1TA8A

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA ligase, NAD-dependent
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 100
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ta8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1ta8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1ta8A02
2HVRA 4X62B 3TY9A 4TOIA 3VNNA 4EEQA 1FVIA 1HNZB 4LF9B 3GDEA 4EFEA 4AQYB 4UCOA 3T1YB 4UFZA 4LF8B 4UCVA 1A0IA 3NC0B 2HIVA 4EQ5A 3SGIA 4LFBB 4DR6B 1N34B 4E6NA 4YHHB 4DR3B 4DR1B 4GKKB 4UCUA 3BA8A 4JV5B 1I94B 1IBKB 2Q2UA 1TA8A 4K0KB 4JI3B 1P16A 4UCSA 1XK5A 4LF6B 4DR4B 1ZAUA 3GJXB 4LFCB 2ZM6B 1HNXB 2UXDB 3W1GA 1TAEA 4LF7B 2VQEB 4DV2B 5BR8B 1CKNB 3RR5A 3BA9A 1XMQB 4DV1B 4X64B 1CKOA 3W5OA 4B3SB 2UXBB 1CKNA 4DV4B 4JI2B 4KHPB 5LMNB 1HR0B 1P8LA 1CKMA 2UUBB 3L2PA 2CFMA 4LF5B 4UCTA 5D1OB 4DUZB 4JI5B 4NXNB 3UQ8A 3OTOB 4DV0B 1IBMB 1HNWB 4DRFA 1XDNA 5D1OA 2Q2TA 1DGSA 4UCRA 4DV6B 1N33B 1XNQB 2VUGA 4DR2B 3GB8B 4DR5B 4JI8B 3JSNA 1VS0A 4JI7B 3NBYB 5LMUB 4DR7B 3NBZB 4X65B 2HHHB 1XMOB 4LF4B 4B3TB 4DUYB 3QWUA 1X9NA 4JI4B 1N36B 1B04A 3KYHC 2HIXA 3JSLA 5FPOA 4CC6A 3BAAA 4EFBA 1V9PA 4OX9B 4JI6B 4LH6A 1N32B 2E5LB 3W1BA 3RTXA 4DV3B 2UXCB 4PZ7A 4NXMB 5DISC 4CC5A 2UUAB 3TY5A 1XNRB 4JYAB 2HVQA 1S68A 5FPRA 2UUCB 3BABA 4PZ8A 3TY8A 4B3MB 1FJGB 1IBLB 4DV7B 4JI0B 4JI1B 4B3RB 3T1HB 4DV5B 4PZ6A 3S24A 4LH7A 2UU9B 1J5EB 4GKJB 4YY3B 4X66B 3PN1A 4LFAB 5D1PA 2HVSA 2F4VB 2VQFB 2OWOA 4GLXA 5IWAB
chains in the Genus database with same CATH superfamily
3T5LA 5A9GA 5ITZB 2YIBD 1SERA 4NZNA 2R93A 4MTDA 2QKCA 1GMGA 4A2AA 4JI1H 2R93G 2DIKA 4QJFA 2H94A 2EINC 2YSUB 1IURA 3ASNC 2KSWA 2QM8A 1DV2A 5KFQA 2BQ3A 3GB7C 4O2AB 2YI8A 4RCNA 3G6BA 4DR3B 2E5LH 4MS2A 1I94B 3T9CA 1NS1A 3HOUG 4DRXB 5IYZA 2NR5A 4YP3A 1B6QA 3AG2B 4FZ0A 4H44B 2Y48A 5IYCO 3K5MA 3U11A 1XQ8A 2VA3A 3L70H 2Y4TA 4O4HB 1MZFA 2HJDA 1Q86W 1RSOA 4J9ZB 3E89A 3TGUH 1CKNB 1L0NH 5JCOC 3HKZE 5EBMC 3S3WA 4XX0B 1JOYA 2GLTA 2DJVA 3JASA 4LF4O 1XMOO 2AZ0A 2I8CA 3W5OA 2R9RB 3B09A 3LDDA 4YJ2A 1VQLV 4QWDA 4ZI7A 1R6NA 3CC7V 3SYQA 2DYSB 2COIA 4E4TA 3H0GG 2CFMA 2A7WA 4NZMA 3MR5A 3UQ8A 4BIZA 2ZKOA 4UUJC 4UVCA 2ZDQA 4ECYA 3G6EV 3U9TA 5EWEA 3FD9A 4DL3A 2C28A 3IGAC 4WFBV 3CQZA 3OUUA 4MVMA 5I5SA 5KT2A 5EZYF 5KT5A 4TQSA 3QWUA 4NTWA 4I55B 4JI4B 3H1JH 5CA0A 1GYFA 2FJZA 3LSQA 3SJBC 4FLVA 4A3FG 4EGJA 2HVJC 1I5XA 2P6JA 3IG0A 4DR5H 1M4UA 4EB6B 1V54B 1SRYA 4MW3A 4FLYA 4LF9O 5DG9A 4NXMB 4A3JG 1BT8A 3TY5A 2R7ZA 2A3QA 2UXBH 4O7RA 1EN4A 2O03A 2R7ZG 1IXMA 1QNMA 3JAKB 1E4FT 2I80A 4U3FH 3KXYT 2F1MA 4YY3O 4KP4A 3L74H 4RAYA 2C22A 3NUAA 5KG2A 3EYYA 4QE9A 4CH4A 1JVMA 4LFCO 5C1PA 5GW7A 1S5HC 5KG1A 2V59A 2CDYA 5JVLA 2E2IA 2R9IA 1YHQV 4PI0A 3K79A 4Q4CA 3RB6A 1K5SA 5EYPB 4LF8B 2JEUA 3ZRVA 4WFAV 4KHPO 2BTOA 4PA7A 1VQ5V 4FFMA 3QNEA 4UB6Z 4O7WA 4HAMA 5A2QN 3GIJA 4LF5O 4DR3O 3CXHF 4DUZO 4YHHB 3CMEV 1I94O 1ENVA 3RWRD 4X1IA 4J9QA 1HNWO 2AU0A 1JJOA 1YVWA 1BS3A 1Y6XA 4BAYA 2FK3A 4AYBE 2P22C 2ZINA 5FLMG 1S97A 3GTMA 4BW9A 2YS7A 1I7LA 2PZSA 1YXBA 4BIOA 2ZD9A 2ZE8A 2ZE7A 1WR2A 3CCEV 3RAXA 4QWAA 5KX5F 5JQGF 1GO3E 1SC5B 1Q90D 2LGWA 4Z1VA 4DV1B 5K2MA 4CMFA 4HYKA 1ZETA 1I2KA 2GSMB 4EYIB 3OGIB 3L71H 2EILB 1VQNV 1WRVA 1SQBH 2FPPB 4HBNA 2NN4A 4O3NA 4ZHQF 3R5HA 2PYLA 4X66H 2ATKC 3EXAA 3M9OB 3N6XA 4C5BA 4UCTA 1US6A 3RYCA 2CW7A 2BOCC 2XAQA 4L8JA 4GX5A 1Q6IA 2A0LA 4X8AA 3RYIB 3AW8A 2HKOA 1M57B 2PN1A 3N27A 3J7AK 1UFIA 4FLWA 4DV6B 3WNZA 3QVNA 4R7CA 2DAAA 1WA8A 5B1BB 2DYRC 3JSNA 3N41B 3N40P 4J9OA 3NXSA 5J9PC 2DPIA 3F7YC 4A93G 5LA6B 4ECQA 3ZMZA 4B3TB 4JV5H 2F93B 1M6VA 2YYAA 3KYHC 4JV0A 1JX4A 4DR4H 1MZBA 3CCVV 1HNXH 2QB5A 3DXRB 1VARA 4X88A 2OLSA 1Y66A 1U97A 3RTXA 1IYDA 3UYYA 3FX7A 4M7EA 4Y8VB 4X20A 2UUAB 4RUCA 2ASJA 3IC7A 5H9CA 5KFOA 3AG1B 5ITZA 3LP8A 4RU9A 4FM9A 4WHXA 3T5HA 2CTPA 2ZJTA 4Q4DA 3RN4A 2UUBH 3GIPA 4WBNB 5IY5B 2EJ2A 5L3EA 3CC4V 2JA8G 3H3VH 4DV5B 1SCUB 3K0GA 3N2KA 4HN2A 3D36A 4FFNA 2ZNJA 3QO5A 1YEWA 1UC8A 1FKAH 4PV1B 4O7VA 2HGWA 4I0XA 5LOVA 5KA6A 1W0JG 4HR7A 3G71V 4I50F 5C44G 5IYDO 4A3MG 2Q69A 3D3IA 2COGA 1JJ2U 1QBZA 1I0HA 2Y69C 1HNZB 2Z02A 3G6YA 2QA4V 4UCOA 3P3NA 1JPXA 1KT8A 5CE8A 2KKWA 4P9PA 2WYOA 2DWEC 2ASLA 5JH7B 4EGQA 4IIJB 2QWOB 4ED7A 1MG1A 1R3LC 1SF9A 1ZX3A 2A06H 5LP6C 1EYZA 3V4SA 4GKKB 2OYQA 2KQXA 4IAJA 3GTPA 2ZQMA 3CB2A 2JJ1G 4DV3H 3MFHA 3KAJA 1GSHA 3JZFA 2XCPA 4JI8O 2CTRA 4ZIBA 3RB4A 4DO2A 3BQ0A 2R8GA 4C7UA 4ETSA 5KFJA 4HQ6A 2R82A 4EBEA 4YAKB 4DUYO 2CGNA 2DWCA 5LHGA 1J5EH 1SESA 4XYMB 2R72A 3GWKC 3L72H 2BE3A 4UV8A 3EFFK 4FLUA 4TUYB 1ULZA 1XHZA 4LC1A 2XGPA 1JDBB 1FXKB 3IFXA 2BSKA 4ED2A 2UUCO 4GZRB 4A2BA 1EM1A 4F6RB 4B3SH 1AR4A 2WLLB 5LP6F 3FKSG 2C2RA 3GTQA 2EJRA 1GRJA 3BHPA 4CH3A 3HB3B 1EZVH 4DV7O 3CX5F 4DR6H 4B3TO 2WLKA 3MD0A 2KG7A 2YZLA 1XHXA 4NXNH 3HOYG 1I1LA 2ETNA 2ZIOA 3BY6A 2YXLA 3JZIA 4AILC 4ECUA 2WA3A 3AEIA 4DR2H 2WB1E 2CNVA 1THZA 3HKEB 4CC5A 2GUZA 2ZIMA 3ZS8C 1GSOA 2EIYA 1KJJA 3RVZA 4YAJB 3ZHRA 1D5AA 5GONF 3RB0A 2IBZH 3AG4C 2W9BB 3B2EE 5HFLA 1DAAA 1FJGB 5IP9G 3OSPA 5H80A 5B3SB 3DF7A 5DGHA 2EIJC 3VPCA 3E22B 2PYJA 1VKZA 3ZRWB 3N2GB 1HW7A 5LYJB 2HGXA 2ZM6O 1KJQA 4GLXA 5IWAB 4R6ZA 1XNRH 4I5SA 2AHZA 5E1AC 1S72V 1HNZO 1SA0A 2DW4A 5BWTA 1K33A 1SEIA 2ZR2A 4O7SA 5I5XA 5IYZF 1K3EA 5LMNO 1O9GA 3R5XA 5KG5A 2Q68A 4JV2A 1NTMH 3J80W 4LFAH 5KFRA 3SGIA 1Q81W 1QCEA 4GKKO 1D2DA 3J81N 1K97A 1YTFB 4U7CA 4DR1B 4LNUA 3FYEB 4IT5A 4HNAB 4R50A 1IBKB 3JZ6A 1AP5A 3K0DA 2Z04A 4ECZA 3P30A 5DAAA 4KXRA 2D2CB 4YJ2F 4JYAH 1JDEA 4ZI7F 3MR6A 1Z5WA 2VQEB 4PDRA 1TUBB 3FAVB 5EC1C 1BGYH 2GQRA 3OR6C 3T54A 1I1KA 2FMAA 5LGNA 1K92A 1XUQA 5EBLC 1TWCA 3JATA 4TQRA 5LXTA 1XDCA 2PF4E 3K5LA 1V55B 3VOUA 2DQ3A 3CCLV 5KFUA 3U10A 1EKVA 4FJCC 5L3CA 4HNVA 3OE7G 5KHGA 1MABG 2W9CA 4LWSA 1I2LA 1A48A 1KMIZ 2DZDA 5B1NA 4MV3A 2P7TC 1PL0A 1M1KW 5CA0F 1KYOF 3ZHSA 5KFAA 2ODTX 4IR1A 3J7AU 5EIBC 1K73W 2V4QA 3OEEG 1GGOA 1FAFA 4L1KA 5L9XA 3QZ7A 2XGQA 2R8KA 2UXNA 2XCAA 3A2FA 3CCMV 1W2BU 5K1PA 1KJIA 4I7ZB 4X65B 2NU9B 4ECSA 3CJHB 4O4IA 4K8XA 3OGCC 1YJWV 2W6IG 2VQFO 1OCCC 3AG7A 4DL5A 2GTSA 2X6AA 2Q4PA 4TV9A 4O2BA 4J7JA 4JI6B 5LHHA 1YCIA 2EJ3A 2DOSA 4WCEV 5L1JA 4QIWE 1JA8A 2DPJA 3T1YO 5CN0A 5DISC 3T99A 4BBSG 2LGQA 3G6XA 5LMUH 5D5PA 2P0AA 1CXZB 4DL7A 1M0WA 5DGAA 4AYBA 1KBHA 2DWDC 4FU0A 4PELA 3ABKB 3BFRA 1D5NA 1Z5VA 3V6JA 1SZTA 4B3MB 1I7FA 5H6RA 2W6OA 4JI5H 2XOKG 4J7ZA 4LH7A 4DV0H 3Q4HB 4GKJB 5IWAO 2AW9A 3A0BZ 1V51A 5JVDB 2W7PA 1VBHA 1Y74A 2PMZE 1FD9A 5KUKA 4MTEA 3CS5A 2RNBA 3GDEA 2B9ZA 4DW1A 4X1YA 5IJ9A 2WLNA 2UUBO 4I4TA 5BPHA 2IP4A 1ZHQA 4PA4A 4DR1O 3OUFA 1K8AW 4E6NA 1ZHSA 1X59A 4KUMA 1KKDA 1OCOC 1IBMO 4ECXA 1PNKA 1TA8A 3E83A 4JI3B 1P16A 2RDIA 1S5JA 1RPOA 4K3AA 1M90W 3KHLA 3GJXB 3OR7C 2VQEO 3JAWB 2EJ0A 1VQOV 5LL6Y 1X4TA 1QR8A 4FFLA 2OCHA 1SQGA 4FS1A 4F6RA 1I7NA 2RCVA 5I5VA 2BR0A 4JI2B 1H2LA 1I3QA 2M6YA 2MCTA 3D36C 4MAMA 4RUFA 3L2PA 4IRCA 2OIEA 3RBZA 2P4VA 2L6LA 4QPKA 5LGTA 4P2ZA 5J2UB 2Z5UA 5JWPA 2QM7A 2ATLA 1BHAA 4R7RA 2J9GA 5IYBG 3GQCA 1M93A 3OMNB 5BWVA 1Q43A 4X1KB 3T9FA 2Q0AA 3JALA 3MDSA 1XI1A 2BTQA 3HPLC 4LCUC 5B1AB 1Q7YW 5BMVA 3CCRV 2YICA 5KFKA 3OEHG 1VS0A 1L0LH 1DIKA 3B8MA 4IGGA 2FPGB 5C8YB 1GN2A 3SJQC 5B5EZ 4X65O 3GV5B 4E4EA 1H8EG 1TGOA 4LF4B 2R92A 1Y4MA 1XMOB 2Q7GA 2K1EA 2NVXA 2HIXA 1NH2D 4PA9A 2E74B 4NTXA 3RYFB 4FLXA 4O3PA 3DSQA 1XMQH 1EKFA 2GV9A 1Q3EA 1GSAA 4J9NA 3TCUA 1W96A 5A2QW 5FPRA 4G3IA 4Z2WA 3QZ8A 4B3MO 5LOVF 1G6UA 2R87A 4JI4H 4PD4F 2XTAA 1CQJB 3H4BA 1S5LZ 3H1HH 3SYAA 2W6NA 4JI0B 1EUCB 1AJNA 1MMMA 3G80A 4GKJO 3BCCH 3SNOA 3HKDB 1KQSU 2JRIA 2UVVA 3L73H 3PN1A 3U9SA 5KFLA 4OXSA 4B7EA 2EIKC 2R7LA 4MVOA 5BR8O 3RYHB 2R7MA 4FFOA 3PW2A 3CSXA 2WLIA 3MAQA 4J9MA 5IJ0A 4O3RA 2QE7G 4C5AA 1V54C 4LBEC 2LW7A 1Y1WA 4LF9B 4AQYB 2HDKA 3UKMA 1Y1WG 4JGSA 3FAVA 3ZMSA 3QQMA 4GX1A 3VQVA 3WWHA 3KTMA 1EUDB 4YB8B 4LFBB 2QWQB 3HOVG 1PD3A 1RM1B 3M9MB 2V7QG 5I5TA 3C90A 2CH7A 1N32H 2Q2UA 1CE8A 3H1LH 2J6UA 