1TA8A

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase, NAD-dependent
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 100
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ta8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1ta8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1ta8A02
5FPRA 3L2PA 3VNNA 4PZ8A 4NXMB 1N36B 4CC5A 5LMNB 1N32B 4DUYB 4DR3B 4B3RB 3GJXB 1FJGB 5D1OA 4OX9B 4DV2B 4LF5B 1FVIA 2HIVA 4X65B 5IWAB 4UCSA 4GLXA 1A0IA 4UCOA 2UUCB 4UFZA 4LF4B 1CKOA 1HNXB 4DV4B 4EFEA 4LFCB 4DV1B 4K0KB 3NBZB 4DR7B 3NC0B 4GKJB 1P8LA 3BAAA 4X64B 4DR5B 1CKNA 4DR2B 2HVQA 4JI5B 1I94B 2ZM6B 3NBYB 4B3MB 1HNWB 2F4VB 4CC6A 5BR8B 4YHHB 1P16A 4EEQA 4JV5B 1HNZB 4GKKB 4JI0B 4DR6B 2Q2UA 3GB8B 3JSNA 4X66B 5DISC 5LMUB 1J5EB 2UXBB 4PZ6A 2UXDB 3S24A 4DR4B 5D1OB 3KYHC 1XDNA 1VS0A 1DGSA 4DV7B 4DV3B 1XK5A 4X62B 3W5OA 4LF9B 1TA8A 4EFBA 1HR0B 3T1HB 1B04A 4B3TB 4KHPB 4UCRA 1N33B 2HIXA 2Q2TA 2UUAB 4LF7B 3TY8A 4NXNB 3RR5A 4JI4B 2OWOA 3RTXA 2UU9B 2VQFB 4JI2B 1CKMA 1CKNB 3BA8A 4DR1B 4JI7B 2E5LB 4LH7A 1XNQB 4PZ7A 1XMOB 4DV6B 4DUZB 3BABA 3BA9A 4LH6A 1IBMB 1X9NA 4LFBB 1S68A 3W1BA 5D1PA 4TOIA 4LFAB 4LF6B 3SGIA 4EQ5A 2HVRA 1XMQB 2HHHB 4JI8B 4LF8B 4JYAB 2HVSA 2UUBB 3JSLA 3T1YB 3UQ8A 4JI3B 4JI6B 1N34B 4DV0B 4UCTA 4DRFA 1TAEA 3TY9A 2UXCB 4UCUA 4DV5B 4E6NA 2VQEB 1V9PA 3PN1A 4AQYB 1IBLB 4UCVA 3GDEA 2VUGA 3TY5A 4JI1B 2CFMA 1IBKB 1ZAUA 3QWUA 4B3SB 1XNRB 4YY3B 3W1GA 3OTOB 5FPOA
chains in the Genus database with same CATH superfamily
2DQ3A 2WLIA 2JS5A 4PZ8A 4QW8A 2J6UA 2R7MA 5JH7F 3K3VA 4CC5A 3G8DA 4ED2A 4CE5A 4O4LF 1OCCC 4E4EA 3WO0A 5C4XG 4ED1A 4PDRA 3SR2C 1KP3A 1AROP 1NT2B 1BSMA 4MTFA 3RYCA 2UUCB 1WCMA 2EBOA 4B3SO 3JD2A 5JVDF 3OTFA 4NXMH 3T9EA 2AGQA 4C5CA 1R3KC 4LFCB 4DV1B 3LSSA 2W6JG 3FKSG 4IZOA 2LGWA 5KG2A 4DR3H 3OM3B 2AW9A 2P6JA 2X5RA 2DOSA 5BR8O 1V4YA 2F93B 2GV9A 1RFYA 4BIUA 1R73A 3QF7A 1JX9A 4DL2A 1NJIW 5CA1A 1HNWB 4K0KH 4X1IB 4J7JA 4LC1A 4CBCA 4PI0A 1K1SA 3BJYA 5KG1A 3K5LA 2WTFA 3QO8A 1BXRA 3CHXA 2JEUA 3K5IA 2Q2UA 3OAAG 2AXTZ 1OZ0A 2WYOA 2YZNA 4DR2H 1SQBH 4DL7A 2XAQA 4NZMA 4UUGA 2ODTX 1A0GA 4FIPC 1NTZH 1Y4MA 1TWAA 1VBHA 5BWXA 2PYJA 1HNZH 5LGTA 3PR4A 3PW7A 2CNVA 2Q8VA 3PR5B 1F23A 4JAUA 3M9MB 5KFGA 5B1AB 3D8CA 4HBNA 1IXBA 2YXHA 5BMVF 2MW2B 4P9OA 1DV1A 1LR1A 2IJIA 4QWCA 3RTXA 4NVPA 5B66Z 2UVRA 3AG7A 4LF9H 5H6RA 2JVDA 1VKZA 5IP9G 1ZL8B 2EIKB 5IYDG 5IT9W 2Y4TA 3J7AK 4FFNA 3ETGA 3HKBA 2HHHO 4FBTA 3M4IA 3SYQA 1K8AW 2Y0SA 2UUBO 4ZKIA 5D1PA 2Q7DA 3JAWA 1QQCA 1M57C 5JH7B 1Q86W 3JCZA 3H4DA 5DGAA 4JTDB 2CE4A 3W7TA 3T9CA 1GM8A 4FM2A 1KJQA 3MWDA 4DL3A 4ECSA 4RUFA 3VQWA 1SQXH 2R7KA 2KKWA 1WSCA 5KT7A 4AQYO 3KTMA 2YI9A 2LGQA 1LUVA 4ZOLB 1EKPA 4DRFA 3JATB 2AZ2A 4DV5B 4E6NA 3TEKA 3T54A 1Q90D 2R9RB 3WB0A 3T1HH 4TWKA 5KG3A 3HKDB 4JI1B 4JZ2A 4JXUA 5FLXN 1M0WA 1Y1VA 4PHZA 2J6SA 3SPCA 4K8XA 4B3RO 4A3BG 2R70A 3JARB 1MNGA 2G38A 1I1KA 1WB8A 4C5BA 3CRMA 3LWBA 2KG7A 4XYLB 2E3CA 5IY5B 4WCEV 3RV3A 4JASA 2YI8A 4NZNA 4DV4O 2DYSB 1EFRG 3VOTA 2C2EA 4YY3H 2M7WA 5LGUA 3SI8A 3SDLA 2CQYA 2PGGA 5BYBA 4O4HB 5DLGA 1MG1A 1IDSA 5E25A 5I5YA 5KFUA 4O4LA 3OTOO 1AJQA 3PW0A 3HOYG 1M90W 5BMVB 3HKEA 2ZM6O 4X64B 3QQMA 1D5NA 5JVDA 2DABA 4TV8F 3CC4V 4GKKO 1N32O 3MFHA 2HVQA 5CR5A 5CN0A 3L75H 1N48A 4X66O 2OCHA 3PW4A 2LP7A 3HKDA 2Q73A 4OPHA 4PA6A 5H9CA 4EGJA 3AG1C 1KECA 4UUJC 5BPHA 1VQ8V 1V55C 3N6XA 4QIWF 1B06A 3R66A 2ZNJA 2ZGIA 3CSXA 4F6RB 4DV7B 5L9XA 2Y0IA 3HPLC 4TUYA 2H94A 4NXNO 2FE3A 3VQYA 4MV8A 3AG4C 2Y69B 2BOBC 1SESA 2UUAB 4LF7B 3TIGA 4GX0A 4F4XA 2OT5A 4BWAA 3IG0A 2ASLA 4A3GG 2Q68A 3RB6A 5BMVA 4BY1G 4I50F 4CKCA 2FK1A 2VRZA 4J41A 2CTPA 3CEIA 2A06H 3RB4A 1B3QA 3BA9A 5LL6b 4YAJB 4UV9A 2VA3A 2XCAA 4DYLA 1YF2A 3EPIA 1S97A 1H2NA 3ZHTA 1UC8A 2I87A 3X2QB 1LNQA 4J9MA 3CXHF 1Y76A 4TV9B 1M6VA 4X1YB 1OCZC 4QPKA 3RUPA 5HBRB 1JIHA 5FNVB 3N43B 5DG8A 1Y1WA 4DAAA 2GPWA 1FAFA 4JI8H 4JV2A 2EJ0A 2VUMA 3ABLC 3K3PA 5LHHA 3Q1KA 4H0LB 5CBHA 3MR3A 2Q9LA 1GN3A 1PM9A 1Q5OA 4JZGA 4HYKA 4FJCC 3E35A 4CH3A 2XHBA 5BWWA 1QLEB 3S3WA 4DUYO 1EUCB 4Z1MG 2R7ZG 4AYBA 2FLNA 5KFAA 1VQMV 4LF5O 4NXMB 4EBDA 2FMLA 3ZMTA 1ET0A 4DR3B 5KHHA 4NTXA 4O7VA 2ZJTA 5KFZA 3SJBC 4W4KA 2W71A 1ZTEA 2R93G 3ASOB 1ZSPA 4K0KB 3BEHA 1OCRC 1BS3A 2WPDG 5EIBD 1I94O 4A5UB 1AB3A 1I7LA 3H3VH 1K33A 4X9QA 1EZJA 4X65H 1U96A 2H3OA 2ZINA 1VQ4V 2GLTA 3TCUA 2YXLA 4DR2B 2ZXWC 4ZHQA 1M56B 4RNNA 4OXSA 5IYZF 4CH6A 4FLVA 1VQ6V 3VPDA 4J9LA 5EK0A 3N2GB 1OJHA 1HNZB 1P7BA 2QKAA 4TV8A 2RF4A 4U3JB 2WB1A 1WNSA 3ZIAG 4HR7A 3ZHRA 5B1OA 4X62O 2L35A 1Z5VA 4O82A 4EYIB 3GWOA 5J2UB 3AYHB 5KFNA 4FFRA 4ED6A 4OGQB 4O86A 1D5AA 2W9CB 4LF9B 1TA8A 1XEQA 4NR1A 4QIWA 4JI2O 2WAQA 2Q69A 5KG5A 2UXBH 5EYPB 4PJ0Z 1M0TA 1N8RW 1BQZA 2WDTA 4M0JA 2R92A 1XBLA 4O7WA 1WN7A 4DV3H 4O2BF 4KL1A 1I50A 3OR7C 1HR0H 1VF6A 5CB4F 3ZHQA 4LFAO 4QWEA 1NZ6A 2W6MA 2FK2A 4MV3A 1RSOB 3JASB 4JUZA 1AVMA 4I50A 3N2GA 3CJHA 3CCSV 5C93A 1N34O 2WLNA 1FFTB 1VF6C 1KEEA 1HP8A 2UXCO 1GSHA 3K79A 1KUQA 5BWVA 3PW2A 3U10A 2VQEO 4DR4H 1VQLV 3STLC 3OMIB 4JI6B 3FB8C 1G4YB 1QLNA 2YS7A 1CPYA 5DMXA 2CTWA 5J2TB 1T94A 1FKAO 5EYPA 2R82A 1ZETA 3KAJA 3MAQA 5LYJA 3MWEA 3UFXB 4YQWA 3QWUA 3CS5A 4I55B 2FYUH 4YY3B 5JQWA 4MW8A 4JI7H 2YIBD 1JQ0A 3SYCA 4CH4A 1US6A 2XAGA 4JTCB 3IAYA 1R3IC 4J9PA 4I5SA 3J81W 5A9GA 4AILC 1HNXO 1P49A 3NXSA 5I5WA 1IXMA 2FLPA 2JA5G 3BG5A 3FFQA 4IL6Z 2BQ3A 2CH7A 4P9PA 5BXZA 1HWYA 2HGXA 3H40A 3E5NA 1GKFA 2DYRB 5L3CA 1SQVH 5E1AC 4FM0A 3TK1A 3H20A 5DQIA 4RNOA 1PNMA 4ETSA 5KFOA 1F4MA 3JCUZ 4LMYA 1RP3B 4A3CG 4MV6A 4JI0O 2RMKB 4OX9O 4O2BB 3IGAC 5IWAO 2BTQB 2UXDO 4DR5H 3N6RA 1W93A 3JZ6A 5EBLC 5IYZA 1VQ7V 4IHJF 1H2GA 2ABJA 1AI5A 2P5OA 4QJFA 2C2RA 4IRDA 2J9GA 3AG2C 5IJ0B 3I5DA 4MVQA 2JGDB 1XHZA 3DTGA 4JV5H 3OSNA 4HNTA 1UPGA 4RUEA 3RBDA 3U54A 4RUAA 1XK5A 1ORQC 2IJKA 4RB2C 2EINC 1SFOA 4XX0B 3FYIB 4HZ3A 3FDSA 2Q7EA 1XMOO 4LFCH 4BW9A 4DV1H 3T5KA 3JALB 3HKCB 4QWDA 1KKCA 5DQGA 4R6ZA 1CQIB 4ZI7B 1IOWA 4NZOA 3D3QA 5EZYA 3ORQA 2V1DA 1QU7A 4C5AA 5FLXW 3RYFA 2XT9A 1GN2A 2OTJV 2CGOA 1IBMB 1HNWH 4IWYA 1N0NA 1TUBA 3GWKC 3B77A 3T9DA 1KBLA 4BIOA 3DTFA 5C8YA 5KUKA 1U97A 5CB4A 5IP7G 2IA6A 2ETNA 2ZCEA 2GPSA 4RQEA 2HVRA 1XMQB 1Z2NX 1Y66A 4JI8B 2IJJA 2PUSA 4J9QA 4G2KA 1Z2OX 3ZN0A 4QIWE 4JGSA 2RCVA 2WAQE 3AEIA 2WSSG 4X88A 3UQ8A 2R86A 2YS8A 4LFBH 2Q67A 3E8FA 4BY7G 2GUZB 4RU9A 3CSWA 4I0XA 5LBQA 4JYAH 1V9PA 4FVMA 3GVMA 4E4TA 4DL5A 1JPXA 3T4DA 2VUGA 4MV9A 3M9NB 3H1JH 1GTOA 4QE7A 1WA8A 4GCZA 1YDXA 1TWCA 3TJTA 5LMNO 1XUQA 2R7LA 3MR5A 3RGZA 3PJSK 4UV8A 1JJ2U 1MZBA 3SYOA 4HNAB 2FB9A 4DV2O 4O3OA 3T2MA 5KHGA 2YWVA 4JV0A 2Z02A 1I7FA 1KKDA 3H0GG 3GTGA 5KKNB 3K5HA 1EBOA 2BR0A 5J9PC 4FFMA 3ABUA 3H1IH 5L3GA 4X65B 4DR7O 1S10A 2K9PA 1ZHQA 3UT5B 4FLZA 5DECA 2QB5A 4QGPA 1KP2A 1F7YA 5KFTA 5CBFA 4JPRA 5HFMA 3E83A 3NC0B 4I9WA 1W0KG 3AW8A 4YHHO 1WLEA 1BCCH 2F95B 3Q2OA 3GTMA 4ASUG 1GN6A 3RV4A 3ZRWB 4O7YA 2VA2A 3JYCA 4U7CA 5I5VA 3UZOA 4Z1VA 1S72V 5LMUO 1F4NA 4O3QA 3N2KA 3OEEG 4EB6A 3T5JA 3ZRVA 2HGSA 2YRWA 3HBLA 4DR6B 2F23A 4O7LA 4IR1A 4ED0A 5K1XA 2UXBB 5BYAA 5EC2C 2FL4A 2YZMA 3GLKA 3A0HZ 1SEIA 5CE8A 3JD1A 4DV3B 4R8CA 4XDKA 4O4IF 5CA0A 3CCQV 2NN4A 4IHJA 3ABMB 1Q6IA 3FX7A 2VQFO 2UU9O 5D8DA 4ECVA 1HR0B 1GAXA 4O84A 4O3NA 5KFMA 2W7OA 1NH2D 2Q2TA 3ZCCA 1XNQO 3QZ8A 3V6KA 1TWHA 5CM0A 5DGBA 3K5NA 4R8UB 1SA0B 1R6KA 3K9SA 1COWG 1MSDA 1VBGA 1N56A 1H2SB 5JQGB 1N33H 4LF6O 1SCUB 4K8ZA 3CX5F 1V54B 2ZDGA 3VPCA 3SJCC 3BQ2A 1X9NA 4O7ZA 1D2DA 1KB9F 2YXYA 2GQRA 2OLSA 1DK1A 1PK8A 1JOYA 2W6ZA 3C0FB 4O3RA 4DV0O 2COIA 3E2EA 2HVSA 4MTDA 5KFDA 3HOUG 3DF7A 4DV6H 4AI8A 3R9RA 4Q8EA 5KA5A 3SNOA 3T1YB 4JI3B 1IBLO 2UVWA 4ED3A 4CH5A 4QWBA 2LW1A 3RWRD 2HGWA 1NTMH 1R6TA 3C3SA 2UUAH 3T1CA 2UXNA 1R3JC 4B3SB 1I2KA 2HFEC 3F7VC 1PL0A 2DIKA 4J9NA 1PV0A 5F2VO 2QF7A 5KA6A 1GGOA 3JAKA 1FXVA 5F9NA 1Z5WA 5KHIA 5DEDA 4J9SA 1K3EA 3OE7G 3DTUB 1G1XB 2UVUA 2R7NA 2JA8G 3PFFA 1K97A 4UCSA 1K5SA 2CNQA 