3UQ8A

Structure of adenylation domain of haemophilus influenzae dna ligases bound to nad+ in adenylated state.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
b'NIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVARIEDRLILLPAPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQEELTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
molecule tags Ligase
source organism Haemophilus influenzae
publication title Structure Guided Understanding of NAD(+) Recognition in Bacterial DNA Ligases.
pubmed doi rcsb
total genus 106
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2011-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3uq8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3uq8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3uq8A02
1X9NA 2UU9B 2Q2UA 3KYHC 1FVIA 5D1PA 2VQEB 2Q2TA 4LF5B 4DV2B 4JI0B 3GDEA 4UCOA 4EFEA 3W5OA 1S68A 4NXMB 1B04A 4GLXA 1N33B 1XDNA 3TY5A 1I94B 5DISC 4B3RB 4K0KB 1HR0B 4JYAB 3RTXA 3BA8A 3L2PA 4PZ6A 4UFZA 4DV7B 2UXDB 4DRFA 2HVRA 1XNRB 4LH6A 4B3SB 3PN1A 5FPRA 1J5EB 2E5LB 1HNWB 4KHPB 4E6NA 4DV4B 2UXBB 4LFAB 4X66B 4UCRA 3T1YB 1FJGB 4PZ7A 4LFCB 1DGSA 4UCUA 4DR6B 4CC6A 3W1GA 4UCTA 2VUGA 4JI4B 1VS0A 1XMOB 2ZM6B 4DR4B 1HNXB 5D1OB 4LF8B 3VNNA 4JI6B 1V9PA 4CC5A 4DV1B 3TY9A 5LMNB 4DV0B 2HVSA 4EFBA 4GKJB 4DR2B 4LFBB 4EQ5A 3BABA 4YHHB 1XNQB 4X65B 4B3MB 3NBZB 1N36B 5LMUB 4EEQA 1XMQB 1HNZB 4DR7B 3NC0B 5FPOA 1N34B 4JV5B 3RR5A 1A0IA 1CKMA 3BA9A 3JSLA 1ZAUA 2CFMA 2UUAB 4LF9B 3TY8A 4JI2B 4JI8B 4AQYB 4LF7B 4UCVA 4DR1B 4DR5B 1CKNA 4DUYB 4DV5B 2HHHB 1CKNB 4JI5B 4DUZB 3T1HB 1P16A 2HIVA 3S24A 1IBMB 1XK5A 4YY3B 3NBYB 2UXCB 4UCSA 4X62B 4TOIA 4GKKB 4LF4B 3GB8B 3OTOB 4DV6B 2F4VB 1TA8A 4JI3B 4DV3B 4B3TB 3GJXB 3SGIA 1N32B 4PZ8A 1P8LA 3BAAA 1IBLB 5D1OA 2HIXA 4X64B 2VQFB 4JI7B 5IWAB 4LF6B 2UUBB 2UUCB 3JSNA 4DR3B 4LH7A 2OWOA 1CKOA 4OX9B 1TAEA 3QWUA 1IBKB 5BR8B 3W1BA 4NXNB 2HVQA 4JI1B 3UQ8A
chains in the Genus database with same CATH superfamily
1GM9A 2DYSB 4LFCO 3BHPA 4W4KA 4X88A 1FJGO 5DQIA 2R8IA 3MHSC 3OUUA 3GDEA 1SA0B 2IH1C 1AUXA 1NTMH 4X9QA 4P30A 4QWEA 1PNMA 4AI8A 1R6TA 3SYPA 3B8MA 2ODMA 4BBRG 3ASOC 5LMUH 4DK0A 1RPRA 3UO3A 4O7YA 2QGNA 4PD4F 2JA7G 1OV9A 2PGGA 4JYYA 4TV9F 5CMUA 2F93B 3GTJA 1Y67A 4DO2A 1EZVH 1OCZC 3IN5A 4O4HB 2PF4E 2CUGA 1US6A 4B3MH 1QCEA 3CE2A 3PFFA 3OMIB 2R93G 1V54C 2VQEO 4HYOA 4PA7A 4TV8F 2P90A 3J7AU 3BFRA 3A2FA 3JARA 3AG4B 3EFFK 4LBEC 4PA4A 2UXCH 3G71V 3B2EE 1AROP 4J7KA 2CE4A 4I55A 3FDSA 3KCYA 3QZ8A 4JI5O 3HKBB 1Q81W 1T5EA 4R50A 1F7YA 1D5AA 2WAQE 1XMQH 3CCJV 4A3BG 3R9RA 2DQ0A 3T99A 2M6YA 4U3JA 2AU0A 4ECZA 4TWKA 3OUZA 3QNEA 3CPWU 2BE3A 1F4NA 5BMVF 2HGSA 4J7ZA 4TUYF 1GN3A 5TISZ 1COWG 3DAAA 4JV5H 2K1EA 4LF9B 2RDJA 2EJ7A 2GPWA 4NXMH 3E86A 1HNXO 1TGOA 3BVOA 4LMYA 1BQ0A 5C44G 1VF5B 3L71H 3FKIG 5I5VA 3TEKA 4O82A 5KFAA 2QM7A 3K06A 4DR1O 1NH2D 4LF5O 1K83A 1DIKA 3M9NB 1YTFB 1ULZA 3P32A 1GYFA 3Q4HA 2DIKA 4EGQA 4X1YB 4O2AB 2QB5A 3K0DA 1Y1VG 5CA1B 2EILC 2MK3A 4UVBA 1KBLA 2FE3A 2VUMG 2HIXA 2F23A 4TM5A 5FD5A 4CKBA 2KSWA 2R87A 1NVPD 1LUWA 2YSUB 4BBSG 1KT8A 4CS3A 4FLWA 3H0GG 1QR8A 5K2MA 5EZYA 2HHHH 4C7UA 4O86A 4F50A 3CMAV 4CKEA 2A9HA 3STLC 3VOTA 2FB5A 3T1HH 5CA0A 1IBKO 3OD4A 3JD3A 5EBLC 1QLEB 1T94A 4JI0B 1KP3A 5IJ9B 2QR4A 3L4JA 4HNVA 5B5EZ 2QKCA 5H9CA 2NLJC 4GX1A 1I7LA 2CDYA 4RAIA 4EYIB 3H1KH 2O57A 2JEGA 4YB8B 3TXQA 1V55C 3ETDA 3RBDA 5I5XA 1NVPB 4DL7A 2W9AA 3H1HH 4QIWF 5CBHA 3D3IA 4LF7O 1SZTA 5DLGA 1CPYA 4CKCA 2UUBH 1VF6A 5FPRA 5KFNA 4RZRA 4PELA 1KC7A 5A2QN 1PL0A 1K34A 5I5SA 3T1CA 2L6LA 5E79Z 3PVXA 3QTCA 1L0NH 4J9YB 1M9NA 1FJGB 4DR2O 2KKWA 3Q8SB 1W2BU 3GTMA 1HWYA 2EIYA 4DUYO 3GVMA 3C90A 4DUZO 2IJJA 4U7NA 1JR9A 2RGVA 3RF2A 4FLZA 3OSNA 3MR6A 1XMOB 5KS8A 4ED3A 1NTZH 4JI8O 4DR6H 2P06A 1SFOA 3SJQC 4CC5A 2VQFO 5LMUO 2W6ZA 4FU0A 4UUGA 2YIAA 5KFTA 3SPCA 3RYIB 1G1XB 5EIBC 1S97A 3Q4HB 1JFFA 4NTYA 3SJAC 1GSOA 2SCUB 1EZ1A 3DF7A 3JZIA 4FVMA 1N4CA 3RYIA 1TWFA 1O9HA 5KFBA 4HNUA 5BWVA 3ASNC 2FTKA 2K9PA 4A3LG 2NVXA 3AK2A 4UCVA 1SQQH 4JV1A 4ETSA 4DR5B 3EPGA 4O2AF 2DN9A 2GSMB 3DXRB 4MVZA 2C35B 1YCIA 2JEJA 4LF6O 3M8AA 5KT6A 4RAZA 4JI7O 4YHHO 1YITV 4JAVA 2EINB 5KT7A 4GC6A 2NU7B 1S0MA 4U3JB 2FYUH 2JGUA 4F6EA 4M9UA 3K59A 2WWWA 3HR0A 1Z2GA 1DK1A 1IYDA 1FKAO 3VBBA 3HOYG 4DR3O 3U11A 3HKBA 1IBKH 3ORQA 2UXDO 2KB1A 1SQBH 5EWFA 5KHKA 1ZHSA 4A3KG 1N8RW 3S3XA 5KFKA 1AR1B 3EVKA 3BY6A 5A2QW 3RV3A 4J9RA 4CHIA 3WWJA 1VP7A 1TAEA 5KT5A 3NGDA 2F4VO 1KP2A 4N23A 3LSSA 4CH5A 4DR7B 4X65H 1AR4A 3MFIA 2QWOB 3ZRSA 5EK0A 3ABKC 1RPOA 2O03A 5CE8A 2JEFA 4O4HA 2BQ3A 4ZBMA 1I1KA 2ZT9B 5EZYB 4ECRA 5HBRB 4JI6H 2LFSA 2JS3A 3G6BA 2VQEH 2HKOA 5L1KA 4LP8A 3B4SA 5EOYA 1EKVA 4BWAA 4LF8O 2YXYA 5ITZB 3BA8A 4CH3A 3P3PA 4LF5H 4X1IB 4DUYH 4CMDA 3VQVA 2DMXA 3N44B 3I4MG 3K58A 3VPCA 4LH6A 5CA1A 4ZQIA 2YCHA 2UUAH 4B3SB 3GV7B 5L3EA 4X1YA 3FB8C 4XX0B 3JASA 5CR5A 3GILA 3E89A 2BOCC 2R7KA 2WA4A 2CKZB 1BGYH 3K9AA 1VBGA 3MWMA 4N21A 5LGNA 3F5WC 5DG8A 3ETEA 1XBLA 2LP7A 3VPBA 1DLBA 2VS0A 2B63G 2FPGB 3CHXA 1GO3E 3A0BZ 5KFWA 2HFEC 3OMAB 3Q8QB 1GSAA 3ZRXA 1Y4MA 4LF8B 2ZQMA 5BWTA 3PW7A 2B1GA 2ASJA 2R82A 5DG9A 5DM6V 1GO3F 3CP1A 1OZ0A 4RCNA 1XNQB 3CSWA 1B3QA 3BG5A 3NBZB 2GTAA 1HNZB 5HNEA 3OUSA 4APMA 1GM8A 4FFNA 2L35A 1W59A 4NYKA 3RR5A 3RV4A 5C3EG 4F4XA 4R8CA 4WD3A 4I55B 1R3LC 3A0RA 4FM1A 3O65A 3SPJA 3BCCH 4RQEA 4DUYB 5KFHA 4K6NA 3K3VA 5IY5B 3L72H 3JAMN 1KKDA 1Q82W 3LMLA 4D7SA 3UYYA 1QQCA 1BJTA 5JH7B 1OJHA 1W93A 4LF4B 4GX0A 3OTOB 1UPGA 2ARHA 2OTLV 1EKFA 1I5YA 4MAMA 4B3TB 2GV9A 4PZ8A 5DECA 2F95B 3U9TA 3SJCC 4X65O 1IBLH 3PR4A 3ABKB 5I5TA 3C3SA 1YXBA 4OGQB 3CQZA 4JI7B 1JMKC 4LF6B 3EYYA 1U97A 3RB4A 4U7CA 2W9BB 1CKOA 4RAYA 4DL2A 2P4KA 2DWCA 1FXVA 2FPIB 1NS1A 2XGPA 1IBKB 3EPIA 4JI3O 1SA0A 3ZJZA 4DV3O 4RZQA 2XCAA 3H01A 2COGA 4EBCA 3I5DA 3VQWA 3ETQA 2WLHA 3JD2A 4HNAB 3GTKA 1I50A 4KHPO 5KFJA 2KG7B 3ZHVA 2CW8A 5L3FA 3LDCA 4F4YA 2W6NA 2VWJA 1MG1A 1Q7YW 1F51A 2WPDG 3B09A 1WB7A 1P84F 4EG0A 3SPGA 3ZEDA 2A79B 1BXRA 3AK1A 2COJA 3BPZA 4DAAA 3AG2C 1PNLA 4NKGB 3APOA 2PYLA 1MZFA 1DF5A 2MCTA 1VKZA 4C2MA 4LC1A 1ZLZA 5DQGA 1ZUQA 3QZ7A 2CGOA 3ABMC 5IYZB 3AG1C 4I50A 1JOYA 2WE6A 1YJWV 5J2UA 5FLXN 1E4EA 1N34H 4TSFG 2ITCC 4DV0O 2W8KA 3G67A 3H1IH 1JDBB 1I7NA 1I1MA 4Q45A 2HVJC 2CTPA 2VUMA 3I56V 1G8MA 4FFLA 4JI6O 2W57A 1J5EH 1MZEA 3PO2G 2ZDIA 5IYCG 4J9NA 4JI4B 5JQGB 3K57A 4DR4B 2DWEC 5CB4F 4K0KO 5EYPB 5KG3A 2ZE7A 2NR5A 2LW1A 2IH3C 2QKSA 4ZHQB 1Z2NX 5IYZF 4IIJB 4ABMA 5LP6F 1A0GA 1GTOA 5A9GA 1OCOC 3TQTA 1PP9H 1Q3EA 4DR4O 2X5RA 5I60A 1AI4A 4J9ZB 5KKNB 4PA6A 4JI5B 1L2ZA 2UXXA 4FLXA 1IOVA 5EC1C 5F9LA 1Y6XA 4ED1A 1XMOH 3HB9A 4WCEV 1M0WA 5LHHA 5KX5F 2AZ0A 3NUAA 3UFXB 4X62B 1FFXA 4ZI7B 1BQZA 3ZHSA 1K1SA 2W7PA 4LF6H 1H2MA 1VQ6V 3J81N 4JI1O 2DZDA 2ITDC 1GK9A 3RBZA 4BW9A 5J2TF 1I08A 5H5NA 3SYAA 2AZ2A 1IBLB 3UKMA 2W6JG 3J80N 1JDEA 4JTCB 4OX9O 5D1OA 5J2UF 4I50F 2CW7A 4ECWA 2UUBB 5BWXA 4TQSA 4PDVA 3TK1A 1Y14B 4YJ2B 3ZRVA 1WP8A 1XILA 2WLLA 3UCSC 4GC7A 2BTQB 3K5LA 1TUEB 1JQ0A 4H37A 5KFFA 3KYHC 2WLIB 4LFBH 3QG5A 2Y0SE 2UXBH 5LA6A 1WAZA 3T54A 3LNNA 5LHIA 4GT1A 1WPBA 1M6VA 5GTIZ 3RYFA 3E83A 2QWPB 4PA9A 4JI4O 3UZOA 3WO0A 1G4YB 5KG2A 1HNZH 3JCZA 3CXHF 3AG4C 3A0HZ 5IP9G 2IJHA 2J6SA 3DTUB 2UUBO 3ABLC 3PN1A 4JASA 3RYHA 3STZC 5DN6G 4Q4CA 3QF7A 2YU9A 4FLTA 4I0XA 4MW8A 4Z1MG 3SYCA 4A3GG 3R65A 4PZ7A 4J41A 4JGSA 3AG7A 4GCZA 3RAXA 1DGSA 5EWGA 4ED7A 3L75H 4DRXA 3NR7A 4UVCA 5CA1F 4MV8A 4I4TB 4O4LB 4WFHA 4X1KB 3F8NA 2Q7HA 4A3MG 4A3DG 3W1GA 3TW6A 5KFGA 3OR6C 2QSAA 5K1PA 2OT5A 5LGUA 2HVSA 4AYBE 3CRCA 1RJRA 4LFBB 3AEIA 2OIEA 2LGWA 1GN4A 1SC5B 1BZKA 4Z2WA 5BWUA 3F7VC 2NU6B 2F4VH 4JV5B 1NU1H 5EIBD 2VWKA 1S77D 2Q8VA 5KMGA 5LP6C 3TY8A 2JA8G 4RWUA 2AW9A 5CN0A 5IP7G 3CCUV 3GIKA 3E8GA 4JYBA 4P2ZA 5JCOA 1CKNB 1WCMG 1P16A 5KFYA 5LXTA 5CB4A 4FBUA 4B3MO 4B08A 3QVNA 3E22A 1Z5WA 2UXCB 4IWXA 2YS7A 3OT7A 1N34O 2DPIA 3TIGA 1BE3H 2YIBA 3G80A 4DV2O 1OHHG 3ZIAG 3CC2V 1GKFA 1KB9F 4NXNO 3CMEV 