5DISC

Crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
289
structure length
264
Chain Sequence
GSMEELSQALASSFSVSQDLNSTAAPHPRLKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Exportin-1
total genus 64
structure length 264
sequence length 289
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11538 Snurportin1 Snurportin1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 5disC00
3BA8A 2HIXA 4LH7A 1X9NA 1A0IA 4EFBA 4E6NA 2Q2TA 1CKNA 3JSNA 2HIVA 2HVQA 3GDEA 4LH6A 5D1OB 4CC6A 2HVSA 4UCRA 3NBYB 5D1PA 3UQ8A 2CFMA 3BABA 4UFZA 2Q2UA 3GB8B 4EFEA 3W5OA 1TA8A 1XDNA 4PZ6A 4DRFA 3W1BA 3W1GA 3TY9A 4CC5A 4GLXA 1S68A 3NC0B 1B04A 3KYHC 5FPRA 4EEQA 4EQ5A 4UCUA 5FPOA 3GJXB 4PZ8A 2VUGA 3PN1A 3S24A 5DISC 4UCTA 3NBZB 3BAAA 1XK5A 3BA9A 1VS0A 3TY8A 2OWOA 1V9PA 1CKNB 3L2PA 1CKMA 4UCVA 2HVRA 1TAEA 1DGSA 3QWUA 4UCOA 1P16A 3RR5A 1CKOA 1P8LA 4PZ7A 3RTXA 3TY5A 5D1OA 4UCSA 3VNNA 1FVIA 3JSLA
chains in the Genus database with same CATH superfamily
2Q2TA 2W6ZA 3LWBA 3JRWA 2GPSA 5DGHA 2Y4RA 3T9FA 3MWDA 5LA6F 3PFFA 3NC0B 1IOWA 3KYHC 2W70A 5I5UA 4HNUA 2C00A 3PN1A 2QF7A 3TW7A 3BAAA 3TY8A 2HG8A 3MWEA 1V9PA 1UC9A 2EJ3A 2FP4B 2COJA 4UCVA 1VBHA 1KJ9A 2YZLA 1P16A 3R5HA 3RTXA 1DV1A 4O84A 1KC7A 4O82A 4YJ3F 2R82A 3U9SA 1KJIA 4ZOLF 5C1OA 2HIVA 2CNVA 3RFCA 3TIIA 1GSAA 1I1KA 2R7NA 4EFEA 5BYAA 4O7SA 3AW8A 2FPIB 1W93A 4O7TA 2ABJA 1TA8A 5I5WA 2GQRA 2YZMA 5FPRA 5I60A 3LULA 1VBGA 2DZDA 5CR5A 1CS0A 1CE8A 5BWRA 4IZOA 4RZQA 3RUPA 2CZGA 3KAKA 4WHXA 2HDKA 5HV6A 3I12A 2QB5A 4E6NA 4RCNA 5I5VA 2Q7DA 1PK8A 2HVQA 1E4EB 3WWIA 1ET0A 1A48A 3OUZA 3KREA 2XCLA 5I47A 4C5CA 1KJQA 4TVIA 1KBLA 1DIKA 2NU7B 3TW6A 1B6SA 5KKNB 4O4JF 2NU8B 1I2KA 4O7ZA 3DTFA 4UCOA 3ETJA 3VNNA 5HBRB 4M9UA 5JVLA 2DLNA 5D1OB 1IYDA 4UCRA 1M6VA 2YS7A 2R7LA 2CNUA 2R7MA 3BACA 3W1BA 4CC5A 4CHIA 5CE8A 5E25A 2YZGA 4YAKB 4EQ5A 3WWHA 1JDBB 3RV4A 2ZGIA 1M0WA 1P8LA 3TY5A 2R7KA 2ZDGA 3LP8A 3WWJA 1KT8A 5K3WA 1M0TA 3UYYA 4EGQA 2PBZA 4CC6A 2GPWA 1EYZA 2I8CA 5KX5F 1C30A 