2X5RA

Crystal structure of the hypothetical protein orf126 from pyrobaculum spherical virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
b'GAMARVGPKIEITHGGKKYTVFSKVTHLVPRTENGEEAEYVVFGPEKEGVISVVVLAPKDLNEEALALRVKWFNDTKPRCVKCGAAYNGKNHFRVVAIRNGTYYLDAVCDKCEPRITWLSAIVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN ORF126
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
molecule tags Viral protein
total genus 28
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.40 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2x5rA01
2X5RA
chains in the Genus database with same CATH superfamily
1EZ1A 3MWDA 2NUAB 4DIMA 3SNOA 5GONF 4EFBA 4E6NA 3KREA 3AW8A 5I5WA 2COGA 3K3PA 1I7NA 5K3WA 4O7SA 1UC8A 2HHFA 2R7LA 3R23A 5HNEA 4TVIA 2YW2A 3SGIA 2FPGB 5EZYF 4O7LA 2QF7A 3SE7A 1TAEA 4XYMB 1G2WA 1CKOA 3VOTA 2DWCA 2NU8B 3T9FA 4O4LF 4MV8A 4MV6A 1GSHA 3U55A 1KUTA 2GLTA 2EJ2A 3LP8A 3RR5A 4O4HF 3NBYB 5J2TF 3GDEA 4C5CA 2YZGA 1M0WA 2HGXA 4CKCA 1XDNA 3LQSA 3W5OA 1OBGA 5KX5F 2R86A 4UCTA 3T9DA 2Q7DA 2HVRA 1B6RA 2I87A 2CZGA 4I4TF 1GLVA 5DGIA 2QB5A 2HG8A 4DQNA 2OLSA 1VBHA 2NU6B 1EUDB 2VUGA 2X5RA 4YB8B 4I55F 5FR9A 5CA0F 1WRVA 2YZLA 4YJ3F 2ODTX 1EUCB 2Q2TA 2QK4A 1B04A 1CKNA 2HIVA 3HB9A 1E4EB 4CMFA 3UQ8A 3JRWA 2YL2A 2R84A 2GQSA 5BYBA 1A9XA 4CKBA 4ZOLF 4M0JA 1W96A 5CB4F 1GGOA 2DZDA 1IYDA 4IHJF 4EG0A 5BWRA 3ETJA 5FPRA 2HVQA 1FVIA 4WHXA 5LOVF 2VR1A 2V59A 5FNVF 5HV6A 1JKJB 3OUZA 4GLXA 3KAKA 3BAAA 3N8DA 1M6VA 3T7AA 4O7WA 3G8DA 4ME6A 4FFRA 4LH7A 2EIYA 4I50F 5BYAA 1EKPA 5JH7F 5DAAA 3JZ6A 4O7YA 4E4TA 3R5FA 4XX0B 5LP6F 2DABA 2CFMA 5D1OA 5CA1F 4EQ5A 3JSLA 1M0TA 1I1LA 2V58A 5I5SA 5D8DA 2J9GA 2XCLA 5BWWA 2VPQA 4UUGA 1V9PA 1IOWA 2I8CA 4MV4A 1VBGA 4O2BF 5IYZF 1CE8A 2WYOA 5BWVA 1PK8A 4UFZA 4L1KA 4RCNA 3QWUA 1KJJA 1EKVA 3QFFA 4IWXA 4CKEA 3TW7A 3VNNA 4DRFA 1KJ9A 4MV7A 4DAAA 3V4ZA 1CKMA 4O84A 4MV1A 4O82A 3Q2OA 3WWJA 4MV3A 4UCSA 2R85A 2ZDGA 3DF7A 3TW6A 3LWBA 2W70A 