3UQ8A

Structure of adenylation domain of haemophilus influenzae dna ligases bound to nad+ in adenylated state.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
322
structure length
322
Chain Sequence
b'NIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVARIEDRLILLPAPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPAQEELTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structure Guided Understanding of NAD(+) Recognition in Bacterial DNA Ligases.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 106
structure length 322
sequence length 322
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2011-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3uq8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3uq8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3uq8A02
3PN1A 1CKNA 2Q2TA 4JI0B 1ZAUA 1I94B 1CKMA 4B3TB 4LF9B 4JV5B 5DISC 2CFMA 3BAAA 4X65B 1XMOB 2HIXA 4DUZB 3BABA 5LMUB 3SGIA 3VNNA 4UCVA 4DUYB 4CC6A 4DR4B 4LF5B 1A0IA 4LFBB 1VS0A 4DV7B 4B3SB 3RTXA 4DR3B 1N36B 4EFBA 4GKJB 4LH7A 2E5LB 1TA8A 5FPRA 4DV6B 2ZM6B 4DV5B 3T1YB 4DV3B 4DR2B 3GJXB 3NBYB 3QWUA 2HVRA 4JI5B 4UCOA 4K0KB 1N33B 4UCRA 4KHPB 4UCUA 1P8LA 4NXNB 4OX9B 1XNQB 3W5OA 3NC0B 2UXCB 1HR0B 5D1OB 2VQFB 4PZ7A 3S24A 3L2PA 4DV0B 1N32B 1P16A 4PZ8A 5D1OA 4JI8B 3JSNA 4JI7B 1S68A 3UQ8A 1IBKB 4DR6B 1DGSA 1XNRB 3TY8A 5IWAB 2UUBB 4JI3B 4TOIA 4EEQA 4GKKB 2HVQA 4LF6B 1XDNA 2HIVA 4LFCB 4X62B 3KYHC 2VUGA 4EFEA 3NBZB 2OWOA 5D1PA 4YY3B 1IBMB 4DRFA 4LF7B 4E6NA 4DR7B 5LMNB 4DR1B 4DR5B 4AQYB 2UXDB 3TY9A 3GB8B 1XMQB 2UUCB 1V9PA 4EQ5A 4X64B 1FJGB 5FPOA 3W1BA 2HVSA 4LFAB 4YHHB 3OTOB 4PZ6A 2UUAB 1FVIA 4LH6A 1HNZB 4GLXA 3BA8A 4JI6B 4CC5A 2VQEB 4DV4B 1N34B 1HNWB 4DV1B 1TAEA 1HNXB 1IBLB 4UCTA 2Q2UA 4JI4B 4JI1B 3JSLA 3W1GA 4X66B 1CKOA 4UFZA 3T1HB 2HHHB 4LF8B 1XK5A 4B3MB 2F4VB 3TY5A 1B04A 4JI2B 3GDEA 4B3RB 1X9NA 4JYAB 1CKNB 3BA9A 4LF4B 2UXBB 4DV2B 5BR8B 4NXMB 2UU9B 4UCSA 1J5EB 3RR5A
chains in the Genus database with same CATH superfamily
1XEQA 1BZKA 5KT2A 2WE6A 1CKMA 1ZL8B 3LNMB 3GTLA 4B3MO 1WCMG 5A2QW 4WBNA 4BR6A 1AI4A 5CA1F 1NTZH 2WLIB 4IGGA 4FFLA 4A3BG 4UUJC 3RF2A 2VUMA 4J42A 4GC7A 1LNQA 4CC6A 1RYSA 3BCCH 4PBCA 3K57A 4QIWF 4LF9O 2BSKB 3M9NB 1BHAA 1K4DC 3QWUA 4DV3B 2YZNA 3R5FA 1TUBA 3UM7A 5I5TA 1RK5A 3I4MG 2AW9A 5A2QN 4MTDA 1OCOC 4LF5O 2ZGIA 1N36O 4ZOLB 3D3QA 3N44B 3CWBH 4FFPA 2AGQA 3OGCC 2E5LO 2H94A 3LSSA 2R7KA 5KFLA 3EXAA 4J9QA 2JDIG 2ZR3A 2ATLA 3SYOA 5BR8O 5KG7A 1W93A 3BEHA 4NXMO 4C5CA 1Q7YW 4WHXA 3ETQA 1XL6A 1Z2PX 4B08A 2JA7A 1F4NA 1IYEA 3CX5F 2FLPA 4PZ8A 1CQJB 4J9PA 1FJGH 1I1LA 3CJHA 2ZT9B 4ZOLF 2JGDB 3Q2OA 4UVCA 1V54C 1N34H 1XDNA 4LFCH 2XAQA 2P22C 1OCCB 1NVPD 5J2TA 4RUCA 1JFFA 4UVBA 4NZMA 4C5BA 5I5XA 1FD9A 2ASDA 3HOXG 2PMZE 5L3FA 2HFEC 4H44B 4YHHB 5JVLA 3JATA 2BTQA 3V4SA 5DQGA 5KFNA 2UXBH 1KP2A 3B8MA 4YP3A 1EZJA 3E2EA 4O2AA 4ED8A 2HJFC 4DQNA 3FKSG 2WLLB 1HNXB 4UUGA 3GV8B 3JSLA 1B6SA 2K1EA 2HDKA 2WPDG 1RSOA 2OCHA 3N40P 3GIIA 2CTWA 1HNZO 2YEVB 1JX9A 1U97A 3ASOB 3SJQC 5F2VO 5BPHA 1H2MA 4DV2B 4DV6H 3E86A 1J5EB 2QK4A 1E1QG 4J7JA 2HHHO 1PL4A 4JI5H 4O7NA 2YZMA 4JZ2A 3G6EV 3IC9A 4JI2O 2W9AA 2UXXA 4ED0A 5E1AC 1TVKB 5ITZA 4H13B 2Q68A 4DUZB 3LSUA 3ZN0A 1CXZB 5IYBO 5L3GA 4J9KA 4DR4B 3K5MA 1VS0A 4MVZA 1ZLZA 2H3OA 2IJHA 1Q6HA 4JI0O 4ECVA 3JZ6A 2YWVA 1I94O 5DGIA 2FYUH 1QR9A 3UYYA 3LMLA 2HGXA 5DGBA 1Y76B 5FD5A 4O3QA 2GDSA 2J6TA 1AI7A 1E4FT 1SQPH 5DLGA 1KEEA 2YYAA 4LFBO 4J9NA 4K3AA 2GV9A 5EBMC 5LGNA 2NU7B 3HPLC 5DGAA 1VF5B 1Q6UA 2PUSA 1P8LA 4RQFA 3R65A 3R66A 4ED2A 3N8DA 3T1YO 2J6UA 5KFFA 1HDJA 4LSAA 4BAYA 3ETHA 1VP7A 1L0NH 3S24A 3CVZA 4DV0B 1TWAA 2EZOA 1S9FA 4PA9A 4W4KA 5IP9G 2W7OA 4RUAA 1IVSA 1EKPA 1K4CC 1OHHG 2UUBB 4ECTA 4NZNA 4EEQA 1K3EA 4FFNA 4APMA 2YIBD 4O3SA 1IYDA 3WWHA 2HIVA 5KFSA 4ECUA 3GWKC 2R87A 2YS6A 5KFAA 3GV7B 1IBMB 4IZOA 5LP6B 1KUQA 3D36C 1SCUB 1B06A 1QLNA 1G1XB 3TY9A 1WJZA 1G2WA 1NR1A 1V9PA 1N33O 2KSWA 4NTYA 4CKEA 1JDEA 4EYHB 2PI5A 1BL8A 1R3JC 2YXYA 4LF4H 3LUTB 5CBGA 5CB4A 3KREA 4CMFA 3E35A 2UUAH 2J6SA 3MHHC 4JI6B 5IE9A 1M90W 1SA0B 2LGQA 4AQYO 1GSHA 5BY1A 3ETEA 3PR5B 1GTOA 3BY6A 3ZRWA 2WA3A 1TWFA 5EDWA 1R1BA 4DR6O 1GLVA 3D8CA 3SNOA 4QE7A 3RBEA 4OGQB 4QGPA 4U3FH 2DJVA 4YJ2F 2JA8G 1BCCH 4ZI7A 1VBHA 2VQDA 4DV5H 5JH7B 2V58A 3RR5A 2ADQB 1R3LC 4XDJA 2R8HA 5BYAA 1YDXA 1CQIB 3JAKB 4A3KG 4B3TB 2Z02A 2C2DA 3FB8C 5EC1C 3DC5A 2Y0SA 5EBWC 2V4RA 1KJIA 4N21A 5LMUB 4MW8A 1E4EA 2FMAA 3APQA 2NUAB 2OIGA 2W6PA 4RNNA 1CP9A 4GX2A 1M7JA 1KC8W 1E79G 3KCYA 4I5SA 1S3JA 2LGWA 1YSCA 5BZBA 2VPQA 5BYBA 5FPRA 1H2KA 1QQCA 4WFFA 4DR2B 4Q4CA 2R7ZG 1YITV 3K04A 4OXSA 1DLBA 1GN3A 4DV3H 5I5YA 1ENVA 3BPZA 2JS5A 3CCLV 1XNRH 4WBNB 3SPHA 3P30A 4DL7A 1EYZA 3WO1A 3RVZA 4IYHA 2XAGA 4X62H 2A06H 4L1KA 5KT3A 3HR0A 1K8AW 4YY3H 2ZXWC 3RBDA 1HR0B 4LSXA 4U3JB 3K08A 5I60A 3TW7A 3D3IA 2EIJC 2ZE6A 2W6QA 2B63G 3PW2A 4W4LA 3ZN1A 3I56V 4WCEV 2P6JA 4HR7A 3T9CA 2YC0A 2C2RA 1JDBB 2P4KA 1ULZA 2CGOA 3QF7A 1PK8A 4BWAA 5CA0A 3EYYA 1IBLH 2EX3A 4JPRA 5FLXW 4RB2C 5D1PA 5KFYA 3T99A 4O3RA 2LQTA 5KHKA 3ZX6A 3MDSA 3OGIB 2AZ0A 2CKZB 1H8HG 1SQFA 3AG4C 4DR5B 2XD4A 1FXKC 4CS4A 3GB8B 5KFQA 4UB6Z 3G6BA 4E4EA 1KT8A 4DL2A 4WFHA 1Y1WA 3RB4A 3BHPA 4AYBA 1ZHSA 2Q69A 3K5HA 2AGPA 1GSAA 4I4TA 4WF9V 5FLXN 1BGYH 3CE2A 1XMQO 2Q2UA 2UUCO 4X64O 4A2BA 2WLHA 5CBHA 4NLGA 4LF8B 2CH7A 4XYMB 1JR9A 4CS3A 3LP8A 3TINA 3PO2G 4GX5A 1WPBA 4X88A 1K33A 3OTFA 5KFWA 3U0GA 1X9NA 2WDTA 5L3EA 5B3SC 2EJ0A 2ZR2A 4JI1O 1RJPA 4JV0A 2Q73A 1ZTEA 3KKYA 1J5EH 1IZ3A 1RSOB 4JV5B 3RV3A 3GIPA 2W6OA 4LR3A 1H2GA 1WR2A 5KG3A 2LO1A 2NU9B 1OJHA 4NXNH 2Y69C 2YU9A 1VQKV 1JXLA 3ZRXA 4QWCA 1ZSPA 2OT5A 1VQLV 3IC7A 4LWSB 5IYDG 5CM0A 2ADPA 2YIAA 2R82A 1Q3EA 4J9MA 1JIHA 4QWAA 4ZHQB 2V1DA 5KFKA 5J2UB 4UCOA 3ZMTA 4ECXA 1P84F 2JEXA 1M0TA 4KHPB 4DV7O 1EM1A 1CS0A 2IW5A 2R93A 3IJ4A 2AGOA 3K9AA 2PI4A 5IT9W 2XCLA 5GONF 1Q5OA 3FB7C 5B1BB 4A3EG 4ZOLA 1U96A 3FYIB 3Q8QB 1DK1A 4J11A 4CMDA 3MR3A 2UXDH 2HG5C 1H8EG 2W6NA 3N2KB 5B66Z 1MA1A 2YIDA 5LA6F 2HJWA 3JAWA 2RGVA 4DV0H 4LFAH 1IBKB 2JEIA 3E8BA 2P90A 3AEIA 1KJQA 3GVMA 2GPSA 4AYBE 4FS1A 3K3VA 2JGDA 3FB6C 3GTMA 1I2KA 4HN2A 1I7LA 2O03A 3RYHB 1A3GA 2VUGA 3B2EE 2OWOA 3WNZA 3ETDA 3ZCCA 2JIZG 1O75A 3U10A 4PELA 5LMNB 3MAQA 5LGUA 3FYEB 2DAAA 4J9YB 5AG2A 3ABLB 3H4BA 5K3WA 2W8KA 3D36A 1FJGB 2CAZC 3N2GB 1M57B 4O7TA 1SEIA 4DL6A 5EOYA 5KHJA 2CZGA 3BQ0A 1JOYA 2COGA 2UU9H 5KG6A 1HNWB 1N34B 3VPCA 3B09A 3CC7V 2OTJV 2WAQA 4WD3A 4JI6H 1K73W 5E79Z 2QB5A 4QIWE 3GTJA 3IG0A 3FFQA 1EZ1A 2WLNA 3TGUH 1XDCA 3TJTA 1XMOH 4R8UB 4O82A 3EPIA 2RDCA 4IWXA 1HP8A 2EULA 3DSQA 3PVXA 2UVUA 3SE7A 1SKVA 4B3SH 1W96A 3OAAG 2R7NA 3TQ1A 4GKKO 3TIIA 2EIMC 3BJYA 2YEVA 4FVMA 2UXBB 2Z04A 1D2DA 1PPJH 2M6YA 2DN9A 4FM2A 4I55B 4LF7O 2DQ3A 1ZAUA 2F93B 2OCCB 4DR1O 4U6PA 1XHXA 4FBUA 5DISC 3N41B 4B3TH 4X65B 2AQ4A 3J80W 1PP9H 4O83A 1AI5A 1M93A 3L73H 4BW9A 1MOFA 5LMUH 5KUMA 4F4ZA 4YXWG 3PW4A 3QZ8A 2RGRA 4FFOA 2EJ3A 4GKJB 4LH7A 2V4DA 4GLWA 3AG7A 4DV6B 3OUFA 3MFIA 4MV3A 4ZBMA 4JI5B 1IOVA 4DR2H 4O4JB 3JARA 3TK1A 4G3IA 3K5IA 2WLJA 4H0LB 4P2ZA 2XT9A 2NU8B 3H20A 2YW2A 4U7CA 3EHBB 1VBGA 4FFMA 4LBEC 1XNQB 4OPAA 2VS0A 1BJTA 5D1OB 4FGRA 5EBLC 2QSAA 3SYCA 1KJ9A 4O4JF 1BXRA 1V4YA 2R86A 3ZRSA 2A79B 2DWCA 4AI8A 3K3WA 2LP7A 2X6CA 3FKIG 3OTOH 1WP8A 2OYQA 3A0RA 2YDEA 4MVQA 1PNKA 4U7OA 4C7UA 2WAQE 3HOYG 4YR3A 2HVQA 4ED7A 3CXHF 2ASJA 4A3LG 1OCOB 4IRCA 2CDYA 2ODMA 4YJ3F 2A3QA 1XQ8A 2FL4A 4DW1A 4F4LA 5TISZ 4O86A 2R92A 4JI7O 1SF9A 1M0WA 2KKWA 5KHGA 2C22A 1VQ8V 1T5EA 2R7LA 1X4TA 5KX5B 4IIJB 4G27B 1ORQC 5EIBC 4JI3O 2R9AA 4DR5H 2QF7A 1V51A 5DGHA 3MD0A 2EIYA 4QWDA 4FLUA 1OCZC 4MTFA 2A1HA 2I8CA 4BY1G 2RF4A 1PNLA 1C3OA 4X1KB 2IBZH 4TV8F 2E75B 4Q20A 2ILMA 1UNNC 2FB9A 1V54B 5HV6A 5F9NA 2VWJA 5KX5F 1SA0A 3HKCB 4YJ2A 3RB3A 4JTDB 5KFIA 4DUYH 5E25A 4LF8H 5LOVF 2FE3A 1UJWB 3K03A 3T5KA 2AXTZ 4MVOA 4X9QA 4LF4B 4GYCB 3T5LA 1PL0A 4EB6A 2IU0A 5BR8B 2FP4B 4NXMB 4I4TB 2YS7A 1K7DA 