3V4ZA

D-alanine--d-alanine ligase from yersinia pestis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
293
Chain Sequence
AEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-alanine--D-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 94
structure length 293
sequence length 305
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3v4zA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3v4zA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4zA01
3WNZA 3VMMA 2VHEA 3K3PA 4FFNA 3TIGA 1OBGA 3KAKA 1M0WA 2QK4A 4C5CA 4RZQA 1B6SA 4EAAA 2YYAA 3R5XA 1VKZA 4MAMA 1Z2OX 4XYMB 2VR1A 4NYEA 5KX5F 2R86A 4M9CA 2FB9A 5CA1F 2R7LA 5DMXA 4DIMA 3U54A 3G8CA 1I7NA 2HJWA 3MWEA 3RV3A 2VQDA 1C3OA 2C00A 4O7SA 3KAJA 2FPIB 2P0AA 2HGSA 2OLSA 2YL2A 4EA8A 5HBRB 2W71A 2GPWA 1GSOA 3U9SA 1DIKA 2ZDQA 3MWDA 2NUAB 5C1PA 2YZNA 3WO0A 4MV6A 2W6ZA 2R82A 4M9UA 3LWBA 1KJQA 1EHIA 2DZDA 2W6QA 1A9XA 5BMVF 2GQSA 4FFOA 2R7KA 3ETHA 1CQIB 3KREA 3HB9A 1EZ1A 5CAEB 5KKNB 2GQRA 4O2AF 2YWVA 4XYLB 4C5AA 3N6RA 5LOVF 4FE2A 3GLKA 4GGMX 1KC7A 1AUXA 1AUVA 4ME6A 1M6VA 3ETJA 1VBHA 2SCUB 2DLNA 3AX6A 2ZDHA 3RFCA 3SE7A 3JRXA 4J6EA 1Z2PX 4O86A 1PX2A 1KJ8A 2V59A 1M0TA 3K5IA 3BG5A 4O2BF 2DWCA 3OUZA 4DLKA 2YS6A 3RUPA 4ZI7F 4O83A 3OUUA 5D8DA 2QF7A 2YZGA 3JZIA 2ZDGA 1KBLA 2XD4A 2V58A 5K2MA 2PVPA 4HQ6A 4IWYA 3R23A 3TW6A 3Q1KA 5JVDF 2FPGB 4O4JF 4YAKB 3TIIA 3ORRA 4QSHA 2R7NA 4MA0A 5C8YF 4FGRA 3BFPA 4O4LF 4YAJB 4EG0A 3I12A 4TV9F 2R85A 4FFPA 2NU7B 3TINA 5JH7F 3GIDA 2NU8B 4HR7A 3U9TA 1KUTA 5FNVF 1UC8A 4FU0A 2Z02A 5LP6F 5JQGF 4FFLA 4M99A 1GGOA 4EGQA 5LYJF 4MV8A 3ORQA 1W96A 2V5AA 4IZOA 4O4IF 1IOVA 4IIJF 1JDEA 2R84A 4O7RA 3BSYA 3VPDA 1SCUB 2YRWA 2Z04A 4HNVA 2VPQA 4Y8VB 3BSSA 2W6PA 4O81A 2NU9B 4O7VA 2CZGA 4EA7A 3KALA 1CQJB 4YBZB 3MJFA 3V4ZA 2YZMA 4FFRA 4EGJA 2I8CA 2PBZA 2YRXA 3N8DA 2I87A 2X0SA 4ZQIA 2XCLA 2PN1A 4O7YA 2J9GA 4C5BA 1CS0A 2I80A 3G8DA 1KJ9A 5I47A 1E4EA 2R7MA 5BPFA 4I4TF 3AW8A 3DF7A 1JLLB 3NUAA 3U55A 4O82A 1KEEA 4O4HF 1E4EB 4I50F 2FP4B 1GSAA 2CQYA 4L1KA 3R5HA 1EYZA 4M98A 5JQWA 3BSWA 5BPHA 3VPBA 1DV2A 4TV8F 1IOWA 3RV4A 5HV6A 2IP4A 1JKJB 4FFMA 1BXRA 2YW2A 4MA5A 1KJIA 4YJ3F 2W6OA 1ULZA 5IYZF 3VPCA 1CE8A 4O7WA 1UC9A 1BNCA 4MV1A 1VBGA 2CNQA 2W70A 4XX0B 4I55F 4O7ZA 2DIKA 2CNUA 4MV7A 4O7NA 2YS7A 5LXTF 3HBLA 2R6FA 3K5HA 3LP8A 1C30A 4YJ2F 3JZFA 4MV3A 4YB8B 1GSHA 3UFXB 5LA6F 3R5FA 4HNTA 2W6MA 4TUYF 1PK8A 3HO8A 5H80A 4MV4A 4EA9A 4EABA 4XZ3B 2YZLA 2CNVA 5EZYF 4O84A 3Q2OA 5J2TF 1Z2NX 3VA7A 3QFFA 1A48A 4E4TA 4WBNF 1T36A 3R9RA 4HNUA 3WO1A 5J2UF 3TQTA 1B6RA 2GPSA 2FPPB 1KJJA 4MV9A 3E5NA 5GONF 1EUCB 1WR2A 4WD3A 5CB4F 4ZHQF 5C1OA 2W6NA 1W93A 4IHJF 5JVLA 1GLVA 5CA0F 4ZOLF 1I7LA 1JDBB 4IWXA 4O7LA 2WYOA 1DV1A 2R87A 4O7TA 2NPOA 3V4SA 1OBDA 3VOTA 1EUDB 2NU6B 3JRWA 2GLTA
chains in the Genus database with same CATH superfamily
1RE1A 2PWYA 2AFHA 1QDEA 4N47A 3ENVA 1JJAA 4JJZA 1RJFA 1SRRA 2IF2A 3MM4A 3H5IA 1EWQA 2P2LA 3PW0A 1SIOA 3BILA 4EB6B 5BN3A 1H0HA 2B4QA 3ECSA 3HXPA 2HDWA 2PXHA 4CDRA 2J9ZB 3RAFC 2PS3A 1JQ3A 5EZSA 3Q15C 2Q4BA 3MT8A 4JX9A 3OAAD 5ESXA 3V1TC 3OQJA 4QELA 1M2EA 3ZWYA 5I4IA 2B99A 4DT1B 4ER3A 3HN7A 4R2KA 3T12A 4P98A 1AURA 2VJMB 4RLQA 1FJGB 1M0WA 2MMCA 4C5CA 2GA9A 3H5AA 5BWLA 4CEJA 5BWUA 3LDAA 4OHWA 5L7TA 2D0IA 2FGJA 2JIQA 4ZTZB 4JENA 1N0HA 2IDKA 4MRRA 4NTZA 2EXXA 4JI3B 4EEZA 2J9FA 4ZYYA 2R6CA 2XYGA 3IL2A 1SU8A 5JD4A 5EWFA 4RK7A 1LCIA 3TW7A 2LKDA 3S2IA 2VA8A 1JALA 3MJDA 4Y9UA 3G0CA 2HQBA 3JWEA 3OZBA 5G40A 3VR4A 3CO5A 3JAWA 3MAAC 1OZGA 4DVGA 4EMUA 3M9WA 4HPJB 1ECBA 3EMDA 4R2HA 5TX7A 1VGQA 4ZCIA 4WKPA 1Q74A 2EQBA 2XLCA 2KLHA 4LZJA 1NNEA 3M1LA 4ED6A 2I4IA 4Q4DA 1NNSA 2L82A 4RPKA 2C9CA 3WLAA 3GD7A 1XZFA 4HZUB 1A8QA 5JVDA 3DEJA 2RFLA 5LVAA 1ENYA 3PPXA 3VVLA 1Y6FA 3KJGA 1F51E 1GM5A 1SXJE 4WA8A 1O94D 2G9VA 3OCCA 5LQCA 4MWGA 1R0XA 3D4NA 4DPLA 2FPIB 4Y2HA 3SQDA 4EZBA 2O8CA 4NF2A 1ONOA 1ZI9A 3IKMB 4LZLA 2B8NA 4EG1A 4BZQA 5K0FA 3KHUA 2J30A 5F5NA 5SY4A 2ZE6A 1QYRA 3H8SA 2WY2D 2WYWA 5AJXA 3PVZA 3A9WA 2O9JA 5JLAA 2JLVA 1V39A 3L92A 1M34B 2J9YB 2JLCA 3BHIA 5DGDA 5AR1A 5BMVB 2GBPA 2QR2A 1J39A 2OGTA 2YCBA 3KWMA 4XTCS 4MV6A 1UPCA 3WWIA 3AUTA 3IA2A 1GNLA 1TZKA 4CM9A 1CHDA 2ZIVB 5KTRA 2PUGA 1NUQA 4FQ7A 3LWBA 1NWCA 3L8DA 2W6QA 1F2UA 3Q3CA 3JPWA 1H4VB 4UUQA 5FUWA 2ACEA 1Y8QA 2OV8A 4E4YA 2W37A 1A69A 4D26A 3UHOA 2DUUA 4B3HA 1F7VA 1QTRA 2BFBB 2XBLA 4AS3A 2P2GA 4CIVA 3ZD8A 3L1VA 1ATZA 4PCUA 1HLFA 4OMFG 4JVLA 1II8A 4ZU1X 2JBWA 2ZYIA 2VSYA 2ZIXA 3ECAA 3M6LA 4LS3A 3W8DA 3SN6A 5BVHB 5TJHA 3UJ6A 1MFZA 1NKSA 3PLNA 4FYYA 5EJGA 5KPDA 2UXBB 1LPMA 3EA4A 4PY2A 1IK6A 1GPMA 4LYGA 5KKNB 3WZMA 5L53A 3IEVA 2V7QD 4JQYA 4NBLA 2P90A 3JWJA 4Q24A 5IJAA 4ZEXA 1LW6E 1PJ8A 2G72A 1H6CA 4TVBA 1JU4A 4UMVA 4BX2A 1XB2A 1UXJA 4R8VA 3VHLB 2P5TB 3LLCA 5CLGA 3K05A 4K86A 1QO0D 2V7QA 2R2AA 4RSMA 3A4VA 4DG8A 3U09A 3ESYA 1KDZA 4DWVA 3FFXA 3F3KA 4F9GA 1EVLA 1PKXA 1HDRA 2QX7A 3EBPA 1BWPA 4OSPA 3TOCA 2JCSA 3PE4A 1P0QA 1ZYUA 2WHEA 4MRNA 1VI5A 3ROFA 3ET5A 2AKYA 3RI3A 4NBUA 3HU1A 4GGMX 3KCNA 3AF1A 5DSTA 3HDVA 3R3WA 4BB6A 5LQRA 4HEJA 1BQ3A 1XWWA 3WIBA 