5F2VO 2XAJA 1P8LA 2HG8A 1XHXA 3DC6A 1CP9A 4ZOLF 5DGIA 2UXDH 4U6PA 1QLEC 1JCHA 5KAFZ 3DTFA 2W8LA 2PUSA 5LXTF 2EJ3A 3FKSG 3IC7A 1Z2OX 4JI2H 5L3CA 1WP7A 3L73H 3V6JA 1WRVA 4NLGA 4DV4O 5BR8B 4BR6A 1RK5A 1Q86W 3VQYA 1RM1B 3ZCCA 4O4JF 5C5JA 3JZFA 4A3JG 1SQFA 4LSAA 2FLNA 2XCPA 2R86A 2HHFB 4NYEA 2AGAA 1CXZB 2IMWP 3LWBA 1S9FA 4H0LB 3HKDB 3N8DA 2PY5A 3BEHA 2E3CA 3HOWG 4K0KB 2XCLA 2OCHA 4DV7H 1BSMA 2FLPA 2CTRA 3RYCB 2UXDB 5KG5A 3K3WA 4MV7A 3GTGA 2Q6AA 4O4JA 3JCUZ 3T5HA 1N36O 2Y0PA 3J7AK 2VQFH 3CCQV 1KU9A 2W70A 2BQRA 1RJPA 1DTOA 2YI8A 5BYAA 3D36C 4YP3A 1QVGU 2CNVA 3CC7V 5D5QA 3FD9A 1AP5A 4QE7A 3RIZA 2BCCH 3LDDA 4CC6A 5BXZA 2XT9A 3GV8B 2HGWA 4BIOA 2UVWA 4L87A 4PI0A 1Q8IA 2JJ2G 4MT8A 4MTXA 2BQUA 4JAAA 5KFPA 4DV1B 3QO7A 4MVQA 4H33A 4EFBA 4I5SA 3TW7A 4EQ5A 5BWWA 4ED6A 1S5LZ 1N36B 3LSQA 4GKKO 3E8BA 2R85A 1QR9A 4FFBA 3LNMB 4DV2H 1KTAA 4MV9A 1ZAUA 4GX5A 2C2EA 2FP4B 2UUCH 4AQYB 4UUJC 3QO5A 5L3GA 1RYSA 5IJ0B 4JI7H 2H8PC 1CKNA 3T9EA 3HOVG 1WH2A 4YIPA 1F4MA 5I5UA 3T1HB 4DL5A 2FMAA 3Q1KA 5KMGB 4JF3A 4MV4A 4FFPA 2BOBC 1JX9A 2ZIMA 3OTOH 1E79G 4LF4H 3AW8A 2XGQA 2FB9A 1TA8A 3EHBB 5EDWA 1P7GA 4YY3O 4RUCA 1SQXH 2XIGA 3BACA 4QWDA 3FAVA 4MTGA 1D5NA 1H38A 1ZTEA 1P7BA 3KHRA 4IL6Z 4PJ0Z 4HQ6A 2YICA 4IHJF 4NXMO 4ZOLA 2PN1A 4ZI7F 1YTFD 3JAWA 5J9PC 1SZXA 1M90W 3CEBA 4JV2A 5L9XA 5KHJA 4JI0O 3K9SA 4NXNB 1NQTA 2HVQA 2Z04A 1TWAA 2PBZA 4A93G 1S0VA 1I6UA 1M57C 3OR7C 3N41B 4K8ZA 3CRAA 1K5SA 5T14A 2NN4A 5B1NA 3RYHB 4O4HF 4XYMB 1B04A 1TWCA 3Q2OA 3B8NA 1HNXH 4GLXA 1NH2B 2JIZG 1EHIA 2A3QA 4O3QA 2FJZA 2R8HA 4CS4A 5JVDF 4J9SA 2P22C 5EWEA 1IXBA 3MDSA 1KKCA 4DV7B 1FYJA 3BQ0A 4Y8VB 3N40P 1KJ9A 4FFMA 1XNRB 4A3EG 3WFVA 4HAMA 4O7TA 5JJNB 1XMQO 1EBOA 4R6ZA 4X64H 4IR9A 4O7SA 4FM0A 4GKJO 3E8FA 2XAFA 3IFXA 3JAKA 1FAFA 2UXCO 4YAKB 3I55V 2CAZC 1Z5VA 3IGAC 3GB7C 1BCCH 2WLLB 1KJ8A 3J81W 2ATLA 1ZL8A 1K4CC 1P49A 4GYCB 1WPXA 3IC9A 5D1OB 2NU8B 2QJ1A 3GIJA 1R6KA 3RVZA 4B7KA 2DE0X 3K5MA 1S0OA 1JJOA 1KECA 4X64O 3OHAA 2CQYA 3BQ1A 3SYQA 2YEVA 2YI9A 4WFGA 2QWNB 2RDCA 4FFRA 2OIGA 4UXNA 2CTQA 1EN6A 5LMUB 2YIBD 3H4BA 4ZIBA 4O7ZA 4C5CA 5KUMA 2ZXWC 3BA9A 2WLMA 2QDOA 2XD4A 3WWHA 4O3PA 4UB8Z 2FK2A 3Q8PB 1K9MW 1M1KW 4RB1A 2AQ4A 3GQCA 2R9RB 2R7ZG 3OSPA 1IURA 1A3GA 4JYAH 2HDKA 4O7RA 4O4IF 2ZE6A 3R5FA 2W6QA 4O7LA 2OYQA 4QGPA 2ABJA 2Q73A 4I0XB 2JA5A 4DV6B 3N2GB 1IDSA 1MNGA 5EZYF 3SPIA 2AXTZ 4YAJB 2AHZA 1I7FA 2ZE8A 4G27B 4NXNH 1M57B 1YSCA 3MR3A 5EYPA 2RNBA 3CSXA 4F4ZA 4X64B 3L9DA 2DPJA 4DV3H 3F5TA 4LF9O 1M5IA 2IBZH 3RW0A 3SE7A 2RGRA 1A9XA 4UVAA 2YZMA 2WYOA 4IHJB 1JJ2U 3AG2B 2ASDA 5K1XA 1N32O 2UU9B 3JALA 4FK5C 1I5XA 2EJ0A 4JTAB 5KT3A 4JPRA 1DAAA 5KFOA 1EN5A 4HR7A 2ZNJA 5IYZA 2XAHA 4M7EA 4A3CG 4LFAO 2A1HA 2BTQA 4UCOA 3WB1A 4YY3H 1SCUB 1N33B 3HKCA 3TY5A 4R7CA 1I94B 4J9OA 2JA6G 4JV0A 3CEIA 5KA6A 1R9TA 3DC5A 2V4QA 3OE7G 3KALA 4O7VA 3FYEB 1KC8W 3CB2A 2GLTA 2WB1E 1S76D 3CWBH 4PHZA 4RUEA 2UXBB 2IP4A 2Z3YA 4QNHB 3R23A 1WJZA 3K3PA 4ZI7A 2YC0A 1KUQA 1NI8A 3T1YB 1X59A 4CBCA 4QW9A 3T4DA 3MHHC 4WFFA 2FK1A 4RUAA 4I55F 4AYBA 1XDCA 3Q8RB 2B1IA 4BY1G 5E25A 4J9PA 2W9BA 2AGOA 1VQNV 3ZMSA 4Z1VA 3KG2A 1EUDB 2R7LA 3JRWA 4UCTA 2ZXWB 1GH6A 4DLKA 5D5PA 1S10A 1OCOB 1H8HG 2ZM6B 1UJWB 4EBDA 2R8KA 5LOVB 1VQOV 2QK4A 3P3NA 2JA5G 2XOKG 3VNNA 2R92G 1B6QA 3ZN1A 3HPLC 1KMIZ 4XDKA 4IIJA 4O2BF 4BXXG 2Y48A 3T9FA 5JH7A 1FXHA 4EEQA 2PZSA 1B33N 4FBTA 1N0JA 2X7RB 2WTFA 4LF8H 2V59A 2PTMA 3HKEB 4MA5A 3ML0A 2OLSA 4TV8B 2EIJC 1GN2A 4DXWA 2YRWA 1SYXB 3GV5B 2FMLA 1G6UA 1URFA 4WFBV 4QIWE 3S24A 1IBMB 2GTSA 1XK5A 5LA6F 1MSDA 4GKJH 2VOBA 2UVVA 2E74B 2PI4A 1JLLB 4LFAH 1TVKA 4TOIA 5DGHA 1O9GA 4DV3B 4I50B 1NTKH 2GDSA 4LFCH 5LBQA 4FS2A 1BMFG 1A32A 2JGDB 3LDEA 2QEXV 1HR0O 4LCUC 4NZOA 4DV6H 3K5NA 3GIQA 3L74H 3VQXA 5JJJB 3JD4A 2Y4TA 4RQFA 1AJNA 2OWOA 1ZQ7A 4DV4H 4QSHA 2HG5C 3QWUA 2Y4RA 2KG7A 2JEUA 1SRYA 3JZ6A 2WLNA 4QWBA 1H2GA 4IR1A 4K0KH 2LW7A 4JZGA 4CS2A 2Q2UA 3N42B 4DL3A 3ABLB 5D1PA 4WHXA 3AK3A 3CXCU 2C28A 3M9OB 3U0ZA 1PL4A 4YXWG 4PBCA 5IYBG 4K3AA 3X2QB 2HGXA 3C3TA 4ICGA 2M05A 2ZINA 4P9OA 1S68A 5BMVB 2V9WA 1I3QA 1RFYA 1NT2B 5AG2A 2I8CA 1S72V 1VF7A 1P4RA 5GW7A 1PM9A 2QKAA 4FFOA 1E1RG 1KQSU 4BWSC 3E2EA 1VMGA 4X20A 4TV9B 4DV4B 2OH2A 2V4RA 3T2MA 4G3IA 3MJFA 3ETHA 1PX2A 3MAQA 3WNZA 4YQWA 4YBZB 2N74A 3T9BA 4UCUA 4DUZH 2R8GA 5KUKA 3V4SA 1VQKV 4WBNB 3T5JA 2LGQA 3GTOA 5FLXW 2ETNA 5LP6B 3R66A 5L3DA 3LSUA 2FPPB 2KSDA 2F1MA 4RUFA 3K5HA 3U0GA 4MTDA 4ED0A 5LMNB 1JKJB 5C4XG 3TGUH 2JEXA 4GKJB 1K97A 2W9CB 5LYJF 4BIUA 4JUZA 5GONA 4LF7H 3SDLA 1Y76A 3RB0A 4I7HA 4B3SO 1JPXA 5L1LA 5FPOA 4GZRB 4OPAA 3JATA 4FLUA 1H2KA 1K92A 2JVDA 3TJTA 4OPHA 5JVDA 4MV6A 4HBNA 4IAJA 5FL7G 1XL4A 4YJ3A 1WA8B 1C30A 4A3FG 3KKYA 1HR0H 3V6KA 3KXYT 4ECYA 5LYJA 1L0LH 4EEYA 1RP3B 4ED2A 5KLVH 1MMMA 2DABA 4WFAV 4GKKB 1VARA 3A8TA 1G2WA 1SESA 3O9OA 1WR2A 3T7AA 1MZBA 3JASB 1N32B 4IWYA 1RM1C 1H2NA 2YZGA 2ZCEA 3RB3A 4ECSA 4X1IA 4MW3A 2LQTA 3D3QA 3JYCA 5B3SB 2XHBA 5ITZA 4O3OA 1CEZA 2IW5A 2WA3A 4J10A 4DYLA 4ED8A 2E5LH 1HNWH 4PI2A 1UC8A 3LP8A 5I5YA 1R3JC 5IT9N 1X9NA 2CH7B 4Q4DA 2JK5C 3UM7A 4Q8FA 3WO1A 5B1AC 4DV2B 1DV2A 2NU9B 1I2LA 1CQJB 1KJQA 2ZKOA 4A2BA 4JZ2A 5DISC 2EX3A 3E5NA 3RTXA 3T9AA 4RB3C 1YJNV 1ORQC 2J6TA 2EIMC 3CRQA 3GIDA 3OMNB 1AVMA 2F43G 3D36A 2UUCO 1TWHA 5JUMA 2Z5UA 2CNQA 3T1YH 4J7JA 4PV1B 1XREA 1SF9A 2WAMA 4O84A 3KHLA 1AP6A 4MTEA 4E6NA 1RSOA 5J2TB 2RQ6A 2VR1A 5KHIA 4A5UB 1PPJH 4DW1A 1YIJV 4LFBO 2CZGA 2C22A 2I80A 5HV6A 2ZM6O 1J5EO 4UV8A 2YW2A 3DGEA 2Q0OC 3DXRA 1E4GT 1H8EG 4I7ZB 2PMZE 4X62H 4TUYB 4CH6A 3H1JH 1Y66A 2N05A 2UUAO 3HOXG 4AHCA 2VPQA 3OGIB 4JI4H 4XDJA 2J9GA 4X89A 1XUQA 5HFMA 3PW2A 2KQXA 1VQMV 1I2KA 5C93A 2UXBO 4O2AA 2GUZA 2Q9LA 2XTAA 1RK6A 3KTMA 1JFFB 2RJZA 2WLKA 3OM3B 1O75A 2B9ZA 5CA0F 1XMQB 1SS3A 5DG7A 2GUZB 3W7SA 1YVWA 4JAUA 1N34B 2IJKA 3G6XA 1GN6A 5LYJB 5FR9A 2A06H 2LJ2A 4JI8B 2R8JA 4NTWA 1XMOO 1LNQA 1AILA 2W71A 3CCRV 4TUYA 2B5UA 4YJ3B 3FMAA 4DUZB 3H3VH 1AR5A 2ADQB 2X0LA 5B3SC 4IIJF 5JVLA 5B1OA 4DR4H 3JATB 4DR5O 5EBMC 5KG1A 5BR8H 1EN4A 5KFIA 1BHBA 4J0MA 2QA4V 2YIDA 2RDIA 3G6EV 4I9QA 1Y76B 2C2AA 5DMXA 4ECVA 1RSOB 5J2TA 4JI3B 3SI8A 3SGIA 5BR8O 2W9CA 3G8DA 4ECXA 2H94A 5B1AB 4JYAO 3HB3B 4PWQA 5L1IA 1K4DC 3KCXA 1XEQA 4QWCA 5KFQA 3VPDA 4WBNA 5JQWA 2W0XA 5I47A 4RNMA 2M7WA 4DV5O 4QPKA 1S5HC 4OX9B 1ENVA 5KHHA 1TWGA 5IJ9A 4MVRA 2I87A 3UQ8A 1I0HA 1VEWA 5CA0B 2JS5A 1MABG 3TETA 4TV9A 4X20B 2CH7A 4YR2A 4CMFA 4B3TH 4IGGA 4ZHQF 1VQ5V 3RGXA 2DW4A 1Q43A 1XI1A 3ZMZA 2WB1A 3G4SV 2GPSA 2BR0A 3H40A 4IRDA 2P67A 2YYAA 1JVMA 1K8AW 5DEDA 1K33A 4FLVA 4B3RB 3WG7C 1WLEA 1CE8A 1AI7A 5KFZA 4K35A 4DR6O 1XL6A 5JCOC 1ZHQA 3WU2Z 5BMVA 4MVOA 5IYDO 1R1BA 1HW7A 1M4UA 1K5QA 4KHPH 5C8YF 4LFAB 5KFXA 1PNKA 3IJ4A 2V5AA 2DJVA 1Q6HA 1ZWIC 2E2HA 1EFRG 1S5JA 5CBGA 2HEPA 2WLJA 4H44B 4QJFA 3HKZE 5BY1A 1I1LA 3VMMA 1WA8A 3CX5F 4YIOA 1GLVA 3G6YA 1HNXB 2IM9A 4IYHA 1SEIA 5JVDB 2Q7DA 1VQLV 4B3RO 3U9SA 2HHHO 4U7OA 3ORRA 4FS1A 2Q4PA 3TY9A 1UFIA 5KX5A 1Q90D 2V58A 1K1QA 3T1YO 4O4IA 5H6RA 5GONB 3ZRWB 1QHTA 5H80A 4XDLA 1VQ8V 5KA5A 1TVKB 4CZZA 3NC0B 3N27A 3KAKA 4DV6O 3PW4A 2XASA 3RN4A 3CCVV 4LF4O 1KJIA 4AQYH 2UUAB 1K7DA 2NVYA 3M4IA 3AG3B 2WDTA 4DR1B 5LP6A 1R73A 4DV5B 3CRMA 3JARB 1N36H 2Q69A 3FB5C 1AB3A 3VOUA 3HKEA 5BPHA 2ZDIC 2YXHA 4DV0H 3U55A 1HP8A 2RF4A 5DGAA 4LR3A 2R92A 4QWAA 1DV1A 3HOUG 2LO1A 3KHGA 4PDBA 1IX9A 3LQSA 2F66C 2EJRA 3FFQA 5LHGA 1NJIW 4Q20A 3QFFA 2PI5A 1IOWA 4Q0YA 2XC9A 4RU9A 1MA1A 1NR1A 2VRZA 4FFKA 4MVUA 1I94H 2UUCB 2BTOA 4J9MA 3D8CA 3SYOA 3ZN0A 4RB2C 4J9LA 4MV1A 1W96A 1XOUA 4AILC 4IT5A 3RVYA 4ECUA 1YEWA 3CS5A 1BNCA 4B3RH 4BW5A 2OTJV 4F4WA 5GTHZ 2UU9H 2VQEB 4JI3H 1MSWD 5KG7A 4IYIA 2W6IG 1H2LA 2YL2A 3W5OA 4Q44A 1WB8A 3OEEG 2OCCB 2X6CA 2C2DA 4BY7G 4YR0A 2RCVA 5DQHA 4UV9A 4O81A 3L2PA 4UFZA 1SQGA 2Q5ZA 2Q67A 3HKCB 1THZA 2IBKA 5IYDG 2JGDA 1Q5OA 1J5EB 2HJFC 2ASLA 1BS3A 3GTQA 1AN7A 3H20A 2DYRC 3JALB 4QE9A 4IHJA 3R5XA 2Z02A 4FZ1A 1VQPV 4O3NA 4FM2A 2W6OA 3N2KA 4E2LA 3FB6C 