4IIJF

Crystal structure of tubulin-stathmin-ttl-apo complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
384
structure length
258
Chain Sequence
MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSSEPGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLAPTSIFIKLHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 258
sequence length 384
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03133 TTL Tubulin-tyrosine ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4iijF02
3.40.50.11480 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4iijF01
2YW2A 4WBNF 2GQRA 3R23A 2PVPA 2I87A 5IYZF 1JKJB 1EZ1A 2FPGB 3HBLA 1PK8A 4XYMB 4FFNA 1CQIB 4MV8A 5D8DA 2SCUB 2R7NA 5JQWA 3MWDA 4IIJF 3V4ZA 4O7YA 2YWVA 4EGJA 1KBLA 3N8DA 1IOWA 3HB9A 1CS0A 2VQDA 3ORRA 2ZDQA 1BNCA 5LA6F 4O7SA 1VBHA 3R5HA 5HBRB 1KC7A 3LWBA 2I80A 4C5BA 3K5IA 1SCUB 5J2UF 2GPWA 2Z04A 2R7KA 2YZLA 2DZDA 4RZQA 2FPPB 1KJIA 4IHJF 3ORQA 3HO8A 2YZGA 3V4SA 4O4HF 4I55F 4HQ6A 4MAMA 3U55A 3ETJA 1DV2A 2W6MA 3WO1A 4XX0B 4MV7A 4O81A 5DMXA 2PBZA 3JZFA 2W6QA 2DIKA 3G8DA 3LP8A 3OUZA 2YYAA 2VPQA 4MA0A 4O2AF 4EG0A 2W6NA 5HV6A 1I7NA 1KJQA 4O2BF 2YZNA 3MWEA 4MV6A 3KREA 4FFLA 2ZDHA 2X0SA 2CNVA 5LP6F 1OBDA 3TW6A 4O7VA 3DF7A 2CNUA 1C3OA 2GPSA 3RFCA 3Q1KA 3G8CA 3RUPA 3N6RA 4FFMA 2W6PA 3JRWA 4TV8F 2NU7B 1B6RA 4YJ2F 1Z2PX 4HNUA 4O83A 3JZIA 2P0AA 2ZDGA 1JDBB 2FP4B 3OUUA 1EHIA 3VOTA 4HR7A 1KJJA 2YS7A 5JQGF 5BMVF 1GSAA 1E4EB 4O86A 5GONF 1EYZA 2FB9A 3RV3A 5C1PA 1B6SA 2R84A 4I50F 3QFFA 2YS6A 2R85A 2R7MA 4Y8VB 1GSOA 2OLSA 1I7LA 2Z02A 5C1OA 3TIGA 3TIIA 1GGOA 5KKNB 4FU0A 2R86A 2V58A 3VMMA 4IZOA 1T36A 2HGSA 2DLNA 5CAEB 4O4JF 2PN1A 2FPIB 2W6OA 3R5XA 5C8YF 4O4IF 5LOVF 4ME6A 2V59A 3TQTA 2I8CA 1ULZA 1M0TA 4YAJB 1KJ9A 4QSHA 2W71A 1JDEA 2J9GA 1Z2OX 2XD4A 2DWCA 5LXTF 3ETHA 4C5AA 5H80A 4YJ3F 1OBGA 2CZGA 5CA0F 5LYJF 4EGQA 5JVLA 4FFOA 4XYLB 2YRWA 2QK4A 4M9UA 2R82A 4ZHQF 2HJWA 4I4TF 3VPBA 4MV9A 2VR1A 4O7ZA 4C5CA 1GSHA 4O4LF 1VKZA 4FFRA 5KX5F 4YB8B 1E4EA 4YBZB 1BXRA 1KEEA 4MA5A 1AUVA 3E5NA 3NUAA 4O7NA 4MV1A 2CNQA 4O84A 4ZQIA 2W6ZA 5BPFA 4FFPA 1WR2A 4TV9F 5EZYF 4ZI7F 1W93A 3SE7A 1C30A 2IP4A 3UFXB 4MV3A 3R5FA 4NYEA 1M0WA 1KJ8A 3VPCA 2WYOA 1CE8A 3TINA 4MV4A 1IOVA 3BG5A 5CB4F 3K5HA 2YL2A 4HNVA 3KALA 4YAKB 1A48A 5BPHA 3GIDA 4ZOLF 1KUTA 4L1KA 5FNVF 1DV1A 2V5AA 3WO0A 2GLTA 4XZ3B 3U9TA 2GQSA 1EUDB 2R87A 4DIMA 3I12A 1GLVA 3KAJA 5J2TF 5JVDF 1JLLB 5CA1F 3GLKA 1Z2NX 2R7LA 1AUXA 3R9RA 1CQJB 3VA7A 3WNZA 3K3PA 2NU6B 2YRXA 1PX2A 4DLKA 1EUCB 4O7WA 4TUYF 1M6VA 4HNTA 4O82A 2NUAB 2QF7A 1A9XA 3Q2OA 3JRXA 4FGRA 3U54A 2C00A 4FE2A 2NU8B 1VBGA 1DIKA 5JH7F 3RV4A 4O7RA 4O7LA 2W70A 1W96A 3KAKA 3AX6A 2XCLA 3MJFA 4E4TA 3AW8A 3U9SA 2NU9B 4O7TA 2YZMA
chains in the Genus database with same CATH superfamily
1CU1A 3LVFO 4EJSB 4TKLA 2JRCA 3WMGA 3CF4G 4IH1A 2COEA 3CTMA 2E6KA 3DR5A 3K9BA 2X0EA 1ZONA 2LE0A 3IA2A 3WYAA 1M2OA 2OGSA 4LSZA 5C7YA 1XDNA 4F6CA 1X7YB 1OW3B 2MINA 1EFPA 2V6MA 4F9TA 2W2KB 4CMIA 1C5KA 5CX1A 3HN6A 4MZDA 3UOGA 3N0VA 1JA9A 3WL4A 3SS7X 5HWSA 2WFAA 2B8WA 4G9EA 3QF4B 1EZ1A 1FZQA 1HLPA 3MILA 4GGPA 4UE6A 3AVVA 3X1YA 4JLJA 1ZJ5A 1MVNA 4P9NA 4W1PA 3JWPA 1G8HA 3STHA 4DLTA 1ND6A 1MG0A 2GD6A 3M8KA 4GVXA 5FOWA 3GDFA 1W30A 3NT4A 4OHPA 1CY2A 1HE1C 1MAHA 2W22A 1O6BA 4BE4A 4FFNA 5FHQA 1U7HA 4Q9KA 1L4HA 4MV8A 4L5AA 4D9KA 3QPBA 3VC7A 2IHNA 2WHQA 3S2YA 3DZCA 4J0DA 4RXUA 2C82A 3ZLJA 1D8TA 4L15A 5LZ2A 5HJ7A 2SKCA 4GAEA 1U3FA 4EDHA 2DU8A 2I3AA 1Q1EA 1WUTA 3ILHA 2PGOA 3LGSA 4AYXA 3DFMA 2GH1A 1KI2A 3VR1A 4AKEA 3W5DA 2PT6A 3L6EA 3QX8A 4JUFA 3EUEA 2J3HA 3N2YA 2NZXA 4AX4A 1E79D 1H6CA 1TYDE 2QY9A 1KBLA 2IP1A 1WRVA 5C9ZA 1UWCA 3IB3A 3QVGA 2H0RA 4FEAA 3KDAA 2B8NA 3ORRA 2Q4RA 3ZBUA 1KFBB 3CUYA 3LXRA 2B35A 2GASA 4F06A 3T35A 5T5QA 3ESAA 1APBA 1GAQA 1MAAA 4Z9YA 3SFZA 3ZZ1A 2LCIA 4MR8B 4CEHB 1LBHA 3BE5A 4UOZA 1YDEA 3HRKA 3E9ZA 1LD3A 1MORA 1RJEA 1VI6A 2W8BA 3A3KA 5I7HA 3Q88A 3SBXA 5I9BA 1KNQA 1RHKA 2FPXA 4JLOA 2CL6X 3IT3A 3RADC 1VHJA 3OJWA 4WX2B 3RU7A 4XQ9A 4Z4QA 4QAQA 5BRJA 1NU8A 1RCTE 2YWHA 2NV2B 1Q22A 5JFOA 2G07A 3Q41A 3NHRA 2CLEB 2DAPA 1PCXA 3CA8A 3NOOA 4JBLA 3IMFA 1KJIA 1FK8A 3MVEA 5HKOA 1H65A 2PKEA 3AO0B 5E9QA 4KR0A 5TE9A 4TLAA 4ZZ2A 2O5EA 5AT1A 1T5BA 4EQ5A 2PU5A 2LP4Y 3H4MA 5JH7A 4BJ1A 1IPEA 1L4EA 2JJ1A 1Z34A 4PGAA 4X7RA 3VZSA 1P0MA 3S1LA 4IO1A 2QNRA 3V4SA 2O4CA 4BCCA 4BRSA 3RRYA 1PRYA 4PZLA 4ZTZB 2I2CA 1G4UR 4N0MA 1KYTA 2D1FA 3IUSA 4UATA 1LDYA 4W5HA 1CY7A 1KDTA 3HN2A 2HWKA 4MP3A 5CVJA 1EU1A 3PI6A 1KI6A 1O6FA 2VF5X 5A7HA 1NW9B 3LT2A 4TMYA 3K0EA 1CRLA 5AM5A 3ZGZA 4V0OA 4KWEA 5JD5A 3K6SA 1NLMA 3G5MA 2PUGA 3T5TA 3V1MA 1N5JA 1LEHA 3AMVA 4G56A 2WB2A 4KBGA 2N1BA 1OFVA 2WTAA 4K28A 4NK4A 3GZNB 4KXQA 4E5MA 3P45A 4NCKA 2HCBA 2OILA 1Q0HA 5SYNA 2PTHA 3RIMA 1Z4IA 3BL8A 1XCBA 2YV5A 4FYPA 4PC1A 4WECA 5IYZA 4X44A 4UARA 1W1IA 3L8FA 5FLKA 2JPDA 3BF8A 3HJHA 4R2JA 4AO7A 4FW8A 4XDHA 5L7TA 4YHHB 2ZATA 4ND8A 4V1CB 5LMUB 2BR4A 3LA8A 2M6RA 4U7WA 4WDQA 1I6MA 2G6BA 2PD4A 4BLTA 1VL5A 1Q15A 4UE2A 4UOEA 1F17A 5IH7A 4JZYA 3LCRA 2V97A 4PAGA 4QA9A 3GLGE 4K3VA 5ADHA 1ZM4A 5JS2A 2AFVA 4JGBA 