3V4ZA

D-alanine--d-alanine ligase from yersinia pestis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
305
structure length
293
Chain Sequence
b'AEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
molecule tags Ligase
source organism Yersinia pestis
publication title D-alanine--D-alanine ligase from Yersinia pestis.
rcsb
total genus 94
structure length 293
sequence length 305
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3v4zA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3v4zA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4zA01
4O7VA 2CNUA 2R7MA 5CAEB 1SCUB 1EUCB 1DIKA 5HBRB 2XCLA 4YB8B 4ZHQF 3RUPA 1JDBB 5LYJF 4M9UA 2FPPB 2CQYA 2NU8B 1PX2A 2J9GA 4IHJF 5BMVF 4ZQIA 3V4SA 1CE8A 1IOVA 2YZLA 4IZOA 4MAMA 4O81A 1DV1A 1B6SA 2CZGA 3MWDA 3KAKA 5BPHA 2R7NA 2R87A 2YRWA 2R84A 1WR2A 4MV4A 4MV1A 3TIIA 5CA1F 2PN1A 2V5AA 4MA5A 5H80A 4DIMA 4C5BA 1KEEA 4EA8A 3BG5A 3N6RA 4O7RA 4I4TF 5C1OA 1CQJB 2YL2A 1CS0A 4EG0A 3VOTA 4MV8A 1GSHA 2YS6A 4J6EA 3KAJA 4HR7A 1EZ1A 2IP4A 1CQIB 1KUTA 1E4EA 1W96A 4TV8F 3HBLA 3ETHA 3K3PA 4ZOLF 3TW6A 2YWVA 2FPGB 4HNVA 3ORRA 4O7ZA 4YBZB 1A9XA 2YYAA 4O7NA 4FFPA 4XX0B 4XZ3B 4DLKA 2W70A 4TV9F 2FB9A 1W93A 3UFXB 2P0AA 3VA7A 5LXTF 4O4JF 3KALA 1A48A 2R86A 4FFNA 4MA0A 4FU0A 4O82A 2XD4A 3R5XA 4L1KA 4O83A 4EAAA 2W6PA 2GLTA 3AW8A 4O7LA 1GGOA 3LP8A 4IIJF 1M0TA 1DV2A 4O7TA 4O4IF 1GSAA 2HGSA 4HNTA 2I8CA 1GLVA 3U55A 1VBGA 2ZDQA 3BSYA 4I55F 5CA0F 1KBLA 4EA7A 5IYZF 4ZI7F 2VQDA 1UC8A 2YRXA 2NPOA 3U9TA 3JRWA 2W6QA 3MJFA 3VPBA 4EA9A 2GQSA 3TQTA 5JQGF 2W6NA 3U9SA 2R7LA 1C30A 3ORQA 4YJ2F 1T36A 5BPFA 4GGMX 3RV3A 1AUVA 1KJIA 2DZDA 4O7WA 5KX5F 3K5HA 1B6RA 4QSHA 1VBHA 2Z02A 4IWYA 3BSWA 2ZDHA 4MV3A 5C8YF 4E4TA 2R7KA 2YZMA 5I47A 3BSSA 4MV6A 3GIDA 4M98A 4HNUA 4O4LF 2DLNA 2NUAB 2VPQA 4RZQA 5K2MA 3BFPA 2CNQA 3WO0A 4O2AF 4WBNF 3MWEA 3RV4A 2YS7A 4EGQA 1OBDA 4XYMB 2NU7B 3VPCA 2HJWA 2YW2A 4WD3A 3TINA 1JDEA 1KJQA 3RFCA 4EGJA 3R23A 1VKZA 2VR1A 1JKJB 3SE7A 1BXRA 2R6FA 5LP6F 2CNVA 5HV6A 2I87A 3K5IA 4Y8VB 3OUZA 1I7NA 5KKNB 2Z04A 3I12A 3TIGA 3JRXA 4XYLB 5C1PA 2R85A 1BNCA 3V4ZA 3AX6A 5LA6F 1AUXA 4O86A 3VMMA 1OBGA 1KC7A 5CB4F 1C3OA 3R9RA 1EYZA 1I7LA 5JQWA 3WNZA 1KJ9A 1IOWA 2NU6B 2OLSA 1ULZA 3JZFA 3R5HA 2NU9B 1PK8A 3GLKA 1Z2PX 5DMXA 2W71A 4ME6A 4O7YA 2V58A 2W6OA 2PVPA 5LOVF 3WO1A 4O4HF 4YJ3F 1JLLB 2YZNA 4FFOA 2DIKA 2V59A 3G8CA 3HB9A 1KJ8A 3JZIA 3NUAA 4MV9A 5FNVF 4FE2A 3VPDA 2QK4A 4TUYF 1KJJA 5D8DA 1E4EB 4M99A 2PBZA 4I50F 2C00A 3LWBA 2VHEA 4O84A 3HO8A 3Q1KA 2YZGA 4FFMA 1Z2NX 3KREA 2I80A 2FPIB 2ZDGA 4MV7A 5EZYF 2R82A 3QFFA 3Q2OA 4FFLA 4EABA 5JH7F 1UC9A 1M0WA 1EHIA 2W6MA 4C5CA 1M6VA 2W6ZA 3N8DA 4FFRA 2GPSA 3ETJA 4O7SA 3R5FA 4NYEA 5J2TF 3DF7A 2GQRA 2DWCA 4YAKB 4IWXA 5J2UF 1GSOA 1EUDB 3OUUA 2FP4B 2QF7A 4FGRA 3G8DA 4C5AA 5GONF 3U54A 1Z2OX 2GPWA 2SCUB 4M9CA 4O2BF 5JVLA 2WYOA 3E5NA 4HQ6A 5JVDF 4YAJB 2X0SA
chains in the Genus database with same CATH superfamily
4ZRNA 2UUAH 3ZDQA 1YB1A 2OV6A 1MAWA 2VT7A 1N8KA 1ZONA 2DHCA 3KKLA 4NZNA 4JBHA 5LB2A 2WLTA 3WR5A 2ZJ3A 1ZU4A 2O2DA 4DV3B 2IL1A 2Y0PA 4JXJA 1EFVA 1IY1A 1FMTA 5FIUA 1MXFA 2AKYA 2BM9A 2MR6A 4L5CA 1XD9A 3WK6A 5E0KB 2R8YA 2G9QA 4X3CA 1B8PA 1YCFA 3IP5A 1L4LA 4HNGA 5AXCA 1NQXA 3NUGA 2ZKIA 3BH7A 1BDMA 4ZOAA 4AK9A 3FZGA 1BVUA 3A25A 4FIZA 5FPPA 2PKEA 5C46F 1PYOA 4B3RB 1PT7A 3I2KA 4H7JA 4L2IA 4MEJA 5DX8A 4WCVA 1X2BA 4LXHA 2ZIXA 3HHEA 3AQIA 3T4PA 4H15A 3FJYA 1QPBA 2PWZA 3AFHA 1DAIA 4HB0A 1P9LA 1TYEB 1PSDA 2WIBA 3D4LA 3NJ8A 5JFOA 1H85A 3A4IA 3NQ41 1T4BA 4JBWA 4Q05A 4WVLA 4YO8A 4Z4CA 2UUBB 4FDAA 1WCV1 2D1SA 4QU8A 3VR2A 4L8LA 2AV6A 5D2CA 1RXEA 1IOVA 4C05A 1NUHA 1IBMB 3RYFA 4MAMA 3CGWA 3CWCA 3E70C 5AHWA 3ZLBA 3HWRA 5A2QW 1VSUA 4ZGBA 5AIAA 4IDBA 4PR3A 4DBLC 2X14A 4L5YA 1GT6A 1WDMA 3GIPA 2Z09A 1YJXA 2X0DA 1TZKA 1H1TA 4HSEA 4RACA 3RI3A 4DR3H 3WE7A 2HFKA 1Q91A 1G5PA 1Z17A 3C3DA 3CZPA 1DAKA 5C31A 3KHGA 2JFZA 1RYYA 1YQWA 4D9NA 2CJXA 4MV1A 4B73A 3RSFA 4M8KA 1WIWA 2VJDA 3DYBA 3HWSA 4FDLA 4FGKA 4IIFA 1GWNA 1YZKA 4Q19A 4PPGA 4BKMA 5JMTA 1FUIA 2VQEB 3ET4A 1M34A 2IGBA 5H80A 5AOCA 3HY6A 3RYTC 4ZOEA 1VJ0A 2WF9A 5DG8A 5EL0A 2GEJA 1I2BA 3U48A 4Q3BA 3OQPA 4D1YA 1TMYA 4UFNA 4CKYA 3PJDA 5L3QB 3OTOB 1I3MA 3D6AA 3FOCA 3CCBA 3QHAA 4LMPA 1LTQA 4PXYA 5FBZA 1W9HA 5F73A 1DE0A 1RAGA 3SI8A 1DAMA 1U3VA 2NUPB 3JVUA 3H18A 3A6LA 1H2AS 1V41E 3NAZA 3WLSA 3MR3A 2MSNA 9GPBA 3JQGA 1BS1A 2QV0A 4WRRA 2EOAA 1ULAA 3M33A 1A2BA 3HZRA 2DH5A 2OQVA 5JSZB 2ILVA 4AROA 2R48A 4AAYA 1FRFS 2MCTA 2QPOA 5A9RA 1RWKA 1XWIA 5LOVB 4LK2A 3LRPA 3ZV7A 5F9LA 3ZWWA 4F5ZA 1XP8A 2YS6A 1IZZA 3P2JA 4CMEC 3AZQA 1EB9A 1YWGO 1ZXXA 5BVHA 1IQUA 2OT3B 3FKIA 1BEUB 1LKZA 1XAHA 3UYYA 4IR1A 3M6MD 3PGXA 4GGPA 4GKBA 5AVOA 3MXTA 5K0NA 2I8AA 5M34A 2JB9A 1JIVA 2ZYHA 2PSSA 2OHFA 3DW3X 2VP4A 3T9CA 1K5HA 2O2HA 1AN9A 5BN4B 4B3GA 3MZ0A 3HVHA 3UTCA 3X1MA 4ETSA 5CVUA 4E5NA 5EY5B 1H4VB 1YMQA 4J9MA 1A72A 3K15A 1I2CA 3L6EA 3Q4GA 4V02A 5EESA 2RHDA 3D1VA 5EHNA 2GZ2A 2H9AA 2QVCA 2PIAA 3JQQA 2F6RA 4J7XA 4TTAA 2YWVA 2JD2A 4J0CA 5CLHA 4ZOQI 1BOFA 4J9KA 1RCTE 3EY9A 4UOQA 5EE0A 1T8UA 1V8OA 2GA9A 2FPGB 