5IJ0A 1RYRA 4HYKA 4PA4A 2M05A 5CR5A 2OCCC 1COWG 1IURA 2W6MA 5JH7A 2CFMA 3C0FB 3GV5B 3CB2A 3JZIA 3JAKA 3JD0A 4JYAO 1A0IA 2ITCC 5KFHA 4BXXG 1G4YB 2HVKC 3ZS8C 3SYPA 3FB5C 4A3MG 4UXNA 5CA1B 2VQFH 3VMMA 1NT2B 3ZMZA 1N32H 3AK1A 2FPIB 1A0GA 4DV5B 4JI4O 3OW2U 1SERA 2HVRA 2FTKA 2X0LA 3CC4V 4MV8A 5IYDO 5JQGB 1AR5A 5D5PA 3K5OA 5IWAH 2FJZA 3KHRA 3PW7A 3MHSC 3S3WA 4KHPH 3UT5B 2ATKC 4DAAA 5JVDF 5F9LA 3W5OA 2UVWA 4IR1A 2HGWA 4ZQIA 1I50A 5HFLA 1NU1H 5BWUA 1RM1C 5JQGF 1W2BU 1KJ8A 3T9EA 3T9FA 3L2PA 5IJ9B 2RDIA 4U3JA 4MTXA 1WNSA 2Q9LA 3JSNA 1F4MA 4C2MA 4JV1A 1PKXA 1SQVH 1D5AA 2XAHA 3JD3A 1XNRB 3TY8A 1IBKH 4BIZA 2UXCO 4PJ0Z 2ZIMA 3RT3C 4LF6B 2Q0OC 5DQHA 2F66C 1A32A 5LL6Y 1GGOA 3QQMA 3TQTA 3SR2C 4X62B 2FLNA 4EFEA 4JTCB 3L4JA 4YY3B 3TXSA 3JD4A 1NQTA 4DRFA 3QZ7A 3OEEG 3STLC 3UO3A 5KT5A 1T94A 1P49A 5LMNH 3KHLA 3JAWB 1T3NA 3SJCC 2Q7DA 3RFCA 1M5IA 3RYCB 4A5UB 4PZ6A 4YR0A 4ETSA 2BQ3A 1KKDA 4DR7O 4XBFA 4CC5A 4D6TH 2QDOA 3Q4HB 1VQPV 1M6VA 1IBLB 1HNWH 2YRXA 4RAYA 2GQSA 4O4IF 2NNUA 3ETJA 3GWOA 4QE9A 3A0BZ 2W70A 2I80A 2DPIA 3U55A 2VA3A 4JYCA 4HNAA 1EZVH 1KQSU 2IH3C 5LHHA 2KG7B 3CXCU 2Q7GA 4MV7A 1I1KA 3B77A 3BG5A 1PV0A 1I7FA 3T1HO 2ZDHA 3OUUA 3UZOA 2EBOA 3P32A 4GT1A 4K0KH 3CCEV 2Q8VA 2JJ1G 3K5NA 5LXTF 4PV1B 1GM9A 1FKAH 4X65H 1TWGA 3DGEA 1F23A 5KUKA 2JS3A 4NTXA 2HP8A 4X1IB 3KALA 3L70H 2CW7A 1JJOA 2VQEO 4DV4O 1OV9A 2R8JA 4GZRB 4IT5A 5BXZA 2YZLA 4GKJH 2X0SA 4LWSA 3NBYB 3AK2A 2YSUB 4Q44A 2JA6G 1I1MA 3ZHVA 3H1IH 2W71A 1N33B 2VOBA 4ZHQA 5J2UA 3JRXA 4WFGA 2XNDG 2EIKC 2YICA 4NXNB 4YBZB 4RAZA 5LA6A 4ECSA 1KBLA 1BT8A 2WAMA 2ZNIA 4DV3O 1XNQH 2VUMG 4RB0A 3UFXB 3H4DA 2DOSA 3WO0A 3FAVB 1GM8A 4I0XB 2W0FC 4I9QA 4PZ7A 2E2HA 2XAFA 1P16A 4MTEA 4FLVA 2DWEC 3JARB 3N2KA 2PYLA 4DR6B 5FNVF 1OBDA 3BQ2A 1WPXA 4NYKA 2P5OA 5I5SA 1L2ZA 1VQMV 3ZHRA 1W0JG 3RN4A 3UCSC 3AYHB 4DV1H 1W0KG 1IX9A 4PDLA 1AP6A 4B7EA 3PZPA 4EBEA 3PO3G 4HAMA 4NR1A 1EKVA 4LNUA 1N8RW 3SPJA 4X66H 3R5HA 3RYHA 2COJA 1S5LZ 2ZXWB 1A9XA 2UXDB 4GUNA 3U0ZA 4B3MH 5KA5A 4EQ5A 2EIJB 2LFRA 4LFAB 3GILA 2JA7G 2R7MA 5T14A 2B5UA 5DECA 1P7GA 3N2GA 3JRWA 4EBDA 4GLXA 3N27A 2HHFA 2YUAA 3RGXA 1R73A 2DPJA 4DLKA 4ICGA 4MSWC 1JLLB 4O2BF 4ECYA 2EJRA 1VQNV 4YHHO 3KHGA 3AG1C 2HEPA 3ML0A 4R8UA 1JVMA 3BRCA 3AG4B 3GDEA 1FXKB 4CH6A 2QM8A 1HNXO 3BA9A 2E5LH 4PWQA 1NJIW 3UKMA 4F6RB 5IYCG 5C1PA 1WLEA 2Y0PA 2UU9B 4QJFB 3PN1A 2Q2TA 5BR8H 2ZDIC 5KG1A 2ALZA 4NXMH 3MR2A 3G71V 3VPDA 3T7AA 4I55A 3CP1A 4YJ2B 3L71H 1BNCA 2JEJA 1XMOB 2ZKOA 2K9PA 1VQ7V 1GN2A 2Y4TA 4DV2O 5H6RA 2LW1A 4WFAV 4B3SB 1THZA 2XGQA 3HB3B 4EFBA 3RJ0A 5KFDA 3VOTA 4EB6B 1UPGA 4J9SA 3L72H 1H2NA 4J80A 4P30A 3SJBC 5B3SB 5IJ0B 3UZBA 5EIBD 2P67A 4DUZO 4KL1A 4J9OA 5KAFZ 5EZYB 3HT5A 3J81W 4DR4O 2LW7A 5GTIZ 2F23A 3KTMA 1LUVA 4JGSA 4PA6A 5EYPB 5JWPA 1AUVA 4NKGB 4O4JA 4MTOA 3MR5A 4N23A 3PW5A 2Y69B 4MV4A 2CUGA 2J9GA 1TWHA 3T4DA 1Z5WA 2WB1E 3AG3B 5EZYF 3L4KA 2IA6A 3NUAA 4DL4A 5D1OA 4RAIA 1FFXB 1I6UA 3IGAC 3J81N 5DLFA 3OR6C 1HNZH 3SPGA 4ZKIA 3CD6V 2JVDA 4EBCA 5KG5A 4TUYF 2ARHA 3C3TA 1DTOA 4M9UA 1S0OA 4LF6H 3HKEB 3CSXA 3H3VH 3JAMW 1DIKA 2AGAA 5KAIZ 4DRXB 1B3QA 4TV8A 2UUBO 1NI8A 4TV9F 1R3KC 4JI2H 4O4HF 3OMAB 3RYIB 3OR7C 5KX5A 4IIJA 2AZ2A 3OTOB 3M9OB 3F7YC 5KFUA 4KFMA 1IBMO 4OX9O 1FXVA 4DL5A 1VF7A 1DV1A 4ECQA 4MW3A 4RUEA 4JI0H 5K1PA 1I94H 1EUCB 1KECA 4X1KA 1MZBA 3JAMN 1WA8A 3WWIA 2R84A 1E4GT 3JASB 1NH2B 3T4ZA 3HKCA 4LFBH 3E8FA 1YTFB 1EFRG 3B4SA 4B3RB 4IHJF 3V4ZA 2ZNJA 4TQRA 5DEDA 3T1YH 5KFZA 4X8AA 1SETA 2KB1A 5BWVA 1N56A 1EUDB 5BWTA 4BY7G 3Q8RB 3BFRA 1KP3A 4Z1MG 4PHZA 3BAAA 2GUZB 3KCXA 3STZC 3GTGA 2HIXA 5I5WA 4FLWA 2R8KA 4HNAB 4DUYB 2RJZA 4MVMA 2F1MA 2DQ0A 1IXBA 4DR3B 4HQ6A 3N43B 2D3OW 1GH6A 2ZQMA 3QO8A 1R6NA 2JEGA 3VQXA 2GQRA 2CE4A 2EIMB 5IY5C 2QE7G 5CA1A 5B1AC 2FK2A 2DW4A 4ME6A 2ASLA 5BMVB 1QNMA 3W7TA 1SZXA 1BSMA 5LYJF 2NU6B 1N33H 5JQGA 4QIWA 1DF5A 1N48A 3N6RA 2JEFA 3NC0B 3HKDB 3UT5A 5KFMA 3RGBA 2CTQA 3W7UA 3AG3C 4RZQA 2VQFB 1ZHQA 2IP4A 3H1LH 1S97A 5BMVF 1N32B 5J2TF 5GONB 2Q0AA 2ZD9A 1BHBA 3MFHA 5IJ9A 4FM1A 5KFGA 2JJ2G 1R6TA 2FK3A 5IWAB 3OHBA 4DR6H 1HR0O 4GKKB 2OIEA 5EC2C 1XOUA 4F50A 5LA6B 4O7WA 4J0MA 4A3JG 1MSDA 1V55C 3F5TA 2AHYA 2DYSC 4I50B 5LL6b 3L74H 2XTAA 5KHHA 4O2AF 4LF7B 1QLEB 2XAJA 2ZM6O 4NVPA 3HOVG 3M4IA 4DR1B 5KS8A 1BMFG 4I7HA 3J7AK 3P3PA 1Y1VA 4IAJA 1N0NA 1YHQV 1VQ6V 3CRCA 2HLDG 3RGZA 3A2FA 4I50F 3LSQA 2R8IA 3RYCA 5IDJA 2IJIA 4LNUB 2YXHA 2ZIOA 3WFVA 5IT9N 4DO2A 2C2EA 2F95B 3CC2V 3O65A 4FU0A 3Q4HA 4J41A 1DV2A 4P9OA 3G80A 4JI8O 2PBZA 1Y74B 4HBNA 2QEXV 3TW6A 4JV2A 1NS1A 1J95A 4LMYA 2BQRA 4FJCC 3WB1A 3LWBA 2CTPA 2P4VA 1QBZA 1CKNB 2M7WA 1SESA 4ED3A 2HHFB 3TCUA 1OCZB 2KG7A 1FVIA 5KKNB 1Y1WG 1YEWA 4LF8O 5IYCO 2DWDC 5C4XG 1K1SA 2EZPA 2ZDIA 1JA8A 2CNUA 4J9LA 1KYOF 3JCZA 3V6KA 4FK5C 1S03G 3BQ1A 2EILC 5D5QA 4UCVA 3F7VC 2Q67A 2FPPB 3RTXA 2FMLA 3LNNA 3DF7A 4HNTA 4X1YB 2P0AA 2HJDA 3T2MA 2Y0IA 4JV5O 4X1IA 5LHIA 2XHBA 2JA5A 2WWWA 3JALA 3NR7A 1FYJA 4K0KB 5JJJB 2BOCC 3DXRB 3JYCA 3QO7A 3ORQA 1S10A 4ECWA 1Q8IA 2F4VO 1AR4A 2IMWP 3VQVA 2BE3A 1S76D 1ET0A 5KFRA 1I2LA 1H2LA 2HGSA 1YJNV 3WG7C 1Q90D 3CCRV 3U54A 2V7QG 3APOA 4R50A 3JD2A 4KHPO 4J9ZB 1XMQH 4PA7A 3ASNC 5CN0A 5JCOC 3I12A 3FAVA 4I0XA 4Z1VA 4M0JA 2W9CB 1S68A 3CCMV 1DF4A 4XZ3B 4PDBA 1NTKH 2RCVA 5DG9A 2WLKA 2PF4E 4TOIA 1XREA 2QM4A 2XOKG 4NYEA 1N0JA 3CEIA 4NZOA 2PYJA 3VOUA 4ASUG 3J80N 4O7ZA 2ODTX 4A93G 4JI1H 5CB4F 2R93G 5K1XA 2GLTA 1QLEC 1SQGA 2N05A 1I7NA 5H80A 2ZE5A 1SC5B 2CTRA 2QWQB 2BTOA 4YJ3B 3RYFB 1B33N 3AK3A 4PDRA 1RM1B 1FAFA 4O2BA 4ED1A 4NTWA 4FLXA 2WSSG 5KMGB 4O3NA 5JJNB 1WCMA 5BPFA 5LMNO 4DV1B 3QO5A 3HKZA 3E8GA 1B6QA 2UXNA 4TQDA 3K5LA 4JI4B 1S72V 2R70A 5KG4A 3W1GA 4UB8Z 4DK1A 1FJGO 5CE8A 4KXRA 4X66B 3RB6A 3ZHUA 3GIDA 2H8PC 1Y66A 4TV8B 2B1GA 3H1KH 2I87A 3OHAA 2R85A 2PY5A 3KAKA 5KFXA 1HW7A 4B3MB 3ZMSA 4DV7H 1K9MW 3U11A 1N34O 1Z2GA 4RNOA 4HYOA 3ZJZA 3QFFA 4J7ZA 1XBLA 2DMXA 4A3FG 4O84A 1JPXA 4LFCO 4B3RH 1HWYA 1K34A 2DYRB 2IH1C 1FXKA 1K83A 1ZETA 3BA8A 1M1KW 2ZJTA 3HKBA 5LOVB 1K97A 4JAUA 4F6RA 1GN6A 4LF9B 1WA8B 4MVUA 4FS2A 1CEZA 4QJFA 4UV9A 1S5HC 4RB1A 4EGQA 3MJFA 4CE5A 1L0LH 2UXBO 3DTUB 4ABMA 3ABMC 1OZ0A 3GTOA 4LF5B 1NTMH 2QKCA 4RCNA 1KKCA 1ZUQA 1N36B 4A3IG 3OSNA 3OM3B 4XDKA 4DR3H 2E5LB 4JXUA 3SI8A 1TA8A 2PGGA 4MA5A 1ZX3A 2QTOA 3T9BA 1QR8A 4FLTA 5BWRA 4CH5A 2ETNA 4GX1A 3RFRA 4FLZA 3FD9A 1Z5VA 4UCUA 4YAJB 5EZYA 2DIKA 3ABKB 5KT7A 3BACA 3EFFK 2QKAA 4DV6O 5EYPA 4JI5O 4FFBB 3LQSA 2ZDGA 5CA0F 2JRIA 1VIBA 5JVDB 3GIQA 2Q4PA 1XNQO 1SYXB 2W57A 2GTSA 5BWXA 4JTAB 4RUFA 1NKDA 1FFXA 3JZFA 3T5HA 2VRZA 3R9RA 3HKZE 3CQZA 4Q8EA 4GKKH 4F4YA 2KSDA 4YIOA 4O4HA 2CW8A 2EIKB 4BW5A 1Y4MA 4CH4A 3C90A 2VPSA 2FB5A 1P7BA 5B1OA 1WRVA 3DAAA 1ZQ7A 3FDSA 3HKEA 3HXLA 4LF7H 1AJPA 1RFYA 4PD4F 1GO3F 2DZDA 2O57A 4DR1H 3W1BA 4DRXA 4GCZA 2R72A 5GW7A 4CBCA 4M7EA 3SJAC 2CGNA 1HNZB 3RYIA 1VQ4V 2GSMB 2W8LA 2Z3YA 2YCHA 3JCUZ 2VQEB 4DV4B 5L3CA 2YL2A 3VBBA 2OH2A 3IFXA 3OSPA 2C35B 1H38A 4TSFG 5LGTA 2Y4UA 2Z5UA 4EKWA 2QR4A 2A9HA 3K0DA 4IHJA 3SDLA 5K2MA 5C44G 3KXYT 2R92G 2HHHB 3QVNA 2WYOA 5C5JA 4RO2A 1NBMG 4O7SA 3TY5A 4QW8A 2FLLA 4JI2B 4CS2A 3JASA 4F4WA 4O4IB 5KFPA 2RDJA 4IR9A 4O4LB 2BCCH 4UV8A 2VWKA 4HNVA 2DYRC 3K58A 1Z2NX 1OBGA 2LFSA 2YZGA 4JI0B 3N42B 5C3EG 1I94B 1I0HA 3KG2A 4AILC 5D8DA 4A3GG 1OCRC 2FKXA 5KFOA 4FZ1A 3N6XA 5EWEA 2VR1A 4O4LF 3KHHA 4KP4A 4LF4O 3PFFA 2VA2A 3SGIA 2GUZA 5LHGA 3H40A 3AG1B 2UUAO 4LFBB 5LXTB 2X6BA 3T54A 4RU9A 4JYYA 3KZIZ 4RWUA 5LYJA 3TEKA 3TETA 1YIJV 3IAYA 2V4QA 1GSOA 2AU0A 1Q43A 3T1YB 5CA3A 3GJXB 2E74B 4JI7H 3HO8A 2IJJA 5DN6G 2NN4A 2IU3A 1H2SB 1M9NA 4JI3H 1AVMA 5FD6A 3EPGA 3CRRA 3ABKC 1YF2A 3CCQV 5BMVA 2Q5ZA 3R5XA 3GIKA 1MG1A 4DV5O 3ABUA 1I08A 3AG2B 1GMGA 2Y4RA 4GC6A 4BIOA 5C93A 3HKDA 1NH2D 5KT4A 4JUZA 3JALB 3OT7A 3CEBA 3U9TA 5KFCA 1YTFD 1DGSA 1MMMA 5GONA 2NVXA 2SCUB 4A3CG 5JCOA 1SFOA 1AR1B 1YVWA 4DL3A 3E89A 3WWJA 1I5XA 2L35A 3CHXA 4C5AA 5FNVB 4PDVA 2A7WA 5HFMA 3A0HZ 2QYZA 3FX7A 4I50A 3H01A 4AQYB 1XNRO 