4O4JF

Tubulin-peloruside a complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
378
structure length
265
Chain Sequence
MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESQVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSSEPYNSCHLTNHCIGRYEEGNEMFFEEFNQYLMDALELQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLASIFIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of microtubule stabilization by laulimalide and peloruside A.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 65
structure length 265
sequence length 378
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o4jF02
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4o4jF01
3R23A 4O81A 3RUPA 3G8CA 3SE7A 1KBLA 3AW8A 3N6RA 2W70A 4O7NA 5CA1F 3MJFA 1GGOA 4EGJA 2V59A 5JH7F 1I7LA 2R7KA 3UFXB 4O84A 4I55F 2FB9A 2R7LA 4XX0B 1CS0A 4MA0A 3LWBA 4FFLA 3VA7A 2DIKA 4FGRA 3JRXA 4EG0A 4MAMA 3WO1A 3JZFA 5J2TF 4FFOA 3BG5A 1PX2A 4XYMB 3U9SA 2NU8B 1T36A 1M6VA 3HBLA 3V4ZA 4EGQA 4O2BF 2V58A 2Z02A 4ZQIA 4YAJB 3G8DA 1JLLB 2WYOA 3K3PA 2FPIB 4ZHQF 3QFFA 3Q2OA 3RFCA 4DIMA 3TINA 2VQDA 1BXRA 5BPHA 4ZOLF 1AUVA 1WR2A 2PVPA 4HNVA 3JZIA 1CQIB 2DZDA 4HQ6A 2J9GA 4O7ZA 5BPFA 1A9XA 5LYJF 1DV1A 1E4EB 2VR1A 2IP4A 1KJQA 1EHIA 1VBHA 2W6NA 4YJ3F 2XD4A 2YS6A 4O7LA 1JDBB 2XCLA 2W6MA 4NYEA 1GLVA 3JRWA 2YWVA 2W71A 4YJ2F 3R9RA 4FU0A 2YRXA 4DLKA 2CNQA 2YZNA 2Z04A 4E4TA 4TUYF 1W93A 2YYAA 4YAKB 5J2UF 1KJ9A 4MV7A 5JVLA 5LOVF 4O4LF 1DV2A 3TIIA 1EZ1A 3R5HA 3E5NA 3OUUA 1EYZA 2SCUB 2R82A 3KREA 4L1KA 2W6QA 4IIJF 4FFPA 3TIGA 1KUTA 1ULZA 4C5AA 5IYZF 3R5XA 4O82A 3GIDA 5JQWA 3TQTA 3N8DA 1KC7A 4I4TF 2NU7B 5GONF 1I7NA 1IOVA 4O4JF 2W6ZA 1E4EA 5HV6A 1GSHA 1C3OA 5D8DA 1KJJA 1EUDB 5C1PA 3KAKA 3WNZA 4MV3A 1JKJB 3U55A 2C00A 2YZLA 3R5FA 3ORRA 1CQJB 5JVDF 4FFRA 3I12A 4HNTA 2R85A 1VKZA 3OUZA 4I50F 3KALA 2YZGA 1AUXA 1BNCA 2VPQA 2PN1A 4XYLB 2P0AA 4O7TA 1CE8A 2YL2A 1GSAA 4YB8B 3ETHA 2CNVA 5HBRB 2V5AA 4IZOA 1OBDA 5C8YF 3U54A 2HGSA 4HNUA 2ZDGA 2YW2A 4Y8VB 3LP8A 2I87A 1Z2PX 3U9TA 4MV8A 4FE2A 4MV4A 3VPCA 2R7MA 3HO8A 4O2AF 4ME6A 2R87A 2FPPB 4FFNA 4O7RA 4O4IF 4HR7A 2HJWA 4M9UA 2W6PA 3WO0A 5H80A 1JDEA 2CNUA 2GLTA 4O86A 2CZGA 3K5HA 3V4SA 4C5CA 2GQRA 5CAEB 1GSOA 2FP4B 3ETJA 1B6SA 3VOTA 2YS7A 1OBGA 2GPWA 2FPGB 2OLSA 1IOWA 4QSHA 4XZ3B 3MWDA 1M0WA 2DWCA 1VBGA 1DIKA 3VMMA 2ZDHA 4IHJF 3AX6A 2I80A 2I8CA 3RV3A 1EUCB 5CA0F 3Q1KA 1C30A 2R84A 4TV9F 4WBNF 3DF7A 5EZYF 4MV1A 1SCUB 3VPBA 2NU9B 4YBZB 5DMXA 2NU6B 4O7WA 1KJ8A 2ZDQA 4O7VA 4O4HF 3MWEA 5C1OA 2R7NA 1Z2NX 5LA6F 2W6OA 4O83A 1KJIA 1W96A 3HB9A 1B6RA 4TV8F 4ZI7F 3K5IA 3NUAA 5KKNB 2QK4A 4C5BA 2NUAB 2YZMA 1M0TA 4MV9A 4O7SA 4MA5A 4MV6A 5FNVF 5LXTF 5CB4F 4O7YA 3ORQA 2DLNA 2X0SA 4RZQA 2GPSA 1PK8A 1Z2OX 3KAJA 2R86A 5BMVF 3TW6A 1KEEA 2YRWA 2GQSA 3GLKA 2QF7A 2PBZA 4FFMA 1A48A 5LP6F 3RV4A 5JQGF 5KX5F
chains in the Genus database with same CATH superfamily
1MRSA 2YHAA 3PE3A 1E9VA 3H4VA 4R31A 5L6LB 3RC1A 1RQRA 5AXAA 4R1SA 5C1DA 5EJ5A 2PT5A 1UPTA 2AOWA 5D1PA 1F2DA 2FHPA 2PL5A 5EKXA 4BQSA 2HRQA 1YS4A 1IBRA 2YWDA 2V7QA 3MWYW 3OZSA 3HE3A 1DDGA 3N28A 5J2UB 1QNLA 3T9FA 5C81A 1S1CA 1UXKA 3BCHA 2AWNA 1Z7WA 3ND8A 4HOYA 5I7EA 2J9FB 1UWLA 1U0NA 3JD4A 1J0BA 1E66A 1DINA 4BQRA 3IC5A 3AVWA 1S8NA 3JQEA 3JVDA 4YUZA 4X54A 1M34E 2NUAA 3MGKA 4JIGA 4M60A 5C52B 1LBSA 1E77A 1RQXA 2VDRB 2MYNA 2D1TA 3F49S 1F6DA 1A9PA 1KYYA 3ZX4A 4UNSA 3WMEA 4ZHQA 1IH8A 2W8BB 3ISJA 3DOJA 2WJIA 2SICE 4L85A 3MXOA 3JATA 3UA3A 1MJGA 3JD2A 1BD4A 1T5IA 2FF7A 2X77A 3OY2A 2R7LA 1TJ3A 4IPTA 1MO3A 2R00A 5AJUA 2G88A 3FNRA 1B1AA 5ALYA 3KYDB 4AYXA 3W2TA 3WIEA 2ORIA 4KPEC 1JHUA 2MTBA 4N65A 1G0OA 2DTDA 2HIMA 3NWEA 4HN9A 2DR0A 1R0SA 5LWHA 2AOXA 4G2NA 4IVNA 3T7CA 3JQGB 1QNFA 3M1YA 1W29A 2G17A 3RDPA 3EDMA 3ZKWB 4CHGA 4WOPA 3PFIA 3OC0A 2VWHA 2PUDA 2AFVA 4KJZA 2XOEA 3ADPA 3OKFA 4DXDA 4MAMA 2EKZA 3WO1A 3AUJB 3PE4A 2EBFX 1Q77A 2VUTA 5EYPB 2BEWA 2WJHA 4O4JB 2GERA 3F7OA 1LQUA 1Y8ZA 1QP4A 1ADYA 5DBIA 3CA8A 4S1PA 4COOA 1P72A 3C74A 1YB1A 4PPFA 4M0CA 4Z86A 1ST3A 1GZSA 2AGVA 1DZ3A 2DABA 2A9QA 1U2PA 2OB2A 2EJCA 3M2TA 5CK5A 2QR3A 3ENWA 1ZP6A 3VR4A 1H8EA 4EG7A 5K45A 4RZSA 1EWKA 4ALJA 4P0PB 4HRAA 5A5GA 4ZI3A 4G6ZA 2XUDA 4XVCA 1CUEA 2XXBA 5ECDA 1XVIA 1NDQA 4DKJA 3JY6A 3PLAE 1S2DA 2G80A 4GQIA 5D6NA 2ZRHA 4UNRA 2HLDD 1VJRA 3OZFA 1SRQA 2QD1A 1QHYA 1H93A 3MLBA 5B7GA 3U7IA 1NIPA 4MKIA 4C0WA 1OYVA 2YYSA 4J3FA 3JQRA 1HI9A 1WR2A 4C20A 3ZV3A 1GV1A 4UCOA 1DOZA 5LP1A 3KHSA 4ES6A 3CNQS 3F9IA 3H1BA 5SICE 5DI9A 3ZK8A 4E5DA 2ABWA 5IT5A 3W3ZB 5M2QA 1CQIB 3N2KA 1DFIA 3OOYA 2LWIA 4L57A 5KU1A 1LVGA 4RYLA 2P8JA 1USGA 4LXUA 4RFLA 4DMUB 2UUCB 5BPFA 1F17A 1UBSB 5TR9A 1A9XA 1JEYB 1CR0A 2QJTA 2VR1A 4DB2A 1QFMA 1OFUX 3R3WA 1YRWA 3EEBA 3EEYA 1G7RA 2O3QA 4NV3A 1NNEA 2JL1A 4MS1B 4CV2A 2JGJA 1VGQA 4Z9XA 4PINA 1W0KA 3EEOA 4B6FA 4FEAA 4O7LA 4QWMA 4Q4LA 5FI0B 3KWLA 4XX0A 1Z2AA 5B3JA 3FGOA 4L5CA 4R6XA 2Q7DA 2OBBA 2OVBA 2PLWA 1T10A 3A6DA 4YMLA 4PFSA 1RJFA 4HQKA 4INPA 3D4NA 2B34A 2QTCA 3IUEA 4QGAA 4Z0TA 4BFCA 5M5BA 1R5OA 2BLLA 1FYVA 3O8OB 4FU0A 1XZEA 1FNDA 1NLMA 4KWTA 1RTTA 4AUKA 4CG3A 4Q39A 2CUNA 4MVJE 1PR0A 3D6VA 