4O7TA

Saicar synthetase (type-2) in complex with adp, asp and tmp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
225
Chain Sequence
b'AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP, ASP and TMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 75
structure length 225
sequence length 225
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7tA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7tA02
1M0TA 3HO8A 4EH5A 5HHWA 5I5ZA 4HVGA 2BRNA 3F88A 2BAKA 3QRUA 3W8QA 4AT5A 2OLSA 3UNKA 2YW2A 1YWVA 4V05A 3HBLA 4TPTA 5JRSA 1CMKE 5DWRA 4AWIA 1I7LA 3C9WA 4NSTA 5GONF 4ANSA 4FUXA 2VZ6A 3PSCA 3PSDA 5HLNA 3N51A 2OXYA 2VV9A 4K8AA 5LVPA 4PDPA 5GNKA 1Z5MA 4ZZNA 3C4EA 5C4KA 4DG2E 4QMNA 5H2UA 2R3LA 2G2FA 1CS0A 3BEGA 5C01A 3G8CA 4USDA 5A6OA 3F82A 3LFNA 3KXHA 2BHEA 2RL5A 3CY3A 3BI6A 2WMWA 4RZVA 5BMVF 4ERKA 4PMSA 4TWOA 2VO0A 3VRYA 5CEIA 2A19B 3E93A 3OF0A 2I0YA 3HX4A 4X3JA 3LFFA 5JQ5A 1KE8A 2C3KA 2GTNA 3POOA 1ZYJA 2YM3A 1I09A 4LUDA 4PTGA 2W99B 5ETIA 4EHZA 1J1CA 4ORKA 1H1RA 3CLYA 3HUBA 5H8GA 4X7QA 3UPXA 4GUEA 2W5BA 4J8MA 1SMHA 4A4LA 4AZFA 3R1QA 4J98A 1W84A 5GIOE 3CTQA 3ORQA 1M52A 4FVPA 3ORLA 4PDSA 4S31A 2Y0AA 4RFYA 2X8DA 3PIYA 4BC6A 4DLKA 1YDTE 2OXXA 3OWLA 4YJ2F 3L8PA 2I8CA 5JVDF 3WF7A 4FSTA 1KE6A 5HD7A 4Z9LA 3QC9A 2BUJA 4U5JA 2Q0BA 4FVRA 5HTCA 1JQHA 4UEUA 3RM6A 2GFSA 3A7FA 3QHRA 4PNKA 4FFLA 4RPVA 4TW9A 4UWCA 4DFUA 3RALA 3AGMA 2WOTA 4XYLB 3CQUA 1M17A 5B0XA 1JDEA 4YJRA 1ZMWA 4TRLA 2W71A 2P3GX 3FSKA 4A4OA 3CKXA 4OGRA 5CSXA 4YLKA 3T9IA 2I6LA 2YERA 3N4VA 4J7BA 2FH9A 4RJ6A 4O7ZA 3LCTA 4GFGA 3RAWA 3TM0A 2FYSA 1OIYA 4DFYA 4QMMA 5IQCA 4EHEA 4EK5A 3CR0A 2ESMA 3R8LA 1REJA 4BDBA 5I9WA 5DE2A 1V1KA 5AUTA 4H1MA 4UX9A 3CE3A 3WO0A 4YC6A 5HNBA 4OTRA 4FTKA 3EHAA 1GGOA 3NUUA 1JKSA 1M2PA 4RLLA 4O7NA 2R7KA 3QQHA 2WQNA 5KBQA 3EWHA 2BZKB 3SA0A 1O6KA 3C0GA 5LXTF 2QR7A 4MX9A 5M4CA 4DFNA 1F5QA 2VTHA 1XH4A 3K3JA 4RIWB 3VHKA 4AN9A 4BBFA 4DINA 4HR7A 2B4SB 2PE0A 2QOHA 4I20A 5EG3A 3SOAA 2XYNA 4QP9A 3MVHA 3NSZA 4CKRA 5H9BA 3KXGA 4F0IA 3P9JA 2X2LA 1HCLA 3GU6A 4B99A 3H30A 3QWKA 2PMOX 1MRYA 2DWCA 1S9IA 4JIAA 4QYGA 1XH7A 3F5XA 4XOYA 3ZMMA 4A9TA 3FMDA 4YPDA 5HG5A 1CE8A 3CS9A 5JT2A 4C36A 4D2SA 5BMMA 1IEPA 4H3PA 4MEDA 2BDWA 2VTRA 3A8WA 1PMUA 4LGGA 1J91A 1KEEA 4RG0A 4WNOA 3MIAA 4PWNA 2BIYA 4F0GA 3DDPA 3HRBA 3P0MA 4K2RA 3FMLA 3DDQA 4KD1A 4OTWA 5IA2A 4JNWA 3L1SA 2QNJA 4RC4A 3VJNA 2YEXA 4IVAA 3DNEA 4RSSA 4IEBA 2R0UA 4BVUA 3PY3A 3BCEA 3S95A 4MWIA 1I7NA 4IM2A 2W1IA 5A4LA 3PIXA 3DBCA 4UWBA 4ZIMA 3V4ZA 2CCHA 3NMUF 3E63A 2I40A 3PPJA 4L42A 3E7VA 1GSOA 4EORA 2QLQA 3DJ6A 3QD3A 4JR3A 1O9UA 4EWQA 2V59A 4ASDA 3G8DA 3EYGA 4A7CA 1UWHA 4NCTC 3UDBA 2J0KA 4RC3A 2JFMA 3HDNA 3LFBA 4YMJA 3F6XA 3ZZEA 4AW1A 1WBWA 2ZDUA 2YIWA 3EQDA 4YBJA 5CSVA 2VWYA 4FIJA 2V5QA 4IM0A 4DBNA 2UVXA 2CGVA 2OBJA 1WBNA 3BWJA 3MVJA 3QUEA 4JG8A 4GL9A 2YZMA 5E8ZA 4JX3A 1DV2A 2BAQA 4YJTA 3LMGA 4DLIA 2IVTA 3DKGA 3HV7A 4FGRA 4CG8A 2RG6A 4PP9A 2R7MA 5IUIA 4ANMA 5JH6A 5KMNA 3GFEA 5KMKA 4APPA 4DEBA 5JZJA 4OBQA 2YZLA 5BUEA 4USEA 2YIYA 4FEUA 5DEWA 4D0XA 5L8KA 5IA4A 2XIKA 2OJ9A 3DZOA 5IQHA 3OZ6A 2Z04A 4DTAA 2NU6B 4RRVA 4J52A 3ALOA 4HYIA 3BEAA 5HCYA 3PTGA 3BGZA 3VO3A 3UBDA 2H96A 2P2IA 4BCPA 2J5EA 3PRFA 4BGGA 5J5SA 3Q4TA 2WQMA 3ORMA 3NR9A 4CFVA 2B54A 5FD2A 3NYNA 4FTJA 5J9ZA 3OMVA 3NAYA 3R1NA 2XK6A 4L44A 4C3RA 4W4WA 1T46A 2CKQA 3VS4A 3LFSA 2R87A 4M0YA 2QKRA 2VWIA 3MH0A 4WUAA 2JKMA 3PWDA 4FTAA 4QTCA 5HU3A 5JVLA 5ETCA 3D5XA 5FEDA 5AWMA 2OK1A 3UZPA 4AN2A 3Q2MA 4YTFA 2CKPA 2VUWA 3GVUA 1GIHA 2HW7A 2NU8B 1JWHA 2PVLA 5GJDA 4ZY5A 4EJ7A 1LEWA 3MB7A 4GG5A 2YYAA 3AC5A 4ME6A 3R2BA 2HGSA 2WMUA 2A27A 1ZY4A 2VTIA 3COKA 5EI2A 3ULZA 1JKJB 5BPHA 4XHKB 2YISA 5BMSA 3DFCB 5ANJA 3QQGA 4CFMA 4EOPA 1P14A 4BCJA 3VNTA 5J95A 2UUEA 4AZEA 3R0TA 3R7EA 4TYHA 3FC1X 5FP6A 4H3BA 3D5WA 3I5NA 4NK9A 3LZBA 3VF8A 4U9AA 5BUIA 3AG9A 3FHIA 1P4OA 3QYWA 5K9IA 3DBQA 4AF3A 3UQGA 4DEIA 2OG8A 2VTNA 3G0EA 4YNEA 1YXXA 4QPAA 3SG9A 4DH1A 1FINA 3HMPA 4I94A 2CKOA 2GHMA 2YJRA 1ULZA 3LCSA 4FNWA 4D9UA 4FEQA 3CQWA 5CU6A 2PZYA 3V5JA 4IB5A 4OTHA 4EH7A 3EZRA 5IA3A 3Q96A 2C5XA 4RIOA 5KKRB 5KX8A 5FM2A 3K5VA 5AEPA 4TZRA 2QU6A 2XF0A 2PULA 4N57A 2NP8A 1TQMA 3WF9A 3W2RA 3ODZX 3VUKA 1VBHA 5IPJA 1UU7A 5AX3A 1UKIA 4I55F 3I6UA 4V0GA 5HU9A 4DGMA 5K4JA 1JNKA 4FV5A 4JG6A 3OY1A 4FT9A 2X9FA 2XIYA 4JRVA 3E5NA 4FMQA 2DZDA 3VS5A 4JDHA 4NKSA 1C30A 4FKIA 3PP1A 5G1XA 3C4WA 5JGDA 2IPXA 4R5YA 4JAJA 5HBHA 2W05A 4XBUA 3GCVA 3H3CA 2HZ4A 3ZO1A 3HA8A 3FUPA 2YL2A 4QTAA 4F9CA 5E9EA 3R30A 1OKYA 1WVYA 3QTRA 5EHYA 1JOWB 3RMFA 3QCXA 4MNEA 5AM7A 4YAKB 5D8DA 3DGKA 3PRIA 3L9NA 4IDVA 3FYKX 4RMZA 3WZUA 4O7WA 2W9ZB 3DLZA 5HE3A 4ALWA 3Q9XA 1YXVA 2R3MA 4FL3A 4IB3A 4IWOA 2OLCA 3LJ2A 1SM2A 2WKMA 5KZIA 4O83A 4JQ7A 4Z55A 3SAYA 5CS6A 5BYLA 4KSQA 4R1VA 3M11A 4D1SA 4BF2A 3BE2A 4AOJA 3N6RA 1U59A 2BZIB 4FT5A 4L68A 2UZWE 3IW6A 2VTJA 4O7RA 3QCYA 4WIHA 3VBWA 4ASXA 4DAWA 3VVHA 4I3ZA 4IIJF 4FGBA 5FXRA 4I6FA 1ZAOA 4DTBA 2QONA 4KB8A 1GJOA 4U0IA 5CEPA 4IAFA 2XJ2A 4LOOA 3R2YA 1BX6A 3R7IA 4L6QA 5CT7A 5EM6A 3MY1A 4F1MA 4LI5A 3ZC5A 5JGBA 