4O7TA

Saicar synthetase (type-2) in complex with adp, asp and tmp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
225
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAICAR synthetase (Type-2) in complex with ADP, ASP and TMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
total genus 75
structure length 225
sequence length 225
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7tA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7tA02
4I94A 4RQKA 1PMUA 5DE2A 2R3OA 4H3PA 4IWOA 1FVVA 4JLCA 3ANRA 4TY1A 3MWDA 4R7IA 3LFDA 3OROA 4G34A 4DTAA 3PRIA 2HJWA 4CD0A 4RWJA 3Q9XA 2J0IA 1X8BA 1PYEA 3U55A 3KXXA 3F2NA 2I87A 1KE6A 3SW7A 3CJGA 3COIA 4JQ7A 5IZFA 5BVWA 2C30A 2JFMA 4MXCA 4FNWA 2R5TA 5FXSA 3MDYA 3NNVA 3W2CA 3KRWA 5EHYA 5IUGA 4MV6A 3CTJA 4GT4A 3NYVA 4BDHA 4CKRA 5IEYA 3D94A 3WILA 3KULB 4AUAA 2FPIB 1PY5A 4E5WA 3VS4A 4BCFA 2QU5A 4C4JA 2I40A 3VVHA 1Z2NX 5IUIA 4ITIA 4PDOA 4CZTA 4F7LA 4AE6A 2XIXA 4CMOA 3VS3A 2EUFB 2QVSE 4AQCA 3OHTA 4ZQIA 3F6XA 3EKKA 3N8DA 2FO0A 2IVUA 4GSBA 2CNVA 2BAKA 1LUFA 4CMTA 4CG8A 4DEIA 4FL2A 4IWPA 1ZOEA 3ATTA 3S4QA 3FZTA 4ARKA 2Z7RA 2CN8A 5AJQA 3AGMA 3W1FA 1H08A 5CS6A 3RHXA 1WBOA 1NVSA 4MA0A 1OL7A 3UVRA 2VTRA 5ANDA 4TWOA 3U9CA 3P0MA 4FT0A 3HAMA 3G5DA 4O38A 3F5XA 2QKWB 4S32A 3DNDA 3GLKA 1G5SA 1GY3A 3MVMA 4KIOA 3RCDA 1IA8A 5AP3A 4A4OA 4DA5A 4WSYA 4RIXB 1P5EA 1AGWA 5EFQA 4FI1A 3BWJA 5JEBA 1NW1A 4ZLOA 1P2AA 4RGJA 2W6NA 2ESMA 2ZMCA 2J51A 3NGAA 4G6NA 3TKUA 3PP1A 4DINA 5C1PA 4KIPA 2UZDA 3P78A 3PJCA 4E4LA 3SRVB 5KMOA 4MXXA 4ZY5A 4AX8A 4KSPA 5IDPA 1CQJB 5KX5F 4FZDB 4WNMA 3GCSA 3NNWA 3RM6A 2XS0A 2ACXA 2YA9A 5CNNA 5HO8A 5C8MA 3VBYA 3O71A 4D58A 1KE9A 4IC7A 1VJYA 2C0OA 1MRUA 2X1NA 3S0OA 4U9AA 5IH4A 3B2TA 3FEGA 4BYJA 2YDKA 1JKJB 2QC6A 5HE0A 3WZUA 5HBRB 4NM3A 1Y8GA 2V58A 4L00A 1YWVA 5A4CA 1R1WA 3RHKA 3DK6A 3HECA 3ZO3A 3LFNA 3AMYA 3FLSA 4YLJA 5HO7A 3HB9A 4W4YA 1JSTA 3LLAA 3G51A 3HL7A 3U4WA 4AACA 5KMNA 1TQMA 1ZYDA 4ZSAA 5JFXA 3BQRA 1A9UA 1VYZA 3E93A 1YOJA 3WZJA 4DFNA 3ERKA 1ZLTA 5J8IA 4C4FA 4QMNA 5BVNA 2CPKE 3EN6A 2ZVAA 1B38A 1K9AA 4QMXA 2C6LA 4YZNA 3FLWA 3R2YA 3VS0A 3EFWA 4HGEA 4NSTA 4EOQA 1DIKA 3H9OA 3EMGA 2WEVA 3LM0A 4FKWA 2H8HA 3K2LA 3BLHA 4O0WA 4AA0A 4E4MA 3Q9WA 4O6LA 4O91A 3JYAA 1PXNA 2X2KA 1LP4A 1V0OA 4FC0A 1JLLB 5DT3A 3LXLA 4FV1A 5FG8A 5A3XA 4CFUA 4Y95A 3PJ1A 3E8CA 3GU7A 4RSSA 4IX5A 1ZZLA 2ZMDA 4OBQA 3RCJA 3DTCA 2B7AA 3GNIB 2WTCA 4UALA 4F9BA 2BKKA 2ERKA 3DK7A 4NT4A 3SHEA 3QUDA 2YACA 1IASA 1LPUA 2XKEA 2G9XA 3QXPA 4D2RA 3QLGA 4ANSA 4I4TF 1P4FA 4Y46A 3HMOA 4H3QA 2VGPA 4F99A 4L6QA 5HU3A 1P14A 3H30A 3U6JA 4KB8A 4G5JA 3DT1A 3CQUA 3IDPA 3ZZWA 4I0TA 2IZSA 4F6WA 4H1JA 2WMUA 4M0ZA 4NJ3A 4TWPA 3N4UA 5IQAA 3CP9A 4G6LA 3GQLA 4OTWA 4X3FB 2UVXA 4K2RA 3SGCA 4RX7A 3TZ9A 2HGSA 3HRBA 4ANMA 3TQTA 3CIKA 3HUCA 5HD7A 3ENHA 2P55A 3DBCA 3PIYA 2HXLA 2C0IA 2VD5A 3LFSA 4JS8A 3GQIA 2YN8A 3AT4A 3BQCA 3VRZA 2HZ4A 3QD3A 4IHPA 3D0EA 4MV1A 3UC4A 4FTQA 4TW9A 3ZFMA 1ZY5A 4YURA 4BDEA 3HDMA 2I0HA 2QG7A 4EQMA 3VO3A 3DB6A 1EYZA 3TJDA 3SKCA 4YLKA 4C4IA 3CS9A 3OZ6A 4BF2A 2XKDA 4O21A 3FC2A 3AC1A 4C3RA 4U45A 4YJ2F 3I79A 4I5PA 2BKZA 4EQUA 1H07A 2QQ7A 4MF1A 2VQDA 1PKDA 4V01A 3JVSA 4YO6A 5DLSA 3E92A 4G6OA 2ITNA 2DUVA 3LE6A 4A4XA 3F82A 2QCSA 5CI7A 4A4LA 3MSSA 3CKXA 5T6KA 4KBAA 5M08A 4KBCA 5C01A 3D2KA 4WBBB 3RJCA 2P0AA 2BALA 1M0TA 3VAPA 2W1CA 3EQPA 4ENXA 2B54A 2GSFA 4QQCA 4IVCA 5HHWA 3C7QA 2A2AA 2UVYA 3KN5A 4WRGA 3BYMA 3R83A 4QMQA 5FBNC 4QYYA 4S34A 3PP0A 1CKJA 4XNEA 3TNPC 4EOLA 3VOTA 3GGFA 3AGLA 4AN9A 3UO4A 2GQGA 2VO3A 2W1HA 3A62A 3AD4A 4APCA 2OIBA 3IOPA 4BC6A 1PXIA 4ERKA 3JXWA 4O7TA 3LFBA 5ANKA 4RMZA 4WNKA 3F3ZA 1NVRA 3FMHA 4RJ8A 2YS7A 4BRXA 3A8XA 2YIWA 3R0TA 5M4CA 4ZS4A 2BRNA 3P7BA 2GDOA 5HBHA 3QUPA 2R3RA 4AA4A 3H9FA 3MPMA 3ZC6A 4DHFA 2PUUA 3NW7A 4IZYA 4ASEA 4ZHQF 1ZYJA 4BZNA 4BCJA 5DOSA 3H3CA 4F6SA 5HBJA 5BUIA 1XHAA 1H25A 4DFLA 3PJ8A 4USEA 3RWQA 4CKJA 2V5QA 5CZIA 3KXGA 4O81A 3ANQA 3FZ1A 5EI2A 4BDFA 3PLAE 3DXPA 3OXTA 3F2RA 3MI9A 3UNZA 4EYMA 2PZ5A 3GIDA 3VMMA 3OWKA 3O50A 3FMLA 2QURA 3Q9YA 3V51A 4AZFA 4ZLZA 3ETHA 1OM1A 4WT6A 1MQBA 2FSLX 5J87A 5TOZA 3VUDA 4O2AF 4IH8A 1E1VA 2VU3A 1FOTA 1JKSA 2GQRA 2IO6A 3VHKA 1GAGA 2JAVA 3K3JA 2C47A 2RFDA 3FI3A 1JWHA 4JBQA 5JVLA 2VTPA 4F0FA 1Q61A 4HNTA 1JLUE 4MWIA 3HV5A 4NKSA 3RPOA 2YYAA 3ZH8A 3ORRA 2HAKA 3VPBA 3I5ZA 4BDCA 4C38A 4MHAA 4LYNA 4QYFA 5DIAA 2E9PA 3QTIA 4MNEB 3WYXA 4F70A 5JQGF 4X21A 1OVEA 2GHGA 3BEGA 3GOPA 3PXYA 2DZDA 4Z7HA 4FV8A 2BHEA 2VNYA 3Q96A 5KMIA 4U79A 5H2UA 1AD5A 2C1BA 3VS1A 5CSHA 3KEXA 3KRRA 2UW0A 5AP6A 4C5AA 5LVPA 3CJFA 2VTHA 3MVHA 3WYYA 2B0QA 3ZUUA 1H1QA 4DF3A 3TUCA 3QL8A 5M07A 2QOBA 3TV4A 2GS2A 4Q9SA 2X4ZA 3GCPA 4U6RA 5DEYA 3NAXA 1Y91A 2JDOA 4L68A 3HP2A 1OKYA 2BROA 4TNDA 4IM0A 2ZV8A 3SE7A 4HYHA 4BI1A 3R01A 2OG8A 3HNGA 3KRLA 2WTVA 4IAFA 3TTIA 4ACMA 3PY0A 1ZARA 3UVPA 1IAHA 4TN6A 3TKHA 1HOWA 1H0WA 4U3ZA 2B53A 2VPQA 5CEQA 3NEWA 4IMYA 1JNKA 2QKRA 4HGSA 4CNHA 4EWHA 3UQGA 3QZFA 4FYOA 3FLNC 2R3KA 3ORNA 1WFCA 2OFUA 2Q0NA 3ZFXA 4Q2AA 1VR2A 3V04A 4DYMA 3E88A 3IPHA 3OTVA 2OWBA 5L8LA 5A6OA 5J9ZA 3E5AA 4UBAA 