2IP4A

Crystal structure of glycinamide ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
MKVLVVGSGGREHALLWKAAQSPRVKRLYAAPGNAGMEALAELVPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVPVVVKDSGLAAGKGVTVAFDLHQAKQAVANILNRAEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVAPYPMDEATLRRVEEEILGPLVRGLRAEGVVYRGVVYAGLMLTREGPKVLEFNARFGDPEAQALLPLLENDLVELALRVAEGRLAGTRLSWKEGAAACVVLAAPGYPESPRKGIPLHVPEPPEGVLVFHAGTRREGGRLVSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylamine--glycine ligase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 108
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2006-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ip4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ip4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ip4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ip4A04
4EA7A 5DMXA 2ZDQA 2IP4A 1VBHA 2W6OA 2OLSA 5K2MA 3BSWA 4ZQIA 1CQIB 4M9CA 2V59A 1GLVA 2V58A 5J2TF 2NU6B 1KJIA 4HNTA 1IOVA 1EUCB 5C1OA 1VKZA 2VPQA 4O7RA 5D8DA 1EZ1A 3BG5A 2V5AA 3DF7A 4XX0B 5IYZF 4M98A 4O7ZA 3WNZA 1W93A 2DZDA 3RFCA 2X0SA 2YZLA 4FFNA 4IHJF 4DLKA 1CE8A 1BXRA 4O86A 2W71A 3VPBA 5I47A 3G8CA 1Z2PX 4XYMB 3R23A 1KJJA 3BSYA 5GONF 3GLKA 1DIKA 1KEEA 4MAMA 3VA7A 4O7TA 1SCUB 3RV3A 4C5AA 5CA1F 2W6NA 2YRXA 4YJ2F 4RZQA 3SE7A 2R84A 4FFPA 2GPSA 4O7NA 3JZIA 2VQDA 2YYAA 2YZMA 5KX5F 4O83A 2W6QA 2DIKA 4IZOA 1BNCA 2CNQA 5KKNB 4YAKB 4EA9A 2NU7B 1M0TA 2YZNA 2ZDGA 1EHIA 4IIJF 1I7NA 4O4LF 5JH7F 4NYEA 4O4IF 1C30A 4YB8B 3HB9A 3V4SA 2YS6A 3RV4A 4I4TF 3K5HA 4O84A 4MV9A 3N6RA 1KC7A 5EZYF 2W6MA 3LWBA 3VOTA 4FFRA 3BSSA 3U54A 4MA0A 5JVLA 4I50F 4O2AF 3RUPA 1UC8A 1W96A 1PX2A 4HNVA 4XZ3B 3MJFA 5J2UF 2SCUB 3WO1A 1IOWA 3TIGA 3JZFA 4O7WA 1KJ9A 3LP8A 1VBGA 2NU9B 2NU8B 4IWXA 2R87A 3ORRA 4O7YA 1KBLA 2PBZA 4FFLA 1CS0A 4TUYF 2FB9A 1B6SA 4ME6A 1GSAA 1GSOA 3HBLA 3E5NA 5LYJF 4XYLB 3VPCA 4FFMA 2HGSA 1M6VA 4M99A 2VR1A 2QF7A 1DV1A 1DV2A 1M0WA 2R7NA 4WD3A 2CNVA 2PVPA 3R5FA 2R6FA 2XCLA 4DIMA 4O2BF 5CAEB 5H80A 3G8DA 5LOVF 1UC9A 5CA0F 2R7LA 3TIIA 2ZDHA 2GLTA 4IWYA 2GQRA 3K3PA 5C8YF 4HR7A 2W6PA 5LA6F 1KJ8A 1JLLB 1JDBB 2FPIB 1B6RA 2WYOA 4E4TA 4ZHQF 2J9GA 2CNUA 1JDEA 4EA8A 4C5BA 2I8CA 4Y8VB 2FPPB 3UFXB 4MV1A 2R7KA 4I55F 1KJQA 3KREA 4EGJA 3VMMA 4MV3A 3K5IA 2R86A 1E4EA 4EGQA 4J6EA 4O81A 4M9UA 2NPOA 5JQWA 4O7LA 2FP4B 4FGRA 4HNUA 4YAJB 3GIDA 3Q1KA 1JKJB 2P0AA 3R5HA 4MA5A 2I80A 2R7MA 1T36A 1A9XA 2YRWA 3HO8A 2C00A 1EYZA 3U9SA 3TINA 3OUUA 1AUXA 3JRWA 4O82A 2YL2A 4QSHA 2CZGA 3BFPA 2DWCA 3OUZA 1OBDA 2W70A 3JRXA 3AX6A 1Z2NX 1GGOA 4WBNF 2FPGB 3VPDA 4FFOA 2HJWA 5BPHA 3U9TA 1CQJB 3KAJA 4TV8F 5HBRB 2Z04A 3KAKA 3R5XA 1GSHA 4O4JF 4ZI7F 5LP6F 1E4EB 4EAAA 2PN1A 4MV6A 2VHEA 2QK4A 1OBGA 2YS7A 2DLNA 1Z2OX 3QFFA 5BMVF 4EG0A 5JVDF 2YW2A 3WO0A 1A48A 4MV8A 3V4ZA 4O4HF 1ULZA 3TQTA 1C3OA 4YJ3F 1EUDB 1PK8A 2I87A 1AUVA 2GQSA 2YZGA 4YBZB 2YWVA 3N8DA 5JQGF 4L1KA 4C5CA 4FU0A 4ZOLF 4O7SA 4MV4A 5FNVF 2R85A 5C1PA 2R82A 3ETJA 2W6ZA 3KALA 4GGMX 3TW6A 3MWEA 5LXTF 2GPWA 1I7LA 4TV9F 2Z02A 2CQYA 3ORQA 3NUAA 3I12A 3AW8A 4FE2A 3MWDA 3Q2OA 5HV6A 1WR2A 4O7VA 3R9RA 2NUAB 3U55A 4MV7A 5CB4F 4EABA 5BPFA 1KUTA 2XD4A 3ETHA 4HQ6A
chains in the Genus database with same CATH superfamily
1FS6A 1CR6A 3IXLA 3IP9A 1I3QA 1P2VA 4IXMA 1NR7A 3GOQA 2ZVPX 4LXGA 5JEEA 4AULA 4BO1A 3ZW9A 4JLDA 4MW5A 1PQYA 3G8YA 3GTLA 3PBKA 1I1MA 4C0JA 1CKMA 4X7PA 1KZ6A 5JUWA 4EKIA 5HUJA 3THWB 3H2ZA 5E2IA 2HSDA 3EXIA 4ENRA 5FB3A 1GQFA 2OOSA 3EMKA 1N4DA 4G81A 3M4NA 3V00A 1P2GA 2IS2A 3OLWA 2A5GA 2O07A 3EGOA 2E4XA 2GDJA 2QEQA 3W1EA 5L3SB 5KVAA 4JYCA 3CW2A 4IVRA 1SJ9A 3AW9A 3MCAA 1J49A 4NICA 1OWOA 4YRBA 3LK7A 5EWMB 2HIVA 3H8VA 2ZRKA 5KVCA 3PSHA 3AKZA 4DQLA 1R6AA 1L5GB 4XJXA 3CNNA 3D3EA 3TUJC 1JWBB 2AFVA 5F9HA 1KETA 2FHSA 2GPJA 3U7HB 2VDWB 1J8YF 4GP9A 3DG9A 2FWRA 4Y1FA 1P9RA 2YS6A 2C2HA 2NOAA 3OZRA 3TXXA 1CIVA 4ZAYA 5LXTB 5IEJA 1J0XO 2AW3A 1RHMA 2P35A 3EUEA 3RHTA 4P36A 2I62A 4K3VA 4OV6B 4WCFA 4L6AA 3HDVA 1A50B 1QGED 1QH1A 4V3CA 2IHJA 3LSYA 3R3HA 1FSFA 3Q9UA 4J0FA 3COVA 3FCYA 5DEOA 3T3HA 3R2JA 1E5VA 5AVYA 1K6EA 3LGSA 3ORRA 3MPUA 4GZMA 4OG2A 3BXPA 4ZAFA 3URMA 2C1ZA 1R00A 2QT9A 3Q3VA 4M0JA 1FPQA 1WSCA 4DPKA 1J2RA 1ST3A 5FJ8G 3RVBA 2XZLA 2R6CA 1FJGB 1HG1A 4M86A 2R8XA 1EJBA 1SC4A 3OI7A 5LOVF 2V96A 2Q3CA 4B3XA 5LA6F 4WN9A 1KI9A 1T34A 4UU8A 2ZR9A 3VH2A 3V7WA 2XKJE 3KSDO 4QQNA 4HLNA 2A9JA 5DT9A 1GAWA 3OT4A 3ZV6A 1LPSA 2W4IA 1QHFA 4A5OA 4RD3A 2IYQA 2WNIA 2O05A 3B9BA 1TPZA 3ZE0B 4BNYA 3LY9A 5F3RA 1M83A 4OHBA 2NPFA 3M9LA 4EGQA 3RW9A 2XMCA 1JQBA 4MCAA 1XMVA 2AZ4A 1A3GA 2JJ1D 1ZAYA 4MVJP 3WWPA 3T7TA 3BIXA 2GO7A 3VHLB 4A3EG 1VRWA 5L95A 3ROPA 4BTEA 4L73A 5IT9W 4KLZA 1L4GA 5FUQA 2R5WA 1T9BA 4DA4A 1ZM4A 5DCUA 2UVRA 3I9OA 2W70A 3MINA 4I50B 4MWDA 4WBNF 5PGMA 1M2GA 4LWOA 4Q6BA 1M2VA 2DFVA 5CDSA 4UHEA 5AUPB 1KAHA 1YS9A 3C6BA 3S1AA 4LNUA 1N2GA 4A0GA 3EXEB 3NVAA 1RRMA 2ZAIA 4QPDA 4QYXA 5BMVF 3N43B 3KAPA 4Q0MA 4RF2A 2H63A 3O3OB 5TQJA 3EARA 2UV8A 4ED6A 2VPPA 5FBRB 1T5IA 4BC0A 4UHJA 3WDLA 4OGKA 2VJCA 1I4WA 1JFSA 3IAUA 1VZ2A 2PEZA 2NU6A 3R5SA 3MIZA 1EE2A 3L0PA 3TGPA 3LXUX 3ASVA 2J7KA 