2X7GA 2HZ0A 4FV3A 1PF8A 4K11A 1PKDA 1A48A 4PUZA 1CKJA 5BVOA 3NNWA 2PZ5A 2J5FA 3H0ZA 3V5LA 2AYPA 2FPGB 3BZ3A 3VWAA 3KVXA 4YHTA 3W32A 4DBXA 3C13A 1P4FA 4FTMA 2C6EA 2Z7RA 2QO7A 4O0XA 4XLIA 4CRSA 4ENYA 3UTOA 4G2FA 2HYYA 4XEYA 2R3IA 4I4FA 3U9SA 4HZRA 4MYGA 4DEGA 5CI7A 3FZOA 3EN4A 4BN1A 3CBLA 4K18A 2J9MA 2OWBA 4O2PA 5C9CA 4ZY4A 3WARA 3LIJA 3P86A 4FNYA 2ITTA 3CPBA 2H34A 4QP3A 3ZSHA 4KIPA 4NW5A 4PNIA 1J7LA 1JVPP 3DT1A 3LMHA 4FV0A 5DI1A 1W83A 3GOPA 3UIXA 4QP1A 4ACMA 1Y6BA 2NU9B 3W18A 4XG8A 1H0VA 2GHGA 3OCGA 3VUDA 2F49A 4TWCA 3GXLA 4O96A 3A8XA 1YXTA 4GK4A 4WNMA 5CSPA 5GINE 4YLJA 3BYSA 4QQJA 4MF1A 4LGHA 3W33A 4EZ7A 2JDSA 5A6NA 3POZA 2OJJA 4BDFA 3SE7A 3DKOA 3HLLA 3EL8A 4C34A 2ZDHA 3NUXA 5DVRA 4FKLA 2O65A 1J7IA 4YJUA 3GB2A 1YQJA 3FZTA 1Q8YA 3NX8A 4PX6A 3QX2A 3CP9A 3M42A 2X39A 3JYAA 2GNJA 4O82A 4U44A 3FEGA 1CDKA 2R3RA 3KB7A 4Z3VA 1WVWA 2BDJA 3IGGA 5IMXA 1PK8A 2Z2WA 3KA0A 3A2CA 5ANEA 3FI8A 2FA2A 1BKXA 3G9NA 3CKWA 4BY9E 3EN5A 3VBYA 3R02A 3MESA 3MJ2A 1PMEA 4H05A 5M51A 4L3JA 1VYWA 1W8CA 3W2PA 2SCUB 1LEZA 4ZTQA 5F1ZA 3FHRA 4EOSA 2PBZA 1QPDA 3D5VA 4YU2A 4M67A 4F7SA 5D41A 3G33A 3HMIA 3QKLA 2ITWA 2YM5A 3TEIA 4F1TA 3GC7A 2ZJWA 2F2CB 2IZUA 1BUHA 3EQCA 2Z7LA 3SRVA 4EH3A 3BLRA 4QP8A 3LM5A 4D5KA 4U97A 4ZTSA 3BLQA 1NVRA 3HAMA 3DLSA 2PVNA 2W6QA 4CMOA 3OVVA 4QMSA 2J7TA 1BI7A 4L52A 4R3RA 2QURA 3N4TA 4ANLA 4EQMA 1B6RA 5LMBA 3AT3A 5FBOA 2FPPB 4ZSAA 4EEVA 2CPKE 3IS5A 4BCFA 4IANA 4FKWA 1W98A 3S0OA 3LHJA 1DI9A 3ATSA 2EB3A 4FOBA 5AP6A 3COMA 5FRIA 2PY3A 1QMZA 1OL1A 3FLQA 4FSRA 2IW8A 4D2RA 1XH5A 4GT5A 4RFZA 4RX7A 3EH9A 5IQDA 2RG5A 4EGJA 3MWUA 3CTJA 3DFAA 3AC3A 1XKKA 2YZAA 1OL5A 4D4RA 3V8SA 4CVAA 4NU1A 1G3NA 3ZS5A 3AMYA 3NW7A 3FLNC 1IA9A 3CD8A 5M4FA 3O8TA 5CAVA 4TYHB 3AT2A 5JK3A 3GC0A 5D7AA 4EH4A 5EYDA 2EU9A 4IZOA 1OIUA 1G8SA 1UU8A 4WBBB 3BU5A 4AGUA 4FTQA 5HX6A 3DPKA 4GT3A 4AFJA 3SQQA 3CJGA 3CQEA 5CAQA 2YZNA 3LWBA 3AC1A 3SV0A 3I7BA 4DEHA 3PXFA 3MTFA 3AMAA 4X2FA 4D5HA 2XH5A 2YZGA 2R86A 2V0DA 4QYEA 3FXWA 2I0VA 2X9EA 4EQCA 3RV3A 5CVFA 4IE9A 2BKKA 3BU6A 4MK0A 4NWMA 3ZDUA 3DKCA 4LFIA 3U87A 4CZUA 5CEOA 5IU2A 1Q3WA 5DHJA 3OOGA 2XNMA 4MXAA 4X3FC 4ZJJA 4F6UA 5HGIA 2EWAA 2IZRA 4X6RA 1V0PA 4IIRA 4D1ZA 1FPUA 5EFQA 2XA4A 3PSBA 4CSVA 4XP3A 2IZTA 2C5NA 2QOOA 3W2OA 1XHAA 4D9TA 4V0GB 4IFGA 5DMXA 3BV3A 5EH0A 3R04A 4ANBA 1YI6A 1Q97A 4MXCA 4E4MA 3K54A 4I21A 4JIKA 5EOLA 2FP4B 4IM3A 2R3PA 3PZHA 4C59A 3MW1A 5HORA 2QK4A 4XJ0A 3HGKA 5GHVA 3ZTXA 3ET7A 4ZTHA 4RGJA 2CSNA 4A9SA 4H1JA 2XM8A 4KIOA 4MWHA 3ZYAA 3COIA 4RJ3A 2VD5A 3KK8A 2DLNA 3HMMA 3FE3A 3F3VA 4C61A 3MYGA 4O0TA 2KULA 2W1CA 2YIQA 3F7ZA 3HB9A 1DAWA 4MNEB 4Q5HA 5B2MA 4FFNA 3JS2A 5AAEA 2C68A 5AAGA 3EFJA 4ZSJA 4P2KA 2EXCX 1WBTA 2XNPA 3BHHA 4U7ZA 3R21A 5J9LA 2O3PA 5EM5A 1MRUA 3ENMA 2WTIA 4EKLA 2ZV2A 4I6BA 2SRCA 2QODA 3LXNA 3LFQA 1YHSA 1ZYSA 4HGLA 4DA5A 4YAJB 3VOTA 3MBLA 3EN9A 4I5PA 3F5GA 5LQFA 1OGUA 4DGOA 2J6MA 3FI4A 5AUWA 2X2MA 3UIBA 3TUCA 1JSVA 4GH2A 4N0SA 3MJFA 5JGAA 2WNTA 3ANRA 4YZCA 1DM2A 4GEOA 4A4XA 1E1VA 2C3LA 3R8ZA 3CEKA 3TKUA 2YWPA 5G6VA 4TV8F 4WSYA 1GZ8A 2C69A 4QQ5A 1G5SA 1KE7A 1AGWA 1IOVA 3WILA 2P0AA 4FT3A 3HVCA 1YRPA 4CLJA 2C6KA 2PMIA 3ZEWA 4B0GA 4D28A 4DGLC 5I4NA 4QSHA 3T8OA 2GQRA 3DTCA 5E8XA 5FTGA 3HV3A 3LE6A 4BI0A 2Z8CA 3K3IA 2B1PA 3ORXA 1H1QA 4LV8A 2XIXA 2W4JA 4BIBA 4DG3E 2OH0E 3TNPC 2XKDA 4BDCA 2HCKA 5M53A 3PLAE 2CNUA 4WNPA 3E8CA 4C58A 3OUUA 3NW5A 3QA8A 2PZRA 4DHFA 1Q62A 2AUHA 4M0ZA 3ETJA 4PTCA 3F61A 1HOWA 5GJFA 1V0BA 2B9JA 3D83A 4OBOA 4JS8A 3W55A 4HVHA 5DN3A 2J0MB 4Q9SA 2QF7A 2WTKB 1WCCA 2PVMA 5C8YF 4EZ5A 1I44A 4RVKA 3RKBA 3JUHA 3OUZA 4IHJF 4OTGA 3PG3A 3D2KA 1TQPA 2Y4PA 4RWJA 4S34A 3DXPA 5CQUA 4D1XA 3DK3A 4L3LA 2QVSE 4J96A 4D58A 3FY0A 4L7SA 4PDOA 1OZ1A 3NRMA 3Q04A 2EUFB 3DZQA 4MH7A 3KF4A 1R1WA 4QP2A 4YZBA 5F20A 1F3MC 3UGCA 4FL1A 4YZMA 4FKPA 1PYEA 4JDJA 5IQIA 3WYXA 3E64A 2YAAA 3LXPA 3LKMA 5AUVA 2RIOA 1E4EA 1WVXA 5E1EA 2W70A 3W2QA 3U9CA 4R78A 1R39A 4EL9A 3RFCA 3F2RA 3OCTA 4FODA 3C50A 4KS8A 4FZFB 3ZHPC 1FVVA 3KFAA 2OKRA 1APME 3C7QA 2IVVA 2VTLA 2Z7QA 4R7HA 3FZ1A 5BPYA 5CI6A 5CYIA 2F7ZE 3SDJA 3U9NA 2WO6A 2VO7A 4BCQA 2JITA 2WOUA 3PJ3A 1BLXA 5HD4A 2WFYA 4M12A 1ND4A 3IDBA 5C1QB 4WKQA 3LQ5A 3WOWA 2G2HA 2W1DA 3ZONA 2CN8A 3DAEA 4C35A 3FZRA 4OLIA 4DT9A 1ZMVA 2JIIA 4KBKA 1Y8GA 2OIBA 1U5QA 3PPKA 4M15A 1KBLA 4IB1A 5IQEA 3SRVB 1PY5A 4FVQA 2BFXA 2GNLA 3FZSA 3ROYA 5HEZA 2FUMA 4W8EA 1OUKA 4KRDA 3I81A 4DFZE 4I41A 2QKWB 3PY0A 2WAJA 4MXYA 5AMNA 2VR1A 5E4HA 3JZFA 3IW5A 4DEEA 2OZAA 5A4EA 3F5PA 3KCKA 4HYSA 4Y72A 2UW3A 2R7NA 1OM1A 4JQEA 4FSYA 4NCTA 4TN6A 4C2WA 1RQQA 2H6DA 1URWA 5LOHA 4I4EA 3BRBA 2WGJA 3KAKA 3RJCA 5J1VA 3TKIA 5EHLA 4UALA 5T68A 3C51A 2YJSA 1PJKA 1SVHA 4NIFB 2F7XE 4S33A 4AT4A 1LPUA 5IH4A 4IAYA 5IUGA 4FICA 3MWEA 5IQBA 4XNEA 4XYMB 5BVKA 4KKEA 5JZNA 3VN9A 3DB8A 4M14A 4XG2A 2WXVA 3FMMA 4QMXA 4YO6A 4BI2A 2AC3A 3LQ8A 4FKSA 4YJQA 3DK7A 4A9RA 2ZB0A 2WTCA 2F7EE 4O86A 2YDKA 2C1AA 4EHVA 5A14A 5CX9A 2WU6A 5AP2A 4QT1A 1YDSE 2QOQA 5F4NA 3W8LA 2J0JA 3QQLA 4CCBA 3MPAA 5AV3A 3DQXA 3Q32A 2GPHA 4JVGA 4RQVA 2R7LA 4ID7A 2C3IB 2ETRA 2XKFA 2O5KA 