4F4LA 1SQPH 1VQ6V 3O9OA 1GM7A 4LFCB 3W1GA 1SQQH 5KFBA 4LF8H 1KKCA 4TQDA 3UZBA 2IMWP 3TW6A 5FJ8G 3K57A 4DR7O 4JI2O 1JFFA 4YHHH 2JK5C 2V9WA 2YRWA 3OUZA 2WB1A 4KHPB 1P8LA 1HR0B 1K83A 5I60A 2UU9H 3OT7A 3WB1A 2BQRA 5KFHA 4FS2A 2GPWA 2UVWA 2VA2A 1E4EA 4LF5B 1KB9F 2JGDA 3K9SA 4DUZB 3U55A 1HNWB 5KG0A 3TIGA 1Q82W 3AX6A 4DRFA 2CKZB 5JQWA 4G2KA 1EHIA 4NLGA 5D1OA 1UPGA 3H9VA 2J6TA 3MHSC 3MWDA 2FK2A 1WAZA 5FNVA 5J2TA 3UT5B 5KFMA 1AP6A 4PJ0Z 4TV8B 3RF2A 1S0NA 5CB4A 3NBZB 4MV4A 2ADQB 5KG6A 2HHHB 3M4IA 2R6FA 4BBRG 4K0KH 3DC6A 4O7NA 3Q8RB 4TQFA 4LF6H 1OZ0A 2QEXV 1AI4A 4O4JA 1L1FA 2CUGA 2UXDH 1GAXA 4I7HA 4DV6H 4DV2H 4CS4A 1NT2B 3WU2Z 3GTJA 4FFKA 5L3BA 4Q44A 4ZOLA 3OMAB 3TK1A 1S9FA 4IHJA 3DAAA 4QNHB 1S68A 3R9RA 1VQ4V 4R8UB 4XBFA 4J10A 4A3KG 4PZ8A 4JI0O 1YITV 1AROP 2RDJA 3WB2A 1IBLB 2HG8A 4B3RB 2W9AA 1R3KC 3VQYA 4CS3A 5TISZ 1H2SB 4YJ3B 1K7DA 1BXRA 3Q8PB 4MT8A 3K9AA 5KFEA 1SS3A 1IX9A 2UUAH 1QLNA 3HBLA 3X2QC 4KL1A 5KT3A 1S3JA 4O4LA 1H38A 2GPSA 4FBUA 4TOIA 4X64O 4AQYO 4QW8A 3RFRA 2AHYA 3L75H 3AYHB 3N44B 2NUAB 4UFZA 3FFQA 2Z3YA 3OHBA 5F9LA 2OT5A 3H40A 4A3DG 1A0IA 1OCRC 4LFBO 2Y0IA 1BHBA 1N36H 2YIBA 3UCSC 1S0MA 3PVXA 5KG7A 4JTCB 2ZE5A 5IY5C 4ECVA 4OX9H 5BY1A 3BQ2A 2Q67A 4JAUA 5KFVA 3KKYA 4UVBA 3BA8A 1S10A 2GDSA 2FYUH 3ZMVA 5F9NA 4X89A 1N33O 1PK8A 1XNQO 2EIMC 4JYCA 1VQ9V 5LXTF 4EBDA 3CCJV 2NU7B 3OHAA 3KREA 2YC0A 3EHBB 4YIPA 3I4NG 3OTFA 1R6TA 2X6CA 5KFFA 1SQXH 3FB6C 1PPJH 4IRKA 2B63A 1HR0O 4JZ2A 3T1HH 4PDLA 2B63G 1NU1H 2IW5A 4QIWA 3AK1A 3TW7A 3RBDA 3RB3A 1KTAA 3W7XA 1P84F 2YDEA 1E1QG 2Y0SE 4BW5A 3OTOB 1Y76A 4MSWC 2I87A 5BWRA 4FFBB 2IJJA 2FLLA 4JYYA 1JLLB 4IR9A 4O4IF 3I12A 3ABUA 1S76D 1M0TA 2EINB 1BCCH 4JI8B 4TV9F 4O2BF 3ASNB 2WAMA 3OD4A 4ZBMA 1VQMV 1L2ZA 2HHHO 2YXYA 4XYLB 1XEQA 2PMZA 3HOZG 4DUYB 1RJRA 4FZ1A 2JDIG 5KLVH 2J6SA 5K3WA 4MTXA 4CC6A 5EZYB 3BAAA 4WFHA 4LF7H 4X62O 4U7NA 2ZXWC 4FVMA 1RYSA 2E5LB 1ZL8A 5BYBA 2YEVB 1VBGA 2W0XA 3A0RA 3RGBA 1ZQ7A 2XT9A 3JARA 1FXKC 5DM6V 4TT3G 4NZOA 1GO3F 1AI7A 3R65A 3RVYA 5KHIA 2Q7DA 2UUCB 3THOA 1EFRG 3AK3A 4BWAA 1IBLO 1QU7A 1VF7A 1S77D 4B3RO 2W71A 3J81W 1GN3A 5DQIA 3SYPA 4NR1A 3APOA 1F23A 4DV7B 1VP7A 2R8HA 1I1MA 3MFIA 4F6EA 2V58A 3L9DA 1RK5A 1M9NA 4RUEA 4I4TF 1XL6A 3E8BA 2NU6B 4A3LG 3H4DA 4J9PA 4XDKA 4GLWA 1COWG 5DEDA 3ABLB 5CBHA 1FJGH 4J42A 5JUMA 2UVUA 1I08A 2YUAA 1YIJV 3FB7C 1O9HA 2X0LA 3CP1A 1GN4A 2XIGA 3MWMA 2EZOA 3RFCA 1KC7A 4DL2A 1I5YA 4IYIA 3JRXA 2YIAA 4K35A 1XK5A 2JEXA 4ED8A 5L1LA 2Q9LA 4O2AA 3G4SV 5BWUA 4BR6A 1LR1A 2ZM6B 2X7RB 2ZDIA 3ABMC 4FM2A 3KHGA 4CKCA 4DRXA 1EBOA 5DG7A 4JI7O 2NNUA 4JAVA 3ETDA 2HR3A 4P30A 3BA9A 5K1XA 4TM5A 3RR5A 1QLEB 1HDJA 4O4HA 1K9MW 2R84A 5KT4A 3CCUV 2UXBB 1CKNA 5KX5B 5JQGB 5L3GA 5LMNB 4GCZA 1IBKH 1VEWA 3F5TA 2W8LA 1N0NA 2WA4A 1L8DA 3M99B 2CZGA 1F4MA 3HKCB 1Y67A 3WFVA 5BMVF 3PR5B 1BL8A 1OHHG 3OTOO 4J7KA 3STLC 4ZHQB 1BJTA 2R70A 3PO3G 2UXCO 2DQ0A 3LSUA 5KFNA 1WP8A 4W4KA 1RFYA 3CCSV 3PW0A 1XDNA 1WCMA 1DGSA 4ED0A 4MVQA 1FFXB 4Q8FA 3CRCA 3K5NA 3T9DA 2ITCC 3SDLA 3ZJZA 2QK4A 1M56C 5DG8A 3WG7B 4JI1O 1N34H 4RZQA 1LNQA 5FR9A 2OIGA 4WFGA 4QWBA 2VQDA 2QTSA 1DLBA 4CH6A 2H3OA 3IJ4A 1X9NA 3LNMB 5H6QA 4FM1A 5C3EG 2HEPA 4MVUA 5DECA 2E5LO 2DN9A 4I55A 3ZMTA 4LH6A 3ETHA 3K06A 3ZHUA 2IJIA 5I5YA 3T9EA 2YW2A 3K58A 3N42B 3LMLA 2HP8A 2HVQA 1T3NA 5GTIZ 4DV4H 4EB6A 2K9PA 1I6UA 1BSMA 1YZBA 4WF9V 5E25A 3HOWG 4GC6A 5AG2A 3I5DA 4JI6H 3JAKA 4X66B 2ZDGA 3Q8SB 2VQFB 2FPIB 1FXVA 2W8KA 1H2MA 1KECA 3GVMA 3BEHA 1NTZH 4MVRA 3TIIA 5KFGA 3B77A 4RNNA 3WO0A 3GWOA 3KCYA 5D5QA 1ZWIC 2HHFB 2PGGA 5I5UA 1KBLA 2DYRB 1F4NA 3VNNA 4EEQA 3ZEDA 4YIOA 1KP2A 5CAEB 2V4RA 4I50B 3T1YB 4U3JB 4J9SA 3CE2A 4ICGA 4C5CA 4EYHB 4F4YA 3JD3A 5EYPA 2CK3G 4MVSA 4O83A 1TWFA 4O7TA 2BOBC 5LL6b 3HKBB 3UM7A 1BZKA 1IVSA 3K5OA 5EC2C 2HVKC 2EULA 4CKBA 1VQ8V 4JV5B 4CKEA 3ZBHA 2FP4B 1PM9A 4MTGA 4KFMA 4DR4B 1K4CC 4A5UB 1HNXB 1VF5B 4CMDA 4FIPC 1CS0A 4DR5O 3E35A 4F4WA 1OBGA 4BY1G 3JAMN 3V6KA 2CW8A 3K3WA 5L1KA 3JYCA 1IXBA 4MW8A 2UXBO 4QWEA 4J9RA 5KKNB 4C2MA 5JJEB 4JI3H 1F7YA 2UUBB 2F4VH 5FNVF 4JTDB 1IOWA 5J2TF 4HYOA 2QWPB 2YCHA 5CR5A 2HGSA 5EWGA 2OCCC 1P7GA 2XCLA 3FKIA 4E2LA 4FBTA 1F51A 2Q5ZA 1IBMB 5CB4F 2CE4A 4PBCA 4GYCB 4U6PA 2C2DA 2FKLA 2CNUA 2Y69B 4OPHA 2QF7A 3STZC 4PDMA 4UCRA 4O86A 4EKWA 2VPSA 3W7WA 2AGPA 2YEVA 2E2HA 3RYIA 5CA1B 4O4JF 3SR2C 4ME6A 4DL6A 1TWGA 2YZGA 3NBYB 4LMYA 3HOXG 4ZOLF 4IHJF 1V4YA 5KHKA 5EK0A 5DGBA 3MWEA 2YS8A 2M7WA 4XDJA 5LA6A 3CEBA 5KFIA 1QHTA 4NYKA 3PJSK 3K08A 4YR3A 4JASA 3T1CA 2LW1A 2Y4UA 4DV3B 2HLDG 3DXRA 5BYAA 3QO8A 4LF4H 1XMOH 5B1AC 5KFSA 4K6NA 3M9NB 4O4LF 4JTAB 3G8DA 1NTKH 2W6QA 5GONB 4X66O 4RNMA 3LWBA 1J5EB 4WBNA 4YQWA 2QJ1A 1ET0A 5EWFA 2LQTA 4D7TA 3TETA 2Q8VA 1RYRA 2F43G 3GTLA 3DGEA 5BXZA 2XAFA 4FFRA 3TY9A 1NH2B 3ZCCA 4QJFB 1VQPV 3RAQA 1JCHA 4CS2A 1OCZB 2YL2A 3V4ZA 4LP8A 4EG0A 2Y0SA 5IYBO 5LHIA 2AZ2A 5J2UF 3N8DA 5IYZB 4MTFA 4DR6B 2JEIA 4JV5O 3I56V 5JH7A 5B1OA 4IIJA 1TWAA 4PDBA 5IDJA 4Q6GA 3OM3B 4DR4O 3T4ZA 1HNXO 1RSOB 2W57A 4J9KA 1ZAUA 3PFFA 4LF9H 3RGZA 1R73A 4QIWF 2QGNA 3JASB 1BMFG 5BR8B 1NVPD 2QWNB 3QFFA 3UFXB 3P3PA 1GLVA 5BWXA 4YJ2B 2PI5A 4ZI7B 1CKOA 2ABJA 5KFTA 5IE9A 1PL4A 2C2AA 3ASOC 2PY5A 4DAAA 2EIJB 2YZNA 2JEFA 2PUSA 2F95B 4YY3H 2LFRA 1N8RW 5FD6A 1B3QA 3JCUZ 3RGXA 4LFCH 1YDXA 3W7SA 3TXQA 4O3OA 1WPBA 3OFNG 2E75B 1FKAO 2IM9A 4RAZA 4MV8A 2HFEC 1H2NA 1JXLA 5JJJB 4TUYA 3VMMA 1C30A 3G67A 3GTKA 3JD4A 2DABA 2QWRB 4KHPH 1TUEB 3MR3A 1UC9A 3HXLA 4ECRA 1FXKA 1S0OA 3P32A 1Q8IA 2JA7A 4UXNA 2N04A 5CA0B 4D6TH 3SYCA 4DR7B 2WLLA 4LF5H 2RMKB 1B06A 4DR3H 5H5NA 2V5AA 4DUZH 4UB8Z 1I94H 3TEKA 1HNWH 1PV0A 2IH1C 3RJ0A 3APQA 3D8CA 4DK0A 1P4RA 3KG2A 4MA5A 1VF6C 3W1BA 1SZXA 2ZDIC 4DV3O 3F5WC 5DMXA 4PZ7A 3AG2C 2YIDA 4DK1A 2QKAA 2W0FC 2R7NA 4JYAB 2ODMA 2C35B 3HKEA 4MA0A 3G6VA 2EJ7A 3TINA 4RB0A 5HFMA 2IU3A 2MK3A 3ZRSA 4DYLA 1J5EO 2YWVA 2R92G 2W9BA 1EN6A 3GIQA 2IH3C 5D1PA 1FS0G 5GTHZ 4F4XA 2DYSC 4Q8EA 5CMUA 1Z2NX 3E22A 4IZOA 1SQVH 3ZRWA 3N2GA 5LYJA 3UO2A 4PHZA 5KT6A 2IJKA 5B66Z 2R8IA 1KUQA 3T9AA 5KAIZ 4PI2A 4B3SO 1HWYA 2XHBA 1XL4A 3T9BA 4O2AF 4RQFA 4X1IB 4Q20A 3CRQA 5BZBA 1OCCB 4DR6O 3FB8C 2HIVA 2WE6A 2EX3A 1KC8W 5HNEA 5C4XG 1KD1W 3SPCA 4NXNO 2LJ2A 2GTAA 2QSAA 3SPIA 3BVOA 5DGIA 2VOBA 4O4HF 3GV8B 2G38A 1C3OA 3SJAC 1WJZA 1K4DC 3B40A 5LGUA 4NXMH 2CNQA 4DR2O 2FKXA 1YJNV 4HNAA 2YS6A 5JJNB 4X64B 2JA6A 3WWIA 1N0JA 1LUWA 1TUBA 5BWWA 3PW5A 4A3BG 1VAJA 5CA1A 1BQZA 5D8DA 4H33A 3RYCB 1QVGU 1DF5A 2IJHA 1VMGA 4Q45A 4IRDA 1R3IC 4QSHA 3L4JA 4JI5B 2QKSA 4DV0B 3ORQA 1WA8B 3U0ZA 3I4MG 1XNRO 3JD1A 1N33B 1XNQB 1WN7A 4O3QA 3T4DA 3E8GA 4HZ3A 5KFPA 2NVYA 4IWXA 3SPJA 4I55F 2ZDHA 1XREA 3T5KA 1EKPA 1UJWB 2V1DA 2X0SA 4LFAO 3ETEA 1CQIB 4MV1A 2AGAA 3FDSA 4EFBA 3VQXA 3CJHA 1N48A 4X20B 3AG3B 2XAGA 5DN6G 4JI8H 4U7OA 4DV1H 3K5HA 4QPJA 4JYAO 3H01A 3BPZA 4GX0A 1FYJA 2YRXA 1ZUQA 2CTQA 2FL4A 3OSNA 1TVKB 4DUYH 2Q0OC 3N2KB 3GTOA 3DTUB 2EILC 3KHRA 3ZX6A 2R9AA 4I0XB 5LOVB 4B08A 2MW2B 3S24A 2HVSA 2FK1A 3NR7A 2JJ2G 3RT3C 3GIKA 4O82A 2PI4A 2CTWA 4R8CA 5EIBD 1IZ3A 4Q43A 3Q4HA 1EN5A 3OMIB 4PA3A 4X62B 3PZPA 2UUCH 1DV1A 5KAFZ 1M57C 4RWUA 5JVDA 2LP7A 3HR0A 1ORQC 3TJTA 1Q5OA 2FB9A 1A3GA 4DV7H 5IT9N 3KZIZ 4EEYA 1GK9A 3UO3A 4B3TH 5B1BC 4MV7A 1LUVA 3H0GA 2N05A 3QG5A 1AI6A 3UZOA 4OPAA 2ASDA 1M5IA 4DLKA 2B5UA 1GKFA 5FLXN 1AB3A 2N74A 1R1BA 3DC5A 1AJQA 1XMQB 3JAWA 5LMUO 1DTOA 3ABLC 1H2GA 2COJA 4QGPA 3AG1C 1RPRA 4DV5H 1MA1A 5KHHA 1MZEA 3R66A 4RNOA 1YSCA 1BQ0A 3F8NA 2AGOA 2EIKB 1W93A 1G2WA 4JI5O 4P9OA 2ZM6H 3DTFA 4J9LA 2XC9A 4DV0O 2BSKB 3GTGA 4YXWG 1PNLA 3KHHA 1GN6A 1JQ0A 1HNZH 2JS3A 5J2UA 1T36A 2VUGA 4LSXA 1R6KA 1G8MA 3CWBH 1KJ9A 5LA6F 4UUGA 5LMNH 2KG7B 2ALZA 4JI7B 3PR4A 1QLEC 4X1KA 1XOUA 2P67A 4FGRA 4M0JA 5IYCG 1Z2OX 4GKKH 4FM0A 2KSDA 4J80A 4D7SA 3A0HZ 5KFWA 1AR5A 4X9QA 2VWJA 3LQSA 1SYXB 1B04A 5C8YA 3K03A 3JSLA 1AUVA 4JYBA 1V9PA 3I55V 1N32B 2GUZB 1VIBA 4IYHA 4HNUA 5BPFA 3ETJA 