3UQ8A

Structure of adenylation domain of haemophilus influenzae dna ligases bound to nad+ in adenylated state.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
NIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVARIEDRLILLPAPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQEELTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA ligase
publication title Structure Guided Understanding of NAD(+) Recognition in Bacterial DNA Ligases.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 106
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2011-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3uq8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3uq8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3uq8A02
4CC6A 4DV1B 4DV5B 3SGIA 3QWUA 2UXBB 4YY3B 4DR5B 3BAAA 1B04A 4PZ8A 3JSLA 1N33B 2HIXA 4LH6A 4DR2B 4JI0B 4DV6B 1CKMA 5LMUB 4LFBB 4LH7A 2ZM6B 3W1BA 4EFEA 4LFCB 4DR1B 4B3MB 1XMOB 3NBYB 1XNQB 4LF4B 5D1PA 1HNZB 4E6NA 5FPOA 1HR0B 4UCUA 1ZAUA 3BA8A 2VQFB 1A0IA 4UCRA 1XNRB 3GB8B 4JI1B 4EQ5A 4DUZB 4GLXA 4UCTA 3NBZB 3S24A 1N34B 4LF7B 4DV0B 2UUAB 4JI5B 5IWAB 4X64B 1IBKB 4JI7B 4TOIA 4KHPB 4LFAB 4AQYB 1N32B 1IBLB 2VQEB 3GDEA 4YHHB 4JI2B 3RTXA 3GJXB 4DR4B 2E5LB 2Q2UA 2HHHB 4UCSA 4X62B 1N36B 3T1HB 3NC0B 1S68A 4B3SB 4UFZA 3TY8A 2HIVA 4JV5B 4LF6B 2VUGA 4UCOA 3RR5A 2UXCB 4EFBA 1V9PA 3PN1A 3W1GA 4B3TB 3W5OA 1IBMB 2UUBB 1XDNA 3BA9A 4DV7B 1X9NA 4JI8B 4K0KB 5DISC 3BABA 4JI3B 1TAEA 4EEQA 4X65B 3T1YB 1TA8A 4PZ6A 4JYAB 2UU9B 4DV3B 1FVIA 4JI6B 4DR3B 1FJGB 1VS0A 2CFMA 5D1OA 4DUYB 5D1OB 5FPRA 3L2PA 1P16A 4DR7B 5LMNB 2HVQA 1J5EB 2Q2TA 1I94B 4X66B 2UUCB 3TY9A 5BR8B 4CC5A 4OX9B 4GKKB 2UXDB 2HVRA 1HNXB 3OTOB 4NXMB 4PZ7A 1XK5A 4DRFA 2OWOA 4LF5B 1CKNA 1XMQB 4LF8B 4DR6B 1CKNB 2HVSA 4DV4B 1DGSA 4UCVA 1HNWB 3TY5A 4LF9B 4DV2B 4B3RB 4GKJB 3JSNA 1CKOA 3KYHC 3VNNA 2F4VB 4JI4B 1P8LA 4NXNB 3UQ8A
chains in the Genus database with same CATH superfamily
4CC6A 5EZYB 4X1IB 3D36C 4FLUA 4ECVA 3EHBB 5JCOC 2HHFB 2PYJA 2CUGA 2IJJA 3HKZE 1U96A 2CH7A 4BR6A 3I12A 4TQSA 1SQGA 4ZOLF 4O7WA 3RUPA 5I5YA 5CA0F 1OJHA 2LGQA 2V59A 3NBYB 4X64H 5L1JA 1NVPB 2EJ0A 4UVAA 4EGJA 4DV7H 3V4SA 1HR0B 4JI3H 2NLJC 2YRWA 5K2MA 3OHBA 4FFBB 4HNTA 3T1HH 2GTSA 3JCUZ 2IH3C 1MOFA 4O3PA 4B7EA 3PO2G 4H33A 3T5KA 1GSOA 1V55B 3IN5A 3A8TA 2R8IA 1DF4A 1E4GT 5KFYA 3GV5B 1NR7A 5I5WA 1SF9A 2EBOA 2WB1A 3DC6A 5EIBC 2DW4A 3BJYA 3LMLA 2BOCC 3CS5A 3EFFK 1EKVA 4ECUA 5C44G 1Y66A 2ZDHA 4JTDB 1RJQA 3OSPA 2CZGA 1YIJV 2R9RB 5E25A 3ASOC 4O4HF 3I5DA 2HIVA 4FIPC 3NGDA 2AGAA 2X6BA 4UXNA 2WLIB 3PZPA 5FNVB 2NU7B 1VQ6V 5IY5B 4KXRA 4DR6O 3RJ0A 1AB3A 3GV8B 1F4MA 2V9WA 1Q5OA 2ILMA 4DR7H 2ETNA 2HJDA 5KA6A 4DV7B 4NVPA 5KG3A 4JI3B 1GTOA 2KG7B 2ZXWC 2AZ0A 1Z2GA 3CSWA 4I4TA 3ABTA 4HBNA 1S5JA 3DC5A 1I2LA 4TV9B 4I5SA 4Q43A 1M0TA 2XUMA 2HKOA 2FB9A 4LF9H 4A3DG 2V4DA 5KUKA 2QKCA 5BY1A 4X66B 3JD0A 2YXLA 3HKBA 2BSKB 3VQWA 4IAJA 1U97A 1ORQC 2ZR2A 4O2BB 4YQWA 2JGDB 3HOVG 4DV5H 2GPSA 3Q8QB 5IYCO 1CKNB 3ZMSA 3CCJV 4QSHA 5JH7F 3KG2A 2ODMA 3MR6A 5IYDO 3T54A 1RJRA 3VQXA 2X6AA 2Q7EA 4AI8A 4O4IF 4E4TA 2NU8B 4NTXA 4DW0A 2Z0AA 4F4XA 3FKSG 4UVBA 3UZOA 2FLNA 3WNZA 4AQYO 3ETEA 5KX5B 2MW2B 3L71H 4LSXA 3AG7A 5D8DA 2H94A 4DV6B 3QG5A 4H44B 3NR7A 4O7NA 1FPOA 1YCIA 4RWUA 5KAIZ 2ZM6B 4RUEA 5IT9W 4D7TA 4J7KA 4JV5O 4J9NA 2WAQA 2PYLA 1K1QA 5I5VA 2RCVA 2VQEH 2VQFB 3FB6C 2R85A 5CA1F 1NBMG 2CNQA 3V6KA 2RDJA 3KHLA 2EIMC 4K0KO 2GQSA 4HNAA 4GC6A 3UO3A 1PNKA 4DK1A 4RZRA 3C90A 4R8UA 3CRCA 5FJ8G 4JV2A 2CGOA 5IT9N 3ABKB 2PMZE 2PVPA 3CSXA 5LL6Y 2FK1A 4J42A 4OX9H 2WPDG 1JMKC 1M56B 4PDMA 5LMNO 4FM2A 2FMLA 5KFRA 4C5CA 2QE7G 3MHHC 4I50A 3AG4C 5LP6F 4JI8H 3TY8A 5GTIZ 3STZC 3LSUA 2RMKB 1SZTA 3LDDA 1SYXB 2W9AA 2ZIOA 3K9AA 4DRXB 5B3SC 2B9ZA 1WLEA 4A3IG 4A3LG 3P32A 2F4VH 5KMGB 4JI4H 3R5XA 1Z2NX 1KYOF 2YRXA 1AI6A 1CPYA 3N43B 1Y4MA 2AXTZ 5GONF 3HOWG 2NU9B 1R3JC 3HPLC 4X65B 2VR1A 3OMNB 1QR9A 1BGWA 2LGWA 5KHHA 1UPGA 4JI6B 4BIUA 4DV3B 3N41B 4A2BA 1OZ0A 1SQXH 2JS5A 4MSWC 3DF7A 3TQTA 1TUBB 1XNQH 4JI0O 1Y6XA 3W7WA 3TIIA 3IFXA 4B3RH 1PKXA 1I94B 1AR1B 2DABA 5KS8A 1M5IA 2PI5A 4OX9B 1M4UA 1LNQA 4JAUA 1KJQA 1R6NA 3TW7A 5CMUA 5KFBA 4DV1H 2R92A 2YSUB 4R8CA 3LUTB 4XYLB 3MDSA 4KUMA 4IYHA 3OMIB 4YP3A 2YIAA 4QW8A 3RGXA 5KFQA 4LFAH 2DPIA 2PF4E 5LOVF 1N34O 2F4VB 4JI4B 1R6KA 2FTKA 4X62H 3A0BZ 1HNZH 1BCCH 1SESA 1B04A 3ORRA 4NKGB 2HIXA 4CS4A 3X2QC 4DR4O 1BSMA 1K7DA 2Q0AA 5KAFZ 3KREA 2ITDC 1BGYH 1ZX3A 4DL5A 3K03A 2ARHA 3EVKA 3TXQA 3GLKA 2XASA 5BYAA 1XNQB 3K0GA 1GSHA 1VQ4V 4X9QA 3T9BA 4JI7H 4QE7A 4FM0A 3V6HA 1IBLH 5C1PA 5L1KA 4JYYA 4FM9A 5BWVA 5KFSA 2WE6A 5KHGA 4DL2A 1CEZA 4AYBE 1IBKB 4LFAB 1FJGO 1H2LA 4ZI7F 3GDEA 4YHHB 5JQGF 1BHAA 3JATB 2Z3YA 1TGOA 2YZLA 4X62B 3AG2B 3K04A 4O7TA 2HR3A 4DYLA 1S72V 1SS3A 1OCRC 1DV1A 3M9NB 3CP1A 2VWJA 1SCUB 2HDKA 4Q44A 3UT5B 2HGSA 2VUGA 1XOUA 2UU9H 3OSNA 2JA7G 4P2ZA 2M6YA 4NB5A 5H5NA 2PY5A 3PN1A 3CXHF 4OXSA 1NU1H 3GIPA 1KTAA 5IJ9B 3U0ZA 1G4YB 4BWSC 4LWSA 5I47A 3K3PA 2DQ3A 1KMIZ 2P7TC 4E4EA 3OM3B 4O4LB 4NXMH 1P49A 3JAWA 2ZKOA 5LMUH 2CFMA 2P90A 3WG7B 2W9BA 3K0DA 1JX4A 4LF5H 5D1OB 1MABG 2RGVA 4X1KB 2PBZA 3R23A 4PBCA 2F23A 3F8NA 1EN5A 5A2QW 3E89A 2XTAA 4LFCO 1A3GA 5GONB 1XL6A 3H3VH 5IYZA 4YJ2F 5I60A 3UZBA 3HT5A 4BIZA 4O7YA 3CHXA 4YJ3A 4K8XA 4CKBA 2BQ3A 5J2UB 4DV4B 1B33N 1HNWB 5C4XG 1YTFB 1VBGA 3RGBA 2WLNA 4U7CA 2AHZA 3L74H 3TINA 4QIWE 4CS2A 1SRYA 2A7WA 5A2QN 2GDSA 2ZINA 1RK5A 2W6IG 3AG3B 5KFPA 3GIKA 5IYBG 5J2TA 1V51A 2VUMG 4YY3B 1GGOA 5JUMA 2ODTX 3ABUA 5JJJB 3W7XA 3FAVB 3PW0A 1ZHSA 5LMUB 4OPAA 3QFFA 1MZBA 3CVZA 3W1BA 2OIGA 4JI5H 4JXUA 1NI8A 1VARA 2W6ZA 1DLBA 4IRDA 1EN4A 1N0NA 1XUQA 3LNMB 3HKDA 2EILC 5KLVH 4I0XA 3G6XA 1R3KC 3HKZA 1H2MA 3T2MA 1I6UA 1A0IA 3FDSA 4IR1A 1Y74A 1KECA 1EFRG 1TWGA 2PZSA 3K5HA 1VMGA 1PPJH 1SFOA 3ASOB 4LF7B 1UFIA 3HKEB 3RFCA 2ATLA 4O3RA 4PDVA 4KHPB 4XZ3B 2MCTA 3CWBH 5CBGA 4AHCA 3UYYA 4WFEA 3CRMA 3RTXA 4PV1B 3B2EE 3SYCA 1I0HA 2UXCO 3APOA 4I4TF 1GO3F 2R9AA 5CR5A 5LXTA 4ASUG 2BE3A 1SQPH 3RR5A 4I55A 3Q8SB 3AW8A 4JTAB 3BHPA 3TXSA 1KC8W 3CE2A 1EKFA 3VA7A 1BHBA 3U55A 3OE7G 2ZD9A 1DF5A 1RYRA 1PX2A 5EBWC 4WF9V 1RYSA 4M7EA 4X8AA 5DG9A 3LULA 3Q8PB 4QNHB 2JA6G 3ZHQA 1F23A 3PW5A 3W7SA 2Y69B 5LYJA 4DR5O 4DUYB 2J6TA 4BY7G 1N33O 1VF6A 3OR7C 3VPCA 4DR2O 1JCHA 1THZA 5EWFA 2JJ1G 4RB0A 2IMWP 4G27B 1J5EB 1W2BU 1Z2PX 2Y0PA 3H0GG 3H4BA 4UV9A 4RNMA 3K08A 5F9NA 4O2AA 1VQ5V 2RDCA 5HNEA 3E86A 5KFWA 1IOVA 3F5WC 3K3VA 3AEIA 1JFFB 4G3IA 2HGXA 2V4QA 1YTFD 4PDLA 3P30A 3FKIA 3OR6C 3G4SV 2XAQA 4XX0B 4IYIA 1BS3A 3RB3A 4GKJB 1RP3B 2VRZA 2ZIMA 2W70A 3RB4A 2P67A 3RW0A 5KG5A 3VOTA 3PVXA 3G6YA 4WBNF 1XMOH 5CA3A 1Z5WA 3ZN1A 4XDJA 3UQ8A 4HYKA 1EZJA 5DEDA 4YBZB 3QWUA 3RWRD 3K59A 3N6XA 1N32O 4EB6A 5EZYF 3VQVA 5HV6A 2R93A 1MA1A 1K73W 4JI1H 2XAGA 1XHZA 3T1HO 2CH7B 4L8JA 3WO1A 2QF7A 4LFBB 3WU2Z 4TUYA 2LQTA 2P6JA 4XDLA 3M9OB 5JCOA 2DYSB 1QNMA 3ZBHA 3HKCB 4UCUA 1A32A 1Q6HA 2R84A 1R6TA 3ORQA 3KTMA 5DGBA 1XL4A 2FE3A 4UCTA 5C5JA 1KQSU 3CMAV 1K8AW 2WLJA 5ITZA 4NR1A 1ZSPA 2XAJA 5TISZ 2R7NA 3QQMA 3OUZA 1JA8A 1PV0A 4UVCA 4TOIA 2ALZA 3WB1A 3KALA 2IU0A 5KFXA 2E75B 4LP8A 3IAYA 4WFAV 4EYIB 1IVSA 1T5EA 5BXZA 4DR7O 1IBMH 4O3NA 2E5LB 2Q2UA 4JUZA 2UUBH 2EJ2A 4DO2A 1R1BA 1VQPV 2QWRB 1MZEA 1S68A 2RQ6A 4B3SB 4Q8FA 1FXKC 1Y1VG 1QHTA 2PMZA 3T1YH 2DWCA 4JYBA 4CH3A 1J95A 4U7OA 4MV9A 5FNVF 4JAAA 2JK5C 1YJWV 3LSQA 3ZRXA 4H0LB 4CMFA 3QO8A 4LF9O 3BA9A 1SA0A 1EKPA 5EDWA 4FFPA 1AI7A 3QF7A 3GTPA 1BQ0A 1DAAA 1TVKA 2JEJA 3E2EA 2W7PA 2QJ1A 4I4TB 1PL4A 4RQFA 2P5OA 1N48A 3GTJA 2C35B 4U3JB 2ZJTA 1P16A 4LF4H 1OBDA 2UXDO 4Z1MG 4TV9F 4FZ1A 4J9QA 5IDJA 2BTOA 2F95B 3HKBB 2JVDA 4CC5A 5K1PA 1A0GA 4DUZH 4DR1O 4J9RA 4NXNH 2YYAA 5EWEA 1G1XB 1WP7A 5DMXA 5KT4A 4O2BF 5H80A 4EG0A 4LF8B 3PR4A 1FXVA 2WWWA 1H2SB 3ETDA 4FLYA 4U6PA 3GVMA 1KJ9A 2QK4A 3JSNA 3ASNC 1VQ8V 4DV0O 4YIOA 1S0NA 1P8LA 3T99A 2A0LA 2RGRA 3MFHA 1AILA 1OCZC 4PD4F 4ZBMA 4ABMA 1HDJA 1W96A 5CE8A 