3UQ8A

Structure of adenylation domain of haemophilus influenzae dna ligases bound to nad+ in adenylated state.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
NIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVARIEDRLILLPAPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQEELTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Understanding of NAD(+) Recognition in Bacterial DNA Ligases.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA ligase
total genus 106
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2011-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3uq8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3uq8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3uq8A02
4JI8B 4LF5B 4DRFA 5D1OA 1IBMB 4LFCB 4EFEA 3T1YB 1I94B 1HR0B 1XK5A 5DISC 3BABA 1N36B 4UCRA 1A0IA 3NBZB 1N33B 2UU9B 3S24A 3L2PA 3JSNA 4DR2B 1XNQB 3TY8A 1P16A 1IBKB 3TY9A 4NXNB 4LFBB 2VUGA 2HVQA 4UCOA 1XDNA 2HVRA 3RTXA 4DUYB 4JI6B 2E5LB 1HNWB 1XNRB 5FPOA 2ZM6B 1P8LA 4DV5B 4DUZB 1V9PA 4JI3B 4LFAB 3TY5A 4DV7B 3SGIA 4DV2B 5D1OB 4GKJB 1B04A 4DR3B 4DV4B 3NBYB 4OX9B 1TAEA 3GB8B 3OTOB 1IBLB 4X64B 2UXCB 5FPRA 4EEQA 2HIVA 4DV1B 1N34B 4UCTA 4JI7B 2HHHB 4DR7B 3BA9A 4LH6A 1J5EB 4JV5B 3RR5A 3UQ8A 3W1GA 2CFMA 1XMQB 4LH7A 2HVSA 5LMUB 4KHPB 4DR4B 4DV6B 5D1PA 1FJGB 3BA8A 1S68A 4EFBA 1VS0A 3PN1A 4JI0B 4CC5A 4DV0B 4UCVA 4DR1B 4B3SB 2Q2UA 4B3MB 4B3RB 4E6NA 2Q2TA 2VQEB 2UXBB 3W5OA 4PZ7A 4X62B 3VNNA 4X65B 5IWAB 1CKOA 4LF7B 4DR6B 1ZAUA 4LF9B 3QWUA 4AQYB 3KYHC 1CKNB 3NC0B 4K0KB 1DGSA 2F4VB 1X9NA 2UUBB 4UCSA 1HNXB 4JI4B 4X66B 5LMNB 2VQFB 3GJXB 1TA8A 3W1BA 1HNZB 3BAAA 4UFZA 4YHHB 4JYAB 1FVIA 4PZ6A 3JSLA 4LF6B 4GKKB 1N32B 4JI1B 4NXMB 2UUAB 2HIXA 4DV3B 2UXDB 5BR8B 4CC6A 4JI2B 4JI5B 1CKNA 2OWOA 4YY3B 3T1HB 2UUCB 4LF4B 1XMOB 3GDEA 4UCUA 1CKMA 4GLXA 4B3TB 4TOIA 4EQ5A 4PZ8A 4DR5B 4LF8B
chains in the Genus database with same CATH superfamily
2Q7HA 4JTDB 4I50A 2FTKA 3CJHA 4DV2O 2XCPA 5J2UA 2AHZA 5IT9W 2R92G 2AW9A 2EJ2A 3DGEA 2VWJA 2W9BA 4J9SA 4R50A 5KHGA 1OCCC 1YJWV 2QKSA 2Z02A 3RYIA 1NR7A 3V4ZA 3TY8A 3S3WA 5J2TF 3RIZA 4Z1VA 1ZHQA 1M6VA 1OHHG 1R3IC 4ICGA 3CD6V 4BW9A 1MSWD 4XYLB 2DN9A 2RDIA 2R87A 1MZFA 4P9OA 2EZOA 2E74B 3HKCA 3EPGA 4I4TA 3RJ0A 1F4MA 4FE2A 1C3OA 3AG7A 3HOUG 1WNSA 4O7RA 4ZOLA 3VMMA 1KBHA 3G4SV 4WCEV 1US6A 2GBOA 2FP4B 5KX5B 4IR1A 2ZNIA 2W9CB 3JD4A 4MV1A 3SPIA 4HYKA 2YZLA 3T9CA 2HIVA 5EWEA 1RJPA 3GIKA 4XDKA 2RGRA 4IRDA 1VQ5V 4WBNA 4EYIB 1AI5A 1AP5A 2C2EA 2B5UA 3OTOO 5CB4B 1ZQ7A 3UYYA 4X1IA 4TV8A 2W6NA 1WP7A 2EINB 1Y67A 5IY5B 4MTFA 1PL4A 3ASNC 2BCCH 2PTMA 3JARA 2WLLA 3RGXA 5JH7F 2AGAA 4MV9A 1UJWB 4Y8VB 1VEWA 3UO3A 3AG4B 4XDJA 2E76B 2ILMA 3OT7A 1M56B 4O7VA 5BMVA 4NLGA 3L71H 3ZN1A 1M1KW 4DR2H 3B2EE 4XYMB 3CCQV 2UUBB 4JYAO 4YAJB 5EC2C 1K1QA 3SYPA 3JCUZ 2CH7B 5IYZF 4X65H 5A9GA 1E79G 4O4JF 2FYUH 1QVGU 2ZE7A 1V51A 1P49A 3BRCA 1M0WA 5KFLA 4IWYA 2HJWA 2CTWA 4DK0A 3JSLA 2XCAA 1N32B 1KTAA 3CCVV 3ZRXA 3LSUA 1SKVA 1V55B 2XIGA 1K4CC 1NVPB 1VBGA 3MR3A 4UCUA 1I94H 2E75B 2CH7A 1XL6A 3FB5C 3GTOA 3NUAA 2ASDA 4LFAH 4DR7O 5D8DA 5I5SA 4DRXB 1Z2GA 2UXDH 1XBLA 5H2FZ 2RJZA 4TQFA 2W0XA 1THZA 1AN7A 5BPHA 1X4TA 2JEXA 4JUZA 3ZCCA 2OCCC 3N42B 2ZR2A 3CRMA 3VQYA 4IGGA 1O9GA 4NR1A 1XDNA 4I50B 2L35A 5CBHA 3ETEA 5B1NA 2Z04A 2HVRA 4JI1H 2XNDG 1FFXB 4JI2O 2OT5A 5L9XA 2HG8A 2YS7A 5I5UA 3WWIA 3J80N 1KU9A 3T9EA 1XNRB 1AUXA 1BGYH 4ME6A 2YDEA 4RU9A 2RQ6A 1ENVA 2I8CA 3OR6C 2P90A 3L73H 2JK5C 4DR7H 5BXZA 3BACA 2R8KA 1FPOA 1UNNC 2Q0OC 4IWXA 4EBDA 3P3PA 4YJ2B 3B77A 2ADPA 1RJQA 2CAZC 3JATB 1XHXA 4EB6B 4X64B 1IBLB 2HP8A 3QO8A 3WNZA 1XMOO 4A3JG 3G8DA 3KHHA 3F5WC 4UUJC 4CH6A 2IJJA 1GLVA 2WE6A 2UUAH 3DF7A 3FB7C 2OIEA 4HNTA 4WD3A 3FYEB 1RSOB 3JD2A 2XOKG 5IYCO 4ECVA 2WAMA 4B3TH 3N40P 3CCSV 1NI8A 1S76D 5H9CA 4IT5A 4WFGA 5CA3A 3G71V 3QZ7A 4DUYH 1T3NA 4FLZA 4J9ZB 3QO5A 2RF4A 1K33A 5JVDB 4JAUA 3CQZA 1R6TA 1WPBA 1CKOA 5LMNH 1S0MA 2Y48A 5KFJA 4RWUA 3WB1A 2LGWA 2GTSA 4LR3A 2Q8VA 3T4ZA 4AQYB 1H8EG 3KZIZ 1W2BU 1K1SA 2O57A 2BTOA 2RDCA 1SQVH 1BMFG 4PBCA 1G6UA 3OTOH 2ZM6O 3GJXB 5KT3A 2WLMA 1L0NH 4A3LG 1JOYA 3TW6A 2DMXA 4MTGA 3K5MA 2A7WA 3ABUA 4FJCC 1K4DC 5I47A 3L75H 4DO2A 2HGWA 1L1FA 3MHSC 4FLUA 4DQNA 1FXKC 4DXWA 4B3RH 1RP3B 1H2GA 3IC7A 4GLXA 3IFXA 2FPPB 2ZDIC 2X6CA 3N6XA 2COIA 5EZYF 4LCUC 1I2KA 4O7SA 4UVCA 1HR0B 3CS5A 4H0LB 4Q8FA 2NVYA 2LQTA 4UCRA 5BWVA 1YIJV 4PI2A 4K0KH 5IJ9A 4FFNA 3ZHUA 4NZOA 2C2AA 3M9OB 1VP7A 5CMUA 4DRXA 2Q67A 1W96A 2EIJC 1G4YB 4JPRA 3NGDA 2XAQA 4ECTA 4B08A 5AG2A 4DV2H 2JJ2G 1GN6A 4FM0A 4I7HA 4J9NA 4I9QA 2ZINA 5KG5A 2VUMA 1RK6A 5L3FA 2E5LO 3TINA 2COGA 4JASA 1ZL8A 1WP8A 3B40A 3PO2G 2QWNB 2ARHA 3SGIA 4JI6H 5IJ0B 5IYDO 3JD0A 1RFYA 5KT2A 4GCZA 5EDWA 1G2WA 3RGZA 3CC4V 3HOYG 4P9PA 4LF6H 1N34B 2FMAA 2F93B 1WA8B 2WA3A 5IYZB 2QK4A 3W1GA 2PGGA 4PA6A 4DL4A 4QE9A 4X20B 1OCCB 3T9FA 4A5UB 4DV0B 5DGHA 1I7FA 5IWAH 3L74H 3D3QA 4JI7O 1DAAA 1VF7A 4U7NA 5LXTB 4B3RB 1KP2A 4FS1A 4AQYO 1XILA 5LMUO 2R7MA 1H38A 5DGBA 3KKYA 2UXBB 5KFCA 4LWSA 3K58A 3FB6C 1EZ1A 4NXNO 3U10A 4BWAA 4LF7B 3RAQA 2ZGIA 4KFMA 2Z5UA 2JS3A 2HVJC 1QNMA 5CA1A 3ETHA 2YW2A 1XHZA 1CEZA 3LDCA 4TV9B 2UXCH 5KFXA 4O2BA 3LMLA 1VQ7V 3Q4HB 3CEIA 4JV5H 4RAIA 1FVIA 3EHBB 3WFVA 1BS3A 4JTAB 3UZBA 4J9KA 3CWBH 2CGNA 3V6KA 2X6AA 1EKPA 3RV3A 3U9SA 3ZMUA 4F6RA 1VQ9V 4ECSA 2Q5ZA 3I4NG 2GSMB 4DR5B 5BR8H 3DAAA 2CW8A 2JIZG 4HAMA 1HDJA 4FGRA 2EINC 5JWPA 3HOXG 4G27B 1QCEA 1IYDA 4IHJF 4LC1A 2W9CA 3ETJA 3SI8A 1Q3EA 3N8DA 3ASNB 1K97A 3OD4A 4LF9H 3OSNA 2HHHH 1N0NA 2OCHA 2UU9B 1XL4A 5KG4A 3R23A 2RCVA 3LNNA 3ZMTA 3BG5A 3ZHQA 1M56C 5LA6F 1JIHA 4I55A 3PZPA 3BVOA 2QWPB 5KA5A 2NR5A 1N56A 3ZBHA 1F4NA 3W7TA 3MHHC 4A3MG 4LFBH 4A3FG 3K03A 1RPRA 2JA7G 2Q68A 4FU0A 4BXXG 1VF6A 4K8ZA 1ZWIC 5LA6B 2W6QA 5DG8A 1O75A 3KHGA 4FFPA 4YXWG 5EIBC 2IW5A 1I94O 5D1OB 5IWAO 4MW8A 1D5AA 1W59A 1TUBB 2CTRA 5CA0F 5IP7G 4DUZH 4EKWA 2PYLA 1XDCA 4JF3A 1WCMA 1GTOA 4I7ZB 3CE2A 3A0RA 4UCTA 4DYLA 4JV5B 3BQ0A 2W6JG 4FFBB 1I2LA 5B1AC 3PR4A 1IBMO 3J7AU 3TK1A 2EJ7A 3HKEA 1W0JG 1GSOA 2Q2UA 4J41A 3FKIA 1Q82W 5JJEB 4ED2A 4DR2O 1TVKB 4ZOLF 2IJHA 3SDLA 1AB3A 1HWYA 1U96A 1KC7A 3K06A 1K5SA 4C5CA 1CXZB 2QSAA 4R6ZA 4O86A 3VPBA 4RB2C 4O7YA 4O84A 5EIBD 1VQ4V 4O3PA 5CBGA 3ZS8C 1SYXB 1OWTA 4OXSA 3GIQA 4RQEA 2B1GA 2R6FA 3NXSA 3AEIA 3K79A 3RYHB 3OUFA 2VQDA 2VQFB 3Q4HA 1TVKA 1GO3F 3JAMW 1EZJA 4O4IB 4X1KB 5KMGB 2CDYA 4DR6H 2CNVA 4PA7A 4BIUA 2E2HA 4X1YB 4LF6B 3CJHB 2CE4A 2DJVA 4MV3A 2W9AA 2PMZE 2P06A 2P22C 4QIWF 1IXMA 2VOBA 4JI0H 5LBQA 4TV8F 4LF9O 1HP8A 5KFNA 2VQEO 4F6RB 2CZGA 2QM8A 3T99A 2B63A 1Q5OA 5C8YB 4YBZB 3VQXA 4EEYA 4EG0A 2X0LA 2F43G 2FE3A 1SZXA 4X1YA 4OPHA 1EUDB 1NQTA 3CMAV 3B4SA 5GTHZ 5BMVF 5BWWA 5KFAA 1N33B 3RF2A 5I5WA 2GUZB 2EJ0A 2C2RA 5KHKA 3HKCB 3FFQA 5BWXA 3AW8A 1GSHA 2J6TA 1IBKB 2JA7A 4RUEA 2ZE5A 3L9DA 4X62O 4CMDA 4G2KA 3WWJA 3FAVB 2HVQA 2V58A 4DV6H 2ASLA 4B3MH 5KT5A 5DECA 4R8UB 2JS5A 3HKBB 5FPOA 2QM4A 4L8JA 5KS8A 3K5OA 3JRXA 4ECWA 2GUZA 3WWHA 4MAMA 4DUYO 3UM7A 3QF7A 1XREA 4FLYA 4MVRA 4DW0A 4DV3O 5KUMA 1FXKB 3CHXA 2LW7A 2ZD9A 3GV7B 2C2DA 2J6SA 3HKDB 4OX9B 2WB1A 3VBBA 4R8UA 3K5HA 3TW7A 4UUGA 5L3DA 4MVZA 4DV7O 5GONF 1M90W 1GSAA 3JRWA 5KFZA 3G67A 3BA9A 2EJ3A 4PI0A 2VQFO 3CRAA 1FJGB 2R85A 3SJCC 3PN1A 4YHHO 1RYSA 2WA4A 5E79Z 3AK1A 3AK3A 3CCRV 4M7EA 5DGIA 1K34A 2JA5G 1N0JA 2ZDIA 3X2QC 3RFRA 4HNUA 5CM0A 5LP6C 2F23A 3N2KA 1VQOV 4MA5A 3Q8QB 4KL1A 1BSMA 1EUCB 3PFFA 1DGSA 2BOCC 4FVMA 1X9NA 1HNXB 1QHTA 3R66A 1MZBA 3KAJA 4AYBA 3EPIA 2YXYA 2GQSA 4LSAA 5DN6G 4CE5A 2B63G 4YJ2A 3T1HH 1JR9A 2VA2A 4UFZA 5KX5F 4J80A 3T54A 3H4BA 2JA8G 4J7KA 4NXMB 1S5LZ 2QWRB 2UUAB 3Q8RB 1IOVA 3I55V 2PY5A 2UXBO 4YY3B 5A2QW 4W4KA 4J0MA 5K3WA 3M99B 3ETGA 5KA6A 4NTWA 4YIPA 4O2AF 3DXRB 5KFYA 1KJIA 3MDSA 2AZ0A 4EBEA 1AR4A 1WAZA 2JEGA 3A2FA 5EBLC 5JVLA 4F50A 3HKZE 4ZQIA 2YS8A 3WO0A 4FMTA 1EKVA 1WA8A 3E86A 4O2AB 4X64O 1K8AW 1O9HA 2Y4UA 1XNRO 3N43B 3GTGA 1QR9A 3CYOA 1GK9A 