3R23A 2UXCB 1FFTB 1QVFU 2YZMA 3RYFA 4LR3A 2HG5C 3SYOA 2W6ZA 3K5IA 4WBNF 5KG4A 4O7LA 1ZLZA 2QM4A 3KALA 1T5EA 2QYZA 3ETGA 4J41A 4YBZB 4LSAA 3R5FA 3GV7B 3WG7C 1ZSPA 4JI1B 3V6HA 4GX2A 2Q7HA 2UU9B 3CYOA 1A0GA 5DLGA 1NR1A 5KFYA 3GLKA 3W7UA 4RB1A 1SA0B 3HKDA 2HVRA 3CD6V 1EZJA 3JAMW 4CBCA 3CPWU 3BACA 1YF2A 1GM9A 1FVIA 5JH7F 4H13B 3ZIAG 3OUSA 3RYHA 4IIJF 4MV9A 3S3XA 4FPPA 5KUMA 5C5JA 1E79G 3LDCA 4BY7G 4DQNA 2E3CA 2E76B 2VUMA 2KB1A 5C93A 2WLJA 2FE3A 1WB7A 2VUMG 3FB5C 4LNUB 5KMGB 1OBDA 4QW9A 2VQFH 5KFCA 1P49A 3CSWA 4JXUA 2BQUA 3T2MA 4BIUA 1AILA 3G8CA 4K0KB 2EZPA 4MV6A 2ZT9B 2WLMA 5CBGA 3N43B 4LF6B 4NTYA 3CVZA 2UXDB 2Q7EA 3T1YH 3MHHC 3CXCU 5EOYA 3WB0A 4DV2B 1P7BA 1PP9H 1XMQO 2B1GA 3JATB 1S0VA 4L87A 4ED1A 5LXTB 1XILA 5C1OA 3MR2A 4Z1MG 3CEIA 4JI4O 2JEGA 2OTLV 5F2VO 1CKMA 4TUYF 2F23A 4QWCA 2DE0X 3HT5A 4LWSB 4ZKIA 2W9CB 5IWAH 3PW7A 2W6PA 1GTOA 5B3SC 3ZMUA 1K1QA 3X2QB 5KA5A 2VRZA 5HV6A 2RJZA 2CQYA 4ECTA 4FLZA 4NXMO 1BNCA 2P06A 3TXSA 3M8AA 1VF6A 1MOFA 2Q2TA 2C2EA 2HJWA 2H8PC 3SE7A 2YI9A 4JUZA 4O7YA 4DR5B 1OCRB 3A8TA 4O4IB 4IL6Z 1WP7A 2B1IA 1W0KG 3K04A 4WFEA 3BJYA 3EPGA 2PVPA 1FPOA 4DR1H 1TVKA 3UT5A 4RO2A 4XDLA 2ZGIA 4FMTA 4O2BB 4TV9B 4TV8A 1N36B 2WSSG 1IYEA 1IBMH 2JEJA 4A3GG 1CPYA 3QF7A 1W59A 1NBMG 1N32O 2EIMB 4OX9B 2VQEH 3WO1A 1AVMA 4WD3A 3JD0A 4ECWA 4I9QA 1R9TA 5CBFA 2ZR3A 2RN9A 2WAQE 4LF8O 3U54A 3RIZA 1PNMA 1WCMG 1SQFA 4PA6A 4PDVA 3L4KA 2IU0A 3NGDA 4FLTA 3TY8A 2GBOA 4YHHO 5LYJF 2Y0PA 2WDTA 2UU9O 4R8UA 5L3DA 3T1HB 2RF4A 3VPBA 4WFFA 4W4LA 1Y74B 4JV1A 1V55C 4TVIA 2OWOA 5KG3A 3CCQV 5KFXA 4DIMA 4YJ3A 3CMAV 3PW4A 4X1YB 5IJ9B 4EBCA 4DV1O 2VS0A 1WLEA 4BXXG 1AUXA 1E4GT 4I4TB 3GILA 2JGUA 5CM0A 2OH2A 3D3QA 2W6MA 4NKGB 2ITDC 4X65H 4UV9A 3IC9A 1TWHA 4JZGA 4EQ5A 3IAYA 1EZ1A 4Q0YA 1VQKV 2ZXWB 4K0KO 1B33N 5L3FA 2RDCA 3CHXA 4LF6O 2UXDO 4A3IG 1E1RG 2JIZG 5CA1F 4DV6O 4DV2O 4TWKA 2OTJV 1TAEA 4LF7B 3W7TA 1OWTA 4CH5A 2A1HA 2GHYA 2P5OA 4B3MH 1OCZC 3LULA 1SETA 3OAAG 1URFA 1PX2A 2W70A 2JVDA 2X6BA 3GIDA 3RW0A 4ED6A 2BCCH 4GKJH 3Q1KA 3ABKC 5IYDG 1BGWA 4MTOA 1J95A 2W7OA 3JRWA 3WWJA 3VQWA 2X5RA 2F66C 2A9HA 4N21A 1K5QA 2YXHA 2FMLA 3QTCA 5BR8H 3JALB 2D3OW 3PO2G 2BTQB 1S03G 2DMXA 2UUAO 5BMVB 1NZ6A 4N23A 4DL4A 2HJFC 1Z2GA 2AGQA 1KP3A 1DK1A 2W6JG 5IP7G 4NVPA 4G28B 2VR1A 4FFBA 1A9XA 1UNNC 1K34A 5EBWC 1NVPB 3QO7A 1QQCA 1RJPA 4RZRA 3FYIB 4DV5O 4YR2A 1N36O 4B7KA 3MJFA 3RBEA 1VQ7V 1JR9A 3HKZA 1N4CA 1B6SA 3ICXA 3SPGA 4OX9O 4ED3A 3C3TA 1WH2A 3EPIA 1Y1VA 3ABMB 1BE3H 5E79Z 1FXHA 1WB8A 3TQTA 3ETQA 1Y1VG 2ARHA 4DW0A 3FKIG 5EZYA 2IBKA 2PTMA 5LBQA 1AI5A 1T94A 4DR7H 1AR1B 1AJPA 5DQGA 5JCOA 4JI2H 3BABA 3K3VA 3CRMA 2SCUB 3T1HO 5LP6B 4APMA 1KEEA 3BQ1A 2NLJC 5JVDF 3LUTB 3E86A 5KMGA 2WLIB 2EBOA 5IJ0B 2XD4A 3B4SA 2JS5A 2C00A 5FD5A 3FMAA 4F50A 4RAIA 5T14A 3VBBA 3E5NA 3CRRA 1M56B 5KFZA 1GH6A 3VA7A 2P4KA 4I9WA 3B8NA 4FK5C 2QR4A 4K8ZA 4GC7A 2UXXA 2CH7B 4CE5A 4GT1A 3K3PA 2QDOA 2Q73A 2Z0AA 4GUNA 4RQEA 1Y14B 3TQ1A 3H1KH 4H0LB 2WWWA 1N34B 1IOVA 2ZE6A 4UCUA 2JA5A 4UCSA 1H8HG 4XZ3B 3K59A 2JA5G 4LF7O 2QTOA 4NYEA 1RJQA 3H1IH 4DXWA 5CA3A 4FE2A 1JFFB 1JX9A 2XAHA 1YJ9V 4JI0H 4TSFG 1K1SA 4B3SB 3LDEA 1E4EB 4DV4B 3H20A 5DLFA 3F7VC 4QE7A 2JGDB 3ZN1A 1KUTA 2V4DA 2R86A 1IDSA 2Y4RA 5KX5A 5JQGA 4O81A 1NR7A 5D1OB 2XAJA 4NXNB 3U0GA 5I5WA 2XASA 5FNVB 5J2TB 3HKCA 1N56A 1SFOA 1A32A 4X64H 1B6RA 3ZHQA 4ZHQA 4AQYH 1OJHA 1WSCA 5CB4B 5C8YF 2RGRA 4DR2B 3E8FA 2ADPA 3AK2A 1HP8A 3AG4B 1FJGO 4LFBH 4O3SA 3VOTA 1FFXA 2LFSA 2CAZC 4O4JB 1MSDA 4H37A 2Q6AA 1NQTA 2FB5A 4ZQIA 1CP9A 5FPOA 4ZOLB 1RM1C 4JAAA 3JD2A 4IHJB 1N33H 1XNQH 2RQ6A 1H2KA 4OGQB 5IT9W 4MVZA 4O7ZA 4J0MA 1XNRB 1YI2V 1JMKC 1HR0H 2XUMA 3GIIA 1YTFD 5I47A 2R7KA 4ABMA 4NB5A 4PWQA 1RK6A 2JA7G 4HNTA 2WLHA 2OCCB 3OW2U 1IBKO 3Q2OA 4PZ6A 2O57A 3HB9A 1CEZA 5DQHA 2VPQA 2UVRA 3C3SA 4LFAB 4O4LB 2F4VB 1Z2PX 3C0FB 2FLNA 1GM8A 5FLXW 4RB2C 2CGOA 3AG3C 1QR9A 5FL7G 5EDWA 1Q6UA 1JIHA 3EVKA 4EFEA 3DTGA 2M05A 2HHFA 3E8HA 2HHHH 4UCVA 1KJ8A 1M7JA 3KCXA 4I50A 1MNGA 3NC0B 3LNNA 1N34O 3E2EA 1SKVA 4U3JA 1JKJB 3RUPA 3SJCC 3BG5A 4BWSC 1I50A 5KS8A 5L1IA 4X62H 3CRAA 4IWYA 4AI8A 2NU8B 1OV9A 3HKBA 1U96A 2AXTZ 3VPDA 3SI8A 2GQSA 4ASUG 4A3EG 1R3JC 2A79B 5KT7A 2ILMA 5H2FZ 3ORRA 4DV4O 1IBLH 4B3RH 3GIMA 3ZN0A 2WTFA 2YU9A 3RV3A 1PKXA 3IN5A 4JPRA 1WPXA 1Y76B 2ZCEA 2WAQA 3J80N 3KAKA 4JI6O 3CC2V 3M7MX 2XNDG 4G27B 2WPDG 4AHCA 4RUAA 1G1XB 3ZHVA 4TV8F 1MSWD 1DF4A 3HO8A 2DLNA 1NKDA 3GB8B 4J9YB 1AN7A 2FTKA 2L35A 2R8JA 4FFPA 5LMUB 2JA6G 2VWKA 1RP3B 1WNSA 3Q8QB 1KU9A 3SPHA 1XBLA 3T5JA 1ZL8B 5LP6A 3T7AA 5KHJA 4CZZA 2R85A 4CHIA 3ZHTA 3JARB 1NI8A 4O84A 1ZTEA 2P90A 3LSSA 4JI7H 2RGVA 2IA6A 4A3CG 1ROPA 3ASOB 3O65A 2FLPA 2AQ4A 3BRCA 1NJIW 4M9UA 2ZNIA 4YR0A 4UVAA 1Q6HA 2PBZA 5KFDA 4YJ3F 2LO1A 4J11A 3ABTA 3N6RA 3JCZA 1OCOB 5HBRB 4RB3C 1G4YB 3RV4A 4JI3O 3ZRXA 2F4VO 3OTOH 4YY3B 1O75A 2UXCH 5GONA 3ML0A 4F4ZA 4JF3A
chains in the Genus database with same CATH topology
3HKDA 5JVDB 2HVRA 5ITZB 5D5QA 2YIBD 3JAMW 2PGGA 4MTEA 3VNNA 4EEQA 3ZEDA 1FVIA 4MV9A 3RYHA 4I50B 3GDEA 3T1YB 4MTDA 4X1YA 5IJ9A 4JI1H 4A2AA 4U3JB 2E3CA 4I4TA 2FE3A 4LNUB 1ZHQA 2KSWA 5KMGB 2VQFH 5EYPA 4O2AB 1P49A 2YI8A 3HKBB 4E6NA 1ZHSA 5LL6b 4DR3B 3K5OA 2E5LH 4JV5B 1I94B 1TA8A 4K0KB 4JI3B 1P16A 4DRXB 1S5JA 5IYZA 3N43B 4LF6B 4DR4B 3K5MA 3GJXB 3CVZA 1HNXB 3U11A 1XQ8A 3JAWB 2Q7EA 2UXDB 3T1YH 4O4HB 5EOYA 3WB0A 4DV2B 1RSOA 1CKNB 1X4TA 5JCOC 3JATB 2CW8A 5LXTB 1SQGA 3JASA 3W5OA 4F6RA 5JJEB 4JI2B 4YJ2A 4ZI7A 2MCTA 1CKMA 4JI3H 2UUBB 2F4VH 3L2PA 5IWAH 2CFMA 2YCHA 2HGSA 5J2UB 3UQ8A 2RJZA 1IBMB 4GYCB 4FLZA 4R7RA 1M93A 2Q2TA 1Q43A 4X1KB 2Q0AA 4UCRA 2VPSA 2YI9A 3JALA 1XI1A 2BTQA 4DR5B 3RYIA 5CA1B 5BMVA 3SR2C 1VS0A 4O4IB 5C8YB 3NBYB 4LMYA 1TGOA 4DR1H 1TVKA 3UT5A 1XMOB 4LF4B 2Q7GA 3QWUA 4TV9B 4O2BB 4I55B 4TV8A 4JI4B 1N36B 5KHKA 1IBMH 5CA0A 2HIXA 1GYFA 3QF7A 3SJBC 5LA6A 4FLVA 4OX9B 1QHTA 3RYFB 2VQEH 4FLXA 3IG0A 4DR5H 3DSQA 1M4UA 4EB6B 4DV3B 4FLYA 4I9QA 1XMQH 4NXMB 2GV9A 3TY5A 1Q3EA 3RIZA 2UXBH 1SQFA 4LF4H 5A2QW 1XMOH 5FPRA 2O03A 3JAKB 3L4KA 1E4FT 1G6UA 4JI4H 4FLTA 3TY8A 3KXYT 4JI0B 5GONB 2WDTA 2F1MA 3T1HB 4RAYA 3HKDB 1J5EB 4WBNA 2QJ1A 3PN1A 3EYYA 4CH4A 4D7TA 2OWOA 3RYHB 4YJ3A 4X1YB 5IJ9B 3CSXA 3TY9A 3MAQA 5IJ0A 1E4GT 4I4TB 4PI0A 4CS2A 2JGUA 4LF9B 4AQYB 5EYPB 4LF8B 4X65H 2BTOA 3VQVA 4EQ5A 4LFBB 5IYZB 3IAYA 4DR6B 4Q0YA 4YHHB 5JH7A 3RWRD 4X1IA 4IIJA 4PDBA 1N32H 1JJOA 2Q2UA 4Q6GA 2P22C 2ZINA 3CHXA 4BW9A 2W57A 2PZSA 1ZAUA 4LF9H 4LFCB 3W1GA 1TAEA 3RGZA 4LF7B 4LF8H 3JASB 5BR8B 4TQDA 4CH5A 4YJ2B 4DV1B 4ZI7B 2P5OA 3K57A 4B3MH 1CKOA 2PY5A 1JFFA 4YHHH 4HBNA 2JVDA 2PUSA 4KHPB 1P8LA 2F95B 1HR0B 4YY3H 2PYLA 4X66H 2UU9H 3WB1A 4GKJH 1BGWA 5FD6A 3N6XA 3RGXA 3VQWA 4LFCH 4LF5B 2F66C 4UCTA 1WPBA 3RYCA 4DUZB 3QTCA 2CW7A 5BR8H 1HNWB 4L8JA 3JALB 2IM9A 4RAZA 4DRFA 2BTQB 1S03G 3RYIB 5BMVB 5JJJB 3J7AK 5D1OA 4FLWA 4TUYA 4DV6B 5FNVA 5J2TA 4NVPA 3JSNA 4FFBA 3UT5B 3N41B 3N40P 3HXLA 4KHPH 4TV8B 1Q8IA 3RF2A 1QQCA 5CA0B 5CB4A 4DR7B 3NBZB 5LA6B 4LF5H 4DR3H 2HHHB 3M4IA 4JV5H 4B3TB 4DUZH 1I94H 4K0KH 1HNWH 2F93B 3KYHC 3ICXA 4LF6H 4TQFA 1MZBA 4DR4H 4O4JA 1WH2A 3RJ0A 1HNXH 2UXDH 4I7HA 4DK0A 4DV6H 4DV2H 4CS4A 3W1BA 3ETQA 1NT2B 3RTXA 5EZYA 4ZOLA 4PZ7A 4M7EA 2PTMA 4IHJA 4DK1A 4X20A 2UUAB 4JYAB 4DR7H 5ITZA 4FM9A 1S68A 5JCOA 2ZJTA 4JI2H 3HKEA 2UUBH 3BABA 3K3VA 4PZ8A 4WBNB 4RB0A 5LP6B 3WB2A 1IBLB 4APMA 4B3RB 3VQYA 4DV5B 4CS3A 3N2KA 1H2SB 4YJ3B 2ZNJA 5KMGA 1YEWA 5D1PA 1FKAH 5IJ0B 1Z2NX 3E22A 2JS5A 2UUAH 5LOVA 5FD5A 3N2GA 4KL1A 3FMAA 4O4LA 5LYJA 4PHZA 4TOIA 3RFRA 1HNZB 4UCOA 3N44B 4UFZA 4PI2A 2KKWA 3FFQA 2XHBA 2WYOA 4K8ZA 5JH7B 1A0IA 4X1IB 4IIJB 1N36H 2YIBA 2HIVA 2WE6A 2EX3A 5LP6C 1N34B 4OX9H 4GKKB 2OYQA 4UCUA 3BA8A 2VOBA 4IAJA 3CB2A 4UCSA 3SJAC 4DV3H 3K59A 4NXMH 3KAJA 4HNAA 4ZIBA 1JFFB 3OTFA 5JJNB 4X64B 4ETSA 1TUBA 4JI0H 4B3SB 3T1HH 5CA1A 4DV4B 3H20A 1J5EH 3RYCB 2V4DA 2R72A 5KX5A 5JQGA 5D1OB 3L4JA 