4IIJF

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
384
structure length
258
Chain Sequence
b'MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSSEPGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLAPTSIFIKLHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 56
structure length 258
sequence length 384
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4iijF02
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iijF01
3QFFA 5CAEB 4MV8A 2R7LA 3JRWA 5C8YF 4HQ6A 4EGJA 5EZYF 4IHJF 5HBRB 4FFLA 2IP4A 4HR7A 5GONF 4FGRA 1JLLB 5CA0F 2OLSA 4FFRA 1CS0A 5BPHA 5FNVF 3VPCA 4MAMA 2YS7A 2ZDGA 3U55A 3VOTA 1KJQA 4O7LA 3DF7A 3LWBA 1PX2A 2NUAB 1GSHA 1EYZA 4FE2A 1DIKA 1Z2NX 3G8DA 4O7VA 1AUVA 1GLVA 2CNVA 3HB9A 3JRXA 4MA5A 3E5NA 3N6RA 2DIKA 4O2AF 3ETJA 4MV6A 5J2TF 2HGSA 5H80A 1KJ9A 5JQGF 3ORRA 5DMXA 4O4LF 3R5HA 1M0TA 4IZOA 2R82A 2C00A 1JDEA 3K5IA 3OUUA 1IOWA 2W6MA 4ME6A 1DV1A 5BMVF 3U9SA 3R9RA 4O7TA 2X0SA 2NU9B 3G8CA 5J2UF 1B6SA 2YYAA 3TIGA 3SE7A 4O7SA 1VBHA 3KAKA 2YZGA 1C30A 2Z04A 4O81A 3R5FA 1GGOA 4C5BA 1AUXA 1JKJB 4WBNF 5LXTF 2V58A 2DWCA 5BPFA 4FFOA 2PVPA 2GQSA 3JZIA 1W96A 5IYZF 5LP6F 1JDBB 5KKNB 2NU7B 4O7ZA 1KC7A 4FU0A 4YAJB 3BG5A 3Q1KA 4YJ3F 4O2BF 4YAKB 3K3PA 4C5CA 4FFNA 1EUDB 4DLKA 3KREA 3VMMA 4TUYF 4XYLB 2W6OA 2R84A 5CA1F 2PN1A 2YZNA 4IIJF 1Z2PX 2YZLA 1CQIB 4O4JF 2XCLA 1KJ8A 3I12A 4ZI7F 3JZFA 5D8DA 2YRXA 4EGQA 4QSHA 4TV9F 2VPQA 4RZQA 3RFCA 3WO0A 2I8CA 4MA0A 4HNTA 2DLNA 3UFXB 1KUTA 3GLKA 4O82A 5JQWA 4XYMB 3V4ZA 5C1PA 4Y8VB 4TV8F 3VPBA 1A48A 4E4TA 2GLTA 4I50F 1C3OA 1VBGA 2WYOA 3WO1A 4FFMA 1T36A 5JVLA 2FPGB 1Z2OX 3AX6A 1M0WA 3TW6A 3TQTA 2YRWA 4ZQIA 2W6ZA 4FFPA 4O83A 4O4IF 3RV4A 3VA7A 1KEEA 2W6QA 4L1KA 1WR2A 4O4HF 5HV6A 4MV7A 4MV4A 3R5XA 3K5HA 3LP8A 1KJIA 4YBZB 5LYJF 1DV2A 2R87A 1EUCB 1BXRA 1E4EA 4ZOLF 2DZDA 4ZHQF 1EZ1A 1SCUB 1KBLA 1B6RA 4MV1A 1PK8A 4XZ3B 2NU8B 2CNUA 3RUPA 4MV3A 1GSAA 1EHIA 1A9XA 3HBLA 1CE8A 4O86A 4YB8B 2R85A 2CNQA 4MV9A 3TIIA 3MWDA 1W93A 2R86A 3WNZA 2VR1A 2R7KA 4C5AA 3RV3A 4O7NA 2NU6B 2YZMA 2R7NA 4HNVA 4YJ2F 4I55F 1OBGA 3R23A 2ZDHA 3V4SA 2FB9A 1ULZA 2SCUB 2GQRA 2V5AA 2HJWA 5JH7F 3KAJA 2GPSA 4O7WA 2GPWA 2YS6A 4XX0B 4DIMA 1KJJA 4M9UA 2J9GA 2V59A 3TINA 4EG0A 2CZGA 1I7NA 1M6VA 4HNUA 1E4EB 2R7MA 3KALA 2W6PA 2P0AA 2YWVA 4O7RA 2QF7A 2W70A 2FPIB 3NUAA 2YW2A 2W71A 5LA6F 3ETHA 5CB4F 2YL2A 3Q2OA 1IOVA 1GSOA 3MJFA 1VKZA 2I80A 2Z02A 2ZDQA 2VQDA 1OBDA 3HO8A 5C1OA 1BNCA 3AW8A 5JVDF 3U54A 1CQJB 2XD4A 3GIDA 2W6NA 2I87A 2PBZA 3OUZA 4NYEA 3U9TA 5LOVF 1I7LA 3MWEA 2QK4A 2FPPB 4I4TF 5KX5F 3N8DA 4O84A 4O7YA 3ORQA 2FP4B
chains in the Genus database with same CATH superfamily
5KOJB 4AQYB 5CAEB 3F9CA 3MCAA 5AVSA 3VPSA 4CKEB 2RH9B 1XTBA 4HV4A 3RSZA 3HXOA 1NDQA 1K2VN 4ILEA 3ZCRA 2G72A 3E03A 3QG5A 5DIFA 2ZM5A 1NLFA 2F48A 3RRZA 3UW1A 3RVRA 2O8EB 3FLAA 2RGYA 1QYXA 3K0HA 3BMOA 4I9NA 3K5PA 1JT9A 1L7VC 1U0HC 3ICEA 1PJ3A 1T3SA 5JMTA 2IPNA 4YRZA 2V0GA 4BC0A 4D0SA 1GLGA 5JISA 3IGFA 4RCZA 2QSYA 5IUKC 3AIMA 3OMWA 4FBMA 4PZ0A 3RJZA 4J43A 1QRRA 1YD7A 3JYNA 1ESMA 3QXSA 1ZCFA 3M4NA 2ZR7A 4UHJA 3QX9A 2P68A 5LZ9A 2DFKB 3WWDA 3COJA 2IS2A 4DCTA 2YJ5A 2ZJFA 3FZEA 2W6ID 4M1OA 5DNVA 1MT3A 2R3SA 3QV1A 3U55A 4ZC8A 5A0TA 1TCBA 1XXHA 3H16A 2XNCA 4P34A 2BGMA 3G9ZA 4M9XA 4MUGA 2XMSA 2FEKA 1OKKD 3C98A 4HAXA 3RLFA 1R9NA 2O0MA 3E22A 4PSDA 1TZMA 4Y1EA 4B7ZA 3GB8B 2PGDA 4Z1MD 4XGIA 1NRJB 1OAAA 1U0NA 3H1BA 4NK5A 2OP0A 4B3DA 3PCXA 1YU9A 1YJXA 5ADVA 2NM0A 3FCCA 4MUEA 4W1SA 4XIGS 2AR0A 2NTEA 1M33A 1NFFA 1UBLS 2O5EA 1J00A 1P0IA 1LDMA 2GHRA 2NNLD 4FHGA 2WYIA 3LK6A 1RKQA 4N3BA 4TWZA 2HGXA 3KQMA 2HSWA 1P3JA 4OBEA 3SEAA 2FV8A 3VM6A 5DYYA 2H4XA 5BYBA 1KETA 1XWIA 3RAJA 2Q6LA 5AW9A 1UMDB 3MNFA 3WK5A 5JADA 1KQFA 3LFTA 4NWIA 4TZ0A 1T34A 1ZN7A 1TAQA 2GYYA 2VNKA 2Y1OA 4MWSA 4NQRA 4F11A 1Z0FA 3KEFA 3S70A 7AT1A 4FMDF 1LCIA 1W0KD 2AVDA 2HRCA 1CULC 3HKDA 1DJMA 3NJRA 1ZGCA 3DEYX 3OX2A 3O31A 3PDWA 3PT9A 5GOTA 5BV2P 4DGQA 3WQHA 3VYSB 1KJ9A 4UM7A 3WLFA 1I3MA 2BEWA 1W25A 4Z99A 1KYWA 3W2HA 3NWEA 1WW2A 3K6RA 4EEQA 3DDSA 3I73A 1RAGA 2XMQA 1I4OA 3H13A 4HLUA 4RK4A 1U0OC 5E6RB 1OFTA 3GGCA 4OHFA 5TIIA 2YXBA 1GCIA 2FR8A 3MOSA 4GKAA 4JBXA 1YJBA 3URKA 1FFXA 1OFVA 5CR9A 4PO3X 1DAGA 1LDYA 2R8OA 6YASA 1RJDA 2WVGA 2R96A 3F3MA 4L72A 3BXHA 4ME6A 1NYTA 1QV6A 4NS1A 4TSFA 3RSOA 4AECA 4A6EA 1NVTA 4E11A 1VI6A 4ZEXA 3AVYA 5ISMA 3O1HB 221PA 4G89A 3RLIA 5FJIA 4B6SA 1NSYA 3ZJ4A 2VWGA 3VI3B 4GLOA 2A0YA 1OFGA 2XIJA 3AEXA 1J49A 4RPGA 2Y4OA 2I67A 5DLYA 1P5FA 1OBFO 1GA1A 3W3AH 3T7SA 2X8JA 1UJ2A 2I3BA 2P1DA 2PUTA 3LUFA 1WR8A 5FFNA 5A9TA 4AUEA 3Q8LA 1UDRA 1FSGA 3SE7A 1SOAA 4R2IA 2XBUA 4HXEB 5EMJA 3ROTA 1Q7TA 1W88B 4KN8A 2EHDA 3AERB 4L7VA 3K8QA 2EL7A 3I2JA 4OGGA 5F78A 4ZVNA 3N1UA 3BK2A 4R1SA 3VSAA 4LKOA 3EXG2 2IHNA 5I5XA 5HCUA 4NG4A 3B1KA 1GR0A 2PL1A 2CXOA 5I9MA 2A35A 1U31A 3C45A 3UGKA 2OYRA 4N6OA 4EZBA 5IFKA 3FTPA 2I1QA 2OQRA 1SXJE 4R9VA 1PP4A 1LTHR 1CYEA 5IVDA 4ZT4A 5K05A 1H22A 1A2BA 1H0RA 4GX1A 3SYTA 4ZOQI 3UXEA 3ZE0B 1BC5A 3UKOA 4CCWA 4HHEA 2ZZKA 3QBJA 4P93A 5DDIP 1XTKA 3JVEA 5JY6A 1CJTC 2ABWA 4H6VA 2ID7A 