4FV4A 4BHZA 5CU2A 1DS5A 2NRUA 2QOFA 5B2LA 5CT7A 2UZWE 3HYHA 2G2IA 3DFAA 2VTIA 5CT0A 4CMUA 2UVZA 1H1WA 2JLDA 3C4WA 4EH2A 1CS0A 3RWPA 2OI4X 5CU3A 3SX9A 3LCDA 4B99A 1YWNA 1OIUA 3A4OX 2VWXA 2GLTA 2PZIA 4FTIA 3FI4A 4CFWA 2IVSA 4PQNA 3LMIA 3VA7A 3QKKA 3HMMA 3AG9A 1BI7A 3U8WA 5DRDA 4AZTA 3QQJA 2P2IA 4O7LA 5KMKA 1ZMUA 4O0RA 4P5QA 5CXHA 2C5YA 3IS5A 3H0ZA 4UXQA 3I6WA 3OD6X 4MV7A 2ETRA 2XF0A 2JIUA 2BFXA 4WOVA 5LJJA 3LHJA 1S9JA 3EFKA 2C0TA 2DYLA 3OUZA 4IJPA 3IW8A 4PNIA 2PVRA 3EL8A 2GNFA 4RVKA 3DKGA 5BPFA 3JS2A 4G9RA 1PK8A 4QMWA 3HDNA 4FU0A 5E8VA 3ZBFA 2W4JA 4QMSA 4FSYA 3OBGA 1VYWA 3RAKA 1BI8A 3NNUA 3LXKA 3P7AA 1Q41A 3UYTA 2W6OA 4FNZA 4FEWA 3TKIA 3M42A 1F0QA 3OP5A 3BU6A 4GT3A 2UZUE 4RPVA 3ORTA 3RMFA 5C1OA 1MRVA 4KA3A 4E8AA 1L8TA 3D7TB 4AGUA 1YXSA 1YOLA 2A0CX 1FVRA 3QQLA 2WNTA 3FL4A 4JG8A 4IW0A 2X8DA 3FJQE 5IQEA 3QTRA 3W2RA 1CQIB 3MS9A 2BTRA 3C51A 4KRDA 1XH4A 4I5HA 5ITAA 1W83A 4DH8A 4EOIA 2VR1A 4JX3A 4IACA 4B7TA 4XZ3B 4FIGA 4FKTA 2UZVA 4JDIA 4QNAA 3VJOA 5K5XA 4F63A 2HELA 2BMCA 4TZRA 3EN7A 5CX9A 4EBVA 3JRWA 1E9HA 3MH3A 3KAKA 1W84A 4L1KA 3WE4A 1UKIA 3DAJA 2OXXA 1STCE 3TNQB 1C3OA 4IX6A 4ZK5A 1YDTE 4F0GA 3UNKA 1S9IA 5FDXA 4FZ7A 1FMKA 5IISA 4O4HF 1YKRA 2FSOX 3R22A 5DYJA 4FZFB 2R0IA 3W2PA 2BCJA 3KMUA 2IVTA 3PIXA 1QMZA 4D4RA 3VUIA 3C50A 2QF7A 2BZKB 1BLXA 2JDVA 5IDNA 4QP1A 5IPJA 3EQDA 4BDDA 2W6ZA 5DFPA 4A9TA 1C30A 2QOIA 3VUHA 4A06A 2HWPA 4XMOA 5KHWA 4QTAA 2XCLA 2X81A 3IG7A 5FEDA 4FIIA 2X7GA 2YCRA 1RDQE 3A7HA 3MFRA 3PTGA 4CEGA 5ACKA 2GS6A 4O7RA 1APME 1E1XA 4EH3A 3D2IA 3WF6A 3H4JA 4ZY4A 1Q62A 3HBLA 2F2UA 4F7SA 5IEVA 4DEBA 2JD5A 3ITZA 4LQMA 4G31A 4JNWA 4ZJJA 4C02A 3TIYA 4E26A 5H8GA 3RK9A 3TWJA 3IKAA 1QPEA 4FR4A 5A6NA 4YZ9A 1KE5A 2KULA 2J6MA 2C00A 4K8AA 4R7HA 4YZBA 3NRMA 2V5AA 4HJOA 3VULA 2PHKA 5FTQA 2OICA 4HCTA 2GHLA 2CJMA 5F95A 5FP5A 3C4XA 4Y8VB 3QTZA 2VX1A 5HTCA 3MGYA 4ORKA 5IA1A 4EGJA 3FPQA 3VS6A 2R3LA 2VX3A 2VNWA 4RJ5A 3CSVA 4PMTA 4A9UA 2QI8A 2QHMA 4PP7A 3MPTA 3DJ7A 5FUTA 3ZBXA 4TYIA 3PLSA 4X2GA 5LCKA 3RPYA 3QZHA 5HZNA 5HIEA 1OKWA 1CE8A 1XO2B 5CXZA 1M2QA 4ZSJA 3W8LA 4YMJA 5ETCA 1Y6BA 3AC5A 4ZTLA 2XJ1A 4XV2A 3MIAA 4RX9A 2X9FA 1E4EB 3MN3A 2H6DA 1FPUA 3NDMA 2WIHA 3NMUF 2G1TA 1J1BA 4QTBA 4EEVA 2C6TA 5KCVA 4FV0A 5CEMA 5CENA 1SNXA 4UWCA 3VS5A 3DBEA 2QD9A 1KJJA 2P4IA 5E8YA 3NUAA 3LFQA 3UYSA 4MKCA 3CTHA 1Z2PX 1DI8A 2XBAA 3DF7A 3DJ6A 4V0GB 2PSQA 4YUQA 4FICA 3UIBA 5K4JA 3B8RA 2ZM3A 2XRWA 4KIQA 3H10A 2C5OA 3PFQA 1WMKA 4ASZA 3KXNA 3QLFA 3L8XA 3OWLA 2QU6A 3FZPA 5EQPA 4RJ7A 4HVSA 3R2BA 3PY1A 4FFRA 4IAAA 2P2HA 3TDVA 2GNHA 1VBGA 4FTKA 4XLIA 2Q83A 3EQIA 1Q8ZA 4L44A 2VWBA 3QYWA 4RVTA 2Y6MA 1ZYCA 2V7OA 4DN5A 3DU8A 5F4NA 1OUYA 1O9UA 3OXIA 5EYCA 2WMSA 2CKEA 3CLYA 3QRKA 4FVRA 4G3GA 4IDTA 4JOAA 4TTHB 4DTBA 1JOWB 2CN5A 3A4PA 4JI9A 3GFEA 5CF4A 1CKIA 1ZRZA 3LQ8A 4DLJA 2OSCA 2I80A 4GH2A 5ETAA 4CT2A 3ET7A 2WAJA 4MD7E 1WBTA 3TEIA 3BG5A 4MX9A 1MQ4A 4L42A 3KK8A 4EK4A 4RFMA 1IR3A 3OUUA 3WF7A 4TV8F 2Y0AA 4BDGA 3FSKA 4FSRA 2AUHA 2ZV9A 3FDNA 1ZZ2A 3LLTA 4NJDA 3F69A 4DGMA 4GS6A 4FL1A 5EM6A 2FB9A 2EB2A 2ITUA 4LRKA 3CPBA 3QGYA 1Q8TA 2OH4A 4L3PA 4O22A 2P33A 4HPTE 4ZMFA 3P5KA 4O0UA 3MWEA 2O65A 2HCKA 3OXZA 4FTLA 4QNYA 3ZU7A 3QD0A 3UOJA 2HY0A 3C4CA 2XNEA 3QX4A 5E90A 3SVVA 1L3RE 4WHZA 3QXOA 2CKPA 2RF9A 3FSFA 3ULZA 5A4EA 4EKLA 3RK5A 4AP7A 4TYGA 2R3QA 1J7IA 2WTKC 1GGOA 4WUAA 3HRFA 3CEKA 5B2MA 5IMXA 5FGKA 2OU7A 2W7XA 5T68A 4XV3A 2IW8A 5C8YF 3OOMA 4I93A 3DKFA 4R5YA 4YZMA 2XIZA 1BUHA 4U8ZA 1JQHA 2BAJA 4RIWA 1UU9A 4TT7A 3KXZA 5HICA 3KCFA 3LQ5A 4JQEA 2W1GA 1PF8A 3TACA 4NFNA 4GU6A 4E6QA 3C4EA 1PKGA 2PE2A 3UPXA 5HTBA 4LGGA 3R9OA 2JBPA 3TXOA 3ORPA 5AX9A 2IP4A 1WR2A 2XUUA 2PL0A 4AZWA 4NH1A 3UZTA 4RZWA 1EUDB 3KAJA 4MH7A 3QQFA 4C37A 4QRCA 3HKOA 3AX6A 5J2UF 5HNGA 2IVVA 1GIIA 2IW6A 2RFEA 4KSQA 4YJOA 3HRCA 3WIKA 4ASXA 2R85A 4YAKB 2BDJA 5CVFA 4MVFA 3SDJA 4C36A 5AM6A 1R39A 3O23A 4HVHA 4EH7A 3RALA 5M09A 3FPMA 1XJDA 2AC3A 3HV4A 1B6SA 2PY3A 1W93A 5C26A 4IVDA 3EFJA 3ENMA 5DHJA 4AT5A 1YDRE 5I0BA 5I4NA 3R71A 4PRJA 4QTDA 4FYNA 2W0JA 4YO4A 5AV0A 3D5UA 1FBNA 3EN9A 3R7EA 1H27A 4O0TA 1WCCA 3JY0A 5EM7A 4F7JA 4IIJF 3GU4A 3RVGA 4OTIA 3VNTA 5DNRA 3UQFA 1OIYA 5CA0F 5EQYA 4YHFA 2F49A 4I6FA 5E8ZA 3ZCLA 5CY3A 2CSNA 5CA1F 4JG6A 4CTCA 3NNXA 5C8NA 3WF8A 1OL5A 2PVNA 2R0UA 2YAKA 3ORMA 4AS0A 4BCQA 1VKZA 3QCQA 4EK5A 3ATSA 4U81A 5CI6A 5J1VA 3UVQA 3JZFA 2XJ2A 3OY1A 4QMUA 3ZFYA 2XEZA 3CBLA 5K3YA 2NNWB 3E3BX 1XBAA 1U59A 2HWOA 4LI5A 2R7IA 3NZ0A 2XEYA 4FOCA 5C4KA 4O6EA 4JBPA 4L67A 3V6SA 3R8PA 3DQWA 3R9NA 1OPJA 3SXSA 2XK6A 4HYSA 3N6RA 3HMPA 1T45A 4KS8A 5CVGA 5TT7A 3SG9A 3UGCA 4L8MA 4PY1A 2BIYA 4FV5A 1U46A 5HG5A 5CAEB 3KGAA 4G3EA 2WMXA 3ZRMA 5HG8A 4EOKA 4DH3A 4EONA 1OL1A 5EZYF 5CF8A 1AQ1A 1Z5MA 4MTAA 4AXAA 3ZO1A 2FB8A 2VO6A 3QD4A 4J71A 2YL2A 2V55A 2XNNA 4EK8A 3EHAA 1URWA 4HGLA 2W1IA 2BDWA 4KRCA 4PDYA 4YJRA 3R9DA 3ORLA 3GCQA 4K77A 3IW7A 4M14A 3MYGA 3A2CA 3FLQA 3PJ3A 5LVNA 4LOPA 4RIYA 3VS7A 2GTNA 4XH6A 3VW6A 4AZSA 3C4FA 4NZWB 1WVWA 5GIPE 2ERZE 3LMHA 3POZA 4IX3A 5CEIA 5HIDA 4E20A 1OMWA 4D4SA 5K5NA 4X2FA 1PW2A 4GL9A 4NM7A 4N70A 5H3QA 