1TA8A

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase, NAD-dependent
total genus 100
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ta8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1ta8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1ta8A02
4JI2B 3GJXB 3BA8A 1TAEA 4JI7B 4JI0B 2VUGA 5D1OA 1HR0B 4EFEA 4DR5B 1XDNA 4LH6A 2Q2UA 4LF4B 4JI5B 4DR2B 3GDEA 4GKJB 4OX9B 4DR7B 3L2PA 3BAAA 2F4VB 5BR8B 1DGSA 4X66B 1HNZB 2Q2TA 1IBLB 1N33B 1N34B 4DR3B 4NXNB 4DRFA 2HVSA 5D1OB 5FPRA 4JI1B 1X9NA 2HHHB 4LF8B 1XNRB 4DV5B 4CC6A 4DV2B 4LF7B 1IBKB 5IWAB 4DV7B 2UUAB 1N32B 3W1BA 3S24A 4PZ6A 5FPOA 4JV5B 4TOIA 2CFMA 5D1PA 2UXCB 4EFBA 2UXBB 3W1GA 1IBMB 4DV0B 4DUYB 1I94B 1FJGB 3JSNA 4PZ8A 1A0IA 4B3TB 3RR5A 4DR1B 4GLXA 1J5EB 4AQYB 4JI8B 3TY8A 4B3SB 3KYHC 4LFBB 4DV3B 4DUZB 4LH7A 2UXDB 4JI4B 4CC5A 3BABA 1P8LA 4X62B 2UUBB 4JI3B 4K0KB 4X64B 3NBYB 1ZAUA 4DR4B 1CKMA 1CKOA 4NXMB 1XNQB 2HIVA 1XMQB 4EEQA 3OTOB 3TY5A 1HNXB 4YHHB 5DISC 4EQ5A 4YY3B 4JYAB 3T1HB 3W5OA 4JI6B 1CKNB 4UCTA 4UCVA 3VNNA 3NC0B 2ZM6B 4DR6B 4KHPB 2VQFB 1FVIA 3PN1A 4LF6B 3RTXA 4E6NA 1S68A 1P16A 2HVRA 3TY9A 2E5LB 4UCOA 2HIXA 4LFCB 3SGIA 4X65B 4LFAB 1TA8A 4GKKB 5LMUB 3GB8B 3BA9A 1XMOB 3QWUA 2VQEB 4LF5B 1VS0A 2UUCB 4UCUA 2UU9B 1B04A 4UCSA 4LF9B 4DV6B 1CKNA 4PZ7A 5LMNB 1XK5A 4DV1B 3NBZB 3JSLA 4B3MB 1V9PA 4UCRA 3UQ8A 1N36B 1HNWB 2HVQA 2OWOA 4DV4B 4UFZA 4B3RB 3T1YB
chains in the Genus database with same CATH superfamily
1JJ2U 3GJXB 4X89A 1WB7A 1XHZA 2W70A 2YI8A 3CXCU 2ZCEA 4DR5B 2EINB 3LDCA 1PL0A 1WR2A 4P30A 3Q2OA 2EINC 2E3CA 2R7LA 2V9WA 1DF5A 2J6TA 4TQFA 3T9CA 3OSNA 3QTCA 3CPWU 3FYIB 4X66B 1WSCA 1J95A 1KT8A 1N33B 5GONA 5L3FA 2DMXA 4MAMA 4DUZH 4EKWA 3V4SA 1L0LH 2R85A 2E2IA 1M4UA 1JLLB 4IL6Z 3G8CA 1Q6HA 1S5LZ 2FK1A 3GTLA 4NTXA 1K5QA 4B3MH 4HNAA 5E79Z 1NH2B 1HNWH 2FYUH 3T1YO 3KKYA 4FBTA 4ZIBA 5IWAB 2Q6AA 4JTAB 1K34A 5HBRB 1S03G 3JASA 2RGVA 2IU3A 3CP1A 4F6RA 4X65H 4DV0H 1SQGA 3P3PA 2R9AA 4RQEA 4JI0H 4JI7H 4O7VA 4LP8A 1JOYA 3SJAC 4P9PA 2PI5A 2RDJA 4RQFA 1JCHA 1OCRC 3ML0A 3JSNA 5K1XA 5JVDB 3Q1KA 2ADQB 2Q9LA 1MZEA 3MAQA 2FP4B 1RYRA 2OH2A 3E2EA 1I50A 3HOXG 4J9RA 4GUNA 5DGHA 4FM9A 4TUYF 1BZKA 4E4TA 4L1KA 5KHHA 2UUBB 2YW2A 2FKLA 4CZZA 4F6RB 1NJIW 5CE8A 4A3KG 1HNXH 1JVMA 2QE7G 4KHPO 5L1LA 2LO1A 1W96A 2LJ2A 5LGNA 1QVFU 4NYEA 3EVKA 4A3CG 4MV9A 2B63A 2QK4A 2ZM6B 5B3SB 1RJRA 1TVKA 4FLZA 2VQFB 5L1IA 5CM0A 4ED2A 3OR7C 2Y4RA 3FX7A 1VKZA 3UZOA 4NLGA 2LW1A 4I55F 4PDRA 5JQGA 5L1JA 5J2UA 3S3XA 4I9WA 2ODTX 4CH4A 4LWSA 3SE7A 4LFCB 3HOVG 4RAYA 1EKFA 5IDJA 4LBEC 1HNZO 2JA6G 3SPGA 2YWVA 4XDKA 2EILB 1NR7A 2IU0A 1VQ6V 2V5AA 2IH3C 1I1MA 2JEXA 2D3OW 4O7WA 2IBZH 2YS7A 4P2ZA 5GTIZ 4WCEV 5EWFA 2ZE5A 3CCLV 4MVSA 1PM9A 4JAAA 5BWUA 2R8HA 5LA6F 3E8FA 3BA8A 4OX9O 4A3DG 4RZQA 2UXCO 4FJCC 1I1LA 2B5UA 3TEKA 2NVYA 2AGPA 1M0WA 2W6ZA 3GILA 1N56A 3RVYA 4TQSA 1KJQA 5BWTA 4HNAB 4DR7B 1ZSPA 3KREA 2EJRA 1DIKA 5IE9A 4H44B 1NQTA 5BR8B 2FLNA 4PD4F 1GN6A 3T99A 2MCTA 4Q45A 2IA6A 3R66A 1IOWA 4IWYA 3Q8RB 1X9NA 3KTMA 5KFRA 5FJ8G 2HHHB 4DR7O 2AHZA 3I12A 1FFXA 5BR8O 3H0GA 5EDWA 4OXSA 1IBLO 2P90A 4O7TA 2WLLA 2DYSB 2K1EA 2ZNIA 3DF7A 1N0JA 4FFOA 4UB8Z 5KFVA 3HOZG 5KFEA 2HG8A 4EYHB 4JF3A 1F4NA 4W4KA 4Q44A 5LYJB 4A3MG 2XGQA 2KSDA 1SA0A 2XIGA 4TV9A 3GTPA 4DR1B 3JATB 2V1DA 2HR3A 2FKXA 1BQZA 1P84F 5JQGF 1BHBA 2NVXA 3VQVA 2XCAA 4NTYA 2KG7A 3U54A 4O3RA 3LSSA 3ASOB 3HKDA 2Q7GA 1GSOA 1NS1A 3D36A 2P22C 1P7BA 1NTKH 5KFJA 4JTDB 3TINA 2W6QA 1A48A 2HIVA 3K04A 5KFHA 4EEQA 3ABLC 3UM7A 1JA8A 5J2TA 1IBLH 5DM6V 5KFIA 3JARA 2WSSG 4X64H 4A3LG 1ZL8A 4FBUA 3JALB 4PDMA 3I4MG 5H80A 1VP7A 4E2LA 3K58A 2E5LB 2W6OA 2OCCB 4K6NA 3QZ7A 4X65B 4O86A 3I4NG 3CYOA 2EILC 3F5TA 3ZS8C 5IWAH 2BQUA 2VRZA 3RYIB 4JTCB 1T36A 5BMVB 2DLNA 3ZX6A 1XK5A 2YZGA 2QKAA 5EBMC 2YEVA 2DYRB 2AGAA 1B6RA 3DC6A 3VQXA 2UU9O 2N05A 3JALA 5EWEA 3K79A 1K8AW 1GN2A 1NH2D 1BQ0A 4K8XA 4C5AA 2C2AA 1N36H 1GTOA 4JI3O 1EKVA 3ABTA 4EFEA 3GIPA 5IYBO 4M0JA 1A3GA 3DSQA 3SPHA 2EIJC 4X65O 3R5XA 4IAJA 2YIBA 4ECYA 4DRXA 5BMVA 2HHFA 4JI6H 2FB5A 1XHXA 3H01A 2KKWA 2ZR2A 1EHIA 4AQYH 2W9AA 4IIJB 1AR5A 1NBMG 3M4IA 3QVNA 1N0NA 1V54C 2GPSA 5FPRA 4GYCB 4JYAH 1B06A 2R6FA 1VEWA 3WWHA 4LF6H 1Z2GA 5IT9W 1S9FA 3LNMB 4K35A 2JA5A 2R7ZA 1LUWA 4DV7B 5HV6A 2UUAB 1N32B 1WN7A 3ZCCA 4ZI7B 3NUAA 3VPDA 1LUVA 4WF9V 3IG0A 4FPPA 1DAAA 2CFMA 3G6EV 3UYYA 1MNGA 3HKEA 4AYBA 2UXBB 1VQ4V 4F4YA 1Q43A 3M9MB 1EZJA 1PV0A 1EM1A 2FL4A 2KQXA 1Y6XA 1XNQH 4B3TB 5I5TA 2GQRA 3GIDA 3FB6C 5KFKA 1XMQH 3AEIA 5KG2A 1Q82W 2PVPA 1SKVA 3FAVA 2XTAA 5DECA 2XOKG 3OEEG 3RBZA 3OUZA 4FZ0A 1I0HA 3U11A 1HDJA 5J2TF 3K3WA 1R6TA 3BEHA 4K0KB 4X64B 3OUUA 4UV8A 4X62H 4MVOA 3M9OB 4JAUA 4GZRB 1KD1W 4D7TA 4GKKH 4BWSC 1AI4A 2WLKA 4RNNA 5FL7G 2JA8G 2ARHA 5L3EA 4UCVA 5CBGA 1F7YA 1RSOB 5KFNA 3M99B 3G8DA 3OMNB 3H9VA 3N2KA 1JPXA 4JI1O 4O7NA 4EEYA 1IXMA 2OTJV 3SPJA 1SQFA 1XOUA 3CEBA 2DQ3A 4FM1A 2ITDC 4PELA 4CKEA 3G6BA 4IYHA 4E4EA 4B7KA 5KA5A 4CKCA 4XDJA 5ITZA 5LMUB 4DR2O 3P30A 2Q0AA 4YJ2B 5C3EG 1CEZA 3K5IA 2UUBH 4PBCA 3LUTB 1WJZA 1BGWA 2I87A 1RSOA 2DYRC 1GMGA 2A0LA 3J81N 3NBZB 2NR5A 4J41A 4O3OA 2YXLA 2CKZB 4DRXB 4XYLB 2Y69B 3K08A 4DR5O 1WA8A 3RYHB 4UFZA 3TGUH 5J2UB 3JCZA 4PI0A 2BQ3A 3PO3G 3CX5F 2AGQA 1K9MW 5IT9N 1QU7A 1WB8A 2YS8A 1PNLA 1S76D 3WG7C 5K3WA 4DQNA 5KFLA 2DABA 4UUGA 4LF4B 4O7RA 3HKCA 3RYCB 4O4HB 3ABLB 1BHAA 5FD5A 4LF5O 3CEIA 3KHRA 1M56C 4DR1H 1RPRA 4QIWA 5LP6A 4M9UA 4O7LA 1CP9A 3IC7A 1V55B 2O03A 1SQPH 4LF7H 3U0GA 2NLJC 1HNWO 4QW8A 2RCVA 4NVPA 3DTFA 4JI1H 4O4HA 2YIDA 4IT5A 1YXBA 5KFBA 3WB1A 4QWBA 3MR3A 2C2DA 3ABKC 3OE7G 2YL2A 2EBOA 3GQCA 3TQTA 4GKKO 4DO2A 2Q67A 1XL4A 4TOIA 3DTUB 2C28A 1US6A 3IGAC 3ABUA 4JI3H 1BSMA 2IH1C 3K5OA 1K1QA 1IDSA 1YJNV 5HFMA 3CRCA 1A0IA 1OCOC 3H1LH 2ZDIA 1QNMA 4UB6Z 3JD2A 3JZ6A 3MR2A 4UVAA 1VQ9V 4FLUA 4QJFA 3BPZA 2HJFC 4TV9F 3CVZA 2YI9A 1Q3EA 3EXAA 4LFAO 2I8CA 3G67A 3SJBC 4CKBA 2UXDH 1EZVH 5IWAO 1DV1A 3JAWA 3CD6V 2ZQMA 1ZAUA 4YHHH 3K0GA 1TGOA 5KUMA 2ZM6O 5KT6A 4TV9B 3GVMA 1ZTEA 4R7RA 4FFNA 1Y1VA 2QR4A 3Q4HA 1L1FA 4QNHB 4A3JG 3RB4A 1M7JA 4ECZA 4WFEA 4JYAB 2F1MA 3T1CA 3K5MA 3K5LA 1VQOV 3I56V 5CA0F 3R65A 5D5PA 3DTGA 1Y74B 4DV5O 4LF6B 4NZMA 3PW7A 2HVRA 3RFCA 2P6JA 3HB9A 3IC9A 1QR8A 2R93G 4LFAB 3JCUZ 2C35B 4AQYO 4A93G 4HNVA 5KFQA 1FFTB 3FMAA 1VS0A 3TXSA 2LFRA 4FM0A 5C93A 4GT1A 3GV8B 4YQWA 4HZ3A 1YJWV 4DV1B 4O3QA 3CCEV 2EJ0A 5HNEA 2Y4UA 1YDXA 3B8MA 5LXTF 5GTHZ 2OTLV 5LA6A 4DV4B 2Y69C 3HKEB 5B1BB 4FU0A 2P67A 1RK6A 3GIMA 1OZ0A 2JJ1G 1AN7A 4DV1O 1IBKO 4I7HA 4MV4A 4RNOA 3M7MX 4FFRA 4A3GG 5EZYB 4MVRA 2IBKA 1BCCH 4N21A 2XAGA 4ZOLB 2WLHA 2VS0A 4JI5B 5IP9G 1I94H 2VUMG 4PDBA 5IJ0B 1SYXB 2QTSA 4JYBA 5EIBC 1LR1A 1GM7A 5EZYF 3KALA 4DW1A 2R8JA 1Z5WA 1DTOA 1IBLB 4Q4CA 2Q73A 3TIGA 2GLTA 1YZBA 5LYJA 4O7YA 1H2MA 2YC0A 2ZIOA 3UCSC 3IFXA 4MTFA 3UZBA 4YJ2A 4RUFA 1NKDA 1EUCB 5EZYA 1IBKB 1F51A 3JAKA 1JQ0A 4JZ2A 2XASA 1RPOA 4HBNA 3ZHVA 4WFAV 5KG6A 2GUZB 4OPAA 4ECXA 5D1PA 4DR6H 4X1IA 2UVVA 1SETA 5IY5C 2I80A 2ZINA 5BWVA 2R8IA 4PZ8A 4CS2A 5LBQA 3A0BZ 2PF4E 3OUSA 1M5IA 2OIEA 3UT5B 4H13B 1OBDA 2A79B 2HGXA 2X7RB 3OTOH 2CDYA 3F7VC 5LXTA 1YTFD 2N04A 4J9YB 3ZRSA 4EB6A 4D6TH 5I5SA 2BR0A 4DV3B 4JI0O 4JI7O 3X2QB 4YJ3B 3D3QA 3DAAA 1M0TA 2PBZA 4RNMA 5LOVB 1MSWD 4B3SO 2QTOA 1CKMA 2ZXWC 2IJKA 3BCCH 4MVQA 1KUTA 3HPLC 3E89A 1VQKV 4G28B 5DISC 1VAJA 1JR9A 3T1HB 4YIPA 1UJWB 3FB5C 1EN4A 1RYSA 1TUEB 3L73H 2YXHA 5KAIZ 1MA1A 2OT5A 2W8KA 1EKPA 1MABG 3LDDA 4I4TB 5F2VO 3T9FA 4EYIB 5DN6G 4JAVA 3GB7C 5EBLC 4PJ0Z 2M05A 5BWRA 2EIMB 1XMOB 3AG2B 1S10A 4I7ZB 5AG2A 2UXDO 2UUCB 2YS6A 3IAYA 5KFPA 4DL7A 4O4IB 4KP4A 1P7GA 1WP8A 1M90W 2JA5G 2YZMA 1OCOB 3PVXA 2GSMB 3B4SA 1C3OA 3ASNB 4OX9H 4UCRA 4QPKA 1H2SB 5FNVF 5ITZB 4TT3G 4X20A 1EBOA 3KHHA 1VF7A 3JZFA 1BL8A 3T4DA 5L3GA 4TM5A 4U6PA 3GTOA 3KHGA 3SJQC 4RZRA 3KAJA 2HKOA 2A3QA 3ICXA 5KFMA 5EC2C 3BJYA 5JH7B 1T5EA 4NXMO 1KP3A 2F95B 1AI6A 