3V4ZA

D-alanine--d-alanine ligase from yersinia pestis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
293
Chain Sequence
b'AEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title D-alanine--D-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 94
structure length 293
sequence length 305
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3v4zA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3v4zA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4zA01
2HGSA 3K5HA 3ETHA 4FU0A 3MWDA 3VMMA 1VKZA 3E5NA 5KX5F 3VOTA 4EA9A 1KJIA 4O7ZA 4O7VA 1UC8A 2GQSA 4YBZB 5KKNB 2DZDA 4TV9F 2YZGA 3G8DA 4EA7A 1EUCB 2IP4A 2GLTA 4I55F 4I4TF 5JVDF 1E4EA 1BXRA 2R85A 3KAKA 4O82A 2W70A 3JRWA 5K2MA 1C30A 5CAEB 2GQRA 4ME6A 1KJ9A 4O7NA 3BSYA 3U9SA 1AUVA 2DIKA 3TIIA 1DV1A 1GSHA 2V59A 3LWBA 2ZDHA 4FFLA 4HNTA 5JVLA 1A9XA 2V5AA 2W71A 5BMVF 4WBNF 1IOWA 2VR1A 2V58A 4O2BF 1PK8A 1KEEA 1UC9A 5LA6F 2NU6B 3WNZA 3R23A 1VBGA 4J6EA 2R87A 5HV6A 1AUXA 1EYZA 3U54A 3VPDA 2C00A 3ETJA 3N8DA 4C5CA 3KALA 3GLKA 3R5FA 4ZHQF 1Z2PX 3MWEA 4O7WA 3BSSA 4FGRA 1KJ8A 4M99A 2WYOA 5J2TF 3HB9A 2R84A 2NPOA 4IHJF 1W96A 2YYAA 1JKJB 2CQYA 1VBHA 3SE7A 2YW2A 3RFCA 2FPGB 4TV8F 3LP8A 1EHIA 3NUAA 1KJJA 4IZOA 4EGQA 3AX6A 4C5BA 4O86A 3WO1A 2ZDGA 1JLLB 1E4EB 1C3OA 5LYJF 3RV3A 2FB9A 2W6MA 4O4IF 2CNUA 1OBDA 4NYEA 4ZOLF 5JH7F 5JQWA 5CA1F 4EA8A 3I12A 1JDBB 4HNUA 2CNQA 2YS7A 3MJFA 4MV4A 3WO0A 2QK4A 3K5IA 1GGOA 4MA0A 2HJWA 5EZYF 4ZI7F 3U9TA 2XD4A 3RUPA 4MV7A 4MA5A 4O4HF 2R86A 2I80A 5LP6F 5J2UF 4EGJA 2DLNA 4O7YA 4EG0A 3KAJA 2R7NA 4MV1A 4DLKA 1Z2OX 4O7SA 3V4ZA 4O7LA 1DIKA 4M9CA 5CA0F 3UFXB 4YAKB 2YZNA 2Z04A 3G8CA 2R7KA 1M0WA 4HQ6A 2FPPB 3ORQA 1KJQA 2I8CA 4IIJF 3JZIA 2OLSA 4C5AA 3V4SA 1M0TA 3TQTA 4XZ3B 4MV3A 2GPSA 2W6OA 4FFNA 3HBLA 3BSWA 4MV9A 5LOVF 2Z02A 4IWYA 2VPQA 2FP4B 2W6PA 1CE8A 2R7MA 4EABA 4MV8A 1CQJB 4YB8B 3VPBA 2YZMA 4FE2A 3Q2OA 3TINA 4MV6A 2R7LA 1DV2A 2I87A 3VA7A 5BPHA 2X0SA 5C8YF 4ZQIA 4FFRA 1SCUB 1WR2A 4YAJB 3GIDA 2W6QA 3KREA 3R9RA 2YS6A 5I47A 2P0AA 4O84A 5CB4F 4WD3A 3JZFA 3AW8A 3QFFA 4EAAA 1EZ1A 4O83A 4Y8VB 4GGMX 2NU9B 1T36A 4O7RA 1GLVA 1ULZA 2FPIB 1EUDB 3U55A 1CS0A 5FNVF 5HBRB 2YRXA 2W6NA 1KC7A 4M9UA 5LXTF 3TW6A 1CQIB 2DWCA 2NUAB 2PVPA 3R5HA 2CNVA 4O4JF 4TUYF 2SCUB 5IYZF 4O81A 2YRWA 2PN1A 3K3PA 2VHEA 1A48A 3TIGA 1BNCA 4IWXA 5D8DA 4MAMA 2R82A 4M98A 1W93A 4XX0B 4YJ2F 2VQDA 2R6FA 5C1OA 4HR7A 2YZLA 5GONF 2J9GA 2PBZA 2ZDQA 1PX2A 1KUTA 4XYMB 3HO8A 4FFMA 2W6ZA 3RV4A 4FFPA 1OBGA 1I7NA 1B6SA 3ORRA 2XCLA 5C1PA 1GSAA 2CZGA 2NU8B 3N6RA 3JRXA 3BG5A 2YL2A 3OUUA 4YJ3F 1Z2NX 4O7TA 4E4TA 1I7LA 3BFPA 3VPCA 2NU7B 3OUZA 2YWVA 4L1KA 5H80A 4I50F 4O4LF 3Q1KA 1GSOA 4QSHA 2GPWA 1M6VA 4HNVA 1IOVA 2QF7A 5DMXA 5JQGF 1B6RA 5BPFA 1KBLA 4XYLB 4DIMA 4RZQA 4FFOA 4O2AF 1JDEA 3DF7A 3R5XA
chains in the Genus database with same CATH superfamily
2H4XA 4A0RA 1F7UA 4IO0A 3DQQA 2OCAA 2DR0A 4PHCA 2VWPA 3IPYA 3NKVA 2V7TA 2RI6A 5FOVA 4RHEA 1T0HB 5F35A 4EJSC 2R4UA 4Q4CA 4BBPA 4TLDA 3UMVA 2CKMA 4KIFA 2XDQA 4TV9F 1BQ4A 1XP5A 4LZZA 1E9VA 2ON6A 2UVWA 4YRPA 2B5WA 1Q7BA 1LPOA 3HCBA 4JGIA 3KFVA 3GFSA 4AG6A 3EMBA 1LPPA 2I2XB 3FBWA 2YXBA 4BB6A 1L4HA 4NENA 3OZ7A 3EPHA 4OLFA 2FZCA 5DN9A 2W2PA 2JFBA 4F3CA 2XMZA 1VMEA 3SSNA 2C7OA 1WG8A 1A9XA 2P77A 5HNKA 2BEVA 3CNLA 3OZAA 3AVWA 3BBPA 5DHTA 1RYNA 2ZAOA 1LDMA 1WAMA 2IF0A 2GAIA 4DARA 4DR4H 2A8YA 2XEDA 1IM2A 1ZK0A 3W5BA 3M6IA 3BSSA 3TXAA 4K8OA 2FSFA 4ENQA 3EXEA 4RDHA 1J2RA 1QZ3A 5KFHA 2ECKA 1AO3A 3VZSA 3TAHA 1PF7E 3ZH9B 5JMPA 4XQCA 1OTYA 2GBFA 5THQA 4FNOA 3DT9A 4OFZA 1CJMA 3D5TA 2VDKB 1NW5A 2N75A 2K2QB 3I8OA 5JXWA 2H65A 2B61A 4I50B 4BO0A 2GA8A 1AS3A 5LIPA 2IKSA 4CF3A 1T6BY 4DV7H 1I2BA 3QNWA 1N7HA 2IZ5A 3V48A 4F6CA 1ATZA 3OOEA 2L69A 2QN9A 2X0JA 3IT2A 3GTJA 4J1QA 1KNXA 3R0QA 2I3GA 2ZYDA 5C8ZA 1UK7A 1W88A 2C95A 1E2PA 4BFCA 5FF9A 2PGJA 2QN8A 1YGYA 1EUDA 2A5GA 4B5LA 4ZHQA 4CMIA 4AKSA 1XMJA 4PAWA 4X41A 4X63A 4EOGA 1R37A 3F73A 2W11A 4ZK2A 2YZNA 2UUPA 3T06B 2DFKB 3WWDA 4BZXA 4DC1A 3CF2A 1PLJA 4O5AA 2C2WA 3PXXA 3WOHA 2QP3A 1LEHA 1PUXA 2ISSD 1PT6A 1IXYA 2A0XA 4QUEA 3RVSA 3FYTA 3VPBA 3JSNA 1PEYA 3O90A 4NS1A 4QT4A 4EY8A 2HF2A 2M2IA 5B58C 5IJXA 3HWRA 1KZ1A 1M5TA 3EF3A 3BJMA 3GMTA 3WMEA 4R7GA 3NJRA 4MULA 2F55A 1BKDR 2HMYB 3AUUA 4GGMX 4XH9B 3FVRA 4OHKA 3SHVA 5CHEA 2XITA 2O2SA 5P21A 3NU1A 1GRQA 3MMPA 2X7JA 4JENA 3UJ8A 3SZGA 1OFUA 3C5CA 1CQIB 2Q1UA 5HTOA 3PR2B 4GMDA 1TYEB 2Y2VA 2ZB7A 5DHPA 3S28A 1WNFA 4H0NA 3GEEA 1Y34E 1ACMA 2OVBA 3K1AA 3AY7A 2IUTA 2OAQ1 4R2IA 2FG7C 5K5EA 2J9GA 4QUIA 1NDQA 3IEMA 4P9NA 5B4UA 5E6UA 2GBLC 4FS8A 4A1FA 2GZMA 1NXPA 2WFAA 3EPKA 2ZE8A 4KXUA 2PR2A 3FROA 2RHMA 1G1AA 1FVXA 1QS0B 1HI9A 3MQ4A 4DYHA 3K30A 2UKDA 3GIPA 2Q07A 1IVSA 1YBAA 4TSFA 3P20A 2AMVA 2DM6A 1ZLYA 2XE4A 2MCTA 2XVXA 5B30A 1XAGA 4KR7A 2CLOB 3KEQA 1X19A 2B78A 3PEUA 5KWEA 3MTBA 1NBME 2Z3VA 1NN0A 3SWWA 2Q9CA 4QUGA 4MEBA 3IP6A 4N8EA 1N7GA 4YBRA 1FFXA 2FP4A 3IVGA 1A9SA 2XUAA 1XQVA 3WGGA 1J09A 4DW8A 4YJFB 4HC4A 4CR6A 1U0NA 4AD8A 1P2SA 2PZLA 2O0JA 4BXOB 1HE8B 3P2JA 1EHCA 3ZWPA 1VG9B 4YRLA 1L5RA 5BSRA 3CVWA 1J49A 3MAJA 