2IP4A

Crystal structure of glycinamide ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
MKVLVVGSGGREHALLWKAAQSPRVKRLYAAPGNAGMEALAELVPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVPVVVKDSGLAAGKGVTVAFDLHQAKQAVANILNRAEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVAPYPMDEATLRRVEEEILGPLVRGLRAEGVVYRGVVYAGLMLTREGPKVLEFNARFGDPEAQALLPLLENDLVELALRVAEGRLAGTRLSWKEGAAACVVLAAPGYPESPRKGIPLHVPEPPEGVLVFHAGTRREGGRLVSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords Phosphoribosylamine--glycine ligase
total genus 108
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2006-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ip4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ip4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ip4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ip4A04
2V59A 4YB8B 1VBGA 4DIMA 2W6QA 2IP4A 3BG5A 1EUDB 2YRWA 3JZIA 2CNVA 2YZLA 1GSOA 4IIJF 1UC8A 1C30A 2GLTA 2ZDHA 2CNUA 3TIGA 2YS7A 3WNZA 2GPWA 2YYAA 3Q1KA 1Z2PX 3WO0A 1M6VA 2R87A 3HO8A 4IZOA 3G8CA 5K2MA 5C8YF 3MWDA 2J9GA 1GLVA 3BFPA 5EZYF 3AW8A 4O7WA 2ZDGA 4TV8F 3KAKA 4C5BA 5J2TF 2NU8B 4O4LF 4J6EA 4M9UA 3MJFA 2HGSA 4O4JF 4EGQA 3RUPA 5JQGF 3VMMA 4C5CA 4MV6A 3U9TA 3TW6A 4FFNA 3LP8A 4YAJB 2FB9A 4HNTA 4O82A 2W6PA 4IHJF 4ZHQF 2GPSA 2R7MA 5FNVF 1VBHA 3VOTA 4O2AF 4MV1A 4XYMB 5LA6F 1EHIA 2R84A 5CAEB 2NPOA 1CQJB 4ME6A 3G8DA 3DF7A 4FFMA 3TIIA 4EGJA 3ETHA 2XCLA 4GGMX 4O7RA 3RV3A 1KEEA 5HV6A 4XZ3B 2QF7A 4FFOA 4FFLA 1AUXA 5C1PA 3VPBA 1DV2A 3BSWA 1AUVA 2VHEA 2XD4A 1C3OA 3VPCA 3KREA 2YZGA 5JVDF 4RZQA 4O7ZA 1VKZA 3R9RA 2NU6B 2FPIB 1KBLA 2NU7B 3R5HA 2WYOA 3U9SA 1A48A 2YW2A 3SE7A 2V58A 4TUYF 1WR2A 3NUAA 4YJ2F 2W6NA 2R85A 2YZMA 1M0WA 2YZNA 1CQIB 1M0TA 1I7LA 2Z04A 1UC9A 3GLKA 3R5FA 5JVLA 4XX0B 3UFXB 5HBRB 4M99A 3OUZA 4ZQIA 2R82A 3ORRA 3U54A 1SCUB 4L1KA 1EUCB 1KJJA 2P0AA 3TINA 4MAMA 2DIKA 3I12A 4HNUA 2VQDA 3N6RA 2ZDQA 3V4SA 3E5NA 1E4EB 1KJQA 3HBLA 4FU0A 3ORQA 3AX6A 1BNCA 2FP4B 4EAAA 4O2BF 2YS6A 3N8DA 4MV8A 3V4ZA 4O83A 1CE8A 4EG0A 4YAKB 2SCUB 2CNQA 1PK8A 4O86A 4XYLB 1JDBB 4EA9A 2GQRA 3R5XA 5J2UF 2YL2A 4WD3A 2Z02A 3BSSA 5JQWA 5LYJF 4O7VA 2C00A 4O7TA 4Y8VB 3KALA 4E4TA 1KJIA 5CA0F 4O7LA 4EA7A 1A9XA 2W6OA 2X0SA 4FE2A 4O7NA 4MV3A 3WO1A 1B6SA 1GSAA 1PX2A 5D8DA 2DWCA 5LOVF 1Z2OX 4MV4A 1BXRA 2W6ZA 5LXTF 4MV7A 1EZ1A 1DV1A 2I8CA 2VPQA 3KAJA 5C1OA 1IOVA 1JKJB 3JRWA 1KJ8A 2NU9B 4IWYA 3VPDA 1KUTA 4O4HF 5I47A 2YRXA 3R23A 3K5HA 4O7YA 2R86A 4DLKA 2GQSA 1JLLB 4WBNF 1IOWA 3BSYA 4C5AA 4O4IF 4HQ6A 1JDEA 4QSHA 5KX5F 4EA8A 4IWXA 2NUAB 4MA0A 5BPHA 4I55F 4I50F 4MV9A 5CA1F 4M9CA 1EYZA 1ULZA 3OUUA 1CS0A 2PN1A 5GONF 2W6MA 3JZFA 1T36A 4FFPA 5CB4F 2OLSA 2QK4A 2PVPA 3U55A 4O7SA 5DMXA 4I4TF 4O81A 1W93A 1DIKA 4FFRA 4EABA 1I7NA 2I87A 4HR7A 4O84A 2W71A 3K5IA 4ZOLF 5BMVF 4NYEA 4YBZB 2FPGB 2PBZA 2VR1A 1B6RA 2R7LA 1KC7A 4ZI7F 3Q2OA 5JH7F 1GSHA 2R7NA 4HNVA 3K3PA 2DLNA 1W96A 2W70A 4YJ3F 2CQYA 3JRXA 5IYZF 2YWVA 1OBGA 4M98A 3GIDA 4TV9F 2DZDA 3RV4A 2I80A 2FPPB 3RFCA 1OBDA 5LP6F 5BPFA 3LWBA 2HJWA 4MA5A 5H80A 1E4EA 2R6FA 5KKNB 1KJ9A 3MWEA 3TQTA 4FGRA 3HB9A 2R7KA 1GGOA 1Z2NX 2CZGA 3QFFA 2V5AA 3VA7A 3ETJA
chains in the Genus database with same CATH superfamily
1TM1E 3S5UA 1JPNA 4YLYA 4ZK2A 1Y8QA 2XQVA 4ML3A 3E9YA 4UXJA 5I5SA 1OX4B 1P44A 3FOBA 3C24A 5T67A 4ZHQB 3TRIA 5THQA 2YRWA 4RB2C 2HVSA 1E59A 2GOYA 3GMTA 4BFVA 4DIKA 5A3QA 5CM8B 3S24A 3E61A 1NKSA 2RJNA 4BY1G 3C70A 2Z2JA 1YGYA 3R8FA 3EH2A 1JKFA 3WLLA 1LDYA 5ICFA 3NVKI 1YJ5A 3C0FB 4QSMA 2BUCA 3T5LA 3CKKA 3V8NA 2H1HA 2NZYA 3U3ZA 4V2UA 5GWXA 4J76A 4C6TB 3UWMA 3W90A 5FPPA 4C4OA 2A5LA 4DV7B 5E9WA 3LW7A 2ZRHA 2AOUB 4PX5A 3ILHA 1MRNA 3PUVA 1ZH4A 2B7CA 4PNZA 5JFGA 1Z2PX 1USIA 2NYRA 1SU4A 3QPUA 3WL8A 1EBUA 2VP4A 1BE8A 3HU2A 4C3UA 4IZOA 1YC2A 4G23A 1KKUA 3AERB 2DPHA 3HKBA 2FUKA 3KLNA 4FR5A 4FVTA 1QE3A 1HR0H 3HU5A 1QTIA 3MQ4A 1GCAA 2M1XA 1XQVA 1JFFB 1FDSA 2HHAA 3AUUA 2WKPA 1TEHA 2F8LA 4EHFA 4KVGA 3WNDA 2JK0A 4O7WA 1U3CA 3PLRA 1XZHA 1ZWLA 3DG9A 1TQDA 3A4TA 3SXPA 1KR2A 2FSUA 2Y0EA 1E9SA 1OF1A 2NXJA 2YXEA 3DMPA 3DZDA 3I2HA 4G36A 4EG5A 3L1JA 2YIVX 4CM3A 1ET0A 5I5EA 4AUNA 4LF4H 3M89A 1XF9A 3PDIA 2DBVO 4UEQA 4BP1A 2AI2A 3DLTA 4LOHA 2I6XA 4F86A 3EXHA 3MR6A 3HJUA 4R1UA 5BWUA 3NAZA 4EKIA 4E1VA 3RB3A 3ZV4A 1NU6A 2GEJA 1FFDA 5HE8A 2NUPA 1XJCA 4YRKA 1GA1A 3C3YA 1TIKA 4A3MG 3F2VA 3K9GA 1GZVA 4Q6WA 5DN6A 4ZGWA 5CDGA 4I36A 2E4VA 1JILA 4MYSA 3UBMA 4OP3A 2D06A 2P9EA 5IMBA 2C98A 5LLTA 3RAFC 3KFXA 3ZWDA 1I24A 4JEMA 3BWMA 2DGDA 4KWHA 2Z08A 4JI1H 1QSGA 2DBYA 2HHCA 3PVXA 1CFZA 3EBPA 1XQWA 5I7HA 1EK0A 2ARKA 5L7YA 3VISA 3NAQA 2B37A 1CJSA 1VJ1A 4OREX 4RIFA 3RJTA 5K45A 4LF7H 3P2IA 3HRHA 1AURA 4OA5A 1G21B 3GH1A 3RKRA 1QCDA 4AJIA 5IT9A 3RYFA 1QO0A 2D59A 4MH0R 4MW2A 1UBHS 4CCAA 4DCPA 5C5DA 4IHJF 2AG8A 4MWTA 3S5JA 3T35A 4HGOA 2WF6A 1VBHA 1UBMS 2VA8A 4PN7A 4IG4A 4Q93A 2UUAH 1JKMA 2PUJA 3DS8A 3DZBA 3MYYA 1CR1A 1GV0A 3Q7PA 1GYQA 2GAAA 1DKLA 2Q5LA 4ZT5A 4O2AF 5K0CA 1XYVA 1JQBA 1VL8A 1OTYA 5JD3A 3EAFA 3HNPA 2IV2X 4DJDC 2R84A 2XUGA 4ND3A 2WJWA 3CBGA 3M9WA 5A05A 1EFVA 1T3NA 4X63A 4CL3A 1CQJB 2YYYA 4FI3C 4POAA 