4MSWC 4X20A 4A2AA 2KSDA 2HJFC 5LP6B 4MTXA 1G8MA 2HHFA 1L0NH 4JI5O 2D2CB 3P30A 5H2FZ 3T9FA 2F4VO 3HXLA 4MS2A 4DR5B 3IN5A 1RYRA 3R5FA 3I4MG 4FFBB 1CKNA 4J9KA 3WG7B 2VWJA 1KC7A 3CD6V 1SRYA 2M05A 5LXTF 1P4RA 3B8NA 4EKWA 1KD1W 1VAJA 4AHCA 1Y14B 5ITZA 3APQA 4JV5B 3CMEV 1QVFU 5GONF 4DR4O 3ZHVA 1K7DA 3I12A 4LBEC 3JSNA 3WNZA 4DW0A 1XILA 2OCCC 4PDVA 3IFXA 4J9YB 1B6SA 2JDIG 4WHXA 4ZOLF 4DIMA 5I47A 4PDBA 4HN2A 2V7QG 5KMGB 4NKGB 2EIJB 1XDCA 2ASDA 3ORRA 4B3MO 1FFXA 1NH2B 1WRVA 3ABTA 3KXYT 2HIXA 2HEPA 4ECZA 1RJRA 2Q7GA 4F4WA 3D3IA 4O4IA 1FXKA 1ZWIC 1IZ3A 4ECXA 1EM1A 3FMAA 3MWMA 1TVKB 2RDIA 5FL7G 4O7RA 4CMFA 3TW7A 1EKFA 1A3GA 2EIMC 4ZQIA 4JI4H 4M7EA 2CTQA 2IU3A 2A9HA 4LFBB 3T4ZA 3ZS8C 1VF5B 3EXAA 1FXKC 5B1NA 4O4HF 1JDEA 2E5LH 2F43G 4EQ5A 1GLVA 4FS1A 1KJJA 4JYAB 3KHHA 1XQ8A 1XOUA 1Z2GA 3JAMN 2Q5ZA 3KZIZ 3T99A 4FMTA 1RK5A 3ZEDA 3HB9A 3TY9A 4H13B 1MABG 2EJ7A 2XIGA 2JEIA 1AI7A 2DPJA 1XNRO 1CS0A 2DWCA 2XCLA 4X1KB 4ED8A 1YHQV 2JA7G 4MA5A 3RIZA 2A0LA 4X1IA 4MV4A 5IYCO 5LXTB 3H1KH 2QYZA 3OTOB 2ATLA 2P06A 1TVKA 4Q4CA 4LP8A 5GONB 4O2AB 4RCNA 1B6QA 1IBKH 3FD9A 2UUCO 2PF4E 2BQRA 4PELA 1N32B 1FYJA 2UXXA 1EN6A 3SJQC 4XZ3B 2ALZA 2HIVA 4GKJH 2HP8A 1Y74B 3Q8QB 4LF4B 1MOFA 2X6CA 4U6PA 2R8JA 3VA7A 2YZGA 5IYBG 4F4LA 1OCOB 4JI6H 2W57A 3DC6A 1YI2V 3G71V 3ZMZA 3LSUA 3J80N 1FJGO 1ZL8A 4F6EA 4EBEA 5HNEA 3ZN1A 5B1AC 4J80A 4X1KA 3VQVA 3WWJA 3QVNA 2RDCA 3M8AA 3H01A 1M1KW 5C1PA 1Q81W 3HOVG 3WU2Z 5B3SB 1L1FA 3ETEA 4TV9F 3ICXA 5LXTA 5JH7A 3GTJA 1M93A 5FNVF 2EIKC 2M6YA 3R23A 5KFJA 3L72H 1AI6A 1DGSA 3EYYA 5CMUA 4GC7A 2WWWA 4R7CA 3RAXA 3U0GA 3L70H 2LJ2A 1MMMA 2I80A 3T5LA 4ZOLA 2ASJA 1SQGA 1N33B 3TIIA 3JATA 1DAAA 1PX2A 5A2QW 5C1OA 1EZ1A 2LW7A 3TQTA 1EZVH 3TXQA 2WLMA 3BA8A 4OPAA 1IOVA 5I5UA 4J42A 4LH7A 1DV2A 4FE2A 4TVIA 5I5TA 1YIJV 3FB6C 4IT5A 4DV6B 3OSPA 1Y67A 3JARA 2R85A 2DWEC 4GX2A 3OFNG 3KCXA 4A3LG 2YW2A 4I4TF 4DR1H 2EZPA 2IM9A 4B7EA 4DRXB 4QE9A 2B63G 3GTKA 2QTSA 3RGBA 4DUZH 4DV5O 4YJ2B 2QKCA 2YICA 5GW7A 4O4HA 1V51A 1KUTA 3KREA 3N44B 4JI1O 1SERA 5KHKA 5IY5C 5D5PA 2RDJA 2DYSC 2JA6A 3C3TA 2FLLA 1EYZA 2CUGA 4BWSC 2B1GA 2OYQA 3A0RA 2IW5A 2DPIA 1SQFA 4PV1B 5LOVB 2Z3YA 2QWOB 3E8BA 3TXSA 5J2UF 4NYEA 5FPOA 4FU0A 3L2PA 1T5EA 1E79G 3MHHC 2ADPA 3B8MA 4JAAA 2CNUA 2VPQA 5KS8A 1AJPA 5FD5A 1NR7A 4L8JA 5DN6G 1IBMH 3GTPA 1K92A 2ODMA 1BL8A 2EZOA 4WD3A 4F6RA 5KG7A 3KCYA 4GYCB 5KX5B 5JJNB 2F66C 3RFRA 4FLXA 1XMQH 2YL2A 3G6YA 4UFZA 4X64O 2EJ2A 1E4GT 1YCIA 1MA1A 2ZDIA 2N74A 2ZE5A 3QO5A 2ZD9A 4RO2A 4MV1A 4FK5C 1WJZA 5KFIA 1WPXA 2GTAA 5E79Z 3LNNA 5K1PA 3U9TA 3NBYB 2ZIMA 1URFA 1H8EG 2Y69C 3B09A 5H80A 3ETDA 2ZDIC 4NYKA 5B5EZ 3STZC 2R84A 4RB0A 4LWSB 3U55A 3V4SA 4DV7O 3VOUA 3DC5A 1YJ9V 1J5EB 4I4TB 4RWUA 1K34A 2FKXA 3IJ4A 4FPPA 1RM1B 2KSWA 2UUAO 4LF7O 4TV9A 5J2TF 4X1YA 1VIBA 2V58A 5KLVH 2BE3A 5FNVA 4PA4A 3SYAA 4ZIBA 2ZDQA 2GDSA 4I55F 4JI4B 3CCLV 3M7MX 1CKMA 2NNUA 3VQXA 3X2QC 2E5LB 1AN7A 5I60A 2PMZE 4KHPH 3WWIA 2AZ0A 5C5JA 1PP9H 1M7JA 5KFLA 4J11A 4WFGA 3K57A 2HJWA 1S0NA 2W7PA 4DR6H 3OMAB 3O9OA 4FLYA 5JWPA 4PDMA 3SYPA 3KAKA 2UVVA 1M4UA 2ILMA 1P7GA 2EILB 2WLHA 1AR5A 1QLEC 1S0VA 2E75B 4IAJA 2W9BB 4UCTA 3FAVB 4IRKA 2XAJA 4FM1A 1YITV 4RB1A 3OT7A 1K1QA 3TY5A 3RGXA 4ECRA 1H8HG 3TETA 2NU7B 1IBKB 3R65A 3L9DA 2P0AA 4NXMO 4FLUA 1S5JA 2ITCC 3ASOC 4I7ZB 2YEVB 2RGRA 3E22B 1ZHSA 4DR3O 3W1BA 2ZT9B 2ZR2A 4GKJB 2YZLA 5FPRA 4C7UA 4U3JA 3JZIA 3FKIG 4WFFA 5KFCA 1M56C 2H8PC 2EJRA 3ZBHA 5J2UA 4OX9B 4K0KO 1GH6A 1THZA 3ZMSA 4IIJB 5IWAB 1A0IA 1OV9A 2W9CA 1N36H 2Z04A 4ZI7F 2NU8B 1DF4A 4DR2O 3T1YH 2HLDG 4NTWA 3SPIA 4JI3H 3RYHB 3W7SA 1P8LA 4A93G 5DAAA 2HVKC 2V4QA 4APMA 2LQTA 1HNZO 3LDDA 2Z0AA 2XC9A 2DWDC 3OW2U 3J7AU 4CC6A 1P16A 3DXRB 4H33A 1L2ZA 4B3SH 2B1IA 2DZDA 1RSOA 3JASA 5KFYA 3LUTB 3SPHA 2DN9A 3HOWG 4KP4A 4LF9O 3CRRA 3S24A 2YCHA 1WPBA 1CE8A 1IVSA 3W5OA 3QG5A 1ULZA 4CKEA 4B3TB 2JEFA 1A48A 4CS2A 4WBNF 4TQFA 2VOBA 3OHAA 4QNHB 4N21A 1P84F 4IYIA 1I2LA 3WB2A 5J2TA 5DG9A 1N4CA 1VP7A 2ADQB 4DR1B 1KJIA 2AGOA 4FZ1A 3NGDA 3M99B 4U7NA 5BZBA 2QE7G 4I55A 4QWAA 4WFBV 3G8CA 4DUZB 5IT9N 2R8IA 3KHGA 2B9ZA 2AGAA 3T1HO 2YIAA 1S68A 3E8HA 1A9XA 1YVWA 4IGGA 1NS1A 3ZHSA 4IR9A 3MR2A 3UKMA 1QR8A 2QA4V 5KT2A 2FPGB 4BR6A 3QNEA 4O7TA 1WCMG 5KFXA 1Q6UA 2HVJC 3V6JA 3RBZA 4O4JF 5KFSA 4Q6GA 3CCEV 1JR9A 2FJZA 5KT3A 2HHHH 1VEWA 4L1KA 2Z5UA 1DF5A 1SQQH 4YY3O 2UUBH 5KFVA 4WFEA 1CEZA 5EOYA 4BBRG 4ED7A 1JFFB 1I1MA 4EEYA 2I8CA 4O2BA 4RZQA 2A79B 2HKOA 1RPRA 2HDKA 2BTQA 2DYRC 1B6RA 1S5HC 4MTGA 1A32A 2X7RB 4AQYH 4K35A 2ITDC 5B1BB 2YRXA 3PVXA 1W0JG 3GV8B 2KB1A 4DQNA 4LNUB 5IJ0A 3GJXB 2JGDA 1VQ5V 5L3FA 4GLXA 2PZSA 2Q4PA 1TWFA 2IJHA 4YIOA 3UYYA 1Q8IA 3I55V 1SQPH 4B3RH 1JVMA 2VQDA 2W8KA 4WF9V 5JQGF 2PN1A 4WBNB 3JALA 3HKCA 1KTAA 4PA3A 4O3PA 1JLLB 3HB3B 4EGQA 4TQDA 5FR9A 4ZI7A 3TGUH 1TWGA 4DV4H 2Q7HA 5CBGA 3N41B 4D6TH 4ECUA 1SKVA 1Q82W 1TUEB 3U0ZA 3I4NG 2EX3A 4TSFG 4K6NA 4G28B 2W0FC 2R7ZA 2V9WA 3OTOH 2GHYA 4H37A 1QHTA 1NQTA 4TT3G 3CCMV 3VPBA 2ZM6H 3ETHA 5D1OB 4JV1A 3RYIB 3ASNB 1N32H 2DJVA 2MCTA 4GX1A 4ICGA 2QGNA 1KBHA 2A1HA 5EBMC 2FK3A 4X66H 4RZRA 1WB7A 4KHPB 2GUZA 2R93A 4UCRA 4PD4F 4O4JB 4LF4H 1VARA 4BAYA 5DGIA 3CRQA 4YR2A 2JGUA 5BY1A 1KT8A 1E4EB 1Y1VG 1FS0G 4YIPA 1IBMO 1OHHG 4YAKB 3N8DA 3N40P 1R9TA 2YIBA 2WA4A 3HKZE 4J10A 2E2HA 3APOA 4NXNH 2AQ4A 1XMQO 1BJTA 4JI8O 2IH1C 3N27A 4HNAA 4DK0A 2JEJA 5LA6B 2CTRA 1NVPD 5LP6F 1RJPA 3U11A 4LF8B 4DK1A 4FFOA 3H4BA 2W70A 1T36A 3K03A 3UT5A 1TGOA 2OIGA 4RNMA 2R8GA 2JEGA 1QCEA 1F51A 4WFAV 4KXRA 2GSMB 4ZBMA 2EJ3A 3CE2A 3JZFA 3LDCA 3PN1A 3GDEA 4X8AA 3JRWA 5CA1F 4HYOA 3ZRWA 2PI4A 1OBGA 1X59A 4JYCA 1FXHA 2CGNA 1VQPV 3N42B 3CB2A 4F4ZA 2N05A 4P2ZA 2C22A 1W96A 2V4RA 1AI4A 2X0LA 4X65O 1J95A 1N36B 1BHAA 1K73W 2XD4A 2JJ2G 2ZDHA 4GUNA 2QM4A 5L1LA 5KT4A 2W6PA 4UCOA 5KAFZ 4YR0A 5C44G 3P32A 1EUDB 1S0OA 2WLKA 5L1JA 1DTOA 2OH2A 2QWNB 3GQCA 3LDEA 3K5OA 4G27B 2D3OW 4KUMA 1O9HA 4R8UA 2E76B 1SA0A 4DR6O 3OGIB 3F8NA 1OCCB 3MR6A 1Q43A 4B3MB 3ABMC 2W6OA 5BR8B 2FKLA 5JQGA 2FPIB 2UXBO 3B40A 5JCOA 3TW6A 4FZ0A 3K5MA 4MV7A 2WLIB 1AUXA 3U9SA 1XL6A 2FP4B 3V4ZA 3MDSA 4DV3O 1YJWV 1UNNC 1I94H 4MW3A 1GRJA 1HR0O 2E2IA 3GIJA 3H9VA 2JA5A 2ZIOA 1EN5A 3RYCB 1V54C 4A2BA 1S03G 1Y1WG 5KFEA 2IMWP 2PY5A 2VUMG 2NU9B 4RAIA 2ZE7A 3QFFA 1XL4A 3BQ1A 3RW0A 3BVOA 2YDEA 1BE3H 4X62H 4PDLA 2JK5C 4O2AF 3ZJZA 3ZRXA 3TQ1A 5CA1B 4PZ7A 1SF9A 1YEWA 2YSUB 4XYMB 3GIPA 3SPJA 1K9MW 4YBZB 4JI2H 1GM7A 3A8TA 1JMKC 5H6QA 2V4DA 2HR3A 2HHHB 3GTQA 1J5EH 2Q6AA 2UUBB 3CQZA 5TISZ 4YXWG 4JI7O 1S3JA 3L73H 1Q6HA 3K08A 2QWQB 2KQXA 3RVYA 4LFAH 5LP6A 4Q0YA 3G6VA 1YSCA 3F5TA 1RK6A 4EYHB 4NTYA 5IDJA 3NR7A 3RF2A 4AQYB 1T3NA 5K3WA 1K4CC 1M57B 4FLTA 3G80A 4FFBA 3WFVA 3QO7A 2SCUB 1N34H 4NLGA 2ATKC 1W2BU 1MSWD 4HNVA 5LP6C 2UXCH 3HKBB 2VQEH 3M9OB 3VBBA 3WWHA 2V5AA 2BOCC 4PA7A 1BGWA 3JAWB 4LSAA 3CRCA 3RBEA 2WLLB 1AR4A 2HJDA 3WG7C 1QVGU 4B3RB 1M9NA 4NB5A 5KFHA 1FJGB 3T5HA 3AK2A 4TUYF 1G6UA 5KMGA 3J81N 3AX6A 2X6AA 1FKAH 4MVZA 4L87A 3JRXA 4DR5O 2GQSA 4DV4B 3F7YC 2AU0A 3BCCH 4ECTA 5GTIZ 5BWRA 5H5NA 3CC7V 3ML0A 2R92G 2V59A 4GT1A 4EBCA 2RQ6A 3W7UA 3BAAA 5EWFA 4XDJA 4JV5O 3D36A 5AG2A 3EFFK 1ZUQA 4UB6Z 3CMAV 2PI5A 1HNXH 2EIJC 3UM7A 2WE6A 1QR9A 2ZM6B 2GBOA 2EULA 1DLBA 1GSOA 4EEQA 2X6BA 1AR1B 1NBMG 3BHPA 2DLNA 1SS3A 4GKKB 2O03A 1BZKA 4M9UA 3GB8B 4LFCO 4DV1O 4YJ2F 4TM5A 5KG4A 2KG7B 2LFSA 4X66B 3D36C 4PZ6A 4IWXA 3Q8SB 4Q44A 3H0GA 4ECWA 3GIMA 1SZXA 4QW9A 2WLJA 3E86A 4JI0H 2WLLA 4OX9H 1HNWO 1GYFA 4EG0A 4EFBA 5IWAH 2Y4UA 2YC0A 4O4LB 2X0SA 2Q0OC 1CQJB 4Q20A 2UXDH 5LOVF 2P22C 3AG1B 3HKEB 4NXNB 3RR5A 3PW5A 5L3EA 2RN9A 1V55B 5JVDB 2PMZA 4LSXA 1O9GA 3BY6A 1KC8W 2R8KA 4LFBO 2XGQA 1JJOA 2ZR3A 5KFQA 3ZRSA 3HO8A 4FGRA 1Q7YW 2YIDA 1GO3E 3W7XA 3CXCU 5KX5F 4LH6A 2Q0AA 3C90A 4UXNA 4JYAO 3AG4B 5GONA 2XCPA 4O2AA 3SGIA 3CP1A 1XMOH 2NU6B 3L4KA 4TUYB 1Y74A 3HOZG 1NI8A 3GILA 2FMAA 3K04A 4X89A 3R5HA 1ZQ7A 2DAAA 4FFKA 