4KXRA 5KG4A 3FKIA 4GLWA 1YSCA 4JI1B 2YSUB 4NR1A 3UT5A 1VMGA 1XNRB 4DUZO 4QW9A 1SZTA 4LF4H 5LL6Y 2P4KA 3T9DA 2KG7B 3FYEB 5CA0B 4LF5H 2PTMA 4J42A 3JYCA 4DW0A 4DAAA 2FE3A 1G2WA 4TQRA 4HYKA 1U96A 5FPOA 3CCSV 4KHPH 2XUMA 2L6LA 4D7SA 1XI1A 5CN0A 1QLEB 5EBWC 3BVOA 1WCMG 1YCIA 4RB3C 4ECQA 3K9SA 3WO0A 3TY8A 2R92G 2XT9A 3CWBH 2WE6A 4C5CA 4DUZB 3ZMVA 1ULZA 3C90A 2HHHO 1E4EB 4X62B 4J7JA 2ZXWB 5KHIA 1GSAA 4DV2H 3ZJZA 5KX5A 5DEDA 4TV8A 3BHPA 2IJJA 2WLJA 3R5HA 5CA1B 1AJPA 4FLTA 4EQ5A 4CHIA 1PK8A 5B1AC 1Q5OA 4IHJB 2BSKA 2XD4A 3D36C 2CTRA 1B33N 1CE8A 2W7PA 1KUQA 3JD3A 3HB3B 1K4CC 5JVLA 3RV4A 2CTQA 4X1IB 2QDOA 3ABKB 4QE9A 1BXRA 1GYFA 4NKGB 2YIBD 1RFYA 4O2BB 4GKKB 3J7AU 4ZBMA 2VUMA 2W9CA 3F5WC 4KUMA 1DV2A 4F6EA 3GIKA 3T5KA 2YZNA 2XAQA 2YDEA 4B3TH 1GM8A 4MV1A 4O4LB 2C2EA 2UUCH 1KC7A 5FR9A 1VQNV 1P49A 2HVKC 4Q4DA 1IBMH 5C5JA 4A3IG 4CBCA 2R86A 1C30A 4LFCH 3GTQA 1K4DC 1WNSA 5B5EZ 1KB9F 3RGZA 1AP6A 4UXNA 4JI2B 4L87A 5HFLA 4XZ3B 4B3RH 2JJ2G 2Q8VA 2F93B 5JCOC 2ZE6A 5A2QN 5DQIA 5KMGB 2PMZA 1NT2B 3BAAA 5IYDO 2A9HA 4G3IA 1TWCA 3LP8A 2ZDHA 1Q90D 1SERA 1AR4A 4DR3B 1QCEA 2XAHA 2YU9A 4FFMA 3TCUA 4FFKA 5LYJF 3TXQA 1KC8W 2RN9A 3T9EA 1E4FT 2Z5UA 1HP8A 4X1KA 5BMVF 5KHGA 2YXYA 3G6YA 2BTQB 1IURA 4OGQB 4DXWA 1V51A 2FPIB 2W9BA 1S3JA 4TV8B 3H0GG 1S0VA 2JVDA 2QWPB 4DV0B 4JI5H 4U3JB 4TQDA 5B1NA 2AHYA 4DV4O 4FLXA 3RIZA 4XYMB 2V4QA 1MSDA 1VBHA 1FJGH 1GO3E 4O4IF 1XUQA 2YRWA 4BY1G 4WBNA 3JRWA 4LH7A 4OPHA 2QWNB 5B1OA 4CC5A 3ASOC 3L9DA 5KFXA 4JI5O 4FLYA 4DV6O 3CRAA 4DR4B 1KP2A 1GN3A 4X66H 4Q6GA 2E75B 2W9CB 4IYIA 5EK0A 2GTAA 2WAQA 1N8RW 4YY3B 5KKNB 1N4CA 5JJNB 5KG1A 3KHLA 2PGGA 2ODMA 3GIQA 3L71H 1WPBA 2YEVB 3FKSG 2HDKA 2VWKA 2XCLA 3KCYA 3VPBA 5CA3A 1H38A 4DYLA 2LFSA 4O81A 1VF5B 4J9QA 2QJ1A 2W71A 4J9PA 3ABMB 4LNUB 4DLKA 3VA7A 3EFFK 1KJJA 2Z3YA 4MTDA 1KQSU 1CS0A 5IYZF 1PD3A 4JGSA 3H4BA 1S77D 2M7WA 2EIYA 3A2FA 1G6UA 4DV1H 4CMFA 1OCRB 3W7SA 4K0KO 4RWUA 4PZ7A 4PV1B 1G4YB 2J6UA 5IYZB 2EIKC 4AYBE 5JUMA 1E4EA 5DAAA 3QG5A 4MA0A 4DV6H 4DL4A 2JS5A 3L75H 4PWQA 4IRCA 4B3RB 3W7XA 2AZ0A 2R7NA 4F4WA 4J9MA 1R6KA 5I5VA 1AJNA 3U9SA 5DG9A 2FPGB 4LCUC 4XDLA 3T9BA 1RM1B 4AILC 1JDBB 1W93A 4F4XA 3HOUG 4HN2A 4I9QA 1Q7YW 4JV5H 2DAAA 2IP4A 5BR8H 2W9BB 1T3NA 2ADPA 3MFHA 1V55C 2CTPA 5L3DA 5LXTB 4IR9A 3GV5B 4LF7B 4EGJA 1Y76A 4ME6A 3ZMSA 1WAZA 1L8DA 3E22B 1AUXA 5K1PA 1D2DA 4PZ6A 3PR5B 1JFFB 1Q6UA 4EGQA 1GLVA 2GTSA 2CUGA 2WYOA 4QSHA 5KG0A 3W1GA 4J0MA 5GONB 1IBMB 2CNUA 2Q4PA 1M57C 3CMEV 4RAIA 1J5EB 1TVKB 2HJWA 1TWHA 1GM9A 4X8AA 2DN9A 4J9KA 2GV9A 1YVWA 2NUAB 1RJQA 4JI4B 2CQYA 3AG7A 4MSWC 1XBLA 2IW5A 2Z04A 1KBLA 3LMLA 5EYPB 3T1HO 1BS3A 3T4ZA 1FKAH 3CS5A 1HNZH 2L35A 2UUBO 2KB1A 3TIIA 2CW7A 3W5OA 4I55A 4I0XB 3VNNA 5KFWA 4X1KB 4KHPB 3B40A 1N33O 4Q20A 3PN1A 1R9TA 1M9NA 4DR1O 3HKZE 1S68A 4MA5A 3RGXA 4FVMA 2WA4A 2P06A 4PA3A 5J9PC 2JEUA 3DXRA 2R8GA 4DV3O 2E74B 4CS4A 5BYBA 3ZRWA 4H33A 5KFSA 3ZMTA 1L0NH 2B1GA 2GPWA 1AROP 4J9OA 4XBFA 4YJ3F 2EIMC 3LSQA 4UVBA 5DGAA 2YRXA 2UU9B 4ECWA 5LOVF 4YXWG 4I0XA 1DK1A 2ZGIA 4O4HF 2NU7B 3I5DA 4ZOLA 4DV2O 4PI2A 3ZRXA 4ASUG 1V9PA 5H2FZ 1SC5B 2IJHA 4IZOA 3G4SV 1S0MA 5L1KA 4O3SA 1WP7A 3RUPA 1XILA 3K5HA 3HO8A 4MV8A 1SEIA 4I50B 3ETHA 5CB4B 2W0XA 4X1YA 1MZFA 1O9HA 5FLXN 4JZGA 4OX9B 3T54A 2HEPA 3L2PA 2JK5C 3MR6A 3H1JH 3VOUA 2ZDQA 4XX0B 4WFGA 1DGSA 4BR6A 3DGEA 4NTWA 2HVSA 2B1IA 3K06A 4MV7A 1I1KA 4LF8B 5C8YF 1MZBA 5LMNH 4C7UA 3K03A 1B3QA 2EULA 2VPQA 5DLGA 3E8BA 1URFA 2W6NA 4EB6B 3OSPA 3OM3B 3GIIA 2O57A 2R87A 3LWBA 5C44G 1SQQH 2V7QG 5H5NA 1PX2A 2COGA 2WB1A 1N34H 4UVCA 3UO2A 2OLSA 2UXCB 4ZKIA 4BW9A 4JI6O 2C2RA 1S0OA 1M57B 2QKSA 3AG1B 3JD0A 4DUYB 5KFUA 2JS3A 1FFXB 1R3JC 2CE4A 1FXHA 5J2TB 2HGSA 5DQGA 2X6CA 3APQA 1HW7A 4ZOLF 3X2QC 3EHBB 4PA6A 1XMOH 1V4YA 5CA0A 4R8UA 2N74A 1Q81W 3BABA 2CGOA 3DXRB 3GTGA 5KG3A 4U7CA 3RF2A 3SPIA 5FLXW 2Z0AA 4ZHQF 1JKJB 1YIJV 3RYIA 4IRKA 3TETA 4GCZA 2QWRB 5B3SC 3NC0B 1FAFA 2NN4A 4DR6B 3CRMA 4CH3A 2RQ6A 1TWFA 2E5LH 3H20A 1H2KA 2GUZA 3ZHTA 5LMUO 3JAWB 4JI2O 3WWIA 5KG7A 1ZX3A 3TY9A 3RYHA 2F43G 1OCZB 1MG1A 4A5UB 2A7WA 2C00A 2ZKOA 2ASDA 2VWJA 4Q8EA 2R7MA 2NU9B 1ROPA 2VQEB 2WLIA 1N36O 4YR2A 4FM2A 2JEGA 2DQ0A 2A06H 4LF9B 4M7EA 1Q8IA 2ALZA 3CCVV 3VOTA 3BQ0A 2WA3A 4B3SH 3BG5A 4B3MB 3RJ0A 3MD0A 1JFFA 5CA1F 4R6ZA 3Q8SB 1FXKA 1MMMA 3CJHA 2V59A 5GONF 2PYJA 4YR0A 1G8MA 5IYBG 4ECRA 5D1OA 3HT5A 4ECUA 1HR0B 3BACA 4LH6A 3SNOA 3RWRD 5DG8A 1IOVA 1IYEA 1S5JA 1HR0H 4DR2B 3GDEA 1UPGA 3RV3A 2V4DA 4O4LA 2E2HA 1ZL8B 4F4LA 3N6XA 4LF9O 2QM8A 3KZIZ 3AYHB 5KT3A 3F7YC 4NXNB 5LL6b 3CRQA 2R70A 4MVUA 1Q86W 5BYAA 4FS2A 2X5RA 4RUCA 2ZT9B 1L2ZA 3B09A 2ZNJA 4BAYA 4A3FG 1YI2V 3WNZA 1EYZA 1ZHSA 2VQEH 4MV6A 1I7NA 5LP6B 4CE5A 5BZBA 1HR0O 3CC7V 2WB1E 5LGTA 3LQSA 3U0ZA 3C3TA 3CE2A 4C2MA 3V6HA 2QF7A 3MWEA 5L3CA 1JXLA 3OGCC 3QO5A 3NR7A 4G2KA 2Y0IA 4PDLA 3JD4A 1SQVH 1I7LA 2ASJA 4JXUA 2ATLA 2HP8A 2PY5A 4GLXA 2X6BA 1NZ6A 1PKXA 2DWDC 4FLVA 5KHJA 3SYOA 3AX6A 4A2BA 3N42B 4DR3H 2B63G 1KEEA 2YZLA 3FDSA 5D8DA 4B3TO 3SYCA 5I5YA 4N23A 4EBCA 1X59A 4JI3B 2YUAA 2BCCH 3RBEA 1PP9H 4F4ZA 2RF4A 4K0KH 1UC9A 4DK0A 3R23A 1TUBA 1MOFA 2JGDB 1M56B 5D5QA 2UUAO 1N32O 5B1AB 4DR7H 1M1KW 1W59A 2FTKA 1PPJH 3N2GA 5IYCO 4PDVA 4QPJA 1QR9A 3SJCC 1IX9A 4QJFB 2QM7A 2GQSA 2JGUA 2QKCA 3TK1A 4JPRA 2WLMA 1QBZA 3A0HZ 3B2EE 3CSWA 5KT5A 5KFGA 2JEJA 3WB0A 5EYPA 4O2AB 3GB8B 5KG5A 4LFBH 3BA9A 3A8TA 2ZE8A 3AG4C 3WO1A 1K83A 3N41B 3STZC 1RK5A 3BQ1A 2AZ2A 3PW0A 5IJ0A 4Q8FA 2HHFB 2H94A 3PJSK 4Q43A 3HOYG 1Z2NX 3OTFA 4PA9A 5DG7A 2WAMA 3H40A 3CXHF 2W0FC 5LP6F 5IJ9B 1VBGA 3ZHUA 3MR5A 1G1XB 3OT7A 1W0JG 2P0AA 2FMAA 5DGIA 4ED8A 3RBDA 5BXZA 1CPYA 1N48A 3SDLA 4GX2A 3K0DA 2Q2UA 3CCRV 3RB0A 3PO2G 5JJJB 1XNRH 4MT8A 4GKJB 1JIHA 3TJTA 2DOSA 4NYKA 4R7CA 2VQDA 2X0SA 3BY6A 2R7KA 3IN5A 3HKDB 3JASB 4LC1A 1S97A 2BQRA 4QE7A 3UO3A 4J7KA 4O2BF 3TW6A 4HAMA 5F9LA 2CZGA 5BWXA 5A9GA 1ENVA 5KFTA 2HFEC 4JV0A 2FK3A 3M8AA 3QQMA 1BJTA 2FJZA 3IJ4A 3V6JA 2UXXA 3NXSA 1B6SA 1FYJA 4ECSA 3CCMV 3W1BA 3S24A 4J80A 1EFRG 4GX1A 1YJ9V 2DPIA 1AUVA 1KYOF 2ZDGA 1K92A 4FFPA 5IP7G 2W6MA 3ASNC 3RR5A 4TUYA 5TISZ 2PMZE 4GC7A 4B3SB 4LSXA 2YCHA 3CSXA 3JAKB 1XNQO 1XREA 5CMUA 1K33A 1GSHA 4H0LB 1AB3A 3L4KA 2UXBH 2PI4A 1KU9A 1CXZB 3NBYB 2F23A 4X20B 3EPIA 1CKOA 2JA6A 1H2GA 4B3MO 4TUYB 1XNQB 1BT8A 1VIBA 3RYFB 4DV7H 4JV2A 3H3VH 1CKNB 2AU0A 4HQ6A 3FD9A 2DWEC 1VQPV 2HVJC 1N33H 2BTQA 4JUZA 1QLNA 5C8YA 3V4ZA 2HIXA 1KMIZ 4DV7O 5CR5A 5KS8A 3SGIA 4TV8F 4JI4O 5CAEB 2JRIA 1TA8A 3ABMC 5DGBA 1BE3H 1E4GT 4I55B 5KT2A 1U97A 3T1HH 2R84A 3JAMW 3PW4A 4UCUA 5FNVB 2R8KA 1VF6A 4MTOA 4IHJF 2BOBC 5LHIA 2R92A 4WBNB 4DV6B 4J9ZB 5KA6A 1H8HG 3L72H 1FPOA 2LGQA 3AG3C 3D8CA 3MDSA 4TSFG 5B66Z 5KFZA 3Q8PB 2WPDG 2QM4A 3OTOO 3Q8QB 3RAQA 2IJIA 2QWOB 4LMYA 1CQJB 5EIBD 2YYAA 3RVZA 1OCCC 1XDNA 3EPGA 3RAXA 2R9IA 4BBSG 4JYCA 1QQCA 3ZIAG 4O4LF 4O4JF 1FXKC 4R50A 2VA3A 1SRYA 3OGIB 3WB2A 3E22A 1N34B 3FKIG 4DRFA 4DV3H 4U7OA 2RGRA 3GTKA 5GW7A 3L74H 3HOWG 2VQFO 4X64O 2BE3A 2LQTA 2KSWA 3A0RA 4DV5B 4LF6O 3E8HA 5CA1A 1I3QA 1EN6A 2C22A 4DR4H 3G80A 5LHGA 1YEWA 1GN4A 3ETEA 4WFFA 1SQBH 4YJ3A 4J9NA 3SPCA 1Y74A 2EX3A 1I94O 3T9AA 2W7OA 2JA7G 4QGPA 1JX9A 1NVPD 3OHAA 1ZETA 1FKAO 1M93A 3FB7C 3BQ2A 1GRJA 1BGYH 3R5FA 2OCHA 1A0GA 1I94B 5KAFZ 4B08A 4DV4H 4DL5A 3DC5A 4I4TF 1IZ3A 3MWMA 2Q0OC 2RMKB 2WLIB 3ORRA 3HKCB 4IIJF 1O75A 3UKMA 4YY3H 4FK5C 4RB1A 5KLVH 3SYQA 3GV7B 1EZ1A 5C8YB 5L9XA 4QWDA 3GLKA 2UU9H 1VQ5V 1PNMA 3K59A 3KCXA 1GAXA 2P7TC 1JX4A 3B8NA 1JMKC 4JASA 5IJ9A 2Q5ZA 4JI8O 4TVIA 2FLLA 2QEXV 5I5WA 1OV9A 4QWCA 4DR6O 4ETSA 1JJOA 2W8LA 1E1RG 5C1PA 3N8DA 4LR3A 4L8JA 1AI7A 5KFOA 1NTMH 2BOCC 2EJ3A 1QVGU 4LF9H 2ZDIC 1CQIB 2ZE7A 4RO2A 4Q0YA 5KFDA 1COWG 1WPXA 4KL1A 4MW8A 5KHKA 2SCUB 4A3BG 1GGOA 3RB6A 5EOYA 1WCMA 1PL4A 4HNTA 3I55V 2LGWA 5JH7F 4X66O 3HKBA 4FFBA 4MTEA 4FGRA 3M9NB 4FS1A 5I5XA 5CBFA 2CH7B 3MFIA 2ILMA 4UV9A 5I47A 3JD1A 1TUBB 4KFMA 4NXNO 