3RFCA 5LYJF 5CAEB 1C30A 4PBCA 2HJWA 2A1HA 1A0GA 2HDKA 3HT5A 4FFNA 4XZ3B 1C3OA 1KTAA 3NBZB 3NUAA 5BMVF 5I47A 2CNUA 1S68A 1P8LA 2EJ0A 3K5IA 3KAJA 3W1GA 2X0SA 2XD4A 2YZMA 3MWEA 2DLNA 4M9UA 2I80A 1P16A 1UC9A 4FGRA 1A48A 4C5AA 5JQWA 4YAKB 3JZFA 4QSHA 5BWXA 4PZ8A 3ETHA 1AUVA 2YS7A 2DAAA 3I12A 3T9CA 2YRWA 5KS8A 1I1KA 4CHIA 4HQ6A 4FU0A 3KYHC 4DLKA 4ZQIA 5DGHA 2R82A 3T54A 1VKZA 1KBLA 5JVLA 1CS0A 3K5HA 3Q1KA 5H80A 4CC5A 2W6ZA 5BWUA 3DTGA 1BNCA 2W6QA 4NYEA 3JRXA 1EKFA 1WR2A 3WWIA 4YJ2F 5K2MA 3QQMA 4MV9A 4FFMA 4UCUA 2FP4B 2PVPA 3RV4A 1KC7A 1SCUB 1EYZA 2HIXA 3GJXB 4CMDA 1KJQA 4YAJB 2OWOA 3BG5A 4PZ7A 5BWTA 3JSNA 2GPSA 4NZNA 4WBNF 3VMMA 2W71A 3CEBA 3G8CA 4Q4CA 4HN2A 2PN1A 4FE2A 3R5HA 1I2LA 3L2PA 3GIDA 5JQGF 3MJFA 2HGWA 5C1OA 4LH6A 3UYYA 2W6MA 1B6SA 2ABJA 2Y4RA 3E5NA 3V4SA 4HNVA 3ORRA 4MAMA 3PN1A 4FFOA 3CSWA 1AUXA 3NC0B 5C8YF 4Y8VB 4FFLA 5HBRB 2IP4A 4TV8F 1JLLB 3T9AA 3BA9A 1GSOA 1W93A 3T9EA 4FFPA 1DGSA 5I5XA 5LXTF 2COJA 2FB9A 3U0GA 4O7ZA 3DTFA 5JVDF 2C00A 2R7KA 2NU7B 1TA8A 2DIKA 4EGQA 3TINA 3VA7A 2Z02A 3WO0A 1IOVA 4K6NA 3T99A 5I5VA 1ULZA 4ZI7F 3VPBA 2NU9B 1IYEA 5C1PA 3KALA 3TIIA 5DISC 3BABA 4O83A 5I5UA 4IWYA 1T36A 4NZMA 3T9BA 2HHFB 3HBLA 3HO8A 2CNQA 3W1BA 2GQRA 1CQIB 1Z2OX 3AX6A 4O4JF 4CC6A 1DIKA 4XYLB 3VPCA 3TY5A 2R7NA 4O7RA 5FPOA 1VS0A 2W6NA 4UCVA 4O86A 1DAAA 3R9RA 2YYAA 1ET0A 2CNVA 4MA0A 1JDEA 1A0IA 4HNTA 2COIA 5BPFA 4O7TA 3VPDA 3WWHA 2R87A 1E4EA 2GPWA 3GB8B 1I2KA 1Z2NX 1I7LA 4O81A 1A3GA 3TQTA 1X9NA 3TY9A 4TV9F 1Z2PX 2FPIB 3UFXB 2ZGIA 5D1PA 3RV3A 4GLWA 1CKNB 3GLKA 1JDBB 3BA8A 3LULA 3OUUA 5I60A 3UZOA 4HR7A 4IIJF 2R7MA 3DAAA 2YS6A 1DV1A 4TUYF 3U9TA 1KEEA 2YZNA 3PFFA 1PX2A 5LA6F 4C5BA 1DV2A 2SCUB 4IZOA 4ZHQF 5CE8A 2W6PA 2YRXA 3R5XA 5J2UF 2ZDHA 4EGJA 3WO1A 2P0AA 4O2AF 4TM5A 2Z04A 3TY8A 3N6RA 5CM0A 4EEQA 2PBZA 3RTXA 5E25A 4Q4DA 2EJ3A 4RZQA 4UCRA 4NZOA 2YWVA 3U54A 1XK5A 4HNUA 1ZAUA 2HGSA 1I1MA 2ZDQA 1KJIA 3JZIA 4EFEA 5CR5A 3ORQA 1KJ8A 1GSAA 1BXRA 2V5AA 3UZBA 5BPHA 5DMXA 4CE5A 3S24A 5KKNB 4O4IF 5D1OB 2HVSA 3BACA 3TIGA 1KT8A 1EHIA 3U9SA 1OBDA 2Q2UA 3RUPA 2VQDA 5I5YA 4YBZB 5I5TA 4PZ6A 2W6OA 2FPPB 4UCOA 4MA5A 3TEKA 4O7NA 4O7VA 3WNZA 4JXUA 1CQJB
