3V4ZA

D-alanine--d-alanine ligase from yersinia pestis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
293
Chain Sequence
AEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title D-alanine--D-alanine ligase from Yersinia pestis.
rcsb
source organism Yersinia pestis
total genus 94
structure length 293
sequence length 305
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3v4zA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3v4zA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4zA01
2PBZA 4YJ2F 5JVDF 1UC9A 1KJQA 2W6NA 4TV9F 1M0TA 2DWCA 3JZIA 3HBLA 4MV6A 2SCUB 4MV1A 5D8DA 5J2TF 1VBGA 2NU7B 3BSSA 3GIDA 4O2AF 4XYMB 3BG5A 2YWVA 5JH7F 2NU8B 4M9CA 4EABA 4FFMA 3U9TA 2X0SA 5KKNB 2PN1A 3R23A 5JQGF 2R85A 1IOVA 1A9XA 3KAJA 1PX2A 1OBDA 3KREA 1E4EB 5JQWA 3KAKA 2GPSA 4M99A 4FGRA 1KEEA 3R5FA 4EG0A 4EAAA 2IP4A 3K5IA 3MWDA 2XD4A 2YZLA 3R5HA 3G8DA 1KJIA 5JVLA 4WBNF 4HNUA 4I55F 3RV3A 5CAEB 4MV8A 5C8YF 4IWYA 4QSHA 1JDBB 4O4JF 4EA8A 1SCUB 1AUXA 5DMXA 4FE2A 5LYJF 4O7RA 2J9GA 3G8CA 1A48A 4O7NA 4O7SA 2Z02A 4L1KA 1Z2PX 3N8DA 1DV2A 5LXTF 1IOWA 3E5NA 1UC8A 2NPOA 1JKJB 2NUAB 2I8CA 2R7KA 4MV9A 4I50F 1VBHA 4MAMA 3UFXB 4C5CA 2YRWA 3R5XA 2FPIB 4O7LA 5BMVF 3VA7A 4ZQIA 4HNTA 2YZMA 4FFRA 4ZI7F 3U9SA 2FPPB 1B6SA 5HV6A 5LOVF 3Q2OA 2NU6B 3BSWA 1E4EA 2YS7A 2ZDQA 2NU9B 1GSAA 2GLTA 1CS0A 2HGSA 1GLVA 4MA5A 4Y8VB 2YYAA 1EZ1A 3OUZA 5BPFA 2DLNA 3KALA 3TQTA 2VPQA 2CQYA 4DLKA 3AW8A 5CB4F 5IYZF 4I4TF 4J6EA 4DIMA 2YRXA 2CNVA 1CE8A 1I7NA 4O4LF 2R6FA 3VMMA 1CQJB 2ZDGA 3TIIA 1KJ8A 3N6RA 4O84A 5H80A 3LP8A 1JLLB 1I7LA 4MV4A 2FP4B 3U55A 4C5AA 3QFFA 4FFNA 1AUVA 4XYLB 5I47A 3DF7A 3NUAA 2W6PA 3GLKA 4YBZB 3ORRA 1ULZA 4O7YA 1EUDB 3MJFA 2VQDA 2QF7A 4YB8B 3ETJA 3JRXA 2W6MA 3TW6A 3VPDA 4FFOA 4FFLA 1WR2A 3SE7A 1KC7A 4TUYF 2C00A 3ETHA 3K3PA 1DIKA 1M0WA 4E4TA 4RZQA 1M6VA 3TINA 3U54A 1EHIA 3HB9A 5GONF 4M9UA 1BNCA 3VPCA 4YAJB 2DZDA 1EYZA 2VR1A 2R87A 2HJWA 4ZHQF 3BSYA 2GQSA 3V4SA 2GQRA 4M98A 4GGMX 4ME6A 2W71A 2YZNA 4HR7A 4FFPA 2VHEA 3BFPA 5C1OA 1DV1A 1Z2NX 3RFCA 2OLSA 2W6ZA 5K2MA 3RUPA 2I80A 5HBRB 5J2UF 2YZGA 4XZ3B 4O81A 4O7ZA 3R9RA 2Z04A 2R7MA 2CZGA 2PVPA 2V5AA 3OUUA 4XX0B 2DIKA 3JZFA 4EA7A 2GPWA 4YJ3F 2V59A 3Q1KA 4O83A 1T36A 2ZDHA 2R82A 3WO0A 1B6RA 3V4ZA 4MV3A 4IHJF 3ORQA 3TIGA 4IZOA 2P0AA 2YS6A 1EUCB 1Z2OX 2YW2A 4IWXA 2WYOA 2CNUA 4O7WA 1GSHA 5FNVF 1JDEA 1C30A 4ZOLF 1KJJA 4EGQA 4O7VA 1C3OA 4O86A 5C1PA 4EA9A 4O4IF 3LWBA 3VOTA 2QK4A 2R7LA 4C5BA 3JRWA 4NYEA 4MV7A 5CA0F 5BPHA 2FPGB 4O2BF 3WNZA 2CNQA 2V58A 3MWEA 2I87A 3WO1A 2W70A 5LA6F 1BXRA 5CA1F 5EZYF 3I12A 4O7TA 4O4HF 4FU0A 4WD3A 2R84A 3HO8A 4HQ6A 5KX5F 4IIJF 2W6QA 1W93A 2YL2A 4TV8F 4YAKB 1OBGA 1KJ9A 3RV4A 1GSOA 3AX6A 4EGJA 2R7NA 2XCLA 1PK8A 1VKZA 1KBLA 4HNVA 2R86A 4MA0A 2FB9A 1W96A 1KUTA 1CQIB 1GGOA 4O82A 3VPBA 5LP6F 3K5HA 2W6OA
chains in the Genus database with same CATH superfamily
2PBZA 1T1IA 2NXCA 4K9QA 1ECPA 2J59A 1ODLA 5M3BA 3EVTA 3T54A 3QG5A 4BFZA 3TEJA 3Q8MA 1VB3A 1XDDA 3OTOH 2A0UA 4N49A 3PR5B 1I24A 1FZQA 4KREA 1NVBA 4E4YA 4BMPB 5CIWA 3WX0A 3Q9LA 4P83A 3AUYA 3OHSX 1WCIA 2YFYA 4YAFA 5KG5A 1Z34A 2OXEA 3KU1A 4BX2A 3FPAA 1SCIA 4OUKX 1REQA 2R2AA 3LFTA 3LSYA 3QVKA 5FBHA 4ZK2A 2HQRA 5ICSA 1I1KA 1U2TA 4N7MA 2QW0X 4ZGGA 2E49A 4WBSA 3PHJA 3QTLA 1NY6A 4FE2A 1SXHA 1H9AA 3ZW9A 1F8GA 1LV7A 4Z4HA 1UPAA 1Y4AE 2WWIA 4AUNA 3O8CA 3AFHA 4L1KA 1ZITA 4PTZA 3RGWS 3N8DA 4X7BA 1JQBA 3L0CA 4J0FA 1U0LA 2Q8NA 5BMVA 3BJRA 4QWDA 5F98A 3ZCXA 1R4MA 2CXNA 2JVJA 4PZ9A 4FPXA 2FK2A 5JALA 2X8BA 3EG5A 1IONA 5EZYB 3BHMA 2O50A 3GIPA 3CIOA 2XAUA 1X9NA 4L8LA 4AWBA 1K2VN 2HF2A 2G88A 1YBVA 1Z2DA 4OYHA 1OREA 3ZEAA 1D2RA 5FOSA 3WBKA 4NABA 4MAAA 2Z5GA 3K9QO 3MSCA 5HKLA 4TZTA 4ZEVA 4WCDA 4DV1B 2R0QC 5KPJA 2C9CA 3WICA 4DRZA 2CHEA 1H9CA 1EVZA 3V4FA 3KZVA 4O4LF 3JQAB 4EUKA 3FYUC 4WZ6A 2I4NA 3PPXA 3RODA 1R0YA 1M1YE 3S2YA 1JVBA 4RVDA 5IK2A 3UHFA 2OO3A 1GQOA 3JD3A 5FUBA 3NU1A 4UJ5A 2P90A 4JVLA 1I6WA 3PYMA 1HRKA 4QBGB 4DEVA 1ULSA 1Z28A 3AR4A 5ANRB 3BK7A 3HCNA 3IEIA 2EW8A 2FFJA 2GS9A 1NMEA 1X7ZA 1KKMA 1TOAA 1RPZA 2HJSA 2QRVA 3KWFA 3R3WA 4DXAA 2B3DA 3DMNA 3QWAA 3K7EA 1AC5A 4ER6A 3TOVA 5IC6A 2FX2A 2JCBA 4J76A 3AKEA 1ZD4A 3UG7A 3VZCA 1BH6A 3ABIA 1HORA 3EVZA 2GH1A 4LYGA 1JFVA 3P94A 1N0WA 4HLQB 1DAIA 1USVA 4XWAA 3PQ8A 5INTA 3MTAA 2C7RA 3M5WA 2FEAA 3PT5A 2VI5A 3VHXB 1ADJA 3L0ZA 4L76A 2A57A 1CLEA 3B51X 2FEMA 4D0NA 4LOLA 4LVCA 4OHKA 4Q43A 5KOJB 2XWPA 1OBHA 1Z2OX 1GPLA 3BK2A 4Q7JB 1IJBA 2RBGA 4YDRA 2R47A 3AJRA 3ASVA 4YRDA 4FYYA 1F1JA 1V3QE 3RTCA 5BVGA 4NZ9A 4IVNA 5LYYA 2MMCA 3O93A 4R2HA 4R1PA 2QZZA 1RTTA 1IJFA 4IJ6A 4MUNA 2G1PA 4KR9A 3I5MA 3E9RA 3M3HA 1JU3A 3P4UA 4C2UA 4EYQA 3UGKA 3QF7A 1Q17A 4GZ6A 3Q5GA 3VTAA 1W5AA 3MW8A 2YFQA 3SEAA 4HLDA 2GAJA 3E3LA 5KFYA 1OXBB 1Q83A 3KB1A 1KK3A 2PZEA 2RDJA 2QV7A 4PHFA 2Q4TA 2FB9A 1WQ3A 3L8DA 2CLKB 1NY5A 1Q7EA 2PS9A 4YRNA 3LHFA 3T4PA 3NFYA 1QWSA 1GFSA 3E2IA 2ZRAA 2B1RA 3GTPA 1G5TA 3PL1A 3FPFA 4O2AF 1JE1A 2YW9A 4ED1A 4IR1A 4ZYWA 5HJ2A 4K8RB 1GKKA 3RS0A 3WJ2A 3ZGOA 1O03A 2JRCA 1KXZA 4GX5A 4X60A 3BERA 2YVKA 1XHEA 2MR6A 4MQ5A 4A27A 3SF8A 