1QH8B 3B20A 3MT7A 4IUYA 5K4AA 4WFJA 3JQ8A 3NZEA 5EJ4A 4EMUA 2I4TA 3CR3C 3OE7A 1H5QA 2PVSA 2PD3A 2X7JA 2YHUA 4PXAA 5AKYA 1WEHA 1FJXA 3M6VA 3T5GA 4F21A 1RHMA 3GJ0A 2IV2X 4CE6A 1HDYA 3AINA 1RWPA 2C4NA 4ENUA 1I94B 4KFCA 4W5OA 1O57A 3D6UA 4YTEA 1DWUA 3F2IA 4YAJB 4Z4CA 5F4ZA 1SXHA 1ZK1A 5CT5A 4D4MA 1VLMA 4GEKA 1E1MA 1UBKS 2HA4A 4EUHA 4FZ3A 4YT5A 2X7XA 2PMWB 5AYVA 4BP9A 2FI1A 2XMRA 4RYDA 1E9FA 3ZVMA 7MHTA 2R8YA 3ZG6A 5FBVB 4EUSA 1SN7A 1V8PA 2JFNA 9LDBA 1ULBA 4M76B 4PAMA 1DBVO 4GQAA 3K9QO 1NOJA 3D3QA 4Y2UA 5BOSA 5DX0A 3ZCVA 1ZGBA 3HZOA 1YRWA 4JX9A 4G5HA 3BIFA 4CMIA 4FHEA 4MS4B 3JQFA 1QFSA 4MI6A 1HEIA 1Y4DE 4LHEA 2LWIA 5T4EA 1NN5A 3W5JA 4KR2A 1ZLYA 3CX6A 3QBTA 4PZ9A 3OKFA 1U5AA 2NSJA 1SO8A 2VT7A 2X2EA 1YH3A 4YASA 1VSBA 1MX1A 4ZC1A 1KJ8A 2MJLA 1A9OA 1JGTA 3MTBA 3WWOA 4HX9A 1FX1A 2I9KA 2OLKA 3A7EA 3GIWA 2HBRA 3VR6H 1M1XB 1NWCA 5HEKA 2Q8PA 5LUAA 4HAWA 1UJBA 2O20A 2OGSA 3MMNA 4M55A 4Q1CA 5EPUA 2OO3A 1JG7A 3EVGA 2CUKA 1Y1LA 3GGGA 4QYMA 1HG0A 5ALOA 1G9XA 3TY5A 3O1LA 5JJ5A 5KNDD 3LLSA 4EY5A 2FEXA 5JD4A 5KDOA 4MA0A 1Z35A 3W2IA 1JHPA 4NP6A 1Z7BA 4G37A 4M1EA 1HQKA 1NN3A 2J3KA 3G0IA 1TU4A 4C6HA 4HDNA 5K0GA 2VHVA 2WSSA 4Q3KA 3UFXB 2XY4A 1E4OA 2W2PA 1PR9A 2WJ3A 4LYJA 4JI1B 3RR2A 4YIHA 3A2KA 1BVHA 2Y92A 3RC7A 2YXDA 3HJGA 3DMGA 3WNVA 2VDPB 5C53B 1GR1A 1TA4A 4U7PB 4NI5A 2PKXA 1KY2A 2C5BA 4MLZA 2PM8A 3NHBA 4OSPA 3C43A 4YT4A 1Z56C 1LPAB 1T4DA 4MR7B 4DCCA 1UH5A 4MITA 4CV1A 3FDZA 2JCBA 2ODTX 3CIOA 4LYFA 3DVQX 2EX1A 2BJWA 5IDXA 4G5SA 2A5JA 4YRSA 3PJDA 4V1CB 1YZUA 3FPKA 4WXMA 1PBTA 1PU2A 4F7WA 1KMCA 2WWGA 3W6ZA 2P9CA 1JIJA 5ICFA 5IJAA 1SUSA 2Z2JA 4FB4A 1I6MA 3ZIUA 3A2NA 1CFZA 2AKAB 2ZAYA 2EGUA 3C3WA 4MGYR 4RVHA 5G0WA 3THSA 4ER0A 5FI5A 1CZLA 4A8TA 3TW4A 4ARUA 1NXXA 3MWGA 4CMKA 2UXBB 1FFEA 2DE0X 1ZNQO 2A9JA 5IYZB 3F3SA 1F2DA 1HY3A 4UARA 2OXIA 2H9IA 2VPWA 2YHSA 3RM3A 3L0OA 4X65B 3HXTA 4F5ZA 2V9PA 2BR3A 4FDUA 4CT4B 4ZAYA 4XKJA 2DH5A 1ZU5A 1J2EA 2P5UA 2Z1MA 4TL7A 4RGQA 1CKMA 1SU4A 4M98A 5DI3A 2W6QA 3GPLA 4OHRA 5CPFA 4Z53A 1QQ6A 4PTLA 3LDFA 4EFBA 4R8VA 2LNDA 1TJYA 4C43A 3X2EA 4PGMA 2IS4A 5TGTA 4B76A 4CM9D 3IMCA 2ZJ6A 4J8PA 3D6HA 1BA3A 2ADOA 2D1FA 4WLUA 3AB3A 1N3IA 1E18A 2AYYA 2HTFA 2FLWA 2RC6A 3FNHA 3UMGA 4OMUA 1H1LA 2QX9A 3D6JA 2HUPA 1CJSA 1DIOB 2RONA 4M1SA 1ZC3A 3WIVA 3JD0A 3RS3A 5KOHB 4ZQFA 4GL2A 2I0FA 3GLVA 4JOSA 3E3LA 5LU8A 1G8YA 1XF9A 1A97A 1QE0A 1ULUA 1DAPA 1YBFA 4LPKA 1ONNA 1F1JA 1X7ZA 4HH1A 5I60A 1ZQ1A 1E2EA 2GBPA 3CNEA 4WDRA 3W1EA 6PFKA 1ETUA 4FZ5A 4ZHQF 2QRMA 4Z7QB 1EP2B 1Z47A 1NXVA 1POXA 1RNLA 2AL7A 1IQUA 4NCNA 1WBBA 1HYQA 1OA0A 5ILOA 5COBA 2W2MA 1ZJZA 3LUPA 3SQLA 1YE3A 3IHKA 5JNRA 1QM5A 2Q6OA 5FULA 1FTNA 3GFPA 1MO2A 3QF7A 3RRJA 1YQDA 3AF1A 1FMLA 3BOSA 4CFSA 4CQMB 3KOWA 3VC1A 4GNKA 4QULA 4QASA 5IM5A 1Z8DA 3QSYA 2JLQA 1Y4SA 3BGVA 2QQEA 1RZ3A 1XJCA 3H9BA 3P9YA 4KE9A 1SOVA 2Q4EA 4OB6A 1IN7A 2AG5A 2C5FA 3E05A 4CVNA 5IW8A 1Q12A 4MMXB 3TKYA 1AKEA 4GWGA 2QTAA 1KGSA 4UZEA 3IKVA 5JZVA 4N47A 3T95A 3M9XA 1TVKB 1YXMA 4OFWA 3REGA 2PT6A 4PYQA 2R85A 3HO1A 4YP5A 1E5XA 1FJ2A 2VYCA 3QY0A 4Y2TA 3L4BA 3EMDA 3H5NA 4GMGA 2ZZNA 5KYXA 4RQBA 1J0XO 1GDTA 3BFKA 1CQJA 3U17A 1HTBA 1F2UA 2DC1A 2R7KA 1AOXA 4RCYA 4BNKA 1KU0A 3AY7A 1J0AA 2HBZA 2B7CA 2VF2A 1L5LA 3E5HA 4QTZA 4BKPA 2PIDA 4RCVA 3VU1A 1CUGA 1DIGA 4C6SA 1X1CA 2IE8A 3BZWA 4H7PA 2B78A 3NRCA 3F78A 1UPXA 2IDJA 1THZA 3VU9A 1HC7A 1UZUA 2V7GA 3FGZA 5G0VA 3SZOA 5HKOA 1XP5A 3BREA 1J56A 3TF5A 3W8FA 5DM70 4LF5B 4FS8A 4N3GA 1S1MA 2W4MA 4MPTA 1ULTA 2IHBA 1TYCA 3U16A 2VL7A 4BFUA 2YWDA 1P8JA 1TLTA 3CUWA 4M60A 2CLKB 3I8SA 4KIUA 2FP4A 4AZVA 3ZHSA 3CT4A 2BKLA 3NKVA 4MHSA 4ALNA 1M1YA 4IHKA 4KTVE 3LMKA 2XD9A 3G23A 3MMSA 4PYRA 2OYSA 2FQYA 2VH2A 2QN8A 2XA2A 4MVJP 1CD5A 5L3QB 2ECKA 2V74B 4E5YA 1SQ5A 3MJRA 4D9NA 3IHTA 5TPZD 1K75A 1GGMA 1YV9A 2HQBA 3M3PA 1SUWA 3ZGLA 3PA8A 2WPNA 3FCXA 4MDFA 4LH7A 1BJRE 2XT9A 5IS2A 1AO0A 3WB9A 1SXPA 3I62A 1M3SA 3GPDG 1C7JA 3DM5A 4LZWA 4HZUA 3B1JA 4KW7A 3T41A 1ZL2A 1ZMTA 3DOUA 2DBRA 3DBOB 4G2TA 4HQLA 4Y1GA 2WKSA 2AQHA 1R0LA 2WTNA 3QVSA 5MN5A 1A9ZA 1G2QA 2H17A 3LYAA 3OCCA 1RLJA 3SS7X 1USKA 4K40A 2W70A 1JHMA 2P65A 2ENWA 1GRQA 2CXNA 2QTHA 4J0EA 3VTKA 2PQ2A 1L5WA 3OH8A 2GEBA 4QICA 3BH7A 3LBAA 2A86A 1QNLA 3F6YA 5FWAA 4BO6A 4GI3A 4H4CA 5AQEA 4G1MB 1E5TA 2EFDB 3AR6A 4MQEB 4O1MA 1YB7A 1MB3A 3ZVKA 5FLKA 1O95D 5KTTA 3ND5A 3OMXA 2Y3IA 3FPGA 1CJVC 4MQFB 1Z07A 2IEZA 5T6BA 4MQ6A 4ESOA 3FUCA 4KRGA 4BMSA 2Q1YA 1ZNZA 4QUDA 2I80A 1ZJ6A 3DB2A 1LLQA 5LIPA 4PPNA 1UC9A 4Q66C 4UKDA 1X7WA 4XGQA 3T5CA 3VR3D 4HGNA 4QGAA 2QTNA 2GASA 2ZSIA 4RFLA 4WN9A 1RYFA 4MPPA 1PR0A 2AX3A 3NEAA 3Q7IA 1PG5A 4AX8A 3HHPA 2H7VA 5JDCA 2Z1NA 1NJ1A 3PXCX 2CJWB 3AUTA 4GZLA 4YNBA 3HBNA 3I64A 3IE2A 2AWOA 4C4TA 3GMIA 1RXEA 1WETA 1JDBC 5KYTA 1FYFA 2JCYA 1N2IA 1DB3A 3KVNA 2IITA 4U2FA 3OM0A 4K81B 2J45A 4MIKA 3C5CA 2R1TB 1M5UA 4CEIB 1K7EB 4R84A 1G98A 2IEYA 2QYOA 2WUFA 4LOAA 4TT8A 3WIBA 4NMHA 1CDDA 5AIAA 2VYNA 2WIKA 3ISJA 1VG1A 3LXMA 4FE3A 1BMDA 4JWTA 3RWMB 1Z25A 3TGLA 1TCCA 2VSQA 3EGIA 3HU2A 4YJGA 1NT2A 1X9HA 3KLBA 5LKAA 1BN7A 2LCIA 5JNWA 1VPVA 1RI5A 2RMKA 1LTKA 