4UUGA 2PN1A 4FFOA 2HHFA 3R23A 1B6RA 3R5FA 5JQGF 4O7YA 4CMDA 4DQNA 4IWYA 4O81A 1GLVA 2YRXA 5HNEA 3R9RA 3LQSA 4DAAA 3T9AA 2NU9B 3N8DA 3QQMA 5BWXA 3JZ6A 5CB4F 1T36A 5CA1F 4MV1A 4CKEA 1EZ1A 5I5XA 3KAJA 2NUAB 5D1PA 1EUCB 4O4IF 4O7RA 3U55A 1S68A 5CA0F 4HNVA 1DAAA 3ORRA 1UC8A 5DISC 4DIMA 3DAAA 4UCTA 3JZIA 4TV8F 4I55F 2YRWA 2IP4A 4MV9A 5DAAA 5JH7F 3K5IA 4MV4A 4IWXA 4NZMA 3BG5A 2V58A 1KEEA 1KJ8A 4MV8A 3T9EA 2CNQA 2EIYA 2XD4A 4PZ6A 3TEKA 3W1GA 1W96A 1G2WA 2W6OA 5I5TA 2OLSA 5IYZF 4O7VA 4CKBA 1JDEA 4YJ2F 5KS8A 5C8YF 4HQ6A 5I5SA 4K6NA 4FFNA 3T54A 3GDEA 1GGOA 3HT5A 4MA0A 3GB8B 3TINA 3JZFA 5BPHA 4HNTA 3E5NA 3VPDA 4EEQA 4YB8B 1IOVA 4MA5A 3VPCA 1E4EA 2SCUB 2EJ2A 2X0SA 5BWUA 2R87A 1X9NA 2V5AA 3SE7A 5BWTA 4FE2A 1CKNA 3RV3A 3NBYB 2X5RA 4EGJA 2YWVA 2DABA 1CQJB 3N6RA 2YS6A 4IIJF 3G8CA 1ULZA 3T99A 4UCUA 5FPOA 4QSHA 2Z02A 3S24A 5BWWA 5BWVA 4EG0A 4JXUA 4C5BA 5FR9A 5JVDF 1CKMA 1DGSA 2FB9A 3U54A 4HR7A 5H80A 1CKOA 2DIKA 4XX0B 4CMFA 3V4SA 1SCUB 2R86A 5JQWA 2I80A 3DTGA 2VR1A 5BPFA 2HVSA 4XZ3B 5K2MA 3VA7A 1VKZA 4FFRA 1Z2OX 3HO8A 4TM5A 1AUXA 1Z2PX 1OBDA 4I50F 4NZNA 3TIGA 2COGA 3TQTA 5J2UF 2HGXA 3OUUA 4GLWA 5D8DA 2VQDA 2YW2A 4O4LF 5CAEB 4EFBA 4CE5A 5I5YA 1KJJA 2I87A 3VPBA 1I1LA 1ZAUA 3ETHA 3W5OA 3HBLA 2NU6B 3KALA 3TY9A 1AUVA 1PX2A 4FFMA 5LP6F 2R84A 3CEBA 3R5XA 4L1KA 4Q4DA 3NBZB 1WRVA 1XK5A 1CKNB 4O7LA 3QFFA 3VMMA 4PZ7A 2WYOA 4MV6A 3BA8A 4O2BF 4LH6A 5EZYF 4FU0A 3MJFA 3ORQA 3G8DA 3CSWA 1XDNA 4I4TF 1BXRA 4FFLA 4C5AA 4O86A 1I1MA 3AX6A 2GLTA 3Q2OA 1A3GA 2V59A 5C1PA 2R85A 4CKCA 3GLKA 4O7NA 4ZI7F 2W6QA 2HVRA 4YAJB 1DV2A 5J2TF 4MV7A 5D1OA 4DLKA 3JSLA 4NZOA 4LH7A 2EJ0A 3JSNA 3U0GA 2FPPB 1JKJB 4UFZA 1C3OA 4XYLB 5FNVF 2YYAA 1WR2A 3WO1A 1B04A 2ZDHA 4O4HF 3SGIA 3GJXB 4M0JA 1I7LA 3T9BA 4Q4CA 4O83A 1A0GA 4NYEA 3NUAA 1TAEA 2PVPA 2ZDQA 3T9CA 2COIA 3T7AA 4UCSA 1JLLB 2HIXA 1EUDB 1IYEA 1OBGA 4ZQIA 4TV9F 3Q1KA 2VPQA 3VOTA 2HJWA 2HHFB 2CFMA 5DGIA 4MV3A 4Y8VB 3UZBA 1KUTA 2FPGB 1CQIB 4FFPA 4E4TA 3T9DA 1Z2NX 3WNZA 2VUGA 2W6NA 3SNOA 