1JSLA 1IXRC 3BGDA 4GMKA 3PE4A 4GYYA 3GGOA 4L8VA 5BSUA 1O4WA 4HQNA 1FS5A 5CK5A 1WPXA 4XAQA 1RWMA 4R84A 3G0CA 1U8YA 1F51E 5K0EA 5CFMA 1YWGO 3RC9A 1O94A 4IJMA 1W73A 1TVMA 3ICPA 2ZRJA 1E1KA 5H82A 5F33A 1OC2A 3UXEA 4FBUA 4X8HA 1ZH2A 4LECA 3BWBA 1I3LA 2FUG6 2ATCA 1I1MA 4U2EA 2C8KA 3QNWA 3LLSA 4G5SA 5LKAA 1XCGB 1DTSA 1JDSA 1QF6A 4IIFA 4JYAB 4IG4A 1D5WA 4HD8A 2VH1A 3GCDA 4NCIA 5JAHA 4ICIA 3C7KA 2ZB7A 5BV8A 2DJIA 4OGGA 3MA0A 4C29A 3CX8A 4HSEA 1E7SA 1DP4A 1COWA 4FK8A 1VBNA 1UWKA 3GBVA 4U6SA 4RPLA 2VYCA 1ZN8A 1ZPDA 2VJYA 3N41B 4PLZA 1GPUA 5ELLA 5IYZA 1LB1B 4A6PA 3IYLW 3S7ZA 1T26A 4Q9AA 1H8HD 2Z3ZA 2VPZA 3HYTA 3G0IA 3NTOA 4H0FA 3NGXA 3D6HA 5FI0B 1SVKA 2Q2QA 2ETVA 3DFKA 2EG9A 4CC6A 3SR4A 4BO3A 3BMCA 3AR9A 3GG2A 3F8NA 1J2RA 1SKUA 2G4CA 3KTFA 3FGPA 2GETA 1WETA 2PRIA 3AGQA 3FTDA 4KH1A 2B5VA 4OU5A 2GTHA 4Q01A 3P0HA 1FDWA 4EZEA 1OXMA 2Y77A 4JWKA 4C2BA 3ZQ4A 1DBRA 3IAM6 1ISMA 2WYUA 1OVGA 4RY9A 2HA7A 4AYWA 4P0QB 1S2IA 2PA3A 1GGHA 1JHDA 1J22A 3MCAA 4MJ7A 1I4OA 3FPJA 4WAUA 2WP0A 5F78A 1WZNA 5IAGA 3P45A 1PFUA 4LX0A 1J0XO 2ZULA 1Y1VG 1A7AA 1T9CA 4M1QA 1CJTC 3COYA 1OGIA 2Q3DA 4JYZA 1DEXA 1ZVQA 3KHUA 3AR5A 2Q4DA 1OVMA 2C94A 2IUYA 4OAQA 5IM5A 3L7MA 1NVWQ 1G5HA 1GGMA 5K8CA 3LDGA 1H1TA 2H2IA 4NI5A 4CKCA 2QMZA 2ZRBA 1R16A 2HBRA 1E18A 4DQKA 3O84A 1QO0A 1Q77A 1ZICA 2H9YA 4EEXA 4E14A 4OA8A 1ZAUA 2H1VA 2GYWA 1Q2XA 3AINA 3V8MA 1QB7A 1OX4B 2HMUA 1UBGA 2E1PA 4DC1A 3AF2A 1JDEA 1Y7HA 3O8DA 4XASA 1V41E 3O91A 1G20A 1VL2A 2J9FA 3NH9A 2XZLA 4MVYA 5C7YA 2HYIC 1R74A 2ZSHA 1WB5A 1J0AA 3CUSA 1O96B 4BZWA 2J09A 5HJ7A 2H5EA 3T7AA 6CHYA 1QJ4A 5CA1F 1OLUA 4O7TA 3AYHB 5J4HA 3MJRA 3THRA 4IQGA 1KDYA 1EVLA 2OMKA 1OXVA 4IUBS 4QIWE 3H8JA 1ENOA 3NBYC 3W78A 1DFGA 2BKVA 3UJHA 2XUJA 4CUKA 2ZM6B 1JX6A 1NW7A 4NDAA 1MC4A 1LY1A 3HLTA 1ZH0A 5I4KA 1HT0A 5IU6A 1X9HA 2P6UA 1UKCA 5REQB 5F12A 1EVIA 4QFMA 3N9IA 4LJKA 1CKNB 1W52X 3CNLA 4UCWA 3EFOB 1IHPA 2V6BA 3U9TA 1T4MA 1UOOA 4M0KA 2ZSBA 5EC8A 2PXAA 3ZGZA 3QIAA 1PJCA 2RMKA 1KK2A 3TRIA 3F6CA 3SFTA 3TPCA 2X3UA 1FPQA 5KYWB 5JV5A 1JPJA 2ZRPA 4OQDA 1ZQ9A 4AS2A 4R9SA 2BUAA 3WWDA 2C2WA 1E6LA 3OO0A 2V6GA 4Q1DA 5C8YF 4ER7A 4N7BA 2EJWA 4DLSA 3T5BA 3WGJA 4BO0A 1T2AA 1WHSA 4M7PA 1GQQA 4UUBA 1U2RA 3MFQA 1JI0A 1QZXA 3LZDA 4F9TA 1XJWA 4TUYA 3ZDAA 1HYBA 2F7SA 5FTWA 4D4JA 3MJSA 2I4OA 2JCVA 3KZXA 5L3QB 16PKA 2HLDA 2WAYA 3BE4A 4JLMA 5FTJA 4L9SA 3FJOA 5F2NA 1UDBA 3DD5A 5KFXA 4OQPA 2Z95A 3NP9A 4HH0A 4EA6A 2CW8A 3N8KA 3ZX5A 3T9DA 1L7OA 3U9LA 4RJTA 4CEIA 3T95A 4A3DG 1SIBE 2IKSA 1UFQA 4GLJA 1P8LA 4YYEA 3A6HA 4FOTA 1R3DA 3HRKA 4G5GA 4BU1A 4CIYA 3WK9A 3RIYA 3A1NA 3UT5A 1R9NA 1P9RA 2FPUA 2DC1A 4UU0A 4X9XA 3R24A 1OFTA 3ZQKA 1AUQA 3KR2A 3QX8A 2NYVA 2P3OA 3L6CA 3UB4A 3QBTA 1Z0KA 2ECPA 4N39A 1FQJA 3NHLA 1K1SA 4HGPA 1Z74A 4F71A 4P7JA 1D8AA 3O9MA 1YZQA 2HLHA 1GCAA 2WQ6A 3K4HA 2J0UA 3EMKA 1XRNA 5EWEA 4ZOLA 2GEDA 1TJ4A 2W2KA 1MCZA 2AXNA 2ZJ7A 4DBLE 4I7HA 3RVRA 2P9HA 4KIWA 4YBZB 3STYA 3V1UA 2UYCA 5IM4A 4S1VA 3WR5A 3K92A 2OGUA 4PRLA 5GJCA 3H3XA 1J7JA 1V3UA 2J3QA 3GARA 3W0LB 3CNEA 2HIAA 3C15C 2C04A 1EZ4A 2RKBA 3PHBE 3P2JA 5TEWA 2O8EB 1TO1E 3GJXB 2GILA 2ZYGA 4KXUA 5HHTA 1N2XA 1JJVA 3Q11A 2W42A 2Y0DA 3PSHA 3BF8A 1LZKA 4DIUA 1A9PA 3Q41A 4IDGA 9LDTA 3L7NA 4AXBA 3URMA 1EU1A 4D74A 3BDAA 1Z4IA 5JCZA 1ZHFA 1QIEA 1CZOA 3LKBA 4GT1A 1ZYUA 3PHHA 2V7GA 5GZ6A 5HW0A 4NU8X 3TQCA 2BEVB 3KKMA 1KZHA 3PSAA 2X2OA 2J31A 4ZEWA 4H1UA 4NYMQ 4GH5A 4J6FA 4LX8A 2TECE 4GPBA 3DKRA 3PEEA 1VLJA 3WL7A 1XQXA 5DGTA 1PJLA 4KQHA 4BEWA 2ZI7A 2VHVA 4N9WA 3M0EA 2FMTA 3TRHA 4K0KB 1UZLA 1PS0A 2WYOA 2OB1A 4LXHA 4TYQA 3EAFA 3ZI0A 1N1DA 4NJMA 5JC8A 1SHZA 2KMLA 3PENA 1W30A 1DJOA 3TEFA 1NVUQ 1I5EA 6Q21A 4OBBA 5KWJA 1KERA 2XWBF 5LCXA 2BFEB 1Y1SA 4LVUA 1MEJA 1K7CA 4J0HA 1QIDA 2AF3C 3ETNA 3LMKA 4GQIA 3C3DA 4V3CA 3EWAA 1RQRA 2YIDA 4ECTA 4KE8A 4MPTA 4Y2SA 5ALHA 2X15A 4A2AA 2AIRA 3NTXA 1J5XA 1K98A 4GNKA 4MYSA 4DM7A 1FVIA 1YMUA 3RVKA 3D1JA 1TA8A 1VRVA 4MR7B 4LV5B 4W1PA 4FB5A 4Z7NB 4FFBB 1DRVA 2QVXX 4Y2XA 5ES4B 2ZJOA 1ULBA 5F1PA 4ENRA 1J8VA 3RB3A 4CV0A 4WKCA 4A3LG 1NBWB 1TWAA 4FYIA 2UZ0A 4P7BA 4NZMA 4O08A 1HTBA 3GD5A 3HN2A 5KTKA 1J56A 1L8QA 3QKTA 2GESA 3WZMA 1IIBA 1VFPA 4JYAH 4WCFB 3QEAZ 1I7PA 1HNZB 2O1SA 3FJYA 1L5ZA 2WHRA 3ET4A 4NQRA 3DZGA 1IPFA 1T94A 1K66A 3PNYA 3T5TA 5IKMA 2Z0MA 4YGXB 1IAVA 1JHZA 4IOLA 3PNSA 1ZUNB 5J47A 2YKGA 3BJMA 5DNAA 1DWPA 1MQAA 1SC6A 3HRIA 4D9BA 1VL6A 3ENNA 4AKEA 1G98A 4FT2A 2AE1A 3OFKA 2O7SA 4JL5A 3ZJYA 3T12A 1YU6A 3IT1A 1FBNA 2OBBA 3WWCA 4BO9A 1H6BA 3SBXA 4Y2QA 5CFPA 1L4YA 1TJNA 1ELOA 4HDOB 4F9GA 3MB5A 1XU4A 3I37X 1B7GO 3X44A 4WGFA 5FWNA 3ZHQA 1E96A 5HCIA 4P3KA 4XR9A 4IDDA 4MWSA 2ZWPA 3OFNA 1RKUA 1VGQA 2BIFA 3DMDA 2G67A 3MJEA 4Q3AA 3ZZNA 3SHTA 5H7XA 4HFRA 2I55A 3BZBA 3HADA 3VTKA 1Z6PA 5DEIA 2BE9A 2FLVA 2CYAA 3L5KA 5JD3A 4YT5A 1JEDA 1XEFA 3L8FA 4D9JA 4J0QA 1GYPA 3I2IA 3PQEA 3QBJA 1RI3A 1KKLA 2QP4A 2B21A 4L2IB 5F2KA 3LY5A 4YQEA 3AL3A 4MV4A 2OD2A 3U4IA 2JS7A 2B8TA 4L50A 4C5AA 2BZGA 2V6MA 5IXSA 2ZUEA 4RQUA 3O2SB 2PGOA 3P0JA 4ZDWA 2G80A 3SYTA 4CBVA 3PVSA 1IUKA 3L6BA 2HH9A 4MMYB 5DTQA 4NFHA 4I5EA 5DISC 1O8BA 