5A4CA 2XJ1A 4FTUA 5EHOA 4MD7E 5BYZA 5L6PA 4HNIA 3ZEPA 2C3JA 2W6NA 3UFXB 2EB2A 1PXPA 1SVEA 2VN9A 4N6ZA 4BCIA 3F9NA 3OEFX 5IA1A 3IPHA 4ANQA 3D7TA 3EFWA 4FTOA 2C0IA 4TY1A 5HNGA 3BQCA 3DAKA 5JKGA 2XK4A 2VWUA 3NIZA 3R71A 3PG1A 3MGYA 1S9JA 1PMNA 3NW6A 3OT3A 4I0TA 4E5BA 1Q8ZA 3CGFA 4GU9A 1GAGA 3JVSA 4XG6A 4NYEA 4IMYA 3QTQA 3O2MA 2RGPA 5CQWA 4GCJA 4C4HA 3EQRA 3DJ7A 1BL6A 2WIHA 1A06A 5FG8A 2P2HA 4AZSA 2R3OA 3NCZA 1C3OA 4KWPA 4B8MA 4F63A 2IVSA 3QTWA 3SC1A 1Y57A 4FTLA 4LL0A 4EK8A 3UIUA 4WOVA 5CLPA 2DWBA 4EHGA 5KHXA 3HDMA 2ERZE 3QYZA 4Y83A 2O2UA 2ZOQA 3NZ0A 3E87A 4U41A 4BBEA 3QKKA 4F64A 4ZOGA 4DFBA 4I5HA 2WQEA 4XBRA 1KJIA 3ZLWA 3MI9A 3GEQA 4Y8DA 4QO9A 3ZFMA 4L53A 4R1YA 3O7LB 4I5CA 1K3AA 4MV4A 2C47A 4O2AF 3R1SA 4E4LA 1SVGA 4HYHA 4L67A 3R7VA 1M7QA 3BBWA 4GRBA 2E9VA 2A4LA 1UVRA 3HNGA 4I4TF 4LOQA 3F2AA 2J0LA 5CA1F 5HG9A 4BDKA 4E6DA 3S3IA 2X8EA 1KJ8A 2YCFA 3PA3A 3Q4UA 4EONA 4BDIA 2FB9A 4C33A 4W4XA 5HVKA 1X8BA 3KU2A 3TIGA 5CF6A 5CSHA 5C1PA 3WE8A 5M4IA 2WD1A 5HESA 4AN3A 5ETFA 3JPVA 3NUNA 4RX8A 4WT6A 3OP5A 2PPQA 5FBNC 3R8MA 2PVPA 3HL7A 4E4XA 2XKEA 2XYUA 2HXQA 4CCUA 2ITOA 4E6AA 4CNHA 2XK9A 4C7TA 4NFMA 5JN2A 3KREA 3KXZA 3O0GA 4IZ5A 1CKIA 2VQDA 3UMWA 5CALA 5BUJA 3MVLA 3O51A 4ZS0A 4NH1A 3AD4A 2OW3A 4IX5A 5LWMA 5DT0A 2BCJA 3VUMA 2UZTA 4GVJA 3KY2A 2CLXA 2JIUA 3LFDA 3Q4CA 4JT3A 3UVPA 4EUTA 2PN1A 4IBMA 3G6GA 4Y73A 1W7HA 5HIDA 3VBQA 2GNHA 5C8KA 1JDBB 2ZM3A 3KN5A 1ZARA 1T45A 3I0OA 3RWPA 2H8HA 3VS3A 2Z02A 5L6OA 1FVRA 3TTJA 3MN3A 4KSPA 1YW2A 3O71A 2VNYA 2QC6A 4RWLA 3TCPA 2DIKA 1R78A 2YWVA 3GI3A 4Y5HA 1ZLTA 3FKLA 1WFCA 3TZ7A 3MY0A 4ZTLA 4QQTA 4RVLA 2ZM1A 4GV1A 1FOTA 2B7AA 3C5IA 3AOXA 3U51A 3ENHA 4IX3A 1M7NA 2PUPA 4GK2A 3RHKA 2R3JA 2OIQA 3UIMA 2BRHA 4WHZA 2R3QA 4AUAA 3G0FA 2XUUA 4WO5A 5BVWA 4C02A 4Y8VB 2Y6OA 2YN8A 2XRWA 3A61A 3DCVA 3GC9A 4U3YA 4XRLA 4E4NA 5JFXA 3JRWA 1KOBA 3KMUA 4S30A 5HLPA 4BI1A 1QPJA 1DAYA 4L46A 2YM6A 4PMPA 2FSMX 2ITYA 3N9XA 4WA9A 2OJIA 2G01A 3JVRA 3RAKA 3ORNA 5HX8A 1GLVA 4EYMA 5CAEB 1YOJA 2XP2A 3VPBA 4BTJA 2XB7A 4EH2A 2IP4A 3QUPA 4XP0A 5FEQA 5KNJA 4AACA 3NUAA 2NNWB 3ALNA 4BHZA 5HIEA 2WMRA 4RA4A 4IAIA 4L01A 4JBQA 1E4EB 3GQIA 3U4WA 2FSLX 2W6PA 3QRKA 3C1XA 2JDTA 4O0WA 2UW0A 5CU0A 2W4KA 2QCSA 3MDYA 3Q52A 5LVLA 3VJOA 5HQ0A 4MCVA 3H10A 3JY0A 4FBXA 5CEKA 4IHPA 1YXSA 3ZH8A 1JKKA 4I93A 4E6QA 4C4EA 5K5XA 4O38A 3FZPA 1NA7A 2PUIA 4QTDA 3KRXA 4A07A 2I80A 5IQGA 3Q5IA 2G2IA 4Y46A 2X8IA 4KBAA 4FIHA 3C4CA 3LCOA 3TNHA 4A9UA 4D4YA 5A54A 2YS6A 4FV1A 2QOLA 2QOIA 4C3FA 3NUSA 4EQUA 2HOGA 4RWIA 4ASZA 3BQRA 4JQ8A 4F7JA 4BIDA 3ZFYA 3R23A 3TINA 4JDIA 3Q4ZA 2IW6A 4FIEA 4G17A 3VUIA 4CRLA 5FGKA 4LRMA 3TJCA 3V51A 2WTVA 3QFFA 1NVQA 2HELA 4G34A 5EI6A 3MWDA 4XV1A 1VZOA 2GQGA 2VTAA 3KVWA 3L9PA 4FG9A 5KO1A 4IJPA 4IVDA 3PE2A 5CEQA 4G6NA 3NIEA 4UZHA 3WF5A 3A7JA 4PL5A 5AX9A 4AA0A 3O8UA 1Q8WA 3W16A 2OZAB 3D15A 3SX9A 2YDIA 4I92A 4NM5A 3CXWA 4G3CA 4M84A 3MY5A 4BCMA 4GVAA 4OBPA 2E2BA 2JDRA 3R7YA 5CZHA 4BGHA 3I0QA 3QBNA 4DH8A 5EZYF 1VEBA 1H01A 3PZEA 3FXZA 1OB3A 3FBVA 3KRLA 2XCLA 2G1TA 4L00A 3HP2A 4XCUA 3R8PA 4ZTNA 3SXFA 4FA2A 5IH5A 2ZB1A 2GHLA 4YJOA 3GCPA 4AA5A 1QCFA 3KGAA 4DH5A 2OIDA 4Y85A 4FC0A 4BDJA 4YO4A 5IQAA 4HNTA 4KRCA 2PSQA 3BGQA 3DNDA 3LVPA 4EOKA 2PYWA 2YHVA 3AC4A 4FR4A 2GPSA 1RJBA 4LG4A 3NLBA 1Y8YA 2GU8A 4HGSA 3B2TA 5EM7A 3Q60A 4F9AA 3DV3A 3HP5A 3Q53A 5JMSA 3G15A 3HKOA 3IDCA 4FKVA 5H8EA 3UODA 4XX0B 2JLDA 4C3PA 1DIKA 4M9UA 4K77A 1U4DA 4OW8A 4TUYF 1Z2PX 4P90A 2F4JA 4RBLA 3KRJA 4PP7A 4RFMA 3FMJA 1XBBA 5E8UA 5C03A 3PP0A 1U54A 4CV8A 4I50F 1B38A 3GFWA 4ENXA 4G1WA 1ERKA 1O6LA 3V8WA 5AAFA 4G5PA 2V55A 5A9UA 1RE8A 4G3GA 5DRBA 5CENA 3WIKA 3VS2A 2XRUA 5LCKA 4DCAA 5IZFA 2XS0A 2IZSA 1PXNA 3D7TB 2PL0A 3OWJA 4IACA 4LRJA 3LP8A 5AUZA 3QD2B 5BNJA 4EH6A 3NGAA 1Q4LA 4H58A 4M3QA 4YJVA 4JX7A 1OVEA 1UWJA 3V5PA 1NW1A 3FJQE 3QLFA 4LL5A 2EVAA 4BDEA 3LFCA 4G5JA 3EZVA 2RKUA 3LLAA 4HOKA 2VGOA 4YSMA 3P78A 1UNHA 1GZNA 1OL6A 2X7OA 3AC2A 4LM5A 5DT3A 3EMGA 2HWOA 4CTBA 3PXZA 4MA0A 5HVYA 2RFSA 5KHWA 1FGKA 2IO6A 3QU0A 5D10A 4G6OA 4KINA 3V5QA 1YKRA 2JEDA 1BMKA 4FV9A 4RVTA 4YTHA 4EUUA 2XM9A 5H3QA 3U6HA 5D7VA 2UZLA 5B2KA 4LRKA 5HG7A 3PVGA 3UJGA 5I9ZA 2VTPA 3GCSA 4FZ7A 4OR5A 3FMHA 5LMKC 1FGIA 2UVZA 4M13A 2ZDTA 4RX5A 1YHVA 2ETKA 2YFXA 3MFRA 5AP3A 3K3PA 4ZMFA 3QUDA 2CNVA 4IWDA 4X2JA 5FXSA 4B9DA 5TO8A 2VX3A 1ZYDA 2RF9A 3NYOA 3QF9A 1WMKA 1JKLA 3TIYA 2PUUA 3ZXZA 2JBOA 5JSMA 1B6CB 3UG1A 4YUQA 3E62A 4YJPA 1XH9A 4PF4A 5FTOA 3ZM9A 5CF5A 3FI3A 4P7EA 3GU4A 2ONLA 3RM7A 2WEIA 2X4ZA 1ZXEA 3PXKA 2W1ZA 3QA0A 3ULIA 3EQHA 4LV5A 1OITA 3WNZA 1XBCA 3TUBA 3QTUA 4F65A 5CNOA 3FQHA 4JBOA 3B8QA 4CKJA 5M07A 4ZOLF 2C1BA 4GIIA 3LM0A 2UW9A 3V4SA 3FAAA 4UWYA 3KL8A 1WR2A 4II5A 1Q24A 4O22A 3HRCA 4YPSA 5KMOA 1J1BA 4G3EA 5JFVA 4K9YA 3L9LA 5EDQA 3E3BX 2HXLA 4O81A 3S4QA 5C1OA 4JBVA 4S2ZA 4IADA 4MD9E 4CFUA 2OO8X 4JG7A 4DFLA 4E4TA 2QOFA 1CM8A 3LOKA 5J8IA 3QALE 4KABA 4TXCA 3VPCA 3UOJA 4CFWA 3UOKA 4CG9A 4UB7A 3ZLSA 4F4PA 3ZU7A 2J0IA 3DA6A 5FM3A 4U45A 3RPSA 2OXDA 3IQ7A 2UW6A 4AE6A 3OWKA 3ZO3A 3TQTA 2F9GA 3BU3A 4JL9A 2OI4X 4XG4A 4C37A 1Z2OX 