chains in the Genus database with same CATH topology
1DAAA 1ET0A 3SNOA 5K2MA 5I5WA 2COGA 3QQMA 2COIA 2DABA 5K3WA 1UC8A 3VPDA 2HHFA 3WWHA 5HNEA 1I1LA 1I2KA 5I5SA 4TVIA 3SGIA 5BWWA 4UUGA 4CMDA 1G2WA 1A3GA 3T9FA 5BWTA 4NZNA 3CEBA 4Q4CA 5BWVA 2ZGIA 4HN2A 4RCNA 2EJ2A 1EKVA 1I2LA 4IWXA 4CKEA 4GLWA 3TW7A 2HGXA 4CKCA 2HGWA 3LULA 3UYYA 4DAAA 3LQSA 2ABJA 2Y4RA 3T9DA 3WWJA 5I60A 2Q7DA 3UZOA 5DGIA 3CSWA 3DAAA 2QB5A 2HG8A 3PFFA 4DQNA 2X5RA 5FR9A 4PBCA 2A1HA 2HDKA 1A0GA 1WRVA 3HT5A 2ODTX 3T9AA 1KTAA 3T9EA 5CE8A 5I47A 5I5XA 2COJA 2EJ0A 4CMFA 3U0GA 3DTFA 4TM5A 5BYBA 5CM0A 4CKBA 4M0JA 5E25A 4Q4DA 1UC9A 2EJ3A 4K6NA 4NZOA 3T99A 1IYDA 5I5VA 5BWXA 1ZAUA 5BWRA 1IYEA 1I1MA 4WHXA 2DAAA 3T9CA 5KS8A 1I1KA 4CHIA 5CR5A 3UZBA 5I5UA 4IWYA 4CE5A 5DGHA 4NZMA 3T9BA 2HHFB 3T54A 3BACA 1KT8A 3T7AA 5BWUA 3DTGA 5I5YA 2EIYA 5I5TA 5BYAA 1EKPA 5DAAA 3TEKA 1EKFA 3JZ6A 3WWIA 4JXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5R A; 
#chains in the Genus database with same CATH topology
 1EZ1 A;  3MWD A;  2NUA B;  4DIM A;  3SNO A;  5GON F;  4EFB A;  4E6N A;  3KRE A;  3AW8 A;  5I5W A;  2COG A;  3K3P A;  1I7N A;  5K3W A;  4O7S A;  1UC8 A;  2HHF A;  2R7L A;  3R23 A;  5HNE A;  4TVI A;  2YW2 A;  3SGI A;  2FPG B;  5EZY F;  4O7L A;  2QF7 A;  3SE7 A;  1TAE A;  4XYM B;  1G2W A;  1CKO A;  3VOT A;  2DWC A;  2NU8 B;  3T9F A;  4O4L F;  4MV8 A;  4MV6 A;  1GSH A;  3U55 A;  1KUT A;  2GLT A;  2EJ2 A;  3LP8 A;  3RR5 A;  4O4H F;  3NBY B;  5J2T F;  3GDE A;  4C5C A;  2YZG A;  1M0W A;  2HGX A;  4CKC A;  1XDN A;  3LQS A;  3W5O A;  1OBG A;  5KX5 F;  2R86 A;  4UCT A;  3T9D A;  2Q7D A;  2HVR A;  1B6R A;  2I87 A;  2CZG A;  4I4T F;  1GLV A;  5DGI A;  2QB5 A;  2HG8 A;  4DQN A;  2OLS A;  1VBH A;  