4O7TA

Saicar synthetase (type-2) in complex with adp, asp and tmp
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
225
Chain Sequence
AKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole-succinocarboxamide synthase
publication title SAICAR synthetase (Type-2) in complex with ADP, ASP and TMP
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 75
structure length 225
sequence length 225
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o7tA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4o7tA02
4NTSA 4O7ZA 3FL4A 4O0RA 4NJ3A 3QD0A 4FIFA 4IADA 4GYIA 4M68A 5JRQA 5AEPA 1YI6A 3F5UA 4EK4A 1CTPE 3RUPA 2JKMA 1ERKA 3BGZA 3U54A 4FKTA 3L1SA 3UMWA 1Z2NX 3EZRA 3F69A 4IAKA 4RIOA 3E8EA 4WO5A 5M4CA 5CU4A 2C00A 1J1CA 2B53A 5CU6A 4L3PA 4PV0A 5JFXA 2R3HA 2OIDA 4TYHA 5JQWA 4UBAA 5LWNA 2PVLA 5M56A 3I1AA 3PVUA 5DEWA 4BHNA 1RJBA 1JDBB 4GIIA 1VKZA 3ZBFA 4CT2A 3D94A 3GOPA 3KY2A 2UZWE 3MBLA 4E5AX 2R3OA 3LLAA 3P7AA 3DDPA 3LJ1A 3QZHA 3V5PA 3VUKA 2BRBA 1GJOA 4BVUA 4DEAA 2Z8CA 3Q4TA 3VBQA 4Q5HA 3I7BA 2CCHA 2Z2WA 4QMPA 3VJOA 3KK8A 3LFSA 2LAVA 4EK6A 2QR7A 4FOBA 4LOQA 4AN3A 4RZQA 3LZBA 3PSBA 3RM6A 1Q8WA 2WOUA 1SMHA 4DEBA 4EYMA 2PZIA 3KQ7A 5LCKA 2WMAA 5FBOA 3RI1A 2OLSA 1H00A 3FZRA 2HY0A 1VR2A 3IOPA 3I7CA 4V05A 4YZDA 5HCZA 2HXLA 1RDQE 4FSQA 4EZ5A 5BMSA 2W71A 1V1KA 5CT7A 2X0GA 2QCSA 3MH1A 4O91A 4CMUA 3OXZA 4A9UA 3O51A 5C8NA 5AP2A 5IQAA 4W8EA 1I7NA 2CGXA 3ITZA 4N0SA 5AM7A 3W8LA 3FI3A 5J9LA 4CFFA 4DGMA 4DGGA 3R8LA 1IASA 4TRLA 5DRDA 4AE9A 4E7WA 2P0CA 1W8CA 4QQ5A 4R6VA 3HA8A 5BPHA 2O5KA 3A4PA 2C6IA 3JPVA 4IEBA 4TW9A 3MFSA 4U44A 4ZP5A 4I4FA 1Z57A 3RPVA 1OITA 5I4NA 5HX6A 2X81A 2BDFA 5IA3A 1KC7A 1Q99A 2PPQA 4BDIA 5M06A 2PUIA 1SM2A 3TUDA 2W4JA 3VIDA 3UFXB 3U51A 1NA7A 4USDA 3A62A 3F2NA 4KBAA 4IVCA 4C4JA 3DAEA 4QQTA 4F7NA 4EH7A 2YACA 4EH8A 4A9RA 1NVRA 5HE2A 4AE6A 3PSDA 4F1MA 3QQGA 2VRXA 5DOSA 4H36A 4IDTA 4YGAA 2PU8A 2VWBA 4IBMA 1W83A 4ZZOA 2WMTA 2VWVA 1H07A 2GNFA 4DINA 3NVMB 4F6UA 1B39A 2WMVA 3R63A 4GJ3A 4NKAA 3FHRA 4O7YA 3D14A 4ZTSA 3ZO1A 3TIZA 3TNPC 3KRXA 1OVEA 1PMNA 4JL9A 5KHXA 1WZYA 3DB6A 3FAAA 5DEYA 3MPMA 4HVSA 4MV3A 4MAOA 3NR9A 2P2IA 4IC8A 4K1BA 3OROA 4P2KA 3R7OA 5IQEA 2NUAB 5DHJA 1JOWB 4BDEA 4L68A 5ANJA 2BAKA 4BHZA 5I9WA 5F20A 3VUHA 5AADA 1WCCA 5IZFA 2C69A 2C6LA 3GB2A 4GG5A 4BBEA 3EQHA 4PTEA 4R7BA 4RVMA 5AP4A 5HKMA 2RG5A 1I44A 3GCUA 4JI9A 3TCPA 1WBNA 2R3KA 3UVQA 1OKYA 2BROA 5CA1F 5IDPA 3QQJA 4C4FA 3A7GA 2QO2A 2VTNA 4PDYA 5A14A 5AJQA 3GXLA 3WI6A 3TKUA 4C35A 3QALE 1IOVA 4IACA 4FTUA 4K2RA 4OR5A 3EL7A 4WNMA 2F4JA 3WOWA 3SA0A 3EQGA 4RX7A 5LJJA 1GIIA 3HRFA 3QKKA 3F7ZA 4YAKB 5CF4A 1OBGA 2HWOA 4U8ZA 3TIIA 3SRVA 4FZDB 4EJ7A 5IEXA 3WF8A 1GSOA 5HORA 3I81A 5IUGA 2BZJA 3R1YA 3G0EA 1SVHA 4FSMA 3WF9A 3K5HA 2WO6A 4IX6A 2WQOA 3D9VA 5HIEA 1W93A 2R4BA 1MRUA 3CSVA 3UIXA 4B6LA 2RGPA 1SCUB 1CQJB 5GIOE 5J8IA 3VQHA 4FG7A 3KXHA 5DWRA 4GFMA 1Y91A 3VMMA 4QT1A 1Q4LA 3CY3A 1H26A 4L45A 3LQ3A 1JSVA 2W17A 3VRYA 4QMLA 3O7LD 3QFVA 3KXGA 4M9UA 4D2SA 3V51A 1H24A 2ITTA 3D5WA 3SLSA 2R3LA 4N57A 4S31A 4DEGA 2FPIB 4MWHA 3VBWA 4RZVA 2QLQA 3QGYA 3B8QA 1M7QA 4FKIA 4TPTA 3R7IA 4I50F 4EOLA 1YOJA 4RLLA 2VQDA 4U40A 3JVRA 3AC1A 4CNHA 1WR2A 1UU8A 3PJ8A 4G17A 4S2ZA 3D7TB 3WF5A 5IH4A 4HVIA 2QR8A 3QHRA 4KBCA 4YBZB 5FRIA 4EOJA 4EKKA 5L2IA 4BGHA 4C4IA 5L3AA 2PVKA 3QL8A 3TZ7A 2C5OA 2R7KA 4EONA 2E9PA 2JIIA 2PVYA 2PVMA 2W4KA 3W10A 3NUNA 4HPUE 5B0XA 3P4KA 4A06A 3UQCA 4NL0A 4TWPA 2ETKA 1ZOGA 2FSMX 2HELA 3NNVA 4OTQA 5D8DA 5LP6F 5HNBA 2FP4B 3N9XA 5EQPA 3ALOA 4ALVA 1PRYA 2QOIA 2WAJA 3H3CA 3QBNA 2GTMA 4K11A 5E8XA 4PDSA 4D1XA 4FKPA 4I1ZA 5C4LA 3FLWA 5K9IA 1WVWA 3Q6UA 4IX5A 4B9DA 2QOKA 4Z16A 3UGCA 4KAOA 2V5AA 5AIRA 4UV0A 2B9HA 5HBRB 4GT5A 4RVTA 1EYZA 4M7IA 3BCEA 4Y73A 1J3HA 2BHHA 2XJ2A 4RZWA 5EQYA 3DFAA 2HIWA 3FMDA 5DH3A 5DR6A 4AXAA 3U6HA 4DT8A 3HMMA 4ID7A 4FNWA 4NKSA 4H3BA 5CVGA 5IUIA 3UNZA 3Q32A 4GU9A 1ZYJA 5CU2A 5HLNA 2HGSA 3Q1KA 3ANRA 4XG4A 2V7OA 4UWYA 4UZDA 3U9NA 2O0UA 4Y72A 1ZYDA 3NEWA 4QP4A 4UXLA 3PXKA 4BCIA 5E8TA 4AS0A 3A4OX 4NSTA 5ETIA 4CRSA 3LXPA 1KV1A 3V4SA 4NCTC 4V0GA 3MW1A 4MV9A 3FQSA 1Q24A 3R7YA 2H96A 4QYYA 1KE8A 3ZCLA 2FGIA 3GGFA 4YNOA 4IDVA 4UZHA 4X3FC 4QNAA 2OU7A 4KIQA 2REIA 4AAAA 4WA9A 3DKFA 2VAGA 1YWNA 4OT6A 5CXZA 3QXOA 3I60A 5E7RA 3VF8A 4BKJA 3OEFX 3MTFA 4J96A 1PK8A 3L8VA 2OG8A 4FI1A 4X21A 4DEDA 4LMUA 2VWYA 3F3UA 1Q3WA 4FV0A 3EH9A 2NRUA 3F2AA 3ORNA 3OXIA 3PZHA 4O7NA 3S95A 5GONF 1YI4A 3P5KA 4I94A 3VS7A 2WXVA 2XIRA 2ERKA 1YHWA 2X2LA 3VJNA 4DH7A 2OGVA 1WBPA 2WPAA 1J91A 1GZNA 1XH8A 2J5FA 3G9NA 3A7FA 1T45A 2BPMA 2H9VA 2V55A 1W7HA 4QP6A 2YZLA 4FK3A 1OBDA 2YJSA 4TT7A 5HE0A 4B4LA 2QOHA 3W2CA 4DH5A 1O6LA 3T9TA 2BRHA 3FMKA 2R3PA 4FOCA 2FPGB 2PE0A 2V5QA 5HI2A 4K77A 3VUMA 3EKKA 2X7FA 1UVRA 4GEOA 4XLIA 4W8DA 4RFYA 4D0XA 4KBKA 3LP8A 3N4UA 5HU9A 4ZSEA 4MEDA 2X8IA 2R82A 4U5JA 2XUUA 4CTCA 3L9LA 4HYSA 5DPVA 2R86A 2AUHA 1DIKA 1H01A 4JBQA 4CEGA 5KBRA 5HD4A 3NDMA 2VWIA 3DKGA 3E5AA 2QI8A 4P4CA 4WD5A 3S3IA 3SD0A 4JNWA 1DS5A 4JBPA 3UP2A 3BX5A 5FEDA 4NTTA 2XRUA 1V0PA 4UWBA 5A6OA 2FPPB 3GI3A 4ZTQA 3Q6WA 3QQHA 3CXWA 