3V4ZA

D-alanine--d-alanine ligase from yersinia pestis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
293
Chain Sequence
AEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title D-alanine--D-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 94
structure length 293
sequence length 305
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3v4zA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3v4zA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4zA01
4M98A 1WR2A 4L1KA 5JVLA 1GSOA 3BSSA 3OUZA 2GQSA 4Y8VB 3TIGA 3E5NA 2SCUB 4J6EA 4GGMX 2R6FA 1VBHA 1KJQA 2V58A 2YYAA 3RV4A 4ZHQF 2CQYA 2R82A 3KREA 5EZYF 5JH7F 4HNUA 5CA1F 3R23A 4IHJF 2R7MA 3AW8A 2DZDA 3G8DA 4EGQA 2NU9B 4FFPA 2W71A 2J9GA 4ME6A 1BNCA 1GLVA 1I7NA 4YAJB 1EHIA 1GSAA 3VA7A 3KALA 1M0WA 4HR7A 4MV1A 1AUVA 2GQRA 4O84A 3GIDA 3K5HA 2YRXA 5CB4F 2V59A 2WYOA 3TINA 3VOTA 4HNTA 1CQJB 4DIMA 4ZQIA 2YL2A 2R7NA 4EA7A 4EG0A 2OLSA 2PVPA 4O83A 3K5IA 3JZFA 3TIIA 1CS0A 4YAKB 3BSYA 4FFMA 4O7RA 2I87A 5IYZF 3V4ZA 3BG5A 5GONF 4O7YA 3Q1KA 3RFCA 1Z2NX 4IIJF 2C00A 4FFOA 4XX0B 5LA6F 1GGOA 3VPDA 2R86A 2CNVA 1B6RA 4MV3A 2ZDGA 4YJ3F 1T36A 3TW6A 2HGSA 2W6ZA 4O7LA 5D8DA 5K2MA 4O81A 5I47A 2Z02A 2YZMA 5H80A 3WO0A 3G8CA 2R7KA 4TV8F 5LXTF 4EA9A 1VKZA 5JVDF 4MV4A 4DLKA 3AX6A 2VQDA 2W6OA 4XYMB 4O4HF 2ZDHA 4O7VA 2YWVA 2GPWA 2YZGA 4YBZB 3RV3A 1OBDA 4IZOA 3K3PA 4E4TA 2IP4A 2YZNA 3ETJA 1A9XA 1DV2A 3JRWA 1KJ8A 2FPPB 4FFNA 1KJIA 4O82A 5J2TF 1IOWA 1CQIB 3VMMA 3ORQA 4FU0A 2W70A 2R87A 2XCLA 4YJ2F 1C3OA 4MV6A 3KAKA 5KX5F 2GLTA 2YZLA 2W6NA 3HO8A 4XZ3B 5C1OA 3SE7A 4IWXA 2I8CA 4WD3A 1PX2A 2NU8B 1OBGA 1EYZA 3JRXA 2R85A 1W93A 2YW2A 4I50F 4MV7A 1W96A 1EUDB 1E4EB 2I80A 3OUUA 2VR1A 4C5AA 1UC9A 5JQWA 4O7ZA 2FPIB 4O2BF 5J2UF 3V4SA 4FGRA 4EGJA 5JQGF 5LYJF 4M9UA 1PK8A 1JKJB 4MA5A 1VBGA 2QK4A 2NU6B 5DMXA 4M99A 1A48A 2V5AA 5FNVF 4NYEA 4MAMA 1B6SA 1KUTA 2DLNA 2XD4A 3MJFA 3I12A 2X0SA 2QF7A 3ETHA 1ULZA 4EA8A 4O7SA 3BFPA 2R84A 3HB9A 1IOVA 3KAJA 2CNQA 3R5XA 1KJ9A 4O4LF 1E4EA 1EZ1A 2FPGB 4HQ6A 3WO1A 4FFLA 1SCUB 2Z04A 2P0AA 4M9CA 1EUCB 1M6VA 3N6RA 5BPHA 5CAEB 3GLKA 4XYLB 2NU7B 4QSHA 4C5BA 3R9RA 4WBNF 5BPFA 4I4TF 3UFXB 2NPOA 3HBLA 2R7LA 4TV9F 2CZGA 1KEEA 3JZIA 3U9SA 3U54A 2FB9A 3LP8A 4O7TA 4O2AF 2W6PA 4O4IF 1DV1A 3QFFA 5HBRB 1JDEA 1Z2OX 2GPSA 3RUPA 4IWYA 4EABA 5KKNB 1Z2PX 1I7LA 2DWCA 2PBZA 2W6QA 4C5CA 2YS6A 1AUXA 2CNUA 3VPCA 3NUAA 3N8DA 3BSWA 3VPBA 3U55A 3R5FA 4I55F 3Q2OA 4MV9A 2PN1A 4O7NA 4O7WA 1KJJA 1GSHA 3U9TA 1JDBB 4ZOLF 3DF7A 4FFRA 4RZQA 4TUYF 3ORRA 2ZDQA 2YS7A 5BMVF 5LOVF 4HNVA 3MWDA 1BXRA 1KBLA 1CE8A 4EAAA 2FP4B 4MA0A 5LP6F 2W6MA 4MV8A 4ZI7F 1C30A 2YRWA 5HV6A 2VPQA 4YB8B 5CA0F 3TQTA 2NUAB 4O4JF 1DIKA 1JLLB 1M0TA 5C1PA 2DIKA 5C8YF 3MWEA 4FE2A 1UC8A 2HJWA 4O86A 3WNZA 2VHEA 1KC7A 3LWBA 3R5HA
chains in the Genus database with same CATH superfamily
5FWAA 2MHCA 3JD2A 2OCPA 1NX9A 5KT6A 4BRSA 2WD9A 1C0KA 5DN6D 3KEGA 1G8KA 2XNHA 4NMMA 2Q8NA 3NHBA 1XP8A 3PFNA 2R6FA 3BQNB 3UZUA 5EIEA 3M2PA 1Q5PA 2VAWA 2REXB 221PA 5ICFA 1AHHA 4MDFA 4JHLA 3D2AA 1EM8B 2PUHA 2JGNA 1BOOA 4US2R 3BACA 4D8UA 4RDXA 3V4FA 1Z37A 1VHJA 2YNMC 4J1TA 3T3GA 2W7TA 1DAPA 2I1QA 3DYIA 4Z7JA 4CEHA 2NUPB 5KT2A 4HN9A 4EHHA 3EXEB 4AKIA 3UVEA 3ZY5A 5HJ7A 1IBCA 2XWJI 4O4HA 3HR4A 2G83A 1JG7A 1J00A 1XAJA 2HQSA 3G5MA 4NWIA 5DGBA 3NAMA 4UHKA 1EGAA 3CPJB 2WTXA 4B3DA 1J8YF 2ZYSA 4N7JA 4Q16A 2CVOA 3LCJA 3DJYA 1VCNA 3GAZA 1J2JA 1I3MA 3QEMB 5C18A 4QRHA 4AN4A 3KYJB 4YDRA 2PK3A 1KEVA 4PLZA 1WHSA 1E8NA 2C4NA 4CI0B 3P9XA 4KNYA 3G0GA 5LQKA 4CG2A 1RKVA 1JHRA 4MS1B 2ONJA 4QVKA 4DLKA 3WGGA 5JVDB 2DUJA 3EX7C 1FP7A 4XIIA 2WU1A 4WGFA 2HO4A 4HRYA 2MSDB 2I91A 1JYEA 1KJ8A 4LDNA 1AX9A 3E2PA 3E7DA 1ABBA 3WV4A 4A92A 1T10A 4C29A 1M1NA 2XB2A 4Z4QA 3UJ6A 2HJVA 4PX2A 1NF3A 4FD2A 4XVHA 1LK7A 3RSFA 3BBLA 4DUGA 3SKXA 1VMIA 5EIXA 1PQWA 4QREA 1YHNA 3ZNQA 3UXMA 1OLUA 2P9QA 1I3KA 3TRDA 1N0WA 4RZRA 4ZVNA 2FSVC 4WN9A 1H8HA 4OKNA 2COEA 1ORRA 3UWDA 3OT1A 1YQDA 4J0KA 1H2EA 4G07A 1K3TA 1MJNA 1T13A 5A03A 4EBCA 3AF1A 1PJLA 2O7NA 1W5SA 2IP1A 4B80A 2JLAA 2P30A 4L6IA 3TNFA 3N8HA 2CXUA 4BPBA 2VNSA 1KDZA 3KXKA 4PGGA 5F77A 1XFAA 3KZOA 1Y1PA 3TUZC 1IXRC 2VDOB 1L8QA 2BZGA 5KFNA 2CL6X 5INTA 2O1WA 2JD1A 3SYKA 5IAAA 2FPMA 2AC4A 4DCVA 2V9ZA 1I33A 4WOCA 4JY7A 2GRUA 3CXRA 5A71A 3ID6C 4H31A 3ZQ6A 4JLAA 4J9SA 2KQUA 5EGNA 2A3NA 4LF6B 1MENA 3SR3A 1FL9A 4XW2A 3FX2A 1T35A 5C34B 4HATA 4EW2A 2CLOB 3TUIC 5JAZA 4H9GA 2G40A 2IXBA 2J3HA 4LZLA 1V35A 2Q62A 4WZ6A 2VSXA 2BFBA 3NJRA 1W94A 4KR3A 7YASA 2WTMA 3QY0A 2XAUA 4QGAA 2BH2A 1Q2UA 3IODA 2QRPA 1EB9A 1OI2A 1OTHA 3LPNA 1FMJA 3UWOA 3T5LA 4LRWA 1P18A 1SKYB 2QAGC 3OF3A 4YJGB 3H2YA 1RADA 4J7AA 1ZK3A 2RGXA 2R00A 5FIUA 3TDKA 1NVAA 4MO2A 2HWYA 3KPJA 3QOXA 1GZSA 4JQOA 4V39A 4NPCA 4FC7A 4LJAA 1Z6AA 1II8B 2WVHA 3RYIB 4FOOA 2RKWA 2ZBUA 4RNDB 1D6NA 4EPXA 4DA0A 3SGIA 2PBFA 2I7TA 5MHTA 1WXIA 3RKSA 2OV1A 1VLZA 4OLFA 1QZZA 4EM6A 1R8QA 3IE2A 3IVXA 1E6CA 2NACA 2I4OA 2PMWB 2QY6A 3OCZA 3RV4A 1ZM2A 4PHHA 1Z4KA 3JATB 5KOHA 3ODPA 3V4OA 4AKHA 4IY1A 1ODIA 5K3DA 5CXQA 3ASVA 1R5BA 1STOA 4NNPA 2AB0A 2OR3A 