2IP4A

Crystal structure of glycinamide ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
MKVLVVGSGGREHALLWKAAQSPRVKRLYAAPGNAGMEALAELVPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVPVVVKDSGLAAGKGVTVAFDLHQAKQAVANILNRAEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVAPYPMDEATLRRVEEEILGPLVRGLRAEGVVYRGVVYAGLMLTREGPKVLEFNARFGDPEAQALLPLLENDLVELALRVAEGRLAGTRLSWKEGAAACVVLAAPGYPESPRKGIPLHVPEPPEGVLVFHAGTRREGGRLVSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords Phosphoribosylamine--glycine ligase
total genus 108
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2006-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ip4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ip4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ip4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ip4A04
4O2AF 1M6VA 2YS7A 2YL2A 3MJFA 2PBZA 3VMMA 4EG0A 2W6OA 2WYOA 4I50F 1KJ8A 4IIJF 4C5AA 5LA6F 5D8DA 1EYZA 1KUTA 4IWYA 3Q1KA 3TW6A 5J2TF 5JH7F 4EA8A 2GPWA 4ZI7F 4XX0B 2YRWA 2W6ZA 5JVDF 3G8DA 1JLLB 4RZQA 3R5HA 2V59A 2DZDA 2GQRA 4FE2A 2HGSA 4FFNA 4EGQA 1PK8A 4O2BF 2PVPA 4ME6A 4HQ6A 1OBGA 3RFCA 3JZFA 2XCLA 2R82A 3K3PA 5H80A 1CS0A 4XYLB 5C1OA 2FPIB 2V58A 4FGRA 4O7ZA 2SCUB 1KBLA 3V4ZA 1C30A 2I80A 2YYAA 5J2UF 2YZGA 1VBHA 4MV6A 1WR2A 2VQDA 1UC8A 1DIKA 2W6NA 3KALA 2YZLA 4YAJB 4M99A 1JDEA 1GLVA 4O7RA 1CQIB 1EUCB 4C5BA 4HNTA 4O7SA 5LOVF 2FB9A 2R7MA 2P0AA 5HBRB 1GSHA 3ETHA 4E4TA 2FPPB 3BSYA 3KREA 2Z04A 1JDBB 3RV3A 1C3OA 5EZYF 3JRWA 1B6SA 2YZMA 3OUZA 4FFOA 1AUXA 3BG5A 3TIIA 2R6FA 3E5NA 3QFFA 5BMVF 4O4LF 4FFMA 3N8DA 4IWXA 1M0TA 2CNQA 1DV2A 2Z02A 1PX2A 1GGOA 2GLTA 3N6RA 3WO1A 4O81A 2W6PA 3BFPA 5LXTF 2C00A 2GPSA 4TV9F 5CA1F 3UFXB 4O7YA 1A9XA 4O4HF 4I55F 1I7NA 4IHJF 4XZ3B 2FPGB 4HR7A 3BSWA 3K5HA 2PN1A 4XYMB 4O86A 1OBDA 4MV7A 2ZDHA 4WBNF 5BPHA 4IZOA 4TUYF 4O82A 3DF7A 4O7LA 1DV1A 2W6MA 3Q2OA 2V5AA 1A48A 2R7NA 3TIGA 2VR1A 3R5FA 3VA7A 4DLKA 4TV8F 1KJIA 3MWEA 4Y8VB 3TINA 2R87A 2R86A 1KC7A 4I4TF 5JQGF 1GSAA 4M9CA 3ORQA 3R9RA 2I87A 3BSSA 2DWCA 1VBGA 4MV9A 4HNUA 2NUAB 5JVLA 4MV8A 1E4EB 1Z2OX 1EZ1A 5CA0F 5HV6A 3JRXA 4O7TA 1SCUB 4MV4A 5LYJF 4M9UA 4NYEA 1JKJB 2W71A 1UC9A 1ULZA 1W96A 3HBLA 3HB9A 5LP6F 1T36A 3OUUA 2HJWA 2NPOA 2J9GA 1E4EA 3ETJA 3RV4A 3R23A 2DIKA 3U9SA 4O4JF 1KJ9A 3RUPA 1KJJA 3GLKA 2YWVA 5CB4F 2CZGA 2IP4A 1IOVA 2NU7B 4FFPA 4ZHQF 5DMXA 3U55A 5KKNB 4J6EA 2YS6A 1M0WA 1BXRA 3VPBA 1KEEA 4ZOLF 1EUDB 2R7LA 4GGMX 3SE7A 4MAMA 1EHIA 5KX5F 5I47A 4MV3A 1Z2NX 4EA7A 5C8YF 2CNUA 2YRXA 2NU6B 2R7KA 2VHEA 1KJQA 2GQSA 5C1PA 3WNZA 3AX6A 4MA0A 4YBZB 3VOTA 1I7LA 4FU0A 4FFRA 4YB8B 3U9TA 4YJ3F 3TQTA 1VKZA 1CE8A 2DLNA 4FFLA 5BPFA 2CQYA 2YZNA 4O7VA 4DIMA 2OLSA 2R85A 5CAEB 2W70A 4MA5A 4MV1A 4L1KA 3LWBA 3AW8A 4M98A 3HO8A 4QSHA 2XD4A 4C5CA 3LP8A 4EABA 3V4SA 2I8CA 3U54A 4HNVA 2X0SA 3MWDA 2ZDQA 5IYZF 4O7WA 3ORRA 2YW2A 4EGJA 2QF7A 3VPCA 5GONF 2QK4A 3VPDA 3K5IA 4O4IF 1BNCA 2VPQA 5FNVF 3R5XA 2NU9B 1GSOA 3KAKA 4ZQIA 2R84A 3I12A 1AUVA 2ZDGA 3NUAA 4WD3A 3G8CA 2W6QA 2CNVA 4EA9A 3KAJA 5K2MA 4O7NA 1CQJB 4O84A 1IOWA 1B6RA 4YJ2F 2NU8B 3GIDA 3JZIA 4YAKB 4O83A 2FP4B 1Z2PX 5JQWA 3WO0A 4EAAA 1W93A
chains in the Genus database with same CATH superfamily
1UT8A 2ZYSA 1XIVA 2C1EA 1ILEA 1P2GA 2EJ3A 4D9MA 5KDLA 3VC1A 2EERA 4Q3NA 3IBTA 1ZAKA 1BXRB 2ZWOA 1MO2A 3C0KA 3L41A 5J4HA 3AKCA 1HRKA 2JFNA 3OLZA 5AK5A 1SBYA 5DQIA 1E4VA 4HI0E 2VP0A 5T64A 1JQ3A 2E4XA 4RORA 5E4YA 1IHDA 1CS0B 4J9VA 4TV8B 4LVUA 2OL4A 1M7GA 1KJ8A 1I13A 4P35A 4B3FX 3TW7A 1VPWA 1XJWA 1SVNA 4ZO4A 1I9GA 3LLVA 4J1TA 2GZ1A 1E2PA 4FBGA 3R7NA 1S2GA 3DT8A 1ZK0A 3DCNA 3H2ZA 4IWYA 3SICE 1PKEA 5BN3B 1SCQA 4YR9A 1XTUA 1EFUA 3BZWA 2CZQA 3FWZA 1C7ZA 3RROA 3PHIA 1PQPA 4I46A 1XNQB 2GYVA 4WDQA 3ZXSA 2UXDB 2DFTA 1IMJA 4TMFA 3A6EA 2Y1OA 2I33A 1V1JA 4UAUA 2WB1E 2B25A 1VB3A 1ZD2P 2JFGA 4IHAA 3JQ9C 3A1UA 4PPYA 5LOVB 3QPUA 3H84A 1KDRA 5I4CA 3N2GB 1Y4UA 2BPOA 4K46A 3ZN2A 4PTYA 3T5AA 1G5IA 1PRYA 2HHAA 4BATA 4ZYTA 2OORA 5DSXA 4Q4HB 2VWGA 5ED4A 1DUSA 3FTPA 2QJOA 4PQRA 4FFNA 4XGNA 4CR6A 3IIKA 3LLCA 5MGBA 5D1NA 3UMJA 3K70D 4MWDA 1U2ZA 3WGHA 1F2UB 4EX7A 5LL6P 1IG0A 1J09A 2QBYA 2WTAA 1JE1A 4KQJA 4QBHA 1SEPA 2GD2A 1OIXA 5FFMA 1WG8A 4I55A 3MMSA 5BURA 4MA4A 4E33A 3PSHA 1VE6A 3K09C 3RJ5A 5EXTA 4PFQA 1BE0A 3RE1A 4MQ5A 5IKXA 1FUKA 2UU9B 2WJ3A 4L4SA 3U7GA 2Y77A 1A69A 1DKQA 1U90A 1EVEA 1RVDA 4AD8A 1UDBA 2V65A 1RM5A 3RNOA 4MR7B 4TKLA 1P6QA 5BSRA 4CBVA 4FOPA 1MVNA 4KKXB 4MWOA 3IEUA 5H0IA 3HV0A 2ZYAA 3V4LA 3WWDA 3LECA 1KJNA 4HYEA 4PGAA 4QWAA 1ZIPA 2QMHA 1KOFA 5CNJA 1AXEA 1R88A 3GLTA 5EP1A 2G7MC 2FGJA 1E5LA 1LLUA 2RG7A 4QRHA 4LV8B 2WHQA 5T4BA 3TRKA 3V97A 2TYSB 4L9RA 4R1OA 1TWGA 3KB1A 3WRYC 1ZNXA 1LDBA 2D8AA 1IFXA 2D1RA 1LPOA 2EQ5A 3ESDA 1MH9A 4BAUA 1USKA 1OI4A 3INRA 1MENA 4JUBA 4N3GA 1GKLA 1R6VA 4BFWA 3OHBA 2FZWA 1XCOA 3IP8A 5KMGA 1WR2A 3U1VA 3ZWKA 3K9QO 1T0BA 7AT1A 3U3RA 1O57A 2EDAA 4S12A 4A3DG 3CRRA 1V71A 2Z3ZA 5TLSA 2ZQ5A 1CG6A 4I1VA 1T24A 3ZGXA 3O31A 3PQ7A 4X92A 3DWIA 3MWMA 5KMGB 4OHYA 1UMDB 2NADA 3PUKA 1IATA 1RI4A 2AVNA 2ILVA 2XUPA 3CPJB 1EDZA 1EXMA 2JIQA 3A7EA 3CS3A 3IP6A 3PDHA 4YRZA 