5ALVA 5KNCD 4F72A 1ZSNA 1M5RA 1TL7C 3KUKA 3L1JA 1OYVA 3CU5A 4H35A 1QONA 4HGPA 4DY4A 4DRXB 1S3GA 3GZNB 1GV0A 1R10A 2RGNA 3I8OA 4QXRA 5F7JA 3UJ7A 4QQNA 1FQKA 1EK5A 1UKBA 3A05A 3K8YA 3NIWA 2H9AA 3K0EA 4COOA 2WZCA 2I6QA 3EBLA 1VDMA 1JQKA 2NUPB 3SQOA 4J4TA 1ZK3A 3S2GA 1JAXA 2Q99A 3PR2B 5JSQA 1NP3A 2XF2A 1PTJA 4YJHB 5TDHA 4BUCA 1G8SA 1G7CA 1NR7A 1J2JA 4ARSA 1UKCA 2DECA 3R9XA 2LR0A 2AD5A 3GOQA 4KDCA 2GEKA 2RHJA 4W5QA 3O4RA 4YCBA 3TRJA 2W7TA 4HDQB 1YVEI 2Q1WA 1ECGA 2J3LA 2FSGA 3NTOA 1DUVG 2I6SA 3G8AA 5DCWA 2J0QA 3IDZA 2X42A 3V42A 3PICA 1MZVA 2XVAA 4ETIA 3D4PA 1Y8RB 1YBVA 1D4FA 4EJSB 2WJVA 3CHYA 3FUUA 3V1LA 4QAJA 3IV9A 3SHVA 3P1JA 4QUKA 5AHOA 1AGNA 3H8SA 4GPBA 1W4AA 4O7LA 1CVIA 3QI7A 2Q9AA 1U9IA 2JFZA 3OZFA 3VJKA 4FHZA 2RE8A 5H02A 4ZREA 1OAOA 2WVHA 2XUKA 2YXEA 3WKEA 3MJCA 1M8JA 1ZUHA 2ES4A 1G9SA 1Q0SA 3LY9A 5JALA 4CG2A 1JI3A 1CZUA 4C76A 3MINA 1HXHA 4BXOA 3KT0A 4FE2A 3TR0A 2FU5C 4PZ6A 1VKJA 3B8HA 1R0CA 4DIBA 4RANA 1Q0PA 1DJPA 3ELDA 4UU1A 5HJEA 4BVAA 4N5LA 5CVEA 4HMQA 4BS9A 2CNVA 1LA2A 3RVDA 1LFAA 1R6DA 2M32A 3KM0A 4BU0A 1MC8A 1I3NA 4DW8A 2XV1A 3PGMA 4LQ4A 4RKEA 1V1JA 5BSGA 1DJLA 1NIPA 1UCFA 1J1IA 1H1TA 1ZOOA 1ZS9A 2WD7A 3FR8A 3O38A 3E7PA 3PQ7A 4MV6A 3ESYA 3H5WA 3JATA 1I2LA 4JT9A 9GPBA 4B8ZA 1TGYA 1XYGA 3EXEA 4GI5A 4HX2A 2H1RA 2OFWA 1XROA 4Z9BA 3ZS9A 3G49A 6ABPA 1VCMA 3KZNA 3CPJB 4US0R 3TCKA 3TLMA 4QEKA 3ET4A 1Y7PA 2OPBA 4DC9A 3THYA 2C5AA 1IK6A 1AKUA 2QEQA 3GUVA 3PSAA 2IELA 1XK6A 3QSGA 4JBGA 5KX5B 4ZT2A 1ZUNA 1ZUIA 2OV8A 2FDXA 2FN8A 1E2KA 5BN5A 1ESNA 4XIIA 1PJCA 1DT5A 1Q83A 2H3HA 3ILXA 2VQSA 2EWWA 2WAYA 3DTVB 3P9QA 4HNSA 1PYGA 3C74A 1UXIA 4K9OA 3KZOA 1B6TA 1EFLA 1T3TA 1J99A 1S0UA 1QG0A 2XUJA 3ESXA 3ILHA 4JSYA 3LVRE 4N49A 4PS0A 1D2MA 4EECA 3QWIA 4IF4A 4EVRA 2JFFA 3K0FB 3KVOA 1TM1E 3CUEF 2OQIA 3RUEA 5BMVA 3R9XB 3DBRB 2F6RA 5GJVC 4Q1FA 5LP6B 6ADHA 3KOOA 1UZMA 5K8CA 4C4YA 4R1NA 2CFSA 1S68A 2RHCA 3TEMA 3P27A 4IS3A 3W34A 3EMKA 1LC0A 4NKRA 1U8AA 1FTYA 3O1IC 1SHTX 4JITA 3M4JA 2EYQA 4RD0A 4BLQA 3LLMA 2OC4A 1EDOA 1T0PA 1HURA 5EJ2A 4MMYB 4OGFA 421PA 3AEUB 4C3UA 2W43A 1TZJA 2C59A 5HIJA 3PXXA 2VHYA 3Q8MA 5GONB 2QQFA 1JLMA 4X1KA 3ZLBA 4B74A 4TZKA 5CA0B 4OLHA 3GROA 4RSMA 3CO5A 1ZONA 3DAHA 3AZQA 5JECA 3TG2A 2C2ZA 1G2OA 1DEXA 3AP1A 3BJZA 4N01A 4PX3A 1NJSA 1KOJA 2AMLA 3OJCA 3Q40A 4RZIA 4Z86A 1GGOA 5K6RA 5T41A 4Q1DA 1Z88A 2ZYSA 4WE3A 1NW8A 3AL0C 4WL0A 1DQSA 4KO8A 4EVIA 1JHUA 1YDWA 2X86A 4YGXB 1FJGB 2JEZA 3V1NA 4DSAA 5A6VA 1X1QA 4O02B 4KR7A 2O7NA 1GPMA 3E1KA 1A95A 2ZRBA 4HB4A 3TLGB 4D1YA 4KP7A 5IAAA 1ZN9A 3H9UA 1GZDA 1HK7A 1W96A 2FFQA 2VZ8A 4X3OA 5F51A 4BNLA 1XVUA 1KEKA 1TT5A 1GO2A 2UZIR 3R3ZA 4M0JA 1PQUA 1TU0A 3I9OA 4OA8A 4ZTZB 4OJTA 3JQ7B 4ZAGA 4A9AA 4GL4A 4K9KA 3BD9A 2IYEA 4LV5B 3EZYA 3MF4A 4M1WA 1F2TB 4Q01A 3G89A 3V97A 1RCFA 1R6BX 2CDNA 2WRZA 3K8ZA 1NMSA 1PEAA 3L8HA 4TQGA 4AF7A 3TOXA 2KPOA 3CKKA 3OCXA 4EKYA 2Q4OA 2IZ0A 1TXGA 1UP7A 1ZHOA 3GEDA 4Q7KA 2G71A 4NJEB 3N3AC 4B3XA 3VNNA 1Q7EA 2AT1A 3BTOA 3DFKA 4H31A 1PO7A 4PSAA 4RIHA 3QIAA 2V5VA 3TTYA 1KBZA 1UQUA 4E2YA 4DDKA 3EGVA 5JZSA 1V43A 1W4BA 3E6AA 1JILA 3ZTYA 2BEUA 1QO0D 2FA9A 2JIDA 5BSTA 1KXZA 3SI7A 4D80A 3AF0A 4IF6A 4P84A 4E4RA 1W49A 3BGOS 3GBSA 4IOMA 3WMWA 1E6LA 3PL5A 4PVCA 4HVTA 3T3IA 5FA8A 2YZLA 5CR5A 3TQQA 4A2QA 4PG8A 3CEMA 4G5OA 4KFRA 1P0FA 3QX8A 3D6TB 3QE3A 4NXMB 4OHCA 1EWTA 2IHKA 3A6FA 3PX3A 3ZGNA 3D3NA 5ALZA 2AJBA 4IQFA 4K6FA 2QTGA 1SVOA 2Y99A 4ZI7F 1T9KA 1BG6A 3A04A 3T1OA 2QJTA 2PYDA 1DDOA 3F7NA 3TIFA 3UA3A 3AGQA 2QLTA 4XEHA 3EVZA 3EUWA 4JI8B 2CCKA 2GJ8A 1SC9A 4TV9F 2Y8EA 1GPLA 4DQXA 5JIBA 3NM6B 4CTMA 4L5BA 3GUYA 2OG2A 3L1KA 2I8CA 2NV0A 2Y1XA 1U0LA 2ODWA 3PE3A 4E15A 2C8KA 4EPYA 2R5WA 2X7HA 4DQKA 3ZX4A 2H06A 4O4IB 4Q4AA 4N76A 3S24A 3AO0B 4LYDA 3OT5A 4CM4A 1VQ1A 2JFUA 3H8VA 2O2HA 4RYLA 2LDBA 5EESA 3CUKA 5F5NA 1XNRB 1WE2A 5JSZB 1JFSA 2D5AA 1PZMA 4BX9A 1CUAA 1EU1A 3SD7A 3F46A 1TTPB 1JFRA 4NQZA 3T7JA 4A0QA 4DIUA 3Q15C 1BQEA 2RH8A 5C1PA 4X7PA 5HF5A 1K6XA 4PLYA 1NONA 4FI3C 1VMDA 1JQ3A 3PHLA 4YJFB 5D1OA 1LPPA 2EP8A 1Z15A 4KXLA 3RU7A 1O6CA 4KWEA 4RTLA 4YB8A 1XLUA 2W9XA 4CI9A 5LXTB 2MINA 3DFUA 1RI3A 4JT8A 4I50F 4MVJA 4RELA 1E0KA 4UHEA 3BHJA 4QTYA 3WO1A 1M74A 1STOA 1R74A 3GT0A 4K6KA 4C04A 4C20A 1EKVA 3Q7PA 1K97A 5F1PA 2G0TA 1O6ZA 3U31A 4W8GA 4O1IA 1LBHA 3GD5A 2H9YA 3LPCA 2AJDA 2NZ2A 5DRYA 2ESRA 4V38A 3TB6A 3L8GA 2OQVA 1ZXLA 2PTHA 5A9SA 2KW5A 3FMFA 1H8EA 1XHFA 4F2DA 3TQTA 1PT9A 2GB4A 1T29A 1PZFA 1YVUA 3HB5X 2Q8QA 3KWJA 4MZDA 2BHLA 1N25A 3L7JA 1Q0HA 2UKDA 4UDOA 4IDQA 4HTAA 2BW0A 2QN7A 2PUBA 2SCUA 5EUBA 2ZSHA 1E2NA 1BQ3A 4JUAA 4C4RA 2QX6A 3RV4A 3VA7A 1I30A 1JU9A 1NC3A 3TZCA 4BO9A 2NZVG 4XQ0A 5FBZA 3QOXA 4Z3DA 1WR2A 1V95A 2OLEA 4O4HF 3HCAA 1PIWA 4H0NA 4HH0A 4Q34A 5TQ2B 4BATA 4E13A 2J59A 1W7AA 2RGXA 2RGAA 3TW0A 3GAZA 3J7TA 4E2XA 4TKVA 2WSLA 2CEKA 3QFHA 3ZU5A 1USWA 3R5XA 3C8MA 3SZUA 3GCGA 3K5HA 2ZANA 2CXSA 1F0YA 2HLPA 4RD2A 4RU1A 3ZJUA 3OFKA 3HJNA 3LY5A 2BDUA 2LXNA 3M1LA 3JAKB 3R5KA 1EZ4A 4KQ1A 3OC0A 2Q1SA 2ANCA 2PS9A 1W0CA 1FFWA 1V7ZA 2JL1A 1N8TA 3R5JA 1GQ2A 1H9CA 4QDOA 5NLLA 3ETCA 1CF2O 1ZA2A 1MGPA 