4UCTA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 102
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4uctA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4uctA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4uctA02
3W1BA 4DR5B 3SGIA 1FVIA 4CC6A 4LFCB 2HHHB 2ZM6B 1XNQB 4B3RB 1CKOA 4DR4B 4JI5B 2UUAB 4JI1B 4DUZB 3W5OA 4LFBB 1CKNB 4DV4B 4LFAB 4DV2B 3TY5A 2UXDB 1DGSA 3GDEA 4UCUA 4YHHB 4DR2B 4X65B 4K0KB 1B04A 4DUYB 3L2PA 4PZ7A 1TA8A 4X64B 4DR1B 1XDNA 4JI6B 4JI7B 1A0IA 3NC0B 3GJXB 2VQEB 5D1PA 1CKNA 3T1HB 1HNZB 4B3SB 4LF8B 1HNXB 4DR3B 2OWOA 1N32B 3NBZB 1XMOB 1FJGB 3KYHC 4NXMB 4CC5A 4E6NA 2VUGA 1V9PA 2VQFB 1HNWB 3JSLA 4LF9B 4GKKB 1N33B 3BA8A 3TY8A 5LMUB 5LMNB 4EFBA 4EEQA 1IBLB 4JI8B 2Q2TA 1XNRB 1N34B 5IWAB 5BR8B 4UCTA 4DR7B 4PZ8A 4JI3B 4B3TB 4UFZA 2UUBB 1XMQB 3W1GA 4TOIA 2UXCB 1HR0B 4UCSA 4LH7A 2HVSA 3RR5A 1CKMA 2HIVA 4DR6B 2E5LB 4AQYB 4EFEA 4LF6B 4UCRA 1I94B 1IBKB 1X9NA 1P8LA 4DV5B 2UXBB 4JV5B 1S68A 2CFMA 3VNNA 1ZAUA 3UQ8A 2UUCB 4LF5B 1N36B 4PZ6A 2HIXA 4DV6B 1TAEA 5D1OA 2HVQA 4B3MB 2HVRA 2UU9B 4DV7B 1VS0A 4X62B 3TY9A 4KHPB 4EQ5A 4UCVA 3RTXA 5FPOA 1P16A 1XK5A 4GKJB 3BAAA 4YY3B 4LF7B 5FPRA 4JYAB 1IBMB 4NXNB 4DV0B 3BA9A 3S24A 4JI2B 4OX9B 4UCOA 4LF4B 4JI0B 3PN1A 4DV3B 5DISC 4LH6A 1J5EB 4GLXA 4X66B 4DRFA 3T1YB 3GB8B 5D1OB 4JI4B 3QWUA 3OTOB 2F4VB 2Q2UA 4DV1B 3BABA 3NBYB 3JSNA
chains in the Genus database with same CATH superfamily
3OD4A 4CKEA 4TV8F 3LSUA 4QE9A 2CGNA 2ARHA 4UVBA 3CCJV 2CNUA 4JI5B 1F51A 2CNVA 2CZGA 4DUZB 4A3MG 1PKXA 1COWG 4DR1O 3F8NA 3ETQA 2EILC 1HR0H 3OE7G 3AEIA 1S03G 4PA7A 1FPOA 3DGEA 2W9CB 2JEIA 4D6TH 5GONB 1XOUA 1KB9F 3SR2C 2VQEO 1I94O 1N33H 2UXDH 4R8UA 4LF9H 4X66O 5BR8H 4LF8B 2R93G 3N43B 1XHXA 3CPWU 4GT1A 4MAMA 5I5XA 5JVDA 3JD0A 2DWCA 3KYHC 3JATA 4E6NA 1V9PA 1K4CC 1WA8A 4P30A 1HNWB 5KG5A 4JGSA 3CJHB 4MV6A 1K3EA 4R7RA 2WLIA 2FYUH 1MZFA 5K2MA 3VPBA 5LMUO 4EEYA 2IH3C 4IIJA 4O7TA 1XNRB 1YSCA 1N34B 3H1JH 1QNMA 2OIEA 3ZN0A 3ZS8C 2CK3G 4CS2A 1W2BU 2BQUA 2R8HA 2ZR2A 2YUAA 2HVSA 2Q0OC 1BGWA 1IYEA 1FAFA 4DV6O 5KFRA 4IRKA 4CH4A 5KG0A 3GV5B 3JAWB 5LP6A 1W96A 3ZMSA 3VQXA 1AI4A 3K0GA 2GQRA 1JXLA 2ZM6O 1ZL8B 1HNWO 5CN0A 2GBOA 3HKCA 2R72A 3WO1A 4BY7G 1YZBA 4F4YA 3OGIB 2BOCC 3P32A 2CGOA 4G2KA 4UXNA 4DV1H 2R92G 2W70A 2C22A 4ZQIA 1N34H 4TM5A 4JTDB 5KFVA 3GV7B 4ZKIA 2RCVA 2QM7A 1L2ZA 1Q43A 3ZMTA 1MSDA 2N05A 2XCPA 3T9AA 3ZN1A 3OSNA 3APQA 4HR7A 4HZ3A 5BPFA 4U6PA 4OPAA 1AI7A 1YDXA 4JI4B 3RBZA 4RAIA 4UUJC 3AG4C 3SPJA 1RFYA 5J2UA 4NKGB 2DQ0A 5LHGA 2HLDG 1XNQO 4CC6A 2R6FA 5KT4A 3SPHA 1OCRB 3KG2A 4IIJF 4B3SH 5EBWC 4DO2A 4FJCC 5KHKA 4DV2B 2CH7A 4B7EA 4WBNB 5DG7A 1XMQH 5KFXA 3RB4A 1VKZA 4K35A 4CMFA 2Q69A 3GVMA 4DR1B 4C7UA 4JI7B 1GSAA 1M1KW 3K3PA 3R5FA 2FMLA 3JD2A 2B5UA 4ECZA 4A3IG 5IP7G 2JK5C 2YS8A 1KC8W 4DR3O 2F4VH 5H6RA 1IOVA 2C2RA 4PI2A 4O4JF 2H94A 2GDSA 1N8RW 3W7WA 2CTRA 4ICGA 4HBNA 4Z2WA 5LMNB 1YJ9V 1BCCH 3BHPA 4OPHA 4ZHQA 4O7NA 2WAMA 4DL6A 2DZDA 3RFRA 3FB5C 1NI8A 3C0FB 3T1HH 5KFYA 1SKVA 2XIGA 4RB0A 4FLZA 4F4ZA 3E83A 5K3WA 3RV3A 2HGXA 2KSWA 1ZL8A 3CJHA 4LH7A 2FMAA 2DYRC 4PI0A 4LFCH 3CCRV 5DM6V 4B3RH 1VP7A 2RGRA 2ZDQA 5J2UF 1ZAUA 3VQVA 3LP8A 4WBNF 2WLLB 1GSOA 4DV6B 2CTPA 3CCUV 1RM1B 4ECUA 1WP7A 2XGQA 3N2KB 4MVOA 2ZM6H 1VS0A 3UZBA 1WRVA 4C5BA 3D36C 3SPCA 5BWWA 4FLVA 1BJTA 5JQGF 2Q8VA 3B09A 5ITZA 3GIPA 1I5XA 3T9BA 3F7YC 5LBQA 5DGIA 2OCCB 1SQBH 1IBMB 1KQSU 1S0VA 4LF7O 2DPIA 3CB2A 1FFTB 4I5SA 3D8CA 5KFHA 2EBOA 2PI4A 1M9NA 2LJ2A 2RDIA 1FYJA 2W6PA 3GILA 1DAAA 3KKYA 1BZKA 4OX9H 4X8AA 3RGZA 4NXNH 2K1EA 5IT9W 4XBFA 1BXRA 3JALB 3UT5B 3J81N 1B3QA 4J9QA 1AJPA 1PP9H 1Q6IA 4BAYA 2HHHH 1B6RA 3A0HZ 1E79G 2YZMA 2Y0SE 2JEFA 5AG2A 2R8JA 3WFVA 2FPPB 4F6EA 1K1QA 2Y0SA 1CKOA 1KC7A 5EZYA 4WFFA 1EHIA 1T3NA 2W6ZA 3JZFA 2Q6AA 1URFA 3R5XA 4LFBB 4X1KA 4U3JA 1CPYA 5C8YA 5J2TF 2DAAA 3AG4B 3T5KA 4DQNA 2Q67A 3K59A 2UVVA 5BPHA 1Y76A 2DN9A 3ZX6A 3WB2A 2BE3A 4X64B 1BNCA 2A0LA 1YVWA 3A0BZ 2C2EA 1F4NA 3STZC 1EZJA 1SESA 5JWPA 3E8GA 4HNUA 1B6SA 5FNVB 1R3LC 4WBNA 1HNXB 4FFPA 5C1PA 1WCMG 4B7KA 2V1DA 1ZX3A 4J9OA 3QTCA 5JH7B 2AZ0A 1Y74B 4ECYA 5BYAA 1V51A 4A3LG 1GH6A 4MA0A 2P5OA 3ZMZA 1L8DA 3ABKC 2FLLA 2Q9LA 1OCZB 4ZIBA 2Z0AA 2XCLA 1BL8A 1ROPA 2QWQB 2PMZA 2P4KA 2ETNA 4JZGA 1NR1A 2IA6A 3Q4HA 2AHZA 3FKIG 4JI0H 1Q82W 4RU9A 3ZEDA 4BIUA 4EGJA 4O3OA 1FFXA 2YIDA 3TIIA 2VUMA 1C3OA 2YZLA 1M7JA 2BQRA 1SQQH 3M99B 1VIBA 3RYIA 4ED0A 2F93B 5EYPA 5DN6G 2A1HA 3RB3A 3QF7A 3E35A 4A5UB 1J95A 5FLXW 5I5TA 5LP6C 3ZCCA 2FB9A 2IMWP 3AG1C 2V7QG 3W7XA 5LA6B 5KFTA 3OHAA 5L1JA 5L9XA 2FLNA 3AG3C 3E8FA 4JAAA 4UB8Z 4DV7O 2EIYA 2HVQA 4O4LA 3PFFA 1NQTA 2KQXA 5JJEB 1M90W 4EQ5A 4QJFA 4JAVA 4UCVA 4J9LA 4KXRA 2CH7B 3EPGA 3PR5B 4AHCA 2A9HA 4DR7H 2I8CA 1YIJV 2Q7GA 3T99A 3NUAA 2WAQE 3JD1A 4FU0A 3FFQA 4NB5A 5KKNB 2HVKC 2W6NA 4XYMB 4IZOA 5L3GA 1IBMO 1AR1B 3T1YB 1CS0A 3QWUA 2PTMA 4NVPA 4X1IA 4F4LA 3LUTB 4O7LA 1K7DA 4O7WA 3NBYB 3KHGA 5KT3A 2V9WA 3GTJA 3W7UA 1GYFA 1AP6A 1KT8A 1FVIA 4NXMH 4NZNA 5JVLA 2ASDA 1S5HC 5D5QA 2WSSG 1PD3A 4W4KA 3FAVA 4I7ZB 3H0GA 1VAJA 1SETA 3RB6A 2MK3A 5KFFA 4LF5H 3ZIAG 2PYLA 4OX9O 4DL3A 2I80A 1EUDB 4JI6H 2Y48A 1D5AA 3BPZA 4C5AA 1N48A 1NH2D 4QWAA 5I5VA 3H1IH 2EIKC 3SJBC 1KJIA 3GIQA 1KMIZ 2YZGA 4EYHB 2RGVA 4GYCB 4IT5A 2ZGIA 2F66C 1K1SA 3TCUA 4IAJA 1E1QG 1KYOF 4U3JB 1K33A 4MV9A 5KFMA 4KHPH 1Y67A 3Q8SB 2JA6A 3GIMA 3SJQC 4O82A 3L72H 3H3VH 2AW9A 4F50A 4GX5A 2F43G 3HOYG 5BXZA 1S5JA 1M0TA 1HWYA 3I4MG 3E89A 3ZMVA 3CMEV 4EEQA 2B9ZA 2ABJA 4DR6O 2DMXA 3KHRA 1RJRA 5KG1A 2UVRA 2ZXWC 4K3AA 2YYAA 3QVNA 3BG5A 3HOVG 5DGAA 4O2AA 3UYYA 3CVZA 3CSWA 2VWKA 1I08A 2KG7B 4EKWA 3PJSK 5B1OA 5B5EZ 5JJJB 1VMGA 4BY1G 4L8JA 3T4ZA 2JEGA 2PY5A 1S68A 3ZRWA 5FLXN 2M05A 4RB2C 3CCEV 1N36B 2NVYA 3OR7C 1NU1H 1QR9A 2DWDC 3DSQA 2YW2A 5IYDO 3BCCH 1M57B 1VEWA 4ZOLA 1DK1A 1KP2A 3RBDA 3D36A 1IBKO 4Q8FA 4MTOA 5IYZB 3IG0A 4LSAA 5C4XG 2P90A 2Y0PA 3B77A 4JTCB 5EYPB 4R7CA 3CRCA 3E2EA 5EBMC 2XC9A 4XYLB 3BA9A 2ZNIA 2XAQA 5IJ0A 4YY3H 4H44B 1XMQO 3U9TA 3PN1A 2QTSA 4X65O 1NBMG 4GLWA 4MSWC 2B63G 5IJ9A 1WAZA 1S10A 4NZMA 2GTAA 1JIHA 2WLIB 3E86A 5CE8A 2IBKA 5KG3A 3A8TA 2R9IA 3KHHA 3W1BA 4DR5B 2W9BA 2EIKB 4DRXA 5B1BB 4L87A 3FYIB 3MHSC 4IHJA 2YRXA 1Q90D 3KCYA 4LFBO 1K4DC 3CX5F 3ZHUA 5KMGB 2PYJA 4WFGA 3GDEA 5DECA 2CAZC 2DLNA 3UO3A 2EIMC 2AQ4A 4X1YA 4ZHQB 2ZKOA 4Q8EA 3HT5A 4PDLA 3LDEA 4JPRA 3ZHVA 2XHBA 3RYHB 3MWMA 3H01A 3E5NA 2NR5A 3Q1KA 5D1PA 5BMVF 1K97A 4H0LB 4O2AB 1G2WA 4TV8A 2GLTA 3RFCA 3G6EV 3PZPA 2OWOA 1EKPA 2QYZA 2WE6A 4IRCA 5IY5C 4PELA 5L3DA 1EBOA 3KHLA 3K06A 4ZI7F 3TY8A 1ZTEA 2KG7A 2AHYA 4I55F 2WLHA 5DG8A 2GUZB 4ECWA 4MVUA 1AVMA 3MR6A 4X65H 2UUBB 1VBGA 2V59A 2QGNA 3ASOC 4TOIA 2Q73A 2VS0A 4QGPA 5KFUA 4LFAH 4XDKA 3JAMN 4JI8O 1KECA 3JAKA 3K08A 1R6TA 2ZIMA 5CMUA 1JX9A 1GN6A 2QWRB 4CH3A 1E4GT 3JZ6A 1BSMA 2NUAB 4DK1A 1RPOA 1IBKB 2UXBB 2OIGA 2HJFC 4A3KG 4LF5B 3ZHSA 3HKZA 1WPBA 4IR9A 5JJNB 1DF4A 4QPKA 3ABLB 4YR2A 3QNEA 4X62O 4QWDA 2EJ7A 