2XT6A 1L5QA 4GX2A 4YP0A 5BWLA 4ZQCB 2C5GA 3DE6X 4UFZA 1ZU4A 1J09A 3GN1A 3NS7A 4LQDA 1KFKB 1SIBE 3EVGA 4KDRA 1KAEA 4ER6A 4Q1BA 5ALVA 3DLHA 3BD9A 1G4HA 4W1RA 3CURA 3GFQA 4DQDA 4EKNB 4GBGA 1XEXA 1I6WA 4XJSA 3RDPA 5C52B 1F3LA 4FT4A 1QIDA 4PX5A 5I45A 5FPOA 5J59A 1HV8A 5BO5A 4AF8A 5JEDA 3DCJA 4MKIA 4HFNA 1RCFA 4LY6A 5SV2A 4ZYZA 3UK7A 3C6BA 2PRZA 1S8OA 1JHVA 4BNKA 1ZK4A 1D6NA 1G8MA 4FFMA 4NCIA 1BCRB 1F3OA 2VSXA 1EFVA 4PPGA 3S55A 2BT4A 3U3DA 2X23A 1B6RA 4YJ2F 5TRTA 2FPSA 3B82A 3RRNA 1RKQA 2GAJA 5B53A 1E2KA 4J90A 5KYNA 3HNOA 1ZNZA 2GK4A 4HDMB 1COWD 3CJRA 1K6EA 4B6JA 3W2HA 1YFZA 3SNOA 1MEJA 3BGDA 5TQ0A 2WJYA 2WSSD 2QTHA 4A0GA 1ZC3A 2ZJ6A 4Z9FA 3PGXA 3OZFA 4WZZA 1NP6A 3FIJA 5JO9A 3REOA 3AVXA 3VR6H 1ZD8A 3A4NA 3L4BC 1RVV1 3K4PA 5A9RA 3NANA 1F8FA 4MVWA 4LGCA 4NQRA 3T3IA 1S2GA 3I61A 3IPRA 3I8OA 4RHXA 1TVKA 1V9SA 4K6HA 3GA0A 4QWWA 5CITA 3LQQA 3O3NB 4HPWA 4CXMA 3I6BA 1V6AA 2BMDA 2ONZA 1FSGA 2ZAYA 1GSAA 4FKZA 3DXZA 4IJVA 4NYJQ 2JKVA 3ZVRA 1NVGA 2FSPA 1UMDB 3NIFB 1A8QA 2JIQA 5DNVA 1ZMOA 1C9JA 3EG9A 2J08A 3M6LA 4PHGA 1BMFA 2I8LA 3ZZTA 5FWYB 4P54A 3ANXA 4EHKA 5DBIA 3JWIA 1C41A 2HA0A 5T4FA 2R1UA 3GB9A 1I01A 4KYVA 1ZGAA 3L4EA 1G2IA 3O73A 3ZQ6A 1PHRA 3VHLB 1G17A 2Z43A 3RVBA 4MWZA 1GFWA 1HKHA 2Q5EA 3QFSA 4DPLA 1P8LA 1QC5B 2IW1A 2OQ2A 3H6GA 3U0BA 1KMNA 4AMVA 3C24A 2V7WA 4P4NA 2JKYA 4DZZA 5EJIA 4L51A 1I4DD 1ZIDA 4O5OA 5EE3A 2WD7B 3NTXA 1B6SA 1ZNQO 3DCNA 3FWNA 3MJSA 4W9NA 4Z3KA 2FZKA 3RW9A 1EJ2A 1JHZA 4BE7B 1GZVA 4O4JB 4IINA 4CLXA 1HL3A 2OHFA 3CUEF 4GW3A 4L5YA 3SZRA 1AQUA 1B42A 2OC4A 2WV9A 1W73A 2Y1XA 4XDGA 2Z02A 1D2NA 3AM3A 4D9MA 1YZNA 2QVXX 3CE9A 5DSTA 3TUIC 3ZCQA 1GTL1 4DCOA 4WL0A 3O4GA 5TS2A 1QHSA 2RGXA 4PSCA 5G40A 3R0IA 2XX3A 5LP6A 1YWGO 2Q2WA 6ABPA 4PG8A 2D1RA 2FW7A 4KFRA 5LMCA 2VJLA 2V58A 3QKRA 1CXZA 3UPTA 1EWKA 2EYQA 5FBZA 3CVWA 4N47A 3D1LA 5AH0A 3U13A 4ZI3A 2J3KA 3H1AA 3ZZUA 3F3YA 8MHTA 1JR3D 1V8OA 1E5QA 4OMCA 5CAEB 2EATA 3K0FB 4X1IA 2O8DA 2X3FA 4M0EA 2V6JA 4L95C 4CG0A 1T9CA 4CFSA 2BEWA 3AJAA 1I4LD 2FTKE 4GZMA 3DHEA 4N41A 3PLAE 1QZUA 2JGEA 3FGNA 2IYXA 3HKBB 1G9TA 1GPWB 2HLHA 2QZSA 4QNMA 5A71A 5IM4F 4MRSA 4TL9A 3SYRA 4X62B 1P8AA 2FQQA 2JLQA 2VRBA 1NBIA 1NWHA 2J9FA 2Z3VA 2CNDA 5CR9A 4YLGA 4OX9Y 3C1UA 3KAPA 4K9LA 4BJ6A 1KJ9A 2GYUA 4LWZA 2BI8A 3S1SA 3UMGA 1JDEA 3NJ4A 4Z7QB 1N34B 3F5QA 1CF4A 4KLNA 5FL3A 1JG4A 1NF2A 2B4QA 2JL1A 3PNYA 5HIKA 3FMOB 1WD7A 4X8MA 1FSFA 2NU9A 2X58A 3FI9A 4RMIA 2AL7A 3CRVA 1L7BA 4UTPA 2DUNA 4YTEA 4J2HA 3EVAA 3U7QB 4CM3A 4UMFA 3BXHA 3Q7SA 1O95C 3T8YA 5LBIA 2CZGA 4OA8A 3ZNPA 3QG5A 4CC6A 1AZTA 3BEDA 5IJ0B 3KQQA 5F2KA 1RRFA 3PQ4A 5HX7A 5EFOA 1IBKB 3L1VA 3NBYB 4CDNA 3GJTA 3GCDA 3STYA 3T5MA 4R1TA 4BVLA 2C2KA 2Q4OA 1W25A 3VRHA 5A03A 4M7WA 4C87A 1HTBA 3ZTWA 1T9BA 2ZITA 3QE4A 4X8OA 1UBUS 5DZSA 4OV6B 3FDZA 4NVRA 4RC9A 4ZHQF 4UHDA 4ZT2A 2RI1A 4HDCA 3KZNA 1I32A 2NVBA 2WZQA 4RDIA 4RQAA 3STTA 2GBIA 3WLTA 5CXUA 1P72A 5DTRA 1VC2A 4DY6A 1V11B 3OLYA 2XR1A 3WLKX 4QASA 3ZV4A 4C5CA 1U1EA 4E5KA 1Z8DA 3NXKA 4P3NA 1S7CA 2H2IA 4PHHA 1YB4A 5L4NA 4NICA 3UCFA 3IQDB 4F0JA 2IBTA 5JPIA 1KIMA 1GGHA 4R9NA 1RZRD 3L7AA 4AB1A 2QRUA 4JGIA 4PYIA 7REQB 1N3BA 4R83A 4DBZA 1SURA 1KK0A 1XNQB 4QU9A 5EXDA 4MQUA 3KPUA 2PMCA 1DINA 5JDIC 4XD2A 1QVRA 4H17A 3FFTA 5I9LA 3E84A 1N3LA 6NULA 5L4SA 1JEOA 3LIIA 1BHO1 1YGPA 4ZC1A 4ZQGA 2DBQA 2CNQA 1I2KA 2IEYA 4HZUB 2GJ8A 3F67A 5BPFA 4WK0B 4OFWA 4QPPA 2FU5C 4WKGA 2SICE 1RJGA 1TB4A 3KQUA 1B8VA 1MABB 5KCZA 4XR4A 2NAFA 3P0JA 4KH0A 5CCBA 4JL8A 4I1IA 4V03A 3V3TA 4LPSA 4GOND 2XRYA 4OATA 1NW5A 1MKYA 1TZBA 4XCXA 5LLTA 1Z6TA 1WUYA 2VJMB 4V1CI 2PQ2A 2AFRA 1GXSA 4FYVA 2DY0A 4P4UA 1BX3A 4RK4A 3SYNA 5A4FS 3GLFE 4OMDA 3MJDA 3V5NA 1Y0BA 5C8YA 1TUGA 5CDSA 3THXA 1NA5A 3E1KA 3Q7PA 2QTVB 1NSTA 4S35A 4PS0A 5C1IA 2N9UA 4O3FA 2JH3A 4G1BA 4DAEA 4UBJA 3LYHA 3IUYA 1WDTA 2ZZKA 4M99A 5JNWA 1RAAA 3EPJA 2YJ5A 2I4MA 3QXGA 3RVPA 4H1UA 3TLMA 3F3SA 4A6EA 4DIDA 5KWSA 4MYUA 2A9PA 2B7BA 2AC2A 4JENA 2H2WA 1XWWA 3LNTA 1W59A 1BQEA 3ZDEA 3PE6A 4B32A 1LKZA 2VTBB 2R25B 1U5CA 5F78A 2ZI7A 2AZ4A 1YBVA 1E2GA 1TJ4A 2WYUA 1TJYA 4ZXFA 1FYEA 2NSJA 5AW0A 2QN6A 1E94E 3JW8A 1KUTA 1M66A 1YZFA 4PQFA 3WRXA 4OLBA 5FNVF 2JI7A 1NRXA 2WM2A 1AHPA 2NO7A 4OM8A 5JAZA 3AGPA 3PDJA 4XEUA 4J4BA 2GSDA 3R3HA 5ED4A 4FDMA 4ZI2A 3CB2A 2YOGA 1RWBA 1AHIA 2G3YA 2QL9A 3HMKA 1MQ8B 3NXSA 3SEQA 5AP9A 4DUZB 2CFMA 1XLWA 3E7PA 1KO8A 3IKMB 3R6TA 2JLRA 2EFYA 4TWRA 4EFDA 5MN5A 3I12A 3Q40A 1X77A 1GLVA 4BHTA 4FE4A 1I1LA 1L5FA 1Z4NA 4GKVA 4ON9A 1QIMA 1J4AA 2Z4SA 2R66A 3E1GA 2PUTA 3OKAA 3UKOA 5IG2A 2RHGB 1PUIA 3SGIA 3WMXA 4BMCA 5JZSA 3U09A 1O8CA 1Q1NA 3ZOKA 1LSUA 1JAZA 3OP1A 2ODQA 1NN5A 5AK0A 4LQLA 5FAKA 2AD5A 4W8OA 1T6XA 1SBNE 2H7CA 4MUFA 4KVGA 4XVUA 1FLDA 3KFVA 1X42A 4FOTA 1YNOA 3L0YA 5ELMA 3VU9B 2BKXA 2E5WA 121PA 4NI5A 5L3RA 1W7AA 2O1WA 4Y6RA 2EARA 2AFIA 4DIUA 3ZBPA 1OY1A 2QVLA 5JQGA 1KSHA 3I30X 3V80A 4BGEA 2BKVA 4V39A 2QJFA 3DE1X 3DZIA 5IM5A 1CEXA 4EUNA 5CFOA 1V5WA 2RGEA 1QAMA 3Q12A 4LDNA 2P78A 1AXRA 1SZDA 3BIOA 4IZIA 5KHAA 5K3SA 4DLPA 2V7QA 3A1VA 3PNMA 3MTGA 1NL3A 2JFFA 4BMZA 4NCHA 1CUDA 1Y63A 1GAXA 3HZRA 1SCKA 1VJTA 3D8BA 