3VNNA

Crystal structure of a sub-domain of the nucleotidyltransferase (adenylation) domain of human dna ligase iv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
139
structure length
124
Chain Sequence
b'FYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTELTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structural insights into the role of domain flexibility in human DNA ligase IV
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 23
structure length 124
sequence length 139
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3vnnA00
4UCSA 1S68A 2Q2TA 3BAAA 3BA8A 2HVSA 1CKNB 4PZ6A 2HVQA 3TY8A 4UCRA 2VUGA 4UFZA 3GB8B 4E6NA 5D1OA 1P16A 3BA9A 1XK5A 1TAEA 3VNNA 2CFMA 3RTXA 3KYHC 3W5OA 4UCTA 4EFEA 3BABA 1V9PA 4UCUA 4CC6A 4EQ5A 4GLXA 3TY5A 3JSNA 1CKNA 2HIXA 3GDEA 2HVRA 1B04A 1CKMA 1P8LA 1TA8A 4LH6A 3W1BA 3PN1A 4PZ8A 3JSLA 5FPOA 4UCVA 1XDNA 1FVIA 4PZ7A 3NBYB 1A0IA 2OWOA 3S24A 3NC0B 5DISC 3NBZB 1DGSA 4EEQA 4CC5A 3L2PA 3W1GA 2Q2UA 4LH7A 5D1OB 4UCOA 3QWUA 4DRFA 3GJXB 3UQ8A 3RR5A 3TY9A 5FPRA 1CKOA 1X9NA 5D1PA 4EFBA 2HIVA 1VS0A
chains in the Genus database with same CATH superfamily
4QSHA 3T7AA 4GLWA 3T9FA 3WWIA 2Q2TA 3LQSA 4O7RA 3LULA 2EIYA 4FFNA 2ZDQA 3DTGA 3NUAA 4HN2A 4O4IF 3G8CA 4UCRA 3KAKA 3UYYA 1I1KA 4CKCA 4E6NA 1ET0A 1I2LA 3E5NA 1P16A 3BA9A 3VOTA 5I5WA 3N6RA 3SE7A 1I2KA 2W6PA 2PVPA 2GLTA 3HO8A 3W5OA 1JDEA 5JVDF 4MAMA 2YZLA 1KJIA 5JH7F 1PK8A 4TV8F 2OLSA 3R9RA 2YYAA 5BPFA 5DGIA 2COJA 4O4JF 4IIJF 1CKNA 1BXRA 1P8LA 1TA8A 4XZ3B 3RV4A 1GLVA 2W6OA 2R7MA 2ZDHA 1B6SA 3U9SA 2I87A 1JDBB 5J2UF 4FFMA 4O2AF 5K3WA 1FVIA 4PZ7A 4YB8B 3U54A 2R84A 4DQNA 3NBYB 3VPCA 5CA1F 4EG0A 3R5HA 4C5AA 5DISC 4K6NA 3GIDA 3AW8A 3T9CA 4I55F 3U9TA 4TUYF 5I5XA 3DF7A 1M6VA 1OBDA 3W1GA 5LA6F 4EGJA 2YZNA 4WBNF 4O84A 1KJJA 3T9AA 3Q2OA 5GONF 3JRXA 2GPSA 4CMDA 5C1PA 4O4HF 1I7NA 5K2MA 1WRVA 3ETJA 4EFBA 2HIVA 5C1OA 1GSHA 4MV6A 3R23A 1CKMA 2PBZA 4UCSA 4FFRA 2DZDA 1T36A 3VMMA 4ME6A 3BA8A 5CE8A 2HVSA 3R5FA 2HVQA 4O7YA 5CA0F 3VA7A 3BACA 