 4DV6B 1XNRB 2HIXA 1N36B 4LF5B 1XDNA 4LF9B 5D1OB 2Q2TA 4OX9B 4JI6B 4GLXA 2E5LB 4GKJB 1IBMB 4DV1B 4JI5B 4DV5B 1P8LA 4EEQA 4JI1B 2UXCB 4JI2B 4EFEA 1HR0B 2UUBB 1A0IA 2F4VB 2UUCB 1VS0A 1CKMA 4B3MB 4E6NA 4UFZA 1N32B 1XMOB 4JV5B 4B3RB 3KYHC 5IWAB 4X66B 4X65B 1X9NA 5DISC 4NXNB 3NBZB 4DUZB 2UU9B 1V9PA 1J5EB 4DR4B 1S68A 3NC0B 4LH6A 2UXDB 2CFMA 1IBLB 5FPOA 3GB8B 4PZ8A 3UQ8A 2UUAB 1DGSA 1HNWB 1XMQB 4DV2B 3GDEA 2Q2UA 3W1GA 1CKNB 4DR7B 4LFCB 4DV0B 2HVQA 2ZM6B 4JI0B 3BAAA 5LMUB 4EFBA 4TOIA 4LF7B 5D1PA 4CC6A 4LF6B 1TAEA 3T1YB 2VQFB 2HVRA 1ZAUA 1CKOA 4UCVA 4PZ7A 5BR8B 2VQEB 3NBYB 3BA8A 3RR5A 1IBKB 5LMNB 3JSNA 4DR3B 1XNQB 3TY8A 2VUGA 3QWUA 4YHHB 4DR1B 4LF4B 2OWOA 4X62B 4LFBB 4NXMB 1HNZB 4JI3B 4DV4B 4JI4B 3W5OA 1XK5A 2HVSA 3L2PA 3BA9A 4LH7A 3OTOB 4LF8B 4LFAB 1CKNA 1FVIA 4B3SB 4JYAB 2HHHB 1HNXB 5FPRA 3W1BA 3JSLA 4DV3B 4AQYB 3BABA 4JI8B 4DR6B 4DV7B 4DR5B 4JI7B 4YY3B 4K0KB 4B3TB 4UCRA 4DUYB 2UXBB 5D1OA 3T1HB 3S24A 3RTXA 1N34B 4GKKB 4UCOA 4UCSA 3SGIA 4KHPB 3VNNA 4X64B 3GJXB 4DRFA 1I94B 4CC5A 1P16A 4EQ5A 4UCTA 1FJGB 3PN1A 3TY5A 3TY9A 4DR2B 4UCUA
chains in the Genus database with same CATH superfamily
2HJDA 4IT5A 2EJ2A 4MV6A 2ZR2A 1AI5A 3DXRA 3JAMN 4C2MA 1EYZA 4GKKO 3OTOO 5KG2A 1VF7A 1FJGH 4HBNA 1UNNC 2E5LB 4LR3A 4CS3A 3K79A 2LFRA 4JI1B 1O9GA 3J81W 3PR5B 4NB5A 3AG1B 4LNUB 4EFEA 1A0IA 2QKSA 4B08A 1NKDA 4O7NA 4TUYA 1BQ0A 3Q1KA 1U97A 1O9HA 1UJWB 1JX9A 1KEEA 4UVAA 2F4VO 5BR8O 4C7UA 3OW2U 1H8HG 5KT2A 4I55F 4Z2WA 5DISC 5KG7A 5CA0B 5KLVH 5BPHA 2Q5ZA 2WWWA 3WU2Z 4I50B 4KHPO 4DV1O 2R72A 4FK5C 4JAUA 3LWBA 4XDLA 2JA7G 5KHHA 4YHHO 2QGNA 2WLKA 2XIGA 3WWJA 1MMMA 2B1GA 3K3PA 1KKCA 5LMUB 2YCHA 4LWSA 2XC9A 3A0HZ 1MA1A 3MWDA 4B3MH 1JPXA 4AQYO 1RM1B 4CHIA 3STLC 1FD9A 1WB8A 3F5WC 3UKMA 2HJWA 3MJFA 2ZXWC 2QF7A 1ZX3A 1K34A 2PBZA 3RJ0A 3WFVA 2ILMA 4U7CA 1TWFA 1XL4A 3T9BA 2V4DA 3V6HA 3SPHA 5H2FZ 5IYDO 5BYAA 2B5UA 3CJHA 4DL3A 2AU0A 3L2PA 1KU9A 3EFFK 2DLNA 3GTMA 2LQTA 5CBHA 4GC6A 4JYAB 2AGOA 2HHHB 2XGPA 5JH7A 5EZYF 2YSUB 2V4RA 1S72V 5DG8A 1VQOV 5L1KA 2M7WA 5IYCG 3ABUA 3JATB 4R8CA 3ZJZA 3J81N 2UVWA 3EXAA 4JI8B 2IM9A 3GIKA 4RU9A 3I4MG 2A79B 2DJVA 1ORQC 3RYFA 3TEKA 2W6QA 3MFHA 2PN1A 4DW0A 4ED6A 4DR6O 4BBSG 4I4TF 2W70A 1M90W 2ALZA 4CS2A 2R92G 1BCCH 3M99B 1YITV 2YWVA 5DQGA 5KFMA 2R8GA 4UCTA 5C1OA 3E8FA 3VPBA 1EBOA 2EINB 4FFPA 4PZ6A 4O4JB 3LDCA 2UUAO 5I5XA 2CDYA 1XNRB 2HIXA 4IRKA 2JEXA 3Q8RB 5T14A 1ZL8B 4RUCA 4O4HA 2JGDB 5C8YA 3BQ2A 1KC7A 2HG5C 4JI6B 1J5EO 3L74H 1YF2A 1RPRA 3HOUG 3LUTB 4ZOLB 1YCIA 1IX9A 2JEJA 2Q6AA 3A8TA 2LGQA 4NXNO 4LF8H 1KUQA 1XREA 1JFFA 5H80A 2YC0A 2MK3A 3HKBB 2P90A 3ZHVA 1HDJA 3OSPA 1FJGO 2OH2A 2FTKA 3GIQA 3JCUZ 3OTOH 2NR5A 4MVQA 2HP8A 2IBZH 4H33A 4O4LA 4JAAA 4MV9A 1BQZA 4FM2A 2WLMA 3A2FA 2UUAB 1JDEA 2WLIA 4ED7A 5DECA 2R7MA 4ECVA 1SKVA 2WAQA 5A2QW 1XMOO 3OHAA 5LOVF 2EIJC 2OTLV 3H1IH 5FD6A 4XDKA 1YZBA 3HXLA 2QYZA 1QNMA 4MVRA 4I7HA 1N8RW 4JYCA 3P30A 3SJQC 5LMNB 2CUGA 1VQMV 3OMIB 5H6RA 2UUCO 1OCOB 5KAIZ 2MCTA 2XAQA 5IJ0A 3VA7A 2XD4A 1O75A 1B3QA 2VR1A 2FB5A 1SA0A 1M4UA 1YJNV 3HOZG 3BA9A 4ECUA 5J9PC 1M57B 3U9SA 5IYCO 3HKEB 2A1HA 3U55A 3K57A 1VQ7V 2UVVA 5FPRA 4I50F 2R86A 4HYOA 1BSMA 3GIMA 3LQSA 4HZ3A 3UO2A 2OCHA 4PHZA 3ZRXA 4PBCA 2JK5C 3HKDB 5KT5A 3GWKC 2KG7B 5BZBA 4N23A 1CPYA 2P6JA 4ZI7B 4X9QA 5JVLA 4GKKB 1QR9A 4CKCA 2A7WA 5IT9W 3RYFB 3SPCA 2PYJA 2BSKB 2PZSA 4GCZA 4J7ZA 4TT3G 1V54C 4UVBA 4MS2A 3RFCA 3MR3A 4BR6A 4O3RA 3MHHC 3CPWU 4I7ZB 1S76D 1RYSA 1ZUQA 2DYSC 3UT5B 2V5AA 2BSKA 1YIJV 4ECTA 2ZINA 2HGSA 3ZBHA 5DLFA 2R82A 2F95B 4IYIA 5DN6G 2HDKA 1NH2D 1M1KW 5KG6A 4DR3H 2IMWP 4IAJA 3OUFA 1ZQ7A 3PW5A 1R9TA 4LCUC 4OX9B 3ZN1A 2EBOA 4PD4F 4QW9A 1IBLO 3G6YA 4LF5O 4LFCH 2E74B 1S0VA 2VQFO 1IYDA 2YZGA 5KFEA 5JJEB 1ZHSA 4DYLA 4FZ0A 4F6RA 1PPJH 2HFEC 2I80A 4YBZB 4ZOLF 2R7ZA 2WPDG 2LJ2A 3FDSA 2B1IA 4B3RB 2ASDA 5IWAB 2EJ3A 1ULZA 1Y74B 3B8NA 2K1EA 2QWQB 3T54A 3DSQA 2E5LO 5F9NA 1F51A 2XAJA 1YEWA 5DEDA 5B1BB 4GKJH 2GUZB 3D3IA 2BE3A 5KFOA 1YVWA 2XAFA 1CQIB 1D5NA 2V7QG 2GQRA 2GPSA 1KECA 2CTRA 2IJHA 1GMGA 2W6OA 1NTZH 3L75H 4JI0H 3ZMUA 5IYDG 5KFIA 4LF6B 2P06A 2EZPA 3K08A 2NLJC 2D2CB 1GN2A 2Y0PA 4X1IA 1WJZA 4JTAB 4TV8F 3H9VA 4LFAH 2CW8A 4IIJB 1I5XA 5LP6A 1AP5A 1K4CC 1R3LC 1I2LA 1SCUB 4QE7A 5I5WA 2W9BA 4LF4B 5LMUO 3GV8B 3AK2A 3ZX6A 2R7KA 3CCMV 4A3LG 1I1LA 4GKJO 4PJ0Z 2CTQA 3RAQA 4I9WA 4ED8A 4UV9A 4YAJB 1S0NA 4LF8B 1KD1W 5CB4F 4K35A 4GX0A 4QIWF 2F1MA 4DV3O 3HKZE 3JSLA 1EZVH 4J11A 5LMUH 3S3WA 2C2EA 4O7LA 3V4ZA 3CCEV 1BXRA 4Q4DA 2IU0A 2UXBO 1K3EA 2YI9A 3K0DA 3G8DA 3D3QA 4K0KB 1AR4A 2I87A 4B3TB 4UCRA 1IBLH 4WBNB 4FU0A 1W0KG 2AW9A 5FD5A 5LHIA 1T94A 4DRXA 4K8ZA 2JEIA 4EB6A 1T5EA 2PF4E 1J5EH 1T36A 2VPQA 2IP4A 3AG4C 1DIKA 3TY9A 1EKFA 2GDSA 4O3OA 1B04A 4RB1A 4I4TA 4JYAH 4JI3H 3JRWA 4BWSC 4QJFA 3CRCA 3K9AA 1IBMO 4LF9B 4IRCA 1AJQA 4B3RH 2VPSA 2UXCB 5KMGA 3T1HO 1RSOA 2QE7G 3CMAV 5BWUA 1IBMH 4FFNA 1PM9A 1P7GA 3RWRD 4X1YB 3CRAA 4NTYA 4E6NA 1A32A 4J9SA 4WFBV 1E4FT 3JD2A 4DV6H 5KA5A 4CMDA 2RGRA 3HKDA 2P67A 4XX0B 5BMVB 5CM0A 4R8UA 1YTFD 3NBZB 4DUZB 1XILA 1QU7A 1J5EB 3C90A 4LF6O 5KT6A 3BFRA 4DV7H 1YXBA 5KHGA 3BY6A 4CKEA 4ABMA 2Q8VA 2V4QA 1I1KA 1FXKA 5LL6Y 4NZNA 3ZHQA 3KHRA 4O2BF 4O4HB 1E4EB 1RK6A 4DL6A 1K7DA 3O9OA 4DR7B 5J2TF 2KKWA 3KALA 4JUZA 4NKGB 4M9UA 1JXLA 2J6UA 1PNLA 2A06H 2PGGA 1EHIA 1AB3A 4CH4A 3IN5A 1EUDB 4F6RB 3CJHB 4DV3H 4MV7A 4DL7A 2AXTZ 4MAMA 4J9PA 2AGQA 4X89A 1XNQB 2QWOB 3CXCU 1LNQA 3K0GA 2E3CA 3SDLA 3TIIA 4NLGA 3SYAA 4XYLB 3Q2OA 1VQ4V 4GT1A 1UC9A 3ZMTA 4U3FH 1AVMA 3RB4A 1PV0A 1WCMG 5B1BC 4FM9A 3ZHTA 4JV5O 1KBHA 2OIEA 2QWPB 1X59A 1VP7A 1WB7A 4P2ZA 3CCQV 2R6FA 2JA6G 4O81A 2FL4A 5IY5C 1GK9A 2Q68A 4I0XB 3B09A 4I4TB 3H01A 4GZRB 1AI6A 4JI5O 4LBEC 1SQBH 3ORQA 3Q4HA 3P3NA 4Z1MG 3DC6A 1Y14B 2B9ZA 2UXXA 5DGAA 5EC1C 4LF9O 3R5FA 4AYBA 3QQMA 2QKAA 3TCUA 1PNKA 4FVMA 2ZD9A 2FMLA 4P9PA 3JAMW 3TQ1A 4FLZA 2H3OA 1KJJA 2R7ZG 3QF7A 1TA8A 1VQKV 3GIIA 4IZOA 1M56C 3W7UA 4JI1O 4IL6Z 1SS3A 1XDNA 4TV9A 5EWGA 3JAWA 3CCSV 1P8LA 4JI5B 2WAMA 1R6NA 4M0JA 3J7AU 4NXNH 2VWKA 2F4VB 4ZBMA 1P84F 2EIMB 3Q8SB 2ZNIA 2V1DA 1L0NH 5KFSA 3L4KA 3RBZA 1XMOB 5KFNA 3W7XA 4JV5B 4JYBA 5EOYA 4DV2H 2W7OA 2YICA 3JYCA 2GSMB 3RT3C 1SQGA 2EIKC 5J2UB 4NXNB 3H40A 2Z5UA 2UU9B 3NC0B 3SI8A 2ZXWB 4J9NA 3HO8A 2UXCO 1QBZA 2JA7A 1Y1VA 5BY1A 5FLMG 1AR1B 2PTMA 2ZIMA 2UXNA 1Q81W 5LGTA 1IVSA 2JJ2G 1XNQO 4NZOA 3W1GA 1Y76A 2HVQA 4X1KA 2ZM6B 1TUBB 3UFXB 3E83A 4QGPA 1AUXA 2ASJA 5D1PA 1NVPB 1AJPA 2Q4PA 4DL2A 4DR4O 4HNVA 4JYAO 5HV6A 3H1LH 5IJ9B 4I9QA 1NVPD 1WH2A 2ZGIA 3DXRB 5D5QA 3ABKB 4PDVA 2AHZA 4YJ3A 3RR5A 4OXSA 4MT8A 5IP9G 1Q6HA 3TY8A 4FFBB 1EN6A 2VUGA 3QTCA 1N36O 1KJ9A 1K73W 5GONB 4X62B 1IOWA 4NXMB 1CXZB 2ZE7A 4O7SA 4XYMB 3RV3A 3DF7A 2UXCH 3VMMA 2DIKA 3ABKC 5C44G 1CP9A 4QSHA 1G2WA 1CKNA 2NU7B 2HEPA 2CTWA 1FVIA 2Z04A 4FLWA 4ECWA 2FPIB 1Y66A 4O4IA 4DUYH 3PW0A 5CA1A 3P3PA 1W93A 4FLVA 1B6QA 3ETJA 4FE2A 3GIPA 4IHJA 1N56A 4UB6Z 2BTQB 2XT9A 1SFOA 2YXHA 2C2DA 4R7RA 4DR6B 3X2QB 2NVYA 2WLNA 4YY3B 2YZLA 3E22A 3RW0A 1KC8W 4MSWC 4RAZA 1WA8A 3AK1A 3CRRA 3JAKB 1VQ6V 2R87A 4O2BA 4LWSB 3VNNA 4FM1A 5F9LA 4QWDA 4FLUA 3ZRSA 4K0KH 3JD4A 4OGQB 4E4TA 2Z0AA 3MR2A 4LFAO 2DABA 4QWAA 4TQRA 1TWHA 1WR2A 1FFTB 3FKSG 1QR8A 4JV2A 1WCMA 2R85A 1Z2NX 2VQDA 1M6VA 1H2MA 2E76B 1MSWD 4ZI7F 3ZMVA 4ICGA 2DWCA 2K9PA 4Q8FA 4MTXA 1HNWH 4GKJB 3CMEV 1C3OA 4X62O 5L3FA 4JV1A 4XZ3B 2H8PC 3ASNC 5KUMA 2V9WA 4Q43A 3K06A 3CP1A 3ZRWB 4RAYA 1B6RA 5GTIZ 5A2QN 1K8AW 2OYQA 3T7AA 2E5LH 2C22A 3UZBA 3CWBH 3GTGA 5KX5B 1FXVA 1S68A 4DR4B 2FPPB 4FFKA 4YP3A 3FD9A 3NGDA 1UPGA 4JI2O 2CFMA 1GTOA 3JZIA 5L1LA 3FMAA 3GB8B 5DMXA 4ZHQA 1IZ3A 2KB1A 5LP6C 5LYJA 1G6UA 3T9EA 1EN4A 3OHBA 1I7FA 3ASOB 2R9IA 4EFBA 1QLEC 4O4IF 5DQIA 4TQSA 5BWTA 2RDJA 1K92A 3PJSK 3QZ8A 2UU9O 1L1FA 1US6A 3OFNG 3GTJA 5KKNB 3KKYA 3JASA 1Y4MA 4A3IG 4CZZA 5BR8B 3ETGA 4X1KB 4EG0A 5I5TA 