4MUFA 4B9EA 4DG8A 1YRLA 3WXBA 2H85A 3L07A 2Q62A 3P19A 1GPAA 3ZHYA 1J2EA 1G6OA 3C4VA 2BI4A 1POXA 1I1QB 3FCSB 4XD2A 4DAEA 5BW8A 1LFDB 1MBZA 1CP2A 1AM4D 3E9QA 2KI5A 4YTEA 4R1UA 2XT9A 4EEZA 1Z8HA 1XZJA 5KFSA 4KK4A 3I61A 1S3FA 1PD1A 2YV2A 3ZJ5A 2FOXA 2ZUDA 1SXJB 2GPNA 4N0EA 2GS9A 4D4KA 4PPFA 2X9QA 1QDUA 1SBNE 2HC9A 3OOJA 4J6FA 3OTOB 2HT6A 1P5FA 1IULA 4MUXA 4D8WA 1L5QA 3OT4A 1E1LA 1DTWB 1B8VA 1VG0B 2J9XB 4FILA 5JEEA 1FDOA 3GQBA 1HNWH 2JA5G 1O5OA 5KOIA 1E6MA 2AQHA 5CFQA 2NMVA 1F0YA 2O8NA 3IV6A 3V6HA 4DYVA 1THMA 3IOEA 5CT8A 3TJMA 1YFKA 1KEZA 3FJ1A 4UBNA 4IIEA 1L7VC 2CHGA 3W5HA 1Z6XA 2WV7A 4E5PA 3VSCA 3RS2A 1M8PA 1KDPA 4JMPA 1Q0HA 1T10A 5C3EG 4HQOA 1P3Y1 4BVJA 3M4NA 5B4VA 4N3GA 2V8BA 4K9RA 3P9IA 3GFBA 4NP6A 2JBAA 1RK5A 3ZD9A 4QYTA 1KA9H 1WRVA 4MA5A 4DCOA 1NW4A 5L9XA 1RFGE 4AFNA 2I33A 4U9IS 4PCLA 4HH3C 2BEJA 2IYYA 1A7UA 1CRPA 3BGOS 1JT2A 1HYBA 4CL8A 5DLQC 3F96A 3ORQA 2WWRA 4Q9DA 2JLQA 3WX0A 4F2WA 4JS0A 5DYNA 1RIFA 2UDPA 4PXSA 2WZBA 2BMWA 4C06A 4JB0A 3ZZ0A 5JYDA 2ZCJA 3RWOA 3JSAA 2ZJ2A 1XRJA 4ZJUA 4BNMA 1YZGA 5CBKA 3IRUA 2QRGA 7YASA 4JL8A 4CF6A 4W5NA 3FNRA 2W6CX 1T8WA 2V9PA 4Q8FA 2BONA 3RDPA 3BGVA 4QREA 5CG2A 3SY8A 4J2HA 4MQLA 2BPOA 1CUAA 4N76A 4BTVA 1R8YA 3I01M 1OH8A 4J1NA 3AR2A 4ZZIA 1CUYA 2RK4A 4ZJYA 3HC7A 3OBBA 3GLSA 1VBFA 3H2GA 4FT2A 5JXJA 1GLNA 5TQVA 3WWEA 2WJZB 1DPFA 1ZAUA 1TZKA 2CW7A 2HF7A 3T5HA 5KFZA 3VR5D 1BC5A 3BUSA 4G1VA 4I4NA 3FOWA 3GT7A 2XB9A 5FOUA 4CL2A 4DC0A 4OHMA 1XJ0A 3LXMA 2JIBA 4LDZA 4GQBA 1FMLA 5B37A 2B6NA 1RQXA 2HPVA 3WZMA 4JU8A 3M5DA 3FR7A 1FRZA 2V7BA 4F3RA 3HPQA 2GZHA 1KDTA 3IELA 1KAGA 4BY9E 4IMJB 1T6XA 5FXMA 4OG2A 1UP6A 1ORHA 2W57A 5FBQB 4KGXA 2DQZA 4NF2A 1I7LA 1JQJC 1CY2A 621PA 1RS0A 2H5EA 1MABA 2EFGA 2JGNA 2JA6A 2OC4A 3GAZA 4P5DA 3SFZA 4ARAA 4D5EA 1XA4A 3IMCA 3LULA 4D8UA 3CSSA 3TXXA 1Y3FE 4IILA 4QHTA 2PYZA 3PYMA 4TT3D 4LFAB 4M37A 2O8BA 4L7VA 3UN1A 2VHYA 4KGZA 3HV0A 1N33B 3HGMA 1UPTA 3C3MA 4NE9A 4DJDC 4JBHA 5KJ6A 1W5SA 3KPUA 4MHOA 1Q1EA 2DGDA 4CBVA 5F98A 1IZ0A 2R8ZA 1GSIA 5AM1A 4NEGA 2WE8A 3G6VA 1Z3IX 3CIFA 1L8QA 2COUA 1K6XA 4N5NA 3PGLA 4D9KA 4ZARA 3UT6A 3N53A 4BL5A 4KI0A 3PR4A 1W59A 5JVDF 3A27A 2PQMA 2JA7A 4TYWA 4EVRA 4RHUA 4NOLA 3ZCXA 3NNDA 4MVJF 4HB2A 4ZIRA 3QZ7A 2AFIE 1H0KA 4NQZA 1ND5A 5DM2A 3RLFA 1QK3A 2WA2A 2OL4A 2WP0A 2VLIA 1VL0A 5FNVB 3HKCA 2XTMA 1X7WB 3HBJA 3KPWA 1L5MA 3BB3A 5D5QA 3GRUA 4IHJA 1I14A 2PGDA 4NESA 3RPEA 3HEAA 1TM1E 1V8OA 2Q45A 4JR2A 4XW2A 2XNKA 1M7BA 1PVOA 4N3CA 2B25A 4HH4A 2ZWVA 1JAYA 1E3LA 2WM8A 1OVMA 2WF5A 3UTDA 2BKXA 2J85A 5EMKA 1J2TA 2F17A 3RR2A 5HIMA 2Y0SA 4YAUA 1ISSA 4G63A 4HS9A 4YPFA 1Z35A 1J2UA 4DRZA 1DE0A 5FOTA 1DCMA 3R6GA 2FK8A 5H9WA 4N7JA 4YMWA 4JSRA 1GZUA 4NENB 3Q2IA 5CK5A 2CD9A 5T4FA 1N6HA 4EY5A 5JV5A 1OR8A 2GFHA 1Z4NA 4C7VA 3MWGA 3ZWVA 5FPTA 1N7IA 4NHEA 3IT3A 4FHDA 1JDBB 4R6WA 4CMEC 4RVUA 2NIPA 5CX4A 5FHQA 3NIGB 2BEVB 3F67A 3FOFC 2ZIXA 1ZS9A 3C3WA 3DOFA 5JARA 1QYRA 3PPIA 1EJ0A 1SBHA 1T26A 4KNVA 2R86A 1NBHA 2Q4DA 3H4MA 4O02B 1UPCA 2OGUA 5IG2A 2J6UA 2IEGA 5ALOA 3T5JA 3VDMA 3QVMA 3ROKA 4ECZA 2R3SA 3PFBA 1M72A 2IHKA 1ESMA 3T3MB 1XD8A 4AQYH 3QVVA 3AM1A 2VP5A 2I5PO 4YRTA 4BQEA 3JQGA 1U7WA 5LOVF 3ESZA 3ZDBA 1OAOA 1C7JA 1VI5A 3SNOA 3C6KA 3DO8A 1OXKB 3NNNA 3OX1A 4NH0A 3W77A 4QAJA 4ESVA 1XTVA 4MUJA 4GW3A 2OOSA 4PLFA 5L7TA 1LDYA 4FVTA 2WWTA 1USWA 2SNIE 4OHRA 4GRIA 3WLFA 1U63A 3OTOH 1U1GA 1W88B 1X94A 4E2YA 3NJ4A 2H1SA 1KMMA 3KVNA 2XCSB 1EUDB 2ZJTA 1ZR4A 4ZHQB 2W6NA 2KJQA 5JJLA 3OECA 2Q8QA 1E5QA 4Q02A 4PYNA 3R7BA 1TJYA 4M89A 3SD7A 1ZSVA 5HIKA 1BEEA 3L7LA 4H7EA 3RBEA 1XU9A 4L4YA 4PLWA 1SUEA 2WD8A 2HVSA 1N6LA 3FGOA 1TK2A 4NZYA 3WA6A 3FI9A 3BGWA 2WT9A 2PX0A 2J6BA 1T1RA 5L3QA 5JH7B 5C8YA 4UHBA 1X2BA 3ZU5A 2C82A 1LTKA 2HIXA 4N12A 2RGAA 2YV3A 1R5JA 4WINA 1L4BA 4TX1A 4G26A 2P3QA 4YJ3F 4GP7A 5JDCA 2RE8A 2R6DA 1M1XB 4H08A 4HFRA 1YBFA 1P2FA 2H29A 5JNWA 3OEWA 3RASA 4UFPA 4Y2VA 1G21E 2DJ5A 2P75A 3HWX1 2BEWA 1H9BA 2NP7A 4QNMA 2PUWA 3LL7A 5KI6A 2I3AA 3G1TA 4MHTA 1RZRD 1F0NA 3I6IA 3OQ1A 5M3BA 3GTLA 2O03A 2WWYA 2NADA 5KQMA 5GZ1A 2QDKA 3BRCA 4O1HA 1N8KA 2EJ0A 1YB4A 2IEBA 5LNK6 1P9NA 3SIPA 1K1EA 3HZZA 1XAJA 3HS3A 2FPOA 4EA9A 1X7YB 3UYKA 4FBUA 3A2LA 4O7VA 1KO8A 4XLTA 3JQ6A 4JUDX 1MB9A 2PBRA 4KPFC 1Z13A 5DDIP 3QJ5A 3FTNA 4G56A 4BQNA 4D9MA 1UKVY 3V8BA 5E6UB 2P5TB 2YBDA 1KZ7B 3GEBA 1NLFA 2AJ8A 1WHTA 4BNUA 1A9RA 3LCCA 3S81A 1FP2A 1ZU5A 1EINA 3EARA 4O4LA 1C9MA 1RQRA 3NTRA 4BKOA 5J3JA 5AW7A 3WRYA 3ZN2A 4FFLA 3DUFA 3K05A 1EFPA 2OKGA 1NTOA 4ETNA 5T8KA 2W71A 1KH1A 5HIAA 2DFVA 2ZUWA 5SZIA 4TTSA 4J9PA 5TMEA 3UJBA 2HK7A 2BFWA 1SXJD 3QQMA 2EJ2A 5JPIA 4BNGA 3WV5A 4H15A 1CEQA 1RCTE 2UU9B 3H1FA 1EX1A 2NZXA 4ONEA 1FFXB 1N6PA 3HB1A 4YRCA 1JVBA 3GWZA 3WLOA 3WKDA 4IRKA 4BCBA 1TADA 1V8FA 4UBKA 4HCJA 3AVOA 2JJ1D 1KHTA 4TZKA 1KP2A 1HLPA 1ILWA 2KW5A 1I4WA 5JROA 1JEEA 5AVOA 1M76A 1LI7A 4IFEA 3M3PA 3UMMA 1DELA 4A8HA 1V4BA 4IZIA 1J1UA 3G5LA 3MSCA 5BV2P 2X6QA 1NOJA 2VNHA 2R4TA 1Y1VG 2C0PA 1QRUA 5DT2A 4CEIA 1R74A 1YMUA 1M8FA 1OXSC 1X14A 2I54A 2BP7B 4PF1A 3U3DA 4KFTA 3GG9A 1THGA 1PWZA 5FTWA 4O4HF 3UYLA 1RXVA 5L6LB 4ND7A 