5I5VA 3LP8A 1WR2A 4YJ2F 3CEBA 4RZQA 5LP6F 5BWRA 5BWTA 5KX5F 5I5SA 1XK5A 4L1KA 4CMFA 1TAEA 2YWVA 2YS6A 3HBLA 4MA5A 4MV3A 1IOWA 1EKFA 5HNEA 1DV2A 5I5UA 1CQIB 2XD4A 4O4LF 3TIIA 4CE5A 4UCUA 4CC6A 1OBGA 1SCUB 3TIGA 1KT8A 4C5CA 4GLXA 2J9GA 2HIXA 1M0TA 4FFLA 2W71A 2DWCA 2Z02A 4LH6A 4O7LA 5BWWA 3ORQA 2ZDGA 3W1BA 5FNVF 5CR5A 4XYMB 2A1HA 3UZOA 5FPOA 4C5BA 3HT5A 2EJ3A 1W93A 5KS8A 2CNQA 3JZIA 5FR9A 2YZMA 2NU8B 2YW2A 4DIMA 1PX2A 4O7TA 1CQJB 4ZOLF 4WHXA 2Z04A 2DIKA 3T99A 2P0AA 3SGIA 2NU7B 3ORRA 4EEQA 2FP4B 2GQRA 1IYDA 3JRWA 4JXUA 4CC5A 2FB9A 4LH7A 4E4TA 4UCOA 3GJXB 2VR1A 2HHFB 2W6MA 1VBHA 3RV3A 2C00A 5FPRA 1CKOA 4TM5A 3QQMA 1KBLA 2HJWA 4NZNA 1CS0A 3RFCA 2I80A 1KTAA 3N8DA 4FE2A 4DRFA 2R7LA 2V58A 1A48A 4RCNA 2WYOA 3OUUA 1KJQA 1JLLB 4HNTA 1CKNB 5H80A 1EUCB 2Y4RA 3VPDA 2ODTX 1KEEA 3UZBA 3PFFA 1C3OA 3GB8B 3U55A 1GGOA 3LWBA 5D1OA 4ZHQF 2HG8A 3KAJA 4O7ZA 3VNNA 2R82A 3ETHA 2QK4A 5BWXA 3RTXA 1E4EA 4UCTA 4PBCA 4FFPA 3BG5A 3JZFA 1CE8A 4HR7A 3WO1A 1V9PA 1A9XA 1EUDB 1C30A 4EQ5A 2COIA 4YBZB 4HNUA 3TY5A 2ZGIA 1JKJB 3KALA 1B04A 1BNCA 1Z2OX 1EKPA 1W96A 4MV1A 3MJFA 1A3GA 3TW6A 3PN1A 5BYBA 3JSLA 2CNUA 1DV1A 2GPWA 2V59A 2YS7A 3V4SA 1UC9A 4CKBA 4UCVA 2CNVA 2V5AA 3HB9A 2W6NA 2COGA 4O7NA 3G8DA 4TVIA 5CM0A 3QFFA 2W6QA 2W6ZA 3Q1KA 5LOVF 4ZI7F 3NC0B 5EZYF 3T9DA 1ZAUA 2CZGA 2I8CA 5C8YF 4IZOA 3UFXB 2R85A 4O7WA 2SCUB 1DGSA 2ABJA 3K5IA 4O7VA 5DMXA 2NUAB 2EJ2A 5HBRB 3L2PA 4M0JA 1I1LA 3QWUA 3CSWA 3UQ8A 4O82A 3RR5A 3TY9A 1AUVA 4IWYA 2R87A 4FFOA 1X9NA 2EJ0A 3T54A 3MWDA 1DAAA 1AUXA 3SNOA 1GSAA 2HHFA 1KJ9A 1VS0A 3VPBA 1VKZA 1M0WA 4O83A 5JQWA 2QF7A 2R86A 4CKEA 1S68A 1I1MA 1DIKA 4O86A 4CHIA 3BAAA 5I5TA 1A0GA 3TQTA 5BWUA 5J2TF 4MA0A 4IHJF 4PZ6A 2FPGB 3TY8A 1G2WA 4MV4A 4DLKA 5E25A 2VUGA 4UFZA 4Q4CA 5DAAA 2NU9B 4O2BF 2FPIB 3GLKA 4FGRA 4DAAA 5I47A 1ULZA 2PN1A 1GSOA 4O7SA 3V4ZA 2HGXA 5JVLA 2R7KA 2DLNA 1I7LA 5BPHA 4NYEA 2CFMA 3KYHC 3TEKA 4M9UA 4EFEA 2HGWA 3BABA 4XYLB 2Q7DA 2NU6B 5D8DA 2VQDA 2YL2A 1KJ8A 4FU0A 1IYEA 4UUGA 1KC7A 1VBGA 2X0SA 4I4TF 5DGHA 3WNZA 