3GTLA 2UXBB 1HR0H 2VQEO 3CCRV 2PUSA 1EHIA 3HB3B 4LF6H 5AG2A 5KX5F 4ETSA 2HHHO 2QTOA 1UJWB 4YR3A 2EULA 1K4DC 4MAMA 4PI0A 2QA4V 2YICA 4GX5A 4JASA 4LSAA 2X7RB 4K35A 2JEUA 4LF4B 3B09A 3SJQC 5KUMA 4FLXA 3BQ2A 1OCCC 3H1IH 1OWTA 1EUDB 4X88A 3N2KA 4DUZB 2EIJC 3CYOA 4ED2A 4MVUA 4IRKA 3F5TA 3JCZA 5EYPA 4JI8O 3GILA 4HNAB 5LP6C 3VBBA 5CB4A 4R8UB 1V54C 3PW4A 1W93A 2YS8A 5JQWA 1XILA 1EUCB 4DL3A 2V4RA 2V7QG 3LP8A 2ATKC 2ZDQA 4QJFA 2R92G 4I50B 5JVLA 3TETA 4QPKA 4PDBA 4ZHQA 4AYBA 3H01A 3R5HA 3FYIB 4O84A 2BTQA 4LF6B 2CNVA 3BFRA 3OUUA 4U3FH 1UNNC 2GLTA 4J9YB 2UXCB 4UB8Z 5DAAA 4Q4CA 1YVWA 3W5OA 1N56A 4B3RO 1WA8A 2YL2A 5B66Z 4X66H 1VQNV 4R7CA 1X9NA 3JASA 2DPJA 3ABLC 4EEQA 2WLMA 4D7SA 4DV1O 3MR5A 4JF3A 2CTQA 1URFA 5DM6V 3OTOO 2Y0SE 3KHHA 3CCEV 2VA2A 5KT5A 3E35A 1AI5A 1Y76A 4ED1A 1H8HG 1I50A 4YR0A 4UUGA 1HNZO 1XK5A 2CTWA 4FFKA 1WCMG 4OGQB 4ECWA 2O57A 2QKAA 4NZOA 4PELA 2UVRA 1EN6A 1XNRO 3BCCH 4UCVA 4DV6H 2R6FA 2KB1A 4YAKB 4CH4A 2W7OA 1KUTA 2ZM6H 1WP8A 2C00A 2W8KA 3J7AK 5BWRA 3U0GA 1HW7A 1UC8A 4JI7O 2Q0OC 2EILB 3AG1C 4JV0A 1IBLO 2VQFH 2R7ZA 1Y1WA 4WFHA 4DL4A 2JA8G 4QIWA 1N36O 2QWQB 4ECXA 1WR2A 4EGQA 4J9LA 4QWCA 4DQNA 3JAKA 3M8AA 3JD2A 4X89A 2LW1A 3CD6V 3BA8A 2YZNA 5KFEA 1AJPA 3H4DA 3RYCA 2R82A 4EQ5A 5K3WA 3LWBA 1M0WA 2HJWA 3AX6A 2B1GA 3RIZA 2ZCEA 5L3FA 4HNVA 1JJ2U 2AU0A 2GQRA 4I7ZB 2J6UA 4RCNA 2UU9O 1JQ0A 3SR2C 4JYCA 4X1YB 3GV7B 2JDIG 5KA5A 1NVPD 3ABMC 3L4JA 5KT3A 3CQZA 3C3SA 3BACA 4Q20A 2AGOA 3ETJA 1N8RW 2X6CA 1I08A 1AP6A 4L1KA 2ZDIC 5BR8O 2N05A 4RUFA 5LYJF 5LL6b 4J11A 4X65H 4NXMO 2WDTA 1S5HC 2IU3A 1TWAA 5CBFA 1GSAA 4DV3H 4JI6H 4HQ6A 4LF5O 5CBHA 1V9PA 5L1IA 4IHJA 1EZ1A 3GIMA 3K06A 4DV2O 2BOBC 3FFQA 2FPGB 3H20A 1Q81W 1I94H 4FMTA 1VQKV 3VPDA 4LWSB 2YI9A 1O9GA 5F2VO 4O4JA 3KXYT 1OCOC 3JAWB 2FMAA 3N2GA 2M7WA 4DR3B 4O4LF 2W9BB 3T9FA 2ADQB 4QWBA 4B3MH 1GK9A 3AK3A 3KAJA 4RNOA 1P7GA 3GB7C 3LSSA 2UUCB 1B6SA 3VPBA 1KU9A 5KHKA 2OT5A 4J9OA 1EZVH 1ROPA 2LFRA 3ZHTA 1IXBA 3K57A 4ECTA 3STLC 4X20A 1YF2A 4LR3A 2UXDB 1E4EA 5JJNB 5C93A 1GAXA 1N0JA 2F43G 5IYZB 2QM4A 2A1HA 1T94A 3QTCA 4JZGA 1XMQB 2HP8A 1Q43A 4YJ3B 5J2UF 2Q8VA 5F9LA 1TWFA 1JIHA 5KG7A 2ZE6A 4JI5O 3RF2A 3JALA 2DYRC 3LNNA 2IJHA 3T9AA 3E8BA 2IJIA 3H9VA 2W57A 5BMVF 1B06A 3BG5A 3S3WA 5J2TB 4D6TH 3HOUG 2KSDA 1B6QA 2W6NA 4JI2O 5BWTA 4LH6A 1M90W 4F4LA 2FP4B 3N6RA 4DLKA 4J9MA 4PHZA 1V4YA 2Q7DA 3IG0A 2QWOB 2B63G 4LH7A 3RYIA 4ECSA 5D5PA 4DXWA 1NH2B 4B3MB 2UXNA 2OCCB 5D1PA 3CB2A 1QLEC 4KP4A 4FVMA 2HJFC 1IBKH 3HKDB 5FPOA 4FLWA 4I0XB 5LHHA 4TVIA 4YHHH 3VQYA 4B3TO 3GTGA 3UM7A 1Y74B 1I5XA 1E79G 1L8DA 4PJ0Z 1VKZA 5IP9G 2EINC 4F6RA 3SJCC 2UUAB 2M05A 4RB3C 1NQTA 4WCEV 3CCQV 2W71A 3BRCA 1W59A 4EBEA 4N23A 2Y4RA 2YZMA 2XCLA 3L75H 4XDKA 3GTOA 3HBLA 1P84F 1QVGU 3TJTA 4RAYA 1K1SA 1COWG 1H2GA 5KT7A 1FYJA 3B8MA 2QTSA 2AW9A 2QWPB 3AK1A 4R50A 2XHBA 4FLTA 3Q2OA 4I55B 3MWEA 2ZE7A 5KG2A 3L72H 1S0VA 4IIJA 5FD5A 2JGDA 3ZIAG 5H2FZ 1XDNA 2JJ2G 2C2AA 3C3TA 1YITV 2ASDA 2CE4A 1CXZB 1EM1A 1NR1A 3ZHUA 2W6QA 2JIZG 2XT9A 4PA7A 5LYJB 4APMA 1JR9A 5CM0A 2COJA 3U9TA 3KHRA 2IBKA 1BE3H 1E1QG 4DV4H 1HNWH 5DGHA 5KG4A 4GYCB 3B40A 4TT3G 4O2AB 4O7SA 5J9PC 1SERA 1M57B 1FAFA 4TV8A 3OTOB 1VF5B 1OCZB 2IM9A 3QO7A 4M0JA 5IYDG 2OWOA 1GYFA 4YY3H 3FD9A 5L3GA 4DR6B 1WJZA 3N40P 2Y48A 3SJBC 1PNMA 2PTMA 5B1AB 3UCSC 5LHGA 2GUZA 5LOVA 3K5LA 2H8PC 5HFLA 3ZHVA 2YIDA 3UKMA 1VQ7V 3SGIA 5IJ0A 3T9EA 5L9XA 3T4DA 4P9PA 4EB6B 4IWYA 3BQ1A 3JSLA 4JV5H 1OCCB 1JPXA 1GM7A 1Q6UA 4LCUC 4ZOLA 1H38A 5CA0A 1RJPA 1NH2D 1YJ9V 1OCRB 5KFOA 5HFMA 1KKDA 5CB4F 4NLGA 2DWDC 5KFGA 3RBEA 4LF7H 4TUYB 4MV6A 4WFFA 5C3EG 3V6JA 4BIOA 2DN9A 1IYDA 4KHPH 4K0KH 2DLNA 4MVMA 4CS3A 4HN2A 3IC7A 1K83A 3DTGA 3GB8B 5BMVB 2WA4A 1IBMO 2HVKC 2UUBO 4RU9A 5IWAO 1A9XA 3JRXA 5KFVA 3E8HA 4GUNA 3K5MA 5EWGA 4PWQA 1GO3E 5ITZB 4IZOA 3EYYA 2NR5A 2R8KA 4K3AA 3T1YO 4JYAO 2ZNIA 2EJ7A 3OGCC 4AQYB 3UFXB 2C28A 2ZGIA 1PK8A 3I56V 1M7JA 3JD4A 4B08A 4O4HA 1S0OA 4UCSA 5IY5C 3DXRB 2CQYA 1CP9A 3OD4A 4NTYA 3TCUA 4PA4A 4GKKO 4JV5B 4HYOA 1QQCA 1SETA 3LQSA 4UCOA 5GW7A 3T7AA 4GLWA 1S9FA 5KFTA 4DUYH 4Q0YA 3JD3A 1JX9A 5KHJA 4MA0A 1MMMA 5KFUA 1FXKA 4FFLA 5KFMA 2YIBA 1J5EH 3OHAA 4MTDA 2F93B 4K0KB 1SA0B 4RO2A 1FFXA 3L73H 2VA3A 4N21A 1I2KA 1TVKB 4NXNO 3RYFA 2QSAA 3M9MB 3DTFA 1PD3A 4MVZA 3PJSK 5GTHZ 5KG6A 2LO1A 2W6PA 3W7TA 4FU0A 5LMNB 3O65A 1HNXO 4I9WA 4GKJH 2ZXWB 2Q68A 1ZQ7A 1US6A 3T5HA 3ZN0A 3JRWA 1LR1A 5JH7A 1HR0O 1N34H 1WSCA 4RB2C 2HVSA 4MVQA 5K1XA 2Y0SA 4Q45A 3KZIZ 4O4IA 2QM8A 4FFOA 2FJZA 4LFBH 4F4YA 2KSWA 3WWIA 1K34A 4CE5A 3A2FA 1O75A 2C2EA 4MW3A 4HAMA 4R6ZA 4JI0B 5IP7G 2GBOA 1FFTB 2EIKC 4Q6GA 4WFGA 2X5RA 3GWKC 3ML0A 1K5SA 2J9GA 2YWVA 2YC0A 5CA1A 1S3JA 1Y14B 4DL7A 4BBRG 4RB1A 2UVWA 1G2WA 5DG8A 2JGUA 3N2KB 3RV4A 2EX3A 2E5LH 3ZRWA 3ABKC 5LA6A 4X64O 1F7YA 1RM1C 3K79A 4DV7O 4JAVA 5EYPB 3GTQA 4G2KA 1N34B 4B3SH 1M56C 4JI3O 1QLNA 4FFMA 2WLLA 2EJRA 5LBQA 5CB4B 1L2ZA 2OCHA 4DAAA 2YEVA 1G6UA 4A5UB 1S77D 2EIMB 1DV2A 4TQRA 5LP6A 5EBLC 4DR4B 2GHYA 5EIBD 2CW8A 4QJFB 4X66O 1RFYA 5LHIA 4UFZA 1K33A 4DK0A 4ZHQB 4I50F 2KQXA 3WFVA 1Y67A 2BTQB 1OCOB 1I7LA 3L70H 4FS2A 1YXBA 5H9CA 3AG4B 4DW1A 1PP9H 1B6RA 4GX2A 3ICXA 3G6VA 5GONA 3TQ1A 4NYKA 4ED0A 2ASLA 3CRRA 4O3SA 5EOYA 1WA8B 4BXXG 1VQMV 5B3SB 4J9PA 4JPRA 3JASB 4P30A 3BABA 2BQUA 1OHHG 2LW7A 1EBOA 5CN0A 3ZCCA 1FJGB 4YXWG 4YB8B 3BY6A 2VS0A 2LFSA 2JS3A 3T5LA 4LF8H 4RUCA 1KJJA 4IGGA 4H37A 4JTCB 4YIPA 1VBHA 4WD3A 4MTGA 5JJEB 3T9CA 3JAMW 4DV6O 3JZ6A 2ASJA 2Q2TA 2XCAA 4NZNA 2NVYA 1T3NA 3RGZA 3GWOA 2ZM6O 1YZBA 1Y76B 5DGIA 4BWAA 5FLXW 1DIKA 3FAVA 3G80A 3ZMTA 4PZ7A 2Z5UA 4Z1VA 1ZUQA 2UXBH 4QPJA 1LUVA 2BQRA 5KFZA 4PDRA 1VQLV 1IOWA 5JWPA 1TUEB 3HOZG 2FK2A 2A79B 1R3LC 4IR9A 4DV5O 2XOKG 4IRCA 3JAMN 4FJCC 4ICGA 4H13B 2IA6A 2IBZH 4O86A 2LP7A 4F4ZA 1QLEB 5L3BA 5FLXN 1LUWA 2K1EA 1I1MA 1WN7A 3T9DA 2E76B 2O03A 3TEKA 1L0LH 2XGPA 2CDYA 3OEHG 5KFNA 5KFDA 5LGUA 2NU6B 4J9ZB 1GN3A 5FLMG 2DIKA 4TM5A 4LFCB 2NNUA 5I5UA 1B3QA 3JAKB 2WLHA 1JDEA 3X2QB 3H1HH 1UC9A 2P4VA 4L87A 5JVDA 3WO0A 4MVSA 1RK6A 1NTMH 3L9DA 1JOYA 1MNGA 3RYCB 4O3QA 5KFCA 1WPXA 2JA5A 3E22A 4Z2WA 4IWXA 2K9PA 3NBZB 1YDXA 2WSSG 4HR7A 3EXAA 4X65O 1BNCA 4K6NA 5IWAB 4U7NA 4ZI7A 5JQGA 4IIJF 1OV9A 3AG2C 2E2HA 3CCMV 4DV3O 4JI6O 2UXCH 4LMYA 5KFLA 3OMAB 4YR2A 1D5AA 1R73A 4C2MA 2Y0IA 1IURA 2R86A 4XBFA 1I94O 5LGTA 2WTFA 4F4WA 4I9QA 3NC0B 3PFFA 4OX9O 2QB5A 4FFRA 2W9CA 2FLLA 5DLFA 2Q4PA 1KP3A 5BWUA 2IJKA 3OTFA 3UO2A 2ZDIA 4IHJB 3B8NA 5KFIA 4K8ZA 3G6BA 3M4IA 3WG7C 4DR5H 4TV8F 4PA6A 2YS6A 1WPBA 4G28B 2F4VO 4JI4O 1FXHA 4DR2H 3SPIA 4IT5A 4O4JB 2N74A 3SYPA 2CTPA 3N2GB 2A3QA 2WLKA 1CQIB 3Q1KA 1TWCA 3CCVV 1P4RA 5DECA 2HGWA 1KC7A 5KFAA 1FKAH 4RQEA 1AJNA 1IX9A 1SQBH 1WB8A 3RVYA 5BWXA 4TWKA 1GN2A 2YCHA 4ED3A 5DGAA 1EYZA 1GM8A 2QDOA 4J80A 2EIYA 1BT8A 1K5QA 2R7LA 4YJ2A 2JA6A 3WB0A 4X20B 1XNQO 1HNXB 1E4EB 1K3EA 3N42B 3W7UA 1K97A 4PA3A 3QZ7A 4NTWA 4MT8A 4DL6A 4CH5A 1KD1W 5IYZF 4BBSG 3AG3C 3HKCA 1Q90D 3H0GA 5KFHA 4YJ3F 2HVJC 3E8FA 2C2RA 1N32H 1Q6IA 3KYHC 4JGSA 3LDEA 1VEWA 4EBCA 3RN4A 3JALB 2DOSA 3Q4HA 3H1KH 2Q5ZA 1RSOA 3CJHA 2A06H 1IBKO 1M9NA 3HO8A 1SQFA 4LFAO 4FGRA 2DQ0A 4DR5B 4YHHO 3MD0A 4GX1A 1N33B 3VMMA 2SCUB 5J2TF 4DR2B 5C8YA 2R70A 2XAHA 1JLLB 3EPIA 3G67A 4X62O 1TWHA 1ENVA 1F4NA 1XHXA 1XREA 4ZKIA 4A3CG 3RYIB 4GC7A 2X0SA 3EPGA 5D5QA 4E6NA 2V1DA 1XI1A 1C30A 2E2IA 4J41A 3GTKA 2IW5A 3M7MX 4UCRA 1DTOA 3CPWU 3T4ZA 1JXLA 4LNUA 3L4KA 2I87A 4F50A 4ECRA 1AR5A 3N8DA 1H8EG 4F6RB 2R8JA 3WB2A 3K5NA 2DMXA 2ABJA 1QR8A 3OGIB 4X64B 1S03G 4UV8A 4NZMA 1NKDA 3J81W 5LGNA 1N32B 1NTKH 3N44B 3GJXB 1K9MW 5H6RA 3ZS8C 5BPFA 2BCCH 2R8GA 3T1HB 4EEYA 4U3JA 5I5TA 4O7RA 1SQVH 1NJIW 1CE8A 4CMDA 3SPJA 2JEIA 4DR3H 3E8GA 5LXTF 3JZFA 4BW5A 3B77A 3W1GA 1S0MA 4IIJB 3SYQA 3J81N 4DV4O 4I55F 1HNWO 3A0RA 1F51A 2Y69C 4MS2A 2FPIB 2XC9A 2YU9A 2UUCH 3VOUA 4QW9A 3SYAA 3ZHRA 1Y1VA 1AJQA 3RYHA 1S5LZ 1GN4A 3APQA 2UXDH 2COGA 2R8HA 5L3CA 5FD6A 3R5FA 3GTMA 2Z02A 4FLVA 3OUFA 2ADPA 