2QRQA 3GPDG 5ITSA 3HKCA 2GBCA 3DFUA 3G7UA 4JASB 1RRCA 4DQNA 4IWXA 4TUYF 1EPUA 3CLSD 3GFTA 4MVJF 3AR6A 1JSRA 5LQCA 5AHOA 2UUOA 5EWLA 1T3SA 2PUWA 2AJLI 3NCHA 3HCWA 1OX4A 1WUTA 3HM9A 5IMBA 2Q3LA 4OXRA 2HCTA 2NV6A 1Q7EA 2OGUA 1ZW6A 2HO5A 3PFGA 4MJLA 4BFSA 3ZY4A 1PVDA 2ZYHA 4FB5A 3DV0B 1QAMA 5TQ2A 3DAAA 5TJHA 4BNZA 2QVCA 2QXUA 1JMVA 2C2ZA 2C0QA 5DI3B 2EZ8A 2HQSA 3T99A 4GRDA 1H4TA 3PC3A 4CETA 2X5JO 2ZBUA 2JGNA 1PJBA 4YA6A 2FLVA 3CX8A 3Q3CA 1EYZA 3F47A 2SKCA 4D4HA 1XE3A 4DZRA 2JJ2D 1TK2A 4ZZ0A 2G9NA 3FGZA 1YXMA 5AJZA 1VXOA 4JX9A 1Z75A 1ISRA 2H4WA 1LA2A 4EUEA 1W7AA 4QA9A 3KE9A 3JQFA 3AJRA 3JAKA 1S8OA 1XD2A 4HYQA 4K3UA 1UL1X 1F51E 1W46A 1LZKA 4JOBA 4AIIA 1H2HA 1YHNA 3KKLA 1W88A 3B1ZA 3AZQA 1UBHS 4I4TF 3P2JA 1GILA 4FMCB 3V3TA 4F8JA 1NI5A 1OQAA 2A5LA 3SZOA 3KTAA 4GPZA 3DNFA 3H13A 3UG6A 1J2EA 1UDXA 4WDRA 5KYUB 3ECCA 3TE6A 2N3ZA 4PGHA 1CW2B 5DRYA 3AF6A 4NICA 1Z28A 3I23A 1L7BA 2JRCA 4ZYLA 4RF2A 5A4IS 1SXJC 2A57A 3DBRA 4ZAGA 3T1OA 2YRFA 3BAAA 1WCV1 3LS2A 2OPBA 3ZI4A 1HY3A 3HXLA 5ENDA 1U4OA 2Z9CA 2WTUA 2WJ6A 2Q2TA 1CULC 3HP7A 1M0SA 1QV9A 4G41A 2X42A 2NAFA 3B3FA 1OLUA 2FRXA 3PUHA 3DBLB 1RRMA 4OGGA 5JJ5A 5DHFA 1DE0A 1Z7BA 4KCGA 2WE8A 4PTLA 3QE4A 2O0JA 4DTIA 4D7AA 4UU1A 2Z3ZA 2B69A 4KO3S 2C5BA 5CXSA 1E6LA 1QIEA 3V97A 4KH1A 2G1JA 1EWRA 1VBMA 2VH1A 4MQLA 4JLSA 2XNKA 2YJ5A 3T9CA 1BS2A 1NYRA 1YC5A 2ZWOA 4IMIB 2VHUA 4N18A 1G41A 3VI4B 1SC4A 4KVAA 1VG9B 4RY0A 5AK3A 1BHO1 4G1BA 3JSNA 4AP6A 3UWDA 3VJKA 4HRXA 1NXXA 1NXQA 3P2KA 1J0CA 3I01A 1O0BA 4PSVA 4JBLA 1QBKC 5FLEX 1Y7IA 2ATXA 3TL6A 4O7TA 3THOA 5KCMA 4CTNA 4Z1OA 1RYYA 3GP8A 1NOIA 3CEJA 1CFJA 1T26A 5BNZA 1S2OA 4KB5A 4JUFA 2VRWA 1S3GA 5BSFA 4EYSA 3CZCA 5K0LA 2XKJE 4OFZA 1GVHA 4FZJA 1A96A 3FPHA 1ODLA 1UKEA 3AWIA 1AB5A 2G5CA 4PGMA 1YQWA 3EAQA 5EZ5A 2R8XA 3O21A 1L3BA 1SB9A 2RB5A 3EMKA 4PNPA 4C03A 4DWJA 2VHXA 2XWJI 1JHVA 2VYQA 1FDSA 1YGPA 2ZWMA 1WNFA 1JAXA 2Q5HA 2I87A 1AHHA 3FROA 1EIZA 1R8QA 1QFSA 2GD0A 4EY6A 2FKNA 3VNRA 2V98A 4KWCA 4RIEA 4NE7A 1PJ3A 4C2UA 3HCRA 1A9ZA 1JQDA 1NKVA 1Z26A 4XGRA 2XB2A 1H85A 3OETA 2BELA 5ESXA 4HQFA 3B20A 3KYDA 1QC5A 4MUYA 1P6UA 3QPUA 4OMUA 2P9EA 4RKRA 1T0JB 2FR1A 1MAAA 2XVXA 2YQZA 2GZ1A 4ZQCB 4Z49A 5KYWB 3ORSA 3GEIA 3LT4A 3N3AC 4TQUS 3N6VA 3NUQA 4LCEA 3WGYA 3L4KA 3NDRA 2ECQA 4YN3A 3U44B 2COGA 2XBLA 2VXOA 3AQIA 5DWDA 4M8KA 4JJGA 2HMYB 5EC8A 1DGQA 4JL5A 4LSGA 1G8YA 1W1WA 1J7JA 3QM1A 4GMHA 4C0KA 1KO8A 2YIDA 2GSWA 1YUNA 3HR8A 4DRXA 5AOCA 1OCEA 1RI2A 2YXNA 1D5WA 2WUDA 4ZZIA 2WP8J 4JI8B 2G1AA 1D9ZA 2FWPA 3O2NA 5JISA 5ECGC 4RANA 1KNXA 2IA5A 3GNQA 3QUTA 2CNKA 2RDMA 3M6IA 4PCUA 4AJKA 2OBLA 5HUHA 1E1NA 2HF9A 3C41J 4TKVA 3GLIA 2O1XA 4J7XA 1C9MA 2XGJA 1BVRA 2RAVA 4QEKA 3C6KA 3I0MA 4YJ2A 1HRKA 3B9BA 4N7JA 5FBHA 4A26A 1W4LA 2GUGA 2IEAA 2VBCA 3NETA 2VH5R 3X1MA 4J76A 4QELA 4PLZA 1TVEA 3OJEA 2YBDA 4IIEA 1FTYA 3A6EA 3E48A 1J8YF 3RABA 3HUTA 3KVNA 4BQFA 5HCIA 4EDFA 1TT5A 1G8JA 2GQRA 3CHYA 3HBJA 4V0MA 2Z8YA 2JLZA 2EKDA 3LBFA 3IJ5A 1GSOA 2FP4B 3AQ4A 2ZJ3A 2P7HA 2A9PA 3TPCA 1A1VA 4JJFA 4RJ2A 1A4IA 2BJVA 2AOUB 3KKMA 4TT3A 5DRTA 3ZXSA 3B6MA 4ZICA 4YQFA 1VRVA 3HFGA 2WA1A 4OU4A 3ZWPA 1E2GA 1P9WA 4G0XA 3MN1A 1DJNA 4LBVA 1HDEA 1QZZA 3OO0A 2HV8A 4WACA 2DERA 4RY2A 5L9AA 4FD2A 1TTTA 3CF6R 4NENB 1UC8A 4NK5A 4LK2A 5F3RA 4EIWA 1NXWA 3I39X 3OO1A 4G63A 1O8CA 3RNOA 3M7IA 1J5XA 1F3LA 1XJWA 3REGA 5J4KA 1YNOA 1YC2A 2P1RA 2Z2KA 3QU7A 3HSYA 4WA7A 5CLLA 4CTOA 5LFAA 3NONA 2JVJA 2PSEA 2PWPA 3JRNA 3OIGA 4J16A 4PONA 3DEFA 1JLSA 5IVIA 1H3FA 2X5XA 5FUXA 1YONA 4E12A 1DBWA 1QXSA 1SQ0A 2OMEA 1Y3DE 2QTAA 1DRWA 1C7QA 3QF4B 2IDMA 2PLFA 5D84A 2ODEA 5ABPA 3B5IA 1E98A 1ZN8A 4F5DA 2FFQA 2FK7A 4UEJA 4AZ0A 2ZSHA 1JJIA 1FSZA 3QIVA 2G76A 2GEUA 2WT9A 3DTVA 2CHQA 1E2NA 2RHOA 5TMPA 2CNWA 2ERXA 1RKUA 3GVHA 4JDUA 1XXHB 3GG9A 4WJKB 3RBVA 4OYLA 5DM0A 1GZVA 4DGQA 3FDIA 1Z47A 7YASA 1E6EA 2DMRA 4PFQA 3UMCA 4Y3UA 3PUJA 3QLJA 5LLDA 1C1DB 4K5QA 3ZNQA 1JAYA 1OWLA 2HA0A 3N7TA 3TL3A 4IJVA 3WL4A 4JLDA 4LWOA 1QZXA 4CF3A 2PPVA 5DNWA 5DN9A 3D02A 3FMFA 5HDBB 3L7LA 1UMBB 4UUPA 2FZ5A 3QKRB 3M6UA 4QDUA 1P0MA 1TM2A 3H05A 3ZLVA 4HAUA 3TXXA 3DV2A 4K81B 4LAFA 4OOFA 5GWXA 1DI0A 3RFUA 3SGIA 5CCXA 3FJOA 3W6OA 2RKOA 4HDKA 4F5WA 3T7IA 1GFSA 4EENA 1Z2CA 1Y4UA 1A2BA 4IDFA 3UAXA 3NV7A 5AKXA 4YV2A 4AX8A 3IVGA 1JQJC 4CKYA 3H3FA 2VPTA 4BNKA 4L0QA 1PLJA 5KC8A 3N8HA 3R0VA 4UBOA 3NJRA 2C9BA 3HCCA 4FIZA 4AY5A 2Q0XA 4WGGA 3OLYA 2X14A 4YDHB 5KSYA 2YXLA 1KYXA 5KYUA 2I7VA 4N8SA 3TVDA 5LP6A 2HQ1A 1UR5A 1OZGA 1UMDA 2OESA 5FUYA 1US8A 1VI6A 4Q3EA 1G6OA 4BFWA 4D8UA 1YR6A 3PGVA 5E1MA 5KWVA 5AVXA 1CUCA 4OGFA 3UT6A 5F2OA 1I9GA 5LQMA 3EXHA 3FE2A 2ZUEA 3PVCA 4ALMA 3WYBA 3BABA 3AKYA 2N1BA 2J6CA 3HV2A 3NNDA 4TMKA 3G9TA 5KOIA 3LGSA 4PRYA 3INNA 1GGVA 1YJCA 4NCNA 3GLGB 1EDOA 4UCSA 3BIFA 1I1MA 3N53A 3QMWA 1HOXA 2W2KA 3STXA 1ZGCA 1EUCA 1JZSA 2J3LA 4NYJQ 1H5NA 4EJ6A 2FMFA 1VHWA 4OK6A 4RZ2A 3SSAA 4E94A 2HDKA 3CSSA 3MS4A 4CGZA 2RAUA 4FN5A 3QLTA 4ZO7A 1FIUA 3LPDA 1VXRA 3HCOA 4IQ0A 5I7UA 4PQYA 4L5BA 3UUEA 6ADHA 2PH7A 1KDVA 3GUYA 1EH5A 1NHWA 4LJ9A 3FCOA 4R8SA 2O3JA 3DL7A 2C88A 3PNBA 3AY3A 4HAWA 2QTMA 2PZFA 1F3OA 2WAYA 3GLKA 3ZU5A 