2X5RA

Crystal structure of the hypothetical protein orf126 from pyrobaculum spherical virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
GAMARVGPKIEITHGGKKYTVFSKVTHLVPRTENGEEAEYVVFGPEKEGVISVVVLAPKDLNEEALALRVKWFNDTKPRCVKCGAAYNGKNHFRVVAIRNGTYYLDAVCDKCEPRITWLSAIVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
molecule tags Viral protein
molecule keywords HYPOTHETICAL PROTEIN ORF126
total genus 28
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.40 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2x5rA01
2X5RA
chains in the Genus database with same CATH superfamily
3T7AA 4HNVA 4UCOA 4DLKA 3DAAA 1VS0A 3T9FA 1A0GA 1M0TA 5H80A 1EZ1A 4L1KA 5BYBA 1I1KA 5BMVF 4MV7A 3PFFA 3T9CA 3KYHC 3ORRA 5C1OA 3SNOA 3JSLA 5FPOA 4MV6A 3R5XA 2Q2UA 1C3OA 4FE2A 4PZ8A 4XYMB 2NU8B 1OBGA 2R84A 3W1GA 1CQIB 4XZ3B 3OUZA 1CS0A 4O4HF 5D8DA 1IOWA 4Y8VB 3TY8A 3HT5A 4FFPA 1E4EA 1TAEA 5D1OA 4O7YA 4CMFA 5KKNB 3VA7A 5C8YF 4XX0B 2GPWA 3JZFA 4GLXA 2NU6B 4O4JF 4IIJF 5GONF 5CAEB 4O4LF 3R5FA 4O82A 1P8LA 5DISC 1KJ8A 3G8DA 4GLWA 4PZ6A 5CM0A 3MWEA 4NYEA 5CB4F 2YW2A 3R5HA 2HGWA 2YYAA 4UCTA 4ZOLF 1EKVA 3TEKA 2HVQA 1CKOA 3RFCA 1DIKA 3U55A 2HHFA 2HHFB 5HBRB 4E6NA 4O7WA 3VPDA 2HGSA 1XDNA 1ET0A 4M9UA 4UFZA 4O7VA 2GPSA 1A0IA 1T36A 2W70A 5BPFA 3OUUA 3WO0A 2VUGA 4O7LA 4UUGA 2I87A 4I55F 5DGIA 1KUTA 2CFMA 4C5BA 4EFEA 1KJJA 4O2BF 1KC7A 2HIVA 3U9SA 3U0GA 1CKNB 5CE8A 3I12A 3LQSA 3U54A 4EFBA 5JQWA 2GQSA 3ETJA 4LH7A 1CQJB 1VBGA 2IP4A 3KAKA 1GSHA 4Q4CA 4YAKB 3T99A 4C5CA 1EHIA 5J2UF 5BWXA 2A1HA 3TQTA 5KS8A 5FPRA 5DMXA 2DIKA 3HO8A 1AUXA 1DV2A 4EGQA 3S24A 3ORQA 5CR5A 3TIGA 3MWDA 3VMMA 4YJ3F 5JH7F 2PBZA 2W71A 4HNUA 2NU7B 1DAAA 1BXRA 3K3PA 3KALA 3UZOA 5I5YA 2HGXA 3E5NA 2W6MA 1P16A 2X0SA 1IYEA 1XK5A 2XCLA 4JXUA 2P0AA 4MV1A 4E4TA 1I2LA 2HIXA 2HVRA 4YJ2F 4O7RA 5BPHA 1B6RA 1PK8A 3U9TA 3G8CA 3RV3A 1UC8A 5BYAA 2HVSA 3DTGA 2FPPB 2YS7A 2YL2A 2DLNA 3VOTA 1I1LA 3N6RA 1C30A 2ZDQA 2W6ZA 