3EEOA 5A02A 2WV7A 2BFPA 4CL8A 3FG9A 4GC7A 3KR9A 4EJ2A 1XKQA 1GA4A 3HQ4O 2Z43A 3T5MA 4KYIB 1E5TA 4OJMX 2OV4A 3PC4A 1Q19A 3W05A 1PJBA 1POWA 1SUAA 2YDXA 3AESB 3EZFA 1ZSVA 2XQFA 1C7JA 2FOIA 3RWMB 5T14A 1J23A 1T10A 5IAAA 2Z2JA 4L5YA 2HOQA 4YHBA 2BSAA 4YI5A 2VJAA 4Q39A 3KD3A 4CMEC 3L7IA 1TAUA 5KG2A 3TY8A 4KXXA 1W35A 3TI7A 3E82A 3U7FB 1DEOA 2JIPA 3CBGA 1Q11A 2M2IA 5CFNA 1EFKA 4ND4A 3W6PA 3H6GA 2OGZA 1KY4A 2QVZX 4JLAA 3RK0A 3SIPA 5LMZA 5IT4A 4MULA 4RBNA 2VL7A 2GCEA 4NULA 1G42A 2ZM6H 2VSOA 3H9QA 2PMBA 2Z6UA 4ARZB 4NR0A 4G9GA 3WGLA 3VR6A 4HUQB 4DUGA 2BD0A 1H4TA 2WFLB 1YH3A 3C6XA 1MXHA 3EEFA 3SD7A 3ITEA 2Z4SA 4PZYA 4QOEA 3ESAA 3R20A 1TB4A 4Y2GA 1IVYA 3L4JA 3HDHA 1UUFA 5JLAA 2WE6A 3BB3A 3CLRD 3AX6A 1VKZA 1T8TA 3WLQA 3L5OA 3ZIAD 5CCBA 4M60A 4K9PA 4V0SA 1F2UA 3VPBA 3T7EA 3WWHA 3ZWAA 2Y6VA 2PCLA 1ODCA 1DBWA 1IBSA 3VU9A 3VISA 3ZDCA 2WK1A 1F3LA 3HUEA 5T8KA 2Q5JA 1Y1PA 2R8EA 2BGNA 1EBUA 1G6HA 1U1IA 3H0KA 4FC7A 4N6NA 1DOZA 4AZ0A 4CM8A 4CV2A 4LXUA 4Z4FA 5B7NA 1Y3HA 1NJ6A 1LX7A 3BHNA 4NENA 4PGGA 3RR2A 5KT2A 3CWZA 1V8BA 4L4XA 4JOSA 3MGKA 2AJDA 4TVSA 3MT9A 4RPHA 4IILA 4DIKA 4WOPA 3WDLA 2X4LA 4HNUA 1AY0A 2B4AA 3BDIA 1EK1A 2ZI9A 1BFKA 3I53A 4DN6A 1WDTA 3P9XA 1O97D 3FCSB 1IJKA 3UJBA 5JNVA 4YP3A 3ZZMA 3W4IA 3LUCA 2GEKA 4AWAA 2F9LA 1JDBC 1AKWA 2HEGA 2YN4A 5JT1A 1VPWA 2PGAA 5DCLA 3E5NA 1SCDA 2XE7A 5DCUA 4BNTA 4DMCA 1GAQA 4EBBA 1L5GB 1V8FA 2IWRA 3HCOA 1JDVA 3QMWA 3RRZA 1UM8A 3MGCA 4RJKA 2ACWA 3D02A 3MERA 2B4YA 3MC1A 3MXTA 2CNWA 5I5YA 2WF8A 2WIDA 6LDHA 1AMOA 4PSKA 4CF7A 3G5UA 4EJSB 1IN4A 2ZIAA 4TV8B 3KKZA 3NYIA 4N5NA 1Z3CA 2PA0A 1U28C 2PV7A 3L7BA 2I7TA 5BPFA 3JYHA 3T9AA 5I9SA 2PFKA 3AJAA 2ZIGA 4MWEA 2E5LB 4ON9A 1RYBA 1ST3A 4RSMA 1GZ6A 1KEVA 2EBWA 1G7RA 2FUCA 3EG9B 3QXCA 4LJ5A 1CT9A 4NCBA 2Q1SA 5U9CA 1V1MB 1CB7A 5BNFA 5IP7G 4QULA 4FINA 1JSCA 2AFIB 4LFCB 1RSZA 1WMAA 1DX4A 3L8GA 4Y9UA 4XYLB 1ZJ5A 1TU4A 4DPMA 2GGSA 3OZTA 1OBOA 5BYAA 2V7QD 1TCCA 2WHXA 4XIFA 5C5JA 4K1XA 3GUHA 3LDAA 3QKRB 2EX0A 1QV9A 3VDRA 4Q8EA 2HKIA 4HDRB 3O03A 1Q44A 1R0LA 3EZ9A 2FTKE 3RS2A 2PSEA 2VUUA 1OB5A 1PT8A 1CKEA 4KX3A 4FE4A 4R40A 3B3QA 5HA5A 4UM7A 1TM5E 3VR5A 1WCMA 5L1KA 1IH8A 2X4GA 4E6PA 4RVSA 4QUAA 4Y8VA 2ZTHA 2B7LA 1F8UA 5I5UA 1XZAA 4OLHA 1MAWA 3WKAA 2BFNA 1QQ5A 1T9AA 1T3ZA 3D31A 1JHXA 5EIHA 2PUBA 3R9RA 1S3SA 3UWPA 4CT5A 2PSSA 3RUCA 3DMYA 5KT4A 3NBUA 1R5NA 3ZHCA 1DKRA 3SC4A 1U94A 1WXXA 4FHDA 1N32H 3UK1A 4MV3A 3GNTA 3N8IA 2AN3A 3E9NA 5IYDG 3COWA 3BORA 3KJQA 4YAGA 1VJDA 3GUUA 1R0ZA 1VM6A 4KQIA 4J0JA 1N1MA 1AHPA 3IP1A 5AWFC 3R0VA 2NXNA 1GO2A 1LDBA 1VFNA 4KE6A 2JNWA 4UM9B 1SUWA 3DO5A 3O3CA 5JFOA 4QATA 2NZ2A 3K9WA 2XUFA 1BE6A 1TZJA 4YXWD 4J2HA 4M46A 4DCNA 1K27A 4R2WA 3ROZA 4CW7A 2FRVA 3H2HA 2YOHA 1VIMA 1HNZH 1E6EA 1ODKA 3JARB 1CW2B 4HYKA 1CIJA 3P27A 2XDQA 5KU1A 2XRMA 2EIXA 2QZ4A 5I5XA 2YHAA 1FRFS 3MUOA 2JJ8A 1SPXA 4J2TA 2WF6A 5DT2A 3HVHA 4XQ0A 4YT2A 4DDUA 5G0TA 1NVKA 3GTLA 2QGZA 1HDEA 1E2KA 4J0CA 3NCHA 4LY6A 3GLHA 5CLHA 5CVUA 1FUKA 2PN1A 2HU7A 1BMFA 4DDHA 2Y1CA 4JR2A 1AK1A 1E4EB 3O4RA 3GDEA 4M99A 3G2HA 2OC4A 3HG7A 3MS7A 4RSRA 2OORC 3ZE1B 3E61A 4NBUA 3TZCA 3WGMA 4A3IG 1Y6RA 2R9VA 2CUKA 2FCRA 2B78A 2WJ4A 4QU0A 1S4QA 2JEGA 2ATVA 1FX0A 2C7OA 2W83A 2GJSA 4KZKA 1U3FA 3OEWA 4QZVA 1DV2A 3LQYA 1E5XA 5F3WB 2V7BA 4RJLA 5FPPA 1RJEA 3IV9A 1YXMA 2O2DA 4XB6B 3TLMA 1J39A 4L22A 3UA4A 1QF9A 3H2KA 5CNKA 2HBQA 2V8OA 1M0EA 4GICA 4PAWA 3B1JA 2UDPA 3A6EA 3VR0A 4G8DA 3C24A 5KU7A 1A1VA 4MW0A 2C4VA 1P81A 3RT1A 4CQNA 4YJ2B 3NW9A 3TQ1A 2JJ1D 2AWOA 9MHTA 2WI8A 2Y2UA 2D3WA 4LF4B 1P0IA 4BMVA 5J2TB 4L5CA 4UOZA 3EH2A 4HDSB 2FR0A 3B70A 3LZCA 1D2MA 4IXWA 5E7QA 1KJ8A 4P1ZA 4ZYZA 1KYIA 1KMHA 5LJIA 2UUPA 3F3KA 5IF9A 3LVFO 2BUCA 4EF6A 5TLSA 3CJRA 4JNKA 3ANNA 3WA7A 4QNRA 3GY0A 1RFLA 4Q9HA 4NE2A 2PGIA 4JITA 2AXQA 4I55B 1NVDA 2FPIA 3B1KA 4TMWA 4PNPA 1YQUA 4JJZA 1EFPB 1L0BA 4FFLA 2GAOA 2CKDA 4HJXA 4F4WA 1P2BA 3KPUA 3ONWA 1U9IA 1US8A 1EKPA 2IYWA 3IVMA 5DIFA 2UYHA 2AUTA 2ZU0C 3NKFA 4C7XA 3SHVA 3LP6A 4N03A 5HZMA 4BNGA 3FMFA 5ELMA 2GAFA 4OHZA 5BN3B 2HDWA 3G8BA 2JGDA 1MA0A 3BRCA 1D1QA 3CGGA 3M3PA 1UM9A 3NM6B 1NJ5A 1RC1A 3EZGA 3FCEA 1P9LA 3EXIB 3M7IA 3PUZA 2CXRA 3GP8A 2CMGA 5HS6A 5HZHA 1H4SA 3GH3A 1G6Q1 2W2LD 2VSYA 1V96A 4CM5A 2D2FA 3BC1A 5BV1A 1MRNA 1QGUB 1USKA 1QU3A 3D6TB 7MDHA 2HCFA 3I62A 4MYTA 3ZHBA 2P0EA 3EISA 4R9UC 4U9UA 1YL7A 3GNSA 4U2KA 4QDJA 1P74A 1P75A 1LPNA 4GZLA 4GUDA 1G3UA 1WSDA 5IRCD 4BLRA 4E5KA 3HWSA 4AJ2A 3W1WA 1HR0H 3FCCA 1X39A 3OEHD 3N2KB 2C58A 1CBUA 5BVHA 4OLBA 3U37A 3GA0A 4PE5B 4ZOEA 5KZMB 4F6RA 2QY9A 4Q0YA 2BV3A 4CIWA 1BEZA 4HZUA 5ARDA 1FUYB 4PYIA 3GZNB 4CF5A 4U02A 2VK1A 1CE8B 4CHIA 1Z62A 3PJEA 3V33A 3GZTB 2O8CA 3HVUA 4JCOA 2AD1A 5EQFA 1U1EA 4BFSA 3DE5X 5ILQA 4EUNA 4RYLA 2R6DA 1QTQA 3WLAA 2LTAA 1JJBA 3LPAA 5ILGA 2YMLA 1W44A 2HHFB 1JJAA 2MYTA 3U44A 4OMFG 4MA0A 2IYEA 3NUQA 3VZDA 4E08A 2CL7X 1LVGA 2IP1A 3HJRA 2NP7A 4WJZA 3PQ5A 5TQ0A 1EAYA 2ALZA 2JLSA 1QDLB 5E7IA 1UF9A 1L4NA 3OT4A 3TCXB 4FN5A 5GV7A 1GKLA 4JD5A 1WM1A 4HWSA 5B1HA 2RHRA 3IAS1 3ET5A 3U48A 3UKDA 4FBLA 3N2NA 3HXQA 3BMOA 3EZ6A 4YPFA 4LF9B 4C7VA 2HQBA 