3ZDAA 1T94A 4ISBA 4E6NA 3MJVA 5LQCA 3I72A 1OJ7A 2O8BA 3KYBA 2I29A 4BEWA 4IPTA 4FZVA 2A1IA 3I0ZA 2COGA 5C8ZA 2OZLA 1N7GA 4LMRA 1R0XA 4U7PB 1EGQA 5IT5A 2EFEB 1L7OA 5AXBA 4ROTA 1KDVA 1IOVA 3ZCTA 3NT4A 4P5PA 3VOBA 5DNDA 4KXYA 4R2MA 4D57A 4TRMA 1HX7A 4GKKH 1NJSA 1H6AA 3RBXA 4RNMA 3O26A 1LNQA 2ZRAA 2HMUA 3W3AD 4DJTA 5EKUA 4TTVA 3N2EA 1NY6A 3L0YA 4FNGA 4O3FA 3TW4A 4YQFA 2O8FA 1XLTC 4Q9LA 3STYA 2AR9A 4MP6A 4RULA 4QUJA 5HHTA 4A6XA 3ZDFA 3A6LA 2PH7A 1E5LA 3JZ6A 1BGXT 2I4LA 3M5WA 4DLPA 1XAGA 3EW7A 4MLCA 5DXJA 5CFOA 4ZVVA 3VSBA 5LMNH 4O83A 3N8IA 1T3ZA 1ZIXA 4EHHA 3X44A 4UCTA 1Q7EA 2A57A 1XLTA 4YT2A 4ZDKA 1CY1A 3F9CA 3IUQA 5IDYA 4QXAA 4WESB 4MO2A 2Y0CA 3EGEA 3W5JA 2HCJB 1F6WA 3LLSA 3S40A 5KHLB 4H0NA 2YJ3A 3NW9A 3EX7C 4YAOA 3VSEA 5H81A 3HUUA 1KI7A 1N2JA 2JNWA 5F2OA 3M70A 2QX7A 5A5FA 1J90A 5DFAA 3CPHA 1BVYF 2C95A 4WN3A 2QYOA 3G89A 5CYGA 2ABWA 4CV1A 4U2KA 1RPZA 1PGNA 3IJ5A 1E1DA 1P72A 3LCRA 1BVUA 1LSJA 3SXJA 1NXPA 2VF8A 4L7VA 1P61B 3HK2A 1C1HA 3ZBPA 4FFMA 4KUGA 1YQ9A 4WZBA 2D0PB 3G17A 4BKUA 5KYVA 3BMCB 4KNVA 5KNDA 1AS0A 5JS8A 3QI7A 1IJBA 3OLQA 1VB3A 1FP7A 1RQ2A 3QA9A 4UHDA 2HRQA 1CUHA 1G2PA 2WDZA 4YROA 2QRPA 1Z5WA 4X3CA 4C88A 1SKBA 1FQOA 3FKJA 4G0QA 4CR8A 3G59A 1RLMA 1U0GA 1E3SA 1PD0A 4G8BA 1HK7A 2V7QD 1VL2A 4DR5H 2FP4B 1K27A 2O2IA 3TVTA 4J43A 4HDSB 4YMTA 2AUNA 1Z0SA 1JKIA 2D13A 2QRZA 1T36A 2MYNA 2PKQP 5K7SA 2G63A 2P77A 4K88A 4V3BA 4C3ZA 1RLOA 4P82A 4BZZA 3E1GA 5B4VA 3RVQA 1H2AS 4EFMA 1OH7A 4Z3KA 3QYAA 2C3YA 1X3SA 2GPYA 3RU9A 1ZOIA 1VHJA 3L2OB 2CMHA 2NUPA 1C50A 1MF7A 3G2LA 1JQAA 4ZRNA 3C6KA 4IDOA 5DHSA 1I6WA 1YK1A 1SIOA 2HDHA 1WJGA 2E87A 1CEYA 3ZHOA 2QVXX 5MHTA 2CN1A 3R7FA 5KWEA 3JYLA 1KY4A 4OB6A 2A9KA 1KBZA 1VIMA 4ID9A 3VYWA 3TJRA 2H5EA 1PTKA 4BOYA 3NBXX 4WZAA 1PT6A 4N4AA 4YWHA 2QTVB 5JARA 5JXHA 1U2TA 1YK0A 1ZN2A 2M6RA 1QFSA 3V8PA 5AESA 5HXAA 3VZQA 1EFTA 1II9A 4CNBA 3KQKA 5D87A 1X80A 3JAKA 3TZHA 1TAEA 1XWWA 5ILQA 4L22A 2HKIA 1TQDA 1SN7A 3EH2A 3C15C 1MX1A 3JQGB 5H9VA 3UBMA 2WV9A 2BQ3A 3C6YA 3KYDB 2WT4A 2PQ6A 1NPYA 5EUQB 4MB0A 2UVQA 2JEIA 3F7MA 1XTVA 2XQVA 1KY5A 2BGTA 2JRCA 3JU3A 1UAAA 2X3YA 4PLWA 2GN2A 2AG0A 3GRZA 1VC2A 4FOSA 4BRWA 2WUVA 4L72A 2QQ5A 3KETA 3BA9A 1F14A 4FDMA 2Z09A 5I6DA 1IQPA 3CURA 1J20A 4G07A 4P4GA 4IMPA 3NDRA 2ROQA 3RHZA 1ZD2P 1KEEA 5LIPA 2OCIA 3V46A 1QU2A 4B3RH 4AZTA 1QLWA 2QLTA 3AM4A 2FG5A 1ZGAA 2DF8A 3A28A 4F3YA 1W2WB 4XYBA 1J33A 3PWSA 4AZ3A 4PAOA 1UH5A 4I6GA 2CXHA 1J8VA 1PF7E 3L0SA 3DHWC 5E8JA 3UAXA 3PEWA 2OBBA 5IH7A 4M60A 1H66A 2W58A 3PDIB 2IEAA 1UODA 1WY7A 2Z98A 3UZUA 2FPMA 2XUIA 5DGXA 4O84A 1NQXA 2VNAA 1N36B 4REOA 4HGRA 1LBTA 4QATA 5T4BA 3TJMA 1J23A 5LLDA 1PX2A 4DR7B 2J9FA 4KXWA 3OPXA 5AJZA 3BD7A 2OCKA 2NXEA 2X19A 1YQQA 4UHCA 1PNOA 1YZNA 4WA7A 1R0SA 3WGLA 5A3VA 4PGHA 1ZCZA 3VHQA 2ZR0A 2VK8A 4J2TA 4QOEA 1XYGA 2YIDA 2ZE8A 1XRLA 4DUGD 1QHYA 1UJBA 1MW8X 5BW4A 7MHTA 1IUNA 2A9OA 3ES9A 3THYB 4HWRA 4Z8YA 3ILSA 4TSRA 5HILA 4ZOAA 1UANA 1T3NA 3T1NA 3VI4B 5E9QA 3HKBB 4CIBA 4CYMA 4MWSA 2VN8A 3THRA 3Q8MA 3FJYA 3HFGA 3R77A 2R7AA 1BCRA 1QCZA 2ESRA 1D3AA 4CL2A 1WF6A 3ZNPA 1SOAA 5LR6A 2AJ8A 4KRYA 5BWLA 3WK7A 2B9VA 2GXSA 1G8FA 3UXMA 3LZCA 2W2PA 3K92A 1G59A 4CKXA 1DWOA 1KKMA 4KQXA 2CLIB 4C14A 5HIIA 1QOQB 5BWOA 4IJ6A 2OBMA 5K99A 4FBUA 2P62A 4ED3A 1QGDA 3TW8A 5L3QB 4XDYA 4XLLA 2ZTVA 4UZFA 4X6XA 4LDNA 5CFNA 4KCGA 1C3EA 4QU9A 3U9LA 3E8SA 3ZV4A 1QORA 4OLJA 2JJ8A 1LJLA 4B48A 1E2GA 1T8RA 4BVAA 3V2HA 3ED5A 1JH8A 3UT0A 4R6XA 2PUBA 2A3RA 2XOXA 5DM0A 1XTPA 1CZOA 1GPYA 4CM8B 3O4IA 2H1IA 4H7DA 3MGAA 5IZCA 3MWLA 5J1SB 2A86A 3KLMX 1TQ8A 4WXPA 2QSJA 1V25A 1DMSA 1GZVA 5I4BA 1WKVA 1NDQA 5LYJB 1A8UA 3RAQA 2YQZA 1DJQA 1TUGA 1N5DA 2WWFA 1I94B 4PLZA 2X8LA 1CUXA 2V6GA 3IEIA 3QJYA 1ZLXA 4LDAA 1L4NA 3TTYA 3NTUA 2DKFA 4LCBA 5HCIA 3PI6A 4J2OA 5LZ4A 1I2KA 4BGIA 5LIRA 4DV6H 1A76A 4XX0A 4KXQA 3O73A 2AN5A 3FSRA 4FE2A 2OUIA 1BXRB 1JG6A 2BR5A 2PK3A 2FK2A 5I9IA 2E5WA 4JYAB 5D5PA 4IKEA 3CSUA 3FKQA 5GV7A 3AFOA 3RLFA 3LWNA 3KPUA 5KFQA 5BPFA 3BGIA 1CP2A 1VIVA 2HA7A 2RONA 4JJKA 4D82A 3WIVA 2XA9A 4KGZA 3R24A 3ZY2A 3G2QA 4QQRA 4KFRA 2DBZA 1JDZA 4KG7A 4PICA 3I9V1 1M1NA 4PAWA 3EXFA 1WU7A 1MORA 1WD7A 4AJJA 4JV0A 1COWA 7AT1A 1W47A 4BMSA 1M33A 2E5FA 3K0AB 1FK8A 4FYWA 3DS8A 3GEEA 4W5TA 3Q15C 2CXRA 3IKLA 4M6WB 2ZJOA 4G3XA 1J0CA 4K1LA 4BO7A 1U0LA 1XNJA 1UPUA 3RGGA 3RUFA 4W5RA 2YRXA 4K5QA 1ONPA 2RGGA 5IW8A 3L7OA 3D2BA 4NBRA 4BY9E 3KD2A 1VSVA 1GPH1 2C7PA 3BOSA 2KPOA 3NM6B 4YAKB 2Q6OA 2HDKA 4ESHA 5DMHA 4D4HA 1U8AA 5KB3A 1A8HA 2FG6C 1Q20A 4RL6A 4KXMA 4YV7A 3CNEA 2LW7A 1UDWA 4ZOLB 1LEHA 4HXFB 5KDDA 4IDEA 4UTOA 3SU8A 4FT4A 2PMEA 5EN4A 3CLHA 5HEKA 3F46A 1ECGA 3FPFA 5BR8H 1TWFA 1PFVA 3COYA 4UAUA 5BSUA 1COZA 4X66H 4YLYA 1NIJA 2D5AA 5AKEA 1USUA 1ZUWA 5F1KA 2BEWA 3U4CA 2NU8B 4JI6H 2JH9A 2WWGA 1L5LA 1ZUNB 2B25A 3T1YH 3QU4A 1UPBA 4ODIA 4WJLA 4QG3A 1ZVMA 3DOHA 4QDTA 4MS4B 2D74A 3NU1A 5KX5A 5L8VA 1YDWA 2F43A 4LYEA 5JXWA 1LI4A 3ZWQA 4N5DA 3CUKA 4IVNA 1S0OA 4K9OA 4F38A 3HEBA 1YVDA 10MHA 1EDDA 4QOGA 1JVBA 4DC9A 4FE7A 4J03A 4TWAA 4EPVA 1CUSA 5IWCA 5C5DA 5KG0A 3UC5A 1J0EA 3ESRA 1BWSA 5FTNA 2ZAYA 3QMVA 5AM0A 4HNQA 4JB3A 4N1AA 3DP7A 