3RTXA 5BWVA 3B40A 1N36O 5JH7A 3OUFA 4AQYH 2X6CA 3JAWA 4YJ2B 4GKJB 1XK5A 2W71A 3K0DA 3T1YH 3AX6A 4IWXA 1FD9A 3RT3C 2YXLA 2QEXV 4DV0O 1PM9A 4ME6A 5EC1C 3AG3B 4J9RA 4GCZA 3X2QC 4K0KO 3WWJA 1GRJA 5BMVA 1H2KA 1S72V 2PZSA 3JARB 1I2KA 3OHBA 1BMFG 3WWIA 2CTWA 1PV0A 1YF2A 5EOYA 4I4TF 2X7RB 5KA6A 1P84F 4J7JA 4Q45A 3OUSA 4CKBA 2EINC 2Y4RA 4J9NA 1N56A 1UNNC 2W0FC 3DC6A 1SQVH 3OEEG 2UUAO 5F9LA 4I4TB 2EJ0A 3V4SA 5HV6A 1H2GA 4I55A 1OBGA 3SDLA 2YL2A 4RB3C 2C35B 3K5HA 4YB8B 5DGHA 4GKJO 2KB1A 2BSKB 3BQ1A 1I50A 2COJA 2WWWA 4PA9A 3VA7A 3A0RA 4PZ7A 2IH1C 4RZQA 4IRDA 4O3SA 1NR7A 2DPJA 4MV3A 3FYEB 3SYAA 5CA1B 1S5LZ 4DV5O 4RCNA 2C2AA 2P67A 2HFEC 2BQ3A 2EZOA 2QK4A 1DV2A 1O9GA 5KT2A 1OCRC 1N32B 3GIKA 4JI5O 1H2MA 2B1GA 5T14A 4ED3A 2W9CA 4CHIA 2IW5A 1B6QA 3JSLA 1P4RA 4KL1A 4A93G 5LMNO 1S76D 5JQWA 3CXCU 1PK8A 4DUYO 4X20B 1H38A 1V54C 3VQWA 4JI8B 1LUWA 2FKLA 1HNXH 2R87A 4L1KA 3HXLA 2ODTX 1AJQA 4K0KH 2VUMG 4DR2H 1BQZA 1R6NA 1C30A 2Z04A 4JYBA 4R8CA 5HFMA 3FKIA 5KFQA 5IYBG 2ZJTA 4DV4H 4MT8A 4X9QA 1HNXO 4MW3A 3K5LA 1CQJB 4DIMA 3RB0A 2ITDC 4EFEA 1FS0G 2Z02A 3N44B 4GX1A 3OT7A 4UCRA 5D8DA 4O4JA 4LC1A 5E79Z 4LF6O 4R8UB 5F9NA 3NR7A 4DV5B 1G1XB 3H1KH 1HR0O 2OLSA 4X62H 3TW7A 1V55C 5GONA 2WLJA 4EGQA 5C1OA 1SA0B 2E5LH 4A3EG 1JCHA 4ZHQF 2COIA 3S3WA 3MWDA 4RUAA 2V58A 3U54A 2JS3A 4KHPB 1CE8A 2E2IA 3A2FA 4QPJA 2W9AA 4C2MA 2PF4E 2YICA 1KD1W 3U55A 1RSOB 1SZXA 4OX9B 1QVFU 1NTMH 4ECXA 2RDJA 3MDSA 1ORQC 2EIJC 4O4JB 2OYQA 1BHAA 4O86A 2X6AA 1LNQA 3HKCB 2NNUA 2R7ZG 4IHJB 4WFAV 1Y66A 2WB1E 2B1IA 4GZRB 5KFJA 4UB6Z 5BWXA 4I9WA 2W6OA 4W4LA 4TSFG 5LOVF 1S0MA 3JSNA 1O75A 4MV7A 1L1FA 1GKFA 1A32A 4UV9A 2DIKA 1T36A 1XREA 4UVCA 1Q7YW 1JX4A 1FXHA 3R9RA 2IU0A 1V54B 1VQPV 1KP3A 3N42B 2R8IA 5KFWA 3JCUZ 2UXCH 2A7WA 4EBEA 5IYDG 1EKFA 5B66Z 1M0WA 3J81W 4B3TH 1W0JG 4JI3H 3SYOA 4ECSA 4DLKA 1KKDA 2W8KA 1OCCC 3MHHC 1DIKA 2YI9A 1A0IA 5EK0A 3ZRSA 1JA8A 3DAAA 4GKKH 3OEHG 5A2QW 1HNZB 3ABMB 4FS2A 2N74A 4K8XA 2YIBD 2F4VO 1JJOA 5IE9A 1I5YA 3L70H 1CEZA 1UC8A 4J10A 4RQFA 5EZYF 2VUGA 3GQCA 3EXAA 4YJ3B 1HNZH 1G6UA 4HYKA 4GKKB 3WWHA 5C8YF 3HOUG 2F1MA 2L6LA 5C44G 2XTAA 2HEPA 2WAQA 1Y1WA 2RMKB 1VARA 4AYBA 1GM9A 2QE7G 3LWBA 2PN1A 2X5RA 4LFAO 5DGBA 3GTKA 2UUCH 4JI3B 4B3TB 2WA4A 5LOVB 3ZHQA 2BCCH 4WFBV 5LGNA 3G8DA 4U7OA 1TWCA 3M9MB 3TINA 3GTLA 1CKMA 5LL6b 2LGWA 5LHHA 3CQZA 3G6XA 3AK2A 2HGWA 1I94B 3BFRA 2DYSB 1NZ6A 3CXHF 5L1KA 2BTQA 4HQ6A 2Y4TA 5FD5A 3ML0A 1AJNA 1P7BA 5DQHA 5F2VO 4JAUA 2UU9B 2VPQA 3N41B 3K9SA 3T5LA 4X62B 3U0GA 5LXTB 5IWAO 5L1IA 1A9XA 1VF6C 2MCTA 4J9MA 4O2BB 4MTGA 4RWUA 2Y69C 4LFCO 4B3RO 3SYQA 5KT6A 1KBLA 2QM8A 3F7VC 3L9DA 4JI4H 4NXNB 4AYBE 4PD4F 2FLPA 3S24A 4DL5A 1Y76B 5CB4F 3CRRA 4BXXG 4ECRA 1IOWA 4F6RA 5LP6B 3K3WA 2JEUA 3TQTA 3MWEA 2VQFH 3SYPA 2ZNJA 5TISZ 5KX5F 2JJ2G 3T1YO 2DWEC 2V5AA 4O4LF 4FM9A 1OCOC 1K5SA 4TV9A 2IJHA 4O3NA 5LYJB 1EUCB 4O83A 3SGIA 4C5CA 4MVZA 2HHHB 1R3JC 2ZM6B 4TQRA 2UVUA 3LDCA 2V4QA 1LUVA 4DV6H 4RO2A 1IURA 1EN4A 5KHHA 4DV4B 4RNNA 2GPSA 4WHXA 3SPIA 4EG0A 1EZ1A 4PA6A 3E22B 4ED7A 4DR2B 3ICXA 1M4UA 1CQIB 1VQ5V 5KFIA 2ADQB 5KAFZ 1QR8A 3I12A 2YC0A 4YAKB 2PGGA 1RK6A 2R92A 4LF4H 3H40A 3M7MX 3T1HB 1SQPH 4TVIA 1XNRH 1AUVA 3GWKC 3GIDA 3JZIA 4O7VA 4GX2A 5D5PA 2Q7DA 4TUYA 4X66H 1E1RG 4BIOA 5KFAA 3CC2V 1ULZA 2NU6B 3BQ0A 1HNZO 1AUXA 2IJKA 2QB5A 1AR4A 2JDIG 4DV4O 5CBFA 5BR8B 5CB4A 5JCOC 5IJ9B 1GLVA 4FFLA 4CBCA 4JXUA 2AU0A 2UXCB 4DR1H 4RUFA 4UCSA 4O84A 4Q4DA 3BQ2A 1ZETA 3V6HA 5LXTA 2JVDA 3JAMW 5KX5A 2HIVA 5KS8A 1GO3E 2YCHA 4AQYB 5A9GA 4PDRA 1M5IA 1DLBA 2OCCC 4OGQB 3U9SA 5EWGA 5KFNA 3MJFA 1P7GA 1SQGA 2VWJA 4JI5H 2ZDIC 1TUEB 5E1AC 1DTOA 1L0NH 2M7WA 4I9QA 4E4TA 5J2UB 2JA7A 2VOBA 3PW5A 4U7NA 4LNUB 4CMDA 4O4IF 4JI7H 2UU9O 3PW2A 2OT5A 1GGOA 4O2AF 1GN3A 3HOZG 2DW4A 4BIZA 2XCAA 4D7SA 1HDJA 2WLNA 1GM8A 3JD4A 5BYBA 1R9TA 2VA3A 4GKJH 3OSPA 3RW0A 3I5DA 1I6UA 3K3VA 2GUZA 1RJPA 3QO7A 5KFGA 2JEXA 1F7YA 5KHGA 5D1OB 3V4ZA 1OCZC 4DV1B 3KAKA 4CH6A 3OUZA 1E4EA 3MR5A 1M56B 4TUYF 2XAFA 3FB8C 3K57A 1R1BA 3ZBHA 1PPJH 2UXBH 4DR5O 4YHHO 1A3GA 2VPSA 4Q43A 4M7EA 3D3IA 3GTGA 2YSUB 3MR2A 4ZI7B 4RB1A 3ETDA 4LFAB 4DW0A 3FB6C 2EJRA 1I1MA 1OCOB 1U96A 1XHZA 4K0KB 2H8PC 3QZ8A 4DUYB 2JGUA 3P3NA 1JQ0A 3SJCC 5LXTF 3CC4V 1XDNA 1EFRG 4F6RB 2QJ1A 2ZE5A 4G28B 2ZINA 5L3CA 5B3SC 3TGUH 4CS4A 1YHQV 5IYZF 2QSAA 3KREA 4MVQA 3AK3A 3SNOA 4DAAA 1H8HG 5GTHZ 3OTOH 2FL4A 4U7CA 3LULA 1SERA 3W7SA 2P6JA 1IBLO 1RPRA 2X0SA 2X0LA 4DR5H 2YS6A 4Q4CA 1XI1A 1JR9A 2QWNB 2ASLA 1VF5B 3EHBB 3LNNA 4HN2A 1WPXA 3G6YA 4EFBA 4O4LB 2DABA 5B1NA 4KHPO 3L4KA 2ZD9A 3GTQA 4ED2A 4JV5H 3TXSA 1NS1A 4RNMA 4O4HF 1UJWB 3ZMUA 1SYXB 3I55V 4B3SO 4GC6A 1X4TA 3NXSA 5DAAA 4MTDA 1R73A 5LA6F 1QLNA 3H0GG 4O3PA 4MV4A 3HKZE 4MTXA 3CC7V 4BBSG 1Q6HA 1SF9A 2JIZG 3CCLV 3X2QB 1M56C 2UVWA 4LF8O 4DUZH 4ZI7A 2R84A 3J7AU 3KAJA 5LGTA 2YI8A 4QE7A 2HG8A 1BHBA 3N2GA 5KFKA 3T1CA 1WCMA 5EIBC 4ED8A 2JA5G 3MAQA 2QTOA 3RVYA 3G80A 3JYCA 3QFFA 4O7YA 3BACA 5B1AB 2FJZA 3H9VA 4JASA 2XOKG 1M6VA 3QQMA 1EN5A 2JA7G 1TWGA 4DV0B 1R3KC 4ZBMA 2ZXWB 2YIAA 3L71H 2OTLV 2YXYA 4JZ2A 4B08A 2R7KA 5IYZA 4JI2H 4FM2A 1I3QA 4JYAH 2COGA 2KSDA 4LNUA 3OTOB 2W6MA 1RJQA 1N0NA 2HGSA 2DYSC 3N40P 5FNVF 3EPIA 2ZCEA 4YQWA 1N36H 3OW2U 3CS5A 2LW7A 5I5SA 1XUQA 4FFNA 2HHHO 4P9OA 1ZSPA 5JH7F 3ZJZA 1YJNV 1XL6A 1RYSA 2A06H 1WJZA 2NU7B 2D2CB 1XQ8A 2DOSA 4IR1A 4PDBA 3W7TA 2AGPA 2UUBH 4UCUA 4FZ1A 2WLKA 5IYCG 3CE2A 4O4HA 4X65B 4K8ZA 1PNMA 2AGOA 5KG4A 2D3OW 4FIPC 2CW8A 2QKCA 1S3JA 2R9RB 3HB9A 4TT3G 5LA6A 1EN6A 4I50A 4I4TA 4JI6B 2XAHA 5J2TB 4DL4A 3CRQA 3CCSV 1J5EH 3IAYA 4YBZB 1AROP 2H3OA 4QWCA 3N2GB 2P7TC 2J6UA 5CBHA 5KFZA 1IBLH 4FLWA 3OTOO 2X6BA 4M9UA 1FJGB 2J9GA 4NXMB 2E3CA 1MNGA 2BOBC 4FPPA 4CC5A 5IDJA 3RUPA 5LGUA 2W9BB 2DJVA 1N33O 3OMNB 4FLTA 2AGQA 3BA8A 4J7KA 4YP3A 3OAAG 4ECTA 3OMAB 3JCZA 3AW8A 1PNLA 3WNZA 3E8BA 3I4NG 2VQFO 1VBHA 2MW2B 1Y1WG 3STLC 4FFBA 2OH2A 2L35A 3CYOA 1ZQ7A 5HBRB 3RR5A 2EULA 3JRWA 1MOFA 4PHZA 4YHHH 4LF6B 3FMAA 1FKAH 1P8LA 5EIBD 4IYIA 5FNVA 3LNMB 1KUTA 2CFMA 4NYEA 2JA6G 2BR0A 1AR5A 1F23A 2O57A 4TWKA 2HIXA 4J42A 4YIOA 1YTFB 2ZDIA 4WF9V 1XMOH 2EJ2A 1Z5WA 1RP3B 2IBZH 2QWOB 3JASB 1PL0A 1S0OA 3VPCA 5KMGA 2NU8B 1BS3A 4CZZA 4M0JA 4YY3B 5C3EG 4Q20A 1MSWD 4WD3A 2Y0IA 2RQ6A 1SA0A 3T2MA 4DW1A 1Q6UA 4UCOA 2LP7A 2YZNA 5CR5A 3HB3B 4BW9A 4JI0B 1H2SB 3RBEA 5E25A 3E22A 4DV3B 2XT9A 3T9EA 5L1LA 1K9MW 4ED1A 1TWFA 1AN7A 4X66B 4E4EA 2OCHA 4N21A 4LF5O 4BW5A 5GONF 3SE7A 1I2LA 4A2AA 4J9SA 5EDWA 3CRAA 5FL7G 5DQGA 1L0LH 2Q2UA 4A2BA 2LFRA 1NTZH 1LR1A 1XNQH 3ETEA 4O4HB 3HPLC 4R50A 3ABMC 3GTPA 3C90A 3KALA 2JGDA 5KA5A 3EFFK 4JV1A 2VQDA 1YCIA 1QVGU 3TIGA 4JI2O 5EWFA 3J7AK 3OFNG 3H4BA 1VQOV 5FLMG 4WFHA 3AK1A 2OTJV 4X64H 4MV8A 1JFFA 1RSOA 3L2PA 1VQ4V 3OTFA 5IT9N 1TA8A 4FVMA 2XASA 3JAKB 2ODMA 4DV3H 5LOVA 1Q8IA 4HNVA 1JLLB 3GTOA 4X1KB 5KFSA 5LHIA 3K5NA 1Z5VA 2HJWA 3GV8B 1HP8A 5IP9G 3TK1A 4DV7H 2YDEA 4RZRA 3LSSA 2LFSA 4LSXA 2VQFB 3S3XA 2RJZA 4TQSA 5C5JA 4Q0YA 