1N7JA 6REQB 3OQNA 4YDSA 3HA5A 4JJKA 3AP1A 1AKWA 2WD9A 3VVCA 4BFSA 1GCGA 3B5EA 3LT5A 5FD6A 1NW6A 1X8XA 1H2XA 2C99A 3L2OB 4RKYA 2I2BA 2Q27A 1HFKA 1ZN8A 4MUFA 2I8AA 5J63A 4PYJA 3K6RA 1W36D 3N43B 2PQ2A 3ROMA 2TRSB 2HNAA 4HTAA 3VJRA 4AWBA 2ERXA 2WVHA 2GM9A 3QKTA 1K06A 1NPDA 5HGXA 4INAA 4Q4HA 1UP7A 4KYIB 1EIWA 1L5SA 3WKCA 5ILGA 5JUWA 3NI2A 1HQYE 4QXQA 2X1MA 2CB9A 1PDOA 4ENUA 4IMPA 3MTAA 1W4RA 4BWGA 4YECA 1JHQA 1JIKA 1YC2A 2I33A 3GTMA 1E5LA 1JSXA 5DG9A 2EJ0A 1M2GA 3TQ1A 4EBEA 4BCBA 5MN6A 1Z4KA 2WT9A 4EELA 2O8BB 2X14A 1SC9A 2GA8A 1LBIA 4C0LA 2JGAA 2FMAA 1T0JB 1IRIA 2VHYA 3A4LA 3CURA 3DS8A 2D1RA 4D0NA 4O3NA 3EXG1 3MGKA 1KQOA 3SP1A 1QO9A 3DKKA 3ELUA 1KBLA 4H7DA 2OG2A 1EKXA 1U8YA 1WXFA 2HUPA 2PVPA 3FE2A 4XIYA 3OEWA 1Y8RB 5D3ZA 4FOPA 1CRPA 4I6EA 3OX2A 2VF7A 1UIMA 3RUEA 1NQVA 2CLDX 2FYTA 3QMMA 2JLWA 1CDZA 4FDAA 4LF9H 1B8OA 1XKQA 4E1AA 5IWAB 1T26A 3LTNC 1CNEA 1X3SA 4L5JA 3F98A 3ID6C 2JA5G 3GLHA 2ZJ1A 1R6BX 3Q7PA 1DMRA 3PEEA 3ZU4A 1E2MA 1IBCA 1UFVA 2HF8A 3PC7A 4GMKA 1RRGA 4JCOA 1YJ5A 5JYDA 2W2OA 3CZQA 4LF4H 4Y6RA 2QENA 3L0ZA 2HMTA 2OO3A 2XCSB 3HBMA 3IUJA 2FEXA 1X1TA 3EZ2A 1PK9A 4MQLA 3N2ZB 1P17A 4O5OA 5EWMB 4D3SA 1JIXA 3PC2A 2BR0A 4KW7A 1DL5A 1SG6A 2GD0A 3HP1A 4ZRDA 1R9MA 1YRQA 5JCJD 3RVLA 4V1CA 3VHRA 2WHQA 1L1RA 1KMIY 3R3VA 1QCYA 4AG5A 3GT0A 4TQAA 2P6PA 4XUEA 3WOVA 2QTFA 3K92A 1FP4A 2ZT7A 3LOQA 4REQA 1BAPA 3DE2X 1KC3A 2QQEA 1XSEA 2VOJA 3NP9A 5K01A 1CKMA 3HJUA 3GRZA 3K9LA 1VJRA 1IBLH 2W2NA 2YV3A 1CUVA 1EFRD 3OZRA 1TAEA 4F8JA 5CLJA 4NI5A 4ZVNA 3CZPA 4RFSB 4WFQA 1RHQA 3KLNA 4ZQGA 5EHXA 1JRLA 3M4NA 1BZYA 2MWMA 2GUGA 1UBEA 3PL5A 3ZQJA 2CNWD 4WJLA 3FOBA 1Z6PA 3SZ3A 4F5WA 1S1CA 4RANA 4N9WA 2AHOA 1TEXA 2HQRA 4PZCA 2HHLA 3UA4A 4JV2A 5K7SA 4DW8A 2WAXA 3BYZA 5LP6F 1G8PA 3KDPA 3VR5A 5IXYA 2JFUA 1UBUS 1YAHA 4ZQFA 4BP3A 2OE2A 1XKLA 4JLDA 2VXOA 5C51B 3FHOA 1FP7A 1PU2A 3JAWB 3OJXA 4O2AA 1TU0A 3E18A 3QIAA 4M99A 5G1OA 2Q4DA 3MAJA 4KC0A 4MS1A 4JEMA 4E14A 1GD1O 3QOFA 1Z0UA 3EUFA 2R1VB 4Q3LA 4GQBA 5IULC 4TXNA 5H4GA 3AF0A 5EUMA 4B3GA 1BX0A 2J0EA 2WI8A 3UWSA 3U1BA 2VAWA 4M1YA 1PFWA 3N0VA 1L3IA 1F38A 2X4LA 3L05A 1XD9A 3MCZA 3CQ9A 4HUTA 3X44A 5EP4A 2FMHA 1XI2A 4ECTA 1TM2A 4A6XA 3GT4A 1JEYB 4I5DA 1E8MA 4PEVA 4ZT3A 1KOJA 1BWQA 3DL7A 3LD9A 4JQCA 2XE7A 3LIPA 4G37A 5J23A 4BP1A 3D2BA 5DM60 3AHDA 3P7MA 3R6DA 2QSJA 4GX5A 4D6XA 2I34A 4MPDA 3F5DA 3UW3A 3C8DA 1EHYA 1L7NA 3LX4A 2IODA 3QK7A 5E9JA 2G07A 3DD1A 1N6PA 5CT4A 3BBPA 1O57A 3IT0A 5FPYA 1UR5A 2WJHA 1BX3A 1YZQA 2C5AA 2B0CA 2OXTA 5I4BA 5IJ9B 4YR3A 5BNTA 2J3DA 2AUNA 2VNSA 4I1YA 4XIFA 3VBCA 1P2UA 1RP7A 3O95A 2HRQA 4LJKA 4QGFA 5DHUA 5JAUA 1PR0A 1WDWB 2D06A 5CNMA 5AJTA 5CFRA 2JI6A 2FSUA 3EXG2 3SGIA 2GJ9A 5IZCC 3SX4A 5LWQA 2GRJA 4JOCA 4AJ2A 2VPPA 3QUSA 1IFXA 1PZXA 3QKUA 2Y4RA 4WZZA 4C20A 2YZ2A 3PPVA 5UKDA 4C1NA 1Z0AA 5KC9A 3TZCA 1P2VA 2OCXA 1G63A 3MJFA 3G9XA 4M7EA 3ZGOA 5DN6A 4ZV7A 3J80W 2IE8A 2P9JA 4KN6A 1HTWA 4DSAA 3UUFA 5AK4A 1X7WB 2JK0A 3HKBA 1DEAA 2WMOB 3JQDA 1W5SA 2C2KA 2QU7A 2XQVA 3C7DB 1KYVA 1HYBA 2PCJA 2JCVA 3GU3A 3QOYA 1G0OA 2X0SA 1WO8A 3T7SA 1QQAA 1H42A 3I9KA 4Y1GA 4D9NA 1MH1A 1Z4JA 2H52A 2BIFA 1VIAA 1AUQA 1XEXA 1GZ5A 1VCIA 3C3DA 1AS0A 3JD4A 1TJ5A 1Y3BE 3BEOA 4GRDA 2XOXA 1QXSA 3ANMA 2RIPA 2GZHA 4QASA 4BQNA 4E31A 4EGCB 5B6IA 1U2GA 2IJGX 1N3BA 4H1WA 2I03A 4ES6A 1O94A 1AS2A 1EGVB 4EQ6B 2F43A 5E6SA 1AN0A 4AU1A 3C3CA 4IRXA 3S5JA 3GXBA 4YDRA 1U98A 2LR0A 3PDJA 3PR1A 2ZFUA 3KVVA 4Q9IA 3ZU6A 1KZ9A 4PAMA 1DDIA 2VDWA 2GN0A 1T43A 3KXPA 3AOEA 4J9SA 1HLGA 1SNYA 3SFZA 4B7XA 1TM5E 4EDFA 1IWOA 5IWCA 4AQ7A 3ORHA 2EBUA 2BI7A 3G9ZA 2V4QA 4LJ9A 2J0QA 1KRWA 1ZO8A 1L7RA 2HQSA 2ZJ0A 5IXSA 1AHHA 2WU8A 1FFGA 1ND5A 1SUDA 1EFLA 3SEZA 3V7UA 4DWWA 3VKHA 3SHWA 1U1IA 2FZCA 1DUSA 4JNKA 1ML3A 5AHRA 5M3BA 5IT9W 1RKVA 1H69A 2B35A 3A4MA 4PCVA 3T3GA 1Z82A 1P33A 2HA6A 2NSDA 4BJ6A 4DDWA 1YQUA 5TMPA 2FZVA 1T0HB 2QRVB 3IQFA 2AHRA 3C6KA 3I8XA 4GPTA 4CG2A 2XYVA 1ZHFA 3REQA 1SPXA 1A8HA 1QPGA 4YAWA 2OXFA 2UXCH 2EG5A 3GK3A 5DNAA 4CL8A 5JQGA 3QVJA 4NX2A 5D7BA 1HH4A 1MHTA 1ILWA 3ES9A 3UKJA 4MWEA 5HUQA 1G0NA 2FLLA 4R2JA 4BEVA 1U2SA 3KFXA 4PHCA 4TMXA 3WLSA 1YIAA 1V7ZA 3KZKA 5AKIA 1L5HB 4DLLA 3HCWA 4DCNA 3U0GA 2MSEB 4CL3A 1XRMA 2Q0QA 2CKDA 4IIBA 5AW3A 4FFMA 1EGHA 2VATA 2HNKA 2Z0MA 2GCEA 3PVXA 3IQGX 1SKUA 3ZBPA 3TZEA 3OO1A 4C0WA 4FCTA 4Z2AA 4YJ3F 4Q1EA 5EKUA 3CEHA 5FTMA 2UUAH 4YEDA 4YCCA 1ACJA 4QVIA 4HXGA 4AFNA 4C2MA 1UBFA 1YDHA 3KOWA 3NC1C 2C9DA 2XXAA 4MVWA 4O02B 5JYCA 2BQUA 1L8QA 1V95A 4NJMA 4HNQA 1EDOA 2W4IA 3PZRA 1XMVA 4UUNA 3IP8A 5B1DA 5TLSA 1EJBA 2I8LA 2X22A 3LBFA 4ZO7A 2UVDA 5FA8A 3DE1X 4GXQA 3IDSA 3PYLA 5FLMG 1TCCA 2VYCA 1SQ5A 4DV7H 1NULA 2A9KA 2SKEA 1ZAYA 1W5BA 5DX8A 2PUDA 5AJUA 1ZP6A 4MUNA 3DVQX 5DF1A 3MT7A 5CT6A 1W0KA 2IDJA 1H5NA 4HWGA 3VUFA 3OZCA 1DQZA 1A76A 3C48A 3RSQA 3P26A 5IU6A 4QQNA 1X1EA 3AVWA 1E2KA 2CMHA 4AJOA 3PXAA 3L7LA 4K46A 4GP7A 3ROEA 3MUNA 3AHJA 1RJQA 3THOA 1LH0A 3JZFA 5EOYA 2XMSA 4LYHA 5CJJA 4F6LA 2R66A 4RCNA 5EI5A 3AR9A 4X90A 3DEHA 3FIJA 2YTZA 1DMSA 3D8HA 3NFRA 4TKZA 1MBZA 2GYWA 4V39A 2WC1A 2QLLA 5EKXA 1UH5A 1O95C 1RW4A 3R7DA 