2IP4A

Crystal structure of glycinamide ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
MKVLVVGSGGREHALLWKAAQSPRVKRLYAAPGNAGMEALAELVPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVPVVVKDSGLAAGKGVTVAFDLHQAKQAVANILNRAEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVAPYPMDEATLRRVEEEILGPLVRGLRAEGVVYRGVVYAGLMLTREGPKVLEFNARFGDPEAQALLPLLENDLVELALRVAEGRLAGTRLSWKEGAAACVVLAAPGYPESPRKGIPLHVPEPPEGVLVFHAGTRREGGRLVSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylamine--glycine ligase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 108
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2006-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ip4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ip4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ip4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ip4A04
3HO8A 1DV1A 2W6QA 3ETHA 1EZ1A 2YZNA 1C3OA 4C5AA 2GQSA 3R9RA 3U55A 3VA7A 2R6FA 3NUAA 2CNVA 4M9CA 3N8DA 2I87A 4O7NA 5CA1F 3Q1KA 1W93A 4M98A 4ZHQF 3BSSA 3AX6A 1GSAA 1DV2A 3DF7A 1JDEA 5IYZF 2ZDQA 5BPHA 4TV8F 2NU8B 2R7MA 2HJWA 1I7NA 4WD3A 3BG5A 4FFPA 2NUAB 2WYOA 3AW8A 2YS7A 4MV8A 2GLTA 4O86A 2DLNA 3R5HA 1KBLA 1KJQA 2Z04A 1JDBB 1CQJB 3SE7A 2NU6B 2R7NA 2ZDHA 1KJ9A 4EGJA 2Z02A 3VOTA 1VBGA 1GLVA 5C8YF 1UC8A 1T36A 3GIDA 1SCUB 4O7RA 1VKZA 3UFXB 1Z2NX 4E4TA 3GLKA 2YW2A 4O2AF 2NU9B 1I7LA 2YRWA 5JQWA 2C00A 3JZFA 3R5FA 4EAAA 3HBLA 2W6NA 4DLKA 2YYAA 4O7SA 5CA0F 5C1PA 5LYJF 2GPWA 1BNCA 2YZGA 5H80A 3ORQA 1KEEA 1EHIA 4MA0A 3U9SA 2FP4B 4O7ZA 5BPFA 4MV4A 2V58A 3TW6A 4O7YA 1CQIB 2R86A 1JKJB 2W6PA 1M0WA 2YWVA 2YL2A 1PK8A 1KUTA 3U9TA 1W96A 5JVDF 1Z2OX 4I4TF 4FFOA 1KJ8A 4EA7A 4I55F 4MAMA 4MV1A 3U54A 4XX0B 2YS6A 2VHEA 2W70A 4O7TA 3MWEA 4RZQA 4XZ3B 3WNZA 5K2MA 2GPSA 4YB8B 3OUZA 2YZMA 3LWBA 5KKNB 2XCLA 2HGSA 4C5CA 4FFNA 4FFRA 2VR1A 2I80A 5BMVF 2X0SA 3VMMA 2CNQA 2CQYA 2IP4A 3K5IA 1AUVA 4O82A 2PBZA 4YAJB 3MJFA 5FNVF 4EGQA 1PX2A 4YAKB 4FGRA 1OBDA 3E5NA 4MV9A 1CE8A 1Z2PX 4O81A 4C5BA 1EYZA 2FPGB 4EA8A 5LP6F 4ME6A 4HQ6A 3QFFA 2W6MA 2ZDGA 4XYLB 5JH7F 2QF7A 2GQRA 4YBZB 1AUXA 5JQGF 2YRXA 4O7LA 3OUUA 2R84A 4IHJF 3TIIA 1GGOA 5LOVF 5HV6A 4EG0A 2V59A 4O2BF 1UC9A 4HNVA 3TINA 2QK4A 2V5AA 3RV4A 2W6OA 2W6ZA 2NU7B 2W71A 5C1OA 3VPBA 3R23A 2PVPA 2P0AA 4HNUA 3N6RA 2OLSA 3ORRA 2YZLA 4MV7A 3KALA 4M99A 1A48A 2FB9A 2R7KA 4FE2A 4O84A 3KAKA 4FU0A 3VPDA 4ZI7F 3G8DA 2CZGA 3JRXA 4NYEA 4IIJF 3V4SA 1WR2A 1DIKA 4IWXA 2NPOA 5LA6F 5JVLA 1CS0A 4FFLA 4YJ3F 2CNUA 3KAJA 3ETJA 4FFMA 5DMXA 3R5XA 3HB9A 2DZDA 1M6VA 4MV3A 4O4IF 4TUYF 4O4LF 1EUDB 2R82A 4YJ2F 4WBNF 3BFPA 5CAEB 1M0TA 1JLLB 3K3PA 4O4JF 2XD4A 1BXRA 5KX5F 1E4EA 1EUCB 5CB4F 1GSHA 4GGMX 4MA5A 3JRWA 4XYMB 2I8CA 4ZOLF 1E4EB 4HNTA 2DIKA 3TIGA 1KJIA 2PN1A 4L1KA 5J2UF 2VPQA 2J9GA 3JZIA 3KREA 4TV9F 5I47A 2FPIB 3Q2OA 4HR7A 4M9UA 5HBRB 3BSYA 5EZYF 3G8CA 3I12A 3RFCA 4Y8VB 4J6EA 1KC7A 4O4HF 4EABA 2R7LA 2VQDA 4QSHA 4O7VA 5D8DA 3MWDA 1B6RA 4MV6A 3K5HA 1B6SA 1VBHA 1C30A 2DWCA 3BSWA 1IOWA 4IZOA 4IWYA 2R87A 4O7WA 1OBGA 1GSOA 2FPPB 4I50F 3TQTA 5LXTF 1ULZA 1A9XA 5GONF 3RV3A 4O83A 2SCUB 4ZQIA 4DIMA 4EA9A 1IOVA 1KJJA 3V4ZA 3RUPA 3WO1A 3WO0A 3VPCA 3LP8A 5J2TF 2R85A
chains in the Genus database with same CATH superfamily
1HG1A 5MDHA 3TY9A 3NVMB 4NU5A 1EWVA 1GNLA 3CEBA 2IY9A 2GEBA 2CNVA 1CY7A 5C37A 2GDZA 1YH3A 1YAHA 2HW8A 3W3AH 5JI2E 1EFLA 1UMDB 1RDFA 2OZEA 3A2KA 4BGIA 1RYFA 3FPFA 3TW0A 5FPOA 4W5WA 1NG9A 5KCMA 4EO7A 1XJCA 1UODA 1RJ9A 4OGFA 2H9IA 5FWAA 3ZWWA 4NBNA 2CXSA 4PINA 1V16A 5DNEA 5TE9A 4GKJH 3UVEA 3WLPA 3MS4A 5HF5A 1MEOA 1OHHA 4Z7OB 4M53A 4EUEA 3RK1A 4S1OA 1V7ZA 1FVOA 1NXTA 4HPJB 3EGXB 1Z0KA 4PBSA 3JAKA 5ALTA 2WV9A 2ZM5A 4E32A 4JV5B 3DVSX 1PDOA 1RI3A 3MCVA 2WEKA 3WWPA 1NF2A 4IJVA 3PHIA 3WNCA 2YZGA 2E5LH 1BS1A 3ZHUA 3IOBA 3OZFA 4DG8A 4NI5A 2C0QA 4KWTA 5IANA 5ENVA 2X6TA 5KYTA 2RE8A 4NBWA 2EP8A 5CVCA 3CY6A 3KETA 1V8OA 7AT1A 4AZ3B 3BJYA 3TQQA 4KU4A 2GM3A 1VMAA 3SJBA 1TO6A 3PHCA 2X0IA 4TZ6A 4B3SB 1GNSA 4M87A 4KSCA 2PLNA 1S0UA 1R6XA 3DKRA 5AFSA 2FUG1 1JQ5A 4CF7A 1U0LA 4F4YA 1K88A 3NVKI 1SZCA 4OIFA 1K75A 1N6RA 5J4YA 2CXQA 3A10A 3G2KA 4HH1A 4FP9A 4JITA 3PPYA 2WSLA 3ZHTA 3QU4A 1QPGA 4ND4A 4JDUA 4MPTA 3OBIA 4FNMA 2B1RA 1PG2A 3DTVD 3BICA 3JAWA 1IUPA 4ZT6A 3ISJA 3FNEA 2X1LA 2XB4A 5MGBA 4K0RA 4P4NA 4ZVQA 4URHA 1P75A 1OLUB 2V0NA 3WMFA 1L3IA 4AJEA 4DIBA 3IT0A 2AFHE 3K1TA 4RENA 3RYIB 5FD5A 2QMYA 1QDEA 1XDGA 2VCHA 5LIPA 2AJDA 4NF2A 4DLSA 4GL2A 4TTJA 2EJUA 4H60A 2RGRA 3SFVA 3RYHB 5EESA 3CF2A 5A6VA 2Z57A 1A9YA 2IHVA 3V7UA 1DXOA 3PXEA 4JUAA 4CI9A 3GZ4A 4Y1EA 2MMCA 4XD7A 5K3FB 1QTIA 3B9PA 2ADOA 2W2PA 3PYMA 5IJZA 4N0QA 4BRSA 5EWFA 4DWVA 2YN4A 4LECA 5C32A 1KNXA 2WIJA 4X65B 4H1VA 2ZTHA 2P79A 3MSXA 3AFIA 1QO0D 1NUSA 1X9HA 1VJ0A 5KYXA 1J0AA 1MO3A 5K4GA 1IOLA 3QKRB 4ACAA 3VOAA 1PZXA 1OJ7A 3M5PA 5AK4A 4LRUA 4A3JG 5KFHA 3ZUPA 1A5TA 2IKSA 4Q1AA 3A1SA 1L5YA 2O3JA 2ZVJA 3EGDB 4F11A 3H1FA 4RK4A 3HZRA 3E61A 3U44A 1OBOA 4NC9A 5AKIA 2FMHA 5DLDA 5ECGC 1QKJA 1NW7A 2BVNA 4MCJA 3ZY5A 4G4GA 3AYHB 3DLPX 4G8JA 4DKJA 2FY8A 4X6LA 2GO1A 3ZZ1A 3N2GB 4YRRA 3AESA 5K0SA 5KT2A 3R2JA 4UBOA 1XFDA 4ZYZA 