1A9XA 4FTTA 3Q4UA 3ZLXA 4AW1A 4U45A 4DCAA 4G34A 2YWVA 1TQMA 3VWAA 2G15A 4XNEA 3D83A 3MIAA 3F66A 2B4SB 4QP7A 4XOZA 1EUDB 5EHYA 3A7IA 2VZ6A 3FQEA 4OGRA 4RX9A 3PVGA 4Q9ZA 1GY3A 5CEPA 3O50A 1UNLA 4X2FA 4O7TA 2V58A 4F7LA 4C2VA 4F9BA 3E92A 5FTQA 3QC9A 5GHVA 4L52A 2IJMA 5H3QA 4IM2A 2GPHA 4KUJA 3ORMA 5DYJA 2VTIA 2ZM3A 3F5PA 4L8MA 3A61A 4RFMA 3SXRA 2J9GA 4LOOA 3IW8A 5JKGA 3SG8A 4L7SA 2BZIB 4KKEA 4AA0A 2PL0A 3PY3A 4UB7A 3UQFA 4BTKA 4ZIMA 3NGAA 4QTEA 2ITPA 3MB6A 1YDSE 4QMTA 2IW9A 3RV3A 4QTAA 2W9ZB 3G15A 3OW3A 5JFWA 3LPBA 2B0QA 3UNJA 5HVKA 3I6WA 3JRWA 3FMMA 4FE2A 2BALA 4RA4A 1OIUA 1SNXA 2HENA 3LVPA 4CV9A 3KEXA 5FM3A 4QMVA 2X1NA 1E4EA 2ZDGA 2G01A 3MWEA 5K3YA 1FBNA 3DAKA 4Z3VA 2VO0A 5L6PA 3CC6A 3HRBA 3LFCA 4I21A 4BI0A 4FKVA 2OFUA 2PZPA 3TWJA 1KUTA 3OVVA 4GUBA 3QWJA 1KE5A 2UZOA 1JBPE 4ANLA 2XNPA 3OXTA 4FV4A 3WZJA 3EJ1A 1YXVA 4M0YA 4X7QA 4ZTMA 5CWZA 4BTFA 3ZEWA 1A06A 2F49A 3DXPA 4FTIA 2NU8B 3FZOA 2R9SA 4I5PA 5DVRA 3UYTA 4MAMA 4YJVA 3HAMA 2P3GX 4O0VA 5HCYA 2RIOA 1PHKA 2W7XA 2YYAA 3DGKA 1OKZA 4XP2A 5CANA 4FGBA 3R5HA 3LJ2A 3R8UA 5E4HA 2Z02A 2CN5A 4O6LA 2ITZA 5EYKA 4GSBA 4Y83A 5BUEA 1STCE 3HV5A 5E9EA 1ZRZA 3R2YA 4L46A 3PYYA 4P90A 2RKUA 3B2WA 2BFXA 1UU7A 4ACMA 4IVAA 3VS6A 3W2OA 3UIBA 3BU3A 4ACCA 3R7EA 2HY81 1M52A 1ZOHA 2YCSA 4F9WA 2I40A 2XNMA 3COMA 3BYMA 4PMMA 1VJYA 4ZS4A 3DAJA 3PXQA 3HP2A 3RWPA 1OPJA 2VTOA 3MFRA 3QA0A 3KMMA 4QYHA 2VO7A 3LLTA 4RWLA 5IF1A 1ZMVA 3FXXA 5FEQA 4TKSA 3GT8A 2JKOA 4O0UA 3MESA 4XBRA 2X39A 4CSVA 4E1ZA 4ZAUA 3QUPA 4Q9SA 2YIRA 1OKWA 2R64A 4IC7A 3ZXZA 2BTSA 5L8KA 1NT2A 5DT3A 3C51A 5BVEA 1JKLA 4CXAA 3Q60A 3FKNA 4U80A 3RK7A 4EUUA 1EZ1A 4O4JF 2UVXA 5EW8A 4WBBB 4AFJA 5CASA 2OXDA 3MS9A 2IN6A 3Q52A 4FEXA 3OS3A 1KE7A 5HNIX 4QYFA 4AP7A 3VPCA 3PIZA 4XV9A 4YP8A 3RGFA 4FFLA 5KX8A 4FKUA 4F7SA 5JMSA 2RFDA 4JQ7A 4LRMA 4DA5A 4ZTNA 3WNZA 4MK0A 3OZ6A 3F7WA 4BZOA 5CU0A 3NRMA 4JQ8A 3OTVA 3VS2A 2C6OA 1CE8A 2HJWA 1UV5A 4X6QC 4DEEA 4GKIA 3U9SA 3QTZA 5ANGA 4DFYA 2FO0A 2I87A 3UPXA 4EI4A 4FKOA 4OTHA 5F4NA 3KC3A 5CLPA 4L44A 4MV4A 3U4WA 2O65A 3QGWA 3FYJX 3KALA 5LXMA 2XMYA 3RK9A 4R3CA 2CMWA 5EDRA 4EKLA 5M51A 4RIYB 4TZRA 3R9NA 2W6NA 4J71A 5DNRA 3AC8A 3UO5A 1F5QA 1R1WA 1IA9A 4F6SA 4DCEA 4ZLZA 1FQ1B 1GNGA 5B2KA 5DIAA 2XIXA 3FZSA 3LCDA 5T6KA 4FKSA 4ASZA 4FEVA 3BBTB 3HX4A 1Q8ZA 5CZHA 5AUWA 4MQ1A 5F9EA 2PVRA 2ZDTA 4ZK5A 1P5EA 1GSAA 2CHLA 4FL3A 4LFIA 5B7VA 1R39A 4PMSA 4EHVA 4YB8B 2VX1A 4C4GA 1GZKA 2AC5A 3CQUA 3D2IA 2OJJA 4QMUA 4HCTA 4PMPA 3COKA 1H25A 5JVDF 1MUOA 2JGZA 3ZZWA 3QZGA 4YBKA 4NM0A 3S00A 4MNEA 4RJ7A 2O63A 3VW6A 4FV6A 2WTJA 3MJ1A 1JWHA 3MN3A 3R73A 1M2QA 4HOKA 1YHSA 3HA6A 4BIDA 4NIFB 5IH6A 5C8YF 4GL9A 3EL8A 5CY3A 3TZ8A 2YS7A 2EUFB 4MTAA 1KWPA 3NYNA 2JIUA 4L3LA 2QONA 3ACJA 1XH6A 2BILB 2VTSA 3NZ0A 4PNKA 5EKNA 1JSTA 2BUJA 2XZSA 3MIYA 2HW6A 2VNYA 1ZMWA 3S4QA 2PMNX 2PTKA 2YM4A 4E20A 3KKVA 3U87A 3DS6A 3QQKA 3LFBA 3VVHA 2V62A 2OJGA 1PXIA 3PTGA 2YRWA 3CIKA 2RG6A 2GQRA 3KMWA 4I5HA 5IMXA 5IA4A 2YZGA 3VO3A 1NVSA 4KB8A 3FZ1A 3N4TA 3R9OA 5G1XA 5TKDA 2QHMA 3UO4A 4BDGA 2QHNA 3OHTA 4FG9A 4FKRA 1FGIA 3FI4A 1O6YA 4GVJA 3HAVA 4MXOA 4ONAA 4P5ZA 4R1YA 3ODYX 5CNOA 5AV3A 4ZZNA 4YZMA 3ZSHA 1JKSA 1JDEA 3ZU7A 4X6RA 2Z7LA 4IVDA 4E6CA 2VGPA 2WMRA 3EIDA 3R71A 4IZAA 4IZYA 5AP6A 4F6WA 3AX6A 5K4JA 5IU2A 5D9HA 2W5HA 4NM7A 3MFTA 5HESA 4R1VA 4EC8A 4DTAA 3AC4A 3SXFA 4RRVA 5D7VA 4J1RA 4GIHA 4O0WA 4YSJA 4YTCA 2Y6OA 3GENA 2VN9A 2W1FA 4QTDA 2A0CX 4FZAB 4YTIA 5AA8A 4GK4A 3UIUA 5B2LA 1U54B 4BR3A 5CF8A 1KOAA 3COHA 3ENMA 3WF7A 4OTGA 5DFPA 2ZDHA 4ME6A 4KIOA 3VHKA 3BE2A 5JN2A 4ZJIA 2DUVA 4IX4A 4NUSA 3V5WA 3H9FA 3BE9A 2Q83A 3TM0A 3W32A 4ZI7F 3M1SA 3MFUA 4ACDA 4XZ3B 2YZNA 1Y8GA 3LMHA 2GNHA 1EH4A 3ACKA 2O3PA 4W4XA 4EQMA 4YMJA 3UE4A 5BPFA 3OG7A 2UZEA 1P2AA 2KTYA 4TYGA 2IVUA 3FJQE 2G2FA 4D4RA 3HMOA 4F08A 3O2MA 3CLYA 3BHTA 3WF6A 3JZIA 4XUFA 2R87A 1XBAA 2XP2A 3R21A 2PZ5A 3QTUA 1OUKA 4I24A 3UC3A 3Q4CA 4JX7A 4FZFB 2E2BA 4ALUA 2QO9A 3FMHA 4YJTA 5HQ0A 4CCBA 3AW8A 4MD9E 3CQWA 3H0ZA 4FUXA 4FT3A 3E7VA 5LARA 4A9TA 3UZTA 4XRJA 3WO0A 5FTOA 4EQCA 3LFFA 4X3FB 4I92A 4YJOA 5CXHA 2BAJA 1OL5A 3UOHA 4E26A 2J90A 2R3IA 5KHWA 2Z7QA 3KCKA 5I9ZA 4HGSA 2JKQA 2UW0A 2PUUA 4D4VA 3CPBA 2IZSA 1XBBA 3Q04A 3ZONA 4ZY5A 2HXQA 4G9RA 2HWPA 2CKEA 2PVHA 4NH1A 4DFLA 3SW7A 4FT5A 1F0QA 3BWJA 3MV5A 4K8AA 5HBJA 3C4ZA 1EUCB 4Z7HA 3FXWA 4AQCA 1IA8A 1E1XA 2X6EA 4XEYA 3U4UA 3OC1A 4BTJA 4P7EA 5T68A 4Y8DA 2C1AA 2F7EE 4V01A 3TJDA 3TNWA 3WARA 4I0RA 3R5FA 1G8SA 2W70A 2C4GA 3RZBA 3FV8A 1H28A 4FTLA 3I6UA 1X8BA 3G33A 3E93A 3R23A 3IW5A 2GNJA 4Q2AA 4IJPA 4IB0A 2VWWA 2ZB1A 5DN3A 3NCZA 1UNHA 1OKVA 3EWHA 4APCA 4KIPA 4ZY4A 1W0XC 4I6BA 3LCKA 5A4CA 1BI8A 3QX2A 3SVVA 1M0WA 2W6PA 3EHAA 2EXMA 3NNWA 4I22A 3EB0A 4RJ8A 4IIRA 3MWUA 4QQCA 5C4KA 2GPSA 2QG7A 5IEVA 2YM7A 4YURA 3ORKA 2B55A 2R5TA 4PMTA 1PYEA 1MRYA 1Q8TA 3GVUA 4FV8A 3DZQA 3NAXA 4QMWA 4BDAA 1S9JA 4YC6A 4I55F 4AZVA 1WAKA 2BIKB 2I0HA 4YTFA 2QOLA 3CTQA 3MPAA 2ITWA 4HGTA 4O86A 4WRSA 1OIYA 1E9HA 3JS2A 4D55A 4F64A 1H1PA 4QSHA 4JS8A 4WOVA 2P2HA 3HLLA 4QNYA 1DV1A 4G3EA 3IW4A 4RFZA 1CSNA 4O21A 3V6SA 2VTJA 3GEQA 3NYXA 