4TUYF 1ORIA 1SVSA 2A0YA 3KSDO 3MIZA 5JPCA 5KCZA 2HWWA 1H6DA 3NAQA 2G1KA 4DV2B 3LHSA 1ZUNB 4UQOA 5CLHA 2CEKA 1TA4A 1Z26A 2JA6A 4TXJA 3ZIAD 4EA9A 1RZRA 2C5LA 1ESZA 5AQ1A 2FPOA 2EJBA 3KYHC 3TL2A 3WIVA 1UZMA 2HPHA 4BBRG 2V9WA 1TEVA 1YONA 2GJAA 4MKGA 3TSYA 4B73A 1E2BA 4TYWA 2CNBA 1NZDA 4X7MA 4L5CA 3H9CA 1QVAA 2JGNA 2X5RA 1T24A 4C0XA 1WCIA 1TIPA 4OHMA 3DWIA 4DJAA 3PQ2A 1YDWA 3OSNA 2Y6UA 4NU6A 1JT2A 1UBRS 1MGPA 2PFKA 3D3EA 4Q1FA 4KDEA 4RFSA 1GZ7A 4MEBA 5JXIA 1RJPA 3L77A 4IPTA 4M0MA 4UBJA 1NC3A 5HDQA 3X1KA 4F21A 1KYQA 3AY0A 2VHXA 4UNRA 1SUPA 1BMTA 1IJFA 1Z33A 4BQOA 3Q9UA 4M37A 4L4RA 4CQMD 3UZOA 3KO8A 4QWMA 2YV1A 1KTAA 4UOEA 1YVUA 5AHXA 3NOXA 4WD3A 3E48A 4IGFA 3EFEA 5CB4F 2R1ZA 3MWDB 3MWYW 4JXJA 1IQUA 4DSTA 4RTMA 4ARSA 4NCAA 1KSFX 1D07A 1SVUA 2HREA 1JA1A 1B8UA 2VA3A 2FX5A 2QJWA 3E8SA 3IAS1 2ZM6H 2XSZA 3AXTA 3GWZA 4K6HA 4BO6A 4F04A 5B64A 1NQXA 1ZD5A 1O9GA 2CVHA 5C7OO 4LC9A 4H60A 3QVWA 4QO8A 5EJAA 1Y4ZA 2OC4A 3G13A 5ADWA 2I4NA 5KSYA 2D7JA 1LBQA 3M34A 3ZXUB 3PRYA 4J07A 3WG9A 2VHVA 4TTQA 5EQFA 2WJAA 5LXTB 4E6EA 3FZYA 1MJHA 3ZV5A 4HY3A 2VJPA 1QIDA 1YR9A 4LZZA 4NMMA 2XNDA 4H35A 3SF8A 4DCTA 1YVPA 3DBLA 3T7KA 2JGLA 2GK7A 5EXEA 4UULA 2J4FA 5B58T 3F47A 3OT5A 4RIFA 3F9IA 2DKNA 2VWHA 3QEMB 2EAUA 4MZXA 4D43A 4YY3H 3DCIA 4XM1A 1HT0A 2WLSA 3MCAA 1DQNA 4IRDA 4RHXA 3EVAA 3RSLA 2EJWA 4LVCA 3BA1A 3QG1A 1RJEA 2MYPA 2Q5QA 4E2YA 2OLKA 3G5AA 1N33H 1F5SA 3UJ9A 2XHEA 3ETNA 3UT5B 5K6TA 4QOHA 2HXYA 1KWGA 4RPGA 1JHRA 3GILA 2O3QA 2YYAA 4F8YA 1BGWA 1DO0A 4CFYA 1KH2A 2P4UA 3A2LA 4FR2A 3W05A 3IIIA 3KK0A 3RQSA 1OA1A 3WK5A 4NFHA 3DCJA 3L6UA 3O1LA 4S1NA 4YT2A 4NBTA 2DCMA 2C7GA 1KJNA 5F1KA 4CDNA 1BHQ1 5ALGA 5EP1A 5KYTA 3DAYA 4B83A 2YJ3A 2RKBA 4IIYA 4ZVUA 4GXTA 4KXYA 3TS1A 2AG1A 2H6EA 3L5KA 4HGNA 4DJTA 2DLDA 4BKPA 4WN9B 4RPJA 1A98A 2DT5A 1SC6A 1VZ3A 2ADOA 3NIFB 1GDTA 3SXJA 1G7SA 2WD8A 3M6VA 3FGOA 2IQIA 1KDTA 5I8PA 2NTVA 4YAKA 1UBLS 1Z06A 2ACWA 4DJFC 4HUQA 1VMEA 4JXZA 1XYVA 5DHQA 4N49A 3WAKA 2R65A 1D9XA 2WSBA 3GLQA 4ZAZA 1HL7A 2QQFA 1NY5A 2BCJQ 4QGSA 4R98A 5BYJA 3BUSA 4G86A 4OAOA 3LDUA 2FWMX 3L82B 1RWOA 3NCHA 2PQ6A 4YMUA 4GL2A 4B6GA 2HXSA 4F6RB 2G1AA 2GSDA 2XMPA 4J1TC 1VL1A 1TLTA 5B37A 1PZNA 4DDKA 2GF9A 2VJKA 2Y1DA 2JIBA 3TECE 2X5KO 3R3YA 1TVKB 3I23A 3IJ5A 4GBJA 2J6UA 4ZRMA 4BFVA 2YWJA 4TLEA 3T38A 4UHDA 3WO0A 4QBKA 1XZHA 4LRUA 3NAGA 4DL5A 2O1EA 1OAKA 3L43A 5DHAA 3LL7A 2H2WA 1WD7A 2EJCA 1A2KC 4B9AA 5A5EA 4Q44A 4OQPA 4JL8A 4DY4A 2Q2UA 4GYKA 4OL0A 1T1SA 2I2AA 4F4JA 1II8B 1L0BA 2APJA 2ZYHA 3TRFA 3PD1A 4WECA 1QYCA 1ODKA 4OHUA 1N4DA 3MR2A 3KAPA 4XIGS 5DM2A 2RSLA 4DLPA 3KT8A 3WDMA 5DIFA 5KOIA 4S1OA 2PGAA 3N8HA 4EDHA 4HXEB 1FS4A 2ANBA 4UNPA 1T2FA 4S1WA 2VJMA 4UCTA 1FS5A 4KGXA 4NBRA 4ZOBA 2Q3HA 5B2FA 4JP5A 4FILA 1G8GA 3SEQA 3WBBA 4GKKH 2CMKA 3GNSA 2FZWA 4H16A 4G0OA 4NV0A 2PD3A 3UQ8A 1P81A 5KTMA 1BKSB 4FYVA 4OBXA 3G82C 3RC1A 3UNXA 1RWVA 5D1PA 4F71A 2ASEA 3WDKA 2X23A 1EESA 4QBHA 3LT4A 1KC7A 4RSHA 4N0DA 4X0EA 4EEKA 3MCVA 2FDXA 1AUXA 1B0PA 3A6EA 1IBMH 4LVNA 4MARA 1L4GA 5ALYA 4RPCA 4KSYA 5NULA 3DE0X 5JMPA 2RH4A 4LQDA 5SYMA 1U8TA 3CYFA 3SQLA 1PNRA 3N0WA 3LP6A 2XKBA 3AZQA 4WCFB 4M0LA 1Q0SA 1T5BA 5IK2A 3WYCA 1H0RA 1SYXB 2XAUA 3TSWA 1SBYA 5J59A 1NG9A 4ML3A 4UPDA 4YP0A 3ZZUA 3ENKA 4H18A 4JLOA 4RVFA 5IT0A 1HG0A 2BMVA 4E22A 1QFJA 1I2ZA 4RCVA 4WSOA 2BEUA 3VZPA 3RRMA 3NBQA 3CNHA 1IUOA 2DWCA 3W9BA 4KIFA 4G5GA 3BB1A 1K6MA 4RQUA 3AJRA 3BJZA 4XDZA 4YO7A 3OPYI 1CERA 1HDZA 1Q91A 3I2JA 4X6XA 4LXUA 1BXGA 3TEFA 2V6BA 4EFEA 1MX5A 2OHIA 3WTBA 5HKKD 1A1VA 3QWUA 5C0OE 3N3AC 1XDSA 3RUPA 5AFSA 4ZI7F 3NH6A 3KIPA 1FC0A 5DYNA 1RE0A 3P9QA 2GVZC 3P45A 1A5SB 3A9RA 3BTSA 3KQYA 4U2KA 2FW0A 3ABZA 2UUCH 1JXLA 221PA 4RY2A 4X20B 1XJ0A 5L1JA 3BMQB 3MERA 4FNMA 2IFTA 1ZGGA 1DIHA 1ZQ1A 2A1UA 2ZRLA 3DBHA 3GFBA 3NANA 3FHLA 4JZKA 1FQJA 4JJ4A 3C6ZA 1U81A 4Q7QA 2CF5A 5IABA 3A28A 3IOYA 4QUGA 4XLTA 1QOPB 3TCKA 3V4OA 1NXPA 1WXGA 2G0NA 4G4IA 2CNKA 4A92A 2O8EB 4A15A 1GPDG 1N0UA 3D1JA 4GO1A 2CVOA 2RGGA 4LXYA 4V2IA 1B0ZA 3IXLA 3RGZA 3EFOB 1WDKA 2GF2A 2KB0A 4I6JA 2OWEA 2UXCB 4QSHA 3GRRA 4H7HA 4G8JA 4MA0A 3UB4A 3NC4A 2BMDA 3NG1A 3G5UA 5L4NA 4J9UE 4AUMA 2AOVA 3OZSA 4OCZA 5BSRA 3F74A 2CBGA 2EL7A 2OKCA 1VC2A 3QA3E 1XFAA 2Q9CA 4R05A 4YAJB 4CHIA 3GVIA 4CJXA 4DB2A 3EZ7A 4J03A 2GX6A 1NLUA 4N6NA 3SSNA 2QAIA 3PFIA 1CW2B 4MRSA 4OL9A 4C08A 4TV9F 2QPTA 5B2ZA 1SHJA 5AW7A 3DKPA 3O83A 2JASA 4IFBA 3X1DA 2JG3A 3AUUA 2PL5A 4UHFA 1B6GA 5JHGB 1TQ8A 2NQ2C 4IDCA 1VE5A 3H3VH 3ZKWA 1AQNA 1A0IA 2BDEA 2IYSA 3KKOA 2OFWA 5E4JA 1ZD2P 3MUFA 1F4LA 4RIIA 1IYZA 1X1SA 2LDBA 5KHLB 2OFOA 1FTWA 2CV1A 1B1CA 1I7PA 1KI6B 3RTEA 4FS8A 2ZGVA 3UQZA 3VR6A 4LRQA 4QXRA 4GNKA 4EF6A 2NP7A 1J5PA 5KFDA 2RGCA 3DG9A 3H1FA 5K3SA 4XWGA 4RZHA 2CXOA 3CUSA 1MJGA 4XB2A 5DHTA 4P92A 4ZRNA 4A3JG 1L4YA 5D84A 3WGTA 4MZDA 1QQBA 2DABA 2K5UA 4GKKB 1LC0A 1U63A 3JSNA 1IB6A 3NRJA 4OK3A 4E33A 4S12A 4DIEA 5TGDA 3UAOA 2QX4A 3F6BX 4UHCA 2DQZA 2EX1A 3UAVA 2CXTA 2VDLB 3GARA 3HU2A 4KACA 4L57A 1DWPA 4MA4A 1XF9A 5K0TA 4HNHA 3H0CA 4HB4A 4ZDKA 2ZIZA 5BUSA 4RNCA 4A4DA 1RDFA 4R9UC 2X0FA 2RHLA 5DJ5A 3OE4A 1R37A 