3RIZA 4DR1H 2P5OA 4QIWA 2EIMC 4O3QA 1VARA 1W59A 3TW6A 2WAQE 3KXYT 5KG1A 2HVKC 3N2GB 1NU1H 4NYEA 1JIHA 1SZXA 1WPBA 3ABLC 4DR1O 4A3FG 4B3TH 1MZBA 4EEYA 3KAKA 2WLLB 3IC9A 4MV1A 1HW7A 1DLBA 3CVZA 4AILC 3HB3B 3OD4A 4FFRA 2R92A 4WFEA 1Q6UA 4F6EA 4B3SB 1A0GA 2R7LA 4R50A 4DV6O 4DK1A 3L70H 5GONA 2RF4A 4MW3A 1VBGA 5KG5A 1CEZA 2W6ZA 2P4VA 2RGVA 1N48A 2UVUA 4JI1H 1ZSPA 3JAWB 5BMVA 2W8KA 2RJZA 3TXQA 3HOXG 4A3DG 2JGDA 5C8YB 3CC4V 4ED3A 1FXHA 2RMKB 3S24A 3RVYA 4HN2A 2FP4B 3CS5A 2FE3A 3VPDA 4KHPB 5I5SA 1YJ9V 5DLGA 3AK3A 4BAYA 3FB7C 1GKFA 4LF9H 5DAAA 4DL5A 4JI8H 1RJRA 5IYBO 3HT5A 5EC2C 5LOVB 2Q7DA 4DV6B 2NU8B 5BPFA 2JA5G 5JUMA 4GX2A 2WE6A 4AYBE 4DV0H 4JZ2A 4DUZH 4AI8A 4QWEA 1EKVA 4OPAA 2FK3A 1KP3A 3AG3C 5KA6A 3K5LA 1CQJB 2KSWA 3WB1A 5B66Z 5FNVA 4DV5B 4JI2B 3M7MX 4EB6B 3TINA 2UUCB 3N43B 5D5PA 2EJ0A 1AROP 4UFZA 1MABG 2PUSA 4K6NA 4LMYA 2OIGA 3O65A 5LGNA 5KT4A 4TV8A 5JQWA 1Q8IA 1VQNV 3RGBA 1V9PA 5EWEA 4J42A 3N44B 2DYRB 1GSAA 2Y0SE 1FPOA 1WP8A 3RFRA 5FPOA 3GILA 2WYOA 5C1PA 3HB9A 3IJ4A 1N34H 1XUQA 5H9CA 1CKNB 1FS0G 4DV0B 2ZDQA 1P49A 2RQ6A 5KUKA 3M8AA 1GN6A 3N6RA 4GYCB 2BQUA 3KCYA 4J80A 2EIYA 4YB8B 3MDSA 2ZM6H 1F7YA 1CS0A 2DWEC 3P32A 1GN3A 1SYXB 2JVDA 4FJCC 3VQYA 1ET0A 3BA8A 5CMUA 1E4GT 5LXTA 5KFJA 2UUBH 1EN5A 3Q8PB 3H1HH 1VF6C 2Y0IA 3U0GA 5L1IA 3MHSC 1N33O 1VQ8V 3H0GG 2JEGA 5FR9A 4H13B 3N2KB 3T1CA 1JLLB 1JVMA 4MVZA 3FYIB 5KFWA 2XASA 2WLIB 1AI7A 3OT7A 4O7TA 2QSAA 4O2AA 4A3JG 2A3QA 3UT5A 4JV0A 1HNXO 3FFQA 4BIZA 1TVKA 4A2AA 3KTMA 2YIAA 2FJZA 3U11A 2DW4A 3HOVG 2UVRA 4B3TO 2Y69B 4LFCO 4RNOA 4JI3O 1BMFG 3WG7B 4FFBA 1VF6A 1EZ1A 3RTXA 4K8XA 3T5LA 3QO7A 2KG7A 4D6TH 3LULA 3FAVA 2IH1C 4J9KA 1K1SA 4MVSA 1P16A 3E8HA 1K5SA 2QTSA 5I5VA 2X7RB 4EQ5A 3ETDA 3ETHA 3TY5A 4H44B 2ZE8A 3EYYA 1DF5A 4HNTA 3JALA 3LDEA 5L3DA 1N36B 1PNMA 3C0FB 4DV5O 4FLTA 4AQYH 3VQVA 3JARA 2YW2A 4GLXA 4EYHB 5IE9A 4DV1B 3QNEA 3RUPA 1L2ZA 5C3EG 3KHLA 4CS4A 1L0LH 3E89A 5K3WA 4WBNF 1RFYA 5I60A 1Q43A 5LYJF 4PWQA 2FLNA 4TWKA 4QPJA 4J7JA 1R73A 1IYEA 2IBKA 3OTFA 4X66B 4L8JA 2C2AA 3PO2G 4FS2A 4I0XA 4WHXA 4DR5H 4XBFA 1COWG 2ZCEA 3E86A 3KCXA 4A2BA 2Q69A 4JZGA 4JI5H 4TV9B 4PA4A 3WG7C 3M9OB 2ATKC 4WFAV 4X20B 3RYIA 1K4DC 4QE9A 5L3GA 3SJBC 2UXDH 4YR2A 3ML0A 2WTFA 1XEQA 3BPZA 4O2AB 4X20A 3AG3B 3RYIB 5J2UF 3RBEA 2HHHO 3F7VC 4O4LF 1GGOA 3SNOA 1KUTA 2VQEB 2J6TA 4MA5A 4OX9O 3BJYA 1JJOA 1PL4A 5CN0A 2Q7HA 1Q6IA 3D8CA 3L9DA 1MOFA 2Q67A 1XQ8A 4LFBB 1G1XB 1N32H 2LW7A 3K5MA 1AR5A 1MNGA 1ZL8A 5LMNO 3MWEA 1N0JA 2G38A 3OTOB 3JATA 1WRVA 3N41B 5FLXW 2CTPA 3BEHA 4ZQIA 4MTEA 4HAMA 3EPGA 2EIJB 5C4XG 2ODMA 3GTPA 4YR0A 1W2BU 5I5UA 5HBRB 3RF2A 3BVOA 1BS3A 5KFPA 4G2KA 3RGZA 3CCVV 5KHJA 5HFLA 3GTLA 2XHBA 2DQ3A 1TVKB 4JI7B 4IRDA 1QQCA 5LHGA 2WA4A 1W0JG 2W9AA 4MTFA 4F4ZA 4DL4A 4J9LA 4F50A 4RUEA 3SGIA 4JI6O 3JCZA 5KHIA 5I47A 1A9XA 2XCLA 4DRFA 5KG4A 2ODTX 4X66O 5EZYB 4G3IA 4J9YB 1Y74A 3W7WA 3H0GA 5LA6F 2CK3G 1QVGU 4YQWA 1V4YA 4FGRA 5KFYA 5LXTB 3FYEB 2WSSG 2WLJA 4FPPA 3VOUA 5JQGA 4WF9V 1XHZA 4QW8A 2JA6A 1GM7A 5KFHA 2XNDG 3A0BZ 3RVZA 4LF5H 3MAQA 4A3EG 5BWWA 1SERA 3KREA 4O7YA 5HNEA 4LFBO 5KFUA 3TIGA 5LBQA 1N4CA 2R7NA 1ZETA 3H1JH 4D7TA 4ED2A 4NTXA 4AHCA 2YRWA 2FB9A 4ZKIA 2ITDC 3H1KH 4B7EA 3AG2B 4FLYA 1S03G 1EKPA 2FKXA 4QPKA 1Z5VA 3MR5A 4G27B 1RJPA 1XBLA 2IJIA 3RYCA 4K3AA 4Q45A 3G4SV 1NBMG 2GTSA 2PI5A 3UQ8A 3GIJA 3TW7A 2QK4A 4Q20A 4KP4A 1MZEA 1Z2PX 4JI0B 3LDDA 3BAAA 1N32O 4PV1B 1YHQV 2Q9LA 3ORRA 1E4EA 3OUZA 4HNAA 5CA0F 2HLDG 3A0RA 2ZR3A 2YIBD 3CCUV 4ASUG 2HHFA 3STZC 2VA3A 3RGXA 5KFXA 4OX9H 2VA2A 1NTMH 2RDCA 1GAXA 2W6JG 1VQPV 4DR3B 4J41A 3T9AA 1NTKH 3ETQA 4YXWG 1C30A 4YJ2F 3G6BA 3T99A 4FM0A 1KB9F 1WPXA 5CA1B 3OEEG 2EINC 3HR0A 4X1YA 4JAVA 1I5YA 3ZHRA 4KHPH 4TUYB 1GN4A 3MD0A 3PR4A 4ECQA 4X65O 2BTOA 2F93B 2NN4A 2DMXA 3OE7G 4JV5H 5BWRA 3KHGA 3HOWG 3QO8A 5FL7G 2NNUA 1DV1A 4HNUA 5JCOA 3DTUB 3NXSA 3ZCCA 3NUAA 4O83A 4C5BA 5KX5A 1JDBB 5JVDA 3H20A 4NTWA 4DR5B 3ZIAG 3APOA 3M9MB 4F4XA 2ZQMA 2JGUA 3ABTA 2X6AA 2Q7GA 4K0KO 1Q82W 4CC5A 5LA6A 1OWTA 2X6BA 3F5TA 3SR2C 1UC8A 2LO1A 3K3WA 1FJGB 1WA8B 3AG7A 3VQXA 1NZ6A 2ZDHA 4IWXA 5DG9A 2IJJA 4DIMA 2YZMA 4U6PA 1TGOA 1KP2A 4DV5H 3RBDA 5K2MA 4RNMA 2FKLA 2XOKG 1XI1A 1KTAA 2ZE6A 5L3EA 3HOYG 2OCCB 3Q8QB 4ZOLA 1LR1A 2ZNJA 2WA3A 4F4YA 4DR3O 5D1OB 3CCLV 5KHKA 4PDRA 3APQA 1HR0H 1TWCA 4DR5O 3VBBA 3OAAG 1OCZC 3OGCC 4DUYO 2CAZC 2E75B 3ABMC 3RB3A 5L9XA 2WLLA 1WN7A 4TQFA 2X0LA 5FLXN 1H2GA 5KG0A 2OTJV 1Q90D 4MTOA 4YIOA 5J2TB 3B8MA 4DAAA 4YJ3B 1RYRA 2M6YA 4LH6A 3ZHSA 1D5AA 1OZ0A 4C5AA 5KFFA 1MZFA 3EVKA 3I4NG 2I8CA 1XNRO 3L72H 1AUVA 3BQ1A 4DV2B 2D3OW 2HKOA 3K03A 2ZDIC 1XMQH 3E8BA 2Y48A 4LF7B 4GX5A 4JI6H 3BG5A 2ZE5A 1IBKO 5FNVF 1YTFB 3S3XA 4RO2A 4BWAA 4ECXA 2VQFB 1F4MA 2GHYA 1VAJA 4MV4A 4B3SO 3M4IA 2AHYA 5KT3A 2W0XA 3ZRVA 2QDOA 4PA3A 2W71A 4YHHB 4O7VA 2L6LA 1JQ0A 3RYHA 4DR1B 3AG2C 1AILA 1Z2OX 2OLSA 4RQFA 2M05A 2UXBH 3PW7A 1FXKB 4JI7O 4DV4B 5EIBC 1XK5A 1B33N 4U3JA 3WWHA 3TK1A 1P7BA 3LSUA 1SC5B 1NS1A 4ME6A 3UM7A 2NVXA 4WBNA 3MFIA 3EHBB 2HGWA 4FIPC 3R66A 4CH6A 3V4SA 1I50A 5EYPB 2DYSB 2WDTA 3BABA 1Y6XA 2EULA 3ZS8C 1RK5A 2ASLA 4IHJB 4N21A 1S9FA 4DUYB 2XGQA 5IYBG 3BCCH 1BGYH 1KT8A 1R3JC 3GTKA 1M57C 4KXRA 3WO1A 1Y67A 4ECZA 5JVDB 1WNSA 3JALB 2PY5A 4TSFG 1SETA 2BQRA 4ZI7A 2QKCA 3SYQA 4YJ2B 2ZM6O 5KAFZ 3T5KA 2PVPA 4DQNA 3UZOA 4X1IB 1HNWO 4BIOA 2WB1E 2PMZE 3OUSA 4MV8A 1N34O 2W7PA 4P30A 2Q2TA 1GO3F 3T5HA 2UUAH 2R8KA 2QM4A 1FXKC 2FYUH 5IYZB 4JF3A 3RV4A 2DQ0A 1M0WA 5H5NA 3K5NA 4Y8VB 4DXWA 3G6VA 2QM7A 4O4HF 3RAXA 1Z5WA 5D8DA 3BRCA 2VQEO 2QWRB 1OV9A 2GUZA 2VWJA 2RNBA 1F23A 5KFQA 5EBMC 1Q5OA 3CC7V 4MTDA 4RZQA 4DK0A 3FX7A 3BACA 3ABMB 4J7KA 3CE2A 2IA6A 1KJ8A 1ZTEA 5CA1F 2YXLA 5IP7G 2HVJC 2ARHA 1HNWB 4EBCA 4DUZO 4H0LB 4CBCA 5BXZA 3KHHA 5KFZA 2YS8A 1U96A 1SEIA 4TOIA 4O4LB 2DN9A 5JWPA 2E2HA 3CCRV 4NYKA 2IJKA 2MW2B 1P4RA 4A5UB 2OT5A 2YXYA 4DLKA 4NXMH 2W6MA 4PZ7A 4YIPA 3OM3B 1S5LZ 3LNNA 3N2KA 2VOBA 3B4SA 2AGAA 3IAYA 1GYFA 3CD6V 5J2UA 1N36H 4FBUA 1NJIW 2B63G 3QVNA 4LF6H 2OWOA 2ADQB 3K5HA 3LSQA 3VOTA 4JI3B 1WP7A 2GPWA 3CRMA 4R6ZA 3VPCA 3QG5A 3HKCA 3SJAC 3T2MA 2QB5A 3N27A 1NT2B 4DR6H 1I2KA 2ETNA 3BHPA 3PO3G 3K59A 1A3GA 1HNXB 3W1BA 1RPOA 4B3MO 2VQEH 1AI4A 3HKCB 1NR7A 4CE5A 3JZFA 1BHBA 1QHTA 1VQ9V 4FBTA 2ADPA 2YIDA 4MA0A 2DPIA 3GV5B 4J9RA 1A48A 2HJFC 4I50A 4BW5A 5CR5A 4X88A 1QLNA 4M7EA 2R8JA 4DW1A 3GJXB 1IDSA 4J9QA 1J95A 1MSDA 3NR7A 2AZ0A 5JQGB 5LXTF 2CQYA 2Q7EA 3CQZA 2FLPA 2JRIA 5DM6V 2XAGA 2NU9B 2ZDGA 2EJRA 5KFDA 4LNUA 4YAKB 1H2LA 3GV7B 3RB6A 2LP7A 2W9CB 3AG4B 1YJWV 3B40A 3OGIB 3K58A 1GSHA 4TUYF 4BXXG 3H3VH 2YS7A 2V58A 1N0NA 4MTGA 3E22B 4EEQA 1V55B 4DO2A 3PFFA 2P7TC 4IR9A 4JI4H 5LOVA 1SF9A 3OMAB 4YHHH 5JCOC 4LF4O 3TGUH 1BL8A 4O2BB 5TISZ 1KMIZ 3JARB 4QWCA 2CH7B 3MWMA 3SJCC 2Y4RA 4XDJA 2YL2A 4CH5A 4A3MG 4LF8O 3JD3A 3L4JA 1BE3H 3DTGA 2GQSA 3J80N 3K3VA 2ATLA 2F4VH 1VKZA 3U54A 4F4WA 3C3SA 4WFHA 3TJTA 5DG7A 4I5SA 4A3KG 2DWDC 2Y4TA 4UUJC 5KS8A 3HBLA 1PKXA 1WAZA 3LNMB 4TVIA 2JS5A 2VUMG 5JJNB 4A3GG 3CC2V 3JAKA 2FPGB 2RN9A 3T9DA 3I56V 3FB6C 2YYAA 2DE0X 1CKOA 1NH2B 4TV9F 5CE8A 3R5HA 1IBKH 4UCVA 1Y1WA 1X4TA 1M7JA 1ZLZA 2J6SA 2QEXV 4QJFB 3K9SA 3CCJV 2WB1A 4UVCA 2R93G 1M0TA 1E79G 1F4NA 2IW5A 2JDIG 4RCNA 5IYZA 4IWYA 2NUAB 3CB2A 4OPHA 1B06A 1HWYA 1DV2A 1V54B 4U7OA 5EK0A 4RB2C 2DOSA 1LUWA 1XNQH 4TQDA 5EBWC 4QNHB 1R6KA 5ITZA 2VUMA 1G4YB 2YIBA 3OEHG 4HNAB 2P22C 4EYIB 4B7KA 4DR7H 3VQWA 5KFTA 1KQSU 3DTFA 5GW7A 1OBDA 2R8IA 1VQLV 4Q44A 4GC7A 1AP6A 3I55V 4DR2H 4DR7O 1K33A 1PL0A 1I94H 4DV2O 3WB2A 1HNZO 1XDCA 1XHXA 3CSWA 3N2GA 4UCSA 3WWIA 2W9BB 4APMA 1FAFA 1TUBA 1I94B 3ETEA 3OR7C 4RUFA 2DZDA 1RM1C 4J10A 3CEBA 2Q0AA 3PN1A 5JH7B 4KUMA 2PMZA 3T1YH 2C00A 1NQTA 2O57A 5B3SC 2SCUB 4JI2H 3PW4A 3UYYA 5LHHA 2KQXA 1GH6A 2Y0SA 3G80A 4L87A 3JASB 1OBGA 3K5OA 1EM1A 3HPLC 2YEVA 4DV4O 4RUAA 2AQ4A 2LGWA 5B3SB 3IFXA 2EILC 