4GM1A 1NHGA 3VJMA 4KPUB 1PS8A 1N6HA 3HFJA 3LGSA 1E8NA 1Z8NA 1H94A 5CT6A 1LBIA 3QX9A 4X6YA 4C1NA 3SFZA 5K03A 2H00A 2ID9A 4DR7B 1GV1A 1IEXA 2CW5A 3GH3A 3IQHX 5CFLA 3AVTA 2Z04A 4E03A 2Y9MB 4PX9A 3WWCA 3H40A 4JV5B 3G5UA 1CCWA 3MT7A 4BFTA 3RWBA 1ZPDA 2IHTA 1AKNA 4M87A 2R8ZA 1L6IA 4Q3BA 4XWYA 4JLOA 4UE6A 2V9WA 1ZVJA 2HHCA 1VCNA 3B13B 5C32A 1TQ6A 3G0GA 4OBXA 1YDFA 3G1TA 1WH2A 3WLJA 3UICA 1MTZA 1THMA 5CX1B 4AKEA 5BSGA 2XNKA 4Q7EA 1Z22A 3ICPA 3K1TA 4OHZA 2XQFA 3I0ZA 4QECA 5KOIA 1HT2E 1FYDA 3IERA 1VFPA 2JRCA 3FPGA 4QOHA 3HDTA 3VSDA 2J6SA 4FIDA 4MVJD 4D43A 4DEVA 1I5EA 4U7GA 4CEJB 4GKAA 3RTAA 5AMXA 4L15A 3RVRA 4J9QA 2PGJA 1N2HA 1Y81A 3DMRA 4JT2A 4X71A 4K2AA 4QEDA 5FHRA 5T3UA 5G1PA 2ATIA 2PLNA 2RCYA 1OWMA 4MI9A 4QDJA 1WVIA 4QTZA 2IUSA 1M1UA 2HA6A 4TYWA 4TQRA 3AERB 3QH4A 3E9NA 4LOJA 4L50A 1S1MA 1NMXA 1QLJA 2BRUC 4OGKA 1SCNE 5LC1A 3ZDFA 4DANA 5A4IS 1P9LA 2XAUA 1WPQA 4HH4A 2EC5A 1NUHA 1X80A 1AKMA 1PG5A 2ENUA 2GRJA 2PRSA 3RU9A 1K0UA 4YMSA 1QMPA 4ZI7B 1VECA 2GK3A 2QL5A 3BERA 3LOUA 4ECEA 2YCBA 2BEWA 2R8YA 3K6SA 2A0YA 5F12A 4Y7DA 3IMFA 1P2DA 3TEMA 1T34A 3NUZA 3TCXB 5KNDH 2FPPA 1KFKB 3COPA 2NSYA 4LQLA 1DHTA 5FORA 3LW8A 1AGYA 4HEHA 4FHGA 3JPWA 3WLAA 5EJGA 1U2DC 4CI0B 1NNUA 3DHVA 5FBQB 2E1RA 1LZLA 2OH2A 3CNNA 3TDMA 4EBBA 1UPTA 4RVHA 5EZQA 3EQ2A 3GV8B 2ZVPX 2ASDA 1EFTA 1XZIA 1EINA 2DR0A 4MDYA 5FYDA 1PVOA 4MV7A 1HNWH 3ZOZA 1M6NA 1BRTA 2CE7A 3GR6A 1NWHA 3AFOA 3KWFA 4GZ3A 2D1QA 1GPMA 1L3BA 4HUJA 5LB4A 1MOPA 2OP1A 1A0OA 4O7LA 4JEUA 2GBIA 3A4NA 3HDGA 4KQHA 5LYYA 1EUCA 3OMLA 1NOKA 3IP9A 1F3LA 2FWNA 1TKCA 1NBAA 2FH5B 2FP4A 3L8GA 3EGDA 3SVLA 5KO2A 2YNMD 2GTPA 1FP2A 5TT0A 3HEAA 8LDHA 2QL6A 3U4GA 2VHWA 1IWPB 2H63A 4D0SA 3FPFA 4A2CA 1EDEA 4PR0A 3QA9A 2ZCJA 3JD3A 2H08A 1TW3A 2ZB2A 1Y5IA 4B85A 1XTQA 4LSZA 1NJ2A 4BO7A 3HBJA 4EI7A 2BC9A 2VNHA 3FYUA 3C1UA 3HU1A 1MJGA 4DQKA 3PPVA 2GZ3A 1NBHA 1PUIA 1V6AA 3EC7A 4MIOA 1IY1A 5EFZA 3D4PA 3NHPA 4I1IA 4L51A 2AJLI 3D1JA 1FLDA 3MHPA 2Q8NA 2X5KO 3G2MA 1E8DA 3HLYA 8MHTA 5IT5A 1RJPA 1GAJA 1CIJA 3SD7A 2EEZA 4X24A 1KSJA 4JQYA 3V1UA 1FF9A 5MHTA 2B4TO 3DFFA 1OBVA 2PY6A 4QAQA 4AKSA 4MRNA 1MC5A 2WE7A 3QEMA 1F17A 3R3UA 4PN3A 1AO0A 3WNCA 4AWAA 3RUFA 4RB1A 4Q3LA 1OWTA 2NSJA 1NVKA 4OP1A 3I52A 4KFRA 4RV5A 3AVVA 3TI7A 2XIGA 1GZ6A 5BRJA 5KC9A 4K6FA 4FIZA 4W9MC 1G3MA 5E7IA 1OXXK 4R83A 4MHSA 2WKSA 1FRFS 4QOGA 1C1DB 4B4VA 3T0FA 2ZE5A 3KVVA 1YQQA 4QFMA 5ALJA 4ZALA 3VR6A 2VF8A 1OWNA 3FRIA 4LWPA 3IKTA 4PANA 1PJ3A 3BWEA 3JQ7A 4JQSA 5DVZA 3WK8A 4Z4CA 3N43B 4YRFA 3KKLA 4N1AA 2PQMA 1J06A 2YJTD 2XH8A 3MOIA 4GLOA 3U7QA 1VBNA 4JXZA 2DWQA 3ZYCA 5FR9A 2XGGA 4QTTB 3EVZA 5FPKA 2YMPA 2BTQB 4OXRA 4QFCA 3SEFA 1WXXA 1ORRA 1FTYA 2GBFA 2NQ2C 3D7NA 2BMAA 5MDHA 2VQFB 4G0MA 2O2EA 1U7TA 1YVEI 3OP4A 1EK0A 3BHMA 3TNLA 4JFAA 1N6LA 2C04A 3JV7A 5L4NA 5BSHA 1NUAA 5EPUA 2CJWB 2KE5A 3O47A 4L5JA 5L3QB 2ZCUA 2AR0A 5LQUA 1G6KA 3F6BX 4R40A 4N7JA 2XDQA 3K0EA 1MRSA 1Z62A 3W5UA 3WRWA 2XD9A 1FA9A 4EF4A 1L4UA 1QG2A 1T91A 5HP4A 4Y2JA 1ADGA 3BX1A 2Q6OA 3L7NA 4U7PB 2BF4A 2YV3A 4AJIA 5I4KA 1VG0B 3K1YA 1EXWA 3PGKA 2ZETA 5KPJA 5TDHA 2IODA 4MHOA 4X66B 1EUDB 3Q9LA 1NYRA 5MFZA 2VTKA 1V4BA 4L6CA 5PNTA 1YR1A 4R2KA 2F62A 1IXSB 3E0QA 4MB2A 3V4OA 1G7CA 2ZJOA 3E58A 3PXXA 1GCGA 2X4IA 1Y6ZA 3C98A 4EPWA 1E7MA 5JPCA 5FOTA 5I47A 4TVKA 1WVMA 1X7ZA 2Z2KA 4RVSA 4W5JA 1W9MA 4HWSA 4Q05A 2Q4BA 4AJEA 1JLHA 1SOUA 2EZUA 3MRTA 4TXLA 2C9MA 3RVMA 4KQ1A 2IEAA 3ZWQA 3LYLA 2ORIA 5EMHA 3QSYA 1KQGA 1IVYA 4G26A 1J07A 1XZ8A 1D1SA 3B5IA 3FMGA 1NONA 3GFVA 3GRCA 5EZ6B 3VSAA 4X1IB 3TQSA 1DMRA 2H5EA 1KKLA 2QD2A 3VDRA 4C9BA 1SXJC 1HNNA 1NL3A 1ZVKA 3T3EA 4MYSA 4P81A 1WM1A 1L7OA 3MT9A 3L0YA 5G1NA 4BNIA 4DR2B 4JODA 3MELA 5CVTA 2G8LA 4PO1A 4XQ9A 5BN4A 2Q6LA 4JBYA 4RCZA 4XYGA 4DIEA 4ZVNA 3WB1A 1QUEA 1SPBS 3AEQA 3E3MA 3UUGA 4ECAA 1J21A 1AHHA 4UD2A 4D4LA 5ARBA 3VC7A 1CKOA 1CEYA 3VU8A 4PG7A 1JT2A 3J81W 1X9GA 1D0SA 2JFFA 4PZAA 5CX4A 4M76B 4H3SA 5ILGA 4A7PA 4RPCA 2G36A 3BS4A 1L8XA 4JQCA 4U4AA 3RD5A 1TTTA 4GKJH 1G19A 2FMTA 5AW5A 3U19A 3BDAA 3HWRA 3MWLA 4RKRA 5BUZA 3GJ7A 4MA5A 4A4DA 3GMSA 4CM8A 4MV1A 2GLUA 4C3UA 1L4FA 1WWKA 2C5FA 2GJ4A 5AI4A 4CMIB 4FUQA 4LZZA 4MI6A 4ZI7A 3I6ZA 4Z7OB 1DL5A 1JLKA 1XD9A 3LD9A 2BM9A 2CLMB 4Q4HA 5T8KA 2IW1A 4GC9A 3QZ7A 3UT6A 1TTHA 1KO7A 4CM1A 4YBRA 4MJ7A 4LE0A 3EWNA 4Z1MA 5CU7A 5ALRA 1MO4A 3A6DA 1MV8A 4KJZA 3W7VA 3GDOA 3O9VA 1WQ3A 4HGNA 4CGZA 3CRZA 3NPMA 2OG1A 4F12A 2CDNA 1JYFA 3HCPA 4YQZA 3WHPA 4W7HA 4H7HA 1XMIA 3PA8A 3R6LA 3WQHA 1BVUA 6CHYA 1OREA 2JA1A 1V35A 3F6SA 1YE8A 2CDBA 3BIOA 5A9SA 1ETHA 1QZTA 3LDFA 1CEXA 1DCMA 2O06A 1D6NA 2ZVQX 3GPCA 2H1LA 3U1BA 2GM4A 3AM1A 4GR9A 2WOOA 4P3NA 4D44A 1WJGA 3O2QB 1U28A 2BEJA 2DPMA 4I6JA 3OCWA 1PEYA 3D59A 3H2SA 1ZOLA 4KXFB 1TAQA 4OUDB 5FTNA 3WLLA 2I2WA 1K98A 1XZHA 2LUOA 2X8AA 1NNI1 2Q8PA 3AXTA 2ZSUA 4JT9A 1LI5A 1SUBA 1U2GC 1F8GA 2QVYX 4QRIA 4HQFA 5FNVF 1JYEA 2A5DA 2WT4A 4ZYUA 2JJ2D 4WY2A 2M6RA 3KAKA 2VUGA 2JFUA 4OB7A 1QK5A 3DFZA 4J9UE 4TSFD 3I12A 4RZHA 3K9BA 5JBQA 2XBMA 4PG4A 2AS0A 4UOEA 3O21A 1PJ8A 3GZTB 3UAOA 3ZLVA 3AIMA 4CLHA 1FPQA 5JAUA 4YGYA 4WZBE 5TF0A 1G3RA 1KBZA 1PR1A 1FFCA 1F6DA 1HLPA 2OHOA 