5M29A 1I0ZA 3O95A 1QYCA 2GUGA 3IODA 1NNEA 2OCGA 2VWQA 4BLVA 5AUNB 3U6BA 3OX3A 1IN7A 1A5SB 1KJYA 3BXOA 3JTMA 4G26A 5DGAA 2JIZD 3PB3A 2Q9AA 2I6SA 4WOBA 4O3MA 2WFLA 3RRFA 1L5HB 1E7RA 2GILA 1QV7A 3UO8B 4FB5A 3OPVA 3WK4A 3CINA 1CJUC 2XAAA 4MIYA 3B1WA 1OBOA 1JYFA 1BS1A 4GVPA 4AX8A 3H0KA 3Q7IA 5FOWA 1QJ4A 2NVBA 1Y7HA 4URUR 5KYNA 2FHPA 3UUEA 4FFDA 3PTAA 5AK6A 3SQXA 3FZYA 3TOVA 5DRTA 3EC2A 4JI2B 2IW1A 3NEPX 2Z9CA 3C41J 1PLJA 5K0CA 4E09A 1BH6A 5CCEA 1T4CB 2QK4A 2ZYDA 2WD8A 5BR1A 1OX6A 4D9HA 1QP7A 4XYEA 3MJDA 1MFZA 5JYCA 2QSYA 3PHIA 4NMXB 2P69A 2X0FA 3TZBA 1QXSA 3OIYA 2F2TA 3G23A 4FONA 1E77A 3CRZA 1N4AA 4Q3CA 4K1XA 3GH1A 5C1BA 4NC9A 2BFBA 4EW3A 5JCZA 4MCHA 1ZD4A 4MV4A 1A5ZA 1RPJA 3TNLA 4OQMA 4OUDB 2QE7D 4X8HA 4G63A 3HJHA 5F9MA 5EMMA 4RH0A 1PYGA 4RTNA 1NYTA 3LXXA 2DG2A 1KFEB 3LP6A 3U80A 2WJVA 3C14C 2O0HA 3MJEA 2PZKA 5IT9A 4O0MA 4RQUA 5HKKA 5EI5A 2CVZA 1SBYA 2LP4Y 5H83A 2K7FA 3GLHB 3I3SR 3KZNA 5DBGA 3KSBC 1VJRA 1ZBDA 2O2SA 4K0KB 5D8DA 2IIBA 4GOND 2VCEA 2XWSA 4FUQA 4U7DA 1EU1A 2AEFA 4HDMB 2QXTA 3O8LA 3Q6IA 5GGXA 5FR1A 5KYYA 1KMHB 2VT3A 4EGCB 2J41A 3OJCA 1KSHA 2P30A 2PX0A 5K3WA 2AX3A 4KHPH 4OXQA 4WUTA 4ZVPA 2I67A 3GBSA 4DRXA 1R9TA 1UZMA 1DBSA 3G1UA 3VPHA 3VR6A 1UPFA 4R8MA 1YJCA 3OX1A 3LY8A 1GWNA 2QXUA 1CUJA 3O2QB 1ZN9A 3HA3A 5B3LA 4DCSA 1RHUA 3RO7A 2IL1A 4O4HB 1G7RA 2V74B 5K0ZA 3BZBA 2HIHA 5E7JA 1QK4A 2BF7A 3B9RA 4BQQA 3ADPA 1N5OX 4CU5A 2PMWB 1DTSA 2P2SA 4DJDC 3F1LA 2BFMA 2ACWA 1OLSB 5TF4A 4EG8A 2YC4C 4FGLA 1PUXA 1EFAA 4DIUA 3OCVA 1YL5A 2PS3A 3F6YA 4X71A 3WO1A 4RS3A 2IHTA 3JZFA 4EVIA 2VHZA 2QD4A 3X1YA 4KLNA 3IA7A 4W9RA 2EGHA 2W9XA 1THTA 2R96A 2Q3DA 2C9OA 2IV7A 3L5KA 2CFTA 1K4KA 3DBRB 4GDMA 1Z3CA 1TX4B 3CF0A 2GM4A 4B74A 1B0AA 1Z0KA 1NOIA 2QF7A 5GVRA 4O1IA 4TWIA 2FY8A 1SQ5A 2NACA 3AHCA 3PWKA 2BRUA 2WJ3A 3OWHA 2ZUFA 3D8TA 3U4HA 3G1WA 1Q14A 5DK6A 4MVCA 2VHJA 3G5TA 5CURA 5JD4A 1ZHFA 4JI3B 3UZOA 1HA3A 3QOYA 3IH5A 2Z6QA 2HOQA 5BMOA 1SGWA 3E2IA 4YX9A 5DP2A 5CT6A 1ZMOA 2HPZA 4W63A 1SURA 4E70A 4TTRA 3N76A 5KSWB 3ABRB 1GNPA 2VF5X 3SKYA 3MMSA 4XCXA 3K9WA 4ADSG 1ZNQO 1DUSA 1E99A 5J4LA 4IO1A 3GIDA 1J8MF 3P27A 4OMFG 2FSGA 3L6DA 1TGVA 3CLRD 3ZE9A 2I80A 1TZMA 1XPOA 5FFMA 3CEAA 3ZWMA 2WMNB 3I83A 2EKPA 4R7TA 1QKIA 3FDXA 1YXMA 2IQIA 1WP9A 3ZEAA 4J07A 1NX6A 1E8DA 1WVGA 3HRKA 3ONEA 2Y0BA 1LPAB 1C9KA 2PGOA 1HNZB 1U63A 4G1CA 4HYEA 3RLIA 3HVRA 4I7HA 1NNSA 5CEJA 1QG6A 3F8NA 4PBCA 1N0HA 4LYHA 3CUSA 2OG2A 3OFSA 2Z0MA 1W9MA 3B9PA 1A48A 2VPXA 1JMVA 5K8JB 2PGIA 3IJEB 4QM7A 3DR5A 1DJLA 3K6SB 5GJWC 3PYLA 5JQGF 3S99A 1VKJA 4TWJA 1TGYA 5B58C 2EHJA 1PTJA 2XRZA 5JTUA 2X4LA 1YQXA 4FGUA 4WNAB 3N8HA 5LWHA 2XB6A 2PKCA 2C3MA 4QOIA 5L1JA 4M1SA 5KT6A 4EMBA 2I4RA 3DO5A 3NASA 5AWFC 3Q10A 1EKXA 1C5KA 5B1DA 4LGVA 1X7WA 1YB1A 1BU5A 2XBMA 2I3AA 3FBTA 1J97A 1ZJ4A 2RDJA 3IBYA 4GO1A 4CKYA 2A7QA 1I4TD 1RYYA 3GLSA 4JJIA 5K5EA 4AECA 2E4WA 1EZ1A 2CWWA 5K20A 4QUHA 5HRUA 1NYLA 1YCHA 2BBWA 3TD2A 2A67A 1YB2A 3R3YA 2NZVG 2IY8A 4NIMA 1WBJB 4L5IA 3DKIA 3P8ZA 5HQ3B 3KO8A 4WOJA 5U9CA 3M9WA 3SQDA 1JIHA 4CCWA 3VTFA 4DUYH 3OE1A 2ZCJA 2JI7A 4RD2A 2HVSA 5G1NA 4YV0A 2PTGA 2JEJA 2VWPA 2YJGA 4PVCA 2NYVA 1I8TA 2E7ZA 3GFOA 3W34A 3JAMA 2WOJA 1ENYA 4XWTA 1RXIA 1ISSA 1T43A 4EEQA 5K8VA 4DNQA 4M4SA 2VZLA 4E2FA 4M9ZA 2J0UA 3PNOA 3I73A 5BNIA 4FINA 1NNI1 4E21A 4QPCA 3EXIB 3DOOA 4N82A 3FIUA 2Q4RA 2D5LA 1EFDN 2AI2A 1GG8A 4IP0A 2DRIA 2ZYWX 3SJAA 4G8DA 3A1NA 4YREA 4V0QA 5GM2A 1FW6A 4UBNA 3NBZC 3WA7A 2W6IA 1A9ZA 4BNHA 1PJZA 2ZULA 1PUIA 2O8DA 4EDFA 4BNVA 1KY2A 3MCUA 3AM3A 2O0JA 4EY3A 1DE0A 2BQRA 5CB0A 2XB9A 5TEWA 2CNBA 4CFZA 2NV0A 1BE1A 2VIIA 2PD3A 4R3NA 4G5HA 2D1RA 2O3UA 2IYUA 3CNHA 4YJ2A 3P4UA 1U3GA 1T4DA 1E7SA 2D2VA 2VLBA 1DINA 1PV1A 2WHQA 1HR0H 1WPGA 1RE1A 2OQRA 4WCFB 4XEHA 5E95A 4U6NA 1JHMA 2R7NA 4TZTA 4GWGA 2VJYA 3FSEA 1FJHA 2VVTA 4IR7A 3NBFA 5EHQA 3IEUA 1U6JA 2QN7A 3QF4A 4H2DA 1W87A 3VC3A 1ZJJA 4EJ0A 4R1PA 5AKJA 4JOBA 1SVKA 1AZWA 1E1NA 1PR1A 2O0LA 1MKYA 4IIXA 3KREA 5AVQA 2B30A 1PUJA 1BU8A 1T0BA 3K73O 1NXQA 4OJMX 3SS7X 2PZBA 4Z0PA 5EGSA 2C8JA 1ULSA 1WW2A 3S2GA 4I4IA 3NT2A 1G8AA 3NHPA 2H07A 4WN9B 4EYSA 1KEUA 4QVGA 3QWFA 1L5FA 2QRHA 3C39A 1U0HC 4ZVKA 2QT0A 3ADCA 2NN3C 1SA0B 5IXYA 4B3SB 1ZZEA 3TSAA 1MW9X 4H7HA 4L8LA 4RHCA 5A2GA 2IZZA 1ZITA 1FNCA 2XMZA 3OM8A 2A14A 4DWOA 2L2QA 4KN9S 1DP4A 4WOPA 1YCFA 4F2GA 4DIDA 4N5IX 1U8FO 3FHJA 2QRJA 2CHFA 2CVPA 1XU9A 1RXYA 1NMSA 9LDTA 2P90A 4YMSA 1JYSA 1WZCA 3QVGA 4HB3A 1L7XA 2F8TA 4ZI3A 2BFNA 2JGAA 2R25B 4UEQA 1ZR2A 3KOMA 2BGLA 1Y8CA 1XA0A 4G3IA 2EBWA 1A4UA 1NMXA 3ILVA 2Z02A 3S1AB 5D1HA 1TLFA 3FCUB 4C4OA 3RT7A 3AWIA 1LZKA 3C3YA 1XQXA 5AI5A 3T9BA 4DDMA 4DFDA 3STWA 1H93A 2YWFA 5ALJA 1Q15A 4YHHH 1N32H 1W1WA 3OBIA 1LD3A 1LCIA 1JQ5A 4ZV7A 2RAVA 3RUEA 3RVRA 1T9KA 1QF7A 1DWQA 2NU6B 3L49A 4OK3A 3SYMA 1ZQ7A 5LZ5A 1IRXA 4QO8A 3LCUA 3AHGA 2Z5GA 4TYWA 2YZKA 2PZ8A 2O8BB 5KG3A 3O90A 3LWDA 2ZTSA 5KT2A 3O7MA 4ONEA 1P3JA 2H5IA 3ZDBA 3R0JA 1JKMA 1XTRA 3INGA 3U60B 3GPIA 2IH5A 1G55A 3UH0A 4H7IA 1UT5A 3VU0A 4ZGBA 3MG9A 3O38A 1AUQA 4LECA 2P2NA 3RJZA 3D3JA 4D6XA 2QAIA 2QGZA 2YIVX 2DECA 3BHMA 4JHXA 2EDAA 2DBYA 3WNCA 2AHOA 3NVDA 4BU0A 5IYZA 