1TA8A

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
313
structure length
313
Chain Sequence
b'PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase, NAD-dependent
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 100
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ta8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1ta8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1ta8A02
1XMQB 1J5EB 4LF7B 3BA8A 4B3SB 5D1OB 4NXNB 2HVQA 1XNQB 1A0IA 3RR5A 3S24A 2OWOA 4PZ6A 2HIVA 4EFBA 5LMUB 3W5OA 2UUCB 3UQ8A 4DV1B 4UCOA 3KYHC 3TY5A 4AQYB 3NC0B 3TY8A 4EQ5A 2UU9B 4DR2B 2UXBB 1P16A 2UUBB 4DR4B 4LF5B 5IWAB 4JYAB 1P8LA 2Q2TA 3QWUA 4EEQA 4B3TB 4LF9B 2HVSA 4UCVA 1VS0A 3SGIA 1N33B 1CKMA 4DR7B 4DV5B 2HHHB 1S68A 1N34B 4JI6B 4GKKB 1CKNA 4DV3B 3JSNA 4X64B 1HNWB 4LF6B 3NBZB 3GJXB 3RTXA 4JV5B 4DR6B 2VUGA 2E5LB 2F4VB 4LF8B 1HNXB 4NXMB 3OTOB 1XNRB 4E6NA 3VNNA 3L2PA 4UCTA 4KHPB 4UCRA 4DV2B 1IBLB 4X65B 1DGSA 1HNZB 4UCUA 3BABA 4LFCB 4DV7B 4DR1B 1N32B 5DISC 4DR3B 4LFAB 3BA9A 3W1BA 2VQEB 1HR0B 1IBMB 1XDNA 5FPOA 4YHHB 4CC6A 3NBYB 1B04A 4LH7A 4LH6A 4JI7B 3GDEA 2UUAB 4DUZB 4PZ7A 5BR8B 4YY3B 5D1OA 1N36B 1X9NA 4JI1B 4GLXA 1CKOA 2ZM6B 4LF4B 2HIXA 2Q2UA 4UCSA 4B3RB 4DRFA 1CKNB 4EFEA 4DV6B 4CC5A 1TA8A 4LFBB 4DV0B 4JI5B 5D1PA 4DUYB 4OX9B 3TY9A 1XK5A 4DR5B 1TAEA 3T1HB 4JI2B 1FVIA 3T1YB 1V9PA 4B3MB 4DV4B 1FJGB 2HVRA 1XMOB 4JI4B 2VQFB 4UFZA 4PZ8A 3PN1A 3W1GA 2UXCB 3JSLA 2CFMA 4TOIA 4JI0B 4JI3B 3BAAA 4X66B 5FPRA 4JI8B 4GKJB 5LMNB 1IBKB 2UXDB 1ZAUA 1I94B 4X62B 4K0KB 3GB8B
chains in the Genus database with same CATH superfamily
1HW7A 4RCNA 5EZYB 2QM4A 5FNVA 3FFQA 4JTAB 1HNXO 4O82A 2R9AA 4J42A 1YITV 1Y6XA 2HVQA 5IYBG 2J6SA 5KA5A 3N41B 4O3RA 5BWRA 5LMUB 2UUCB 3JRXA 4ZKIA 2V4RA 3F8NA 2ITDC 4WCEV 1KD1W 5EWGA 5L3GA 4J9KA 3QO8A 2Z04A 4IYIA 5BYBA 4ECQA 4QW8A 3AW8A 3ZMTA 3MD0A 1NKDA 4EEQA 2UXCO 2HVSA 4O4IA 2VWJA 1LNQA 3AEIA 4DR7B 4JI3O 2V5AA 4C5CA 1IVSA 2FK1A 5JH7A 2W8KA 3IAYA 2EZOA 5IJ9A 4I4TF 3CCLV 4X1YB 4DV0O 1BHBA 1TUEB 1J5EO 2RN9A 3RYFB 2F4VB 3BHPA 3CRCA 4J9RA 1XDCA 5CM0A 2OT5A 2QTOA 2W0FC 3L4JA 4N21A 2K9PA 1G4YB 3K04A 3QZ7A 4JI4O 4JAAA 5KHHA 4E4TA 2CW8A 5BR8H 1K97A 5B1BB 1M93A 3TXQA 2UVWA 2LGQA 3DXRB 2YZNA 1P84F 3AG1B 2V1DA 5KLVH 1YDXA 2A1HA 1QVGU 3NGDA 4LFBH 4IHJF 2R8HA 3ABLC 1R3IC 1VAJA 3VQXA 2FKXA 4NXNH 3CEBA 4Z1MG 3G71V 1XNQH 2WLMA 1K7DA 3RFCA 1Q90D 5KT4A 4GX5A 1FJGH 2E3CA 4LF4B 5KFOA 2EIMC 2NNUA 3JASB 4X88A 1HNWO 1SKVA 2EIJC 2YXYA 2ASDA 2JJ2G 3K06A 4ED1A 1AJNA 2D3OW 3F7YC 1YTFD 3CD6V 5DGHA 4WBNF 1JJ2U 2ZXWC 4U7OA 3HO8A 1VQOV 4GKJH 3CHXA 3MR3A 2QYZA 4CZZA 1DIKA 4I55F 4I9QA 1BQ0A 5I47A 1VF7A 5JVDB 5EC2C 4APMA 4UV8A 4ZI7F 4LSXA 4FM1A 2FLNA 4IL6Z 3MR5A 2DLNA 3QZ8A 5EZYA 2E2HA 3HBLA 4PDLA 2DPIA 3H0GG 1PNLA 4TQRA 4YB8B 3WNZA 5A9GA 4YJ3A 4FGRA 3ETHA 2OYQA 4JV5O 4M7EA 2YZMA 2UXBH 1QR8A 2QWQB 2BCCH 4DV6O 2RF4A 5K1XA 3KAKA 3G6XA 3RR5A 2UVRA 1JLLB 3IFXA 3SR2C 3TXSA 3CCRV 4A3IG 1R6TA 2Q7DA 4FU0A 1DAAA 4DV5H 1CPYA 3V4ZA 5GONA 5KFUA 2FMAA 5LA6F 3ZHVA 5EK0A 3TINA 1W2BU 1MZFA 4X9QA 4QWEA 2ODMA 3FDSA 3BFRA 3CRRA 3RYFA 1KYOF 1NH2B 4CS2A 4EYHB 3KHRA 1K33A 3CSWA 2V7QG 4O4JF 3M8AA 4W4LA 3J7AK 3H0GA 3CC7V 3GJXB 5DMXA 4EBDA 1OBGA 1NJIW 1US6A 1XNRB 4DR5O 5LP6F 4KHPB 1ZSPA 4UCRA 4RNMA 3ZHTA 4ED8A 1ZQ7A 4X65B 5LMUO 3CX5F 4LNUA 2UUCO 4CHIA 4QE7A 2AHYA 5BMVB 5D5QA 2ODTX 4JI1H 1VKZA 4K8ZA 4YBZB 3U54A 4EEYA 4JI8H 1S0OA 4FLXA 3RB0A 2UXDH 2R8IA 3K3VA 2R9RB 3JASA 3NBYB 2JEJA 2Q7HA 3V6JA 2N04A 5CA0B 4I7HA 2WA3A 2UVVA 4U7CA 5CR5A 1SCUB 4I50F 1JOYA 1SEIA 2EJ3A 3JD1A 2QM8A 4FS2A 4LBEC 2HKOA 4OGQB 3OUZA 1SZTA 4FFPA 2YXLA 5B1BC 1IDSA 2CTRA 2DAAA 3D8CA 2X5RA 1CQIB 2JEGA 5IP7G 4O84A 3CCSV 3PW0A 3AG1C 3I4NG 4DR2O 3BJYA 1TAEA 2WDTA 1PL0A 3T1YB 4HNVA 4B3TH 3KHHA 4A5UB 3QNEA 1E4EA 4NLGA 4O7WA 2B1GA 3EPIA 1S0VA 3OSNA 2YSUB 1Y14B 2ZIOA 1MSDA 3ZHUA 3TEKA 3OR7C 2XCLA 4X66B 3ABKB 3ZMSA 1NT2B 1HNXH 5DG8A 5JJJB 1O75A 2PY5A 3CCQV 2WAQA 1GM8A 4J9OA 3BA8A 5AG2A 3J80W 2QR4A 1FPOA 5KHJA 1DTOA 4XBFA 5KT3A 3APOA 1JX9A 5EIBC 2WB1A 4I0XA 4DR1H 4O4HF 1Q6HA 2CNQA 1E79G 3TGUH 3E8HA 3STZC 4EFBA 4ECTA 4KP4A 3Q4HB 1PL4A 5LOVB 2ZDQA 1N32O 1JA8A 5FR9A 3H40A 3AG4C 3EXAA 3CJHA 4DQNA 4O4LB 5CMUA 3NC0B 4FLVA 1W93A 2W9BB 4Q4CA 3U0ZA 4CKEA 5TISZ 1WCMG 5KFBA 3NUAA 1JR9A 4JV1A 1BL8A 3HKDB 3G8CA 4JYCA 4F6RB 1QQCA 2GHYA 4ZHQB 1QVFU 5JQGF 3GIPA 1R1BA 4FZ1A 2HG8A 4RUEA 2R84A 4JI6B 1CKNA 2X0LA 1YZBA 3LSUA 3SPJA 5I5SA 4Z2WA 2Q69A 5JCOA 2W9AA 4DUYO 5C8YF 4TQFA 3MAQA 5KFVA 3T9CA 1GMGA 4YR2A 4C2MA 2M6YA 2AZ0A 3M7MX 1UNNC 1F4MA 2DW4A 2QGNA 5IYZF 4JI7H 1SETA 3BG5A 3SE7A 5H80A 4GX2A 2WAMA 3NXSA 3ABTA 3ORRA 2ZINA 4DV7B 1M5IA 2W71A 3ORQA 3B4SA 1IBMB 1KP2A 4B7KA 5CB4B 1FXVA 1BE3H 3W7TA 4KUMA 5EIBD 4B3SH 1FXKA 1K34A 2Y69B 1S3JA 3ASOB 3PO2G 2A9HA 3PW7A 2I87A 5BR8B 5C93A 2CK3G 1X9NA 3FB7C 3FB5C 3GTPA 5BPFA 2R85A 4BBSG 5L1KA 4UCSA 2YRXA 4DRFA 5JCOC 1OCCB 3HPLC 5CBHA 5C1PA 3HKZA 3RGBA 2Y0IA 4LFBB 2JK5C 2JEIA 3OEHG 3SYCA 5DLGA 3S3XA 5LHHA 4KHPO 2FJZA 2RCVA 3TIGA 4MTXA 4X1IA 4O2BB 2DIKA 2Y4TA 5CA1B 4JI2B 5DGAA 2P4KA 3WWJA 5LL6Y 1E4GT 2QEXV 3ZHSA 4IR1A 4X62H 2FYUH 4DV4B 1FJGB 3G6YA 3TIIA 4JV2A 4XZ3B 5KFFA 3L73H 3VA7A 1AROP 1N33O 3W7WA 3JSLA 2PVPA 4JI0B 2L6LA 3K9SA 4GKKO 4K6NA 5KHIA 4JV5H 5HBRB 3UYYA 4GKJB 5FPRA 2YS6A 2AHZA 1B6SA 3LNMB 1IBKB 4TUYA 3SJCC 1NR7A 1V55B 1GKFA 1YXBA 2COIA 1EM1A 4O4LA 1PM9A 4FFNA 4HYKA 4JV0A 1HNZH 3E5NA 3UKMA 1XBLA 4PZ6A 5LGNA 3TQ1A 3KG2A 4KL1A 2NLJC 1IZ3A 2WPDG 3ETDA 3LSQA 2P06A 4ZHQA 3T1YO 3CVZA 1SERA 1FFTB 3ABKC 2UXBB 1TUBA 4O7SA 2QDOA 4J0MA 1R3LC 1SQVH 4DR6H 1WB7A 4G3IA 3JATB 3DAAA 4DO2A 3I55V 4YIPA 2FP4B 5JUMA 4O2AB 4Y8VB 2ZIMA 3E8FA 4FE2A 4DV5B 4X66O 1SZXA 3HKBA 1RSOB 4MV8A 4X64B 2IH1C 1L2ZA 1FKAH 2CUGA 4DR3H 4OPHA 1VQ6V 4D7SA 2B63G 3ZRXA 2E5LB 4CE5A 4IIJA 1J95A 4P30A 1YEWA 3T1HO 5EOYA 3JARB 3K9AA 5KFQA 1BZKA 4NZMA 1TWCA 4DK1A 1JJOA 1BNCA 4LFCB 3SPHA 1TWAA 5DISC 1SF9A 1ROPA 3ZEDA 2RMKB 4J9SA 3GTMA 4JAUA 2R8GA 2RJZA 4WFGA 3R66A 2JEXA 5A2QW 1O9GA 1LUVA 2YZGA 4FM9A 4ED3A 3RFRA 5LYJF 5KFLA 4AILC 4JI1B 4JI6O 4BWSC 2XNDG 4P9OA 2ZM6B 3ZMZA 4MA5A 3H1HH 2EZPA 1IOWA 3LWBA 5IYDO 1S9FA 4ED7A 1COWG 3SI8A 2QKAA 2PYJA 1AVMA 2UU9O 2BQRA 5IWAH 4TV9A 1QU7A 1FVIA 3B77A 2B63A 3R9RA 4FFOA 2HVRA 2IJJA 1DLBA 2E74B 3JAWA 2JEFA 1IBMO 1JFFB 4TOIA 4AYBE 1OCCC 4NR1A 5KAFZ 1S5LZ 3RWRD 1Z2PX 3CMAV 3JALB 1XMQB 1R3KC 2GUZB 3L9DA 2HGWA 2R86A 2EULA 2QA4V 4TV8B 1WN7A 4JYAH 3JD2A 4JZGA 4ECWA 3AG7A 4J10A 4O3NA 1K73W 5I5TA 1ZLZA 4U3FH 3HOVG 4JI2O 4HYOA 2JIZG 4MTFA 1CXZB 4AQYB 4G27B 1Z5WA 1UPGA 4E4EA 4DV4O 2PTMA 3TW7A 5H6RA 4MTDA 1RFYA 1R73A 2CH7A 1V55C 3L72H 2FPIB 2YIAA 1S0NA 1EUDB 3N6XA 1CKMA 4DV2H 5J2TF 2FPPB 3RBZA 4J41A 1IBKO 2IH3C 2JJ1G 4UVCA 3QFFA 4DUYH 2W9CB 1GO3E 3GILA 4LF6B 4EGQA 1SQQH 1RJQA 5FNVB 3J81N 4FFBA 1Z2NX 1XMOH 2ZNIA 2VQFH 1KU9A 4GYCB 3JZ6A 4NZNA 4IGGA 5I5WA 1QNMA 3MHHC 2HDKA 4MW3A 2X6AA 4QIWE 3ZMUA 4YJ2A 2B1IA 4PA4A 5KFIA 1K83A 3RVYA 5I5UA 4IRDA 4J7KA 2VOBA 1I5XA 1OCOB 4WHXA 3MR6A 1I94H 4ZIBA 4J11A 3OUFA 5EC1C 2XHBA 4JI7B 5D8DA 1IXBA 1Y67A 3CXCU 3DTGA 1NS1A 4PZ7A 4YY3B 4O4IB 4FK5C 1Q82W 2HGSA 4GLXA 5BPHA 2HR3A 1TWFA 2Y0SE 4X64O 5JH7B 1SS3A 2VPQA 4Z1VA 4CC5A 3JCZA 3QO5A 2CGNA 2E5LO 1KKDA 1R3JC 2ZDIC 2UUBH 5DG7A 3K0DA 1E4FT 5LMNH 1C30A 2NU9B 4BWAA 3WO0A 1UJWB 4LF9H 5JVLA 4QWBA 1DV2A 5L3CA 2WLKA 1KMIZ 4LFCO 1N56A 1I5YA 4UFZA 1Q43A 4PZ8A 4DL2A 1WSCA 3THOA 3BRCA 2GTAA 4TV8A 3CCMV 5DM6V 4B08A 2QSAA 3OR6C 1OCZB 2XAHA 2Y48A 5CA3A 5CE8A 1NQTA 4CC6A 2VQDA 4X62B 3KYHC 3E22B 5KG1A 1EN5A 3AG2B 1L8DA 4ME6A 2CGOA 2ZM6O 4UUGA 1TVKA 3EPGA 2YUAA 1JMKC 3DC6A 4ECZA 1K5QA 3SYQA 4DXWA 2JGDA 4DYLA 2IBZH 2ADQB 4O7YA 2VQEH 4J7ZA 4DV3H 2QWPB 3AK3A 5JJEB 4O3PA 5KG6A 1S72V 2GTSA 4ZOLF 1P7BA 2AGQA 3RAQA 3RBEA 3J80N 2EX3A 1PPJH 5B1OA 5C4XG 2ALZA 4JTCB 4FFRA 1A32A 2F93B 1ZL8A 2HFEC 5LA6B 4MVRA 2Z3YA 3O65A 4JI5H 3R65A 1QBZA 4I4TA 