2BTQB 2FP4B 1ET0A 1GM7A 1VQNV 3Q8PB 5LMUB 2YIBA 4FK5C 5BWTA 4ED6A 4MTEA 1OBDA 2W6JG 4DXWA 3IC7A 4F4XA 1AI6A 1GN2A 4MW8A 4HAMA 1I0HA 4MVMA 4FM1A 1KJ8A 1YJWV 4JV5O 4A3BG 2FE3A 1AB3A 1TWHA 3K79A 4UUGA 2XGPA 4A3JG 2FK3A 2UU9H 5CA3A 4FBTA 3T54A 2W7PA 1D2DA 2IU3A 3FD9A 2GTSA 3UQ8A 1N0JA 3MFHA 5KHJA 3L74H 3DF7A 2HHFA 1AP5A 3GB7C 2CW7A 2E5LO 2F23A 4B3MB 4FM0A 4O4IB 4QW8A 4NTXA 5CAEB 5BR8O 1WB8A 4TV8B 3UFXB 2GQSA 1MZBA 4I0XB 5K1PA 4DV3O 4O7ZA 5DLGA 3D3QA 4J9KA 2HVJC 3IFXA 4Z1VA 2PMZE 3HO8A 3GTMA 3ABUA 3PVXA 3U11A 5KG6A 3MR3A 1IDSA 2Q7HA 1SZTA 3V6KA 1J5EB 4TUYB 4GLXA 4DL2A 1UPGA 4CS3A 1V4YA 2FPGB 3GIIA 4DRFA 1TVKB 1YI2V 2UXNA 3N2KA 5KLVH 2W6QA 1EM1A 3BABA 5L3BA 2R70A 1VQLV 4XDJA 5B3SB 4IWYA 2QDOA 2XAJA 1V55B 4FLYA 3N8DA 1PX2A 5BZBA 1RK5A 3Q2OA 4O7SA 3HOXG 2HP8A 1VQ7V 2VA2A 1OJHA 1IXMA 2UUAB 5CM0A 4JI1B 2CQYA 3PW4A 3LDDA 1H2LA 1VQMV 1T94A 3VOTA 5KFOA 1DGSA 1S0NA 4APMA 2ADPA 3WO0A 5JVDB 1HW7A 3G6VA 2ZR3A 1SCUB 5CA0A 1FXKB 2NLJC 3K03A 3AG7A 1NVPB 5KUKA 4TV9F 4FZ0A 5GTIZ 4B3SB 4LWSB 2R8KA 3GIJA 4EBDA 4JTAB 2ZDGA 3NGDA 3R23A 2E2HA 4ZOLB 5FR9A 3BJYA 3G67A 5GW7A 4J7ZA 1IXBA 3RF2A 1FKAO 1UC9A 5KAIZ 5JUMA 3EYYA 2LW1A 5DQIA 1W59A 4RUEA 4JF3A 5IWAB 2I87A 4UCTA 1MABG 3DTUB 1A0GA 1TWAA 4EBCA 1XMQB 2IJIA 3W1GA 1QLEC 3BY6A 3WU2Z 4LCUC 5IYBO 4LFBH 4NTYA 4FE2A 3B8MA 1I1LA 2E5LB 4B3MO 1H8EG 2YU9A 4AQYO 5FJ8G 2EIJB 1ZHQA 5IY5B 3MD0A 3CCQV 3L73H 4JV5B 1VF7A 1JVMA 4AILC 5LYJA 3ETHA 4YJ3F 2WLMA 3K04A 1TAEA 1N32O 4DR4H 4DYLA 4FFRA 4DR3H 2DQ3A 5H9CA 1SFOA 2R8GA 3CD6V 2ZIOA 5KHIA 3M4IA 4QWEA 4LBEC 1RYRA 1NVPD 3ASOB 3CEIA 4EB6A 4FLUA 4LF7B 5L3FA 5EZYB 2EIMB 4JI8H 2QR4A 2FTKA 4DV2O 5KT7A 1KUQA 1Z2GA 4H13B 3QO5A 2A79B 4A3GG 3TJTA 4FFOA 3HKEB 1TUBB 4HNAA 3V6JA 4LF7H 1N32H 3C3SA 4DK0A 2XD4A 1QU7A 1Q5OA 3SJAC 3SPGA 2QKSA 4PV1B 5IJ0B 1I1KA 3M9OB 3GWOA 1I7FA 4LFCB 4B3RB 4CE5A 2R7MA 5KFLA 5JVDF 4EYIB 1XMOO 4O4IA 4DR4B 1FJGO 3RYCB 2YXHA 1FFXB 3CCVV 2R86A 3W5OA 1Y14B 5I5WA 3THOA 5ITZB 2UXDB 4MVSA 3PW7A 2W57A 4TV9B 2CE4A 4DR6H 1BE3H 3IN5A 3RAXA 2F95B 2WLLA 2IJJA 3TETA 2P0AA 4KP4A 2V4RA 5LMNH 4P9PA 1KEEA 3NC0B 5EWEA 1W0KG 2UXCO 2ZT9B 3IC9A 5KFPA 3N6XA 3VPDA 2FK2A 2JA8G 5IWAH 3ORQA 3T9DA 4QJFB 1QHTA 1HNWH 1RM1C 5KG7A 3LQSA 3E8HA 1QLEB 4LR3A 3VMMA 1IX9A 5LP6F 3DXRB 4LF8H 4GC7A 3ASNB 2ATLA 4LF9B 4PWQA 2GPWA 2CNQA 2ZE8A 4FLXA 2KKWA 2FPIB 4ETSA 1N4CA 4PZ8A 1XNRO 1K92A 3I56V 5C8YB 1OHHG 4YJ2F 1HR0B 4DV2H 1J5EO 1JMKC 3KXYT 4A3CG 2WDTA 3JARA 4DR6B 4O7RA 3G6BA 4YR3A 3H20A 1YEWA 1X9NA 4H33A 5H2FZ 3SYCA 2YWVA 1P49A 3B4SA 3UM7A 3ZRVA 1AI5A 1CXZB 2LO1A 1Y1VA 3RAQA 1US6A 1IBKH 3VOUA 2R7NA 3FDSA 1YXBA 1A48A 1K73W 4GX0A 3VBBA 5KFDA 3PO2G 2PI5A 2HJDA 2VRZA 2JA5A 4RUCA 4KFMA 1NH2B 3ORRA 1SEIA 3ABKB 3DTGA 3M9NB 1VF6A 5I5UA 3IJ4A 5FPOA 2FK1A 5CA1F 2WTFA 1WN7A 2CUGA 3UT5A 1G8MA 2BSKA 2NU9B 1KKCA 2AXTZ 4IGGA 4FFKA 3AYHB 2P06A 1MZEA 4LF4B 1K5QA 4IYHA 3WB1A 5DLFA 1Q3EA 1UFIA 2RF4A 2N04A 3QG5A 3RYFA 4UV8A 4EB6B 4LMYA 4PJ0Z 2ALZA 2UXBO 4A3FG 1PNKA 3ZRXA 1KJJA 3FB7C 2M6YA 3CEBA 1WSCA 3Q4HB 4PDVA 2JEJA 1S77D 5HFLA 4J9PA 2Z3YA 2JRIA 3ABLC 1DV1A 2LQTA 2R93A 1Y1VG 1I7LA 1CKNB 3WG7C 1JDEA 3TY5A 2HHFB 4F4WA 4DL7A 3JALA 4YJ2A 1XL4A 1KBHA 4MA5A 3QO8A 1VQ8V 3P30A 4U3FH 2ILMA 4QSHA 3RYIB 4YR0A 2Z5UA 1BGYH 4FFBB 1WR2A 3HKBA 5KT5A 4X20A 4XDLA 1THZA 2E74B 3RJ0A 4N23A 3J80N 5FD6A 4X1IB 4DR3B 4KUMA 5LMUH 2G38A 3AG2C 1I7NA 3L4JA 1GSHA 3U10A 4RAYA 1OCCB 5DG9A 4I50B 2Q0AA 1N33B 3OMIB 5CA1A 3PR4A 1GO3F 2ASJA 1Y4MA 1Z2NX 4TQFA 2ZE6A 2Q2TA 3N27A 2R9AA 2O03A 2E75B 1H2NA 1SQXH 4PA4A 5JCOA 2RN9A 5JQGA 3O65A 3K5IA 3R5HA 4I50F 4UFZA 5BY1A 4LF9O 5BWUA 2FKXA 4I0XA 3DC5A 2Q5ZA 4DR2O 1I94H 4J9ZB 3G71V 1FXKC 2CDYA 2Q7EA 3HKEA 4DR7O 1CP9A 1B33N 1K83A 3TEKA 4JI3O 4H37A 4B3TO 4BR6A 1QCEA 2PBZA 2VR1A 1E4EB 2QA4V 4ABMA 2RNBA 2XNDG 4Q6GA 2UUCB 3WB0A 3CSXA 4O3QA 1O9HA 2ZQMA 2IP4A 4JUZA 1EZVH 5I60A 4PZ6A 4NYKA 1WH2A 5EC2C 3CP1A 3RYHA 2HVRA 1XDCA 3TQ1A 4NZOA 3M8AA 1VQ6V 2XUMA 3FKSG 4LF4O 4QIWE 5A2QN 1P16A 3DTFA 3RYFB 3OUUA 3BAAA 1SC5B 1EYZA 3KTMA 4YXWG 1SS3A 1NTKH 3RV4A 1FXVA 1MMMA 2AZ2A 4UVAA 3ETGA 5J2TA 1D5NA 2R85A 3RYCA 1K8AW 5CB4B 3VQYA 1WNSA 3GB8B 3B8NA 4JI1H 3OR6C 2UUAH 4JI7O 3BVOA 2IM9A 4J41A 5L3EA 1IYDA 3HKDB 5KX5B 1VQ9V 1MA1A 4FBUA 4FMTA 4PA3A 4B3MH 4K6NA 3HOWG 3LSQA 2J6SA 2EX3A 4J9YB 2HKOA 4J0MA 3OGCC 3Q8QB 4JV2A 2K9PA 3CRMA 5DEDA 2R82A 3UCSC 4A3DG 3RGXA 4LF6H 2ATKC 2CKZB 1R3IC 5CBGA 3TW6A 3O9OA 4JI4O 4O81A 4WFEA 4PBCA 1ZWIC 2VQEB 1T5EA 1ZUQA 3WG7B 3ZRWB 3TXQA 1DF5A 3K5MA 4R6ZA 1QQCA 3NBZB 4I55B 1E4FT 3ABTA 4CH5A 1NT2B 4QIWA 2AGAA 4MV1A 3EVKA 2C28A 1ENVA 3HR0A 1QBZA 1R6KA 4OXSA 4RAZA 4P2ZA 2LGQA 1JJ2U 3G8CA 3KCXA 5IYCO 4FS1A 3IGAC 4I7HA 5B1AC 1KU9A 3SI8A 2WYOA 4NXNO 1BQ0A 4DR7B 4O2BF 3F5TA 3AG1B 4DV5H 2GHYA 2DE0X 2FB5A 4HNTA 4O3RA 2QWPB 4YY3O 1GAXA 2HG5C 4JYCA 1X59A 1XEQA 4HYOA 4E2LA 2GSMB 5J9PC 5B1BC 4IIJB 4CKCA 5EBLC 3ETJA 3VNNA 3F5WC 2Q68A 2PUSA 3H1HH 5D1OA 1YITV 4JV0A 2JGDB 4JYAO 4DV7B 3BEHA 1Q86W 3QZ7A 1SRYA 1Z2PX 3FX7A 3TY9A 1WLEA 5CA0B 3ZHRA 1GTOA 1MG1A 5I47A 3MFIA 2ZE7A 2W8LA 1JDBB 1S9FA 4Q44A 3H1LH 4G3IA 2C2DA 4RQEA 5FPRA 1M93A 4JI2B 2W7OA 2UXXA 4MS2A 4DV1O 1Y6XA 4TQDA 5KG2A 4XX0B 2JJ1G 2Q4PA 4LH6A 3R66A 3UKMA 1XBLA 3T1HO 2XAGA 3L75H 1VQKV 4DV0H 2R7ZA 1KTAA 2A3QA 4J11A 1NKDA 2GV9A 2EZPA 4QIWF 3C3TA 3UO2A 4NLGA 3ASNC 2EJ3A 3K9AA 1WP8A 1XNQB 5KFEA 1IVSA 3T4DA 1S97A 3T5HA 3PO3G 3HKBB 3DXRA 2YEVB 4O2BA 3RVZA 3U0ZA 2Y69B 4JI0O 1OV9A 5H6QA 4YAJB 4YHHB 3K5OA 3JD3A 3RWRD 2V4DA 1B04A 3JATB 4WCEV 3HBLA 3N6RA 4G27B 3OM3B 4FFMA 2DYRB 5H80A 3PW0A 3G4SV 3CMAV 1F4MA 3P3PA 2UUBO 4JI6O 2C00A 2SCUB 3GJXB 5K1XA 4Z1MG 1CKNA 2Y4UA 1PL4A 4YIPA 3T7AA 1TGOA 2UUCO 5KUMA 2BTOA 3KZIZ 1TVKA 1JPXA 1XMOB 4DR4O 2P4VA 1GK9A 1JKJB 2QF7A 4NXMO 2WPDG 2UXDO 2VQEH 2ITCC 4DRXB 3T9CA 3B2EE 3RIZA 4X88A 1SQFA 1M57C 4ZOLF 2WB1A 1EKVA 1IBLB 1U97A 4LWSA 4FGRA 5CA0F 2PVPA 1IBMH 4MVRA 2E76B 2EILB 4X64O 3JASA 1TUBA 4HNAB 4GKKO 4X89A 1GMGA 4BWAA 5KFCA 3H4DA 4D7TA 1GN4A 1FXKA 5LL6Y 3T5JA 4ASUG 2YRWA 1W93A 3RN4A 4DUYH 1N34O 1JOYA 2W0XA 1AILA 4PDMA 3APOA 1BT8A 3FAVB 5C93A 4BBRG 3Q8RB 2B63A 3UZOA 2ZDHA 5H5NA 5JQGB 2YEVA 4QW9A 3R65A 3CHXA 2HDKA 5HNEA 3ZHTA 4JYYA 1FJGH 5I5YA 4GUNA 2R7LA 4QWBA 4DUZO 2EINB 4XZ3B 3J80W 2WA3A 5BMVB 4MTFA 5BWRA 2JS5A 2NN4A 3RGBA 1Q81W 3BRCA 1ZHSA 2CTQA 1ZLZA 1OZ0A 1XILA 1K34A 3AG2B 4IHJF 4JYAB 1JFFB 4JI1O 1YTFD 2J6TA 4BWSC 1G4YB 2P22C 3GLKA 4Y8VB 3HKDA 4ECQA 2HR3A 4NR1A 4NTWA 1KJ9A 2QKAA 4IL6Z 5DISC 1KJQA 1Z2OX 1Y74A 3LMLA 3JRXA 1WA8B 3T9FA 4LP8A 4YJ3A 5LYJF 4QNHB 1WB7A 4ECVA 3CWBH 2NVXA 2YS7A 3K58A 2RDCA 3CCMV 2F4VB 2W6IG 5KFBA 4RNOA 5DMXA 2QM4A 1IZ3A 4AI8A 4J80A 1OWTA 4X1YB 1B06A 1NJIW
chains in the Genus database with same CATH topology