4DK1A 2AQ4A 5CB4A 3OW2U 4YAKB 2QGNA 3JZIA 3PW5A 2UXCH 1KKDA 4ZHQB 3K3VA 2UUCO 2OWOA 3HKBB 3S3WA 4X9QA 4Y8VB 3G71V 4FLWA 3OR6C 3HXLA 4O3PA 4BBRG 3AK1A 4O7ZA 5JVDA 2F4VO 4H37A 3OD4A 1Y66A 3THOA 3FB8C 2UVWA 1FXVA 1F23A 2Q68A 3RN4A 3VMMA 2OIGA 1PNKA 2DPJA 4Z2WA 1OHHG 2DJVA 2AW9A 3W7TA 2F4VB 1Y1WG 4O3NA 1K3EA 2Q7DA 4YJ2F 1XEQA 2J6SA 5D1OB 4GX0A 5LA6B 1WH2A 4YIOA 2QSAA 3C0FB 3APOA 3MHHC 1R3KC 4RU9A 4DV2B 2PN1A 4MVMA 4JI8H 5K2MA 1F4MA 3RYCA 4FMTA 4BIUA 1W2BU 1H2LA 4YB8B 2XCPA 4O84A 5LOVA 4W4LA 4JV5B 1AI5A 1XMOO 1NVPB 2ZM6H 1SS3A 4LF8H 3AG3B 2JIZG 3ORQA 5H6RA 3ZN0A 5IY5B 3SI8A 1DF4A 1E1QG 3AG1C 2CTWA 1Y76B 1THZA 4DR3O 1R1BA 4AQYB 4WBNF 2DZDA 1IYDA 3J80N 4WHXA 2M6YA 5BPFA 5CB4F 4O4IA 1FJGO 1WLEA 2ZD9A 4UUJC 2XHBA 3WG7B 4NXNH 1Z2OX 1D5NA 4J11A 4ECVA 2IM9A 1OCCB 3JARB 2Y0PA 3FFQA 4GKJO 5EC1C 4O7SA 2FB9A 5FLMG 3OMIB 2EZPA 2Y4TA 3OAAG 3WU2Z 4A2AA 3OTOB 4WFBV 4A3EG 1HNXB 4BW5A 1M6VA 2VQFH 4BXXG 5IYCG 4G27B 4CS3A 3ETJA 4O4JB 1XL6A 1FVIA 3VBBA 4ZI7A 4NB5A 4O82A 4EBEA 1P16A 5H9CA 2EJ2A 4BIZA 4CH6A 2Q69A 2W6IG 1OCZC 4JV1A 4DV5H 5KX5F 5KFAA 4RCNA 1WA8B 5KFCA 1IXBA 4J9SA 3CJHB 3MHSC 2PYLA 4EBDA 1SFOA 4LF5B 1KJ9A 1YITV 1I7FA 4I50F 1B04A 2CGNA 1S5HC 1CKNA 2HGWA 4B3RO 4C5BA 3GIJA 3P3NA 2DIKA 4IIJA 4HYOA 4YY3O 1Q6IA 3ETQA 3ZRWB 1HNWB 1XMQO 1UNNC 1AJQA 3E83A 4PA7A 4LFAH 4TWKA 3J80W 4DR5H 1SQXH 3K57A 2VUGA 1I5YA 1Z5VA 3SR2C 4CH5A 4JI4H 3GWKC 3T7AA 3ZBHA 4PHZA 3N44B 3NGDA 1SCUB 5JVDF 3WWJA 3UFXB 1J5EH 4IGGA 3E86A 4B7EA 2Q2TA 1YHQV 4LF4O 3MJFA 1GK9A 3CCQV 3AK3A 3OMAB 1NTZH 1ZLZA 2PUSA 3H1KH 2E5LO 4FE2A 2F66C 2ABJA 2AGOA 4NXMH 3T5LA 4FFLA 4BWAA 5E1AC 2E76B 1B6QA 3LDEA 2W6JG 4IRDA 4ECTA 2JA7A 3G6VA 4YAJB 3HKZA 1D5AA 3ZHQA 3WFVA 2VR1A 3H1HH 2QYZA 1NR1A 4HNUA 5JWPA 4LSAA 3OHBA 1Y1VG 5KT4A 4RB2C 2ZIMA 3E35A 5LGUA 2JGDA 2COJA 4DUYH 2COIA 2EZOA 5E25A 2IMWP 2FK2A 3KYHC 1SF9A 4ZI7F 3ZRVA 2UXDB 5C4XG 3RB3A 3BFRA 5EWGA 3E5NA 4LWSB 2XAFA 1K1SA 3T5JA 1FXKB 4O2AA 3N6RA 4DIMA 1DLBA 4MVZA 5C1OA 3ZN1A 4NXMB 1RM1C 2GBOA 2R9RB 3O9OA 1UC8A 1OJHA 1NU1H 1KBHA 4R8CA 5KFYA 4UCTA 4ED1A 4DL3A 3V6KA 4RAZA 1E79G 4JV5O 1T94A 2QWQB 2RNBA 3SYPA 1S0NA 3H1IH 3ZEDA 1J5EO 2Y48A 3PFFA 4APMA 3QO7A 4JYAO 1KTAA 3BRCA 3RW0A 1X4TA 4FIPC 2CNQA 2XAJA 2ZJTA 2XNDG 3QWUA 1TWGA 1I08A 1ET0A 2UXBO 4J10A 1AP5A 2ATKC 3ETDA 1K5SA 3ZMUA 1BNCA 1EUDB 4RUEA 1GH6A 4AI8A 3CRRA 3CMAV 4GKJH 2P4VA 4ED6A 3UQ8A 1Z2PX 5DMXA 4MS2A 2MK3A 2ASLA 4X88A 2DWCA 3PW2A 4IR1A 5T14A 2VA2A 1I6UA 3SYAA 1TAEA 3Q4HB 5I5UA 3KAKA 1AILA 1S72V 2ETNA 2LW7A 2XGPA 1AR1B 5H6QA 2J9GA 4NZOA 3FAVB 1Y14B 1HWYA 5IYZA 2XC9A 1Y67A 1XQ8A 2G38A 2NU6B 3TW7A 3P32A 4P9OA 2RDIA 1I2KA 2H8PC 4EG0A 3VQYA 5DQHA 1W0KG 1RJPA 3RT3C 2YICA 4CC6A 3CC2V 2P5OA 3U9TA 4QWEA 2JEFA 3J7AK 4I50A 2EJ7A 1KKCA 4R8UB 2BSKB 1ZHQA 3D3IA 2CK3G 2UVRA 3F8NA 2GDSA 2VPSA 3AG2C 3OFNG 1VQMV 4WD3A 4EFBA 1QLEC 3GWOA 1ZQ7A 4Z1MG 5KX5B 3N43B 4ED7A 1SZXA 3L70H 2F4VH 1LNQA 2R72A 3CQZA 2ITCC 1ORQC 3OUFA 4JI8B 4LF8O 2WDTA 3T5HA 3R9RA 2CAZC 2WLLB 4LFBB 1ZWIC 3LSUA 1I2LA 2H3OA 2V58A 1P8LA 4O83A 2JEIA 4U3FH 3VPCA 1OBGA 1WRVA 4LFBO 5LHHA 5A2QW 2MW2B 3PZPA 3GTMA 1KJ8A 2Q7HA 3B77A 3ZHSA 3CCUV 1A9XA 1XMQB 3TY5A 1YTFB 4O2AF 2OYQA 3RFRA 4JI6B 1SESA 3KXYT 3JAMN 5JQWA 2PZSA 3JATA 3QFFA 5BY1A 4ED0A 5F9NA 1R3LC 3QO8A 4HR7A 1R73A 2X6AA 4Z1VA 1VQ7V 1VF6C 3J81W 2D2CB 2FMLA 2OCCC 2ZR3A 3U10A 4DL2A 2UUAH 1K97A 2WTFA 1N32H 2HG5C 5LP6C 3QF7A 1R3IC 4U3JA 4ZQIA 3AG4B 2DYSC 1I5XA 4GC6A 4JYYA 3CC4V 3GTJA 3W7UA 2NNUA 4UCSA 5CBHA 3LULA 2QB5A 1IBMO 3U55A 2Y0SA 3N2GB 3N2KB 4QIWE 2AXTZ 4O2BA 1XNRO 1IBKH 1K7DA 1VQ8V 2HVQA 3HBLA 2UXNA 4I4TA 1A32A 3K9AA 4BY7G 3TQ1A 3STLC 2CH7A 4LNUA 4RB0A 4JI7B 4JI0B 1IVSA 2EIJB 4DR2H 4FFBB 2WAQE 2HJDA 4DV0O 2RJZA 2HLDG 1GO3F 4PA4A 2A1HA 4U7NA 5I60A 2CW8A 1XDCA 5BPHA 2VQEO 4NZNA 2V4RA 1Y1WA 5LMUH 3HR0A 4MTGA 3ZHRA 1K73W 2DE0X 1HNZB 3G6XA 4J9LA 1Y4MA 4RUAA 1SA0B 1UFIA 2X0LA 4WFHA 5FD6A 2BTOA 3CHXA 4ED3A 4AHCA 3QNEA 2W6PA 4J7ZA 2RDCA 4DR4O 3L4JA 5FNVA 3AW8A 1KECA 2YIAA 3ETGA 3OEHG 4X62O 1H2NA 1FS0G 1TWAA 1BMFG 5BWWA 5IYDG 3QZ8A 1OWTA 4O4JA 5KT7A 2FLPA 2R7ZG 4X1YB 4MTXA 5JCOA 3ZMZA 3W7WA 1RP3B 5JH7A 3JRXA 4YHHO 1KJIA 4ICGA 4YP3A 1P4RA 4K8ZA 5JJEB 1VQLV 1FJGB 1R6NA 4DL6A 3EYYA 4LFCO 4ABMA 4YR3A 1GKFA 1VARA 5KUKA 4DUYO 4YBZB 2B9ZA 1N34O 4I5SA 4MW3A 4CMDA 4IHJA 3VQWA 5DLFA 3T2MA 4GX5A 1FD9A 4BIOA 3MWDA 1NI8A 2JDIG 1JDEA 5LMNO 4YHHB 1EN5A 2DW4A 5J2UF 2VOBA 3CB2A 1YF2A 3E8GA 3N27A 3RGBA 3T1YH 4JI2H 3K3PA 2W57A 1V54B 1ZUQA 3N40P 3RTXA 4E6NA 4LF7O 1H8EG 2Y0SE 3AK2A 2WWWA 3C3SA 2GHYA 2K9PA 4UCOA 5L3BA 4ZHQA 2Z02A 2R82A 3LNNA 4FZ1A 2Q7EA 4QIWF 2UVUA 1QHTA 4IWXA 2LP7A 3KG2A 3RYFA 1AVMA 3O65A 5KMGA 2HHHH 4F50A 2WLNA 5JQGB 1O9GA 2FPPB 2EIKB 3CCJV 2QA4V 5LMNB 3PR4A 3H4DA 1HNXO 2CNVA 3JSLA 3K5NA 4QWAA 1N36B 5KFFA 4K3AA 2R93A 4MV3A 2NU8B 5B1BC 3T1YB
chains in the Genus database with same CATH topology
4FLWA 4I7HA 3GJXB 3HXLA 3M7MX 1XHZA 2YI8A 5JVDA 2ZCEA 5EZYB 4DR5B 4I50B 1SEIA 3THOA 4ZOLB 2E3CA 5CB4B 4JI5B 4PDBA 1I94H 4X1YA 5IJ0B 1O9HA 1SYXB 4TQFA 5EIBC 2HEPA 3QTCA 4OX9B 3L2PA 2F4VB 1DGSA 3KALA 4X66B 1Z5WA 1IBLB 1N33B 5GONA 4DUZH 5LYJA 2HVSA 5D1OB 5LA6B 1WH2A 4MV7A 4LF8B 2ZIOA 1M4UA 1MZBA 5LMNH 3C0FB 4YJ2A 4DV2B 4EB6B 4B3MH 4HNAA 5EZYA 1HNWH 1IBKB 3JAKA 4ZIBA 5IWAB 4JI8H 3RYCA 4HBNA 1S03G 3JASA 2RGVA 5LOVA 4F6RA 4X65H 4DV0H 1SQGA 4JV5B 2R9AA 5D1PA 1N34H 2ZM6H 4JI0H 4JI7H 4X1IA 4DR6H 2UXCB 3SJAC 4LF8H 4BW9A 4DUYB 2ZINA 3JSNA 5K1XA 4PZ8A 5JVDB 4CS2A 1FFXB 3UT5B 1M5IA 5J2TB 3OTOH 2HGSA 5LXTA 3MAQA 4AQYB 1HW7A 4EB6A 4O4IA 2XHBA 4DV3B 4FM9A 1XMOH 4NXNH 5CA0A 1Z2OX 4YJ3B 3BABA 5KHHA 1M0TA 2UUBB 2IM9A 4F6RB 3JARB 5LOVB 3FFQA 1CKMA 1HNXH 3RF2A 5FLXW 4A2AA 3OTOB 3RYIA 1HNXB 2VQFH 5DISC 4MV9A 3T1HB 4CS3A 3NC0B 2ZM6B 4DR6B 1TVKA 4O4JB 2VQFB 4CH3A 2RQ6A 4FLZA 1FVIA 4ZI7A 2E5LH 3H20A 3JAWB 5JQGA 1P16A 5J2UA 3TY9A 4I4TB 3RYHA 4CH6A 4CH4A 4LFCB 2VWJA 4DV5H 4RAYA 2PYLA 1XMOB 2VQEB 4LF5B 2UUCB 1I7FA 4FM2A 1B04A 3IAYA 4LF9B 4O4IB 4M7EA 1Q8IA 1CKNA 4IIJA 4B3SH 4OX9H 3RJ0A 4B3MB 4UCRA 3ETQA 1HNWB 1H2SB 1JFFA 5ITZB 4X20A 4LFAH 3J80W 2PYJA 4DR5H 3BA8A 3K57A 1VF7A 4RZQA 2VUGA 5D1OA 1HR0B 1Z5VA 4LH6A 3RWRD 3SR2C 4CH5A 1M0WA 4JI4H 3KAJA 4PHZA 3N44B 1S5JA 1HR0H 4DR2B 3GDEA 3ICXA 4HNAB 4DR7B 5JH7B 1T5EA 2V4DA 4O4LA 1J5EH 2F95B 5BR8B 3N6XA 2Q2TA 2MCTA 4NXNB 5LL6b 1X9NA 2R70A 4JI1B 2HHHB 3UT5A 1FFXA 2PUSA 1XNRB 4LF4H 2F66C 1L2ZA 2ZNJA 4NXMH 4BWAA 5CA0B 1ZHSA 2VQEH 4LF5H 3DF7A 2ZNIA 2PTMA 5LP6B 2FE3A 3U0ZA 1D5AA 5FPOA 4KHPH 4D7SA 1XI1A 4LSAA 5LYJB 4RB2C 2ZIMA 4RB3C 1SA0A 2XIGA 4TV9A 4DR1B 4GLXA 2PY5A 4DUYH 3JATB 3TY8A 4FLVA 5KHJA 2WE6A 3KYHC 4A2BA 3VQVA 3N42B 4DUZB 4DR3H 2UXDB 4X62B 3HKDA 2Q7GA 4JI3B 2P22C 5KHIA 4O2AA 4DV2H 4NXMB 5KX5A 4K0KH 4TV8A 3BHPA 2HIVA 4EEQA 4DK0A 5CA1B 1TUBA 4FLTA 5D5QA 4EQ5A 4DR7H 4UCTA 5J2TA 4RAZA 1Q5OA 4IHJB 3N2GA 1IBLH 3SJCC 3JARA 3ZEDA 4X64H 2JGUA 4APMA 3JALB 3BRCA 4X1IB 3K58A 3B2EE 2E5LB 1GYFA 1X4TA 2YIBD 3WB0A 4X65B 4O2BB 5EYPA 4GKKB 4O2AB 3GB8B 4LFBH 3BA9A 2ZJTA 3QWUA 3ZS8C 5IWAH 3N41B 3RYIB 5IJ0A 5BMVB 4B3TH 1Z2NX 3OTFA 4O4LB 1XK5A 2UUCH 4GKJH 1P49A 3UQ8A 1Z2PX 1IBMH 3VQXA 5IJ9B 4LFCH 3JALA 1WNSA 3RGZA 4K8XA 1N36H 1I6UA 4JI2B 1TAEA 3KAKA 4EFEA 4B3RH 2Q2UA 4IAJA 3DSQA 2F93B 5JCOC 2YIBA 5JJJB 5KMGB 4GKJB 4DRXA 5BMVA 4JI6H 1NT2B 1XHXA 3BAAA 5IYZA 2KKWA 1XQ8A 4AQYH 4IIJB 3HKDB 3M4IA 3JASB 4DR3B 5FPRA 3VQYA 4GYCB 4JYAH 4CC6A 2P5OA 3J7AK 1E4FT 4LF6H 4I50A 5IT9W 4X1KA 1BJTA 5KHGA 4DV7B 1ZHQA 2UUAB 1N32B 1WN7A 4ZI7B 3F8NA 3W1BA 3S24A 2VPSA 2BTQB 3IG0A 2CFMA 3HKEA 4EFBA 4TV8B 2UXBB 5KX5B 3N43B 1Q43A 2JVDA 4DV0B 4JI5H 4U3JB 4TQDA 3RR5A 4B3TB 1XNQH 3RIZA 4FLXA 1XMQH 4TUYA 2F4VH 1FJGH 2R72A 4JI8B 2WDTA 4B3SB 4LSXA 4WBNA 2YCHA 1SKVA 2CAZC 3CSXA 4LH7A 4LFBB 4CC5A 3JAKB 3U11A 1P8LA 3L4KA 4FLYA 4K0KB 4X64B 2UXBH 1KU9A 3NBYB 4DR4B 4X20B 5A2QW 1CKOA 4X62H 4X66H 2Q7HA 4TUYB 