4LBZA 1SXJC 1XZHA 3W5BA 1KO1A 1JQKA 4LWQA 1OWLA 3EVEA 3D2AA 5FORA 5JLJA 2H1HA 2VUSA 3EZFA 1DP4A 1SBIA 4RIHA 2NU8B 1JS1X 1NOIA 1EINA 2BLLA 3A4LA 3PR2B 5FQNA 1N7JA 5GJBA 4PBSA 3C3MA 2YHAA 5BWCA 1RC0A 2VCYA 4IVRA 2GVDC 4QWMA 1PQ4A 4Q4LA 2DQSA 3PSAA 2GZ1A 1O57A 2VTVA 3QIVA 2HUPA 3AP2A 1EXDA 5MFPA 3IAM6 3G5LA 1K3FA 4N1AA 1U5AA 1L8LA 2NNLD 2BFEB 4RABA 4ZZ1A 3IQFA 4OHCA 4XJTA 1KI7A 1MB4A 1QMGA 2H11A 4HAUA 5AKGA 2YZMA 2VA8A 3BWEA 2B3DA 3MSCA 1GKLA 4N8SA 1PYOA 2F7SA 2FOLA 1LX7A 2FX3A 3NFRA 1NX9A 2GNOA 4UCQA 3JQAD 4GLOA 2I87A 5I5YA 1M75A 3AHCA 4IKEA 2RH5A 1G66A 1P75A 4NMMA 3SBEA 5KOJA 2OYRA 5KTKA 2XBLA 4AY4A 3IDZA 3OX1A 1VKJA 1HMPA 2O2DA 2BP7A 1KC1A 1KE1A 2X9VA 4EPRA 2GESA 3VJMA 4WDRA 3ZCPA 3IE1A 4W9NC 1RXYA 2VYNA 3B36A 4F60A 3OQMA 2XYQA 3T15A 2HMUA 4I9HA 1FVOA 2VUTA 2WT8A 3RUDA 1FNDA 3HB1A 5DNCA 1ZQ9A 4RELA 1NN0A 1SULA 1XRNA 2IVFA 2G82A 4DDKA 3CGWA 4QFMA 4IOMA 1JLMA 1YZVA 3VTZA 2QVBA 3ZIAD 5HM6A 1CBUA 3PQ2A 1CQIB 1R8SA 1I2MA 1XK6A 1Z9BA 2J8ZA 2ZAMA 2Y27A 3AVQA 2H5LA 3CNQS 3KLOA 4FOLA 4NAUA 4QOFA 2FW9A 3DM9B 4XVQA 5J2UB 2BI7A 2SCUB 1JAXA 2VJBA 1GNPA 4NYIR 2HPAA 4L8VA 5LP6C 4RFLA 3U40A 3DJFA 2P9JA 1QGAA 2XPCA 3EFOB 1HC7A 4MYRA 3VR5D 3CRQA 2IXBA 4CG1A 1C0LA 1NG1A 2M1XA 4IYRA 4KRGA 5IASA 5HFNA 1QB8A 3EPKA 2P90A 3ABRB 1NUAA 4IIDA 3CSWA 4TUYA 1RLMA 5AO9A 3N2GB 4C7MA 2R6AA 2ZJYA 1GOTA 1DT5A 2R8ZA 1V39A 1RYZA 2CXSA 3DVSX 2H65A 4J6FA 5FL7A 1P7YA 3LT4A 3GT0A 2QG6A 4UBLA 2H9IA 3ZJVA 2Q62A 3CHYA 4DFDA 2O2YA 1J1UA 3D4IA 4FX5A 1JLLA 4TM8A 5AM1A 1XVIA 1PYGA 1Z56C 2VRCA 1NSFA 3HSSA 5T6BA 2WKPA 2FVXA 2XCQA 1U2EA 3JSXA 1NDQA 1QYWA 4WFIA 5IT4A 4ZO4A 2YZLA 3GL9A 3CKMA 1CUIA 1KZ6A 2Y93A 3LGXA 1M54A 2A4KA 3G0BA 4NZZA 2A5LA 2BY4A 3V2HA 1CZRA 4PPNA 1NKSA 5CTJA 3OJFA 4C7OA 2CNLA 1A76A 2PWAA 3BCRA 4JQYA 4XFDA 4W6QA 1QGDA 4YY3B 3SLGA 4IHKA 4Y1GA 4EGCB 2QP4A 3NBZB 3I1IA 2WWGA 3OF3A 2BFOA 1UZAA 3QUSA 1Q2UA 3WGUA 1W0KD 1ZZGA 4MAMA 1A9TA 5BSEA 1KVSA 5MDHA 2W6MA 1D04A 1TRHA 1YRLA 2P2YA 2VNIA 3C6KA 3E82A 3KYDA 4NG5A 4R1OA 4KHPB 4CM9A 3TRJA 2TMGA 1H6AA 2QYOA 5HOEA 1UJNA 1C7ZA 3LUFA 3T34A 4PO3X 5F4ZA 1E2EA 4JI7B 1A3GA 4U7TB 4ZU6X 3O0DA 2EP7A 2WUFA 1SOVA 2YN4A 2CLDX 4C7BA 3Q6NA 4X6YA 3EOAI 2XV1A 3GXBA 2P35A 4GX0A 2HJVA 5DOZA 4JXZA 2P9ZA 3MT7A 1KJQA 1QZTA 4OOFA 3E9NA 2VXBA 4OB7A 3W6OA 2P5TB 2COUA 2WNSA 4Q3EA 3V8BA 4Z4HA 1ZQ1A 1KJZA 4KV9A 4PZYA 1Q1QA 4FDAA 2XNCA 1P5JA 1W9HA 3LECA 3T9EA 3TLEA 1HNXB 1U28C 3O91A 4XW2A 4H7PA 2FOIA 1XF9A 3LXUX 1WW2A 2WWVD 1T6NA 5MN4A 1ZXBA 2Q6LA 2ZP1A 3HWSA 5CCEA 4YCJA 1R2QA 3PGJA 1OH7A 2P0EA 4MGHA 4RETA 4X93A 5ERGB 2WKQA 1U6JA 4I6EA 4JT9A 1I3KA 2CFTA 4I9UA 2VP9A 5FCDA 4G0VA 2GPSA 2ZRFA 2PGXA 5IJZA 1O94C 5ICCA 4WW0A 2PZGA 3DYVA 4KEAA 1I1MA 4L5IA 3AI2A 3E1SA 2RONA 3GAZA 2XF2A 3MJRA 3L07A 3QVLA 4MVCA 2ID8A 3HUUA 1JSXA 1KFCB 2YMMA 3GGDA 4YUZA 3HI6A 3OY7A 4JLDA 4AZ0B 3G7UA 5AVUA 5L45A 3FYUC 9GPBA 1QYRA 4N6OA 1IQUA 2J3LA 5C8VA 5JIBA 2ZBVA 5K0SA 1T2DA 3KOXA 3RHZA 1L6IA 3KHKA 4DSNA 2OSVA 5C2JB 1R5NA 2JA2A 4TRNA 2TMDA 3GLHB 2IYTA 3GC6A 1RHMA 4G5XA 1ODIA 2D2VA 1W76A 2ZIWB 1WNTA 4GSYA 3EISA 4K2AA 4QBFA 5EE1A 1JLKA 1TO1E 2CD9A 4M1ZA 2P2LA 2O8BA 2OM6A 4B9AA 1P0PA 3WJ2A 1NYQA 3ZDFA 3ADCA 5KPJA 3VVBA 3JSLA 2FRVA 4A73A 1LTQA 1AGPA 3DL0A 1P33A 1TTQB 4C0XA 1SMKA 3K2EA 4H1VA 1IYZA 1J21A 5BMVF 1JYEA 3KJNA 4U63A 2GBCA 4QTXA 1D6JA 3BTSA 2WR8A 4PAWA 2MOKA 3K6RA 1VB3A 1P4JA 5AK6A 3EA0A 3IAUA 5F7JA 4AYWA 3TVTA 5F9HA 4ENTA 5J4VA 4K1LA 1SUFA 3TCXB 4C4ZA 1CNEA 1UKEA 5AI4A 4AKGA 2QQEA 2AD1A 4N7JA 1M2VA 4YO8A 3ND6A 4Q02A 2EQAA 3KKNA 1SG6A 1F8YA 1QU3A 4HATA 4LOIA 4R2LA 5EJMA 3T5DA 4YGXB 2GO1A 4OQNA 2E4VA 2PSHA 5F33A 1RMQA 3H3FA 4XZ3A 5DTQA 2FPPA 3BB3A 4BFVA 4IF4A 4QT0A 3MQ2A 4CODB 4RMHA 2CZCA 3RHTA 4Y9DA 2YJGA 2DBRA 4J1NA 4CKCA 5J23A 3C15C 1HGXA 3SM9A 2FG6C 2GILA 2R1VB 3OLCX 4XGIA 1OLSA 4IQ0A 3C3YA 4D74A 1Y8QB 4BKUA 1GN9A 4FR0A 4NFSA 1HYBA 5EJ7A 4W5OA 3C14C 2HHFB 2IUUA 4Y8VB 1B14A 2FSSA 3NTOA 2NADA 4IOJA 3FVWA 1JTVA 4FNGA 4DLBA 1NW4A 2VYVA 1P77A 4FS8A 4S1WA 2BGTA 5GTDA 1A0OA 3LX5A 3DONA 4IW3B 4NJMA 3EHEA 4CMDA 3P9KA 4D45A 1L7QA 1TUBA 5A5GA 4H4EA 3TSWA 1IK6A 4JUAA 1IG0A 4Q39A 5ILQA 2YWFA 5TQ2A 2LCQA 2C7GA 1HEIA 4Y3UA 3KV3O 1S01A 3ZWAA 2VI5A 3GBSA 2X42A 3R1IA 4BGUA 3SHTA 4H3VA 1R6DA 4R8RA 1G8JA 1VA5A 3V7WA 2LCFA 4RKWA 1OH6A 1YVPA 1KGSA 3E8SA 2JLSA 1Q0SA 1EUZA 2GBLA 2H52A 3S70A 3KYIB 2ZRKA 1L8AA 2EVWX 2DCMA 2DXIA 1Z4JA 2MCFA 3WIUA 4DG8A 1T4DA 1J25A 1UJBA 3D4BA 3TQTA 1FQWA 2F17A 2FNAA 4JI1B 3K4HA 1WUKS 5CIWA 3E4CA 3L8HA 4AT1A 4JEHA 3LQ1A 3W9UA 4M0PA 3IVAA 2X5NA 4Y1EA 5B3JA 2BPOA 3DC7A 3QFCA 4BTEA 2F3QA 3F74A 4G97A 5LXTF 1LFDB 4C5AA 1D9XA 2WG0A 3NC0B 5H80A 3A32A 4QHSA 4RCZA 4TS4A 4EB0A 3A28A 3H11B 3P2MA 1EKPA 4Y9TA 5ICSA 1CJVC 3L8EA 4K9PA 3ESZA 4N9WA 2NXCA 3H1PA 3UB3A 1OBGA 5K9ZA 5KYWB 5CFNA 4YLYA 1VKOA 4XWOA 4OXRA 1YV9A 4MKFA 5LYJF 2YDYA 1L7VC 5IFKA 3EGEA 5GONA 3Q11A 5JR3A 4ZT6A 1U4NA 4AAYA 2VRWA 2OHVA 3I9FA 4XSHA 5IABA 1ECFA 3DDNA 5K0BA 3WS7A 1JKJA 3M6VA 4PHCA 1RMTA 1PJAA 2J3JA 3AL2A 2ZWPA 5I9NA 4DS3A 3FOZA 4RTQA 3N2LA 3GGJA 1UKZA 3IUJA 1USUA 3N87A 4JZKA 4O8CA 4RFSA 4Z7NB 4TLEA 