2IP4A

Crystal structure of glycinamide ribonucleotide synthetase from thermus thermophilus hb8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
414
structure length
414
Chain Sequence
MKVLVVGSGGREHALLWKAAQSPRVKRLYAAPGNAGMEALAELVPWNGDVEALADWALAEGIDLTLVGPEAPLVEGIADAFQARGLLLFGPTQKAAMIEGSKAFAKGLMERYGIPTARYRVFREPLEALAYLEEVGVPVVVKDSGLAAGKGVTVAFDLHQAKQAVANILNRAEGGEVVVEEYLEGEEATVLALTDGETILPLLPSQDHKRLLDGDQGPMTGGMGAVAPYPMDEATLRRVEEEILGPLVRGLRAEGVVYRGVVYAGLMLTREGPKVLEFNARFGDPEAQALLPLLENDLVELALRVAEGRLAGTRLSWKEGAAACVVLAAPGYPESPRKGIPLHVPEPPEGVLVFHAGTRREGGRLVSAGGRVLNVVGLGRDLKEALERAYAYIPQVGFPGAVYRRDIGRRALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phosphoribosylamine--glycine ligase
publication title Crystal structures of glycinamide ribonucleotide synthetase, PurD, from thermophilic eubacteria
pubmed doi rcsb
source organism Thermus thermophilus
total genus 108
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature ec 6.3.4.13: Phosphoribosylamine--glycine ligase.
pdb deposition date 2006-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
A PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain
A PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2ip4A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2ip4A02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ip4A01
3.90.600.10 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Phosphoribosylglycinamide synthetase, C-terminal domain 2ip4A04
2NU9B 4HQ6A 3ORQA 2Z04A 3QFFA 2IP4A 2PN1A 4GGMX 4O83A 3K3PA 2I87A 5FNVF 2YZMA 5JVDF 3OUUA 4O4HF 4MV4A 3OUZA 4XX0B 1KJIA 2V59A 2DLNA 4MA0A 2YS6A 2W6ZA 4EGJA 4WD3A 2CQYA 4I55F 3TINA 5BPHA 5JQWA 2NU7B 3ETHA 5HV6A 4FFRA 4EA9A 4O86A 4O7YA 4DIMA 4QSHA 5CB4F 1C3OA 2W71A 4MV6A 2CNUA 1ULZA 5J2UF 2FPIB 4O7ZA 4YAJB 5HBRB 1GSHA 5BPFA 2R87A 2YYAA 5LA6F 5JQGF 1T36A 2ZDGA 4M98A 1EYZA 3BFPA 4ME6A 3LWBA 4O2BF 4J6EA 5D8DA 3BG5A 4MV9A 3LP8A 5H80A 4NYEA 4ZOLF 5K2MA 4EABA 2VR1A 4FU0A 3K5IA 4FE2A 1JKJB 4FGRA 2YZNA 3R5FA 4FFNA 3VPDA 3VOTA 4O7RA 4IWYA 4EA7A 4O2AF 1SCUB 4IWXA 3HB9A 3TW6A 1CQIB 3AW8A 3U9TA 2CZGA 3Q2OA 2P0AA 4M99A 1IOWA 1PX2A 2GPWA 1AUVA 5I47A 4RZQA 4ZQIA 2FB9A 4O81A 4XYMB 1CQJB 2W6MA 4O84A 2Z02A 5C1PA 1EZ1A 2X0SA 1EUCB 2R6FA 2YRWA 2FP4B 1DV1A 2NUAB 4Y8VB 5C8YF 4XYLB 2NU6B 2NPOA 3KREA 1DV2A 4I50F 4O82A 3BSYA 4C5BA 3TIGA 4HR7A 2VQDA 2YL2A 1EHIA 2W6PA 1VBHA 5EZYF 2J9GA 4O7TA 4O7VA 1M0TA 3NUAA 3RV4A 1GLVA 4IZOA 3RFCA 4FFLA 3WNZA 4HNVA 3VA7A 4IHJF 2FPPB 3BSSA 3WO1A 2R7NA 4C5CA 3R5XA 4M9UA 1Z2OX 2DIKA 4TUYF 1KEEA 4TV8F 2CNVA 3JZFA 1KC7A 2OLSA 4O4IF 1GSAA 3U55A 1IOVA 5C1OA 1CE8A 1GGOA 1M6VA 4DLKA 1BXRA 1I7NA 1UC9A 3AX6A 1W96A 3ETJA 2W6NA 4MV3A 5LXTF 1GSOA 3JRWA 3RUPA 4WBNF 1VBGA 4O4JF 2XD4A 4HNUA 1PK8A 2C00A 5CA1F 3UFXB 5KX5F 1OBDA 3GIDA 3N8DA 1M0WA 2R7KA 3TIIA 2R86A 4O7NA 2PBZA 2W6QA 5CAEB 4YAKB 3U54A 3V4SA 2DWCA 4EG0A 5CA0F 2V58A 3U9SA 3V4ZA 3HBLA 2SCUB 4EA8A 4M9CA 2YWVA 2ZDHA 1BNCA 5LP6F 1B6RA 3ORRA 1W93A 1EUDB 5J2TF 1KBLA 2VPQA 4MV7A 2YZGA 2R82A 2ZDQA 4O7SA 2I80A 3WO0A 1AUXA 4FFMA 2XCLA 2GPSA 1E4EA 3G8CA 4ZI7F 2CNQA 2GQSA 2DZDA 2QF7A 4FFOA 3N6RA 3VPBA 4FFPA 1Z2PX 3MJFA 4HNTA 4EAAA 3BSWA 4C5AA 1E4EB 3R23A 2NU8B 4ZHQF 2YZLA 5LYJF 1A48A 3MWDA 4MA5A 2YW2A 4EGQA 1KJJA 3JRXA 4I4TF 2HGSA 3E5NA 4YJ2F 3GLKA 4MV1A 4XZ3B 1CS0A 1KJQA 2R84A 1KJ8A 5GONF 3TQTA 2V5AA 2R7LA 1DIKA 3KALA 1UC8A 4YBZB 1JLLB 1JDEA 1I7LA 2I8CA 4YJ3F 3VMMA 5LOVF 2GQRA 3G8DA 4TV9F 2QK4A 3I12A 4O7WA 4L1KA 5IYZF 1A9XA 1KJ9A 4MV8A 1VKZA 2R85A 1B6SA 2HJWA 3Q1KA 4E4TA 2R7MA 3DF7A 2FPGB 1Z2NX 3VPCA 4IIJF 3SE7A 5JVLA 1WR2A 2PVPA 5JH7F 2W70A 2W6OA 5DMXA 5BMVF 3R9RA 1JDBB 1OBGA 2YRXA 4O7LA 4O4LF 2GLTA 2YS7A 3K5HA 1C30A 1KUTA 3R5HA 3KAKA 3RV3A 3KAJA 2VHEA 5KKNB 2WYOA 4YB8B 3JZIA 3MWEA 3HO8A 4MAMA
chains in the Genus database with same CATH superfamily
1E9RA 3CT6A 3BAFA 2VA2A 2IYTA 2O7QA 3ZCVA 3MBKA 4EYGA 5J5AA 2HHHB 3ELWA 4FS8A 4QGSA 4KPUA 3H5RA 3E9DA 1G8FA 3T12A 2FFHA 1JXLA 1V9SA 3PFKA 3UC5A 3KVNA 4DZRA 2F43A 1TIBA 4D0SA 1BMQA 5JXJA 2HSWA 4RV4A 5CCBA 1K1QA 1XXHE 5FWYA 3I6BA 5FULA 1IBSA 4ND2A 5IZ4A 2UUBB 2E2IA 3IQHX 1DC3A 2GILA 2XKJE 3KJEA 3HNPA 2NXJA 2O59A 3IL2A 3I04A 1E63A 2COIA 2IRWA 5IKMA 3DWFA 4W5QA 1NU8A 2JFNA 2KQUA 4TT3A 3O95A 3T5GA 5B4TA 4NC9A 3FCEA 2JARA 4M9SA 4J0QA 5KNDD 4PWYA 2AMFA 3DS8A 3ZHQA 1QG6A 1L4GA 4L0CA 5IDVA 3DDUA 2UKDA 4FYMA 3ZWPA 1YOVA 1QO0D 2YJNA 1G7CA 1OVMA 3G0IA 4JBLA 2IF2A 1EX1A 1EGQA 4D92A 1SOAA 2W7OA 1G1MA 3ZY3A 3M5PA 2W6ID 3TK1A 2HLPA 2HI0A 4BCBA 3SHFA 3N53A 4RKYA 3U4GA 3WL7A 3HN7A 1QV9A 1AO3A 1B23P 4LDAA 4DE5A 1JQEA 1II8A 4XPIB 5DIFA 4PBSA 2X7HA 1WPGA 3FZQA 5DG9A 4G4IA 2X0KA 5C8YB 1JT9A 1MGOA 2C1ZA 3I5AA 3H5NA 3VJLA 2VDWB 1NRJB 4MCHA 1ZOSA 4BC0A 1L2ZA 1BWSA 3S2YA 5F1PA 1ODJA 2XDYA 4JLBA 4KDCA 1NVVQ 4IMIB 2XB8A 4TWJA 1J8QA 4MRSA 1ONNA 1UZLA 2G1JA 4BQIA 3TW7A 1QVWA 1C50A 4ZJPA 5IEJA 5BSRA 2MR6A 4M1TA 1DC4A 3KXYT 4AWAA 5CNMA 4FX5A 3GHHA 1S8NA 3X2FA 3X3HA 4ZREA 4GDMA 3GIDA 3A4NA 4BMVA 2IW3A 1DNPA 3BTSA 2Q6TA 4NEHB 2ZIWB 3U54A 1HQYE 2I62A 4G9EA 5TJHA 1GPMA 3BPSA 4JXUA 2PGNA 5GTDA 2P6MA 4RS4A 1OD6A 4IFIA 4D41A 2O8VA 4KO2S 4Y6OA 2XEXA 3WHPA 1Y0BA 5KFRA 1ZMRA 