2NU6 B;  1EUD B;  2VUG A;  2X5R A;  4YB8 B;  4I55 F;  5FR9 A;  5CA0 F;  1WRV A;  2YZL A;  4YJ3 F;  2ODT X;  1EUC B;  2Q2T A;  2QK4 A;  1B04 A;  1CKN A;  2HIV A;  3HB9 A;  1E4E B;  4CMF A;  3UQ8 A;  3JRW A;  2YL2 A;  2R84 A;  2GQS A;  5BYB A;  1A9X A;  4CKB A;  4ZOL F;  4M0J A;  1W96 A;  5CB4 F;  1GGO A;  2DZD A;  1IYD A;  4IHJ F;  4EG0 A;  5BWR A;  3ETJ A;  5FPR A;  2HVQ A;  1FVI A;  4WHX A;  5LOV F;  2VR1 A;  2V59 A;  5FNV F;  5HV6 A;  1JKJ B;  3OUZ A;  4GLX A;  3KAK A;  3BAA A;  3N8D A;  1M6V A;  3T7A A;  4O7W A;  3G8D A;  4ME6 A;  4FFR A;  4LH7 A;  2EIY A;  4I50 F;  5BYA A;  1EKP A;  5JH7 F;  5DAA A;  3JZ6 A;  4O7Y A;  4E4T A;  3R5F A;  4XX0 B;  5LP6 F;  2DAB A;  2CFM A;  5D1O A;  5CA1 F;  4EQ5 A;  3JSL A;  1M0T A;  1I1L A;  2V58 A;  5I5S A;  5D8D A;  2J9G A;  2XCL A;  5BWW A;  2VPQ A;  4UUG A;  1V9P A;  1IOW A;  2I8C A;  4MV4 A;  1VBG A;  4O2B F;  5IYZ F;  1CE8 A;  2WYO A;  5BWV A;  1PK8 A;  4UFZ A;  4L1K A;  4RCN A;  3QWU A;  1KJJ A;  1EKV A;  3QFF A;  4IWX A;  4CKE A;  3TW7 A;  3VNN A;  4DRF A;  1KJ9 A;  4MV7 A;  4DAA A;  3V4Z A;  1CKM A;  4O84 A;  4MV1 A;  4O82 A;  3Q2O A;  3WWJ A;  4MV3 A;  4UCS A;  2R85 A;  2ZDG A;  3DF7 A;  3TW6 A;  3LWB A;  2W70 A;  3RFC A;  5LYJ F;  5CAE B;  1C30 A;  4PBC A;  2HJW A;  2A1H A;  1A0G A;  2HDK A;  3HT5 A;  4FFN A;  4XZ3 B;  1C3O A;  1KTA A;  3NBZ B;  3NUA A;  5BMV F;  5I47 A;  2CNU A;  1S68 A;  1P8L A;  2EJ0 A;  3K5I A;  3KAJ A;  3W1G A;  2X0S A;  2XD4 A;  2YZM A;  3MWE A;  2DLN A;  4M9U A;  2I80 A;  1P16 A;  1UC9 A;  4FGR A;  1A48 A;  4C5A A;  5JQW A;  4YAK B;  3JZF A;  4QSH A;  5BWX A;  4PZ8 A;  3ETH A;  1AUV A;  2YS7 A;  2DAA A;  3I12 A;  3T9C A;  2YRW A;  5KS8 A;  1I1K A;  4CHI A;  4HQ6 A;  4FU0 A;  3KYH C;  4DLK A;  4ZQI A;  5DGH A;  2R82 A;  3T54 A;  1VKZ A;  1KBL A;  5JVL A;  1CS0 A;  3K5H A;  3Q1K A;  5H80 A;  4CC5 A;  2W6Z A;  5BWU A;  3DTG A;  1BNC A;  2W6Q A;  4NYE A;  