5DISC

Crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
289
structure length
264
Chain Sequence
b'GSMEELSQALASSFSVSQDLNSTAAPHPRLKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 64
structure length 264
sequence length 289
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5disC00
5FPRA 4CC5A 3KYHC 4UCOA 3TY5A 3QWUA 4EFBA 1P8LA 1CKNB 3NC0B 1CKOA 3W1GA 1TAEA 2HIVA 1XK5A 3VNNA 4LH7A 1X9NA 3TY9A 2CFMA 4PZ6A 5D1OB 3TY8A 3W5OA 4LH6A 4EFEA 4CC6A 2Q2TA 1S68A 3BAAA 1DGSA 3BA9A 3RR5A 4GLXA 2Q2UA 4PZ7A 1CKNA 1CKMA 5D1PA 4UFZA 2HIXA 3BA8A 3S24A 5FPOA 3JSNA 3GDEA 3NBZB 3GB8B 2VUGA 1V9PA 1B04A 4EQ5A 5D1OA 1XDNA 3JSLA 2OWOA 1P16A 4EEQA 4DRFA 3UQ8A 4UCRA 3L2PA 3NBYB 3BABA 2HVRA 3W1BA 3RTXA 3PN1A 1FVIA 4UCVA 5DISC 1A0IA 1VS0A 2HVQA 3GJXB 4UCTA 4E6NA 4UCUA 4PZ8A 2HVSA 1TA8A 4UCSA
chains in the Genus database with same CATH superfamily
4CC5A 4UCOA 3TY5A 3QWUA 3TIGA 1DV1A 3KALA 2QK4A 4O4JF 3U55A 2R86A 2DABA 3W1GA 3SE7A 3T54A 1A0GA 1KJ8A 3I12A 1XK5A 4I55F 3VNNA 1GGOA 4XYLB 3E5NA 4E4TA 3UZBA 4UUGA 3R5HA 2PBZA 5I5VA 1IYDA 4K6NA 4CKCA 1T36A 1ZAUA 5IYZF 3TY9A 3R5FA 2EJ0A 5D1OB 3DTGA 4EG0A 3TY8A 3RV3A 1CE8A 5KS8A 2GPSA 4EFEA 1E4EB 2OLSA 4FFLA 4CC6A 1AUXA 1ET0A 4L1KA 1M0WA 4FE2A 4XX0B 1KJIA 5E25A 5DGHA 5I5YA 4HQ6A 4NZNA 4CKBA 1C30A 4PBCA 5DAAA 5J2UF 4EGQA 3JZIA 4DQNA 2YYAA 1I7LA 3CSWA 3HBLA 5LYJF 5K2MA 5LA6F 2W71A 4O4HF 1GSAA 1EZ1A 1M0TA 4IWYA 5DGIA 3UFXB 1KJQA 4O86A 1WRVA 4C5AA 4CHIA 3JSNA 3GLKA 3T7AA 3NBZB 3BG5A 4NZOA 2W70A 2VUGA 3T9DA 1I1KA 3V4ZA 4XYMB 1XDNA 5BWVA 3RV4A 3AW8A 3PFFA 4O84A 4DRFA 4RCNA 2NU7B 4UCRA 5I5TA 4Q4DA 3BABA 1UC8A 2YS6A 3CEBA 4MV9A 5FNVF 3PN1A 5JQWA 1GLVA 5BWTA 5CA0F 5CE8A 4C5CA 2HVQA 4E6NA 2YZNA 4ZOLF 4TV9F 2GQSA 5I5UA 4JXUA 3R23A 5I5SA 1TA8A 4DAAA 4PZ7A 4WHXA 1I1LA 3Q2OA 1E4EA 1CS0A 5FPRA 2YRWA 3VPBA 1Z2NX 3GIDA 3DAAA 5LXTF 2HGSA 4CMDA 4FFMA 1KJ9A 3TW6A 2ZDHA 3K5HA 1A48A 1BXRA 1I1MA 3LULA 3JZ6A 4LH7A 3VPDA 1W96A 2CFMA 4PZ6A 1UC9A 2HHFB 5BWUA 