2PN1A 3M9MB 3GLKA 4EEYA 1RK6A 5H5NA 4LF6O 1TGOA 2B9ZA 2XUMA 3U9SA 2HVSA 1M56C 3SYAA 4MV9A 4QPKA 4X62O 4JYAH 5KFTA 3W7XA 2QM7A 4PDMA 3ABTA 4AHCA 5IYZB 4YY3O 2MCTA 4EYIB 3RAQA 2YIBA 3WB2A 2QWNB 3K0GA 4A3DG 3CRAA 4O3OA 5L1JA 5C8YB 3W7SA 5JUMA 4JI4H 1MZEA 4RQEA 4J7KA 3RW0A 1B6RA 3H1JH 5IYZF 3V6JA 3OEHG 1YI2V 4MV1A 1Y74A 1O9GA 2WB1A 4O2BB 2OLSA 1IBLO 1SQXH 2R7ZA 1RJQA 1K5SA 1Y67A 3K9SA 4TVIA 5C8YF 4MT8A 3CCUV 4ECRA 4D7TA 1CKNA 2PVPA 4QWBA 5EWFA 4J10A 2BOBC 4LF9H 2V9WA 4OPHA 3E22B 1RPOA 1QHTA 1WSCA 4DXWA 3ZEDA 2NLJC 2JGUA 3ZMVA 3X2QB 4JYBA 4D7SA 2UXCH 4FM0A 3H1HH 4CH3A 4O7YA 4TWKA 4LF5H 2B63A 4PI2A 2EJ2A 1N36H 1IOWA 4X1YA 1CE8A 1FFTB 1BS3A 3HKBB 3SPCA 1ZWIC 5A9GA 4X20A 4DW0A 1Q82W 3DXRA 3AW8A 1OCCC 3ZHTA 3R23A 3K59A 3H0GA 4OX9B 3SYQA 2X7RB 5I5UA 2EJ7A 3E5NA 4DR7H 1WP7A 3AG2C 3Q8PB 3CCJV 1F7YA 1AJQA 1J5EO 3OUSA 1EHIA 3A8TA 2CNQA 1S0VA 2X6AA 4NXNO 5IY5B 2MK3A 1I3QA 5LP6F 5B1AB 2W9CA 2R9IA 3HB9A 2Z0AA 2XIGA 4Q43A 1SQQH 4QWEA 4E6NA 3B8NA 3T1HH 1VF6C 3QTCA 5KA6A 3I5DA 4TUYB 4JAVA 4DK0A 2W0XA 3ASOC 1URFA 1XMQB 2UUCB 1XHZA 2P06A 3V6HA 4X64B 2ZINA 5FPOA 4HNUA 3HOUG 3ZHQA 4YJ3A 3RYFA 4LH6A 1VAJA 2RQ6A 1O9HA 1I5YA 4TV9B 3NGDA 4O4HB 2UXDO 2VQEH 4DV4H 5GTHZ 5KMGA 1MABG 1RP3B 4MA0A 3KAJA 4JI1B 2L6LA 1S5JA 3THOA 1JKJB 3L75H 4FIPC 4UFZA 4DV0O 4LFAO 1V55B 4BBRG 2DYSB 4R6ZA 4F6EA 1S0MA 3OMNB 5DG8A 1PD3A 1EBOA 1S77D 5JH7F 2HHHH 4QW9A 4PI0A 1MSWD 1AI6A 1LUWA 4CZZA 5IP7G 3J7AU 1VQ5V 1IDSA 4K6NA 2QTSA 4LC1A 3T1CA 2CNVA 1NVPB 3CMAV 4IHJB 1AROP 1KMIZ 3JD1A 2JEUA 3WB0A 5LOVA 2R8GA 5CAEB 3TXQA 2RN9A 4MAMA 1EKFA 1FXHA 2W7PA 4R7RA 3X2QC 2E2IA 5KFBA 2UU9O 1F51A 5FJ8G 4I9WA 5L3BA 4DV7B 3M7MX 3FMAA 1DAAA 4JI6O 3AX6A 4WBNF 1TUBB 2W9BA 2AHZA 2ZM6B 1QCEA 1BGWA 5B1NA 3GTKA 2ZE8A 5EWGA 3RB0A 1YCIA 1XMOO 1PX2A 1T36A 4BWSC 4HZ3A 1BQ0A 5LBQA 4O81A 3T5JA 5J9PC 1VEWA 3K3PA 4H37A 4B3SO 4QSHA 1NZ6A 4QNHB 1VQ9V 5LP6C 1Z2OX 3H0GG 1JCHA 1GK9A 1KBHA 4J9RA 2Y48A 4JZGA 4YAKB 2EILB 1WB8A 5HBRB 5DAAA 1YJ9V 5LYJB 5FR9A 3CJHB 4G28B 5H6QA 1C30A 1WH2A 1JJ2U 3MWDA 4FFBA 4WFEA 4B3TO 3W7WA 4JI8B 4FE2A 3OE7G 3GB7C 3CCVV 3UQ8A 4YHHH 1YZBA 1VARA 4R8CA 5JVDA 1UC9A 2XCPA 3DC6A 1JX4A 4K8ZA 3GIMA 2FK1A 2KQXA 5LMUO 3I55V 5J2TB 4XX0B 2Y0SE 1QVFU 1JFFB 2E3CA 1HNXH 1RPRA 3KYHC 3CRMA 3M99B 1M4UA 2IJKA 2XASA 4K35A 4CKBA 4EG0A 4DR2O 1R9TA 3G6YA 4MVRA 3VQYA 3CPWU 1SS3A 4YQWA 3WG7B 3JATB 2BTQB 3K06A 2MW2B 4AQYH 3E83A 4O2AB 1KB9F 5L1LA 3ASNB 4DV2H 3IN5A 2N04A 3ETGA 3MWEA 5DM6V 3H9VA 2Q6AA 3HOZG 3P3NA 1ZL8A 1CKOA 4G2KA 2GTAA 1OWTA 4DUZH 3OTOO 2WLIA 4U7NA 3VPBA 3GIJA 1Q86W 2QKSA 3ICXA 3VQWA 2F4VB 5KFVA 4DR4H 4MV6A 3ZMUA 3C3SA 1GM7A 3F5WC 1SRYA 5I47A 4O4IA 5CBFA 4O4LA 2BSKA 3CS5A 4UCSA 1W59A 4RZRA 1VKZA 2G38A 5ITZB 1Q6IA 1P4RA 4TM5A 1FPOA 3OMIB 3S3XA 4DR5O 1N4CA 3OUZA 2R9RB 3HOWG 4B3RO 4O7RA 4Y8VB 3OD4A 2GBOA 3BABA 1R6KA 1KU9A 3VNNA 4ZHQF 1JMKC 1BQZA 5J2UF 1PM9A 3M8AA 2UVRA 5KFEA 2QWPB 4NB5A 3PW0A 1GKFA 1VMGA 3FKIA 4FBTA 5LXTA 2PZSA 4ZIBA 2UVVA 1L1FA 1AP5A 2V59A 1E1RG 1AUXA 2RNBA 4X89A 4Q45A 4TQFA 4RB3C 3OFNG 4DUYO 3Q8SB 3G67A 3TIGA 4UCRA 2UUBH 1GO3E 2HKOA 4Q8FA 4DR3O 4FMTA 2E76B 3ZIAG 4B7KA 4LCUC 3T9AA 4GX0A 4Q6GA 3K79A 1EN4A 4I7ZB 1IBMH 4OX9H 2ABJA 2W6IG 1Y14B 3ABMB 4O7VA 3DTGA 1D5NA 4Q4DA 3CYOA 3GTPA 5L1KA 2WTFA 2CK3G 3MR6A 4JI7B 2ZCEA 4L8JA 1IXMA 4X20B 3SPIA 4JI3B 2BR0A 4JF3A 5JQWA 1WN7A 2COIA 4LFCB 4KUMA 2VQFO 3RUPA 4UVAA 1LR1A 2WLLA 5L3DA 1AJNA 2HVJC 3LDDA 1N32O 3NBZB 4IRDA 4MTGA 4QPJA 4CHIA 3CMEV 1TWCA 3RV4A 2EINB 3G4SV 5FNVA 5BWWA 3LDEA 2C00A 5IWAO 1VQOV 1K1QA 3ORRA 4ECZA 4XDLA 1VF6A 5CB4B 3B40A 2YS8A 2ITDC 2UUCH 1JQ0A 2Q7EA 4X64H 5KHIA 2YRWA 4E2LA 2WLMA 1GAXA 1K5QA 2P7TC 3O9OA 3ZRWB 4BBSG 4MS2A 2X5RA 1Q81W 4A2AA 5IYZA 4FFRA 1TAEA 1BE3H 2FPGB 2PTMA 2NVYA 5EK0A 4R7CA 4YR2A 3RBZA 4DYLA 3L9DA 1TVKA 2V5AA 4PA3A 5C8YA 2LJ2A 1L8DA 1IBKO 5I5VA 4I55F 1EN6A 3Q1KA 2W6JG 1QU7A 2QJ1A 4ZI7B 5H9CA 4WFBV 5DQIA 4JYAB 4IYIA 1KD1W 4E4TA 1XI1A 1Y1VG 4Q0YA 3EVKA 1R3IC 4O7LA 3RIZA 2GPWA 3G8CA 4FLYA 5KLVH 1Y76A 3QNEA 4YB8B 2YXLA 5IYBG 4XYLB 2F43G 4O3PA 1XILA 4FPPA 2XCAA 1E4EB 5KG0A 1S0NA 2OTLV 5B1BC 5KT6A 4ZI7F 1A48A 3GTQA 3G6XA 1MNGA 5KG2A 1HR0H 3E22A 1KC7A 2QGNA 4JAAA 1UC8A 2QWOB 3CRQA 3RVYA 1HNWO 2ZDQA 2YI9A 5L9XA 4RNMA 2ZM6H 4Z2WA 3MWMA 3GQCA 1KUTA 2HG8A 2DABA 3PJSK 1CPYA 3E8HA 2DLNA 3QG5A 5DMXA 1SQBH 2XC9A 1NR7A 2C2AA 1OCRB 2JK5C 5B5EZ 3T9DA 1YXBA 1WB7A 2UXCB 2W9BB 3ABLC 5LP6A 4TQSA 4K0KO 2DE0X 1M57C 2QWRB 5CMUA 3F8NA 3RAXA 1G6UA 4YIPA 4DIMA 3ZRVA 4EGJA 4F4XA 4P9PA 4FZ0A 4L87A 1FKAO 2Q7HA 4FM9A 4X65O 1X59A 1G8MA 5FL7G 1YJWV 2W6ZA 4JI8H 1KTAA 4MVSA 5CA0B 2QA4V 2IM9A 2JA5G 1AILA 4ED6A 3LDCA 4H33A 3VA7A 2D2CB 3NXSA 4IIJF 4LP8A 5DG7A 1TUEB 1QVGU 3ZHSA 2XGPA 4GKJO 3RWRD 1GN4A 2N74A 1WAZA 3UO2A 3LULA 1XL4A 3DTFA 5HNEA 4DR7B 2EINC 3BVOA 4TT3G 3I4NG 1MZFA 2BQUA 4FFKA 3G8DA 3HBLA 5FLMG 1GYFA 2GHYA 3WU2Z 2A0LA 1XUQA 4TUYA 2R6FA 1SZTA 2ZE7A 3ZBHA 1US6A 1GRJA 2UUAB 5KFJA 2HR3A 2CQYA 2FKLA 4CKCA 2NR5A 4JASA 1K92A 4UCTA 5L1IA 1AN7A 4JV5H 1FS0G 5H2FZ 4TV9A 2CH7B 4IRKA 1Y6XA 2RMKB 3PR4A 3T1HB 1ROPA 1EN5A 5C1OA 5JJEB 2YI8A 2C28A 1XK5A 4I4TF 1KJJA 3CCSV 3G6VA 1B04A 4K8XA 2WA4A 4DV1O 2F4VH 1RJRA 2IBKA 2PMZA 2JA6A 4IWYA 1PNMA 2B1IA 1M56B 4IL6Z 4X66O 4BIUA 1UFIA 1AB3A 3CSWA
chains in the Genus database with same CATH topology
4D7TA 4I55B 1CKNA 2WE6A 1ZAUA 1CKMA 2F93B 1XHXA 5A2QW 5DISC 3N41B 4PHZA 4WBNA 3BAAA 4B3TH 4LF9H 4X65B 3RF2A 3J80W 3E22B 2HIXA 1QHTA 1M93A 4FLWA 3ZEDA 4HNAB 4DUYB 2JGUA 2RJZA 4CC6A 2F1MA 4BW9A 4D7SA 4FM0A 5LMUH 2UXCH 4CH3A 3K57A 4DR3B 3N43B 4LF5H 2RGRA 4GKJB 4LH7A 2V4DA 4PI2A 1N36H 4DV6B 4X1YA 3VQXA 3HKBB 3QWUA 4DV3B 1TUBA 5CA1A 4JI5B 4DR2H 4O4JB 3JARA 5BMVB 4X20A 4MTDA 3H20A 4ZOLB 1N33H 5JQGA 3N44B 3K59A 4OX9B 1XNQB 3NC0B 3HKDB 3UT5A 4DR7H 1BJTA 5D1OB 3RGBA 4RZQA 2VQFB 3ETQA 1ZHQA 1Z2PX 4B08A 1N32B 5GONB 4PZ8A 1FJGH 2Q0AA 5IJ9A 4FM1A 3OTOH 2OYQA 5IWAB 4DR6H 4GKKB 2HVQA 1N34H 1XDNA 5LA6B 4J0MA 2XIGA 1XQ8A 4I50B 5LL6b 4LFCH 5KHHA 2P22C 5J2TA 4LF7B 4E6NA 1JFFA 1M0WA 3T1HH 4NVPA 2KKWA 5KHGA 3QTCA 3M4IA 4DR1B 1T5EA 4TUYB 4I7HA 4DK0A 1X4TA 4IIJB 5EIBC 5KX5B 1XMQB 3J7AK 2UUCB 1XHZA 2R9AA 4X64B 2ZINA 4DR5H 5FPOA 4IAJA 4YHHB 4FLUA 3JATA 3RGZA 2BTQA 4YJ3A 3RYFA 4LH6A 3A2FA 2UXBH 2RQ6A 1O9HA 4X1KB 4O2AA 4TV9B 3RYCA 4O4HB 4LNUB 1HNXB 2ZIOA 2VQEH 4DV4H 5KMGA 2VWJA 3KAJA 2F95B 3JSLA 4JI1B 1S5JA 3THOA 1SA0A 1RSOA 4UFZA 3HKCB 4YJ2A 3N40P 4HBNA 4DUYH 4LMYA 2HHHH 4LF8H 4PI0A 2FE3A 3WB1A 1CKNB 4LF4B 4GYCB 4DV2B 4DV6H 4EB6A 5BR8B 4NXMB 1FVIA 4I4TB 1J5EB 1YEWA 4JI5H 5IJ0A 4IHJB 5JH7A 1KMIZ 2CFMA 3C0FB 3WB0A 5LOVA 3CB2A 1TVKB 3JAKA 5ITZA 4DUZB 4R7RA 1S03G 5D5QA 4UCVA 1A0IA 4DR4B 3K5MA 1VS0A 3RTXA 4DV7B 3LNNA 3DF7A 3ZS8C 4X1YB 3M7MX 3FMAA 1TUBB 5CA1B 2VQFH 1NT2B 3LMLA 1N32H 4X1IA 2ZM6B 1BGWA 2XHBA 4DV5B 5FD5A 4BWSC 2HVRA 1E4FT 3JALA 4K0KB 5JJJB 5JQGB 5D5PA 3K5OA 5IWAH 2GV9A 1Q8IA 2PUSA 4KHPH 3UT5B 1P8LA 5LP6C 3W5OA 1Z2OX 3VQVA 2HGSA 4LSAA 5LYJB 3S24A 3L2PA 1WH2A 1XMQH 5IJ9B 4DV0B 3CVZA 4U3JA 4FFBA 1WNSA 5JCOC 4JI8B 3JSNA 1S68A 3UQ8A 4YHHH 5JVDA 4PDBA 4K8ZA 1D5AA 1XNRB 3TY8A 1IBKH 2UUBB 4TOIA 4EEQA 4APMA 2QM4A 2ZIMA 2YIBD 4LF6B 5J2TB 2F66C 2HIVA 2PYJA 1JFFB 2E3CA 3SR2C 1HNXH 4X62B 3KYHC 4EFEA 4JI1H 3L4JA 5K1XA 4YY3B 1IBMB 4DRFA 1SQGA 5LP6B 1M4UA 3VQYA 1P49A 3TY9A 2BTOA 5LMNH 3JATB 2BTQB 4YJ3B 1V9PA 3JAWB 3RYFB 4AQYH 2KSWA 3SJCC 4O2AB 1M5IA 3RYCB 4O2BA 4PZ6A 4LF4H 4ETSA 4DV2H 5CB4A 4FLXA 5KMGB 2UUAH 5JJNB 4JI6B 4CC5A 4DV1B 1SA0B 1IBLB 1HNWH 4TQDA 3K5LA 4JI4B 4RAYA 2R70A 3W1GA 4DK1A 4X66B 1CKOA 4DUZH 4TV8B 3KAKA 2PY5A 3ICXA 3VQWA 1HW7A 4B3MB 2F4VB 4DR4H 4DV7H 4HNAA 3U11A 2Q7GA 4MV7A 4B3RH 4O4IA 4ZI7A 1I7FA 4O4LA 4DV5H 4UCSA 3BA8A 5JH7B 3RR5A 2ZJTA 3HKBA 5LOVB 4K0KH 3JAKB 4F6RA 5ITZB 4B3TB 4LF9B 3K5NA 4RB1A 1FKAH 3BABA 4X65H 5LMUB 1KU9A 3VNNA 1JMKC 4LF5B 4X1IB 1N36B 3KALA 2CW7A 1JJOA 4DR3H 2E5LB 1TA8A 5LXTA 5FPRA 2PZSA 4ZIBA 2PGGA 4GKJH 3NBYB 1QQCA 4DR2B 4TQFA 