1YE8A 5K8IA 2X4GA 3ABSB 3VKHA 3GLVA 3DVQX 4HXEB 2Y1EA 5ARDA 1EWVA 2AMFA 4XI9A 1W5BA 2GF2A 5J9FA 3K73O 2YINC 4A0HA 1H2EA 4DV0H 2QL5A 5C8YA 3ZHXA 5IASA 3G9UA 1SBZA 2IZOA 3EY4A 3J7AK 1VI6A 3KVOA 3OCYA 3KWFA 1BWSA 4KQ2A 1XVAA 4HXFB 5ESXA 5H9WA 2PT5A 3OX2A 1ZNWA 2YICA 2H52A 4B3XA 1P3Y1 4TROA 2ZROA 1AK9A 3AHIA 3RV3A 4K1XA 2JH8A 4PDBA 1Z25A 2FRVA 3ND6A 1TK3A 3GLGA 2Q4OA 1AKUA 3FETA 4GOND 1DEOA 4D9MA 4OHFA 2R92A 1JG4A 1ZA1A 2IEYA 4YMIA 3E6AA 3IUPA 3OH8A 5KOHA 1JPJA 3JX9A 2BTQB 2GHIA 2AG6A 1NVVR 1OA1A 2A0KA 2QVLA 3AFNA 3VU3A 5C53B 2NZUG 2OENG 3PQ6A 3VMFA 5BN4B 3WWEA 5HKAA 5JANA 4RY8A 3Q3GE 1IHXA 3FDZB 1NVMB 3LM8A 5FLEX 3FR8A 3TAHA 4C6RA 2VHEA 1FQKA 1K7CA 4RU1A 2XD4A 1JQ5A 3CXUA 2O5CA 3VPCA 1YS2X 3L7MA 3PNVA 3EYAA 3STYA 3JSLA 3H3XA 2FPUA 1CUBA 1L6IA 1ZRHA 4YAUA 1N34H 1GEEA 5NULA 2XCPA 1E2KA 1NN3A 2IUSA 1ZQ9A 3VTKA 3DLHA 1E8NA 2H59A 4P53A 5CDFA 4UW9A 4BWGA 1UFOA 1TKRA 4EUSA 1VA5A 3SDSA 4MVJH 1F2TB 4B3BA 4TYPA 2HK6A 1G1AA 4W7IA 5TLSA 3GH3A 1NIPA 1HXHA 5BV0A 1JAZA 2R60A 3HWSA 3ZGVA 4ZN6A 2JG3A 2FPIB 3OJCA 1R9MA 2HDHA 4HZUB 4KDFA 4OB7A 3DE0X 2BIFA 4HAYA 3GEMA 1E7MA 2WT4A 3SU8A 1ZM9A 3UYLA 1P7ZA 5ALTA 5BT8A 4QVKA 4YRQA 1XA0A 1LU9A 1A0OA 1T0IA 4GIBA 3QUSA 5G41A 5HM8A 2PUDA 1UXIA 3OPYA 3GELA 4QPJC 1T3ZA 1WF3A 1QHYA 5DULA 5DX8A 4KZKA 2XTMA 1QM5A 3GPDG 2E4AA 3RANA 5HIJA 1GAEO 2RDMA 1TYDE 3HFRA 1D8AA 2WLSA 3ILSA 2AOXA 1X80A 4RPIA 1G59A 5LD2C 2NXNA 3TW8B 4RANA 5EQTA 2P6OA 3GHHA 4R69A 3WL6A 4JJ8A 2JIMA 4G8JA 1CY8A 1Z3IX 3WB9A 1DC5A 3RUFA 3O3OB 3C1TA 2EZ4A 4AP9A 3ORRA 1K5HA 4L07A 3U2QA 1D6MA 2EQ5A 3DE4X 2AXNA 2CVQA 3A32A 3O0TA 2O3SA 5KS8A 1KBZA 4NS4A 3M9OB 1NVKA 1EUCB 2D5AA 1G21A 1P31A 2BVNA 2F3TA 2H11A 1QHNA 3QP9A 4N3NA 4QQNA 2Q4BA 1M76A 1RYDA 3HCCA 4MVJI 2OBXA 3RS8A 3X1MA 2VUTA 4B3MB 1PYDA 4TV8B 1H1LB 1GZ7A 2OZLB 5TV2A 5SZIA 2XQJA 1MV5A 2DIKA 2PT7A 3HOWG 2IIPA 3JSXA 3OBBA 4LJKA 5M04A 2RGRA 1RJEA 3HKDB 4WWHA 1ECFA 2PFGA 2AR0A 1ENYA 2H4WA 4KH0A 4GX2A 4DV1B 3BQNB 3JPWA 3FYUA 3AK4A 3QVUA 2PIDA 3UJNA 1V5GA 1Z5OA 3CG4A 4I6GA 2VDOB 4HUQB 3OPYI 2YJNA 3L93A 2XF2A 3I5MA 1KTVA 4YRRA 4YRMA 1WS6A 3P32A 2RMKA 4MUIA 1A5AB 1Y8QB 3O5AA 4X85A 1OZAA 1WF6A 4CMIA 1NUSA 2JFZA 3BQMB 4A1OA 1VE6A 2IH4A 4QPPA 2PEYA 2R7ZG 1RU3A 4UEOA 4BO7A 4JI8B 1GFZA 2JJYA 2Z09A 4UDXX 2CUTA 4HLDA 4GRDA 2HNKA 3GIIA 1SN7A 3MCVA 3Q85A 1MX1A 4R9NA 5HGJA 3REQB 2O5VA 4BX0A 4DAOA 4PSUA 1VOTA 4U3JB 3QFCA 1GIAA 2OCLA 1W25A 2BGUA 5FA6A 1GO3E 1QAMA 1YA6A 1E92A 1NRIA 1R5NA 2F9MA 3FE2A 5KTMA 1HK7A 2BKAA 3PDWA 1D7AA 4PWZA 4DL2A 4RGYA 1RM5A 5B3KA 3L8GA 4IOKA 3MPUA 2P2DA 5EI5A 3NEJA 5KVAA 3UWPA 1WY7A 2ZB7A 3ZCUA 4WD3A 3PQ3A 3WMRA 2PH5A 1G7TA 2DULA 2V4RA 1I14A 1VCNA 2HADA 2R2AA 4LOLA 1E18A 2HSWA 4OFWA 3OKCA 2WWGA 3CLUC 4B4OA 2LVBA 3FMVA 4L5JA 2JGRA 3HZHA 4G8BA 2X8AA 3FSGD 1SKBA 1YJ8A 1PFGA 3FROA 2M98A 3OE7A 1TA8A 1JU3A 3M5WA 1CJKC 1V9LA 3ZKWB 3HSYA 3G23A 1TO6A 1KDPA 2ENWA 3R3WA 4CMHA 2QZZA 1AN9A 3N5CA 1E61A 2G72A 4HK4A 4B3IA 1AZLA 2FPOA 3CINA 2NMVA 4YXWA 4LJLA 5KYWA 4IO0A 5LOVB 3LY7A 1E7SA 2E2HA 2DQ4A 3KQYA 3RG8A 2FQXA 2PR7A 2R1VB 3FTQA 1Z56C 2YVKA 4YJFA 4JASB 3WGYA 1XNRB 4NXMB 3UMSA 5I3ZA 3H40A 4F6LA 1N2XA 3RCBA 4J0MA 2HV8A 3ZLUA 3CMCO 2D4AA 1E9RA 3MBOA 5LXTF 4QPDA 2QL6A 1NAIA 3IOYA 5CJJA 5K6AA 1WO8A 4BVLA 1Z6XA 1KEEB 3QXCA 4Q0YA 1SR8A 5DGIA 2ZUTA 5IM4A 4HY3A 1AX9A 1JLHA 4OX9B 3O4JA 4JOQA 3KKMA 2V9PA 4R40A 1O0CA 4Q19A 1JKJB 4J1SA 2PLRA 3TE6A 2B35A 2YHIA 2OBMA 4O0LA 1IB6A 1LBHA 2P5TB 3TE7A 3KOWA 2WM9B 5KFZA 1ENPA 1N3BA 4H59A 3MFQA 3SR3A 3Q5DA 3Q41A 3QKWA 4Y2JA 5AVSA 1GN9A 3D2LA 3URMA 3I5AA 3S1LA 4DYVA 3INYA 3FUWA 1E8DA 5BQ5A 4BZQA 5CB8A 3LZ6A 1EE9A 1Y1PA 1PFVA 2GJSA 5DM0A 3KAPA 3W1GA 4GKAA 1U8YA 4NDNE 1LPNA 5D1PA 1PS9A 4Q9LA 4B7AA 3CPSA 4OEHA 2FCRA 2XOXA 5IJZA 5J4VA 5JH7A 2VHTA 4Y98A 1B00A 2ZI6A 3GNTA 3D6MA 4EG8A 3IV6A 3FPEA 3X1ZA 3ND9A 2VPWA 2QJFA 3B53X 3SHFA 3W2IA 4AN4A 1LV7A 2XHEA 1MO3A 1Y89A 4BX8A 2I6SA 4AXXA 3FPGA 5CR5A 2GXSA 3IB3A 3MIZA 4FNMA 4RJIA 1BMFA 4FMPA 3HACA 3UJAA 1A2KC 1QRDA 3MUNA 4EHHA 3NOOA 4ASUD 2ONJA 2ZSEA 3GV7B 1LS1A 1SXGA 2VDLB 3C14C 3EXIB 3NS7A 5AYVA 1V0JA 3D3NA 3F73A 1HG1A 4U8GA 3F1KA 5G53C 2NUBA 2O2SA 1AUQA 3IKVA 3M1IA 3GZNB 5FLKA 3E1KA 4NYJR 2G83A 3N43B 3IEIA 1IBMB 2Y6UA 5FAXA 2W2NA 4KE6A 5IXSA 1DQYA 4EUEA 3ZJ4A 2XDYA 2P6MA 3FCYA 1W88B 4L7VA 2XNDA 1OAOA 2EFHB 3RGZA 4L0CA 5D00A 2EZTA 3NIFB 1CY6A 2VLIA 5G3YA 2G8LA 4BB9A 1W88A 2BMWA 1UMCA 1FW8A 3TZHA 1Y98A 4HAVA 3T1NA 3VR2A 1A4UA 3ABOB 3QNWA 4DT1A 3PGVA 1QORA 3DB1A 4JB3A 4PG6A 1JRLA 2VJMB 4UBMA 3AM3A 2PN1A 1EFPB 1M1YA 4RQAA 1Z7WA 1NURA 2X15A 3GRFA 4BO3A 4LBWA 2H7VA 3IBCA 3K0SA 2FWMX 3EDCA 3RKSA 2A84A 1O9BA 4E33A 4FE7A 4NE2A 3SG0A 1KYYA 2BEKA 4YRGA 4CEJB 1W85A 3ITKA 3JARA 4UD6A 1BVRA 1L4HA 1RHJA 4TM7A 4H1HA 4TLCA 1A9QA 3F8TA 3VYUB 5AESA 5JNUA 2PGIA 4LYDA 1W34A 4O7SA 3L04A 5DMXA 4HTAA 1QAQA 4O81A 1W85B 3RYHA 2ZSFA 1WZCA 1E9VA 3AHDA 3BYZA 4CQMA 4C76A 1C14A 4Q1EA 1I3OA 3DAAA 2BOVA 3ZOZA 2LGJA 3H5VA 1SQGA 3MG9A 2XUOA 3H4MA 4D0RA 2I87A 2JASA 4KPUA 3UHFA 3ZK7A 4HR7A 3K9QO 2AVNA 3DE5X 5AP9A 2YYSA 1PSDA 1M9NA 1ULTA 3VC1A 2ZI5A 4D3YA 1XZPA 2CDAA 1QK4A 3G8YA 4PCLA 1C1YA 