3WNZA 4LH6A 2ZDGA 4YJ3F 2I87A 3HO8A 2Q2TA 3U54A 1IOWA 2VPQA 3BAAA 1OBDA 2HGXA 2Z04A 2EIYA 3LQSA 2EJ3A 4O83A 3T9FA 1DGSA 2I80A 4O82A 5BPHA 3KAJA 4NYEA 2YZLA 4O7VA 3U9TA 5EZYF 5J2TF 1CKNA 4TVIA 4DIMA 4GLWA 1KEEA 4O7NA 4HR7A 5HNEA 2XD4A 4O2BF 4O7ZA 4UFZA 2HIXA 2HGWA 2ZDQA 4FFNA 1IOVA 5FPOA 3S24A 3GB8B 3U0GA 5I5XA 1Z2OX 2VQDA 2Y4RA 1V9PA 1B04A 4EQ5A 4IZOA 2NU8B 4FFOA 1DAAA 1I2LA 2CZGA 2NU6B 3QFFA 5C8YF 4MV3A 1VBGA 3OUZA 3UQ8A 3NBYB 4ME6A 3N6RA 4YB8B 2HVRA 3DTFA 3W1BA 3TEKA 5LP6F 3RTXA 1KT8A 2Q7DA 3LWBA 1JKJB 2COIA 4DLKA 3WWHA 1EUDB 1W93A 1EYZA 4YAJB 5CM0A 3GJXB 5JVLA 2Z02A 4UCUA 5I60A 1CQIB 4PZ8A 2FP4B 3TW7A 4ZQIA 2HHFA 1AUVA 4UCSA 2DZDA 3WO1A 1I7NA 1PX2A 1KJJA 3U9SA 2X5RA 2YZMA 4EFBA 1CKNB 1P8LA 2YRXA 5BYAA 1M6VA 3WWIA 4O7RA 4M9UA 3ORQA 4C5BA 4O7SA 1TAEA 3SGIA 2DAAA 2HDKA 4WBNF 1EKVA 2R87A 4O4IF 2A1HA 2R7KA 2W6ZA 3MJFA 3KAKA 3OUUA 2HG8A 3BACA 2V58A 4I50F 1WR2A 3TIIA 1B6SA 5C1PA 3DF7A 1CQJB 2FB9A 2PN1A 2W6PA 3G8CA 3UZOA 4TUYF 1KTAA 2X0SA 2NU9B 2C00A 3BA9A 3T99A 2R82A 2QF7A 4O7TA 1ULZA 2YL2A 4MAMA 3JRXA 5BPFA 4FFPA 1A3GA 3HT5A 4MV7A 1CKMA 2DLNA 2GLTA 3VMMA 5D1PA 5I5WA 3T9EA 4HNUA 2GQRA 5CB4F 2QB5A 2IP4A 3BA8A 4CE5A 3K3PA 4TM5A 5GONF 5CR5A 4Y8VB 1EUCB 3WO0A 2W6QA 2PVPA 2COJA 4I4TF 2OWOA 2V59A 1P16A 4FFRA 4EEQA 2ODTX 3Q1KA 2GPWA 3VOTA 5H80A 2FPPB 3L2PA 4YBZB 3KREA 4MA0A 4M0JA 4XZ3B 3NUAA 5DISC 2R7LA 2R85A 1I2KA 4MV6A 1EKPA 2J9GA 1JDEA 3SNOA 2YW2A 1PK8A 2V5AA 2HJWA 1JDBB 2FPIB 3VPCA 1GSOA 1KUTA 3KYHC 4ZHQF 3QQMA 3K5IA 4YAKB 1EHIA 2DWCA 3T9CA 2R7NA 3NC0B 1Z2PX 4ZI7F 5LOVF 1CKOA 1A9XA 1EKFA 3AX6A 2VR1A 4NZMA 1DV2A 2HIVA 2ZGIA 4Q4CA 5D8DA 3RFCA 4QSHA 1X9NA 5CA1F 1C3OA 2CNQA 5JQGF 4O2AF 3T9BA 4CKEA 3T9AA 2CNVA 3W5OA 4O7WA 2R7MA 3R5XA 2SCUB 2CNUA 2EJ2A 4YJ2F 1S68A 5BWXA 5BYBA 3RR5A 3VA7A 5KX5F 1VKZA 4GLXA 1KBLA 2Q2UA 4O4LF 5JVDF 1VBHA 5HBRB 3HB9A 3LP8A 2R84A 4MV4A 2FPGB 3ETJA 4MV8A 3MWEA 1JLLB 2NUAB 5KKNB 5CAEB 2ABJA 3ETHA 3ORRA 4HNTA 3GDEA 3TINA 4FU0A 1KC7A 2XCLA 3TQTA 