1QZZA 2AD5A 3A11A 5JLAA 3ILYA 2PS3A 5EIBD 2ZFUA 1E0AA 5CB8A 3E61A 5I7RA 2PE5A 2OAP1 1UM9B 2FN4A 3BGIA 3P71T 3ZPXA 3MBIA 1NRXA 4LECA 2R1UA 4YA6A 4CMJA 2O5VA 1CB0A 5K3WA 2A1HA 2VCYA 3DFIA 1E3WB 3M6MD 5JI3E 5FQOA 3H3VH 2B9EA 3QKIA 2PX6A 2J4DA 3KT6A 3DZHA 3N2LA 4OU5A 1TQ6A 1U9IA 2M1XA 5KNBD 3ZXYA 4QARA 2DHDA 3CTMA 4F97A 4GYJA 3WSWA 1LV8A 2YRFA 1TX4B 1PR6A 2JAHA 5DAAA 3MCAA 2DQZA 2PH5A 4IIJA 1IUNA 2BAGA 2C1EA 2QN2A 2O0KA 4K6KA 4MA4A 1PR3A 1F20A 3HYLA 2XNDA 3CX6A 1KKLA 1PJLA 2ZRDA 4MIKA 2WVAA 1ZEJA 4NXNB 1QGAA 5FBQB 4TQUS 5CDFA 3C7DB 1RI5A 3PT5A 3MWFA 1X80B 4B3JA 4FZ3A 4CLOA 3AKCA 3N75A 3L06A 1E5TA 5A4KA 5T6MA 1Z75A 1Z82A 4D98A 1HNNA 1NOKA 2D1QA 5KTMA 2IP4A 2WB2A 3X44A 1UJ5A 4OSEA 2OENG 1EE9A 1FXSA 1HSZA 4BJ3A 1O4WA 4D9IA 1FS5A 5CFZA 4G1UC 3HBAA 1AQLA 4PW0A 2LIVA 2Y2VA 1KJIA 2UVQA 4MCIA 2H07A 5F5NA 1OLOA 3IT2A 3RRXA 1Z17A 1JIIA 3SYLA 2O8EB 5KFUA 1GZ4A 4JQSA 3K20A 3Q5GA 4YJ2B 2JGDB 3O8OA 1RKUA 5FD6A 1O6FA 4YJGB 3GQBA 3GV5B 4LG1A 2AXNA 2AG5A 3LECA 4NULA 2X2FA 3KETA 4QIWE 1Z5PA 5BPFA 2AXQA 4TZTA 2H4JA 3GFFA 4BDSA 2Q3EA 4FC6A 4BX8A 2EGHA 2BLNA 4R31A 5HVNA 1XK7A 1T0IA 4O4LA 1YKSA 4Z7OB 4PSAA 3AU9A 1NBWB 1QOZA 4Z7JA 3OF5A 4B4VA 5AVOA 2QU8A 4DDKA 2NTEA 3QLUC 2BONA 4MMZB 4BWYA 1K5HA 2GMWA 1I2BA 2YN2A 2O3TA 1ZZEA 3IE1A 4B6OA 4INPA 3J81k 1SWVA 4YP3A 3X1XA 2GDZA 1MO5A 2X4GA 4W9MC 3O74A 2W6MA 3TZEA 2UUAB 1N2CB 3F47A 3M9XA 1FNSA 2WP0A 1OIWA 1QVVA 5C8YF 3TWOA 4R1OA 2M6KA 3P5BA 1P8AA 4BNFA 5A03A 4OHKA 4ZXPA 3FNFA 1SU6A 2QXTA 5DTEA 2ZSIA 2PWPA 2IHNA 5K01A 3LQKA 5IXSA 4IILA 4G3XA 4ENRA 2QBYA 5E38A 1BAPA 2PDAA 4G89A 3HJAA 2J6IA 5CFPA 3LO5A 3DCJA 4J4HA 4EP1A 5JAIA 3DZGA 3L2OB 2FPGA 3K9WA 3TSZA 5I7UA 3MR5A 3FSGA 1REQA 3O1HB 3QVGB 2UXBB 2CYCA 4LMBA 4MCAA 2VT6A 3D7SA 2AOUA 4WQMA 4L9SA 3CLUC 3WB0A 5ALZA 3OQMA 1M2HA 2BFEA 3M0EA 1G20B 4D3DA 1BA2A 3QFHA 3BTOA 2P62A 4MUBA 3EDCA 4C05A 2VTEA 1GNSA 3GBVA 4QO8A 2ZJ4A 2E4ZA 4QBIA 3D0QA 4DM7A 5DXJA 2Q1WA 4CKWA 4C0KA 3RS9A 5C34B 4EPTA 3N41B 3GCWA 4MW2A 2QW0X 4MR7A 4MRMB 4D42A 2AGOA 2J41A 5KG1A 1H8EA 4CN9A 3MCTA 5GGXA 5AESA 4LOJA 4M6WA 3T1VA 2R2AA 1Q1ZA 1UAYA 4PFSA 2QG9A 2HGSA 2HA0A 4BYMA 1EB8A 4YNBA 1KZGB 3ZDRA 1E2GA 1N5MA 4KIUA 4GS5A 2CXQA 1GYQA 5I45A 4D3ZA 4HL6A 1CQXA 1QRDA 1XQVA 1Z56C 4F86A 2FLWA 4WK6A 1Q0QA 3CZRA 3V2IA 1T94A 2Y4RA 3RVKA 2ZXUA 4HJXA 3EYAA 3QOXA 4F3TA 1SIOA 1PWHA 4L1KA 4NG4A 1ZNXA 3A6ZA 1A9XA 2N9UA 1Q92A 1AN0A 4Q93A 1Q17A 2WFLA 4TVSA 3MFHA 1PV4A 5LWHA 3CF0A 4H3KB 2EV9A 2O1WA 4UNQA 2NT3A 4GWKA 3LDHA 4YQZA 3RCBA 5T4EA 4DLVA 4D45A 3VX4A 1BKYA 1XT6A 4YAOA 1Q11A 2EHDA 4DGQA 4L7QA 3GD7A 1PZFA 4GR9A 1NVVR 4ZGGA 2W11A 5K3AA 3PLNA 3MXTA 3T61A 3UMVA 1U7ZA 2WHQA 4WW0A 4IF6A 1R5BA 2BEVB 4NAUA 3JQDA 2AI1A 3KV3O 5T3UA 5KNCA 4HMPA 3TR6A 3CR8A 5FNVF 3CRZA 4TYYA 1FNCA 2Y66A 1CF4A 2Q6LA 1HGXA 1RR6A 4EELA 3TQOA 4TTRA 3KEMA 2ACWA 1IYZA 2ODNA 2ZPAA 3REQB 1LLCA 2XLCA 2VA8A 2OSVA 1UKYA 1L8OA 1QNFA 3RROA 1NJSA 4PSUA 4ZKEA 5JIBA 4CIBA 4X1KA 4ALJA 4W99A 2NWQA 4BVHA 3JTEA 3D4BA 3DKVA 4RQUA 4JB8A 4RKQA 1NX6A 1C3OB 1J39A 4UHHA 2P1RA 3PNOA 1WP9A 4MLCA 4LXYA 3BFPA 4JELA 5BN3A 2HW8A 5C7IO 3HMKA 1I9CA 2GNAA 1E3DA 1MB2A 3SHOA 4CIDA 5FV4A 4EDHA 1FDUA 4W5JA 3AEQB 2ZRNA 5PGMA 2XBUA 4A3JG 3KOZA 1ZCBA 1ECGA 1EFTA 4KP7A 3DLBA 5SZKB 3EWIA 5DISC 1CQJB 4DIDA 1SVNA 1YVRA 1DWOA 1SKMA 3X1WA 3PA8A 2B1RA 2JANA 5K8VA 3DMFA 5KTOA 3CUVA 1DV1A 3OWOA 2ZJYA 3GTQA 3DONA 4AUKA 1CK4A 2CHFA 4NATA 4EEKA 5C5EA 2VQDA 3O9ZA 2UYQA 3E82A 4LYEA 2SNIE 1JLRA 3FYUB 4ZCIA 5FLKA 3E9ZA 2Y4NA 2AJBA 4XRRA 3LKDA 2B0JA 4I8IA 1RS0A 2OH2A 4WXPA 1E2HA 1KHHA 3GUUA 2IPLA 2ZAMA 4KITB 1BIFA 1R4AA 3UG7A 1R3DA 5CVEA 5EEGA 3IT1A 3C97A 1EZZA 2EL9A 1CJUC 3A6FA 2JBAA 5DM60 3JCZA 2FNAA 1QV7A 5IVPA 3K4QA 3BMNB 2RG7A 3LQ2A 4AY3A 2J6SA 1K5PA 4KRXA 2PH3A 3SFZA 3FLEA 3IODA 4PAMA 1J20A 3RTCA 1OI7A 4IICA 1TM1E 1CR1A 2YZGA 1PJ8A 3OOYA 3UAWA 3FPAA 1GIAA 4LQCA 4MUEA 3NVMB 2QTNA 3A3KA 5ECGC 5L7WA 5DKFA 5TRTA 2Y1WA 3OQ1A 3CBQA 3AV3A 1TYEB 1JQBA 4ARIA 1DU4A 1KDRA 4B43A 2I6UA 2P9FA 4H3SA 3VR5D 1INLA 3D2AA 4P5DA 3LWZA 4BWGA 5EXDA 3Q7PA 3DP9A 1Y6JA 4R0MA 5ECYA 3ULKA 4KTVE 1P5ZB 2REQA 4CR8A 3GLIB 1PN3A 1BEEA 1E58A 4QYWA 2N3ZA 3WL6A 2CBXA 1XC7A 2K87A 5EHGA 1QYXA 1BMFD 4PYQA 4F8JA 3N8IA 3ETNA 2VYVD 1A9YA 3AVUA 4K9RA 3R3VA 4XARA 3K8ZA 2Z08A 3D2BA 5E3IA 1AS0A 1F9AA 2Y1EA 2AFVA 3MERA 2ZYVX 2BMDA 1B73A 2NO0A 5DGCA 5BWBA 3UJ6A 4D0NA 1ZJZA 2CW5A 3G8YA 1TRKA 1J22A 3DHYA 5CFLA 3UCEA 2JA5A 2QUIA 4N5NA 2W7PA 2VPSA 2PBFA 2VHEA 4QUDA 4K8RB 1XNGA 3ROXA 2PT7A 1OGYA 1EP3B 1DT3A 3ISVA 3QFFA 1FX0B 1F2VA 1QK4A 2C7BA 4WKOA 1M66A 1RJQA 5KYNA 1PGQA 1GM5A 4R81A 2XVXA 3G6YA 1JYFA 3BRCA 1I1MA 1LFAA 1NQXA 2IYOA 1GP2A 3B1XA 1PT8A 2NO5A 1T4CA 2BHTA 1QRUA 1WNTA 5JQWA 3ETHA 1S8AA 3NHPA 3DMTC 1P4RA 4DLUA 3IUYA 4KNVA 3QF4A 4LJSA 4BP1A 4MUJA 4MXDA 3L07A 3QW2A 3G3EA 2YZ2A 1A2KC 4GPBA 4E5MA 1U5BA 4W5TA 3B48A 5NULA 2DE0X 1QDEA 5HKKA 1I24A 3MT9A 4DCPA 3FRJA 1UBOS 1TWGA 3MJTA 5CPFA 4DLSA 4RMIA 3NKVA 4RHUA 5CDFE 3IBFA 1DMRA 4W5NA 4E3WA 1JLMA 4WESA 4U2CA 5EGNA 2SICE 2D13A 4AP9A 1X1SA 2GEBA 3NR2A 4FE7A 5CT9A 2W8LA 1R2QA 3M6FA 2BTQB 3K0AA 1CQIB 4ZU3A 4R3NA 2G5GX 4UCSA 1ML3A 2YHSA 4RESA 1GYFA 2J3QA 2IYUA 3IBSA 3JR3A 2YRWA 5E8RA 4DADA 1E4VA 