2UW5A 2X0GA 2B9HA 1UWHA 2XNPA 4ZTSA 1ZOGA 4FT9A 4WKQA 2W9FB 4PX6A 4QTCA 5CU6A 4MCVA 2DLNA 2YZNA 4HYUA 4P90A 5GJGA 4L7SA 4TXCA 3FI8A 2ITXA 3RNIA 5IYZF 5HE1A 2QOLA 4L43A 4EOMA 5BYYA 3PDTA 3OVVA 4I0SA 4X2KA 1ZYSA 1GNGA 2BRMA 1HCKA 2OBJA 4IC8A 4ITHA 4C4EA 5J9LA 1A9XA 4B8LA 2EU9A 2UZEA 4H58A 4IEBA 5K9IA 3Q2OA 3PPZA 4F08A 4ACHA 3HVCA 3OW3A 3KULA 5F1ZA 1XR1A 4P2KA 2Z2WA 1XWSA 3F2AA 4YC3A 5AM7A 5M4IA 4C5CA 1OKZA 2PULA 4BKJA 4D9UA 4DGGA 5J9YA 3S1HA 5CAPA 1UA2A 1YXXA 3FMMA 1J1CA 4RIXA 4YPSA 4F9CA 2YWPA 4DCAA 3EN5A 5M53A 3LFCA 3BBWA 3S00A 4JX7A 4YBKA 1JSUA 4XP0A 4ZOGA 3BU5A 4FMQA 4YZDA 3TIGA 4E93A 5DWRA 4O0XA 2R3NA 3N9XA 2F4JA 2Y6OA 4X7QA 3P7CA 4JR7A 3VF9A 4YAJB 5EM5A 3AOXA 4TNBA 4ACGA 3LXPA 2GNGA 2UZOA 2XIYA 3UZPA 5CF6A 3TT0A 2I6LA 2JKOA 5E4HA 4CV9A 3EQCA 4BTFA 4QMMA 2JDRA 5G6VA 3OCTA 4C7TA 3E64A 1KBLA 2YM8A 3I6UA 2VX0A 3F3WA 4TKSA 4XP2A 2XM9A 1VEBA 2FSTX 5LMBA 4KS7A 4BBEA 4CV8A 3WI6A 2YM3A 2W5BA 2BIKB 4FA2A 4YJNA 4DFYA 4KKGA 4S30A 4D1ZA 4V05A 4RVMA 4BN1A 3E62A 3MJ1A 3PG1A 4FT5A 1FGIA 4RBLA 4WO5A 3G90X 1CKPA 5C4LA 1CM8A 3I81A 3F88A 3V5WA 3LWBA 4G1WA 3NYNA 5AUWA 4V0GA 4GYIA 3SXFA 4ENYA 4R78A 4FVQA 3UQCA 2J5EA 3TZ8A 2WTKB 3COMA 2DQ7X 3Q5ZA 2R9SA 4YJTA 5JGAA 1I7LA 3RZBA 3TNHA 4E6CA 3KREA 5HEZA 2XJ0A 4QTEA 5DT0A 5EH0A 4FTCA 1M6VA 2WMVA 1W0XC 1UU8A 1KV1A 1UKHA 3HMNA 2B9FA 3U54A 4AGCA 4AW5A 4DG2E 3ORIA 2YIYA 1SVGA 3PSDA 5FTOA 4NK9A 4C3FA 4GKHA 4TUYF 4BZOA 5DG5A 3I0OA 2YCFA 3MY0A 4TYJA 3UOHA 1IOWA 4JXFA 4S2ZA 4F9YA 4DFUA 4FK3A 4I24A 3FE3A 4DLKA 5GJDA 4N6YA 3LVPA 4DEGA 4WIHA 5JGBA 4X0MA 5HLNA 3LJ0A 4MA5A 2PVFA 2Y9QA 4FK6A 3GC7A 1VZOA 3QF9A 5LOHA 3CGOA 1T36A 4JAIA 4DGLC 5JFVA 4FSTA 4XJ0A 4IM2A 4WG4A 2HZNA 4OBOA 4ALVA 4IZOA 5L8KA 2VTNA 4OGRA 4QPSA 4XOYA 3BHHA 2LAVA 2AC5A 2VTTA 3QQGA 4EL9A 5CU0A 2X39A 1YHSA 4WA9A 3PZHA 4HVIA 2V0DA 1WAKA 3K3IA 3V5LA 4GMYA 5KNJA 2OO8X 1J3HA 5HE3A 2AYPA 4RZQA 2HW6A 3QTXA 4IFGA 2OJ9A 4EHZA 3CKWA 2O8YA 3DLSA 3L8PA 4XG2A 2UZLA 3ETJA 5DRBA 2Y4PA 4FTRA 3AW8A 3OFMA 3Q53A 2R7BA 3R8UA 4UYAA 4Z3VA 4TYEA 3FY0A 1Z57A 2NPQA 3HO8A 4I4EA 1OI9A 4FT3A 5BNJA 5A46A 1TQIA 5M56A 2O5KA 4BCNA 2VV9A 1JAMA 3QC4A 4E73A 4R5SA 5HLWA 4C33A 3MPAA 3PVUA 4Z7GA 1OPKA 2QO7A 1ULZA 4JIAA 3LKMA 5JQ5A 4BIBA 3QCXA 2YRXA 3RGFA 3ORQA 3DCVA 1PXKA 2ETMA 1FQ1B 2BILB 4IB1A 3D7TA 4LOOA 4WNPA 3DB8A 5J95A 4HW7A 4CVAA 5ICPA 3BU3A 3BI6A 2B55A 3OEFX 2QG5A 3Q9ZA 4FEVA 2JIVA 3OS3A 3QC9A 3ID6C 5JSMA 2W71A 1PXPA 1JBPE 2BUJA 2QOKA 1ERKA 4XS2A 5H8BA 2W5AA 4LUDA 3EYGA 5D9HA 4LMNA 1WBPA 2JC6A 2YM4A 3O2MA 2FVDA 5FM2A 3SD0A 3VUKA 3G6GA 4EK3A 5IQDA 5C27A 4WD5A 4AW0A 4FFLA 2JKQA 4XYMB 2WTIA 3R28A 4O7VA 4D0WA 2XK4A 2HOGA 4P5ZA 3T9IA 3MB6A 3NUUA 4I6HA 4XYFA 4DFXE 4ZAUA 5FRIA 4EI4A 4ZJVA 4HCUA 1U4DA 3UG2A 1Q97A 3PPJA 2WMWA 3Q6UA 2CZGA 2R7LA 1UWJA 4PV0A 4FUYA 4JVGA 4UZHA 1XBCA 1BL7A 3PZEA 2X9EA 3ZMMA 2Z7LA 2PPQA 3R02A 3R7UA 4GVJA 3U51A 5D7VA 5FEEA 3HZTA 4AG8A 3ZUTA 1XBBA 2CMWA 3OT3A 5JQWA 3B2WA 3BKBA 3DAKA 4F1OA 4XV9A 2CDZA 3GP0A 4RJ6A 5DR6A 3WBLA 4ALUA 3L9MA 4TRLA 5CYIA 3QTQA 3MB7A 4W8EA 4RX5A 4IE9A 1PMEA 3PWYA 4MK0A 4XBUA 2ONLC 1OB3A 2C3LA 3D15A 3OUKA 4QP8A 5HI2A 3PJ2A 3RK7A 3EKNA 4YB8B 1M17A 4LUEA 5HVKA 3LCTA 4YZCA 1M7NA 4O27B 3C9WA 3R1QA 1YQJA 4XEYA 4XG3A 4BBFA 5IH5A 4XYLB 3V4ZA 1OBDA 4FG7A 3NVMB 1SYKA 4DGNA 2IG7A 2XIKA 2YM7A 3L9LA 3BYOA 4AW2A 5AA8A 3UDBA 4E5AX 2HENA 5LOVF 1UU7A 1RW8A 2EXCX 5LVLA 1U54B 2V62A 5FEQA 5CAVA 2PBZA 2BZJA 5D10A 4M13A 5DBXA 3Q2JA 5LWMA 3L8SA 1EHIA 4NUSA 3ULIA 2YISA 4D28A 2J9GA 3LM5A 4EOSA 3ROYA 2WQEA 3VUMA 4F6UA 5TO8A 3N4TA 3W8QA 3P79A 3FZSA 4DBXA 3LXNA 3GUBA 2VTQA 2ZDUA 5E8WA 3BGZA 3R30A 2PVYA 2UW7A 2VWYA 4XCUA 5BVEA 3MA6A 4ZZNA 5H9BA 3R8ZA 4IX4A 5J2TF 3I1AA 2WTDA 4M69B 3PRFA 1YI6A 3W32A 1BNCA 1OL6A 3KL8A 1JKKA 4AW1A 5LMKA 2R86A 2C5NA 3ZYAA 5FXQA 4BCMA 2W6PA 3LP8A 3QHWA 4L3JA 4QMZA 4XLVA 4F1MA 4S31A 3KQ7A 4USFA 4FGBA 4IB0A 5I9VA 1J91A 1YDSE 1H00A 3FZRA 2X8IA 4QQJA 5CQWA 4RC2A 3WNZA 4BR3A 2WPAA 2PUIA 2WKMA 3W55A 2NP8A 3Q5IA 3TV6A 5I9YA 3NS9A 3PVBA 4CT1A 3UZRA 1RE8A 2OFVA 4LMUA 4TYHA 5AUYA 4FFMA 1YWRA 4X6QC 4I4FA 5BVDA 1V1KA 5ANEA 2YZGA 3F3TA 4MXYA 5LVOA 3FAAA 2ZM4A 3ORZA 1TVOA 4NM0A 1LEZA 3AQVA 5AP0A 1B6RA 5AEPA 3KALA 4FTJA 1PXLA 3V4SA 4G9CA 4MAMA 1FGKA 3D5WA 3ZDIA 5G1XA 1GOLA 5JH6A 4QQTA 3R8LA 5HESA 3EQBA 5EYKA 2OJGA 4L52A 2X6DA 5M06A 3HGKA 3R63A 4O4JF 4JR3A 3AC2A 4EOJA 4P7EA 4RFZA 3UODA 3R5XA 3UMXA 2RG5A 3II5A 1VBHA 2J0JA 4HQ6A 4XG6A 3BLQA 3EFLA 3C5IA 4L45A 3GXLA 3DBDA 1QL6A 1KJIA 3QZGA 5JK3A 4I22A 4CTBA 4M8TA 5CB4F 3CCNA 4Y8DA 3KFAA 5FXRA 3DK3A 1R78A 4JIKA 4P4CA 4DG3E 1ZMWA 3WF9A 4CLJA 2XIRA 2Y7JA 1B6CB 3ACJA 4UY9A 3IONA 3MA3A 2J0KA 4NYEA 4R3RA 5EG3A 5AUVA 3R7OA 5JRSA 4K9YA 4RJ3A 2YZLA 5HIBA 3RI1A 1GSHA 4KWPA 4M7IA 2VTOA 3EZVA 4J7BA 3MVJA 4U40A 5L8JA 3MY1A 4FV6A 5CAUA 1ZY4A 2J7TA 2C6KA 2CGVA 3MY5A 4YC8A 4DE4A 2R3JA 4FSWA 3Q1KA 3BYVA 1T46A 4BB4A 3EOCA 4CQEA 5J7HA 2XMYA 1Y57A 2GTMA 2RIOA 3TUDA 4EG0A 2F2CB 4TPTA 2H9VA 4E1ZA 3ALOA 4E4TA 1Q3WA 5D1JA 1M2RA 4FUXA 3D83A 2QO2A 4FKLA 3GEQA 4Q5EA 2I0VA 4NTTA 4FFOA 1ND4A 1PMVA 2XD4A 3FMEA 3EQRA 3CY3A 