1AJEA 3CLTD 1ECCA 1N9ZA 3K8YA 4RGYA 2A7XA 1YUBA 2JLCA 2PSDA 3SFVA 3LLCA 4BQRA 3CC8A 2QZ9A 1JT2A 3TTUA 1EFKA 2PIAA 1B74A 1IDOA 2IW3A 3DBHB 4J0CA 2Q1SA 2YHIA 4P31A 1OHHD 1BKDR 2QRLA 2VZEA 1DIGA 4W5JA 5JSKA 4PRZA 4JKOA 4EKDA 1W44A 5KX5F 1TK9A 4KAAA 2D06A 1WDKA 2XUAA 3PL1A 3V4FA 1M2KA 1KZGB 2C5FA 4ERXA 1ZVJA 3P26A 4OJNA 1Y7PA 2WINI 3D3JA 2W37A 3GQVA 4BU1A 1Z2CA 3IPLA 3I3SR 4N18A 1TGVA 3WFJA 1E1DA 2QRQA 1DAGA 2A94A 2I34A 4EJ6A 4EO7A 4ZQIA 3X1JA 3O8OA 4B6FA 5BN3A 3IHTA 5I60A 3G2OA 1J9EA 5JV5A 1EVIA 1NQVA 3M6MD 2HMTA 5LJLA 2PQMA 4HO1X 4J07A 1UOQA 3G8BA 4FDTA 1Z7YA 2RBEA 4H16A 1RWKA 2MSNA 3F49S 1OLUB 2HRQA 4Z3DA 2QRPA 1WM1A 3LIPA 5HQ3B 3UFXB 2DOKA 2P77A 2BHTA 3V4PB 1RP7A 2R8OA 3OCJA 2OK7A 3W5AA 4JXUA 1JIIA 1DRKA 1R0YA 3QE2A 4LBVA 4AMZA 4PGHA 1RDFA 3QUQA 2W98A 2X1VA 4PQGA 3ZQJA 4YUYA 2E6UX 4RVFA 1E5LA 3A1SA 1EFUA 3OFJA 4U9IS 2IK8A 1LDGA 4NYEA 3LXXA 3OJCA 4KI0A 1WHTA 1Y3AA 3BM5A 4QLBA 4B6OA 4PZZA 5NLLA 3HFGA 3PUYA 1CE8A 1HE8B 1NONA 1JQJC 3C70A 3KEFA 1QRSA 1KQGA 2PYZA 3DL7A 4CLHA 4BQOA 1I2CA 4YIHA 4W5QA 2XCTB 2BF4A 2D0IA 3CMMA 1LF0A 4BVEA 1U0BB 3OA0A 2RHRA 3MUNA 4EVSA 4JVSB 1U94A 2ZAOA 5JROA 5A6SA 4KFSA 3HR8A 5FI1B 2FR8A 2ZVPX 5KC9A 1F60A 3QY9A 1PW7A 1NLYA 2Q3MA 1EQUA 4FZVA 4RK6A 5KYUB 1U2GC 1NAIA 1K89A 1EUQA 2FLWA 1XWFA 2FXIA 2GLTA 3PHBE 3QX7A 4NV0A 1XJ0A 2QZZA 2B1RA 1SG9A 2G08A 2GQ0A 3DBLB 2A3NA 4URFA 4BEVA 1TQHA 1YO6A 1J56A 1EUDB 3QXSA 1EAYA 4MUNA 2CZQA 4Y2HA 4LBYA 3T94A 2SKEA 3LL7A 4RPJA 3UJCA 5KZMB 4BFWA 3W3ZB 2GWHA 3IBTA 4Q3LA 1D2RA 2R62A 3G0IA 4PG5A 5M3BA 3ZKWA 1ZBQA 3DKVA 5I47A 2D3WA 3NH9A 2D5IA 3JZAA 1PJ4A 2Y1LA 2R7LA 4O2BB 3ZYZA 4AN0A 3ER8A 2F43A 4ZVMA 1FDTA 5ECWA 3K3PA 4JC4A 2NO5A 3EZ2A 3G9TA 3ZJ4A 4BLVA 5BP7A 1DJMA 1PX2A 5TX7A 4ZO7A 2AOWA 4PCVA 2BJHA 1ISJA 3LU1A 4XYBA 2GAFA 4DLKA 1AVTA 2IXDA 1Q7CA 4HWSA 4AECA 2XOXA 2PCJA 4FZRA 3BRQA 4ARBA 4DYHA 1SK8A 4L22A 3FMFA 1XVUA 1J8YF 3JQ6A 4K46A 3NTVA 2FMKA 1U2SA 4HWRA 3AF0A 3ED1A 4C22A 1T3TA 4OFZA 4Q0MA 1QQ7A 1N1DA 2WD8A 4G5GA 2HQOA 1SHKA 3K9CA 3F8SA 3LKDA 1Z63A 1NBEA 1R6TA 4IQFA 1XXLA 1O96A 2X8AA 3H1TA 1YQTA 4ZJPA 1PL7A 2O52A 3GHYA 1RLOA 3WWJA 1T1IA 4MOWA 4EA6A 4EYKA 1YGYA 4HL6A 4L02A 2YC4C 1R9MA 2DHDA 1DC8A 4U2BA 3AILA 3DO8A 1U8ZA 2ZSJA 4BXOB 3PIRA 5I7SA 2AH5A 2O50A 2C3MA 1CVIA 1YZKA 4V2IA 5GIOE 4N0QA 2AR0A 1GTZA 4EY4A 2IBSA 2JIBA 1PVVA 2Y1CA 1JXAA 4O7LA 1DTEA 3H2JA 2J33A 3M3HA 1C1YA 2BMEA 4KYUA 4OHUA 3VPHA 5I3CA 3DKPA 3KAKA 3LHSA 5EFZA 5K8TA 2J3IA 4IIHA 2GN0A 2IYWA 3LGAA 1T3SA 3ADKA 3K8ZA 1M2NA 2VP4A 3KCNA 2VL7A 3OKCA 3EBLA 4AUMA 10MHA 1RRPA 2C42A 3ICEA 4TPKA 4MYSA 2GF0A 5CE8A 1A9PA 1RYNA 5DP2A 3TY5A 1R6AA 4IPTA 1XOIA 2ADMA 5BT8A 2HA7A 1EDDA 3PHJA 4XGQA 5FJJA 3VTKA 3H17A 3UK6A 3ZE2B 3Q2KA 3CZPA 5ALGA 1M0EA 4AC9A 3MTJA 2QTAA 5JNTA 1QJCA 4WBNF 2W2TA 2GN4A 1RBQA 2BMWA 1HL7A 3HHEA 4J3FA 3RC2A 3S2FA 1D6SA 3VVMA 2I03A 1PWZA 5HSGA 4LV5B 4NTZA 3VC1A 4I2VA 1OYWA 2HPHA 1ET0A 1T2FA 2OGZA 1KETA 3OHSX 1ND5A 5C51B 4QPZA 1L4LA 3TE7A 3HBLA 3NBUA 1BWRA 4Y2QA 3SPXA 4TMVA 3GRYA 3F3MA 4FBMA 4QHTA 3UAZA 4B8ZA 2DR2A 4NP6A 3TFWA 1JLSA 1YZHA 1HOTA 5DYGA 2QQ5A 5FPYA 3AOEC 2DPXA 3VSCA 3FFXA 4E2WA 2WLSA 5CVVA 5EJEA 2P5YA 4L27A 3PT9A 5CA1A 1QHXA 4MO9A 4F1JA 1XEWX 2CDAA 4LMAA 5TDHA 2ZI5A 1NATA 2ZRIA 3GJ7A 4CMKA 5KQGA 1P9NA 1ENZA 4DSOA 4IIJF 1VDZA 1RWQA 2WABA 3FSJX 3WK8A 4RY2A 1W4AA 1LJLA 2FZ5A 2H6EA 5G0SA 1OSNA 3AUAA 3CLSD 4X8LA 4RTOA 1LPNA 3MTAA 3P8ZA 2QTZA 2UUPA 1J1ZA 2B20A 3K8QA 4NF2A 4PXAA 4RPCA 3W5SA 1UUFA 2B94A 4XYGA 5JSYA 4DSAA 2Y0BA 2DWUA 4K9NA 4KQGA 2I6UA 5FBKA 4AF6A 4HNAB 4OI4A 3RBAA 5EP1A 5FO1A 1Z39A 3GLHE 3UXHA 5EMNA 4GR5A 1JSCA 4ABYA 4N4AA 1BMDA 1HTWA 1ZSVA 2VSOA 3GLVA 3HFSA 3HJRA 1RAHA 5EYPA 3BA6A 4INZA 3UK2A 3H9GA 1C30B 1GGVA 1QHEA 3OEYA 1SCUB 1YCGA 4RF2A 2YNMD 1Z6XA 4RE6A 4CIXA 4FFWA 5HZMA 4YJFB 4TTQA 3LPLA 2WY2D 1PK7A 3T7EA 1BCSB 1PVOA 4BJHB 3NPAA 4OAQA 3WGTA 1CQJA 2KMLA 3D3WA 3B2NA 3KHTA 1PGQA 1OZFA 1LV7A 3RM3A 3VGPA 3EGDA 4KGVA 1AO0A 3IO5A 3N2KA 3GRAA 2QN3A 5DLPA 4CQMA 1CK4A 3OCWA 2OD9A 1DKNA 2HMSA 1WIWA 3KS9A 3NG1A 4FOPA 1E9CA 3CB4A 4K7JA 3O75A 4XQ0A 3R5JA 4DSZA 1XZ8A 2E21A 1DRVA 5H70A 4AP9A 1L4FA 4I55F 2VEOA 1DXYA 2BFNA 1LVUA 3OU2A 4GM1A 2C9ZA 4RCNA 2XWSA 2AG1A 5GIPE 4AG5A 4Q7MB 4ZTBA 4Z0HO 4GLBA 4JSTA 4KO2S 4GSLA 2B0JA 1SU7A 2NO6A 3IAXA 1GCAA 3AHGA 5ALEA 3B9PA 5TLSA 1NKVA 3H2SA 4Z0TA 4D4HA 4TT3D 1YR7A 4H1WA 1TT5A 2Y8EA 3ZIDA 4FHCA 2DFNA 3L5KA 2FE1A 4MS1A 4Q4JA 1M8KA 5I48A 1VGVA 4X84A 3G8DA 3WLEA 2BGUA 4EOGA 2GXAA 2P9QA 3LP8A 1ONPA 3A6GA 1H5NA 2OECA 4CM4B 1J97A 4D42A 1PT7A 4AUKA 1CP2A 1Z3IX 3DE0X 5G1NA 4ZRNA 2R8RA 3PB3A 3URKA 4ZJZA 2X0NA 2H59A 3AM5A 4D5EA 4A0QA 4MUKA 1ZN9A 2G9ZA 2PR2A 1W88A 2YZNA 1EEHA 2XLBA 3ZXYA 3A4IA 1QF7A 1GO2A 4YJHA 4YJ2B 4QXRA 5EWJB 1HEYA 2VS1A 3I9OA 5HQJA 1WV1A 1YRAA 3WXBA 2NUPA 4DV1B 3SMQA 3WV4A 1ZCFA 3AERA 3COYA 4QATA 3AR4A 3L0OA 4HWOA 5EJ6A 5EHXA 1HZZC 3EXIB 4RKFA 4CIWA 3DV2A 1J8MF 1SN7A 2NTJA 4MS3A 1UJMA 4OJQA 1YQDA 1LUAA 1A7KA 1GZHB 3G0HA 2YWBA 4MIKA 3ZXIA 1E98A 3RSQA 1R10A 1JXOA 1GJRA 1SQGA 2FZCA 3ONDA 4QPNA 4ZQEA 1LK0A 3G8CA 1ELOA 4OQMA 1GL6A 4GZ3A 5H9WA 3TPCA 