4JI5B 4TUYB 4FLUA 4NXNB 3OTOB 4DV0B 5FNVB 3U0ZA 5J2TB 1XHZA 3HKCA 4FFBB 4X64H 4AQYH 4ZHQA 1N33B 1XNQB 1WN7A 4F6RB 5CB4B 4A2BA 4DR2B 4B3SH 2RGRA 1M0TA 4JI8B 3BHPA 4CH3A 4LFBH 1L2ZA 1FFXA 4DR6H 2CAZC 4O4JB 4DUYB 1XHXA 4NXNH 2ZIOA 5FPOA 4CC6A 5EZYB 3BAAA 2YXLA 4ZOLB 4EFBA 3VQXA 4AILC 4LF7H 4IHJB 4X20B 1N33H 4FVMA 1XNQH 2E5LB 4DR2H 2RQ6A 4JI8H 4DV1H 3RGBA 3HKEB 5IT9W 4CC5A 3JARA 4J0MA 3BPZA 1XNRB 2ZIMA 3ZS8C 5KHIA 1JMKC 2UUCB 1TVKB 4DUYH 1HR0H 1D5AA 3THOA 3N2KB 4BWAA 1VF7A 3J81W 3B2EE 1FJGB 4DV7B 3DF7A 2R9AA 3E22B 5LOVB 4B08A 2PYJA 4PZ6A 3S24A 3N2GB 2HVSA 1HW7A 4LFAB 4O4LB 5LYJB 2F4VB 1Z2PX 3C0FB 5FLXW 4RB2C 4GLXA 5IWAB 1XNRH 5EIBD 4X62B 2UUCH 1SA0A 5JVDA 1SEIA 4EFEA 1FJGH 1Q5OA 4DV7H 2HHHH 1O9GA 4UCVA 4B3TH 1O9HA 4MV7A 3J80W 4I50A 3NC0B 4LFAH 2XIGA 3LNNA 3QG5A 3SGIA 3MWMA 1SKVA 4U3JA 3SJCC 4BWSC 4DR1B 4X62H 4LNUA 1IBKB 2YIAA 4HNAB 1M5IA 1XK5A 4O2AA 3HKBA 2ZM6B 4JYAH 1Z5WA 2VQEB 4FM2A 1TUBB 4DRXA 5K1XA 3RR5A 3BA9A 1XMQB 3JAWA 4O4HA 1IBLH 4B3RH 2UXBB 1CKNA 5KX5B 5JQGB 4DV5H 3JATA 5KHHA 5LMNB 1IBKH 5LXTA 3K5LA 1L8DA 2ZCEA 3F8NA 3KAKA 3U10A 3HKCB 2ZM6H 3M7MX 1BJTA 4ZHQB 5KHGA 2R70A 1KMIZ 4AHCA 1HNZH 1XDNA 5J2UA 1DGSA 1FFXB 2VUGA 4LSXA 3GB8B 3K5NA 5LMNH 4JI7B 5EIBC 1AN7A 4X1KA 5LMUB 2VWKA 1Z2OX 3A2FA 4RZQA 1N34H 5K1PA 1WNSA 4FM0A 4X65B 4GKKH 4D7SA 4O4IA 4K8XA 4CH6A 1X9NA 1KU9A 1SYXB 2VWJA 1B04A 5C8YA 3JSLA 4FM1A 2HEPA 5LP6A 5KHJA 1V9PA 4TV9A 4O2BA 4I55A 4JI6B 3JARB 4LH6A 1N32B 2UXCB 4JI7H 2RGVA 5DISC 3K58A 3RYFA 3N42B 4LR3A 5LMUH 3BRCA 5D5PA 3LMLA 2HVQA 4DV4H 4EB6A 2QM4A 1M0WA 2ZNIA 3KALA 1T5EA 1Z5VA 4LSAA 1I6UA 4B3MB 1I7FA 4JI1B 4RB3C 4JI6H 3JAKA 4JI5H 4LH7A 2Q7HA 3OTOH 2UU9B 4DV0H 4GKJB 4YY3B 4X66B 1O75A 2UXCH 2VQFB 5GONA 4RB1A 1SA0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVR A;  4X62 B;  3TY9 A;  4TOI A;  3VNN A;  4EEQ A;  1FVI A;  1HNZ B;  4LF9 B;  3GDE A;  4EFE A;  4AQY B;  4UCO A;  3T1Y B;  4UFZ A;  4LF8 B;  4UCV A;  1A0I A;  3NC0 B;  2HIV A;  4EQ5 A;  3SGI A;  4LFB B;  4DR6 B;  1N34 B;  4E6N A;  4YHH B;  4DR3 B;  4DR1 B;  4GKK B;  4UCU A;  3BA8 A;  4JV5 B;  1I94 B;  1IBK B;  2Q2U A;  1TA8 A;  4K0K B;  4JI3 B;  1P16 A;  4UCS A;  1XK5 A;  4LF6 B;  4DR4 B;  1ZAU A;  3GJX B;  4LFC B;  2ZM6 B;  1HNX B;  2UXD B;  3W1G A;  1TAE A;  4LF7 B;  2VQE B;  4DV2 B;  5BR8 B;  1CKN B;  3RR5 A;  3BA9 A;  1XMQ B;  4DV1 B;  4X64 B;  1CKO A;  3W5O A;  4B3S B;  2UXB B;  1CKN A;  4DV4 B;  4JI2 B;  4KHP B;  5LMN B;  1HR0 B;  1P8L A;  1CKM A;  2UUB B;  3L2P A;  2CFM A;  4LF5 B;  4UCT A;  5D1O B;  4DUZ B;  4JI5 B;  4NXN B;  3UQ8 A;  3OTO B;  4DV0 B;  1IBM B;  1HNW B;  4DRF A;  1XDN A;  5D1O A;  2Q2T A;  1DGS A;  4UCR A;  4DV6 B;  1N33 B;  1XNQ B;  2VUG A;  4DR2 B;  3GB8 B;  4DR5 B;  4JI8 B;  3JSN A;  1VS0 A;  4JI7 B;  3NBY B;  5LMU B;  4DR7 B;  3NBZ B;  4X65 B;  2HHH B;  1XMO B;  4LF4 B;  4B3T B;  4DUY B;  3QWU A;  1X9N A;  4JI4 B;  1N36 B;  1B04 A;  3KYH C;  2HIX A;  3JSL A;  5FPO A;  4CC6 A;  3BAA A;  4EFB A;  1V9P A;  4OX9 B;  4JI6 B;  4LH6 A;  1N32 B;  2E5L B;  3W1B A;  3RTX A;  4DV3 B;  2UXC B;  4PZ7 A;  4NXM B;  5DIS C;  4CC5 A;  2UUA B;  3TY5 A;  1XNR B;  4JYA B;  2HVQ A;  1S68 A;  5FPR A;  2UUC B;  3BAB A;  4PZ8 A;  3TY8 A;  4B3M B;  1FJG B;  1IBL B;  4DV7 B;  4JI0 B;  4JI1 B;  4B3R B;  3T1H B;  4DV5 B;  4PZ6 A;  3S24 A;  4LH7 A;  2UU9 B;  1J5E B;  4GKJ B;  4YY3 B;  4X66 B;  3PN1 A;  4LFA B;  5D1P A;  2HVS A;  2F4V B;  2VQF B;  2OWO A;  4GLX A;  5IWA B; 
#chains in the Genus database with same CATH topology
 3T5L A;  5A9G A;  5ITZ B;  2YIB D;  1SER A;  4NZN A;  2R93 A;  4MTD A;  2QKC A;  1GMG A;  4A2A A;  4JI1 H;  2R93 G;  2DIK A;  4QJF A;  2H94 A;  2EIN C;  2YSU B;  1IUR A;  3ASN C;  2KSW A;  2QM8 A;  1DV2 A;  5KFQ A;  2BQ3 A;  3GB7 C;  4O2A B;  2YI8 A;  4RCN A;  3G6B A;  4DR3 B;  2E5L H;  4MS2 A;  1I94 B;  3T9C A;  1NS1 A;  3HOU G;  4DRX B;  5IYZ A;  2NR5 A;  4YP3 A;  1B6Q A;  3AG2 B;  4FZ0 A;  4H44 B;  2Y48 A;  5IYC O;  3K5M A;  3U11 A;  1XQ8 A;  2VA3 A;  3L70 H;  2Y4T A;  4O4H B;  1MZF A;  2HJD A;  1Q86 W;  1RSO A;  4J9Z B;  3E89 A;  3TGU H;  1CKN B;  1L0N H;  5JCO C;  3HKZ E;  5EBM C;  3S3W A;  4XX0 B;  1JOY A;  2GLT A;  2DJV A;  3JAS A;  4LF4 O;  1XMO O;  2AZ0 A;  2I8C A;  3W5O A;  2R9R B;  3B09 A;  3LDD A;  4YJ2 A;  1VQL V;  4QWD A;  4ZI7 A;  1R6N A;  3CC7 V;  3SYQ A;  2DYS B;  2COI A;  4E4T A;  3H0G G;  2CFM A;  2A7W A;  4NZM A;  3MR5 A;  3UQ8 A;  4BIZ A;  2ZKO A;  4UUJ C;  4UVC A;  2ZDQ A;  4ECY A;  3G6E V;  3U9T A;  5EWE A;  3FD9 A;  4DL3 A;  2C28 A;  3IGA C;  4WFB V;  3CQZ A;  3OUU A;  4MVM A;  5I5S A;  5KT2 A;  5EZY F;  5KT5 A;  4TQS A;  3QWU A;  4NTW A;  4I55 B;  4JI4 B;  3H1J H;  5CA0 A;  1GYF A;  2FJZ A;  3LSQ A;  3SJB C;  4FLV A;  4A3F G;  4EGJ A;  2HVJ C;  1I5X A;  2P6J A;  3IG0 A;  4DR5 H;  1M4U A;  4EB6 B;  1V54 B;  1SRY A;  4MW3 A;  4FLY A;  4LF9 O;  5DG9 A;  4NXM B;  4A3J G;  1BT8 A;  3TY5 A;  2R7Z A;  2A3Q A;  2UXB H;  4O7R A;  1EN4 A;  2O03 A;  2R7Z G;  1IXM A;  1QNM A;  3JAK B;  1E4F T;  2I80 A;  4U3F H;  3KXY T;  2F1M A;  4YY3 O;  4KP4 A;  3L74 H;  4RAY A;  2C22 A;  3NUA A;  5KG2 A;  3EYY A;  4QE9 A;  4CH4 A;  1JVM A;  4LFC O;  5C1P A;  5GW7 A;  1S5H C;  5KG1 A;  2V59 A;  2CDY A;  5JVL A;  2E2I A;  2R9I A;  1YHQ V;  4PI0 A;  3K79 A;  4Q4C A;  3RB6 A;  1K5S A;  5EYP B;  4LF8 B;  2JEU A;  3ZRV A;  4WFA V;  4KHP O;  2BTO A;  4PA7 A;  1VQ5 V;  4FFM A;  3QNE A;  4UB6 Z;  4O7W A;  4HAM A;  5A2Q N;  3GIJ A;  4LF5 O;  4DR3 O;  3CXH F;  4DUZ O;  4YHH B;  3CME V;  1I94 O;  1ENV A;  3RWR D;  4X1I A;  4J9Q A;  1HNW O;  2AU0 A;  1JJO A;  1YVW A;  1BS3 A;  1Y6X A;  4BAY A;  2FK3 A;  4AYB E;  2P22 C;  2ZIN A;  5FLM G;  1S97 A;  3GTM A;  4BW9 A;  2YS7 A;  1I7L A;  2PZS A;  1YXB A;  4BIO A;  2ZD9 A;  2ZE8 A;  2ZE7 A;  1WR2 A;  3CCE V;  3RAX A;  4QWA A;  5KX5 F;  5JQG F;  1GO3 E;  1SC5 B;  1Q90 D;  2LGW A;  4Z1V A;  4DV1 B;  5K2M A;  4CMF A;  4HYK A;  1ZET A;  1I2K A;  2GSM B;  4EYI B;  3OGI B;  3L71 H;  2EIL B;  1VQN V;  1WRV A;  1SQB H;  2FPP B;  4HBN A;  2NN4 A;  4O3N A;  4ZHQ F;  3R5H A;  2PYL A;  4X66 H;  2ATK C;  3EXA A;  3M9O B;  3N6X A;  4C5B A;  4UCT A;  1US6 A;  3RYC A;  2CW7 A;  2BOC C;  2XAQ A;  4L8J A;  4GX5 A;  1Q6I A;  2A0L A;  4X8A A;  3RYI B;  3AW8 A;  2HKO A;  1M57 B;  2PN1 A;  3N27 A;  3J7A K;  1UFI A;  4FLW A;  4DV6 B;  3WNZ A;  3QVN A;  4R7C A;  2DAA A;  1WA8 A;  5B1B B;  2DYR C;  3JSN A;  3N41 B;  3N40 P;  4J9O A;  3NXS A;  5J9P C;  2DPI A;  3F7Y C;  4A93 G;  5LA6 B;  4ECQ A;  3ZMZ A;  4B3T B;  4JV5 H;  2F93 B;  1M6V A;  2YYA A;  3KYH C;  4JV0 A;  1JX4 A;  4DR4 H;  1MZB A;  3CCV V;  1HNX H;  2QB5 A;  3DXR B;  1VAR A;  4X88 A;  2OLS A;  1Y66 A;  1U97 A;  3RTX A;  1IYD A;  3UYY A;  3FX7 A;  4M7E A;  4Y8V B;  4X20 A;  2UUA B;  4RUC A;  2ASJ A;  3IC7 A;  5H9C A;  5KFO A;  3AG1 B;  5ITZ A;  3LP8 A;  4RU9 A;  4FM9 A;  4WHX A;  3T5H A;  2CTP A;  2ZJT A;  4Q4D A;  3RN4 A;  2UUB H;  3GIP A;  4WBN B;  5IY5 B;  2EJ2 A;  5L3E A;  3CC4 V;  2JA8 G;  3H3V H;  4DV5 B;  1SCU B;  3K0G A;  3N2K A;  4HN2 A;  3D36 A;  4FFN A;  2ZNJ A;  3QO5 A;  1YEW A;  1UC8 A;  1FKA H;  4PV1 B;  4O7V A;  2HGW A;  4I0X A;  5LOV A;  5KA6 A;  1W0J G;  4HR7 A;  3G71 V;  4I50 F;  5C44 G;  5IYD O;  4A3M G;  2Q69 A;  3D3I A;  2COG A;  1JJ2 U;  1QBZ A;  1I0H A;  2Y69 C;  1HNZ B;  2Z02 A;  3G6Y A;  2QA4 V;  4UCO A;  3P3N A;  1JPX A;  1KT8 A;  5CE8 A;  2KKW A;  4P9P A;  2WYO A;  2DWE C;  2ASL A;  5JH7 B;  4EGQ A;  4IIJ B;  2QWO B;  4ED7 A;  1MG1 A;  1R3L C;  1SF9 A;  1ZX3 A;  2A06 H;  5LP6 C;  1EYZ A;  3V4S A;  4GKK B;  2OYQ A;  2KQX A;  4IAJ A;  3GTP A;  2ZQM A;  3CB2 A;  2JJ1 G;  4DV3 H;  3MFH A;  3KAJ A;  1GSH A;  3JZF A;  2XCP A;  4JI8 O;  2CTR A;  4ZIB A;  3RB4 A;  4DO2 A;  3BQ0 A;  2R8G A;  4C7U A;  4ETS