1T4MA 3BL6A 3N53A 5TSDA 3ZW8A 1DWOA 1Q95A 5IZ4A 1CY6A 1RXVA 4Q3NA 3COZA 4URXR 3EUFA 2C5BA 1GXSB 4TV9F 4I9NA 1IG3A 5HILA 5PNTA 5IXJA 1CUSA 4MRVA 2IK8A 3PR2B 5JCOA 1U31A 3IUNA 4KBGA 4EECA 1QCZA 3KSUA 5DGHA 1E8NA 3UHFA 3ISJA 4E08A 4HWPA 3RNLA 4LSMA 5JROA 2FOLA 2ZJ6A 3I45A 2QNBA 3SC2B 4CE6A 3ZE0B 4EDHA 3R3YA 1QRTA 1JV2B 5EGNA 1S2IA 5LZ5A 1QG0A 4KJZA 4L72A 2C5LA 5L1LA 4FOLA 5GGYA 1E7SA 2WHQA 3HJTA 3RYHA 2QRVB 4QIHA 4DV7H 3I73A 2MHCA 3ZLTA 4HVLA 4ECRA 1XALA 1YVRA 1WXQA 1NPYA 4EKNB 1ABEA 2ZYAA 1MZBA 3PVSA 4HDMB 4RKQA 2OQ2A 3ZWQA 2Z2KA 3TGPA 1SVSA 1L3IA 2QEQA 4PS1A 5H59A 4BLUA 1XELA 2ZAMA 2ZJ8A 3ELBA 3NTQA 3TL6A 2PNFA 3M3PA 1ECGA 2Q46A 1Q19A 2HVQA 1YC5A 2WJHA 2OSVA 5F2OA 2ZWIA 3FNHA 3QXXA 2ZJZA 3VHQA 5DISB 1F4VA 3IDFA 1YRWA 2EX0A 3OZEA 2CLIB 1DUVG 4Q3CA 1SC4A 1VHQA 2UVQA 1PU2A 2E6KA 2OM2A 2Q9CA 3OJLA 3EZFA 1JG7A 2YNMA 3B51X 2FP4A 2BJWA 5IVIA 3GFTA 3T7DA 3W2FA 1M10A 4ND4A 2PK3A 2PXHA 3NNSA 1R6BX 1R9JA 2BP7B 3QFSA 3O4RA 2YJNA 2GAJA 4MWTA 3MBOA 3GIIA 1ZESA 2HMVA 1P3DA 4KHPB 3L46A 4RK7A 2WTFA 3U80A 4PHGA 2FPUA 5K0EA 3WK7A 2JANA 4RGVA 1HFKA 1K63A 5DOZA 3S81A 3UT6A 3PNYA 1XPRA 4MVJG 4DG9A 3GB9A 4OGKA 3BXEA 3EZXA 4UBIA 3DHEA 2Y0BA 2JFFA 1OYOA 2PXAA 3G8YA 3RS7A 3TB4A 4Z5XA 1AMOA 2JEGA 2QUIA 2Y4RA 1XA4A 1XU4A 2GAAA 4MS4A 4WKCA 5IHPA 1LU9A 3HKDA 1SQSA 1KO4A 3PX7A 1KC1A 4UCWA 4S24A 1I6LA 1VA5A 2ZYGA 4N1AA 1ZAKA 3I9FA 3GNLA 4REQB 2CNWD 4WKNA 3F9IA 2VPSA 1R12A 2JFHA 5G0SA 3TGWA 4L4SA 3V6MA 1PNOA 1FMLA 1CF9A 1QJCA 3OVMA 4BLWA 4ZGWA 4LJAA 1EBUA 4UVDA 1HOTA 2Q5IA 2X6TA 1F4PA 3VR4D 3OLQA 2JK1A 4GKKH 1DFHA 1NDHA 1J9GA 1YQGA 3VNAA 5LM3A 1IEVA 4TSFA 2WTBA 3WICA 2GKSA 3WIOA 5KQPA 4FT4A 1U0RA 3KL2A 3N3AC 4IIEA 1CKOA 2ST1A 1PWHA 4I6GA 1T2FA 4ZT5A 3VDXA 4HQKA 3U9SA 4MTLA 5FOTA 3RSCA 3FLBA 5CH5A 4ZI5A 1J8YF 3O8LA 5IUNC 1Y3FE 2JJ1A 2PTGA 3I0NA 3OA0A 4CI9A 4B3MB 1BG6A 2Q0SA 1GR0A 1J24A 1ZN9A 3B5IA 1U0EA 3EPHA 4R83A 3X1YA 1T43A 2R8EA 3I4LA 3V1UA 3TUZC 2OTCA 3EXFA 5TJHA 3KUKA 3GJTA 3MFIA 1QIEA 1PFKA 1Z5WA 5CXXA 3CUWA 1KI8A 1G6Q1 4DLNA 3U13A 4IHJB 1JLKA 1KJIA 1K98A 2FZEA 3UJBA 1E4OA 2ZATA 4ESVA 1WW2A 4YP0A 4TM5A 5KSZA 3GP5A 2QPTA 2HK9A 3RSQA 1OZGA 3S2FA 3ZTWA 5DGTA 2OWDA 1JEQB 3B85A 3WK4A 4G5GA 5IAAA 2QRNA 2ZWAA 4P54A 4DA0A 1B93A 1KI9A 3K6JA 3OJXA 4XUCA 3OSPA 4K2HA 3MCUA 1WDKA 4UJ5A 5IN5A 4CQMB 5K5EA 1VKHA 4ZIRB 5I47A 3A4LA 4I08A 4JGBA 3WGYA 4UTRA 1J0AA 3OFJA 3PU6A 3FLAA 2JATA 1KFJB 5FPRA 2VDRB 4TKUB 2EP5A 2Q3MA 3AETA 4N54A 4POAA 1W8IA 5FT9A 4PX3A 2AK3A 2JGKA 1ND5A 2VJMA 4P0QB 3MCVA 4TTIA 4GPIB 2ZIVB 3BFPA 1U9IA 3LRXA 2FEPA 2J5KA 4RVNA 4WZBE 1H3EA 2PZBA 3MWEA 1UBEA 4K7JA 3R5KA 4I1UA 1OBDA 1L5HB 1Z36A 5FTNA 1KJWA 1XFAA 2XODA 1F3OA 2J9YB 5JQGA 2I4RA 2YW2A 2XECA 3ANMA 3OZUA 4K03A 2PMKA 4KO4S 2RIRA 4RPCA 3L93A 4YRDA 3RC7A 3SVZA 4KLRA 4F6CA 1R6VA 4HN9A 3T4XA 3H84A 3WKBA 4XARA 3JPYA 1OD6A 2C4KA 1AHPA 3M6VA 3OD1A 4EPTA 2QD3A 4NG4A 1Y3HA 2ZSDA 2WD9A 1NSYA 5AKKA 3ZLUA 4EY8A 1GZ3A 2C0QA 5KYTA 3GRKA 4FZ3A 3IHLA 1GL6A 3A14A 4DVJA 4KR2A 1VG1A 3OQ1A 1FNBA 3PEYA 4J1NA 1RBMA 3G88A 4PXAA 4Y6OA 4ZV7A 3FKQA 4MYUA 5E9JA 2CB0A 1LUAA 2HTEA 3FVTA 5IDXA 1Q3KA 3OUZA 1JLLA 3D6TB 1Z7GA 4R2XA 1FW8A 4URHA 3QITA 2E2WA 3CO0S 3PNSA 1LNZA 2GS9A 3E61A 3GGCA 4WECA 1O8CA 1REQB 1SBTA 2DQSA 5THQA 3CO5A 2H7YA 3BMQA 2G3YA 2H2HA 1O5OA 3SY8A 1IQ0A 4GZLA 2RGNC 2HB6A 3DM9B 3IRVA 3O0TA 4JITA 4MR9A 4ZOLA 4I1IA 5BOVA 5K7SA 4BXOA 4D6YA 2P4UA 1LPAB 5K8VA 1VRVA 4TN5A 4A15A 4HRVA 4DANA 1HT0A 4GDMA 4PCAA 2V4RA 1KC7A 1XLTA 3JQBA 2JAUA 3RVPA 3THOA 7AT1A 2O2SA 3IDSA 3LD9A 3E15A 1RYSA 2OV3A 3LDGA 4IF6A 4OK5A 1OX6A 3DKVA 1SKBA 1WP4A 2O2EA 2RHHA 2QXUA 1AQYA 1C7FA 1JIJA 4KRYA 5HF6A 4TV9B 2IV2X 3R9RA 1TU3A 4L28A 3CUTA 2IYVA 4J4BA 3RREA 3LL7A 5C0OE 5EJ5A 3K8YA 1ZK0A 1KZ1A 1LV8A 3KUXA 2IOFA 3BTSA 4Y6GB 4G0XA 2QL6A 1O77A 5DT2A 3JR7A 3ZE2B 1UZUA 2A5JA 1KO7A 5IBRA 4UOZA 2FW1A 3PD7A 2ISCA 1XPJA 3H8WA 1EJ6A 3KKNA 3GLGE 5ALRA 1GU1A 1QE0A 4WIAA 4DKXA 3GTLA 3MWEB 5EIEA 5DCYA 1FFXA 1ZD4A 2DBRA 4C0LA 2EJ0A 2NZWA 3BRWD 3GROA 3HA3A 1K4YA 1PJSA 3SEQA 5F12A 3SR4A 5I4KA 3W1BA 3DAFA 3EUAA 2A8YA 5HS4A 1RYHA 4NH0A 4ALNA 5LLTA 1B4DA 1JIXA 2ZJ7A 3B82A 3GNQA 3IUPA 4P4SB 2H63A 4ZU1X 1A04A 5EPOA 3P2OA 4WNAB 1KDYA 3T5KA 3B70A 2ARKA 3GGDA 2ZIXB 3KQQA 1ZM2A 3BORA 1GGFA 5AM1A 1KWGA 2IU4A 3SKVA 3LYAA 2EIHA 4V0MA 5E1MA 2COJA 3COVA 3ZGOA 1VJGA 3JTMA 4NS4A 5G1NA 3F5DA 4AMZA 3PC4A 5HZMA 5A06A 2DFLA 2WA1A 4M3NA 1TM7E 3HYSA 3GQBA 2H2DA 4K3VA 1GPAA 2ZYUX 4O2LA 2AD5A 2B4TO 1MAHA 5D84A 5I7AA 1IXZA 3ZOKA 2O8DA 3EULA 3AHCA 2OXRA 2SHKA 3IAS1 3MNFA 4JP2A 4J2HA 4G85A 3PW7A 5E6RB 3ZNPA 3OLVA 4RM2A 1WDTA 1FFWA 2DIKA 1TJNA 1RJ9A 1V26A 4LBYA 3GX1A 3S44A 3MWDB 4BKQA 3OF3A 1N2XA 1QHEA 4Y1RA 3WLMA 1I7DA 4DR4B 1SOVA 1T6ZA 2E4YA 2Q3LA 3NB0A 3O74A 1JX4A 4P86A 3UCFA 2XUZA 4C87A 4Q4CA 3FR7A 2RHJA 3BWEA 2C5HA 2CLLB 3F2VA 2V7WA 4J0JA 3HL0A 1RRFA 4DMHA 1BVRA 3UWPA 3HXKA 1MRNA 2HUPA 1FIUA 1V7QA 1CD5A 1KYIA 2G70A 4ZWNA 3PNMA 2FX3A 4J6FA 3T7EA 1E8DA 4QPCA 4D8XA 5JYEA 4UARA 1AHIA 1C3OB 2DBYA 4F3RA 2ETVA 4UU8A 3PDIA 1Q92A 1T0PA 2VRWA 3D3NA 2GDJA 3BJEA 1KO1A 3ZHBA 2P9GA 3VNUA 2UZIR 