4JB3A 1JHZA 1Z3CA 1B8NA 4BVJA 1AQ6A 1EZ1A 2ODAA 1GQQA 1ZK0A 2X15A 4H6XA 4IMPA 4D26A 2M6RA 4UUOA 4M7OA 1E79D 1GD1O 2FE1A 2YZKA 3I6ZA 4JJGA 2ZB2A 1H3FA 1P9WA 2VBIA 1CV2A 3K7EA 3U3DA 2ZULA 4CPDA 4BJ6A 2VHQA 5TS2A 4XZ3B 1M2HA 1FTQA 2V5UA 2XECA 1ONBA 3O94A 2JKZA 5THQA 4AIRA 1UC5B 4CG1A 5HKKD 2FG7C 4RL6A 4XCQA 2WY2D 1JV2B 16PKA 4I6EA 1I6WA 3OOEA 2QWXA 5CNIA 1ZA1A 2GM5A 5ENVA 2X8BA 3NANA 3P9ZA 2W2NA 2C3OA 1C3LA 3JR7A 4A23A 1MVOA 5BWNA 3CMMA 5EIAA 4LGVA 3GJRA 3QYJA 3QXHA 3QLUA 3WYGA 5BSWA 2O2CA 3AIIA 3BUSA 4P6VF 4RDCA 3R1IA 1MO4A 1YVDA 2CLIB 3VR0A 4EDHA 3OJ0A 3NALA 3K6SA 2X76A 4XSVA 1R1DA 1JEQA 4ZD6A 4EHLA 3RRYA 1M72A 5E4YA 3PRJA 4QECA 1LB1B 1QO0A 4FGUA 4JIGA 3QE9Y 1N36B 4MRSA 4BZWA 2QAJA 4JDPA 4X24A 4CKYA 1IBMB 1T24A 2C2WA 4D46A 1IHXA 2XWPA 1A9SA 1P1FA 4I1IA 1IZ9A 1I0IA 1JVNA 3EMVA 4L6IA 3QQ5A 2NU6B 3IA7A 3TAXA 1DTSA 3GGOA 2VJOA 3KJIA 3OQIB 4QJ4A 5AOAA 2OFFA 4AT1A 4U7HA 4YJ2F 3BF7A 4TTJA 4TMZA 2VSOA 3LZDA 1WP9A 3M5WA 2FUG1 2RHOA 2HT6A 2X1HA 2DQZA 4MP3A 5KWSA 2VRWA 4MAFA 2ZAGA 2VNSA 1R0RE 2AN9A 2NG1A 4IZHA 4WSOA 3RSFA 4EGCB 2JCXA 1A0GA 1Q20A 3RU3A 1G21B 4DRZA 3UG7A 1LDNA 3G9XA 3BA6A 4E12A 2PDAA 1QLWA 1RAFA 2EJUA 4U8GA 4JJ7A 2XKBA 3FUVA 1AUQA 4AKTA 1L5KA 3QKIA 4YRGA 3IV7A 2PRSA 3AGPA 3KAJA 2GZHA 3M70A 4R3UC 3OZIA 2ZYUX 3FLEA 4UVDA 2OZEA 4MGZR 1EJBA 2YOHA 2PG3A 3PSHA 4ERNA 2F67A 1V16A 2VAXA 3BE6A 4OJYA 4W4TA 3TBKA 4UDXX 1HEUA 4YP9A 2GMWA 1JFTA 1TYZA 4LVOA 3HJBA 5CX1B 4DIMA 1TO1E 5DLQC 1KQPA 5LQSA 5KPJA 2DFNA 4Z3KA 1XVVA 3FY4A 4CM3A 1XU4A 5C3MA 2EBUA 4IEEA 3DBLB 3F6EX 4DVGA 2IYTA 4J76A 2AYZA 4TOIA 1KO4A 1UANA 2O3RA 4ZMSA 2ZU6A 1E66A 1GUYA 4JKOA 5PNTA 4NHEA 4L85A 2HJ9A 4GSYA 1DAAA 3RADC 3O4HA 3DUFB 3SEFA 2CMDA 2YHBA 3P2EA 4DANA 5IWCA 2C8JA 2OC9A 5BXQC 4PXSA 2BHTA 1LFDB 2ZSUA 4UMFA 3OZWA 5JAMA 3VV2A 3PEYA 2WHEA 5I48A 4L0CA 2AFHB 2ASEA 1J22A 2QKYA 3W5DA 1OY1A 5JQGA 1SBZA 1ZR4A 1IONA 2H5EA 3W1GA 1LD3A 1J9EA 4D98A 2VXYA 2ZIXB 1S01A 1DUIA 2TMKA 4L9RA 1NJ8A 1YZTA 2XUDA 4L27A 1C1HA 2V0NA 3ZYZA 4G1UC 2FPLA 3P32A 2QUJA 1PT7A 4JC4A 1DXHA 1I10A 4HYTA 2BT4A 3O93A 1ITZA 4Q4DA 3R6LA 1Z5PA 2WM3A 1YR3A 3AG5A 1XRRA 4AJOA 1GPH1 5DMHA 2UVDA 1TTHA 2A30A 2VJNA 1G8PA 4LUCA 5AJWA 3ZIAA 1RTTA 3H11B 5ERYA 3TW8A 1NMEA 1GZSA 3A6GA 5EJIA 2QJFA 3V7UA 4URVR 2QV7A 3QMWA 6GPBA 1W48A 3AW8A 2YJTD 4RIIA 5JU6A 1L7DA 5EWMA 3IDAA 3IILA 3QU2A 5JVDF 1B42A 2C7VA 2O8FA 4H9GA 4UBLA 1PGOA 3P94A 4FYWA 1L7NA 5FOTA 2CL6X 2OP1A 1E3WA 1VJ1A 3AOEA 5EIHA 4UBKA 2QTCA 1NX9A 2SICE 4HRVA 5EMLA 2Z83A 4ITUA 3VPGA 2HSJA 3EXG1 3PYXA 4C0LA 3OUZA 2VP3A 3T4XA 1AHPA 1YZGA 4YP7A 3TW7A 5LOVF 2HIXA 3I61A 5DBGA 1KY5A 2F7SA 1R64A 2GN8A 2NP7A 1IYEA 2GF9A 2PYIA 1JTEA 4EZIA 3AVXA 2HBYA 4YRCA 3MYRA 3UB4A 3LK7A 1XKQA 2IUEA 3UH1A 2RK4A 1P44A 1PD0A 3B9RA 4YFVA 1WY7A 1OR8A 3GK3A 2G1UA 2QTWB 2O0JA 3SIWA 5CXSA 3SKVA 3VR2A 4D8UA 1CZOA 1T8WA 4OHUA 1W47A 3CLTC 2IKQA 1JR3E 4BAZA 3MOIA 4CXMA 1YFJA 3ESDA 3HDYA 2MYTA 4ER6A 4ND8B 3DE0X 1Y8AA 3HXKA 1IRXA 2PNFA 3E9QA 3HXQA 1KZ1A 1VIYA 1Z74A 3B5JA 2G80A 4OH1A 4CT0A 5K0CA 3P0IA 3R7FA 1UR5A 2BHNA 3QKWA 4TN1A 2H7YA 1QLHA 2UYGA 4FJ0A 4H0CA 1YS1X 2D7DA 3K73O 4GXQA 3PC8C 4TSRA 2D1TA 3HXLA 3WQQA 1CKOA 2J3MA 3MBIA 3MB8A 4WXHA 2IP4A 2PKQO 2Q3EA 1WUTA 3PVZA 2JK1A 1AKRA 1GGKA 3LPNA 4HTFA 5EIFA 2XWBF 5K0FA 4YEDA 4FDTA 2WZBA 2O19A 4NC9A 4S12A 3BMCB 4TMVA 1RRPA 4DJFC 1FYEA 3D3WA 2ZBFA 3D0KA 3GFBA 4H3KB 1P74A 1NA5A 5BN1A 3H18A 4BTEA 3LQYA 1ESDA 2VXCA 1I4DD 1WB5A 3CZCA 3PNMA 1U8FO 4HGYA 5EJAA 5EJEA 1YRAA 2VG8A 2ICAA 3MSXA 4K3VA 3T35A 1WUHS 5E6UA 3KWFA 4CEJA 1DX4A 2R44A 2R2AA 2ODQA 1PX2A 1NMXA 1WO8A 2Z8XA 4RACA 3ZE2B 4LXTA 5KNBH 4LF9B 1SD2A 3A2MA 3IVGA 3BBLA 1UDAA 1E1NA 2H5JA 2RGEA 3WLMA 3OPQA 3WBJA 3BD8A 3Q9SA 4LI3X 2LD4A 2ASVA 2EBHX 4OYYA 5F2NA 1JFFA 3OJXA 2NPOA 1OBHA 4Y98A 5KKAA 3WX0A 1JEYB 2HMTA 3D8NA 5KYUA 3WDMA 1DIKA 1E2BA 4UJ3A 5MN6A 2GFHA 3THWB 2ZIUB 3L8DA 2WU0A 2X9VA 1F6WA 1FSZA 3I1IA 4JGIA 3UJNA 1WU7A 5EIXA 3IE0A 2J9XB 3SSNA 4B4WA 4JI7B 4AY2A 2A5LA 2VYQA 3KTOA 1ZOPA 3N70A 2JARA 2A1HA 4MS1B 1TRHA 4IYRA 4OQDA 4UHCA 3S2SA 3NVDA 4RY2A 1RBYA 4DV6B 2IVZA 2WK1A 5CDGA 2HZBA 1JJIA 1AGYA 2WTAA 3WVNA 3G17A 4MRRA 5EIEA 4PQRA 3FB1A 1X0VA 5DMXA 1H2FA 2B4TO 3C5WP 2HQ1A 3LQ4A 3UMSA 1ICIA 1QP0A 5IC5A 3G0GA 2JAWA 4HAIA 2CWDA 5C5IA 2WU4A 2WYUA 1ZI6A 3ROZA 1IQPA 3JXEA 1NV8A 1DFHA 4EKIA 3B3AA 5HK8A 2C00A 3O95A 5I4CA 1E7SA 4I5FA 3BORA 4Y9SA 4E07A 4OQQA 2FEWB 5C2JB 1QIKA 1SQGA 2IYAA 1PQPA 5LZ7A 1IZYA 1KPHA 1PDWA 4CKCA 1XTJA 2EJVA 3NIFB 2VATA 3BABA 2W2LD 4IL5A 2AG0A 2X4LA 2A7XA 2A33A 2B98A 2BZGA 3GFOA 2ZEJA 3L43A 4IQ8A 5A7FA 2JEOA 1I7QB 4BQRA 1EEXB 3AV0B 4CBVA 3FYUA 1T6YA 4E2FA 4NOMA 3TXXA 5JPCA 5GIPE 4BVLA 1ECPA 5L53A 5JHGB 5J2UF 1ST3A 2NAPA 1F48A 3BMOB 3PC6A 4IG9A 1OHHA 2YWFA 1NR1A 1TB4A 4XD2A 2IZ6A 4Y9RA 4ZCLA 4M0PA 4KEAA 5MHTA 4JA2A 1YQ9A 1Q7GA 2IL1A 3EWNA 3WBKA 4WK2B 1Z0DA 4RHYA 2PZAA 3BDAA 1MU0A 3PXDA 4FBGA 2P4SA 5A71A 2Q4TA 1KQ3A 1F5SA 3EUAA 3OQHA 1XN4A 5DP1A 3BSWA 1QHNA 3LDUA 4ZARA 4BFTA 4FMBB 3K2BA 3GN2A 5DGXA 5E1OA 2DQYA 3QLJA 1J9ZA 1XXHB 3O91A 1U3FA 2YQZA 5KDLA 5M3BA 5C4IA 2FCAA 2JD1A 