1TA8A

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
313
structure length
313
Chain Sequence
b'PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase, NAD-dependent
molecule tags Ligase
source organism Enterococcus faecalis
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
total genus 100
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1ta8A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1ta8A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1ta8A02
4NXNB 4DRFA 3RTXA 4LH6A 3UQ8A 4X64B 4JI6B 5BR8B 2Q2UA 1TA8A 4AQYB 1IBKB 2Q2TA 4LH7A 1CKOA 4NXMB 1FJGB 2UXBB 4PZ6A 2UXDB 3TY9A 1S68A 3BABA 4JI7B 4B3SB 2F4VB 4B3RB 4DV3B 1CKMA 1HNZB 4JI0B 2VQFB 1CKNA 2CFMA 3W1BA 4DR4B 4B3TB 4JYAB 1IBMB 4DV4B 1HNWB 4JI8B 3JSNA 4LF8B 2UXCB 3TY8A 1DGSA 2HVRA 1N32B 5DISC 4E6NA 4OX9B 4PZ7A 1N36B 2HIXA 1XK5A 4DR7B 4DR5B 4JI2B 4UCUA 1P16A 3BA8A 1XMOB 3TY5A 3BAAA 3VNNA 2HIVA 3L2PA 2VQEB 4KHPB 1TAEA 2E5LB 4EEQA 2HVQA 3PN1A 4JV5B 1I94B 1XMQB 1CKNB 1A0IA 4DR1B 3SGIA 4DV7B 3W1GA 2HVSA 3GJXB 4B3MB 1HR0B 4DR2B 1P8LA 5D1PA 4EFEA 4X65B 5D1OB 3S24A 5D1OA 4JI3B 4LF6B 4LFCB 4LFBB 4LF7B 2HHHB 1ZAUA 4EQ5A 4UCOA 4UCTA 4DV0B 4GKJB 4UCVA 1XNQB 4DV1B 1IBLB 4EFBA 5FPOA 4UCSA 4DR3B 4LF4B 1XDNA 5LMUB 4DUYB 5FPRA 1J5EB 3NBZB 3NC0B 1HNXB 4CC5A 2UUCB 4GKKB 3KYHC 3W5OA 4PZ8A 4YY3B 3JSLA 4LF9B 3GDEA 2UU9B 4GLXA 4UFZA 3NBYB 4TOIA 4X62B 5LMNB 4DR6B 4DV6B 4X66B 4LFAB 4DV5B 2ZM6B 1B04A 5IWAB 3T1HB 2OWOA 2VUGA 2UUAB 4YHHB 2UUBB 1N34B 3OTOB 3QWUA 1V9PA 4UCRA 4LF5B 1X9NA 3RR5A 4DUZB 1VS0A 3T1YB 3BA9A 1FVIA 1N33B 4JI1B 4DV2B 4CC6A 4JI4B 4K0KB 1XNRB 3GB8B 4JI5B
chains in the Genus database with same CATH superfamily
2XCPA 4B7KA 3OSPA 1NT2B 3ZHTA 2Q2UA 2QKCA 2LGQA 4TV9A 1PX2A 2WTFA 2PN1A 1MZFA 3VMMA 4IL6Z 3FKIA 2BQUA 3JASB 2D3OW 4H13B 3CE2A 5JJNB 2EIKC 2I8CA 3E89A 4QWEA 3SJQC 4JZGA 4U3JB 3X2QB 1G6UA 1Y66A 2F66C 1Y1WA 4JI7O 2EIJC 4TV8A 1I1KA 1BGWA 1SZXA 4LF4O 3MR2A 3KZIZ 1FJGH 4TUYA 4HYOA 5FL7G 2M05A 1V54C 1JR9A 3LSQA 4LF8B 1KU9A 1EZ1A 3F7YC 4FLWA 3CSWA 1H2NA 2FMLA 3V6KA 5DLFA 1AUXA 2VPQA 3LQSA 3JCZA 3C3SA 1YVWA 3AK2A 3LSSA 4UCUA 3T5HA 4LBEC 1HW7A 3LDCA 3WG7C 2DPJA 4JI4H 2XTAA 3APQA 4FFBA 3L2PA 4MVRA 4FS2A 3STLC 3ZN1A 1FFXB 1N48A 5CBFA 3TINA 3AG3C 5B1AC 5LBQA 4CKCA 4MVQA 4FLZA 3G8CA 1K83A 5E1AC 1WB7A 3HKBB 5I5WA 2HVSA 1P7BA 4CS4A 3BACA 5KFQA 1EN4A 1P8LA 5BMVB 5DQHA 5D1PA 4PDRA 3K57A 5E79Z 1ZQ7A 4JI5H 3ZCCA 4O7YA 1YJ9V 4IR9A 1XUQA 1I5XA 2WWWA 2VWJA 2WYOA 3TQ1A 4AHCA 4KFMA 1DTOA 2VPSA 3ZMSA 2IJHA 3ORRA 2E75B 4X20B 5LYJF 4IIJB 3A2FA 1K92A 4X89A 4O3OA 3DSQA 2BOCC 2NUAB 1PNLA 2BOBC 5IYBG 1H8HG 1AJPA 2PVPA 3EPIA 4ED1A 3B8MA 1X4TA 4CC5A 4TQSA 5JUMA 2E5LH 4DQNA 4ZI7A 2HGWA 3JSLA 1SA0A 4LF9B 3I56V 1FS0G 2ZNJA 4UXNA 4ASUG 5BMVF 3W7SA 5LP6B 2QF7A 1KTAA 1VF7A 1JQ0A 4FFOA 3QNEA 3KALA 3TW7A 3MR3A 3KHHA 4NXNH 2ADPA 1K8AW 2RDJA 1VBHA 4B3TO 2RDCA 5CM0A 3GIDA 1VP7A 4FU0A 4I0XB 2YRXA 1S03G 1RSOA 1Y76B 3MWMA 4KUMA 5AG2A 1SESA 2W57A 4OGQB 5DEDA 1IVSA 3WNZA 3PR4A 4BY1G 4JZ2A 5BYAA 3B4SA 1PK8A 4MTGA 5DECA 3H9VA 4IT5A 3HKZE 4TQRA 4I4TF 2Z5UA 3CCMV 4AQYB 2FJZA 2CAZC 3ZMZA 1D2DA 3WG7B 1BNCA 1PM9A 3TY9A 2AZ0A 5KFCA 4FLTA 2ZR3A 4JI7B 1MABG 1YI2V 1URFA 3K04A 3CCQV 2Y69B 1PPJH 2ILMA 5CA0F 2Q7DA 3JSNA 4Q0YA 4HNVA 2NR5A 3CCRV 1IBKH 3P3NA 4EB6A 2JEUA 2B1IA 1R6NA 3QZ7A 1KC7A 2PUSA 2VUMG 4GKKO 1P16A 3BA8A 4EKWA 4MV7A 1TUEB 3JARA 1YDXA 2ZIMA 5LMUO 1SZTA 4O4LF 3C3TA 2H3OA 4FFKA 4YJ2F 2JEFA 2ARHA 3W7TA 4YR2A 3MHSC 3ZBHA 4J7KA 5LXTA 1IZ3A 3CRCA 1HR0O 2QEXV 2UUBH 3VPDA 3ML0A 3T5LA 3BCCH 2YZLA 3GV7B 3PFFA 2AQ4A 5H2FZ 2HJFC 1SA0B 3CCUV 4O7VA 2X7RB 1QVFU 1GN3A 3S24A 4E4TA 3GTQA 3JALB 3SR2C 1OV9A 2EJ7A 4ZOLB 2PMZA 3AG2B 4F4LA 5CB4B 2HFEC 2GV9A 1I0HA 3QQMA 1O9HA 4MTOA 3P3PA 1OBGA 4QE9A 4O2AF 1PD3A 4QW8A 4TWKA 3GTJA 4GKJH 5BY1A 4BW9A 3TCUA 1YJNV 1KD1W 4RUAA 2VA2A 3B09A 1TWGA 4HNUA 4LCUC 1WP8A 3RGBA 1H38A 5L1LA 4IRCA 2JRIA 4DL7A 2JK5C 2PI5A 2WA4A 1ZWIC 2KSDA 2PZSA 1B04A 5CMUA 4DR7O 5KHJA 3B8NA 4U7OA 3QFFA 1I1LA 5GTHZ 3H0GA 4JGSA 1FXHA 3C90A 5JVDF 4PA6A 2CTPA 1S5LZ 5EK0A 3KCXA 4Q8EA 3V6JA 2XAJA 2F43G 5IYCG 4ZQIA 3CMAV 4MV4A 3GQCA 4U7NA 1GTOA 4AQYO 3I5DA 3H1LH 1YZBA 1IBKO 1AVMA 1NQTA 2X6AA 4J7ZA 2W0XA 1SQQH 4JI6B 1I6UA 3CRMA 3MDSA 4HBNA 5A9GA 2NLJC 2DYSC 1KJJA 4DL2A 4K8XA 4J80A 4JAVA 1CKOA 4DR4H 2XHBA 2CH7B 4PDLA 3SYOA 3OUZA 5L1JA 3APOA 3CC4V 1EKPA 1HNZB 2F1MA 4NTWA 4QJFB 4MV3A 2VR1A 3C0FB 2F4VO 2DMXA 5GW7A 4LF7O 4EGQA 2B63G 1IBLH 2CW7A 1KKCA 5JH7B 1N36B 5CR5A 2J6TA 3GIPA 1QQCA 1SRYA 1XBLA 2JGDA 3D36C 4JYCA 5BWXA 4OPAA 3SYCA 2FKXA 4F6RA 1WPXA 1Y74A 1EYZA 3CC2V 2FTKA 2KSWA 2RF4A 2Q7HA 3SE7A 4PELA 1NR7A 1M0WA 2P90A 2LQTA 2K1EA 4DV2O 2RN9A 1Y14B 2ABJA 1VQ5V 1FKAH 1F23A 2IBZH 3W1GA 5K2MA 2AGPA 4X62O 3KG2A 2CDYA 4DV1H 4OPHA 3K0GA 4O86A 2HEPA 4P9PA 4X20A 2DAAA 1Y1VG 2ITCC 2ZXWB 4LF7B 4CH4A 4H33A 4JV0A 1WA8A 4RUCA 1OCOC 4O4IB 4ECQA 3TXSA 1BSMA 2P06A 2WLJA 3TK1A 2V5AA 3UM7A 5TISZ 3JD2A 5KFFA 1EKVA 1H2MA 4IHJA 4BWSC 2ZGIA 1TWHA 1TUBA 5EBMC 1E4EB 2NU8B 1CEZA 2EZOA 4Q43A 3CS5A 5IYDG 3W5OA 2NVYA 4Q20A 2C00A 1AI7A 4GUNA 3OR7C 3TIIA 3K3PA 3QO5A 1XDCA 2W71A 1GO3F 3SYAA 2Z3YA 3A0RA 2V58A 3GIJA 1VQ8V 2QWNB 2Q5ZA 4R6ZA 4FZ1A 1Q82W 2P7TC 1QCEA 5LL6b 4I0XA 3T54A 3HXLA 5EYPB 3LNNA 1ENVA 4O83A 3KHRA 4Q45A 1N33B 4JI1B 4JI6O 2KB1A 2EILC 3RYFA 4NLGA 2UXDH 4DV5H 2VQEO 3V4SA 2E5LO 2RDIA 1XL4A 3RYHB 4RNNA 4OX9H 2BE3A 2AZ2A 5F9LA 2ZD9A 4FLUA 1V51A 5KFBA 2XNDG 4ECUA 4JYYA 2UXDB 2V4RA 3G71V 3RIZA 5KFSA 5GONB 4UV8A 2F4VB 4JF3A 1IDSA 3K79A 4RUFA 4J11A 4B3SH 1SQPH 1IBMO 2CFMA 3GTLA 1HWYA 4RAIA 4RO2A 1IBMB 4X9QA 2DWCA 1AI5A 4C5AA 2UVWA 2HVRA 3MFIA 4O7TA 3E5NA 5EWGA 4ED6A 3FFQA 1BHAA 4FVMA 4QE7A 1O9GA 1US6A 4JI2B 4CMFA 1XNRH 2HP8A 2EBOA 4DR5O 1M5IA 5EYPA 1TAEA 4EEQA 2E5LB 4DK0A 4HR7A 5EC1C 3HBLA 2XGPA 3G6BA 1NS1A 2V9WA 1I94B 4HQ6A 4MW3A 2F95B 3ZRXA 1IURA 4RB0A 2JA5A 1M0TA 3E2EA 4PA9A 1V4YA 1GSHA 3ZIAG 5IT9W 5EZYB 4QIWA 1N0NA 5IWAH 4A3DG 1UJWB 1S76D 5JCOA 5LA6B 4IWXA 5I5UA 4EFEA 5LMNH 1Y1VA 2KQXA 2A79B 2QSAA 4R7RA 3HR0A 5D1OA 3FB5C 4NZNA 1RP3B 2W7PA 2A3QA 4GX1A 2Q7GA 2FKLA 3RT3C 3TETA 1I3QA 2IU3A 3UZOA 3AG3B 5BYBA 4R8CA 3L71H 4NKGB 5FPRA 3NBZB 5KFIA 3ZMVA 5J2TA 3HOWG 5LA6F 4KL1A 4A3CG 1BGYH 5C8YA 2D2CB 2YSUB 3HB3B 3RW0A 2Y4RA 4TM5A 2WB1A 3H40A 3RFRA 3SDLA 2DQ3A 4UVCA 2LO1A 3M8AA 1Y1WG 1EKFA 2A7WA 4G27B 5I60A 4DR6B 2DQ0A 5C5JA 2J9GA 2ASDA 5JVDB 3WO0A 3T9EA 4O7RA 1HNXH 2AHZA 2MW2B 5IWAB 1D5AA 4DV7O 2XAGA 4JI1H 3M4IA 3FB8C 5JCOC 3JAMN 4A3IG 4DR3H 3KHLA 1RJRA 3RF2A 3OTOO 1RK5A 1VF5B 2HJDA 4QPKA 4QWBA 5KLVH 4WBNB 3MWEA 1XOUA 1XNRB 3ZMUA 3P32A 4RUEA 3HKCB 2IJJA 2JJ1G 3RTXA 5L3BA 1XNRO 5IP9G 4BR6A 1FFTB 5CA1B 3FB7C 5KFWA 4DV3O 2YXHA 4H44B 3FYIB 4BBRG 4YR3A 1MSWD 5KFUA 3DGEA 4AYBE 4DV3B 5DAAA 4LP8A 1T36A 4DL5A 2YW2A 1M6VA 2VQFB 3AK3A 5IWAO 2DZDA 4XDLA 2GQRA 1JLLB 3CPWU 2ZR2A 2QM7A 2DLNA 3R5HA 4YAJB 2UXCB 1S5HC 1SC5B 4H0LB 1FXVA 1GMGA 4F6RB 2YS8A 2PF4E 2Q7EA 2UXCO 4J9MA 5LGTA 5FD6A 4DYLA 4UV9A 1JFFB 4BIZA 4A5UB 1JCHA 1AP5A 3JD1A 1RK6A 2HIVA 5F9NA 3JAKA 2PBZA 4G28B 1GM8A 5CA1F 1VQLV 4WBNA 2XC9A 4JI0H 1XHXA 3JD3A 1M57C 1C3OA 3HOVG 4FM9A 1PL4A 1A0IA 2BR0A 2Y4UA 4D7TA 1M93A 4YJ3A 2CH7A 3OMIB 4DR2B 2J6UA 3PZPA 3HOUG 5BWVA 4O82A 2H8PC 2UVRA 3RB6A 1M90W 2FPPB 2HDKA 1N36H 3ABKC 4I7ZB 3GIMA 1W0KG 4LF6O 2WE6A 4O4IA 4XYMB 2UVUA 1IBLB 2GQSA 5EZYF 4MVMA 4TV9B 4WFGA 4WFEA 4GX0A 3QF7A 4DRXB 4JAUA 2QDOA 1XREA 1HNZH 1B3QA 3PW7A 1P84F 5IY5C 1HNXB 1VQ6V 1WJZA 4RQEA 4LF9O 1E4EA 2ZE5A 3K5MA 4O4LB 5LYJA 4RAZA 1KQSU 4KHPO 4LSXA 2JS3A 3CP1A 4P9OA 1I50A 2R8IA 1K34A 2Q67A 2ZE6A 1JDBB 1OCCB 1OBDA 3H1JH 4X1KB 3SPCA 4TV8F 5KFKA 2R9AA 2C35B 3RUPA 3CCJV 3H0GG 3IJ4A 3T1HB 3DXRA 5JQGF 4DLKA 2QE7G 5H6QA 3VA7A 4I4TA 2R7KA 4QSHA 4XYLB 4DV0O 4UCRA 4I55A 5GONF 2W6IG 1IX9A 4DL6A 3VQVA 4U7CA 2A06H 1GKFA 1K33A 4FJCC 5HV6A 3TEKA 2GTSA 1OCZC 4BWAA 2FK3A 3OM3B 1VAJA 5DMXA 3N2GA 3GWKC 