4Q6GA 1XNQB 4D7TA 1XMQB 3TY5A 3RYFB 4DV7H 4BWSC 2OYQA 4GKKH 3RFRA 4YY3B 5JJNB 4JI6B 1CKNB 3KXYT 4UCVA 2PZSA 3JATA 2PGGA 1WPBA 3N2KA 1N33H 2VWKA 2BTQA 3J81W 1SQFA 3U10A 5C8YA 2UUAH 1N32H 4FM1A 2QJ1A 2HIXA 1KMIZ 4LNUB 5LP6C 3SGIA 3QF7A 1TA8A 4U3JA 5ITZA 5LMUB 1E4GT 4MTDA 4I55B 3T1HH 2Q0AA 4YJ2B 3A2FA 1G6UA 3JAMW 4DV1H 4UCUA 5FNVB 2UUBH 4UCSA 4WBNB 1BGWA 4DV6B 4PZ7A 1RSOA 5IYZB 3NBZB 3N2GB 3N2KB 3QG5A 2YXLA 4O2BA 4DRXB 4DV6H 1IBKH 2HVQA 2QM4A 4I4TA 2JS5A 4UFZA 5J2UB 3RYHB 4PI0A 4B3RB 4LMYA 5EIBD 4LNUA 4RB0A 4JI7B 4JI0B 4DR2H 4FFBB 1XDNA 2RJZA 4LF4B 3HKCA 3RYCB 1QQCA 4O4HB 2CW8A 5FD5A 4AILC 4DR1H 5LMUH 1HNZB 3WB2A 5LP6A 3E22A 4I9QA 1N34B 4JV5H 4DRFA 4DV3H 5BR8H 2RGRA 1SA0B 5FD6A 2O03A 2BTOA 4LF7H 3CHXA 2KSWA 4AHCA 4NVPA 4DV5B 4JI1H 4O4HA 5LXTB 3L4JA 5CA1A 5FNVA 4DR4H 2YIAA 4LF7B 3WB1A 1YEWA 4O4JA 4YJ3A 4X1YB 1L8DA 2EX3A 3E22B 5JCOA 5K1PA 4PZ6A 5JH7A 1JFFB 4TOIA 2WYOA 1M93A 3W1GA 4JI3H 4J0MA 5GONB 1IBMB 4K8ZA 5JJEB 3K5OA 1I94B 1FJGB 4DV4H 4B08A 1A0IA 3MWMA 3EYYA 1J5EB 1TVKB 3HKCB 1O75A 4YY3H 4RB1A 4FLUA 2GV9A 3BPZA 4JI4B 2YI9A 1Q3EA 5C8YB 3CVZA 4IHJA 3VQWA 2UU9H 3SJBC 1XNRH 3K59A 3LMLA 2UXDH 1JMKC 5IJ9A 5EYPB 3JAWA 1ZAUA 4YHHH 1FKAH 1TGOA 4ETSA 1HNZH 4TV9B 1JJOA 4R7RA 4YHHB 2CW7A 4JYAB 2F1MA 3W5OA 2VOBA 3CB2A 4I55A 3VNNA 4LR3A 4L8JA 3RGBA 4X1KB 4JI2H 4KHPB 3T1YH 3K5MA 2W57A 3K5LA 3PN1A 5D5PA 4LF9H 4LF6B 3N40P 4Q0YA 3RTXA 4E6NA 4KL1A 1S68A 5KHKA 2HVRA 3RGXA 4FVMA 4UCOA 5EOYA 4ZHQA 4CS4A 4LFAB 3LNNA 3HKBA 2Q7EA 4FFBA 4MTEA 3FMAA 1QHTA 1VS0A 3RYFA 2UU9B 5KMGA 4FM0A 2HHHH 1TUBB 5JQGB 1O9GA 5LMNB 4DV1B 4DK1A 4ZOLA 5CB4A 2UXCH 3JSLA 4PI2A 4ZHQB 3K5NA 1V9PA 3K3VA 1N36B 5LA6A 2OWOA 3HKBB 4DV4B 3HKEB 1AN7A 3T1YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 B;  3GJX B;  3BA8 A;  1TAE A;  4JI7 B;  4JI0 B;  2VUG A;  5D1O A;  1HR0 B;  4EFE A;  4DR5 B;  1XDN A;  4LH6 A;  2Q2U A;  4LF4 B;  4JI5 B;  4DR2 B;  3GDE A;  4GKJ B;  4OX9 B;  4DR7 B;  3L2P A;  3BAA A;  2F4V B;  5BR8 B;  1DGS A;  4X66 B;  1HNZ B;  2Q2T A;  1IBL B;  1N33 B;  1N34 B;  4DR3 B;  4NXN B;  4DRF A;  2HVS A;  5D1O B;  5FPR A;  4JI1 B;  1X9N A;  2HHH B;  4LF8 B;  1XNR B;  4DV5 B;  4CC6 A;  4DV2 B;  4LF7 B;  1IBK B;  5IWA B;  4DV7 B;  2UUA B;  1N32 B;  3W1B A;  3S24 A;  4PZ6 A;  5FPO A;  4JV5 B;  4TOI A;  2CFM A;  5D1P A;  2UXC B;  4EFB A;  2UXB B;  3W1G A;  1IBM B;  4DV0 B;  4DUY B;  1I94 B;  1FJG B;  3JSN A;  4PZ8 A;  1A0I A;  4B3T B;  3RR5 A;  4DR1 B;  4GLX A;  1J5E B;  4AQY B;  4JI8 B;  3TY8 A;  4B3S B;  3KYH C;  4LFB B;  4DV3 B;  4DUZ B;  4LH7 A;  2UXD B;  4JI4 B;  4CC5 A;  3BAB A;  1P8L A;  4X62 B;  2UUB B;  4JI3 B;  4K0K B;  4X64 B;  3NBY B;  1ZAU A;  4DR4 B;  1CKM A;  1CKO A;  4NXM B;  1XNQ B;  2HIV A;  1XMQ B;  4EEQ A;  3OTO B;  3TY5 A;  1HNX B;  4YHH B;  5DIS C;  4EQ5 A;  4YY3 B;  4JYA B;  3T1H B;  3W5O A;  4JI6 B;  1CKN B;  4UCT A;  4UCV A;  3VNN A;  3NC0 B;  2ZM6 B;  4DR6 B;  4KHP B;  2VQF B;  1FVI A;  3PN1 A;  4LF6 B;  3RTX A;  4E6N A;  1S68 A;  1P16 A;  2HVR A;  3TY9 A;  2E5L B;  4UCO A;  2HIX A;  4LFC B;  3SGI A;  4X65 B;  4LFA B;  1TA8 A;  4GKK B;  5LMU B;  3GB8 B;  3BA9 A;  1XMO B;  3QWU A;  2VQE B;  4LF5 B;  1VS0 A;  2UUC B;  4UCU A;  2UU9 B;  1B04 A;  4UCS A;  4LF9 B;  4DV6 B;  1CKN A;  4PZ7 A;  5LMN B;  1XK5 A;  4DV1 B;  3NBZ B;  3JSL A;  4B3M B;  1V9P A;  4UCR A;  3UQ8 A;  1N36 B;  1HNW B;  2HVQ A;  2OWO A;  4DV4 B;  4UFZ A;  4B3R B;  3T1Y B; 
#chains in the Genus database with same CATH topology
 1JJ2 U;  3GJX B;  4X89 A;  1WB7 A;  1XHZ A;  2W70 A;  2YI8 A;  3CXC U;  2ZCE A;  4DR5 B;  2EIN B;  3LDC A;  1PL0 A;  1WR2 A;  4P30 A;  3Q2O A;  2EIN C;  2E3C A;  2R7L A;  2V9W A;  1DF5 A;  2J6T A;  4TQF A;  3T9C A;  3OSN A;  3QTC A;  3CPW U;  3FYI B;  4X66 B;  1WSC A;  1J95 A;  1KT8 A;  1N33 B;  5GON A;  5L3F A;  2DMX A;  4MAM A;  4DUZ H;  4EKW A;  3V4S A;  1L0L H;  2R85 A;  2E2I A;  1M4U A;  1JLL B;  4IL6 Z;  3G8C A;  1Q6H A;  1S5L Z;  2FK1 A;  3GTL A;  4NTX A;  1K5Q A;  4B3M H;  4HNA A;  5E79 Z;  1NH2 B;  1HNW H;  2FYU H;  3T1Y O;  3KKY A;  4FBT A;  4ZIB A;  5IWA B;  2Q6A A;  4JTA B;  1K34 A;  5HBR B;  1S03 G;  3JAS A;  2RGV A;  2IU3 A;  3CP1 A;  4F6R A;  4X65 H;  4DV0 H;  1SQG A;  3P3P A;  2R9A A;  4RQE A;  4JI0 H;  4JI7 H;  4O7V A;  4LP8 A;  1JOY A;  3SJA C;  4P9P A;  2PI5 A;  2RDJ A;  4RQF A;  1JCH A;  1OCR C;  3ML0 A;  3JSN A;  5K1X A;  5JVD B;  3Q1K A;  2ADQ B;  2Q9L A;  1MZE A;  3MAQ A;  2FP4 B;  1RYR A;  2OH2 A;  3E2E A;  1I50 A;  3HOX G;  4J9R A;  4GUN A;  5DGH A;  4FM9 A;  4TUY F;  1BZK A;  4E4T A;  4L1K A;  5KHH A;  2UUB B;  2YW2 A;  2FKL A;  4CZZ A;  4F6R B;  1NJI W;  5CE8 A;  4A3K G;  1HNX H;  1JVM A;  2QE7 G;  4KHP O;  5L1L A;  2LO1 A;  1W96 A;  2LJ2 A;  5LGN A;  1QVF U;  4NYE A;  3EVK A;  4A3C G;  4MV9 A;  2B63 A;  2QK4 A;  2ZM6 B;  5B3S B;  1RJR A;  1TVK A;  4FLZ A;  2VQF B;  5L1I A;  5CM0 A;  4ED2 A;  3OR7 C;  2Y4R A;  3FX7 A;  1VKZ A;  3UZO A;  4NLG A;  2LW1 A;  4I55 F;  4PDR A;  5JQG A;  5L1J A;  5J2U A;  3S3X A;  4I9W A;  2ODT X;  4CH4 A;  4LWS A;  3SE7 A;  4LFC B;  3HOV G;  4RAY A;  1EKF A;  5IDJ A;  4LBE C;  1HNZ O;  2JA6 G;  3SPG A;  2YWV A;  4XDK A;  2EIL B;  1NR7 A;  2IU0 A;  1VQ6 V;  2V5A A;  2IH3 C;  1I1M A;  2JEX A;  2D3O W;  4O7W A;  2IBZ H;  2YS7 A;  4P2Z A;  5GTI Z;  4WCE V;  5EWF A;  2ZE5 A;  3CCL V;  4MVS A;  1PM9 A;  4JAA A;  5BWU A;  2R8H A;  5LA6 F;  3E8F A;  3BA8 A;  4OX9 O;  4A3D G;  4RZQ A;  2UXC O;  4FJC C;  1I1L A;  2B5U A;  3TEK A;  2NVY A;  2AGP A;  1M0W A;  2W6Z A;  3GIL A;  1N56 A;  3RVY A;  4TQS A;  1KJQ A;  5BWT A;  4HNA B;  4DR7 B;  1ZSP A;  3KRE A;  2EJR A;  1DIK A;  5IE9 A;  4H44 B;  1NQT A;  5BR8 B;  2FLN A;  4PD4 F;  1GN6 A;  3T99 A;  2MCT A;  4Q45 A;  2IA6 A;  3R66 A;  1IOW A;  4IWY A;  3Q8R B;  1X9N A;  3KTM A;  5KFR A;  5FJ8 G;  2HHH B;  4DR7 O;  2AHZ A;  3I12 A;  1FFX A;  5BR8 O;  3H0G A;  5EDW A;  4OXS A;  1IBL O;  2P90 A;  4O7T A;  2WLL A;  2DYS B;  2K1E A;  2ZNI A;  3DF7 A;  1N0J A;  4FFO A;  4UB8 Z;  5KFV A;  3HOZ G;  5KFE A;  2HG8 A;  4EYH B;  4JF3 A;  1F4N A;  4W4K A;  4Q44 A;  5LYJ B;  4A3M G;  2XGQ A;  2KSD A;  1SA0 A;  2XIG A;  4TV9 A;  3GTP A;  4DR1 B;  3JAT B;  2V1D A;  2HR3 A;  2FKX A;  1BQZ A;  1P84 F;  5JQG F;  1BHB A;  2NVX A;  3VQV A;  2XCA A;  4NTY A;  2KG7 A;  3U54 A;  4O3R A;  3LSS A;  3ASO B;  3HKD A;  2Q7G A;  1GSO A;  1NS1 A;  3D36 A;  2P22 C;  1P7B A;  1NTK H;  5KFJ A;  4JTD B;  3TIN A;  2W6Q A;  1A48 A;  2HIV A;  3K04 A;  5KFH A;  4EEQ A;  3ABL C;  3UM7 A;  1JA8 A;  5J2T A;  1IBL H;  5DM6 V;  5KFI A;  3JAR A;  2WSS G;  4X64 H;  4A3L G;  1ZL8 A;  4FBU A;  3JAL B;  4PDM A;  3I4M G;  5H80 A;  1VP7 A;  4E2L A;  3K58 A;  2E5L B;  2W6O A;  2OCC B;  4K6N A;  3QZ7 A;  4X65 B;  4O86 A;  3I4N G;  3CYO A;  2EIL C;  3F5T A;  3ZS8 C;  5IWA H;  2BQU A;  2VRZ A;  3RYI B;  4JTC B;  1T36 A;  5BMV B;  2DLN A;  3ZX6 A;  1XK5 A;  2YZG A;  2QKA A;  5EBM C;  2YEV A;  2DYR B;  2AGA A;  1B6R A;  3DC6 A;  3VQX A;  2UU9 O;  2N05 A;  3JAL A;  5EWE A;  3K79 A;  1K8A W;  1GN2 A;  1NH2 D;  1BQ0 A;  4K8X A;  4C5A A;  2C2A A;  1N36 H;  1GTO A;  4JI3 O;  1EKV A;  3ABT A;  4EFE A;  3GIP A;  5IYB O;  4M0J A;  1A3G A;  3DSQ A;  3SPH A;  2EIJ C;  4X65 O;  3R5X A;  4IAJ A;  2YIB A;  4ECY A;  4DRX A;  5BMV A;  2HHF A;  4JI6 H;  2FB5 A;  1XHX A;  3H01 A;  2KKW A;  2ZR2 A;  1EHI A;  4AQY H;  2W9A A;  4IIJ B;  1AR5 A;  1NBM G;  3M4I A;  3QVN A;  1N0N A;  1V54 C;  2GPS A;  5FPR A;  4GYC B;  4JYA H;  1B06 A;  2R6F A;  1VEW A;  3WWH A;  4LF6 H;  1Z2G A;  5IT9 W;  1S9F A;  3LNM B;  4K35 A;  2JA5 A;  2R7Z A;  1LUW A;  4DV7 B;  5HV6 A;  2UUA B;  1N32 B;  1WN7 A;  3ZCC A;  4ZI7 B;  3NUA A;  3VPD A;  1LUV A;  4WF9 V;  3IG0 A;  4FPP A;  1DAA A;  2CFM A;  3G6E V;  3UYY A;  1MNG A;  3HKE