4DR6B 2C2RA 4DV7O 3GIIA 4MVSA 1SQPH 1YJ9V 5CBFA 1Z2PX 4MS2A 3G6VA 1QVFU 2ZR3A 4TV8A 2P5OA 2VA3A 4JI2O 2EIJB 4DL4A 3V6HA 4MA0A 5C1OA 1PKXA 2HVKC 3CJHA 2HJDA 3BABA 4J42A 1LR1A 4MV3A 1NKDA 2P4VA 3E35A 3N2GA 4FE2A 3TXSA 3IG0A 1BGWA 3OHBA 1BL8A 3JSLA 1EM1A 2Q7EA 2JJ1G 2Q7GA 4JI2B 5LOVA 3APQA 2W6PA 1IBMH 3CD6V 1VAJA 2EULA 5KT2A 4FPPA 1ROPA 4HZ3A 1D2DA 3AYHB 3WB2A 4MSWC 4PDLA 3PR5B 1VQ7V 1VQ4V 4A2AA 1OCCB 4TQDA 1OCRC 3UO2A 5KFRA 2QTSA 2ZR2A 1BHAA 5F9NA 1JA8A 1Y74A 1HNZO 1R6NA 2FKLA 2YEVB 1WN7A 3LUTB 4YHHH 1XNRH 3JRXA 4DR7O 3SPHA 4Q8EA 1XQ8A 3HO8A 2WSSG 4JXUA 5EC2C 5C1PA 3X2QC 1V4YA 3T1HO 4DV1O 2ALZA 4RNNA 5IWAB 3T5LA 4NR1A 4R8UA 2FKXA 1ZL8B 2C00A 4AQYO 5E1AC 5CAEB 1M0TA 3LULA 4O2BB 3UT5B 3ABUA 2XUMA 1PV0A 5LL6Y 4DR1H 3RB6A 1GRJA 3MR2A 3JD0A 3FKIA 5BPFA 4EKWA 2V7QG 1FXKB 4DR2H 4IRCA 3RGZA 4NVPA 4EYHB 4X62O 3SNOA 3E8HA 2FL4A 4DK1A 2FK3A 5FNVF 3TIIA 5KG6A 2DWDC 3GIPA 4ASUG 4B7EA 2N04A 1Y1VA 1HR0B 3RAQA 2ZNIA 4FIPC 1L1FA 1PD3A 2DYSC 1K3EA 3GLKA 2DQ3A 2VPSA 5FJ8G 1N33H 3FB7C 2PMZA 2P6JA 3ZHQA 4NZMA 2E75B 1M7JA 2A0LA 4PDMA 3IAYA 5KFLA 4TVIA 3HOZG 3B40A 4LSXA 2UVRA 1GAXA 4J9QA 3ASOB 3JAWB 4U3FH 3BJYA 4F6RB 5FLMG 5LGTA 4E4EA 1N33O 2YS8A 2A7WA 4ZKIA 5C8YB 3FAVB 1IXMA 2ZDQA 5KG4A 4DL6A 3N6RA 1QLNA 2CGNA 2YXLA 3QO8A 2R9AA 4DR2B 3T4ZA 2HLDG 1NZ6A 1OCCC 3ZBHA 5LOVF 4B3MB 3ICXA 3GTPA 3ABTA 4DV1H 3TINA 1IYEA 4C5AA 4L1KA 3DSQA 1J95A 2JRIA 2CFMA 1KJJA 2RN9A 4LF7B 2R93A 5LL6b 5CM0A 3H9VA 3W7WA 5IJ0A 2BSKA 5BZBA 3K03A 2HIVA 3N6XA 5IT9W 4FLYA 1YZBA 2IA6A 3NBYB 4LNUA 1UC9A 4G28B 3JAKB 4NZNA 2Q68A 4BIZA 4JV5O 3TCUA 2E76B 2ZE5A 5FNVB 5IYCO 2UU9O 2AGPA 3U10A 2IU0A 5KHGA 1FKAH 3HXLA 4M0JA 1XHZA 3CCSV 4P9PA 2P7TC 4LWSA 4O3SA 2Q0AA 1VF6C 5JQGF 1TUBB 1L8DA 2QE7G 2V1DA 1NBMG 1M93A 4X8AA 1RJQA 1GMGA 5KFEA 5IE9A 5KFVA 3WB0A 3ZMUA 3P30A 2EIMB 3RGBA 1W0KG 4DR5H 5KAIZ 2ZJTA 4FJCC 2EILB 1B6SA 2PVPA 2CNUA 1Y1WA 2ILMA 1F23A 4FMTA 1SKVA 4EFEA 4O4JB 3M9MB 3PO3G 3MWEA 4ZOLB 4A3IG 2H3OA 2ATKC 2HJWA 3NXSA 3HKDA 1JIHA 3JD1A 2JDIG 5KFMA 4TQRA 1SETA 4KXRA 4EB6A 3H0GA 4PDRA 5L3BA 4X66B 3CRRA 4TT3G 5B66Z 1SERA 4UCRA 3MD0A 4ECQA 1FJGH 4LFCB 5KFSA 5JJEB 3WWIA 1V55B 4H13B 4C5BA 2JEIA 1KEEA 3UZBA 3V4ZA 1FPOA 3B77A 2CTWA 1R3IC 4FZ0A 2RMKB 4K8XA 1U96A 1TUBA 2GHYA 2ZD9A 1E1QG 2VUGA 1JXLA 4XBFA 4FFBB 5KFUA 4DV0B 2R72A 1N56A 1MOFA 2GQSA 5FNVA 1QBZA 1IBLO 2AHYA 5DGBA 4D6TH 2PYJA 1ET0A 1M56C 1KYOF 4LNUB 4O3RA 4QIWA 1VBHA 1OWTA 3K04A 2QWQB 2IJIA 2WAQA 3RBEA 2BSKB 5HFLA 2LFRA 2HHHB 3OUFA 5IYBO 4J11A 4BAYA 3H4DA 2YUAA 2D2CB 5B1BC 2YWVA 4Q43A 3KREA 4YY3B 5H2FZ 3H1LH 3K0GA 4WFEA 1FFTB 3BRCA 4DIMA 4RB0A 3ASNB 2D3OW 1T3NA 3RWRD 4XZ3B 1S0NA 4EB6B 2Y69C 5IDJA 1AUVA 4IZOA 1AI6A 5FD6A 4DQNA 4TQFA 3RJ0A 5C8YA 4DV5H 3RYCA 3K5IA 2X6AA 4GLWA 4XYLB 1XNRO 4F6RA 2R7MA 3JSNA 3T9DA 4RO2A 4I4TA 4O4LA 4X1KA 1OBGA 2EINC 2CK3G 5DLFA 3WG7B 2Y4UA 1AI5A 4B3TO 3R5HA 1WCMA 4B3SH 3W1BA 2QWRB 1WSCA 5L1JA 4LH7A 2YDEA 3RUPA 2HHFA 3GTLA 2FLLA 1K73W 2JA7A 4LF5B 3G8CA 4X66H 2QM8A 1N48A 4JYCA 1JX4A 3M7MX 4NXMB 5IWAO 1FS0G 3ZS8C 1AJQA 4WF9V 1XDNA 1N0NA 2UVUA 2IU3A 4JYAB 2E2IA 2Y0SA 5LMNH 1RYRA 4DRFA 3THOA 4CH4A 4LWSB 4OXSA 4WBNF 2NNUA 1UNNC 4KHPB 4O83A 2YZNA 3U54A 3OGCC 4ME6A 3PW5A 1IBMO 1C3OA 2EIKB 1EKPA 3T5KA 3I12A 3HKZA 3J80W 1AJPA 1CS0A 4DW0A 3E22B 1T36A 3K5OA 3W7XA 3MR5A 2R7ZA 2GBOA 5DAAA 1GM7A 2V4DA 5CB4B 4YJ2A 5LXTB 1PK8A 3KAJA 4JI5H 1M56B 4Q6GA 4R8UB 3BQ2A 1YDXA 2X6BA 3TQ1A 2QF7A 1YF2A 1VS0A 2MW2B 3K79A 3AG3C 3PZPA 4JI6B 1CQIB 3PJSK 3AX6A 2QYZA 1V51A 4YJ3F 5B1BB 2UXNA 1EYZA 4X65B 4R7RA 4DR7H 4KP4A 1FFXB 3ZHRA 5LMNO 2J6UA 4OX9H 2VA2A 1S3JA 1A0IA 1CKMA 2W6MA 4HYKA 3W7TA 2Y69B 1B6RA 3EXAA 4JI1H 4YR3A 2HR3A 4KL1A 1Q6UA 4DRXB 3CCEV 4JTDB 2W0FC 4FM9A 1GSHA 3CCLV 2XNDG 3L4KA 3HBLA 4UCSA 4EGJA 5BYBA 1E4FT 4FGRA 3ETJA 1S03G 2DOSA 2F4VB 1ZETA 1DF4A 5KG0A 1VQ9V 5KFDA 1Y1WG 3BAAA 2ZDHA 1WNSA 3HT5A 4MTOA 2W7OA 3OAAG 5IY5C 1FD9A 4HN2A 5EBWC 5JQGA 2XAGA 1YI2V 3VA7A 2COIA 4NTXA 4I9WA 4JI8H 2EBOA 2EZPA 2OCCC 4DR3B 3CC4V 1EUCB 4W4LA 4IRKA 1YHQV 3RYFB 1QNMA 3L70H 1R3KC 4J80A 3CCMV 2EZOA 2QM4A 5LA6B 3CYOA 1FVIA 1FXKA 4O7WA 2WLIA 2Q2TA 3RT3C 1E4EB 5JH7F 2E5LO 1HNWO 4HNTA 4RNOA 3OTOO 1NR7A 2XAQA 3UT5A 3OFNG 1IVSA 4O2BA 4PA3A 2EIKC 2R6FA 2DYRB 2R9IA 4PZ6A 3ZX6A 4D7TA 2Y0IA 2ZIOA 2HVRA 2G38A 1LUVA 3FYIB 4HNAA 3K08A 2DAAA 2EJ2A 4YJ2F 3GIMA 2B63A 1HDJA 3T9CA 4ECTA 1B06A 3ZHUA 2E5LB 1HNWB 1GGOA 3I4NG 1KUTA 4GX2A 3W7UA 4I4TF 4O4LF 5I5WA 1Y74B 2ZM6H 1IZ3A 2ADPA 3ZMTA 1XNQO 3CVZA 2R70A 1H2SB 3C0FB 4MTFA 2VQDA 2YZLA 2ODTX 2YRXA 4MVMA 3MWDA 1OCZB 4KUMA 3OW2U 5IWAH 3ABMB 3AG1B 3OTFA 1I94O 3JAMW 4GKKH 1V9PA 2GQRA 4JI0H 1OBDA 3S3WA 1ZSPA 4YHHB 2R84A 1EZJA 1XNQH 1V54B 1OCRB 3RFCA 4ZHQA 2NUAB 3OEHG 4G2KA 1ZX3A 4NB5A 3MFHA 4E4TA 3CJHB 4F4LA 4GUNA 2HP8A 1X4TA 4KFMA 5H6QA 2QTOA 4LF9H 5K3WA 5GONF 3FX7A 2DLNA 5JWPA 2P0AA 1KD1W 1VIBA 3GWKC 1Q6IA 3N2KB 3GWOA 3KZIZ 2R7NA 2X0SA 3ZHTA 1N32H 5CA3A 3SR2C 3RFRA 4QPJA 3ZMVA 1BT8A 3N43B 3GB8B 2Z0AA 3ZRWA 4J9KA 1QU7A 4QW8A 4O4IB 3GJXB 5J2UB 4DR3H 4O7NA 5D8DA 1A48A 2YS6A 5KX5B 3KHHA 4EBEA 2AGQA 2JA6A 2ZGIA 1FXKC 3PW0A 1KBHA 5BWRA 3ETGA 2VQFB 5KT4A 1W0JG 3SJBC 4UB6Z 4L8JA 4QJFB 1SQVH 2ZDGA 4X66O 4CE5A 3DTGA 3M99B 5KFCA 3F7YC 3QQMA 4JI1B
chains in the Genus database with same CATH topology
3N42B 4CS2A 2Q2UA 3BHPA 3KYHC 5D1PA 4DR2H 4LFBH 3RGZA 4NVPA 3QG5A 3U0ZA 2UXBH 5LA6A 3LNNA 4DK1A 3GDEA 1SA0B 2ZINA 1WPBA 3RYFA 5BMVB 1S68A 1NT2B 1HR0B 1HNZH 1VF7A 5LMUH 4DK0A 2ZNIA 2PGGA 2F93B 2VPSA 1N33H 4BWSC 3PN1A 4O4HB 3RYHA 3QF7A 4X20A 4DV4B 4TV9B 4FLTA 3IAYA 4B3MH 4LSXA 4PZ7A 3MAQA 1DGSA 4DUZH 4UCUA 4DR1H 3JAWB 4DRXA 4I4TB 4O4LB 3A2FA 3JARA 4X1KB 2Q7HA 4F6RB 4WBNB 3W1GA 3F8NA 5FLXW 5LP6B 2UXCH 3B2EE 4I55A 5C8YB 2F1MA 3HKBB 5K1PA 1T5EA 4MTDA 1XMQH 1D5AA 5LMNB 2HVSA 2YXLA 4GKJB 2R9AA 4DR2B 4LFBB 4U3JA 5GONA 4LF7H 4B3MB 3ICXA 4I7HA 2F4VH 2HGSA 5FPOA 4DV1H 4JV5B 4JV5H 5EIBD 3JATA 4FLUA 2VWKA 3DSQA 2JVDA 2CFMA 5KMGA 5LP6C 3TY8A 4LF9B 5JVDA 4HBNA 4LF7B 4IAJA 4NXMH 1TGOA 4YJ3A 5LL6b 4LMYA 1CKNB 5JCOA 5IJ0A 1HR0H 1P16A 2HIVA 3KXYT 5LXTA 5CB4A 3N6XA 5IT9W 4FLYA 5LYJA 4B08A 3NBYB 3E22A 1Z5WA 4LNUA 2UXCB 3JAKB 4GKKB 2YIBA 1GYFA 5FNVB 1MZBA 3JASB 3U10A 1N32B 5KHGA 1P8LA 4X1YB 4O2AB 1XHXA 1XHZA 3HXLA 1FKAH 5CA1B 2ZCEA 2FE3A 2UXDH 2Q0AA 4X1IA 2HIXA 5FD5A 1TUBB 2PUSA 1L8DA 5ITZA 2XHBA 2KSWA 4JI2H 1Z2OX 1M93A 4CS3A 4FLWA 3WB0A 2E5LH 1HNWH 4PI2A 5EZYA 5BR8B 2HHHH 3RGBA 4DR5H 3VQYA 1X9NA 1SQFA 2ZJTA 4LSAA 3T1HH 5CA0A 4DV2B 4JI0B 5IJ9B 3L4JA 1SKVA 4EFEA 4O4JB 4A2BA 3HKDB 5DISC 4ZOLB 2EX3A 2PY5A 2E3CA 4K0KB 3RTXA 4RB3C 4DV7H 3RYCB 2UXDB 3HKDA 4MV7A 4O4JA 3T1YH 2UUBH 5FPRA 4EB6A 4MTEA 3J7AK 2VQFH 4E6NA 1RSOA 5J2TB 2RQ6A 1KU9A 4X66B 2YI8A 5KHIA 4UCRA 3QTCA 5D5QA 1FJGB 1FJGH 2KKWA 4LFCB 5JJEB 3RIZA 4CC6A 1E4GT 4X62H 4TUYB 4CH6A 4FLZA 4K8XA 2RGVA 3RF2A 1TUBA 4AHCA 2VUGA 4JI4H 4PI0A 1XMOB 1Q8IA 4DR6H 4CC5A 4DV1B 4FFBB 2YIAA 4DV0B 4O2AA 3RYIB 4EFBA 5EIBC 2R72A 4EQ5A 5FNVA 3SJAC 1JFFA 3DF7A 1JFFB 2RJZA 4FVMA 1O75A 1N36B 1XMQB 3RYIA 1N34B 2PYJA 1O9HA 4LNUB 4FFBA 4DV2H 5LYJB 4MV9A 1ZAUA 4JI8B 2UUCH 4AQYB 4UCVA 5IJ0B 4ETSA 4JI7H 4DR5B 1CKNA 4TUYA 2HHHB 1WH2A 4YJ3B 3FMAA 4DUZB 3T1HB 5KMGB 4RAZA 4DR4H 3JATB 4YY3B 5BR8H 2ZIMA 4J0MA 3BRCA 4RB0A 3OTOH 4LF4H 4I9QA 5J2TA 1TA8A 4JI3B 4U3JB 3RWRD 2JGUA 3SGIA 4EB6B 3K59A 2XIGA 5FD6A 3U11A 3HKBA 4TQFA 3RJ0A 5C8YA 1IBKH 4DV5H 3RYCA 5KHKA 1ZHSA 4F6RA 4ZOLA 3JSNA 4WBNA 4I4TA 4O4LA 4X1KA 5A2QW 3JAWA 4OX9B 1TAEA 5KHHA 5KHJA 5IJ9A 4B3SH 3W1BA 4NXNB 4CH5A 2HVQA 4LH7A 3UQ8A 4DR7B 4X65H 5CA0B 2JS5A 1I6UA 4TV9A 4X20B 2O03A 4B3TH 4LF5B 3N41B 4X66H 4K8ZA 3RGXA 1Q43A 4O4HA 3RYHB 3M7MX 1XI1A 5EZYB 4JI6H 4NXMB 1B04A 1HNXH 3ZS8C 4GLXA 2VQEH 1XDNA 5EOYA 4FLVA 4BWAA 4B3RB 4JYAB 4CS4A 5ITZB 3BA8A 5LMNH 4CH3A 2P22C 4LF5H 4DV7B 4DRFA 4X1IB 3THOA 4DUYH 3VQVA 4CH4A 3N44B 5JCOC 1ZHQA 3N40P 5BMVA 3K58A 1XNRB 4LH6A 5CA1A 2YCHA 2UUAH 4B3SB 1HW7A 1M4UA 4X1YA 5JJNB 3JASA 