3TI1A 3JZIA 2ZB1A 5F94A 4BHNA 3BYSA 4MBLA 2UUEA 5CSVA 3P86A 5CEPA 3C0IA 1K3AA 3DV3A 3PA5A 5AAFA 3KK9A 4RWKA 5ANOA 5KBRA 4FIHA 4C58A 4EJNA 4C61A 2YCSA 4NWMA 2O2UA 4W4XA 2GPHA 3VRYA 5C1QB 4LRJA 5CEKA 5A9UA 5DGZA 3GB2A 3MBLA 3QFVA 3PA3A 3HP5A 1WVYA 3I60A 3KCKA 4QP2A 5EHLA 2ZDQA 4O4IF 4IFCA 4CG9A 2HXQA 4PMMA 2UZBA 3QU0A 1KOBA 2J0LA 3G15A 3OBJA 5JH7F 3EJ1A 5DT4A 3UO5A 3JUHA 4G5PA 3SV0A 3KU2A 2W99B 3NLBA 1FVTA 2ITQA 4GK2A 3ZHPC 5CVHA 4F1TA 4K18A 4RA4A 2Y4IB 2GMXA 4GVAA 3CR0A 5HG9A 2C6EA 2C4GA 3F5GA 4YP8A 4ZXTA 3A7GA 5LVMA 2R4BA 1ATPE 3LCSA 4G17A 4GJ3A 3R8MA 1OIQA 4DC2A 1GIHA 3OWPA 1ZWSA 3HV6A 4GKIA 5B0XA 3W10A 2YRWA 5DR2A 3F3VA 3G8CA 4IHJF 4ZTQA 3R6XA 2VWVA 3Q2MA 5DN3A 2DWBA 3FQSA 2PK9A 4FKQA 3DPKA 3O0GA 4XX9A 1OPLA 2ITPA 2W9ZB 4HCVA 2PU8A 4NW5A 4HVDA 2CLXA 1GLVA 2FA2A 4ZZOA 2JKKA 3LAUA 3OCSA 3OTUA 1R0PA 5IQHA 4CLIA 3I12A 2OZAB 2HW7A 4IZ5A 4MYGA 4PNKA 3FUPA 3R04A 4E7WA 4QOXA 4XV1A 4A9SA 3A7IA 2PVLA 5IA4A 4PL4A 1KJ9A 4O2PA 1RQQA 5JMSA 3GU8A 3KRXA 4D55A 4G3CA 5CF5A 3NUYA 2WMBA 1TQPA 5LWNA 3AC8A 3PG3A 4N57A 2BFYA 5D8DA 5CEOA 5I9ZA 2FPGB 3NYOA 4RRVA 5E8XA 4IVBA 1J7UA 3EH9A 2G2HA 4B6LA 3MJFA 4BICA 4FKOA 4IZAA 3MH2A 3SLSA 3NR9A 4B9DA 4FL3A 4AF3A 1XH6A 5I9XA 4QP4A 3LIJA 2O63A 2Z04A 1YW2A 3PIZA 3RAIA 3V8TA 3UIUA 1QCFA 3TL8A 2BZIB 1H26A 3C1XA 2OXYA 4KABA 4Z9LA 2X7FA 3EL7A 3RFCA 3IW6A 4R6VA 4YJVA 2YIQA 3NUPA 3LQ3A 2CKQA 3BIZA 3GU6A 2PE0A 3KY2A 5CTPA 1W98A 3UP7A 4RZVA 4IWDA 3C4ZA 4K11A 3WIGA 3DJ5A 3K5VA 4BI2A 4DIMA 3PPKA 4RFYA 2QODA 4DG0E 4IAZA 2OKRA 5J1WA 2XVDA 2W1EA 5EQEA 3UO6A 4JDHA 3QZIA 5AP2A 3RKBA 5LXMA 1Q4LA 2C6MA 1HCLA 3U4UA 4Z55A 3TM0A 3JRXA 2ZJWA 4O2BF 3PA4A 5AAGA 3LFEA 4IAKA 3I5NA 2VAGA 2ETKA 3QUEA 4O84A 4YNOA 5AP1A 4ZY6A 1SVHA 5AWMA 3NYXA 1KE8A 2C3JA 4IJ9A 4FTMA 3OCBA 3IOKA 4N6ZA 3ZO4A 1A48A 3ZRKA 5H80A 3AMBA 4CKIA 2YJSA 1PXJA 3R7YA 3TG1A 3FYKX 3ZEWA 4HNVA 3R1YA 5BYZA 4DEHA 3R9HA 4EC9A 4DTKA 4W8DA 2C3KA 2BRGA 3IK3A 4RVLA 2GU8A 4QQ5A 5EM8A 4ACCA 5A14A 2BHHA 4M97A 4FV3A 3GT8A 3IDBA 4YJSA 3VS2A 3ZLWA 2GPWA 1OL2A 3QA0A 1KSWA 1PMNA 1Q8WA 4L3LA 1WBVA 2RL5A 2WMRA 3IQ7A 5KMJA 1M0WA 3SC1A 2XH5A 2GPSA 3ZSGA 2YM5A 2CCIA 3O8TA 2R2PA 3I7BA 3PSBA 4S33A 4CRLA 3MFSA 5IA2A 4E4XA 4FV7A 4ZJIA 4KBKA 3UIMA 3FMDA 1GSAA 4GU9A 4UV0A 4HNUA 3FLZA 4MD9E 4GT5A 3TCPA 4M84A 3ZC5A 3D14A 2Q0BA 1GZNA 2WGJA 4QPAA 4O7SA 4ZZMA 3R8VA 1JKTA 4JJRA 4BIEA 3BZ3A 4ZMEA 4ZLYA 2J2IB 2GNIA 4EH9A 2YZMA 4YU2A 2DIKA 2YAAA 4GG5A 5A4TA 4F7NA 5JFSA 3U6IA 4JT3A 5HBEA 2I0YA 4BDAA 4EH5A 2BRHA 2NUAB 2B9JA 1P4OA 3GOKA 3UFXB 4DEEA 3K5HA 4I0RA 5GHVA 3LPBA 3U9TA 2OLSA 4DH7A 4BDBA 4R77A 2PTKA 4NU1A 4EH8A 4ZOLF 2QR7A 5HU9A 4RLKA 5FP6A 2ITTA 2OIDA 4OT5A 4ACDA 2YDIA 4GJ2A 2JITA 5T3QA 2W96B 3AC4A 3MFTA 3A60A 4PTEA 3SRVA 3ZM4A 3U6HA 1YRPA 3WE8A 2P0CA 1Y6AA 5HX6A 5KO1A 4IM3A 2XYNA 5EOLA 4EUTA 5CSPA 5EK7A 4F64A 3KXMA 4RWIA 4I23A 3BHUA 5AUZA 2PYWA 3D4QA 4FNYA 4BZDA 3G0FA 3BGPA 1V0BA 4CFFA 4N4SA 2W1FA 5AP7A 2PVKA 1Z9XA 4FNXA 4NIFB 2FUMA 2GNJA 3ZONA 3F5UA 1GIJA 3O51A 4D9TA 5HLPA 3GCUA 4DEDA 2VRXA 4C2WA 5AX3A 2ZB0A 4HYIA 1Q8YA 4FZAB 4AAAA 5GONF 3FBVA 3NIZA 4DH5A 4B0GA 3BEAA 1R3CA 3QQKA 5ANJA 3ELJA 1PXMA 4FEQA 2G15A 3L9NA 3HX4A 3CQWA 3PYYA 4G16A 4YTCA 1DI9A 4ZP5A 2FGIA 4J8NA 3WARA 3O7LB 3FQHA 1OKVA 4QMVA 1UNLA 3K54A 2WO6A 3QCSA 3PY3A 2X4FA 1YI3A 3Q3BA 4AGDA 3BV2A 2R3PA 3BYUA 4GG7A 3DDQA 4L7FA 5CAQA 5AP4A 1U54A 5KBQA 2OZOA 5EW8A 2Z02A 4HZSA 3LZBA 3TN8A 4MXZA 2CLQA 2FH9A 4RC3A 5IQFA 4BGQA 4H05A 2BRBA 2REIA 5HD4A 3FI2A 3VQUA 1Q5KA 1KOAA 3V8SA 3A8WA 1O6LA 2PMLX 2PZYA 2YDJA 5AUXA 3VF8A 3VUGA 5E8UA 3AC3A 2WELA 3U9NA 3ALNA 1CSNA 2BTSA 4ID7A 4NCTA 1XH5A 5HVJA 3ZLXA 3UOLA 3REPA 4H1MA 2LGCA 4MV4A 4M67A 4W4VA 4PTCA 2QHNA 3OW4A 1H8FA 4I5CA 2J9MA 1YXVA 1JKLA 3VIDA 4CRSA 3FKLA 3BWFA 3SAYA 3VWAA 2XNMA 4M15A 2X2MA 2E2BA 2O0UA 3EQGA 3PVWA 2W05A 3DZQA 3UBDA 3ZUVA 5IH6A 4KUJA 4WBOA 3JY9A 4U80A 4Y5QA 3KVXA 3NSZA 4ZTMA 4HR7A 5JVDF 4BIDA 3A99A 1OITA 1BMKA 2J90A 4R3PA 1M2PA 4TYHB 3DA6A 2XBJA 1Q3DA 5CZHA 5E1SA 3ZS5A 5I5ZA 4NTSA 1KJ8A 4GIIA 3OF0A 4ONAA 4DFBA 4FGRA 3ZM9A 1LR4A 4LV8A 3QTUA 5BX0A 2R7KA 4Y85A 4CFNA 1CTPE 3KMWA 3O17A 3NVKI 4XG7A 1NA7A 2XM8A 5IQIA 4GUBA 4EZ5A 3ETAA 3WZDA 2R3GA 2YIXA 3AMAA 2IN6A 3F7WA 4BDKA 3GC9A 2ZDHA 3QQHA 4DT8A 4PUZA 3ZTXA 3BBTB 4K33A 4XX0B 3IW4A 1GZ8A 4JAJA 4M68A 2QK4A 3DBQA 5GNKA 4C4GA 2GHMA 3FL5A 3E7VA 2IZUA 5HORA 2XK7A 2XB7A 2F7EE 4YHTA 4UYNA 5M57A 2ZDGA 3TINA 4LV5A 4O7NA 5FDPA 3NW6A 2VGOA 4ZSEA 3KKVA 4BDJA 3ZLSA 3PXFA 3P1AA 2J5FA 1TKIA 4ANLA 1SZMA 3BRBA 1ZAOA 1H28A 5L6PA 5EDRA 3ACKA 4OTGA 3QYZA 3CD3A 3E7OA 2B4SB 1F5QA 3Q4UA 3VQHA 3UJGA 4FV9A 4GRBA 4EYJA 5IEXA 4FT7A 5HGIA 2R7NA 4FKGA 1IEPA 4HNIA 3V3VA 4J95A 4USDA 4BCOA 4U97A 3V01A 2WB8A 1I7NA 3QALE 5C03A 4EZ7A 5M55A 3DTWA 3WZKA 3COKA 4FODA 4YGAA 3GU5A 3JVRA 4FIFA 2VTJA 1GZKA 3TZMA 2HK5A 1YI4A 5E8SA 4AA5A 2Z8CA 5JN2A 3DLZA 4FKPA 1OIRA 4ME6A 3UPZA 2ITZA 1H4LA 4D5HA 5CALA 4RX8A 4U42A 1PRYA 5EW9A 3L8VA 4JL9A 5LQFA 4L46A 2UW8A 4EHGA 2B1PA 2WMTA 5IQCA 3FXXA 2BAQA 2C69A 4PF4A 3QRUA 5EOBA 3T3UA 3K3PA 2XZSA 4IZ7A 3ORXA 5CWZA 5CNOA 4ALWA 4F9WA 