4CV8A 2ZJWA 3T9IA 3KN6A 5H80A 3L9NA 4JDIA 4XP0A 4WHZA 2YERA 1XH7A 3AQVA 4JR7A 4YJ2F 3IS5A 4FX3A 3HGKA 2Q0NA 2QQ7A 3QKMA 4XG2A 1FVTA 1PJKA 4O7SA 1QL6A 4G3GA 3SKCA 4DYMA 4RX5A 5IYZF 2DWCA 3OD6X 4GFOA 1WBWA 1K2PA 4R7HA 2WIPA 4O7RA 3UVPA 2G9XA 1H0WA 5T3QA 2XB7A 4ZMEA 4LRKA 5M4IA 3CQEA 4BDDA 4X0MA 3OUUA 4U6RA 4X2NA 3R1QA 4C5BA 3NW7A 3ORLA 4FTCA 2CKQA 1IOWA 2BAQA 1GIJA 2PMLX 4NYEA 3OY1A 4QOXA 4G1WA 4W4VA 2EWAA 4ZTHA 3OY3A 3VOTA 5FTGA 5BMMA 2WHBA 3CTJA 4EGJA 4YJSA 3FE3A 3FMEA 2A4LA 3LMIA 4EH9A 4MYGA 2OZAA 4FK6A 5CAUA 3H4JA 4RT7A 3AC2A 3C4WA 4YZCA 3SE7A 4E4XA 1KJJA 3PY0A 4IAAA 4JDHA 3QCYA 2OH4A 3VS1A 1BUHA 4M3QA 3ZUVA 4AA4A 1BMKA 2W1IA 4BI2A 2C5XA 2J0LA 3UTOA 1M7NA 5EDQA 4DG3E 2XCLA 4ANBA 4I6FA 4Y8VB 4WNOA 4TN6A 3UG1A 1T36A 4C5CA 1FMKA 5GINE 4MF1A 1LPUA 3TV6A 4PQNA 4PP7A 3DK3A 2RF9A 4E6DA 2YAAA 3BELA 4AW2A 2B9JA 1Q61A 3U9CA 5CEMA 4Y95A 1K3AA 2DLNA 3G90X 2B54A 3JUHA 3RALA 5AV4A 4O7VA 5JRSA 3TNIA 3C0HA 4RBLA 3LAUA 4MQ2A 3DXNA 3LE6A 3TN8A 4YJPA 2HAKA 2Y9QA 4TYJA 4FIGA 5E91A 3ORPA 4EH4A 3MVLA 2JDTA 2A19B 4XOYA 5CAOA 3O17A 4BRXA 1R78A 2OIBA 1PXMA 3NNXA 4I23A 4FTAA 5IQGA 1M6VA 4FV9A 4G5JA 3DBFA 3A60A 3BKBA 2H34A 4TYEA 5AV2A 4DHFA 4GK3A 3EFWA 5HG8A 3SDJA 4AGDA 2GHMA 3DY7A 4J8NA 1OMWA 3HEGA 3I79A 4JQEA 2X7GA 3FLZA 5EZYF 2YN8A 3KXNA 2PE2A 3HMPA 2GDOA 3HMNA 1FINA 5ANEA 4C37A 5ICPA 3ERKA 3QD4A 3PRIA 4FYNA 4LQMA 3LQ5A 3CEKA 3GCQA 3DKOA 4FNXA 5LVPA 4L9IA 3BU6A 5JEBA 2WQMA 2XKFA 3R30A 3P0MA 3KREA 1DI8A 3CGOA 5GJFA 4C0TA 2VWUA 4RQKA 3HUBA 2WFYA 3KU2A 3LQ8A 3BV2A 3PLSA 4DH1A 1KV2A 4M8TA 3HNGA 5I0BA 1ZMUA 2J6MA 3LCOA 4EGQA 4OTIA 5EYMA 2PBZA 5CVFA 4OBPA 3AMYA 4RG0A 1JLUE 1XKKA 2QC6A 3PA5A 3E3BX 4YHTA 5CEQA 3TKIA 1PY5A 3QYZA 3WZDA 4C7TA 1EHIA 2JFLA 5AP3A 4DEIA 5JK3A 1W82A 2PN1A 2BHEA 1CKPA 3G2FA 2FA2A 4QPSA 4BCQA 2UW5A 2BRGA 2XNNA 1CMKE 3FUPA 4LV5A 2WGJA 5GJDA 2YIWA 4OT5A 5JFSA 1H08A 2GU8A 4N6YA 2R3QA 5TOZA 1O9UA 1OL2A 5GIPE 4EJNA 5DI1A 4L43A 3GUBA 2J0KA 4LYNA 2R3JA 4Y46A 2WTVA 3MY1A 5LVOA 3PXRA 4QP8A 2OXYA 3RHKA 3DJ5A 5E8SA 4BI1A 1XWSA 4FV1A 1OL7A 3KRWA 4XG8A 3RNIA 4RC2A 4ALWA 3QTQA 4TYHB 4KRCA 4WUNA 3WE4A 4FIHA 3D4QA 5CQWA 2G2HA 2PK9A 2OXXA 3ENHA 5LMBA 2GSFA 4IAZA 1WMKA 1UKHA 3OFMA 3C5IA 3VNTA 3GQLA 5ETAA 2C3LA 2VNWA 5FLFA 3F5GA 2VTMA 4DLKA 2WMWA 5CAPA 4EOQA 5IA0A 4BDJA 1AUXA 2OLCA 3DFCB 4XYMB 1PXKA 4U79A 3VS0A 4B8MA 2FH9A 2ZMDA 4D4YA 4DFBA 3AC3A 4QMSA 2Y8OA 1L8TA 3NUUA 2J0MB 3PIXA 5FM2A 4EH6A 3SGCA 3S1HA 4IHJF 3R83A 3UDBA 2J9MA 3QYWA 3OCTA 4R77A 3MA6A 3U8WA 3AC5A 2WB8A 3DJ7A 1KJ8A 4KABA 4RIXA 3MA3A 4ITIA 4O81A 1OPKA 3UOKA 1IAHA 2OFVA 2SRCA 5IQHA 4HQ6A 2YRXA 5HIDA 1H4LA 5H2UA 1OIRA 3VF9A 2RFSA 4EOOA 4DH3A 1B6RA 5DBXA 4JAIA 2YIYA 4LM5A 3L8PA 1JKJB 3I12A 3MH3A 5EOLA 3Q9ZA 1RW8A 4YZ9A 3V5LA 2XA4A 1OZ1A 2JDVA 3HRCA 3AD6A 4NFNA 3ATSA 3FI2A 3GFEA 4XJ0A 3VUGA 3Q2JA 3QZFA 3QCSA 2P55A 4PUZA 4XYFA 3VS5A 4AOTA 4NW5A 2JC6A 3ZO3A 2ZVAA 3PWYA 4I5MA 4OUCA 2W9FB 4MXAA 5AV0A 4Y5HA 3ETHA 3MVJA 1UU9A 5CSHA 1SYKA 3ORTA 5CEKA 4YPSA 3O8TA 3UG2A 4C3FA 1CKJA 3WO1A 1B38A 4M84A 3PG3A 4E6AA 2XIYA 4AG8A 2C0IA 2I80A 3PE1A 1LP4A 2XRWA 3DXQA 3ELJA 5HE3A 5D10A 2Z7RA 4R3RA 3FXZA 5EI8A 1GOLA 3BBWA 4PDPA 3U55A 1W84A 4BGGA 2WOTA 4QQJA 4AW0A 3KK9A 2YDKA 2Y0AA 4DTBA 4IWQA 5HBEA 2NO3A 4G6NA 2Y4PA 3W16A 2DS1A 3K3IA 1JLLB 1M0TA 3HDNA 4BF2A 2XBJA 2C3KA 2I0VA 1NXKA 1Z9XA 3PJ2A 3D0EA 3QF9A 4FV7A 3ZRLA 2OJFE 5CVHA 3BHHA 1TQIA 1VYZA 4EWHA 4RQVA 2I0EA 4YLLA 3BI6A 1KEEA 2GHGA 5KZ0A 2YWPA 3NW5A 4P5QA 3TTJA 4ACHA 2J51A 4LV8A 3QD3A 2ITUA 4CKIA 5I9YA 4Z9LA 2CKOA 5L2SA 5BYYA 2HK5A 5FDPA 2OJIA 5HO8A 2HZ4A 2QD9A 3QKLA 3WZKA 4ZOLF 4HYUA 1RE8A 4K33A 4JLCA 3VW8A 2ITYA 4E8AA 3QXPA 1RQQA 4QMXA 3F2RA 4J97A 2YDIA 5AV1A 1TVOA 3E63A 4U43A 3T3UA 3ULZA 3UJGA 3JZFA 5E92A 4NT4A 5CSVA 4GCJA 3DZOA 3SRVB 4FTRA 3Q2OA 3B2TA 3CBLA 3THBA 3BZ3A 4I4EA 4ACGA 1ATPE 3TNQB 3AT2A 2GMXA 3PFQA 4L00A 4H1MA 5EYCA 2BZHB 2ZOQA 4RIWA 5EW3A 4D5KA 5BVDA 4FSYA 1BYGA 1QPEA 4TXCA 1BKXA 5GJGA 5LMKA 1YVJA 4PL4A 5BNJA 3KRLA 2WTWA 2UW9A 3LOKA 3TG1A 4IANA 1CS0A 1AQ1A 4AX8A 2BRMA 4JG7A 3JY9A 1DV2A 3NPCA 4KKGA 4OTFA 2PYWA 2XK6A 4HGEA 3GC0A 3V8SA 4L7FA 1Q5KA 4UYAA 1OGUA 2PE1A 3TACA 2XNBA 4GH2A 4TWCA 3DK7A 3BEGA 3R6XA 4O0SA 4NK9A 4TTHB 3DJ6A 4LL0A 4TV9F 2JDOA 3CD8A 3COIA 4CFWA 3GU6A 5JH6A 5IDNA 3HV6A 4USEA 4EWQA 3F3WA 4DFXE 3UODA 4MA5A 4TUYF 3BQCA 4MXCA 4RJ6A 3OBJA 4ZEGA 4MHAA 3TKHA 4BDHA 4DITA 5KNJA 2VPQA 4HNIA 5M55A 1LEZA 4GYGA 3KF4A 2BDJA 3PJ1A 4D5HA 5HHWA 2R84A 3DBQA 3QUEA 4U81A 5AMNA 2WD1A 1PW2A 2WKMA 3IGOA 4ERKA 2YCFA 4QP1A 5AP5A 5EK7A 5HLWA 3VBXA 1W96A 2XK3A 3P23A 3NMUF 3SG9A 4IMYA 4GV1A 4JDKA 4RVLA 4IB1A 5EQEA 3ID6C 5KMNA 4FFMA 5K5XA 3TINA 1G3NA 2ZM4A 3MJFA 4PNIA 3GU4A 3RK5A 1OPLA 2YM5A 4UX9A 3HV7A 4DN5A 2VTTA 3CGFA 3IW7A 3KMUA 4G2FA 2YL2A 3RKBA 3ORRA 4KS7A 5D11A 3RFCA 3KULA 4OTRA 4QMQA 1YWRA 5BVWA 2R7LA 4IM3A 2QOQA 4CVAA 2YFXA 3DCVA 5DT4A 5JGDA 2JDRA 2O8YA 4BCOA 3N6RA 3NLBA 3D15A 4I3ZA 4FT0A 5DGZA 5LQFA 1BXRA 1O6KA 1NY3A 3D7ZA 4F9YA 4IFCA 3BHUA 5CEIA 4HNTA 5IQFA 3Q53A 5IQBA 1YOMA 4S33A 5ETCA 2C6KA 1XHAA 2IVSA 3V8TA 4EH3A 4F0GA 4FFPA 4GRBA 1Z2PX 