2X5RA

Crystal structure of the hypothetical protein orf126 from pyrobaculum spherical virus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
GAMARVGPKIEITHGGKKYTVFSKVTHLVPRTENGEEAEYVVFGPEKEGVISVVVLAPKDLNEEALALRVKWFNDTKPRCVKCGAAYNGKNHFRVVAIRNGTYYLDAVCDKCEPRITWLSAIVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
molecule tags Viral protein
molecule keywords HYPOTHETICAL PROTEIN ORF126
total genus 28
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.40 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2x5rA01
2X5RA
chains in the Genus database with same CATH superfamily
3TY8A 2W71A 3LULA 2VPQA 3QWUA 2W6NA 1I1LA 3ORRA 1XK5A 5I5VA 2OWOA 4LH6A 4O4IF 3QFFA 3ETHA 1VS0A 3GDEA 2HVQA 4MV1A 3G8DA 3UZBA 3WWHA 5FPOA 2Z02A 3PFFA 4MV7A 1EHIA 3BG5A 3W5OA 2WYOA 2XD4A 3U9SA 5KX5F 2HVRA 2DZDA 3RV4A 1E4EA 4EGQA 1ET0A 5E25A 2ZGIA 3V4ZA 5HBRB 1EZ1A 2NU7B 1GSHA 3UZOA 4CKEA 3HB9A 4FFPA 5LP6F 4O4LF 2HGWA 3Q1KA 4HNVA 4O86A 4TVIA 4Q4CA 2YYAA 3Q2OA 1KC7A 1A0GA 3TW6A 5BMVF 2NU9B 5FR9A 2ZDGA 2GLTA 3OUZA 3CSWA 4CC6A 2R7KA 2IP4A 2NU8B 4Q4DA 1P8LA 3WWIA 4DQNA 5I5SA 4IZOA 3VOTA 3VMMA 1IYDA 2YW2A 2PVPA 5BYAA 2W70A 2COIA 2YRWA 1P16A 3ORQA 3CEBA 3BAAA 4TUYF 2Y4RA 5BPHA 2HHFB 1V9PA 1KBLA 5DISC 1I7LA 5C1PA 2R82A 4O84A 2C00A 3UQ8A 4MAMA 3JSNA 4MV3A 3VNNA 3N8DA 4K6NA 4TM5A 5I5XA 1DGSA 4UFZA 1EKVA 3TINA 2SCUB 5J2UF 1KTAA 2HHFA 4WHXA 3T9BA 1EYZA 4EGJA 1G2WA 3TEKA 4GLXA 3BA8A 1ZAUA 3KAKA 1B04A 4HNUA 3NC0B 4CC5A 4I55F 5FPRA 4YAJB 4O83A 1W96A 3PN1A 3BA9A 5BWRA 2R7LA 4MA0A 3JRXA 1M0TA 1S68A 1TA8A 1I1KA 2P0AA 1OBDA 5IYZF 2YS6A 1JLLB 2YL2A 1BNCA 4YBZB 1DIKA 4MV6A 4HNTA 1M0WA 3SE7A 3UYYA 2R7MA 5DGHA 3DTFA 3LWBA 4HN2A 2V5AA 3MWEA 2Q2UA 1XDNA 3S24A 5HNEA 5FNVF 1VBGA 4XX0B 2GPSA 4MV9A 1DV1A 3RUPA 5C1OA 1WRVA 4O7NA 2HIVA 4EQ5A 1I1MA 4CE5A 5D8DA 2HGSA 1Z2NX 3N6RA 2I8CA 3DF7A 3VPBA 2EJ0A 2R84A 2EJ3A 1VKZA 5D1PA 4O7TA 3T9AA 1B6RA 1A3GA 1JKJB 2W6OA 1X9NA 3JZ6A 