5DQHA 2GTSA 4B3TH 1WP8A 2LFRA 4UCVA 3G6EV 4ZHQF 1W59A 3LNMB 3O65A 4ECQA 3H1HH 4DL4A 3I56V 3GV7B 4GZRB 2NUAB 2VR1A 5BPFA 4J9ZB 3V6HA 1JKJB 1OCOC 1OCZB 3VNNA 1SZTA 2C00A 3ZX6A 4PBCA 4LF4O 2P90A 2QWRB 2R72A 4DUYB 2IU0A 3ABLB 2R9IA 3L4JA 2ZQMA 4LCUC 2A7WA 4LF5B 3NUAA 1K83A 1YXBA 2ZE6A 3IC9A 3QTCA 4DLKA 1N0JA 1Y76B 1CKOA 3BRCA 4JF3A 4A3JG 1VQNV 5B3SC 4ME6A 4O81A 5LMNH 2IBKA 1C3OA 4MVSA 2E74B 4DV2H 3Q4HB 4MTEA 5C3EG 4B7KA 2BSKB 1FPOA 1BHBA 3CYOA 1I94B 4I9QA 1UJWB 4YJ3F 5KHJA 2HG8A 1PD3A 4DR7H 1OWTA 3GIQA 1GM9A 2FTKA 1EKVA 4FM9A 5DM6V 1LUWA 2C28A 1I08A 4A3MG 1OCRB 4R50A 1R6NA 5LL6Y 3DAAA 3WO1A 4DRXA 2JIZG 1YJNV 2BTOA 3CEBA 4YHHH 4D7TA 2VWKA 5KFRA 2WAMA 1N33O 2QK4A 2ZXWB 4YJ2A 2QSAA 4X62B 2JRIA 4C2MA 1H2LA 2JJ1G 5LMUH 3AG3B 3AK1A 1VQOV 1L8DA 2W6QA 2WA3A 5EBWC 3MD0A 1R3LC 3ABKB 4JI2B 3EHBB 1HDJA 4DV6O 5JJJB 2YS6A 5LYJF 4PI2A 3DGEA 4KFMA 4ZHQB 5DG7A 1BQ0A 1S0MA 2W6IG 5LOVA 3Q4HA 5EWEA 2BSKA 2OIEA 4MVOA 1QNMA 4TV8B 4IIJF 3G6BA 2VQFH 2UU9H 4TQSA 1IYDA 4TOIA 5LHIA 2RNBA 4LFAB 4H44B 1XNQH 2P67A 2Y0SE 4DXWA 2ZE8A 3B4SA 2QM8A 5KX5A 1KQSU 2CW8A 1QBZA 1X4TA 1I3QA 1ZX3A 3PZPA 1MZEA 4Y8VB 1PKXA 3OUFA 4CKBA 1N34B 4LF6H 5FJ8G 3SPGA 1TAEA 2UXCB 3THOA 2VQEB 1WAZA 5EC1C 1NKDA 1I7NA 3LULA 5L3BA 2NVXA 1JDBB 5L1IA 4DV0H 5FLMG 3G6XA 4YJ3B 2PVPA 3RN4A 4LWSA 1IBLH 4P30A 2A3QA 3RT3C 3AG3C 4I50B 3CJHB 4Q4DA 4TQRA 4I4TA 3GB7C 3CCJV 4RUCA 2ZNIA 1CXZB 1GK9A 2B5UA 3ABKC 4GX5A 4Q8FA 3PO3G 4LF8H 4RB3C 1I0HA 1HNXB 3JD4A 4EFEA 4RAYA 2JS3A 1UC9A 1EN4A 1PL4A 1XI1A 3SJAC 5HFLA 4N23A 5DGHA 3T9AA 5EZYF 2F1MA 2RGVA 1VQ9V 4A3IG 2DE0X 1RM1C 1PNLA 5BWTA 5LYJB 3S3XA 1H38A 2JA7A 1IURA 1J5EO 2C2DA 2ARHA 3GTLA 4E2LA 4YB8B 4JI0B 2PTMA 4J9OA 3BPZA 4JTAB 5C8YF 2C35B 4Z2WA 2NVYA 4QSHA 4YJ3A 1BMFG 5DISC 4JI5H 2UXDB 2F4VH 3P3PA 3KYHC 1XDNA 3RB0A 2CW7A 3EVKA 3KHRA 3FB7C 4UVCA 2CH7B 4JI4O 3BFRA 2W9BA 5IYDO 3T1HB 1B04A 3VMMA 3OGCC 1PPJH 3FAVA 5KFPA 4ABMA 4DL6A 2E5LO 1Z2PX 3E89A 2QJ1A 3CWBH 2IH3C 2FPPB 1Y6XA 3DSQA 4XDLA 1VQKV 3HKZA 1SC5B 2EILC 4JAVA 1E4FT 3AG2B 1VMGA 1XMOB 2FB5A 2QKSA 3KKYA 1YZBA 2YEVA 3CCRV 5F9LA 3UZBA 3E22A 4PWQA 2J6TA 4R7RA 3B2EE 1EHIA 4B3MH 2EINB 3TINA 5BR8H 1WH2A 5EDWA 5IYZB 3GIKA 2YYAA 1R1BA 1NR1A 4CMDA 4QJFB 2Y0PA 3JAMW 2IP4A 4U7OA 1GSAA 4PA9A 4D7SA 2N04A 1H2KA 2XASA 2VPSA 3JSLA 4IIJA 2YUAA 5T14A 2XAFA 5IYBO 4BBSG 3BACA 3L74H 3T7AA 3GIDA 2P7TC 5IE9A 1IBKO 3LMLA 1BGYH 4UCUA 4FLWA 1I5YA 2XTAA 3RYHA 3Q8PB 3E8GA 3CRAA 4O3SA 5I5SA 1G2WA 3A2FA 2PYLA 4GKJO 4J9RA 1JA8A 5EZYB 3MFIA 2O57A 3GIIA 2XUMA 4MVUA 4XBFA 3RYFB 5D5QA 1JXLA 3DXRA 1AUVA 3F5WC 2CKZB 4JI6O 1TUBB 4U3FH 2R87A 5C8YB 4O7NA 5CB4B 5LMNB 1KYOF 4B08A 4AYBE 1OBDA 5JUMA 1XNRH 2B63A 4DV2B 1FVIA 5CA0F 5LHGA 5BWUA 3G67A 3G4SV 1KJ8A 3GTOA 3T9BA 2Y48A 5JVLA 1AP6A 1C30A 1Q3EA 1I1LA 3OUUA 1ZLZA 4Q43A 1ENVA 4QPJA 3RJ0A 4DR7B 4I0XB 1B33N 3J80W 4HNUA 4ECYA 2XAHA 4RAZA 4BW5A 4RQFA 2UUCH 5EIBC 4CHIA 3UO2A 1WA8B 4YR3A 5LA6F 3RB3A 1FD9A 4MTOA 4YHHB 1GN4A 3SE7A 1KMIZ 1MZFA 4GC6A 1H2MA 2VS0A 2QEXV 3CC2V 2W6NA 4O7SA 5IYCG 2CK3G 3KALA 3HR0A 5JJEB 5LMUB 2WB1E 3K9AA 3CCUV 3OR6C 3MJFA 5FD6A 4B3TO 3P3NA 1S76D 5KT5A 2JEXA 3IC7A 3OHBA 2CZGA 2AHZA 1FJGH 2XOKG 4I7HA 4MT8A 5CA3A 1GO3F 4DR1O 2P4VA 2MK3A 3JD0A 2BQUA 4CS3A 2OWOA 5EWGA 2UU9B 2VQFB 3H1LH 2K1EA 4DUZO 2COGA 1E1QG 3AK3A 1YTFD 5KG0A 1JFFA 5A2QN 1XNQB 3ZMVA 1RPOA 2XGPA 5HV6A 1I6UA 2BCCH 3N2KB 4EB6B 1HW7A 3ZHUA 2RJZA 3OMNB 2IBZH 4GKKH 3UCSC 4LF6B 3ZMUA 4LNUA 1WR2A 3ETQA 4DW1A 2W8LA 5KFBA 3BQ0A 5KUMA 5CA0B 4Q45A 3K3WA 2HG5C 4IHJB 4FFPA 4A3DG 2P4KA 4DV0B 5B1BC 2W0XA 4WBNA 2L6LA 1K5QA 3MHSC 1IBLB 4FS2A 3LP8A 1NU1H 3W7WA 1IX9A 4J7KA 2CFMA 1ZAUA 2Y4RA 4K3AA 2YU9A 4JYBA 4A3KG 3EPGA 1ROPA 1XHXA 3K0GA 4DV5H 3W1GA 2R6FA 5K2MA 3HOXG 2PBZA 2AHYA 2COJA 4JI1H 3K0DA 3KG2A 3LSQA 4W4LA 4DO2A 2EIYA 1CP9A 1WP7A 5D1OA 5L1KA 5L3DA 3RYIA 2C2AA 5LGNA 1NTKH 3K06A 3OEHG 1XREA 3ETJA 3CCVV 2AGPA 4UVBA 2W9AA 1RJQA 3K59A 3CPWU 1KJ9A 2NLJC 5DLFA 4O4JA 1BT8A 3NBZB 4YP3A 2ZKOA 2CDYA 2QTOA 1UFIA 3UO3A 3R5XA 1I5XA 3ASNC 1E4EA 4MAMA 1S5LZ 4J7ZA 4HAMA 3FB5C 1AJNA 4JI5B 1PNKA 2XNDG 2F4VB 2CAZC 4WFHA 4G3IA 4A3FG 4UB8Z 1S77D 4X64H 2QWPB 3JAKB 3OUSA 4HQ6A 2DW4A 5KT6A 5LA6A 3FKIA 4DR4B 1E1RG 4MVRA 4FFLA 3FYEB 4KHPO 1JX4A 1VS0A 1RYSA 4F50A 4DUYH 5KG6A 4X20B 4BXXG 3CVZA 1SETA 5IJ9B 4LF5H 4O83A 2QM7A 1O75A 2DMXA 2HHFB 2JA6G 3PO2G 5I5XA 3TY8A 1KU9A 4DV7H 4BIZA 1S9FA 2R9AA 1YTFB 2OCCB 3QZ7A 3RFCA 3Q8RB 1CKNB 4LR3A 4JI7B 4UVAA 4F4YA 1AP5A 2LO1A 3K58A 5ITZB 4LF7H 1BNCA 1K4DC 3BABA 5CAEB 4LF8O 3RAQA 1AILA 2OTLV 2DQ0A 3OUZA 2QR4A 5JCOC 4IRCA 1M5IA 3HT5A 3LQSA 4CZZA 2QDOA 4GLWA 1L0LH 1JCHA 3RVZA 2NR5A 4CS4A 1FFXB 2EIMB 4JYYA 5GTHZ 3WB1A 3JD3A 4FBUA 5KFFA 5KFKA 1VF7A 4A3EG 5IJ9A 5KFWA 3KHLA 3OD4A 4O4IB 1FXKB 1SYXB 1DIKA 4MVMA 4MA0A 5KAIZ 3L71H 2R8HA 4IYHA 3GV5B 1N36O 1XNRB 1GMGA 1NVPB 3A0BZ 1IYEA 4J0MA 3T1YO 4JI3O
chains in the Genus database with same CATH topology
5FPRA 4U3JA 4HNAB 3VNNA 2JS5A 4PZ8A 3K3VA 5KHGA 4CC5A 1I7FA 2R72A 4DUYB 5J2UA 4OX9B 3L4JA 4IIJB 3SR2C 4LF5B 4X65B 3QTCA 1NT2B 5IWAB 1A0IA 2UUCB 3RYCA 1ZHQA 3UT5B 4FLZA 3OTFA 3BRCA 1CKOA 4NXMH 1N36H 4LFCB 4DV1B 5LMNH 3T1YH 4DR3H 4JI3H 3NC0B 3RYHB 1P8LA 4DV2H 2F93B 2GV9A 2F95B 4MTEA 3QF7A 4APMA 1I94B 5CA1A 4I9QA 5KHJA 1HNWB 4K0KH 4X1IB 4CC6A 1P16A 4DR7H 4PI0A 3N2KA 4EB6A 1L2ZA 3K5LA 2HGSA 4B3SH 3CHXA 4DR6B 2Q2UA 4FM9A 1RSOA 2WYOA 3JASA 4DR2H 5K1XA 2UXBB 4DRXA 3S24A 2BTOA 2YCHA 4YHHH 4D7TA 2VWKA 1SEIA 1WPBA 2PYJA 1HNZH 4DV3B 4YJ2A 4X62B 5CA0A 3W5OA 4IHJA 3QG5A 4HBNA 1HR0B 5LMUH 4B3TB 4CS2A 2Q2TA 1L8DA 4TQFA 2VOBA 3WB2A 3RTXA 4NVPA 4JI2B 3K5NA 5J2TA 5JJJB 4PI2A 1SA0B 4DR1B 4ZHQB 4LF9H 2JVDA 1H2SB 5IT9W 5LOVA 4I55A 5JQGB 3J7AK 1N33H 4K8ZA 3HKBA 4DUZB 4TV8B 3SJCC 3M4IA 2UU9H 2VQFH 1X9NA 2YIAA 1S68A 5D1PA 4TOIA 4LFAB 3JAWA 1QQCA 5JH7B 1XNQH 3C0FB 2HVSA 5KX5A 4MTDA 4FM2A 3DF7A 4DV6H 2CW8A 1X4TA 3VQWA 3T1YB 4JI3B 2KKWA 1N34B 2YI9A 4Q6GA 4ZOLB 4LF6H 4CH5A 4DRFA 1TAEA 2UXCB 3JATB 3RWRD 4DV5B 4E6NA 2HHHH 3THOA 2VQEB 3T1HH 3WB0A 2UUBH 3HKDB 5EOYA 4JI1B 2UUAH 1JFFB 4O2BA 1M0WA 4DV0H 4B3SB 4RZQA 4PHZA 4YJ3B 2BTQA 4K8XA 2R70A 3JARB 3JAKA 4AQYH 1IBLH 1Z5WA 5KHIA 2E3CA 4I50B 2YI8A 4I4TA 4LNUB 5IJ0A 2ZNIA 3GJXB 4YY3H 2PZSA 4UCSA 4GLXA 2PGGA 4X20A 4A2AA 4RB3C 4LF8H 4O4HB 1Q8IA 1HNXB 4EFEA 5LP6B 4RAYA 4O4LA 1XI1A 3SJAC 4B3RH 5BMVB 3HKEA 4WBNB 3HXLA 4X64B 3JALA 3HKCA 4DR5B 2F1MA 5JVDA 2RGVA 4TQDA 4FFBB 4ZI7A 1CKNA 5LYJB 2HVQA 2VWJA 4DV4H 2Q7HA 3N41B 4AHCA 3HKDA 1SKVA 5ITZA 4JV5B 3U0ZA 2EX3A 4JI0B 2PTMA 3BPZA 3JSNA 3N6XA 3OTOH 4YJ3A 5DISC 1QHTA 4JI5H 2ZM6H 4PDBA 2ZNJA 2UXDB 2F4VH 3CSXA 4F6RB 5D1OB 3KYHC 1XDNA 5KMGB 4DV7B 3RYIB 2CW7A 1N32H 4TUYA 2MCTA 2FE3A 1FFXA 3VQYA 4X66H 3T1HB 1B04A 4KHPB 4UCRA 4O4JB 4LF4H 3KXYT 2HIXA 2HEPA 1Z2PX 2UUAB 2Q7GA 2QJ1A 4LF7B 2JGUA 3DSQA 4BWAA 4O4IA 3IG0A 3FMAA 3MWMA 1E4FT 5BMVA 1TVKB 3N40P 1XMOB 2YIBA 3E22A 4NXNH 4R7RA 4JI4H 1BJTA 3B2EE 3BA9A 4M7EA 5LL6b 4B3MH 5BR8H 4HNAA 4DK0A 1WH2A 4LFBB 3ZS8C 5IYZB 5LA6B 2E5LH 4EQ5A 3JAMW 3U11A 4LF8B 4DK1A 4D7SA 4JYAB 1XQ8A 2VPSA 3JSLA 4IIJA 3UT5A 4TV9B 1TGOA 4X1YB 3ZEDA 5FNVB 3LMLA 3TY9A 3N43B 4UCUA 2XIGA 4JI8H 4FLWA 3RYHA 3PN1A 3GDEA 3A2FA 2PYLA 4X1KB 5EZYB 3RIZA 1Q5OA 4X1IA 3N42B 3CB2A 3RYFB 5D5QA 4CH3A 5LXTB 2XHBA 3OTOB 1TVKA 1TUBB 5GONB 4O2AB 4NXMB 1N36B 1IBKH 5C8YB 5CB4B 5LMNB 4B08A 1N32B 4DR3B 1XNRH 5KHHA 2QM4A 4DV2B 1FVIA 2HIVA 4GKJH 2ZJTA 4UCOA 3SJBC 4LF4B 1Q3EA 4K0KB 3RJ0A 4DR7B 5EIBD 4JI6H 3J80W 2W57A 4RAZA 3K5OA 4X65H 2ZINA 2UUCH 5EIBC 1O9HA 1SA0A 2YXLA 4DR2B 4ZHQA 3F8NA 4CH6A 1Q43A 4B3MB 4FLVA 5BR8B 4YHHB 5JQGA 1KMIZ 4X1KA 3VQVA 3N2GB 5JCOA 1HNZB 3K5MA 4TV8A 4U3JB 4MV7A 1WNSA 3KALA 3ICXA 5JJEB 5LXTA 5LMUB 1I94H 5JH7A 1Z5VA 1M93A 5J2UB 5FD6A 1DGSA 3EYYA 2ZIOA 3RYCB 4A2BA 1FJGH 1D5AA 4LF9B 1TA8A 4I7HA 1S03G 4ZOLA 2UXBH 5EYPB 1SQGA 2PY5A 1N33B 3JATA 1M0TA 2WDTA 5A2QW 4CS3A 2OWOA 