4OBPA 2GFCA 3KXHA 3TW6A 3DFCB 4BCGA 2R7MA 4FKJA 5HCZA 3QQUA 4XBRA 2OF2A 2OK1A 4I3ZA 4DH1A 2YM6A 5FTGA 1UNGA 4XG4A 2C68A 4PDSA 2WXVA 5L3AA 5AUTA 5JZJA 4RIWB 2RFNA 2VWZA 1FMOE 3FKOA 2J4ZA 2YFXA 4LG4A 4OLIA 3VBWA 3WOWA 4EHVA 4I50F 2X8EA 2JDSA 5BMVF 3F5PA 5ANGA 4Q5HA 1JVPP 4TV9F 3G8DA 5B7VA 3FWQA 2OJIA 4AWIA 2CGUA 4UZDA 4GFMA 5FNVF 5BQ0A 4U3YA 2KTYA 2V22A 1EUCB 2WEIA 4J52A 3QBNA 3K5UA 2QLUA 3CD8A 4KD1A 5BPYA 4BY9E 2OW3A 1EZ1A 5DH3A 3Q04A 1E4EA 3LCOA 3LFFA 5EI6A 3VN9A 3IO7A 4RLLA 2YABA 5BMSA 4V04A 2IZRA 3MH1A 2QOCA 4JBOA 4O86A 1XH8A 3O7LD 2PMNX 2BPMA 4KKEA 5FLFA 3EZRA 1FINA 3N51A 2C1AA 2WHBA 3FKNA 4FEUA 5CANA 1ZMVA 2I1MA 2WQNA 4YPDA 5IF1A 5HCXA 3G9LX 2J0MB 4K0YA 3E5NA 1RJBA 3QWJA 2SCUB 4FSMA 2GQSA 3TNWA 4RA5A 5HKMA 3G6HA 3ZXTA 1MUOA 4UWYA 2CGWA 1IAJA 2OGVA 5D12A 4EJ7A 5LCJA 2GFSA 2JDTA 4BGGA 3KA0A 1M52A 2YCQA 1PYXA 3NUSA 1WBSA 2WTJA 4IWQA 4YR8A 4MNFA 4ZSGA 1XH7A 3POOA 4PMSA 4FSNA 5AV2A 4AFJA 4IAIA 4NM5A 3QTSA 1YHWA 4FE2A 2XKFA 4D1XA 4AE9A 2WMQA 3DKCA 3F3UA 5F20A 2UZTA 4I55F 3FC1X 2XCKA 3ROCA 5E1EA 4AFEA 3NPCA 3E63A 2PVMA 4O0SA 3L1SA 5M51A 3GVUA 3T9TA 3BHVA 1XQZA 3BV3A 1BYGA 3GC8A 3LOKA 4DCEA 4ASDA 5HCYA 4M3QA 5KZIA 4GK4A 1UVRA 4QT1A 4BTKA 2FP4B 1NXKA 2W4KA 3NCGA 3AD5A 5KZ0A 3EQHA 4D5KA 4ANQA 3L9PA 5TKDA 2XA4A 4AOTA 4DBNA 4ZI7F 4AOJA 4O83A 4FIEA 5E9EA 1PJKA 3ZXZA 2WQBA 1H24A 3UIXA 1UU3A 1OBGA 4H36A 4BVUA 3AD6A 4YTIA 5K4IA 4O0YA 2JIIA 4IB5A 2CGXA 3DZOA 3Q4CA 3R1SA 2FPPB 3QD2B 4O96A 3CC6A 2O64A 5JFWA 1SM2A 4XOZA 3ZLYA 4IANA 2W4OA 4FKRA 1OZ1A 1IA9A 1M14A 2QOHA 4C35A 4EBWA 3PXRA 5DEWA 2R3FA 4YJ3F 2VO7A 4FVPA 4Y73A 2ZV7A 4QP9A 1UV5A 3OUNB 4NFMA 3FLYA 2SRCA 2QOQA 2JGZA 3SOCA 5HNBA 5M44A 4U7ZA 2EXMA 4OTFA 3RAHA 2ZOQA 2B52A 2PUNA 1O6KA 4PDPA 3RP9A 4G3FA 3QRTA 4OR5A 5E92A 4CXAA 3U87A 5L2WA 4FSQA 4EKKA 5EI8A 3H9RA 5A54A 3FZOA 3IGOA 3F66A 3PE1A 3CTQA 1OUKA 4C3PA 3B8QA 2EWAA 4J97A 4FFPA 3GC0A 2VTAA 1YVJA 4LM5A 3RUPA 3RTPA 3UNJA 4BCHA 3D5XA 5KUPA 3EIDA 4AGWA 5EHOA 5JGDA 5HV6A 4YSMA 5A4QA 2JKMA 3CY2A 4NL0A 4EHEA 4IADA 4F0IA 3EQFA 3IDCA 4G2FA 3K5IA 4FTTA 4U0IA 3QRIA 2W1ZA 4BCPA 2IZTA 3DOGA 4OTHA 4R1YA 2X0SA 3GCVA 4QP6A 3DXQA 3UE4A 3A7JA 4RC4A 3E3PA 1U5RA 3P08A 3R5HA 4WNOA 1UNHA 4QP7A 3ODYX 4MXAA 2PMIA 4QYGA 3RV4A 2UW3A 2WOUA 1BKXA 4J96A 3FV8A 4U44A 5TR6A 3V5JA 3FMKA 3QCYA 2XNBA 3DAEA 5BVKA 3N4VA 5L2SA 2J50A 4K1BA 3G9NA 2B9IA 3HUBA 4O7WA 3SA0A 4MNEA 4ZEGA 5BUJA 3C13A 2V7AA 4Y72A 5AAEA 5IU2A 3PWDA 5GINE 2WMAA 3TNIA 4M9UA 2NO3A 4OUCA 5CSXA 3Q52A 2ITWA 4QYHA 1JPAA 4UXLA 5KE0A 5BUEA 4FTUA 2WYOA 3BGQA 5DMXA 3WZEA 3WO1A 2WU6A 4L01A 1KWPA 4MEDA 1O6YA 3Q60A 4N0SA 4NW6A 5A4LA 2DWCA 4J53A 2ZV2A 3CQEA 5AIKA 3R21A 4CFMA 3TIZA 4PP9A 2A1AB 2HY81 4O7YA 4DAWA 3D9VA 4QSHA 2W5HA 4QO9A 3BHYA 1A06A 4YJUA 4PTGA 1SCUB 4QMLA 5LXTF 1I44A 5AV1A 3HLLA 4AT4A 3TTJA 3H0YA 5C8KA 1JSVA 4DGOA 4RG0A 5M4FA 4GUEA 2XRUA 3R7VA 3VHEA 2CKOA 4AU8A 4EUUA 5GIOE 3FHIA 4JRNA 1JDEA 2OH0E 2PZPA 2JAMA 5C9CA 3UC3A 3P4KA 2XK3A 3QGWA 3W2QA 4B4LA 3RM7A 4J98A 4LRMA 5CSWA 4A9RA 2C5XA 4FSUA 4AZVA 3Q32A 4MV8A 4J1RA 4YC6A 5L6WL 4UEUA 3NAYA 3O8PA 3HAVA 2CNQA 4X3JA 2XP2A 1QPCA 4YBJA 1AUXA 2WOTA 4R7BA 3T8OA 1IRKA 3PXQA 4IAYA 3QFFA 3QA8A 3EWHA 3ZZEA 5TF9A 2I0EA 3U9SA 3W2OA 2I8CA 1WBWA 2HIWA 2BR1A 4IBMA 1SNUA 4YJQA 2IW9A 4B8MA 5HNIX 1CMKE 3ZO2A 1ZXEA 3I4BA 4LL0A 2CCHA 4DT9A 4L9IA 4YTFA 4F65A 3GENA 2Y8OA 3HV7A 3TDWA 5E7RA 2WD1A 2UW4A 3E8DA 2VWUA 5L6OA 2F57A 4H39A 4PL3A 4U43A 3SG8A 4RIYB 4MV9A 3FY2A 1REJA 4FFNA 4X6RA 5BVOA 2VUWA 4DEAA 5EYDA 4YSJA 3QKMA 5IQBA 4MV3A 4AOIA 3R5FA 2WQMA 3WO0A 1B39A 4RIOA 5EKNA 1V0PA 5EYMA 4C5BA 1W96A 3VBXA 5CAOA 2RFSA 3BE2A 1OECA 5KKRC 4MD8E 2BVAA 1I09A 2PWLA 4FG8A 4FSZA 4II5A 2CHLA 4KNBA 2VWWA 5CLPA 5KKNB 5LYJF 2VTLA 2ITYA 5HE2A 3QHRA 2WIPA 3KB7A 4FTOA 2GCDA 5JQ8A 4BCKA 3ZRLA 1Q8UA 3OCGA 3HEGA 4TWNA 3M2WA 4IB3A 4ERWA 4FTNA 4J99A 1W8CA 2X6EA 3C0GA 2H34A 3HA6A 4X2NA 3TJCA 4UB7A 4PMPA 4GIHA 2NU6B 2W1DA 1H0VA 4QYEA 3QAME 3RPVA 3R9RA 3C5UA 3ORKA 2Y4IC 4K6ZA 2WFYA 3LJ1A 5CQUA 2ZM1A 3DKOA 3VPCA 5KKRB 3R00A 1H1RA 3THBA 3QWKA 4ITJA 4Z16A 2W70A 3MVLA 4OTRA 2CNUA 3UG1A 5KHXA 1GSOA 3BPRA 2Z7QA 4EWQA 2R87A 4O0VA 3NIEA 4O82A 2RKUA 5CU4A 5EKOA 5FM3A 4BGHA 4EOOA 2BDFA 3UOKA 2E9UA 4CFVA 4O4LF 4JQ8A 1KJQA 2PUPA 4MXOA 3FXWA 3DDPA 4R1VA 5AUUA 4QP3A 1NT2A 4LGHA 4LL5A 2QR8A 3R73A 1YXTA 3F61A 1KEEA 3KC3A 5D7AA 3OWJA 3E87A 3W2SA 2E9NA 5AADA 1KC7A 4ZTNA 2C6DA 5ETFA 5E91A 3G0EA 3NCZA 3P23A 2OJJA 2XK9A 4OT6A 5CASA 4WRSA 4FIJA 4HOKA 4EC8A 3DQXA 5LMAA 5KMMA 1LEWA 2C5VA 3EB0A 3OMVA 4BTMA 1AUVA 4KINA 4H3BA 2OF4A 4RT7A 1CDKA 3HV3A 4UWBA 3PUPA 5DVRA 2W06A 3RAWA 3S3IA 3VBTA 4A07A 2NU8B 1PX2A 2QNJA 3G2FA 2YERA 3RPSA 4A9YA 4EH4A 4AN3A 4X3FA 1KUTA 1Y8YA 4CCUA 3KVWA 2PE1A 4HNFA 2PZRA 2A4LA 3O8UA 4PL5A 4HVGA 4X3FC 4A7CA 1BXRA 3RV3A 3M1SA 2UV2A 4I5MA 2QOOA 1R0EA 2F9GA 3I7CA 4GFOA 1KV2A 4MQ1A 2R64A 4JG7A 4Y83A 3R7IA 2XKCA 3EYHA 3MFUA 2NU7B 2IJMA 1K2PA 4CSVA 3RINA 3BE9A 3LJ2A 4CZUA 5F9EA 3EN4A 4ZTRA 2OZAA 3KF7A 3CXWA 4NCTC 2C6OA 4JBVA 5JZNA 4OW8A 4YLLA 4ZTHA 3E8NA 5DR9A 3PE2A 1DV2A 5ETIA 3DY7A 3MTFA 4L53A 3Q6WA 3V8WA 