2Q7DA 1B6SA 4PZ7A 4CKBA 4XYMB 2EJ2A 2Z04A 3KREA 3TQTA 1A9XA 1PX2A 5GONF 3WNZA 3GB8B 4MV8A 3KALA 2X5RA 3R9RA 1CKNA 2YZGA 3AX6A 2R85A 2A1HA 5LOVF 1KT8A 1I7NA 4C5CA 5K2MA 4CMFA 2DLNA 3TY9A 5LA6F 2CFMA 1KJQA 3LQSA 4FU0A 4C5AA 3MJFA 4O7YA 1C3OA 4O7LA 5I5UA 2HVSA 1PK8A 3VA7A 4JXUA 2DIKA 5CM0A 3LP8A 3RTXA 3T9DA 1W93A 4UUGA 1DAAA 2DABA 3GLKA 4FFOA 4NYEA 5BWVA 2CNUA 1KEEA 1T36A 3JZFA 4YAKB 2W6MA 2R87A 3R5XA 2FP4B 1C30A 1A48A 3TY5A 3U9TA 3R5FA 2W6PA 1GGOA 5I5TA 2W6ZA 4FFMA 1Z2OX 3RV3A 3DAAA 4ZI7F 1M6VA 4UCTA 4IWYA 2YZLA 4QSHA 5CAEB 2PN1A 5KKNB 4FE2A 2I80A 2ZDQA 4I50F 4FGRA 3RR5A 2NU6B 4O4HF 3RFCA 3AW8A 4O7WA 4CMDA 3BABA 3K5HA 2FPPB 5LYJF 2CNVA 4GLWA 4C5BA 3T7AA 1KUTA 5I5WA 1JDBB 1E4EB 3E5NA 3SNOA 1FVIA 1GSAA 2HIXA 3T54A 4PZ6A 5EZYF 3U54A 4M0JA 3NBYB 2YZNA 3GIDA 4O81A 3GJXB 4HQ6A 5CA1F 2XCLA 2ODTX 5CR5A 4PZ8A 2QB5A 1CS0A 4RCNA 2Q2TA 3MWDA 5H80A 2FB9A 3DTGA 3G8CA 3BACA 3U55A 4WBNF 2I87A 4O2BF 2X0SA 3R5HA 3K5IA 3KYHC 4DRFA 4DAAA 4YB8B 1Z2PX 4E6NA 4IWXA 3SGIA 4HR7A 5CE8A 2GPWA 3NBZB 5J2TF 4YJ2F 4UCRA 3T9CA 4NZOA 2COJA 2YZMA 4E4TA 1KJ8A 4XYLB 5CA0F 4IIJF 4XZ3B 4UCUA 2GQSA 1IYEA 1KJIA 4EFBA 5JQGF 4ZOLF 5K3WA 4IHJF 1SCUB 4NZMA 4FFRA 2VUGA 5JH7F 2J9GA 2DAAA 2NUAB 1CKNB 1UC8A 2PBZA 4YJ3F 5JVLA 5BYBA 5BPFA 1BXRA 4M9UA 4O4JF 3K3PA 1VBHA 3JZIA 5I47A 4CHIA 1IOWA 3TW7A 3R23A 3VPCA 1GSOA 2YS7A 2COGA 2HG8A 1TAEA 2CNQA 5D1OA 2DWCA 5HV6A 5JVDF 4O82A 4UCOA 1OBGA 1CQJB 5LXTF 1UC9A 4O7RA 1JDEA 2HDKA 5I60A 3L2PA 1EKPA 2GQRA 3T9FA 3T99A 3NUAA 1EKFA 2ABJA 1AUVA 5KS8A 3HBLA 1EUDB 4RZQA 3JSLA 1KJ9A 5DMXA 3I12A 4O7ZA 4MV4A 3TIGA 1ULZA 2ZDHA 3T9EA 2FPIB 1DV2A 2HGXA 4CKCA 3KAJA 1EUCB 2HJWA 1IOVA 4PBCA 2OLSA 2QF7A 1GLVA 3OUUA 1CE8A 3WO0A 2YRXA 4O2AF 4TV8F 3VPDA 4LH7A 3WWJA 3V4SA 4NZNA 4UCVA 3WO1A 2VQDA 4O7SA 2R7NA 2QK4A 5I5YA 1KJJA 4ZHQF 5BWTA 1AUXA 4Y8VB 4I4TF 1I2LA 4FFNA 5BWXA 4TV9F 4MA5A 3UFXB 5BWUA 2CZGA 4FFLA 3HT5A 5C8YF 5DAAA 4DLKA 1I2KA 3W1GA 3HO8A 4EEQA 4EFEA 2EIYA 2R86A 1CQIB 2YWVA 3ETJA 4O7VA 3U0GA 2V58A 4ZQIA 1WR2A 5CB4F 3W1BA 1CKOA 3QQMA 4UCSA 1CKMA 3TIIA 5D1OB 3JRWA 4ME6A 2W6QA 5DGIA 4EG0A 2V59A 1A0IA 4DIMA 4L1KA 5JQWA 2VR1A 5BWWA 2FPGB