1FUEA 1E3WB 4YRKA 2ZVPX 4ZT2A 1R0SA 3LDHA 3ILSA 1LK5A 4AY5A 4AZ0A 5CHYA 3GNSA 3AHEA 3ITKA 1MRSA 1PNVA 1Z0SA 5GY7A 4DA4A 3RKUA 3A1EA 1WMBA 4RPLA 5KIAA 4ML3A 4ZVLA 1YZYA 2HK8A 1RBMA 5DHFA 2PGDA 5E4FA 1L0BA 4P92A 3Q0IA 1AN7A 2Z1DA 1G38A 5CGQB 3FW1A 2R4UA 2XOKA 2HJWA 2NVYA 3F5FA 2HA5A 1B0UA 2YWJA 3U2QA 3TH5A 1EU1A 1DB3A 2HJSA 1KQ3A 3ADBA 4CG1A 2IEYA 5IH3A 1D0VA 4GOND 2VO1A 2H07A 1U1DA 3VTKA 3SP1A 2R9VA 1X92A 2EKBA 3I01A 2JHAA 1YHYA 5LQJA 2ODPA 3BX1A 3U40A 2W2TA 1Y5IA 3PXAA 3WLJA 3U7QB 4UTXA 3TZLA 1B14A 3EAFA 5FLXA 1XMSA 4AZTA 2J6BA 1M0SA 3T94A 4DUGA 5BNTA 3JQCA 4L2IA 3N0WA 3ZHZA 3QY9A 4DR7B 3VZPA 1EK2A 4DV6H 1OWLA 2OBFA 3NIBA 1EJ2A 1HLDA 1MFZA 1O9GA 3TQHA 3RJ0A 1FYFA 1IJFA 3RD5A 4WK2B 4XM2A 5EJ4A 2X2PA 2Y6VA 1RQ2A 3BMXA 1F7VA 2XZPA 5CHEA 1I33A 5AM1A 5HIMA 1HC7A 4I1SA 3ASYA 2QYZA 4C4YA 5TF0A 3UXYA 3BA9A 4L50A 4HAYA 1NC1A 3VMMA 2CNQA 4MUJA 2IZ1A 1EIWA 1Y7HA 5FQOA 4QUDA 3TNYA 3S29A 4FZJA 2QXUA 2VHUA 3KQQA 2O8DB 1K9VF 5TRTA 2ORYA 3OZTA 4CKBA 3DVQX 4YDRA 1JMVA 3NX4A 4IOJA 2GLXA 5EJAA 1G5PA 2DRIA 2XMCA 4JBLA 4CMEC 3GPBA 4WLEA 5F9MA 1Z2DA 3V7NA 2ZUVA 3AEYA 1W5FA 2PT7A 5DH9A 3HRIA 4Y2HA 3E84A 3U80A 3D3NA 1IUKA 3DCYA 4V0ME 1NXPA 2R92G 1J0EA 4V03A 4X6YA 4BFZA 4WA7A 4ALNA 2H4JA 1Y7PA 5CT8A 3ZQ6A 3G7SA 1YRBA 4UCTA 1NI4A 1XQ9A 1CY6A 3LTNC 4TYQA 2HWYA 4QC2A 1OXSC 3SJ7A 2VTBB 3UICA 1QYCA 2J45A 1E2GA 5EHQA 4EPXA 1T8RA 1IAVA 4IZIA 2IS6A 4P5EA 4KOAA 1EXWA 2D0PB 4M0MA 3UCFA 4HO1X 2AF4C 2JFBA 3KFLA 4PQYA 3GELA 4G9BA 5IM5A 3ZJUA 2IHYA 1RYEA 4DLVA 4WZAB 2K4MA 3LX5A 3PD0A 5BOSA 1SOAA 1JIKA 1X9NA 3O8OA 1CUDA 1U7UA 1NY5A 4BB6A 2XSZA 2P6PA 3GFTA 2XCIA 4JQYA 1YZVA 5K7SA 3VYVA 4AJIA 1ZCZA 2BKLA 6LDHA 2PKXA 4BNLA 2Y1EA 4V0RA 3VH1A 2Z2ZA 1P7YA 5ALJA 1FUIA 2XI4A 1CFZA 4PSVA 2GTHA 2Y0PA 1P4AA 1HR0B 1QVRA 2O8FA 4KG7A 3TQRA 3UK1A 4KPEC 3K3VA 4HPXB 1CRQA 3AHHA 3OY7A 1LDBA 4Z1MD 1G5FA 1HX7A 4Y2JA 4MZXA 2XVYA 4ZKEA 3C8MA 4G5GA 3MQ2A 2ZAGA 3MHPA 4RD0A 1IXRC 2IW1A 1UOEA 4MKRA 3MWGA 1P9LA 4GT1A 5AKEA 3BGSA 2ASLA 3NLLA 3TIFA 5BWXA 4ZV9A 3CVJA 5KQRA 1T4CB 2BYTA 2FE4A 3QJGA 3SKYA 1UDBA 5ABPA 4ZYUA 3AR9A 2PLAA 2QPTA 4RNDB 2PGNA 3ENWA 2X0FA 4I55B 4MMZB 2WFAA 5HCIA 3RB3A 3BMCB 3I1IA 1B41A 4MW1A 1II0A 1Y42X 3THWB 3TL3A 4XLZA 4I4IA 4IILA 4G4JA 2P90A 2ID4A 1EBBA 3KQHA 1ZC4A 2WI8A 3NHYA 4IM7A 4EPRA 3HSYA 4A3SA 2FUNB 3IX7A 3ECAA 2DB3A 1E6WA 2GA9A 2I1LA 1GGEA 1I8TA 1NQWA 1NONA 1E3DA 4Q7LA 4GRAA 3CR8A 3VBCA 3VNQA 3LUDA 4JJFA 2C29D 1IBKB 3VAAA 4LQ4A 3H5LA 1CQJA 2E2HA 1I1KA 1FRNA 1EA5A 4EBDA 4Q82A 1V45E 4HLDA 2Q0SA 3C16C 3B8HA 4U63A 5IVKA 1SN7A 1C3LA 3U0VA 3C3KA 3IL2A 1KMCA 1FVIA 1QV7A 5EJFA 3UK2A 1P16A 2JLVA 2H5LA 3VHXB 4JDPA 2V5VA 3KTFA 3SYTA 2VUMG 2VH5R 3D7NA 4D9CA 3DSRA 1E2KA 3IT2A 3WG9A 1JL3A 3JVIA 1YC5A 3L07A 3N58A 4NCJA 3Q8WA 1XCPA 3AVUA 3FOAA 2AFHB 1WZIA 3E58A 2QYHA 2G6TA 4IDDA 2OB1A 1V8PA 5A3JA 5EE5B 4B87A 4HY3A 3WRYA 5KNCA 4C78A 3VVMA 1WDKA 3L77A 1E1KA 2NQTA 2PUJA 4U5XA 3SQLA 4LKRA 2FPRA 4GP6A 3S28A 3W6OA 1LI5A 3IE2A 5MFZA 1K8QA 4B31A 4B81A 3KQLA 1GRVA 2H1WA 4BVLA 2GYUA 2G9NA 3R7WB 2P9JA 1V4VA 1NIJA 4P80A 1QHHB 1M34E 2AXQA 3HDHA 1QKIA 1JH8A 2YJ4A 2QNBA 4X66B 5BWNA 1KK0A 5CPBA 1R6DA 3MLBA 3WLHA 2Y77A 2WICA 3BWDD 3OT1A 4LVUA 3ZK7A 3NKFA 2PRSA 2KSWA 3JQGA 1ZIDA 2BFDA 3TSWA 3NVAA 3KT0A 4UTNA 5BYBA 2PTGA 5EIBC 5I9MA 4DYVA 4XOUA 4BQSA 5AO9A 1UMCA 4Y6LA 1BGXT 4K6KA 2OAP1 3C7CB 3C4VA 4AG3A 3TTWA 1EHCA 4DXAA 3KWJA 2WJ3A 3LQKA 1PJCA 3EARA 1NW3A 2XUAA 5J2TB 1DTWA 1WTCA 3MOIA 4HB0A 2XCTB 1FJ2A 2BBSA 3OZEA 5CR9A 2B98A 2VQSA 3ELUA 3ZZUA 3KFXA 1P4GA 3PFGA 3K1JA 1N2XA 1A7AA 5HYVA 2YWHA 3LYHA 2IEGA 3A6JA 3OJWA 3L93A 5DXJA 3DXFA 1E2MA 5A06A 3OTOH 4KXNA 4G1VA 2O03A 2M9MA 1RLMA 2EJVA 3HDTA 4PLVA 2GM4A 3E9RA 3WMXA 3W1VA 4H27A 4HC4A 2GSWA 2GF2A 5C35A 3ZWOA 1CVLA 1VKOA 4TTPA 4XGQA 4YV7A 2X3YA 5ESWA 1RJGA 2JVJA 2ZJAA 2QOEA 5BSMA 2FPIB 5T4FA 5JW6A 2CV0A 3R3UA 3DKVA 1XU4A 4RB0A 1EUYA 5KNDA 2YWDA 4ECEA 2PKQO 1N56A 1L7OA 2VJMA 1I7DA 3TSCA 1C9YA 3A1UA 3ZEAA 1IHUA 1P18A 2R7LA 2PD3A 3WBBA 2JA7G 2NMVA 2DPYA 1EP9A 1ZK1A 1WXIA 3SF8A 1RJFA 2GXAA 1UXGA 4P0TA 3GB8B 4K87A 4N0PA 3VNUA 2HL6A 3JASB 2IUUA 4F12A 2EWWA 4OCZA 1N6IA 1LF5A 3P2MA 3Q5EA 1QFZA 2R1TB 2DCMA 3UJCA 4FZ3A 1TEZA 3PXBA 3WP1B 1UKVY 4M0PA 2GJ4A 3L79A 4ESHA 3DV9A 4KV7A 3FLMA 1LBQA 2A5JA 1EM8A 3N6VA 3SIPA 1Z5WA 4HH3C 2H5IA 3TEKA 5H3HA 1YBMA 3S2YA 3WK8A 5LSAA 4L07A 1YBVA 2HO4A 4JODA 4R8KA 2B5WA 1OXMA 4EWLA 2OY0A 4R1SA 1O77A 4PZ9A 4CCWA 3WC4A 1WXEA 2NU6A 1T1IA 5IMSA 2N9UA 2XUGA 1XQ1A 1X7XA 2XYRA 3LT2A 1GKUB 2UZ0A 2WHXA 3FNQA 4LOKA 1FSGA 2YHIA 4P53A 3NEYA 4NULA 2BFMA 4FUTA 3X0DA 5M5BA 3N7AA 4OIMA 4IXDA 4JP1A 5TEVA 4BE9A 3VDXA 3KQKA 2XAUA 3UJ7A 3IALA 2A9OA 4GECA 4YCCA 3TTYA 3DBHB 2W8LA 3UNXA 2VA2A 5ECWA 1T3LA 1SD1A 1K7SN 4KBYA 3CRRA 1RLTA 5B2ZA 5A1JA 1EGQA 1ZH4A 2EX1A 4MP8A 1H0RA 4JYCA 3BGOS 3TSYA 4UOEA 5SZIA 2JEIA 2V7GA 1D7AA 1C1XB 2IOYA 2QS9A 4FR2A 1FSZA 4ZQGA 1O6ZA 5BR4A 1RKQA 3QVWA 2ZSJA 4NFHA 1O8BA 1DAAA 3U0BA 5JHHB 3V33A 4TSKA 3KWFA 4RTRA 2E55A 4UTVA 5J1TB 4OHMA 4YK7A 4FNAA 1BHSA 3ZBPA 3JCZA 2PYIA 1ZH2A 1T10A 3I1JA 3J81k 5JS7A 1N8KA 3SICE 1VL0A 3BD8A 4NLGA 3AIMA 4EA8A 1R10A 