2ZNJA 4YY3O 1BL8A 3QVNA 2YS7A 1XMQH 2OH2A 2Y4UA 3CC2V 4DR1H 3L2PA 3OFNG 3SYOA 3D8CA 1JJOA 4DR7B 2QKSA 2HVQA 3C0FB 1W0JG 3JD1A 1NZ6A 1ZL8A 1KT8A 5KG1A 5LMUO 1X4TA 2NVXA 1KJ8A 4R7RA 1KB9F 4RZQA 2N04A 5HBRB 2CGNA 2WAMA 4RAIA 4TV8B 4O2AF 2CTRA 3PO3G 2D3OW 4DRFA 4P9OA 4DV0H 1GN6A 2ZQMA 4FK5C 3JARA 2CAZC 2IP4A 2EIKB 4LF9B 1OBGA 2Q7GA 4QE9A 1CKOA 4C5BA 4WBNA 1AROP 2OYQA 2YUAA 2GUZB 5LOVB 3HOYG 1VQ9V 4LF7O 2JEFA 1RPOA 1SQQH 1BQZA 2HHHH 5BYBA 3BEHA 5EZYA 4DV5B 1I1LA 2V5AA 4X1IA 1S76D 2HFEC 4KHPO 4ZQIA 1WH2A 5IE9A 1QBZA 5IJ0B 4OPHA 5LA6F 3BAAA 2R87A 2DYSC 2HEPA 5EC1C 2HG8A 2HHFA 5L3DA 3N27A 3FB5C 4UUJC 3MJFA 4JV1A 4ZOLB 5CA0B 5IYBO 2RF4A 1WB7A 1RM1B 2QEXV 1CKMA 3T1CA 1Z5VA 1GM9A 2EJ3A 5CAEB 3DAAA 2UUAH 3B4SA 4DR1B 4MV8A 1S97A 3ZX6A 4FFNA 1SC5B 4BY1G 4TUYF 5FL7G 5DN6G 5KFFA 2FKXA 4ED6A 3OT7A 4FE2A 1L0NH 2Q67A 4FFBA 4AILC 1JVMA 1AVMA 3MFIA 2P4KA 1SZXA 3CEBA 4DV0B 4NYEA 3U11A 1AP5A 3SI8A 3CC7V 1VIBA 1BMFG 4DUYO 2VPSA 4CKCA 2VQEB 4MVOA 5B1OA 3PW2A 3OEEG 3ZMUA 2HHHB 1J5EO 4O4HB 2W6MA 3FMAA 4EYHB 2IH1C 1M6VA 5B1BC 2AHYA 1ULZA 3ZMVA 1SKVA 2WLIA 5B5EZ 5FNVA 1MSWD 2UXXA 4EFBA 5BWWA 2R72A 2VQDA 2GTAA 4O82A 3MWMA 2UVUA 3THOA 2LJ2A 1FXKB 3MHSC 3D3QA 1Q86W 4GKJO 4MV7A 2QR4A 1L1FA 1R3IC 4JI8B 3TIGA 3WWJA 2YXHA 1KJIA 1TAEA 1FFXB 5EK0A 2KG7A 2W6JG 3OTOH 4TQFA 1I7FA 3RYFB 1PL0A 3SPCA 2H3OA 4O7VA 1FVIA 2Q69A 3GQCA 4TV9A 2VPQA 4DR6H 2P22C 1JDBB 4A3BG 4KL1A 4GZRB 4FM1A 2YW2A 3FKIG 2CNUA 2L35A 4UB6Z 5LXTB 4GT1A 2XGQA 3FB8C 3ZMZA 2BSKA 2UVVA 4LFBO 4QWAA 3TY9A 1VAJA 1XNRH 4O2BA 3MR3A 5EC2C 3O9OA 5JH7B 2YI8A 1CKNA 3K5IA 3H40A 1C3OA 1GLVA 4ME6A 3DGEA 2R93G 2P06A 4B3RB 1GMGA 1WNSA 4O4IB 3T5JA 4Y8VB 1QCEA 4ED8A 4ED7A 2D2CB 4B7KA 5JVDF 4HZ3A 1D2DA 1WCMA 3KAKA 1N36H 4DV1B 3GIJA 3F7VC 4PA9A 3NUAA 5I5SA 5KX5A 1XQ8A 2FYUH 3ASNB 4PZ8A 5IYCG 1E4FT 4MTEA 2E5LO 1XMOO 3K3WA 4X1YA 4GX0A 1WAZA 4PI2A 2DAAA 4B3SO 1MZFA 4A3KG 1KUQA 4EFEA 2X0LA 2FPPB 4JI1O 4TQDA 1IXMA 3E5NA 1HNZB 5CA1B 4AQYH 3KHGA 3CXCU 4A3FG 2WB1E 1XNRB 3QNEA 5KT2A 2AZ2A 3ZRWB 5LA6B 2FKLA 3TGUH 3SPHA 3K5OA 1G8MA 4I7HA 2Q9LA 1Z2OX 1AUXA 3U10A 1GH6A 5BZBA 2WLLB 1E1RG 1HP8A 2RDIA 2EIJB 4JI7B 3AYHB 3HB9A 3GIDA 2YEVB 5BR8H 1IBLB 4CKEA 2R9IA 5I5XA 3CC4V 5L1LA 2WYOA 4A3JG 5LP6B 3G6EV 2YDEA 1N36B 2EZPA 1V54B 1O9HA 1V55C 4YAJB 2JRIA 4A3GG 4DV2H 3SPGA 3IJ4A 4DRXA 3P3PA 4W4KA 4ZHQF 3A0HZ 3RBDA 1ZWIC 5KMGA 2QYZA 5H6QA 4LF8O 2YIBD 1H2KA 4MV4A 4ECZA 3MAQA 5LMNH 4KFMA 1WRVA 2A9HA 1I3QA 4JZ2A 4MTFA 1IDSA 1YEWA 1YSCA 5DISC 5KHIA 1TA8A 5L3EA 2C2DA 3J7AU 4FPPA 2UU9B 1VS0A 2UXBO 2XCPA 5FPRA 1TUBA 1S10A 3ABLB 1GKFA 1VP7A 3ZEDA 4MVRA 3RT3C 3CCUV 4J9SA 5BR8B 4BAYA 3CMEV 4NXMB 2JA5G 2QGNA 4LF4O 1IYEA 4QWEA 2PN1A 5C8YF 1AN7A 4LF5B 2Y4TA 2AGQA 4JI0H 2EZOA 4DUZO 4DV2B 2JEXA 2Q6AA 1NT2B 3VNNA 4JI2H 3R9RA 3RB6A 2JEGA 3AK2A 4O3OA 3R66A 4QWDA 4O7ZA 5BPHA 3OW2U 4MV3A 2WAQE 1MG1A 3J80W 4A3MG 4C7UA 3K9SA 2YZGA 4MW8A 3RVZA 3IC9A 3AG1B 2C22A 1M1KW 1R9TA 4QIWF 4LBEC 4B3TH 1P7BA 3PR5B 2F66C 4LF6O 3CCSV 1K4CC 2HG5C 3K58A 3FX7A 2XNDG 1AI4A 4J9KA 4GCZA 3TK1A 1Q82W 4J10A 5KT6A 5JVDB 2OIEA 4DR4H 2XAFA 4GLXA 3CEIA 3E22B 2B63A 3J80N 3OAAG 2HLDG 4J7JA 2J6SA 3FB7C 2GPWA 5FR9A 1RPRA 3GIQA 4JI5B 1JKJB 2CW7A 4FBUA 1Q3EA 4F6EA 4ZI7B 5JQGB 3QO5A 3FYEB 3HR0A 2G38A 2QWNB 2Z04A 3BPZA 2DE0X 3JATA 4JI2B 1CS0A 2W6OA 2XD4A 1YHQV 2OTLV 3I55V 1YI2V 1AUVA 1SEIA 2KKWA 1NTZH 4QGPA 4BW9A 3M99B 3KKYA 1I1KA 3ABMB 2B5UA 3UT5A 1W0KG 1BXRA 3TW6A 5DG7A 2W9CB 2DJVA 1FS0G 2FB5A 1FJGH 3RV3A 1FKAO 4B3TB 2CKZB 1N4CA 3ZHSA 3D3IA 5IJ9A 5KFJA 2GV9A 4IHJF 4CHIA 3SJAC 4CBCA 2E74B 2COIA 3JYCA 2AQ4A 2V58A 1ET0A 4O4LA 2GSMB 3BVOA 3I4NG 2DWEC 4PZ6A 3HXLA 2VWKA 5D1OA 4O4JF 3RAQA 2BR0A 4X1KA 5C1OA 2WA3A 3RAXA 3OUSA 3G71V 5DLGA 1A48A 1XBLA 4XYMB 2PI4A 4YJ2B 5DQGA 3PW7A 2ITCC 5EBMC 3DTUB 1PNLA 2ZDGA 1X59A 4ECYA 1GRJA 3D36A 3WWHA 2E3CA 5J2UA 1NS1A 5T14A 3V4ZA 4A2AA 4FZ0A 2R7ZG 4HNUA 1VF7A 2B1IA 1Y1WG 2JA7A 4EBDA 2ZE8A 3ZRVA 3SNOA 3CRQA 1M93A 1QVFU 3ETGA 4ZIBA 5BMVA 2ZR3A 3NXSA 4LFCH 3QZ8A 4A93G 4MTXA 3Q4HB 1RSOB 3CJHB 1D5NA 5B1NA 4C5AA 5E79Z 2I80A 3DSQA 3H1JH 2OCCC 5KG0A 4MV1A 4MTOA 3G8CA 2ZE5A 5C8YB 2DYRB 3ETHA 3RFRA 3S3XA 1ZLZA 4E2LA 3SE7A 2Q7HA 2R7MA 4ECQA 4FBTA 2VQFO 1I5YA 3I4MG 1XMOB 4O83A 5KFKA 5IWAH 3DXRA 2P0AA 1ZAUA 4MA5A 4J7ZA 5KKNB 2R7KA 3SDLA 1K92A 4JI1B 4O7LA 3U9SA 4JYAH 4CZZA 2I8CA 2NN4A 4LNUB 4WFBV 1ZTEA 4RNNA 2RN9A 3JZIA 4WHXA 3S24A 2DZDA 3HKEA 5B1BB 1ZETA 2FLPA 3F7YC 2ZT9B 4DR3O 2FL4A 1ZHQA 4RAZA 2EINB 1DK1A 2L6LA 4GKKH 4DIMA 1AR4A 2Q73A 2QM7A 2XIGA 1YJNV 4FS1A 1XDCA 3RBZA 3ZRSA 2UUCO 3U54A 2VUMA 1VQOV 2CK3G 2VOBA 4J0MA 4Q8EA 1QU7A 1CQJB 4A3EG 4FLZA 3CX5F 3CRAA 1XMQO 5A9GA 3E83A 2OTJV 1IBMB 5DQIA 2W0XA 2UUBB 4Q4DA 1IZ3A 3R65A 1KKCA 1KP2A 3KCXA 1KBHA 1VF6C 2YXYA 3RYHB 3G8DA 3MWDA 2W8LA 3T1YB 1H2NA 1BJTA 1HNXH 1KEEA 4JYAB 3BQ0A 1BZKA 2OLSA 3P3NA 3GIIA 4IL6Z 1Q8IA 1KBLA 3MR2A 2RJZA 1M57C 4TSFG 2W0FC 4CH6A 1MSDA 3ETQA 4O81A 1ZL8B 1I7NA 1T36A 4RUAA 1Q7YW 4EKWA 5E1AC 3RB0A 4B3MO 3ZJZA 5B1AC 3H1LH 4GKKB 2HVRA 1JFFA 3HOXG 4W4LA 4LC1A 5DQHA 4M9UA 1N33H 1DGSA 3JARB 2FK3A 3TY5A 3KCYA 2NUAB 3Q8RB 1PM9A 2MK3A 1FD9A 1HWYA 4WBNB 3IGAC 2RNBA 3CCLV 2UUAO 2PGGA 1XEQA 2AGPA 4NXNB 3LDCA 2F1MA
chains in the Genus database with same CATH topology
4CC6A 5EZYA 4DV5B 5EZYB 4X1IA 3SGIA 5IJ0A 3QWUA 4X1IB 3RWRD 5IJ0B 3K59A 4FLUA 4EB6A 3N6XA 4EB6B 3BAAA 2HEPA 3VQVA 3JSLA 5JCOC 4JV5H 2PYJA 4JI1H 4ZOLA 4ZOLB 5CA0A 1XHZA 5CA0B 4L8JA 1CKMA 1Z5VA 1SQGA 4LFBB 4TUYA 4LF7H 4TUYB 2UUAH 4DR1B 5JCOA 3NBYB 4X64H 3HKCB 4DV7H 4KHPH 1HR0B 4K0KH 4UCUA 4CS3A 4JI3H 3GB8B 5BMVB 4FFBA 4FFBB 2FE3A 4UCTA 4AILC 3T1HH 3K5MA 5ITZA 5ITZB 4DV0B 3EYYA 3U11A 1E4GT 2ZNIA 4TOIA 3WB1A 5EIBC 3KALA 4AQYB 3IAYA 2VPSA 2VQEB 3LMLA 1T5EA 1IBMH 2E5LB 2Q2UA 2UUBH 4B08A 4O4HA 2HHHB 4UCSA 4O4HB 3FMAA 1S68A 2RQ6A 4B3SB 2HIVA 4JV5B 1QHTA 1SKVA 3T1YH 1QQCA 5FNVA 4UCOA 5FNVB 4EFBA 4DUYH 3RJ0A 4CH3A 4MV9A 4Q0YA 2R72A 5KHJA 1Q5OA 3MWMA 4DR7H 3THOA 2YIBA 1J5EH 3BA9A 4MTDA 4DV7B 4MV7A 1SA0A 2F93B 4NVPA 1SA0B 4JI8B 4K0KB 3QF7A 1FFXA 4JI3B 1TAEA 1FFXB 1TVKA 1TVKB 3OTOH 4TQFA 3RYFA 1I7FA 3RYFB 4I4TA 2QJ1A 4HBNA 4I4TB 1S5JA 1FVIA 2P5OA 4TV9A 4TV9B 4DR6H 2P22C 4U3JB 1M0TA 2ZJTA 1P16A 4LF4H 4KL1A 5LMNB 4FM1A 4LF9H 4GKJH 2V4DA 5LXTB 4X66B 2BTOA 2F95B 2YXLA 3HKBA 3HKBB 3TY9A 2JVDA 3VQWA 4CC5A 5K1PA 4IAJA 1XNRH 4O2BA 4DUZH 4O2BB 4NXNH 4DV5H 5JH7A 5JH7B 2YI8A 1CKNA 1N34H 4LF8B 1CKNB 4RB2C 1H2SB 5K1XA 4FLYA 2HVSA 4B3RB 3JSNA 4O4IA 1WNSA 4O4IB 3VQXA 4LFBH 2Q7EA 2KSWA 1P8LA 2RGRA 1N36H 3KAKA 4DV1B 3A2FA 2UXBB 1O75A 1HR0H 5KX5A 5KX5B 2PUSA 1XQ8A 4LSXA 4PZ8A 4LF6H 4JI0B 1E4FT 4MTEA 4DV6B 3QG5A 4ETSA 4X1YA 4Q6GA 4PI0A 4PI2A 2ZM6B 4LSAA 5IT9W 4EFEA 4D7TA 2PYLA 4LF4B 4TQDA 1HNZB 5CA1A 5CA1B 4AQYH 4FLXA 2VQEH 2VQFB 4RB1A 1XNRB 3N2KA 4DUZB 2JGUA 3N2KB 2E5LH 2EX3A 5LA6A 5LA6B 5EYPA 5EYPB 4HNAA 1N34B 4B3SH 4HNAB 3K5OA 5LP6C 4I7HA 1Z2OX 3U10A 4DK1A 5CB4A 5CB4B 2HHHH 1L2ZA 4JI7B 1G6UA 3CSXA 5BR8H 1IBLB 4OX9H 5LP6A 2WYOA 1JMKC 5LP6B 4DR4B 5EIBD 4FM2A 2CW8A 1N36B 4I50A 4I50B 4JI8H 1O9HA 4UFZA 4ZHQA 4DK0A 3TY8A 4PDBA 4ZHQB 2BTQA 4LF6B 1SYXB 4DV2H 2BTQB 4DRXA 2ZIOA 4DRXB 2UXCB 5KMGA 2F4VH 5KMGB 4JI4H 2YIBD 1Z2NX 3ICXA 3W5OA 5GONA 3MAQA 5LMNH 3N43B 5EOYA 4X66H 1X9NA 3JASA 1YEWA 3JASB 5DISC 3BABA 4EEQA 4X65B 5KHIA 1TA8A 1BGWA 4D7SA 2UU9B 5KHHA 4DV3B 4JI6B 1FJGB 1VS0A 3N41B 4A2BA 5FPRA 2JS5A 3DF7A 1TUBA 4LF8H 1TUBB 1XNQH 5JJEB 3JAMW 4B3RH 3ZEDA 2Q2TA 1I94B 3RGZA 1M5IA 5BR8B 4OX9B 1M4UA 4BWAA 5FLXW 4NXMB 4PZ7A 1XK5A 4DV1H 1AN7A 2UXBH 4LF5B 4JI0H 2YIAA 4UCVA 3RGXA 4DV6H 4DV2B 4LFAH 3VNNA 1NT2B 4CH4A 2F4VB 2ZM6H 4JI4B 4JI2H 3J7AK 4X62H 1HW7A 1HNZH 1WN7A 1B04A 2VQFH 3J80W 2HIXA 2O03A 4CS4A 2Q0AA 3UQ8A 4B3TH 4LFCB 3JAKA 2F66C 3JAKB 1XNQB 3K58A 4JI7H 4FM0A 1IBLH 5JVDA 3BA8A 5JVDB 3RYCA 4FM9A 4EQ5A 3RYCB 4DR4H 3E22A 4GLXA 3E22B 1M0WA 3NBZB 3RIZA 2ZCEA 2WE6A 4JI5B 5KHGA 2CW7A 5IWAB 1Q3EA 4ZI7A 5JQGA 4ZI7B 5JQGB 