4YJ3A 1LI7A 2V5AA 3H4BA 1P1CA 2VEDA 4UDXX 4IZOA 1YBVA 2PXCA 3KQQA 5JSQA 2Q46A 1HX7A 1CP3A 4HFMA 4PTLA 3ISVA 4U9UA 1H2BA 2C3OA 3EZNA 5F4ZA 5FWXB 4I5IA 3GLTA 1QG2A 4UTXA 1Z7WA 5FFFA 2WTFA 2HU7A 3OIUA 1USIA 5JOQA 3R4CA 2BUAA 1UJ4A 3REQB 1C9YA 1V51A 3D2AA 4L50A 3MN1A 1E4VA 2HNBA 3BZWA 3CN7A 4JLMA 1QIGA 3O4RA 3WKEA 4JOQA 2RGBA 3DM5A 4IFEA 3TTWA 4JI0B 1JAXA 2UYYA 1DQYA 4CM1A 4CT5A 1GL6A 3HQ4O 3O4GA 4W5QA 4N3CA 5EIEA 1XLTA 2GAIA 3ZGXA 5A7GA 2DYKA 4J6FA 1T5HX 2CUZA 3OIWA 4R1OA 2JZCA 2JGKA 4KK4A 4LCJA 3KHLA 2J3IA 4B3XA 4TTRA 3L0BA 1H2AS 3TSZA 5HJ7A 2XODA 1FTQA 2EARA 2H1IA 2Q4RA 2WABA 3IHKA 2FEWB 3DDOA 3RUIA 3V7YA 3VSBA 4D0RA 2VBGA 3GROA 4R1SA 3ITKA 4IILA 4EHLA 2B36A 3ZWXA 5HEKA 2ZJ3A 1P31A 2FZEA 2MIIA 2ZB2A 3ZOKA 2CZGA 4Q82A 4B6QA 5C8DA 1PT6A 1A9XB 4I19A 3EG9A 5I01A 2CLCX 3KQLA 5AW9A 3ILHA 3IKVA 4KGZA 3RSGA 2BT4A 3MB5A 1GL3A 4JMPA 4P4SA 3W5VA 2B69A 4L5AA 3U44B 1FFEA 1SKAA 4IUCS 1UK9A 4H4EA 1AH2A 2Q7XA 2WG0A 1B6TA 1SUCA 4X60A 1A72A 4KFCA 4ZPJA 5C2JB 4DLUA 4LY9A 1RRCA 5B1SA 1R16A 2CNDA 2A9FA 2WWHA 2GTIA 2ZULA 3T3EA 3TQHA 3WMRA 4CM9D 1KAOA 3Q3HA 1Y6GA 4MP8A 2D6FA 2LCFA 3KZ1E 4C3ZA 1EX6A 4KWCA 2FN8A 3I2KA 5AK6A 5BUCA 5F7OA 3I0NA 4DCOA 1CIVA 4L27A 4JV5B 2OSVA 1S96A 3B13B 4L5YA 1LF5A 3BJIC 4CMEA 1R4MA 2CCGA 1CY7A 5TPWA 1K5DA 4Z3OA 4NBNA 2IYXA 2CV2A 4X62B 3G5TA 3N2KA 2WUVA 3Q8QB 4YLEA 3PC8A 3VAYA 5KSOA 3FCOA 2G9UA 5IDWA 3JZDA 2YHUA 5HKLA 1WU7A 4LJLA 2QZPA 3W2IA 3G23A 2D1YA 2BQRA 2JHCA 4OPMA 1RJ9A 3WGMA 3L8CA 4CM6A 1M34E 2A1HA 4JB3A 4I50F 1IHDA 3DMHA 3AR2A 1HMYA 5EMMA 4FMCB 4MR7A 4OD0A 5FNVA 5JXJA 4DN6A 1GEGA 3RIZA 2A30A 3UKDA 1D4FA 5LQUA 3EEBA 4YV0A 5EJ5A 1ZNWA 3OQMA 3T6KA 2XUFA 3OFNA 4EARA 1XPJA 4XQ0A 3GEHA 1CZOA 1PDWA 3BHJA 2GARA 5JXGA 2AKEA 5BN4A 4TXHA 1YIDA 4XCXA 2BTQB 2NSYA 3DLAA 3DZIA 1KMMA 3HGQA 2ODEA 3HJRA 3PX2A 1QVZA 3SF8B 3RJZA 5KJ6A 3WNBA 1GRCA 4K6FA 4LECA 4E0BA 1GZ6A 1EBFA 2PWBA 3GCDA 1KGDA 1HE8B 3RG2A 5EJ7A 5F9NA 3UYYA 1OWTA 1F20A 3NBMA 1HYHA 1Z35A 3BF8A 1Q57A 3L1HA 5HQ3A 4J2HA 2OB2A 1TTPB 4CF7A 1ACMA 2J45A 2H63A 4KZPA 4UARA 2W6OA 1IHUA 4WNAB 1I24A 3QG5A 4M1TA 3H3JA 2OCYC 4LRSB 5FBQB 2QTGA 4YT5A 2X9LA 1VBGA 3CPSA 2ODBA 4H2DA 2HSZA 1OX4A 3QEAZ 2VWGA 4BB0A 1I7SB 2IUUA 4CFSA 1ZSNA 1RYZA 4DQUA 5DTJA 2Y66A 4L07A 2OHXA 1U3WA 2XI4A 3WWZA 5K0EA 3L06A 1NVBA 3WL6A 4C14A 3BJRA 3C1AA 5JASA 5D1HA 5LXTF 3PYXA 2R9VA 4L9SA 3BMNA 4M9SA 3SKVA 3M6UA 4D74A 2WF5A 4ENVA 4HWSA 5CD9A 3QZ7A 2DPJA 2HK9A 3WL5A 3FR7A 4D1YA 3ONFA 4UTNA 4CC6A 4B44A 5EIAA 3JQRA 5BQPA 2J3HA 1Q44A 2QIOA 4I4LA 3EFHA 3QWFA 5J4HA 1TCVA 5L4LA 1CZLA 2Z4RA 4LISA 4R51A 4RU9A 3WMWA 2IUYA 2QRJA 3RU9A 4HRXA 1O6GA 4UTZA 4ESVA 1NNLA 5BWRA 1RCTE 2JFBA 1J8FA 1I80A 5AOVA 4CV0A 4EJ2A 5KMGA 1FDRA 4MV4A 2ALZA 3GJ5A 5JG7A 2WAYA 4DMCA 3PI7A 4CMDA 3JU3A 4CEIB 3FGZA 1TWFA 5AOCA 1B16A 5FNZA 3TE6A 4A2PA 2DFDA 3P97A 1N8KA 1WVGA 1FQOA 3F46A 5DASA 1TMGE 3PJFA 3RIMA 1XEAA 4ZAYA 2J6HA 4HO1X 1IN7A 1CS0B 4DA7A 4EUSA 4WGGA 5JADA 4CZ2A 2CGEA 2VQ3A 3I1JA 2Y2UA 3EODA 4ZZ0A 3VVMA 2DGDA 4LJ7A 4I3FA 3AFIA 3GFTA 3E27A 1F6WA 3GZNA 3KBOA 2I6FA 3OZAA 4KWTA 1MKYA 2PAAA 3H04A 1CTQA 1DAIA 3BXHA 3R3HA 4NDNE 3I2YX 1JBEA 1ESEA 3D6AA 4IDOA 4INJA 4W5WA 1W6RA 4Q6WA 5L7WA 4CMHA 3K6SA 1PV4A 3W3AA 1Z2DA 4B40A 1KKUA 2FG5A 4DM3A 3QZ8A 1PI3A 3M6WA 4AYBE 2GH1A 2PSDA 3ABQB 3ZDXB 4JLSA 3DFKA 4K03A 1LS1A 1WQ1R 5F1PA 2QT1A 4BC1A 4BQEA 4AKIA 3IILA 3IMFA 4GZLA 5ER9A 3G49A 3G5LA 3RF7A 1T2VA 1P73A 1VDMA 5BSGA 5FUBA 4Y1RA 3ZQ6A 5GM1A 4K1LA 1S2GA 1V35A 4B3SH 1LPNA 4R71A 4Y0NA 5JTUA 2ZTVA 3GMIA 4P84A 3D8SA 2EV9A 4HAWA 4N03A 3SBEA 1FMTA 5CK4A 4KFSA 1N1MA 1MCZA 1MNAA 3BK1A 4QRHA 4G84A 4L9AA 4E30A 5ENDA 5A62A 4UFPA 2FK2A 4CHGA 5BURA 5A7FA 3RIGA 3WWPA 1QHIA 3OKFA 4ESOA 1NQWA 2XA2A 2Z2IA 3LJKA 3SE0A 4F3RA 2VHEA 3A6JA 3I9V6 2WTBA 2GZ3A 3F5SA 3H9GA 4C01A 4A3MG 3AG5A 2XUZA 4Z1OA 1OZHA 4TV8A 1RQNA 3UICA 2HMAA 5J43A 4D3FA 4GVLA 3K73O 1GGHA 1JILA 1L3BA 2P67A 2VUMA 1OI4A 4JI6B 4QTTB 4YMGA 4LYYA 3RAQA 4ECRA 1E6WA 1QPBA 2ZJ8A 2ZI9A 3L6BA 5A3SA 3RVRA 4AKGA 1EAMA 2X2EA 3QEKA 3LQYA 3ZE1B 4ZC8A 3QYPA 2M6LA 2HMSA 3EPLA 5CYPA 3SMVA 1K0FA 3GRPA 1M7HA 1V9LA 2ZRIA 3QEJA 1ZW1A 2QTAA 1EGQA 4ITUA 3ZK9A 3VC3A 1U7PA 5KNDH 3PGLA 2ZAGA 3HUTA 1LJUA 1QH1B 2AXQA 3R6GA 2XECA 4M7PA 4NJMB 5A7HA 3CG4A 4NYEA 4Z49A 3BJEA 3P0IA 2EZTA 3GZJA 2QTVA 4QIWA 3DR5A 3F71A 4JH0A 2F90A 4TS9A 4G9GA 3G8CA 4D0GA 2RAVA 2GESA 4J3JA 3H99A 2D8MA 1C4XA 2P0EA 4CKWA 5KQMA 3HU3A 4BAZA 1JFRA 4E5PA 3WWJA 1EFTA 3M6IA 2OUIA 2R00C 1V8BA 1J2RA 1HF3A 4NOLA 4V3CA 5JS2A 5JSFA 1E66A 4MCHA 4EI8A 2XB9A 2R44A 2GKSA 3IRUA 5CURA 3C41J 4ZI3A 4ND3A 3EGDB 1X7WA 2XAAA 1VL2A 3MMPA 4H6XA 3OLXA 1PVVA 5E1MA 3O3MB 4ZVSA 3EXIA 3BTOA 3R3JA 4BNHA 3NRBA 4FBMA 4PG5A 2F4VB 2HA4A 1CUGA 2BEKA 2D13A 2JARA 3HV0A 4P38A 3ZDYB 4L8VA 4PAQA 1GSOA 4DOMA 2ODAA 2VPIA 2HM7A 4UEQA 4YS6A 4BXXG 2CFCA 2H54A 2IHJA 2ZJYA 5HNKA 1SUBA 4MWZA 5B7NA 3K16A 2VHUA 3IP5A 3GV8B 1U2TA 4MYTA 3D6MA 2GZRA 1Z88A 1NN1A 2OO5C 5E9WA 4EVIA 1HSZA 1ZG3A 2P9HA 5CGQB 2CY0A 1ONPA 2YWHA 3HMKA 1ST2A 3BFKA 4KV9A 4YHBA 8MHTA 3S70A 4JA0A 4TGLA 1O89A 5FEMA 3X1YA 1MABB 