1L4BA 3OM9A 4MZDA 4WEQA 3T7TA 2Y4OA 1MDBA 1CY4A 1IUNA 1M2KA 1CQXA 2GLUA 2Q9AA 5ALLA 5KDLA 2KM1A 3HDYA 3RV4A 2OHIA 2WZQA 4UPDA 2Q0QA 2FPRA 2Y2UA 4MIKA 1L5NA 8ABPA 5K4GA 2AN9A 3BULA 3GA7A 4W5WA 1HT3A 2OGSA 3AKDA 4HEA1 1RC0A 1GHTA 3P4UA 4Q19A 4PN3A 1FVHA 4M98A 3E7FA 3JSAA 4DPKA 1UXJA 4JYCA 1SEPA 4QXRA 2WFAA 4WXMA 5CDYA 2B1GA 1GQOA 3P9PA 3VZQA 2YNMC 2UVPA 1WCWA 1MV5A 4CIDA 2Q62A 1L9KA 2ETXA 3UMFA 1BRTA 3IP8A 3KQSA 1U02A 5F77A 3AW8A 4IFBA 5KNDA 1AT1A 1PFWA 3GH1A 4O2BA 1TNDA 2WA2A 1S2IA 4H7IA 2PCJA 3D4OA 1A5ZA 3AZPA 5HF6A 1ZD4A 1CHNA 3R0XA 4JZKA 4D45A 4NBTA 4Q4HA 4RPCA 3Q0TA 3GFPA 1YS6A 2FSHA 2VZEA 3OFJA 5F64A 5ELMA 2KMLA 3PEYA 2Q5OA 1H2XA 1P7VA 4O84A 3PC8C 5M04A 4QKQA 2YN2A 4PQEA 3DOOA 3EWNA 2NSDA 1A5TA 2D1FA 5JU6A 4C06A 3FFXA 3TEMA 5CPFA 1OBOA 3OFVA 3LWBA 4P58A 5KTSA 2IH5A 4QQKA 2HPHA 1PU2A 1E1RA 2EAUA 3FNIA 3VA7A 2I4RA 1GY8A 2BI8A 4WN9A 4O0LA 5BVHA 2E48A 2DKOA 4K40A 4J2OA 4YJHA 1JDPA 2HA7A 2QPOA 3HA3A 1GPH1 5GONB 3ZD9A 9LDTA 1PHPA 2OILA 4FVTA 4CV0A 2X5KO 3BG5A 1PI3A 2IGTA 2JJ1D 1ZD3A 3ENZA 1UBKS 2PL9A 3W8EA 3C3AA 3L9XA 3U7JA 2Z9DA 3EUEA 1ECJA 4OBEA 1UFKA 2RI6A 5DV9A 1N4AA 5IHXA 1YR7A 4OH1A 1OWOA 4QBKA 4KSCA 5FOVA 4A6DA 1JF8A 2XNJA 2WJAA 1GU1A 1MOZA 1QYRA 5GPBA 4C6SA 1MGOA 4P4SA 1QQAA 2NVWA 3RSZA 2BFFB 5AJHA 1XWWA 1Z29A 2NZ2A 3A9VA 3E3MA 4AS1A 1GAWA 2P62A 3B3AA 3U7QA 1EX6A 3O2SB 1U2SA 4OHBA 1CNFA 2WYOA 3P0IA 2CV1A 4WADA 5CDHA 2V4MA 5CA0B 1SUEA 2G63A 3LF2A 4II3A 4LV6A 1Z83A 4LNAA 5JVDB 4B48A 1PKXA 3GF4A 3M1AA 1BWPA 1MT0A 1C29B 2HA5A 3LPNA 1A3CA 3PXCX 1DJPA 1ZA2A 4FNAA 4JJ6A 3UAOA 4ZVOA 2CSUA 3HCFA 1T43A 4Q3BA 1YZKA 2H65A 1WB6A 5HGJA 4CL3A 1PCXA 1N2OA 1Z6TA 5BN5B 2VJOA 4K46A 3V80A 3U3RA 5TMDA 3HNOA 3RODA 4UBNA 2O8BB 3N8IA 4V0OA 3GRAA 2O19A 4D9JA 1AV7A 4PLCA 2J09A 3UQ8A 5JZSA 1SVLA 4JV5B 3EZYA 5JRJA 1VMKA 3DAGA 4XUGB 4W9RA 5HSGA 3MM4A 4JK3A 2GBFA 4M2LA 4O4LA 1F8XA 1MJGM 3MILA 4RMNA 4HYTA 3GJ8A 2OCIA 4IJUA 1C3OB 1X7XA 1WS6A 3QU9A 4KK3A 3WMGA 5AW3A 3IE1A 2FR8A 2P9BA 1N36B 2IHTA 3WLPA 1BFKA 2VSOA 3GMDA 1T9GR 1HRDA 2FTKE 1MX3A 4JP3A 4JVSB 1JE0A 2BFEA 4WXPA 5T6BA 3V1YA 4DJ5X 1W36C 1FQOA 1UMKA 2PZMA 4OYHA 3W5BA 3NHMA 2RC6A 5LBTA 4WOJA 4CM8A 1Z7GA 1ND5A 2PRSA 4DC9A 1ZVKA 1XRPA 2FHSA 4JAVC 4QEDA 4ER0A 1W94A 5ADUS 2ZTSA 1X2EA 3IA2A 1M1NB 1QHXA 4D57A 5F12A 3KQVA 4UDYX 4N5LA 2OM6A 4TZTA 2NO6A 5AVJA 2CDNA 3EIUA 2ET6A 4N41A 2QRZA 1WHSA 3IHLA 4GI2A 4P0TA 1NVBA 3N5KA 4RD3A 2G5GX 1AUOA 1ZI8A 2W4IA 3LQ4A 3LZ6A 4MI6A 5EP1A 1D6SA 3RFTA 3ZTWA 4N5NA 3ER8A 3CR3C 3WRYA 1JEQA 2X2OA 1ZDMA 4QOSA 3ERCA 4EK9A 5JTTA 1JWLA 2QZZA 3I0ZA 1C0PA 1G2PA 1ZRSA 3OLCX 2HXSA 3HDVA 4LZNA 5HHTA 2FMHA 2D4AA 5MF6A 2NO7A 1CE8B 3WLTA 2PMBA 2JLUA 2DSTA 2GJKA 5A6SB 4G8BA 4BN4A 3ZVKA 3QZUA 4L6AA 5U4XA 2A2ZA 3DMNA 1OVMA 2O9JA 2NO4A 3ML1A 4G1VA 4JLOA 4NMLA 4P38A 2JVIA 1PJAA 5JANA 3U9LA 2WEKA 3GVXA 3ZYCA 3RJ9A 1FVIA 1CUJA 1UT6A 1QV6A 4GM4A 1KZ6A 3K72B 3KT0A 4LYJA 4AZTA 4IZIA 5HE9A 3A1NA 4ZVKA 1KEVA 3M8KA 1G5FA 2B7CA 2HCBA 4YRBA 3QXHA 1SCJA 5SV2A 1U3FA 3LLVA 1AMOA 1LUAA 1QHSA 1SVUA 4W5TA 1M1YE 3EXFB 2Z43A 621PA 1MTZA 2DXIA 2PX4A 1WDTA 2GHRA 4B3BA 2PMFA 1ZM2A 4BTVA 1IOVA 1ATZA 3LP6A 3MD9A 4ND7A 3AETA 5AVWA 1P2FA 2RJOA 2QD5A 1XD8A 1HURA 1NY5A 4OUKX 1IWPB 2HYDA 1V5IA 1QBGA 4NV1A 4N01A 1RAIA 1JLKA 2FN7A 1GAJA 1YQEA 2PSJA 3ZVLA 2CJXA 3ACDA 3L04A 4F2GA 3FDFA 1C1HA 3Q12A 1YR2A 2WNHA 3ILYA 1NP3A 1IYEA 3GDEA 3WK9A 1W1UA 2NO0A 4EWLA 1QAOA 3B12A 1M7HA 1GNSA 2EIYA 2FWNA 1DAPA 2HXGA 3EGOA 3JD1A 4GGMX 4N6GA 4I1VA 1NA5A 1UK6A 1K5PA 1K8RA 4MRAA 3S2EA 3PUZA 1M2JA 2E4AA 1SXJB 3AVYA 3U4DA 1MA0A 1OY1A 3WNVA 4WD3A 3EUWA 1V8PA 2G08A 4J6FA 4REQA 1A8IA 1PT5A 4RABA 1FP6A 4D5GA 4H31A 4NZ9A 1LF0A 1P2DA 3FMVA 4TWAA 1T4CB 4EF6A 5B3KA 5DIFA 5KJFA 1IHUA 1XYVA 4GU5A 5E0OA 1KYTA 2NSHA 5GMOA 4A8JB 4KLCA 2G9ZA 1KAOA 3EVZA 3P8ZA 1FBTA 1PJCA 3QLUC 4M9CA 3ICEA 2JD2A 1QU2A 3EUAA 4DG8A 1ZJJA 1N7HA 2I33A 3UPUA 3ISVA 3PENA 1BG6A 1V3TA 2CUKA 4PAMA 2A1IA 1F2TA 5FTNA 2QHXA 1D1TA 2ISCA 5EA2A 2HWXA 3EQ7A 3PUXA 3UAGA 4LEIA 2G9RA 5GQSA 4FZ5A 2IUFA 3H6KA 1IBKB 4N8EA 2I6GA 4AULA 4LE0A 4YB8B 1J1IA 1JA1A 2DG2A 2FEKA 1FP7A 3CX3A 2P2DA 5F98A 4GX0A 2V5UA 2MSKA 1TVKA 1RCTE 2B92A 4OHCA 1RAFA 1L7OA 1EEHA 2EWWA 2HCFA 1VFNA 3ANYB 4FWBA 4UC0A 1VJ0A 1ZUNA 4X6XA 1J99A 3E23A 2IS1A 3B8EA 3S1LA 2Q1SA 1Z2PX 3NUGA 1ZJWA 3U9TA 3WYCA 3EEQA 3S24A 1N3LA 3PRHA 2MSCB 4YPOA 4HZUB 4J1QA 4RM3A 1Y6GA 2XT0A 3W79A 1BGXT 4QC2A 4KNVA 4E5MA 4TV8B 4I9UA 4LDQA 1T2NA 4ZOBA 3TBHA 2UYYA 2WF8A 2IYLD 4JT8A 3EIWA 4M21A 4UEQA 4ZI7B 1SKMA 3ZJVA 1GZ3A 4Y2QA 3ZZUA 2HHCA 1K8QA 3PNOA 1Z5WA 4LVUA 2MT9A 2YVLA 2W6JD 2KWIA 4LNUB 5GP1A 4MRMB 2O52A 4OA5A 1R00A 1G4HA 2I1VB 3L77A 1ONOA 3I5UA 2AG6A 4B3XA 1NAIA 5KB3A 4B6RA 1MHTA 1U2GA 1XQYA 4I7EA 4OHFA 4ZRDA 3C3WA 1GEEA 5IH3A 6CHYA 4CN9A 5K6AA 1WF3A 3PT5A 3QOXA 2CHEA 1X80B 3HC7A 1M8PA 1WHTA 4EUHA 2B20A 4FFNA 4B4KA 3V8QA 1ZJYA 5JSZA 4O7RA 1KH3A 2HHLA 3DEKA 3S3TA 4GOND 1EGVB 2WICA 3MQ4A 1NAHA 3FSRA 3IAHA 4IWNA 1JHRA 1VE9A 4WBXC 1F2UA 1PRYA 1WXFA 2OD2A 4XIFA 4J1NA 3TLAA 3X43A 1CF2O 4IDPA 2LIPA 3I01M 4FWIB 4M53A 1M5RA 3OJXA 4N0EA 3V6MA 4XSVA 3GY0A 5CA0A 1W34A 