2XCLA 3OUZA 4IWXA 2DABA 3JSNA 4XX0B 3U0GA 3GDEA 4EGQA 2HVRA 1B6RA 5BMVF 1Z2NX 3DTFA 5I5YA 1EYZA 2YRXA 4PZ8A 1EKVA 3R5XA 4MV8A 3WWJA 3MWEA 1Z2PX 2R7NA 1XDNA 1KUTA 4YAKB 4I50F 2GQSA 3WO0A 1A0IA 4Q4DA 5HV6A 2YRWA 3WWHA 4YJ3F 3T9EA 2DAAA 2HDKA 2OWOA 1IOVA 5BYAA 2YZGA 3S24A 5LXTF 3K5HA 5BWVA 3KREA 4YAJB 3TW7A 3T9BA 4Y8VB 3NBZB 3JZ6A 5JQGF 2HGSA 4HQ6A 2VPQA 1UC8A 4ZQIA 2X5RA 3DAAA 3RUPA 2Q2UA 5KKNB 5D1OB 5I60A 4MV7A 2IP4A 3TINA 4NZMA 4O81A 2FPPB 4NZOA 4TV9F 5CB4F 3K3PA 4MV9A 1E4EB 3I12A 5D1PA 2QB5A 5LYJF 1EHIA 5CAEB 2W70A 3AX6A 5IYZF 1EZ1A 4HNVA
chains in the Genus database with same CATH topology
4UCSA 1S68A 2Q2TA 3BAAA 3BA8A 2HVSA 1CKNB 4PZ6A 2HVQA 3TY8A 4UCRA 2VUGA 4UFZA 3GB8B 4E6NA 5D1OA 1P16A 3BA9A 1XK5A 1TAEA 3VNNA 2CFMA 3RTXA 3KYHC 3W5OA 4UCTA 4EFEA 3BABA 1V9PA 4UCUA 4CC6A 4EQ5A 4GLXA 3TY5A 3JSNA 1CKNA 2HIXA 3GDEA 2HVRA 1B04A 1CKMA 1P8LA 1TA8A 4LH6A 3W1BA 3PN1A 4PZ8A 3JSLA 5FPOA 4UCVA 1XDNA 1FVIA 4PZ7A 3NBYB 1A0IA 2OWOA 3S24A 3NC0B 5DISC 3NBZB 1DGSA 4EEQA 4CC5A 3L2PA 3W1GA 2Q2UA 4LH7A 5D1OB 4UCOA 3QWUA 4DRFA 3GJXB 3UQ8A 3RR5A 3TY9A 5FPRA 1CKOA 1X9NA 5D1PA 4EFBA 2HIVA 1VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCS A;  1S68 A;  2Q2T A;  3BAA A;  3BA8 A;  2HVS A;  1CKN B;  4PZ6 A;  2HVQ A;  3TY8 A;  4UCR A;  2VUG A;  4UFZ A;  3GB8 B;  4E6N A;  5D1O A;  1P16 A;  3BA9 A;  1XK5 A;  1TAE A;  3VNN A;  2CFM A;  3RTX A;  3KYH C;  3W5O A;  4UCT A;  4EFE A;  3BAB A;  1V9P A;  4UCU A;  4CC6 A;  4EQ5 A;  4GLX A;  3TY5 A;  3JSN A;  1CKN A;  2HIX A;  3GDE A;  2HVR A;  1B04 A;  1CKM A;  1P8L A;  1TA8 A;  4LH6 A;  3W1B A;  3PN1 A;  4PZ8 A;  3JSL A;  5FPO A;  4UCV A;  1XDN A;  1FVI A;  4PZ7 A;  3NBY B;  1A0I A;  2OWO A;  3S24 A;  3NC0 B;  5DIS C;  3NBZ B;  1DGS A;  4EEQ A;  4CC5 A;  3L2P A;  3W1G A;  2Q2U A;  4LH7 A;  5D1O B;  4UCO A;  3QWU A;  4DRF A;  3GJX B;  3UQ8 A;  3RR5 A;  3TY9 A;  5FPR A;  1CKO A;  1X9N A;  5D1P A;  4EFB A;  2HIV A;  1VS0 A; 
#chains in the Genus database with same CATH topology