1IBKB 3SR2C 4LFAB 2UXCH 4X1YB 4LMYA 3GDEA 4YHHB 3BPZA 3L4JA 1D5AA 3JATA 4JI2B 3JATB 1TGOA 4X62B 1SEIA 2KKWA 4I9QA 3NC0B 4BW9A 5LL6b 2VWJA 3UT5A 4X65H 2WDTA 3UT5B 2HGSA 2VUGA 2UU9H 3OTFA 4DV3H 4JI6H 1FJGH 1V9PA 2PY5A 3PN1A 4IHJA 4B3TB 4IHJB 5IJ9A 4K8ZA 2GV9A 3FFQA 5IJ9B 3H20A 3M4IA 3U0ZA 4DR5H 3SJAC 1I94H 4BWSC 1WPBA 2YI9A 4DR2H 1O9GA 1KMIZ 4O4LA 4O4JA 4NXMH 4O4LB 4O4JB 4PZ6A 3KXYT 1P49A 3JAWA 3HXLA 2VWKA 3JAWB 3N2GA 2CFMA 4DR3B 5LMUH 3N2GB 5D1OA 4LF5H 5D1OB 4X1KA 2RGVA 4B3MH 4X1KB 1FKAH 3KAJA 3F8NA 2UUCB 2YCHA 5A2QW 1KU9A 5KHKA 3K57A 4YJ2A 4X20A 3WB0A 4LR3A 4YJ2B 4X20B 2UXDB 1HNXB 5JJNB 5GONB 3N42B 5IYZA 5IYZB 2QM4A 3CHXA 3QTCA 2E3CA 4YJ3A 5J2UA 1XMQB 4K8XA 4YJ3B 1Q43A 5J2UB 4A2AA 4CH5A 4DV4B 3HKCA 1HNWB 1VF7A 3RGBA 1N32H 3KYHC 1M93A 4ZIBA 4CS2A 5BMVA 3RF2A 3JALA 4LFCH 3LNNA 3JALB 2ZINA 1RSOA 2W57A 1SQFA 5J2TA 5J2TB 4YY3B 4DR5B 3DSQA 1N33B 5JJJB 4LH6A 4DR2B 5C8YA 2R70A 5C8YB 3RFRA 4PHZA 1XHXA 1ZHSA 2Q7HA 5LMUB 3IG0A 1MZBA 3CVZA 4LH7A 3RYIA 5D5PA 3RYIB 3W1BA 4JI5H 4B3MB 1XMOB 5IWAH 5D5QA 5D1PA 3CB2A 3HKDA 4FVMA 1XI1A 4E6NA 3HKDB 5FPOA 1IBKH 4FLWA 1ZAUA 1I6UA 4YHHH 3VQYA 1A0IA 3M7MX 4UCRA 4JI1B 4JYAH 4LNUA 1L8DA 4LNUB 3L4KA 2PZSA 3S24A 4F6RA 4LF7B 3HKEA 3SJCC 3WB2A 4F6RB 3HKEB 3K5NA 2UUAB 4RB3C 1S03G 4X64B 3BRCA 4KHPB 2MCTA 3J81W 1N32B 1ZHQA 4RAZA 4AHCA 4GKKH 3N44B 3RTXA 3GJXB 3B2EE 2XIGA 3ZS8C 3T1HB 4RAYA 4U3JA 2VOBA 2R9AA 4J0MA 5LXTA 2XHBA 4I55A 4FLTA 3RR5A 4DR3H 4I55B 4FLZA 3BHPA 5FD5A 4IIJA 3W1GA 4IIJB 1IBMB 2UUBB 1XDNA 2UUCH 4M7EA 3RYHA 3RYHB 2UXDH 3T1YB 1BJTA 1HNXH 4JYAB 5FD6A 5LYJA 4FLVA 2ZNJA 5LYJB 4APMA 4DUYB 1Q8IA 1XMQH 2RJZA 4DR1H 3L2PA 1JJOA 4DR7B 3C0FB 2HVQA 4RB0A 4DV4H 1HNWH 4CH6A 1J5EB 1Z2PX 3ETQA 1X4TA 4GYCB 4O2AA 4R7RA 4O2AB 4RZQA 4GKKB 2HVRA 4TV8A 1JFFA 3OTOB 3K3VA 4TV8B 1JFFB 2IM9A 4DRFA 2OWOA 1GYFA 4YY3H 4DV0H 4DR6B 3N40P 3SJBC 1N33H 3JARA 2CAZC 2PTMA 1DGSA 3JARB 3TY5A 4LF9B 4GKJB 2Q7GA 2ZIMA 1CKOA 4WBNA 5LOVA 4WBNB 2OYQA 1WH2A 5LOVB 3K5LA 2PGGA 1XMOH 4NXNB 1Z5WA 2F1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC6 A;  4DV1 B;  4DV5 B;  3SGI A;  3QWU A;  2UXB B;  4YY3 B;  4DR5 B;  3BAA A;  1B04 A;  4PZ8 A;  3JSL A;  1N33 B;  2HIX A;  4LH6 A;  4DR2 B;  4JI0 B;  4DV6 B;  1CKM A;  5LMU B;  4LFB B;  4LH7 A;  2ZM6 B;  3W1B A;  4EFE A;  4LFC B;  4DR1 B;  4B3M B;  1XMO B;  3NBY B;  1XNQ B;  4LF4 B;  5D1P A;  1HNZ B;  4E6N A;  5FPO A;  1HR0 B;  4UCU A;  1ZAU A;  3BA8 A;  2VQF B;  1A0I A;  4UCR A;  1XNR B;  3GB8 B;  4JI1 B;  4EQ5 A;  4DUZ B;  4GLX A;  4UCT A;  3NBZ B;  3S24 A;  1N34 B;  4LF7 B;  4DV0 B;  2UUA B;  4JI5 B;  5IWA B;  4X64 B;  1IBK B;  4JI7 B;  4TOI A;  4KHP B;  4LFA B;  4AQY B;  1N32 B;  1IBL B;  2VQE B;  3GDE A;  4YHH B;  4JI2 B;  3RTX A;  3GJX B;  4DR4 B;  2E5L B;  2Q2U A;  2HHH B;  4UCS A;  4X62 B;  1N36 B;  3T1H B;  3NC0 B;  1S68 A;  4B3S B;  4UFZ A;  3TY8 A;  2HIV A;  4JV5 B;  4LF6 B;  2VUG A;  4UCO A;  3RR5 A;  2UXC B;  4EFB A;  1V9P A;  3PN1 A;  3W1G A;  4B3T B;  3W5O A;  1IBM B;  2UUB B;  1XDN A;  3BA9 A;  4DV7 B;  1X9N A;  4JI8 B;  4K0K B;  5DIS C;  3BAB A;  4JI3 B;  1TAE A;  4EEQ A;  4X65 B;  3T1Y B;  1TA8 A;  4PZ6 A;  4JYA B;  2UU9 B;  4DV3 B;  1FVI A;  4JI6 B;  4DR3 B;  1FJG B;  1VS0 A;  2CFM A;  5D1O A;  4DUY B;  5D1O B;  5FPR A;  3L2P A;  1P16 A;  4DR7 B;  5LMN B;  2HVQ A;  1J5E B;  2Q2T A;  1I94 B;  4X66 B;  2UUC B;  3TY9 A;  5BR8 B;  4CC5 A;  4OX9 B;  4GKK B;  2UXD B;  2HVR A;  1HNX B;  3OTO B;  4NXM B;  4PZ7 A;  1XK5 A;  4DRF A;  2OWO A;  4LF5 B;  1CKN A;  1XMQ B;  4LF8 B;  4DR6 B;  1CKN B;  2HVS A;  4DV4 B;  1DGS A;  4UCV A;  1HNW B;  3TY5 A;  4LF9 B;  4DV2 B;  4B3R B;  4GKJ B;  3JSN A;  1CKO A;  3KYH C;  3VNN A;  2F4V B;  4JI4 B;  1P8L A;  4NXN B;  3UQ8 A; 
#chains in the Genus database with same CATH topology
 4CC6 A;  5EZY B;  4X1I B;  3D36 C;  4FLU A;  4ECV A;  3EHB B;  5JCO C;  2HHF B;  2PYJ A;  2CUG A;  2IJJ A;  3HKZ E;  1U96 A;  2CH7 A;  4BR6 A;  3I12 A;  4TQS A;  1SQG A;  4ZOL F;  4O7W A;  3RUP A;  5I5Y A;  5CA0 F;  1OJH A;  2LGQ A;  2V59 A;  3NBY B;  4X64 H;  5L1J A;  1NVP B;  2EJ0 A;  4UVA A;  4EGJ A;  4DV7 H;  3V4S A;  1HR0 B;  4JI3 H;  2NLJ C;  2YRW A;  5K2M A;  3OHB A;  4FFB B;  4HNT A;  3T1H H;  2GTS A;  3JCU Z;  2IH3 C;  1MOF A;  4O3P A;  4B7E A;  3PO2 G;  4H33 A;  3T5K A;  1GSO A;  1V55 B;  3IN5 A;  3A8T A;  2R8I A;  1DF4 A;  1E4G T;  5KFY A;  3GV5 B;  1NR7 A;  5I5W A;  1SF9 A;  2EBO A;  2WB1 A;  3DC6 A;  5EIB C;  2DW4 A;  3BJY A;  3LML A;  2BOC C;  3CS5 A;  3EFF K;  1EKV A;  4ECU A;  5C44 G;  1Y66 A;  2ZDH A;  4JTD B;  1RJQ A;  3OSP A;  2CZG A;  1YIJ V;  2R9R B;  5E25 A;  3ASO C;  4O4H F;  3I5D A;  2HIV A;  4FIP C;  3NGD A;  2AGA A;  2X6B A;  4UXN A;  2WLI B;  3PZP A;  5FNV B;  2NU7 B;  1VQ6 V;  5IY5 B;  4KXR A;  4DR6 O;  3RJ0 A;  1AB3 A;  3GV8 B;  1F4M A;  2V9W A;  1Q5O A;  2ILM A;  4DR7 H;  2ETN A;  2HJD A;  5KA6 A;  4DV7 B;  4NVP A;  5KG3 A;  4JI3 B;  1GTO A;  2KG7 B;  2ZXW C;  2AZ0 A;  1Z2G A;  3CSW A;  4I4T A;  3ABT A;  4HBN A;  1S5J A;  3DC5 A;  1I2L A;  4TV9 B;  4I5S A;  4Q43 A;  1M0T A;  2XUM A;  2HKO A;  2FB9 A;  4LF9 H;  4A3D G;  2V4D A;  5KUK A;  2QKC A;  5BY1 A;  4X66 B;  3JD0 A;  2YXL A;  3HKB A;  2BSK B;  3VQW A;  4IAJ A;  1U97 A;  1ORQ C;  2ZR2 A;  4O2B B;  4YQW A;  2JGD B;  3HOV G;  4DV5 H;  2GPS A;  3Q8Q B;  5IYC O;  1CKN B;  3ZMS A;  3CCJ V;  4QSH A;  5JH7 F;  3KG2 A;  2ODM A;  3MR6 A;  5IYD O;  3T54 A;  1RJR A;  3VQX A;  2X6A A;  2Q7E A;  4AI8 A;  4O4I F;  4E4T A;  2NU8 B;  4NTX A;  4DW0 A;  2Z0A A;  4F4X A;  3FKS G;  4UVB A;  3UZO A;  2FLN A;  3WNZ A;  4AQY O;  3ETE A;  5KX5 B;  2MW2 B;  3L71 H;  4LSX A;  3AG7 A;  5D8D A;  2H94 A;  4DV6 B;  3QG5 A;  4H44 B;  3NR7 A;  4O7N A;  1FPO A;  1YCI A;  4RWU A;  5KAI Z;  2ZM6 B;  4RUE A;  5IT9 W;  4D7T A;  4J7K A;  4JV5 O;  4J9N A;  2WAQ A;  2PYL A;  1K1Q A;  5I5V A;  2RCV A;  2VQE H;  2VQF B;  3FB6 C;  2R85 A;  5CA1 F;  1NBM G;  2CNQ A;  3V6K A;  2RDJ A;  3KHL A;  2EIM C;  4K0K O;  2GQS A;  4HNA A;  4GC6 A;  3UO3 A;  1PNK A;  4DK1 A;  4RZR A;  3C90 A;  4R8U A;  3CRC A;  5FJ8 G;  4JV2 A;  2CGO A;  5IT9 N;  3ABK B;  2PMZ E;  2PVP A;  3CSX A;  5LL6 Y;  2FK1 A;  4J42 A;  4OX9 H;  2WPD G;  1JMK C;  1M56 B;  4PDM A;  5LMN O;  4FM2 A;  2FML A;  5KFR A;  4C5C A;  2QE7 G;  3MHH C;  4I50 A;  3AG4 C;  5LP6 F;  4JI8 H;  3TY8 A;  5GTI Z;  3STZ C;  3LSU A;  2RMK B;  1SZT A;  3LDD A;  1SYX B;  2W9A A;  2ZIO A;  3K9A A;  4DRX B;  5B3S C;  2B9Z A;  1WLE A;  4A3I G;  4A3L G;  3P32 A;  2F4V H;  5KMG B;  4JI4 H;  3R5X A;  1Z2N X;  1KYO F;  2YRX A;  1AI6 A;  1CPY A;  3N43 B;  1Y4M A;  2AXT Z;  5GON F;  3HOW G;  2NU9 B;  1R3J C;  3HPL C;  4X65 B;  2VR1 A;  3OMN B;  1QR9 A;  1BGW A;  2LGW A;  5KHH A;  1UPG A;  4JI6 B;  4BIU A;  4DV3 B;  3N41 B;  4A2B A;  1OZ0 A;  1SQX H;  2JS5 A;  4MSW C;  3DF7 A;  3TQT A;  1TUB B;  1XNQ H;  4JI0 O;  1Y6X A;  3W7W A;  3TII A;  3IFX A;  4B3R H;  1PKX A;  1I94 B;  1AR1 B;  2DAB A;  5KS8 A;  1M5I A;  2PI5 A;  4OX9 B;  1M4U A;  1LNQ A;  4JAU A;  1KJQ A;  1R6N A;  3TW7 A;  5CMU A;  5KFB A;  4DV1 H;  2R92 A;  2YSU B;  4R8C A;  3LUT B;  4XYL B;  3MDS A;  4KUM A;  4IYH A;  3OMI B;  4YP3 A;  2YIA A;  4QW8 A;  3RGX A;  5KFQ A;  4LFA H;  2DPI A;  2PF4 E;  5LOV F;  1N34 O;  2F4V B;  4JI4 B;  1R6K A;  2FTK A;  4X62 H;  3A0B Z;  1HNZ H;  1BCC H;  1SES A;  1B04 A;  3ORR A;  4NKG B;  2HIX A;  4CS4 A;  3X2Q C;  4DR4 O;  1BSM A;  1K7D A;  2Q0A A;  5KAF Z;  3KRE A;  2ITD C;  1BGY H;  1ZX3 A;  4DL5 A;  3K03 A;  2ARH A;  3EVK A;  3TXQ A;  3GLK A;  2XAS A;  5BYA A;  1XNQ B;  3K0G A;  1GSH A;  1VQ4 V;  4X9Q A;  3T9B A;  4JI7 H;  4QE7 A;  4FM0 A;  3V6H A;  1IBL H;  5C1P A;  5L1K A;  4JYY A;  4FM9 A;  5BWV A;  5KFS A;  2WE6 A;  5KHG A;  4DL2 A;  1CEZ A;  4AYB E;  1IBK B;  4LFA B;  1FJG O;  1H2L A;  4ZI7 F;  3GDE A;  4YHH B;  