1M57B 1DF4A 3H9VA 1VAJA 1H2LA 2Q9LA 3J81N 2DIKA 2CUGA 1AP6A 3E8HA 4HNAA 4WHXA 3V4SA 4LMYA 4X62H 4A2AA 5K1PA 3K3PA 3P3NA 1A3GA 4U6PA 5LHIA 2COJA 3EXAA 1P84F 1Z5VA 2WLHA 3AK2A 4OGQB 4RNOA 5KFGA 4DV7B 3LQSA 2R8JA 4TV8B 4X88A 4UB8Z 1KUTA 4DV2B 5JH7B 4LFCH 1B04A 3A0HZ 1M9NA 2D3OW 2YIBA 5JJNB 3Q2OA 3CRCA 4JI5O 2UXCB 2Q4PA 5CBFA 5FNVF 3ZIAG 5KFVA 4MVOA 5CE8A 3ZRSA 5JVDA 3F7YC 1Q90D 1W93A 4FFOA 1H2SB 2CTPA 4RQFA 1XMQB 2QB5A 5KFFA 3GWOA 2NU8B 2Z0AA 4J9PA 3H1KH 2UUAO 1Q6UA 2W6OA 4F6EA 4BY7G 2DE0X 1QLNA 1VF5B 3E22A 3WB2A 1PM9A 1Q6IA 4DV0H 5IWAB 5HNEA 3QTCA 3KYHC 4CS4A 2R7NA 3E8BA 5KFWA 1NS1A 3CSWA 1BGWA 4ECZA 1F51A 5DG7A 1ZTEA 2R9RB 3T4DA 4R8CA 3GV5B 3U0ZA 2RNBA 5JQGF 4B7EA 2XAFA 1BL8A 1VQ6V 3RBDA 3C3TA 4A3KG 1PK8A 2YYAA 2YIDA 5B3SC 1BQ0A 3P32A 2BE3A 4YJ3A 1Q43A 5T14A 3K08A 4I50F 3Q8PB 5B1AB 2UXXA 2QDOA 1GN4A 4CBCA 4JI8B 3MD0A 4ZKIA 3MR5A 4DRFA 5D1OA 5KG3A 1KT8A 5D5QA 3NR7A 1FFTB 4A3GG 5JCOC 1MA1A 5FR9A 4RAZA 2FB9A 3H4DA 4E4TA 5IYZA 4X66H 1S03G 2K9PA 2Q6AA 4LFBB 3AG3C 4O4HF 2BQUA 1UFIA 3ABLC 4UCOA 1PNLA 3RB3A 2LGQA 2ZE6A 4MV7A 3ABTA 1HNXO 1SZTA 3KHLA 4YB8B 3JAWB 4DIMA 5LMNO 2V9WA 2JA6G 4ED3A 4DR3O 4MTOA 4DV4H 4A2BA 5DEDA 4RZQA 1NR1A 4IYIA 1TWFA 1IURA 1JMKC 2IH3C 2LFSA 5EWFA 2OH2A 1CP9A 3U9TA 1OCOB 4JYYA 5KUKA 2UXNA 5BR8O 2C35B 2DAAA 5KFQA 4FBTA 4DV5H 5BPFA 2P6JA 4DR1O 3JAWA 2GQRA 4JI7B 4LH6A 2WLNA 1GAXA 1SS3A 4QW9A 4JI5H 1I6UA 3N41B 4BIZA 2XAHA 4LFCO 4DV1O 3LULA 3R5FA 4LWSB 4LF7O 4DV5O 3E22B 2IJKA 2F95B 3TIIA 2P5OA 5H5NA 2CGOA 2W71A 1L0LH 4PZ7A 2PBZA 5LL6Y 2O03A 1IDSA 3SYOA 1FD9A 2FL4A 4K0KB 1ET0A 3RYFB 5KFUA 2FK3A 4TT3G 2IJIA 4XBFA 4CS2A 2AGPA 1TWCA 2KG7A 3JAKA 1I1MA 4X64H 1IBKH 1K73W 1SQPH 1R3KC 2Q7GA 2W0FC 4AQYH 1YTFB 1WJZA 2ITDC 4A3EG 5GW7A 4QWAA 2BQRA 4LF7H 3CC7V 3W7WA 2GPSA 5I5YA 2SCUB 3RB0A 3SJBC 2UXDB 1IOWA 4RUFA 2Q0AA 3M8AA 2H8PC 4ED0A 4APMA 2OWOA 2MCTA 2JGDB 1HNWO 4YIOA 1YITV 2FKLA 1CKMA 5L3EA 1VF6C 2DW4A 3JYCA 5FD6A 2R7ZA 1B6QA 4HYOA 2N74A 2V4QA 4HBNA 1KEEA 2QYZA 4DR4O 2ZKOA 4GX5A 3BABA 4BWSC 5KFEA 3W7XA 2YWVA 3X2QB 2XCLA 3V6JA 2E5LH 1A0IA 1C30A 4ABMA 3GVMA 5LP6B 2PF4E 4J9QA 4DV4O 4X89A 4MSWC 5CAEB 5LYJF 2WTFA 3RBZA 4X8AA 3CCLV 4Q4CA 2VUGA 3IC9A 3OGIB 5KFMA 3ZMSA 4JYAH 1T36A 4ASUG 4YY3O 2J9GA 5ITZB 1TUBA 1S5JA 4YP3A 1A9XA 3OUSA 1Q81W 2EILC 2IH1C 5LP6A 2OTLV 4C5AA 4IAJA 2QA4V 2RMKB 3OE7G 1QU7A 4NTXA 1R3JC 4EYHB 1BE3H 4H33A 3OEEG 1NZ6A 1B6SA 1FXVA 5KT6A 1I5YA 5HFLA 3DC6A 4BW5A 2A9HA 3Q1KA 2HHFB 1JFFB 2YI9A 1TWHA 4NTYA 3SPHA 2WSSG 2FMLA 3CCMV 4DV1B 2GV9A 4GKKH 1BHAA 3EVKA 2Z3YA 5I5TA 3Q8SB 4WFEA 4DV7H 1M7JA 2XGPA 2P0AA 4GKJH 1PV0A 1S68A 3GV8B 1S3JA 4FFMA 4X65O 2WDTA 3T1CA 5JCOA 1CE8A 4LNUA 2AGOA 2EBOA 3GTLA 3OHAA 1SQXH 4KHPO 4RUCA 3TGUH 5FNVA 1YEWA 4RZRA 3KREA 1K7DA 1M57C 4N23A 2YIBD 4J9OA 3RB4A 1PNMA 1Y6XA 1L8DA 4C7UA 4DR6B 3G8CA 3K9SA 4FS2A 1YVWA 2HVKC 4AILC 3E5NA 1CKNB 3APOA 4O3NA 2M6YA 5KG2A 2FPGB 4YJ2F 1PNKA 3STZC 4LF4H 3PW0A 2ODMA 1Y74A 4XDLA 1RPOA 4O2AA 1FXHA 3R9RA 4OX9H 4HR7A 1S0VA 2UUCH 2I87A 2R7ZG 4WFBV 4TM5A 2NLJC 3KTMA 4JI4H 1Z2PX 2GTAA 3GWKC 1YSCA 1XNRH 2HKOA 3K9AA 5LHGA 4GKJO 3HKBA 3RUPA 1XI1A 3U11A 4QIWA 3GILA 4O4HB 1CKNA 4ETSA 2Q73A 2FLPA 3HB3B 3RT3C 2XGQA 2Y4TA 4EQ5A 5LGUA 3WB0A 5K2MA 3QVNA 4H44B 5B5EZ 1PX2A 2W6MA 4MVQA 4R7CA 2VQEH 2R93G 5DGAA 3MWMA 3L4JA 4LFCB 3R5XA 1N4CA 5C4XG 4K35A 1XK5A 5DAAA 1V54B 3NBZB 2F66C 5I5VA 4NYEA 2EJRA 4TUYA 1P16A 2QF7A 1KC8W 1DF5A 3MJFA 3V6HA 3H3VH 3ZMVA 1JVMA 1R3LC 3ASOB 5FLXW 5KFHA 3UT5B 4GZRB 2V4DA 4J7JA 2LP7A 1ZHSA 5TISZ 1HNZH 1J95A 5L1KA 1BT8A 1A0GA 5DMXA 5KFIA 3PVXA 4NXMH 3KCXA 2ZDGA 3E8FA 3VA7A 1YF2A 2XAJA 4FM1A 1FKAH 4FFKA 3TETA 1N8RW 5B3SB 2F1MA 3P30A 5D5PA 4B7KA 5FLXN 2EZPA 1F23A 3HKEB 1QQCA 2YC0A 5FJ8G 4DL2A 1JJOA 3GIDA 4O4JA 1G8MA 2ZJTA 4PDRA 1WR2A 4O4LA 1IVSA 5C8YF 5KFBA 4J7ZA 2NU6B 3K5LA 2QJ1A 1JA8A 1DLBA 4MTDA 1KUQA 3EFFK 1FFXA 3OR7C 2B1IA 5J9PC 3M9NB 4KHPB 5D1PA 4DR4B 3IG0A 1FS0G 2QTOA 1NT2B 1JKJB 2A1HA 3IN5A 2FPIB 1I1KA 2RN9A 4E6NA 3LWBA 1B6RA 2HEPA 1QBZA 5FL7G 2UU9O 1OCRC 4I0XB 3AG3B 4PWQA 1NTKH 3ABLB 4FLVA 1NKDA 1AJNA 3ZRVA 2ZT9B 5LOVA 2K1EA 3G80A 3MFIA 3R5HA 4PD4F 4DL6A 5EC1C 1EM1A 1Z5WA 3J7AK 1SRYA 5KFSA 4PA3A 3NC0B 1I0HA 3LDEA 2DPIA 1SA0B 4NZMA 3D36A 3DTFA 3SE7A 3RYCA 5C93A 4NXMO 2HR3A 1M93A 2C00A 4P30A 3SYCA 4MT8A 2RGVA 1SEIA 5KX5A 4HN2A 4F4WA 1KP3A 1OCOC 3JD1A 5F9LA 1QVFU 4JI3O 3U0GA 2YIAA 3APQA 4FLWA 4DV1H 1M4UA 1AI6A 3VOUA 2BTQB 2F4VH 5LYJB 1E1RG 4HNAB 3B8MA 4UB6Z 1WSCA 4M9UA 3DXRA 4TQRA 4TVIA 1XMOB 3JZFA 4LP8A 1VQKV 4Q0YA 4DR1H 4FLTA 3T5LA 1QLEB 3HOWG 2FLNA 3G6YA 4DL7A 1E4EA 4QE7A 2AHYA 5LOVF 5JH7A 3T1YB 1TWAA 2RDJA 4DW1A 3GLKA 5DISC 1R1BA 2MW2B 3WO1A 4O2BB 2JDIG 3LUTB 1XNQB 1S97A 2UXCO 3D3IA 2P4KA 4N21A 4I9WA 4CS3A 3H0GA 4MV8A 4RNMA 2ZDQA 4DLKA 4ZHQB 1Q86W 4ECRA 2AU0A 1R6NA 2PMZA 3U54A 2E5LB 2XC9A 2DWCA 4LF4O 3BPZA 2ZXWC 4FZ1A 3ORQA 5IP9G 4LF5O 4FPPA 2YXHA 1NVPD 4LSXA 3MWEA 3FKIG 1JPXA 4G28B 1H2NA 1MMMA 3GTPA 1M0TA 4JI7H 4W4LA 4UVBA 3CXCU 1ZX3A 4DV4B 2Q7DA 2YEVB 1U97A 3AG2C 3BJYA 5JQWA 2NU9B 4CKBA 1EHIA 3PO3G 4I55B 1N48A 4QJFA 2R72A 5KG6A 1DIKA 2JA5A 2ZCEA 5KHIA 2HLDG 2HVSA 1GO3E 5LMUB 1VIBA 5L1IA 3CXHF 5IDJA 1ZETA 4JXUA 4YR3A 4BY1G 2R9IA 2QM7A 3CMEV 5IJ9B 1KQSU 1H2KA 4U3JB 1JDEA 3PJSK 4PV1B 4IIJA 1PPJH 1WLEA 3ABMB 3JAMN 1KJ8A 2BQ3A 4F4XA 4B3SH 2XTAA 2EIYA 4JV0A 5F2VO 2HGSA 1ZAUA 3T1YH 2UU9H 1MNGA 1IYEA 4O3OA 4JI8O 3T1YO 5CA1F 3GIJA 2EILB 5H6RA 3N2KB 5L3BA 3TJTA 1IX9A 1XNQO 1KYOF 4U3JA 1I7NA 3W1BA 3IGAC 1R73A 5H80A 3N44B 4PELA 5GONA 3GIMA 4YHHB 4FM9A 2OLSA 4JYAB 4PZ6A 1FJGO 4O82A 3OM3B 4JI1B 2ABJA 4MS2A 4DR5O 4O7WA 2EIMB 2VPSA 3T9DA 4O4IA 2JRIA 3OMAB 4JI5B 4J42A 1KB9F 4LF4B 2QGNA 1Q6HA 3JATA 1B06A 1XUQA 4ED7A 4X66B 4LF5B 3BHPA 4FFLA 3RYIB 2Y4RA 4C5BA 4IHJA 1BZKA 1YHQV 1TUEB 5EYPB 3RWRD 3PW2A 4JI4O 1IBLH 1LUWA 4X1KA 1S0NA 4PHZA 4X20A 4I0XA 1HNWH 3JSNA 3AYHB 5KFPA 1EN4A 3G6BA 3ZX6A 3HB9A 3PW7A 4NXNB 2I80A 4EGJA 1S5HC 2KG7B 4ECUA 3KHRA 3N6RA 1ROPA 3D36C 3VQVA 5J2UF 2YUAA 5IT9N 1IBKO 3HOVG 4O3QA 4J10A 4IRKA 3FAVA 4K8XA 2R8HA 1NBMG 2XHBA 5DQGA 4DV5B 2WLIB 4DAAA 2M7WA 3OUUA 3H0GG 4JI3B 2V5AA 2V59A 3TY5A 2NUAB 4G3IA 4CH3A 3VPCA 4U7CA 2R70A 3M4IA 4LBEC 2NNUA 2VRZA 5CA0A 3O9OA 3NBYB 3RV4A 4WBNB 4UV9A 3KALA 4QPKA 2UVWA 1KD1W 5BMVB 4MTEA 3OTOB 2R8GA 1YJ9V 2DOSA 1K9MW 1WB8A 1OZ0A 3PW4A 3OMIB 1Y76B 1CS0A 4I4TF 3S3XA 5KHHA 3MFHA 2ZNJA 2EULA 5DQHA 1GN2A 5L3CA 4OX9O 1V54C 3VPDA 1VMGA 2N04A 1XNQH 3E2EA 3K04A 1VQPV 3E89A 3JD3A 1VS0A 4CC5A 5CR5A 2LFRA 4WFFA 1E4GT 4WBNF 1E1QG 1SESA 2H94A 3WG7C 3TQ1A 1NU1H 3GTJA 4JI8H 3ORRA 3ASOC 4D7SA 5EWGA 4O7TA 3SYQA 3JZ6A 3ZRWA 4B3SO 2DYSB 4UVAA 1ORQC 4XX0B 4EBCA 3BCCH 3SR2C 3OGCC 2HFEC 1NH2D 4K6NA 4PA4A 4GX1A 4JV2A 3W7UA 4J9MA 4JI4B 1AROP 2ATKC 4IL6Z 1GM9A 1ZL8B 1GYFA 1XMQO 3T5JA 4KUMA 5GONB 4IIJB 5KAIZ 3CVZA 3FMAA 5IJ0A 5B1BB 2B9ZA 2R7LA 2WLJA 4GKKB 3BFRA 4BBRG 1K5QA 1KECA 5FD5A 3MR2A 3ETQA 4X66O 4CC6A 1UPGA 2X6BA 1S9FA 1AR1B 2UVVA 3ML0A 3QO7A 4MVUA 4QJFB 3STLC 4B3TB 4TOIA 3MR6A 1Y1VG 3UKMA 3BQ2A 4JGSA 4PDMA 4EGQA 3JASB 5DM6V 4GT1A 4ZI7A 4CHIA 1EBOA 4YJ3B 3OEHG 4EFEA 1UC9A 2WWWA 3L70H 1VQNV 1OCRB 1BNCA 2IMWP 3F8NA 2FJZA 5KMGA 4A3IG 2DLNA 4B3RO 2DWEC 3RN4A 3AX6A 1XOUA 3L2PA 2R86A 2YL2A 3RGBA 4A3CG 5C44G 5LXTA 1I1LA 2GHYA 1MZEA 1VQ8V 4ECXA 4NVPA 5CA1B 4FK5C 1BXRA 1OCZB 3E8GA 3ABKC 1MOFA 3RAXA 5C8YA 4O4LF 2BSKB 4L87A 3BY6A 5KAFZ 3G6XA 1BQZA 2EIKB 5JVDF 2FLLA 3OW2U 2XASA 3SJQC 2M05A 3MAQA 5EZYB 2QE7G 2DYRB 5HV6A 4H37A 5EK0A 1Y66A 1QLEC 4KHPH 1S10A 1RSOA 1COWG 3LP8A 4K3AA 3QNEA 1Y76A 3OMNB 1GM7A 2YRXA 2V7QG 1B33N 1WB7A 2BSKA 3I5DA 4DR7B 1YZBA 1KJ9A 3BEHA 2YICA 3JARB 4MVSA 2VPQA 4DV6B 2JEFA 2BTQA 2CNQA 4QWCA 4QPJA 4RCNA 5L3GA 5EZYA 4F4LA 4GKKO 1N33O 4F4ZA 3EYYA 1XMOH 1URFA 1Q8IA 3C3SA 4TSFG 1WN7A 2IM9A 1Y74B 2ZM6H 2ZQMA 5BY1A 1H8HG 1TGOA 3T9AA 2IBKA 4GLWA 1I50A 1YI2V 4MV4A 3RFCA 5KFOA 3QWUA 3I4MG 2ZXWB 2JVDA 1OBGA 2VWKA 3IAYA 1TWGA 4QIWE 2ZIOA 5JQGA 3GTMA 