3BACA 3BG5A 4DQNA 3WWHA 3BA9A 1VBHA 4MV3A 1A9XA 2VPQA 4DAAA 3TIIA 2R85A 1Z2PX 4NZOA 3QFFA 1A48A 5D1OB 5BWUA 3UYYA 1VKZA 5LOVF 1PX2A 1IYDA 5EZYF 2DWCA 3GLKA 2EJ0A 4ZI7F 3TY5A 4HR7A 1I2KA 4K6NA 3V4ZA 2V58A 1GLVA 3KAJA 2R7NA 4MV9A 3AW8A 2FPGB 3LP8A 4EEQA 1B6SA 5DGHA 2I8CA 2Z02A 3LULA 2V5AA 2ZGIA 3BAAA 4IZOA 5I47A 3VNNA 4EGJA 4I4TF 3NBZB 3WNZA 2ZDGA 4O4IF 2YZLA 4MAMA 2OLSA 2R86A 3WWJA 5JVDF 4RCNA 1S68A 4MV8A 2NU9B 4DRFA 3T9EA 3RV4A 1KT8A 3NUAA 5I5SA 2QF7A 3AX6A 3DF7A 1M0WA 4FFRA 2Y4RA 4UCUA 2C00A 1IOVA 5I5WA 2CZGA 2YZNA 4NZMA 2DABA 3SE7A 3VPCA 1EKFA 5HV6A 4MV4A 3PN1A 2R7LA 2FPIB 1W96A 1JLLB 3Q2OA 3N8DA 4QSHA 1JDEA 2COGA 2VQDA 5K3WA 4WHXA 4TV9F 4CMDA 2XD4A 2Q7DA 2Z04A 1KEEA 5K2MA 1JKJB 2HDKA 3LWBA 1DGSA 2YRXA 1V9PA 2VR1A 5J2TF 5CA1F 2R82A 3RR5A 1SCUB 4LH6A 2EIYA 2NUAB 5I5TA 3NBYB 1OBDA 1GGOA 1EUCB 1KBLA 3K5IA 3SGIA 5I5VA 3UFXB 3ETHA 1I1MA 5DAAA 4M0JA 4PBCA 1B04A 2OWOA 3UZBA 1GSOA 1AUVA 4HNTA 1EUDB 4HN2A 1TA8A 1KJQA 5C1PA 1KJIA 4CE5A 4O2AF 2CNVA 1G2WA 2Q2TA 4UCRA 4DIMA 4XYLB 1ULZA 2FB9A 4CC5A 3T9AA 5JQGF 2I80A 4O7NA 5LXTF 1X9NA 5HNEA 3CEBA 4HQ6A 2ZDHA 3R23A 2HG8A 4PZ7A 3RTXA 3WWIA 3JZIA 4Q4DA 4UCVA 3T9DA 4MA5A 4TVIA 4I50F 5BWVA 3T9BA 3TW6A 4O84A 1DV1A 3CSWA 3UQ8A 1I7NA 2PN1A 3GIDA 3JRXA 2V59A 4O86A 4YAJB 1JDBB 5LP6F 3Q1KA 2CNUA 3JRWA 2QK4A 3JSNA 4ZHQF 3W5OA 1BNCA 3V4SA 4O7ZA 3DTFA 3T54A 5FNVF 5BWWA 3GJXB 5I5XA 3HB9A 2W6OA 4IWXA 3GDEA 4ZQIA 2YZMA 2ODTX 1UC9A 4TM5A 3R9RA 5D1PA 2R7KA 2R87A 2YWVA 3VPBA 4TUYF 1EYZA 4C5AA 1W93A 2EJ3A 3L2PA 4FU0A 1GSAA 2PVPA 5BWTA 2CNQA 1M6VA 1CKNA 1Z2NX 3GB8B 3KREA 4ME6A 1CE8A 4FFMA 5CA0F 2HJWA 3TY9A 2FP4B 3JZ6A 2QB5A 2COIA 2DAAA 3BABA 5E25A 4FFLA 2R7MA 2W6NA 4CHIA 2GLTA 4RZQA 1KJ9A 4FGRA 1EKPA 4CKCA 2ABJA 3K5HA 5KX5F 1ZAUA 4IHJF 2WYOA 2X5RA 4MA0A 2EJ2A 1Z2OX 3NC0B 4FFNA 1A3GA 5IYZF 5LA6F 2DZDA 4FFOA 4O7SA 3RUPA 4CC6A 1KTAA 4TV8F 3TINA 2YZGA 4UCSA 4O7TA 1FVIA 4YB8B 5FR9A 3WO1A 4YBZB 3HBLA 3QQMA 3MJFA 1I7LA 2SCUB 3TW7A 4IWYA 4O83A 2YS6A 5LYJF 5I5UA 5BWRA 4O81A 5I60A 1CKMA 2YRWA 4EQ5A 1E4EB 2GQRA 5JVLA 3QWUA 4NZNA 3W1BA 2W6QA 2J9GA 2W6PA 2COJA 4EG0A 1WR2A 4WBNF 4CKEA 3BA8A 4CKBA 1WRVA