4CL8A 3E4DA 2DUNA 3U1VA 1HM5A 3WWDA 4HR7A 2VIIA 4NVRA 1YZFA 2VWPA 2B2CA 4FQ5A 2P2DA 4LJLA 4IO1A 3LXRA 3GLVA 1KTVA 3JQGA 2ORVA 2WPDA 4DJEC 4YJFA 2H3HA 2WAQE 2OMEA 5SZHB 2HYDA 3MD9A 3RSHA 1CS0A 4YAKB 3TLZA 3GVXA 2WJJA 4G1BA 1Z4LA 2OD7A 5A4KA 1PJ3A 1QOZA 3C6MA 2QRZA 4RVCA 3JZDA 2VHTA 1YS7A 4PAQA 4P7FA 3MOIA 3I6MA 2EQBA 3KKKA 4RDIA 4ZGWA 3FCAA 4PHGA 1R6VA 4D8WA 2ECFA 1UXHA 3OU6A 1A2QA 1DJOA 2PSDA 2XKBA 5AW8A 3ZHQA 3QSGA 3P45A 4LMPA 4BLUA 2Y2VA 1AT1A 3NAQA 4BCBA 4WHMA 1I94H 2BFDA 1TO1E 2W6OA 2QD4A 5ARBA 3Q3VA 4HLUC 1RQ7A 2GPWA 3AY3A 2YWFA 3LRTA 2QYHA 3C8HA 1J9ZA 1Z3IX 2SKCA 3S68A 5LMNH 1V4YA 1FVXA 3T8YA 4PYMA 4BQPA 2UVWA 4Z9YA 4Q1DA 3HKBB 1YUBA 4BNYA 5E6RB 5KX5B 3C8UA 1PNOA 3I30X 4HJRA 3NBFA 4CKBB 1ODJA 1ECPA 3O73A 5BQFA 2ATXA 4GX0A 4UXHA 1EUDB 5BN4B 3CVVA 2GGSA 4WMLA 4YRPA 4Q4JA 2YJNA 1XTIA 2ZBDA 3PXAA 2P6PA 2WFLA 4QUHA 2HDKA 5JQWA 2V6BA 1RYYA 4X3CA 2R6JA 2P9GA 1CZRA 2I4TA 1FXSA 1DJNA 2XOXA 1G66A 4ONEA 1ODTC 3VGJA 4ESEA 2QW1A 1SXQA 3LNTA 3QVGA 4L8YA 1KC3A 1ZIOA 4YX9A 4I3HA 4XQCA 2JBHA 1JB1A 4KR9A 1PEDA 4JOCA 1BN7A 3FTEA 1U4SA 2FUG1 1TM1E 4XWWA 2X0RA 3LKDA 3GEHA 4R68A 2OYSA 4MYSA 4J8PA 2NZJA 3SZOA 1OSNA 2V7PA 3CBQA 3CG4A 4TSFA 2Q8QA 1O6FA 1AGYA 4D8YA 3MUEA 4BQNA 2I5PO 4QIWA 3H2IA 4TV9B 1CUDA 1FQOA 1RXCA 3Q41A 3D6TB 5J5VA 4HZIA 2YWBA 4QOHA 2YXPX 2FR0A 2OCDA 3HCWA 3AUKA 1M0EA 1KZ1A 3U3KA 3MOSA 1U9ZA 2WJIA 1T5IA 4QULA 2WK1A 3RAEC 1TQ4A 1OWOA 3RC3A 4CIVA 3HBFA 4LSGA 1P8LA 1SD2A 2RKOA 1PSZA 1Y1RA 2GPBA 3GLUA 1FUUA 1V8PA 2AG8A 4YP6A 1T6NA 1U8TA 2XLCA 1CE8A 2QMUA 2PE5A 4EYSA 3ETGA 2NSYA 2B34A 4O3FA 1ZOPA 3TDNA 3OPNA 3PQFA 4O4JF 1OWMA 2C94A 3EODA 4W5WA 4YHBA 4DGQA 1X87A 2AXNA 2IH4A 3SBEA 1PV4A 5TRTA 3HV0A 3JARB 5F4ZA 5B7GA 1UFQA 1XCLA 4CHTA 2ZZKA 4G1VA 5AKGA 1L4YA 3VR3D 2B1IA 4MQ6A 3ZTYA 4H6PA 3LHDA 1E1QD 1MVLA 1XD8A 3IP7A 5AXDA 1EK0A 4CIYA 2ZWVA 2IUSA 2R8GA 5EZYF 4FI3C 2O52A 2FSIA 4Q37A 2YWEA 3AEYA 3TOSA 2BOVA 2OZLA 3KWMA 4C4YA 2QM7A 4BJHB 1KZ7B 4KOEC 1V1RA 3W2IA 3GW8A 4PSCA 4LK3A 2DT8A 2I1WA 4GQIA 4B2YA 5JAOA 5TEWA 5LNK6 2RJOA 3IDZA 2ZM6H 3BDAA 3D2CA 4ANFA 5FBLB 2ODTX 1B0PA 3R9XA 4ZKEA 1I94B 3F98A 5IYCG 2JCVA 1D2GA 4WUTA 1KC1A 4J16C 1HYEA 2I87A 3VXKA 4CU2A 4NBUA 3K6JA 3T3EA 1XOIA 5CPBA 1G3MA 2ZIFA 3FN4A 1FC0A 2O8CA 2ZIXA 4LH7A 5LMNB 1T36A 3OCYA 4PZEA 2WHPA 4HJXA 3LQRA 3WDKA 3B3AA 4HGYA 5AW3A 1TF7A 2XGSA 2VT6A 3TJZA 5JCJA 2M1XA 5KFBA 1T5OA 3GTKA 4CC6A 1T2DA 2Q21A 2ROQA 4GR5A 3JQ9C 1CJKC 4RK0A 4X1YB 5B5SA 2Y0CA 1M8JA 4HDRA 3K3PA 5KYXA 4BBZA 4JELA 2BEWA 3OSZA 2IMWP 1EXVA 2HC9A 2AZXA 1ZX1A 5I01A 2UXDH 1I6KA 1LVUA 3G3EA 3VX3A 4Y2HA 4HGPA 4DF3A 2ZWPA 4CF5A 3FWZA 3A28A 2P9EA 1TWHA 1G2OA 1HC7A 3EDCA 2EFYA 3KKMA 3IHTA 4IOJA 1VMDA 2OECA 4AMYA 1KMIY 2XDQB 4Y67A 3CONA 2PZAA 3D8HA 3P9QA 1P9NA 1P1IA 4ZTUB 1VGQA 2C57A 2CYCA 2O2XA 1JXOA 4RTLA 1P1FA 5GV8A 4AIIA 2FXVA 1QQBA 1XWIA 2QAJA 1Y37A 4XVQA 3NEAA 3GJXB 2OFOA 4OREX 4YNBA 5B4VA 1SOUA 2A0WA 1W25A 4RPKA 3GRAA 3UENA 5B6IA 3EIWA 1RM3A 1NW8A 1IPHA 3PFIA 3O4HA 4LQCA 1YQXA 4RIIA 2OCYC 2VTBA 1N1DA 1WSBA 2ZYGA 3GYGA 4JT8A 3JQAB 2FMHA 3D4NA 3HWSA 1U1CA 3UHFA 2QU8A 2WF5A 3PD1A 3VNAA 2Y0PA 4P80A 5ILQA 2A30A 1DNPA 4ZCPA 1OQAA 4DIUA 3NASA 3DWFA 4CTOA 1R3DA 4U7GA 2XNSA 4ZIRA 1PW7A 1P7YA 4RU1A 1IDN1 3GJSA 2AFIB 4PWZA 2BI7A 4F3TA 1FX0B 1DC8A 4L0CA 3TNJA 5JASA 2JFUA 3Q85A 3GB8B 2UUAH 3PQCA 1L3IA 2H4WA 2PG3A 5F9NA 4KIFA 1CKEA 1QC5B 4TKMA 4DOMA 2OG1A 2XMBA 2I71A 3MJEA 3LX6A 5TARA 3VR1A 1SPXA 4R31A 3N8DA 1GZVA 4YLYA 1A5SB 4EL0A 3IV9A 4AY2A 5E7IA 4B2PA 1B1AA 4BTVA 4W1RA 2NO9A 2MINB 5KKAA 4FZ5A 4UHCA 2YQ5A 1LF0A 4YHHH 3SFTA 2IEBA 3OI7A 5TQVA 4L95C 3CIFA 4J0JA 3GJTA 1RWBA 3CLHA 2GYYA 4BQFA 3ESXA 5CB0A 4QXMA 1AQLA 2D8MA 3GB9A 1ZXXA 4U9HS 5K8UA 3B12A 2MSLA 4KHPH 3HA3A 3G68A 4MCAA 2FPRA 4TOIA 5DLDA 1CJUC 5K6TA 2UZ4A 2CXNA 2QVCA 5AJTA 3QBDA 3IBYA 1J5PA 3OZFA 3H13A 3FVQA 9MHTA 4ZVUA 3W8NA 3NBZB 1XXHB 4F6RA 1J20A 2ZM6B 1QG0A 4DIFA 3E3AA 4H59A 3IP3A 3K2IA 2BQRA 4ID9A 1ZUD1 4KDFA 4WWHA 3NWJA 2JFGA 5CYPA 1PDVA 1G8AA 3GRKA 4EHLA 4XVUA 5JSHA 5C8DA 1XEFA 4HPWA 5C7IO 2ZRBA 4LE2A 3R4VA 2XCUA 5CJ2A 2HHAA 1CUXA 4P83A 2R8OA 4RTRA 1VJ1A 1XAIA 3QYAA 1UPUA 3KQYA 2X3FA 4PPNA 4DLNA 4MHOA 2W90A 4DUPA 5IKMA 3EVBA 4UAJA 5KAMA 3E1KA 1SUIA 2YYZA 1U0LA 5EZ6B 3IN5A 1IFXA 2H11A 5IYZB 4OMFG 1DTWB 1FYVA 4E5MA 1BVHA 4PO3X 2RHBA 4BCCA 4NCBA 2UXDB 1WXEA 1ZKMA 2VNAA 1RJ9B 3OKCA 5B1YA 4J2HA 2PXXA 4MVJI 3DDOA 3OT4A 4D6PA 3AT1A 4D9HA 2CW5A 1NURA 2GRJA 4MHSA 4GW3A 4KP7A 1ETHA 3GZJA 1NSFA 3D81A 1XK6A 3HFGA 3HJFA 4JBHA 2IYAA 3U4CA 3I39X 2FMUA 3D64A 2AKAB 1O03A 2PO7A 1FFSA 1E0SA 1B1CA 4FE7A 5JANA 5KFPA 3F5FA 3C5HA 5BSHA 4QDZA 1E6EA 3FCOA 4UASA 3AETB 3L8ZA 3MPUA 1L5LA 4B71A 1JHVA 1M6WA 3GV0A 2RHOA 3PNMA 2CNWD 4OI4A 4KODA 4NAHA 2PV0A 4IWXA 5TQ2B 4EI7A 1DOZA 1M8PA 5A9TA 1HE1C 3R5KA 4LZPA 1GO2A 4QWMA 1IY9A 5DGIA 1LWOA 5B4UA 3EY9A 1Y81A 3OD1A 2OB1A 3OUUA 3E7FA 2REQB 1MB4A 3DTGA 4FYJA 3U4MA 1EKVA 3RO7A 4KU4A 1NJ8A 4PE5B 4EKGA 1YKFA 2LKCA 4FHZA 1MQAA 4LY6A 4M9RA 2IV3A 5IK2D 4MRNA 5A5EA 5B12A 4EW3A 3SD7A 4R83A 2PIAA 1I3OA 3WLFA 1NFRA 4JGBA 4S0XA 1ULZA 3D5EA 