5BUSA 4ZVQA 1WSDA 3GJ6A 3TY5A 1XCLA 1G7SA 4LSGA 5IPFA 4MDFA 1JYEA 1SVWA 2HDNB 2RGYA 2FETA 2PHZA 1DHRA 1Z17A 2GUGA 1TEXA 4HEA1 4CLOB 2IS6A 3SJBA 1JFLA 4LBYA 2YMQA 1HZZA 5IJAA 1R27A 2C31A 3LG2A 5BWTA 3UM9A 4WKPA 5FOQA 5DK4A 4DC1A 3PRHA 5H59A 4DGSA 4ZI7F 4URXR 1UINA 4H18A 3GEHA 4JXUA 1UOEA 1X74A 3OZAA 1EFLA 1YVDA 2GM3A 5JISA 2EXXA 3DBOB 2C94A 4DXAA 1BEZA 2B3DA 1TYEB 2VSXA 4GOKA 2GRJA 3QIAA 2X2FA 5ICCA 4RFSA 2RIRA 4HEQA 4GX0A 1E6KA 3R8XA 2OORA 2Z3WA 1ADYA 3L1IA 3N2NA 4YUYA 1B6GA 3O4IA 4IDHA 1SY7A 5CMLA 4GWLA 5E1DA 3ZY5A 4WJZA 3WS7A 1NSTA 3IFSA 1C7IA 4KWIA 4IMPA 1C8LA 1UC5B 2XB6A 3E9ZA 3JWJA 4L8FA 3DMNA 3FUXA 4RH1A 5HF9A 1GAJA 1KC3A 4Q3NA 3JATA 2X7JA 1IZYA 1H42A 2VTKA 4ZVSA 3RF2A 2XQGA 4BFTA 5COBA 3PZBA 4YWJA 2VDUE 3ANLA 4FZVA 4WK2B 4EHJA 4AKGA 3KTMA 1S03G 3V8BA 1FP7A 1N2GA 5AK3A 5KYWB 2UVPA 2FW0A 3DXXA 3C48A 3JTEA 4JI6H 2FGKA 4MB6A 3VSDA 4OHRA 4AG5A 4YRCA 2QUZA 4CLDA 4UUOA 4EM6A 3QHQA 1KMHB 5AK0A 3SZGA 3TMKA 5A1TA 2J8ZA 3FPFA 2ZRAA 2VZ8A 2QSYA 4XWAA 2HHHH 3J80W 5AM3A 3PT5A 3WNQA 4GI3A 3L2PA 5BVGA 4G37A 1B41A 2FDCA 2DTXA 5FUQA 1ZU4A 1Q7CA 1Z13A 4UCTA 1JLMA 3WVNA 4FGJA 1UPCA 2P2GA 4LXHA 2BLNA 3J81W 3DDCA 1K6MA 4LXUA 4YBZA 1XUOA 4W8HA 4KMMA 5CLHA 2QQ0A 3EFEA 4A2QA 4UCSA 2Y76A 4G86A 3TZQA 1VBGA 4YI3A 5DMHA 5EE5B 5FBRB 4F4WA 2ZR0A 3OTHA 4A91A 1S96A 4B82A 5LQJA 1IL0A 4D96A 2MR5A 4CUJA 1EJ6A 1WJGA 4HN2A 1NUQA 4MKHA 2PJDA 2GZSA 4Z4FA 3AJRA 1UFVA 1YU6A 3GZJA 1W19A 4V02A 4YT5A 5TQ0A 3CEHA 1KKLA 2P6NA 1YS6A 2QTCA 2X41A 4G1EB 4A0GA 2Q2TA 2XA9A 1IJEA 4RIEA 1QPZA 4AJ4A 1TO1E 4LQDA 4XQGA 4IOMA 1L7QA 4HHEA 2LCIA 2V1XA 4CKCA 2R6R1 3BK7A 1T9BA 1VE7A 1FYEA 1L5QA 3LTNC 5T64A 1KMHA 3GTJA 2Y1WA 3ODGA 3IDAA 5I45A 2ZB4A 4IGEA 4CIYA 4ZXFA 1ISSA 1QH8A 3BHNA 4LI0A 4CIVA 1QFYA 3KETA 1GFWA 2A14A 3IV7A 3KBOA 1T5HX 2KM1A 2RJOA 4KPUB 4AKSA 2HNBA 2BM8A 4DCVA 4ECEA 1X13A 3RVQA 1ATIA 1J39A 1HFJA 1UJ5A 4MQLA 4DB4A 3HEBA 1T6NA 3OJ0A 2CUZA 4KE8A 5AVOA 3SC2A 5EIBC 2QVGA 1IHDA 1UAAA 3PO2G 1OGJA 3LNTA 3RVMA 3IP9A 2AFIB 1CU1A 1E4GT 4XE5A 2QEQA 2I6GA 4MDYA 1EMDA 2VWHA 2Q45A 4RELA 1G6HA 2CXSA 3RUIA 4B3RB 3IDQA 5FNVB 3ZKAA 5K0SA 2OGZA 4LC9A 3D3EA 4GQAA 5B1YA 2O19A 5JYCA 3GEBA 2WSSD 2WIFA 4QJ3A 2O7SA 4ZO7A 1LBQA 1RBZA 2HWXA 4BB6A 4Z1MD 2QLTA 1NBHA 3AR7A 1K88A 1FVIA 2C61A 4S0XA 3AUXA 4HNSA 3F78A 4NH4A 3X0DA 5KG1A 4BFUA 4BNZA 5HQTA 3TUZC 2VKTA 2IBSA 1IG0A 1RI3A 4M76B 1ST2A 4DIBA 4CMFA 1NUTA 5LP1A 3M6MD 2ZIAA 3VO1A 1W9MA 3T4XA 2RI1A 1XNQB 1L7PA 3WK6A 4HZGA 2Q5CA 4G4SO 4ONEA 4WNAB 1NC1A 3S1SA 3QE2A 4FKMA 4QVGA 2WFMA 4AY2A 2AC4A 2C57A 2X5JO 1P1RA 3WLFA 5FNVF 4D82A 4OSOA 3RLIA 3TBKA 3RIXA 4X91A 5AFSA 3AEXA 1FYXA 2ATCA 2ZBQA 1LB1B 5F7JA 2UUAB 5HIMA 1JSLA 2R8HA 3IVCA 2GILA 1PT9A 2K4MA 1QHXA 2GN1A 4U2CA 4IGKA 4N54A 4REOA 3QU4A 2F1OA 1SK8A 4CTKA 3MGBA 5IVPA 3EGCA 3EF1A 2QSUA 4FCTA 3RQIA 3SM9A 4LF7B 4AO7A 5K0NA 2UYOA 3DV2A 1KEVA 3GNQA 1YFKA 3LX8A 4DMRA 1D8TA 1YA4A 4Q3CA 4MKGA 4A3GG 1LQ2A 2X9QA 1Y9JA 4G84A 1GQRA 4Y7CA 5AMXA 1KP2A 3TNDA 3TKLA 4BWVA 1F0YA 3QUBA 1X1BA 5BW6B 1V5EA 4NLLA 2OO3A 3QVOA 4ZDJA 1TVCA 3AMVA 3FMGA 3GLIE 1J90A 4GGMX 3JVDA 4JZKA 5EINA 3HXPA 4GKKB 2Q7XA 1Q50A 3S8MA 2PBLA 5BQOA 4S1VA 1N1MA 4XZ3B 4X94A 3TJRA 2AK3A 3F9CA 3GN2A 3QENA 4MQEA 4N7JA 4NE9A 3EJ6A 1VJDA 2CE7A 2VJDA 4S1WA 4JP3A 3M6IA 3KQSA 4AXBA 3ILVA 1XA3A 2LBPA 3RHFA 3W05A 2G3YA 2CVOA 3DMFA 2PV7A 5KG3A 4ZC8A 5J43A 1G3RA 4KR0A 4C7KA 4TSFD 4DG9A 1DV2A 5JYBA 4WNCA 3GG2A 2B63A 3K1AB 5HNEA 4Q3EA 4TSRA 3IC5A 4WLEA 1EK1A 1LC0A 3GOQA 3J81A 1K6IA 5CFZA 1OVMA 1Z75A 2BDUA 1ECPA 5IP7G 3NGDA 1G6Q1 1Y6JA 3ONFA 3U02A 1R8QA 4AQ7A 1F2UA 2BDTA 4JYMA 4NBKA 4OXKA 3TOZA 5CH8A 4CUZA 1SYXB 4JVMA 3T5KA 2D1FA 3ZY6A 4JL6A 5KHLB 2J46A 2JBAB 1O94C 2X9NA 2ZAOA 2PUCA 1N2IA 4XCXA 1BWPA 4DLXA 2RGBA 5HG0A 1IUKA 3N05A 3WIOA 1ZGAA 1WL8A 4DV7H 1C81A 1FFCA 1Y1TA 1YOBA 3K4PA 1ND5A 2O54A 1BKDR 3F4LA 2PMZE 4RZUA 2QXYA 4AAYA 1P9OA 4DL9A 4MHTA 2B2CA 2WD7A 1K4KA 4BEWA 1FDVA 4UCUA 2JEFA 2ZSAA 5IT5A 2R25B 3DEIA 1RFGE 4DL3A 5JVDA 2QBYA 2OHXA 3RF7A 4J9OA 1UFRA 3GEIA 3L8HA 4PZ6A 3C3CA 4UHJA 4YUVA 5L1JA 3AEUB 5SV2A 2EP5A 1Y5LA 1M1ZA 1NONA 1E0JA 2AW3A 2QS9A 3F9RA 2XMCA 2H65A 3GGSA 3GLRA 1J97A 4I4TB 4MVJE 3USZA 1M0WA 3Q0IA 5JXJA 4KR7A 3VC7A 3K1AA 2XVYA 1JKJA 4L78A 3UWSA 4EK9A 1HO3A 2EU8A 4F5YA 1YC5A 3JCZA 4ZYLA 2AKEA 4RS3A 4DR6B 4KI7A 3GGPA 3L49A 3NM6B 3R6GA 3OMWA 5IAAA 5E7IA 2COUA 5CDFE 4EQ6A 4M99A 1N36B 4UFNA 3ZC3A 4XGNA 2GEUA 3L05A 4G0VA 1U5BA 4G4SP 2Q28A 3SM3A 4DXDA 2WFLB 2FOIA 3O8NA 2YDXA 1QC5B 1YVRA 1YK1A 5JASA 1MAHA 1F2DA 3SEFA 1IFXA 4KIFA 2XB9A 4M0DA 2FHPA 4NS1A 1A04A 4R0VA 3ZDYB 4DM3A 5E4YA 1ACMA 2Z8ZA 3TGPA 3K70B 3TL2A 4ACAA 4FJ0A 4E7OA 1OH5A 3KSDO 4YCBA 5TRTA 1XTBA 2PX4A 1O96A 4M0EA 1ULUA 2VDMB 4RCVA 1TTHA 2JA8G 2F62A 2MJLA 2BFDA 5BN5B 2XTJA 3AZPA 1CC1S 1ECGA 3U3OA 2FDXA 2O8FB 3E7XA 2QJWA 1X0XA 2YFKA 3L79A 2Z1MA 3H6GA 3PQEA 4AS2A 1E4OA 1QKIA 3UK1A 4BFCA 2AF3C 1E89A 3D8TA 2DWOA 4BECA 4TSFA 5KCMA 4KFSA 4Z7QB 4ZYWA 1YZKA 2HG8A 3AY3A 5KJ6A 3LECA 4I3HA 5A2QW 1EB8A 1KE1A 1LTQA 1ZW6A 3DKVA 3K32A 4FLFA 4G8CA 4UD2A 3NW9A 3WKBA 1NT4A 4YY3H 4ROSA 4RJJA 4EBDA 2OM2A 3SVTA 4B47A 1E9FA 