4AN4A 2Y4NA 5EXDA 2LP4Y 4MMZB 3ZHVA 3KREA 5D6NA 4RB1A 4ZIRA 2JK1A 4CUJA 7ADHA 1O3YA 2PS1A 1G4UR 3O95A 3MGAA 3UCFA 1KO7A 4RTNA 1ORVA 4KXNA 1SQFA 1KNXA 3ROMA 1RRFA 4ZO6A 3Q3EA 4HDQB 2E4ZA 4UUNA 1UBFA 1WPGA 4HH1A 1JXMA 5KJ1A 3QLEA 3KKOA 2Q9AA 2EKPA 2AQHA 3ZI4A 3ZUPA 3CG4A 5HNEA 4E32A 3SXUB 5EJ4A 4I19A 2E5LH 4QFDA 3RIMA 4B9EA 3OJEA 1CVLA 1CUYA 2N42A 4O0LA 2XTJA 3GDGA 2Z58A 3KSUA 5T67A 5C4XG 3HFRA 3AF6A 4Y1RB 1EG7A 5C7OO 1X0XA 3IMKA 3KL4A 2WWTA 4K9LA 3NB0A 3DPIA 4O4HB 2QAGA 2K2QB 4MV0A 2C57A 3Q2KA 3VVMA 2Q5HA 3GCZA 3RSSA 4LFCH 2VUSA 2A5YB 2QT0A 1L5KA 2ZT6A 2VOEA 2FMAA 2ZTUA 2XXAB 1WDMA 4Z53A 3SSOA 4C20A 4M7WA 2QAIA 1XP5A 2FPKA 3VVLA 2DBRA 3GPIA 5LN1A 3OM9A 2DT8A 5FBZA 5AXAA 4B82A 5KT5A 1GDHA 3OUZA 1RLJA 2OK8A 1E2DA 1QV7A 3KJXA 4PLGA 4MYUA 4DKJA 1TD1A 5CAEA 5KHOC 1YULA 2RGUA 3EA0A 2YRXA 3EMDA 1N2CB 4NCKA 1QHFA 1GUBA 4RHTA 4Z3OA 1C0IA 3AV0B 3RKRA 5J4VA 3OQ6A 2ZYSA 5LDHA 1OXSC 2BZ0A 4DDWA 3FPCA 3WGKA 1VJRA 1DC6A 4WK6A 4Y2VA 1P2TA 3TUJC 4TM8A 2IZ0A 1ZHOA 3U7RA 1NVTA 4PU0A 1M75A 4MYHA 3DFIA 3UOWA 4C21A 1L5FA 3JRXA 3AONB 2JLRA 3N2YA 5D01A 1U9YA 1K1EA 1QH1B 2VTVA 1YBHA 2YC2C 4GLOA 1L4GA 4UPDA 1CZRA 3GDHA 5K8UA 1BNCA 2XTAA 1V1RA 1EYZA 5C1BA 5A3QA 5ECDA 3H5VA 3AWDA 3Q1LA 3UXHA 1XRRA 4D5GA 4Q3NA 5L3SB 1NW6A 4HTFB 1LQUA 4KV7A 4RV4A 4TTSA 4XGQA 2GN6A 4YFYA 3PNPA 1Z7EA 3SQOA 4TTJA 2GK4A 2IIVA 4QU9A 4A3BG 3JD2A 1EJ2A 3ONVA 2BC9A 2DBZA 4GBJA 5M04A 4UDYX 5EJ9A 1G59A 2QQGA 2DEUA 4D3DA 2XZPA 4YJKA 3WY9A 1DRKA 2Z2XA 5CA0A 1EEHA 5C1PA 4OQLA 5FF9A 3KEGA 4OP1A 3Q7EA 4MMXB 4DV7B 2NSYA 2FPGB 4QGAA 2CB9A 2GRUA 2KWIA 2WFZA 3PCTA 3NWBA 3NC1C 4B2IA 2VJNA 4ZN6A 4C0LA 2GJKA 2ZVDA 1N6HA 1FYVA 4FSDA 2WZBA 1SOAA 3GV0A 1SD2A 1U7UA 3FNGA 4JXXA 4W5JA 2GFIA 2I4IA 4L4UA 3ELUA 1R8XA 1H5NA 2UZ1B 3O8OB 2DE0X 1ZLYA 3KTMA 3PGXA 1OTYA 2ZSJA 4OKIA 2QD3A 1QG0A 4MV1A 3FDZA 2ICAA 3EXEB 3V9AA 4B73A 2BBWA 3FXAA 2Y1DA 3D1VA 2TMDA 2MYUA 1TYZA 2O05A 1D4ZA 3FVRA 4DL3A 4D4HA 2E87A 5JQWA 5I3CA 2H7XA 3WFJA 4BKQA 5JISA 1KEEA 2RH5A 4D26A 1DO8A 4Q9DA 3BL5A 1VJ1A 2C2GA 2BZSA 2QX4A 4BNMA 5ILOA 2G9VA 1GP2A 2DQ4A 1RMQA 2GYYA 5A7GA 4BFWA 4IDFA 4JLBA 2WTFA 4J0IA 3AUUA 1LI5A 1E7WA 3GYBA 5IHXA 2H11A 1NDHA 5FJIA 1OLSA 4UD2A 1IOWA 3HXOA 4KQ6A 2VP9A 1G63A 4LF4H 4DLTA 4GVXA 3PFWO 3A9RA 4JXJA 3BWMA 3CN7A 3FDJA 4A3EG 3ZU2A 3WVNA 2VBFA 1F1BA 1LNZA 4LVOA 1QRSA 1RJPA 3C7AA 4OHVA 3ONDA 5BV2P 3QXJA 1Q50A 1QZZA 3G1UA 3DEFA 1M34B 1YQEA 4Z4QA 3KQTA 5LD2B 2R11A 2SKCA 2QD1A 3FYSA 1YHYA 4A0FA 1IM2A 3HFSA 3ZE6A 4RD4A 3VSEA 3WNQA 1GY8A 1FNMA 1U99A 4RSHA 1W47A 2ZI4A 3SJ7A 3EIUA 4LOHA 1BVHA 4F84A 3QQ5A 1NF3A 4GMDA 1VPVA 4HFMA 4ZT5A 1FXWA 4EPVA 3JZAA 2QL9A 1E2HA 2RK6A 4UEOA 4KFSA 4H3VA 5B53A 1G291 3H9CA 5ENZA 1SULA 4FDTA 3TNDA 4L8WB 3A1UA 3GLKA 3QV1A 3L1KA 4IKEA 1B15A 1FYFA 2W6CX 3F8WA 3DAHA 3GGDA 5G3ZA 2QTNA 1Z0AA 2IU4A 3OX1A 5ARBA 2FEOA 4FGSA 2OE2A 4NE7A 1Y9JA 4J4HA 4DIBA 2PMDA 4MP3A 3DHYA 4YAEA 3HUUA 2Y4RA 1H69A 1U02A 1WUYA 4X1YB 1OXTA 1EZZA 1TVCA 1VBKA 4PX5A 2OPHA 1RCFA 1N33B 1W85A 1KIAA 4ZYUA 3MWEB 5FHQA 4LDNA 2GDJA 4B09A 1JLSA 3AU9A 4ER5A 4ZANA 4G5YA 4ANFA 4AJNA 2DUWA 2BW0A 4C03A 2V55B 3B6IA 1A82A 2C5BA 1ZM7A 3VFDA 1ZVMA 1NR1A 3CZ4A 4X6LA 5FA5A 2Z6VA 5CBKA 2RBKA 1L4HA 2NW6A 3PFCA 3U16A 3E3OA 1IY2A 1V16B 4IQ4A 1YRYE 1W5SA 4ECRA 4FB4A 1KZ4A 3WGNA 3KT0A 1YVRA 3UHAA 1HGXA 4MP6A 4DSZA 2W57A 3JSLA 2BT4A 2V4ZA 3KFLA 4QUDA 3AEUB 3JALB 5AHRA 1O57A 4NYJQ 4IKOA 2LGJA 2J0SA 3IR6A 4RULA 4J9MA 2WM9B 3IQGX 5I7RA 1ITZA 1QGZA 3DF9A 1S0NA 3MBKA 1SWVA 4P3OA 4IIJA 4A1FA 2G8LA 4OGWA 4LNUA 3BE6A 4LF9H 3GI1A 2BKAA 1C7EA 3HK2A 1R8SA 4K2AA 4E5YA 1BA3A 4LJLA 1MIHA 2PM8A 1DDGA 1F9AA 3TTXA 3LECA 1DRWA 1JMYA 2IHVA 4DCJA 1WBDA 1R5JA 3HB1A 1PG5A 2CFIA 1TM4E 1X9GA 2ZEJA 4EJ0A 1GUDA 1G21A 4QWCA 4Q21A 3I2KA 2FSIA 4M1ZA 4F8YA 4JP8A 5DJ5A 3MQFA 5J5CA 1QS0B 2P9FA 3AJ8A 1V3VA 1KPIA 5JH7F 3GJ0A 1SBCA 4K46A 4GRAA 5AD1A 3NUZA 3BVPA 2C88A 5E1OA 4ER0A 2QRPA 1XTSA 1I36A 3GGJA 2WB4A 4ALJA 2BUBA 3QUCA 5CE8A 2YNMA 1U7ZA 3ZV5A 3CY6A 1YDEA 3S24A 3RGZA 3E81A 4BYGA 2VNSA 3TXAA 3UN1A 4PGAA 5LYJF 3KR0A 2ZWMA 5FUVA 1N6RA 1MPXA 4OYYA 1F8XA 1SG9A 2YV2A 5KQLA 4B3FX 3D8HA 2V7EA 2KJQA 3FPSA 5D86A 1JYFA 1YR7A 1P1IA 4PANA 1C1DB 4MW7A 1O75A 4Q24A 4BS9A 5KFPA 3WYBA 2GZRA 3HJCA 3EPLA 1N1EA 5D1OB 4MKGA 1EKVA 3EVDA 3BACA 2NO5A 2P6PA 3R5XA 4NYIR 4E2ZA 4FGZA 3GIJA 2N1MA 4JP2A 1B00A 3HSYA 2R6GA 3U9SA 2EZUA 4US1R 3WKEA 4MR9B 1YK1A 3IULA 3A05A 5E8RA 1T3GA 4FWTA 3O8QA 4MS1A 4OTZA 4DYDA 5B36A 4KQ1A 1UMDB 1HL7A 2KSWA 1GDDA 2R8XA 4UNSA 4B81A 1SD1A 2RGWA 4K9DA 2RGRA 1UKZA 4ZAWA 5CPBA 3DONA 5D00A 3LY7A 1Z73A 3W9BA 1I0IA 3E9DA 3ETCA 3WB1A 3RCBA 4J9RA 4KR0A 5I4CA 4DR5B 3JTMA 1XAIA 4G5FA 1C3EA 5TF0A 1JXOA 2O3JA 3VJLA 1TZKA 3LX6A 2G0NA 4E6EA 4YP5A 4JZKA 1MFZA 5DV9A 3E53A 3CSWA 1OH6A 5A4KA 1HH4A 3LL7A 2P6OA 5CR5A 1BWPA 1N4AA 3W5JA 1H2BA 3T1QA 1PWXA 4I3FA 3JRNA 1Y6FA 1KQPA 1XZMA 1B42A 3RIHA 4NOKA 4M9UA 5MN6A 1VBMA 2O2YA 1X3SA 4PC7A 4IDHA 5CMLA 1ILWA 4EJFA 2V7WA 2VJDA 1U8ZA 6YASA 1N78A 3I9KA 4I8XA 3L7LA 3ZDBA 4YQZA 4IW3B 3WGIA 3L49A 2CJYA 1ND6A 2WIAA 1P16A 4NJEB 3EUAA 4DV7H 4RH1A 3H4TA 