1G8JA 3H8VA 1CC1S 2GCNA 2CDNA 1N2GA 3L1JA 2FN3A 2ZSUA 4CTOA 4BUJA 3MR6A 2J0UB 3GYBA 3TRFA 2FLKA 2EWVA 4Y9SA 1MN6A 4DIDA 2D5AA 2PUVA 4FFLA 2X7HA 4XVHA 1ZFNA 4O4JB 3B13B 2A92A 3JYPA 3F7TA 3G9QA 3PQ4A 2LZ0A 4TMYA 1IHPA 2QYTA 3SFZA 1X94A 3VYSB 1SFRA 4QWAA 4NHOA 1NOIA 3VNRA 3WWDA 2FK3A 5FD5A 1PZNA 3SNHA 2FZKA 3ROXA 1MV5A 1V6AA 2OORA 3FNGA 4TQGA 4OFXA 3FWHA 3MJRA 1E2QA 2PX6A 3SHWA 4CF3A 1GITA 1OXXK 2WKQA 4D0NA 1OLXA 5HQJA 4BVAA 4M46A 4PZYA 3ITDA 4YO7A 4RSMA 1E3IA 3B1VA 4XM0A 3RRJA 2NG1A 4IQ8A 1I3NA 3LYLA 2GYWA 1XZAA 4UBJA 1YR1A 3R0VA 2R97A 2CJWA 3KSZO 1Q74A 3LGAA 4MR8B 4ZZ0A 2JLWA 1QIDA 1HNWB 2ZRDA 3IA2A 3CRNA 3GRPA 3ZWDA 3DONA 3L0ZA 4IWXA 3VC1A 1XA0A 1M72A 4X7MA 1KE2A 4GGOA 3SFVA 4DCUA 3D6MA 2FFHA 4NAHA 2QN7A 1PWZA 1LC3A 1QTNA 1TM3E 2EHDA 2ZE7A 4O2BA 3MPUA 5EFOA 5F9NA 1EDDA 2H4JA 2YQ4A 3PE4A 3DT6A 3EXEB 3KSDO 4HUQA 1T5TA 2CFMA 4LVCA 4TZKA 2XKKA 2MSWA 4GLWA 1KR2A 4HMOA 1D07A 1BFDA 1SBNE 3RFVA 1BYUA 1Z2OX 3HP4A 3JSXA 4DV3H 4QGBA 4KK4A 4RORA 2Q7DA 2OAP1 5A0TA 1U6JA 5ANRB 1UZAA 1P3Y1 3EPGA 3AEUB 2CZCA 4C03A 2PX0A 4N5IX 3B7WA 5ALVA 4G4JA 5DNCA 4OP3A 1QVZA 1HKHA 2FN8A 3THXA 3ZHSA 1IVYA 3VNSA 4I46A 1Y7HA 3K8ZA 2G9ZA 5E3HA 2P2LA 1LQUA 3RTEA 1LWNA 2VF8A 4HDNB 1UJMA 2J0UA 2IITA 3OTQA 1O97C 4BN0A 2QTGA 4M7EA 1O03A 1CR4A 1VYUA 3HBFA 1POXA 2QRUA 4H77A 2OUKA 4JAVC 1MNQA 3S99A 1ISGA 3UZOA 2D2IA 4J9UE 2O3TA 3D3EA 1EE1A 2QQ5A 3NBAA 3RJ5A 2LIPA 3U81A 4DLLA 2KPOA 5TEVA 4YIHA 1VMKA 3PYLA 2NO9A 2C4MA 3LG2A 4PBCA 2HSZA 2A35A 4RA9A 2YFYA 4C6TA 1BDHA 2PH5A 4FCCA 4YYEA 1E9BA 2FUEA 3P7MA 4NPAA 2E48A 2XYHA 3BL5A 1C81A 2DQKA 5DQHA 3HDJA 1Y4ZA 1QU3A 3PA6A 2VXYA 3IB6A 1JYSA 5TT0A 1YA4A 2B5VA 2XUFA 1KAQA 3EGOA 3KWJA 2J3LA 4JQOA 5HQ3A 1HLPA 2BP7A 3OZXA 4GOJA 3KKKA 1GR1A 1C9EA 3WJAA 5CCXA 1K7XB 3QF7A 4HV4A 5DNEA 3JQ8A 3P0FA 1PTJC 3U0VA 3L1HA 5L9AA 4BNXA 3LULA 3I01A 2PMZE 4W7IA 2QM8A 3AU8A 3CN9A 3AEQB 3WGJA 4CMBA 2IT1A 1KYQA 3T9AA 1FL9A 5AKZA 2C88A 1A2QA 1FTWA 3LPLA 3Q1LA 1R64A 4PG6A 4QVIA 3MAAC 1X70A 2PU7A 3AHFA 2MSKA 3HR4A 4S05A 1H9CA 4CCWA 4W7SA 1A96A 1QG6A 3URKA 5KJCA 1X1DA 3HVKA 5JLAA 2LD4A 1TIBA 3WG9A 3NWBA 3WYDA 2I22A 3GQCA 3BD8A 3EY4A 3EXG1 4QG7A 3TLJA 1WY5A 4L0CA 4N3AA 5CTJA 5JW6A 3LC0A 1JG3A 5ADVA 1RQGA 3R6LA 1OKKD 2M1XA 3MTBA 2QRJA 5D6OA 1PGQA 2QHXA 4Q5IA 1CF4A 1QRRA 1R6UA 2ZITA 3U0BA 4A3DG 3CNHA 1E5VA 1SVIA 2QMYA 1MB0A 3R8XA 3FPBA 2DHDA 4A7PA 4YUXA 5LNK1 2HMYB 2C1EA 2W4IA 4G67A 4U7GA 3ZHZA 3TRKA 1QKJA 2FX5A 1VIYA 3QVVA 3O90A 5A2GA 1NN0A 4KYVA 4RKYA 3C7AA 3LX6A 1XKQA 5I5VA 1Z6QA 3P4XA 4XVRA 2O05A 1LA2A 4NG5A 1HE3A 1ONPA 3JZMA 1BIFA 1XQVA 1ID8A 1CCWA 1ZXLA 3SG0A 2C92A 4FXPA 5TEWA 3T1HH 1MF7A 3AXSA 3LUAA 1AQ6A 5M04A 3H5NA 2Q2VA 4K9QA 3DMPA 4CWAA 1UXJA 4B5KA 2O2GA 4D0LB 5CT9A 3E2MA 4J6EA 5BNFA 5LBTA 2OSBA 4EYIB 4EZEA 4MW2A 4UFZA 2X9LA 1K8RA 2J31A 1RP1A 3CU5A 3L7LA 4WQMA 1HT2E 4W99A 3ABSB 3HLKA 2XMSA 3B6IA 4X20A 4J9VA 3LDFA 1JWAB 3GLQA 4O4LA 3LKDA 2F00A 2ORWA 1Z37A 2VHQA 3AH8A 3EQZA 3FCYA 2AG1A 4RKWA 3NW9A 1KZYC 4F5YA 5IT0A 3LCRA 1TIPA 1U5BA 2XUGA 4ZKDA 2OCAA 4FI3F 2OGZA 2RKBA 3ED5A 1M2JA 3UK6A 2NVXA 5GONB 3MT9A 1HDYA 4P6VF 3QE4A 4UCUA 2H11A 3V8MA 1RRMA 1C0LA 1CRLA 1OX5A 3WGZA 3H8SA 2WAYA 3IUSA 4LW8A 3UNXA 4N9QA 1SZDA 4B6OA 4HT3B 2FJUA 3KLMX 2W70A 1SG9A 2CW5A 3DKRA 3QBDA 3R3XA 3ROTA 4E07A 3MILA 1XHFA 3MS2A 3PFCA 4XYMA 2GBGA 3X1XA 1R6TA 3L2PA 3JZDA 4P5PA 2AR9A 5F77A 3DDOA 1PG0A 3VJMA 1IN4A 2P0AA 1ZC3A 4HJRA 2DUWA 3V6JA 2R25B 4LN1A 2NSLA 1TD1A 3P9SA 3VA7A 4TV9A 3ZI0A 4L9AA 4BV2A 2V7GA 4GF5A 1JU3A 4O4JF 4O33A 2OHJA 5G53C 3NKFA 4UM9B 2WVHA 5B4TA 5FA8A 1NMEA 4ILKA 4A3SA 4DCTA 1CP2A 2CSUA 2HFJA 2QMOA 3MYRA 4YCBA 1Z12A 3TQSA 5ALHA 1G1AA 2HA5A 4YMGA 2XA2A 2QBYA 2CXTA 5KG0A 2VRNA 2WJAA 4U3JA 1PL6A 1QLJA 2V6FA 3UB2A 4D0GA 5A04A 1ESEA 1XRJA 3V8NA 2JIRA 3Q15C 3FYUC 1QRAA 2E2HA 4YCSA 2YIDA 2HG8A 1YS1X 1RK5A 1QGYA 4LY0A 4EJMA 1L7QA 1XD8A 4YB8A 1RJGA 4JV0A 2XQVA 2X0EA 2H2IA 2Q1SA 3DT9A 4A4DA 3DDWA 2ZUDA 1EEHA 1Z22A 2D0IA 3SJUA 2PQ2A 3AW8A 1DBIA 4U2BA 4ZXFA 4OX9Y 2XQJA 3ND8A 3PHHA 1TJ3A 4MCIA 1I4OA 1EM6A 1ITZA 2GYUA 5CGQB 3T4EA 4F86A 5A02A 1XTSA 1M0TA 2VO1A 1E5LA 4O7TA 3GFPA 3IEKA 4WXEA 2C4NA 2L0XA 3AKZA 1H2EA 1GSAA 2DKOA 1DBRA 2X4IA 4GE0A 4KN8A 2GJ9A 2MOKA 2YJTD 2TS1A 1PP4A 2X8JB 2OLEA 2O8DB 3KKMA 4PRKA 4FVTA 1GQYA 2R6DA 4O3FA 4HGQA 4L7VA 2WU4A 3CEAA 3EF1A 3M6LA 2KI5A 4JYMA 2JFQA 4LGYA 4XJTA 3BACA 2EF0A 4FBTA 5KFYA 2D00A 4JP8A 4QOGA 4MK4A 4FGZA 5DWVA 5EKUA 4I36A 5KYYB 2Y1LA 1Z56C 5FTWA 2J3KA 4FT2A 4N18A 1JQEA 1OAOC 4OJTA 2Y93A 4BEJA 1AJEA 3ROKA 3VHXB 3QUCA 1QK3A 2JHPA 4N5LA 5IU6A 2A9OA 1JHRA 4DPMA 1UXIA 3I9LA 3V1TC 4PC1A 4HAXA 3NDPA 3B6JA 4QNMA 5BWUA 4XB6B 2I03A 5DBHX 4K6CA 5BQXA 3RLFA 4LXTA 4M9SA 3ORSA 2RAFA 2EW2A 5FTMA 4D9GA 4B3SB 4EA9A 4CEHB 1LX6A 3U40A 3GRAA 4KQ2A 3WLPA 3SDZA 3NBXX 1WSCA 2AOUA 4Q47A 4KR3A 1QHSA 5JQGF 4FTWA 2VSYA 3E35A 1KEVA 4L15A 1G5FA 4LCBA 4E15A 3QPAA 1E1CA 1KQGA 1QU2A 1RI1A 1C30A 4GPZA 5FADA 1TLTA 4DV4B 1SIUA 2OXEA 3MLAA 5HOQA 1FLVA 2R4QA 1U94A 5GOTA 4CETA 4TPKA 2IIVA 4ES6A 1Y3BE 5BXQC 5GTDA 1TZJA 2X5OA 1R5NA 5CA1B 1VE3A 4QODA 5K51A 4ZDIA 3CZAA 