3JRX A;  1EKF A;  1WR2 A;  3WWI A;  4YJ2 F;  5K2M A;  3QQM A;  4MV9 A;  4FFM A;  4UCU A;  2FP4 B;  2PVP A;  3RV4 A;  1KC7 A;  1SCU B;  1EYZ A;  2HIX A;  3GJX B;  4CMD A;  1KJQ A;  4YAJ B;  2OWO A;  3BG5 A;  4PZ7 A;  5BWT A;  3JSN A;  2GPS A;  4NZN A;  4WBN F;  3VMM A;  2W71 A;  3CEB A;  3G8C A;  4Q4C A;  4HN2 A;  2PN1 A;  4FE2 A;  3R5H A;  1I2L A;  3L2P A;  3GID A;  5JQG F;  3MJF A;  2HGW A;  5C1O A;  4LH6 A;  3UYY A;  2W6M A;  1B6S A;  2ABJ A;  2Y4R A;  3E5N A;  3V4S A;  4HNV A;  3ORR A;  4MAM A;  3PN1 A;  4FFO A;  3CSW A;  1AUX A;  3NC0 B;  5C8Y F;  4Y8V B;  4FFL A;  5HBR B;  2IP4 A;  4TV8 F;  1JLL B;  3T9A A;  3BA9 A;  1GSO A;  1W93 A;  3T9E A;  4FFP A;  1DGS A;  5I5X A;  5LXT F;  2COJ A;  2FB9 A;  3U0G A;  4O7Z A;  3DTF A;  5JVD F;  2C00 A;  2R7K A;  2NU7 B;  1TA8 A;  2DIK A;  4EGQ A;  3TIN A;  3VA7 A;  2Z02 A;  3WO0 A;  1IOV A;  4K6N A;  3T99 A;  5I5V A;  1ULZ A;  4ZI7 F;  3VPB A;  2NU9 B;  1IYE A;  5C1P A;  3KAL A;  3TII A;  5DIS C;  3BAB A;  4O83 A;  5I5U A;  4IWY A;  1T36 A;  4NZM A;  3T9B A;  2HHF B;  3HBL A;  3HO8 A;  2CNQ A;  3W1B A;  2GQR A;  1CQI B;  1Z2O X;  3AX6 A;  4O4J F;  4CC6 A;  1DIK A;  4XYL B;  3VPC A;  3TY5 A;  2R7N A;  4O7R A;  5FPO A;  1VS0 A;  2W6N A;  4UCV A;  4O86 A;  1DAA A;  3R9R A;  2YYA A;  1ET0 A;  2CNV A;  4MA0 A;  1JDE A;  1A0I A;  4HNT A;  2COI A;  5BPF A;  4O7T A;  3VPD A;  3WWH A;  2R87 A;  1E4E A;  2GPW A;  3GB8 B;  1I2K A;  1Z2N X;  1I7L A;  4O81 A;  1A3G A;  3TQT A;  1X9N A;  3TY9 A;  4TV9 F;  1Z2P X;  2FPI B;  3UFX B;  2ZGI A;  5D1P A;  3RV3 A;  4GLW A;  1CKN B;  3GLK A;  1JDB B;  3BA8 A;  3LUL A;  3OUU A;  5I60 A;  3UZO A;  4HR7 A;  4IIJ F;  2R7M A;  3DAA A;  2YS6 A;  1DV1 A;  4TUY F;  3U9T A;  1KEE A;  2YZN A;  3PFF A;  1PX2 A;  5LA6 F;  4C5B A;  1DV2 A;  2SCU B;  4IZO A;  4ZHQ F;  5CE8 A;  2W6P A;  2YRX A;  3R5X A;  5J2U F;  2ZDH A;  4EGJ A;  3WO1 A;  2P0A A;  4O2A F;  4TM5 A;  2Z04 