4X64H 4KHPB 4KHPH 4LFAB 4FM0A 3MWMA 3JAKA 3J80W 3E22B 2CAZC 1Z5VA 1S5JA 3K5OA 2V4DA 2HEPA 5CB4B 4YJ2A 5LXTB 3KAJA 3J81W 4JI5H 1P49A 4GYCB 3CHXA 4Q6GA 1VS0A 1HNXB 2IM9A 5D1OB 1SEIA 2QJ1A 5JVDB 3K5MA 4LF8B 4JI6B 1JJOA 3TY9A 5KX5A 2YI9A 4O4IA 1XNQB 4X65B 4R7RA 5GONB 4DR7H 1QHTA 3NBZB 1TVKB 2YIBD 5LMUB 1FFXB 1HNZB 4APMA 3NC0B 4ZIBA 3KAKA 4OX9H 3RR5A 1A0IA 1CKMA 3BA9A 4AQYH 2UUAB 3M4IA 4I55B 4RB1A 4FM1A 2WDTA 4DR1B 5LP6A 4JI1H 4DUYB 4DV5B 4KL1A 3JARB 3K3VA 1N36H 4JYAH 4DRXB 3HKEA 4FM9A 2OYQA 3LMLA 4D7SA 3L4KA 1QQCA 4DV0H 1BJTA 4UCSA 1E4FT 5JH7B 4LF4B 3OTOB 4LR3A 1S03G 4DV6B 3N2GB 2F4VB 4B3TB 2GV9A 4PZ8A 4PDBA 2F95B 2F66C 3BAAA 1WNSA 3FFQA 3SJCC 1I7FA 1IBLH 4NXNH 5EYPA 3CSXA 4Q0YA 4X64B 5JQGA 4JI7B 1JMKC 4LF6B 1I94H 3EYYA 2UUCB 2BTOA 4JI8H 4DR3B 4DV3H 1CKOA 4RAYA 4RB2C 1M5IA 3RYFB 1IBKB 2RGRA 1SA0A 4AILC 2WYOA 1YEWA 4IHJB 4B3RH 5LA6B 2QM4A 5K1XA 2UU9B 3JALA 4RZQA 1FVIA 2UU9H 2VQEB 2Q2TA 4JI3H 3VQWA 2ZNJA 3ETQA 5IYZA 4M7EA 3UT5A 4HNAB 2BTQA 4UCOA 4O2BA 3WB1A 3W5OA 2CW8A 4YY3H 1N33B 3HKCA 3TY5A 2VWJA 1I94B 3ZEDA 3L2PA 4PZ6A 4UFZA 1SQGA 4D7TA 3BPZA 3HKCB 2ZIOA 2HVRA 2PYLA 3KALA 2MCTA 1Q5OA 4HNAA 3CB2A 5IYZB 2WE6A 4I50A 1J5EB 2E5LB 1HNWB 5J2UA 1N34H 4PHZA 2UXBB 1AN7A 3H20A 2ZM6H 3JALB 4ZI7A 3CVZA 4IHJA 2R70A 3T1YB 1H2SB 3C0FB 4FM2A 3N2KA 2W57A 4DR6B 1J5EH 4UCTA 1Z2PX 5D5PA 4TV8A 2P5OA 4JI4B 5JQGB 2ZM6B 3K57A 4DR4B 5LOVB 5IWAH 3OTFA 3VNNA 3JAMW 5EYPB 4GKKH 1V9PA 4JI0H 1KMIZ 4IIJA 4ZHQB 1XNQH 3BABA 4YHHB 1Z2NX 3N2GA 4ZHQA 5JH7A 4IIJB 4EEQA 2PZSA 3IG0A 4LF8H 1BGWA 1X4TA 2PTMA 3HKEB 3JSLA 2Q7EA 2Q7GA 4LF9H 4JI2B 5LOVA 1Q3EA 1IBMH 4TV8B 1SYXB 1G6UA 4JI5B 1L2ZA 4FLXA 3WB2A 3S24A 3N2KB 1IBMB 1XK5A 4A2AA 4GKJH 4TQDA 1XMOH 2VOBA 1N32H 1M0WA 3SR2C 3RFRA 4LF6H 4X62B 1FFXA 4ZI7B 4LFAH 1TVKA 4TOIA 3N43B 3GB8B 1O9GA 4O4IB 3GJXB 5J2UB 4DV3B 4DR3H 4I50B 4LFCH 1WN7A 4BW9A 4YHHH 1IBLB 5KX5B 1XNRH 1XQ8A 4DV6H 5D1OA 3K5NA 2VQFB 3VQXA 5IWAB 2CW7A 5JJJB 2UUBB 3SJBC 2OWOA 4L8JA 4DV4H 4YJ2B 1M0TA 3QWUA 4O2BB 2BTQB 3UT5B 3K5LA 4K0KH 4JI1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9N A;  2UU9 B;  2Q2U A;  3KYH C;  1FVI A;  5D1P A;  2VQE B;  2Q2T A;  4LF5 B;  4DV2 B;  4JI0 B;  3GDE A;  4UCO A;  4EFE A;  3W5O A;  1S68 A;  4NXM B;  1B04 A;  4GLX A;  1N33 B;  1XDN A;  3TY5 A;  1I94 B;  5DIS C;  4B3R B;  4K0K B;  1HR0 B;  4JYA B;  3RTX A;  3BA8 A;  3L2P A;  4PZ6 A;  4UFZ A;  4DV7 B;  2UXD B;  4DRF A;  2HVR A;  1XNR B;  4LH6 A;  4B3S B;  3PN1 A;  5FPR A;  1J5E B;  2E5L B;  1HNW B;  4KHP B;  4E6N A;  4DV4 B;  2UXB B;  4LFA B;  4X66 B;  4UCR A;  3T1Y B;  1FJG B;  4PZ7 A;  4LFC B;  1DGS A;  4UCU A;  4DR6 B;  4CC6 A;  3W1G A;  4UCT A;  2VUG A;  4JI4 B;  1VS0 A;  1XMO B;  2ZM6 B;  4DR4 B;  1HNX B;  5D1O B;  4LF8 B;  3VNN A;  4JI6 B;  1V9P A;  4CC5 A;  4DV1 B;  3TY9 A;  5LMN B;  4DV0 B;  2HVS A;  4EFB A;  4GKJ B;  4DR2 B;  4LFB B;  4EQ5 A;  3BAB A;  4YHH B;  1XNQ B;  4X65 B;  4B3M B;  3NBZ B;  1N36 B;  5LMU B;  4EEQ A;  1XMQ B;  1HNZ B;  4DR7 B;  3NC0 B;  5FPO A;  1N34 B;  4JV5 B;  3RR5 A;  1A0I A;  1CKM A;  3BA9 A;  3JSL A;  1ZAU A;  2CFM A;  2UUA B;  4LF9 B;  3TY8 A;  4JI2 B;  4JI8 B;  4AQY B;  4LF7 B;  4UCV A;  4DR1 B;  4DR5 B;  1CKN A;  4DUY B;  4DV5 B;  2HHH B;  1CKN B;  4JI5 B;  4DUZ B;  3T1H B;  1P16 A;  2HIV A;  3S24 A;  1IBM B;  1XK5 A;  4YY3 B;  3NBY B;  2UXC B;  4UCS A;  4X62 B;  4TOI A;  4GKK B;  4LF4 B;  3GB8 B;  3OTO B;  4DV6 B;  2F4V B;  1TA8 A;  4JI3 B;  4DV3 B;  4B3T B;  3GJX B;  3SGI A;  1N32 B;  4PZ8 A;  1P8L A;  3BAA A;  1IBL B;  5D1O A;  2HIX A;  4X64 B;  2VQF B;  4JI7 B;  5IWA B;  4LF6 B;  2UUB B;  2UUC B;  3JSN A;  4DR3 B;  4LH7 A;  2OWO A;  1CKO A;  4OX9 B;  1TAE A;  3QWU A;  1IBK B;  5BR8 B;  3W1B A;  4NXN B;  2HVQ A;  4JI1 B;  3UQ8 A; 
#chains in the Genus database with same CATH topology
 1GM9 A;  2DYS B;  4LFC O;  3BHP A;  4W4K A;  4X88 A;  1FJG O;  5DQI A;  2R8I A;  3MHS C;  3OUU A;  3GDE A;  1SA0 B;  2IH1 C;  1AUX A;  1NTM H;  4X9Q A;  4P30 A;  4QWE A;  1PNM A;  4AI8 A;  1R6T A;  3SYP A;  3B8M A;  2ODM A;  4BBR G;  3ASO C;  5LMU H;  4DK0 A;  1RPR A;  3UO3 A;  4O7Y A;  2QGN A;  4PD4 F;  2JA7 G;  1OV9 A;  2PGG A;  4JYY A;  4TV9 F;  5CMU A;  2F93 B;  3GTJ A;  1Y67 A;  4DO2 A;  1EZV H;  1OCZ C;  3IN5 A;  4O4H B;  2PF4 E;  2CUG A;  1US6 A;  4B3M H;  1QCE A;  3CE2 A;  3PFF A;  3OMI B;  2R93 G;  1V54 C;  2VQE O;  4HYO A;  4PA7 A;  4TV8 F;  2P90 A;  3J7A U;  3BFR A;  3A2F A;  3JAR A;  3AG4 B;  3EFF K;  4LBE C;  4PA4 A;  2UXC H;  3G71 V;  3B2E E;  1ARO P;  4J7K A;  2CE4 A;  4I55 A;  3FDS A;  3KCY A;  3QZ8 A;  4JI5 O;  3HKB B;  1Q81 W;  1T5E A;  4R50 A;  1F7Y A;  1D5A A;  2WAQ E;  1XMQ H;  3CCJ V;  4A3B G;  3R9R A;  2DQ0 A;  3T99 A;  2M6Y A;  4U3J A;  2AU0 A;  4ECZ A;  4TWK A;  3OUZ A;  3QNE A;  3CPW U;  2BE3 A;  1F4N A;  5BMV F;  2HGS A;  4J7Z A;  4TUY F;  1GN3 A;  5TIS Z;  1COW G;  3DAA A;  4JV5 H;  2K1E A;  4LF9 B;  2RDJ A;  2EJ7 A;  2GPW A;  4NXM H;  3E86 A;  1HNX O;  1TGO A;  3BVO A;  4LMY A;  1BQ0 A;  5C44 G;  1VF5 B;  3L71 H;  3FKI G;  5I5V A;  3TEK A;  4O82 A;  5KFA A;  2QM7 A;  3K06 A;  4DR1 O;  1NH2 D;  4LF5 O;  1K83 A;  1DIK A;  3M9N B;  1YTF B;  1ULZ A;  3P32 A;  1GYF A;  3Q4H A;  2DIK A;  4EGQ A;  4X1Y B;  4O2A B;  2QB5 A;  3K0D A;  1Y1V G;  5CA1 B;  2EIL C;  2MK3 A;  4UVB A;  1KBL A;  2FE3 A;  2VUM G;  2HIX A;  2F23 A;  4TM5 A;  5FD5 A;  4CKB A;  2KSW A;  2R87 A;  1NVP D;  1LUW A;  2YSU B;  4BBS G;  1KT8 A;  4CS3 A;  4FLW A;  3H0G G;  1QR8 A;  5K2M A;  5EZY A;  2HHH H;  4C7U A;  4O86 A;  4F50 A;  3CMA V;  4CKE A;  2A9H A;  3STL C;  3VOT A;  2FB5 A;  3T1H H;  5CA0 A;  1IBK O;  3OD4 A;  3JD3 A;  5EBL C;  1QLE B;  1T94 A;  4JI0 B;  1KP3 A;  5IJ9 B;  2QR4 A;  3L4J A;  4HNV A;  5B5E Z;  2QKC A;  5H9C A;  2NLJ C;  4GX1 A;  1I7L A;  2CDY A;  4RAI A;  4EYI B;  3H1K H;  2O57 A;  2JEG A;  4YB8 B;  3TXQ A;  1V55 C;  3ETD A;  3RBD A;  5I5X A;  1NVP B;  4DL7 A;  2W9A A;  3H1H H;  4QIW F;  5CBH A;  3D3I A;  4LF7 O;  1SZT A;  5DLG A;  1CPY A;  4CKC A;  2UUB H;  1VF6 A;  5FPR A;  5KFN A;  4RZR A;  4PEL A;  1KC7 A;  5A2Q N;  1PL0 A;  1K34 A;  5I5S A;  3T1C A;  2L6L A;  5E79 Z;  3PVX A;  3QTC A;  1L0N H;  4J9Y B;  1M9N A;  1FJG B;  4DR2 O;  2KKW A;  3Q8S B;  1W2B U;  3GTM A;  1HWY A;  2EIY A;  4DUY O;  3GVM A;  3C90 A;  4DUZ O;  2IJJ A;  4U7N A;  1JR9 A;  2RGV A;  3RF2 A;  4FLZ A;  3OSN A;  3MR6 A;  1XMO B;  5KS8 A;  4ED3 A;  1NTZ H;  4JI8 O;  4DR6 H;  2P06 A;  1SFO A;  3SJQ C;  4CC5 A;  2VQF O;  5LMU O;  2W6Z A;  4FU0 A;  4UUG A;  2YIA A;  5KFT A;  3SPC A;  3RYI B;  1G1X B;  5EIB C;  1S97 A;  3Q4H B;  1JFF A;  4NTY A;  3SJA C;  1GSO A;  2SCU B;  1EZ1 A;  3DF7 A;  3JZI A;  4FVM A;  1N4C A;  3RYI A;  1TWF A;  1O9H A;  5KFB A;  4HNU A;  5BWV A;  3ASN C;  2FTK A;  2K9P A;  4A3L G;  2NVX A;  3AK2 A;  4UCV A;  1SQQ H;  4JV1 A;  4ETS A;  4DR5 B;  3EPG A;  4O2A F;  2DN9 A;  2GSM B;  3DXR B;  4MVZ A;  2C35 B;  1YCI A;  2JEJ A;  4LF6 O;  3M8A A;  5KT6 A;  4RAZ A;  4JI7 O;  4YHH O;  1YIT V;  4JAV A;  2EIN B;  5KT7 A;  4GC6 A;  2NU7 B;  1S0M A;  4U3J B;  2FYU H;  2JGU A;  4F6E A;  4M9U A;  3K59 A;  2WWW A;  3HR0 A;  1Z2G A;  1DK1 A;  1IYD A;  1FKA O;  3VBB A;  3HOY G;  4DR3 O;  3U11 A;  3HKB A;  1IBK H;  3ORQ A;  2UXD O;  2KB1 A;  1SQB H;  5EWF A;  5KHK A;  1ZHS A;  4A3K G;  1N8R W;  3S3X A;  5KFK A;  1AR1 B;  3EVK A;  3BY6 A;  5A2Q W;  3RV3 A;  4J9R A;  4CHI A;  3WWJ A;  1VP7 A;  1TAE A;  5KT5 A;  3NGD A;  2F4V O;  1KP2 A;  4N23 A;  3LSS A;  4CH5 A;  4DR7 B;  4X65 H;  1AR4 A;  3MFI A;  2QWO B;  3ZRS A;  5EK0 A;  3ABK C;  1RPO A;  2O03 A;  5CE8 A;  2JEF A;  4O4H A;  2BQ3 A;  4ZBM A;  1I1K A;  2ZT9 B;  5EZY B;  4ECR A;  5HBR B;  4JI6 H;  2LFS A;  2JS3 A;  3G6B A;  2VQE H;  2HKO A;  5L1K A;  4LP8 A;  3B4S A;  5EOY A;  1EKV A;  4BWA A;  4LF8 O;  2YXY A;  5ITZ B;  3BA8 A;  4CH3 