2UV8A 5BWVA 3PWSA 3AF6A 1OXSC 4X8HA 3T06B 2DWQA 4U5XA 3TK1A 3R8FA 3ICVA 1TDJA 1D7OA 1RXIA 2YWGA 3AB8A 3I8SA 3KB1A 1VMKA 2WM9B 3JYHA 4JUBA 2GM3A 2GRAA 5COQA 3KSBC 2XY4A 1Z6TA 2VHTA 4G5XA 4CMAA 5DSXA 1ODSA 4UDYX 2BCEA 4XFKA 1LQ2A 1NVVR 5K3FA 2DLCX 1VBKA 3S24A 1XJCA 1Z12A 5DO9A 3W6PA 4S2UA 1E3JA 3CTMA 3E7WA 1ABFA 4B81A 4QO7A 3C5VA 3UAGA 5CXUA 2J48A 3WIEA 2YFHA 3BAFA 1N9GA 3D3NA 3N8GA 5IG2A 3Q6MA 1JXQA 4NYJQ 5CDTA 4R8UB 3B7GA 3WMEA 2EYQA 2VEOA 4EJ0A 4RV5A 3CH4B 3CW2A 4P3XA 1IYDA 3HB1A 1AF7A 2G5TA 4NVRA 4D8TA 6PFKA 2GPTA 2CFTA 2YWXA 3GNTA 4LIPD 3GLGE 3OJLA 2AN1A 4QBGB 2ZUWA 2A5DA 3P9YA 4J0JA 1X77A 4U7HA 1W9MA 2G1UA 4C0SA 1CUWA 3PT5A 1EJ6A 2W8KA 2WQZA 1ZX1A 2INGX 4P81A 1VOTA 1QCCA 2BEUB 1GUZA 2JZNA 1DP4A 2XCOA 3OJFA 5DFAA 2LDXA 4KZKA 3ESRA 4KR3A 4DR5H 1I2KA 1P5HA 2X0KA 3IPRA 1RZ3A 2Q8PA 2JGEA 5JEDA 1YUNA 3H2JA 3HR4A 3TIXB 1KJ8A 2IOFA 4IOMA 1SB9A 4P5PA 4XX0A 3OQIB 4MR8B 4QPPA 4D45A 1LLUA 4E5MA 2PX0A 1ILEA 1BCSA 1VHDA 4LGCA 3DC2A 3T7DA 4JI6H 1V7QA 1C9KA 3CT4A 4FIZA 2Q7OE 3QLUA 5D3QA 3O74A 1ISRA 1M1YA 2ZAMA 4EK9A 2CXPA 1O87A 1FS6A 2ZB3A 2QX8A 4KQEA 2CCKA 1FEZA 2VUSA 4Y1RB 4JUFA 4L9WA 4AMZA 3PDHA 2DPYA 1XVUA 4LHYA 4TL9A 1Z22A 1GFWA 1R1DA 1YCDA 3GJ0A 2CNWA 5JRJA 3IA7A 1I7QB 3OETA 1BN6A 2ZVJA 2C2YA 4U2DA 4ON9A 2VQEB 1EKFA 3MWMA 2XDAA 3GPCA 5DWVA 4AURA 3IP1A 1QOQB 2MR5A 1S2MA 3KTFA 3O9VA 2SHKA 4G81A 4JKIA 2VNJA 3V80A 1PJTA 1J8YF 3F3MA 4BVBA 1KNQA 3K9HA 3CZRA 2PJUA 1HT2E 1KEEB 5DCUA 2BFDB 2ZJFA 3NUQA 4QT0A 5ALKA 3JR7A 3LQQA 4LHEA 5JD3A 1KZ1A 3IHTA 2Z43A 3NC0B 3V8VA 3VH3A 1AK1A 4BVLA 3HA2A 2AFIE 1UXIA 4UFOA 1KZ6A 4HNAA 2B8JA 4E32A 5CT9A 3S2SA 2ZM6B 2WRZA 2R8XA 2AXNA 4F1WA 3RYHA 2VT7A 3TL6A 4QU0A 4TKVA 1ORDA 1QG0A 3KKZA 3LY5A 2HSDA 3CBQA 4EYQA 4DC9A 2XUHA 2JJYA 5EP3A 3TEMA 1N78A 3W5JA 4V0LA 1O4VA 2OO5A 4XD7D 1X6VA 2CLOB 5GZ6A 4JBIA 4MKRA 2QUKA 1CQIA 5AHWA 4BB5A 2ZRMA 2GPYA 1M72A 2V7UA 3PTLA 3HKEA 4ND2A 4G6ZA 1OFUX 1DO2A 4OAPA 1AM4D 2WKPA 4F12A 5KYWB 1NR5A 5DNUA 4JLPA 5D1OA 1G20E 3IEPA 3L8YA 2ZRNA 3WLKX 3CVOA 4DMLA 1ZU4A 2CVQA 2QMYA 4NPAA 1NQAO 1TOAA 3ETGA 1N7GA 1NM5C 4ECXA 2EWMA 2YN0A 2YXLA 2ZWAA 3I64A 3L8FA 3Q88A 4I4CA 3BWCA 4IL5A 4MGZR 4YPFA 2VDRB 4H1TA 3SYNA 1V3UA 3DHWC 3WLFA 1O1YA 3WK7A 3OKAA 1QRDA 2POCA 5HNEA 3OG9A 4YX9A 4JI7H 3H3FA 3NRCA 4EW6A 4G01B 3VPXA 3B9PA 1SBIA 1R0BA 2JI7A 4G1CA 3RC2A 2HR1A 3ILSA 1GYQA 2MYUA 4MYHA 4U63A 1EM8A 4URVR 3IV7A 4GQAA 4N5MA 1D0VA 1G9XA 1CZNA 4Q02A 1NWHA 2VUMG 1LVUA 3COWA 2QL5A 4FFLA 3FKSD 1CETA 4EJSA 3U56A 2SECE 5LDDC 3GTGA 1OWNA 3PFBA 1ECCA 1SK8A 4AQDA 4JJAA 4O4IA 4DAEA 2F3QA 3BIOA 4LV8B 4YRCA 3U1TA 2Y8EA 2FUEA 2YWFA 3KZMA 1QZ3A 4ZMBA 4CTNA 4F46A 1QS0A 1Z15A 3GT3A 1ZESA 1I1OA 4IGAA 1QH8B 4HH1A 2E5FA 3OTOB 4EPVA 4GWGA 4XFDA 3AF5A 1T9ZA 4IV5A 1G6KA 5LOVA 3OLYA 1YFKA 1TUBA 4GGOA 1U02A 3KB6A 3U3DA 1W96A 1DAAA 3NHBA 4X3CA 5LU8A 2Y92A 3DAOA 4J9RA 5ECDA 1NP3A 3E3NA 5ADUS 1PE0A 1KVQA 4KO8A 3AKDA 5CM8B 3D7KA 4O08A 1PFKA 5BVGB 1IOVA 1U7OA 4X5OA 5GQSA 1BDMA 1OXVA 4HNRA 2XWSA 2HK6A 4N3GA 3RIXA 1B8PA 2ODNA 3SYMA 3W6NA 5I7WA 1UOOA 1BE6A 3DXYA 4MPJA 3W3ZB 4CR7A 5LP6B 2CHUA 3LLMA 4BYGA 4YCMA 1L2ZA 1G38A 4WRRA 3QVLA 3MWFA 4FEAA 1SBTA 1I01A 1SCNE 2H2FA 3F5QA 3MQFA 3C8UA 4G25A 1NUHA 5C8ZA 4EMTA 2G80A 5C5EA 5HVNA 1M7JA 2NU6A 3NOQA 1O8CA 4LNAA 4M1MA 1AB5A 4Q4HB 1UMBB 2YRWA 4BLUA 3RRJA 3L4BC 1USGA 3HC7A 4C4TA 2WF9A 3AHFA 2VP9A 1E2UA 4PFKA 2OFFA 2GN1A 2G0TA 3OT1B 5BR7A 1GTVA 3CM0A 4NJOA 4QGHA 3E82A 4TL8A 3NGDA 4O7VA 1U4SA 4WXEA 3CRMA 3T7AA 3U13A 3ZOZA 5CFZA 5DGXA 3LBAA 4JC5A 4OLBA 5EJ6A 1CG6A 4WINA 2E6UX 1HT1E 2AJCA 3UCXA 4B3DA 5I7RA 1E5DA 2OQRA 4IM7A 3JQ7A 2PLFA 3MTBA 621PA 4PBCA 2OHJA 4LZAA 3HM2A 1LNSA 5B5SA 1WCWA 2YRXA 4EB0A 2PEZA 4HYKA 1EFVA 1E5VA 4N4AA 1IHPA 5EE5B 4BJ1A 2F1RA 3R0VA 3OEYA 4XR9A 1Y1VG 1REQA 4CI0B 2IP1A 1CC1S 4DLAA 4KVFA 2O2SA 5C37A 3ZWVA 2OAP1 3LSTA 4I9HA 3ON5A 3ZWAA 2QX6A 2PN1A 3C6YA 5JALA 1PR2A 1EDDA 1DNPA 2W2LA 4NCJA 1F0PA 1Z4LA 2W8LA 3ZX4A 3PHBE 2O7RA 1WV0A 1E4EA 3HVHA 1YULA 1ZMXA 3ZCPA 3MB8A 3ZU5A 3JVUA 3GAZA 3O4VA 4YRSA 3ELBA 1A9RA 1RADA 5BVHA 1VB3A 4PLGA 4KXWA 4F96A 5AVZA 4E3WA 5TE9A 4JB0A 2M9MA 3BRQA 4PQRA 2PO7A 4FI3C 5AHOA 1UMBA 3PNLA 4ZAVA 10MHA 1VYTA 2PBRA 1C1HA 2E6KA 2VJAA 4OB6A 1DJLA 4EAQA 1LX7A 5AD1A 1ZM2A 4IUBS 1OV6A 3BXPA 4ED7A 4IJMA 2GZDA 4EO9A 3M83A 3DZHA 1OASA 1PV1A 1ZWKA 2FRVA 3B6IA 3R41A 3GWGA 4KWIA 5FWDA 3J81k 1Z5VA 1O5OA 3URKA 3MOIA 4YN3A 2W0SA 3I9V1 4RDHA 3X1JA 4X65B 1MO4A 3NBZC 3UXMA 1NN0A 4KQIA 2QL9A 1W88A 2TMGA 4QVKA 4EY8A 4DQ0A 1FQWA 1Y7TA 3TLBA 2OUKA 4BO7A 1RK6A 4QA9A 4L1KA 3T5KA 1GCIA 1M8FA 4YUWA 4ZGBA 4QOGA 1VM6A 1PQUA 2GK3A 4ECAA 5CEJA 1SXIA 4ETMA 1KARA 2TSYB 3WWOA 4H6WA 3FJYA 5F77A 3H5WA 1WXEA 1PR1A 1D9ZA 2I7DA 2C3MA 4HDSA 5DEIA 3MILA 4PSVA 3ZBTA 1ADJA 4YRKA 3WHIA 2XUPA 1CY1A 1ZH4A 2DJIA 1PS9A 4BFXA 2EKDA 1JIJA 4QDKA 4B71A 1KVSA 2BKLA 3N59A 4OXKA 4RKEA 2GMWA 4TV8F 2O0JA 3M4JA 3HH8A 1JWAB 3MF4A 4ZKEA 1GAEO 3WL8A 4F9FA 1BN7A 1KRHA 4KPUA 1YJBA 4N65A 2EFDB 2PRIA 2O06A 4WLNA 3WGLA 2RK6A 3BPSA 3AKZA 2C97A 1PSZA 4Q43A 1DVRA 1LDBA 2QR5A 4AIRA 4D4MA 3PJEA 4JBGA 2O59A 2L18A 