3MWDA 4O7LA 5D1OA 3G8DA 3JZFA 1SCUB 3JSLA 3V4SA 2W6NA 1GSHA 2I8CA 2YWVA 5C1OA 5HV6A 5I47A 2DIKA 4CMFA 2W6MA 1IYEA 5FR9A 1OBGA 4EGJA 5BMVF 3JRWA 1G2WA 4IHJF 2COGA 4O81A 3RUPA 2W6OA 2YZGA 2WYOA 1FVIA 4UCVA 2P0AA 4MV1A 4TV8F 2YS7A 4FGRA 4RZQA 1DIKA 1A0IA 1VS0A 3R9RA 5BWWA 4IIJF 5BWRA 3N8DA 4HN2A 1BNCA 4UCTA 5JH7F 5K3WA 5DMXA 2HVSA 4O7YA 4MA5A 1B6RA 3UYYA 3WWJA 4HNVA 4IWXA
chains in the Genus database with same CATH topology
5FPRA 4CC5A 3KYHC 4UCOA 3TY5A 3QWUA 4EFBA 1P8LA 1CKNB 3NC0B 1CKOA 3W1GA 1TAEA 2HIVA 1XK5A 3VNNA 4LH7A 1X9NA 3TY9A 2CFMA 4PZ6A 5D1OB 3TY8A 3W5OA 4LH6A 4EFEA 4CC6A 2Q2TA 1S68A 3BAAA 1DGSA 3BA9A 3RR5A 4GLXA 2Q2UA 4PZ7A 1CKNA 1CKMA 5D1PA 4UFZA 2HIXA 3BA8A 3S24A 5FPOA 3JSNA 3GDEA 3NBZB 3GB8B 2VUGA 1V9PA 1B04A 4EQ5A 5D1OA 1XDNA 3JSLA 2OWOA 1P16A 4EEQA 4DRFA 3UQ8A 4UCRA 3L2PA 3NBYB 3BABA 2HVRA 3W1BA 3RTXA 3PN1A 1FVIA 4UCVA 5DISC 1A0IA 1VS0A 2HVQA 3GJXB 4UCTA 4E6NA 4UCUA 4PZ8A 2HVSA 1TA8A 4UCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPR A;  4CC5 A;  3KYH C;  4UCO A;  3TY5 A;  3QWU A;  4EFB A;  1P8L A;  1CKN B;  3NC0 B;  1CKO A;  3W1G A;  1TAE A;  2HIV A;  1XK5 A;  3VNN A;  4LH7 A;  1X9N A;  3TY9 A;  2CFM A;  4PZ6 A;  5D1O B;  3TY8 A;  3W5O A;  4LH6 A;  4EFE A;  4CC6 A;  2Q2T A;  1S68 A;  3BAA A;  1DGS A;  3BA9 A;  3RR5 A;  4GLX A;  2Q2U A;  4PZ7 A;  1CKN A;  1CKM A;  5D1P A;  4UFZ A;  2HIX A;  3BA8 A;  3S24 A;  5FPO A;  3JSN A;  3GDE A;  3NBZ B;  3GB8 B;  2VUG A;  1V9P A;  1B04 A;  4EQ5 A;  5D1O A;  1XDN A;  3JSL A;  2OWO A;  1P16 A;  4EEQ A;  4DRF A;  3UQ8 A;  4UCR A;  3L2P A;  3NBY B;  3BAB A;  2HVR A;  3W1B A;  3RTX A;  3PN1 A;  1FVI A;  4UCV A;  5DIS C;  1A0I A;  1VS0 A;  2HVQ A;  3GJX B;  4UCT A;  4E6N A;  4UCU A;  4PZ8 A;  2HVS A;  1TA8 A;  4UCS A; 
#chains in the Genus database with same CATH topology