A;  5KFJ A;  4HQ6 A;  2R82 A;  4EBE A;  4YAK B;  4DUY O;  2CGN A;  2DWC A;  5LHG A;  1J5E H;  1SES A;  4XYM B;  2R72 A;  3GWK C;  3L72 H;  2BE3 A;  4UV8 A;  3EFF K;  4FLU A;  4TUY B;  1ULZ A;  1XHZ A;  4LC1 A;  2XGP A;  1JDB B;  1FXK B;  3IFX A;  2BSK A;  4ED2 A;  2UUC O;  4GZR B;  4A2B A;  1EM1 A;  4F6R B;  4B3S H;  1AR4 A;  2WLL B;  5LP6 F;  3FKS G;  2C2R A;  3GTQ A;  2EJR A;  1GRJ A;  3BHP A;  4CH3 A;  3HB3 B;  1EZV H;  4DV7 O;  3CX5 F;  4DR6 H;  4B3T O;  2WLK A;  3MD0 A;  2KG7 A;  2YZL A;  1XHX A;  4NXN H;  3HOY G;  1I1L A;  2ETN A;  2ZIO A;  3BY6 A;  2YXL A;  3JZI A;  4AIL C;  4ECU A;  2WA3 A;  3AEI A;  4DR2 H;  2WB1 E;  2CNV A;  1THZ A;  3HKE B;  4CC5 A;  2GUZ A;  2ZIM A;  3ZS8 C;  1GSO A;  2EIY A;  1KJJ A;  3RVZ A;  4YAJ B;  3ZHR A;  1D5A A;  5GON F;  3RB0 A;  2IBZ H;  3AG4 C;  2W9B B;  3B2E E;  5HFL A;  1DAA A;  1FJG B;  5IP9 G;  3OSP A;  5H80 A;  5B3S B;  3DF7 A;  5DGH A;  2EIJ C;  3VPC A;  3E22 B;  2PYJ A;  1VKZ A;  3ZRW B;  3N2G B;  1HW7 A;  5LYJ B;  2HGX A;  2ZM6 O;  1KJQ A;  4GLX A;  5IWA B;  4R6Z A;  1XNR H;  4I5S A;  2AHZ A;  5E1A C;  1S72 V;  1HNZ O;  1SA0 A;  2DW4 A;  5BWT A;  1K33 A;  1SEI A;  2ZR2 A;  4O7S A;  5I5X A;  5IYZ F;  1K3E A;  5LMN O;  1O9G A;  3R5X A;  5KG5 A;  2Q68 A;  4JV2 A;  1NTM H;  3J80 W;  4LFA H;  5KFR A;  3SGI A;  1Q81 W;  1QCE A;  4GKK O;  1D2D A;  3J81 N;  1K97 A;  1YTF B;  4U7C A;  4DR1 B;  4LNU A;  3FYE B;  4IT5 A;  4HNA B;  4R50 A;  1IBK B;  3JZ6 A;  1AP5 A;  3K0D A;  2Z04 A;  4ECZ A;  3P30 A;  5DAA A;  4KXR A;  2D2C B;  4YJ2 F;  4JYA H;  1JDE A;  4ZI7 F;  3MR6 A;  1Z5W A;  2VQE B;  4PDR A;  1TUB B;  3FAV B;  5EC1 C;  1BGY H;  2GQR A;  3OR6 C;  3T54 A;  1I1K A;  2FMA A;  5LGN A;  1K92 A;  1XUQ A;  5EBL C;  1TWC A;  3JAT A;  4TQR A;  5LXT A;  1XDC A;  2PF4 E;  3K5L A;  1V55 B;  3VOU A;  2DQ3 A;  3CCL V;  5KFU A;  3U10 A;  1EKV A;  4FJC C;  5L3C A;  4HNV A;  3OE7 G;  5KHG A;  1MAB G;  2W9C A;  4LWS A;  1I2L A;  1A48 A;  1KMI Z;  2DZD A;  5B1N A;  4MV3 A;  2P7T C;  1PL0 A;  1M1K W;  5CA0 F;  1KYO F;  3ZHS A;  5KFA A;  2ODT X;  4IR1 A;  3J7A U;  5EIB C;  1K73 W;  2V4Q A;  3OEE G;  1GGO A;  1FAF A;  4L1K A;  5L9X A;  3QZ7 A;  2XGQ A;  2R8K A;  2UXN A;  2XCA A;  3A2F A;  3CCM V;  1W2B U;  5K1P A;  1KJI A;  4I7Z B;  4X65 B;  2NU9 B;  4ECS A;  3CJH B;  4O4I A;  4K8X A;  3OGC C;  1YJW V;  2W6I G;  2VQF O;  1OCC C;  3AG7 A;  4DL5 A;  2GTS A;  2X6A A;  2Q4P A;  4TV9 A;  4O2B A;  4J7J A;  4JI6 B;  5LHH A;  1YCI A;  2EJ3 A;  2DOS A;  4WCE V;  5L1J A;  4QIW E;  1JA8 A;  2DPJ A;  3T1Y O;  5CN0 A;  5DIS C;  3T99 A;  4BBS G;  2LGQ A;  3G6X A;  5LMU H;  5D5P A;  2P0A A;  1CXZ B;  4DL7 A;  1M0W A;  5DGA A;  4AYB A;  1KBH A;  2DWD C;  4FU0 A;  4PEL A;  3ABK B;  3BFR A;  1D5N A;  1Z5V A;  3V6J A;  1SZT A;  4B3M B;  1I7F A;  5H6R A;  2W6O A;  4JI5 H;  2XOK G;  4J7Z A;  4LH7 A;  4DV0 H;  3Q4H B;  4GKJ B;  5IWA O;  2AW9 A;  3A0B Z;  1V51 A;  5JVD B;  2W7P A;  1VBH A;  1Y74 A;  2PMZ E;  1FD9 A;  5KUK A;  4MTE A;  3CS5 A;  2RNB A;  3GDE A;  2B9Z A;  4DW1 A;  4X1Y A;  5IJ9 A;  2WLN A;  2UUB O;  4I4T A;  5BPH A;  2IP4 A;  1ZHQ A;  4PA4 A;  4DR1 O;  3OUF A;  1K8A W;  4E6N A;  1ZHS A;  1X59 A;  4KUM A;  1KKD A;  1OCO C;  1IBM O;  4ECX A;  1PNK A;  1TA8 A;  3E83 A;  4JI3 B;  1P16 A;  2RDI A;  1S5J A;  1RPO A;  4K3A A;  1M90 W;  3KHL A;  3GJX B;  3OR7 C;  2VQE O;  3JAW B;  2EJ0 A;  1VQO V;  5LL6 Y;  1X4T A;  1QR8 A;  4FFL A;  2OCH A;  1SQG A;  4FS1 A;  4F6R A;  1I7N A;  2RCV A;  5I5V A;  2BR0 A;  4JI2 B;  1H2L A;  1I3Q A;  2M6Y A;  2MCT A;  3D36 C;  4MAM A;  4RUF A;  3L2P A;  4IRC A;  2OIE A;  3RBZ A;  2P4V A;  2L6L A;  4QPK A;  5LGT A;  4P2Z A;  5J2U B;  2Z5U A;  5JWP A;  2QM7 A;  2ATL A;  1BHA A;  4R7R A;  2J9G A;  5IYB G;  3GQC A;  1M93 A;  3OMN B;  5BWV A;  1Q43 A;  4X1K B;  3T9F A;  2Q0A A;  3JAL A;  3MDS A;  1XI1 A;  2BTQ A;  3HPL C;  4LCU C;  5B1A B;  1Q7Y W;  5BMV A;  3CCR V;  2YIC A;  5KFK A;  3OEH G;  1VS0 A;  1L0L H;  1DIK A;  3B8M A;  4IGG A;  2FPG B;  5C8Y B;  1GN2 A;  3SJQ C;  5B5E Z;  4X65 O;  3GV5 B;  4E4E A;  1H8E G;  1TGO A;  4LF4 B;  2R92 A;  1Y4M A;  1XMO B;  2Q7G A;  2K1E A;  2NVX A;  2HIX A;  1NH2 D;  4PA9 A;  2E74 B;  4NTX A;  3RYF B;  4FLX A;  4O3P A;  3DSQ A;  1XMQ H;  1EKF A;  2GV9 A;  1Q3E A;  1GSA A;  4J9N A;  3TCU A;  1W96 A;  5A2Q W;  5FPR A;  4G3I A;  4Z2W A;  3QZ8 A;  4B3M O;  5LOV F;  1G6U A;  2R87 A;  4JI4 H;  4PD4 F;  2XTA A;  1CQJ B;  3H4B A;  1S5L Z;  3H1H H;  3SYA A;  2W6N A;  4JI0 B;  1EUC B;  1AJN A;  1MMM A;  3G80 A;  4GKJ O;  3BCC H;  3SNO A;  3HKD B;  1KQS U;  2JRI A;  2UVV A;  3L73 H;  3PN1 A;  3U9S A;  5KFL A;  4OXS A;  4B7E A;  2EIK C;  2R7L A;  4MVO A;  5BR8 O;  3RYH B;  2R7M A;  4FFO A;  3PW2 A;  3CSX A;  2WLI A;  3MAQ A;  4J9M A;  5IJ0 A;  4O3R A;  2QE7 G;  4C5A A;  1V54 C;  4LBE C;  2LW7 A;  1Y1W A;  4LF9 B;  4AQY B;  2HDK A;  3UKM A;  1Y1W G;  4JGS A;  3FAV A;  3ZMS A;  3QQM A;  4GX1 A;  3VQV A;  3WWH A;  3KTM A;  1EUD B;  4YB8 B;  4LFB B;  2QWQ B;  3HOV G;  1PD3 A;  1RM1 B;  3M9M B;  2V7Q G;  5I5T A;  3C90 A;  2CH7 A;  1N32 H;  2Q2U A;  1CE8 A;  3H1L H;  2J6U A;  4F4L A;  1SQP H;  1VQ6 V;  3O9O A;  1GM7 A;  4LFC B;  3W1G A;  1SQQ H;  5KFB A;  4LF8 H;  1KKC A;  4TQD A;  3UZB A;  2IMW P;  3TW6 A;  5FJ8 G;  3K57 A;  4DR7 O;  4JI2 O;  1JFF A;  4YHH H;  2JK5 C;  2V9W A;  2YRW A;  3OUZ A;  2WB1 A;  4KHP B;  1P8L A;  1HR0 B;  1K83 A;  5I60 A;  2UU9 H;  3OT7 A;  3WB1 A;  2BQR A;  5KFH A;  4FS2 A;  2GPW A;  2UVW A;  2VA2 A;  1E4E A;  4LF5 B;  1KB9 F;  2JGD A;  3K9S A;  4DUZ B;  3U55 A;  1HNW B;  5KG0 A;  3TIG A;  1Q82 W;  3AX6 A;  4DRF A;  2CKZ B;  5JQW A;  4G2K A;  1EHI A;  4NLG A;  5D1O A;  1UPG A;  3H9V A;  2J6T A;  3MHS C;  3MWD A;  2FK2 A;  1WAZ A;  5FNV A;  5J2T A;  3UT5 B;  5KFM A;  1AP6 A;  4PJ0 Z;  4TV8 B;  3RF2 A;  1S0N A;  5CB4 A;  3NBZ B;  4MV4 A;  2ADQ B;  5KG6 A;  2HHH B;  3M4I A;  2R6F A;  4BBR G;  4K0K H;  3DC6 A;  4O7N A;  3Q8R B;  4TQF A;  4LF6 H;  1OZ0 A;  2QEX V;  1AI4 A;  4O4J A;  1L1F A;  2CUG A;  2UXD H;  1GAX A;  4I7H A;  4DV6 H;  4DV2 H;  4CS4 A;  1NT2 B;  3WU2 Z;  3GTJ A;  4FFK A;  5L3B A;  4Q44 A;  4ZOL A;  3OMA B;  3TK1 A;  1S9F A;  4IHJ A;  3DAA A;  4QNH B;  1S68 A;  3R9R A;  1VQ4 V;  4R8U B;  4XBF A;  4J10 A;  4A3K G;  4PZ8 A;  4JI0 O;  1YIT V;  1ARO P;  2RDJ A;  3WB2 A;  1IBL B;  2HG8 A;  4B3R B;  2W9A A;  1R3K C;  3VQY A;  4CS3 A;  5TIS Z;  1H2S B;  4YJ3 B;  1K7D A;  1BXR A;  3Q8P B;  4MT8 A;  3K9A A;  5KFE A;  1SS3 A;  1IX9 A;  2UUA H;  1QLN A;  3HBL A;  3X2Q C;  4KL1 A;  5KT3 A;  1S3J A;  4O4L A;  1H38 A;  2GPS A;  4FBU A;  4TOI A;  4X64 O;  4AQY O;  4QW8 A;  3RFR A;  2AHY A;  3L75 H;  3AYH B;  3N44 B;  2NUA B;  4UFZ A;  3FFQ A;  2Z3Y A;  3OHB A;  5F9L A;  2OT5 A;  3H40 A;  4A3D G;  1A0I A;  1OCR C;  4LFB O;  2Y0I A;  1BHB A;  1N36 H;  2YIB A;  3UCS C;  1S0M A;  3PVX A;  5KG7 A;  4JTC B;  2ZE5 A;  5IY5 C;  4ECV A;  4OX9 H;  5BY1 A;  3BQ2 A;  2Q67 A;  4JAU A;  5KFV A;  3KKY A;  4UVB A;  3BA8 A;  1S10 A;  2GDS A;  2FYU H;  3ZMV A;  5F9N A;  4X89 A;  1N33 O;  1PK8 A;  1XNQ O;  2EIM C;  4JYC A;  1VQ9 V;  5LXT F;  4EBD A;  3CCJ V;  2NU7 B;  3OHA A;  3KRE A;  2YC0 A;  3EHB B;  4YIP A;  3I4N G;  3OTF A;  1R6T A;  2X6C A;  5KFF A;  1SQX H;  3FB6 C;  1PPJ H;  4IRK A;  2B63 A;  1HR0 O;  4JZ2 A;  3T1H H;  4PDL A;  2B63 G;  1NU1 H;  2IW5 A;  4QIW A;  3AK1 A;  3TW7 A;  3RBD A;  3RB3 A;  1KTA A;  3W7X A;  1P84 F;  2YDE A;  1E1Q G;  2Y0S E;  4BW5 A;  3OTO B;  1Y76 A;  4MSW C;  2I87 A;  5BWR A;  4FFB B;  2IJJ A;  2FLL A;  4JYY A;  1JLL B;  4IR9 A;  4O4I F;  3I12 A;  3ABU A;  1S76 D;  1M0T A;  2EIN B;  1BCC H;  4JI8 B;  4TV9 F;  4O2B F;  3ASN B;  2WAM A;  3OD4 A;  4ZBM A;  1VQM V;  1L2Z A;  2HHH O;  2YXY A;  4XYL B;  