4P82A 1OBCA 4PYNA 4AROA 1K4KA 3FHCB 1C3LA 5AI8A 2ZJ7A 1G1AA 3GFRA 4MAAA 1TCCA 3CV3A 5ETJA 5CW1A 3DEYX 3VKGA 5FTNA 2OBMA 2AVDA 3S8EA 3AXTA 2C83A 4Z1MD 3QLUA 2BHNA 3H84A 4NOKA 4DEVA 3JQ8B 4KBFA 4NQZA 4E32A 2RBGA 1QLJA 1QOZA 3IT2A 2ECPA 4HVTA 4LRTB 4NBRA 2JW5A 4URVR 1JE1A 3R3YA 3ZWYA 1M76A 2ODBA 2CL5A 2NT4A 3CTPA 4OGKA 4BBZA 4F5WA 5IK2D 5M04A 1U90A 4JP2A 4QJ5A 1N5OX 2A9KA 5EIOA 3RTXA 1B3RA 3WAKA 4EY7A 1NYRA 1IHOA 2EKQA 2YS7A 5JQGF 1IC6A 2OWEA 3AETA 1IDN1 4KMRA 2VAMA 4QQFA 2Q50A 2V7GA 3KJQA 3OEED 3T5GA 5C4IA 5A1JA 4XPZA 3EB9A 1VQ1A 4G1CA 4U7JA 4A16A 4WOBA 1Y98A 4JOBA 4EBFA 2VTKA 3LY9A 2J0QA 3PC2A 1TAQA 4LI0A 2OCPA 3QKIA 4KPYA 4TLDA 1M9NA 1Z6PA 1NVMB 1VE1A 5F76A 4AIRA 1E0SA 1ML3A 1M1UA 3ZGXA 3COSA 2QEQA 4DNQA 1F2DA 4N5MA 1JP7A 2IEDA 2HM7A 1KKUA 1L7OA 1YASA 3DDCA 4HH1A 4CTJA 4D82A 1LNQA 3H2KA 4MQ6A 4A9AA 1Y1LA 4IJ5A 4Q1FA 3M82A 3JQ9A 3CVYA 3EQ2A 1NT4A 1GNSA 4KO8A 3ZCUA 1RAFA 3T61A 4YCCA 2G1KA 4EG3A 3QEJA 4H7DA 4DILA 1MC8A 3KPWA 1AN9A 3A1NA 4ONEA 2MSCB 2PBRA 1E3WB 1X80A 3SZMA 2P91A 1MV8A 3TRFA 2WNHA 3GP8A 1PGJA 2Q9UA 1QIEA 3LC7O 3UXMA 3ELYA 5AI9A 3WGYA 4H6PA 3OUTA 5ES4B 4KG7A 2HWXA 1WA5A 1C4KA 3PNKA 3KUKA 4X20A 4RENA 3V4OA 1WULS 4PZ0A 4OF4A 5K2OA 4HLNA 1DOAA 1JNYA 1ZM7A 5FWXA 3AG6A 4RA6A 2YCLA 2ADOA 3ISJA 4ZCTA 5ALXA 3I09A 3LFHA 1GADO 3Q3GE 4DPKA 1NLFA 4Z99A 2I4NA 4S1OA 4OQFA 4RSHA 1EGHA 5EQDA 1Q95A 1JZTA 4J75A 3CLRC 3WGNA 4EJFA 3QYFA 4BC1A 4EQ6A 3BXGA 3S2IA 2WSMA 2DLNA 2YJNA 1ZGHA 4ZI5A 3SN6A 2BV3A 3JAWB 2MSWA 1M2GA 5HE9A 3OCYA 3UW3A 4ZJYA 1K6JA 2OO7A 3ONEA 1CZUA 3PNBA 3NT2A 4UHHA 1RKVA 1Q7EA 2ZRDA 3QV1A 4I36A 4D4GA 1NQXA 1Z0FA 4KQ6A 4IZHA 4E07A 2V59A 3FRHA 4Q7EA 3PNOA 3KWLA 1L1EA 4H7IA 4Q1DA 1H2EA 3IOYA 4CCSA 2HYDA 1R0XA 3NUZA 3RTCA 5IJ9B 1WKCA 4YRAA 1T8SA 2IZ6A 3WGVA 3IP6A 2EHDA 4TQ9A 1NMYA 3SJCA 3SR4A 1IEWA 2I0FA 2J3DA 4RADA 3TB6A 1U1GA 2PL9A 1UPAA 3FYSA 1VJCA 2OEPA 4L7VA 1QLWA 4QRIA 2JAUA 1VSUA 4WV3A 1M1NB 3VUEA 3R5TA 3EPPA 5FOSA 1Y9JA 4FR5A 1N2BA 1J5XA 1H0KA 1TE2A 5F1PA 5KAPA 1EAMA 4C43A 1EXNA 5FFNA 1A4RA 2B69A 5CM2Z 4BO7A 1GRRA 4UU8A 1JHUA 1U6KA 5CA0F 3PTAA 4D43A 1DCFA 4TVKA 4CM7A 1HMYA 5DGXA 3IRVA 4Y18A 1ZIXA 2PQ6A 1CUYA 4Q66C 1S4QA 1W2HA 1IEQA 3STUA 4XYLB 3QELB 4P83A 5DBHX 4KW7A 2YRWA 3W2GA 2D5BA 1JQLB 3A1EA 2WD9A 4MW6A 4IDQA 1FTQA 1R64A 3M2TA 3M3DA 1UOEA 2R11A 5D5PA 1FSSA 1H6DA 5DN9A 5FBLB 3S3TA 2B1QA 3SX2A 3UHJA 4ASUD 2JATA 3ZWBA 3GLIB 3I2YX 2FHSA 1VG1A 2EJUA 4HTFB 1FUKA 4P4LA 4INOA 3ZBTA 1X7WB 4MCIA 3SWWA 3KPJA 4O6VA 1E3JA 2VDJA 3HA3A 1K4MA 2H31A 3QNUA 1W19A 4U7DA 1FFHA 4JV5B 2O19A 4LY3A 1P29A 1OAOA 2J59A 1XXHE 2HSGA 4ND4A 4PLYA 3TQHA 1A98A 4GDMA 2PX3A 2LXNA 2QUAA 2VF8A 3H4VA 3ROXA 3AJ8A 1ZN2A 1U0EA 1GZ4A 1XMPA 4XVHA 4G5OA 1KU0A 3VZPA 2GJAA 3UAYA 2XQJA 4OBBA 3FKSD 5JI3E 4GYWA 1M8PA 1DG9A 3HJCA 4RIGA 3ZHUA 1XZEA 1HDXA 3O8BA 3TGLA 1DXQA 4QRDA 1U7DA 3R6GA 1YA8A 1IIBA 2CXTA 1OZAA 3P9CA 1D7AA 4B3GA 4QTZA 4G63A 3TQQA 3AKEA 1J99A 3LCVB 1TAUA 4YHBA 2EQ5A 1A72A 3HCEA 3LOUA 4O84A 4QOIA 3BREA 3DTVA 5KVSA 4EG4A 5B1IA 3L8CA 4YMTA 5P21A 2BUCA 3HLKA 4RNCA 5DW3A 2RSLA 3M4JA 4KRFA 2WMYA 4TROA 4UAVA 3USZA 2WU3A 3BXOA 1C7FA 3FSGA 4YRPA 3ZVLA 2XNHA 5BYAA 1HETA 2GTIA 1QCZA 3JYPA 3O31A 4PQRA 4XD7A 5D7NA 5EWLA 3V1TC 4B43A 4D0NA 1EH5A 3RKUA 4CFZA 4UJ5A 1KAHA 1LGYA 2NO1A 3K09A 4MS4B 2G28A 2BVNA 5AVXA 1UADA 3GXOA 4YCDA 3ZG6A 4U6SA 1C8LA 2DF8A 2GF9A 4IMPA 3B6JA 4YQZA 3TLCA 1SHUX 1GR1A 1RXSA 1Z33A 1U8YA 3GJ6A 2JFUA 2KWIA 3OHMA 2GKGA 1U8CB 1QO0A 2C2XA 3NGLA 1O95D 2QRNA 1C2TA 3PUWA 5CNMA 4N7RA 4FPXA 3O2NA 1AQLA 1A48A 2D2FA 2QM7A 1BS1A 5CHEA 4E31A 1YKSA 2CHEA 1L0BA 1F06A 1V3QE 2RHJA 1CUXA 4HT3B 2YWGA 2ONYA 1RC1A 1K5GA 2Y68A 1W4RA 2I2AA 4BV9A 1D4AA 1JE0A 4PYLA 4Z1OA 1ZMBA 3PNSA 4PG6A 2OG2A 3ADPA 5D1OB 3E9EA 3FTPA 3HDJA 2YWXA 4R0NA 5GQSA 5CD9A 4LRSB 1DEOA 1C4XA 3TJMA 4Q3BA 1IAQA 2JB9A 2ZE7A 3EDOA 3NOQA 4MI6A 1ODLA 3LLUA 3PGVA 2XIJA 1IFXA 1AURA 1P39A 1U7XA 4RD6A 3RBVA 3UANA 3W05A 3J80A 3O84A 2B92A 1Z45A 2WU0A 4O2RA 3TY9A 1K5PA 5JVDF 1KMCA 3EOBI 3IAFA 3HYCA 3QKSB 1LBSA 4OJYA 4DY4A 2J0VA 2IL1A 4QT4A 2P9YA 3KE8A 3OFVA 3V1NA 2X40A 3BKXA 1VECA 3HLTA 1YTLA 3A37A 2IJGX 2ZUUA 1L5RA 4G0YA 3D64A 1P5ZB 3N39C 4HCJA 4MPDA 4YRRA 4DNPA 3BWYA 1PJ3A 3R6WA 4MI9A 3ZKAA 1F7UA 2A9JA 1E1RA 2O9JA 1KKMA 1CUAA 3F4BA 2OO5C 5ENZA 5H82A 3T0GA 4MCHA 2OZKA 1PJ2A 5JXGA 3EEIA 2COIA 1DS6A 5LR6A 4DCMA 2WHPB 1AQNA 1B2LA 2AG8A 4FMCF 4JR2A 1ID1A 4UU0A 4CN8A 5KEIA 3AINA 4JEMA 2HCJB 3E3MA 3C97A 1Z5ZA 1M6VA 4I4LA 2FQWA 3G1TA 5AVJA 5ITZA 1E3QA 2Q7XA 2R00C 4Y6GB 4M8SA 2WYVA 1QP8A 5B7NA 4I5GA 2B7LA 1R5JA 2H29A 1CZOA 4MJXA 2EZ4A 2PGLA 1BW9B 4OHBA 4P7BA 4RHFA 3AFNA 3BSFA 2XI4A 2GHQA 2Q8PA 3AKZA 3CNNA 1VE7A 4AW9A 4M49A 3CPEA 2BL4A 3NVAA 3T5BA 1K6XA 1ZCAA 4A91A 4EAQA 2YY6A 3YASA 2UDPA 3KKPA 3NRJA 1UKCA 4M3NA 3RRZA 421PA 4BAUA 4ZI7A 3U5TA 1MLDA 5EKSA 2NXJA 3R9XA 4NFYA 1EI9A 4YAEA 2HLDA 1L4UA 1RADA 3FWKA 3I9NA 3RV4A 3M1LA 5CVEA 4HRAA 3KQLA 4EDFA 5E3JA 2PO5A 4WA7A 1DHTA 3AH8A 1ZM3A 1KTVA 3GP5A 4IX9A 3CQ9A 4DBLC 4HNSA 3VGJA 4IJQA 3SR3A 3ZVNA 1K3TA 5E95A 4ZJUA 3RNOA 4NFLA 3KOWA 4NESA 5E7JA 1WBJB 5E1OA 2PUVA 3OT1B 