3DSRA 4GF5A 5DNWA 1XK7A 5ARDA 3RFXA 1T4CB 1X8LA 4IDPA 3TSAA 4YUZA 1XL1A 2Q9CA 2XNDD 3EZ9A 1O3YA 3KC2A 3UMVA 4BFVA 1E5XA 4L0MA 1PZMA 3Q6MA 3IAAA 4K9KA 1WTCA 5JXWA 1JVSA 1S0OA 1R00A 1TYEB 2ZAMA 3WWZA 2AFHB 2VUIB 4BQIA 5E3JA 3NH6A 2NV6A 1D09A 1Q7EA 3FPSA 2AI1A 2V45A 3O1HB 4LMPA 1ECJA 1AHPA 4J9SA 1WCV1 2IYZA 5KTMA 4WX2B 1SG0A 1VSQA 3EYAA 3WLMA 3NGMA 1IHYA 3GEHA 4EY5A 2NU6A 1SCDA 4NR0A 3RU3A 2HCJB 2HEGA 5AVTA 3E5RA 5ITZB 3SYRA 3RFFA 3H4BA 5CLGA 2BBTA 2YXNA 3RVLA 1AXGA 3RTEA 4TS9A 3UMCA 2YASA 3MCVA 3M3PA 1OD6A 2AUMA 1UZLA 3TR6A 2DT5A 1KMIY 2WT9A 2GETA 4L0DA 1O9HA 4N0DA 1P0QA 3LWNA 5DISB 3PWSA 2WBLC 5A4FS 4DBLC 2VJNA 1IAVA 2P91A 3PGXA 4KXLA 2XDQB 1POWA 1ZONA 3SZ3A 2AX3A 4C7XA 5C51B 4FCVA 2B6NA 3KOWA 4R84A 4MGKR 4TSKA 3DLAA 3I9NA 1RLIA 2CBGA 2RGWA 3M83A 4CE6A 2AYYA 4GVLA 1BMQA 2QSZA 3HO1A 1MOSA 3KYDA 2WWHA 1SO8A 5KHAA 1FBNA 4XXHA 5BWOA 1SUAA 5BWWA 3O8LA 4NVRA 4C7BA 2KHZA 1ZX1A 1HLFA 3D8HA 3LY8A 4DN6A 1ODIA 2FFRA 1RWKA 3DCYA 1Q7RA 4YRDA 3DUWA 4NXMH 1T25A 4RIGA 3Q98A 3TNFA 5LDGA 1T8PA 1T1EA 3AR7A 4G5XA 2VUHB 2FK2A 4C4YA 2XXBA 5KYTA 3KQPA 1Z2DA 1EFRA 2AYXA 1C7IA 1HI9A 3BH6A 2XTZA 2W43A 1ZSNA 4AJ1A 4DPMA 5JJIA 5CM0A 1Z25A 3FYDA 2PRIA 3OIFA 1R0XA 1GRRA 2L82A 4OAOA 5IH3A 3V1TC 3PU6A 2GQRA 3OZTA 4FE7A 2XUQA 1GRQA 3M5WA 1Y6RA 3N2GA 3LSYA 2N1BA 1YZHA 2JJ8A 3OC6A 1T6YA 1PK8A 1TYCA 2XT0A 4GICA 2PKRA 1EVJA 1I2BA 3VVBA 4BZWA 1O9GA 4DV2H 2VSFA 1L3IA 3IILA 4HDMA 2Z2ZA 1OBGA 4UAGA 2XMPA 5DCUA 4HNHA 3EVBA 3G6VA 5J1TB 4D56A 3BA9A 4D02A 1IZ7A 2HMVA 5EXXA 5JQGB 2IYUA 2R82A 1O4VA 1R74A 4DBLE 1YDHA 1KI6A 1PJLA 4BN5A 2CLEB 1IY9A 1AKTA 1LJLA 3AHHA 3VKVA 3ZHCA 4KAAA 1K6JA 3UXMA 3K70C 3W5VA 1WUIS 1BVHA 2FUNB 3JWJA 3N2KB 2JH9A 2VJDA 5BR1A 2VLBA 4QOJA 5TNXA 5JXHA 4LBYA 2NSDA 1R0WA 1H69A 4D45A 1RCFA 1S10A 2XWPA 2SCUB 1WMAA 1AG9A 1OGJA 3BRWD 3UPUA 4ROSA 1U8TA 3NIDB 2XWBF 2F2TA 1T2FA 2QNIA 4WINA 2C5SA 2PSEA 2Y9PB 2G76A 4P9NA 4WOCA 2BUCA 3G2KA 4OAPA 3RHFA 2OQRA 2P9GA 5EHZA 4QYIA 3HL4A 5IPFA 1ODSA 4RK4A 5M7EA 3BT7A 2BR0A 5BW4A 2DKNA 4H2DA 5JS7A 4DV6B 4QQ8A 4Z51A 1YZQA 2EP7A 4I5IA 3NETA 2IHUA 3S70A 3VBEA 4U0KA 3TZEA 4GUDA 1N5LA 2F4VH 1XNGA 4Q44A 1R66A 3RYTC 5D3MB 1WSWA 3CLVA 4ATNA 1SQ5A 3KB2A 3MINA 4MRRA 1MB0A 1K5PA 3OPYB 2B5WA 1IK6A 1W5FA 1L5YA 1UBCA 1NIJA 1NN3A 5BYBA 2AHRA 4LJKA 4DBZA 4JGGA 2V7VA 1QF9A 3NNNA 5CDYA 5B1IA 2E5LB 3B70A 2E4WA 3I5XA 4RVUA 1EP3B 2ORVA 1K6MA 3NP9A 4GAEA 1XQWA 1L5QA 2QRQA 5AHRA 1F0YA 4JVMA 3MIIA 4NX2A 4BVEA 5BSKA 5BWLA 1C41A 3H1TA 4NFLA 2AOVA 5IJ9A 4P0QB 3DVLA 2C9DA 3AR8A 4BQNA 2FSVC 4URFA 4ZAWA 1NC3A 4O0MA 4TROA 1VPDA 2SHKA 3RIHA 2JJMA 2B8WA 4KAJA 1YR7A 4XJXA 5I7AA 3UEOA 1JFFA 4BMDA 1NI4A 4O33A 2KX7A 4EPYA 1CVRA 3PDUA 5EXSA 3G88A 5TR9A 4J2OA 2EGUA 2I2CA 3FROA 4BNVA 1LBTA 4LF8H 3ODGA 4DARA 3IAHA 4RMHA 2UUAB 3E03A 3V46A 5KFQA 2IHBA 1JILA 4O25A 4J0FA 1A4IA 5J58A 2J0VA 4MH0R 4PAGA 1DPGA 1AUXA 1QGAA 2DBVO 3GFSA 3NHUA 2FE3A 5IC6A 4C0QC 2AVDA 4C2BA 3ESXA 4C89A 4ETWA 3LX4A 3UW3A 5BXQC 1OROA 5KYUA 3V8QA 4XVRA 1CULC 1VC2A 1NQWA 2O8VA 4NYJQ 3KSAC 1J24A 5HUJA 4MDEA 3B7WA 3GOHA 4UFNA 3GA0A 5IJWA 4ZARA 2OWEA 1DV2A 2G9UA 2NO4A 4RSHA 1XU9A 1S0MA 1OC4A 1P7PA 5ALMA 4CIXA 5TPZA 3D3QA 2ZB3A 1DT3A 4U1RA 3WGQA 1ZMOA 4AMYA 2HHLA 4BMSA 5FL7A 3SIRA 2J3MA 3BRSA 4EYKA 3A4VA 3BB1A 1GCUA 5AI0A 5JROA 1L4HA 2X4DA 4FN4A 4TTAA 4BVBA 3G02A 1YAHA 4HN4B 3H42B 4P7KA 5K0FA 3WLRA 2H1WA 3Q0IA 2QX4A 5EXDA 1TD1A 1BEZA 1VL8A 1NI3A 4AJPA 3KEQA 3M4IA 4TKZA 2J6UA 3NG1A 1JSCA 4X0EA 1IRIA 1QWSA 3GT0A 3BK1A 1PV1A 4XVCA 4XVQA 4NOLA 5HF9A 5LQKA 4JVLA 4HDQB 5HZMA 4Z54A 3TG2A 4JLPA 4M0FA 5A1TA 2CEAA 2A67A 2COUA 2WWGA 4WXYB 2H06A 2FSHA 2I3GA 5AM4A 3ZOKA 2E5FA 1KQPA 2I3AA 2P9QA 3WGMA 4LBZA 3OSPA 5E1MA 4CT4B 4XZ3B 1AMNA 9LDTA 2H4JA 4LC9A 5DKFA 5FA5A 5JANA 1E1CA 2Y76A 3IIMA 4L5YA 4M9XA 3WXBA 1SK9A 4DRFA 2X9LA 4Q7MB 1M5RA 1YBAA 3DTNA 4L28A 1YF3A 1KTIA 1EHYA 3GCWA 4YDHB 3KFXA 1QRDA 1VHJA 4PGFA 5ITSA 5AQEA 2QZZA 4DSZA 4BNNA 1VKHA 2FRXA 4OLAA 4I1SA 2EEPA 5KYXB 3AUFA 4YCSA 2HN9A 2BBSA 1N6RA 4ABYA 1FVIA 2VSOA 3M81A 1QVAA 4WXRA 1B2RA 1P2FA 4WBNF 5TMBA 3THRA 3W2EA 3BJIC 5JLJA 3RSCA 4MKGA 2VAWA 3ZUPA 3TOSA 5AM1A 3OLVA 2R8GA 1SXJB 3OJWA 1IULA 4K6MA 3E1KA 4UU1A 2GCGA 5JZVA 4BUJA 5G1OA 5JFOA 2RGVA 3OJFA 3OO1A 4MS4B 1I1NA 2JJ2A 5ECGC 2REBA 1DDOA 3HZHA 5KBYA 1FK8A 1QWOA 4C0WA 3HOZG 1E9RA 1K4KA 1TM2A 3IJ5A 4MKFA 2P2DA 3ZTTA 2DT8A 1QJ4A 2Q3LA 4A3SA 2F8TA 1V5GA 1DRKA 2HEIA 2QTZA 3AEUB 3H3XA 3O26A 4D9BA 1AZWA 4IUCS 4Q1FA 5U4XA 3S27A 4ZOBA 3HG7A 5C1DA 2EZ9A 2PJZA 1H5QA 1CY7A 2GAFA 3AINA 3GBSA 3CM0A 4D41A 4LWZA 4AQYH 3A9VA 3KTAB 4X44A 4TV8F 2R6JA 2R60A 1DAFA 2O7QA 2YBDA 4HN9A 3VU3A 3NWBA 1FNSA 4QELA 4ZOQI 1RXSA 1IZ8A 2VQFH 1BHQ1 2JGDB 1DXHA 5CIQA 3TY9A 4KQWA 1PVVA 3OTOB 2AN4A 1U0HC 3T0GA 1I6MA 1FFHA 1X8KA 5KOHA 2XAAA 1NG9A 1DRWA 3DTYA 2PGDA 3JY6A 3G9TA 4A73A 1XVVA 2WAXA 4ZO7A 1VBGA 1KAEA 4KHZA 3IP1A 2A86A 2VDMB 5FNVA 2EHJA 3ABZA 4AMUA 3JYPA 2FSUA 2Q1TA 1AN7A 1FXWA 2V74B 2YX1A 3DOEA 2EFYA 3WYDA 4BNWA 3T1YB 1Q57A 4ACBA 1V1MB 3HBAA 4JELA 3ZCSA 2J7PA 3PNLA 3ET4A 4F2HA 4F96A 2ETVA 1M1YE 4FNAA 5AKKA 3C8ZA 3PUWA 5JJCA 1Z4LA 1T43A 3WMWA 5KFVA 