3OE7A 5K2MA 4JMPA 3E15A 3RFXA 1R9JA 2PRSA 2FX3A 4P35A 5KFGA 3EXG2 3WKBA 2IF2A 4DEYA 1X80A 3G82C 4MV5A 2OYSA 4PHTA 3C5WP 1ZO8A 1ML3A 3FOWA 1GTJ1 4HXGA 3I32A 1QORA 2C7QA 4BLTA 1TM3E 1SELA 1XQ6A 2D5LA 4MZXA 2D4AA 1HEYA 4JWTA 2JGEA 3K0FB 4JV0A 2HNBA 3ICOA 4IFIA 5ALWA 1J0DA 4PXSA 2UUOA 2H92A 4B7CA 4TZ6A 3M1YA 1M54A 1K5HA 2YWFA 1QCYA 4K05A 5ICMA 2VYNA 4HAXA 3AP2A 4WNYA 2BFAA 4POAA 5AKXA 4XUGB 1T35A 4DV1H 3HS3A 1Q0PA 1A2OA 1M3SA 5HF8A 4I50A 2J30A 4RMHA 4HQRA 1QVRA 4ISBA 4CDGA 4M4SA 5GV8A 1W93A 2NXEA 1SUCA 4D0LB 4JC8A 1E9FA 1UBNA 4GPAA 3RF6A 4I1PA 1W8IA 2Q6VA 4RMGA 1NV8A 3IMGA 3DHEA 1EBFA 4D4LA 1LBIA 1T5LA 3CH4B 1KGSA 2F1JA 4A3KG 1C3JA 1C50A 3ZXSA 5IHPA 4L0DA 1M8PA 4K7JA 1Z18A 5CVTA 4O5OA 4LI3X 1DMRA 4E7PA 4US2R 1FMCA 2DKFA 4PCVA 4INOA 5IMSA 1KA9H 1GYQA 3O94A 1NJGA 1PZHA 3HKEB 2XNJA 3WSWA 1E9DA 1R0RE 2XOXA 5KG3A 3BCSA 2CV2A 2O2ZA 4DBVO 2HCBA 1FA9A 1IDN1 2CUNA 4GL2A 1UXKA 2Z6AA 3MHPA 5K8JB 3HABA 4KQKA 3QP9A 4IWYA 4RVGA 3O4IA 1LW6E 4DSAA 1PNOA 3DB2A 1KRHA 2PKYX 3HKZA 3E1GA 3WE7A 1ND5A 3C5EA 4L8GA 4S1OA 1X7HA 2QM7A 5EP4A 4YDSA 1W0JA 4YCMA 1L4UA 1XFAA 1II8B 3OD1A 1P5ZB 4K6OA 1EQAA 4IS3A 1X14A 1A69A 2EC5A 5LA6B 4KE7A 4QXAA 1UNNC 5B1IA 1QYWA 3CLHA 3FFBA 5TMDA 2D7DA 1ZMRA 4BNJA 2J87A 2J3JA 2E48A 5ALLA 1X77A 4XIGS 2P1DA 5KOIA 3AI1A 4Q4JB 4EL0A 4KVAA 4UTVA 3L7YA 3TM4A 3QHPA 4NZPA 1JR3D 3INGA 4TVIA 2C7VA 2UVVA 2OEPA 4C7MA 5KSWB 3VTZA 3FYCA 4PSUA 1M9NA 4X62B 2SKEA 1WMDA 1K5DA 5CDFE 3V4OA 3J80W 2G5TA 2E85A 2XYPA 3LX5A 4M88A 4LOKA 2RB4A 2RHGB 1L7EA 1XN1A 1GTG1 1AN7A 3FKJA 4W7HA 2PZKA 2FEKA 3NHWA 4OKNA 4HAZA 4YWJA 3OZSA 4IRMA 4EI9A 1ZJJA 3O82A 1Y7PA 3H0GA 2XJ4A 1PW5A 1EQUA 2Y1GA 2Q3HA 1X1BA 5I4BA 4FFDA 1ONSA 4B3GA 2V97A 5EZ6B 2RGGA 1W4BA 1ZXXA 3B8HA 1WEHA 1E32A 3VPCA 1KFBB 1LI4A 1IY9A 3MRSA 4Q66C 1NSFA 3L6RA 1ZDMA 3L7JA 5AW9A 3EFOA 3K1YA 3TDKA 3GTOA 4QLOA 2R1VA 3SIRA 2DKNA 2UXDB 1U9JA 5L4LA 1WDLA 1MABB 1NF9A 4C6HA 4IIDA 1QVZA 2P4HX 3V7YA 2I8LA 1N6OA 2A1UB 1SUSA 3VU0A 5ALUA 2W00A 3RT7A 2Z09A 3SJZA 1KF0A 3U4HA 4TT3A 4MQ4A 4AICA 4RESA 4DYHA 4QQFA 1NX6A 3MGBA 3OX4A 3D7KA 2R82A 3JYNA 4QGFA 3RSHA 1D6MA 3IPAA 1KTVA 4EGQA 3B78A 1ISRA 5JIBA 3KSBC 3LWBA 4KXFB 4UFPA 4GOND 5JJCA 1P6XA 3DTVD 4U0JA 3DMPA 2WVJA 1K3TA 4ZO4A 1E3JA 4X6UA 3OSUA 5EPUA 2ZAYA 2Q5IA 1CUVA 1GGFA 4E13A 4B4WA 5JZOA 4BBPA 1W94A 1NXSA 4A8TA 4EBEA 4WA8A 3UKOA 5FH9A 1FPMA 4PN7A 3KUDA 2V45A 1V8ZA 2DM6A 2JIQA 1PWHA 3L43A 1QB8A 3T9FA 2GRAA 3AY3A 4N54A 4LV6A 3IODA 3D8TA 1OW3B 4PY2A 3GIDA 1BD3A 4XYMB 1TA9A 5DU2A 1P9WA 2Q7XA 4RORA 4V1CI 2EGUA 4F4JA 2ZR0A 1WCV1 4B7UA 1MG5A 5FAXA 4GR4A 2QUHA 4G0YA 3QENA 1JFTA 2IPOA 4YBZA 2A7QA 2FFRA 3TD9A 1F6WA 3A6JA 1TM1E 4ASUD 1D2NA 3TB6A 5MF6A 1R9MA 1TGYA 2RI6A 2WHYA 4JQSA 4BDTA 5I60A 3RVOA 1TX4B 1DX6A 4DJJA 4PNEA 3C6BA 4TMVA 2AUMA 4XEUA 2BSXA 1XBTA 1W88A 1U7PA 2PT5A 4I9FA 3ISJA 4RNOA 3HR8A 1RXIA 4YH1A 1R27A 2IP2A 1R5OA 2AI2A 2MWMA 2BFDB 3DOHA 1XXLA 4GXNA 1GFZA 3A6PC 3MRXA 4PYNA 3KSAC 5I7AA 2H63A 2OFXA 3GB8B 2K87A 4LGVA 1JKJB 1TK2A 3V97A 3WRXC 3STUA 3IEVA 4Z6KA 2EBHX 1Q7RA 1U8CB 1SC1A 3IC5A 4BJ5A 3D2BA 3BCRA 4DR5H 2XRFA 4K6KA 4UD6A 3K1AB 2BEVA 1NZDA 2AEMA 3DZFA 4DAOA 2FR8A 1M33A 3G2LA 3N05A 3IR7A 3N2ZB 2DHRA 4RVCA 1XKXA 1LQ2A 4M1OA 4YJGB 4DBZA 1TD9A 4MRMB 1DHTA 1W19A 2HF7A 5F1KA 3OOEA 4JELA 3U7JA 4YHHB 1UXGA 5CT9A 1CJCA 4MLDA 1YFLA 4LQLA 4ALMA 4LJ7A 1NC1A 4CKYA 1QP0A 2PQ0A 1RVV1 4DIOA 3FM9A 2FQYA 4W8HA 4YMHA 4S2EA 2ZBVA 4IH9A 5IH7A 3FRIA 1RHMA 3I28A 1T6YA 2PJDA 2D8MA 3MWLA 4V38A 1PL7A 1TDJA 4HWRA 4AJPA 3ELWA 2RGAA 3MJFA 4QEDA 1BVYF 3UFXA 3ZBUA 1T24A 1SMKA 2Y67A 4YYZA 2V9WA 3DOCA 2B69A 3KBOA 4O4JB 2QUJA 2ZAMA 3V6JA 4B7AA 2FMHA 4FHGA 3K3PA 1E69A 2NAFA 2W8KA 4AF8A 3LU1A 3JYLA 3DMRA 3U1TA 2PKXA 1UDRA 5CLLA 2AI3A 2OXCA 3NIFB 4U6QA 1XD9A 4AZTA 4ED3A 5FP0A 4A82A 4I5DA 2E89A 5IARA 4P98A 1V7QA 4RA9B 4DFDA 3H7IA 2C0PA 3F9CA 1BDHA 2H2DA 4ITUA 1DAPA 3KOWA 3FGNA 4LDQA 4MGZR 1CQJA 4B6EA 2ZCVA 1NW5A 1IN7A 3FYDA 4MYDA 2PL1A 1GEGA 4Q02A 3DOIA 2VH2A 3IIMA 2XYRA 1VIYA 4INZA 2QAJA 1VP3A 2VQFB 3RLFA 2XE6A 4RNDB 4OSPA 1HM5A 2ZDHA 5KOHB 2HK8A 4CF6A 2EJ2A 1WBJB 2IE8A 3IQFA 1BEUB 3GELA 3I83A 2IUFA 4EI2A 2DTEA 5JY1A 1U1CA 3FLEA 3Q8QB 2G9RA 3R7WA 3F9RA 2ZYVX 4OFWA 2C83A 4C7OA 2Q99A 4CTJA 3U56A 3I12A 2OUKA 1EFVA 1WSAA 2R84A 4C1BA 4Q1EA 4BJHB 2FW1A 4UHKA 2ZZNA 1E7RA 1VLHA 3CX7A 3HZRA 1NQXA 2W2MA 3EVAA 3J7TA 3E84A 3V1LA 1OTXA 3PDIB 5A4DA 4H6VA 1P17A 1OYVA 4EB6B 3BGWA 4BNXA 5M7EA 2WWXA 4M53A 2DWCA 4TYYA 3CXRA 1TM2A 3DZIA 1AQYA 1FQWA 5CFRA 2AR0A 3TWOA 2A6PA 4WCVA 3ZVRA 3OZCA 4RK7A 4GPEA 4QJBA 1SKYB 4TWBA 1HDOA 5JQGF 4MHTA 1ANKA 2FSPA 1D0IA 1LDNA 3IRVA 2H4YA 3S8MA 1B93A 1JU9A 4JLVA 4MB0A 5ALRA 4YALA 1OIWA 2RJ3A 4FTWA 2Q4RA 1M1UA 1EFTA 2PL5A 2OCGA 2J8ZA 3LUJA 3EUFA 1ODTC 3U4CA 4BUZA 2PO5A 2H4ZA 5D3KA 1T1RA 3JXEA 4X0EA 1SGWA 1WOYA 2HTEA 3RQIA 2V54A 4Q4CA 2HY7A 2Q5QA 3M4YA 1SKBA 2GF0A 4E2WA 2OLJA 4NBSA 1KU6A 3EC2A 1VIVA 1NE2A 3LTEA 3NWEA 2WUEA 4YROA 4MEBA 3MZ0A 4B3HA 4X62H 4Z51A 3P4YA 2RDIA 1DG1G 2FE4A 3QKWA 5K01A 1NBHA 3V1YA 4KO3S 3DULA 3GTJA 3IOBA 1P5HA 2XRYA 4EEKA 4OFZA 1OA0A 3HI4A 1QGDA 1X38A 