1JFFB 3ZN0A 5IWAO 1SESA 4KFMA 5J2TA 2PYLA 1VS0A 2W0FC 3DC5A 1K97A 3ABLB 3E35A 4O4IB 2ZJTA 1I7NA 4ZHQB 2B63A 2Z3YA 1AJNA 2XTAA 3AG1C 3RYHB 1WLEA 4IIJA 5LP6B 2FK1A 2N04A 2X5RA 4R7CA 5EYPA 1QLEB 2NU6B 5IDJA 3FB8C 4ED0A 4A3CG 4YJ3F 3W7TA 1FYJA 2CNQA 2Q0OC 3GQCA 5BWXA 3KG2A 2FMAA 2RDIA 5LMNH 1H2SB 4MVMA 1H2KA 5JQGF 1QCEA 1TUEB 1TAEA 2ITCC 5CAEB 4FS1A 4RAIA 4G28B 1JJ2U 4O3PA 1I08A 1DAAA 5C5JA 3U9TA 1IXBA 2CNVA 5KFAA 2V59A 1DF4A 4MVOA 3CRQA 5E79Z 1I7LA 4L1KA 1ZWIC 1R6TA 2CNUA 3PW2A 4JI7H 4LC1A 2EX3A 2UXDO 2QJ1A 4JI4B 3N8DA 2HR3A 2CGNA 2PI4A 4EGJA 2QWNB 4UB8Z 3CYOA 1YI2V 3KZIZ 4LFAB 1VF5B 3U0ZA 3GB7C 4JXUA 3SE7A 5LGUA 5B1NA 4IHJF 1FFXB 1VBHA 5KFVA 4AQYB 2BCCH 3OSNA 3T5JA 2CGOA 2P4KA 2VS0A 5BYBA 1MG1A 3SYCA 1BT8A 1YSCA 3PVXA 4DV7B 4QIWE 4TV8B 4LFBH 1XMQO 1KKDA 3V6JA 1T3NA 1Z2GA 4I55A 2L35A 4DR4H 2JIZG 1TWGA 2C28A 2YS6A 3RB0A 5CB4A 4U3JB 1FKAO 5L3BA 2ABJA 4B3RO 3Q4HB 4FLXA 4LSXA 1OCRC 5JVDF 1VQ5V 3ZMZA 2HIVA 3EPIA 3X2QC 4NXMO 1ZHQA 3PZPA 1G8MA 2VRZA 1NR1A 2GV9A 4ECRA 2XCPA 3E5NA 3SPIA 3GVMA 2GLTA 3ZEDA 1DK1A 1JMKC 1I0HA 4X64O 3ZRWA 4ED1A 3FKIG 2Z02A 4YY3O 1BZKA 5KFGA 3F7YC 4DV7O 4CMFA 4O4JA 1BJTA 4X64H 1LUVA 3CEIA 1HR0B 2IU3A 2OCCC 1E1QG 4PI0A 1Y1WG 4O3SA 4O2AF 4C5CA 5KFKA 4B3MB 3N42B 4U7NA 1RP3B 2HHFB 4YJ2A 5IYZF 1Y1VG 3DGEA 4WFGA 4X65B 1X9NA 4HYKA 3I12A 3WO0A 2UXDB 4EBEA 1S5JA 5LL6b 1W96A 1SQXH 5DQHA 3AX6A 1FKAH 4LP8A 3HKBA 1Q3EA 1DGSA 1SQQH 2Y4UA 1XMQB 1Q7YW 2Q2UA 2BQ3A 2AGPA 3TXSA 3ASNB 1V51A 4O7ZA 2XCAA 1S10A 3OUUA 1R1BA 1VIBA 4A93G 1N33H 4DRXB 4CC6A 4EGQA 1EUCB 4BBRG 2JA5A 5FJ8G 2HVRA 1FFXA 2UUBO 1RJQA 4J9OA 2CH7A 2EZOA 5AG2A 4BIUA 3NBYB 4DV1H 1SZTA 5EBLC 1UFIA 4RQEA 1IBKB 1IXMA 2COJA 1TWAA 5KX5F 1JA8A 3N6XA 3LSSA 5BWVA 4O84A 2F23A 1ENVA 1JOYA 2BOBC 4O7RA 5BR8H 2HVSA 5E1AC 2EIKB 2QR4A 2RCVA 3G6EV 4FFOA 1OCOC 5GTHZ 4P9OA 5L3CA 2IH3C 3GWOA 5EWFA 2X6CA 3CHXA 3T4ZA 3E8GA 3JD1A 4JTCB 2QTOA 4PA9A 2XAHA 3R9RA 2YEVB 4JPRA 4J0MA 2DPJA 3RN4A 5D1OA 1S3JA 1KBLA 3ZHUA 2HHHH 4PI2A 3T1HB 4KL1A 1Q86W 1I1MA 4IR1A 4UCOA 3OMNB 2DYRC 3MR6A 4RB0A 3WNZA 5JJJB 1IOVA 1S5HC 2A0LA 5CBGA 1CE8A 4PDMA 3IC7A 4JI0O 4Z1VA 5IT9N 4DV0O 4O86A 3IG0A 1OCCC 1OCRB 1H38A 1GO3E 4LF7O 1RSOB 1PP9H 4B3SH 1HNZH 4BY7G 2ZDIA 4LF5B 4HR7A 3T9CA 3THOA 5KMGB 4UXNA 4W4KA 2GTAA 2R9RB 4FZ1A 1M9NA 4RNNA 5B1AC 2X0SA 4DV4H 4O3NA 4J9MA 1EZJA 3JRXA 2F43G 3FAVB 1SQVH 3JD0A 2UUBB 3K5IA 5DGHA 1BGWA 3G71V 2R8HA 1XNRH 3T1HH 4FMTA 1I6UA 1CKMA 2BTQA 2W8LA 1H2NA 3CXHF 5K1XA 2BR0A 2LW1A 1HNXH 3E2EA 1H8EG 1OCZB 4W4LA 1THZA 5CBFA 3KYHC 2VQFH 3QFFA 2ZT9B 3T1YO 4O7WA 1KJIA 4QWBA 1K9MW 2C35B 5EIBD 2N74A 1ROPA 3FKIA 1AN7A 1YDXA 2FLLA 2EJ7A 5B1OA 3SPGA 2R84A 2COGA 4YY3H 2LFSA 1OHHG 1JKJB 3UCSC 2W6PA 5KFLA 5LYJB 3H4BA 3G6XA 3H4DA 2JS3A 4DR2O 1B6SA 1ZAUA 4JGSA 3TETA 4CKBA 4ECYA 2COIA 5B5EZ 3AYHB 3SPJA 4J9ZB 4WFFA 3R23A 4BY1G 1XL6A 4GX1A 4YR3A 3LP8A 1L8DA 4I55B 3F8NA 3QWUA 3QO5A 3GLKA 3R65A 3RYCB 2YRXA 5I5YA 2YU9A 5ITZB 3FB5C 1D2DA 1GLVA 4FFLA 3D36A 5BMVF 4LH7A 1BNCA 4JASA 1Y76B 4EBDA 5A9GA 3IGAC 4LSAA 4DV3B 2JEUA 2ZKOA 2HGXA 2JJ1G 4A3BG 2O03A 5GONF 3I5DA 1OJHA 4UV8A 4X8AA 4NZMA 5EDWA 3ASOC 3ZMSA 2JA8G 5KFCA 5F2VO 2W57A 3G67A 3J80W 2UXBB 3TQTA 4JTDB 4PDLA 3W7SA 2J9GA 4X65H 5C93A 5EZYA 5JH7F 3HKZA 1BHAA 1K5QA 4E4EA 2YDEA 3GTQA 1R3KC 1M56B 4JI8O 3L73H 3V6KA 4FFMA 4DR2B 4IIJF 4UCUA 4RWUA 1XMOH 1N33B 2JEFA 1PK8A 4PDBA 1WSCA 2CW7A 1IURA 4LF4H 5KT7A 4GKKH 4E2LA 4JI4O 1IBMB 2H94A 4Q8EA 3HKEA 4BW9A 3BQ0A 4ZHQF 3AEIA 3JZ6A 4MV3A 2N05A 5KFRA 4R8UB 3AW8A 3M9NB 2W9CA 1S97A 5DGBA 3ICXA 5FNVB 3OR6C 3SYOA 2KSDA 5H6QA 3J7AK 2GBOA 4IYHA 1N32B 4RB3C 2WLHA 4Q0YA 4F4LA 5B1AB 5IY5B 1V55C 3D36C 1R3IC 5K1PA 1VEWA 2Y69C 4TM5A 1IBLB 1M5IA 4PZ8A 3T9FA 1EFRG 2Q73A 1KYOF 1I3QA 4GUNA 1QVFU 1OCCB 3GDEA 5IWAH 1S77D 2P0AA 4LFCB 3R5XA 1PX2A 4RZRA 3U10A 1JX4A 4NR1A 3N40P 4O82A 2CKZB 1DTOA 5KG3A 5IJ9A 1KJQA 1JR9A 2R70A 3T1YB 1S0OA 5LP6F 1GM8A 1K83A 1GRJA 2CE4A 5LA6B 3LMLA 4ETSA 2UU9H 2QA4V 1SRYA 2W6IG 2YUAA 2HG8A 2A9HA 3G8CA 4MW8A 2ZIOA 1JCHA 3C3TA 1GM9A 4ZIBA 4HQ6A 3JSNA 4WD3A 4PA7A 2E2IA 2FK2A 4X66H 4GLWA 4Q4CA 4IGGA 2EILB 4H37A 1HNZB 3DAAA 2F66C 5DGIA 2R9AA 5KFBA 3W5OA 3B77A 3T4DA 2YZNA 5E25A 1K1QA 1SQPH 3CX5F 3SYPA 1M93A 4WCEV 3L71H 2AZ2A 1I94O 5L1JA 3CSXA 1E1RG 1URFA 4MVUA 2YI8A 2UUCH 3GIDA 1PD3A 4JYYA 1XOUA 5CB4B 3KAJA 4CH3A 4NVPA 5CA0A 1HP8A 5C8YF 4X62H 3QZ7A 4EKWA 2W6NA 4LF7H 1HR0O 4Q6GA 4UUGA 2QM8A 1N34B 5IJ0B 2R93A 5CA3A 4PELA 2CZGA 2C2RA 3WB0A 4X64B 3B2EE 3GTOA 1VMGA 1SA0B 1S0MA 1NI8A 2BOCC 3UO3A 3K04A 1SQFA 4ECSA 4D7SA 2DAAA 4O4JF 1GSOA 4PA6A 2XUMA 5HFMA
chains in the Genus database with same CATH topology
5LXTB 1TA8A 4JI2H 5JQGA 1XHZA 3JASB 3K5OA 1XDNA 4TV9A 1VF7A 1FJGH 4HBNA 4LF5H 3MAQA 2E5LB 3JAWA 4LR3A 4CS3A 1P8LA 4JI5B 1JFFB 4JI1B 1O9GA 3J81W 4LNUB 4EFEA 4NXNH 2VWKA 1A0IA 2F4VB 4B08A 4TUYA 4D7TA 5J2TA 4AHCA 2PYLA 1O9HA 1VS0A 2ZNIA 3L4KA 4O4IB 1XMOB 2ZJTA 4FLYA 4ZHQB 1S03G 4JV5B 5EOYA 4DV2H 3RYHB 1Z5VA 1SQGA 4IIJA 5J2UB 5LP6B 4NXNB 5DISC 5CA0B 2UU9B 3NC0B 4I50B 3RYCA 5EYPA 2R72A 2PTMA 2ZIMA 5KHHA 3UQ8A 2XIGA 3W1GA 1Z2PX 2HVQA 4X1KA 2ZM6B 1TUBB 3BAAA 4JI0B 5LMUB 2YCHA 5LMNH 4B3MH 1H2SB 5D1PA 4HNAA 1TAEA 2YIBD 5IJ9B 4I9QA 3RGXA 4OX9H 1WH2A 4YJ3A 5D5QA 3RJ0A 3RR5A 4DR3B 3TY8A 3ETQA 2V4DA 4FFBB 2VUGA 3QTCA 4FM0A 5GONB 4X62B 5CA1B 4JI7H 4NXMB 2EX3A 2QJ1A 4X1YA 4JI4B 3DF7A 2UXCH 4KHPH 3L2PA 4TUYB 1KU9A 4LFAB 1CKNA 2BTOA 3U0ZA 2HEPA 1FVIA 4FLWA 4JYAB 2F93B 4O4IA 2HHHB 4DUYH 5JH7A 5CA1A 4JV5H 4FLVA 1FFXB 3JATB 4AQYB 4IHJA 2BTQB 5JCOA 4JI8B 2IM9A 4R7RA 4DR6B 5KX5A 5JVDA 3H20A 4DV7B 4DR5B 4TV8B 4LFBH 4YY3B 3RYFA 3E22A 4RAZA 4I55A 4DR4H 3JAKB 4O2BA 5CB4A 4CS2A 3VNNA 2JGUA 4FM1A 4U3JB 2Q7GA 4CC5A 5LA6A 3SR2C 4FLUA 4K0KH 4UCTA 1FJGB 3VQXA 4FLXA 4LSXA 4DV5H 1TGOA 2HIVA 1ZHQA 1XI1A 4PZ6A 4O4JB 1Z2NX 2GV9A 1XNRB 2HIXA 4ZOLA 2ZNJA 3ZEDA 4O4HA 5C8YA 1JMKC 5D1OB 4JI6B 5KHKA 1HNWH 4GKJB 1HR0H 4O4JA 1BJTA 4X64H 1HR0B 4ZOLB 2CAZC 4PI0A 4LF8H 1WN7A 4TQFA 1JFFA 4B3MB 3N42B 4RAYA 4YJ2A 3HKBB 2OYQA 2E5LH 5J2TB 3OTOH 4X65B 1X9NA 5KX5B 4YJ3B 1S68A 4DR4B 4LH6A 4O4LA 1D5AA 2UXDB 2CFMA 1S5JA 5LL6b 3FMAA 4MV9A 1FKAH 3GB8B 3HKBA 4FM2A 1Q3EA 3A2FA 4ZHQA 1DGSA 2UUAB 1XMQB 5LP6C 5LYJA 4DV2B 2Q2UA 1G6UA 1SKVA 1I7FA 1XMQH 5A2QW 4EFBA 4LF7B 1N33H 4JI6H 4DRXB 4CC6A 4BWAA 2HVRA 2VQFB 1FFXA 5FD6A 3M4IA 3HXLA 3JASA 5BR8B 4X1KB 3RIZA 4I7HA 3NBYB 4DV1H 4DR1H 1IBKB 5LMNB 2P5OA 3KXYT 4YHHB 3N6XA 4DR1B 3RYHA 2MCTA 3N2GB 5IJ0A 1O75A 1WPBA 1Z2OX 4B3TH 1MZBA 2UXBH 5BR8H 4DV4B 5EIBC 1SA0A 1XK5A 2HVSA 3KAKA 1M4UA 4U3JA 3BA9A 1HW7A 3CVZA 4AILC 3HKEB 4B3SB 3K57A 5FPRA 4WBNA 4DK1A 5GONA 4CH6A 3CHXA 5EYPB 2WDTA 3BABA 4PHZA 2RGVA 4JI1H 3ZS8C 3HKDB 3JAWB 5BMVA 4IHJB 2RJZA 4J0MA 5C8YB 5D1OA 4DUYB 2HHHH 4PI2A 3T1HB 3S24A 4KL1A 4ZI7B 4GKKB 2FE3A 4UCOA 5IT9W 3RYFB 4KHPB 2PYJA 2PZSA 4RB0A 5JVDB 5JJJB 1WNSA 3JALB 2PY5A 4LF9H 4ZI7A 4YJ2B 3UT5B 4JI8H 3IG0A 5LOVB 4DV6B 2ZINA 4B3SH 1HNZH 4X1IB 2HGSA 2F95B 4LF5B 2WE6A 4DV0H 4DR3H 3THOA 4DUZH 5KMGB 4IAJA 2Q2TA 2KSWA 3K5LA 4OX9B 3WB1A 2UUAH 2QM4A 5FNVA 4DV5B 4DV4H 5IYZB 4JI2B 4LFCH 2UUBB 1M0WA 3K5NA 3M7MX 4EB6B 1BGWA 2UUCB 3N43B 5D5PA 5JJEB 1ZHSA 1XNRH 3T1HH 1Z5WA 4F6RA 1I6UA 1CKMA 2BTQA 3BRCA 4UFZA 2PUSA 5K1XA 1HNXH 2VWJA 4LMYA 4B3RB 3KYHC 5IWAB 1Q5OA 4TV8A 2VQFH 4MTDA 1Q8IA 4RZQA 3DSQA 3RGBA 1V9PA 4DK0A 3N44B 5EIBD 1YEWA 3RFRA 2YXLA 4GKJH 5FPOA 2WYOA 1AN7A 1HNWB 1N34H 1CKNB 4DV0B 1P49A 2RQ6A 4YY3H 1SEIA 4O4LB 4TOIA 4GYCB 5LYJB 2ZM6H 4JI0H 4LF6B 1SYXB 1ZAUA 2JVDA 4NXMH 4PZ7A 4X1IA 3VQYA 2VOBA 3LNNA 3N2KA 3BA8A 3IAYA 1GYFA 4LFAH 1E4GT 4IIJB 5LP6A 1L8DA 4I55B 5LXTA 5J2UA 3QWUA 2CW8A 3F8NA 1N36H 2UUBH 4LF4B 4LF6H 2OWOA 3RYCB 4JI3B 5ITZB 3N2KB 3QG5A 3HKCA 3SJAC 4DR6H 1NT2B 4LH7A 4LF8B 3BHPA 3K59A 2F1MA 1HNXB 4O2AA 3W1BA 3JSLA 3UT5A 4LSAA 4DV3B 2VQEH 5LMUH 3FFQA 1TVKA 