 4CC5 A;  4UCO A;  3TY5 A;  3QWU A;  3TIG A;  1DV1 A;  3KAL A;  2QK4 A;  4O4J F;  3U55 A;  2R86 A;  2DAB A;  3W1G A;  3SE7 A;  3T54 A;  1A0G A;  1KJ8 A;  3I12 A;  1XK5 A;  4I55 F;  3VNN A;  1GGO A;  4XYL B;  3E5N A;  4E4T A;  3UZB A;  4UUG A;  3R5H A;  2PBZ A;  5I5V A;  1IYD A;  4K6N A;  4CKC A;  1T36 A;  1ZAU A;  5IYZ F;  3TY9 A;  3R5F A;  2EJ0 A;  5D1O B;  3DTG A;  4EG0 A;  3TY8 A;  3RV3 A;  1CE8 A;  5KS8 A;  2GPS A;  4EFE A;  1E4E B;  2OLS A;  4FFL A;  4CC6 A;  1AUX A;  1ET0 A;  4L1K A;  1M0W A;  4FE2 A;  4XX0 B;  1KJI A;  5E25 A;  5DGH A;  5I5Y A;  4HQ6 A;  4NZN A;  4CKB A;  1C30 A;  4PBC A;  5DAA A;  5J2U F;  4EGQ A;  3JZI A;  4DQN A;  2YYA A;  1I7L A;  3CSW A;  3HBL A;  5LYJ F;  5K2M A;  5LA6 F;  2W71 A;  4O4H F;  1GSA A;  1EZ1 A;  1M0T A;  4IWY A;  5DGI A;  3UFX B;  1KJQ A;  4O86 A;  1WRV A;  4C5A A;  4CHI A;  3JSN A;  3GLK A;  3T7A A;  3NBZ B;  3BG5 A;  4NZO A;  2W70 A;  2VUG A;  3T9D A;  1I1K A;  3V4Z A;  4XYM B;  1XDN A;  5BWV A;  3RV4 A;  3AW8 A;  3PFF A;  4O84 A;  4DRF A;  4RCN A;  2NU7 B;  4UCR A;  5I5T A;  4Q4D A;  3BAB A;  1UC8 A;  2YS6 A;  3CEB A;  4MV9 A;  5FNV F;  3PN1 A;  5JQW A;  1GLV A;  5BWT A;  5CA0 F;  5CE8 A;  4C5C A;  2HVQ A;  4E6N A;  2YZN A;  4ZOL F;  4TV9 F;  2GQS A;  5I5U A;  4JXU A;  3R23 A;  5I5S A;  1TA8 A;  4DAA A;  4PZ7 A;  4WHX A;  1I1L A;  3Q2O A;  1E4E A;  1CS0 A;  5FPR A;  2YRW A;  3VPB A;  1Z2N X;  3GID A;  3DAA A;  5LXT F;  2HGS A;  4CMD A;  4FFM A;  1KJ9 A;  3TW6 A;  2ZDH A;  3K5H A;  1A48 A;  1BXR A;  1I1M A;  3LUL A;  3JZ6 A;  4LH7 A;  3VPD A;  1W96 A;  2CFM A;  4PZ6 A;  1UC9 A;  2HHF B;  5BWU A;  3WNZ A;  4LH6 A;  2ZDG A;  4YJ3 F;  2I87 A;  3HO8 A;  2Q2T A;  3U54 A;  1IOW A;  2VPQ A;  3BAA A;  1OBD A;  2HGX A;  2Z04 A;  2EIY A;  3LQS A;  2EJ3 A;  4O83 A;  3T9F A;  1DGS A;  2I80 A;  4O82 A;  5BPH A;  3KAJ A;  4NYE A;  2YZL A;  4O7V A;  3U9T A;  5EZY F;  5J2T F;  1CKN A;  4TVI A;  4DIM A;  4GLW A;  1KEE A;  4O7N A;  4HR7 A;  5HNE A;  2XD4 A;  4O2B F;  4O7Z A;  4UFZ A;  2HIX A;  2HGW A;  2ZDQ A;  4FFN A;  1IOV A;  5FPO A;  3S24 A;  3GB8 B;  3U0G