chains in the Genus database with same CATH topology
1KTAA 2HHFA 4WHXA 3LULA 3T9BA 4CHIA 1G2WA 3TW7A 3TEKA 1ZAUA 1I1LA 5I5VA 5I5TA 2COGA 2HG8A 3DAAA 4IWYA 5BWRA 1UC9A 3UZBA 3WWHA 2HDKA 3PFFA 5I60A 1EKPA 3T9FA 3T99A 1EKFA 2ABJA 1I1KA 5KS8A 4CMDA 1ET0A 4GLWA 5E25A 2ZGIA 3T9EA 3T7AA 3UYYA 5DGHA 5I5WA 2HGXA 4CKCA 3DTFA 3SNOA 4HN2A 3T54A 4M0JA 4PBCA 5HNEA 3UZOA 4CKEA 1WRVA 3VPDA 1I1MA 2HGWA 4CE5A 2ODTX 3WWJA 5CR5A 4TVIA 2QB5A 4NZNA 4RCNA 4Q4CA 2EJ0A 3DTGA 3BACA 2EJ3A 1A0GA 3T9AA 5I5YA 5BWTA 4DAAA 1A3GA 5FR9A 3CSWA 4IWXA 3SGIA 3JZ6A 2Q7DA 1I2LA 4CKBA 5BWXA 2EJ2A 4Q4DA 5BWUA 5CE8A 3WWIA 4DQNA 3T9CA 4NZOA 5I5SA 2COJA 3HT5A 1IYDA 5DAAA 2X5RA 5BYAA 2COIA 1I2KA 3CEBA 2Y4RA 2A1HA 1KT8A 2EIYA 5K2MA 4CMFA 2HHFB 3U0GA 1IYEA 3LQSA 5K3WA 3QQMA 4NZMA 5I5UA 2DAAA 4JXUA 4K6NA 4TM5A 5CM0A 3T9DA 4UUGA 1UC8A 1DAAA 5I5XA 5BYBA 2DABA 5DGIA 1EKVA 5BWVA 5BWWA 5I47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5R A; 
#chains in the Genus database with same CATH topology
 3TY8 A;  2W71 A;  3LUL A;  2VPQ A;  3QWU A;  2W6N A;  1I1L A;  3ORR A;  1XK5 A;  5I5V A;  2OWO A;  4LH6 A;  4O4I F;  3QFF A;  3ETH A;  1VS0 A;  3GDE A;  2HVQ A;  4MV1 A;  3G8D A;  3UZB A;  3WWH A;  5FPO A;  2Z02 A;  3PFF A;  4MV7 A;  1EHI A;  3BG5 A;  3W5O A;  2WYO A;  2XD4 A;  3U9S A;  5KX5 F;  2HVR A;  2DZD A;  3RV4 A;  1E4E A;  4EGQ A;  1ET0 A;  5E25 A;  2ZGI A;  3V4Z A;  5HBR B;  1EZ1 A;  2NU7 B;  1GSH A;  3UZO A;  4CKE A;  3HB9 A;  4FFP A;  5LP6 F;  4O4L F;  2HGW A;  3Q1K A;  4HNV A;  4O86 A;  4TVI A;  4Q4C A;  2YYA A;  3Q2O A;  1KC7 A;  1A0G A;  3TW6 A;  5BMV F;  2NU9 B;  5FR9 A;  2ZDG A;  2GLT A;  3OUZ A;  3CSW A;  4CC6 A;  2R7K A;  2IP4 A;  2NU8 B;  4Q4D A;  1P8L A;  3WWI A;  4DQN