 4QSH A;  3T7A A;  4GLW A;  3T9F A;  3WWI A;  2Q2T A;  3LQS A;  4O7R A;  3LUL A;  2EIY A;  4FFN A;  2ZDQ A;  3DTG A;  3NUA A;  4HN2 A;  4O4I F;  3G8C A;  4UCR A;  3KAK A;  3UYY A;  1I1K A;  4CKC A;  4E6N A;  1ET0 A;  1I2L A;  3E5N A;  1P16 A;  3BA9 A;  3VOT A;  5I5W A;  3N6R A;  3SE7 A;  1I2K A;  2W6P A;  2PVP A;  2GLT A;  3HO8 A;  3W5O A;  1JDE A;  5JVD F;  4MAM A;  2YZL A;  1KJI A;  5JH7 F;  1PK8 A;  4TV8 F;  2OLS A;  3R9R A;  2YYA A;  5BPF A;  5DGI A;  2COJ A;  4O4J F;  4IIJ F;  1CKN A;  1BXR A;  1P8L A;  1TA8 A;  4XZ3 B;  3RV4 A;  1GLV A;  2W6O A;  2R7M A;  2ZDH A;  1B6S A;  3U9S A;  2I87 A;  1JDB B;  5J2U F;  4FFM A;  4O2A F;  5K3W A;  1FVI A;  4PZ7 A;  4YB8 B;  3U54 A;  2R84 A;  4DQN A;  3NBY B;  3VPC A;  5CA1 F;  4EG0 A;  3R5H A;  4C5A A;  5DIS C;  4K6N A;  3GID A;  3AW8 A;  3T9C A;  4I55 F;  3U9T A;  4TUY F;  5I5X A;  3DF7 A;  1M6V A;  1OBD A;  3W1G A;  5LA6 F;  4EGJ A;  2YZN A;  4WBN F;  4O84 A;  1KJJ A;  3T9A A;  3Q2O A;  5GON F;  3JRX A;  2GPS A;  4CMD A;  5C1P A;  4O4H F;  1I7N A;  5K2M A;  1WRV A;  3ETJ A;  4EFB A;  2HIV A;  5C1O A;  1GSH A;  4MV6 A;  3R23 A;  1CKM A;  2PBZ A;  4UCS A;  4FFR A;  2DZD A;  1T36 A;  3VMM A;  4ME6 A;  3BA8 A;  5CE8 A;  2HVS A;  3R5F A;  2HVQ A;  4O7Y A;  5CA0 F;  3VA7 A;  3BAC A;  5I5V A;  3LP8 A;  1WR2 A;  4YJ2 F;  3CEB A;  4RZQ A;  5LP6 F;  5BWR A;  5BWT A;  5KX5 F;  5I5S A;  1XK5 A;  4L1K A;  4CMF A;  1TAE A;  2YWV A;  2YS6 A;  3HBL A;  4MA5 A;  4MV3 A;  1IOW A;  1EKF A;  5HNE A;  1DV2 A;  5I5U A;  1CQI B;  2XD4 A;  4O4L F;  3TII A;  4CE5 A;  4UCU A;  4CC6 A;  1OBG A;  1SCU B;  3TIG A;  1KT8 A;  4C5C A;  4GLX A;  2J9G A;  2HIX A;  1M0T A;  4FFL A;  2W71 A;  2DWC A;  2Z02 A;  4LH6 A;  4O7L A;  5BWW A;  3ORQ A;  2ZDG A;  3W1B A;  5FNV F;  5CR5 A;  4XYM B;  2A1H A;  3UZO A;  5FPO A;  4C5B A;  3HT5 A;  2EJ3 A;  1W93 A;  5KS8 A;  2CNQ A;  3JZI A;  5FR9 A;  2YZM A;  2NU8 B;  2YW2 A;  4DIM A;  1PX2 A;  4O7T A;  1CQJ B;  4ZOL F;  4WHX A;  2Z04 A;  2DIK A;  3T99 A;  