5HJEA 1DAMA 4A3SA 1XEAA 3DTYA 3K9CA 2XNDA 2CKDA 3LY9A 5AUNB 1SQFA 2I66A 3HM9A 3V1UA 3OTWA 4FQ8A 4E5YA 4KGVA 2AEMA 1U8YA 5IJ9A 2OCXA 1UJBA 4N82A 2P79A 5HIJA 2D2FA 3EZ2A 4AQDA 4DB4A 1UFVA 3D4PA 1GUFA 1S7GA 1EP9A 4KB5A 4EG8A 3KR0A 1V9LA 4LHSA 1YR2A 2LKDA 4QM6A 2NVWA 4DANA 2WJYA 4HVTA 1JYSA 1BX1A 1KI7A 4NL4H 1Y6QA 3WBJA 1QH0A 3ITDA 2UZAA 4S1PA 1LBEA 1CFZA 3S3TA 4JB8A 5EL0A 4QARA 2XSZA 4YMGA 3HYRA 3IP8A 5K6AA 5FR2A 5JBIA 5M34A 2ZRPA 5IKPA 2QX9A 3B1YA 2QD5A 3KSRA 3K9HA 3Q7TA 4NWIA 4U8HA 1Q6YA 1FU4A 3BWDD 5IH3A 4A3BG 1KQ3A 1THZA 4JI7B 3RYHB 1FTGA 3BD8A 5HFNA 4QXQA 1OT5A 4R8VA 4F3YA 4J03A 1D0SA 1ZGGA 1TKAA 2VA3A 2VP6A 5CEJA 1DGQA 5EJEA 3WIEA 2PN1A 4BATA 1ZL2A 3BH7A 4U8GA 3EIOA 1OYWA 1U2QA 2VQDA 3IBSA 1O6ZA 3WHPA 3HFRA 4NU8X 2ACWA 1QQAA 5HCNA 3IILA 1Z8DA 4QG3A 3VHXA 4CLRA 1Q6ZA 3IIEA 3X2FA 2EJ3A 1X1SA 4F91B 1BSVA 2QG9A 2XCLA 1P6QA 5K51A 2VPXA 3OFSA 5CTAA 4LNHA 4PYMA 5J4HA 3VH3A 5AVXA 4V3CA 4DUYH 2EZ4A 4HEHA 2PPLA 1IXZA 4OKNA 4BNXA 3LIIA 4LJAA 5AT1A 4F97A 1GNVA 1QFYA 1TO2E 3QKRB 1PUJA 3VSDA 3KFXA 1R8QA 4R8LA 1XPUA 2IEZA 1XZ8A 3CVZA 1L1QA 2GWRA 4LXIA 4N03A 4JBNA 4RD0A 1OBOA 2OBBA 1QHYA 4MR9A 2ZCUA 1JQAA 2O2DA 3V2GA 1CWUA 4JP1A 1Y80A 3RS3A 2NTYC 4K46A 1KDVA 2NSJA 2O8DB 3U7JA 2QAGC 1P80A 1VJ5A 3WHIA 3JX9A 4LHXA 2ZIFA 3G2LA 3K71B 2QRJA 3SC2A 4RETA 1KQOA 3KYJB 4GI3A 2C5SA 3JY6A 4TSKA 2Q6IA 1YZHA 1LWNA 2Z56A 1T3LA 4O3RA 1PLLA 3SOPA 5K0CA 4Z7QB 1F7VA 1Y4DE 2AC4A 1GDTA 4W1SA 4ZOQI 3VR5A 5KC9A 1JFFA 2O3UA 2CEKA 5AVZA 3OE1A 2O8BB 3PNQA 4EL5A 3MJTA 4MICA 1R0RE 3MOSA 1PT9A 5A3VA 1L8LA 4YR0A 4WV3A 2ZI3A 1DX6A 1UK8A 4WIAA 1GVNB 1KTVA 2VHJA 4YR3A 1YNOA 3GP3A 4WFJA 1HZZA 3FOCA 1ICEA 4F8EA 4IGEA 1YU9A 2IU3A 2Q1XA 3N2GA 2DH5A 5KVQA 3N42B 3DYBA 2I9PA 3MGKA 3U0VA 3VX3A 2OBMA 4C0XA 4ZQCB 1Y1KE 3GNTA 2NZVG 4ZRDA 2OGTA 4CRWB 4ZIRB 3IXMA 3CZ5A 4ITVA 1PGJA 2AF3C 5KNBD 5LPNA 3HJFA 4BFTA 3GJ6A 1CQWA 1BHSA 1H93A 4O2BA 3ZJTA 4YY3H 3G5MA 2B20A 4TT3A 3GG2A 1LSJA 1K6IA 3RS7A 4JJ7A 4FYJA 4Q1CA 3C3JA 4QOHA 1NMSA 4FHFA 3RRZA 4LVOA 4Q7LA 3DT8A 1EB8A 1GG2A 4LY3A 5JAZA 1KK0A 1W1WA 2JGMA 4Y1FA 1TK3A 5EIWA 1RWPA 2FUCA 1GGFA 1ZAKA 4DM7A 1YDFA 2GN2A 4CIWA 2EV9A 3OLVA 1M5UA 1EX6A 4X1KA 1C41A 3B82A 2PU7A 1LD3A 4OSPA 1U80A 1RP1A 3CLKA 3JQRA 3ZBUA 1C9DB 1QGUA 2PUDA 4U6NA 5FP0A 2WM2A 1RQ2A 2BY4A 2OWDA 4YVFA 1YQQA 1G19A 5K3AA 2UU9H 3HJGA 3H20A 3D81A 4QBKA 2EL9A 4ZVRA 3W8DA 5ALYA 4CTOA 1FYVA 4YRDA 2PWYA 3E1SA 3RC8A 4X6UA 1AF7A 1EWKA 4F5YA 1TEHA 2O14A 3QEAZ 1NNSA 1XZMA 2KM1A 5HYVA 2EIXA 3TI9A 4DGQA 2V0GA 2H2HA 3U49A 1Z83A 2PMZA 1J0CA 5BQ5A 3TY5A 5F2KA 1GQ2A 5AWFC 4FBGA 3BWMA 1W44A 4RCZA 2FOLA 5KG7A 3GPBA 5DM4A 3GLHE 4J9UE 4KO1S 1L1RA 3JQGB 3B7GA 3MWEB 2IE8A 2IA5A 4QA9A 5F4ZA 1DINA 3DAFA 3WR5A 2GN9A 1XR3A 2P4HX 2JK1A 2NWQA 1YDHA 1F8YA 3AJ8A 1Y81A 4O4IB 3ZJUA 1VXRA 4PWYA 1VHJA 2G3YA 1ZK1A 1N5DA 3NYIA 4WA8A 4D8TA 3V8MA 4G97A 1R18A 1NULA 2DHCA 3WLRA 1VOTA 5IDYA 4V0MA 5DWDA 5DNDA 3G9XA 5TPZD 3S55A 4DJFC 1JIJA 2CHFA 2GESA 4KDEA 3NBQA 5TEVA 3KZNA 5AFSA 1PJ4A 1Q16A 5LP6B 3SX4A 3WADA 1WB9A 1P2BA 1FTNA 3WP1B 3D7NA 2LGJA 3CUKA 1EEXB 4WZ6A 4ALMA 3STXA 4K2AA 3KTDA 1NQAO 3T1TA 2HF8A 4KMSA 4M1WA 4P2BA 1PBTA 3QWBA 2W93A 2G8NA 4CQNA 2QUAA 1YHYA 1QHGA 1DB3A 5HDBB 5KX5F 4ROSA 1G0OA 2Q29A 3U3JA 1HE5A 1M2GA 1WIWA 1DBPA 5L3QB 2GEUA 1I7SB 5C8YB 5LN1A 4L08A 1TM5E 3NMUF 2WJPA 2PZKA 2ID7A 4JI7H 1C30A 4N5LA 2AQ4A 1Z25A 4GR5A 5JSYA 1JTEA 1D07A 3CNEA 2AZXA 1GSHA 1E2KA 5A4JA 5IUKC 1CUFA 3EPGA 4OB6A 4I2NA 3LWNA 2PRYA 2C97A 4COKA 3OICA 1NG9A 4BO6A 2BEWB 2XGOA 2AJBA 3W90A 3LGXA 2Q7DA 2AX3A 3QUAA 2R87A 1JN0A 4UHJA 3U54A 2JGRA 1ZNWA 1KOFA 2H1VA 4YA6A 4CM1A 1LDBA 4Q82A 2RCNA 3KALA 2Q5JA 1Z2PX 4HGOA 3ZWOA 1RRKA 4DQNA 5IJZA 2PUEA 1IWBB 1Y98A 2P2GA 1XQWA 1N32H 4JQYA 4OJQA 4X0EA 3HXTA 4B7AA 4D4IA 1FFEA 3OFVA 4C76A 5DHRA 1QS0A 2NZUG 1TX4B 3N7AA 3D7KA 4NXNH 1WHTB 2A5DA 4BC1A 3CKYA 3REOA 2BGUA 2X2EA 2FB9A 1LGYA 2BGKA 3SSAA 2ZPUA 2F8TA 4K0RA 1PWYE 4O4LB 1IH8A 1FK8A 3C1UA 2OBFA 5C51B 1EFPB 1QKJA 3HZHA 1JQ5A 5GP1A 1WSWA 3FDJA 1RZRA 1DEKA 3IO3A 3WL8A 1V8ZA 2A9FA 2FAXA 4POOA 4C29A 1WUIS 1GU0A 1KVQA 4NLGA 1OI3A 1XTPA 2VA8A 4OXNA 4R40A 2W37A 5I7SA 1EFAA 5ICSA 3WBBA 1ORWA 4D26A 5GIPE 2ZJ8A 3N76A 3TG8A 1MP0A 4KLCA 4A3KG 1E2BA 3D4OA 4EDFA 3HCFA 1CNMA 1EFLA 1UDCA 4DXAA 1UQUA 2WB1A 4ZYWA 2F1JA 2CNWD 3ESAA 4G23A 3WV4A 3WGJA 2NV0A 1KH2A 1MG5A 1Z18A 4GS5A 3O73A 5KQSA 4CEIB 3FKSD 4C6TA 4C2AA 1QCZA 2FN9A 4FOSA 3X1WA 2VAMA 4KQCA 4EFEA 1SXJA 4ZVUA 4MGHA 1O5TA 1ULZA 3O21A 3HBMA 3MCZA 4LFBB 2XMGA 3SFTA 3VPSA 5DK6A 2ZM5A 3ESDA 4LWPA 1PJSA 3NBMA 4KBGA 4LX0A 2ACVA 3USES 3CEJA 2P9FA 4OQYA 2JJ1A 4PQYA 5IJ9B 2GN8A 5C3UA 1JHMA 3COVA 4XTCS 4G8DA 4HAUA 4ZQEA 5JXHA 2XRZA 4NJOA 3LRPA 4PCAA 3CGWA 2WIAA 4JODA 2VDMB 1ZY2A 1OFIA 3DFUA 4MVJG 2BN4A 1LRKA 5TT0A 4F0JA 5BWRA 1U3CA 3RB8A 1GD1O 2DPJA 3GFQA 3DEFA 5FKJA 1I7NA 4ETMA 4YAIA 2H2FA 2G1JA 4H35A 2JAUA 3WIDA 4LBZA 3A3YA 2ZGVA 3DZJA 2ZUSA 4LYFA 2I4TA 3E6AA 1BAPA 1JPUA 4OQFA 3H2IA 4B75A 3TEJA 4A2AA 1B41A 5KNCH 5J2UB 1HE3A 1M3SA 1AHNA 3TZBA 3RVRA 2AE2A 3RH0A 5IABA 5JPDA 2H7VA 4R71A 4IDPA 3PV0A 3V5NA 3SEFA 