4BS9A 1E3JA 3TSCA 5K9ZA 2V1UA 2YOFA 3AB3A 2YJ4A 4LDRA 1E1DA 2Y0CA 1FCJA 1X1QA 2QG6A 1HEYA 4QVIA 1NQAO 1YL7A 1WHTB 3JWGA 1K9VF 2ECPA 3F8TA 2VZ9A 3OICA 4NU0A 2B7LA 4DV5H 1RPNA 2VYFA 2ODQA 3Q3CA 4J0CA 2HWXA 3AZOA 3BH7A 2QEQA 4EYHB 3CISA 2IUTA 3EOAI 4DZTA 1TGYA 2MYNA 5ALYA 3R4VA 5J5CA 3U56A 2G5GX 1QQAA 1FSPA 4I81A 2JJQA 2IZOA 2JFOA 1JKJB 5JG7A 2B63G 1CJSA 4MLDA 4D97A 1M6WA 3HB9A 2G4VA 4L95C 4MPJA 1I9CA 4IS3A 6YASA 1JXOA 2CF6A 3FUUA 4YT5A 1SU8A 3WGJA 4NATA 1PR6A 2ZI4A 3Q40A 5BN3A 1DC5A 4ZI5A 4HLUA 2BKLA 3QKUA 3VNSA 5DGAA 4OU4A 1Y3HA 3OE5A 3N2IA 2AV6A 5T67A 3FPBA 4OATA 3ZEAA 1CUHA 2ZSFA 3PICA 3ZE2B 3BK7A 5H7XA 1P2UA 3E2PA 4FKMA 4M3NA 4UW9A 1OAOA 2Z8YA 3PENA 3TEJA 4MP8A 2APJA 1W36D 3CSDA 3RUPA 2ODPA 3P96A 2CCGA 4WCVA 4FXPA 3L0IB 1KTAA 1JPJA 1UEXC 3D02A 2PVCA 3OC0A 4JUIA 4P83A 5JYBA 2PXCA 2ZM6B 1RPTA 2YVUA 5CB4F 4RU1A 2RGXA 5K4AA 2Y0SE 2OQVA 2DYKA 4ID3A 3K30A 5E9QA 1M2EA 2GERA 2IUYA 2SNIE 4TS3A 1D5WA 2NU7B 5DK6A 3ITEA 3SJCA 4AFNA 4WCFC 1WSAA 1ZC4A 4ONEA 2WJVA 5TX7A 1NQ5A 4GZLA 4RD6A 3Q9NA 1FBTA 4A27A 3KTDA 3CGWA 4UEQA 3GJXB 1ARZA 1GFWA 2Q6VA 2QTHA 5DM4A 2FP3A 4D9JA 5AW3A 2AXEA 3ENNA 1ZHSA 1BS9A 1M72A 1KZ7B 1NOJA 3AK4A 4D4GA 1EQAA 2HJ9A 1KZGB 3GPBA 5CH8A 2UUCH 1SB8A 2CUKA 2ZZKA 3JRNA 4UTOA 2I1QA 5HEKA 2Q1XA 4FX5A 2PRKA 3BCUA 4ARZA 4ZJZA 3FMAA 1F8XA 1XAHA 2OCGA 1WMBA 2JD0A 3GJQA 2O8EB 4QUDA 1KI3A 2W9CB 3D3WA 4DJDC 4DUYH 2HU5A 2QTVB 5E6SB 1IZ0A 1R5JA 3DE7X 4B4WA 3CB4A 1NVXQ 3S2FA 1E62A 3U44A 1EPUA 4DV4H 1M1XB 2BF7A 2JGAA 3IA2A 4JLUA 4DREA 4ARIA 2C2KA 2GEUA 2RAUA 1H93A 4PGGA 4RZXA 2OTCA 3HACA 4OP2A 4AF7A 4A3LG 2HDNB 2PTGA 4IFEA 4BKUA 2CF5A 4P36A 4ZVUA 2QE7A 1W85B 1CVIA 1NNSA 1XDSA 3L0SA 1J99A 3O7WA 3T9CA 2YXLA 5MN4A 1BKDR 2CFTA 2WYIA 5ER6A 4YP6A 3GJ3A 3EEYA 1HDEA 3O8QB 3USCS 1Y42X 4PRKA 3K6RA 1DDIA 1QO0A 1VKZA 1H0HA 1V8DA 1KC1A 1YU9A 2GEBA 1NJ1A 2IDMA 2X7HA 4WKPA 4N0EA 2MSCB 3U3KA 5EIHA 4K9SA 2GJAA 2SECE 1UBSB 2AD1A 3PUYA 4OM7A 4I1UA 1DINA 2I62A 4RHXA 4YJGB 1JI0A 2D8MA 3M6IA 2R93G 3EF1A 3NBUA 1EFHA 1SQ6A 3P5BA 4EUKA 2HHFB 2YJ5A 1UJCA 1LLDA 2J41A 1TVKA 5FX2A 5DU2A 2C8KA 4OFBA 4OJMX 4S2UA 2WNIA 2NZUG 2ZYWX 2QVCA 1PX0A 3FDIA 3H11B 4KHPB 5FO0A 1HDRA 4TKUA 4UREA 1J22A 5EP2A 1US8B 2YINC 4Q3EA 2VUSA 4TLBA 5HMMA 2FX2A 3EUWA 3Q5GA 1RQ2A 3GJ8A 4A0SA 4ZIRB 3BMCB 2HO4A 3NGLA 4N3BA 3TLGB 1I4DD 1HUQA 3EXEB 4W9RA 1U31A 1GUZA 3VGJA 2G71A 4JITA 4BWYA 5GINE 2PU5A 1B3BA 3H4IA 2FJ0A 1E2NA 4PBSA 3RJTA 2CXHA 3S8EA 1ZAUA 3NOVA 1JJIA 3OJ0A 4BV9A 1AKUA 4TTPA 4KRXA 1YMQA 3AF5A 1FXSA 2DBRA 5IC5A 1E2KA 1VLJA 4X41A 4LGMA 3KB6A 4IQ4A 3QYFA 2PV0A 2HR1A 1L0BA 3OU2A 3V4SA 1XN4A 3FTCA 4U6QA 1OFVA 3CZ5A 4FBLA 3IJRA 1YB1A 3FZYA 4RAOA 4REQB 5EIWA 2K6GA 2ZUTA 4ZCIA 5HDQA 1V11A 2XT6A 2C03A 1BCSA 1CW2B 1ZGBA 2PZAA 2TMDA 3AYZB 3PB3A 2X41A 4O7WA 3E1SA 1SXPA 3LUFA 3L4BA 3QU7A 5HWSA 1NLMA 2CHUA 3S99A 2VPSA 4C76A 4LOKA 3UF0A 3LDHA 2EFHB 4RVNA 4GPEA 4DSAA 3BWDD 1BHJA 1HETA 3KLBA 2OD9A 4EHHA 5C18A 3B12A 3GLVA 5CYOA 1ODTC 1FP1D 2CNNA 2RMKA 2X8JB 1I7SB 4TVOA 1FYXA 1M8PA 2AMLA 2VPQA 1PQWA 3CNQS 1Y4AE 1YNOA 3RB3A 2GZRA 2J85A 4HNAA 1JQJC 1RZUA 4MR8A 3UUWA 3W1EA 4AC9A 2ORYA 2ZW9A 3G49A 2ZIAA 3O0DA 4GU5A 4KSCA 1W7AA 1QANA 3R6WA 4IIHA 3RYIA 5K6TA 3H4VA 4Y6GB 2EW8A 4NCJA 4AICA 1JX6A 3R9XA 2PLAA 3KXPA 5CBPB 4CIDA 2H59A 4FZJA 4A8TA 1GIAA 4XQEA 4F7WA 2G63A 1YJXA 2FHSA 4NPAA 1I94H 1T5SA 3JVEA 1ADBA 2JA8G 2E2WA 1MZBA 3T5HA 2WR8A 3D4BA 4AZSA 3KJGA 3GI1A 3RG2A 1DELA 3C16C 3M6WA 3PD0A 1YBVA 4ITRC 4MQFA 2FN3A 5J43A 4DR3B 4P8RA 2ZP1A 4Y6RA 3RC3A 2VNAA 1T5HX 4A3EG 3THWB 2QYSA 2W2PA 2YFQA 4WXHA 4B3SB 1Z4QA 2FFHA 4JDUA 4JBXA 5KQMA 3AF2A 3O92A 4O4LA 4CF5A 4AMGA 3EOBI 1UAYA 2PSJA 2X76A 3AOEA 2JGFA 3T5CA 4DY4A 3AVWA 1CQJA 1H4TA 3PFIA 3PIDA 2HDOA 2W9CA 2I3ZA 3LOQA 2DFDA 4DDMA 4A3FG 4AIIA 4YAKA 5KU1A 1AE1A 1RT9A 2CDRA 2R1TB 4KDFA 1COWD 2X9QA 5KNBH 4Q1VA 5FYQA 3L0PA 1PYDA 1YRBA 2OQ2A 2VC2B 1NDUA 3LW7A 4FDAA 3QPAA 2HXYA 3L1KA 1XX6A 1NTRA 3EW7A 3GNQA 4MGYR 3ZWVA 2IEZA 4YEDA 4RW0A 4FWBA 4O3QA 1QPBA 3IH5A 3NT2A 1PNQA 3HDHA 3CLKA 4IBOA 2JATA 4JUFA 4YFYA 5J63A 1PZNA 2HQBA 4JR2A 4KLAA 4W9NC 4MMXB 4OXKA 1JBQA 1JQBA 3WFIA 2FRVA 1Q6YA 1K7XB 1W4LA 4UCVA 5KFIA 1J20A 2JIBA 3MJFA 2PBLA 4F4ZA 2Z83A 4ZU1X 1T94A 1FFWA 5EUMA 4DCUA 2CXOA 2Q8QA 4NENA 4WOJA 3HBFA 4KFUA 4IIJF 3OOSA 1QHHA 5K4HA 4FR2A 1HG1A 3UWOA 3BEDA 5FPTA 4RTOA 5BWUA 1P0FA 2NOAA 2VPZA 3GG9A 4NFHA 1DJQA 3ZEIA 1MA3A 1ZK2A 3L6UA 1ORHA 3GQVA 1L5FA 1NVTA 1Z16A 4Q3CA 2OCYC 4R8SA 2NTEA 1N9GA 3WZMA 4CF7A 2ZUEA 4AY5A 3MBKA 4HB2A 2XCUA 3MWJA 2RC5A 1Q15A 1AZTA 3IUJA 4DL6A 1GNRA 2EBUA 1PQUA 3K4HA 4IZ6A 3ADPA 2BQRA 1UCFA 2PMBA 4XJSA 2P69A 5J2TF 3UJCA 5KFKA 4QGGA 4C87A 5AUOB 3QEBZ 2QRMA 4OH7A 4UEKA 1EP1B 1V51A 4G2TA 3QPBA 2J45A 4IGIA 4RHTA 4YP9A 3G8DA 1JG3A 3NBYC 4NF2A 3P9RA 2P5UA 1LY1A 3WLQA 1T2AA 3ZHBA 1F20A 3N2LA 4D4JA 1ZFNA 3ESRA 4XD2A 2JAXA 4C07A 5JNSA 3DLHA 1IG3A 1SKQA 1WUHS 1B26A 4JP2A 2FLVA 4EA6A 4CM9D 1GN8A 4YT2A 4BWVA 4OJNA 2HGSA 4JBIA 4PFKA 1OZAA 4KG7A 3DBRA 2Q46A 3RWMB 2KMLA 4WKOA 3AF0A 2JHPA 1CUCA 2JI6A 2P77A 3AKZA 1I3MA 2P2SA 2B4KA 2VT6A 4KO8A 2LE0A 1KE1A 3WMXA 3KTOA 3ZCRA 4EJSB 3MWFA 