4MA0A 3DTUB 2E3CA 5C5JA 2R93A 4ZI7F 1AJQA 2E2IA 1T5EA 1I7LA 4JI2H 2JEIA 3CP1A 2WLLB 5IE9A 1FXKA 4MTXA 1MG1A 1SERA 4LF8H 4B3TO 3TCUA 5I5XA 1AR5A 1Y4MA 2YI8A 3AG2B 4FLXA 2VR1A 4GUNA 3ZHVA 3R65A 4CKCA 1D2DA 4J9LA 3CEBA 5LXTF 4JI6O 4FFBA 4PDVA 1GRJA 5LGTA 1X59A 3JASA 4ZI7B 1YTFD 4UV8A 5HFMA 2AQ4A 3ETDA 1A32A 3JALB 4PDBA 4CKEA 5E1AC 3QQMA 1IBMB 4U3FH 2JA6A 4O4JB 2YS6A 3OUZA 4LFAO 2AGQA 1S0OA 1IZ3A 2VUMG 2PN1A 1N36B 4TUYB 5IYDG 2C28A 3ABMC 5BYBA 3T9BA 3TXQA 4LF8O 1HNXH 3S24A 3OHBA 1D5NA 4DR2B 3KXYT 2DQ0A 2W8KA 2W9BB 3SPGA 5J2TA 4YR0A 3HPLC 3RYCB 2ITCC 3H40A 1QR8A 3DSQA 2KQXA 4JI1O 2DQ3A 3T1HO 3RTXA 4RB1A 3HOZG 3KG2A 2FK1A 4BAYA 1ZLZA 3CCJV 2XD4A 3E83A 4GX0A 4ED6A 1HNWB 1R9TA 4O2BF 1F7YA 5C3EG 1N32H 4RO2A 2ZM6B 1AI4A 5BWTA 1P8LA 2R92A 1VBHA 4QGPA 1GH6A 3RYHA 2EIMC 3SPJA 5KLVH 2W70A 2QTSA 2Y0PA 3LSSA 4DR4H 2P67A 2Y0SA 3N2GB 2LW1A 2CKZB 2BR0A 1E4EB 3FYIB 3MWDA 2HJDA 4UXNA 2YZGA 2YZMA 2C22A 5FPRA 1L2ZA 3RB6A 2LJ2A 4JAAA 2HHHB 5DG9A 3GQCA 4YHHH 4GX2A 1FAFA 2NU7B 1GGOA 3PW5A 3GTQA 1JCHA 1K92A 5LYJA 4O7LA 4R7RA 3BA8A 1HR0O 1Z2OX 2ASJA 4JI0B 5I60A 2Y69B 5HBRB 1GMGA 3K5IA 4O83A 5DLFA 3QZ8A 2YU9A 1HW7A 5EBMC 5CB4A 2Q2TA 2LO1A 3I56V 2Q69A 4CH4A 4I55F 2CK3G 1SC5B 2W57A 4LF5H 1NH2B 2OIGA 4ZIBA 4Q44A 2R8IA 4IHJB 2J6UA 2DPJA 4D6TH 4HQ6A 4QWEA 3G6VA 4CZZA 4O4HA 2R84A 3TXSA 1WH2A 4UCSA 1N33H 4PA9A 4DR3H 1CQJB 5A2QN 4FIPC 4O3RA 4O7NA 4QWBA 3C0FB 3OTFA 2PI4A 2QWQB 4MVMA 1HNZB 4Q43A 1WRVA 4BR6A 3H1IH 4B3MO 2IU0A 4P2ZA 2HIXA 4DV3B 3UO2A 2A3QA 2W6IG 4X1IB 2UUCB 3GDEA 3M9MB 3GIPA 1IBLO 4WFHA 1K83A 4Q20A 3CCEV 2PZSA 1YJNV 5CN0A 2A06H 4PZ8A 5LGNA 3T7AA 3WG7B 3AG1C 5EOYA 2NVXA 1EZVH 5CA0B 1Z2NX 2WLKA 2WAQA 4GC6A 2DYSC 5KFTA 4DR5H 2MK3A 1N32O 1EYZA 4RNNA 1Q7YW 3T5HA 4O4IF 4JYBA 5BYAA 1FJGH 1RM1C 4FZ0A 4DR6O 4A93G 2KKWA 3DC5A 3HT5A 1LUVA 1P7BA 5B1BC 4AHCA 1VARA 1AJPA 2DZDA 2PVPA 2BOBC 2VA3A 1JLLB 4RB0A 5K1XA 3CC2V 4IRCA 1JDBB 2ZIMA 4GKJB 2CTQA 5DQIA 5J2UB 4FBUA 5KFDA 5KFKA 1TAEA 3KAKA 3H01A 4Q4DA 5F9NA 1R6KA 1MSDA 1CQIB 3CRRA 1J5EB 1BJTA 2YRWA 2WYOA 4IZOA 4LH7A 1DK1A 4TUYF 1GKFA 2XT9A 2QEXV 1N36O 2XUMA 3HXLA 4B3MB 4NZNA 3OSPA 4CH5A 3IJ4A 4QSHA 2A79B 1YXBA 3SNOA 4Q8EA 2R82A 1GN3A 4DUZO 3W5OA 4I4TB 4ZHQF 4X65B 1OCZC 3ZHSA 4J11A 3ABKB 3G6EV 1OBDA 4ED8A 1KJJA 3K5NA 4LF9B 4H13B 1JFFA 1HNZO 2GPWA 4IR9A 4JYCA 2OYQA 5LP6F 2EIKC 5LOVB 1FYJA 2YZNA 3F5TA 1JJ2U 2IBZH 1EN6A 1TA8A 5B1OA 2DYRC 3FKSG 3ZHTA 3TIGA 4LNUB 1AI7A 2JJ1G 1NTMH 4E2LA 3T5KA 3RBEA 5BR8B 3K59A 1EN5A 1YDXA 2CQYA 2HHHO 4JAVA 1LNQA 3PR5B 2PYJA 1I3QA 5EBWC 3ICXA 1K3EA 1BHBA 4ZHQA 1KJQA 2IP4A 1PL0A 3E35A 3CCUV 4JI0O 3HO8A 4TV9F 1I94B 1SCUB 1KKDA 1CPYA 2D2CB 3VOTA 1E4FT 2FB5A 1IXBA 3THOA 3ZN0A 4TQSA 1RYRA 3CB2A 3K3WA 2W6ZA 2QWOB 3RW0A 1M5IA 5IY5C 5KT4A 4KXRA 5GTIZ 3TY9A 3KCYA 1SQQH 3RYFA 2V4RA 2ODTX 4JI3H 4JV5O 2PI5A 2JEUA 3B09A 1JXLA 4DUYB 3AG4C 5BWUA 4JI6B 5E25A 4WFAV 4QW8A 3ZHRA 2ZE8A 3DTGA 1YCIA 1P7GA 4RAYA 2W7OA 2JEJA 1WCMG 2EX3A 4DUZB 4QNHB 3HKDA 3W7SA 1V9PA 1G1XB 4LFAB 2QKCA 3JAKB 1SQFA 3CRQA 5B66Z 3JZIA 4FFRA 4QWDA 2UXDO 2PUSA 1P4RA 1NTZH 5JUMA 3FB8C 1ZUQA 5LMUH 4AI8A 5KG7A 5IYCG 2IA6A 4D7TA 1V55C 3OAAG 3H20A 5KT7A 1ULZA 2UUBO 2ZDHA 5LL6b 2FKXA 2YXLA 3ZRWB 2UXBH 2AZ2A 3K0DA 4Q6GA 3GB7C 5C1PA 1Y1WA 5LHHA 4EFBA 3VQWA 4B3SB 4UCVA 2Y0IA 4TQDA 4LF6O 2GDSA 3TEKA 2UUBH 4BBSG 2VQEB 4NYKA 1SQGA 4A3DG 3F7VC 1VKZA 4X62B 3LSQA 4Z1MG 4DV0O 4BIOA 3LNMB 3VNNA 4GC7A 4LFBO 3UCSC 5ITZA 4PJ0Z 5KKNB 2KSDA 2OCCB 1AVMA 1RK5A 2Y0SE 2F4VB 2ZR3A 1KBLA 4DL3A 2YCHA 1N34O 1KKCA 3H1LH 2QR4A 3K57A 1EFRG 2L6LA 4YQWA 5LMNB 4EB6A 3L72H 5IYBG 5CB4F 4C2MA 1DTOA 2W8LA 4HZ3A 2G38A 1XMQH 4TV9A 4FM2A 5EYPA 4XZ3B 4ZOLB 2UVUA 2ETNA 2R7KA 2VQFH 3WU2Z 4MW3A 4JI2B 3J81W 3RVYA 3BQ1A 3K0GA 2DWDC 1GM8A 2HGXA 2H3OA 3FD9A 3D8CA 1SETA 2HHFA 4IYHA 4JZ2A 5BWRA 4J9YB 2X0SA 2Y69C 4PDLA 1OJHA 5C1OA 4RUAA 1W0KG 2A0LA 4NKGB 4DV3H 2X5RA 3UFXB 2ALZA 4KP4A 4OPAA 3RVZA 3N2GA 4RB3C 2VS0A 4ECYA 4JV1A 1RJRA 2WB1E 1DV1A 5FNVB 2W6PA 2NN4A 1EKFA 3GIIA 2HDKA 3SPCA 4U7OA 2GLTA 5FLMG 5BZBA 3SJAC 3CPWU 3C90A 3M7MX 2CNUA 1JX4A 1V4YA 1SQBH 2WPDG 3LDDA 3T2MA 5JQGB 2FK2A 5L1JA 4GYCB 3CX5F 1XEQA 3GTKA 3H1HH 1PP9H 1ZSPA 2UUCO 4F4YA 2R9AA 1WPXA 3N27A 4DV6O 2CW7A 4O7ZA 3HR0A 3A0BZ 5KG0A 2W7PA 4NXNH 2P7TC 3J80W 2ADQB 3L4KA 4JTCB 5KG1A 3OFNG 2UVRA 4J9RA 4L1KA 4JZGA 3QFFA 1T94A 1Y1WG 4DR3B 5H6QA 4O81A 4ED1A 1HR0H 2WLIA 3JALA 3GB8B 4AYBE 2WAQE 1PD3A 2F4VO 4E4EA 3UT5A 1H2MA 4EEQA 1JX9A 1UC8A 4NB5A 5JJJB 2QKAA 4YJ3F 2JGDA 1N36H 2DABA 1SFOA 3RR5A 3AG1B 3UQ8A 1KMIZ 2YEVA 4MV6A 2OTJV 3SYAA 2P4VA 2CFMA 3H1JH 2N05A 2X7RB 3ZJZA 3JCZA 3ZEDA 2HG5C 4DR1B 4IIJF 5L1LA 3U55A 3K3VA 1N34H 1AUVA 4I5SA 2Q7EA 2HJFC 3HBLA 4DL5A 1I5XA 1JQ0A 1J5EH 5KHJA 4HNVA 2YSUB 1RM1B 4Z2WA 4CMFA 1SF9A 5IYBO 3ZMZA 2ATLA 4YAKB 4TWKA 3UZOA 1B3QA 1LR1A 2XAGA 3HKZA 4A3BG 5KFRA 1PKXA 2EIJB 1XQ8A 4ZBMA 1J5EO 1Y14B 4WF9V 4M0JA 4ECQA 1VQLV 4K0KO 3A8TA 1Y1VA 1BCCH 4YY3H 1OV9A 3BAAA 2KSWA 1S77D 2KB1A 1DV2A 4X9QA 4O3SA 3O65A 4YR2A 3CSXA 1VQMV 1IBMH 1MABG 2AXTZ 5LA6A 4DK1A 1S72V 1NJIW 1A48A 3T1HB 5DLGA 3TQTA 2JGUA 3B8NA 1AILA 4Q45A 3FDSA 3FX7A 2IU3A 1I08A 4O4LB 5J2TB 3QG5A 2V1DA 3I12A 1SA0A 4LF8B 1FKAO
chains in the Genus database with same CATH topology
2Q7HA 3VQXA 2VQEH 4PDBA 4I50A 3MWMA 3L4JA 1IBMB 4LFCB 2FE3A 4O4JB 5J2UA 4X1YA 1XK5A 5IT9W 2VWJA 4TUYB 1N36B 5KHGA 3NBZB 1N33B 1HNXH 3RF2A 3S24A 2F66C 5KHKA 3RYIA 3HKCB 4DR2B 3FFQA 3KXYT 3TY8A 4TUYA 1IBKB 1P16A 3RIZA 5J2TA 3RYCB 5FLXW 4DV6H 2HVQA 4B3MH 1ZHQA 3UT5B 3DSQA 2V4DA 4BW9A 3RTXA 1ZHSA 4RB1A 1HNZH 2JS5A 3HKBB 1HNWB 1N32H 4NXMH 5FPOA 2ZM6B 2QM4A 4L8JA 3HKCA 3K5OA 1P8LA 4I4TA 3RJ0A 4FM1A 1FKAH 3QF7A 3RYHA 2F1MA 1WNSA 5D5PA 4ZOLA 4FLYA 3HKEB 1QQCA 4DR4H 1JJOA 3CHXA 5KX5B 2ZNIA 3N2GB 4O4JA 2ZJTA 3HKDB 4OX9B 4O4LA 1L2ZA 5FPRA 3K5LA 2HIVA 2QJ1A 2HHHB 4MTDA 2RGRA 3BA9A 4YHHH 1FFXA 4PI0A 4WBNA 4KHPB 5D1PA 4DR4B 5LYJA 3IG0A 1FJGB 4R7RA 5CB4B 3BA8A 1Z2OX 1NT2B 4TV8A 4X1IA 3PN1A 3SJCC 4JI0B 4E6NA 4M7EA 1HW7A 5CB4A 2Q2TA 2HEPA 1XMQH 4CH4A 2PTMA 3JARA 3RFRA 4FLVA 3RGXA 2W57A 5LP6C 5LOVA 4LF5H 4MV9A 4EQ5A 3N2KA 4ZIBA 4IHJB 1Z5WA 3J7AK 4KL1A 5BMVA 3NC0B 4DR2H 1DGSA 1SA0B 3B2EE 4FVMA 4O4HA 1X9NA 2UUBB 4UCSA 1HNXB 1QHTA 3RYCA 1MZBA 1WH2A 4DR3H 1N33H 4X65H 3KAJA 1M93A 3C0FB 3OTFA 4LSAA 1P49A 3BRCA 1M0WA 2RGVA 4YJ2A 1HNZB 1SEIA 3T1HH 5KX5A 4UFZA 2YIAA 4DK0A 3JSLA 4FLWA 1N32B 4DV1H 1M4UA 4NXMB 2BTQB 2F4VH 2UUAB 5LYJB 2HIXA 4HNAB 1SKVA 4DV3B 2XIGA 4X1IB 2PY5A 4YY3B 2UUCB 5A2QW 3QG5A 4J0MA 1XMOB 3GDEA 4UCUA 1I94H 4Q0YA 4DR1H 4FLTA 2PZSA 4LFAH 4PZ8A 4DRXB 5JH7A 2UXDH 5EOYA 3T1YB 5CA0B 1Z2NX 5DISC 2RJZA 3A2FA 4TQFA 4O2BB 1AN7A 1X4TA 1XNQB 4DR5H 4O2AB 1O9HA 4CS3A 3N43B 3N42B 1FJGH 3VQYA 1O9GA 1XDNA 4ZHQB 4I50B 2HVRA 4JI1H 1FFXB 2E5LB 4HNAA 2KKWA 4LMYA 4X62H 1KU9A 3BPZA 1XNRB 4A2AA 5K1PA 2RQ6A 4AHCA 1Z5VA 4LSXA 4DR7H 4DV7B 4TV8B 1M0TA 4RB0A 5K1XA 4JI7H 4DV2B 5JH7B 2ZIMA 4GKJB 1B04A 4LFCH 5J2UB 4YJ2B 4DV4B 2YIBA 5JJNB 1TAEA 2CAZC 3JATB 1XHXA 4EB6B 4X64B 1IBLB 2UXCB 3KAKA 4I55B 2R72A 2WE6A 4CH6A 5JVDA 2UUAH 2ZCEA 1J5EB 1BJTA 3DF7A 1H2SB 2WYOA 5KHIA 1XMQB 4LH7A 2HVSA 5LMUB 4B3TH 3HXLA 4B3MB 3N40P 4CH5A 5IJ9B 4U3JB 4DUYH 3E22A 4IIJA 3WB2A 4FLZA 3W5OA 4I4TB 5JVDB 4X65B 4DV0H 4B3SH 5IWAB 1WPBA 1CKOA 5LMNH 2HGSA 1ZAUA 3T1YH 3K5NA 4LF9B 4LR3A 3WB1A 4AQYB 1JFFA 2UU9H 3QTCA 3KYHC 4CS4A 2BTOA 2OYQA 1BGWA 5LOVB 3N2KB 1G6UA 3OTOH 3U0ZA 1TA8A 4U3JA 3GJXB 3W1BA 3N44B 5GONA 4FM9A 4YHHB 4JYAB 4PZ6A 3K5MA 4LNUB 4JI1B 5BR8B 2VPSA 4O4IA 4JI5B 4YJ3A 3K59A 4FLUA 4LF4B 1Q43A 4B3RH 4GLXA 3N6XA 3JATA 2PYJA 4X66B 4JI8B 3ICXA 4LF5B 3BHPA 4ZHQA 3RYIB 4DRFA 5D1OA 4IHJA 5D5QA 5EYPB 1I94B 1HR0B 3RWRD 1E4FT 3THOA 4UCRA 1IBLH 3CB2A 4X1KA 4PHZA 4X20A 5JCOC 1HNWH 3JSNA 4PI2A 4RAZA 4K0KH 1M5IA 5IJ9A 5IYZA 4X66H 1S03G 3TY9A 4NXNB 4LFBB 3RYFA 4UCOA 4JI3H 4DRXA 4MV7A 3VQVA 4DUYB 4JI6B 4B08A 3JAWB 4DV2H 4K8XA 4RAYA 4FM0A 2XHBA 2EX3A 4I7HA 4DV5B 