4FLTA 4DV3H 4CH5A 3BPZA 2JS5A 4RB3C 1XNRH 4WBNB 3RFRA 1N33B 2VOBA 4UCRA 4ZHQA 4FLZA 2UUBH 1Z5VA 5J2UA 4UCUA 5EZYA 4Q6GA 4NXNB 4RAZA 4X62H 5LA6A 5EYPA 2ZNIA 4YY3H 1IBMH 4OX9H 1XNQH 1HR0B 4RB0A 4LSXA 4U3JB 4FFBB 4I9QA 4PZ7A 5JVDB 1P16A 4MTEA 4FLVA 4JI7B 2ZCEA 3JARB 3N2KA 4L8JA 4X20B 2PYLA 4DR6B 1SYXB 2W57A 2P5OA 1L2ZA 1FFXA 4JI3B 1WN7A 4DV1H 3QF7A 4LFCB 4GKKH 4BWAA 5CA0A 3EYYA 1IBLH 2EX3A 4O4HA 4LNUA 2CW8A 3NBZB 5FLXW 4RB2C 5D1PA 4CH4A 5KHKA 2VPSA 4X66H 3RYHA 3HKEA 3HXLA 4LF7H 5FNVA 4DR5B 1SQFA 2UXDB 4CS4A 3GB8B 3U0ZA 4B3MH 4DR1H 4EQ5A 5CB4B 3W1BA 4DRXA 2UUCH 4LFAB 2Q7EA 4X64H 2R72A 4M7EA 3SJAC 5KHIA 1HNZB 3BHPA 3N2GA 3RYIA 4GLXA 1ZHSA 2YCHA 2VQEB 4DV4B 3RGXA 4I4TA 4A2AA 5IYZA 1TAEA 2PTMA 2Q2UA 4IHJA 4A2BA 3KXYT 2HHHB 1TVKA 4LF8B 5C8YA 2HEPA 2WYOA 1L8DA 4CS3A 3TY5A 1WPBA 4JI2B 4CS2A 3BRCA 3JASA 3OTFA 4O4IB 2QJ1A 4ZI7B 4O4LB 4CH6A 3GDEA 1X9NA 2WDTA 4JYAB 3BA9A 2VWKA 1XI1A 2E5LH 4Q0YA 3K58A 4F6RB 3RIZA 2UU9B 1Z2NX 4FLYA 3PN1A 2Q2TA 5BR8H 4JI0B 4NXMH 3N42B 2YXLA 1I94B 1J5EH 4AILC 4JV5B 4I55A 4LR3A 4YJ2B 3N6XA 1XMOB 4NXNH 3SGIA 4LFBB 4B3SB 1HR0H 3E22A 5LXTB 4EFBA 3RJ0A 5LYJA 4EB6B 2YIAA 3IAYA 1Q3EA 1Q43A 3T1YB 3SJBC 2YI9A 5IJ0B 3GJXB 4ZHQB 5EIBD 4JI7H 2ZM6H 5J2UB 4UCOA 4KL1A 3MWMA 5EZYB 3J81W 1H2SB 1M0TA 4KHPB 4JI3H 5FD6A 5EYPB 3QG5A 4O4JA 5BMVA 5IT9W 1Q5OA 4ZOLA 2UXCB 5LP6A 1Z5WA 2UXDH 3L4KA 3HKDA 3N2KB 3F8NA 1G6UA 5D1OA 3JALB 1FFXB 3JAWA 2RGVA 4DV0H 2Q7HA 4LFAH 1I6UA 1IBKB 4FM9A 4JI8H 1DGSA 5GONA 1HNZH 5CA0B 2IM9A 2JVDA 5JCOA 3K3VA 2O03A 3RYHB 2VUGA 3HKEB 4LF6H 3B2EE 3CHXA 3CSXA 5FNVB 2OWOA 3RWRD 4DR7B 1O75A 3U10A 3JAMW 4I50A 5LMNB 4DRXB 3MAQA 4AQYB 4TV8A 1GYFA 4JI2H 1FJGB 2CAZC 1TGOA 3N2GB 3RYIB 2HVSA 4TUYA 1SEIA 4MV9A 5KX5A 4IIJA 4JYAH 5EOYA 3OTOB 5KHJA 2UUAB 5IYZB 4AHCA 2MCTA 1VF7A 2YIBA 3WB2A 2UU9H 1HNWB 1N34B 4JI0H 5K1PA 4JI6H 1I94H 4UCTA 4X1KA 1AN7A 1MZBA 4JV5H 3IG0A 3FFQA 4TV9A 5C8YB 3T1HB 4JI4H 1XMOH 1E4GT 3JASB 3DSQA 5JJEB 2YI8A 1XK5A 1SKVA 1B04A 3HKCA 4B3SH 4K8XA 4LFBH 1O9GA 4B3RB 4O2BB 2F4VH 2ZNJA 4FVMA 2UXBB 3T1YH 4FM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN1 A;  1CKN A;  2Q2T A;  4JI0 B;  1ZAU A;  1I94 B;  1CKM A;  4B3T B;  4LF9 B;  4JV5 B;  5DIS C;  2CFM A;  3BAA A;  4X65 B;  1XMO B;  2HIX A;  4DUZ B;  3BAB A;  5LMU B;  3SGI A;  3VNN A;  4UCV A;  4DUY B;  4CC6 A;  4DR4 B;  4LF5 B;  1A0I A;  4LFB B;  1VS0 A;  4DV7 B;  4B3S B;  3RTX A;  4DR3 B;  1N36 B;  4EFB A;  4GKJ B;  4LH7 A;  2E5L B;  1TA8 A;  5FPR A;  4DV6 B;  2ZM6 B;  4DV5 B;  3T1Y B;  4DV3 B;  4DR2 B;  3GJX B;  3NBY B;  3QWU A;  2HVR A;  4JI5 B;  4UCO A;  4K0K B;  1N33 B;  4UCR A;  4KHP B;  4UCU A;  1P8L A;  4NXN B;  4OX9 B;  1XNQ B;  3W5O A;  3NC0 B;  2UXC B;  1HR0 B;  5D1O B;  2VQF B;  4PZ7 A;  3S24 A;  3L2P A;  4DV0 B;  1N32 B;  1P16 A;  4PZ8 A;  5D1O A;  4JI8 B;  3JSN A;  4JI7 B;  1S68 A;  3UQ8 A;  1IBK B;  4DR6 B;  1DGS A;  1XNR B;  3TY8 A;  5IWA B;  2UUB B;  4JI3 B;  4TOI A;  4EEQ A;  4GKK B;  2HVQ A;  4LF6 B;  1XDN A;  2HIV A;  4LFC B;  4X62 B;  3KYH C;  2VUG A;  4EFE A;  3NBZ B;  2OWO A;  5D1P A;  4YY3 B;  1IBM B;  4DRF A;  4LF7 B;  4E6N A;  4DR7 B;  5LMN B;  4DR1 B;  4DR5 B;  4AQY B;  2UXD B;  3TY9 A;  3GB8 B;  1XMQ B;  2UUC B;  1V9P A;  4EQ5 A;  4X64 B;  1FJG B;  5FPO A;  3W1B A;  2HVS A;  4LFA B;  4YHH B;  3OTO B;  4PZ6 A;  2UUA B;  1FVI A;  4LH6 A;  1HNZ B;  4GLX A;  3BA8 A;  4JI6 B;  4CC5 A;  2VQE B;  4DV4 B;  1N34 B;  1HNW B;  4DV1 B;  1TAE A;  1HNX B;  1IBL B;  4UCT A;  2Q2U A;  4JI4 B;  4JI1 B;  3JSL A;  3W1G A;  4X66 B;  1CKO A;  4UFZ A;  3T1H B;  2HHH B;  4LF8 B;  1XK5 A;  4B3M B;  2F4V B;  3TY5 A;  1B04 A;  4JI2 B;  3GDE A;  4B3R B;  1X9N A;  4JYA B;  1CKN B;  3BA9 A;  4LF4 B;  2UXB B;  4DV2 B;  5BR8 B;  4NXM B;  2UU9 B;  4UCS A;  1J5E B;  3RR5 A; 
#chains in the Genus database with same CATH topology
 1XEQ A;  1BZK A;  5KT2 A;  2WE6 A;  1CKM A;  1ZL8 B;  3LNM B;  3GTL A;  4B3M O;  1WCM G;  5A2Q W;  4WBN A;  4BR6 A;  1AI4 A;  5CA1 F;  1NTZ H;  2WLI B;  4IGG A;  4FFL A;  4A3B G;  4UUJ C;  3RF2 A;  2VUM A;  4J42 A;  4GC7 A;  1LNQ A;  4CC6 A;  1RYS A;  3BCC H;  4PBC A;  3K57 A;  4QIW F;  4LF9 O;  2BSK B;  3M9N B;  1BHA A;  1K4D C;  3QWU A;  4DV3 B;  2YZN A;  3R5F A;  1TUB A;  3UM7 A;  5I5T A;  1RK5 A;  3I4M G;  2AW9 A;  5A2Q N;  4MTD A;  1OCO C;  4LF5 O;  2ZGI A;  1N36 O;  4ZOL B;  3D3Q A;  3N44 B;  3CWB H;  4FFP A;  2AGQ A;  3OGC C;  2E5L O;  2H94 A;  3LSS A;  2R7K A;  5KFL A;  3EXA A;  4J9Q A;  2JDI G;  2ZR3 A;  2ATL A;  3SYO A;  5BR8 O;  5KG7 A;  1W93 A;  3BEH A;  4NXM O;  4C5C A;  1Q7Y W;  4WHX A;  3ETQ A;  1XL6 A;  1Z2P X;  4B08 A;  2JA7 A;  1F4N A;  1IYE A;  3CX5 F;  2FLP A;  4PZ8 A;  1CQJ B;  4J9P A;  1FJG H;  1I1L A;  3CJH A;  2ZT9 B;  4ZOL F;  2JGD B;  3Q2O A;  4UVC A;  1V54 C;  1N34 H;  1XDN A;  4LFC H;  2XAQ A;  2P22 C;  1OCC B;  1NVP D;  5J2T A;  4RUC A;  1JFF A;  4UVB A;  4NZM A;  4C5B A;  5I5X A;  1FD9 A;  2ASD A;  3HOX G;  2PMZ E;  5L3F A;  2HFE C;  4H44 B;  4YHH B;  5JVL A;  3JAT A;  2BTQ A;  3V4S A;  5DQG A;  5KFN A;  2UXB H;  1KP2 A;  3B8M A;  4YP3 A;  1EZJ A;  3E2E A;  4O2A A;  4ED8 A;  2HJF C;  4DQN A;  3FKS G;  2WLL B;  1HNX B;  4UUG A;  3GV8 B;  3JSL A;  1B6S A;  2K1E A;  2HDK A;  2WPD G;  1RSO A;  2OCH A;  3N40 P;  3GII A;  2CTW A;  1HNZ O;  2YEV B;  1JX9 A;  1U97 A;  3ASO B;  3SJQ C;  5F2V O;  5BPH A;  1H2M A;  4DV2 B;  4DV6 H;  3E86 A;  1J5E B;  2QK4 A;  1E1Q G;  4J7J A;  2HHH O;  1PL4 A;  4JI5 H;  4O7N A;  2YZM A;  4JZ2 A;  3G6E V;  3IC9 A;  4JI2 O;  2W9A A;  2UXX A;  4ED0 A;  5E1A C;  1TVK B;  5ITZ A;  4H13 B;  2Q68 A;  4DUZ B;  3LSU A;  3ZN0 A;  1CXZ B;  5IYB O;  5L3G A;  4J9K A;  4DR4 B;  3K5M A;  1VS0 A;  4MVZ A;  1ZLZ A;  2H3O A;  2IJH A;  1Q6H A;  4JI0 O;  4ECV A;  3JZ6 A;  2YWV A;  1I94 O;  5DGI A;  2FYU H;  1QR9 A;  3UYY A;  3LML A;  2HGX A;  5DGB A;  1Y76 B;  5FD5 A;  4O3Q A;  2GDS A;  2J6T A;  1AI7 A;  1E4F T;  1SQP H;  5DLG A;  1KEE A;  2YYA A;  4LFB O;  4J9N A;  4K3A A;  2GV9 A;  5EBM C;  5LGN A;  2NU7 B;  3HPL C;  5DGA A;  1VF5 B;  1Q6U A;  2PUS A;  1P8L A;  4RQF A;  3R65 A;  3R66 A;  4ED2 A;  3N8D A;  3T1Y O;  2J6U A;  5KFF A;  1HDJ A;  4LSA A;  4BAY A;  3ETH A;  1VP7 A;  1L0N H;  3S24 A;  3CVZ A;  4DV0 B;  1TWA A;  2EZO A;  1S9F A;  4PA9 A;  4W4K A;  5IP9 G;  2W7O A;  4RUA A;  1IVS A;  1EKP A;  1K4C C;  1OHH G;  2UUB B;  4ECT A;  4NZN A;  4EEQ A;  1K3E A;  4FFN A;  4APM A;  2YIB D;  4O3S A;  1IYD A;  3WWH A;  2HIV A;  5KFS A;  4ECU A;  3GWK C;  2R87 A;  2YS6 A;  5KFA A;  3GV7 B;  1IBM B;  4IZO A;  5LP6 B;  1KUQ A;  3D36 C;  1SCU B;  1B06 A;  1QLN A;  1G1X B;  3TY9 A;  1WJZ A;  1G2W A;  1NR1 A;  1V9P A;  1N33 O;  2KSW A;  4NTY A;  4CKE A;  1JDE A;  4EYH B;  2PI5 A;  1BL8 A;  1R3J C;  2YXY A;  4LF4 H;  3LUT B;  5CBG A;  5CB4 A;  3KRE A;  4CMF A;  3E35 A;  2UUA H;  2J6S A;  3MHH C;  4JI6 B;  5IE9 A;  1M90 W;  1SA0 B;  2LGQ A;  4AQY O;  1GSH A;  5BY1 A;  3ETE A;  3PR5 B;  1GTO A;  3BY6 A;  3ZRW A;  2WA3 A;  1TWF A;  5EDW A;  1R1B A;  4DR6 O;  1GLV A;  3D8C A;  3SNO A;  4QE7 A;  3RBE A;  4OGQ B;  4QGP A;  4U3F H;  2DJV A;  4YJ2 F;  2JA8 G;  1BCC H;  4ZI7 A;  1VBH A;  2VQD A;  4DV5 H;  5JH7 B;  2V58 A;  3RR5 A;  2ADQ B;  1R3L C;  4XDJ A;  2R8H A;  5BYA A;  1YDX A;  1CQI B;  3JAK B;  4A3K G;  4B3T B;  2Z02 A;  2C2D A;  3FB8 C;  5EC1 C;  3DC5 A;  2Y0S A;  5EBW C;  2V4R A;  1KJI A;  4N21 A;  5LMU B;  4MW8 A;  1E4E A;  2FMA A;  3APQ A;  2NUA B;  2OIG A;  2W6P A;  4RNN A;  1CP9 A;  4GX2 A;  1M7J A;  1KC8 W;  1E79 G;  3KCY A;  4I5S A;  1S3J A;  2LGW A;  1YSC A;  5BZB A;  2VPQ A;  5BYB A;  5FPR A;  1H2K A;  1QQC A;  4WFF A;  4DR2 B;  4Q4C A;  2R7Z G;  1YIT V;  3K04 A;  4OXS A;  1DLB A;  1GN3 A;  4DV3 H;  5I5Y A;  1ENV A;  3BPZ A;  2JS5 A;  3CCL V;  1XNR H;  4WBN B;  3SPH A;  3P30 A;  4DL7 A;  1EYZ A;  3WO1 A;  3RVZ A;  4IYH A;  