3HMIA 2UW6A 5EDPA 4D0XA 4J8MA 4E4NA 2BZHB 2YZAA 3NW5A 4FTAA 4U41A 4C34A 1BL6A 4DLIA 4LFIA 4WBNF 1GJOA 3F9NA 3M11A 4GK3A 4M12A 3AT3A 3MWUA 3VC4A 2Z7SA 1G8AA 2I7QA 2JFLA 2UZNA 5BVFA 1NY3A 2E9OA 5KX8A 3OG7A 4F09A 2R3HA 2HYYA 1F3MC 4GCJA 4WUNA 1U5QA 2YITA 4JRVA 2C6IA 4ANBA 4D4VA 5LP6F 5ANIA 4Y5HA 2XYUA 5I9UA 1EH4A 3GBZA 3V5TA 1H1PA 3O96A 3LW0A 3VJNA 2EB3A 3FQEA 2XK8A 3V5QA 4D2SA 4AT3A 3KMMA 2XCHA 3MH0A 2GS7A 5AV3A 2YIRA 2Z60A 2A19B 5DA3A 4XUFA 3W18A 5JRQA 2JBOA 5AFVA 4RWLA 4E5BA 4WG3A 4OTQA 4PWNA 5BYLA 4CFXA 2QO9A 3BX5A 1ZOHA 4I20A 4D4YA 4ZS0A 5HG7A 5HQ0A 5B2KA 2FSMX 2V59A 1M7QA 2RG6A 3FYJX 4WG5A 1DM2A 3D5VA 3JPVA 4ZSLA 3R23A 5H8EA 2PVPA 3DXNA 2WQOA 3P9JA 4FKVA 4XP3A 2UW9A 3E8EA 3LCKA 3WF5A 5HVYA 3TUBA 5L2TA 3SOAA 2X2LA 3IECA 3LFAA 3OOGA 2ITVA 4IDVA 5AMNA 4IQ6A 4O2ZA 3ZDUA 4QMOA 4BCIA 4BI0A 2YW2A 3NUNA 4MAOA 3UTOA 4DFZE 3DS6A 5IA5A 4UN0C 3KF4A 3V6RA 3OC1A 4KKHA 5E8TA 2DS1A 4HPUE 5L2IA 2G2FA 4RJ4A 4C4HA 4CCBA 4C0TA 5D41A 3VW8A 5IG1A 3BELA 3MW1A 3TIIA 5GJFA 5LMKC 2OXDA 3OEZA 1G3NA 5IUHA 2A27A 2W6QA 3MIYA 4GV1A 5JT2A 3D7ZA 3T3VA 2W17A 5JKGA 4QMYA 2IWIA 4C59A 2R84A 1XKKA 5J5SA 2JEDA 3G33A 2VTSA 3MV5A 4FV2A 4FX3A 3Q4ZA 4MWHA 4XG9A 2ONLA 2VWIA 5AIRA 4FBXA 4C62A 4YBZB 2FYSA 3KN6A 5ACBC 4FKIA 4MQ2A 2R3MA 4O7ZA 4QMPA 3TZ7A 2XNGA 1DAWA 1NVQA 2YWVA 5DI1A 4M0YA 4E6AA 4FZ6A 2C3IB 1Q99A 4GEOA 4R3CA 3ZSHA 3S2PA 3NX8A 4F9AA 3FHRA 3V5PA 2ZDTA 5M4UA 2P3GX 4NKAA 5AP5A 3SQQA 2R3IA 1URCA 4XRJA 4F4PA 3TV7A 1W7HA 1DAYA 3MESA 4FOBA 4GW8A 4AN2A 4YJPA 4HZRA 5FQDC 3OY3A 1SVEA 4APPA 3VBVA 2YEXA 3BCEA 3PVGA 5LA6F 4YNEA 2VN9A 1H1SA 1WZYA 3C0HA 5IA0A 3DBFA 1GZOA 1KE7A 3FXZA 3FMJA 3W16A 2W6MA 4BYIA 2NRYA 3BLRA 1YHVA 3NUXA 4GYGA 5AV4A 1H01A 3BHTA 2OLCA 3MJ2A 2VZ6A 3CGFA 2WZJA 2HZIA 4I21A 3CE3A 4C2VA 4EZ3A 2HZ0A 1JDBB 1SMHA 1MP8A 2IPXA 2OIQA 2PMOX 4FG9A 3JR1A 1WVXA 4AZEA 4HGTA 2XNOA 3S95A 3GI3A 3IGGA 3HA8A 5IA3A 1Z2OX 4KAOA 4MBIA 4BDIA 1J7LA 4YHJA 5IQGA 2F7ZE 3DNEA 3FMNA 2PN1A 3SW4A 2R82A 3ODZX 4XG8A 1YOMA 1IG1A 2VO0A 2YHVA 2X7OA 2G01A 3QX2A 4IVAA 5LARA 3W33A 1IOVA 4I41A 2WU7A 4QMTA 3GFWA 1QPDA 4DITA 3A7FA 1QPJA 2E9VA 4XRLA 1DV1A 5D11A 3IW5A 2H96A 4I6BA 4LOQA 5BPHA 3NWWA 4IIRA 4TL0A 1YXUA 3PXZA 4D1SA 3LMGA 4BBMA 4MBJA 4ZIMA 2F7XE 2EVAA 2PVJA 4W4WA 4TWCA 4FKUA 5EDQA 5I9WA 2RGPA 4EH6A 4EK6A 3QTWA 2NU9B 4OTDA 4Q9ZA 3QKLA 3ZOSA 3F7ZA 3Q4TA 3A61A 3PSCA 3QRJA 2PVHA 5DPVA 3OT8A 2WTWA 4UX9A 4JDJA 1WBNA 2ITOA 5IMEA 1BX6A 4EOPA 2VTMA 3KRJA 4X2JA 4BTJA 1MRYA 3UMWA 5EW3A 3RPRA 2QONA 5KMLA 3PXKA 3DGKA 4I1ZA 4I92A 4U5JA 4YTHA 5FBOA 3ZSIA 4CGAA 3SXRA 1REKA 4RQVA 2QLQA 3COHA 5HX8A 5AA9A 4JDKA 4EGQA 2ZYBA 1W82A 1Q24A 4G3DA 4FEXA 5FD2A 3VBQA 4EQCA 4XHKB 1G8SA 5BMMA 2YJRA 4EORA 4E6DA 1XH9A 2GNLA 3AT2A 3AXWA 3CPCA 2OJFE 3R1NA 4I6QA 1PXOA 2YS6A 3UP2A 1OGUA 2ZAZA 4FKSA 1PHKA 4GFGA 3ZEPA 3MTLA 2O3PA 3I0QA
chains in the Genus database with same CATH superfamily
4I94A 4RQKA 1PMUA 5DE2A 2R3OA 4H3PA 4IWOA 1FVVA 4JLCA 3ANRA 4TY1A 3MWDA 4R7IA 3LFDA 3OROA 4G34A 4DTAA 3PRIA 2HJWA 5BYBA 4CD0A 4RWJA 3Q9XA 2J0IA 1X8BA 1PYEA 3U55A 3KXXA 3F2NA 2I87A 1KE6A 3SW7A 3CJGA 3COIA 4JQ7A 5CE8A 5IZFA 5BVWA 2C30A 2JFMA 4MXCA 4FNWA 2R5TA 5FXSA 3MDYA 3NNVA 3W2CA 3KRWA 5EHYA 5IUGA 4MV6A 3CTJA 4GT4A 3NYVA 4BDHA 4CKRA 5IEYA 3D94A 3WILA 3KULB 4AUAA 2FPIB 1PY5A 1CKNA 4E5WA 3VS4A 4BCFA 2QU5A 4C4JA 2I40A 3VVHA 1Z2NX 5IUIA 4ITIA 4PDOA 3WWJA 4CZTA 4F7LA 4AE6A 2XIXA 4CMOA 1G8JA 3VS3A 2EUFB 2QVSE 4AQCA 3NBYB 3OHTA 4ZQIA 3F6XA 3EKKA 3N8DA 2FO0A 2IVUA 4GSBA 2CNVA 2BAKA 1LUFA 4CMTA 4CG8A 4DEIA 4CHIA 4FL2A 4IWPA 1ZOEA 3ATTA 3S4QA 3FZTA 4ARKA 2Z7RA 2CN8A 5AJQA 3AGMA 1KTAA 3W1FA 1H08A 1ST0A 5CS6A 3RHXA 1WBOA 1NVSA 4MA0A 1OL7A 3UVRA 2VTRA 5ANDA 4TWOA 3U9CA 3P0MA 4FT0A 3W1BA 4K6NA 3HAMA 3G5DA 4O38A 3F5XA 2QKWB 4S32A 3DNDA 3GLKA 1G5SA 1GY3A 3MVMA 4KIOA 3RCDA 1IA8A 5AP3A 4A4OA 4DA5A 4WSYA 4RIXB 1P5EA 1AGWA 3CSWA 5EFQA 4FI1A 3BWJA 3W1GA 5JEBA 1NW1A 4ZLOA 1P2AA 4RGJA 2W6NA 2ESMA 2ZMCA 2J51A 3NGAA 4G6NA 3TKUA 3PP1A 4DINA 5C1PA 4KIPA 2UZDA 3P78A 3PJCA 4E4LA 3SRVB 5KMOA 4MXXA 4ZY5A 4AX8A 4KSPA 5IDPA 1CQJB 5KX5F 4FZDB 4WNMA 3GCSA 3NNWA 3RM6A 2XS0A 2ACXA 2YA9A 5CNNA 5HO8A 5C8MA 3VBYA 3O71A 4D58A 1KE9A 3T9EA 4IC7A 1VJYA 2C0OA 1MRUA 2X1NA 3S0OA 4U9AA 5IH4A 3B2TA 3FEGA 4BYJA 5BWXA 2YDKA 1JKJB 2QC6A 5HE0A 3WZUA 5HBRB 4NM3A 1Y8GA 2V58A 4L00A 1YWVA 5A4CA 5D1OA 1R1WA 3RHKA 3DK6A 3HECA 3ZO3A 3LFNA 3AMYA 3FLSA 4YLJA 5HO7A 3HB9A 4W4YA 3VPDA 1JSTA 3LLAA 3G51A 3HL7A 3U4WA 4AACA 5KMNA 2NYAA 1TQMA 1ZYDA 4ZSAA 5JFXA 3BQRA 1A9UA 1VYZA 3E93A 1YOJA 3WZJA 4DFNA 3ERKA 1ZLTA 5J8IA 4C4FA 4QMNA 5BVNA 2CPKE 3EN6A 2ZVAA 1B38A 1K9AA 4QMXA 2C6LA 4YZNA 3TW7A 3FLWA 3R2YA 3VS0A 1CKOA 3EFWA 4HGEA 4NSTA 4EOQA 1DIKA 3H9OA 3EMGA 2WEVA 3LM0A 4FKWA 2H8HA 3K2LA 3BLHA 4O0WA 4AA0A 4E4MA 3T9FA 3Q9WA 4O6LA 4O91A 3JYAA 1PXNA 2X2KA 4CKEA 1LP4A 1V0OA 4FC0A 1JLLB 5DGIA 5DT3A 3LXLA 4FV1A 5FG8A 5A3XA 4CFUA 4Y95A 3PJ1A 3E8CA 3GU7A 4RSSA 4IX5A 1ZZLA 2ZMDA 4OBQA 3RCJA 3DTCA 2B7AA 3GNIB 2WTCA 4UALA 4F9BA 2BKKA 2ERKA 4QDEA 3DK7A 4NT4A 3SHEA 5D1PA 3QUDA 2YACA 1IASA 1LPUA 2COIA 