1XEQ A;  2PMZ A;  3HOZ G;  4DUY B;  1RJR A;  4FZ1 A;  2JDI G;  5KLV H;  2J6S A;  5K3W A;  4MTX A;  4CC6 A;  5EZY B;  3BAA A;  4WFH A;  4LF7 H;  4X62 O;  4U7N A;  2ZXW C;  4FVM A;  1RYS A;  2E5L B;  1ZL8 A;  5BYB A;  2YEV B;  1VBG A;  2W0X A;  3A0R A;  3RGB A;  1ZQ7 A;  2XT9 A;  3JAR A;  1FXK C;  5DM6 V;  4TT3 G;  4NZO A;  1GO3 F;  1AI7 A;  3R65 A;  3RVY A;  5KHI A;  2Q7D A;  2UUC B;  3THO A;  1EFR G;  3AK3 A;  4BWA A;  1IBL O;  1QU7 A;  1VF7 A;  1S77 D;  4B3R O;  2W71 A;  3J81 W;  1GN3 A;  5DQI A;  3SYP A;  4NR1 A;  3APO A;  1F23 A;  4DV7 B;  1VP7 A;  2R8H A;  1I1M A;  3MFI A;  4F6E A;  2V58 A;  3L9D A;  1RK5 A;  1M9N A;  4RUE A;  4I4T F;  1XL6 A;  3E8B A;  2NU6 B;  4A3L G;  3H4D A;  4J9P A;  4XDK A;  4GLW A;  1COW G;  5DED A;  3ABL B;  5CBH A;  1FJG H;  4J42 A;  5JUM A;  2UVU A;  1I08 A;  2YUA A;  1YIJ V;  3FB7 C;  1O9H A;  2X0L A;  3CP1 A;  1GN4 A;  2XIG A;  3MWM A;  2EZO A;  3RFC A;  1KC7 A;  4DL2 A;  1I5Y A;  4IYI A;  3JRX A;  2YIA A;  4K35 A;  1XK5 A;  2JEX A;  4ED8 A;  5L1L A;  2Q9L A;  4O2A A;  3G4S V;  5BWU A;  4BR6 A;  1LR1 A;  2ZM6 B;  2X7R B;  2ZDI A;  3ABM C;  4FM2 A;  3KHG A;  4CKC A;  4DRX A;  1EBO A;  5DG7 A;  4JI7 O;  2NNU A;  4JAV A;  3ETD A;  2HR3 A;  4P30 A;  3BA9 A;  5K1X A;  4TM5 A;  3RR5 A;  1QLE B;  1HDJ A;  4O4H A;  1K9M W;  2R84 A;  5KT4 A;  3CCU V;  2UXB B;  1CKN A;  5KX5 B;  5JQG B;  5L3G A;  5LMN B;  4GCZ A;  1IBK H;  1VEW A;  3F5T A;  2W8L A;  1N0N A;  2WA4 A;  1L8D A;  3M99 B;  2CZG A;  1F4M A;  3HKC B;  1Y67 A;  3WFV A;  5BMV F;  3PR5 B;  1BL8 A;  1OHH G;  3OTO O;  4J7K A;  3STL C;  4ZHQ B;  1BJT A;  2R70 A;  3PO3 G;  2UXC O;  2DQ0 A;  3LSU A;  5KFN A;  1WP8 A;  4W4K A;  1RFY A;  3CCS V;  3PW0 A;  1XDN A;  1WCM A;  1DGS A;  4ED0 A;  4MVQ A;  1FFX B;  4Q8F A;  3CRC A;  3K5N A;  3T9D A;  2ITC C;  3SDL A;  3ZJZ A;  2QK4 A;  1M56 C;  5DG8 A;  3WG7 B;  4JI1 O;  1N34 H;  4RZQ A;  1LNQ A;  5FR9 A;  2OIG A;  4WFG A;  4QWB A;  2VQD A;  2QTS A;  1DLB A;  4CH6 A;  2H3O A;  3IJ4 A;  1X9N A;  3LNM B;  5H6Q A;  4FM1 A;  5C3E G;  2HEP A;  4MVU A;  5DEC A;  2E5L O;  2DN9 A;  4I55 A;  3ZMT A;  4LH6 A;  3ETH A;  3K06 A;  3ZHU A;  2IJI A;  5I5Y A;  3T9E A;  2YW2 A;  3K58 A;  3N42 B;  3LML A;  2HP8 A;  2HVQ A;  1T3N A;  5GTI Z;  4DV4 H;  4EB6 A;  2K9P A;  1I6U A;  1BSM A;  1YZB A;  4WF9 V;  5E25 A;  3HOW G;  4GC6 A;  5AG2 A;  3I5D A;  4JI6 H;  3JAK A;  4X66 B;  2ZDG A;  3Q8S B;  2VQF B;  2FPI B;  1FXV A;  2W8K A;  1H2M A;  1KEC A;  3GVM A;  3BEH A;  1NTZ H;  4MVR A;  3TII A;  5KFG A;  3B77 A;  4RNN A;  3WO0 A;  3GWO A;  3KCY A;  5D5Q A;  1ZWI C;  2HHF B;  2PGG A;  5I5U A;  1KBL A;  2DYR B;  1F4N A;  3VNN A;  4EEQ A;  3ZED A;  4YIO A;  1KP2 A;  5CAE B;  2V4R A;  4I50 B;  3T1Y B;  4U3J B;  4J9S A;  3CE2 A;  4ICG A;  4C5C A;  4EYH B;  4F4Y A;  3JD3 A;  5EYP A;  2CK3 G;  4MVS A;  4O83 A;  1TWF A;  4O7T A;  2BOB C;  5LL6 b;  3HKB B;  3UM7 A;  1BZK A;  1IVS A;  3K5O A;  5EC2 C;  2HVK C;  2EUL A;  4CKB A;  1VQ8 V;  4JV5 B;  4CKE A;  3ZBH A;  2FP4 B;  1PM9 A;  4MTG A;  4KFM A;  4DR4 B;  1K4C C;  4A5U B;  1HNX B;  1VF5 B;  4CMD A;  4FIP C;  1CS0 A;  4DR5 O;  3E35 A;  4F4W A;  1OBG A;  4BY1 G;  3JAM N;  3V6K A;  2CW8 A;  3K3W A;  5L1K A;  3JYC A;  1IXB A;  4MW8 A;  2UXB O;  4QWE A;  4J9R A;  5KKN B;  4C2M A;  5JJE B;  4JI3 H;  1F7Y A;  2UUB B;  2F4V H;  5FNV F;  4JTD B;  1IOW A;  5J2T F;  4HYO A;  2QWP B;  2YCH A;  5CR5 A;  2HGS A;  5EWG A;  2OCC C;  1P7G A;  2XCL A;  3FKI A;  4E2L A;  4FBT A;  1F51 A;  2Q5Z A;  1IBM B;  5CB4 F;  2CE4 A;  4PBC A;  4GYC B;  4U6P A;  2C2D A;  2FKL A;  2CNU A;  2Y69 B;  4OPH A;  2QF7 A;  3STZ C;  4PDM A;  4UCR A;  4O86 A;  4EKW A;  2VPS A;  3W7W A;  2AGP A;  2YEV A;  2E2H A;  3RYI A;  5CA1 B;  4O4J F;  3SR2 C;  4ME6 A;  4DL6 A;  1TWG A;  2YZG A;  3NBY B;  4LMY A;  3HOX G;  4ZOL F;  4IHJ F;  1V4Y A;  5KHK A;  5EK0 A;  5DGB A;  3MWE A;  2YS8 A;  2M7W A;  4XDJ A;  5LA6 A;  3CEB A;  5KFI A;  1QHT A;  4NYK A;  3PJS K;  3K08 A;  4YR3 A;  4JAS A;  3T1C A;  2LW1 A;  2Y4U A;  4DV3 B;  2HLD G;  3DXR A;  5BYA A;  3QO8 A;  4LF4 H;  1XMO H;  5B1A C;  5KFS A;  4K6N A;  3M9N B;  4O4L F;  4JTA B;  3G8D A;  1NTK H;  2W6Q A;  5GON B;  4X66 O;  4RNM A;  3LWB A;  1J5E B;  4WBN A;  4YQW A;  2QJ1 A;  1ET0 A;  5EWF A;  2LQT A;  4D7T A;  3TET A;  2Q8V A;  1RYR A;  2F43 G;  3GTL A;  3DGE A;  5BXZ A;  2XAF A;  4FFR A;  3TY9 A;  1NH2 B;  3ZCC A;  4QJF B;  1VQP V;  3RAQ A;  1JCH A;  4CS2 A;  1OCZ B;  2YL2 A;  3V4Z A;  4LP8 A;  4EG0 A;  2Y0S A;  5IYB O;  5LHI A;  2AZ2 A;  5J2U F;  3N8D A;  5IYZ B;  4MTF A;  4DR6 B;  2JEI A;  4JV5 O;  3I56 V;  5JH7 A;  5B1O A;  4IIJ A;  1TWA A;  4PDB A;  5IDJ A;  4Q6G A;  3OM3 B;  4DR4 O;  3T4Z A;  1HNX O;  1RSO B;  2W57 A;  4J9K A;  1ZAU A;  3PFF A;  4LF9 H;  3RGZ A;  1R73 A;  4QIW F;  2QGN A;  3JAS B;  1BMF G;  5BR8 B;  1NVP D;  2QWN B;  3QFF A;  3UFX B;  3P3P A;  1GLV A;  5BWX A;  4YJ2 B;  2PI5 A;  4ZI7 B;  1CKO A;  2ABJ A;  5KFT A;  5IE9 A;  1PL4 A;  2C2A A;  3ASO C;  2PY5 A;  4DAA A;  2EIJ B;  2YZN A;  2JEF A;  2PUS A;  2F95 B;  4YY3 H;  2LFR A;  1N8R W;  5FD6 A;  1B3Q A;  3JCU Z;  3RGX A;  4LFC H;  1YDX A;  3W7S A;  3TXQ A;  4O3O A;  1WPB A;  3OFN G;  2E75 B;  1FKA O;  2IM9 A;  4RAZ A;  4MV8 A;  2HFE C;  1H2N A;  1JXL A;  5JJJ B;  4TUY A;  3VMM A;  1C30 A;  3G67 A;  3GTK A;  3JD4 A;  2DAB A;  2QWR B;  4KHP H;  1TUE B;  3MR3 A;  1UC9 A;  3HXL A;  4ECR A;  1FXK A;  1S0O A;  3P32 A;  1Q8I A;  2JA7 A;  4UXN A;  2N04 A;  5CA0 B;  4D6T H;  3SYC A;  4DR7 B;  2WLL A;  4LF5 H;  2RMK B;  1B06 A;  4DR3 H;  5H5N A;  2V5A A;  4DUZ H;  4UB8 Z;  1I94 H;  3TEK A;  1HNW H;  1PV0 A;  2IH1 C;  3RJ0 A;  3APQ A;  3D8C A;  4DK0 A;  1P4R A;  3KG2 A;  4MA5 A;  1VF6 C;  3W1B A;  1SZX A;  2ZDI C;  4DV3 O;  3F5W C;  5DMX A;  4PZ7 A;  3AG2 C;  2YID A;  4DK1 A;  2QKA A;  2W0F C;  2R7N A;  4JYA B;  2ODM A;  2C35 B;  3HKE A;  4MA0 A;  3G6V A;  2EJ7 A;  3TIN A;  4RB0 A;  5HFM A;  2IU3 A;  2MK3 A;  3ZRS A;  4DYL A;  1J5E O;  2YWV A;  2R92 G;  2W9B A;  1EN6 A;  3GIQ A;  2IH3 C;  5D1P A;  1FS0 G;  5GTH Z;  4F4X A;  2DYS C;  4Q8E A;  5CMU A;  1Z2N X;  3E22 A;  4IZO A;  1SQV H;  3ZRW A;  3N2G A;  5LYJ A;  3UO2 A;  4PHZ A;  5KT6 A;  2IJK A;  5B66 Z;  2R8I A;  1KUQ A;  3T9A A;  5KAI Z;  4PI2 A;  4B3S O;  1HWY A;  2XHB A;  1XL4 A;  3T9B A;  4O2A F;  4RQF A;  4X1I B;  4Q20 A;  3CRQ A;  5BZB A;  1OCC B;  4DR6 O;  3FB8 C;  2HIV A;  2WE6 A;  2EX3 A;  1KC8 W;  5HNE A;  5C4X G;  1KD1 W;  3SPC A;  4NXN O;  2LJ2 A;  2GTA A;  2QSA A;  3SPI A;  3BVO A;  5DGI A;  2VOB A;  4O4H F;  3GV8 B;  2G38 A;  1C3O A;  3SJA C;  1WJZ A;  1K4D C;  3B40 A;  5LGU A;  4NXM H;  2CNQ A;  4DR2 O;  2FKX A;  1YJN V;  4HNA A;  2YS6 A;  5JJN B;  4X64 B;  2JA6 A;  3WWI A;  1N0J A;  1LUW A;  1TUB A;  5BWW A;  3PW5 A;  4A3B G;  1VAJ A;  5CA1 A;  1BQZ A;  5D8D A;  4H33 A;  3RYC B;  1QVG U;  1DF5 A;  2IJH A;  1VMG A;  4Q45 A;  4IRD A;  1R3I C;  4QSH A;  3L4J A;  4JI5 B;  2QKS A;  4DV0 B;  3ORQ A;  1WA8 B;  3U0Z A;  3I4M G;  1XNR O;  3JD1 A;  1N33 B;  1XNQ B;  1WN7 A;  4O3Q A;  3T4D A;  3E8G A;  4HZ3 A;  5KFP A;  2NVY A;  4IWX A;  3SPJ A;  4I55 F;  2ZDH A;  1XRE A;  3T5K A;  1EKP A;  1UJW B;  2V1D A;  2X0S A;  4LFA O;  3ETE A;  1CQI B;  4MV1 A;  2AGA A;  3FDS A;  4EFB A;  3VQX A;  3CJH A;  1N48 A;  4X20 B;  3AG3 B;  2XAG A;  5DN6 G;  4JI8 H;  4U7O A;  4DV1 H;  3K5H A;  4QPJ A;  4JYA O;  3H01 A;  3BPZ A;  4GX0 A;  1FYJ A;  2YRX A;  1ZUQ A;  2CTQ A;  2FL4 A;  3OSN A;  1TVK B;  4DUY H;  2Q0O C;  3N2K B;  3GTO A;  3DTU B;  2EIL C;  3KHR A;  3ZX6 A;  2R9A A;  4I0X B;  5LOV B;  4B08 A;  2MW2 B;  3S24 A;  2HVS A;  2FK1 A;  3NR7 A;  2JJ2 G;  3RT3 C;  3GIK A;  4O82 A;  2PI4 A;  2CTW A;  4R8C A;  5EIB D;  1IZ3 A;  4Q43 A;  3Q4H A;  