2XAG A;  4X62 H;  2A06 H;  4L1K A;  5KT3 A;  3HR0 A;  1K8A W;  4YY3 H;  2ZXW C;  3RBD A;  1HR0 B;  4LSX A;  4U3J B;  3K08 A;  5I60 A;  3TW7 A;  3D3I A;  2EIJ C;  2ZE6 A;  2W6Q A;  2B63 G;  3PW2 A;  4W4L A;  3ZN1 A;  3I56 V;  4WCE V;  2P6J A;  4HR7 A;  3T9C A;  2YC0 A;  2C2R A;  1JDB B;  2P4K A;  1ULZ A;  2CGO A;  3QF7 A;  1PK8 A;  4BWA A;  5CA0 A;  3EYY A;  1IBL H;  2EX3 A;  4JPR A;  5FLX W;  4RB2 C;  5D1P A;  5KFY A;  3T99 A;  4O3R A;  2LQT A;  5KHK A;  3ZX6 A;  3MDS A;  3OGI B;  2AZ0 A;  2CKZ B;  1H8H G;  1SQF A;  3AG4 C;  4DR5 B;  2XD4 A;  1FXK C;  4CS4 A;  3GB8 B;  5KFQ A;  4UB6 Z;  3G6B A;  4E4E A;  1KT8 A;  4DL2 A;  4WFH A;  1Y1W A;  3RB4 A;  3BHP A;  4AYB A;  1ZHS A;  2Q69 A;  3K5H A;  2AGP A;  1GSA A;  4I4T A;  4WF9 V;  5FLX N;  1BGY H;  3CE2 A;  1XMQ O;  2Q2U A;  2UUC O;  4X64 O;  4A2B A;  2WLH A;  5CBH A;  4NLG A;  4LF8 B;  2CH7 A;  4XYM B;  1JR9 A;  4CS3 A;  3LP8 A;  3TIN A;  3PO2 G;  4GX5 A;  1WPB A;  4X88 A;  1K33 A;  3OTF A;  5KFW A;  3U0G A;  1X9N A;  2WDT A;  5L3E A;  5B3S C;  2EJ0 A;  2ZR2 A;  4JI1 O;  1RJP A;  4JV0 A;  2Q73 A;  1ZTE A;  3KKY A;  1J5E H;  1IZ3 A;  1RSO B;  4JV5 B;  3RV3 A;  3GIP A;  2W6O A;  4LR3 A;  1H2G A;  1WR2 A;  5KG3 A;  2LO1 A;  2NU9 B;  1OJH A;  4NXN H;  2Y69 C;  2YU9 A;  1VQK V;  1JXL A;  3ZRX A;  4QWC A;  1ZSP A;  2OT5 A;  1VQL V;  3IC7 A;  4LWS B;  5IYD G;  5CM0 A;  2ADP A;  2YIA A;  2R82 A;  1Q3E A;  4J9M A;  1JIH A;  4QWA A;  4ZHQ B;  2V1D A;  5KFK A;  5J2U B;  4UCO A;  3ZMT A;  4ECX A;  1P84 F;  2JEX A;  1M0T A;  4KHP B;  4DV7 O;  1EM1 A;  1CS0 A;  2IW5 A;  2R93 A;  3IJ4 A;  2AGO A;  3K9A A;  2PI4 A;  5IT9 W;  2XCL A;  5GON F;  1Q5O A;  3FB7 C;  5B1B B;  4A3E G;  4ZOL A;  1U96 A;  3FYI B;  3Q8Q B;  1DK1 A;  4J11 A;  4CMD A;  3MR3 A;  2UXD H;  2HG5 C;  1H8E G;  2W6N A;  3N2K B;  5B66 Z;  1MA1 A;  2YID A;  5LA6 F;  2HJW A;  3JAW A;  2RGV A;  4DV0 H;  4LFA H;  1IBK B;  2JEI A;  3E8B A;  2P90 A;  3AEI A;  1KJQ A;  3GVM A;  2GPS A;  4AYB E;  4FS1 A;  3K3V A;  2JGD A;  3FB6 C;  3GTM A;  1I2K A;  4HN2 A;  1I7L A;  2O03 A;  3RYH B;  1A3G A;  2VUG A;  3B2E E;  2OWO A;  3WNZ A;  3ETD A;  3ZCC A;  2JIZ G;  1O75 A;  3U10 A;  4PEL A;  5LMN B;  3MAQ A;  5LGU A;  3FYE B;  2DAA A;  4J9Y B;  5AG2 A;  3ABL B;  3H4B A;  5K3W A;  2W8K A;  3D36 A;  1FJG B;  2CAZ C;  3N2G B;  1M57 B;  4O7T A;  1SEI A;  4DL6 A;  5EOY A;  5KHJ A;  2CZG A;  3BQ0 A;  1JOY A;  2COG A;  2UU9 H;  5KG6 A;  1HNW B;  1N34 B;  3VPC A;  3B09 A;  3CC7 V;  2OTJ V;  2WAQ A;  4WD3 A;  4JI6 H;  1K73 W;  5E79 Z;  2QB5 A;  4QIW E;  3GTJ A;  3IG0 A;  3FFQ A;  1EZ1 A;  2WLN A;  3TGU H;  1XDC A;  3TJT A;  1XMO H;  4R8U B;  4O82 A;  3EPI A;  2RDC A;  4IWX A;  1HP8 A;  2EUL A;  3DSQ A;  3PVX A;  2UVU A;  3SE7 A;  1SKV A;  4B3S H;  1W96 A;  3OAA G;  2R7N A;  3TQ1 A;  4GKK O;  3TII A;  2EIM C;  3BJY A;  2YEV A;  4FVM A;  2UXB B;  2Z04 A;  1D2D A;  1PPJ H;  2M6Y A;  2DN9 A;  4FM2 A;  4I55 B;  4LF7 O;  2DQ3 A;  1ZAU A;  2F93 B;  2OCC B;  4DR1 O;  4U6P A;  1XHX A;  4FBU A;  5DIS C;  3N41 B;  4B3T H;  4X65 B;  2AQ4 A;  3J80 W;  1PP9 H;  4O83 A;  1AI5 A;  1M93 A;  3L73 H;  4BW9 A;  1MOF A;  5LMU H;  5KUM A;  4F4Z A;  4YXW G;  3PW4 A;  3QZ8 A;  2RGR A;  4FFO A;  2EJ3 A;  4GKJ B;  4LH7 A;  2V4D A;  4GLW A;  3AG7 A;  4DV6 B;  3OUF A;  3MFI A;  4MV3 A;  4ZBM A;  4JI5 B;  1IOV A;  4DR2 H;  4O4J B;  3JAR A;  3TK1 A;  4G3I A;  3K5I A;  2WLJ A;  4H0L B;  4P2Z A;  2XT9 A;  2NU8 B;  3H20 A;  2YW2 A;  4U7C A;  3EHB B;  1VBG A;  4FFM A;  4LBE C;  1XNQ B;  4OPA A;  2VS0 A;  1BJT A;  5D1O B;  4FGR A;  5EBL C;  2QSA A;  3SYC A;  1KJ9 A;  4O4J F;  1BXR A;  1V4Y A;  2R86 A;  3ZRS A;  2A79 B;  2DWC A;  4AI8 A;  3K3W A;  2LP7 A;  2X6C A;  3FKI G;  3OTO H;  1WP8 A;  2OYQ A;  3A0R A;  2YDE A;  4MVQ A;  1PNK A;  4U7O A;  4C7U A;  2WAQ E;  3HOY G;  4YR3 A;  2HVQ A;  4ED7 A;  3CXH F;  2ASJ A;  4A3L G;  1OCO B;  4IRC A;  2CDY A;  2ODM A;  4YJ3 F;  2A3Q A;  1XQ8 A;  2FL4 A;  4DW1 A;  4F4L A;  5TIS Z;  4O86 A;  2R92 A;  4JI7 O;  1SF9 A;  1M0W A;  2KKW A;  5KHG A;  2C22 A;  1VQ8 V;  1T5E A;  2R7L A;  1X4T A;  5KX5 B;  4IIJ B;  4G27 B;  1ORQ C;  5EIB C;  4JI3 O;  2R9A A;  4DR5 H;  2QF7 A;  1V51 A;  5DGH A;  3MD0 A;  2EIY A;  4QWD A;  4FLU A;  1OCZ C;  4MTF A;  2A1H A;  2I8C A;  4BY1 G;  2RF4 A;  1PNL A;  1C3O A;  4X1K B;  2IBZ H;  4TV8 F;  2E75 B;  4Q20 A;  2ILM A;  1UNN C;  2FB9 A;  1V54 B;  5HV6 A;  5F9N A;  2VWJ A;  5KX5 F;  1SA0 A;  3HKC B;  4YJ2 A;  3RB3 A;  4JTD B;  5KFI A;  4DUY H;  5E25 A;  4LF8 H;  5LOV F;  2FE3 A;  1UJW B;  3K03 A;  3T5K A;  2AXT Z;  4MVO A;  4X9Q A;  4LF4 B;  4GYC B;  3T5L A;  1PL0 A;  4EB6 A;  2IU0 A;  5BR8 B;  2FP4 B;  4NXM B;  4I4T B;  2YS7 A;  1K7D A;  5IJ0 A;  1RYR A;  4HYK A;  4PA4 A;  2M05 A;  5CR5 A;  2OCC C;  1COW G;  1IUR A;  2W6M A;  5JH7 A;  2CFM A;  3C0F B;  3GV5 B;  3CB2 A;  3JZI A;  3JAK A;  3JD0 A;  4JYA O;  1A0I A;  2ITC C;  5KFH A;  4BXX G;  1G4Y B;  2HVK C;  3ZS8 C;  3SYP A;  3FB5 C;  4A3M G;  4UXN A;  5CA1 B;  2VQF H;  3VMM A;  1NT2 B;  3ZMZ A;  1N32 H;  3AK1 A;  2FPI B;  1A0G A;  4DV5 B;  4JI4 O;  3OW2 U;  1SER A;  2HVR A;  2FTK A;  2X0L A;  3CC4 V;  4MV8 A;  5IYD O;  5JQG B;  1AR5 A;  5D5P A;  3K5O A;  5IWA H;  2FJZ A;  3KHR A;  3PW7 A;  3MHS C;  3S3W A;  4KHP H;  3UT5 B;  2ATK C;  4DAA A;  5JVD F;  5F9L A;  3W5O A;  2UVW A;  4IR1 A;  2HGW A;  4ZQI A;  1I50 A;  5HFL A;  1NU1 H;  5BWU A;  1RM1 C;  5JQG F;  1W2B U;  1KJ8 A;  3T9E A;  3T9F A;  3L2P A;  5IJ9 B;  2RDI A;  4U3J A;  4MTX A;  1WNS A;  2Q9L A;  3JSN A;  1F4M A;  4C2M A;  4JV1 A;  1PKX A;  1SQV H;  1D5A A;  2XAH A;  3JD3 A;  1XNR B;  3TY8 A;  1IBK H;  4BIZ A;  2UXC O;  4PJ0 Z;  2ZIM A;  3RT3 C;  4LF6 B;  2Q0O C;  5DQH A;  2F66 C;  1A32 A;  5LL6 Y;  1GGO A;  3QQM A;  3TQT A;  3SR2 C;  4X62 B;  2FLN A;  4EFE A;  4JTC B;  3L4J A;  4YY3 B;  3TXS A;  3JD4 A;  1NQT A;  4DRF A;  3QZ7 A;  3OEE G;  3STL C;  3UO3 A;  5KT5 A;  1T94 A;  1P49 A;  5LMN H;  3KHL A;  3JAW B;  1T3N A;  3SJC C;  2Q7D A;  3RFC A;  1M5I A;  3RYC B;  4A5U B;  4PZ6 A;  4YR0 A;  4ETS A;  2BQ3 A;  1KKD A;  4DR7 O;  4XBF A;  4CC5 A;  4D6T H;  2QDO A;  3Q4H B;  1VQP V;  1M6V A;  1IBL B;  1HNW H;  2YRX A;  4RAY A;  2GQS A;  4O4I F;  2NNU A;  3ETJ A;  3GWO A;  4QE9 A;  3A0B Z;  2W70 A;  2I80 A;  2DPI A;  3U55 A;  2VA3 A;  4JYC A;  4HNA A;  1EZV H;  1KQS U;  2IH3 C;  5LHH A;  2KG7 B;  3CXC U;  2Q7G A;  4MV7 A;  1I1K A;  3B77 A;  3BG5 A;  1PV0 A;  1I7F A;  3T1H O;  2ZDH A;  3OUU A;  3UZO A;  2EBO A;  3P32 A;  4GT1 A;  4K0K H;  3CCE V;  2Q8V A;  2JJ1 G;  3K5N A;  5LXT F;  4PV1 B;  1GM9 A;  1FKA H;  4X65 H;  1TWG A;  3DGE A;  1F23 A;  5KUK A;  2JS3 A;  4NTX A;  2HP8 A;  4X1I B;  3KAL A;  3L70 H;  2CW7 A;  1JJO A;  2VQE O;  4DV4 O;  1OV9 A;  2R8J A;  4GZR B;  4IT5 A;  5BXZ A;  2YZL A;  4GKJ H;  2X0S A;  4LWS A;  3NBY B;  3AK2 A;  2YSU B;  4Q44 A;  2JA6 G;  1I1M A;  3ZHV A;  3H1I H;  2W71 A;  1N33 B;  2VOB A;  4ZHQ A;  5J2U A;  3JRX A;  4WFG A;  2XND G;  2EIK C;  2YIC A;  4NXN B;  4YBZ B;  4RAZ A;  5LA6 A;  4ECS A;  1KBL A;  1BT8 A;  2WAM A;  2ZNI A;  4DV3 O;  1XNQ H;  2VUM G;  4RB0 A;  3UFX B;  3H4D A;  2DOS A;  3WO0 A;  3FAV B;  1GM8 A;  4I0X B;  2W0F C;  4I9Q A;  4PZ7 A;  2E2H A;  2XAF A;  1P16 A;  4MTE A;  4FLV A;  2DWE C;  3JAR B;  3N2K A;  2PYL A;  4DR6 B;  5FNV F;  1OBD A;  3BQ2 A;  1WPX A;  4NYK A;  2P5O A;  5I5S A;  1L2Z A;  1VQM V;  3ZHR A;  1W0J G;  3RN4 A;  3UCS C;  3AYH B;  4DV1 H;  1W0K G;  1IX9 A;  4PDL A;  1AP6 A;  4B7E A;  3PZP A;  4EBE A;  3PO3 G;  4HAM A;  4NR1 A;  1EKV A;  4LNU A;  1N8R W;  3SPJ A;  4X66 H;  3R5H A;  3RYH A;  2COJ A;  1S5L Z;  2ZXW B;  1A9X A;  2UXD B;  4GUN A;  3U0Z A;  4B3M H;  5KA5 A;  4EQ5 A;  2EIJ B;  2LFR A;  4LFA B;  3GIL A;  2JA7 G;  2R7M A;  5T14 A;  2B5U A;  5DEC A;  1P7G A;  3N2G A;  3JRW A;  