3RGGA 4UUNA 3WDSA 2B82A 3H6KA 1P1JA 1U94A 2QVYX 1VKHA 2N42A 3E22B 2YWBA 2AW3A 2H63A 3NKLA 4FBLA 4K8RB 2C3MA 4HWPA 1Z37A 3IPLA 4WNCA 5D7BA 2B21A 4D9MA 4C1NA 5LVAA 4QX6A 2GSDA 4HH3C 3K0KA 2C7GA 4P8RA 2WWVD 1X1TA 2B8WA 2AK2A 2EHJA 4QFDA 3GCDA 4UHFA 2WNSA 3NUGA 1Z29A 3DGEC 3HEAA 4CNBA 2NQ8A 3H1EA 4N6GA 2GN6A 5IMSA 2R6CA 5DISC 4K03A 2GLXA 5DX1A 5DW0A 2A0XA 1WUJS 5EZQA 3MS4A 2AF3C 4IOKA 3GCXA 2F3SA 2GYUA 3D02A 1PV2A 3JR3A 1XLVA 1NXWA 1QWOA 1QQTA 3IEPA 4JJ8A 5NULA 4E1AA 3SHWA 3PHGA 4BNVA 2FYTA 5BR8B 2VDWA 3DL7A 2QD1A 2DTDA 2ZUVA 4EG6A 4I8DA 3OPNA 3FOBA 4OK6A 1NC1A 1Z3IX 4QXOA 3AIKA 1NOKA 3B1ZA 2O7VA 3HKDB 4BLPA 5BN3A 1P0CA 5JATA 2PT7A 4G86A 1UMKA 2H59A 3HUUA 4DCJA 2QUZA 4L8FA 2BGJA 2JGIA 4U2BA 3F1LA 4EOGA 2XQFA 2DM6A 4GOXA 2BEWB 3RUFA 3S5UA 4J9VA 2DAPA 4PYNA 3ONNA 3OP4A 4U00A 1XXHE 2D00A 2IQ5A 4KIGA 4UQPA 2F3QA 2IEIA 5IAEA 521PA 4YDRA 1PJ8A 4NARA 2FFAA 3JRNA 3KTFA 3K32A 4JBWA 5AW7A 4EF5A 4L08A 1Z6XA 4P80A 1N2XA 4PQFA 1WZNA 1G42A 1FFXB 3OZGA 3AKZA 2G1PA 4TTSA 1EX7A 3L0CA 4TRMA 3E9RA 2EWMA 3SIPA 3F71A 1A0OA 5IN4A 2YDXA 3X44A 2OCGA 2PVCA 4OXNA 4FZRA 3OF3A 4F1WA 1BFDA 1YL7A 3C4JA 2PFSA 3PD7A 3R6WA 2J7PA 3H7IA 4M38A 3GEMA 4ANFA 4Z4IA 3JZFA 1CT9A 3DKKA 3D81A 3DL0A 2FEOA 3B48A 7YASA 2FTKE 5F64A 3SP1A 3EFEA 2MSEB 3MCWA 1IOLA 4NBNA 1ZZGA 2J30A 4P5EA 2ZWMA 5IUJC 4ND6A 2HLDD 1QUEA 1ZHFA 2O2JA 2X8JB 2XAAA 4L6CA 1BXGA 1S89A 2AE2A 3W3AD 1TW2A 4YH1A 3EXHC 1H0SA 4BNYA 1I1LA 1WCIA 4BVBA 4MROA 4AAYA 5I3ZA 4GSLA 3EDCA 4UMDA 3P2KA 4LBVA 2W58A 2R25B 4N7BA 3ZWVA 2CYBA 3OF5A 4YRLA 1U9CA 3ZBUA 4F5EA 2UYQA 4Q19A 1EX9A 1Z06A 1H2YA 2V98A 1MVLA 4HGQA 5EIWA 1OTYA 2XUPA 2Y67A 4OUDA 3VPBA 3DNPA 5CRIA 1LLUA 4JENA 4ZVPA 4Q39A 5LZ5A 4A8JC 1WPRA 4BBPA 4DABA 5KSOA 4MK4A 3H99A 1RWWA 5ULLA 3Q5DA 3IURA 3E35A 1MHPA 2HU5A 1OXVA 4ZYZA 3Q0TA 2B25A 4FFMA 2PJUA 4IH4A 1E2FA 2UZ0A 3CUSA 3B3FA 3JQ8B 3QENA 2FMTA 3NIBA 4CV2A 3KLMX 3UIEA 2B2CA 3OP1A 4BMYA 4CETA 3QJ5A 1PZNA 4UOQA 1BCSA 1J4AA 2WUGA 1RXCA 1XRPA 2FPRA 1URPA 2H4HA 5FTMA 1NKVA 3KHUA 2FMIA 3RSHA 1L7PA 4C14A 1L7MA 2IWRA 5JAPA 1UZAA 2QZJA 3JWGA 3OBIA 5T4HA 2ZJZA 2WSYB 2VJKA 3G3EA 2W6ZA 4H3SA 4YR7A 1KH1A 3DVLA 3JW8A 2B3DA 5JCJD 2JFBA 4MJLA 1SRRA 3TQOA 3FWZA 3RUCA 3VISA 3WNDA 4AMVA 3BHIA 3R3VA 1SG0A 4HDSA 5CBKA 5JSHA 2WWYA 1X94A 5EXDA 1AG9A 4QUHA 1YMQA 3TL6A 3SFVA 4E5SA 5B3KA 4MDHA 2I9PA 1KZ6A 4I5IA 4I0WB 3DBHA 1FQJA 3EHEA 5IJ0A 4J94A 3CNNA 2VLBA 4MQMA 4DJJA 3SX0A 5BOSB 4MV7A 2I2FA 4NCHA 4DLBA 3VVMA 2AV6A 1ZIOA 4CMIB 1KE2A 3ZHCA 5HG0A 3L4KA 4J1SA 7ADHA 2AUNA 2C92A 3E58A 4MVYA 2CHVA 3TLCA 3HP1A 3FDFA 4PQEA 3I2GA 4X9XA 3AEZA 5BV1A 1R8YA 2MSWA 1KI8A 5IC6A 3MIZA 3LSYA 2HU7A 3I3OA 3G2LA 1C8VB 2LBPA 2X41A 3QE2A 4ZT7A 3MT9A 1QTQA 4BLVA 1MTOA 2AKYA 5K2MA 2OD7A 3R3YA 4ISCA 1DIHA 4NIMA 3JALA 3VR1A 2FAXA 1IUPA 1M2FA 1MJFA 2CFIA 2KM1A 5D87A 4CZ2A 1BJTA 4TM8A 3UYYA 4RK1A 2XZPA 3E8MA 4OI4A 3THOA 5FFMA 2HTEA 2CMHA 4NZ9A 2JLRA 4YAGA 1MAHA 1IHYA 3AVQA 2EFYA 3V8BA 4QDTA 2RGWA 3QLEA 4ZHQA 3IUSA 3IQFA 2YY6A 4WZ6A 4AC9A 1AKQA 2L17A 3G2HA 1NVBA 4P32A 4ROSA 4UD6A 1PK8A 2WWWA 4UVIA 3LH5A 4HDNB 2P40A 3NOVA 2I4NA 1UXJA 4PYOA 4XWAA 3RE1A 3T0FA 3ZK9A 4YBRA 3OQNA 4DV4B 1V41E 5GZ1A 2P2SA 3DAGA 4ZPJA 3VNRA 2TECE 3WTCA 2WF5A 3KJQA 1S9DA 4HWTA 4R2KA 1VBKA 3RVJA 3EQ6A 4TROA 4RHTA 3IT3A 5TMDA 1LWNA 3H1PA 3REQA 2XLCA 2I8LA 3HABA 4MNTA 3ZXYA 3I23A 4MR8A 3RHFA 8OHMA 5KB3A 1UAAA 3DHYA 3L8CA 3FDZB 3SR3A 1VHJA 4N65A 2QRZA 4O86A 1P0PA 2JFXA 1MD9A 5CGZA 1UMCA 4LRSB 4IH9A 1S1CA 5AP9A 3AR5A 3I2YX 5BURA 5JAZA 1L5ZA 1P72A 2X3YA 4M88A 1Z6AA 3SBDA 1C3EA 3P45A 1EKFA 1TDJA 3QA9A 2QNIA 4X44A 4QGGA 4R9NA 1Y7HA 5CD1A 1CY7A 1V7PC 2I99A 5ALUA 3R7SA 4A0HA 1F0PA 4YUWA 3QLVA 1GUFA 4B87A 5G53C 1FYDA 5H68A 2GN2A 4KLZA 4GS5A 1J8DA 2QLBA 4XYBA 1DHTA 3RYTC 1XAIA 3CE6A 3F5SA 2BFCA 4F3CA 3HWX1 1FUEA 4B45A 2WMDA 3W5OA 4UPEA 1ZAKA 2ZDHA 3O92A 3CKYA 5HM6A 5LB4A 4GBGA 4IRUB 4XQCA 4UCSA 2OWOA 3FI9A 3WGVA 2YVAA 2I78A 2WPDD 1XEXA 4D42A 2FJUA 4NBVA 5L6LB 4WNYA 1RPTA 3NAMA 4JFAA 2DRIA 8ATCA 5DI3B 1C4XA 3D7MA 3PQ8A 1P9LA 1GYQA 3JWPA 2HJHA 4YMWA 1NW4A 1CG6A 1EVYA 1QDUA 4IICA 1ZVVA 5DGHA 4HP8A 3F90A 4UCOA 1V47A 1AVTA 2I8AA 4OG2A 2RI1A 4KPFC 1F14A 4YREA 1TTTA 3QVXA 1H1LB 1UBHS 2BZ1A 5DE3A 2AVNA 1ZMBA 5D6NA 5BRNA 1YS6A 3UW3A 5F52A 3L8YA 2BP7A 3NPMA 3UA4A 3V4LA 2W90A 1M2OA 3EHDA 4HFNA 4WOJA 3RTGA 4KMRA 5E8JA 4XWYA 5KVQA 1LNZA 1D9ZA 2VOJA 4GYWA 1VJRA 4WK4B 3S68A 4ES6A 1ZJJA 4PU0A 1X7YA 5DN9A 1HYHA 5F9FA 2BMWA 1X7ZB 2COIA 2HF9A 2QAGC 2BMEA 3D9QX 1XZDA 3PJFA 3NUZA 4NCIA 5EE0A 2IY7A 3ZY6A 4EP1A 3ZWWA 5JNLA 5K8VA 3AM1A 3UMBA 5C8VA 4QOFA 2YWVA 1NW9B 5HUQA 3SZRA 5EQDA 3F8SA 4IAOA 4MLDA 3PFKA 2CXXA 3TTSA 5ENZA 2FPSA 4IJMA 3TY8A 2CBGA 3CLUD 1WB9A 1IXRC 1U0GA 3GMSA 5BY2A 5HWSA 2VH5R 1ZLXA 2QMYA 1C0LA 3ABSB 1U90A 2YL2A 4IIDA 2XZDA 2O0HA 3C5VA 2O23A 1XOIA 4BBJA 5FTLA 4IVNA 3G7UA 4EARA 3A4LA 3CNBA 3DC7A 1VZ3A 2QVZX 4E6EA 3A1FA 3P26A 4V3BA 5JEEA 5E9WA 1LEHA 2O6HA 3TPFA 4B2PA 4GDFA 3B7PA 4QHTA 4ZQEA 3TMYA 1K08A 4W1PA 1N5IA 3D2BA 2LW7A 4YRDA 1OBDA 3HCEA 5TEWA 1NFRA 5B37A 3PKIA 2V8BA 3TNYA 3HO8A 4IQ0A 4D9FA 