2DS1A 4IC7A 3VA7A 4AOIA 3QKMA 4ZSLA 3COHA 2WYOA 3U6IA 4CGAA 1STCE 4ARKA 2Y7JA 3JY9A 2CZGA 4W4VA 3PPZA 2NO3A 1XQZA 4WBOA 3FLZA 4X6QC 2YRXA 3II5A 2XZSA 1IAJA 4V04A 5CNNA 2VX1A 5HLWA 3LAUA 4ONAA 4GW8A 1NY3A 4F08A 2IN6A 5TKDA 3GENA 3D4QA 3ZZWA 3UC3A 5M09A 3FY2A 3F2NA 5LJJA 4IVCA 4MBLA 4F0FA 2R3HA 4BCOA 4X2GA 4BDDA 4O4IF 3UOHA 2JKKA 4WG4A 1R0EA 2XK8A 5JFWA 3WE4A 2X81A 1Y91A 2WTDA 3KQ7A 3FC2A 4RX9A 3Q2JA 3ERKA 4PRJA 4C4JA 4YJ3F 4O4LF 1PXJA 4KNBA 1QPEA 4EOJA 4K1BA 4U3ZA 1H24A 3R7OA 1A9XA 1H1SA 2BALA 3P23A 4B7TA 4QMZA 3BBTB 3MB6A 5IMEA 3U8WA 5DR6A 2CGXA 3C0IA 3QCSA 4MBJA 5KUPA 5FEEA 1H08A 1YDRE 2NRYA 4TT7A 3KAJA 3IW4A 2C6TA 3A62A 4TV9F 4O7TA 4CFXA 3R9NA 1Q8TA 2BKZA 4W4YA 2J4ZA 1DI8A 3ORIA 4NZWB 2Y6MA 3DBFA 4IC8A 3R01A 4OUCA 3MH1A 5EW3A 3TIZA 4BRXA 2CJMA 4CMUA 4HVIA 2XNEA 2XCHA 4R7IA 4QP6A 3E88A 4IX4A 4YZNA 5J9YA 1Z57A 4HZSA 5DH3A 4GKIA 5D9HA 3AT4A 4I24A 4ZMEA 5KBRA 1U46A 4FFRA 3AD6A 2J90A 5I9UA 2UZEA 3WF6A 3WZDA 4FKUA 2J9GA 2PVRA 3Q9WA 4AGDA 5HKMA 4QNYA 1WBPA 4YTCA 4QMQA 2E9NA 2XBJA 3JXWA 3GU5A 4R3CA 4E5AX 4Q2AA 2HZNA 5DYJA 3ZSGA 2R9SA 4MV1A 3F5UA 3ATTA 3CJFA 4GG7A 2LAVA 3S2PA 4ITJA 4CLIA 5DBXA 2XEZA 5DPVA 3RCJA 3QZFA 3BPRA 4IAZA 5AFVA 3ZXTA 3R9DA 2UVYA 2PVHA 5JRQA 1Q5KA 4C62A 5BYYA 3QL8A 3H9RA 4NUSA 3WZEA 2I1MA 4FYNA 1OPLA 4QMUA 5DG5A 4EOQA 3KULB 2XK3A 3R8VA 4E7WA 4EBWA 2JD5A 3I7CA 3D2IA 3DKFA 4XV3A 3OW4A 2F2UA 3CGOA 4JLCA 5KZ0A 5LARA 4CQEA 2PVJA 4L43A 2XK7A 5ACBC 2W5HA 4XH6A 3HZTA 3ZC6A 5CF8A 3RHXA 4IJ9A 3OY3A 4QMOA 3UZTA 4JXFA 4Y95A 4LYNA 1CQIB 2WQBA 1FBNA 5B2LA 4C2VA 5ANKA 4JJRA 4QRCA 4ZSGA 2B9HA 2Y4IB 3W10A 4G3DA 3Q5ZA 5HCZA 3R5HA 3H9FA 4AOTA 2R85A 4KBCA 1Q8UA 3EQFA 5BVDA 3DJ5A 3KXXA 3QCQA 4AE9A 4CZTA 3NVKI 4H3QA 5C8NA 5LYJF 5AUUA 4RC2A 3RCDA 5A4TA 5LWNA 4IFCA 3DY7A 3U55A 3ZOSA 1U54B 3VBTA 4C4GA 2VTOA 1GY3A 1UU3A 3CY2A 5T6KA 1QPCA 2QI8A 4TYEA 5EM8A 5J87A 3HV4A 3LQ3A 2HY0A 2W6ZA 2FO0A 1Q41A 1JLUE 3M1SA 4FKGA 4IWQA 1CQJB 4YSJA 4MBIA 5L8LA 4ITHA 2R82A 2OZOA 1R3CA 4QPSA 3Q6UA 3FI2A 4RIXA 4LUEA 3GT8A 1KE9A 3UQCA 3VW6A 3PDTA 1H00A 1ATPE 2BAJA 4O0UA 4RIYA 4XG9A 1EYZA 2OJGA 2XMYA 2EXMA 3PE1A 2LGCA 4IAAA 3HAVA 3OWPA 4EC9A 4TL0A 5AP4A 3UMXA 1IA8A 3HV5A 3NNUA 5H8BA 3FSFA 3WF8A 2UW5A 5CAUA 2C6OA 5IEVA 3C0HA 2R7IA 2UW4A 5M55A 2PZIA 5L2TA 4BZOA 4DC2A 4BR3A 3TNIA 3CPCA 4AP7A 3AGLA 3K5UA 4ZS4A 4CTCA 4O4JF 4FTRA 5TF9A 3KRWA 2J51A 3NS9A 1CSNA 2BVAA 4IWPA 4YNOA 5DEYA 1GZOA 3RINA 2B52A 2FPIB 3MFTA 1Q3DA 1YI4A 4NFNA 3I79A 1F0QA 4X21A 3L8XA 4C38A 1UA2A 2PUNA 3QZHA 2WZJA 2QD9A 3EOCA 2UZBA 4PDYA 2CHLA 4TWPA 4EJNA 4CMTA 4FI1A 4O6LA 2HK5A 2VWXA 4XV2A 5CAPA 4KS7A 4PL4A 2B55A 3I1AA 2JDOA 5AA9A 4BYIA 1YXUA 2QOCA 4MV8A 2WQOA 3RWQA 3N4UA 5CTPA 5HCXA 4EK3A 1P2AA 2XVDA 3MTLA 2ZMDA 5AJQA 4HPUE 5EK7A 3VS0A 3FMEA 5ANIA 4L9IA 2Z60A 2BTRA 3DQWA 3TKHA 4DLJA 3AMBA 5BX0A 3ACKA 2W1EA 4ACHA 3OUNB 1IG1A 3MJ1A 1YHWA 2J2IB 3I60A 3SXSA 1OPKA 3SVVA 3ROCA 4NW6A 4JAIA 1PMVA 4XS2A 3QTZA 4DG0E 3FXXA 5FDPA 2HY81 2W6MA 4FTIA 4PTEA 4EYJA 5BPFA 2WB8A 2WMBA 1REKA 4FG8A 5K4IA 4TKSA 4XLVA 2C6MA 4F6WA 4N70A 4FT0A 2E9PA 4FUYA 2BR1A 3SLSA 2C6DA 2WMAA 4OTIA 3MFUA 4F99A 2I87A 3DU8A 4U43A 4F7NA 2C5YA 4AXAA 2UW7A 3W1FA 3B8RA 2Q0NA 3I6WA 4Z7HA 2OSCA 5M57A 1JSTA 4R6VA 2CDZA 5LVNA 4ZTRA 3ID6C 3D94A 5CT0A 1PHKA 2O8YA 3RI1A 2C0OA 5CU2A 3GUBA 3MFSA 1IR3A 3LFAA 4I5MA 3GGFA 3UO6A 5LOVF 3Q1KA 3C5UA 4O0SA 4K33A 1VJYA 2BPMA 4JR7A 3EKNA 2ZV9A 4IZ7A 4FX3A 4ZZMA 5L2WA 5E1SA 2X6DA 1WAKA 4O4HF 3AC8A 3R9HA 3NPCA 5F94A 1B39A 4WG3A 1GZKA 1E9HA 4YJNA 4FU0A 5DR9A 1EUDB 5CEMA 3QTIA 4MQ2A 4V01A 2CGUA 3SKCA 5LVMA 4MNFA 4MAMA 3KALA 3U9TA 5CSWA 1XR1A 2O63A 2HWPA 3A7HA 4HYUA 4C4IA 4UBAA 3IOPA 5CVGA 5DGZA 5HV6A 4AG8A 5HG8A 1KJ9A 1PXOA 3MSSA 4ZY6A 1XWSA 3ORPA 5IEYA 5KCVA 3TDWA 2VWVA 4NT4A 5DOSA 2C00A 3R83A 2JIVA 3SW7A 2C30A 2C6LA 3ZSIA 4C4FA 3TXOA 2YAKA 3NAXA 2X2KA 4LMNA 2GS2A 3ZRMA 3G5DA 4J53A 2PZPA 3MIYA 1P5EA 3PXYA 4MTAA 1Y6AA 4AGWA 2B9FA 3QQUA 3DK6A 4FTCA 4EK6A 5IF1A 3EFLA 3F3ZA 4XZ3B 3RUPA 4OT6A 4MXZA 4FV8A 4BHNA 2BZJA 1W96A 5D1JA 5AUYA 4TYIA 3UQFA 3N8DA 4CXAA 3FWQA 5HNIX 3TZ8A 2R84A 5KX5F 3PWYA 3R73A 5DLSA 5EQPA 3O96A 5HBJA 1M2QA 5LA6F 2YM7A 4TNDA 5EKNA 1KV2A 1UU9A 5JQGF 5CF4A 1SYKA 4RJ4A 1KJJA 2PTKA 4XP2A 3D9VA 4YHFA 1VKZA 5M56A 1W93A 1OL7A 4DN5A 3KRRA 3MPTA 1GIIA 3OG7A 3EL7A 4PV0A 5E7RA 1OUYA 2QOKA 4F09A 1H4LA 3QXPA 4D4SA 3SW4A 3LLTA 5AP0A 1ZZ2A 3PJ8A 2IVUA 4C0TA 2QOBA 4FKTA 3G90X 3UOLA 1KC7A 3UZRA 5CB4F 2ZYBA 2AC5A 2FSTX 1H8FA 2W96B 3EN6A 4C5AA 4LMUA 2YCQA 4I6QA 2ZDQA 4C5CA 2QU5A 1ZOEA 3PLSA 2XKCA 4O21A 2VWWA 2VO6A 4GS6A 1A9UA 4FEXA 4X2KA 5AM6A 3T3VA 4R3PA 3FL5A 3IK3A 5HE1A 1DV1A 3EQGA 3TACA 4N6YA 5E8SA 5FLFA 4R5SA 2UZUE 4HNVA 2VTTA 2OJFE 4FIGA 4G6LA 4U6RA 3ZUUA 2YM8A 3F66A 2PVKA 4MXOA 3HMNA 2WIPA 1MP8A 1LR4A 4BICA 3BYVA 4DT8A 1PYXA 2V7AA 3WYYA 3BHUA 4FFMA 3ZLYA 2CCIA 2W7XA 2GMXA 3UO4A 1PXLA 5J1WA 5IA0A 3DAJA 4J1RA 3RVGA 4BTKA 3GP0A 2OFVA 5EW8A 1LP4A 1L3RE 1Z2NX 3QTSA 3EQPA 4G3FA 3RPRA 1TQIA 5FP5A 4AQCA 3D0EA 3KN6A 3QGYA 4WUNA 4UY9A 4D55A 3QTXA 4YB8B 4O7YA 1FMKA 4H39A 3DXQA 4BIEA 2C6IA 3R63A 4QYFA 