4HQ6A 1KY2A 2YR0A 1L3BA 4X3CA 3PFKA 1ISJA 4M0CA 2GZDA 4BC0A 1FCJA 4F5YA 4U2DA 1CZRA 5DX0A 3E9EA 2QV0A 3QMWA 821PA 3GFPA 3V2HA 5FFFA 5CBKA 4Z4FA 3W4JA 5KSZA 4G1MB 1KWGA 4DCGA 2H7VA 3NZEA 4ZAVA 1TGVA 2MSKA 2R47A 4HJRA 4EUFA 2Z4TA 2WRZA 3AM1A 1O94C 3FYDA 1E2PA 1T9HA 4Q1EA 4FJ2A 2PMFA 4M1YA 1OU0A 3ZLUA 4J9RA 1B0ZA 3OI7A 3EYWA 5LR6A 3K92A 4CT0A 1QIIA 5DYTA 1XA3A 4H17A 2OBXA 4IQ8A 3WJ1A 4OM7A 4UVHA 5P21A 1JLLA 3GJRA 2R82A 3U4IA 3OG9A 3FRHA 3T3PB 2OEPA 2PD6A 1PBTA 1HKUA 3IBFA 3D1JA 1VSTA 1W76A 3B60A 4OHFA 2ZWMA 1JKFA 3ZDXB 4PAMA 3DDUA 5EDWA 4UASA 2ZK7A 4RFVA 3F90A 1NUUA 2GEKA 3RSHA 4HSEA 1HXHA 3K2EA 2M32A 2FZGA 3VR5H 4QE3A 2C96A 3T5DA 1JEAA 4IY1A 2C7QA 2EBFX 2BEWB 4EJSC 2YZ2A 2VDWB 1C1DB 2BSAA 5I9LA 1XZAA 4FXOA 4LYAA 4JP2A 2PSFA 4HN4B 2FZWA 4HEJA 4UTOA 2BBTA 5AW0A 4YQWA 2FZCA 3M6UA 3NATA 3MMSA 1JI0A 5DZSA 2Z6AA 5LLTA 4K0KH 3AG5A 1KETA 4TQRA 4BO8A 4RNNA 2J0QA 3BBPA 3LWZA 3D7KA 4F2PA 3UGJA 1ZZGA 4FEYA 1ULTA 2XCPA 3INYA 4EB3A 2EZ4A 3NAQA 2YCHA 1FTQA 3T15A 2BJWA 3DLHA 4MYCA 3FETA 4JU9A 2CLMB 1Y9EA 2NZ8A 2NYUA 3KYCB 1G8AA 2XH8A 4QSMA 1U02A 4RETA 4RTQA 1BN6A 3CYFA 1GR0A 3WHKA 4GNKA 1LZLA 1L5SA 4HTAA 2D2XA 3O8NA 4NONA 3TLGB 1WETA 3ZZMA 4EH1A 3DOOA 4F5EA 1MH9A 3O8BA 5D87A 1X7ZB 4DV5H 3CVZA 1I7NA 4QQRA 4EKYA 4X64B 4A3EG 3ZCRA 2GILA 3IBYA 3IQIX 3QU7A 4AKGA 1T43A 5HJ2A 2IXFA 2GN0A 2CJFA 3DKPA 1DKRA 4EKNB 2JK0A 3EDYA 2QSYA 4M0KA 2WYVA 2OV1A 4HGQA 4JJKA 1WULS 4NAVA 3TTSA 3KC2A 1M34B 3JY6A 4DA8A 1UL1X 4US2R 1U1EA 1PVOA 3B70A 1OYVA 3PXXA 2HQRA 1YOVA 5DHSA 4EUNA 2IPLA 2CUZA 4HF7A 3OSZA 3E3AA 3PRHA 4DL4A 1TVCA 1AD2A 1WHTA 4GXQA 4C08A 2QN6A 1ODIA 4JJAA 4JN6B 1KEEB 4DILA 3BRSA 2Q27A 1JS1X 2VEOA 4AG5A 2WK1A 3IB3A 3P19A 2ZS8A 3VYSB 1ORHA 2IBMA 2XQGA 4HMPA 2YS6A 2OFFA 4DLBA 1TIBA 4OHRA 4WNIA 3QUTA 4KGDA 4F5DA 3WFZA 3O1HB 3OUZA 4C4TA 1QUFA 1S4MA 1SD2A 4R41A 3ROFA 2QTMA 2I62A 2VPPA 5CFOA 3VTZA 2BFPA 2OGZA 4X1KB 3KJGA 2ASDA 3DEJA 3CZRA 3SGLA 1XALA 3BPSA 2DFDA 5LIRA 4MS1A 1PT5A 4N5IX 4YRMA 4LF6H 1E6UA 1TYCA 2VDRB 3AI7A 2AT1A 3LS2A 2A7QA 5AW2A 1LXCA 1SR8A 2O2XA 1NUTA 3F2VA 4YV0A 4M4SA 5DTJA 2UXDH 4EJFA 2FR8A 3EIUA 2W11A 1PZMA 3GIMA 4AO6A 4RDXA 2P5YA 4JI3H 1D2CA 1F2UA 3OLWA 4PC1A 2WWWA 4F7WA 2HDNB 4BMDA 4RUAA 1E2LA 4MB2A 1BIFA 2JA6A 2G5GX 5JEDA 1EDBA 3LSTA 2H7YA 5CYFA 2B7LA 4P86A 3AL2A 3WHPA 2VQ3A 4K6CA 1DNPA 1ADJA 3PEEA 1L4KA 5EVJA 1ML4A 4OL0A 5JAPA 3DDHA 2Q2UA 3K4QA 2O6HA 1TA4A 5EKXA 3L82B 4Y6OA 1N6LA 4JEMA 1X2EA 5KOIA 1DAHA 1Z9BA 3IG0A 3PJFA 2BLNA 2QMHA 3COWA 4AS2A 3I3OA 4C4PA 2HCBA 3HUTA 1G4HA 1GFSA 5KYVA 2REBA 4C22A 5JDIA 2UU9B 1AZSC 3DWEX 4G4SP 3PTLA 3L1IA 4UDYX 3MHTA 1T2CA 4RDCA 3IP7A 5JMPA 1TE2A 2PZAA 4HAUA 3MGAA 2EIHA 4BFWA 4GKAA 3CZ4A 4X54A 1L8LA 4ZCIA 4FYJA 4DFDA 2Z9CA 2DCUA 2QX6A 4QEKA 3ZCQA 2PEZA 1RVDA 4FHGA 4B45A 3MJCA 1UXJA 3GEMA 2CW8A 3RTEA 4H9GA 1DQRA 4ND7A 2B1QA 3H40A 3E05A 2YHUA 4W1RA 2P5TB 5KJEA 2H92A 1J2JA 1M7BA 2RSLA 1FYDA 2VYNA 1R6BX 4YHHB 3EEYA 3LRPA 3NYRA 4HVTA 3EH1A 1G8PA 1MZBA 2RCNA 3CZAA 1E4YA 3QWIA 1VJTA 4AMGA 2VRCA 4J4HA 5JAUA 4QPZA 3DKKA 1S97A 5FL3A 5EP2A 2O9JA 2A9VA 1KK3A 1CUWA 5JRDS 4RANA 4E7OA 2V65A 1U8EA 4WLVA 1N2SA 3AY7A 4M3NA 1G20A 3GPLA 3G0GA 3O8CA 5FBLB 1BMFD 2Q49A 4ZIRA 3L7MA 3R5HA 2JI4A 4YXWD 1PR9A 2CLDX 2WSBA 1V47A 3ETLA 2IIPA 3KQSA 2PE5A 5B4UA 1FLDA 3OSPA 1T36A 3G0DA 4LCJA 4AZWA 3NEPX 1QC5A 3DB1A 4B8YA 1JSCA 3QVGB 2W6NA 3B1VA 3CRMA 2BUAA 3EXEA 1XP5A 5HQ3A 3FCXA 2GRJA 4UAVA 4Q4HB 4KRGA 4LWZA 3GTMA 1JIIA 3IP1A 5KFWA 1KGDA 4HXYA 3RADC 3U4QA 3W5AA 1IXSB 2OM2A 2WZDA 1Q1QA 2NV2B 4OHPA 2J7KA 1M6NA 4RK7A 4L3OA 2JARA 2G76A 1TM1E 3MWEA 1QKKA 4WZBA 4LJYA 1OX4B 3D3EA 3QW2A 4DJDC 2W2KA 3RDPA 2JFWA 4IO0A 3F3SA 2WF8A 2HGSA 3MWFA 4OQNA 1X19A 3GILA 4KE9A 3ZV5A 1PS0A 3MUEA 4ZC1A 1OA1A 4O82A 1IY1A 2R1UA 2WBLC 1K5HA 1WZUA 4H3HB 2V4UA 4KE7A 5DQGA 2BFAA 5E95A 3M7IA 1LS1A 3GCGA 1FLAA 1CY1A 4IJ5A 1Z4KA 2JKZA 5KBYA 1T5BA 2XDQB 1BS2A 1PHRA 3LGSA 1VLJA 3L0CA 3MAJA 1KKLA 2NPFA 1PS8A 5FTLA 3S8YA 1GGOA 1K6EA 3DEKA 4BP8A 5DHUA 2DE0X 2ACVA 3W2IA 3Q3EA 1ZMRA 3L8CA 3IPAA 3EYYA 1HYHA 2G63A 2F4NA 2RH9B 2NV0A 5T41A 4HL6A 2VXYA 1NW5A 4GKVA 3UFBA 3BJZA 4MQMA 1JB1A 1DC3A 3U3OA 5AW8A 2I78A 1F0NA 3OE5A 4QJBA 2B3TA 2QM0A 1QYRA 4G01B 2EATA 4H7JA 3VPDA 2OOKA 3SZ3A 2H51A 3JRXA 2Z5LA 4TYMA 2NT4A 3BEOA 5K1ZA 4TV8A 5FBVB 1BX1A 5JSQA 1H2FA 1YFLA 1J22A 3SX0A 4UDXX 4NCIA 3ZY2A 2BMEA 2C5BA 3C3MA 3IESA 4AROA 3V6HA 2VP5A 1YTLA 1ZH6A 2X3FA 4WJKB 5EXEA 4W5OA 5H02A 1FNCA 3ICVA 1OXKB 4GI3A 1X1BA 3DO6A 4BTLA 1QYWA 4DA0A 3OQMA 5FPKA 2XT9A 3I6MA 3JZIA 4JLAA 1T2UA 3TJRA 1XMIA 2YJGA 3TRKA 1KDZA 3GUVA 3LZ6A 4I5EA 1R3DA 1QQBA 3U19A 5L4SA 4DLLA 4A1OA 5LYJB 1VBFA 4UBNA 3IAM1 4AMUA 2ZOSA 5HX7A 3VMFA 5LLDA 5I7AA 4LPKA 3W4KA 4G67A 1WEHA 5KKAA 2BDTA 1KO1A 5KWSA 4KXVA 4C9BA 4ZJPA 2WB4A 2YVLA 3IAAA 4KKXB 3P0FA 2GJ9A 5ES4B 2QP9X 3L2OB 3HU1A 3QV2A 4U2BA 3RNOA 3E9DA 2VSYA 2P5UA 4EI9A 4F3CA 4LFAH 2BHLA 2R6ZA 1WD5A 2YJ6A 1LQ2A 2JLXA 3GEPA 5COBA 1VL5A 3L8HA 2A57A 1NRJB 5H4HA 1PWYE 3I4CA 4UHEA 1O1YA 3RG2A 1PJ4A 4MQ6A 3WLTA 1QX3A 2OCXA 3NT5A 3ZR4B 3I1YA 4CC6A 1T3HA 2UVDA 1A8PA 3CUTA 5CNJA 3U17A 4OQEA 4AJ4A 4B6OA 5IYDG 2VCEA 