4FFRA 4OB7A 2Y0SE 3N3AC 5DOVA 5JVLA 3G0HA 1L4UA 1PW5A 2ZAMA 4N03A 1WY5A 3GQBA 4EI8A 1QB7A 4N5MA 3F4KA 4Y2RA 3RFXA 4B6EA 1Z4LA 2HDNB 4AYBE 3MT7A 1PGJA 4C7JA 1RI5A 4CIYA 2Z8ZA 3O8DA 4MMYB 2RGEA 1NW3A 3UCXA 4B5KA 2HG8A 2BFDA 4M1TA 4OPMA 5BWMA 5F7ZA 2R00A 4DLBA 1RM3A 1UC5B 4DR4B 5KFEA 3LK6A 1S8FA 4J29A 2R3SA 4U7TB 1X7XA 1IBSA 4YP0A 4EG4A 4F4YA 1Q1QA 2ZWVA 4B7AA 3NM4A 1JB1A 3DVLA 1H1DA 1TD1A 5CMLA 4MMZB 4RWEA 1P1IA 4GZ3A 3G1TA 3QHQA 3TGLA 4CUKA 5KT3A 4XIIA 3HA7A 3LNTA 3VJMA 4I8DA 1M9NA 3DD5A 4BHTA 2HCBA 2YJ6A 1HDCA 2C2XA 4WZBB 4P22A 4X65B 5HA5A 3DXYA 4YAFA 3G9UA 1D4ZA 1KC3A 4IUYA 2W93A 4EB6A 2X5JO 4OQZA 2R1VA 2JGEA 2YNMC 1IE3A 3A26A 1EWQA 1I4DD 2WVAA 3P2JA 1RYSA 2E5LH 1U31A 1L7AA 3GVXA 2VDLB 2HA6A 4DPLA 3PQ6A 2F17A 2XE8A 4R7GA 5MFPA 2DVMA 1OWLA 1OC2A 3NIDB 1YGPA 3OMWA 3EE6A 5AJHA 1PEAA 4C6HA 3FCXA 5B3AA 5HOQA 3CB2A 4OX9H 3JVEA 2EJ0A 2FXIA 4UFNA 2ZI5A 1CRLA 4RJ2A 4N8EA 3STUA 3DVAA 3QEBZ 1V4VA 1Y34E 4MDFA 1PGOA 4BX3A 2OBLA 4OOFA 1HM5A 5JFGA 3L41A 4X95A 3K31A 1T36B 4WXRA 3EWAA 5K9ZA 4WZAE 2D1QA 4B3TH 2WIKA 5KOHA 3V2GA 1FUIA 1N48A 3VR4A 4IAJA 4O02B 3C3XA 5AHXA 1GRNA 1GGKA 2R85A 2NUPB 2QSUA 3AHHA 3G9TA 3QVLA 1Q7CA 5G4KB 3HM2A 1TF7A 2PJRA 1GZSA 3IRUA 5DHFA 2Y1WA 1P45A 4NCAA 3KQOA 3QKSA 1CF9A 2QMZA 1LPMA 2RGDA 1T35A 1XZFA 4MZDA 3TZCA 2E0IA 3T7RA 3DE3X 1BHJA 3B1YA 2QRQA 5FQOA 5AI4A 4OQ4A 1ZJ6A 1F5NA 2X0KA 4PIMA 1UOQA 3EGVA 5AHOA 1Y5RA 2WFMA 4P6VF 3HVHA 5LNK1 1KR5A 3GTGA 1WE2A 2ZRHA 4F2PA 3C7CB 3DFFA 5M34A 1YZKA 2JEZA 4G1EB 2ZUTA 5BYBA 5CD9A 1OA1A 2KX7A 3MILA 1X80B 3JAKB 4JNKA 2V65A 1PR4A 1P0PA 4IHQA 1YB7A 2PRKA 2GEJA 3WDSA 1SZCA 3GVHA 2X7HA 3W6ZA 5BQFA 1X1RA 3OPYA 2GRJA 2H7XA 5L9XA 3CLVA 1TW3A 4S2EA 1PX0A 3ZWNA 3K70C 3JZIA 3E9EA 2A2ZA 2W22A 1A8PA 2UZ3A 3HG7A 1JJ7A 4ESVA 1SHJA 5JJ5A 2VYCA 3DTNA 4CN8A 5LB4A 3G0BA 2NU7B 1EHIA 4KMMA 4MW9A 1BMFA 4U39A 2IEZA 1G8GA 5B37A 4UNPA 4HZGA 1GZHB 1ISHA 1KEEB 4QIHA 5ETJA 5I9SA 1M2FA 4ON9A 5AVZA 1O54A 2DPGA 3JYPA 4B17A 5LZ2A 2GHRA 2YWCA 1H8EA 5CM8B 3KVOA 4AZ3B 1L1FA 1C9YA 1KRWA 3R9KA 5A3JA 5DGHA 2BCEA 1TU0A 4AMBA 4C76A 5HJ5A 3UOWA 5C52B 2GO1A 4AAYA 2AC7A 3LLUA 4X20A 2WYWA 3FGNA 2V45A 5KINB 3H42B 1L3CA 4N0DA 3HACA 1GPLA 2Z8YM 1BROA 3EYAA 1M8FA 3LHFA 4Q9IA 2Q3HA 5LL6P 3E81A 2AKEA 2XKAA 3ESYA 4ECYA 3GIQA 1M0WA 3FTCA 2J9FB 4OQPA 2YV3A 2WF5A 1C9EA 4J0JA 2OCBA 4AURA 4KQWA 1Z7BA 3EDQA 2JIRA 5TX7A 1AKRA 3WGIA 5CGZA 3F5FA 3FOBA 4Y30A 2WSIA 3D8SA 5FHRA 4Y2XA 4FZ3A 1Q6ZA 2VYNA 4JI8H 4XQCA 1VFPA 5AJVB 1L1QA 3KPYA 3H11A 3H99A 1CP3A 1EK1A 2QKYA 1GA4A 1C0IA 2YWJA 2Q0HA 5GZ1A 3MPOA 4B3IA 3CSSA 1WUYA 4U6QA 2E89A 3LTNC 5LWQA 1I0LA 1X7DA 2OAQ1 1ZGCA 5CFLA 3OFVA 3Q1KA 1BCRB 5C7YA 2ATIA 3A1CA 3OTOB 3ZN2A 4JA2A 4B83A 1ECCA 4JROA 1PFQA 1XXHE 1M75A 2PGJA 1J5EH 4J1TC 4LHXA 4F4UA 1CD5A 1VL8A 3O94A 1D6NA 3I4MG 4HRYA 2H7YA 3S55A 4RKQA 3PFBA 3WGZA 3T9CA 1H1LA 1Z6YA 1XA4A 3MWEB 3N2KA 1E1RD 1RMQA 3MAAC 1ZZGA 1KU6A 1JLKA 4ZI7F 5LP6F 4FZJA 3WB9A 3TW8B 3OSNA 2CXOA 4LY9A 1XAHA 1WDLA 1GHTA 3U40A 3H3XA 1YZVA 1WXDA 2FZEA 1D4AA 1EM8A 2H00A 4BVLA 2HLNA 2IEIA 4TXJA 1PG0A 1J5XA 2BLNA 1QGYA 3EFHA 1D9ZA 2O8NA 4DC1A 4KEAA 2EZUA 4OATA 5HTKA 1OFHA 1ZI8A 5LUAA 4LC0A 4CE5A 1E62A 2R82A 3GJ4A 4RDIA 3B7GA 4R68A 3T5BA 4Q3DA 4QTTB 5DCYA 1TM1E 2EQ5A 3U7FB 3WDMA 3DLPX 1PQPA 2OHXA 4CG1A 4QT0A 2HAEA 2YWRA 3B1ZA 1Z28A 4DQXA 3NB0A 2C4MA 1ISFA 1KUTA 2WJYA 5J5CA 5EG5A 2GYWA 2FV8A 4F4CA 1N78A 4L9RA 3KAQA 4D7AA 4KIGA 4JXJA 4OI1A 1EJ2A 4OJYA 2V58A 5B2EA 2J7PA 2C4UA 1SWWA 3F9IA 5ILGA 4B7XA 3KPWA 3MQ4A 1DADA 1F8YA 3QE0A 4XX0B 5IWAH 4LDPA 2CXSA 2Y0SA 5LLTA 1PNVA 1JHRA 4J4BA 3C6MA 3B2EA 2QRUA 1A0IA 1CUVA 1K6MA 1GGEA 5J4HA 1U28C 2BDTA 4FNOA 2BW0A 2OHJA 4XB6B 4AYBA 5I3CA 2JKVA 4FHEA 5E6RB 4M88A 3K09C 2I7VA 1LV8A 1ZD5A 3OPNA 2GJSA 2JVKA 4ED1A 3GYGA 4V0LA 2CL0X 3EXFB 1OV4A 2VDKB 1GPNA 3VVCA 1FTSA 5E6UA 5AKKA 2CBZA 4YI5A 3G5LA 3H17A 4DJ5X 2BR3A 5B30A 3K09A 1ZBQA 4TWZA 3MHPA 2PS1A 2Z5FA 2VP5A 3V8VA 3NHYA 4YECA 5EZYF 3ND6A 3F7TA 1ZEMA 1JQEA 1GQRA 1S68A 1GTRA 4WZ6A 5CIQA 1KJNA 3TIGA 3CKLA 4HZUA 5HOEA 4HP8A 5JXJA 2RHTA 4FX2A 1H6DA 2FK1A 3AL3A 1AKMA 2QR2A 1TEZA 3IL2A 3NYRA 1UDAA 3U0VA 1PEDA 4WKGA 2UYHA 5HDQA 6AT1A 2MR6A 2FR0A 1FFGA 3D5EA 4RACA 3OQMA 3ENNA 2VQEH 3IB3A 4YT4A 2GAFA 3P9IA 3TI7A 4JUCA 4MITA 4CKEA 4FNMA 5EJMA 2CYCA 2PMBA 3D0QA 3WKDA 1NW9B 3L92A 2X6TA 2VP4A 1LDBA 2BEWB 2XUKA 1GNLA 2OR3A 1GTG1 3CZCA 3VVBA 3IPAA 3TLZA 3HOUG 2AK3A 2EGGA 2ZWIA 5GY7A 1EEXB 2E4VA 4QNNA 2IA5A 3SHTA 4BJHB 5FO1A 5NULA 1KHTA 4HMQA 3W6UA 1D6JA 4G6ZA 1USVA 5KX5B 3ZLVA 1R0ZA 5EZSA 3BICA 2RH5A 4LXYA 4JOSA 1W4CA 3O84A 1I9GA 5KTYA 4Q7JB 1X7YA 4MGIR 3QPAA 2RHMA 3FAKA 2V1UA 1NDHA 1S0MA 3SR4A 3OLYA 2HO4A 2YWBA 3L7DA 4QECA 3HCOA 1CC1S 2QP4A 3AVQA 3DXXA 4OREX 2X2OA 3OUZA 4PZDA 2VHTA 4F1WA 3T3GA 3D81A 4RHUA 5BPHA 3AL0C 3V34A 4HDAA 1OKKD 4HPXB 4EKGA 3ZZTA 3M6LA 4DMGA 2E37A 4CDMA 1K7FB 2J4DA 4D43A 1MB3A 1NMYA 1SH7A 3ZDQA 2ZM5A 2WFLB 3VDQA 1GOTA 2OLEA 1T8SA 3OOSA 4FKBA 1RVV1 4M8LA 1NBHA 4KFTA 4MV8A 2HZ7A 3OTHA 2R11A 4RUCA 2I87A 3IESA 3SIRA 4LVOA 3Q8LA 2HHHB 3CF6R 2DU8A 1VCNA 4UNNA 3QKRA 4RYLA 3UF0A 1N9GA 2WIJA 1CERA 4BCCA 5TS3A 4Z2YA 