A;  4AYB A;  2UXB B;  1VQ4 V;  4F4Y A;  1Q43 A;  3M9M B;  1EZJ A;  1PV0 A;  1EM1 A;  2FL4 A;  2KQX A;  1Y6X A;  1XNQ H;  4B3T B;  5I5T A;  2GQR A;  3GID A;  3FB6 C;  5KFK A;  1XMQ H;  3AEI A;  5KG2 A;  1Q82 W;  2PVP A;  1SKV A;  3FAV A;  2XTA A;  5DEC A;  2XOK G;  3OEE G;  3RBZ A;  3OUZ A;  4FZ0 A;  1I0H A;  3U11 A;  1HDJ A;  5J2T F;  3K3W A;  1R6T A;  3BEH A;  4K0K B;  4X64 B;  3OUU A;  4UV8 A;  4X62 H;  4MVO A;  3M9O B;  4JAU A;  4GZR B;  1KD1 W;  4D7T A;  4GKK H;  4BWS C;  1AI4 A;  2WLK A;  4RNN A;  5FL7 G;  2JA8 G;  2ARH A;  5L3E A;  4UCV A;  5CBG A;  1F7Y A;  1RSO B;  5KFN A;  3M99 B;  3G8D A;  3OMN B;  3H9V A;  3N2K A;  1JPX A;  4JI1 O;  4O7N A;  4EEY A;  1IXM A;  2OTJ V;  3SPJ A;  1SQF A;  1XOU A;  3CEB A;  2DQ3 A;  4FM1 A;  2ITD C;  4PEL A;  4CKE A;  3G6B A;  4IYH A;  4E4E A;  4B7K A;  5KA5 A;  4CKC A;  4XDJ A;  5ITZ A;  5LMU B;  4DR2 O;  3P30 A;  2Q0A A;  4YJ2 B;  5C3E G;  1CEZ A;  3K5I A;  2UUB H;  4PBC A;  3LUT B;  1WJZ A;  1BGW A;  2I87 A;  1RSO A;  2DYR C;  1GMG A;  2A0L A;  3J81 N;  3NBZ B;  2NR5 A;  4J41 A;  4O3O A;  2YXL A;  2CKZ B;  4DRX B;  4XYL B;  2Y69 B;  3K08 A;  4DR5 O;  1WA8 A;  3RYH B;  4UFZ A;  3TGU H;  5J2U B;  3JCZ A;  4PI0 A;  2BQ3 A;  3PO3 G;  3CX5 F;  2AGQ A;  1K9M W;  5IT9 N;  1QU7 A;  1WB8 A;  2YS8 A;  1PNL A;  1S76 D;  3WG7 C;  5K3W A;  4DQN A;  5KFL A;  2DAB A;  4UUG A;  4LF4 B;  4O7R A;  3HKC A;  3RYC B;  4O4H B;  3ABL B;  1BHA A;  5FD5 A;  4LF5 O;  3CEI A;  3KHR A;  1M56 C;  4DR1 H;  1RPR A;  4QIW A;  5LP6 A;  4M9U A;  4O7L A;  1CP9 A;  3IC7 A;  1V55 B;  2O03 A;  1SQP H;  4LF7 H;  3U0G A;  2NLJ C;  1HNW O;  4QW8 A;  2RCV A;  4NVP A;  3DTF A;  4JI1 H;  4O4H A;  2YID A;  4IT5 A;  1YXB A;  5KFB A;  3WB1 A;  4QWB A;  3MR3 A;  2C2D A;  3ABK C;  3OE7 G;  2YL2 A;  2EBO A;  3GQC A;  3TQT A;  4GKK O;  4DO2 A;  2Q67 A;  1XL4 A;  4TOI A;  3DTU B;  2C28 A;  1US6 A;  3IGA C;  3ABU A;  4JI3 H;  1BSM A;  2IH1 C;  3K5O A;  1K1Q A;  1IDS A;  1YJN V;  5HFM A;  3CRC A;  1A0I A;  1OCO C;  3H1L H;  2ZDI A;  1QNM A;  4UB6 Z;  3JD2 A;  3JZ6 A;  3MR2 A;  4UVA A;  1VQ9 V;  4FLU A;  4QJF A;  3BPZ A;  2HJF C;  4TV9 F;  3CVZ A;  2YI9 A;  1Q3E A;  3EXA A;  4LFA O;  2I8C A;  3G67 A;  3SJB C;  4CKB A;  2UXD H;  1EZV H;  5IWA O;  1DV1 A;  3JAW A;  3CD6 V;  2ZQM A;  1ZAU A;  4YHH H;  3K0G A;  1TGO A;  5KUM A;  2ZM6 O;  5KT6 A;  4TV9 B;  3GVM A;  1ZTE A;  4R7R A;  4FFN A;  1Y1V A;  2QR4 A;  3Q4H A;  1L1F A;  4QNH B;  4A3J G;  3RB4 A;  1M7J A;  4ECZ A;  4WFE A;  4JYA B;  2F1M A;  3T1C A;  3K5M A;  3K5L A;  1VQO V;  3I56 V;  5CA0 F;  3R65 A;  5D5P A;  3DTG A;  1Y74 B;  4DV5 O;  4LF6 B;  4NZM A;  3PW7 A;  2HVR A;  3RFC A;  2P6J A;  3HB9 A;  3IC9 A;  1QR8 A;  2R93 G;  4LFA B;  3JCU Z;  2C35 B;  4AQY O;  4A93 G;  4HNV A;  5KFQ A;  1FFT B;  3FMA A;  1VS0 A;  3TXS A;  2LFR A;  4FM0 A;  5C93 A;  4GT1 A;  3GV8 B;  4YQW A;  4HZ3 A;  1YJW V;  4DV1 B;  4O3Q A;  3CCE V;  2EJ0 A;  5HNE A;  2Y4U A;  1YDX A;  3B8M A;  5LXT F;  5GTH Z;  2OTL V;  5LA6 A;  4DV4 B;  2Y69 C;  3HKE B;  5B1B B;  4FU0 A;  2P67 A;  1RK6 A;  3GIM A;  1OZ0 A;  2JJ1 G;  1AN7 A;  4DV1 O;  1IBK O;  4I7H A;  4MV4 A;  4RNO A;  3M7M X;  4FFR A;  4A3G G;  5EZY B;  4MVR A;  2IBK A;  1BCC H;  4N21 A;  2XAG A;  4ZOL B;  2WLH A;  2VS0 A;  4JI5 B;  5IP9 G;  1I94 H;  2VUM G;  4PDB A;  5IJ0 B;  1SYX B;  2QTS A;  4JYB A;  5EIB C;  1LR1 A;  1GM7 A;  5EZY F;  3KAL A;  4DW1 A;  2R8J A;  1Z5W A;  1DTO A;  1IBL B;  4Q4C A;  2Q73 A;  3TIG A;  2GLT A;  1YZB A;  5LYJ A;  4O7Y A;  1H2M A;  2YC0 A;  2ZIO A;  3UCS C;  3IFX A;  4MTF A;  3UZB A;  4YJ2 A;  4RUF A;  1NKD A;  1EUC B;  5EZY A;  1IBK B;  1F51 A;  3JAK A;  1JQ0 A;  4JZ2 A;  2XAS A;  1RPO A;  4HBN A;  3ZHV A;  4WFA V;  5KG6 A;  2GUZ B;  4OPA A;  4ECX A;  5D1P A;  4DR6 H;  4X1I A;  2UVV A;  1SET A;  5IY5 C;  2I80 A;  2ZIN A;  5BWV A;  2R8I A;  4PZ8 A;  4CS2 A;  5LBQ A;  3A0B Z;  2PF4 E;  3OUS A;  1M5I A;  2OIE A;  3UT5 B;  4H13 B;  1OBD A;  2A79 B;  2HGX A;  2X7R B;  3OTO H;  2CDY A;  3F7V C;  5LXT A;  1YTF D;  2N04 A;  4J9Y B;  3ZRS A;  4EB6 A;  4D6T H;  5I5S A;  2BR0 A;  4DV3 B;  4JI0 O;  4JI7 O;  3X2Q B;  4YJ3 B;  3D3Q A;  3DAA A;  1M0T A;  2PBZ A;  4RNM A;  5LOV B;  1MSW D;  4B3S O;  2QTO A;  1CKM A;  2ZXW C;  2IJK A;  3BCC H;  4MVQ A;  1KUT A;  3HPL C;  3E89 A;  1VQK V;  4G28 B;  5DIS C;  1VAJ A;  1JR9 A;  3T1H B;  4YIP A;  1UJW B;  3FB5 C;  1EN4 A;  1RYS A;  1TUE B;  3L73 H;  2YXH A;  5KAI Z;  1MA1 A;  2OT5 A;  2W8K A;  1EKP A;  1MAB G;  3LDD A;  4I4T B;  5F2V O;  3T9F A;  4EYI B;  5DN6 G;  4JAV A;  3GB7 C;  5EBL C;  4PJ0 Z;  2M05 A;  5BWR A;  2EIM B;  1XMO B;  3AG2 B;  1S10 A;  4I7Z B;  5AG2 A;  2UXD O;  2UUC B;  2YS6 A;  3IAY A;  5KFP A;  4DL7 A;  4O4I B;  4KP4 A;  1P7G A;  1WP8 A;  1M90 W;  2JA5 G;  2YZM A;  1OCO B;  3PVX A;  2GSM B;  3B4S A;  1C3O A;  3ASN B;  4OX9 H;  4UCR A;  4QPK A;  1H2S B;  5FNV F;  5ITZ B;  4TT3 G;  4X20 A;  1EBO A;  3KHH A;  1VF7 A;  3JZF A;  1BL8 A;  3T4D A;  5L3G A;  4TM5 A;  4U6P A;  3GTO A;  3KHG A;  3SJQ C;  4RZR A;  3KAJ A;  2HKO A;  2A3Q A;  3ICX A;  5KFM A;  5EC2 C;  3BJY A;  5JH7 B;  1T5E A;  4NXM O;  1KP3 A;  2F95 B;  1AI6 A;  4KXR A;  5KG4 A;  3FKI A;  4GLW A;  1YSC A;  4JI1 B;  2YSU B;  4NR1 A;  3UT5 A;  1VMG A;  1XNR B;  4DUZ O;  4QW9 A;  1SZT A;  4LF4 H;  5LL6 Y;  2P4K A;  3T9D A;  2KG7 B;  3FYE B;  5CA0 B;  4LF5 H;  2PTM A;  4J42 A;  3JYC A;  4DW0 A;  4DAA A;  2FE3 A;  1G2W A;  4TQR A;  4HYK A;  1U96 A;  5FPO A;  3CCS V;  4KHP H;  2XUM A;  2L6L A;  4D7S A;  1XI1 A;  5CN0 A;  1QLE B;  5EBW C;  3BVO A;  1WCM G;  1YCI A;  4RB3 C;  4ECQ A;  3K9S A;  3WO0 A;  3TY8 A;  2R92 G;  2XT9 A;  3CWB H;  2WE6 A;  4C5C A;  4DUZ B;  3ZMV A;  1ULZ A;  3C90 A;  2HHH O;  1E4E B;  4X62 B;  4J7J A;  2ZXW B;  5KHI A;  1GSA A;  4DV2 H;  3ZJZ A;  5KX5 A;  5DED A;  4TV8 A;  3BHP A;  2IJJ A;  2WLJ A;  3R5H A;  5CA1 B;  1AJP A;  4FLT A;  4EQ5 A;  4CHI A;  1PK8 A;  5B1A C;  1Q5O A;  4IHJ B;  2BSK A;  2XD4 A;  3D36 C;  2CTR A;  1B33 N;  1CE8 A;  2W7P A;  1KUQ A;  3JD3 A;  3HB3 B;  1K4C C;  5JVL A;  3RV4 A;  2CTQ A;  4X1I B;  2QDO A;  3ABK B;  4QE9 A;  1BXR A;  1GYF A;  4NKG B;  2YIB D;  1RFY A;  4O2B B;  4GKK B;  3J7A U;  4ZBM A;  2VUM A;  2W9C A;  3F5W C;  4KUM A;  1DV2 A;  4F6E A;  3GIK A;  3T5K A;  2YZN A;  2XAQ A;  2YDE A;  4B3T H;  1GM8 A;  4MV1 A;  4O4L B;  2C2E A;  2UUC H;  1KC7 A;  5FR9 A;  1VQN V;  1P49 A;  2HVK C;  4Q4D A;  1IBM H;  5C5J A;  4A3I G;  4CBC A;  2R86 A;  1C30 A;  4LFC H;  3GTQ A;  1K4D C;  1WNS A;  5B5E Z;  1KB9 F;  3RGZ A;  1AP6 A;  4UXN A;  4JI2 B;  4L87 A;  5HFL A;  4XZ3 B;  4B3R H;  2JJ2 G;  2Q8V A;  2F93 B;  5JCO C;  2ZE6 A;  5A2Q N;  5DQI A;  5KMG B;  2PMZ A;  1NT2 B;  3BAA A;  5IYD O;  2A9H A;  4G3I A;  1TWC A;  3LP8 A;  2ZDH A;  1Q90 D;  1SER A;  1AR4 A;  4DR3 B;  1QCE A;  2XAH A;  2YU9 A;  4FFM A;  3TCU A;  4FFK A;  5LYJ F;  3TXQ A;  1KC8 W;  2RN9 A;  3T9E A;  1E4F T;  2Z5U A;  1HP8 A;  4X1K A;  5BMV F;  5KHG A;  2YXY A;  3G6Y A;  2BTQ B;  1IUR A;  4OGQ B;  4DXW A;  1V51 A;  2FPI B;  2W9B A;  1S3J A;  4TV8 B;  3H0G G;  1S0V A;  2JVD A;  2QWP B;  4DV0 B;  4JI5 H;  4U3J B;  4TQD A;  5B1N A;  2AHY A;  4DV4 O;  4FLX A;  3RIZ A;  4XYM B;  2V4Q A;  1MSD A;  1VBH A;  1FJG H;  1GO3 E;  4O4I F;  1XUQ A;  2YRW A;  4BY1 G;  4WBN A;  3JRW A;  4LH7 A;  4OPH A;  2QWN B;  5B1O A;  4CC5 A;  3ASO C;  3L9D A;  5KFX A;  4JI5 O;  4FLY A;  4DV6 O;  3CRA A;  4DR4 B;  1KP2 A;  1GN3 A;  4X66 H;  4Q6G A;  2E75 B;  2W9C B;  4IYI A;  5EK0 A;  2GTA A;  2WAQ A;  1N8R W;  4YY3 B;  5KKN B;  1N4C A;  5JJN B;  5KG1 A;  3KHL A;  2PGG A;  2ODM A;  3GIQ A;  3L71 H;  1WPB A;  2YEV B;  3FKS G;  2HDK A;  2VWK A;  2XCL A;  3KCY A;  3VPB A;  5CA3 A;  1H38 A;  4DYL A;  2LFS A;  