1LLDA 2VUHB 1NFFA 3IEIA 2QUJA 4FOTA 1G3QA 4MGIR 4D3FA 4BNHA 2HMSA 1SELA 2IU6A 1ZBQA 3AFHA 5D5HA 5KQGA 3W7AA 4R4JA 1O7JA 5EZSA 1HSZA 3TZCA 2WVAA 3OZIA 2G80A 1MTOA 4DDKA 2O2YA 4BKQA 5KC8A 2XX3A 3LLCA 1SBYA 3A1FA 3SKYA 2IZ1A 4N6OA 5FHRA 4FONA 1KTAA 1N5RA 3HSSA 1PE0A 3DPSA 1JR3E 4CVNA 3KEMA 5HILA 2XCUA 4MHSA 1G3UA 4IR9A 3ZDDA 5TT1A 2PL9A 2ZGIA 1ZFNA 4RIHA 4EYQA 1W36D 4YNBA 2COGA 2Q8NA 3L04A 4GOJA 3HFSA 2R68A 2EP7A 1Y1TA 3NUZA 2AA3A 4AF7A 1Y8CA 1H4VB 4NV1A 3QHAA 4ZCTA 3U81A 4K87A 3R5FA 4E88A 4CG1A 1G20A 4YJ2B 1CFJA 1RYSA 3GJZA 1Z08A 3T7IA 2DFLA 1VE1A 4DXHA 5I9MA 2VQFH 4NBNA 1XMIA 1ZYUA 1JRLA 1WUKS 2WINI 1SZCA 1EBUA 3CPJB 2IS4A 2JZNA 1W7AA 3FTDA 2OCBA 5EPUA 4FGJA 3SC2B 3R0VA 1ST2A 1V96A 2HDWA 4JH0A 2FZWA 5LWQA 6AT1A 2ZKLA 2JIPA 2D5IA 1OBDA 4DCTA 5B1YA 5L3VA 4UCSA 1FNCA 5EAIA 5JJBA 4QKQA 3HCPA 3II6X 1FVIA 3NRCA 2ARKA 3T35A 4S1NA 4N7MA 1NSFA 3ORYA 4A1OA 3VAYA 3ESCA 2XA2A 3AM5A 2I6TA 1I36A 4CI0B 3ZNNA 3B20A 2VBIA 1RKXA 1GTJ1 1H3NA 4MW7A 1B1CA 4UD6A 2C4KA 4XDHA 2IQ5A 4N0DA 5F78A 3GU3A 3P4UA 4M1KA 4KXWA 4FMCF 3OOWA 2X0NA 3HBLA 4ENUA 1C1DA 1YCFA 5K8IA 2JLVA 4UM8B 4UBJA 2AFHE 2B7CA 3IQIX 4OBWA 4LEIA 2OILA 1XN1A 2B4TO 3H2KA 1I3OA 3WB0A 4TSRA 1SVUA 5KFGA 2D1SA 1ZRMA 2BT4A 5FNVA 2VATA 4RLSA 1X7WA 3GJ0A 5C44G 5F76A 4JOBA 2QU8A 3NZEA 1EJBA 2XADA 4O2BB 3N05A 1E2HA 3AI3A 4GXNA 1XEWX 4IYRA 2H7YA 1L3BA 2XPCA 4B34A 4C7BA 1LX6A 4TGLA 4WXMA 2GTPA 4GF5A 5BW5A 1T36A 4BQSA 3MWFA 1X1TA 4XJSA 3LK6A 3X2EA 3OBIA 3EGEA 1JIIA 4Z0TA 4XUEA 4JI8B 4KPUA 1PZHA 5BNIA 4EFNA 2GDZA 6CHYA 3H5WA 2JFPA 3KKPA 4I4LA 3AONB 1KAMA 1HT3A 4J43A 4CV1A 1VSBA 2A5LA 1DUSA 3MJDA 3QKSA 2WTXA 3GT3A 4X1KB 2RAFA 1EUCA 1T9ZA 5B3LA 1T13A 2Q99A 4OHBA 3F6SA 1QGUB 1OIVA 1ZOIA 4DFDA 2GFQA 4B3IA 3GEDA 3LPDA 2OV8A 2GPBA 3IQFA 3BXOA 2F1OA 5TGTA 4G1FA 4A82A 4EGFA 4B3MB 5I9SA 4RTRA 5HKKD 4OYHA 4Q39A 3MSXA 2M1XA 1QF9A 4LPKA 3A4IA 2AI1A 3AIKA 1T2UA 3ZWNA 2RB4A 5KB3A 5FO0A 3ZY6A 5J43A 4FSDA 1QGOA 2EF1A 2RONA 3WOVA 3TJZA 2Q41A 1W94A 6NULA 3RR5A 4MQ4A 1XYYA 5EHIA 5LZ7A 2XZOA 4FWIB 4AJOA 3D59A 3TIIA 4J0MA 5B2FA 1C9JA 3TZ6A 5CB6A 1EI9A 3ZE8A 2OKCA 4ZTZB 5BSVA 1I5EA 1XXLA 3CXRA 2AXNA 2BHTA 2VT2A 5EJIA 4PU0A 1AG9A 5DX1A 4QNNA 5LZ8A 5H8WA 2R7AA 4ECTA 1HDXA 2ODBA 3LT1A 2PLFA 3MXTA 1L8XA 4BGDA 4MA4A 1J0XO 4QEDA 2XYGA 3I2IA 2H17A 1YOBA 2UV8A 1RDFA 5JH7A 4NOKA 4YV2A 4OIMA 1X13A 1HL3A 4MS4A 2RAVA 2ZAYA 1P39A 3E18A 3AIMA 3NLLA 2FF7A 2ZIEA 3RGGA 1CQJA 4TWIA 1PTJC 3ND9A 3ZBQA 5TPZA 1C30B 3DXZA 4FGUA 4A5OA 3T1HB 2PX6A 5L40A 4DLRA 1DAGA 2Y1XA 4RY0A 1OLXA 1J0DA 3W6PA 1NI4B 2V0NA 2PRIA 4RVDA 4OM8A 4ZU6X 2YQ5A 3IKLA 4D9NA 4RK5A 4FW9A 2ZITA 3GIIA 1D7AA 1SR8A 3BGSA 2WZQA 2MSCB 4TYMA 3DONA 3L8DA 3U9TA 2B82A 2VDOB 3CRW1 3IHKA 4HUTA 1U28A 3EHDA 1X7YA 1ADBA 1TA0A 3T94A 3JALA 2E7ZA 2A14A 3I1FA 1E9EA 3HV2A 5B1DA 4R2JA 5IC5A 5FT9A 1MGOA 2Y99A 3NALA 4RAZA 2PH1A 1T9CA 3RSSA 4XGRA 1NVDA 1RHRA 5B58T 3NHPA 4IWYA 3SHTA 1SUPA 3QXSA 1N6KA 4WACA 3H1EA 3N0TA 1NUUA 4MV8A 4XPZA 3WLHA 4G6ZA 4QTZA 1O95C 2I2DA 3WKBA 1RWNA 4YDHB 2OAEA 3QRWA 4NIMA 4OREX 2RGNA 1MQAA 3G8BA 2L17A 2JI4A 1E96A 5M29A 1D1PA 3VKGA 5IZCC 3S68A 1CY0A 4P7BA 4TT8A 4YRAA 1S2IA 1X9HA 5CCXA 2DPIA 3H9CA 3MYYA 4BV9A 1SD2A 1KQGA 2OXEA 1ZCZA 3EWNA 4HLUA 5DNEA 4NCXA 1DBIA 1JXLA 2HJGA 5NULA 5K0GA 2GR9A 3Q3GE 3PUHA 1L6RA 1Z0AA 2DEUA 2WKPA 2W58A 4RK7A 1HYEA 1EXMA 1HT1E 1BS1A 2AC2A 4RJIA 4GKJB 1R4NA 1XZHA 3ABRB 1K4MA 1CIPA 4N18A 4NEHB 2Y6VA 1S2OA 2BR3A 4NJMA 4HDKA 4OMFG 3Q12A 3SQNA 4DL9A 1LF5A 3NGDA 4I1VA 2D3WA 2DQSA 1X1DA 2C5EA 3VR5H 3SQXA 1AKQA 2LRHA 2L19A 3QHQA 4MH0R 1BRTA 3A7DA 4CETA 2MTBA 2BP7A 1OA0A 4ED0A 4E5UA 2R92A 3T5KA 1YMVA 5IVPA 4C6TB 2BHNA 3GTKA 4KODA 2AR9A 3C8ZA 1HTTA 4N6GA 3TW4A 4MXDA 1Z5WA 5TF4A 1DBRA 4KKXB 2I67A 1IOVA 2G36A 4KQXA 2Q3MA 4K9NA 1ZIPA 3LHKA 1UEJA 3G2PA 4X84A 4MW0A 3TRFA 1FB5A 1NUTA 2JLCA 5JZOA 3K9FC 2C3UA 4ILKA 1RWKA 4LZOA 2HHHB 3WL7A 2XZPA 2ZJ0A 1MOPA 2CNWA 1BE8A 3W7BA 4KITB 2Z1DA 2XD9A 2IK8A 4O3NA 1Y1RA 2QPOA 1E9BA 1SUSA 5D85A 1IZYA 4OYLA 2A94A 3BIXA 1AK9A 1RRPA 3AKEA 4OLBA 3ZQUA 5G3ZA 3RYHA 4JI8H 1W49A 1HV8A 1YR9A 2IX3A 2X0DA 4RMIA 3FDZB 1C0LA 1H1TA 5TMBA 4JBWA 2J32A 3R76A 1GNSA 4CF5A 2QL5A 1JA0A 4KXLA 4MDYA 4D8VA 5KFWA 2H5IA 3UATA 4TMFA 1OJ7A 3NNSA 1KZYC 3ZDYB 3WGMA 3WK9A 4MAAA 3C39A 3M4IA 3IOMA 3M6VA 1KY5A 1SFRA 4ADSG 1TE2A 4L73A 1B4DA 1Y9JA 1YUMA 2LCIA 1VKRA 1E2UA 3TUIC 4G5SA 3ICOA 5J2TF 1LRLA 5LZ2A 2ZULA 3ZHTA 1M0EA 2R48A 4Y9SA 2EJCA 3OE4A 1BQEA 2IUYA 3NUAA 2EQBA 3N43B 3VJRA 3KQLA 2IRWA 4M8NE 3ACCA 5KYGA 2H0RA 4R1QA 4J4TA 1Y3DE 4DHEA 3QKRA 2XCIA 3EXG1 4JK3A 4JR0A 5CFRA 4YRSA 3FVTA 2G1UA 3O6VA 4QNRA 4DG5A 5F73A 3A6GA 2WD7B 1RWMA 4MUNA 2Q1YA 4ZDWA 2BF7A 3WRWA 4YGXB 3I9FA 3F2IA 1BTOA 2LIVA 2QT9A 2GSDA 1H6CA 3QEKA 4FGWA 2OTCA 4RAOA 3KVRA 5FNZA 5CDFE 4OSOA 4EF5A 2O8DA 4IAJA 1RMTA 1G20B 2AZ4A 5EXEA 1AD2A 1CDEA 1QRSA 2XYPA 1SEPA 1RM3A 2IXGA 3ZCTA 2HY7A 4IM7A 3EGVA 3D5EA 3PNVA 5HGJA 2YNMC 1JEDA 2Q1SA 1U8AA 5LYJA 2YWHA 5EXXA 2GWHA 1S2DA 1XUOA 4BJ3A 2QMQA 2OZEA 4NARA 4AX8A 1AC5A 1XRMA 4LMAA 5KKAA 3ZGLA 3O95A 2YIVX 1IE3A 4CLXA 1KO5A 2H11A 1Z62A 