2UU9B 2VQFB 1WN7A 4DV3H 4X62H 3BA8A 4KL1A 1JFFA 4LH7A 5CA1B 1XNQB 4PZ7A 1HR0H 1YEWA 1I6UA 3N2KB 4DV6B 4EB6B 3JARA 1HW7A 4JI2H 2RJZA 3JASB 4GKKH 4DR1H 1JMKC 4I50A 3N2GA 2IM9A 4LF6B 4DRXB 4LNUA 2V4DA 2HHHB 3ETQA 1J5EH 2UUBB 3RGBA 4DUZH 3U10A 4YJ2B 4DR4H 5CA0B 4IHJB 4O4HA 4JI6B 4LFAH 5LP6A 4DV0B 3N44B 4Q0YA 5KHKA 5D5PA 4WBNA 3RF2A 4AQYB 1IBLB 4BWSC 5J2TB 5EYPA 4FLTA 4FFBA 3MAQA 2OYQA 2CFMA 1ZAUA 5LYJA 3KAJA 1N34H 3QWUA 1SQFA 5LOVB 4I55B 4YY3B 5LP6C 2UXCH 1XHXA 4JI7H 2YIBD 4DV5H 3W1GA 3HKBB 2VQEH 5FPOA 4CH4A 3L2PA 1T5EA 5FD5A 3IAYA 4JI1H 1BGWA 3JAWB 4L8JA 4LSAA 1IBMH 3J81W 4B3RB 4AILC 1P49A 1FJGB 4F6RA 5D1OA 4GYCB 5KX5B 5JJNB 1G6UA 5KMGA 3FFQA 2F66C 3RFRA 3RYIA 1FKAH 4FLXA 1XMQH 4UFZA 4DV4B 1E4GT 3K59A 4O4JA 3NBZB 4FM0A 3H20A 2RQ6A 4ETSA 3BAAA 4LMYA 3LNNA 5K1PA 1HNXH 4JI5B 4O2BB 2WE6A 2ZM6B 3NBYB 2F4VB 2CAZC 2ZIMA 4EEQA 2BTQB 3BHPA 4GKKB 2O03A 4X64H 3JAKB 4DR5H 3GB8B 4RB0A 5IYZA 4X66B 5LA6A 1J5EB 4PZ6A 2P5OA 4I4TB 5IJ0B 4DR4B 1XHZA 1VS0A 4JV5H 2KSWA 4DUYH 1XK5A 4JI0H 4X20B 4OX9H 4TV9A 3CVZA 4RB2C 4X1YA 1GYFA 5IJ9B 4LF5H 4EFBA 5IWAH 1O75A 4O4LB 5FNVA 2UXDH 4ZIBA 2P22C 3HKEB 2Q7EA 4NXNB 1KU9A 4BW9A 4JI4B 3RR5A 3TY8A 3JALB 3HKCB 4DV1H 4DV7H 4LFCH 2R9AA 5JVDB 3M7MX 1CKMA 4LSXA 1O9GA 3VQXA 4LR3A 5EZYA 4ZI7B 4JI7B 1CKNB 2E5LB 1AN7A 1JJOA 5FLXW 4KHPH 3RYFA 3K58A 5ITZB 4LF7H 3BABA 4LH6A 1IBMB 2Q0AA 1HNWH 1TUBA 5GONA 3K57A 4O2AA 5C8YA 5CB4A 3SGIA 4DR6H 5JCOC 2ZCEA 1XMOH 1M5IA 2HVRA 1XMQB 4FLYA 1Z2NX 4JI8B 3L4KA 2PUSA 3KAKA 1M4UA 1Z2OX 4TUYB 4CS4A 3UQ8A 4LFBH 1FFXB 4IAJA 4UCTA 3WB1A 4JYAH 1V9PA 4FVMA 4FM1A 1VF7A 4B3TH 5IJ9A 4RB1A 4O4IB 4UCVA 2VUGA 3TY5A 1SYXB 3RGXA 4MV9A 1IBKB 4FLUA 1S5JA 1XNRB 2RGRA 3E22B 4J0MA 3RGZA 1ZHSA 3W1BA 4GKJB 1MZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPR A;  3L2P A;  3VNN A;  4PZ8 A;  4NXM B;  1N36 B;  4CC5 A;  5LMN B;  1N32 B;  4DUY B;  4DR3 B;  4B3R B;  3GJX B;  1FJG B;  5D1O A;  4OX9 B;  4DV2 B;  4LF5 B;  1FVI A;  2HIV A;  4X65 B;  5IWA B;  4UCS A;  4GLX A;  1A0I A;  4UCO A;  2UUC B;  4UFZ A;  4LF4 B;  1CKO A;  1HNX B;  4DV4 B;  4EFE A;  4LFC B;  4DV1 B;  4K0K B;  3NBZ B;  4DR7 B;  3NC0 B;  4GKJ B;  1P8L A;  3BAA A;  4X64 B;  4DR5 B;  1CKN A;  4DR2 B;  2HVQ A;  4JI5 B;  1I94 B;  2ZM6 B;  3NBY B;  4B3M B;  1HNW B;  2F4V B;  4CC6 A;  5BR8 B;  4YHH B;  1P16 A;  4EEQ A;  4JV5 B;  1HNZ B;  4GKK B;  4JI0 B;  4DR6 B;  2Q2U A;  3GB8 B;  3JSN A;  4X66 B;  5DIS C;  5LMU B;  1J5E B;  2UXB B;  4PZ6 A;  2UXD B;  3S24 A;  4DR4 B;  5D1O B;  3KYH C;  1XDN A;  1VS0 A;  1DGS A;  4DV7 B;  4DV3 B;  1XK5 A;  4X62 B;  3W5O A;  4LF9 B;  1TA8 A;  4EFB A;  1HR0 B;  3T1H B;  1B04 A;  4B3T B;  4KHP B;  4UCR A;  1N33 B;  2HIX A;  2Q2T A;  2UUA B;  4LF7 B;  3TY8 A;  4NXN B;  3RR5 A;  4JI4 B;  2OWO A;  3RTX A;  2UU9 B;  2VQF B;  4JI2 B;  1CKM A;  1CKN B;  3BA8 A;  4DR1 B;  4JI7 B;  2E5L B;  4LH7 A;  1XNQ B;  4PZ7 A;  1XMO B;  4DV6 B;  4DUZ B;  3BAB A;  3BA9 A;  4LH6 A;  1IBM B;  1X9N A;  4LFB B;  1S68 A;  3W1B A;  5D1P A;  4TOI A;  4LFA B;  4LF6 B;  3SGI A;  4EQ5 A;  2HVR A;  1XMQ B;  2HHH B;  4JI8 B;  4LF8 B;  4JYA B;  2HVS A;  2UUB B;  3JSL A;  3T1Y B;  3UQ8 A;  4JI3 B;  4JI6 B;  1N34 B;  4DV0 B;  4UCT A;  4DRF A;  1TAE A;  3TY9 A;  2UXC B;  4UCU A;  4DV5 B;  4E6N A;  2VQE B;  1V9P A;  3PN1 A;  4AQY B;  1IBL B;  4UCV A;  3GDE A;  2VUG A;  3TY5 A;  4JI1 B;  2CFM A;  1IBK B;  1ZAU A;  3QWU A;  4B3S B;  1XNR B;  4YY3 B;  3W1G A;  3OTO B;  5FPO A; 
#chains in the Genus database with same CATH topology
 2DQ3 A;  2WLI A;  2JS5 A;  4PZ8 A;  4QW8 A;  2J6U A;  2R7M A;  5JH7 F;  3K3V A;  4CC5 A;  3G8D A;  4ED2 A;  4CE5 A;  4O4L F;  1OCC C;  4E4E A;  3WO0 A;  5C4X G;  4ED1 A;  4PDR A;  3SR2 C;  1KP3 A;  1ARO P;  1NT2 B;  1BSM A;  4MTF A;  3RYC A;  2UUC B;  1WCM A;  2EBO A;  4B3S O;  3JD2 A;  5JVD F;  3OTF A;  4NXM H;  3T9E A;  2AGQ A;  4C5C A;  1R3K C;  4LFC B;  4DV1 B;  3LSS A;  2W6J G;  3FKS G;  4IZO A;  2LGW A;  5KG2 A;  4DR3 H;  3OM3 B;  2AW9 A;  2P6J A;  2X5R A;  2DOS A;  5BR8 O;  1V4Y A;  2F93 B;  2GV9 A;  1RFY A;  4BIU A;  1R73 A;  3QF7 A;  1JX9 A;  4DL2 A;  1NJI W;  5CA1 A;  1HNW B;  4K0K H;  4X1I B;  4J7J A;  4LC1 A;  4CBC A;  4PI0 A;  1K1S A;  3BJY A;  5KG1 A;  3K5L A;  2WTF A;  3QO8 A;  1BXR A;  3CHX A;  2JEU A;  3K5I A;  2Q2U A;  3OAA G;  2AXT Z;  1OZ0 A;  2WYO A;  2YZN A;  4DR2 H;  1SQB H;  4DL7 A;  2XAQ A;  4NZM A;  4UUG A;  2ODT X;  1A0G A;  4FIP C;  1NTZ H;  1Y4M A;  1TWA A;  1VBH A;  5BWX A;  2PYJ A;  1HNZ H;  5LGT A;  3PR4 A;  3PW7 A;  2CNV A;  2Q8V A;  3PR5 B;  1F23 A;  4JAU A;  3M9M B;  5KFG A;  5B1A B;  3D8C A;  4HBN A;  1IXB A;  2YXH A;  5BMV F;  2MW2 B;  4P9O A;  1DV1 A;  1LR1 A;  2IJI A;  4QWC A;  3RTX A;  4NVP A;  5B66 Z;  2UVR A;  3AG7 A;  4LF9 H;  5H6R A;  2JVD A;  1VKZ A;  5IP9 G;  1ZL8 B;  2EIK B;  5IYD G;  5IT9 W;  2Y4T A;  3J7A K;  4FFN A;  3ETG A;  3HKB A;  2HHH O;  4FBT A;  3M4I A;  3SYQ A;  1K8A W;  2Y0S A;  2UUB O;  4ZKI A;  5D1P A;  2Q7D A;  3JAW A;  1QQC A;  1M57 C;  5JH7 B;  1Q86 W;  3JCZ A;  3H4D A;  5DGA A;  4JTD B;  2CE4 A;  3W7T A;  3T9C A;  1GM8 A;  4FM2 A;  1KJQ A;  3MWD A;  4DL3 A;  4ECS A;  4RUF A;  3VQW A;  1SQX H;  2R7K A;  2KKW A;  1WSC A;  5KT7 A;  4AQY O;  3KTM A;  2YI9 A;  2LGQ A;  1LUV A;  4ZOL B;  1EKP A;  4DRF A;  3JAT B;  2AZ2 A;  4DV5 B;  4E6N A;  3TEK A;  3T54 A;  1Q90 D;  2R9R B;  3WB0 A;  3T1H H;  4TWK A;  5KG3 A;  3HKD B;  4JI1 B;  4JZ2 A;  4JXU A;  5FLX N;  1M0W A;  1Y1V A;  4PHZ A;  2J6S A;  3SPC A;  4K8X A;  4B3R O;  4A3B G;  2R70 A;  3JAR B;  1MNG A;  2G38 A;  1I1K A;  1WB8 A;  4C5B A;  3CRM A;  3LWB A;  2KG7 A;  4XYL B;  2E3C A;  5IY5 B;  4WCE V;  3RV3 A;  4JAS A;  2YI8 A;  4NZN A;  4DV4 O;  2DYS B;  1EFR G;  3VOT A;  2C2E A;  4YY3 H;  2M7W A;  5LGU A;  3SI8 A;  3SDL A;  2CQY A;  2PGG A;  5BYB A;  4O4H B;  5DLG A;  1MG1 A;  1IDS A;  5E25 A;  5I5Y A;  5KFU A;  4O4L A;  3OTO O;  1AJQ A;  3PW0 A;  3HOY G;  1M90 W;  5BMV B;  3HKE A;  2ZM6 O;  4X64 B;  3QQM A;  1D5N A;  5JVD A;  2DAB A;  4TV8 F;  3CC4 V;  4GKK O;  1N32 O;  3MFH A;  2HVQ A;  5CR5 A;  5CN0 A;  3L75 H;  1N48 A;  4X66 O;  2OCH A;  3PW4 A;  2LP7 A;  3HKD A;  2Q73 A;  4OPH A;  4PA6 A;  5H9C A;  4EGJ A;  3AG1 C;  1KEC A;  4UUJ C;  5BPH A;  1VQ8 V;  1V55 C;  3N6X A;  4QIW F;  1B06 A;  3R66 A;  2ZNJ A;  2ZGI A;  3CSX A;  4F6R B;  4DV7 B;  5L9X A;  2Y0I A;  3HPL C;  4TUY A;  2H94 A;  4NXN O;  2FE3 A;  3VQY A;  4MV8 A;  3AG4 C;  2Y69 B;  2BOB C;  1SES A;  2UUA B;  4LF7 B;  3TIG A;  4GX0 A;  4F4X A;  2OT5 A;  4BWA A;  3IG0 A;  2ASL A;  4A3G G;  2Q68 A;  3RB6 A;  5BMV A;  4BY1 G;  4I50 F;  4CKC A;  2FK1 A;  2VRZ A;  4J41 A;  2CTP A;  3CEI A;  2A06 H;  3RB4 A;  1B3Q A;  3BA9 A;  5LL6 b;  4YAJ B;  4UV9 A;  2VA3 A;  2XCA A;  4DYL A;  1YF2 A;  3EPI A;  1S97 A;  1H2N A;  3ZHT A;  1UC8 A;  2I87 A;  3X2Q B;  1LNQ A;  4J9M A;  3CXH F;  1Y76 A;  4TV9 B;  1M6V A;  4X1Y B;  1OCZ C;  4QPK A;  3RUP A;  5HBR B;  1JIH A;  5FNV B;  3N43 B;  5DG8 A;  1Y1W A;  4DAA A;  2GPW A;  1FAF A;  4JI8 H;  4JV2 A;  2EJ0 A;  2VUM A;  3ABL C;  3K3P A;  5LHH A;  3Q1K A;  4H0L B;  5CBH A;  3MR3 A;  2Q9L A;  1GN3 A;  1PM9 A;  1Q5O A;  4JZG A;  4HYK A;  4FJC C;  3E35 A;  4CH3 A;  2XHB A;  5BWW A;  1QLE B;  3S3W A;  4DUY O;  1EUC B;  4Z1M G;  2R7Z G;  4AYB A;  2FLN A;  5KFA A;  1VQM V;  4LF5 O;  4NXM B;  4EBD A;  2FML A;  3ZMT A;  1ET0 A;  4DR3 B;  5KHH A;  4NTX A;  4O7V A;  2ZJT A;  5KFZ A;  3SJB C;  4W4K A;  2W71 A;  1ZTE A;  2R93 G;  3ASO B;  1ZSP A;  4K0K B;  3BEH A;  1OCR C;  1BS3 A;  2WPD G;  5EIB D;  1I94 O;  4A5U B;  1AB3 A;  1I7L A;  3H3V H;  1K33 A;  4X9Q A;  1EZJ A;  4X65 H;  1U96 A;  2H3O A;  2ZIN A;  1VQ4 V;  2GLT A;  3TCU A;  2YXL A;  4DR2 B;  2ZXW C;  4ZHQ A;  1M56 B;  4RNN A;  4OXS A;  5IYZ F;  4CH6 A;  