A;  5I5X A;  1Z2O X;  2VQD A;  2Y4R A;  1V9P A;  1B04 A;  4EQ5 A;  4IZO A;  2NU8 B;  4FFO A;  1DAA A;  1I2L A;  2CZG A;  2NU6 B;  3QFF A;  5C8Y F;  4MV3 A;  1VBG A;  3OUZ A;  3UQ8 A;  3NBY B;  4ME6 A;  3N6R A;  4YB8 B;  2HVR A;  3DTF A;  3W1B A;  3TEK A;  5LP6 F;  3RTX A;  1KT8 A;  2Q7D A;  3LWB A;  1JKJ B;  2COI A;  4DLK A;  3WWH A;  1EUD B;  1W93 A;  1EYZ A;  4YAJ B;  5CM0 A;  3GJX B;  5JVL A;  2Z02 A;  4UCU A;  5I60 A;  1CQI B;  4PZ8 A;  2FP4 B;  3TW7 A;  4ZQI A;  2HHF A;  1AUV A;  4UCS A;  2DZD A;  3WO1 A;  1I7N A;  1PX2 A;  1KJJ A;  3U9S A;  2X5R A;  2YZM A;  4EFB A;  1CKN B;  1P8L A;  2YRX A;  5BYA A;  1M6V A;  3WWI A;  4O7R A;  4M9U A;  3ORQ A;  4C5B A;  4O7S A;  1TAE A;  3SGI A;  2DAA A;  2HDK A;  4WBN F;  1EKV A;  2R87 A;  4O4I F;  2A1H A;  2R7K A;  2W6Z A;  3MJF A;  3KAK A;  3OUU A;  2HG8 A;  3BAC A;  2V58 A;  4I50 F;  1WR2 A;  3TII A;  1B6S A;  5C1P A;  3DF7 A;  1CQJ B;  2FB9 A;  2PN1 A;  2W6P A;  3G8C A;  3UZO A;  4TUY F;  1KTA A;  2X0S A;  2NU9 B;  2C00 A;  3BA9 A;  3T99 A;  2R82 A;  2QF7 A;  4O7T A;  1ULZ A;  2YL2 A;  4MAM A;  3JRX A;  5BPF A;  4FFP A;  1A3G A;  3HT5 A;  4MV7 A;  1CKM A;  2DLN A;  2GLT A;  3VMM A;  5D1P A;  5I5W A;  3T9E A;  4HNU A;  2GQR A;  5CB4 F;  2QB5 A;  2IP4 A;  3BA8 A;  4CE5 A;  3K3P A;  4TM5 A;  5GON F;  5CR5 A;  4Y8V B;  1EUC B;  3WO0 A;  2W6Q A;  2PVP A;  2COJ A;  4I4T F;  2OWO A;  2V59 A;  1P16 A;  4FFR A;  4EEQ A;  2ODT X;  3Q1K A;  2GPW A;  3VOT A;  5H80 A;  2FPP B;  3L2P A;  4YBZ B;  3KRE A;  4MA0 A;  4M0J A;  4XZ3 B;  3NUA A;  5DIS C;  2R7L A;  2R85 A;  1I2K A;  4MV6 A;  1EKP A;  2J9G A;  1JDE A;  3SNO A;  2YW2 A;  1PK8 A;  2V5A A;  2HJW A;  1JDB B;  2FPI B;  3VPC A;  1GSO A;  1KUT A;  3KYH C;  4ZHQ F;  3QQM A;  3K5I A;  4YAK B;  1EHI A;  2DWC A;  3T9C A;  2R7N A;  3NC0 B;  1Z2P X;  4ZI7 F;  5LOV F;  1CKO A;  1A9X A;  1EKF A;  3AX6 A;  2VR1 A;  4NZM A;  1DV2 A;  2HIV A;  2ZGI A;  4Q4C A;  5D8D A;  3RFC A;  4QSH