4QDOA 3ZE7A 5FL7A 1P6UA 1OX5A 1QAMA 1CE8A 3IO5A 4F4YA 5EGSA 3W3AH 2QGNA 2HN9A 1N36H 1F12A 1VJ5A 3BT7A 4HGRA 1CFZA 4U0KA 5DBEX 1KT8A 2R8EA 3KUKA 4C1BA 4DDUA 5SZIA 3ANSA 4DR7H 2B1JA 3D3QA 3AO0B 2XADA 2OBXA 3I9LA 2BCGY 2Q6IA 3HCOA 3KC2A 4JQSA 4JLAA 1S02A 1T8RA 2X86A 1U8FO 3BMOB 1EXWA 4LOLA 1XPRA 1P0FA 1MEEA 5E4FA 3GFPA 3HBLA 5JC1A 1ZUIA 5YASA 1LV7A 3OCWA 3EJ6A 1JB1A 1TW2A 1O97D 1N0VC 1Z5WA 4MDHA 4NU8X 3LP8A 2PLWA 5A3QA 4PR0A 3SZRA 3OTGA 2QA5A 4RXTA 3HYTA 4XPIB 4DA6A 5BW8A 4MDEA 1DIBA 3J81W 1NI3A 1SUAA 3GDFA 3GEBA 4NG4A 4ZALA 4J4BA 3G2PA 2AFHB 1N8SA 2YW9A 4BN4A 3HCFA 1Z0FA 2W6MA 4Q12A 1L7XA 2IA5A 1VA4A 4B2YA 4CQMA 3NW9A 4KQJA 3DJFA 2B34A 2BFCB 1UJ5A 1E3MA 4H0NA 4TYMA 1XXLA 1CT9A 2PZBA 4EW1A 1Z5UA 3L7YA 4MUAA 2ILTA 5IC4A 1P2BA 3CQZA 1R0KA 1ZAUA 1X2EA 1YZNA 1T5TA 3Q8PB 2DPMA 2DTXA 2I6QA 3MTEA 3OEEA 4KX3A 4OO3A 2X8BA 1M6HA 4AW9A 4BX0A 4QUKA 3F73A 5F3WB 4WV3A 3AONB 3C5HA 1BVYF 4MS3B 4NPHA 1PQWA 1NDHA 3AUAA 1F0NA 2ZANA 4RHCA 5IH3A 4G3IA 5ARBA 2SBTA 1JFFB 4GAEA 4K6CA 4MQFB 3ZXYA 4EG8A 3FPHA 3TQTA 3PQ7A 4CV1A 4MPPA 3PE6A 5BQ3A 3DOFA 1QR2A 2ZTSA 1FYFA 3BE5A 3EASA 3E5NA 3O4FA 1PT7A 5BNIA 4DUZB 1QF6A 2I1WA 2KWIA 4XGIA 2BHNA 3GAMA 2AH5A 3G6VA 4N40A 5BYBA 1E7QA 1J5EB 2P9TA 4OXYA 4DLVA 1SRQA 1ZCFA 3CPHA 4DBLE 1NATA 2BUBA 3R5TA 1PNVA 4OUDA 1L5LA 3O7WA 5BXYA 2OGWA 4K9DA 4UREA 2VT2A 3A4NA 1DV1A 3D7MA 4IRMA 3WB9A 2VRCD 2H5IA 4KEAA 5K51A 5A71A 4RXMA 2Y9PB 1LI4A 4RF4A 4UXIA 4V0MA 2JPDA 2MSKA 5IYBG 2ZYUX 4G8DA 3UH0A 3G0GA 3V4SA 4IAOA 4IDGA 1D8TA 2WM3A 5ALOA 1FTNA 3JQBA 3KWFA 2GBFA 2V8BA 3JRWA 4OG2A 4QQ8A 2V0NA 5AJYA 2QUIA 3NYIA 1D1PA 3QWIA 2A67A 2GBGA 1PWHA 4TM5A 4LBVA 3FXAA 3I45A 3S2ZA 1DEOA 2BTEA 3GPDG 3ZJVA 1CQWA 4C07A 1D1QA 3SXPA 2BC9A 1Y7PA 3H17A 3MBOA 2CD9A 3VMMA 3DR3A 4M0KA 3K8ZA 2F1KA 2IUTA 1LS6A 4RGYA 1AV7A 1WOYA 3QF4B 1FPMA 3O84A 3U0VA 3AIMA 2Z8ZA 2B3TA 4A73A 4NCIA 4Y30A 4EYSA 1WSDA 3M4YA 3QJGA 4RH3A 5CE8A 3EC1A 1OBGA 2P1ZA 4O2BA 4ILKA 4LBYA 5SICE 3MJHA 3KSRA 3ORYA 3WL3A 2NYUA 3UWOA 3K71B 3A6GA 3GGSA 3LUPA 3CSSA 2VA9A 1WB5A 2IBSA 3IB3A 4X8LA 1P9OA 2HJRA 4TLAA 4XWYA 3MFHA 4P4LA 1RPAA 1XAIA 3NKFA 4X63A 1O0SA 1E5QA 3C3KA 1V43A 3OHMA 1HKHA 4RFVA 1ISPA 1RAFA 3P9KA 2AZTA 3U60B 2UZ0A 4H3SA 4AM8A 4HK4A 5FX2A 1J00A 1M6WA 1S9DA 5KX5F 4FWTA 1IBKB 1XF1A 3RASA 2JFXA 4X7PA 1VPTA 4FOSA 3ZE6A 5ITWA 2WHYA 3IT3A 3NHAA 4BVJA 1O58A 2M32A 2W2XA 1UBNA 1XVVA 2V7VA 2D7DA 2ASJA 3AJDA 3RYCB 2DM6A 4YMIA 2H29A 3FYUA 1XZLA 2O7SA 1FB5A 3RKUA 1PTJA 1QUFA 4LX8A 5D00A 1U8CB 4KMSA 2IOYA 2XUDA 1DXOA 1HZZC 4YRTA 1XD2A 1EU1A 1GGVA 5I9MA 3GXOA 5BWMA 4YJ2A 3H3XA 4O7SA 4GOKA 4ZICA 3DMDA 1KDYA 3GLHE 4YT8A 2FNAA 2P5UA 4F5DA 2WF6A 4J9NA 3EXEB 4JK3A 3D64A 1LY1A 3KKPA 1VG8A 3D6UA 3PXGA 1E9FA 5KCMA 4X65H 3GRYA 5HKBA 1WE2A 2O1WA 2OPHA 2QR3A 3W90A 1SIBE 1B00A 1EFPA 4JEIA 2XGJA 1DIKA 2IC5A 1I2CA 5F5LA 5HBRA 1YI8A 3C0KA 1AO0A 1JU9A 2BVNA 4KVAA 1J56A 4AYWA 4IRCA 3R9XB 1FSFA 3TJZA 4LF8H 2W6ZA 3RE1A 5MFZA 4D9JA 3C3JA 3QXGA 3A4IA 2P11A 1YDMA 4I4NA 3PFHA 1Z7GA 3UZBA 4Y0AA 3AT1A 1P8AA 1XXHE 1EVKA 4J7CA 2ZYSA 5GAJA 1PD0A 3W9YA 4FFOA 5AVUA 3GJQA 2VZEA 2IX3A 3Q11A 1QRTA 2EL9A 4KTVE 2HF9A 3QU2A 2BOVA 3LT2A 1ZJ6A 7MDHA 3F5MA 4ZI7B 4MQUA 2ILVA 1AF4A 4WN9A 1SA0A 2CLKB 2AKAB 2X0IA 4Q1DA 3EC2A 1B26A 1U1EA 1UBGA 3AFNA 2YUIA 1Y5RA 3ZW9A 2W42A 3LVBA 5TQVA 2VBIA 2AK3A 2JNWA 1YU6A 3N0RA 4EG4A 5CB4A 1P5RA 1SVKA 4HQOA 2FQYA 1ZJJA 1J8MF 2ZJZA 3N86A 2O8BA 3T3DA 4BKMA 1J2JA 4ICIA 2W98A 2ZR9A 4YUZA 4G09A 4WESB 3OY7A 5HXAA 4B87A 2G1JA 1GCOA 4RAZA 1KAGA 1ZNQO 1XZMA 4E09A 1N32B 2D4AA 4CYMA 1XMSA 2Y77A 4YJKA 4B7CA 1K1QA 2CK3D 3QNWA 3F78A 2VH5R 3E84A 1RYBA 2AJDA 2IIBA 2QX9A 3OTQA 3TJMA 3NH9A 2PX3A 4L8YA 2VYFA 4JBNA 2JFZA 4EYIB 5EKSA 1IXKA 2PQ0A 1XTRA 4J6EA 3WV5A 4A82A 4QBIA 1V71A 3EF1A 3N76A 1N2ZA 4A2BA 1OTXA 2CXSA 2G9QA 2RAFA 1E3EA 3A3PA 3H42B 3QI2A 4FYHA 5A9TA 2RH5A 5ICEA 3UMMA 2FE1A 2I6SA 5EP2A 3IOEA 2GRUA 1XMJA 5A03A 2Q50A 2UUAB 5LMUB 1WUKS 4H08A 4PYLA 4LY0A 1ZGCA 2H1WA 2JK1A 4M8KA 4W8OA 3WC4A 2BLNA 3E0XA 4OFZA 4ITVA 5K3EA 3E9YA 1DBRA 3UHFA 3N0TA 1D6NA 1HE3A 1E7RA 1S8OA 2D3TA 1Z16A 4O1IA 5LMZA 5H9WA 1ARZA 1K98A 5BNZA 2KSWA 2AEJA 3C6BA 1C9EA 4X93A 1QO7A 2NU8A 2FPRA 2V7PA 1CK4A 4AB1A 5EWLA 2RHBA 3NV7A 5BR8B 4UFZA 1V7CA 4NBWA 1NUAA 3HCBA 3LNCA 1YGPA 2KJQA 5PNTA 1RJ9B 4JAVC 4UNQA 1R4NB 3PI6A 4RKRA 4TVOA 4ENRA 3CR7A 3EXHB 1V41E 3BGIA 2BFWA 3TTTA 4BZPA 2XX3A 4R3UC 2TS1A 5JV5A 4LMBA 1M2KA 4O4LA 3VAZA 3G2KA 3KYIB 3QU9A 2D0DA 2ASVA 3K7EA 2RHOA 4EW2A 5C5CA 3EBLA 3C1OA 4YRMA 1CUDA 2B21A 3GI1A 3ORRA 1DKLA 1WCIB 2VF2A 4OLAA 1NG1A 2M1ZA 3LC2O 2WW8A 3DCNA 4V0RA 4DV2H 1I2MA 3VDQA 3LG2A 2BAGA 1SY7A 2IYAA 3I01A 3R0ZA 1BMDA 1NW4A 3EDCA 3IVXA 3DT9A 3RC7A 2DHDA 1USUA 4QG3A 1V4YA 3OQHA 1PFUA 4O4LF 2PFGA 3ADCA 2PT7A 5ALJA 3CF4G 4I08A 4ARIA 2HJSA 1GFZA 3BORA 2XZLA 2D1SA 1J49A 2MSCB 4H7EA 2PH5A 1V7PC 3AB3A 2H0QA 2V5VA 2J5BA 4LF8B 1WQ4A 3C6MA 3RAPR 4HVCA 4YH1A 1WRBA 4CU5A 4DJJA 2O5EA 2OM2A 2O2HA 3L1IA 3SS8A 3ZVKA 3PFWO 1FLAA 4IZ6A 3T1VA 1YQEA 3PK0A 1SVIA 3DOEA 4QLAA 3IR7A 1MR3F 1VP9A 5AM0A 4EBFA 1E92A 1W5AA 2FWPA 4Q47A 5F73A 