4FLV A;  1VQ6 V;  3VPD A;  4J9L A;  5EK0 A;  3N2G B;  1OJH A;  1HNZ B;  1P7B A;  2QKA A;  4TV8 A;  2RF4 A;  4U3J B;  2WB1 A;  1WNS A;  3ZIA G;  4HR7 A;  3ZHR A;  5B1O A;  4X62 O;  2L35 A;  1Z5V A;  4O82 A;  4EYI B;  3GWO A;  5J2U B;  3AYH B;  5KFN A;  4FFR A;  4ED6 A;  4OGQ B;  4O86 A;  1D5A A;  2W9C B;  4LF9 B;  1TA8 A;  1XEQ A;  4NR1 A;  4QIW A;  4JI2 O;  2WAQ A;  2Q69 A;  5KG5 A;  2UXB H;  5EYP B;  4PJ0 Z;  1M0T A;  1N8R W;  1BQZ A;  2WDT A;  4M0J A;  2R92 A;  1XBL A;  4O7W A;  1WN7 A;  4DV3 H;  4O2B F;  4KL1 A;  1I50 A;  3OR7 C;  1HR0 H;  1VF6 A;  5CB4 F;  3ZHQ A;  4LFA O;  4QWE A;  1NZ6 A;  2W6M A;  2FK2 A;  4MV3 A;  1RSO B;  3JAS B;  4JUZ A;  1AVM A;  4I50 A;  3N2G A;  3CJH A;  3CCS V;  5C93 A;  1N34 O;  2WLN A;  1FFT B;  1VF6 C;  1KEE A;  1HP8 A;  2UXC O;  1GSH A;  3K79 A;  1KUQ A;  5BWV A;  3PW2 A;  3U10 A;  2VQE O;  4DR4 H;  1VQL V;  3STL C;  3OMI B;  4JI6 B;  3FB8 C;  1G4Y B;  1QLN A;  2YS7 A;  1CPY A;  5DMX A;  2CTW A;  5J2T B;  1T94 A;  1FKA O;  5EYP A;  2R82 A;  1ZET A;  3KAJ A;  3MAQ A;  5LYJ A;  3MWE A;  3UFX B;  4YQW A;  3QWU A;  3CS5 A;  4I55 B;  2FYU H;  4YY3 B;  5JQW A;  4MW8 A;  4JI7 H;  2YIB D;  1JQ0 A;  3SYC A;  4CH4 A;  1US6 A;  2XAG A;  4JTC B;  3IAY A;  1R3I C;  4J9P A;  4I5S A;  3J81 W;  5A9G A;  4AIL C;  1HNX O;  1P49 A;  3NXS A;  5I5W A;  1IXM A;  2FLP A;  2JA5 G;  3BG5 A;  3FFQ A;  4IL6 Z;  2BQ3 A;  2CH7 A;  4P9P A;  5BXZ A;  1HWY A;  2HGX A;  3H40 A;  3E5N A;  1GKF A;  2DYR B;  5L3C A;  1SQV H;  5E1A C;  4FM0 A;  3TK1 A;  3H20 A;  5DQI A;  4RNO A;  1PNM A;  4ETS A;  5KFO A;  1F4M A;  3JCU Z;  4LMY A;  1RP3 B;  4A3C G;  4MV6 A;  4JI0 O;  2RMK B;  4OX9 O;  4O2B B;  3IGA C;  5IWA O;  2BTQ B;  2UXD O;  4DR5 H;  3N6R A;  1W93 A;  3JZ6 A;  5EBL C;  5IYZ A;  1VQ7 V;  4IHJ F;  1H2G A;  2ABJ A;  1AI5 A;  2P5O A;  4QJF A;  2C2R A;  4IRD A;  2J9G A;  3AG2 C;  5IJ0 B;  3I5D A;  4MVQ A;  2JGD B;  1XHZ A;  3DTG A;  4JV5 H;  3OSN A;  4HNT A;  1UPG A;  4RUE A;  3RBD A;  3U54 A;  4RUA A;  1XK5 A;  1ORQ C;  2IJK A;  4RB2 C;  2EIN C;  1SFO A;  4XX0 B;  3FYI B;  4HZ3 A;  3FDS A;  2Q7E A;  1XMO O;  4LFC H;  4BW9 A;  4DV1 H;  3T5K A;  3JAL B;  3HKC B;  4QWD A;  1KKC A;  5DQG A;  4R6Z A;  1CQI B;  4ZI7 B;  1IOW A;  4NZO A;  3D3Q A;  5EZY A;  3ORQ A;  2V1D A;  1QU7 A;  4C5A A;  5FLX W;  3RYF A;  2XT9 A;  1GN2 A;  2OTJ V;  2CGO A;  1IBM B;  1HNW H;  4IWY A;  1N0N A;  1TUB A;  3GWK C;  3B77 A;  3T9D A;  1KBL A;  4BIO A;  3DTF A;  5C8Y A;  5KUK A;  1U97 A;  5CB4 A;  5IP7 G;  2IA6 A;  2ETN A;  2ZCE A;  2GPS A;  4RQE A;  2HVR A;  1XMQ B;  1Z2N X;  1Y66 A;  4JI8 B;  2IJJ A;  2PUS A;  4J9Q A;  4G2K A;  1Z2O X;  3ZN0 A;  4QIW E;  4JGS A;  2RCV A;  2WAQ E;  3AEI A;  2WSS G;  4X88 A;  3UQ8 A;  2R86 A;  2YS8 A;  4LFB H;  2Q67 A;  3E8F A;  4BY7 G;  2GUZ B;  4RU9 A;  3CSW A;  4I0X A;  5LBQ A;  4JYA H;  1V9P A;  4FVM A;  3GVM A;  4E4T A;  4DL5 A;  1JPX A;  3T4D A;  2VUG A;  4MV9 A;  3M9N B;  3H1J H;  1GTO A;  4QE7 A;  1WA8 A;  4GCZ A;  1YDX A;  1TWC A;  3TJT A;  5LMN O;  1XUQ A;  2R7L A;  3MR5 A;  3RGZ A;  3PJS K;  4UV8 A;  1JJ2 U;  1MZB A;  3SYO A;  4HNA B;  2FB9 A;  4DV2 O;  4O3O A;  3T2M A;  5KHG A;  2YWV A;  4JV0 A;  2Z02 A;  1I7F A;  1KKD A;  3H0G G;  3GTG A;  5KKN B;  3K5H A;  1EBO A;  2BR0 A;  5J9P C;  4FFM A;  3ABU A;  3H1I H;  5L3G A;  4X65 B;  4DR7 O;  1S10 A;  2K9P A;  1ZHQ A;  3UT5 B;  4FLZ A;  5DEC A;  2QB5 A;  4QGP A;  1KP2 A;  1F7Y A;  5KFT A;  5CBF A;  4JPR A;  5HFM A;  3E83 A;  3NC0 B;  4I9W A;  1W0K G;  3AW8 A;  4YHH O;  1WLE A;  1BCC H;  2F95 B;  3Q2O A;  3GTM A;  4ASU G;  1GN6 A;  3RV4 A;  3ZRW B;  4O7Y A;  2VA2 A;  3JYC A;  4U7C A;  5I5V A;  3UZO A;  4Z1V A;  1S72 V;  5LMU O;  1F4N A;  4O3Q A;  3N2K A;  3OEE G;  4EB6 A;  3T5J A;  3ZRV A;  2HGS A;  2YRW A;  3HBL A;  4DR6 B;  2F23 A;  4O7L A;  4IR1 A;  4ED0 A;  5K1X A;  2UXB B;  5BYA A;  5EC2 C;  2FL4 A;  2YZM A;  3GLK A;  3A0H Z;  1SEI A;  5CE8 A;  3JD1 A;  4DV3 B;  4R8C A;  4XDK A;  4O4I F;  5CA0 A;  3CCQ V;  2NN4 A;  4IHJ A;  3ABM B;  1Q6I A;  3FX7 A;  2VQF O;  2UU9 O;  5D8D A;  4ECV A;  1HR0 B;  1GAX A;  4O84 A;  4O3N A;  5KFM A;  2W7O A;  1NH2 D;  2Q2T A;  3ZCC A;  1XNQ O;  3QZ8 A;  3V6K A;  1TWH A;  5CM0 A;  5DGB A;  3K5N A;  4R8U B;  1SA0 B;  1R6K A;  3K9S A;  1COW G;  1MSD A;  1VBG A;  1N56 A;  1H2S B;  5JQG B;  1N33 H;  4LF6 O;  1SCU B;  4K8Z A;  3CX5 F;  1V54 B;  2ZDG A;  3VPC A;  3SJC C;  3BQ2 A;  1X9N A;  4O7Z A;  1D2D A;  1KB9 F;  2YXY A;  2GQR A;  2OLS A;  1DK1 A;  1PK8 A;  1JOY A;  2W6Z A;  3C0F B;  4O3R A;  4DV0 O;  2COI A;  3E2E A;  2HVS A;  4MTD A;  5KFD A;  3HOU G;  3DF7 A;  4DV6 H;  4AI8 A;  3R9R A;  4Q8E A;  5KA5 A;  3SNO A;  3T1Y B;  4JI3 B;  1IBL O;  2UVW A;  4ED3 A;  4CH5 A;  4QWB A;  2LW1 A;  3RWR D;  2HGW A;  1NTM H;  1R6T A;  3C3S A;  2UUA H;  3T1C A;  2UXN A;  1R3J C;  4B3S B;  1I2K A;  2HFE C;  3F7V C;  1PL0 A;  2DIK A;  4J9N A;  1PV0 A;  5F2V O;  2QF7 A;  5KA6 A;  1GGO A;  3JAK A;  1FXV A;  5F9N A;  1Z5W A;  5KHI A;  5DED A;  4J9S A;  1K3E A;  3OE7 G;  3DTU B;  1G1X B;  2UVU A;  2R7N A;  2JA8 G;  3PFF A;  1K97 A;  4UCS A;  1K5S A;  2CNQ A;  4MSW C;  4X20 A;  4A2A A;  2KSD A;  2HJF C;  5LP6 B;  4MTX A;  1G8M A;  2HHF A;  1L0N H;  4JI5 O;  2D2C B;  3P30 A;  5H2F Z;  3T9F A;  2F4V O;  3HXL A;  4MS2 A;  4DR5 B;  3IN5 A;  1RYR A;  3R5F A;  3I4M G;  4FFB B;  1CKN A;  4J9K A;  3WG7 B;  2VWJ A;  1KC7 A;  3CD6 V;  1SRY A;  2M05 A;  5LXT F;  1P4R A;  3B8N A;  4EKW A;  1KD1 W;  1VAJ A;  4AHC A;  1Y14 B;  5ITZ A;  3APQ A;  4JV5 B;  3CME V;  1QVF U;  5GON F;  4DR4 O;  3ZHV A;  1K7D A;  3I12 A;  4LBE C;  3JSN A;  3WNZ A;  4DW0 A;  1XIL A;  2OCC C;  4PDV A;  3IFX A;  4J9Y B;  1B6S A;  2JDI G;  4WHX A;  4ZOL F;  4DIM A;  5I47 A;  4PDB A;  4HN2 A;  2V7Q G;  5KMG B;  4NKG B;  2EIJ B;  1XDC A;  2ASD A;  3ORR A;  4B3M O;  1FFX A;  1NH2 B;  1WRV A;  3ABT A;  3KXY T;  2HIX A;  2HEP A;  4ECZ A;  1RJR A;  2Q7G A;  4F4W A;  3D3I A;  4O4I A;  1FXK A;  1ZWI C;  1IZ3 A;  4ECX A;  1EM1 A;  3FMA A;  3MWM A;  1TVK B;  2RDI A;  5FL7 G;  4O7R A;  4CMF A;  3TW7 A;  1EKF A;  1A3G A;  2EIM C;  4ZQI A;  4JI4 H;  4M7E A;  2CTQ A;  2IU3 A;  2A9H A;  4LFB B;  3T4Z A;  3ZS8 C;  1VF5 B;  3EXA A;  1FXK C;  5B1N A;  4O4H F;  1JDE A;  2E5L H;  2F43 G;  4EQ5 A;  1GLV A;  4FS1 A;  1KJJ A;  4JYA B;  3KHH A;  1XQ8 A;  1XOU A;  1Z2G A;  3JAM N;  2Q5Z A;  3KZI Z;  3T99 A;  4FMT A;  1RK5 A;  3ZED A;  3HB9 A;  3TY9 A;  4H13 B;  1MAB G;  2EJ7 A;  2XIG A;  2JEI A;  1AI7 A;  2DPJ A;  1XNR O;  1CS0 A;  2DWC A;  2XCL A;  4X1K B;  4ED8 A;  1YHQ V;  2JA7 G;  4MA5 A;  3RIZ A;  2A0L A;  4X1I A;  4MV4 A;  5IYC O;  5LXT B;  3H1K H;  2QYZ A;  3OTO B;  2ATL A;  2P06 A;  1TVK A;  4Q4C A;  4LP8 A;  5GON B;  4O2A B;  4RCN A;  1B6Q A;  1IBK H;  3FD9 A;  2UUC O;  2PF4 E;  2BQR A;  4PEL A;  1N32 B;  1FYJ A;  2UXX A;  1EN6 A;  3SJQ C;  4XZ3 B;  2ALZ A;  2HIV A;  4GKJ H;  2HP8 A;  1Y74 B;  3Q8Q B;  4LF4 B;  1MOF A;  2X6C A;  4U6P A;  2R8J A;  3VA7 A;  2YZG A;  5IYB G;  4F4L A;  1OCO B;  4JI6 H;  2W57 A;  3DC6 A;  1YI2 V;  3G71 V;  3ZMZ A;  3LSU A;  3J80 N;  1FJG O;  1ZL8 A;  4F6E A;  4EBE A;  5HNE A;  3ZN1 A;  5B1A C;  4J80 A;  4X1K A;  3VQV A;  3WWJ A;  3QVN A;  2RDC A;  3M8A A;  3H01 A;  1M1K W;  5C1P A;  1Q81 W;  3HOV G;  3WU2 Z;  5B3S B;  1L1F A;  3ETE A;  4TV9 F;  3ICX A;  5LXT A;  5JH7 A;  3GTJ A;  1M93 A;  5FNV F;  2EIK C;  2M6Y A;  3R23 A;  5KFJ A;  3L72 H;  1AI6 A;  1DGS A;  3EYY A;  5CMU A;  4GC7 A;  2WWW A;  4R7C A;  3RAX A;  3U0G A;  3L70 H;  2LJ2 A;  1MMM A;  2I80 A;  3T5L A;  4ZOL A;  2ASJ A;  1SQG A;  1N33 B;  3TII A;  3JAT A;  1DAA A;  1PX2 A;  5A2Q W;  5C1O A;  1EZ1 A;  2LW7 A;  3TQT A;  1EZV H;  3TXQ A;  2WLM A;  3BA8 A;  4OPA A;  1IOV A;  5I5U A;  