A;  1X9N A;  5CA1 F;  1C3O A;  2CNQ A;  5JQG F;  4O2A F;  3T9B A;  4CKE A;  3T9A A;  2CNV A;  3W5O A;  4O7W A;  2R7M A;  3R5X A;  2SCU B;  2CNU A;  2EJ2 A;  4YJ2 F;  1S68 A;  5BWX A;  5BYB A;  3RR5 A;  3VA7 A;  5KX5 F;  1VKZ A;  4GLX A;  1KBL A;  2Q2U A;  4O4L F;  5JVD F;  1VBH A;  5HBR B;  3HB9 A;  3LP8 A;  2R84 A;  4MV4 A;  2FPG B;  3ETJ A;  4MV8 A;  3MWE A;  1JLL B;  2NUA B;  5KKN B;  5CAE B;  2ABJ A;  3ETH A;  3ORR A;  4HNT A;  3GDE A;  3TIN A;  4FU0 A;  1KC7 A;  2XCL A;  3TQT A;  3MWD A;  4O7L A;  5D1O A;  3G8D A;  3JZF A;  1SCU B;  3JSL A;  3V4S A;  2W6N A;  1GSH A;  2I8C A;  2YWV A;  5C1O A;  5HV6 A;  5I47 A;  2DIK A;  4CMF A;  2W6M A;  1IYE A;  5FR9 A;  1OBG A;  4EGJ A;  5BMV F;  3JRW A;  1G2W A;  4IHJ F;  2COG A;  4O81 A;  3RUP A;  2W6O A;  2YZG A;  2WYO A;  1FVI A;  4UCV A;  2P0A A;  4MV1 A;  4TV8 F;  2YS7 A;  4FGR A;  4RZQ A;  1DIK A;  1A0I A;  1VS0 A;  3R9R A;  5BWW A;  4IIJ F;  5BWR A;  3N8D A;  4HN2 A;  1BNC A;  4UCT A;  5JH7 F;  5K3W A;  5DMX A;  2HVS A;  4O7Y A;  4MA5 A;  1B6R A;  3UYY A;  3WWJ A;  4HNV A;  4IWX A; 
#chains in the Genus database with same CATH homology
 5FPR A;  4CC5 A;  3KYH C;  4UCO A;  3TY5 A;  3QWU A;  4EFB A;  1P8L A;  1CKN B;  3NC0 B;  1CKO A;  3W1G A;  1TAE A;  2HIV A;  1XK5 A;  3VNN A;  4LH7 A;  1X9N A;  3TY9 A;  2CFM A;  4PZ6 A;  5D1O B;  3TY8 A;  3W5O A;  4LH6 A;  4EFE A;  4CC6 A;  2Q2T A;  1S68 A;  3BAA A;  1DGS A;  3BA9 A;  3RR5 A;  4GLX A;  2Q2U A;  4PZ7 A;  1CKN A;  1CKM A;  5D1P A;  4UFZ A;  2HIX A;  3BA8 A;  3S24 A;  5FPO A;  3JSN A;  3GDE A;  3NBZ B;  3GB8 B;  2VUG A;  1V9P A;  1B04 A;  4EQ5 A;  5D1O A;  1XDN A;  3JSL A;  2OWO A;  1P16 A;  4EEQ A;  4DRF A;  3UQ8 A;  4UCR A;  3L2P A;  3NBY B;  3BAB A;  2HVR A;  3W1B A;  3RTX A;  3PN1 A;  1FVI A;  4UCV A;  5DIS C;  1A0I A;  1VS0 A;  2HVQ A;  3GJX B;  4UCT A;  4E6N A;  4UCU A;  4PZ8 A;  2HVS A;  1TA8 A;  4UCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...