3VSCA 4AZ0B 1TYDE 4AY5A 2IYOA 3GQBA 2R92A 2ZREA 3K1AA 4O4JB 2XCAA 4JJGA 1DQPA 1ZN9A 4PRKA 2FGKA 2P9QA 2HLPA 1ULSA 3QXSA 1NLYA 4G1MB 4QTZA 4Q4AA 1N7HA 4RK4A 5JYEA 2UVUA 3VQTA 3ND5A 4Q01A 4TLMB 2MCFA 1WV1A 1V8ZA 4OXQA 1GQOA 3CNQS 2VL7A 3NTLA 3NYRA 5AVJA 2OFXA 4YP9A 2ZSKA 3BH7A 2BFOA 4Y8VA 3IQHX 3WX0A 1AKVA 1V2GA 3JD2A 1P7VA 3V9PA 1P1JA 1MIOB 1MX1A 3C45A 3MRVA 4ENPA 4FSXA 5DV9A 2XHZA 3EVBA 4AC9A 3L4BA 3Q3GE 1P4HA 3L4EA 3CLTC 2P9BA 5J5CA 3UUEA 7REQA 2MMGA 3T5JA 3AWIA 4M55A 1Z6YA 4TVIA 2PDAA 2F8TA 3DNMA 2PPVA 2ZQZA 1BTOA 4UXHA 2V6MA 1S8AA 4TQGA 1JQ5A 3CKKA 1W87A 3NXKA 4DV6B 4PSDA 3QOXA 5J5VA 4BCDA 1ESDA 5WRFA 3LQRA 3HKZA 4C0KA 1VIVA 2PV0A 4P08A 5CX1A 4YAIA 1S68A 2E9SA 2B63G 1DKRA 2IA6A 1BD3A 3LDHA 3CX4A 3B2QA 4H4CA 3S5UA 5BN3B 3I42A 1BDBA 3HUDA 1NBWB 1U2ZA 1QG4A 1J70A 1EE1A 5I5SA 3BD6A 3KYJB 5DLPA 5P8WA 2W2KB 4ARAA 1FMCA 4BP8A 4ZI5A 4GC7A 2IGTA 4JDUA 2VUHB 5E3HA 2EGHA 3ZEAA 1QH0A 3ZUGA 1RJDA 1T10A 4K88A 4E2ZA 4J9LA 2RCYA 2ZBPA 4J16C 1KFJB 1RKBA 2FQQA 5K3FB 4BKUA 4Q7JB 1NRIA 4PO3X 4OY3A 3QQ5A 4ENQA 4U8HA 1IDOA 5KFNA 4RZUA 3F4BA 3BRWA 3KKMA 4JC4A 4MUJA 1Y1KE 3E2IA 2YMQA 4MRAA 2XVYA 3QVTA 5CW1A 3TY5A 3ENZA 2JFPA 3HACA 3IQXA 2I78A 3TYXA 4Z4FA 1OAAA 3D4LA 1PWZA 4LHZA 4YRLA 3UJAA 3RFVA 4FE3A 1ODCA 4F4WA 1ZHHA 5ELMA 3VV3A 4OX9B 1CQJB 5AW2A 1GPUA 1WL8A 3ET4A 3GLRA 3O3OB 3UV7A 4GP6A 2ZZMA 1L7BA 1AKRA 3KCQA 1ZC4A 3KEOA 3P5BA 4GPD1 3VO1A 4DCUA 4G1UC 4GPBA 5B1EA 1I0LA 4UBOA 5B1IA 3RBXA 4QHSA 4J4TA 4MVYA 5LNK6 4LSXA 2HLHA 3NXSA 3MTDA 2WWGA 1SXJC 3B1XA 3DEZA 4O33A 1WP4A 4O7YA 2V98A 1H3FA 5K8IA 5PGMA 2ZS7A 5TS3A 5CDGA 3H1AA 3ITEA 1C4OA 2BD0A 5F2EA 3TSAA 3LYUA 1FJ2A 2YX1A 3LYAA 4O2LA 3GJZA 5IDYA 4ARUA 1ZGHA 2WUEA 3O8NA 1MJNA 3AJAA 3DF9A 3GN2A 4QJ5A 1UPBA 4X6LA 3ZE2B 5A6SA 2KW5A 5BPFA 1FLDA 3MNFA 3S4YA 3KHKA 1RC1A 1C7EA 1N2XA 1TU3A 4J0FA 4AG3A 5KOYA 3WSWA 1OQAA 3NEPX 3VR6H 2EC5A 4JITA 2Z8YM 1N7IA 4OYRA 4O82A 5B7GA 5C5IA 4TZ6A 1M2HA 1CR2A 1B8NA 1UMCB 1JSCA 2ZE8A 1JMYA 3IMGA 1WH2A 3MBKA 5MDHA 4QVGA 3CB2A 3NVMB 1F2TA 1N5RA 4FE7A 5FD8A 5DOVA 3U6BA 4PAWA 1RYSA 3N58A 3S2FA 2X5OA 1QCZA 4OQNA 3INTA 5EXTA 3CE9A 4HLDA 2QVCA 3HYSA 5FKJA 4HC4A 1IMOA 1KVTA 1M67A 4RA9B 3W5SA 5KWIA 4WAUA 1W4CA 1SBCA 4HHEA 4PNPA 5BV0A 2C57A 5AKKA 2N75A 4A3SA 4F2GA 3GBPA 2E89A 2VPZA 3PJGA 1ABEA 4ZMSA 4DM4A 5ALVA 4DRYA 2XOKD 1HSOA 3CZMA 2J41A 3RTXA 2VI5A 1NC1A 1XD8A 3IV9A 3ZWOA 3IIJA 1JUDA 1X9IA 4EVSA 1DKNA 2I0FA 3ZDZB 3A1FA 5B6PA 5CLFA 1J2EA 1JX4A 4KFTA 2B7BA 3AJ8A 2Q2TA 2GPNA 1WW8A 1RI3A 3IUNA 2R6ZA 1C81A 2AU0A 1XDUA 3IJRA 4K28A 1Z7EA 1QQ7A 4FS2A 4V0KA 3ZY3A 1IATA 3UPTA 3ZJTA 4QWBA 4ZJZA 1RI2A 4BMSA 5E6RA 2AYXA 4N6GA 1JJFA 2EW2A 1RMQA 1I4DD 2OCLA 2Z09A 4DV3H 3SLKA 4GOOD 1RYYA 4EUKA 5BSFA 4R9RA 4BTLA 2Q6VA 2Z3ZA 1EFRA 2O7VA 3C70A 3KXDA 1VS0A 1P1IA 2HA7A 4HB3A 3S40A 3H0GA 3LUDA 2ONKA 1JI0A 1NF3A 2Z3WA 2ZRAA 5ERYA 3A3OA 3DYIA 3GY0A 3JARA 4I66A 3A70A 4MV7A 3TLGA 3WI7A 4BLWA 1FX0A 5JLJA 2ZE5A 4FYKA 3RTDA 4BFCA 3LBHA 2YS7A 1J0DA 1PR3A 4DR6H 3ED5A 3PNBA 2GF0A 3E9ZA 3MJRA 3KT6A 5KDOA 4F4UA 4CCWA 1PR9A 3L8MA 2CSXA 1Z83A 4YJ2F 2WMYA 5LJLA 1NAHA 1SHZA 2FPLA 1P0MA 5DGTA 2FEOA 2QN2A 3TNYA 2CYCA 3H5TA 4ALNA 3HFJA 4LF5H 3RBAA 2WJ3A 3ZHRA 4PGGA 2NTEA 4QJIA 3FAZA 2R8YA 1SXJA 4HT3B 1ZICA 4DA4A 2IEGA 421PA 3BICA 2I5PO 4RKFA 5G0SA 3DL4A 4M0PA 4PW0A 3T5CA 4KQGA 3TAHA 4EGFA 3HO8A 2O5RA 3O8DA 3GRCA 2I4LA 2Y68A 2VKQA 2C0PA 4N8SA 3U4QA 1JV2B 1SU4A 3OZUA 3C6QA 5JISA 1XXHA 2PT6A 1RWNA 1VSUA 2HI0A 1E6KA 5CLQA 3Q2OA 4HKTA 3KJEA 4FC7A 3ZDBA 1WKVA 3QWAA 3W8EA 5KTTA 4AJEA 5JAQA 3O8CA 3FAKA 3W5DA 3LPAA 4GRAA 3SVLA 1EK2A 1TM7E 4CKCA 5DHPA 3EPHA 4YFVA 4I1OA 1WU8A 3H20A 1AA6A 3CFYA 2ISQA 1L7QA 4V0NA 1FNBA 5AOAA 3V4FA 1TFUA 1IZ9A 2SKCA 1GTJ1 3FJOA 3KYCA 4KO4S 3SLRA 3GLFE 2OYRA 3RREA 5LQKA 2WIDA 2P75A 2XNSA 3MMSA 4U9HS 4G0NA 2OZLA 2NZ2A 2A0KA 2B7CA 2CC2A 5KQRA 1HE5A 3GLIB 4TTPA 4JP3A 4ECYA 4LXTA 3QVXA 1JDVA 2XPCA 3CRVA 5IT9A 1OI7A 1YDFA 2EIHA 4AICA 1D2GA 4RMGA 1S4QA 3ELWA 2VTBA 3FIUA 2DPXA 2UUPA 2NU9A 5HBGA 1GL9B 4YTEA 3U9LA 1ATIA 1E3SA 1FVOA 1DAOA 2B63A 2RGEA 2X7XA 3AF3A 3H4DA 5KFAA 1DOHA 4IMRA 4EITA 1UQUA 3R7WB 1UKVY 3FNHA 1OB2A 4GE3A 4NLLA 3OJWA 5ALWA 1XRQA 3GIPA 4OSEA 4CR6A 4HDKB 1TAHA 5KDLA 3AM4A 1ZH6A 4RB1A 2GJ8A 3O0TA 2G4LA 1AKUA 1DEKA 3OEHD 3Q2IA 3QLJA 4P22A 3RNOA 1NI4A 1YJQA 1GV1A 3CZCA 3Q3EA 4P0TA 4OXIA 3W5AA 1U0EA 4KREA 1ORRA 4KLCA 4GDMA 3C87A 3N2LA 1ISSA 2JA1A 1KSJA 4HDSB 1SCDA 1AZSC 1NVDA 2C1ZA 3M1IA 3AY3A 5CXXA 5K3BA 3GEGA 1JFLA 2B4AA 4ZVVA 1LPBB 4WLEA 2WPNA 2Y1CA 4RVDA 4OI0A 4ZK2A 2FPUA 4L15A 3K0FB 4DILA 4L0DA 1Z0KA 4JXXA 3FYUC 3JASB 4IZIA 4DL6A 4C6HA 2ONJA 3DFFA 3FETA 4KE8A 4B5LA 1RYHA 1P7ZA 2PU7A 3KTMA 1A88A 3FPAA 4ZVLA 5LB2A 1B4DA 3KD3A 4JBHA 3CUWA 1OYVA 2UVPA 4P33A 5ILOA 3WLEA 1R7RA 5FTWA 4ZXFA 2EIXA 2HCRA 2Y05A 3STVA 2EQAA 2J7PD 1VKZA 2WB4A 4CMIB 1MENA 2GFQA 1E98A 5DX1A 1Y3HA 1XK7A 3O03A 1DRVA 1RPNA 1OH8A 3FRIA 3H86A 5EWJA 4TLLB 5FP0A 1R5NA 4E11A 1OLSB 2C5BA 4JXUA 3LKDA 2QL6A 4KN8A 3KLBA 2RGYA 3JVDA 3T0GA 3E4DA 5JSYA 1VL5A 4GSYA 5TQ2B 2C7VA 4DIDA 1YS7A 2PGXA 2RHDA 3MD0A 2C9ZA 4CI9A 