4J42 A;  4LH7 A;  1DV2 A;  4FE2 A;  4TVI A;  5I5T A;  1YIJ V;  3FB6 C;  4IT5 A;  4DV6 B;  3OSP A;  1Y67 A;  3JAR A;  2R85 A;  2DWE C;  4GX2 A;  3OFN G;  3KCX A;  4A3L G;  2YW2 A;  4I4T F;  4DR1 H;  2EZP A;  2IM9 A;  4B7E A;  4DRX B;  4QE9 A;  2B63 G;  3GTK A;  2QTS A;  3RGB A;  4DUZ H;  4DV5 O;  4YJ2 B;  2QKC A;  2YIC A;  5GW7 A;  4O4H A;  1V51 A;  1KUT A;  3KRE A;  3N44 B;  4JI1 O;  1SER A;  5KHK A;  5IY5 C;  5D5P A;  2RDJ A;  2DYS C;  2JA6 A;  3C3T A;  2FLL A;  1EYZ A;  2CUG A;  4BWS C;  2B1G A;  2OYQ A;  3A0R A;  2IW5 A;  2DPI A;  1SQF A;  4PV1 B;  5LOV B;  2Z3Y A;  2QWO B;  3E8B A;  3TXS A;  5J2U F;  4NYE A;  5FPO A;  4FU0 A;  3L2P A;  1T5E A;  1E79 G;  3MHH C;  2ADP A;  3B8M A;  4JAA A;  2CNU A;  2VPQ A;  5KS8 A;  1AJP A;  5FD5 A;  1NR7 A;  4L8J A;  5DN6 G;  1IBM H;  3GTP A;  1K92 A;  2ODM A;  1BL8 A;  2EZO A;  4WD3 A;  4F6R A;  5KG7 A;  3KCY A;  4GYC B;  5KX5 B;  5JJN B;  2F66 C;  3RFR A;  4FLX A;  1XMQ H;  2YL2 A;  3G6Y A;  4UFZ A;  4X64 O;  2EJ2 A;  1E4G T;  1YCI A;  1MA1 A;  2ZDI A;  2N74 A;  2ZE5 A;  3QO5 A;  2ZD9 A;  4RO2 A;  4MV1 A;  4FK5 C;  1WJZ A;  5KFI A;  1WPX A;  2GTA A;  5E79 Z;  3LNN A;  5K1P A;  3U9T A;  3NBY B;  2ZIM A;  1URF A;  1H8E G;  2Y69 C;  3B09 A;  5H80 A;  3ETD A;  2ZDI C;  4NYK A;  5B5E Z;  3STZ C;  2R84 A;  4RB0 A;  4LWS B;  3U55 A;  3V4S A;  4DV7 O;  3VOU A;  3DC5 A;  1YJ9 V;  1J5E B;  4I4T B;  4RWU A;  1K34 A;  2FKX A;  3IJ4 A;  4FPP A;  1RM1 B;  2KSW A;  2UUA O;  4LF7 O;  4TV9 A;  5J2T F;  4X1Y A;  1VIB A;  2V58 A;  5KLV H;  2BE3 A;  5FNV A;  4PA4 A;  3SYA A;  4ZIB A;  2ZDQ A;  2GDS A;  4I55 F;  4JI4 B;  3CCL V;  3M7M X;  1CKM A;  2NNU A;  3VQX A;  3X2Q C;  2E5L B;  1AN7 A;  5I60 A;  2PMZ E;  4KHP H;  3WWI A;  2AZ0 A;  5C5J A;  1PP9 H;  1M7J A;  5KFL A;  4J11 A;  4WFG A;  3K57 A;  2HJW A;  1S0N A;  2W7P A;  4DR6 H;  3OMA B;  3O9O A;  4FLY A;  5JWP A;  4PDM A;  3SYP A;  3KAK A;  2UVV A;  1M4U A;  2ILM A;  1P7G A;  2EIL B;  2WLH A;  1AR5 A;  1QLE C;  1S0V A;  2E75 B;  4IAJ A;  2W9B B;  4UCT A;  3FAV B;  4IRK A;  2XAJ A;  4FM1 A;  1YIT V;  4RB1 A;  3OT7 A;  1K1Q A;  3TY5 A;  3RGX A;  4ECR A;  1H8H G;  3TET A;  2NU7 B;  1IBK B;  3R65 A;  3L9D A;  2P0A A;  4NXM O;  4FLU A;  1S5J A;  2ITC C;  3ASO C;  4I7Z B;  2YEV B;  2RGR A;  3E22 B;  1ZHS A;  4DR3 O;  3W1B A;  2ZT9 B;  2ZR2 A;  4GKJ B;  2YZL A;  5FPR A;  4C7U A;  4U3J A;  3JZI A;  3FKI G;  4WFF A;  5KFC A;  1M56 C;  2H8P C;  2EJR A;  3ZBH A;  5J2U A;  4OX9 B;  4K0K O;  1GH6 A;  1THZ A;  3ZMS A;  4IIJ B;  5IWA B;  1A0I A;  1OV9 A;  2W9C A;  1N36 H;  2Z04 A;  4ZI7 F;  2NU8 B;  1DF4 A;  4DR2 O;  3T1Y H;  2HLD G;  4NTW A;  3SPI A;  4JI3 H;  3RYH B;  3W7S A;  1P8L A;  4A93 G;  5DAA A;  2HVK C;  2V4Q A;  4APM A;  2LQT A;  1HNZ O;  3LDD A;  2Z0A A;  2XC9 A;  2DWD C;  3OW2 U;  3J7A U;  4CC6 A;  1P16 A;  3DXR B;  4H33 A;  1L2Z A;  4B3S H;  2B1I A;  2DZD A;  1RSO A;  3JAS A;  5KFY A;  3LUT B;  3SPH A;  2DN9 A;  3HOW G;  4KP4 A;  4LF9 O;  3CRR A;  3S24 A;  2YCH A;  1WPB A;  1CE8 A;  1IVS A;  3W5O A;  3QG5 A;  1ULZ A;  4CKE A;  4B3T B;  2JEF A;  1A48 A;  4CS2 A;  4WBN F;  4TQF A;  2VOB A;  3OHA A;  4QNH B;  4N21 A;  1P84 F;  4IYI A;  1I2L A;  3WB2 A;  5J2T A;  5DG9 A;  1N4C A;  1VP7 A;  2ADQ B;  4DR1 B;  1KJI A;  2AGO A;  4FZ1 A;  3NGD A;  3M99 B;  4U7N A;  5BZB A;  2QE7 G;  4I55 A;  4QWA A;  4WFB V;  3G8C A;  4DUZ B;  5IT9 N;  2R8I A;  3KHG A;  2B9Z A;  2AGA A;  3T1H O;  2YIA A;  1S68 A;  3E8H A;  1A9X A;  1YVW A;  4IGG A;  1NS1 A;  3ZHS A;  4IR9 A;  3MR2 A;  3UKM A;  1QR8 A;  2QA4 V;  5KT2 A;  2FPG B;  4BR6 A;  3QNE A;  4O7T A;  1WCM G;  5KFX A;  1Q6U A;  2HVJ C;  3V6J A;  3RBZ A;  4O4J F;  5KFS A;  4Q6G A;  3CCE V;  1JR9 A;  2FJZ A;  5KT3 A;  2HHH H;  1VEW A;  4L1K A;  2Z5U A;  1DF5 A;  1SQQ H;  4YY3 O;  2UUB H;  5KFV A;  4WFE A;  1CEZ A;  5EOY A;  4BBR G;  4ED7 A;  1JFF B;  1I1M A;  4EEY A;  2I8C A;  4O2B A;  4RZQ A;  2A79 B;  2HKO A;  1RPR A;  2HDK A;  2BTQ A;  2DYR C;  1B6R A;  1S5H C;  4MTG A;  1A32 A;  2X7R B;  4AQY H;  4K35 A;  2ITD C;  5B1B B;  2YRX A;  3PVX A;  1W0J G;  3GV8 B;  2KB1 A;  4DQN A;  4LNU B;  5IJ0 A;  3GJX B;  2JGD A;  1VQ5 V;  5L3F A;  4GLX A;  2PZS A;  2Q4P A;  1TWF A;  2IJH A;  4YIO A;  3UYY A;  1Q8I A;  3I55 V;  1SQP H;  4B3R H;  1JVM A;  2VQD A;  2W8K A;  4WF9 V;  5JQG F;  2PN1 A;  4WBN B;  3JAL A;  3HKC A;  1KTA A;  4PA3 A;  4O3P A;  1JLL B;  3HB3 B;  4EGQ A;  4TQD A;  5FR9 A;  4ZI7 A;  3TGU H;  1TWG A;  4DV4 H;  2Q7H A;  5CBG A;  3N41 B;  4D6T H;  4ECU A;  1SKV A;  1Q82 W;  1TUE B;  3U0Z A;  3I4N G;  2EX3 A;  4TSF G;  4K6N A;  4G28 B;  2W0F C;  2R7Z A;  2V9W A;  3OTO H;  2GHY A;  4H37 A;  1QHT A;  1NQT A;  4TT3 G;  3CCM V;  3VPB A;  2ZM6 H;  3ETH A;  5D1O B;  4JV1 A;  3RYI B;  3ASN B;  1N32 H;  2DJV A;  2MCT A;  4GX1 A;  4ICG A;  2QGN A;  1KBH A;  2A1H A;  5EBM C;  2FK3 A;  4X66 H;  4RZR A;  1WB7 A;  4KHP B;  2GUZ A;  2R93 A;  4UCR A;  4PD4 F;  4O4J B;  4LF4 H;  1VAR A;  4BAY A;  5DGI A;  3CRQ A;  4YR2 A;  2JGU A;  5BY1 A;  1KT8 A;  1E4E B;  1Y1V G;  1FS0 G;  4YIP A;  1IBM O;  1OHH G;  4YAK B;  3N8D A;  3N40 P;  1R9T A;  2YIB A;  2WA4 A;  3HKZ E;  4J10 A;  2E2H A;  3APO A;  4NXN H;  2AQ4 A;  1XMQ O;  1BJT A;  4JI8 O;  2IH1 C;  3N27 A;  4HNA A;  4DK0 A;  2JEJ A;  5LA6 B;  2CTR A;  1NVP D;  5LP6 F;  1RJP A;  3U11 A;  4LF8 B;  4DK1 A;  4FFO A;  3H4B A;  2W70 A;  1T36 A;  3K03 A;  3UT5 A;  1TGO A;  2OIG A;  4RNM A;  2R8G A;  2JEG A;  1QCE A;  1F51 A;  4WFA V;  4KXR A;  2GSM B;  4ZBM A;  2EJ3 A;  3CE2 A;  3JZF A;  3LDC A;  3PN1 A;  3GDE A;  4X8A A;  3JRW A;  5CA1 F;  4HYO A;  3ZRW A;  2PI4 A;  1OBG A;  1X59 A;  4JYC A;  1FXH A;  2CGN A;  1VQP V;  3N42 B;  3CB2 A;  4F4Z A;  2N05 A;  4P2Z A;  2C22 A;  1W96 A;  2V4R A;  1AI4 A;  2X0L A;  4X65 O;  1J95 A;  1N36 B;  1BHA A;  1K73 W;  2XD4 A;  2JJ2 G;  2ZDH A;  4GUN A;  2QM4 A;  5L1L A;  5KT4 A;  2W6P A;  4UCO A;  5KAF Z;  4YR0 A;  5C44 G;  3P32 A;  1EUD B;  1S0O A;  2WLK A;  5L1J A;  1DTO A;  2OH2 A;  2QWN B;  3GQC A;  3LDE A;  3K5O A;  4G27 B;  2D3O W;  4KUM A;  1O9H A;  4R8U A;  2E76 B;  1SA0 A;  4DR6 O;  3OGI B;  3F8N A;  1OCC B;  3MR6 A;  1Q43 A;  4B3M B;  3ABM C;  2W6O A;  5BR8 B;  2FKL A;  5JQG A;  2FPI B;  2UXB O;  3B40 A;  5JCO A;  3TW6 A;  4FZ0 A;  3K5M A;  4MV7 A;  2WLI B;  1AUX A;  3U9S A;  1XL6 A;  2FP4 B;  3V4Z A;  3MDS A;  4DV3 O;  1YJW V;  1UNN C;  1I94 H;  4MW3 A;  1GRJ A;  1HR0 O;  2E2I A;  3GIJ A;  3H9V A;  2JA5 A;  2ZIO A;  1EN5 A;  3RYC B;  1V54 C;  4A2B A;  1S03 G;  1Y1W G;  5KFE A;  2IMW P;  2PY5 A;  2VUM G;  2NU9 B;  4RAI A;  2ZE7 A;  3QFF A;  1XL4 A;  3BQ1 A;  3RW0 A;  3BVO A;  2YDE A;  1BE3 H;  4X62 H;  4PDL A;  2JK5 C;  4O2A F;  3ZJZ A;  3ZRX A;  3TQ1 A;  5CA1 B;  4PZ7 A;  1SF9 A;  1YEW A;  2YSU B;  4XYM B;  3GIP A;  3SPJ A;  1K9M W;  4YBZ B;  4JI2 H;  1GM7 A;  3A8T A;  1JMK C;  5H6Q A;  2V4D A;  2HR3 A;  2HHH B;  3GTQ A;  1J5E H;  2Q6A A;  2UUB B;  3CQZ A;  5TIS Z;  4YXW G;  4JI7 O;  1S3J A;  3L73 H;  1Q6H A;  3K08 A;  2QWQ B;  2KQX A;  3RVY A;  4LFA H;  5LP6 A;  4Q0Y A;  3G6V A;  1YSC A;  3F5T A;  1RK6 A;  4EYH B;  4NTY A;  5IDJ A;  3NR7 A;  3RF2 A;  4AQY B;  1T3N A;  5K3W A;  1K4C C;  1M57 B;  4FLT A;  3G80 A;  4FFB A;  3WFV A;  3QO7 A;  2SCU B;  1N34 H;  4NLG A;  2ATK C;  1W2B U;  1MSW D;  4HNV A;  5LP6 C;  2UXC H;  3HKB B;  2VQE H;  3M9O B;  3VBB A;  3WWH A;  2V5A A;  2BOC C;  4PA7 A;  1BGW A;  3JAW B;  4LSA A;  3CRC A;  3RBE A;  2WLL B;  1AR4 A;  2HJD A;  3WG7 C;  1QVG U;  4B3R B;  1M9N A;  4NB5 A;  5KFH A;  1FJG B;  3T5H A;  3AK2 A;  4TUY F;  1G6U A;  5KMG A;  3J81 N;  3AX6 A;  2X6A A;  1FKA H;  4MVZ A;  4L87 A;  3JRX A;  4DR5 O;  2GQS A;  4DV4 B;  3F7Y C;  2AU0 A;  3BCC H;  4ECT A;  5GTI Z;  5BWR A;  5H5N A;  3CC7 