2QKSA 4YJ3B 1XMQO 2YYAA 4ASUG 3NBZB 1CEZA 3F5TA 3T1HH 4DR6B 2E75B 4B7EA 2HHFA 2JA8G 1NZ6A 4EGJA 3JZFA 3RYHA 2Q7GA 4A3DG 3SNOA 3G67A 2HLDG 2VA2A 4UCUA 1F51A 3VMMA 4AQYO 4DR3B 4H33A 5GONB 5KAIZ 1RPRA 4B3RH 1IXMA 2RNBA 1IYDA 3BA9A 3A8TA 1M9NA 3KREA 3FYEB 2JA7G 1PKXA 3JAMN 2Q7EA 1OHHG 3RYCA 2W8LA 4LWSA 1GLVA 4HBNA 2WLLB 2Q8VA 3UT5A 2CE4A 5DECA 4LF6O 1A9XA 5F2VO 4O7TA 4O81A 2H8PC 5CAEB 2CZGA 1I1KA 3OMIB 2C2RA 3CE2A 4ICGA 2UU9H 3PR5B 1OCOC 3OM3B 4WBNA 1SESA 4UVBA 2ABJA 1N0JA 4I55A 3RVZA 2AGAA 3OD4A 4LF7H 1KJ8A 1E1QG 4LNUB 3GV8B 2PI4A 2P90A 4ZI7A 1A3GA 3E22A 5FD5A 5EDWA 3CC4V 1B6QA 5KFAA 3K0GA 2HHHO 4PA6A 3LMLA 2FB5A 3T9AA 3OUUA 4F4YA 3BAAA 5BWUA 4LF8H 1ZAUA 1QR9A 4YY3O 2DOSA 1GM7A 3ZN0A 3FKIG 1VMGA 3ASNB 2C22A 2JA7A 5KFKA 3OAAG 2EJ2A 3CS5A 1IBLO 2HJDA 4MVZA 3SYAA 2ASLA 4BIZA 3PJSK 2ZCEA 3GWOA 5CN0A 5KFYA 3W5OA 3P32A 1JVMA 5EYPA 3SPCA 3K5NA 2R82A 4LFAO 3U0GA 2DJVA 1AILA 1HR0H 4UCOA 2IJKA 2WSSG 1AB3A 2PN1A 2C2EA 1JIHA 5LA6A 1G6UA 1OCZC 1YSCA 3AG4B 1P16A 4EG0A 2LP7A 3H4DA 2NUAB 4DR4B 4FS1A 1OBDA 3DF7A 1E4EB 4JYAB 5KHGA 3AG2C 2HEPA 2X6CA 3VPDA 1JDBB 3SYPA 1G2WA 2LJ2A 4C7UA 5KFEA 1A0GA 3N27A 5F9LA 2FMLA 3PR4A 4CKBA 1S03G 4FLTA 1TWHA 2YXHA 1YF2A 3OSPA 5J2UF 2GPWA 3JSNA 1KTAA 4Q8FA 4O4JA 3D36A 2CTPA 1SQXH 2P6JA 3L75H 4OX9O 1JDEA 1M90W 4NXMB 1BGWA 3FB6C 1GGOA 4MV4A 3L2PA 1OWTA 3JD0A 4NTXA 1S10A 5DQGA 4DV2B 3FKIA 4A3MG 2H3OA 1YHQV 4I0XB 4MVOA 5IJ0A 2OTLV 4O7VA 1S77D 4DUZH 1ZX3A 5KX5B 4YR3A 1QCEA 5KFDA 1AI4A 2EJ7A 3CJHB 2WLLA 1BXRA 3U10A 3GIDA 4ED6A 4YHHB 3CC2V 2W6IG 2CKZB 3HOZG 1WR2A 4A3LG 5EZYF 2COJA 1CS0A 3CYOA 4A3KG 2YU9A 4O7ZA 1N36B 3N2GA 3PFFA 3AG3B 4I50A 5E79Z 2Q2UA 1CKNB 3D36C 2LO1A 3GTKA 4YP3A 1N8RW 1B3QA 2Q0AA 2XUMA 3KCXA 1K3EA 2WAQE 5A2QN 4LR3A 4OXSA 2HGXA 4CKCA 3HKCA 4B3MB 1EZJA 4FFLA 3OGIB 2WB1E 2HG5C 3P3NA 2IM9A 4MTGA 4HN2A 1XL4A 1M1KW 4Q8EA 3K79A 4DR7O 1GSHA 4IWXA 5H5NA 3LDEA 3OMNB 4OPAA 1KJIA 2P4VA 4X1KA 5LMNB 5B1AB 4H13B 1FXKB 2XAJA 1X59A 1W0JG 4K0KB 3RV4A 4P9PA 2F4VO 1SC5B 5FD6A 1KUQA 3T2MA 1M7JA 4DL7A 1GAXA 2GQSA 2F66C 4O4HA 5I60A 4RB0A 3KTMA 3ZN1A 3MWDA 4DV1B 5FL7G 4ED2A 1GN2A 1RPOA 2X6BA 2ZE8A 4X1IB 2NR5A 2UUAH 3CPWU 3IC9A 4M0JA 5KKNB 3LP8A 1MABG 1AR1B 4LF5B 5B5EZ 1XHXA 1WNSA 3ASNC 2KKWA 1Q3EA 2XT9A 4XX0B 5IP9G 3SGIA 1GRJA 2FK2A 1AP5A 1S68A 4LF4O 1N34B 2VS0A 4DV3B 4RUCA 4PA3A 4TUYB 4UXNA 4CMFA 2YEVB 5KX5A 4TQSA 5GTIZ 3ZRWB 4ECYA 5C8YA 3BQ2A 3OTOB 5L3BA 5KA6A 3B2EE 2N74A 3R5HA 5JVDF 1AN7A 5J9PC 2Q5ZA 4IWYA 3IJ4A 1LUWA 5IT9N 5GTHZ 5L1JA 2UXCH 2JRIA 1VQ8V 4JTDB 3ZS8C 4JI3H 3HKZE 3K5IA 3U9TA 2Q6AA 1T5EA 1XDNA 4DR4O 2Y4RA 4RNOA 4DL3A 1H2LA 4DV0H 1TUBB 2QM7A 1WJZA 3BQ0A 1J5EH 2EILB 1WRVA 5BWVA 5IDJA 1K1SA 4F50A 1BSMA 2YL2A 3G6BA 2W6MA 4JI4H 2QKCA 1M0WA 3HKBB 4B3RB 1P49A 3SJAC 4BW9A 5ITZA 2AZ2A 1YCIA 2PMZA 1KP3A 4PDRA 5LYJB 5K2MA 4A2BA 3HB3B 3TY9A 2WLHA 4H0LB 4IIJB 3H1IH 4IAJA 4G2KA 3B09A 4PDMA 2ATKC 1XHZA 1V9PA 4EB6B 4O7NA 3RB6A 3B8NA 1S76D 2ZKOA 5KFHA 3ETGA 2HP8A 3N2KB 2IP4A 3N44B 3AG3C 4ZQIA 1WCMA 1T3NA 3Q2OA 1Y74B 3STLC 4YHHO 1HNWH 3OUSA 4QSHA 1Q6IA 3PW2A 4O3SA 3UO3A 3TETA 5HFLA 2BQ3A 1GYFA 1N36O 5KFGA 2R8JA 4LF7B 5LXTB 2EIKC 3UCSC 1XNRO 2V4QA 2E2IA 2XGPA 3SDLA 3SJBC 4NXNB 2NU6B 3HOXG 3PVXA 4X65O 5KT5A 1XNQB 5KFZA 2BTQA 5BMVF 4LFAH 4Q44A 5DQHA 5FLXW 1HDJA 1I6UA 2OTJV 3H20A 3TY5A 3VQVA 3RW0A 4B3MO 4TV9B 3TW6A 4GC6A 3PW5A 5B1AC 1FXKC 1KJJA 2W6JG 3LUTB 5CA0F 2Q2TA 2P22C 1GH6A 3H4BA 2CNUA 3OW2U 2YEVA 2Q68A 5LHIA 5JJNB 3RN4A 3ZRWA 1TGOA 4FIPC 4PI2A 3JAWB 4DV6H 2MK3A 3APQA 1PX2A 4MA0A 2CDYA 2HJFC 5IYDG 3A0HZ 4RZQA 1WPBA 4XYLB 4K0KO 2X0SA 3ZJZA 3A0RA 1FS0G 4EKWA 1VQNV 3TK1A 5KT7A 4UCTA 3GVMA 4DRXA 4MVMA 1FAFA 3HB9A 1KBHA 3T5KA 4JYBA 2W70A 2QK4A 1H2SB 4C5AA 4TWKA 4DV1O 2BSKA 2O57A 2EJRA 1VQ9V 4O7RA 3KHGA 3I5DA 1JX4A 1CQJB 1DF4A 2R7NA 3QO7A 3JZIA 4YIOA 3GV5B 4LF5O 5BWXA 2C2AA 1BJTA 4LH7A 2P5OA 3ZRVA 2P67A 2UVUA 2CH7B 2R6FA 1D5NA 2EIYA 2BOCC 4DUZB 3VOUA 4GLWA 3UZOA 5LYJA 3T4DA 5DG9A 4DR5H 1S5JA 3QQMA 2R87A 2XAQA 3V6KA 1H8EG 4PWQA 2A06H 2ZR3A 2XC9A 5LMUH 2UUCH 3RGZA 1A48A 1ORQC 4GX0A 4EB6A 1BCCH 5LOVF 1H8HG 5HNEA 1WLEA 2LGWA 3JAKA 1IYEA 3SPIA 5DN6G 3N2KA 1KBLA 3GIIA 1Y74A 4FFBB 4FM2A 1M57B 2P0AA 1I7NA 5JWPA 2NVYA 2W6ZA 2EILC 2DN9A 2JA5G 2COGA 4BY7G 4DR7H 3P30A 2A3QA 4ZHQF 1RJPA 4YJ2B 4RO2A 2PBZA 4PBCA 2ARHA 3E83A 5LXTA 2FB9A 1MMMA 3WB0A 1AUVA 1SQBH 2WTFA 4J9YB 3CB2A 5KFRA 2RQ6A 2VR1A 4JI8B 1VARA 2F4VH 2ITCC 4KFMA 2UXDB 3T9FA 2K1EA 2W0XA 4IRCA 3GB8B 4F4ZA 4DR2H 2IBKA 4UUJC 1B6RA 1K9MW 1XQ8A 2LQTA 3D3IA 3R5FA 2YIBA 1L0LH 3BACA 2H94A 1L0NH 4BIOA 3D3QA 1Q6UA 2HIVA 2LW1A 4DV7O 1QHTA 2ZDHA 4MV9A 3ETEA 2AW9A 1BT8A 5KT2A 3K03A 2JDIG 5CB4F 4IR9A 2DWDC 4Q45A 1SQGA 1AP6A 2FLLA 2F1MA 4B3TB 5BR8O 3OE7G 3EVKA 1VS0A 2ZJTA 2W6NA 2OH2A 5J2TA 2P7TC 4PHZA 3RUPA 2DE0X 4MVSA 5LGTA 4LFBO 4F4WA 5BYAA 3C0FB 1N32H 1EZVH 4FMTA 2C00A 2WA4A 1VQKV 1HNXB 4NXNO 4O2BF 1YIJV 3ZX6A 3VNNA 5CA1F 1XNQO 2N05A 2Z02A 1TVKB 1GSAA 1I2LA 3E35A 1FJGO 3BCCH 4J9LA 1DGSA 1ZWIC 4PI0A 2J9GA 2O03A 2JGDB 4CS4A 3KHLA 1FFXA 4DR1B 3JYCA 4MAMA 2DQ3A 1VQMV 3MDSA 2PI5A 2DWCA 4JI0O 3JRWA 4IRKA 3SPGA 1Q86W 4HNAA 5KUMA 4GKJO 4K3AA 3UM7A 5KFMA 3WFVA 5I5XA 3RGXA 5KT6A 1VQ4V 4LH6A 1AI7A 3RIZA 1GSOA 2CTWA 4R8CA 3T9BA 5KFPA 1ZTEA 5BWWA 3IN5A 5D1OA 2R8KA 5EBLC 3K5LA 1VQPV 1ZL8B 4JF3A 4F6EA 5K3WA 3T5LA 4HNTA 3WG7B 3GV7B 2Z5UA 4X20A 2IMWP 4I4TB 3F5WC 1SQFA 3T4ZA 3A2FA 4MT8A 4DV0B 3UO2A 3OMAB 3K5OA 1RK6A 1W59A 2GDSA 4JASA 2F95B 3KKYA 3TCUA 1XK5A 2UXBO 2HHFB 4QW9A 3HKEA 4Q4DA 4RAYA 2EBOA 3RYHB 1YJNV 4JI4B 4DW1A 3J7AU 1I3QA 4O2AF 2RDJA 3OHAA 2C28A 3LNNA 2XCPA 1MOFA 4MV7A 1KB9F 4DV5O 2XAFA 4L87A 3U11A 4YAJB 1GM9A 2J6TA 4IHJB 4J9MA 1D2DA 1GN3A 4QPJA 4KHPH 2V58A 3RYCB 1P7GA 2QB5A 4LWSB 1M57C 1RP3B 4B3SB 3S3WA 3BQ1A 1ULZA 3B8MA 1S0MA 3V6HA 5L1LA 5LHGA 3I56V 3UT5B 3S24A 3WWHA 4X89A 1N33H 4MS2A 3QVNA 3CQZA 3U9SA 2FTKA 4PDBA 1U96A 1CP9A 1XOUA 3MFIA 4FVMA 4WBNB 1EHIA 1R6NA 4GKKH 3WWIA 1FD9A 1NR1A 2E76B 3LDCA 3E86A 1AJPA 3OT7A 4I55B 4ZOLA 3NR7A 2ZR2A 4QJFB 2I80A 4U3JA 5KG0A 4RAIA 1IURA 3QWUA 4GX1A 1D5AA 4ZI7B 3G8DA 4JI1O 5KFJA 1URFA 1EN4A 1KJ9A 2SCUB 1PK8A 1WH2A 3BEHA 4JI8O 2DABA 4ECVA 1XEQA 3E8BA 3SJQC 2UXDO 3C3TA 1KQSU 1Z2GA 4LC1A 3LQSA 3HT5A 1MZBA 4MTOA 4JV5B 2RDIA 1X4TA 3CSXA 4NZOA 3T1YH 3ABUA 3OEEG 1KECA 3ZHRA 2QTSA 4J9ZB 3VBBA 1OCRB 1HNZB 1NTMH 5EYPB 3W7XA 3VOTA 4FPPA 4X66H 2YC0A 1GO3F 1VP7A 4TQDA 3KALA 3W1BA 1IOVA 4MVUA 4RQFA 3SYOA 3H1LH 2GSMB 4FJCC 4R8UA 1M0TA 4O86A 3HR0A 1V51A 5KFSA 5DAAA 2DQ0A 1Y66A 1G1XB 1CKOA 2AQ4A 1M4UA 3EHBB 4QIWF 4DW0A 4ECSA 1SA0A 1BQZA 4ZBMA 4O4JB 2DWEC 1EUCB 4ABMA 2BQUA 1QLNA 3QTCA 1WA8A 4PD4F 2PYLA 2OIEA 4DR5B 3MJFA 3GQCA 5LP6B 1CE8A 3N40P 5H6QA 2BOBC 1K4DC 4FLYA 5HV6A 3H3VH 1MSWD 5IJ0B 2ATLA 4IHJA 4DR1O 2R70A 3EFFK 3GLKA 4JI6H 5IY5C 2R9IA 1ZHQA 1H2GA 1VQ7V 3JCUZ 3RJ0A 2AU0A 3RYIA 3VPCA 4MV3A 3WG7C 3T1CA 4RNNA 1EKFA 3LULA 3N43B 5EBMC 4J9QA 3DGEA 5FNVF 3AK2A 1VF5B 3KAJA 3MWEA 5BY1A 4UVAA 1JCHA 1YVWA 3PW4A 3N2GB 2DMXA 5KFNA 4O83A 4TVIA 4I50B 1A0IA 4DV7H 4A3GG 3QF7A 4QJFA 3F7VC 4PDVA 3T9EA 1IBMH 4BXXG 1AI5A 1XUQA 2JS5A 4DL5A 3TY8A 4EQ5A 4DR2B 1M6VA 3H1KH 2M7WA 1I1MA 4HAMA 3HKCB 4JI7O 2AGOA 5IWAB 3ZIAG 5C44G 3IG0A 4O4IF 1THZA 3CRQA 5JH7F 1GN4A 4TT3G 5BWTA 4Q0YA 5J2UA 1BS3A 1HWYA 4X1KB 5FLXN 1JXLA 5IYCO 2PF4E 4XDLA 5E1AC 5KFCA 4B3SO 3N8DA 4JI2H 4IYHA 3RV3A 4EBEA 4F4XA 4DV4H 2MCTA 4YR0A 4KXRA 3AX6A 2V4DA 4J7JA 4I7ZB 1BGYH 1JPXA 4O4HB 5E25A 5IYBO 4JI0H 3I4MG 3M9NB 2ZE6A 2UXXA 1N32B 4I5SA 2ADPA 1W96A 1Z2OX 2V59A 1IBKH 4O3QA 1UFIA 3ZRSA 3K5HA 1MZEA 2LFRA 3GIQA 1JKJB 2ZT9B 3RB3A 3WU2Z 4X62O 2GPSA 2OIGA 3K58A 4JXUA 5KFXA 1L1FA 1E1RG 4J9NA 2EJ0A 3AK1A 2XGQA 2NVXA 2FLPA 5JQGB 5LP6A 1OCRC 2Y4UA 4A3FG 1NTZH 2WLIB 2OLSA 4GCZA 4O7LA 4MV1A 4Q6GA 1SFOA 1Q8IA 4DUYB 5C8YB 4MTEA 1PV0A 2CAZC 4QPKA 3CMEV 1VQ5V 3MR2A 4RUAA 3L74H 4LP8A 3T54A 2XASA 4MV6A 1HNZO 5IYZB 3Q1KA 1XMOB 