4WKPA 3H6KA 3KAQA 5AXBA 1SU4A 4NG4A 2MSKA 2SHKA 5CTAA 3SJZA 1YRHA 3Q9NA 4YCMA 4R05A 1V5EA 4HAWA 3O6VA 1YCDA 4RLHA 2FWIA 2O3TA 1I10A 3EW7A 1UFOA 4CF5A 5D3QA 1AKEA 2E5LB 2ZUWA 3SC4A 1RWXA 2UZAA 2YYYA 2OHIA 5JT1A 3JQ9C 3JQGA 3ITKA 3LO8A 3QQPA 4UXIA 3CUKA 3L02A 2HGXA 4I46A 3DMDA 2QJWA 2XE7A 4PSVA 4I08A 4FYHA 1TGYA 1Z5WA 3FKJA 3KBOA 2TYSB 2W11A 3FAZA 4B4OA 4BPBA 5LZ4A 3LKVA 2P2CA 3OZGA 5BWUA 1GFIA 1XALA 1NE7A 2Q99A 4KJXA 3SIRA 4G67A 2UYCA 3KSMA 1ESZA 1KZ9A 1IHXA 3LLSA 4XYMB 2YMPA 4FI3C 5C53B 3WLHA 5J2TA 4UUPA 3K32A 1UBJS 2FFRA 2QROA 4YO7A 3TTVA 4LF5B 2K7ZA 3AUFA 1SXPA 5EJ9A 3ABQB 5HS4A 1N5IA 3C8MA 4EYGA 4F6RA 3CXRA 1TU3A 3GAMA 5I5TA 1U99A 1QGOA 4RVHA 3EIXA 5DTMA 2Q5LA 2BKAA 2GF2A 2YDXA 4FZJA 1EM8B 2B1JA 2FRXA 5DCYA 3QOYA 1Z2AA 2IODA 5K0TA 1H1LA 1WNFA 2YQZA 3Q7EA 4FYYA 1FDWA 1I51A 5CW2A 3A4MA 2Q1UA 4PV7A 1ZAUA 2VQDA 5AKEA 3X2SA 3WJAA 1EB8A 3OJOA 1GL9B 2IS1A 2A59A 4ZYUA 1TCBA 1ZUHA 3HEBA 4XVRA 1WB9A 4TYPA 2PE5A 2QL7A 1S5PA 2ORYA 3TL2A 1MP0A 1KC7A 1X2BA 3UB2A 3AU9A 1GPAA 2BFFB 3NASA 3VISA 3VKVA 5C8DA 1P0CA 5F2NA 1F2UA 3ETCA 5EE5B 1XK5A 4DMLA 1R9GA 1RSZA 2GWRA 5FOVA 2BTOA 1NW6A 5HZKA 5IEJA 4PXYA 2GPWA 1OX4B 2WAAA 1UOPA 5DN6A 2W48A 4EX6A 5CJPA 4EY3A 2HVSA 4Q3CA 4YPFA 3LUKA 5DDIP 3Q5EA 1WUHS 4FFDA 5AW1A 1DXOA 2H07A 1IZ8A 4ND3A 3RANA 2KJQA 2BI4A 3DO6A 3HXKA 4LTDA 1KMMA 3M89A 5KDOA 3SXUB 3IC5A 1QORA 1NMSA 1ZXXA 3OH8A 3ZQUA 1E62A 4KR6A 5EJFA 2BFDB 2ZT8A 3Q7RA 2YZGA 2PA3A 2AN4A 4NY1A 3U81A 3W4JA 4DJAA 3ZGNA 3MERA 1CR4A 3TR6A 5F7ZA 1X7GA 4R71A 3LA6A 1K7XB 2IYYA 3I05A 1ZAKA 1S2DA 2IKSA 1J07A 1G60A 4JCCA 5E38A 4ARZA 1RU3A 4ITRC 3QWIA 4FGLA 5JMOA 4Y9SA 2PMKA 4Q4HA 1DV2A 4C7KA 3AB8A 4DMGA 2FWMX 3NMUF 3N0XA 3F6BX 3PGA1 3PPYA 4NU5A 5ALHA 2E0IA 2IUSA 3L49A 4ZGBA 1ZMXA 3Q98A 1KI3A 4MEAA 3AUJB 3DOFA 4MQEB 3OJ0A 1UWKA 1DEAA 3MCUA 5LLSA 2JAPA 1KMHB 1YQEA 3DKRA 4Q48A 1ESDA 1LI4A 2YWDA 3MRSA 1AX9A 5AWFC 3ZZMA 2W6NA 4B76A 5HV6A 2VAXA 2WZBA 5C7IO 3DDWA 4MWSA 1UIMA 4JFAA 4AZ3B 5BSWA 5LZ9A 2IA5A 5B64A 3MWFA 4JIMA 2B9EA 3HDGA 5FR1A 4NMXB 1I0IA 4GLLA 3ASUA 2EW8A 3DVLA 4QBHA 1KBZA 1M10A 4WH0A 2FW0A 3QP9A 2HV8A 3CWQA 2LPMA 1DFHA 1EDOA 1VMKA 2QLJA 5BY2A 3GLFA 3RYHB 2O54A 1Z07A 2R0QC 4L4YA 4QOHA 4DLXA 1P61B 1UBNA 1V4VA 2FETA 4KX3A 4Y0AA 5K5EA 1HE5A 2I7XA 1E6UA 1SKBA 2C2HA 1W5SA 2JCBA 4WFQA 1U2DA 1AS3A 2PYDA 1LRKA 2C9BA 2VP3A 3FSEA 3GWGA 3PEEA 3PQ5A 1D0VA 3E6AA 1WS6A 3MBOA 4HGRA 4MUIA 2CNUA 2X8BA 4EJSA 1PLKA 2GCNA 2XUFA 4UASA 2TMKA 3UHFA 3X1KA 3GCZA 1G2WA 3RFCA 2LTAA 3PFCA 4QOGA 4J0KA 3VU0A 4AJ2A 4KO3S 1X7YA 3GDWA 4BQFA 1Z7GA 3HU5A 3WDSA 2W2KA 1XTIA 2AXPA 4QU0A 2QRHA 2YWCA 4TLBA 4UDOA 1G291 5ENVA 4DVJA 4E4RA 4EBBA 4D26A 4RKEA 3QF4A 1FBNA 4QOJA 3DHNA 2QYTA 5TQVA 2NU7B 4MDHA 5EA2A 1SC4A 2H9YA 3VO1A 4S05A 1OXBB 1YS9A 4QQ8A 3SZLA 3TF5A 3BZBA 2WP0A 4YECA 3M4XA 3K09C 3IVXA 1IXKA 1E9EA 3MTIA 4BO0A 4IOKA 3TLYA 3RC8A 3PD7A 2MDTA 3MINB 2H51A 4EFKA 2IX3A 2QDXA 1FX0B 4OKIA 1QCYA 4JI0B 2ZBPA 3OIVA 1WZEA 1T2AA 4YMGA 3QKUA 2D1TA 5KCMA 3GRFA 4B31A 2QTFA 2WTUA 1MC1A 2VPZA 3VOTA 3A6JA 4KMSA 3SF8B 2A2ZA 4MWCA 4BV8A 1A4UA 3COVA 4G6ZA 1BHJA 2CFRA 3ZNQA 2A9VA 1XDGA 2P4SA 1BC5A 4C9BA 3B7PA 5LCXA 4N5HX 5HW0A 1DKPA 2O5RA 3BD8A 3FF4A 2WW8A 4DGSA 1T9GS 4LE2A 4GMXA 1F0NA 2ECQA 2WTEA 2O4UX 2JG3A 4UD6A 4KN5A 4NV3A 2ZRLA 2PJUA 5F52A 2AIRA 4Y1FA 2QX9A 1VPVA 2KX7A 3V46A 1DMRA 1N7IA 1SB9A 2ES4A 2MINB 2HY7A 1V9CA 4CMIB 3GEIA 3SDSA 4FW9A 3RREA 1QE0A 1WW3A 1FIUA 1PBTA 4NZPA 1CUEA 1EXWA 2O1EA 4Q18A 1HSZA 2XUHA 3ETNA 4UHFA 4C0HA 5ADWA 5MGNA 3H2HA 4JL6A 1UBKS 3F6EX 4G8BA 4GP7A 3LYAA 3JS5A 3NDPA 2H08A 2OORA 4GSKA 4U7GA 5ARDA 4C6HA 4KYTA 4CWAA 2XUIA 1EX6A 1UFRA 2R7MA 2X4GA 3M34A 4UVEA 1AQJA 2VDWB 1RAIA 4DMRA 3G1UA 1OX6A 3FZGA 3TZCA 4F2DA 1F4PA 3MCAA 3I04A 3E03A 1KU6A 3MB5A 1S8FA 3HJNA 5IC5A 2PNJA 4EI9A 4XLLA 4QM6A 2C1ZA 4B6PA 1E1CA 3IB6A 2OFWA 2ZYDA 2IPMA 2DSTA 4TGLA 4CV2A 1KK2A 1ZEMA 4R8LA 4YRSA 3JQBC 3GLQA 3GZNA 4QECA 5DK6A 4GOOD 1ZMTA 2JFNA 2JIZA 1P3JA 5IKOA 3ZHVA 4LSMA 4ZV7A 1KVUA 1FFXB 5JSFA 5JD3A 2H06A 3IULA 3RRFA 1BJKA 4RM2A 3RS8A 3ZV5A 3DEZA 3FMVA 1MX1A 3RC3A 4DQ0A 1O0BA 2BH2A 1FDVA 4V1CA 2W8BB 2C7PA 2VK8A 2BGLA 1ZJ6A 4IXNA 1MN6A 3L6DA 1OFIA 4KXLA 3INGA 5GGXA 1JDBC 5LYJB 3HRHA 5D51S 3PEWA 1YI0A 4JUIA 3GGCA 3IKTA 4CR7A 3MUFA 1I5OA 2NZYA 2PYIA 4IH4A 1DCTA 2POQX 2ZGVA 4DM7A 3A3PA 1P0IA 3E5HA 3QUBA 2W71A 2V3VA 1B8PA 2XZPA 2R4TA 1JHOA 3TOZA 3ZWNA 4AN1A 2QN7A 5JH7B 2J9GA 1Z2OX 5A3QA 3T5PA 5EXEA 4UBNA 5HBGA 4CQNA 2ZRMA 3CU5A 4R8MA 5I7RA 4RD1A 2X0IA 4G1VA 5BMOA 4Y6QA 3KT0A 1RXVA 2V03A 4QUKA 4ZALA 4F4HA 3RIYA 4OHZA 4JLSA 4BC0A 3AIOA 2HJSA 1VOTA 1WQ4A 2B61A 4PAOA 1KI6B 1T1GA 4RK0A 4AJOA 4AWXA 1T4BA 2EGHA 4MHOA 5JS7A 3IXQA 1BCRA 2CEKA 2EOAA 4OJTA 4WKBA 1UFQA 3ML1A 3K6SB 1SEVA 4DIOA 1ORRA 3DF9A 3BH7A 3NV9A 1MZPA 1Z47A 5FBRB 3TQFA 1D03A 4M9CA 2IYUA 3DO5A 1WOYA 3DLPX 4HDMA 5ILOA 1H5UA 3WOVA 1H0RA 1PR2A 3L9WA 9ATCA 1A9XB 1JH9A 4BNZA 3U5ZB 3L1UA 5D2CA 3N2ZB 3W77A 4B2IA 1KJWA 4REQB 4EPYA 3HI4A 3LQ4A 4I4TF 5IBCA 1PFVA 1UR5A 3DVAA 2BKEA 1WMEA 3CNHA 5DB4A 3VFDA 3WGGA 2I99A 3AR8A 4J49A 2BH9A 4D4IA 2QYSA 2QRKA 1WZIA 3NVDA 