4I9QA 4DUZB 2ZINA 4A2BA 4RZQA 3HKDA 4DV4H 1V9PA 4JI3B 4LFAB 3TY5A 3JAKB 1JMKC 1SQFA 3SGIA 4CH3A 4JI6H 2PUSA 2R70A 3M4IA 5IJ0B 5CA0A 3NBYB 4WBNB 3KALA 5LMUH 5BMVB 4MTEA 4D7TA 3OTOB 3H20A 5LL6b 4DV5H 3RGZA 3JAWA 4LF6H 1N34B 4JI7B 2F93B 2YXLA 5KHHA 4LH6A 2ZNJA 2UXBH 5IYZB 3W1GA 2PGGA 4Q6GA 4JI5H 1XNQH 1I6UA 3N41B 4X20B 4EFBA 3VQWA 1VS0A 1E4GT 4CC5A 4DV0B 4UCVA 1I7FA 4B3SB 5IWAH 4TQDA 1VF7A 5LXTB 4B3RB 2UUBH 3E22B 2F95B 4JI8H 2VQEB 2P5OA 1SQGA 4D7SA 2UXBB 4PZ7A 4X62B 3K58A 3VNNA 2O03A 5ITZA 3U10A 3SR2C 4BWAA 4LF7B 4K0KB 3RYFB 2F4VB 5CA1A 2YCHA 4CS2A 1XHZA 4JI4B 3K57A 5LMNB 4EB6A 4TV9B 3JAKA 4X64H 1IBKH 2UXCH 1GYFA 2Q7GA 5GONB 4AQYH 4O2BA 4IIJB 3CVZA 3LMLA 3FMAA 5IJ0A 4LF7H 4JV5H 1FVIA 4TV9A 4FM2A 5EYPA 4GKKB 4ZOLB 3SJBC 5FD5A 3ETQA 2UXDB 2Q0AA 4CC6A 3J81W 4JI2B 2VQFH 4APMA 2OWOA 2MCTA 1CKMA 4B3TB 4TOIA 4F6RA 5FD6A 4ZI7A 3JASB 4DR5B 5BR8H 2CW8A 4HBNA 4YJ3B 4DV3H 4EFEA 4RB3C 3N2GA 4LF9H 1Q3EA 3BABA 4BWSC 2HHHH 2E5LH 3F8NA 5FNVB 5KMGA 1A0IA 2UU9B 5LP6B 3L2PA 3RGBA 5LXTA 3SJAC 3LNNA 3M7MX 5JQGB 2VUGA 4NVPA 5CA1B 4I55A 4GYCB 4JYAH 2R9AA 5ITZB 1TUBA 1S5JA 2CW7A 5C8YA 4NXNH 4LFBH 3J80W 3L4KA 5LP6A 4IAJA 4K8ZA 5LA6B 1O75A 3MAQA 5EZYB 5EIBC 5D1OB 1D5AA 4DR3B 1TUBB 4DUZH 1HR0H 3JALA 2PYLA 4KHPH 3GB8B 1RSOA 1JFFB 2YI9A 3UT5A 4EEQA 4DV1B 2GV9A 5JJJB 4GKKH 4UCTA 1N36H 4DR7B 4JV5B 3RR5A 4DV7H 3UQ8A 1KMIZ 4FFBB 2CFMA 3JARB 4DV6B 2BTQA 4GKJH 1S68A 3HKEA 5EZYA 3ZEDA 4DR1B 2Q2UA 2WDTA 3K3VA 1N34H 5JCOA 4LNUA 3EYYA 5JJEB 2Q7EA 1XMOH 1Q8IA 1TVKB 1WN7A 2IM9A 2ZM6H 5FNVA 1J5EH 1YEWA 5KHJA 2YIBD 1TGOA 1L8DA 4DR6B 3QWUA 4RB2C 4AILC 1CKNB 2JVDA 5EIBD 2VWKA 3IAYA 3ZS8C 2ZIOA 5JQGA 1SYXB 1XQ8A 2E3CA 4LF4H 3RYHB 2VQFB 1T5EA 4O2AA 1TVKA 4JI2H 3JAMW 4OX9H 4O4IB 4X1KB 5KMGB 4YY3H 2UUCH 3BAAA 4DR6H 4LF8H 2KSWA 4X1YB 4JI4H 4LF6B 1Z2PX 2YI8A 1XNRH 3CSXA 4FLXA 3HKBA 1IBMH 4DK1A 5LA6A 3U11A 2P22C 1XI1A 2VOBA 4JI0H 4O4HB 1CKNA 3T1HB 4ETSA 4F6RB 4FFBA 2JGUA 3JASA 4ZI7B 1Q5OA 5C8YB 5J2TB 4O4LB 3WB0A 3JALB 1SA0A 4LF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 B;  4LF5 B;  4DRF A;  5D1O A;  1IBM B;  4LFC B;  4EFE A;  3T1Y B;  1I94 B;  1HR0 B;  1XK5 A;  5DIS C;  3BAB A;  1N36 B;  4UCR A;  1A0I A;  3NBZ B;  1N33 B;  2UU9 B;  3S24 A;  3L2P A;  3JSN A;  4DR2 B;  1XNQ B;  3TY8 A;  1P16 A;  1IBK B;  3TY9 A;  4NXN B;  4LFB B;  2VUG A;  2HVQ A;  4UCO A;  1XDN A;  2HVR A;  3RTX A;  4DUY B;  4JI6 B;  2E5L B;  1HNW B;  1XNR B;  5FPO A;  2ZM6 B;  1P8L A;  4DV5 B;  4DUZ B;  1V9P A;  4JI3 B;  4LFA B;  3TY5 A;  4DV7 B;  3SGI A;  4DV2 B;  5D1O B;  4GKJ B;  1B04 A;  4DR3 B;  4DV4 B;  3NBY B;  4OX9 B;  1TAE A;  3GB8 B;  3OTO B;  1IBL B;  4X64 B;  2UXC B;  5FPR A;  4EEQ A;  2HIV A;  4DV1 B;  1N34 B;  4UCT A;  4JI7 B;  2HHH B;  4DR7 B;  3BA9 A;  4LH6 A;  1J5E B;  4JV5 B;  3RR5 A;  3UQ8 A;  3W1G A;  2CFM A;  1XMQ B;  4LH7 A;  2HVS A;  5LMU B;  4KHP B;  4DR4 B;  4DV6 B;  5D1P A;  1FJG B;  3BA8 A;  1S68 A;  4EFB A;  1VS0 A;  3PN1 A;  4JI0 B;  4CC5 A;  4DV0 B;  4UCV A;  4DR1 B;  4B3S B;  2Q2U A;  4B3M B;  4B3R B;  4E6N A;  2Q2T A;  2VQE B;  2UXB B;  3W5O A;  4PZ7 A;  4X62 B;  3VNN A;  4X65 B;  5IWA B;  1CKO A;  4LF7 B;  4DR6 B;  1ZAU A;  4LF9 B;  3QWU A;  4AQY B;  3KYH C;  1CKN B;  3NC0 B;  4K0K B;  1DGS A;  2F4V B;  1X9N A;  2UUB B;  4UCS A;  1HNX B;  4JI4 B;  4X66 B;  5LMN B;  2VQF B;  3GJX B;  1TA8 A;  3W1B A;  1HNZ B;  3BAA A;  4UFZ A;  4YHH B;  4JYA B;  1FVI A;  4PZ6 A;  3JSL A;  4LF6 B;  4GKK B;  1N32 B;  4JI1 B;  4NXM B;  2UUA B;  2HIX A;  4DV3 B;  2UXD B;  5BR8 B;  4CC6 A;  4JI2 B;  4JI5 B;  1CKN A;  2OWO A;  4YY3 B;  3T1H B;  2UUC B;  4LF4 B;  1XMO B;  3GDE A;  4UCU A;  1CKM A;  4GLX A;  4B3T B;  4TOI A;  4EQ5 A;  4PZ8 A;  4DR5 B;  4LF8 B; 
#chains in the Genus database with same CATH topology
 2Q7H A;  4JTD B;  4I50 A;  2FTK A;  3CJH A;  4DV2 O;  2XCP A;  5J2U A;  2AHZ A;  5IT9 W;  2R92 G;  2AW9 A;  2EJ2 A;  3DGE A;  2VWJ A;  2W9B A;  4J9S A;  4R50 A;  5KHG A;  1OCC C;  1YJW V;  2QKS A;  2Z02 A;  3RYI A;  1NR7 A;  3V4Z A;  3TY8 A;  3S3W A;  5J2T F;  3RIZ A;  4Z1V A;  1ZHQ A;  1M6V A;  1OHH G;  1R3I C;  4ICG A;  3CD6 V;  4BW9 A;  1MSW D;  4XYL B;  2DN9 A;  2RDI A;  2R87 A;  1MZF A;  4P9O A;  2EZO A;  2E74 B;  3HKC A;  3EPG A;  4I4T A;  3RJ0 A;  1F4M A;  4FE2 A;  1C3O A;  3AG7 A;  3HOU G;  1WNS A;  4O7R A;  4ZOL A;  3VMM A;  1KBH A;  3G4S V;  4WCE V;  1US6 A;  2GBO A;  2FP4 B;  5KX5 B;  4IR1 A;  2ZNI A;  2W9C B;  3JD4 A;  4MV1 A;  3SPI A;  4HYK A;  2YZL A;  3T9C A;  2HIV A;  5EWE A;  1RJP A;  3GIK A;  4XDK A;  2RGR A;  4IRD A;  1VQ5 V;  4WBN A;  4EYI B;  1AI5 A;  1AP5 A;  2C2E A;  2B5U A;  3OTO O;  5CB4 B;  1ZQ7 A;  3UYY A;  4X1I A;  4TV8 A;  2W6N A;  1WP7 A;  2EIN B;  1Y67 A;  5IY5 B;  4MTF A;  1PL4 A;  3ASN C;  2BCC H;  2PTM A;  3JAR A;  2WLL A;  3RGX A;  5JH7 F;  2AGA A;  4MV9 A;  1UJW B;  4Y8V B;  1VEW A;  3UO3 A;  3AG4 B;  4XDJ A;  2E76 B;  2ILM A;  3OT7 A;  1M56 B;  4O7V A;  5BMV A;  4NLG A;  3L71 H;  3ZN1 A;  1M1K W;  4DR2 H;  3B2E E;  4XYM B;  3CCQ V;  2UUB B;  4JYA O;  4YAJ B;  5EC2 C;  1K1Q A;  3SYP A;  3JCU Z;  2CH7 B;  5IYZ F;  4X65 H;  5A9G A;  1E79 G;  4O4J F;  2FYU H;  1QVG U;  2ZE7 A;  1V51 A;  1P49 A;  3BRC A;  1M0W A;  5KFL A;  4IWY A;  2HJW A;  2CTW A;  4DK0 A;  3JSL A;  2XCA A;  1N32 B;  1KTA A;  3CCV V;  3ZRX A;  3LSU A;  1SKV A;  1V55 B;  2XIG A;  1K4C C;  1NVP B;  1VBG A;  3MR3 A;  4UCU A;  1I94 H;  2E75 B;  2CH7 A;  1XL6 A;  3FB5 C;  3GTO A;  3NUA A;  2ASD A;  4LFA H;  4DR7 O;  5D8D A;  5I5S A;  4DRX B;  1Z2G A;  2UXD H;  1XBL A;  5H2F Z;  2RJZ A;  4TQF A;  2W0X A;  1THZ A;  1AN7 A;  5BPH A;  1X4T A;  2JEX A;  4JUZ A;  3ZCC A;  2OCC C;  3N42 B;  2ZR2 A;  3CRM A;  3VQY A;  4IGG A;  1O9G A;  4NR1 A;  1XDN A;  4I50 B;  2L35 A;  5CBH A;  3ETE A;  5B1N A;  2Z04 A;  2HVR A;  4JI1 H;  2XND G;  1FFX B;  4JI2 O;  2OT5 A;  5L9X A;  2HG8 A;  2YS7 A;  5I5U A;  3WWI A;  3J80 N;  1KU9 A;  3T9E A;  1XNR B;  1AUX A;  1BGY H;  4ME6 A;  2YDE A;  4RU9 A;  2RQ6 A;  1ENV A;  2I8C A;  3OR6 C;  2P90 A;  3L73 H;  2JK5 C;  4DR7 H;  5BXZ A;  3BAC A;  2R8K A;  1FPO A;  1UNN C;  2Q0O C;  4IWX A;  4EBD A;  3P3P A;  4YJ2 B;  3B77 A;  2ADP A;  1RJQ A;  2CAZ C;  3JAT B;  1XHX A;  4EB6 B;  4X64 B;  1IBL B;  2HP8 A;  3QO8 A;  3WNZ A;  1XMO O;  4A3J G;  3G8D A;  3KHH A;  3F5W C;  4UUJ C;  4CH6 A;  2IJJ A;  1GLV A;  2WE6 A;  2UUA H;  3DF7 A;  3FB7 C;  2OIE A;  4HNT A;  4WD3 A;  3FYE B;  1RSO B;  3JD2 A;  2XOK G;  5IYC O;  4ECV A;  2WAM A;  4B3T H;  3N40 P;  3CCS V;  1NI8 A;  1S76 D;  5H9C A;  4IT5 A;  4WFG A;  5CA3 A;  3G71 V;  3QZ7 A;  4DUY H;  1T3N A;  4FLZ A;  4J9Z B;  3QO5 A;  2RF4 A;  1K33 A;  5JVD B;  4JAU A;  3CQZ A;  1R6T A;  1WPB A;  1CKO A;  5LMN H;  1S0M A;  2Y48 A;  5KFJ A;  4RWU A;  3WB1 A;  2LGW A;  2GTS A;  4LR3 A;  2Q8V A;  3T4Z A;  4AQY B;  1H8E G;  3KZI Z;  1W2B U;  1K1S A;  2O57 A;  2BTO A;  2RDC A;  1SQV H;  1BMF G;  4PBC A;  1G6U A;  3OTO H;  2ZM6 O;  3GJX B;  5KT3 A;  2WLM A;  1L0N H;  4A3L G;  1JOY A;  3TW6 A;  2DMX A;  4MTG A;  3K5M A;  2A7W A;  3ABU A;  4FJC C;  1K4D C;  5I47 A;  3L75 H;  4DO2 A;  2HGW A;  1L1F A;  3MHS C;  4FLU A;  4DQN A;  1FXK C;  4DXW A;  4B3R H;  1RP3 B;  1H2G A;  3IC7 A;  4GLX A;  3IFX A;  2FPP B;  2ZDI C;  2X6C A;  3N6X A;  2COI A;  5EZY F;  4LCU C;  1I2K A;  4O7S A;  4UVC A;  1HR0 B;  3CS5 A;  4H0L B;  4Q8F A;  2NVY A;  2LQT A;  4UCR A;  5BWV A;  1YIJ V;  4PI2 A;  4K0K H;  5IJ9 A;  4FFN A;  3ZHU A;  4NZO A;  2C2A A;  3M9O B;  1VP7 A;  5CMU A;  4DRX A;  2Q67 A;  1W96 A;  2EIJ C;  1G4Y B;  4JPR A;  3NGD A;  2XAQ A;  4ECT A;  4B08 A;  5AG2 A;  4DV2 H;  2JJ2 G;  1GN6 A;  4FM0 A;  4I7H A;  4J9N A;  4I9Q A;  2ZIN A;  5KG5 A;  2VUM A;  1RK6 A;  5L3F A;  2E5L O;  3TIN A;  2COG A;  4JAS A;  1ZL8 A;  1WP8 A;  3B40 A;  3PO2 G;  2QWN B;  2ARH A;  3SGI A;  4JI6 