4RZWA 4UYNA 3RAHA 5CASA 4JDKA 2UZNA 3IW7A 2WELA 3D5UA 4GIHA 3C4FA 3MPMA 4FV2A 4FK6A 5EYKA 4NKAA 4QYHA 4ACDA 2QQ7A 3DBDA 3F3WA 4BCNA 4O6EA 1W0XC 2GNGA 4RIXB 3PJ1A 3R1YA 5K3YA 3BHTA 4M8TA 3ANQA 3NYXA 4L3PA 2GLTA 5KMJA 3EYHA 2PE2A 4RIYB 5DRDA 2WTWA 4AW0A 2PK9A 1OKVA 4IDTA 4O0VA 4EGQA 2HJWA 2PMLX 4XUFA 4YC3A 3VUGA 1M2RA 2A0CX 4ZHQF 3BHVA 3R00A 5IA5A 2XNGA 5CU4A 2NRUA 3V8TA 4QP7A 3HECA 3F69A 2JAVA 3GOKA 5EYMA 2ACXA 3P7BA 5BVEA 4E93A 5L3AA 3R5XA 3VW8A 1AUVA 1AQ1A 1K9AA 4ZP5A 4ZLZA 4CD0A 4ZQIA 2YABA 4QYYA 4FKJA 2GS7A 3QD0A 3E8NA 3UNJA 4U8ZA 1WBVA 3MS9A 3G6HA 3TNWA 4A9YA 2R2PA 5FUTA 1DS5A 1ZRZA 4IH8A 4E20A 2G15A 4FT7A 5T3QA 5BVFA 3FKOA 4FV7A 3UPZA 3NUPA 1YI3A 3BX5A 5FXQA 1H25A 3VQHA 3ZUTA 4EC8A 3KCFA 5EYCA 4IAKA 3PA5A 2X4FA 2X6EA 5CANA 4UYAA 5C4LA 2CN5A 1PX2A 3WBLA 1H27A 3ODYX 4ITIA 4DEDA 4E8AA 3MV5A 4HNUA 5I0BA 3FPQA 2YIXA 2ETMA 4RA5A 4X0MA 1KUTA 1ZWSA 3R9OA 2JKQA 4NM7A 1J7UA 1RDQE 3FLYA 3I12A 4FEWA 3LFEA 2QR8A 3V01A 1IRKA 3OBGA 4XRJA 4RWKA 1ZZLA 4UXLA 2IJMA 2JBPA 2UV2A 4G9RA 4HCTA 4I0SA 5IUHA 3AXWA 3DF7A 2ITPA 4FE2A 1RW8A 3QQJA 2GPWA 3REPA 2CMWA 4HNFA 4Q5EA 4BZDA 2W17A 4LQMA 4HPTE 4M7IA 2P4IA 4G9CA 5FDXA 2X0SA 3GIDA 3UVRA 2WU7A 4RT7A 5GJGA 3RP9A 5AV4A 5E8VA 3KEXA 4BCGA 5LMKA 5KKRC 4TNBA 3NEWA 5CAOA 5CWZA 2W06A 2GCDA 4YP8A 3GNIB 4PMMA 3U6JA 1IAHA 1H1WA 2PVFA 5BQ0A 4R7BA 5L2SA 4RLKA 4ZTMA 4UZDA 3OS3A 1PXIA 1OKWA 4JBPA 3VS7A 5AP5A 4QMPA 1O6YA 3ZFXA 3EN7A 3EB0A 3NWWA 4OTQA 4U80A 4DF3A 4TYGA 4WRSA 3Q2OA 2WMSA 4U42A 3W2CA 3A4OX 3PVWA 2WPAA 4O7VA 3GC8A 1WZYA 3I4BA 4H36A 2W5AA 4WRGA 4KAOA 3RGFA 3RPVA 4AU8A 2E9OA 5EQYA 3TZ9A 4EH9A 4EK4A 4HW7A 2NPQA 1XBAA 4DH3A 3H9OA 2IWIA 4GT4A 3HUCA 3FQEA 5CZIA 3OW3A 4J8NA 4FKQA 4XG3A 3BHYA 4NM3A 3TT0A 4ZJIA 3UNZA 3FQSA 3NYVA 4FYOA 2ZDGA 5D12A 3Q6WA 4X2NA 5JFSA 4AZVA 3A7GA 4FKRA 4GK3A 4I6HA 3UP7A 5D11A 4USFA 4ALUA 3L8SA 3QZIA 3PXRA 3OUKA 3BLHA 1VYZA 4B4LA 3WI6A 3HMOA 5AADA 3DXNA 1YWRA 4AX8A 2VRXA 3VS6A 4BGQA 3TW6A 2NUAB 2VTQA 4FNZA 4ZSEA 4BDGA 3TIIA 3O23A 4AZTA 4DIMA 4ZK5A 2H9VA 4GJ2A 1SZMA 3V6RA 3GQLA 4L45A 4QMYA 2WHBA 3S1HA 1FVTA 1XJDA 3KULA 4J97A 5HBRB 5LCJA 5EQEA 5J2TF 1H28A 3VQUA 4FFPA 4FSUA 2DYLA 2I7QA 4M97A 3HYHA 3OT8A 3T9TA 3VC4A 3E5AA 4O2ZA 5EW9A 3VHEA 3F7WA 2PWLA 4FV4A 1SCUB 3WO1A 1BNCA 3LJ1A 4TTHB 4NTTA 5DFPA 3O17A 1M14A 2OF2A 5EDPA 5C8MA 5ANGA 4FSZA 3PA4A 4MXXA 3U54A 5IDNA 3LCKA 4YBZB 3PIZA 3P7AA 4BDAA 4AGCA 3E92A 3PYYA 4FKOA 1FQ1B 2B0QA 4ZZOA 3SD0A 4GMYA 3VUHA 2YM4A 2YCRA 4PMTA 2VO3A 2VPQA 5H80A 3R22A 4KKHA 2QO2A 1SNUA 5KMLA 2ZV7A 1G8AA 3R5FA 3TTIA 2J50A 2P33A 3QQKA 5KE0A 2BRMA 3JR1A 5J7HA 3TZMA 3OBJA 4BKJA 3CIKA 3R28A 3VBXA 3GCQA 5AV2A 4S32A 5TOZA 4YHJA 2VU3A 4G31A 1UNLA 1PRYA 1BYGA 2JFLA 2ITVA 2JKOA 2V62A 3F3TA 5KKNB 3JZIA 4CT1A 2CKEA 1GNGA 3MA6A 3PVBA 3Q3BA 2W1FA 3IECA 2R7BA 1ZYCA 5M4UA 3TV6A 4GU6A 3I5ZA 2UZDA 5AP7A 5F95A 3TWJA 3FLSA 3TN8A 4I1ZA 2PU8A 2GNIA 1VR2A 5J2UF 5ITAA 2C0TA 2WMVA 3R7UA 3ZDIA 2YCSA 2Y8OA 5EDRA 5AV0A 3R9RA 1UNGA 3HA6A 3F3UA 5F9EA 3EIDA 5I9YA 5JH7F 1R0PA 2UZVA 4GYIA 2OGVA 4IZYA 3PJCA 2XNNA 3QQFA 4RJ8A 4XX9A 5HICA 4EWHA 2R4BA 2XJ0A 4GUBA 3QX4A 4LOPA 5HVJA 4NJ3A 3NVMB 4MA5A 1YOLA 3OTUA 2R3GA 2BRGA 3QXOA 5TR6A 1OECA 2ITUA 4O0YA 3V5WA 3E7OA 3ORRA 3RK7A 1VBGA 3BELA 5IG1A 4BYJA 4F9YA 3OC1A 2P55A 4FIFA 2CLQA 5IEXA 3NNVA 4GFMA 2R64A 3MA3A 4WD5A 2HIWA 4DGGA 5DA3A 1PW2A 2XEYA 5E8TA 5L6WL 3W2SA 3KK9A 4E73A 3A7IA 3HV6A 5FQDC 2YITA 2QG5A 2G9XA 3Q9YA 4FSMA 2WTJA 3RPYA 2VGPA 3CTHA 3L9MA 2JGZA 4IB0A 2DQ7X 4XG7A 4FEVA 3RV4A 4X3FA 3CC6A 2GQSA 2GS6A 4IQ6A 2VAGA 4L1KA 2JDVA 3L8VA 2P0CA 5CXZA 3A99A 4ZI7F 3KXNA 3LJ0A 5LVOA 1BXRA 4EZ3A 3AX6A 2PVYA 4XOZA 4KUJA 3BE9A 4XYFA 3A60A 3BYMA 5ANDA 1KWPA 2Z7SA 2RFEA 5DIAA 4DE4A 4MV9A 3GBZA 4YLLA 1EHIA 3VMMA 3AW8A 5LMAA 1PKGA 3O50A 4YURA 4A06A 5IISA 3EQIA 4AFEA 3KMMA 4ACGA 2RFDA 4J71A 4FL2A 3RZBA 3IDPA 2F57A 4FZ6A 5BVNA 1MQ4A 3O8PA 2I0HA 2GNFA 3JRXA 3OFMA 4BZNA 2BRBA 2JC6A 1UKHA 1H07A 3PY1A 2O64A 4FSNA 4HJOA 4P5ZA 3CSVA 3OCSA 3TV4A 3UP2A 4QTEA 2FSOX 2W0JA 2BZHB 3HRFA 4O7SA 1JPAA 3LXKA 4DITA 4FIIA 4KIQA 1GSAA 1K2PA 1YVJA 3K5IA 2QG7A 2CNQA 3UYTA 5CA0F 2BHHA 2VWZA 1KSWA 2ITQA 3ETAA 2QLUA 3NDMA 2IW9A 3ZRLA 4ACCA 5C27A 3IO7A 1IOWA 3DOGA 3TV7A 4CV9A 3IOKA 4FSQA 4QTBA 1JAMA 3SGCA 2PMNX 4Z16A 3C4ZA 3ITZA 5M08A 2KTYA 4FSWA 4RVMA 4HQ6A 1U5RA 5CXHA 2QHMA 4MHAA 4WNKA 1GOLA 4XMOA 3RK9A 4I22A 3KC3A 3EFKA 3VIDA 4E6CA 3K5HA 5AIKA 3FKNA 1T36A 2OU7A 1TVOA 3TG1A 3ORTA 1TKIA 1V0OA 4NJDA 3LW0A 3PJ2A 3TI1A 5HZNA 1CKPA 2ZAZA 3OROA 2VNWA 5AIRA 5L8JA 2UW8A 4N4SA 2Y4IC 1OBGA 3B2WA 5JQWA 5E8YA 4JOAA 4O7LA 3IGOA 4FZAB 3G51A 4YC8A 3ZM4A 2CGWA 3OXZA 4HGEA 3H0YA 3K2LA 3FYJX 3VS1A 1UV5A 3NUYA 4QMTA 4AS0A 5KMIA 1JLLB 1NVSA 3P7CA 3PUPA 4JRNA 4OTFA 1W82A 1AD5A 3EKKA 4QNAA 5HO8A 4ZAUA 5CVHA 4PQNA 3ZBXA 3FMNA 2E9UA 4EOOA 2V58A 3BYOA 4EG0A 4TWNA 3ZBFA 3QWJA 4YTIA 5IH6A 4K6ZA 5JEBA 3T3UA 4EI4A 3GU8A 4HGTA 1CTPE 1MUOA 3GCUA 3UG2A 1OIQA 4XV9A 4G16A 4C5BA 4GKHA 3TDVA 1KV1A 3FPMA 5LXMA 2VX0A 3V3VA 1Z9XA 5AP1A 4HCVA 2REIA 3EQBA 5HIBA 2W9FB 3ZCLA 4AW5A 5ETAA 3LPBA 3P5KA 3HEGA 5EI8A 4FFOA 