4O81 A;  1VF5 B;  4J9Q A;  2QJ1 A;  2W71 A;  4J9P A;  3ABM B;  4LNU B;  4DLK A;  3VA7 A;  3EFF K;  1KJJ A;  2Z3Y A;  4MTD A;  1KQS U;  1CS0 A;  5IYZ F;  1PD3 A;  4JGS A;  3H4B A;  1S77 D;  2M7W A;  2EIY A;  3A2F A;  1G6U A;  4DV1 H;  4CMF A;  1OCR B;  3W7S A;  4K0K O;  4RWU A;  4PZ7 A;  4PV1 B;  1G4Y B;  2J6U A;  5IYZ B;  2EIK C;  4AYB E;  5JUM A;  1E4E A;  5DAA A;  3QG5 A;  4MA0 A;  4DV6 H;  4DL4 A;  2JS5 A;  3L75 H;  4PWQ A;  4IRC A;  4B3R B;  3W7X A;  2AZ0 A;  2R7N A;  4F4W A;  4J9M A;  1R6K A;  5I5V A;  1AJN A;  3U9S A;  5DG9 A;  2FPG B;  4LCU C;  4XDL A;  3T9B A;  1RM1 B;  4AIL C;  1JDB B;  1W93 A;  4F4X A;  3HOU G;  4HN2 A;  4I9Q A;  1Q7Y W;  4JV5 H;  2DAA A;  2IP4 A;  5BR8 H;  2W9B B;  1T3N A;  2ADP A;  3MFH A;  1V55 C;  2CTP A;  5L3D A;  5LXT B;  4IR9 A;  3GV5 B;  4LF7 B;  4EGJ A;  1Y76 A;  4ME6 A;  3ZMS A;  1WAZ A;  1L8D A;  3E22 B;  1AUX A;  5K1P A;  1D2D A;  4PZ6 A;  3PR5 B;  1JFF B;  1Q6U A;  4EGQ A;  1GLV A;  2GTS A;  2CUG A;  2WYO A;  4QSH A;  5KG0 A;  3W1G A;  4J0M A;  5GON B;  1IBM B;  2CNU A;  2Q4P A;  1M57 C;  3CME V;  4RAI A;  1J5E B;  1TVK B;  2HJW A;  1TWH A;  1GM9 A;  4X8A A;  2DN9 A;  4J9K A;  2GV9 A;  1YVW A;  2NUA B;  1RJQ A;  4JI4 B;  2CQY A;  3AG7 A;  4MSW C;  1XBL A;  2IW5 A;  2Z04 A;  1KBL A;  3LML A;  5EYP B;  3T1H O;  1BS3 A;  3T4Z A;  1FKA H;  3CS5 A;  1HNZ H;  2L35 A;  2UUB O;  2KB1 A;  3TII A;  2CW7 A;  3W5O A;  4I55 A;  4I0X B;  3VNN A;  5KFW A;  4X1K B;  4KHP B;  3B40 A;  1N33 O;  4Q20 A;  3PN1 A;  1R9T A;  1M9N A;  4DR1 O;  3HKZ E;  1S68 A;  4MA5 A;  3RGX A;  4FVM A;  2WA4 A;  2P06 A;  4PA3 A;  5J9P C;  2JEU A;  3DXR A;  2R8G A;  4DV3 O;  2E74 B;  4CS4 A;  5BYB A;  3ZRW A;  4H33 A;  5KFS A;  3ZMT A;  1L0N H;  2B1G A;  2GPW A;  1ARO P;  4J9O A;  4XBF A;  4YJ3 F;  2EIM C;  3LSQ A;  4UVB A;  5DGA A;  2YRX A;  2UU9 B;  4ECW A;  5LOV F;  4YXW G;  4I0X A;  1DK1 A;  2ZGI A;  4O4H F;  2NU7 B;  3I5D A;  4ZOL A;  4DV2 O;  4PI2 A;  3ZRX A;  4ASU G;  1V9P A;  5H2F Z;  1SC5 B;  2IJH A;  4IZO A;  3G4S V;  1S0M A;  5L1K A;  4O3S A;  1WP7 A;  3RUP A;  1XIL A;  3K5H A;  3HO8 A;  4MV8 A;  1SEI A;  4I50 B;  3ETH A;  5CB4 B;  2W0X A;  4X1Y A;  1MZF A;  1O9H A;  5FLX N;  4JZG A;  4OX9 B;  3T54 A;  2HEP A;  3L2P A;  2JK5 C;  3MR6 A;  3H1J H;  3VOU A;  2ZDQ A;  4XX0 B;  4WFG A;  1DGS A;  4BR6 A;  3DGE A;  4NTW A;  2HVS A;  2B1I A;  3K06 A;  4MV7 A;  1I1K A;  4LF8 B;  5C8Y F;  1MZB A;  5LMN H;  4C7U A;  3K03 A;  1B3Q A;  2EUL A;  2VPQ A;  5DLG A;  3E8B A;  1URF A;  2W6N A;  4EB6 B;  3OSP A;  3OM3 B;  3GII A;  2O57 A;  2R87 A;  3LWB A;  5C44 G;  1SQQ H;  2V7Q G;  5H5N A;  1PX2 A;  2COG A;  2WB1 A;  1N34 H;  4UVC A;  3UO2 A;  2OLS A;  2UXC B;  4ZKI A;  4BW9 A;  4JI6 O;  2C2R A;  1S0O A;  1M57 B;  2QKS A;  3AG1 B;  3JD0 A;  4DUY B;  5KFU A;  2JS3 A;  1FFX B;  1R3J C;  2CE4 A;  1FXH A;  5J2T B;  2HGS A;  5DQG A;  2X6C A;  3APQ A;  1HW7 A;  4ZOL F;  3X2Q C;  3EHB B;  4PA6 A;  1XMO H;  1V4Y A;  5CA0 A;  4R8U A;  2N74 A;  1Q81 W;  3BAB A;  2CGO A;  3DXR B;  3GTG A;  5KG3 A;  4U7C A;  3RF2 A;  3SPI A;  5FLX W;  2Z0A A;  4ZHQ F;  1JKJ B;  1YIJ V;  3RYI A;  4IRK A;  3TET A;  4GCZ A;  2QWR B;  5B3S C;  3NC0 B;  1FAF A;  2NN4 A;  4DR6 B;  3CRM A;  4CH3 A;  2RQ6 A;  1TWF A;  2E5L H;  3H20 A;  1H2K A;  2GUZ A;  3ZHT A;  5LMU O;  3JAW B;  4JI2 O;  3WWI A;  5KG7 A;  1ZX3 A;  3TY9 A;  3RYH A;  2F43 G;  1OCZ B;  1MG1 A;  4A5U B;  2A7W A;  2C00 A;  2ZKO A;  2ASD A;  2VWJ A;  4Q8E A;  2R7M A;  2NU9 B;  1ROP A;  2VQE B;  2WLI A;  1N36 O;  4YR2 A;  4FM2 A;  2JEG A;  2DQ0 A;  2A06 H;  4LF9 B;  4M7E A;  1Q8I A;  2ALZ A;  3CCV V;  3VOT A;  3BQ0 A;  2WA3 A;  4B3S H;  3BG5 A;  4B3M B;  3RJ0 A;  3MD0 A;  1JFF A;  5CA1 F;  4R6Z A;  3Q8S B;  1FXK A;  1MMM A;  3CJH A;  2V59 A;  5GON F;  2PYJ A;  4YR0 A;  1G8M A;  5IYB G;  4ECR A;  5D1O A;  3HT5 A;  4ECU A;  1HR0 B;  3BAC A;  4LH6 A;  3SNO A;  3RWR D;  5DG8 A;  1IOV A;  1IYE A;  1S5J A;  1HR0 H;  4DR2 B;  3GDE A;  1UPG A;  3RV3 A;  2V4D A;  4O4L A;  2E2H A;  1ZL8 B;  4F4L A;  3N6X A;  4LF9 O;  2QM8 A;  3KZI Z;  3AYH B;  5KT3 A;  3F7Y C;  4NXN B;  5LL6 b;  3CRQ A;  2R70 A;  4MVU A;  1Q86 W;  5BYA A;  4FS2 A;  2X5R A;  4RUC A;  2ZT9 B;  1L2Z A;  3B09 A;  2ZNJ A;  4BAY A;  4A3F G;  1YI2 V;  3WNZ A;  1EYZ A;  1ZHS A;  2VQE H;  4MV6 A;  1I7N A;  5LP6 B;  4CE5 A;  5BZB A;  1HR0 O;  3CC7 V;  2WB1 E;  5LGT A;  3LQS A;  3U0Z A;  3C3T A;  3CE2 A;  4C2M A;  3V6H A;  2QF7 A;  3MWE A;  5L3C A;  1JXL A;  3OGC C;  3QO5 A;  3NR7 A;  4G2K A;  2Y0I A;  4PDL A;  3JD4 A;  1SQV H;  1I7L A;  2ASJ A;  4JXU A;  2ATL A;  2HP8 A;  2PY5 A;  4GLX A;  2X6B A;  1NZ6 A;  1PKX A;  2DWD C;  4FLV A;  5KHJ A;  3SYO A;  3AX6 A;  4A2B A;  3N42 B;  4DR3 H;  2B63 G;  1KEE A;  2YZL A;  3FDS A;  5D8D A;  4B3T O;  3SYC A;  5I5Y A;  4N23 A;  4EBC A;  1X59 A;  4JI3 B;  2YUA A;  2BCC H;  3RBE A;  1PP9 H;  4F4Z A;  2RF4 A;  4K0K H;  1UC9 A;  4DK0 A;  3R23 A;  1TUB A;  1MOF A;  2JGD B;  1M56 B;  5D5Q A;  2UUA O;  1N32 O;  5B1A B;  4DR7 H;  1M1K W;  1W59 A;  2FTK A;  1PPJ H;  3N2G A;  5IYC O;  4PDV A;  4QPJ A;  1QR9 A;  3SJC C;  1IX9 A;  4QJF B;  2QM7 A;  2GQS A;  2JGU A;  2QKC A;  3TK1 A;  4JPR A;  2WLM A;  1QBZ A;  3A0H Z;  3B2E E;  3CSW A;  5KT5 A;  5KFG A;  2JEJ A;  3WB0 A;  5EYP A;  4O2A B;  3GB8 B;  5KG5 A;  4LFB H;  3BA9 A;  3A8T A;  2ZE8 A;  3AG4 C;  3WO1 A;  1K83 A;  3N41 B;  3STZ C;  1RK5 A;  3BQ1 A;  2AZ2 A;  3PW0 A;  5IJ0 A;  4Q8F A;  2HHF B;  2H94 A;  3PJS K;  4Q43 A;  3HOY G;  1Z2N X;  3OTF A;  4PA9 A;  5DG7 A;  2WAM A;  3H40 A;  3CXH F;  2W0F C;  5LP6 F;  5IJ9 B;  1VBG A;  3ZHU A;  3MR5 A;  1G1X B;  3OT7 A;  1W0J G;  2P0A A;  2FMA A;  5DGI A;  4ED8 A;  3RBD A;  5BXZ A;  1CPY A;  1N48 A;  3SDL A;  4GX2 A;  3K0D A;  2Q2U A;  3CCR V;  3RB0 A;  3PO2 G;  5JJJ B;  1XNR H;  4MT8 A;  4GKJ B;  1JIH A;  3TJT A;  2DOS A;  4NYK A;  4R7C A;  2VQD A;  2X0S A;  3BY6 A;  2R7K A;  3IN5 A;  3HKD B;  3JAS B;  4LC1 A;  1S97 A;  2BQR A;  4QE7 A;  3UO3 A;  4J7K A;  4O2B F;  3TW6 A;  4HAM A;  5F9L A;  2CZG A;  5BWX A;  5A9G A;  1ENV A;  5KFT A;  2HFE C;  4JV0 A;  2FK3 A;  3M8A A;  3QQM A;  1BJT A;  2FJZ A;  3IJ4 A;  3V6J A;  2UXX A;  3NXS A;  1B6S A;  1FYJ A;  4ECS A;  3CCM V;  3W1B A;  3S24 A;  4J80 A;  1EFR G;  4GX1 A;  1YJ9 V;  2DPI A;  1AUV A;  1KYO F;  2ZDG A;  1K92 A;  4FFP A;  5IP7 G;  2W6M A;  3ASN C;  3RR5 A;  4TUY A;  5TIS Z;  2PMZ E;  4GC7 A;  4B3S B;  4LSX A;  2YCH A;  3CSX A;  3JAK B;  1XNQ O;  1XRE A;  5CMU A;  1K33 A;  1GSH A;  4H0L B;  1AB3 A;  3L4K A;  2UXB H;  2PI4 A;  1KU9 A;  1CXZ B;  3NBY B;  2F23 A;  4X20 B;  3EPI A;  1CKO A;  2JA6 A;  1H2G A;  4B3M O;  4TUY B;  1XNQ B;  1BT8 A;  1VIB A;  3RYF B;  4DV7 H;  4JV2 A;  3H3V H;  1CKN B;  2AU0 A;  4HQ6 A;  3FD9 A;  2DWE C;  1VQP V;  2HVJ C;  1N33 H;  2BTQ A;  4JUZ A;  1QLN A;  5C8Y A;  3V4Z A;  2HIX A;  1KMI Z;  4DV7 O;  5CR5 A;  5KS8 A;  3SGI A;  4TV8 F;  4JI4 O;  5CAE B;  2JRI A;  1TA8 A;  3ABM C;  5DGB A;  1BE3 H;  1E4G T;  4I55 B;  5KT2 A;  1U97 A;  3T1H H;  2R84 A;  3JAM W;  3PW4 A;  4UCU A;  5FNV B;  2R8K A;  1VF6 A;  4MTO A;  4IHJ F;  2BOB C;  5LHI A;  2R92 A;  4WBN B;  4DV6 B;  4J9Z B;  5KA6 A;  1H8H G;  3L72 H;  1FPO A;  2LGQ A;  3AG3 C;  3D8C A;  3MDS A;  4TSF G;  5B66 Z;  5KFZ A;  3Q8P B;  2WPD G;  2QM4 A;  3OTO O;  3Q8Q B;  3RAQ A;  2IJI A;  2QWO B;  4LMY A;  1CQJ B;  5EIB D;  2YYA A;  3RVZ A;  1OCC C;  1XDN A;  3EPG A;  3RAX A;  2R9I A;  4BBS G;  4JYC A;  1QQC A;  3ZIA G;  4O4L F;  4O4J F;  1FXK C;  4R50 A;  2VA3 A;  1SRY A;  3OGI B;  3WB2 A;  3E22 A;  1N34 B;  3FKI G;  4DRF A;  4DV3 H;  4U7O A;  2RGR A;  3GTK A;  5GW7 A;  3L74 H;  3HOW G;  2VQF O;  4X64 O;  2BE3 A;  2LQT A;  2KSW A;  3A0R A;  4DV5 B;  4LF6 O;  3E8H A;  5CA1 