4R01A 1JQEA 1NJ1A 4LJKA 3W05A 4B3RH 4LXHA 1R3UA 5EKSA 4DREA 1Z6ZA 2H6EA 1BH2A 3VKUA 2I6FA 3SC4A 3T3IA 4KHPH 4G07A 1V39A 2O52A 4M9QA 4RJJA 1B0AA 1EG7A 1T2AA 3BMQB 3K35A 5KYYA 3A32A 3BWYA 3GCWA 1EFDN 2AE2A 5D2CA 1J2TA 1PUIA 2PX0A 2Z95A 4X20A 5KAMA 2C35B 4A0QA 4Z1OA 4EYIB 4XX1A 1LVUA 4UJ5A 4W99A 5LMCA 1FFCA 1TQ4A 3KLBA 3JPYA 4ZVOA 1GG5A 3NW9A 4XARA 3B3FA 1PZFA 1NM5C 1AXGA 1CETA 2WHYA 4YJ2A 1FDSA 4KIJA 4UOQA 2I5PO 3ELBA 3NP7A 2RH5A 2VSFA 3L7YA 4UPVA 3BXHA 3PSAA 1P80A 4LXQA 2Q3LA 4C1BA 1P5FA 4YRZA 3JQRA 3OIYA 1YJAA 2UYYA 2WIBA 4LC1A 3SHFA 2RAFA 4QDXA 5JCJA 2GPYA 1CKNA 4E94A 4WLNA 2C42A 2GO7A 2QTBA 1P62B 1WUKS 4YN3A 4Z99A 4Y0AA 1VI2A 1ZUNB 2JL1A 4LS3A 4KMSA 4UE2A 4QJIA 3MTBA 4B34A 4I4CA 1UZAA 1XPRA 3I8SA 2AVNA 2O1SA 4M8SA 1NNI1 5FLMG 4Y9RA 3PBKA 1G6Q1 2JD2A 3DEZA 1JXLA 4LJLA 1ZDMA 4NBUA 4JOBA 4TGLA 3I9V1 4BGUA 5LKRA 3EVFA 5CYOA 1EWRA 4D3ZA 4BEVA 4XJXA 5EVCA 4A0SA 1QLHA 1XRNA 3RYFA 4C0BA 2Q0XA 3FTEA 3ZE8A 3TW4A 1XD2A 2W6OA 5CXSA 3S2FA 3PN1A 3BL6A 1SXJD 3AY6A 2Y71A 4HNUA 4YX9A 3IR5A 2PUBA 3DBRB 5B7QA 1V37A 1FLVA 1PP4A 2QRHA 4MKZA 1MOQA 4PC7A 2Z2KA 3TW7A 3BCSA 3HJAA 4G5XA 4ETIA 4RA9B 5GM2A 4B8WA 4QJ3A 3V8VA 1YJ8A 4YJ3F 3A1DA 2ABWA 2FOIA 4BFSA 1JZTA 3DVLA 3H4TA 3JD4A 3STXA 1K2VN 2XYVA 2WZCA 3GWGA 2WT4A 4PLTA 4DC1A 5A9SB 4BUJA 5CLQA 3LCJA 1KSFX 3KM0A 3VR4H 1YRWA 2HXGA 4GPEA 1ZWKA 4DRYA 3CXUA 5KOHB 1Z3CA 3SC6A 5FLEX 1G21E 3AJRA 1R6AA 4M22A 3OKFA 1V96A 2UUBB 2REOA 3NNDA 3AFGA 4GXRA 2ZSAA 5C18A 2XDWA 1KI3A 2EOAA 2WM8A 2VP9A 1Y3BE 5DGXA 2ZI7A 4FB4A 4YAWA 3DLBA 4EKGA 3ABQB 5KFTA 5CA0B 1E7SA 1BYUA 3OZUA 3UO8B 4R8SA 2ZB8A 4GHWA 3Q11A 2IJGX 1SVIA 3TL6A 1IBLB 3I04A 3M4XA 1WUYA 3IXQA 3CW8X 3NI2A 3EHEA 2PS0A 4CM4A 4GPBA 1HI9A 1GSOA 3D6MA 5KFVA 1C30B 1G8YA 3UWDA 4OXKA 3B82A 3GU3A 1UBLS 1TTQB 4LV8B 4JUIA 1XZDA 3HCOA 2CDBA 2CK3D 1A9XB 3WO1A 2UXCB 4M8LA 4RMIA 1K1SA 1JG7A 1WCMA 3E5RA 4KQEA 5LWQA 1DIAA 2GQSA 5LLSA 4NJEA 1ZL0A 4EQ6A 4OGGA 1XNJA 2GBGA 1MW8X 1KE1A 4Z9AA 2EW2A 1SCIA 3WLQA 1H22A 3FMGA 1NVAA 1SPBS 2WT9A 5COQA 2OKCA 5LP6A 4UCSA 1RJQA 3OEHD 3HBFA 3DZIA 1BJTA 4N3BA 1NX9A 1GQOA 2VNIA 2GH1A 5SZKB 5AI4A 1UQUA 4LXXA 2XZTA 1YDMA 2PSDA 5HUQA 1APBA 3F96A 1A0OA 1SB9A 4URYR 4BNTA 2VF4X 4UVDA 2RAVA 3TZEA 4NNJA 3EPHA 1PR3A 1Y4SA 2NU9A 3HN6A 3GP5A 1JIHA 2QUHA 4BXXG 2BFBB 3IODA 4LK3A 5KTPA 1UBGA 4GPIB 2P78A 3IDZA 3QPBA 4HBZA 4UQPA 3IPRA 2J46A 1K08A 3NWJA 2TMKA 3VKFA 5LXTB 4DANA 1MQSA 1EIZA 3LXXA 1HTBA 4OEHA 1XZFA 3IAEA 4NMWA 4LYEA 3RVSA 3L0ZA 1RYMA 3M6AA 1JR6A 4F2WA 4IZHA 2P27A 2V6GA 2VJKA 1J2EA 5JVDF 3N74A 3GFGA 3AFNA 4QGAA 3PNOA 2FF7A 3HGMA 5IWAB 1H9AA 1QLWA 1I2AA 2O3QA 3SWWA 5C34B 3VR6A 3H3JA 3QMPA 4JCCA 1QRSA 2H0RA 3LUCA 4WFJA 1XVLA 4O25A 4LF8B 3LIIA 2VXOA 2XMGA 5ELMA 3HL4A 4RKYA 2W8BA 3UT6A 4DGSA 2E4AA 4X00A 1GYRA 2UZ1B 9GPBA 1PV2A 1B1CA 1GU7A 2C28A 3MJFA 5CP8A 3T7JA 2I9KA 3MWLA 2QTLA 4K9RA 2XF2A 1E9BA 1XTVA 3VKGA 3B9RA 4MVJG 2C2KA 3NGDA 3BXGA 3HVIA 2PX2A 2OYCA 3LC1O 5ELLA 3N0TA 2XWPA 3R9XA 3P9KA 3GAFA 1E63A 4L8WB 3TIIA 1CUBA 1TM3E 3I2GA 4DV4B 2YJZA 2K6GA 3PD7A 1CT9A 1FRFS 2F55A 3TLKA 3I4FA 1WP4A 3FWHA 1XEFA 4LW8A 1YU9A 4ZVKA 1D2AA 3Q10A 1XQXA 4JBHA 4UU7A 4S2UA 1CJMA 5G4LA 3V8MA 1HPLA 2FEOA 5KYKA 5FTKA 621PA 5EMNA 2ONCA 2COUA 4RHEA 3AOEA 1EFUA 4HNAB 4LRTB 4QICA 5AVYA 4RPJA 2ID7A 2A0FA 4TKVB 2DKOA 2PX6A 4ECYA 2C2OA 2QEQA 2X7XA 1GQYA 4EGFA 4TPKA 3GFRA 3RYTC 1RQNA 4UTRA 5A7HA 3ADCA 2DQ4A 1EE2A 4BMPB 4WV3A 2UVPB 3M6MD 3QXCA 3OOYA 1TU3A 1U6KA 3BFKA 4PXSA 1H1LA 4YNBA 1SRRA 3VSDA 4M83A 4WK6A 2Y0SE 1RQLA 3AUAA 4ZOBA 1QFMA 3WR5A 1UQTA 3NH9A 4MUFA 4MWGA 2BKXA 4OJNA 1KFKB 2ZVQX 5KVCA 2HLDD 3O3OB 3MJEA 4MKFA 3R7DA 1C1HA 2O2EA 2J3KA 3BSWA 4A3KG 3PWSA 4ZO8A 1WU7A 1IRIA 5GZ6A 2PH7A 3DLCA 1GPYA 3STVA 2QROA 2GWRA 3AHJA 5FFNA 4Z3DA 2WJ6A 1ZUIA 4D8YA 4A36A 3LP8A 1PZHA 4RTPA 3TQOA 3CO5A 4FS3A 2DPXA 3QUQA 2W6QA 1SOWA 5JO9A 3T1HH 4G0YA 2VT6A 5IP5A 1NASA 4YPFA 3KYDA 5IS2A 1N33B 3K70C 4YMGA 3TD2A 1YRHA 3P2IA 3DLIA 1SFRA 2X9VA 4QNMA 4R2KA 4UHHA 1YONA 1KEWA 1J9EA 2VJLA 1N8NA 2PAFA 5UKDA 3ZVNA 2JFZA 1TO2E 4DEVA 1IIBA 3V4LA 3K5WA 4O8CA 2ACWA 4ARSA 4CLRA 3S44A 2C58A 3G2HA 1R7RA 3R7FA 3SQXA 1C4KA 4ED3A 1T6ZA 4B1FA 4JVOA 2WU4A 4HCJA 1OI4A 2QX7A 3HA7A 5I5WA 4CIYA 2XVAA 1QH1B 5M3BA 2CVQA 2VT3A 3GLKA 5BN5A 4XKJA 3GTJA 2CLLB 4EAAA 4EG8A 4WEOA 4DLKA 1BC5A 3SE0A 3E3MA 4D3FA 2LP4Y 3IMEA 4CU2A 3EOBI 1C8VB 1ZIOA 3EPKA 2BFEB 1KXJA 2A30A 1ZGCA 4ZYLA 4U02A 5CVUA 4JEUA 2C2GA 2QRVB 4OKIA 3DE4X 3WIVA 5C5EA 4O4LB 3HP1A 4MW7A 4RF4A 1U2DA 1AGRA 2XGSA 5KTKA 3OX4A 2CFSA 2AYXA 3RABA 1X1CA 4TTSA 1D3AA 1PEKE 5ALEA 4DJFC 3C3XA 3OPMA 1MAAA 4BB9A 4CV3A 4DR6B 1JSXA 1ZKDA 4K2HA 3SG0A 1E2NA 2FJPA 3OZBA 1JHRA 5IBQA 1J06A 4NCXA 3HKEA 1A9PA 4KNWA 4OP2A 1PQ4A 3AF6A 3TOXA 3MR6A 3GQBA 1EYZA 1YHNA 1XDNA 3AIOA 3IUMA 1G21B 2D06A 1D8TA 4HNSA 4CG3A 3RSGA 3GEBA 2YRXA 1DWPA 1XDBA 2D7JA 2HSWA 2Q4DA 1W36C 3VSEA 2IU3A 4FFVA 4YECA 3TEMA 2JCSA 3EMDA 2F6RA 1I2MA 1NVUQ 3CWQA 3OWHA 5IW8A 3RWMB 1Y3FE 1SBCA 1RWQA 3NIGB 4MVJF 3HNPA 3H05A 2DT8A 1IYZA 1CUHA 4OOFA 1SG6A 2O7SA 1JBQA 5IJ0A 4LRWA 5FOTA 1WQ4A 2B7BA 1JHYA 3U02A 5HCUA 4IF4A 5JJ5A 1ECLA 2ZT6A 4U7JA 