4O8CA 5CIYA 2OXFA 1JIKA 3QXCA 2PE5A 3I1FA 5JC1A 2WVJA 3V3KA 5T4FA 3NOQA 2HDOA 1OT5A 2Y76A 3CJRA 3NTXA 4C0AC 4C5CA 4RQBA 3IUMA 3PJGA 4LRWA 3LBNA 5KS8A 3EHEA 4FCTA 3O4IA 4PXSA 5KQLA 4BVLA 1Q12A 2JEZA 3VH2A 3FN4A 2XSZD 2YOGA 1GAQA 2I67A 3C3CA 2JKVA 4AYTA 4ROTA 4C4SA 3NHPA 3M2PA 3RU9A 2PANA 3LRXA 5KJCA 1N5JA 2QRHA 4RK6A 1ZD2P 4R05A 1BH2A 3SIWA 2CXQA 3AUSA 4M8SA 1WZUA 2A1UA 4B4VA 4C0LA 1QH0A 2LDBA 4YT4A 2B0CA 1WRBA 3OFNA 1X1AA 2JBWA 1O0SA 3QTBA 4A36A 4NOKA 5HKAA 2XA2A 1FFXB 1R3DA 4GR5A 3ER6A 3G68A 2WMDA 3JQQA 4BCDA 5L3SB 1GZ6A 5BWTA 4OP1A 1XRRA 2A92A 3LY9A 3HDHA 4N1AA 3B6EA 2FW9A 1RYHA 3P9ZA 2BMFA 2LCIA 1X7DA 1X1BA 2CUZA 2B1RA 3H17A 4X7PA 1YD7A 1JG2A 3TTUA 1SU8A 2VHJA 4KQFA 4G8CA 2WHPA 4IX9A 4IX1A 4LMRA 4Q5IA 3ZXUB 3JPYA 3Q87B 3N05A 3WRXC 1GEGA 1KO5A 2JRLA 4BEWA 1UP4A 1XVLA 5IAKA 1KVQA 2P2YA 3KXDA 1GRRA 5AJTA 1EINA 3STUA 3H5TA 4FSHA 1HFWA 3M3PA 4QG3A 4UULA 5BYKA 1Q3TA 3NGXA 5ALJA 1XK7A 2BCJQ 4BWYA 1RBZA 3JVVA 2Y67A 1MA3A 4BL5A 4TTQA 4GPD1 2V7UA 4XYGA 4PHTA 3A6GA 4YMSA 4B76A 1JXOA 4AICA 5DMXA 3NAZA 5LMCA 4BVEA 2CB9A 4UNNA 5BWWA 4GOJA 4II7A 3DTYA 1XC7A 5D00A 4M37A 5FNVA 1L4NA 2PUTA 4GPAA 3RAPR 3TQQA 721PA 4OM8A 1EVIA 3WAGA 1XZ8A 4RKQA 4UHFA 1YCDA 2YMMA 4G9BA 4QBFA 1E7WA 3LDAA 3KUUA 1I5RA 4LYFA 5TC4A 1D4AA 2LZ0A 3RD5A 2NSJA 3F3KA 3EG9A 4D0LB 3FD8A 1Q3KA 3DS8A 3GFRA 3KE8A 3O4RA 4DBZA 2GTHA 3EVNA 4MQUA 1LJUA 2WWWA 2ERYA 4R8KA 3G2LA 4IS2A 3U0GA 2W6OA 2Z8YM 4Y6LA 3HVUA 1GNPA 2A5FA 2VK2A 1W96A 2O5RA 3O47A 4G09A 4ZT7A 2F1RA 1DDIA 3ESDA 3PPWA 4GS5A 4YS6A 5TGDA 1NUQA 5KTNA 3ZUPA 2HW8A 1PD0A 2AR0A 1B3BA 2VBIA 1XVAA 2G7ZA 3G5UA 3HXQA 3LA6A 5IDVA 2PNJA 5KDDA 4EJSB 1OAKA 3WB0A 1D8AA 4X62B 2NO9A 5F3WB 4J0HA 3RIXA 1RCUA 3U13A 1Y7LA 1W4ZA 3GI1A 4GLJA 5E38A 3ZY5A 3PC7A 3BRCA 4Y2XA 3SY8A 1HYBA 2OY0A 1GT91 1TD1A 1SVKA 2JA1A 4BQEA 3SSNA 2QW0X 4ANFA 5ICCA 1AGXA 2F4NA 4MV9A 4S1VA 1JTFA 1SU7A 4IUBS 3MTIA 4LXGA 4DLSA 3NH6A 5JCJA 4S1TA 1GKLA 1ORIA 1DADA 1FZTA 1UZUA 1QIHA 2V5VA 4NU6A 1WMSA 4K87A 3CVVA 1GFIA 1UBLS 3PUIA 16PKA 1LVHA 4CR7A 3BE4A 1EM8B 3IPCA 3MWJA 4H1VA 3VU3A 2X0SA 1Z4KA 3QWAA 4KQIA 5IVDA 1SXJA 2O2EA 2PH3A 3UZBA 1EEXB 3ORHA 5EXSA 1YJBA 1PK8A 1DEHA 5KSOA 1W35A 2QV7A 4NCBA 2Y1DA 1ACLA 2F7SA 2N46A 2ZB7A 4BNJA 1F7VA 1W8DA 2WQZA 2NAPA 1EGQA 1M66A 3A36A 2R86A 2VUGA 3GCGA 3R3UA 4JU9A 2GKOA 1S0UA 2ZR7A 1L4HA 4R1MA 4X7BA 4NOJA 4O1MA 5DX8A 1KBQA 2JFNA 3T0IA 1U0GA 4OFBA 1Z25A 1Z4NA 3R7BA 1FA9A 2RGCA 2JFZA 1PWZA 3BD9A 4DUGA 3L4SO 3OWXA 2OFOA 2ILTA 2B3DA 4G24A 5K0SA 2CVOA 1X42A 1KMIY 2R11A 1HLGA 1ADFA 1HT1E 5E8JA 1CZHA 4AO6A 1XO1A 2PH1A 4KE8A 5E8RA 3ZCRA 5JNLA 2QU7A 1F0NA 3BIJA 1GPNA 4NBSA 3HEBA 4Q7EA 3ZDZB 1QPZA 4O8ZA 1JYSA 5BV8A 1E2IA 1RHUA 2VDUE 5EI5A 2YJGA 4XPZA 2QJOA 3MTEA 1MW8X 3VR6D 3NOVA 3AIIA 3WA6A 1ZIYA 1DARA 3VVLA 1U7WA 4G1MB 1JIVA 3AUXA 1NZJA 4LV8B 3SYTA 1I36A 1NTOA 3VR5H 2ZT5A 3E7XA 3C3EA 4AF7A 1WNTA 4B73A 3EGEA 1K68A 1KO4A 4IH1A 3LUPA 3N74A 4DG5A 1QZUA 3TUJC 5DMHA 2AFIA 1PK7A 2W70A 2ZRQA 5AM0A 2DQZA 1G8MA 3V8EA 3VNQA 3U48A 4MRVA 3N0VA 2WHXA 4TKUB 1PFUA 1NMQA 3DC2A 3KXIA 1KDZA 3UHFA 3RASA 4CMCA 4QJ5A 4R9SA 2W90A 4LBZA 3EIOA 5DW0A 1RQGA 1NHGA 1P1RA 3DFIA 3FZQA 3Q2IA 3BMOA 4R0MA 2HJRA 4FHGA 4LZJA 3OF3A 4I55F 4BNTA 1CR4A 1GUDA 3IXLA 4NFLA 2G28A 4PY2A 1GCGA 1G3RA 1GQRA 5KQSA 3DZCA 3GMSA 1JTEA 4FFLA 1JJBA 4P0QB 2ZYGA 3TJMA 4FX5A 3HS3A 4F96A 1A72A 3EASA 3R6LA 1U8YA 1V7PC 1FU7A 4M1MA 5BSUA 1K0UA 1JG4A 3MQ2A 4HATA 4JLAA 4V1CA 2R5WA 3E61A 3GNTA 1SUIA 3JQCA 3L2PA 4BEJA 1FSFA 3FHTA 4R3WA 2PX3A 2ZAYA 1XKLA 1OTYA 3I8SA 5CPBA 2IUSA 1OBCA 1E3QA 2R6HA 2PDAA 4I6EA 4J94A 4GXNA 5FI3A 4B5KA 3AJEA 2H57A 5DCWA 4F97A 2H4YA 1B3RA 5I8WA 4JFAA 2BGWA 1Z3CA 2SBTA 4GSKA 4INZA 1B7GO 4EG8A 1H1DA 1DBIA 1JB1A 1X77A 2FW7A 1M54A 4WXEA 2JGDB 2PXCA 3W8FA 2FPOA 4KQWA 2BMVA 1BD3A 5BWOA 3V7NA 3ZDAA 4TRMA 5CTJA 4H4DA 1KP3A 2O8FA 3DYIA 3PXBA 4BP1A 2J1LA 2PKQP 4P8RA 1I7PA 5KTTA 2IOYA 4LKRA 1L4UA 4EFNA 4CLDA 5K0JA 1NMYA 1EJ0A 2YX1A 4MICA 5TQ0A 2IEDA 1NY6A 1SCDA 3RFCA 1MNAA 2DAPA 2I91A 2P5UA 3SOZA 3T1HB 1EVEA 2VQDA 2C4WA 1TYAE 5DGIA 3ET5A 2GX6A 3IUYA 1AUVA 1AB6A 4FOPA 4KBYA 3UAVA 4L8WB 1S8FA 3A6ZA 5EKDA 3V8RA 3MCUA 4PFJA 2NZWA 1C0EA 2ZSKA 5AIBA 1KARA 1QVVA 1OR8A 1V7ZA 2AG0A 2UXDB 1PFYA 4G4JA 4B5LA 2JGFA 5TQJA 5HQTA 4URVR 4GPEA 3RC8A 5DM60 1Z3IX 4UATA 1VLVA 3QA3E 1O2DA 1RI1A 2VRCA 3IPYA 2J87A 4HGPA 4PC3A 3WC4A 1CQWA 1MABA 3QELB 3THWB 4DQKA 1G3UA 2DFDA 4G5RA 5CDSA 3FOCA 5A9SA 5G02A 4MR7A 3G82C 3AFHA 4A5SA 4MNTA 2H8GA 5AI9A 1Y0BA 4YRZA 4KYTA 3BH7A 1KK0A 2WM9B 5JLAA 1VBHA 1NNI1 2FMKA 1S7CA 3AEXA 5HR5A 1RJWA 3OBBA 1AK2A 4PQGA 3X1KA 2QN9A 3A1DA 1EKXA 2QZ9A 3PZBA 4K9PA 4CQLB 1BE1A 3OTGA 3ZC3A 5JAOA 5HZMA 4J0KA 2NZUG 3S1AA 2YWVA 2UVQA 4LFCB 3K4PA 2YRXA 2IPOA 1WBDA 4ARVA 4EYOA 4TXNA 1I2BA 1N9GB 4XR4A 3AB7A 4LNHA 5G1NA 2OECA 3U17A 4DADA 1HSOA 4CKEA 2YUIA 4XWYA 1W9HA 2ZSEA 4MXDA 4ZO9A 2I22A 5H4GA 1E8NA 3GEPA 1HK7A 4JUCA 2QL9A 3CY6A 3C7KA 4NBLA 2NTVA 4PIPA 1EBFA 3LULA 3ICWA 1NUHA 4WLNA 5AYVA 5FO0A 4J0IA 5J2UF 3KFXA 5J4LA 2PZJA 4R1UA 3S8MA 3G23A 4MQFA 3LWNA 3VHQA 4RV5A 1C1XB 1MB0A 5FB3A 1FCJA 1G21B 1ML3A 1X9HA 3GELA 2GSDA 