5LXTF 3BA9A 2OWOA 4XYMB 3DF7A 3K3PA 3UFXB 3RR5A 1EKVA 2W6MA 2GQSA 3L2PA 2A1HA 1I7NA 3HB9A 5DMXA 1GSHA 4PBCA 1I2LA 3V4ZA 5BMVF 3UQ8A 2Q2UA 3UZOA 4DRFA 4GLXA 5LOVF 3K5HA 1GSOA 2HGWA 1EHIA 1EKPA 2YL2A 1VS0A 1BNCA 2W71A 2HGSA 2DWCA 2W6PA 2P0AA 3QWUA 2ODTX 3GIDA 4YBZB 1A9XA 1FVIA 2YZNA 4TUYF 1A0IA 3WO0A 4WBNF 4ZHQF 5GONF 2QK4A 4O2AF 4FGRA 3BABA 2DAAA 4HN2A 5BYBA 4IHJF 5LYJF 3JRXA 2Z04A 4PZ8A 3U9TA 1EKFA 1KTAA 4ME6A 4O7WA 5CM0A 2J9GA 4MAMA
chains in the Genus database with same CATH topology
3BA8A 2HIXA 4LH7A 1X9NA 1A0IA 4EFBA 4E6NA 2Q2TA 1CKNA 3JSNA 2HIVA 2HVQA 3GDEA 4LH6A 5D1OB 4CC6A 2HVSA 4UCRA 3NBYB 5D1PA 3UQ8A 2CFMA 3BABA 4UFZA 2Q2UA 3GB8B 4EFEA 3W5OA 1TA8A 1XDNA 4PZ6A 4DRFA 3W1BA 3W1GA 3TY9A 4CC5A 4GLXA 1S68A 3NC0B 1B04A 3KYHC 5FPRA 4EEQA 4EQ5A 4UCUA 5FPOA 3GJXB 4PZ8A 2VUGA 3PN1A 3S24A 5DISC 4UCTA 3NBZB 3BAAA 1XK5A 3BA9A 1VS0A 3TY8A 2OWOA 1V9PA 1CKNB 3L2PA 1CKMA 4UCVA 2HVRA 1TAEA 1DGSA 3QWUA 4UCOA 1P16A 3RR5A 1CKOA 1P8LA 4PZ7A 3RTXA 3TY5A 5D1OA 4UCSA 3VNNA 1FVIA 3JSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BA8 A;  2HIX A;  4LH7 A;  1X9N A;  1A0I A;  4EFB A;  4E6N A;  2Q2T A;  1CKN A;  3JSN A;  2HIV A;  2HVQ A;  3GDE A;  4LH6 A;  5D1O B;  4CC6 A;  2HVS A;  4UCR A;  3NBY B;  5D1P A;  3UQ8 A;  2CFM A;  3BAB A;  4UFZ A;  2Q2U A;  3GB8 B;  4EFE A;  3W5O A;  1TA8 A;  1XDN A;  4PZ6 A;  4DRF A;  3W1B A;  3W1G A;  3TY9 A;  4CC5 A;  4GLX A;  1S68 A;  3NC0 B;  1B04 A;  3KYH C;  5FPR A;  4EEQ A;  4EQ5 A;  4UCU A;  5FPO A;  3GJX B;  4PZ8 A;  2VUG A;  3PN1 A;  3S24 A;  5DIS C;  4UCT A;  3NBZ B;  3BAA A;  1XK5 A;  3BA9 A;  1VS0 A;  3TY8 A;  2OWO A;  1V9P A;  1CKN B;  3L2P A;  1CKM A;  4UCV A;  2HVR A;  1TAE A;  1DGS A;  3QWU A;  4UCO A;  1P16 A;  3RR5 A;  1CKO A;  1P8L A;  4PZ7 A;  3RTX A;  3TY5 A;  5D1O A;  4UCS A;  3VNN A;  1FVI A;  3JSL A; 
#chains in the Genus database with same CATH topology