1IIBA 3OQIA 4LWOA 4RHEA 1LXCA 3H6GA 1YFJA 3MT8A 1I8TA 1G4UR 1G8GA 1RE0A 2C57A 4NTZA 3R7DA 4EAQA 3NATA 3ZWYA 4CMCA 2J3DA 4M7EA 4IFTA 5T4EA 1I4WA 1M5TA 3SQOA 5E6UB 3A4IA 5EMNA 2KYRA 4ZANA 4LXXA 3SAJA 2FPIB 1SVSA 1VCIA 3A58B 2Y66A 2OV3A 4QHSA 4UAVA 3S2ZA 4B74A 3Q8RB 2OAGA 1SUFA 3MK31 2V58A 1EWYA 2A9PA 3D31A 1LGYA 3GVIA 2CV0A 2HU8A 1MMFB 5AI5A 4N39A 1ISHA 1LDNA 1WUYA 4JLVA 1M2OB 5IM4F 2ST1A 2IXDA 4DB4A 4RQBA 1XEAA 4DMMA 5C37A 3B1VA 4AG3A 4OFXA 1MJGM 3GYGA 3GEBA 3H97A 3UB4A 1OA1A 3O9ZA 1HWYA 4BFSA 5J2UF 4NPHA 2HIVA 4MJXA 5B12A 4N0MA 3THYB 5IASA 4KH0A 5B58T 2FR0A 2QV0A 1ORDA 1PJCA 3NTRA 3QEKA 2BCEA 3ERCA 1ZOSA 3QUSA 4PINA 1RIFA 1MB3A 3PFWO 2WD9A 3H0GG 3G1UA 1A27A 3AHFA 4MGHA 4PBCA 1DIKA 1SULA 1JEQA 2VPXA 4JDPA 3HB5X 3P27A 1O96B 4OJQA 5FEMA 1EKFA 3ZJ4A 1QZUA 2KM1A 5JW6A 2IS1A 3O94A 2OD7A 2DETA 3AL0C 3TUZC 1GG9A 3DV9A 4JLMA 4YAJB 5TGZA 1BXKA 5KWSA 2I6GA 4UOQA 5COBA 4NWIA 4X1OA 1ESZA 4CUKA 3A7DA 4Q4DA 3C3YA 4UU7A 3WIEA 2P6NA 3C45A 3QNUA 1FQJA 1ISRA 5LU9A 1YTLA 2F1RA 4CPDA 2ATVA 2Z57A 3MA0A 5IM5A 3M2PA 4MUGA 4IJQA 5FWYB 1LTQA 1NM5C 3I5YA 3L0CA 1SOVA 1ENOA 5HQJA 3VUFA 1W5AA 1I7PA 1XRLA 1WCMG 1I6LA 4E4TA 1I3OA 2P4QA 2QZJA 4H0CA 1A04A 4R51A 2ZRPA 1HT0A 2ZSBA 1EJ6A 1RRGA 3PW0A 2F9FA 2YIDA 3F67A 3H2BA 4FFWA 3WNVA 2Z6QA 4UDXX 2WTFA 5AVZA 4QJ5A 4HMPA 1E4FT 3GPIA 2NW6A 1LW7A 1WXEA 5DULA 5G4LA 4DV3B 1HZJA 2QSYA 2WP0A 2YWJA 3DW3X 3O3OB 3PNKA 3IQDB 4GQAA 2HIXA 5DMHA 2Q2NA 5JAHA 4KMRA 4W5OA 2VA9A 1P7VA 5AOVA 3UJHA 1E9VA 2D1SA 3LX5A 3BG5A 3N2ZB 4UBMA 4HQRA 3VU1A 1ZEJA 4LCJA 1U0RA 3KZMA 3QOYA 5BMVF 1UBUS 4O4LF 1UZNA 3IHTA 1PGPA 1K5HA 1YRYE 3M1IA 1AA9A 1IZ9A 4Q4AB 3CSUA 3ESCA 4DV7H 3RSGA 3TLYA 1IHXA 4NL4H 3MT0A 3MPUA 3CV3A 2YNMA 1CETA 1IUOA 4M1EA 1SKUA 4P5DA 2XE7A 2HX1A 1E3WA 2V7BA 4IQ0A 1A7KA 4O2BB 2W4IA 4N47A 1Q84A 4M8KA 4HATA 3U7QB 4P2BA 4IUYA 4RJJA 3HZZA 5DI9A 3D6MA 1QHFA 5CHYA 1NGSA 3NOXA 4Z8YA 3OE4A 2G6BA 3SVZA 4RVOA 2GPSA 2GCIA 2Q9UA 4HDOB 4Y1EA 5MFPA 4WEQA 2R92A 3CKMA 2QW8A 2FEMA 2ON6A 4UPVA 3G0BA 4QG7A 3F46A 2F48A 5JVDB 1RHUA 4JBNA 5JAMA 3D8RA 3L01A 3PQ5A 3DZKA 2C28A 4HWKA 5K3OA 3CEBA 1GNSA 2DF8A 5DGIA 2GDZA 3B38A 4EHFA 3CKYA 2ZXEA 1S96A 2FI1A 3ONDA 5LZ8A 1I6WA 3ZVRA 1KL7A 4EUEA 4H7PA 5MF6A 3DH0A 2P3QA 3K5HA 3AQIA 4ZEMA 4CM4A 3EGXA 2PN1A 4S1VA 3RVQA 4NENB 5LLSA 4DA7A 3RSFA 1L9XA 1XZCA 1SD2A 3UPDA 4AL4A 3QXGA 1UK7A 3IL2A 5GZ1A 2QLMA 4JKYA 5B7NA 1FEZA 1JQEA 1O94D 5FTKA 3GV7B 1OYVA 1RHRA 2REQA 1NMZA 2YCHA 2GKGA 3PC6A 2GPTA 4DJEC 2JI8A 4BNXA 2P6OA 5JMWA 1TO2E 2JI9A 2XJ9A 4C3ZA 5DTMA 4EG1A 3U44B 3HKZE 3DAGA 3FKSA 3L92A 1XQ9A 2HSEA 1MRZA 3MJRA 2GNPA 3ONWA 1Y7PA 3Q2OA 4KIFA 2WABA 2Y1XA 3R4CA 3KAPA 3OEWA 5LMZA 2VA2A 1E3TA 2SBTA 2VPIA 4FFVA 5ECWA 4C6TB 1JDVA 4HDAA 3I5MA 4IOJA 4BHTA 1ZVVA 3ZZMA 3WXMA 2RI1A 1Z5UA 4ZJYA 2O59A 1Z5ZA 1T13A 3ZXXA 4BWFB 1S2NA 3OLCX 3DJFA 5M3BA 1AB6A 1FTSA 4G4GA 3MINB 2WNHA 3H05A 5AK4A 5DBFA 4KITB 3U6BA 1NVEA 1GG2A 3PD7A 4CIWA 2IXTA 3OWXA 5EHGA 2H7YA 4CM5A 3HHEA 1V95A 1TE2A 3ZY3A 2J9FB 1TT5A 4Z9YA 5GM1A 4G0XA 1E5DA 3HC7A 4HX5A 3UAYA 4TQGA 4KOAA 1U0SY 1QIFA 4HB4A 5A04A 2O14A 2NT3A 3N0XA 3VV3A 3YASA 1V9PA 3ICWA 3BMNB 1E0AA 3HCNA 1KC7A 3FSGD 2O3JA 1I80A 4R2IA 2YVAA 4V1CA 1G8HA 4JYZA 1QCZA 3WTBA 1O95C 1GSAA 2A5FA 3Q11A 1MIOA 4O4IB 3PDIB 2CD7A 4Z53A 3I4NG 2NZXA 2P2LA 2AT1A 4C4ZA 1KR5A 3UZUA 2IBKA 4QPNA 1FDOA 1JWAB 2VEOA 2OESA 3MN1A 3QXJA 4HCJA 4LXYA 1TVEA 4Q5IA 1WE2A 3K9FC 1CF4A 2WD8A 1FW6A 4EJSC 1V3TA 3AIKA 1B0PA 3KLNA 2B4QA 4HNUA 1T2NA 2GA8A 3N2KA 3TD9A 4YLYA 1CT9A 5HNKA 2EKBA 2LKCA 1G1AA 4UEOA 1JQLB 1TADA 1UXGA 1Z0KA 2BEWB 3DZHA 3H9EO 2JCXA 1GL6A 2DTXA 1WD5A 3GP5A 4TL8A 2EIXA 4ZOAA 1J90A 2DWUA 2JZOA 1RJWA 3IUPA 3PHCA 4GOOD 1XWWA 1HYBA 2PXAA 3GCXA 3JYHA 3NXSA 4OB6A 3RHTA 3ROTA 4YCMA 2BFBA 4W7IA 5KFHA 2K87A 1G5PA 1GL9B 2VF5X 2OK7A 4WBNB 1QVZA 2I7VA 1E3WB 4UU8A 3UHOA 3L9WA 3P2MA 2PKQP 5FBLB 5D87A 4IDEA 4PCLA 4UUNA 2QN7A 2B8EA 4XX0A 2Y68A 1UJ2A 1T5LA 4QXRA 2AC7A 3MTIA 1XP8A 1ZKDA 2KSQA 1SVLA 2FMFA 4Q7LA 4Y6LA 4OGFA 3DOIA 5FBKA 4HAYA 1M6EX 5CLQA 2WPDA 1J6UA 5LP6F 4GI2A 2FW1A 4JVNA 1OWPA 4YWHA 3NVKI 2UXBB 1GFSA 3NHJA 2P9BA 3JQ9A 5FD6A 2C2HA 2EP8A 4NZOA 4H0NA 4KGDA 4MKHA 3HY4A 5AHWA 1H8HD 4FD3A 1H2WA 4RCNA 1XV5A 2D7CA 1TF7A 2VTBA 1BX1A 3W5OA 1QRSA 5FF9A 5C5DA 2EWMA 2DIKA 2PIDA 3PFHA 3N39C 1WMSA 4P86A 4QJ4A 5DP2A 1U7DA 2L19A 4B7XA 5WRFA 4BXOB 2R3SA 1LNQA 1Q21A 2JD1A 5E9AA 3V34A 3H11A 4F4JA 4WZZA 4YCCA 1JE0A 2MMCA 2O7SA 2DGDA 4Q34A 4WK6A 2XQGA 3LYUA 3PDWA 1QKKA 1N9KA 2F43A 5TQ2B 3Q8PB 3U80A 2Z0MA 2QPAA 2VNSA 1QTRA 2YXDA 4K6CA 5EFOA 4EVSA 2CBXA 4ZHQB 4XD7A 2F9MA 2JIMA 2ZI7A 1ZOPA 2WW8A 3PZBA 5AVVA 2J3HA 2WJHA 4NFSA 3I6IA 4WVLA 4BTLA 1NSFA 4TMYA 4E51A 4RU9A 3BMNA 4RF4A 3GRAA 4PAWA 3MCWA 3CH7A 4EW6A 3L02A 4FYMA 4UE2A 5DASA 1EWRA 1DLJA 2UUBH 2H92A 1IOLA 3IVCA 4WNAA 1XYGA 4HVLA 5IJAA 3KJXA 2D1YA 3D4OA 3DV0A 1YHYA 3IAM1 2ZRHA 1ZJYA 4RPLA 1SKYE 4EA7A 4K9PA 1KVSA 3D4NA 4JJ6A 5IKOA 3KD2A 4BY1G 4ECTA 1YFKA 3WNBA 1EKPA 3NHSA 4KBFA 2Q49A 3CZ9A 3WLFA 2GXUA 5K0SA 2VBFA 4Y18A 1IYZA 3QU9A 2I3DA 3GJ0A 4YDSA 3AV0B 4MWZA 2O8EA 3JCZA 2AE1A 4URYR 1L7VC 4NQZA 1OFUX 2HCFA 5HKOA 4ZJUA 