4QFDA 3TD9A 2UUAB 3FRJA 3EAGA 3N8IA 3ZWCA 1GUBA 3QFTA 2I0FA 2QORA 3E9RA 3OJLA 4M87A 5HQTA 2C97A 4DEXA 1JPUA 3RBAA 3TI9A 4K1XA 5BWNA 4R8SA 2QRNA 3W8EA 1Q77A 3ECSA 2W98A 5M5BA 3I73A 2FLKA 4IZIA 3BA8A 1H5QA 5DHUA 1LS1A 4DN6A 4CPDA 4LVOA 3DHNA 3O93A 4C3ZA 4YHHB 4CMBA 3UAVA 4PPQA 3PQ2A 1P74A 5EUMA 3WVNA 3KYCB 5ALKA 2JK1A 2XUPA 1KPGA 3GEEA 3AJ9A 3ONWA 3F74A 5L3SB 4GZ3A 1WR8A 5L9AA 4KHPB 4OXKA 2W4QA 4EH1A 2DPGA 2EJVA 4I4TA 2A35A 1Q0RA 1YZGA 2OK7A 2I7CA 2XCAA 3OTWA 2VPQA 4CR6A 4D6YA 2E1RA 1P29A 4MS4A 1ZHHA 3H0GA 2WM2A 4IIGA 3S4YA 1YJ5A 4YC7A 2V5VA 2C4KA 1N2EA 4OHBA 1KVSA 1U3UA 2KW5A 4BDTA 3ESZA 3ZEIA 5KC8A 1FTQA 3JV7A 4HQFA 2ZB8A 3DPSA 2PL9A 2D0OB 1ZGJA 4RC9A 4ZCTA 1U1FA 1JX6A 3RS5A 1KO4A 1B3BA 1TJPB 1VFNA 1PNVA 2ACVA 1Z33A 3TZEA 2J3IA 8ADHA 2PZFA 4D3ZA 2HG8A 1E3EA 3K5PA 2OXTA 4EFBA 3X43A 3WAGA 1I8TA 3RG2A 3MR2A 2ZS9A 1DJMA 3U48A 3MFHA 1DIRA 3GGCA 4IH1A 4HRXA 4B87A 4XSGA 4NYIQ 2F9MA 3DR3A 3KQTA 1V8OA 2PRYA 3A4MA 1T9ZA 5AKKA 1ZI6A 3NOXA 4MVJH 3ZE2B 4DBZA 3WP0A 3GJQA 4IJ5A 2OHJA 1KI2A 3WHKA 5I60A 3LP6A 1VL8A 1M10A 3C3BA 1FDVA 1NN3A 3HG7A 5IASA 2F3TA 2WMNB 5IMSA 1GO3E 4JXKA 4LY3A 1VYVA 5T64A 4BJ6A 1TUEA 4DV6H 3IQDB 2QM3A 1R88A 1QB8A 3T5CA 1J5EH 3NWEA 3H9BA 5JS7A 4A2QA 4FEEA 2PUEA 2VDMB 3VSEA 1M1YA 1JPNA 1Q1NA 2PZJA 4EGAA 1JS1X 5FYQA 5A3SA 4F9EA 2JEYA 1RQGA 3BDVA 2WG0A 4M0UA 4GC6A 2EIXA 4PO1A 2XWPA 1V25A 5ILOA 2AQ4A 3X2EA 1GTRA 4DDUA 4JJ7A 4RAYA 1N36H 2AN5A 5IJ9A 2D3WA 2GARA 2WWTA 1CEYA 3UBTA 5IKOA 5JZOA 1BQ4A 5LQCA 4D26A 1H94A 3NV7A 3BOSA 3Q7TA 4C88A 4RXUA 2PCLA 5CFZA 1QYWA 3F97A 1W29A 2CYAA 5JT1A 5IT4A 4F4CA 1FNSA 3F8TA 1W88B 1S02A 4S1NA 4OCZA 3EZ9A 4FWBA 3VVBA 2DR3A 2KLBA 3JWPA 3CVUA 1DZIA 2PPLA 4EEXA 4F04A 4OSOA 5TE9A 5C5JA 1GPLA 1PFYA 4AX4A 1S3GA 1YD7A 1R5NA 4IBOA 5M7EA 4EJ6A 1BS9A 4LF8H 2O54A 3ZBUA 1G6HA 3D2BA 4HT3B 3A6LA 1P2TA 3H87A 1OUMA 1WW2A 2QRVB 1NFFA 2HB6A 2CKMA 2AIRA 5LC1A 1OYWA 4GLFA 2VJBA 3QH4A 2RK4A 3LH5A 3D6NB 2JVKA 3QBVA 4EKNB 3DEHA 4J1NA 2MSCB 2HDOA 2F1KA 1GQQA 4U2KA 1TKBA 3KKEA 1IUPA 3DTFA 3GRYA 3HKZA 2OHIA 1BD3A 2WDZA 1WOMA 1XMQH 3GBPA 4UEOA 5A5FA 1YZUA 5DNAA 3OTGA 1KTAA 2XEDA 1TOAA 3ABZA 4H2DA 1P0FA 2J0UB 4DYHA 2Q5JA 2F6RA 3AVTA 5FWYA 4RYLA 2F1OA 1OWPA 4BFZA 1KT8A 4AJJA 4B3BA 3VU3A 5AESA 2IYSA 3PPVA 4MR8A 4AJKA 4R1PA 3UJNA 4DR3H 3OZUA 4JFAA 3LZ6A 1NVXQ 4A2PA 5A0VA 5LU9A 3ZHOA 1M2EA 4PNZA 1GGEA 5FFMA 1FRQA 4HUJA 3ZBTA 1C80A 2ZXUA 2POCA 1NLUA 3PU6A 5AW5A 1ZCFA 3UFXA 2F8TA 4TZTA 3ZS9A 5AOCA 1QP0A 3K1AB 5C4XG 3AWIA 1T2AA 3AEZA 2B37A 1NW7A 1XPOA 5FOXA 4KXWA 4YCSA 2GBFA 1ZDMA 5C8YF 3CZPA 3FRHA 5HF5A 2J41A 1ZN7A 2LCQA 4QGBA 2HV9A 1Z3CA 1EVZA 1V4VA 1YIAA 1KYVA 5EIOA 1XTVA 3WLKX 4O0LA 3PHLA 1YB4A 4YACA 5T4FA 4MB0A 4GGMX 2AD5A 1ODCA 3PZRA 2H4FA 2O8NA 4MI3A 3B60A 3IRVA 4EPTA 5DN9A 3AGQA 1D2EA 3VR4H 4Z4GA 3FDZA 4DV6B 5BYBA 4I8DA 2Y6VA 2AR0A 1J5EB 1GEGA 2EP5A 4AX8A 1FTSA 1GADO 3QPCA 1H93A 1AZWA 3SHVA 3VYRB 2J67A 4QWAA 3J7TA 3B1KA 1JAIA 3NCTA 2DUUA 3JQBC 5TSDA 1CQJB 4XJVA 1SO8A 2ZJOA 4I6GA 1NP7A 4TL7A 3W1GA 5ITZB 1CZNA 1WXDA 3C74A 1OOEA 5IANA 4DRXA 1SCKA 3TQSA 4K6GA 2I54A 1B73A 2Q3DA 5TLSA 3ZU2A 1GCAA 2GD2A 1N36B 2IE8A 3ZW9A 3ADBA 4B84A 1SVNA 3SLGA 1E2BA 3IT2A 2IEGA 2J87A 1LNZA 1R8YA 4A16A 3TLGA 3GTGA 3GELA 5DAAA 4MPPA 3OZSA 3WA6A 5KTMA 4YRIA 3M6XA 1C3OB 4BQOA 5ES3A 2O9JA 2M6LA 5TJHA 1H85A 2JLZA 2DB3A 4DPMA 1X7DA 1U28A 1VC2A 2GD1O 3B7PA 3VZSA 3MRSA 5F7OA 4POOA 3TWOA 2EG9A 1OC4A 5C5DA 1G63A 3NH9A 4CMKA 1L5VA 4M36A 3N05A 5D1OA 3FTCA 4UEWA 5DOVA 1ZRSA 3DDUA 4JA2A 2JIZA 4LF8B 3FFAA 3E0QA 1QZUA 2PMZA 1FP4A 1D4ZA 2BBSA 2VHYA 3Q7EA 3CVWA 2ZBFA 3LPAA 1PR3A 5EIFA 1OB2A 3DV2A 1QYIA 4Q34A 1Z4QA 3TIFA 2A7QA 4WD3A 3V6LA 3CIOA 2XZPA 5PGMA 4PZYA 3ZE1B 5L8VA 3K16A 3N9IA 1GTJ1 3OG9A 2WKWA 1MGPA 4JI0H 4K40A 3B8HA 1LXCA 4B82A 1OLOA 3OLZA 4MVXA 4I50B 1A82A 2C5EA 1RJRA 4R2KA 1XMQB 2XGMA 3M49A 4LBWA 1WD5A 1NYRA 2QKYA 2NX2A 5FF9A 4V3BA 3U3DA 4ZYUA 1E96A 2CFMA 2HKIA 2EX0A 3IUJA 3UT0A 4WCFA 2C2MA 1DBVO 4DR3B 3C48A 1C9MA 1BCSA 4EMSA 1Z4IA 1CUIA 3Q10A 1RPZA 2NQ2C 2UAGA 5JNVA 3WK8A 4F92B 2R1TA 3WDSA 4IRMA 3FYUA 2O59A 1AN7A 3MT8A 2J0VA 3THOA 1B43A 1SCQA 3ZDEA 1NTRA 1ZGCA 1AXRA 2YQZA 4TT8A 3EEYA 4JMLA 3H8WA 2OBFA 1SG6A 3PYXA 2IV7A 3FR8A 4IMPA 5ITVA 1F4LA 1UBHS 1UKBA 4O2AB 5KSZA 1RMTA 2OK8A 3LBNA 1A0IA 3DWEX 3D5QA 2UYOA 4E5DA 4TRRA 5H1YA 4DCCA 4X6YA 5FBWB 1JHZA 4CV3A 4AURA 1VLMA 5AW7A 1KAQA 1MR3F 1CR1A 3ZEAA 7REQA 1AN0A 4QNRA 5J23A 2ZVDA 3OZGA 1MRNA 2D54A 3IHKA 1RWXA 4R1NA 1OH5A 4MKHA 1ZWKA 1QIEA 1JTVA 1PP4A 3ISTA 4B7UA 3NNNA 1VYHA 2WE7A 2P2NA 3MYRA 4EVQA 3L8EA 1R27A 2CXSA 4N5HX 5JFTA 3DMYA 1NXOA 4UAUA 4EAQA 3RS4A 3R5HA 3U6BA 4LDJA 2DSNA 3OUZA 4HMPA 4JBGA 3TX6A 1GM5A 1KZ4A 2GN2A 3I05A 2ZP1A 4RZIA 1ZR2A 1FXWA 4RLQA 3ZZNA 2CFCA 4BLPA 4KR0A 1ADBA 1WBJB 5DWVA 4KN5A 1E1LA 4WV3A 2HXYA 4D3SA 1WKVA 1Z8FA 4MZDA 1JW9B 4XXHA 5E8JA 1LS6A 5ALXA 5CIWA 4GI7A 1AQJA 4GDFA 1KO8A 3IAM1 2DAAA 3HGQA 4E12A 2J0SA 5T67A 5JDCA 5JD3A 1IJKA 1EHIA 1ITZA 2FE1A 3BWMA 2DERA 3OT5A 4IP0A 1FE8A 5I9SA 2MYTA 1RWNA 3PQ5A 3OTOH 4YEDA 1NPDA 2QLTA 3PSAA 4S12A 4R2MA 3D3WA 3HWX1 4LRTB 1UDCA 