1KE6A 3ETJA 2PVPA 3SHEA 3TNHA 2J0IA 1PMUA 3EQBA 5LCJA 2YM6A 5CA0F 2F7XE 4CLJA 2OSCA 2VD5A 5L8LA 4BYIA 2C5VA 3DTCA 5C8KA 3P9JA 5M4FA 3R5XA 2NU7B 4KD1A 2E9UA 3PRFA 2JAVA 4NM5A 3CE3A 3HL7A 3ZFXA 2C6DA 5KMMA 2VO3A 2XNGA 3FDNA 4OTDA 4YR8A 2B1PA 4V0GB 4YC3A 5CU3A 5DMXA 4FL2A 2JITA 1WBSA 4DEHA 1C3OA 2NU6B 4X2JA 4OTWA 4DE4A 5ACBC 3V01A 5JZNA 4EOKA 5AUUA 4MVFA 5GNKA 4D0WA 4DT9A 1YXXA 2XD4A 1GZ8A 1YDRE 3DOGA 2GHLA 3LIJA 1YRPA 4JR3A 4JG8A 4JVGA 1OECA 4FKGA 4TL0A 4TV8F 4HYHA 5M08A 3Q96A 3R22A 4KSPA 4NU1A 4QYEA 5HVJA 2QU5A 4JDJA 5H9BA 5DRBA 3SW4A 4GK2A 5IISA 3V4ZA 3HBLA 3AD5A 2UW3A 2ZV7A 2FB8A 3UYSA 3M42A 4FICA 5D1JA 3TZ9A 3N4VA 1ZWSA 3CPCA 5AUTA 4HVDA 4XX0B 1MRVA 4B7TA 1W98A 1XH9A 2PMIA 3QD2B 5M07A 3Q5IA 3K5UA 2AC3A 5AAGA 2YEXA 3P1AA 2OZOA 2NP8A 3JR1A 4C34A 3G6HA 4I5CA 5HTCA 3HZTA 5DR9A 4F0FA 1U5QA 4QMOA 3U6JA 4U3ZA 4L1KA 4MXXA 2I8CA 5E1EA 1FGKA 4LL5A 4C5AA 3LM0A 4DLIA 4HPTE 2GLTA 3FSKA 2UW4A 3NUAA 4A4OA 2A1AB 4B8LA 4EBWA 5A4EA 1HOWA 3AT3A 2IPXA 3PPZA 1OL1A 4EYJA 1OL6A 4HJOA 1AD5A 3O7LB 3TIYA 2YCRA 3DTWA 5G6VA 2ZAZA 3RVGA 3MWDA 4HNUA 4F99A 1G8AA 4RJ5A 2CDZA 4YJRA 4FVPA 4LGHA 3DPKA 1IRKA 4QTCA 4GFGA 3R01A 4DGOA 3BHYA 2WTIA 1Q8YA 1H27A 3KFAA 3Q9YA 4XCUA 4Z55A 5J1VA 3LHJA 3DB8A 4AA5A 4F1TA 5J9ZA 2IO6A 3WYYA 3GIDA 4IW0A 4M15A 2AYPA 4FZ6A 2V0DA 4GJ2A 4GMYA 3SV0A 5KMIA 2HOGA 3AMAA 3EYGA 2W1CA 5BYZA 1J7UA 2YW2A 2PVJA 5CAVA 2W6ZA 3RINA 3WZUA 4ASEA 2GCDA 3AGMA 5HTBA 2FYSA 3R9DA 3EQFA 3BLQA 3BHVA 3DBDA 1NVQA 1JPAA 4GS6A 2QF7A 4YJNA 1REKA 3IKAA 1CM8A 3BYUA 3NYOA 4WIHA 2ITNA 3UNKA 2W1HA 1JVPP 1BI7A 5AP1A 3QZIA 5C27A 2V59A 4AZFA 2E9VA 4PF4A 2GQSA 4JBOA 2OO8X 4O4IF 4L67A 1TQPA 3O96A 4WBNF 4HNVA 3HUCA 4O4HF 2WYOA 4GT3A 4YPDA 3ZTXA 3RMFA 5M4UA 4FKJA 4AFEA 1XH5A 2BIYA 3PPKA 4CG9A 4O22A 1B6CB 4Q5EA 4BBMA 5I9UA 5BMVF 2XK4A 3C4EA 5IEYA 3VUDA 3LXNA 3O8UA 3V3VA 1NW1A 5EFQA 4DG0E 3EZVA 3QRKA 3R2BA 1PXNA 3T8OA 2C3JA 2R2PA 4DBXA 4YBJA 4ANSA 3TL8A 3LCTA 1QMZA 1E4EB 4JRNA 4X2GA 2QKWB 4TWOA 4CFUA 3LJ0A 3ORXA 4UY9A 4JJRA 1T46A 3ZC5A 4KS8A 2EB3A 3Q9XA 5LWMA 1YKRA 2XCHA 3BYVA 4AUAA 3CCNA 4O6EA 4ZSLA 3GLKA 4F7JA 4CG8A 3LFEA 4FTOA 3LMGA 3ZLSA 3DT1A 2Q0BA 4YLKA 1GSHA 3II5A 1YI3A 4J53A 2W6MA 3DNEA 3ORIA 4MA0A 2VTPA 1AGWA 1J7LA 1PF8A 2R7BA 3POOA 4CGAA 4CQEA 1BNCA 3VBVA 4G5PA 5D12A 3K2LA 2VV9A 2X8DA 4NW6A 1YQJA 3AXWA 4IZ7A 4LUDA 5ANOA 3ZEPA 2QVSE 4J98A 4FGRA 1R3CA 2B9FA 5FBNC 3MY0A 3L8XA 4AZTA 4MV1A 5AA9A 2A27A 4G3CA 4LUEA 5HICA 3WIGA 3ZO2A 4C3RA 5C26A 5HZNA 3TDWA 4E4LA 4WNPA 4XS2A 2CNQA 2FSTX 2RFNA 4D2RA 4J52A 3PXYA 5FUTA 4N6ZA 2IP4A 5C1OA 1YDTE 4O0XA 4AWIA 4MXYA 4C38A 4NM3A 4EZ7A 5E8VA 1U59A 3VRZA 4BCGA 3O8PA 2XIKA 5A54A 2BR1A 4U9AA 2UW7A 1H1WA 4DGLC 1C30A 3G6GA 1PX2A 4O96A 5CSPA 4YO6A 3JYAA 2UVYA 4FTKA 4ARKA 3R9RA 3DLZA 1SZMA 2PY3A 3F3ZA 3OCBA 4O0YA 3FKOA 4FVQA 3UZPA 4EK5A 4ZMFA 2V22A 3UQGA 3QRUA 5FD2A 5IUHA 3QQFA 2GTNA 4OBOA 4BIEA 5JFVA 1TKIA 2OKRA 5EHOA 3GU8A 1PXPA 4ASXA 4ZOGA 5CI6A 3NVKI 4FU0A 4IAYA 2C30A 2IZUA 3I0OA 2PZRA 3G5DA 3Q4ZA 2G1TA 5IH5A 4CFNA 3BLHA 1BLXA 3V5QA 4S32A 1SVGA 3D5XA 3W8QA 3V5TA 3QFFA 2DIKA 5ANKA 5EOBA 4DF3A 5CF6A 2ZDQA 2CZGA 4IH8A 4HVHA 3DKCA 1Z5MA 2WEIA 3PDTA 2VX3A 1P4OA 3PG1A 2XNEA 2PVNA 3RPYA 4AACA 5CEOA 3KAKA 4BCNA 3C1XA 3RAKA 2I0YA 4ZSGA 5BVFA 2KULA 2FB9A 3EFKA 4IWDA 2CSNA 2JIVA 5F1ZA 5HBHA 3GQIA 1IEPA 4XMOA 3OUKA 4YTHA 4AN9A 3GU7A 3DBCA 3QHWA 4AT3A 4E73A 1E1VA 3LW0A 4FIJA 1ZXEA 3EN5A 4X3JA 2JKKA 3ZSIA 2PUNA 4FKQA 3QAME 4L53A 4Z7GA 5BPYA 5AUVA 4FR4A 4YHJA 1XBCA 3QWKA 4FIEA 2PWLA 4D1ZA 3E5NA 3HB9A 2W0JA 4LOPA 4NZWB 2ZDUA 3VBYA 3ROCA 5L6WL 3PJ3A 1IG1A 4FSUA 3ZS5A 2WELA 3AMBA 5FXSA 4LGGA 1XO2B 4A9YA 4BC6A 3K54A 2ONLA 3NIZA 3WE8A 4C4HA 4E4TA 2WU7A 4QPAA 4RWJA 2OICA 4CZTA 5A46A 5E1SA 2Y7JA 5LYJF 3EYHA 4A4XA 2UZVA 4F9AA 2J4ZA 4BCJA 3CD3A 2H6DA 2W1ZA 3FBVA 3BGPA 3H0YA 4RA5A 4TYIA 4I4TF 3RM7A 3OCGA 3MYGA 1R0EA 4HZRA 1JQHA 4MXZA 4EUTA 3QCQA 4WSYA 2W6QA 4M69B 2GFCA 4AZSA 4JRVA 4PL3A 4QO9A 2XEYA 3HDMA 3CS9A 2CGVA 2CNVA 2VUWA 3F9NA 4D28A 3IPHA 2XKDA 4BN1A 3GCSA 4K6ZA 5K5NA 2HZ0A 4MNEB 5AM6A 4APPA 4F4PA 4JOAA 4YZNA 1B6SA 2OI4X 1VBHA 3SAYA 2C5NA 4RJ4A 4XG3A 4FA2A 3BWFA 5CALA 3UOLA 4A7CA 1LUFA 2J0JA 4UYNA 5AAFA 5J5SA 3LFDA 3D7TA 4IQ6A 4EEVA 1KSWA 3KXZA 5IPJA 5BYLA 2ZM1A 3GFWA 4RWIA 3F6XA 3OWJA 2J5EA 3NS9A 4FUYA 4TNBA 3W33A 4ZHQF 2DWBA 2X4FA 4RLKA 4DH8A 2YZMA 2EU9A 3TUCA 3E8DA 3C9WA 3F82A 3EOCA 3M2WA 5HG7A 3UVRA 1BL6A 5FXRA 5HLPA 1ZAOA 4F70A 1J1BA 1R0PA 3OMVA 1ZZ2A 2BFYA 2DYLA 4HCVA 2FSOX 4WNKA 3TDVA 4O2AF 4RC3A 4FG8A 4DLJA 2BRNA 3ZRMA 4PY1A 4E93A 3FC1X 4IAIA 2VTLA 3PPJA 3TV7A 2Y4IC 5AUYA 3SQQA 3R8VA 1FVVA 2I6LA 3QTWA 4MBLA 3S0OA 1YXSA 2QG5A 1DAYA 3HMIA 3OT3A 4R78A 4CFXA 3LXKA 4MD8E 3IO7A 3E8NA 4YJ3F 1ZYSA 5CENA 3LWBA 3QRIA 3ZFMA 4YAJB 2GS7A 4XP3A 3R9HA 3HV3A 3D2KA 4IIJF 2QOOA 2YITA 3GC8A 5JQ8A 2O64A 5DE2A 1FMOE 2R3MA 5JQ5A 1VYWA 1JKKA 2VTHA 3EN7A 4HNFA 3KVWA 2Z04A 4CT1A 2YM3A 1H8FA 3ODZX 2P4IA 2FSLX 2YHVA 3ATTA 3KRJA 3NUXA 3UC4A 4RMZA 2PUPA 3NIEA 4PTGA 5B2MA 4AT4A 1Y8YA 1BX6A 1YHVA 3EN9A 3GU5A 3FLYA 4ZY6A 2QU6A 1OM1A 1Y57A 1DAWA 2C1BA 4ZSAA 5HX8A 3ZZEA 