4EBD A;  4GLX A;  3N27 A;  2HHF A;  2YUA A;  3RGX A;  1R73 A;  2DPJ A;  4DLK A;  4ICG A;  4MSW C;  1JLL B;  4O2B F;  4ECY A;  2EJR A;  1VQN V;  4YHH O;  3KHG A;  3AG1 C;  2HEP A;  3ML0 A;  4R8U A;  1JVM A;  3BRC A;  3AG4 B;  3GDE A;  1FXK B;  4CH6 A;  2QM8 A;  1HNX O;  3BA9 A;  2E5L H;  4PWQ A;  1NJI W;  3UKM A;  4F6R B;  5IYC G;  5C1P A;  1WLE A;  2Y0P A;  2UU9 B;  4QJF B;  3PN1 A;  2Q2T A;  5BR8 H;  2ZDI C;  5KG1 A;  2ALZ A;  4NXM H;  3MR2 A;  3G71 V;  3VPD A;  3T7A A;  4I55 A;  3CP1 A;  4YJ2 B;  3L71 H;  1BNC A;  2JEJ A;  1XMO B;  2ZKO A;  2K9P A;  1VQ7 V;  1GN2 A;  2Y4T A;  4DV2 O;  5H6R A;  2LW1 A;  4WFA V;  4B3S B;  1THZ A;  2XGQ A;  3HB3 B;  4EFB A;  3RJ0 A;  5KFD A;  3VOT A;  4EB6 B;  1UPG A;  4J9S A;  3L72 H;  1H2N A;  4J80 A;  4P30 A;  3SJB C;  5B3S B;  5IJ0 B;  3UZB A;  5EIB D;  2P67 A;  4DUZ O;  4KL1 A;  4J9O A;  5KAF Z;  5EZY B;  3HT5 A;  3J81 W;  4DR4 O;  2LW7 A;  5GTI Z;  2F23 A;  3KTM A;  1LUV A;  4JGS A;  4PA6 A;  5EYP B;  5JWP A;  1AUV A;  4NKG B;  4O4J A;  4MTO A;  3MR5 A;  4N23 A;  3PW5 A;  2Y69 B;  4MV4 A;  2CUG A;  2J9G A;  1TWH A;  3T4D A;  1Z5W A;  2WB1 E;  3AG3 B;  5EZY F;  3L4K A;  2IA6 A;  3NUA A;  4DL4 A;  5D1O A;  4RAI A;  1FFX B;  1I6U A;  3IGA C;  3J81 N;  5DLF A;  3OR6 C;  1HNZ H;  3SPG A;  4ZKI A;  3CD6 V;  2JVD A;  4EBC A;  5KG5 A;  4TUY F;  2ARH A;  3C3T A;  1DTO A;  4M9U A;  1S0O A;  4LF6 H;  3HKE B;  3CSX A;  3H3V H;  3JAM W;  1DIK A;  2AGA A;  5KAI Z;  4DRX B;  1B3Q A;  4TV8 A;  2UUB O;  1NI8 A;  4TV9 F;  1R3K C;  4JI2 H;  4O4H F;  3OMA B;  3RYI B;  3OR7 C;  5KX5 A;  4IIJ A;  2AZ2 A;  3OTO B;  3M9O B;  3F7Y C;  5KFU A;  4KFM A;  1IBM O;  4OX9 O;  1FXV A;  4DL5 A;  1VF7 A;  1DV1 A;  4ECQ A;  4MW3 A;  4RUE A;  4JI0 H;  5K1P A;  1I94 H;  1EUC B;  1KEC A;  4X1K A;  1MZB A;  3JAM N;  1WA8 A;  3WWI A;  2R84 A;  1E4G T;  3JAS B;  1NH2 B;  3T4Z A;  3HKC A;  4LFB H;  3E8F A;  1YTF B;  1EFR G;  3B4S A;  4B3R B;  4IHJ F;  3V4Z A;  2ZNJ A;  4TQR A;  5DED A;  3T1Y H;  5KFZ A;  4X8A A;  1SET A;  2KB1 A;  5BWV A;  1N56 A;  1EUD B;  5BWT A;  4BY7 G;  3Q8R B;  3BFR A;  1KP3 A;  4Z1M G;  4PHZ A;  3BAA A;  2GUZ B;  3KCX A;  3STZ C;  3GTG A;  2HIX A;  5I5W A;  4FLW A;  2R8K A;  4HNA B;  4DUY B;  2RJZ A;  4MVM A;  2F1M A;  2DQ0 A;  1IXB A;  4DR3 B;  4HQ6 A;  3N43 B;  2D3O W;  1GH6 A;  2ZQM A;  3QO8 A;  1R6N A;  2JEG A;  3VQX A;  2GQR A;  2CE4 A;  2EIM B;  5IY5 C;  2QE7 G;  5CA1 A;  5B1A C;  2FK2 A;  2DW4 A;  4ME6 A;  2ASL A;  5BMV B;  1QNM A;  3W7T A;  1SZX A;  1BSM A;  5LYJ F;  2NU6 B;  1N33 H;  5JQG A;  4QIW A;  1DF5 A;  1N48 A;  3N6R A;  2JEF A;  3NC0 B;  3HKD B;  3UT5 A;  5KFM A;  3RGB A;  2CTQ A;  3W7U A;  3AG3 C;  4RZQ A;  2VQF B;  1ZHQ A;  2IP4 A;  3H1L H;  1S97 A;  5BMV F;  1N32 B;  5J2T F;  5GON B;  2Q0A A;  2ZD9 A;  1BHB A;  3MFH A;  5IJ9 A;  4FM1 A;  5KFG A;  2JJ2 G;  1R6T A;  2FK3 A;  5IWA B;  3OHB A;  4DR6 H;  1HR0 O;  4GKK B;  2OIE A;  5EC2 C;  1XOU A;  4F50 A;  5LA6 B;  4O7W A;  4J0M A;  4A3J G;  1MSD A;  1V55 C;  3F5T A;  2AHY A;  2DYS C;  4I50 B;  5LL6 b;  3L74 H;  2XTA A;  5KHH A;  4O2A F;  4LF7 B;  1QLE B;  2XAJ A;  2ZM6 O;  4NVP A;  3HOV G;  3M4I A;  4DR1 B;  5KS8 A;  1BMF G;  4I7H A;  3J7A K;  3P3P A;  1Y1V A;  4IAJ A;  1N0N A;  1YHQ V;  1VQ6 V;  3CRC A;  2HLD G;  3RGZ A;  3A2F A;  4I50 F;  3LSQ A;  2R8I A;  3RYC A;  5IDJ A;  2IJI A;  4LNU B;  2YXH A;  2ZIO A;  3WFV A;  5IT9 N;  4DO2 A;  2C2E A;  2F95 B;  3CC2 V;  3O65 A;  4FU0 A;  3Q4H A;  4J41 A;  1DV2 A;  4P9O A;  3G80 A;  4JI8 O;  2PBZ A;  1Y74 B;  4HBN A;  2QEX V;  3TW6 A;  4JV2 A;  1NS1 A;  1J95 A;  4LMY A;  2BQR A;  4FJC C;  3WB1 A;  3LWB A;  2CTP A;  2P4V A;  1QBZ A;  1CKN B;  2M7W A;  1SES A;  4ED3 A;  2HHF B;  3TCU A;  1OCZ B;  2KG7 A;  1FVI A;  5KKN B;  1Y1W G;  1YEW A;  4LF8 O;  5IYC O;  2DWD C;  5C4X G;  1K1S A;  2EZP A;  2ZDI A;  1JA8 A;  2CNU A;  4J9L A;  1KYO F;  3JCZ A;  3V6K A;  4FK5 C;  1S03 G;  3BQ1 A;  2EIL C;  5D5Q A;  4UCV A;  3F7V C;  2Q67 A;  2FPP B;  3RTX A;  2FML A;  3LNN A;  3DF7 A;  4HNT A;  4X1Y B;  2P0A A;  2HJD A;  3T2M A;  2Y0I A;  4JV5 O;  4X1I A;  5LHI A;  2XHB A;  2JA5 A;  2WWW A;  3JAL A;  3NR7 A;  1FYJ A;  4K0K B;  5JJJ B;  2BOC C;  3DXR B;  3JYC A;  3QO7 A;  3ORQ A;  1S10 A;  4ECW A;  1Q8I A;  2F4V O;  1AR4 A;  2IMW P;  3VQV A;  2BE3 A;  1S76 D;  1ET0 A;  5KFR A;  1I2L A;  1H2L A;  2HGS A;  1YJN V;  3WG7 C;  1Q90 D;  3CCR V;  3U54 A;  2V7Q G;  3APO A;  4R50 A;  3JD2 A;  4KHP O;  4J9Z B;  1XMQ H;  4PA7 A;  3ASN C;  5CN0 A;  5JCO C;  3I12 A;  3FAV A;  4I0X A;  4Z1V A;  4M0J A;  2W9C B;  1S68 A;  3CCM V;  1DF4 A;  4XZ3 B;  4PDB A;  1NTK H;  2RCV A;  5DG9 A;  2WLK A;  2PF4 E;  4TOI A;  1XRE A;  2QM4 A;  2XOK G;  4NYE A;  1N0J A;  3CEI A;  4NZO A;  2PYJ A;  3VOU A;  4ASU G;  3J80 N;  4O7Z A;  2ODT X;  4A93 G;  4JI1 H;  5CB4 F;  2R93 G;  5K1X A;  2GLT A;  1QLE C;  1SQG A;  2N05 A;  1I7N A;  5H80 A;  2ZE5 A;  1SC5 B;  2CTR A;  2QWQ B;  2BTO A;  4YJ3 B;  3RYF B;  1B33 N;  3AK3 A;  4PDR A;  1RM1 B;  1FAF A;  4O2B A;  4ED1 A;  4NTW A;  4FLX A;  2WSS G;  5KMG B;  4O3N A;  5JJN B;  1WCM A;  5BPF A;  5LMN O;  4DV1 B;  3QO5 A;  3HKZ A;  3E8G A;  1B6Q A;  2UXN A;  4TQD A;  3K5L A;  4JI4 B;  1S72 V;  2R70 A;  5KG4 A;  3W1G A;  4UB8 Z;  4DK1 A;  1FJG O;  5CE8 A;  4KXR A;  4X66 B;  3RB6 A;  3ZHU A;  3GID A;  2H8P C;  1Y66 A;  4TV8 B;  2B1G A;  3H1K H;  2I87 A;  3OHA A;  2R85 A;  2PY5 A;  3KAK A;  5KFX A;  1HW7 A;  4B3M B;  3ZMS A;  4DV7 H;  1K9M W;  3U11 A;  1N34 O;  1Z2G A;  4RNO A;  4HYO A;  3ZJZ A;  3QFF A;  4J7Z A;  1XBL A;  2DMX A;  4A3F G;  4O84 A;  1JPX A;  4LFC O;  4B3R H;  1HWY A;  1K34 A;  2DYR B;  2IH1 C;  1FXK A;  1K83 A;  1ZET A;  3BA8 A;  1M1K W;  2ZJT A;  3HKB A;  5LOV B;  1K97 A;  4JAU A;  4F6R A;  1GN6 A;  4LF9 B;  1WA8 B;  4MVU A;  4FS2 A;  1CEZ A;  4QJF A;  4UV9 A;  1S5H C;  4RB1 A;  4EGQ A;  3MJF A;  4CE5 A;  1L0L H;  2UXB O;  3DTU B;  4ABM A;  3ABM C;  1OZ0 A;  3GTO A;  4LF5 B;  1NTM H;  2QKC A;  4RCN A;  1KKC A;  1ZUQ A;  1N36 B;  4A3I G;  3OSN A;  3OM3 B;  4XDK A;  4DR3 H;  2E5L B;  4JXU A;  3SI8 A;  1TA8 A;  2PGG A;  4MA5 A;  1ZX3 A;  2QTO A;  3T9B A;  1QR8 A;  4FLT A;  5BWR A;  4CH5 A;  2ETN A;  4GX1 A;  3RFR A;  4FLZ A;  3FD9 A;  1Z5V A;  4UCU A;  4YAJ B;  5EZY A;  2DIK A;  3ABK B;  5KT7 A;  3BAC A;  3EFF K;  2QKA A;  4DV6 O;  5EYP A;  4JI5 O;  4FFB B;  3LQS A;  2ZDG A;  5CA0 F;  2JRI A;  1VIB A;  5JVD B;  3GIQ A;  2Q4P A;  1XNQ O;  1SYX B;  2W57 A;  2GTS A;  5BWX A;  4JTA B;  4RUF A;  1NKD A;  1FFX A;  3JZF A;  3T5H A;  2VRZ A;  3R9R A;  3HKZ E;  3CQZ A;  4Q8E A;  4GKK H;  4F4Y A;  2KSD A;  4YIO A;  4O4H A;  2CW8 A;  2EIK B;  4BW5 A;  1Y4M A;  4CH4 A;  3C90 A;  2VPS A;  2FB5 A;  1P7B A;  5B1O A;  1WRV A;  3DAA A;  1ZQ7 A;  3FDS A;  3HKE A;  3HXL A;  4LF7 H;  1AJP A;  1RFY A;  4PD4 F;  1GO3 F;  2DZD A;  2O57 A;  4DR1 H;  3W1B A;  4DRX A;  4GCZ A;  2R72 A;  5GW7 A;  4CBC A;  4M7E A;  3SJA C;  2CGN A;  1HNZ B;  3RYI A;  1VQ4 V;  2GSM B;  2W8L A;  2Z3Y A;  2YCH A;  3JCU Z;  2VQE B;  4DV4 B;  5L3C A;  2YL2 A;  3VBB A;  2OH2 A;  3IFX A;  3OSP A;  2C35 B;  1H38 A;  4TSF G;  5LGT A;  2Y4U A;  2Z5U A;  4EKW A;  2QR4 A;  2A9H A;  3K0D A;  4IHJ A;  3SDL A;  5K2M A;  5C44 G;  3KXY T;  2R92 G;  2HHH B;  3QVN A;  2WYO A;  5C5J A;  4RO2 A;  1NBM G;  4O7S A;  3TY5 A;  4QW8 A;  2FLL A;  4JI2 B;  4CS2 A;  3JAS A;  4F4W A;  4O4I B;  5KFP A;  2RDJ A;  4IR9 A;  4O4L B;  2BCC H;  4UV8 A;  2VWK A;  4HNV A;  2DYR C;  3K58 A;  1Z2N X;  1OBG A;  2LFS A;  2YZG A;  4JI0 B;  3N42 B;  5C3E G;  1I94 B;  1I0H A;  3KG2 A;  4AIL C;  5D8D A;  4A3G G;  1OCR C;  2FKX A;  5KFO A;  4FZ1 A;  3N6X A;  5EWE A;  2VR1 A;  4O4L F;  3KHH A;  4KP4 A;  4LF4 O;  3PFF A;  2VA2 A;  3SGI A;  2GUZ A;  5LHG A;  3H40 A;  3AG1 B;  2UUA O;  4LFB B;  5LXT B;  2X6B