 2Q2T A;  2W6Z A;  3LWB A;  3JRW A;  2GPS A;  5DGH A;  2Y4R A;  3T9F A;  3MWD A;  5LA6 F;  3PFF A;  3NC0 B;  1IOW A;  3KYH C;  2W70 A;  5I5U A;  4HNU A;  2C00 A;  3PN1 A;  2QF7 A;  3TW7 A;  3BAA A;  3TY8 A;  2HG8 A;  3MWE A;  1V9P A;  1UC9 A;  2EJ3 A;  2FP4 B;  2COJ A;  4UCV A;  1VBH A;  1KJ9 A;  2YZL A;  1P16 A;  3R5H A;  3RTX A;  1DV1 A;  4O84 A;  1KC7 A;  4O82 A;  4YJ3 F;  2R82 A;  3U9S A;  1KJI A;  4ZOL F;  5C1O A;  2HIV A;  2CNV A;  3RFC A;  3TII A;  1GSA A;  1I1K A;  2R7N A;  4EFE A;  5BYA A;  4O7S A;  3AW8 A;  2FPI B;  1W93 A;  4O7T A;  2ABJ A;  1TA8 A;  5I5W A;  2GQR A;  2YZM A;  5FPR A;  5I60 A;  3LUL A;  1VBG A;  2DZD A;  5CR5 A;  1CS0 A;  1CE8 A;  5BWR A;  4IZO A;  4RZQ A;  3RUP A;  2CZG A;  3KAK A;  4WHX A;  2HDK A;  5HV6 A;  3I12 A;  2QB5 A;  4E6N A;  4RCN A;  5I5V A;  2Q7D A;  1PK8 A;  2HVQ A;  1E4E B;  3WWI A;  1ET0 A;  1A48 A;  3OUZ A;  3KRE A;  2XCL A;  5I47 A;  4C5C A;  1KJQ A;  4TVI A;  1KBL A;  1DIK A;  2NU7 B;  3TW6 A;  1B6S A;  5KKN B;  4O4J F;  2NU8 B;  1I2K A;  4O7Z A;  3DTF A;  4UCO A;  3ETJ A;  3VNN A;  5HBR B;  4M9U A;  5JVL A;  2DLN A;  5D1O B;  1IYD A;  4UCR A;  1M6V A;  2YS7 A;  2R7L A;  2CNU A;  2R7M A;  3BAC A;  3W1B A;  4CC5 A;  4CHI A;  5CE8 A;  5E25 A;  2YZG A;  4YAK B;  4EQ5 A;  3WWH A;  1JDB B;  3RV4 A;  2ZGI A;  1M0W A;  1P8L A;  3TY5 A;  2R7K A;  2ZDG A;  3LP8 A;  3WWJ A;  1KT8 A;  5K3W A;  1M0T A;  3UYY A;  4EGQ A;  2PBZ A;  4CC6 A;  2GPW A;  1EYZ A;  2I8C A;  5KX5 F;  1C30 A;  4UUG A;  2PN1 A;  4FFO A;  2HHF A;  3R23 A;  1B6R A;  3R5F A;  5JQG F;  4O7Y A;  4CMD A;  4DQN A;  4IWY A;  4O81 A;  1GLV A;  2YRX A;  5HNE A;  3R9R A;  3LQS A;  4DAA A;  3T9A A;  2NU9 B;  3N8D A;  3QQM A;  5BWX A;  3JZ6 A;  5CB4 F;  1T36 A;  5CA1 F;  4MV1 A;  4CKE A;  1EZ1 A;  5I5X A;  3KAJ A;  2NUA B;  5D1P A;  1EUC B;  4O4I F;  4O7R A;  3U55 A;  1S68 A;  5CA0 F;  4HNV A;  1DAA A;  3ORR A;  1UC8 A;  5DIS C;  4DIM A;  3DAA A;  4UCT A;  3JZI A;  4TV8 F;  4I55 F;  2YRW A;  2IP4 A;  4MV9 A;  5DAA A;  5JH7 F;  3K5I A;  4MV4 A;  4IWX A;  4NZM A;  