4TYQA 2RF4A 1XRSB 1XROA 1YZFA 3IAUA 5HMLA 4X7BA 5AI0A 1F5NA 3MELA 4OHRA 2Z2KA 4B45A 4B4DA 4Q03A 2A9VA 3SI8A 4GLOA 4FJ0A 3X3HA 3HCDA 3H2SA 3PFCA 1REQB 4KAAA 2HD4A 4JYZA 3HVKA 4CM8A 1S0NA 1PNOA 1M0SA 1U3CA 5DULA 3LQFA 4AK9A 3RANA 3T4EA 5J47A 5DE3A 1GFIA 2H9IA 2W2LD 1C3EA 3L1KA 4BASA 3WA7A 2AD1A 2IKSA 2FHPA 3GD5A 2ATVA 1WCMG 2H2IA 2VVTA 2WUDA 3LKBA 4HPWA 4XPZA 1WMBA 3GUVA 1NBIA 2X6TA 4WXPA 5L7YA 3ZV3A 3EOAI 1U8XX 5C1PA 5KFEA 1DAPA 1TMOA 5GTDA 2B9EA 2OQ2A 5KSZA 2ZK7A 1GGJA 1JTVA 1KEWA 2FOIA 4RPHA 2AR7A 3TRKA 4DZRA 2PKQO 3VH1A 3OT1A 5J2TA 1MO6A 5AXCA 1UOEA 1YIOA 1Z6QA 2HWKA 2QG6A 3EISA 3TLYA 4FB5A 4DJ5X 2YWCA 3SKYA 3NJ8A 1T9GR 3KYBA 5FPSA 1UZUA 2JH9A 2FR8C 1AOXA 4DLYA 2R93G 1E2HA 2Y3IA 4MICA 5DK6A 2WSMA 2Z5GA 1GR1A 3LXXA 4J9VA 4TZKA 3WYBA 3WZLA 4UVDA 3PXUA 2FK1A 1OBVA 1HYEA 2B7LA 3KDSE 1CQIB 3N7TA 4LXQA 3V3TA 2YV5A 4BFWA 4EGSA 4UNSA 1T5SA 5AYVA 3VDRA 2GI4A 3CF0A 3P94A 1D7AA 2FOLA 3Q72A 4FE4A 4URYR 3HB9A 1PT8A 5CAEB 3ASVA 3OZWA 1GPYA 2GO1A 4K0KH 1WDLA 1U2DA 1I5RA 2ECPA 4LRYA 3TOSA 1GYPA 3T0IA 3UWKA 2YWVA 1NOJA 1CCWA 2HV9A 1M75A 4DUGD 3QE3A 5LZ9A 3T1NA 5IM4F 3AIOA 1Z0SA 5HIKA 3ZNQA 2J9FB 4CRWB 1TCAA 3K8OE 3UJDA 5BQFA 1S0MA 1QDUA 4TYPA 3LLUA 3N6RA 3DE3X 4PHFA 4Y2VA 3RJ9A 2NQ8A 1TU4A 3L0CA 5AM1A 4K6GA 1HFEL 3WMXA 2HRBA 3ZHZA 4A7PA 4P80A 2WV7A 3CLRC 2D59A 2X42A 1WEKA 1MT3A 4Q48A 2Z6VA 3V33A 4AMBA 4B4WA 1SD1A 1UT6A 5HIAA 2BDTA 2DLNA 1I4OA 1DXHA 1MXFA 4QWAA 2NZ8A 3GZTB 5LDGA 3LUFA 2WVGA 1NVUQ 1P9NA 5E6UA 1SAYA 3HZRA 2Q8QA 2OL4A 4CGZA 1I3KA 5JS6A 1U9ZA 4RDCA 4ER6A 2C78A 6CHYA 2XVXA 2YHIA 4JI1H 2FK3A 2AN9A 4TMFA 2HIHA 3BM5A 4CKEA 4GSKA 1QGYA 4HYTA 4WE3A 5HE9A 1WBDA 2ZKLA 1L7AA 1UBKS 3TQOA 3V32A 4L22A 1MC8A 2GXUA 3OQIA 4MR8A 3USES 2JBAA 4LGVA 5DWQA 2I3GA 5B1YA 4ZJUA 3OUZA 5AICA 1KR2A 6LDHA 3PB3A 4WY2A 4DMGA 4MKZA 3AP3A 3S2EA 5JZBA 1NLMA 1P5JA 5AKZA 4DLKA 1U8ZA 4L78A 5GM2A 2F3UA 3KRTA 3GELA 4OHPA 1U9IA 2ZYDA 1O54A 1AQYA 4XJXA 4M1SA 2QD1A 2HU2A 3HBNA 2WFZA 5E7QA 2HCJB 2IZ0A 1V45E 4HRAA 1YS1X 2DR2A 2O52A 3RS9A 4CCSA 4X66H 5KFBA 4HBGA 1G5TA 3VAAA 2XVZA 4LCEA 1E6CA 3FR8A 4HQ6A 2NZWA 3R23A 4XGKA 2FK7A 1HPLA 1LQTA 1M2VB 1XCJA 3DH0A 4ZI7A 5TC4A 2A1IA 5JS1A 1FY2A 1SC3A 2QVGA 1YGYA 2OCGA 2FPGB 1ETUA 3A9UA 4ZYTA 3RARA 4ETNA 4BNKA 4OA5A 4M36A 2XR1A 2WAQE 1ITZA 3JPYA 2ZR8A 4QXMA 3PDCA 4CKCB 2RGUA 3DV2A 3OZ7A 3PR3A 3PQ6A 1T9CA 4QATA 4EQ6A 5KYYA 3I09A 4CU2A 4AF8A 3D8TA 4P3OA 1J0XO 4FLMA 4W1QA 3IN5A 4G56A 1QHGA 5E4TA 3Q8RB 3AEKB 1UDBA 3U4DA 4DV1H 1FP6A 1NURA 1IHYA 2AW5A 2GNAA 1NJFA 4C21A 2UUBB 4D4IA 2FMTA 2V6IA 3G1WA 3UHAA 1GRRA 1MOQA 1WABA 4O3SA 2I29A 2V7TA 3DOIA 5KFRA 1BVRA 2VSFA 4RMNA 2G83A 2HJGA 3JQAD 1PYGA 2VP4A 3EGEA 3NHPA 4R1MA 3T5GA 2WM8A 1PJLA 3TUJC 5TPZA 1A7UA 2O1XA 3KVNA 4PPFA 2NOAA 3STHA 1KI2A 3HJGA 3ZE9A 3EW9A 5KG0A 2JFYA 3GLUA 3T3MB 4D9FA 1FU7A 2R68A 2ZJAA 4WERA 5HG0A 4YRQA 2ZIUB 5D5PA 4FQ5A 1SO8A 3TPZA 3FBTA 2UZ1B 3QXHA 4U2BA 2JAOA 5TEVA 3IHLA 3NTOA 4FU0A 1IVYA 3ASZA 3EGDA 3SBDA 1AIPA 4AX8A 4BVHA 5CDYA 3KLOA 3IKTA 2XH8A 5JQGF 2Q9AA 4A3FG 4XZ3A 1PL8A 1QHHA 3BFXA 4Q9HA 1DPGA 3PGA1 4N0QA 5JO9A 2ENWA 3GLVA 4B43A 1OLXB 5IMSA 3Q41A 3S8EA 3K0CC 1ZHQA 1QMPA 1UXGA 3WIDA 1HQKA 4MUIA 4GH5A 4UPVA 3SDBA 1K8XB 4A5SA 4B2IA 2MINB 4OKNA 3D7RA 1UODA 3A1EA 3NHJA 1I4EB 3HB4X 4DVJA 2QTVB 4F2HA 3W5CA 2AN4A 2IE0A 3EQZA 5IS2A 2V7XA 3SC6A 2VTKA 4IQ8A 1YXMA 1ET0A 4F3CA 4CM4B 2P3OA 2O57A 3RGXA 3GIMA 2NUBA 3CRQA 3EVZA 2G9NA 3TTXA 2FI1A 1XKTA 5C80A 3L4JA 1U3FA 2VUGA 3GRAA 2L17A 4Y6SA 3UJ8A 1BMQA 3BSYA 2XYPA 5HFJA 3QE2A 3VPDA 2JIPA 3FSGD 3JQ8A 2DBZA 3NASA 3MYYA 1FOEB 3O1HB 1ZM3A 1EXNA 5A3JA 5DM70 4HDOB 5MN4A 2PLNA 3HEAA 1O95A 4E07A 3MW8A 1MJFA 5ADHA 2NAFA 2YJZA 1AKQA 2ENUA 2PMCA 1ZRNA 1IM5A 3ZNNA 4DJDC 1ZD9A 6Q21A 1RPJA 3V1KA 2HHFA 2DY1A 1B3BA 3RB8A 3ZZTA 5E1BA 4D9BA 1YA6A 1PZFA 3CIOA 2C2DA 1LZKA 1GL7A 3VTFA 2CCJA 4B3CA 3KNZA 5DW0A 5FA6A 3UENA 3OUTA 1XEXB 5H1YA 2E2HA 1LLDA 2J67A 2EERA 2HV8A 3ZTYA 4A3IG 4BRSA 2AG5A 1A5AB 3LW7A 4EA7A 2UZ4A 5FOWA 5ICFA 2GLXA 3PD7A 5EY5B 1C80A 2JJ1A 1X19A 3ZXXA 3PA6A 3DP7A 3B70A 2QIPA 4EUEA 3DDNA 4Q4JB 1OH5A 4JODA 2XZOA 4YAUA 3AVUA 2BH2A 1FRVA 1G20A 5IAOA 3ND6A 3OP1A 4JOBA 3RNLA 2E4UA 4ZQIA 1DRJA 4KI7A 4MRPA 5JROA 1E2IA 3H11B 2NO0A 2GS9A 4EL5A 3G8DA 3PDWA 2N1BA 4RVUA 1XMOH 2AEFA 2YDXA 5IVPA 4R2MA 1ADFA 1H94A 4JBYA 3NBAA 5IKXA 5TQ0A 1NL3A 3L4SO 2Q5EA 3AU8A 2OBFA 4MHTA 3TCXB 5BN5A 2RGVA 3R9IA 5FWYB 1VBMA 1HQDA 2ZR0A 5AXAA 3MINB 3TBKA 1I33A 3CRNA 4KP7A 1YRLA 2JB9A 1YTLA 4C7XA 4RWEA 3NM5A 1DQSA 4BZZA 2O23A 3C14C 1FA9A 4C43A 1FXWA 3GMDA 1T8YA 4IFTA 4MWSA 4KFRA 3UJ3X 1Z29A 5DLGA 4HLUA 4JLVA 1M2OA 1UEJA 2QTNA 4WFIA 1C1YA 4Q9AA 3SZMA 5KVSA 4NU5A 5BQOA 1IBLB 1RR6A 3UUGA 4O4HF 2ZSBA 3FYCA 4WOPA 1OFVA 3KUXA 4EUFA 2HXGA 4GBMA 5AI5A 5KFWA 5JATA 3U6KA 1JLHA 3DO6A 3UYLA 2A9QA 1UBMS 2WAOA 3M1AA 4OK6A 4PSUA 4OQMA 2VF5X 2Q4EA 4ZP1A 3I30X 1GSAA 1VRVA 4FYMA 4LZNA 3RVDA 2GVDC 3CLUD 5CITA 3B1VA 3BE4A 1KE1A 1FXWF 2I3DA 3AESA 4GUDA 3QQPA 1OU4A 2DQSA 2YZKA 3F8TA 4WUTA 2DERA 1Q7CA 4II2A 1LF0A 1XRJA 4UCXA 1H1LB 4MW0A 5FTKA 5IJWA 2CXXA 5JNSA 1KEKA 1IY0A 4KR7