3IW8A 2ZMCA 3QC4A 4B6LA 4IW0A 4F7LA 2HAKA 2R0IA 4MVFA 4F1OA 4GSBA 3QRTA 2OF4A 5CU3A 3SHEA 2X1NA 4PL3A 5IQFA 4DTKA 5K5NA 1YOMA 1OL2A 1JSUA 2WMTA 2YACA 3R8UA 4ZJVA 3QAME 4AW2A 3THBA 5FNVF 1NT2A 1B6SA 5I9VA 3C4XA 3RAIA 4CEGA 4F9BA 3RNIA 2R5TA 1WBOA 4J95A 2YIRA 4ASEA 4CFNA 3H4JA 4E26A 2OH4A 3KF7A 2DUVA 5AV1A 3QRIA 4RQKA 1KE5A 1LUFA 4DH7A 3IG7A 2BROA 2BILB 3VULA 4ALVA 5IDPA 3ZLXA 1E1XA 3ZRKA 2W1HA 4IVBA 5ANOA 4O27B 1KOAA 3VAPA 1JKTA 2A2AA 4F70A 3KXMA 2I0EA 3DBEA 1URCA 4MQ1A 4O2BF 2WMQA 3WZJA 4F9WA 5IYZF 4YGAA 1OI9A 4ZXTA 4E5WA 1EUCB 4WG5A 2ITXA 3UC4A 2Y9QA 3OOMA 4FK3A 3D14A 3KMWA 1ZOGA 3SOCA 4KKGA 4MAOA 2BIKB 3GU7A 1OKZA 2B9IA 2ONLC 2XNBA 4GFOA 4BCHA 5M44A 3OXIA 5HO7A 2YS7A 2QHNA 4YR8A 4FG7A 4U81A 2BMCA 2R3NA 3VBVA 4DYMA 4EH8A 2NU7B 4MD8E 4U79A 3SG8A 4W8DA 1EH4A 1H26A 4ZEGA 3G2FA 5HBEA 3UO5A 4YZDA 3O7LD 5AUXA 2GDOA 2WTKC 2ITZA 3BYUA 1HCKA 2XIZA 3QGWA 4YJSA 3WZKA 1M0WA 2X0GA 2X7FA 4K0YA 4QMWA 5HTBA 4NL0A 5DT4A 3QFVA 4UV0A 4P5QA 3QRJA 1H1PA 1JBPE 2FGIA 3LCDA 1H0WA 3EJ1A 3ELJA 3DTWA 5DNRA 5ACKA 3ZO4A 4Y5QA 3QHWA 4FOCA 4EBVA 5I9XA 4J99A 1AUXA 1OPJA 4ZLOA 4DFXE 4RIWA 3OHTA 4QMLA 5M06A 4EKKA 5A3XA 5KMMA 4EOMA 1WBSA 2W1GA 3MVMA 4U40A 4AZWA 3GLKA 3FDNA 1GIJA 5TT7A 5EOBA 1ZOHA 3P4KA 4AT3A 2A1AB 4BTFA 5A46A 1Q99A 5GIPE 2ZV8A 2OICA 1NXKA 1PXKA 4EOLA 3V6SA 4D4VA 1SNXA 1ZMUA 3ZUVA 4BB4A 3Q9ZA 2WMXA 4FV6A 3QD4A 2VTMA 4I0RA 3M2WA 3BGPA 3UVQA 4L7FA 2QO9A 1IASA 2YA9A 4IX6A 2WEVA 3PVUA 4ERWA 2W4OA 4M68A 5E92A 3E3PA 2HZIA 2V7OA 2R3FA 3BKBA 3AQVA 3OTVA 3A4PA 3CCNA 3V04A 2YDJA 3VF9A 2C4GA 4RJ5A 1GSHA 1M6VA 3RK5A 4APCA 4Q9ZA 2V5AA 5E90A 5HE0A 5ICPA 3WIGA 2GTMA 2GFCA 5B7VA 3QLGA 4HCUA 4FTNA 4MV6A 5DR2A 2HENA 3CD3A 3RTPA 4DCEA 4F6SA 3DB6A 3FMKA 1BI8A 2XIRA 3E8DA 5EKOA 3TL8A 4X3FB 2VWBA 4GJ3A 4M69B 4Z7GA 3IKAA 2V22A 4FTTA 3VRZA 3AD5A 4E1ZA 4GYGA 1QL6A 5E8WA 3S00A 3RPOA 2Q83A 1PXMA 1XH6A 4UN0C 2PHKA 4O91A 2YRWA 4AAAA 2C5OA 2O0UA 2OFUA 2W6OA 3KKVA 4MV7A 3OXTA 2ERKA 4IZAA 4ZLYA 3UYSA 3ETHA 4R77A 1OMWA 1XH8A 3OD6X 2XNOA 4P4CA 4HVSA 3BG5A 3ORKA 3P08A 1KJQA 4EOIA 4CFFA 4D0WA 1MRVA 1MQBA 1XO2B 4MKCA 5A4QA 3V5TA 4L8MA 5AA8A 2BFYA 4FNXA 3LXLA 4JI9A 4AA4A 4B8LA 3OEZA 3G9LX 5C26A 5HI2A 3E8EA 4UXQA 3SXRA 3D7ZA 4WBNF 1EZ1A 2FVDA 2PE1A 4BCKA 4DGNA 2BDFA 4O0RA 2B53A 3LMIA 3BWFA 3MH3A 4PY1A 4QMVA 3DS6A 4BTMA 3TNQB 4OT5A 2ZVAA 4BDHA 5E91A 2FB8A 3P79A 4OTDA 5JQ8A 2JAMA 1Q61A 2ITNA 2UZOA 4KA3A 1OIRA 2IG7A 4BBMA 4FZDB 3FL4A 4QQCA 3FV8A 2HW6A 1BL7A 3BV2A 4DEAA 3TJDA 3NCGA 4TYJA 1ZY5A 2ZM4A 3R6XA 1OBDA 3NNXA 4YZ9A 3ACJA 3FLWA 2XBAA 2BTSA 2VTSA 5CY3A 3PFQA 4CT2A 4HVDA 4I23A 4YBKA 3MH2A 2GSFA 4CKIA 5LP6F 1L8TA 1YWNA 4QP4A 5FTQA 3UE4A 4QOXA 4NM0A 4RJ7A 3TUDA 2XD4A 5HE2A 3BIZA 4MV3A 2C5VA 3U4UA 4NTSA 4O84A 3PXQA 3QZGA 3ORZA 2R3KA 2XCKA 5L2IA 1J3HA 3ZO2A 3P1AA 4RZQA 3OCBA 1FMOE 3IONA 2RFNA
chains in the Genus database with same CATH superfamily
1M0TA 3HO8A 4EH5A 5HHWA 5I5ZA 4HVGA 2BRNA 3F88A 4NZNA 2BAKA 3QRUA 3W8QA 4AT5A 2OLSA 3PFYA 3UNKA 2YW2A 1YWVA 4V05A 3HBLA 4TPTA 5JRSA 1CMKE 5DWRA 4AWIA 1I7LA 3C9WA 4NSTA 5GONF 4ANSA 4FUXA 2VZ6A 3PSCA 3PSDA 5HLNA 3N51A 2OXYA 2VV9A 4K8AA 5LVPA 4PDPA 1V9PA 5GNKA 1Z5MA 4ZZNA 3C4EA 5C4KA 4DG2E 4QMNA 5H2UA 2R3LA 2G2FA 1CS0A 3BEGA 5C01A 3G8CA 4USDA 5A6OA 3F82A 3LFNA 3KXHA 2BHEA 2RL5A 3CY3A 3BI6A 2WMWA 4RZVA 5BMVF 4ERKA 4PMSA 4TWOA 2VO0A 3VRYA 5CEIA 2A19B 4CE5A 3E93A 3OF0A 2I0YA 3HX4A 4X3JA 3LFFA 5JQ5A 1KE8A 2C3KA 2GTNA 3POOA 1ZYJA 2YM3A 1I09A 4LUDA 4PTGA 2W99B 5ETIA 4EHZA 1J1CA 4ORKA 1H1RA 3CLYA 3HUBA 5H8GA 4X7QA 3UPXA 4GUEA 2W5BA 4J8MA 1SMHA 4A4LA 4AZFA 3R1QA 4J98A 1W84A 5GIOE 3CTQA 3ORQA 1M52A 4FVPA 3ORLA 4PDSA 4S31A 4IWXA 2Y0AA 4RFYA 2X8DA 3PIYA 4BC6A 4DLKA 1YDTE 2OXXA 3OWLA 4YJ2F 2XANA 3L8PA 2I8CA 5JVDF 3WF7A 1ZAUA 4FSTA 1KE6A 5HD7A 4Z9LA 3QC9A 2BUJA 4U5JA 2Q0BA 4FVRA 5HTCA 1JQHA 4UEUA 3RM6A 2GFSA 3A7FA 3QHRA 4PNKA 4FFLA 4RPVA 4TW9A 4UWCA 4DFUA 3RALA 3AGMA 2WOTA 3W0RA 3CQUA 1M17A 5B0XA 1JDEA 4XYLB 4YJRA 1ZMWA 3W1BA 4TRLA 2W71A 2P3GX 3FSKA 4A4OA 3CKXA 4OGRA 5CSXA 4YLKA 3T9IA 2I6LA 2YERA 3N4VA 4J7BA 2FH9A 4RJ6A 4O7ZA 3LCTA 4GFGA 3RAWA 3TM0A 1ST4A 3W1GA 2FYSA 1OIYA 4DFYA 4QMMA 5IQCA 4EHEA 4EK5A 3CR0A 2ESMA 3R8LA 1REJA 4BDBA 4NZOA 5I9WA 5DE2A 1V1KA 5AUTA 4H1MA 4UX9A 3CE3A 3WO0A 4YC6A 5HNBA 4OTRA 4FTKA 4DHIB 3EHAA 1GGOA 3NUUA 1JKSA 1M2PA 3AKKA 4O7NA 4RLLA 2R7KA 3QQHA 2WQNA 5KBQA 4UCRA 3EWHA 5FPOA 2BZKB 3SA0A 1O6KA 3C0GA 5LXTF 2QR7A 4MX9A 5M4CA 4DFNA 1F5QA 2VTHA 1XH4A 3K3JA 4RIWB 3VHKA 4AN9A 4BBFA 4DINA 4HR7A 2B4SB 2PE0A 2QOHA 4I20A 5EG3A 3SOAA 2XYNA 4QP9A 3MVHA 3NSZA 4CKRA 5H9BA 3KXGA 4F0IA 3P9JA 2X2LA 1HCLA 3GU6A 4B99A 5DISC 3H30A 3QWKA 2PMOX 1MRYA 2DWCA 4CC6A 1S9IA 4JIAA 4QYGA 1XH7A 3F5XA 4XOYA 3ZMMA 4A9TA 3FMDA 4YPDA 5HG5A 4FJVA 1CE8A 3CS9A 5JT2A 4C36A 4D2SA 5BMMA 1IEPA 4H3PA 4MEDA 2BDWA 2VTRA 3A8WA 1PMUA 4LGGA 1J91A 1KEEA 4RG0A 4WNOA 4UUGA 3MIAA 4PWNA 2BIYA 4F0GA 3DDPA 3T7AA 3HRBA 3P0MA 4K2RA 3FMLA 3DDQA 4KD1A 4OTWA 5IA2A 5I5YA 4JNWA 3L1SA 2QNJA 4RC4A 3VJNA 2YEXA 4IVAA 3DNEA 4RSSA 4IEBA 2R0UA 4BVUA 3PY3A 3BCEA 3S95A 4MWIA 3PUFC 4IM2A 