A;  3P3P A;  4LF5 H;  4X1I B;  4DUY H;  4CMD A;  3VQV A;  2DMX A;  3N44 B;  3I4M G;  3K58 A;  3VPC A;  4LH6 A;  5CA1 A;  4ZQI A;  2YCH A;  2UUA H;  4B3S B;  3GV7 B;  5L3E A;  4X1Y A;  3FB8 C;  4XX0 B;  3JAS A;  5CR5 A;  3GIL A;  3E89 A;  2BOC C;  2R7K A;  2WA4 A;  2CKZ B;  1BGY H;  3K9A A;  1VBG A;  3MWM A;  4N21 A;  5LGN A;  3F5W C;  5DG8 A;  3ETE A;  1XBL A;  2LP7 A;  3VPB A;  1DLB A;  2VS0 A;  2B63 G;  2FPG B;  3CHX A;  1GO3 E;  3A0B Z;  5KFW A;  2HFE C;  3OMA B;  3Q8Q B;  1GSA A;  3ZRX A;  1Y4M A;  4LF8 B;  2ZQM A;  5BWT A;  3PW7 A;  2B1G A;  2ASJ A;  2R82 A;  5DG9 A;  5DM6 V;  1GO3 F;  3CP1 A;  1OZ0 A;  4RCN A;  1XNQ B;  3CSW A;  1B3Q A;  3BG5 A;  3NBZ B;  2GTA A;  1HNZ B;  5HNE A;  3OUS A;  4APM A;  1GM8 A;  4FFN A;  2L35 A;  1W59 A;  4NYK A;  3RR5 A;  3RV4 A;  5C3E G;  4F4X A;  4R8C A;  4WD3 A;  4I55 B;  1R3L C;  3A0R A;  4FM1 A;  3O65 A;  3SPJ A;  3BCC H;  4RQE A;  4DUY B;  5KFH A;  4K6N A;  3K3V A;  5IY5 B;  3L72 H;  3JAM N;  1KKD A;  1Q82 W;  3LML A;  4D7S A;  3UYY A;  1QQC A;  1BJT A;  5JH7 B;  1OJH A;  1W93 A;  4LF4 B;  4GX0 A;  3OTO B;  1UPG A;  2ARH A;  2OTL V;  1EKF A;  1I5Y A;  4MAM A;  4B3T B;  2GV9 A;  4PZ8 A;  5DEC A;  2F95 B;  3U9T A;  3SJC C;  4X65 O;  1IBL H;  3PR4 A;  3ABK B;  5I5T A;  3C3S A;  1YXB A;  4OGQ B;  3CQZ A;  4JI7 B;  1JMK C;  4LF6 B;  3EYY A;  1U97 A;  3RB4 A;  4U7C A;  2W9B B;  1CKO A;  4RAY A;  4DL2 A;  2P4K A;  2DWC A;  1FXV A;  2FPI B;  1NS1 A;  2XGP A;  1IBK B;  3EPI A;  4JI3 O;  1SA0 A;  3ZJZ A;  4DV3 O;  4RZQ A;  2XCA A;  3H01 A;  2COG A;  4EBC A;  3I5D A;  3VQW A;  3ETQ A;  2WLH A;  3JD2 A;  4HNA B;  3GTK A;  1I50 A;  4KHP O;  5KFJ A;  2KG7 B;  3ZHV A;  2CW8 A;  5L3F A;  3LDC A;  4F4Y A;  2W6N A;  2VWJ A;  1MG1 A;  1Q7Y W;  1F51 A;  2WPD G;  3B09 A;  1WB7 A;  1P84 F;  4EG0 A;  3SPG A;  3ZED A;  2A79 B;  1BXR A;  3AK1 A;  2COJ A;  3BPZ A;  4DAA A;  3AG2 C;  1PNL A;  4NKG B;  3APO A;  2PYL A;  1MZF A;  1DF5 A;  2MCT A;  1VKZ A;  4C2M A;  4LC1 A;  1ZLZ A;  5DQG A;  1ZUQ A;  3QZ7 A;  2CGO A;  3ABM C;  5IYZ B;  3AG1 C;  4I50 A;  1JOY A;  2WE6 A;  1YJW V;  5J2U A;  5FLX N;  1E4E A;  1N34 H;  4TSF G;  2ITC C;  4DV0 O;  2W8K A;  3G67 A;  3H1I H;  1JDB B;  1I7N A;  1I1M A;  4Q45 A;  2HVJ C;  2CTP A;  2VUM A;  3I56 V;  1G8M A;  4FFL A;  4JI6 O;  2W57 A;  1J5E H;  1MZE A;  3PO2 G;  2ZDI A;  5IYC G;  4J9N A;  4JI4 B;  5JQG B;  3K57 A;  4DR4 B;  2DWE C;  5CB4 F;  4K0K O;  5EYP B;  5KG3 A;  2ZE7 A;  2NR5 A;  2LW1 A;  2IH3 C;  2QKS A;  4ZHQ B;  1Z2N X;  5IYZ F;  4IIJ B;  4ABM A;  5LP6 F;  1A0G A;  1GTO A;  5A9G A;  1OCO C;  3TQT A;  1PP9 H;  1Q3E A;  4DR4 O;  2X5R A;  5I60 A;  1AI4 A;  4J9Z B;  5KKN B;  4PA6 A;  4JI5 B;  1L2Z A;  2UXX A;  4FLX A;  1IOV A;  5EC1 C;  5F9L A;  1Y6X A;  4ED1 A;  1XMO H;  3HB9 A;  4WCE V;  1M0W A;  5LHH A;  5KX5 F;  2AZ0 A;  3NUA A;  3UFX B;  4X62 B;  1FFX A;  4ZI7 B;  1BQZ A;  3ZHS A;  1K1S A;  2W7P A;  4LF6 H;  1H2M A;  1VQ6 V;  3J81 N;  4JI1 O;  2DZD A;  2ITD C;  1GK9 A;  3RBZ A;  4BW9 A;  5J2T F;  1I08 A;  5H5N A;  3SYA A;  2AZ2 A;  1IBL B;  3UKM A;  2W6J G;  3J80 N;  1JDE A;  4JTC B;  4OX9 O;  5D1O A;  5J2U F;  4I50 F;  2CW7 A;  4ECW A;  2UUB B;  5BWX A;  4TQS A;  4PDV A;  3TK1 A;  1Y14 B;  4YJ2 B;  3ZRV A;  1WP8 A;  1XIL A;  2WLL A;  3UCS C;  4GC7 A;  2BTQ B;  3K5L A;  1TUE B;  1JQ0 A;  4H37 A;  5KFF A;  3KYH C;  2WLI B;  4LFB H;  3QG5 A;  2Y0S E;  2UXB H;  5LA6 A;  1WAZ A;  3T54 A;  3LNN A;  5LHI A;  4GT1 A;  1WPB A;  1M6V A;  5GTI Z;  3RYF A;  3E83 A;  2QWP B;  4PA9 A;  4JI4 O;  3UZO A;  3WO0 A;  1G4Y B;  5KG2 A;  1HNZ H;  3JCZ A;  3CXH F;  3AG4 C;  3A0H Z;  5IP9 G;  2IJH A;  2J6S A;  3DTU B;  2UUB O;  3ABL C;  3PN1 A;  4JAS A;  3RYH A;  3STZ C;  5DN6 G;  4Q4C A;  3QF7 A;  2YU9 A;  4FLT A;  4I0X A;  4MW8 A;  4Z1M G;  3SYC A;  4A3G G;  3R65 A;  4PZ7 A;  4J41 A;  4JGS A;  3AG7 A;  4GCZ A;  3RAX A;  1DGS A;  5EWG A;  4ED7 A;  3L75 H;  4DRX A;  3NR7 A;  4UVC A;  5CA1 F;  4MV8 A;  4I4T B;  4O4L B;  4WFH A;  4X1K B;  3F8N A;  2Q7H A;  4A3M G;  4A3D G;  3W1G A;  3TW6 A;  5KFG A;  3OR6 C;  2QSA A;  5K1P A;  2OT5 A;  5LGU A;  2HVS A;  4AYB E;  3CRC A;  1RJR A;  4LFB B;  3AEI A;  2OIE A;  2LGW A;  1GN4 A;  1SC5 B;  1BZK A;  4Z2W A;  5BWU A;  3F7V C;  2NU6 B;  2F4V H;  4JV5 B;  1NU1 H;  5EIB D;  2VWK A;  1S77 D;  2Q8V A;  5KMG A;  5LP6 C;  3TY8 A;  2JA8 G;  4RWU A;  2AW9 A;  5CN0 A;  5IP7 G;  3CCU V;  3GIK A;  3E8G A;  4JYB A;  4P2Z A;  5JCO A;  1CKN B;  1WCM G;  1P16 A;  5KFY A;  5LXT A;  5CB4 A;  4FBU A;  4B3M O;  4B08 A;  3QVN A;  3E22 A;  1Z5W A;  2UXC B;  4IWX A;  2YS7 A;  3OT7 A;  1N34 O;  2DPI A;  3TIG A;  1BE3 H;  2YIB A;  3G80 A;  4DV2 O;  1OHH G;  3ZIA G;  3CC2 V;  1GKF A;  1KB9 F;  4NXN O;  3CME V;  5F2V O;  2XAJ A;  1P8L A;  2HG8 A;  1XHX A;  3DC6 A;  1CP9 A;  4ZOL F;  5DGI A;  2UXD H;  4U6P A;  1QLE C;  1JCH A;  5KAF Z;  3DTF A;  2W8L A;  2PUS A;  5LXT F;  2EJ3 A;  3FKS G;  3IC7 A;  1Z2O X;  4JI2 H;  5L3C A;  1WP7 A;  3L73 H;  3V6J A;  1WRV A;  4NLG A;  4DV4 O;  5BR8 B;  4BR6 A;  1RK5 A;  1Q86 W;  3VQY A;  1RM1 B;  3ZCC A;  4O4J F;  5C5J A;  3JZF A;  4A3J G;  1SQF A;  4LSA A;  2FLN A;  2XCP A;  2R86 A;  2HHF B;  4NYE A;  2AGA A;  1CXZ B;  2IMW P;  3LWB A;  1S9F A;  4H0L B;  3HKD B;  3N8D A;  2PY5 A;  3BEH A;  2E3C A;  3HOW G;  4K0K B;  2XCL A;  2OCH A;  4DV7 H;  1BSM A;  2FLP A;  2CTR A;  3RYC B;  2UXD B;  5KG5 A;  3K3W A;  4MV7 A;  3GTG A;  2Q6A A;  4O4J A;  3JCU Z;  3T5H A;  1N36 O;  2Y0P A;  3J7A K;  2VQF H;  3CCQ V;  1KU9 A;  2W70 A;  2BQR A;  1RJP A;  1DTO A;  2YI8 A;  5BYA A;  3D36 C;  4YP3 A;  1QVG U;  2CNV A;  3CC7 V;  5D5Q A;  3FD9 A;  1AP5 A;  4QE7 A;  3RIZ A;  2BCC H;  3LDD A;  4CC6 A;  5BXZ A;  2XT9 A;  3GV8 B;  2HGW A;  4BIO A;  2UVW A;  4L87 A;  4PI0 A;  1Q8I A;  2JJ2 G;  4MT8 A;  4MTX A;  2BQU A;  4JAA A;  5KFP A;  4DV1 B;  3QO7 A;  4MVQ A;  4H33 A;  4EFB A;  4I5S A;  3TW7 A;  4EQ5 A;  5BWW A;  4ED6 A;  1S5L Z;  1N36 B;  3LSQ A;  4GKK O;  3E8B A;  2R85 A;  1QR9 A;  4FFB A;  3LNM B;  4DV2 H;  1KTA A;  4MV9 A;  1ZAU A;  4GX5 A;  2C2E A;  2FP4 B;  2UUC H;  4AQY B;  4UUJ C;  3QO5 A;  5L3G A;  1RYS A;  5IJ0 B;  4JI7 H;  2H8P C;  1CKN A;  3T9E A;  3HOV G;  1WH2 A;  4YIP A;  1F4M A;  5I5U A;  3T1H B;  4DL5 A;  2FMA A;  3Q1K A;  5KMG B;  4JF3 A;  4MV4 A;  4FFP A;  2BOB C;  1JX9 A;  2ZIM A;  3OTO H;  1E79 G;  4LF4 H;  3AW8 A;  2XGQ A;  2FB9 A;  1TA8 A;  3EHB B;  5EDW A;  1P7G A;  4YY3 O;  4RUC A;  1SQX H;  2XIG A;  3BAC A;  4QWD A;  3FAV A;  4MTG A;  1D5N A;  1H38 A;  1ZTE A;  1P7B A;  3KHR A;  4IL6 Z;  4PJ0 Z;  4HQ6 A;  2YIC A;  4IHJ F;  4NXM O;  4ZOL A;  2PN1 A;  4ZI7 F;  1YTF D;  3JAW A;  5J9P C;  1SZX A;  1M90 W;  3CEB A;  4JV2 A;  5L9X A;  5KHJ A;  4JI0 O;  3K9S A;  4NXN B;  1NQT A;  2HVQ A;  2Z04 A;  1TWA A;  2PBZ A;  4A93 G;  1S0V A;  1I6U A;  1M57 C;  3OR7 C;  3N41 B;  4K8Z A;  3CRA A;  1K5S A;  5T14 A;  2NN4 A;  5B1N A;  3RYH B;  4O4H F;  4XYM B;  1B04 A;  1TWC A;  3Q2O A;  3B8N A;  1HNX H;  4GLX A;  1NH2 B;  2JIZ G;  1EHI A;  2A3Q A;  4O3Q A;  2FJZ A;  2R8H A;  4CS4 A;  5JVD F;  4J9S A;  2P22 C;  5EWE A;  1IXB A;  3MDS A;  1KKC A;  4DV7 B;  1FYJ A;  3BQ0 A;  4Y8V B;  3N40 P;  1KJ9 A;  4FFM A;  1XNR B;  4A3E G;  3WFV A;  4HAM A;  4O7T A;  5JJN B;  1XMQ O;  1EBO A;  4R6Z A;  4X64 H;  4IR9 A;  4O7S A;  4FM0 A;  4GKJ O;  3E8F A;  2XAF A;  3IFX A;  3JAK A;  1FAF A;  2UXC O;  4YAK B;  3I55 V;  2CAZ C;  1Z5V A;  3IGA C;  3GB7 C;  1BCC H;  2WLL B;  1KJ8 A;  3J81 W;  2ATL A;  1ZL8 A;  1K4C C;  1P49 A;  4GYC B;  1WPX A;  3IC9 A;  5D1O B;  2NU8 B;  2QJ1 A;  3GIJ A;  1R6K A;  3RVZ A;  4B7K A;  2DE0 X;  3K5M A;  1S0O A;  1JJO A;  1KEC A;  4X64 O;  3OHA A;  2CQY A;  3BQ1 A;  3SYQ A;  2YEV A;  2YI9 A;  4WFG A;  2QWN B;  2RDC A;  4FFR A;  2OIG A;  4UXN A;  2CTQ A;  1EN6 A;  