2QKSA 1JJ2U 4O4HA 1TA8A 2ZE7A 3HKDB 3JALA 4LR3A 1VBGA 2Y0PA 5EBLC 4LH7A 3Q8RB 3ZJZA 3CHXA 1WNSA 4GC7A 2B9ZA 5KT3A 1A3GA 4J9OA 3J80N 4B3RB 1N4CA 3T5JA 1GSOA 2OCCB 3H3VH 3U11A 3W1BA 5J9PC 5IJ9A 2WLIA 4DV4B 1HNWB 1Q3EA 3ZN0A 2QM4A 4XX0B 4FFBB 3L75H 4JI6H 4JI2H 3FB6C 4DV5O 4JXUA 2CK3G 3CCEV 2COGA 4IYHA 3OUSA 3G80A 1JDEA 4OX9O 4JV2A 3TY5A 3BAAA 3PR5B 5IJ0A 4ECSA 4IRDA 1JXLA 4LF5O 2EIMB 4JV5B 4NR1A 2M7WA 1UFIA 3LWBA 3GV5B 2Q4PA 5BMVA 3K3VA 3I12A 1NH2B 5KG2A 1QNMA 4PD4F 2A9HA 1YTFD 4X64O 5L3FA 5EIBD 3N42B 2CUGA 3N2KB 3Q1KA 4KHPH 4WFAV 2YIBA 4O2AA 4BW5A 5KFGA 4LFCH 1SS3A 4PJ0Z 4DV4O 1ZAUA 5KG7A 1N33H 1XQ8A 3PW2A 4GKJB 4PA3A 4UVAA 1THZA 1ZL8A 5FPOA 4DL4A 2JA8G 1WLEA 2EILB 4MA0A 4CS3A 4IIJA 1JVMA 1XDNA 4FLVA 1GAXA 5DN6G 4LF4H 2N74A 3GTMA 3N44B 3RYHA 1SF9A 1EFRG 3MJFA 4JV5O 2RQ6A 4O7WA 3T9BA 2P67A 4X1YA 1H2KA 4RZRA 3N6RA 4PZ8A 3CB2A 5JWPA 2C28A 1R3IC 1P49A 2VOBA 2X0LA 1H2GA 3PO2G 4DV6B 3CXCU 2FK2A 3RB0A 4HZ3A 4E4EA 3HKBA 1K97A 3QTCA 5J2TF 5IJ0B 5DQIA 4I9WA 5KT5A 3JAKB 1KC8W 3LNMB 4A3JG 2W0FC 2UUBB 4MV6A 4XDJA 4BIUA 2PGGA 1I94H 2WLMA 4TV9F 4AILC 3HB9A 2WAQA 3UFXB 2WLKA 1A9XA 1VS0A 1YHQV 2COJA 2FB5A 2G38A 4LF7H 4O4IF 4EG0A 4DRFA 2R85A 2JDIG 3CQZA 5DGAA 5EIBC 1Q5OA 1W59A 3JAWB 4TUYF 1PNKA 3RBZA 2QA4V 2XCAA 4JTDB 3BVOA 2YS6A 4J9YB 5JQGB 4DV7H 1L8DA 4B3SB 3IFXA 5A2QN 3U0GA 1WR2A 2QJ1A 2BTQA 4YIPA 3OTOH 3J80W 3DTFA 1O75A 3R5FA 1RSOB 1EZVH 2XAHA 4LNUA 4OX9B 2HGSA 1S9FA 1EUDB 4J9QA 5D5PA 3PJSK 5IJ9B 1S77D 5DGHA 2DPIA 2C2DA 2R8JA 4ZHQF 1K3EA 3I4NG 4DO2A 2GDSA 4TUYB 5KHKA 4YHHH 2P0AA 1XEQA 4ED0A 4Y8VB 1R9TA 2RGRA 3PO3G 3JRWA 4J9SA 4WFBV 4O81A 3BPZA 4F4ZA 1S3JA 4J9ZB 3VQXA 2QTSA 4AI8A 5LL6Y 4ZOLF 4X65B 4DRXA 3AYHB 3GIQA 1DF5A 1T3NA 1OHHG 4C5CA 2IM9A 4X65O 4LFBB 4K0KH 1AN7A 3H1KH 4FFMA 3JZFA 2XAQA 3RN4A 2RJZA 1VQPV 4FFRA 4JI5O 4Q4CA 4UCOA 4QIWE 3LDDA 3I55V 4YXWG 2EZPA 4ZHQB 1PV0A 4CKEA 3AW8A 1E4GT 4EYIB 4FK5C 5JJEB 2VRZA 3WB1A 4B7EA 2X5RA 2DWEC 1FAFA 3ORQA 1NZ6A 1KJQA 2JA7A 1W2BU 3OFNG 2JA7G 2Z04A 4A3FG 1G1XB 5EZYA 2YXYA 2I87A 4UFZA 4JI8O 4I5SA 1FXKC 4J7JA 2ZE8A 3ZS8C 2R70A 1RPOA 3G6YA 1R6TA 1DAAA 1N36O 2KKWA 2R87A 2W9BB 1YIJV 2UUAB 5HFLA 4DUZH 1IOWA 5KMGA 4B3TH 3RYFB 2W9AA 3UCSC 1A32A 4QWAA 4YBZB 2LFSA 1Z2GA 3OEEG 4U3FH 4M0JA 5FNVF 4DV2B 1GN6A 3CMEV 2W9CB 4BAYA 4J0MA 2DJVA 2FB9A 4PDVA 1U96A 5EBWC 5BR8B 3GWOA 5C44G 1KP2A 4L8JA 4IIJF 3RBEA 2WDTA 2FLPA 1R6KA 2UU9H 3K3WA 1EN6A 3I4MG 3HOZG 1GN2A 2QWPB 5BR8O 2RGVA 1ULZA 3RGZA 1IYEA 1GM7A 1R3KC 2CTQA 4A93G 5J2TB 1S68A 2BTOA 1Z5WA 2LJ2A 1QBZA 5I5VA 3BQ2A 4EYHB 2P4KA 2ODTX 5KFPA 5KS8A 4DUYH 3HKCA 4ECTA 1CKNA 4YAKB 1B6QA 5B1BC 4DR4B 2R7LA 2KG7A 2ZDHA 1V55C 2UUAO 3TIGA 4YJ2B 1UC9A 4RWUA 5DISC 2XOKG 5C1OA 3OSNA 3ETGA 3GIIA 1DV1A 4DR5B 3ZRWB 2R8HA 1K4CC 5DM6V 4QWDA 5FJ8G 4FPPA 3VNNA 3R66A 1L0NH 3RAQA 4ZI7F 1SQXH 3ZHRA 1G2WA 5L3GA 3ZRVA 3AG1B 2NU6B 3F5TA 4CS2A 1WH2A 1N0JA 2GUZA 3SGIA 2R82A 5DGIA 2WPDG 4X1IB 5BWRA 4DR6O 3EYYA 3Q4HA 5KFLA 4YR0A 4NZMA 1SEIA 4LFBO 3ZRWA 2EULA 3FMAA 5KFYA 5LP6A 5KHGA 5CN0A 1JJOA 2HHHB 2XUMA 1K5QA 3PW4A 3MR5A 4ED2A 2OCCC 2ODMA 4ZI7B 3OTFA 3GTOA 4EFBA 3IN5A 4DUZO 2JA5G 2PYJA 2W6OA 5LOVF 3FAVB 4O3RA 1BS3A 1MZEA 1Q6UA 4LF8O 2ZDQA 4X1IA 1BXRA 4DUYB 4A2AA 4DR3O 1VF6C 5KAFZ 1KJIA 4NB5A 2CGOA 5D8DA 4IR1A 5D5QA 4I50F 4J9RA 2HHHH 1Q81W 3RAXA 2CNVA 3FDSA 4GLWA 5BZBA 1GLVA 4XBFA 2P5OA 1KB9F 5BR8H 5LP6C 2Q0OC 2C2RA 2ZM6B 4YJ3F 4IZOA 4FIPC 4DV2H 3OTOB 3QO7A 5EOYA 1RJPA 4IHJB 1VQ7V 3K59A 5KG1A 1TWAA 5ITZB 4DV1O 2YZMA 3RR5A 2R72A 2V4QA 4DUZB 1D5NA 5GTIZ 2NU7B 2OT5A 4R50A 2DW4A 1WSCA 4O7ZA 2BTQB 2R92A 4QIWF 4O3PA 5J2UB 3RYCA 4HNAB 1S0OA 2ASLA 4DR1O 2XCLA 5BWUA 2FLLA 2YIDA 3OW2U 2Y4TA 2Y0IA 1KEEA 3FKIG 4O7SA 3OMAB 1PKXA 2W70A 5LGUA 1T5EA 3WWIA 3JD4A 2W6ZA 2OYQA 5KHHA 2W6QA 3DXRB 4O7LA 3CRAA 4PDBA 2GHYA 3TY8A 4WBNF 3RB4A 4ECRA 3ZX6A 1Q6IA 3CSXA 2LW7A 2XIGA 1AR4A 1G8MA 1IBLO 4DIMA 2Q0AA 4A3EG 1YF2A 1BT8A 5CB4A 3M9NB 2F93B 4QNHB 4EBCA 1M56B 4WCEV 4FM0A 1M57B 3PN1A 2R8GA 1HR0H 2UUCH 3M99B 5KFZA 3VPCA 1I2LA 3MHHC 1F51A 3ZEDA 3E86A 4DR1B 1RJQA 4DV7B 2Z02A 1G4YB 4O84A 1SETA 2IH1C 2FPGB 3N2KA 3X2QC 4ZHQA 1K7DA 1PL0A 3CEIA 4X62H 2HHHO 3N8DA 3PW0A 2WSSG 4RAYA 3K03A 4BXXG 4EGJA 1I1MA 4C5BA 4UUGA 4LF6B 4JI3H 2NVXA 1KT8A 3VQWA 4ECZA 4EEYA 5DG7A 4DV0B 1E1RG 4UCTA 3GV8B 2V4DA 3HKEB 1I7FA 3AG7A 3RWRD 1RFYA 4MW8A 4UCSA 2FMAA 1RM1B 2SCUB 3LSUA 1NTZH 3SJAC 3ABLB 5LHGA 2HG8A 5JH7F 4B08A 4TT3G 4UVBA 3UT5A 3T1CA 1SFOA 3N27A 2WLIB 4A3GG 1TGOA 5IP7G 3QG5A 2ZM6O 4BIOA 1JPXA 4DR7H 2R92G 3V4ZA 2DOSA 3KXYT 3SPIA 5KFDA 1CS0A 4O2BF 1N32H 3K5IA 3CRQA 5FR9A 1QVGU 1NH2D 5KFNA 5LMUH 1L0LH 2JA6A 1HNWO 3HT5A 3HKDA 1VQ4V 2R93A 1CXZB 1AI4A 1X9NA 3ASOC 3QZ8A 2A1HA 3ZHQA 4B3RH 2R8KA 5KG0A 5CA1A 2CKZB 3ZHVA 4K6NA 2ITDC 3JAMW 4MV9A 3M9OB 3LDEA 3A0BZ 5IYDO 4O3NA 1AROP 1W96A 4DV6H 1QU7A 4FM2A 2EINB 4ECYA 4PI2A 3R5XA 4JI8H 4I55F 4TQFA 4YY3H 2CW8A 2W8LA 4ED8A 2GLTA 1KJ9A 5FNVA 2UUCO 1MG1A 5K3WA 1I08A 4YP3A 4GZRB 1YITV 1AUVA 2W8KA 4K3AA 3DTGA 5KG4A 3L4JA 2WAMA 3N43B 3D8CA 4LNUB 1DGSA 1R3LC 3S3XA 5J2UF 4L87A 1S72V 4GKJO 4MTXA 3K5HA 1BQ0A 4PZ7A 3ETJA 1C30A 4NYKA 4D7SA 2ZDIC 1VQOV 3AEIA 1HNXO 3LMLA 4A2BA 4ABMA 1FYJA 1QR8A 2R7ZG 1E4FT 1BQZA 1Z2OX 4DV4H 2DIKA 3D3QA 4KHPB 3TJTA 4TQDA 1K73W 1TVKA 4B3MH 1AJNA 3DAAA 4CH5A 2CTRA 3EFFK 2YS7A 4GCZA 2PTMA 5EWFA 2JEIA 3T7AA 4NXMO 1S0VA 1DV2A 2K9PA 3DC5A 3K5OA 4H37A 5BWTA 2KG7B 3CCLV 4JV5H 3F5WC 1JA8A 5H9CA 4X66O 1UPGA 5D1OB 4C2MA 4ZKIA 2ZQMA 4NTYA 5GONA 3IAYA 2R84A 4MAMA 1S0NA 4QGPA 3HPLC 4I7HA 2ZDIA 5LA6A 1N32O 5C8YF 3H4DA 3VBBA 3Q8SB 4DXWA 5BWWA 1HNWH 1R1BA 3AX6A 3FKSG 5I5XA 3T99A 4JTAB 4Q8FA 2P22C 2P6JA 3F8NA 1YEWA 2CGNA 3U10A 3J7AK 4B3RO 4QWCA 5C3EG 1RPRA 4U3JA 4I9QA 3GIKA 1A0GA 5DGBA 4DV6O 4A3MG 1XL6A 3L73H 3T1HO 4RCNA 3JCUZ 4YY3O 4ECXA 4X66B 4JI0O 1NJIW 4FBTA 4DV5B 4R7CA 2ZIOA 3SJBC 1DLBA 3QWUA 3RYCB 3ABMC 4I4TB 4PHZA 1S97A 3FAVA 3JZ6A 4LF5B 2YIBD 1R3JC 2WLHA 2VQEH 3KKYA 3ASNB 1TUBB 3AG1C 4K0KB 1LR1A 5H6RA 3THOA 3GB8B 2IBKA 3R65A 1CQIB 3J7AU 4X64B 2WA3A 4FZ0A 4DW1A 5IT9N 3ASNC 4DL3A 4O3QA 2C2AA 4DR2H 2IW5A 1K1QA 5I5TA 3CXHF 4FGRA 4PZ6A 3VQYA 5LXTB 2QB5A 1BCCH 3LULA 4HN2A 1SCUB 1NTKH 3OMNB 1V55B 3S3WA 3SYQA 4JI0B 2HKOA 2YUAA 2R9IA 1SQFA 4QW9A 4W4LA 3ZRSA 4NXMH 3RVZA 2OH2A 2HHFB 1CE8A 3OGIB 3MR6A 1FXKA 3JATB 1NTMH 2E2HA 1VIBA 4O2BA 4JV1A 4E6NA 4X66H 1L1FA 2XASA 1GN4A 1XK5A 2V7QG 3B77A 2UXCH 5KFAA 1Q43A 3HKZA 4K0KO 1MA1A 3SPGA 1EN5A 4UB6Z 4F4XA 3G6VA 2JIZG 4LMYA 1N8RW 4NYEA 3CCVV 4YQWA 1E79G 2YWVA 2PI4A 1XMQO 1ZLZA 2UUBO 1A48A 3OR6C 4GX5A 3BQ0A 5HBRB 5KX5F 2UVVA 1ZETA 2LGWA 2E76B 3RB3A 4PWQA 2YDEA 4DAAA 2DWDC 1JX9A 2UXDO 2AGOA 1I7LA 1UC8A 4GC6A 5FLXW 3GLKA 1NBMG 2HVJC 1QR9A 4EQ5A 2O57A 4MTFA 2PY5A 4WFHA 2ETNA 4J9KA 2I80A 4GX2A 4DW0A 4MSWC 5LHHA 4B3SO 2AGAA 5KX5B 1Y4MA 4JI2O 2YICA 1CPYA 4K8ZA 1HNZO 2JVDA 4O4LA 5LYJB 4IGGA 1RYRA 1DK1A 4X8AA 5EC2C 5B3SB 5HNEA 1B6SA 4GLXA 1IXBA 5KAIZ 4FFPA 4TOIA 3JRXA 1JFFA 3HKEA 2UU9O 2R6FA 2GTAA 3H1IH 3ZHSA 3O65A 1J5EH 2HR3A 4JAAA 4YHHB 5I47A 3G6EV 3BFRA 3VOUA 4NVPA 1OCRC 4EBEA 2LP7A 2EINC 3T1YB 3MFHA 3KHGA 3BA9A 4F4WA 5BXZA 4CC6A 1XMOH 1ZSPA 2HGXA 1F4MA 3Q2OA 5F2VO 1GSAA 3EXAA 3MWDA 2N05A 4AQYH 3AG4C 3QVNA 3STZC 1W93A 1WP7A 1Q90D 3JASA 3R23A 4ZOLA 3JD0A 1Y67A 5C1PA 3CC7V 3ABTA 3T1YH 3CVZA 3K58A 4DR4O 5CBGA 3L4KA 3CD6V 5BPFA 3AG2C 4UUJC 2L6LA 2GPWA 3CYOA 2W6PA 4RB1A 5L3EA 2GPSA 1GH6A 3WB2A 1P7GA 2ZCEA 3E8HA 5JVDA 1YCIA 2IH3C 4CBCA 1B33N 1P4RA 3JARB 2NU9B 4PA4A 2YI8A 1I5YA 5KMGB 3WWJA 4TVIA 5J2UA 5C8YB 2VS0A 4FE2A 1XILA 2YI9A 1NVPB 3GJXB 5JQGA 4PV1B 4Q44A 4B3MB 4E2LA 1FKAO 2YXLA 3SNOA 2NNUA 2EJ0A 3UO3A 5E25A 3OEHG 3N41B 3UYYA 4JI3B 4LF6H 1LUWA 2EIYA 4M7EA 3RJ0A 2NN4A 1SQGA 2CNQA 3RV3A 1WRVA 3TQTA 2VQFO 2FLNA 1XHZA 4DV1B 3DF7A 3GTKA 2Y69C 3RVYA 3SPJA 1IBMH 3K5LA 1H8EG 1KYOF 4LF4B 3Q4HB 5IYCO 1WA8B 1M56C 1BJTA 2W6JG 3PVXA 1MOFA 3RV4A 2QGNA 5CB4F 1AJQA 4D6TH 