V;  3ML0 A;  2R92 G;  2V59 A;  4GT1 A;  4EBC A;  2RQ6 A;  3W7U A;  3BAA A;  5EWF A;  4XDJ A;  4JV5 O;  3D36 A;  5AG2 A;  3EFF K;  1ZUQ A;  4UB6 Z;  3CMA V;  2PI5 A;  1HNX H;  2EIJ C;  3UM7 A;  2WE6 A;  1QR9 A;  2ZM6 B;  2GBO A;  2EUL A;  1DLB A;  1GSO A;  4EEQ A;  2X6B A;  1AR1 B;  1NBM G;  3BHP A;  2DLN A;  1SS3 A;  4GKK B;  2O03 A;  1BZK A;  4M9U A;  3GB8 B;  4LFC O;  4DV1 O;  4YJ2 F;  4TM5 A;  5KG4 A;  2KG7 B;  2LFS A;  4X66 B;  3D36 C;  4PZ6 A;  4IWX A;  3Q8S B;  4Q44 A;  3H0G A;  4ECW A;  3GIM A;  1SZX A;  4QW9 A;  2WLJ A;  3E86 A;  4JI0 H;  2WLL A;  4OX9 H;  1HNW O;  1GYF A;  4EG0 A;  4EFB A;  5IWA H;  2Y4U A;  2YC0 A;  4O4L B;  2X0S A;  2Q0O C;  1CQJ B;  4Q20 A;  2UXD H;  5LOV F;  2P22 C;  3AG1 B;  3HKE B;  4NXN B;  3RR5 A;  3PW5 A;  5L3E A;  2RN9 A;  1V55 B;  5JVD B;  2PMZ A;  4LSX A;  1O9G A;  3BY6 A;  1KC8 W;  2R8K A;  4LFB O;  2XGQ A;  1JJO A;  2ZR3 A;  5KFQ A;  3ZRS A;  3HO8 A;  4FGR A;  1Q7Y W;  2YID A;  1GO3 E;  3W7X A;  3CXC U;  5KX5 F;  4LH6 A;  2Q0A A;  3C90 A;  4UXN A;  4JYA O;  3AG4 B;  5GON A;  2XCP A;  4O2A A;  3SGI A;  3CP1 A;  1XMO H;  2NU6 B;  3L4K A;  4TUY B;  1Y74 A;  3HOZ G;  1NI8 A;  3GIL A;  2FMA A;  3K04 A;  4X89 A;  3R5H A;  1ZQ7 A;  2DAA A;  4FFK A;  5DQH A;  2GTS A;  4B3T H;  1WP8 A;  2LFR A;  4UCV A;  3G6E V;  4ZHQ F;  1W59 A;  3LNM B;  3O65 A;  4ECQ A;  3H1H H;  4DL4 A;  3I56 V;  3GV7 B;  4GZR B;  2NUA B;  2VR1 A;  5BPF A;  4J9Z B;  3V6H A;  1JKJ B;  1OCO C;  1OCZ B;  3VNN A;  1SZT A;  2C00 A;  3ZX6 A;  4PBC A;  4LF4 O;  2P90 A;  2QWR B;  2R72 A;  4DUY B;  2IU0 A;  3ABL B;  2R9I A;  3L4J A;  2ZQM A;  4LCU C;  2A7W A;  4LF5 B;  3NUA A;  1K83 A;  1YXB A;  2ZE6 A;  3IC9 A;  3QTC A;  4DLK A;  1N0J A;  1Y76 B;  1CKO A;  3BRC A;  4JF3 A;  4A3J G;  1VQN V;  5B3S C;  4ME6 A;  4O81 A;  5LMN H;  2IBK A;  1C3O A;  4MVS A;  2E74 B;  4DV2 H;  3Q4H B;  4MTE A;  5C3E G;  4B7K A;  2BSK B;  1FPO A;  1BHB A;  3CYO A;  1I94 B;  4I9Q A;  1UJW B;  4YJ3 F;  5KHJ A;  2HG8 A;  1PD3 A;  4DR7 H;  1OWT A;  3GIQ A;  1GM9 A;  2FTK A;  1EKV A;  4FM9 A;  5DM6 V;  1LUW A;  2C28 A;  1I08 A;  4A3M G;  1OCR B;  4R50 A;  1R6N A;  5LL6 Y;  3DAA A;  3WO1 A;  4DRX A;  2JIZ G;  1YJN V;  2BTO A;  3CEB A;  4YHH H;  4D7T A;  2VWK A;  5KFR A;  2WAM A;  1N33 O;  2QK4 A;  2ZXW B;  4YJ2 A;  2QSA A;  4X62 B;  2JRI A;  4C2M A;  1H2L A;  2JJ1 G;  5LMU H;  3AG3 B;  3AK1 A;  1VQO V;  1L8D A;  2W6Q A;  2WA3 A;  5EBW C;  3MD0 A;  1R3L C;  3ABK B;  4JI2 B;  3EHB B;  1HDJ A;  4DV6 O;  5JJJ B;  2YS6 A;  5LYJ F;  4PI2 A;  3DGE A;  4KFM A;  4ZHQ B;  5DG7 A;  1BQ0 A;  1S0M A;  2W6I G;  5LOV A;  3Q4H A;  5EWE A;  2BSK A;  2OIE A;  4MVO A;  1QNM A;  4TV8 B;  4IIJ F;  3G6B A;  2VQF H;  2UU9 H;  4TQS A;  1IYD A;  4TOI A;  5LHI A;  2RNB A;  4LFA B;  4H44 B;  1XNQ H;  2P67 A;  2Y0S E;  4DXW A;  2ZE8 A;  3B4S A;  2QM8 A;  5KX5 A;  1KQS U;  2CW8 A;  1QBZ A;  1X4T A;  1I3Q A;  1ZX3 A;  3PZP A;  1MZE A;  4Y8V B;  1PKX A;  3OUF A;  4CKB A;  1N34 B;  4LF6 H;  5FJ8 G;  3SPG A;  1TAE A;  2UXC B;  3THO A;  2VQE B;  1WAZ A;  5EC1 C;  1NKD A;  1I7N A;  3LUL A;  5L3B A;  2NVX A;  1JDB B;  5L1I A;  4DV0 H;  5FLM G;  3G6X A;  4YJ3 B;  2PVP A;  3RN4 A;  4LWS A;  1IBL H;  4P30 A;  2A3Q A;  3RT3 C;  3AG3 C;  4I50 B;  3CJH B;  4Q4D A;  4TQR A;  4I4T A;  3GB7 C;  3CCJ V;  4RUC A;  2ZNI A;  1CXZ B;  1GK9 A;  2B5U A;  3ABK C;  4GX5 A;  4Q8F A;  3PO3 G;  4LF8 H;  4RB3 C;  1I0H A;  1HNX B;  3JD4 A;  4EFE A;  4RAY A;  2JS3 A;  1UC9 A;  1EN4 A;  1PL4 A;  1XI1 A;  3SJA C;  5HFL A;  4N23 A;  5DGH A;  3T9A A;  5EZY F;  2F1M A;  2RGV A;  1VQ9 V;  4A3I G;  2DE0 X;  1RM1 C;  1PNL A;  5BWT A;  5LYJ B;  3S3X A;  1H38 A;  2JA7 A;  1IUR A;  1J5E O;  2C2D A;  2ARH A;  3GTL A;  4E2L A;  4YB8 B;  4JI0 B;  2PTM A;  4J9O A;  3BPZ A;  4JTA B;  5C8Y F;  2C35 B;  4Z2W A;  2NVY A;  4QSH A;  4YJ3 A;  1BMF G;  5DIS C;  4JI5 H;  2UXD B;  2F4V H;  3P3P A;  3KYH C;  1XDN A;  3RB0 A;  2CW7 A;  3EVK A;  3KHR A;  3FB7 C;  4UVC A;  2CH7 B;  4JI4 O;  3BFR A;  2W9B A;  5IYD O;  3T1H B;  1B04 A;  3VMM A;  3OGC C;  1PPJ H;  3FAV A;  5KFP A;  4ABM A;  4DL6 A;  2E5L O;  1Z2P X;  3E89 A;  2QJ1 A;  3CWB H;  2IH3 C;  2FPP B;  1Y6X A;  3DSQ A;  4XDL A;  1VQK V;  3HKZ A;  1SC5 B;  2EIL C;  4JAV A;  1E4F T;  3AG2 B;  1VMG A;  1XMO B;  2FB5 A;  2QKS A;  3KKY A;  1YZB A;  2YEV A;  3CCR V;  5F9L A;  3UZB A;  3E22 A;  4PWQ A;  2J6T A;  4R7R A;  3B2E E;  1EHI A;  4B3M H;  2EIN B;  3TIN A;  5BR8 H;  1WH2 A;  5EDW A;  5IYZ B;  3GIK A;  2YYA A;  1R1B A;  1NR1 A;  4CMD A;  4QJF B;  2Y0P A;  3JAM W;  2IP4 A;  4U7O A;  1GSA A;  4PA9 A;  4D7S A;  2N04 A;  1H2K A;  2XAS A;  2VPS A;  3JSL A;  4IIJ A;  2YUA A;  5T14 A;  2XAF A;  5IYB O;  4BBS G;  3BAC A;  3L74 H;  3T7A A;  3GID A;  2P7T C;  5IE9 A;  1IBK O;  3LML A;  1BGY H;  4UCU A;  4FLW A;  1I5Y A;  2XTA A;  3RYH A;  3Q8P B;  3E8G A;  3CRA A;  4O3S A;  5I5S A;  1G2W A;  3A2F A;  2PYL A;  4GKJ O;  4J9R A;  1JA8 A;  5EZY B;  3MFI A;  2O57 A;  3GII A;  2XUM A;  4MVU A;  4XBF A;  3RYF B;  5D5Q A;  1JXL A;  3DXR A;  1AUV A;  3F5W C;  2CKZ B;  4JI6 O;  1TUB B;  4U3F H;  2R87 A;  5C8Y B;  4O7N A;  5CB4 B;  5LMN B;  1KYO F;  4B08 A;  4AYB E;  1OBD A;  5JUM A;  1XNR H;  2B63 A;  4DV2 B;  1FVI A;  5CA0 F;  5LHG A;  5BWU A;  3G67 A;  3G4S V;  1KJ8 A;  3GTO A;  3T9B A;  2Y48 A;  5JVL A;  1AP6 A;  1C30 A;  1Q3E A;  1I1L A;  3OUU A;  1ZLZ A;  4Q43 A;  1ENV A;  4QPJ A;  3RJ0 A;  4DR7 B;  4I0X B;  1B33 N;  3J80 W;  4HNU A;  4ECY A;  2XAH A;  4RAZ A;  4BW5 A;  4RQF A;  2UUC H;  5EIB C;  4CHI A;  3UO2 A;  1WA8 B;  4YR3 A;  5LA6 F;  3RB3 A;  1FD9 A;  4MTO A;  4YHH B;  1GN4 A;  3SE7 A;  1KMI Z;  1MZF A;  4GC6 A;  1H2M A;  2VS0 A;  2QEX V;  3CC2 V;  2W6N A;  4O7S A;  5IYC G;  2CK3 G;  3KAL A;  3HR0 A;  5JJE B;  5LMU B;  2WB1 E;  3K9A A;  3CCU V;  3OR6 C;  3MJF A;  5FD6 A;  4B3T O;  3P3N A;  1S76 D;  5KT5 A;  2JEX A;  3IC7 A;  3OHB A;  2CZG A;  2AHZ A;  1FJG H;  2XOK G;  4I7H A;  4MT8 A;  5CA3 A;  1GO3 F;  4DR1 O;  2P4V A;  2MK3 A;  3JD0 A;  2BQU A;  4CS3 A;  2OWO A;  5EWG A;  2UU9 B;  2VQF B;  3H1L H;  2K1E A;  4DUZ O;  2COG A;  1E1Q G;  3AK3 A;  1YTF D;  5KG0 A;  1JFF A;  5A2Q N;  1XNQ B;  3ZMV A;  1RPO A;  2XGP A;  5HV6 A;  1I6U A;  2BCC H;  3N2K B;  4EB6 B;  1HW7 A;  3ZHU A;  2RJZ A;  3OMN B;  2IBZ H;  4GKK H;  3UCS C;  4LF6 B;  3ZMU A;  4LNU A;  1WR2 A;  3ETQ A;  4DW1 A;  2W8L A;  5KFB A;  3BQ0 A;  5KUM A;  5CA0 B;  4Q45 A;  3K3W A;  2HG5 C;  4IHJ B;  4FFP A;  4A3D G;  2P4K A;  4DV0 B;  5B1B C;  2W0X A;  4WBN A;  2L6L A;  1K5Q A;  3MHS C;  1IBL B;  4FS2 A;  3LP8 A;  1NU1 H;  3W7W A;  1IX9 A;  4J7K A;  2CFM A;  1ZAU A;  2Y4R A;  4K3A A;  2YU9 A;  4JYB A;  4A3K G;  3EPG A;  1ROP A;  1XHX A;  3K0G A;  4DV5 H;  3W1G A;  2R6F A;  5K2M A;  3HOX G;  2PBZ A;  2AHY A;  2COJ A;  4JI1 H;  3K0D A;  3KG2 A;  3LSQ A;  4W4L A;  4DO2 A;  2EIY A;  1CP9 A;  1WP7 A;  5D1O A;  5L1K A;  5L3D A;  3RYI A;  2C2A A;  5LGN A;  1NTK H;  3K06 A;  3OEH G;  1XRE A;  3ETJ A;  3CCV V;  2AGP A;  4UVB A;  2W9A A;  1RJQ A;  3K59 A;  3CPW U;  1KJ9 A;  2NLJ C;  5DLF A;  4O4J A;  1BT8 A;  3NBZ B;  4YP3 A;  2ZKO A;  2CDY A;  2QTO A;  1UFI A;  3UO3 A;  3R5X A;  1I5X A;  3ASN C;  1E4E A;  4MAM A;  1S5L Z;  4J7Z A;  4HAM A;  3FB5 C;  1AJN A;  4JI5 B;  1PNK A;  2XND G;  2F4V B;  2CAZ C;  4WFH A;  4G3I A;  4A3F G;  4UB8 Z;  1S77 D;  4X64 H;  2QWP B;  3JAK B;  3OUS A;  4HQ6 A;  2DW4 A;  5KT6 A;  5LA6 A;  3FKI A;  4DR4 B;  1E1R G;  4MVR A;  4FFL A;  3FYE B;  4KHP O;  1JX4 A;  1VS0 A;  1RYS A;  4F50 A;  4DUY H;  5KG6 A;  4X20 B;  4BXX G;  3CVZ A;  1SET A;  5IJ9 B;  4LF5 H;  4O83 A;  2QM7 A;  1O75 A;  2DMX A;  2HHF B;  2JA6 G;  3PO2 G;  5I5X A;  3TY8 A;  1KU9 A;  4DV7 H;  4BIZ A;  1S9F A;  2R9A A;  1YTF B;  2OCC B;  3QZ7 A;  3RFC A;  3Q8R B;  1CKN B;  4LR3 A;  4JI7 B;  4UVA A;  4F4Y A;  1AP5 A;  2LO1 A;  3K58 A;  5ITZ B;  4LF7 H;  1BNC A;  1K4D C;  3BAB A;  5CAE B;  4LF8 O;  3RAQ A;  1AIL A;  2OTL V;  2DQ0 A;  3OUZ A;  2QR4 A;  5JCO C;  4IRC A;  1M5I A;  3HT5 A;  3LQS A;  4CZZ A;  2QDO A;  4GLW A;  1L0L H;  1JCH A;  3RVZ A;  2NR5 A;  4CS4 A;  1FFX B;  2EIM B;  4JYY A;  5GTH Z;  3WB1 A;  3JD3 A;  4FBU A;  5KFF A;  5KFK A;  1VF7 A;  4A3E G;  5IJ9 A;  5KFW A;  3KHL A;  3OD4 A;  4O4I B;  1FXK B;  1SYX B;  1DIK A;  4MVM A;  4MA0 A;  5KAI Z;  3L71 H;  2R8H A;  4IYH A;  3GV5 B;  1N36 O;  1XNR B;  1GMG A;  1NVP B;  3A0B Z;  1IYE A;  4J0M A;  3T1Y O;  4JI3 O; 