4H6XA 4QUHA 2ZSBA 5D84A 2HK9A 4GKBA 1IUOA 3ND6A 1N57A 2PWBA 3N2IA 3BFPA 2WAMA 2V3CC 3O0DA 2WKRA 3V32A 5I7SA 3FFTA 3V4PB 4G41A 2W2XA 4OUKX 1NVMB 1PR4A 1Q1ZA 5JRZA 3DHVA 3AVVA 1JRLA 5JV5A 2BZ0A 5LKAA 4O2AA 2H1IA 2OZLB 3OLZA 1TTHA 9LDTA 3OFND 5IVPA 1OBCA 4TL9A 3WGMA 5AVWA 2CLOB 1JLRA 1QF7A 5I47A 4FHFA 2VXBA 5K9ZA 2XQJA 3THSA 3FPHA 4O33A 1LS6A 4LNUA 5IF9A 2GKGA 4KO4S 3OZWA 4HYQA 1RRVA 1Y33E 3CRNA 2VP4A 1W1IA 4KQ9A 1S4QA 3KQNA 2PA3A 4HEA1 3H5OA 1G64A 3NJ8A 4MWDA 2IW3A 3V8EA 1VGQA 3DMRA 4AX4A 5AW3A 2QTTA 2O3SA 2ALJA 4ECUA 3LUJA 5FAXA 3RFTA 5I8WA 1V8BA 5ICSA 2JGEA 1JW9B 1VA4A 4UC0A 4CQMD 3NUQA 3SZRA 1Y6GA 3KKEA 5DU2A 3L4JA 3HJGA 3K09A 1XF9A 1GILA 5CH3A 1H5QA 5KHAA 3GY0A 2WE6A 2TMGA 4REOA 4IP0A 1GQQA 3ZH9B 4C6TA 3K9GA 3B7PA 1GUZA 3DTFA 1BHO1 3C4QA 5JAHA 4V1CA 2X8JB 1GTL1 4LYJA 2C2RA 1KP2A 1AKRA 1JX6A 4XB2A 1T35A 3TI9A 5BVGB 1VG0B 1Z4QA 2YFQA 1NJ6A 4LYGA 3KUUA 3OLVA 3L6EA 2GLTA 4O0LA 4LGCA 1JQBA 2B63G 2G5TA 1VJRA 3IQFA 2C7PA 4GRIA 2FRVA 4GW3A 5DAAA 5DLGA 1GTMA 2IWHA 3R5FA 3M33A 4F6CA 5EJEA 2WJHA 4QPCA 4GICA 2ZB2A 2JEZA 3OKPA 3OU6A 1TPZA 5LA6A 5AK0A 3ABZA 1H93A 1JVNA 3WGUA 5B3JA 3UWPA 5JANA 4NXMH 4M8IA 3FDZA 2QLNA 1S3FA 4O4IA 4MV4A 5ED4A 2XRZA 1NP7A 1WZCA 3OQIA 5HILA 5DM0A 1TAEA 1WS6A 3FH0A 1PK8A 4CWAA 5IK2A 3IXMA 4AIIA 1SHTX 5HW0A 4FHDA 3UIEA 4I66A 1H6BA 3W7AA 3JALA 4FTWA 4XX0B 1IN1A 1M3SA 4JYBA 2I2BA 1HE8B 1LZKA 4NBKA 3QX7A 3PW0A 2YN0A 4GVXA 4ZVMA 3ZU2A 2QLFA 4V38A 4L15A 2VPXA 4DDHA 2C5FA 3E9MA 2FQQA 2ZATA 1CUJA 2WUFA 2VRWA 1WUHS 3WAKA 4V0OA 5AK6A 1EUQA 1EFKA 2WHQA 4NX2A 1UDWA 3T41A 1WIWA 4DL3A 2FRXA 3FMFA 2HPHA 2D5CA 3CBGA 2MSNA 4PHTA 5DN6A 4QG3A 3UJNA 2ZYHA 1U5AA 4I50A 4Q4JB 1UXOA 3IAHA 3B1FA 4HVLA 1D2RA 3Q3IA 5DHQA 4O2BF 5BN3B 1VJCA 5D7BA 3N53A 1Q91A 8LDHA 4JBWA 2OV2A 3BB4A 5HHTA 3WZ2A 1GQFA 2PWZA 3ER9A 3TGLA 4YMVA 4EPYA 3BMNA 4C29A 2HADA 3AVQA 2GD2A 5BNZA 4L75A 1AKTA 2GA8A 2WYIA 4IGAA 5C8ZA 2CSUA 1XXHA 1KFJB 5GJVC 1M2OB 3VHRA 1ZXXA 1YKGA 5EXSA 4M9RA 4BWVA 4ZOEA 4BN0A 3I3SR 3EC1A 3TBFA 4LV5B 1FTSA 1JHAA 4NCHA 3QOXA 1NF3A 1QWOA 1L5MA 1SKYE 3L7AA 1KEVA 2ST1A 4YAIA 2ZPAA 5J58A 4BNDB 4FYIA 2C82A 1CP3A 2J09A 2WABA 2BEVB 3STWA 1E5LA 5IXYA 1JXAA 3N5KA 5BV7A 4AKIA 2HVRA 4IDBA 3KCNA 2DFNA 1MAUA 5AIBA 2QG6A 1LJ8A 3K0AA 4Y7CA 1YA8A 3OAAD 2CNWA 3H4IA 4HJXA 2GJKA 3QM1A 3DV2A 3VI4B 3CZ5A 1VP9A 5IKPA 3ROGA 5TJHA 3V5NA 4ECTA 2PMZA 4RVGA 1SKMA 4MQFA 1KP3A 1G8JA 1G9XA 2PZ8A 2HRRA 5IT9A 3ONDA 3MAAC 3CNQS 5B58C 4QDOA 1CG6A 4QJ4A 2WOOA 1VHJA 5GONF 1IONA 3UTDA 3P0RA 1ZK0A 4DJEC 1ULUA 4AN1A 2Y93A 3H42B 2UDPA 1ADCA 5D3ZA 1Q7TA 5FWXA 2ZJ5A 2Q3DA 1Y4UA 2B3DA 4MO9A 1V5EA 1JG4A 2IZ7A 4KIGA 1L7XA 2QTVA 2XYGA 4ZAYA 3W7BA 2VJCA 4MQ4A 1JHQA 4F06A 5IAGA 2B35A 3QIVA 1YB1A 5FAKA 1KBOA 1CDOA 3J81W 4LE1A 5KTRA 3VTAA 4KJZA 3VNNA 4M1SA 2QZPA 5E6RB 1DO0A 3RHZA 1POWA 1WBDA 2X7JA 3WIOA 3QOYA 4G4IA 4K28A 4LEIA 5EERA 2R0QC 3JZMA 4V2UA 2E2IA 1XRSB 1HT3A 3L01A 3JATB 4PG7A 4U1RA 2H06A 4B71A 4E4TA 4NXNH 2BZ1A 3DBOB 1D4FA 1K7CA 1UM8A 1DRJA 3JZFA 3RK0A 5I5YA 3CCBA 3DD5A 1H2HA 2XWQA 1UWVA 3G79A 3JQPA 1Z08A 2GM5A 5GAJA 4J75A 2LCIA 4HRXA 2EGGA 2ORVA 4E4YA 3WKBA 4HLQB 1Q0SA 3N8HA 3P2OA 3GBPA 1USUA 4MS3B 3A2NA 3V3TA 2X8WA 1MB0A 3D6TB 5GADl 2FPKA 2SNIE 3VOBA 2D0DA 5K6TA 2VI5A 1QIKA 1AS3A 5IRCD 1EX9A 5FYDA 1NE2A 3HK2A 4PM4A 3WRWA 1GT91 1M2NA 3HY6A 3OJFA 4RFSA 4Z53A 2FWMX 3DW3X 3JWIA 1WPXA 1QIJA 3CVWA 4GZ6A 1KE2A 3TAHA 3BRCA 3H1PA 2P1RA 2XV1A 3PQCA 4Y6RA 1K8RA 4LMBA 4W6ZA 5KFFA 1QJ4A 1KVTA 2DMRA 1DC5A 3QFFA 3DONA 3WWHA 4OUDA 2QSZA 1QZ3A 4TXHA 1M1ZA 2CY0A 3FFAA 4DNXA 3H3XA 3D0OA 1FFEA 4CEHA 3A31A 4XIGS 4XDHA 2C8LA 3NHSA 3S8EA 1JLMA 1S2GA 3EHDA 1T6NA 2H85A 2VBIA 1XHLA 1Q92A 3DYVA 4PPNA 4EEKA 4O5OA 3ZCTA 1N77A 10MHA 1U0BB 4RVFA 3KAPA 3F6PA 5I48A 3MMPA 1E6MA 2AMYA 3MQFA 4F3TA 3CLRD 5F77A 1YNSA 4UBMA 1ZU5A 1QO9A 1WR2A 1GNVA 5FPQA 3ZWKA 5DPMA 3RSSA 4MW0A 5LQNA 2I3AA 1P7ZA 5AVQA 3W9UA 2I6GA 1OB2A 2QMOA 3SSMA 2C2HA 1K5GA 1PW7A 4IJWA 2CT8A 3QWAA 3D9QX 2JCGA 4KNVA 1YJ5A 4L9AA 3EWAA 5L9AA 3PTZA 1ZU4A 3ZXXA 1C8BA 1E4EA 3LTEA 4M60A 2X5NA 1JIUA 1R0YA 4EY4A 4WKBA 1PL7A 4D9FA 1KYXA 3LYAA 2E9SA 1TCAA 3NV7A 3K6SA 2XZDA 4WZZA 3INRA 5C8DA 5DBOA 3RFCA 4OYRA 1IYDA 1J1IA 2F48A 3KTDA 3SX2A 2GCGA 3SI7A 1RCTE 7MDHA 4EABA 2FE1A 4MQBA 1UOOA 3H11B 2WUDA 3D3KA 5CLHA 5KT3A 2C04A 3AO0B 1SQ0A 4FFBB 2QUIA 2VQEH 1JG3A 2R65A 3NHJA 2HI0A 3AUFA 1RMYA 2AXEA 5E8RA 4BZQA 3WL6A 3K15A 4YY3B 1JKIA 1SVMA 1KR5A 2QW8A 5LUBA 1EZ4A 2ENWA 2WJPA 3LE8A 4II3A 3WIUA 1B43A 1MDFA 2ZZMA 3WWYA 4NWIA 1OH6A 3ETHA 1P8AA 2JH3A 2XR1A 4WCFB 1R8XA 4J94A 3AF4A 2IEDA 1C3OB 1I50A 3ASUA 1ULSA 4GNRA 1ISRA 3BXOA 3BDVA 5C0OE 1N9GB 2P2CA 4LXIA 4YAUA 3FD8A 4D6PA 4A2BA 1SUBA 2JAQA 1TWHA 4CF4A 5FOXA 3FMAA 3I42A 2XEXA 4TWIA 2ZSHA 3LIPA 5LDGA 4RJTA 2HAEA 4IEIA 2QL5A 4FFPA 3GD5A 4B3CA 3NHKA 4E15A 1RQ7A 1ZH8A 3NUZA 4PZPA 5FEUA 3Q2IA 1JEYA 1FIUA 1ZW6A 2DAAA 1Q0UA 1O2DA 1LTKA 2WSSA 5L4LA 2JA8G 1QFXA 2V4ZA 3T7EA 1SRQA 4PYNA 2FJ0A 4IIJA 4WECA 4BQQA 4RF5A 1WX1A 5L1JA 3OOHA 4K26A 2OMEA 1NQOA 4DSNA 1SEIA 3TBKA 1RRKA 3PNPA 4FGKA 3GLIE 2ZIAA 1LWOA 2H52A 1W73A 5J40A 1UM9B 2C2WA 4WLOA 1C0IA 2LE0A 4XEUA 