1I7NA 2W1IA 5A4LA 3PIXA 3DBCA 4UWBA 4ZIMA 3V4ZA 2CCHA 3NMUF 3E63A 2I40A 3PPJA 4L42A 3E7VA 1GSOA 4EORA 2QLQA 3DJ6A 3QD3A 4JR3A 1O9UA 4EWQA 2V59A 4ASDA 3G8DA 3EYGA 4A7CA 1UWHA 4NCTC 3UDBA 3TEKA 2J0KA 5D1OA 4RC3A 2JFMA 3HDNA 3LFBA 1XMMA 3W0NA 3F6XA 3ZZEA 4AW1A 4YMJA 1WBWA 2ZDUA 2YIWA 3EQDA 4YBJA 5CSVA 2VWYA 4FIJA 2V5QA 4IM0A 4DBNA 2UVXA 2CGVA 2OBJA 1WBNA 3BWJA 3MVJA 3QUEA 4JG8A 4GL9A 2YZMA 5E8ZA 4JX3A 1DV2A 2BAQA 4YJTA 3LMGA 4DLIA 2IVTA 3DKGA 3HV7A 4FGRA 4CG8A 2RG6A 4PP9A 2R7MA 5IUIA 4ANMA 5JH6A 5KMNA 3GFEA 5KMKA 4APPA 4DEBA 5JZJA 3W5OA 4OBQA 2YZLA 5BUEA 4USEA 2YIYA 4FEUA 5DEWA 4D0XA 5L8KA 5IA4A 2XIKA 2OJ9A 3DZOA 5IQHA 3OZ6A 2Z04A 4DTAA 2NU6B 4RRVA 4J52A 3ALOA 4HYIA 3BEAA 5HCYA 3PTGA 3BGZA 3VO3A 3UBDA 2H96A 4IWYA 2P2IA 4BCPA 2J5EA 3PRFA 4BGGA 5J5SA 3Q4TA 2WQMA 3ORMA 3NR9A 4CFVA 2B54A 5FD2A 3NYNA 4FTJA 5J9ZA 3OMVA 3NAYA 3R1NA 2XK6A 4L44A 4C3RA 4W4WA 1T46A 2CKQA 3VS4A 3LFSA 2R87A 4M0YA 2QKRA 2VWIA 3MH0A 4WUAA 2JKMA 3PWDA 4FTAA 4QTCA 5HU3A 5JVLA 5ETCA 3D5XA 5FEDA 5AWMA 2OK1A 3UZPA 4AN2A 3Q2MA 4YTFA 4UCOA 2CKPA 2VUWA 3GVUA 1GIHA 2HW7A 2NU8B 1JWHA 2PVLA 5GJDA 4ZY5A 4EJ7A 1LEWA 3MB7A 4GG5A 2YYAA 3AC5A 4ME6A 3R2BA 1EKVA 2HGSA 2WMUA 2A27A 1ZY4A 2VTIA 3COKA 5EI2A 3ULZA 1JKJB 5BPHA 4XHKB 2YISA 5BMSA 3DFCB 5ANJA 3QQGA 4CFMA 4EOPA 1P14A 4BCJA 3VNTA 5J95A 2UUEA 4AZEA 3R0TA 3R7EA 4TYHA 3FC1X 5FP6A 4H3BA 3D5WA 3I5NA 4NK9A 3LZBA 3VF8A 4U9AA 5BUIA 3AG9A 3FHIA 1P4OA 3QYWA 5K9IA 3DBQA 4AF3A 3UQGA 4DEIA 2OG8A 2VTNA 3G0EA 4YNEA 1YXXA 4QPAA 3SG9A 4DH1A 1FINA 3HMPA 4I94A 2CKOA 2GHMA 2YJRA 1ULZA 3LCSA 4FNWA 4D9UA 2Y4RA 4FEQA 3CQWA 1X9NA 5CU6A 2PZYA 3V5JA 4IB5A 4OTHA 4EH7A 3EZRA 5IA3A 3Q96A 2C5XA 4RIOA 5KKRB 5KX8A 5FM2A 3K5VA 5AEPA 4TZRA 2QU6A 2XF0A 2PULA 4N57A 2NP8A 1TQMA 3WF9A 2COJA 3W2RA 3ODZX 3VUKA 1VBHA 5IPJA 1UU7A 5AX3A 1UKIA 4I55F 3I6UA 4V0GA 5HU9A 4DGMA 5K4JA 4NZMA 1JNKA 4FV5A 4JG6A 3OY1A 4FT9A 2X9FA 2XIYA 4JRVA 3E5NA 4FMQA 2DZDA 3VS5A 4JDHA 4NKSA 1C30A 4TM5A 4FKIA 3PP1A 5G1XA 3C4WA 5JGDA 2IPXA 4R5YA 3BACA 4JAJA 5HBHA 2W05A 4XBUA 3GCVA 3H3CA 2HZ4A 3ZO1A 3HA8A 3FUPA 2YL2A 4QTAA 4F9CA 5E9EA 3R30A 1OKYA 1WVYA 3QTRA 5EHYA 1JOWB 3RMFA 3QCXA 4MNEA 5AM7A 4YAKB 5D8DA 3DGKA 3PRIA 3L9NA 4IDVA 3FYKX 4RMZA 3WZUA 4O7WA 2W9ZB 3DLZA 5HE3A 4ALWA 3RR5A 3Q9XA 1YXVA 2R3MA 4FL3A 4IB3A 4IWOA 2OLCA 3LJ2A 1SM2A 2WKMA 5KZIA 4O83A 4JQ7A 4Z55A 3SAYA 5CS6A 5BYLA 4KSQA 4R1VA 3M11A 4D1SA 4BF2A 3BE2A 4AOJA 4DHJA 1U59A 2BZIB 4FT5A 4L68A 2UZWE 3IW6A 2VTJA 4O7RA 3QCYA 4WIHA 3VBWA 4ASXA 4DAWA 3VVHA 4I3ZA 3W0SA 4IIJF 4FGBA 5FXRA 4I6FA 1ZAOA 4DTBA 3NFFB 2QONA 4KB8A 1GJOA 4U0IA 5CEPA 4IAFA 2XJ2A 4LOOA 3R2YA 1BX6A 3R7IA 4L6QA 5CT7A 5EM6A 3MY1A 4F1MA 4LI5A 3ZC5A 5JGBA 2X7GA 1FVIA 2HZ0A 4FV3A 1PF8A 4K11A 1PKDA 1A48A 4PUZA 1CKJA 5BVOA 3NNWA 2PZ5A 2J5FA 3H0ZA 3V5LA 2AYPA 2FPGB 3BZ3A 3VWAA 3KVXA 4YHTA 3W32A 4DBXA 3C13A 1P4FA 4FTMA 2C6EA 2Z7RA 2QO7A 4O0XA 4XLIA 4CRSA 4CRLA 4ENYA 3UTOA 4G2FA 2HYYA 4XEYA 2R3IA 4I4FA 3U9SA 4HZRA 4MYGA 4DEGA 5CI7A 3FZOA 3EN4A 4BN1A 3CBLA 4K18A 2J9MA 2OWBA 4O2PA 5C9CA 4ZY4A 1VS0A 3WARA 3LIJA 3P86A 4FNYA 2ITTA 3CPBA 2H34A 4QP3A 3ZSHA 4KIPA 4NW5A 4PNIA 1J7LA 1JVPP 3DT1A 3LMHA 4FV0A 5DI1A 2AEGA 1W83A 3GOPA 3UIXA 4QP1A 4ACMA 1Y6BA 1A0GA 3W18A 2CFMA 2NU9B 4XG8A 1H0VA 2GHGA 3OCGA 5DGHA 3VUDA 2F49A 4TWCA 3GXLA 4O96A 3A8XA 1YXTA 4GK4A 4WNMA 5CSPA 5GINE 4YLJA 3BYSA 4QQJA 4MF1A 4LGHA 3W33A 4EZ7A 2JDSA 5A6NA 3POZA 2OJJA 4BDFA 3SE7A 3DKOA 1A0IA 3HLLA 3EL8A 4C34A 2ZDHA 3NUXA 3T9EA 5DVRA 5D1OB 4FKLA 2O65A 1J7IA 4YJUA 3GB2A 1YQJA 3FZTA 3ML1A 1Q8YA 3NX8A 4PX6A 3QX2A 3CP9A 3M42A 2X39A 3JYAA 2GNJA 4O82A 4U44A 3FEGA 1CDKA 2R3RA 3KB7A 4Z3VA 1WVWA 2BDJA 3IGGA 5IMXA 1PK8A 2Z2WA 3KA0A 3A2CA 5ANEA 3FI8A 2FA2A 1BKXA 3G9NA 3CKWA 2ZGIA 4BY9E 3EN5A 3VBYA 3R02A 3MESA 3MJ2A 1PMEA 4H05A 5M51A 4L3JA 1VYWA 1W8CA 3W2PA 2SCUB 1LEZA 4ZTQA 5F1ZA 3FHRA 4EOSA 2PBZA 1QPDA 3D5VA 4YU2A 4M67A 4F7SA 5D41A 3G33A 3HMIA 3QKLA 2ITWA 2YM5A 3TEIA 4F1TA 3GC7A 2ZJWA 2F2CB 2IZUA 1BUHA 1ZYLA 2Z7LA 3EQCA 3SRVA 4EH3A 3BLRA 4QP8A 3LM5A 4D5KA 4U97A 4ZTSA 3BLQA 1NVRA 3HAMA 3DLSA 1WRVA 2PVNA 2W6QA 4CMOA 3OVVA 4QMSA 2J7TA 1BI7A 4L52A 4R3RA 2QURA 3N4TA 4ANLA 4EQMA 1B6RA 5LMBA 4M0JA 3AT3A 5FBOA 2FPPB 4ZSAA 4EEVA 2CPKE 3IS5A 4BCFA 4IANA 4FKWA 1W98A 3S0OA 3LHJA 1DI9A 3ATSA 2EB3A 4FOBA 5AP6A 3COMA 5FRIA 2PY3A 1QMZA 1OL1A 3FLQA 4FSRA 2IW8A 4D2RA 1XH5A 4GT5A 4RFZA 4RX7A 3EH9A 5IQDA 2RG5A 4EGJA 3MWUA 3CTJA 3DFAA 3AC3A 1XKKA 2YZAA 3QWUA 1OL5A 4D4RA 3V8SA 4CVAA 4NU1A 1G3NA 3ZS5A 3AMYA 3NW7A 3FLNC 1IA9A 3CD8A 5M4FA 3O8TA 5CAVA 4TYHB 3AT2A 5JK3A 3GC0A 5D7AA 4EH4A 5EYDA 2EU9A 4IZOA 1OIUA 1G8SA 1UU8A 4WBBB 3BU5A 4AGUA 4FTQA 5HX6A 3DPKA 4GT3A 4AFJA 3SQQA 3CJGA 3CQEA 5CAQA 2YZNA 3LWBA 3AC1A 3SV0A 1DAAA 3I7BA 4DEHA 3PXFA 3MTFA 3AMAA 4X2FA 4D5HA 3GJXB 2XH5A 2YZGA 2R86A 2V0DA 4QYEA 3FXWA 2I0VA 2X9EA 4EQCA 3RV3A 5CVFA 4IE9A 2BKKA 3BU6A 4MK0A 4NWMA 3ZDUA 3DKCA 4LFIA 3U87A 4CZUA 5CEOA 5IU2A 1Q3WA 5DHJA 3OOGA 2XNMA 4MXAA 4X3FC 4ZJJA 4F6UA 5HGIA 2EWAA 2IZRA 4X6RA 1IYEA 1I2KA 1V0PA 4IIRA 4D1ZA 1FPUA 5EFQA 2XA4A 3PSBA 4CSVA 4XP3A 