1VMGA 2YEVB 1KMIZ 5B1OA 2DYRC 4QJFA 4JYBA 3GDEA 4MTEA 1L2ZA 2M6YA 3T4DA 3TXQA 5LOVA 3B2EE 4R8UB 4Z1VA 3G67A 2BSKB 4X1YB 4GKKH 1Q8IA 5L3CA 1EHIA 2ZNIA 1YJWV 1Y74B 5IYBO 5KX5A 3G4SV 5JVLA 2H94A 4ICGA 4W4KA 4AYBA 3T1YO 3SI8A 1XNQO 4WD3A 4MVZA 5EWEA 1I94O 1S5JA 2DN9A 1BL8A 3H1HH 2Q6AA 1RYSA 4RQFA 2EIMC 3V6HA 2XT9A 2MCTA 3FD9A 1KECA 3UZBA 4Z1MG 3U54A 1BE3H 2CZGA 1SYXB 5L9XA 3DTUB 2C22A 1MZBA 2Y0SA 3MD0A 4HYKA 2UXBB 1KBLA 2AGQA 4CH6A 4MV8A 4RU9A 3GTGA 4NTXA 2HG5C 2F4VH 2R7ZA 1OWTA 1VQ9V 3BJYA 2JEXA 1WCMG 3QO8A 1VQKV 4K35A 3N6XA 2RCVA 4Z2WA 5FLXN 3JAWA 4YJ3B 4FBUA 3OGCC 2ATKC 5KFTA 4P30A 1YSCA 3L74H 2HIXA 3HO8A 1ZHQA 1VKZA 2WB1E 4RNMA 4EBDA 4N23A 1XMOB 4FMTA 2JEJA 1ZL8B 3TW6A 2B5UA 3SYPA 5DLGA 1MSDA 3EVKA 2VQFH 5B1AB 3BHPA 2BQRA 1OCZB 1WCMA 2UXXA 2QKAA 1TWCA 2QWOB 2WLLB 2UXBO 1S0MA 1K1SA 2FE3A 4O4JB 1HR0B 1YXBA 2YIAA 3L70H 3E22B 2JGDB 2VWKA 1E1QG 4O4HB 2BSKA 5JH7A 1V54B 2YC0A 3SPHA 1T94A 1BMFG 3IC7A 4JASA 5LOVB 4CE5A 2EIJB 1OCCC 3W7UA 3JZIA 4HNTA 5I5SA 4A3LG 3CJHB 4DUYO 5CBHA 1UNNC 4DR3B 2EIKB 2CQYA 2E3CA 5KG5A 2RMKB 5KKNB 5IY5B 4G3IA 2L35A 3ETDA 1NI8A 4LSAA 4ECWA 2QWRB 1Z5VA 4JUZA 4GKKB 1HP8A 2Q69A 3VOTA 3N40P 1KP3A 1GYFA 4KP4A 4O2AB 3J81W 3ICXA 3ABUA 2EJ2A 4J9NA 3RGXA 3T4ZA 2ZKOA 5ITZA 3A0HZ 3NBYB 3OE7G 2W6NA 3ABKB 2IA6A 4FFLA 4IRKA 3E83A 5B1BB 4IAJA 1Z2NX 1ZUQA 2DYRB 2EX3A 4CH3A 1VQMV 3E8GA 4JYAH 1QLNA 2ZDGA 4LF5H 1V9PA 5FLMG 4CZZA 3KAKA 3OT7A 4LWSA 2JJ2G 5IDJA 1ORQC 4GYCB 2P4VA 3Q8PB 2YEVA 1QHTA 3T9CA 1GRJA 3WFVA 2F23A 4TSFG 3CCSV 5CA0A 1VQNV 2HVKC 3CX5F 1B6RA 1F7YA 3T2MA 4ZBMA 5B5EZ 4NXNO 3D36A 4MV1A 2Q2TA 2DABA 3RFCA 2EJ3A 4NXMB 4XDKA 2A0LA 4X1KA 4YIOA 4DV3H 1I2KA 4X88A 5C4XG 5I5YA 1WB8A 4B3TB 1CQJB 4MVOA 1R73A 2UXBH 1FXKB 3JATA 5CAEB 1TVKB 1SQVH 2WLNA 1N32B 5BPHA 5B66Z 1XMOO 2FP4B 2RNBA 1VEWA 4LWSB 4DR7B 2E2IA 4MS2A 5L3DA 1MNGA 5KT2A 4ETSA 3IC9A 3RYIA 3E35A 5DQGA 1EUCB 3K08A 4I55B 4IWYA 3KTMA 2HVQA 3U9SA 2V1DA 3H01A 4RB3C 2FYUH 5LP6F 3E8BA 4MVSA 1ZHSA 2BQ3A 1SQBH 3IGAC 4A3BG 4FLYA 2ASJA 3K5NA 2AU0A 4ECVA 5LMNO 2J6SA 1M9NA 2OIGA 4LFAO 2AW9A 4Q6GA 1Y6XA 3L9DA 3WO1A 4DR6H 4BBSG 4M9UA 5KG6A 4EB6B 3EPGA 4LFBH 2OIEA 4N21A 2YZGA 4I50A 3AG4B 4KXRA 3T9AA 4UCVA 3UKMA 4I50B 5IYZA 4MA5A 2E74B 3P30A 4WF9V 1NU1H 3J81N 4JPRA 5KFJA 5KUKA 5LMUB 3OD4A 1AR5A 5H5NA 1J5EB 1OCRB 3SJCC 2UUCB 4O4JF 3KYHC 5DG9A 1JOYA 5CA0B 4YY3B 2OLSA 4LF9H 4CMDA 4RB2C 5LMNB 4ED7A 1EBOA 2Q8VA 1PP9H 4LFAB 4HNAA 3D3IA 2QR4A 3T5KA 3RYIB 2ZT9B 1AR1B 1YTFB 5B3SC 3W7WA 1B06A 1IOVA 2O03A 1Q7YW 1AB3A 2CE4A 4ED3A 2JS5A 1ET0A 4Q4DA 4J9PA 5K1PA 4O3SA 3EHBB 3BRCA 2ZINA 3W7XA 3OHBA 1ZX3A 2WAQE 2ADQB 5KT6A 3Q8QB 1OJHA 4HAMA 1K9MW 5KFRA 4DV0H 4PDMA 2VA3A 2OCHA 4IYIA 4G2KA 2ALZA 3O9OA 2YRWA 4JI5B 4NXNB 3OHAA 1N33O 4JI4O 2YCHA 1IBKB 1KKDA 2VUMA 1GK9A 2QK4A 3T9FA 3E22A 1X59A 1H2LA 3N2GB 5KUMA 3UO2A 1WAZA 4DR1H 2HHFA 4J9LA 1EZJA 5B1NA 2GUZB 1CKMA 2Q68A 3GILA 1BHBA 1IXMA 3CJHA 5KFOA 1S10A 2Y48A 5KA6A 5L1KA 4JI8B 2ZM6H 4LFAH 1BZKA 2XGQA 1VARA 4APMA 1JKJB 2C2EA 1M4UA 5A2QW 5T14A 4FFNA 4CHIA 5KHIA 1SKVA 1QLEB 2X6BA 4RNOA 4UB8Z 1FD9A 3VPBA 1GO3E 2JGUA 3HOXG 1CKNB 4FM1A 3R9RA 1GGOA 4JI1O 2FK1A 5KA5A 1QLEC 5KT4A 4PA7A 3NXSA 1FFXA 4O4HF 3L72H 4ME6A 5FD5A 3FX7A 1FPOA 1M1KW 4X64H 2B1GA 1PNMA 4F4YA 4LFCB 5IE9A 2QM8A 4L1KA 2W9CA 2X6CA 3HOYG 2YYAA 4LF8H 2R7NA 1KUQA 1J5EO 2OTJV 2DE0X 2VQDA 3BY6A 2XAFA 3ZMTA 3GB7C 1M7JA 3LP8A 3NC0B 3CEBA 3NR7A 3ABMB 4FLXA 1TWFA 2Z0AA 2WLLA 4O7NA 1AP6A 2LW1A 3WB0A 1ROPA 4J42A 4X62B 2CNUA 3U55A 1OCOB 3PW5A 1I7NA 3MAQA 1W0JG 2ZXWC 3WWHA 1DF4A 2HLDG 5KG3A 3RBDA 3JYCA 2OWOA 1COWG 1KUTA 3F7VC 5KFMA 1NVPD 3ZHUA 2UXNA 1N34B 3CWBH 1Y76A 2OTLV 2CTWA 3G8DA 5KFVA 5CE8A 5LHIA 4TV8B 1N34O 3E8FA 3FYEB 3M7MX 2MK3A 4JI4B 4BY7G 2R9RB 1JIHA 2EJRA 4LH6A 2JA6G 3UQ8A 1OZ0A 3OAAG 4YB8B 4GT1A 4A3KG 4PI0A 4F6EA 5C93A 5KT7A 1FJGB 2IU0A 2GSMB 3BABA 2HJWA 2R86A 3KAJA 3ETQA 2YU9A 4J41A 2JEGA 4JTCB 5KFHA 1NKDA 4JYAO 3M9MB 3NGDA 1LUVA 2GBOA 3CRRA 2FL4A 1WPBA 5JJJB 1SERA 1NR1A 2B63A 4JYAB 4NZOA 3K9SA 4PBCA 3U0ZA 3T1HH 4CKBA 4IHJF 3H4BA 4ZIBA 1WN7A 2DYSB 3G6XA 2R93G 5LGNA 5EDWA 1AI6A 1K4DC 2VQEB 5JQWA 1VF6A 3DC6A 4J10A 3T9DA 3U9TA 3B40A 2AHYA 2W6MA 1XMQB 1MMMA 2W9BA 5CA3A 1HDJA 5KFEA 2Q73A 4JI7H 4B3MO 1FJGO 3AK1A 5IYZB 2IJKA 4YHHO 2YL2A 4XZ3B 1KBHA 2Y0SE 4LC1A 2XD4A 2FPIB 5L1IA 3BG5A 2PYLA 4LFCO 4JI3O 1Z2PX 3WU2Z 3K9AA 3NUAA 4DR2O 3KCYA 1XI1A 2QTOA 2IMWP 2QWQB 1JMKC 4F50A 4OXSA 4DR5H 3BEHA 2ATLA 1Q6HA 4X65H 1XNQB 5FNVB 2COIA 4MT8A 3UT5B 1J95A 3A8TA 4QPJA 5DG8A 1N34H 5HFMA 2Q9LA 1N56A 1JX4A 2UUAH 3ASOB 1LNQA 5K1XA 1XNQH 4R8UA 2X0SA 3LUTB 1DIKA 3ETEA 1GM9A 2ZJTA 2R7MA 2V59A 4WHXA 1IYDA 3ETHA 5IYZF 1ZTEA 3GVMA 2YZNA 3K0DA 3H20A 2UU9B 1CP9A 4MVUA 5H80A 3OUUA 1EM1A 1U97A 2QYZA 3TGUH 1KJ8A 1Q86W 4P2ZA 4U6PA 2VUGA 1F4NA 4O4JA 2W7OA 1AILA 3K06A 1XMQH 3KREA 2AXTZ 4DK1A 3BQ1A 3OUFA 4WFFA 3GTPA 2BCCH 2LFRA 3ABLC 2N04A 4YJ2A 4C7UA 4FS1A 1H2SB 2PMZE 1K5SA 4O2BB 1FVIA 5KFXA 4MTDA 2IJIA 3IG0A 5LXTF 1RM1C 2IP4A 4RZQA
chains in the Genus database with same CATH topology
3RTXA 2BTQB 2MCTA 1NT2B 2Q2UA 5J2UB 3RYCA 1SYXB 4HNAB 5CA1B 4TV9A 1MZBA 2UXBB 3JASB 4CH6A 5JJNB 1T5EA 4DV3B 4U3JB 2F4VH 1G6UA 2F66C 2VQFB 2OYQA 5KHHA 4TV8A 1BGWA 3N6XA 1FJGH 4TUYA 3JAWA 4YJ3B 4PDBA 4LF8B 2UXCB 3TY8A 1KU9A 4FLWA 4F6RB 3CSXA 2XIGA 2Q7EA 2HIXA 1ZHQA 5FD6A 4UCUA 2Q0AA 1HW7A 1JFFB 5CB4A 1XMOB 4JI4H 2F93B 4FFBA 2HIVA 3L2PA 3JAKA 1FFXB 4FM0A 3PN1A 2VQFH 1HR0H 2UUCH 4JI0H 4WBNA 3BHPA 1XHXA 4FLZA 4FM9A 3ZEDA 1A0IA 4DR1B 4DV7B 3HKBB 2FE3A 4D7TA 1M93A 2HVSA 4YJ3A 4CS4A 3N2KA 4O4JB 1HR0B 4DR2B 2YIAA 4ZHQA 1P8LA 5BMVB 5D1PA 3E22B 4X62H 2VWKA 3K57A 4O4HB 4RAYA 5JH7A 4JI5H 4LF6B 4JI3H 5LOVB 2VWJA 3VQWA 2WYOA 1N36H 4AHCA 2VPSA 4DV0B 4UCTA 2WE6A 4O4IA 2V4DA 4X20B 3HKEB 1I7FA 1IBLB 3RWRD 4IIJB 3A2FA 4UCSA 4DR3B 2E3CA 3DSQA 3SJAC 4TV9B 3QF7A 4DRXB 1HNZH 4LSAA 4B08A 1Z5VA 1X4TA 3UT5A 4CC5A 1HNXB 4GKKB 3N40P 1GYFA 2E5LH 4O2AB 3J81W 3ICXA 4ZI7A 3K5MA 4O4LB 5LYJA 3RGXA 1TGOA 3JSLA 1SA0A 4LF9B 4RAZA 4LSXA 5ITZA 2ZNJA 3QG5A 3NBYB 4X1KB 5LP6B 4DR7H 2R9AA 1VF7A 3KXYT 3KALA 4IAJA 4NXNH 3T1HB 1Z2NX 1N32H 2EX3A 4CH3A 5LMUH 4I4TA 4JYAH 3HKDA 4LF5H 1S03G 1V9PA 1RSOA 4UCRA 4I55A 3KAKA 3MWMA 1X9NA 2W57A 4B3RH 3VQVA 5CA1A 4GYCB 4BWAA 1QHTA 3JAMW 4MV9A 3N2GA 4DV6H 5CA0A 4O4HA 1TA8A 4FM2A 3HKDB 3JALA 4LR3A 4AQYB 4PI2A 2CAZC 4JI8H 2Q2TA 4LH7A 4TQFA 4YY3H 4NXMB 3TY9A 3CHXA 2CW8A 1WNSA 4FLTA 5FNVA 4JI7B 4X1KA 4B3RB 4DV3H 3U11A 3W1BA 4B3TB 2UXBH 5IJ9A 3JATA 1TVKB 3L4JA 4DV4B 1HNWB 3N43B 3JSNA 4Q0YA 1Q3EA 1DGSA 2QM4A 4LNUB 4FFBB 1N32B 1IBKH 4JI6H 4JI2H 4EB6A 4PZ7A 2PUSA 4D7SA 4DR7B 1P16A 3LMLA 4A2BA 3BA8A 4MV7A 1E4FT 3TY5A 3BAAA 4ETSA 3JARA 2ZIMA 3RYIA 5IJ0A 1Z2OX 4DV4H 4I55B 4KHPB 4TQDA 2HVQA 4JV5B 1TVKA 4RB3C 4B3MH 5LXTA 4CH5A 1ZHSA 5BMVA 3K3VA 2UUBH 2PTMA 4FLYA 3K5NA 3K5OA 4JV5H 5EIBD 3N42B 3N2KB 1SA0B 4KHPH 4Q6GA 4DR6H 5D1OB 2YIBA 4O2AA 3S24A 3JALB 4EB6B 5GONA 4LFCH 3IAYA 4LFBH 3SR2C 4I7HA 1ZAUA 5LA6A 4ZOLB 1N33H 1XQ8A 4I50A 5CB4B 4GKJB 4UCVA 4I50B 5IYZA 2GV9A 5FPOA 1HNWH 1O9HA 4CS3A 4IIJA 1XDNA 4FLVA 2P22C 4LF4H 5LMUB 3F8NA 3N44B 1YEWA 1J5EB 3RYHA 3SJCC 2RQ6A 3U10A 3J7AK 4GKJH 2UUCB 4BW9A 3KYHC 4U3JA 4X1YA 4I9QA 4PZ8A 5CA0B 3CB2A 4YY3B 4LF9H 2VOBA 1P49A 3RGBA 4RB2C 5LMNB 4DV6B 2PZSA 4X66B 4LFAB 4HNAA 3HKBA 3QTCA 4DV5B 1B04A 3RYIB 5IJ0B 5KHJA 2ZIOA 2O03A 3JAKB 3SJBC 2UUBB 2JS5A 3QWUA 3RYCB 5K1PA 3BRCA 2PGGA 2ZINA 4I4TB 4PHZA 1I94H 4AILC 4LF5B 2YIBD 1VS0A 2VQEH 4DV0H 1TUBB 4K0KB 4LF7H 3THOA 3GB8B 4JI5B 4NXNB 4DRFA 5EIBC 1Q5OA 4JI6B 4X64B 2YCHA 1I6UA 3JAWB 1IBKB 4HBNA 4DR2H 3E22A 4K8XA 1CKOA 4PZ6A 3N2GB 4DR4H 3VQYA 5LXTB 2XHBA 5JQGB 4DV7H 1L8DA 4DR1H 4B3SB 1CKMA 1HNZB 2F1MA 4JI0B 1SQFA 2QJ1A 2BTQA 3C0FB 4NXMH 3OTOH 3J80W 4JI8B 3JATB 1IBLH 2CW7A 4O2BA 1O75A 2ZM6H 4E6NA 4OX9B 4LNUA 5JH7B 2HGSA 4X66H 4LFAH 1N36B 1XK5A 1QQCA 4APMA 5D5PA 5IJ9B 1M4UA 5A2QW 2UXCH 