2CLCX 3WWOA 1FFSA 4E11A 1NC3A 1IK6A 1YONA 3AUKA 4HSGA 2W7OA 1N7JA 3GGJA 1YR6A 3A6DA 3GT0A 3PNPA 2IYVA 5DW3A 3WGGA 5DSZA 2Q3JA 4DVGA 4W5JA 2C5GA 4HNAA 1U2ZA 3ABSB 4HNSA 3MS7A 4MOWA 4WY5A 4KN6A 2HMSA 2BFBB 2V59A 4PZ0A 3WIEA 2R7ZG 2NZ2A 2YZ2A 3IOBA 1NF2A 1ZINA 1Z6QA 1VG1A 3D7MA 2O5EA 1N3BA 3GFVA 3LAWA 4KO4S 4AN1A 5TARA 3DAOA 1L4FA 1U3DA 2ISQA 4I3HA 3FLBA 5KKAA 4ZKEA 1E89A 3QY9A 1T8TA 4MKGA 1NKTA 2P9BA 1GPMA 5KQLA 1QOZA 4OI0A 2ETXA 4US1R 1OY1A 2WU1A 5JYBA 2UUAH 1E5TA 2RK4A 3Q0EA 2IPXA 3PC8C 4Y9TA 5B64A 1KAEA 4BYGA 4R0MA 4FHGA 2A6PA 4ZAVA 3FMVA 1FSGA 1QMPA 3TJZA 2Y4NA 1E6WA 3BGSA 1RADA 4PSKA 1CJTC 4BNUA 3WLOA 3QXXA 4J9LA 1NLUA 3OOEA 3EQZA 5KYYB 3P2MA 1IBCA 3RI3A 1O5TA 3FRJA 5C53B 2Y9PB 3KEFA 4ENVA 4QLOA 4L8GA 3RV4A 3ED1A 3E8XA 4DCOA 4X9XA 3Q0IA 4E94A 4YWJA 3IKMB 3K15A 4IXWA 4DRXB 1Z0IA 4R2LA 1YR9A 4YHBA 4HS4A 3IP5A 2W11A 2I22A 1OREA 2J0VA 4TTSA 2WICA 4S1OA 1IVNA 2VRWA 4HD8A 4IGAA 2OHOA 5LMCA 1W6UA 4XR4A 1RZRD 4O8ZA 4HB2A 3TTUA 2R87A 1M1ZA 3KYJB 5JJIA 2BKAA 4I3FA 5L40A 1WPXA 3FPGA 1EK5A 1XXHA 3AVXA 4D96A 5TJ9A 3U7JA 3CO5A 5IN5A 5F1OA 1D2RA 1QX4A 5EKTA 3OP4A 5D01A 3FDZA 3AP1A 1ESEA 3E2MA 3LUBA 4OJQA 3D5TA 1HQCA 3I6MA 3KWJA 2IX3A 2GLTA 4UCQA 2X15A 4OM7A 1FRFS 4UFOA 1KJ8A 4BIMA 2MTBA 1IM2A 2HK6A 1VRVA 5EA2A 4QFDA 4ZHQF 2WP0A 4RK4A 1AMUA 4KE8A 4DLVA 2I4IA 1QSGA 5JMOA 3EGWA 2P6MA 1NPDA 3OQIA 1S03G 1CKOA 1WLYA 1J2JA 3P94A 2ZYUX 4CDNA 4KIJA 5IN4A 3PUIA 3KD3A 4Z2AA 1BWQA 4GW3A 3PUYA 3QMWA 3OE4A 1ORWA 3WLMA 1OSNA 1XNRB 4WOCA 3NOOA 3T1TA 3MELA 5ER9A 3A37A 1GSHA 3WL3A 2BZ1A 3QLTA 4BPBA 1P18A 2PZEA 3WR5A 3ODPA 4AW9A 1CZHA 5IX8A 5ITVA 2WTMA 1LVHA 1VI5A 1KE2A 4ZXFA 3WLHA 1T9AA 3U48A 1P8AA 5KSYA 1AUPA 1DRVA 1YR3A 2ZATA 1BHO1 2BGJA 3CRRA 2GQSA 1VB5A 4BLRA 3S8YA 4YCJA 1WTCA 2F1IA 1XCMA 3C5HA 4B34A 2MJLA 1R4AA 1O95D 4N9QA 3WLKX 5C1PA 3CJQA 5EHZA 4QJBA 1TWCA 4EA6A 3ZW7A 3O5AA 1VG9B 1AKVA 1SHTX 3H2HA 1KS9A 4H31A 4AO8A 5EY5B 4ETIA 2JW5A 3DEHA 4GKJH 4TLAA 1R88A 2BEVA 2ZEJA 1YFLA 4S04A 2FWBA 1Z0ZA 1Q7GA 3DCYA 2CV2A 5C31A 4RXTA 5K6AC 2FW8A 3QEJA 4ENSA 1OT3A 4MP3A 3IAEA 5AQ1A 3ZQ6A 4BMYA 4EZEA 1RKBA 1WXGA 5B4TA 3TLJA 3JQ7A 3RIMA 4UCOA 3R76A 2AG5A 1M66A 3ZXSA 3RFCA 9ABPA 5BN3A 1S2GA 3V7UA 3UV7A 2W71A 2FZ5A 2CDBA 5K6AA 4L0MA 3LVBA 4PSCA 1S8AA 3K32A 1X7WB 1YZTA 4A2AA 3RD5A 3GCZA 5I4CA 3ENQA 5HF9A 3UJCA 3DAPA 2UKDA 1CUBA 3MCTA 4IRUB 4OY3A 3RTCA 2J6SA 1GEGA 4KWIA 3KE9A 4NZPA 1PR3A 1GZ5A 2ZUUA 1JR4A 5ALZA 3ILYA 5FBWB 3OJ0A 3P9YA 2XHZA 3ZXYA 3IOMA 5JH7F 1LVGA 2QB5A 2OHGA 2Q2OA 3IBSA 2YMLA 4B87A 5ALRA 2CXQA 2R79A 3W06A 2WZBA 3T9DA 3VOTA 1M8GA 1MJNA 3GMIA 2DUJA 4LHYA 5DO9A 3JWHA 1QCCA 1O6CA 3NTOA 3O93A 1ESCA 1BKYA 4PO3X 2QYTA 3S1SA 3SNOA 1LKZA 3ANMA 2J0UB 5KNCA 4LZJA 5T5QA 5IAGA 2DCMA 4MICA 5CT5A 2PMFA 1K2VN 2CW8A 1YZFA 5JYDA 2Q1XA 4WK6A 2CLOB 2ZB2A 4NDZA 4MP8A 4HDOB 3SFZA 2NYAA 4XIJA 2O8DB 4KWHA 4H9GA 2CBXA 2PWBA 4ED9A 1NVAA 1G3MA 4BRSA 2Q9BA 4AUEA 1GTZA 3ECAA 1AHHA 3DEKA 1LTHR 2Q9UA 1EKVA 1QFMA 4B0OA 2HC9A 4R9SA 2C9DA 3DE4X 2EGUA 4N48A 1GNSA 3WK9A 3X3HA 5E7MA 4K2AA 1SXIA 4YJ2B 3MFIA 3TDKA 3RG2A 1LDEA 2PX4A 5F5LA 3WGNA 4LJ6A 5IBCA 1Y7PA 1ZD3A 5JNLA 1YACA 5EMHA 3B20A 4QXOA 1K0FA 4MB6A 1KZ7B 2C84A 4EGSA 5ALVA 16PKA 4X8MA 1GA6A 3VU9A 3UJNA 2EATA 3RAGA 3LCMA 4HRXA 3QF4B 4GI1A 2BBTA 5FPQA 4PYKA 4GU5A 3ZIAA 4XIGS 3V1KA 1NJFA 4ANFA 1Y3DE 4B3DA 3EVCA 4K0RA 3SIXA 1TTQB 2XV1A 1XFAA 4UFZA 5TVKA 2JC3A 2AJTA 5LOVA 2UVVA 2A59A 3VR5D 4M0UA 3T5TA 1SVWA 3NUQA 1G7SA 1H6BA 1I36A 3DBHA 5LA6A 1QF9A 2G6BA 4MUYA 4G8CA 3QBEA 1GUYA 3NP7A 2EP5A 1QR6A 3PK0A 3FVWA 4NQRA 5GADl 5WRFA 1WNFA 3PNSA 3B38A 4P83A 4HEQA 4CGYA 1DOAA 4DLXA 4QJFA 1KTVA 3OKFA 1O58A 3PP8A 1JZSA 2O48X 2W6JA 4BYMA 1I2ZA 3KB1A 5TPWA 1GCGA 4MR9A 1OLUA 4J9VA 1JU4A 2R5FA 1A5TA 2IYLD 1I2LA 4CGZA 3DTTA 1QDLB 5JS7A 3X2FA 4AT1A 2AYZA 1HLDA 2ZR7A 1CLEA 3KDPA 1I6KA 4LJ9A 4WBNA 1DAOA 1DAFA 3E3OA 3QVGB 4R8RA 3E3MA 4P0PB 5BVGB 1TMOA 1VL5A 2K4MA 5K2MA 2VO1A 3EA4A 1SUEA 4MVJD 2DFDA 1Z39A 1DT3A 3VKVA 3QITA 3QUSA 1ZIYA 3LBAA 5BMVA 5BQXA 1WUIS 1XMXA 5C37A 2PKRA 3K71B 1OYOA 2PSSA 2W2LA 4Q4HA 1UAYA 4H1VA 1ZXXA 4YMGA 4QX6A 3Q72A 1EFVB 1PR5A 2Y9MB 4NFLA 4C06A 4DXHA 5CLJA 4HATA 2VP6A 4DV0H 2PZJA 5C4MA 5JI3E 2VWHA 3FFBA 3E18A 5ABPA 1HDEA 4IKPA 1JH9A 3CRW1 2EHDA 2EYQA 1QRAA 4QU5A 4KN5A 3MLAA 1M7JA 2XZTA 4HKTA 3IOYA 4CQJA 2P5TB 2OE2A 2VUIB 1Y1PA 1USKA 4KITB 2IYRA 5LP6C 1XEAA 2ZM6B 2JPDA 1QGOA 2OQVA 1IZ8A 5CU7A 1I2CA 2X0DA 4B3BA 2E21A 2X5NA 4NBTA 3VZCA 2O8CA 2PFSA 2TMYA 1OFUX 3VDXA 2PT5A 2LIVA 3ZG6A 4MJLA 3VDRA 3RIYA 4Y7DA 1VMKA 3HJNA 3B3GA 4YS6A 2EJ2A 2ZJ4A 5EUBA 5F51A 1MQ8B 1QC5A 1JG2A 4B46A 5JASA 1V47A 4MEBA 4CTJA 5IPFA 1B8NA 5CPFA 2IXEA 3R7SA 4ZGWA 2C2MA 4DR3H 4FYVA 4AS2A 2P8SA 2J5BA 3IELA 4B0PA 5IYZB 4K81B 4MKZA 4Z1OA 1U2EA 2IUUA 5C44G 3GQBB 3UPTA 4OFZA 1JL3A 4O2BF 4UVGA 2Z4TA 3Q8PB 2HHFA 2PXAA 3P2IA 4ZYUA 4LZZA 1I50A 4JUZA 3BA8A 2O2ZA 5EERA 3UAGA 2ENUA 1BH2A 1X92A 2DB3A 2Y27A 1MH9A 2CHQA 1MVLA 2J9XB 4J0GA 4Y6QA 1NLFA 4AMZA 1B6RA 5D1PA 2Z08A 4U3JA 3RB6A 2BFDB 1DIAA 2VRCD 4JR2A 3BHIA 5JXGA 3I2FA 2C9ZA 1NRIA 4ZEMA 1Y1LA 1X7XB 1XJCA 3D3KA 2XNHA 4HJXA 2FEAA 3JASA 2QP3A 1DTEA 