chains in the Genus database with same CATH topology
3T7AA 5KS8A 3DAAA 3T9FA 1A0GA 3DTFA 5CR5A 3T54A 3WWJA 5BWWA 4RCNA 5I5XA 5BYBA 1I1KA 4IWXA 3T9EA 3PFFA 3T9CA 1KT8A 2ODTX 5I5SA 1UC9A 3SNOA 4TM5A 2Y4RA 1DAAA 5I5WA 4NZMA 3UZOA 2DABA 5I5YA 1EKFA 2HGXA 2EJ3A 1IYEA 5BWTA 5I47A 4JXUA 3HT5A 1I2LA 4CMFA 2COGA 5K3WA 4WHXA 4CMDA 3JZ6A 2Q7DA 5K2MA 2QB5A 2HDKA 2COIA 1UC8A 2DAAA 5CM0A 4GLWA 5E25A 5BYAA 3DTGA 4CHIA 2HGWA 1EKVA 3TEKA 1I1LA 1EKPA 4CKCA 2EIYA 2ABJA 3BACA 5I5TA 4DQNA 1ZAUA 2HHFA 2HHFB 3WWHA 2X5RA 3SGIA 2EJ2A 5I5VA 1I1MA 5DAAA 1A3GA 3VPDA 4M0JA 4PBCA 4DAAA 1ET0A 3UZBA 1KTAA 4HN2A 4CE5A 4NZOA 1G2WA 5FR9A 4UUGA 5BWUA 3QQMA 3UYYA 3T9AA 5DGIA 5HNEA 3CEBA 1IYDA 4IWYA 3TW7A 2HG8A 5I5UA 3WWIA 5BWRA 3U0GA 2EJ0A 4Q4DA 5I60A 3T9DA 4TVIA 5CE8A 5BWVA 1I2KA 3LQSA 4K6NA 3T9BA 3CSWA 4NZNA 4Q4CA 5DGHA 2COJA 3T99A 3LULA 4CKEA 2ZGIA 5BWXA 4CKBA 1WRVA 2A1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5R A; 
#chains in the Genus database with same CATH topology
 3T7A A;  4HNV A;  4UCO A;  4DLK A;  3DAA A;  1VS0 A;  3T9F A;  1A0G A;  1M0T A;  5H80 A;  1EZ1 A;  4L1K A;  5BYB A;  1I1K A;  5BMV F;  4MV7 A;  3PFF A;  3T9C A;  3KYH C;  3ORR A;  5C1O A;  3SNO A;  3JSL A;  5FPO A;  4MV6 A;  3R5X A;  2Q2U A;  1C3O A;  4FE2 A;  4PZ8 A;  4XYM B;  2NU8 B;  1OBG A;  2R84 A;  3W1G A;  1CQI B;  4XZ3 B;  3OUZ A;  1CS0 A;  4O4H F;  5D8D A;  1IOW A;  4Y8V B;  3TY8 A;  3HT5 A;  4FFP A;  1E4E A;  1TAE A;  5D1O A;  4O7Y A;  4CMF A;  5KKN B;  3VA7 A;  5C8Y F;  4XX0 B;  2GPW A;  3JZF A;  4GLX A;  2NU6 B;  4O4J F;  4IIJ F;  5GON F;  5CAE B;  4O4L F;  3R5F A;  4O82 A;  1P8L A;  5DIS C;  1KJ8 A;  3G8D A;  4GLW A;  4PZ6 A;  5CM0 A;  3MWE A;  4NYE A;  5CB4 F;  2YW2 A;  3R5H A;  