4MSWC 3GIMA 2VQFB 1AI6A 1Z5VA 3N6RA 2GQRA 4X64H 4CH4A 2IU3A 3J81W 3K57A 5EWEA 2ILMA 1M56B 2JVDA 4YJ3F 2Q4PA 4WFAV 4X1YA 3E2EA 2E5LH 4DLKA 5DGIA 2ASJA 2IJIA 5H2FZ 1I94B 4DR6O 2ZE5A 4TM5A 3LSSA 3ICXA 5KFWA 2OCHA 5LP6C 4QE9A 1PNMA 2EIKB 2RDCA 3Q8PB 2XAGA 4CH5A 4LFCH 1MNGA 5KG4A 1B33N 2Q9LA 4RQEA 4YQWA 5CBGA 5ITZB 1GTOA 1FKAO 3UQ8A 5GONF 4DR3O 1RK5A 1PNKA 3DXRA 4P2ZA 4RUFA 2IU0A 4BBRG 2R7ZG 5D5PA 3W7UA 2DPJA 2UUBB 5KG3A 1Q5OA 5B66Z 4HZ3A 4JZ2A 2YCHA 1JQ0A 1WPXA 1UC9A 1VBHA 4J80A 4LF9B 2ZM6H 2WLNA 1N33B 1YI2V 1T36A 2AGPA 1Y4MA 4A3BG 3VPBA 5KMGB 2DZDA 4GKKB 5HFMA 3O9OA 5L1IA 3GTLA 1KC7A 2C35B 4WF9V 3TQTA 3V4SA 4UV9A 3GIKA 4Q43A 1DF5A 3E8GA 1EKPA 3GTGA 3RB4A 4R7RA 5FJ8G 1RJRA 2BR0A 1P4RA 5JVDA 1I0HA 3VQWA 1K1QA 2BTQB 1V4YA 2KQXA 2JA6G 1AR4A 1K5SA 4RB1A 4QNHB 2KG7B 5F9NA 4GT1A 4DK0A 2PMZE 2VQEB 3EYYA 5JQGA 5IWAO 1XMQH 3GB7C 4FLUA 2WLIA 2FK3A 3R5XA 2FE3A 2R7ZA 1NBMG 1AJQA 3A0BZ 1NVPB 1WB8A 4ED0A 2VUMG 5L9XA 2D2CB 4LSAA 3FB8C 1PP9H 2A0LA 3OHBA 3IGAC 3Q8SB 4PELA 5IYZA 2GBOA 1TA8A 4RZRA 3JD3A 4U6PA 4AQYH 4JI5B 1HP8A 1EKVA 4EBCA 2HVJC 3IC7A 4WFFA 3B40A 5GW7A 4DRXB 3T1HB 5K1PA 4BR6A 5C3EG 5DEDA 2EINB 2PGGA 4JYAO 2GLTA 3T99A 1I08A 5DQIA 2BSKB 2YI8A 3QG5A 4NB5A 3FD9A 5C1OA 4PA7A 3HOYG 4LF6H 2JA6A 3U55A 3HOUG 4CBCA 4C5BA 1RYRA 2QJ1A 4WD3A 4NXMO 3ML0A 3RBDA 4JGSA 4QWAA 4CMDA 5DLFA 3BPZA 2BE3A 5KFTA 4DV2O 2VUMA 4NVPA 5I5VA 3RAXA 5KX5F 5BMVA 1H38A 4RWUA 2VWKA 1K92A 3JAMW 3ETQA 2HHHH 3JAKB 3HOWG 2G38A 4WFEA 4N23A 3L4KA 4A3JG 1M56C 2W7PA 3OFNG 5KMGA 2UU9B 3CCUV 4JAVA 1XMOO 2VQFO 4YY3H 4A93G 3N42B 4YAKB 2YRWA 1U97A 1O9HA 1XL6A 1EYZA 5CA0A 1RM1B 1H2MA 2PZSA 3AYHB 2Q73A 3G80A 3ABMB 3G4SV 3I12A 4DIMA 2F43G 1WAZA 4PJ0Z 1IBLH 3OGCC 3DSQA 3OTFA 4QWCA 4I9WA 3FAVB 3L71H 1I94O 1N4CA 4K8XA 4D6TH 5T14A 5IE9A 4UB8Z 3CEIA 2OCCB 2X7RB 3MWMA 1FYJA 4LF8B 2R7MA 2KG7A 4RU9A 1UC8A 1XI1A 5FLMG 4W4KA 2DYSB 1QLEB 5KG5A 2ZGIA 1KT8A 2ZDGA 3BABA 3ZBHA 1Q81W 4ECUA 3CCEV 5KUKA 3FYIB 3E89A 2CNVA 2MW2B 4JPRA 1K8AW 2UUBO 4F4LA 5C5JA 3Q8RB 1HR0B 1Y1WG 2WYOA 1OV9A 5I5YA 4NYKA 3T5JA 5LMNO 2IW5A 2KSWA 1I1LA 4YXWG 4LF9O 2M05A 4OX9H 1S97A 2ZD9A 3TJTA 3G6EV 3VQYA 3BVOA 3L70H 3C90A 1KJQA 5J2TB 2LFSA 2HVKC 2VA3A 1Q7YW 1MA1A 3Q4HA 4PV1B 5LOVA 4TSFG 2L35A 1NH2D 4RAZA 3K3PA 2W9BA 5LGUA 1B06A 1V54B 4O3OA 2QE7G 2YI9A 4FBTA 2BTOA 1F23A 3PO3G 3HKDA 2QWOB 3KCYA 3PN1A 4HNUA 1NI8A 4F6RA 1FFXB 4FFKA 3KXYT 3W1GA 1R6KA 3DTUB 3P3PA 2VQEO 5B3SB 4WFHA 4ETSA 1N34O 2CTQA 2DYRB 4DV3O 2A7WA 4HNAB 2CQYA 1I7FA 3K08A 4R6ZA 4TUYF 3T5HA 2QF7A 1Y1WA 3GWKC 5CBFA 1Y76B 3OTOO 3FKSG 1GN6A 3K5MA 4O4LF 5D1OB 4FM0A 1C3OA 4XDKA 2IA6A 1GK9A 2EINC 4JI5O 4H44B 1Y1VG 4X20B 4FBUA 1YJ9V 3X2QB 3CCJV 3H01A 1F7YA 3W7SA 4IT5A 3G6VA 4J9PA 2WLJA 5CB4A 5KHKA 3KZIZ 3M99B 3HKEB 3H9VA 2AXTZ 3FAVA 3C3SA 2UXNA 5KS8A 1NTKH 1P8LA 3CRMA 4E2LA 1IX9A 4DAAA 4JUZA 4WFBV 2Q67A 4B3RO 2J6UA 4U7NA 5EBWC 5L3DA 4A3CG 5EWFA 2KB1A 1NVPD 2VUGA 4IIJF 1EBOA 4E6NA 4O2BA 5DGBA 2XCAA 1F4NA 5CA1A 1KKCA 2ZQMA 2R92G 1RM1C 3ABMC 1XREA 4BY1G 1DV1A 2RGVA 4RB2C 1YJWV 1S5HC 2XD4A 4LF4H 2Y0PA 1Y1VA 2B9ZA 2JA5A 3M9MB 2LW7A 4ECXA 4MW8A 4BW5A 5FPOA 2Y69C 3ASOC 1B04A 4H37A 4ZOLB 2PUSA 2OCCC 1BHAA 4BAYA 2UUAB 4U3JB 4IZOA 2W7OA 2R7KA 5LXTF 3CWBH 1MG1A 4LF7O 4M9UA 2XOKG 5JQWA 2QWNB 1ET0A 2ZNJA 4FLWA 2DYSC 5LBQA 4R50A 1QLEC 2HIXA 3UFXB 2KSDA 2FKLA 1ZETA 2R93G 3MHSC 3K3WA 1I7LA 3MFHA 4HQ6A 4FZ0A 2YDEA 2WWWA 3RT3C 4LF8O 2A79B 5D1PA 4GC7A 4CH6A 2IJHA 1SYXB 2XIGA 1VQLV 4DR4H 2F23A 4GZRB 4TV9F 4A2AA 1EN6A 3T9DA 2YS8A 3JATA 4DL6A 3RF2A 3CXHF 1H2KA 1Y76A 4O2AA 2R92A 1BMFG 4JYYA 2UXCB 3DTFA 1HR0O 2YW2A 1N0NA 2CFMA 3CCVV 1EZ1A 5BXZA 5IY5B 4JI3B 1RSOA 1ZHSA 1N48A 1SRYA 4NXMH 5IT9W 4NKGB 4NYEA 2YICA 1YTFB 5BZBA 2GV9A 1J5EB 4R8UB 2R7LA 1V54C 1OJHA 3JARA 1ENVA 3CRAA 2CW7A 4DL4A 3GTJA 5L3EA 1SA0B 2OWOA 4L1KA 3FMAA 2R93A 3JD4A 4AYBA 5B3SC 2W6OA 1W0KG 4YHHH 2ZDIA 2DYRC 1WA8B 2R72A 1VF6A 2YIBD 2FL4A 1T94A 4HR7A 3M9OB 2JEUA 3GIJA 1N36H 4AI8A 3H1JH 1XNRH 4DUZO 4QWDA 2JS3A 4L8JA 1AR5A 1KEEA 4UCVA 4CH3A 4XDJA 1AUXA 5LL6b 4NTYA 4BIUA 4D7TA 4X65H 2HHHB 2YS7A 3RYIB 3Q8QB 1K4CC 3HXLA 4PA9A 3CP1A 3X2QC 2JGUA 1VEWA 5L3FA 2FPGB 4MVQA 1HNWB 3M4IA 1WP8A 4XYMB 3RTXA 3ABLB 3BY6A 1PD3A 3ZHQA 4B3MH 4LMYA 4RB3C 3ZMVA 2W57A 2NU8B 5IJ9B 4FLZA 2RGRA 1IBLB 2EIMB 2EIJB 3ZCCA 4YJ2F 5KG2A 5H9CA 4UB6Z 1SQPH 4CS3A 1VF6C 4LFAB 4QGPA 2VRZA 1JFFA 1H2NA 2ZXWB 4LCUC 1DK1A 3GTOA 2C2DA 2ETNA 4K0KH 1XILA 3GDEA 1KC8W 3JALA 3K59A 3R23A 1I50A 4R7CA 2GUZA 2NN4A 2B5UA 2Q0OC 4AHCA 1WP7A 4GUNA 1TWGA 4QIWA 1R9TA 4EFEA 4DV6B 5J2UB 4DV1H 4A3EG 2W6QA 4NTWA 2QWRB 5KG7A 1G8MA 2YZLA 3WO1A 2YWVA 1FXHA 4OX9B 3ETJA 1RYSA 1OZ0A 3LDDA 3T7AA 4ECRA 4LF5H 4EYIB 4G28B 2W6PA 3DC5A 3WB2A 3GTQA 3WB1A 1NU1H 2ZE7A 4Q20A 2Z0AA 4B3TO 4X8AA 1KUTA 1LR1A 1VBGA 5B1NA 4FFMA 1I2KA 1N34H 1ZUQA 4K35A 2HJWA 2Y0SA 2V9WA 2YIDA 4TV8F 2WE6A 5IYCG 1EFRG 2I8CA 2NU7B 3PZPA 3UZBA 2W9CA 2UUAO 3FX7A 3OTOH 2XTAA 1VIBA 2VPSA
chains in the Genus database with same CATH topology
1HW7A 3JALB 5EZYB 2QM4A 5FNVA 3FFQA 3ICXA 5LXTB 1XMQB 4LF7B 2R9AA 5LP6C 3SJBC 4NXNB 4TV8B 2HVQA 1WN7A 4JYAH 4CH5A 1XNQB 4LFCH 2BTQA 3N41B 4LFAH 5LMUB 5ITZB 2UUCB 3UQ8A 3F8NA 5FLXW 1I6UA 3H20A 3TY5A 3VQVA 4AQYB 1Z5WA 4TV9B 5D5PA 2PTMA 2UUBB 1Q5OA 4MTDA 2YCHA 2Q2TA 2P22C 4EEQA 2HVSA 4LF9B 2YIAA 4O4IA 5JJNB 2ZM6H 2VWJA 3N6XA 1TGOA 1N33B 4PI2A 1CKMA 3JAWB 4DV2H 4DR7B 4DV6H 5KMGB 5JH7A 3IAYA 5IJ9A 4GKKB 4RZQA 1WPBA 4DUYH 4X1YB 4LF6B 3RYFB 5FNVB 2F4VB 3BHPA 4FFBA 1Z2NX 4R7RA 4UCTA 4DRXA 2ZNIA 1XMOH 2VQFH 1KU9A 3L4JA 4GYCB 5JVDA 3VQWA 2BTQB 1H2SB 5KHHA 2CW8A 5BR8H 1M93A 4YJ2A 4RB1A 2VOBA 4DK0A 2VQEB 3EYYA 1I94H 5JQGA 4LFBH 1XMQH 1BJTA 4LH7A 4ZIBA 4FLUA 2XHBA 2P5OA 4JI7B 3VQXA 2FE3A 4NXNH 4DUZB 4DR5H 4PZ7A 5LYJA 4YY3B 4O4IB 1XNQH 4LSAA 1S5JA 2HGSA 4GLXA 1FJGH 2E3CA 4LF4B 5LMUH 2UUCH 5JH7B 3RGZA 3JASB 1SKVA 4EB6A 5IYZA 4CC5A 1TA8A 4AQYH 4JI5B 3JAKA 3N2KA 2UUBH 4FFBB 4FM2A 3CHXA 1E4FT 4GKJH 5LMNH 4DRXB 3T1HB 5K1PA 4BWAA 4I9QA 4LF9H 1VF7A 5JVDB 4APMA 2PGGA 1KMIZ 4DR7H 4UFZA 1Q43A 4FM1A 4PZ8A 4LSXA 5EZYA 4YJ2B 2YI8A 5LXTA 3QG5A 3THOA 3BRCA 3WB0A 4TV8A 4LF6H 3CB2A 4B08A 2RQ6A 4JI8B 4YJ3A 2F4VH 2OYQA 2UXDB 4CC6A 4M7EA 4X62B 2QJ1A 3GB8B 3KYHC 3E22B 2UXBH 4DR2H 1L8DA 1XQ8A 3BPZA 2YIBA 1TVKA 1JMKC 5K1XA 4NVPA 3KAKA 3RR5A 3SR2C 2HIVA 5BMVA 2VWKA 3JAMW 2VQEH 3ETQA 1QHTA 4MV9A 3JAKB 4DV5H 5GONA 2HHHH 3L4KA 4DV3H 5JJEB 2UU9B 5KMGA 1SQGA 4YY3H 2F1MA 3N42B 1O9HA 5CA0A 2PZSA 2EX3A 4B3TB 1VS0A 3RYFA 2ZJTA 4CS2A 1IBLH 2F93B 5J2TA 5LA6B 3DSQA 4PHZA 3OTFA 4JI5H 4I4TA 4K8XA 1N32H 4YJ3B 3C0FB 3J7AK 3NBZB 3GJXB 3T1HH 4DR6B 3MWMA 4LF8B 1HNXB 1XNRB 3VNNA 4KHPB 4UCRA 1XI1A 1TVKB 3RYHA 2Q7GA 4X65B 4LNUA 1DGSA 4PI0A 2O03A 5BMVB 4UCUA 4CS4A 5D5QA 4JI1H 3BABA 1FFXA 4DR1B 4K8ZA 4DR3B 5GONB 4JI8H 4B3RH 4FLXA 2UXDH 3BA9A 4HNAA 1HR0B 3K3VA 2WYOA 3RGXA 3JASA 3NBYB 2KSWA 4LH6A 3RIZA 2Q7HA 2Q7EA 4OX9H 5CA0B 3RYCA 4I7HA 5D1OA 3VQYA 4HBNA 3K5LA 1SEIA 5J2TB 3UT5A 2YXLA 4X20A 4I4TB 1SQFA 3A2FA 4DV0B 5LOVA 2UU9H 3K5OA 4RAZA 4WBNA 2F95B 1XK5A 1TAEA 2WDTA 3HKEA 3T1YB 4B3TH 4I55A 4RAYA 3RYHB 2YI9A 4LF7H 4JI4B 2BTOA 4LNUB 3HKDA 3PN1A 4ZI7A 3E22A 5FD5A 4F6RA 3LNNA 1FFXB 4ETSA 3KXYT 3W1GA 4MV7A 2ZIOA 3LMLA 4HNAB 3BAAA 3U11A 4X66B 1I7FA 1NT2B 1HNXH 4LF8H 4IHJB 1ZAUA 5JJJB 1O75A 2PY5A 4KHPH 3RYCB 3BA8A 3K5MA 4B3SB 5D1OB 3J80W 4FM0A 5KHJA 5EIBC 4DR1H 3UT5B 3S24A 4X20B 4EFBA 2ZCEA 1N33H 3W5OA 5LOVB 5EYPA 3K5NA 1HR0H 4PDBA 4UCOA 4FVMA 4WBNB 4GKKH 4O4LB 3NC0B 4FLVA 1G6UA 5LA6A 5CB4A 3U0ZA 5KHKA 1P16A 3HKEB 4I55B 4ZOLA 4DR4B 3DF7A 4U3JA 4JYAB 5KHGA 1P8LA 3QWUA 2HEPA 3HKDB 1D5AA 4ZI7B 4F6RB 1QQCA 4ZHQB 1WH2A 1S03G 4FLTA 4JI6B 1CKNA 3JSNA 4O4JA 1MZBA 5JCOA 4JV5B 1X4TA 3CSXA 4TQFA 3MAQA 2VUGA 3T1YH 4NXMB 1BGWA 4E6NA 4O2BA 3L2PA 5CA1A 3M7MX 4JI7H 4DV2B 5IJ0A 4DUZH 1HNZB 5KX5B 2RGVA 4RB2C 2ZINA 4DV7B 5EYPB 1M5IA 4LF4H 4X66H 3U10A 4TQDA 3KALA 