2O03A 3HKCB 4A2AA 2YIAA 3U11A 1QHTA 2YI9A 2W57A 4K0KB 3J80W 4B3TB 4UCRA 2UXBB 4WBNB 1IBLH 4X65H 4FFBA 3RTXA 4I50A 5FD5A 5EZYA 4K8XA 4DRXA 4K8ZA 4M7EA 3GJXB 4EB6A 5JQGB 1T5EA 2Q7EA 1P16A 1J5EH 4EQ5A 3TY5A 3TY9A 3EYYA 4DR2B 3JALA 4UCUA 1XMOH 1B04A 1N33B 4RB1A 4LNUA 4I4TA 4JYAH 4JI3H 4BWSC 4PDBA 1N36B 3C0FB 2CW7A 4LF4H 3K58A 4GKKH 4LF9B 4FLTA 4AQYH 3VQVA 3JARA 4GLXA 4B3RH 1IBMB 2VPSA 4DV1B 3HKEA 4BW9A 3E22B 4EEQA 2UXCB 4JI4H 5KMGA 1L2ZA 1RSOA 5LOVA 1IBMH 4YHHH 5JCOC 4CS4A 3ICXA 4O2BB 5FNVB 3RWRD 4X1YB 1KMIZ 3JARB 4E6NA 1Q43A 3MWMA 1N32B 3J7AK 3SJCC 4RB3C 1E4FT 4Q0YA 4DV6H 2RGRA 3HKDA 4CH5A 3OTFA 4X66B 4L8JA 5BMVB 3L4JA 5K1PA 3NBZB 4DUZB 1J5EB 3K3VA 2F4VH 4DV7H 4DR5H 5KHGA 2ZCEA 4A2BA 1IBLB 1M5IA 4PZ8A 4JI5H 4TV9B 4X20B 3RYIA 5IWAH 3GDEA 4O4HB 4DR7B 4LFCB 3U10A 2KKWA 3KALA 3N40P 2JS5A 3SJBC 5JJNB 5IJ9A 2UXDH 3JAKA 3BPZA 4O2AB 2R70A 2PGGA 4X20A 3RYIB 3T1YB 4CH4A 5LA6B 3LMLA 4ETSA 1CKOA 2UU9H 1IBKH 4UCVA 1X4TA 4F6RB 2VQEB 4DV3H 2ZIOA 4MV7A 4ZIBA 1JJOA 3JSNA 1M0TA 1XNQB 2E3CA 2Q7HA 5IYZA 3CB2A 4X66H 1XQ8A 4LFBB 1HNZB 1N32H 2F66C 3K5MA 2R9AA 3W5OA 4RB2C 3OTOB 1XNQH 3JATA 3N41B 5FLXW 4TQDA 1M93A 5ITZA 4FM9A 4MTEA 2YIBA 4HNAB 2P22C 4DR7H 3VQWA 3CSXA 2YI8A 3RF2A 2UUCH 5CB4B 4I4TB 3KAJA 3RGZA 4CH3A 4DR2H 5KHJA 4NVPA 5CA0A 1I94H 2XHBA 4JI7B 1TVKB 3WB2A 4X62H 1QQCA 4LF7H 1XHXA 4Q6GA 1N34B 3N2GA 5IJ0B 4UCSA 3SGIA 3WB0A 4X64B 5KHIA 3B2EE 4APMA 4DRFA 1TUBA 1I94B 1SA0B 5EZYB 1SQFA 2Q0AA 3PN1A 4FVMA 5JH7B 3JAMW 4D7SA 3T1YH 4FLZA 3QF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIV A;  1B04 A;  1TA8 A;  1N33 B;  4PZ6 A;  4DV6 B;  1XNR B;  2HIX A;  1N36 B;  4LF5 B;  1XDN A;  4LF9 B;  5D1O B;  2Q2T A;  4OX9 B;  4JI6 B;  4GLX A;  2E5L B;  4GKJ B;  1IBM B;  4DV1 B;  4JI5 B;  4DV5 B;  1P8L A;  4EEQ A;  4JI1 B;  2UXC B;  4JI2 B;  4EFE A;  1HR0 B;  2UUB B;  1A0I A;  2F4V B;  2UUC B;  1VS0 A;  1CKM A;  4B3M B;  4E6N A;  4UFZ A;  1N32 B;  1XMO B;  4JV5 B;  4B3R B;  3KYH C;  5IWA B;  4X66 B;  4X65 B;  1X9N A;  5DIS C;  4NXN B;  3NBZ B;  4DUZ B;  2UU9 B;  1V9P A;  1J5E B;  4DR4 B;  1S68 A;  3NC0 B;  4LH6 A;  2UXD B;  2CFM A;  1IBL B;  5FPO A;  3GB8 B;  4PZ8 A;  3UQ8 A;  2UUA B;  1DGS A;  1HNW B;  1XMQ B;  4DV2 B;  3GDE A;  2Q2U A;  3W1G A;  1CKN B;  4DR7 B;  4LFC B;  4DV0 B;  2HVQ A;  2ZM6 B;  4JI0 B;  3BAA A;  5LMU B;  4EFB A;  4TOI A;  4LF7 B;  5D1P A;  4CC6 A;  4LF6 B;  1TAE A;  3T1Y B;  2VQF B;  2HVR A;  1ZAU A;  1CKO A;  4UCV A;  4PZ7 A;  5BR8 B;  2VQE B;  3NBY B;  3BA8 A;  3RR5 A;  1IBK B;  5LMN B;  3JSN A;  4DR3 B;  1XNQ B;  3TY8 A;  2VUG A;  3QWU A;  4YHH B;  4DR1 B;  4LF4 B;  2OWO A;  4X62 B;  4LFB B;  4NXM B;  1HNZ B;  4JI3 B;  4DV4 B;  4JI4 B;  3W5O A;  1XK5 A;  2HVS A;  3L2P A;  3BA9 A;  4LH7 A;  3OTO B;  4LF8 B;  4LFA B;  1CKN A;  1FVI A;  4B3S B;  4JYA B;  2HHH B;  1HNX B;  5FPR A;  3W1B A;  3JSL A;  4DV3 B;  4AQY B;  3BAB A;  4JI8 B;  4DR6 B;  4DV7 B;  4DR5 B;  4JI7 B;  4YY3 B;  4K0K B;  4B3T B;  4UCR A;  4DUY B;  2UXB B;  5D1O A;  3T1H B;  3S24 A;  3RTX A;  1N34 B;  4GKK B;  4UCO A;  4UCS A;  3SGI A;  4KHP B;  3VNN A;  4X64 B;  3GJX B;  4DRF A;  1I94 B;  4CC5 A;  1P16 A;  4EQ5 A;  4UCT A;  1FJG B;  3PN1 A;  3TY5 A;  3TY9 A;  4DR2 B;  4UCU A; 
#chains in the Genus database with same CATH topology
 2HJD A;  4IT5 A;  2EJ2 A;  4MV6 A;  2ZR2 A;  1AI5 A;  3DXR A;  3JAM N;  4C2M A;  1EYZ A;  4GKK O;  3OTO O;  5KG2 A;  1VF7 A;  1FJG H;  4HBN A;  1UNN C;  2E5L B;  4LR3 A;  4CS3 A;  3K79 A;  2LFR A;  4JI1 B;  1O9G A;  3J81 W;  3PR5 B;  4NB5 A;  3AG1 B;  4LNU B;  4EFE A;  1A0I A;  2QKS A;  4B08 A;  1NKD A;  4O7N A;  4TUY A;  1BQ0 A;  3Q1K A;  1U97 A;  1O9H A;  1UJW B;  1JX9 A;  1KEE A;  4UVA A;  2F4V O;  5BR8 O;  4C7U A;  3OW2 U;  1H8H G;  5KT2 A;  4I55 F;  4Z2W A;  5DIS C;  5KG7 A;  5CA0 B;  5KLV H;  5BPH A;  2Q5Z A;  2WWW A;  3WU2 Z;  4I50 B;  4KHP O;  4DV1 O;  2R72 A;  4FK5 C;  4JAU A;  3LWB A;  4XDL A;  2JA7 G;  5KHH A;  4YHH O;  2QGN A;  2WLK A;  2XIG A;  3WWJ A;  1MMM A;  2B1G A;  3K3P A;  1KKC A;  5LMU B;  2YCH A;  4LWS A;  2XC9 A;  3A0H Z;  1MA1 A;  3MWD A;  4B3M H;  1JPX A;  4AQY O;  1RM1 B;  4CHI A;  3STL C;  1FD9 A;  1WB8 A;  3F5W C;  3UKM A;  2HJW A;  3MJF A;  2ZXW C;  2QF7 A;  1ZX3 A;  1K34 A;  2PBZ A;  3RJ0 A;  3WFV A;  2ILM A;  4U7C A;  1TWF A;  1XL4 A;  3T9B A;  2V4D A;  3V6H A;  3SPH A;  5H2F Z;  5IYD O;  5BYA A;  2B5U A;  3CJH A;  4DL3 A;  2AU0 A;  3L2P A;  1KU9 A;  3EFF K;  2DLN A;  3GTM A;  2LQT A;  5CBH A;  4GC6 A;  4JYA B;  2AGO A;  2HHH B;  2XGP A;  5JH7 A;  5EZY F;  2YSU B;  2V4R A;  1S72 V;  5DG8 A;  1VQO V;  5L1K A;  2M7W A;  5IYC G;  3ABU A;  3JAT B;  4R8C A;  3ZJZ A;  3J81 N;  2UVW A;  3EXA A;  4JI8 B;  2IM9 A;  3GIK A;  4RU9 A;  3I4M G;  2A79 B;  2DJV A;  1ORQ C;  3RYF A;  3TEK A;  2W6Q A;  3MFH A;  2PN1 A;  4DW0 A;  4ED6 A;  4DR6 O;  4BBS G;  4I4T F;  2W70 A;  1M90 W;  2ALZ A;  4CS2 A;  2R92 G;  1BCC H;  3M99 B;  1YIT V;  2YWV A;  5DQG A;  5KFM A;  2R8G A;  4UCT A;  5C1O A;  3E8F A;  3VPB A;  1EBO A;  2EIN B;  4FFP A;  4PZ6 A;  4O4J B;  3LDC A;  2UUA O;  5I5X A;  2CDY A;  1XNR B;  2HIX A;  4IRK A;  2JEX A;  3Q8R B;  5T14 A;  1ZL8 B;  4RUC A;  4O4H A;  2JGD B;  5C8Y A;  3BQ2 A;  1KC7 A;  2HG5 C;  4JI6 B;  1J5E O;  3L74 H;  1YF2 A;  1RPR A;  3HOU G;  3LUT B;  4ZOL B;  1YCI A;  1IX9 A;  2JEJ A;  2Q6A A;  3A8T A;  2LGQ A;  4NXN O;  4LF8 H;  1KUQ A;  1XRE A;  1JFF A;  5H80 A;  2YC0 A;  2MK3 A;  3HKB B;  2P90 A;  3ZHV A;  1HDJ A;  3OSP A;  1FJG O;  2OH2 A;  2FTK A;  3GIQ A;  3JCU Z;  3OTO H;  2NR5 A;  4MVQ A;  2HP8 A;  2IBZ H;  4H33 A;  4O4L A;  4JAA A;  4MV9 A;  1BQZ A;  4FM2 A;  2WLM A;  3A2F A;  2UUA B;  1JDE A;  2WLI A;  4ED7 A;  5DEC A;  2R7M A;  4ECV A;  1SKV A;  2WAQ A;  5A2Q W;  1XMO O;  3OHA A;  5LOV F;  2EIJ C;  2OTL V;  3H1I H;  5FD6 A;  4XDK A;  1YZB A;  3HXL A;  2QYZ A;  1QNM A;  4MVR A;  4I7H A;  1N8R W;  4JYC A;  3P30 A;  3SJQ C;  5LMN B;  2CUG A;  1VQM V;  3OMI B;  5H6R A;  2UUC O;  1OCO B;  5KAI Z;  2MCT A;  2XAQ A;  5IJ0 A;  3VA7 A;  2XD4 A;  1O75 A;  1B3Q A;  2VR1 A;  2FB5 A;  1SA0 A;  1M4U A;  1YJN V;  3HOZ G;  3BA9 A;  4ECU A;  5J9P C;  1M57 B;  3U9S A;  5IYC O;  3HKE B;  2A1H A;  3U55 A;  3K57 A;  1VQ7 V;  2UVV A;  5FPR A;  4I50 F;  2R86 A;  4HYO A;  1BSM A;  3GIM A;  3LQS A;  4HZ3 A;  3UO2 A;  2OCH A;  4PHZ A;  3ZRX A;  4PBC A;  2JK5 C;  3HKD B;  5KT5 A;  3GWK C;  2KG7 B;  5BZB A;  4N23 A;  1CPY A;  2P6J A;  4ZI7 B;  4X9Q A;  5JVL A;  4GKK B;  1QR9 A;  4CKC A;  2A7W A;  5IT9 W;  3RYF B;  3SPC A;  2PYJ A;  2BSK B;  2PZS A;  4GCZ A;  4J7Z A;  4TT3 G;  1V54 C;  4UVB A;  4MS2 A;  3RFC A;  3MR3 A;  4BR6 A;  4O3R A;  3MHH C;  3CPW U;  4I7Z B;  1S76 D;  1RYS A;  1ZUQ A;  2DYS C;  3UT5 B;  2V5A A;  2BSK A;  1YIJ V;  4ECT A;  2ZIN A;  2HGS A;  3ZBH A;  5DLF A;  2R82 A;  2F95 B;  4IYI A;  5DN6 G;  2HDK A;  1NH2 D;  1M1K W;  5KG6 A;  4DR3 H;  2IMW P;  4IAJ A;  3OUF A;  1ZQ7 A;  3PW5 A;  1R9T A;  4LCU C;  4OX9 B;  3ZN1 A;  2EBO A;  4PD4 F;  4QW9 A;  1IBL O;  3G6Y A;  4LF5 O;  4LFC H;  2E74 B;  1S0V A;  2VQF O;  1IYD A;  2YZG A;  5KFE A;  5JJE B;  1ZHS A;  4DYL A;  4FZ0 A;  4F6R A;  1PPJ H;  2HFE C;  2I80 A;  4YBZ B;  4ZOL F;  2R7Z A;  2WPD G;  2LJ2 A;  3FDS A;  2B1I A;  4B3R B;  2ASD A;  5IWA B;  2EJ3 A;  1ULZ A;  1Y74 B;  3B8N A;  2K1E A;  2QWQ B;  3T54 A;  3DSQ A;  2E5L O;  5F9N A;  1F51 A;  2XAJ A;  1YEW A;  5DED A;  5B1B B;  4GKJ H;  2GUZ B;  3D3I A;  2BE3 A;  5KFO A;  1YVW A;  2XAF A;  1CQI B;  1D5N A;  2V7Q G;  2GQR A;  2GPS A;  1KEC A;  2CTR A;  2IJH A;  1GMG A;  2W6O A;  1NTZ H;  3L75 H;  4JI0 H;  3ZMU A;  5IYD G;  5KFI A;  4LF6 B;  2P06 A;  2EZP A;  3K08 A;  2NLJ C;  2D2C B;  1GN2 A;  2Y0P A;  4X1I A;  1WJZ A;  4JTA B;  