5KHIA 1Q43A 1SKVA 4F6RA 2KSWA 2Q7HA 4TUYB 2JGUA 5KHKA 1M0WA 4LMYA 1CKNB 4FM1A 4YHHH 1FKAH 2RGRA 3W1GA 1FFXA 3BPZA 3VQXA 5FD5A 4DV1H 2HEPA 4DRXA 4X65B 4X64H 4X20A 2IM9A 5FLXW 4LFCB 4LFBB 4LF7B 4CH4A 1AN7A 4K0KH 4EQ5A 2RJZA 4O4IB 4UCOA 2PY5A 4LF8H 4ZHQB 1E4GT 5JJEB 3WB1A 4IHJA 3NC0B 4BWSC 1TUBA 5KX5B 4K8ZA 2JVDA 4O4LA 5LYJB 4FLXA 3W5OA 5EZYA 3WB0A 4GLXA 4UFZA 4TOIA 4X62B 3ZS8C 3MAQA 1JFFA 2R70A 3HKEA 2OWOA 2KKWA 1J5EH 2UUAB 4YHHB 1N34B 4DUZH 5KMGA 4B3TH 3RYFB 5LL6b 4NVPA 4TV8B 3HXLA 5EYPB 3LNNA 3T1YB 3M7MX 3BA9A 1N33B 4JI1B 4DV2B 4CC6A 4JI4B 1XMOH 3RYFA 2UXDH 4J0MA 4DV5H 3RYHB 4LH6A 3UQ8A 5BR8B 4OX9H 4L8JA 4AQYH 2WDTA 4FLUA 2UU9H 4PI0A 3JASA 2RGVA 3RGZA 4ZOLA 1FJGB 2UXDB 5J2TB 1S68A 3BABA 2BTOA 3RIZA 1Z5WA 3KAJA 5GONB 3T1YH 3ETQA 3CVZA 3K58A 2F4VB 3L4KA 4B3SH 4DUYH 3HKCA 1CKNA 2CFMA 5JJJB 1WPBA 4DR4B 4JYAB 4RB1A 1IBMB 4YJ2B 2HVRA 5DISC 3WB2A 3U0ZA 3T1HH 3FFQA 4FVMA 2ZCEA 1O9GA 4DR5B 4JI2B 4ZIBA 1WN7A 5JVDA 1XNRH 3VNNA 1M5IA 2VQEB 5EYPA 1TAEA 3JARB 4EEQA 4DK0A 2E5LB 2YI8A 5KMGB 1I94B 5J2UA 5C8YB 1XMQB 2F95B 4RB0A 4CS2A 1WH2A 1M0TA 4JI7H 2YI9A 3SGIA 5IT9W 5EZYB 5IYZB 3GJXB 4X1IB 5IWAH 5JQGA 4B3MB 5JCOA 3EYYA 2YXLA 5LA6B 1SEIA 2PYLA 4EFEA 5LMNH 1Z2PX 3N41B 3FMAA 4R7RA 5D1OA 5LP6A 1XI1A 5KHGA 4JI3B 4LF6H 1JMKC 4M7EA 4DR5H 1JJOA 2HHHB 3RJ0A 1SQGA 2Q7GA 4X65H 4ZI7B 1XNQB 5FNVB 1XHZA 3OTFA 4DV1B 3DF7A 4EFBA 2PYJA 3UT5B 3K5LA 4LF4B 1IBMH 1N34H 2UUAH 1BJTA 4X1IA 4DUYB 5FPRA 3NBZB 5K1XA 4A2AA 5J2TA 1XNQH 4KL1A 5D5QA 5C8YA 2ZJTA 2HHHH 1KMIZ 3RFRA 4MTEA 3GDEA 1L2ZA 3H20A 2UU9B 5LOVA 3B2EE 4DR6B 2P5OA 5BR8H 5LP6C 5JVDB 4X1YB 1HNXH 4GKKH 1Q8IA 2ZM6B 5IWAB 1D5AA 2ZNIA 4DV2H 2VUGA 4JI1H 5KX5A 3M4IA 4O4JA 5JCOC 3OTOB 5EOYA 1XMQH 4IHJB 3K59A 4DR3H 3RF2A 4DK1A 5ITZB 3RR5A 2R72A 4YJ2A 4DUZB 1H2SB 4WBNB 4O2BB 1FVIA 4MTDA 1S5JA 3IG0A 4RZQA 1XNRB 3HKCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN B;  4DRF A;  3RTX A;  4LH6 A;  3UQ8 A;  4X64 B;  4JI6 B;  5BR8 B;  2Q2U A;  1TA8 A;  4AQY B;  1IBK B;  2Q2T A;  4LH7 A;  1CKO A;  4NXM B;  1FJG B;  2UXB B;  4PZ6 A;  2UXD B;  3TY9 A;  1S68 A;  3BAB A;  4JI7 B;  4B3S B;  2F4V B;  4B3R B;  4DV3 B;  1CKM A;  1HNZ B;  4JI0 B;  2VQF B;  1CKN A;  2CFM A;  3W1B A;  4DR4 B;  4B3T B;  4JYA B;  1IBM B;  4DV4 B;  1HNW B;  4JI8 B;  3JSN A;  4LF8 B;  2UXC B;  3TY8 A;  1DGS A;  2HVR A;  1N32 B;  5DIS C;  4E6N A;  4OX9 B;  4PZ7 A;  1N36 B;  2HIX A;  1XK5 A;  4DR7 B;  4DR5 B;  4JI2 B;  4UCU A;  1P16 A;  3BA8 A;  1XMO B;  3TY5 A;  3BAA A;  3VNN A;  2HIV A;  3L2P A;  2VQE B;  4KHP B;  1TAE A;  2E5L B;  4EEQ A;  2HVQ A;  3PN1 A;  4JV5 B;  1I94 B;  1XMQ B;  1CKN B;  1A0I A;  4DR1 B;  3SGI A;  4DV7 B;  3W1G A;  2HVS A;  3GJX B;  4B3M B;  1HR0 B;  4DR2 B;  1P8L A;  5D1P A;  4EFE A;  4X65 B;  5D1O B;  3S24 A;  5D1O A;  4JI3 B;  4LF6 B;  4LFC B;  4LFB B;  4LF7 B;  2HHH B;  1ZAU A;  4EQ5 A;  4UCO A;  4UCT A;  4DV0 B;  4GKJ B;  4UCV A;  1XNQ B;  4DV1 B;  1IBL B;  4EFB A;  5FPO A;  4UCS A;  4DR3 B;  4LF4 B;  1XDN A;  5LMU B;  4DUY B;  5FPR A;  1J5E B;  3NBZ B;  3NC0 B;  1HNX B;  4CC5 A;  2UUC B;  4GKK B;  3KYH C;  3W5O A;  4PZ8 A;  4YY3 B;  3JSL A;  4LF9 B;  3GDE A;  2UU9 B;  4GLX A;  4UFZ A;  3NBY B;  4TOI A;  4X62 B;  5LMN B;  4DR6 B;  4DV6 B;  4X66 B;  4LFA B;  4DV5 B;  2ZM6 B;  1B04 A;  5IWA B;  3T1H B;  2OWO A;  2VUG A;  2UUA B;  4YHH B;  2UUB B;  1N34 B;  3OTO B;  3QWU A;  1V9P A;  4UCR A;  4LF5 B;  1X9N A;  3RR5 A;  4DUZ B;  1VS0 A;  3T1Y B;  3BA9 A;  1FVI A;  1N33 B;  4JI1 B;  4DV2 B;  4CC6 A;  4JI4 B;  4K0K B;  1XNR B;  3GB8 B;  4JI5 B; 
#chains in the Genus database with same CATH topology
 2XCP A;  4B7K A;  3OSP A;  1NT2 B;  3ZHT A;  2Q2U A;  2QKC A;  2LGQ A;  4TV9 A;  1PX2 A;  2WTF A;  2PN1 A;  1MZF A;  3VMM A;  4IL6 Z;  3FKI A;  2BQU A;  3JAS B;  2D3O W;  4H13 B;  3CE2 A;  5JJN B;  2EIK C;  2I8C A;  3E89 A;  4QWE A;  3SJQ C;  4JZG A;  4U3J B;  3X2Q B;  1G6U A;  1Y66 A;  2F66 C;  1Y1W A;  4JI7 O;  2EIJ C;  4TV8 A;  1I1K A;  1BGW A;  1SZX A;  4LF4 O;  3MR2 A;  3KZI Z;  1FJG H;  4TUY A;  4HYO A;  5FL7 G;  2M05 A;  1V54 C;  1JR9 A;  3LSQ A;  4LF8 B;  1KU9 A;  1EZ1 A;  3F7Y C;  4FLW A;  3CSW A;  1H2N A;  2FML A;  3V6K A;  5DLF A;  1AUX A;  2VPQ A;  3LQS A;  3JCZ A;  3C3S A;  1YVW A;  3AK2 A;  3LSS A;  4UCU A;  3T5H A;  4LBE C;  1HW7 A;  3LDC A;  3WG7 C;  2DPJ A;  4JI4 H;  2XTA A;  3APQ A;  4FFB A;  3L2P A;  4MVR A;  4FS2 A;  3STL C;  3ZN1 A;  1FFX B;  1N48 A;  5CBF A;  3TIN A;  3AG3 C;  5B1A C;  5LBQ A;  4CKC A;  4MVQ A;  4FLZ A;  3G8C A;  1K83 A;  5E1A C;  1WB7 A;  3HKB B;  5I5W A;  2HVS A;  1P7B A;  4CS4 A;  3BAC A;  5KFQ A;  1EN4 A;  1P8L A;  5BMV B;  5DQH A;  5D1P A;  4PDR A;  3K57 A;  5E79 Z;  1ZQ7 A;  4JI5 H;  3ZCC A;  4O7Y A;  1YJ9 V;  4IR9 A;  1XUQ A;  1I5X A;  2WWW A;  2VWJ A;  2WYO A;  3TQ1 A;  4AHC A;  4KFM A;  1DTO A;  2VPS A;  3ZMS A;  2IJH A;  3ORR A;  2E75 B;  4X20 B;  5LYJ F;  4IIJ B;  3A2F A;  1K92 A;  4X89 A;  4O3O A;  3DSQ A;  2BOC C;  2NUA B;  1PNL A;  2BOB C;  5IYB G;  1H8H G;  1AJP A;  2PVP A;  3EPI A;  4ED1 A;  3B8M A;  1X4T A;  4CC5 A;  4TQS A;  5JUM A;  2E5L H;  4DQN A;  4ZI7 A;  2HGW A;  3JSL A;  1SA0 A;  4LF9 B;  3I56 V;  1FS0 G;  2ZNJ A;  4UXN A;  4ASU G;  5BMV F;  3W7S A;  5LP6 B;  2QF7 A;  1KTA A;  1VF7 A;  1JQ0 A;  4FFO A;  3QNE A;  3KAL A;  3TW7 A;  3MR3 A;  3KHH A;  4NXN H;  2ADP A;  1K8A W;  2RDJ A;  1VBH A;  4B3T O;  2RDC A;  5CM0 A;  3GID A;  1VP7 A;  4FU0 A;  4I0X B;  2YRX A;  1S03 G;  1RSO A;  1Y76 B;  3MWM A;  4KUM A;  5AG2 A;  1SES A;  2W57 A;  4OGQ B;  5DED A;  1IVS A;  3WNZ A;  3PR4 A;  4BY1 G;  4JZ2 A;  5BYA A;  3B4S A;  1PK8 A;  4MTG A;  5DEC A;  3H9V A;  4IT5 A;  3HKZ E;  4TQR A;  4I4T F;  2Z5U A;  3CCM V;  4AQY B;  2FJZ A;  2CAZ C;  3ZMZ A;  1D2D A;  3WG7 B;  1BNC A;  1PM9 A;  3TY9 A;  2AZ0 A;  5KFC A;  4FLT A;  2ZR3 A;  4JI7 B;  1MAB G;  1YI2 V;  1URF A;  3K04 A;  3CCQ V;  2Y69 B;  1PPJ H;  2ILM A;  5CA0 F;  2Q7D A;  3JSN A;  4Q0Y A;  4HNV A;  2NR5 A;  3CCR V;  1IBK H;  3P3N A;  4EB6 A;  2JEU A;  2B1I A;  1R6N A;  3QZ7 A;  1KC7 A;  2PUS A;  2VUM G;  4GKK O;  1P16 A;  3BA8 A;  4EKW A;  4MV7 A;  1TUE B;  3JAR A;  1YDX A;  2ZIM A;  5LMU O;  1SZT A;  4O4L F;  3C3T A;  2H3O A;  4FFK A;  4YJ2 F;  2JEF A;  2ARH A;  3W7T A;  4YR2 A;  3MHS C;  3ZBH A;  4J7K A;  5LXT A;  1IZ3 A;  3CRC A;  1HR0 O;  2QEX V;  2UUB H;  3VPD A;  3ML0 A;  3T5L A;  3BCC H;  2YZL A;  3GV7 B;  3PFF A;  2AQ4 A;  5H2F Z;  2HJF C;  1SA0 B;  3CCU V;  4O7V A;  2X7R B;  1QVF U;  1GN3 A;  3S24 A;  4E4T A;  3GTQ A;  3JAL B;  3SR2 C;  1OV9 A;  2EJ7 A;  4ZOL B;  2PMZ A;  3AG2 B;  4F4L A;  5CB4 B;  2HFE C;  2GV9 A;  1I0H A;  3QQM A;  1O9H A;  4MTO A;  3P3P A;  1OBG A;  4QE9 A;  4O2A F;  1PD3 A;  4QW8 A;  4TWK A;  3GTJ A;  4GKJ H;  5BY1 A;  4BW9 A;  3TCU A;  1YJN V;  1KD1 W;  4RUA A;  2VA2 A;  3B09 A;  1TWG A;  4HNU A;  4LCU C;  1WP8 A;  3RGB A;  1H38 A;  5L1L A;  4IRC A;  2JRI A;  4DL7 A;  2JK5 C;  2PI5 A;  2WA4 A;  1ZWI C;  2KSD A;  2PZS A;  1B04 A;  5CMU A;  4DR7 O;  5KHJ A;  3B8N A;  4U7O A;  3QFF A;  1I1L A;  5GTH Z;  3H0G A;  4JGS A;  1FXH A;  3C90 A;  5JVD F;  4PA6 A;  2CTP A;  1S5L Z;  5EK0 A;  3KCX A;  4Q8E A;  3V6J A;  2XAJ A;  2F43 G;  5IYC G;  4ZQI A;  3CMA V;  4MV4 A;  3GQC A;  4U7N A;  1GTO A;  4AQY O;  3I5D A;  3H1L H;  1YZB A;  1IBK O;  1AVM A;  1NQT A;  2X6A A;  4J7Z A;  2W0X A;  1SQQ H;  4JI6 B;  1I6U A;  3CRM A;  3MDS A;  4HBN A;  5A9G A;  2NLJ C;  2DYS C;  1KJJ A;  4DL2 A;  4K8X A;  4J80 A;  4JAV A;  1CKO A;  4DR4 H;  2XHB A;  2CH7 B;  4PDL A;  3SYO A;  3OUZ A;  5L1J A;  3APO A;  3CC4 V;  1EKP A;  1HNZ B;  2F1M A;  4NTW A;  4QJF B;  4MV3 A;  2VR1 A;  3C0F B;  2F4V O;  2DMX A;  5GW7 A;  4LF7 O;  4EGQ A;  2B63 G;  1IBL H;  2CW7 A;  1KKC A;  5JH7 B;  1N36 B;  5CR5 A;  2J6T A;  3GIP