3W1BA 1IBMB 5CB4B 5FPOA 4YHHB 1B04A 4ZOLB 5EIBD 2PUSA 4B3SH 2UUAB 4U3JB 5BR8B 1M0TA 1N36B 3N2GA 1X9NA 2ZNJA 1CKOA 4I50A 4FLWA 1M4UA 2HIXA 2Q2UA 4UCSA 4DRFA 1CKNB 1SA0A 5JCOC 4O4JB 3RGBA 4LFBB 5D1PA 4CH6A 1SYXB 2Q0AA 2XIGA 3QTCA 4DR4H 4X1IA 4DR5B 4O2BB 2PYLA 4LR3A 4A2AA 5CA1B 4JI2B 5LP6B 1E4GT 3N40P 4X62H 3HKCA 4FLYA 4B3MB 4DV4B 3JATA 1FJGB 5IJ0B 4IHJA 3RF2A 2R70A 2IM9A 4O2AA 4JI6H 2UXCB 3JSLA 1ZHQA 3RJ0A 2CFMA 3RYIA 4JI0B 4JI3B 1RSOA 1ZHSA 5KHIA 4JV5H 4GKJB 5FPRA 4X1KA 5LMNB 1IBKB 3N43B 4NXMH 4TUYA 3SJCC 5IT9W 4K0KB 2GV9A 1J5EB 3KAJA 5FD6A 4O4LA 3JARA 3N2GB 2CW7A 1HNZH 4I50B 1A0IA 2F66C 4DV7H 3QF7A 1SA0B 4O4HA 2OWOA 4PZ6A 3FMAA 4KL1A 4RB0A 1IBMH 2JS5A 4DV1B 4YHHH 4ZHQA 3TY8A 2R72A 4EQ5A 3CVZA 4X1IB 2UXBB 4DR2B 2YIBD 2UUAH 1TUBA 4J0MA 4DR6H 3HKCB 4LF5B 1N36H 3JATB 5IWAB 1XHXA 1XNRH 3IG0A 1WNSA 4L8JA 2KKWA 1Q3EA 4UCVA 4O2AB 3SGIA 4CH3A 5LL6b 2ZIMA 4D7TA 4X65H 4DV5B 2HHHB 1S68A 3RYIB 1N34B 3HXLA 3HKBA 4DV3B 4Q0YA 5J2UA 4X64B 2JGUA 1L2ZA 1FKAH 4X1KB 1HNWB 3M4IA 4DR3H 4TUYB 3RTXA 5KX5A 4JI2H 4D7SA 5C8YA 2E5LB 3OTOB 4IIJA 4B3MH 3B2EE 4DV4H 1YEWA 4LMYA 4RB3C 2MCTA 5EOYA 3JARB 2W57A 1AN7A 5IJ9B 4FLZA 2RGRA 2V4DA 1IBLB 2UXCH 4DK1A 4O4HB 1JJOA 4JI0H 4LFCB 3ZS8C 4JI3H 4CS3A 1N32B 5DISC 4LFAB 1T5EA 1JFFA 3ZEDA 1Z2OX 1IBKH 1XDNA 4K0KH 4DV0H 1TUBB 2RJZA 1J5EH 5A2QW 1O9GA 3GDEA 4FM9A 3JALA 3RFRA 3K59A 3K58A 4AILC 4JI1B 4BWSC 4AHCA 2ZM6B 4JI4H 5JQGB 5LP6A 1M0WA 3HKBB 4B3RB 4EFEA 4DV6B 5J2UB 4DV1H 1P49A 3SJAC 4BW9A 5ITZA 4Q6GA 5LYJB 1Q8IA 4DUYB 4A2BA 5C8YB 4OX9B 3TY9A 4MTEA 4IIJB 2PYJA 4LF5H 5IWAH 4IAJA 2CAZC 4TV9A 1FVIA 1XHZA 3WB2A 1V9PA 4EB6B 5IYZB 3WB1A 2HVRA 1XMOB 2VQFB 1N34H 1Z5VA 3N2KB 3N44B 3JAWA 4X64H 4CH4A 2WE6A 1JFFB 4TOIA 3J81W 3K57A 1HNWH 2JVDA 4X1YA 2E5LH 3OTOH 3RWRD 1Z2PX 1I94B 1GYFA 2VPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ B;  1J5E B;  4LF7 B;  3BA8 A;  4B3S B;  5D1O B;  4NXN B;  2HVQ A;  1XNQ B;  1A0I A;  3RR5 A;  3S24 A;  2OWO A;  4PZ6 A;  2HIV A;  4EFB A;  5LMU B;  3W5O A;  2UUC B;  3UQ8 A;  4DV1 B;  4UCO A;  3KYH C;  3TY5 A;  4AQY B;  3NC0 B;  3TY8 A;  4EQ5 A;  2UU9 B;  4DR2 B;  2UXB B;  1P16 A;  2UUB B;  4DR4 B;  4LF5 B;  5IWA B;  4JYA B;  1P8L A;  2Q2T A;  3QWU A;  4EEQ A;  4B3T B;  4LF9 B;  2HVS A;  4UCV A;  1VS0 A;  3SGI A;  1N33 B;  1CKM A;  4DR7 B;  4DV5 B;  2HHH B;  1S68 A;  1N34 B;  4JI6 B;  4GKK B;  1CKN A;  4DV3 B;  3JSN A;  4X64 B;  1HNW B;  4LF6 B;  3NBZ B;  3GJX B;  3RTX A;  4JV5 B;  4DR6 B;  2VUG A;  2E5L B;  2F4V B;  4LF8 B;  1HNX B;  4NXM B;  3OTO B;  1XNR B;  4E6N A;  3VNN A;  3L2P A;  4UCT A;  4KHP B;  4UCR A;  4DV2 B;  1IBL B;  4X65 B;  1DGS A;  1HNZ B;  4UCU A;  3BAB A;  4LFC B;  4DV7 B;  4DR1 B;  1N32 B;  5DIS C;  4DR3 B;  4LFA B;  3BA9 A;  3W1B A;  2VQE B;  1HR0 B;  1IBM B;  1XDN A;  5FPO A;  4YHH B;  4CC6 A;  3NBY B;  1B04 A;  4LH7 A;  4LH6 A;  4JI7 B;  3GDE A;  2UUA B;  4DUZ B;  4PZ7 A;  5BR8 B;  4YY3 B;  5D1O A;  1N36 B;  1X9N A;  4JI1 B;  4GLX A;  1CKO A;  2ZM6 B;  4LF4 B;  2HIX A;  2Q2U A;  4UCS A;  4B3R B;  4DRF A;  1CKN B;  4EFE A;  4DV6 B;  4CC5 A;  1TA8 A;  4LFB B;  4DV0 B;  4JI5 B;  5D1P A;  4DUY B;  4OX9 B;  3TY9 A;  1XK5 A;  4DR5 B;  1TAE A;  3T1H B;  4JI2 B;  1FVI A;  3T1Y B;  1V9P A;  4B3M B;  4DV4 B;  1FJG B;  2HVR A;  1XMO B;  4JI4 B;  2VQF B;  4UFZ A;  4PZ8 A;  3PN1 A;  3W1G A;  2UXC B;  3JSL A;  2CFM A;  4TOI A;  4JI0 B;  4JI3 B;  3BAA A;  4X66 B;  5FPR A;  4JI8 B;  4GKJ B;  5LMN B;  1IBK B;  2UXD B;  1ZAU A;  1I94 B;  4X62 B;  4K0K B;  3GB8 B; 
#chains in the Genus database with same CATH topology
 1HW7 A;  4RCN A;  5EZY B;  2QM4 A;  5FNV A;  3FFQ A;  4JTA B;  1HNX O;  4O82 A;  2R9A A;  4J42 A;  1YIT V;  1Y6X A;  2HVQ A;  5IYB G;  2J6S A;  5KA5 A;  3N41 B;  4O3R A;  5BWR A;  5LMU B;  2UUC B;  3JRX A;  4ZKI A;  2V4R A;  3F8N A;  2ITD C;  4WCE V;  1KD1 W;  5EWG A;  5L3G A;  4J9K A;  3QO8 A;  2Z04 A;  4IYI A;  5BYB A;  4ECQ A;  4QW8 A;  3AW8 A;  3ZMT A;  3MD0 A;  1NKD A;  4EEQ A;  2UXC O;  2HVS A;  4O4I A;  2VWJ A;  1LNQ A;  3AEI A;  4DR7 B;  4JI3 O;  2V5A A;  4C5C A;  1IVS A;  2FK1 A;  5JH7 A;  2W8K A;  3IAY A;  2EZO A;  5IJ9 A;  4I4T F;  3CCL V;  4X1Y B;  4DV0 O;  1BHB A;  1TUE B;  1J5E O;  2RN9 A;  3RYF B;  2F4V B;  3BHP A;  3CRC A;  4J9R A;  1XDC A;  5CM0 A;  2OT5 A;  2QTO A;  2W0F C;  3L4J A;  4N21 A;  2K9P A;  1G4Y B;  3K04 A;  3QZ7 A;  4JI4 O;  4JAA A;  5KHH A;  4E4T A;  2CW8 A;  5BR8 H;  1K97 A;  5B1B B;  1M93 A;  3TXQ A;  2UVW A;  2LGQ A;  3DXR B;  2YZN A;  1P84 F;  3AG1 B;  2V1D A;  5KLV H;  1YDX A;  2A1H A;  1QVG U;  3NGD A;  4LFB H;  4IHJ F;  2R8H A;  3ABL C;  1R3I C;  1VAJ A;  3VQX A;  2FKX A;  4NXN H;  3CEB A;  4Z1M G;  3G71 V;  1XNQ H;  2WLM A;  1K7D A;  3RFC A;  1Q90 D;  5KT4 A;  4GX5 A;  1FJG H;  2E3C A;  4LF4 B;  5KFO A;  2EIM C;  2NNU A;  3JAS B;  4X88 A;  1HNW O;  1SKV A;  2EIJ C;  2YXY A;  2ASD A;  2JJ2 G;  3K06 A;  4ED1 A;  1AJN A;  2D3O W;  3F7Y C;  1YTF D;  3CD6 V;  5DGH A;  4WBN F;  1JJ2 U;  2ZXW C;  4U7O A;  3HO8 A;  1VQO V;  4GKJ H;  3CHX A;  3MR3 A;  2QYZ A;  4CZZ A;  1DIK A;  4I55 F;  4I9Q A;  1BQ0 A;  5I47 A;  1VF7 A;  5JVD B;  5EC2 C;  4APM A;  4UV8 A;  4ZI7 F;  4LSX A;  4FM1 A;  2FLN A;  4IL6 Z;  3MR5 A;  2DLN A;  3QZ8 A;  5EZY A;  2E2H A;  3HBL A;  4PDL A;  2DPI A;  3H0G G;  1PNL A;  4TQR A;  4YB8 B;  3WNZ A;  5A9G A;  4YJ3 A;  4FGR A;  3ETH A;  2OYQ A;  4JV5 O;  4M7E A;  2YZM A;  2UXB H;  1QR8 A;  2QWQ B;  2BCC H;  4DV6 O;  2RF4 A;  5K1X A;  3KAK A;  3G6X A;  3RR5 A;  2UVR A;  1JLL B;  3IFX A;  3SR2 C;  3TXS A;  3CCR V;  4A3I G;  1R6T A;  2Q7D A;  4FU0 A;  1DAA A;  4DV5 H;  1CPY A;  3V4Z A;  5GON A;  5KFU A;  2FMA A;  5LA6 F;  3ZHV A;  5EK0 A;  3TIN A;  1W2B U;  1MZF A;  4X9Q A;  4QWE A;  2ODM A;  3FDS A;  3BFR A;  3CRR A;  3RYF A;  1KYO F;  1NH2 B;  4CS2 A;  4EYH B;  3KHR A;  1K33 A;  3CSW A;  2V7Q G;  4O4J F;  3M8A A;  4W4L A;  3J7A K;  3H0G A;  3CC7 V;  3GJX B;  5DMX A;  4EBD A;  1OBG A;  1NJI W;  1US6 A;  1XNR B;  4DR5 O;  5LP6 F;  4KHP B;  1ZSP A;  4UCR A;  4RNM A;  3ZHT A;  4ED8 A;  1ZQ7 A;  4X65 B;  5LMU O;  3CX5 F;  4LNU A;  2UUC O;  4CHI A;  4QE7 A;  2AHY A;  5BMV B;  5D5Q A;  2ODT X;  4JI1 H;  1VKZ A;  4K8Z A;  4YBZ B;  3U54 A;  4EEY A;  4JI8 H;  1S0O A;  4FLX A;  3RB0 A;  2UXD H;  2R8I A;  3K3V A;  2R9R B;  3JAS A;  3NBY B;  2JEJ A;  2Q7H A;  3V6J A;  2N04 A;  5CA0 B;  4I7H A;  2WA3 A;  2UVV A;  4U7C A;  5CR5 A;  1SCU B;  4I50 F;  1JOY A;  1SEI A;  2EJ3 A;  3JD1 A;  2QM8 A;  4FS2 A;  4LBE C;  2HKO A;  4OGQ B;  3OUZ A;  1SZT A;  4FFP A;  2YXL A;  5B1B C;  1IDS A;  2CTR A;  2DAA A;  3D8C A;  2X5R A;  1CQI B;  2JEG A;  5IP7 G;  4O84 A;  3CCS V;  3PW0 A;  3AG1 C;  3I4N G;  4DR2 O;  3BJY A;  1TAE A;  2WDT A;  1PL0 A;  3T1Y B;  4HNV A;  4B3T H;  3KHH A;  4A5U B;  3QNE A;  1E4E A;  4NLG A;  4O7W A;  2B1G A;  3EPI A;  1S0V A;  3OSN A;  2YSU B;  1Y14 B;  2ZIO A;  1MSD A;  3ZHU A;  3TEK A;  3OR7 C;  2XCL A;  4X66 B;  3ABK B;  3ZMS A;  1NT2 B;  1HNX H;  5DG8 A;  5JJJ B;  1O75 A;  2PY5 A;  3CCQ V;  2WAQ A;  1GM8 A;  4J9O A;  3BA8 A;  5AG2 A;  3J80 W;  2QR4 A;  1FPO A;  5KHJ A;  1DTO A;  4XBF A;  5KT3 A;  3APO A;  1JX9 A;  5EIB C;  2WB1 A;  4I0X A;  4DR1 H;  4O4H F;  1Q6H A;  2CNQ A;  1E79 G;  3TGU H;  3E8H A;  3STZ C;  4EFB A;  4ECT A;  4KP4 A;  3Q4H B;  1PL4 A;  5LOV B;  2ZDQ A;  1N32 O;  1JA8 A;  5FR9 A;  3H40 A;  3AG4 C;  3EXA A;  3CJH A;  4DQN A;  4O4L B;  5CMU A;  3NC0 B;  4FLV A;  1W93 A;  2W9B B;  4Q4C A;  3U0Z A;  4CKE A;  5TIS Z;  1WCM G;  5KFB A;  3NUA A;  1JR9 A;  4JV1 A;  1BL8 A;  3HKD B;  3G8C A;  4JYC A;  4F6R B;  1QQC A;  2GHY A;  4ZHQ B;  1QVF U;  5JQG F;  3GIP A;  1R1B A;  4FZ1 A;  2HG8 A;  4RUE A;  2R84 A;  4JI6 B;  1CKN A;  2X0L A;  1YZB A;  3LSU A;  3SPJ A;  5I5S A;  4Z2W A;  2Q69 A;  5JCO