A;  5I5S A;  4IZO A;  3VOT A;  3VMM A;  1IYD A;  2YW2 A;  2PVP A;  5BYA A;  2W70 A;  2COI A;  2YRW A;  1P16 A;  3ORQ A;  3CEB A;  3BAA A;  4TUY F;  2Y4R A;  5BPH A;  2HHF B;  1V9P A;  1KBL A;  5DIS C;  1I7L A;  5C1P A;  2R82 A;  4O84 A;  2C00 A;  3UQ8 A;  4MAM A;  3JSN A;  4MV3 A;  3VNN A;  3N8D A;  4K6N A;  4TM5 A;  5I5X A;  1DGS A;  4UFZ A;  1EKV A;  3TIN A;  2SCU B;  5J2U F;  1KTA A;  2HHF A;  4WHX A;  3T9B A;  1EYZ A;  4EGJ A;  1G2W A;  3TEK A;  4GLX A;  3BA8 A;  1ZAU A;  3KAK A;  1B04 A;  4HNU A;  3NC0 B;  4CC5 A;  4I55 F;  5FPR A;  4YAJ B;  4O83 A;  1W96 A;  3PN1 A;  3BA9 A;  5BWR A;  2R7L A;  4MA0 A;  3JRX A;  1M0T A;  1S68 A;  1TA8 A;  1I1K A;  2P0A A;  1OBD A;  5IYZ F;  2YS6 A;  1JLL B;  2YL2 A;  1BNC A;  4YBZ B;  1DIK A;  4MV6 A;  4HNT A;  1M0W A;  3SE7 A;  3UYY A;  2R7M A;  5DGH A;  3DTF A;  3LWB A;  4HN2 A;  2V5A A;  3MWE A;  2Q2U A;  1XDN A;  3S24 A;  5HNE A;  5FNV F;  1VBG A;  4XX0 B;  2GPS A;  4MV9 A;  1DV1 A;  3RUP A;  5C1O A;  1WRV A;  4O7N A;  2HIV A;  4EQ5 A;  1I1M A;  4CE5 A;  5D8D A;  2HGS A;  1Z2N X;  3N6R A;  2I8C A;  3DF7 A;  3VPB A;  2EJ0 A;  2R84 A;  2EJ3 A;  1VKZ A;  5D1P A;  4O7T A;  3T9A A;  1B6R A;  1A3G A;  1JKJ B;  2W6O A;  1X9N A;  3JZ6 A;  2Q7D A;  1B6S A;  4PZ7 A;  4CKB A;  4XYM B;  2EJ2 A;  2Z04 A;  3KRE A;  3TQT A;  1A9X A;  1PX2 A;  5GON F;  3WNZ A;  3GB8 B;  4MV8 A;  3KAL A;  2X5R A;  3R9R A;  1CKN A;  2YZG A;  3AX6 A;  2R85 A;  2A1H A;  5LOV F;  1KT8 A;  1I7N A;  4C5C A;  5K2M A;  4CMF A;  2DLN A;  3TY9 A;  5LA6 F;  2CFM A;  1KJQ A;  3LQS A;  4FU0 A;  4C5A A;  3MJF A;  4O7Y A;  1C3O A;  4O7L A;  5I5U A;  2HVS A;  1PK8 A;  3VA7 A;  4JXU A;  2DIK A;  5CM0 A;  3LP8 A;  3RTX A;  3T9D A;  1W93 A;  4UUG A;  1DAA A;  2DAB A;  3GLK A;  4FFO A;  4NYE A;  5BWV A;  2CNU A;  1KEE A;  1T36 A;  3JZF A;  4YAK B;  2W6M A;  2R87 A;  3R5X A;  2FP4 B;  1C30 A;  1A48 A;  3TY5 A;  3U9T A;  3R5F A;  2W6P