4AW5A 3QTSA 4W4WA 5CSXA 1Z2OX 2GNIA 4L42A 2CLXA 1ZY4A 4U42A 1AUVA 1Q8UA 3K5IA 3CTHA 3QX4A 1FPUA 4AN2A 3E87A 4YJUA 3MVHA 4MNFA 4ORKA 5IA2A 5HEZA 4E4MA 2W1EA 2WU6A 3O0GA 3EQCA 3ZUTA 3K3PA 2W5BA 5HVYA 3GCPA 3P7BA 2W4OA 4YLJA 3RJCA 4OLIA 3RPRA 2HW7A 4YSMA 5JT2A 2JLDA 3OCSA 4F09A 2PVFA 2W99B 5CAQA 4C3PA 4U3YA 3FEGA 5C01A 3FLSA 5J2UF 5EH0A 5JZJA 1GLVA 4XRLA 2ZV9A 3QTRA 1DM2A 2FVDA 2PHKA 3ZXTA 3WIKA 2ITXA 3TXOA 4B99A 5AAEA 4I41A 3LKMA 4MCVA 4EZ3A 2E9OA 3NAYA 4ZJVA 1S9IA 5KKRC 2SCUB 4JIKA 3AGLA 2WEVA 5FGKA 2WMBA 3QCXA 3VULA 3ZHPC 3IONA 3SOAA 5FP6A 3RV4A 4XH6A 1HCLA 5LMKC 2OW3A 3EMGA 2R85A 4C2WA 4FTQA 2QODA 3WBLA 3UOJA 2GPWA 4LMNA 3OWKA 4WT6A 2F9GA 4C36A 5KMJA 3VQUA 1OUYA 2A2AA 4MWIA 1PMEA 2XNOA 3BRBA 3DQWA 3POZA 4YZBA 1JKTA 2B52A 3EN6A 3EQIA 4R7IA 4I0SA 2ZYBA 5A4LA 5FP5A 1I7LA 3H30A 2W1DA 1M2RA 1OB3A 5E8UA 5JVLA 4BZNA 4O2BF 4QMNA 3DF7A 1M17A 4GKHA 3ZM4A 5CNNA 3ZRKA 4M13A 1L3RE 2EVAA 4MKCA 5AFVA 4II5A 2FUMA 4K9YA 5H8BA 4UALA 5H8EA 5DA3A 5J87A 4XG7A 5HCXA 4JBVA 5AP7A 5HIBA 3HO8A 4FT7A 3TW6A 5L6OA 2BDWA 5KMLA 5CYIA 3DDQA 2UZTA 3KA0A 2W1GA 3A2CA 3I4BA 5TO8A 3RAIA 4A4LA 4ASDA 5M53A 3EQRA 3M11A 4D1SA 3ET7A 1XH4A 2HZNA 2YS6A 3GP0A 4YJQA 2DQ7X 4J95A 4BIBA 5FNVF 2XH5A 4O83A 5EM8A 1DI9A 5HGIA 5EG3A 4U41A 1KJ9A 4ENXA 2X9FA 5K4IA 5J1WA 3I5ZA 3PY1A 5AIKA 2UUEA 4JAJA 2PZYA 4G6LA 4QP3A 2BKZA 5I5ZA 3UO6A 3TT0A 4YNEA 3PXZA 1CKIA 2V7AA 3TI1A 3FLQA 5KCVA 3TTIA 4BY9E 1SNUA 4AGWA 3ZLWA 4JXFA 3L9PA 3GNIB 2X7OA 5CZIA 3PZEA 2LGCA 5HNGA 2WMSA 2CGUA 2UZLA 4U97A 5TF9A 5KKNB 1WVYA 1M14A 1KE9A 3K3JA 4LG4A 2GFSA 3MY5A 2BVAA 4GVAA 2CN8A 3G9LX 4JIAA 1QPDA 3E8CA 3EKNA 3G51A 3QU0A 4KKHA 5LMAA 3ZC6A 4FFNA 4FIIA 2WTKC 4C58A 2YIXA 2NU9B 2QLUA 5M57A 3W2QA 4BDKA 3BGQA 2R0UA 2Z7SA 5CF5A 4GUEA 1PXOA 1WBVA 1P14A 2XBAA 3O71A 4IWOA 4R5SA 5BUJA 4EC9A 1PMVA 2JBPA 1G5SA 3F61A 3FQHA 4M0ZA 3EQPA 3FWQA 5LVMA 3D5VA 5CI7A 4FC0A 4A07A 2I1MA 1UKIA 4AT5A 4WBOA 1APME 1U5RA 4O4LF 1QPCA 3BYOA 4FSTA 1ZZLA 4S34A 4J8MA 4L6QA 2OF2A 5JH7F 5IQDA 2WTDA 2W5AA 5EM6A 3KF7A 4EOSA 4ERWA 5CB4F 3CJFA 3MGYA 2YM8A 4IM0A 2IZTA 3FC2A 4LRJA 5FEEA 4AZWA 4BCFA 4I6HA 5IMEA 5HV6A 2JDSA 3GC7A 3NWWA 5IQCA 4N70A 2F7ZE 4DG2E 5ITAA 1F3MC 2WMXA 1CQIB 3G8DA 2DZDA 5HD7A 4EBVA 4WUAA 2OZAB 2OK1A 3IQ7A 3EFJA 1ZARA 4U7ZA 5LVLA 3W2RA 1VBGA 3JVSA 3QRJA 3QTXA 4G3FA 4UEUA 4EH2A 5L2TA 3U6IA 4EL9A 1ZY5A 4OW8A 1GIHA 5EDPA 1URCA 3HKOA 3W2PA 3VS4A 1UWHA 2CGWA 2NPQA 2OJ9A 4C59A 3HVCA 2G2IA 5AX3A 4HW7A 3ZMMA 4CMOA 4DBNA 3MSSA 3LFNA 3EN4A 5AUZA 4DGNA 4ZJJA 3Q9WA 3DA6A 2OH0E 3ZH8A 4TY1A 3ZO4A 3F3TA 1IAJA 4E5WA 4BCPA 3PWDA 4L01A 5F95A 3VPBA 2QOBA 3IECA 2VU3A 1PKGA 3ZLYA 2XVDA 5IA1A 1KBLA 4IFGA 4O27B 5C8MA 3V8WA 3G8CA 4C02A 4I93A 2JD5A 5A4QA 1Y6AA 4V04A 5E8YA 1K9AA 2UW6A 5E8WA 2JEDA 3P7CA 2GS6A 3L9MA 3D5UA 3ZM9A 5M09A 4XX9A 4FNZA 3PLAE 5ANDA 1YXTA 1H1SA 4FMQA 3LCSA 2W06A 3BYSA 3NUYA 4O7LA 4WRGA 4IAFA 2F2CB 5C1QB 2I7QA 2OF4A 3B8RA 2IZRA 3DBEA 3NW6A 4QMYA 2IG7A 3FPMA 3PP0A 2QKRA 4QP9A 2IW6A 3E64A 4FV2A 4JT3A 4YC8A 4HCUA 2C0OA 5DT0A 5EI2A 2HZIA 4I0TA 4BYJA 3R8PA 3C50A 2X8EA 3SXSA 3GOKA 4GU6A 3VA7A 3E7OA 4PRJA 3V5JA 4FTNA 5BQ0A 4H58A 4O2ZA 3R04A 3DLSA 4BCMA 4NFMA 5HO7A 1PKDA 3QUDA 1ZLTA 5HG5A 4F63A 4UXQA 3MJ2A 3OP5A 3SOCA 3OWLA 4YUQA 2X9EA 5IG1A 4QMMA 2XCKA 1H1RA 3NYVA 1PXJA 4G3DA 3MDYA 5FDXA 4CCUA 2XS0A 3NNUA 4JG6A 3GBZA 4RIYA 2RL5A 5EW9A 2O2UA 3R00A 3WZEA 4YO4A 1QPJA 5CTPA 5JQGF 2EB2A 2UZDA 5CQUA 2WQBA 2YDJA 3K5VA 4MD7E 3KXXA 4UN0C 4D9UA 5CT0A 4AGUA 3AD4A 4RVKA 4ZZMA 3BQRA 4C33A 3C4FA 5CAEB 4PWNA 4I20A 2VX0A 2NNWB 3MVMA 2PMOX 1M2PA 1V0BA 2XKCA 3G0FA 4O82A 4CRLA 5FG8A 3FI8A 5LOHA 1KJQA 3TIGA 1MQBA 1REJA 3MPTA 3R1SA 4BCKA 1UA2A 2P0AA 3IDPA 3FZPA 3IW6A 3DK6A 3FLNC 3W55A 4DFUA 2WZJA 1JNKA 3QLGA 4I6QA 5LA6F 2PULA 3RAHA 4M14A 1JSUA 1WVXA 4EHEA 2VWZA 4M12A 2XYNA 3QQLA 4RX8A 5CX9A 2YCQA 2WTCA 1PYXA 1Y6BA 1ZOEA 3QTIA 1A9UA 4BICA 4WG4A 4GT4A 5EM7A 5TR6A 3ZBXA 4XV1A 4ZS0A 5HG9A 4ZLYA 4O7WA 2XEZA 3ZDIA 3ZFYA 4HYIA 4EK8A 5J7HA 2C47A 4S30A 3ZSGA 1H0VA 4FL1A 2BCJA 4FZ7A 4DFNA 5D41A 4CKRA 2QOCA 3HV4A 5KE0A 3MI9A 5E90A 3V6RA 4FSWA 3FMLA 3A7HA 4FSZA 3FKLA 3NCGA 2H8HA 2QO7A 3L8SA 3TZMA 1P4FA 4NWMA 2R3GA 4PL5A 5IQIA 2ERZE 3IOKA 4RIXB 4O2PA 2F2UA 4BDFA 2XYUA 4EORA 1VZOA 3BG5A 4DIMA 3BLRA 2B7AA 1A48A 4FSRA 4ITHA 4LI5A 3Q5ZA 1OI9A 2C6TA 2CJMA 4HGLA 2UW8A 4IX3A 3REPA 3RTPA 4JX3A 4CLIA 4EHGA 2R0IA 4BDCA 4H1JA 2R3NA 3KVXA 5IA5A 3C0GA 1PXLA 3A8WA 2ITQA 4IB5A 4J7BA 1GGOA 3U9TA 3UZRA 4DTKA 5KMKA 2QK4A 2ETRA 5AWMA 3AT4A 4FVRA 4ZLOA 1U4DA 5H8GA 1OIQA 3TUBA 4TWNA 4H39A 3ZYAA 4AF3A 1U54A 3RCJA 5J95A 2R7MA 4PDOA 4F65A 1JAMA 4E5BA 1H1QA 3W18A 3KL8A 4XHKB 1VEBA 3E3PA 3ULIA 3Q3BA 2Y4IB 3GCVA 3CKWA 4X2KA 4FFOA 3R02A 4AU8A 2UZUE 5LXTF 5JGAA 4KNBA 4FNYA 4RGJA 2QNJA 2VWXA 4DC2A 4ANQA 4EH5A 4ZTRA 4MV7A 3CKXA 3PVBA 5M44A 2X0SA 3PXFA 3HP5A 4CD0A 5ACKA 3OOMA 5BUIA 2CPKE 2IVVA 4RPVA 4D4SA 3RPOA 4FV5A 3C4XA 2CCIA 2XM8A 2YIQA 2WIHA 2ZB0A 4HVGA 5A9UA 2JAMA 4WG3A 4PX6A 2VGOA 3TQTA 4FEWA 5FXQA 3R1NA 4XG6A 4GW8A 2XK9A 4XV3A 4DAWA 4EOPA 4QYGA 3QA8A 2WMQA 3T3VA 3V04A 4AZEA 1URWA 1J7IA 3BU5A 3PJCA 