4F9TA 5EC8A 4D3SA 1DQNA 4IR1A 1DO2A 5A3SA 3EIWA 4A2CA 3DV0B 5AVVA 4ZOLA 3VVCA 5DK6A 4QWBA 1T8PA 4DVJA 4QG7A 3M81A 1Z5VA 5BW6B 3BL8A 3BMOA 3D4LA 1JFTA 4L6CA 4W1PA 3F46A 4UDNA 3I2IA 2PO5A 5HFNA 1MO4A 1VPEA 4ED1A 1US8A 2F9FA 3W04A 3WKAA 3A25A 3ANNA 3KR2A 1ONPA 4NCNA 2DUUA 2OCAA 4NL4H 1DAMA 4YAKB 2LNDA 3JARB 4DMKA 1SKYB 2O3RA 3CUUA 1EWYA 2IDJA 4U7DA 1XNGA 3VR3D 1IZYA 2DBRA 1UAYA 5IULC 2Y2VA 2ZZKA 1T2EA 2IHZA 2O7RA 3NTVA 2RGDA 3IE1A 1KMHA 1NI5A 4AF7A 4RQTA 4WXPA 1N3LA 2OZPA 2BGUA 3JTMA 1WW2A 3CT6A 2ZJOA 5H0IA 3A27A 4EQ5A 1BDJA 4ROSA 5IVDA 3RODA 2G9ZA 1M8PA 4JLBA 4LMYA 3T9AA 5JYBA 1MBZA 4H2DA 3N41B 1F0YA 3WDMA 2ZXUA 5CA1A 3KAKA 4AJOA 1N2IA 1XI2A 2AJ8A 4HEQA 3NC0C 1I3MA 5JVLA 4GP7A 1TZJA 4I9NA 2CNUA 4JI1H 1N5IA 1EX7A 1W4RA 2UXBB 2FG6C 1SVOA 1JR3A 3TMYA 3QQ5A 4ZTBA 4NATA 1VE5A 3SQNA 1IJBA 4AJNA 4MS4A 2OFPA 4TXMA 4EB6A 4O4JF 2R48A 1N2ZA 1R37A 4RVSA 1SWVA 1KY5A 1XTSA 4QGHA 3GTKA 3W2TA 1D07A 1QS0A 3DEYX 5IPFA 1GTVA 3EFOB 3TSAA 5I6DA 1EVKA 1V0JA 2Y1DA 4CKEA 3PVZA 5CFNA 1LBHA 4TN1A 3MBIA 5D1OA 5JDCC 3X2SA 4MJ3A 3FPJA 5IJWA 1ZJWA 4PYJA 2IYXA 4EARA 1CLEA 4DL2A 2CKDA 1GAQA 3O8QA 3QEJA 5A4MS 3UAOA 3NETA 4DR4H 3EDMA 3ZHXA 3KXYT 1SKBA 3F2IA 3BIJA 1UP6A 3IEUA 4CF6A 3JQ7A 2PGAA 2BR5A 5JD4A 2J0UA 3DZGA 3HACA 1VI6A 5FPRA 3KYHC 4EG6A 3D6VA 3TTUA 2HRCA 3FAKA 2V7QD 2R8GA 1XZNA 2ZAMA 2WZQA 4TZTA 1TJ3A 5CURA 3MFYA 4DIMA 3J81A 1K3UB 3HFJA 4QDTA 1UOPA 3DW1X 1VPWA 4JSYA 1ZEMA 2RAPA 1XG5A 1UMBB 2O0LA 2EBWA 3OETA 2ZW9A 1D0IA 1OAOC 1TFRA 2Q5QA 4HAIA 3H2BA 1CEEA 4XSGA 3TSOA 4L0MA 1EFRD 4MMYB 3B2QA 1DBIA 4AO7A 4EG5A 3ORYA 1TTPB 1FMJA 5FDFA 5CTAA 4DLRA 1JKMA 2YY7A 3EA5A 2C8KA 1E1QA 4ZQEA 3WDKA 4F56A 3R7AA 5TX7A 1GV0A 4WERA 3DP9A 3KKLA 1Y8RB 2OCYC 3MWMA 3MIZA 1XT6A 3ABSB 4Z9XA 1NFQA 3DQZA 5C31A 1KOGA 3K72B 3UOGA 4CKWB 4OGLA 4QGSA 4JVNA 3FLBA 4JVLA 1GGNA 1UR5A 3LHKA 2RGEA 3B12A 2OP1A 4QNNA 1SWWA 1QJCA 5BRAA 3PDJA 1EAMA 1B8UA 4N5DA 3DFUA 1TWAA 1WHSA 2FXIA 4DLUA 1SBQA 2QZZA 3UH1A 4P2BA 2CNDA 4YMIA 5PNTA 1RHRA 3TRDA 2E18A 3EFEA 2H1LA 5AVXA 4L4SA 1JKJB 4UUGA 4X0EA 3CLUD 3EEBA 1Z4MA 1YQ9A 4IDEA 1YB7A 4OX9Y 4MUHA 4ZPJA 2NNLD 4R8MA 2DEUA 1D6MA 4PO1A 1AZWA 2NZYA 4A3MG 2CNLA 4LHEA 4K6MA 2ZS7A 4HRVA 2ATXA 4QBHA 4JZYA 2IUFA 3TRJA 121PA 4DIEA 5F4ZA 1W9HA 3HNRA 4LRSB 1YR8A 3HHPA 2GYWA 1YVUA 1FP4A 3U62A 4GEGA 1FFDA 5E7QA 1C9DB 2DBVO 2FPMA 4RIHA 4GUDA 5FV4A 1DE0A 3F98A 3CNNA 4KTTE 2IUEA 1EK6A 4EI2A 4NAUA 3ABIA 1HMYA 5JH7F 3GC6A 1D03A 3RKSA 5KNLA 4EMUA 5B57C 1R5NA 2YY5A 3VGJA 1FDIA 4IHJF 5I9TA 2XB8A 4IX9A 2CBXA 3BWBA 5KCZA 4GLWA 4EG1A 3QEBZ 1OF1A 1OLSA 5FOUA 4FDUA 3O4RA 5CB8A 2PVPA 3T5CA 3Q6IA 1XMPA 3UKOA 4MAAA 2O54A 4PR3A 2GZSA 1GPNA 4A6PA 2OE2A 1VG8A 3SFZA 2AL7A 3DWFA 4UUMA 1XLVA 1ZGJA 3GAMA 1P5JA 1MJ5A 4FE2A 2V03A 4JT2A 1HUQA 4WH0A 3K2IA 4LFCH 1EDEA 3FR7A 1ONSA 3G49A 2XNKA 2JA5G 3EXHA 5EHIA 3K2BA 4TL7A 3D64A 4F7DA 1FS4A 3AONB 3KOXA 4KHZA 4IXMA 5DW0A 4C7OB 5KFLA 3NNNA 2OHOA 1M6HA 1GQ2A 2J9RA 3AVYA 3AXTA 3RFVA 3I0MA 1P19A 4LDRA 3OY2A 2PXHA 1GYQA 2YXLA 1ZN2A 1XLTA 1H2EA 4N7JA 1NT2A 2H1CA 2Z2JA 5JY6A 5HA5A 1EBFA 2ORIA 3GDEA 1AGNA 4XLTA 1HDYA 4F9EA 2XVXA 3H4VA 2QRGA 3JXEA 5KYWA 2WT8A 4A8JA 1CS4C 4ADSG 3I4MG 3CUEF 3H0GA 4X1OA 3KPVA 3C5WP 4J4TA 2HJGA 1G6OA 2BGJA 2Z6QA 2RGYA 1H3NA 1CRWG 1JBKA 2ZGIA 2P91A 2EFJA 4P81A 1EX6A 4C2BA 3H4MA 4E6PA 2Q2WA 3NBZC 5A2GA 4CTNA 3OZIA 4NCAA 2EVWX 2GHQA 4XWOA 4JKYA 1PJSA 1SVKA 3LBIA 3GNLA 3FZQA 3KS9A 3T7TA 3ZBTA 3HJUA 2B9EA 4CM9D 4PWZA 1JJBA 5CTJA 5DI3A 4DE5A 1DARA 3GLIB 2UUCB 1I4EB 1V3TA 4YRLA 3M9LA 1YI8A 5JAIA 2I4OA 3TQFA 3GGCA 3DGEC 3IPLA 2NU8B 3JVDA 4Z5XA 1O96B 2DLDA 4QIWA 4CV1A 4EG3A 2AGQA 2UYHA 4B4VA 2FN9A 2V8OA 4V0KA 1SU7A 3IR7A 3VU8A 3QF4B 1T25A 2B0JA 3MM4A 2OGUA 3X1ZA 1WMEA 5CEEA 1Y81A 3DAYA 1WXQA 2POCA 4XQ9A 5L40A 4OP3A 5FJJA 1ZW1A 3N2EA 4YJHA 4G2TA 4RMHA 1HQCA 4MR8A 2GAFA 3MMNA 2AI3A 2Q2QA 1W85A 4DR2B 1J1UA 4OKSA 1E9RA 1TEVA 1COWD 3K9FC 4G2NA 2CLEB 5DTQA 4V0QA 4WSOA 2WY2D 5JEEA 1QIFA 4FQ5A 1JT2A 4Z4IA 3NU1A 1AV7A 4LJAA 2OH2A 1ZD2P 2HA0A 1GA6A 2LD4A 4Q9JA 2NO9A 3ZPXA 3KJHA 5TS2A 2PUAA 2VYQA 3OTQA 3DUFB 4M0FA 5IN5A 5C2JB 1GGMA 1TCUA 1XEAA 4B7UA 4BZZA 2N75A 3UK6A 2A3RA 1N2HA 3ZDEA 1U2GA 4XA8A 4KMMA 4DLYA 4NYMR 5TQ2B 3PK0A 3VR1A 1G7RA 5LMUB 1ZJZA 1GNTA 1Q1EA 1OGIA 2Y66A 5E9QA 1N8SA 3L41A 3EVDA 4JSTA 4ZEWA 1T8TA 5EIXA 4KPYA 2NNWB 5FNVF 2EJ3A 4FGRA 1GL9B 1I5OA 1I7PA 3HWWA 2VDOB 1NXVA 1Z2PX 3W2EA 1QSGA 1YDHA 3OOEA 1OXXK 1AT1A 1HFKA 3JX9A 1BVUA 5FBRB 3FUTA 2XKJE 3BXXA 3ADDA 3ZE9A 4QLBA 3AK4A 3HU2A 4XJSA 4UM9B 2VHWA 1H4QA 1NW8A 5HV6A 1OV4A 2VF2A 2G9VA 4NRDA 1Q0QA 3ZG6A 1HDEA 4HLUC 2PO7A 3MA0A 1YL6A 3F74A 4ZMSA 4B82A 1NXSA 1XYGA 3NPAA 2O1EA 3R7BA 2FSPA 3GF4A 4M99A 1EFPB 4OX9B 3M70A 3MC1A 1DIKA 4U7FA 2PK3A 3FVTA 2NVBA 3HGQA 3EFHA 2PMDA 1SZJG 2H1RA 1EUDB 3D43A 1I0ZA 3F3YA 1J99A 3KVNA 2HOQA 3RKRA 2YQ4A 1CUCA 1EEHA 2ETVA 2P6RA 4HDMB 4N01A 3RVJA 1SULA 2HK6A 3KYJB 4UMFA 3KLPX 3MS7A 4JOQA 2Z2IA 1A77A 4Q93A 2REQA 4GC7A 2ZIVB 4GG1A 2RBGA 4MW4A 5KFGA 4BLUA 3RASA 1G3IA 1THTA 3AJDA 1ES9A 4GR4A 3A7EA 3UT5A 2IX3A 2Q3FA 2HIXA 1G4AE 1E98A 2NIPA 2AOUA 2GAAA 2Q5HA 2G7ZA 2OK8A 4S3MA 3JWGA 1KC7A 