A;  1I3Q A;  1EN6 A;  2C22 A;  4DR4 H;  3G80 A;  5LHG A;  1YEW A;  1GN4 A;  3ETE A;  4WFF A;  1SQB H;  4YJ3 A;  4J9N A;  3SPC A;  1Y74 A;  2EX3 A;  1I94 O;  3T9A A;  2W7O A;  2JA7 G;  4QGP A;  1JX9 A;  1NVP D;  3OHA A;  1ZET A;  1FKA O;  1M93 A;  3FB7 C;  3BQ2 A;  1GRJ A;  1BGY H;  3R5F A;  2OCH A;  1A0G A;  1I94 B;  5KAF Z;  4B08 A;  4DV4 H;  4DL5 A;  3DC5 A;  4I4T F;  1IZ3 A;  3MWM A;  2Q0O C;  2RMK B;  2WLI B;  3ORR A;  3HKC B;  4IIJ F;  1O75 A;  3UKM A;  4YY3 H;  4FK5 C;  4RB1 A;  5KLV H;  3SYQ A;  3GV7 B;  1EZ1 A;  5C8Y B;  5L9X A;  4QWD A;  3GLK A;  2UU9 H;  1VQ5 V;  1PNM A;  3K59 A;  3KCX A;  1GAX A;  2P7T C;  1JX4 A;  3B8N A;  1JMK C;  4JAS A;  5IJ9 A;  2Q5Z A;  4JI8 O;  4TVI A;  2FLL A;  2QEX V;  5I5W A;  1OV9 A;  4QWC A;  4DR6 O;  4ETS A;  1JJO A;  2W8L A;  1E1R G;  5C1P A;  3N8D A;  4LR3 A;  4L8J A;  1AI7 A;  5KFO A;  1NTM H;  2BOC C;  2EJ3 A;  1QVG U;  4LF9 H;  2ZDI C;  1CQI B;  2ZE7 A;  4RO2 A;  4Q0Y A;  5KFD A;  1COW G;  1WPX A;  4KL1 A;  4MW8 A;  5KHK A;  2SCU B;  4A3B G;  1GGO A;  3RB6 A;  5EOY A;  1WCM A;  1PL4 A;  4HNT A;  3I55 V;  2LGW A;  5JH7 F;  4X66 O;  3HKB A;  4FFB A;  4MTE A;  4FGR A;  3M9N B;  4FS1 A;  5I5X A;  5CBF A;  2CH7 B;  3MFI A;  2ILM A;  4UV9 A;  5I47 A;  3JD1 A;  1TUB B;  4KFM A;  4NXN O;  4DK1 A;  2AQ4 A;  5CB4 A;  3OW2 U;  4YAK B;  2QGN A;  3JZI A;  3PW5 A;  2UXC H;  1KKD A;  4ZHQ B;  3K3V A;  2UUC O;  2OWO A;  3HKB B;  3S3W A;  4X9Q A;  4Y8V B;  3G71 V;  4FLW A;  3OR6 C;  3HXL A;  4O3P A;  4BBR G;  3AK1 A;  4O7Z A;  5JVD A;  2F4V O;  4H37 A;  3OD4 A;  1Y66 A;  3THO A;  3FB8 C;  2UVW A;  1FXV A;  1F23 A;  2Q68 A;  3RN4 A;  3VMM A;  2OIG A;  1PNK A;  2DPJ A;  4Z2W A;  1OHH G;  2DJV A;  2AW9 A;  3W7T A;  2F4V B;  1Y1W G;  4O3N A;  1K3E A;  2Q7D A;  4YJ2 F;  1XEQ A;  2J6S A;  5D1O B;  4GX0 A;  5LA6 B;  1WH2 A;  4YIO A;  2QSA A;  3C0F B;  3APO A;  3MHH C;  1R3K C;  4RU9 A;  4DV2 B;  2PN1 A;  4MVM A;  4JI8 H;  5K2M A;  1F4M A;  3RYC A;  4FMT A;  4BIU A;  1W2B U;  1H2L A;  4YB8 B;  2XCP A;  4O84 A;  5LOV A;  4W4L A;  4JV5 B;  1AI5 A;  1XMO O;  1NVP B;  2ZM6 H;  1SS3 A;  4LF8 H;  3AG3 B;  2JIZ G;  3ORQ A;  5H6R A;  3ZN0 A;  5IY5 B;  3SI8 A;  1DF4 A;  1E1Q G;  3AG1 C;  2CTW A;  1Y76 B;  1THZ A;  4DR3 O;  1R1B A;  4AQY B;  4WBN F;  2DZD A;  1IYD A;  3J80 N;  4WHX A;  2M6Y A;  5BPF A;  5CB4 F;  4O4I A;  1FJG O;  1WLE A;  2ZD9 A;  4UUJ C;  2XHB A;  3WG7 B;  4NXN H;  1Z2O X;  1D5N A;  4J11 A;  4ECV A;  2IM9 A;  1OCC B;  3JAR B;  2Y0P A;  3FFQ A;  4GKJ O;  5EC1 C;  4O7S A;  2FB9 A;  5FLM G;  3OMI B;  2EZP A;  2Y4T A;  3OAA G;  3WU2 Z;  4A2A A;  3OTO B;  4WFB V;  4A3E G;  1HNX B;  4BW5 A;  1M6V A;  2VQF H;  4BXX G;  5IYC G;  4G27 B;  4CS3 A;  3ETJ A;  4O4J B;  1XL6 A;  1FVI A;  3VBB A;  4ZI7 A;  4NB5 A;  4O82 A;  4EBE A;  1P16 A;  5H9C A;  2EJ2 A;  4BIZ A;  4CH6 A;  2Q69 A;  2W6I G;  1OCZ C;  4JV1 A;  4DV5 H;  5KX5 F;  5KFA A;  4RCN A;  1WA8 B;  5KFC A;  1IXB A;  4J9S A;  3CJH B;  3MHS C;  2PYL A;  4EBD A;  1SFO A;  4LF5 B;  1KJ9 A;  1YIT V;  1I7F A;  4I50 F;  1B04 A;  2CGN A;  1S5H C;  1CKN A;  2HGW A;  4B3R O;  4C5B A;  3GIJ A;  3P3N A;  2DIK A;  4IIJ A;  4HYO A;  4YY3 O;  1Q6I A;  3ETQ A;  3ZRW B;  1HNW B;  1XMQ O;  1UNN C;  1AJQ A;  3E83 A;  4PA7 A;  4LFA H;  4TWK A;  3J80 W;  4DR5 H;  1SQX H;  3K57 A;  2VUG A;  1I5Y A;  1Z5V A;  3SR2 C;  4CH5 A;  4JI4 H;  3GWK C;  3T7A A;  3ZBH A;  4PHZ A;  3N44 B;  3NGD A;  1SCU B;  5JVD F;  3WWJ A;  3UFX B;  1J5E H;  4IGG A;  3E86 A;  4B7E A;  2Q2T A;  1YHQ V;  4LF4 O;  3MJF A;  1GK9 A;  3CCQ V;  3AK3 A;  3OMA B;  1NTZ H;  1ZLZ A;  2PUS A;  3H1K H;  2E5L O;  4FE2 A;  2F66 C;  2ABJ A;  2AGO A;  4NXM H;  3T5L A;  4FFL A;  4BWA A;  5E1A C;  2E76 B;  1B6Q A;  3LDE A;  2W6J G;  4IRD A;  4ECT A;  2JA7 A;  3G6V A;  4YAJ B;  3HKZ A;  1D5A A;  3ZHQ A;  3WFV A;  2VR1 A;  3H1H H;  2QYZ A;  1NR1 A;  4HNU A;  5JWP A;  4LSA A;  3OHB A;  1Y1V G;  5KT4 A;  4RB2 C;  2ZIM A;  3E35 A;  5LGU A;  2JGD A;  2COJ A;  4DUY H;  2COI A;  2EZO A;  5E25 A;  2IMW P;  2FK2 A;  3KYH C;  1SF9 A;  4ZI7 F;  3ZRV A;  2UXD B;  5C4X G;  3RB3 A;  3BFR A;  5EWG A;  3E5N A;  4LWS B;  2XAF A;  1K1S A;  3T5J A;  1FXK B;  4O2A A;  3N6R A;  4DIM A;  1DLB A;  4MVZ A;  5C1O A;  3ZN1 A;  4NXM B;  1RM1 C;  2GBO A;  2R9R B;  3O9O A;  1UC8 A;  1OJH A;  1NU1 H;  1KBH A;  4R8C A;  5KFY A;  4UCT A;  4ED1 A;  4DL3 A;  3V6K A;  4RAZ A;  1E79 G;  4JV5 O;  1T94 A;  2QWQ B;  2RNB A;  3SYP A;  1S0N A;  3H1I H;  3ZED A;  1J5E O;  2Y48 A;  3PFF A;  4APM A;  3QO7 A;  4JYA O;  1KTA A;  3BRC A;  3RW0 A;  1X4T A;  4FIP C;  2CNQ A;  2XAJ A;  2ZJT A;  2XND G;  3QWU A;  1TWG A;  1I08 A;  1ET0 A;  2UXB O;  4J10 A;  1AP5 A;  2ATK C;  3ETD A;  1K5S A;  3ZMU A;  1BNC A;  1EUD B;  4RUE A;  1GH6 A;  4AI8 A;  3CRR A;  3CMA V;  4GKJ H;  2P4V A;  4ED6 A;  3UQ8 A;  1Z2P X;  5DMX A;  4MS2 A;  2MK3 A;  2ASL A;  4X88 A;  2DWC A;  3PW2 A;  4IR1 A;  5T14 A;  2VA2 A;  1I6U A;  3SYA A;  1TAE A;  3Q4H B;  5I5U A;  3KAK A;  1AIL A;  1S72 V;  2ETN A;  2LW7 A;  2XGP A;  1AR1 B;  5H6Q A;  2J9G A;  4NZO A;  3FAV B;  1Y14 B;  1HWY A;  5IYZ A;  2XC9 A;  1Y67 A;  1XQ8 A;  2G38 A;  2NU6 B;  3TW7 A;  3P32 A;  4P9O A;  2RDI A;  1I2K A;  2H8P C;  4EG0 A;  3VQY A;  5DQH A;  1W0K G;  1RJP A;  3RT3 C;  2YIC A;  4CC6 A;  3CC2 V;  2P5O A;  3U9T A;  4QWE A;  2JEF A;  3J7A K;  4I50 A;  2EJ7 A;  1KKC A;  4R8U B;  2BSK B;  1ZHQ A;  3D3I A;  2CK3 G;  2UVR A;  3F8N A;  2GDS A;  2VPS A;  3AG2 C;  3OFN G;  1VQM V;  4WD3 A;  4EFB A;  1QLE C;  3GWO A;  1ZQ7 A;  4Z1M G;  5KX5 B;  3N43 B;  4ED7 A;  1SZX A;  3L70 H;  2F4V H;  1LNQ A;  2R72 A;  3CQZ A;  2ITC C;  1ORQ C;  3OUF A;  4JI8 B;  4LF8 O;  2WDT A;  3T5H A;  3R9R A;  2CAZ C;  2WLL B;  4LFB B;  1ZWI C;  3LSU A;  1I2L A;  2H3O A;  2V58 A;  1P8L A;  4O83 A;  2JEI A;  4U3F H;  3VPC A;  1OBG A;  1WRV A;  4LFB O;  5LHH A;  5A2Q W;  2MW2 B;  3PZP A;  3GTM A;  1KJ8 A;  2Q7H A;  3B77 A;  3ZHS A;  3CCU V;  1A9X A;  1XMQ B;  3TY5 A;  1YTF B;  4O2A F;  2OYQ A;  3RFR A;  4JI6 B;  1SES A;  3KXY T;  3JAM N;  5JQW A;  2PZS A;  3JAT A;  3QFF A;  5BY1 A;  4ED0 A;  5F9N A;  1R3L C;  3QO8 A;  4HR7 A;  1R73 A;  2X6A A;  4Z1V A;  1VQ7 V;  1VF6 C;  3J81 W;  2D2C B;  2FML A;  2OCC C;  2ZR3 A;  3U10 A;  4DL2 A;  2UUA H;  1K97 A;  2WTF A;  1N32 H;  2HG5 C;  5LP6 C;  3QF7 A;  1R3I C;  4U3J A;  4ZQI A;  3AG4 B;  2DYS C;  1I5X A;  4GC6 A;  4JYY A;  3CC4 V;  3GTJ A;  3W7U A;  2NNU A;  4UCS A;  5CBH A;  3LUL A;  2QB5 A;  1IBM O;  3U55 A;  2Y0S A;  3N2G B;  3N2K B;  4QIW E;  2AXT Z;  4O2B A;  1XNR O;  1IBK H;  1K7D A;  1VQ8 V;  2HVQ A;  3HBL A;  2UXN A;  4I4T A;  1A32 A;  3K9A A;  4BY7 G;  3TQ1 A;  3STL C;  2CH7 A;  4LNU A;  4RB0 A;  4JI7 B;  4JI0 B;  1IVS A;  2EIJ B;  4DR2 H;  4FFB B;  2WAQ E;  2HJD A;  4DV0 O;  2RJZ A;  2HLD G;  1GO3 F;  4PA4 A;  2A1H A;  4U7N A;  5I60 A;  2CW8 A;  1XDC A;  5BPH A;  2VQE O;  4NZN A;  2V4R A;  1Y1W A;  5LMU H;  3HR0 A;  4MTG A;  3ZHR A;  1K73 W;  2DE0 X;  1HNZ B;  3G6X A;  4J9L A;  1Y4M A;  4RUA A;  1SA0 B;  1UFI A;  2X0L A;  4WFH A;  5FD6 A;  2BTO A;  3CHX A;  4ED3 A;  4AHC A;  3QNE A;  2W6P A;  4J7Z A;  2RDC A;  4DR4 O;  3L4J A;  5FNV A;  3AW8 A;  1KEC A;  2YIA A;  3ETG A;  3OEH G;  4X62 O;  1H2N A;  1FS0 G;  1TWA A;  1BMF G;  5BWW A;  5IYD G;  3QZ8 A;  1OWT A;  4O4J A;  5KT7 A;  2FLP A;  2R7Z G;  4X1Y B;  4MTX A;  5JCO A;  3ZMZ A;  3W7W A;  1RP3 B;  5JH7 A;  3JRX A;  4YHH O;  1KJI A;  4ICG A;  4YP3 A;  1P4R A;  4K8Z A;  5JJE B;  1VQL V;  1FJG B;  1R6N A;  4DL6 A;  3EYY A;  4LFC O;  4ABM A;  4YR3 A;  1GKF A;  1VAR A;  5KUK A;  4DUY O;  4YBZ B;  2B9Z A;  1N34 O;  4I5S A;  4MW3 A;  4CMD A;  4IHJ A;  3VQW A;  5DLF A;  3T2M A;  4GX5 A;  1FD9 A;  4BIO A;  3MWD A;  1NI8 A;  2JDI G;  1JDE A;  5LMN O;  4YHH B;  1EN5 A;  2DW4 A;  5J2U F;  2VOB A;  3CB2 A;  1YF2 A;  3E8G A;  3N27 A;  3RGB A;  3T1Y H;  4JI2 H;  3K3P A;  2W57 A;  1V54 B;  1ZUQ A;  3N40 P;  3RTX A;  4E6N A;  4LF7 O;  1H8E G;  2Y0S E;  3AK2 A;  2WWW A;  3C3S A;  2GHY A;  2K9P A;  4UCO A;  5L3B A;  4ZHQ A;  2Z02 A;  2R82 A;  3LNN A;  4FZ1 A;  2Q7E A;  4QIW F;  2UVU A;  1QHT A;  4IWX A;  2LP7 A;  3KG2 A;  3RYF A;  1AVM A;  3O65 A;  5KMG A;  2HHH H;  4F50 A;  2WLN A;  5JQG B;  1O9G A;  2FPP B;  2EIK B;  3CCJ V;  2QA4 V;  5LMN B;  3PR4 A;  3H4D A;  1HNX O;  2CNV A;  3JSL A;  3K5N A;  4QWA A;  1N36 B;  5KFF A;  4K3A A;  2R93 A;  4MV3 A;  2NU8 B;  5B1B C;  3T1Y B; 