H;  5IJ0 B;  5IYD O;  3JD0 A;  1RFY A;  5KT2 A;  4GCZ A;  5EDW A;  1G2W A;  3RGZ A;  3CC4 V;  3HOY G;  4P9P A;  4LF6 H;  1N34 B;  2FMA A;  2F93 B;  1WA8 B;  2WA3 A;  5IYZ B;  2QK4 A;  3W1G A;  2PGG A;  4PA6 A;  4DL4 A;  4QE9 A;  4X20 B;  1OCC B;  3T9F A;  4A5U B;  4DV0 B;  5DGH A;  1I7F A;  5IWA H;  3L74 H;  3D3Q A;  4JI7 O;  1DAA A;  1VF7 A;  4U7N A;  5LXT B;  4B3R B;  1KP2 A;  4FS1 A;  4AQY O;  1XIL A;  5LMU O;  2R7M A;  1H38 A;  5DGB A;  3KKY A;  2UXB B;  5KFC A;  4LWS A;  3K58 A;  3FB6 C;  1EZ1 A;  4NXN O;  3U10 A;  4BWA A;  4LF7 B;  3RAQ A;  2ZGI A;  4KFM A;  2Z5U A;  2JS3 A;  2HVJ C;  1QNM A;  5CA1 A;  3ETH A;  2YW2 A;  1XHZ A;  1CEZ A;  3LDC A;  4TV9 B;  2UXC H;  5KFX A;  4O2B A;  3LML A;  1VQ7 V;  3Q4H B;  3CEI A;  4JV5 H;  4RAI A;  1FVI A;  3EHB B;  3WFV A;  1BS3 A;  4JTA B;  3UZB A;  4J9K A;  3CWB H;  2CGN A;  3V6K A;  2X6A A;  1EKP A;  3RV3 A;  3U9S A;  3ZMU A;  4F6R A;  1VQ9 V;  4ECS A;  2Q5Z A;  3I4N G;  2GSM B;  4DR5 B;  5BR8 H;  3DAA A;  2CW8 A;  2JIZ G;  4HAM A;  1HDJ A;  4FGR A;  2EIN C;  5JWP A;  3HOX G;  4G27 B;  1QCE A;  1IYD A;  4IHJ F;  4LC1 A;  2W9C A;  3ETJ A;  3SI8 A;  1Q3E A;  3N8D A;  3ASN B;  1K97 A;  3OD4 A;  4LF9 H;  3OSN A;  2HHH H;  1N0N A;  2OCH A;  2UU9 B;  1XL4 A;  5KG4 A;  3R23 A;  2RCV A;  3LNN A;  3ZMT A;  3BG5 A;  3ZHQ A;  1M56 C;  5LA6 F;  1JIH A;  4I55 A;  3PZP A;  3BVO A;  2QWP B;  5KA5 A;  2NR5 A;  1N56 A;  3ZBH A;  1F4N A;  3W7T A;  3MHH C;  4A3M G;  4LFB H;  4A3F G;  3K03 A;  1RPR A;  2JA7 G;  2Q68 A;  4FU0 A;  4BXX G;  1VF6 A;  4K8Z A;  1ZWI C;  5LA6 B;  2W6Q A;  5DG8 A;  1O75 A;  3KHG A;  4FFP A;  4YXW G;  5EIB C;  2IW5 A;  1I94 O;  5D1O B;  5IWA O;  4MW8 A;  1D5A A;  1W59 A;  1TUB B;  2CTR A;  5CA0 F;  5IP7 G;  4DUZ H;  4EKW A;  2PYL A;  1XDC A;  4JF3 A;  1WCM A;  1GTO A;  4I7Z B;  3CE2 A;  3A0R A;  4UCT A;  4DYL A;  4JV5 B;  3BQ0 A;  2W6J G;  4FFB B;  1I2L A;  5B1A C;  3PR4 A;  1IBM O;  3J7A U;  3TK1 A;  2EJ7 A;  3HKE A;  1W0J G;  1GSO A;  2Q2U A;  4J41 A;  3FKI A;  1Q82 W;  5JJE B;  4ED2 A;  4DR2 O;  1TVK B;  4ZOL F;  2IJH A;  3SDL A;  1AB3 A;  1HWY A;  1U96 A;  1KC7 A;  3K06 A;  1K5S A;  4C5C A;  1CXZ B;  2QSA A;  4R6Z A;  4O86 A;  3VPB A;  4RB2 C;  4O7Y A;  4O84 A;  5EIB D;  1VQ4 V;  4O3P A;  5CBG A;  3ZS8 C;  1SYX B;  1OWT A;  4OXS A;  3GIQ A;  4RQE A;  2B1G A;  2R6F A;  3NXS A;  3AEI A;  3K79 A;  3RYH B;  3OUF A;  2VQD A;  2VQF B;  3Q4H A;  1TVK A;  1GO3 F;  3JAM W;  1EZJ A;  4O4I B;  4X1K B;  5KMG B;  2CDY A;  4DR6 H;  2CNV A;  4PA7 A;  4BIU A;  2E2H A;  4X1Y B;  4LF6 B;  3CJH B;  2CE4 A;  2DJV A;  4MV3 A;  2W9A A;  2PMZ E;  2P06 A;  2P22 C;  4QIW F;  1IXM A;  2VOB A;  4JI0 H;  5LBQ A;  4TV8 F;  4LF9 O;  1HP8 A;  5KFN A;  2VQE O;  4F6R B;  2CZG A;  2QM8 A;  3T99 A;  2B63 A;  1Q5O A;  5C8Y B;  4YBZ B;  3VQX A;  4EEY A;  4EG0 A;  2X0L A;  2F43 G;  2FE3 A;  1SZX A;  4X1Y A;  4OPH A;  1EUD B;  1NQT A;  3CMA V;  3B4S A;  5GTH Z;  5BMV F;  5BWW A;  5KFA A;  1N33 B;  3RF2 A;  5I5W A;  2GUZ B;  2EJ0 A;  2C2R A;  5KHK A;  3HKC B;  3FFQ A;  5BWX A;  3AW8 A;  1GSH A;  2J6T A;  1IBK B;  2JA7 A;  4RUE A;  2ZE5 A;  3L9D A;  4X62 O;  4CMD A;  4G2K A;  3WWJ A;  3FAV B;  2HVQ A;  2V58 A;  4DV6 H;  2ASL A;  4B3M H;  5KT5 A;  5DEC A;  4R8U B;  2JS5 A;  3HKB B;  5FPO A;  2QM4 A;  4L8J A;  5KS8 A;  3K5O A;  3JRX A;  4ECW A;  2GUZ A;  3WWH A;  4MAM A;  4DUY O;  3UM7 A;  3QF7 A;  1XRE A;  4FLY A;  4MVR A;  4DW0 A;  4DV3 O;  5KUM A;  1FXK B;  3CHX A;  2LW7 A;  2ZD9 A;  3GV7 B;  2C2D A;  2J6S A;  3HKD B;  4OX9 B;  2WB1 A;  3VBB A;  4R8U A;  3K5H A;  3TW7 A;  4UUG A;  5L3D A;  4MVZ A;  4DV7 O;  5GON F;  1M90 W;  1GSA A;  3JRW A;  5KFZ A;  3G67 A;  3BA9 A;  2EJ3 A;  4PI0 A;  2VQF O;  3CRA A;  1FJG B;  2R85 A;  3SJC C;  3PN1 A;  4YHH O;  1RYS A;  2WA4 A;  5E79 Z;  3AK1 A;  3AK3 A;  3CCR V;  4M7E A;  5DGI A;  1K34 A;  2JA5 G;  1N0J A;  2ZDI A;  3X2Q C;  3RFR A;  4HNU A;  5CM0 A;  5LP6 C;  2F23 A;  3N2K A;  1VQO V;  4MA5 A;  3Q8Q B;  4KL1 A;  1BSM A;  1EUC B;  3PFF A;  1DGS A;  2BOC C;  4FVM A;  1X9N A;  1HNX B;  1QHT A;  3R66 A;  1MZB A;  3KAJ A;  4AYB A;  3EPI A;  2YXY A;  2GQS A;  4LSA A;  5DN6 G;  4CE5 A;  2B63 G;  4YJ2 A;  3T1H H;  1JR9 A;  2VA2 A;  4UFZ A;  5KX5 F;  4J80 A;  3T54 A;  3H4B A;  2JA8 G;  4J7K A;  4NXM B;  1S5L Z;  2QWR B;  2UUA B;  3Q8R B;  1IOV A;  3I55 V;  2PY5 A;  2UXB O;  4YY3 B;  5A2Q W;  4W4K A;  4J0M A;  5K3W A;  3M99 B;  3ETG A;  5KA6 A;  4NTW A;  4YIP A;  4O2A F;  3DXR B;  5KFY A;  1KJI A;  3MDS A;  2AZ0 A;  4EBE A;  1AR4 A;  1WAZ A;  2JEG A;  3A2F A;  5EBL C;  5JVL A;  4F50 A;  3HKZ E;  4ZQI A;  2YS8 A;  3WO0 A;  4FMT A;  1EKV A;  1WA8 A;  3E86 A;  4O2A B;  4X64 O;  1K8A W;  1O9H A;  2Y4U A;  1XNR O;  3N43 B;  3GTG A;  1QR9 A;  3CYO A;  1GK9 A;  1M57 B;  1DF4 A;  3H9V A;  1VAJ A;  1H2L A;  2Q9L A;  3J81 N;  2DIK A;  2CUG A;  1AP6 A;  3E8H A;  4HNA A;  4WHX A;  3V4S A;  4LMY A;  4X62 H;  4A2A A;  5K1P A;  3K3P A;  3P3N A;  1A3G A;  4U6P A;  5LHI A;  2COJ A;  3EXA A;  1P84 F;  1Z5V A;  2WLH A;  3AK2 A;  4OGQ B;  4RNO A;  5KFG A;  4DV7 B;  3LQS A;  2R8J A;  4TV8 B;  4X88 A;  4UB8 Z;  1KUT A;  4DV2 B;  5JH7 B;  4LFC H;  1B04 A;  3A0H Z;  1M9N A;  2D3O W;  2YIB A;  5JJN B;  3Q2O A;  3CRC A;  4JI5 O;  2UXC B;  2Q4P A;  5CBF A;  5FNV F;  3ZIA G;  5KFV A;  4MVO A;  5CE8 A;  3ZRS A;  5JVD A;  3F7Y C;  1Q90 D;  1W93 A;  4FFO A;  1H2S B;  2CTP A;  4RQF A;  1XMQ B;  2QB5 A;  5KFF A;  3GWO A;  2NU8 B;  2Z0A A;  4J9P A;  3H1K H;  2UUA O;  1Q6U A;  2W6O A;  4F6E A;  4BY7 G;  2DE0 X;  1QLN A;  1VF5 B;  3E22 A;  3WB2 A;  1PM9 A;  1Q6I A;  4DV0 H;  5IWA B;  5HNE A;  3QTC A;  3KYH C;  4CS4 A;  2R7N A;  3E8B A;  5KFW A;  1NS1 A;  3CSW A;  1BGW A;  4ECZ A;  1F51 A;  5DG7 A;  1ZTE A;  2R9R B;  3T4D A;  4R8C A;  3GV5 B;  3U0Z A;  2RNB A;  5JQG F;  4B7E A;  2XAF A;  1BL8 A;  1VQ6 V;  3RBD A;  3C3T A;  4A3K G;  1PK8 A;  2YYA A;  2YID A;  5B3S C;  1BQ0 A;  3P32 A;  2BE3 A;  4YJ3 A;  1Q43 A;  5T14 A;  3K08 A;  4I50 F;  3Q8P B;  5B1A B;  2UXX A;  2QDO A;  1GN4 A;  4CBC A;  4JI8 B;  3MD0 A;  4ZKI A;  3MR5 A;  4DRF A;  5D1O A;  5KG3 A;  1KT8 A;  5D5Q A;  3NR7 A;  1FFT B;  4A3G G;  5JCO C;  1MA1 A;  5FR9 A;  4RAZ A;  2FB9 A;  3H4D A;  4E4T A;  5IYZ A;  4X66 H;  1S03 G;  2K9P A;  2Q6A A;  4LFB B;  3AG3 C;  4O4H F;  2BQU A;  1UFI A;  3ABL C;  4UCO A;  1PNL A;  3RB3 A;  2LGQ A;  2ZE6 A;  4MV7 A;  3ABT A;  1HNX O;  1SZT A;  3KHL A;  4YB8 B;  3JAW B;  4DIM A;  5LMN O;  2V9W A;  2JA6 G;  4ED3 A;  4DR3 O;  4MTO A;  4DV4 H;  4A2B A;  5DED A;  4RZQ A;  1NR1 A;  4IYI A;  1TWF A;  1IUR A;  1JMK C;  2IH3 C;  2LFS A;  5EWF A;  2OH2 A;  1CP9 A;  3U9T A;  1OCO B;  4JYY A;  5KUK A;  2UXN A;  5BR8 O;  2C35 B;  2DAA A;  5KFQ A;  4FBT A;  4DV5 H;  5BPF A;  2P6J A;  4DR1 O;  3JAW A;  2GQR A;  4JI7 B;  4LH6 A;  2WLN A;  1GAX A;  1SS3 A;  4QW9 A;  4JI5 H;  1I6U A;  3N41 B;  4BIZ A;  2XAH A;  4LFC O;  4DV1 O;  3LUL A;  3R5F A;  4LWS B;  4LF7 O;  4DV5 O;  3E22 B;  2IJK A;  2F95 B;  3TII A;  2P5O A;  5H5N A;  2CGO A;  2W71 A;  1L0L H;  4PZ7 A;  2PBZ A;  5LL6 Y;  2O03 A;  1IDS A;  3SYO A;  1FD9 A;  2FL4 A;  4K0K B;  1ET0 A;  3RYF B;  5KFU A;  2FK3 A;  4TT3 G;  2IJI A;  4XBF A;  4CS2 A;  2AGP A;  1TWC A;  2KG7 A;  3JAK A;  1I1M A;  4X64 H;  1IBK H;  1K73 W;  1SQP H;  1R3K C;  2Q7G A;  2W0F C;  4AQY H;  1YTF B;  1WJZ A;  2ITD C;  4A3E G;  5GW7 A;  4QWA A;  2BQR A;  4LF7 H;  3CC7 V;  3W7W A;  2GPS A;  5I5Y A;  2SCU B;  3RB0 A;  3SJB C;  2UXD B;  1IOW A;  4RUF A;  2Q0A A;  3M8A A;  2H8P C;  4ED0 A;  4APM A;  2OWO A;  2MCT A;  2JGD B;  1HNW O;  4YIO A;  1YIT V;  2FKL A;  1CKM A;  5L3E A;  1VF6 C;  2DW4 A;  3JYC A;  5FD6 A;  2R7Z A;  1B6Q A;  4HYO A;  2N74 A;  2V4Q A;  4HBN A;  1KEE A;  2QYZ A;  4DR4 O;  2ZKO A;  4GX5 A;  3BAB A;  4BWS C;  5KFE