1TIPA 4MUKA 2W43A 3QK7A 4HTFA 1QOZA 2X5JO 3A4MA 4HDKA 4G1EB 2NP6A 1T9BA 3ZZTA 2BE9A 4V0SA 2R93G 1YVEI 4XWKA 3WGZA 1TMOA 3DTGA 2K87A 5GQSA 5F12A 2R8HA 3ITNA 4R05A 1CYEA 4PU0A 1NNEA 3C7TA 5C5JA 1PLJA 1RHMA 1XOIA 3W06A 1PEDA 3I92A 4ARZB 3VZQA 3LY7A 5FJIA 1UPUA 4UCRA 3WO0A 2B2XA 3FAZA 4JZKA 3CMMA 4JI0B 2HC9A 1MX3A 3PP8A 4RIGA 5C46F 5CT9A 5A2QA 4OBXA 3RT7A 1KS9A 2ZBRA 4ZVUA 5U1PA 4X1IB 4RD1A 4YAOA 2PJDA 2E5LB 1AUQA 1XL0A 3IULA 1VJDA 3V1LA 4CGYA 4ECVA 3UEOA 4D6XA 3OP1A 3OH8A 2HWKA 2B37A 2Z83A 5EAIA 3D1LA 1V4NA 2HU8A 1VHLA 4F71A 4MYSA 4FBGA 2ZJZA 3ZHQA 3JWJA 3P9XA 2PS1A 3LFHA 2LXNA 4N18A 3L4BA 3NWBA 1O5OA 5E6UB 1B6TA 3ZJVA 4JLVA 4XCVA 2PX8A 1RCFA 2O23A 5DSTA 5C8YF 3Q7EA 1Q2UA 2CW7A 3Q6NA 3AR2A 5KWVA 2CNOA 5TVKA 3G9QA 1B8NA 2X9QA 3WXBA 3PQ2A 1A72A 5AVKA 5F9NA 1PFWA 3PC3A 4JV1A 1NATA 2P4EA 1RW4A 1U0FA 1LLUA 1O89A 4LTMA 4YWHA 1TUEA 3S24A 1MEJA 5SY6A 4G09A 3STUA 3I2HA 5A6SB 4RLSA 2VCYA 5ALIA 5AVTA 4GR9A 4J6FA 1L5KA 1XQWA 1HL3A 1OWMA 1M0WA 3F7MA 3Q85A 4RAQA 3H5IA 1ACLA 2QRZA 3HSSA 4CLXA 4DR1H 1EFVB 1G19A 4A9AA 1RPTA 3RJ5A 3RF7A 1YR9A 1T1JA 2GNOA 4YB8A 3W1GA 1I2DA 4FYXA 1PT6A 1QK5A 1XSEA 1GO3E 2B9VA 3KQWA 1U8TA 4AJHA 1T9DA 4XWAA 3B52X 5JRJA 2HMUA 3UY4A 1P1HA 4F3RA 3JQ9A 1L6RA 2RHCA 2VP6A 2CMGA 3WGGA 4AQYH 1USWA 1XZJA 5JCOC 3VH2A 4OJQA 1M33A 5C4GB 1DHTA 3REQA 5JNTA 1X7YA 2W98A 1WY7A 1QP7A 2O5VA 1S96A 4DMMA 3W5SA 1Q84A 5BQPA 2WPNA 4YASA 5IAEA 3SXJA 1QOPB 4OJYA 3Q3VA 5CVTA 2VNJA 1IEWA 4C3UA 2ZUCA 4GO1A 3P2KA 3EDQA 3QEMA 2EIXA 4QATA 4OA5A 3T9DA 1NGSA 1RRGA 1IFXA 1UXIA 3MMZA 4DM3A 4BWYA 1AMNA 2Y76A 5A5EA 4PEVA 2FW0A 3GV5B 1ZGGA 3PNVA 2JJMA 1T29A 1DTEA 3TGWA 4MUIA 1O54A 4P4LA 1A04A 3EODA 5FR1A 1J90A 4UNIA 1UZNA 2WWYA 3EPIA 2HQSA 1E1LA 5BV8A 1UMKA 2WFLA 4UD2A 3TW8A 4X8LA 4MDYA 4AZVA 5IT9W 4GZMA 1HNNA 2D1YA 2PKCA 1E0JA 5HG0A 1M6VB 2R6CA 3AG6A 2BTQA 4RPHA 3C3CA 4R81A 1AA6A 1GFWA 2VDJA 1LU9A 2CXUA 2AG1A 2ZYIA 4A2PA 3WIDA 2C95A 1FMTA 3FUCA 2P9QA 2WWFA 2VDPB 2R11A 4L6IA 2WWHA 3MGCA 4C4AA 5KVAA 2JW5A 4DSTA 1VE1A 1IY0A 3FGOA 4EMSA 4JUFA 1XA4A 5EZYF 4XIIA 5C8VA 4RF3A 4J6EA 1IB6A 1DFIA 4OB7A 1SUFA 3FYTA 5KFBA 3BF8A 1Z47A 1UKYA 4JQZA 4NDZA 2JDIA 3U0GA 2I7TA 1F60A 4XQ0A 3PITA 2W2OA 3FGNA 3TZHA 3VR6H 3FPKA 1JX4A 3FJ1A 1FMCA 5KYUB 1CKEA 3TLYA 3M9MB 1IIRA 2Q5FA 4CG2A 4H16A 2ZIEA 5FPSA 3QGMA 4HYKA 3G8BA 1SC9A 3UKJA 2JJQA 5KOYA 4PC2A 3UGTA 2C0CA 3UAZA 2NUTA 4ZQIA 2ECOA 4ZZ2A 1ZP6A 4PGHA 3HKCA 1WVGA 1TM2A 2WQ7A 4PFSA 3TXYA 1KDVA 4KWEA 2WPDA 4GPAA 3W1EA 4MIYA 1E5TA 2J67A 3T3HA 2QR2A 2OWDA 1NYQA 3Q40A 3RC2A 2AFRA 4RVCA 4DQXA 3I9NA 4O3QA 1FUUA 2YINC 3P4UA 2NUAA 5IT0A 1KPGA 2E6KA 3V8BA 4DV6B 3OCWA 4URUR 1T8WA 3OHAA 3UTCA 3KB2A 5NULA 1PJ2A 1I1MA 1K3TA 4Q03A 4FBLA 3U4CA 5KVSA 3QITA 2OGSA 3A9VA 3WSVA 4ND8B 2W7TA 1SCDA 4ENQA 4HXGA 5KFQA 3FYHA 1Q0PA 5JADA 3FOFC 4MI9A 1MGPA 1WCIB 3QE3A 1P7CA 3R9IA 3HT5A 4CKCA 2DBQA 3BGIA 1I4TD 4EIWA 1IN8A 3EVZA 4CZ2A 4BS9A 3A14A 2VPWA 1WMSA 3Q41A 3ZOKA 3F73A 5HWSA 1II9A 4NZZA 2PUVA 4KQXA 1B4DA 3KJEA 2UV8A 3LLUA 2P62A 3R6LA 4I8IA 4D8UA 3R5JA 4YJ3B 4TUYA 1Z7WA 1TZCA 3QLEA 2PSJA 1G0NA 2XCSB 6YASA 2FSGA 3LVQE 1HGXA 1Y1SA 2C2ZA 3FWKA 1G8FA 3IJRA 3DE0X 4KX5A 2QPLA 5I4BA 2DHCA 1RWMA 2RKOA 3FFBA 2CFOA 1W29A 4QVIA 2WOJA 3OIGA 2JFQA 4DPLA 3WSTA 1KU0A 2WMNB 3QI7A 3UV6A 2FSFA 1JQKA 4RADA 4QQFA 3QP9A 1CUIA 4QJFA 4PHFA 1DXYA 1N92A 4LK2A 3NH6A 1YR6A 3DAAA 3PD1A 4A03A 3DAFA 3PR4A 4BP1A 4L22A 1ENYA 1Z7BA 4MVJE 3HU3A 1MF7A 1TTTA 3IGFA 2PUTA 4X97A 1Y7IA 3MSCA 3QELA 2QUZA 1U5CA 1K7YA 4EG0A 1NNSA 5AJXA 3IUSA 3RSFA 3TVYA 4KEAA 4UXJA 2CGEA 3AF5A 1YFKA 5E0KB 2M6RA 1GTSA 2J7PA 4CQLA 2C5LA 4RVUA 4OH7A 3AF1A 2C3PA 5C7LO 1UBTS 2W83A 2HMSA 1A3GA 4LC9A 4ZI3A 4A3BG 2XHEA 3ZNOA 3B5IA 4PC6A 4CMHA 2RIRA 3T7RA 2PFGA 2PCJA 1L8OA 3GLGB 4NJMA 1UDCA 4EGAA 1WUTA 2D5LA 2DFVA 1AXRA 4TM5A 3BD7A 5BWMA 2DZDA 5AKKA 4BKQA 4WBNF 3M0EA 5BOVA 5HM6A 3QX8A 2OPHA 3SBDA 3RR2A 2DQKA 3B6ZA 1TM5E 4M21A 1NTRA 4NYJQ 2UKDA 2PT6A 3THYA 2PBLA 3PO2G 1Z13A 4LZOA 3PQ7A 2OZVA 3L7KA 1XCLA 4YJFA 5A0TA 4HX2A 1NOJA 4KPUB 5B1EA 3MOSA 1R18A 4WIAA 2CL5A 1DUIA 3FWYA 4OTZA 1EBUA 3CUSA 4PAOA 2DQSA 1XWIA 4HNGA 2B83A 2XTZA 3H84A 4HUTA 4LOJA 5B6PA 2PUFA 3BACA 4JLOA 4JMPA 2P2SA 1J8QA 2QT0A 1ORDA 1CP2A 4CF5A 2CFMA 4TT8A 4ZOQI 5LQKA 5TB5A 1DKPA 2XW6A 4MULA 3TSZA 2VKQA 1NNLA 3O93A 2AFVA 1NPYA 2GK3A 1XAHA 1QVAA 1D6NA 5JVDB 3AR8A 1UP7A 2AHRA 1CTQA 4R9VA 4BEJA 4MA4A 5EIHA 1NFRA 1HDXA 1U1FA 3COYA 3DVAA 5EJ7A 3NGLA 3GRCA 4XPIB 3ISTA 5KUTA 2NPIA 3IURA 1IVYA 3KPYA 2WFZA 3WBKA 2QN8A 1L4GA 3WV5A 1UUFA 2ASJA 5AESA 2UZ4A 6Q21A 1PX0A 1RQGA 5CH8A 2ZRAA 3AZOA 3ZCUA 4LCBA 5IJAA 5CBPA 2GVNA 1I6UA 3H9CA 3RANA 3AIKA 1J8FA 3B1YA 1SVWA 3B51X 4MQ5A 4DUYH 2DH5A 5CDTA 3KHTA 2JIPA 3VXKA 3IB6A 1ZH0A 2FW9A 1JG2A 1UPXA 3P2JA 3G9XA 1KDYA 4UHBA 5KSPA 2AGVA 4ARUA 1RXWA 2DSNA 1KEZA 1R16A 5HQTA 3WNQA 1U1GA 4BXOB 2HLNA 1ULAA 1SUSA 2QY9A 4LDPA 2Y0CA 16PKA 2QI9C 3LMKA 1XVAA 4JK3A 2ZCUA 2FYTA 1P60A 4RVHA 4CL8A 3CEHA 5EP1A 3JQAD 1R5JA 1UKZA 1TM4E 5IKOA 1AC5A 5CXQA 3AF0A 4J0KA 2AI1A 4P32A 4FN5A 1X8LA 4QTXA 1NN1A 1YULA 2PZKA 4X8HA 1QR2A 5DRTA 1E96A 3ZDDA 3QBDA 5CFLA 2E7ZA 3OLCX 4P54A 