A;  1QQC A;  1SRY A;  1XBL A;  2JGD A;  3D36 C;  4JYC A;  5BWX A;  4OPA A;  3SYC A;  2FKX A;  4F6R A;  1WPX A;  1Y74 A;  1EYZ A;  3CC2 V;  2FTK A;  2KSW A;  2RF4 A;  2Q7H A;  3SE7 A;  4PEL A;  1NR7 A;  1M0W A;  2P90 A;  2LQT A;  2K1E A;  4DV2 O;  2RN9 A;  1Y14 B;  2ABJ A;  1VQ5 V;  1FKA H;  1F23 A;  2IBZ H;  3W1G A;  5K2M A;  2AGP A;  4X62 O;  3KG2 A;  2CDY A;  4DV1 H;  4OPH A;  3K0G A;  4O86 A;  2HEP A;  4P9P A;  4X20 A;  2DAA A;  1Y1V G;  2ITC C;  2ZXW B;  4LF7 B;  4CH4 A;  4H33 A;  4JV0 A;  1WA8 A;  4RUC A;  1OCO C;  4O4I B;  4ECQ A;  3TXS A;  1BSM A;  2P06 A;  2WLJ A;  3TK1 A;  2V5A A;  3UM7 A;  5TIS Z;  3JD2 A;  5KFF A;  1EKV A;  1H2M A;  4IHJ A;  4BWS C;  2ZGI A;  1TWH A;  1TUB A;  5EBM C;  1E4E B;  2NU8 B;  1CEZ A;  2EZO A;  4Q43 A;  3CS5 A;  5IYD G;  3W5O A;  2NVY A;  4Q20 A;  2C00 A;  1AI7 A;  4GUN A;  3OR7 C;  3TII A;  3K3P A;  3QO5 A;  1XDC A;  2W71 A;  1GO3 F;  3SYA A;  2Z3Y A;  3A0R A;  2V58 A;  3GIJ A;  1VQ8 V;  2QWN B;  2Q5Z A;  4R6Z A;  4FZ1 A;  1Q82 W;  2P7T C;  1QCE A;  5LL6 b;  4I0X A;  3T54 A;  3HXL A;  5EYP B;  3LNN A;  1ENV A;  4O83 A;  3KHR A;  4Q45 A;  1N33 B;  4JI1 B;  4JI6 O;  2KB1 A;  2EIL C;  3RYF A;  4NLG A;  2UXD H;  4DV5 H;  2VQE O;  3V4S A;  2E5L O;  2RDI A;  1XL4 A;  3RYH B;  4RNN A;  4OX9 H;  2BE3 A;  2AZ2 A;  5F9L A;  2ZD9 A;  4FLU A;  1V51 A;  5KFB A;  2XND G;  4ECU A;  4JYY A;  2UXD B;  2V4R A;  3G71 V;  3RIZ A;  5KFS A;  5GON B;  4UV8 A;  2F4V B;  4JF3 A;  1IDS A;  3K79 A;  4RUF A;  4J11 A;  4B3S H;  1SQP H;  1IBM O;  2CFM A;  3GTL A;  1HWY A;  4RAI A;  4RO2 A;  1IBM B;  4X9Q A;  2DWC A;  1AI5 A;  4C5A A;  2UVW A;  2HVR A;  3MFI A;  4O7T A;  3E5N A;  5EWG A;  4ED6 A;  3FFQ A;  1BHA A;  4FVM A;  4QE7 A;  1O9G A;  1US6 A;  4JI2 B;  4CMF A;  1XNR H;  2HP8 A;  2EBO A;  4DR5 O;  1M5I A;  5EYP A;  1TAE A;  4EEQ A;  2E5L B;  4DK0 A;  4HR7 A;  5EC1 C;  3HBL A;  2XGP A;  3G6B A;  1NS1 A;  2V9W A;  1I94 B;  4HQ6 A;  4MW3 A;  2F95 B;  3ZRX A;  1IUR A;  4RB0 A;  2JA5 A;  1M0T A;  3E2E A;  4PA9 A;  1V4Y A;  1GSH A;  3ZIA G;  5IT9 W;  5EZY B;  4QIW A;  1N0N A;  5IWA H;  4A3D G;  1UJW B;  1S76 D;  5JCO A;  5LA6 B;  4IWX A;  5I5U A;  4EFE A;  5LMN H;  1Y1V A;  2KQX A;  2A79 B;  2QSA A;  4R7R A;  3HR0 A;  5D1O A;  3FB5 C;  4NZN A;  1RP3 B;  2W7P A;  2A3Q A;  4GX1 A;  2Q7G A;  2FKL A;  3RT3 C;  3TET A;  1I3Q A;  2IU3 A;  3UZO A;  3AG3 B;  5BYB A;  4R8C A;  3L71 H;  4NKG B;  5FPR A;  3NBZ B;  5KFI A;  3ZMV A;  5J2T A;  3HOW G;  5LA6 F;  4KL1 A;  4A3C G;  1BGY H;  5C8Y A;  2D2C B;  2YSU B;  3HB3 B;  3RW0 A;  2Y4R A;  4TM5 A;  2WB1 A;  3H40 A;  3RFR A;  3SDL A;  2DQ3 A;  4UVC A;  2LO1 A;  3M8A A;  1Y1W G;  1EKF A;  2A7W A;  4G27 B;  5I60 A;  4DR6 B;  2DQ0 A;  5C5J A;  2J9G A;  2ASD A;  5JVD B;  3WO0 A;  3T9E A;  4O7R A;  1HNX H;  2AHZ A;  2MW2 B;  5IWA B;  1D5A A;  4DV7 O;  2XAG A;  4JI1 H;  3M4I A;  3FB8 C;  5JCO C;  3JAM N;  4A3I G;  4DR3 H;  3KHL A;  1RJR A;  3RF2 A;  3OTO O;  1RK5 A;  1VF5 B;  2HJD A;  4QPK A;  4QWB A;  5KLV H;  4WBN B;  3MWE A;  1XOU A;  1XNR B;  3ZMU A;  3P32 A;  4RUE A;  3HKC B;  2IJJ A;  2JJ1 G;  3RTX A;  5L3B A;  1XNR O;  5IP9 G;  4BR6 A;  1FFT B;  5CA1 B;  3FB7 C;  5KFW A;  4DV3 O;  2YXH A;  4H44 B;  3FYI B;  4BBR G;  4YR3 A;  1MSW D;  5KFU A;  3DGE A;  4AYB E;  4DV3 B;  5DAA A;  4LP8 A;  1T36 A;  4DL5 A;  2YW2 A;  1M6V A;  2VQF B;  3AK3 A;  5IWA O;  2DZD A;  4XDL A;  2GQR A;  1JLL B;  3CPW U;  2ZR2 A;  2QM7 A;  2DLN A;  3R5H A;  4YAJ B;  2UXC B;  1S5H C;  1SC5 B;  4H0L B;  1FXV A;  1GMG A;  4F6R B;  2YS8 A;  2PF4 E;  2Q7E A;  2UXC O;  4J9M A;  5LGT A;  5FD6 A;  4DYL A;  4UV9 A;  1JFF B;  4BIZ A;  4A5U B;  1JCH A;  1AP5 A;  3JD1 A;  1RK6 A;  2HIV A;  5F9N A;  3JAK A;  2PBZ A;  4G28 B;  1GM8 A;  5CA1 F;  1VQL V;  4WBN A;  2XC9 A;  4JI0 H;  1XHX A;  3JD3 A;  1M57 C;  1C3O A;  3HOV G;  4FM9 A;  1PL4 A;  1A0I A;  2BR0 A;  2Y4U A;  4D7T A;  1M93 A;  4YJ3 A;  2CH7 A;  3OMI B;  4DR2 B;  2J6U A;  3PZP A;  3HOU G;  5BWV A;  4O82 A;  2H8P C;  2UVR A;  3RB6 A;  1M90 W;  2FPP B;  2HDK A;  1N36 H;  3ABK C;  4I7Z B;  3GIM A;  1W0K G;  4LF6 O;  2WE6 A;  4O4I A;  4XYM B;  2UVU A;  1IBL B;  2GQS A;  5EZY F;  4MVM A;  4TV9 B;  4WFG A;  4WFE A;  4GX0 A;  3QF7 A;  4DRX B;  4JAU A;  2QDO A;  1XRE A;  1HNZ H;  1B3Q A;  3PW7 A;  1P84 F;  5IY5 C;  1HNX B;  1VQ6 V;  1WJZ A;  4RQE A;  4LF9 O;  1E4E A;  2ZE5 A;  3K5M A;  4O4L B;  5LYJ A;  4RAZ A;  1KQS U;  4KHP O;  4LSX A;  2JS3 A;  3CP1 A;  4P9O A;  1I50 A;  2R8I A;  1K34 A;  2Q67 A;  2ZE6 A;  1JDB B;  1OCC B;  1OBD A;  3H1J H;  4X1K B;  3SPC A;  4TV8 F;  5KFK A;  2R9A A;  2C35 B;  3RUP A;  3CCJ V;  3H0G G;  3IJ4 A;  3T1H B;  3DXR A;  5JQG F;  4DLK A;  2QE7 G;  5H6Q A;  3VA7 A;  4I4T A;  2R7K A;  4QSH A;  4XYL B;  4DV0 O;  4UCR A;  4I55 A;  5GON F;  2W6I G;  1IX9 A;  4DL6 A;  3VQV A;  4U7C A;  2A06 H;  1GKF A;  1K33 A;  4FJC C;  5HV6 A;  3TEK A;  2GTS A;  1OCZ C;  4BWA A;  2FK3 A;  3OM3 B;  1VAJ A;  5DMX A;  3N2G A;  3GWK C;  2QKS A;  1JJ2 U;  4O4H A;  1TA8 A;  2ZE7 A;  3HKD B;  3JAL A;  4LR3 A;  1VBG A;  2Y0P A;  5EBL C;  4LH7 A;  3Q8R B;  3ZJZ A;  3CHX A;  1WNS A;  4GC7 A;  2B9Z A;  5KT3 A;  1A3G A;  4J9O A;  3J80 N;  4B3R B;  1N4C A;  3T5J A;  1GSO A;  2OCC B;  3H3V H;  3U11 A;  3W1B A;  5J9P C;  5IJ9 A;  2WLI A;  4DV4 B;  1HNW B;  1Q3E A;  3ZN0 A;  2QM4 A;  4XX0 B;  4FFB B;  3L75 H;  4JI6 H;  4JI2 H;  3FB6 C;  4DV5 O;  4JXU A;  2CK3 G;  3CCE V;  2COG A;  4IYH A;  3OUS A;  3G80 A;  1JDE A;  4OX9 O;  4JV2 A;  3TY5 A;  3BAA A;  3PR5 B;  5IJ0 A;  4ECS A;  4IRD A;  1JXL A;  4LF5 O;  2EIM B;  4JV5 B;  4NR1 A;  2M7W A;  1UFI A;  3LWB A;  3GV5 B;  2Q4P A;  5BMV A;  3K3V A;  3I12 A;  1NH2 B;  5KG2 A;  1QNM A;  4PD4 F;  2A9H A;  1YTF D;  4X64 O;  5L3F A;  5EIB D;  3N42 B;  2CUG A;  3N2K B;  3Q1K A;  4KHP H;  4WFA V;  2YIB A;  4O2A A;  4BW5 A;  5KFG A;  4LFC H;  1SS3 A;  4PJ0 Z;  4DV4 O;  1ZAU A;  5KG7 A;  1N33 H;  1XQ8 A;  3PW2 A;  4GKJ B;  4PA3 A;  4UVA A;  1THZ A;  1ZL8 A;  5FPO A;  4DL4 A;  2JA8 G;  1WLE A;  2EIL B;  4MA0 A;  4CS3 A;  4IIJ A;  1JVM A;  1XDN A;  4FLV A;  1GAX A;  5DN6 G;  4LF4 H;  2N74 A;  3GTM A;  3N44 B;  3RYH A;  1SF9 A;  1EFR G;  3MJF A;  4JV5 O;  2RQ6 A;  4O7W A;  3T9B A;  2P67 A;  4X1Y A;  1H2K A;  4RZR A;  3N6R A;  4PZ8 A;  3CB2 A;  5JWP A;  2C28 A;  1R3I C;  1P49 A;  2VOB A;  2X0L A;  1H2G A;  3PO2 G;  4DV6 B;  3CXC U;  2FK2 A;  3RB0 A;  4HZ3 A;  4E4E A;  3HKB A;  1K97 A;  3QTC A;  5J2T F;  5IJ0 B;  5DQI A;  4I9W A;  5KT5 A;  3JAK B;  1KC8 W;  3LNM B;  4A3J G;  2W0F C;  2UUB B;  4MV6 A;  4XDJ A;  4BIU A;  2PGG A;  1I94 H;  2WLM A;  4TV9 F;  4AIL C;  3HB9 A;  2WAQ A;  3UFX B;  2WLK A;  1A9X A;  1VS0 A;  1YHQ V;  2COJ A;  2FB5 A;  2G38 A;  4LF7 H;  4O4I F;  4EG0 A;  4DRF A;  2R85 A;  2JDI G;  3CQZ A;  5DGA A;  5EIB C;  1Q5O A;  1W59 A;  3JAW B;  4TUY F;  1PNK A;  3RBZ A;  2QA4 V;  2XCA A;  4JTD B;  3BVO A;  2YS6 A;  4J9Y B;  5JQG B;  4DV7 H;  1L8D A;  4B3S B;  3IFX A;  5A2Q N;  3U0G A;  1WR2 A;  2QJ1 A;  2BTQ A;  4YIP A;  3OTO H;  3J80 W;  3DTF A;  1O75 A;  3R5F A;  1RSO B;  1EZV H;  2XAH A;  4LNU A;  4OX9 B;  2HGS A;  1S9F A;  1EUD B;  4J9Q A;  5D5P A;  3PJS K;  5IJ9 B;  1S77 D;  5DGH A;  2DPI A;  2C2D A;  2R8J A;  4ZHQ F;  1K3E A;  3I4N G;  4DO2 A;  2GDS A;  4TUY B;  5KHK A;  4YHH H;  2P0A A;  1XEQ A;  4ED0 A;  4Y8V B;  1R9T A;  2RGR A;  3PO3 G;  3JRW A;  4J9S A;  4WFB V;  4O81 A;  3BPZ A;  4F4Z A;  1S3J A;  4J9Z B;  3VQX A;  2QTS A;  4AI8 A;  5LL6 Y;  4ZOL F;  4X65 B;  4DRX A;  3AYH B;  3GIQ A;  1DF5 A;  1T3N A;  1OHH G;  4C5C A;  2IM9 A;  4X65 O;  4LFB B;  4K0K H;  1AN7 A;  3H1K H;  4FFM A;  3JZF A;  2XAQ A;  3RN4 A;  2RJZ A;  1VQP V;  4FFR A;  4JI5 O;  4Q4C A;  4UCO A;  4QIW E;  3LDD A;  3I55 V;  4YXW G;  2EZP A;  