2IPOA 1KK3A 3VYVA 4JI4B 2GPAA 2WSSD 4P35A 4J2OA 2REBA 1PTJA 3IERA 1QYXA 4M9XA 3TTXA 2CC2A 5K09A 4PSAA 3M6IA 2Z5VA 3QOWA 2HEIA 3RHFA 4RTJA 2XCQA 1YRBA 2VYVA 4HMQA 3LA6A 5KTTA 1YB4A 3MSCA 2XY4A 2XR1A 3ETEA 1F0NA 3YASA 1I2AA 1CNFA 2R7KA 3VR5A 5DLYA 4LC0A 2LR0A 1K86A 1M6NA 3S1SA 1JHAA 1QLWA 2FFQA 3CA8A 1KYWA 2OFXA 1ESNA 3KKZA 4DNPA 5B1HA 1RHRA 1T29A 4URFA 3U4DA 3ETLA 3GIDA 1RAEA 4HQ0A 1Y9EA 2ZIAA 3CT6A 3DC2A 2PL9A 4G84A 4PZ9A 1TK2A 3TI7A 1BGVA 4B71A 3WWJA 3C41J 3RRYA 2HHFA 1XCMA 2YYSA 5BO5A 2CNQA 4RJLA 5ED4A 5SZKB 4CR7A 3WLRA 3GRVA 3PFWO 1IUPA 2QX9A 4R3NA 2WFZA 4BP9A 4M8IA 3KQKA 4A27A 3SJAA 4F38A 1OASA 1OWTA 3KXIA 2GN4A 1MDBA 3AIOA 1Y81A 4UAJA 3VPCA 3TNFA 3DO5A 4UUQA 2AYYA 3GJ4A 3S2EA 5TDHA 7MDHA 5HHTA 4CV2A 4NMHA 3RUCA 3K0BA 1FRNA 2DMRA 1DJPA 3L7MA 1RQPA 3PV0A 3OCVA 4FNAA 5HCUA 1XP5A 3T3DA 4CM3A 3CISA 2R6FA 1LFDB 4EPYA 1WVMA 1Z18A 4CKCB 2X19A 4BFCA 5JCJA 4EAQA 3H8JA 2AE2A 1IQRA 4G09A 3OE1A 4RB3C 3CH6A 3JCZA 3L9WA 3PGA1 4YWHA 1BD4A 2YV4A 4IXDA 4B76A 4EITA 3A6JA 2A7XA 4OLJA 1YOVB 3ND7A 3MIZA 3OM9A 3R3JA 2EHJA 4RHTA 5HQTA 2VK2A 1YB5A 3UMVA 1FS5A 2PD4A 1UT5A 1IZYA 4EHDA 1AKRA 2O7QA 5KG6A 4YRTA 4RF2A 3PIIA 5DP2A 3SYKA 3U4GA 3TJRA 2OEPA 1ADYA 1W47A 4LV6A 3NR2A 5BWOA 3S3TA 4HBZA 3OOJA 4D4JA 1GPDG 4G37A 4LXIA 1AUOA 3QELB 4EBEA 3DWIA 2C2WA 3N2GB 2H31A 2ZYDA 5CVDA 3GT3A 1KP9A 3P5BA 3K0KA 4AF6A 4LF4H 3ZQ4A 4IGAA 1LNSA 4LVNA 2QJFA 3IVRA 4G63A 1SOWA 4ZQFA 4Q21A 4DA9A 5KWEA 4M36A 3EQ9A 1MEEA 1L5ZA 3LC7O 1QVAA 5U1PA 5FLMG 5A3SA 3RRNA 3CX3A 4G26A 4Q1DA 1WXFA 1LPBB 3NS7A 3A9WA 1IN6A 3DOHA 5IF9A 4KL8S 4BGUA 1TW3A 2XYGA 2PKQO 4FMDB 1GDHA 2OLSA 3CHYA 5CPBA 1P0CA 2BEWA 2FZLA 1P7ZA 2HU5A 3MCTA 1KVUA 3NLLA 4KAFA 4YAEA 5TMEA 4E5VA 3AUXA 4YRIA 3O8QB 2NUTA 4ZZ2A 4RFLA 1DTWB 1DJMA 1SIOA 4DARA 1OV4A 1TD9A 3II6X 1N2BA 1K4KA 1W44A 2JHGA 1NFRA 4GXNA 1FX0A 3OZDA 3QIAA 4MW0A 3TQOA 3Q8LA 3MWYW 4L8WB 4OLAA 1CUJA 3EHDA 1HYGA 2A0FA 3AVUA 2WE6A 4GR9A 2V7BA 4LXQA 1XE3A 4OXYA 3BB4A 4X6LA 5BMVA 4E7PA 3ESZA 3R9KA 2FHSA 4YAJA 5EJ8A 2AI3A 2VH5R 4KFCA 1V5GA 4PZ7A 1OCEA 3BWCA 1VP3A 4PG4A 2ID7A 3AOEA 4IJUA 3GARA 4OL0A 3WL7A 1QZXA 4HYYA 4QHSA 1V9CA 4BO2A 2Y1CA 3L49A 1GCIA 4KAXA 5LQJA 2NACA 3WJ2A 1I1KA 5DLEA 3EOZA 4WUVA 5E25A 2FF5A 3OAAD 1ZOPA 4TYWA 3HOUG 3OQ6A 3E81A 4P5EA 4WNYA 3UW1A 5BWXA 4BE4A 3OZRA 3HN7A 5CEFA 4RYLA 3OQNA 3D54D 4QDZA 4ZRDA 1I24A 3HPQA 3LOQA 1JXOA 4F50A 1RPJA 2NO7A 3MJDA 3OT5A 4Z99A 2HHHB 1W4LA 3D7SA 3I83A 2EG9A 3QELA 3QPVA 1NQAO 2JGJA 2J1LA 3DDSA 4MI3A 2VCHA 3CLSC 1MJNA 1NONA 4JR2A 4I55B 1U7UA 1HNXH 1ZMTA 5JNUA 1DC8A 2C00A 3O9VA 2OESA 4OU4A 3PP8A 5JCOC 4K9SA 3D3WA 3VBCA 2V8OA 3TW8A 1B6TA 1Q6ZA 1XJQA 2UUBH 1EK1A 1GM5A 2HTFA 3OTHA 1E5QA 1YQ9A 2IZ1A 5L4NA 3R9XA 4FFMA 1U8TA 2DE0X 3C3AA 2PX5A 5DEIA 1FZTA 3KHRA 4OD0A 4FHDA 3OZVA 2C5AA 2C2EA 4OHUA 3RGWS 1NUQA 3ZHQA 1LQ2A 5B2ZA 1E77A 1O94D 4N3CA 5IK2A 2GJ4A 3GTPA 1ZIOA 1K88A 2UZ0A 3NFRA 1MD9A 1GKUB 2NVBA 4R8SA 5KFFA 3FXAA 4CMIB 1QRSA 2NUTB 3O8QA 3BWDD 3RFFA 4BNWA 1NQ5A 1M0WA 1P0PA 1UT8A 2JFBA 4Y2XA 1FXWF 1Z9BA 5DNAA 3B1KA 5TXGA 3GRYA 1G8KA 2QGZA 3TQHA 1K1SA 4GP6A 4G0WA 2GR9A 4A6EA 1X1SA 4H7IA 1WB5A 3BH0A 4DQXA 1YI8A 4E11A 3UH0A 1K3FA 1MOSA 1UJBA 4GWGA 4HJXA 3LBYA 4TQUS 2R0QC 1DB3A 1ZQ1A 2H92A 2ZI9A 5IRCD 5SV2A 1SOUA 1JSZA 1ZINA 2A0YA 1Z6PA 2P40A 3KZOA 4KRXA 4R1PA 4YP7A 3RWBA 5B1IA 3VOAA 3ZDAA 2HSGA 2R44A 2WNIA 2UU9B 3ZKWB 4RH0A 1N2CB 1LPNA 4D99A 2CL7X 2O6LA 3QVLA 1PZHA 4MUBA 3UK7A 4ZI3A 3JAMW 3K2QA 3F1LA 3NRBA 5ENDA 5IXYA 3Q98A 1PGNA 4D9MA 5KNDD 4G1VA 4HDAA 4MWBA 2SICE 1Z8DA 1H8ED 1K7SN 1IJBA 3IDAA 4MGHA 4YRMA 5CM2Z 5GJBA 2JARA 4Q12A 1EP1B 2EP7A 3CG4A 4EG7A 3C8DA 3WP0A 1XTTA 3K05A 4IIBA 2GNPA 2V7PA 4UBKA 3HRKA 4K9PA 1K06A 4FOOA 4P4TA 4RF3A 4RUKA 4B6JA 2B92A 5DYWA 5IP5A 3M9OB 1K08A 3C4VA 1HEUA 2WAMA 3DE1X 4JOCA 1WULS 2FFRA 4NTZA 5DASA 1GG2A 3T1QA 3ZWOA 1A1SA 3OJOA 3GVIA 4LTDA 4OM7A 1P6QA 3HPRA 1DOAA 3ISVA 2GPNA 4C20A 2JZCA 3DVRX 2ZI4A 2CXPA 4RLQA 1W85A 4ARIA 2AQ8A 3FRJA 4MARA 2HHHH 2O1XA 2WF6A 1ECFA 1T9CA 2NSYA 1WQ1R 4J9RA 3CH5A 4LSZA 4OK6A 1RHJA 2OZLB 2JIDA 3T7RA 1FFYA 1OZHA 1ZN8A 1G5QA 4A8JB 5EE9A 4D82A 4WFJA 5AK5A 1QGDA 2C98A 5ALOA 4QGSA 3BGWA 4BO0A 4N9WA 3O91A 2GUGA 2I4IA 2BF7A 2WVAA 2YBDA 5E38A 4DR6H 2SKCA 2FZWA 4UUNA 3S2UA 1VBNA 3KQPA 2VJPA 4U0KA 1VE7A 3KJNA 3IOYA 4PYNA 1JLMA 3U7JA 2C7QA 2FFAA 1R16A 4HAWA 1TAEA 3K2EA 1NVXQ 3M9LA 3B3GA 3T5TA 3H0KA 1J7KA 2FWIA 4PSUA 6PFKA 1MEJA 2Q07A 3UCXA 1T9GR 1TJPB 2VTEA 5AVSA 3LA8A 2JIBA 2OVBA 1U8UA 1BQEA 5K3DA 5K8LA 4CIDA 1NASA 1A0GA 2JI6A 2LVBA 5C5JA 1NUTA 1VL6A 2NAFA 5FWYB 3OQBA 4EG3A 3ZBTA 1CUHA 2E89A 3H0CA 1Y5NA 4QYTA 2ORVA 4PYOA 2JAXA 3TRDA 2ZUVA 2ATCA 1FPMA 1DNPA 1C30B 2CCGA 2XB9A 1HH4A 3GPIA 1E6LA 1Y4DE 1DBPA 2WB4A 3GG9A 1Y1VG 4W9RA 1QHYA 4QOEA 2ZP1A 1F5NA 1S97A 2CHEA 5E7MA 3C3JA 2HBYA 1H5UA 3C1UA 3USES 1DV1A 3PEVA 4F6RB 1YTUA 2DFNA 4LZWA 3NC1C 3RAXA 2W9CA 2PYZA 4O4IB 3IAAA 5AM0A 4RZ2A 1OI2A 3EDCA 4V1CA 1D2AA 1INLA 4M7WA 3TEMA 4E5YA 3KELA 4BQFA 4CTMA 5IFKA 5A4IS 1WUKS 5AOBA 2QD1A 1JVSA 5HKAA 3C97A 2XCSB 5CB6A 4UCVA 2JCBA 5DSXA 2XVAA 2GEDA 4R8RA 2C5FA 4AI6A 1X8JA 5DCLA 