2P0A A;  3SGI A;  2NU7 B;  3ORR A;  4EEQ A;  2FP4 B;  2GQR A;  1IYD A;  3JRW A;  4JXU A;  4CC5 A;  2FB9 A;  4LH7 A;  4E4T A;  4UCO A;  3GJX B;  2VR1 A;  2HHF B;  2W6M A;  1VBH A;  3RV3 A;  2C00 A;  5FPR A;  1CKO A;  4TM5 A;  3QQM A;  1KBL A;  2HJW A;  4NZN A;  1CS0 A;  3RFC A;  2I80 A;  1KTA A;  3N8D A;  4FE2 A;  4DRF A;  2R7L A;  2V58 A;  1A48 A;  4RCN A;  2WYO A;  3OUU A;  1KJQ A;  1JLL B;  4HNT A;  1CKN B;  5H80 A;  1EUC B;  2Y4R A;  3VPD A;  2ODT X;  1KEE A;  3UZB A;  3PFF A;  1C3O A;  3GB8 B;  3U55 A;  1GGO A;  3LWB A;  5D1O A;  4ZHQ F;  2HG8 A;  3KAJ A;  4O7Z A;  3VNN A;  2R82 A;  3ETH A;  2QK4 A;  5BWX A;  3RTX A;  1E4E A;  4UCT A;  4PBC A;  4FFP A;  3BG5 A;  3JZF A;  1CE8 A;  4HR7 A;  3WO1 A;  1V9P A;  1A9X A;  1EUD B;  1C30 A;  4EQ5 A;  2COI A;  4YBZ B;  4HNU A;  3TY5 A;  2ZGI A;  1JKJ B;  3KAL A;  1B04 A;  1BNC A;  1Z2O X;  1EKP A;  1W96 A;  4MV1 A;  3MJF A;  1A3G A;  3TW6 A;  3PN1 A;  5BYB A;  3JSL A;  2CNU A;  1DV1 A;  2GPW A;  2V59 A;  2YS7 A;  3V4S A;  1UC9 A;  4CKB A;  4UCV A;  2CNV A;  2V5A A;  3HB9 A;  2W6N A;  2COG A;  4O7N A;  3G8D A;  4TVI A;  5CM0 A;  3QFF A;  2W6Q A;  2W6Z A;  3Q1K A;  5LOV F;  4ZI7 F;  3NC0 B;  5EZY F;  3T9D A;  1ZAU A;  2CZG A;  2I8C A;  5C8Y F;  4IZO A;  3UFX B;  2R85 A;  4O7W A;  2SCU B;  1DGS A;  2ABJ A;  3K5I A;  4O7V A;  5DMX A;  2NUA B;  2EJ2 A;  5HBR B;  3L2P A;  4M0J A;  1I1L A;  3QWU A;  3CSW A;  3UQ8 A;  4O82 A;  3RR5 A;  3TY9 A;  1AUV A;  4IWY A;  2R87 A;  4FFO A;  1X9N A;  2EJ0 A;  3T54 A;  3MWD A;  1DAA A;  1AUX A;  3SNO A;  1GSA A;  2HHF A;  1KJ9 A;  1VS0 A;  3VPB A;  1VKZ A;  1M0W A;  4O83 A;  5JQW A;  2QF7 A;  2R86 A;  4CKE A;  1S68 A;  1I1M A;  1DIK A;  4O86 A;  4CHI A;  3BAA A;  5I5T A;  1A0G A;  3TQT A;  5BWU A;  5J2T F;  4MA0 A;  4IHJ F;  4PZ6 A;  2FPG B;  3TY8 A;  1G2W A;  4MV4 A;  4DLK A;  5E25 A;  2VUG A;  4UFZ A;  4Q4C A;  5DAA A;  2NU9 B;  4O2B F;  2FPI B;  3GLK A;  4FGR A;  4DAA A;  5I47 A;  1ULZ A;  2PN1 A;  1GSO A;  4O7S A;  3V4Z