4ZHQ B;  1PV0 A;  4CKE A;  3AW8 A;  1E4G T;  4EYI B;  4FK5 C;  5JJE B;  2VRZ A;  3WB1 A;  4B7E A;  2X5R A;  2DWE C;  1FAF A;  3ORQ A;  1NZ6 A;  1KJQ A;  2JA7 A;  1W2B U;  3OFN G;  2JA7 G;  2Z04 A;  4A3F G;  1G1X B;  5EZY A;  2YXY A;  2I87 A;  4UFZ A;  4JI8 O;  4I5S A;  1FXK C;  4J7J A;  2ZE8 A;  3ZS8 C;  2R70 A;  1RPO A;  3G6Y A;  1R6T A;  1DAA A;  1N36 O;  2KKW A;  2R87 A;  2W9B B;  1YIJ V;  2UUA B;  5HFL A;  4DUZ H;  1IOW A;  5KMG A;  4B3T H;  3RYF B;  2W9A A;  3UCS C;  1A32 A;  4QWA A;  4YBZ B;  2LFS A;  1Z2G A;  3OEE G;  4U3F H;  4M0J A;  5FNV F;  4DV2 B;  1GN6 A;  3CME V;  2W9C B;  4BAY A;  4J0M A;  2DJV A;  2FB9 A;  4PDV A;  1U96 A;  5EBW C;  5BR8 B;  3GWO A;  5C44 G;  1KP2 A;  4L8J A;  4IIJ F;  3RBE A;  2WDT A;  2FLP A;  1R6K A;  2UU9 H;  3K3W A;  1EN6 A;  3I4M G;  3HOZ G;  1GN2 A;  2QWP B;  5BR8 O;  2RGV A;  1ULZ A;  3RGZ A;  1IYE A;  1GM7 A;  1R3K C;  2CTQ A;  4A93 G;  5J2T B;  1S68 A;  2BTO A;  1Z5W A;  2LJ2 A;  1QBZ A;  5I5V A;  3BQ2 A;  4EYH B;  2P4K A;  2ODT X;  5KFP A;  5KS8 A;  4DUY H;  3HKC A;  4ECT A;  1CKN A;  4YAK B;  1B6Q A;  5B1B C;  4DR4 B;  2R7L A;  2KG7 A;  2ZDH A;  1V55 C;  2UUA O;  3TIG A;  4YJ2 B;  1UC9 A;  4RWU A;  5DIS C;  2XOK G;  5C1O A;  3OSN A;  3ETG A;  3GII A;  1DV1 A;  4DR5 B;  3ZRW B;  2R8H A;  1K4C C;  5DM6 V;  4QWD A;  5FJ8 G;  4FPP A;  3VNN A;  3R66 A;  1L0N H;  3RAQ A;  4ZI7 F;  1SQX H;  3ZHR A;  1G2W A;  5L3G A;  3ZRV A;  3AG1 B;  2NU6 B;  3F5T A;  4CS2 A;  1WH2 A;  1N0J A;  2GUZ A;  3SGI A;  2R82 A;  5DGI A;  2WPD G;  4X1I B;  5BWR A;  4DR6 O;  3EYY A;  3Q4H A;  5KFL A;  4YR0 A;  4NZM A;  1SEI A;  4LFB O;  3ZRW A;  2EUL A;  3FMA A;  5KFY A;  5LP6 A;  5KHG A;  5CN0 A;  1JJO A;  2HHH B;  2XUM A;  1K5Q A;  3PW4 A;  3MR5 A;  4ED2 A;  2OCC C;  2ODM A;  4ZI7 B;  3OTF A;  3GTO A;  4EFB A;  3IN5 A;  4DUZ O;  2JA5 G;  2PYJ A;  2W6O A;  5LOV F;  3FAV B;  4O3R A;  1BS3 A;  1MZE A;  1Q6U A;  4LF8 O;  2ZDQ A;  4X1I A;  1BXR A;  4DUY B;  4A2A A;  4DR3 O;  1VF6 C;  5KAF Z;  1KJI A;  4NB5 A;  2CGO A;  5D8D A;  4IR1 A;  5D5Q A;  4I50 F;  4J9R A;  2HHH H;  1Q81 W;  3RAX A;  2CNV A;  3FDS A;  4GLW A;  5BZB A;  1GLV A;  4XBF A;  2P5O A;  1KB9 F;  5BR8 H;  5LP6 C;  2Q0O C;  2C2R A;  2ZM6 B;  4YJ3 F;  4IZO A;  4FIP C;  4DV2 H;  3OTO B;  3QO7 A;  5EOY A;  1RJP A;  4IHJ B;  1VQ7 V;  3K59 A;  5KG1 A;  1TWA A;  5ITZ B;  4DV1 O;  2YZM A;  3RR5 A;  2R72 A;  2V4Q A;  4DUZ B;  1D5N A;  5GTI Z;  2NU7 B;  2OT5 A;  4R50 A;  2DW4 A;  1WSC A;  4O7Z A;  2BTQ B;  2R92 A;  4QIW F;  4O3P A;  5J2U B;  3RYC A;  4HNA B;  1S0O A;  2ASL A;  4DR1 O;  2XCL A;  5BWU A;  2FLL A;  2YID A;  3OW2 U;  2Y4T A;  2Y0I A;  1KEE A;  3FKI G;  4O7S A;  3OMA B;  1PKX A;  2W70 A;  5LGU A;  1T5E A;  3WWI A;  3JD4 A;  2W6Z A;  2OYQ A;  5KHH A;  2W6Q A;  3DXR B;  4O7L A;  3CRA A;  4PDB A;  2GHY A;  3TY8 A;  4WBN F;  3RB4 A;  4ECR A;  3ZX6 A;  1Q6I A;  3CSX A;  2LW7 A;  2XIG A;  1AR4 A;  1G8M A;  1IBL O;  4DIM A;  2Q0A A;  4A3E G;  1YF2 A;  1BT8 A;  5CB4 A;  3M9N B;  2F93 B;  4QNH B;  4EBC A;  1M56 B;  4WCE V;  4FM0 A;  1M57 B;  3PN1 A;  2R8G A;  1HR0 H;  2UUC H;  3M99 B;  5KFZ A;  3VPC A;  1I2L A;  3MHH C;  1F51 A;  3ZED A;  3E86 A;  4DR1 B;  1RJQ A;  4DV7 B;  2Z02 A;  1G4Y B;  4O84 A;  1SET A;  2IH1 C;  2FPG B;  3N2K A;  3X2Q C;  4ZHQ A;  1K7D A;  1PL0 A;  3CEI A;  4X62 H;  2HHH O;  3N8D A;  3PW0 A;  2WSS G;  4RAY A;  3K03 A;  4BXX G;  4EGJ A;  1I1M A;  4C5B A;  4UUG A;  4LF6 B;  4JI3 H;  2NVX A;  1KT8 A;  3VQW A;  4ECZ A;  4EEY A;  5DG7 A;  4DV0 B;  1E1R G;  4UCT A;  3GV8 B;  2V4D A;  3HKE B;  1I7F A;  3AG7 A;  3RWR D;  1RFY A;  4MW8 A;  4UCS A;  2FMA A;  1RM1 B;  2SCU B;  3LSU A;  1NTZ H;  3SJA C;  3ABL B;  5LHG A;  2HG8 A;  5JH7 F;  4B08 A;  4TT3 G;  4UVB A;  3UT5 A;  3T1C A;  1SFO A;  3N27 A;  2WLI B;  4A3G G;  1TGO A;  5IP7 G;  3QG5 A;  2ZM6 O;  4BIO A;  1JPX A;  4DR7 H;  2R92 G;  3V4Z A;  2DOS A;  3KXY T;  3SPI A;  5KFD A;  1CS0 A;  4O2B F;  1N32 H;  3K5I A;  3CRQ A;  5FR9 A;  1QVG U;  1NH2 D;  5KFN A;  5LMU H;  1L0L H;  2JA6 A;  1HNW O;  3HT5 A;  3HKD A;  1VQ4 V;  2R93 A;  1CXZ B;  1AI4 A;  1X9N A;  3ASO C;  3QZ8 A;  2A1H A;  3ZHQ A;  4B3R H;  2R8K A;  5KG0 A;  5CA1 A;  2CKZ B;  3ZHV A;  4K6N A;  2ITD C;  3JAM W;  4MV9 A;  3M9O B;  3LDE A;  3A0B Z;  5IYD O;  4O3N A;  1ARO P;  1W96 A;  4DV6 H;  1QU7 A;  4FM2 A;  2EIN B;  4ECY A;  4PI2 A;  3R5X A;  4JI8 H;  4I55 F;  4TQF A;  4YY3 H;  2CW8 A;  2W8L A;  4ED8 A;  2GLT A;  1KJ9 A;  5FNV A;  2UUC O;  1MG1 A;  5K3W A;  1I08 A;  4YP3 A;  4GZR B;  1YIT V;  1AUV A;  2W8K A;  4K3A A;  3DTG A;  5KG4 A;  3L4J A;  2WAM A;  3N43 B;  3D8C A;  4LNU B;  1DGS A;  1R3L C;  3S3X A;  5J2U F;  4L87 A;  1S72 V;  4GKJ O;  4MTX A;  3K5H A;  1BQ0 A;  4PZ7 A;  3ETJ A;  1C30 A;  4NYK A;  4D7S A;  2ZDI C;  1VQO V;  3AEI A;  1HNX O;  3LML A;  4A2B A;  4ABM A;  1FYJ A;  1QR8 A;  2R7Z G;  1E4F T;  1BQZ A;  1Z2O X;  4DV4 H;  2DIK A;  3D3Q A;  4KHP B;  3TJT A;  4TQD A;  1K73 W;  1TVK A;  4B3M H;  1AJN A;  3DAA A;  4CH5 A;  2CTR A;  3EFF K;  2YS7 A;  4GCZ A;  2PTM A;  5EWF A;  2JEI A;  3T7A A;  4NXM O;  1S0V A;  1DV2 A;  2K9P A;  3DC5 A;  3K5O A;  4H37 A;  5BWT A;  2KG7 B;  3CCL V;  4JV5 H;  3F5W C;  1JA8 A;  5H9C A;  4X66 O;  1UPG A;  5D1O B;  4C2M A;  4ZKI A;  2ZQM A;  4NTY A;  5GON A;  3IAY A;  2R84 A;  4MAM A;  1S0N A;  4QGP A;  3HPL C;  4I7H A;  2ZDI A;  5LA6 A;  1N32 O;  5C8Y F;  3H4D A;  3VBB A;  3Q8S B;  4DXW A;  5BWW A;  1HNW H;  1R1B A;  3AX6 A;  3FKS G;  5I5X A;  3T99 A;  4JTA B;  4Q8F A;  2P22 C;  2P6J A;  3F8N A;  1YEW A;  2CGN A;  3U10 A;  3J7A K;  4B3R O;  4QWC A;  5C3E G;  1RPR A;  4U3J A;  4I9Q A;  3GIK A;  1A0G A;  5DGB A;  4DV6 O;  4A3M G;  1XL6 A;  3L73 H;  3T1H O;  4RCN A;  3JCU Z;  4YY3 O;  4ECX A;  4X66 B;  4JI0 O;  1NJI W;  4FBT A;  4DV5 B;  4R7C A;  2ZIO A;  3SJB C;  1DLB A;  3QWU A;  3RYC B;  3ABM C;  4I4T B;  4PHZ A;  1S97 A;  3FAV A;  3JZ6 A;  4LF5 B;  2YIB D;  1R3J C;  2WLH A;  2VQE H;  3KKY A;  3ASN B;  1TUB B;  3AG1 C;  4K0K B;  1LR1 A;  5H6R A;  3THO A;  3GB8 B;  2IBK A;  3R65 A;  1CQI B;  3J7A U;  4X64 B;  2WA3 A;  4FZ0 A;  4DW1 A;  5IT9 N;  3ASN C;  4DL3 A;  4O3Q A;  2C2A A;  4DR2 H;  2IW5 A;  1K1Q A;  5I5T A;  3CXH F;  4FGR A;  4PZ6 A;  3VQY A;  5LXT B;  2QB5 A;  1BCC H;  3LUL A;  4HN2 A;  1SCU B;  1NTK H;  3OMN B;  1V55 B;  3S3W A;  3SYQ A;  4JI0 B;  2HKO A;  2YUA A;  2R9I A;  1SQF A;  4QW9 A;  4W4L A;  3ZRS A;  4NXM H;  3RVZ A;  2OH2 A;  2HHF B;  1CE8 A;  3OGI B;  3MR6 A;  1FXK A;  3JAT B;  1NTM H;  2E2H A;  1VIB A;  4O2B A;  4JV1 A;  4E6N A;  4X66 H;  1L1F A;  2XAS A;  1GN4 A;  1XK5 A;  2V7Q G;  3B77 A;  2UXC H;  5KFA A;  1Q43 A;  3HKZ A;  4K0K O;  1MA1 A;  3SPG A;  1EN5 A;  4UB6 Z;  4F4X A;  3G6V A;  2JIZ G;  4LMY A;  1N8R W;  4NYE A;  3CCV V;  4YQW A;  1E79 G;  2YWV A;  2PI4 A;  1XMQ O;  1ZLZ A;  2UUB O;  1A48 A;  3OR6 C;  4GX5 A;  3BQ0 A;  5HBR B;  5KX5 F;  2UVV A;  1ZET A;  2LGW A;  2E76 B;  3RB3 A;  4PWQ A;  2YDE A;  4DAA A;  2DWD C;  1JX9 A;  2UXD O;  2AGO A;  1I7L A;  1UC8 A;  4GC6 A;  5FLX W;  3GLK A;  1NBM G;  2HVJ C;  1QR9 A;  4EQ5 A;  2O57 A;  4MTF A;  2PY5 A;  4WFH A;  2ETN A;  4J9K A;  2I80 A;  4GX2 A;  4DW0 A;  4MSW C;  5LHH A;  4B3S O;  2AGA A;  5KX5 B;  1Y4M A;  4JI2 O;  2YIC A;  1CPY A;  4K8Z A;  1HNZ O;  2JVD A;  4O4L A;  5LYJ B;  4IGG A;  1RYR A;  1DK1 A;  4X8A A;  5EC2 C;  5B3S B;  5HNE A;  1B6S A;  4GLX A;  1IXB A;  5KAI Z;  4FFP A;  4TOI A;  3JRX A;  1JFF A;  3HKE A;  2UU9 O;  2R6F A;  2GTA A;  3H1I H;  3ZHS A;  3O65 A;  1J5E H;  2HR3 A;  4JAA A;  4YHH B;  5I47 A;  3G6E V;  3BFR A;  3VOU A;  4NVP A;  1OCR C;  4EBE A;  2LP7 A;  2EIN C;  3T1Y B;  3MFH A;  3KHG A;  3BA9 A;  4F4W A;  5BXZ A;  4CC6 A;  1XMO H;  1ZSP A;  2HGX A;  1F4M A;  3Q2O A;  5F2V