4TV8 F;  3H9V A;  4LFA H;  2CW8 A;  4IIJ B;  1I5X A;  5LP6 A;  1AP5 A;  1K4C C;  1R3L C;  1I2L A;  1SCU B;  4QE7 A;  5I5W A;  2W9B A;  4LF4 B;  5LMU O;  3GV8 B;  3AK2 A;  3ZX6 A;  2R7K A;  3CCM V;  4A3L G;  1I1L A;  4GKJ O;  4PJ0 Z;  2CTQ A;  3RAQ A;  4I9W A;  4ED8 A;  4UV9 A;  4YAJ B;  1S0N A;  4LF8 B;  1KD1 W;  5CB4 F;  4K35 A;  4GX0 A;  4QIW F;  2F1M A;  4DV3 O;  3HKZ E;  3JSL A;  1EZV H;  4J11 A;  5LMU H;  3S3W A;  2C2E A;  4O7L A;  3V4Z A;  3CCE V;  1BXR A;  4Q4D A;  2IU0 A;  2UXB O;  1K3E A;  2YI9 A;  3K0D A;  3G8D A;  3D3Q A;  4K0K B;  1AR4 A;  2I87 A;  4B3T B;  4UCR A;  1IBL H;  4WBN B;  4FU0 A;  1W0K G;  2AW9 A;  5FD5 A;  5LHI A;  1T94 A;  4DRX A;  4K8Z A;  2JEI A;  4EB6 A;  1T5E A;  2PF4 E;  1J5E H;  1T36 A;  2VPQ A;  2IP4 A;  3AG4 C;  1DIK A;  3TY9 A;  1EKF A;  2GDS A;  4O3O A;  1B04 A;  4RB1 A;  4I4T A;  4JYA H;  4JI3 H;  3JRW A;  4BWS C;  4QJF A;  3CRC A;  3K9A A;  1IBM O;  4LF9 B;  4IRC A;  1AJQ A;  4B3R H;  2VPS A;  2UXC B;  5KMG A;  3T1H O;  1RSO A;  2QE7 G;  3CMA V;  5BWU A;  1IBM H;  4FFN A;  1PM9 A;  1P7G A;  3RWR D;  4X1Y B;  3CRA A;  4NTY A;  4E6N A;  1A32 A;  4J9S A;  4WFB V;  1E4F T;  3JD2 A;  4DV6 H;  5KA5 A;  4CMD A;  2RGR A;  3HKD A;  2P67 A;  4XX0 B;  5BMV B;  5CM0 A;  4R8U A;  1YTF D;  3NBZ B;  4DUZ B;  1XIL A;  1QU7 A;  1J5E B;  3C90 A;  4LF6 O;  5KT6 A;  3BFR A;  4DV7 H;  1YXB A;  5KHG A;  3BY6 A;  4CKE A;  4ABM A;  2Q8V A;  2V4Q A;  1I1K A;  1FXK A;  5LL6 Y;  4NZN A;  3ZHQ A;  3KHR A;  4O2B F;  4O4H B;  1E4E B;  1RK6 A;  4DL6 A;  1K7D A;  3O9O A;  4DR7 B;  5J2T F;  2KKW A;  3KAL A;  4JUZ A;  4NKG B;  4M9U A;  1JXL A;  2J6U A;  1PNL A;  2A06 H;  2PGG A;  1EHI A;  1AB3 A;  4CH4 A;  3IN5 A;  1EUD B;  4F6R B;  3CJH B;  4DV3 H;  4MV7 A;  4DL7 A;  2AXT Z;  4MAM A;  4J9P A;  2AGQ A;  4X89 A;  1XNQ B;  2QWO B;  3CXC U;  1LNQ A;  3K0G A;  2E3C A;  3SDL A;  3TII A;  4NLG A;  3SYA A;  4XYL B;  3Q2O A;  1VQ4 V;  4GT1 A;  1UC9 A;  3ZMT A;  4U3F H;  1AVM A;  3RB4 A;  1PV0 A;  1WCM G;  5B1B C;  4FM9 A;  3ZHT A;  4JV5 O;  1KBH A;  2OIE A;  2QWP B;  1X59 A;  1VP7 A;  1WB7 A;  4P2Z A;  3CCQ V;  2R6F A;  2JA6 G;  4O81 A;  2FL4 A;  5IY5 C;  1GK9 A;  2Q68 A;  4I0X B;  3B09 A;  4I4T B;  3H01 A;  4GZR B;  1AI6 A;  4JI5 O;  4LBE C;  1SQB H;  3ORQ A;  3Q4H A;  3P3N A;  4Z1M G;  3DC6 A;  1Y14 B;  2B9Z A;  2UXX A;  5DGA A;  5EC1 C;  4LF9 O;  3R5F A;  4AYB A;  3QQM A;  2QKA A;  3TCU A;  1PNK A;  4FVM A;  2ZD9 A;  2FML A;  4P9P A;  3JAM W;  3TQ1 A;  4FLZ A;  2H3O A;  1KJJ A;  2R7Z G;  3QF7 A;  1TA8 A;  1VQK V;  3GII A;  4IZO A;  1M56 C;  3W7U A;  4JI1 O;  4IL6 Z;  1SS3 A;  1XDN A;  4TV9 A;  5EWG A;  3JAW A;  3CCS V;  1P8L A;  4JI5 B;  2WAM A;  1R6N A;  4M0J A;  3J7A U;  4NXN H;  2VWK A;  2F4V B;  4ZBM A;  1P84 F;  2EIM B;  3Q8S B;  2ZNI A;  2V1D A;  1L0N H;  5KFS A;  3L4K A;  3RBZ A;  1XMO B;  5KFN A;  3W7X A;  4JV5 B;  4JYB A;  5EOY A;  4DV2 H;  2W7O A;  2YIC A;  3JYC A;  2GSM B;  3RT3 C;  1SQG A;  2EIK C;  5J2U B;  4NXN B;  3H40 A;  2Z5U A;  2UU9 B;  3NC0 B;  3SI8 A;  2ZXW B;  4J9N A;  3HO8 A;  2UXC O;  1QBZ A;  2JA7 A;  1Y1V A;  5BY1 A;  5FLM G;  1AR1 B;  2PTM A;  2ZIM A;  2UXN A;  1Q81 W;  5LGT A;  1IVS A;  2JJ2 G;  1XNQ O;  4NZO A;  3W1G A;  1Y76 A;  2HVQ A;  4X1K A;  2ZM6 B;  1TUB B;  3UFX B;  3E83 A;  4QGP A;  1AUX A;  2ASJ A;  5D1P A;  1NVP B;  1AJP A;  2Q4P A;  4DL2 A;  4DR4 O;  4HNV A;  4JYA O;  5HV6 A;  3H1L H;  5IJ9 B;  4I9Q A;  1NVP D;  1WH2 A;  2ZGI A;  3DXR B;  5D5Q A;  3ABK B;  4PDV A;  2AHZ A;  4YJ3 A;  3RR5 A;  4OXS A;  4MT8 A;  5IP9 G;  1Q6H A;  3TY8 A;  4FFB B;  1EN6 A;  2VUG A;  3QTC A;  1N36 O;  1KJ9 A;  1K73 W;  5GON B;  4X62 B;  1IOW A;  4NXM B;  1CXZ B;  2ZE7 A;  4O7S A;  4XYM B;  3RV3 A;  3DF7 A;  2UXC H;  3VMM A;  2DIK A;  3ABK C;  5C44 G;  1CP9 A;  4QSH A;  1G2W A;  1CKN A;  2NU7 B;  2HEP A;  2CTW A;  1FVI A;  2Z04 A;  4FLW A;  4ECW A;  2FPI B;  1Y66 A;  4O4I A;  4DUY H;  3PW0 A;  5CA1 A;  3P3P A;  1W93 A;  4FLV A;  1B6Q A;  3ETJ A;  4FE2 A;  3GIP A;  4IHJ A;  1N56 A;  4UB6 Z;  2BTQ B;  2XT9 A;  1SFO A;  2YXH A;  2C2D A;  4R7R A;  4DR6 B;  3X2Q B;  2NVY A;  2WLN A;  4YY3 B;  2YZL A;  3E22 A;  3RW0 A;  1KC8 W;  4MSW C;  4RAZ A;  1WA8 A;  3AK1 A;  3CRR A;  3JAK B;  1VQ6 V;  2R87 A;  4O2B A;  4LWS B;  3VNN A;  4FM1 A;  5F9L A;  4QWD A;  4FLU A;  3ZRS A;  4K0K H;  3JD4 A;  4OGQ B;  4E4T A;  2Z0A A;  3MR2 A;  4LFA O;  2DAB A;  4QWA A;  4TQR A;  1TWH A;  1WR2 A;  1FFT B;  3FKS G;  1QR8 A;  4JV2 A;  1WCM A;  2R85 A;  1Z2N X;  2VQD A;  1M6V A;  1H2M A;  2E76 B;  1MSW D;  4ZI7 F;  3ZMV A;  4ICG A;  2DWC A;  2K9P A;  4Q8F A;  4MTX A;  1HNW H;  4GKJ B;  3CME V;  1C3O A;  4X62 O;  5L3F A;  4JV1 A;  4XZ3 B;  2H8P C;  3ASN C;  5KUM A;  2V9W A;  4Q43 A;  3K06 A;  3CP1 A;  3ZRW B;  4RAY A;  1B6R A;  5GTI Z;  5A2Q N;  1K8A W;  2OYQ A;  3T7A A;  2E5L H;  2C22 A;  3UZB A;  3CWB H;  3GTG A;  5KX5 B;  1FXV A;  1S68 A;  4DR4 B;  2FPP B;  4FFK A;  4YP3 A;  3FD9 A;  3NGD A;  1UPG A;  4JI2 O;  2CFM A;  1GTO A;  3JZI A;  5L1L A;  3FMA A;  3GB8 B;  5DMX A;  4ZHQ A;  1IZ3 A;  2KB1 A;  5LP6 C;  5LYJ A;  1G6U A;  3T9E A;  1EN4 A;  3OHB A;  1I7F A;  3ASO B;  2R9I A;  4EFB A;  1QLE C;  4O4I F;  5DQI A;  4TQS A;  5BWT A;  2RDJ A;  1K92 A;  3PJS K;  3QZ8 A;  2UU9 O;  1L1F A;  1US6 A;  3OFN G;  3GTJ A;  5KKN B;  3KKY A;  3JAS A;  1Y4M A;  4A3I G;  4CZZ A;  5BR8 B;  3ETG A;  4X1K B;  4EG0 A;  5I5T A;  3RIZ A;  4DR1 H;  2P5O A;  4QIW A;  2EIM C;  4O3Q A;  1VAR A;  1W59 A;  3TW6 A;  2WAQ E;  3KXY T;  5KG1 A;  2HVK C;  3N2G B;  1NU1 H;  4NYE A;  1JIH A;  1SZX A;  1WPB A;  3ABL C;  4DR1 O;  4A3F G;  4B3T H;  1MZB A;  4EEY A;  3KAK A;  2WLL B;  3IC9 A;  4MV1 A;  1HW7 A;  1DLB A;  3CVZ A;  4AIL C;  3HB3 B;  3OD4 A;  4FFR A;  2R92 A;  4WFE A;  1Q6U A;  4F6E A;  4B3S B;  1A0G A;  2R7L A;  4R50 A;  4DV6 O;  4DK1 A;  3L70 H;  5GON A;  2RF4 A;  4MW3 A;  1VBG A;  5KG5 A;  1CEZ A;  2W6Z A;  2P4V A;  2RGV A;  1N48 A;  2UVU A;  4JI1 H;  1ZSP A;  3JAW B;  5BMV A;  2W8K A;  2RJZ A;  3TXQ A;  3HOX G;  4A3D G;  2JGD A;  5C8Y B;  3CC4 V;  4ED3 A;  1FXH A;  2RMK B;  3S24 A;  3RVY A;  4HN2 A;  2FP4 B;  3CS5 A;  2FE3 A;  3VPD A;  4KHP B;  5I5S A;  1YJ9 V;  5DLG A;  3AK3 A;  4BAY A;  3FB7 C;  1GKF A;  4LF9 H;  5DAA A;  4DL5 A;  4JI8 H;  1RJR A;  5IYB O;  3HT5 A;  5EC2 C;  5LOV B;  2Q7D A;  4DV6 B;  2NU8 B;  5BPF A;  2JA5 G;  5JUM A;  4GX2 A;  2WE6 A;  4AYB E;  4DV0 H;  4JZ2 A;  4DUZ H;  4AI8 A;  4QWE A;  1EKV A;  4OPA A;  2FK3 A;  1KP3 A;  3AG3 C;  5KA6 A;  3K5L A;  1CQJ B;  2KSW A;  3WB1 A;  5B66 Z;  5FNV A;  4DV5 B;  4JI2 B;  3M7M X;  4EB6 B;  3TIN A;  2UUC B;  3N43 B;  5D5P A;  2EJ0 A;  1ARO P;  4UFZ A;  1MAB G;  2PUS A;  4K6N A;  4LMY A;  2OIG A;  3O65 A;  5LGN A;  5KT4 A;  4TV8 A;  5JQW A;  1Q8I A;  1VQN V;  3RGB A;  1V9P A;  5EWE A;  4J42 A;  3N44 B;  2DYR B;  1GSA A;  2Y0S E;  1FPO A;  1WP8 A;  3RFR A;  5FPO A;  3GIL A;  2WYO A;  5C1P A;  3HB9 A;  3IJ4 A;  1N34 H;  1XUQ A;  5H9C A;  1CKN B;  1FS0 G;  4DV0 B;  2ZDQ A;  1P49 A;  2RQ6 A;  5KUK A;  3M8A A;  1GN6 A;  3N6R A;  4GYC B;  2BQU A;  3KCY A;  4J80 A;  2EIY A;  4YB8 B;  3MDS A;  2ZM6 H;  1F7Y A;  1CS0 A;  2DWE C;  3P32 A;  1GN3 A;  1SYX B;  2JVD A;  4FJC C;  3VQY A;  1ET0 A;  3BA8 A;  5CMU A;  1E4G T;  5LXT A;  5KFJ A;  2UUB H;  1EN5 A;  3Q8P B;  3H1H H;  1VF6 C;  2Y0I A;  3U0G A;  5L1I A;  3MHS C;  1N33 O;  1VQ8 V;  3H0G G;  2JEG A;  5FR9 A;  4H13 B;  3N2K B;  3T1C A;  1JLL B;  1JVM A;  4MVZ A;  3FYI B;  5KFW A;  2XAS A;  2WLI B;  1AI7 A;  3OT7 A;  4O7T A;  2QSA A;  4O2A A;  4A3J G;  2A3Q A;  3UT5 A;  4JV0 A;  1HNX O;  3FFQ A;  4BIZ A;  1TVK A;  4A2A A;  3KTM A;  2YIA A;  2FJZ A;  3U11 A;  2DW4 A;  3HOV G;  2UVR