A;  2W9A A;  4DUY O;  5C8Y F;  4TQF A;  3MAQ A;  5KFV A;  3T9C A;  1GMG A;  4YR2 A;  4C2M A;  2M6Y A;  2AZ0 A;  3M7M X;  1UNN C;  1F4M A;  2DW4 A;  2QGN A;  5IYZ F;  4JI7 H;  1SET A;  3BG5 A;  3SE7 A;  5H80 A;  4GX2 A;  2WAM A;  3NXS A;  3ABT A;  3ORR A;  2ZIN A;  4DV7 B;  1M5I A;  2W71 A;  3ORQ A;  3B4S A;  1IBM B;  1KP2 A;  4B7K A;  5CB4 B;  1FXV A;  1BE3 H;  3W7T A;  4KUM A;  5EIB D;  4B3S H;  1FXK A;  1K34 A;  2Y69 B;  1S3J A;  3ASO B;  3PO2 G;  2A9H A;  3PW7 A;  2I87 A;  5BR8 B;  5C93 A;  2CK3 G;  1X9N A;  3FB7 C;  3FB5 C;  3GTP A;  5BPF A;  2R85 A;  4BBS G;  5L1K A;  4UCS A;  2YRX A;  4DRF A;  5JCO C;  1OCC B;  3HPL C;  5CBH A;  5C1P A;  3HKZ A;  3RGB A;  2Y0I A;  4LFB B;  2JK5 C;  2JEI A;  3OEH G;  3SYC A;  5DLG A;  3S3X A;  5LHH A;  4KHP O;  2FJZ A;  2RCV A;  3TIG A;  4MTX A;  4X1I A;  4O2B B;  2DIK A;  2Y4T A;  5CA1 B;  4JI2 B;  5DGA A;  2P4K A;  3WWJ A;  5LL6 Y;  1E4G T;  2QEX V;  3ZHS A;  4IR1 A;  4X62 H;  2FYU H;  4DV4 B;  1FJG B;  3G6Y A;  3TII A;  4JV2 A;  4XZ3 B;  5KFF A;  3L73 H;  3VA7 A;  1ARO P;  1N33 O;  3W7W A;  3JSL A;  2PVP A;  4JI0 B;  2L6L A;  3K9S A;  4GKK O;  4K6N A;  5KHI A;  4JV5 H;  5HBR B;  3UYY A;  4GKJ B;  5FPR A;  2YS6 A;  2AHZ A;  1B6S A;  3LNM B;  1IBK B;  4TUY A;  3SJC C;  1NR7 A;  1V55 B;  1GKF A;  1YXB A;  2COI A;  1EM1 A;  4O4L A;  1PM9 A;  4FFN A;  4HYK A;  4JV0 A;  1HNZ H;  3E5N A;  3UKM A;  1XBL A;  4PZ6 A;  5LGN A;  3TQ1 A;  3KG2 A;  4KL1 A;  2NLJ C;  1IZ3 A;  2WPD G;  3ETD A;  3LSQ A;  2P06 A;  4ZHQ A;  3T1Y O;  3CVZ A;  1SER A;  1FFT B;  3ABK C;  2UXB B;  1TUB A;  4O7S A;  2QDO A;  4J0M A;  1R3L C;  1SQV H;  4DR6 H;  1WB7 A;  4G3I A;  3JAT B;  3DAA A;  4DO2 A;  3I55 V;  4YIP A;  2FP4 B;  5JUM A;  4O2A B;  4Y8V B;  2ZIM A;  3E8F A;  4FE2 A;  4DV5 B;  4X66 O;  1SZX A;  3HKB A;  1RSO B;  4MV8 A;  4X64 B;  2IH1 C;  1L2Z A;  1FKA H;  2CUG A;  4DR3 H;  4OPH A;  1VQ6 V;  4D7S A;  2B63 G;  3ZRX A;  2E5L B;  4CE5 A;  4IIJ A;  1J95 A;  4P30 A;  1YEW A;  3T1H O;  5EOY A;  3JAR B;  3K9A A;  5KFQ A;  1BZK A;  4NZM A;  1TWC A;  4DK1 A;  1JJO A;  1BNC A;  4LFC B;  3SPH A;  1TWA A;  5DIS C;  1SF9 A;  1ROP A;  3ZED A;  2RMK B;  4J9S A;  3GTM A;  4JAU A;  2R8G A;  2RJZ A;  4WFG A;  3R66 A;  2JEX A;  5A2Q W;  1O9G A;  1LUV A;  2YZG A;  4FM9 A;  4ED3 A;  3RFR A;  5LYJ F;  5KFL A;  4AIL C;  4JI1 B;  4JI6 O;  4BWS C;  2XND G;  4P9O A;  2ZM6 B;  3ZMZ A;  4MA5 A;  3H1H H;  2EZP A;  1IOW A;  3LWB A;  5IYD O;  1S9F A;  4ED7 A;  1COW G;  3SI8 A;  2QKA A;  2PYJ A;  1AVM A;  2UU9 O;  2BQR A;  5IWA H;  4TV9 A;  1QU7 A;  1FVI A;  3B77 A;  2B63 A;  3R9R A;  4FFO A;  2HVR A;  2IJJ A;  1DLB A;  2E74 B;  3JAW A;  2JEF A;  1IBM O;  1JFF B;  4TOI A;  4AYB E;  1OCC C;  4NR1 A;  5KAF Z;  1S5L Z;  3RWR D;  1Z2P X;  3CMA V;  3JAL B;  1XMQ B;  1R3K C;  2GUZ B;  3L9D A;  2HGW A;  2R86 A;  2EUL A;  2QA4 V;  4TV8 B;  1WN7 A;  4JYA H;  3JD2 A;  4JZG A;  4ECW A;  3AG7 A;  4J10 A;  4O3N A;  1K73 W;  5I5T A;  1ZLZ A;  4U3F H;  3HOV G;  4JI2 O;  4HYO A;  2JIZ G;  4MTF A;  1CXZ B;  4AQY B;  4G27 B;  1Z5W A;  1UPG A;  4E4E A;  4DV4 O;  2PTM A;  3TW7 A;  5H6R A;  4MTD A;  1RFY A;  1R73 A;  2CH7 A;  1V55 C;  3L72 H;  2FPI B;  2YIA A;  1S0N A;  1EUD B;  3N6X A;  1CKM A;  4DV2 H;  5J2T F;  2FPP B;  3RBZ A;  4J41 A;  1IBK O;  2IH3 C;  2JJ1 G;  4UVC A;  3QFF A;  4DUY H;  2W9C B;  1GO3 E;  3GIL A;  4LF6 B;  4EGQ A;  1SQQ H;  1RJQ A;  5FNV B;  3J81 N;  4FFB A;  1Z2N X;  1XMO H;  2ZNI A;  2VQF H;  1KU9 A;  4GYC B;  3JZ6 A;  4NZN A;  4IGG A;  5I5W A;  1QNM A;  3MHH C;  2HDK A;  4MW3 A;  2X6A A;  4QIW E;  3ZMU A;  4YJ2 A;  2B1I A;  4PA4 A;  5KFI A;  1K83 A;  3RVY A;  5I5U A;  4IRD A;  4J7K A;  2VOB A;  1I5X A;  1OCO B;  4WHX A;  3MR6 A;  1I94 H;  4ZIB A;  4J11 A;  3OUF A;  5EC1 C;  2XHB A;  4JI7 B;  5D8D A;  1IXB A;  1Y67 A;  3CXC U;  3DTG A;  1NS1 A;  4PZ7 A;  4YY3 B;  4O4I B;  4FK5 C;  1Q82 W;  2HGS A;  4GLX A;  5BPH A;  2HR3 A;  1TWF A;  2Y0S E;  4X64 O;  5JH7 B;  1SS3 A;  2VPQ A;  4Z1V A;  4CC5 A;  3JCZ A;  3QO5 A;  2CGN A;  2E5L O;  1KKD A;  1R3J C;  2ZDI C;  2UUB H;  5DG7 A;  3K0D A;  1E4F T;  5LMN H;  1C30 A;  2NU9 B;  4BWA A;  3WO0 A;  1UJW B;  4LF9 H;  5JVL A;  4QWB A;  1DV2 A;  5L3C A;  2WLK A;  1KMI Z;  4LFC O;  1N56 A;  1I5Y A;  4UFZ A;  1Q43 A;  4PZ8 A;  4DL2 A;  1WSC A;  3THO A;  3BRC A;  2GTA A;  4TV8 A;  3CCM V;  5DM6 V;  4B08 A;  2QSA A;  3OR6 C;  1OCZ B;  2XAH A;  2Y48 A;  5CA3 A;  5CE8 A;  1NQT A;  4CC6 A;  2VQD A;  4X62 B;  3KYH C;  3E22 B;  5KG1 A;  1EN5 A;  3AG2 B;  1L8D A;  4ME6 A;  2CGO A;  2ZM6 O;  4UUG A;  1TVK A;  3EPG A;  2YUA A;  1JMK C;  3DC6 A;  4ECZ A;  1K5Q A;  3SYQ A;  4DXW A;  2JGD A;  4DYL A;  2IBZ H;  2ADQ B;  4O7Y A;  2VQE H;  4J7Z A;  4DV3 H;  2QWP B;  3AK3 A;  5JJE B;  4O3P A;  5KG6 A;  1S72 V;  2GTS A;  4ZOL F;  1P7B A;  2AGQ A;  3RAQ A;  3RBE A;  3J80 N;  2EX3 A;  1PPJ H;  5B1O A;  5C4X G;  2ALZ A;  4JTC B;  4FFR A;  1A32 A;  2F93 B;  1ZL8 A;  2HFE C;  5LA6 B;  4MVR A;  2Z3Y A;  3O65 A;  4JI5 H;  3R65 A;  1QBZ A;  4I4T A;  2QKS A;  4YJ3 B;  1XMQ O;  2YYA A;  4ASU G;  3NBZ B;  1CEZ A;  3F5T A;  3T1H H;  4DR6 B;  2E75 B;  4B7E A;  2HHF A;  2JA8 G;  1NZ6 A;  4EGJ A;  3JZF A;  3RYH A;  2Q7G A;  4A3D G;  3SNO A;  3G67 A;  2HLD G;  2VA2 A;  4UCU A;  1F51 A;  3VMM A;  4AQY O;  4DR3 B;  4H33 A;  5GON B;  5KAI Z;  1RPR A;  4B3R H;  1IXM A;  2RNB A;  1IYD A;  3BA9 A;  3A8T A;  1M9N A;  3KRE A;  3FYE B;  2JA7 G;  1PKX A;  3JAM N;  2Q7E A;  1OHH G;  3RYC A;  2W8L A;  4LWS A;  1GLV A;  4HBN A;  2WLL B;  2Q8V A;  3UT5 A;  2CE4 A;  5DEC A;  4LF6 O;  1A9X A;  5F2V O;  4O7T A;  4O81 A;  2H8P C;  5CAE B;  2CZG A;  1I1K A;  3OMI B;  2C2R A;  3CE2 A;  4ICG A;  2UU9 H;  3PR5 B;  1OCO C;  3OM3 B;  4WBN A;  1SES A;  4UVB A;  2ABJ A;  1N0J A;  4I55 A;  3RVZ A;  2AGA A;  3OD4 A;  4LF7 H;  1KJ8 A;  1E1Q G;  4LNU B;  3GV8 B;  2PI4 A;  2P90 A;  4ZI7 A;  1A3G A;  3E22 A;  5FD5 A;  5EDW A;  3CC4 V;  1B6Q A;  5KFA A;  3K0G A;  2HHH O;  4PA6 A;  3LML A;  2FB5 A;  3T9A A;  3OUU A;  4F4Y A;  3BAA A;  5BWU A;  4LF8 H;  1ZAU A;  1QR9 A;  4YY3 O;  2DOS A;  1GM7 A;  3ZN0 A;  3FKI G;  1VMG A;  3ASN B;  2C22 A;  2JA7 A;  5KFK A;  3OAA G;  2EJ2 A;  3CS5 A;  1IBL O;  2HJD A;  4MVZ A;  3SYA A;  2ASL A;  4BIZ A;  3PJS K;  2ZCE A;  3GWO A;  5CN0 A;  5KFY A;  3W5O A;  3P32 A;  1JVM A;  5EYP A;  3SPC A;  3K5N A;  2R82 A;  4LFA O;  3U0G A;  2DJV A;  1AIL A;  1HR0 H;  4UCO A;  2IJK A;  2WSS G;  1AB3 A;  2PN1 A;  2C2E A;  1JIH A;  5LA6 A;  1G6U A;  1OCZ C;  1YSC A;  3AG4 B;  1P16 A;  4EG0 A;  2LP7 A;  3H4D A;  2NUA B;  4DR4 B;  4FS1 A;  1OBD A;  3DF7 A;  1E4E B;  4JYA B;  5KHG A;  3AG2 C;  2HEP A;  2X6C A;  3VPD A;  1JDB B;  3SYP A;  1G2W A;  2LJ2 A;  4C7U A;  5KFE A;  1A0G A;  3N27 A;  5F9L A;  2FML A;  3PR4 A;  4CKB A;  1S03 G;  4FLT A;  1TWH A;  2YXH A;  1YF2 A;  3OSP A;  5J2U F;  2GPW A;  3JSN A;  1KTA A;  4Q8F A;  4O4J A;  3D36 A;  2CTP A;  1SQX H;  2P6J A;  3L75 H;  4OX9 O;  1JDE A;  1M90 W;  4NXM B;  1BGW A;  3FB6 C;  1GGO A;  4MV4 A;  3L2P A;  1OWT A;  3JD0 A;  4NTX A;  1S10 A;  5DQG A;  4DV2 B;  3FKI A;  4A3M G;  2H3O A;  1YHQ V;  4I0X B;  4MVO A;  5IJ0 A;  2OTL V;  4O7V A;  1S77 D;  4DUZ H;  1ZX3 A;  5KX5 B;  4YR3 A;  1QCE A;  5KFD A;  1AI4 A;  2EJ7 A;  3CJH B;  2WLL A;  1BXR A;  3U10 A;  3GID A;  4ED6 A;  4YHH B;  3CC2 V;  2W6I G;  2CKZ B;  3HOZ G;  1WR2 A;  4A3L G;  5EZY F;  2COJ A;  1CS0 A;  3CYO A;  4A3K G;  2YU9 A;  4O7Z A;  1N36 B;  3N2G A;  3PFF A;  3AG3 B;  4I50 A;  5E79 Z;  2Q2U A;  1CKN B;  3D36 C;  2LO1 A;  3GTK A;  4YP3 A;  1N8R W;  1B3Q A;  2Q0A A;  2XUM A;  3KCX A;  1K3E A;  2WAQ E;  5A2Q N;  4LR3 A;  4OXS A;  2HGX A;  4CKC A;  3HKC A;  4B3M B;  1EZJ A;  4FFL A;  3OGI B;  2WB1 E;  2HG5 C;  3P3N A;  