O;  1GSA A;  3EXA A;  3MWD A;  2N05 A;  4AQY H;  3AG4 C;  3QVN A;  3STZ C;  1W93 A;  1WP7 A;  1Q90 D;  3JAS A;  3R23 A;  4ZOL A;  3JD0 A;  1Y67 A;  5C1P A;  3CC7 V;  3ABT A;  3T1Y H;  3CVZ A;  3K58 A;  4DR4 O;  5CBG A;  3L4K A;  3CD6 V;  5BPF A;  3AG2 C;  4UUJ C;  2L6L A;  2GPW A;  3CYO A;  2W6P A;  4RB1 A;  5L3E A;  2GPS A;  1GH6 A;  3WB2 A;  1P7G A;  2ZCE A;  3E8H A;  5JVD A;  1YCI A;  2IH3 C;  4CBC A;  1B33 N;  1P4R A;  3JAR B;  2NU9 B;  4PA4 A;  2YI8 A;  1I5Y A;  5KMG B;  3WWJ A;  4TVI A;  5J2U A;  5C8Y B;  2VS0 A;  4FE2 A;  1XIL A;  2YI9 A;  1NVP B;  3GJX B;  5JQG A;  4PV1 B;  4Q44 A;  4B3M B;  4E2L A;  1FKA O;  2YXL A;  3SNO A;  2NNU A;  2EJ0 A;  3UO3 A;  5E25 A;  3OEH G;  3N41 B;  3UYY A;  4JI3 B;  4LF6 H;  1LUW A;  2EIY A;  4M7E A;  3RJ0 A;  2NN4 A;  1SQG A;  2CNQ A;  3RV3 A;  1WRV A;  3TQT A;  2VQF O;  2FLN A;  1XHZ A;  4DV1 B;  3DF7 A;  3GTK A;  2Y69 C;  3RVY A;  3SPJ A;  1IBM H;  3K5L A;  1H8E G;  1KYO F;  4LF4 B;  3Q4H B;  5IYC O;  1WA8 B;  1M56 C;  1BJT A;  2W6J G;  3PVX A;  1MOF A;  3RV4 A;  2QGN A;  5CB4 F;  1AJQ A;  4D6T H;  1VMG A;  2YEV B;  1KMI Z;  5B1O A;  2DYR C;  4QJF A;  4JYB A;  3GDE A;  4MTE A;  1L2Z A;  2M6Y A;  3T4D A;  3TXQ A;  5LOV A;  3B2E E;  4R8U B;  4Z1V A;  3G67 A;  2BSK B;  4X1Y B;  4GKK H;  1Q8I A;  5L3C A;  1EHI A;  2ZNI A;  1YJW V;  1Y74 B;  5IYB O;  5KX5 A;  3G4S V;  5JVL A;  2H94 A;  4ICG A;  4W4K A;  4AYB A;  3T1Y O;  3SI8 A;  1XNQ O;  4WD3 A;  4MVZ A;  5EWE A;  1I94 O;  1S5J A;  2DN9 A;  1BL8 A;  3H1H H;  2Q6A A;  1RYS A;  4RQF A;  2EIM C;  3V6H A;  2XT9 A;  2MCT A;  3FD9 A;  1KEC A;  3UZB A;  4Z1M G;  3U54 A;  1BE3 H;  2CZG A;  1SYX B;  5L9X A;  3DTU B;  2C22 A;  1MZB A;  2Y0S A;  3MD0 A;  4HYK A;  2UXB B;  1KBL A;  2AGQ A;  4CH6 A;  4MV8 A;  4RU9 A;  3GTG A;  4NTX A;  2HG5 C;  2F4V H;  2R7Z A;  1OWT A;  1VQ9 V;  3BJY A;  2JEX A;  1WCM G;  3QO8 A;  1VQK V;  4K35 A;  3N6X A;  2RCV A;  4Z2W A;  5FLX N;  3JAW A;  4YJ3 B;  4FBU A;  3OGC C;  2ATK C;  5KFT A;  4P30 A;  1YSC A;  3L74 H;  2HIX A;  3HO8 A;  1ZHQ A;  1VKZ A;  2WB1 E;  4RNM A;  4EBD A;  4N23 A;  1XMO B;  4FMT A;  2JEJ A;  1ZL8 B;  3TW6 A;  2B5U A;  3SYP A;  5DLG A;  1MSD A;  3EVK A;  2VQF H;  5B1A B;  3BHP A;  2BQR A;  1OCZ B;  1WCM A;  2UXX A;  2QKA A;  1TWC A;  2QWO B;  2WLL B;  2UXB O;  1S0M A;  1K1S A;  2FE3 A;  4O4J B;  1HR0 B;  1YXB A;  2YIA A;  3L70 H;  3E22 B;  2JGD B;  2VWK A;  1E1Q G;  4O4H B;  2BSK A;  5JH7 A;  1V54 B;  2YC0 A;  3SPH A;  1T94 A;  1BMF G;  3IC7 A;  4JAS A;  5LOV B;  4CE5 A;  2EIJ B;  1OCC C;  3W7U A;  3JZI A;  4HNT A;  5I5S A;  4A3L G;  3CJH B;  4DUY O;  5CBH A;  1UNN C;  4DR3 B;  2EIK B;  2CQY A;  2E3C A;  5KG5 A;  2RMK B;  5KKN B;  5IY5 B;  4G3I A;  2L35 A;  3ETD A;  1NI8 A;  4LSA A;  4ECW A;  2QWR B;  1Z5V A;  4JUZ A;  4GKK B;  1HP8 A;  2Q69 A;  3VOT A;  3N40 P;  1KP3 A;  1GYF A;  4KP4 A;  4O2A B;  3J81 W;  3ICX A;  3ABU A;  2EJ2 A;  4J9N A;  3RGX A;  3T4Z A;  2ZKO A;  5ITZ A;  3A0H Z;  3NBY B;  3OE7 G;  2W6N A;  3ABK B;  2IA6 A;  4FFL A;  4IRK A;  3E83 A;  5B1B B;  4IAJ A;  1Z2N X;  1ZUQ A;  2DYR B;  2EX3 A;  4CH3 A;  1VQM V;  3E8G A;  4JYA H;  1QLN A;  2ZDG A;  4LF5 H;  1V9P A;  5FLM G;  4CZZ A;  3KAK A;  3OT7 A;  4LWS A;  2JJ2 G;  5IDJ A;  1ORQ C;  4GYC B;  2P4V A;  3Q8P B;  2YEV A;  1QHT A;  3T9C A;  1GRJ A;  3WFV A;  2F23 A;  4TSF G;  3CCS V;  5CA0 A;  1VQN V;  2HVK C;  3CX5 F;  1B6R A;  1F7Y A;  3T2M A;  4ZBM A;  5B5E Z;  4NXN O;  3D36 A;  4MV1 A;  2Q2T A;  2DAB A;  3RFC A;  2EJ3 A;  4NXM B;  4XDK A;  2A0L A;  4X1K A;  4YIO A;  4DV3 H;  1I2K A;  4X88 A;  5C4X G;  5I5Y A;  1WB8 A;  4B3T B;  1CQJ B;  4MVO A;  1R73 A;  2UXB H;  1FXK B;  3JAT A;  5CAE B;  1TVK B;  1SQV H;  2WLN A;  1N32 B;  5BPH A;  5B66 Z;  1XMO O;  2FP4 B;  2RNB A;  1VEW A;  4LWS B;  4DR7 B;  2E2I A;  4MS2 A;  5L3D A;  1MNG A;  5KT2 A;  4ETS A;  3IC9 A;  3RYI A;  3E35 A;  5DQG A;  1EUC B;  3K08 A;  4I55 B;  4IWY A;  3KTM A;  2HVQ A;  3U9S A;  2V1D A;  3H01 A;  4RB3 C;  2FYU H;  5LP6 F;  3E8B A;  4MVS A;  1ZHS A;  2BQ3 A;  1SQB H;  3IGA C;  4A3B G;  4FLY A;  2ASJ A;  3K5N A;  2AU0 A;  4ECV A;  5LMN O;  2J6S A;  1M9N A;  2OIG A;  4LFA O;  2AW9 A;  4Q6G A;  1Y6X A;  3L9D A;  3WO1 A;  4DR6 H;  4BBS G;  4M9U A;  5KG6 A;  4EB6 B;  3EPG A;  4LFB H;  2OIE A;  4N21 A;  2YZG A;  4I50 A;  3AG4 B;  4KXR A;  3T9A A;  4UCV A;  3UKM A;  4I50 B;  5IYZ A;  4MA5 A;  2E74 B;  3P30 A;  4WF9 V;  1NU1 H;  3J81 N;  4JPR A;  5KFJ A;  5KUK A;  5LMU B;  3OD4 A;  1AR5 A;  5H5N A;  1J5E B;  1OCR B;  3SJC C;  2UUC B;  4O4J F;  3KYH C;  5DG9 A;  1JOY A;  5CA0 B;  4YY3 B;  2OLS A;  4LF9 H;  4CMD A;  4RB2 C;  5LMN B;  4ED7 A;  1EBO A;  2Q8V A;  1PP9 H;  4LFA B;  4HNA A;  3D3I A;  2QR4 A;  3T5K A;  3RYI B;  2ZT9 B;  1AR1 B;  1YTF B;  5B3S C;  3W7W A;  1B06 A;  1IOV A;  2O03 A;  1Q7Y W;  1AB3 A;  2CE4 A;  4ED3 A;  2JS5 A;  1ET0 A;  4Q4D A;  4J9P A;  5K1P A;  4O3S A;  3EHB B;  3BRC A;  2ZIN A;  3W7X A;  3OHB A;  1ZX3 A;  2WAQ E;  2ADQ B;  5KT6 A;  3Q8Q B;  1OJH A;  4HAM A;  1K9M W;  5KFR A;  4DV0 H;  4PDM A;  2VA3 A;  2OCH A;  4IYI A;  4G2K A;  2ALZ A;  3O9O A;  2YRW A;  4JI5 B;  4NXN B;  3OHA A;  1N33 O;  4JI4 O;  2YCH A;  1IBK B;  1KKD A;  2VUM A;  1GK9 A;  2QK4 A;  3T9F A;  3E22 A;  1X59 A;  1H2L A;  3N2G B;  5KUM A;  3UO2 A;  1WAZ A;  4DR1 H;  2HHF A;  4J9L A;  1EZJ A;  5B1N A;  2GUZ B;  1CKM A;  2Q68 A;  3GIL A;  1BHB A;  1IXM A;  3CJH A;  5KFO A;  1S10 A;  2Y48 A;  5KA6 A;  5L1K A;  4JI8 B;  2ZM6 H;  4LFA H;  1BZK A;  2XGQ A;  1VAR A;  4APM A;  1JKJ B;  2C2E A;  1M4U A;  5A2Q W;  5T14 A;  4FFN A;  4CHI A;  5KHI A;  1SKV A;  1QLE B;  2X6B A;  4RNO A;  4UB8 Z;  1FD9 A;  3VPB A;  1GO3 E;  2JGU A;  3HOX G;  1CKN B;  4FM1 A;  3R9R A;  1GGO A;  4JI1 O;  2FK1 A;  5KA5 A;  1QLE C;  5KT4 A;  4PA7 A;  3NXS A;  1FFX A;  4O4H F;  3L72 H;  4ME6 A;  5FD5 A;  3FX7 A;  1FPO A;  1M1K W;  4X64 H;  2B1G A;  1PNM A;  4F4Y A;  4LFC B;  5IE9 A;  2QM8 A;  4L1K A;  2W9C A;  2X6C A;  3HOY G;  2YYA A;  4LF8 H;  2R7N A;  1KUQ A;  1J5E O;  2OTJ V;  2DE0 X;  2VQD A;  3BY6 A;  2XAF A;  3ZMT A;  3GB7 C;  1M7J A;  3LP8 A;  3NC0 B;  3CEB A;  3NR7 A;  3ABM B;  4FLX A;  1TWF A;  2Z0A A;  2WLL A;  4O7N A;  1AP6 A;  2LW1 A;  3WB0 A;  1ROP A;  4J42 A;  4X62 B;  2CNU A;  3U55 A;  1OCO B;  3PW5 A;  1I7N A;  3MAQ A;  1W0J G;  2ZXW C;  3WWH A;  1DF4 A;  2HLD G;  5KG3 A;  3RBD A;  3JYC A;  2OWO A;  1COW G;  1KUT A;  3F7V C;  5KFM A;  1NVP D;  3ZHU A;  2UXN A;  1N34 B;  3CWB H;  1Y76 A;  2OTL V;  2CTW A;  3G8D A;  5KFV A;  5CE8 A;  5LHI A;  4TV8 B;  1N34 O;  3E8F A;  3FYE B;  3M7M X;  2MK3 A;  4JI4 B;  4BY7 G;  2R9R B;  1JIH A;  2EJR A;  4LH6 A;  2JA6 G;  3UQ8 A;  1OZ0 A;  3OAA G;  4YB8 B;  4GT1 A;  4A3K G;  4PI0 A;  4F6E A;  5C93 A;  5KT7 A;  1FJG B;  2IU0 A;  2GSM B;  3BAB A;  2HJW A;  2R86 A;  3KAJ A;  3ETQ A;  2YU9 A;  4J41 A;  2JEG A;  4JTC B;  5KFH A;  1NKD A;  4JYA O;  3M9M B;  3NGD A;  1LUV A;  2GBO A;  3CRR A;  2FL4 A;  1WPB A;  5JJJ B;  1SER A;  1NR1 A;  2B63 A;  4JYA B;  4NZO A;  3K9S A;  4PBC A;  3U0Z A;  3T1H H;  4CKB A;  4IHJ F;  3H4B A;  4ZIB A;  1WN7 A;  2DYS B;  3G6X A;  2R93 G;  5LGN A;  5EDW A;  1AI6 A;  1K4D C;  2VQE B;  5JQW A;  1VF6 A;  3DC6 A;  4J10 A;  3T9D A;  3U9T A;  3B40 A;  2AHY A;  2W6M A;  1XMQ B;  1MMM A;  2W9B A;  5CA3 A;  1HDJ A;  5KFE A;  2Q73 A;  4JI7 H;  4B3M O;  1FJG O;  3AK1 A;  5IYZ B;  2IJK A;  4YHH O;  2YL2 A;  4XZ3 B;  1KBH A;  2Y0S E;  4LC1 A;  2XD4 A;  2FPI B;  5L1I A;  3BG5 A;  2PYL A;  4LFC O;  4JI3 O;  1Z2P X;  3WU2 Z;  3K9A A;  3NUA A;  4DR2 O;  3KCY A;  1XI1 A;  2QTO A;  2IMW P;  2QWQ B;  1JMK C;  4F50 A;  4OXS A;  4DR5 H;  3BEH A;  2ATL A;  1Q6H A;  4X65 H;  1XNQ B;  5FNV B;  2COI A;  4MT8 A;  3UT5 B;  1J95 A;  3A8T A;  4QPJ A;  5DG8 A;  1N34 H;  5HFM A;  2Q9L A;  1N56 A;  1JX4 A;  2UUA H;  3ASO B;  1LNQ A;  5K1X A;  1XNQ H;  4R8U A;  2X0S A;  3LUT B;  1DIK A;  3ETE A;  1GM9 A;  2ZJT A;  2R7M A;  2V59 A;  4WHX A;  1IYD A;  3ETH A;  5IYZ F;  1ZTE A;  3GVM A;  2YZN A;  3K0D A;  3H20 A;  2UU9 B;  1CP9 A;  4MVU A;  5H80 A;  3OUU A;  1EM1 A;  1U97 A;  2QYZ A;  3TGU H;  1KJ8 A;  1Q86 W;  4P2Z A;  4U6P A;  2VUG A;  1F4N A;  4O4J A;  2W7O A;  1AIL A;  3K06 A;  1XMQ H;  3KRE A;  2AXT Z;  4DK1 A;  3BQ1 A;  3OUF A;  4WFF A;  3GTP A;  2BCC H;  2LFR A;  3ABL C;  2N04 A;  4YJ2 A;  4C7U A;  4FS1 A;  1H2S B;  2PMZ E;  1K5S A;  4O2B B;  1FVI A;  5KFX A;  4MTD A;  2IJI A;  3IG0 A;  5LXT F;  1RM1 C;  2IP4 A;  4RZQ A; 