1FBTA 2DBRA 4WACA 2JG3A 2NO5A 4QC2A 4MUBA 5K8TA 2IA6A 3VO8A 2YV2A 4CV2A 3D6NB 4EHKA 2J3QA 2VQ3A 1N3LA 1ZH2A 3PIRA 3HLKA 3W9UA 4RM2A 4BCBA 4INAA 3DGEC 5DWVA 4HRVA 3N42B 2FX5A 3K0HA 1PNTA 4PHHA 5BN4A 4AJNA 2D1SA 1B15A 1OTXA 3FPHA 1O97C 3O1JC 5EGNA 1CKEA 4EB6B 1Q2UA 2R1VB 3N0WA 4YLGA 2RHOA 4DHWA 3F96A 3IPYA 3HDHA 1QYIA 3DDNA 4YAEA 3C3MA 4D9MA 1KI3A 4O2LA 1C0LA 2JLAA 5JMPA 2F3PA 2Q27A 1VHTA 3WYGA 4JDPA 1GTL1 3NTLA 2ZB4A 1R0WA 4YCCA 2VAWA 4UEWA 3NWPA 1MNAA 3PL1A 4ARZA 3DLAA 4G1BA 5LQSA 3NIBA 3OIFA 3EISA 2B34A 5TDHA 1O6GA 2IKSA 5G2OA 1RLIA 5KOIA 1Y6JA 5KOHB 1U2DC 2E2HA 2YFKA 4DMUB 1NKSA 3GIKA 3JVIA 3E7FA 3TW7A 4L0DA 3AR2A 3KOUA 5HNEA 1YDGA 2ZSUA 3A6HA 4PDBA 1I4OA 2AUTA 4X1YA 1N0UA 2EZ8A 1XWIA 1OYVA 3QKSB 5I7VA 3KHSA 5BWNA 5IVKA 1L5WA 1P0CA 1U2DA 1RJQA 4WFJA 2VDJA 1T2AA 2ISSD 5B2ZA 1X86B 3AHJA 1EXVA 4JJFA 1YTUA 3KBOA 3T12A 1ADBA 4GIBA 1QH1B 1LSUA 3D4IA 3FPAA 2CK3A 3ZCUA 3AJEA 1WMSA 3TI9A 3TG8A 2IPAB 3NEYA 1ZI9A 3F98A 2VJBA 1PDWA 5ALQA 3FYSA 4H4EA 1UZNA 3IUJA 4OP1A 4L5BA 2RGVA 1DXHA 3KG2A 5EIFA 4BBSG 5I9TA 4JXKA 4UHFA 1NBWB 4JU9A 3ZQJA 3AY0A 3MLBA 1S9DA 4FCWA 2QM8A 2WWYA 4BKOA 3N6RA 5ALSA 3LYAA 1W48A 3LC2O 4JBWA 1Y5MA 3OPYB 5ESDA 1H0SA 1TCUA 4AWAA 5BNTA 3SCZA 4JQOA 1YHNA 1K9SA 4JT2A 5I01A 4LGYA 3A6JA 1MGOA 4X94A 1L4MA 5CFMA 1SC9A 3V3TA 1FFYA 1YFKA 4BJ5A 2C7GA 4QEKA 4E5UA 3QLVC 1IFXA 4CM4A 4F8EA 3VHXA 1X14A 5F7OA 2YWHA 5EXEA 1NBIA 1Z0JA 1QBKC 4DLAA 3TRJA 3CPEA 3W5UA 3G79A 3G0CA 3LY7A 4KR3A 1B1AA 5G3YA 1R0KA 4BGUA 1P9OA 4RGBA 4UKDA 3BA1A 5HGXA 2WTAA 3QLVA 3PF8A 4X20B 3MINB 1SOUA 3WG9A 1L4HA 3EIUA 1M2VB 4AICA 3HUDA 2Q4EA 3D6JA 1J5PA 4A3CG 4YPVA 1HE4A 4LNUB 3R74A 1YDFA 1KH2A 4FMCF 2QG4A 3H9EO 4IIVA 3CZRA 3L5OA 4ND6A 2OP0A 3HMQA 1T6NA 4ABTA 1PHPA 3DEYX 4WBSA 1F20A 2Q0XA 1Z33A 5BUQA 4KXNA 2NSLA 2J3JA 3W9SA 3H4VA 4FR5A 3G2PA 5JC1A 1HYGA 1MIOA 1P3DA 3DTGA 2AN4A 2W9CA 3DONA 1Y3BE 4ZO7A 1P4SA 4F56A 1Z56C 1PL7A 5JS6A 2VZ8A 5K2OA 1LI7A 3BK2A 3ROXA 2OZLB 1IHXA 3LUAA 2HJSA 3RPEA 2H0AA 3N2GA 2AXPA 4EPWA 1ZD8A 1OYWA 4FOLA 3BIJA 4EJFA 1I9CA 4P92A 5BUCA 5I9BA 4Y0AA 4DLSA 3CF2A 3TGWA 1H1LB 2Q2NA 221PA 2JLQA 5SZHB 2ZCVA 3VNRA 2FW0A 5JD5A 4RDCA 1CEEA 3E1SA 3Q7TA 2P0YA 2C07A 4DNOA 5JADA 4UAGA 3GGDA 5TQVA 2ZYTX 1Z5NA 1Y8QA 1JECA 3Q2OA 2NTYC 4JAVC 3WV5A 3LGAA 3I2IA 5KTRA 3PUHA 4PAMA 4UNIA 3KHLA 1SKMA 5EVCA 5JR3A 4OFWA 1EVEA 3FB1A 2O8FB 2BFPA 2KM1A 1E1QD 2P41A 1O6ZA 3E35A 4KPFC 4YV2A 1EM8B 3FMOB 1QTRA 2VAXA 3KQNA 2R1TA 1CQPA 4MYUA 5BSRA 2G09A 4LQ4A 1HSZA 1NF9A 4RVDA 4RZUA 2JLUA 4Q16A 3HFSA 4M46A 4KXXA 2W00A 1XLUA 1I80A 4L57A 4TL8A 4RY0A 1JT2A 1BX3A 1KFCB 3MWGA 3HRHA 1Z9BA 4A0FA 3BGDA 4IW3B 2ZRDA 4EHFA 4AX4A 1D0VA 3LBHA 1CUWA 3QX3A 5G0TA 5JUMA 3D4BA 3GRRA 5HM6A 4W5OA 3FNHA 1DAIA 2ZBDA 1E92A 5CA1F 3W78A 3RK0A 2QD3A 4JEMA 1T9GS 3FSGA 4NOLA 4XSHA 1C7IA 5FUWA 3VNUA 2UYGA 1PZGA 5FBKA 2CNQA 3MSXA 4AJ2A 1C7EA 3F9RA 1B16A 3G9ZA 2WYIA 3V4SA 2H2DA 3OZSA 3DWGA 3QEAZ 1K7SN 2HFKA 1QDUA 4QYTA 5CFQA 5J58A 4ZQFA 5D6OA 1NQVA 3VXKA 4PXSA 5T3UA 4DKXA 1W96A 3BIFA 2H3EA 2IYAA 2Q3MA 2FQQA 2QX6A 1FFBA 3O4GA 5E6UB 1XZJA 3V7FA 3C1UA 1FRVA 4IIDA 4RNNA 5ALOA 1A82A 1RAHA 2D7CA 4J3NA 4JBGA 2FB9A 1F2TA 4G23A 4N7MA 5KEIA 3WFZA 4EPRA 4WX2B 2YNMA 4MA4A 3CJTA 3OM0A 5ALNA 5A6SA 1R64A 3GUUA 4GXRA 5I5VA 2YINC 3JRNA 1J2YA 2XWJI 5ENVA 3QFTA 1F0YA 3KLBA 4HZUB 2NO4A 3DFKA 2IYOA 2HLPA 1W25A 3GLTA 3RYFA 3K0FA 2EZ4A 5I7WA 5KNDD 5TMBA 2PKYX 5EE3A 1HDZA 4XWKA 1W5FA 2IS6A 2ZJ2A 3AGPA 1QRUA 1Q92A 3AQIA 1K3FA 3WB2A 4MR7A 4BFYA 4XVQA 5JC8A 4FT2A 3PITA 2H2AA 1W52X 5A06A 3W8FA 3VMMA 1UM9A 2OGTA 4QYIA 4BKPA 4GMDA 2NQTA 2ZSJA 4MJ3A 1MB2A 4ZYLA 3ZZMA 4CKEB 1Y7IA 1QH9A 4XCQA 3AR5A 1Q7RA 2Y1DA 3LO5A 2RB4A 3OIVA 2IZ6A 2COUA 1BX0A 4U6SA 2C00A 2CSUA 1FTYA 4FYXA 4CMKA 2OECA 4RLQA 1F0PA 2Z95A 2O54A 2WWTA 3NBQA 1TZ2A 4WZAB 2VL7A 5L7YA 2YVQA 1PWXA 1TJPB 1QQBA 4E3ZA 2OWOA 3RC2A 2XYQA 3G7NA 3DZKA 3ZGZA 1G21A 4RMGA 5IDQA 2JLXA 4NYJQ 4DQVA 1KKUA 2QV7A 3CZPA 3BD8A 3A4IA 3WLJA 3EYWA 1X7YB 2XUQA 2I6XA 1U4OA 1XEXA 2GN9A 4ZQCB 5I5EA 1FP4A 4GZLA 3A4LA 4IEFB 5AK0A 4F5DA 3WAKA 1O8BA 2WM9B 2QJTA 2QUIA 2GS9A 1M6NA 1WMFA 3OC6A 4MQUA 3GJXC 1KJWA 5AM3A 3DOEA 3WRVA 4QG7A 1ADYA 1EA5A 1GAQA 1ISPA 1YU9A 1PZXA 1D4OA 5SY9A 3ULKA 3DDWA 1XPUA 2EKZA 3OIWA 3O8OA 1JG3A 2FMTA 1PWHA 4EM6A 1PZFA 1ZETA 1JGTA 1M34E 4PVDA 4EELA 1CQWA 1T9ZA 3T3IA 2X8AA 1ZMTA 3HVJA 4MV7A 3WBJA 3AYZB 3QJGA 3A9TA 1QVZA 3WP1B 4GVXA 2YN4A 4ZVSA 4G5SA 4PEVA 2CY0A 3MA0A 1Z2DA 2NYRA 3KB8A 1IBKH 1U1DA 2GBFA 2MSKA 7GPBA 2H2GA 3OHPA 3QKRB 1XE3A 1N9GB 5IMBA 3AVYA 2M05A 4RVNA 4OQLA 4I46A 2XZPA 4P3NA 3CEHA 3RVMA 3TG2A 2XIGA 1QOPB 4PZZA 1Z8HA 4IDPA 3S2UA 4JJ4A 1RP7A 1V7QA 3UWDA 3TLGA 3GP3A 1NHGA 1LSOA 1LUAA 3OEHA 3LHKA 5IKMA 1H2RS 2FRXA 4KO2S 1GCAA 4RBNA 3ROGA 3E9QA 4KOAA 1F1BA 4G0XA 4MPDA 3RBAA 4U7WA 3D1LA 5LL6b 2YHAA 4CM1A 1XD9A 1XTSA 2WMOB 3V9PA 4ALMA 1W75A 5DK4A 4B73A 4WK0B 1NW5A 1V71A 3KL4A 2G80A 2P2CA 2IHYA 2V4QA 4NYMR 4BTVA 2CB9A 4LRQA 4Y2HA 4LF7H 4Z4FA 1FBNA 4LMAA 2V3WA 4MYTA 1E5QA 1A1VA 3M33A 5EEGA 1Y82A 2F9MA 2GETA 3RANA 2WHEA 3RB4A 1Y5NA 1KP9A 2XA2A 4DKJA 3KR9A 4IILA 4HL6A 1CUEA 1B26A 5HP4A 3PDUA 4JL8A 