4MS4A 3JQ6A 1T9KA 3GPBA 2JHCA 2VTKA 3RVOA 2DUUA 2Q5FA 3PT9A 3RFFA 1JLLA 1EZ1A 1Q1QA 2PKCA 1ISHA 1JIXA 4PFKA 3EPHA 5GJBA 4HDSB 3QHAA 4YR7A 3W5AA 3A9UA 3BOSA 4L0DA 4XDHA 4CVNA 3L7AA 3A9WA 1MB4A 3L0CA 5JFGA 2EFJA 5BN4A 4BHTA 4C5AA 1XZLA 3GROA 2QAGC 3K9WA 3VX3A 3SVLA 5GZ6A 5C32A 2IBSA 3BGDA 4NQRA 3BF8A 2CXPA 1OAAA 3KR9A 4Y2GA 1H1LA 3VH3A 3I3SR 3K0BA 3TQTA 3AY6A 1C8BA 5CNKA 1PQWA 4M1OA 2IJGX 2YIJA 2V9PA 3NHFA 2X2EA 4E15A 2H5LA 1UJ4A 1ABBA 3DDOA 4KIFA 1QDLB 4B3JA 3K9FC 4FHDA 3OQ1A 2UZ3A 1JA0A 1VA4A 3EPJA 2OHOA 3Q41A 4C87A 4O4JF 3W7BA 4IG9A 4N7BA 1KFJB 1NXVA 1WQ4A 2QPAA 3EZ2A 3LWDA 3COJA 1I7QB 3IV9A 3HLYA 3KYJB 4PIMA 3OD1A 4WGFA 3HCBA 3Q11A 4M7PA 4EZEA 3A4LA 4Y2YA 4YRJA 3ADCA 3E22A 3IMFA 4DJAA 3MERA 1MQAA 4KR9A 2O3UA 2CLEB 1K63A 5SY4A 3VR3D 3ELUA 3QKSA 2DPMA 3NEAA 4PC6A 1CVIA 4LH7A 4KWEA 4XARA 4YLYA 3ZK9A 1OZFA 1UFOA 2QTZA 4WV3A 1Z62A 1SBQA 3LVRE 3RS9A 2C3OA 4YASA 4IM7A 4MPJA 4E32A 3FDZB 4HNTA 2WKRA 1Z4JA 2WM2A 4MW9A 1JLMA 2OC9A 1VKZA 4EO7A 2J6IA 3E1KA 2EKPA 4DNFA 5JTUA 1RJ9B 3AJAA 2ST1A 3GDFA 3RWBA 2NW6A 3P9IA 3R3SA 2X0FA 3WQRA 3QWFA 2YZGA 3RBZA 4HPJB 1B2LA 4KXWA 1JX6A 4BLRA 3OPMA 3KYHC 3DT9A 4WDQA 2ZGVA 1D4ZA 5T6MA 1GWNA 1X87A 3H6GA 5LB4A 1GUFA 1QB7A 3L82B 3VKVA 1WW8A 1SOVA 4JS0A 4WY2A 3RQIA 4HNHA 5ICMA 3T4UA 3IJPA 2FZ4A 4XIGS 3VJLA 5KTOA 5LMUB 1IY9A 3C6QA 3PGMA 1OH8A 5LD2C 1U2EA 1Y8QB 1L1RA 3ZX5A 3TQFA 2R4QA 1WBBA 4LGYA 1P91A 1IN8A 2OBYA 1GCOA 2F43B 3PLNA 4U9HS 2VYND 4S1WA 3ZDQA 2O8CB 3Q0IA 2Z6UA 1DP4A 1NBMD 4FCVA 4O4IA 2V6JA 2X0NA 3K1AA 2HNBA 2VPIA 4WLFA 5C2JB 2ZEJA 4KXLA 3RT9A 2WBLC 4HN4B 4IDDA 1ZICA 2HGSA 1M75A 5ENVA 2ROQA 1WSWA 1BU5A 3K96A 5BSTA 3VUEA 5LL6P 1L5OA 3NALA 3PG5A 4X3OA 1FFAA 4B79A 3DHYA 4BUZA 2YNMA 3EGIA 3P9RA 3GRKA 4LE2A 4NYMQ 3IQDB 4TLBA 1LC0A 3D6TB 1YJ5A 3GA5A 2E49A 4X91A 5FOWA 4L07A 5I48A 5DN6A 4KOEC 1RE1A 3TJZA 4L8VA 1LC3A 2ZYIA 3AP1A 1OKKA 2AH5A 3TN7A 2R8ZA 4X97A 4DDKA 1AZWA 2CYAA 4ZEXA 2QX6A 3GGPA 3KQLA 2JJ8A 2VJBA 5BSRA 3C7CB 3V4LA 2RGXA 1SXGA 3IVAA 3K6KA 4RD1A 1E2KA 1IY1A 3UWPA 2E5LB 1YRQA 1EUDA 4WCFC 2OUKA 1WG8A 1DXYA 3CKLA 1HDOA 4MWOA 4DMLA 1YCFA 3EWAA 2W98A 4KQCA 4DT1B 3N2NA 1SUCA 3H1AA 3PC8A 2RHWA 4DR6B 3ESXA 3FHJA 2R87A 4JBNA 5KHAA 4NPAA 4TZKA 2FPKA 1HETA 2ZBRA 3D1JA 4EHNA 3HVRA 4OSPA 1WKVA 2X4IA 1VE5A 1ZA1A 1TF2A 2Z4RA 2ZSUA 3DEAA 1QHEA 2I8AA 4L16A 1FMFA 1ENZA 1X1QA 3G6KA 4RHTA 1V8DA 3BK1A 3AR5A 3BFKA 3C43A 4X1IB 2CD7A 3CG4A 4E5UA 2X9NA 1WWKA 4ZEOA 4D6PA 1R3UA 3EISA 3LPAA 1V5WA 1Z0SA 2Y99A 4G9GA 2IDJA 2JFYA 3DF9A 4U2CA 4J29A 1TQ2A 4CYMA 3FB4A 2NZYA 3PXGA 3ROXA 1AY0A 1QRDA 2AG1A 5CE8A 1A4UA 2AUNA 2HX1A 4TV9A 4FMCF 4WT7A 4FE4A 3DVLA 3ZIAD 5JEDA 4O86A 1DQSA 3K5HA 2I76A 3T95A 3FWPA 4PPYA 1AXGA 3PDJA 5TE9A 3V00A 1KO7A 3NBFA 3OT1A 3U3ZA 1U2RA 5AK0A 1SB8A 3GJZA 5D3MA 2BFCB 2UXCB 2A3NA 5CAEB 2Q3CA 1V4VA 4EHHA 2DYKA 4F91B 5KMGB 3DEYX 5DYTA 3R6WA 4CLRA 5FL3A 2VCEA 3WFZA 4B47A 3MPUA 1E1CA 4ID9A 4TMVA 4Y18A 1V8BA 1H4SA 1BDBA 1E7YA 3G0OA 4PSAA 4ZTBA 3Q40A 1LX6A 1VLQA 1HLFA 3DLAA 1XDBA 4NFYA 1UK7A 2DFKB 1G20A 1Q7CA 4L75A 5TQVA 5LQRA 1AK1A 1M9NA 4DLYA 1XRQA 2JVKA 4M8IA 1QHIA 5ITWA 1XRNA 1ESNA 1ODSA 1UXGA 1RPZA 3ONEA 3LLSA 4LKOA 2DBVO 5KQMA 1SBIA 4LUCA 1DIKA 4NR0A 4ZDWA 3E9EA 2G4VA 3MF4A 5LA6A 4ZYVA 2W2VA 4F1JA 4OHPA 1U8FO 4MAAA 3T7JA 3SYMA 1YI8A 2Q2QA 1IQPA 3U7RA 5CT6A 1HTWA 4R0VA 4PSDA 2R0QC 2YFHA 3O4GA 3HA7A 4ONEA 4DBVO 3MTGA 5C3MA 1C41A 3M3DA 4DNPA 3N9IA 4YI5A 3R5KA 2XZLA 2C5GA 2PYIA 3AYXB 3KUDA 4ML3A 3FVRA 3AK4A 1CY6A 1ZU5A 1Q2UA 2CL6X 2WWHA 3L7KA 3PKZA 4UW9A 4LWPA 2O3TA 3H9JA 1A95A 4L5YA 4LRYA 4F3NA 4BV8A 1B41A 2BFDA 3O3CA 8AT1A 5KOJB 4CC5A 4M9QA 4MS3A 3BL8A 4CT0A 4ED9A 5K0GA 1KU6A 4UZSA 5DH9A 2A1TS 4YBZB 5H9WA 4YPFA 4RK4A 4TPKA 2VYVA 3RYHA 3QSYA 3Q7SA 3L7YA 3PFWO 1V43A 1OZ0A 1YI1A 4HPWA 2OQRA 2Z1NA 3CUTA 4KZKA 3WGLA 5CB4A 4ZYUA 3IMKA 5A4AA 2AJBA 2ZTHA 1IEQA 2ZRMA 3CQ9A 3H9UA 3MHPA 3TG8A 1O08A 1U5BA 2E1RA 3W5VA 2NACA 3FWNA 1AO3A 1KVRA 1NZFA 3G2HA 3HBNA 5J1TB 3RIHA 2C7GA 2LBPA 4ZU3A 4B8ZA 3A05A 1AO0A 2WMNB 2Q5CA 4BNDB 2OFPA 5LNK6 4EM6A 4C3ZA 2YWGA 3MWKA 4D1YA 1E4VA 3R7SA 3GMIA 1A4RA 3SOPA 1Q1ZA 7ABPA 2YWEA 5EIAA 5B1YA 3OC6A 4HAYA 4TSRA 5EQTA 1Z63A 4RELA 3DXZA 3D0OA 4FBGA 1OXUA 2Q8NA 3LO8A 3K1TA 5CR5A 3KLOA 3L0OA 3WLQA 1RXYA 4YRSA 5HE8A 1VE7A 4DYVA 1FMCA 3K35A 2Z2ZA 2PY6A 1JNYA 5G4KA 3MINB 1XZCA 5FTMA 4OVKA 4CF5A 5DBFA 1ZW1A 3IDSA 3M82A 5KAPA 5B58T 5HS6A 4Q4AB 5HG0A 4QNMA 1E3WA 2FEXA 3TBKA 1DX9A 2D0PB 3HDTA 2WIGA 3EDYA 4X0EA 4DABA 4TKZA 1P8JA 2C03A 2OV3A 1XZHA 5EWJA 3PGJA 4QUGA 5HCUA 5E3IA 1NQOA 1FX0A 1EVLA 1QIGA 1XBTA 1WPGA 4YMIA 1TUGA 3DKKA 4FE3A 5JI3E 4J6EA 3T15A 2ID8A 4WOCA 4RZQA 4HDQB 3UKOA 3OJOA 4G5SA 1F4VA 1M3SA 3DMPA 3ZW8A 2ZKIA 3AOEC 2C83A 1H0SA 2EVWX 2WWIA 3E0QA 4JX8A 2X3YA 1KAQA 3LQFA 4WNCA 3WMXA 2OCDA 3NATA 2PJRA 1R0YA 2NU9A 2Y0EA 1UIMA 1M83A 2I54A 4BMOB 4CHIA 4Q4JA 4NNJA 2VQFB 5D7NA 1QB8A 2GO1A 5HS4A 5LM3A 5TMBA 2BSXA 4EVQA 2IX3A 4MV0A 3Q8MA 2V7BA 3OCYA 4DSOA 4EI8A 3OZBA 3STHA 1WAMA 3MUFA 4PZZA 4IUCS 2P1DA 1WE2A 2VPWA 2VP4A 3AF2A 4KIGA 1XMOB 2BBSA 2VNSA 1IE3A 2NXWA 3R23A 2G82A 2NXNA 2X6TA 1QO7A 3IQEA 3K0FB 5CYPA 