3W1BA 4DR5B 2UXBH 4DRXA 1I7FA 4LFCB 4B3RB 4DR4B 4O4IA 4JI5B 2VPSA 4IHJA 3RYCB 4M7EA 1FFXB 4DUZB 3W5OA 4ZI7B 4RB1A 3THOA 4LFAB 5ITZB 3ETQA 5KMGB 2UXDB 2PYJA 3F8NA 1HR0H 3GDEA 1XHZA 2W57A 2CAZC 4TV9B 4K0KB 4DR6H 1S03G 4X1YA 4ZHQB 4DUYB 2JGUA 3SJCC 2F95B 5GONB 1XDNA 4F6RB 5LMNH 2QJ1A 2XHBA 3RYHB 2ZINA 3SR2C 3NC0B 3MWMA 1N33H 2UXDH 4CS4A 5D1PA 3N6XA 4LF9H 5IWAH 5BR8H 4LF8B 3N43B 4O2AB 4TV8A 1QHTA 1XHXA 1HNWH 3OTOH 2OWOA 5JVDA 3KYHC 2WE6A 3JATA 4E6NA 4DR5H 1V9PA 4LR3A 1HNWB 1XI1A 4LF8H 3LNNA 4LF9B 3TY8A 4R7RA 4FLXA 4EFBA 2KKWA 4ETSA 4IIJA 4O4LB 1XNRB 1N34B 4PZ8A 3L4KA 5C8YB 4X65H 4JV5H 2UUBB 3ZS8C 4TOIA 4CS2A 1HR0B 4DV2H 1SYXB 1JMKC 2HVSA 3KXYT 4LFAH 1X4TA 1BGWA 3JAKA 2WDTA 4MTDA 2ZIMA 3JARA 4DR6B 4CH4A 4CH3A 1E4GT 3H20A 4DK1A 1YEWA 1IBKB 1X9NA 3JAWB 5LP6A 2UXBB 1P49A 4DUZH 4ZI7A 4LF5B 3VQXA 3KAJA 1IBKH 2YI8A 1WPBA 5JJNB 3N2GA 3HKCA 2R72A 5EIBC 1SEIA 3MAQA 3RTXA 5FPOA 5JH7A 4DV1H 4AQYH 3JAWA 4YJ2B 1WN7A 4GKJB 1XK5A 1N34H 3UT5A 3T1YH 4DV0B 2YXLA 1L2ZA 1Q43A 2YIAA 4LF4B 3WB1A 1Q3EA 4B08A 3QG5A 5BMVA 5IYZA 4JI2H 2PZSA 4FM2A 3JARB 4JYAH 3RYFA 4JI4B 4LNUA 4EB6B 3OTOB 5EOYA 4LMYA 2HGSA 3N40P 2ZCEA 1N36H 5J2UA 4CC6A 4I4TB 1XQ8A 4I55A 4B3SH 1CKNB 5KHKA 4PDBA 4RB3C 4DV2B 3TY5A 4WBNB 3JALA 4YJ2A 1XMQH 2UUBH 4UCUA 4O4HA 4X65B 4K8ZA 2CW8A 4PZ7A 4RZQA 4DR1B 3RYIB 4JI6B 5LA6A 5J2TB 4I50A 4I4TA 1J5EH 4JI7B 3IAYA 5CA1B 4FFBB 3N2GB 3HKBA 4X20A 1IBLH 3RJ0A 5FD6A 1O9GA 4X1IB 4FLWA 2F4VH 4DR3B 1N32B 1FJGB 5LMUH 4NXMB 2E3CA 4PI2A 4CC5A 3L4JA 3JSLA 3U10A 4FLTA 4RAYA 4KL1A 4I50B 2Q0AA 3BA8A 1N33B 4HBNA 5CA1A 5LMNB 3BHPA 4ZHQA 1Z2NX 4TQFA 4X20B 3RFRA 4JI8B 3VQWA 2Q2TA 1HNXH 3C0FB 3HXLA 3T1HH 2R9AA 1SKVA 2O03A 5JCOA 5JQGA 2XIGA 4K0KH 4RB0A 4UFZA 4FLZA 4DR2H 4FFBA 1I94H 2KSWA 4LH7A 2ZJTA 4DV4H 3RR5A 2Q7EA 4PHZA 3K5LA 3HKEA 4PI0A 4EFEA 3N44B 4YHHH 4LF6B 4UCRA 3FMAA 1FKAH 4LFCH 4B3RH 4O4JA 1P8LA 5EIBD 2RGRA 4DV5B 5FNVA 2CFMA 4X62H 4Q6GA 1ZAUA 3VQVA 3CSXA 3WB0A 1O9HA 2UUCB 5GONA 1WH2A 4PZ6A 2HIXA 4DV6B 1SA0B 3RYHA 2E5LH 2HVRA 2ZM6H 3N2KB 1VS0A 1XMOH 1Z5WA 4FLVA 1BJTA 4KHPB 3JASB 5ITZA 5KMGA 3A2FA 1P16A 3RYFB 3BAAA 4YY3B 1IBMB 4OX9B 3CB2A 2RQ6A 1SA0A 4UCOA 4O4JB 2OYQA 4BW9A 5J2TA 1H2SB 4JI0B 3E22A 4DV3B 3HKCB 4IHJB 3RYCA 1AN7A 4X66B 4OX9H 5CB4B 3VQYA 4A2AA 1WNSA 3RGZA 4NXNH 5IT9W 3GB8B 4JI1H 2Q2UA 4A2BA 2UUAH 3JALB 3UT5B 2HHHH 1XNQH 2IM9A 4O4HB 3JSNA 1O75A 4MV7A 3HKDB 5KX5B 4B3MH 3KALA 1CKOA 5EZYA 2EX3A 4LFBB 4X1KA 3N42B 4J0MA 3J7AK 4U3JA 2UXCH 5C8YA 3RGXA 4X64H 4LF6H 1M0WA 3J81W 3K59A 1JFFA 4B3TH 1RSOA 4JI3H 3L2PA 3OTFA 1TA8A 4FVMA 3WB2A 3JAKB 4X64B 2YI9A 1A0IA 4DV3H 5LOVA 1Q8IA 2VQEB 4GKKH 1T5EA 4X1KB 5FNVB 5A2QW 1HNZB 3K5NA 1Z5VA 4WBNA 1HNXB 3K5MA 4K8XA 2YIBD 3QTCA 1JJOA 1QQCA 3NBZB 5JH7B 4DV7H 4I55B 1E4FT 4LSXA 2VUGA 2VQFB 2RJZA 1NT2B 4YJ3B 4CH5A 2P5OA 4Q0YA 2BTQB 1HNZH 1L8DA 1G6UA 4GKKB 4RAZA 2F1MA 4ZIBA 2HEPA 5LMUB 2YIBA 4MTEA 4I7HA 1KU9A 2WYOA 4DR7B 2UUCH 4JI3B 4B3TB 4JI0H 4DV5H 5LOVB 3ZEDA 4FM1A 2FE3A 1FFXA 1CKMA 5LL6b 2UU9H 3RYIA 2F93B 5EYPA 3QF7A 4IIJB 1I94B 5FLXW 5LP6C 2BTQA 3VNNA 3UQ8A 2PUSA 5KHJA 3DF7A 5FD5A 5LA6B 5D1OA 2HVQA 4B3MB 2CW7A 2UU9B 4O4LA 4DV7B 4FM0A 4O4IB 3N41B 4X62B 1Z2PX 5LXTB 3TY9A 5CA0B 5JJEB 4EQ5A 4TV8B 2MCTA 4O2BB 1MZBA 4UCVA 5K1PA 4AHCA 4DR7H 4JI4H 5FPRA 1M93A 4NXNB 3S24A 2Q7GA 4JI2B 3U11A 2Q7HA 4TQDA 3FFQA 4F6RA 5LP6B 4LH6A 1J5EB 4TUYB 4GLXA 4CS3A 2VQFH 4DV0H 2ZNJA 4DRFA 3T1YB 1TVKB 3QWUA 2PTMA 3N2KA 4NVPA 4X1IA 3BABA 2R70A 4FM9A 3NBYB 4TV9A 2GV9A 5LYJB 4FLYA 1GYFA 3SGIA 1FVIA 4NXMH 5D5QA 2ZM6B 2HHHB 1XNQB 4DV6H 2UUAB 4JI1B 4LF5H 2PYLA 3HKBB 5KHHA 4DV4B 4O2BA 3U0ZA 1DGSA 4APMA 3E22B 4JI6H 1D5AA 3BPZA 3K5OA 5JVDB 3RWRD 4YHHB 3ICXA 1HW7A 4DR2B 2V4DA 1B04A 1M4UA 3JATB 5CA0A 3SJBC 1KMIZ 2RGVA 4GYCB 2F66C 2PGGA 3GJXB 5K1XA 4LF4H 3M7MX 1CKNA 4IAJA 3T1HB 4B3SB 1TGOA 4U3JB 1XNRH 4MV9A 4KHPH 2BTOA 1TVKA 1XMOB 5D5PA 4ZOLB 4TUYA 4X66H 1S5JA 1M0TA 2VQEH 4DRXB 3RF2A 3B2EE 3RIZA 1SQFA 4EEQA 3EYYA 1IBLB 1IBMH 5IWAB 5BR8B 4UCTA 5CB4A 5JCOC 3JASA 1TUBA 4HNAB 5IJ9B 1XMQB 3W1GA 4BWAA 2UXCB 4D7TA 4DR1H 4UCSA 4LFBH 4O2AA 3CVZA 5LXTA 2JVDA 2VWKA 3JAMW 4DUYH 5KX5A 2HIVA 2YCHA 2E5LB 4AQYB 5JJJB 1ZHQA 4L8JA 1M5IA 2PY5A 4JV5B 1S68A 4RB2C 5JQGB 1VF7A 4AILC 5LYJA 1N36B 3CHXA 1TAEA 3DSQA 4JI5H 1SQGA 2VWJA 4DR4H 4ZOLA 1FJGH 4DR3H 3J80W 4I9QA 5BMVB 2ZIOA 5J2UB 5IYZB 5KHIA 3IG0A 4LSAA 2JS5A 5EYPB 3RGBA 2VOBA 3M4IA 3BRCA 1ZHSA 4LNUB 4EB6A 4FLUA 4JI7H 4LF7B 5EZYB 4JYAB 1JFFB 4JI8H 3BA9A 2P22C 4BWSC 2ZNIA 5IJ0A 4YY3H 3HKDA 4D7SA 4GKJH 3PN1A 5DISC 1Z2OX 1I6UA 3LMLA 3K3VA 4YJ3A 3HKEB 1TUBB 4HNAA 5IJ9A 5KHGA 5D1OB 4LF7H 1N32H 4DK0A 3K58A 2F4VB 4DV1B 3KAKA 4CH6A 1Q5OA 3SJAC 2QM4A 3K57A 4X1YB 5IJ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1B A;  4DR5 B;  3SGI A;  1FVI A;  4CC6 A;  4LFC B;  2HHH B;  2ZM6 B;  1XNQ B;  4B3R B;  1CKO A;  4DR4 B;  4JI5 B;  2UUA B;  4JI1 B;  4DUZ B;  3W5O A;  4LFB B;  1CKN B;  4DV4 B;  4LFA B;  4DV2 B;  3TY5 A;  2UXD B;  1DGS A;  3GDE A;  4UCU A;  4YHH B;  4DR2 B;  4X65 B;  4K0K B;  1B04 A;  4DUY B;  3L2P A;  4PZ7 A;  1TA8 A;  4X64 B;  4DR1 B;  1XDN A;  4JI6 B;  4JI7 B;  1A0I A;  3NC0 B;  3GJX B;  2VQE B;  5D1P A;  1CKN A;  3T1H B;  1HNZ B;  4B3S B;  4LF8 B;  1HNX B;  4DR3 B;  2OWO A;  1N32 B;  3NBZ B;  1XMO B;  1FJG B;  3KYH C;  4NXM B;  4CC5 A;  4E6N A;  2VUG A;  1V9P A;  2VQF B;  1HNW B;  3JSL A;  4LF9 B;  4GKK B;  1N33 B;  3BA8 A;  3TY8 A;  5LMU B;  5LMN B;  4EFB A;  4EEQ A;  1IBL B;  4JI8 B;  2Q2T A;  1XNR B;  1N34 B;  5IWA B;  5BR8 B;  4UCT A;  4DR7 B;  4PZ8 A;  4JI3 B;  4B3T B;  4UFZ A;  2UUB B;  1XMQ B;  3W1G A;  4TOI A;  2UXC B;  1HR0 B;  4UCS A;  4LH7 A;  2HVS A;  3RR5 A;  1CKM A;  2HIV A;  4DR6 B;  2E5L B;  4AQY B;  4EFE A;  4LF6 B;  4UCR A;  1I94 B;  1IBK B;  1X9N A;  1P8L A;  4DV5 B;  2UXB B;  4JV5 B;  1S68 A;  2CFM A;  3VNN A;  1ZAU A;  3UQ8 A;  2UUC B;  4LF5 B;  1N36 B;  4PZ6 A;  2HIX A;  4DV6 B;  1TAE A;  5D1O A;  2HVQ A;  4B3M B;  2HVR A;  2UU9 B;  4DV7 B;  1VS0 A;  4X62 B;  3TY9 A;  4KHP B;  4EQ5 A;  4UCV A;  3RTX A;  5FPO A;  1P16 A;  1XK5 A;  4GKJ B;  3BAA A;  4YY3 B;  4LF7 B;  5FPR A;  4JYA B;  1IBM B;  4NXN B;  4DV0 B;  3BA9 A;  3S24 A;  4JI2 B;  4OX9 B;  4UCO A;  4LF4 B;  4JI0 B;  3PN1 A;  4DV3 B;  5DIS C;  4LH6 A;  1J5E B;  4GLX A;  4X66 B;  4DRF A;  3T1Y B;  3GB8 B;  5D1O B;  4JI4 B;  3QWU A;  3OTO B;  2F4V B;  2Q2U A;  4DV1 B;  3BAB A;  3NBY B;  3JSN A; 
#chains in the Genus database with same CATH topology