A;  3TY8 A;  3N6R A;  5CM0 A;  4EEQ A;  2PBZ A;  3RTX A;  5E25 A;  4Q4D A;  2EJ3 A;  4RZQ A;  4UCR A;  4NZO A;  2YWV A;  3U54 A;  1XK5 A;  4HNU A;  1ZAU A;  2HGS A;  1I1M A;  2ZDQ A;  1KJI A;  3JZI A;  4EFE A;  5CR5 A;  3ORQ A;  1KJ8 A;  1GSA A;  1BXR A;  2V5A A;  3UZB A;  5BPH A;  5DMX A;  4CE5 A;  3S24 A;  5KKN B;  4O4I F;  5D1O B;  2HVS A;  3BAC A;  3TIG A;  1KT8 A;  1EHI A;  3U9S A;  1OBD A;  2Q2U A;  3RUP A;  2VQD A;  5I5Y A;  4YBZ B;  5I5T A;  4PZ6 A;  2W6O A;  2FPP B;  4UCO A;  4MA5 A;  3TEK A;  4O7N A;  4O7V A;  3WNZ A;  4JXU A;  1CQJ B; 
#chains in the Genus database with same CATH homology
 1DAA A;  1ET0 A;  3SNO A;  5K2M A;  5I5W A;  2COG A;  3QQM A;  2COI A;  2DAB A;  5K3W A;  1UC8 A;  3VPD A;  2HHF A;  3WWH A;  5HNE A;  1I1L A;  1I2K A;  5I5S A;  4TVI A;  3SGI A;  5BWW A;  4UUG A;  4CMD A;  1G2W A;  1A3G A;  3T9F A;  5BWT A;  4NZN A;  3CEB A;  4Q4C A;  5BWV A;  2ZGI A;  4HN2 A;  4RCN A;  2EJ2 A;  1EKV A;  1I2L A;  4IWX A;  4CKE A;  4GLW A;  3TW7 A;  2HGX A;  4CKC A;  2HGW A;  3LUL A;  3UYY A;  4DAA A;  3LQS A;  2ABJ A;  2Y4R A;  3T9D A;  3WWJ A;  5I60 A;  2Q7D A;  3UZO A;  5DGI A;  3CSW A;  3DAA A;  2QB5 A;  2HG8 A;  3PFF A;  4DQN A;  2X5R A;  5FR9 A;  4PBC A;  2A1H A;  2HDK A;  1A0G A;  1WRV A;  3HT5 A;  2ODT X;  3T9A A;  1KTA A;  3T9E A;  5CE8 A;  5I47 A;  5I5X A;  2COJ A;  2EJ0 A;  4CMF A;  3U0G A;  3DTF A;  4TM5 A;  5BYB A;  5CM0 A;  4CKB A;  4M0J A;  5E25 A;  4Q4D A;  1UC9 A;  2EJ3 A;  4K6N A;  4NZO A;  3T99 A;  1IYD A;  5I5V A;  5BWX A;  1ZAU A;  5BWR A;  1IYE A;  1I1M A;  4WHX A;  2DAA A;  3T9C A;  5KS8 A;  1I1K A;  4CHI A;  5CR5 A;  3UZB A;  5I5U A;  4IWY A;  4CE5 A;  5DGH A;  4NZM A;  3T9B A;  2HHF B;  3T54 A;  3BAC A;  1KT8 A;  3T7A A;  5BWU A;  3DTG A;  5I5Y A;  2EIY A;  5I5T A;  5BYA A;  1EKP A;  5DAA A;  3TEK A;  1EKF A;  3JZ6 A;  3WWI A;  4JXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...