4LJ9A 4RLSA 1TTQB 2W6IA 9ABPA 3GJ5A 3OZIA 4K0KH 4A0QA 2BR5A 4KFUA 4W1QA 2WB1A 3KYDB 2WWRA 3KB8A 1LH0A 5J59A 4GOKA 3J7AK 3GAFA 1U0SY 1II9A 5I9NA 4EG6A 1Z33A 4ZMRA 1E64A 1CR1A 5KFRA 2A58A 1NN3A 2JZCA 4KQFA 4BLVA 2WAXA 2AFHE 2ZVQX 3DAPA 2FSUA 1NQWA 4C4ZA 5HZKA 3MTBA 1JX4A 4XFKA 1PL6A 3L0PA 3FLAA 4M1MA 4XWOA 4TMZA 4QRDA 3QJ5A 4E07A 4IIVA 2WJYA 5HEKA 3VPGA 4CMCA 1EX9A 1LEHA 4RXUA 2FRDA 5D6OA 1TMGE 1TCBA 3UM9A 2NUAA 4NH4A 5BSEA 5FTKA 4O8CA 4NZOA 2COGA 2G0AA 3FFAA 4YR7A 4MCHA 2WP8J 3V42A 2C95A 1JFLA 3VYUB 4G6ZA 1T8UA 4TKVB 3ZD9A 4U63A 3L18A 2B99A 3OX3A 3LF2A 5AXDA 4JXUA 3PX3A 4WY8A 4PGFA 3ETGA 1QQTA 1J0BA 1QBGA 4UHFA 5EXTA 2QMEA 4UULA 4BVBA 3K4QA 2HI0A 1QFSA 1J00A 2QD5A 4BE4A 1O95A 1MQ9A 1HT3A 4Y2HA 3GV5B 2YFHA 3NT2A 4D4MA 4AY6A 4BQNA 4QXRA 4I14A 3RVNA 3C87A 4M0DA 1PS9A 3DDOA 2AK3A 1KFJB 3LQQA 2F62A 3EGEA 1GPWB 3S1AA 2YOGA 4N5DA 3VNRA 3VVCA 4CEHA 2C9YA 1KHTA 2ASDA 3N1UA 3TTSA 4BMOB 4U2CA 4MKFA 1E61A 1EG2A 2C4WA 2JA7A 1EFUA 4GXTA 1YB6A 4EFMA 4P4LA 1QK3A 2IXGA 1A8QA 1I1LA 2PRYA 2CNLA 4OQXA 2VLBA 3CVWA 3H17A 4YB8A 4FC6A 1TWFA 4K9SA 1V2HE 1BE0A 1UT5A 1JEOA 2DJ5A 1MD9A 4Y30A 3AEKA 2R6HA 4HQKA 5E6SA 2I6FA 3FCOA 1PG0A 1XLUA 3KUCA 4DBLC 4XKJA 1NW8A 4DZTA 1UKBA 3GTMA 3WTCA 2IBMA 5IW8A 1T9ZA 1N9GA 5DT9A 4W8OA 3D2LA 4CEJA 1YQXA 4CM4A 2KX7A 1LUAA 3G0GA 1J8MF 3SQXA 3TDNA 3UY4A 1AN9A 4D9HA 4GC9A 4N65A 1JDNA 2IHKA 1GPMA 3IBYA 1JG6A 4E3WA 3LUGA 1RRGA 2GK7A 3M5CA 3EN0A 1GL7A 2DU8A 1QONA 3E1SA 4Z9XA 5G1OA 5CX4A 1H1LB 3P2KA 3IOYA 2OCKA 4HVTA 1YAHA 2BHRA 4CE5A 3ZN2A 2YZ2A 2DPMA 4WERA 4F5WA 3DVAA 5KFBA 1E1QD 3INTA 5CRIA 2M6SA 5COQA 1CV2A 1I2ZA 2QQFA 3P0RA 5B7GA 5K4HA 3DBOB 5JTUA 2XV1A 2BRUC 4FX2A 1C80A 4ERNA 3AI2A 3UJ6A 3KKEA 2POQX 1ZD1A 3ZWKA 3QE0A 3MS2A 1H4VB 1UKYA 5DM70 5AXBA 2ZM5A 1XMPA 3C8ZA 4KEAA 1KSGA 3KE9A 2DULA 3RB4A 4H59A 4JIMA 2YZLA 2GXUA 3HN7A 4JLSA 3SX2A 2LV8A 3VI4B 2GJAA 4LE0A 1PZGA 4Y3UA 3HDVA 2BTOA 3DTFA 2V4UA 4K86A 5JANA 1NYQA 4HQ0A 2J3MA 5L4SA 2ZG6A 5KYXB 3HU3A 1U8AA 3EIQA 2XIGA 2L69A 4YHHH 3IIIA 1H05A 4GBGA 4U00A 2NPOA 1Y8ZA 1G9TA 3IVAA 5GOZA 1MV5A 3H2JA 1AV7A 3WIVA 1M2OB 2JCSA 5CD9A 1JALA 1WXFA 4D92A 4R8LA 4N01A 2VPXA 3P9NA 1AKQA 4YCLA 4BVJA 2EARA 1E2NA 3ESCA 1YZHA 5HGXA 4XCXA 1QPZA 1KFKB 4DL5A 3GFSA 3CNBA 4DMMA 3KLBA 2AN1A 2R92A 1L1RA 3BF7A 1SCQA 4K6MA 1KYWA 4MW9A 5CU7A 1N0UA 3RS7A 2B37A 2IS4A 4QYMA 2JVIA 2CDBA 4EGAA 2YQ5A 5E38A 3K53A 1RIIA 2OG1A 1M6YA 4C4AA 2C59A 2HWKA 3KHLA 2R5FA 4RPCA 3TG2A 4B6GA 4UUOA 4XFDA 3C8UA 2E37A 4R9RA 1SYXB 3CMMA 3GJSA 5TR9A 4D43A 2NWQA 5EIEA 3ILSA 3HOXG 5FQNA 3U3ZA 3SHWA 3LGAA 3SYLA 3HC7A 1DWOA 1DQNA 5GM1A 3H1TA 3N39C 5J3JA 2FGJA 2ZT5A 4MQFA 5KNBD 1C9EA 1Y3FE 4HO1X 5CTAA 4ED2A 1H8ED 1GQSA 4MS4A 3I73A 2MT9A 5A2GA 4JI5B 1O6GA 3KLNA 1MOPA 1YJQA 4JUDX 4ACAA 3AFIA 5L1LA 2PDAA 4PZLA 2Z9BA 1JZTA 3MBIA 4WDQA 1Q0RA 1TTTA 5IX8A 4HEQA 1HA3A 1NLUA 2VSNA 3ZZUA 3KX2A 4ZVVA 4V0QA 1WUKS 4F4UA 1ZCZA 3P9QA 2RK4A 3WL4A 3IA7A 1L8LA 5FIUA 1ZA1A 2E1RA 4IYRA 1TQ8A 1IFXA 4EVIA 2OLSA 3I8XA 3KOXA 3C16C 3CXUA 5LUAA 4GQBA 2NSDA 2JFHA 3U7QA 1PKEA 3FUCA 5F7XA 2QX9A 1PR3A 2JHAA 3FMIA 1ECCA 2Y3IA 2VDJA 3Q1KA 2O8FB 2QTWB 3LQKA 4E94A 2P6RA 1AHIA 4Z0HO 1V8DA 4YO8A 3EXG1 4O7WA 1DAAA 1VDZA 3PUXA 3OCYA 4DSTA 1Q22A 4HB0A 4L6CA 4LHYA 5JYCA 1WWKA 3FDIA 1I10A 3BGVA 3WGHA 4JY7A 1J09A 3AF4A 3IT3A 2WY2D 3MT7A 5KHAA 1M2VB 3K1ZA 1QRAA 1TWCA 1IHYA 4NF2A 4AFNA 2DKOA 3FFTA 5FYDA 3N76A 4LZWA 3HBJA 4LZZA 2EF1A 2FKAA 3MUFA 4EB3A 3CPHA 4PINA 3QG1A 4X54A 1A9OA 5ICFA 1JHQA 3BWCA 1GN9A 3JAKB 5LZ5A 2R7NA 5IAKA 4UQOA 2E2IA 1IK4A 1A9YA 1XVUA 2IC5A 3A1FA 1B1CA 1HK7A 3MRVA 4JUCA 1ZISA 1IQPA 4HDSA 2UZIR 3D6NB 2V4MA 3PIIA 1I32A 2AC2A 3WLOA 4AY2A 4HMQA 5CT6A 4AMBA 1J8YF 1KOLA 3MTJA 5AJHA 4FFMA 1INLA 2GZ2A 4CM6A 4WKPA 3R4CA 5D1PA 4JVOA 3E8XA 1NBMD 4JL8A 3R5FA 2AQKA 3L0SA 1UJ4A 1OH8A 5B5SA 1P4JA 1RM5A 3KXLA 1VL0A 4H3HB 3DOUA 2I2BA 2XKBA 1SZDA 3W7BA 3O26A 1EB8A 1U90A 1DAOA 1E1YA 4LRUA 2EFEB 4PQRA 1PJ3A 4QHYA 5LVAA 2NUBA 3TS1A 1OI2A 3M81A 1JJFA 1HOTA 2BHLA 2NVUA 3HXKA 4ZDIA 1I9GA 1OPRA 1QYVA 5FFNA 4IJQA 3K0CC 3CNQS 5T4BA 1DIGA 2O03A 1YMQA 3OLVA 3CJTA 3B48A 3O8RA 4FXOA 3ROXA 4RFLA 3DE0X 2HBZA 3GVCA 2G8NA 1Z37A 3A9VA 4BGVA 3HV2A 3UANA 4XDYA 4GOLD 1Z5ZA 4EEYA 1ADFA 5LWQA 4WNAA 4D1YA 1JSRA 1B6SA 3P9IA 2LVBA 3WNCA 4I3HA 1JH9A 4EVSA 3QX7A 3RUIA 1C1XA 2DQKA 4LWPA 2D2EA 1EZ1A 1JLRA 3PYLA 1GCUA 4ENSA 4JLJA 2IS2A 1NFRA 5ALDA 3CKLA 3GZNA 6PFKA 5JYBA 3KM0A 1XTJA 1CE8A 4Q1BA 1P0QA 3V7UA 2CVFA 1AKYA 4J3FA 4PICA 3MEQA 5TQVA 5F7OA 2XLCA 2QVCA 3NDIA 1OE0A 3J81A 1NIPA 5FO0A 3CVZA 3PEVA 2J6BA 3ONEA 3ROEA 3W3AD 4DLRA 4F2WA 5JMWA 5KNDH 3LULA 4BE7B 2BY4A 3QZ8A 2Q46A 1RYSA 2NO1A 3VH4A 3DBLB 1L5WA 2EYQA 3R7NA 1UXJA 3GZJA 3OPYA 3EHDA 1VKRA 1JL3A 3K70C 1M6VA 3EA4A 1F2DA 3RGXA 3N5KA 1JIUA 2C9BA 3LJKA 3GF4A 2JAOA 4E5SA 3L92A 2Q0HA 3I1YA 3HNOA 1Q92A 4XFJA 3V4VB 3MAJA 5K99A 1D4AA 2NX2A 3IP5A 2CDAA 3FB1A 3NETA 3GJ3A 3N0VA 1BWQA 3AR6A 1F60A 3R6WA 1UBMS 1L9KA 4XB1A 5B2FA 4IDQA 1SXJE 3RS4A 4PZ6A 3OE5A 4FGLA 5FOWA 5JNUA 1Y1LA 3ZK9A 5A9RA 2Q5EA 2Q2TA 5AUOB 4QKQA 2HRQA 2ARKA 2WIJA 2IK8A 4Q15A 1PBNA 