3GRCA 3DBOB 4GI3A 3WB2A 4UTVA 3SQXA 4U7TB 1W25A 4I36A 5CHYA 4RE5A 2F1RA 4EI2A 5EZYF 3GN2A 3O73A 3I58A 2ZWMA 1RD4A 1TUBA 2CF6A 2Z98A 1TFRA 4C14A 4IKOA 2QPTA 4FFDA 3C3MA 4NDAA 2AFHB 1OZFA 3VNBA 2HNKA 4L28A 3R0JA 3GLFA 2VRCA 4AG5A 3F71A 1HYQA 3ZDZB 3UZUA 2HVRA 2AOTA 3ZGNA 3PRHA 3EASA 1JIKA 2OXTA 4ETNA 3CN9A 3EH2A 2ASJA 2KB0A 5LLDA 5JALA 1DI0A 1RMYA 1D2GA 5KX5F 1V96A 2WTAA 3Q72A 3P20A 4KXFB 2ZPTX 3PZBA 2O48X 2PBZA 3VJRA 2A0UA 4YAKB 1I1LA 4FJ0A 5IFLA 5DN6D 4LISA 4A3GG 1PR4A 2Q7OE 1MX5A 4ADSG 3I05A 1BDJA 3CYFA 4BUZA 2FK2A 2GPBA 2W2VA 2ETVA 4WZBA 1H0KA 4MUNA 3IEUA 3WXBA 4B3XA 4FFMA 5K3CA 1TLTA 1ZGZA 1RQ2A 1VLQA 1L5QA 2QW8A 3W4KA 2XGQA 5K03A 3IUEA 2YH2A 4F71A 5DTIA 4NP6A 4XQEA 3EZGA 5AKHA 1EKVA 2WKQA 4V1CI 1TC2A 4FMDF 3JRXA 2OBMA 5GWXA 5J43A 1V41E 5GONF 3MM4A 4AQDA 2G5TA 4Q45A 4WLNA 2DR2A 4YBZB 1QZUA 3SYMA 3STWA 4ILKA 2NZVG 1NPTO 3H17A 2AFIB 2ZIFA 4MQLA 3CXRA 3ZYCA 5I5VA 2I9PA 5ED4A 3FTQA 3M1IA 1BFKA 5J4HA 2V1XA 5CDUA 4B09A 1JG3A 5JZ9A 2AZMA 2QT1A 5IH7A 2C5AA 2QD1A 5KG6A 1ARZA 2YS7A 3LULA 2VNKA 4TRRA 3UHFA 5KC9A 3HTXA 1ZK0A 2M6RA 2G3YA 6Q21A 2UZ3A 3KZKA 4LTNA 4YB8B 3RTXA 2QYHA 1Z4QA 1Q74A 3WIEA 2WJGA 4JI6H 1P9LA 2C54A 4LAFA 4OJMX 1OH7A 4WAUA 2Z04A 3C16C 2GF9A 2G6BA 4TXHA 4R0NA 1L5OA 1NVWQ 4GEGA 1S9DA 3VR4A 5C53B 4UCOA 4MS1B 4Y6PA 4EG6A 1T2VA 3CURA 5B58T 2OP0A 2HSDA 2CD9A 3TR5A 1K06A 3OICA 3ESBA 2J5BA 4DEYA 3T7IA 1GO3E 4C2BA 1L3BA 1NLFA 2WWIA 3KX2A 4CKXA 2WT8A 2BR3A 1IHYA 3J81W 1FZQA 3ZEAA 1ULBA 3RHTA 3BE4A 3AWDA 4ECTA 2H29A 2B6NA 2OC9A 1P3JA 1SEPA 3U3JA 1W47A 5IUNC 4FONA 1P3Y1 3HWX1 3WGNA 2XE8A 1MQ9A 1HM5A 4Q1DA 1KJZA 3I28A 1I9GA 3DYBA 3FBGA 1P62B 4JDUA 3ZQ4A 4MRRA 3U7JA 4R3WA 3QYJA 2VF7A 1TO1E 3KXIA 2CMFA 1CD5A 3L0IB 2JCSA 3CHYA 2A4KA 1CUEA 5A1JA 3OLCX 3EK2A 1G64A 5EWEA 2OPHA 1FFGA 2ZYRA 4DL5A 4UDOA 4UQOA 1CUJA 1QO9A 3BA8A 2QR2A 2IYSA 4Y9RA 3NTUA 4C5BA 5HQ3A 3Q7IA 4F5DA 2UUCB 2NSHA 4BNTA 5FPSA 3C5EA 4ND8A 2VAWA 3W5VA 3CPSA 4FJ2A 1SXJD 2VDKB 1GRRA 2L2QA 1I4WA 4RMJA 3E27A 4DUGA 2X8JA 2WE8A 1PGNA 1DADA 1Z47A 2ZITA 4ZMSA 4YHBA 3NIDB 2FRXA 1I80A 3TGWA 3EE6A 3B5EA 2RMKA 2QRLA 4MV3A 3F46A 1WB9A 2XTJA 1AKNA 4M60A 1FMJA 1Y9ZA 4MO2A 1FU7A 2Z9DA 1SK9A 4IVNA 3WWZA 4BEJA 4XDZA 5BN4B 2DABA 5CH5A 2OV3A 4FN4A 1M0SA 3HCDA 2M9MA 2VJYA 4R2IA 2HHFA 3RYCA 2JEGA 3EAQA 1L7MA 3CVUA 2LXNA 5DNEA 4M83A 2QLLA 2R1ZA 3GV8B 2WJJA 3BQ9A 1IJBA 5UKDA 4EG7A 4EJ0A 1Q50A 1W85B 3Q8MA 4LK3A 1IBLB 2XCRB 2AEMA 2CBGA 2XJ9A 1SBZA 3E8XA 4JA2A 4IMJB 3NHUA 3AO0B 1MTZA 3NIFB 4AROA 1GA1A 4OHXA 3ZS8A 1WP4A 4R7TA 4G0ZA 1J07A 2OGWA 4MS3A 2X15A 1Z0JA 3CGWA 5IM4A 3JR7A 1XZLA 1U7PA 2RHCA 1FMFA 5AW5A 5I8WA 3I3SR 5I9TA 1PD1A 2A3RA 4WRRA 2C2ZA 4PRZA 1W2HA 2QTBA 4YJ3F 5G0UA 3HWRA 2FWPA 3QK7A 1URPA 4RK5A 1VKHA 1Z16A 1W6RA 3V4FA 1RMTA 4O4JB 3UV7A 3FPFA 4Z54A 2HF2A 4B1FA 2IX3A 1KMMA 2W70A 2ID4A 5A62A 3BHIA 4UUNA 3S2EA 3PO2G 3WV5A 1XB2A 4X54A 4DTIA 2P0YA 1JB9A 4B7AA 1KC1A 4MVJM 5LP6A 4MAFA 5LJIA 3JZIA 1BDHA 4OHMA 2QP9X 3U17A 1EGAA 2O7SA 3FYHA 1QIFA 2X5NA 2XZDA 2WF5A 3J81A 1AGXA 1Y4DE 5LQRA 1LK7A 3AR6A 4F3RA 2UYHA 3NS7A 1HO3A 1VRCA 3OJLA 4HDNA 1I6LA 1V1RB 2J67A 2O5EA 4GO1A 4MDFA 1MJNA 2ZVQX 2YVLA 5F7XA 4RPGA 4FFSA 3EGDB 1U8CB 1ZMTA 1RWNA 4MAAA 4HZIA 1XQWA 3UN1A 5AP9A 1D6NA 3H4TA 1LKZA 2O5RA 3NV9A 3HG7A 2HMYB 1S0UA 4Y3UA 3H97A 5LB2A 4CL8A 4KZKA 3A1DA 3OZRA 1KDYA 5D5QA 5KREA 1OTXA 4OYHA 4JAVC 4GX2A 2AEEA 3BAZA 4N49A 4HQOA 1EEXB 2TMGA 4L8FA 3ZU3A 2JRCA 2DT8A 2P78A 1JGTA 4C0JA 3FUXA 4QM7A 3AG5A 2C5HA 1P4HA 3O90A 4JT2A 4J7CA 1HYEA 3RSLA 4PPNA 2Z2KA 3U3ZA 2I7XA 3GFGA 3L6BA 4HTFB 1P33A 3AEUA 1SXGA 3OVMA 3S27A 2QR3A 1D5CA 2Q5JA 1AMNA 1AZWA 5ALRA 4YDQA 3Q3VA 5H3HA 4G0OA 3MTEA 3ZQJA 3INRA 4FR5A 3ZNPA 5JVDA 3AUFA 2NG1A 2VXYA 5I01A 2DFTA 1IYDA 4ARVA 4NL4H 3UJPA 5DOVA 3MMNA 1NATA 4NV3A 4YRIA 2GARA 2BR5A 3JQRA 1YHZA 1Z6TA 5JYBA 4NDZA 1E5QA 1UBTS 2ZTMA 2GAJA 5BRNA 4TKLA 1JE1A 2GOYA 4HEA6 3GDFA 1AS3A 1CHDA 4J9KA 4RCZA 4YR0A 4JR2A 3W2HA 3VI4B 2WWGA 1PHPA 5D2CA 2WIGA 2HQOA 2EZ8A 1KY3A 3HL4A 1Z5WA 4HP8A 1Z2DA 1FVOA 4OXYA 4IRXA 3IVMA 3QFTA 1POWA 2QJWA 4PPGA 5EKSA 5J59A 3TB6A 1DAAA 1P1FA 1M0WA 4B4OA 2FPLA 4IJ5A 3WLOA 3GLHA 2ZU0C 2BSQA 2VO1A 1PBTA 4NYJQ 2A5DA 2Z57A 2XUOA 3MR2A 4S0ZA 3H7AA 2VWQA 2P11A 1W19A 3RRYA 4FYYA 3CXUA 3S2ZA 1IJEA 2JAQA 1K8RA 1FDIA 1XLWA 3IBTA 3A6DA 1NBME 5BR4A 3OX2A 1D04A 2ZIEA 4KO3S 1RXWA 2QL7A 4EDFA 3U2QA 4I5DA 2XMCA 4FR2A 1T5BA 4LZZA 5IFKA 3NM6B 3OFSA 4DIUA 2VBIA 1DEOA 4FS2A 2CL5A 3W6ZA 1E0DA 8OHMA 3FMOB 3TPZA 4K46A 3NHYA 4KFTA 3GLFE 2W98A 1DAEA 1TF7A 1ORIA 1M33A 1Z07A 3ONFA 3NFYA 3PVSA 4UHFA 1DTWB 1G16A 3LHSA 4LXUA 4TVKA 2Q7XA 1PEDA 4K81B 1MH1A 3SHWA 3U39A 3LL7A 2O1EA 4A03A 1L7QA 3RSZA 3L0ZA 3EDRA 3RT9A 3L7OA 2QSZA 4ESOA 2NP6A 5KOIA 2CFCA 2X7XA 4P5PA 4HWSA 1GUFA 4ZTUB 1W4ZA 4UBOA 3NFRA 1QYDA 3FKIA 1I5EA 3I01M 4QWBA 2OZLB 1Q6ZA 2NVOA 2RIRA 4E46A 1QR6A 1NNSA 4TRNA 2IT1A 3BM5A 2FW0A 4WZBE 5DM70 1BS1A 3CH6A 1EK6A 2RHRA 4N8EA 1ZKDA 4KCGA 1F2DA 1EJBA 4BV3A 1C0PA 2DTXA 5SZHB 4P7FA 1E2DA 2VPTA 1YB5A 1HDYA 4R1UA 1RPJA 4TS9A 2QGNA 4OI4A 4DG5A 4CM5A 3OA0A 5F1YA 4KR0A 4K87A 1UK7A 4PRYA 1LDGA 3MJEA 3NO4A 2JIZD 5AD1A 2GK4A 1EQAA 2GASA 2HCTA 1DHRA 1NSFA 2QIOA 3O9VA 4HVCA 5CX1A 1X1TA 2QL9A 3GRRA 1PZXA 