1E2JA 4UM9D 3N74A 3WKEA 3KSUA 5JMWA 1NUQA 1KS2A 4DJTA 4PZ7A 2AKEA 2OZLB 2IYLD 3P97A 1VLJA 3ET5A 3GU3A 4C21A 1UMDA 5EL0A 3KXIA 3V6MA 2X2EA 1JR4A 4TTRA 3TPFA 1V2HE 3WLJA 1T8UA 5JARA 3LK6A 4HBGA 1QB7A 3OKFA 1E1YA 4HGYA 1W1WA 5FWYA 1Z6AA 2D1QA 2IZ5A 3ESYA 4O08A 3NUAA 1KI1A 2WU8A 4YPOA 3DOCA 5ALLA 4EY6A 2GRAA 3FNIA 5AKKA 2QRMA 4LF6B 2IEGA 1WP9A 4FGJA 1ML4A 2NTNA 4KCGA 4RK5A 3RS3A 5AD1A 3V2GA 1P1CA 2AJDA 2PX6A 3OCVA 4B6EA 3PTZA 2BKLA 2PUEA 3Q3HA 4DCTA 1A8UA 3BAAA 1KKLA 3IQGX 3MBIA 5DW0A 1LF5A 3FJOA 2EGUA 1Y89A 3DDHA 3OZAA 3SVTA 2CDBA 2WHYA 2EWMA 4O4JA 3E3AA 1SXJB 3GJ8A 1U9YA 5L7WA 1NXVA 3BMNB 3KD3A 1OD6A 4HF7A 2ZE5A 3I9KA 4M4SA 3CZAA 3N0RA 4JXXA 3F7OA 1YMUA 2CLLB 3W7AA 2IHKA 3MT8A 5CXSA 2YVUA 3CZRA 1T5HX 2JCVA 1AH2A 4RF4A 3TK1A 4CYMA 1SC1A 3UJHA 1V8PA 2Y77A 3LSTA 2C3UA 5CDFA 2FPWA 4RE5A 1TVKB 4C78A 3QH4A 4GZ6A 4WOCA 1VL1A 2AW3A 1MZVA 1PF7E 3D02A 3BBLA 1FB5A 4GLFA 3HP4A 1QHGA 2AN3A 4QXAA 4DRXB 2PLNA 2QT0A 4DR2B 3GVXA 3B6KA 3NUQA 5KHLB 1H85A 3D4LA 3GCGA 3K6KA 1VPDA 4CF3A 3THYB 4BY9E 2PUCA 1O1YA 3I64A 4TMXA 3IL2A 3NHYA 3PD0A 4KQ1A 3IPYA 4EFEA 2RAFA 2NYAA 2WI8A 5BYBA 3AQ4A 3WB2A 1GAEO 1PR3A 1FCJA 2XMQA 3K0FA 3KSZO 4TMTA 5CAEA 3ROFA 1F0PA 1Y6QA 2WIJA 4JJFA 1X1DA 4YXWA 4P3OA 4DL9A 4IS3A 3PUXA 4NBUA 5HJ2A 3AVUA 5K4GA 2QNIA 1JI0A 3WMRA 2PXCA 3QVJA 3R24A 1P9OA 2PJDA 4KN9S 1RWPA 3AF4A 4J1TA 5KUTA 1QE5A 4EQZA 3VR2D 3U4QB 3UJ6A 4F86A 3LDHA 1IN1A 3NALA 2VWGA 1V6SA 3DXYA 3UY4A 1SKMA 3BS4A 1H2AS 4C03A 2J31A 2CC2A 3F71A 5F1OA 4AIIA 5JNVA 3GLKA 4EKGA 2HF8A 1BFKA 3GUUA 5B4UA 4J7XA 3U39A 3E8MA 2DGDA 3R5SA 5EWMB 4F6LA 2XEDA 3VA7A 2C2MA 1EVEA 2DPLA 4JBHA 1GQQA 4IGFA 3U61B 2BSQA 1C0EA 4QXPA 3U7QA 4EJSC 2EIYA 3ESQA 5B3KA 2WAOA 1WCXA 3EIOA 3QOWA 1V8ZA 3DYBA 4BKRA 2ZB4A 2B6NA 3H2BA 4IUYA 1S2OA 2PD6A 4IICA 5K3AA 5IJ0A 3D43A 3DLBA 1A4XA 1SUIA 4NNJA 3VBCA 4JQOA 2JGJA 2D2EA 3JARB 3W9SA 4R9SA 5LP6B 4JJEA 5TXGA 1NXQA 4UJ3A 3EYWA 3MFYA 3NHBA 4L6AA 3UMRA 1H2YA 4R9RA 1ADCA 3QM1A 4K3UA 3W5OA 1X87A 4QC2A 4ESHA 3PEUA 3S2ZA 1I4TD 2J30A 1G19A 3P96A 1W4LA 3GUVA 1XROA 2G06A 5IDYA 4ZZ3A 2HJ9A 3KXLA 1XNJA 5LNK1 3HPQA 4LFCB 2OE2A 2H2GA 5JFGA 1V11A 2EFJA 4EYOA 4WBNB 1NVDA 2HT1A 4FI3F 4CKEB 1ETHA 4FE2A 1PNQA 1TVMA 2Y0DA 3FZYA 1YE3A 2HSDA 3ENKA 3UHAA 2G5CA 4YRQA 3TRKA 3VYSB 3IBCA 4S1NA 3N5KA 1GFSA 3D6NB 3TAUA 7REQA 3ZWVA 1QTRA 3ICPA 5COBA 1OYVA 2ZWVA 4NDZA 2IYPA 3I0ZA 2XJ4A 5TV2A 4DNXA 4H18A 1KRWA 4FMDF 3KDSE 1RNLA 3OG9A 2YN2A 5PNTA 3RYFB 5T7BA 3B53X 1IJEA 1B41A 4DR6B 5AM3A 4YCAA 1H9CA 3S8MA 2NU9B 2X3YA 1ZH0A 3IO3A 2HL6A 2ZS9A 4O7TA 2QMOA 3UENA 2EG9A 1DRJA 1TJ5A 2FP3A 3A3OA 4ZK6A 4HZUA 3ZE0B 2UVQA 1E79A 3VAYA 4DIEA 4OSEA 4ZIRA 1PV4A 4EW2A 1J8VA 3ODGA 4ODIA 4QBKA 4D9HA 1SUSA 2OHHA 1OBFO 1N5MA 3FBWA 4B3BA 5IHXA 2ISSD 4O33A 4IIJB 1O97D 2RHWA 4ZKDA 3S2GA 3ZZNA 1M6WA 1SELA 1DQSA 4DCSA 3HV2A 3LUAA 1PDWA 3D6HA 3KT6A 4MVJE 2DWPA 3OZRA 1A9ZA 3OIGA 1O54A 1GTG1 4F46A 1BG6A 3D7NA 4N8DA 4PTZA 4G2NA 4UUMA 5H83A 1YDGA 5D84A 5B7QA 5IKMA 5IW8A 1JA0A 3P4UA 4GOKA 4DF3A 3TQCA 1MTZA 2QTVA 2OORC 3MF4A 2A0KA 4B84A 3FR7A 5D6OA 2PMBA 3N8GA 2HSZA 1F4VA 5HCUA 5CG1A 5I5EA 4J1QA 1PK8A 4X90A 1I7SB 1EFCA 4ZT5A 2UXDB 2GN2A 4JLPA 2BZGA 4K8OA 3ENZA 2A92A 4FX2A 3SP1A 1XMXA 3KD2A 4FFBA 4ER3A 2FMTA 2PLFA 2E4UA 2P6UA 3SEZA 2E4WA 2VTBA 3E48A 4NCAA 3FDFA 3LDAA 5H59A 4C6TB 3HCBA 1NHWA 2YJ4A 2B37A 1P17A 1M73E 2YY5A 2QM0A 2OYCA 2GI4A 3NCTA 2P6NA 4QUAA 5LQAA 4JXKA 1H9AA 1U0LA 2F1RA 4BNMA 3U4MA 3G2IA 1J22A 2P4QA 2RHDA 2XUZA 5JMPA 1AF7A 3V55A 3MELA 2JA1A 2A5GA 3TRIA 2AZTA 2P6RA 1TD1A 4QFCA 4EARA 2C31A 2XE8A 5BUCA 3BFJA 4I55B 3BWXA 2JVJA 2QT9A 4YREA 3WGOA 4EUFA 3LQFA 3U56A 5KKCA 4W8HA 2FUNB 3LWBA 1DAPA 3C3KA 4GYJA 3V8NA 3ILYA 4F4IA 1XPOA 1IZ0A 1EVLA 1X8LA 3B1VA 4E5YA 1OFTA 4U5QA 3FYUB 1PN3A 1GXSB 4RA9B 5CU7A 4U2GA 3NTRA 2X0FA 3RUIA 3DOEA 3D54D 4LFBB 4RJKA 2QN9A 5C8YB 4I19A 3WRYA 4MSUA 4C4OA 3RFUA 3THXB 3IDQA 4RULA 2R79A 3FPKA 5JNUA 1JF8A 2XYVA 5AM0A 1YVDA 2HGWA 2H1IA 2XA9A 4J29A 3AR9A 4Z54A 4GKAA 1L5MA 2AN1A 2BM0A 3CSUA 3GMSA 2R2GA 3ONFA 3B2EA 1I2ZA 2PZ8A 4X00A 2J67A 3LYLA 2HTEA 3N05A 3PRHA 1VG9B 5HF8A 1Y1PA 3INTA 1NRIA 4HADA 1JN0A 1OYOA 1XQWA 1QIGA 4MUMA 5DT2A 1QK4A 1L6RA 5ARBA 4FNMA 3IEVA 4GXRA 4MTLA 1U8XX 2JBWA 2JIPA 5T3UA 2OHOA 3OURA 1PG2A 4DA8A 1XLUA 2AEEA 4DTIA 3ND9A 4AJ1A 3WI7A 4DANA 2B2NA 3JQCA 1XQ6A 3R7NA 4OOEA 2UUAB 3SKYA 3KOUA 4C4AA 1LDBA 3B38A 5J1TB 3UAWA 4GPTA 2NU8A 5J63A 4O2AF 5BRAA 3M70A 1ISMA 3TN7A 5FPHA 4DDUA 4R81A 3HKDB 1ZFNA 1C9MA 3RAFC 3WGHA 2VAPA 3P52A 1G38A 1V5IA 5EG5A 1TI7A 3B1JA 5T67A 1JG1A 3QA3E 3OLQA 4P53A 1COWA 5TF0A 4F97A 1CJTC 1LBEA 1QHHA 1V8BA 3NBQA 5E9JA 2B25A 3QU7A 1Q84A 1G6OA 1SZCA 1ZGCA 5GPBA 2Y6UA 3DL4A 4FK8A 3U3RA 3AF3A 5KNCH 4E5UA 1EQAA 4GBJA 4Y6SA 4HB2A 1IUOA 1D6MA 2G70A 2ZIFA 5G1PA 2BFEA 1Y4SA 2GA9A 4XXHA 3V48A 3A04A 1K66A 3L01A 4IGEA 2XB8A 3OWOA 2CV1A 2X0SA 2ZIUB 1CNMA 4JEUA 3RVRA 3AVYA 1H66A 3G0OA 1JV2B 3K92A 1Y5NA 3H1EA 1DBWA 4UM9B 3F96A 3EVBA 3DFUA 4EEZA 2I2XB 2QS9A 3M49A 1TM2A 1Z8HA 2VUGA 2ZRPA 3HWWA 2EBFX 3M4YA 1YI8A 3A1UA 3DP9A 1ONSA 1L4NA 2GZRA 2QD2A 4EJ2A 5AHXA 4KRXA 5CT5A 2EKZA 