2B8EA 3PFBA 1EFDN 3C8DA 2AG8A 3A04A 1OWPA 4Y1RA 2OTCA 2ZRFA 3H4DA 1P44A 3F67A 2AGQA 2XCIA 4O4HA 1IBKB 4LA4A 3ZWCA 5FL7A 3G17A 1C0LA 1ZG3A 1UBLS 2Q7OE 4Z4EA 5KVVA 1U0TA 1N5KA 1X3LA 3PQCA 1Q15A 4UCVA 5AVQA 3DC2A 3BN3A 4A0GA 2H8KA 4DB2A 1GPJA 4RVFA 4LE1A 1RD4A 2ACEA 1RE1A 2XMDA 1SKAA 3RV4A 3IJPA 4JKIA 4R7TA 5L4NA 2XEDA 4OGLA 2W4MA 3KXIA 3OPMA 4XZ3A 2BKLA 2OECA 4L15A 1AZWA 3RHSA 1N2CA 4GX2A 5JXJA 4M2LA 2W6NA 4JJ6A 3I9MA 4KZPA 4MQUA 4PX3A 2WFMA 2YV3A 1Z5VA 3IUEA 4WHMA 3DLBA 4MA4A 1N1GA 2JDID 2D3TA 4BVKA 3WIOA 1AS0A 4MKIA 1C3VA 4FIDA 2OO5A 3PC2A 1MPTA 4GYKA 4OM7A 2JASA 3CZCA 1KP3A 3A1SA 3GFVA 2AF4C 1J0CA 2DSTA 2EJ3A 4B7XA 4IEEA 1WD7A 4OXQA 3IQXA 5CCDA 3V46A 1UPXA 4KI7A 2NAPA 1EIZA 1KZ7B 4PTLA 4DXHA 1LQTA 1IVNA 1F17A 4FE3A 2IXBA 4MIKA 2H5IA 1VI5A 1SVMA 1KDPA 4XWTA 3ETLA 2EAUA 2FAXA 5EZ5A 4CU5A 5L3SA 3RRFA 3WMEA 1XDGA 1YKGA 1S68A 2M6KA 2YRWA 5B4VA 2EX4A 2H2AA 1JQ5A 3AFNA 4ESOA 3HI6A 1Y5LA 2NVOA 1ZL2A 1WXDA 4F56A 1E3TA 4ZHQB 4N6GA 4PN3A 2E0IA 4ROTA 5JRJA 5A1TA 5KFQA 3IDQA 2VAPA 4M1EA 2GLTA 3ZD8A 2D2XA 1T2NA 2R66A 5LP6B 2PVCA 3G5MA 1KE2A 1CEEA 2A9VA 4Y7DA 2IWHA 1FTQA 4QOGA 1JQDA 3QWBA 2VDMB 1H3NA 1Y4DE 4RABA 4JI5H 2CFOA 4J94A 3H5LA 5I7VA 1YJCA 4RH3A 2AHRA 4YCDA 3U3XA 1UPCA 3TOXA 1GNTA 3R0XA 2HEIA 4YUZA 3QPAA 2WMDA 2NACA 4PO9A 4ZZ0A 4HDMB 3RAQA 3IG0A 3L8ZA 3NNSA 5EHGA 5FNZA 4AG6A 2VXOA 5B1DA 1BDBA 2HHAA 5F4ZA 4Q4AB 2NSLA 4N8DA 1AKNA 5DHTA 1OTHA 4D8XA 1PSDA 3RW9A 5EZYA 1SZCA 4F72A 2PH3A 4GAEA 4KIJA 2I1LA 2YHSA 3PD1A 5DFAA 3T1VA 2W2QA 1UPTA 3I8OA 3A1DA 4MRRA 4B4UA 5IVKA 1A9QA 3JWGA 2ANCA 4DUPA 3A1CA 2FW7A 5F9MA 1DGSA 2J0VA 5IN4A 5NULA 4EY8A 4BTLA 1YQGA 3IPRA 2BI8A 5KWSA 4FP9A 2FMXA 1NV9A 1SXPA 3JQAA 4OJKA 1Z8FA 3VKUA 1BO6A 1U7XA 4TRRA 4AD8A 2OQVA 1IMOA 4P9NA 5JWRA 1QPBA 1FQKA 1KT8A 2GBFA 1MJGM 3MAAC 2YXNA 3EWIA 4MWGA 4MVJG 1JGTA 2AYYA 3ITKA 4C3OB 1JWBB 5CK4A 2O06A 4G97A 2Z4TA 1PFVA 4IMPA 5L7YA 2VRCA 5KCZA 3Q8PB 2Z2YA 3MF4A 2IYTA 4UAUA 1NZJA 5DNYB 4DV0B 1Z0UA 3HM2A 4I46A 1DXOA 3FOBA 3PTZA 2PGLA 4REOA 3CEAA 4C22A 2BQ3A 2HA0A 1Z63A 1I3KA 4JEUA 3F1LA 3EGOA 4KRFA 4H3SA 4QX6A 1ZOLA 5FLXW 4HNGA 4G0VA 3RQSA 3W9YA 4PG5A 2R86A 2HNKA 4YRSA 4ZU3A 1IXZA 4QHSA 1ZEMA 3RSCA 3OURA 4OIMA 2C2EA 4J07A 4JYMA 3VHXA 4KDRA 1JTEA 3PIRA 5ISMA 3DXFA 4UMDA 5KOJA 3RB8A 2XA1A 1JR6A 4TOIA 5EJ5A 1WV1A 3BTUA 5KFSA 4HWKA 3TE6A 3KQMA 3D0QA 1PK7A 4OPMA 4YRGA 2IODA 4J0DA 3E22B 2E7ZA 2I8AA 4X8OA 3GNLA 2YMPA 2ZJ2A 3I6MA 3AM5A 4FHEA 2OD9A 4HH3C 3ZY4A 1CY2A 5I7WA 2W43A 3AIKA 3RROA 2VF2A 2D74A 1FZTA 1WQ1R 1JU4A 1GADO 1KY5A 3JQQA 5CVVA 1KBQA 3E2PA 5FNVB 5JZ9A 5DEOA 3ZDEA 1HETA 2PJUA 3BGSA 4BRSA 2VATA 4KWHA 3ZBTA 1U6IA 4BNFA 1GT91 3VR2D 2PUJA 3WRWA 3A3NA 3NMUF 2QXTA 4FMCF 5E9QA 1VBHA 1OWTA 4GI3A 1BG6A 2AW5A 1ODJA 3KD2A 1RKXA 2KHZA 1R9GA 1RAGA 1ZUIA 1ZVKA 3IV6A 3EPKA 1RRCA 3W2EA 3K4PA 2H4HA 3H7AA 5LOVF 1XU9A 2RHOA 2C4NA 2E4WA 3H19A 1KI4A 1SFRA 3PWZA 3QBVA 5JUWA 2OCYC 1K6IA 4HDNB 1Y0BA 2V4RA 1T4DA 1F5NA 4J9UE 5DGCA 2YYAA 4DRFA 2NTVA 1YI1A 1WUJS 3NVDA 4UU1A 1ZN2A 5IWCA 1V7PC 2Z9CA 3NYQA 2Z8YA 4O33A 1TU0A 2J3EA 3DEAA 1VJ5A 3QELB 3IOEA 1K63A 4DIMA 1S7GA 3G9QA 4IR9A 2FPWA 1GZUA 3KFVA 1UJ5A 3BPSA 4M9ZA 1KQ3A 5FI1B 3AYXB 3K0SA 3MIZA 3EPRA 3QXHA 3S70A 2P2DA 2ZJ5A 4M87A 1GL9B 5ITZB 3IELA 4TPKA 3OIFA 2GSWA 1V39A 5KWVA 1XRPA 1RXVA 2C3YA 1L6RA 1SC3A 3WLLA 1GNRA 2J85A 3MG9A 3OJ0A 4FYPA 4GVPA 5EMKA 3TW6A 1LJ8A 2ZOSA 1UCFA 2HV9A 7YASA 2QRNA 3IDZA 1MAUA 4LE2A 4Q93A 1W4ZA 4BFXA 3IA2A 1M74A 1UANA 1N2ZA 5ESDA 4JLPA 4PONA 2NZYA 4CCYB 1WF3A 3K6SB 3CJQA 1P19A 4PC6A 1RXYA 1BXRB 3WXBA 3DBRB 1MO6A 3U1VA 3I0NA 4WIAA 5I4IA 4DUYB 4G0QA 1T2VA 3IDFA 4FZJA 4JDUA 4E33A 2ZB2A 1XTTA 1IBKH 1FKAH 2GSDA 4YCNA 4A8JB 3CEMA 1YE8A 3HGMA 3OY2A 4LOJA 3A2NA 2PT7A 5G2OA 1L7MA 4O2AB 3A3YA 4RA6B 1I14A 3JVEA 3PL5A 1YZLA 1Q5PA 4BNDB 2QW1A 4XWYA 3RYCB 4NLLA 4ABTA 3PA8A 1FJGB 5EZSA 2R8HA 4ONEA 3EEIA 4O63O 4DJDC 2SNIE 1LKZA 1RI1A 2PUAA 4HNQA 3WKDA 2D0IA 2LIVA 3GRZA 4DMRA 4OOFA 3ROPA 4M1KA 4TS4A 3IS3A 4UTZA 5LQNA 5ER9A 1KJ9A 5JAUA 5ALGA 5LSAA 3H9UA 3D4IA 1JEJA 5MGBA 1RHQA 2G17A 2V3CC 3QI7A 5JJBA 4MUYA 1NSTA 2QDKA 3DCJA 1GZDA 1LFAA 2NSJA 3BQ9A 4D81A 1AQNA 2NYUA 2XNDA 7AT1A 1MAHA 4TV9F 1GLGA 5H3LA 1PEAA 4R2MA 4GR9A 1M1ZA 4TROA 3OTIA 3QU5A 3GN2A 4E2YA 5D8DA 2IS6A 3ON5A 1OX4A 4KO2S 5CH5A 1A8IA 1DLJA 3LKVA 1VPLA 4ZEXA 1JXAA 4OQZA 3NC0B 3NTVA 5LDGA 5TVGA 3X1WA 3W9SA 4MVXA 4A10A 4PX2A 5EUBA 3RVDA 2EZ8A 3DLIA 1LBQA 3QLVC 5SYMA 3TL2A 4S24A 3F2IA 2GF2A 1E3LA 1OJ7A 1PJSA 4BNVA 1O96A 1N33H 3LCJA 3W1VA 1IQUA 4R2LA 5AOVA 3IDSA 3D59A 4Q6WA 4UARA 2IYNA 2HJRA 5GIOE 2Z5FA 2D1TA 1BE1A 1Q57A 1ISFA 4IUDS 4WOCA 3DOEA 3O2JA 5JG7A 5FUMA 1E3MA 2C0QA 3SY8A 1KXJA 3JQBC 3GC6A 1Q1BA 4IM7A 5E9AA 3GLIB 1A9ZA 4KKVA 3LWNA 1C4XA 5JCJD 5ES3A 2AN9A 3TOSA 2ZJFA 3W1EA 2IHTA 2BCJQ 4PLYA 4EHHA 2RCNA 1RAHA 4CTOA 2HGZA 2NO4A 2H1RA 2BL4A 3OWHA 3SYNA 1SY7A 5REQA 1CKNA 4K8OA 2YWXA 2CXXA 2JA6A 5KAPA 1U5BB 2O23A 2W22A 1R00A 2HWWA 4PZAA 4E31A 3GA5A 3OWOA 5KYWA 3K0FA 4HNAB 1Y8AA 2IIBA 1DOAA 4J7AA 2JJQA 5CLQA 2DCUA 2W2XA 1BDIA 1Z2CA 4X5OA 4E30A 3RD5A 3HVIA 3WLEA 3W9UA 1ZHHA 