3E8MA 4YRBA 5LNK1 4WOBA 4YAJA 5TDHA 1TJ3A 3ENNA 5ELLA 2O05A 2PZKA 2PLWA 4AMVA 4GQBA 2H7XA 4W5WA 3QLUA 2QS9A 1UQUA 3TSCA 3PFNA 1E94E 3LVQE 1BQEA 2ZAGA 1I3NA 1TXGA 3KYJB 4E3ZA 3V4LA 1PU2A 4II7A 2AL7A 1S8FA 1MB0A 4J03A 3AF6A 1IJKA 1ZK2A 3VVBA 3WGMA 4OI2A 4M2LA 3QUBA 4B3CA 1V26A 1BQ4A 2X58A 4HN9A 5A2GA 3LPCA 1U2QA 4IDGA 4EM6A 4MPJA 4UFPA 2YV2A 4CMGA 2VRBA 1RXSA 4Q5IA 2INGX 2I4LA 1HDCA 1T3TA 2OLEA 1TM5E 3JQ8A 4FGUA 2XTZA 1CUIA 4EITA 2I3BA 1PZHA 2VIIA 2CVFA 2ISCA 1LY1A 1E1RD 3VR0A 3BE6A 2OBYA 2QA5A 2P2LA 5AM0A 5KTKA 4YDSA 1DAOA 4IHJA 1LB1B 4LHYA 5BSKA 2D59A 2EFJA 2I7TA 5IVIA 2C9MA 2XDQA 5A7HA 3PRKE 4PFKA 3UK2A 3DF9A 3OPYA 4B3TH 3FNEA 2IEDA 4Q0MA 1LX7A 1RM5A 4IZ6A 3N2GB 3JRWA 1ZN2A 2WG0A 1AOXA 1R5OA 4HNUA 3ITDA 3U3KA 1U9JA 4AFNA 2VSQA 2B8NA 3ILVA 4LMPA 4G9BA 2J0QA 1WOMA 3PNYA 3N76A 4PSCA 4BPBA 1JEYB 3U9SA 1TQ2A 1C1DA 1LJ8A 2F1HA 1KDVA 4QUAA 3QEJA 1E8DA 4CG3A 5IP9G 2EIHA 3QVSA 5K0SA 4IG9A 1YONA 1WXQA 2OUKA 2FX3A 3F8TA 421PA 3BULA 1DC8A 1KK3A 2JIPA 3LVFO 1YQXA 2V8OA 1XNHA 4DG9A 1QHHA 1W36C 3QZ8A 1DRJA 5LP6C 1WCV1 4TXLA 3JSLA 5DLFA 3HDGA 3HXMA 4FPXA 3WR5A 4G0QA 3RF6A 5JI2E 4QG3A 3A05A 3WAGA 3WGGA 5I5EA 1XNJA 2HWUA 3L6UA 1E18A 3E7WA 4YRCA 3HCPA 3ESQA 3E4CA 3E3LA 3C87A 4GC5A 3AUUA 3UGJA 2MU1A 4A8JB 5LC1A 4MEAA 3D4IA 5F9MA 4L0MA 1QK5A 4YCLA 2Y6VA 3W6OA 3AR4A 3Q1KA 5L4LA 1ZIDA 1W6UA 4BLPA 1EBUA 3LBIA 2P3SA 4KRYA 1OFIA 3DZKA 2YBEA 2H85A 3H1FA 5HUHA 4CR6A 4RCYA 1PS8A 1IZ8A 4PX5A 1G7SA 3EXFB 2IVZA 1X7WB 2EFYA 2RH9B 4DBLC 2QMUA 3FDIA 4IJWA 1DG3A 5JEDA 2ZBGA 4X6XA 4O3RA 3DKPA 5BMOA 1EDBA 2AXEA 1EFLA 2MMCA 4KAXA 3RK0A 3K30A 4UZEA 3R5SA 4FNOA 2WIDA 2GJ8A 3DMHA 4P3OA 1VA5A 4HMOA 3TIXB 5P8WA 2Q0SA 4KPGA 5JV5A 2WTUA 5I6DA 4D8VA 1R9JA 2C7RA 1Q6YA 3PF8A 5K8TA 4HN4B 5IK2D 3SI7A 3LRXA 4EGJA 2ZXEA 2Q2TA 5B4UA 4CQNA 1OA1A 2HMUA 4BLWA 1UXIA 5ULLA 1IIRA 3KKMA 1R10A 1OOEA 4MV6A 1VG1A 4D9HA 5EJ2A 2WAXA 4TTTS 4EENA 1JEQA 1R5JA 3C74A 4YRTA 4HWPA 1OZAA 3GRAA 3OKPA 4MW9A 3ZZ1A 1MR3F 1N2SA 3TTUA 3EIEA 3K8YA 4WHMA 5CTAA 2VFAA 1XKTA 4QUJA 4JS0A 1XF1A 1SCKA 3TLCA 8ABPA 1P1HA 3JSAA 4JDPA 3FKSD 2JBHA 1UPUA 3SCZA 2CV2A 3OP4A 5EDWA 1K7SN 1U6KA 2X23A 2D7DA 2RHGB 4M38A 1KE1A 2HTFA 4GSLA 1JNXX 1UDCA 4BNIA 2QP4A 2HVQA 5EN4A 2QNRA 3PCRB 2DERA 3MCUA 3KT8A 4BVLA 3PC6A 4HFJA 4X20A 3B38A 1DO2A 3PXAA 3MELA 2FDCA 1LRJA 3FYTA 3RK1A 1KK0A 2A4MA 4HNGA 4HUJA 3GP3A 4PNEA 1FYDA 3EGVA 1GQYA 4PE5B 3IEIA 5B64A 4R8MA 1UK8A 1EVIA 3TBHA 1TEZA 4HVTA 1GQ2A 2Y92A 1UDAA 5T67A 2M1ZA 2DHRA 3KUCA 4DBLE 1T5SA 2GN1A 3DT8A 4FDUA 3LK7A 3EZ6A 4BQNA 1DEAA 2RH4A 4GLOA 4OK6A 2ZGVA 4N03A 4CL2A 4ZT5A 2ZVPX 2W0MA 4TMTA 1Y8QB 1D1SA 3PNSA 1RRGA 1B8OA 2YYYA 2OZEA 3CRQA 4NNJA 4HFMA 3I2FA 1GPYA 2RKOA 1LXCA 3BIOA 3AF3A 1DJOA 1CETA 1SZPA 3WLIA 1TNDA 1V7QA 3L01A 2L19A 3P0EA 4MEBA 1BG6A 4HQFA 2QLJA 1AKMA 3IQWA 1CLUA 4FGSA 3IAS1 2XJ4A 4YJHA 3PFFA 4JYZA 5DQIA 3TIVA 2QRHA 3VMFA 2OCDA 1PQWA 5BN5A 3DTNA 2EU8A 3OZVA 1VECA 2D4HA 3PUVA 3N2NA 3S4YA 2DPGA 3OPQA 3TRIA 1D2MA 4LGMA 3BTUA 4PFJA 4IRUB 2E89A 3MWDA 2QORA 1NI4B 1E7QA 2O8DB 4FBMA 2QJFA 1ET0A 1Q1QA 4IIBA 3UW1A 2QVLA 2P5TB 3HVKA 3TG2A 3PP8A 4EHNA 2C9OA 4WI1A 5GJVC 5DW3A 1YS7A 3PNBA 3EG9B 1T26A 3D7LA 1NL3A 2I8CA 3GGOA 1SPBS 2A8YA 1UBSB 1PJAA 1XJ0A 2R7MA 1WW2A 2VCHA 5L7YA 2E48A 2WM8A 2HCRA 3GLHE 2ZE5A 3RO7A 2ZYHA 2UDPA 4ZPJA 4EHIA 1KO1A 1TQ4A 4HXYA 1M7GA 1D2AA 1SK8A 4JI3H 1MT3A 3PDIA 1U8FO 1Z4MA 4KQWA 3KAKA 3B7GA 4EFDA 4EB6B 1VTKA 5M04A 5E6SA 2XLBA 1T43A 3PGVA 5KFHA 2H4FA 1FMTA 3IR7A 1HE1C 5KMGB 2DQSA 1R8XA 2PUEA 2DBYA 3LQRA 4RL4A 3DMTA 4BMDA 2HT1A 1DC6A 2A9RA 3ICCA 5BUSA 2B2CA 2P4QA 4GECA 3F5FA 5H4GA 1FMCA 2EXXA 1FL9A 1C3JA 4V39A 2W2NA 4RE6A 4UULA 1HL7A 2H4XA 1TYDE 1WCYA 5DLPA 2CXHA 2YFKA 2UVDA 3C8ZA 4PZCA 4YQYA 3U16A 1SVOA 3NZEA 2VQ6A 4A1OA 4X45A 1ZM7A 2W2QA 2ZUBA 1E2NA 4DR6B 3CZ4A 2DUJA 3C4VA 1ZUHA 4ZCLA 4JENA 4NJEB 4GC9A 1W7AA 2VJQA 1NR5A 3LFHA 5AW7A 3FHTA 2CFTA 4S1OA 5FFNA 3KPWA 5DNCA 2WFAA 5KFXA 5SY6A 2EG9A 3GIPA 1HR0H 4TZ0A 2ODWA 1M7BA 2HNBA 4TLEA 4DARA 4TYNA 2VBGA 4Z6KA 4W1QA 3GFTA 3Q1LA 3SF8B 5EJ6A 3CZMA 4XUCA 2QVGA 4Y8VA 3VNSA 3RYFB 5ENDA 3QBDA 1TMOA 2QT9A 3CNNA 5JO0A 2P9HA 2XDAA 4NESA 3GTKA 2AJ8A 1BU8A 1EXMA 4ZYYA 3IUJA 3MSXA 4V02A 3PUJA 1NLZA 2AN4A 4I99A 2ZAOA 3OE5A 2YL2A 3GBPA 4IRMA 1WQ3A 3DL7A 5JSQA 3ENVA 1MPXA 2ORYA 4Z4EA 3DO5A 1I3MA 4PHTA 3BBPA 5HPYB 1M72A 4JI5H 3FSEA 1L1FA 2R92G 1WF3A 4AMYA 1PL7A 2EFHB 3KQWA 2PMWB 5AJXA 1P0QA 3C2QA 4FKBA 4LOLA 1JHDA 3TRJA 5EWJB 3CGGA 1DKMA 1E1QD 1GL6A 1Y3IA 4DR7H 2H16A 4YASA 1EUQA 6LDHA 3PC2A 4MVJD 5K2OA 3RBVA 3OIYA 4CLHA 1FVXA 2IC5A 1T1GA 4CNBA 1P7ZA 1SHLA 1TT5B 1IZ9A 5FTWA 1UK6A 3AM1A 4FFBB 2JGNA 4PIVA 1EXNA 4LDRA 2R6ZA 1US8B 1ATZA 2D7JA 3F9IA 3T54A 5AOCA 1NR7A 3HFJA 3UMBA 1CS4C 5FA6A 2VP5A 2QRZA 4RU1A 5DQGA 3H9QA 4I14A 2JCXA 4ZQBA 1QH8B 3X2EA 4HDRA 3HOZG 4NWIA 4MB6A 4WTOA 4Z8YA 2E18A 3G13A 2PKWA 5ETJA 3LP5A 3FI0A 2BP7A 3NYWA 3OZBA 1JYEA 2QUBA 3BGVA 4KQMA 2JJ2D 4QVGA 5J3JA 3PUXA 3U13A 1MFZA 5U9CA 1XIVA 1TF2A 1JQKA 1K08A 2UYCA 1AKRA 4PVCA 2VT2A 1QHYA 5CVUA 4K9KA 3AETA 2WVHA 4YJ2F 1JSXA 5TPWA 1ZYUA 4M37A 4EIWA 2EJ3A 4LPSA 1SQ0A 4TKZA 1MW9X 1R4MB 3QV2A 3TS1A 4TKUB 4K6NA 2X40A 2XT6A 2XMDA 4QTZA 3ONEA 1JDEA 2H63A 1UJBA 3OJOA 