A;  4B3T O;  2Y69 B;  4LFC O;  4RNO A;  4JI3 O;  1BMF G;  3WG7 B;  4FFB A;  1VF6 A;  1EZ1 A;  3RTX A;  4K8X A;  3T5L A;  3QO7 A;  2KG7 A;  4D6T H;  3LUL A;  3FAV A;  2IH1 C;  4J9K A;  1K1S A;  4MVS A;  1P16 A;  3E8H A;  1K5S A;  2QTS A;  5I5V A;  2X7R B;  4EQ5 A;  3ETD A;  3ETH A;  3TY5 A;  4H44 B;  2ZE8 A;  3EYY A;  1DF5 A;  4HNT A;  3JAL A;  3LDE A;  5L3D A;  1N36 B;  1PNM A;  3C0F B;  4DV5 O;  4FLT A;  4AQY H;  3VQV A;  3JAR A;  2YW2 A;  4GLX A;  4EYH B;  5IE9 A;  4DV1 B;  3QNE A;  3RUP A;  1L2Z A;  5C3E G;  3KHL A;  4CS4 A;  1L0L H;  3E89 A;  5K3W A;  4WBN F;  1RFY A;  5I60 A;  1Q43 A;  5LYJ F;  4PWQ A;  2FLN A;  4TWK A;  4QPJ A;  4J7J A;  1R73 A;  1IYE A;  2IBK A;  3OTF A;  4X66 B;  4L8J A;  2C2A A;  3PO2 G;  4FS2 A;  4I0X A;  4WHX A;  4DR5 H;  4XBF A;  1COW G;  2ZCE A;  3E86 A;  3KCX A;  4A2B A;  2Q69 A;  4JZG A;  4JI5 H;  4TV9 B;  4PA4 A;  3WG7 C;  3M9O B;  2ATK C;  4WFA V;  4X20 B;  3RYI A;  1K4D C;  4QE9 A;  5L3G A;  3SJB C;  2UXD H;  4YR2 A;  3ML0 A;  2WTF A;  1XEQ A;  3BPZ A;  4O2A B;  4X20 A;  3AG3 B;  3RYI B;  5J2U F;  3RBE A;  2HHH O;  3F7V C;  4O4L F;  1GGO A;  3SNO A;  1KUT A;  2VQE B;  2J6T A;  4MA5 A;  4OX9 O;  3BJY A;  1JJO A;  1PL4 A;  5CN0 A;  2Q7H A;  1Q6I A;  3D8C A;  3L9D A;  1MOF A;  2Q67 A;  1XQ8 A;  4LFB B;  1G1X B;  1N32 H;  2LW7 A;  3K5M A;  1AR5 A;  1MNG A;  1ZL8 A;  5LMN O;  3MWE A;  1N0J A;  2G38 A;  3OTO B;  3JAT A;  1WRV A;  3N41 B;  5FLX W;  2CTP A;  3BEH A;  4ZQI A;  4MTE A;  4HAM A;  3EPG A;  2EIJ B;  5C4X G;  2ODM A;  3GTP A;  4YR0 A;  1W2B U;  5I5U A;  5HBR B;  3RF2 A;  3BVO A;  1BS3 A;  5KFP A;  4G2K A;  3RGZ A;  3CCV V;  5KHJ A;  5HFL A;  3GTL A;  2XHB A;  2DQ3 A;  1TVK B;  4JI7 B;  4IRD A;  1QQC A;  5LHG A;  2WA4 A;  1W0J G;  2W9A A;  4MTF A;  4F4Z A;  4DL4 A;  4J9L A;  4F50 A;  4RUE A;  3SGI A;  4JI6 O;  3JCZ A;  5KHI A;  5I47 A;  1A9X A;  2XCL A;  4DRF A;  5KG4 A;  2ODT X;  4X66 O;  5EZY B;  4G3I A;  4J9Y B;  1Y74 A;  3W7W A;  3H0G A;  5LA6 F;  2CK3 G;  1QVG U;  4YQW A;  1V4Y A;  4FGR A;  5KFY A;  5LXT B;  3FYE B;  2WSS G;  2WLJ A;  4FPP A;  3VOU A;  5JQG A;  4WF9 V;  1XHZ A;  4QW8 A;  2JA6 A;  1GM7 A;  5KFH A;  2XND G;  3A0B Z;  3RVZ A;  4LF5 H;  3MAQ A;  4A3E G;  5BWW A;  1SER A;  3KRE A;  4O7Y A;  5HNE A;  4LFB O;  5KFU A;  3TIG A;  5LBQ A;  1N4C A;  2R7N A;  1ZET A;  3H1J H;  4D7T A;  4ED2 A;  4NTX A;  4AHC A;  2YRW A;  2FB9 A;  4ZKI A;  2ITD C;  3H1K H;  4B7E A;  3AG2 B;  4FLY A;  1S03 G;  1EKP A;  2FKX A;  4QPK A;  1Z5V A;  3MR5 A;  4G27 B;  1RJP A;  1XBL A;  2IJI A;  3RYC A;  4K3A A;  4Q45 A;  3G4S V;  1NBM G;  2GTS A;  2PI5 A;  3UQ8 A;  3GIJ A;  3TW7 A;  2QK4 A;  4Q20 A;  4KP4 A;  1MZE A;  1Z2P X;  4JI0 B;  3LDD A;  3BAA A;  1N32 O;  4PV1 B;  1YHQ V;  2Q9L A;  3ORR A;  1E4E A;  3OUZ A;  4HNA A;  5CA0 F;  2HLD G;  3A0R A;  2ZR3 A;  2YIB D;  3CCU V;  4ASU G;  2HHF A;  3STZ C;  2VA3 A;  3RGX A;  5KFX A;  4OX9 H;  2VA2 A;  1NTM H;  2RDC A;  1GAX A;  2W6J G;  1VQP V;  4DR3 B;  4J41 A;  3T9A A;  1NTK H;  3ETQ A;  4YXW G;  1C30 A;  4YJ2 F;  3G6B A;  3T99 A;  4FM0 A;  1KB9 F;  1WPX A;  5CA1 B;  3OEE G;  2EIN C;  3HR0 A;  4X1Y A;  4JAV A;  1I5Y A;  3ZHR A;  4KHP H;  4TUY B;  1GN4 A;  3MD0 A;  3PR4 A;  4ECQ A;  4X65 O;  2BTO A;  2F93 B;  2NN4 A;  2DMX A;  3OE7 G;  4JV5 H;  5BWR A;  3KHG A;  3HOW G;  3QO8 A;  5FL7 G;  2NNU A;  1DV1 A;  4HNU A;  5JCO A;  3DTU B;  3NXS A;  3ZCC A;  3NUA A;  4O83 A;  4C5B A;  5KX5 A;  1JDB B;  5JVD A;  3H20 A;  4NTW A;  4DR5 B;  3ZIA G;  3APO A;  3M9M B;  4F4X A;  2ZQM A;  2JGU A;  3ABT A;  2X6A A;  2Q7G A;  4K0K O;  1Q82 W;  4CC5 A;  5LA6 A;  1OWT A;  2X6B A;  3F5T A;  3SR2 C;  1UC8 A;  2LO1 A;  3K3W A;  1FJG B;  1WA8 B;  3AG7 A;  3VQX A;  1NZ6 A;  2ZDH A;  4IWX A;  5DG9 A;  2IJJ A;  4DIM A;  2YZM A;  4U6P A;  1TGO A;  1KP2 A;  4DV5 H;  3RBD A;  5K2M A;  4RNM A;  2FKL A;  2XOK G;  1XI1 A;  1KTA A;  2ZE6 A;  5L3E A;  3HOY G;  2OCC B;  3Q8Q B;  4ZOL A;  1LR1 A;  2ZNJ A;  2WA3 A;  4F4Y A;  4DR3 O;  5D1O B;  3CCL V;  5KHK A;  4PDR A;  3APQ A;  1HR0 H;  1TWC A;  4DR5 O;  3VBB A;  3OAA G;  1OCZ C;  3OGC C;  4DUY O;  2CAZ C;  2E75 B;  3ABM C;  3RB3 A;  5L9X A;  2WLL A;  1WN7 A;  4TQF A;  2X0L A;  5FLX N;  1H2G A;  5KG0 A;  2OTJ V;  1Q90 D;  4MTO A;  4YIO A;  5J2T B;  3B8M A;  4DAA A;  4YJ3 B;  1RYR A;  2M6Y A;  4LH6 A;  3ZHS A;  1D5A A;  1OZ0 A;  4C5A A;  5KFF A;  1MZF A;  3EVK A;  3I4N G;  2I8C A;  1XNR O;  3L72 H;  1AUV A;  3BQ1 A;  4DV2 B;  2D3O W;  2HKO A;  3K03 A;  2ZDI C;  1XMQ H;  3E8B A;  2Y48 A;  4LF7 B;  4GX5 A;  4JI6 H;  3BG5 A;  2ZE5 A;  1IBK O;  5FNV F;  1YTF B;  3S3X A;  4RO2 A;  4BWA A;  4ECX A;  2VQF B;  1F4M A;  2GHY A;  1VAJ A;  4MV4 A;  4B3S O;  3M4I A;  2AHY A;  5KT3 A;  2W0X A;  3ZRV A;  2QDO A;  4PA3 A;  2W71 A;  4YHH B;  4O7V A;  2L6L A;  1JQ0 A;  3RYH A;  4DR1 B;  3AG2 C;  1AIL A;  1Z2O X;  2OLS A;  4RQF A;  2M05 A;  2UXB H;  3PW7 A;  1FXK B;  4JI7 O;  4DV4 B;  5EIB C;  1XK5 A;  1B33 N;  4U3J A;  3WWH A;  3TK1 A;  1P7B A;  3LSU A;  1SC5 B;  1NS1 A;  4ME6 A;  3UM7 A;  2NVX A;  4WBN A;  3MFI A;  3EHB B;  2HGW A;  4FIP C;  3R66 A;  4CH6 A;  3V4S A;  1I50 A;  5EYP B;  2DYS B;  2WDT A;  3BAB A;  1Y6X A;  2EUL A;  3ZS8 C;  1RK5 A;  2ASL A;  4IHJ B;  4N21 A;  1S9F A;  4DUY B;  2XGQ A;  5IYB G;  3BCC H;  1BGY H;  1KT8 A;  1R3J C;  3GTK A;  1M57 C;  4KXR A;  3WO1 A;  1Y67 A;  4ECZ A;  5JVD B;  1WNS A;  3JAL B;  2PY5 A;  4TSF G;  1SET A;  2BQR A;  4ZI7 A;  2QKC A;  3SYQ A;  4YJ2 B;  2ZM6 O;  5KAF Z;  3T5K A;  2PVP A;  4DQN A;  3UZO A;  4X1I B;  1HNW O;  4BIO A;  2WB1 E;  2PMZ E;  3OUS A;  4MV8 A;  1N34 O;  2W7P A;  4P30 A;  2Q2T A;  1GO3 F;  3T5H A;  2UUA H;  2R8K A;  2QM4 A;  1FXK C;  2FYU H;  5IYZ B;  4JF3 A;  3RV4 A;  2DQ0 A;  1M0W A;  5H5N A;  3K5N A;  4Y8V B;  4DXW A;  3G6V A;  2QM7 A;  4O4H F;  3RAX A;  1Z5W A;  5D8D A;  3BRC A;  2VQE O;  2QWR B;  1OV9 A;  2GUZ A;  2VWJ A;  2RNB A;  1F23 A;  5KFQ A;  5EBM C;  1Q5O A;  3CC7 V;  4MTD A;  4RZQ A;  4DK0 A;  3FX7 A;  3BAC A;  3ABM B;  4J7K A;  3CE2 A;  2IA6 A;  1KJ8 A;  1ZTE A;  5CA1 F;  2YXL A;  5IP7 G;  2HVJ C;  2ARH A;  1HNW B;  4EBC A;  4DUZ O;  4H0L B;  4CBC A;  5BXZ A;  3KHH A;  5KFZ A;  2YS8 A;  1U96 A;  1SEI A;  4TOI A;  4O4L B;  2DN9 A;  5JWP A;  2E2H A;  3CCR V;  4NYK A;  2IJK A;  2MW2 B;  1P4R A;  4A5U B;  2OT5 A;  2YXY A;  4DLK A;  4NXM H;  2W6M A;  4PZ7 A;  4YIP A;  3OM3 B;  1S5L Z;  3LNN A;  3N2K A;  2VOB A;  3B4S A;  2AGA A;  3IAY A;  1GYF A;  3CD6 V;  5J2U A;  1N36 H;  4FBU A;  1NJI W;  2B63 G;  3QVN A;  4LF6 H;  2OWO A;  2ADQ B;  3K5H A;  3LSQ A;  3VOT A;  4JI3 B;  1WP7 A;  2GPW A;  3CRM A;  4R6Z A;  3VPC A;  3QG5 A;  3HKC A;  3SJA C;  3T2M A;  2QB5 A;  3N27 A;  1NT2 B;  4DR6 H;  1I2K A;  2ETN A;  3BHP A;  3PO3 G;  3K59 A;  1A3G A;  1HNX B;  3W1B A;  1RPO A;  4B3M O;  2VQE H;  1AI4 A;  3HKC B;  1NR7 A;  4CE5 A;  3JZF A;  1BHB A;  1QHT A;  1VQ9 V;  4FBT A;  2ADP A;  2YID A;  4MA0 A;  2DPI A;  3GV5 B;  4J9R A;  1A48 A;  2HJF C;  4I50 A;  4BW5 A;  5CR5 A;  4X88 A;  1QLN A;  4M7E A;  2R8J A;  4DW1 A;  3GJX B;  1IDS A;  4J9Q A;  1J95 A;  1MSD A;  3NR7 A;  2AZ0 A;  5JQG B;  5LXT F;  2CQY A;  2Q7E A;  3CQZ A;  2FLP A;  2JRI A;  5DM6 V;  2XAG A;  2NU9 B;  2ZDG A;  2EJR A;  5KFD A;  4LNU A;  4YAK B;  1H2L A;  3GV7 B;  3RB6 A;  2LP7 A;  2W9C B;  3AG4 B;  1YJW V;  3B40 A;  3OGI B;  3K58 A;  1GSH A;  4TUY F;  4BXX G;  3H3V H;  2YS7 A;  2V58 A;  1N0N A;  4MTG A;  3E22 B;  4EEQ A;  1V55 B;  4DO2 A;  3PFF A;  2P7T C;  4IR9 A;  4JI4 H;  5LOV A;  1SF9 A;  3OMA B;  4YHH H;  5JCO C;  4LF4 O;  3TGU H;  1BL8 A;  4O2B B;  5TIS Z;  1KMI Z;  3JAR B;  4QWC A;  2CH7 B;  3MWM A;  3SJC C;  2Y4R A;  4XDJ A;  2YL2 A;  4CH5 