A;  2HGX A;  5JVL A;  2R7K A;  2DLN A;  1I7L A;  5BPH A;  4NYE A;  2CFM A;  3KYH C;  3TEK A;  4M9U A;  4EFE A;  2HGW A;  3BAB A;  4XYL B;  2Q7D A;  2NU6 B;  5D8D A;  2VQD A;  2YL2 A;  1KJ8 A;  4FU0 A;  1IYE A;  4UUG A;  1KC7 A;  1VBG A;  2X0S A;  4I4T F;  5DGH A;  3WNZ A;  2XCL A;  3OUZ A;  4IWX A;  2DAB A;  3JSN A;  4XX0 B;  3U0G A;  3GDE A;  4EGQ A;  2HVR A;  1B6R A;  5BMV F;  1Z2N X;  3DTF A;  5I5Y A;  1EYZ A;  2YRX A;  4PZ8 A;  1EKV A;  3R5X A;  4MV8 A;  3WWJ A;  3MWE A;  1Z2P X;  2R7N A;  1XDN A;  1KUT A;  4YAK B;  4I50 F;  2GQS A;  3WO0 A;  1A0I A;  4Q4D A;  5HV6 A;  2YRW A;  3WWH A;  4YJ3 F;  3T9E A;  2DAA A;  2HDK A;  2OWO A;  1IOV A;  5BYA A;  2YZG A;  3S24 A;  5LXT F;  3K5H A;  5BWV A;  3KRE A;  4YAJ B;  3TW7 A;  3T9B A;  4Y8V B;  3NBZ B;  3JZ6 A;  5JQG F;  2HGS A;  4HQ6 A;  2VPQ A;  1UC8 A;  4ZQI A;  2X5R A;  3DAA A;  3RUP A;  2Q2U A;  5KKN B;  5D1O B;  5I60 A;  4MV7 A;  2IP4 A;  3TIN A;  4NZM A;  4O81 A;  2FPP B;  4NZO A;  4TV9 F;  5CB4 F;  3K3P A;  4MV9 A;  1E4E B;  3I12 A;  5D1P A;  2QB5 A;  5LYJ F;  1EHI A;  5CAE B;  2W70 A;  3AX6 A;  5IYZ F;  1EZ1 A;  4HNV A; 
#chains in the Genus database with same CATH homology
 4UCS A;  1S68 A;  2Q2T A;  3BAA A;  3BA8 A;  2HVS A;  1CKN B;  4PZ6 A;  2HVQ A;  3TY8 A;  4UCR A;  2VUG A;  4UFZ A;  3GB8 B;  4E6N A;  5D1O A;  1P16 A;  3BA9 A;  1XK5 A;  1TAE A;  3VNN A;  2CFM A;  3RTX A;  3KYH C;  3W5O A;  4UCT A;  4EFE A;  3BAB A;  1V9P A;  4UCU A;  4CC6 A;  4EQ5 A;  4GLX A;  3TY5 A;  3JSN A;  1CKN A;  2HIX A;  3GDE A;  2HVR A;  1B04 A;  1CKM A;  1P8L A;  1TA8 A;  4LH6 A;  3W1B A;  3PN1 A;  4PZ8 A;  3JSL A;  5FPO A;  4UCV A;  1XDN A;  1FVI A;  4PZ7 A;  3NBY B;  1A0I A;  2OWO A;  3S24 A;  3NC0 B;  5DIS C;  3NBZ B;  1DGS A;  4EEQ A;  4CC5 A;  3L2P A;  3W1G A;  2Q2U A;  4LH7 A;  5D1O B;  4UCO A;  3QWU A;  4DRF A;  3GJX B;  3UQ8 A;  3RR5 A;  3TY9 A;  5FPR A;  1CKO A;  1X9N A;  5D1P A;  4EFB A;  2HIV A;  1VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...