1EN5 A;  3OMI B;  4PA3 A;  4X62 B;  3PZP A;  2UUC H;  1DV1 A;  5KAF Z;  1M57 C;  4RWU A;  5JVD A;  2LP7 A;  3HR0 A;  1ORQ C;  3TJT A;  1Q5O A;  2FB9 A;  1A3G A;  4DV7 H;  5IT9 N;  3KZI Z;  4EEY A;  1GK9 A;  3UO3 A;  4B3T H;  5B1B C;  4MV7 A;  1LUV A;  3H0G A;  2N05 A;  3QG5 A;  1AI6 A;  3UZO A;  4OPA A;  2ASD A;  1M5I A;  4DLK A;  2B5U A;  1GKF A;  5FLX N;  1AB3 A;  2N74 A;  1R1B A;  3DC5 A;  1AJQ A;  1XMQ B;  3JAW A;  5LMU O;  1DTO A;  3ABL C;  1H2G A;  2COJ A;  4QGP A;  3AG1 C;  1RPR A;  4DV5 H;  1MA1 A;  5KHH A;  1MZE A;  3R66 A;  4RNO A;  1YSC A;  1BQ0 A;  3F8N A;  2AGO A;  2EIK B;  1W93 A;  1G2W A;  4JI5 O;  4P9O A;  2ZM6 H;  3DTF A;  4J9L A;  2XC9 A;  4DV0 O;  2BSK B;  3GTG A;  4YXW G;  1PNL A;  3KHH A;  1GN6 A;  1JQ0 A;  1HNZ H;  2JS3 A;  5J2U A;  1T36 A;  2VUG A;  4LSX A;  1R6K A;  1G8M A;  3CWB H;  1KJ9 A;  5LA6 F;  4UUG A;  5LMN H;  2KG7 B;  2ALZ A;  4JI7 B;  3PR4 A;  1QLE C;  4X1K A;  1XOU A;  2P67 A;  4FGR A;  4M0J A;  5IYC G;  1Z2O X;  4GKK H;  4FM0 A;  2KSD A;  4J80 A;  4D7S A;  3A0H Z;  5KFW A;  1AR5 A;  4X9Q A;  2VWJ A;  3LQS A;  1SYX B;  1B04 A;  5C8Y A;  3K03 A;  3JSL A;  1AUV A;  4JYB A;  1V9P A;  3I55 V;  1N32 B;  2GUZ B;  1VIB A;  4IYH A;  4HNU A;  5BPF A;  3ETJ A;  3R23 A;  2UXC B;  1FFT B;  1QVF U;  2YZM A;  3RYF A;  4LR3 A;  2HG5 C;  3SYO A;  2W6Z A;  3K5I A;  4WBN F;  5KG4 A;  4O7L A;  1ZLZ A;  2QM4 A;  3KAL A;  1T5E A;  2QYZ A;  3ETG A;  4J41 A;  4YBZ B;  4LSA A;  3R5F A;  3GV7 B;  3WG7 C;  1ZSP A;  4JI1 B;  3V6H A;  4GX2 A;  2Q7H A;  2UU9 B;  3CYO A;  1A0G A;  5DLG A;  1NR1 A;  5KFY A;  3GLK A;  3W7U A;  4RB1 A;  1SA0 B;  3HKD A;  2HVR A;  3CD6 V;  1EZJ A;  3JAM W;  4CBC A;  3CPW U;  3BAC A;  1YF2 A;  1GM9 A;  1FVI A;  5JH7 F;  4H13 B;  3ZIA G;  3OUS A;  3RYH A;  4IIJ F;  4MV9 A;  3S3X A;  4FPP A;  5KUM A;  5C5J A;  1E79 G;  3LDC A;  4BY7 G;  4DQN A;  2E3C A;  2E76 B;  2VUM A;  2KB1 A;  5C93 A;  2WLJ A;  2FE3 A;  1WB7 A;  2VUM G;  3FB5 C;  4LNU B;  5KMG B;  1OBD A;  4QW9 A;  2VQF H;  5KFC A;  1P49 A;  3CSW A;  4JXU A;  2BQU A;  3T2M A;  4BIU A;  1AIL A;  3G8C A;  4K0K B;  2EZP A;  4MV6 A;  2ZT9 B;  2WLM A;  5CBG A;  3N43 B;  4LF6 B;  4NTY A;  3CVZ A;  2UXD B;  2Q7E A;  3T1Y H;  3MHH C;  3CXC U;  5EOY A;  3WB0 A;  4DV2 B;  1P7B A;  1PP9 H;  1XMQ O;  2B1G A;  3JAT B;  1S0V A;  4L87 A;  4ED1 A;  5LXT B;  1XIL A;  5C1O A;  3MR2 A;  4Z1M G;  3CEI A;  4JI4 O;  2JEG A;  2OTL V;  5F2V O;  1CKM A;  4TUY F;  2F23 A;  4QWC A;  2DE0 X;  3HT5 A;  4LWS B;  4ZKI A;  2W9C B;  5IWA H;  3PW7 A;  2W6P A;  1GTO A;  5B3S C;  3ZMU A;  1K1Q A;  3X2Q B;  5KA5 A;  2VRZ A;  5HV6 A;  2RJZ A;  2CQY A;  4ECT A;  4FLZ A;  4NXM O;  1BNC A;  2P06 A;  3TXS A;  3M8A A;  1VF6 A;  1MOF A;  2Q2T A;  2C2E A;  2HJW A;  2H8P C;  3SE7 A;  2YI9 A;  4JUZ A;  4O7Y A;  4DR5 B;  1OCR B;  3A8T A;  4O4I B;  4IL6 Z;  1WP7 A;  2B1I A;  1W0K G;  3K04 A;  4WFE A;  3BJY A;  3EPG A;  2PVP A;  1FPO A;  4DR1 H;  1TVK A;  3UT5 A;  4RO2 A;  4XDL A;  2ZGI A;  4FMT A;  4O2B B;  4TV9 B;  4TV8 A;  1N36 B;  2WSS G;  1IYE A;  1IBM H;  2JEJ A;  4A3G G;  1CPY A;  3QF7 A;  1W59 A;  1NBM G;  1N32 O;  2EIM B;  4OX9 B;  2VQE H;  3WO1 A;  1AVM A;  4WD3 A;  3JD0 A;  4ECW A;  4I9Q A;  1R9T A;  5CBF A;  2ZR3 A;  2RN9 A;  2WAQ E;  4LF8 O;  3U54 A;  3RIZ A;  1PNM A;  1WCM G;  1SQF A;  4PA6 A;  4PDV A;  3L4K A;  2IU0 A;  3NGD A;  4FLT A;  3TY8 A;  2GBO A;  4YHH O;  5LYJ F;  2Y0P A;  2WDT A;  2UU9 O;  4R8U A;  5L3D A;  3T1H B;  2RF4 A;  3VPB A;  4WFF A;  4W4L A;  1Y74 B;  4JV1 A;  1V55 C;  4TVI A;  2OWO A;  5KG3 A;  3CCQ V;  5KFX A;  4DIM A;  4YJ3 A;  3CMA V;  3PW4 A;  4X1Y B;  5IJ9 B;  4EBC A;  4DV1 O;  2VS0 A;  1WLE A;  4BXX G;  1AUX A;  1E4G T;  4I4T B;  3GIL A;  2JGU A;  5CM0 A;  2OH2 A;  3D3Q A;  2W6M A;  4NKG B;  2ITD C;  4X65 H;  4UV9 A;  3IC9 A;  1TWH A;  4JZG A;  4EQ5 A;  3IAY A;  1EZ1 A;  4Q0Y A;  1VQK V;  2ZXW B;  4K0K O;  1B33 N;  5L3F A;  2RDC A;  3CHX A;  4LF6 O;  2UXD O;  4A3I G;  1E1R G;  2JIZ G;  5CA1 F;  4DV6 O;  4DV2 O;  4TWK A;  2OTJ V;  1TAE A;  4LF7 B;  3W7T A;  1OWT A;  4CH5 A;  2A1H A;  2GHY A;  2P5O A;  4B3M H;  1OCZ C;  3LUL A;  1SET A;  3OAA G;  1URF A;  1PX2 A;  2W70 A;  2JVD A;  2X6B A;  3GID A;  3RW0 A;  4ED6 A;  2BCC H;  4GKJ H;  3Q1K A;  3ABK C;  5IYD G;  1BGW A;  4MTO A;  1J95 A;  2W7O A;  3JRW A;  3WWJ A;  3VQW A;  2X5R A;  2F66 C;  2A9H A;  4N21 A;  1K5Q A;  2YXH A;  2FML A;  3QTC A;  5BR8 H;  3JAL B;  2D3O W;  3PO2 G;  2BTQ B;  1S03 G;  2DMX A;  2UUA O;  5BMV B;  1NZ6 A;  4N23 A;  4DL4 A;  2HJF C;  1Z2G A;  2AGQ A;  1KP3 A;  1DK1 A;  2W6J G;  5IP7 G;  4NVP A;  4G28 B;  2VR1 A;  4FFB A;  1A9X A;  1UNN C;  1K34 A;  5EBW C;  1NVP B;  3QO7 A;  1QQC A;  1RJP A;  4RZR A;  3FYI B;  4DV5 O;  4YR2 A;  1N36 O;  4B7K A;  3MJF A;  3RBE A;  1VQ7 V;  1JR9 A;  3HKZ A;  1N4C A;  1B6S A;  3ICX A;  3SPG A;  4OX9 O;  4ED3 A;  3C3T A;  1WH2 A;  3EPI A;  1Y1V A;  3ABM B;  1BE3 H;  5E79 Z;  1FXH A;  1WB8 A;  3TQT A;  3ETQ A;  1Y1V G;  2ARH A;  4DW0 A;  3FKI G;  5EZY A;  2IBK A;  2PTM A;  5LBQ A;  1AI5 A;  1T94 A;  4DR7 H;  1AR1 B;  1AJP A;  5DQG A;  5JCO A;  4JI2 H;  3BAB A;  3K3V A;  3CRM A;  2SCU B;  3T1H O;  5LP6 B;  4APM A;  1KEE A;  3BQ1 A;  2NLJ C;  5JVD F;  3LUT B;  3E86 A;  5KMG A;  2WLI B;  2EBO A;  5IJ0 B;  2XD4 A;  3B4S A;  2JS5 A;  2C00 A;  5FD5 A;  3FMA A;  4F50 A;  4RAI A;  5T14 A;  3VBB A;  3E5N A;  3CRR A;  1M56 B;  5KFZ A;  1GH6 A;  3VA7 A;  2P4K A;  4I9W A;  3B8N A;  4FK5 C;  2QR4 A;  4K8Z A;  4GC7 A;  2UXX A;  2CH7 B;  4CE5 A;  4GT1 A;  3K3P A;  2QDO A;  2Q73 A;  2Z0A A;  4GUN A;  4RQE A;  1Y14 B;  3TQ1 A;  3H1K H;  4H0L B;  2WWW A;  1N34 B;  1IOV A;  2ZE6 A;  4UCU A;  2JA5 A;  4UCS A;  1H8H G;  4XZ3 B;  3K59 A;  2JA5 G;  4LF7 O;  2QTO A;  4NYE A;  1RJQ A;  3H1I H;  4DXW A;  5CA3 A;  4FE2 A;  1JFF B;  1JX9 A;  2XAH A;  1YJ9 V;  4JI0 H;  4TSF G;  1K1S A;  4B3S B;  3LDE A;  1E4E B;  4DV4 B;  3H20 A;  5DLF A;  3F7V C;  4QE7 A;  2JGD B;  3ZN1 A;  1KUT A;  2V4D A;  2R86 A;  1IDS A;  2Y4R A;  5KX5 A;  5JQG A;  4O81 A;  1NR7 A;  5D1O B;  2XAJ A;  4NXN B;  3U0G A;  5I5W A;  2XAS A;  5FNV B;  5J2T B;  3HKC A;  1N56 A;  1SFO A;  1A32 A;  4X64 H;  1B6R A;  3ZHQ A;  4ZHQ A;  4AQY H;  1OJH A;  1WSC A;  5CB4 B;  5C8Y F;  2RGR A;  4DR2 B;  3E8F A;  2ADP A;  3AK2 A;  1HP8 A;  3AG4 B;  1FJG O;  4LFB H;  4O3S A;  3VOT A;  1FFX A;  2LFS A;  2CAZ C;  4O4J B;  1MSD A;  4H37 A;  2Q6A A;  1NQT A;  2FB5 A;  4ZQI A;  1CP9 A;  5FPO A;  4ZOL B;  1RM1 C;  4JAA A;  3JD2 A;  4IHJ B;  1N33 H;  1XNQ H;  2RQ6 A;  1H2K A;  4OGQ B;  5IT9 W;  4MVZ A;  4O7Z A;  4J0M A;  1XNR B;  1YI2 V;  1JMK C;  1HR0 H;  2XUM A;  3GII A;  1YTF D;  5I47 A;  2R7K A;  4ABM A;  4NB5 A;  4PWQ A;  1RK6 A;  2JA7 G;  4HNT A;  2WLH A;  2OCC B;  3OW2 U;  1IBK O;  3Q2O A;  4PZ6 A;  2O57 A;  3HB9 A;  1CEZ A;  5DQH A;  2VPQ A;  2UVR A;  3C3S A;  4LFA B;  4O4L B;  2F4V B;  1Z2P X;  3C0F B;  2FLN A;  1GM8 A;  5FLX W;  4RB2 C;  2CGO A;  3AG3 C;  1QR9 A;  5FL7 G;  5EDW A;  1Q6U A;  1JIH A;  3EVK A;  4EFE A;  3DTG A;  2M05 A;  2HHF A;  3E8H A;  2HHH H;  4UCV A;  1KJ8 A;  1M7J A;  3KCX A;  4I50 A;  1MNG A;  3NC0 B;  3LNN A;  1N34 O;  3E2E A;  1SKV A;  4U3J A;  1JKJ B;  3RUP A;  3SJC C;  3BG5 A;  4BWS C;  1I50 A;  5KS8 A;  5L1I A;  4X62 H;  3CRA A;  4IWY A;  4AI8 A;  2NU8 B;  1OV9 A;  3HKB A;  1U96 A;  2AXT Z;  3VPD A;  3SI8 A;  2GQS A;  4ASU G;  4A3E G;  1R3J C;  2A79 B;  5KT7 A;  2ILM A;  5H2F Z;  3ORR A;  4DV4 O;  1IBL H;  4B3R H;  3GIM A;  3ZN0 A;  2WTF A;  2YU9 A;  3RV3 A;  1PKX A;  3IN5 A;  4JPR A;  1WPX A;  1Y76 B;  2ZCE A;  2WAQ A;  3J80 N;  3KAK A;  4JI6 O;  3CC2 V;  3M7M X;  2XND G;  4G27 B;  2WPD G;  4AHC A;  4RUA A;  1G1X B;  3ZHV A;  4TV8 F;  1MSW D;  1DF4 A;  3HO8 A;  2DLN A;  1NKD A;  3GB8 B;  4J9Y B;  1AN7 A;  2FTK A;  2L35 A;  2R8J A;  4FFP A;  5LMU B;  2JA6 G;  2VWK A;  1RP3 B;  1WNS A;  3Q8Q B;  1KU9 A;  3SPH A;  1XBL A;  3T5J A;  1ZL8 B;  5LP6 A;  3T7A A;  5KHJ A;  4CZZ A;  2R85 A;  4CHI A;  3ZHT A;  3JAR B;  1NI8 A;  4O84 A;  1ZTE A;  2P90 A;  3LSS A;  4JI7 H;  2RGV A;  2IA6 A;  4A3C G;  1ROP A;  3ASO B;  3O65 A;  2FLP A;  2AQ4 A;  3BRC A;  1NJI W;  4M9U A;  2ZNI A;  4YR0 A;  4UVA A;  1Q6H A;  2PBZ A;  5KFD A;  4YJ3 F;  2LO1 A;  4J11 A;  3ABT A;  3N6R A;  3JCZ A;  1OCO B;  5HBR B;  4RB3 C;  1G4Y B;  3RV4 A;  4JI3 O;  3ZRX A;  2F4V O;  3OTO H;  4YY3 B;  1O75 A;  2UXC H;  5GON A;  3ML0 A;  4F4Z A;  4JF3 A; 