 3OD4 A;  4CKE A;  4TV8 F;  3LSU A;  4QE9 A;  2CGN A;  2ARH A;  4UVB A;  3CCJ V;  2CNU A;  4JI5 B;  1F51 A;  2CNV A;  2CZG A;  4DUZ B;  4A3M G;  1PKX A;  1COW G;  4DR1 O;  3F8N A;  3ETQ A;  2EIL C;  1HR0 H;  3OE7 G;  3AEI A;  1S03 G;  4PA7 A;  1FPO A;  3DGE A;  2W9C B;  2JEI A;  4D6T H;  5GON B;  1XOU A;  1KB9 F;  3SR2 C;  2VQE O;  1I94 O;  1N33 H;  2UXD H;  4R8U A;  4LF9 H;  4X66 O;  5BR8 H;  4LF8 B;  2R93 G;  3N43 B;  1XHX A;  3CPW U;  4GT1 A;  4MAM A;  5I5X A;  5JVD A;  3JD0 A;  2DWC A;  3KYH C;  3JAT A;  4E6N A;  1V9P A;  1K4C C;  1WA8 A;  4P30 A;  1HNW B;  5KG5 A;  4JGS A;  3CJH B;  4MV6 A;  1K3E A;  4R7R A;  2WLI A;  2FYU H;  1MZF A;  5K2M A;  3VPB A;  5LMU O;  4EEY A;  2IH3 C;  4IIJ A;  4O7T A;  1XNR B;  1YSC A;  1N34 B;  3H1J H;  1QNM A;  2OIE A;  3ZN0 A;  3ZS8 C;  2CK3 G;  4CS2 A;  1W2B U;  2BQU A;  2R8H A;  2ZR2 A;  2YUA A;  2HVS A;  2Q0O C;  1BGW A;  1IYE A;  1FAF A;  4DV6 O;  5KFR A;  4IRK A;  4CH4 A;  5KG0 A;  3GV5 B;  3JAW B;  5LP6 A;  1W96 A;  3ZMS A;  3VQX A;  1AI4 A;  3K0G A;  2GQR A;  1JXL A;  2ZM6 O;  1ZL8 B;  1HNW O;  5CN0 A;  2GBO A;  3HKC A;  2R72 A;  3WO1 A;  4BY7 G;  1YZB A;  4F4Y A;  3OGI B;  2BOC C;  3P32 A;  2CGO A;  4G2K A;  4UXN A;  4DV1 H;  2R92 G;  2W70 A;  2C22 A;  4ZQI A;  1N34 H;  4TM5 A;  4JTD B;  5KFV A;  3GV7 B;  4ZKI A;  2RCV A;  2QM7 A;  1L2Z A;  1Q43 A;  3ZMT A;  1MSD A;  2N05 A;  2XCP A;  3T9A A;  3ZN1 A;  3OSN A;  3APQ A;  4HR7 A;  4HZ3 A;  5BPF A;  4U6P A;  4OPA A;  1AI7 A;  1YDX A;  4JI4 B;  3RBZ A;  4RAI A;  4UUJ C;  3AG4 C;  3SPJ A;  1RFY A;  5J2U A;  4NKG B;  2DQ0 A;  5LHG A;  2HLD G;  1XNQ O;  4CC6 A;  2R6F A;  5KT4 A;  3SPH A;  1OCR B;  3KG2 A;  4IIJ F;  4B3S H;  5EBW C;  4DO2 A;  4FJC C;  5KHK A;  4DV2 B;  2CH7 A;  4B7E A;  4WBN B;  5DG7 A;  1XMQ H;  5KFX A;  3RB4 A;  1VKZ A;  4K35 A;  4CMF A;  2Q69 A;  3GVM A;  4DR1 B;  4C7U A;  4JI7 B;  1GSA A;  1M1K W;  3K3P A;  3R5F A;  2FML A;  3JD2 A;  2B5U A;  4ECZ A;  4A3I G;  5IP7 G;  2JK5 C;  2YS8 A;  1KC8 W;  4DR3 O;  2F4V H;  5H6R A;  1IOV A;  2C2R A;  4PI2 A;  4O4J F;  2H94 A;  2GDS A;  1N8R W;  3W7W A;  2CTR A;  4ICG A;  4HBN A;  4Z2W A;  5LMN B;  1YJ9 V;  1BCC H;  3BHP A;  4OPH A;  4ZHQ A;  4O7N A;  2WAM A;  4DL6 A;  2DZD A;  3RFR A;  3FB5 C;  1NI8 A;  3C0F B;  3T1H H;  5KFY A;  1SKV A;  2XIG A;  4RB0 A;  4FLZ A;  4F4Z A;  3E83 A;  5K3W A;  3RV3 A;  2HGX A;  2KSW A;  1ZL8 A;  3CJH A;  4LH7 A;  2FMA A;  2DYR C;  4PI0 A;  4LFC H;  3CCR V;  5DM6 V;  4B3R H;  1VP7 A;  2RGR A;  2ZDQ A;  5J2U F;  1ZAU A;  3VQV A;  3LP8 A;  4WBN F;  2WLL B;  1GSO A;  4DV6 B;  2CTP A;  3CCU V;  1RM1 B;  4ECU A;  1WP7 A;  2XGQ A;  3N2K B;  4MVO A;  2ZM6 H;  1VS0 A;  3UZB A;  1WRV A;  4C5B A;  3D36 C;  3SPC A;  5BWW A;  4FLV A;  1BJT A;  5JQG F;  2Q8V A;  3B09 A;  5ITZ A;  3GIP A;  1I5X A;  3T9B A;  3F7Y C;  5LBQ A;  5DGI A;  2OCC B;  1SQB H;  1IBM B;  1KQS U;  1S0V A;  4LF7 O;  2DPI A;  3CB2 A;  1FFT B;  4I5S A;  3D8C A;  5KFH A;  2EBO A;  2PI4 A;  1M9N A;  2LJ2 A;  2RDI A;  1FYJ A;  2W6P A;  3GIL A;  1DAA A;  3KKY A;  1BZK A;  4OX9 H;  4X8A A;  3RGZ A;  4NXN H;  2K1E A;  5IT9 W;  4XBF A;  1BXR A;  3JAL B;  3UT5 B;  3J81 N;  1B3Q A;  4J9Q A;  1AJP A;  1PP9 H;  1Q6I A;  4BAY A;  2HHH H;  1B6R A;  3A0H Z;  1E79 G;  2YZM A;  2Y0S E;  2JEF A;  5AG2 A;  2R8J A;  3WFV A;  2FPP B;  4F6E A;  1K1Q A;  2Y0S A;  1CKO A;  1KC7 A;  5EZY A;  4WFF A;  1EHI A;  1T3N A;  2W6Z A;  3JZF A;  2Q6A A;  1URF A;  3R5X A;  4LFB B;  4X1K A;  4U3J A;  1CPY A;  5C8Y A;  5J2T F;  2DAA A;  3AG4 B;  3T5K A;  4DQN A;  2Q67 A;  3K59 A;  2UVV A;  5BPH A;  1Y76 A;  2DN9 A;  3ZX6 A;  3WB2 A;  2BE3 A;  4X64 B;  1BNC A;  2A0L A;  1YVW A;  3A0B Z;  2C2E A;  1F4N A;  3STZ C;  1EZJ A;  1SES A;  5JWP A;  3E8G A;  4HNU A;  1B6S A;  5FNV B;  1R3L C;  4WBN A;  1HNX B;  4FFP A;  5C1P A;  1WCM G;  4B7K A;  2V1D A;  1ZX3 A;  4J9O A;  3QTC A;  5JH7 B;  2AZ0 A;  1Y74 B;  4ECY A;  5BYA A;  1V51 A;  4A3L G;  1GH6 A;  4MA0 A;  2P5O A;  3ZMZ A;  1L8D A;  3ABK C;  2FLL A;  2Q9L A;  1OCZ B;  4ZIB A;  2Z0A A;  2XCL A;  1BL8 A;  1ROP A;  2QWQ B;  2PMZ A;  2P4K A;  2ETN A;  4JZG A;  1NR1 A;  2IA6 A;  3Q4H A;  2AHZ A;  3FKI G;  4JI0 H;  1Q82 W;  4RU9 A;  3ZED A;  4BIU A;  4EGJ A;  4O3O A;  1FFX A;  2YID A;  3TII A;  2VUM A;  1C3O A;  2YZL A;  1M7J A;  2BQR A;  1SQQ H;  3M99 B;  1VIB A;  3RYI A;  4ED0 A;  2F93 B;  5EYP A;  5DN6 G;  2A1H A;  3RB3 A;  3QF7 A;  3E35 A;  4A5U B;  1J95 A;  5FLX W;  5I5T A;  5LP6 C;  3ZCC A;  2FB9 A;  2IMW P;  3AG1 C;  2V7Q G;  3W7X A;  5LA6 B;  5KFT A;  3OHA A;  5L1J A;  5L9X A;  2FLN A;  3AG3 C;  3E8F A;  4JAA A;  4UB8 Z;  4DV7 O;  2EIY A;  2HVQ A;  4O4L A;  3PFF A;  1NQT A;  2KQX A;  5JJE B;  1M90 W;  4EQ5 A;  4QJF A;  4JAV A;  4UCV A;  4J9L A;  4KXR A;  2CH7 B;  3EPG A;  3PR5 B;  4AHC A;  2A9H A;  4DR7 H;  2I8C A;  1YIJ V;  2Q7G A;  3T99 A;  3NUA A;  2WAQ E;  3JD1 A;  4FU0 A;  3FFQ A;  4NB5 A;  5KKN B;  2HVK C;  2W6N A;  4XYM B;  4IZO A;  5L3G A;  1IBM O;  1AR1 B;  3T1Y B;  1CS0 A;  3QWU A;  2PTM A;  4NVP A;  4X1I A;  4F4L A;  3LUT B;  4O7L A;  1K7D A;  4O7W A;  3NBY B;  3KHG A;  5KT3 A;  2V9W A;  3GTJ A;  3W7U A;  1GYF A;  1AP6 A;  1KT8 A;  1FVI A;  4NXM H;  4NZN A;  5JVL A;  2ASD A;  1S5H C;  5D5Q A;  2WSS G;  1PD3 A;  4W4K A;  3FAV A;  4I7Z B;  3H0G A;  1VAJ A;  1SET A;  3RB6 A;  2MK3 A;  5KFF A;  4LF5 H;  3ZIA G;  2PYL A;  4OX9 O;  4DL3 A;  2I80 A;  1EUD B;  4JI6 H;  2Y48 A;  1D5A A;  3BPZ A;  4C5A A;  1N48 A;  1NH2 D;  4QWA A;  5I5V A;  3H1I H;  2EIK C;  3SJB C;  1KJI A;  3GIQ A;  1KMI Z;  2YZG A;  4EYH B;  2RGV A;  4GYC B;  4IT5 A;  2ZGI A;  2F66 C;  1K1S A;  3TCU A;  4IAJ A;  1E1Q G;  1KYO F;  4U3J B;  1K33 A;  4MV9 A;  5KFM A;  4KHP H;  1Y67 A;  3Q8S B;  2JA6 A;  3GIM A;  3SJQ C;  4O82 A;  3L72 H;  3H3V H;  2AW9 A;  4F50 A;  4GX5 A;  2F43 G;  3HOY G;  5BXZ A;  1S5J A;  1M0T A;  1HWY A;  3I4M G;  3E89 A;  3ZMV A;  3CME V;  4EEQ A;  2B9Z A;  2ABJ A;  4DR6 O;  2DMX A;  3KHR A;  1RJR A;  5KG1 A;  2UVR A;  2ZXW C;  4K3A A;  2YYA A;  3QVN A;  3BG5 A;  3HOV G;  5DGA A;  4O2A A;  3UYY A;  3CVZ A;  3CSW A;  2VWK A;  1I08 A;  2KG7 B;  4EKW A;  3PJS K;  5B1O A;  5B5E Z;  5JJJ B;  1VMG A;  4BY1 G;  4L8J A;  3T4Z A;  2JEG A;  2PY5 A;  1S68 A;  3ZRW A;  5FLX N;  2M05 A;  4RB2 C;  3CCE V;  1N36 B;  2NVY A;  3OR7 C;  1NU1 H;  1QR9 A;  2DWD C;  3DSQ A;  2YW2 A;  5IYD O;  3BCC H;  1M57 B;  1VEW A;  4ZOL A;  1DK1 A;  1KP2 A;  3RBD A;  3D36 A;  1IBK O;  4Q8F A;  4MTO A;  5IYZ B;  3IG0 A;  4LSA A;  5C4X G;  2P90 A;  2Y0P A;  3B77 A;  4JTC B;  5EYP B;  4R7C A;  3CRC A;  3E2E A;  5EBM C;  2XC9 A;  4XYL B;  3BA9 A;  2ZNI A;  2XAQ A;  5IJ0 A;  4YY3 H;  4H44 B;  1XMQ O;  3U9T A;  3PN1 A;  2QTS A;  4X65 O;  1NBM G;  4GLW A;  4MSW C;  2B63 G;  5IJ9 A;  1WAZ A;  1S10 A;  4NZM A;  2GTA A;  1JIH A;  2WLI B;  3E86 A;  5CE8 A;  2IBK A;  5KG3 A;  3A8T A;  2R9I A;  3KHH A;  3W1B A;  4DR5 B;  2W9B A;  2EIK B;  4DRX A;  5B1B B;  4L87 A;  3FYI B;  3MHS C;  4IHJ A;  2YRX A;  1Q90 D;  3KCY A;  4LFB O;  1K4D C;  3CX5 F;  3ZHU A;  5KMG B;  2PYJ A;  4WFG A;  3GDE A;  5DEC A;  2CAZ C;  2DLN A;  3UO3 A;  2EIM C;  2AQ4 A;  4X1Y A;  4ZHQ B;  2ZKO A;  4Q8E A;  3HT5 A;  4PDL A;  3LDE A;  4JPR A;  3ZHV A;  2XHB A;  3RYH B;  3MWM A;  3H01 A;  3E5N A;  2NR5 A;  3Q1K A;  5D1P A;  5BMV F;  1K97 A;  4H0L B;  4O2A B;  1G2W A;  4TV8 A;  2GLT A;  3RFC A;  3G6E V;  3PZP A;  2OWO A;  1EKP A;  2QYZ A;  2WE6 A;  4IRC