1Y8QA 3WYGA 1PYOA 4QX6A 4UVEA 1RKXA 4CDMA 1HQCA 1SM4A 2Y27A 4OREX 4UMDA 1TKCA 3PL1A 2PGJA 1E2MA 3GEDA 4AUEA 5HJ7A 3ORFA 5ERXA 3SE7A 2GD2A 3MSCA 4FR2A 4QUAA 4H1TA 3IT1A 4UTOA 3U16A 5EHGA 1V11A 2IX9A 4JLJA 3H2HA 1EE9A 4HB3A 3U56A 3QPCA 4DBLE 3LCUA 1FRQA 2SECE 4L78A 1LH0A 2DWOA 4P4GA 1KT8A 1KXZA 3I83A 4BNVA 5HOEA 1KI6A 1TPZA 2ZR9A 2RMKA 3EVGA 3KHUA 5KKCA 3A4MA 2XXAB 3NDBB 1Y8CA 4LCJA 1I51A 1L0BA 1GGMA 3MZ0A 1U81A 5LCXA 2JLAA 2FPLA 3LL7A 5B5SA 1XVVA 5HK9A 4E30A 2JLRA 4G07A 4HHEA 4I5EA 3UPTA 3WNQA 4MEAA 1Z5GA 5AKKA 3EOZA 4KO8A 4LQDA 4ALIA 3RVPA 2X7JA 4WL0A 4FGRA 4X90A 3ZXXA 1Y1TA 3ZZ0A 1PG2A 5CHYA 4BJ1A 4DIUA 4ZO6A 1IL0A 3ANNA 4FFBB 4GAEA 4GXTA 3UXEA 3DXXA 4H7EA 4I6JA 1ESEA 5LDDC 3A14A 3KXKA 4CM3A 1C1YA 3IUQA 3RUEA 3G2PA 3QVUA 4JXUA 5B55A 5KYTA 4E7PA 2C1EA 1M6VA 4B44A 3V4ZA 3NAQA 1X14A 2PUAA 1Y80A 3WLIA 3BMCA 4OGWA 2R8YA 2WSBA 1GZHB 1OU4A 1TMOA 4L28A 3BWBA 4HVLA 4Q24A 1G5HA 4U7TB 3ZYZA 2ZB2A 1LVUA 1CZKA 1XJ0A 1P9OA 1P29A 1KSGA 1RLTA 4TRRA 1J0DA 3HQ4O 1S1MA 4GZ6A 5KTRA 4YV7A 3F5MA 3QUCA 4M0EA 4UVDA 3RW9A 2WPDA 3UWMA 4BFTA 5C8XA 4NWIA 2R60A 3CLKA 3ZQ4A 2JD1A 1KTAA 4DR5B 2CJWA 2H2IA 3OOEA 4DNQA 4DDUA 2F6RA 3UCXA 1PR6A 3QVOA 3FKSD 3AXSA 3O90A 5BRJA 5BVGB 4KQKA 2ZJAA 4JBIA 3C5HA 1DS6A 5KYYA 1YZQA 2V7WA 5GY7A 4ARZA 4YDSA 3UFBA 3UEOA 5J47A 4HNVA 4DUYB 1HEUA 3AERA 4DLRA 3GEHA 4LC0A 4WAUA 5EFZA 5LN1A 2ZCJA 2AYXA 4G25A 5EJFA 2FMXA 3BDAA 1BC5A 4ZTZB 3RJZA 3MS7A 2ZCVA 3K09C 4F2PA 4P98A 5LPNA 3DFMA 3KBOA 1IQ0A 3EW9A 1NI4A 4QOHA 1JHOA 4QUEA 5CJ2A 2J6HA 5LOVA 4CEJB 2IPAB 4MGZR 2NVOA 4IYJA 1FQWA 3UGTA 4YAIA 2O3RA 3DL4A 3JTEA 1B6TA 2C0CA 2XMDA 2REOA 1DTEA 3UFXA 4YPVA 1AA6A 5IKOA 3CCCA 4HVTA 2J8ZA 4K6FA 3UWOA 4YUAA 3MJEA 1Z2EA 4DHEA 5C8YB 2D7CA 4QDOA 1SEVA 3NOXA 3T5DA 3UUFA 3VKHA 3BHNA 3LQRA 1E5DA 1Y42X 1YVDA 2ZRCA 4RIFA 3RU7A 5I4KA 1E1DA 2H7CA 4K8RB 4UM7A 1JKXA 1NDUA 3UMVA 5BY2A 1TLFA 3LX8A 2ZQYA 3T3IA 3WV5A 4GBMA 2NVUA 1XZMA 3ZCQA 4BO9A 2HMSA 2PEYA 3KL2A 1K5HA 4TWJA 1ZN9A 2HVRA 5L7WA 1J07A 4IMJB 4LRSB 2XYHA 3WQHA 1SUSA 4XWGA 3THXB 1ZMBA 2WF5A 1VBNA 2EJ3A 1ZH2A 2FRVA 3B1KA 3WRXA 3ZU6A 4ZYWA 1KQPA 1FVFA 4JT9A 3LNCA 5FOXA 1CY1A 4M86A 5IT0A 3TUZC 2OG2A 3OESA 2O2CA 2XYGA 3ZCSA 4R1NA 1D2EA 3V1UA 2OG1A 2IYZA 3ZV4A 4AJ1A 2GK7A 2RI1A 3AR3A 2WJWA 4X3PA 2F1IA 4UNIA 3RC7A 1FPMA 3SHOA 2ZIEA 3GZJA 3LHFA 1DV2A 3TNJA 4CPDA 2ATEA 4E5KA 1NXTA 2YY7A 5ALIA 2A0KA 4PG7A 5LQDA 4P36A 5BR8B 1CEEA 2QBYB 3OCUA 2GT1A 4NNPA 1E2EA 1RQNA 2DPHA 4L1KA 4LHZA 4UDXX 3TOCA 4EOGA 4GKKB 2MYTA 1RM4A 1IQRA 1RQ7A 3JYPA 1SIUA 4M4SA 1H4QA 2GF2A 2OV2A 1G8FA 4JJAA 2I29A 3VZPA 2C8JA 3X0DA 1RM0A 4O82A 1PZXA 2NSLA 5AWFC 3N8DA 4HPXB 2VQEB 4RORA 5GVRA 5A05A 1OGYA 4RULA 4JWTA 4WY8A 4KDRA 5GONF 3NHKA 3TZ6A 4CV3A 1LV7A 1DWQA 3UJAA 1Y8RA 2JKZA 3Q1LA 2WKSA 3AOGA 1B74A 1MAUA 2CL7X 5HF8A 3TW4A 1JFFA 5JQGB 2QAGB 3D3NA 4UM9B 2AXEA 4NK4A 3MCZA 3WB1A 3RAEC 1HE3A 4R01A 3SKVA 4H3HB 1AS0A 1D07A 2J3MA 5C1PA 3K6JA 1NWCA 2SKDA 3KKZA 2J0QA 4V02A 1YCHA 4PPGA 4I5DA 5A62A 1DKNA 3DMTA 3GAFA 2QIPA 3U55A 1YL7A 2PRZA 3DKIA 1HZJA 3BMQB 1UDWA 3IQWA 3M4JA 3OIVA 4P53A 5CXXA 5AIAA 5F35A 2CLIB 2FSPA 1XJCA 4QVKA 2PUCA 1VG0B 3EXIB 2EJ0A 4HH4A 3N0TA 3T6KA 3NAGA 1W49A 1RTKA 4ENUA 3HJBA 1NE7A 4DNXA 1QRUA 1BTOA 5JVDF 1SO8A 4L9AA 4LDNA 3GYGA 4PF1A 3RUHA 3UUWA 4DQVA 2IDKA 2BT4A 5JAPA 1DMSA 2AXNA 4MIYA 5JAIA 1X9NA 5H3HA 2W83A 1X1DA 2JA2A 3VSAA 3D6MA 3FZYA 3G88A 4G65A 1Q0QA 2VHYA 5LZ4A 1TD9A 3OBIA 4YQZA 4ETMA 2O20A 4QJ4A 3JQAD 2ALJA 3ZLBA 3DWEX 5DT9A 5TVKA 2A9JA 3HEMA 2CL0X 2BKEA 5HPYB 5K8LA 5KWEA 4WZ6A 3WK5A 1V37A 2FZEA 2DUJA 3PWZA 4RIHA 3QKUA 3VH4A 2V0GA 5EZYB 4U63A 3H3JA 1SK9A 3F6BX 3WR5A 2BHNA 4TGLA 2BY4A 3BXHA 2CBZA 2X15A 3FH0A 3I73A 4KXQA 4BUCA 4EB6B 2AQHA 1D1PA 1HNXB 2PEZA 1NYQA 4FEGA 4P84A 3JARB 4YQYA 1T9BA 2FN4A 3RKRA 3AGQA 3TD9A 1XLVA 1O6GA 5TV2A 3A37A 3AFMA 3RH0A 1KRHA 3LPCA 3S7TA 4DZTA 2SCUA 3Q8LA 3AB8A 3RVQA 3C5WP 4ZYYA 4E5SA 1AU9A 1KZGB 2FEAA 1TIKA 4IZHA 3ADKA 2GZAA 4MR9B 2O23A 4W9NC 3TQRA 3KKKA 1E2UA 3BA1A 1PGPA 2QM7A 4FGLA 1JB9A 4UEKA 2FNAA 3V2GA 4WE3A 2O6HA 3K0AB 4XA8A 3REQB 1N0WA 3COYA 3QEOA 1EGHA 2FQXA 1SC1A 4MLPA 5LD2B 3SIPA 4FE2A 1Q92A 2AB0A 3TGWA 1Z2DA 4L4YA 1PAUA 3SNKA 1Z88A 1HT2E 4HLUA 4OAOA 3TM5A 3MAGA 2O8VA 1IIBA 3VGJA 1IU9A 2PH5A 3PQ2A 4YYEA 3EFOA 2GHTA 2HJGA 2C3MA 2J0VA 4INOA 1P9NA 4ZU1X 3S99A 3GFOA 1SKYB 1ISJA 3LU1A 4AB1A 3K2EA 3QQ5A 1AV6A 2Q0SA 3TB6A 1FVXA 4YCJA 4JP8A 1K1EA 1I30A 2VAVA 1K2VN 5SY6A 2B61A 1U1IA 3AVOA 2R7MA 4OHUA 4KVFA 5GJWC 3MGAA 4ACBA 1N8KA 1ZCAA 2Q5JA 2FPPB 1B14A 3OOJA 4D96A 1HUQA 5IVPA 1OBFO 1GRCA 3DLIA 4TTTS 3ETCA 3QYPA 1RPTA 4D46A 2XTZA 4DG9A 5IJZA 3TKLA 2ZATA 2QS9A 3PTZA 3RSQA 1U7UA 3OX1A 3HKEB 3I5MA 1U8TA 2DGDA 3AVPA 3QHPA 2XI4A 4QOFA 3EC7A 2X76A 5J1SB 3TW8A 1ET0A 4IHJA 1FFYA 2FXVA 4TN1A 5GAJA 4CEIB 1CKMA 1YRHA 3W7AA 1P62B 2XYRA 3R7DA 3BXOA 4DIEA 1Q0LA 3LCRA 1RQLA 3IEIA 3MTDA 1ULBA 1VMIA 1FXUA 2IZ1A 4YWHA 4ESHA 5I9SA 3NIWA 4TKLA 1FLAA 1X1RA 2A0FA 2CZGA 4HUJA 5BVGA 3F1LA 1RYNA 1DG1G 1YFZA 4D43A 1HDXA 2DWQA 3RRXA 3DMRA 4L02A 3NRCA 2GN4A 4PG5A 4U4AA 4WKCA 1T8UA 1YFKA 2P41A 2RKBA 1ZCBA 3CPSA 3NQ41 3KSDO 4PBTA 