3ER8A 3TXYA 3AG6A 3IKMB 3M4JA 3WRXA 1RPZA 1WDWB 1B8NA 1QUFA 2D1TA 3W0LB 2EATA 2Q1TA 1DRUA 2R00A 4KQEA 3JQFA 3OZGA 2O7RA 1T9HA 3CEBA 5HKOA 1BZYA 4WACA 2WT9A 5A1TA 1S3IA 2OV2A 4TWIA 1MDFA 2XZTA 2VKTA 3FA2A 1QYRA 2XRFA 3PI6A 3UWDA 5BW8A 5KVSA 5COQA 3ECSA 2FRDC 4HH1A 4O7RA 2AUNA 4KN6A 3CBQA 5DGXA 1MJHA 2YQ5A 2DPHA 3WBBA 2XF2A 3M4YA 1X1QA 2NV0A 1Z08A 1AQNA 1FNCA 2OYSA 4NE2A 1XWWA 2RDMA 2FWJA 5ICEA 3LVRE 1A2KC 1B43A 4BB6A 1Z4PX 1GLGA 1D1TA 3ANYB 3O3MB 1YS9A 4LSAA 2BHTA 1CYDA 2O8CB 1EB8A 1VCHA 3K0CC 4NDZA 3JASA 1XMXA 4P7BA 5KCMA 4RHFA 4DQKA 2QT9A 1GSHA 1M76A 3E7XA 1PQWA 2QP4A 4PN3A 1GTJ1 4YXWA 2CWWA 3PKZA 3VI3B 4GKKB 1R74A 4DV0H 1RM5A 2C4UA 2QT0A 2XGSA 1DKNA 2GERA 1CDDA 4RSRA 3WZ2A 3CZMA 1K7YA 5FTLA 2LE0A 1E96A 4JEMA 1TX4B 1WHSB 3BQ2A 1L4UA 1NBEA 3OY2A 3Q2IA 4G0PA 3DM5A 3LOUA 5IJ0A 4ZOLF 2O50A 3BABA 1XDSA 4ND5A 1T34A 3LT1A 4TQ9A 2AEJA 1QORA 4MW1A 3SS9X 1V4NA 2XXJA 1KBZA 2XT0A 3WGTA 2BGIA 4B7ZA 5JYCA 1SCBA 4I7EA 2PEZA 2GILA 4XLTA 1PFUA 2O57A 1WKVA 2R8BA 4IBOA 4JVSB 4PM4A 2AZXA 3RAEC 4ZOCA 3ZK9A 4M86A 1IWBB 3KVOA 3P19A 4JKIA 1IIBA 3KOUA 5E2IA 3ZEIA 5FUWA 3UY4A 1H05A 4AWXA 2O59A 1W8DA 1R00A 3UYKA 2ZANA 4OJQA 3DEZA 4O02B 2YMLA 1YZGA 4F97A 3HU1A 3ND6A 5IP7G 2BIFA 3LBNA 5AI0A 5I5SA 3WGOA 3LCUA 4JXZA 4PYIA 5EINA 1X0XA 5BWVA 2OMKA 3FUUA 4Y2TA 2ZPTX 5CT6A 3TKLA 4BZXA 4KQFA 4DN6A 4KLCA 4LF4B 4IQ4A 4CKBA 2MSLA 4HH3C 4Y1EA 2HRRA 5AM5A 1N77A 2A67A 3D64A 1XF1A 2R86A 3Q12A 4ZHQB 4ZK6A 1FY2A 4ACAA 1BEZA 1RRGA 2ATXA 4QFDA 2QW8A 4ALIA 5KT5A 4G56A 1W4BA 2PBRA 4BMCA 1HNZH 1DINA 1I33A 1IFXA 3BN3A 3KT8A 3PLRA 5FOUA 4K0KH 3CZ9A 3WBKA 1DQZA 2WJZB 2WW8A 4DJDC 2D06A 3DL4A 1XVLA 5JOQA 3TZCA 1I3KA 1P62B 2J6HA 2YXNA 2B8TA 5JAZA 1NVAA 1R7RA 4LXXA 3NHWA 1SMKA 1IY8A 4NZPA 3G0GA 3L7BA 1IDN1 5A7FA 1H2BA 5A03A 3A1CA 4PO9A 2Z6AA 3K0CA 3OO0A 3TGLA 4CUKA 4R9VA 4Y1FA 2X0IA 3PNVA 3B52X 5C37A 4KO1S 3DBRB 3LLCA 1TYAE 3ZU6A 4DHWA 1WXIA 2HQ1A 1V7ZA 3PSAA 1GFSA 4ISBA 2ATVA 3CBGA 5BUZA 3FOZA 1QTQA 3DOIA 2FQWA 2V54A 3GFFA 4DXAA 5FX2A 2IXAA 4BWVA 4ETIA 4O8CA 2EDAA 2B30A 4BMVA 1D2GA 3HJRA 4K9DA 3MWMA 4F56A 4JB8A 2PSFA 2W8BA 3NBFA 3OX1A 1QGUA 3OM8A 4MGKR 5KYWB 2VDPB 4K86A 3L82B 2H2AA 2B3DA 4P4GA 3ZS9A 4NFSA 3DZCA 1L5HA 1OTYA 5BSUA 1M2OA 2RI1A 3D0KA 2AF4C 1FTNA 1JKXA 2EKZA 1D2MA 2W2PA 3TZQA 2W2TA 3P45A 1NW9B 4QYMA 4YP6A 4X1KA 4DV4H 1VMAA 1T2AA 4XR9A 4EB0A 1T8SA 3G6WA 3N41B 2IGTA 1UC4B 2C8JA 4LAFA 3WZLA 1W49A 5AH0A 2QMEA 3STYA 2OKCA 2QKYA 4KKXB 4RKEA 2VZLA 4BO1A 1B23P 3QEBZ 1WTAA 5BRJA 1ZM3A 3JTEA 1C0KA 3N7AA 4UE6A 4IMJB 2VXOA 6LDHA 2ZI3A 3A11A 3UWMA 3ZBUA 2WPNA 2XZDA 4QXAA 3ETDA 3D81A 1WW3A 5CFPA 1VI5A 2BVNA 1RQRA 2VDLB 2YRFA 1JG1A 1Z15A 2SKDA 4ZQEA 2TMKA 5I51A 1XNRB 3A4MA 2R1TB 3BCRA 4PLGA 1TWFA 1JEJA 3KSBC 4U2DA 3HCOA 1T8PA 1V2GA 1W94A 1A9TA 1BWQA 3MWKA 2IEAA 4O3OA 1SCIA 4MJXA 2GSDA 2I3BA 3FVWA 4MKZA 5FJIA 2GCIA 3H5WA 1BS2A 5CBPB 1GAWA 2PGAA 3I9KA 3TX6A 4EG6A 2RAVA 1EP9A 1XZQA 5CR5A 3DZJA 4QXMA 1OX4A 3T54A 1G60A 4BVJA 1C0PA 1EK2A 4H4DA 5AO9A 4EFMA 5C8YF 3ZZMA 2BMAA 1L4BA 1KFEB 4WKOA 2H4ZA 3H6KA 4BFTA 1KNQA 3QSYA 3MJEA 1FNMA 1E58A 3T0IA 2EYUA 1QIKA 3IIEA 4OQ4A 4UMVA 1O95D 4U7HA 3V8EA 3BB3A 3KLOA 2FA9A 1SWWA 2FN7A 2DLNA 2ZI7A 4HWGA 4YI5A 4A1FA 2VPQA 2CUZA 1URPA 1NG1A 4J16C 1BGXT 2A33A 1OR8A 2QTLA 1S8AA 3IVCA 1ESCA 1X1BA 1PFYA 4DR4H 1W46A 1Y89A 4F7DA 4DPKA 2X5RA 2OY0A 2ASJA 4IG4A 4D8TA 1DAGA 5HUQA 4BEVA 1KKUA 1XMIA 4D74A 2JA5G 2AZTA 2MSDB 2VP3A 3GAMA 3HJUA 3UUWA 3UAOA 4ALLA 4D79A 1I7SB 3TINA 3C1AA 3N2ZB 5DI9A 3IE2A 2H4FA 5J3JA 1W5FA 1W85B 3IUMA 3R23A 1MB3A 2Y92A 3HOWG 3DDNA 3FBTA 4FN5A 1QX3A 4KQWA 4PPQA 3HEMA 4RVDA 5E2AA 5EUQB 2BZGA 3B8HA 1JKJB 1U9IC 3S2SA 4C4RA 3TPCA 1RJWA 4S1VA 5KNDA 1U99A 4FR0A 4ZA2A 4Q9IA 4YRPA 1PF7E 4FZJA 1YS6A 3R3VA 2BOVA 4WFQA 2RG7A 4ZKEA 2VJOA 1U7OA 2VVTA 3CNLA 3I4NG 1OV6A 1H0KA 2O8VA 2OVFA 1RHMA 2OC9A 2ZTLA 3UYLA 4AKTA 3KR0A 2Z6VA 1H0HA 3PEUA 3PL5A 2JL1A 4OQNA 4Y2QA 3L8HA 4EQ6A 1PS0A 3OT1A 2P2SA 4LDJA 3A6FA 2W98A 4ZJUA 1MHTA 3TTSA 1VKNA 3OCYA 5ALJA 2PA3A 4MQEA 3RUEA 4RY9A 1OX4B 2IYAA 5E95A 2JS7A 2HRCA 5FLEX 1JILA 2R5WA 3CRZA 3E05A 3CF0A 4LG1A 4WN9A 4KUEA 1TL7C 4LKOA 3H0GG 1IE3A 3PC2A 3GUHA 4KGDA 2QTAA 1F06A 1U0HC 2JVIA 3ABZA 2EFYA 1VDZA 5MFPA 3HDQA 1UBRS 1FNNA 3JQDA 1XNJA 4BRSA 1CKEA 1QYWA 4HNAA 1DI0A 4XWYA 3WHIA 4BVEA 2HC9A 2GEUA 5BYJA 1YL7A 2GYVA 2PSEA 1M2VA 4GMKA 1WOMA 2ETXA 2OKGA 5BWNA 3HKZE 4JU8A 5JJ5A 1QQBA 2CVOA 2PGLA 4J76A 3RC3A 1X38A 3VR3A 4TMZA 2IH2A 1WLSA 5LYJA 2Z56A 2IE8A 2NU9B 3LXMA 3NOVA 4O4JA 4R4JA 3QFHA 3QFTA 3KCQA 4C7XA 1TEVA 3IOMA 2ODQA 3G82C 2W90A 2NPFA 4GSLA 1DUSA 2X7JA 1Y1SA 5JNLA 3C7TA 1P2BA 5F5XA 2JRCA 2N1BA 2ZSEA 3UXYA 3KT3A 1KS2A 2CFRA 2HO5A 2Z3WA 5AKLA 4W1QA 3H4IA 4J1TC 4TS9A 1KJYA 1UXOA 1AHNA 2C94A 1H3NA 1SUSA 4J1SA 4XAQA 1L5SA 3T1YB 1OH8A 1R8QA 2NXWA 4M1ZA 1QYIA 3COJA 3BK7A 4BGEA 5I5EA 2ZU0C 5EQDA 2VOJA 1G2IA 4HDRB 1WJGA 4JBYA 4Y8VA 1JTFA 2GZDA 2M6LA 5IXSA 4HDKB 2QE7A 1ODJA 1VJRA 3KQUA 3EGDA 1J06A 1RQLA 2GTPA 3CRMA 4ZO7A 3WHKA 4I6EA 3D4NA 5AI8A 3PC3A 4BJ5A 1M1YB 3LMKA 2QLJA 4INAA 5BVHB 4MP8A 1XTVA 3E9EA 1TEZA 3V4RA 4XEHA 3FNBA 