#chains in the Genus database with same CATH homology
 5FPR A;  4U3J A;  4HNA B;  3VNN A;  2JS5 A;  4PZ8 A;  3K3V A;  5KHG A;  4CC5 A;  1I7F A;  2R72 A;  4DUY B;  5J2U A;  4OX9 B;  3L4J A;  4IIJ B;  3SR2 C;  4LF5 B;  4X65 B;  3QTC A;  1NT2 B;  5IWA B;  1A0I A;  2UUC B;  3RYC A;  1ZHQ A;  3UT5 B;  4FLZ A;  3OTF A;  3BRC A;  1CKO A;  4NXM H;  1N36 H;  4LFC B;  4DV1 B;  5LMN H;  3T1Y H;  4DR3 H;  4JI3 H;  3NC0 B;  3RYH B;  1P8L A;  4DV2 H;  2F93 B;  2GV9 A;  2F95 B;  4MTE A;  3QF7 A;  4APM A;  1I94 B;  5CA1 A;  4I9Q A;  5KHJ A;  1HNW B;  4K0K H;  4X1I B;  4CC6 A;  1P16 A;  4DR7 H;  4PI0 A;  3N2K A;  4EB6 A;  1L2Z A;  3K5L A;  2HGS A;  4B3S H;  3CHX A;  4DR6 B;  2Q2U A;  4FM9 A;  1RSO A;  2WYO A;  3JAS A;  4DR2 H;  5K1X A;  2UXB B;  4DRX A;  3S24 A;  2BTO A;  2YCH A;  4YHH H;  4D7T A;  2VWK A;  1SEI A;  1WPB A;  2PYJ A;  1HNZ H;  4DV3 B;  4YJ2 A;  4X62 B;  5CA0 A;  3W5O A;  4IHJ A;  3QG5 A;  4HBN A;  1HR0 B;  5LMU H;  4B3T B;  4CS2 A;  2Q2T A;  1L8D A;  4TQF A;  2VOB A;  3WB2 A;  3RTX A;  4NVP A;  4JI2 B;  3K5N A;  5J2T A;  5JJJ B;  4PI2 A;  1SA0 B;  4DR1 B;  4ZHQ B;  4LF9 H;  2JVD A;  1H2S B;  5IT9 W;  5LOV A;  4I55 A;  5JQG B;  3J7A K;  1N33 H;  4K8Z A;  3HKB A;  4DUZ B;  4TV8 B;  3SJC C;  3M4I A;  2UU9 H;  2VQF H;  1X9N A;  2YIA A;  1S68 A;  5D1P A;  4TOI A;  4LFA B;  3JAW A;  1QQC A;  5JH7 B;  1XNQ H;  3C0F B;  2HVS A;  5KX5 A;  4MTD A;  4FM2 A;  3DF7 A;  4DV6 H;  2CW8 A;  1X4T A;  3VQW A;  3T1Y B;  4JI3 B;  2KKW A;  1N34 B;  2YI9 A;  4Q6G A;  4ZOL B;  4LF6 H;  4CH5 A;  4DRF A;  1TAE A;  2UXC B;  3JAT B;  3RWR D;  4DV5 B;  4E6N A;  2HHH H;  3THO A;  2VQE B;  3T1H H;  3WB0 A;  2UUB H;  3HKD B;  5EOY A;  4JI1 B;  2UUA H;  1JFF B;  4O2B A;  1M0W A;  4DV0 H;  4B3S B;  4RZQ A;  4PHZ A;  4YJ3 B;  2BTQ A;  4K8X A;  2R70 A;  3JAR B;  3JAK A;  4AQY H;  1IBL H;  1Z5W A;  5KHI A;  2E3C A;  4I50 B;  2YI8 A;  4I4T A;  4LNU B;  5IJ0 A;  2ZNI A;  3GJX B;  4YY3 H;  2PZS A;  4UCS A;  4GLX A;  2PGG A;  4X20 A;  4A2A A;  4RB3 C;  4LF8 H;  4O4H B;  1Q8I A;  1HNX B;  4EFE A;  5LP6 B;  4RAY A;  4O4L A;  1XI1 A;  3SJA C;  4B3R H;  5BMV B;  3HKE A;  4WBN B;  3HXL A;  4X64 B;  3JAL A;  3HKC A;  4DR5 B;  2F1M A;  5JVD A;  2RGV A;  4TQD A;  4FFB B;  4ZI7 A;  1CKN A;  5LYJ B;  2HVQ A;  2VWJ A;  4DV4 H;  2Q7H A;  3N41 B;  4AHC A;  3HKD A;  1SKV A;  5ITZ A;  4JV5 B;  3U0Z A;  2EX3 A;  4JI0 B;  2PTM A;  3BPZ A;  3JSN A;  3N6X A;  3OTO H;  4YJ3 A;  5DIS C;  1QHT A;  4JI5 H;  2ZM6 H;  4PDB A;  2ZNJ A;  2UXD B;  2F4V H;  3CSX A;  4F6R B;  5D1O B;  3KYH C;  1XDN A;  5KMG B;  4DV7 B;  3RYI B;  2CW7 A;  1N32 H;  4TUY A;  2MCT A;  2FE3 A;  1FFX A;  3VQY A;  4X66 H;  3T1H B;  1B04 A;  4KHP B;  4UCR A;  4O4J B;  4LF4 H;  3KXY T;  2HIX A;  2HEP A;  1Z2P X;  2UUA B;  2Q7G A;  2QJ1 A;  4LF7 B;  2JGU A;  3DSQ A;  4BWA A;  4O4I A;  3IG0 A;  3FMA A;  3MWM A;  1E4F T;  5BMV A;  1TVK B;  3N40 P;  1XMO B;  2YIB A;  3E22 A;  4NXN H;  4R7R A;  4JI4 H;  1BJT A;  3B2E E;  3BA9 A;  4M7E A;  5LL6 b;  4B3M H;  5BR8 H;  4HNA A;  4DK0 A;  1WH2 A;  4LFB B;  3ZS8 C;  5IYZ B;  5LA6 B;  2E5L H;  4EQ5 A;  3JAM W;  3U11 A;  4LF8 B;  4DK1 A;  4D7S A;  4JYA B;  1XQ8 A;  2VPS A;  3JSL A;  4IIJ A;  3UT5 A;  4TV9 B;  1TGO A;  4X1Y B;  3ZED A;  5FNV B;  3LML A;  3TY9 A;  3N43 B;  4UCU A;  2XIG A;  4JI8 H;  4FLW A;  3RYH A;  3PN1 A;  3GDE A;  3A2F A;  2PYL A;  4X1K B;  5EZY B;  3RIZ A;  1Q5O A;  4X1I A;  3N42 B;  3CB2 A;  3RYF B;  5D5Q A;  4CH3 A;  5LXT B;  2XHB A;  3OTO B;  1TVK A;  1TUB B;  5GON B;  4O2A B;  4NXM B;  1N36 B;  1IBK H;  5C8Y B;  5CB4 B;  5LMN B;  4B08 A;  1N32 B;  4DR3 B;  1XNR H;  5KHH A;  2QM4 A;  4DV2 B;  1FVI A;  2HIV A;  4GKJ H;  2ZJT A;  4UCO A;  3SJB C;  4LF4 B;  1Q3E A;  4K0K B;  3RJ0 A;  4DR7 B;  5EIB D;  4JI6 H;  3J80 W;  2W57 A;  4RAZ A;  3K5O A;  4X65 H;  2ZIN A;  2UUC H;  5EIB C;  1O9H A;  1SA0 A;  2YXL A;  4DR2 B;  4ZHQ A;  3F8N A;  4CH6 A;  1Q43 A;  4B3M B;  4FLV A;  5BR8 B;  4YHH B;  5JQG A;  1KMI Z;  4X1K A;  3VQV A;  3N2G B;  5JCO A;  1HNZ B;  3K5M A;  4TV8 A;  4U3J B;  4MV7 A;  1WNS A;  3KAL A;  3ICX A;  5JJE B;  5LXT A;  5LMU B;  1I94 H;  5JH7 A;  1Z5V A;  1M93 A;  5J2U B;  5FD6 A;  1DGS A;  3EYY A;  2ZIO A;  3RYC B;  4A2B A;  1FJG H;  1D5A A;  4LF9 B;  1TA8 A;  4I7H A;  1S03 G;  4ZOL A;  2UXB H;  5EYP B;  1SQG A;  2PY5 A;  1N33 B;  3JAT A;  1M0T A;  2WDT A;  5A2Q W;  4CS3 A;  2OWO A;  2UU9 B;  2VQF B;  1WN7 A;  4DV3 H;  4X62 H;  3BA8 A;  4KL1 A;  1JFF A;  4LH7 A;  5CA1 B;  1XNQ B;  4PZ7 A;  1HR0 H;  1YEW A;  1I6U A;  3N2K B;  4DV6 B;  4EB6 B;  3JAR A;  1HW7 A;  4JI2 H;  2RJZ A;  3JAS B;  4GKK H;  4DR1 H;  1JMK C;  4I50 A;  3N2G A;  2IM9 A;  4LF6 B;  4DRX B;  4LNU A;  2V4D A;  2HHH B;  3ETQ A;  1J5E H;  2UUB B;  3RGB A;  4DUZ H;  3U10 A;  4YJ2 B;  4DR4 H;  5CA0 B;  4IHJ B;  4O4H A;  4JI6 B;  4LFA H;  5LP6 A;  4DV0 B;  3N44 B;  4Q0Y A;  5KHK A;  5D5P A;  4WBN A;  3RF2 A;  4AQY B;  1IBL B;  4BWS C;  5J2T B;  5EYP A;  4FLT A;  4FFB A;  3MAQ A;  2OYQ A;  2CFM A;  1ZAU A;  5LYJ A;  3KAJ A;  1N34 H;  3QWU A;  1SQF A;  5LOV B;  4I55 B;  4YY3 B;  5LP6 C;  2UXC H;  1XHX A;  4JI7 H;  2YIB D;  4DV5 H;  3W1G A;  3HKB B;  2VQE H;  5FPO A;  4CH4 A;  3L2P A;  1T5E A;  5FD5 A;  3IAY A;  4JI1 H;  1BGW A;  3JAW B;  4L8J A;  4LSA A;  1IBM H;  3J81 W;  4B3R B;  4AIL C;  1P49 A;  1FJG B;  4F6R A;  5D1O A;  4GYC B;  5KX5 B;  5JJN B;  1G6U A;  5KMG A;  3FFQ A;  2F66 C;  3RFR A;  3RYI A;  1FKA H;  4FLX A;  1XMQ H;  4UFZ A;  4DV4 B;  1E4G T;  3K59 A;  4O4J A;  3NBZ B;  4FM0 A;  3H20 A;  2RQ6 A;  4ETS A;  3BAA A;  4LMY A;  3LNN A;  5K1P A;  1HNX H;  4JI5 B;  4O2B B;  2WE6 A;  2ZM6 B;  3NBY B;  2F4V B;  2CAZ C;  2ZIM A;  4EEQ A;  2BTQ B;  3BHP A;  4GKK B;  2O03 A;  4X64 H;  3JAK B;  4DR5 H;  3GB8 B;  4RB0 A;  5IYZ A;  4X66 B;  5LA6 A;  1J5E B;  4PZ6 A;  2P5O A;  4I4T B;  5IJ0 B;  4DR4 B;  1XHZ A;  1VS0 A;  4JV5 H;  2KSW A;  4DUY H;  1XK5 A;  4JI0 H;  4X20 B;  4OX9 H;  4TV9 A;  3CVZ A;  4RB2 C;  4X1Y A;  1GYF A;  5IJ9 B;  4LF5 H;  4EFB A;  5IWA H;  1O75 A;  4O4L B;  5FNV A;  2UXD H;  4ZIB A;  2P22 C;  3HKE B;  2Q7E A;  4NXN B;  1KU9 A;  4BW9 A;  4JI4 B;  3RR5 A;  3TY8 A;  3JAL B;  3HKC B;  4DV1 H;  4DV7 H;  4LFC H;  2R9A A;  5JVD B;  3M7M X;  1CKM A;  4LSX A;  1O9G A;  3VQX A;  4LR3 A;  5EZY A;  4ZI7 B;  4JI7 B;  1CKN B;  2E5L B;  1AN7 A;  1JJO A;  5FLX W;  4KHP H;  3RYF A;  3K58 A;  5ITZ B;  4LF7 H;  3BAB A;  4LH6 A;  1IBM B;  2Q0A A;  1HNW H;  1TUB A;  5GON A;  3K57 A;  4O2A A;  5C8Y A;  5CB4 A;  3SGI A;  4DR6 H;  5JCO C;  2ZCE A;  1XMO H;  1M5I A;  2HVR A;  1XMQ B;  4FLY A;  1Z2N X;  4JI8 B;  3L4K A;  2PUS A;  3KAK A;  1M4U A;  1Z2O X;  4TUY B;  4CS4 A;  3UQ8 A;  4LFB H;  1FFX B;  4IAJ A;  4UCT A;  3WB1 A;  4JYA H;  1V9P A;  4FVM A;  4FM1 A;  1VF7 A;  4B3T H;  5IJ9 A;  4RB1 A;  4O4I B;  4UCV A;  2VUG A;  3TY5 A;  1SYX B;  3RGX A;  4MV9 A;  1IBK B;  4FLU A;  1S5J A;  1XNR B;  2RGR A;  3E22 B;  4J0M A;  3RGZ A;  1ZHS A;  3W1B A;  4GKJ B;  1MZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...