1WW2A 5HCUA 2CLFB 2EWVA 5AQEA 2PQ2A 2JDIA 2WM8A 5IDVA 3JZAA 3PDUA 3MTEA 4XM0A 4NFHA 1E7QA 1HZJA 1USWA 2D0IA 1UUFA 1V1MA 2V74B 2VWQA 8MHTA 3W1EA 1X2EA 3B9RA 1CETA 1BQ4A 2X1HA 2G28A 3I92A 3OX1A 3PDJA 3R09A 4YX9A 3N40P 3HOXG 1OW3B 2GBLA 4OX9H 4RPCA 5K0TA 1NOIA 2WEKA 3NTXA 5I8WA 1WZEA 1C9YA 2HFJA 5FV7A 2DJ5A 3UV3A 1RMYA 3BHMA 4Q9DA 1JSCA 1X80B 3ESBA 3H2JA 3TRJA 3SBEA 1L3CA 3BGDA 1TJNA 4CDNA 4PLWA 2KYRA 2RK6A 1SC9A 3IRVA 1DUVG 1PV1A 1A5TA 3RADC 1NNSA 2Q2OA 3FSGA 4HSGA 4Y0NA 3NM5A 1S8FA 3U4DA 1D2EA 4R9SA 3KSAC 4U7GA 5DASA 5EWJB 2C7OA 3QBJA 4ROTA 1ZAKA 3MCAA 2WTAA 2ILTA 4E4TA 3SC4A 4MGYR 3M4NA 2FEPA 3CGWA 4GX1A 5C5JA 5REQB 2QMOA 4ZTBA 5KQMA 1TWAA 3UHAA 3AIIA 2X9LA 1AKMA 2AJLI 4XGRA 1K5PA 1SHZA 2G6TA 1F2TA 4DV3H 2NVXA 4LSAA 1K2VN 4Q1DA 2WI8A 3M49A 4DLZA 1XTPA 1E1MA 3UVEA 2VTVA 4BQNA 2QM3A 1O2DA 4PAMA 3WK9A 1XIVA 1L4LA 1VL6A 5LA6B 1HE5A 3W8EA 4B83A 1KFCB 4MW0A 1VKHA 4FKZA 3OQHA 4WXYB 3TR5A 4TMXA 1ZJWA 4MLDA 3SICE 4F4ZA 1ZEJA 5E4JA 1YAHA 4I99A 4IM7A 3TSZA 4DIFA 4DMHA 5LNK1 1JHDA 1W7AA 5ALVA 3DAOA 4DG5A 4ER6A 5BSWA 4E5KA 4J4HA 10MHA 3EXEB 1SURA 3AVWA 1UC4B 2E49A 1YU9A 4PNEA 2Q62A 2OUKA 2YVAA 1KC1A 3HPQA 4Y30A 1G18A 1QJ4A 1LLDA 3GY0A 1O3YA 4CGYA 2X1LA 4XJVA 2XYGA 3E15A 2DFPA 1XKLA 2EJCA 3OEED 1Y3HA 4HP8A 4INZA 4QUIA 4ZDKA 2FPWA 1LRLA 5KEIA 1ORIA 1K8QA 2OBNA 3D6FA 5ALOA 1FJXA 1KK2A 2Z58A 4JLMA 3RUHA 4BNDA 3ZJVA 5B5SA 2O8CA 5K3CA 4ZMRA 3NIDB 1WZIA 1Q7GA 2NZWA 2OC9A 4IRXA 4TS9A 3WP1B 1HG0A 1K1QA 2AIRA 4QREA 1PF7E 4QFCA 4DAAA 3F5SA 3CNBA 1GAQA 1PYOA 3V33A 3L0IB 2ISCA 1SQ0A 1GDDA 3HCAA 3QVGB 4M0LA 4B31A 5JMOA 3N41B 3RSGA 4OHKA 5EN4A 4ZARA 1XMVA 3TDNA 3KQUA 1X7GA 5KFFA 1Q1EA 1SWVA 1V26A 4G5YA 1E9EA 4Z8YA 3VPFA 4BMOB 3AERA 3QG5A 3MWMA 4Q9IA 3DVLA 5DGXA 3AUJB 5EIFA 3VU1A 4HWKA 2PQMA 3H13A 3GAMA 3SIRA 5FOXA 4O4IF 4YECA 5JBIA 5GOZA 1W46A 1VE3A 3NCTA 4J29A 2YNMD 4JXJA 1VXRA 2P2YA 4RX1A 4JDUA 3VNNA 1CUVA 5AK4A 3EULA 3DKKA 3B9BA 1UOOA 4ZEMA 4J90A 2QBYB 1GQQA 3FNGA 3MCUA 4GOJA 2O4CA 3HA2A 2BV3A 1Q74A 4US1R 3UT5A 2K2QB 1REQA 3A06A 2J3JA 1KY3A 1OWMA 1DAAA 4O1IA 5U1PA 1OYVA 2OQIA 3DOJA 4HWSA 4WFKA 1G9XA 5TF0A 4UTRA 1DDIA 1W2WB 2R47A 3AILA 3HJRA 2I5PO 4R8LA 1LKZA 4BCCA 2H1VA 4DSTA 5FD5A 3WQSB 4BRWA 4PRKA 1QP8A 4C0KA 1OX4A 3IH5A 5I51A 3KJIA 1SQSA 2EX4A 2JI8A 4FS8A 4AKIA 1SPBS 1UXJA 1VLMA 1Z82A 2EX1A 3B20A 4NH0A 4RO0A 1CIJA 2FNAA 1Z62A 4HLCA 1YMVA 5TJHA 5CFQA 3I6MA 1TJYA 2VDQB 2QYHA 4K9SA 4KHZA 4IFBA 2W6MA 2H08A 1YDMA 3ZXUB 5CURA 4DLYA 2ZRKA 5HUHA 2B8JA 3FUCA 4H9GA 2PX0A 2QMHA 2D0OB 2A9KA 3ZD6A 3PIRA 3A28A 4HMQA 4JI4H 3RTGA 4KWCA 2JH3A 3LBIA 1KP9A 3OX4A 4V03A 4D3ZA 2CJWA 3U55A 5FPTA 2OCPA 4PS1A 1M5TA 2O14A 1YE3A 3G8BA 3QMWA 3JAMW 1Q1QA 3JQFA 4PVCA 1S2NA 4WN9A 1RLUA 3RW9A 2WKQA 1TVEA 3KZNA 3ZWAA 5I4KA 2UKDA 2FZGA 2PKEA 1I3LA 1T9HA 5J5AA 5MDHA 3T99A 3UB2A 3Q87B 2QIOA 5BWRA 5G0UA 4PGFA 3ETLA 1BRTA 5F98A 1ZCAA 5E3JA 1Y1WG 1UL1X 1TT7A 2H4ZA 2ABJA 5E1BA 2P8JA 3AFOA 4WOBA 4BFSA 2IU4A 2REQA 3D4LA 2D0PB 2AMLA 3CF0A 2B82A 3RGGA 2R8OA 5LP6A 1G4HA 2P69A 4C2UA 3ELBA 4D6YA 1TTQB 2OYRA 5BNIA 2VPSA 3N2KA 3R7FA 3T06B 4LOIA 4KN5A 3BL6A 2FR8C 2HBZA 3A4IA 3WOHA 1SKMA 3RB4A 4IYRA 1KWGA 1HFWA 3LX4A 2OZPA 1CKNB 3BXZA 3IUYA 2OPHA 1EVJA 3ML1A 2J6BA 1KC7A 2R9VA 1ZI8A 1F4PA 3GOHA 4H7EA 4KAXA 2OXIA 3ZN2A 2ZXEA 1AD2A 3SXJA 2V5UA 5J4YA 3KEMA 3T5MA 3LGSA 1W96A 3NTLA 2PWYA 1QH1B 2YUTA 1TFRA 1XZDA 5AVZA 1Z83A 1NTRA 4YCMA 4TSKA 4BQIA 2BMAA 1RYNA 2P3QA 3MRXA 5KFWA 4D9HA 4LAFA 4ZI7A 8ADHA 1ZAYA 3UJ7A 1I30A 1M33A 4X1OA 1A72A 3EMKA 5A9RA 5BYKA 3BPSA 3RT9A 2WF9A 2EW8A 4DAEA 3SBOA 3ZHSA 3WRWA 2YU9A 3T54A 5AJTA 3F7NA 2DZDA 3RAJA 2BFPA 3IR5A 4HL6A 4L5BA 3SJUA 3FNRA 3LT0A 4JITA 4J2HA 3JXEA 3VVCA 4GMKA 1OBDA 5LP6F 2GA8A 3LSYA 3ESDA 3ZWWA 1IMJA 3VR5H 4DMCA 3W5DA 5TDHA 2IHNA 3JRNA 3VTAA 3LPNA 4R3WA 3H84A 2LTAA 1JFFA 4ZI2A 3LXRA 4LSWA 1T5TA 3KZKA 1M2EA 1WAMA 3MWEA 3ROXA 2WAQE 2PCLA 4FUQA 4ZOLA 1IZ7A 2GLUA 3MGAA 3UCXA 1OKKA 2B6NA 3F8NA 3E0QA 3ORYA 4HDNB 1XMOH 3ES9A 3OM9A 5DCUA 4ER7A 2XVZA 5IG2A 3I1IA 2Q49A 1BE1A 2ZRMA 1XPRA 2QRJA 1E6MA 2OE2A 5EJ4A 1ZUHA 3NFYA 1XTQA 3ENWA 3UQZA 4FHFA 5AW0A 1OQAA 5DG7A 2FSIA 4FI3F 4XPIB 3UK0A 2IZZA 2ES4A 5FWAA 4BTLA 1GARA 1HDOA 5IJ0B 1L5OA 2CZCA 1IBLH 3LNCA 5WRFA 4EY8A 4W63A 3FZGA 1IE3A 4MX8A 4MKFA 1OLXA 1FCJA 3B7PA 4BWFB 4JJ6A 5FR9A 1VMEA 3PC3A 3IT0A 3KPVA 3G0OA 4TOIA 4ZRNA 3L9WA 3UWOA 3ZD9A 1RJGA 2W6QA 4ZHSA 2GNPA 3PHIA 3T1YH 4KK3A 1YR8A 2X14A 4AKTA 4O3FA 4KPFC 1UADA 5C3UA 4DT1B 3D6NB 1UP7A 3VOSA 3VJLA 1WBJB 3HUFA 4GKBA 3WGGA 1WVGA 3HXTA 3L3BA 3FGOA 5DX0A 1CHDA 2AEFA 3I6QA 3DAGA 5KFCA 4YJ3B 2MSCB 3R40A 4Z51A 3M4XA 1JV2B 1X3LA 1FMJA 1SVMA 4MW7A 3WBKA 1NZDA 4DOMA 1LXCA 1SZJG 2YWEA 4K26A 2TYSB 3PT9A 3BMNB 4I2NA 3PEVA 3EFOB 5ITWA 4LF5H 2QRGA 3GLHE 4ON9A 3W4IA 3KVNA 1WCXA 1CF9A 4IKPA 5T5QA 4O2BA 1TMKA 1JR3D 3FMOB 5EWMA 3KT6A 3EUWA 3LSTA 3HB5X 4DJ5X 4AK9A 4IV0A 4L4YA 4R1QA 4JJ4A 4XDYA 1XZQA 1GLVA 1UODA 4C2TA 5JJCA 1N2CE 3AZQA 2VK4A 4J7XA 4D92A 2EFGA 4J1TA 5TT1A 2W9CA 3KB2A 2B4KA 4HI0E 4Z9BA 2OL4A 5D3MB 4ZFNA 1DS6A 1N2EA 3GQVA 2JFXA 4FCVA 3HYRA 5DTIA 4RTRA 1UBLS 2CYAA 2YHSA 2H18A 4RFVA 2O7QA 1UOPA 