3NYIA 1G0NA 5BQFA 1BOFA 3ZHRA 2J4FA 3W6ZA 1JHZA 4PE5B 1MA0A 5KNBA 1H65A 4ZQEA 2AGVA 4OHUA 5A4AA 1EIZA 2VDKB 4MVCA 3PUXA 2VP4A 4EJMA 3REGA 1NRIA 2OZPA 3M5CA 3IMGA 1C8BA 4R1UA 1AKYA 1BJRE 1VIMA 3R9KA 4KREA 4E3ZA 1ZN8A 5I4IA 4C2TA 3TRIA 4MYUA 1B76A 1GQRA 1Z47A 1BMFA 5AKGA 4HRVA 3L93A 3OF3A 4DDHA 2PZJA 3VR4H 3CFYA 3VBCA 4RMGA 1CUUA 1JIJA 4RGBA 3FTNA 1G63A 3QPWA 4N82A 2OKCA 2D1FA 1EFCA 3AUJB 3H65A 4AXBA 5IHPA 4OIFA 2GZ2A 1II0A 4LY9A 5DYTA 5IKPA 2ZRJA 5BP7A 3BWBA 4NYJR 4WLVA 2I9PA 4HDNB 4GL4A 4QU8A 2ZKLA 1M34B 2XUFA 3S2EA 3PJRA 4LX8A 3KZXA 1N57A 4BV2A 4F4DA 2OUKA 2XGOA 2PX2A 2QAGC 3D7LA 4FCCA 4M98A 4XOIA 1NW4A 2HYDA 1Y8QB 3I37X 1I51A 3E4CA 3EUEA 3HU3A 1WOMA 5KWVA 5JSZA 4J4BA 5CDUA 4L08A 4IVRA 4MAFA 1P60A 3FY4A 1T9ZA 4I9NA 3JALB 4HQLA 3DXXA 4E4YA 3AM5A 2GEJA 2EJTA 3A04A 3B1ZA 4PC6A 3EEOA 1BD4A 3S5UA 3A6PC 3HDQA 4BO2A 2I8CA 1XN1A 4J1SA 4K6OA 2FPSA 3VPXA 4BB0A 4IICA 3RK1A 1NW9B 2QW1A 3G2JA 2WP8J 3P9KA 1M34A 3L9XA 4CODB 2XZDA 1X8XA 3H2GA 3HXKA 3BQNB 4QXAA 2QW0X 4F5ZA 4DLLA 4OI4A 5CDSA 1H8ED 3PI6A 2AJCA 2ZVDA 3BK2A 4J03A 5LQRA 1FU4A 1ORTA 4IX9A 3ZK7A 2JASA 2XC9A 2DSNA 3FZNA 5AYVA 4N54A 4OQYA 4F2WA 2QT0A 2R8XA 4YAUA 1YUNA 4NNPA 1YBHA 4AJ9A 2ZTUA 4TMTA 4R2JA 4V0MA 3HWWA 2ZI5A 1TQ4A 1VIDA 3RFTA 4QWMA 4YYZA 1X86B 2R8IA 2CXXA 4EB6B 4S04A 4G0QA 3DDNA 3ZCQA 3AJEA 2O2DA 4PRLA 1KRHA 1K0FA 3ASVA 5KT7A 4AZVA 1NHWA 5AVYA 1P7CA 1W88A 1PUJA 3RAXA 1PZFA 2WM3A 3QV1A 1F3OA 4P82A 5JDIA 2JC3A 3C6BA 4MEBA 2B1GA 1D1PA 3H5IA 3W2HA 4DDVA 2XTNA 1U7ZA 3G5LA 3LI2A 3EZ2A 1CERA 4N7BA 3KAJA 4JIGA 3BQ1A 1GKUB 2XRYA 3KXIA 4F92B 1EA5A 1YZKA 4O7NA 5FOQA 3T9DA 5J1SB 4KUGA 3GNTA 4LFAB 3JYQA 4RGQA 4IHJA 4OK6A 2XSZD 1RWOA 1U9YA 4PQFA 5E6RB 3BFVA 2MR6A 2R92G 4M1QA 3ZU3A 1JPUA 4JYMA 4ALLA 3GIDA 4R1QA 4DSOA 1K89A 2HMSA 1N4DA 2IY7A 2QDKA 3L3BA 3T9BA 2CKZB 2A1HA 2JI4A 3M6UA 4RIIA 4Y0NA 4B3CA 3DV0B 2M05A 2QM3A 4G6ZA 3RIGA 2RHJA 3AL3A 4F2GA 1WZNA 3FTDA 2NYVA 1LPSA 4C7OA 4TV9A 3HOVG 4PYQA 5DHPA 4F9TA 5DBEX 2NZJA 3SU8A 1HE5A 2G04A 2I4OA 3QQPA 4HLQB 3WRXC 4WJLA 3P0EA 4XSHA 4JOQA 3NBYB 1PT8A 1XDUA 2ZJ0A 1HK7A 3ZTYA 1I2CA 1L4GA 5CIWA 1V3VA 2PKXA 5HF8A 4R8RA 4TS4A 1O8CA 5EMLA 5JSFA 1QZXA 5TXGA 4C4AA 2I34A 4KO3S 4O2AF 1BC5A 2EW2A 5A2GA 4LF9B 2V6MA 3GTJA 2ZSJA 4IYRA 5EIAA 2KS6A 1YB7A 2C88A 1G7RA 3HYSA 3ECCA 5E7MA 5IBCA 3H5RA 3C4JA 4HNAB 3QMMA 3QUBA 1N36B 1FIUA 5JNUA 3NBZB 1XMVA 1QCYA 3IMEA 3EGOA 4IH4A 3F7NA 1PNVA 1IBCA 2J3LA 1JLSA 3LQQA 3FZEA 3QYAA 4NYMR 3DOCA 4P4SA 1H2AS 4XIFA 4Y3UA 4DV5B 4JLJA 1CUYA 2FPIA 1MT0A 1VA5A 1JSZA 1ZG3A 2X6RA 4GOXA 1IJKA 1ECGA 2H51A 4PLZA 2VDVE 5KG6A 1RJFA 3BILA 1DEXA 2C2EA 4M0EA 5G53C 3HOXG 2XI4A 5KFJA 3LBFA 3NGXA 4Y67A 1E64A 2DTDA 3C3KA 4NRDA 3CO5A 4BMVA 1R4MA 3RVSA 1ZWKA 4DUPA 2OV4A 3FVTA 2E89A 3L8EA 5JWRA 4UHDA 3UV6A 3STVA 2UYYA 3C48A 5EJMA 5E8JA 1KZ1A 2M6SA 3FWHA 5DT2A 1I3QA 2DMRA 2PSSA 3BQ0A 1D7AA 1OZGA 1WULS 3J7AK 1Z6AA 2R2AA 4QPCA 2IH4A 2IUEA 4JNCA 5EAIA 1IPEA 1DKPA 4JB3A 3ELYA 3USES 5LU8A 2COGA 5E1DA 1P91A 5LJIA 1RJQA 2XCPA 3LPAA 3N74A 4LSMA 5HKLA 3HUTA 1L5LA 1NY5A 4CCAA 1CUSA 3OM0A 3ZX5A 4CMJA 3RSLA 2ZPTX 4H3HB 4OYHA 4P4LA 3VYVA 2IOHA 5I01A 3LVFO 2WJIA 1A5BB 4RLHA 3W8FA 4AUMA 3R40A 4QWCA 4Y7CA 1U02A 3K9WA 2CJPA 2EX4A 2F4NA 2FKNA 3KR0A 5IC4A 1KKMA 3EF0A 1PGJA 2OGTA 1G6Q1 3CNLA 5ALSA 4G86A 1SK8A 2DFLA 2ZUUA 2FWJA 1ZJ5A 3FOAA 1MQ8B 4XDYA 1X9IA 3PFFA 4LRXA 3CC8A 3VC3A 1NQTA 4QDZA 1JEDA 2XYVA 3JSAA 2O7NA 5ADWA 4TYQA 3IOEA 3N28A 3V4VB 5EWFA 3CEPB 2NZYA 2QA5A 2BE9A 4U63A 5AKLA 3WWOA 1PKXA 3WQBA 3TXAA 3Q15C 1GFZA 2I80A 3P7MA 4IYJA 4FWTA 3BABA 1HE4A 3FKJA 3MWEB 1T6XA 4Q19A 1V8OA 2DUNA 4YR7A 6GPBA 1DOAA 1K3FA 2MTBA 1KXZA 3JSLA 1ULBA 1CKEA 3CU5A 1XKLA 1MJHA 1D6JA 2GM5A 2V8OA 4DR5H 1JXAA 3ILSA 4KVAA 2J67A 4O08A 3TUJC 3U4DA 4H1UA 2J5QA 1H66A 2PXXA 2PS0A 2VQDA 3BGDA 3I1IA 1M7HA 1SOAA 4OY3A 3KYBA 4Q6WA 4YBZA 3RO7A 4D6PA 3PR3A 4C2MA 4G3XA 4X5OA 1MAHA 2CW8A 3MOSA 3R5KA 1QGED 1VG1A 3RI3A 1YSCA 1ACLA 4G4IA 2EFDB 1NXPA 2NZ2A 3AP3A 3ELDA 4HAVA 3DL0A 4JB0A 4LV5B 4WQMA 1Y3CE 4WRRA 3VI4B 1CEEA 2Q29A 1BW9B 3EH1A 3IUEA 1JXQA 2H3EA 2GN6A 1X1DA 2I1WA 2ZRFA 4ML3A 4WXPA 1Y1PA 4Y2RA 3UUEA 2JHFA 4C4RA 1GQ2A 2WAMA 1JL3A 2JJYA 5KKCA 1BDBA 1IU9A 1W0JD 1WL8A 4KXXA 2YRFA 5EJ7A 3AMVA 3T1NA 2UZ1B 3ZBQA 5JARA 3KVRA 2AK2A 1GQYA 3B52X 3G1WA 2M1XA 4FUTA 4IV0A 2VOJA 4J7AA 4XQGA 1V8PA 4FDMA 5ALGA 4WT7A 3B5JA 4ZCQA 5IAAA 4B17A 5C81A 1XALA 2I54A 3E9ZA 4NOMA 1E99A 1E5VA 1V8FA 1VAJA 4PZZA 3QMPA 4V0SA 3UUFA 2EL9A 4M60A 4PRYA 2XQIA 3UMMA 3ESQA 3H19A 1UDXA 4YUWA 5DAAA 4BBJA 2YZMA 1G2PA 2FMKA 1ZJ4A 3EVGA 4FQ5A 5B6IA 1OYYA 1QS0B 3AKDA 1IPFA 2W9XA 1FMFA 3STWA 2B69A 4LF5H 4MINA 1YAJA 5EN4A 1RWPA 3QXCA 2QUZA 3NBFA 1B33N 2HW8A 4CKWA 2WAQE 3OZUA 3K05A 4LVOA 5K3WA 2OE2A 3I23A 3N2NA 3HS3A 2O8NA 4LJAA 1PX2A 4NZZA 4G0YA 4HH3C 4REMA 1BCSB 3LZDA 1Z06A 2H1CA 3W5CA 1E77A 1FFXA 1DQNA 2IZ6A 4IRMA 4UM9D 2IYYA 2A5JA 1JA1A 3AOGA 3W5AA 5IUNC 1DAHA 4DUGD 4LRWA 4ZVMA 4YV0A 2P6MA 2NMVA 1HZZC 1K2WA 2HRZA 4O4HA 4E31A 3QVGB 2MINA 4MQBA 4LI3X 1PSZA 3B1JA 3QLJA 3ZWXA 4F11A 1H1LA 1PK9A 2Z5GA 4NXMB 3KCNA 4NEHB 3UFXB 1RJDA 1QGUA 1P5FA 3IKJA 3BE4A 1NVAA 