A;  5IY5 C;  4PEL A;  5L3D A;  1EBO A;  3KHL A;  3K06 A;  4ZI7 F;  3TY8 A;  1ZTE A;  2KG7 A;  2AHY A;  4I55 F;  2WLH A;  5DG8 A;  2GUZ B;  4ECW A;  4MVU A;  1AVM A;  3MR6 A;  4X65 H;  2UUB B;  1VBG A;  2V59 A;  2QGN A;  3ASO C;  4TOI A;  2Q73 A;  2VS0 A;  4QGP A;  5KFU A;  4LFA H;  4XDK A;  3JAM N;  4JI8 O;  1KEC A;  3JAK A;  3K08 A;  1R6T A;  2ZIM A;  5CMU A;  1JX9 A;  1GN6 A;  2QWR B;  4CH3 A;  1E4G T;  3JZ6 A;  1BSM A;  2NUA B;  4DK1 A;  1RPO A;  1IBK B;  2UXB B;  2OIG A;  2HJF C;  4A3K G;  4LF5 B;  3ZHS A;  3HKZ A;  1WPB A;  4IR9 A;  5JJN B;  1DF4 A;  4QPK A;  3ABL B;  4YR2 A;  3QNE A;  4X62 O;  4QWD A;  2EJ7 A;  3RTX A;  5BWV A;  3B40 A;  1N36 O;  5JH7 A;  3OUF A;  4AQY H;  2X6C A;  3JAW A;  4YJ2 B;  4GKJ B;  1XK5 A;  2W71 A;  3K0D A;  3T1Y H;  3AX6 A;  4IWX A;  1FD9 A;  3RT3 C;  2YXL A;  2QEX V;  4DV0 O;  1PM9 A;  4ME6 A;  5EC1 C;  3AG3 B;  4J9R A;  4GCZ A;  3X2Q C;  4K0K O;  3WWJ A;  1GRJ A;  5BMV A;  1H2K A;  1S72 V;  2PZS A;  3JAR B;  1I2K A;  3OHB A;  1BMF G;  3WWI A;  2CTW A;  1PV0 A;  1YF2 A;  5EOY A;  4I4T F;  2X7R B;  5KA6 A;  1P84 F;  4J7J A;  4Q45 A;  3OUS A;  4CKB A;  2EIN C;  2Y4R A;  4J9N A;  1N56 A;  1UNN C;  2W0F C;  3DC6 A;  1SQV H;  3OEE G;  2UUA O;  5F9L A;  4I4T B;  2EJ0 A;  3V4S A;  5HV6 A;  1H2G A;  4I55 A;  1OBG A;  3SDL A;  2YL2 A;  4RB3 C;  2C35 B;  3K5H A;  4YB8 B;  5DGH A;  4GKJ O;  2KB1 A;  2BSK B;  3BQ1 A;  1I50 A;  2COJ A;  2WWW A;  4PA9 A;  3VA7 A;  3A0R A;  4PZ7 A;  2IH1 C;  4RZQ A;  4IRD A;  4O3S A;  1NR7 A;  2DPJ A;  4MV3 A;  3FYE B;  3SYA A;  5CA1 B;  1S5L Z;  4DV5 O;  4RCN A;  2C2A A;  2P67 A;  2HFE C;  2BQ3 A;  2EZO A;  2QK4 A;  1DV2 A;  1O9G A;  5KT2 A;  1OCR C;  1N32 B;  3GIK A;  4JI5 O;  1H2M A;  2B1G A;  5T14 A;  4ED3 A;  2W9C A;  4CHI A;  2IW5 A;  1B6Q A;  3JSL A;  1P4R A;  4KL1 A;  4A93 G;  5LMN O;  1S76 D;  5JQW A;  3CXC U;  1PK8 A;  4DUY O;  4X20 B;  1H38 A;  1V54 C;  3VQW A;  4JI8 B;  1LUW A;  2FKL A;  1HNX H;  2R87 A;  4L1K A;  3HXL A;  2ODT X;  1AJQ A;  4K0K H;  2VUM G;  4DR2 H;  1BQZ A;  1R6N A;  1C30 A;  2Z04 A;  4JYB A;  4R8C A;  5HFM A;  3FKI A;  5KFQ A;  5IYB G;  2ZJT A;  4DV4 H;  4MT8 A;  4X9Q A;  1HNX O;  4MW3 A;  3K5L A;  1CQJ B;  4DIM A;  3RB0 A;  2ITD C;  4EFE A;  1FS0 G;  2Z02 A;  3N44 B;  4GX1 A;  3OT7 A;  4UCR A;  5D8D A;  4O4J A;  4LC1 A;  5E79 Z;  4LF6 O;  4R8U B;  5F9N A;  3NR7 A;  4DV5 B;  1G1X B;  3H1K H;  1HR0 O;  2OLS A;  4X62 H;  3TW7 A;  1V55 C;  5GON A;  2WLJ A;  4EGQ A;  5C1O A;  1SA0 B;  2E5L H;  4A3E G;  1JCH A;  4ZHQ F;  2COI A;  3S3W A;  3MWD A;  4RUA A;  2V58 A;  3U54 A;  2JS3 A;  4KHP B;  1CE8 A;  2E2I A;  3A2F A;  4QPJ A;  2W9A A;  4C2M A;  2PF4 E;  2YIC A;  1KD1 W;  3U55 A;  1RSO B;  1SZX A;  4OX9 B;  1QVF U;  1NTM H;  4ECX A;  2RDJ A;  3MDS A;  1ORQ C;  2EIJ C;  4O4J B;  2OYQ A;  1BHA A;  4O86 A;  2X6A A;  1LNQ A;  3HKC B;  2NNU A;  2R7Z G;  4IHJ B;  4WFA V;  1Y66 A;  2WB1 E;  2B1I A;  4GZR B;  5KFJ A;  4UB6 Z;  5BWX A;  4I9W A;  2W6O A;  4W4L A;  4TSF G;  5LOV F;  1S0M A;  3JSN A;  1O75 A;  4MV7 A;  1L1F A;  1GKF A;  1A32 A;  4UV9 A;  2DIK A;  1T36 A;  1XRE A;  4UVC A;  1Q7Y W;  1JX4 A;  1FXH A;  3R9R A;  2IU0 A;  1V54 B;  1VQP V;  1KP3 A;  3N42 B;  2R8I A;  5KFW A;  3JCU Z;  2UXC H;  2A7W A;  4EBE A;  5IYD G;  1EKF A;  5B66 Z;  1M0W A;  3J81 W;  4B3T H;  1W0J G;  4JI3 H;  3SYO A;  4ECS A;  4DLK A;  1KKD A;  2W8K A;  1OCC C;  3MHH C;  1DIK A;  2YI9 A;  1A0I A;  5EK0 A;  3ZRS A;  1JA8 A;  3DAA A;  4GKK H;  3OEH G;  5A2Q W;  1HNZ B;  3ABM B;  4FS2 A;  2N74 A;  4K8X A;  2YIB D;  2F4V O;  1JJO A;  5IE9 A;  1I5Y A;  3L70 H;  1CEZ A;  1UC8 A;  4J10 A;  4RQF A;  5EZY F;  2VUG A;  3GQC A;  3EXA A;  4YJ3 B;  1HNZ H;  1G6U A;  4HYK A;  4GKK B;  3WWH A;  5C8Y F;  3HOU G;  2F1M A;  2L6L A;  5C44 G;  2XTA A;  2HEP A;  2WAQ A;  1Y1W A;  2RMK B;  1VAR A;  4AYB A;  1GM9 A;  2QE7 G;  3LWB A;  2PN1 A;  2X5R A;  4LFA O;  5DGB A;  3GTK A;  2UUC H;  4JI3 B;  4B3T B;  2WA4 A;  5LOV B;  3ZHQ A;  2BCC H;  4WFB V;  5LGN A;  3G8D A;  4U7O A;  1TWC A;  3M9M B;  3TIN A;  3GTL A;  1CKM A;  5LL6 b;  2LGW A;  5LHH A;  3CQZ A;  3G6X A;  3AK2 A;  2HGW A;  1I94 B;  3BFR A;  2DYS B;  1NZ6 A;  3CXH F;  5L1K A;  2BTQ A;  4HQ6 A;  2Y4T A;  5FD5 A;  3ML0 A;  1AJN A;  1P7B A;  5DQH A;  5F2V O;  4JAU A;  2UU9 B;  2VPQ A;  3N41 B;  3K9S A;  3T5L A;  4X62 B;  3U0G A;  5LXT B;  5IWA O;  5L1I A;  1A9X A;  1VF6 C;  2MCT A;  4J9M A;  4O2B B;  4MTG A;  4RWU A;  2Y69 C;  4LFC O;  4B3R O;  3SYQ A;  5KT6 A;  1KBL A;  2QM8 A;  3F7V C;  3L9D A;  4JI4 H;  4NXN B;  4AYB E;  4PD4 F;  2FLP A;  3S24 A;  4DL5 A;  1Y76 B;  5CB4 F;  3CRR A;  4BXX G;  4ECR A;  1IOW A;  4F6R A;  5LP6 B;  3K3W A;  2JEU A;  3TQT A;  3MWE A;  2VQF H;  3SYP A;  2ZNJ A;  5TIS Z;  5KX5 F;  2JJ2 G;  3T1Y O;  2DWE C;  2V5A A;  4O4L F;  4FM9 A;  1OCO C;  1K5S A;  4TV9 A;  2IJH A;  4O3N A;  5LYJ B;  1EUC B;  4O83 A;  3SGI A;  4C5C A;  4MVZ A;  2HHH B;  1R3J C;  2ZM6 B;  4TQR A;  2UVU A;  3LDC A;  2V4Q A;  1LUV A;  4DV6 H;  4RO2 A;  1IUR A;  1EN4 A;  5KHH A;  4DV4 B;  4RNN A;  2GPS A;  4WHX A;  3SPI A;  4EG0 A;  1EZ1 A;  4PA6 A;  3E22 B;  4ED7 A;  4DR2 B;  3ICX A;  1M4U A;  1CQI B;  1VQ5 V;  5KFI A;  2ADQ B;  5KAF Z;  1QR8 A;  3I12 A;  2YC0 A;  4YAK B;  2PGG A;  1RK6 A;  2R92 A;  4LF4 H;  3H40 A;  3M7M X;  3T1H B;  1SQP H;  4TVI A;  1XNR H;  1AUV A;  3GWK C;  3GID A;  3JZI A;  4O7V A;  4GX2 A;  5D5P A;  2Q7D A;  4TUY A;  4X66 H;  1E1R G;  4BIO A;  5KFA A;  3CC2 V;  1ULZ A;  2NU6 B;  3BQ0 A;  1HNZ O;  1AUX A;  2IJK A;  2QB5 A;  1AR4 A;  2JDI G;  4DV4 O;  5CBF A;  5BR8 B;  5CB4 A;  5JCO C;  5IJ9 B;  1GLV A;  4FFL A;  4CBC A;  4JXU A;  2AU0 A;  2UXC B;  4DR1 H;  4RUF A;  4UCS A;  4O84 A;  4Q4D A;  3BQ2 A;  1ZET A;  3V6H A;  5LXT A;  2JVD A;  3JAM W;  5KX5 A;  2HIV A;  5KS8 A;  1GO3 E;  2YCH A;  4AQY B;  5A9G A;  4PDR A;  1M5I A;  1DLB A;  2OCC C;  4OGQ B;  3U9S A;  5EWG A;  5KFN A;  3MJF A;  1P7G A;  1SQG A;  2VWJ A;  4JI5 H;  2ZDI C;  1TUE B;  5E1A C;  1DTO A;  1L0N H;  2M7W A;  4I9Q A;  4E4T A;  5J2U B;  2JA7 A;  2VOB A;  3PW5 A;  4U7N A;  4LNU B;  4CMD A;  4O4I F;  4JI7 H;  2UU9 O;  3PW2 A;  2OT5 A;  1GGO A;  4O2A F;  1GN3 A;  3HOZ G;  2DW4 A;  4BIZ A;  2XCA A;  4D7S A;  1HDJ A;  2WLN A;  1GM8 A;  3JD4 A;  5BYB A;  1R9T A;  2VA3 A;  4GKJ H;  3OSP A;  3RW0 A;  3I5D A;  1I6U A;  3K3V A;  2GUZ A;  1RJP A;  3QO7 A;  5KFG A;  2JEX A;  1F7Y A;  5KHG A;  5D1O B;  3V4Z A;  1OCZ C;  4DV1 B;  3KAK A;  4CH6 A;  3OUZ A;  1E4E A;  3MR5 A;  1M56 B;  4TUY F;  2XAF A;  3FB8 C;  3K57 A;  1R1B A;  3ZBH A;  1PPJ H;  2UXB H;  4DR5 O;  4YHH O;  1A3G A;  2VPS A;  4Q43 A;  4M7E A;  3D3I A;  3GTG A;  2YSU B;  3MR2 A;  4ZI7 B;  4RB1 A;  3ETD A;  4LFA B;  4DW0 A;  3FB6 C;  2EJR A;  1I1M A;  1OCO B;  1U96 A;  1XHZ A;  4K0K B;  2H8P C;  3QZ8 A;  4DUY