A;  3W7X A;  2YWV A;  3X2Q B;  2XCL A;  3V6J A;  2E5L H;  1A0I A;  1C30 A;  4ABM A;  3GVM A;  5LP6 B;  2PF4 E;  4J9Q A;  4DV4 O;  4X89 A;  4MSW C;  5CAE B;  5LYJ F;  2WTF A;  3RBZ A;  4X8A A;  3CCL V;  4Q4C A;  2VUG A;  3IC9 A;  3OGI B;  5KFM A;  3ZMS A;  4JYA H;  1T36 A;  4ASU G;  4YY3 O;  2J9G A;  5ITZ B;  1TUB A;  1S5J A;  4YP3 A;  1A9X A;  3OUS A;  1Q81 W;  2EIL C;  2IH1 C;  5LP6 A;  2OTL V;  4C5A A;  4IAJ A;  2QA4 V;  2RMK B;  3OE7 G;  1QU7 A;  4NTX A;  1R3J C;  4EYH B;  1BE3 H;  4H33 A;  3OEE G;  1NZ6 A;  1B6S A;  1FXV A;  5KT6 A;  1I5Y A;  5HFL A;  3DC6 A;  4BW5 A;  2A9H A;  3Q1K A;  2HHF B;  1JFF B;  2YI9 A;  1TWH A;  4NTY A;  3SPH A;  2WSS G;  2FML A;  3CCM V;  4DV1 B;  2GV9 A;  4GKK H;  1BHA A;  3EVK A;  2Z3Y A;  5I5T A;  3Q8S B;  4WFE A;  4DV7 H;  1M7J A;  2XGP A;  2P0A A;  4GKJ H;  1PV0 A;  1S68 A;  3GV8 B;  1S3J A;  4FFM A;  4X65 O;  2WDT A;  3T1C A;  5JCO A;  1CE8 A;  4LNU A;  2AGO A;  2EBO A;  3GTL A;  3OHA A;  1SQX H;  4KHP O;  4RUC A;  3TGU H;  5FNV A;  1YEW A;  4RZR A;  3KRE A;  1K7D A;  1M57 C;  4N23 A;  2YIB D;  4J9O A;  3RB4 A;  1PNM A;  1Y6X A;  1L8D A;  4C7U A;  4DR6 B;  3G8C A;  3K9S A;  4FS2 A;  1YVW A;  2HVK C;  4AIL C;  3E5N A;  1CKN B;  3APO A;  4O3N A;  2M6Y A;  5KG2 A;  2FPG B;  4YJ2 F;  1PNK A;  3STZ C;  4LF4 H;  3PW0 A;  2ODM A;  1Y74 A;  4XDL A;  1RPO A;  4O2A A;  1FXH A;  3R9R A;  4OX9 H;  4HR7 A;  1S0V A;  2UUC H;  2I87 A;  2R7Z G;  4WFB V;  4TM5 A;  2NLJ C;  3KTM A;  4JI4 H;  1Z2P X;  2GTA A;  3GWK C;  1YSC A;  1XNR H;  2HKO A;  3K9A A;  5LHG A;  4GKJ O;  3HKB A;  3RUP A;  1XI1 A;  3U11 A;  4QIW A;  3GIL A;  4O4H B;  1CKN A;  4ETS A;  2Q73 A;  2FLP A;  3HB3 B;  3RT3 C;  2XGQ A;  2Y4T A;  4EQ5 A;  5LGU A;  3WB0 A;  5K2M A;  3QVN A;  4H44 B;  5B5E Z;  1PX2 A;  2W6M A;  4MVQ A;  4R7C A;  2VQE H;  2R93 G;  5DGA A;  3MWM A;  3L4J A;  4LFC B;  3R5X A;  1N4C A;  5C4X G;  4K35 A;  1XK5 A;  5DAA A;  1V54 B;  3NBZ B;  2F66 C;  5I5V A;  4NYE A;  2EJR A;  4TUY A;  1P16 A;  2QF7 A;  1KC8 W;  1DF5 A;  3MJF A;  3V6H A;  3H3V H;  3ZMV A;  1JVM A;  1R3L C;  3ASO B;  5FLX W;  5KFH A;  3UT5 B;  4GZR B;  2V4D A;  4J7J A;  2LP7 A;  1ZHS A;  5TIS Z;  1HNZ H;  1J95 A;  5L1K A;  1BT8 A;  1A0G A;  5DMX A;  5KFI A;  3PVX A;  4NXM H;  3KCX A;  2ZDG A;  3E8F A;  3VA7 A;  1YF2 A;  2XAJ A;  4FM1 A;  1FKA H;  4FFK A;  3TET A;  1N8R W;  5B3S B;  2F1M A;  3P30 A;  5D5P A;  4B7K A;  5FLX N;  2EZP A;  1F23 A;  3HKE B;  1QQC A;  2YC0 A;  5FJ8 G;  4DL2 A;  1JJO A;  3GID A;  4O4J A;  1G8M A;  2ZJT A;  4PDR A;  1WR2 A;  4O4L A;  1IVS A;  5C8Y F;  5KFB A;  4J7Z A;  2NU6 B;  3K5L A;  2QJ1 A;  1JA8 A;  1DLB A;  4MTD A;  1KUQ A;  3EFF K;  1FFX A;  3OR7 C;  2B1I A;  5J9P C;  3M9N B;  4KHP B;  5D1P A;  4DR4 B;  3IG0 A;  1FS0 G;  2QTO A;  1NT2 B;  1JKJ B;  2A1H A;  3IN5 A;  2FPI B;  1I1K A;  2RN9 A;  4E6N A;  3LWB A;  1B6R A;  2HEP A;  1QBZ A;  5FL7 G;  2UU9 O;  1OCR C;  4I0X B;  3AG3 B;  4PWQ A;  1NTK H;  3ABL B;  4FLV A;  1NKD A;  1AJN A;  3ZRV A;  2ZT9 B;  5LOV A;  2K1E A;  3G80 A;  3MFI A;  3R5H A;  4PD4 F;  4DL6 A;  5EC1 C;  1EM1 A;  1Z5W A;  3J7A K;  1SRY A;  5KFS A;  4PA3 A;  3NC0 B;  1I0H A;  3LDE A;  2DPI A;  1SA0 B;  4NZM A;  3D36 A;  3DTF A;  3SE7 A;  3RYC A;  5C93 A;  4NXM O;  2HR3 A;  1M93 A;  2C00 A;  4P30 A;  3SYC A;  4MT8 A;  2RGV A;  1SEI A;  5KX5 A;  4HN2 A;  4F4W A;  1KP3 A;  1OCO C;  3JD1 A;  5F9L A;  1QVF U;  4JI3 O;  3U0G A;  2YIA A;  3APQ A;  4FLW A;  4DV1 H;  1M4U A;  1AI6 A;  3VOU A;  2BTQ B;  2F4V H;  5LYJ B;  1E1R G;  4HNA B;  3B8M A;  4UB6 Z;  1WSC A;  4M9U A;  3DXR A;  4TQR A;  4TVI A;  1XMO B;  3JZF A;  4LP8 A;  1VQK V;  4Q0Y A;  4DR1 H;  4FLT A;  3T5L A;  1QLE B;  3HOW G;  2FLN A;  3G6Y A;  4DL7 A;  1E4E A;  4QE7 A;  2AHY A;  5LOV F;  5JH7 A;  3T1Y B;  1TWA A;  2RDJ A;  4DW1 A;  3GLK A;  5DIS C;  1R1B A;  2MW2 B;  3WO1 A;  4O2B B;  2JDI G;  3LUT B;  1XNQ B;  1S97 A;  2UXC O;  3D3I A;  2P4K A;  4N21 A;  4I9W A;  4CS3 A;  3H0G A;  4MV8 A;  4RNM A;  2ZDQ A;  4DLK A;  4ZHQ B;  1Q86 W;  4ECR A;  2AU0 A;  1R6N A;  2PMZ A;  3U54 A;  2E5L B;  2XC9 A;  2DWC A;  4LF4 O;  3BPZ A;  2ZXW C;  4FZ1 A;  3ORQ A;  5IP9 G;  4LF5 O;  4FPP A;  2YXH A;  1NVP D;  4LSX A;  3MWE A;  3FKI G;  1JPX A;  4G28 B;  1H2N A;  1MMM A;  3GTP A;  1M0T A;  4JI7 H;  4W4L A;  4UVB A;  3CXC U;  1ZX3 A;  4DV4 B;  2Q7D A;  2YEV B;  1U97 A;  3AG2 C;  3BJY A;  5JQW A;  2NU9 B;  4CKB A;  1EHI A;  3PO3 G;  4I55 B;  1N48 A;  4QJF A;  2R72 A;  5KG6 A;  1DIK A;  2JA5 A;  2ZCE A;  5KHI A;  2HLD G;  2HVS A;  1GO3 E;  5LMU B;  1VIB A;  5L1I A;  3CXH F;  5IDJ A;  1ZET A;  4JXU A;  4YR3 A;  4BY1 G;  2R9I A;  2QM7 A;  3CME V;  5IJ9 B;  1KQS U;  1H2K A;  4U3J B;  1JDE A;  3PJS K;  4PV1 B;  4IIJ A;  1PPJ H;  1WLE A;  3ABM B;  3JAM N;  1KJ8 A;  2BQ3 A;  4F4X A;  4B3S H;  2XTA A;  2EIY A;  4JV0 A;  5F2V O;  2HGS A;  1ZAU A;  3T1Y H;  2UU9 H;  1MNG A;  1IYE A;  4O3O A;  4JI8 O;  3T1Y O;  5CA1 F;  3GIJ A;  2EIL B;  5H6R A;  3N2K B;  5L3B A;  3TJT A;  1IX9 A;  1XNQ O;  1KYO F;  4U3J A;  1I7N A;  3W1B A;  3IGA C;  1R73 A;  5H80 A;  3N44 B;  4PEL A;  5GON A;  3GIM A;  4YHH B;  4FM9 A;  2OLS A;  4JYA B;  4PZ6 A;  1FJG O;  4O82 A;  3OM3 B;  4JI1 B;  2ABJ A;  4MS2 A;  4DR5 O;  4O7W A;  2EIM B;  2VPS A;  3T9D A;  4O4I A;  2JRI A;  3OMA B;  4JI5 B;  4J42 A;  1KB9 F;  4LF4 B;  2QGN A;  1Q6H A;  3JAT A;  1B06 A;  1XUQ A;  4ED7 A;  4X66 B;  4LF5 B;  3BHP A;  4FFL A;  3RYI B;  2Y4R A;  4C5B A;  4IHJ A;  1BZK A;  1YHQ V;  1TUE B;  5EYP B;  3RWR D;  3PW2 A;  4JI4 O;  1IBL H;  1LUW A;  4X1K A;  1S0N A;  4PHZ A;  4X20 A;  4I0X A;  1HNW H;  3JSN A;  3AYH B;  5KFP A;  1EN4 A;  3G6B A;  3ZX6 A;  3HB9 A;  3PW7 A;  4NXN B;  2I80 A;  4EGJ A;  1S5H C;  2KG7 B;  4ECU A;  3KHR A;  3N6R A;  1ROP A;  3D36 C;  3VQV A;  5J2U F;  2YUA A;  5IT9 N;  1IBK O;  3HOV G;  4O3Q A;  4J10 A;  4IRK A;  3FAV A;  4K8X A;  2R8H A;  1NBM G;  2XHB A;  5DQG A;  4DV5 B;  2WLI B;  4DAA A;  2M7W A;  3OUU A;  3H0G G;  4JI3 B;  2V5A A;  2V59 A;  3TY5 A;  2NUA B;  4G3I A;  4CH3 A;  3VPC A;  4U7C A;  2R70 A;  3M4I A;  4LBE C;  2NNU A;  2VRZ A;  5CA0 A;  3O9O A;  3NBY B;  3RV4 A;  4WBN B;  4UV9 A;  3KAL A;  4QPK A;  2UVW A;  1KD1 W;  5BMV B;  4MTE A;  3OTO B;  2R8G A;  1YJ9 V;  2DOS A;  1K9M W;  1WB8 A;  1OZ0 A;  3PW4 A;  3OMI B;  1Y76 B;  1CS0 A;  4I4T F;  3S3X A;  5KHH A;  3MFH A;  2ZNJ A;  2EUL A;  5DQH A;  1GN2 A;  5L3C A;  4OX9 O;  1V54 C;  3VPD A;  1VMG A;  2N04 A;  1XNQ H;  3E2E A;  3K04 A;  1VQP V;  3E89 A;  3JD3 A;  1VS0 A;  4CC5 A;  5CR5 A;  2LFR A;  4WFF A;  1E4G T;  4WBN F;  1E1Q G;  1SES A;  2H94 A;  3WG7 C;  3TQ1 A;  1NU1 H;  3GTJ A;  4JI8 H;  3ORR A;  3ASO C;  4D7S A;  5EWG A;  4O7T A;  3SYQ A;  3JZ6 A;  3ZRW A;  4B3S O;  2DYS B;  4UVA A;  1ORQ C;  4XX0 B;  4EBC A;  3BCC H;  3SR2 C;  3OGC C;  2HFE C;  1NH2 D;  4K6N A;  4PA4 A;  4GX1 A;  4JV2 A;  3W7U A;  4J9M A;  4JI4 B;  1ARO P;  2ATK C;  4IL6 Z;  1GM9 A;  1ZL8 B;  1GYF A;  1XMQ O;  3T5J A;  4KUM A;  5GON B;  4IIJ B;  5KAI Z;  3CVZ A;  3FMA A;  5IJ0 A;  5B1B B;  2B9Z A;  2R7L A;  2WLJ A;  4GKK B;  3BFR A;  4BBR G;  1K5Q A;  1KEC A;  5FD5 A;  3MR2 A;  3ETQ A;  4X66 O;  4CC6 A;  1UPG A;  2X6B A;  1S9F A;  1AR1 B;  2UVV A;  3ML0 A;  3QO7 A;  4MVU A;  4QJF B;  3STL C;  4B3T B;  4TOI A;  3MR6 A;  1Y1V G;  3UKM A;  3BQ2 A;  4JGS A;  4PDM A;  4EGQ A;  3JAS B;  5DM6 V;  4GT1 A;  4ZI7 A;  4CHI A;  1EBO A;  4YJ3 B;  3OEH G;  4EFE A;  1UC9 A;  2WWW A;  3L70 H;  1VQN V;  1OCR B;  1BNC A;  2IMW P;  3F8N A;  2FJZ A;  5KMG A;  4A3I G;  2DLN A;  4B3R O;  2DWE C;  3RN4 A;  3AX6 A;  1XOU A;  3L2P A;  2R86 A;  2YL2 A;  3RGB A;  4A3C G;  5C44 G;  5LXT A;  1I1L A;  2GHY A;  1MZE A;  1VQ8 V;  4ECX A;  4NVP A;  5CA1 B;  4FK5 C;  1BXR A;  1OCZ B;  3E8G A;  3ABK C;  1MOF A;  3RAX A;  