2XKEA 3NBZB 2G9XA 3QXPA 4D2RA 2HIXA 3QLGA 4ANSA 4I4TF 1P4FA 4Y46A 3HMOA 3UDSA 4H3QA 2VGPA 4F99A 4L6QA 5HU3A 1P14A 3H30A 3U6JA 4KB8A 4G5JA 3DT1A 3CQUA 3IDPA 3ZZWA 4I0TA 2IZSA 4F6WA 4H1JA 2WMUA 4M0ZA 4NJ3A 4TWPA 3N4UA 5IQAA 3CP9A 4G6LA 3GQLA 4OTWA 4X3FB 2UVXA 4K2RA 3SGCA 4RX7A 3TZ9A 2HGSA 3HRBA 4ANMA 3TQTA 3CIKA 3HUCA 5HD7A 3HT5A 3ENHA 2P55A 3DBCA 3PIYA 2HXLA 2C0IA 2VD5A 3LFSA 4JS8A 3GQIA 2YN8A 3AT4A 3BQCA 1I2KA 3VRZA 2HZ4A 3QD3A 4IHPA 3D0EA 4MV1A 3UC4A 4FTQA 4TW9A 3ZFMA 1ZY5A 4YURA 4BDEA 3HDMA 2I0HA 2QG7A 4EQMA 3VO3A 3DB6A 1EYZA 3TJDA 3SKCA 4YLKA 4C4IA 3CS9A 3OZ6A 4BF2A 2XKDA 4O21A 3FC2A 3AC1A 4C3RA 4U45A 4YJ2F 3I79A 4CMFA 4I5PA 2BKZA 4EQUA 1H07A 2QQ7A 4MF1A 2VQDA 1PKDA 4V01A 3JVSA 4YO6A 5DLSA 3E92A 4G6OA 2ITNA 2DUVA 3LE6A 4A4XA 3F82A 2QCSA 5CI7A 4A4LA 3MSSA 3CKXA 5T6KA 4KBAA 5M08A 4KBCA 5C01A 3D2KA 4WBBB 3RJCA 2P0AA 2BALA 1M0TA 3VAPA 2W1CA 3EQPA 4ENXA 2B54A 2GSFA 4QQCA 4IVCA 5HHWA 3C7QA 2A2AA 2UVYA 3KN5A 4WRGA 3BYMA 3R83A 4QMQA 5FBNC 4QYYA 4S34A 3PP0A 1CKJA 4XNEA 3TNPC 4EOLA 3VOTA 3GGFA 3AGLA 4AN9A 3UO4A 2GQGA 2VO3A 2W1HA 3A62A 3AD4A 4APCA 1VS0A 3T9CA 2OIBA 3IOPA 4BC6A 2XANA 3UQ8A 1PXIA 4ERKA 3JXWA 4CKBA 4O7TA 3LFBA 5ANKA 4RMZA 4WNKA 3F3ZA 1NVRA 3FMHA 4RJ8A 3VNNA 3LULA 2YS7A 4BRXA 3A8XA 2YIWA 3R0TA 5M4CA 4ZS4A 2BRNA 3P7BA 2GDOA 5HBHA 4PZ7A 3QUPA 2R3RA 4AA4A 3H9FA 3MPMA 3ZC6A 4DHFA 2PUUA 3NW7A 4IZYA 4ASEA 3NC0B 1ZYJA 4ZHQF 4BZNA 4BCJA 5DOSA 3H3CA 4F6SA 5HBJA 5BUIA 1XHAA 1H25A 4DFLA 3PJ8A 4USEA 3RWQA 4CKJA 2V5QA 5CZIA 3KXGA 4O81A 3JZ6A 3ANQA 3FZ1A 5EI2A 4BDFA 3PLAE 3DXPA 3OXTA 3F2RA 3MI9A 3UNZA 4EYMA 2PZ5A 3GIDA 3VMMA 3OWKA 3O50A 4CC5A 3FMLA 4E6QA 2QURA 3Q9YA 3V51A 4AZFA 4ZLZA 1I2LA 1OM1A 3ETHA 4WT6A 1MQBA 2FSLX 5J87A 5TOZA 3VUDA 4O2AF 4IH8A 1E1VA 2VU3A 1FOTA 1JKSA 2GQRA 2IO6A 3VHKA 1GAGA 2JAVA 3K3JA 2C47A 2RFDA 3FI3A 1JWHA 4JBQA 1S68A 3GDEA 5JVLA 2VTPA 4F0FA 1Q61A 4HNTA 1JLUE 4MWIA 3HV5A 4NKSA 3RPOA 2YYAA 3ZH8A 3ORRA 2HAKA 3VPBA 3I5ZA 4BDCA 4C38A 4MHAA 4LYNA 4QYFA 5DIAA 2E9PA 3QTIA 4MNEB 3WYXA 4F70A 5JQGF 4X21A 1OVEA 2GHGA 3BEGA 3GOPA 3PXYA 2DZDA 5E25A 4Z7HA 4FV8A 2BHEA 2VNYA 3Q96A 5KMIA 2VUGA 4U79A 5H2UA 1AD5A 2C1BA 3VS1A 5CSHA 3KEXA 3KRRA 2UW0A 5AP6A 4C5AA 5LVPA 3CJFA 2VTHA 3MVHA 3WYYA 2B0QA 3ZUUA 1H1QA 4DF3A 3TUCA 3QL8A 5M07A 2QOBA 3TV4A 5DAAA 2GS2A 4Q9SA 2X4ZA 3GCPA 4U6RA 5DEYA 3NAXA 1Y91A 2JDOA 4L68A 3HP2A 1OKYA 2BROA 4TNDA 4IM0A 2ZV8A 3SE7A 4HYHA 4BI1A 3R01A 2OG8A 3HNGA 3KRLA 2WTVA 4IAFA 3TTIA 4ACMA 3PY0A 1ZARA 3RR5A 3UVPA 1IAHA 4TN6A 3TKHA 1HOWA 1H0WA 4U3ZA 2B53A 2VPQA 5CEQA 3NEWA 4IMYA 1JNKA 2QKRA 4HGSA 4CNHA 4EWHA 3UQGA 3QZFA 5BWUA 4FYOA 4LH6A 3FLNC 2R3KA 3ORNA 1WFCA 2OFUA 2Q0NA 3ZFXA 4Q2AA 1VR2A 3V04A 4DYMA 1G2WA 3E88A 3IPHA 3OTVA 2OWBA 5L8LA 5A6OA 5J9ZA 3E5AA 4UBAA 4FV4A 4BHZA 5CU2A 1DS5A 2NRUA 2QOFA 5B2LA 5CT7A 2UZWE 3HYHA 2G2IA 3DFAA 2VTIA 4QDVA 5CT0A 2UVZA 1H1WA 2JLDA 3C4WA 4CMUA 4EH2A 1CS0A 3RWPA 2OI4X 5CU3A 3SX9A 3LCDA 4B99A 1YWNA 1OIUA 3A4OX 2VWXA 2GLTA 4NZMA 2PZIA 4FTIA 3FI4A 4CFWA 2IVSA 4PQNA 3LMIA 3VA7A 3QKKA 3HMMA 3AG9A 1BI7A 3U8WA 3TEKA 5DRDA 4AZTA 3QQJA 2P2IA 4O7LA 5KMKA 1ZMUA 4O0RA 4P5QA 5CXHA 2C5YA 3IS5A 3H0ZA 4UXQA 3I6WA 3OD6X 4MV7A 2ETRA 2XF0A 2JIUA 3UDTA 5KS8A 2BFXA 4WOVA 5LJJA 3LHJA 1S9JA 3EFKA 2C0TA 2DYLA 3OUZA 4IJPA 3IW8A 4PNIA 2PVRA 3EL8A 2GNFA 4RVKA 3DKGA 5BPFA 3JS2A 4G9RA 1PK8A 4QMWA 3HDNA 2OWOA 4FU0A 5E8VA 2DABA 3ZBFA 2W4JA 4QMSA 4FSYA 3OBGA 1VYWA 3RAKA 1BI8A 3NNUA 3LXKA 3P7AA 1Q41A 3UYTA 2W6OA 4FNZA 4FEWA 3TKIA 3M42A 1F0QA 3OP5A 3BU6A 4GT3A 2UZUE 4AQKA 4RPVA 3ORTA 3RMFA 5C1OA 1MRVA 4KA3A 4E8AA 1L8TA 3D7TB 4AGUA 1YXSA 3W0OA 1YOLA 2A0CX 1FVRA 3QQLA 2WNTA 3FL4A 4JG8A 4IW0A 2X8DA 3FJQE 5IQEA 3QTRA 3W2RA 1CQIB 3MS9A 2BTRA 3C51A 4KRDA 1XH4A 1IYEA 4I5HA 5ITAA 1W83A 4DHZA 4DH8A 4EOIA 2VR1A 4JX3A 4IACA 4B7TA 4XZ3B 4FIGA 4FKTA 2UZVA 4JDIA 4QNAA 3VJOA 5K5XA 4F63A 2HELA 2BMCA 4TZRA 3EN7A 5CX9A 4EBVA 3JRWA 1E9HA 3MH3A 3KAKA 4NZNA 1W84A 4L1KA 4RCNA 3WE4A 1UKIA 3DAJA 2OXXA 1STCE 3TNQB 1C3OA 4IX6A 4ZK5A 1YDTE 4F0GA 3UNKA 1S9IA 5FDXA 4FZ7A 1FMKA 5IISA 4O4HF 1YKRA 2FSOX 3R22A 5DYJA 4FZFB 2R0IA 3W2PA 2BCJA 3KMUA 2IVTA 3PIXA 3W0NA 1QMZA 4D4RA 3VUIA 3C50A 2HDKA 2QF7A 2BZKB 1BLXA 1TFFA 2JDVA 5IDNA 4QP1A 5IPJA 3EQDA 4BDDA 2W6ZA 5DFPA 4A9TA 4AXEA 1C30A 2QOIA 3VUHA 4A06A 2HWPA 4XMOA 5KHWA 4QTAA 2XCLA 2X81A 3IG7A 5FEDA 4FIIA 2X7GA 2YCRA 1RDQE 3A7HA 3MFRA 3PTGA 4CEGA 5ACKA 2GS6A 4O7RA 1APME 1E1XA 4EH3A 3D2IA 3WF6A 3H4JA 4ZY4A 1Q62A 3HBLA 2F2UA 4F7SA 5IEVA 1KT8A 4DEBA 2JD5A 3ITZA 2ZFYA 4G31A 4LQMA 4JNWA 4ZJJA 4C02A 3TIYA 5K2MA 4E26A 5H8GA 3RK9A 3TWJA 3IKAA 1QPEA 4FR4A 5A6NA 4YZ9A 1KE5A 2KULA 2J6MA 2C00A 4K8AA 4R7HA 4YZBA 3NRMA 2V5AA 5D1OB 4HJOA 3VULA 2PHKA 5FTQA 2OICA 4HCTA 2GHLA 2CJMA 5F95A 5FP5A 3C4XA 3TMOA 3QTZA 2VX1A 4Y8VB 5HTCA 3MGYA 4ORKA 5IA1A 4EGJA 3FPQA 4JMQA 3VS6A 2R3LA 2VX3A 2VNWA 4RJ5A 3CSVA 4PMTA 4A9UA 2QI8A 2QHMA 4PP7A 3MPTA 3DJ7A 5FUTA 3ZBXA 4TYIA 4UCVA 3PLSA 4X2GA 5LCKA 4E6NA 3RPYA 3QZHA 5HZNA 5HIEA 1OKWA 1CE8A 1XO2B 5CXZA 3TY5A 1M2QA 4ZSJA 3W8LA 4YMJA 5ETCA 1Y6BA 3AC5A 4ZTLA 2XJ1A 4XV2A 3MIAA 4RX9A 