2IM9 A;  4MTG A;  4HN2 A;  1XL4 A;  1M1K W;  4Q8E A;  3K79 A;  4DR7 O;  1GSH A;  4IWX A;  5H5N A;  3LDE A;  3OMN B;  4OPA A;  1KJI A;  2P4V A;  4X1K A;  5LMN B;  5B1A B;  4H13 B;  1FXK B;  2XAJ A;  1X59 A;  1W0J G;  4K0K B;  3RV4 A;  4P9P A;  2F4V O;  1SC5 B;  5FD6 A;  1KUQ A;  3T2M A;  1M7J A;  4DL7 A;  1GAX A;  2GQS A;  2F66 C;  4O4H A;  5I60 A;  4RB0 A;  3KTM A;  3ZN1 A;  3MWD A;  4DV1 B;  5FL7 G;  4ED2 A;  1GN2 A;  1RPO A;  2X6B A;  2ZE8 A;  4X1I B;  2NR5 A;  2UUA H;  3CPW U;  3IC9 A;  4M0J A;  5KKN B;  3LP8 A;  1MAB G;  1AR1 B;  4LF5 B;  5B5E Z;  1XHX A;  1WNS A;  3ASN C;  2KKW A;  1Q3E A;  2XT9 A;  4XX0 B;  5IP9 G;  3SGI A;  1GRJ A;  2FK2 A;  1AP5 A;  1S68 A;  4LF4 O;  1N34 B;  2VS0 A;  4DV3 B;  4RUC A;  4PA3 A;  4TUY B;  4UXN A;  4CMF A;  2YEV B;  5KX5 A;  4TQS A;  5GTI Z;  3ZRW B;  4ECY A;  5C8Y A;  3BQ2 A;  3OTO B;  5L3B A;  5KA6 A;  3B2E E;  2N74 A;  3R5H A;  5JVD F;  1AN7 A;  5J9P C;  2Q5Z A;  4IWY A;  3IJ4 A;  1LUW A;  5IT9 N;  5GTH Z;  5L1J A;  2UXC H;  2JRI A;  1VQ8 V;  4JTD B;  3ZS8 C;  4JI3 H;  3HKZ E;  3K5I A;  3U9T A;  2Q6A A;  1T5E A;  1XDN A;  4DR4 O;  2Y4R A;  4RNO A;  4DL3 A;  1H2L A;  4DV0 H;  1TUB B;  2QM7 A;  1WJZ A;  3BQ0 A;  1J5E H;  2EIL B;  1WRV A;  5BWV A;  5IDJ A;  1K1S A;  4F50 A;  1BSM A;  2YL2 A;  3G6B A;  2W6M A;  4JI4 H;  2QKC A;  1M0W A;  3HKB B;  4B3R B;  1P49 A;  3SJA C;  4BW9 A;  5ITZ A;  2AZ2 A;  1YCI A;  2PMZ A;  1KP3 A;  4PDR A;  5LYJ B;  5K2M A;  4A2B A;  3HB3 B;  3TY9 A;  2WLH A;  4H0L B;  4IIJ B;  3H1I H;  4IAJ A;  4G2K A;  3B09 A;  4PDM A;  2ATK C;  1XHZ A;  1V9P A;  4EB6 B;  4O7N A;  3RB6 A;  3B8N A;  1S76 D;  2ZKO A;  5KFH A;  3ETG A;  2HP8 A;  3N2K B;  2IP4 A;  3N44 B;  3AG3 C;  4ZQI A;  1WCM A;  1T3N A;  3Q2O A;  1Y74 B;  3STL C;  4YHH O;  1HNW H;  3OUS A;  4QSH A;  1Q6I A;  3PW2 A;  4O3S A;  3UO3 A;  3TET A;  5HFL A;  2BQ3 A;  1GYF A;  1N36 O;  5KFG A;  2R8J A;  4LF7 B;  5LXT B;  2EIK C;  3UCS C;  1XNR O;  2V4Q A;  2E2I A;  2XGP A;  3SDL A;  3SJB C;  4NXN B;  2NU6 B;  3HOX G;  3PVX A;  4X65 O;  5KT5 A;  1XNQ B;  5KFZ A;  2BTQ A;  5BMV F;  4LFA H;  4Q44 A;  5DQH A;  5FLX W;  1HDJ A;  1I6U A;  2OTJ V;  3H20 A;  3TY5 A;  3VQV A;  3RW0 A;  4B3M O;  4TV9 B;  3TW6 A;  4GC6 A;  3PW5 A;  5B1A C;  1FXK C;  1KJJ A;  2W6J G;  3LUT B;  5CA0 F;  2Q2T A;  2P22 C;  1GH6 A;  3H4B A;  2CNU A;  3OW2 U;  2YEV A;  2Q68 A;  5LHI A;  5JJN B;  3RN4 A;  3ZRW A;  1TGO A;  4FIP C;  4PI2 A;  3JAW B;  4DV6 H;  2MK3 A;  3APQ A;  1PX2 A;  4MA0 A;  2CDY A;  2HJF C;  5IYD G;  3A0H Z;  4RZQ A;  1WPB A;  4XYL B;  4K0K O;  2X0S A;  3ZJZ A;  3A0R A;  1FS0 G;  4EKW A;  1VQN V;  3TK1 A;  5KT7 A;  4UCT A;  3GVM A;  4DRX A;  4MVM A;  1FAF A;  3HB9 A;  1KBH A;  3T5K A;  4JYB A;  2W70 A;  2QK4 A;  1H2S B;  4C5A A;  4TWK A;  4DV1 O;  2BSK A;  2O57 A;  2EJR A;  1VQ9 V;  4O7R A;  3KHG A;  3I5D A;  1JX4 A;  1CQJ B;  1DF4 A;  2R7N A;  3QO7 A;  3JZI A;  4YIO A;  3GV5 B;  4LF5 O;  5BWX A;  2C2A A;  1BJT A;  4LH7 A;  2P5O A;  3ZRV A;  2P67 A;  2UVU A;  2CH7 B;  2R6F A;  1D5N A;  2EIY A;  2BOC C;  4DUZ B;  3VOU A;  4GLW A;  3UZO A;  5LYJ A;  3T4D A;  5DG9 A;  4DR5 H;  1S5J A;  3QQM A;  2R87 A;  2XAQ A;  3V6K A;  1H8E G;  4PWQ A;  2A06 H;  2ZR3 A;  2XC9 A;  5LMU H;  2UUC H;  3RGZ A;  1A48 A;  1ORQ C;  4GX0 A;  4EB6 A;  1BCC H;  5LOV F;  1H8H G;  5HNE A;  1WLE A;  2LGW A;  3JAK A;  1IYE A;  3SPI A;  5DN6 G;  3N2K A;  1KBL A;  3GII A;  1Y74 A;  4FFB B;  4FM2 A;  1M57 B;  2P0A A;  1I7N A;  5JWP A;  2NVY A;  2W6Z A;  2EIL C;  2DN9 A;  2JA5 G;  2COG A;  4BY7 G;  4DR7 H;  3P30 A;  2A3Q A;  4ZHQ F;  1RJP A;  4YJ2 B;  4RO2 A;  2PBZ A;  4PBC A;  2ARH A;  3E83 A;  5LXT A;  2FB9 A;  1MMM A;  3WB0 A;  1AUV A;  1SQB H;  2WTF A;  4J9Y B;  3CB2 A;  5KFR A;  2RQ6 A;  2VR1 A;  4JI8 B;  1VAR A;  2F4V H;  2ITC C;  4KFM A;  2UXD B;  3T9F A;  2K1E A;  2W0X A;  4IRC A;  3GB8 B;  4F4Z A;  4DR2 H;  2IBK A;  4UUJ C;  1B6R A;  1K9M W;  1XQ8 A;  2LQT A;  3D3I A;  3R5F A;  2YIB A;  1L0L H;  3BAC A;  2H94 A;  1L0N H;  4BIO A;  3D3Q A;  1Q6U A;  2HIV A;  2LW1 A;  4DV7 O;  1QHT A;  2ZDH A;  4MV9 A;  3ETE A;  2AW9 A;  1BT8 A;  5KT2 A;  3K03 A;  2JDI G;  5CB4 F;  4IR9 A;  2DWD C;  4Q45 A;  1SQG A;  1AP6 A;  2FLL A;  2F1M A;  4B3T B;  5BR8 O;  3OE7 G;  3EVK A;  1VS0 A;  2ZJT A;  2W6N A;  2OH2 A;  5J2T A;  2P7T C;  4PHZ A;  3RUP A;  2DE0 X;  4MVS A;  5LGT A;  4LFB O;  4F4W A;  5BYA A;  3C0F B;  1N32 H;  1EZV H;  4FMT A;  2C00 A;  2WA4 A;  1VQK V;  1HNX B;  4NXN O;  4O2B F;  1YIJ V;  3ZX6 A;  3VNN A;  5CA1 F;  1XNQ O;  2N05 A;  2Z02 A;  1TVK B;  1GSA A;  1I2L A;  3E35 A;  1FJG O;  3BCC H;  4J9L A;  1DGS A;  1ZWI C;  4PI0 A;  2J9G A;  2O03 A;  2JGD B;  4CS4 A;  3KHL A;  1FFX A;  4DR1 B;  3JYC A;  4MAM A;  2DQ3 A;  1VQM V;  3MDS A;  2PI5 A;  2DWC A;  4JI0 O;  3JRW A;  4IRK A;  3SPG A;  1Q86 W;  4HNA A;  5KUM A;  4GKJ O;  4K3A A;  3UM7 A;  5KFM A;  3WFV A;  5I5X A;  3RGX A;  5KT6 A;  1VQ4 V;  4LH6 A;  1AI7 A;  3RIZ A;  1GSO A;  2CTW A;  4R8C A;  3T9B A;  5KFP A;  1ZTE A;  5BWW A;  3IN5 A;  5D1O A;  2R8K A;  5EBL C;  3K5L A;  1VQP V;  1ZL8 B;  4JF3 A;  4F6E A;  5K3W A;  3T5L A;  4HNT A;  3WG7 B;  3GV7 B;  2Z5U A;  4X20 A;  2IMW P;  4I4T B;  3F5W C;  1SQF A;  3T4Z A;  3A2F A;  4MT8 A;  4DV0 B;  3UO2 A;  3OMA B;  3K5O A;  1RK6 A;  1W59 A;  2GDS A;  4JAS A;  2F95 B;  3KKY A;  3TCU A;  1XK5 A;  2UXB O;  2HHF B;  4QW9 A;  3HKE A;  4Q4D A;  4RAY A;  2EBO A;  3RYH B;  1YJN V;  4JI4 B;  4DW1 A;  3J7A U;  1I3Q A;  4O2A F;  2RDJ A;  3OHA A;  2C28 A;  3LNN A;  2XCP A;  1MOF A;  4MV7 A;  1KB9 F;  4DV5 O;  2XAF A;  4L87 A;  3U11 A;  4YAJ B;  1GM9 A;  2J6T A;  4IHJ B;  4J9M A;  1D2D A;  1GN3 A;  4QPJ A;  4KHP H;  2V58 A;  3RYC B;  1P7G A;  2QB5 A;  4LWS B;  1M57 C;  1RP3 B;  4B3S B;  3S3W A;  3BQ1 A;  1ULZ A;  3B8M A;  1S0M A;  3V6H A;  5L1L A;  5LHG A;  3I56 V;  3UT5 B;  3S24 A;  3WWH A;  4X89 A;  1N33 H;  4MS2 A;  3QVN A;  3CQZ A;  3U9S A;  2FTK A;  4PDB A;  1U96 A;  1CP9 A;  1XOU A;  3MFI A;  4FVM A;  4WBN B;  1EHI A;  1R6N A;  4GKK H;  3WWI A;  1FD9 A;  1NR1 A;  2E76 B;  3LDC A;  3E86 A;  1AJP A;  3OT7 A;  4I55 B;  4ZOL A;  3NR7 A;  2ZR2 A;  4QJF B;  2I80 A;  4U3J A;  5KG0 A;  4RAI A;  1IUR A;  3QWU A;  4GX1 A;  1D5A A;  4ZI7 B;  3G8D A;  4JI1 O;  5KFJ A;  1URF A;  1EN4 A;  1KJ9 A;  2SCU B;  1PK8 A;  1WH2 A;  3BEH A;  4JI8 O;  2DAB A;  4ECV A;  1XEQ A;  3E8B A;  3SJQ C;  2UXD O;  3C3T A;  1KQS U;  1Z2G A;  4LC1 A;  3LQS A;  3HT5 A;  1MZB A;  4MTO A;  4JV5 B;  2RDI A;  1X4T A;  3CSX A;  4NZO A;  3T1Y H;  3ABU A;  3OEE G;  1KEC A;  3ZHR A;  2QTS A;  4J9Z B;  3VBB A;  1OCR B;  1HNZ B;  1NTM H;  5EYP B;  3W7X A;  3VOT A;  4FPP A;  4X66 H;  2YC0 A;  1GO3 F;  1VP7 A;  4TQD A;  3KAL A;  3W1B A;  1IOV A;  4MVU A;  4RQF A;  3SYO A;  3H1L H;  2GSM B;  4FJC C;  4R8U A;  1M0T A;  4O86 A;  3HR0 A;  1V51 A;  5KFS A;  5DAA A;  2DQ0 A;  1Y66 A;  1G1X B;  1CKO A;  2AQ4 A;  1M4U A;  3EHB B;  4QIW F;  4DW0 A;  4ECS A;  1SA0 A;  1BQZ A;  4ZBM A;  4O4J B;  2DWE C;  1EUC B;  4ABM A;  2BQU A;  1QLN A;  3QTC A;  1WA8 A;  4PD4 F;  2PYL A;  2OIE A;  4DR5 B;  3MJF A;  3GQC A;  5LP6 B;  1CE8 A;  3N40 P;  5H6Q A;  2BOB C;  1K4D C;  4FLY A;  5HV6 A;  3H3V H;  1MSW D;  5IJ0 B;  2ATL A;  4IHJ A;  4DR1 O;  2R70 A;  3EFF K;  3GLK A;  4JI6 H;  5IY5 C;  2R9I A;  1ZHQ A;  1H2G A;  1VQ7 V;  3JCU Z;  3RJ0 A;  2AU0 A;  3RYI A;  3VPC A;  4MV3 A;  3WG7 C;  3T1C A;  4RNN A;  1EKF A;  3LUL A;  3N43 B;  5EBM C;  4J9Q A;  3DGE A;  5FNV F;  3AK2 A;  1VF5 B;  3KAJ A;  3MWE A;  5BY1 A;  4UVA A;  1JCH A;  1YVW A;  3PW4 A;  3N2G B;  2DMX A;  5KFN A;  4O83 A;  4TVI A;  4I50 B;  1A0I A;  4DV7 H;  4A3G G;  3QF7 A;  4QJF A;  3F7V C;  4PDV A;  3T9E A;  1IBM H;  4BXX G;  1AI5 A;  1XUQ A;  2JS5 A;  4DL5 