4A91A 1QWSA 5I47A 4KN9S 4JP8A 1Q0RA 5TS2A 3AL2A 3HVJA 2B8EA 1K88A 4YAWA 4MV0A 2HDNB 4N48A 3ZY3A 3QWHA 1JJAA 1VAJA 4IVQA 4LGMA 2G1AA 3DMFA 5FTJA 4L57A 5K0FA 2VA9A 3WK6A 3BJEA 5A3QA 4NBVA 2KPOA 3IMFA 1VJGA 4UMVA 4FNMA 3AOGA 3T1HH 1KO1A 1X7DA 4P1ZA 1SZDA 4H1TA 2VYVD 3NBYB 1C1DB 1MX3A 2YMMA 4MS3B 5C8DA 3I62A 4F9TA 3NHJA 3V32A 4JASB 4TM5A 4Z9XA 3TQCA 2NACA 4L4XA 2D2IA 2IF2A 3DDOA 2Y6UA 3JYNA 5AKIA 2D06A 2HTEA 1NVAA 2PA0A 3TBKA 3HJRA 2EW1A 1E2FA 3VNAA 3NAGA 4QSHA 1FQWA 1SCNE 4RHXA 2QRUA 3JR3A 2QMHA 1T36B 2VCHA 4RK0A 2IIBA 4B8YA 3RF6A 3W0LB 5LXTA 2DR3A 4PZAA 4NFSA 4KPUB 3D8NA 4GLBA 3GGOA 2OV1A 4HNHA 3S99A 3DLTA 4U02A 1E4YA 1T4CA 3P9PA 2J7PD 2RG1A 4RUKA 4GYWA 3V9PA 3OOYA 3QKSB 3SXUA 4YROA 4IS3A 4ZODA 1ONBA 3HY6A 2XA1A 4QO8A 1EUCB 4H16A 5CYFA 4URFA 4WOBA 3MR6A 1SZJG 1ZGCA 2XBUA 3DBLA 1SB9A 4D74A 4BWVA 2VJOA 1L5LA 5EWMB 3TTWA 4YCDA 1RYBA 3OTGA 1ZW1A 4BLOA 4IF4A 1KVTA 2QSZA 2QI9C 2QA5A 5F3RA 4G4GA 4ZQFA 1G8MA 4EEYA 3M0EA 1GOTA 2GO7A 4O3MA 1WU7A 4JI4B 4XXHA 3LU1A 4J2TA 2PSSA 2AUMA 4RE5A 3ZS9A 3ETJA 3DZFA 4EG3A 1SVMA 3Q3VA 3MWEA 2HG8A 5CFNA 5DNAA 2X5JO 1P73A 1NXWA 4I81A 2R93G 1M7HA 4O4IA 2MSLA 3INYA 2RHDA 3SE7A 4V02A 4A0HA 2BCEA 5BURA 2Y0EA 5BUCA 4RZXA 5FUWA 1IL0A 5ERXA 4YECA 2CMGA 1UPUA 4CTMA 2YWDA 3R5TA 3L8MA 4L7QA 4L27A 3NIDB 2ZIWB 5IBCA 1MZVA 3RC7A 2KSWA 2ZROA 2GK4A 5E4JA 5L4SA 5LP6A 5DG8A 3FUCA 1VFPA 4P0PB 3VKFA 3JS5A 1ONNA 3KB1A 3CLUD 2DJIA 1C4OA 4Q16A 4LIPD 1MW9X 4ML3A 3Q15C 3HXQA 5HKKA 2HHHH 2KSQA 3T9EA 3WGHA 1T29A 1V8BA 2AG5A 3TNDA 3PR3A 4D8XA 1XMVA 4INPA 3PGA1 3CUVA 4QICA 2B9EA 1U90A 2XIQA 3ZHCA 2FA9A 1EE9A 1N8NA 1JL3A 2O48X 4B74A 1QQ6A 4RF4A 3OCZA 3REQA 1U81A 4LE2A 2R7KA 5KFBA 3ON5A 1ONOA 3OPXA 1FFYA 3ND6A 4DRYA 3MLEA 3DOEA 5ES4B 1UP4A 1RPNA 2OGWA 2GPSA 1M6EX 4MS4B 4HGZA 2ZLBA 2RGCA 3BGIA 1O4WA 4LDAA 2ZT8A 4LRUA 4H7HA 3ILYA 1CQJB 3ZE9A 5AI9A 3LD9A 4M9SA 4MV6A 1E7WA 4CLDA 5ECYA 3CNQS 1N0VC 1OLXB 1QVWA 1CDZA 5B12A 3E0QA 1QIGA 4H59A 5L6MB 3HOUG 4M0DA 4D81A 3DMYA 1M9NA 4BNLA 2HADA 1RYZA 3GFOA 1CJSA 4ZI7A 2G6BA 2HRQA 4BY1G 1OE0A 3DAOA 1E60A 3EIEA 4KQ1A 4OF4A 2X2FA 2IP2A 3JALB 2ALJA 3HDVA 2RKBA 4MQUA 1Y7HA 2CDBA 1PQWA 3ZWBA 4MMXB 3OPYI 4C78A 4DE5A 3RJTA 5IRCD 4NMXB 5JBNA 2BKEA 3DEAA 3G1WA 2FUEA 1U8UA 1UAAA 2WAQA 2NXJA 3A9WA 5SYMA 5FFMA 1O54A 2H18A 1TZ2A 3RO7A 3BZWA 3I0MA 1CUWA 2ZFUA 1TCUA 4ARBA 3I6MA 5KJFA 4ZCIA 1AF4A 3ZYZA 1IEXA 3ZUGA 4P3PA 2IYLD 4CMKA 2CZGA 3C4QA 3CG0A 5AUPB 1VE7A 1K4YA 3OJCA 1BFKA 3K0EA 4J0KA 3KKEA 2V6IA 5K8VA 1YB2A 1NM5A 3D54D 1WB6A 3KZKA 2F3SA 4F96A 4ZREA 1FQKA 2PJZA 1KJWA 5AVRA 5DTMA 2YW9A 1J42A 3B2NA 1PEDA 1S03G 1XEFA 5EPEA 2UXDB 4LGYA 2DRIA 3RVOA 1RCFA 3HGTA 1Z0UA 2PRKA 5EN4A 2PXAA 3BD7A 1R4NB 4F04A 3P32A 1WUHS 3ESBA 4ZGBA 2CCJA 4LCEA 4RIGA 4D0SA 4NJMB 3HB5X 2DZDA 1J8VA 1Q21A 1U6JA 2GCEA 4HDKB 2JRCA 3RG2A 1F8XA 4LFAH 4ENPA 3EZGA 4ENWA 4DDVA 2LIPA 2AI2A 4HXGA 4CM7A 1N33H 4CDGA 4NBUA 4R5HA 4CZ2A 1PFGA 2P30A 3K8ZA 1Z28A 2FW1A 1QIHA 3VTZA 4HMOA 2FR0A 5CB4B 2PZAA 4NCKA 3L49A 5EJ5A 3SXPA 1DBWA 1U2EA 4IDCA 1ORTA 2A9OA 2Q2NA 1ZH4A 1C4XA 2XB8A 3KKMA 5I7WA 4O33A 3DMDA 1A8HA 3VKUA 2XTNA 1J97A 2ID9A 3L8EA 1GZVA 3VOBA 3Q7RA 1KMCA 5KHAA 4NV3A 4A2CA 1F3LA 2PIAA 1X7XA 3TLAA 4REMA 3SFVA 5I48A 3TOVA 3TZQA 2G08A 5IHXA 2HR1A 1V48A 2P40A 2CSXA 4OX9Y 2JHCA 3HB9A 3OY2A 4U9HS 2QRKA 2EBFX 1GKYA 5AHXA 3UT5B 4W5RA 1O0CA 3QOWA 2FE1A 3WIVA 4OXXA 3K6JA 4GT1A 1V5FA 1WA5A 3IAEA 1P1HA 4N3AA 1BU5A 3UXMA 4DV4B 4URUR 2O2ZA 2WJ4A 1CR2A 4KBFA 4P58A 3W79A 4L8WB 2HREA 3ZY4A 5J2UA 1JAHA 2P2CA 1UH5A 1P4JA 4IR1A 4TTVA 3MGAA 3RIZA 4RD2A 3FE2A 8GPBA 3UUGA 3J81W 2QLMA 3GLVA 1D6SA 4PHHA 1N2JA 4ZZ3A 3D6HA 3S1SA 4NXMB 3O3NB 1N1GA 5JD5A 1TLLA 2GAJA 3Q7IA 3I2KA 4B47A 1V39A 4CUKA 4C7OB 5CA0F 1BO6A 3GDEA 1ZM9A 1RMYA 3KX2A 1C7QA 3F5QA 5BT8A 3GH1A 1ZD8A 4MYRA 3R74A 2RGDA 4IIYA 4MV3A 4YUYA 5KJ1A 5DK4A 4QQRA 2BTEA 5D3MA 3N2EA 5K8UA 1BCRA 2D0OB 2VHXA 1ZM3A 3FTPA 1V5IA 2WNIA 1FUEA 3PHIA 4K9LA 2PE5A 3A1VA 1GFZA 3TE6A 3U0GA 2HHFB 2JIMA 4R8SA 1N9GA 1RBQA 1QM5A 3WGOA 1K1QA 1V3UA 2P9BA 3PPXA 5KFNA 4A8PA 2XGGA 2A9VA 4CMAA 4AP9A 3O4HA 3WLJA 1ISIA 1Q3KA 4QM7A 4O3PA 3OQPA 2WSSD 3UMGA 5A05A 4GXQA 1KE1A 4YJ2A 4D43A 2O23A 1MH9A 1O9BA 4CM9D 1SOAA 1JALA 3S2FA 3BXHA 1WXWA 4GP9A 3RLIA 3GF4A 3PRKE 4Q9IA 5DEOA 5D8DA 4I3HA 2B4QA 1QQ5A 5KTTA 3DLIA 4KAAA 2QR3A 2QOEA 4NKRA 3QOFA 1E77A 5LYJB 4A7PA 3OC6A 1IHXA 4D0NA 1QU2A 2CF6A 3FNQA 4MVXA 4BUCA 1VMIA 4W99A 1E9DA 4DV0B 1W36B 2FN4A 4LSZA 1HO3A 3MHPA 5JXGA 1JWBB 1IN8A 3I5AA 1XXHE 3AUXA 4X7BA 3DVLA 4HSGA 3WIUA 3PNBA 1GSOA 4R31A 2GPWA 2UXCB 2KQUA 3SYLA 1WD7A 3O7WA 5SZHB 3DZCA 3A0UA 1MC8A 4WXHA 3CG4A 3TR5A 3V4PB 4BCDA 2IP1A 2Q6VA 3CNOA 4LY0A 2GTIA 1Y3AA 4IFTA 2GXQA 2H8KA 1NVGA 3U31A 2OV3A 4WBSA 3SAJA 1E6KA 4Q6WA 4O6VA 1SURA 2DPLA 2O2IA 4A73A 2I7VA 4L5YA 2XWBF 1PK7A 4KV9A 4IQGA 1DHTA 4RDXA 3NTLA 4JUFA 1B8UA 4D4HA 4L9AA 3TQOA 1QHNA 1HFKA 2Z95A 3UMSA 4ETIA 3DVRX 4Q15A 2Q3EA 1JE1A 3QV2A 5I7VA 3VZBA 1IN6A 4GEGA 3RHSA 3RVQA 2HNAA 4D9GA 2ZJ3A 1LLFA 1KYVA 1OB5A 3QBJA 3RS4A 4MUGA 4MVJE 5LXTB 4JI6B 3WWIA 5LA6F 2PY6A 4L8YA 5TLSA 3SK0A 4TUYB 