2J9FA 2AFHE 3ETNA 1E4FT 4BCDA 1TTQB 2YWCA 1JFRA 5CU7A 3A9TA 1S2DA 2ENWA 1VL5A 1ISJA 2RD2A 1PR1A 4X7PA 4IDHA 1UP6A 2AE2A 3G9QA 3I2YX 1V4NA 3EUFA 2NXEA 1CKNB 4WLEA 2FX3A 1E3IA 4PPYA 4FX5A 1SHLA 5KYYB 3ORHA 7AT1A 2DWQA 3EVFA 1I0LA 2H1HA 3PXEA 4IINA 2XNKA 4OEHA 2MYNA 3K9BA 3RTDA 4D80A 4IIBA 5AKHA 4QO7A 1TT5A 1C2YA 3GLFA 3FTQA 4LHSA 4LGMA 3PI6A 4D46A 3UMGA 2ZKLA 4U2FA 4JI0B 1H65A 3K0EA 2H4JA 3SLKA 3VC7A 1Z6QA 1RC0A 4ND7A 4CJXA 1F2UB 5EIAA 4QG7A 5EHZA 2EKQA 5TDHA 3ANTA 2QD3A 3NLLA 4A3IG 4X1IB 3DXXA 5DP1A 4D98A 1DGSA 2OQRA 2PXCA 1ZL0A 1W0JD 1MORA 3P2OA 2R93A 2Q9CA 5LLDA 3PVSA 5C1OA 4CCSA 1RI2A 4CLDA 1FMFA 4DILA 4NQRA 1M34B 2PWZA 5E9WA 5IWCA 5H5JA 4Y7DA 4G86A 4LOAA 3W8FA 2PKXA 1F8FA 1T3NA 1C3LA 4D41A 2A88A 3FBGA 3DJFA 5KJ6A 3D6HA 5FTWA 3LXUX 4YMGA 2M98A 2X14A 4LF6H 4DY6A 1F4PA 5ALPA 1XEAA 1VMEA 3FYCA 4JFRA 4ER5A 3U37A 3ROZA 3KKZA 4DZTA 1WNTA 2CMDA 3S8YA 1FW8A 4YJ2A 4EYEA 5EWLA 3GXOA 3T9BA 5FJIA 2HEIA 4K03A 3IDQA 2VP6A 4REMA 4DV3H 4UD2A 1XKTA 2Y0SA 3L6UA 2PZ8A 4BNVA 1F1BA 3D8SA 4L3VA 4H7JA 1A9TA 4YRDA 3EDRA 4O2RA 1JU3A 3TQHA 5E3JA 3LDHA 3AF6A 3TRIA 1XTQA 1FNBA 3INRA 3N44B 2PLFA 3I4NG 3KB8A 1JLMA 1N5KA 2JEOA 1YL7A 1CRZA 3M9MB 2C9YA 4XX1A 2NTNA 1TTPB 1NIJA 2YHIB 4JODA 4FNOA 2VYQA 2V98A 3A05A 4O7TA 1U7UA 2QUZA 5FTMA 3WL7A 1TM4E 4ECTA 4ZCMA 1WIWA 2ZTUA 3N2GA 1EDEA 2MR5A 2FWIA 4DARA 2Z5FA 3ZE0B 5JYEA 4CQMD 4JSYA 4IXMA 3QU4A 3EGWA 3LOQA 3LZDA 1JIKA 2UV8A 1N5RA 2RGRA 4NU0A 4DR2H 1NIPA 2ATVA 1Y9EA 2QVBA 5GTDA 3ZD7A 4ZOLB 4X85A 5LZ7A 3AYZB 4ZV4A 3GJ4A 2XOEA 1YZYA 5ICEA 4A2AA 5EJMA 5DJ5A 2XXAB 3BFVA 1OXTA 3AVOA 4JXJA 1PKXA 5BQXA 2JLSA 5C8ZA 3MS4A 4C76A 3RF6A 4I1YA 3D6UA 4ZT2A 1SOVA 3TI7A 5A3JA 4I99A 1UT8A 5JBIA 1Y1VG 4YRZA 3K53A 4AG6A 4AUNA 3B85A 3SI7A 3LA6A 2YIMA 3WRWA 3PQ4A 3OTOB 1OH7A 1QVZA 3KOXA 1U65A 1Z4PX 2W6IA 1LSSA 3OQBA 2J6TA 3FETA 2P2LA 2XJ4A 4DEVA 3T7JA 5KJFA 4IHJF 4L15A 4F9GA 2IITA 3K94A 1VPEA 1A96A 4K2AA 4XLZA 1NSTA 3KFXA 1CY2A 4Z0PA 4LSMA 1VFPA 4BL5A 3HZZA 1FCJA 1UXKA 1PJTA 3BXXA 3T0GA 3DE0X 1ODFA 1TC1A 3CCBA 1JBEA 1JQEA 2ACEA 4Y1FA 1UNNC 4WE3A 4R7GA 3WJ7A 3MUNA 3LKZA 1ZD1A 3CQZA 3TY9A 4C6TA 4WY8A 1X7YA 2JEZA 4XFKA 1S10A 1DWPA 5KYKA 2UZ3A 1RLOA 5ESXA 4ARZB 4LIPD 4I9GA 5K7SA 3GQBB 2D13A 1AHPA 4XQEA 2ZFUA 3EVEA 1UADA 5IVHA 4ZMBA 4MVCA 4MRRA 1Z2CA 4AVYA 4YWHA 1IRXA 1U2DA 4PR0A 4FNMA 1KQ3A 4Y2UA 3HYNA 2EJ3A 1GDTA 3LS2A 3LYLA 4B7ZA 3I2KA 5DYIA 4L16A 1BFDA 2GF9A 1G1MA 2AYYA 4IFBA 1BVRA 2WD7A 1WS6A 4RGYA 2VYND 1WKCA 5DCUA 3EZXA 3QNMA 3GZNA 2XB8A 2IY9A 3AIKA 1KORA 4E4TA 4YJDA 3EAQA 3GLRA 4R3UC 2BEVA 1Y8CA 4MKFA 1ENYA 2GEVA 2CL7X 1CFJA 3P0RA 3HYCA 1QVAA 4OM8A 4Y6RA 3O83A 3ROKA 1Y9DA 2FRXA 2X5XA 4B3RB 3NAZA 3RIHA 4DV3B 1C3XA 3HSSA 3EQZA 1CJVC 1PK9A 4BP9A 1E79D 1T1GA 3MYYA 2HJRA 1X0XA 4CDGA 2JJ2A 1DIOB 5DCLA 3T3PB 4GNKA 4P34A 3KOYA 3A6JA 3ADDA 4UCTA 3FUWA 3A14A 1Z0FA 1DC4A 1C29B 2P4HX 1P4AA 4V03A 3WKCA 2IXDA 1BOFA 3E9QA 3IJPA 3BD6A 3HFJA 5DGXA 1JR3D 2WYVA 4RJLA 1DVRA 4JB2A 4AYBE 3ZTTA 3EGXB 4FUTA 3X1WA 2WZBA 1Z08A 1REQB 2VK4A 4FIZA 2XD9A 3JW8A 4QLBA 4BLOA 4PZCA 3RM3A 3HR8A 4BP1A 3DQQA 3GK3A 1JQJC 1NY6A 1UC5B 1HFKA 3F4KA 5LVAA 4PTLA 4FFSA 4KAXA 1ZVVA 3DXYA 3I01A 4BBJA 3AG6A 2JIBA 4KVFA 3IUEA 3ZU3A 5IUJC 3REOA 4DR2B 4L9SA 4X41A 2PTGA 4MQBA 2J1LA 1KEEA 1VG0B 3LSTA 4XVCA 1N2OA 1JTEA 1JI3A 5YASA 1QU2A 2IS6A 3DMTA 4F3YA 3ZVMA 3ROGA 4ACAA 1RKBA 5FFFA 3G85A 3G2KA 3J80A 5D00A 2J7PD 4ZYWA 1MXFA 1JEYA 1MKYA 3P2EA 4MNTA 1W0KD 3EARA 3AH8A 3TEKA 4EKYA 3K8YA 1KSGA 2C0CA 4WK6A 4QUIA 1KZ6A 1ZJZA 1TF2A 3FYSA 4MR7A 4I5IA 4TT3A 5TQJA 3NC0C 1GZ3A 3Q1LA 3M82A 4UOZA 5CA0F 3QVVA 1YZHA 2FW9A 1KMQA 1LPPA 2X4DA 1L7XA 1PNQA 3UUGA 1A4XA 4FLEA 4ZYLA 3A6ZA 3IUPA 1N4AA 3CH7A 3OIVA 5A06A 3W6ZA 4CTMA 2R9VA 1KEKA 4U9IS 1SRRA 4UATA 4BAUA 4MGZR 2XE7A 2W8LA 1SHJA 5DNCA 4G5OA 4RCVA 4AJEA 1OAKA 4TX1A 1DIGA 3BE4A 3NVAA 2WINI 3R23A 4XGIA 1V7CA 2CHEA 3JPWA 1VBFA 3LK6A 4ME6A 1Z5OA 4WOPA 4DPKA 2GK3A 1EEXB 4HTFB 2QRLA 4REQA 2Y99A 5DTEA 4CZ2A 3DFMA 2ORIA 4IRXA 3O8NA 3OOSA 3H4DA 5LR6A 3VU0A 4R1OA 3GEDA 1J7KA 4EMUA 2I4RA 2GR9A 3BMNB 3DBIA 1HDZA 3NHUA 1AE1A 4KBGA 3U3MA 1L7EA 3WMXA 5AVYA 5KJCA 2C98A 3O4FA 1T2UA 2HU7A 3TGLA 4FDTA 4H3SA 3I3OA 2MCFA 4CKWB 4ZQGA 2C5FA 2IPMA 3KHTA 3G0DA 3RBZA 3PQDA 2CZCA 2B9VA 1UBSB 3DC2A 3ILSA 4HVTA 2E49A 4MUEA 1GRCA 3GUHA 1IQRA 3SHTA 2ZB4A 1V41E 1X8JA 2GBLA 4O7LA 2J46A 1SFRA 1FFWA 2EF0A 4Y6SA 4EA9A 3GVPA 1Z29A 1R0LA 4AQDA 3J81A 2ZCUA 4LC1A 1UC4B 1I4TD 1W36C 3S0JA 2EIYA 3QLUC 2VOBA 2OO3A 3V4LA 1K5DA 3O8OB 1Z35A 2AZ4A 1LBIA 3WHIA 3DE5X 1LQTA 4TMWA 3KQUA 2GLTA 4E5PA 1BKSB 1VB3A 4WKGA 2FLNA 5T8KA 2NMVA 3IVMA 1PDWA 2H4YA 3M5WA 1O95A 1RQXA 3IR7A 1FBTA 3E15A 4XB2A 1V51A 5FHQA 4YCCA 4MWGA 3RS7A 4CGZA 3BGIA 2YOFA 1DADA 1BFKA 4R5HA 5FORA 1OXVA 1QFZA 2HQBA 4B7XA 3KJGA 1CQXA 3QKIA 2DTEA 2V3CC 1LJ8A 3ER8A 1BROA 1KI7A 4LJ9A 1MT3A 5C4IA 4RMGA 4LEIA 4EGJA 1QTRA 3PP8A 5JQGF 4OQLA 2JHPA 4J29A 4MQFB 4RUCA 4HEHA 1I2LA 3V34A 2V74B 4EJMA 1VI2A 2YN0A 4LE0A 2BN4A 4DLYA 2Q7DA 1JUDA 1OAOC 2XUKA 3WMRA 5FNVB 4ZXPA 1R12A 1GTZA 2E4XA 1I1HA 3NBYC 1QQAA 4Q7QA 5JECA 5L7WA 4OYRA 