1W4AA 2FWPA 2P9BA 4MS1B 4Q00A 3KU4A 1TUIA 2JH9A 1DUIA 5FNVF 1CRWG 1OLSA 3L7IA 3PQ2A 1SCQA 2R5FA 2ZBPA 5G0TA 4D57A 5K3OA 3MQ2A 4MLZA 1JEQA 1YDMA 2IUEA 2VEOA 1EP3B 3EBLA 1GD1O 1S1MA 2F1JA 1G21B 2PBZA 2XCAA 1SYXB 2QGFA 4EP1A 3LWBA 1NXPA 1TO2E 3OLZA 5AVQA 1WTCA 4BNJA 2X9NA 4FZ5A 3FFBA 4GLOA 1Y3DE 1X7GA 2GNOA 3PJGA 1W0JA 1PSWA 4JVLA 1VSQA 4KX3A 4IZ6A 3OBIA 2XOKA 3RT1A 4NS1A 3O03A 2A5LA 2V45A 3JD4A 4I9FA 2Y0SE 3QPWA 2A57A 2VFAA 2I80A 2FPIB 4LYFA 4TRNA 5FBLB 2LP4Y 2ZQYA 3IQEA 4G24A 4EI8A 4LFBB 3LPAA 1I1OA 3HB4X 1A27A 3T8YA 2RI0A 1PGPA 1N1EA 3NTLA 1QYDA 2H6EA 4QXQA 3TCXB 4LF7H 2CMFA 3AJ8A 2ODAA 4JK3A 4ZPXA 3ZEAA 3L01A 4IYRA 4RGBA 1Q1QA 2DABA 1L7OA 3T12A 3W8EA 1R0CA 4WASA 4RANA 2RONA 1V71A 1AS0A 4FBMA 4KUHA 3ZWKA 4EZBA 2YHUA 1YHZA 1JQ5A 2XUOA 1UQRA 4X7RA 3EDRA 1PZEA 4QOJA 4IW3B 2PR2A 1K66A 3G0OA 1X42A 3UV3A 1BN7A 1KIAA 4UD2A 1ZAYA 1P5FA 5G4LA 3IV7A 1RKXA 1S4QA 1T3SA 3NBQA 3BZUA 5I5WA 1GL9B 2VG8A 3DF7A 2XMQA 2JIZD 3CZ5A 3DCIA 3G0IA 1MKYA 2NO5A 3G1WA 3QBJA 4IR7A 4MWDA 4FN4A 3KEGA 3IP7A 3ZPXA 1ZZGA 5I5TA 1G0NA 3GMDA 4OYHA 3U3KA 4ZICA 1U04A 1U4NA 3C0KA 1OBOA 2IEYA 1QZ3A 3QNMA 1E62A 1T25A 5C8YB 1C4KA 1TYCA 1TYBE 2EZ8A 3QVTA 3G9TA 2OXCA 1NZJA 1GSOA 1FS6A 2EJBA 1PI3A 1QHGA 2I2BA 3JD0A 3MYYA 3NPAA 4WK6A 4BN5A 1CDZA 4HX2A 4IZHA 4BZQA 1YQEA 2XAUA 3FNEA 1TA8A 3QX9A 4FGRA 1JDSA 4BNTA 1F48A 2E85A 3KQWA 4PIPA 4QQKA 1U7ZA 2C2MA 2ZAOA 4PZAA 1G9SA 2CK3A 1VFNA 2IRWA 2VHYA 4MAAA 3JX9A 3NRJA 4JLBA 4NFHA 3TTVA 4CR6A 2EVWX 3U4QA 3T34A 3HXTA 5HDBB 2OL4A 4X85A 3T7KA 3TLKA 2W2LA 4LOJA 1DADA 3A3PA 4O2AB 4DYHA 3DV0B 1DQNA 1MC8A 3MSXA 2B7BA 3MS7A 3Q87B 2QNRA 5LR6A 3PSHA 3RIZA 2QTTA 1VTKA 1VRWA 4ETMA 2CEAA 1LEHA 1NL3A 2VYND 2O23A 3QEKA 1H5NA 2GCEA 3H3FA 3KHKA 1N78A 4LJSA 3BX1A 3DUWA 2IELA 3JRNA 3GR6A 3LIIA 2AOTB 1Y4UA 3KD3A 1EUCB 1IY0A 3OU7A 2GJKA 3P9YA 5FH9A 3FAKA 3MWFA 3Q7RA 1E7QA 4UBNA 5FWXA 1FUUA 2W7TA 4ARZB 4FWTA 3BT7A 4H18A 5ADWA 2YR0A 2G1AA 4EHJA 3ABQB 2JDID 2QE6A 3GEGA 4QXRA 3IJRA 4DUGA 4PPNA 4R9SA 2LWIA 5BQPA 3TY9A 1RJPA 3VR4A 5LL6b 3UAWA 1JDBB 3K9QO 3ECCA 5C5DA 3ZH9B 4PYRA 4M9UA 2Q2NA 4LFBH 4LQDA 1UCFA 4OH7A 3HA2A 4EW1A 1Z0AA 4DV6B 1D6SA 2WD7A 4ZO8A 1PX2A 4HYEA 1TWAA 3DAOA 1R8SA 1RJRA 5HEKA 4YAWA 5HZHA 3VR6A 1N2ZA 2W0SA 1D2HA 1TGYA 4PXSA 1UWVA 1UK6A 4H3SA 2V1XA 4AP5A 1U1GA 3GQBB 4I4IA 2BLNA 5HF9A 1RLIA 1GHTA 1F51E 4LH7A 4UUMA 4ZAZA 5HYVA 4NYIR 5KFLA 1LRJA 4X5OA 3LX8A 3WYGA 1MGOA 1UQTA 2DR2A 5SY9A 2Q9AA 3C4JA 4C30A 4DUYH 3HACA 1RWOA 3QKWA 3ZJVA 1T8YA 5F5LA 4LZLA 3V1YA 2FVYA 2WIGA 4ERXA 1NLFA 2EFDB 3TLGA 1DRJA 4IQGA 5EAIA 3H6HA 2HL6A 3QWHA 3WFIA 3MINA 4E6PA 1ZETA 3G8AA 1CYEA 1QE5A 3QUQA 2QAGA 1MAUA 4LNUA 3WIUA 4I99A 3QE9Y 1FRZA 2ZR0A 2CE2X 4EL0A 1O57A 2ZULA 5DYGA 1UBLS 2WQ6A 2CUNA 5JU6A 1NKVA 3Q9UA 2IBTA 4P3PA 3L5KA 2W48A 1L5OA 1E6MA 1HDCA 1AZWA 1ISSA 4WLEA 3RC2A 1JA0A 1YBFA 5C32A 3CQZA 3OHAA 1FE8A 4FCVA 1ABBA 1TQ2A 3BG5A 4LE0A 2ZYSA 2QBYB 3EODA 5PGMA 3B6ZA 2PGOA 1ZCAA 1CQJB 4DSOA 3QLEA 2YKGA 1L6RA 4JV5H 4WK4B 1H2ZA 4FE3A 3J7AK 5L95A 4BY7G 2Q4OA 3MTQA 4AKIA 3QWUA 2OCGA 1YVUA 2YJ5A 3GQVA 3RAFC 2EC5A 3UBMA 3LY5A 1M2GA 1C7EA 1RJQA 2R1UA 4O3SA 1OAAA 3EX7C 4RSHA 4AX8A 4ER0A 5B7NA 1HO3A 4GZ6A 1CZHA 3BB1A 2F2TA 4N65A 5CDSA 5CG2A 3MGKA 4CEHA 3RVDA 3IPXA 4KBFA 1E3TA 3FNIA 3H0GA 3IQXA 4Q1FA 4YAFA 4JDPA 5ALYA 1KE1A 2IV7A 3RSLA 1A95A 1NWCA 4OAQA 4BMXA 3BILA 5JYBA 3C6BA 4KC0A 1HDZA 2FFJA 2FR8C 4M4SA 2QW1A 3S7TA 4KXXA 3MOSA 1KPHA 4KDRA 5IKOA 3WHLA 1KOFA 3I30X 4Q4HB 4ZVKA 3KQHA 1OFUX 2NIPA 1UANA 3PL1A 2ZR9A 4RU9A 4TLEA 2CNWA 1EUZA 5DBIA 3OE7A 1L5FA 3BF8A 2I4MA 4MWCA 4WFKA 2AB0A 3KAPA 1CZUA 1CBUA 1V16A 3G2OA 4IAOA 2MINA 5KWVA 3M83A 1ZEMA 4C4AA 4ZCPA 1ZBDA 4L8VA 2FHPA 4EG8A 4GMFA 4AF8A 2J3EA 4BXOB 1D0VA 2QTRA 3OPYB 1W6RA 2DQZA 4K6GA 3WL4A 5CIYA 4XM2A 4AZWA 4ABYA 4CDNA 4D96A 1AKVA 3QXGA 5C1DA 5LUAA 1W93A 1HXHA 1NVBA 1OHHD 1Z62A 2GLXA 3NHAA 4J91A 3SS8A 3WA6A 4Q48A 5KEIA 3EEQA 5KMGB 5HK8A 2ORED 1D4OA 1QMGA 5DGCA 1L8XA 4BPBA 5EJ6A 4BJ1A 3EZ2A 1E59A 1NI4B 5ES4B 2C4HA 5AKIA 3EIXA 1K6IA 1LS1A 1I8TA 1EGVB 1GV0A 4C88A 2B98A 3CXUA 3NBUA 4UHCA 2WJ6A 5JPIA 1GZVA 2VQSA 4LJYA 5A4FS 1OROA 1ZGCA 2WJ4A 3NWJA 4FSHA 4Z6KA 1XLTC 3CM0A 1R5OA 4Q9AA 2P75A 1XDNA 2H0AA 2N75A 1X1CA 1NNUA 4U8GA 4URZR 4BRUA 2Z6UA 2KQUA 3SSNA 4ENSA 1BOOA 3LW7A 1MCZA 3LSYA 2QP9X 3QPBA 4N47A 5M2QA 4TLLB 3PB3A 3QMVA 3A6DA 4H1WA 4JOBA 5CCBA 4DA4A 3ZS8A 1TK3A 4EDFA 1J21A 2RGRA 1A9YA 1Q1AA 4IRKA 2EZ9A 4J7CA 1YIAA 1YZQA 3OU2A 4Z4EA 2W6PA 2NVWA 2GM9A 3F78A 3SZOA 1G64A 3WLTA 3ZHOA 4Z2AA 1U2ZA 1QCCA 2LPMA 3R0JA 1SA0A 1EA5A 1VLQA 5FO0A 3KG2A 5F2NA 4UFOA 4O3PA 1DV2A 1HUQA 4EUKA 3FPJA 2DTDA 1HE4A 3TYXA 4BB9A 2W11A 3KKEA 1J07A 4H35A 2ON6A 1JDPA 2HLDA 1RAAA 1QHHB 3TZKA 4YAUA 2A3RA 4JWTA 3VKFA 4AO6A 1IBLB 3SZ3A 1MFPA 2BV3A 4HKTA 3FTPA 4QNNA 2ZCJA 1MOQA 3EZ7A 2FZCA 4OYLA 3QUTA 4RHCA 2E3JA 3T5AA 3WRVA 5AKJA 1APBA 1E92A 2BFDA 2W9CB 2OZVA 2WG0A 4MINA 2R7AA 2PUAA 1J56A 2UXBH 4KXYA 3QV1A 4AYBE 1AU9A 1ICEA 1CJVC 5C52B 3FH0A 3JQ9C 2BWJA 1XLWA 2VQDA 1FJ2A 4KO2S 1D9XA 1OWLA 1M6YA 1R2QA 1NUPA 3CNNA 1KVQA 1Z7EA 4JNCA 3RGZA 1W5BA 2HU7A 4UEWA 