#chains in the Genus database with same CATH homology
 4FLW A;  4I7H A;  3GJX B;  3HXL A;  3M7M X;  1XHZ A;  2YI8 A;  5JVD A;  2ZCE A;  5EZY B;  4DR5 B;  4I50 B;  1SEI A;  3THO A;  4ZOL B;  2E3C A;  5CB4 B;  4JI5 B;  4PDB A;  1I94 H;  4X1Y A;  5IJ0 B;  1O9H A;  1SYX B;  4TQF A;  5EIB C;  2HEP A;  3QTC A;  4OX9 B;  3L2P A;  2F4V B;  1DGS A;  3KAL A;  4X66 B;  1Z5W A;  1IBL B;  1N33 B;  5GON A;  4DUZ H;  5LYJ A;  2HVS A;  5D1O B;  5LA6 B;  1WH2 A;  4MV7 A;  4LF8 B;  2ZIO A;  1M4U A;  1MZB A;  5LMN H;  3C0F B;  4YJ2 A;  4DV2 B;  4EB6 B;  4B3M H;  4HNA A;  5EZY A;  1HNW H;  1IBK B;  3JAK A;  4ZIB A;  5IWA B;  4JI8 H;  3RYC A;  4HBN A;  1S03 G;  3JAS A;  2RGV A;  5LOV A;  4F6R A;  4X65 H;  4DV0 H;  1SQG A;  4JV5 B;  2R9A A;  5D1P A;  1N34 H;  2ZM6 H;  4JI0 H;  4JI7 H;  4X1I A;  4DR6 H;  2UXC B;  3SJA C;  4LF8 H;  4BW9 A;  4DUY B;  2ZIN A;  3JSN A;  5K1X A;  4PZ8 A;  5JVD B;  4CS2 A;  1FFX B;  3UT5 B;  1M5I A;  5J2T B;  3OTO H;  2HGS A;  5LXT A;  3MAQ A;  4AQY B;  1HW7 A;  4EB6 A;  4O4I A;  2XHB A;  4DV3 B;  4FM9 A;  1XMO H;  4NXN H;  5CA0 A;  1Z2O X;  4YJ3 B;  3BAB A;  5KHH A;  1M0T A;  2UUB B;  2IM9 A;  4F6R B;  3JAR B;  5LOV B;  3FFQ A;  1CKM A;  1HNX H;  3RF2 A;  5FLX W;  4A2A A;  3OTO B;  3RYI A;  1HNX B;  2VQF H;  5DIS C;  4MV9 A;  3T1H B;  4CS3 A;  3NC0 B;  2ZM6 B;  4DR6 B;  1TVK A;  4O4J B;  2VQF B;  4CH3 A;  2RQ6 A;  4FLZ A;  1FVI A;  4ZI7 A;  2E5L H;  3H20 A;  3JAW B;  5JQG A;  1P16 A;  5J2U A;  3TY9 A;  4I4T B;  3RYH A;  4CH6 A;  4CH4 A;  4LFC B;  2VWJ A;  4DV5 H;  4RAY A;  2PYL A;  1XMO B;  2VQE B;  4LF5 B;  2UUC B;  1I7F A;  4FM2 A;  1B04 A;  3IAY A;  4LF9 B;  4O4I B;  4M7E A;  1Q8I A;  1CKN A;  4IIJ A;  4B3S H;  4OX9 H;  3RJ0 A;  4B3M B;  4UCR A;  3ETQ A;  1HNW B;  1H2S B;  1JFF A;  5ITZ B;  4X20 A;  4LFA H;  3J80 W;  2PYJ A;  4DR5 H;  3BA8 A;  3K57 A;  1VF7 A;  4RZQ A;  2VUG A;  5D1O A;  1HR0 B;  1Z5V A;  4LH6 A;  3RWR D;  3SR2 C;  4CH5 A;  1M0W A;  4JI4 H;  3KAJ A;  4PHZ A;  3N44 B;  1S5J A;  1HR0 H;  4DR2 B;  3GDE A;  3ICX A;  4HNA B;  4DR7 B;  5JH7 B;  1T5E A;  2V4D A;  4O4L A;  1J5E H;  2F95 B;  5BR8 B;  3N6X A;  2Q2T A;  2MCT A;  4NXN B;  5LL6 b;  1X9N A;  2R70 A;  4JI1 B;  2HHH B;  3UT5 A;  1FFX A;  2PUS A;  1XNR B;  4LF4 H;  2F66 C;  1L2Z A;  2ZNJ A;  4NXM H;  4BWA A;  5CA0 B;  1ZHS A;  2VQE H;  4LF5 H;  3DF7 A;  2ZNI A;  2PTM A;  5LP6 B;  2FE3 A;  3U0Z A;  1D5A A;  5FPO A;  4KHP H;  4D7S A;  1XI1 A;  4LSA A;  5LYJ B;  4RB2 C;  2ZIM A;  4RB3 C;  1SA0 A;  2XIG A;  4TV9 A;  4DR1 B;  4GLX A;  2PY5 A;  4DUY H;  3JAT B;  3TY8 A;  4FLV A;  5KHJ A;  2WE6 A;  3KYH C;  4A2B A;  3VQV A;  3N42 B;  4DUZ B;  4DR3 H;  2UXD B;  4X62 B;  3HKD A;  2Q7G A;  4JI3 B;  2P22 C;  5KHI A;  4O2A A;  4DV2 H;  4NXM B;  5KX5 A;  4K0K H;  4TV8 A;  3BHP A;  2HIV A;  4EEQ A;  4DK0 A;  5CA1 B;  1TUB A;  4FLT A;  5D5Q A;  4EQ5 A;  4DR7 H;  4UCT A;  5J2T A;  4RAZ A;  1Q5O A;  4IHJ B;  3N2G A;  1IBL H;  3SJC C;  3JAR A;  3ZED A;  4X64 H;  2JGU A;  4APM A;  3JAL B;  3BRC A;  4X1I B;  3K58 A;  3B2E E;  2E5L B;  1GYF A;  1X4T A;  2YIB D;  3WB0 A;  4X65 B;  4O2B B;  5EYP A;  4GKK B;  4O2A B;  3GB8 B;  4LFB H;  3BA9 A;  2ZJT A;  3QWU A;  3ZS8 C;  5IWA H;  3N41 B;  3RYI B;  5IJ0 A;  5BMV B;  4B3T H;  1Z2N X;  3OTF A;  4O4L B;  1XK5 A;  2UUC H;  4GKJ H;  1P49 A;  3UQ8 A;  1Z2P X;  1IBM H;  3VQX A;  5IJ9 B;  4LFC H;  3JAL A;  1WNS A;  3RGZ A;  4K8X A;  1N36 H;  1I6U A;  4JI2 B;  1TAE A;  3KAK A;  4EFE A;  4B3R H;  2Q2U A;  4IAJ A;  3DSQ A;  2F93 B;  5JCO C;  2YIB A;  5JJJ B;  5KMG B;  4GKJ B;  4DRX A;  5BMV A;  4JI6 H;  1NT2 B;  1XHX A;  3BAA A;  5IYZ A;  2KKW A;  1XQ8 A;  4AQY H;  4IIJ B;  3HKD B;  3M4I A;  3JAS B;  4DR3 B;  5FPR A;  3VQY A;  4GYC B;  4JYA H;  4CC6 A;  2P5O A;  3J7A K;  1E4F T;  4LF6 H;  4I50 A;  5IT9 W;  4X1K A;  1BJT A;  5KHG A;  4DV7 B;  1ZHQ A;  2UUA B;  1N32 B;  1WN7 A;  4ZI7 B;  3F8N A;  3W1B A;  3S24 A;  2VPS A;  2BTQ B;  3IG0 A;  2CFM A;  3HKE A;  4EFB A;  4TV8 B;  2UXB B;  5KX5 B;  3N43 B;  1Q43 A;  2JVD A;  4DV0 B;  4JI5 H;  4U3J B;  4TQD A;  3RR5 A;  4B3T B;  1XNQ H;  3RIZ A;  4FLX A;  1XMQ H;  4TUY A;  2F4V H;  1FJG H;  2R72 A;  4JI8 B;  2WDT A;  4B3S B;  4LSX A;  4WBN A;  2YCH A;  1SKV A;  2CAZ C;  3CSX A;  4LH7 A;  4LFB B;  4CC5 A;  3JAK B;  3U11 A;  1P8L A;  3L4K A;  4FLY A;  4K0K B;  4X64 B;  2UXB H;  1KU9 A;  3NBY B;  4DR4 B;  4X20 B;  5A2Q W;  1CKO A;  4X62 H;  4X66 H;  2Q7H A;  4TUY B;  4Q6G A;  1XNQ B;  4D7T A;  1XMQ B;  3TY5 A;  3RYF B;  4DV7 H;  4BWS C;  2OYQ A;  4GKK H;  3RFR A;  4YY3 B;  5JJN B;  4JI6 B;  1CKN B;  3KXY T;  4UCV A;  2PZS A;  3JAT A;  2PGG A;  1WPB A;  3N2K A;  1N33 H;  2VWK A;  2BTQ A;  3J81 W;  1SQF A;  3U10 A;  5C8Y A;  2UUA H;  1N32 H;  4FM1 A;  2QJ1 A;  2HIX A;  1KMI Z;  4LNU B;  5LP6 C;  3SGI A;  3QF7 A;  1TA8 A;  4U3J A;  5ITZ A;  5LMU B;  1E4G T;  4MTD A;  4I55 B;  3T1H H;  2Q0A A;  4YJ2 B;  3A2F A;  1G6U A;  3JAM W;  4DV1 H;  4UCU A;  5FNV B;  2UUB H;  4UCS A;  4WBN B;  1BGW A;  4DV6 B;  4PZ7 A;  1RSO A;  5IYZ B;  3NBZ B;  3N2G B;  3N2K B;  3QG5 A;  2YXL A;  4O2B A;  4DRX B;  4DV6 H;  1IBK H;  2HVQ A;  2QM4 A;  4I4T A;  2JS5 A;  4UFZ A;  5J2U B;  3RYH B;  4PI0 A;  4B3R B;  4LMY A;  5EIB D;  4LNU A;  4RB0 A;  4JI7 B;  4JI0 B;  4DR2 H;  4FFB B;  1XDN A;  2RJZ A;  4LF4 B;  3HKC A;  3RYC B;  1QQC A;  4O4H B;  2CW8 A;  5FD5 A;  4AIL C;  4DR1 H;  5LMU H;  1HNZ B;  3WB2 A;  5LP6 A;  3E22 A;  4I9Q A;  1N34 B;  4JV5 H;  4DRF A;  4DV3 H;  5BR8 H;  2RGR A;  1SA0 B;  5FD6 A;  2O03 A;  2BTO A;  4LF7 H;  3CHX A;  2KSW A;  4AHC A;  4NVP A;  4DV5 B;  4JI1 H;  4O4H A;  5LXT B;  3L4J A;  5CA1 A;  5FNV A;  4DR4 H;  2YIA A;  4LF7 B;  3WB1 A;  1YEW A;  4O4J A;  4YJ3 A;  4X1Y B;  1L8D A;  2EX3 A;  3E22 B;  5JCO A;  5K1P A;  4PZ6 A;  5JH7 A;  1JFF B;  4TOI A;  2WYO A;  1M93 A;  3W1G A;  4JI3 H;  4J0M A;  5GON B;  1IBM B;  4K8Z A;  5JJE B;  3K5O A;  1I94 B;  1FJG B;  4DV4 H;  4B08 A;  1A0I A;  3MWM A;  3EYY A;  1J5E B;  1TVK B;  3HKC B;  1O75 A;  4YY3 H;  4RB1 A;  4FLU A;  2GV9 A;  3BPZ A;  4JI4 B;  2YI9 A;  1Q3E A;  5C8Y B;  3CVZ A;  4IHJ A;  3VQW A;  2UU9 H;  3SJB C;  1XNR H;  3K59 A;  3LML A;  2UXD H;  1JMK C;  5IJ9 A;  5EYP B;  3JAW A;  1ZAU A;  4YHH H;  1FKA H;  1TGO A;  4ETS A;  1HNZ H;  4TV9 B;  1JJO A;  4R7R A;  4YHH B;  2CW7 A;  4JYA B;  2F1M A;  3W5O A;  2VOB A;  3CB2 A;  4I55 A;  3VNN A;  4LR3 A;  4L8J A;  3RGB A;  4X1K B;  4JI2 H;  4KHP B;  3T1Y H;  3K5M A;  2W57 A;  3K5L A;  3PN1 A;  5D5P A;  4LF9 H;  4LF6 B;  3N40 P;  4Q0Y A;  3RTX A;  4E6N A;  4KL1 A;  1S68 A;  5KHK A;  2HVR A;  3RGX A;  4FVM A;  4UCO A;  5EOY A;  4ZHQ A;  4CS4 A;  4LFA B;  3LNN A;  3HKB A;  2Q7E A;  4FFB A;  4MTE A;  3FMA A;  1QHT A;  1VS0 A;  3RYF A;  2UU9 B;  5KMG A;  4FM0 A;  2HHH H;  1TUB B;  5JQG B;  1O9G A;  5LMN B;  4DV1 B;  4DK1 A;  4ZOL A;  5CB4 A;  2UXC H;  3JSL A;  4PI2 A;  4ZHQ B;  3K5N A;  1V9P A;  3K3V A;  1N36 B;  5LA6 A;  2OWO A;  3HKB B;  4DV4 B;  3HKE B;  1AN7 A;  3T1Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...