3MH2A 3A7JA 5E8ZA 2ETMA 2GQGA 1ULZA 4BZDA 4D58A 4ZTLA 4NCTA 1YXUA 3OF0A 5FQDC 4YU2A 2ONLC 2J50A 5D7AA 4Y85A 2XJ0A 2Z60A 4USFA 2WNTA 4X3FA 4MV6A 5BVKA 4R3PA 4EOMA 2X2MA 4L3JA 4W4YA 1KOBA 3PVWA 3NSZA 4FV3A 3I0QA 5KO1A 4NJDA 4AOJA 1UNGA 3PIYA 2HYYA 4WG5A 5C03A 4UWCA 5AP0A 1I09A 2QURA 4FTJA 4G9CA 3R8MA 1GAGA 5CS6A 1QCFA 2YISA 2YJRA 1HCKA 3KRRA 4MX9A 5HE1A 3ORZA 1U46A 4IZOA 4EK3A 3R7UA 1WFCA 2NRYA 2ZV8A 3DU8A 5AUXA 5BVOA 1YWVA 5ANIA 4E4NA 3PSCA 3FL5A 4O0TA 4FKWA 4U0IA 5KKRB 2C3IB 1BL7A 2X2KA 5ETFA 4RIWB 4TNDA 4ZSJA 4QP2A 4MH7A 4YHFA 3LXLA 4BCHA 3KCFA 2IVTA 2VTAA 2ZV2A 4BDBA 4AOIA 4N4SA 3TV4A 4CZUA 5KZIA 3CJGA 3FZTA 3NX8A 2C68A 3F3VA 1UU3A 3C7QA 3N8DA 4XG9A 3ZUUA 3NUSA 3OWPA 3FPQA 4FT9A 3UMXA 3LM5A 3QRTA 5AX9A 2C6MA 3R8ZA 3FYKX 3RCDA 3CP9A 2C5YA 2X4ZA 3RHXA 4IWPA 3TJCA 4IJ9A 1SVEA 2YA9A 4K18A 3VAPA 3IGGA 4KWPA 2XKEA 3WYXA 5KUPA 3C13A 4BB4A 3BPRA 1XQZA 2J7TA 3UPZA 4IZ5A 1GZOA 4IB3A 3HYHA 2B9IA 4PP9A 5EKOA 4XBUA 4OBQA 4AGCA 3ZDUA 5L8JA 4D9TA 2UZBA 3R28A 2R7NA 4FEQA 3W2SA 3ETAA 4RJ3A 5JSMA 3OUZA 4O84A 2QOFA 3VBTA 1LR4A 3P78A 5DR2A 3OOGA 4C4EA 5JGBA 5J2TF 4IVBA 2R3FA 2XF0A 5LOVF 2C6EA 1V0OA 4G6OA 2F57A 4H05A 5EHLA 4F9CA 3OW4A 4BGQA 4EOIA 4CTBA 2VR1A 4R5YA 4PTCA 5HU3A 1FVRA 4QRCA 5EM5A 2UV2A 4XLVA 2P33A 4IE9A 2E9NA 5DG5A 2IWIA 3LFAA 5EI6A 1Q97A 3S2PA 3BEAA 3KULB 2VTQA 3JXWA 4F1OA 4F0IA 2J2IB 4FKLA 3P79A 4XYLB 4HZSA 1YW2A 4ZXTA 3PUPA 3ROYA 2WQNA 2CLQA 4BBFA 4KA3A 2XK7A 5C9CA 3IG7A 4CKJA 5KX5F 1FOTA 3DNDA 4EHZA 3LFQA 5C1PA 3HECA 1ND4A 2JFMA 5TT7A 4WKQA 4ANMA 3P86A 1Q62A 1WBOA 1ZYCA 2ZMCA 3FY0A 4M97A 3ZOSA 5KBQA 2C0TA 2YAKA 3C0IA 3RAWA 2W6OA 1Q3DA 1YOLA 2GS2A 2X6DA 2XK8A 4BTMA 3I5NA 4ENYA 3MB7A 3P08A 3ORQA 4FODA 4Y5QA 3H9OA 3PA3A 2GNGA 3IK3A 2HCKA 3RP9A 2WTKB 3GC9A 4C62A 1Q41A 2BTRA 3NUPA 2VO6A 3QQUA 3UBDA 3PP1A 4M67A 3RWQA 3OBGA 3IDBA 4MV8A 3TEIA 2UVZA 4G16A 5L2WA 4FTMA 4C61A 3BIZA 4XV2A 4O38A 3Q2MA 4B0GA 3SC1A 2ITOA 3H10A 3R0TA 3H9RA 3VHEA 2OBJA 3JY0A 3MH0A 4FSNA 3SX9A 4EG0A 4CFVA 5F94A 3KGAA 4IHPA 3UIMA 3UP7A 3EFLA 3CR0A 2JBOA 2VTRA 2W05A 5J9YA 1MQ4A 3KN5A 4MBIA 2PSQA 3ALNA 2ESMA 4FYOA 5I9XA 1IR3A 3ANQA 2BMCA 3C5UA 3QC4A 3KXMA 2Y6MA 4J99A 3FMJA 3IDCA 3JRXA 3VUIA 5A6NA 2XIZA 2BZKB 1XR1A 2WQEA 3FY2A 3OT8A 3PA4A 4MBJA 4QMZA 4CFMA 2RFEA 4E6QA 5BVNA 3OEZA 5DLSA 3VN9A 3OUNB 3VS3A 3FHIA 3A99A 3QLFA 3W1FA 4K0YA 3PE2A 2OIQA 2R3RA 4H3QA 4RWKA 3F5XA 3KAJA 1CDKA 4FEUA 2CNUA 5I9VA 3FMNA 4EQUA 4QTBA 3CY2A 4A9SA 2BKKA 3O23A 3A8XA 2WMUA 3E88A 3E62A 1LEWA 5CSWA 2XM9A 3WILA 2ACXA 4FBXA 5A3XA 5BX0A 3FSFA 2W96B 3R7VA 1KJIA 4RC4A 3MTLA 1UWJA 4FFRA 3VC4A 3AG9A 5EYDA 4HR7A 2XJ1A 3AOXA 3BV3A 2GNLA 3C4CA 3DV3A 3F88A 2YABA 4H3PA 1WBTA 4G31A 4KSQA 4CMTA 2CKPA 2R7IA 1MP8A 4GG7A 2UZNA 4DFZE 5KMOA 2IW8A 2OWBA 2ITVA 4ITJA 3DQXA 4RSSA 3RPSA 2EXCX 3N51A 5A4TA 3KB7A 1XJDA 3OTUA 2YZAA 5LVNA 4KRDA 4ZQIA 3EQDA 4KINA
chains in the Genus database with same CATH superfamily
4NTSA 4O7ZA 3FL4A 4O0RA 4NJ3A 3QD0A 4FIFA 4IADA 4GYIA 4M68A 2QB5A 5JRQA 5AEPA 4CKCA 1YI6A 3F5UA 4EK4A 1CTPE 3RUPA 2JKMA 1ERKA 3BGZA 3U54A 4FKTA 5I5VA 3L1SA 3UMWA 1Z2NX 3EZRA 3F69A 4IAKA 4RIOA 3E8EA 4WO5A 5M4CA 5CU4A 2C00A 1J1CA 2B53A 5CU6A 4L3PA 4PV0A 5JFXA 2R3HA 2OIDA 4TYHA 5JQWA 4UBAA 5LWNA 2PVLA 5M56A 3I1AA 3PVUA 5DEWA 4BHNA 1RJBA 1JDBB 4GIIA 1VKZA 3ZBFA 4CT2A 3D94A 3GOPA 3KY2A 2UZWE 3MBLA 4E5AX 2R3OA 3LLAA 3P7AA 3DDPA 3LJ1A 3QZHA 3V5PA 3VUKA 2BRBA 1GJOA 4BVUA 4DEAA 2Z8CA 3Q4TA 3VBQA 4Q5HA 3I7BA 2CCHA 2Z2WA 4QMPA 3VJOA 3KK8A 3LFSA 2LAVA 4EK6A 2QR7A 4FOBA 4LOQA 4AN3A 4RZQA 3LZBA 3PSBA 3RM6A 1Q8WA 2WOUA 1SMHA 4DEBA 4NZNA 4EYMA 2PZIA 3KQ7A 5LCKA 2WMAA 5FBOA 3RI1A 2OLSA 1H00A 2HGXA 3FZRA 2HY0A 1VR2A 3IOPA 3I7CA 4V05A 4YZDA 5HCZA 2HXLA 1RDQE 4FSQA 4EZ5A 5BMSA 2W71A 1V1KA 5CT7A 2X0GA 3TMOA 2QCSA 3MH1A 5BV3A 4O91A 4CMUA 1XMMA 3OXZA 4A9UA 4JXUA 3O51A 5C8NA 5AP2A 5IQAA 4W8EA 1I7NA 2CGXA 3ITZA 4N0SA 5AM7A 3W8LA 3FI3A 4CE5A 5J9LA 4CFFA 4DGMA 4DGGA 3R8LA 1IASA 4TRLA 5DRDA 4AE9A 4E7WA 2P0CA 1W8CA 4QQ5A 4R6VA 3HA8A 5BPHA 2O5KA 3A4PA 2C6IA 3JPVA 4IEBA 4TW9A 3MFSA 4U44A 4ZP5A 4I4FA 1Z57A 3RPVA 1OITA 5I4NA 3DTFA 5HX6A 2X81A 2BDFA 5IA3A 1KC7A 1Q99A 2PPQA 4BDIA 2HGWA 5M06A 2PUIA 1SM2A 3TUDA 2W4JA 3VIDA 3UFXB 3U51A 1NA7A 4USDA 3A62A 3F2NA 4KBAA 4IVCA 4C4JA 3DAEA 4QQTA 4F7NA 4EH7A 1CKNA 2YACA 4EH8A 4A9RA 1NVRA 5HE2A 4AE6A 3PSDA 4F1MA 3QQGA 2VRXA 5DOSA 1ST4A 4H36A 4IDTA 4YGAA 2PU8A 2VWBA 4IBMA 1W83A 4ZZOA 2WMTA 2VWVA 1H07A 2GNFA 4DINA 3NVMB 2ZGIA 4F6UA 1B39A 2WMVA 3R63A 4GJ3A 4NKAA 3FHRA 4O7YA 3D14A 4ZTSA 3ZO1A 3TIZA 3TNPC 3KRXA 1KT8A 1OVEA 1PMNA 4JL9A 5KHXA 1WZYA 3DB6A 3FAAA 5DEYA 3MPMA 4HVSA 4MV3A 4MAOA 4GLXA 3NR9A 2P2IA 4IC8A 4K1BA 3OROA 4P2KA 3R7OA 5IQEA 2NUAB 5DHJA 1JOWB 4BDEA 4L68A 5ANJA 2BAKA 4BHZA 5I9WA 5F20A 3VUHA 5AADA 1WCCA 5IZFA 2C69A 2C6LA 3GB2A 4GG5A 4BBEA 3EQHA 4PTEA 4R7BA 4RVMA 5AP4A 5HKMA 2RG5A 1I44A 2DABA 3GCUA 4JI9A 3TCPA 1WBNA 2R3KA 3UVQA 1OKYA 2BROA 5CA1F 5IDPA 3QQJA 4C4FA 3A7GA 2QO2A 2VTNA 4PDYA 5A14A 1I1LA 5AJQA 3GXLA 3WI6A 3TKUA 4C35A 3QALE 1IOVA 4IACA 4FTUA 4AAYA 4K2RA 5I47A 4OR5A 3EL7A 4WNMA 2F4JA 