5JQG F;  1BHA A;  3JAT B;  2Z3Y A;  1TGO A;  2YZL A;  4X62 B;  3AG2 B;  3K04 A;  4O7T A;  2HR3 A;  4DYL A;  1S72 V;  1SS3 A;  1OCR C;  1DV1 A;  3M9N B;  3CP1 A;  2VWJ A;  1SCU B;  2HDK A;  4Q44 A;  3UT5 B;  2HGS A;  2VUG A;  1XOU A;  2UU9 H;  3OSN A;  2JA7 G;  4P2Z A;  2M6Y A;  4NB5 A;  5H5N A;  2PY5 A;  3PN1 A;  3CXH F;  4OXS A;  1NU1 H;  3GIP A;  1KTA A;  5IJ9 B;  3U0Z A;  1G4Y B;  4BWS C;  4LWS A;  5I47 A;  3K3P A;  2DQ3 A;  1KMI Z;  2P7T C;  4E4E A;  3OM3 B;  4O4L B;  4NXM H;  1P49 A;  3JAW A;  2ZKO A;  5LMU H;  2CFM A;  2P90 A;  3WG7 B;  2W9B A;  3K0D A;  1JX4 A;  4LF5 H;  5D1O B;  1MAB G;  2RGV A;  4X1K B;  2PBZ A;  3R23 A;  4PBC A;  2F23 A;  3F8N A;  1EN5 A;  5A2Q W;  3E89 A;  2XTA A;  4LFC O;  1A3G A;  5GON B;  1XL6 A;  3H3V H;  5IYZ A;  4YJ2 F;  5I60 A;  3UZB A;  3HT5 A;  4BIZ A;  4O7Y A;  3CHX A;  4YJ3 A;  4K8X A;  4CKB A;  2BQ3 A;  5J2U B;  4DV4 B;  1B33 N;  1HNW B;  5C4X G;  1YTF B;  1VBG A;  3RGB A;  2WLN A;  4U7C A;  2AHZ A;  3L74 H;  3TIN A;  4QIW E;  4CS2 A;  1SRY A;  2A7W A;  5A2Q N;  2GDS A;  2ZIN A;  1RK5 A;  2W6I G;  3AG3 B;  5KFP A;  3GIK A;  5IYB G;  5J2T A;  1V51 A;  2VUM G;  4YY3 B;  1GGO A;  5JUM A;  2ODT X;  3ABU A;  5JJJ B;  3W7X A;  3FAV B;  3PW0 A;  1ZHS A;  5LMU B;  4OPA A;  3QFF A;  1MZB A;  3CVZ A;  3W1B A;  2OIG A;  4JI5 H;  4JXU A;  1NI8 A;  1VAR A;  2W6Z A;  1DLB A;  4IRD A;  1EN4 A;  1N0N A;  1XUQ A;  3LNM B;  3HKD A;  2EIL C;  5KLV H;  4I0X A;  3G6X A;  1R3K C;  3HKZ A;  1H2M A;  3T2M A;  1I6U A;  1A0I A;  3FDS A;  4IR1 A;  1Y74 A;  1KEC A;  1EFR G;  1TWG A;  2PZS A;  3K5H A;  1VMG A;  1PPJ H;  1SFO A;  3ASO B;  4LF7 B;  1UFI A;  3HKE B;  3RFC A;  2ATL A;  4O3R A;  4PDV A;  4KHP B;  4XZ3 B;  2MCT A;  3CWB H;  5CBG A;  4AHC A;  3UYY A;  4WFE A;  3CRM A;  3RTX A;  4PV1 B;  3B2E E;  3SYC A;  1I0H A;  2UXC O;  3APO A;  4I4T F;  1GO3 F;  2R9A A;  5CR5 A;  5LXT A;  4ASU G;  2BE3 A;  1SQP H;  3RR5 A;  4I55 A;  3Q8S B;  3AW8 A;  4JTA B;  3BHP A;  3TXS A;  1KC8 W;  3CE2 A;  1EKF A;  3VA7 A;  1BHB A;  3U55 A;  3OE7 G;  2ZD9 A;  1DF5 A;  1RYR A;  1PX2 A;  5EBW C;  4WF9 V;  1RYS A;  4M7E A;  4X8A A;  5DG9 A;  3LUL A;  3Q8P B;  4QNH B;  2JA6 G;  3ZHQ A;  1F23 A;  3PW5 A;  3W7S A;  2Y69 B;  5LYJ A;  4DR5 O;  4DUY B;  2J6T A;  4BY7 G;  1N33 O;  1VF6 A;  3OR7 C;  3VPC A;  4DR2 O;  1JCH A;  1THZ A;  5EWF A;  2JJ1 G;  4RB0 A;  2IMW P;  4G27 B;  1J5E B;  1W2B U;  1Z2P X;  2Y0P A;  3H0G G;  3H4B A;  4UV9 A;  4RNM A;  3K08 A;  5F9N A;  4O2A A;  1VQ5 V;  2RDC A;  5HNE A;  3E86 A;  5KFW A;  1IOV A;  3F5W C;  3K3V A;  3AEI A;  1JFF B;  4G3I A;  2HGX A;  2V4Q A;  1YTF D;  4PDL A;  3P30 A;  3FKI A;  3OR6 C;  3G4S V;  2XAQ A;  4XX0 B;  4IYI A;  1BS3 A;  3RB3 A;  4GKJ B;  1RP3 B;  2VRZ A;  2ZIM A;  2W70 A;  3RB4 A;  2P67 A;  3RW0 A;  5KG5 A;  3VOT A;  3PVX A;  3G6Y A;  4WBN F;  1XMO H;  5CA3 A;  1Z5W A;  3ZN1 A;  4XDJ A;  3UQ8 A;  4HYK A;  1EZJ A;  5DED A;  4YBZ B;  3QWU A;  3RWR D;  3K59 A;  3N6X A;  1N32 O;  4EB6 A;  5EZY F;  3VQV A;  5HV6 A;  2R93 A;  1MA1 A;  1K73 W;  4JI1 H;  2XAG A;  1XHZ A;  3T1H O;  2CH7 B;  4L8J A;  3WO1 A;  2QF7 A;  4LFB B;  3WU2 Z;  4TUY A;  2LQT A;  2P6J A;  4XDL A;  3M9O B;  5JCO A;  2DYS B;  1QNM A;  3ZBH A;  3HKC B;  4UCU A;  1A32 A;  1Q6H A;  2R84 A;  1R6T A;  3ORQ A;  3KTM A;  5DGB A;  1XL4 A;  2FE3 A;  4UCT A;  5C5J A;  1KQS U;  3CMA V;  1K8A W;  2WLJ A;  5ITZ A;  4NR1 A;  1ZSP A;  2XAJ A;  5TIS Z;  2R7N A;  3QQM A;  3OUZ A;  1JA8 A;  1PV0 A;  4UVC A;  4TOI A;  2ALZ A;  3WB1 A;  3KAL A;  2IU0 A;  5KFX A;  2E75 B;  4LP8 A;  3IAY A;  4WFA V;  4EYI B;  1IVS A;  1T5E A;  5BXZ A;  4DR7 O;  1IBM H;  4O3N A;  2E5L B;  2Q2U A;  4JUZ A;  2UUB H;  2EJ2 A;  4DO2 A;  1R1B A;  1VQP V;  2QWR B;  1MZE A;  1S68 A;  2RQ6 A;  4B3S B;  4Q8F A;  1FXK C;  1Y1V G;  1QHT A;  2PMZ A;  3T1Y H;  2DWC A;  4JYB A;  4CH3 A;  1J95 A;  4U7O A;  4MV9 A;  5FNV F;  4JAA A;  2JK5 C;  1YJW V;  3LSQ A;  3ZRX A;  4H0L B;  4CMF A;  3QO8 A;  4LF9 O;  3BA9 A;  1SA0 A;  1EKP A;  5EDW A;  4FFP A;  1AI7 A;  3QF7 A;  3GTP A;  1BQ0 A;  1DAA A;  1TVK A;  2JEJ A;  3E2E A;  2W7P A;  2QJ1 A;  4I4T B;  1PL4 A;  4RQF A;  2P5O A;  1N48 A;  3GTJ A;  2C35 B;  4U3J B;  2ZJT A;  1P16 A;  4LF4 H;  1OBD A;  2UXD O;  4Z1M G;  4TV9 F;  4FZ1 A;  4J9Q A;  5IDJ A;  2BTO A;  2F95 B;  3HKB B;  2JVD A;  4CC5 A;  5K1P A;  1A0G A;  4DUZ H;  4DR1 O;  4J9R A;  4NXN H;  2YYA A;  5EWE A;  1G1X B;  1WP7 A;  5DMX A;  5KT4 A;  4O2B F;  5H80 A;  4EG0 A;  4LF8 B;  3PR4 A;  1FXV A;  2WWW A;  1H2S B;  3ETD A;  4FLY A;  4U6P A;  3GVM A;  1KJ9 A;  2QK4 A;  3JSN A;  3ASN C;  1VQ8 V;  4DV0 O;  4YIO A;  1S0N A;  1P8L A;  3T99 A;  2A0L A;  2RGR A;  3MFH A;  1AIL A;  1OCZ C;  4PD4 F;  4ZBM A;  4ABM A;  1HDJ A;  1W96 A;  5CE8 A;  3GTL A;  2UXB B;  1HR0 H;  2VQE O;  3CCR V;  2PUS A;  1EHI A;  3HB3 B;  4LF6 H;  5AG2 A;  5KX5 F;  4ETS A;  2HHH O;  2QTO A;  1UJW B;  4YR3 A;  2EUL A;  1K4D C;  4MAM A;  4PI0 A;  2QA4 V;  2YIC A;  4GX5 A;  4JAS A;  4LSA A;  2X7R B;  4K35 A;  2JEU A;  4LF4 B;  3B09 A;  3SJQ C;  5KUM A;  4FLX A;  3BQ2 A;  1OCC C;  3H1I H;  1OWT A;  1EUD B;  4X88 A;  3N2K A;  4DUZ B;  2EIJ C;  3CYO A;  4ED2 A;  4MVU A;  4IRK A;  3F5T A;  3JCZ A;  5EYP A;  4JI8 O;  3GIL A;  4HNA B;  5LP6 C;  3VBB A;  5CB4 A;  4R8U B;  1V54 C;  3PW4 A;  1W93 A;  2YS8 A;  5JQW A;  1XIL A;  1EUC B;  4DL3 A;  2V4R A;  2V7Q G;  3LP8 A;  2ATK C;  2ZDQ A;  4QJF A;  2R92 G;  4I50 B;  5JVL A;  3TET A;  4QPK A;  4PDB A;  4ZHQ A;  4AYB A;  3H01 A;  3R5H A;  3FYI B;  4O84 A;  2BTQ A;  4LF6 B;  2CNV A;  3BFR A;  3OUU A;  4U3F H;  1UNN C;  2GLT A;  4J9Y B;  2UXC B;  4UB8 Z;  5DAA A;  4Q4C A;  1YVW A;  3W5O A;  1N56 A;  4B3R O;  1WA8 A;  2YL2 A;  5B66 Z;  4X66 H;  1VQN V;  4R7C A;  1X9N A;  3JAS A;  2DPJ A;  3ABL C;  4EEQ A;  2WLM A;  4D7S A;  4DV1 O;  3MR5 A;  4JF3 A;  2CTQ A;  1URF A;  5DM6 V;  3OTO O;  2Y0S E;  3KHH A;  3CCE V;  2VA2 A;  5KT5 A;  3E35 A;  1AI5 A;  1Y76 A;  4ED1 A;  1H8H G;  1I50 A;  4YR0 A;  4UUG A;  1HNZ O;  1XK5 A;  2CTW A;  4FFK A;  1WCM G;  4OGQ B;  4ECW A;  2O57 A;  2QKA A;  4NZO A;  4PEL A;  2UVR A;  1EN6 A;  1XNR O;  3BCC H;  4UCV A;  4DV6 H;  2R6F A;  2KB1 A;  4YAK B;  4CH4 A;  2W7O A;  1KUT A;  2ZM6 H;  1WP8 A;  2C00 A;  2W8K A;  3J7A K;  5BWR A;  3U0G A;  1HW7 A;  1UC8 A;  4JI7 O;  2Q0O C;  2EIL B;  3AG1 C;  4JV0 A;  1IBL O;  2VQF H;  2R7Z A;  1Y1W A;  4WFH A;  4DL4 A;  2JA8 G;  4QIW A;  1N36 O;  2QWQ B;  4ECX A;  1WR2 A;  4EGQ A;  4J9L A;  4QWC A;  4DQN A;  3JAK A;  3M8A A;  3JD2 A;  4X89 A;  2LW1 A;  3CD6 V;  3BA8 A;  2YZN A;  5KFE A;  1AJP A;  3H4D A;  3RYC A;  2R82 A;  4EQ5 A;  5K3W A;  3LWB A;  1M0W A;  2HJW A;  3AX6 A;  2B1G A;  3RIZ A;  2ZCE A;  5L3F A;  4HNV A;  1JJ2 U;  2AU0 A;  2GQR A;  4I7Z B;  2J6U A;  4RCN A;  2UU9 O;  1JQ0 A;  3SR2 C;  4JYC A;  4X1Y B;  3GV7 B;  2JDI G;  5KA5 A;  1NVP D;  3ABM C;  3L4J A;  5KT3 A;  3CQZ A;  3C3S A;  3BAC A;  4Q20 A;  2AGO A;  3ETJ A;  1N8R W;  2X6C A;  1I08 A;  1AP6 A;  4L1K A;  2ZDI C;  5BR8 O;  2N05 A;  4RUF A;  5LYJ F;  5LL6 b;  4J11 A;  4X65 H;  4NXM O;  2WDT A;  1S5H C;  2IU3 A;  1TWA A;  5CBF A;  1GSA A;  4DV3 H;  4JI6 H;  4HQ6 A;  4LF5 O;  5CBH A;  1V9P A;  5L1I A;  4IHJ A;  1EZ1 A;  3GIM A;  3K06 A;  4DV2 O;  2BOB C;  3FFQ A;  2FPG B;  3H20 A;  1Q81 W;  1I94 H;  4FMT A;  1VQK V;  3VPD A;  4LWS B;  2YI9 A;  1O9G A;  5F2V O;  4O4J A;  3KXY T;  1OCO C;  3JAW B;  2FMA A;  3N2G A;  2M7W A;  4DR3 B;  4O4L F;  2W9B B;  3T9F A;  2ADQ B;  4QWB A;  4B3M H;  1GK9 A;  3AK3 A;  3KAJ A;  4RNO A;  1P7G A;  3GB7 C;  3LSS A;  2UUC B;  1B6S A;  3VPB A;  1KU9 A;  5KHK A;  2OT5 A;  4J9O A;  1EZV H;  1ROP A;  2LFR A;  3ZHT A;  1IXB A;  3K57 A;  4ECT A;  3STL C;  4X20 A;  1YF2 A;  4LR3 A;  2UXD B;  1E4E A;  5JJN B;  5C93 A;  1GAX A;  1N0J A;  