4DR5B 1ACJA 3PXCX 1GYRA 2R48A 1TT7A 4BB9A 4ND6A 3EBPA 3SJUA 1TJ5A 1I94B 4DV5B 1F7UA 2BE7A 4RQTA 3JWHA 1SUIA 1XZPA 4O7LA 2VUUA 1A9TA 4RPKA 1NQOA 4AY6A 3BKWA 2HD4A 3K9NA 3QWHA 5K3SA 5G2OA 5IVHA 1G8SA 2R8HA 1J0EA 2GPAA 1PK7A 5THXA 1FDRA 3UK7A 3NBUA 4GICA 3OCJA 5FR9A 4LNAA 1HNWB 4XUEA 2HXSA 2B4QA 1C1XA 3P9KA 1ZWLA 1A7AA 3IO3A 2QQ5A 1NF9A 2CXUA 3V97A 4IO1A 2VH1A 3WL8A 1GTL1 3ZZ0A 2WG2A 3O03A 3ER9A 1A2QA 4NOMA 2HBQA 2HJVA 3HZRA 1TTTA 4K8OA 1S2IA 5E0OA 3N70A 3DLCA 3ZDXB 3FR7A 1I3OA 4IO0A 2HC9A 1ONOA 1M2OB 5J47A 2XNKA 3E9RA 3SQLA 3R3ZA 1AZLA 2PT5A 1N57A 4PBCA 1P7PA 1GY8A 4MH0R 4AJPA 3JYQA 3KTMA 3L9WA 4JD5A 3Q0IA 4R2JA 5JCPA 3SWWA 1WMDA 1EDEA 4KK4A 1Y8RA 2JHPA 4UMVA 2ZR0A 3GK3A 5K3BA 5CAEA 1Q19A 1JKJA 1OFTA 3U3RA 3WMRA 1J5XA 1NT2A 3ND9A 3DOJA 3R3SA 2BZSA 2XV1A 4BBPA 3DE2X 5CITA 1G38A 4KI7A 2Q99A 3TTTA 4N5MA 2I4MA 2YZNA 3VPSA 4FOLA 3HKDA 4YQFA 1L7RA 2PA3A 4EA7A 1ODLA 2C4WA 2AA3A 2F4NA 2J1LA 5JUWA 4DV0H 3C48A 4Q3CA 2CLDX 1C0LA 4QXMA 4F9GA 1M7JA 2IYRA 3ET4A 1R4ZA 1VQ1A 3H9CA 4JJZA 2DWOA 1KP2A 5GY7A 3AIOA 2P3OA 3ZE8A 4R8LA 1AX9A 3OF3A 3OM8A 3H4BA 1IY8A 1V7ZA 2CW8A 3NNDA 3QUAA 4KQ2A 4DT1B 2CJWB 2IHVA 4ZV4A 4KE8A 1QGED 3COPA 1TAEA 4YMUA 1GFIA 3C1UA 2XAUA 4ZZ0A 4V3CA 1Y6GA 4JJFA 2BEJA 4DXHA 5K8JB 1O6ZA 4LN1A 2GFQA 3VVMA 2D2VA 3SGLA 3DXZA 5K4HA 4Z7QB 4PQFA 2H1FA 3GJXC 2O20A 1NVTA 2XYVA 2GXAA 2WJIA 1XZNA 4XOIA 1GTVA 1TEXA 4IG4A 4FD3A 3Q8KA 4GU5A 1T9CA 2IYNA 1DELA 2WMNB 3V4SA 2E85A 6ADHA 1TE2A 3T15A 2I6QA 3OTOB 5CFNA 5ALSA 1AXEA 4QPNA 3L8EA 4Q1CA 3ORSA 2C0PA 1TTHA 4LY3A 3AERB 3BCSA 3A27A 2PWAA 3PI7A 3SS7X 3EXIB 2HIHA 3O5AA 3HXQA 2X0RA 1H2HA 1I7SB 3GGJA 2QG4A 1UNNC 1Y3HA 1JH8A 2YWFA 4AECA 3R24A 1MBZA 5KVAA 4UC0A 5K51A 4EG4A 1S2DA 4KW7A 3E05A 4R1MA 3A4LA 3DBIA 1WNFA 3T9BA 2BMFA 5AJVB 2YJ5A 3C3CA 4JXKA 1SRRA 3STXA 3WLTA 5EUCA 3MR3A 1Q14A 2G80A 4EUHA 1HQKA 1QC5B 3F78A 4CUKA 4HDOB 2LVBA 1NIJA 1JF8A 5BV0A 2ARKA 1V3QE 1SXPA 2ZBRA 5ANRB 1EVQA 2A9OA 4OAQA 3ZBTA 3ASYA 1VSUA 5KYXA 1HORA 5IVDA 4IVRA 5JAUA 4YR7A 2J32A 1PHRA 1XEFA 4OREX 3CLRC 1IPEA 2BFDA 1FJHA 2Y0EA 3E2IA 1CNFA 2NAFA 2AZXA 4CEIA 2PT9A 3WYAA 3QG1A 3MLEA 2IZZA 3SBEA 2GYYA 2R79A 2UXDH 4JYBA 4LZJA 1MXHA 1Y82A 1V3VA 1U3DA 2EATA 3GTOA 5MGBA 1VDMA 3S99A 5TNXA 1PJ4A 4RC9A 1YZUA 1NFRA 2KSQA 2ZRAA 5E3JA 4CKBA 1YQTA 2AJLI 3NGMA 3ORQA 3UQZA 2B78A 1LLUA 4REQB 3B3JA 5AJHA 3ZCUA 2G70A 2WNIA 4Q4CA 3UKDA 2NVYA 3DOEA 1L7VC 1JDTA 1YZVA 1NBMA 1U8UA 5FUMA 4DR1B 1WMFA 4NZMA 4EL5A 3D8NA 2XODA 3AKEA 3CLTD 2J0SA 2BR4A 1FFSA 3RJZA 5G3YA 2Y76A 3H9GA 1USUA 1X3SA 4H7HA 3HDYA 3FJYA 3S28A 2OCXA 3M6UA 4IY1A 4O3OA 3LPAA 2FE1A 1SHZA 1D1TA 1DC5A 3BFXA 1DRVA 3WNQA 3KKQA 4O0MA 1E79A 5KYUA 3G2KA 3BMOA 1QPBA 3RYTC 7MDHA 4ARZB 4IHAA 1F14A 1MDFA 2RC5A 3Q40A 5C4XG 1A8UA 3R7SA 4R8UB 1E20A 2WOJA 2HZ7A 2FG6C 3PW4A 2PG3A 2XA1A 4GBMA 1QZXA 2YYSA 2RGWA 4YR9A 3VKVA 2Q49A 4K26A 1ZRNA 1YE3A 3ZGVA 3OJCA 5HTOA 1X92A 4B44A 5GV7A 2ASEA 2VJAA 4EY7A 2CWWA 4O81A 3N2YA 1DEHA 1Z63A 1UJCA 2HMVA 3VXKA 1T8TA 1THTA 3IEMA 3MS7A 4PZ0A 2Z6AA 3CNOA 1PFYA 1HT1E 5K7SA 1FNMA 4Z2YA 2AK3A 1OV6A 5C80A 1FRNA 1K7FB 2D2FA 5IAOA 5K1ZA 4EKDA 3O4IA 1O57A 5AXCA 2I6SA 3AR2A 3P2KA 4H7EA 4TLAA 3D02A 2PMDA 1RIFA 1VB3A 3QKRB 5LMUH 5EJ4A 3FW1A 5EOYA 2DB3A 4QD3A 5IU6A 3D6UA 5LA6A 1FNBA 3MGKA 3GGSA 2WWVD 4WMLA 4QUIA 5A7FA 4WKPA 4AZSA 2R5WA 3TQHA 4ZOLA 2NSJA 5TMEA 1Y7IA 1LA2A 2YN4A 1OB2A 2SCUA 4NCXA 2PGAA 4UASA 3N2KA 2X9VA 4YHHH 3EZYA 3SC4A 4YFVA 3BERA 3UGTA 3UATA 3O8RA 4YTEA 3U7GA 3DUFA 1F51E 4UCTA 2P2SA 3IA7A 3KUDA 1DBSA 1VKRA 5E4TA 4JX9A 1ZHHA 4L6AA 3DHNA 4V1CA 3DVAA 3EVDA 3IDFA 1IE3A 1UANA 5C35A 1WZNA 3KHRA 1B4DA 2CKZB 5F1OA 2QYTA 5D1OA 4ZARA 4ECZA 5A5DA 3IOMA 3GGDA 4FSHA 4YR3A 3PNVA 2X6TA 2C88A 3E22A 4OGLA 1TO6A 1OCEA 4E32A 5CM9C 2X41A 1WB6A 1KZ9A 1ZXBA 1SKQA 5DW0A 3MYYA 3OZAA 4P6VF 1IQRA 2AEJA 1YACA 1VG9B 1FSFA 1RKVA 1FNNA 3WGJA 4P80A 4V2IA 4GYYA 3LW7A 1IY2A 2FOXA 3VU9B 3G49A 4EVQA 3EPHA 3OA2A 2HY7A 2XHZA 1G63A 3KSAC 2V7QD 2GF0A 2R85A 3ZTWA 4K0KH 1KYZA 4OLHA 1Z5NA 2H4WA 1WBJB 4QTUB 3PHGA 4HQKA 2EQAA 2PVPA 3MGGA 4IL5A 3W5OA 5KSWB 5IYZB 3T0IA 3ZV3A 3TLYA 4EAQA 1P2VA 3L0PA 5CNJA 3AXTA 4ASUA 2YIDA 1T0HB 1UAAA 2AQ4A 2B25A 2ZYGA 3PR1A 3KYBA 3TNLA 2CLEB 1ST3A 5AM3A 3HDQA 2ZRKA 1RAGA 4CM4A 1HNXB 4JJKA 4D0RA 3GDHA 2GRUA 5IABA 4Y6QA 2HK9A 3AY3A 5EIHA 4OBWA 4TLCA 5A4JA 3UY4A 1WZIA 3EIWA 4ZHQB 4ZKDA 2R8ZA 3SZLA 5FOQA 1RC1A 1V3UA 5FFFA 2JLYA 4XM2A 1E9SA 1SY7A 3AHCA 2K2WA 4QSHA 5DCLA 1KT8A 1KH3A 4KXMA 2P35A 2FI1A 2R4TA 3LT1A 2W6CX 4EY3A 1A5ZA 2NTNA 1OC2A 5IWAB 1LDBA 1HTTA 4AZWA 4BNVA 1O89A 3KWMA 3ED5A 3QOFA 3DNMA 1W0JD 3AR3A 2QYSA 4D79A 2XT9A 3W1BA 3JASA 2P0EA 2OC4A 2BM1A 1OXSC 1JDPA 3DZJA 1K92A 3P0RA 1IVSA 4CG2A 1LI7A 1RJWA 2DFPA 3M9LA 1PDWA 1P1IA 1FZTA 2EJ2A 2ZREA 4HAXA 1F8YA 1F5SA 4X85A 2REXB 3DE6X 5AHXA 5DLYA 1HE2A 4DUYB 3AL0C 1P9WA 2EHJA 2ZQYA 4ZCMA 1ZNQO 4XASA 1WUKS 5BUQA 1GKYA 4XFKA 4E30A 1P4JA 4LJ5A 2FP4B 1T9HA 2HV8A 1E2QA 5CD9A 3U31A 3IALA 3Q3GE 4ZT2A 3QRWA 4ZV7A 4MX8A 2G07A 2Q5FA 1DIGA 3VPAA 4BYGA 2DJIA 2YIVX 1KI9A 4JU9A 3GUZA 2AFRA 4M8SA 1PUJA 2OPBA 1BZYA 3TGLA 1HE8B 4HQRA 4PC3A 3GV0A 2F4VH 3P0IA 2DH5A 1Y1TA 4C5CA 4DOMA 2GJSA 3UJDA 3LX5A 4A16A 1TIPA 4DQXA 3N0RA 3P9YA 2REOA 3WHKA 