#chains in the Genus database with same CATH homology
 3HKD A;  5JVD B;  2HVR A;  5ITZ B;  5D5Q A;  2YIB D;  3JAM W;  2PGG A;  4MTE A;  3VNN A;  4EEQ A;  3ZED A;  1FVI A;  4MV9 A;  3RYH A;  4I50 B;  3GDE A;  3T1Y B;  4MTD A;  4X1Y A;  5IJ9 A;  4JI1 H;  4A2A A;  4U3J B;  2E3C A;  4I4T A;  2FE3 A;  4LNU B;  1ZHQ A;  2KSW A;  5KMG B;  2VQF H;  5EYP A;  4O2A B;  1P49 A;  2YI8 A;  3HKB B;  4E6N A;  1ZHS A;  5LL6 b;  4DR3 B;  3K5O A;  2E5L H;  4JV5 B;  1I94 B;  1TA8 A;  4K0K B;  4JI3 B;  1P16 A;  4DRX B;  1S5J A;  5IYZ A;  3N43 B;  4LF6 B;  4DR4 B;  3K5M A;  3GJX B;  3CVZ A;  1HNX B;  3U11 A;  1XQ8 A;  3JAW B;  2Q7E A;  2UXD B;  3T1Y H;  4O4H B;  5EOY A;  3WB0 A;  4DV2 B;  1RSO A;  1CKN B;  1X4T A;  5JCO C;  3JAT B;  2CW8 A;  5LXT B;  1SQG A;  3JAS A;  3W5O A;  4F6R A;  5JJE B;  4JI2 B;  4YJ2 A;  4ZI7 A;  2MCT A;  1CKM A;  4JI3 H;  2UUB B;  2F4V H;  3L2P A;  5IWA H;  2CFM A;  2YCH A;  2HGS A;  5J2U B;  3UQ8 A;  2RJZ A;  1IBM B;  4GYC B;  4FLZ A;  4R7R A;  1M93 A;  2Q2T A;  1Q43 A;  4X1K B;  2Q0A A;  4UCR A;  2VPS A;  2YI9 A;  3JAL A;  1XI1 A;  2BTQ A;  4DR5 B;  3RYI A;  5CA1 B;  5BMV A;  3SR2 C;  1VS0 A;  4O4I B;  5C8Y B;  3NBY B;  4LMY A;  1TGO A;  4DR1 H;  1TVK A;  3UT5 A;  1XMO B;  4LF4 B;  2Q7G A;  3QWU A;  4TV9 B;  4O2B B;  4I55 B;  4TV8 A;  4JI4 B;  1N36 B;  5KHK A;  1IBM H;  5CA0 A;  2HIX A;  1GYF A;  3QF7 A;  3SJB C;  5LA6 A;  4FLV A;  4OX9 B;  1QHT A;  3RYF B;  2VQE H;  4FLX A;  3IG0 A;  4DR5 H;  3DSQ A;  1M4U A;  4EB6 B;  4DV3 B;  4FLY A;  4I9Q A;  1XMQ H;  4NXM B;  2GV9 A;  3TY5 A;  1Q3E A;  3RIZ A;  2UXB H;  1SQF A;  4LF4 H;  5A2Q W;  1XMO H;  5FPR A;  2O03 A;  3JAK B;  3L4K A;  1E4F T;  1G6U A;  4JI4 H;  4FLT A;  3TY8 A;  3KXY T;  4JI0 B;  5GON B;  2WDT A;  2F1M A;  3T1H B;  4RAY A;  3HKD B;  1J5E B;  4WBN A;  2QJ1 A;  3PN1 A;  3EYY A;  4CH4 A;  4D7T A;  2OWO A;  3RYH B;  4YJ3 A;  4X1Y B;  5IJ9 B;  3CSX A;  3TY9 A;  3MAQ A;  5IJ0 A;  1E4G T;  4I4T B;  4PI0 A;  4CS2 A;  2JGU A;  4LF9 B;  4AQY B;  5EYP B;  4LF8 B;  4X65 H;  2BTO A;  3VQV A;  4EQ5 A;  4LFB B;  5IYZ B;  3IAY A;  4DR6 B;  4Q0Y A;  4YHH B;  5JH7 A;  3RWR D;  4X1I A;  4IIJ A;  4PDB A;  1N32 H;  1JJO A;  2Q2U A;  4Q6G A;  2P22 C;  2ZIN A;  3CHX A;  4BW9 A;  2W57 A;  2PZS A;  1ZAU A;  4LF9 H;  4LFC B;  3W1G A;  1TAE A;  3RGZ A;  4LF7 B;  4LF8 H;  3JAS B;  5BR8 B;  4TQD A;  4CH5 A;  4YJ2 B;  4DV1 B;  4ZI7 B;  2P5O A;  3K57 A;  4B3M H;  1CKO A;  2PY5 A;  1JFF A;  4YHH H;  4HBN A;  2JVD A;  2PUS A;  4KHP B;  1P8L A;  2F95 B;  1HR0 B;  4YY3 H;  2PYL A;  4X66 H;  2UU9 H;  3WB1 A;  4GKJ H;  1BGW A;  5FD6 A;  3N6X A;  3RGX A;  3VQW A;  4LFC H;  4LF5 B;  2F66 C;  4UCT A;  1WPB A;  3RYC A;  4DUZ B;  3QTC A;  2CW7 A;  5BR8 H;  1HNW B;  4L8J A;  3JAL B;  2IM9 A;  4RAZ A;  4DRF A;  2BTQ B;  1S03 G;  3RYI B;  5BMV B;  5JJJ B;  3J7A K;  5D1O A;  4FLW A;  4TUY A;  4DV6 B;  5FNV A;  5J2T A;  4NVP A;  3JSN A;  4FFB A;  3UT5 B;  3N41 B;  3N40 P;  3HXL A;  4KHP H;  4TV8 B;  1Q8I A;  3RF2 A;  1QQC A;  5CA0 B;  5CB4 A;  4DR7 B;  3NBZ B;  5LA6 B;  4LF5 H;  4DR3 H;  2HHH B;  3M4I A;  4JV5 H;  4B3T B;  4DUZ H;  1I94 H;  4K0K H;  1HNW H;  2F93 B;  3KYH C;  3ICX A;  4LF6 H;  4TQF A;  1MZB A;  4DR4 H;  4O4J A;  1WH2 A;  3RJ0 A;  1HNX H;  2UXD H;  4I7H A;  4DK0 A;  4DV6 H;  4DV2 H;  4CS4 A;  3W1B A;  3ETQ A;  1NT2 B;  3RTX A;  5EZY A;  4ZOL A;  4PZ7 A;  4M7E A;  2PTM A;  4IHJ A;  4DK1 A;  4X20 A;  2UUA B;  4JYA B;  4DR7 H;  5ITZ A;  4FM9 A;  1S68 A;  5JCO A;  2ZJT A;  4JI2 H;  3HKE A;  2UUB H;  3BAB A;  3K3V A;  4PZ8 A;  4WBN B;  4RB0 A;  5LP6 B;  3WB2 A;  1IBL B;  4APM A;  4B3R B;  3VQY A;  4DV5 B;  4CS3 A;  3N2K A;  1H2S B;  4YJ3 B;  2ZNJ A;  5KMG A;  1YEW A;  5D1P A;  1FKA H;  5IJ0 B;  1Z2N X;  3E22 A;  2JS5 A;  2UUA H;  5LOV A;  5FD5 A;  3N2G A;  4KL1 A;  3FMA A;  4O4L A;  5LYJ A;  4PHZ A;  4TOI A;  3RFR A;  1HNZ B;  4UCO A;  3N44 B;  4UFZ A;  4PI2 A;  2KKW A;  3FFQ A;  2XHB A;  2WYO A;  4K8Z A;  5JH7 B;  1A0I A;  4X1I B;  4IIJ B;  1N36 H;  2YIB A;  2HIV A;  2WE6 A;  2EX3 A;  5LP6 C;  1N34 B;  4OX9 H;  4GKK B;  2OYQ A;  4UCU A;  3BA8 A;  2VOB A;  4IAJ A;  3CB2 A;  4UCS A;  3SJA C;  4DV3 H;  3K59 A;  4NXM H;  3KAJ A;  4HNA A;  4ZIB A;  1JFF B;  3OTF A;  5JJN B;  4X64 B;  4ETS A;  1TUB A;  4JI0 H;  4B3S B;  3T1H H;  5CA1 A;  4DV4 B;  3H20 A;  1J5E H;  3RYC B;  2V4D A;  2R72 A;  5KX5 A;  5JQG A;  5D1O B;  3L4J A;  4JI5 B;  4TUY B;  4FLU A;  4NXN B;  3OTO B;  4DV0 B;  5FNV B;  3U0Z A;  5J2T B;  1XHZ A;  3HKC A;  4FFB B;  4X64 H;  4AQY H;  4ZHQ A;  1N33 B;  1XNQ B;  1WN7 A;  4F6R B;  5CB4 B;  4A2B A;  4DR2 B;  4B3S H;  2RGR A;  1M0T A;  4JI8 B;  3BHP A;  4CH3 A;  4LFB H;  1L2Z A;  1FFX A;  4DR6 H;  2CAZ C;  4O4J B;  4DUY B;  1XHX A;  4NXN H;  2ZIO A;  5FPO A;  4CC6 A;  5EZY B;  3BAA A;  2YXL A;  4ZOL B;  4EFB A;  3VQX A;  4AIL C;  4LF7 H;  4IHJ B;  4X20 B;  1N33 H;  4FVM A;  1XNQ H;  2E5L B;  4DR2 H;  2RQ6 A;  4JI8 H;  4DV1 H;  3RGB A;  3HKE B;  5IT9 W;  4CC5 A;  3JAR A;  4J0M A;  3BPZ A;  1XNR B;  2ZIM A;  3ZS8 C;  5KHI A;  1JMK C;  2UUC B;  1TVK B;  4DUY H;  1HR0 H;  1D5A A;  3THO A;  3N2K B;  4BWA A;  1VF7 A;  3J81 W;  3B2E E;  1FJG B;  4DV7 B;  3DF7 A;  2R9A A;  3E22 B;  5LOV B;  4B08 A;  2PYJ A;  4PZ6 A;  3S24 A;  3N2G B;  2HVS A;  1HW7 A;  4LFA B;  4O4L B;  5LYJ B;  2F4V B;  1Z2P X;  3C0F B;  5FLX W;  4RB2 C;  4GLX A;  5IWA B;  1XNR H;  5EIB D;  4X62 B;  2UUC H;  1SA0 A;  5JVD A;  1SEI A;  4EFE A;  1FJG H;  1Q5O A;  4DV7 H;  2HHH H;  1O9G A;  4UCV A;  4B3T H;  1O9H A;  4MV7 A;  3J80 W;  4I50 A;  3NC0 B;  4LFA H;  2XIG A;  3LNN A;  3QG5 A;  3SGI A;  3MWM A;  1SKV A;  4U3J A;  3SJC C;  4BWS C;  4DR1 B;  4X62 H;  4LNU A;  1IBK B;  2YIA A;  4HNA B;  1M5I A;  1XK5 A;  4O2A A;  3HKB A;  2ZM6 B;  4JYA H;  1Z5W A;  2VQE B;  4FM2 A;  1TUB B;  4DRX A;  5K1X A;  3RR5 A;  3BA9 A;  1XMQ B;  3JAW A;  4O4H A;  1IBL H;  4B3R H;  2UXB B;  1CKN A;  5KX5 B;  5JQG B;  4DV5 H;  3JAT A;  5KHH A;  5LMN B;  1IBK H;  5LXT A;  3K5L A;  1L8D A;  2ZCE A;  3F8N A;  3KAK A;  3U10 A;  3HKC B;  2ZM6 H;  3M7M X;  1BJT A;  4ZHQ B;  5KHG A;  2R70 A;  1KMI Z;  4AHC A;  1HNZ H;  1XDN A;  5J2U A;  1DGS A;  1FFX B;  2VUG A;  4LSX A;  3GB8 B;  3K5N A;  5LMN H;  4JI7 B;  5EIB C;  1AN7 A;  4X1K A;  5LMU B;  2VWK A;  1Z2O X;  3A2F A;  4RZQ A;  1N34 H;  5K1P A;  1WNS A;  4FM0 A;  4X65 B;  4GKK H;  4D7S A;  4O4I A;  4K8X A;  4CH6 A;  1X9N A;  1KU9 A;  1SYX B;  2VWJ A;  1B04 A;  5C8Y A;  3JSL A;  4FM1 A;  2HEP A;  5LP6 A;  5KHJ A;  1V9P A;  4TV9 A;  4O2B A;  4I55 A;  4JI6 B;  3JAR B;  4LH6 A;  1N32 B;  2UXC B;  4JI7 H;  2RGV A;  5DIS C;  3K58 A;  3RYF A;  3N42 B;  4LR3 A;  5LMU H;  3BRC A;  5D5P A;  3LML A;  2HVQ A;  4DV4 H;  4EB6 A;  2QM4 A;  1M0W A;  2ZNI A;  3KAL A;  1T5E A;  1Z5V A;  4LSA A;  1I6U A;  4B3M B;  1I7F A;  4JI1 B;  4RB3 C;  4JI6 H;  3JAK A;  4JI5 H;  4LH7 A;  2Q7H A;  3OTO H;  2UU9 B;  4DV0 H;  4GKJ B;  4YY3 B;  4X66 B;  1O75 A;  2UXC H;  2VQF B;  5GON A;  4RB1 A;  1SA0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...