5LMU B;  2YIB D;  3H4B A;  4ZIB A;  4O7Z A;  4C5C A;  5KUM A;  2ZXW C;  3BA9 A;  2WLM A;  2QDO A;  2XD4 A;  3WWH A;  4O3P A;  4UB8 Z;  2FK2 A;  3Q8P B;  1K9M W;  1M1K W;  4RB1 A;  2AQ4 A;  3GQC A;  2R9R B;  2R7Z G;  3OSP A;  1IUR A;  1A3G A;  4JYA H;  2HDK A;  4O7R A;  4O4I F;  2ZE6 A;  3R5F A;  2W6Q A;  4O7L A;  2OYQ A;  4QGP A;  2ABJ A;  2Q73 A;  4I0X B;  2JA5 A;  4DV6 B;  3N2G B;  1IDS A;  1MNG A;  5EZY F;  3SPI A;  2AXT Z;  4YAJ B;  2AHZ A;  1I7F A;  2ZE8 A;  4G27 B;  4NXN H;  1M57 B;  1YSC A;  3MR3 A;  5EYP A;  2RNB A;  3CSX A;  4F4Z A;  4X64 B;  3L9D A;  2DPJ A;  4DV3 H;  3F5T A;  4LF9 O;  1M5I A;  2IBZ H;  3RW0 A;  3SE7 A;  2RGR A;  1A9X A;  4UVA A;  2YZM A;  2WYO A;  4IHJ B;  1JJ2 U;  3AG2 B;  2ASD A;  5K1X A;  1N32 O;  2UU9 B;  3JAL A;  4FK5 C;  1I5X A;  2EJ0 A;  4JTA B;  5KT3 A;  4JPR A;  1DAA A;  5KFO A;  1EN5 A;  4HR7 A;  2ZNJ A;  5IYZ A;  2XAH A;  4M7E A;  4A3C G;  4LFA O;  2A1H A;  2BTQ A;  4UCO A;  3WB1 A;  4YY3 H;  1SCU B;  1N33 B;  3HKC A;  3TY5 A;  4R7C A;  1I94 B;  4J9O A;  2JA6 G;  4JV0 A;  3CEI A;  5KA6 A;  1R9T A;  3DC5 A;  2V4Q A;  3OE7 G;  3KAL A;  4O7V A;  3FYE B;  1KC8 W;  3CB2 A;  2GLT A;  2WB1 E;  1S76 D;  3CWB H;  4PHZ A;  4RUE A;  2UXB B;  2IP4 A;  2Z3Y A;  4QNH B;  3R23 A;  1WJZ A;  3K3P A;  4ZI7 A;  2YC0 A;  1KUQ A;  1NI8 A;  3T1Y B;  1X59 A;  4CBC A;  4QW9 A;  3T4D A;  3MHH C;  4WFF A;  2FK1 A;  4RUA A;  4I55 F;  4AYB A;  1XDC A;  3Q8R B;  2B1I A;  4BY1 G;  5E25 A;  4J9P A;  2W9B A;  2AGO A;  1VQN V;  3ZMS A;  4Z1V A;  3KG2 A;  1EUD B;  2R7L A;  3JRW A;  4UCT A;  2ZXW B;  1GH6 A;  4DLK A;  5D5P A;  1S10 A;  1OCO B;  1H8H G;  2ZM6 B;  1UJW B;  4EBD A;  2R8K A;  5LOV B;  1VQO V;  2QK4 A;  3P3N A;  2JA5 G;  2XOK G;  3VNN A;  2R92 G;  1B6Q A;  3ZN1 A;  3HPL C;  1KMI Z;  4XDK A;  4IIJ A;  4O2B F;  4BXX G;  2Y48 A;  3T9F A;  5JH7 A;  1FXH A;  4EEQ A;  2PZS A;  1B33 N;  4FBT A;  1N0J A;  2X7R B;  2WTF A;  4LF8 H;  2V59 A;  2PTM A;  3HKE B;  4MA5 A;  3ML0 A;  2OLS A;  4TV8 B;  2EIJ C;  1GN2 A;  4DXW A;  2YRW A;  1SYX B;  3GV5 B;  2FML A;  1G6U A;  1URF A;  4WFB V;  4QIW E;  3S24 A;  1IBM B;  2GTS A;  1XK5 A;  5LA6 F;  1MSD A;  4GKJ H;  2VOB A;  2UVV A;  2E74 B;  2PI4 A;  1JLL B;  4LFA H;  1TVK A;  4TOI A;  5DGH A;  1O9G A;  4DV3 B;  4I50 B;  1NTK H;  2GDS A;  4LFC H;  5LBQ A;  4FS2 A;  1BMF G;  1A32 A;  2JGD B;  3LDE A;  2QEX V;  1HR0 O;  4LCU C;  4NZO A;  4DV6 H;  3K5N A;  3GIQ A;  3L74 H;  3VQX A;  5JJJ B;  3JD4 A;  2Y4T A;  4RQF A;  1AJN A;  2OWO A;  1ZQ7 A;  4DV4 H;  4QSH A;  2HG5 C;  3QWU A;  2Y4R A;  2KG7 A;  2JEU A;  1SRY A;  3JZ6 A;  2WLN A;  4QWB A;  1H2G A;  4IR1 A;  4K0K H;  2LW7 A;  4JZG A;  4CS2 A;  2Q2U A;  3N42 B;  4DL3 A;  3ABL B;  5D1P A;  4WHX A;  3AK3 A;  3CXC U;  2C28 A;  3M9O B;  3U0Z A;  1PL4 A;  4YXW G;  4PBC A;  5IYB G;  4K3A A;  3X2Q B;  2HGX A;  3C3T A;  4ICG A;  2M05 A;  2ZIN A;  4P9O A;  1S68 A;  5BMV B;  2V9W A;  1I3Q A;  1RFY A;  1NT2 B;  5AG2 A;  2I8C A;  1S72 V;  1VF7 A;  1P4R A;  5GW7 A;  1PM9 A;  2QKA A;  4FFO A;  1E1R G;  1KQS U;  4BWS C;  3E2E A;  1VMG A;  4X20 A;  4TV9 B;  4DV4 B;  2OH2 A;  2V4R A;  3T2M A;  4G3I A;  3MJF A;  3ETH A;  1PX2 A;  3MAQ A;  3WNZ A;  4YQW A;  4YBZ B;  2N74 A;  3T9B A;  4UCU A;  4DUZ H;  2R8G A;  5KUK A;  3V4S A;  1VQK V;  4WBN B;  3T5J A;  2LGQ A;  3GTO A;  5FLX W;  2ETN A;  5LP6 B;  3R66 A;  5L3D A;  3LSU A;  2FPP B;  2KSD A;  2F1M A;  4RUF A;  3K5H A;  3U0G A;  4MTD A;  4ED0 A;  5LMN B;  1JKJ B;  5C4X G;  3TGU H;  2JEX A;  4GKJ B;  1K97 A;  2W9C B;  5LYJ F;  4BIU A;  4JUZ A;  5GON A;  4LF7 H;  3SDL A;  1Y76 A;  3RB0 A;  4I7H A;  4B3S O;  1JPX A;  5L1L A;  5FPO A;  4GZR B;  4OPA A;  3JAT A;  4FLU A;  1H2K A;  1K92 A;  2JVD A;  3TJT A;  4OPH A;  5JVD A;  4MV6 A;  4HBN A;  4IAJ A;  5FL7 G;  1XL4 A;  4YJ3 A;  1WA8 B;  1C30 A;  4A3F G;  3KKY A;  1HR0 H;  3V6K A;  3KXY T;  4ECY A;  5LYJ A;  1L0L H;  4EEY A;  1RP3 B;  4ED2 A;  5KLV H;  1MMM A;  2DAB A;  4WFA V;  4GKK B;  1VAR A;  3A8T A;  1G2W A;  1SES A;  3O9O A;  1WR2 A;  3T7A A;  1MZB A;  3JAS B;  1N32 B;  4IWY A;  1RM1 C;  1H2N A;  2YZG A;  2ZCE A;  3RB3 A;  4ECS A;  4X1I A;  4MW3 A;  2LQT A;  3D3Q A;  3JYC A;  5B3S B;  2XHB A;  5ITZ A;  4O3O A;  1CEZ A;  2IW5 A;  2WA3 A;  4J10 A;  4DYL A;  4ED8 A;  2E5L H;  1HNW H;  4PI2 A;  1UC8 A;  3LP8 A;  5I5Y A;  1R3J C;  5IT9 N;  1X9N A;  2CH7 B;  4Q4D A;  2JK5 C;  3UM7 A;  4Q8F A;  3WO1 A;  5B1A C;  4DV2 B;  1DV2 A;  2NU9 B;  1I2L A;  1CQJ B;  1KJQ A;  2ZKO A;  4A2B A;  4JZ2 A;  5DIS C;  2EX3 A;  3E5N A;  3RTX A;  3T9A A;  4RB3 C;  1YJN V;  1ORQ C;  2J6T A;  2EIM C;  3CRQ A;  3GID A;  3OMN B;  1AVM A;  2F43 G;  3D36 A;  2UUC O;  1TWH A;  5JUM A;  2Z5U A;  2CNQ A;  3T1Y H;  4J7J A;  4PV1 B;  1XRE A;  1SF9 A;  2WAM A;  4O84 A;  3KHL A;  1AP6 A;  4MTE A;  4E6N A;  1RSO A;  5J2T B;  2RQ6 A;  2VR1 A;  5KHI A;  4A5U B;  1PPJ H;  4DW1 A;  1YIJ V;  4LFB O;  2CZG A;  2C22 A;  2I80 A;  5HV6 A;  2ZM6 O;  1J5E O;  4UV8 A;  2YW2 A;  3DGE A;  2Q0O C;  3DXR A;  1E4G T;  1H8E G;  4I7Z B;  2PMZ E;  4X62 H;  4TUY B;  4CH6 A;  3H1J H;  1Y66 A;  2N05 A;  2UUA O;  3HOX G;  4AHC A;  2VPQ A;  3OGI B;  4JI4 H;  4XDJ A;  2J9G A;  4X89 A;  1XUQ A;  5HFM A;  3PW2 A;  2KQX A;  1VQM V;  1I2K A;  5C93 A;  2UXB O;  4O2A A;  2GUZ A;  2Q9L A;  2XTA A;  1RK6 A;  3KTM A;  1JFF B;  2RJZ A;  2WLK A;  3OM3 B;  1O75 A;  2B9Z A;  5CA0 F;  1XMQ B;  1SS3 A;  5DG7 A;  2GUZ B;  3W7S A;  1YVW A;  4JAU A;  1N34 B;  2IJK A;  3G6X A;  1GN6 A;  5LYJ B;  5FR9 A;  2A06 H;  2LJ2 A;  4JI8 B;  2R8J A;  4NTW A;  1XMO O;  1LNQ A;  1AIL A;  2W71 A;  3CCR V;  4TUY A;  2B5U A;  4YJ3 B;  3FMA A;  4DUZ B;  3H3V H;  1AR5 A;  2ADQ B;  2X0L A;  5B3S C;  4IIJ F;  5JVL A;  5B1O A;  4DR4 H;  3JAT B;  4DR5 O;  5EBM C;  5KG1 A;  5BR8 H;  1EN4 A;  5KFI A;  1BHB A;  4J0M A;  2QA4 V;  2YID A;  2RDI A;  3G6E V;  4I9Q A;  1Y76 B;  2C2A A;  5DMX A;  4ECV A;  1RSO B;  5J2T A;  4JI3 B;  3SI8 A;  3SGI A;  5BR8 O;  2W9C A;  3G8D A;  4ECX A;  2H94 A;  5B1A B;  4JYA O;  3HB3 B;  4PWQ A;  5L1I A;  1K4D C;  3KCX A;  1XEQ A;  4QWC A;  5KFQ A;  3VPD A;  4WBN A;  5JQW A;  2W0X A;  5I47 A;  4RNM A;  2M7W A;  4DV5 O;  4QPK A;  1S5H C;  4OX9 B;  1ENV A;  5KHH A;  1TWG A;  5IJ9 A;  4MVR A;  2I87 A;  3UQ8 A;  1I0H A;  1VEW A;  5CA0 B;  2JS5 A;  1MAB G;  3TET A;  4TV9 A;  4X20 B;  2CH7 A;  4YR2 A;  4CMF A;  4B3T H;  4IGG A;  4ZHQ F;  1VQ5 V;  3RGX A;  2DW4 A;  1Q43 A;  1XI1 A;  3ZMZ A;  2WB1 A;  3G4S V;  2GPS A;  2BR0 A;  3H40 A;  4IRD A;  2P67 A;  2YYA A;  1JVM A;  1K8A W;  5DED A;  1K33 A;  4FLV A;  4B3R B;  3WG7 C;  1WLE A;  1CE8 A;  1AI7 A;  5KFZ A;  4K35 A;  4DR6 O;  1XL6 A;  5JCO C;  1ZHQ A;  3WU2 Z;  5BMV A;  4MVO A;  5IYD O;  1R1B A;  1HW7 A;  1M4U A;  1K5Q A;  4KHP H;  5C8Y F;  4LFA B;  5KFX A;  1PNK A;  3IJ4 A;  2V5A A;  2DJV A;  1Q6H A;  1ZWI C;  2E2H A;  1EFR G;  1S5J A;  5CBG A;  2HEP A;  2WLJ A;  4H44 B;  4QJF A;  3HKZ E;  5BY1 A;  1I1L A;  3VMM A;  1WA8 A;  3CX5 F;  4YIO A;  1GLV A;  3G6Y A;  1HNX B;  2IM9 A;  4IYH A;  1SEI A;  5JVD B;  2Q7D A;  1VQL V;  4B3R O;  3U9S A;  2HHH O;  4U7O A;  3ORR A;  4FS1 A;  2Q4P A;  3TY9 A;  1UFI A;  5KX5 A;  1Q90 D;  2V58 A;  1K1Q A;  3T1Y O;  4O4I A;  5H6R A;  5GON B;  3ZRW B;  1QHT A;  5H80 A;  4XDL A;  1VQ8 V;  5KA5 A;  1TVK B;  4CZZ A;  3NC0 B;  3N27 A;  3KAK A;  4DV6 O;  3PW4 A;  2XAS A;  3RN4 A;  3CCV V;  4LF4 O;  1KJI A;  4AQY H;  2UUA B;  1K7D A;  2NVY A;  3M4I A;  3AG3 B;  2WDT A;  4DR1 B;  5LP6 A;  1R73 A;  4DV5 B;  3CRM A;  3JAR B;  1N36 H;  2Q69 A;  3FB5 C;  1AB3 A;  3VOU A;  3HKE A;  5BPH A;  2ZDI C;  2YXH A;  4DV0 H;  3U55 A;  1HP8 A;  2RF4 A;  5DGA A;  4LR3 A;  2R92 A;  4QWA A;  1DV1 A;  3HOU G;  2LO1 A;  3KHG A;  4PDB A;  1IX9 A;  3LQS A;  2F66 C;  2EJR A;  3FFQ A;  5LHG A;  1NJI W;  4Q20 