A;  3T54 A;  4RU9 A;  4JYY A;  3KZI Z;  4RWU A;  5LYJ A;  3TEK A;  3TET A;  1YIJ V;  3IAY A;  2V4Q A;  1GSO A;  2AU0 A;  1Q43 A;  3T1Y B;  5CA3 A;  3GJX B;  2E74 B;  4JI7 H;  3HO8 A;  2IJJ A;  5DN6 G;  2NN4 A;  2IU3 A;  1H2S B;  1M9N A;  4JI3 H;  1AVM A;  5FD6 A;  3EPG A;  3CRR A;  3ABK C;  1YF2 A;  3CCQ V;  5BMV A;  2Q5Z A;  3R5X A;  3GIK A;  1MG1 A;  4DV5 O;  3ABU A;  1I08 A;  3AG2 B;  1GMG A;  2Y4R A;  4GC6 A;  4BIO A;  5C93 A;  3HKD A;  1NH2 D;  5KT4 A;  4JUZ A;  3JAL B;  3OT7 A;  3CEB A;  3U9T A;  5KFC A;  1YTF D;  1DGS A;  1MMM A;  5GON A;  2NVX A;  2SCU B;  4A3C G;  5JCO A;  1SFO A;  1AR1 B;  1YVW A;  4DL3 A;  3E89 A;  3WWJ A;  1I5X A;  2L35 A;  3CHX A;  4C5A A;  5FNV B;  4PDV A;  2A7W A;  5HFM A;  3A0H Z;  2QYZ A;  3FX7 A;  4I50 A;  3H01 A;  4AQY B;  1XNR O;  2PN1 A;  3M9M B;  3GLK A;  4EEY A;  1RK6 A;  5H5N A;  4LF6 O;  1TGO A;  2B9Z A;  2XUM A;  3U9S A;  2HVS A;  1M56 C;  3SYA A;  4MV9 A;  4QPK A;  4X62 O;  4JYA H;  5KFT A;  3W7X A;  2QM7 A;  4PDM A;  3ABT A;  4AHC A;  5IYZ B;  4YY3 O;  2MCT A;  4EYI B;  3RAQ A;  2YIB A;  3WB2 A;  2QWN B;  3K0G A;  4A3D G;  3CRA A;  4O3O A;  5L1J A;  5C8Y B;  3W7S A;  5JUM A;  4JI4 H;  1MZE A;  4RQE A;  4J7K A;  3RW0 A;  1B6R A;  3H1J H;  5IYZ F;  3V6J A;  3OEH G;  1YI2 V;  4MV1 A;  1Y74 A;  1O9G A;  2WB1 A;  4O2B B;  2OLS A;  1IBL O;  1SQX H;  2R7Z A;  1RJQ A;  1K5S A;  1Y67 A;  3K9S A;  4TVI A;  5C8Y F;  4MT8 A;  3CCU V;  4ECR A;  4D7T A;  1CKN A;  2PVP A;  4QWB A;  5EWF A;  4J10 A;  2BOB C;  4LF9 H;  2V9W A;  4OPH A;  3E22 B;  1RPO A;  1QHT A;  1WSC A;  4DXW A;  3ZED A;  2NLJ C;  2JGU A;  3ZMV A;  3X2Q B;  4JYB A;  4D7S A;  2UXC H;  4FM0 A;  3H1H H;  4CH3 A;  4O7Y A;  4TWK A;  4LF5 H;  2B63 A;  4PI2 A;  2EJ2 A;  1N36 H;  1IOW A;  4X1Y A;  1CE8 A;  1FFT B;  1BS3 A;  3HKB B;  3SPC A;  1ZWI C;  5A9G A;  4X20 A;  4DW0 A;  1Q82 W;  3DXR A;  3AW8 A;  1OCC C;  3ZHT A;  3R23 A;  3K59 A;  3H0G A;  4OX9 B;  3SYQ A;  2X7R B;  5I5U A;  2EJ7 A;  3E5N A;  4DR7 H;  1WP7 A;  3AG2 C;  3Q8P B;  3CCJ V;  1F7Y A;  1AJQ A;  1J5E O;  3OUS A;  1EHI A;  3A8T A;  2CNQ A;  1S0V A;  2X6A A;  4NXN O;  5IY5 B;  2MK3 A;  1I3Q A;  5LP6 F;  5B1A B;  2W9C A;  2R9I A;  3HB9 A;  2Z0A A;  2XIG A;  4Q43 A;  1SQQ H;  4QWE A;  4E6N A;  3B8N A;  3T1H H;  1VF6 C;  3QTC A;  5KA6 A;  3I5D A;  4TUY B;  4JAV A;  4DK0 A;  2W0X A;  3ASO C;  1URF A;  1XMQ B;  2UUC B;  1XHZ A;  2P06 A;  3V6H A;  4X64 B;  2ZIN A;  5FPO A;  4HNU A;  3HOU G;  3ZHQ A;  4YJ3 A;  3RYF A;  4LH6 A;  1VAJ A;  2RQ6 A;  1O9H A;  1I5Y A;  4TV9 B;  3NGD A;  4O4H B;  2UXD O;  2VQE H;  4DV4 H;  5GTH Z;  5KMG A;  1MAB G;  1RP3 B;  4MA0 A;  3KAJ A;  4JI1 B;  2L6L A;  1S5J A;  3THO A;  1JKJ B;  3L75 H;  4FIP C;  4UFZ A;  4DV0 O;  4LFA O;  1V55 B;  4BBR G;  2DYS B;  4R6Z A;  4F6E A;  1S0M A;  3OMN B;  5DG8 A;  1PD3 A;  1EBO A;  1S77 D;  5JH7 F;  2HHH H;  4QW9 A;  4PI0 A;  1MSW D;  1AI6 A;  1LUW A;  4CZZ A;  5IP7 G;  3J7A U;  1VQ5 V;  1IDS A;  4K6N A;  2QTS A;  4LC1 A;  3T1C A;  2CNV A;  1NVP B;  3CMA V;  4IHJ B;  1ARO P;  1KMI Z;  3JD1 A;  2JEU A;  3WB0 A;  5LOV A;  2R8G A;  5CAE B;  3TXQ A;  2RN9 A;  4MAM A;  1EKF A;  1FXH A;  2W7P A;  4R7R A;  3X2Q C;  2E2I A;  5KFB A;  2UU9 O;  1F51 A;  5FJ8 G;  4I9W A;  5L3B A;  4DV7 B;  3M7M X;  3FMA A;  1DAA A;  4JI6 O;  3AX6 A;  4WBN F;  1TUB B;  2W9B A;  2AHZ A;  2ZM6 B;  1QCE A;  1BGW A;  5B1N A;  3GTK A;  2ZE8 A;  5EWG A;  3RB0 A;  1YCI A;  1XMO O;  1PX2 A;  1T36 A;  4BWS C;  4HZ3 A;  1BQ0 A;  5LBQ A;  4O81 A;  3T5J A;  5J9P C;  1VEW A;  3K3P A;  4H37 A;  4B3S O;  4QSH A;  1NZ6 A;  4QNH B;  1VQ9 V;  5LP6 C;  1Z2O X;  3H0G G;  1JCH A;  1GK9 A;  1KBH A;  4J9R A;  2Y48 A;  4JZG A;  4YAK B;  2EIL B;  1WB8 A;  5HBR B;  5DAA A;  1YJ9 V;  5LYJ B;  5FR9 A;  3CJH B;  4G28 B;  5H6Q A;  1C30 A;  1WH2 A;  1JJ2 U;  3MWD A;  4FFB A;  4WFE A;  4B3T O;  3W7W A;  4JI8 B;  4FE2 A;  3OE7 G;  3GB7 C;  3CCV V;  3UQ8 A;  4YHH H;  1YZB A;  1VAR A;  4R8C A;  5JVD A;  1UC9 A;  2XCP A;  3DC6 A;  1JX4 A;  4K8Z A;  3GIM A;  2FK1 A;  2KQX A;  5LMU O;  3I55 V;  5J2T B;  4XX0 B;  2Y0S E;  1QVF U;  1JFF B;  2E3C A;  1HNX H;  1RPR A;  3KYH C;  3CRM A;  3M99 B;  1M4U A;  2IJK A;  2XAS A;  4K35 A;  4CKB A;  4EG0 A;  4DR2 O;  1R9T A;  3G6Y A;  4MVR A;  3VQY A;  3CPW U;  1SS3 A;  4YQW A;  3WG7 B;  3JAT B;  2BTQ B;  3K06 A;  2MW2 B;  4AQY H;  3E83 A;  4O2A B;  1KB9 F;  5L1L A;  3ASN B;  4DV2 H;  3IN5 A;  2N04 A;  3ETG A;  3MWE A;  5DM6 V;  3H9V A;  2Q6A A;  3HOZ G;  3P3N A;  1ZL8 A;  1CKO A;  4G2K A;  2GTA A;  1OWT A;  4DUZ H;  3OTO O;  2WLI A;  4U7N A;  3VPB A;  3GIJ A;  1Q86 W;  2QKS A;  3ICX A;  3VQW A;  2F4V B;  5KFV A;  4DR4 H;  4MV6 A;  3ZMU A;  3C3S A;  1GM7 A;  3F5W C;  1SRY A;  5I47 A;  4O4I A;  5CBF A;  4O4L A;  2BSK A;  3CS5 A;  4UCS A;  1W59 A;  4RZR A;  1VKZ A;  2G38 A;  5ITZ B;  1Q6I A;  1P4R A;  4TM5 A;  1FPO A;  3OMI B;  3S3X A;  4DR5 O;  1N4C A;  3OUZ A;  2R9R B;  3HOW G;  4B3R O;  4O7R A;  4Y8V B;  3OD4 A;  2GBO A;  3BAB A;  1R6K A;  1KU9 A;  3VNN A;  4ZHQ F;  1JMK C;  1BQZ A;  5J2U F;  1PM9 A;  3M8A A;  2UVR A;  5KFE A;  2QWP B;  4NB5 A;  3PW0 A;  1GKF A;  1VMG A;  3FKI A;  4FBT A;  5LXT A;  2PZS A;  4ZIB A;  2UVV A;  1L1F A;  1AP5 A;  2V59 A;  1E1R G;  1AUX A;  2RNB A;  4X89 A;  4Q45 A;  4TQF A;  4RB3 C;  3OFN G;  4DUY O;  3Q8S B;  3G67 A;  3TIG A;  4UCR A;  2UUB H;  1GO3 E;  2HKO A;  4Q8F A;  4DR3 O;  4FMT A;  2E76 B;  3ZIA G;  4B7K A;  4LCU C;  3T9A A;  4GX0 A;  4Q6G A;  3K79 A;  1EN4 A;  4I7Z B;  1IBM H;  4OX9 H;  2ABJ A;  2W6I G;  1Y14 B;  3ABM B;  4O7V A;  3DTG A;  1D5N A;  4Q4D A;  3CYO A;  3GTP A;  5L1K A;  2WTF A;  2CK3 G;  3MR6 A;  4JI7 B;  2ZCE A;  4L8J A;  1IXM A;  4X20 B;  3SPI A;  4JI3 B;  2BR0 A;  4JF3 A;  5JQW A;  1WN7 A;  2COI A;  4LFC B;  4KUM A;  2VQF O;  3RUP A;  4UVA A;  1LR1 A;  2WLL A;  5L3D A;  1AJN A;  2HVJ C;  3LDD A;  1N32 O;  3NBZ B;  4IRD A;  4MTG A;  4QPJ A;  4CHI A;  3CME V;  1TWC A;  3RV4 A;  2EIN B;  3G4S V;  5FNV A;  5BWW A;  3LDE A;  2C00 A;  5IWA O;  1VQO V;  1K1Q A;  3ORR A;  4ECZ A;  4XDL A;  1VF6 A;  5CB4 B;  3B40 A;  2YS8 A;  2ITD C;  2UUC H;  1JQ0 A;  2Q7E A;  4X64 H;  5KHI A;  2YRW A;  4E2L A;  2WLM A;  1GAX A;  1K5Q A;  2P7T C;  3O9O A;  3ZRW B;  4BBS G;  4MS2 A;  2X5R A;  1Q81 W;  4A2A A;  5IYZ A;  4FFR A;  1TAE A;  1BE3 H;  2FPG B;  2PTM A;  2NVY A;  5EK0 A;  4R7C A;  4YR2 A;  3RBZ A;  4DYL A;  3L9D A;  1TVK A;  2V5A A;  4PA3 A;  5C8Y A;  2LJ2 A;  1L8D A;  1IBK O;  5I5V A;  4I55 F;  1EN6 A;  3Q1K A;  2W6J G;  1QU7 A;  2QJ1 A;  4ZI7 B;  5H9C A;  4WFB V;  5DQI A;  4JYA B;  4IYI A;  1KD1 W;  4E4T A;  1XI1 A;  1Y1V G;  4Q0Y A;  3EVK A;  1R3I C;  4O7L A;  3RIZ A;  2GPW A;  3G8C A;  4FLY A;  5KLV H;  1Y76 A;  3QNE A;  4YB8 B;  2YXL A;  5IYB G;  4XYL B;  2F43 G;  4O3P A;  1XIL A;  4FPP A;  2XCA A;  1E4E B;  5KG0 A;  1S0N A;  2OTL V;  5B1B C;  5KT6 A;  4ZI7 F;  1A48 A;  3GTQ A;  3G6X A;  1MNG A;  5KG2 A;  1HR0 H;  3E22 A;  1KC7 A;  2QGN A;  4JAA A;  1UC8 A;  2QWO B;  3CRQ A;  3RVY A;  1HNW O;  2ZDQ A;  2YI9 A;  5L9X A;  4RNM A;  2ZM6 H;  4Z2W A;  3MWM A;  3GQC A;  1KUT A;  2HG8 A;  2DAB A;  3PJS K;  1CPY A;  3E8H A;  2DLN A;  3QG5 A;  5DMX A;  1SQB H;  2XC9 A;  1NR7 A;  2C2A A;  1OCR B;  2JK5 C;  5B5E Z;  3T9D A;  1YXB A;  1WB7 A;  2UXC B;  2W9B B;  3ABL C;  5LP6 A;  4TQS A;  4K0K O;  2DE0 X;  1M57 C;  2QWR B;  5CMU A;  3F8N A;  3RAX A;  1G6U A;  4YIP A;  4DIM A;  3ZRV A;  4EGJ A;  4F4X A;  4P9P A;  4FZ0 A;  4L87 A;  1FKA O;  2Q7H A;  4FM9 A;  4X65 O;  1X59 A;  1G8M A;  5FL7 G;  1YJW V;  2W6Z A;  4JI8 H;  1KTA A;  4MVS A;  5CA0 B;  2QA4 V;  2IM9 A;  2JA5 G;  1AIL A;  4ED6 A;  3LDC A;  4H33 A;  3VA7 A;  2D2C B;  3NXS A;  4IIJ F;  4LP8 A;  5DG7 A;  1TUE B;  1QVG U;  3ZHS A;  2XGP A;  4GKJ O;  3RWR D;  1GN4 A;  2N74 A;  1WAZ A;  3UO2 A;  3LUL A;  1XL4 A;  3DTF A;  5HNE A;  4DR7 B;  2EIN C;  3BVO A;  4TT3 G;  3I4N G;  1MZF A;  2BQU A;  4FFK A;  3G8D A;  3HBL A;  5FLM G;  1GYF A;  2GHY A;  3WU2 Z;  2A0L A;  1XUQ A;  4TUY A;  2R6F A;  1SZT A;  2ZE7 A;  3ZBH A;  1US6 A;  1GRJ A;  2UUA B;  5KFJ A;  2HR3 A;  2CQY A;  2FKL A;  4CKC A;  2NR5 A;  4JAS A;  1K92 A;  4UCT A;  5L1I A;  1AN7 A;  4JV5 H;  1FS0 G;  5H2F Z;  4TV9 A;  2CH7 B;  4IRK A;  1Y6X A;  2RMK B;  3PR4 A;  3T1H B;  1ROP A;  1EN5 A;  5C1O A;  5JJE B;  2YI8 A;  2C28 A;  1XK5 A;  4I4T F;  1KJJ A;  3CCS V;  3G6V A;  1B04 A;  4K8X A;  2WA4 A;  4DV1 O;  2F4V H;  1RJR A;  2IBK A;  2PMZ A;  2JA6 A;  4IWY A;  1PNM A;  2B1I A;  1M56 B;  4IL6 Z;  4X66 O;  4BIU A;  1UFI A;  1AB3 A;  3CSW A; 