2F43 G;  5IYZ B;  2QM4 A;  2A1H A;  1T94 A;  3QTC A;  4JZG A;  1XMQ B;  2HP8 A;  1Q43 A;  4YJ3 B;  5J2U F;  2Q8V A;  5F9L A;  1TWF A;  1JIH A;  5KG7 A;  2ZE6 A;  4JI5 O;  3RF2 A;  3JAL A;  2DYR C;  3LNN A;  2IJH A;  3T9A A;  3E8B A;  2IJI A;  3H9V A;  2W57 A;  5BMV F;  1B06 A;  3BG5 A;  3S3W A;  5J2T B;  4D6T H;  3HOU G;  2KSD A;  1B6Q A;  2W6N A;  4JI2 O;  5BWT A;  4LH6 A;  1M90 W;  4F4L A;  2FP4 B;  3N6R A;  4DLK A;  4J9M A;  4PHZ A;  1V4Y A;  2Q7D A;  3IG0 A;  2QWO B;  2B63 G;  4LH7 A;  3RYI A;  4ECS A;  5D5P A;  4DXW A;  1NH2 B;  4B3M B;  2UXN A;  2OCC B;  5D1P A;  3CB2 A;  1QLE C;  4KP4 A;  4FVM A;  2HJF C;  1IBK H;  3HKD B;  5FPO A;  4FLW A;  4I0X B;  5LHH A;  4TVI A;  4YHH H;  3VQY A;  4B3T O;  3GTG A;  3UM7 A;  1Y74 B;  1I5X A;  1E79 G;  1L8D A;  4PJ0 Z;  1VKZ A;  5IP9 G;  2EIN C;  4F6R A;  3SJC C;  2UUA B;  2M05 A;  4RB3 C;  1NQT A;  4WCE V;  3CCQ V;  2W71 A;  3BRC A;  1W59 A;  4EBE A;  4N23 A;  2Y4R A;  2YZM A;  2XCL A;  3L75 H;  4XDK A;  3GTO A;  3HBL A;  1P84 F;  1QVG U;  3TJT A;  4RAY A;  1K1S A;  1COW G;  1H2G A;  5KT7 A;  1FYJ A;  3B8M A;  2QTS A;  2AW9 A;  2QWP B;  3AK1 A;  4R50 A;  2XHB A;  4FLT A;  3Q2O A;  4I55 B;  3MWE A;  2ZE7 A;  5KG2 A;  3L72 H;  1S0V A;  4IIJ A;  5FD5 A;  2JGD A;  3ZIA G;  5H2F Z;  1XDN A;  2JJ2 G;  2C2A A;  3C3T A;  1YIT V;  2ASD A;  2CE4 A;  1CXZ B;  1EM1 A;  1NR1 A;  3ZHU A;  2W6Q A;  2JIZ G;  2XT9 A;  4PA7 A;  5LYJ B;  4APM A;  1JR9 A;  5CM0 A;  2COJ A;  3U9T A;  3KHR A;  2IBK A;  1BE3 H;  1E1Q G;  4DV4 H;  1HNW H;  5DGH A;  5KG4 A;  4GYC B;  3B40 A;  4TT3 G;  4O2A B;  4O7S A;  5J9P C;  1SER A;  1M57 B;  1FAF A;  4TV8 A;  3OTO B;  1VF5 B;  1OCZ B;  2IM9 A;  3QO7 A;  4M0J A;  5IYD G;  2OWO A;  1GYF A;  4YY3 H;  3FD9 A;  5L3G A;  4DR6 B;  1WJZ A;  3N40 P;  2Y48 A;  3SJB C;  1PNM A;  2PTM A;  5B1A B;  3UCS C;  5LHG A;  2GUZ A;  5LOV A;  3K5L A;  2H8P C;  5HFL A;  3ZHV A;  2YID A;  3UKM A;  1VQ7 V;  3SGI A;  5IJ0 A;  3T9E A;  5L9X A;  3T4D A;  4P9P A;  4EB6 B;  4IWY A;  3BQ1 A;  3JSL A;  4JV5 H;  1OCC B;  1JPX A;  1GM7 A;  1Q6U A;  4LCU C;  4ZOL A;  1H38 A;  5CA0 A;  1RJP A;  1NH2 D;  1YJ9 V;  1OCR B;  5KFO A;  5HFM A;  1KKD A;  5CB4 F;  4NLG A;  2DWD C;  5KFG A;  3RBE A;  4LF7 H;  4TUY B;  4MV6 A;  4WFF A;  5C3E G;  3V6J A;  4BIO A;  2DN9 A;  1IYD A;  4KHP H;  4K0K H;  2DLN A;  4MVM A;  4CS3 A;  4HN2 A;  3IC7 A;  1K83 A;  3DTG A;  3GB8 B;  5BMV B;  2WA4 A;  1IBM O;  2HVK C;  2UUB O;  4RU9 A;  5IWA O;  1A9X A;  3JRX A;  5KFV A;  3E8H A;  4GUN A;  3K5M A;  5EWG A;  4PWQ A;  1GO3 E;  5ITZ B;  4IZO A;  3EYY A;  2NR5 A;  2R8K A;  4K3A A;  3T1Y O;  4JYA O;  2ZNI A;  2EJ7 A;  3OGC C;  4AQY B;  3UFX B;  2C28 A;  2ZGI A;  1PK8 A;  3I56 V;  1M7J A;  3JD4 A;  4B08 A;  4O4H A;  1S0O A;  4UCS A;  5IY5 C;  3DXR B;  2CQY A;  1CP9 A;  3OD4 A;  4NTY A;  3TCU A;  4PA4 A;  4GKK O;  4JV5 B;  4HYO A;  1QQC A;  1SET A;  3LQS A;  4UCO A;  5GW7 A;  3T7A A;  4GLW A;  1S9F A;  5KFT A;  4DUY H;  4Q0Y A;  3JD3 A;  1JX9 A;  5KHJ A;  4MA0 A;  1MMM A;  5KFU A;  1FXK A;  4FFL A;  5KFM A;  2YIB A;  1J5E H;  3OHA A;  4MTD A;  2F93 B;  4K0K B;  1SA0 B;  4RO2 A;  1FFX A;  3L73 H;  2VA3 A;  4N21 A;  1I2K A;  1TVK B;  4NXN O;  3RYF A;  2QSA A;  3M9M B;  3DTF A;  1PD3 A;  4MVZ A;  3PJS K;  5GTH Z;  5KG6 A;  2LO1 A;  2W6P A;  3W7T A;  4FU0 A;  5LMN B;  3O65 A;  1HNX O;  4I9W A;  4GKJ H;  2ZXW B;  2Q68 A;  1ZQ7 A;  1US6 A;  3T5H A;  3ZN0 A;  3JRW A;  1LR1 A;  5JH7 A;  1HR0 O;  1N34 H;  1WSC A;  4RB2 C;  2HVS A;  4MVQ A;  5K1X A;  2Y0S A;  4Q45 A;  3KZI Z;  4O4I A;  2QM8 A;  4FFO A;  2FJZ A;  4LFB H;  4F4Y A;  2KSW A;  3WWI A;  1K34 A;  4CE5 A;  3A2F A;  1O75 A;  2C2E A;  4MW3 A;  4HAM A;  4R6Z A;  4JI0 B;  5IP7 G;  2GBO A;  1FFT B;  2EIK C;  4Q6G A;  4WFG A;  2X5R A;  3GWK C;  3ML0 A;  1K5S A;  2J9G A;  2YWV A;  2YC0 A;  5CA1 A;  1S3J A;  1Y14 B;  4DL7 A;  4BBR G;  4RB1 A;  2UVW A;  1G2W A;  5DG8 A;  2JGU A;  3N2K B;  3RV4 A;  2EX3 A;  2E5L H;  3ZRW A;  3ABK C;  5LA6 A;  4X64 O;  1F7Y A;  1RM1 C;  3K79 A;  4DV7 O;  4JAV A;  5EYP B;  3GTQ A;  4G2K A;  1N34 B;  4B3S H;  1M56 C;  4JI3 O;  1QLN A;  4FFM A;  2WLL A;  2EJR A;  5LBQ A;  5CB4 B;  1L2Z A;  2OCH A;  4DAA A;  2YEV A;  1G6U A;  4A5U B;  1S77 D;  2EIM B;  1DV2 A;  4TQR A;  5LP6 A;  5EBL C;  4DR4 B;  2GHY A;  5EIB D;  2CW8 A;  4QJF B;  4X66 O;  1RFY A;  5LHI A;  4UFZ A;  1K33 A;  4DK0 A;  4ZHQ B;  4I50 F;  2KQX A;  3WFV A;  1Y67 A;  2BTQ B;  1OCO B;  1I7L A;  3L70 H;  4FS2 A;  1YXB A;  5H9C A;  3AG4 B;  4DW1 A;  1PP9 H;  1B6R A;  4GX2 A;  3ICX A;  3G6V A;  5GON A;  3TQ1 A;  4NYK A;  4ED0 A;  2ASL A;  3CRR A;  4O3S A;  5EOY A;  1WA8 B;  4BXX G;  1VQM V;  5B3S B;  4J9P A;  4JPR A;  3JAS B;  4P30 A;  3BAB A;  2BQU A;  1OHH G;  2LW7 A;  1EBO A;  5CN0 A;  3ZCC A;  1FJG B;  4YXW G;  4YB8 B;  3BY6 A;  2VS0 A;  2LFS A;  2JS3 A;  3T5L A;  4LF8 H;  4RUC A;  1KJJ A;  4IGG A;  4H37 A;  4JTC B;  4YIP A;  1VBH A;  4WD3 A;  4MTG A;  5JJE B;  3T9C A;  3JAM W;  4DV6 O;  3JZ6 A;  2ASJ A;  2Q2T A;  2XCA A;  4NZN A;  2NVY A;  1T3N A;  3RGZ A;  3GWO A;  2ZM6 O;  1YZB A;  1Y76 B;  5DGI A;  4BWA A;  5FLX W;  1DIK A;  3FAV A;  3G80 A;  3ZMT A;  4PZ7 A;  2Z5U A;  4Z1V A;  1ZUQ A;  2UXB H;  4QPJ A;  1LUV A;  2BQR A;  5KFZ A;  4PDR A;  1VQL V;  1IOW A;  5JWP A;  1TUE B;  3HOZ G;  2FK2 A;  2A79 B;  1R3L C;  4IR9 A;  4DV5 O;  2XOK G;  4IRC A;  3JAM N;  4FJC C;  4ICG A;  4H13 B;  2IA6 A;  2IBZ H;  4O86 A;  2LP7 A;  4F4Z A;  1QLE B;  5L3B A;  5FLX N;  1LUW A;  2K1E A;  1I1M A;  1WN7 A;  3T9D A;  2E76 B;  2O03 A;  3TEK A;  1L0L H;  2XGP A;  2CDY A;  3OEH G;  5KFN A;  5KFD A;  5LGU A;  2NU6 B;  4J9Z B;  1GN3 A;  5FLM G;  2DIK A;  4TM5 A;  4LFC B;  2NNU A;  5I5U A;  1B3Q A;  3JAK B;  2WLH A;  1JDE A;  3X2Q B;  3H1H H;  1UC9 A;  2P4V A;  4L87 A;  5JVD A;  3WO0 A;  4MVS A;  1RK6 A;  1NTM H;  3L9D A;  1JOY A;  1MNG A;  3RYC B;  4O3Q A;  5KFC A;  1WPX A;  2JA5 A;  3E22 A;  4Z2W A;  4IWX A;  2K9P A;  3NBZ B;  1YDX A;  2WSS G;  4HR7 A;  3EXA A;  4X65 O;  1BNC A;  4K6N A;  5IWA B;  4U7N A;  4ZI7 A;  5JQG A;  4IIJ F;  1OV9 A;  3AG2 C;  2E2H A;  3CCM V;  4DV3 O;  4JI6 O;  2UXC H;  4LMY A;  5KFL A;  3OMA B;  4YR2 A;  1D5A A;  1R73 A;  4C2M A;  2Y0I A;  1IUR A;  2R86 A;  4XBF A;  1I94 O;  5LGT A;  2WTF A;  4F4W A;  4I9Q A;  3NC0 B;  3PFF A;  4OX9 O;  2QB5 A;  4FFR A;  2W9C A;  2FLL A;  5DLF A;  2Q4P A;  1KP3 A;  5BWU A;  2IJK A;  3OTF A;  3UO2 A;  2ZDI A;  4IHJ B;  3B8N A;  5KFI A;  4K8Z A;  3G6B A;  3M4I A;  3WG7 C;  4DR5 H;  4TV8 F;  4PA6 A;  2YS6 A;  1WPB A;  4G28 B;  2F4V O;  4JI4 O;  1FXH A;  4DR2 H;  3SPI A;  4IT5 A;  4O4J B;  2N74 A;  3SYP A;  2CTP A;  3N2G B;  2A3Q A;  2WLK A;  1CQI B;  3Q1K A;  1TWC A;  3CCV V;  1P4R A;  5DEC A;  2HGW A;  1KC7 A;  5KFA A;  1FKA H;  4RQE A;  1AJN A;  1IX9 A;  1SQB H;  1WB8 A;  3RVY A;  5BWX A;  4TWK A;  1GN2 A;  2YCH A;  4ED3 A;  5DGA A;  1EYZ A;  1GM8 A;  2QDO A;  4J80 A;  2EIY A;  1BT8 A;  1K5Q A;  2R7L A;  4YJ2 A;  2JA6 A;  3WB0 A;  4X20 B;  1XNQ O;  1HNX B;  1E4E B;  1K3E A;  3N42 B;  3W7U A;  1K97 A;  4PA3 A;  3QZ7 A;  4NTW A;  4MT8 A;  4DL6 A;  4CH5 A;  1KD1 W;  5IYZ F;  4BBS G;  3AG3 C;  3HKC A;  1Q90 D;  3H0G A;  5KFH A;  4YJ3 F;  2HVJ C;  3E8F A;  2C2R A;  1N32 H;  1Q6I A;  3KYH C;  4JGS A;  3LDE A;  1VEW A;  4EBC A;  3RN4 A;  3JAL B;  2DOS A;  3Q4H A;  3H1K H;  2Q5Z A;  1RSO A;  3CJH A;  2A06 H;  1IBK O;  1M9N A;  3HO8 A;  1SQF A;  4LFA O;  4FGR A;  2DQ0 A;  4DR5 B;  4YHH O;  3MD0 A;  4GX1 A;  1N33 B;  3VMM A;  2SCU B;  5J2T F;  4DR2 B;  5C8Y A;  2R70 A;  2XAH A;  1JLL B;  3EPI A;  3G67 A;  4X62 O;  1TWH A;  1ENV A;  1F4N A;  1XHX A;  1XRE A;  4ZKI A;  4A3C G;  3RYI B;  4GC7 A;  2X0S A;  3EPG A;  5D5Q A;  4E6N A;  2V1D A;  1XI1 A;  1C30 A;  2E2I A;  4J41 A;  3GTK A;  2IW5 A;  3M7M