3DV0A 4MRVA 4X92A 3ZWPA 3H8JA 3PFCA 1GM5A 3BZWA 3F71A 1P5RA 5IYZA 2OTCA 1MJHA 6ABPA 4UEJA 1QIGA 1UFQA 2VUMG 3MJFA 2VJBA 3BA6A 3UA4A 1QTQA 1NPYA 4DLVA 3NEAA 5B37A 3HT5A 4JUZA 1SC4A 4RKQA 2F43A 5KJEA 3IBTA 2A1IA 1N9GA 2DFLA 1JMKC 2MWMA 1OTXA 4U00A 3RS4A 4YJHB 4ALNA 1TU0A 5L6MB 3GFFA 2TRSB 3WICA 3W3AD 1UP6A 4ZGGA 2JLBA 4D80A 3WSWA 2XUJA 5TB5A 1QQBA 4ZI7B 3P4XA 3E48A 2M2IA 4RK5A 4UAUA 4CCSA 2NTNA 3B82A 4I9NA 7ABPA 3G82C 4EJSC 3EYWA 2PX2A 3CH6A 1U1CA 4FZ5A 2ZT6A 4JU8A 4DV6B 1I36A 3W3AA 3FDIA 4XLTA 2QPAA 1VG8A 2W2VA 3R77A 4GM0A 4KQCA 4EHIA 4CETA 3UAOA 3KO8A 3I3OA 4I4LA 1VHJA 1DQRA 4NCHA 4QHYA 2AZMA 4YP5A 3FJYA 1DKMA 2EL9A 3BHJA 3D0QA 5KQLA 1RYHA 1UMDB 5HZKA 4OAPA 1JXQA 2YC2C 5LA6F 3BD9A 1BH6A 4GLFA 3CUVA 1XRQA 3GB9A 4GX5A 4F0JA 3EEYA 2JCYA 3AIOA 3O9ZA 3SJ7A 4CXMA 5E2AA 5CEEA 2WF8A 2ZBDA 1QHFA 1CP2A 4DR1H 3IMEA 1QR6A 2ADFA 2LW7A 3EVTA 1PL7A 3KYCA 3IOCA 2I8AA 2P91A 4Y2SA 4P84A 3VJKA 1U99A 1WX1A 1G42A 3WY9A 4EQZA 2BR0A 5IJ0A 4JQOA 1GA6A 3OPMA 2FVXA 1SOMA 2P79A 2PVSA 5TQVA 2BT4A 3SQWA 1RWKA 5EAIA 3X1XA 4DMGA 4A73A 2D5CA 4NNPA 4XKJA 1JJ7A 3JS5A 5GV7A 3L6EA 4YP9A 2REQB 5LP6B 1XZ8A 1G8JA 1VYTA 4P58A 4QTYA 3H86A 1WPQA 4QARA 1UIMA 2XCSB 1G8KA 5BP7A 3CVWA 1JLKA 2FFRA 1Z5NA 2GN4A 3EA5A 4G5OA 1DCFA 1R7RA 3HI4A 4F38A 3DO8A 3K0AA 4MIEA 3E9DA 4NPCA 5T6BA 1YDEA 3G1WA 2WJ3A 4KN8A 5IWAB 2J6CA 1KNQA 3KXIA 5TIIA 1RPZA 5BSTA 1KI3A 2I6QA 2QYOA 3W1VA 3NWPA 3WRVA 1A2BA 4Y2QA 2OD7A 3THRA 3ZEAA 3DHWC 4F9TA 4BUZA 1QX4A 2JFYA 2C22A 1LPAB 1WZUA 2RH9B 5HILA 5EKUA 4YXFA 2DH5A 1PD0A 1SU8A 2UYCA 4DMUB 1L5RA 2R7ZA 2A1TS 3VHXA 3M82A 5K03A 1NF8A 5G0TA 4EGCB 5TVGA 4UOEA 1ZMTA 4RAYA 1MW9X 2WA2A 2VZ9A 3IDOA 4IQGA 4J94A 3UUEA 1VI2A 4MAAA 4N65A 1RQXA 3FLBA 4B9AA 1XU7A 1KIAA 2F1HA 2D2VA 5J40A 4EB3A 3PQ4A 4MAFA 1RNLA 5CRIA 4CR6A 3MCTA 1ZXXA 3P8ZA 2NZ8A 2BKLA 2ORED 3SI8A 2NO1A 4APMA 1P75A 3GIWA 5FUWA 4EIWA 2WTMA 5JIBA 4PX3A 4BV3A 2X5XA 4YMGA 3JQQA 4MUAA 4GLBA 4M1YA 4XPIA 1ST3A 1RYMA 5J1SB 1M7JA 1Z4PX 2L2QA 2VF2A 1YKSA 2XWPA 5LA6A 4BIMA 3U9SA 4CI0B 3HMKA 4BFYA 5KOIA 3BBPA 1P81A 4J0CA 5A3SA 1NVFA 1H2FA 4IJ5A 1YTLA 2HPZA 5EXXA 2BTEA 2QN9A 4K86A 1XZMA 2C35B 3P0RA 1AMNA 5KFBA 1UXKA 1M0TA 5AOCA 3WK4A 2NM0A 1G9TA 3SZMA 1J9EA 1O4VA 3TY8A 1CUXA 1SQFA 3NAGA 1PDOA 3AEKB 1R4NA 4D6PA 3Q7TA 3LC0A 3O8QA 4W9NA 3WDKA 1P39A 1UMCB 4HDSA 4OP1A 2VOBA 1DOHA 1FP6A 1A7AA 1Z29A 1Z8NA 3WIDA 2O07A 5JCPA 2ZIEA 4YVFA 4C3ZA 5IVDA 2XOKD 4L1KA 1R1DA 2FEMA 4YAOA 1OFGA 1U3GA 3WJ2A 4DVGA 4CHIA 1K97A 1I94H 3BEOA 3F4BA 3F6YA 1M0EA 4TL7A 2FSSA 3B38A 2CV2A 1VPLA 5C1BA 4PANA 4N7RA 2HXSA 4OHVA 5DTMA 4KNWA 3EARA 5EIAA 1KJZA 2A9PA 4P0QB 2ZI4A 1O77A 1U9JA 1I2DA 2EV9A 4PO3X 4M9XA 2BMJA 2FMUA 3HL0A 4ECUA 1HTTA 2HEIA 2GZAA 5HOEA 5KQRA 2Z6QA 2ZTMA 3Q6NA 5H3HA 2ZETA 4WI1A 1BHO1 4CLHA 1CQJA 1DBIA 2WU3A 4IHQA 3ZU3A 4C01A 4QG7A 2NV6A 1NLMA 1GITA 3IVMA 5F9FA 2C0QA 2CCGA 2NVUA 3VPGA 1DUSA 1NBMD 5HIKA 3E9CA 1YASA 1U11A 1KY5A 1V2HE 3MYRA 2IYZA 5IAGA 4CW7A 4EAAA 1BVUA 3KRTA 3U19A 2UUBH 1CCWA 5KT5A 1A98A 1O95A 2H1RA 2H7CA 2ZR8A 4FYVA 4OXNA 2CDBA 1VMKA 2Z43A 5CLJA 2SKCA 3I9OA 3V4PB 1V45E 4ICIA 1ONPA 2G1PA 3QK7A 2Y0SE 1I2ZA 3IQZA 2QGZA 2P4HX 2QX6A 2FE1A 5ADUS 3BWYA 1VMIA 3KE8A 4MW4A 4QXPA 2BYTA 3FOWA 5DG9A 4JB8A 3GFSA 4Q4AB 3OFKA 1HEYA 2OCXA 4JA2A 3ZPXA 2QAJA 4DNOA 4R1SA 1FRZA 2XD9A 1CRLA 1NVWQ 2QRVB 2VOEA 1DIGA 4QW8A 2VXOA 1JHXA 2PWAA 3R9XB 2YHIB 3KHKA 3PPVA 2FZLA 4NYMQ 5EVCA 4ZTZB 1FUIA 1NVVQ 4WXPA 5CK4A 1D2RA 5B1HA 1IXZA 4IBOA 5P8WA 2P35A 4KV9A 1U0JA 4WHXA 1UPXA 4NOKA 3RIYA 4GI2A 4FHZA 1SIBE 1E6EA 3C6QA 4PZDA 1TYZA 2IHBA 3OPXA 4QJ5A 4G5HA 4IIYA 1XL1A 3HVIA 2V45A 2UZ1B 1EX1A 3EXIA 4X9XA 4Y6QA 2MR6A 3PP8A 5HP4A 4FOOA 1CQPA 4TWBA 4HNQA 3Q8WA 3KCNA 1E4VA 1GSAA 1IOLA 1I1KA 1Z5WA 2VXCA 3PYMA 2QTZA 3E9MA 2V54A 4IHJA 2DMRA 2NU7A 4J0KA 1SUDA 1Z2AA 1YI1A 4HMOA 1P1FA 3EB9A 4G41A 1UBCA 4L51A 1VIYA 2OHIA 1PDVA 4R8UB 1VDMA 2VCEA 3A3OA 1CD5A 1PCXA 1ZRNA 3EGWA 1U0RA 5FT9A 5AXBA 3IP3A 1XAIA 3RSHA 2R8IA 3LYUA 3N8GA 1LY1A 5JCXA 4Y6RA 5EJ6A 3DLIA 1TVMA 5DBHX 3Q2IA 3EN0A 3R2JA 4RF2A 2FLPA 5F1KA 3TLAA 4C0QC 3MOSA 4PIMA 2C2GA 2RG7A 1U3UA 5BXQC 3N8NA 4X1KA 5ALKA 3ASVA 2IQ5A 1ZNXA 3QXSA 1RW4A 3DTYA 1QCZA 3T3OA 4CCYA 3TG8A 4DHEA 3PEEA 1P91A 2WWWA 3K7EA 4C0HA 5JHGB 4D9KA 5M29A 5LL6P 1ADFA 2BEVA 3KT8A 2J6UA 1KUTA 3FTCA 1XNQH 3ENNA 5D6NA 1EINA 3LWZA 1HETA 7ADHA 5CTAA 3ICOA 3P9KA 4LW8A 3DXZA 3QUTA 4UBKA 3VR4D 4N7BA 1D5CA 3QRWA 4RV5A 4F2HA 4CFZA 5FUYA 4DLKA 1BDBA 2WMOB 4L0DA 3MTDA 3I04M 4MWCA 4JELA 3RKUA 2I2FA 1HLGA 4RF5A 3IMCA 2N1MA 3HQ4O 4NBVA 4FE3A 1J5EH 2C5GA 1RXIA 1ZSNA 2QUBA 2F00A 3JQAB 3OZXA 5DF1A 3MTAA 2WT9A 3WLMA 3IMFA 2FKAA 2F3UA 1XQXA 4U2GA 2NXCA 1PGOA 3VJMA 1SEPA 2J6TA 2FFJA 4FGUA 1B42A 4M83A 3HP4A 1Q2UA 2WY2D 1N1DA 1C3XA 4A03A 3N9IA 1EDDA 4PHGA 1CUYA 4LVNA 2H1OA 5JNSA 1BEUB 1WUTA 4CLRA 1ZX1A 3P5SA 4LMBA 4UJ5A 3L0PA 3RD5A 4DJEC 1S10A 2NQ2C 3C74A 2OWDA 5KB3A 3RK4A 4WV3A 1JBKA 3V1LA 3WGZA 5JS8A 2XADA 4MV9A 1LBIA 2X9VA 2X0DA 4XDGA 4AZSA 5B57C 1XPOA 3AM1A 3HK2A 1BQ3A 2HDWA 4NBWA 2RKBA 4O4JB 3RTEA 5TMEA 3VH4A 2HLNA 1L4YA 1T3GA 4DSNA 5BV8A 1IRIA 1HMPA 2AHOA 2XRFA 5F2KA 1BS2A 2IF0A 