#chains in the Genus database with same CATH homology
 4D7T A;  4I55 B;  1CKN A;  2WE6 A;  1ZAU A;  1CKM A;  2F93 B;  1XHX A;  5A2Q W;  5DIS C;  3N41 B;  4PHZ A;  4WBN A;  3BAA A;  4B3T H;  4LF9 H;  4X65 B;  3RF2 A;  3J80 W;  3E22 B;  2HIX A;  1QHT A;  1M93 A;  4FLW A;  3ZED A;  4HNA B;  4DUY B;  2JGU A;  2RJZ A;  4CC6 A;  2F1M A;  4BW9 A;  4D7S A;  4FM0 A;  5LMU H;  2UXC H;  4CH3 A;  3K57 A;  4DR3 B;  3N43 B;  4LF5 H;  2RGR A;  4GKJ B;  4LH7 A;  2V4D A;  4PI2 A;  1N36 H;  4DV6 B;  4X1Y A;  3VQX A;  3HKB B;  3QWU A;  4DV3 B;  1TUB A;  5CA1 A;  4JI5 B;  4DR2 H;  4O4J B;  3JAR A;  5BMV B;  4X20 A;  4MTD A;  3H20 A;  4ZOL B;  1N33 H;  5JQG A;  3N44 B;  3K59 A;  4OX9 B;  1XNQ B;  3NC0 B;  3HKD B;  3UT5 A;  4DR7 H;  1BJT A;  5D1O B;  3RGB A;  4RZQ A;  2VQF B;  3ETQ A;  1ZHQ A;  1Z2P X;  4B08 A;  1N32 B;  5GON B;  4PZ8 A;  1FJG H;  2Q0A A;  5IJ9 A;  4FM1 A;  3OTO H;  2OYQ A;  5IWA B;  4DR6 H;  4GKK B;  2HVQ A;  1N34 H;  1XDN A;  5LA6 B;  4J0M A;  2XIG A;  1XQ8 A;  4I50 B;  5LL6 b;  4LFC H;  5KHH A;  2P22 C;  5J2T A;  4LF7 B;  4E6N A;  1JFF A;  1M0W A;  3T1H H;  4NVP A;  2KKW A;  5KHG A;  3QTC A;  3M4I A;  4DR1 B;  1T5E A;  4TUY B;  4I7H A;  4DK0 A;  1X4T A;  4IIJ B;  5EIB C;  5KX5 B;  1XMQ B;  3J7A K;  2UUC B;  1XHZ A;  2R9A A;  4X64 B;  2ZIN A;  4DR5 H;  5FPO A;  4IAJ A;  4YHH B;  4FLU A;  3JAT A;  3RGZ A;  2BTQ A;  4YJ3 A;  3RYF A;  4LH6 A;  3A2F A;  2UXB H;  2RQ6 A;  1O9H A;  4X1K B;  4O2A A;  4TV9 B;  3RYC A;  4O4H B;  4LNU B;  1HNX B;  2ZIO A;  2VQE H;  4DV4 H;  5KMG A;  2VWJ A;  3KAJ A;  2F95 B;  3JSL A;  4JI1 B;  1S5J A;  3THO A;  1SA0 A;  1RSO A;  4UFZ A;  3HKC B;  4YJ2 A;  3N40 P;  4HBN A;  4DUY H;  4LMY A;  2HHH H;  4LF8 H;  4PI0 A;  2FE3 A;  3WB1 A;  1CKN B;  4LF4 B;  4GYC B;  4DV2 B;  4DV6 H;  4EB6 A;  5BR8 B;  4NXM B;  1FVI A;  4I4T B;  1J5E B;  1YEW A;  4JI5 H;  5IJ0 A;  4IHJ B;  5JH7 A;  1KMI Z;  2CFM A;  3C0F B;  3WB0 A;  5LOV A;  3CB2 A;  1TVK B;  3JAK A;  5ITZ A;  4DUZ B;  4R7R A;  1S03 G;  5D5Q A;  4UCV A;  1A0I A;  4DR4 B;  3K5M A;  1VS0 A;  3RTX A;  4DV7 B;  3LNN A;  3DF7 A;  3ZS8 C;  4X1Y B;  3M7M X;  3FMA A;  1TUB B;  5CA1 B;  2VQF H;  1NT2 B;  3LML A;  1N32 H;  4X1I A;  2ZM6 B;  1BGW A;  2XHB A;  4DV5 B;  5FD5 A;  4BWS C;  2HVR A;  1E4F T;  3JAL A;  4K0K B;  5JJJ B;  5JQG B;  5D5P A;  3K5O A;  5IWA H;  2GV9 A;  1Q8I A;  2PUS A;  4KHP H;  3UT5 B;  1P8L A;  5LP6 C;  3W5O A;  1Z2O X;  3VQV A;  2HGS A;  4LSA A;  5LYJ B;  3S24 A;  3L2P A;  1WH2 A;  1XMQ H;  5IJ9 B;  4DV0 B;  3CVZ A;  4U3J A;  4FFB A;  1WNS A;  5JCO C;  4JI8 B;  3JSN A;  1S68 A;  3UQ8 A;  4YHH H;  5JVD A;  4PDB A;  4K8Z A;  1D5A A;  1XNR B;  3TY8 A;  1IBK H;  2UUB B;  4TOI A;  4EEQ A;  4APM A;  2QM4 A;  2ZIM A;  2YIB D;  4LF6 B;  5J2T B;  2F66 C;  2HIV A;  2PYJ A;  1JFF B;  2E3C A;  3SR2 C;  1HNX H;  4X62 B;  3KYH C;  4EFE A;  4JI1 H;  3L4J A;  5K1X A;  4YY3 B;  1IBM B;  4DRF A;  1SQG A;  5LP6 B;  1M4U A;  3VQY A;  1P49 A;  3TY9 A;  2BTO A;  5LMN H;  3JAT B;  2BTQ B;  4YJ3 B;  1V9P A;  3JAW B;  3RYF B;  4AQY H;  2KSW A;  3SJC C;  4O2A B;  1M5I A;  3RYC B;  4O2B A;  4PZ6 A;  4LF4 H;  4ETS A;  4DV2 H;  5CB4 A;  4FLX A;  5KMG B;  2UUA H;  5JJN B;  4JI6 B;  4CC5 A;  4DV1 B;  1SA0 B;  1IBL B;  1HNW H;  4TQD A;  3K5L A;  4JI4 B;  4RAY A;  2R70 A;  3W1G A;  4DK1 A;  4X66 B;  1CKO A;  4DUZ H;  4TV8 B;  3KAK A;  2PY5 A;  3ICX A;  3VQW A;  1HW7 A;  4B3M B;  2F4V B;  4DR4 H;  4DV7 H;  4HNA A;  3U11 A;  2Q7G A;  4MV7 A;  4B3R H;  4O4I A;  4ZI7 A;  1I7F A;  4O4L A;  4DV5 H;  4UCS A;  3BA8 A;  5JH7 B;  3RR5 A;  2ZJT A;  3HKB A;  5LOV B;  4K0K H;  3JAK B;  4F6R A;  5ITZ B;  4B3T B;  4LF9 B;  3K5N A;  4RB1 A;  1FKA H;  3BAB A;  4X65 H;  5LMU B;  1KU9 A;  3VNN A;  1JMK C;  4LF5 B;  4X1I B;  1N36 B;  3KAL A;  2CW7 A;  1JJO A;  4DR3 H;  2E5L B;  1TA8 A;  5LXT A;  5FPR A;  2PZS A;  4ZIB A;  2PGG A;  4GKJ H;  3NBY B;  1QQC A;  4DR2 B;  4TQF A;  4FLT A;  4DV3 H;  4CH5 A;  3BPZ A;  2JS5 A;  4RB3 C;  1XNR H;  4WBN B;  3RFR A;  1N33 B;  2VOB A;  4UCR A;  4ZHQ A;  4FLZ A;  2UUB H;  1Z5V A;  5J2U A;  4UCU A;  5EZY A;  4Q6G A;  4NXN B;  4RAZ A;  4X62 H;  5LA6 A;  5EYP A;  2ZNI A;  4YY3 H;  1IBM H;  4OX9 H;  1XNQ H;  1HR0 B;  4RB0 A;  4LSX A;  4U3J B;  4FFB B;  4I9Q A;  4PZ7 A;  5JVD B;  1P16 A;  4MTE A;  4FLV A;  4JI7 B;  2ZCE A;  3JAR B;  3N2K A;  4L8J A;  4X20 B;  2PYL A;  4DR6 B;  1SYX B;  2W57 A;  2P5O A;  1L2Z A;  1FFX A;  4JI3 B;  1WN7 A;  4DV1 H;  3QF7 A;  4LFC B;  4GKK H;  4BWA A;  5CA0 A;  3EYY A;  1IBL H;  2EX3 A;  4O4H A;  4LNU A;  2CW8 A;  3NBZ B;  5FLX W;  4RB2 C;  5D1P A;  4CH4 A;  5KHK A;  2VPS A;  4X66 H;  3RYH A;  3HKE A;  3HXL A;  4LF7 H;  5FNV A;  4DR5 B;  1SQF A;  2UXD B;  4CS4 A;  3GB8 B;  3U0Z A;  4B3M H;  4DR1 H;  4EQ5 A;  5CB4 B;  3W1B A;  4DRX A;  2UUC H;  4LFA B;  2Q7E A;  4X64 H;  2R72 A;  4M7E A;  3SJA C;  5KHI A;  1HNZ B;  3BHP A;  3N2G A;  3RYI A;  4GLX A;  1ZHS A;  2YCH A;  2VQE B;  4DV4 B;  3RGX A;  4I4T A;  4A2A A;  5IYZ A;  1TAE A;  2PTM A;  2Q2U A;  4IHJ A;  4A2B A;  3KXY T;  2HHH B;  1TVK A;  4LF8 B;  5C8Y A;  2HEP A;  2WYO A;  1L8D A;  4CS3 A;  3TY5 A;  1WPB A;  4JI2 B;  4CS2 A;  3BRC A;  3JAS A;  3OTF A;  4O4I B;  2QJ1 A;  4ZI7 B;  4O4L B;  4CH6 A;  3GDE A;  1X9N A;  2WDT A;  4JYA B;  3BA9 A;  2VWK A;  1XI1 A;  2E5L H;  4Q0Y A;  3K58 A;  4F6R B;  3RIZ A;  2UU9 B;  1Z2N X;  4FLY A;  3PN1 A;  2Q2T A;  5BR8 H;  4JI0 B;  4NXM H;  3N42 B;  2YXL A;  1I94 B;  1J5E H;  4AIL C;  4JV5 B;  4I55 A;  4LR3 A;  4YJ2 B;  3N6X A;  1XMO B;  4NXN H;  3SGI A;  4LFB B;  4B3S B;  1HR0 H;  3E22 A;  5LXT B;  4EFB A;  3RJ0 A;  5LYJ A;  4EB6 B;  2YIA A;  3IAY A;  1Q3E A;  1Q43 A;  3T1Y B;  3SJB C;  2YI9 A;  5IJ0 B;  3GJX B;  4ZHQ B;  5EIB D;  4JI7 H;  2ZM6 H;  5J2U B;  4UCO A;  4KL1 A;  3MWM A;  5EZY B;  3J81 W;  1H2S B;  1M0T A;  4KHP B;  4JI3 H;  5FD6 A;  5EYP B;  3QG5 A;  4O4J A;  5BMV A;  5IT9 W;  1Q5O A;  4ZOL A;  2UXC B;  5LP6 A;  1Z5W A;  2UXD H;  3L4K A;  3HKD A;  3N2K B;  3F8N A;  1G6U A;  5D1O A;  3JAL B;  1FFX B;  3JAW A;  2RGV A;  4DV0 H;  2Q7H A;  4LFA H;  1I6U A;  1IBK B;  4FM9 A;  4JI8 H;  1DGS A;  5GON A;  1HNZ H;  5CA0 B;  2IM9 A;  2JVD A;  5JCO A;  3K3V A;  2O03 A;  3RYH B;  2VUG A;  3HKE B;  4LF6 H;  3B2E E;  3CHX A;  3CSX A;  5FNV B;  2OWO A;  3RWR D;  4DR7 B;  1O75 A;  3U10 A;  3JAM W;  4I50 A;  5LMN B;  4DRX B;  3MAQ A;  4AQY B;  4TV8 A;  1GYF A;  4JI2 H;  1FJG B;  2CAZ C;  1TGO A;  3N2G B;  3RYI B;  2HVS A;  4TUY A;  1SEI A;  4MV9 A;  5KX5 A;  4IIJ A;  4JYA H;  5EOY A;  3OTO B;  5KHJ A;  2UUA B;  5IYZ B;  4AHC A;  2MCT A;  1VF7 A;  2YIB A;  3WB2 A;  2UU9 H;  1HNW B;  1N34 B;  4JI0 H;  5K1P A;  4JI6 H;  1I94 H;  4UCT A;  4X1K A;  1AN7 A;  1MZB A;  4JV5 H;  3IG0 A;  3FFQ A;  4TV9 A;  5C8Y B;  3T1H B;  4JI4 H;  1XMO H;  1E4G T;  3JAS B;  3DSQ A;  5JJE B;  2YI8 A;  1XK5 A;  1SKV A;  1B04 A;  3HKC A;  4B3S H;  4K8X A;  4LFB H;  1O9G A;  4B3R B;  4O2B B;  2F4V H;  2ZNJ A;  4FVM A;  2UXB B;  3T1Y H;  4FM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...