2HGW A;  2YYA A;  4UCT A;  4ZOL F;  1EKV A;  3TEK A;  2HVQ A;  1CKO A;  3RFC A;  1DIK A;  3U55 A;  2HHF A;  2HHF B;  5HBR B;  4E6N A;  4O7W A;  3VPD A;  2HGS A;  1XDN A;  1ET0 A;  4M9U A;  4UFZ A;  4O7V A;  2GPS A;  1A0I A;  1T36 A;  2W70 A;  5BPF A;  3OUU A;  3WO0 A;  2VUG A;  4O7L A;  4UUG A;  2I87 A;  4I55 F;  5DGI A;  1KUT A;  2CFM A;  4C5B A;  4EFE A;  1KJJ A;  4O2B F;  1KC7 A;  2HIV A;  3U9S A;  3U0G A;  1CKN B;  5CE8 A;  3I12 A;  3LQS A;  3U54 A;  4EFB A;  5JQW A;  2GQS A;  3ETJ A;  4LH7 A;  1CQJ B;  1VBG A;  2IP4 A;  3KAK A;  1GSH A;  4Q4C A;  4YAK B;  3T99 A;  4C5C A;  1EHI A;  5J2U F;  5BWX A;  2A1H A;  3TQT A;  5KS8 A;  5FPR A;  5DMX A;  2DIK A;  3HO8 A;  1AUX A;  1DV2 A;  4EGQ A;  3S24 A;  3ORQ A;  5CR5 A;  3TIG A;  3MWD A;  3VMM A;  4YJ3 F;  5JH7 F;  2PBZ A;  2W71 A;  4HNU A;  2NU7 B;  1DAA A;  1BXR A;  3K3P A;  3KAL A;  3UZO A;  5I5Y A;  2HGX A;  3E5N A;  2W6M A;  1P16 A;  2X0S A;  1IYE A;  1XK5 A;  2XCL A;  4JXU A;  2P0A A;  4MV1 A;  4E4T A;  1I2L A;  2HIX A;  2HVR A;  4YJ2 F;  4O7R A;  5BPH A;  1B6R A;  1PK8 A;  3U9T A;  3G8C A;  3RV3 A;  1UC8 A;  5BYA A;  2HVS A;  3DTG A;  2FPP B;  2YS7 A;  2YL2 A;  2DLN A;  3VOT A;  1I1L A;  3N6R A;  1C30 A;  2ZDQ A;  2W6Z A;  3BAC A;  3BG5 A;  4DQN A;  3WWH A;  3BA9 A;  1VBH A;  4MV3 A;  1A9X A;  2VPQ A;  4DAA A;  3TII A;  2R85 A;  1Z2P X;  4NZO A;  3QFF A;  1A48 A;  5D1O B;  5BWU A;  3UYY A;  1VKZ A;  5LOV F;  1PX2 A;  1IYD A;  5EZY F;  2DWC A;  3GLK A;  2EJ0 A;  4ZI7 F;  3TY5 A;  4HR7 A;  1I2K A;  4K6N A;  3V4Z A;  2V58 A;  1GLV A;  3KAJ A;  2R7N A;  4MV9 A;  3AW8 A;  2FPG B;  3LP8 A;  4EEQ A;  1B6S A;  5DGH A;  2I8C A;  2Z02 A;  3LUL A;  2V5A A;  2ZGI A;  3BAA A;  4IZO A;  5I47 A;  3VNN A;  4EGJ A;  4I4T F;  3NBZ B;  3WNZ A;  2ZDG A;  4O4I F;  2YZL A;  4MAM A;  2OLS A;  2R86 A;  3WWJ A;  5JVD F;  4RCN A;  1S68 A;  4MV8 A;  2NU9 B;  4DRF A;  3T9E A;  3RV4 A;  1KT8 A;  