3NPAA 1RZ3A 3QVVA 4LSZA 2PRKA 3U3MA 5KQRA 1P2GA 4MULA 4KBFA 4NULA 4DA0A 3WAJA 4BNNA 1FP4B 2ORYA 1TCBA 2ZU0C 1F5NA 1AKYA 2CFCA 1C14A 2EWMA 4XD7D 2HLDA 2VJYA 3KUCA 1P4HA 4BMDA 2MJLA 3LW8A 3DBVO 4FILA 3OSZA 4EEQA 3ZOKA 3DCJA 3DM9B 5C1BA 2DQYA 1J00A 3PKJA 5B6PA 5KX5B 3HXMA 1M76A 1NQWA 1U9YA 2KYRA 1J8QA 4Y8VA 1NBIA 2QVGA 3ROMA 1Q15A 5JXJA 4GMGA 2P68A 4BBPA 1YTUA 1ZCFA 3W4JA 2RH8A 4KAFA 4QO8A 3GFSA 2D0DA 1URPA 2HWWA 4G0VA 1HX7A 5E6RB 2K7FA 1VGRA 2GBLA 3FFWA 3MNFA 1QK5A 1X1EA 4H7FA 4P4NA 4H9GA 1Z68A 4A91A 5KC9A 1XNHA 1I7SB 2VKQA 3AHDA 1E9BA 4UZFA 3V8BA 2JI8A 4X7RA 4EG6A 1A50B 3OG9A 4AG6A 1P2TA 4RTQA 4H15A 2W42A 2G40A 1B0PA 4LF9B 1WB9A 3DF7A 1VFPA 5CLHA 3BIOA 1AXRA 1KFCB 4QE3A 1W76A 4UU0A 1XZBA 4OBXA 5LDGA 4QLAA 1WUIS 5GZ1A 1E3JA 4HWGA 3RAGA 5LJLA 4J3NA 3W6UA 2PT6A 1P2VA 1DT5A 1GL6A 3D8RA 5L53A 3R40A 3EDOA 5CW1A 4MB2A 4NF2A 1U7DA 4X6YA 4XSHA 3HPRA 4ZCLA 5C7IO 1VP9A 5KTPA 1LDYA 3EF1A 4BZZA 3GLFB 1V71A 1K9SA 2H85A 3FFAA 1SVNA 1KS2A 2VH2A 2IOQA 2P6PA 2CZCA 2JEOA 4N40A 4PBCA 1AD2A 3AG6A 3S2IA 1O58A 3H8WA 1XZNA 2DLDA 2F8SA 1L4YA 2Z08A 3NP9A 3QXJA 4C22A 4UHDA 1T4MA 1R6TA 1O5TA 4V1CI 4QUHA 1FXSA 2CL5A 1BXZA 1HZZC 4UBJA 4O4HF 1BDHA 2AFHE 4JEMA 2ZRKA 2ZT6A 4AD8A 3TFQA 3D8HA 1NVGA 4YRQA 5BV7A 1PR1A 1Z39A 4UM8B 4DQ0A 1ZHOA 5IJXA 1V1JA 3HDQA 3QU2A 1QQ5A 2GXSA 4OM7A 3LCVB 3R2JA 4TV8F 4TL6A 3C4QA 5BMVA 4DV4B 3BM5A 1LZLA 3IVXA 4ZI7F 1QGUA 3RYFB 1N5IA 1N33B 1B15A 1TYBE 2CXSA 2XQKA 3NP7A 5DEOA 4I8IA 3T8YA 4H77A 2HA2A 4QASA 2H0RA 5DLPA 4RD6A 2UYHA 3EIXA 4C5BA 1AN0A 3B38A 4CMAA 1C3JA 4D98A 2O2DA 2W48A 2WTNA 1QIDA 1UFQA 4G5HA 5L3QB 3GPCA 5FTWA 4RL4A 3FYUC 2O1EA 4Q3CA 4PXYA 3EGDB 4ZOEA 4ZKEA 3JCZA 3K5PA 2X0JA 1JDBC 4ASUD 3ABIA 4XWAA 1IEWA 2NSYA 3KSRA 1IQUA 4TTJA 3B1YA 3EZNA 3R9XB 3PU6A 3N1UA 2IYRA 2Z3VA 1Q74A 1Y7TA 4JC4A 1P61B 4JLUA 5CFMA 4I1PA 2BFWA 2CVQA 1WSBA 1SU4A 2D54A 2PX6A 1KI3A 4J1TA 4P5EA 4PEVA 3AY7A 2GKSA 4K6KA 2H2AA 4OB6A 4OU5A 1QK4A 2QNBA 4YRPA 4M7RA 3CONA 1TQ4A 1QV7A 1ZMTA 1II8B 3ESCA 1SRRA 2I4TA 4KDFA 5HK8A 3UWKA 1IXRC 3WNDA 5K03A 2W4QA 4LIPD 1CJBA 2FLWA 4AZWA 1K2WA 2VTDA 2C29D 1NC1A 2OCLA 3L7JA 1UM8A 2WSSD 2QLNA 4NE2A 3REOA 3F7NA 2OL4A 1KYWA 5SZHB 4OJYA 4R2IA 1QHHA 2V8OA 3GDGA 1O96B 1OWNA 1ZNZA 3Q15C 4RVFA 3SPXA 5BYBA 4UKDA 2BONA 1TJ4A 5B37A 5CB0A 1XCLA 4CIYA 3E9ZA 5ITZB 2XKKA 3C5CA 3HDGA 1XEFA 3OVMA 3R6DA 4EZIA 2UKDA 3L18A 2JLWA 3BAFA 3GK3A 3HY6A 3U1VA 4CDGA 5FWXB 2E9SA 1RZRD 4GLWA 1I1KA 1SD2A 4RKWA 4Z3KA 3OZIA 3K6SA 4HNRA 4L6CA 3ASUA 4BBAA 3G0HA 2J45A 4YJ2B 3F6RA 4TLLB 1KMHB 2BF7A 2C8VA 2V45A 2X0IA 3ZDXB 4QXOA 3OLZA 4PZAA 3DHWC 1Y37A 5HA5A 5B1HA 5DP1A 4MK4A 3ZWDA 1PF7E 2J07A 2WKQA 5F1OA 2Y0DA 4RE6A 2B7BA 1FSGA 2CXNA 1XZQA 2QRVB 3AHIA 5ITVA 5EHQA 2BEJA 3SJUA 5KNBH 3VVBA 3OJLA 5I7SA 3CW2A 3OE1A 3G8CA 4G0WA 3O2QB 1YOVA 2FX3A 5FWNA 1UWVA 4FEEA 3NLLA 3VNAA 2GEJA 2OZKA 4YREA 3FCAA 4A0FA 4ENSA 1N1DA 1UT8A 4GF5A 5DHSA 3REQA 1ESCA 1KBZA 1P4RA 4RNDB 3LSYA 4EKIA 1LS1A 3I6BA 2WHRA 5B4TA 1HDYA 4TLEA 4GWGA 4WFQA 3NMUF 5I47A 4YO8A 5K0EA 3LQ1A 4QTUB 5EE5B 2VQSA 4M87A 1JFLA 4P54A 4AM8A 3L8CA 4GECA 4BMZA 1U3VA 1AKUA 1TUIA 4M83A 3SC6A 3H9CA 3VHLB 1PBTA 2PA3A 2ZSFA 3BB1A 5IN5A 5I5TA 4Q9HA 5ADHA 2CDAA 1XMIA 3A7DA 1T3TA 1OXBB 1YVRA 3KPJA 2WP0A 2YHIB 3F5FA 2B1QA 3O8DA 4FLEA 4MW0A 4RM2A 1TECE 4ZOLA 3M9WA 5BNFA 4DHWA 4EL5A 2ONYA 2AA3A 4E3ZA 1U63A 4QUDA 2EHDA 3VH1A 1JDTA 1YDMA 2INGX 3CF4A 3GRRA 4TLCA 2FDRA 3AEKB 2NYUA 4FBLA 1RYFA 4RTPA 4PU0A 2FVYA 4EG0A 3HVHA 3IEXA 4F7WA 3V7YA 3V8VA 3AYZB 4G36A 5J2TF 1UMCB 4EKDA 3QNWA 3IBTA 1FLNA 3LVFO 4CF4A 5HYVA 3HKEA 4RZIA 4MGYR 2LKCA 3B2QA 1GGEA 3IPAA 4WCFA 5FNZA 2NU8B 1FDWA 3I0NA 3JAWA 4ND8B 2FH5B 1PIWA 2F17A 4BGIA 4CQMD 1YFJA 4DLVA 3O8RA 4RGBA 1YWGO 3FI0A 3TQOA 4G5QA 5AUQA 5IM4A 4G0ZA 1U2ZA 2H6EA 2XB6A 4GT1A 2WG2A 4ZN6A 1T5DX 2GPTA 3PQ5A 2ZUFA 3KIPA 4H0NA 4RSRA 3OQBA 1YJAA 2OLEA 1XMPA 5B36A 2ZIZA 4OUDA 2ORWA 2PZLA 3E27A 4WLVA 4DRZA 1C9YA 3P0HA 4EPVA 2AE2A 1J0XO 4LDJA 5K0FA 2IBTA 1Z5UA 3STVA 4BY9E 2BHTA 4WFIA 1MFPA 5I5VA 3HXTA 3BSWA 2C99A 3SGLA 2ACWA 2ZE8A 1R2QA 4A6XA 3ZIDA 1PYDA 3KOXA 1ZG3A 1XCJA 5CDTA 1WDMA 3DTTA 2O2ZA 3CKMA 4D9MA 6REQA 3GQBB 5E6SB 3JZMA 1MMFB 2BM8A 1BVYF 3ESAA 3K9QO 1V95A 3KKOA 4AO7A 4DCSA 1BDIA 2CLHB 4NMHA 4JUIA 1N3BA 1QCDA 2VG8A 3TOVA 2ZP1A 1WSAA 3BFXA 4YXWD 3BKXA 1A8HA 2QTWB 4RPGA 1CR2A 3TMAA 3WJAA 4FGWA 2CF5A 4ESEA 1XMXA 4QGHA 1B8NA 4YVFA 4Y9DA 4RENA 1CUAA 3BMNB 1KETA 2RHBA 2J9GA 4WY5A 4ETWA 4KMOA 5KS2A 2ZTUA 2ZRBA 3K4QA 1OI2A 3LK6A 4YRAA 2BSQA 5EIHA 3NWPA 4CF7A 4PRKA 1DV1A 2G1KA 1SN7A 3AXTA 5HNEA 1SCAA 4YRGA 3CZ4A 4U9IS 1DC4A 3KV1A 4RVCA 1ECCA 4ZYZA 1CYEA 4NYMR 2RH4A 2PG3A 5EVJA 4RTSA 1UANA 2MINA 4I3GA 1PGOA 1UZMA 3O82A 3SQOA 4OQYA 2J5QA 3ZGOA 4HTFA 1OHHD 3C15C 1ISPA 1YBHA 4IIJA 3O92A 2QNRA 3RHFA 4M0FA 1YV9A 2VP2A 4TRNA 1MC5A 3IXQA 4ZHSA 4B3SB 3WNCA 5CH5A 3ZGZA 3OA0A 3AM5A 2RGBA 2HMVA 2P9TA 2C2WA 3PTLA 3TF5A 1YR3A 2ZZNA 3H0KA 5I01A 3SK0A 4DV2B 1REQB 2WMOB 4IDAA 4D8XA 4LPKA 2H4ZA 1GTL1 1A7JA 3HT5A 2EJUA 3VSEA 1HYHA 3I8XA 1ENOA 3H84A 3W8DA 3FDJA 5B58C 1VECA 2IYYA 1Q0UA 4F45A 4MV5A 1R27A 4XYMA 4L2IA 2YJ6A 4N48A 1RJGA 