3ABOB 4O8CA 5CK4A 2X5OA 2ZKLA 5EJMA 5AM0A 2J3HA 2PE5A 3ASYA 5KU1A 5KYXB 4Y6PA 4NCXA 4JEHA 1CQJB 4IMRA 1NI5A 2OV1A 4OFZA 3Q7QA 4DBLE 3VYVA 1F2UB 4LGMA 2H1VA 3LUGA 2X2OA 3ICPA 3LGXA 2OCAA 1EFKA 4L5CA 2FFBA 4Y9DA 4F1KA 4MUJA 2ERYA 1VBMA 3MVEA 2V6GA 4G0UA 3F96A 1M1NA 3LCJA 3NXKA 4MARA 1CUWA 5G3ZA 3JSNA 1OXMA 4RKQA 1XQ6A 3VU9B 4C4AA 1GTG1 2J3DA 4WMLA 2YRFA 1MTZA 4DM7A 5CURA 5DOVA 1CY0A 1JDSA 2DHDA 4H59A 3N8DA 2GCGA 4EG3A 3IIIA 1SHLA 2XYRA 4DOMA 2JK0A 2GZ3A 2C94A 1M34A 3DKIA 3Q88A 4FX5A 3B6EA 3ZOKA 4DV3B 1EDZA 5KAMA 4HKTA 1QIEA 2FP4B 3TOZA 5I7WA 3IQWA 2FRDC 2YMMA 4GR4A 4IO1A 2HVSA 3DE1X 1M1YB 3QP9A 2PU7A 3HMKA 3QWFA 1Q92A 3GDFA 4QU8A 5T3YA 1A8UA 4MWBA 3V3TA 5FTWA 3WGQA 2WD8A 4JS0A 3WL3A 2FY8A 2I5PO 2DKFA 3R5SA 5C8YF 2NZJA 4EGJA 3B6ZA 3FZNA 1SCDA 5JWOA 3WK8A 3CEBA 4RWZA 1UADA 3LT1A 3O9ZA 4FLEA 3SC2A 1XTPA 1CNFA 1DC8A 1P61B 4HZUB 4JI5B 2I22A 4JEMA 3ZHBA 4JUIA 4A6PA 4AZ0A 4F46A 1GITA 5ESWA 5C31A 4XPIA 2VHXA 3ES9A 5BRJA 1YI1A 4S1VA 3FSJX 4RGBA 4A5OA 4CWAA 5CDFE 1E8DA 3EDRA 2G0AA 1T5SA 1QOZA 2WKQA 3WK6A 5BPHA 3QELA 4JQYA 4EEKA 5EQJB 2RG7A 3QM1A 4H7EA 4JUFA 1GXSA 2O2EA 2L2QA 2YIVX 3JQQA 3MS7A 3VYRB 1SEVA 1XVLA 1VL5A 3KR0A 3TRDA 1T1GA 1WABA 1ISFA 3MA0A 4P7FA 4DCPA 1JKJA 2WU8A 4YONB 4YGYA 4BVGA 2X3FA 4QNRA 1RJEA 4ILKA 1YFZA 3N7TA 2I54A 2WG2A 4G4IA 3VFDA 3PLRA 4MIOA 2RCYA 3T7EA 4C3OB 1U8ZA 4MYTA 5CIWA 3SZ3A 1G4UR 2QN6A 3IKLA 4OAOA 5JMOA 1Y1RA 3DUWA 3GLQA 1KO1A 1X7WB 2OMKA 2HXGA 4YRTA 1YZFA 4WN9B 4MTCA 5IANA 3MD0A 1GARA 2P9HA 1KH3A 1JHAA 2GM3A 4CC5A 1XVTA 3H87A 3KXDA 1W46A 3ND8A 2JJ2D 5MF6A 1YZKA 1H4QA 1OZAA 3GA7A 1EBUA 1RFLA 3RBZA 1RAEA 1UBOS 3HN7A 3O4IA 1N5JA 4HNAA 3ZBPA 1N0UA 1NF2A 3KZMA 3T5DA 4GZ5A 3AOGA 2XCIA 3I1JA 3K15A 4R31A 2Q9UA 4XB1A 4NESA 1U2PA 2VSFA 3TRIA 3ICQB 3R0ZA 4ZZ3A 2AXNA 2NACA 4MUXA 1HDXA 1ZWKA 4PSCA 1SVIA 1T4CA 2EGHA 4Q7MB 5KS8A 2VWQA 1T5LA 4Q93A 5J2TF 5K6AA 2HGSA 5LZ8A 2W0MA 3AHIA 4KAAA 5CDYA 4NK4A 1E6UA 5CDSA 1YZLA 3MERA 1G9TA 1RM0A 3PV0A 1YAJA 1GTL1 5HNKA 1G3QA 2A0UA 1NG1A 1W1UA 4QVGA 4YJGB 4A7PA 4BTLA 2P0YA 3KXIA 1WMEA 4QDZA 4O4LF 4ZVOA 3ZJTA 4KLAA 4NF2A 2UVPA 4EA6A 4DRFA 1JDEA 3O8DA 3A4YA 4OFBA 1KKUA 2G88A 1SOUA 1E9DA 1QHSA 1IJFA 3LO8A 1F8GA 3DEIA 1R4NA 3D0OA 5EERA 2PMCA 3RSLA 1QR6A 2OCBA 2PH5A 4AG6A 1P5HA 1IPFA 1SEPA 4PX9A 3ZVRA 1ZR2A 1VCHA 1VP9A 2W93A 4EEXA 3BMNA 4D45A 2NV2B 3DZFA 2J08A 5I9LA 1A72A 2FOIA 1G8AA 4WKOA 3ITNA 3OT1A 1HTTA 3QXCA 2Q6IA 5DXJA 4QO8A 3WKBA 5COAA 4EYEA 2VNJA 2WSBA 1M6HA 2HM7A 5K0JA 3FJOA 2ON6A 3AI2A 3H2KA 2QGZA 3L7NA 3N2LA 1IPHA 1H9AA 3K9GA 3VRHA 3HN6A 2F1RA 2X1MA 3INRA 1AHIA 1JP7A 4IIUA 1XGKA 3NRBA 3OTGA 1Z2AA 3P9IA 4O7SA 2NTJA 3GJ5A 1OH5A 3ADPA 2NVUA 4NBWA 2O1XA 5I5WA 3DV2A 3STWA 4DEVA 1KAOA 1OASA 1XZAA 4N8EA 5E38A 3SYMA 4BHTA 1QTNA 2XDQA 4V0KA 5ERXA 4E32A 5EZ6B 5REQA 4LOLA 4AF8A 4AURA 5ED4A 1R8SA 2GX6A 4UUAA 3KAKA 1CTQA 2DHQA 3RC8A 2GQ0A 3B5EA 4ZODA 4ZU3A 5JCOC 1PHPA 3L93A 3IH5A 3IUQA 3RVQA 1KEWA 1KRXA 1NBMA 2QY6A 3PLNA 4MMZB 4UOEA 5K0ZA 2YV1A 4P7BA 1NPYA 2I4RA 3D3KA 4V24A 3OQPA 4GPTA 1U1CA 2R6JA 3W78A 2BMJA 1EH5A 2XI4A 3ZV5A 4RHXA 3MINB 1ZD9A 3SJZA 1QIFA 2YMQA 4MVWA 1KWGA 4BXOB 5ICMA 1ZIXA 1C7FA 3LX6A 1UK6A 3SQMA 2DGDA 1BHO1 4D3SA 3ZNOA 1EFRA 2NXCA 2OV4A 3BXXA 3PDIA 4HFRA 3KU4A 3AM5A 3ZDAA 2H16A 3EOBI 4TYWA 2D1YA 2XNSA 3A26A 3CQ9A 2WA1A 3HG7A 3LHKA 1V3TA 1TJ3A 1W4LA 3RK4A 3PUHA 1P7PA 1Q0LA 2XYVA 3K9WA 3B6JA 1YQEA 2OZVA 2LPMA 2W22A 2WD7B 4IJVA 3TM5A 2CVHA 1JH9A 2RHDA 3AVUA 4W82A 1V3VA 3JATB 2FSFA 2IP1A 3KQSA 4KXWA 4RSRA 3EXEB 5AICA 4KGVA 1ATIA 1LK7A 3BFVA 5BNWA 4TLAA 1O94D 3ZWXA 3NKFA 3THYB 5A3JA 1A5ZA 1UDBA 2VHUA 4ACAA 1P0QA 3U19A 1BD4A 4KRXA 1E3JA 1XMQB 2WIDA 1ZUNB 4AUMA 2P2LA 1CF4A 4YLYA 3DZKA 3TNDA 4MQBA 1AK9A 2VYVA 3PYLA 3VBCA 3DZBA 5G4LA 3FBTA 1Q1ZA 2Y2UA 2Q5IA 4ISBA 4JJ6A 4MCJA 4NLLA 4QA9A 1N5MA 3IAHA 4IH1A 4ZCTA 4GGOA 1B8OA 1Z9BA 1HE5A 2FKNA 3K31A 2WF8A 1OD6A 5BQPA 4DAOA 5BMVB 2B69A 5I4IA 1D09A 3ERCA 1ISGA 1WVMA 2J0UA 3BCRA 4CC6A 1BO6A 4ZI7A 4PIPA 1P1IA 1NW6A 2Q3HA 3UMCA 3M1AA 4F86A 2B1RA 3INYA 3CY6A 2ATXA 3WICA 4R05A 3S1LA 3T0GA 1P6XA 3W8EA 1XZLA 2JFQA 4TV9A 5CTJA 1X92A 1E2QA 1ZM4A 3W2EA 4YUAA 1QYWA 1SU7A 1N1GA 3MGGA 4XTRA 1WM1A 1DAFA 2QM8A 4X1KB 1WJGA 4I4IA 1Z4QA 5E7QA 3CC8A 3EGEA 3D7RA 2VP2A 4LWOA 3DMHA 3ZHUA 1GYRA 4D57A 4OHYA 3AESA 1T6BY 3U7GA 3GVHA 1B7GO 2ZS8A 1MA3A 2PRJA 1J39A 3E1GA 4QBFA 1Z5GA 2EVWX 2PX5A 5E2IA 3L6UA 5K01A 3L7MA 3AYXB 3IHLA 1MAAA 3HR8A 2CLFB 4X1YA 5TF0A 3MLEA 3OJLA 2C83A 1CIPA 3NR2A 1G8MA 2M6SA 2J4FA 1P9OA 1V6CA 4HG2A 4AVYA 5ERGB 4DC0A 4NFHA 2YFYA 1J97A 3U81A 3ZPXA 5IJ9A 4PR3A 1E1RD 2CDRA 2GJSA 3IPCA 4I50A 4YRKA 2G77B 1YTUA 1CKEA 1TQ6A 1Y8CA 4EH1A 1DGQA 2XQIA 1TT5B 2AG6A 1KMHA 1KU6A 2FN4A 4QBTA 1L5HA 3WRXA 3QPVA 3VO1A 1N5KA 1W75A 4WZZA 3Q72A 1J8YF 4HDRA 4PGFA 4M9RA 2NVBA 5KTPA 5BYKA 4QXQA 3A6KA 5KYWA 1JAHA 1FRQA 4NBUA 4TLLB 2EJBA 3PIDA 1XWWA 3A36A 4KBYA 3KKPA 1DEHA 3D5TA 5KJ6A 4FDMA 4BZXA 4EAQA 2X8AA 4RE5A 2AQ8A 5JNUA 3H0CA 4I1OA 3AK4A 4E1VA 1D4AA 4MV0A 1KERA 1NP7A 1XDSA 1NP6A 2WVJA 2RHTA 1NVUQ 1FRVA 4JUBA 3RS5A 2A14A 4KITB 3IMEA 2HAEA 3LG2A 1SURA 