3NUA A;  5I5S A;  2QF7 A;  3AX6 A;  3DF7 A;  1M0W A;  4FFR A;  2Y4R A;  4UCU A;  2C00 A;  1IOV A;  5I5W A;  2CZG A;  2YZN A;  4NZM A;  2DAB A;  3SE7 A;  3VPC A;  1EKF A;  5HV6 A;  4MV4 A;  3PN1 A;  2R7L A;  2FPI B;  1W96 A;  1JLL B;  3Q2O A;  3N8D A;  4QSH A;  1JDE A;  2COG A;  2VQD A;  5K3W A;  4WHX A;  4TV9 F;  4CMD A;  2XD4 A;  2Q7D A;  2Z04 A;  1KEE A;  5K2M A;  1JKJ B;  2HDK A;  3LWB A;  1DGS A;  2YRX A;  1V9P A;  2VR1 A;  5J2T F;  5CA1 F;  2R82 A;  3RR5 A;  1SCU B;  4LH6 A;  2EIY A;  2NUA B;  5I5T A;  3NBY B;  1OBD A;  1GGO A;  1EUC B;  1KBL A;  3K5I A;  3SGI A;  5I5V A;  3UFX B;  3ETH A;  1I1M A;  5DAA A;  4M0J A;  4PBC A;  1B04 A;  2OWO A;  3UZB A;  1GSO A;  1AUV A;  4HNT A;  1EUD B;  4HN2 A;  1TA8 A;  1KJQ A;  5C1P A;  1KJI A;  4CE5 A;  4O2A F;  2CNV A;  1G2W A;  2Q2T A;  4UCR A;  4DIM A;  4XYL B;  1ULZ A;  2FB9 A;  4CC5 A;  3T9A A;  5JQG F;  2I80 A;  4O7N A;  5LXT F;  1X9N A;  5HNE A;  3CEB A;  4HQ6 A;  2ZDH A;  3R23 A;  2HG8 A;  4PZ7 A;  3RTX A;  3WWI A;  3JZI A;  4Q4D A;  4UCV A;  3T9D A;  4MA5 A;  4TVI A;  4I50 F;  5BWV A;  3T9B A;  3TW6 A;  4O84 A;  1DV1 A;  3CSW A;  3UQ8 A;  1I7N A;  2PN1 A;  3GID A;  3JRX A;  2V59 A;  4O86 A;  4YAJ B;  1JDB B;  5LP6 F;  3Q1K A;  2CNU A;  3JRW A;  2QK4 A;  3JSN A;  4ZHQ F;  3W5O A;  1BNC A;  3V4S A;  4O7Z A;  3DTF A;  3T54 A;  5FNV F;  5BWW A;  3GJX B;  5I5X A;  3HB9 A;  2W6O A;  4IWX A;  3GDE A;  4ZQI A;  2YZM A;  2ODT X;  1UC9 A;  4TM5 A;  3R9R A;  5D1P A;  2R7K A;  2R87 A;  2YWV A;  3VPB A;  4TUY F;  1EYZ A;  4C5A A;  1W93 A;  2EJ3 A;  3L2P A;  4FU0 A;  1GSA A;  2PVP A;  5BWT A;  2CNQ A;  1M6V A;  1CKN A;  1Z2N X;  3GB8 B;  3KRE A;  4ME6 A;  1CE8 A;  4FFM A;  5CA0 F;  2HJW A;  3TY9 A;  2FP4 B;  3JZ6 A;  2QB5 A;  2COI A;  2DAA A;  3BAB A;  5E25 A;  4FFL A;  2R7M A;  2W6N A;  4CHI A;  2GLT A;  4RZQ A;  1KJ9 A;  4FGR A;  1EKP A;  4CKC A;  2ABJ A;  3K5H A;  5KX5 F;  1ZAU