5C8Y A;  4O4L F;  2BSK B;  4L87 A;  3BY6 A;  5KAF Z;  3G6X A;  1BQZ A;  2EIK B;  5JVD F;  2FLL A;  3OW2 U;  2XAS A;  3SJQ C;  2M05 A;  3MAQ A;  5EZY B;  2QE7 G;  2DYR B;  5HV6 A;  4H37 A;  5EK0 A;  1Y66 A;  1QLE C;  4KHP H;  1S10 A;  1RSO A;  1COW G;  3LP8 A;  4K3A A;  3QNE A;  1Y76 A;  3OMN B;  1GM7 A;  2YRX A;  2V7Q G;  1B33 N;  1WB7 A;  2BSK A;  3I5D A;  4DR7 B;  1YZB A;  1KJ9 A;  3BEH A;  2YIC A;  3JAR B;  4MVS A;  2VPQ A;  4DV6 B;  2JEF A;  2BTQ A;  2CNQ A;  4QWC A;  4QPJ A;  4RCN A;  5L3G A;  5EZY A;  4F4L A;  4GKK O;  1N33 O;  4F4Z A;  3EYY A;  1XMO H;  1URF A;  1Q8I A;  3C3S A;  4TSF G;  1WN7 A;  2IM9 A;  1Y74 B;  2ZM6 H;  2ZQM A;  5BY1 A;  1H8H G;  1TGO A;  3T9A A;  2IBK A;  4GLW A;  1I50 A;  1YI2 V;  4MV4 A;  3RFC A;  5KFO A;  3QWU A;  3I4M G;  2ZXW B;  2JVD A;  1OBG A;  2VWK A;  3IAY A;  1TWG A;  4QIW E;  2ZIO A;  5JQG A;  3GTM A;  4MA0 A;  3DTU B;  2E3C A;  5C5J A;  2R93 A;  4ZI7 F;  1AJQ A;  2E2I A;  1T5E A;  1I7L A;  4JI2 H;  2JEI A;  3CP1 A;  2WLL B;  5IE9 A;  1FXK A;  4MTX A;  1MG1 A;  1SER A;  4LF8 H;  4B3T O;  3TCU A;  5I5X A;  1AR5 A;  1Y4M A;  2YI8 A;  3AG2 B;  4FLX A;  2VR1 A;  4GUN A;  3ZHV A;  3R65 A;  4CKC A;  1D2D A;  4J9L A;  3CEB A;  5LXT F;  4JI6 O;  4FFB A;  4PDV A;  1GRJ A;  5LGT A;  1X59 A;  3JAS A;  4ZI7 B;  1YTF D;  4UV8 A;  5HFM A;  2AQ4 A;  3ETD A;  1A32 A;  3JAL B;  4PDB A;  4CKE A;  5E1A C;  3QQM A;  1IBM B;  4U3F H;  2JA6 A;  4O4J B;  2YS6 A;  3OUZ A;  4LFA O;  2AGQ A;  1S0O A;  1IZ3 A;  2VUM G;  2PN1 A;  1N36 B;  4TUY B;  5IYD G;  2C28 A;  3ABM C;  5BYB A;  3T9B A;  3TXQ A;  4LF8 O;  1HNX H;  3S24 A;  3OHB A;  1D5N A;  4DR2 B;  3KXY T;  2DQ0 A;  2W8K A;  2W9B B;  3SPG A;  5J2T A;  4YR0 A;  3HPL C;  3RYC B;  2ITC C;  3H40 A;  1QR8 A;  3DSQ A;  2KQX A;  4JI1 O;  2DQ3 A;  3T1H O;  3RTX A;  4RB1 A;  3HOZ G;  3KG2 A;  2FK1 A;  4BAY A;  1ZLZ A;  3CCJ V;  2XD4 A;  3E83 A;  4GX0 A;  4ED6 A;  1HNW B;  1R9T A;  4O2B F;  1F7Y A;  5C3E G;  1N32 H;  4RO2 A;  2ZM6 B;  1AI4 A;  5BWT A;  1P8L A;  2R92 A;  1VBH A;  4QGP A;  1GH6 A;  3RYH A;  2EIM C;  3SPJ A;  5KLV H;  2W70 A;  2QTS A;  2Y0P A;  3LSS A;  4DR4 H;  2P67 A;  2Y0S A;  3N2G B;  2LW1 A;  2CKZ B;  2BR0 A;  1E4E B;  3FYI B;  3MWD A;  2HJD A;  4UXN A;  2YZG A;  2YZM A;  2C22 A;  5FPR A;  1L2Z A;  3RB6 A;  2LJ2 A;  4JAA A;  2HHH B;  5DG9 A;  3GQC A;  4YHH H;  4GX2 A;  1FAF A;  2NU7 B;  1GGO A;  3PW5 A;  3GTQ A;  1JCH A;  1K92 A;  5LYJ A;  4O7L A;  4R7R A;  3BA8 A;  1HR0 O;  1Z2O X;  2ASJ A;  4JI0 B;  5I60 A;  2Y69 B;  5HBR B;  1GMG A;  3K5I A;  4O83 A;  5DLF A;  3QZ8 A;  2YU9 A;  1HW7 A;  5EBM C;  5CB4 A;  2Q2T A;  2LO1 A;  3I56 V;  2Q69 A;  4CH4 A;  4I55 F;  2CK3 G;  1SC5 B;  2W57 A;  4LF5 H;  1NH2 B;  2OIG A;  4ZIB A;  4Q44 A;  2R8I A;  4IHJ B;  2J6U A;  2DPJ A;  4D6T H;  4HQ6 A;  4QWE A;  3G6V A;  4CZZ A;  4O4H A;  2R84 A;  3TXS A;  1WH2 A;  4UCS A;  1N33 H;  4PA9 A;  4DR3 H;  1CQJ B;  5A2Q N;  4FIP C;  4O3R A;  4O7N A;  4QWB A;  3C0F B;  3OTF A;  2PI4 A;  2QWQ B;  4MVM A;  1HNZ B;  4Q43 A;  1WRV A;  4BR6 A;  3H1I H;  4B3M O;  2IU0 A;  4P2Z A;  2HIX A;  4DV3 B;  3UO2 A;  2A3Q A;  2W6I G;  4X1I B;  2UUC B;  3GDE A;  3M9M B;  3GIP A;  1IBL O;  4WFH A;  1K83 A;  4Q20 A;  3CCE V;  2PZS A;  1YJN V;  5CN0 A;  2A06 H;  4PZ8 A;  5LGN A;  3T7A A;  3WG7 B;  3AG1 C;  5EOY A;  2NVX A;  1EZV H;  5CA0 B;  1Z2N X;  2WLK A;  2WAQ A;  4GC6 A;  2DYS C;  5KFT A;  4DR5 H;  2MK3 A;  1N32 O;  1EYZ A;  4RNN A;  1Q7Y W;  3T5H A;  4O4I F;  4JYB A;  5BYA A;  1FJG H;  1RM1 C;  4FZ0 A;  4DR6 O;  4A93 G;  2KKW A;  3DC5 A;  3HT5 A;  1LUV A;  1P7B A;  5B1B C;  4AHC A;  1VAR A;  1AJP A;  2DZD A;  2PVP A;  2BOB C;  2VA3 A;  1JLL B;  4RB0 A;  5K1X A;  3CC2 V;  4IRC A;  1JDB B;  2ZIM A;  4GKJ B;  2CTQ A;  5DQI A;  5J2U B;  4FBU A;  5KFD A;  5KFK A;  1TAE A;  3KAK A;  3H01 A;  4Q4D A;  5F9N A;  1R6K A;  1MSD A;  1CQI B;  3CRR A;  1J5E B;  1BJT A;  2YRW A;  2WYO A;  4IZO A;  4LH7 A;  1DK1 A;  4TUY F;  1GKF A;  2XT9 A;  2QEX V;  1N36 O;  2XUM A;  3HXL A;  4B3M B;  4NZN A;  3OSP A;  4CH5 A;  3IJ4 A;  4QSH A;  2A79 B;  1YXB A;  3SNO A;  4Q8E A;  2R82 A;  1GN3 A;  4DUZ O;  3W5O A;  4I4T B;  4ZHQ F;  4X65 B;  1OCZ C;  3ZHS A;  4J11 A;  3ABK B;  3G6E V;  1OBD A;  4ED8 A;  1KJJ A;  3K5N A;  4LF9 B;  4H13 B;  1JFF A;  1HNZ O;  2GPW A;  4IR9 A;  4JYC A;  2OYQ A;  5LP6 F;  2EIK C;  5LOV B;  1FYJ A;  2YZN A;  3F5T A;  1JJ2 U;  2IBZ H;  1EN6 A;  1TA8 A;  5B1O A;  2DYR C;  3FKS G;  3ZHT A;  3TIG A;  4LNU B;  1AI7 A;  2JJ1 G;  1NTM H;  4E2L A;  3T5K A;  3RBE A;  5BR8 B;  3K59 A;  1EN5 A;  1YDX A;  2CQY A;  2HHH O;  4JAV A;  1LNQ A;  3PR5 B;  2PYJ A;  1I3Q A;  5EBW C;  3ICX A;  1K3E A;  1BHB A;  4ZHQ A;  1KJQ A;  2IP4 A;  1PL0 A;  3E35 A;  3CCU V;  4JI0 O;  3HO8 A;  4TV9 F;  1I94 B;  1SCU B;  1KKD A;  1CPY A;  2D2C B;  3VOT A;  1E4F T;  2FB5 A;  1IXB A;  3THO A;  3ZN0 A;  4TQS A;  1RYR A;  3CB2 A;  3K3W A;  2W6Z A;  2QWO B;  3RW0 A;  1M5I A;  5IY5 C;  5KT4 A;  4KXR A;  5GTI Z;  3TY9 A;  3KCY A;  1SQQ H;  3RYF A;  2V4R A;  2ODT X;  4JI3 H;  4JV5 O;  2PI5 A;  2JEU A;  3B09 A;  1JXL A;  4DUY B;  3AG4 C;  5BWU A;  4JI6 B;  5E25 A;  4WFA V;  4QW8 A;  3ZHR A;  2ZE8 A;  3DTG A;  1YCI A;  1P7G A;  4RAY A;  2W7O A;  2JEJ A;  1WCM G;  2EX3 A;  4DUZ B;  4QNH B;  3HKD A;  3W7S A;  1V9P A;  1G1X B;  4LFA B;  2QKC A;  3JAK B;  1SQF A;  3CRQ A;  5B66 Z;  3JZI A;  4FFR A;  4QWD A;  2UXD O;  2PUS A;  1P4R A;  1NTZ H;  5JUM A;  3FB8 C;  1ZUQ A;  5LMU H;  4AI8 A;  5KG7 A;  5IYC G;  2IA6 A;  4D7T A;  1V55 C;  3OAA G;  3H20 A;  5KT7 A;  1ULZ A;  2UUB O;  2ZDH A;  5LL6 b;  2FKX A;  2YXL A;  3ZRW B;  2UXB H;  2AZ2 A;  3K0D A;  4Q6G A;  3GB7 C;  5C1P A;  1Y1W A;  5LHH A;  4EFB A;  3VQW A;  4B3S B;  4UCV A;  2Y0I A;  4TQD A;  4LF6 O;  2GDS A;  3TEK A;  2UUB H;  4BBS G;  2VQE B;  4NYK A;  1SQG A;  4A3D G;  3F7V C;  1VKZ A;  4X62 B;  3LSQ A;  4Z1M G;  4DV0 O;  4BIO A;  3LNM B;  3VNN A;  4GC7 A;  4LFB O;  3UCS C;  5ITZ A;  4PJ0 Z;  5KKN B;  2KSD A;  2OCC B;  1AVM A;  1RK5 A;  2Y0S E;  2F4V B;  2ZR3 A;  1KBL A;  4DL3 A;  2YCH A;  1N34 O;  1KKC A;  3H1L H;  2QR4 A;  3K57 A;  1EFR G;  2L6L A;  4YQW A;  5LMN B;  4EB6 A;  3L72 H;  5IYB G;  5CB4 F;  4C2M A;  1DTO A;  2W8L A;  4HZ3 A;  2G38 A;  1XMQ H;  4TV9 A;  4FM2 A;  5EYP A;  4XZ3 B;  4ZOL B;  2UVU A;  2ETN A;  2R7K A;  2VQF H;  3WU2 Z;  4MW3 A;  4JI2 B;  3J81 W;  3RVY A;  3BQ1 A;  3K0G A;  2DWD C;  1GM8 A;  2HGX A;  2H3O A;  3FD9 A;  3D8C A;  1SET A;  2HHF A;  4IYH A;  4JZ2 A;  5BWR A;  4J9Y B;  2X0S A;  2Y69 C;  4PDL A;  1OJH A;  5C1O A;  4RUA A;  1W0K G;  2A0L A;  4NKG B;  4DV3 H;  2X5R A;  3UFX B;  2ALZ A;  4KP4 A;  4OPA A;  3RVZ A;  3N2G A;  4RB3 C;  2VS0 A;  4ECY A;  4JV1 A;  1RJR A;  2WB1 E;  1DV1 A;  5FNV B;  2W6P A;  2NN4 A;  1EKF A;  3GII A;  2HDK A;  3SPC A;  4U7O A;  2GLT A;  5FLM G;  5BZB A;  3SJA C;  3CPW U;  3C90 A;  3M7M X;  2CNU A;  1JX4 A;  1V4Y A;  1SQB H;  2WPD G;  3LDD A;  3T2M A;  5JQG B;  2FK2 A;  5L1J A;  4GYC B;  3CX5 F;  1XEQ A;  3GTK A;  3H1H H;  1PP9 H;  1ZSP A;  2UUC O;  4F4Y A;  2R9A A;  1WPX A;  3N27 A;  4DV6 O;  2CW7 A;  4O7Z A;  3HR0 A;  3A0B Z;  5KG0 A;  2W7P A;  4NXN H;  2P7T C;  3J80 W;  2ADQ B;  3L4K A;  4JTC B;  5KG1 A;  3OFN G;  2UVR A;  4J9R A;  4L1K A;  4JZG A;  3QFF A;  1T94 A;  1Y1W G;  4DR3 B;  5H6Q A;  4O81 A;  4ED1 A;  1HR0 H;  2WLI A;  3JAL A;  3GB8 B;  4AYB E;  2WAQ E;  1PD3 A;  2F4V O;  4E4E A;  3UT5 A;  1H2M A;  4EEQ A;  1JX9 A;  1UC8 A;  4NB5 A;  5JJJ B;  2QKA A;  4YJ3 F;  2JGD A;  1N36 H;  2DAB A;  1SFO A;  3RR5 A;  3AG1 B;  3UQ8 A;  1KMI Z;  2YEV A;  4MV6 A;  2OTJ V;  3SYA A;  2P4V A;  2CFM A;  3H1J H;  2N05 A;  2X7R B;  3ZJZ A;  3JCZ A;  3ZED A;  2HG5 C;  4DR1 B;  4IIJ F;  5L1L A;  3U55 A;  3K3V A;  1N34 H;  1AUV A;  4I5S A;  2Q7E A;  2HJF C;  3HBL A;  4DL5 A;  1I5X A;  1JQ0 A;  1J5E H;  5KHJ A;  4HNV A;  2YSU B;  1RM1 B;  4Z2W A;  4CMF A;  1SF9 A;  5IYB O;  3ZMZ A;  2ATL A;  4YAK B;  4TWK A;  3UZO A;  1B3Q A;  1LR1 A;  2XAG A;  3HKZ A;  4A3B G;  5KFR A;  1PKX A;  2EIJ B;  1XQ8 A;  4ZBM A;  1J5E O;  1Y14 B;  4WF9 V;  4M0J A;  4ECQ A;  1VQL V;  4K0K O;  3A8T A;  1Y1V A;  1BCC H;  4YY3 H;  1OV9 A;  3BAA A;  2KSW A;  1S77 D;  2KB1 A;  1DV2 A;  4X9Q A;  4O3S A;  3O65 A;  4YR2 A;  3CSX A;  1VQM V;  1IBM H;  1MAB G;  2AXT Z;  5LA6 A;  4DK1 A;  1S72 V;  1NJI W;  1A48 A;  3T1H B;  5DLG A;  3TQT A;  2JGU A;  3B8N A;  1AIL A;  4Q45 A;  3FDS A;  3FX7 A;  2IU3 A;  1I08 A;  4O4L B;  5J2T B;  3QG5 A;  2V1D A;  3I12 A;  1SA0 A;  4LF8 B;  1FKA O; 