A;  4A3M G;  4LF8 O;  3JD3 A;  3L4J A;  1BE3 H;  3DTG A;  2GQS A;  3J80 N;  3K3V A;  2ATL A;  2F4V H;  1VKZ A;  3U54 A;  4F4W A;  3C3S A;  4WFH A;  3TJT A;  5DG7 A;  4I5S A;  4A3K G;  2DWD C;  2Y4T A;  4UUJ C;  5KS8 A;  3HBL A;  1PKX A;  1WAZ A;  3LNM B;  4TVI A;  2JS5 A;  2VUM G;  5JJN B;  4A3G G;  3CC2 V;  3JAK A;  2FPG B;  2RN9 A;  3T9D A;  3I56 V;  3FB6 C;  2YYA A;  2DE0 X;  1CKO A;  1NH2 B;  4TV9 F;  5CE8 A;  3R5H A;  1IBK H;  4UCV A;  1Y1W A;  1X4T A;  1M7J A;  1ZLZ A;  2J6S A;  2QEX V;  4QJF B;  3K9S A;  3CCJ V;  2WB1 A;  4UVC A;  2R93 G;  1M0T A;  1E79 G;  1F4N A;  2IW5 A;  2JDI G;  4RCN A;  5IYZ A;  4IWY A;  2NUA B;  3CB2 A;  4OPH A;  1B06 A;  1HWY A;  1DV2 A;  1V54 B;  4U7O A;  5EK0 A;  4RB2 C;  2DOS A;  1LUW A;  1XNQ H;  4TQD A;  5EBW C;  4QNH B;  1R6K A;  5ITZ A;  2VUM A;  1G4Y B;  2YIB A;  3OEH G;  4HNA B;  2P22 C;  4EYI B;  4B7K A;  4DR7 H;  3VQW A;  5KFT A;  1KQS U;  3DTF A;  5GW7 A;  1OBD A;  2R8I A;  1VQL V;  4Q44 A;  4GC7 A;  1AP6 A;  3I55 V;  4DR2 H;  4DR7 O;  1K33 A;  1PL0 A;  1I94 H;  4DV2 O;  3WB2 A;  1HNZ O;  1XDC A;  1XHX A;  3CSW A;  3N2G A;  4UCS A;  3WWI A;  2W9B B;  4APM A;  1FAF A;  1TUB A;  1I94 B;  3ETE A;  3OR7 C;  4RUF A;  2DZD A;  1RM1 C;  4J10 A;  3CEB A;  2Q0A A;  3PN1 A;  5JH7 B;  4KUM A;  2PMZ A;  3T1Y H;  2C00 A;  1NQT A;  2O57 A;  5B3S C;  2SCU B;  4JI2 H;  3PW4 A;  3UYY A;  5LHH A;  2KQX A;  1GH6 A;  2Y0S A;  3G80 A;  4L87 A;  3JAS B;  1OBG A;  3K5O A;  1EM1 A;  3HPL C;  2YEV A;  4DV4 O;  4RUA A;  2AQ4 A;  2LGW A;  5B3S B;  3IFX A;  2EIL C;  1JFF B;  3ZN0 A;  5IWA O;  1SES A;  4KFM A;  5J2T A;  2PYL A;  1VS0 A;  2W0F C;  3DC5 A;  1K97 A;  3ABL B;  3E35 A;  4O4I B;  2ZJT A;  1I7N A;  4ZHQ B;  2B63 A;  2Z3Y A;  1AJN A;  2XTA A;  3AG1 C;  3RYH B;  1WLE A;  4IIJ A;  5LP6 B;  2FK1 A;  2N04 A;  2X5R A;  4R7C A;  5EYP A;  1QLE B;  2NU6 B;  5IDJ A;  3FB8 C;  4ED0 A;  4A3C G;  4YJ3 F;  3W7T A;  1FYJ A;  2CNQ A;  2Q0O C;  3GQC A;  5BWX A;  3KG2 A;  2FMA A;  2RDI A;  5LMN H;  1H2S B;  4MVM A;  1H2K A;  5JQG F;  1QCE A;  1TUE B;  1TAE A;  2ITC C;  5CAE B;  4FS1 A;  4RAI A;  4G28 B;  1JJ2 U;  4O3P A;  1I08 A;  1DAA A;  5C5J A;  3U9T A;  1IXB A;  2CNV A;  5KFA A;  2V59 A;  1DF4 A;  4MVO A;  3CRQ A;  5E79 Z;  1I7L A;  4L1K A;  1ZWI C;  1R6T A;  2CNU A;  3PW2 A;  4JI7 H;  4LC1 A;  2EX3 A;  2UXD O;  2QJ1 A;  4JI4 B;  3N8D A;  2HR3 A;  2CGN A;  2PI4 A;  4EGJ A;  2QWN B;  4UB8 Z;  3CYO A;  1YI2 V;  3KZI Z;  4LFA B;  1VF5 B;  3U0Z A;  3GB7 C;  4JXU A;  3SE7 A;  5LGU A;  5B1N A;  4IHJ F;  1FFX B;  1VBH A;  5KFV A;  4AQY B;  2BCC H;  3OSN A;  3T5J A;  2CGO A;  2P4K A;  2VS0 A;  5BYB A;  1MG1 A;  3SYC A;  1BT8 A;  1YSC A;  3PVX A;  4DV7 B;  4QIW E;  4TV8 B;  4LFB H;  1XMQ O;  1KKD A;  3V6J A;  1T3N A;  1Z2G A;  4I55 A;  2L35 A;  4DR4 H;  2JIZ G;  1TWG A;  2C28 A;  2YS6 A;  3RB0 A;  5CB4 A;  4U3J B;  1FKA O;  5L3B A;  2ABJ A;  4B3R O;  3Q4H B;  4FLX A;  4LSX A;  1OCR C;  5JVD F;  1VQ5 V;  3ZMZ A;  2HIV A;  3EPI A;  3X2Q C;  4NXM O;  1ZHQ A;  3PZP A;  1G8M A;  2VRZ A;  1NR1 A;  2GV9 A;  4ECR A;  2XCP A;  3E5N A;  3SPI A;  3GVM A;  2GLT A;  3ZED A;  1DK1 A;  1JMK C;  1I0H A;  4X64 O;  3ZRW A;  4ED1 A;  3FKI G;  2Z02 A;  4YY3 O;  1BZK A;  5KFG A;  3F7Y C;  4DV7 O;  4CMF A;  4O4J A;  1BJT A;  4X64 H;  1LUV A;  3CEI A;  1HR0 B;  2IU3 A;  2OCC C;  1E1Q G;  4PI0 A;  1Y1W G;  4O3S A;  4O2A F;  4C5C A;  5KFK A;  4B3M B;  3N42 B;  4U7N A;  1RP3 B;  2HHF B;  4YJ2 A;  5IYZ F;  1Y1V G;  3DGE A;  4WFG A;  4X65 B;  1X9N A;  4HYK A;  3I12 A;  3WO0 A;  2UXD B;  4EBE A;  1S5J A;  5LL6 b;  1W96 A;  1SQX H;  5DQH A;  3AX6 A;  1FKA H;  4LP8 A;  3HKB A;  1Q3E A;  1DGS A;  1SQQ H;  2Y4U A;  1XMQ B;  1Q7Y W;  2Q2U A;  2BQ3 A;  2AGP A;  3TXS A;  3ASN B;  1V51 A;  4O7Z A;  2XCA A;  1S10 A;  3OUU A;  1R1B A;  1VIB A;  4A93 G;  1N33 H;  4DRX B;  4CC6 A;  4EGQ A;  1EUC B;  4BBR G;  2JA5 A;  5FJ8 G;  2HVR A;  1FFX A;  2UUB O;  1RJQ A;  4J9O A;  2CH7 A;  2EZO A;  5AG2 A;  4BIU A;  3NBY B;  4DV1 H;  1SZT A;  5EBL C;  1UFI A;  4RQE A;  1IBK B;  1IXM A;  2COJ A;  1TWA A;  5KX5 F;  1JA8 A;  3N6X A;  3LSS A;  5BWV A;  4O84 A;  2F23 A;  1ENV A;  1JOY A;  2BOB C;  4O7R A;  5BR8 H;  2HVS A;  5E1A C;  2EIK B;  2QR4 A;  2RCV A;  3G6E V;  4FFO A;  1OCO C;  5GTH Z;  4P9O A;  5L3C A;  2IH3 C;  3GWO A;  5EWF A;  2X6C A;  3CHX A;  3T4Z A;  3E8G A;  3JD1 A;  4JTC B;  2QTO A;  4PA9 A;  2XAH A;  3R9R A;  2YEV B;  4JPR A;  4J0M A;  2DPJ A;  3RN4 A;  5D1O A;  1S3J A;  1KBL A;  3ZHU A;  2HHH H;  4PI2 A;  3T1H B;  4KL1 A;  1Q86 W;  1I1M A;  4IR1 A;  4UCO A;  3OMN B;  2DYR C;  3MR6 A;  4RB0 A;  3WNZ A;  5JJJ B;  1IOV A;  1S5H C;  2A0L A;  5CBG A;  1CE8 A;  4PDM A;  3IC7 A;  4JI0 O;  4Z1V A;  5IT9 N;  4DV0 O;  4O86 A;  3IG0 A;  1OCC C;  1OCR B;  1H38 A;  1GO3 E;  4LF7 O;  1RSO B;  1PP9 H;  4B3S H;  1HNZ H;  4BY7 G;  2ZDI A;  4LF5 B;  4HR7 A;  3T9C A;  3THO A;  5KMG B;  4UXN A;  4W4K A;  2GTA A;  2R9R B;  4FZ1 A;  1M9N A;  4RNN A;  5B1A C;  2X0S A;  4DV4 H;  4O3N A;  4J9M A;  1EZJ A;  3JRX A;  2F43 G;  3FAV B;  1SQV H;  3JD0 A;  2UUB B;  3K5I A;  5DGH A;  1BGW A;  3G71 V;  2R8H A;  1XNR H;  3T1H H;  4FMT A;  1I6U A;  1CKM A;  2BTQ A;  2W8L A;  1H2N A;  3CXH F;  5K1X A;  2BR0 A;  2LW1 A;  1HNX H;  3E2E A;  1H8E G;  1OCZ B;  4W4L A;  1THZ A;  5CBF A;  3KYH C;  2VQF H;  3QFF A;  2ZT9 B;  3T1Y O;  4O7W A;  1KJI A;  4QWB A;  1K9M W;  2C35 B;  5EIB D;  2N74 A;  1ROP A;  3FKI A;  1AN7 A;  1YDX A;  2FLL A;  2EJ7 A;  5B1O A;  3SPG A;  2R84 A;  2COG A;  4YY3 H;  2LFS A;  1OHH G;  1JKJ B;  3UCS C;  2W6P A;  5KFL A;  5LYJ B;  3H4B A;  3G6X A;  3H4D A;  2JS3 A;  4DR2 O;  1B6S A;  1ZAU A;  4JGS A;  3TET A;  4CKB A;  4ECY A;  2COI A;  5B5E Z;  3AYH B;  3SPJ A;  4J9Z B;  4WFF A;  3R23 A;  4BY1 G;  1XL6 A;  4GX1 A;  4YR3 A;  3LP8 A;  1L8D A;  4I55 B;  3F8N A;  3QWU A;  3QO5 A;  3GLK A;  3R65 A;  3RYC B;  2YRX A;  5I5Y A;  2YU9 A;  5ITZ B;  3FB5 C;  1D2D A;  1GLV A;  4FFL A;  3D36 A;  5BMV F;  4LH7 A;  1BNC A;  4JAS A;  1Y76 B;  4EBD A;  5A9G A;  3IGA C;  4LSA A;  4DV3 B;  2JEU A;  2ZKO A;  2HGX A;  2JJ1 G;  4A3B G;  2O03 A;  5GON F;  3I5D A;  1OJH A;  4UV8 A;  4X8A A;  4NZM A;  5EDW A;  3ASO C;  3ZMS A;  2JA8 G;  5KFC A;  5F2V O;  2W57 A;  3G67 A;  3J80 W;  2UXB B;  3TQT A;  4JTD B;  4PDL A;  3W7S A;  2J9G A;  4X65 H;  5C93 A;  5EZY A;  5JH7 F;  3HKZ A;  1BHA A;  1K5Q A;  4E4E A;  2YDE A;  3GTQ A;  1R3K C;  1M56 B;  4JI8 O;  3L73 H;  3V6K A;  4FFM A;  4DR2 B;  4IIJ F;  4UCU A;  4RWU A;  1XMO H;  1N33 B;  2JEF A;  1PK8 A;  4PDB A;  1WSC A;  2CW7 A;  1IUR A;  4LF4 H;  5KT7 A;  4GKK H;  4E2L A;  4JI4 O;  1IBM B;  2H94 A;  4Q8E A;  3HKE A;  4BW9 A;  3BQ0 A;  4ZHQ F;  3AEI A;  3JZ6 A;  4MV3 A;  2N05 A;  5KFR A;  4R8U B;  3AW8 A;  3M9N B;  2W9C A;  1S97 A;  5DGB A;  3ICX A;  5FNV B;  3OR6 C;  3SYO A;  2KSD A;  5H6Q A;  3J7A K;  2GBO A;  4IYH A;  1N32 B;  4RB3 C;  2WLH A;  4Q0Y A;  4F4L A;  5B1A B;  5IY5 B;  1V55 C;  3D36 C;  1R3I C;  5K1P A;  1VEW A;  2Y69 C;  4TM5 A;  1IBL B;  1M5I A;  4PZ8 A;  3T9F A;  1EFR G;  2Q73 A;  1KYO F;  1I3Q A;  4GUN A;  1QVF U;  1OCC B;  3GDE A;  5IWA H;  1S77 D;  2P0A A;  4LFC B;  3R5X A;  1PX2 A;  4RZR A;  3U10 A;  1JX4 A;  4NR1 A;  3N40 P;  4O82 A;  2CKZ B;  1DTO A;  5KG3 A;  5IJ9 A;  1KJQ A;  1JR9 A;  2R70 A;  3T1Y B;  1S0O A;  5LP6 F;  1GM8 A;  1K83 A;  1GRJ A;  2CE4 A;  5LA6 B;  3LML A;  4ETS A;  2UU9 H;  2QA4 V;  1SRY A;  2W6I G;  2YUA A;  2HG8 A;  2A9H A;  3G8C A;  4MW8 A;  2ZIO A;  1JCH A;  3C3T A;  1GM9 A;  4ZIB A;  4HQ6 A;  3JSN A;  4WD3 A;  4PA7 A;  2E2I A;  2FK2 A;  4X66 H;  4GLW A;  4Q4C A;  4IGG A;  2EIL B;  4H37 A;  1HNZ B;  3DAA A;  2F66 C;  5DGI A;  2R9A A;  5KFB A;  3W5O A;  3B77 A;  3T4D A;  2YZN A;  5E25 A;  1K1Q A;  1SQP H;  3CX5 F;  3SYP A;  1M93 A;  4WCE V;  3L71 H;  2AZ2 A;  1I94 O;  5L1J A;  3CSX A;  1E1R G;  1URF A;  4MVU A;  2YI8 A;  2UUC H;  3GID A;  1PD3 A;  4JYY A;  1XOU A;  5CB4 B;  3KAJ A;  4CH3 A;  4NVP A;  5CA0 A;  1HP8 A;  5C8Y F;  4X62 H;  3QZ7 A;  4EKW A;  2W6N A;  4LF7 H;  1HR0 O;  4Q6G A;  4UUG A;  2QM8 A;  1N34 B;  5IJ0 B;  2R93 A;  5CA3 A;  4PEL A;  2CZG A;  2C2R A;  3WB0 A;  4X64 B;  3B2E E;  3GTO A;  1VMG A;  1SA0 B;  1S0M A;  1NI8 A;  2BOC C;  3UO3 A;  3K04 A;  1SQF A;  4ECS A;  4D7S A;  2DAA A;  4O4J F;  1GSO A;  4PA6 A;  2XUM A;  5HFM A; 