X;  4UCR A;  1DTO A;  3CPW U;  3T4Z A;  1JXL A;  4LNU A;  3L4K A;  2I87 A;  4F50 A;  4ECR A;  1AR5 A;  3N8D A;  1H8E G;  4F6R B;  2R8J A;  3WB2 A;  3K5N A;  2DMX A;  2ABJ A;  1QR8 A;  3OGI B;  4X64 B;  1S03 G;  4UV8 A;  4NZM A;  1NKD A;  3J81 W;  5LGN A;  1N32 B;  1NTK H;  3N44 B;  3GJX B;  1K9M W;  5H6R A;  3ZS8 C;  5BPF A;  2BCC H;  2R8G A;  3T1H B;  4EEY A;  4U3J A;  5I5T A;  4O7R A;  1SQV H;  1NJI W;  1CE8 A;  4CMD A;  3SPJ A;  2JEI A;  4DR3 H;  3E8G A;  5LXT F;  3JZF A;  4BW5 A;  3B77 A;  3W1G A;  1S0M A;  4IIJ B;  3SYQ A;  3J81 N;  4DV4 O;  4I55 F;  1HNW O;  3A0R A;  1F51 A;  2Y69 C;  4MS2 A;  2FPI B;  2XC9 A;  2YU9 A;  2UUC H;  3VOU A;  4QW9 A;  3SYA A;  3ZHR A;  1Y1V A;  1AJQ A;  3RYH A;  1S5L Z;  1GN4 A;  3APQ A;  2UXD H;  2COG A;  2R8H A;  5L3C A;  5FD6 A;  3R5F A;  3GTM A;  2Z02 A;  4FLV A;  3OUF A;  2ADP A;  2ZNJ A;  4YY3 O;  1BL8 A;  3QVN A;  2YS7 A;  1XMQ H;  2OH2 A;  2Y4U A;  3CC2 V;  4DR1 H;  3L2P A;  3OFN G;  3SYO A;  3D8C A;  1JJO A;  4DR7 B;  2QKS A;  2HVQ A;  3C0F B;  1W0J G;  3JD1 A;  1NZ6 A;  1ZL8 A;  1KT8 A;  5KG1 A;  5LMU O;  1X4T A;  2NVX A;  1KJ8 A;  4R7R A;  1KB9 F;  4RZQ A;  2N04 A;  5HBR B;  2CGN A;  2WAM A;  4RAI A;  4TV8 B;  4O2A F;  2CTR A;  3PO3 G;  2D3O W;  4DRF A;  4P9O A;  4DV0 H;  1GN6 A;  2ZQM A;  4FK5 C;  3JAR A;  2CAZ C;  2IP4 A;  2EIK B;  4LF9 B;  1OBG A;  2Q7G A;  4QE9 A;  1CKO A;  4C5B A;  4WBN A;  1ARO P;  2OYQ A;  2YUA A;  2GUZ B;  5LOV B;  3HOY G;  1VQ9 V;  4LF7 O;  2JEF A;  1RPO A;  1SQQ H;  1BQZ A;  2HHH H;  5BYB A;  3BEH A;  5EZY A;  4DV5 B;  1I1L A;  2V5A A;  4X1I A;  1S76 D;  2HFE C;  4KHP O;  4ZQI A;  1WH2 A;  5IE9 A;  1QBZ A;  5IJ0 B;  4OPH A;  5LA6 F;  3BAA A;  2R87 A;  2DYS C;  2HEP A;  5EC1 C;  2HG8 A;  2HHF A;  5L3D A;  3N27 A;  3FB5 C;  4UUJ C;  3MJF A;  4JV1 A;  4ZOL B;  5CA0 B;  5IYB O;  2RF4 A;  1WB7 A;  1RM1 B;  2QEX V;  1CKM A;  3T1C A;  1Z5V A;  1GM9 A;  2EJ3 A;  5CAE B;  3DAA A;  2UUA H;  3B4S A;  4DR1 B;  4MV8 A;  1S97 A;  3ZX6 A;  4FFN A;  1SC5 B;  4BY1 G;  4TUY F;  5FL7 G;  5DN6 G;  5KFF A;  2FKX A;  4ED6 A;  3OT7 A;  4FE2 A;  1L0N H;  2Q67 A;  4FFB A;  4AIL C;  1JVM A;  1AVM A;  3MFI A;  2P4K A;  1SZX A;  3CEB A;  4DV0 B;  4NYE A;  3U11 A;  1AP5 A;  3SI8 A;  3CC7 V;  1VIB A;  1BMF G;  4DUY O;  2VPS A;  4CKC A;  2VQE B;  4MVO A;  5B1O A;  3PW2 A;  3OEE G;  3ZMU A;  2HHH B;  1J5E O;  4O4H B;  2W6M A;  3FMA A;  4EYH B;  2IH1 C;  1M6V A;  5B1B C;  2AHY A;  1ULZ A;  3ZMV A;  1SKV A;  2WLI A;  5B5E Z;  5FNV A;  1MSW D;  2UXX A;  4EFB A;  5BWW A;  2R72 A;  2VQD A;  2GTA A;  4O82 A;  3MWM A;  2UVU A;  3THO A;  2LJ2 A;  1FXK B;  3MHS C;  3D3Q A;  1Q86 W;  4GKJ O;  4MV7 A;  2QR4 A;  1L1F A;  1R3I C;  4JI8 B;  3TIG A;  3WWJ A;  2YXH A;  1KJI A;  1TAE A;  1FFX B;  5EK0 A;  2KG7 A;  2W6J G;  3OTO H;  4TQF A;  1I7F A;  3RYF B;  1PL0 A;  3SPC A;  2H3O A;  4O7V A;  1FVI A;  2Q69 A;  3GQC A;  4TV9 A;  2VPQ A;  4DR6 H;  2P22 C;  1JDB B;  4A3B G;  4KL1 A;  4GZR B;  4FM1 A;  2YW2 A;  3FKI G;  2CNU A;  2L35 A;  4UB6 Z;  5LXT B;  4GT1 A;  2XGQ A;  3FB8 C;  3ZMZ A;  2BSK A;  2UVV A;  4LFB O;  4QWA A;  3TY9 A;  1VAJ A;  1XNR H;  4O2B A;  3MR3 A;  5EC2 C;  3O9O A;  5JH7 B;  2YI8 A;  1CKN A;  3K5I A;  3H40 A;  1C3O A;  1GLV A;  4ME6 A;  3DGE A;  2R93 G;  2P06 A;  4B3R B;  1GMG A;  1WNS A;  4O4I B;  3T5J A;  4Y8V B;  1QCE A;  4ED8 A;  4ED7 A;  2D2C B;  4B7K A;  5JVD F;  4HZ3 A;  1D2D A;  1WCM A;  3KAK A;  1N36 H;  4DV1 B;  3GIJ A;  3F7V C;  4PA9 A;  3NUA A;  5I5S A;  5KX5 A;  1XQ8 A;  2FYU H;  3ASN B;  4PZ8 A;  5IYC G;  1E4F T;  4MTE A;  2E5L O;  1XMO O;  3K3W A;  4X1Y A;  4GX0 A;  1WAZ A;  4PI2 A;  2DAA A;  4B3S O;  1MZF A;  4A3K G;  1KUQ A;  4EFE A;  2X0L A;  2FPP B;  4JI1 O;  4TQD A;  1IXM A;  3E5N A;  1HNZ B;  5CA1 B;  4AQY H;  3KHG A;  3CXC U;  4A3F G;  2WB1 E;  1XNR B;  3QNE A;  5KT2 A;  2AZ2 A;  3ZRW B;  5LA6 B;  2FKL A;  3TGU H;  3SPH A;  3K5O A;  1G8M A;  4I7H A;  2Q9L A;  1Z2O X;  1AUX A;  3U10 A;  1GH6 A;  5BZB A;  2WLL B;  1E1R G;  1HP8 A;  2RDI A;  2EIJ B;  4JI7 B;  3AYH B;  3HB9 A;  3GID A;  2YEV B;  5BR8 H;  1IBL B;  4CKE A;  2R9I A;  5I5X A;  3CC4 V;  5L1L A;  2WYO A;  4A3J G;  5LP6 B;  3G6E V;  2YDE A;  1N36 B;  2EZP A;  1V54 B;  1O9H A;  1V55 C;  4YAJ B;  2JRI A;  4A3G G;  4DV2 H;  3SPG A;  3IJ4 A;  4DRX A;  3P3P A;  4W4K A;  4ZHQ F;  3A0H Z;  3RBD A;  1ZWI C;  5KMG A;  2QYZ A;  5H6Q A;  4LF8 O;  2YIB D;  1H2K A;  4MV4 A;  4ECZ A;  3MAQ A;  5LMN H;  4KFM A;  1WRV A;  2A9H A;  1I3Q A;  4JZ2 A;  4MTF A;  1IDS A;  1YEW A;  1YSC A;  5DIS C;  5KHI A;  1TA8 A;  5L3E A;  2C2D A;  3J7A U;  4FPP A;  2UU9 B;  1VS0 A;  2UXB O;  2XCP A;  5FPR A;  1TUB A;  1S10 A;  3ABL B;  1GKF A;  1VP7 A;  3ZED A;  4MVR A;  3RT3 C;  3CCU V;  4J9S A;  5BR8 B;  4BAY A;  3CME V;  4NXM B;  2JA5 G;  2QGN A;  4LF4 O;  1IYE A;  4QWE A;  2PN1 A;  5C8Y F;  1AN7 A;  4LF5 B;  2Y4T A;  2AGQ A;  4JI0 H;  2EZO A;  4DUZ O;  4DV2 B;  2JEX A;  2Q6A A;  1NT2 B;  3VNN A;  4JI2 H;  3R9R A;  3RB6 A;  2JEG A;  3AK2 A;  4O3O A;  3R66 A;  4QWD A;  4O7Z A;  5BPH A;  3OW2 U;  4MV3 A;  2WAQ E;  1MG1 A;  3J80 W;  4A3M G;  4C7U A;  3K9S A;  2YZG A;  4MW8 A;  3RVZ A;  3IC9 A;  3AG1 B;  2C22 A;  1M1K W;  1R9T A;  4QIW F;  4LBE C;  4B3T H;  1P7B A;  3PR5 B;  2F66 C;  4LF6 O;  3CCS V;  1K4C C;  2HG5 C;  3K58 A;  3FX7 A;  2XND G;  1AI4 A;  4J9K A;  4GCZ A;  3TK1 A;  1Q82 W;  4J10 A;  5KT6 A;  5JVD B;  2OIE A;  4DR4 H;  2XAF A;  4GLX A;  3CEI A;  3E22 B;  2B63 A;  3J80 N;  3OAA G;  2HLD G;  4J7J A;  2J6S A;  3FB7 C;  2GPW A;  5FR9 A;  1RPR A;  3GIQ A;  4JI5 B;  1JKJ B;  2CW7 A;  4FBU A;  1Q3E A;  4F6E A;  4ZI7 B;  5JQG B;  3QO5 A;  3FYE B;  3HR0 A;  2G38 A;  2QWN B;  2Z04 A;  3BPZ A;  2DE0 X;  3JAT A;  4JI2 B;  1CS0 A;  2W6O A;  2XD4 A;  1YHQ V;  2OTL V;  3I55 V;  1YI2 V;  1AUV A;  1SEI A;  2KKW A;  1NTZ H;  4QGP A;  4BW9 A;  3M99 B;  3KKY A;  1I1K A;  3ABM B;  2B5U A;  3UT5 A;  1W0K G;  1BXR A;  3TW6 A;  5DG7 A;  2W9C B;  2DJV A;  1FS0 G;  2FB5 A;  1FJG H;  3RV3 A;  1FKA O;  4B3T B;  2CKZ B;  1N4C A;  3ZHS A;  3D3I A;  5IJ9 A;  5KFJ A;  2GV9 A;  4IHJ F;  4CHI A;  3SJA C;  4CBC A;  2E74 B;  2COI A;  3JYC A;  2AQ4 A;  2V58 A;  1ET0 A;  4O4L A;  2GSM B;  3BVO A;  3I4N G;  2DWE C;  4PZ6 A;  3HXL A;  2VWK A;  5D1O A;  4O4J F;  3RAQ A;  2BR0 A;  4X1K A;  5C1O A;  2WA3 A;  3RAX A;  3OUS A;  3G71 V;  5DLG A;  1A48 A;  1XBL A;  4XYM B;  2PI4 A;  4YJ2 B;  5DQG A;  3PW7 A;  2ITC C;  5EBM C;  3DTU B;  1PNL A;  2ZDG A;  1X59 A;  4ECY A;  1GRJ A;  3D36 A;  3WWH A;  2E3C A;  5J2U A;  1NS1 A;  5T14 A;  3V4Z A;  4A2A A;  4FZ0 A;  2R7Z G;  4HNU A;  1VF7 A;  2B1I A;  1Y1W G;  2JA7 A;  4EBD A;  2ZE8 A;  3ZRV A;  3SNO A;  3CRQ A;  1M93 A;  1QVF U;  3ETG A;  4ZIB A;  5BMV A;  2ZR3 A;  3NXS A;  4LFC H;  3QZ8 A;  4A93 G;  4MTX A;  3Q4H B;  1RSO B;  3CJH B;  1D5N A;  5B1N A;  4C5A A;  5E79 Z;  2I80 A;  3DSQ A;  3H1J H;  2OCC C;  5KG0 A;  4MV1 A;  4MTO A;  3G8C A;  2ZE5 A;  5C8Y B;  2DYR B;  3ETH A;  3RFR A;  3S3X A;  1ZLZ A;  4E2L A;  3SE7 A;  2Q7H A;  2R7M A;  4ECQ A;  4FBT A;  2VQF O;  1I5Y A;  3I4M G;  1XMO B;  4O83 A;  5KFK A;  5IWA H;  3DXR A;  2P0A A;  1ZAU A;  4MA5 A;  4J7Z A;  5KKN B;  2R7K A;  3SDL A;  1K92 A;  4JI1 B;  4O7L A;  3U9S A;  4JYA H;  4CZZ A;  2I8C A;  2NN4 A;  4LNU B;  4WFB V;  1ZTE A;  4RNN A;  2RN9 A;  3JZI A;  4WHX A;  3S24 A;  2DZD A;  3HKE A;  5B1B B;  1ZET A;  2FLP A;  3F7Y C;  2ZT9 B;  4DR3 O;  2FL4 A;  1ZHQ A;  4RAZ A;  2EIN B;  1DK1 A;  2L6L A;  4GKK H;  4DIM A;  1AR4 A;  2Q73 A;  2QM7 A;  2XIG A;  1YJN V;  4FS1 A;  1XDC A;  3RBZ A;  3ZRS A;  2UUC O;  3U54 A;  2VUM A;  1VQO V;  2CK3 G;  2VOB A;  4J0M A;  4Q8E A;  1QU7 A;  1CQJ B;  4A3E G;  4FLZ A;  3CX5 F;  3CRA A;  1XMQ O;  5A9G A;  3E83 A;  2OTJ V;  1IBM B;  5DQI A;  2W0X A;  2UUB B;  4Q4D A;  1IZ3 A;  3R65 A;  1KKC A;  1KP2 A;  3KCX A;  1KBH A;  1VF6 C;  2YXY A;  3RYH B;  3G8D A;  3MWD A;  2W8L A;  3T1Y B;  1H2N A;  1BJT A;  1HNX H;  1KEE A;  4JYA B;  3BQ0 A;  1BZK A;  2OLS A;  3P3N A;  3GII A;  4IL6 Z;  1Q8I A;  1KBL A;  3MR2 A;  2RJZ A;  1M57 C;  4TSF G;  2W0F C;  4CH6 A;  1MSD A;  3ETQ A;  4O81 A;  1ZL8 B;  1I7N A;  1T36 A;  4RUA A;  1Q7Y W;  4EKW A;  5E1A C;  3RB0 A;  4B3M O;  3ZJZ A;  5B1A C;  3H1L H;  4GKK B;  2HVR A;  1JFF A;  3HOX G;  4W4L A;  4LC1 A;  5DQH A;  4M9U A;  1N33 H;  1DGS A;  3JAR B;  2FK3 A;  3TY5 A;  3KCY A;  2NUA B;  3Q8R B;  1PM9 A;  2MK3 A;  1FD9 A;  1HWY A;  4WBN B;  3IGA C;  2RNB A;  3CCL V;  2UUA O;  2PGG A;  1XEQ A;  2AGP A;  4NXN B;  3LDC A;  2F1M A; 