3UFXA 3GC6A 5AJYA 1GSOA 3UOAB 5BWOA 1TCUA 2BMAA 1EXVA 3C6KA 2DY1A 4LYDA 3OY2A 2AQHA 2LNDA 3L4SO 2ZJBA 1C81A 2O57A 2R6HA 3OIWA 3MILA 4P31A 3NP7A 1NPYA 4LX8A 4Y0VA 4UTPA 3NBMA 4HDSB 2G72A 4MS4A 3T5KA 2VUIB 3TOVA 3I23A 2FMTA 4CW7A 4URVR 4MI1A 1JIQA 4LRTB 1E1CA 3PEEA 3FCCA 5K3FA 3KL2A 3F4KA 4TWBA 1NKVA 2YTZA 3ILSA 4N54A 4LA4A 2BV3A 2DQYA 4L4UA 2VAMA 4A36A 3G2IA 1WB5A 4OUDA 4CTMA 4GKBA 1Y3BE 1JWLA 3ZZMA 2JKVA 4Q39A 1UEJA 1YQUA 3GHYA 4YECA 1CY0A 4ZOBA 4QBKA 1C7ZA 1WH2A 5ITVA 3IP3A 4EWLA 3DEAA 2R8BA 3UTCA 3MGBA 1D9ZA 1R8SA 4QKQA 5BO5A 1DX9A 4X60A 5D3MB 1G7TA 3ESYA 4MW4A 5CVCA 3ETDA 1W46A 3S8EA 3PCTA 4NEQA 2P65A 3D9QX 5CGQB 5A9TA 5EIOA 1JDUA 4BNUA 5IYZF 3WG9A 3OZEA 3SKYA 2FMAA 1FPQA 2MMGA 5EHIA 1DSSG 2J8ZA 4FEAA 2QGFA 2B3DA 1TTQB 3R9KA 3PYXA 3NNNA 1Z36A 4UBNA 1UK9A 4E5YA 3F6CA 4NENB 3CKMA 3T1HB 1Y6ZA 1U94A 3I9V6 5B1IA 1OI4A 4Z9YA 5C31A 1X2BA 4O3QA 3WLMA 1F48A 5ERYA 3WA7A 4KLZA 4HRXA 3HO8A 3UF0A 3I4CA 5G3ZA 3RM3A 2QD2A 1A9SA 1UDWA 3MTDA 3OWXA 4HVAA 4WFQA 4X6YA 4B81A 3V1NA 3RH0A 4LJRA 4RVUA 5ES3A 1QZTA 3PSAA 1XL0A 2Z1DA 5LYJA 4NECA 2C8KA 1JFRA 1JE0A 1HYBA 2WHYA 4CMEC 3F73A 3K0SA 1VIYA 4ZOEA 2B83A 1KYIA 2CVPA 4UNPA 3BL5A 5KNCH 2Q5HA 4QYIA 2PKCA 2KBEA 1M1YA 2CJXA 2R8OA 3HOVG 3F6YA 3SIPA 4HFNA 1X0XA 3PQCA 5DBHX 4FD2A 4M0LA 3H5IA 4G5SA 4JEIA 4AKIA 4G6ZA 4HWKA 3EFBA 3EMBA 1CYEA 3CG4A 3LDAA 2BBSA 4K6CA 4LBYA 4W7SA 3KJIA 2VDUE 4BFSA 3WLSA 1R0LA 3IAM6 4CFZA 4DR3H 3TFOA 4N47A 3GQVA 3BDAA 3HCFA 1J0BA 3G79A 2V4UA 4CMIB 5L95A 1ZAKA 1XD9A 3ZCTA 4CKEB 2ZJZA 3VPDA 1R74A 1KE2A 1PNRA 1F0NA 4QWMA 2RBEA 2BEWA 2HG8A 4QLBA 2NOAA 4UHBA 2X0FA 5EHXA 1V8BA 3V8EA 4KRFA 4ZQIA 1L4MA 1P0CA 1ISGA 4LHEA 4AL4A 2D8MA 2DMRA 4HB0A 3CW9A 2XVAA 1GZ3A 2J59A 3GUVA 2R6FA 1N0VC 4Z7NB 4BOYA 1EA5A 1Y48E 4TTJA 4YVFA 3Q7QA 5JNSA 2XA9A 4J0CA 3OSNA 1ZHFA 1UKZA 2WDPA 1YVDA 3WICA 3HPRA 2GEUA 1NVAA 1XWWA 3R9IA 4HQNA 1K6MA 4QX6A 5JNWA 3RRZA 3OF2A 4CL0A 2HMSA 1QHGA 1ZUNA 2CEKA 3VHRA 2Z95A 2RBKA 3QVJA 5FNZA 3LH5A 5CPBA 4Q24A 4NBSA 3FROA 4DLXA 5F21A 3ND7A 3C4JA 2XKAA 1BDBA 3KQOA 1MD9A 1J24A 1M5UA 4O4JF 1SZDA 2P9GA 4P4NA 4BKRA 2XUKA 1V8FA 2PUGA 1PS0A 2R7KA 1K97A 3D6NB 2GESA 3ZI7A 2RHLA 2VOJA 2ETXA 3V3KA 1AM4D 3MJSA 2JAXA 4ZCPA 3PO3G 2JEIA 2FKAA 2IDKA 3PGMA 3HFSA 3FUWA 1ORTA 1Y7HA 4NAHA 1E9DA 3QVVA 1AKEA 4O2AB 4EKEA 2Y4OA 3U4DA 2NLOA 1H6BA 4J29A 1NN5A 5AK5A 1TCVA 3RW9A 1FTYA 2FG5A 3HHEA 4D5EA 5IJZA 3DFUA 1OLSA 4R54A 3OHPA 2A14A 3T9DA 1E6LA 4H6WA 1YL6A 4HNSA 2CNDA 2DPXA 2FZ4A 1DRUA 2HGZA 3D8BA 3IS3A 4RXMA 4YONB 1HETA 1P16A 1OLUA 3ER8A 2Q9BA 4ZRDA 3TNDA 5I60A 3C3BA 5JJKA 2FH5B 2X6RA 1R6UA 5A02A 1WKCA 2FSSA 3ZE1B 4MUMA 1NY5A 3ZQKA 2O8FB 4NE2A 1RBMA 1NQWA 3FVWA 2PZLA 1KGSA 2WG1A 1QFYA 1OTHA 3DVLA 2NVBA 1FMLA 4HGNA 1JB1A 3M81A 4EHJA 1JEJA 2HH9A 4B2LA 3DF7A 3KJQA 3WDKA 2W2LD 1PG2A 2NZUG 2BM8A 4IHQA 1P2FA 3B6ZA 3ZHCA 2ADMA 1JTFA 2F59A 3RVJA 4G9GA 3DD1A 1Q0ZA 1WB4A 3TSOA 3OE4A 1HI9A 3K5HA 1O9HA 4PCAA 3R7AA 1K98A 3NWPA 1HT0A 5F9HA 5HFJA 1Y7PA 1JLHA 5J5CA 1N5OX 1Q95A 2YV1A 4EECA 2OO7A 3PUZA 3KWFA 4YDHB 2ZTLA 3FJ1A 4D0LB 2CDAA 3N87A 1J8MF 2XRMA 2FPWA 3AYZB 2H1OA 1L5GB 5FBZA 1OLXB 2OZVA 1LTHR 4J0HA 2ZSUA 3QVOA 4ML3A 4NPAA 4BMOB 2G83A 4INJA 1FKAH 4P34A 3SQOA 5BYKA 1NJ1A 4RXTA 4BIIA 3RGZA 2XGMA 4S04A 2H7YA 1P5JA 5REQA 4BO6A 3F8WA 1ULAA 4V0SA 1F2TA 1OWPA 4B6QA 3V32A 5F2NA 4DIMA 4JJAA 2GVNA 1NMQA 4C7OA 3OE7D 4IR7A 3HXPA 2PEYA 2H4ZA 1T2EA 4B4DA 1XZBA 4MTDA 4XIGS 4DUZH 4KQGA 3GBSA 1QANA 1UDRA 4HRAA 2HN9A 5J58A 4IKPA 1BJRE 2I2FA 4C4ZA 1FTQA 4CI0B 3IQZA 4KX5A 4ND7A 4UD2A 5IBRA 2CBZA 1SHUX 3ELUA 4WINA 1VJDA 1JBQA 4AZ0B 5LU9A 2YJ4A 4F84A 2AG6A 2DEUA 2VK2A 4BWSC 4KAAA 2VP6A 1IN7A 1GFZA 2ZWAA 1MC1A 1LPAB 5TVGA 3K4PA 5KTTA 1VBNA 3FUCA 5SYMA 3H3XA 5EZ5A 4IWXA 3WYGA 1P44A 2O3QA 1L4NA 1LLFA 4MKRA 3GCZA 2FCRA 2PEZA 1NMXA 3D3QA 2UZ4A 1J25A 1HOXA 5CDYA 3AR5A 4DV1B 2FZCA 4KN6A 1W94A 1H2BA 5EMKA 2LE0A 1OX4A 5DGBA 3E9CA 1N3YA 1X7XA 1XCBA 3AJ8A 1A77A 2JLBA 1XLTC 3ROEA 1ONPA 1I0ZA 5KFPA 4RM3A 4OXNA 1RRMA 4D9MA 3GJ4A 1YR7A 3FTDA 3L3BA 1SUFA 1IQPA 5A4MS 1XDGA 5AKYA 3R5KA 4YMSA 4YV1A 4M9UA 3PWSA 2BMVA 1XQ9A 1P18A 3QYFA 5ERGB 4RF4A 3LBAA 1A4XA 2Q27A 3AX6A 3CTPA 3SYRA 1WJGA 4MKZA 3M2PA 3B3GA 2ZM6B 3W9YA 4RTPA 4F6RB 2PU7A 2TRSB 3H5LA 3S24A 2F62A 3H13A 1JX4A 3CEHA 3VC1A 4J9SA 2D06A 5FPPA 1EM8B 1BN7A 4UNSA 4F2GA 3VO8A 3IVGA 4JOSA 3EODA 3L8DA 1FYWA 3CNEA 2UZ1B 4QVKA 4M9CA 1C4WA 2EP7A 2JDIA 4HZGA 1J33A 3OEHA 4UEQA 3OMXA 3L82B 2ZI3A 2JGLA 5E0KB 3E9MA 3JAWA 4RH1A 2PZMA 4AN4A 1Q7EA 4F50A 3W05A 1MRNA 2GFHA 1E4OA 4A3CG 1NPDA 2QZ4A 1L7OA 3DAHA 2ZUTA 6AT1A 1Q0UA 5LMNB 2JZCA 1S3FA 3N7TA 4HV4A 1IHXA 1L0BA 2Z2ZA 1SUAA 5JBIA 1H1LB 3VTFA 4NYJR 4NV0A 1ZWKA 4B3FX 4BNKA 1R0BA 1DZIA 1JIJA 4RA9B 1E2EA 4BKOA 1Z06A 1ZK4A 5D51S 4WLOA 2X0IA 3EGXB 2PX3A 1BGVA 1DGQA 3VUEA 1NVMB 3UHPA 3QFCA 1A7KA 4U39A 5JO9A 4QOEA 4RFVA 2QRUA 3WLJA 1UBHS 3ZUPA 4QWWA 3HNRA 4TWZA 4P82A 3PJEA 4OQFA 3HP4A 5LUBA 4POOA 3D81A 3T7CA 5ENZA 4OY3A 3R5JA 2O2XA 3M7IA 4LIPD 1JSRA 4TKVB 2TMYA 4KR9A 3PQ2A 1JFFA 5MHTA 1FW6A 5E6RB 3NYRA 4KGVA 1S9FA 4W7IA 5IDWA 3U81A 4OKNA 4E88A 4ND3A 3GPIA 4OEHA 3DZCA 3CVYA 1V9PA 2PYDA 1ODTC 2FDXA 2QQFA 4MKXA 2FA9A 2O6LA 4GX5A 1A2OA 4DHEA 4YYZA 1ZHOA 1PKXA 