A;  1GGO A;  5I5T A;  2W6Z A;  4FFM A;  1Z2O X;  3RV3 A;  3DAA A;  4ZI7 F;  1M6V A;  4UCT A;  4IWY A;  2YZL A;  4QSH A;  5CAE B;  2PN1 A;  5KKN B;  4FE2 A;  2I80 A;  2ZDQ A;  4I50 F;  4FGR A;  3RR5 A;  2NU6 B;  4O4H F;  3RFC A;  3AW8 A;  4O7W A;  4CMD A;  3BAB A;  3K5H A;  2FPP B;  5LYJ F;  2CNV A;  4GLW A;  4C5B A;  3T7A A;  1KUT A;  5I5W A;  1JDB B;  1E4E B;  3E5N A;  3SNO A;  1FVI A;  1GSA A;  2HIX A;  3T54 A;  4PZ6 A;  5EZY F;  3U54 A;  4M0J A;  3NBY B;  2YZN A;  3GID A;  4O81 A;  3GJX B;  4HQ6 A;  5CA1 F;  2XCL A;  2ODT X;  5CR5 A;  4PZ8 A;  2QB5 A;  1CS0 A;  4RCN A;  2Q2T A;  3MWD A;  5H80 A;  2FB9 A;  3DTG A;  3G8C A;  3BAC A;  3U55 A;  4WBN F;  2I87 A;  4O2B F;  2X0S A;  3R5H A;  3K5I A;  3KYH C;  4DRF A;  4DAA A;  4YB8 B;  1Z2P X;  4E6N A;  4IWX A;  3SGI A;  4HR7 A;  5CE8 A;  2GPW A;  3NBZ B;  5J2T F;  4YJ2 F;  4UCR A;  3T9C A;  4NZO A;  2COJ A;  2YZM A;  4E4T A;  1KJ8 A;  4XYL B;  5CA0 F;  4IIJ F;  4XZ3 B;  4UCU A;  2GQS A;  1IYE A;  1KJI A;  4EFB A;  5JQG F;  4ZOL F;  5K3W A;  4IHJ F;  1SCU B;  4NZM A;  4FFR A;  2VUG A;  5JH7 F;  2J9G A;  2DAA A;  2NUA B;  1CKN B;  1UC8 A;  2PBZ A;  4YJ3 F;  5JVL A;  5BYB A;  5BPF A;  1BXR A;  4M9U A;  4O4J F;  3K3P A;  1VBH A;  3JZI A;  5I47 A;  4CHI A;  1IOW A;  3TW7 A;  3R23 A;  3VPC A;  1GSO A;  2YS7 A;  2COG A;  2HG8 A;  1TAE A;  2CNQ A;  5D1O A;  2DWC A;  5HV6 A;  5JVD F;  4O82 A;  4UCO A;  1OBG A;  1CQJ B;  5LXT F;  1UC9 A;  4O7R A;  1JDE A;  2HDK A;  5I60 A;  3L2P A;  1EKP A;  2GQR A;  3T9F A;  3T99 A;  3NUA A;  1EKF A;  2ABJ A;  1AUV A;  5KS8 A;  3HBL A;  1EUD B;  4RZQ A;  3JSL A;  1KJ9 A;  5DMX A;  3I12 A;  4O7Z A;  4MV4 A;  3TIG A;  1ULZ A;  2ZDH A;  3T9E A;  2FPI B;  1DV2 A;  2HGX A;  4CKC A;  3KAJ A;  1EUC B;  2HJW A;  1IOV A;  4PBC A;  2OLS A;  2QF7 A;  1GLV A;  3OUU A;  1CE8 A;  3WO0 A;  2YRX A;  4O2A F;  4TV8 F;  3VPD A;  4LH7 A;  3WWJ A;  3V4S A;  4NZN A;  4UCV