#chains in the Genus database with same CATH homology
 4CC6 A;  5EZY A;  4DV5 B;  5EZY B;  4X1I A;  3SGI A;  5IJ0 A;  3QWU A;  4X1I B;  3RWR D;  5IJ0 B;  3K59 A;  4FLU A;  4EB6 A;  3N6X A;  4EB6 B;  3BAA A;  2HEP A;  3VQV A;  3JSL A;  5JCO C;  4JV5 H;  2PYJ A;  4JI1 H;  4ZOL A;  4ZOL B;  5CA0 A;  1XHZ A;  5CA0 B;  4L8J A;  1CKM A;  1Z5V A;  1SQG A;  4LFB B;  4TUY A;  4LF7 H;  4TUY B;  2UUA H;  4DR1 B;  5JCO A;  3NBY B;  4X64 H;  3HKC B;  4DV7 H;  4KHP H;  1HR0 B;  4K0K H;  4UCU A;  4CS3 A;  4JI3 H;  3GB8 B;  5BMV B;  4FFB A;  4FFB B;  2FE3 A;  4UCT A;  4AIL C;  3T1H H;  3K5M A;  5ITZ A;  5ITZ B;  4DV0 B;  3EYY A;  3U11 A;  1E4G T;  2ZNI A;  4TOI A;  3WB1 A;  5EIB C;  3KAL A;  4AQY B;  3IAY A;  2VPS A;  2VQE B;  3LML A;  1T5E A;  1IBM H;  2E5L B;  2Q2U A;  2UUB H;  4B08 A;  4O4H A;  2HHH B;  4UCS A;  4O4H B;  3FMA A;  1S68 A;  2RQ6 A;  4B3S B;  2HIV A;  4JV5 B;  1QHT A;  1SKV A;  3T1Y H;  1QQC A;  5FNV A;  4UCO A;  5FNV B;  4EFB A;  4DUY H;  3RJ0 A;  4CH3 A;  4MV9 A;  4Q0Y A;  2R72 A;  5KHJ A;  1Q5O A;  3MWM A;  4DR7 H;  3THO A;  2YIB A;  1J5E H;  3BA9 A;  4MTD A;  4DV7 B;  4MV7 A;  1SA0 A;  2F93 B;  4NVP A;  1SA0 B;  4JI8 B;  4K0K B;  3QF7 A;  1FFX A;  4JI3 B;  1TAE A;  1FFX B;  1TVK A;  1TVK B;  3OTO H;  4TQF A;  3RYF A;  1I7F A;  3RYF B;  4I4T A;  2QJ1 A;  4HBN A;  4I4T B;  1S5J A;  1FVI A;  2P5O A;  4TV9 A;  4TV9 B;  4DR6 H;  2P22 C;  4U3J B;  1M0T A;  2ZJT A;  1P16 A;  4LF4 H;  4KL1 A;  5LMN B;  4FM1 A;  4LF9 H;  4GKJ H;  2V4D A;  5LXT B;  4X66 B;  2BTO A;  2F95 B;  2YXL A;  3HKB A;  3HKB B;  3TY9 A;  2JVD A;  3VQW A;  4CC5 A;  5K1P A;  4IAJ A;  1XNR H;  4O2B A;  4DUZ H;  4O2B B;  4NXN H;  4DV5 H;  5JH7 A;  5JH7 B;  2YI8 A;  1CKN A;  1N34 H;  4LF8 B;  1CKN B;  4RB2 C;  1H2S B;  5K1X A;  4FLY A;  2HVS A;  4B3R B;  3JSN A;  4O4I A;  1WNS A;  4O4I B;  3VQX A;  4LFB H;  2Q7E A;  2KSW A;  1P8L A;  2RGR A;  1N36 H;  3KAK A;  4DV1 B;  3A2F A;  2UXB B;  1O75 A;  1HR0 H;  5KX5 A;  5KX5 B;  2PUS A;  1XQ8 A;  4LSX A;  4PZ8 A;  4LF6 H;  4JI0 B;  1E4F T;  4MTE A;  4DV6 B;  3QG5 A;  4ETS A;  4X1Y A;  4Q6G A;  4PI0 A;  4PI2 A;  2ZM6 B;  4LSA A;  5IT9 W;  4EFE A;  4D7T A;  2PYL A;  4LF4 B;  4TQD A;  1HNZ B;  5CA1 A;  5CA1 B;  4AQY H;  4FLX A;  2VQE H;  2VQF B;  4RB1 A;  1XNR B;  3N2K A;  4DUZ B;  2JGU A;  3N2K B;  2E5L H;  2EX3 A;  5LA6 A;  5LA6 B;  5EYP A;  5EYP B;  4HNA A;  1N34 B;  4B3S H;  4HNA B;  3K5O A;  5LP6 C;  4I7H A;  1Z2O X;  3U10 A;  4DK1 A;  5CB4 A;  5CB4 B;  2HHH H;  1L2Z A;  4JI7 B;  1G6U A;  3CSX A;  5BR8 H;  1IBL B;  4OX9 H;  5LP6 A;  2WYO A;  1JMK C;  5LP6 B;  4DR4 B;  5EIB D;  4FM2 A;  2CW8 A;  1N36 B;  4I50 A;  4I50 B;  4JI8 H;  1O9H A;  4UFZ A;  4ZHQ A;  4DK0 A;  3TY8 A;  4PDB A;  4ZHQ B;  2BTQ A;  4LF6 B;  1SYX B;  4DV2 H;  2BTQ B;  4DRX A;  2ZIO A;  4DRX B;  2UXC B;  5KMG A;  2F4V H;  5KMG B;  4JI4 H;  2YIB D;  1Z2N X;  3ICX A;  3W5O A;  5GON A;  3MAQ A;  5LMN H;  3N43 B;  5EOY A;  4X66 H;  1X9N A;  3JAS A;  1YEW A;  3JAS B;  5DIS C;  3BAB A;  4EEQ A;  4X65 B;  5KHI A;  1TA8 A;  1BGW A;  4D7S A;  2UU9 B;  5KHH A;  4DV3 B;  4JI6 B;  1FJG B;  1VS0 A;  3N41 B;  4A2B A;  5FPR A;  2JS5 A;  3DF7 A;  1TUB A;  4LF8 H;  1TUB B;  1XNQ H;  5JJE B;  3JAM W;  4B3R H;  3ZED A;  2Q2T A;  1I94 B;  3RGZ A;  1M5I A;  5BR8 B;  4OX9 B;  1M4U A;  4BWA A;  5FLX W;  4NXM B;  4PZ7 A;  1XK5 A;  4DV1 H;  1AN7 A;  2UXB H;  4LF5 B;  4JI0 H;  2YIA A;  4UCV A;  3RGX A;  4DV6 H;  4DV2 B;  4LFA H;  3VNN A;  1NT2 B;  4CH4 A;  2F4V B;  2ZM6 H;  4JI4 B;  4JI2 H;  3J7A K;  4X62 H;  1HW7 A;  1HNZ H;  1WN7 A;  1B04 A;  2VQF H;  3J80 W;  2HIX A;  2O03 A;  4CS4 A;  2Q0A A;  3UQ8 A;  4B3T H;  4LFC B;  3JAK A;  2F66 C;  3JAK B;  1XNQ B;  3K58 A;  4JI7 H;  4FM0 A;  1IBL H;  5JVD A;  3BA8 A;  5JVD B;  3RYC A;  4FM9 A;  4EQ5 A;  3RYC B;  4DR4 H;  3E22 A;  4GLX A;  3E22 B;  1M0W A;  3NBZ B;  3RIZ A;  2ZCE A;  2WE6 A;  4JI5 B;  5KHG A;  2CW7 A;  5IWA B;  1Q3E A;  4ZI7 A;  5JQG A;  4ZI7 B;  5JQG B;  1IBK B;  3SR2 C;  4LFA B;  2UXC H;  4X1Y B;  4LMY A;  3GDE A;  4YHH B;  3BPZ A;  3L4J A;  1D5A A;  3JAT A;  4JI2 B;  3JAT B;  1TGO A;  4X62 B;  1SEI A;  2KKW A;  4I9Q A;  3NC0 B;  4BW9 A;  5LL6 b;  2VWJ A;  3UT5 A;  4X65 H;  2WDT A;  3UT5 B;  2HGS A;  2VUG A;  2UU9 H;  3OTF A;  4DV3 H;  4JI6 H;  1FJG H;  1V9P A;  2PY5 A;  3PN1 A;  4IHJ A;  4B3T B;  4IHJ B;  5IJ9 A;  4K8Z A;  2GV9 A;  3FFQ A;  5IJ9 B;  3H20 A;  3M4I A;  3U0Z A;  4DR5 H;  3SJA C;  1I94 H;  4BWS C;  1WPB A;  2YI9 A;  4DR2 H;  1O9G A;  1KMI Z;  4O4L A;  4O4J A;  4NXM H;  4O4L B;  4O4J B;  4PZ6 A;  3KXY T;  1P49 A;  3JAW A;  3HXL A;  2VWK A;  3JAW B;  3N2G A;  2CFM A;  4DR3 B;  5LMU H;  3N2G B;  5D1O A;  4LF5 H;  5D1O B;  4X1K A;  2RGV A;  4B3M H;  4X1K B;  1FKA H;  3KAJ A;  3F8N A;  2UUC B;  2YCH A;  5A2Q W;  1KU9 A;  5KHK A;  3K57 A;  4YJ2 A;  4X20 A;  3WB0 A;  4LR3 A;  4YJ2 B;  4X20 B;  2UXD B;  1HNX B;  5JJN B;  5GON B;  3N42 B;  5IYZ A;  5IYZ B;  2QM4 A;  3CHX A;  3QTC A;  2E3C A;  4YJ3 A;  5J2U A;  1XMQ B;  4K8X A;  4YJ3 B;  1Q43 A;  5J2U B;  4A2A A;  4CH5 A;  4DV4 B;  3HKC A;  1HNW B;  1VF7 A;  3RGB A;  1N32 H;  3KYH C;  1M93 A;  4ZIB A;  4CS2 A;  5BMV A;  3RF2 A;  3JAL A;  4LFC H;  3LNN A;  3JAL B;  2ZIN A;  1RSO A;  2W57 A;  1SQF A;  5J2T A;  5J2T B;  4YY3 B;  4DR5 B;  3DSQ A;  1N33 B;  5JJJ B;  4LH6 A;  4DR2 B;  5C8Y A;  2R70 A;  5C8Y B;  3RFR A;  4PHZ A;  1XHX A;  1ZHS A;  2Q7H A;  5LMU B;  3IG0 A;  1MZB A;  3CVZ A;  4LH7 A;  3RYI A;  5D5P A;  3RYI B;  3W1B A;  4JI5 H;  4B3M B;  1XMO B;  5IWA H;  5D5Q A;  5D1P A;  3CB2 A;  3HKD A;  4FVM A;  1XI1 A;  4E6N A;  3HKD B;  5FPO A;  1IBK H;  4FLW A;  1ZAU A;  1I6U A;  4YHH H;  3VQY A;  1A0I A;  3M7M X;  4UCR A;  4JI1 B;  4JYA H;  4LNU A;  1L8D A;  4LNU B;  3L4K A;  2PZS A;  3S24 A;  4F6R A;  4LF7 B;  3HKE A;  3SJC C;  3WB2 A;  4F6R B;  3HKE B;  3K5N A;  2UUA B;  4RB3 C;  1S03 G;  4X64 B;  3BRC A;  4KHP B;  2MCT A;  3J81 W;  1N32 B;  1ZHQ A;  4RAZ A;  4AHC A;  4GKK H;  3N44 B;  3RTX A;  3GJX B;  3B2E E;  2XIG A;  3ZS8 C;  3T1H B;  4RAY A;  4U3J A;  2VOB A;  2R9A A;  4J0M A;  5LXT A;  2XHB A;  4I55 A;  4FLT A;  3RR5 A;  4DR3 H;  4I55 B;  4FLZ A;  3BHP A;  5FD5 A;  4IIJ A;  3W1G A;  4IIJ B;  1IBM B;  2UUB B;  1XDN A;  2UUC H;  4M7E A;  3RYH A;  3RYH B;  2UXD H;  3T1Y B;  1BJT A;  1HNX H;  4JYA B;  5FD6 A;  5LYJ A;  4FLV A;  2ZNJ A;  5LYJ B;  4APM A;  4DUY B;  1Q8I A;  1XMQ H;  2RJZ A;  4DR1 H;  3L2P A;  1JJO A;  4DR7 B;  3C0F B;  2HVQ A;  4RB0 A;  4DV4 H;  1HNW H;  4CH6 A;  1J5E B;  1Z2P X;  3ETQ A;  1X4T A;  4GYC B;  4O2A A;  4R7R A;  4O2A B;  4RZQ A;  4GKK B;  2HVR A;  4TV8 A;  1JFF A;  3OTO B;  3K3V A;  4TV8 B;  1JFF B;  2IM9 A;  4DRF A;  2OWO A;  1GYF A;  4YY3 H;  4DV0 H;  4DR6 B;  3N40 P;  3SJB C;  1N33 H;  3JAR A;  2CAZ C;  2PTM A;  1DGS A;  3JAR B;  3TY5 A;  4LF9 B;  4GKJ B;  2Q7G A;  2ZIM A;  1CKO A;  4WBN A;  5LOV A;  4WBN B;  2OYQ A;  1WH2 A;  5LOV B;  3K5L A;  2PGG A;  1XMO H;  4NXN B;  1Z5W A;  2F1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...