A;  3TY8 A;  4EQ5 A;  4DR2 B;  1M6V A;  3H1K H;  2M7W A;  1I1M A;  4HAM A;  3HKC B;  4JI7 O;  2AGO A;  5IWA B;  3ZIA G;  5C44 G;  3IG0 A;  4O4I F;  1THZ A;  3CRQ A;  5JH7 F;  1GN4 A;  4TT3 G;  5BWT A;  4Q0Y A;  5J2U A;  1BS3 A;  1HWY A;  4X1K B;  5FLX N;  1JXL A;  5IYC O;  2PF4 E;  4XDL A;  5E1A C;  5KFC A;  4B3S O;  3N8D A;  4JI2 H;  4IYH A;  3RV3 A;  4EBE A;  4F4X A;  4DV4 H;  2MCT A;  4YR0 A;  4KXR A;  3AX6 A;  2V4D A;  4J7J A;  4I7Z B;  1BGY H;  1JPX A;  4O4H B;  5E25 A;  5IYB O;  4JI0 H;  3I4M G;  3M9N B;  2ZE6 A;  2UXX A;  1N32 B;  4I5S A;  2ADP A;  1W96 A;  1Z2O X;  2V59 A;  1IBK H;  4O3Q A;  1UFI A;  3ZRS A;  3K5H A;  1MZE A;  2LFR A;  3GIQ A;  1JKJ B;  2ZT9 B;  3RB3 A;  3WU2 Z;  4X62 O;  2GPS A;  2OIG A;  3K58 A;  4JXU A;  5KFX A;  1L1F A;  1E1R G;  4J9N A;  2EJ0 A;  3AK1 A;  2XGQ A;  2NVX A;  2FLP A;  5JQG B;  5LP6 A;  1OCR C;  2Y4U A;  4A3F G;  1NTZ H;  2WLI B;  2OLS A;  4GCZ A;  4O7L A;  4MV1 A;  4Q6G A;  1SFO A;  1Q8I A;  4DUY B;  5C8Y B;  4MTE A;  1PV0 A;  2CAZ C;  4QPK A;  3CME V;  1VQ5 V;  3MR2 A;  4RUA A;  3L74 H;  4LP8 A;  3T54 A;  2XAS A;  4MV6 A;  1HNZ O;  5IYZ B;  3Q1K A;  1XMO B;  4MSW C;  3GIM A;  2VQF B;  1AI6 A;  1Z5V A;  3N6R A;  2GQR A;  4X64 H;  4CH4 A;  2IU3 A;  3J81 W;  3K57 A;  5EWE A;  2ILM A;  1M56 B;  2JVD A;  4YJ3 F;  2Q4P A;  4WFA V;  4X1Y A;  3E2E A;  2E5L H;  4DLK A;  5DGI A;  2ASJ A;  2IJI A;  5H2F Z;  1I94 B;  4DR6 O;  2ZE5 A;  4TM5 A;  3LSS A;  3ICX A;  5KFW A;  2OCH A;  5LP6 C;  4QE9 A;  1PNM A;  2EIK B;  2RDC A;  3Q8P B;  2XAG A;  4CH5 A;  4LFC H;  1MNG A;  5KG4 A;  1B33 N;  2Q9L A;  4RQE A;  4YQW A;  5CBG A;  5ITZ B;  1GTO A;  1FKA O;  3UQ8 A;  5GON F;  4DR3 O;  1RK5 A;  1PNK A;  3DXR A;  4P2Z A;  4RUF A;  2IU0 A;  4BBR G;  2R7Z G;  5D5P A;  3W7U A;  2DPJ A;  2UUB B;  5KG3 A;  1Q5O A;  5B66 Z;  4HZ3 A;  4JZ2 A;  2YCH A;  1JQ0 A;  1WPX A;  1UC9 A;  1VBH A;  4J80 A;  4LF9 B;  2ZM6 H;  2WLN A;  1N33 B;  1YI2 V;  1T36 A;  2AGP A;  1Y4M A;  4A3B G;  3VPB A;  5KMG B;  2DZD A;  4GKK B;  5HFM A;  3O9O A;  5L1I A;  3GTL A;  1KC7 A;  2C35 B;  4WF9 V;  3TQT A;  3V4S A;  4UV9 A;  3GIK A;  4Q43 A;  1DF5 A;  3E8G A;  1EKP A;  3GTG A;  3RB4 A;  4R7R A;  5FJ8 G;  1RJR A;  2BR0 A;  1P4R A;  5JVD A;  1I0H A;  3VQW A;  1K1Q A;  2BTQ B;  1V4Y A;  2KQX A;  2JA6 G;  1AR4 A;  1K5S A;  4RB1 A;  4QNH B;  2KG7 B;  5F9N A;  4GT1 A;  4DK0 A;  2PMZ E;  2VQE B;  3EYY A;  5JQG A;  5IWA O;  1XMQ H;  3GB7 C;  4FLU A;  2WLI A;  2FK3 A;  3R5X A;  2FE3 A;  2R7Z A;  1NBM G;  1AJQ A;  3A0B Z;  1NVP B;  1WB8 A;  4ED0 A;  2VUM G;  5L9X A;  2D2C B;  4LSA A;  3FB8 C;  1PP9 H;  2A0L A;  3OHB A;  3IGA C;  3Q8S B;  4PEL A;  5IYZ A;  2GBO A;  1TA8 A;  4RZR A;  3JD3 A;  4U6P A;  4AQY H;  4JI5 B;  1HP8 A;  1EKV A;  4EBC A;  2HVJ C;  3IC7 A;  4WFF A;  3B40 A;  5GW7 A;  4DRX B;  3T1H B;  5K1P A;  4BR6 A;  5C3E G;  5DED A;  2EIN B;  2PGG A;  4JYA O;  2GLT A;  3T99 A;  1I08 A;  5DQI A;  2BSK B;  2YI8 A;  3QG5 A;  4NB5 A;  3FD9 A;  5C1O A;  4PA7 A;  3HOY G;  4LF6 H;  2JA6 A;  3U55 A;  3HOU G;  4CBC A;  4C5B A;  1RYR A;  2QJ1 A;  4WD3 A;  4NXM O;  3ML0 A;  3RBD A;  4JGS A;  4QWA A;  4CMD A;  5DLF A;  3BPZ A;  2BE3 A;  5KFT A;  4DV2 O;  2VUM A;  4NVP A;  5I5V A;  3RAX A;  5KX5 F;  5BMV A;  1H38 A;  4RWU A;  2VWK A;  1K92 A;  3JAM W;  3ETQ A;  2HHH H;  3JAK B;  3HOW G;  2G38 A;  4WFE A;  4N23 A;  3L4K A;  4A3J G;  1M56 C;  2W7P A;  3OFN G;  5KMG A;  2UU9 B;  3CCU V;  4JAV A;  1XMO O;  2VQF O;  4YY3 H;  4A93 G;  3N42 B;  4YAK B;  2YRW A;  1U97 A;  1O9H A;  1XL6 A;  1EYZ A;  5CA0 A;  1RM1 B;  1H2M A;  2PZS A;  3AYH B;  2Q73 A;  3G80 A;  3ABM B;  3G4S V;  3I12 A;  4DIM A;  2F43 G;  1WAZ A;  4PJ0 Z;  1IBL H;  3OGC C;  3DSQ A;  3OTF A;  4QWC A;  4I9W A;  3FAV B;  3L71 H;  1I94 O;  1N4C A;  4K8X A;  4D6T H;  5T14 A;  5IE9 A;  4UB8 Z;  3CEI A;  2OCC B;  2X7R B;  3MWM A;  1FYJ A;  4LF8 B;  2R7M A;  2KG7 A;  4RU9 A;  1UC8 A;  1XI1 A;  5FLM G;  4W4K A;  2DYS B;  1QLE B;  5KG5 A;  2ZGI A;  1KT8 A;  2ZDG A;  3BAB A;  3ZBH A;  1Q81 W;  4ECU A;  3CCE V;  5KUK A;  3FYI B;  3E89 A;  2CNV A;  2MW2 B;  4JPR A;  1K8A W;  2UUB O;  4F4L A;  5C5J A;  3Q8R B;  1HR0 B;  1Y1W G;  2WYO A;  1OV9 A;  5I5Y A;  4NYK A;  3T5J A;  5LMN O;  2IW5 A;  2KSW A;  1I1L A;  4YXW G;  4LF9 O;  2M05 A;  4OX9 H;  1S97 A;  2ZD9 A;  3TJT A;  3G6E V;  3VQY A;  3BVO A;  3L70 H;  3C90 A;  1KJQ A;  5J2T B;  2LFS A;  2HVK C;  2VA3 A;  1Q7Y W;  1MA1 A;  3Q4H A;  4PV1 B;  5LOV A;  4TSF G;  2L35 A;  1NH2 D;  4RAZ A;  3K3P A;  2W9B A;  5LGU A;  1B06 A;  1V54 B;  4O3O A;  2QE7 G;  2YI9 A;  4FBT A;  2BTO A;  1F23 A;  3PO3 G;  3HKD A;  2QWO B;  3KCY A;  3PN1 A;  4HNU A;  1NI8 A;  4F6R A;  1FFX B;  4FFK A;  3KXY T;  3W1G A;  1R6K A;  3DTU B;  3P3P A;  2VQE O;  5B3S B;  4WFH A;  4ETS A;  1N34 O;  2CTQ A;  2DYR B;  4DV3 O;  2A7W A;  4HNA B;  2CQY A;  1I7F A;  3K08 A;  4R6Z A;  4TUY F;  3T5H A;  2QF7 A;  1Y1W A;  3GWK C;  5CBF A;  1Y76 B;  3OTO O;  3FKS G;  1GN6 A;  3K5M A;  4O4L F;  5D1O B;  4FM0 A;  1C3O A;  4XDK A;  2IA6 A;  1GK9 A;  2EIN C;  4JI5 O;  4H44 B;  1Y1V G;  4X20 B;  4FBU A;  1YJ9 V;  3X2Q B;  3CCJ V;  3H01 A;  1F7Y A;  3W7S A;  4IT5 A;  3G6V A;  4J9P A;  2WLJ A;  5CB4 A;  5KHK A;  3KZI Z;  3M99 B;  3HKE B;  3H9V A;  2AXT Z;  3FAV A;  3C3S A;  2UXN A;  5KS8 A;  1NTK H;  1P8L A;  3CRM A;  4E2L A;  1IX9 A;  4DAA A;  4JUZ A;  4WFB V;  2Q67 A;  4B3R O;  2J6U A;  4U7N A;  5EBW C;  5L3D A;  4A3C G;  5EWF A;  2KB1 A;  1NVP D;  2VUG A;  4IIJ F;  1EBO A;  4E6N A;  4O2B A;  5DGB A;  2XCA A;  1F4N A;  5CA1 A;  1KKC A;  2ZQM A;  2R92 G;  1RM1 C;  3ABM C;  1XRE A;  4BY1 G;  1DV1 A;  2RGV A;  4RB2 C;  1YJW V;  1S5H C;  2XD4 A;  4LF4 H;  2Y0P A;  1Y1V A;  2B9Z A;  2JA5 A;  3M9M B;  2LW7 A;  4ECX A;  4MW8 A;  4BW5 A;  5FPO A;  2Y69 C;  3ASO C;  1B04 A;  4H37 A;  4ZOL B;  2PUS A;  2OCC C;  1BHA A;  4BAY A;  2UUA B;  4U3J B;  4IZO A;  2W7O A;  2R7K A;  5LXT F;  3CWB H;  1MG1 A;  4LF7 O;  4M9U A;  2XOK G;  5JQW A;  2QWN B;  1ET0 A;  2ZNJ A;  4FLW A;  2DYS C;  5LBQ A;  4R50 A;  1QLE C;  2HIX A;  3UFX B;  2KSD A;  2FKL A;  1ZET A;  2R93 G;  3MHS C;  3K3W A;  1I7L A;  3MFH A;  4HQ6 A;  4FZ0 A;  2YDE A;  2WWW A;  3RT3 C;  4LF8 O;  2A79 B;  5D1P A;  4GC7 A;  4CH6 A;  2IJH A;  1SYX B;  2XIG A;  1VQL V;  4DR4 H;  2F23 A;  4GZR B;  4TV9 F;  4A2A A;  1EN6 A;  3T9D A;  2YS8 A;  3JAT A;  4DL6 A;  3RF2 A;  3CXH F;  1H2K A;  1Y76 A;  4O2A A;  2R92 A;  1BMF G;  4JYY A;  2UXC B;  3DTF A;  1HR0 O;  2YW2 A;  1N0N A;  2CFM A;  3CCV V;  1EZ1 A;  5BXZ A;  5IY5 B;  4JI3 B;  1RSO A;  1ZHS A;  1N48 A;  1SRY A;  4NXM H;  5IT9 W;  4NKG B;  4NYE A;  2YIC A;  1YTF B;  5BZB A;  2GV9 A;  1J5E B;  4R8U B;  2R7L A;  1V54 C;  1OJH A;  3JAR A;  1ENV A;  3CRA A;  2CW7 A;  4DL4 A;  3GTJ A;  5L3E A;  1SA0 B;  2OWO A;  4L1K A;  3FMA A;  2R93 A;  3JD4 A;  4AYB A;  5B3S C;  2W6O A;  1W0K G;  4YHH H;  2ZDI A;  2DYR C;  1WA8 B;  2R72 A;  1VF6 A;  2YIB D;  2FL4 A;  1T94 A;  4HR7 A;  3M9O B;  2JEU A;  3GIJ A;  1N36 H;  4AI8 A;  3H1J H;  1XNR H;  4DUZ O;  4QWD A;  2JS3 A;  4L8J A;  1AR5 A;  1KEE A;  4UCV A;  4CH3 A;  4XDJ A;  1AUX A;  5LL6 b;  4NTY A;  4BIU A;  4D7T A;  4X65 H;  2HHH B;  2YS7 A;  3RYI B;  3Q8Q B;  1K4C C;  3HXL A;  4PA9 A;  3CP1 A;  3X2Q C;  2JGU A;  1VEW A;  5L3F A;  2FPG B;  4MVQ A;  1HNW B;  3M4I A;  1WP8 A;  4XYM B;  3RTX A;  3ABL B;  3BY6 A;  1PD3 A;  3ZHQ A;  4B3M H;  4LMY A;  4RB3 C;  3ZMV A;  2W57 A;  2NU8 B;  5IJ9 B;  4FLZ A;  2RGR A;  1IBL B;  2EIM B;  2EIJ B;  3ZCC A;  4YJ2 F;  5KG2 A;  5H9C A;  4UB6 Z;  1SQP H;  4CS3 A;  1VF6 C;  4LFA B;  4QGP A;  2VRZ A;  1JFF A;  1H2N A;  2ZXW B;  4LCU C;  1DK1 A;  3GTO A;  2C2D A;  2ETN A;  4K0K H;  1XIL A;  3GDE A;  1KC8 W;  3JAL A;  3K59 A;  3R23 A;  1I50 A;  4R7C A;  2GUZ A;  2NN4 A;  2B5U A;  2Q0O C;  4AHC A;  1WP7 A;  4GUN A;  1TWG A;  4QIW A;  1R9T A;  4EFE A;  4DV6 B;  5J2U B;  4DV1 H;  4A3E G;  2W6Q A;  4NTW A;  2QWR B;  5KG7 A;  1G8M A;  2YZL A;  3WO1 A;  2YWV A;  1FXH A;  4OX9 B;  3ETJ A;  1RYS A;  1OZ0 A;  3LDD A;  3T7A A;  4ECR A;  4LF5 H;  4EYI B;  4G28 B;  2W6P A;  3DC5 A;  3WB2 A;  3GTQ A;  3WB1 A;  1NU1 H;  2ZE7 A;  4Q20 A;  2Z0A A;  4B3T O;  4X8A A;  1KUT A;  1LR1 A;  1VBG A;  5B1N A;  4FFM A;  1I2K A;  1N34 H;  1ZUQ A;  4K35 A;  2HJW A;  2Y0S A;  2V9W A;  2YID A;  4TV8 F;  2WE6 A;  5IYC G;  1EFR G;  2I8C A;  2NU7 B;  3PZP A;  3UZB A;  2W9C A;  2UUA O;  3FX7 A;  3OTO H;  2XTA A;  1VIB A;  2VPS A; 