A;  3QFF A;  2PI5 A;  1IOW A;  4Q0Y A;  2XC9 A;  4RU9 A;  1MA1 A;  1NR1 A;  2VRZ A;  4FFK A;  4MVU A;  1I94 H;  2UUC B;  2BTO A;  4J9M A;  3D8C A;  3SYO A;  3ZN0 A;  4RB2 C;  4J9L A;  4MV1 A;  1W96 A;  1XOU A;  4AIL C;  4IT5 A;  3RVY A;  4ECU A;  1YEW A;  3CS5 A;  1BNC A;  4B3R H;  4BW5 A;  2OTJ V;  4F4W A;  5GTH Z;  2UU9 H;  2VQE B;  4JI3 H;  1MSW D;  5KG7 A;  4IYI A;  2W6I G;  1H2L A;  2YL2 A;  3W5O A;  4Q44 A;  1WB8 A;  3OEE G;  2OCC B;  2X6C A;  2C2D A;  4BY7 G;  4YR0 A;  2RCV A;  5DQH A;  4UV9 A;  4O81 A;  3L2P A;  4UFZ A;  1SQG A;  2Q5Z A;  2Q67 A;  3HKC B;  1THZ A;  2IBK A;  5IYD G;  2JGD A;  1Q5O A;  1J5E B;  2HJF C;  2ASL A;  1BS3 A;  3GTQ A;  1AN7 A;  3H20 A;  2DYR C;  3JAL B;  4QE9 A;  4IHJ A;  3R5X A;  2Z02 A;  4FZ1 A;  1VQP V;  4O3N A;  4FM2 A;  2W6O A;  3N2K A;  4E2L A;  3FB6 C;  4DR6 B;  2C2R A;  4DV7 O;  3GII A;  4MVS A;  1SQP H;  1YJ9 V;  5CBF A;  1Z2P X;  4MS2 A;  3G6V A;  1QVF U;  2ZR3 A;  4TV8 A;  2P5O A;  2VA3 A;  4JI2 O;  2EIJ B;  4DL4 A;  3V6H A;  4MA0 A;  5C1O A;  1PKX A;  2HVK C;  3CJH A;  2HJD A;  3BAB A;  4J42 A;  1LR1 A;  4MV3 A;  1NKD A;  2P4V A;  3E35 A;  3N2G A;  4FE2 A;  3TXS A;  3IG0 A;  1BGW A;  3OHB A;  1BL8 A;  3JSL A;  1EM1 A;  2Q7E A;  2JJ1 G;  2Q7G A;  4JI2 B;  5LOV A;  3APQ A;  2W6P A;  1IBM H;  3CD6 V;  1VAJ A;  2EUL A;  5KT2 A;  4FPP A;  1ROP A;  4HZ3 A;  1D2D A;  3AYH B;  3WB2 A;  4MSW C;  4PDL A;  3PR5 B;  1VQ7 V;  1VQ4 V;  4A2A A;  1OCC B;  4TQD A;  1OCR C;  3UO2 A;  5KFR A;  2QTS A;  2ZR2 A;  1BHA A;  5F9N A;  1JA8 A;  1Y74 A;  1HNZ O;  1R6N A;  2FKL A;  2YEV B;  1WN7 A;  3LUT B;  4YHH H;  1XNR H;  3JRX A;  4DR7 O;  3SPH A;  4Q8E A;  1XQ8 A;  3HO8 A;  2WSS G;  4JXU A;  5EC2 C;  5C1P A;  3X2Q C;  1V4Y A;  3T1H O;  4DV1 O;  2ALZ A;  4RNN A;  5IWA B;  3T5L A;  4NR1 A;  4R8U A;  2FKX A;  1ZL8 B;  2C00 A;  4AQY O;  5E1A C;  5CAE B;  1M0T A;  3LUL A;  4O2B B;  3UT5 B;  3ABU A;  2XUM A;  1PV0 A;  5LL6 Y;  4DR1 H;  3RB6 A;  1GRJ A;  3MR2 A;  3JD0 A;  3FKI A;  5BPF A;  4EKW A;  2V7Q G;  1FXK B;  4DR2 H;  4IRC A;  3RGZ A;  4NVP A;  4EYH B;  4X62 O;  3SNO A;  3E8H A;  2FL4 A;  4DK1 A;  2FK3 A;  5FNV F;  3TII A;  5KG6 A;  2DWD C;  3GIP A;  4ASU G;  4B7E A;  2N04 A;  1Y1V A;  1HR0 B;  3RAQ A;  2ZNI A;  4FIP C;  1L1F A;  1PD3 A;  2DYS C;  1K3E A;  3GLK A;  2DQ3 A;  2VPS A;  5FJ8 G;  1N33 H;  3FB7 C;  2PMZ A;  2P6J A;  3ZHQ A;  4NZM A;  2E75 B;  1M7J A;  2A0L A;  4PDM A;  3IAY A;  5KFL A;  4TVI A;  3HOZ G;  3B40 A;  4LSX A;  2UVR A;  1GAX A;  4J9Q A;  3ASO B;  3JAW B;  4U3F H;  3BJY A;  4F6R B;  5FLM G;  5LGT A;  4E4E A;  1N33 O;  2YS8 A;  2A7W A;  4ZKI A;  5C8Y B;  3FAV B;  1IXM A;  2ZDQ A;  5KG4 A;  4DL6 A;  3N6R A;  1QLN A;  2CGN A;  2YXL A;  3QO8 A;  2R9A A;  4DR2 B;  3T4Z A;  2HLD G;  1NZ6 A;  1OCC C;  3ZBH A;  5LOV F;  4B3M B;  3ICX A;  3GTP A;  3ABT A;  4DV1 H;  3TIN A;  1IYE A;  4C5A A;  4L1K A;  3DSQ A;  1J95 A;  2JRI A;  2CFM A;  1KJJ A;  2RN9 A;  4LF7 B;  2R93 A;  5LL6 b;  5CM0 A;  3H9V A;  3W7W A;  5IJ0 A;  2BSK A;  5BZB A;  3K03 A;  2HIV A;  3N6X A;  5IT9 W;  4FLY A;  1YZB A;  2IA6 A;  3NBY B;  4LNU A;  1UC9 A;  4G28 B;  3JAK B;  4NZN A;  2Q68 A;  4BIZ A;  4JV5 O;  3TCU A;  2E76 B;  2ZE5 A;  5FNV B;  5IYC O;  2UU9 O;  2AGP A;  3U10 A;  2IU0 A;  5KHG A;  1FKA H;  3HXL A;  4M0J A;  1XHZ A;  3CCS V;  4P9P A;  2P7T C;  4LWS A;  4O3S A;  2Q0A A;  1VF6 C;  5JQG F;  1TUB B;  1L8D A;  2QE7 G;  2V1D A;  1NBM G;  1M93 A;  4X8A A;  1RJQ A;  1GMG A;  5KFE A;  5IE9 A;  5KFV A;  3WB0 A;  3ZMU A;  3P30 A;  2EIM B;  3RGB A;  1W0K G;  4DR5 H;  5KAI Z;  2ZJT A;  4FJC C;  2EIL B;  1B6S A;  2PVP A;  2CNU A;  1Y1W A;  2ILM A;  1F23 A;  4FMT A;  1SKV A;  4EFE A;  4O4J B;  3M9M B;  3PO3 G;  3MWE A;  4ZOL B;  4A3I G;  2H3O A;  2ATK C;  2HJW A;  3NXS A;  3HKD A;  1JIH A;  3JD1 A;  2JDI G;  5KFM A;  4TQR A;  1SET A;  4KXR A;  4EB6 A;  3H0G A;  4PDR A;  5L3B A;  4X66 B;  3CRR A;  4TT3 G;  5B66 Z;  1SER A;  4UCR A;  3MD0 A;  4ECQ A;  1FJG H;  4LFC B;  5KFS A;  5JJE B;  3WWI A;  1V55 B;  4H13 B;  4C5B A;  2JEI A;  1KEE A;  3UZB A;  3V4Z A;  1FPO A;  3B77 A;  2CTW A;  1R3I C;  4FZ0 A;  2RMK B;  4K8X A;  1U96 A;  1TUB A;  2GHY A;  2ZD9 A;  1E1Q G;  2VUG A;  1JXL A;  4XBF A;  4FFB B;  5KFU A;  4DV0 B;  2R72 A;  1N56 A;  1MOF A;  2GQS A;  5FNV A;  1QBZ A;  1IBL O;  2AHY A;  5DGB A;  4D6T H;  2PYJ A;  1ET0 A;  1M56 C;  1KYO F;  4LNU B;  4O3R A;  4QIW A;  1VBH A;  1OWT A;  3K04 A;  2QWQ B;  2IJI A;  2WAQ A;  3RBE A;  2BSK B;  5HFL A;  2LFR A;  2HHH B;  3OUF A;  5IYB O;  4J11 A;  4BAY A;  3H4D A;  2YUA A;  2D2C B;  5B1B C;  2YWV A;  4Q43 A;  3KRE A;  4YY3 B;  5H2F Z;  3H1L H;  3K0G A;  4WFE A;  1FFT B;  3BRC A;  4DIM A;  4RB0 A;  3ASN B;  2D3O W;  1T3N A;  3RWR D;  4XZ3 B;  1S0N A;  4EB6 B;  2Y69 C;  5IDJ A;  1AUV A;  4IZO A;  1AI6 A;  5FD6 A;  4DQN A;  4TQF A;  3RJ0 A;  5C8Y A;  4DV5 H;  3RYC A;  3K5I A;  2X6A A;  4GLW A;  4XYL B;  1XNR O;  4F6R A;  2R7M A;  3JSN A;  3T9D A;  4RO2 A;  4I4T A;  4O4L A;  4X1K A;  1OBG A;  2EIN C;  2CK3 G;  5DLF A;  3WG7 B;  2Y4U A;  1AI5 A;  4B3T O;  3R5H A;  1WCM A;  4B3S H;  3W1B A;  2QWR B;  1WSC A;  5L1J A;  4LH7 A;  2YDE A;  3RUP A;  2HHF A;  3GTL A;  2FLL A;  1K73 W;  2JA7 A;  4LF5 B;  3G8C A;  4X66 H;  2QM8 A;  1N48 A;  4JYC A;  1JX4 A;  3M7M X;  4NXM B;  5IWA O;  1FS0 G;  3ZS8 C;  1AJQ A;  4WF9 V;  1XDN A;  1N0N A;  2UVU A;  2IU3 A;  4JYA B;  2E2I A;  2Y0S A;  5LMN H;  1RYR A;  4DRF A;  3THO A;  4CH4 A;  4LWS B;  4OXS A;  4WBN F;  2NNU A;  1UNN C;  4KHP B;  4O83 A;  2YZN A;  3U54 A;  3OGC C;  4ME6 A;  3PW5 A;  1IBM O;  1C3O A;  2EIK B;  1EKP A;  3T5K A;  3I12 A;  3HKZ A;  3J80 W;  1AJP A;  1CS0 A;  4DW0 A;  3E22 B;  1T36 A;  3K5O A;  3W7X A;  3MR5 A;  2R7Z A;  2GBO A;  5DAA A;  1GM7 A;  2V4D A;  5CB4 B;  4YJ2 A;  5LXT B;  1PK8 A;  3KAJ A;  4JI5 H;  1M56 B;  4Q6G A;  4R8U B;  3BQ2 A;  1YDX A;  2X6B A;  3TQ1 A;  2QF7 A;  1YF2 A;  1VS0 A;  2MW2 B;  3K79 A;  3AG3 C;  3PZP A;  4JI6 B;  1CQI B;  3PJS K;  3AX6 A;  2QYZ A;  1V51 A;  4YJ3 F;  5B1B B;  2UXN A;  1EYZ A;  4X65 B;  4R7R A;  4DR7 H;  4KP4 A;  1FFX B;  3ZHR A;  5LMN O;  2J6U A;  4OX9 H;  2VA2 A;  1S3J A;  1A0I A;  1CKM A;  2W6M A;  4HYK A;  3W7T A;  2Y69 B;  1B6R A;  3EXA A;  4JI1 H;  4YR3 A;  2HR3 A;  4KL1 A;  1Q6U A;  4DRX B;  3CCE V;  4JTD B;  2W0F C;  4FM9 A;  1GSH A;  3CCL V;  2XND G;  3L4K A;  3HBL A;  4UCS A;  4EGJ A;  5BYB A;  1E4F T;  4FGR A;  3ETJ A;  1S03 G;  2DOS A;  2F4V B;  1ZET A;  1DF4 A;  5KG0 A;  1VQ9 V;  5KFD A;  1Y1W G;  3BAA A;  2ZDH A;  1WNS A;  3HT5 A;  4MTO A;  2W7O A;  3OAA G;  5IY5 C;  1FD9 A;  4HN2 A;  5EBW C;  5JQG A;  2XAG A;  1YI2 V;  3VA7 A;  2COI A;  4NTX A;  4I9W A;  4JI8 H;  2EBO A;  2EZP A;  2OCC C;  4DR3 B;  3CC4 V;  1EUC B;  4W4L A;  4IRK A;  1YHQ V;  3RYF B;  1QNM A;  3L70 H;  1R3K C;  4J80 A;  3CCM V;  2EZO A;  2QM4 A;  5LA6 B;  3CYO A;  1FVI A;  1FXK A;  4O7W A;  2WLI A;  2Q2T A;  3RT3 C;  1E4E B;  5JH7 F;  2E5L O;  1HNW O;  4HNT A;  4RNO A;  3OTO O;  1NR7 A;  2XAQ A;  3UT5 A;  3OFN G;  1IVS A;  4O2B A;  4PA3 A;  2EIK C;  2R6F A;  2DYR B;  2R9I A;  4PZ6 A;  3ZX6 A;  4D7T A;  2Y0I A;  2ZIO A;  2HVR A;  2G38 A;  1LUV A;  3FYI B;  4HNA A;  3K08 A;  2DAA A;  2EJ2 A;  4YJ2 F;  3GIM A;  2B63 A;  1HDJ A;  3T9C A;  4ECT A;  1B06 A;  3ZHU A;  2E5L B;  1HNW B;  1GGO A;  3I4N G;  1KUT A;  4GX2 A;  3W7U A;  4I4T F;  4O4L F;  5I5W A;  1Y74 B;  2ZM6 H;  1IZ3 A;  2ADP A;  3ZMT A;  1XNQ O;  3CVZ A;  2R70 A;  1H2S B;  3C0F B;  4MTF A;  2VQD A;  2YZL A;  2ODT X;  2YRX A;  4MVM A;  3MWD A;  1OCZ B;  4KUM A;  3OW2 U;  5IWA H;  3ABM B;  3AG1 B;  3OTF A;  1I94 O;  3JAM W;  4GKK H;  1V9P A;  2GQR A;  4JI0 H;  1OBD A;  3S3W A;  1ZSP A;  4YHH B;  2R84 A;  1EZJ A;  1XNQ H;  1V54 B;  1OCR B;  3RFC A;  4ZHQ A;  2NUA B;  3OEH G;  4G2K A;  1ZX3 A;  4NB5 A;  3MFH A;  4E4T A;  3CJH B;  4F4L A;  4GUN A;  2HP8 A;  1X4T A;  4KFM A;  5H6Q A;  2QTO A;  4LF9 H;  5K3W A;  5GON F;  3FX7 A;  2DLN A;  5JWP A;  2P0A A;  1KD1 W;  1VIB A;  3GWK C;  1Q6I A;  3N2K B;  3GWO A;  3KZI Z;  2R7N A;  2X0S A;  3ZHT A;  1N32 H;  5CA3 A;  3SR2 C;  3RFR A;  4QPJ A;  3ZMV A;  1BT8 A;  3N43 B;  3GB8 B;  2Z0A A;  3ZRW A;  4J9K A;  1QU7 A;  4QW8 A;  4O4I B;  3GJX B;  5J2U B;  4DR3 H;  4O7N A;  5D8D A;  1A48 A;  2YS6 A;  5KX5 B;  3KHH A;  4EBE A;  2AGQ A;  2JA6 A;  2ZGI A;  1FXK C;  3PW0 A;  1KBH A;  5BWR A;  3ETG A;  2VQF B;  5KT4 A;  1W0J G;  3SJB C;  4UB6 Z;  4L8J A;  4QJF B;  1SQV H;  2ZDG A;  4X66 O;  4CE5 A;  3DTG A;  3M99 B;  5KFC A;  3F7Y C;  3QQM A;  4JI1 B; 