2WM9B 3OCXA 4LX0A 1O94A 1IOVA 3TS1A 5BP7A 4L3WA 1D9ZA 4KWHA 2JRCA 4O4LB 2IX9A 4RHXA 2CXHA 1H2WA 4IMJB 1UPFA 2XZDA 4C2AA 3QE3A 3DEYX 2OORA 2H2FA 1Z4MA 3UB3A 4CM5A 3KYDA 4Q4HA 2Z6VA 1OR8A 4D81A 1Z45A 5AJUA 3VR4D 3N7UA 2C7RA 2A0YA 1Q20A 4IQFA 4BNNA 4B7CA 2GEBA 1PVDA 2GWHA 5CVDA 2AKYA 4GVPA 1XVTA 1Y6ZA 4JMPA 1XQ1A 4F2HA 3H5NA 4XGNA 1VPDA 2GPSA 2WWFA 4HWGA 1OFIA 4MPDA 4RUAA 1ULTA 3RYCB 2DQKA 5FCDA 3U19A 4MMYB 4C87A 1A3CA 2AEMA 1YDFA 2BIFA 3ENQA 4FBGA 2PS0A 5LZ5A 4QJBA 1NXPA 1DLIA 1EXMA 4L57A 4KPFC 2ZRPA 3ZIAD 2OBYA 1I80A 4LVCA 3U4DA 3UWMA 4I3GA 3GLGE 1QYCA 4RTPA 3N0TA 1YVPA 3O47A 6REQA 1GUDA 2C3YA 3OU2A 2DLDA 4XDGA 2Z0MA 2B8EA 4QFCA 2YWDA 2X0DA 4KWEA 1LZLA 1LQ2A 4CEHB 1GNQA 2UZ1A 4PSDA 4CIXA 4OGFA 2YTZA 2XTJA 4KEAA 4O4HB 1MHPA 5FPSA 3INGA 3H5IA 2PRKA 1IAVA 2WNHA 2CHVA 3FPHA 1A9ZA 2W0MA 4BRZA 3WRVA 4XIGS 5JPDA 4GLWA 1UDXA 2RGNA 4YP5A 1GTG1 2O2CA 1L4BA 2F4NA 4JX8A 3GDFA 2VZ0A 2XMSA 2P6NA 4WOJA 4DJDC 1C9JA 1IWPB 4UM9B 1QJCA 3A6KA 3OECA 1WHSB 4TVIA 2BTQA 4FLFA 2J4DA 4NP6A 1FU7A 1O4WA 1TPZA 3TIIA 5DBOA 3AIMA 5JH7A 3SQWA 3MLEA 1SEIA 2JLCA 3KS9A 5I7WA 3RNLA 4BX3A 3BTVA 5CVEA 2JA2A 1B0UA 3SC2A 3ND6A 4JLUA 3DLPX 5KG4A 5FLKA 1K8QA 5KNDA 1JHQA 3LBIA 3PW2A 3DZHA 3LG2A 2HGWA 1IXZA 1M1NB 3R76A 4ASUD 2ZXFA 4XOUA 4KPYA 3VJLA 4MYDA 3OCVA 1Q0TA 4JI4H 2WFZA 3GNQA 2BEJA 1TWAA 1OLUB 3ZJUA 1K6IA 2GCIA 5DV9A 3ZK8A 2C88A 2Y0EA 5AI4A 4WN9B 1E6KA 1A04A 2EGHA 3EMVA 4Q39A 5BT9A 3OT1B 1ZVMA 2Q50A 4CV0A 1M33A 4YMWA 4YWJA 1XRPA 2EKDA 1MQ9A 3D1JA 4QQNA 2FPKA 1YE3A 2LW7A 5AVOA 3A58B 2RIRA 2OCLA 3F8NA 3VH2A 1N3YA 4AZ0A 9LDBA 3MT0A 3EIOA 4C01A 1OWNA 3GIKA 4U1RA 1MXHA 4N8DA 5E8RA 1ONBA 5LMUH 2G9QA 2L17A 2AUMA 1CULC 3HSYA 1R8JA 2R85A 3D6AA 3NHAA 4TXLA 4CMHA 4D8TA 5KFGA 2VBIA 5TNXA 1KPIA 1UP7A 2I2FA 1SQGA 4YYZA 5FYDA 2O4CA 2QL9A 3GL9A 2WAQA 1G41A 1HZJA 3CX7A 4A82A 3VR2A 1XVAA 1S4MA 4P1ZA 5BN3A 3MJVA 4B9EA 2HK7A 2QK4A 2BQ3A 3VC2A 4RJTA 3ROQA 1Z0KA 1WETA 4AK9A 4NV0A 2HDWA 2W8ZA 1ATZA 1UBLS 4KN6A 4BMZA 2HJ9A 2H1SA 2D3TA 5DLPA 1E2DA 2R8YA 3PYLA 2LVBA 3S27A 3FSEA 2BFBB 4HLQB 3K8ZA 3II6X 3DC7A 3OM0A 1VECA 2EKZA 3NH6A 4QGSA 2O2EA 4HPXB 4D4KA 4M8NE 4IF4A 4O3QA 4RKQA 1XCPA 4GLLA 3U26A 4YASA 5HZHA 4DG8A 2AXQA 3M3PA 1WCIA 3PITA 3QNUA 1Q74A 1P1BA 3BERA 4X8LA 3QFRA 3HXPA 4AF6A 1AG9A 4N5MA 2D2XA 4K87A 2ZJ5A 3S8MA 1MAWA 1TJ3A 4EABA 5C1BA 4ZOAA 1KAMA 2QGFA 2NVWA 3UC5A 4HEQA 2CNUA 1QGUA 3FOEC 1ZNQO 1XB2A 1H2HA 2GYUA 3Q15C 3HTXA 1Q0ZA 2J9XB 1RJPA 2BZ1A 2Q6IA 3G1TA 4FS1A 4EUSA 3LY8A 5BORA 3N8KA 4KBFA 4UM5A 4NDZA 1PFQA 3PC2A 1A97A 3PF8A 4BFTA 4AD8A 3L6BA 3AVUA 4M1MA 4M2LA 2WWVD 4B0OA 1K27A 5BV8A 3ZCSA 3PEWA 5KOHB 3BWDD 3G89A 3K3VA 3HB5X 1WZ2A 1PWZA 3LVBA 1C8KA 3K0FA 4RS4A 2DFDA 3T38A 3QHAA 4CE5A 3T15A 2VJMA 3W5AA 4PLPA 4IRKA 4HH3C 2GDJA 1QIMA 1R10A 3W90A 4MCJA 3OHAA 1Q1GA 4JVLA 1K1QA 3K70C 2OD9A 3F6EX 1T6YA 1E1KA 5A6VA 1MV5A 5H9VA 5BXYA 4HFJA 5F3DA 3JQGB 4YJFB 2NV6A 3EOZA 3Q88A 4EPRA 1CS0B 2J33A 3FBWA 4N6OA 1IYDA 2ZRAA 3UO8B 3OJEA 2GS9A 2ZUCA 2HTFA 1JDTA 2ID7A 5CVVA 4AT1A 3QMPA 1N8SA 3HCBA 1Z6YA 1ESCA 1XCMA 2UVRA 1GQRA 2XLBA 5IX8A 1JXQA 3EXHA 3C1OA 5EJ4A 1UM9A 3O3MB 2C59A 2BL4A 4WUVA 3PA6A 1J1UA 2OO7A 1UOPA 1TQ2A 1JJBA 1QCZA 3FTPA 4NZYA 3ILXA 1MIOA 4MWSA 4N54A 2EFJA 5LL6b 2BFDB 3DVRX 1MIHA 3HC7A 1LBQA 1NXSA 4RF4A 4JI4B 2Z6QA 3M6AA 2ZUVA 4FMDF 4N3CA 1T0BA 2J5BA 2ZCVA 1VL0A 3SYRA 3CLTD 1PW5A 5IAJA 3FCUB 2FR1A 3NTLA 3HRIA 3O0TA 4OFXA 3G1WA 4D9JA 2G72A 4N41A 3UHAA 2WYIA 4QDOA 1ZM7A 4UNIA 2H1CA 4KC0A 5DGAA 3FD8A 4RVUA 4L8GA 4L75A 1KE1A 3ZHZA 5E4YA 3MJRA 4RLFA 2D5BA 2GILA 5CLQA 4L2IA 1NQTA 3AX6A 3KT0A 3STYA 3PI7A 3OOJA 3EYWA 5LMUB 4WEQA 1S01A 3Q8XB 4MI9A 1KS9A 1P73A 2BF4A 1H66A 4Q4JB 3R0ZA 1L1QA 3V1UA 2WFLB 3W78A 4QPPA 4WVLA 3NTXA 4U0JA 4MWDA 1N5LA 1I7DA 1Z0AA 2VRNA 3CU5A 1Z2EA 4UTZA 1JPVA 2JGAA 3PC3A 5D87A 3IP8A 3QVGB 3GIJA 4IV0A 5JZMA 4J3FA 4HF7A 2B6NA 4LRSB 2Q5OA 3LY5A 2CLHB 2YFHA 4H3HB 3M9OB 2YHSA 1ISGA 1LFAA 1N2ZA 3IEVA 2CJYA 1P1JA 5T41A 1WQ4A 2WVAA 5FLEX 3AHEA 3CNQS 5J40A 2B5OA 2GKSA 5JY1A 3KJXA 5KOIA 5KG1A 4PZ7A 2BC9A 3B3JA 3F5DA 1N33H 1XQ6A 1OZGA 1N9ZA 3R6DA 1SULA 4O08A 4M6WA 3NBUA 4RJIA 1D09A 4BE9A 4IVNA 5CFQA 4OL9A 4U63A 3KXLA 3TQCA 2FPUA 2QLBA 2QYTA 3GPLA 3OQVA 4EHIA 3ZDXB 1NUSA 1US8A 4LXGA 4BS9A 3FNFA 4O33A 1PFKA 1R9GA 4BB9A 4N48A 3T1YH 2X41A 5K0ZA 1SU4A 3BRQA 4RORA 5DXAA 5IAEA 4DCJA 2R7LA 2AZDA 4UFNA 1CE8B 1N7GA 2YCHA 3WMWA 4OL0A 3E4CA 1T34A 5IAOA 4X64H 2JBAB 4A0SA 2ZRLA 2M2IA 4HS4A 4XOIA 5L1IA 2VPZA 1KY2A 4XASA 4CM3A 2DFKB 4ED2A 3NKLA 5TXGA 1A27A 4LVUA 2Y1EA 2QMOA 3T5DA 2W22A 1KVRA 4ENVA 3SDZA 3E61A 3RWOA 1H0SA 2JH8A 1NXTA 4AUMA 3ZG6A 4P35A 3ND9A 1NQUA 3F8SA 4LV8B 1UBRS 3GG2A 2O03A 3KT6A 4G1UC 3CN9A 4BY1G 2XOKA 5A4FS 2PFSA 3DV0A 2WKSA 3FHJA 3G2QA 2FW8A 4Z5XA 1HX7A 3GNTA 4OLJA 1GZUA 3LSYA 4RHFA 2R8EA 1M67A 1S9HA 3VSCA 4NK4A 5AT1A 4B45A 1QK3A 1XIVA 1W2GA 2OZLB 1Y4ZA 2IL1A 1JYFA 1O08A 4RHTA 4GP9A 3TW8A 5PNTA 4PEVA 1C1XA 1V1RB 2FP3A 5F3RA 4I55A 1M1XB 2Q0XA 2APJA 4R8RA 1Z74A 2I2CA 3KJQA 4AMZA 2R65A 2XIGA 1P19A 4HYTA 2PSFA 4MYRA 1QH9A 4TMVA 1T9KA 3R9XB 4UXJA 2VJKA 2CW8A 1JJAA 