B;  2JGU A;  3P3N A;  1JQ0 A;  3SJC C;  5LXT F;  3CC4 V;  1XDN A;  1EFR G;  4F6R B;  2QJ1 A;  2ZE5 A;  4G28 B;  2ZIN A;  5L3C A;  5B3S C;  3TGU H;  4CS4 A;  1YHQ V;  5IYZ F;  2QSA A;  3KRE A;  4MVQ A;  3AK3 A;  3SNO A;  4DAA A;  1H8H G;  5GTH Z;  3OTO H;  2FL4 A;  4U7C A;  3LUL A;  1SER A;  3W7S A;  2P6J A;  1IBL O;  1RPR A;  2X0S A;  2X0L A;  4DR5 H;  2YS6 A;  4Q4C A;  1XI1 A;  1JR9 A;  2QWN B;  2ASL A;  1VF5 B;  3EHB B;  3LNN A;  4HN2 A;  1WPX A;  3G6Y A;  4EFB A;  4O4L B;  2DAB A;  5B1N A;  4KHP O;  3L4K A;  2ZD9 A;  3GTQ A;  4ED2 A;  4JV5 H;  3TXS A;  1NS1 A;  4RNM A;  4O4H F;  1UJW B;  3ZMU A;  1SYX B;  3I55 V;  4B3S O;  4GC6 A;  1X4T A;  3NXS A;  5DAA A;  4MTD A;  1R73 A;  5LA6 F;  1QLN A;  3H0G G;  4O3P A;  4MV4 A;  3HKZ E;  4MTX A;  3CC7 V;  4BBS G;  1Q6H A;  1SF9 A;  2JIZ G;  3CCL V;  3X2Q B;  1M56 C;  2UVW A;  4LF8 O;  4DUZ H;  4ZI7 A;  2R84 A;  3J7A U;  3KAJ A;  5LGT A;  2YI8 A;  4QE7 A;  2HG8 A;  1BHB A;  3N2G A;  5KFK A;  3T1C A;  1WCM A;  5EIB C;  4ED8 A;  2JA5 G;  3MAQ A;  2QTO A;  3RVY A;  3G80 A;  3JYC A;  3QFF A;  4O7Y A;  3BAC A;  5B1A B;  2FJZ A;  3H9V A;  4JAS A;  2XOK G;  1M6V A;  3QQM A;  1EN5 A;  2JA7 G;  1TWG A;  4DV0 B;  1R3K C;  4ZBM A;  2ZXW B;  2YIA A;  3L71 H;  2OTL V;  2YXY A;  4JZ2 A;  4B08 A;  2R7K A;  5IYZ A;  4JI2 H;  4FM2 A;  1I3Q A;  4JYA H;  2COG A;  2KSD A;  4LNU A;  3OTO B;  2W6M A;  1RJQ A;  1N0N A;  2HGS A;  2DYS C;  3N40 P;  5FNV F;  3EPI A;  2ZCE A;  4YQW A;  1N36 H;  3OW2 U;  3CS5 A;  2LW7 A;  5I5S A;  1XUQ A;  4FFN A;  2HHH O;  4P9O A;  1ZSP A;  5JH7 F;  3ZJZ A;  1YJN V;  1XL6 A;  1RYS A;  2A06 H;  1WJZ A;  2NU7 B;  2D2C B;  1XQ8 A;  2DOS A;  4IR1 A;  4PDB A;  3W7T A;  2AGP A;  2UUB H;  4UCU A;  4FZ1 A;  2WLK A;  5IYC G;  3CE2 A;  4O4H A;  4X65 B;  4K8Z A;  1PNM A;  2AGO A;  5KG4 A;  2D3O W;  4FIP C;  2CW8 A;  2QKC A;  1S3J A;  2R9R B;  3HB9 A;  4TT3 G;  5LA6 A;  1EN6 A;  4I50 A;  4I4T A;  4JI6 B;  2XAH A;  5J2T B;  4DL4 A;  3CRQ A;  3CCS V;  1J5E H;  3IAY A;  4YBZ B;  1ARO P;  2H3O A;  4QWC A;  3N2G B;  2P7T C;  2J6U A;  5CBH A;  5KFZ A;  1IBL H;  4FLW A;  3OTO O;  2X6B A;  4M9U A;  1FJG B;  2J9G A;  4NXM B;  2E3C A;  1MNG A;  2BOB C;  4FPP A;  4CC5 A;  5IDJ A;  3RUP A;  5LGU A;  2W9B B;  2DJV A;  1N33 O;  3OMN B;  4FLT A;  2AGQ A;  3BA8 A;  4J7K A;  4YP3 A;  3OAA G;  4ECT A;  3OMA B;  3JCZ A;  3AW8 A;  1PNL A;  3WNZ A;  3E8B A;  3I4N G;  2VQF O;  1VBH A;  2MW2 B;  1Y1W G;  3STL C;  4FFB A;  2OH2 A;  2L35 A;  3CYO A;  1ZQ7 A;  5HBR B;  3RR5 A;  2EUL A;  3JRW A;  1MOF A;  4PHZ A;  4YHH H;  4LF6 B;  3FMA A;  1FKA H;  1P8L A;  5EIB D;  4IYI A;  5FNV A;  3LNM B;  1KUT A;  2CFM A;  4NYE A;  2JA6 G;  2BR0 A;  1AR5 A;  1F23 A;  2O57 A;  4TWK A;  2HIX A;  4J42 A;  4YIO A;  1YTF B;  2ZDI A;  4WF9 V;  1XMO H;  2EJ2 A;  1Z5W A;  1RP3 B;  2IBZ H;  2QWO B;  3JAS B;  1PL0 A;  1S0O A;  3VPC A;  5KMG A;  2NU8 B;  1BS3 A;  4CZZ A;  4M0J A;  4YY3 B;  5C3E G;  4Q20 A;  1MSW D;  4WD3 A;  2Y0I A;  2RQ6 A;  1SA0 A;  3T2M A;  4DW1 A;  1Q6U A;  4UCO A;  2LP7 A;  2YZN A;  5CR5 A;  3HB3 B;  4BW9 A;  4JI0 B;  1H2S B;  3RBE A;  5E25 A;  3E22 A;  4DV3 B;  2XT9 A;  3T9E A;  5L1L A;  1K9M W;  4ED1 A;  1TWF A;  1AN7 A;  4X66 B;  4E4E A;  2OCH A;  4N21 A;  4LF5 O;  4BW5 A;  5GON F;  3SE7 A;  1I2L A;  4A2A A;  4J9S A;  5EDW A;  3CRA A;  5FL7 G;  5DQG A;  1L0L H;  2Q2U A;  4A2B A;  2LFR A;  1NTZ H;  1LR1 A;  1XNQ H;  3ETE A;  4O4H B;  3HPL C;  4R50 A;  3ABM C;  3GTP A;  3C90 A;  3KAL A;  2JGD A;  5KA5 A;  3EFF K;  4JV1 A;  2VQD A;  1YCI A;  1QVG U;  3TIG A;  4JI2 O;  5EWF A;  3J7A K;  3OFN G;  3H4B A;  1VQO V;  5FLM G;  4WFH A;  3AK1 A;  2OTJ V;  4X64 H;  4MV8 A;  1JFF A;  1RSO A;  3L2P A;  1VQ4 V;  3OTF A;  5IT9 N;  1TA8 A;  4FVM A;  2XAS A;  3JAK B;  2ODM A;  4DV3 H;  5LOV A;  1Q8I A;  4HNV A;  1JLL B;  3GTO A;  4X1K B;  5KFS A;  5LHI A;  3K5N A;  1Z5V A;  2HJW A;  3GV8 B;  1HP8 A;  5IP9 G;  3TK1 A;  4DV7 H;  2YDE A;  4RZR A;  3LSS A;  2LFS A;  4LSX A;  2VQF B;  3S3X A;  2RJZ A;  4TQS A;  5C5J A;  4Q0Y A;  2BTQ B;  2FP4 B;  1ET0 A;  1GM7 A;  1VQN V;  3Q8P B;  5LMU B;  2YIB A;  4FK5 C;  5BWT A;  4ED6 A;  4MTE A;  1OBD A;  2W6J G;  4DXW A;  3IC7 A;  4F4X A;  1AI6 A;  1GN2 A;  4MW8 A;  4HAM A;  1I0H A;  4MVM A;  4FM1 A;  1KJ8 A;  1YJW V;  4JV5 O;  4A3B G;  2FE3 A;  1AB3 A;  1TWH A;  3K79 A;  4UUG A;  2XGP A;  4A3J G;  2FK3 A;  2UU9 H;  5CA3 A;  4FBT A;  3T54 A;  2W7P A;  1D2D A;  2IU3 A;  3FD9 A;  2GTS A;  3UQ8 A;  1N0J A;  3MFH A;  5KHJ A;  3L74 H;  3DF7 A;  2HHF A;  1AP5 A;  3GB7 C;  2CW7 A;  2E5L O;  2F23 A;  4B3M B;  4FM0 A;  4O4I B;  4QW8 A;  4NTX A;  5CAE B;  5BR8 O;  1WB8 A;  4TV8 B;  3UFX B;  2GQS A;  1MZB A;  4I0X B;  5K1P A;  4DV3 O;  4O7Z A;  5DLG A;  3D3Q A;  4J9K A;  2HVJ C;  3IFX A;  4Z1V A;  2PMZ E;  3HO8 A;  3GTM A;  3ABU A;  3PVX A;  3U11 A;  5KG6 A;  3MR3 A;  1IDS A;  2Q7H A;  1SZT A;  3V6K A;  1J5E B;  4TUY B;  4GLX A;  4DL2 A;  1UPG A;  4CS3 A;  1V4Y A;  2FPG B;  3GII A;  4DRF A;  1TVK B;  1YI2 V;  2UXN A;  3N2K A;  5KLV H;  2W6Q A;  1EM1 A;  3BAB A;  5L3B A;  2R70 A;  1VQL V;  4XDJ A;  5B3S B;  4IWY A;  2QDO A;  2XAJ A;  1V55 B;  4FLY A;  3N8D A;  1PX2 A;  5BZB A;  1RK5 A;  3Q2O A;  4O7S A;  3HOX G;  2HP8 A;  1VQ7 V;  2VA2 A;  1OJH A;  1IXM A;  2UUA B;  5CM0 A;  4JI1 B;  2CQY A;  3PW4 A;  3LDD A;  1H2L A;  1VQM V;  1T94 A;  3VOT A;  5KFO A;  1DGS A;  1S0N A;  4APM A;  2ADP A;  3WO0 A;  5JVD B;  1HW7 A;  3G6V A;  2ZR3 A;  1SCU B;  5CA0 A;  1FXK B;  2NLJ C;  3K03 A;  3AG7 A;  1NVP B;  5KUK A;  4TV9 F;  4FZ0 A;  5GTI Z;  4B3S B;  4LWS B;  2R8K A;  3GIJ A;  4EBD A;  4JTA B;  2ZDG A;  3NGD A;  3R23 A;  2E2H A;  4ZOL B;  5FR9 A;  3BJY A;  3G67 A;  5GW7 A;  4J7Z A;  1IXB A;  3RF2 A;  1FKA O;  1UC9 A;  5KAI Z;  5JUM A;  3EYY A;  2LW1 A;  5DQI A;  1W59 A;  4RUE A;  4JF3 A;  5IWA B;  2I87 A;  4UCT A;  1MAB G;  3DTU B;  1A0G A;  1TWA A;  4EBC A;  1XMQ B;  2IJI A;  3W1G A;  1QLE C;  3BY6 A;  3WU2 Z;  4LCU C;  5IYB O;  4LFB H;  4NTY A;  4FE2 A;  3B8M A;  1I1L A;  2E5L B;  4B3M O;  1H8E G;  2YU9 A;  4AQY O;  5FJ8 G;  2EIJ B;  1ZHQ A;  5IY5 B;  3MD0 A;  3CCQ V;  3L73 H;  4JV5 B;  1VF7 A;  1JVM A;  4AIL C;  5LYJ A;  3ETH A;  4YJ3 F;  2WLM A;  3K04 A;  1TAE A;  1N32 O;  4DR4 H;  4DYL A;  4FFR A;  4DR3 H;  2DQ3 A;  5H9C A;  1SFO A;  2R8G A;  3CD6 V;  2ZIO A;  5KHI A;  3M4I A;  4QWE A;  4LBE C;  1RYR A;  1NVP D;  3ASO B;  3CEI A;  4EB6 A;  4FLU A;  4LF7 B;  5L3F A;  5EZY B;  2EIM B;  4JI8 H;  2QR4 A;  2FTK A;  4DV2 O;  5KT7 A;  1KUQ A;  1Z2G A;  4H13 B;  3QO5 A;  2A79 B;  4A3G G;  3TJT A;  4FFO A;  3HKE B;  1TUB B;  4HNA A;  3V6J A;  4LF7 H;  1N32 H;  3C3S A;  4DK0 A;  2XD4 A;  1QU7 A;  1Q5O A;  3SJA C;  3SPG A;  2QKS A;  4PV1 B;  5IJ0 B;  1I1K A;  3M9O B;  3GWO A;  1I7F A;  4LFC B;  4B3R B;  4CE5 A;  2R7M