2ACKA 1IZZA 3MFYA 2BEUB 1QNFA 4M0LA 1NM5A 2FFJA 5DFAA 3L0BA 5LYYA 1KJIA 2OO5C 3II6X 4IHAA 1FZQA 3AB8A 1WLSA 3G5AA 3C8DA 2HWUA 3EGOA 5COQA 2ONJA 5C5CA 3EEIA 2JZCA 3B6IA 4RZSA 4YMHA 2R87A 5E9AA 5A04A 4E5KA 4DV0B 2E82A 3P8ZA 2P3LA 4MB2A 2HWYA 4ENSA 1B2LA 3N2ZB 1X7HA 1HKHA 1H0HA 1H2BA 2YYYA 4R3WA 1A8SA 2ATCA 1CQPA 3KSBC 2QMZA 1J09A 4GOND 4N41A 2QUAA 2VJPA 2X22A 4PM4A 3NDBB 3MCTA 3DMFA 4GVPA 2DPLA 3GVXA 4OCZA 2JLBA 4OMDA 4FK8A 5JE8A 5JOQA 3CRNA 4U7DA 4TXHA 2BFFA 4Y6OA 2CMGA 3WV4A 721PA 5ICCA 3EDYA 4BNDA 4LXGA 3B1XA 4OOFA 4QU9A 5FIUA 1KI1A 1U1GA 1SZCA 5L45A 4I55B 3KD2A 1EJ6A 4UXIA 1WBDA 2V7QA 3I9JA 1JB1A 5HBGA 2MMGA 4GMDA 4M2LA 2IJGX 2G06A 1Z8NA 3OIUA 5HS4A 3TLYA 4Z8YA 4Q4AB 3WYDA 3S1SA 2PL5A 1A77A 1TIPA 1UM8A 2PFGA 4CM4B 4FI3F 4JXKA 3AJ9A 2UYCA 4NDNE 3SN6A 4DCOA 4TL6A 5FX2A 4F2WA 3RYIA 2JGJA 5DV9A 4GSKA 4UXJA 1NU6A 3WHPA 1IXYA 4D6PA 1II0A 1CY6A 2YVKA 2PQMA 3K2EA 4NV1A 1XZBA 2IUUA 3VTZA 5FHRA 1RYMA 4OHWA 4E3WA 1II8A 3PXGA 5D1OB 1F3OA 1EB9A 2G83A 3LZCA 4H2DA 4J3FA 4YB8B 4P3KA 5AR1A 3ADKA 3V8NA 2MINB 5GVSA 5KSYA 2VFAA 3Q3GE 1HL7A 3QHAA 1KF0A 1AXGA 1T5HX 5EXXA 3V7WA 5CCBA 4A10A 4HWGA 3MC1A 1CNMA 4Q48A 1T3GA 1KQNA 4LDPA 4JXZA 3VNBA 3ZWDA 3IKTA 1WUIS 3NBZC 1YQTA 1MDBA 2BMVA 4PHFA 3OCVA 2YNMD 4FT2A 1PJ2A 2BGTA 1FK8A 4O7NA 3CISA 3TD9A 3K0CC 5A9SB 4MUHA 2ZTUA 3IOYA 4RZUA 3TKAA 2J67A 3CH4B 3ZXSA 3FR7A 2V6JA 4MH0R 4YI3A 3V4SA 5K99A 2JNWA 1E69A 2QP4A 4YJ2A 1MA0A 4QU0A 1ANKA 2SCUB 1UXGA 1KFJB 2GPNA 2Q1TA 4JB8A 3WQSB 1YS4A 3OZ7A 4CGZA 3EISA 1C4OA 4JWKA 1GZVA 1H3NA 1Q0RA 2PPLA 3O8QA 1XUOA 3KDAA 4LMBA 3L6OO 2C77A 2XMPA 2C5HA 3C3AA 3IT0A 1OWLA 3KLPX 2J46A 1OJLA 1U4SA 4NV0A 5JWHA 3AF6A 1RM4A 1UK7A 4UDNA 5CVUA 1D6NA 4JSTA 5F3DA 1ZGZA 4IYJA 1C0PA 1U4NA 4TKVB 3QITA 1ZC4A 5EE9A 4KNYA 3G82C 1J06A 2IW3A 4G0OA 5DEOA 2NZUG 2QUHA 1M6YA 1YBMA 3KL4A 1R15A 2QJWA 5EI5A 2WNHA 3TAUA 1SK9A 1KJJA 3KO8A 3TXAA 3VZBA 3CMCO 1GN8A 5DTEA 4L4UA 1C9NA 1H2EA 2O2SA 3I6MA 1UP6A 4MO9A 3UKJA 2YJ4A 1H94A 4OYLA 4AS3A 1WUKS 2K87A 3DGFC 3U9LA 2QRVA 1W94A 1UWVA 3CRQA 3BB3A 3FPLA 5IT5A 1UPFA 2XXJA 3KSZO 1TZBA 4UTOA 1PJRA 2YY5A 3VH2A 4XM0A 5DT9A 2UXCB 1JLLA 4QYIA 1YK1A 1E64A 1N2GA 5BSKA 1X86B 7ABPA 1MC4A 3INGA 4F38A 3M34A 2QX4A 1LRLA 1JG6A 1JJFA 5E2AA 3SGIA 1Y82A 1Y7IA 1K6MA 3DEHA 3AETA 1YQUA 4XSHA 4BP1A 1HL3A 2CKMA 3VKUA 1TQDA 2H31A 3GT3A 2OPHA 2ZFUA 5ALFA 2II6A 4LY9A 2XRZA 1P81A 2IE0A 3GBVA 4ZKEA 3FRIA 4EG1A 1TYAE 1KI6A 2G7ZA 2VWPA 5AVKA 5LB2A 5DHSA 5K45A 3O4VA 5TARA 3DDUA 3RK0A 1USIA 4EBBA 5EIBC 3NM5A 4H27A 3TQRA 4XM2A 3BWDD 3FKSD 2YHIA 2LCFA 3EAFA 3H5TA 5AKGA 3OTIA 3PT5A 4J0IA 4F04A 2BEJA 1DELA 2VQDA 2C82A 4FINA 4DNPA 1K6JA 3MJEA 1XK5A 1YFKA 1OGJA 4XD7A 4A0GA 3BE8A 3ZCUA 4W9NA 5CT4A 2H7XA 4L9AA 5AT1A 1JIXA 3K6SB 1JEQB 2DYKA 1G8KA 5DHRA 3AXTA 3HWWA 6REQA 2VZ0A 4F92B 4YACA 1DQYA 5JVDA 2QLMA 1DVRA 2QZSA 3STHA 3NP7A 3LDGA 4FSDA 4GOMD 4LEIA 3AHCA 1V45E 1EDEA 3QVMA 4DR7B 4KQMA 5F7XA 1U5BA 4JLVA 4LRWA 2YINC 2YFQA 3REFA 2PBFA 4RS4A 5CNJA 1KEZA 3DPSA 3FCUB 2Q5HA 5DF1A 3EEOA 4QPNA 1TJNA 4DDWA 2B2NA 5LOVA 2CDAA 2NZXA 3VZQA 1BKYA 1N77A 1G64A 2IEAA 3NJ8A 3FG9A 5IKEA 3COWA 3H2BA 5E6SA 4YUZA 1SUDA 4DG9A 2VI5A 2XMCA 4Q18A 4C2UA 2SKEA 3R3JA 5AUNB 4R2XA 2Y1KA 4MCHA 2WKPA 2B3TA 1V16B 4OTZA 2ADMA 3M6MD 2I62A 2HGZA 4BQEA 5KWJA 3A32A 1Y1QA 3GX1A 5A05A 5KNLA 3LFHA 1P2DA 3BICA 2WAOA 5G1NA 3T38A 1D6MA 5KQMA 2HFKA 3U44A 2C2MA 1N6OA 5BUCA 4JQSA 3SG0A 5LFAA 1UPBA 1EFDN 3ZNNA 3ADCA 4P58A 4EKEA 3BA8A 1ISPA 4EA8A 1Z39A 1X3LA 1LPNA 2M2IA 5T4FA 5JXWA 2XB4A 5MGNA 1TKBA 3T9DA 5TV2A 2PSFA 2X19A 2HF7A 4FFLA 1YBAA 4EO9A 3FNGA 2UVQA 1SIBE 4WBSA 1U2GC 4GWLA 3W06A 4MQUA 1JDVA 1CEQA 2OLSA 1QO7A 5FLEX 1PLLA 5DXFA 4DLZA 3T5AA 5T8KA 2JLZA 1BMFD 4NOLA 5F9HA 4OAPA 1TM7E 2AFIA 3H7AA 4KSCA 1CXZA 4Y2HA 1C3VA 4NPAA 3RC2A 2IHZA 4C0WA 2YS7A 2DXIA 5JQGB 1JSRA 2O0KA 3OIYA 1AV7A 3ASVA 4J16A 1RZVA 2Q50A 3SHFA 4KDFA 4LJ4A 2ZKIA 1BQ4A 2NZYA 2QIPA 3DLHA 3R4CA 1HQDA 1QOPB 3BRSA 3IOEA 3RVLA 2GVNA 5K2OA 5DYTA 3L6CA 2F43A 3GFRA 3HA3A 3PJEA 1B23P 3A9VA 2JH8A 2WFZA 1WSDA 3MHPA 1PT8A 3PXUA 4KAJA 3VU8A 3JZ6A 3Q3IA 4PFKA 4RXMA 2PH1A 3R0IA 2C4HA 1V2HE 2Y66A 3VR5D 2E48A 5IWAB 1IULA 5I7RA 1S2NA 4BMPB 4C7JA 1JEAA 4BMCA 3CH7A 4JLJA 1GU1A 5EWMB 2HDWA 3CNHA 3HEBA 4C0XA 1I1KA 2GRAA 2V7EA 3OWHA 4INAA 4IV8A 3WLJA 5CG2A 2O8FB 1C7ZA 4HEHA 2EZTA 1Z6PA 2GYVA 3A3PA 3WGTA 3A4VA 2Y1CA 5B4VA 5TQ0A 1E3WB 3U1TA 2O52A 3CJQA 4O2AF 5LP6C 5FLXA 3ADOA 4PPFA 5GZ6A 5P8WA 2EG5A 1CDOA 4RLSA 3I28A 4ZMBA 5H80A 3H3XA 4MPJA 3ZI0A 1Y3HA 4G01B 3ZY2A 1NKSA 1NMYA 1SY7A 1J6UA 1JE1A 2WKWA 5JCZA 2XITA 4DVJA 3TFWA 2XZTA 3R75A 2ZGIA 3O21A 2DPMA 2WVAA 1I6LA 4OHZA 5M04A 2D0OB 5T67A 1RJ9A 1OVMA 2XVYA 1DRVA 1E1LA 2HRQA 3JZMA 4GH5A 4LV6A 3RDPA 2BTOA 4C88A 3B6MA 2ENUA 1WXXA 3EWIA 1XMPA 4TSKA 2A58A 4FCCA 4PRYA 3FHCB 4F9GA 1R9MA 1UJ4A 4I1RA 4MUKA 4ZCIA 4JV5B 1GFIA 3PITA 2Z5LA 1WVIA 3Q1LA 4LDJA 4AJ2A 3WLSA 1RM5A 3FAZA 4DMUB 1RQLA 4ZJPA 2H1OA 1AKWA 1JSLA 4BO1A 2V7XA 3UK7A 2H57A 3LE8A 4CMEC 1R5JA 3DKPA 1C7RA 4KQEA 1H2WA 4E21A 1RW4A 5IXYA 3IVCA 5F21A 3ECAA 4RF4A 3M3HA 4F71A 3IUYA 2BZ0A 4U2GA 