#chains in the Genus database with same CATH homology
 3N42 B;  4CS2 A;  2Q2U A;  3BHP A;  3KYH C;  5D1P A;  4DR2 H;  4LFB H;  3RGZ A;  4NVP A;  3QG5 A;  3U0Z A;  2UXB H;  5LA6 A;  3LNN A;  4DK1 A;  3GDE A;  1SA0 B;  2ZIN A;  1WPB A;  3RYF A;  5BMV B;  1S68 A;  1NT2 B;  1HR0 B;  1HNZ H;  1VF7 A;  5LMU H;  4DK0 A;  2ZNI A;  2PGG A;  2F93 B;  2VPS A;  1N33 H;  4BWS C;  3PN1 A;  4O4H B;  3RYH A;  3QF7 A;  4X20 A;  4DV4 B;  4TV9 B;  4FLT A;  3IAY A;  4B3M H;  4LSX A;  4PZ7 A;  3MAQ A;  1DGS A;  4DUZ H;  4UCU A;  4DR1 H;  3JAW B;  4DRX A;  4I4T B;  4O4L B;  3A2F A;  3JAR A;  4X1K B;  2Q7H A;  4F6R B;  4WBN B;  3W1G A;  3F8N A;  5FLX W;  5LP6 B;  2UXC H;  3B2E E;  4I55 A;  5C8Y B;  2F1M A;  3HKB B;  5K1P A;  1T5E A;  4MTD A;  1XMQ H;  1D5A A;  5LMN B;  2HVS A;  2YXL A;  4GKJ B;  2R9A A;  4DR2 B;  4LFB B;  4U3J A;  5GON A;  4LF7 H;  4B3M B;  3ICX A;  4I7H A;  2F4V H;  2HGS A;  5FPO A;  4DV1 H;  4JV5 B;  4JV5 H;  5EIB D;  3JAT A;  4FLU A;  2VWK A;  3DSQ A;  2JVD A;  2CFM A;  5KMG A;  5LP6 C;  3TY8 A;  4LF9 B;  5JVD A;  4HBN A;  4LF7 B;  4IAJ A;  4NXM H;  1TGO A;  4YJ3 A;  5LL6 b;  4LMY A;  1CKN B;  5JCO A;  5IJ0 A;  1HR0 H;  1P16 A;  2HIV A;  3KXY T;  5LXT A;  5CB4 A;  3N6X A;  5IT9 W;  4FLY A;  5LYJ A;  4B08 A;  3NBY B;  3E22 A;  1Z5W A;  4LNU A;  2UXC B;  3JAK B;  4GKK B;  2YIB A;  1GYF A;  5FNV B;  1MZB A;  3JAS B;  3U10 A;  1N32 B;  5KHG A;  1P8L A;  4X1Y B;  4O2A B;  1XHX A;  1XHZ A;  3HXL A;  1FKA H;  5CA1 B;  2ZCE A;  2FE3 A;  2UXD H;  2Q0A A;  4X1I A;  2HIX A;  5FD5 A;  1TUB B;  2PUS A;  1L8D A;  5ITZ A;  2XHB A;  2KSW A;  4JI2 H;  1Z2O X;  1M93 A;  4CS3 A;  4FLW A;  3WB0 A;  2E5L H;  1HNW H;  4PI2 A;  5EZY A;  5BR8 B;  2HHH H;  3RGB A;  4DR5 H;  3VQY A;  1X9N A;  1SQF A;  2ZJT A;  4LSA A;  3T1H H;  5CA0 A;  4DV2 B;  4JI0 B;  5IJ9 B;  3L4J A;  1SKV A;  4EFE A;  4O4J B;  4A2B A;  3HKD B;  5DIS C;  4ZOL B;  2EX3 A;  2PY5 A;  2E3C A;  4K0K B;  3RTX A;  4RB3 C;  4DV7 H;  3RYC B;  2UXD B;  3HKD A;  4MV7 A;  4O4J A;  3T1Y H;  2UUB H;  5FPR A;  4EB6 A;  4MTE A;  3J7A K;  2VQF H;  4E6N A;  1RSO A;  5J2T B;  2RQ6 A;  1KU9 A;  4X66 B;  2YI8 A;  5KHI A;  4UCR A;  3QTC A;  5D5Q A;  1FJG B;  1FJG H;  2KKW A;  4LFC B;  5JJE B;  3RIZ A;  4CC6 A;  1E4G T;  4X62 H;  4TUY B;  4CH6 A;  4FLZ A;  4K8X A;  2RGV A;  3RF2 A;  1TUB A;  4AHC A;  2VUG A;  4JI4 H;  4PI0 A;  1XMO B;  1Q8I A;  4DR6 H;  4CC5 A;  4DV1 B;  4FFB B;  2YIA A;  4DV0 B;  4O2A A;  3RYI B;  4EFB A;  5EIB C;  2R72 A;  4EQ5 A;  5FNV A;  3SJA C;  1JFF A;  3DF7 A;  1JFF B;  2RJZ A;  4FVM A;  1O75 A;  1N36 B;  1XMQ B;  3RYI A;  1N34 B;  2PYJ A;  1O9H A;  4LNU B;  4FFB A;  4DV2 H;  5LYJ B;  4MV9 A;  1ZAU A;  4JI8 B;  2UUC H;  4AQY B;  4UCV A;  5IJ0 B;  4ETS A;  4JI7 H;  4DR5 B;  1CKN A;  4TUY A;  2HHH B;  1WH2 A;  4YJ3 B;  3FMA A;  4DUZ B;  3T1H B;  5KMG B;  4RAZ A;  4DR4 H;  3JAT B;  4YY3 B;  5BR8 H;  2ZIM A;  4J0M A;  3BRC A;  4RB0 A;  3OTO H;  4LF4 H;  4I9Q A;  5J2T A;  1TA8 A;  4JI3 B;  4U3J B;  3RWR D;  2JGU A;  3SGI A;  4EB6 B;  3K59 A;  2XIG A;  5FD6 A;  3U11 A;  3HKB A;  4TQF A;  3RJ0 A;  5C8Y A;  1IBK H;  4DV5 H;  3RYC A;  5KHK A;  1ZHS A;  4F6R A;  4ZOL A;  3JSN A;  4WBN A;  4I4T A;  4O4L A;  4X1K A;  5A2Q W;  3JAW A;  4OX9 B;  1TAE A;  5KHH A;  5KHJ A;  5IJ9 A;  4B3S H;  3W1B A;  4NXN B;  4CH5 A;  2HVQ A;  4LH7 A;  3UQ8 A;  4DR7 B;  4X65 H;  5CA0 B;  2JS5 A;  1I6U A;  4TV9 A;  4X20 B;  2O03 A;  4B3T H;  4LF5 B;  3N41 B;  4X66 H;  4K8Z A;  3RGX A;  1Q43 A;  4O4H A;  3RYH B;  3M7M X;  1XI1 A;  5EZY B;  4JI6 H;  4NXM B;  1B04 A;  1HNX H;  3ZS8 C;  4GLX A;  2VQE H;  1XDN A;  5EOY A;  4FLV A;  4BWA A;  4B3R B;  4JYA B;  4CS4 A;  5ITZ B;  3BA8 A;  5LMN H;  4CH3 A;  2P22 C;  4LF5 H;  4DV7 B;  4DRF A;  4X1I B;  3THO A;  4DUY H;  3VQV A;  4CH4 A;  3N44 B;  5JCO C;  1ZHQ A;  3N40 P;  5BMV A;  3K58 A;  1XNR B;  4LH6 A;  5CA1 A;  2YCH A;  2UUA H;  4B3S B;  1HW7 A;  1M4U A;  4X1Y A;  5JJN B;  3JAS A;  4X64 H;  4KHP B;  4KHP H;  4LFA B;  4FM0 A;  3MWM A;  3JAK A;  3J80 W;  3E22 B;  2CAZ C;  1Z5V A;  1S5J A;  3K5O A;  2V4D A;  2HEP A;  5CB4 B;  4YJ2 A;  5LXT B;  3KAJ A;  3J81 W;  4JI5 H;  1P49 A;  4GYC B;  3CHX A;  4Q6G A;  1VS0 A;  1HNX B;  2IM9 A;  5D1O B;  1SEI A;  2QJ1 A;  5JVD B;  3K5M A;  4LF8 B;  4JI6 B;  1JJO A;  3TY9 A;  5KX5 A;  2YI9 A;  4O4I A;  1XNQ B;  4X65 B;  4R7R A;  5GON B;  4DR7 H;  1QHT A;  3NBZ B;  1TVK B;  2YIB D;  5LMU B;  1FFX B;  1HNZ B;  4APM A;  3NC0 B;  4ZIB A;  3KAK A;  4OX9 H;  3RR5 A;  1A0I A;  1CKM A;  3BA9 A;  4AQY H;  2UUA B;  3M4I A;  4I55 B;  4RB1 A;  4FM1 A;  2WDT A;  4DR1 B;  5LP6 A;  4JI1 H;  4DUY B;  4DV5 B;  4KL1 A;  3JAR B;  3K3V A;  1N36 H;  4JYA H;  4DRX B;  3HKE A;  4FM9 A;  2OYQ A;  3LML A;  4D7S A;  3L4K A;  1QQC A;  4DV0 H;  1BJT A;  4UCS A;  1E4F T;  5JH7 B;  4LF4 B;  3OTO B;  4LR3 A;  1S03 G;  4DV6 B;  3N2G B;  2F4V B;  4B3T B;  2GV9 A;  4PZ8 A;  4PDB A;  2F95 B;  2F66 C;  3BAA A;  1WNS A;  3FFQ A;  3SJC C;  1I7F A;  1IBL H;  4NXN H;  5EYP A;  3CSX A;  4Q0Y A;  4X64 B;  5JQG A;  4JI7 B;  1JMK C;  4LF6 B;  1I94 H;  3EYY A;  2UUC B;  2BTO A;  4JI8 H;  4DR3 B;  4DV3 H;  1CKO A;  4RAY A;  4RB2 C;  1M5I A;  3RYF B;  1IBK B;  2RGR A;  1SA0 A;  4AIL C;  2WYO A;  1YEW A;  4IHJ B;  4B3R H;  5LA6 B;  2QM4 A;  5K1X A;  2UU9 B;  3JAL A;  4RZQ A;  1FVI A;  2UU9 H;  2VQE B;  2Q2T A;  4JI3 H;  3VQW A;  2ZNJ A;  3ETQ A;  5IYZ A;  4M7E A;  3UT5 A;  4HNA B;  2BTQ A;  4UCO A;  4O2B A;  3WB1 A;  3W5O A;  2CW8 A;  4YY3 H;  1N33 B;  3HKC A;  3TY5 A;  2VWJ A;  1I94 B;  3ZED A;  3L2P A;  4PZ6 A;  4UFZ A;  1SQG A;  4D7T A;  3BPZ A;  3HKC B;  2ZIO A;  2HVR A;  2PYL A;  3KAL A;  2MCT A;  1Q5O A;  4HNA A;  3CB2 A;  5IYZ B;  2WE6 A;  4I50 A;  1J5E B;  2E5L B;  1HNW B;  5J2U A;  1N34 H;  4PHZ A;  2UXB B;  1AN7 A;  3H20 A;  2ZM6 H;  3JAL B;  4ZI7 A;  3CVZ A;  4IHJ A;  2R70 A;  3T1Y B;  1H2S B;  3C0F B;  4FM2 A;  3N2K A;  2W57 A;  4DR6 B;  1J5E H;  4UCT A;  1Z2P X;  5D5P A;  4TV8 A;  2P5O A;  4JI4 B;  5JQG B;  2ZM6 B;  3K57 A;  4DR4 B;  5LOV B;  5IWA H;  3OTF A;  3VNN A;  3JAM W;  5EYP B;  4GKK H;  1V9P A;  4JI0 H;  1KMI Z;  4IIJ A;  4ZHQ B;  1XNQ H;  3BAB A;  4YHH B;  1Z2N X;  3N2G A;  4ZHQ A;  5JH7 A;  4IIJ B;  4EEQ A;  2PZS A;  3IG0 A;  4LF8 H;  1BGW A;  1X4T A;  2PTM A;  3HKE B;  3JSL A;  2Q7E A;  2Q7G A;  4LF9 H;  4JI2 B;  5LOV A;  1Q3E A;  1IBM H;  4TV8 B;  1SYX B;  1G6U A;  4JI5 B;  1L2Z A;  4FLX A;  3WB2 A;  3S24 A;  3N2K B;  1IBM B;  1XK5 A;  4A2A A;  4GKJ H;  4TQD A;  1XMO H;  2VOB A;  1N32 H;  1M0W A;  3SR2 C;  3RFR A;  4LF6 H;  4X62 B;  1FFX A;  4ZI7 B;  4LFA H;  1TVK A;  4TOI A;  3N43 B;  3GB8 B;  1O9G A;  4O4I B;  3GJX B;  5J2U B;  4DV3 B;  4DR3 H;  4I50 B;  4LFC H;  1WN7 A;  4BW9 A;  4YHH H;  1IBL B;  5KX5 B;  1XNR H;  1XQ8 A;  4DV6 H;  5D1O A;  3K5N A;  2VQF B;  3VQX A;  5IWA B;  2CW7 A;  5JJJ B;  2UUB B;  3SJB C;  2OWO A;  4L8J A;  4DV4 H;  4YJ2 B;  1M0T A;  3QWU A;  4O2B B;  2BTQ B;  3UT5 B;  3K5L A;  4K0K H;  4JI1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...