3HJCA 5H0IA 2BOVA 4ZQGA 3DXXA 4NBWA 1MOQA 2VYVA 4C5CA 3H5TA 3P0RA 3VC2A 4CLHA 5EQTA 3D3WB 3PHBE 1T4CB 2GEKA 3LHSA 3OKFA 3SXUB 1Z5PA 3IQZA 4DRFA 1L4EA 5CFLA 2IS6A 4TV8F 5KFVA 2O4UX 3ODGA 3ZW8A 3VJKA 2JKZA 4H6VA 2ABJA 3KYBA 2I1WA 3DBLB 3MJ4A 1JECA 2R2AA 3GZJA 4WNCA 4MRAA 2WQ6A 4A6EA 1YR8A 4NH4A 3ZXXA 4LXQA 2AKAB 4DNXA 5JQGB 3W1WA 2LDBA 2QLTA 4GOLD 3L1JA 1V51A 1JQLB 1E0DA 3A06A 3JQBA 3GFPA 1DTSA 2X1VA 1NZDA 3UHFA 5IEJA 3K5PA 4KPGA 1EQAA 1M6VB 5AESA 3WB9A 4DBVO 1FE8A 2JCVA 3KT6A 2AYYA 4BBRG 3WLLA 4DM4A 1TGYA 5ESRA 3OEHD 4WXYB 3PVXA 1KSGA 4WKBA 3WS7A 1J7KA 1YQDA 1VLJA 3CPHA 2DPHA 3LA8A 2Z83A 2Z2ZA 2I2CA 4CMFA 3GVIA 5K4AA 3JVVA 4CN9A 3AM3A 3GYGA 1KGSA 1G2IA 3JASA 4GP6A 1GTSA 3PSHA 3ILHA 1ZJYA 2AS0A 1OXMA 1FFGA 2VF8A 4KN8A 3QV1A 2QGFA 4NULA 2AHRA 1COZA 1M2KA 1VMKA 3R3HA 4IINA 5IP7G 2V55B 3GEIA 2JI6A 1PEKE 1AZTA 1UJ4A 4V2UA 1UT6A 3PXAA 3UIEA 1T4BA 3GZ4A 4FBMA 1KJNA 5KTSA 3HVUA 3LK7A 2WQZA 3LVFO 2VVTA 1W581 3REQB 4R83A 1JEQA 4DV4H 4O81A 2VAXA 5ALTA 2B35A 2YRWA 3GAMA 4J9OA 3FB1A 3Q6MA 3MJVA 3N86A 6ADHA 3TGLA 4YMUA 4BNYA 2WABA 3NUGA 4GI7A 1XZIA 1A4IA 1JKIA 1L7PA 3W4JA 2C61A 2FKAA 1L8AA 3IOYA 2HCFA 1XZEA 2UVVA 2MR5A 3GUUA 1NI4A 3L0PA 3UAXA 1JMKC 3KB8A 1LLCA 3GFGA 1ZUHA 3G7SA 3RWBA 3WL6A 5CT9A 2WY2D 1CJBA 1JG4A 4LF5B 2CNLA 1IUNA 2Y2UA 1PG0A 3CXUA 3RNOA 1ES9A 4NXMH 1XTUA 2GZRA 3FPCA 2Q2OA 3M8KA 1L7RA 4ZI7B 1E7SA 5MDHA 2XMDA 2I3DA 2FU5C 2IJGX 4MVCA 2R6CA 4C7KA 3L8CA 2GN1A 1AS0A 1ORVA 1KYZA 2FG6C 4UTNA 3P4YA 5CIYA 4AJ4A 4J9MA 1E6UA 1EFKA 1U8FO 4LRQA 1I3LA 4QT0A 1DRUA 2PSHA 1DDOA 3B6ZA 3T5LA 1QUFA 5T64A 3BE8A 3LXUX 5E0KB 2QYHA 4UVDA 2QLBA 2ZTVA 3I6ZA 1U7TA 1WW8A 2ZB2A 1NMXA 2C2HA 3CLVA 5F51A 1YIDA 4FC6A 3BMNA 4OI0A 4QGSA 4KMMA 4P22A 3E5HA 5JANA 3PP8A 5G0SA 4RK6A 3LX5A 2YN0A 5KSZA 1HWYA 5JZBA 2O19A 2ZXEA 5MN6A 1FMFA 1WJGA 2VP3A 3R3ZA 4TXNA 4UNRA 5JVLA 5H4GA 3MA0A 3TY8A 3OZDA 2YZ2A 1GPKA 3LP5A 3F8SA 5TNXA 5AOAA 5MFZA 1CVRA 4TTIA 3UAGA 4E21A 3BF8A 3DJYA 4J6EA 3AF4A 1F4LA 3A6LA 4C0AC 1REQB 3VNBA 3HDGA 4O7WA 2V54A 1TRHA 3W5UA 1L5SA 2NXNA 4DPKA 5T3UA 1Y9ZA 2WI8A 4LF9B 5A0FA 2EKLA 2I4NA 4ZVLA 1DMRA 3G8YA 4BWFB 1HNXB 4Y1GA 4BEBA 3D43A 3R7AA 3KE9A 3LAWA 2IPMA 2I4MA 3AX6A 2QM7A 3DH0A 2AX4A 4JT2A 1RQ7A 4N9QA 4EBFA 2PJRA 3LBHA 3H5RA 2GM3A 1RPAA 1QLHA 2ZJ6A 4P4GA 4S3MA 2CUNA 4BTLA 4B3TB 3RYTC 3C2QA 3CONA 4HFNA 2PMWB 3I12A 4TXLA 5AVTA 3ORFA 4Q7QA 1QIFA 1U4SA 4CQMD 1QO7A 3CRQA 1ICIA 3M1AA 3A1CA 1Z0ZA 1Z8FA 3MJSA 3OWXA 5KG6A 1X7XB 2ATIA 5KEIA 4DLKA 2C9CA 4IQ8A 4AMYA 1F5NA 4Q1BA 1QJ4A 1Y6GA 3V4ZA 1A98A 4YPVA 2VUSA 2D13A 5F7ZA 4ZV7A 1SD1A 2VYQA 3GRVA 1IWPB 3R75A 4UMFA 2WVHA 4HMPA 5IDQA 2WSMA 5C18A 2OO5A 4PV7A 3B5IA 3GBSA 3C14C 1CSEE 4EFBA 1FXSA 3DGEC 3IEVA 3CUTA 1JMYA 4OKIA 3ADDA 2X3YA 4C1NA 4R8MA 3VNRA 5LD2C 2GN0A 2VAPA 4A2BA 3RT1A 5FYQA 1DTEA 2YU9A 1E4OA 2GKOA 5AYVA 1W5AA 1K8XB 3FDZA 4JJGA 2HSWA 4PSAA 3H97A 4RU1A 4A0GA 2BFPA 1K08A 2HFJA 2VH1A 3FKQA 2F7SA 3HA5A 1EJ2A 2QBYA 4ACBA 3JQQA 4Z3KA 2ANCA 5BQXA 3L6UA 1OASA 4L6CA 1PYOA 3PQ5A 4BLSA 1NVWQ 3OKAA 4RMNA 4EWLA 3B85A 3RQIA 3TEMA 5LL6P 3ROGA 4G8BA 3RIMA 1MLDA 1BDHA 1JG1A 2F67A 3VBCA 1V16A 3NBZB 3JZMA 4W5HA 2J5RA 3TIGA 3DO5A 2EJTA 1OAOC 2XUOA 3GDFA 4GRAA 1EGVB 1KXJA 2VF4X 3AW9A 3PQFA 5D3MB 2VH5R 4TKMA 5C1IA 5EPOA 3TLYA 1BCRB 1ANKA 5ED0A 3KAQA 5AKZA 4LOLA 1P4AA 3HVRA 1G3RA 4J7UA 1V35A 1ODCA 3TEFA 1P91A 3I9OA 1N9GB 4LVCA 2WD7A 2A1UB 4DTCA 3GTPA 1AURA 2HZBA 4GOXA 3H5OA 3V8VA 4YJDA 2IU0A 2YY7A 2VRWA 3H3FA 1S89A 2D8MA 3TQFA 1I01A 1HL7A 5AOVA 2B0CA 1R4MA 5HZKA 2VF7A 2QR5A 3IQHX 2QX6A 3D6JA 1C8VB 2I7DA 2I9KA 4K2HA 5ALDA 4C30A 1RU3A 3Q10A 2A1HA 1V6CA 4ZEXA 5P8WA 2OV6A 3EVBA 4MI6A 2JFNA 4W9NA 4PO3X 3GL9A 4WGFA 3GA0A 1TJ4A 5LVAA 2QVBA 1P17A 1CR1A 2YYZA 3KXYT 2DHEA 2GN4A 3C5VA 3QVJA 3I4NG 2IP4A 2J67A 2YJZA 1OBFO 1UBEA 1T9KA 4BVEA 1FXWF 1CYDA 5JDCC 4MK4A 3JRWA 4J7AA 5H5JA 3GUHA 2O6HA 4GBED 3U1TA 1MO6A 5I60A 4C1BA 3VKVA 5K2OA 2FK7A 3WDLA 3NC0B 5IT0A 3KO8A 2R4QA 5A9RA 4KR2A 3D2CA 5FLMG 4PVCA 3GPLA 1LK0A 2B63A 4GVPA 3W05A 5EIHA 4CM9A 4RB0A 4RCVA 1B0UA 3DLAA 3N0RA 3EX7C 3ZD6A 3IKMB 1Z82A 1OBCA 5ALUA 2ZJAA 1L4KA 3IMKA 3IDSA 4PWQA 2DPYA 1F9AA 1CX9B 1WQ4A 3HJHA 4MS3A 2OORA 4BEVA 1KEPA 3VHQA 1ZAYA 4C3UA 5CX1B 3TSCA 2J1LA 1UKAA 5EZQA 3PEWA 5B1IA 4AZ3A 3CLRD 1EXVA 5DHSA 5A9TA 4NDAA 3TSOA 4S12A 2FPGB 2WDPA 3VJMA 4JZKA 1BXGB 1AXEA 1F6DA 4C3VA 3VU1A 4H3KB 1M8JA 4EW6A 1AZSC 3SBEA 2L2QA 5KSPA 3WWJA 3CX7A 3WRYC 3H4IA 2J07A 3DV9A 2FK2A 5T8KC 3P45A 1XRNA 2PV7A 3F6YA 3OZUA 2CWDA 2EIHA 4YT4A 1RYMA 1KO7A 3L6BA 3VO9A 1ZMOA 1KMHA 3AV0B 4GECA 1O9GA 4MYCA 4AMGA 3M3DA 1VJRA 4EHJA 3RUCA 1J39A 3P97A 1IEWA 2VSYA 4BZWA 4WA7A 4XYBA 1WSAA 2DFDA 1WCYA 3HWWA 2W0SA 3IUYA 3T5MA 2EF0A 3FWYA 3HEMA 1NNEA 1U3VA 3EDMA 4R9RA 4Z99A 4KTTE 2F64A 5L51A 3QVXA 3I9MA 4AG5A 1TVKB 3CEAA 5KNBA 5FJIA 3E23A 4YRKA 2HU5A 3JAMA 2QPTA 4I14A 1I2KA 1RHQA 1NF8A 4MV9A 3X2SA 2E48A 1GPJA 1R6TA 5EWMA 2FW8A 4RMHA 1IXSB 5L53A 4DEVA 1AQ6A 2HHJA 3ENZA 3DGFC 1I24A 4GVXA 3U4MA 4XB1A 3ZZMA 2ZYSA 3C74A 3GT4A 2YXEA 1MQ9A 2BM9A 4P7KA 3FGNA 7GPBA 1R0BA 2A3RA 3PX7A 1LFAA 2Y0CA 1W4AA 1SXGA 