3BA9A 2X9FA 1E4EB 3MN3A 2H6DA 1FPUA 3NDMA 2WIHA 3NMUF 2G1TA 1J1BA 4QTBA 4EEVA 2C6TA 5KCVA 4FV0A 5CEMA 5CENA 1SNXA 4UWCA 3VS5A 3DBEA 2QD9A 1KJJA 2P4IA 5E8YA 3NUAA 3LFQA 3UYSA 4MKCA 3CTHA 1Z2PX 1DI8A 2XBAA 3DF7A 3DJ6A 4V0GB 2PSQA 4YUQA 4FICA 3UIBA 5K4JA 3B8RA 2ZM3A 2XRWA 4EQ5A 4KIQA 3H10A 2C5OA 3PFQA 1WMKA 4ASZA 3KXNA 3QLFA 3L8XA 2HVRA 3OWLA 2QU6A 3FZPA 5EQPA 4RJ7A 4HVSA 5CR5A 3R2BA 3PY1A 4FFRA 4IAAA 2P2HA 3TDVA 2GNHA 1VBGA 4FTKA 4XLIA 2Q83A 3EQIA 1Q8ZA 4L44A 2VWBA 3QYWA 4RVTA 2Y6MA 1ZYCA 2V7OA 4DN5A 3DU8A 5F4NA 1OUYA 1O9UA 3OXIA 5EYCA 2WMSA 2CKEA 3CLYA 3QRKA 4FVRA 4G3GA 4IDTA 4JOAA 4TTHB 4LV7A 1JOWB 2CN5A 3A4PA 4JI9A 3GFEA 3VONA 1CKIA 1ZRZA 5CF4A 3LQ8A 1X9NA 4DLJA 2OSCA 2I80A 4GH2A 1ZYLA 5ETAA 4CT2A 3ET7A 2WAJA 4MD7E 1WBTA 3TEIA 3BG5A 4MX9A 1MQ4A 4L42A 4PBCA 3KK8A 4EK4A 4RFMA 1IR3A 3OUUA 3WF7A 4TV8F 2Y0AA 4BDGA 3FSKA 4FSRA 2AUHA 2ZV9A 3FDNA 1ZZ2A 3LLTA 4NJDA 3F69A 4DGMA 4GS6A 4FL1A 5EM6A 2FB9A 2EB2A 2ITUA 4LRKA 3SGIA 3CPBA 3QGYA 1Q8TA 2OH4A 4L3PA 4O22A 2P33A 4HPTE 4ZMFA 1V9PA 3P5KA 4O0UA 3MWEA 2O65A 2HCKA 3OXZA 4FTLA 4QNYA 3ZU7A 3QD0A 3UOJA 2HY0A 3C4CA 2XNEA 3QX4A 5E90A 3SVVA 1L3RE 4WHZA 3QXOA 2CKPA 5HNEA 2RF9A 3FSFA 3ULZA 5A4EA 4EKLA 3RK5A 4AP7A 4TYGA 2R3QA 1J7IA 2WTKC 1GGOA 4WUAA 3HRFA 3CEKA 5B2MA 5IMXA 5FGKA 2OU7A 2W7XA 5T68A 4XV3A 2IW8A 5C8YF 3OOMA 4I93A 3DKFA 4R5YA 4YZMA 1A0IA 2XIZA 1BUHA 4U8ZA 1JQHA 2BAJA 4RIWA 1UU9A 4TT7A 3KXZA 5HICA 3KCFA 3LQ5A 4JQEA 2W1GA 1PF8A 3TACA 2AEGA 4GU6A 4NFNA 3C4EA 1PKGA 2PE2A 3UPXA 5HTBA 4LGGA 3R9OA 2JBPA 3QQMA 3TXOA 3ORPA 5AX9A 2IP4A 1WR2A 2XUUA 4I6LA 2PL0A 4AZWA 4NH1A 3UZTA 4RZWA 1EUDB 3KAJA 4MH7A 3QQFA 4C37A 4QRCA 3HKOA 3AX6A 5J2UF 5HNGA 2IVVA 5I5XA 1GIIA 2IW6A 2RFEA 4KSQA 4YJOA 3HRCA 3WIKA 4ASXA 2R85A 4YAKB 2BDJA 5CVFA 4MVFA 3SDJA 4C36A 5AM6A 3AKJA 1R39A 3O23A 3BACA 4HVHA 4EH7A 3RALA 5M09A 3FPMA 1XJDA 2AC3A 3HV4A 1B6SA 2CFMA 2PY3A 1W93A 5C26A 4IVDA 3EFJA 3ENMA 5DHJA 4AT5A 1YDRE 5I0BA 5I4NA 3R71A 3UYYA 4PRJA 4QTDA 4FYNA 2W0JA 4YO4A 3PUFC 5AV0A 1XK5A 3D5UA 1FBNA 3EN9A 3R7EA 1H27A 4O0TA 1WCCA 3JY0A 5EM7A 4F7JA 4IIJF 3GU4A 3RVGA 4OTIA 3VNTA 5DNRA 3UQFA 1OIYA 5CA0F 5EQYA 4YHFA 2F49A 4I6FA 5E8ZA 3ZCLA 5CY3A 2CSNA 5CA1F 4JG6A 4CTCA 3NNXA 1FVIA 5C8NA 3WF8A 1OL5A 2PVNA 2R0UA 2YAKA 3ORMA 4AS0A 4BCQA 1VKZA 3QCQA 4EK5A 3ATSA 4U81A 5CI6A 4DRFA 5J1VA 3UVQA 3JZFA 2XJ2A 3OY1A 4QMUA 3ZFYA 2XEZA 3CBLA 5K3YA 2NNWB 3E3BX 1XBAA 1U59A 2HWOA 4LI5A 2R7IA 3NZ0A 2XEYA 4FOCA 5C4KA 4O6EA 4JBPA 4L67A 3V6SA 3R8PA 3DQWA 3R9NA 1OPJA 3SXSA 2XK6A 4HYSA 3N6RA 3HMPA 1T45A 4KS8A 5CVGA 5TT7A 3SG9A 3UGCA 4L8MA 4PY1A 2BIYA 4FV5A 1U46A 5HG5A 5CAEB 3KGAA 3T9DA 4G3EA 2WMXA 3ZRMA 5HG8A 4EOKA 4DH3A 4EONA 1OL1A 5EZYF 5CF8A 1AQ1A 1Z5MA 4MTAA 4AXAA 3ZO1A 3UZBA 2FB8A 2VO6A 3QD4A 4J71A 2YL2A 2V55A 2XNNA 4EK8A 3EHAA 1URWA 4HGLA 2W1IA 2BDWA 4KRCA 4PDYA 4YJRA 3R9DA 3ORLA 3GCQA 4DDIA 4K77A 3IW7A 2HHFA 4M14A 3MYGA 3A2CA 4DQNA 3FLQA 3PJ3A 5LVNA 4LOPA 4RIYA 3VS7A 2GTNA 4XH6A 3VW6A 4AZSA 3C4FA 4NZWB 1WVWA 5GIPE 2ERZE 3W0SA 3LMHA 3POZA 4IX3A 5CEIA 5HIDA 4E20A 1OMWA 4D4SA 5K5NA 4X2FA 1PW2A 4GL9A 4NM7A 4N70A 5H3QA 2UW5A 2X0GA 2B9HA 1UWHA 2XNPA 4ZTSA 1ZOGA 4FT9A 4WKQA 2W9FB 4PX6A 4QTCA 5CU6A 4MCVA 2DLNA 2YZNA 4HYUA 4P90A 5GJGA 4L7SA 4TXCA 1A3GA 3FI8A 2ITXA 4MUQA 3RNIA 5IYZF 5HE1A 2QOLA 1I1LA 4L43A 4EOMA 5BYYA 2EIYA 3PDTA 3OVVA 4I0SA 4X2KA 1ZYSA 1GNGA 2BRMA 1HCKA 2OBJA 4IC8A 4ITHA 4C4EA 5J9LA 1A9XA 4B8LA 2EU9A 2UZEA 4H58A 4IEBA 5K9IA 3Q2OA 4LH7A 3PPZA 4F08A 4ACHA 3HVCA 3OW3A 3KULA 5F1ZA 1XR1A 4P2KA 2Z2WA 1XWSA 3F2AA 4YC3A 5AM7A 5M4IA 4C5CA 1OKZA 2PULA 4BKJA 4D9UA 4DGGA 5J9YA 3S1HA 5CAPA 1UA2A 1YXXA 3FMMA 1J1CA 4RIXA 4YPSA 4F9CA 2YWPA 4DCAA 3EN5A 5M53A 3LFCA 3BBWA 4DHIB 2HGWA 3S00A 4JX7A 4YBKA 1JSUA 4XP0A 4ZOGA 3BU5A 4FMQA 4YZDA 3TIGA 4E93A 5DWRA 2HGXA 4O0XA 2R3NA 3N9XA 2F4JA 2Y6OA 4X7QA 3P7CA 4JR7A 3VF9A 4YAJB 5EM5A 4IWYA 3AOXA 4TNBA 4ACGA 3LXPA 2GNGA 2UZOA 2XIYA 3UZPA 5CF6A 4FJVA 3TT0A 2I6LA 2JKOA 5E4HA 4CV9A 3KYHC 5CM0A 3EQCA 4BTFA 4QMMA 2JDRA 5G6VA 3OCTA 4C7TA 3E64A 1KBLA 2YM8A 3I6UA 2VX0A 3F3WA 4TKSA 4XP2A 2XM9A 1CKNB 1VEBA 2FSTX 5LMBA 4KS7A 4BBEA 4CV8A 3WI6A 2YM3A 2W5BA 2BIKB 4FA2A 4YJNA 4DFYA 4KKGA 4S30A 4D1ZA 4V05A 4RVMA 4BN1A 3E62A 3MJ1A 3PG1A 4FT5A 1FGIA 4RBLA 4WO5A 3G90X 1CKPA 5C4LA 1CM8A 3I81A 3F88A 3V5WA 3LWBA 4G1WA 3NYNA 5AUWA 4V0GA 4GYIA 3SXFA 4ENYA 4R78A 4FVQA 3UQCA 2COJA 4WHXA 2J5EA 3TZ8A 2WTKB 3COMA 2DQ7X 3Q5ZA 2R9SA 4YJTA 5JGAA 1EKFA 3RZBA 3TNHA 4E6CA 3KREA 5HEZA 2XJ0A 4QTEA 5DT0A 5EH0A 4FTCA 1M6VA 2WMVA 1W0XC 1UU8A 1KV1A 1UKHA 3HMNA 2B9FA 3U54A 4AGCA 4AW5A 4DG2E 3ORIA 2YIYA 1SVGA 3PSDA 5FTOA 4NK9A 4C3FA 4GKHA 4TUYF 4BZOA 5DG5A 3I0OA 2YCFA 3MY0A 4TYJA 3UOHA 1IOWA 4JXFA 4S2ZA 4F9YA 4DFUA 4FK3A 4I24A 3FE3A 4DLKA 5GJDA 4N6YA 3LVPA 4DEGA 4WIHA 5FPOA 5JGBA 2HVSA 4X0MA 5HLNA 3LJ0A 4MA5A 2PVFA 4UCRA 2Y9QA 4FK6A 3GC7A 1VZOA 3QF9A 5LOHA 3CGOA 1T36A 4JAIA 4DGLC 5JFVA 4UFZA 4FSTA 4XJ0A 4IM2A 4WG4A 2HZNA 4OBOA 4ALVA 4IZOA 5L8KA 2VTNA 4OGRA 4QPSA 4XOYA 3BHHA 2LAVA 2AC5A 2VTTA 3QQGA 3W0RA 4EL9A 5CU0A 1ST4A 2X39A 1YHSA 4WA9A 3PZHA 1VLRA