4DJAA 1NN3A 3NHUA 1A9QA 3RVMA 3AM5A 4ED7A 4GYJA 1QAMA 4CIAA 4Z9YA 4KE6A 1PRYA 2RK3A 3UPDA 3E7FA 3FB1A 1I10A 5TMPA 3B6IA 1OLXA 3FKSA 3KHRA 2FPWA 3PGXA 2ZBPA 5BMVF 4AKEA 1VGVA 3LUGA 2BM9A 2WUEA 3CW9A 1YZFA 2IV3A 1UJ4A 1WB6A 2JLCA 2WJWA 3K2QA 3A1NA 1KZHA 4EW2A 5IUJC 1G60A 3SHVA 4EG7A 1EVQA 1YS9A 1E8DA 1WF6A 1L7BA 4IH4A 2JJ2D 5BYAA 3DOHA 3OTOB 2EHDA 4UEJA 1ORVA 5KNCH 5HM8A 4O2RA 3TEFA 5H4GA 4UD6A 4MRAA 4G3XA 4JHXA 4QA9A 1XEXA 2RJ3A 3CRVA 5ESRA 1QIGA 5JJLA 2XKAA 3CB4A 1PTKA 2Q1XA 2P9YA 1SM4A 2LW7A 5BR1A 4NYEA 4JI4H 2A1HA 3QUBA 4EHJA 1DP4A 3W8RA 1GRQA 2BFFB 3VU1A 3PEVA 5HGJA 3KU4A 3SS7X 1NI3A 4GXTA 1V4BA 4GKKB 2QX9A 4HHEA 4L4YA 3SSAA 4WESB 3LC7O 2Q1SA 5DJ5A 1JG6A 2B8JA 4EJSB 2QX8A 5K01A 2COJA 4I1RA 3FI0A 2CV2A 1C81A 4DCSA 3NUGA 3KEGA 2O4UX 5EE9A 4L4ZA 3ROQA 1NSFA 3W8DA 3DOEA 4LSAA 5D3MA 4QPNA 1JTVA 1HTTA 1MJFA 4AIRA 1XELA 3MN1A 2VQDA 1JEEA 4Y30A 2JGDA 5I4IA 1GZDA 2ZANA 5D85A 5IU6A 4QPDA 3FHCB 3MWDB 3B1XA 1NA5A 3HB4X 5HKKD 3TR0A 2YIJA 1BA3A 3EX7C 4TMFA 4HB2A 2YZ7A 3GLHE 2Q1YA 5B2FA 2A9RA 3FYCA 2NVUB 5I7OA 2QAJA 3BULA 3SHOA 2PR2A 4QU0A 4C5AA 4N6NA 5EWMB 1SUWA 2D7DA 3P9ZA 1BGWA 3AILA 2QGFA 4B32A 5KNDH 1MIOA 2IE0A 1OCEA 3H04A 3WYAA 3DHYA 2V98A 3MVEA 2AOXA 3UOAB 3HYRA 1YS6A 5F1KA 2HDKA 3JQ6A 1L8QA 4YH1A 1P2VA 4KI7A 2FRDA 2VBGA 3BAAA 4H4CA 5J4KA 2JAPA 5JYDA 3RF2A 2AN1A 4TT3A 2W8KA 4R2IA 1WVIA 4JT8A 4ZQHA 3OIWA 4YP0A 5CUQA 1XZ8A 4J49A 3EJWA 4QYXA 2E1PA 3BA1A 4CUJA 2WINI 4R9UC 3MYYA 2XCQA 2R8PA 3T9CA 2JFUA 1U2EA 1JIQA 4CCSA 2OLEA 1L5WA 4XQCA 2WKPA 2ONKA 2ZJ6A 2QD4A 4CVNA 1LDGA 4DR5B 1BQ3A 1I4LD 1NMZA 4BWGA 1J09A 4O7ZA 3RIEA 2QQ5A 1DCKA 4MUXA 2OL4A 1FJGH 4WI1A 2JFXA 3D0KA 1I36A 2PSHA 3C97A 1T5LA 1KJWA 3U3DA 4JUZA 2H2WA 1PJTA 4RMNA 2ZT8A 3HKZA 3CPSA 3RG8A 4HYEA 3EEIA 5CITA 3D6NB 3PLRA 1KH1A 1TMYA 3OTGA 3COSA 3UAVA 1A2BA 4JJEA 4Z7NB 4ALJA 3P9YA 4JVSB 2AQKA 2ZRHA 4KIFA 2VTDA 1NJGA 4TVKA 4Y2TA 2Q4RA 2C03A 3G88A 1GGHA 2C9MA 1GUDA 1W88B 3WRYC 4HGNA 1OGJA 4QHTA 2I2FA 4YT4A 5JC8A 1J33A 3BWVA 4M1KA 3S5JA 4PZUA 4FYPA 3GT0A 2ILVA 4DQLA 2IFTA 3T9BA 4URWR 5TF4A 1A50B 3P0EA 4DKXA 2AX4A 1X7WA 2XDYA 1KIMA 3CR3C 2WMDA 1ZGZA 2W9CB 2MT9A 4RDHA 5DGTA 3SKVA 4R3UC 5DNWA 3BIXA 3BH6A 3E9YA 4PZ7A 2F4VB 1J0CA 5F1PA 3AL3A 5IYBG 2JG3A 5HIIA 4Y9DA 1I2CA 1HKHA 1ACMA 2C2DA 4RGQA 1E18A 1JIVA 4NVRA 1L4FA 3EEQA 3J7AC 4CMJA 2N42A 4A8TA 4I8DA 1FUKA 1MVLA 4IXWA 1M7GA 1MIHA 4JXZA 3D4PA 4K81B 4DDTA 3RI3A 3Q4GA 2EGUA 2GD6A 2XB9A 1ZOSA 1N1EA 1JEQA 4H77A 4PZ0A 2FPLA 1E3QA 1T26A 1P9OA 3H2IA 5IEBA 2QTZA 4QXRA 1T5SA 1QNFA 1TMGE 2PRJA 4CLEA 4XH9B 4HLCA 3H2GA 1YE8A 4DXDA 3UBTA 3G82C 1NZJA 1X1AA 1KVRA 5KVVA 2XA2A 2HG8A 2V4MA 4MYDA 3N87A 1FNSA 4QX6A 2C0PA 4EW1A 4MIOA 1HDZA 3ZS9A 2XNCA 2QV7A 1A2QA 1DIOB 2JLWA 2HXSA 1Q6YA 4N5LA 5MN5A 3ROEA 3V00A 3UWMA 4IDCA 5AP9A 3THXA 1FX0A 3KKQA 5EHGA 3FZNA 1BDMA 3KJQA 1KIAA 2DWQA 1QXSA 3QE0A 1SY7A 3LQ2A 4DV5B 2G17A 1ZUWA 2JIZD 3EVAA 5THKA 1QH9A 4ZEOA 4Y6QA 3ZHVA 2COKA 4XIJA 2BP7A 3JYNA 2YQZA 3GH1A 1KJJA 4GEKA 2LUOA 2ZR8A 3KYBA 5BV2P 2RC6A 2H4WA 5EOYA 3H99A 2OECA 1NQ5A 3HRHA 3CUKA 2P3LA 3SBXA 1WRBA 4Q47A 3VPHA 2IIVA 2J08A 5DHTA 4IIXA 1RD4A 3V34A 4LYFA 4QD3A 5DT2A 2BGIA 4GE3A 4AN0A 4N7MA 1W93A 2DBYA 1X42A 4DIKA 1QYXA 2HSJA 5F5XA 4NCBA 4MR7A 2VF5X 1CRZA 1USIA 4E5KA 3CO0S 2H2GA 3DL0A 3CF4A 3ROKA 4YYZA 1AKVA 5CCBA 2PZGA 2HU7A 4WD3A 3BXZA 3RU3A 1O95A 4NDNE 1XK5A 1J21A 3A1TA 1VM6A 4GYYA 3D6UA 3RVOA 4O2BB 1K68A 4UE3S 3S1AA 1N8TA 5JAOA 1ECFA 3WGTA 3OM1A 3JD2A 3WADA 1YZLA 3WRVA 1IN6A 4JB2A 2A8YA 2V3WA 3KR0A 1Z39A 3IMKA 2FI1A 4MRVA 3VI3B 3GFOA 4RYLA 9ABPA 4EI7A 4PZZA 3O5AA 3KDAA 5ARDA 5DBHX 3FDIA 5LB2A 4W5RA 4LF6B 3GTOA 4IMPA 3LKVA 2I3BA 2ZE5A 3TUJC 3LQQA 4P0PB 5B6JA 1RE0A 2IP2A 2PWYA 4RHCA 2X14A 3LYUA 4AQ7A 1ATZA 2BCJQ 1YRAA 6REQA 2A0UA 2HU2A 4FLEA 2GCOA 4HLNA 3M89A 1VSVA 3N8GA 5KG7A 1UKAA 1YL5A 5BVHA 2Q3HA 2B8WA 3GEEA 4DB4A 3PXGA 3TYXA 4PTZA 1CDZA 1B15A 2J1LA 1R0CA 3F1KA 2CFIA 1CIJA 2A0YA 3LDUA 4NH0A 4BZWA 4RZXA 3SNKA 5C5CA 1KZ1A 4O81A 4G5QA 4W8GA 2GHRA 1E7WA 2HA3A 1PEYA 2QAGC 1HNXB 3BK7A 4FSXA 4X3OA 1DJOA 3IH5A 4BNMA 2JGKA 1CU1A 4NQZA 3ZLVA 1HT0A 2J9FB 2WC1A 2P1DA 1JGTA 4RXTA 2VKTA 5ALUA 4E6NA 1TC1A 1CUGA 3AVTA 2RG7A 4BN4A 3EB9A 2V5AA 3AHCA 1QONA 4WTOA 1QCCA 2BHNA 1CJBA 2E37A 4KAXA 4JT9A 3N6RA 4IFBA 2C2EA 4K03A 1H4TA 5LNK6 4NE7A 4IDQA 4Z0PA 4BNVA 4CV0A 4GU5A 1GDHA 2VZ0A 4DMUB 3DFKA 3GNTA 3FJYA 2FOLA 3HLKA 5TQ0A 2MU1A 5C80A 5KQSA 5G4KA 3L8MA 4F4WA 4M9ZA 1Z0AA 2ZXFA 4NNPA 3IAXA 1G8KA 1OWNA 2ZR9A 3DMDA 3G2QA 2QM7A 3GLHB 2X40A 3V4RA 1BXGB 3JPWA 1ODTC 2NXNA 1HZZA 1NMYA 4WNCA 1TA8A 4K9LA 4U00A 3STTA 3U7RA 5CVDA 4X93A 1XZKA 3UKDA 1XIVA 1GSHA 4KYTA 1OMOA 2QYTA 1N5RA 5AQ1A 3C6QA 3RGXA 4QU5A 5A2QW 3WJAA 5AI5A 2VA3A 4PNHA 1CUYA 2VAXA 2PUCA 5M34A 2L19A 5K0BA 3KQTA 4ZZ1A 1KO5A 2FP3A 1Z25A 3ZBUA 4BKOA 1K6XA 3IIJA 2P2ZA 3Q88A 3CTPA 4CXMA 5EUBA 1YS4A 2PQ0A 1TYAE 4M37A 1G18A 3NHPA 4AJ1A 1U0JA 4B9EA 1PL6A 3R3HA 3RS8A 2GB4A 3KE9A 3FXAA 2B21A 4AZSA 1O3YA 3OQPA 1BCRA 2BGTA 5DDIP 4CUKA 3OJOA 3GRRA 3HO8A 5HXAA 1I30A 4JBNA 4PQGA 3A8TA 3LYLA 3V6JA 2BL4A 2QE7A 3VX4A 2J4DA 1EE9A 3CZ9A 3ACCA 1Z6YA 4XDGA 2MHCA 3LD9A