1NRWA 4AKTA 2QU7A 3BMCA 1KO8A 4O4HF 3MD0A 3EXIB 3I28A 5LN1A 2BHSA 1KA9H 2QJWA 2V55B 3DKKA 1E9BA 4IMPA 4CFZA 1LK7A 1FDUA 3RWOA 3F8NA 1RVV1 2V9PA 2YVLA 3FAKA 1X42A 3KYDB 3MF4A 4LSGA 4ZN6A 1Z6XA 3PW5A 4TM7A 1QRUA 1NQOA 2YXBA 1FJGB 2NN3C 4JT8A 3LWDA 1P4AA 2DFPA 2ZE8A 3LXMA 3THWA 2AW3A 2YJZA 4QJFA 1OFTA 4LKRA 3WICA 5G0UA 5DTIA 1HE8B 2SKDA 3LUAA 3TBFA 2BVNA 4BWSC 4DR3H 3BB3A 1HE1C 3DZCA 4B83A 1QOZA 3GJYA 4L7QA 1R3DA 2WKQA 4YP1A 5JE8A 2PZLA 2ZDHA 1WPRA 3PNBA 3C97A 3IXLA 1F0NA 1HV8A 2OHXA 2RGNC 2XNDA 4EHKA 4TN1A 3HSKA 1BX3A 2JIDA 5JJKA 2CNBA 4DDUA 3RJZA 1LPAB 1TKRA 1TZBA 1NURA 5KB3A 3STYA 1N5OX 3RG8A 3UYLA 5IAKA 3DVSX 4G4JA 3NORA 2IF0A 3TWOA 4C4PA 3ZDAA 2GA9A 4CMFA 2OKGA 4ETNA 4PYLA 1YV9A 4TSFA 2NV0A 5U9CA 4GI7A 5KFCA 4YT4A 2V7QA 2H9AA 4GX5A 1WMEA 3OZDA 3H9BA 3LG2A 4CKXA 2GEFA 5KEIA 2X5RA 3IODA 2R8EA 3MYYA 1ZN9A 3DNFA 4Y1GA 2ECQA 5L3SA 5TVKA 4D25A 3CVXA 4QW9A 1B7GO 5CRIA 4LVCA 1N1EA 4YMIA 4P7GA 2V7EA 2C4NA 2P5YA 2A88A 3OZIA 4M0KA 4F4IA 3GEIA 2FV8A 3VKFA 3HXPA 1DCFA 2EHDA 4BVLA 4EG7A 1G9SA 4NYIR 2QMUA 3F6PA 3ML1A 4BNJA 4MXDA 1XO1A 4IKEA 3R9RA 5CGQB 4CT0A 2JEFA 3FFWA 1XJ5A 1WXIA 4AULA 4RE5A 3I1FA 1AA6A 4DLZA 1OJ7A 1AHNA 1XP5A 2J7KA 3JZMA 3QVXA 3KQWA 1MBZA 4ZO8A 1KSGA 3SSAA 4CR8A 4LNUB 1YIAA 3AR5A 1GQFA 1UBHS 2AZDA 5LBUA 4NG5A 5DCYA 2DBZA 1YJCA 5EXPA 3LUGA 4QGBA 2ZULA 1C3EA 3FSGA 3OCVA 4JOCA 2PWYA 3KPWA 1FQOA 1P1CA 2GEDA 2IP1A 4KDCA 4PNZA 5KG2A 3FVVA 4WLUA 4EB0A 4UBKA 1Z2OX 3VV2A 2D7JA 4DMHA 5L6MB 1GV0A 5D5QA 4PXYA 1PWXA 2AQKA 4U7CA 4WPGA 4F84A 4RHUA 4CXMA 1G8PA 3EPHA 5A06A 1Y9JA 3GIQA 1G2OA 1PTJA 1JLLA 2Z3VA 4QLOA 5ALTA 3KKQA 1G3UA 1SBQA 3ZD7A 4KR7A 1QFSA 5CCEA 3OZSA 3VNUA 3UOWA 1GDDA 1NY6A 1QX4A 4EIWA 1W2WB 4AP5A 4COKA 3MTEA 2L18A 5LQJA 4MIKA 1UKAA 3F74A 3O9MA 4GBED 1N1MA 3ECSA 3JSNA 4GYWA 2AG8A 3RPEA 5CFNA 3VTAA 4ECXA 5C8DA 4QIWE 2AMJA 1J56A 3U6KA 3CZCA 3R23A 1NVDA 3VOAA 2OLEA 3PUVA 4L72A 2X1HA 3LBHA 4XCXA 3T9FA 3U9SA 1RHQA 1WDMA 1OLSA 2BM8A 3CJQA 2ZSAA 4IIJA 4MYCA 1FSZA 1VRWA 3H2IA 1Q77A 3HZOA 4OX9Y 1USGA 2BHLA 5A62A 5EZYA 2WIGA 2WMOB 1MU0A 3TL3A 1L2TA 3TAUA 3HOWG 4KWTA 4MX8A 3EWAA 4RPJA 4B7CA 4BKPA 2Z2XA 1D0IA 4I5GA 4PX3A 2BEVB 2CL6X 5CYPA 1A98A 3A8TA 4PO3X 4QZVA 4GX1A 3ZJ5A 1RADA 2ATXA 5DMXA 2I71A 3QZUA 3NM5A 1SELA 4MUHA 4UCOA 1ZUWA 3GVHA 4HKTA 2Q3CA 3OOHA 4LK3A 5ILOA 2CV1A 5KNBD 5FWXA 3S5JA 1I1KA 1JW9B 2JFPA 4N5LA 2YUIA 4DYVA 3AC0A 4BP1A 2G07A 5A0VA 1KRXA 5J5VA 4QJBA 2BW0A 1B8UA 3QJGA 4E11A 5IJZA 2OHGA 1QC5A 4EBEA 2YJ6A 4IGAA 1HYGA 1Q1BA 4EYSA 1OC2A 5AQ1A 3EDQA 1KHHA 1GTRA 1EDOA 1X7YA 4MV3A 1Z2NX 2WZQA 3IC5A 4KQIA 4LISA 1MW9X 2RJNA 3UK1A 3WLIA 2CNUA 1YZYA 1GDTA 4DCGA 4UTRA 5AUQA 2R8PA 2NGRA 4IXWA 1TM5E 4LS3A 1QG4A 4C6HA 3WNZA 3QVUA 4DG9A 4EHAA 2WQ6A 4BXXG 3L4KA 2Q5JA 3VJKA 3B1WA 4YBZB 3COZA 2FJPA 2V98A 4KH1A 3SQDA 2AMYA 4JLBA 1Y3DE 1X7ZB 2ERYA 4YMGA 5I5XA 1NRJB 4AS2A 2ESRA 5GMOA 1DMSA 2MU1A 3DCIA 1G59A 2Q4DA 5KTYA 3C43A 3T5MA 1ISJA 3GF4A 3H3JA 4D0GA 3GGSA 2WICA 4BN0A 2VA3A 3OZAA 3NHBA 1IJEA 2G40A 3OSZA 2ZSIA 2VQ6A 1OASA 3K9CA 3QZ8A 4JBHA 1BWQA 1KVQA 4ZDJA 5K3BA 3T7JA 4C3OB 2FR1A 2JFWA 1FRQA 1GPDG 1KIAA 4R31A 4HVAA 4N18A 4CL3A 4BE7B 5AJTA 5E8RA 5FJJA 4CGYA 3P2OA 1KHTA 3OJLA 4LY3A 2YW9A 4II7A 2NPFA 3OX1A 2R85A 3DWGA 4RWEA 1T3ZA 3EXHA 3NOQA 2O0JA 1IHUA 1XTKA 1E6UA 2PO7A 1N0UA 4IFIA 3VR5A 4K05A 1M0SA 1ZGZA 3V2HA 3P26A 3OTQA 3EPKA 2COIA 2X2PA 4JI2H 4G8BA 1Q7TA 2AN5A 2TECE 2YDXA 3JD1A 1BCRA 1TK3A 2Y1KA 3QFRA 4D74A 1RLOA 1ZM9A 3WIUA 2H5LA 3HA3A 1DEOA 3DF9A 3PVCA 1E5QA 3P9XA 4DMUB 3R44A 3NC1C 1XDBA 2A3NA 2X14A 1Y6JA 3DAFA 4HPWA 4BNYA 3CB2A 4K8RB 1LNZA 5DX1A 4OM8A 1FRZA 1K6IA 1DXOA 4KGXA 4U5QA 3OZCA 4Y2PA 5FLKA 3JVDA 3V8BA 1QKJA 5A4KA 2I65A 2VO1A 1J8FA 1N5DA 1GUBA 3S1LA 4NHEA 2WLTA 3URKA 4C05A 3INTA 4DIUA 5FWDA 4B34A 1HFJA 5C2JB 1QONA 3HR4A 4EO9A 1HNWB 4MCHA 4KVZA 4JX9A 4JLWA 5EIFA 3GFQA 1VPTA 1XAGA 1F38A 5LXTB 1N92A 4ZDKA 1YC5A 5GONF 3B60A 3WA6A 5L4LA 1XT6A 2C2MA 2XUOA 3NLLA 2XCAA 3NC0B 4LSXA 4X7MA 3PD1A 1AU9A 4PLFA 3DB1A 5EL0A 5CM2Z 5U4QA 1NW7A 4KQMA 1DTSA 1FNCA 4O8CA 2NZ8A 4RNCA 4XLZA 4YV2A 2OV6A 1H4QA 3GZJA 2HYIC 1VHQA 4A3MG 5G3ZA 2F55A 2OO7A 3T95A 1L7BA 4LBVA 1RJEA 5ICEA 3W1BA 4Z49A 3QEMB 1JN0A 2QD1A 3OCCA 2YY5A 4JJ7A 1QFYA 5DNEA 1ABEA 1X3LA 3A4TA 2G08A 3P0HA 3AVPA 1TFUA 1FTWA 1XBTA 2QTTA 4PHFA 1J5XA 3VVMA 3F6RA 4I2VA 3D54D 3FKQA 4QGAA 4U39A 4D3DA 5BSEA 2WVAA 1E6WA 5L3VA 1A95A 1U9ZA 5BYJA 5KFEA 3F47A 4CDMA 4OOFA 1V25A 3ZLJA 2ZB7A 3AWIA 4GXRA 1E7QA 1FUUA 3HVHA 5A9RA 5AM3A 3NIGB 5KT5A 2P8SA 3NRBA 1WABA 2GHRA 1QVVA 3W9SA 4DPKA 3IYLW 2FCRA 1BKSB 3A2KA 4RZIA 4F6RA 4QUAA 4UHKA 4OHFA 1FNMA 2PRJA 2R97A 1E98A 2V0NA 2MCTA 3E9DA 4YQFA 3S1AB 5E2BA 1CSEE 3RABA 1CNMA 3RKUA 4KWEA 3OMWA 2LCQA 2Q99A 1TECE 4URUR 2XZOA 1QIDA 2ASEA 5ESWA 1DBVO 3VGPA 3I4LA 5IP5A 1CRPA 3KHSA 1IHPA 2CLLB 1QHGA 2BGUA 3GN2A 2P3SA 3R09A 2ZRQA 3PC7A 2QKYA 1RRKA 2IHYA 1A7JA 3K4PA 5EGSA 3F4LA 4UCUA 4BV3A 2DUMA 4CLEA 3DGEC 1P7YA 2MMGA 4X62H 3H0CA 1TA0A 1GL7A 1JEYB 2X5JO 4EDHA 3DBHB 4E5SA 2WAAA 3DEIA 5D6OA 1YNSA 1C81A 3NBAA 5KHOC 2OFWA 4BASA 3PX2A 3IV9A 2B34A 4XCVA 3EJWA 1QP8A 2BMWA 2J0UA 3OKPA 5D85A 