2YYAA 1FP4A 2REBA 4P22A 2Z8YM 5J2UA 3A31A 5HP4A 4HTFB 4MKXA 2RKBA 5AHRA 5DWVA 1X8LA 3D3EA 2P78A 2VK8A 2PGJA 4ZFNA 4MVXA 4KNWA 2Q4RA 5EJ5A 1BSVA 2FMXA 3D3WB 2B4QA 4YRRA 2QS9A 2C9ZA 2WYWA 4BKMA 4ZO4A 3SXPA 2VHZA 3T7TA 3HEMA 4EJ6A 4Z54A 1F0NA 4J6FA 3MCVA 4DE5A 1U98A 3IT1A 2P35A 4KG7A 3V5NA 3T1TA 3FTFA 2XQVA 1I4WA 1WXGA 5E6UB 4BN0A 4WBNF 4CEJB 4Y8VA 1FBNA 3CG0A 3F9IA 3KKQA 4LA4A 4I5EA 5GAJA 4A6XA 4DIOA 4PG7A 4YMTA 3OHSX 1I0LA 3U7RA 4ACBA 2XQGA 2VS1A 4BP8A 1O1YA 3FGPA 3N74A 3S55A 1DIRA 1ZITA 3D31A 3G68A 3L5OA 1JFFB 3EJ6A 4B2LA 2CT8A 4P0QB 2JAOA 4Q12A 6CHYA 1KYIA 1MN6A 2P5YA 4JD5A 5E3HA 2EWVA 3EYAA 5KYUB 3ROPA 3UPTA 4C21A 2JB9A 1S2IA 1THTA 5J1SB 3CIFA 3SBOA 1PSDA 4ZOEA 4LWZA 4ARZA 1VE1A 3L8EA 2H1SA 2JZOA 4JYMA 3IIJA 1B73A 1IUNA 4ZOAA 4FU0A 1FFBA 2QZZA 3Q8KA 1VC2A 4K6CA 5D3KA 3TBHA 1E4VA 3UJ9A 4CF3A 1E98A 2Z08A 2IYZA 2PZBA 4IDFA 1VB5A 2CZQA 2PV0A 1J0BA 3F2VA 1G20A 1Y7TA 1E4YA 3OA0A 4FMDB 1YRQA 3LT2A 2GCIA 3TM4A 1MCZA 1WZEA 3AR4A 3IPAA 4J3NA 1DAHA 4JR2A 1AXEA 1U4OA 4IGAA 2VJMA 1MLDA 3DE7X 4O33A 2PO7A 4Q3CA 5LC1A 3CX8A 4BNUA 2GBGA 2IYVA 1U3VA 1IC6A 4LXUA 5E7MA 5FWYA 5L7YA 2MU1A 1U6IA 5BW5A 4YXWA 1PUXA 4ER3A 5ARBA 5LQMA 4YP1A 2JJQA 3EX7C 4K1LA 2J9FA 2Y1WA 3WMXA 1NBOA 3IAAA 1GPUA 1QRSA 1R5NA 4E31A 1RLTA 4EKGA 3RYFA 1P5JA 4TT3A 3A1DA 3LC1O 4N5DA 4UNSA 3FF1A 5C9ZA 5D7NA 4IKPA 2W83A 3KPVA 4J07A 1UXOA 4CKCB 2IBTA 1RPNA 1ECFA 4MJXA 1N7GA 3N7UA 2NIPA 3UQ8A 1JSXA 1RLUA 1AGXA 2ERXA 2OXFA 3L4SO 4YK7A 5DNUA 1Q6ZA 4G8CA 4JQCA 2EZ8A 1VMIA 5FWNA 1AMOA 1OGYA 3FYUB 2QVLA 1ECBA 4RK0A 3BXGA 4WLVA 2YH2A 2IV3A 2BRUC 2O3QA 4GBMA 5DM1A 4DDTA 4NRDA 2N75A 1P1BA 3I0ZA 4W6QA 3ZOZA 3NJ4A 1IY8A 4XQGA 3OLVA 4AZ3A 2CMKA 1L8QA 1NAIA 3MRVA 3VVLA 4DADA 3AVPA 1G291 3FFXA 3PZRA 3W77A 4J0DA 3AFGA 4TTPA 4WKNA 2FWAA 3DSRA 2QM7A 2VYFA 3IX7A 5FOUA 3UXYA 2C4TA 2BGUA 1UF9A 4AIIA 5KREA 1B2RA 4IDHA 2AEMA 1SBTA 4YMIA 5M29A 5AWFC 2CLDX 4Q3LA 3VDMA 4C0JA 1O96A 1V4VA 1WVGA 4EJFA 4RPKA 1R0YA 2BR5A 4MQLA 3CGWA 2ZZMA 3HXMA 4D9HA 2IV7A 4LGCA 2PD6A 5AM1A 2PUWA 4OH7A 2GM4A 4IKEA 5IAGA 2F8TA 2PZJA 4G26A 2HADA 4WESA 1NF3A 4MW2A 4ONEA 2GLTA 4PC6A 1EFPA 4EQZA 1TT7A 3DYBA 4EX7A 5KSWB 1X14A 4MLPA 4F6LA 2IYRA 2RBKA 4DMRA 2OCDA 4DCMA 3CZ5A 2BH2A 3GJQA 1T36A 4D5GA 2WIFA 1X13A 2HHLA 2JGDA 3OLWA 5SV2A 5TR9A 3OQOA 1QFZA 1GPAA 3LUDA 5KO2A 1GFZA 2OORC 3FFBA 3QG1A 5CITA 4RMHA 3M6UA 3IDOA 1GFSA 4DZTA 4R6XA 4AKGA 1VG0B 1EQ2A 3ZWKA 2VXBA 2VDWB 3FPEA 1IB6A 1O9HA 2PL3A 3IKJA 4GE0A 2O0LA 3O47A 1DZ3A 3WFZA 1A88A 4DCSA 1L2TA 3QW2A 2COJA 3ZHRA 4UNRA 4UEOA 5BN3B 3E82A 3Q6MA 1KZ4A 2PZMA 3GA0A 4PAWA 3R7DA 1PGPA 1PR1A 2F90A 2GPAA 1UIMA 4MS3A 1Y42X 2Q1UA 4BX3A 3F5MA 2QRLA 1LDBA 1VHWA 2EQAA 1E62A 1IY2A 1WTAA 1EXNA 4UFOA 3MFQA 5LWQA 4OXYA 4NABA 3UGTA 4UCTA 1A9RA 1N57A 5JJIA 4JN6B 3OTQA 4CL0A 4WX2B 5AVXA 5IZCC 4Z4GA 4BEWA 4MV4A 1VB3A 3RUIA 1CJBA 4IVRA 2M1ZA 3KYCA 1CY8A 1FQOA 1X7XA 3ONEA 4H1VA 2VIIA 2YJ3A 3KR1A 3LYUA 3PWKA 1Y5MA 4FYVA 2R6HA 1O0CA 1OT5A 4U6QA 1E63A 1NX6A 3DQZA 2AI3A 5BNTA 1ECJA 3IMFA 2AEJA 1G19A 3ANLA 2YVUA 4OVKA 2HN9A 5FO0A 1ZGGA 3QXXA 4PCUA 1Q16A 4HS9A 1GEEA 5KTKA 4DL9A 4LZJA 5D5HA 1V6SA 4MXDA 3WNCA 5TXGA 2CXRA 4WZAE 2H2WA 2DZDA 1OA1A 5SYNA 2QL9A 4LJRA 3GR6A 2XB9A 3DD1A 1DMRA 3AHGA 1CR6A 1F7VA 3SQNA 3D54D 1BXGB 1X6VA 2X2PA 3A1TA 4B0PA 4ZGWA 5E25A 1C9MA 4OATA 5IKPA 2VDJA 1U2DC 1GAXA 1SXJA 2UAGA 4EUEA 1JRLA 1XQ9A 4HEQA 4ZK6A 2KJQA 1WCIB 3SMVA 2GA8A 4LC0A 4FX2A 1L7EA 2PH3A 4QGSA 4IDOA 3ZGVA 2VJLA 4A91A 1T43A 2H48A 1V25A 4IIYA 5ED0A 2A92A 3C3MA 2HPAA 1A82A 4LN1A 3VV3A 4JX8A 1RKBA 3HJCA 4GO1A 1GSAA 4PBSA 5IBQA 3BJRA 3FYSA 4C0HA 5LR6A 1KTVA 1GAEO 1A9XA 4IEFB 2J3EA 4OUDB 5CM9C 1UJCA 4BOYA 5CB8A 4HBGA 4N3AA 4JLMA 3U09A 3HB7A 4K0KB 4RAOA 5CDTA 3TIIA 4HNGA 2EQ5A 1FA9A 1W76A 1YB2A 3KUXA 3M5CA 3NNDA 4A6DA 2VDUE 4ALKA 3P2IA 1DXOA 2WYHA 4YMUA 2YVLA 3ZS8A 1FU4A 4WNIA 3TN7A 5EJ7A 3LFUA 1BCSB 1VL0A 2JGFA 3GA5A 3L6DA 3IAFA 3JQBA 4PZYA 3IEKA 1G5RA 3K96A 1Q0QA 2H52A 4OYRA 4DEYA 4HNQA 3OA2A 1SVLA 4LSZA 5GV7A 4ZXFA 1Z17A 3GFFA 3ABZA 5I9SA 2YUTA 1TFUA 2F17A 2G8NA 2WJJA 3CGGA 3AFMA 4JAVC 4KFTA 1K3FA 3IBCA 1JLHA 1M5TA 1YZQA 3V1KA 4M1KA 5EWJA 4HDSB 4C4OA 5FXMA 2GN9A 3HKCA 1Z68A 2NTNA 4DSOA 5DEIA 5JH7F 3H9QA 1E9AA 1KBQA 5ALPA 4D9KA 3DBHB 1M1ZA 2BUCA 3GP3A 3ZCPA 5IJ0B 2TSYB 4INZA 4UFPA 1Z0KA 5JRZA 4WA7A 3RTCA 2C95A 4PBCA 3BWXA 1C1XA 5C1IA 3S6JA 2BFWA 2RKWA 3JSAA 1W85A 2PMDA 3W4KA 4JMLA 5I01A 2EBFX 1TJPB 1NT4A 2JHAA 4C4SA 4D8VA 3QGMA 4MQ5A 1DKPA 2VDQB 4HRYA 1NIJA 3TINA 3NDRA 1WP4A 2YMPA 2HMWA 1GIAA 1T8UA 2C03A 5FL7A 3VR4A 3Q10A 1ZDMA 2B1IA 3GJSA 3F0TA 1JWAB 1PGNA 2V7UA 4Y0AA 4AJ4A 4ZYTA 3JALB 3IKMB 3IQHX 2R6DA 1S8FA 2LKCA 2V4UA 3IO5A 3LQFA 5H70A 3RABA 4EFLA 2JGAA 1JXOA 1HBJA 1T3ZA 3FCOA 1NVWQ 4B7AA 4CM8A 1FL9A 4ER5A 1EVIA 2W2QA 1HFKA 4NMXB 1U0BB 1U0JA 4ZHQB 4ZA2A 2Y71A 1WHSA 1JHOA 3YASA 3K8OE 2QTRA 4P33A 1NPTO 4YMLA 3BWYA 4HB3A 4DUGA 2E4YA 3M81A 1Q1NA 1F1BA 1Q84A 4HAZA 4R2WA 5BNFA 3W7AA 2CUNA 2CNNA 3HZZA 3D2AA 1DG1G 1EDBA 2DPGA 2E0IA 2IXFA 2NTVA 4FDLA 3REQB 2J6HA 1BVRA 1Y5LA 3KDPA 3W1WA 5BV8A 3HDHA 3LD9A 2FKAA 4MR8B 2E7ZA