2G06A 4IKEA 1SKQA 1EK5A 1PJZA 1T4CB 2FRXA 4QQFA 1UPFA 4P3NA 3QVTA 3TLMA 1FEZA 4E32A 2OV8A 5GZ1A 1WD5A 1TQ2A 4R7TA 3BXGA 5MGBA 3LBYA 3X1YA 4U7WA 3LVFO 1XTUA 2FUG6 1OPXA 4QHSA 4YFYA 4XIGS 4RKWA 1NJ6A 4PGAA 4ATNA 1QG6A 3CTMA 3CX6A 2OQVA 2Z9CA 3HP7A 2N1BA 3OP1A 3RJMA 3ROTA 2VA3A 3FUVA 1P3JA 4L5YA 5FFNA 3O90A 5HJ2A 2EKBA 2CVHA 2APJA 4CMDA 2PS3A 5EMNA 3RBEA 4OGLA 4QKQA 4KW7A 2B6HA 4WXHA 4O2AB 5JY6A 3QY0A 2XCUA 1E9BA 3OQ6A 1PWHA 4UCFA 4YP0A 5I7OA 2FMTA 4R5MA 1T2NA 3FHOA 4F1KA 4ZOCA 1Z0JA 4QODA 4AY6A 4B7CA 4AYXA 5EMMA 3KELA 4J07A 2HHHB 1LBEA 3NR2A 4LGVA 2IA5A 4LECA 4NPHA 3Q7IA 4FOPA 4J7CA 1TWGA 1OXTA 2ZAMA 4M1TA 4UUMA 4HS9A 4AX4A 5LQRA 2CNWA 2KMLA 2HM7A 1T94A 2WU0A 4YR3A 5FLYA 3ADDA 1QU3A 4I1PA 4UCWA 4D4HA 1J70A 4OBEA 4O25A 2J6SA 3D0KA 1CPYA 3E2PA 2EJTA 4UUPA 5GMOA 1X42A 1G4UR 4UE3S 2JHCA 5IANA 1WSCA 5BXYA 3ZOKA 1HC7A 4CKEA 3I5UA 1P1IA 3BXHA 5EMKA 1IN7A 1F51E 2J09A 1Y3FE 2OM6A 2P2LA 5KYXB 5IYZF 4YR2A 1SXJD 1V48A 2D13A 2ZJAA 3JATB 1Z26A 3NCHA 5DHTA 2YXLA 4GNRA 4R8RA 1V96A 4M98A 3GIDA 2OK7A 4FX2A 2UYQA 1YHZA 2Y0SA 4TTQA 2CFSA 4BMZA 1PVDA 5I5UA 2H48A 5TQ0B 3L4KA 1JR6A 1WMSA 2ODQA 5CH5A 3WGIA 5G40A 2IX3A 2ERYA 3CJQA 4Z4GA 3WJ1A 1PHPA 1Z7BA 2HGWA 2X7HA 1E5XA 4EYKA 3FKSA 1E32A 2H1FA 1KJ9A 1T0BA 1L7MA 5HS4A 1A8IA 1OFHA 3HDGA 3G59A 3IIEA 1A0IA 5TX7A 4OGGA 4C0XA 1IBMH 2IRWA 5KNCD 4PAQA 2FMIA 5KYGA 4P82A 2H54A 5FRDA 1RHRA 1QYIA 3GJ8A 5KT6A 2ZYUX 3C3DA 3EIQA 3NKFA 5DHAA 5AK5A 3HB1A 3TTYA 3V9PA 1GILA 4UFZA 2FGJA 3GWZA 4EPYA 2DERA 1DAGA 3I5YA 3UTCA 3L4JA 3ZW8A 2XHZA 2O8VA 1O8BA 3NWEA 5CGZA 1SZCA 3QFFA 3NBZB 3FMAA 2JA7G 16PKA 2NO0A 2VT2A 4WLNA 5DNCA 5LDDC 3ETJA 3BWCA 4NK4A 3HBFA 1O03A 3Q3CA 3M3HA 4FS1A 2V59A 2CNBA 1LH0A 3QU5A 1EUQA 2VHXA 4LXIA 2VHZA 4DDHA 1YZUA 1FP1D 1P2TA 2A67A 4A26A 3EHDA 1U28C 4C6TA 2D54A 3H16A 1GSOA 1ACLA 1R9TA 3S8EA 1UC8A 3PGKA 4L95C 2IEBA 2OMKA 2DPIA 2P27A 3A9RA 2VP5A 3IUMA 3MUOA 1AV6A 3VUEA 2NUPB 2ZJBA 1QRUA 3NV9A 5BN5A 4QE3A 5EY5B 3S2UA 4UASA 1I2MA 5IYDG 2QMQA 3SY8A 3BZBA 4EY5A 5AJHA 2Z9DA 4LCBA 4M2LA 2GTIA 1BXZA 4GI7A 3WNZA 3W5VA 2BFNA 5F78A 5C4IA 3Q1KA 1M10A 2O2IA 3KKNA 2IV3A 1X7XA 1DVRA 4FZ3A 3NASA 3OZSA 4FT4A 4G1CA 1CHNA 3PTLA 4HDRA 4ND4A 4KG7A 2UZ1A 3VQTA 1XCBA 3AQIA 3GEDA 1SU6A 1Z5ZA 1KETA 1OIWA 1WXGA 3DL7A 3CLRC 3V4OA 4KQFA 2O7RA 1NQWA 3PSAA 4P3KA 3UMJA 2Q0QA 1E4YA 3L07A 3PEUA 1P7YA 3CUSA 3PDIB 5IYZB 2FSFA 4Z53A 2Q5OA 1RZUA 2J3IA 4LGYA 2ZAYA 2H0RA 1CFJA 1J21A 3FDJA 4OKNA 3H19A 3K15A 2DFTA 1D09A 4QOJA 3GAZA 3A1FA 3UWDA 5EJ7A 4CPDA 1YMUA 4LE0A 3BFJA 5ARCA 1E1RA 2EX0A 3TH5A 4BBPA 4FB5A 3OTOH 1PD1A 2DP4E 4KIWA 4DABA 5A5VA 3QQMA 4ARBA 3O1IC 3DC2A 4NU6A 1OLXB 3SVLA 4WEOA 4EPTA 2HT1A 1OE0A 3CJTA 2O1WA 3OKAA 3HJTA 5EJMA 5CG2A 1H9BA 2A2ZA 4TTJA 1U0BB 3L02A 3A6GA 4HDSB 4MV6A 3EC7A 5ESDA 1N33B 2RHHA 4KOAA 2NADA 2FFQA 1U2GA 5J2UB 1WHTA 3IAM6 2QYTA 1YR3A 1ZD4A 3GUCA 4G81A 4JKYA 4L74A 4P5PA 2LKCA 3AR3A 2WSSA 1TPZA 3T4UA 5DM60 1WY5A 4CEIA 3D7SA 5BYJA 4PBTA 1G1MA 3KYDB 1PV4A 2JLSA 3CX7A 3U7EB 3CNQS 2CNNA 3T0IA 4KX5A 3MQFA 3WGUA 5KBYA 3T1TA 3ZJTA 4QEZA 4BJ3A 4R54A 5CFMA 5LL6b 1A4XA 4BXXG 2J32A 1J1IA 4DUGD 3BMNA 3RUAA 4ETIA 4FP9A 5M2QA 3UAVA 3S55A 1C1XA 1T1JA 4LDRA 3ZE1B 4JVSB 3SR0A 2FFHA 1FDTA 3FOAA 4YP7A 1NBMA 3W34A 1I32A 4IR1A 3AWDA 4MGKR 4RTJA 3LMKA 2IXEA 4CM8A 4AO8A 2QTFA 1DQZA 3Q6MA 5FBZA 4BB5A 3RTAA 1KP3A 2ZRIA 3QE4A 4BMYA 1F4LA 3D3WB 3IB6A 3R3SA 2VAMA 5F1YA 3TIIA 4DSOA 3ICPA 4AF7A 3H4DA 2ATXA 5T8KC 3ZZTA 3UGKA 4NXMH 3C6ZA 1LTHR 2CJYA 5KFVA 4LSXA 2MYTA 5CH3A 1LLQA 1XI2A 3LL7A 3ZE0B 3FKIG 1M2FA 2UXDH 2B69A 3NVDA 2N3ZA 1UJNA 4UBLA 4J9MA 3HU1A 4WACA 4CVNA 3CB4A 4I7HA 4JKIA 4BHTA 2PX3A 2ZJ5A 1KO1A 3C8DA 3NETA 3I4FA 3FWNA 5FUMA 2PQ0A 4J9QA 4OYYA 5LQNA 4ZYXA 3GJQA 7MDHA 3AY7A 2BMFA 4J91A 1SBHA 4DUZH 1WLYA 3PQ2A 5DP2A 1RTTA 1XXHA 2QYSA 3WL4A 3OWXA 3QTBA 2Z5LA 1JE1A 3DVAB 3JZMA 1UH5A 2NQTA 2PS1A 1JT2A 2ZRDA 4MR7B 4PYQA 3V1TC 2PUTA 1N0IA 2C4HA 4G1FA 2CNKA 4HV4A 2DLCX 3R0ZA 1MT0A 2PXXA 2VH2A 3TYXA 1RDFA 2WDZA 1U8FO 4QIWA 2BSAA 3E2IA 5IAEA 3UJBA 2C5BA 3R4VA 3W06A 4B8YA 4DTIA 4DL7A 1MJFA 1MOQA 3E2MA 1PNTA 4YHBA 4C89A 2YFQA 4IXWA 3NC0C 4UTXA 5TS2A 1YQXA 4TMVA 2G9NA 2GD6A 5BV2P 3Q7EA 1GL6A 1M7BA 4BP3A 2BR4A 3EIXA 3EVZA 2WG1A 4D3DA 3FCXA 2ZIGA 1SVOA 3H7AA 2G4VA 8LDHA 5L7TA 5HWSA 1UBSB 1Z18A 3BAFA 1E1DA 5I9TA 1GNTA 3LQ1A 3R9RA 4LMAA 4IFIA 3Q9SA 5LZ7A 2ACEA 2C4NA 3SZ3A 2PRKA 1EX6A 3ZV6A 2VDPB 5K3FB 3ADCA 2HRDA 2J9FB 2PANA 4YRFA 2NSYA 2IXDA 4N3BA 7GPBA 2JW5A 1T26A 4PNHA 2XGSA 3KOZA 3D81A 1O6CA 5FYDA 1LWNA 3B1XA 4DXHA 3G89A 4B4KA 1TZJA 4KSYA 1QFZA 3JSAA 4F6RA 1PFKA 1U3TA 5EKDA 2YZNA 4I14A 4ID9A 1YZYA 4LIPD 1XCGB 1YRQA 2UU9B 3U26A 4OQ4A 1LW6E 3OM0A 1U0SY 1UC9A 1I51A 2J3KA 1XJWA 3C4JA 4MLCA 3WB2A 1QYVA 3WGVA 4A3CG 3K20A 1L7VC 1N4AA 3C6YA 1XZNA 4YJGA 5H4GA 1XD2A 4XX0B 1N5KA 1R5OA 2AJTA 3HBJA 4EKGA 1H2AS 2OWEA 4ITVA 2B0CA 4ZQIA 1HNXH 3TW0A 3WLEA 3RU3A 2CHUA 4JN6B 1F0PA 5KTPA 5JTUA 1CUSA 3OE1A 4CHGA 1NN5A 2OCIA 3FY4A 4JJAA 3OY7A 2DUJA 4QBIA 3ZHQA 1EFTA 6PFKA 5HGXA 4PYMA 4NDZA 3VYRB 1GKUB 1MX9A 2WJIA 5A06A 1XWWA 4U7HA 4CEJA 1KDOA 4TZ6A 2KSWA 3BWEA 4R7ZA 3DP9A 4ZXPA 3W8FA 