9LDTA 3BBLA 5C37A 3TG2A 1NATA 2J5BA 4KR0A 1AGNA 1XDGA 2RGGA 1L7BA 1OZAA 3QXHA 4J0HA 4BZQA 1MPTA 1SC9A 2DE0X 1AY0A 3ITNA 4RQBA 4M0MA 1DQSA 3OIGA 2GJ8A 4LFBH 3OT5A 5ADHA 4IGAA 2I1LA 2X41A 5K6AC 1O97D 4FQ5A 4CIYA 3F9RA 5TB5A 5ICGA 1ZQ1A 5JBQA 3IE1A 3JASB 3T4PA 4RHCA 4PG5A 5BWCA 4AYXA 2C77A 3EXAA 1H6BA 1DCFA 2W00A 1BHJA 2BKVA 3OVMA 3STWA 3I5MA 1XHLA 4JSYA 4XFKA 4HNGA 1GADO 1DG9A 2WIDA 1GT91 3G9ZA 3ZHOA 5BORA 1XZKA 4NNJA 4FMPA 2YXPX 1L7OA 1SOUA 3PUJA 3QIAA 1YBVA 2EU8A 2IHNA 3OEHA 3BJZA 1M2FA 1ARZA 3H2SA 2VNSA 1JEQB 1S01A 3ETHA 2D1TA 4YO8A 1TTPB 1M6YA 4L6AA 1E8NA 1HTWA 4HN4B 3UAOA 1O0SA 4ZT3A 2FRVA 1EEHA 1MC5A 1I1NA 4B3RB 1EXDA 2PQ2A 4LV5B 4TRRA 4CG0A 1O58A 4ZI5A 3UB4A 5JISA 3LF2A 1WH2A 1TU3A 2P6RA 2POCA 4O82A 1Z5OA 3GN2A 3WLPA 1ADCA 2VEDA 3B8HA 3VFDA 3BDVA 3FDXA 3KQMA 4IIVA 5CE8A 1GZHB 8OHMA 5H59A 1MVOA 1SVLA 1AZWA 1BE1A 3OC0A 2ZT5A 2PSDA 4DLUA 3ACBA 1VYTA 2IS2A 3TS1A 3GEGA 5A5GA 3SR3A 3SQWA 3K7EA 3WWPA 3KKKA 3B70A 4S1TA 4M38A 1RLMA 1J7JA 3BAAA 1P8LA 2WM9B 5IAAA 2VJPA 2ZYTX 2O5EA 3E9ZA 4XWKA 1Z5UA 2YW2A 1IG3A 2FUG6 1NASA 3AWIA 3GP5A 3LOUA 4RM2A 4NCBA 4AXBA 3Q9UA 1JBQA 2QD4A 4DAAA 3JAKA 3EVTA 3BMNB 3RV3A 1NP6A 1JYFA 3GD7A 3L4BA 4MUMA 2V45A 1T6YA 1QBKC 1L4FA 4S35A 1Y9EA 1ESDA 4WHXA 3ZLVA 1TIBA 4EFKA 3LUJA 1BWSA 1FPMA 1A8PA 1X1BA 3OZXA 1W8IA 2Q3BA 3BZBA 3N0VA 1M1YE 5BR1A 1G8FA 3I64A 3QKUA 4HP8A 2DLNA 1SOWA 1HZZC 4O7SA 3K72B 3R3UA 3M1IA 3AHDA 3KHSA 1HM5A 4QDTA 4B2YA 3BWXA 3NCTA 3FWZA 1IBLB 3ZWKA 2PYDA 2AXQA 1T2NA 3FAZA 1RI2A 3QEBZ 4GL2A 3LY8A 1GZ5A 2BYTA 3RS5A 4CG2A 1W2HA 2B8WA 1K3UB 5CB4A 4XQ9A 2Y4RA 1UOEA 4ZRNA 2Q2TA 4KQ9A 3ZHXA 1G5RA 2AOUB 1DAPA 4BNFA 1E2LA 3B1JA 3KUXA 1JJIA 1DXYA 3PXEA 2I87A 4XCXA 4EY7A 3QXGA 4PRZA 1DQNA 4NBTA 5HCUA 5CFPA 1UEIA 4R8UA 1P60A 2QV0A 3GUCA 1V0JA 2XTAA 3MXOA 4I6GA 1IK6A 4OLJA 1YR3A 3FUUA 1BD3A 2ZTLA 3ESRA 3Q9SA 3IKTA 5DTEA 1ZRNA 3MBOA 5JSQA 2HA7A 2QXUA 5K3EA 3G82C 1WCXA 2CXTA 3VO2A 2IIVA 3VPGA 3UT5A 4B6RA 4OQQA 4BXXG 2R5NA 4B33A 2P11A 1ADGA 2E2IA 4K81B 2WBLC 2O3RA 3UV3A 4OJNA 1IZ8A 2VUTA 4PPNA 3OPYB 3FKSA 4BVFA 1II0A 2YZLA 1ORIA 3TLGA 5UKDA 3IDZA 2O2HA 4F4ZA 5BMOA 1P9WA 1E1KA 4ZT7A 1A0OA 4LKRA 1NJGA 4UZEA 3I83A 4QQKA 1ABFA 3UJ7A 2HQBA 1E0JA 4ZYXA 1G4HA 2OBYA 4AO8A 4GZ5A 4KKVA 2PS9A 4CQMA 1QRDA 1H2YA 1TMOA 1HLGA 1RXIA 4LA4A 2QBYB 4CR7A 3KOYA 1A7JA 1UZAA 3AHIA 3WY9A 3Q1KA 1UOQA 4YMIA 3CZCA 2W4IA 2AZMA 5BPFA 5DLPA 4C7OA 1YMQA 1PS9A 1UR5A 4E15A 2CCKA 5KTYA 3HUFA 2IH5A 5CDSA 4LK3A 3IUEA 2PSJA 2ABWA 2QVGA 5E3HA 2F1HA 1NQUA 5FOXA 3O93A 3ZD8A 3TF5A 1V16B 4TLLB 4QUBA 3EZNA 1MEJA 1JZSA 3DLPX 3VMMA 3RAFC 3ECCA 1VL6A 1QFSA 1FX1A 3LFTA 3EF0A 4V0RA 3AUTA 4J0GA 2HHFA 4B3MH 2HLDD 2WUEA 1XELA 3FMIA 2IXEA 5I9BA 3UY4A 4LAFA 5FWDA 3CZQA 3AFOA 1OFGA 2PGLA 3TKYA 3H9EO 2XT0A 4LDQA 4CKZA 4CTJA 5GINE 2WILA 5HIIA 4YV0A 1R4MB 1NURA 4PQRA 4NS4A 1WLSA 3OF5A 3P9YA 3AP3A 3A14A 3RUIA 2ECQA 3DW1X 1WZCA 1WDKA 3IG0A 3H8VA 2X0IA 1GA6A 3H6GA 1S68A 4E3ZA 3SCZA 3VI4B 1U5BB 5ITZA 1FNBA 2E2HA 4X20A 2XIJA 3P2EA 5EE9A 5DBIA 2PDAA 2Q4BA 1U0RA 1MAHA 4PC2A 4X8HA 1M0SA 4N7RA 4G4SP 2ZJYA 4DA4A 1JDTA 3EA5A 4IJQA 2ZRLA 4V0OA 4WESA 1G5TA 5HXAA 1IQRA 1XCLA 2DUWA 2HDOA 1AMOA 2CZCA 3C3KA 4F3KA 4H1WA 3TZHA 2ZR0A 5HKLA 2QNIA 2P68A 5JMWA 4PTZA 5BXQC 3ZDEA 1NQTA 5BN1A 4Y2HA 1W5FA 9GPBA 3N74A 3EH1A 2ZTSA 2FVYA 4INZA 3ZIAD 3I3OA 4EG0A 2ZZMA 3VSAA 3TDNA 4BZZA 3ZV4A 5JI2E 5ADWA 3BE6A 3B38A 2J0QA 2V4RA 3A11A 1B2LA 4WVFA 3JWJA 3I05A 4KVZA 1ZK3A 3ZHQA 3RNLA 4AZ3B 3AU8A 3GDHA 2KX7A 2OZPA 2R7ZA 1UXHA 4Q34A 4KC0A 5AJWA 3K20A 1YUBA 4XVHA 3PC6A 4KP7A 3MTIA 4YMLA 1XVLA 1VMAA 3NC4A 2X2OA 1PFUA 1A95A 1LXCA 1C3VA 4AWBA 1LV8A 3RBDA 5C7LO 1NU6A 5FAXA 3KREA 1RVV1 5EP3A 2Z2JA 4P86A 3LT0A 5KWIA 4TUYA 1KMHB 3U44B 1JH9A 3R7NA 1MZPA 1PI3A 6Q21A 3D3WA 4L3OA 4KOEC 1TQHA 2J4FA 2ZR8A 3W8RA 1DEXA 3D0RA 3EZFA 5JASA 3HKZE 1QWOA 3DTVB 2H1LA 1RQNA 2CNVA 5I01A 1YDWA 4O4JF 3N0XA 3FHCB 4B6SA 4LBVA 3G3EA 4NZNA 1GRVA 3WLNA 5F2OA 1XAIA 2CXHA 1P1FA 2WICA 4UXIA 4RVGA 4MWOA 2NYVA 1VSVA 2NAFA 1Z37A 5ENVA 5CPFA 1EWRA 4DIKA 5JQGA 4ZYZA 5DLDA 1V7CA 3DAAA 5KAPA 3L02A 1ATIA 4PLHA 4TMKA 5I9IA 1G9XA 4PS1A 4GKJH 1SXJC 4MWBA 2Q4OA 4DLWA 3HXKA 1PL0A 2JLWA 1DRWA 4MDHA 1FFCA 2GXUA 1Q2XA 4UHFA 1TIKA 3GLGE 3EXG2 1M6VA 1DAAA 2Q0XA 3TVYA 1ISGA 5KTPA 2LCQA 1LTHR 2AR0A 2VP0A 2IWHA 3RTXA 5KVVA 5CFZA 1H2BA 2MINA 3MWMA 3CN7A 4PSUA 4WY2A 3A6KA 3EVGA 1FKAH 1S1CA 1TNDA 1D5CA 3DAPA 3LQ4A 2PGIA 1ZK4A 1JVSA 4IHKA 1YZFA 2IVFA 4U7CA 3TAUA 1E2IA 5ALMA 3ND7A 4BB9A 4LYGA 1YZUA 4KO3S 3IPRA 4QTYA 3F8NA 1A50B 3ZR4B 5AXAA 4LV6A 1TJNA 5DISB 1GDHA 2GVDC 4JC5A 1B15A 5LR6A 3ICWA 3BULA 5AP9A 1B00A 3GX1A 4R9VA 1KETA 1Q7TA 1NV9A 3K3VA 4A3IG 4DL5A 5GGYA 3B9BA 4AJPA 2P9CA 4M4SA 4ZT6A 3OIYA 4J7CA 1PFKA 4E5VA 1SOVA 1BD4A 3ZWQA 4GC9A 5I9NA 4RJLA 4YAFA 3O4RA 4QRDA 1JSRA 2NZWA 2OZLB 4MARA 3HSKA 1BRMA 4BWGA 5JSKA 2ATVA 3DE2X 4P08A 3H2BA 4KNYA 4PZEA 3W5AA 4CC5A 3O74A 1L4UA 1EHIA 2I0FA 4QGFA 3IURA 5EUBA 2OFXA 2FSVA 4IGKA 1DUVG 5HQJA 2GBPA 4TWAA 3GLQA 5A2QW 1SKYE 2FSSA 1YS9A 3RAQA 5LBUA 3LF1A 1M1NA 3LUAA 3I53A 3AP2A 3TIFA 3QUCA 3U7RA 3E5MA 