A;  3WO1 A;  2VQD A;  4O7S A;  2R7N A;  2QK4 A;  5I5Y A;  1KJJ A;  4ZHQ F;  5BWT A;  1AUX A;  4Y8V B;  4I4T F;  1I2L A;  4FFN A;  5BWX A;  4TV9 F;  4MA5 A;  3UFX B;  5BWU A;  2CZG A;  4FFL A;  3HT5 A;  5C8Y F;  5DAA A;  4DLK A;  1I2K A;  3W1G A;  3HO8 A;  4EEQ A;  4EFE A;  2EIY A;  2R86 A;  1CQI B;  2YWV A;  3ETJ A;  4O7V A;  3U0G A;  2V58 A;  4ZQI A;  1WR2 A;  5CB4 F;  3W1B A;  1CKO A;  3QQM A;  4UCS A;  1CKM A;  3TII A;  5D1O B;  3JRW A;  4ME6 A;  2W6Q A;  5DGI A;  4EG0 A;  2V59 A;  1A0I A;  4DIM A;  4L1K A;  5JQW A;  2VR1 A;  5BWW A;  2FPG B; 
#chains in the Genus database with same CATH homology
 1KTA A;  2HHF A;  4WHX A;  3LUL A;  3T9B A;  4CHI A;  1G2W A;  3TW7 A;  3TEK A;  1ZAU A;  1I1L A;  5I5V A;  5I5T A;  2COG A;  2HG8 A;  3DAA A;  4IWY A;  5BWR A;  1UC9 A;  3UZB A;  3WWH A;  2HDK A;  3PFF A;  5I60 A;  1EKP A;  3T9F A;  3T99 A;  1EKF A;  2ABJ A;  1I1K A;  5KS8 A;  4CMD A;  1ET0 A;  4GLW A;  5E25 A;  2ZGI A;  3T9E A;  3T7A A;  3UYY A;  5DGH A;  5I5W A;  2HGX A;  4CKC A;  3DTF A;  3SNO A;  4HN2 A;  3T54 A;  4M0J A;  4PBC A;  5HNE A;  3UZO A;  4CKE A;  1WRV A;  3VPD A;  1I1M A;  2HGW A;  4CE5 A;  2ODT X;  3WWJ A;  5CR5 A;  4TVI A;  2QB5 A;  4NZN A;  4RCN A;  4Q4C A;  2EJ0 A;  3DTG A;  3BAC A;  2EJ3 A;  1A0G A;  3T9A A;  5I5Y A;  5BWT A;  4DAA A;  1A3G A;  5FR9 A;  3CSW A;  4IWX A;  3SGI A;  3JZ6 A;  2Q7D A;  1I2L A;  4CKB A;  5BWX A;  2EJ2 A;  4Q4D A;  5BWU A;  5CE8 A;  3WWI A;  4DQN A;  3T9C A;  4NZO A;  5I5S A;  2COJ A;  3HT5 A;  1IYD A;  5DAA A;  2X5R A;  5BYA A;  2COI A;  1I2K A;  3CEB A;  2Y4R A;  2A1H A;  1KT8 A;  2EIY A;  5K2M A;  4CMF A;  2HHF B;  3U0G A;  1IYE A;  3LQS A;  5K3W A;  3QQM A;  4NZM A;  5I5U A;  2DAA A;  4JXU A;  4K6N A;  4TM5 A;  5CM0 A;  3T9D A;  4UUG A;  1UC8 A;  1DAA A;  5I5X A;  5BYB A;  2DAB A;  5DGI A;  1EKV A;  5BWV A;  5BWW A;  5I47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...