2IZTA 2C5NA 2QOOA 3W2OA 1XHAA 4D9TA 4V0GB 4IFGA 3GDEA 3BV3A 5EH0A 5DMXA 3R04A 4ANBA 1YI6A 1Q97A 4MXCA 4E4MA 1S68A 3K54A 4I21A 4JIKA 5EOLA 2FP4B 4IM3A 2R3PA 3PZHA 4C59A 3MW1A 5HORA 2QK4A 4XJ0A 3HGKA 5GHVA 3ZTXA 3UZBA 3ET7A 4ZTHA 4RGJA 2CSNA 4A9SA 4H1JA 2XM8A 4KIOA 4MWHA 3ZYAA 3COIA 4RJ3A 2VD5A 1XK5A 3KK8A 2DLNA 3HMMA 3FE3A 3F3VA 4C61A 3MYGA 4O0TA 2KULA 2W1CA 2YIQA 3F7ZA 3HB9A 1DAWA 4MNEB 4Q5HA 5B2MA 4FFNA 3JS2A 5AAEA 2C68A 5AAGA 3EFJA 4ZSJA 4P2KA 2EXCX 1WBTA 2XNPA 3BHHA 4U7ZA 3R21A 5J9LA 2O3PA 5EM5A 1CKOA 1MRUA 3ENMA 2WTIA 4EKLA 2ZV2A 4I6BA 2SRCA 2QODA 3LXNA 3LFQA 1YHSA 1ZYSA 4HGLA 3SNOA 4DA5A 4YAJB 3VOTA 3MBLA 3EN9A 4I5PA 3F5GA 5LQFA 1OGUA 4DGOA 2J6MA 3FI4A 5AUWA 2X2MA 3UIBA 3TUCA 1JSVA 4GH2A 4N0SA 3MJFA 5JGAA 2WNTA 3ANRA 4YZCA 1DM2A 5BYAA 4GEOA 1EKPA 4A4XA 1E1VA 2C3LA 3R8ZA 3CEKA 3TKUA 2YWPA 5G6VA 4TV8F 4WSYA 1GZ8A 2C69A 1P8LA 5BWRA 4QQ5A 1G5SA 1KE7A 1AGWA 1IOVA 3WILA 2P0AA 4FT3A 2HVRA 3HVCA 1YRPA 4CLJA 2C6KA 2PMIA 3ZEWA 4B0GA 4D28A 4DGLC 5I4NA 4QSHA 2XALA 2GQRA 3T8OA 3DTCA 5E8XA 5FTGA 3HV3A 3LE6A 4BI0A 2Z8CA 3K3IA 2B1PA 3ORXA 1H1QA 4LV8A 2XIXA 2W4JA 4BIBA 4DG3E 2OH0E 3TNPC 2XKDA 4BDCA 2HCKA 5M53A 3PLAE 2CNUA 5I5TA 4WNPA 3E8CA 4AXCA 4C58A 3OUUA 3NW5A 3QA8A 2PZRA 4DHFA 3BABA 1Q62A 2AUHA 3O5AA 4M0ZA 3ETJA 4PTCA 3F61A 1HOWA 5GJFA 1V0BA 2B9JA 3D83A 4OBOA 5BWVA 4JS8A 3W55A 4HVHA 5DN3A 2J0MB 4Q9SA 2QF7A 2WTKB 1WCCA 2PVMA 5C8YF 4EZ5A 1I44A 4RVKA 4EFBA 3RKBA 3JUHA 3OUZA 4IHJF 4OTGA 3PG3A 3D2KA 1TQPA 2Y4PA 4RWJA 4S34A 3DXPA 5CQUA 4D1XA 3DK3A 4L3LA 2QVSE 4J96A 4D58A 3FY0A 4L7SA 4PDOA 1OZ1A 3NRMA 3Q04A 2EUFB 3DZQA 4MH7A 3KF4A 1R1WA 4QP2A 4YZBA 5F20A 1F3MC 3UGCA 4FL1A 4YZMA 4FKPA 1PYEA 4JDJA 5IQIA 3WYXA 3E64A 2YAAA 4CKCA 3LXPA 3LKMA 5AUVA 2RIOA 1E4EA 1WVXA 5E1EA 2W70A 3BLAA 3W2QA 3DAAA 3U9CA 4R78A 1R39A 5D1PA 4EL9A 3RFCA 3F2RA 3OCTA 4FODA 3C50A 4KS8A 4FZFB 3ZHPC 1FVVA 3KFAA 2OKRA 1APME 3C7QA 2IVVA 2VTLA 2Z7QA 4R7HA 3FZ1A 5BPYA 2DAAA 5CI6A 5CYIA 2F7ZE 3SDJA 3U9NA 2WO6A 3BA8A 2VO7A 3UQ8A 4BCQA 2JITA 2WOUA 3PJ3A 1BLXA 5HD4A 2WFYA 4M12A 1ND4A 3IDBA 5C1QB 4WKQA 3LQ5A 3WOWA 2G2HA 2W1DA 3ZONA 2CN8A 3DAEA 4C35A 3FZRA 4OLIA 4DT9A 1ZMVA 2JIIA 4KBKA 1Y8GA 2OIBA 1U5QA 3PPKA 4M15A 1KBLA 4IB1A 4QEBA 5IQEA 3SRVB 1PY5A 4FVQA 2BFXA 2GNLA 3FZSA 3ROYA 5HEZA 2FUMA 4W8EA 1OUKA 4KRDA 3I81A 4DFZE 4I41A 2QKWB 3PY0A 2WAJA 4MXYA 5AMNA 2VR1A 5E4HA 3JZFA 3IW5A 2HIXA 4DEEA 2OZAA 5A4EA 3F5PA 3KCKA 4HYSA 4Y72A 2UW3A 2R7NA 1OM1A 4JQEA 4FSYA 4NCTA 4TN6A 4C2WA 1RQQA 2H6DA 1URWA 3S24A 5LOHA 4I4EA 3BRBA 2WGJA 3KAKA 3RJCA 5J1VA 3TKIA 5EHLA 4UALA 5T68A 3C51A 5CE8A 2YJSA 1PJKA 1SVHA 4NIFB 2F7XE 4S33A 4AT4A 1LPUA 5IH4A 4E6NA 4IAYA 5IUGA 4FICA 3MWEA 5IQBA 4XNEA 4XYMB 5BVKA 4KKEA 5JZNA 3VN9A 3DB8A 4M14A 4XG2A 2WXVA 1G8JA 3FMMA 4QMXA 4YO6A 4BI2A 2AC3A 3LQ8A 4FKSA 4YJQA 3DK7A 4A9RA 2ZB0A 2WTCA 2F7EE 4O86A 2YDKA 2C1AA 4EHVA 5A14A 5CX9A 2WU6A 5AP2A 4QT1A 1YDSE 2QOQA 5F4NA 3W8LA 2J0JA 3QQLA 4CCBA 3MPAA 5AV3A 3DQXA 3Q32A 2GPHA 4JVGA 4RQVA 2R7LA 4ID7A 3T9AA 2C3IB 2ETRA 2XKFA 2O5KA 5A4CA 2XJ1A 4FTUA 5EHOA 4MD7E 5BYZA 5L6PA 4HNIA 3ZEPA 2C3JA 2W6NA 3UFXB 2EB2A 1PXPA 1SVEA 2VN9A 4N6ZA 4BCIA 3F9NA 3OEFX 5IA1A 3IPHA 4ANQA 3D7TA 3EFWA 4FTOA 2C0IA 4TY1A 5HNGA 3BQCA 3DAKA 5JKGA 2XK4A 2VWUA 3NIZA 3R71A 3TY5A 3PG1A 3MGYA 1S9JA 1PMNA 3NW6A 3OT3A 4I0TA 4E5BA 1Q8ZA 3CGFA 4GU9A 1GAGA 3JVSA 4XG6A 4NYEA 4IMYA 3QTQA 3O2MA 2RGPA 5CQWA 4GCJA 1VLRA 3CEBA 4C4HA 3EQRA 3DJ7A 1BL6A 2WIHA 1A06A 5FG8A 2P2HA 4AZSA 2R3OA 3NCZA 1C3OA 4KWPA 4B8MA 4F63A 2IVSA 3QTWA 3SC1A 1Y57A 4FTLA 4LL0A 1UC9A 4EK8A 3UIUA 4WOVA 5CLPA 2DWBA 4EHGA 4DQNA 5KHXA 3HDMA 2ERZE 3QYZA 4Y83A 2O2UA 2ZOQA 3NZ0A 3E87A 4U41A 4BBEA 3QKKA 4F64A 1TAEA 4ZOGA 4DFBA 4I5HA 2WQEA 4XBRA 1KJIA 3ZLWA 3MI9A 3GEQA 4Y8DA 4QO9A 3ZFMA 4L53A 4R1YA 3O7LB 4I5CA 1K3AA 4MV4A 2C47A 4O2AF 3R1SA 4E4LA 1SVGA 5BWXA 4HYHA 4L67A 3R7VA 1M7QA 3BBWA 4GRBA 2E9VA 2A4LA 5BYBA 1UVRA 3HNGA 4I4TF 4LOQA 3F2AA 2J0LA 5CA1F 5HG9A 4BDKA 4E6DA 3S3IA 2X8EA 1KJ8A 2YCFA 3PA3A 3Q4UA 4EONA 4BDIA 2FB9A 4C33A 4W4XA 5HVKA 4CC5A 1X8BA 3KU2A 3TIGA 5CF6A 5CSHA 5C1PA 3WE8A 5M4IA 2WD1A 5HESA 4AN3A 5ETFA 3JPVA 3NUNA 4RX8A 4WT6A 3OP5A 2PPQA 5FBNC 3R8MA 2PVPA 3HL7A 4E4XA 2XKEA 2XYUA 2HXQA 4CCUA 4PZ6A 2ITOA 4E6AA 4CNHA 2XK9A 4C7TA 4NFMA 5JN2A 3KREA 3KXZA 3O0GA 4IZ5A 1CKIA 2VQDA 3UMWA 5CALA 5BUJA 3MVLA 3O51A 4ZS0A 4NH1A 3AD4A 2OW3A 4IX5A 5LWMA 5DT0A 2BCJA 5K3WA 3VUMA 2UZTA 4GVJA 3KY2A 2CLXA 2JIUA 3LFDA 3Q4CA 4JT3A 3UVPA 4EUTA 2PN1A 4IBMA 3G6GA 4Y73A 1W7HA 5HIDA 3VBQA 2GNHA 5C8KA 1JDBB 2ZM3A 3KN5A 1ZARA 1T45A 3I0OA 3RWPA 2H8HA 3VS3A 2Z02A 5L6OA 1FVRA 3TTJA 3MN3A 4KSPA 1YW2A 3O71A 2VNYA 2QC6A 4RWLA 3TCPA 2DIKA 1R78A 2YWVA 3GI3A 4Y5HA 1ZLTA 3FKLA 1WFCA 3TZ7A 3MY0A 4ZTLA 4QQTA 2HGXA 3SGIA 4RVLA 2ZM1A 4GV1A 1FOTA 2B7AA 3C5IA 3AOXA 3U51A 3ENHA 4IX3A 1M7NA 2PUPA 4GK2A 3RHKA 2R3JA 2OIQA 3UIMA 2BRHA 4WHZA 2R3QA 3LULA 4AUAA 3G0FA 4LH6A 2XUUA 4WO5A 4UCUA 5BVWA 4C02A 4Y8VB 2Y6OA 2YN8A 2XRWA 3A61A 3DCVA 3GC9A 4U3YA 4XRLA 4E4NA 4PZ8A 5JFXA 3JRWA 1KOBA 3KMUA 4S30A 5HLPA 4BI1A 1QPJA 2COIA 3T54A 1DAYA 4L46A 2YM6A