3BA1A 1WA5A 4KNYA 3KG2A 2CN1A 3RYHB 2IPNA 5J1TB 3U55A 3VYVA 3VYRB 4WZBE 3DM9B 4OXXA 1OJLA 4IGAA 2QBYB 1YD7A 2N47A 4E15A 2ZBGA 1AO3A 4YQYA 4QW9A 3QY9A 5L3QA 3M70A 3TTWA 3PXUA 1T36B 1JBKA 5KIAA 2EQAA 3UWSA 2PH7A 2JA5A 3D4BA 4J49A 5EQJB 4HEJA 3KDSE 2EJCA 5HRUA 2X3YA 5C5CA 1R6AA 1L5YA 5I5GA 5H81A 3KEMA 4CF3A 1NXWA 3EJWA 2H4JA 2PL9A 4B3CA 3HKCB 3N0RA 5CA1B 4C7KA 2JLQA 3NLLA 3KXKA 2OAGA 2X1MA 4JP3A 3MTEA 3G89A 2GCNA 4KUEA 1ZWKA 1HZJA 1Z56C 1I13A 1FNSA 3LT2A 2EWWA 1E20A 2PSHA 5BWLA 3EWSA 5KUTA 4ZVMA 3PU6A 5IBCA 1TLTA 1D2AA 3OE1A 3HOVG 4CGYA 1MG0A 1H0HA 2WUGA 4RKYA 1GXSB 1RJ9B 2PUEA 1E0KA 4NDNE 4DR7B 2JHPA 2PUVA 4DV0H 1SAYA 2NOAA 1UBHS 1L1QA 2B0JA 5DGDA 1OGJA 1R4AA 2LRHA 5C1IA 3TSAA 3DTVB 4YDHB 3BQ1A 2F43B 3GGCA 3PB3A 3E9ZA 5EZQA 2B2XA 1L7DA 1ZIPA 4TT8A 3D8UA 3KE8A 3T3HA 3I05A 3M89A 1G41A 5JMOA 3KHTA 3OPXA 1AU9A 1T3LA 2O8EA 2IEGA 4ECXA 1DCMA 1MFPA 4PQYA 3ID6C 5E95A 4Q9KA 3MD0A 3MBOA 1I30A 1CFJA 3AXSA 1Y7TA 1PR9A 1OLOA 4CLXA 3OIVA 1OU4A 4C4TA 4YRKA 3WQBA 2K5UA 4JBWA 3HDYA 4MITA 4A5OA 3RWOA 4F3TA 2PQMA 3ZDRA 3PRJA 1B23P 1G7CA 3T1OA 1Q2UA 4CIVA 4NH0A 3L93A 5IN5A 5HTOA 3LIPA 1P2FA 5FR2A 3E7XA 2INGX 3EQ6A 3I01M 4BX0A 4QO7A 1OFIA 4H08A 4E1BA 3QVJA 3RGGA 5FV7A 1VMEA 1Z9BA 2ADOA 3N75A 1AKEA 1PX2A 2JCGA 2C3OA 3QU9A 1BFUA 4Z9BA 2V1XA 2BKUA 4PHCA 3PNQA 4FLFA 4Z4IA 2BFEA 1XMVA 3ITNA 2JEYA 3EDQA 3SI8A 2NADA 4R1TA 4B5KA 4NU5A 4O1IA 2ZGIA 3OEYA 3AHGA 1Y37A 2Y76A 1XZNA 1WD5A 1H5QA 3TTTA 3JD1A 3ZDFA 4RL4A 1V1JA 2X4DA 5KC8A 1G64A 1T2FA 2F1IA 4FGKA 4DF3A 3G8CA 3H40A 5KSZA 3GFPA 4MR7A 1IOZA 1J42A 4DR3B 1I01A 3LUPA 5CVCA 2FQQA 4FFBA 2Y0CA 4M0CA 3ONFA 3G49A 5FWDA 1KP9A 4OX9B 4C7BA 2VZ8A 3DGEC 3GLFB 4FHFA 1DXYA 3VA7A 3AVTA 4A15A 2R8BA 3SIXA 4JJIA 2ODQA 3OCVA 1Z08A 5TMPA 2H06A 1HLPA 1ZAYA 3GUZA 3BSWA 4ZO8A 2GKOA 5E0KB 1FFAA 4FOOA 4P7GA 3JWPA 2H2GA 2C1EA 4WCFA 5KFOA 3Q85A 4UUAA 1ZNZA 1NVXQ 5JVDB 2AZDA 1DBVO 1QGYA 1L3CA 4BEVA 3FSGA 2E2WA 2J5XA 3PVZA 4TTQA 5CB4F 1U0EA 1AA6A 2HJVA 5GY7A 3LFHA 4HSGA 2G07A 4XTRA 4LDAA 5HRCA 1ZUNA 1N48A 3J7AC 4ARAA 3W5CA 4WKNA 2DY1A 1PJTA 1IY0A 2FYTA 3B89A 1R2QA 1GHTA 4K0RA 4DMGA 2I2WA 4LRXA 4A3GG 1PTJC 2WC1A 5CCXA 4DLUA 3GLQA 3VKVA 4OI2A 1Y82A 1ZI9A 3F5FA 2IRWA 1A76A 4KQ9A 1GVNB 3N59A 3C98A 1XDWA 3P71T 4UTRA 4ZQHA 3B3JA 4D8UA 4M6WB 4WLEA 3AWIA 1OHHD 2V5VA 3NBZC 4R5HA 4JB8A 4U9HS 2W98A 4EQ6B 4IJVA 1SVIA 4YRMA 4XYMA 3BIWA 2Y68A 1AX9A 2R97A 4GEGA 2XQVA 4IX1A 1F38A 1FJGH 5CDUA 3H8VA 3GTQA 1ZJZA 4KODA 1IRXA 4L2IA 2XOKA 3RFVA 1EA7A 1LVUA 2HLNA 1N3YA 2DQSA 1Q0QA 3L8MA 4HWGA 4JT8A 3T4UA 4EFKA 1ZH6A 3TZ6A 3KPYA 4OB8A 1NBAA 2KI5A 4Q0MA 3OU7A 3KQYA 4OL9A 1Y48E 2X5KO 5G40A 4M8LA 4UCXA 1ZBQA 2CLEB 3DHWC 4XI9A 1JKJA 4RB0A 1S7CA 1EGAA 1L5VA 2ZPTX 3DQQA 1IC6A 3FETA 2VPSA 3P19A 1ECGA 3UB3A 3FTQA 1BYIA 1CQZA 4D3XA 3SQWA 3UYLA 3GVHA 4PFJA 3K1AA 3AESA 3ANTA 4ED9A 3CS3A 3RRBA 4UCTA 1K8QA 2WZCA 1YQWA 3I5YA 4BFUA 4R01A 5JPCA 1XZDA 2G6TA 2WDTA 1LWOA 1DMSA 3V2IA 2YN0A 5EL0A 1N5LA 4EGJA 4YJGA 1X1TA 3VSCA 1ILEA 1Q7BA 1I1QB 1GGOA 3A1EA 5AESA 3ME5A 3CKKA 3EA5A 4H7DA 1J06A 1TQDA 3PDWA 4AVYA 3IIJA 1IZ8A 4XA8A 1FJ2A 4CRWB 3ZCUA 5KFLA 3AFGA 1HNXB 3EXHB 1D0VA 4OHCA 1NP3A 3O9ZA 3I1IA 4H16A 4ARZA 2W9CB 1CWUA 1N25A 1LK7A 1VS0A 3OPQA 4FUTA 1K7YA 1KI8A 4FSHA 4FYVA 4HUQA 4Q34A 4LYFA 2IW1A 2WFLA 3SE0A 1XMIA 1N9KA 3LO8A 2O2XA 4AJHA 1EWTA 1AUXA 4D57A 3DEKA 5JMTA 2UXDH 4RA9A 3ICVA 2GM5A 3HUTA 1VZ2A 1LBTA 2E82A 1NFFA 1YE5A 4X90A 3HWRA 4EFDA 2WYHA 4JI2B 4MQEB 4RU1A 2ODTX 2ZJ6A 1G8MA 4Q1FA 3T9CA 4UAGA 2ZE8A 1UZAA 2SECE 1XTUA 3R3HA 4RS4A 1P39A 4KAFA 2BOVA 4FZRA 4TSFA 1Q1AA 3DWIA 4M21A 3S68A 4ZVTA 3N07A 3H9BA 4DJEC 1QNLA 2XSZA 5GGYA 1OIXA 4LXQA 3FDFA 3OSNA 2GCPA 1ZETA 2Q9UA 5EIBC 1KPGA 4F3NA 3VYWA 2OILA 3UMGA 1QO9A 3V8NA 3LKZA 3FKSD 4WXPA 3Q7QA 4XD2A 5ALFA 2G83A 3DLPX 2EKZA 1CJKC 5K09A 2EQ5A 4UREA 5ESRA 4EJMA 1W75A 1BVRA 5ALEA 1UADA 3CSUA 4G0ZA 3H4IA 3K09C 3AXTA 4MRAA 4DW8A 4DR7H 1ZEJA 4YRQA 4DADA 2ZI3A 1L5NA 5H9WA 4BWVA 1G5FA 2QJRA 4EYGA 4ID9A 4YS6A 2O19A 3WG9A 4F50A 1OZHA 5JWHA 2XMPA 2C00A 4EJSA 3JATB 4TV8A 3M4ZA 4X6XA 3LRTA 4CKXA 3BBLA 1Z0DA 2J7PA 1F8YA 1MLDA 5TJHA 2P77A 5JAQA 3TR0A 1NULA 2ZRKA 4DJAA 2VA2A 4FJ1A 1QFJA 3FCUB 5CCEA 3IESA 2B63A 1UFKA 3H16A 4PR0A 2Q62A 3V3TA 4JGIA 4R8SA 4YWHA 4KPFC 3EG9A 1N2IA 3NHSA 4KQ2A 4QUIA 4XLLA 4NBRA 4UPEA 4PS1A 4D9CA 4ZJYA 1TJ5A 1V1MA 1NRXA 2VXYA 3ILYA 4FR2A 1KEWA 1I8TA 2AFIA 3TX2A 4U7DA 5MN5A 3H1FA 4H6XA 1KR2A 1KS9A 1VXRA 4XYLA 5G4KB 4BLPA 3SQNA 3ACDA 2A33A 3OAAA 3BE5A 1N77A 5AR1A 4AYBE 4NPHA 2CLIB 3HRHA 4J9KA 1B33N 3KQNA 1HE8B 3QKRA 2UU9B 1GV0A 2C96A 1ACLA 3TFOA 1BTOA 2PKEA 4HDRA 4O25A 4D9GA 3KELA 1K3FA 2WJPA 5BSTA 2VK4A 2H17A 2LZ0A 3SJCA 4D4GA 1E89A 3KEOA 1UJMA 5F51A 1PV1A 2VWPA 4G0UA 3U1BA 1UZUA 2ZRDA 3DO6A 3HA3A 1D7AA 3PZBA 2C2YA 2DQZA 1ZD2P 1FSPA 4A6DA 1VL5A 1YZKA 2VUTA 4QOFA 2PBRA 3EPGA 3LZ6A 4A3CG 1GTRA 4L16A 2ACKA 4GI2A 1L3BA 2VDLB 1R88A 3H8SA 1CEYA 5ALXA 2R48A 3K70D 1M7JA 4EUHA 3FHCB 4CV1A 8GPBA 5IAEA 1L7RA 3WJ1A 2O5EA 1BMTA 6REQB 5DN6A 4YEDA 1ZK4A 5E8JA 3K05A 2GT1A 1UL1X 2G1AA 2C29D 4Z4CA 5T7BA 2ECQA 4C6SA 4R0NA 2TYSB