#chains in the Genus database with same CATH homology
 2Q7H A;  3VQX A;  2VQE H;  4PDB A;  4I50 A;  3MWM A;  3L4J A;  1IBM B;  4LFC B;  2FE3 A;  4O4J B;  5J2U A;  4X1Y A;  1XK5 A;  5IT9 W;  2VWJ A;  4TUY B;  1N36 B;  5KHG A;  3NBZ B;  1N33 B;  1HNX H;  3RF2 A;  3S24 A;  2F66 C;  5KHK A;  3RYI A;  3HKC B;  4DR2 B;  3FFQ A;  3KXY T;  3TY8 A;  4TUY A;  1IBK B;  1P16 A;  3RIZ A;  5J2T A;  3RYC B;  5FLX W;  4DV6 H;  2HVQ A;  4B3M H;  1ZHQ A;  3UT5 B;  3DSQ A;  2V4D A;  4BW9 A;  3RTX A;  1ZHS A;  4RB1 A;  1HNZ H;  2JS5 A;  3HKB B;  1HNW B;  1N32 H;  4NXM H;  5FPO A;  2ZM6 B;  2QM4 A;  4L8J A;  3HKC A;  3K5O A;  1P8L A;  4I4T A;  3RJ0 A;  4FM1 A;  1FKA H;  3QF7 A;  3RYH A;  2F1M A;  1WNS A;  5D5P A;  4ZOL A;  4FLY A;  3HKE B;  1QQC A;  4DR4 H;  1JJO A;  3CHX A;  5KX5 B;  2ZNI A;  3N2G B;  4O4J A;  2ZJT A;  3HKD B;  4OX9 B;  4O4L A;  1L2Z A;  5FPR A;  3K5L A;  2HIV A;  2QJ1 A;  2HHH B;  4MTD A;  2RGR A;  3BA9 A;  4YHH H;  1FFX A;  4PI0 A;  4WBN A;  4KHP B;  5D1P A;  4DR4 B;  5LYJ A;  3IG0 A;  1FJG B;  4R7R A;  5CB4 B;  3BA8 A;  1Z2O X;  1NT2 B;  4TV8 A;  4X1I A;  3PN1 A;  3SJC C;  4JI0 B;  4E6N A;  4M7E A;  1HW7 A;  5CB4 A;  2Q2T A;  2HEP A;  1XMQ H;  4CH4 A;  2PTM A;  3JAR A;  3RFR A;  4FLV A;  3RGX A;  2W57 A;  5LP6 C;  5LOV A;  4LF5 H;  4MV9 A;  4EQ5 A;  3N2K A;  4ZIB A;  4IHJ B;  1Z5W A;  3J7A K;  4KL1 A;  5BMV A;  3NC0 B;  4DR2 H;  1DGS A;  1SA0 B;  3B2E E;  4FVM A;  4O4H A;  1X9N A;  2UUB B;  4UCS A;  1HNX B;  1QHT A;  3RYC A;  1MZB A;  1WH2 A;  4DR3 H;  1N33 H;  4X65 H;  3KAJ A;  1M93 A;  3C0F B;  3OTF A;  4LSA A;  1P49 A;  3BRC A;  1M0W A;  2RGV A;  4YJ2 A;  1HNZ B;  1SEI A;  3T1H H;  5KX5 A;  4UFZ A;  2YIA A;  4DK0 A;  3JSL A;  4FLW A;  1N32 B;  4DV1 H;  1M4U A;  4NXM B;  2BTQ B;  2F4V H;  2UUA B;  5LYJ B;  2HIX A;  4HNA B;  1SKV A;  4DV3 B;  2XIG A;  4X1I B;  2PY5 A;  4YY3 B;  2UUC B;  5A2Q W;  3QG5 A;  4J0M A;  1XMO B;  3GDE A;  4UCU A;  1I94 H;  4Q0Y A;  4DR1 H;  4FLT A;  2PZS A;  4LFA H;  4PZ8 A;  4DRX B;  5JH7 A;  2UXD H;  5EOY A;  3T1Y B;  5CA0 B;  1Z2N X;  5DIS C;  2RJZ A;  3A2F A;  4TQF A;  4O2B B;  1AN7 A;  1X4T A;  1XNQ B;  4DR5 H;  4O2A B;  1O9H A;  4CS3 A;  3N43 B;  3N42 B;  1FJG H;  3VQY A;  1O9G A;  1XDN A;  4ZHQ B;  4I50 B;  2HVR A;  4JI1 H;  1FFX B;  2E5L B;  4HNA A;  2KKW A;  4LMY A;  4X62 H;  1KU9 A;  3BPZ A;  1XNR B;  4A2A A;  5K1P A;  2RQ6 A;  4AHC A;  1Z5V A;  4LSX A;  4DR7 H;  4DV7 B;  4TV8 B;  1M0T A;  4RB0 A;  5K1X A;  4JI7 H;  4DV2 B;  5JH7 B;  2ZIM A;  4GKJ B;  1B04 A;  4LFC H;  5J2U B;  4YJ2 B;  4DV4 B;  2YIB A;  5JJN B;  1TAE A;  2CAZ C;  3JAT B;  1XHX A;  4EB6 B;  4X64 B;  1IBL B;  2UXC B;  3KAK A;  4I55 B;  2R72 A;  2WE6 A;  4CH6 A;  5JVD A;  2UUA H;  2ZCE A;  1J5E B;  1BJT A;  3DF7 A;  1H2S B;  2WYO A;  5KHI A;  1XMQ B;  4LH7 A;  2HVS A;  5LMU B;  4B3T H;  3HXL A;  4B3M B;  3N40 P;  4CH5 A;  5IJ9 B;  4U3J B;  4DUY H;  3E22 A;  4IIJ A;  3WB2 A;  4FLZ A;  3W5O A;  4I4T B;  5JVD B;  4X65 B;  4DV0 H;  4B3S H;  5IWA B;  1WPB A;  1CKO A;  5LMN H;  2HGS A;  1ZAU A;  3T1Y H;  3K5N A;  4LF9 B;  4LR3 A;  3WB1 A;  4AQY B;  1JFF A;  2UU9 H;  3QTC A;  3KYH C;  4CS4 A;  2BTO A;  2OYQ A;  1BGW A;  5LOV B;  3N2K B;  1G6U A;  3OTO H;  3U0Z A;  1TA8 A;  4U3J A;  3GJX B;  3W1B A;  3N44 B;  5GON A;  4FM9 A;  4YHH B;  4JYA B;  4PZ6 A;  3K5M A;  4LNU B;  4JI1 B;  5BR8 B;  2VPS A;  4O4I A;  4JI5 B;  4YJ3 A;  3K59 A;  4FLU A;  4LF4 B;  1Q43 A;  4B3R H;  4GLX A;  3N6X A;  3JAT A;  2PYJ A;  4X66 B;  4JI8 B;  3ICX A;  4LF5 B;  3BHP A;  4ZHQ A;  3RYI B;  4DRF A;  5D1O A;  4IHJ A;  5D5Q A;  5EYP B;  1I94 B;  1HR0 B;  3RWR D;  1E4F T;  3THO A;  4UCR A;  1IBL H;  3CB2 A;  4X1K A;  4PHZ A;  4X20 A;  5JCO C;  1HNW H;  3JSN A;  4PI2 A;  4RAZ A;  4K0K H;  1M5I A;  5IJ9 A;  5IYZ A;  4X66 H;  1S03 G;  3TY9 A;  4NXN B;  4LFB B;  3RYF A;  4UCO A;  4JI3 H;  4DRX A;  4MV7 A;  3VQV A;  4DUY B;  4JI6 B;  4B08 A;  3JAW B;  4DV2 H;  4K8X A;  4RAY A;  4FM0 A;  2XHB A;  2EX3 A;  4I7H A;  4DV5 B;  4I9Q A;  4DUZ B;  2ZIN A;  4A2B A;  4RZQ A;  3HKD A;  4DV4 H;  1V9P A;  4JI3 B;  4LFA B;  3TY5 A;  3JAK B;  1JMK C;  1SQF A;  3SGI A;  4CH3 A;  4JI6 H;  2PUS A;  2R70 A;  3M4I A;  5IJ0 B;  5CA0 A;  3NBY B;  4WBN B;  3KAL A;  5LMU H;  5BMV B;  4MTE A;  4D7T A;  3OTO B;  3H20 A;  5LL6 b;  4DV5 H;  3RGZ A;  3JAW A;  4LF6 H;  1N34 B;  4JI7 B;  2F93 B;  2YXL A;  5KHH A;  4LH6 A;  2ZNJ A;  2UXB H;  5IYZ B;  3W1G A;  2PGG A;  4Q6G A;  4JI5 H;  1XNQ H;  1I6U A;  3N41 B;  4X20 B;  4EFB A;  3VQW A;  1VS0 A;  1E4G T;  4CC5 A;  4DV0 B;  4UCV A;  1I7F A;  4B3S B;  5IWA H;  4TQD A;  1VF7 A;  5LXT B;  4B3R B;  2UUB H;  3E22 B;  2F95 B;  4JI8 H;  2VQE B;  2P5O A;  1SQG A;  4D7S A;  2UXB B;  4PZ7 A;  4X62 B;  3K58 A;  3VNN A;  2O03 A;  5ITZ A;  3U10 A;  3SR2 C;  4BWA A;  4LF7 B;  4K0K B;  3RYF B;  2F4V B;  5CA1 A;  2YCH A;  4CS2 A;  1XHZ A;  4JI4 B;  3K57 A;  5LMN B;  4EB6 A;  4TV9 B;  3JAK A;  4X64 H;  1IBK H;  2UXC H;  1GYF A;  2Q7G A;  5GON B;  4AQY H;  4O2B A;  4IIJ B;  3CVZ A;  3LML A;  3FMA A;  5IJ0 A;  4LF7 H;  4JV5 H;  1FVI A;  4TV9 A;  4FM2 A;  5EYP A;  4GKK B;  4ZOL B;  3SJB C;  5FD5 A;  3ETQ A;  2UXD B;  2Q0A A;  4CC6 A;  3J81 W;  4JI2 B;  2VQF H;  4APM A;  2OWO A;  2MCT A;  1CKM A;  4B3T B;  4TOI A;  4F6R A;  5FD6 A;  4ZI7 A;  3JAS B;  4DR5 B;  5BR8 H;  2CW8 A;  4HBN A;  4YJ3 B;  4DV3 H;  4EFE A;  4RB3 C;  3N2G A;  4LF9 H;  1Q3E A;  3BAB A;  4BWS C;  2HHH H;  2E5L H;  3F8N A;  5FNV B;  5KMG A;  1A0I A;  2UU9 B;  5LP6 B;  3L2P A;  3RGB A;  5LXT A;  3SJA C;  3LNN A;  3M7M X;  5JQG B;  2VUG A;  4NVP A;  5CA1 B;  4I55 A;  4GYC B;  4JYA H;  2R9A A;  5ITZ B;  1TUB A;  1S5J A;  2CW7 A;  5C8Y A;  4NXN H;  4LFB H;  3J80 W;  3L4K A;  5LP6 A;  4IAJ A;  4K8Z A;  5LA6 B;  1O75 A;  3MAQ A;  5EZY B;  5EIB C;  5D1O B;  1D5A A;  4DR3 B;  1TUB B;  4DUZ H;  1HR0 H;  3JAL A;  2PYL A;  4KHP H;  3GB8 B;  1RSO A;  1JFF B;  2YI9 A;  3UT5 A;  4EEQ A;  4DV1 B;  2GV9 A;  5JJJ B;  4GKK H;  4UCT A;  1N36 H;  4DR7 B;  4JV5 B;  3RR5 A;  4DV7 H;  3UQ8 A;  1KMI Z;  4FFB B;  2CFM A;  3JAR B;  4DV6 B;  2BTQ A;  4GKJ H;  1S68 A;  3HKE A;  5EZY A;  3ZED A;  4DR1 B;  2Q2U A;  2WDT A;  3K3V A;  1N34 H;  5JCO A;  4LNU A;  3EYY A;  5JJE B;  2Q7E A;  1XMO H;  1Q8I A;  1TVK B;  1WN7 A;  2IM9 A;  2ZM6 H;  5FNV A;  1J5E H;  1YEW A;  5KHJ A;  2YIB D;  1TGO A;  1L8D A;  4DR6 B;  3QWU A;  4RB2 C;  4AIL C;  1CKN B;  2JVD A;  5EIB D;  2VWK A;  3IAY A;  3ZS8 C;  2ZIO A;  5JQG A;  1SYX B;  1XQ8 A;  2E3C A;  4LF4 H;  3RYH B;  2VQF B;  1T5E A;  4O2A A;  1TVK A;  4JI2 H;  3JAM W;  4OX9 H;  4O4I B;  4X1K B;  5KMG B;  4YY3 H;  2UUC H;  3BAA A;  4DR6 H;  4LF8 H;  2KSW A;  4X1Y B;  4JI4 H;  4LF6 B;  1Z2P X;  2YI8 A;  1XNR H;  3CSX A;  4FLX A;  3HKB A;  1IBM H;  4DK1 A;  5LA6 A;  3U11 A;  2P22 C;  1XI1 A;  2VOB A;  4JI0 H;  4O4H B;  1CKN A;  3T1H B;  4ETS A;  4F6R B;  4FFB A;  2JGU A;  3JAS A;  4ZI7 B;  1Q5O A;  5C8Y B;  5J2T B;  4O4L B;  3WB0 A;  3JAL B;  1SA0 A;  4LF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...