#chains in the Genus database with same CATH homology
 5LXT B;  1TA8 A;  4JI2 H;  5JQG A;  1XHZ A;  3JAS B;  3K5O A;  1XDN A;  4TV9 A;  1VF7 A;  1FJG H;  4HBN A;  4LF5 H;  3MAQ A;  2E5L B;  3JAW A;  4LR3 A;  4CS3 A;  1P8L A;  4JI5 B;  1JFF B;  4JI1 B;  1O9G A;  3J81 W;  4LNU B;  4EFE A;  4NXN H;  2VWK A;  1A0I A;  2F4V B;  4B08 A;  4TUY A;  4D7T A;  5J2T A;  4AHC A;  2PYL A;  1O9H A;  1VS0 A;  2ZNI A;  3L4K A;  4O4I B;  1XMO B;  2ZJT A;  4FLY A;  4ZHQ B;  1S03 G;  4JV5 B;  5EOY A;  4DV2 H;  3RYH B;  1Z5V A;  1SQG A;  4IIJ A;  5J2U B;  5LP6 B;  4NXN B;  5DIS C;  5CA0 B;  2UU9 B;  3NC0 B;  4I50 B;  3RYC A;  5EYP A;  2R72 A;  2PTM A;  2ZIM A;  5KHH A;  3UQ8 A;  2XIG A;  3W1G A;  1Z2P X;  2HVQ A;  4X1K A;  2ZM6 B;  1TUB B;  3BAA A;  4JI0 B;  5LMU B;  2YCH A;  5LMN H;  4B3M H;  1H2S B;  5D1P A;  4HNA A;  1TAE A;  2YIB D;  5IJ9 B;  4I9Q A;  3RGX A;  4OX9 H;  1WH2 A;  4YJ3 A;  5D5Q A;  3RJ0 A;  3RR5 A;  4DR3 B;  3TY8 A;  3ETQ A;  2V4D A;  4FFB B;  2VUG A;  3QTC A;  4FM0 A;  5GON B;  4X62 B;  5CA1 B;  4JI7 H;  4NXM B;  2EX3 A;  2QJ1 A;  4X1Y A;  4JI4 B;  3DF7 A;  2UXC H;  4KHP H;  3L2P A;  4TUY B;  1KU9 A;  4LFA B;  1CKN A;  2BTO A;  3U0Z A;  2HEP A;  1FVI A;  4FLW A;  4JYA B;  2F93 B;  4O4I A;  2HHH B;  4DUY H;  5JH7 A;  5CA1 A;  4JV5 H;  4FLV A;  1FFX B;  3JAT B;  4AQY B;  4IHJ A;  2BTQ B;  5JCO A;  4JI8 B;  2IM9 A;  4R7R A;  4DR6 B;  5KX5 A;  5JVD A;  3H20 A;  4DV7 B;  4DR5 B;  4TV8 B;  4LFB H;  4YY3 B;  3RYF A;  3E22 A;  4RAZ A;  4I55 A;  4DR4 H;  3JAK B;  4O2B A;  5CB4 A;  4CS2 A;  3VNN A;  2JGU A;  4FM1 A;  4U3J B;  2Q7G A;  4CC5 A;  5LA6 A;  3SR2 C;  4FLU A;  4K0K H;  4UCT A;  1FJG B;  3VQX A;  4FLX A;  4LSX A;  4DV5 H;  1TGO A;  2HIV A;  1ZHQ A;  1XI1 A;  4PZ6 A;  4O4J B;  1Z2N X;  2GV9 A;  1XNR B;  2HIX A;  4ZOL A;  2ZNJ A;  3ZED A;  4O4H A;  5C8Y A;  1JMK C;  5D1O B;  4JI6 B;  5KHK A;  1HNW H;  4GKJ B;  1HR0 H;  4O4J A;  1BJT A;  4X64 H;  1HR0 B;  4ZOL B;  2CAZ C;  4PI0 A;  4LF8 H;  1WN7 A;  4TQF A;  1JFF A;  4B3M B;  3N42 B;  4RAY A;  4YJ2 A;  3HKB B;  2OYQ A;  2E5L H;  5J2T B;  3OTO H;  4X65 B;  1X9N A;  5KX5 B;  4YJ3 B;  1S68 A;  4DR4 B;  4LH6 A;  4O4L A;  1D5A A;  2UXD B;  2CFM A;  1S5J A;  5LL6 b;  3FMA A;  4MV9 A;  1FKA H;  3GB8 B;  3HKB A;  4FM2 A;  1Q3E A;  3A2F A;  4ZHQ A;  1DGS A;  2UUA B;  1XMQ B;  5LP6 C;  5LYJ A;  4DV2 B;  2Q2U A;  1G6U A;  1SKV A;  1I7F A;  1XMQ H;  5A2Q W;  4EFB A;  4LF7 B;  1N33 H;  4JI6 H;  4DRX B;  4CC6 A;  4BWA A;  2HVR A;  2VQF B;  1FFX A;  5FD6 A;  3M4I A;  3HXL A;  3JAS A;  5BR8 B;  4X1K B;  3RIZ A;  4I7H A;  3NBY B;  4DV1 H;  4DR1 H;  1IBK B;  5LMN B;  2P5O A;  3KXY T;  4YHH B;  3N6X A;  4DR1 B;  3RYH A;  2MCT A;  3N2G B;  5IJ0 A;  1O75 A;  1WPB A;  1Z2O X;  4B3T H;  1MZB A;  2UXB H;  5BR8 H;  4DV4 B;  5EIB C;  1SA0 A;  1XK5 A;  2HVS A;  3KAK A;  1M4U A;  4U3J A;  3BA9 A;  1HW7 A;  3CVZ A;  4AIL C;  3HKE B;  4B3S B;  3K57 A;  5FPR A;  4WBN A;  4DK1 A;  5GON A;  4CH6 A;  3CHX A;  5EYP B;  2WDT A;  3BAB A;  4PHZ A;  2RGV A;  4JI1 H;  3ZS8 C;  3HKD B;  3JAW B;  5BMV A;  4IHJ B;  2RJZ A;  4J0M A;  5C8Y B;  5D1O A;  4DUY B;  2HHH H;  4PI2 A;  3T1H B;  3S24 A;  4KL1 A;  4ZI7 B;  4GKK B;  2FE3 A;  4UCO A;  5IT9 W;  3RYF B;  4KHP B;  2PYJ A;  2PZS A;  4RB0 A;  5JVD B;  5JJJ B;  1WNS A;  3JAL B;  2PY5 A;  4LF9 H;  4ZI7 A;  4YJ2 B;  3UT5 B;  4JI8 H;  3IG0 A;  5LOV B;  4DV6 B;  2ZIN A;  4B3S H;  1HNZ H;  4X1I B;  2HGS A;  2F95 B;  4LF5 B;  2WE6 A;  4DV0 H;  4DR3 H;  3THO A;  4DUZ H;  5KMG B;  4IAJ A;  2Q2T A;  2KSW A;  3K5L A;  4OX9 B;  3WB1 A;  2UUA H;  2QM4 A;  5FNV A;  4DV5 B;  4DV4 H;  5IYZ B;  4JI2 B;  4LFC H;  2UUB B;  1M0W A;  3K5N A;  3M7M X;  4EB6 B;  1BGW A;  2UUC B;  3N43 B;  5D5P A;  5JJE B;  1ZHS A;  1XNR H;  3T1H H;  1Z5W A;  4F6R A;  1I6U A;  1CKM A;  2BTQ A;  3BRC A;  4UFZ A;  2PUS A;  5K1X A;  1HNX H;  2VWJ A;  4LMY A;  4B3R B;  3KYH C;  5IWA B;  1Q5O A;  4TV8 A;  2VQF H;  4MTD A;  1Q8I A;  4RZQ A;  3DSQ A;  3RGB A;  1V9P A;  4DK0 A;  3N44 B;  5EIB D;  1YEW A;  3RFR A;  2YXL A;  4GKJ H;  5FPO A;  2WYO A;  1AN7 A;  1HNW B;  1N34 H;  1CKN B;  4DV0 B;  1P49 A;  2RQ6 A;  4YY3 H;  1SEI A;  4O4L B;  4TOI A;  4GYC B;  5LYJ B;  2ZM6 H;  4JI0 H;  4LF6 B;  1SYX B;  1ZAU A;  2JVD A;  4NXM H;  4PZ7 A;  4X1I A;  3VQY A;  2VOB A;  3LNN A;  3N2K A;  3BA8 A;  3IAY A;  1GYF A;  4LFA H;  1E4G T;  4IIJ B;  5LP6 A;  1L8D A;  4I55 B;  5LXT A;  5J2U A;  3QWU A;  2CW8 A;  3F8N A;  1N36 H;  2UUB H;  4LF4 B;  4LF6 H;  2OWO A;  3RYC B;  4JI3 B;  5ITZ B;  3N2K B;  3QG5 A;  3HKC A;  3SJA C;  4DR6 H;  1NT2 B;  4LH7 A;  4LF8 B;  3BHP A;  3K59 A;  2F1M A;  1HNX B;  4O2A A;  3W1B A;  3JSL A;  3UT5 A;  4LSA A;  4DV3 B;  2VQE H;  5LMU H;  3FFQ A;  1TVK A;  2O03 A;  3HKC B;  4A2A A;  2YIA A;  3U11 A;  1QHT A;  2YI9 A;  2W57 A;  4K0K B;  3J80 W;  4B3T B;  4UCR A;  2UXB B;  4WBN B;  1IBL H;  4X65 H;  4FFB A;  3RTX A;  4I50 A;  5FD5 A;  5EZY A;  4K8X A;  4DRX A;  4K8Z A;  4M7E A;  3GJX B;  4EB6 A;  5JQG B;  1T5E A;  2Q7E A;  1P16 A;  1J5E H;  4EQ5 A;  3TY5 A;  3TY9 A;  3EYY A;  4DR2 B;  3JAL A;  4UCU A;  1XMO H;  1B04 A;  1N33 B;  4RB1 A;  4LNU A;  4I4T A;  4JYA H;  4JI3 H;  4BWS C;  4PDB A;  1N36 B;  3C0F B;  2CW7 A;  4LF4 H;  3K58 A;  4GKK H;  4LF9 B;  4FLT A;  4AQY H;  3VQV A;  3JAR A;  4GLX A;  4B3R H;  1IBM B;  2VPS A;  4DV1 B;  3HKE A;  4BW9 A;  3E22 B;  4EEQ A;  2UXC B;  4JI4 H;  5KMG A;  1L2Z A;  1RSO A;  5LOV A;  1IBM H;  4YHH H;  5JCO C;  4CS4 A;  3ICX A;  4O2B B;  5FNV B;  3RWR D;  4X1Y B;  1KMI Z;  3JAR B;  4E6N A;  1Q43 A;  3MWM A;  1N32 B;  3J7A K;  3SJC C;  4RB3 C;  1E4F T;  4Q0Y A;  4DV6 H;  2RGR A;  3HKD A;  4CH5 A;  3OTF A;  4X66 B;  4L8J A;  5BMV B;  3L4J A;  5K1P A;  3NBZ B;  4DUZ B;  1J5E B;  3K3V A;  2F4V H;  4DV7 H;  4DR5 H;  5KHG A;  2ZCE A;  4A2B A;  1IBL B;  1M5I A;  4PZ8 A;  4JI5 H;  4TV9 B;  4X20 B;  3RYI A;  5IWA H;  3GDE A;  4O4H B;  4DR7 B;  4LFC B;  3U10 A;  2KKW A;  3KAL A;  3N40 P;  2JS5 A;  3SJB C;  5JJN B;  5IJ9 A;  2UXD H;  3JAK A;  3BPZ A;  4O2A B;  2R70 A;  2PGG A;  4X20 A;  3RYI B;  3T1Y B;  4CH4 A;  5LA6 B;  3LML A;  4ETS A;  1CKO A;  2UU9 H;  1IBK H;  4UCV A;  1X4T A;  4F6R B;  2VQE B;  4DV3 H;  2ZIO A;  4MV7 A;  4ZIB A;  1JJO A;  3JSN A;  1M0T A;  1XNQ B;  2E3C A;  2Q7H A;  5IYZ A;  3CB2 A;  4X66 H;  1XQ8 A;  4LFB B;  1HNZ B;  1N32 H;  2F66 C;  3K5M A;  2R9A A;  3W5O A;  4RB2 C;  3OTO B;  1XNQ H;  3JAT A;  3N41 B;  5FLX W;  4TQD A;  1M93 A;  5ITZ A;  4FM9 A;  4MTE A;  2YIB A;  4HNA B;  2P22 C;  4DR7 H;  3VQW A;  3CSX A;  2YI8 A;  3RF2 A;  2UUC H;  5CB4 B;  4I4T B;  3KAJ A;  3RGZ A;  4CH3 A;  4DR2 H;  5KHJ A;  4NVP A;  5CA0 A;  1I94 H;  2XHB A;  4JI7 B;  1TVK B;  3WB2 A;  4X62 H;  1QQC A;  4LF7 H;  1XHX A;  4Q6G A;  1N34 B;  3N2G A;  5IJ0 B;  4UCS A;  3SGI A;  3WB0 A;  4X64 B;  5KHI A;  3B2E E;  4APM A;  4DRF A;  1TUB A;  1I94 B;  1SA0 B;  5EZY B;  1SQF A;  2Q0A A;  3PN1 A;  4FVM A;  5JH7 B;  3JAM W;  4D7S A;  3T1Y H;  4FLZ A;  3QF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...