3EQ7A 2Z1NA 2QN1A 2J9GA 2HA6A 4M1ZA 1BNCA 2Q5LA 1L7MA 1U0FA 2R8BA 3SPXA 4GX1A 1WUIS 4C0KA 5JAQA 1X1BA 2O8CB 2ZIXB 4Q3EA 5HF9A 1T36B 2IK8A 3TINA 2WHPB 1VP9A 4CLRA 3H4TA 3ELUA 1IMOA 1Y1WG 3VKFA 4MJXA 1F8GA 3SC3A 2XNJA 3F71A 2CFRA 5HWSA 3DO5A 4CCAA 4RPLA 1U1IA 4LJ5A 4ZT6A 4OHPA 3R0XA 3ZHYA 2CV0A 2QTZA 3G5AA 1QNLA 3T5KA 3SIXA 4HDRB 5KYXB 1L5GB 4WACA 2H7YA 2BEWB 1AU9A 3IOCA 4D79A 4I1OA 1NUHA 2I4IA 4ZPJA 4P58A 4AWXA 2W6ZA 4ECXA 3MTDA 1P1RA 2WF7A 1BE0A 4Q48A 2GBGA 2QE7A 3FKSA 1A71A 3NCHA 3LDFA 4WPGA 1J09A 4K6HA 3LGAA 4PNEA 4OMDA 1RYMA 2HVRA 1RRGA 4G1EB 1QDUA 4U00A 1SKQA 3TOCA 2A4KA 4CG0A 3R8XA 1XMVA 1JV2B 2JKVA 1D07A 3GT7A 3E23A 2O5CA 3OZDA 3QZUA 2ONZA 2QAIA 1D2CA 5BOSA 4YJ3A 4S05A 2VQSA 3AF0A 4ZK6A 3W5CA 3OE5A 4FZJA 4MLDA 1G2QA 3EUAA 3M6IA 5FTNA 1TDJA 4OYHA 2ZJBA 5CT8A 3GJ6A 1N33B 1M75A 2G77B 4OXIA 1SFOA 4PFKA 3HPQA 2VTBB 5KPDA 1HYGA 1D7AA 2CLKB 3JAMA 4C7OA 4FHGA 3THSA 2NV0A 3ESAA 4FS3A 2I8AA 4K46A 2WOOA 2P3QA 2NXJA 5IAGA 4ZIRB 1SEVA 9LDTA 1E2PA 1UMBA 2GLXA 3T1YB 5JCPA 1L5KA 3HQ4O 2KPOA 2W9XA 3U60B 2ODNA 1HDGO 5FUWA 4ND8A 4R6XA 4CGYA 4X64B 4KQEA 5T3YA 3SHWA 3RKUA 1ZU5A 1W2WB 3A4LA 1VXOA 4LFCH 4OHWA 4C4XA 3RB3A 3PJRA 2RGBA 4O2LA 2C5HA 3THXB 2Y92A 3NANA 3ZV6A 1M6VA 1CT9A 1QR2A 2Y1LA 4E70A 1QYXA 1RSZA 4FPXA 1IXSB 1P0QA 5JW6A 3H18A 4O3NA 2WICA 4Q18A 4F8YA 4HS9A 2JIPA 2QN2A 3IXMA 4XCVA 3L04A 5AYVA 2J09A 4EG6A 2P91A 3E03A 4KACA 1NZDA 3K96A 5I7HA 1OROA 1X7WA 2I8LA 3M5CA 3RT7A 1RXUA 2NPFA 5AK0A 5AJZA 5A62A 2ZYUX 4N39A 4RSHA 3O38A 1M2WA 1OBCA 5HUHA 3VUFA 4UBIA 5E3HA 5IULC 3I61A 2GN1A 5EMMA 5LJLA 3CZAA 2RB4A 2FWRA 5KG3A 1QCYA 3T3DA 3PHCA 3FYTA 3NVKI 4JP1A 1D0IA 3FVVA 4F6RB 4R0MA 3AZQA 4EJSA 3ODGA 1BMQA 2A84A 3P2IA 2G76A 4HOYA 1UF9A 5ED4A 4B31A 4BXOA 5IYBG 1PAUA 4M7WA 4MEJA 4D42A 3ZQKA 3QWHA 2ZM5A 4GPBA 3Q7QA 1P91A 4DRZA 1JA9A 3C7DB 2BHSA 4J6EA 5GZ6A 2CF6A 3EDQA 1DPFA 1K3UB 4D0LB 1K08A 2V58A 2H0RA 1CZHA 3BFJA 2MMGA 1SC3A 1E1NA 1JILA 1NOIA 2QROA 2QUKA 3WK9A 1TK3A 3M6MD 3D7RA 1UINA 4N6GA 4Y18A 4H1VA 2J4FA 5JTTA 2GZ3A 3JQAD 2XE8A 1ZXLA 4G2TA 1Z36A 4DANA 3FNRA 5HR5A 3B6ZA 1B8VA 4G8DA 1SZDA 3V2IA 3L0BA 3FUCA 3A3NA 3DMDA 1ZC4A 1GGMA 3L46A 2AUTA 4FP9A 2EX1A 1AK2A 2Q2WA 2PUTA 2QTCA 3V8RA 3C41J 1DUVG 1CP2A 4EY4A 1WL8A 4H4DA 1R37A 3GPIA 3MBOA 2WSSA 1K06A 2JFBA 1SC4A 5HFJA 2H54A 5BV1A 3JZAA 4QDUA 3FM9A 3OBBA 2ETVA 4OHRA 3RAPR 4HL6A 1JDZA 2ZE8A 2XT0A 4EHAA 4K9OA 3N1UA 4A3FG 1NUTA 2QV0A 3PR1A 3HV2A 3KEQA 1TYEB 5JRDS 2JA5A 5FBZA 5CB4A 3Q72A 1AURA 3FCSB 4DMKA 5EJ9A 3UMYA 5I47A 4YUAA 4MWZA 1B8UA 2XUFA 1L5QA 5IS2A 1J2TA 4EB0A 3Q9SA 4AJ9A 2DC1A 1BWQA 2ZT8A 4UM8B 3L5KA 4ZK2A 3UC9A 3S81A 1PKEA 4II3A 1EA7A 3E3MA 2WJVA 3PB3A 5KG0A 3DKIA 3NHJA 4V0LA 4DT1A 4CKXA 1EJ0A 3ZE9A 2QR5A 4X7BA 4GC5A 1NAHA 3IHLA 4CLEA 1BO6A 3RI3A 3RF7A 3H2KA 4YRNA 1QLHA 4FYMA 2KBFA 2IUFA 3TF5A 3ICOA 5KTSA 2PHZA 1TGYA 4G5YA 1EGVB 5AUQA 3RUHA 3IKTA 2RAPA 4CDNA 1X42A 2WSIA 1DXHA 2B30A 2EWWA 5A3VA 3ELDA 2X9VA 3OTIA 4IHKA 3NOQA 1EIZA 4MTCA 1D2HA 3CBGA 1XALA 3M1YA 2NVBA 4MW4A 1UZAA 1LX6A 4M53A 1IYZA 2CLMB 3JALA 4LC9A 1X9GA 4LFCB 2R6R1 4HRVA 1N6NA 1T43A 4YR3A 5B3JA 4BVHA 5GVSA 5DMHA 3DW1X 2GVNA 1ZOSA 2HFKA 4MUBA 1GQ2A 3FHCB 3X1ZA 1X86B 1L6RA 4V02A 2OHVA 3WX0A 1SBYA 1NQWA 3LMLA 4PRLA 4MUYA 1XLTC 3TZLA 4LJRA 2DWOA 4MCHA 4BATA 2R6ZA 5HF6A 3EUEA 4L85A 2EKPA 1OV4A 2C9MA 2FCAA 4EHFA 1TADA 1QVVA 3OURA 3OIUA 1RJQA 1W4RA 2IUYA 2NM0A 2P0AA 4HDAA 4Z1MD 5SZJA 1OT3A 3U7EB 1U0GA 1H3NA 4MCIA 2O6HA 3CEMA 1U2GC 1C41A 1YVEI 3IUYA 4I4TB 1E1CA 1JFLA 2AOVA 2BFAA 1KSHA 4UW9A 2YKGA 1RWOA 5DBGA 3ROFA 2JGLA 1O9GA 3PJGA 4JZYA 1WUHS 3TAHA 3T95A 2C0QA 1M1UA 1VTKA 4KHZA 2I7DA 4MS4B 2J3JA 4IAOA 3LOPA 4IGKA 3S8EA 1E3MA 3RG8A 2AC7A 5ESDA 3BHMA 2LE0A 4QDTA 1MO5A 4JI5H 2PKRA 2Q1UA 2DPJA 4N47A 1Y4AE 3TTWA 3H5RA 3PEVA 4IZ6A 1ZICA 2IHZA 2C5SA 3P32A 1SZPA 2HK8A 4PSVA 3EZ6A 2E6KA 4GG1A 1TCCA 1QH0A 2QNBA 2GDZA 4B76A 3I64A 2C77A 2H00A 1MCZA 1XNJA 4KAFA 3SQMA 1B6GA 4AWAA 4Z49A 1LPNA 1I9GA 4G0OA 3MCVA 1Y5RA 3MN1A 1PWXA 3KC2A 3BTSA 5JVLA 1JBKA 1QRDA 4JVSB 4AFNA 3TIGA 2BSQA 4CQLA 3TTSA 4KQ9A 2R8RA 3ZGZA 4PCVA 3C1AA 2OOSA 2OUKA 1ZSYA 3LY9A 1IQPA 4AXXA 5LP6A 1Z4JA 1EFDN 4WADA 3ESYA 2ASDA 4C20A 2MTBA 4DL5A 3NEYA 1O0CA 2A5GA 1BJKA 4EG8A 4P0QB 1R7RA 2OFWA 2QWXA 1M1YB 1NBAA 1QH1A 1I2AA 3HU3A 2VP2A 4OLBA 5I8ZA 3R44A 4BUCA 2YL2A 5FEUA 4UHHA 1FSFA 3IEPA 1GPUA 2VVTA 5IJ9B 1E18A 1YCHA 5JHHB 2V6MA 5KTRA 4ND4A 3NM6B 3KG2A 2ZK7A 1UT5A 2HSJA 3C6ZA 4ATNA 1EX6A 1UXOA 3T4UA 2I29A 2TMGA 1JDNA 3CPSA 3MZ0A 2ZSUA 3C8ZA 2P79A 3ILYA 2VHQA 1IEVA 4B3RH 4UVIA 3ZV5A 2GN0A 1JLRA 3QUAA 5BSFA 1U2PA 2JEIA 4UC0A 2XQIA 2N42A 2FN7A 3GMTA 4OIMA 5CD9A 2FWNA 2R7KA 1CR4A 4TSFD 4QQFA 5AM1A 3WL3A 1PYDA 4E2FA 1ECGA 1ZIXA 4BGIA 3P4YA 1Z0JA 2PNJA 1P1HA 1O6ZA 3GHHA 3SZUA 3RWBA 4CLOA 1R6AA 3WLNA 2HWXA 1ML4A 5DSZA 3W04A 5DLEA 2XWBF 2H1VA 3LWDA 1IOWA 4M88A 4RB0A 3UCEA 3P0FA 1N4DA 4EVRA 1H9BA 1N92A 5EOVA 3K09A 4UZSA 3NT4A 2QLMA 4DQVA 1GGJA 3HOZG 1ZY2A 2XXJA 1V6SA 2AJBA 2BBWA 3L1UA 4KYUA 2RGAA 4U7HA 3ZCTA 5KSYA 3GCWA 4L27A 4MV5A 4ZU6X 3CEBA 1WLSA 1KETA 3ELBA 2QLFA 2DR2A 3UT5A 