2M32A 1H5NA 3PGA1 1N1DA 1GKKA 1XNRB 4L74A 1V8OA 2BVNA 3BZUA 1XZFA 4DA4A 2H1CA 1XE3A 4YUYA 4FSXA 3JZAA 1GDDA 2O8NA 5CIWA 3UA3A 1C2TA 1MH9A 3AF4A 4NOJA 1OYVA 4Q9DA 3W3AA 2O1XA 4MVJI 4ZMRA 1Z28A 3NHFA 1XTVA 1J8YF 3DD5A 3H2BA 3VR4H 3ZHRA 1CHNA 2H65A 1XLUA 3JZDA 2Q07A 1H4VB 1T24A 2GK6A 4PC1A 4R2HA 1CRWG 2TYSB 3JQAB 5DH9A 3SI8A 1YMQA 2VJNA 4L9RA 3T7AA 2WINI 2XTAA 4ZQCB 3C5VA 3CRW1 4JHXA 1XV5A 3A7DA 1I3CA 5K2MA 4ITUA 3J7AC 1GL3A 4C0BA 3THXA 4EZIA 1WSDA 1UZNA 3NKFA 2HK7A 2H1LA 2OORA 1UP4A 3TL2A 3BA9A 3BK1A 1RZVA 1UBKS 2AQIA 5I7EA 4PNHA 3RJ0A 1Z62A 5HIIA 1U63A 2A30A 4DDMA 3M6VA 5I47A 1EUCA 3GJYA 2XKBA 2JHFA 4OGWA 1XLVA 3E7PA 3CUTA 4FB5A 1C7RA 2XF8A 4ZVQA 5JWOA 3D8UA 4MARA 3IP9A 3WK8A 1HOTA 2N46A 3EVTA 3I30X 3TB4A 1JAHA 5EP4A 4UPEA 2QENA 4LRYA 3IX7A 2C7VA 3W4IA 1M1YE 2JPDA 2Y99A 4RVGA 2FJZA 1XCGB 4ARAA 4BNDB 2HF8A 2DBQA 1GU0A 4E5SA 1G8PA 3W5JA 2AOXA 4OLFA 2IKSA 1M8PA 3QKSA 2Q4TA 2Y2UA 2ZYDA 1JSLA 2AQ8A 1OASA 5JCJA 4PSDA 2XTMA 3SG0A 2J6CA 2Y77A 5E9QA 3QX9A 1QHXA 4CL3A 5JADA 1Y5IA 4MGZR 1JPVA 3FIJA 2QRVA 5JSZB 1RPNA 1QMGA 2XR1A 5KDOA 2GWRA 3CPJB 5BWXA 1KAOA 4HEHA 3EZNA 2CK3D 2OCPA 1TLLA 4XSVA 1KQOA 2EQBA 4RGYA 1PYGA 1UT5A 4KGDA 1DX4A 4YV7A 2I55A 4MIOA 1X8LA 3AFNA 3HSSA 1G17A 2AOWA 2NUPB 4MGEA 4R16A 4B73A 4UBIA 2Y27A 3FUUA 3O8QA 2QB5A 5FUVA 3GJQA 3LS2A 3NRCA 6ABPA 4C6RA 4CU2A 4NYIQ 2FZEA 2ZJ0A 1U2GC 1E3SA 3JW8A 4P86A 3PTZA 1XTJA 2GKGA 3DLPX 1Z2PX 2OK8A 4OQLA 1XMQB 1ZFNA 2OCGA 1H2EA 4PLZA 3ZC3A 4HNAB 3T3IA 2WWHA 4C2MA 3CSUA 4Q3EA 2OD2A 3OOEA 4CT0A 5IJXA 4EVSA 3SZGA 1K7XB 1MKYA 1R6VA 2JCGA 2EBWA 3DBLA 2HK8A 1FA9A 1N8TA 1RACA 4AX4A 5EWMB 3TQSA 3HLTA 1YAHA 2VDJA 4Q1FA 1JI3A 2D7CA 4JA0A 4IDQA 3A1SA 1SCIA 1J9EA 2V7XA 3UHAA 1G2IA 3C7TA 2HU7A 4RPJA 3N0VA 1A50B 4F92B 2VEDA 1R18A 3DE5X 3BGSA 4PLGA 2Y93A 4ES6A 3BWBA 1Z68A 3ZCPA 3EMDA 4AKSA 4J3NA 2CHGA 1GT91 2ZUEA 4U7CA 2Z2YA 4D02A 1T3ZA 2Q2OA 4EI8A 3NTRA 1T8UA 5M29A 5FWAA 3R5HA 1UT6A 1BGWA 4H31A 2WJ6A 4MYDA 5KSYA 1UKBA 2J4FA 1KKMA 5B6JA 1PNVA 2IS4A 1MZPA 5F76A 4A3FG 1XZKA 5AFSA 5G0TA 4MQMA 3FRIA 4GI5A 1RE0A 3T35A 4GGMX 3L02A 4L4ZA 3E8SA 2J5RA 3IJEB 1CTQA 2H8GA 4LJ6A 4YBRA 2XB4A 2A0WA 2NVXA 3PPVA 4ZZIA 4EEXA 4J9LA 4MP3A 4FN5A 1S3SA 5B6IA 3K92A 3GFQA 2W6ZA 3JATB 1CEXA 3GLQA 5KFKA 4DDWA 3TECE 5GJCA 3PIIA 4MUAA 2BLLA 2FE4A 2C2EA 5CX4A 2QE7D 4JV5H 5F12A 1PV1A 2BBWA 4I4LA 3R40A 2J08A 4DV3H 1KFJB 2OLJA 2V7EA 5E1MA 3VZPA 5TLSA 3R7FA 4YT4A 4MJLA 2CD7A 1SOVA 3ABOB 4X62B 1DMSA 2YYAA 3G6VA 1X42A 3HBMA 5G1PA 1DOAA 3DZDA 2VDMB 1VMIA 1YDHA 4G23A 3HCCA 3T5BA 3NBXX 5BQOA 4XR9A 3FCYA 4FFNA 5FTKA 3KE8A 3T9EA 4D4KA 2PMKA 3LD9A 3HMQA 4PWZA 4E03A 4EEYA 2IIPA 1WCXA 2J0UA 3OECA 2NUTB 4UCQA 5DCUA 4CCYA 1J7JA 2EX4A 5HNKA 3C7KA 4O4HA 2XZLA 821PA 4WCDA 1HLPA 4K86A 5HUJA 3EZFA 4FCVA 1XCPA 3TNYA 1A8PA 3PQ3A 5TPZD 2EP8A 3HXOA 1UOPA 2O3SA 4J0EA 1PL6A 3OIFA 4DHWA 4YP1A 1SG6A 5IKOA 3WBKA 4C3UA 5J9FA 2R66A 4MPTA 5EAIA 1HNZH 2OA0A 2FKLA 2ZYAA 1TEHA 2XD9A 4B84A 4DEXA 3AKYA 5L3VA 5HYVA 4ECUA 2WTMA 2J48A 1WZCA 3TEFA 2IJGX 1ZVVA 4Z3DA 4JFAA 1ZSYA 2PRZA 3ZWDA 1PEYA 2QUKA 1OAOA 3Q15C 3TVYA 2G4CA 3U7QB 2CWDA 3KJGA 1AU9A 2YJZA 5LN1A 4OGGA 3JVUA 3I61A 1RADA 2QX8A 3UXEA 1NHGA 4IDFA 5C9ZA 4OX9B 4UVDA 1CDOA 2BFAA 1CLEA 3Q8LA 1Q0PA 4HYYA 3CH7A 1T9ZA 1WHSA 1BVYF 1R50A 4FDLA 4JL8A 3HA2A 3WTCA 4N7BA 3F6EX 3U40A 5GPBA 5HDQA 2VT3A 3MJ4A 4UXIA 5F2KA 2AN3A 3I5MA 4KTTE 3SM9A 3K73O 1LSSA 2VNHA 1DKRA 3T3OA 2RCNA 4F2PA 3GA0A 2QTWB 4FFVA 1Y81A 3R5TA 3RIMA 4LC0A 4R9SA 3QGMA 1O6GA 2CXRA 4AN0A 2XUHA 1U5AA 1PR9A 3Q6NA 3TLKA 3ZI0A 4KBGA 1VLZA 1QP4A 2YHBA 4TV8B 2H2IA 2UZAA 1ZL2A 4O4IB 2K5UA 3N86A 1FY2A 1Y14B 1ZITA 5CA1A 1FFXA 1RI4A 1ABBA 2UYYA 1J8DA 4DCMA 4V2UA 2YWHA 2D8AA 1XEXA 4G0NA 4RVSA 4H77A 4EF6A 4M8KA 4L5YA 2QQEA 1NGSA 2X5OA 5EE9A 5TARA 2P7IA 3QHQA 2H6EA 2UV8A 3G9UA 3U62A 2C9DA 5CP8A 4JQYA 1MAWA 3UMGA 4PBRA 5EVJA 4EJ2A 2RK3A 4LI3X 1BWPA 4LJYA 3HY6A 4PZ8A 4C2TA 4PCVA 5G0VA 1JHYA 2BEKA 5AKLA 1YTLA 1T2UA 2R6R1 5JRDS 3KT3A 2PUBA 4MP6A 4MR8A 1PR1A 3L7NA 1LJUA 3A8TA 3F90A 4IDBA 3OUUA 4UCWA 1JJ7A 2NZYA 3BMQB 4YCMA 4CEHA 2OORC 1FP1D 4HGQA 3CWZA 2Z56A 1HDXA 4N3CA 2XKKA 3N44B 2QRMA 1YB7A 1ANKA 3IHLA 3FPLA 5KFFA 4FFRA 3KKNA 2UZ0A 1VB5A 1GGHA 1GTSA 2O0MA 2N1MA 1N2XA 3ZD6A 3N05A 1X13A 5KNLA 4GE0A 1N3LA 3TEMA 1UMDA 4ZT4A 1R00A 4TMFA 4FYPA 3IUSA 4HRVA 2OB1A 2QVCA 5F1KA 3GD5A 3WQSB 3LDFA 1CUXA 4OUKX 4JBIA 3V7FA 1XX6A 2AMVA 4IDCA 1XDNA 4M1MA 1HFEL 3GROA 1GPWB 4M1KA 2IVFA 1QG0A 1KR5A 3IXLA 1PD0A 4NCIA 3OO0A 5BVGA 2O8BA 1X9HA 3E7DA 1JAYA 1QQAA 2OHVA 4RV5A 4PYKA 3D7KA 6GPBA 3HB7A 2Z6VA 1RI2A 1QZ3A 2A33A 1Y1PA 1D1PA 1FYXA 4O84A 2Z3ZA 3R6TA 2UXCB 4KMRA 2GHTA 1NSYA 4CM3A 4NE7A 3DVSX 1O77A 4P98A 1ND5A 4EYKA 3QE3A 4QICA 3VR6D 4B3DA 4W63A 4MW1A 4Q9JA 3CZAA 3C8HA 3EA0A 2ERXA 3THRA 3C5WP 1E5DA 2C99A 2NO4A 5FUBA 4WZZA 2DLCX 4NABA 3URMA 5IHPA 4UZSA 3AWIA 3P32A 1QJCA 1QHNA 2BFBB 1F12A 1XMPA 5KFSA 6PFKA 1SKAA 5LDDC 2ZSJA 1Q7CA 2ET6A 5J1SB 4KVFA 1D7AA 3H1AA 4UNNA 4WJZA 1XRMA 1QX4A 4XJSA 2PV0A 1O0CA 3W9UA 2R1VB 5FTNA 3ZWNA 2ZWPA 1YH3A 2V7VA 3KHSA 3OCZA 4Q02A 3FE2A 4EG3A 3X0DA 4C0QC 3T7DA 3EOZA 3AVTA 5JQGB 4ZYUA 4CKCA 4MI6A 1QH9A 3SEQA 2FMIA 3DGEC 2XHEA 3WIDA 3VYTB 4EQ6B 2EX0A 3PW5A 3A9UA 