3WOWA 3SA0A 3EQGA 4RX7A 5LJJA 1GIIA 3HRFA 3QKKA 3F7ZA 4YAKB 5CF4A 1OBGA 2HWOA 4U8ZA 3TIIA 3SRVA 4FZDB 4EJ7A 5IEXA 3WF8A 1GSOA 5HORA 3I81A 5IUGA 2BZJA 3R1YA 3G0EA 1SVHA 4FSMA 3WF9A 3BA9A 3K5HA 2WO6A 4FJVA 4IX6A 2WQOA 2EJ0A 3D9VA 5HIEA 1W93A 2R4BA 1MRUA 3CSVA 3UIXA 4B6LA 2RGPA 1SCUB 1CQJB 5GIOE 5J8IA 3VQHA 4FG7A 3KXHA 5DWRA 4GFMA 1Y91A 3VMMA 4QT1A 1Q4LA 3CY3A 1H26A 4L45A 3LQ3A 1JSVA 2W17A 3VRYA 4QMLA 3O7LD 3QFVA 3KXGA 4M9UA 4D2SA 3V51A 1H24A 2ITTA 3D5WA 3SLSA 4CKEA 2R3LA 4N57A 4S31A 4DEGA 2FPIB 4MWHA 3VBWA 4RZVA 2QLQA 3QGYA 3B8QA 1M7QA 4FKIA 4TPTA 3R7IA 4I50F 4EOLA 1YOJA 4RLLA 2VQDA 4U40A 3JVRA 3AC1A 4CNHA 1WR2A 1UU8A 3PJ8A 4G17A 4S2ZA 3D7TB 3WF5A 5IH4A 4HVIA 2QR8A 3QHRA 4KBCA 4YBZB 5FRIA 4EOJA 4EKKA 5L2IA 4BGHA 4RCNA 4C4IA 5L3AA 2PVKA 3QL8A 3TZ7A 2C5OA 2R7KA 4EONA 2E9PA 4CC5A 2JIIA 2PVYA 2PVMA 2W4KA 3W10A 3NUNA 4HPUE 5B0XA 3P4KA 4A06A 3UQCA 4NL0A 4TWPA 2ETKA 1ZOGA 2FSMX 2HELA 3NNVA 4OTQA 5D8DA 5LP6F 5HNBA 2FP4B 3N9XA 5EQPA 3ALOA 4ALVA 1PRYA 2QOIA 2WAJA 3H3CA 3QBNA 2GTMA 4K11A 5E8XA 4PDSA 4D1XA 4FKPA 4I1ZA 5C4LA 3FLWA 5K9IA 1WVWA 3Q6UA 4IX5A 4B9DA 2QOKA 3UDSA 3UGCA 4Z16A 4KAOA 2V5AA 5AIRA 4UV0A 2B9HA 5HBRB 4GT5A 4RVTA 1EYZA 4M7IA 3BCEA 4Y73A 1J3HA 2BHHA 2XJ2A 4RZWA 5EQYA 5CE8A 3DFAA 2HIWA 3FMDA 5DH3A 5DR6A 4AXAA 3U6HA 4DT8A 3W0MA 3HMMA 4ID7A 4FNWA 4NKSA 4H3BA 5CVGA 5IUIA 3O5AA 3UNZA 3Q32A 4GU9A 1ZYJA 5CU2A 5HLNA 2HGSA 3Q1KA 3ANRA 4XG4A 2V7OA 4UWYA 4UZDA 3U9NA 2O0UA 4Y72A 1ZYDA 3NEWA 4QP4A 4UXLA 3T9CA 3PXKA 4BCIA 5E8TA 3QWUA 4AS0A 3A4OX 4NSTA 5ETIA 4CRSA 3LXPA 1KV1A 3V4SA 4NCTC 4V0GA 3MW1A 4MV9A 3FQSA 1Q24A 3R7YA 2H96A 4QYYA 1KE8A 3ZCLA 2FGIA 3GGFA 4YNOA 4IDVA 4UZHA 4X3FC 4QNAA 2OU7A 4KIQA 2REIA 4AAAA 4WA9A 3DKFA 2VAGA 1YWNA 4OT6A 5CXZA 3QXOA 3I60A 5E7RA 3VF8A 4BKJA 3BL9A 3MTFA 3OEFX 4J96A 1PK8A 3L8VA 2OG8A 4FI1A 4X21A 4DEDA 4LMUA 2VWYA 3F3UA 1Q3WA 4FV0A 3EH9A 2NRUA 3F2AA 3ORNA 3OXIA 3PZHA 4O7NA 3S95A 5GONF 5BWTA 1YI4A 3P5KA 4I94A 3KIOC 2WXVA 3VS7A 2XIRA 2ERKA 1YHWA 2X2LA 3VJNA 4DH7A 2OGVA 1WBPA 2WPAA 1J91A 1GZNA 1XH8A 2J5FA 3G9NA 3A7FA 1T45A 2BPMA 2H9VA 2V55A 1W7HA 4QP6A 2YZLA 4FK3A 1KTAA 1OBDA 2YJSA 4TT7A 5HE0A 4B4LA 2QOHA 3W2CA 4DH5A 1O6LA 3T9TA 2BRHA 3FMKA 2R3PA 4FOCA 2FPGB 2PE0A 2V5QA 5HI2A 4K77A 3VUMA 3EKKA 2X7FA 1UVRA 4GEOA 4XLIA 4W8DA 4RFYA 4D0XA 4KBKA 3LP8A 3N4UA 5HU9A 4ZSEA 4MEDA 2X8IA 2R82A 4U5JA 3W0RA 2XUUA 4CTCA 3L9LA 2Q2TA 4HYSA 5DPVA 3UDZA 2R86A 2AUHA 1DIKA 1H01A 4JBQA 4CEGA 5KBRA 5HD4A 3NDMA 1TAEA 2VWIA 3DKGA 3E5AA 3GB8B 2QI8A 4P4CA 4WD5A 3S3IA 3SD0A 4JNWA 1DS5A 4JBPA 3UP2A 3BX5A 5FEDA 4NTTA 2XRUA 1V0PA 4UWBA 5A6OA 2FPPB 3GI3A 4ZTQA 3Q6WA 3QQHA 3CXWA 1A9XA 3T99A 4FTTA 3Q4UA 3ZLXA 4AW1A 4U45A 4DCAA 4G34A 2YWVA 1TQMA 3VWAA 2G15A 4XNEA 3D83A 3MIAA 1DGSA 3F66A 2B4SB 4QP7A 4XOZA 2HDKA 1EUDB 5EHYA 3A7IA 2VZ6A 2COGA 3FQEA 4OGRA 4RX9A 3PVGA 4Q9ZA 1GY3A 5CEPA 3O50A 1UNLA 4X2FA 4O7TA 1S68A 2V58A 4EEQA 4F7LA 4C2VA 4F9BA 3E92A 5FTQA 3QC9A 5GHVA 4L52A 2IJMA 3W0PA 5H3QA 4IM2A 2GPHA 4KUJA 3ORMA 5DYJA 2VTIA 2ZM3A 3F5PA 4L8MA 3A61A 4RFMA 3SXRA 2J9GA 4LOOA 3IW8A 5JKGA 3SG8A 4L7SA 2BZIB 4KKEA 4AA0A 2PL0A 3PY3A 4UB7A 3UQFA 4BTKA 4ZIMA 3NGAA 4QTEA 2ITPA 3MB6A 1YDSE 4QMTA 2IW9A 1XDNA 4QTAA 2W9ZB 3RV3A 3G15A 3OW3A 5JFWA 3LPBA 2B0QA 3UNJA 5HVKA 3I6WA 3JRWA 3FMMA 4FE2A 2BALA 4RA4A 1OIUA 1SNXA 2HENA 3LVPA 4CV9A 3KEXA 1EKVA 1G8JA 5FM3A 3DTGA 4QMVA 2X1NA 1E4EA 2ZDGA 2G01A 3MWEA 3PUFC 5K3YA 1FBNA 3DAKA 4Z3VA 2VO0A 5L6PA 3CC6A 3HRBA 3LFCA 4I21A 4BI0A 4FKVA 2OFUA 2PZPA 3TWJA 1KUTA 3OVVA 4GUBA 3QWJA 1KE5A 2UZOA 1JBPE 4ANLA 2XNPA 3OXTA 4FV4A 3T7AA 3WZJA 3EJ1A 1YXVA 4M0YA 4X7QA 4ZTMA 5DGIA 5CWZA 4BTFA 3ZEWA 1A06A 2F49A 3DXPA 4FTIA 2NU8B 3FZOA 2R9SA 4I5PA 5DVRA 3NBZB 3UYTA 4MAMA 4YJVA 3HAMA 2P3GX 4O0VA 5HCYA 2RIOA 1PHKA 2W7XA 2YYAA 3DGKA 1OKZA 4XP2A 5CANA 4FGBA 3R5HA 3LJ2A 3R8UA 5E4HA 1ST0A 2Z02A 2CN5A 4O6LA 2ITZA 5EYKA 4GSBA 4Y83A 5BUEA 1STCE 3HV5A 5E9EA 1ZRZA 3R2YA 4L46A 3PYYA 4P90A 2RKUA 3B2WA 2BFXA 1UU7A 4ACMA 4IVAA 5I5XA 3VS6A 4DAAA 3W2OA 3UIBA 3BU3A 4ACCA 3R7EA 2HY81 1M52A 1ZOHA 2YCSA 4F9WA 2Q7DA 2I40A 2XNMA 3COMA 3BYMA 4PMMA 1VJYA 4ZS4A 3DAJA 3PXQA 3HP2A 3RWPA 1OPJA 2VTOA 3MFRA 3QA0A 3KMMA 4QYHA 2VO7A 3LLTA 4RWLA 5IF1A 1ZMVA 3FXXA 5FEQA 4TKSA 3GT8A 2JKOA 4O0UA 3MESA 4XBRA 2X39A 4CSVA 4E1ZA 4ZAUA 3QUPA 4Q9SA 2YIRA 1OKWA 2R64A 4IC7A 3ZXZA 2BTSA 5L8KA 1NT2A 5DT3A 3C51A 3AKJA 5BVEA 1JKLA 4CXAA 3Q60A 3FKNA 4U80A 3RK7A 4EUUA 3RNYA 1EZ1A 2UVXA 5EW8A 4O4JF 4WBBB 4AFJA 5CASA 2OXDA 3MS9A 2IN6A 3Q52A 4FEXA 3OS3A 1KE7A 5HNIX 4QYFA 4AP7A 4F78A 3VPCA 3PIZA 4XV9A 4YP8A 3RGFA 4FFLA 5KX8A 4FKUA 4F7SA 5JMSA 2RFDA 4JQ7A 4LRMA 4DA5A 4ZTNA 3WNZA 4MK0A 3OZ6A 3F7WA 4BZOA 5CU0A 3NRMA 4JQ8A 3OTVA 3VS2A 2C6OA 1CE8A 2HJWA 1UV5A 4X6QC 4DEEA 4GKIA 3U9SA 3QTZA 5ANGA 4DFYA 2FO0A 2I87A 3UPXA 4EI4A 4FKOA 4OTHA 4QMYA 5F4NA 3KC3A 5CLPA 4L44A 4MV4A 3U4WA 2O65A 3QGWA 3FYJX 3KALA 5LXMA 2XMYA 3RK9A 4R3CA 2CMWA 5EDRA 4EKLA 5M51A 4RIYB 4TZRA 3R9NA 2W6NA 4J71A 5DNRA 3AC8A 3UO5A 1F5QA 1R1WA 1IA9A 4F6SA 4DCEA 4ZLZA 1FQ1B 1GNGA 5B2KA 5DIAA 2XIXA 3FZSA 3LCDA 5T6KA 4FKSA 4ASZA 4FEVA 