A;  4IHJ F;  2WYO A;  2X5R A;  4MA0 A;  2EJ2 A;  1Z2O X;  3NC0 B;  4FFN A;  1A3G A;  5IYZ F;  5LA6 F;  2DZD A;  4FFO A;  4O7S A;  3RUP A;  4CC6 A;  1KTA A;  4TV8 F;  3TIN A;  2YZG A;  4UCS A;  4O7T A;  1FVI A;  4YB8 B;  5FR9 A;  3WO1 A;  4YBZ B;  3HBL A;  3QQM A;  3MJF A;  1I7L A;  2SCU B;  3TW7 A;  4IWY A;  4O83 A;  2YS6 A;  5LYJ F;  5I5U A;  5BWR A;  4O81 A;  5I60 A;  1CKM A;  2YRW A;  4EQ5 A;  1E4E B;  2GQR A;  5JVL A;  3QWU A;  4NZN A;  3W1B A;  2W6Q A;  2J9G A;  2W6P A;  2COJ A;  4EG0 A;  1WR2 A;  4WBN F;  4CKE A;  3BA8 A;  4CKB A;  1WRV A; 
#chains in the Genus database with same CATH homology
 3T7A A;  5KS8 A;  3DAA A;  3T9F A;  1A0G A;  3DTF A;  5CR5 A;  3T54 A;  3WWJ A;  5BWW A;  4RCN A;  5I5X A;  5BYB A;  1I1K A;  4IWX A;  3T9E A;  3PFF A;  3T9C A;  1KT8 A;  2ODT X;  5I5S A;  1UC9 A;  3SNO A;  4TM5 A;  2Y4R A;  1DAA A;  5I5W A;  4NZM A;  3UZO A;  2DAB A;  5I5Y A;  1EKF A;  2HGX A;  2EJ3 A;  1IYE A;  5BWT A;  5I47 A;  4JXU A;  3HT5 A;  1I2L A;  4CMF A;  2COG A;  5K3W A;  4WHX A;  4CMD A;  3JZ6 A;  2Q7D A;  5K2M A;  2QB5 A;  2HDK A;  2COI A;  1UC8 A;  2DAA A;  5CM0 A;  4GLW A;  5E25 A;  5BYA A;  3DTG A;  4CHI A;  2HGW A;  1EKV A;  3TEK A;  1I1L A;  1EKP A;  4CKC A;  2EIY A;  2ABJ A;  3BAC A;  5I5T A;  4DQN A;  1ZAU A;  2HHF A;  2HHF B;  3WWH A;  2X5R A;  3SGI A;  2EJ2 A;  5I5V A;  1I1M A;  5DAA A;  1A3G A;  3VPD A;  4M0J A;  4PBC A;  4DAA A;  1ET0 A;  3UZB A;  1KTA A;  4HN2 A;  4CE5 A;  4NZO A;  1G2W A;  5FR9 A;  4UUG A;  5BWU A;  3QQM A;  3UYY A;  3T9A A;  5DGI A;  5HNE A;  3CEB A;  1IYD A;  4IWY A;  3TW7 A;  2HG8 A;  5I5U A;  3WWI A;  5BWR A;  3U0G A;  2EJ0 A;  4Q4D A;  5I60 A;  3T9D A;  4TVI A;  5CE8 A;  5BWV A;  1I2K A;  3LQS A;  4K6N A;  3T9B A;  3CSW A;  4NZN A;  4Q4C A;  5DGH A;  2COJ A;  3T99 A;  3LUL A;  4CKE A;  2ZGI A;  5BWX A;  4CKB A;  1WRV A;  2A1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...