3ZCVA 1D0SA 4ITUA 3UF0A 2IYFA 3UYKA 2Z5VA 1JKXA 3GLHA 3ICCA 3JQ6A 1JR3E 2PKWA 3QVGA 5K8UA 5KDOA 5HZHA 2JGDA 1BMQA 2EHJA 4R83A 2OFPA 2QVYX 3M3DA 1OH7A 5KJCA 5PNTA 1F12A 2ISQA 2I8LA 3ZNQA 1QIHA 2R6JA 1NF2A 4O3RA 4N6GA 4D44A 5HKBA 5KFHA 2CEAA 2XB8A 2P75A 5K3DA 1J2EA 3IE2A 5L4NA 2WAQA 2V7TA 1TB4A 2LIVA 2FLKA 4EY6A 2V6JA 1N56A 3KM0A 2IS4A 3DYVA 1H2YA 5KTRA 4MP3A 1JWAB 4F4XA 3WMWA 3O3NB 3AF6A 2GCOA 4GS5A 3K2QA 4X41A 1REQB 1CQWA 3M4JA 1AKTA 3P45A 1U1IA 2Q27A 1ZHFA 3GP5A 4Q9KA 2GXQA 4OXQA 4ZKEA 3TQOA 3X43A 3BREA 3C3PA 5KVVA 1IZ8A 1IN1A 3FAKA 5LMUH 3KUCA 3DKPA 2YJGA 2ZSJA 3M6VA 1Z88A 5FI5A 4YGXB 2A5GA 1OREA 1GZHB 2Y68A 4H6WA 3W9YA 2A9QA 2IYNA 1FS4A 2O7NA 1Q1AA 1VJTA 2H9YA 4X93A 3WQBA 1J8DA 3OZ7A 5H3LA 5AW4A 4OKSA 1TQ4A 1ZXBA 2JZNA 3IMKA 4NTZA 4UHKA 3UFXA 3WA7A 2VQFB 1HLPA 5A7GA 4X7BA 1T0HB 3MB5A 2V03A 2NO7A 3OIWA 3OPVA 4G0NA 3J7AC 4N41A 2QG9A 5H3CA 4LF9B 2BGNA 3ZYZA 5HF5A 4QVIA 2I3DA 3MWEB 3KZ1E 2B20A 1IZZA 3SQXA 4HB3A 1EWQA 2EYUA 3WLAA 4IL5A 3MTIA 4DJAA 4KGZA 3QPWA 2VRNA 3PFGA 1F7VA 3BGIA 3KALA 5EMHA 4B3GA 3L5KA 1AXGA 3Q3HA 1M75A 5L4LA 1KJIA 5T7BA 3L7BA 2Q50A 4JI5H 3ZG6A 2H16A 4B33A 5ECDA 1MVLA 3SLRA 4B3DA 5JYEA 1A5ZA 2VT6A 2QWXA 4QWMA 3LX6A 3KL2A 3CCFA 1AKYA 3A6JA 2I22A 3G2NA 3C4QA 3WO1A 1HNWH 2H5EA 1RTKA 2GAJA 1SXQA 1X1DA 4QGAA 4ZJZA 1KDZA 3VC3A 3IXMA 5FULA 3K9FC 2XVXA 4A2WA 4ZOQI 3T7AA 1KO4A 1ZDMA 2BR3A 2QPTA 4NZNA 1A7KA 3LA6A 4I4CA 1GGNA 2O3UA 2TMYA 2OGSA 2R1VA 2G0TA 3V34A 3A27A 1GA4A 2AB0A 2CBXA 4V0QA 4Y9UA 4TZTA 3AR4A 5EC8A 4BE4A 3I4CA 4OTZA 3FHLA 1L7BA 2HGZA 4PCUA 4DDVA 2WB1A 2V7XA 3ONWA 5AW5A 3N3BC 3FMIA 3B1YA 1KDVA 3K92A 4I1IA 4EY4A 1YWGO 5IBCA 1ZAUA 4BKRA 2OBBA 2GYVA 2V5VA 3WFZA 2OXRA 3HEMA 2WJ6A 4PYRA 5E6SB 2BBTA 2CXHA 4AFNA 3WBBA 1Q6ZA 1VTKA 1N3IA 4RULA 3HY6A 3GLIA 3HA3A 3ZJYA 1BCRB 1R6VA 2Q7DA 1XMIA 1G55A 1XJQA 1XRSB 4D26A 2X4DA 4LHYA 3HDJA 4MYRA 1QYCA 4OHZA 1DIBA 1VJ5A 4HWOA 5CVVA 3IJRA 3ZQ4A 3L4BC 3A6ZA 5H83A 1SB9A 2NNLD 4B44A 4F8EA 1G98A 2VI5A 2ZSDA 3THYA 3EMBA 5CVJA 3HYNA 4A93G 1DIOB 2MINB 2VSYA 4OU4A 3TTXA 5JYDA 1AGNA 3II6X 2I4OA 4XVQA 4BO1A 3F5MA 4Q4HB 1J0CA 5K3OA 3KQMA 4KL8S 4MWBA 4WECA 2ATLA 3OLZA 1K2WA 1T5SA 2FPIA 3BHIA 3I09A 1GXSA 4ZA2A 2K7FA 1R0YA 2QD1A 2XX3A 4UKDA 4V1CI 4ZCSA 4GC9A 5F7XA 2ZULA 2QORA 3ETDA 1V1RA 4HN4B 3F3SA 4N5NA 1AMUA 4F4HA 2IEDA 4YJFB 2GPBA 1U5AA 3F5QA 2JD1A 1QGOA 2W4MA 1A4IA 4QJIA 5HMMA 1SULA 4CQJA 3TNFA 2I2WA 2JFOA 4M1MA 4EVRA 1T3LA 4GSYA 3CURA 1QUFA 2JF0A 2FR8A 3AKEA 1BDMA 4QO7A 5AVVA 3ERCA 1ISMA 1CB7A 2ZTUA 2YV3A 1ZHSA 1OFVA 3G7NA 4URYR 1JJBA 3S29A 5LJLA 3A2KA 2C20A 2V6MA 1X1RA 3JSNA 2Q9CA 1CUHA 2ZXUA 4M9CA 4MSUA 4Y9SA 5DWVA 1BH2A 1SCBA 1CKNA 1QF6A 1IQPA 5A4AA 2Y1LA 3AP1A 3ILXA 3NHSA 2B9EA 3ETGA 1FUKA 1M7GA 3NG1A 4G56A 2JA6A 5JZ9A 1PJ8A 4HD8A 1ZMBA 4PZCA 2ZITA 3TI9A 3FOFC 4FGSA 2NP6A 4KQ1A 3ZWBA 4MULA 3M0EA 1Z5UA 2HRBA 2XKAA 3GZTB 1DCTA 2C54A 2QAIA 3BICA 1WEKA 4TN1A 1I3MA 1DJQA 2QN6A 1THMA 1W93A 3BQ2A 4JI3H 2QV0A 4KQKA 4H27A 1S8NA 4DR7H 1Q92A 1ZUNA 2VL7A 3NHYA 4QGBA 3X1WA 1B73A 2BCGY 4AUMA 4BNFA 2M32A 3OTQA 1WDMA 4JT9A 1PIWA 3WWIA 2PUFA 3TL3A 4Q02A 1ZIYA 5BYBA 3L7CA 4LHZA 5HIAA 3RRYA 2YIMA 2YZ2A 5BMVF 4CTJA 1ZISA 3OPYB 4Y2TA 4BKMA 4OBWA 5JDIA 4GWKA 4RNNA 3DLAA 5IN4A 1A96A 3LBNA 3C8MA 1P7WA 4WDQA 1O9HA 5E1MA 3V2HA 3SXUB 4L76A 1T10A 2QTAA 1T8PA 2XE8A 2VR1A 1B6RA 4PNPA 4B9EA 1L4EA 1YRHA 2VSQA 4C1NA 1AZSC 4MYDA 4XPZA 3PLAE 5EOYA 1N5OX 1HKHA 1GT6A 2AMVA 5B58T 1ABBA 2GRUA 2FPGA 2G9UA 2O06A 3QPDA 4HUTA 3LPMA 1K8YB 1KQPA 2VKQA 3NBAA 4RMNA 1ONOA 3R1IA 4AS3A 1O7JA 4WXMA 4BVKA 3N7TA 1QTRA 1DG1G 3Q5GA 2ZB3A 4O4JA 4Q16A 1PFWA 4TMTA 1TT5B 2IYOA 2XWSA 3TD6A 3F49S 3PNSA 4HVAA 3R5TA 4PINA 5FV4A 4IILA 1SUEA 3C6BA 1NFQA 1AQYA 3CUUA 3BB3A 4TV9F 1W6RA 1N6PA 1QHHB 2QT9A 2YC4C 4MUNA 4CUKA 4ARIA 4JXZA 1TT5A 4YMSA 2HEGA 1A5SB 1DAPA 1DARA 3DSRA 4X54A 4AJ9A 1DAHA 2HBQA 2BFOA 1KAOA 2B3TA 2QAGA 2WHEA 5BPFA 1PJRA 2ZRLA 4EYIB 3B7WA 4KIUA 4Y9DA 1Z68A 4AM8A 3EQZA 3KLOA 1BC5A 2CGEA 2CDCA 3G5MA 3QEMA 1ZGGA 5ITZA 3PBKA 4HAIA 2JBAA 2POCA 4GO1A 4IDQA 2ACKA 1EAYA 2E89A 3GA7A 5EP1A 4AG6A 4GYKA 4NEHB 4TPKA 4DPMA 5I9IA 3V32A 3AP3A 3AC0A 3IOEA 3CU5A 3DUFB 3G5AA 1H4QA 4KVZA 2R7KA 3EPIA 3ETNA 2HGXA 2JFHA 1F14A 3B6IA 3PNLA 3HU3A 2R66A 2F55A 1Q57A 5CM9C 1JU4A 5DTRA 3NANA 5I9LA 1C1DB 1YZNA 3KSZO 2W98A 3WLOA 1OXKB 4PTLA 5EWEA 2R6CA 3PGA1 4LWPA 4D56A 4Z6KA 2J0UA 1VZ2A 2COJA 3PPIA 4MRMA 2BFBA 2DE0X 3LOUA 1JALA 3D4NA 3BGSA 3RS7A 5C32A 1Z38A 5F52A 1H0RA 3KXKA 2G71A 4MQEB 5AH0A 2H2FA 4J0IA 4PXAA 4YXWD 1J8VA 1GPLA 1GYPA 3GV0A 3IQWA 3QOYA 5I9NA 2FK3A 1RAIA 4LSMA 5KIAA 3VO9A 1EBFA 3M83A 4RV4A 2OFFA 3LYAA 1P6QA 2LE0A 1XDZA 2HBRA 2BFFB 4TKZA 4GF5A 3TUIC 1U7OA 1PT6A 5ABPA 3TLBA 1MORA 2XKKA 3HJBA 2YS7A 1NQ5A 2ZVPX 1KRWA 1MCZA 4O4LB 3SLGA 5LZ9A 4XR4A 3UMCA 4AY3A 5IP9G 2NVOA 3A9CA 4QD3A 3OQNA 4LHSA 5JAIA 2AJDA 4M8IA 1BJKA 5IFKA 2XMQA 4W99A 4DL6A 1T8RA 2ZB2A 1C7EA 1D6SA 2PS9A 4QNMA 3WAKA 5CEFA 2I71A 1DWOA 3B1JA 4FD3A 5CIWA 5D7NA 3S44A 5KNDD 1OGYA 3V1NA 1P2FA 2ST1A 1TM4E 3CY6A 2IOFK 4P98A 4YYZA 5KSOA 2IE8A 3IAUA 2QE6A 3LXUX 2O57A 3KLPX 3R20A 4DBZA 1ZHQA 3CUTA 3FKSD 3WQRA 