3BBTB 3HX4A 1Q8ZA 5CZHA 5AUWA 4MQ1A 5F9EA 2PVRA 2ZDTA 4ZK5A 1P5EA 1GSAA 2CHLA 4FL3A 4LFIA 5B7VA 1R39A 4PMSA 4EHVA 4CMFA 3ML1A 4YB8B 2VX1A 4C4GA 1GZKA 2AC5A 3CQUA 3D2IA 2OJJA 4QMUA 4HCTA 4PMPA 3COKA 3NFFB 1H25A 5JVDF 1MUOA 2JGZA 3ZZWA 3QZGA 4YBKA 4NM0A 3S00A 4MNEA 4RJ7A 2O63A 3VW6A 4FV6A 2WTJA 3MJ1A 3WWJA 2NYAA 1JWHA 3MN3A 3R73A 1M2QA 4HOKA 1YHSA 3HA6A 4BIDA 4NIFB 5IH6A 5C8YF 4GL9A 3EL8A 5CY3A 3TZ8A 2YS7A 2EUFB 4MTAA 1KWPA 3NYNA 2JIUA 4L3LA 2QONA 3ACJA 1XH6A 2BILB 2VTSA 3NZ0A 4PNKA 5EKNA 1JSTA 2BUJA 2XZSA 3MIYA 2HW6A 2VNYA 1ZMWA 3S4QA 2PMNX 2PTKA 2YM4A 4E20A 3KKVA 3U87A 1I1KA 3DS6A 3QQKA 3W0SA 3LFBA 3VVHA 2V62A 2OJGA 1PXIA 3QQMA 3PTGA 2YRWA 3CIKA 2RG6A 2GQRA 3KMWA 4I5HA 5IMXA 5IA4A 2YZGA 3JSLA 3VO3A 1NVSA 4KB8A 3FZ1A 3N4TA 3R9OA 5G1XA 5TKDA 2QHMA 3UO4A 4BDGA 2QHNA 3OHTA 4FG9A 4FKRA 1FGIA 3FI4A 1O6YA 4GVJA 3HAVA 4MXOA 4ONAA 4P5ZA 4R1YA 3ODYX 5CNOA 5AV3A 4ZZNA 4YZMA 3ZSHA 1JKSA 1JDEA 3ZU7A 4X6RA 2Z7LA 4IVDA 4E6CA 2VGPA 2WMRA 3EIDA 3R71A 4IZAA 4IZYA 5AP6A 4F6WA 3AX6A 5K4JA 3P5JC 5IU2A 3TY9A 5D9HA 2W5HA 4NM7A 3MFTA 5HESA 4R1VA 4EC8A 4DTAA 3AC4A 3SXFA 4RRVA 5D7VA 4J1RA 4GIHA 4O0WA 4YSJA 4YTCA 2Y6OA 3GENA 2VN9A 2W1FA 4QTDA 2A0CX 4FZAB 4YTIA 5AA8A 4GK4A 3UIUA 5B2LA 1U54B 4BR3A 5CF8A 1KOAA 3COHA 3ENMA 3WF7A 4OTGA 5DFPA 2ZDHA 4ME6A 4KIOA 3VHKA 3BE2A 5JN2A 4ZJIA 2DUVA 4IX4A 4NUSA 3V5WA 3H9FA 3BE9A 2Q83A 3TM0A 3W32A 4ZI7F 3M1SA 3MFUA 4ACDA 4XZ3B 2YZNA 1Y8GA 3LMHA 2GNHA 1EH4A 3ACKA 2O3PA 4W4XA 3L2PA 4EQMA 4YMJA 3UE4A 5BPFA 3OG7A 2UZEA 1P2AA 2KTYA 4TYGA 2IVUA 3FJQE 2G2FA 4D4RA 3HMOA 4F08A 3O2MA 3CLYA 3BHTA 3WF6A 3JZIA 4XUFA 2R87A 1XBAA 2XP2A 3R21A 2PZ5A 3QTUA 1OUKA 4I24A 3UC3A 3Q4CA 4UCUA 4JX7A 4FZFB 2E2BA 4ALUA 2QO9A 3FMHA 4YJTA 5HQ0A 4CCBA 3AW8A 4MD9E 3CQWA 3H0ZA 4FUXA 4FT3A 3E7VA 5LARA 4A9TA 3UZTA 4XRJA 3WO0A 5FTOA 4EQCA 3LFFA 4X3FB 4I92A 4YJOA 5CXHA 2BAJA 1OL5A 3UOHA 4E26A 2J90A 2R3IA 5KHWA 2Z7QA 2EIYA 3KCKA 5I9ZA 4HGSA 2Y4RA 2JKQA 2UW0A 3AKLA 2PUUA 4D4VA 3CPBA 2IZSA 1XBBA 3Q04A 3ZONA 4ZY5A 2HXQA 4G9RA 2HWPA 2CKEA 2PVHA 4NH1A 4DFLA 3SW7A 4FT5A 1F0QA 3BWJA 3MV5A 4K8AA 5HBJA 3C4ZA 3TY8A 1EUCB 4Z7HA 3FXWA 4AQCA 1IA8A 1E1XA 2X6EA 4XEYA 3U4UA 3OC1A 4BTJA 4P7EA 5T68A 4Y8DA 2C1AA 2F7EE 4V01A 3TJDA 3TNWA 3WARA 4I0RA 3R5FA 2ODTX 1G8SA 1UC8A 4Q4DA 2W70A 2C4GA 3RZBA 3FV8A 1H28A 4FTLA 3I6UA 4AXCA 1X8BA 3G33A 3E93A 3R23A 3IW5A 2GNJA 4Q2AA 4IJPA 4IB0A 2VWWA 2ZB1A 5DN3A 3NCZA 1UNHA 1OKVA 3EWHA 4APCA 4KIPA 4ZY4A 1W0XC 2X5RA 4I6BA 3LCKA 5A4CA 1BI8A 3QX2A 3SVVA 1M0WA 2W6PA 3EHAA 2EXMA 3NNWA 4I22A 3EB0A 4RJ8A 4IIRA 3MWUA 4QQCA 5C4KA 2GPSA 2QG7A 5IEVA 2YM7A 4YURA 3ORKA 2B55A 2R5TA 4PMTA 1PYEA 1MRYA 1Q8TA 3GVUA 4FV8A 3DZQA 3NAXA 4QMWA 4BDAA 1S9JA 4YC6A 4I55F 4AZVA 1WAKA 2BIKB 2I0HA 4YTFA 2QOLA 3CTQA 3MPAA 2ITWA 4HGTA 4O86A 4WRSA 1OIYA 3NBYB 1E9HA 3JS2A 4D55A 4F64A 1H1PA 4QSHA 4JS8A 3JZ6A 4WOVA 2P2HA 3HLLA 4QNYA 1DV1A 4G3EA 3IW4A 4RFZA 1CSNA 4O21A 3V6SA 2VTJA 3GEQA 3NYXA 4CV8A 2ZJWA 3T9IA 3KN6A 2HIXA 5H80A 3L9NA 4JDIA 4XP0A 4WHZA 2YERA 1XH7A 3AQVA 4JR7A 4YJ2F 3IS5A 4FX3A 3HGKA 2Q0NA 2QQ7A 3QKMA 4XG2A 1FVTA 5DAAA 4BJJB 1PJKA 4O7SA 1QL6A 4G3GA 3SKCA 4DYMA 4RX5A 5IYZF 2DWCA 3OD6X 4GFOA 1WBWA 1K2PA 4R7HA 3W1BA 2WIPA 4O7RA 3UVPA 2G9XA 1H0WA 5T3QA 2XB7A 4ZMEA 4LRKA 5M4IA 3CQEA 4BDDA 4X0MA 3OUUA 4U6RA 4X2NA 5HNEA 3R1QA 4C5BA 3NW7A 3ORLA 4FTCA 2CKQA 1IOWA 2BAQA 1GIJA 2PMLX 4NYEA 3OY1A 4QOXA 4G1WA 4W4VA 2EWAA 4ZTHA 3OY3A 3VOTA 4DDIA 5FTGA 4TVIA 5BMMA 2WHBA 3CTJA 4EGJA 4YJSA 3FE3A 3FMEA 2A4LA 3LMIA 4EH9A 4MYGA 1ET0A 2OZAA 4FK6A 5CAUA 3H4JA 4RT7A 3AC2A 3C4WA 4PZ6A 4YZCA 3SE7A 4E4XA 1KJJA 3PY0A 4IAAA 4JDHA 3QCYA 2OH4A 3VS1A 1BUHA 4M3QA 3ZUVA 4AA4A 1BMKA 2W1IA 4BI2A 2C5XA 2J0LA 3UTOA 1M7NA 5EDQA 4DG3E 2EJ2A 4ANBA 2XCLA 4I6FA 4Y8VB 4WNOA 4TN6A 3UG1A 1T36A 3BACA 4C5CA 1FMKA 5GINE 4MF1A 1LPUA 4JMQA 4PQNA 3TV6A 4PP7A 3DK3A 2RF9A 4E6DA 2YAAA 3BELA 4AW2A 2B9JA 1Q61A 3U9CA 5CEMA 4Y95A 3PFYA 1K3AA 2DLNA 3G90X 2B54A 3JUHA 3RALA 5AV4A 5FPRA 4O7VA 5JRSA 3TNIA 3C0HA 4RBLA 4DHJA 3LAUA 4MQ2A 3DXNA 3LE6A 3TN8A 4YJPA 2HAKA 2Y9QA 4TYJA 4FIGA 5E91A 3ORPA 4EH4A 3MVLA 2JDTA 2A19B 4XOYA 5CAOA 3O17A 4BRXA 1R78A 2OIBA 1PXMA 3NNXA 4I23A 4FTAA 5IQGA 5DGHA 1M6VA 4FV9A 4G5JA 3DBFA 3A60A 3BKBA 2H34A 4TYEA 5AV2A 4DHFA 4GK3A 2DAAA 3EFWA 5HG8A 3SDJA 2XANA 4AGDA 3W1GA 2GHMA 1FVIA 3DY7A 4J8NA 1OMWA 3HEGA 3I79A 4JQEA 2X7GA 3FLZA 5EZYF 2YN8A 3KXNA 2PE2A 3HMPA 2GDOA 3HMNA 1FINA 5ANEA 4C37A 5ICPA 3ERKA 3QD4A 3PRIA 4FYNA 4LQMA 3LQ5A 3CEKA 4LDTA 3GCQA 3DKOA 4FNXA 5LVPA 4L9IA 3BU6A 5JEBA 5BWVA 2WQMA 2XKFA 3R30A 3P0MA 3KREA 5I5YA 1DI8A 3CGOA 5GJFA 4C0TA 2VWUA 4RQKA 3HUBA 2WFYA 3KU2A 3LQ8A 3BV2A 3BLAA 3PLSA 4DH1A 1KV2A 4M8TA 3HNGA 5I0BA 1ZMUA 2J6MA 3LCOA 4EGQA 4OTIA 5EYMA 2PBZA 5CVFA 3CEBA 4OBPA 3AMYA 4RG0A 5D1PA 1JLUE 1XKKA 2QC6A 3PA5A 3E3BX 4YHTA 5CEQA 3TKIA 1PY5A 3QYZA 3WZDA 4C7TA 1EHIA 2JFLA 5AP3A 4DEIA 5JK3A 1W82A 1P8LA 2PN1A 2BHEA 1CKPA 2XALA 3G2FA 2FA2A 4QPSA 4BCQA 2UW5A 2BRGA 2XNNA 4MUQA 4UCRA 1CMKE 3FUPA 4LV5A 4NZOA 2WGJA 5GJDA 2YIWA 4OT5A 5JFSA 1H08A 2GU8A 3BL7A 2R3QA 4N6YA 1O9UA 5TOZA 1OL2A 1DAAA 2HVRA