3BG5 A;  2V58 A;  1KEE A;  1KJ8 A;  4MV8 A;  3T9E A;  2CNQ A;  2EIY A;  2XD4 A;  4PZ6 A;  3TEK A;  3W1G A;  1W96 A;  1G2W A;  2W6O A;  5I5T A;  2OLS A;  5IYZ F;  4O7V A;  4CKB A;  1JDE A;  4YJ2 F;  5KS8 A;  5C8Y F;  4HQ6 A;  5I5S A;  4K6N A;  4FFN A;  3T54 A;  3GDE A;  1GGO A;  3HT5 A;  4MA0 A;  3GB8 B;  3TIN A;  3JZF A;  5BPH A;  4HNT A;  3E5N A;  3VPD A;  4EEQ A;  4YB8 B;  1IOV A;  4MA5 A;  3VPC A;  1E4E A;  2SCU B;  2EJ2 A;  2X0S A;  5BWU A;  2R87 A;  1X9N A;  2V5A A;  3SE7 A;  5BWT A;  4FE2 A;  1CKN A;  3RV3 A;  3NBY B;  2X5R A;  4EGJ A;  2YWV A;  2DAB A;  1CQJ B;  3N6R A;  2YS6 A;  4IIJ F;  3G8C A;  1ULZ A;  3T99 A;  4UCU A;  5FPO A;  4QSH A;  2Z02 A;  3S24 A;  5BWW A;  5BWV A;  4EG0 A;  4JXU A;  4C5B A;  5FR9 A;  5JVD F;  1CKM A;  1DGS A;  2FB9 A;  3U54 A;  4HR7 A;  5H80 A;  1CKO A;  2DIK A;  4XX0 B;  4CMF A;  3V4S A;  1SCU B;  2R86 A;  5JQW A;  2I80 A;  3DTG A;  2VR1 A;  5BPF A;  2HVS A;  4XZ3 B;  5K2M A;  3VA7 A;  1VKZ A;  4FFR A;  1Z2O X;  3HO8 A;  4TM5 A;  1AUX A;  1Z2P X;  1OBD A;  4I50 F;  4NZN A;  3TIG A;  2COG A;  3TQT A;  5J2U F;  2HGX A;  3OUU A;  4GLW A;  5D8D A;  2VQD A;  2YW2 A;  4O4L F;  5CAE B;  4EFB A;  4CE5 A;  5I5Y A;  1KJJ A;  2I87 A;  3VPB A;  1I1L A;  1ZAU A;  3ETH A;  3W5O A;  3HBL A;  2NU6 B;  3KAL A;  3TY9 A;  1AUV A;  1PX2 A;  4FFM A;  5LP6 F;  2R84 A;  3CEB A;  3R5X A;  4L1K A;  4Q4D A;  3NBZ B;  1WRV A;  1XK5 A;  1CKN B;  4O7L A;  3QFF A;  3VMM A;  4PZ7 A;  2WYO A;  4MV6 A;  3BA8 A;  4O2B F;  4LH6 A;  5EZY F;  4FU0 A;  3MJF A;  3ORQ A;  3G8D A;  3CSW A;  1XDN A;  4I4T F;  1BXR A;  4FFL A;  4C5A A;  4O86 A;  1I1M A;  3AX6 A;  2GLT A;  3Q2O A;  1A3G A;  2V59 A;  5C1P A;  2R85 A;  4CKC A;  3GLK A;  4O7N A;  4ZI7 F;  2W6Q A;  2HVR A;  4YAJ B;  1DV2 A;  5J2T F;  4MV7 A;  5D1O A;  4DLK A;  3JSL A;  4NZO A;  4LH7 A;  2EJ0 A;  3JSN A;  3U0G A;  2FPP B;  1JKJ B;  4UFZ A;  1C3O A;  4XYL B;  5FNV F;  2YYA A;  1WR2 A;  3WO1 A;  1B04 A;  2ZDH A;  4O4H F;  