4LMPA 2CNDA 4AMYA 2EZ4A 4N5IX 4X20B 5FPOA 2H1WA 2CJPA 3KELA 3VYWA 5C8ZA 2ZAOA 4C78A 4X1YB 4GH5A 3KLPX 3FWHA 1PNTA 2ZI6A 3OX3A 3R3XA 4CKWA 2BH9A 1IM8A 1ZGBA 3A2KA 1QOZA 3LSTA 3HDJA 4GKBA 3T7AA 1JLHA 4B2LA 3A31A 1X7YB 4I0WB 1I3OA 1KDRA 3OUUA 4AMVA 4ZGBA 4OK5A 1WCIA 2RHMA 2AKYA 1FTNA 3V46A 3SQMA 1CX9B 1CEYA 2RHRA 3L43A 1MCZA 2PKEA 1XQVA 2C5LA 3EAGA 2OXCA 2K5UA 3Q9NA 4DV5B 4RLFA 2EQBA 1SHLA 5E4FA 3F2IA 2X5NA 3GIWA 1DXOA 4PLFA 2DQ4A 4AN4A 3QQMA 2E4XA 1EX1A 2PJZA 2Q49A 3HYNA 3R75A 4IV0A 1GXSB 2LCFA 1CRWG 1G9SA 2NX2A 2OMKA 4E08A 4BGDA 2EOAA 1KMQA 3G9UA 4O33A 4AJHA 5FBQB 4AZ3A 1R64A 3VKUA 4HRVA 4NE9A 4GPTA 2JGLA 3F1KA 4CLXA 3BTOA 2GM4A 3KQPA 1VPLA 1GR0A 4M9XA 1XRSB 4CIBA 2FWAA 3OQIA 4NS1A 4UREA 3E70C 1VI2A 1G5PA 2VJMB 4EX7A 1THMA 2J5KA 4ECEA 1BMFD 3REFA 4EYEA 1QYCA 1ISGA 4CL8A 2NTYC 3LPLA 1GLGA 3UAYA 1EFKA 1T2EA 4E1AA 3COWA 4C14A 2ASVA 3ZQ6A 3GEBA 2ZB4A 1EZZA 3CT6A 3ONVA 2B94A 3JQ8B 2FPXA 5HOQA 3B6IA 4UU7A 2H4XA 2R1UA 1OIWA 3OHPA 4NEGA 5ISMA 4KRYA 4LHXA 2CEAA 2VHCA 3L0IB 1ECFA 3IOYA 1M34B 3QWUA 4NQZA 3KALA 2FUEA 4GSYA 4M46A 3BD6A 1ZN7A 4K2AA 2BEVB 1PGJA 4QDZA 2FA9A 2FRDA 4KJXA 2B2NA 3LM8A 3O84A 3CH6A 2HD4A 5C9ZA 4LF7B 4X3CA 3H19A 5IFKA 2VPQA 3AOEA 5SZKB 3H4IA 1SG6A 4KQ1A 5AM5A 3TSCA 3F46A 4BU1A 4DNOA 3WMFA 4F1KA 1QIFA 1KC1A 3G5MA 1JKIA 3N86A 3G7NA 3MT8A 4IXWA 4DMHA 4CNBA 3NW9A 5TXGA 3AFOA 2YL2A 5F73A 1BMTA 5K3FA 4RA6B 3AW9A 3H5LA 1XPUA 2BI7A 1YJQA 3HYRA 4WZBB 3C3DA 5CHEA 1JFRA 1U7ZA 1WXEA 1YB5A 3SVZA 2MYUA 1MJNA 3JASB 5I7WA 1XJ5A 2NQ8A 2OP0A 4CMBA 3KUXA 4M6WB 1W87A 4YECA 1QRAA 4I46A 2Z9BA 4LDAA 2X9VA 5BQPA 3TKAA 4A2QA 5CITA 2IE0A 2AF3C 2W0MA 2OLKA 1GPUA 3ZLUA 1TCUA 2W2LD 4F4FA 4NJMA 4TL7A 4WZAA 2JIZD 4ZZ2A 1ZRNA 2WSLA 2WI8A 3F9CA 3KDSE 4WINA 4B9AA 1YO6A 1YS7A 2X1MA 3IP3A 3FKJA 1KL7A 1CJCA 3HCAA 4I14A 2BEKA 2IKQA 3D3WA 1KEWA 2VT7A 4FGJA 5COQA 3EPLA 3ONDA 1QHFA 4OLAA 2X5OA 1THGA 1U1FA 5EINA 3ZV5A 1PNOA 3V4FA 2Q1XA 3U7GA 1P74A 1N5KA 1W73A 1VCMA 3VPAA 4B74A 5C4IA 4TTRA 3S1SA 1T35A 3WA7A 3VPCA 1UC4B 3O1HB 3AT1A 3BEOA 2ZUBA 3O4VA 4WFKA 5C80A 5I9NA 5BR1A 3RKUA 1JHZA 5FPKA 2QZJA 1G21E 4JNKA 3AEUB 4BV3A 2L2QA 1O9GA 1EAYA 4DA7A 4LY6A 1P5RA 2OORC 4NFHA 4A0RA 2QSJA 2F9MA 1M5UA 1DRKA 1XNJA 5AKGA 1BX1A 1EZ4A 4WPGA 5J5CA 1L5LA 3KZCA 1QX4A 2R4TA 4IRMA 4CMEA 3LKDA 1KJZA 2VLIA 2HRZA 3QPAA 5EJ2A 3DDHA 3FLEA 1FFBA 2CFSA 5D3QA 3ZW9A 3WS7A 4UXIA 2P8SA 4M0KA 1YS1X 3GG2A 1MZPA 1Z08A 1KTVA 5LZ5A 2QX7A 4RKYA 3U4GA 4H60A 2V6BA 3SZMA 5THQA 5JARA 2CSXA 1AA9A 3UH1A 2H63A 3UK6A 5UKDA 1XA4A 3W6PA 1TB4A 3EY4A 2F3SA 1GAEO 2C4VA 2VP9A 2I3AA 3OT4A 1GTRA 1KO1A 1S2GA 4WBNA 4PO9A 2FWJA 4XYLA 4QYTA 1K3FA 2B2XA 2XD9A 3CO5A 2QRGA 3HZOA 5MGNA 1P45A 4M54A 3GQBA 2PNFA 4RQUA 5AFSA 3UATA 2ACVA 1WEHA 3H5VA 4H35A 2XITA 4MRRA 3HWWA 1ZL0A 2CFMA 4YLGA 3SEZA 1RABA 3USZA 1PFKA 2OP1A 4QDXA 4PICA 5AI4A 4BEVA 1IATA 1SPXA 3E7PA 5LZ2A 3DLTA 3A10A 4MUFA 2E37A 3ILVA 2N47A 4UTZA 3DHNA 2ZVDA 2I5PO 1NMZA 1UXOA 4CM7A 2IS2A 4W7IA 2VSYA 5IJ9B 2OLSA 3PC6A 4EGCB 4MQ4A 3NV9A 3WWEA 4XJTA 4PZ7A 5J5AA 1IY2A 1H69A 3MWDA 2FKAA 4R9RA 3RJ5A 3IH5A 3MUNA 2JAQA 4BVJA 2ZM6B 2UUPA 3JYQA 3GUZA 5DM1A 4BASA 2C42A 5E3JA 4MARA 1U0BB 3ETDA 3MAJA 2XPCA 4HRYA 3VMMA 2ZBVA 4D3YA 3K09A 2PS9A 4ZQGA 1SUPA 1PZFA 3U60B 3C5EA 2IODA 4D9FA 1V3UA 2H48A 4TN5A 1X9GA 1WUYA 2AF4C 3CNHA 4WZZA 5I9TA 5DFAA 4MEJA 3QJ5A 2TMDA 4L5AA 4ITRC 3NPMA 2PKYX 3ZR4B 5C4MA 1H9BA 2RAPA 4OFXA 3H2ZA 3V2IA 3OMLA 1XP8A 3CNEA 4UUNA 1TK3A 1A0GA 4HGNA 2D00A 4N0MA 1L7QA 4URYR 1KPGA 2R6GA 3W2HA 1PLKA 4P7GA 3FGNA 1EFRD 2A4MA 3L7IA 2ZBQA 3IQHX 4GM0A 3BGWA 3RIGA 3QITA 1LLFA 2C2KA 5AKJA 2RFLA 3TSAA 1JT9A 1YQXA 2WWFA 3X3HA 5FBZA 2Q99A 1GTVA 1VKOA 1Y63A 2Q0HA 4KXNA 4KQMA 4XFDA 1P0PA 2QRNA 2P0EA 4DSZA 2X8JB 3RS2A 4EY7A 3ECAA 3CB4A 1G7TA 2XTJA 3FTNA 5LXTA 3NORA 3NVMB 2BZ0A 1NVUQ 2C04A 5J5VA 1QAQA 3KYCA 4NKRA 3JWIA 1XOIA 4HX9A 4YDRA 3ZE1B 1CZUA 5JCOC 2VAXA 5C1OA 4RK5A 4V03A 1M2GA 3CSUA 3OZDA 2WW8A 2GCNA 4OJMX 4DR4B 1E1KA 2AC2A 1LKZA 2ICAA 2WAMA 4JI7B 1H6BA 4ZEVA 1KJIA 2GESA 4OHRA 5EUBA 2BGTA 5HF9A 4GWKA 3GL9A 4HGQA 1KDTA 4RJTA 2Z95A 4GZ5A 2XT6A 2FW6A 2I2WA 1A1SA 4JGIA 2NZ8A 4M8LA 3HB5X 3DOCA 4TTAA 4EUSA 3G8AA 3F71A 1GGFA 2W2TA 5JXWA 3B6ZA 2QM0A 2WAXA 1WKBA 4JB2A 4KN8A 1S5PA 1XVUA 4GQBA 5ETJA 5FYDA 4C29A 1VLLA 2Z5LA 5AJWA 1HDZA 2FPGA 1ZINA 1XLTA 2CXRA 1N1GA 2IXEA 1ID1A 1ZMXA 2H07A 2WU1A 4LXIA 1F20A 1JVSA 1RKBA 4GPIB 3PFCA 4YTEA 5H82A 2XUFA 3HO1A 5F2NA 1KF0A 4Y2RA 1SUAA 1GA4A 3R0JA 1EK1A 2HA3A 4KFTA 1E92A 4WXYB 3W9SA 2QP3A 1CR6A 4RVHA 3QWBA 2O5CA 4L73A 3TZHA 4MZXA 4QPJC 2XAUA 3AMVA 1XA3A 3LRTA 3PUVA 3W90A 2VVTA 2AR7A 3IYLW 3FYUB 4JL8A 4WW0A 1NYLA 3WGMA 2HHFB 3AEQB 4O5OA 4HX2A 3JQ7B 2IIBA 3ZWAA 5IRCD 1X15A 3ZHUA 4BDTA 1GUZA 4PCLA 3E8XA 1TQ8A 4Q15A 1JDSA 3SXJA 4CCSA 4EA9A 3FCXA 4J1SA 1J1UA 4OLBA 3RHSA 2F1HA 5DK4A 2IXBA 2JGEA 4ZK2A 5BR7A 1X8LA 1C7IA 1CNEA 4M1ZA 4MYTA 4DJEC 2Z1DA 3CXRA 4YJ3B 3Q3EA 4FYPA 2W58A 1X6VA 1LW6E 5AK5A 1NOJA 2I0FA 2H3EA 2VSNA 3G5TA 2JBAA 1C0KA 5F1YA 1XTRA 5FUQA 2PBZA 1QVRA 1E6WA 1YJXA 2ZT8A 4QU8A 4R2WA 5SYMA 2B21A 1KY3A 3T1YB 2XA9A 1NU6A 1PW7A 3CGWA 1N6PA 3OWHA 2OO3A 4C01A