2NVXA 1U9JA 3I58A 1W49A 1YDGA 5ERGB 5FWYB 3T9AA 1I10A 1TA8A 3GYBA 2ZRNA 3K9NA 1S2OA 5GOTA 2AYXA 4MR8B 2NYUA 2XXBA 3HOVG 4UVEA 3RANA 4LWOA 3JS5A 3SYMA 4KNVA 6YASA 2X19A 3T1HH 1TO2E 4F3RA 3VPXA 4URYR 1SXJC 5KHAA 5CNIA 1NDHA 3AXTA 1HE2A 1SUAA 3ND5A 5F35A 2Y1OA 1XR3A 5TVKA 5FT9A 4JI5B 1E0DA 1JYSA 2VSYA 3ND7A 3FVTA 3UFXB 1NF2A 4MS3A 4QXQA 5H3HA 2H08A 4WINA 4C7XA 2X1MA 1FP2A 1EXWA 2PNFA 3OIFA 4M0JA 1P62B 2WLSA 2QE6A 1Q83A 2FJZA 1HDEA 1JDEA 4QLOA 3AP3A 1KI6A 4OB8A 1IBSA 4PN7A 1DEXA 4CMCA 3TMKA 1P5RA 3OLQA 3EQ6A 1HDYA 4FLMA 3FKQA 4BFSA 4ZV9A 3MINA 4NZZA 4M60A 1ZYUA 2FQWA 3T3OA 2WIJA 4F5WA 1TRHA 3LHIA 1OFUA 1KOFA 2B5VA 2CXTA 5CP8A 4UZFA 3TTYA 3SBDA 3RVOA 1M7GA 1QPZA 1XNQH 3FDZB 1FDWA 1N2SA 4E5SA 2GZRA 1I24A 4C0SA 2QOEA 4RESA 2A9QA 1X74A 1ZHSA 5JCJD 2V0GA 1ESMA 3PDHA 2E2IA 3D8RA 2Q3JA 1YRHA 3RLFA 1UXIA 2GTHA 2DFTA 1Z06A 5JATA 2BFMA 3U4GA 3RASA 3E9ZA 3F5QA 4W82A 3FHTA 3COVA 4IG9A 2FI1A 2CFIA 5J4KA 5CM9C 4DRXB 2FR8C 2Z43A 1QIFA 1XD9A 3TPCA 2OB2A 1GWNA 3ROXA 3E9EA 4R98A 3EBLA 1XLVA 3OUTA 3S6JA 1PGQA 2F2TA 2J3KA 3EVZA 1SCAA 2G5CA 3E9MA 2XVMA 1EWVA 3TLGB 1XA0A 1L1EA 3WFZA 3UXYA 2B69A 2CLEB 1UKAA 4IDAA 4PN3A 2WP0A 4HQNA 5I7FA 4Y1EA 4FUQA 3ICEA 2H1OA 1YB6A 3ANYB 4DIMA 1ZC3A 2WFAA 3ZZMA 2Z8YM 1EFHA 3AM3A 4FJ2A 5F2EA 1ZVQA 4U6NA 1HE5A 2CT8A 1UFOA 1AK1A 2EGUA 2VHJA 5A0TA 5DO9A 3DHVA 3OFVA 1VCHA 4H7IA 4J0MA 5TEVA 2AA3A 3RB8A 5D1OB 2DFLA 2Z5GA 2QW8A 2OWOA 3H65A 4ECRA 2RGVA 4N0EA 5EGSA 3RHTA 1F6WA 3B6MA 1FP4B 3V42A 2WB4A 3TZQA 1BWPA 3FHLA 3ICWA 3BC1A 1MJGA 4LFAH 2IGBA 4ISCA 4ZMSA 3TXYA 1QOQB 4C0QC 3QV1A 1HL3A 3KOWA 3TDMA 4YGXB 1YASA 3MT7A 3OZ7A 1CC1S 5FD6A 4MJ3A 2Q27A 5TS3A 2L42A 3PQ7A 5IUKC 2BI4A 2H92A 3ETJA 4KTVE 4RDCA 3N3AC 3FF1A 1KY5A 1H9AA 2ZJFA 3S99A 3HPRA 3QKWA 1SCJA 2F3SA 3U7QA 1ZHQA 3OQ1A 3QRWA 4Q44A 4EW6A 4TN1A 1GFSA 5AVUA 3R6GA 1S5PA 2DBZA 4CMEA 1OE0A 2RI6A 4MVJD 1MFZA 4K7JA 4HB0A 1P1CA 5BNTA 4EGCB 3PW5A 1YBAA 1V4BA 1TAHA 4WCFB 4CKEA 1OREA 3L8YA 1BCSB 2YYSA 4ESHA 5JRJA 3T1HB 4LWPA 5DG7A 1E2EA 1DOHA 1XZCA 3ROTA 3CJQA 3MTQA 3QHQA 1GLGA 3BCUA 5JS8A 5LYJF 1TMYA 2R1TB 1ACLA 3FYUB 4DSZA 2OWDA 4JS0A 3A3OA 4ODIA 3AR2A 5DMXA 3LFHA 4K2HA 4OQZA 4OI0A 2P90A 4H6VA 4H1UA 3NMUF 2M1ZA 1JHAA 4WOKA 4J7XA 1XP5A 2V8OA 4Y1RA 5FWXA 1XDGA 3H1EA 4DSTA 1KFKB 4J0IA 1F06A 3LECA 1JA0A 4MB6A 5EEHA 4D4MA 2A33A 1DC5A 1N7HA 1E2GA 1LEHA 3WL4A 1SY7A 3RB0A 4BFYA 3NOOA 7REQB 4RZSA 4PFJA 2GXAA 3FSJX 3I9NA 4LTDA 1HPLA 5ALQA 4LXUA 4HGQA 1DEKA 2HFJA 4TL8A 4Q0YA 2M32A 3NGDA 1H05A 1MN6A 2PMEA 4EFNA 4PQYA 2FEXA 1E2FA 4G41A 2VUMA 4I5GA 1XNQB 3C5WP 5IBPA 3HGTA 4QGFA 2X4LA 5ADUS 2R7ZA 2PL3A 2QT1A 3LXMA 1SCUA 2Q9UA 4J9RA 1Y6RA 2WRZA 2B3TA 2CV2A 3CGGA 2J6CA 3K9FC 1YONA 3MWJA 3G5LA 4TYNA 1KYYA 1H3FA 4BPRA 5BRNA 5DM0A 1BAPA 3I2JA 3HCEA 1FY2A 1ZW1A 1G18A 1SBCA 2F1JA 4Y6QA 2DHRA 5GJVC 3HEAA 4X9XA 2G3YA 3NHRA 4OUKX 4O86A 2OGZA 3VO8A 4L1KA 2GHTA 5FH9A 3PIDA 3EA0A 3Q3CA 3EF3A 3KVNA 4M1OA 3L7OA 3W5DA 3B5EA 2O0HA 3E6AA 2QZPA 4Y30A 3AUUA 3D3WB 5JJ5A 4LRUA 3RYTC 3BB1A 3H7AA 2J9FB 1KNXA 4RY8A 5BW6B 1CP3A 5GGYA 3QLEA 5F7XA 3HADA 1TVKA 5AVKA 1BCRA 1X15A 2CFTA 2RC6A 2ODPA 3CRQA 3DVLA 5JARA 6NULA 1MMFB 5ADHA 1G21E 5JCOC 3RT1A 4NXNH 1W85A 2ZATA 1GUYA 5AUNB 4RNMA 4TXMA 3SIRA 4YAFA 4UQOA 3TZKA 2C3MA 5KFYA 3S2GA 4P33A 1TMOA 3SEQA 1Q3TA 1TM2A 3ZY4A 4JI3H 3R8CA 5J59A 4DLZA 3NPMA 4LFAB 2JVIA 1TT5B 1P9OA 3A1WA 3GLFB 2VTVA 3V8QA 1WWKA 4KV7A 2YVKA 1NMSA 4O6VA 2XODA 4Z8YA 1I1NA 3GWZA 1P6UA 1X38A 5CT6A 1E62A 3KAQA 4FFOA 3DYVA 4CE6A 3T7IA 4P6VF 1G5RA 3AONB 3G7NA 5IH7A 1K0FA 4EZBA 2LV8A 3BDIA 3M7IA 4IR1A 3PFCA 3IXQA 4RANA 1XRQA 5A4DA 4LDQA 3I2GA 1TW3A 1GFZA 2BTOA 3L92A 4KK4A 4BLTA 1CLUA 4P5EA 2GZAA 1QM5A 3E84A 2FFAA 1RCTE 4BGUA 4LRYA 3KOUA 3ORQA 1U5BB 1BDJA 4FU0A 4DLTA 4B1FA 5FO1A 4YJ2B 5EWLB 2PLWA 1LX7A 3SE7A 2ZSIA 2ZULA 3JYLA 1RRFA 4E5YA 4GVXA 5GJCA 5GZ3A 4KWCA 2FEPA 3B52X 5F5NA 2AI1A 1YFJA 1ZFNA 1YRAA 3B1XA 5CMLA 3NHMA 3QXCA 2HJGA 2J31A 2AT1A 4PC1A 2VYVD 1B26A 4JYPA 3A1SA 2QJTA 3DMGA 2EAUA 4U5XA 3AKEA 3FXAA 4MULA 3KKPA 2JFQA 4ZEVA 3TFWA 1XZAA 1UJCA 1QH8A 4C0LA 5LP1A 4FCWA 4OGWA 3CNOA 1YVDA 1DX4A 4JP5A 1OX4A 2GEJA 4F50A 3V4PB 2CE7A 2NIPA 4QNMA 3D7MA 5K09A 5CR9A 1DE0A 3N2GB 1UOOA 1DX9A 3UHJA 3D31A 1GQOA 1BFUA 3RS8A 2ECQA 2W2LA 4DSNA 4FK8A 2HA4A 3I8SA 1EKXA 5FJJA 1IHYA 4LZZA 3NP7A 4FIDA 3OAAA 3A3PA 4LTNA 3FUUA 4KFSA 4FOPA 3RS9A 4GOJA 3H6GA 4W7HA 5IVIA 5IC4A 4FHEA 2PRJA 3QKTA 3ZHCA 4MGIR 1D3AA 2WJ6A 1ZM4A 4KIGA 4EIWA 4KO8A 4KX5A 5C3EG 5JNLA 3WNBA 3V1MA 4G2NA 1ZONA 4Q6BA 2YY5A 5EJGA 3SHFA 3MMPA 2Z57A 4WXHA 4RL6A 4UNQA 3LIPA 1GG8A 4HNVA 4KUHA 5BWLA 2C28A 4JJ6A 1L7OA 3WLRA 5HCIA 1CK4A 1W8DA 4ZI7F 1E5TA 1KI4A 2JL1A 5E1BA 3F3YA 5HZMA 4I2VA 1G2PA 1M83A 3F6PA 4X93A 1NBOA 1N0IA 1UKEA 4PWYA 2O4UX 1I4EB 2BKXA 4AYBA 3ZY2A 1WR2A 4JH0A 2AEFA 4I1SA 4NXNB 4QU8A 4C6TB 3RBVA 1M2OA 3IVGA 1RS0A 1X7YB 3I1FA 4TUYA 5KWIA 5LOVA 1H2RS 3WJ2A 2BHLA 3TY8A 1CD5A 2Y1KA 1UJ5A 4LSWA 1RYHA 1RAEA 4GM1A 4JI3B 4F21A 5BR1A 2CHUA 1LLUA 1Q1EA 4WJKB 4R05A 2QMEA 1NJ2A 1QTNA 2DECA 1PNRA 3X1DA 1T8SA 5G0WA 1TJNA 4DLBA 3G6VA 4KXXA 3IAHA 2H06A 