3SGI A;  3GJX B;  4M0J A;  1I7L A;  3T9B A;  4Q4C A;  4O83 A;  1A0G A;  4NYE A;  3NUA A;  1TAE A;  2PVP A;  2ZDQ A;  3T9C A;  2COI A;  3T7A A;  4UCS A;  1JLL B;  2HIX A;  1EUD B;  1IYE A;  1OBG A;  4ZQI A;  4TV9 F;  3Q1K A;  2VPQ A;  3VOT A;  2HJW A;  2HHF B;  2CFM A;  5DGI A;  4MV3 A;  4Y8V B;  3UZB A;  1KUT A;  2FPG B;  1CQI B;  4FFP A;  4E4T A;  3T9D A;  1Z2N X;  3WNZ A;  2VUG A;  2W6N A;  3SNO A;  5LXT F;  3BA9 A;  2OWO A;  4XYM B;  3DF7 A;  3K3P A;  3UFX B;  3RR5 A;  1EKV A;  2W6M A;  2GQS A;  3L2P A;  2A1H A;  1I7N A;  3HB9 A;  5DMX A;  1GSH A;  4PBC A;  1I2L A;  3V4Z A;  5BMV F;  3UQ8 A;  2Q2U A;  3UZO A;  4DRF A;  4GLX A;  5LOV F;  3K5H A;  1GSO A;  2HGW A;  1EHI A;  1EKP A;  2YL2 A;  1VS0 A;  1BNC A;  2W71 A;  2HGS A;  2DWC A;  2W6P A;  2P0A A;  3QWU A;  2ODT X;  3GID A;  4YBZ B;  1A9X A;  1FVI A;  2YZN A;  4TUY F;  1A0I A;  3WO0 A;  4WBN F;  4ZHQ F;  5GON F;  2QK4 A;  4O2A F;  4FGR A;  3BAB A;  2DAA A;  4HN2 A;  5BYB A;  4IHJ F;  5LYJ F;  3JRX A;  2Z04 A;  4PZ8 A;  3U9T A;  1EKF A;  1KTA A;  4ME6 A;  4O7W A;  5CM0 A;  2J9G A;  4MAM A; 
#chains in the Genus database with same CATH homology
 3BA8 A;  2HIX A;  4LH7 A;  1X9N A;  1A0I A;  4EFB A;  4E6N A;  2Q2T A;  1CKN A;  3JSN A;  2HIV A;  2HVQ A;  3GDE A;  4LH6 A;  5D1O B;  4CC6 A;  2HVS A;  4UCR A;  3NBY B;  5D1P A;  3UQ8 A;  2CFM A;  3BAB A;  4UFZ A;  2Q2U A;  3GB8 B;  4EFE A;  3W5O A;  1TA8 A;  1XDN A;  4PZ6 A;  4DRF A;  3W1B A;  3W1G A;  3TY9 A;  4CC5 A;  4GLX A;  1S68 A;  3NC0 B;  1B04 A;  3KYH C;  5FPR A;  4EEQ A;  4EQ5 A;  4UCU A;  5FPO A;  3GJX B;  4PZ8 A;  2VUG A;  3PN1 A;  3S24 A;  5DIS C;  4UCT A;  3NBZ B;  3BAA A;  1XK5 A;  3BA9 A;  1VS0 A;  3TY8 A;  2OWO A;  1V9P A;  1CKN B;  3L2P A;  1CKM A;  4UCV A;  2HVR A;  1TAE A;  1DGS A;  3QWU A;  4UCO A;  1P16 A;  3RR5 A;  1CKO A;  1P8L A;  4PZ7 A;  3RTX A;  3TY5 A;  5D1O A;  4UCS A;  3VNN A;  1FVI A;  3JSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...