4UCUA 4DBZA 1JDUA 4DDHA 5EQDA 5AUOB 3ZC3A 5BV2P 4US0R 1SUWA 4XGIA 3EF1A 1N0VC 2KBFA 1JHQA 4RB2C 4ER3A 3EPIA 4LGCA 3ANXA 3EA5A 1QK3A 4EBEA 3PNVA 1UWKA 2C2OA 1VJ5A 1J7KA 1WPRA 4QICA 2Z4SA 4YEDA 3OJWA 1V9LA 3ET4A 4HXYA 2PRZA 4GL4A 5G40A 3TLAA 2IS4A 1O0CA 2WZDA 2XGOA 1OXTA 2NUTA 3Q7RA 4J1TA 4YMVA 2JGDA 4FR2A 5DDIP 2Y6VA 5IM4F 5GJBA 2FX2A 3LIIA 5IFKA 2ZI9A 3KZVA 4XJVA 2OWDA 4ZAZA 1R74A 4W6QA 3WJ1A 3HOWG 2ZZKA 1L5OA 3SMVA 1HNXB 4DR6B 4BO8A 3OCWA 1ICEA 1XXHB 2ECOA 4CMJA 3NI2A 4GMKA 4DE5A 3K3VA 4LFAB 1PNRA 4I55F 1XTTA 2D1FA 3TMKA 4NONA 1K3UB 1QNLA 3P9CA 1Z5ZA 3EOBI 1KK1A 3FDZB 3KJGA 3IT0A 4FGRA 3GLGE 3E82A 4AY5A 4F3NA 5EJ5A 3TY8A 3MUNA 3MD0A 2VBCA 3R7BA 2JEGA 2X4IA 2XWBF 1Z12A 4I9HA 3QTBA 4CUJA 1DAEA 3LBIA 1JG1A 1WCYA 4QUBA 4LRXA 1OBVA 4UD2A 3A2KA 4LWQA 1ONSA 4YRDA 2QDKA 3IJRA 3K9LA 3BX1A 1RHJA 4ER7A 5CD1A 3DWFA 1U90A 3OQIB 4D42A 4MV6A 3AF3A 4EW1A 1WMAA 4ERNA 5AXCA 3NIWA 4E4YA 1SEIA 4F60A 2AQHA 2C5HA 1F2DA 3VZPA 4CEIA 2DJIA 3AZOA 1VE7A 3DBOB 1P2TA 2PHZA 5AW8A 5KYTA 2ZUCA 4ZDIA 1P73A 1RBZA 3BXEA 4ZU3A 1R8YA 2B1IA 3DPUA 1ZHOA 1A9OA 3A31A 1E69A 4IFBA 3L0IB 4C6SA 1PS0A 4JGBA 2P6OA 2WSYB 1LJUA 2IV3A 3IUYA 4LX0A 3NNNA 1M1NB 3SHWA 1FF9A 2VA3A 2DLCX 3ZDCA 1XRQA 2BZSA 2CQYA 3N2NA 5BWXA 2ZUEA 1U28A 1N8SA 1ZK0A 3IR5A 2DSTA 1E58A 4F4DA 3M6MD 2HRDA 2IUYA 2CNDA 1DTWA 3RVJA 3TTSA 4ZPXA 1DX6A 1EEHA 2XSZA 4XB2A 4K05A 2PFGA 2ZU6A 3KYCA 3BIWA 1KFKB 3MAJA 2WJ6A 3EDCA 3KOZA 2VRBA 5JPCA 3RSLA 2ODNA 3JALA 3FNIA 5LQKA 3SBOA 5T6MA 5ITZA 4B9AA 3R6GA 1ZVKA 2ZRLA 1UBLS 5AOAA 1KI2A 4OIMA 4GM0A 4HGNA 4CT0A 3M9XA 4U2FA 2FPWA 2C29D 4EYQA 3L8FA 1CE8A 2Q7DA 2BEVB 3CT6A 4F12A 3R0QA 4R8LA 4TXNA 5JQGA 3NAZA 3DOCA 2CHUA 1JPVA 1LPPA 2P2ZA 4PN3A 2XWQA 2JFXA 2CSXA 1COWD 4CQNA 3QXCA 4Q7LA 3ABQB 1V1RA 3ZCSA 1KI6A 3NO4A 4M54A 2QL9A 2C3UA 5HPYB 3NHZA 4PYOA 1NG9A 3HO1A 3CKKA 1R50A 3JQ7B 4OHVA 1JFFA 2HF7A 3S7ZA 3R5JA 3B6MA 4DNFA 2W6QA 4QGFA 5BN3B 5T41A 4MSUA 4GI2A 4M0FA 3WXBA 4P4TA 4W7IA 1VIAA 4RV9A 4ECSA 5F77A 3IVAA 2WJGA 4TTIA 2V6BA 4UM9B 2WHXA 2WWHA 4CBVA 2X9LA 4MWCA 4QIWE 2W5UA 3M83A 5KNBD 2ZLBA 5LFAA 4D9JA 2F43B 3E9MA 2GWRA 1H8HA 3D8HA 4QGAA 3S2FA 4XPIA 5GZ6A 3EMDA 4A10A 2VDUE 2W2TA 4BU1A 5B6PA 1TT5A 5CUQA 1RQGA 2HO5A 1BDMA 3Q98A 4TQSA 4WT7A 3EZGA 3RREA 2J6HA 2BM1A 1MGPA 4UATA 2AJBA 5FEMA 2I2XB 2AL7A 2PCJA 3E9CA 4I81A 2IODA 2E1RA 2C97A 4NPAA 2BV3A 2X6QA 3ZYZA 1BEUB 4ZCLA 3GJYA 3PFIA 1CF2O 3NKLA 3QYPA 1SUDA 4B6GA 1M6VA 2WFAA 3ITEA 4LQLA 3H86A 3SK0A 5C9ZA 3ZVKA 1KKLA 4XZ3A 5J5VA 4EX7A 3ROZA 2GB4A 1EFCA 5LU9A 2C5BA 5AT1A 1MV8A 1X2BA 4M2LA 4A1OA 3F71A 2G4LA 3BH7A 4LEIA 5DU2A 2AZXA 1NMQA 3BQ2A 2ZUSA 5A4JA 4LDZA 3ODGA 4YC7A 5DW0A 3DZBA 4Z4HA 3V4LA 4P35A 2BL4A 4TKLA 2CJPA 5AI9A 1TU4A 3G7UA 3DKRA 5JAQA 4QOHA 4L51A 1EVQA 2CL6X 1EDOA 4Q37A 2XUFA 3SR0A 2VTKA 1M34A 2AF3C 1YULA 1CBUA 2FRDC 3NC0C 1EUDA 1Z6TA 4QHTA 4TT8A 2VUTA 4KDCA 3UMFA 4BP8A 1YVUA 3P2OA 2I1VB 4IIUA 1EFPA 3M4IA 3L04A 3KAKA 2JAOA 5LBIA 2P9ZA 4NQZA 3VNBA 3WWIA 4EFDA 1IJEA 2C57A 3VU9B 3M6UA 1J70A 2HJHA 5F9FA 5KFDA 1OR8A 4ALIA 3QW2A 1C0KA 4EEKA 5L4LA 3SDZA 4MW0A 2ZYAA 3UKDA 5JSHA 2FOLA 1J2UA 5IJWA 2JJYA 2RF4A 4HC4A 3F0TA 5EKSA 4R7ZA 4YRRA 2I2WA 5LOVB 4JBLA 2ZI3A 3K6KA 1L5NA 1YR8A 2F90A 4WXMA 5K3OA 1VSTA 3SLRA 1R8JA 3DBHB 5LA6B 3PC8A 4YCAA 4UXIA 5KUTA 4QRIA 3TRKA 2CV0A 5K3AA 2FFAA 2A5JA 1MUUA 4OLAA 1M2EA 4WV3A 3VNNA 3KB2A 4H1TA 2OV1A 2Q62A 3ICPA 3BH6A 5IARA 2PXHA 3K8OE 1U8YA 5TPWB 5HKKD 5E38A 4DV7B 5HR5A 1OLUB 3I37X 1GDDA 2IF2A 2W0SA 3X1MA 4FXPA 3UGQA 2J31A 1U9IC 4RKEA 2R2AA 3NETA 1LDYA 4V0KA 3KEMA 2X5OA 3JWPA 5EXTA 4WBNB 4CR6A 4L4YA 1FDOA 2CJWA 2BR4A 3VYRB 3ZLJA 2QX4A 2CL7X 5GJCA 5TGZA 2YHUA 3PGA1 1TKCA 3OFNA 4KFUA 2DLDA 4DSAA 3OU7A 1R9NA 3IE0A 4IXNA 4GP7A 2GZSA 4JR1A 5BMVB 4JXZA 2ZUBA 3VTZA 1I32A 2FN8A 2LDXA 5G3ZA 3QP9A 4Q4HB 2UUOA 1BNCA 4HQLA 3VR6D 4DS3A 1G3IA 2CVHA 2Z2XA 1V4BA 1N7IA 3WMFA 3SJZA 2O3QA 1OD6A 2FI1A 1UJ4A 1V41E 4EOGA 4YP5A 4U2GA 5K6TA 3KKQA 1WZEA 2OGUA 5HFAA 2HLDA 2D62A 1LGYA 4GFDA 3EVEA 2Z56A 3VGPA 3T5JA 4R8VA 3JSNA 2XUHA 3E27A 2BEKA 3GLGA 1XF9A 2FPUA 4GF5A 1DWPA 3PC4A 1M54A 5B7NA 2F64A 3D8RA 3TK1A 2VK1A 5BQOA 1GCUA 3OIDA 2HWWA 2IVFA 2GZ2A 3KBBA 3GQVA 1N9ZA 4Z7OB 2DXIA 4CG3A 4LAFA 2GCNA 5K4GA 1I1OA 3O4FA 4PWQA 1Q44A 4JY7A 2VZ9A 1OFUA 4FVTA 5M04A 2C1XA 1QC5B 1VQ1A 4BDTA 4RNCA 4LYDA 5FJIA 2PMCA 1HDGO 3PR2B 1QZZA 3ETNA 2XMQA 1YS4A 3KVRA 2HADA 4Q1BA 1CCWA 4FSXA 4G4SO 3ZHUA 2Z6AA 3PRHA 4ESOA 2DH6A 2XY4A 4MUXA 3QELA 3BWVA 4IH1A 4JENA 3RWOA 1HDRA 2PZFA 4NDAA 2JFNA 4YR3A 3ZY3A 4J6EA 3LT4A 1M8JA 5JDIC 1TT7A 4Z3OA 3QZ8A 1IQRA 2HHFB 1JFVA 1MRZA 4LSMA 3GGPA 1GFIA 4CM7A 2I6TA 1GPAA 1L7DA 4IMRA 4F4WA 4A82A 1IG3A 1TZKA 4U3JB 1IU9A 4UBIA 5D2CA 3JRXA 1Z2NX 3N75A 3ONFA 4UOQA 1XIVA 1PG5A 5ADHA 3DEFA 2PRIA 4DV1B 3PWZA 2FOIA 5JDIA 1ARZA 2CUZA 4M1QA 4BVHA 5DCLA 1S9FA 3JASB 1T8PA 1P7VA 2VHEA 3RSZA 1DARA 4C7MA 1N3YA 2PBLA 2GAJA 2UXDB 1SM4A 4IRDA 4YJDA 3HYCA 1CR2A 3DZFA 3D2AA 4F11A 4UEOA 1RYFA 3IAHA 4RYDA 2JANA 2FE1A 2YZGA 4D97A 5KFYA 3ICVA 5AW4A 1TO6A 5JRJA 1RI3A 2JGJA 2D06A 3UJPA 3UWMA 4TWBA 5AW5A 4WOKA 2X2EA 4P98A 4Z6KA 3AUUA 4CN9A 1P8LA 3GILA 1NVFA 4ND3A 