1V47A 4Z4IA 1EVYA 5C3EG 3THYB 4L4ZA 1M2HA 2EJ3A 4Z7NB 4MEJA 1JJFA 3N70A 1QB8A 3GJXB 3DKRA 5CBPA 4ZKDA 2B1QA 2VXYA 3HBNA 5AW2A 5DP1A 2ZK7A 4OMCA 1X87A 1SG6A 2MTBA 2RH4A 1EXVA 4TQGA 3IXLA 2ZVQX 5ANRB 3GTOA 1TVKB 1ZLXA 4MGHA 1T9KA 1R8SA 2ERXA 5EIOA 3U81A 1X1SA 4DPLA 1MOZA 2VF7A 2RONA 4KGVA 4N0QA 4Y6LA 4JQCA 5H81A 1AHPA 1ISRA 2H2IA 1O1YA 1RWWA 4MKZA 4MVJD 5THXA 3NBUA 4D3FA 4CMEA 3K35A 2J07A 1B2RA 5K5EA 1SOUA 2DR2A 3Q40A 3CT4A 2WC1A 3NWBA 1DC4A 2E87A 3ZWYA 1B8NA 1N7IA 4FFNA 4LH7A 1XQ9A 1Y3DE 3JAWA 4EI8A 5C9ZA 5EJGA 3BTUA 4BP9A 3VKGA 2ID9A 2FB9A 4HNTA 3ISTA 1TJ4A 1M2WA 2AUTA 2WRZA 4PBSA 3UAWA 3HFGA 3NT4A 4KN6A 4CCYB 1W5FA 1V4VA 1ZNZA 1XEXB 1VHQA 1QHHA 4BMNA 3KWMA 2G63A 2X9GA 1Q20A 4D98A 1IK6A 1U02A 2SKDA 2I3BA 3GK3A 5BMVB 3PWTA 2KLBA 4CLXA 4LJ7A 5HKKD 1S9DA 1T9GS 2FOLA 5LMNH 1KNXA 1NMEA 1THZA 1WWKA 1YACA 3T7EA 4DC9A 2GEFA 2W42A 4MV1A 1SCJA 4JGIA 4LUCA 1FS6A 3RREA 4FQ8A 5TE9A 3EPRA 4G6ZA 4IVQA 4MGIR 1G38A 4RACA 4G5FA 3DW1X 4JJZA 4M1SA 4ZOBA 5LU8A 3E03A 1KK3A 3GTMA 3AW9A 4B6FA 2DPXA 5AIBA 2IEAA 5B36A 4Z0HO 5M7EA 3A1UA 1VJRA 5IC6A 5KJ1A 1GG5A 2RHTA 1FTNA 3DM9B 3PVCA 5LN1A 2AFHB 3PZPA 2R4QA 1DXHA 1NJ1A 1XRMA 3C98A 3KQWA 2OCKA 1JHAA 1HYEA 2HIHA 3EWSA 5DLGA 1RRFA 1S9HA 3NBZC 4KXXA 3TDKA 4EB8A 1H6BA 3BE8A 4QUAA 4FXPA 4M88A 3UGTA 3ZK9A 3D7LA 3CWQA 1ZOOA 2W8ZA 3OQOA 4OLAA 3I6ZA 3M6FA 1DBQA 1XRLA 2P9CA 3NVMB 3RYTC 3IQIX 4RJ2A 3SS7X 1PW7A 1PT5A 3EW7A 5LZ4A 2ZRNA 5ENVA 2QLBA 3GMSA 2C2BA 1E3WB 3VKFA 3BBLA 1SVNA 3EMVA 3PNYA 1VPWA 1VLQA 4FYYA 5FBQB 1GNLA 1UXGA 4JYZA 4YMWA 4DLPA 1FJHA 1NW6A 4BE9A 4J2TA 1Y7HA 7AT1A 1OXMA 2ZIUB 4HPWA 2UYHA 1SCDA 1YA8A 2QTTA 5JO9A 4A3EG 3CZ5A 3FRIA 1JEYA 2J7KA 3PR3A 1G8HA 2AZDA 3CUYA 3A58B 1TQ6A 4JV5H 3MA0A 4O1HA 4TRMA 3WGNA 4X64B 3T5PA 4GDFA 4IRCA 3E7DA 2EBWA 1KK0A 3CH4B 2JAOA 4HAXA 3UH0A 2C96A 5JZSA 3IALA 4U2KA 1FW6A 4GICA 1S8AA 2PL9A 1TW3A 4Q5IA 5EYPA 5SZKB 3AG5A 1IATA 1MRZA 4FWBA 2FZCA 4G0PA 4JI4B 1AXEA 3ND5A 4RK0A 4FILA 1ETHA 1H1DA 4DUPA 1KBLA 4Q48A 1P6UA 1TYAE 3KJEA 4D4LA 1V37A 1A4RA 5KKAA 3Q4GA 2VUSA 2ATEA 1F4VA 2VIIA 4PG8A 4HLUA 3TJMA 4X00A 5AJXA 4G2NA 4HDQB 1F8YA 1NDQA 3GVPA 3PHJA 4EUNA 1WR8A 3LP5A 4RLFA 4UNIA 4BPRA 3JZ6A 3FTFA 2IMWP 5E38A 4QJ4A 1XMQH 1F6DA 5L1LA 3NRJA 5FA5A 3UB3A 1G4AE 2PGOA 3TZKA 1G63A 1L4NA 2TMGA 3WYDA 4N01A 1AHNA 1KS2A 1Z36A 3GIJA 4NBSA 4WKCA 3N42B 4XQCA 4BBAA 3KUDA 4XZ3A 4C03A 3FBTA 1NWHA 1U6JA 4Q12A 1DC7A 1U31A 1EIZA 1M2GA 2FMAA 2PZAA 3TSAA 2VSNA 1P72A 3NIGB 2O3TA 2FDRA 3OUZA 4JT8A 5TGZA 3UB4A 3UUGA 4EG3A 4PRZA 5BQ3A 2PMWB 3O9VA 4RAOA 5DWDA 4BLPA 2C9BA 1ORWA 4GW3A 5K4HA 1LLCA 4PC3A 4RE5A 4LFCH 2XUPA 3IVAA 1C4XA 3AF0A 3EFBA 3LQFA 4P5EA 4PCVA 3KQNA 3C39A 1CRZA 2VYND 4MIKA 4ZWNA 1B93A 3MJ4A 4ZT3A 1I6KA 4TZ0A 3L0DA 4IDOA 1WXWA 3I23A 4PHHA 2F1KA 2FQQA 3P1JA 1KH2A 4OH7A 4XYMA 2B7LA 3AEZA 4OL0A 5FFMA 3ZIAD 4ESHA 2BFEA 3LI2A 1MC8A 3TMAA 1P17A 1ZD9A 2QA5A 3EXHC 3W2TA 3HTXA 4I1UA 4PLPA 3U7RA 4NBTA 3H5IA 3WWYA 2RKWA 5D3ZA 1LF0A 3OP4A 1OI7A 3E7WA 4RK1A 3P0EA 1BNCA 1HL7A 3O7WA 4AJKA 5ESWA 4EBBA 3DMYA 3AHFA 4ZMBA 3EGDA 1QF9A 1R8XA 2ZR7A 2V7BA 4DQUA 4ENPA 5TGTA 4RDIA 2H29A 2V3CC 4K0KB 1QP4A 5BO5A 4NAUA 1VP3A 3FSRA 4XJSA 2OK8A 1GZ3A 2YX1A 4KXQA 1EWTA 3QLVC 4RHUA 5A5DA 3H11B 3PXCX 3VJRA 2IYWA 2ZBFA 4O83A 4RDCA 3CQZA 4FS3A 3GTLA 3G8AA 3BXOA 3KOMA 4FQ7A 1NVUQ 3GR6A 1CY1A 4NMWA 1E2DA 3HYSA 5FNVA 5GJCA 4ZVOA 5B1SA 3MWLA 3S2ZA 1PZGA 4WGGA 4RUKA 2JIRA 3PW2A 3OD1A 4ENRA 4EA9A 3M6AA 1W4BA 2BJHA 5TC4A 1BCSA 4JA0A 1YO6A 1EXMA 1KBOA 2Y3IA 2ZE5A 3BSSA 1ZN2A 4MWOA 5CR9A 1GO2A 1ZA2A 2JJ1A 3HXQA 3ZJUA 4I19A 1K5GA 2AOVA 2GRAA 1ZVJA 2XEDA 4XFJA 1J2TA 4UOQA 5B1DA 5DYGA 1JEYB 4TYWA 3V8VA 2IYEA 3VDNB 3UATA 1VAJA 2X8WA 4RZ2A 4YQZA 3TZBA 4Q7QA 2IBTA 1CUUA 1QDUA 3AKDA 3ZDBA 2IVZA 5B7GA 3G9QA 1W9HA 2Q0SA 3LRXA 3QM1A 3NHAA 1L6RA 1P0QA 3NONA 1G5TA 1U7PA 3IERA 3RGXA 4H3HB 3HOZG 1AQUA 3AUYA 3PNPA 2DFNA 3DLCA 4AUKA 4DRXB 4HYYA 3X1JA 4IYJA 1XHFA 3INRA 3D5QA 3ZUGA 1B6SA 4HAUA 3KKQA 1CUFA 3G6VA 2VP3A 2W2KA 3A3KA 3AHJA 3IAAA 3C8UA 2QG4A 4IW3B 5LDHA 3ASYA 5KTNA 4UHFA 2IE0A 4KDRA 4W9RA 5DNWA 5AW1A 1JQDA 4HXGA 6AT1A 1SRQA 1BXRA 1FSZA 3AI7A 5DPMA 3WNCA 5IKMA 3WLKX 1VG1A 5JCOC 3ZQJA 4LRSB 5KVQA 4BWYA 3PC7A 3ELUA 2XTZA 4ISCA 1FA9A 3VAAA 4MV7A 4DQNA 3M4IA 1E9AA 1RLIA 2EQAA 2IU6A 3T4PA 1ENOA 3HCBA 4LFBB 4WEQA 2P9QA 3D8BA 1CUDA 2A7QA 1WMFA 2BTOA 2OGWA 1AKNA 3EZ2A 2HQBA 1SAYA 5EXTA 4ZJUA 2R6DA 3DBLB 3RSFA 4O08A 4TTSA 2PGXA 3RNOA 2GCIA 2Z5GA 4ALJA 1DIAA 4CEIB 4ABYA 2XF8A 2Q3CA 2FH5B 3KBBA 5CT9A 2JANA 4DSZA 1HV8A 2BELA 1VG9B 2XE4A 5DRYA 1Y4DE 1NFRA 3CLTC 1GU1A 3WLNA 1GG9A 1H9AA 4PLVA 1DTWA 2DECA 2HA4A 2Q6LA 3ZX5A 3RVJA 2FYTA 4F12A 1Z2DA 3K0FB 4IQFA 5KKCA 3FFXA 2XUIA 1XXHB 3FWYA 3IGFA 4FSHA 3KYDA 4W5HA 3RLFA 3B1WA 2HSDA 4I5IA 5A4IS 2FWBA 5F35A 1UZLA 3RSQA 1MA0A 1M34B 4QWAA 1JEQB 1P1JA 3I9JA 3RS5A 3RVOA 4A6XA 4BRSA 3M4YA 2ADMA 1KZ9A 2IOHA 5IXJA 4BLWA 3AHEA 4R31A 1I01A 1Z7GA 2FPSA 1M72A 3MD9A 1KE2A 1WCMA 5KO2A 2P90A 2X86A 1WNFA 3WISA 4YPOA 1P0CA 4LHXA 4RQBA 5HJ5A 3BRWA 1Z6QA 3PR1A 1JWBB 4XD7D 5FB3A 1XCMA 3MGGA 3WMXA 3V97A 1GKYA 3TEFA 4QO8A 5BVHA 3BMCB 1PQWA 3KCQA 3B3JA 3QPBA