4BQIA 5JQGB 3A0RB 1W47A 3N2IA 4Z4FA 1X19A 3PFFA 4PFQA 1ZSYA 3G88A 3UYKA 4I1PA 4KSYA 4HQ0A 4OIFA 5CLIA 1P1RA 2SNIE 2P2NA 3FPFA 3F73A 2QD3A 4AKIA 3JRWA 4TV8F 2FJUA 3PICA 3DD5A 3FPEA 4XUDA 1SQ0A 1DB3A 1P5FA 2QZ4A 4I8XA 3W2IA 1O87A 1PFKA 1ZW1A 4XE5A 4BMVA 4JBYA 3RJTA 2XOKA 2XB2A 3DZDA 5DHAA 1E59A 3SS8A 4I3HA 2AV6A 3LY7A 4E15A 4O83A 4R5HA 1JSRA 4YUWA 2I62A 3GCXA 5J2UA 3G79A 1JJFA 3HCWA 3JQDA 5A4JA 2SCUA 4YGYA 2EZ9A 1JFVA 2XODA 4XASA 3A6ZA 1SY7A 1TMKA 2YVQA 2WJAA 3FDIA 4XWGA 3UG6A 1J7JA 4ND7A 3TZ6A 3CH6A 4CLEA 3HVUA 2BFAA 4PBCA 3F6CA 5FLEX 2NGRA 3TAXA 5HHTA 1DQPA 1R5BA 3CLUD 4RJIA 3T7CA 4AQYB 3RBXA 5JD4A 3MNFA 4JDPA 4EB6B 2ZM6B 2ZKIA 2J6HA 2P8JA 1EDBA 3CSSA 4YT5A 2VKTA 3BIJA 3R9WA 1E69A 1KORA 2NZ2A 4H0CA 3UOWA 3D6FA 2PBFA 3N2GA 1XBTA 1UBFA 4LA4A 4PAQA 5KWVA 1ZD5A 2VNAA 4DIFA 2ZJ3A 1JEEA 5BR8B 4UNPA 1KEEB 5EIFA 4BATA 4IXWA 1SGWA 3VH1A 4HQRA 4H59A 4C0QC 4EAAA 5AVSA 1C1XB 2GN8A 1Y6ZA 7AT1A 1BEEA 1CD5A 3WOHA 2HWWA 3UTCA 3OIUA 1NWCA 1RACA 4J1TC 4L57A 5BORA 3HZZA 1JR3A 2J4DA 2BFWA 3UH1A 5H4GA 4Z9XA 1TKAA 3ZK7A 4BLRA 2F4VB 3V97A 4QM7A 1PW5A 5AMXA 2Q41A 5EMMA 1OT3A 4YS6A 1HT0A 2FQ1A 3FJ1A 1XDZA 4HS9A 3HZOA 2OV1A 4LXQA 1WF3A 2G0TA 4F56A 3K15A 3QFFA 3SR0A 4F96A 2GM5A 3GRRA 2PKWA 4PNHA 2LD4A 4BFXA 1PD0A 1RW4A 4L8YA 3L46A 4B81A 3K9GA 2FN9A 1EGMB 5ESWA 3ITNA 4QELA 4WESB 1JHPA 2C4WA 1PQPA 3KQYA 2AYZA 2ZW9A 3NBYC 4D6YA 5JAIA 1E3LA 1MXFA 1JIJA 3VVCA 4AZWA 3WK6A 2A84A 5GZ6A 2QAGC 4UOQA 4D80A 2L19A 3W6ZA 2CUTA 3HUDA 1RPJA 3B1KA 3IP7A 4HB0A 1YB7A 3DGFC 1HY3A 1MA3A 2K87A 4L0CA 2PD3A 1SXJE 1NQAO 1VG8A 2DTXA 2X2FA 3NNSA 1IXSB 1ZJZA 2RHHA 2P79A 3RT7A 3UZUA 2ACVA 3KZVA 4AXBA 2BGNA 2YASA 5K6RA 2ASEA 2EU8A 2ZE8A 4FM9A 3EAQA 4DSTA 1L9XA 1MEOA 5TNXA 1NMZA 1IK4A 3DAGA 1K8ZB 3DE4X 3IGFA 2W6OA 2GBFA 4NMHA 4PR0A 3GEPA 3K20A 4LMBA 4TZKA 4K9OA 5AJXA 5HA5A 3HA2A 2EX4A 1BDMA 1WR8A 1UJCA 3KM0A 3AZOA 3IEUA 3UHPA 4EZIA 2LRHA 2DB3A 2E37A 3HDTA 4AJHA 1RBZA 4G8DA 1MX9A 2BIFA 4F2GA 1VCMA 2AXQA 4B1FA 1IHYA 1FYVA 1K7EB 1R9NA 1TIPA 3MCVA 1XZPA 1EGQA 3H3JA 3K5WA 5GAJA 2WFMA 2XYRA 3TUJC 2DKOA 4E5PA 1X0VA 1YCHA 4FYMA 2OAQ1 3S7TA 1B0UA 821PA 2FLVA 3ETHA 1ZL2A 1YQGA 4Y2GA 2JLYA 1L7NA 3RCBA 4IF6A 5JNRA 1NBMD 2P6PA 2I71A 4KDFA 5HIJA 4P3XA 3L7JA 1RWWA 1O9GA 2WTNA 3BHJA 4XGKA 4ZGWA 4C2UA 1QQTA 3HBMA 3DUFB 3EPHA 3LUHA 3RYIA 1VB5A 2P9GA 3UQ8A 3QVUA 1Q6ZA 3O83A 1E2QA 3EZLA 4UUBA 4YRMA 1G20B 4AZ0A 3S28A 2WEKA 1IONA 1FEZA 5K7SA 2C8JA 4NZOA 6AT1A 2X1MA 3IAS1 3GFVA 1SCQA 1NG9A 1BU8A 4M9UA 5B6IA 5CBKA 4DR4B 2R82A 1TKBA 4QPJC 3SICE 1PQUA 1CNFA 3GLHA 3QU9A 5K3DA 4KFTA 4KLCA 1L8XA 3OICA 1C3EA 1P1KA 2JZCA 4AXXA 4D9NA 2DC1A 1ZR4A 1NJ6A 1OWNA 1UDWA 2C77A 1NXTA 2OGUA 2XVAA 5B1EA 6Q21A 2ATEA 4W5WA 3BJEA 4DADA 1DSSG 2VSFA 3QVOA 3SJ7A 4YT8A 4NCBA 2G4CA 1DQRA 2II6A 4Q93A 1IB0A 4E7OA 4CLDA 1YZGA 4LH7A 3O95A 4TYQA 4LH6A 3DNPA 2ZQ5A 2XMBA 4LXXA 5AHRA 4ZCIA 621PA 4EM6A 1U3DA 1QOPB 4LHXA 4ZVKA 3IKVA 3I3OA 1GITA 3O7WA 3PITA 4JUBA 4MYHA 1G5QA 3PDHA 5ARCA 1N6HA 5JJLA 5CNKA 4BQSA 2R60A 1BH6A 5ALMA 5CM8B 5B7GA 2CK3D 3C8ZA 3PJFA 4PU0A 4C89A 4NU0A 1YRWA 2I76A 3VZBA 4CI9A 3ISVA 3LDGA 2VP5A 4WJKB 5CFLA 4WASA 3AUYA 1H5QA 4PC3A 4UTRA 1KF0A 5ITWA 1HT2E 3O90A 3ZY3A 1A5ZA 3ZCRA 4IVQA 1Y5LA 5CH5A 4KU4A 4CE5A 3AM4A 3VYRB 5EP2A 3LT1A 3IKJA 1GZSA 1HYGA 3DFKA 3VOSA 3OQOA 1TCAA 4H6XA 4FFPA 3TR0A 1YR8A 1IY0A 2TS1A 3Q1LA 4DZTA 4FLEA 2CJFA 3FYDA 3VR4D 1SVUA 3ROMA 3LUCA 3AI7A 1CZLA 4TKZA 3IH5A 1GEGA 3G68A 2W2VA 1IM5A 1EWRA 4M9SA 1AZLA 3KPVA 3OSZA 3TZEA 2O2IA 2R1VA 3R5FA 4G0WA 4KREA 1MB9A 1Y8QA 1N0WA 2C07A 3B3JA 5ALYA 4B85A 2B99A 4JBXA 1D07A 2QWXA 3PE4A 2GM4A 2AE1A 1KEZA 2KLHA 2OV4A 3IBFA 5FXMA 4F4JA 3PRJA 4K03A 1FX1A 1V3VA 1BMQA 3S2SA 2DEUA 2GPJA 5ELLA 4C4XA 3KIPA 1KYWA 3PXCX 4FHDA 4XUGB 5M34A 2E18A 3PUZA 5K0FA 1U2PA 4F91B 4N9QA 4O8ZA 4HAXA 1Z4PX 2O7RA 1IOVA 3DEFA 4G65A 5IZCC 2ZJ2A 5EY5B 3K5HA 1TU4A 4EUEA 1F20A 1HO3A 1T9AA 5J3JA 1KXJA 1PVDA 1CUHA 4BWGA 2OCYC 1ENOA 3SOPA 3RFTA 4LHYA 2VLBA 2ICAA 2ZE6A 4EJMA 1ZI8A 4KUEA 4X1OA 1PJQA 1DV1A 5AQEA 4Q19A 3ZHBA 5JHGB 5B5SA 2W2LD 1MQSA 4FMCB 4JYBA 4JX9A 4XCQA 3SQWA 1Z6ZA 3F1KA 3KXPA 5JZVA 3NHSA 1TM1E 5I9IA 3V6LA 3EGXA 5IMSA 2DQKA 3L0PA 4XZ3B 4G3XA 4CR8A 2EERA 3KP1A 3GJ3A 3Q10A 4R7GA 3RABA 4I4IA 3O4HA 1XKLA 3BQMB 3PEVA 4MVJP 4UHEA 1KYIA 5DKFA 1NHGA 2V54A 2GAOA 3SYMA 3EYAA 2H1CA 4G1EB 4MUYA 4ZVUA 2JRLA 4DLUA 2R8BA 2PXAA 3MOGA 4CKCB 1V16B 3GJXC 1RRKA 4EZBA 3QFRA 1Q3HA 4X0EA 1SXIA 3L6BA 3HXTA 3THRA 5JSHA 3A8TA 1X6VA 4ENWA 3GDHA 3H11A 4BL5A 2IV7A 4E6NA 1QWSA 1Y7HA 3VNAA 3O92A 5KYWA 1EP1B 5DISC 4FB5A 2QB5A 1B8UA 2KM1A 3DMHA 4U7PB 3OD5A 4ZWNA 3ECSA 3GDEA 3UBMA 4BNVA 1BZYA 5EMLA 2E87A 4DLVA 1Y5MA 4ZA2A 5A4MS 4J0IA 4BDTA 1V3TA 3TXXA 1SZJG 4Y2UA 1NNSA 3OOEA 5U4XA 5JS1A 4GF5A 2EKBA 3MWGA 3KSAC 2QF7A 4DUGD 1M1YB 2GKOA 1KVTA 2W6ID 2DSNA 2H63A 2VSQA 5JDCC 3U31A 4KUHA 2NV6A 3Q85A 4HG2A 4BMXA 1LCIA 2BGJA 1R16A 4LF4B 3RODA 1F9EA 4Z5XA 4UTNA 2V6FA 3O8RA 2HQBA 4XDYA 1II0A 2NVWA 2XQFA 3AFMA 4JHLA 1RHQA 2WKSA 4JC5A 3DMYA 2QOEA 5DH9A 2X2PA 3MB8A 5K3WA 1V4BA 2RKWA 3W8NA 4U2CA 1YOVB 1W96A 1E5DA 4RMJA 3DWFA 4MVJG 5IXYA 3ZI0A