5LP6A 1E20A 1ZM7A 3SC6A 5JD4A 4Y1RA 1VI6A 2J5KA 4NU8X 3EULA 4M49A 1FS6A 2PBZA 3VMMA 1O94C 3AJRA 3G2OA 3HYNA 2HJHA 3KJEA 3LJKA 3NTQA 2UXCB 5HRCA 1EB9A 4B6OA 3PW4A 2HRBA 3W3ZB 2CGEA 4A5SA 3VPSA 1TC2A 3KKNA 5JD3A 3O8RA 4ZK6A 1MO3A 2W7PA 3BWYA 5JVDA 1UKZA 5I7RA 1I4LD 2CV2A 1U1IA 1XD2B 2RHLA 1KQOA 3BZBA 4HDKA 5DX0A 4ZVPA 2YN4A 3AIIA 1JTVA 4HDCA 4NNJA 1D6MA 1GTJ1 3DDWA 5AKHA 1N2OA 3T5DA 3EVAA 1YUMA 1LBQA 1XAIA 3P0IA 2DULA 1XEXB 1Z3IX 4E3WA 1E2LA 3EMVA 4R2XA 2FLKA 2FLLA 4UM8B 5DCWA 3U9LA 4EA8A 3KL2A 4O2BA 4Y6OA 5DXJA 5I48A 2FAXA 1KMCA 1TO1E 2CLFB 1X14A 2FX5A 4A0HA 2F1JA 4H7JA 1DVRA 5JATA 5JCOC 4MQEB 4B5LA 2BAGA 4RCYA 1LJ8A 1Z4OA 2GAIA 1QV6A 4LF6B 4IG9A 3AESA 3GDHA 1Z4JA 3BTVA 3DMDA 3DWEX 2WFAA 4LPKA 3E3NA 1MNAA 4FE2A 3ORHA 3A37A 3KQMA 3S81A 1T9GR 2GGSA 3VR2D 4ZT4A 1PZHA 2RONA 4KIWA 1IM5A 2GRAA 1QQBA 5ICSA 4CF4A 3L05A 4XUEA 1TK2A 4OX9B 5CCDA 4GS5A 5L40A 4HNSA 4I1RA 2I6FA 4IGFA 1QAQA 1U81A 4DGQA 2D2VA 1J00A 2E6UX 2X2OA 3MLBA 4Y2YA 3HXMA 4X93A 2CFOA 5KSZA 2FU5C 3QFTA 3S7ZA 3ZVNA 4ENQA 1Y48E 4UNIA 5HQTA 1QIEA 3C1AA 4AO6A 2HFKA 2QP3A 3IDAA 5DLFA 4QDXA 5CVVA 3WLSA 5BV7A 1KMMA 1P9OA 3MWGA 4LKOA 2PANA 2W0MA 3GDEA 3VTZA 1YOBA 1PEDA 4RTPA 1RLUA 1FRVA 1A9ZA 3RARA 3SZRA 5HVNA 1OGIA 2BMVA 4AB1A 2DQKA 3D1LA 3H3VH 3D2CA 3NONA 2H5IA 2H4HA 3PPYA 2HQSA 5JYDA 1M2KA 4X1IA 2EDCA 3D5EA 4A8JC 2V3VA 3QTTA 1ZJ6A 4TPKA 1W5BA 3DMTC 2EWVA 2ID7A 1PD1A 3QJYA 2FWRA 2DRIA 1M74A 4Y6SA 5L3SB 1ZH6A 3NHKA 4X64B 2ZT6A 1S0NA 4P3OA 4RZ3A 1X7WA 3WIVA 1V96A 2ISCA 4A2PA 4F45A 2WU0A 1PIWA 3IESA 2HXSA 5G4KA 3G6YA 1ZGCA 5IVIA 1WV1A 3MBOA 2Y1DA 3F5FA 5B3AA 2IIQA 3PJDA 2WFLB 1QLWA 4K8OA 5KYVA 1Z2CA 5F4BA 4Z7QB 3IGFA 4F6RB 4DBVO 4GSLA 3OIUA 1Q0SA 1JDEA 5EIOA 1ZESA 4C20A 5J4LA 4IMRA 1X7WB 4TLMB 2AFHA 3FAZA 3HY3A 2R11A 5DN6A 2ONYA 1VSVA 1FTQA 4GQBA 2XRFA 4PW0A 1BA2A 3U17A 3GARA 3ZDEA 4Z3DA 3F9IA 2R7MA 3UH1A 3Q85A 3FSEA 3PL5A 3QPCA 3ZKAA 1IZYA 2P0AA 5EI5A 1MC4A 1O77A 1G5FA 4C29A 3HNPA 2MIIA 4YCDA 5HKKD 5I8WA 3H17A 3HB7A 4FVTA 3IAM6 3T3DA 4RTLA 2IQ5A 3GIWA 3SSOA 3BFJA 2JHGA 3KR1A 5E6UA 3RKRA 4DW8A 3PC8A 4J1NA 5EJ6A 5L3QA 4EWLA 1X0XA 3IO3A 1KPGA 3ER9A 2EKDA 5DI3A 2V7UA 1VE3A 5KFAA 4BRUA 1CQPA 2C4TA 3BE6A 3KTFA 3TOVA 4D8XA 2QHXA 5DM70 1JDNA 1YO6A 4EGSA 1VLHA 5LR6A 2VPTA 2I1VB 4OYRA 1KAHA 1UKYA 2O8DA 4OG2A 4RSRA 3WTCA 3R74A 1JZQA 1R4AA 2PMFA 2C4VA 5JZ9A 1GO3E 2QBYB 1HQCA 2ZRCA 3HXTA 4FK8A 4IJKA 1HQKA 3M82A 5DGTA 2NM0A 4PNHA 1BGWA 3QXSA 4UXHA 2MINB 2OB2A 3JW8A 4YC7A 4BLRA 2GAJA 1WZIA 3NDBB 5F1PA 3BA8A 1DU4A 2EQAA 1L5NA 1RRCA 4F38A 2AHOA 1QM5A 1IUNA 2BFFA 5DW0A 2R48A 4J49A 2G1JA 4YX9A 4AW9A 5LQDA 1AK2A 3L1JA 2FWIA 4H4CA 2A30A 3IQXA 4MPRA 4RZRA 1PG2A 2JJ1A 4AIRA 4NBTA 4DADA 3KHRA 1P0PA 2GEKA 3X3HA 1L5VA 2LWIA 1I24A 3I32A 2G0NA 3I61A 1ESCA 3HYCA 4J3FA 4L75A 2OAP1 4LXIA 1XRQA 4EFKA 4CCYB 4RFSB 3FBGA 2I4RA 4WECA 5L6LB 2GSDA 3H3FA 4L8LA 5AVSA 1GP2A 1A1VA 2B5OA 3MS2A 2Z4TA 4I55F 4TXJA 4RK0A 4C30A 2FPGB 1PFQA 2ZUCA 1QP0A 3R7LA 1CP3A 5K0NA 2HDKA 3BWXA 2V7GA 3HWSA 3N41B 4DLSA 1A5AB 1GT91 1WCIA 4HX2A 4W8GA 1S3SA 3H1BA 3UK6A 2AZXA 4XYMB 2V6BA 3F1LA 3KRTA 4O86A 5FUMA 3LDGA 2P78A 2QQFA 2WZDA 4MKRA 1DIOB 1ECBA 3E84A 4A3BG 4DA8A 4K03A 2ZJ8A 4RAZA 1X92A 1DO8A 2DM6A 2IYWA 5CVCA 3ZGOA 3L7OA 4ISCA 3R3YA 4DCPA 1TIBA 2Y2UA 4TUYF 1ONBA 2HGZA 5KVQA 1B73A 1ORWA 3A3NA 4RK7A 5F9NA 3E3LA 3IAXA 1CUJA 4UKDA 1H6DA 5FBRB 3SBEA 3PC2A 4GR5A 4ND3A 4FYHA 2LTAA 1XVTA 3RCBA 2E4ZA 4RVCA 2ASVA 1W1IA 5DYGA 5KT6A 2W9BB 2IA6A 2IMWP 3KOYA 1L1FA 4Q1AA 4OJYA 3TFWA 3WNDA 1CB0A 5KWIA 1JQAA 4LSAA 1N2SA 1U9CA 4OQZA 4RHYA 3CG0A 3TFQA 3H8SA 4ZYYA 5HRAA 4RWZA 1YRWA 2ZUBA 4CT5A 5BT8A 4V0ME 4QYIB 3PQEA 3R7FA 3N5CA 4TXNA 1ZM4A 2YWEA 3RASA 3VA7A 2E7ZA 1BIFA 4DLKA 2O20A 2W6JD 3UHPA 3N7UA 5JZOA 3L04A 3DE4X 3GFPA 3MWEA 1KH2A 2QGFA 2RHTA 2XDYA 3BKWA 2UDPA 5AW4A 1E3LA 4B0PA 1U0OC 1NXVA 1Z33A 2B3TA 2R86A 4LRSB 5EC8A 1EUDA 4WZAE 4B1FA 3ELUA 4F06A 5KFUA 4JU8A 6Q21A 3Q10A 4MWGA 2WQZA 3W4JA 3NC4A 3OX4A 4IW3B 2D5IA 4R5HA 5I9BA 2HTFA 1RRVA 5CDFA 3U3OA 4D0LB 2B0CA 3SLRA 3H5VA 5KQLA 2HV9A 3FW1A 4CUZA 3SGIA 2QQ0A 1ZCBA 3WKCA 4O3OA 1OFUA 3TUIC 2NU9A 4B46A 1LSSA 4PS0A 2AC2A 4YUYA 3EZ6A 1SKYB 4HDMB 2HGXA 3C6XA 1XR3A 3EIEA 5EWEA 2BFDA 4HDSA 4JC0A 4XWGA 5ALPA 4CETA 2C61A 4D46A 1H3EA 5A2QA 3ANYB 2PO5A 4GPD1 4X8OA 1N34H 4D26A 3MWYW 3AUUA 4UVGA 5ENVA 4DV2B 3BXFA 3OIDA 1EZ1A 1HQDA 2E4YA 3BMXA 1ZETA 2E4AA 4KN5A 4D81A 1FS5A 1MEOA 1IN7A 3N0TA 4LYJA 3H4DA 2REOA 4KVGA 2ZAGA 3P9IA 4DE5A 1ND5A 1XZQA 1BMFD 4HLCA 4RNMA 1FFGA 1G16A 1OB2A 3W8EA 3T54A 2QGNA 5L1IA 5LZ4A 3HFGA 5ALOA 3FFTA 4EBFA 4IIEA 5AXAA 2DR2A 1KZHA 5A4DA 2Q3HA 4FYPA 1PFVA 3TIXB 4KLNA 1SU7A 3WBJA 1BE6A 3DNMA 2JCSA 4IL5A 5IS2A 1WCYA 1HT1E 3FPJA 1DHRA 5ENDA 3ETJA 1E4EA 3RV4A 1I4TD 2RBEA 1HDXA 3DONA 5JAQA 4YPVA 1GPH1 3O4GA 1ZO8A 2RI6A 1ZNWA 3ICOA 1YR8A 1PV2A 1CQXA 1YB2A 2IL1A 5DLEA 1KE2A 4Q45A 4FKZA 3SSNA 4GOMD 5LL6b 1VLZA 2W22A 3IELA 3JD0A 4C21A 3CINA 3BTSA 1PLLA 3QXHA 3ORSA 3U4HA 1OXBB 4WHXA 3BZUA 4AYXA 5HBRA 1KTVA 1YKFA 3PVXA 1SVIA 1U6IA 3AOEC 1H2HA 3HJRA 2Y1GA 2D5AA 4TM8A 3AVXA 1RBZA 3PWTA 4P3KA 4IINA 3PUIA 3CONA 2PZ8A 4H08A 4X45A 4FILA