1GITA 3GMSA 2A58A 4RVHA 5AVSA 5C80A 4URVR 4B3SB 4H4CA 3EFHA 3BAZA 3UCFA 2EWMA 2QVCA 1QV7A 4YFYA 4RJ2A 3IUQA 4G0VA 2OCDA 2WJGA 5FPOA 2Q9AA 3R7LA 2CL0X 4TS3A 2OVFA 1UBHS 1Q3TA 1ZMBA 4ZVOA 1BWRA 1OGYA 5KCMA 2JLUA 4OQ4A 3KKLA 1Y5RA 4J3JA 4FSHA 3LUPA 4C7MA 2WUWE 1WMFA 4AULA 3JAKB 3QA9A 5LBIA 5KOYA 3P0IA 4UDOA 1BDMA 1V2GA 2NTNA 3SDZA 1E2JA 2CLLB 3H4TA 1UDRA 3DL7A 5AJTA 4E22A 3AGPA 3TB6A 1L7AA 4I9NA 3ZVRA 2R5FA 4YQEA 3GWGA 4AY4A 4IKOA 1EFRD 1MU0A 2UXBB 3FSGD 3SG0A 1S02A 4CIAA 4RPLA 2G77B 4ZDIA 1EZ1A 1QFZA 5C5JA 1REQA 4H7DA 1NL3A 2QTLA 4MIKA 4FYXA 1G66A 3BJRA 4E1VA 4Z6KA 3A0RB 1NJ5A 4LSAA 1N77A 5I3CA 1IY8A 4LISA 1AB6A 2F4VB 3HUUA 3K9GA 1Z88A 3NBYC 4HVLA 4IH9A 2CLCX 3A3KA 4BX3A 2VRCD 5AR1A 4EPXA 1W2GA 2NPIA 4XM1A 5K05A 5KMGB 1ULTA 1PO7A 5JZMA 1WUTA 1Z7YA 3DVAA 1W1IA 2BSQA 4NMMA 3GFRA 6ABPA 3T5TA 1GJRA 1UBSB 3C70A 2F3UA 3LM8A 3OJFA 4R2XA 1I0ZA 2ZRJA 2QEQA 5EJ7A 4DV1B 1BDIA 1XN4A 3VPXA 1ISJA 1VSUA 3O0DA 4QJ3A 1IQUA 1QH1A 1T3NA 4R8UB 1TM2A 3A2NA 4ZICA 4MR8A 1RKUA 4G37A 2Y05A 3EYYA 1EIZA 2H4FA 2H1OA 3KV1A 3EQ2A 4FEGA 2G83A 1VYHA 3RTCA 3ZC3A 1I10A 4DLNA 2Z8XA 3KV3O 1RBZA 1R5BA 3CRMA 2XMSA 1F6BA 5D1HA 3MT0A 1ODFA 4M6WA 2JFYA 2B34A 2YJTD 1MZBA 1BE6A 3GB8B 3SIRA 3CHYA 4HLDA 3CH5A 3Q98A 1QP8A 4A6DA 1JDBC 3TLGB 3PQDA 1T4DA 4A3EG 3WAKA 1TVMA 2ATCA 1TA8A 5H1YA 2AJCA 1YE3A 2BCJQ 1UZLA 1DCTA 4M1QA 4MW2A 4ZHSA 4EI2A 3UWDA 4CQMB 1W0JD 2CT8A 4Y98A 2C04A 1AUVA 4BRWA 1P5JA 3ZOZA 2OECA 3L7MA 2DXIA 4LOKA 1RXWA 4D82A 5FUBA 3LBAA 2QUZA 4WBNF 2VAVA 2R2GA 3HJUA 3VOSA 5KNBH 1VJ0A 5BRNA 4P3KA 2JFGA 4V0KA 1CPYA 4Z2YA 4N49A 2PBLA 3SJ7A 4MO2A 4WLFA 1Q1BA 5KDOA 2ZAIA 3LHDA 4K6HA 2OD2A 3PUKA 3LPNA 4F5ZA 1AN7A 2NSDA 1TZCA 4E7PA 4TOIA 4U5XA 5CT4A 2GTHA 1JJVA 4DDUA 3S4YA 4XZ3A 2P6UA 4JI4H 3TQSA 3CFYA 2A1UA 3UUWA 4WKGA 2NVBA 3H17A 1F5SA 1ORDA 5EVCA 3RRNA 4RTMA 3KQHA 1T8SA 4UTZA 4G85A 5JS6A 3E2IA 2DQKA 4JJ6A 1QIJA 5AKYA 5AK0A 2P65A 2W7PA 3EY9A 1JB9A 3EBOA 2FMTA 3P2KA 221PA 3K09A 2ZE6A 3C6MA 4UCXA 1MB3A 3ITEA 5AH0A 4PSVA 1KZ4A 4B3BA 5HBRA 1QH8B 3O8QA 4GQAA 1IQ0A 3FOZA 3H4BA 1F0PA 1QG0A 1FYWA 5ITZB 1IM5A 4XD7D 4X20B 4M8IA 3AKYA 2ZBQA 1B33N 2PG3A 2RBEA 3DHEA 2RGUA 5HF8A 2HLDA 2B37A 2IZOA 1QOQB 1GGHA 3SR0A 5JWRA 5DZSA 2QY6A 1RWBA 3PFGA 4UCUA 2FLPA 4B3CA 4WESB 4QVKA 1YIOA 1I94B 3PVCA 4AY6A 2RC6A 4ZAVA 3UZOA 2QAJA 3PDJA 2YHUA 5ALVA 2UAGA 1NOKA 4IOLA 5IKOA 1X0VA 2JIDA 1U28C 1THTA 5L1IA 5IN5A 1UNNC 4ZK6A 2C28A 1OAAA 5LM3A 3S2UA 4CXMA 2WD9A 4UXHA 1Q19A 4BMOB 4J29A 5CX1A 5TVGA 1UKBA 4HADA 3D7MA 1W4LA 2ODWA 3DTVD 2CNKA 1QG2A 4QW8A 1RQGA 5IAKA 4D0LB 1SQSA 2VK2A 2QQ0A 2XCOA 2FPGA 4RENA 4DR6B 3EDCA 1TCVA 3UM9A 1BXGA 1QYVA 4MAMA 3G68A 2QW0X 2Q2WA 3HB0A 1MA0A 3ZJYA 5EUMA 1VPTA 1UPXA 1KFEB 4YLYA 4HR7A 2C7RA 5L3RA 1EA5A 1V3TA 3WI7A 3WLQA 4J90A 4LE1A 2RGNC 3LUHA 1KI3A 2JAQA 4BVGA 4B3SH 3A6DA 2N47A 2UZ4A 4N01A 1OOEA 5DKFA 4YQYA 1Y9DA 2B69A 4H4EA 1Z4PX 2H0QA 4GAEA 1N5MA 2QXTA 5BNWA 5JXIA 4HLUC 2F6RA 1C8KA 1I2ZA 1OFUX 2Z8ZA 1QLJA 2RCYA 1MNAA 3DBRB 1QANA 3IVXA 5E9QA 1GQSA 1EAMA 1JP7A 4U63A 1TVKA 4RU9A 4WZAE 2DULA 3L7IA 3CZRA 3R0IA 5IVIA 4C2BA 3WK7A 1V8PA 3JYPA 3FVQA 4KH1A 3ZE6A 5CDGA 3CURA 5EQFA 4KH0A 2HGWA 4KXXA 3N8HA 1AJEA 2UXBH 2IV3A 3MMNA 3AMVA 4RJKA 4BC0A 3M4ZA 4LXXA 3NS7A 5F1OA 1G0NA 3TPFA 2UXDH 4HDNA 5FQOA 3SX0A 4YLEA 2CB9A 2WE7A 5K0EA 4X65B 1JBEA 1VM6A 16PKA 4WPGA 1CV2A 3AOEA 2R1ZA 1CJCA 2AEFA 4D57A 3FNHA 1DT3A 1Z8NA 2BI8A 3GTGA 2J7PA 5E7IA 1P18A 4U2DA 2Z1NA 2EEPA 1MR3F 2A1TS 3MUNA 1NE2A 3DP7A 3AKCA 3ZEIA 4IMPA 3EEBA 1E4FT 3RAGA 1ZNYA 2MINB 3HL4A 3PDCA 5D5PA 4E6NA 2CL5A 3TRKA 5G1NA 1T1GA 1NFRA 3LMKA 2JJ2D 2PMCA 5AI6A 1FLAA 2W4MA 3LC1O 1RZUA 4DV1H 2QSJA 4D3DA 1Y0BA 1VBHA 4UVHA 5DBFA 1NVVR 3IHLA 4PRLA 3ZNQA 1XQ9A 1JFTA 2EJVA 2QN2A 1P7VA 2UYGA 1ZD9A 3DWIA 2P67A 2X5NA 3WL4A 3AQ4A 2HDKA 5JS8A 2J6HA 3ZV7A 1YR6A 3H5NA 1PWXA 3LIPA 3H4DA 4MJ3A 1NFQA 3V4LA 3OO0A 1XDZA 2BMVA 4JD5A 2X4GA 1UADA 4HB0A 3K0SA 4OHVA 4Y8VA 1H0RA 4GE3A 5FCDA 1YQXA 1H2HA 1RRFA 1UT5A 1ECBA 2EFDB 1FTWA 1WCMA 3NDIA 4LSWA 3O9ZA 3RSOA 1NLUA 3PIIA 1F51E 4K9PA 1TC1A 1HG1A 2OQIA 1CF9A 2RHLA 4OHZA 1T5SA 5ITWA 3NHFA 4UXJA 2YFYA 2GK7A 3ZXIA 3DE0X 3B2QA 5A9SB 4YCLA 4XM0A 2DSNA 3TBHA 1I32A 1SBZA 1QGYA 5H81A 1OI7A 3FFAA 1PR0A 1U65A 1UODA 5HHTA 2KB0A 4KHPB 3CF0A 3KVOA 1CNEA 4L9WA 1EVEA 1AXRA 1WCIA 2HNKA 4PQEA 3TRJA 2ZSDA 5BNTA 3MC1A 4DIBA 2A4MA 2ZAMA 3QX9A 4ENSA 2H63A 4IX9A 4R0NA 1M1NB 3MG9A 5B2EA 1V41E 2JEJA 3QBVA 1SBQA 1EU1A 5B3JA 2AVNA 4R2LA 1KSFX 3OEYA 3SZ3A 4KLZA 2C78A 4FUQA 3PITA 3JPWA 4GHWA 1VLMA 1QF6A 1V2HE 1PFWA 1K5HA 3QFSA 2IYRA 2FX3A 3GVPA 3A25A 1S2GA 4D3XA 2D5LA 3EJWA 3WIBA 4WL0A 2O05A 4NCHA 4YR2A 4U2BA 5LKRA 1GPYA 4TVBA 1BFDA 3V1LA 1TLTA 2OB2A 3U39A 3B3AA 3M6FA 3NWEA 4F3NA 1MF7A 3RBZA 2R6FA 3G2IA 4J91A 2PRZA 1PX2A 3AB8A 2DPMA 5BYKA 1HTBA 3M2PA 3B6MA 4RK4A 1RAFA 1FC0A 1B3RA 3H7AA 5JCJD 2QS9A 4YP0A 3KR2A 4EHLA 1TLFA 2ZRBA 5I5GA 3KJEA 3R0XA 5HKBA 1N3BA 1M75A 5MFPA 2QTMA 3N59A 3LBYA 4MB2A 4D9BA 3BIWA 3ROQA 1DXQA 4K6GA 5KFPA 1P1RA 3MTDA 1ONSA 4BPBA 2FKLA 4DV0H 3HRHA 2YJ5A 2J4DA 5LU8A 1G8SA 3N2KA 1ZJZA 4AJLA 2UXCH 2AOUA