#chains in the Genus database with same CATH homology
 1HW7 A;  3JAL B;  5EZY B;  2QM4 A;  5FNV A;  3FFQ A;  3ICX A;  5LXT B;  1XMQ B;  4LF7 B;  2R9A A;  5LP6 C;  3SJB C;  4NXN B;  4TV8 B;  2HVQ A;  1WN7 A;  4JYA H;  4CH5 A;  1XNQ B;  4LFC H;  2BTQ A;  3N41 B;  4LFA H;  5LMU B;  5ITZ B;  2UUC B;  3UQ8 A;  3F8N A;  5FLX W;  1I6U A;  3H20 A;  3TY5 A;  3VQV A;  4AQY B;  1Z5W A;  4TV9 B;  5D5P A;  2PTM A;  2UUB B;  1Q5O A;  4MTD A;  2YCH A;  2Q2T A;  2P22 C;  4EEQ A;  2HVS A;  4LF9 B;  2YIA A;  4O4I A;  5JJN B;  2ZM6 H;  2VWJ A;  3N6X A;  1TGO A;  1N33 B;  4PI2 A;  1CKM A;  3JAW B;  4DV2 H;  4DR7 B;  4DV6 H;  5KMG B;  5JH7 A;  3IAY A;  5IJ9 A;  4GKK B;  4RZQ A;  1WPB A;  4DUY H;  4X1Y B;  4LF6 B;  3RYF B;  5FNV B;  2F4V B;  3BHP A;  4FFB A;  1Z2N X;  4R7R A;  4UCT A;  4DRX A;  2ZNI A;  1XMO H;  2VQF H;  1KU9 A;  3L4J A;  4GYC B;  5JVD A;  3VQW A;  2BTQ B;  1H2S B;  5KHH A;  2CW8 A;  5BR8 H;  1M93 A;  4YJ2 A;  4RB1 A;  2VOB A;  4DK0 A;  2VQE B;  3EYY A;  1I94 H;  5JQG A;  4LFB H;  1XMQ H;  1BJT A;  4LH7 A;  4ZIB A;  4FLU A;  2XHB A;  2P5O A;  4JI7 B;  3VQX A;  2FE3 A;  4NXN H;  4DUZ B;  4DR5 H;  4PZ7 A;  5LYJ A;  4YY3 B;  4O4I B;  1XNQ H;  4LSA A;  1S5J A;  2HGS A;  4GLX A;  1FJG H;  2E3C A;  4LF4 B;  5LMU H;  2UUC H;  5JH7 B;  3RGZ A;  3JAS B;  1SKV A;  4EB6 A;  5IYZ A;  4CC5 A;  1TA8 A;  4AQY H;  4JI5 B;  3JAK A;  3N2K A;  2UUB H;  4FFB B;  4FM2 A;  3CHX A;  1E4F T;  4GKJ H;  5LMN H;  4DRX B;  3T1H B;  5K1P A;  4BWA A;  4I9Q A;  4LF9 H;  1VF7 A;  5JVD B;  4APM A;  2PGG A;  1KMI Z;  4DR7 H;  4UFZ A;  1Q43 A;  4FM1 A;  4PZ8 A;  4LSX A;  5EZY A;  4YJ2 B;  2YI8 A;  5LXT A;  3QG5 A;  3THO A;  3BRC A;  3WB0 A;  4TV8 A;  4LF6 H;  3CB2 A;  4B08 A;  2RQ6 A;  4JI8 B;  4YJ3 A;  2F4V H;  2OYQ A;  2UXD B;  4CC6 A;  4M7E A;  4X62 B;  2QJ1 A;  3GB8 B;  3KYH C;  3E22 B;  2UXB H;  4DR2 H;  1L8D A;  1XQ8 A;  3BPZ A;  2YIB A;  1TVK A;  1JMK C;  5K1X A;  4NVP A;  3KAK A;  3RR5 A;  3SR2 C;  2HIV A;  5BMV A;  2VWK A;  3JAM W;  2VQE H;  3ETQ A;  1QHT A;  4MV9 A;  3JAK B;  4DV5 H;  5GON A;  2HHH H;  3L4K A;  4DV3 H;  5JJE B;  2UU9 B;  5KMG A;  1SQG A;  4YY3 H;  2F1M A;  3N42 B;  1O9H A;  5CA0 A;  2PZS A;  2EX3 A;  4B3T B;  1VS0 A;  3RYF A;  2ZJT A;  4CS2 A;  1IBL H;  2F93 B;  5J2T A;  5LA6 B;  3DSQ A;  4PHZ A;  3OTF A;  4JI5 H;  4I4T A;  4K8X A;  1N32 H;  4YJ3 B;  3C0F B;  3J7A K;  3NBZ B;  3GJX B;  3T1H H;  4DR6 B;  3MWM A;  4LF8 B;  1HNX B;  1XNR B;  3VNN A;  4KHP B;  4UCR A;  1XI1 A;  1TVK B;  3RYH A;  2Q7G A;  4X65 B;  4LNU A;  1DGS A;  4PI0 A;  2O03 A;  5BMV B;  4UCU A;  4CS4 A;  5D5Q A;  4JI1 H;  3BAB A;  1FFX A;  4DR1 B;  4K8Z A;  4DR3 B;  5GON B;  4JI8 H;  4B3R H;  4FLX A;  2UXD H;  3BA9 A;  4HNA A;  1HR0 B;  3K3V A;  2WYO A;  3RGX A;  3JAS A;  3NBY B;  2KSW A;  4LH6 A;  3RIZ A;  2Q7H A;  2Q7E A;  4OX9 H;  5CA0 B;  3RYC A;  4I7H A;  5D1O A;  3VQY A;  4HBN A;  3K5L A;  1SEI A;  5J2T B;  3UT5 A;  2YXL A;  4X20 A;  4I4T B;  1SQF A;  3A2F A;  4DV0 B;  5LOV A;  2UU9 H;  3K5O A;  4RAZ A;  4WBN A;  2F95 B;  1XK5 A;  1TAE A;  2WDT A;  3HKE A;  3T1Y B;  4B3T H;  4I55 A;  4RAY A;  3RYH B;  2YI9 A;  4LF7 H;  4JI4 B;  2BTO A;  4LNU B;  3HKD A;  3PN1 A;  4ZI7 A;  3E22 A;  5FD5 A;  4F6R A;  3LNN A;  1FFX B;  4ETS A;  3KXY T;  3W1G A;  4MV7 A;  2ZIO A;  3LML A;  4HNA B;  3BAA A;  3U11 A;  4X66 B;  1I7F A;  1NT2 B;  1HNX H;  4LF8 H;  4IHJ B;  1ZAU A;  5JJJ B;  1O75 A;  2PY5 A;  4KHP H;  3RYC B;  3BA8 A;  3K5M A;  4B3S B;  5D1O B;  3J80 W;  4FM0 A;  5KHJ A;  5EIB C;  4DR1 H;  3UT5 B;  3S24 A;  4X20 B;  4EFB A;  2ZCE A;  1N33 H;  3W5O A;  5LOV B;  5EYP A;  3K5N A;  1HR0 H;  4PDB A;  4UCO A;  4FVM A;  4WBN B;  4GKK H;  4O4L B;  3NC0 B;  4FLV A;  1G6U A;  5LA6 A;  5CB4 A;  3U0Z A;  5KHK A;  1P16 A;  3HKE B;  4I55 B;  4ZOL A;  4DR4 B;  3DF7 A;  4U3J A;  4JYA B;  5KHG A;  1P8L A;  3QWU A;  2HEP A;  3HKD B;  1D5A A;  4ZI7 B;  4F6R B;  1QQC A;  4ZHQ B;  1WH2 A;  1S03 G;  4FLT A;  4JI6 B;  1CKN A;  3JSN A;  4O4J A;  1MZB A;  5JCO A;  4JV5 B;  1X4T A;  3CSX A;  4TQF A;  3MAQ A;  2VUG A;  3T1Y H;  4NXM B;  1BGW A;  4E6N A;  4O2B A;  3L2P A;  5CA1 A;  3M7M X;  4JI7 H;  4DV2 B;  5IJ0 A;  4DUZ H;  1HNZ B;  5KX5 B;  2RGV A;  4RB2 C;  2ZIN A;  4DV7 B;  5EYP B;  1M5I A;  4LF4 H;  4X66 H;  3U10 A;  4TQD A;  3KAL A;  3W1B A;  1IBM B;  5CB4 B;  5FPO A;  4YHH B;  1B04 A;  4ZOL B;  5EIB D;  2PUS A;  4B3S H;  2UUA B;  4U3J B;  5BR8 B;  1M0T A;  1N36 B;  3N2G A;  1X9N A;  2ZNJ A;  1CKO A;  4I50 A;  4FLW A;  1M4U A;  2HIX A;  2Q2U A;  4UCS A;  4DRF A;  1CKN B;  1SA0 A;  5JCO C;  4O4J B;  3RGB A;  4LFB B;  5D1P A;  4CH6 A;  1SYX B;  2Q0A A;  2XIG A;  3QTC A;  4DR4 H;  4X1I A;  4DR5 B;  4O2B B;  2PYL A;  4LR3 A;  4A2A A;  5CA1 B;  4JI2 B;  5LP6 B;  1E4G T;  3N40 P;  4X62 H;  3HKC A;  4FLY A;  4B3M B;  4DV4 B;  3JAT A;  1FJG B;  5IJ0 B;  4IHJ A;  3RF2 A;  2R70 A;  2IM9 A;  4O2A A;  4JI6 H;  2UXC B;  3JSL A;  1ZHQ A;  3RJ0 A;  2CFM A;  3RYI A;  4JI0 B;  4JI3 B;  1RSO A;  1ZHS A;  5KHI A;  4JV5 H;  4GKJ B;  5FPR A;  4X1K A;  5LMN B;  1IBK B;  3N43 B;  4NXM H;  4TUY A;  3SJC C;  5IT9 W;  4K0K B;  2GV9 A;  1J5E B;  3KAJ A;  5FD6 A;  4O4L A;  3JAR A;  3N2G B;  2CW7 A;  1HNZ H;  4I50 B;  1A0I A;  2F66 C;  4DV7 H;  3QF7 A;  1SA0 B;  4O4H A;  2OWO A;  4PZ6 A;  3FMA A;  4KL1 A;  4RB0 A;  1IBM H;  2JS5 A;  4DV1 B;  4YHH H;  4ZHQ A;  3TY8 A;  2R72 A;  4EQ5 A;  3CVZ A;  4X1I B;  2UXB B;  4DR2 B;  2YIB D;  2UUA H;  1TUB A;  4J0M A;  4DR6 H;  3HKC B;  4LF5 B;  1N36 H;  3JAT B;  5IWA B;  1XHX A;  1XNR H;  3IG0 A;  1WNS A;  4L8J A;  2KKW A;  1Q3E A;  4UCV A;  4O2A B;  3SGI A;  4CH3 A;  5LL6 b;  2ZIM A;  4D7T A;  4X65 H;  4DV5 B;  2HHH B;  1S68 A;  3RYI B;  1N34 B;  3HXL A;  3HKB A;  4DV3 B;  4Q0Y A;  5J2U A;  4X64 B;  2JGU A;  1L2Z A;  1FKA H;  4X1K B;  1HNW B;  3M4I A;  4DR3 H;  4TUY B;  3RTX A;  5KX5 A;  4JI2 H;  4D7S A;  5C8Y A;  2E5L B;  3OTO B;  4IIJ A;  4B3M H;  3B2E E;  4DV4 H;  1YEW A;  4LMY A;  4RB3 C;  2MCT A;  5EOY A;  3JAR B;  2W57 A;  1AN7 A;  5IJ9 B;  4FLZ A;  2RGR A;  2V4D A;  1IBL B;  2UXC H;  4DK1 A;  4O4H B;  1JJO A;  4JI0 H;  4LFC B;  3ZS8 C;  4JI3 H;  4CS3 A;  1N32 B;  5DIS C;  4LFA B;  1T5E A;  1JFF A;  3ZED A;  1Z2O X;  1IBK H;  1XDN A;  4K0K H;  4DV0 H;  1TUB B;  2RJZ A;  1J5E H;  5A2Q W;  1O9G A;  3GDE A;  4FM9 A;  3JAL A;  3RFR A;  3K59 A;  3K58 A;  4AIL C;  4JI1 B;  4BWS C;  4AHC A;  2ZM6 B;  4JI4 H;  5JQG B;  5LP6 A;  1M0W A;  3HKB B;  4B3R B;  4EFE A;  4DV6 B;  5J2U B;  4DV1 H;  1P49 A;  3SJA C;  4BW9 A;  5ITZ A;  4Q6G A;  5LYJ B;  1Q8I A;  4DUY B;  4A2B A;  5C8Y B;  4OX9 B;  3TY9 A;  4MTE A;  4IIJ B;  2PYJ A;  4LF5 H;  5IWA H;  4IAJ A;  2CAZ C;  4TV9 A;  1FVI A;  1XHZ A;  3WB2 A;  1V9P A;  4EB6 B;  5IYZ B;  3WB1 A;  2HVR A;  1XMO B;  2VQF B;  1N34 H;  1Z5V A;  3N2K B;  3N44 B;  3JAW A;  4X64 H;  4CH4 A;  2WE6 A;  1JFF B;  4TOI A;  3J81 W;  3K57 A;  1HNW H;  2JVD A;  4X1Y A;  2E5L H;  3OTO H;  3RWR D;  1Z2P X;  1I94 B;  1GYF A;  2VPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...