2VJCA 1E2DA 4CTJA 1NXXA 3BAZA 5G1PA 2INGX 4QJFA 1EBBA 1E3WB 1Z0ZA 2E82A 4HG2A 5U9CA 3UJ6A 4FB4A 4CC6A 2EQBA 4HAVA 4C43A 3FBGA 3PNKA 3O3OB 5D6NA 5T3YA 3WMEA 1M2FA 4QDXA 2AF3C 5P8WA 4L6IA 3ZVKA 3VPBA 4EH1A 1AXGA 1NM5A 1ICIA 4FBGA 1WZNA 5DI3B 2POQX 1Z25A 4NARA 4Y0NA 1DGSA 1SD5A 4LV8B 4UD6A 5J59A 1MIOA 3PA8A 2R7LA 1IY9A 3FOBA 4MJ7A 3QYJA 2D5LA 4W5NA 3ORQA 1Q22A 4A3EG 1Y5LA 1MBZA 4L51A 4R81A 3SKXA 5ITSA 1ZGGA 2QX6A 2R6HA 3DTFA 1T36A 4QOFA 1X87A 1XAIA 5J2TB 4RLSA 2COEA 2QMUA 4G4GA 4WBSA 4ENRA 3MTDA 1H1LB 1Z6YA 3UWKA 3DP7A 5K3AA 3UKDA 3IKJA 1KFCB 1U80A 2H17A 4FS1A 5KFSA 1TAGA 3IPYA 3MCZA 5T8KC 4V0OA 4A82A 4EPVA 5HTOA 5JTUA 3HOVG 5F1KA 1LDMA 4G25A 1UPFA 4A3JG 1IPEA 1HNXB 1ECBA 4EPXA 3HGMA 4G1UC 3L1UA 3PGKA 1OB2A 3AR3A 1JZTA 2DKFA 3FYCA 3HOXG 1QKIA 1LPMA 4RYDA 2AW3A 2EW8A 2FSHA 3L7NA 3W6NA 1HL7A 5BSHA 1H65A 1XAGA 3FSRA 4F4JA 8ABPA 1MIHA 5EWEA 3I58A 2JEIA 3FPHA 1S7GA 4KZPA 3DMRA 2B5OA 2H2WA 3WWYA 2YFQA 2FVXA 5C8YA 4A3BG 2FLPA 1XRLA 4EKDA 2P3SA 5KVAA 1RAHA 5TF4A 4DHEA 2WYHA 3SZRA 5DHTA 8LDHA 3W7AA 4DF3A 1DHRA 2AR7A 1T1GA 3D3QA 1L5LA 3ZGNA 4CMKA 5AESA 4BY9E 2HF2A 4YJHB 5E3JA 1U0OC 1RCFA 4OIFA 3BK2A 4XCQA 5BYBA 4ZAYA 4CNBA 2YXBA 3D8NA 3U0GA 4OI0A 1FA9A 1YAJA 2EX4A 4WD3A 2P2DA 5IDYA 2YMMA 4EG1A 1A9QA 1XXLA 1CK4A 1MA3A 3E8SA 3PVZA 1B6GA 5DSZA 3W5SA 4UU0A 5JBQA 1OXSC 4XYGA 5CEJA 1HNNA 4BMNA 1K6JA 3C48A 1TWGA 1F38A 1U4OA 4UEQA 5T4EA 2OYCA 4ZJZA 4I1YA 5LIRA 2GN1A 1KBQA 2NXEA 4D45A 4UM7A 1P1BA 2WYVA 4HEQA 5JD3A 5TJ9A 3N39C 1NVTA 2C4TA 1YR2A 4N0EA 5K3EA 4DV0B 2OBMA 1GUYA 4YRCA 2GXUA 1DEHA 2J87A 3STUA 4WI1A 5HIKA 3BMNB 1XYYA 5K03A 2R6AA 3PUYA 3DMHA 1ADCA 2BDEA 5K3BA 2Z1DA 5HF5A 1T2CA 2CDCA 3FDZA 4LEIA 1BROA 1E3SA 3SXUA 3TSYA 2VTDA 5DK6A 4C0BA 3RS4A 3U4MA 2D5BA 1VL1A 3N8IA 1DMSA 3ADBA 4EG4A 1NP6A 1ZYUA 4QWBA 1SUIA 2FG5A 2VZEA 1WH2A 4INZA 1YBMA 1A4RA 4RZIA 3GA5A 3PXUA 4L27A 1USGA 5J40A 4FFVA 3ZLVA 2CFTA 2GK4A 1MGPA 5DM1A 4AUNA 1QTRA 4OAOA 4Y7CA 2WJIA 2YCHA 3EW7A 5CA0B 1RZUA 1Z35A 3FHCB 3AHIA 3ZXSA 1ZL2A 5JI2E 5L8VA 3I2GA 5MDHA 1TEXA 1D1QA 4G9BA 2IYLD 1U65A 3DSRA 1E1YA 3JYQA 3P0JA 4YECA 2O5CA 4G5XA 1OBFO 3NCHA 1PUXA 4NECA 3N28A 2AEFA 1L4NA 1HE5A 2JC3A 4WOPA 4AKEA 2VZ9A 2IOYA 1H0RA 3CSWA 4I1VA 4CQLA 3LTNC 2F8TA 2F43A 3IBSA 2FDXA 4P36A 2WD8A 3DZIA 2J45A 2V6IA 4W5TA 2AI1A 2AOXA 2B6NA 1EFVB 1SZJG 1UJCA 2QTVB 3IV6A 4RWZA 3GGGA 5JAHA 5BYKA 4AKSA 3UOAB 3CEMA 1QB7A 2ZRPA 2WILA 3FJOA 3VC7A 1I1NA 2VA3A 1M2OB 1Q1GA 1GZ4A 4JJIA 2M9MA 4NHEA 5B53A 3UZUA 1X9HA 2EV9A 2GTIA 1UJ5A 3AEYA 1H2YA 2OHVA 1XZEA 2PRSA 2X1HA 3EG5A 3KBOA 4JEUA 4II2A 5CJJA 2WY2D 4F4UA 4WTOA 3HKCB 1QH8A 5ITVA 4MVJP 3PKIA 1BN6A 3I09A 3P5SA 3D8RA 4WV3A 2VQ6A 3SPXA 4CF4A 1YZFA 1DLJA 1U0FA 2BGUA 2Y1KA 2VNAA 4ZREA 3FDFA 3GBPA 1YQTA 2A0UA 3TQFA 4C2AA 4NDNE 2O8BB 4OA8A 4KHZA 4TKZA 1UK8A 3PDHA 1UKBA 3BD6A 3L8EA 5KOJB 2G8LA 3VFDA 2C3YA 3AL0C 1NY5A 3C3PA 2YZNA 1MC1A 2NLOA 5TQJA 3W2HA 3LX5A 5CDUA 3KB2A 2BGGA 1V8PA 1QIHA 3OZ7A 1FVXA 2X2FA 1V1MA 3SQWA 4NV0A 1VGQA 1KJ8A 3NUAA 4BWSC 4I50A 3Q85A 2ANCA 2VZ0A 1E63A 4MYDA 5BR8B 1I01A 4XKJA 3X1WA 2DUJA 1GN8A 1KYXA 4A2PA 2QK4A 1J20A 3V6LA 3U4HA 1MABA 3EIOA 3U3JA 1N0WA 1R8XA 2H3HA 4KOEC 4EJSA 5C7IO 3G0DA 5IS2A 2R1VB 2QQGA 1XJ5A 1JHPA 3CONA 1O4WA 2DFTA 2PY6A 3E8XA 1GNLA 2PLWA 3OM1A 3FKIG 3PRHA 4ZAGA 3RJZA 1NP7A 4MVJD 1NKSA 3Q1KA 2EXXA 3DEYX 4QAJA 1E1QD 2YZGA 2WWWA 1SXJC 2PMDA 4BUCA 3DDZX 2G83A 4CQLB 3UPUA 2IYRA 4KEAA 1AS2A 5LDDC 3ID6C 3NP7A 4JJEA 4UUOA 4M22A 4DRXA 1P2FA 1OIWA 3JVIA 3R7LA 5KI6A 2BM1A 4LJKA 1P74A 2J59A 2G1KA 2YZ7A 2XEXA 4PPFA 5I4CA 1TUBA 3VYWA 1YMVA 2GESA 2PKQP 3RT9A 3DO8A 4GMHA 5C53B 3SZGA 4XDHA 2RF4A 2HMTA 2VSOA 4LJLA 4RKFA 4UHBA 4ZT2A 3EMBA 4G0OA 5EPUA 5ALSA 5H3CA 5DVZA 2IU0A 1SC1A 1XTKA 3EJWA 2FGKA 5J1SB 2E4ZA 2RGNA 3HCFA 2O8NA 4RUAA 1HYBA 4Z8YA 1ZUNA 5IASA 5JD6A 3IMCA 1KI2A 1CY0A 4EYEA 4L75A 1SD1A 2JASA 4O7SA 1XCOA 1RWMA 2D1YA 5AK6A 3R5FA 5FV7A 3OH8A 3V1NA 5H81A 1IMOA 1THGA 1J8QA 1R6XA 2CHUA 4JLNA 3A1FA 3ECAA 5GJCA 4XIYA 4KWHA 2C2HA 1JP7A 3UMSA 3N44B 4L08A 3A1SA 5E7QA 5LP6A 4WK0B 4YHBA 3GA7A 1GGNA 1W4CA 2LCQA 3AM4A 2PHZA 2HD4A 2Q3BA 2CNNA 3EA0A 4LMRA 3FZNA 1G7CA 3K9GA 1YD7A 3AP2A 4DIFA 4BX8A 4C4SA 4HLUA 1FDRA 4V3BA 4WA7A 1I4WA 1RKQA 4B79A 4X3PA 2WF7A 3FUWA 1ODFA 5F2EA 2QF7A 1IATA 4YV0A 2WF5A 3ANSA 1QYCA 1TMGE 1JUDA 3A1VA 3G7SA 4CLRA 2AJBA 2D0OB 4QUEA 3L9XA 4LF6B 3G2IA 3HYNA 1X3LA 4ARAA 3R4CA 3DA8A 1O2DA 2GPWA 3GEIA 1QNFA 1MZVA 2R1VA 4OXXA 1QHHA 2FGJA 3QLJA 3F6BX 4OHVA 3HNPA 4KRGA 4N3BA 4EVRA 5JC8A 2PGJA 3WC4A 2QLMA 3P2YA 3MJTA 3L41A 3DB2A 2BONA 3GC6A 1BXKA 1SCDA 3CVZA 3SIPA 2XI4A 1GG9A 1DEXA 3KPUA 2RAUA 2VJBA 5HRCA 1ORRA 3QEJA 5ICGA 3FPGA 1KIMA 2IPMA 2B1IA 2Y4OA 1VGVA 4DCOA 3FGZA 1C9MA 2TMDA 3B20A 4MWGA 3M6WA 3KZCA 3DMDA 3RRBA 2P4HX 3P26A 1ODIA 5IDVA 4E2YA 2NU9A 4RETA 4JLJA 1LGYA 1HDEA 1N33B 1RW4A 3DWFA 4DUZB 1HX7A 1IUNA 3HR7A 1QHXA 3OJFA 3H3JA 1JB1A 5HUHA 3T95A 2J7PA 4KFTA 1ZRHA 2VT6A 3FKSA 5HF8A 3S55A 4CHTA 3PT9A 5HE8A 1PFVA 4XRGA 5BQFA 5I8PA 3LV8A 4JC5A 4WY8A 2QN9A 5FBHA 2DLDA 1YFLA 2VPXA 4IHAA 2WM2A 1N8TA 2PT6A 4KMRA 4U9HS 2W8KA 4X3OA 3NVAA 5IAGA 