3ZUPA 1VLJA 4RIFA 1YKSA 4O84A 4NBLA 1G7SA 1KVQA 4RD2A 5FOUA 3A06A 4G8BA 2OBLA 1C7QA 1YMVA 2ZYWX 2PMDA 2VCHA 2WD7B 4C4ZA 3VQTA 1BHSA 2KS6A 3GZNB 3DNFA 2W58A 1YQEA 3EC2A 1K97A 1JIJA 4XJSA 1DG9A 4WXEA 3B48A 3NDPA 1RI4A 4ZRMA 3OOWA 2BEVB 4NONA 3WMGA 2LBPA 4GP7A 4LZWA 1J2UA 2I62A 3WRYA 2BQUA 4QTXA 4KUEA 3EPLA 1GHTA 2XYVA 3AHFA 4HGZA 4YR9A 3OO1A 1Y8QA 3G8CA 4LC0A 4K6NA 3U7RA 4MYCA 3GVIA 3CR7A 4D82A 4KKVA 1UBJS 1D1PA 4RF5A 3UT6A 3R7AA 2JKYA 5CX1A 2YWVA 5K4GA 2C04A 3U2QA 1KIMA 1EXNA 3SSAA 2XRFA 4GRAA 1O96A 3DZIA 3FI9A 1N0UA 1MOQA 3JQRA 4P92A 1QE0A 3FR7A 3VNNA 1FRVA 5BR8H 1VJ0A 2CLSA 4D5EA 4RPIA 4M1YA 4FGWA 1V3QE 4GKAA 4Q3BA 5H8WA 1W75A 1IAQA 3BL6A 4IKPA 3TSOA 2ZBRA 3JRXA 3FKIG 3X1YA 1UQRA 3QX9A 1KAHA 1FTNA 3ABIA 5JWRA 4HXGA 5DISC 1QAMA 4B6OA 3MA0A 4DV0H 5JZBA 1PLKA 4KAAA 4DL6A 3E3NA 3QJGA 1RLTA 2A5JA 2FZLA 1OW3B 2EQAA 5CLGA 3RUCA 1KEEB 1AZTA 1TQHA 5I9MA 4E03A 2ZQYA 4ENWA 3EIHA 1R0RE 1JQAA 3A9VA 4GYJA 2JLVA 3EZLA 3UH0A 3TJMA 1B04A 2WKQA 1JEYB 2UYYA 3ZIUA 5KOYA 2FU5C 2HD4A 2DG2A 3GUVA 1SUWA 3GLKA 1PJ4A 4E6NA 1VS0A 1DOAA 1ULUA 3TD6A 1CERA 5CM0A 2WF6A 1D4OA 2ZJ1A 3OIYA 2DJIA 3DL4A 4MR7B 2P7IA 3EEFA 1UDBA 1AUQA 1JEJA 3KJHA 5AXAA 4DTCA 1Z2PX 3OZAA 4RQBA 4JU8A 3FCCA 1GP2A 4L8LA 1ZHOA 2B20A 3KUKA 3DOUA 4H15A 1XMIA 2EJBA 4WL0A 5KCMA 1H2AS 1P6QA 1FKAH 3OBIA 4QOIA 1GQFA 1YS2X 4RTKA 2F1RA 3ZWMA 5BMVF 1A77A 3KPWA 3VSDA 2B4AA 4NJOA 3Q3IA 4XWKA 3RAGA 2RK3A 3O4GA 5I4IA 2PWAA 1JE0A 4TLMB 2P1DA 3QBTA 3U7HB 1KR5A 1YFZA 1V6AA 3R3UA 1Y7TA 2DIKA 1VQ1A 3P1JA 1QO0A 5EPUA 2YHAA 4REQB 4D97A 3FGZA 3V2HA 4RF3A 2IPAB 1E9AA 4Z3KA 1KQFA 4DM7A 2DQYA 2UU9H 1AC5A 5DQIA 3SZRA 3A4TA 3KEFA 5DCYA 5CGQB 1TC2A 4IIYA 1ZU4A 2GF0A 4Z86A 1VBHA 4DLWA 1Q7EA 2C9OA 2V0CA 9ABPA 2NZ2A 3U13A 3VJRA 3RODA 4UVGA 2O8EA 2I6GA 5IH3A 4MKXA 1L4UA 1VCOA 5KBYA 4UBNA 4KZKA 3B36A 3AR7A 3AI2A 3M6WA 4RK4A 3ZNNA 1NXVA 4JLVA 3U3ZA 1T5LA 1BGXT 1H2BA 2RC5A 4K6MA 3K5HA 1M7HA 1DWUA 3GIWA 2N0SA 1RHKA 2ICAA 3VNRA 1T91A 5FUVA 3BMOA 5L4NA 4OOFA 2PUWA 4UEKA 1MF7A 1JFSA 1V48A 3DPIA 3QPDA 4YPVA 4OYYA 3DBLA 4JWKA 1H0RA 2VKTA 4UVHA 4ZT7A 3GO4A 2GAAA 5KNDH 4EBFA 6PFKA 3DR5A 4DAAA 3RVDA 1OXMA 5I3CA 1IUKA 1PLJA 3VVMA 1ADYA 4P3YA 5DXJA 1GY8A 1XMPA 3GLGA 1AO3A 4BYMA 3IMCA 4Q3CA 5BR8B 1ECLA 2C29D 4PHTA 1I7PA 1PZGA 1SQFA 5JVDF 3JASA 1RAGA 2P5UA 4ALNA 2ENUA 4N0QA 4BKUA 3D4OA 3O1LA 4G4IA 2CK3A 3HUDA 3UF0A 3WK4A 3W8DA 4BX9A 3KLPX 1DG3A 4J49A 5EMLA 4EGSA 4DV0B 2CXXA 1TLFA 5D1PA 4TWJA 1FFAA 5AJXA 3ZR4B 1M6EX 2XNDA 3ZNOA 3EZYA 4FONA 5C4MA 2IPLA 1BS1A 1C0PA 4KYVA 2OKGA 1S1CA 4BLRA 4BGVA 3D9QX 1AA9A 2ZETA 1BVUA 4OJQA 4HAIA 2JB9A 4ENTA 2NZ8A 1ZH6A 2Q5FA 3K0AA 4FDUA 2O5EA 3L1JA 5DZSA 2FAXA 3KYDB 4Q4HB 1J0XO 5E2BA 3MXOA 3TYXA 2JGMA 4A2CA 1XU7A 1XDDA 4UNPA 1KS2A 1YZNA 1K4MA 3ZU5A 7MDHA 3OSUA 1AS2A 1KUTA 4A8JC 1KWGA 1KMCA 3ZDCA 2FG7C 4I8IA 4NYJQ 3ETHA 4PYJA 4XKJA 5CVCA 4M8SA 2VUGA 3HZHA 2B7BA 3A7DA 3AQ4A 3WIBA 3H2SA 3H1BA 2F17A 4PO8A 2BHRA 4D6XA 5JROA 3WO1A 4I0WB 3V1TC 2QT9A 1GDHA 3AINA 1JDPA 1RFGE 3FDFA 3C14C 4QHSA 1IHDA 4MV0A 5KTKA 5DI9A 1AN9A 1PIWA 4ZD6A 3M3HA 1KO7A 4C4RA 2JFWA 5AHOA 5FLXA 4DLXA 1RR6A 3AJEA 3NDJA 1CUVA 3L0SA 3SJUA 1HSZA 4YXFA 1V95A 5EWMA 2BMAA 4R16A 4RTJA 1ZITA 3B9BA 6REQB 2ADMA 1WZUA 1MH1A 3CF2A 3H6KA 3HJAA 5DQHA 4YQEA 1R50A 1WB9A 4A3GG 4UCVA 2XEXA 2O3RA 3O1IC 1QQ6A 5JNSA 1AMOA 2UU9B 4H7EA 3V00A 1WLYA 2JA8G 5F2KA 2V7TA 4DLRA 4RWEA 2UZ1B 4CRWB 2OZEA 5DIZA 4XIJA 3L7NA 4OFWA 2B3DA 3T3MB 4R3NA 1NTOA 1XZJA 4D4IA 2P3OA 1F51E 2AGOA 4INJA 3WWZA 1EDBA 3PXUA 5I4CA 4GC9A 2V0NA 1FFHA 5FTJA 3MTIA 1Z34A 1L7AA 1T0IA 1P3JA 3ZCVA 1SQ0A 5B4TA 1T1RA 1U0RA 3VOAA 4NAUA 3CSUA 3SR0A 2WTBA 1U6JA 1I2DA 1Y3FE 4GGOA 1VHDA 1XELA 1Z75A 1C4XA 2XCRB 2BTQB 3OF2A 4LBVA 4Z51A 5KTOA 4C7KA 2HVSA 5FQOA 2IZ5A 4IFTA 5JH7B 1G3QA 3CVXA 1U94A 4F5EA 1U3FA 4S2EA 4CL0A 4IG4A 1ORIA 1IHOA 3ZGYA 2IBSA 3SC2B 1A4RA 1RHRA 3ADOA 2P2YA 2TMKA 4HAXA 1OT5A 1QS0A 3N28A 4IRDA 2AG6A 4B40A 1YRLA 4UNSA 1HTBA 3F6CA 1AUVA 4PHFA 3GLHE 4BNWA 3SFVA 2EZ9A 3E3LA 4H7PA 1AXGA 1Z2AA 2GESA 1Z6ZA 1LFDB 4NLGA 1U3TA 1AOXA 1GCIA 2C2EA 5THKA 5I5WA 4K9RA 4ZT4A 1CF4A 1YI1A 2CHQA 1YFKA 1W6RA 2B36A 3BULA 2EWMA 4IUYA 2IDZA 4GBJA 4D9CA 2JD2A 1WCWA 5CXUA 2VA9A 1YTUA 2XC9A 1O97D 2JA7G 3AU9A 3V4ZA 2YCBA 3PLNA 5KG7A 4JUCA 4AKEA 4JL8A 1J0BA 1H6BA 3SYLA 2KMLA 2FSVA 5I8PA 4NZMA 3FDIA 1PV1A 4IJMA 2GZHA 5CFMA 4APMA 1RRKA 1L4KA 4LMAA 1MZVA 1VIDA 4E2YA 4AZ0B 5BWVA 2FMAA 3R1IA 2Q2TA 4OK3A 2LUOA 2HI0A 5H02A 5BY2A 2B21A 2GOYA 2B78A 1JQDA 4PLHA 2OLEA 1VKJA 3A1CA 1PG0A 1NKVA 4HQKA 3VPSA 4QVGA 1OBDA 3PGXA 2C4HA 1YJCA 4LYJA 4EZIA 3I6QA 3BJRA 1KYIA 4Q7EA 2C7GA 1PZMA 3Q6MA 4BV3A 1QZTA 1NZJA 5F1PA 1E1DA 4PBTA 5BUCA 3Q8KA 1H42A 2A3RA 5G4LA 3IYLW 4XTCS 2GI4A 3GCZA 5BN3B 1NW6A 3ENNA 5KX5F 3QG1A 4G25A 1SQ5A 3V4RA 4E14A 1T0JB 1K7XB 2HF8A 4JUZA 3CNLA 4ILKA 3T9FA 4GZMA 1T8WA 2FRDA 1A4UA 1U9IA 1PSWA 4W5HA 3H2GA 4RVGA 5TF4A 4GIBA 4YBZA 1Q7RA 5DTQA 5I5XA 3LUJA 4C3VA 4Q3OA 3B1JA 1H5NA 5D6NA 4DMCA 3I9MA 2ACWA 4PQEA 1EFRA 1UZMA 2AGPA 3R3WA 4JLKA 2Q4DA 1RP7A 3IELA 5I9IA 3GFGA 4MQ5A 4UM9D 4PTZA 5CW2A 3SDBA 1PVVA 4PXAA