1SVLA 3OZWA 3TQRA 1OB5A 1Z8FA 1O5IA 4TVIA 5DWVA 3I4FA 2DLDA 2ZBEA 1Y4ZA 3HFRA 4CGYA 4AB1A 4Q4JA 1G5TA 1P17A 5AHRA 3RF7A 4ENPA 1WXHA 4Z53A 5EE5B 5C37A 1GG5A 1CKEA 1KRXA 5FHRA 4ED6A 2GPSA 2GHRA 2XUAA 3WX0A 2PCLA 1E7YA 3GX1A 1N34B 4YROA 3LW8A 7ADHA 4X95A 3NBYB 2FPRA 2JATA 3R7WA 3GRKA 2V0NA 4ZVLA 4BY1G 1C3VA 1WABA 2Z5FA 3H18A 4JJ4A 3D3KA 3PQ4A 3TDMA 5FOSA 5JOQA 1JR3A 3ESDA 1KJ8A 1Z0KA 5G41A 4OM7A 3UJHA 5IC4A 3OTWA 3V2HA 1YSCA 4Y2VA 3RFFA 4RH0A 3ECAA 1EFRA 4Q3LA 3Q98A 3GPDG 1KRHA 1TD1A 2B4TO 1TAHA 2IA6A 1HEUA 4IDHA 4E4TA 1OGIA 4WWHA 1J5PA 4MVJG 3W5DA 4URHA 1KNQA 3RB6A 4YPOA 1AN9A 1I5OA 3DDCA 1N9GA 3H2ZA 1E1YA 2NXNA 3HJCA 3LLUA 3SLGA 5IMBA 2NU9A 3ONNA 4IINA 1XZAA 4KXQA 1OREA 3I6IA 2D2IA 5EQDA 4CMEA 3Q8SB 3KBOA 1I6MA 1K7YA 3RU2A 2N47A 3RJ9A 4UTOA 1E2PA 4QPZA 4OJTA 3H4VA 4C6TB 4IEEA 4F46A 2EZ9A 4BXOB 5FBLB 3DL2A 1PJCA 4F38A 2LCFA 1XVVA 1WDLA 3LBFA 4GLJA 4RY2A 4UAJA 5EWLA 1C3EA 1JR2A 4K5QA 3HVRA 1TMKA 2R4QA 2DBZA 3D3WA 3ZZTA 2PK3A 2B7LA 4QGGA 1E3LA 2PRYA 5EXEA 4AIIA 3LUDA 2VC2B 3V9PA 2X8BA 4B3BA 3QWBA 3NHAA 2FK8A 5TF0A 2R8JA 1USIA 4Z3KA 3OHBA 2E21A 1KNXA 2XGSA 3V42A 1NN1A 5C32A 4U9UA 2XDWA 3U3XA 3W0LB 4D3SA 2XCPA 4YYEA 1PE0A 2WYVA 3OCYA 2G1UA 5AVXA 1JDJA 2ALJA 2CV1A 1XRNA 4A15A 1XDZA 5CE8A 3MBOA 5BQ5A 2PUJA 1QDUA 4JI0B 4G84A 1CDEA 4N7MA 3LC2O 3BA6A 4XQ9A 2YV5A 1U2EA 1ZINA 3EDMA 3WQQA 4WCFB 1DRKA 3UAVA 3ZD7A 1EIZA 3FKJA 1U7WA 5EZQA 1XYGA 1O97D 1GCAA 4YQWA 2NUBA 5A3JA 2WK1A 1ZLXA 4MQFA 3AW8A 4X64B 3R09A 4J7XA 4R1NA 1PX2A 1I2ZA 1QFJA 1SULA 3PHLA 1KMQA 4G1EB 5A5VA 1IBMB 4Z4GA 1TAGA 2RGNA 1OAOC 4LJ4A 2Z1MA 4WOCA 1IM2A 4M8IA 1A8HA 4I55A 3NVAA 1NTRA 3GJ5A 5I8PA 2HIAA 5C7OO 4S1TA 2H5LA 2L0XA 4BNWA 4GFDA 3VYSB 1COWD 3LVRE 1X8KA 5E9AA 1YL7A 2D2EA 3ZW8A 4DQLA 1Z29A 3ETEA 1CFZA 2PMCA 1C9NA 1G59A 3EIQA 3WAJA 4HT3B 3VZSA 2QJOA 5AJUA 5LXTA 3RYHA 5B55A 4RHXA 1ISMA 1OT3A 2NZ2A 2XXJA 4DLPA 3PFIA 4EFBA 5H4HA 3DV9A 3W3AH 5CIYA 1RWMA 1XTPA 4K6HA 3IPAA 2CNBA 1OBDA 2WU1A 1K3UB 4DJJA 2W6QA 2QHXA 3FDJA 4O3NA 2O3RA 2EWMA 5TT1A 3QUQA 3N5KA 4E1VA 3O7WA 5HJEA 2ATCA 1ODIA 1THMA 4YRQA 1HYGA 2CMHA 1Y9JA 4J0IA 4FW8A 2OXRA 2DU8A 3FWPA 4KLAA 1KYTA 4ANFA 1C3LA 1NMYA 1GAJA 3OQHA 2QL5A 3QEMB 4ECXA 1BX3A 1RXUA 3G1WA 4N1AA 4Z49A 4DC0A 2D1FA 1TM2A 2Q46A 2WJPA 3FB1A 4MPPA 2VQ3A 2C98A 1II0A 3WK6A 2EJBA 2JGEA 3I6ZA 4QUHA 1U1CA 3ZGZA 4IQ4A 2VJDA 2KYRA 4CKYA 3A2KA 2FJPA 3OEWA 4KLRA 3NC0B 4MWCA 4Z99A 1LBQA 4DCUA 1KP9A 2X1MA 2PGIA 1C2YA 4KSBA 2WAQA 2QROA 1X1BA 3K1AB 3O47A 4WZAA 4J9NA 1S96A 5AO9A 4U5XA 1AXGA 3QVTA 4PTLA 1VKZA 1B6SA 4QUGA 2WUEA 5I7WA 2PLRA 1K1SA 1VC2A 1SQFA 4ZQFA 4DPMA 3QWAA 5JDIA 4XW2A 1YBFA 2ZYTX 3AJ9A 3UIEA 3IG0A 1CEQA 3E5HA 2ZT5A 3OJFA 1CVIA 3QLEA 2MR5A 1C9MA 2LWIA 4CTOA 3H11B 1ZG3A 1L5KA 2VYND 3ZIAD 4ZDKA 4RZUA 4JH0A 3SHTA 1TM4E 3DOIA 2KS6A 1HLGA 3ES9A 4I2VA 2OCKA 2WD7A 5L51A 1A69A 5JTUA 4ZAGA 3BRWD 4WXYB 2JJYA 1S2MA 3IAXA 1S97A 2W93A 2JD1A 1TM3E 2AG0A 3RD5A 1DP4A 4CMCA 4HYTA 4EZBA 5FORA 3V1LA 1BW9A 1QH1A 4NOKA 2FDRA 3WNBA 4I4TA 3U02A 4Y2HA 5I9MA 1AA6A 1KYYA 1JMVA 1ISJA 3LXXA 3G7SA 1A8IA 4YPVA 3SZRA 3V1UA 1MC5A 4LZPA 4BKMA 1NXPA 4DABA 1XP8A 1HMYA 2V6IA 3NP9A 5K8CA 1IB6A 2Q6VA 1RVV1 3LOUA 3GMDA 4KVAA 3CBGA 2XMBA 3BH7A 4X24A 1XR3A 4EKIA 1OH5A 1OY1A 5HBRB 1EU1A 3KQLA 2VKQA 1K27A 4QFBA 4DLZA 3LCMA 2P9EA 3ZHSA 1D0VA 4JOCA 3KDAA 1AB5A 1PGOA 1MABB 2VH5R 4PQRA 1GVNB 3KSDO 1G42A 3QMWA 5DYNA 1ZVMA 1OWNA 1YUNA 2RK6A 2RC6A 1XLTA 2HMWA 1Z4OA 3QYAA 3OLYA 3WLFA 3LY9A 1JSZA 4WACA 1S1CA 4R51A 4X7PA 1ZIPA 5LQNA 2UVRA 1AUVA 3QX8A 1V11A 4KB5A 3MCVA 2IEIA 2GBLA 3I52A 1ODSA 3ZD8A 1U5CA 4TL6A 1T3NA 1PO7A 4RW0A 4M21A 2ABJA 5HKOA 2Q5CA 1O7JA 5YASA 2MCFA 2Q3MA 3URKA 5DT2A 4FOPA 2PFKA 5JASA 4C6SA 2OO5A 3KEQA 4JR1A 4QHSA 2GDJA 5ALLA 4HY3A 2J9GA 3THWA 4MVYA 2AC7A 4ZGWA 4HQ0A 2OXIA 4RJJA 4DLWA 5SV2A 2NNWB 2BBOA 3U09A 3T7KA 1Z2OX 1W2GA 1VLLA 4TL7A 4LBVA 4AW9A 1LX6A 1X39A 1YS9A 4IR1A 1WF6A 5J2UB 2GXUA 1NY6A 3JWEA 4F1KA 4DQVA 4XB6B 3MEQA 1UQTA 2LGJA 1YZNA 1JL3A 1XWFA 1KZ7B 3N0XA 2EERA 1VXOA 2LZ0A 3W7AA 5HE8A 4DDHA 2I4RA 1YU6A 4Y7CA 5FPYA 4X44A 1EK0A 1DBIA 2WHPB 1YA6A 1OYYA 1LQTA 3ZOZA 3AI2A 5FAXA 1ZH2A 3E3OA 4U0KA 3H65A 3IUPA 1ABEA 5K9ZA 4F1JA 4M1WA 4WNIA 2XCIA 1KF0A 1N32B 1EP9A 1KI6A 3R0IA 2WMDA 3U7HB 1IHUA 3F3KA 2QDKA 4ZHQF 4XZ3A 1XALA 5TQ0B 3MZ0A 4RL6A 2W6JD 1UCFA 4ACBA 5CU7A 4OMUA 3UPTA 4KSYA 2GEKA 1XTKA 3CPEA 1EUYA 3T1YH 2JGKA 4EVRA 5J63A 3F6SA 2CGEA 3V00A 2BCJQ 1D4ZA 3JSNA 1ZM9A 2Q8QA 1SC6A 4BBRG 3FPEA 2YICA 1BCSB 2ODAA 1YR8A 5CRIA 2Z30A 3BIWA 1Y1RA 4DM3A 3T99A 4HWGA 3GIJA 2IBTA 4ZFNA 4L0QA 4A0FA 1B6TA 2YRXA 3L8YA 4YRGA 1FXUA 4OLAA 4URXR 5I8ZA 3ASZA 4DL7A 1U0GA 1A4IA 2A94A 2VOBA 3HJGA 5J2TA 4C30A 4G3IA 3HE3A 3EN0A 2OKCA 4CUJA 1DBVO 4Q3OA 3FWNA 4FHEA 2YWRA 3NAQA 4FKZA 1ZONA 3EA4A 5BVHB 1WD7A 1VSVA 1XGKA 4CTKA 3DM9B 3MTIA 3HXTA 4PR0A 1Z0ZA 4GKJB 5JSKA 2IEYA 2PZGA 3U0GA 2Q8NA 4ZGBA 5KFQA 4KIWA 1M8KA 3I53A 4RVDA 3RR2A 2JKYA 1JR3E 2HMAA 4I7HA 3PC8C 1KJNA 2C4MA 3OKAA 4KO1S 3ZXUB 4O2LA 4A3SA 4FKMA 2Z3WA 3ANSA 1PG5A 4EJ6A 2RGNC 1T3LA 1HTBA 4AKTA 2JEYA 4XVUA 4QM6A 4Y2PA 2VUGA 5TE9A 4CF4A 1YTUA 1UBGA 2D0PB 1J0XO 4IDPA 4PPYA 1GQOA 4GX0A 4Q9NA 5TJ9A 4NH4A 3TSWA 2XYQA 5LOVB 5AICA 3GJ3A 2Q5IA 3CEPB