3ZDZB 2Y0CA 1I6WA 4CG0A 4L4YA 2PMEA 3WK8A 1NVDA 4MUKA 3IIKA 1AKQA 1L1FA 3SXJA 3ZZ1A 4K8OA 1R5JA 2XMRA 2ZPAA 5ISMA 5HM6A 1UXKA 4KXVA 5IJZA 1RCUA 2FH5B 2I2WA 1KMQA 1UJ4A 1YRAA 3UQZA 1ODCA 1Z5VA 5A7GA 1NNEA 1N7GA 2HIVA 1VYVA 5IAKA 4TXJA 2OFFA 2WB2A 1HNZB 2I2AA 3R7DA 4A8HA 4C3VA 1EDOA 2F48A 4QWMA 3L4KA 1RHKA 4Z54A 4KSBA 5KT3A 2B21A 2WAQE 4ZYTA 3TTUA 1PUIA 4UNIA 3N0WA 4MVJM 2AEMA 5TRTA 4JBGA 4JBNA 2X1VA 1SBQA 5BV8A 2YRWA 2GRAA 1S03G 3NGMA 3GIJA 4N0PA 4DEXA 3EBOA 3WV5A 1IRXA 3KCNA 2B63A 2O2XA 3EUWA 4C9BA 9ATCA 1JEYB 4D9IA 3K20A 1IPFA 2ZXEA 3ZHYA 1GKLA 3RS9A 5MN4A 1DEAA 4G65A 4MUMA 2XOXA 2KBFA 2FKNA 2Z43A 3PC8A 4XD2A 1NPTO 4OGFA 4X92A 2V7QA 1FQJA 9MHTA 1VPLA 2O7SA 5A05A 1F0KA 1YA8A 1YR3A 4HP8A 5HIMA 5JEDA 3OHMA 4DLTA 4KITB 1SBYA 2CBZA 3H1EA 3ZXYA 4EA6A 3W1VA 1U90A 2VPZA 4XB2A 5IYDG 4BLRA 2DQYA 5KYKA 5ESRA 1RXIA 4B9AA 5I4IA 1ZL0A 1LV7A 4UM8B 4YT2A 4S04A 3T35A 2JLVA 2XGPA 5K0GA 3FRIA 3ETCA 3BQNB 5BWLA 1GPH1 3TIVA 2DR0A 4AJJA 4LTNA 5C5IA 3F2IA 4ABTA 5HM8A 3U4CA 5I7WA 4Q3LA 3EXIA 3V4VB 1Y4SA 4W8GA 3ZWAA 3W5VA 4C76A 4WWHA 1T3NA 5NULA 1YVPA 1EZ1A 3MOIA 4BMZA 3INTA 4G5HA 4UATA 2AN1A 1KK2A 1ZJWA 4DR1B 1X1RA 1YBAA 5DHPA 3TF5A 4LE2A 1IOLA 2Z9DA 1HFEL 2JPDA 4BZPA 2F4NA 4PLVA 2XVMA 4I19A 4KJXA 2EKLA 4NCHA 1XZFA 3HJNA 2X7XA 4XH9B 1K75A 1XQYA 2QZZA 4EVQA 2Y66A 2OORC 4OGGA 3T3MB 2JJ2A 1X1TA 1K5GA 2GHRA 2VJMB 3KR9A 2ZAIA 1E4YA 4MRAA 4E46A 1NWHA 3PCRB 1A9XA 3KZ1E 3KXKA 3GDOA 5BN1A 5KG7A 2CBXA 2P6RA 2FPKA 2XOKD 5T6MA 1VZ3A 4M1TA 4RAYA 1OWNA 4GDFA 3ZDYB 1DC7A 1MPXA 5F9FA 1G3IA 1SUWA 4M55A 2P6OA 3A1EA 3IUEA 1FQKA 1FMCA 4ROSA 3I2HA 1EM8B 1U98A 4L5JA 2BN4A 3V7YA 3QKIA 4ZCIA 2Y2VA 4ZDWA 1U6KA 1OOEA 3HKBB 4XA8A 3TB6A 1H6CA 2Z2JA 4JP3A 4RJJA 4B2PA 1GAQA 1XF9A 4QT0A 4AJOA 4ED1A 3CFYA 3H42B 5FYQA 5CYGA 3QXJA 3LQKA 4RCVA 1AK1A 3RODA 3TOXA 3D0RA 7GPBA 3HDVA 1ZDMA 1A88A 5FPQA 2JFNA 3WIBA 4FU0A 4G4IA 6ABPA 2PU5A 4NMLA 3VZQA 4MI6A 1P1JA 4QBHA 2AT1A 3KXDA 3RM3A 2BW0A 3GOHA 8ADHA 2BFBA 2PR7A 3TLZA 4MEBA 4F84A 2COKA 1FFXB 1I4TD 1P6UA 2IJGX 1CE8B 2QXYA 4FP9A 2OZKA 3L02A 4LDPA 1S89A 1Q1ZA 4GECA 1YE3A 1GG5A 1XZKA 3QG5A 4QJBA 4TS3A 1KTAA 1GUAA 2RHRA 4AJLA 5JAPA 4RELA 2AUTA 3MHTA 1ORHA 3QKSA 2CFOA 1EGAA 4IX9A 4NU0A 1RJEA 3LP8A 3LT4A 3K9FC 3CLTC 4INOA 3MINB 4K1XA 5KYGA 1JXQA 1U7WA 3OICA 3N5KA 4M49A 5EMJA 3HABA 3MOGA 3W4KA 2VWPA 2JGDB 3JAKA 4PZZA 4QQNA 4QATA 2JBWA 4A8JC 1XMVA 2BFOA 1WNFA 3H1BA 1RE1A 4B33A 1Z39A 1BWPA 4QIWE 3GBVA 4R1MA 1U3WA 4TKVA 1QP4A 3OZAA 1OREA 1GVHA 4DCCA 2HMSA 4WJLA 3P32A 1XSEA 2WWGA 4DREA 1L4EA 1N5KA 5CW2A 3U3OA 3NORA 2NTYC 2W5UA 3RFTA 4HRYA 4YDHB 4EA7A 2UZAA 2G71A 1QPZA 4KFSA 2PMBA 4YBZA 1D04A 3BIXA 2OP1A 3AG5A 3A2LA 1A1VA 5E7JA 1Q5PA 4E30A 4AFNA 5AR1A 5F98A 1XTUA 3DAAA 1AX9A 3EDOA 3LKVA 1NUAA 1KK0A 1XLUA 1Z88A 2H18A 3E3OA 4FLMA 4XGQA 3V00A 4R7TA 2YXEA 1K3TA 1NYTA 3MRXA 1NJ5A 5A9SB 3IVMA 1VMEA 1AN0A 1E2KA 2C9DA 2RFLA 3DOJA 1BEEA 4LNUB 3TNDA 4FNMA 2NP7A 3U9TA 1IVNA 2IPAB 1YHYA 3WX0A 1TJ5A 1C1HA 2DPJA 1NN1A 4Z9FA 1E9VA 1ZRSA 2J3DA 1ZVMA 3GK3A 3U7FB 1YAHA 5I7OA 4MQFA 2G04A 4ZVRA 3GGJA 1I3OA 4I66A 3H40A 1JBEA 1LSSA 1TLLA 2IIQA 3LZCA 1D7OA 3OJEA 4WPGA 1ANKA 2OCXA 2OD9A 2BKLA 1E99A 2RGYA 5JIBA 4GU5A 3Q7EA 1Z7YA 5FPYA 4K6KA 3G2PA 3ZU2A 1EIWA 5TQVA 2HK6A 1FU4A 1JR6A 1B74A 3I37X 3ILSA 5C51B 1GO2A 3PXGA 4FQ5A 4GMXA 2FZ4A 5F35A 3RIHA 1JDBC 3L7DA 5EJ7A 5DNYB 1K92A 2QX4A 3U1TA 3RTCA 1JI0A 5BWWA 2HDNB 1ZM4A 1YQXA 3QQ5A 3U17A 4IFIA 4WZBA 4P3YA 4RE5A 1OWMA 1VBHA 1W0KD 1X1EA 5KU7A 1G5HA 2PRJA 2ZQZA 4C0JA 4C7KA 1AKYA 4HAZA 5EOVA 3RHZA 3PXXA 3VC2A 4IOKA 5ITWA 1TAUA 1HFWA 1Q83A 2P69A 2W2QA 4ZJPA 4D8VA 4KXMA 1GYPA 3HG7A 1GQQA 3UOGA 3TW0A 3USZA 4BN4A 3BSSA 4YDSA 3Q3CA 4MS3B 3JALB 3QTTA 5G40A 3WDMA 5TQ0B 1EFUA 4OJKA 4HHEA 1O89A 1YE8A 5TNXA 3LZDA 4GOOD 2O4CA 2ATEA 3KZVA 4P38A 3H5OA 4AJ9A 1MO4A 1O96A 1TM2A 2FG7C 3Q8WA 5LBIA 1D6JA 3ZE7A 2IYQA 1HWYA 1KFKB 2P5UA 4ZDKA 1UADA 5K6TA 2X2EA 3AKEA 4O2AF 3BQ1A 4OXRA 2NMVA 4JHLA 2R93A 4EO7A 5TGDA 1PJ2A 1Q57A 1W59A 2IPLA 3CPEA 1FDOA 2QG6A 1S0NA 5ECDA 5FCDA 2GEKA 4H6XA 3RPEA 2WAQA 3ZXXA 1FDIA 5DFAA 2C03A 4H0CA 1E61A 1VKZA 4B84A 2VR1A 4KPEC 5EQTA 2VYVD 2ZTHA 1S5PA 3ONDA 3B1JA 4TTQA 3SEFA 1B0AA 4NAVA 5LP6F 3NH9A 1MX5A 1CIPA 2BKAA 1YR6A 1MVLA 4RJKA 4HDOB 3H1TA 1V8DA 3FYDA 3K30A 4L9RA 1U28A 4M88A 4MIYA 4LPKA 1N5MA 3R3UA 4DOMA 4X66H 1Q11A 2AHRA 1I7NA 5KKNB 1SQ6A 5CPFA 3AWDA 3TVDA 2R96A 3WA7A 1PBTA 2QG9A 2V4QA 2VYCA 1N33H 1GNTA 1GTVA 4A9AA 4MS4B 1XZJA 2EJTA 1T6YA 4HH4A 2PUCA 1BSVA 1UBOS 3QA3E 5KFXA 2ASLA 4FFBA 5J5AA 1P0QA 2IWRA 4EKEA 1TJYA 3BICA 4PSKA 5LU9A 4YMTA 5HQ3B 5LA6F 4IQ0A 4XWTA 3H5AA 5TV2A 3QV2A 2IV3A 4BQSA 4O86A 3E0QA 4C0SA 2DKNA 5AM4A 3OQIB 2ACVA 5AVWA 1A4IA 4LHXA 4LOLA 4A2QA 3CVVA 5HKBA 3B36A 1SVKA 2VDWA 2XUKA 2NO1A 3H5RA 3I8SA 4TYMA 2AGPA 3KLBA 3QW4B 3OCXA 4GVPA 1P8AA 4LH6A 1WXXA 4XUDA 2PUBA 2GF0A 5BWTA 1Q7RA 4GOXA 5EXXA 1V3QE 4YHHH 1DBVO 2QQFA 1T1EA 1IOWA 2ERXA 2V6BA 3A9UA 2CL6X 2RHGB 4KV9A 5L3SB 2XHZA 1M66A 1ULZA 1ULHA 4MLCA 3G0HA 3KC2A 1WSBA 4PVCA 3AYHB 4BYMA 5DN6D 4JYPA 3BWMA 1V35A 3OESA 5HBRA 4EGSA 4DV7B 2NTNA 3VHRA 1ZM7A