#chains in the Genus database with same CATH homology
 3RTX A;  2BTQ B;  2MCT A;  1NT2 B;  2Q2U A;  5J2U B;  3RYC A;  1SYX B;  4HNA B;  5CA1 B;  4TV9 A;  1MZB A;  2UXB B;  3JAS B;  4CH6 A;  5JJN B;  1T5E A;  4DV3 B;  4U3J B;  2F4V H;  1G6U A;  2F66 C;  2VQF B;  2OYQ A;  5KHH A;  4TV8 A;  1BGW A;  3N6X A;  1FJG H;  4TUY A;  3JAW A;  4YJ3 B;  4PDB A;  4LF8 B;  2UXC B;  3TY8 A;  1KU9 A;  4FLW A;  4F6R B;  3CSX A;  2XIG A;  2Q7E A;  2HIX A;  1ZHQ A;  5FD6 A;  4UCU A;  2Q0A A;  1HW7 A;  1JFF B;  5CB4 A;  1XMO B;  4JI4 H;  2F93 B;  4FFB A;  2HIV A;  3L2P A;  3JAK A;  1FFX B;  4FM0 A;  3PN1 A;  2VQF H;  1HR0 H;  2UUC H;  4JI0 H;  4WBN A;  3BHP A;  1XHX A;  4FLZ A;  4FM9 A;  3ZED A;  1A0I A;  4DR1 B;  4DV7 B;  3HKB B;  2FE3 A;  4D7T A;  1M93 A;  2HVS A;  4YJ3 A;  4CS4 A;  3N2K A;  4O4J B;  1HR0 B;  4DR2 B;  2YIA A;  4ZHQ A;  1P8L A;  5BMV B;  5D1P A;  3E22 B;  4X62 H;  2VWK A;  3K57 A;  4O4H B;  4RAY A;  5JH7 A;  4JI5 H;  4LF6 B;  4JI3 H;  5LOV B;  2VWJ A;  3VQW A;  2WYO A;  1N36 H;  4AHC A;  2VPS A;  4DV0 B;  4UCT A;  2WE6 A;  4O4I A;  2V4D A;  4X20 B;  3HKE B;  1I7F A;  1IBL B;  3RWR D;  4IIJ B;  3A2F A;  4UCS A;  4DR3 B;  2E3C A;  3DSQ A;  3SJA C;  4TV9 B;  3QF7 A;  4DRX B;  1HNZ H;  4LSA A;  4B08 A;  1Z5V A;  1X4T A;  3UT5 A;  4CC5 A;  1HNX B;  4GKK B;  3N40 P;  1GYF A;  2E5L H;  4O2A B;  3J81 W;  3ICX A;  4ZI7 A;  3K5M A;  4O4L B;  5LYJ A;  3RGX A;  1TGO A;  3JSL A;  1SA0 A;  4LF9 B;  4RAZ A;  4LSX A;  5ITZ A;  2ZNJ A;  3QG5 A;  3NBY B;  4X1K B;  5LP6 B;  4DR7 H;  2R9A A;  1VF7 A;  3KXY T;  3KAL A;  4IAJ A;  4NXN H;  3T1H B;  1Z2N X;  1N32 H;  2EX3 A;  4CH3 A;  5LMU H;  4I4T A;  4JYA H;  3HKD A;  4LF5 H;  1S03 G;  1V9P A;  1RSO A;  4UCR A;  4I55 A;  3KAK A;  3MWM A;  1X9N A;  2W57 A;  4B3R H;  3VQV A;  5CA1 A;  4GYC B;  4BWA A;  1QHT A;  3JAM W;  4MV9 A;  3N2G A;  4DV6 H;  5CA0 A;  4O4H A;  1TA8 A;  4FM2 A;  3HKD B;  3JAL A;  4LR3 A;  4AQY B;  4PI2 A;  2CAZ C;  4JI8 H;  2Q2T A;  4LH7 A;  4TQF A;  4YY3 H;  4NXM B;  3TY9 A;  3CHX A;  2CW8 A;  1WNS A;  4FLT A;  5FNV A;  4JI7 B;  4X1K A;  4B3R B;  4DV3 H;  3U11 A;  3W1B A;  4B3T B;  2UXB H;  5IJ9 A;  3JAT A;  1TVK B;  3L4J A;  4DV4 B;  1HNW B;  3N43 B;  3JSN A;  4Q0Y A;  1Q3E A;  1DGS A;  2QM4 A;  4LNU B;  4FFB B;  1N32 B;  1IBK H;  4JI6 H;  4JI2 H;  4EB6 A;  4PZ7 A;  2PUS A;  4D7S A;  4DR7 B;  1P16 A;  3LML A;  4A2B A;  3BA8 A;  4MV7 A;  1E4F T;  3TY5 A;  3BAA A;  4ETS A;  3JAR A;  2ZIM A;  3RYI A;  5IJ0 A;  1Z2O X;  4DV4 H;  4I55 B;  4KHP B;  4TQD A;  2HVQ A;  4JV5 B;  1TVK A;  4RB3 C;  4B3M H;  5LXT A;  4CH5 A;  1ZHS A;  5BMV A;  3K3V A;  2UUB H;  2PTM A;  4FLY A;  3K5N A;  3K5O A;  4JV5 H;  5EIB D;  3N42 B;  3N2K B;  1SA0 B;  4KHP H;  4Q6G A;  4DR6 H;  5D1O B;  2YIB A;  4O2A A;  3S24 A;  3JAL B;  4EB6 B;  5GON A;  4LFC H;  3IAY A;  4LFB H;  3SR2 C;  4I7H A;  1ZAU A;  5LA6 A;  4ZOL B;  1N33 H;  1XQ8 A;  4I50 A;  5CB4 B;  4GKJ B;  4UCV A;  4I50 B;  5IYZ A;  2GV9 A;  5FPO A;  1HNW H;  1O9H A;  4CS3 A;  4IIJ A;  1XDN A;  4FLV A;  2P22 C;  4LF4 H;  5LMU B;  3F8N A;  3N44 B;  1YEW A;  1J5E B;  3RYH A;  3SJC C;  2RQ6 A;  3U10 A;  3J7A K;  4GKJ H;  2UUC B;  4BW9 A;  3KYH C;  4U3J A;  4X1Y A;  4I9Q A;  4PZ8 A;  5CA0 B;  3CB2 A;  4YY3 B;  4LF9 H;  2VOB A;  1P49 A;  3RGB A;  4RB2 C;  5LMN B;  4DV6 B;  2PZS A;  4X66 B;  4LFA B;  4HNA A;  3HKB A;  3QTC A;  4DV5 B;  1B04 A;  3RYI B;  5IJ0 B;  5KHJ A;  2ZIO A;  2O03 A;  3JAK B;  3SJB C;  2UUB B;  2JS5 A;  3QWU A;  3RYC B;  5K1P A;  3BRC A;  2PGG A;  2ZIN A;  4I4T B;  4PHZ A;  1I94 H;  4AIL C;  4LF5 B;  2YIB D;  1VS0 A;  2VQE H;  4DV0 H;  1TUB B;  4K0K B;  4LF7 H;  3THO A;  3GB8 B;  4JI5 B;  4NXN B;  4DRF A;  5EIB C;  1Q5O A;  4JI6 B;  4X64 B;  2YCH A;  1I6U A;  3JAW B;  1IBK B;  4HBN A;  4DR2 H;  3E22 A;  4K8X A;  1CKO A;  4PZ6 A;  3N2G B;  4DR4 H;  3VQY A;  5LXT B;  2XHB A;  5JQG B;  4DV7 H;  1L8D A;  4DR1 H;  4B3S B;  1CKM A;  1HNZ B;  2F1M A;  4JI0 B;  1SQF A;  2QJ1 A;  2BTQ A;  3C0F B;  4NXM H;  3OTO H;  3J80 W;  4JI8 B;  3JAT B;  1IBL H;  2CW7 A;  4O2B A;  1O75 A;  2ZM6 H;  4E6N A;  4OX9 B;  4LNU A;  5JH7 B;  2HGS A;  4X66 H;  4LFA H;  1N36 B;  1XK5 A;  1QQC A;  4APM A;  5D5P A;  5IJ9 B;  1M4U A;  5A2Q W;  2UXC H;  5KHI A;  1Q43 A;  1SKV A;  4F6R A;  2KSW A;  2Q7H A;  4TUY B;  2JGU A;  5KHK A;  1M0W A;  4LMY A;  1CKN B;  4FM1 A;  4YHH H;  1FKA H;  2RGR A;  3W1G A;  1FFX A;  3BPZ A;  3VQX A;  5FD5 A;  4DV1 H;  2HEP A;  4DRX A;  4X65 B;  4X64 H;  4X20 A;  2IM9 A;  5FLX W;  4LFC B;  4LFB B;  4LF7 B;  4CH4 A;  1AN7 A;  4K0K H;  4EQ5 A;  2RJZ A;  4O4I B;  4UCO A;  2PY5 A;  4LF8 H;  4ZHQ B;  1E4G T;  5JJE B;  3WB1 A;  4IHJ A;  3NC0 B;  4BWS C;  1TUB A;  5KX5 B;  4K8Z A;  2JVD A;  4O4L A;  5LYJ B;  4FLX A;  3W5O A;  5EZY A;  3WB0 A;  4GLX A;  4UFZ A;  4TOI A;  4X62 B;  3ZS8 C;  3MAQ A;  1JFF A;  2R70 A;  3HKE A;  2OWO A;  2KKW A;  1J5E H;  2UUA B;  4YHH B;  1N34 B;  4DUZ H;  5KMG A;  4B3T H;  3RYF B;  5LL6 b;  4NVP A;  4TV8 B;  3HXL A;  5EYP B;  3LNN A;  3T1Y B;  3M7M X;  3BA9 A;  1N33 B;  4JI1 B;  4DV2 B;  4CC6 A;  4JI4 B;  1XMO H;  3RYF A;  2UXD H;  4J0M A;  4DV5 H;  3RYH B;  4LH6 A;  3UQ8 A;  5BR8 B;  4OX9 H;  4L8J A;  4AQY H;  2WDT A;  4FLU A;  2UU9 H;  4PI0 A;  3JAS A;  2RGV A;  3RGZ A;  4ZOL A;  1FJG B;  2UXD B;  5J2T B;  1S68 A;  3BAB A;  2BTO A;  3RIZ A;  1Z5W A;  3KAJ A;  5GON B;  3T1Y H;  3ETQ A;  3CVZ A;  3K58 A;  2F4V B;  3L4K A;  4B3S H;  4DUY H;  3HKC A;  1CKN A;  2CFM A;  5JJJ B;  1WPB A;  4DR4 B;  4JYA B;  4RB1 A;  1IBM B;  4YJ2 B;  2HVR A;  5DIS C;  3WB2 A;  3U0Z A;  3T1H H;  3FFQ A;  4FVM A;  2ZCE A;  1O9G A;  4DR5 B;  4JI2 B;  4ZIB A;  1WN7 A;  5JVD A;  1XNR H;  3VNN A;  1M5I A;  2VQE B;  5EYP A;  1TAE A;  3JAR B;  4EEQ A;  4DK0 A;  2E5L B;  2YI8 A;  5KMG B;  1I94 B;  5J2U A;  5C8Y B;  1XMQ B;  2F95 B;  4RB0 A;  4CS2 A;  1WH2 A;  1M0T A;  4JI7 H;  2YI9 A;  3SGI A;  5IT9 W;  5EZY B;  5IYZ B;  3GJX B;  4X1I B;  5IWA H;  5JQG A;  4B3M B;  5JCO A;  3EYY A;  2YXL A;  5LA6 B;  1SEI A;  2PYL A;  4EFE A;  5LMN H;  1Z2P X;  3N41 B;  3FMA A;  4R7R A;  5D1O A;  5LP6 A;  1XI1 A;  5KHG A;  4JI3 B;  4LF6 H;  1JMK C;  4M7E A;  4DR5 H;  1JJO A;  2HHH B;  3RJ0 A;  1SQG A;  2Q7G A;  4X65 H;  4ZI7 B;  1XNQ B;  5FNV B;  1XHZ A;  3OTF A;  4DV1 B;  3DF7 A;  4EFB A;  2PYJ A;  3UT5 B;  3K5L A;  4LF4 B;  1IBM H;  1N34 H;  2UUA H;  1BJT A;  4X1I A;  4DUY B;  5FPR A;  3NBZ B;  5K1X A;  4A2A A;  5J2T A;  1XNQ H;  4KL1 A;  5D5Q A;  5C8Y A;  2ZJT A;  2HHH H;  1KMI Z;  3RFR A;  4MTE A;  3GDE A;  1L2Z A;  3H20 A;  2UU9 B;  5LOV A;  3B2E E;  4DR6 B;  2P5O A;  5BR8 H;  5LP6 C;  5JVD B;  4X1Y B;  1HNX H;  4GKK H;  1Q8I A;  2ZM6 B;  5IWA B;  1D5A A;  2ZNI A;  4DV2 H;  2VUG A;  4JI1 H;  5KX5 A;  3M4I A;  4O4J A;  5JCO C;  3OTO B;  5EOY A;  1XMQ H;  4IHJ B;  3K59 A;  4DR3 H;  3RF2 A;  4DK1 A;  5ITZ B;  3RR5 A;  2R72 A;  4YJ2 A;  4DUZ B;  1H2S B;  4WBN B;  4O2B B;  1FVI A;  4MTD A;  1S5J A;  3IG0 A;  4RZQ A;  1XNR B;  3HKC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...