4QA9A 5CHYA 4LW8A 1WCMG 4LIPD 5KJCA 3SN6A 3FTEA 4HG2A 3P4XA 3F6PA 5DP1A 2HTFA 1NQWA 3MTEA 5TSDA 2VAMA 4KB5A 2B36A 4TYQA 1XSEA 4QULA 3IKTA 2VJLA 2QN6A 3TNDA 1BHSA 2JKYA 1RE0A 4UNRA 3FMAA 4QIWA 3DEJA 4WERA 2VPQA 1EBBA 1QANA 3RK1A 3BMXA 4P5EA 1SUCA 4YUZA 3X1WA 3I6YA 3WQSB 1STOA 2BHNA 2AYXA 3IE2A 4NCIA 1NIPA 2R751 4ARZB 1LNZA 2E82A 3R7DA 2WSMA 4OSOA 1LBEA 4K86A 2P67A 4G1MB 1LWOA 4LF6H 3N59A 4P4SA 2OHIA 1V37A 2NG1A 4AS1A 4H16A 5GIOE 1X2EA 4LHSA 5T3YA 2XT6A 4Y0NA 2O5RA 5AKGA 1FYVA 3HXPA 2FE3A 2DM6A 1YASA 4KW7A 2OXIA 3A3NA 1NW4A 4OLFA 1MHPA 3TN7A 3HN2A 4X1YB 3HRIA 1YRBA 5IYDG 3NBZB 2H2IA 3N74A 4UCRA 2V6IA 4IDHA 5EE5B 1U9ZA 1G38A 3GN2A 1QYVA 1HLFA 1ISIA 4ETMA 5EQTA 3LQYA 2Q1TA 2IBTA 1DC4A 1TZCA 2JGKA 3RC1A 1YOVA 4WFQA 3RC7A 4EITA 1N92A 3MQFA 2JHFA 5KCMA 1CKNA 2FN3A 5LN1A 3U1TA 1I7QB 3AUJB 4HSEA 4WGFA 3CXUA 4ZYWA 2PD4A 3BD6A 1UBKS 3KR0A 4LOHA 1BGWA 1O5OA 1NZDA 4FKMA 4D9GA 3V6LA 1EESA 3CLTD 4URYR 1QB8A 5DYWA 3DLCA 4X41A 1VBGA 1QFZA 2W6ID 5CYFA 2EC5A 1U3WA 1U4SA 2YRFA 4UDXX 3NV9A 3L7MA 3ROQA 2XLBA 3GC6A 3CQZA 3CLUC 3HR4A 4OAPA 1KF0A 1EG2A 3AEKA 2TS1A 3A2LA 4PXAA 4BLTA 3NFYA 4FGJA 4AZ0A 3GYBA 4KI7A 2FGKA 4IF4A 1H2YA 2Z8YA 3HKDA 3SZGA 3M3HA 3J7TA 4EUEA 1OGJA 2H11A 1ZK3A 4L8YA 1PP4A 2X7JA 3TIIA 3F6RA 1IB6A 2Y05A 1BWRA 3BQ9A 4BV3A 4N3BA 4Z86A 1M67A 1RYMA 2FAXA 1RYRA 3Q6NA 1YGYA 3LZ6A 4CM4B 1WOMA 4X1OA 3VHXB 3NHWA 4IOMA 3AGQA 1G8YA 1GUBA 2J3MA 3AKEA 1Q1GA 1IBLB 1ULTA 1H0HA 3JD0A 4JJZA 1FVHA 2OCAA 3NHUA 5C8XA 1XMOB 3W77A 1JSXA 3M3PA 4QQFA 1NNUA 2HSZA 3QH4A 1JW9B 3ZV7A 4FZRA 4UNQA 4FS8A 4D74A 3ZJ4A 5KYKA 3PX3A 5LZ9A 4XVRA 1L4YA 3WWCA 4MUAA 4YR2A 3DPIA 3NHJA 4PFQA 1WBDA 1CR1A 3UJDA 3IT1A 1EG7A 4M1YA 1M6EX 3TQFA 2XCPA 4ZMSA 3AHFA 1Y3FE 4GC7A 3WLNA 2E48A 2OHHA 4QGSA 1BW9A 1DC6A 3HY6A 5IAKA 1FZTA 2ZZNA 3A9VA 2BHSA 1RR6A 3N0RA 1A1SA 5F33A 5IFLA 1FRNA 4MQLA 1YRLA 3OZIA 3KKOA 2AGQA 4YIKA 4LJ5A 3RS3A 1MIOB 1YO6A 5D85A 4D3ZA 5H70A 1EUCA 4QDJA 5BV1A 3TW6A 5H82A 1UDBA 4JBNA 1E96A 1IN6A 2HMYB 1ZC4A 1YHYA 4MYRA 3OO1A 3I32A 3N2GB 4WVLA 4DSUA 1ZM9A 3GGOA 5JALA 1F12A 2EZ9A 1Z5OA 2OYCA 4JB2A 2PLNA 1EVYA 2R6GA 3RHSA 4CMFA 2C2YA 2OLSA 2I7XA 2BMFA 1JQ3A 1D6MA 4ZI7A 5LP6A 1N1EA 2DHQA 4A27A 1PVOA 2CMKA 4F8JA 3QPCA 1RKXA 1Q21A 1G19A 3GB8B 3OLXA 1Y8QB 3YASA 5CX1A 5DBIA 2JD2A 3NH9A 4ZZ1A 2QDXA 1TYBE 4QUKA 5JSUA 2RK3A 1GFSA 2MSEB 3SGLA 1ZI6A 3PVCA 3LL7A 1KJJA 1F9EA 2R1TB 3W4JA 3WSVA 3F4LA 4DWWA 3R9XA 4DT1A 1E7MA 4ZEOA 4CMDA 3DO6A 1EK2A 4BC1A 3G6XA 4KRGA 4CJXA 2XCSB 3ZI4A 1VCIA 1QMGA 3DGFC 3VNQA 2RH8A 1JFRA 3GP5A 1QTNA 4XB1A 3QVVA 1Y8ZA 4ILEA 2O6LA 2F6RA 1E9FA 1DIHA 2ZE5A 3BE8A 1PRYA 3DYBA 4W7SA 2HK7A 5KOYA 4B4DA 5FTMA 4WY8A 1CX9B 1O8CA 1VJTA 1JQJC 3U6KA 1PJTA 1XR3A 5FIUA 4Z3DA 4F50A 2PQMA 3U5TA 4HN4B 3KHUA 3I2YX 2E4YA 2PVSA 5K0JA 1Z0AA 2II6A 3SIWA 4C3OB 4MAAA 4F5WA 2PLRA 3OMXA 1GILA 2D2XA 1TYEB 4BO2A 5AJWA 1NF3A 2XNDA 4LK3A 4PO1A 2E4AA 4E03A 5KFRA 1UJ5A 4MULA 3W5CA 2OWEA 2BCGY 3UFXA 4R2KA 1LXCA 1S3IA 3GDEA 1OIXA 1JN0A 5F4BA 1L7BA 4M99A 2Q5OA 3KXIA 5TB5A 1IY8A 1JVSA 4FLMA 4TRRA 4EBFA 3RS0A 4CLOA 2YV5A 3FFAA 2ODWA 2IYPA 3O4JA 3SQWA 2GQRA 2P1DA 4NNPA 4LJ4A 3QOFA 4I5IA 2BKEA 3BJIC 5EZYA 2MWMA 1Z16A 1USIA 3DEZA 3C4VA 1F2TB 2JFBA 1O94C 4GLLA 4PANA 3GBVA 1DIBA 2OBYA 1P9NA 4GE3A 4HH1A 3DVAB 5A6SB 2D5BA 3AFGA 1AM4D 4C21A 2GFHA 2C8LA 4Q02A 4TS9A 4D5GA 3J81k 4S0XA 2XEDA 3IBTA 3HE3A 3REGA 4H17A 1XNQB 2HGZA 3DC7A 4GBED 3HBAA 1DO8A 4RU1A 1O2DA 4JGGA 3PT5A 3AIIA 3BXGA 1FLDA 1G21E 3RYFB 3K0FB 4Q1EA 3ISTA 1KYIA 1ZFNA 1QP4A 3L1UA 4L28A 1GCIA 3E9ZA 4KQJA 4MR7B 2ZWOA 1TZJA 4FD2A 3CUVA 2UYCA 2AFRA 1UM9B 4QYIB 3UPDA 3FX2A 5ELXA 1QIEA 2H16A 2JKZA 1OX5A 5HUHA 4LMYA 2ACKA 3ZI0A 4YR7A 1Y4DE 3LDHA 5DBFA 3D7SA 3CZ5A 3EIHA 2M1XA 2RFLA 1MAHA 4DCNA 1ULUA 8LDHA 1RKQA 3I9FA 5CNKA 3MR2A 3A4VA 4TKZA 4LDRA 3AB7A 2K5UA 1KI4A 1JZQA 1AJEA 1BYIA 4Q7KA 2AI3A 1NRWA 3WLTA 2WY2D 1BDIA 2JAQA 3NAGA 3VR4D 1UXJA 1JHDA 4RE5A 1XEXB 3PXAA 5FADA 1FP4B 1H5NA 3TZ6A 4HI0E 3HWRA 4DDUA 5EMJA 4A3KG 4LF8B 1BJTA 3GA7A 3Q85A 4GX2A 2N47A 5LMUB 2GAOA 3PICA 4IZ6A 1V35A 1CZNA 1C9DB 5C0OE 1N8NA 2NM0A 1DZIA 1RC1A 4RO0A 4BBAA 4C7VA 2Q2TA 4L8WB 3NIGB 3O8OB 1LLUA 2QGNA 4KVFA 5HE8A 4RVSA 1CNEA 5D3MA 3DHVA 5BYAA 1WO8A 4PG8A 4NOKA 2PUCA 4LK2A 2R97A 5LDGA 3HO6A 5AM5A 4YT8A 4EB0A 1NQ5A 2B21A 3GGGA 5EWEA 1ONOA 3OZVA 3FN4A 5FLXW 4M0LA 1WD5A 1S5PA 8ATCA 2VA2A 3CVZA 3RS2A 3W6PA 4L6IA 4L0QA 2I7TA 4QBTA 3K70B 2CNOA 3JPWA 2LCFA 4NFHA 1ID1A 4NG4A 4GDFA 1TXGA 4C08A 4BL5A 2AR7A 4UNSA 2QVZX 5DM2A 3ZVMA 1IRIA 3D31A 2IYEA 5EJ9A 2Q4TA 3CRQA 3TLGB 5FL7A 2DULA 3G5AA 3MT8A 1E0DA 5JSFA 3A4YA 1XMQH 3JYHA 1R18A 2Y4RA 4AYTA 1SZDA 2QN3A 5DYIA 5EQJB 2DCUA 3IAS6 1CUCA 4HADA 3AVVA 1HTWA 3LUDA 2JIOA 4DN6A 1BMFD 1I5RA 3IC5A 4IG9A 3KVYA 1QRDA 1ONBA 1R15A 1HKUA 5HFNA 1N5IA 1X8JA 3NYWA 1P5RA 1AA9A 3QOWA 2VAPA 1UADA 1PQ4A 3UJ7A 1Y33E 2G28A 4OMUA 4EF4A 5IT0A 1C7RA 1ZH8A 4CKWA 2CXNA 3DH0A 1E79A 1YB5A 1II0A 3HZOA 1MO3A 3H11B 1H8ED 1GKYA 2J4CA 1YB4A 3WGMA 5HS6A 3LKDA 2CE7A 5EUMA 2DBQA 4Y8VA 2GEUA 1QAQA 3QZUA 5IXSA 5KU7A 1OCEA 1Z2EA 3N05A 3ZXUB 1KFBB 1FY2A 4GKVA 5KFZA 3DWEX 4UAJA 1EXMA 2PLAA 4IDCA 1L9KA