A;  5KFL A;  5JVD F;  4EYI B;  1XMO O;  4O4I A;  4DR4 B;  1FJG O;  3RYC B;  2YXH A;  1FFX B;  3CCV V;  2R86 A;  3W5O A;  1Y14 B;  5I5W A;  3THO A;  5ITZ B;  2UXD B;  4MVS A;  3PW7 A;  2W57 A;  4TV9 B;  2CE4 A;  4DR6 H;  1BE3 H;  3IN5 A;  3RAX A;  2F95 B;  2WLL A;  2IJJ A;  3TET A;  2P0A A;  4KP4 A;  2V4R A;  5LMN H;  4P9P A;  1KEE A;  3NC0 B;  5EWE A;  1W0K G;  2UXC O;  2ZT9 B;  3IC9 A;  5KFP A;  3N6X A;  3VPD A;  2FK2 A;  2JA8 G;  5IWA H;  3ORQ A;  3T9D A;  4QJF B;  1QHT A;  1HNW H;  1RM1 C;  5KG7 A;  3LQS A;  3E8H A;  1QLE B;  4LR3 A;  3VMM A;  1IX9 A;  5LP6 F;  3DXR B;  4LF8 H;  4GC7 A;  3ASN B;  2ATL A;  4LF9 B;  4PWQ A;  2GPW A;  2CNQ A;  2ZE8 A;  4FLX A;  2KKW A;  2FPI B;  4ETS A;  1N4C A;  4PZ8 A;  1XNR O;  1K92 A;  3I56 V;  5C8Y B;  1OHH G;  4YJ2 F;  1HR0 B;  4DV2 H;  1J5E O;  1JMK C;  3KXY T;  4A3C G;  2WDT A;  3JAR A;  4DR6 B;  4O7R A;  3G6B A;  4YR3 A;  3H20 A;  1YEW A;  1X9N A;  4H33 A;  5H2F Z;  3SYC A;  2YWV A;  1P49 A;  3B4S A;  3UM7 A;  3ZRV A;  1AI5 A;  1CXZ B;  2LO1 A;  1Y1V A;  3RAQ A;  1US6 A;  1IBK H;  3VOU A;  2R7N A;  3FDS A;  1YXB A;  1A48 A;  1K73 W;  4GX0 A;  3VBB A;  5KFD A;  3PO2 G;  2PI5 A;  2HJD A;  2VRZ A;  2JA5 A;  4RUC A;  4KFM A;  1NH2 B;  3ORR A;  1SEI A;  3ABK B;  3DTG A;  3M9N B;  1VF6 A;  5I5U A;  3IJ4 A;  5FPO A;  2FK1 A;  5CA1 F;  2WTF A;  1WN7 A;  2CUG A;  3UT5 A;  1G8M A;  2BSK A;  2NU9 B;  1KKC A;  2AXT Z;  4IGG A;  4FFK A;  3AYH B;  2P06 A;  1MZE A;  4LF4 B;  1K5Q A;  4IYH A;  3WB1 A;  5DLF A;  1Q3E A;  1UFI A;  2RF4 A;  2N04 A;  3QG5 A;  3RYF A;  4UV8 A;  4EB6 B;  4LMY A;  4PJ0 Z;  2ALZ A;  2UXB O;  4A3F G;  1PNK A;  3ZRX A;  1KJJ A;  3FB7 C;  2M6Y A;  3CEB A;  1WSC A;  3Q4H B;  4PDV A;  2JEJ A;  1S77 D;  5HFL A;  4J9P A;  2Z3Y A;  2JRI A;  3ABL C;  1DV1 A;  2LQT A;  2R93 A;  1Y1V G;  1I7L A;  1CKN B;  3WG7 C;  1JDE A;  3TY5 A;  2HHF B;  4F4W A;  4DL7 A;  3JAL A;  4YJ2 A;  1XL4 A;  1KBH A;  4MA5 A;  3QO8 A;  1VQ8 V;  3P30 A;  4U3F H;  2ILM A;  4QSH A;  3RYI B;  4YR0 A;  2Z5U A;  1BGY H;  4FFB B;  1WR2 A;  3HKB A;  5KT5 A;  4X20 A;  4XDL A;  1THZ A;  2E74 B;  3RJ0 A;  4N23 A;  3J80 N;  5FD6 A;  4X1I B;  4DR3 B;  4KUM A;  5LMU H;  2G38 A;  3AG2 C;  1I7N A;  3L4J A;  1GSH A;  3U10 A;  4RAY A;  1OCC B;  5DG9 A;  4I50 B;  2Q0A A;  1N33 B;  3OMI B;  5CA1 A;  3PR4 A;  1GO3 F;  2ASJ A;  1Y4M A;  1Z2N X;  4TQF A;  2ZE6 A;  2Q2T A;  3N27 A;  2R9A A;  2O03 A;  2E75 B;  1H2N A;  1SQX H;  4PA4 A;  5JCO A;  2RN9 A;  5JQG A;  3O65 A;  3K5I A;  3R5H A;  4I50 F;  4UFZ A;  5BY1 A;  4LF9 O;  5BWU A;  2FKX A;  4I0X A;  3DC5 A;  2Q5Z A;  4DR2 O;  1I94 H;  4J9Z B;  3G71 V;  1FXK C;  2CDY A;  2Q7E A;  3HKE A;  4DR7 O;  1CP9 A;  1B33 N;  1K83 A;  3TEK A;  4JI3 O;  4H37 A;  4B3T O;  4BR6 A;  1QCE A;  2PBZ A;  2VR1 A;  1E4E B;  2QA4 V;  4ABM A;  2RNB A;  2XND G;  4Q6G A;  2UUC B;  3WB0 A;  3CSX A;  4O3Q A;  1O9H A;  2ZQM A;  2IP4 A;  4JUZ A;  1EZV H;  5I60 A;  4PZ6 A;  4NYK A;  1WH2 A;  5EC2 C;  3CP1 A;  3RYH A;  2HVR A;  1XDC A;  3TQ1 A;  4NZO A;  3M8A A;  1VQ6 V;  2XUM A;  3FKS G;  4LF4 O;  4QIW E;  5A2Q N;  1P16 A;  3DTF A;  3RYF B;  3OUU A;  3BAA A;  1SC5 B;  1EYZ A;  3KTM A;  4YXW G;  1SS3 A;  1NTK H;  3RV4 A;  1FXV A;  1MMM A;  2AZ2 A;  4UVA A;  3ETG A;  5J2T A;  1D5N A;  2R85 A;  3RYC A;  1K8A W;  5CB4 B;  3VQY A;  1WNS A;  3GB8 B;  3B8N A;  4JI1 H;  3OR6 C;  2UUA H;  4JI7 O;  3BVO A;  2IM9 A;  4J41 A;  5L3E A;  1IYD A;  3HKD B;  5KX5 B;  1VQ9 V;  1MA1 A;  4FBU A;  4FMT A;  4PA3 A;  4B3M H;  4K6N A;  3HOW G;  3LSQ A;  2J6S A;  2EX3 A;  4J9Y B;  2HKO A;  4J0M A;  3OGC C;  3Q8Q B;  4JV2 A;  2K9P A;  3CRM A;  5DED A;  2R82 A;  3UCS C;  4A3D G;  3RGX A;  4LF6 H;  2ATK C;  2CKZ B;  1R3I C;  5CBG A;  3TW6 A;  3O9O A;  4JI4 O;  4O81 A;  4WFE A;  4PBC A;  1ZWI C;  2VQE B;  1T5E A;  1ZUQ A;  3WG7 B;  3ZRW B;  3TXQ A;  1DF5 A;  3K5M A;  4R6Z A;  1QQC A;  3NBZ B;  4I55 B;  1E4F T;  3ABT A;  4CH5 A;  1NT2 B;  4QIW A;  2AGA A;  4MV1 A;  3EVK A;  2C28 A;  1ENV A;  3HR0 A;  1QBZ A;  1R6K A;  4OXS A;  4RAZ A;  4P2Z A;  2LGQ A;  1JJ2 U;  3G8C A;  3KCX A;  5IYC O;  4FS1 A;  3IGA C;  4I7H A;  5B1A C;  1KU9 A;  3SI8 A;  2WYO A;  4NXN O;  1BQ0 A;  4DR7 B;  4O2B F;  3F5T A;  3AG1 B;  4DV5 H;  2GHY A;  2DE0 X;  2FB5 A;  4HNT A;  4O3R A;  2QWP B;  4YY3 O;  1GAX A;  2HG5 C;  4JYC A;  1X59 A;  1XEQ A;  4HYO A;  4E2L A;  2GSM B;  5J9P C;  5B1B C;  4IIJ B;  4CKC A;  5EBL C;  3ETJ A;  3VNN A;  3F5W C;  2Q68 A;  2PUS A;  3H1H H;  5D1O A;  1YIT V;  4JV0 A;  2JGD B;  4JYA O;  4DV7 B;  3BEH A;  1Q86 W;  3QZ7 A;  1SRY A;  1Z2P X;  3FX7 A;  3TY9 A;  1WLE A;  5CA0 B;  3ZHR A;  1GTO A;  1MG1 A;  5I47 A;  3MFI A;  2ZE7 A;  2W8L A;  1JDB B;  1S9F A;  4Q44 A;  3H1L H;  4G3I A;  2C2D A;  4RQE A;  5FPR A;  1M93 A;  4JI2 B;  2W7O A;  2UXX A;  4MS2 A;  4DV1 O;  1Y6X A;  4TQD A;  5KG2 A;  4XX0 B;  2JJ1 G;  2Q4P A;  4LH6 A;  3R66 A;  3UKM A;  1XBL A;  3T1H O;  2XAG A;  3L75 H;  1VQK V;  4DV0 H;  2R7Z A;  1KTA A;  2A3Q A;  4J11 A;  1NKD A;  2GV9 A;  2EZP A;  4QIW F;  3C3T A;  3UO2 A;  4NLG A;  3ASN C;  2EJ3 A;  3K9A A;  1WP8 A;  1XNQ B;  5KFE A;  1IVS A;  3T4D A;  1S97 A;  3T5H A;  3PO3 G;  3HKB B;  3DXR A;  2YEV B;  4O2B A;  3RVZ A;  3U0Z A;  2Y69 B;  4JI0 O;  1OV9 A;  5H6Q A;  4YAJ B;  4YHH B;  3K5O A;  3JD3 A;  3RWR D;  2V4D A;  1B04 A;  3JAT B;  4WCE V;  3HBL A;  3N6R A;  4G27 B;  3OM3 B;  4FFM A;  2DYR B;  5H80 A;  3PW0 A;  3G4S V;  3CMA V;  1F4M A;  3P3P A;  2UUB O;  4JI6 O;  2C00 A;  2SCU B;  3GJX B;  5K1X A;  4Z1M G;  1CKN A;  2Y4U A;  1PL4 A;  4YIP A;  3T7A A;  1TGO A;  2UUC O;  5KUM A;  2BTO A;  3KZI Z;  1TVK A;  1JPX A;  1XMO B;  4DR4 O;  2P4V A;  1GK9 A;  1JKJ B;  2QF7 A;  4NXM O;  2WPD G;  2UXD O;  2VQE H;  2ITC C;  4DRX B;  3T9C A;  3B2E E;  3RIZ A;  4X88 A;  1SQF A;  1M57 C;  4ZOL F;  2WB1 A;  1EKV A;  1IBL B;  1U97 A;  4LWS A;  4FGR A;  5CA0 F;  2PVP A;  1IBM H;  4MVR A;  2E76 B;  2EIL B;  4X64 O;  3JAS A;  1TUB A;  4HNA B;  4GKK O;  4X89 A;  1GMG A;  4BWA A;  5KFC A;  3H4D A;  4D7T A;  1GN4 A;  1FXK A;  5LL6 Y;  3T5J A;  4ASU G;  2YRW A;  1W93 A;  3RN4 A;  4DUY H;  1N34 O;  1JOY A;  2W0X A;  1AIL A;  4PDM A;  3APO A;  1BT8 A;  3FAV B;  5C93 A;  4BBR G;  3Q8R B;  2B63 A;  3UZO A;  2ZDH A;  5H5N A;  5JQG B;  2YEV A;  4QW9 A;  3R65 A;  3CHX A;  2HDK A;  5HNE A;  3ZHT A;  4JYY A;  1FJG H;  5I5Y A;  4GUN A;  2R7L A;  4QWB A;  4DUZ O;  2EIN B;  4XZ3 B;  3J80 W;  2WA3 A;  5BMV B;  4MTF A;  5BWR A;  2JS5 A;  2NN4 A;  3RGB A;  1Q81 W;  3BRC A;  1ZHS A;  2CTQ A;  1ZLZ A;  1OZ0 A;  1XIL A;  1K34 A;  3AG2 B;  4IHJ F;  4JYA B;  1JFF B;  4JI1 O;  1YTF D;  2J6T A;  4BWS C;  1G4Y B;  2P22 C;  3GLK A;  4Y8V B;  3HKD A;  4ECQ A;  2HR3 A;  4NR1 A;  4NTW A;  1KJ9 A;  2QKA A;  4IL6 Z;  5DIS C;  1KJQ A;  1Z2O X;  1Y74 A;  3LML A;  3JRX A;  1WA8 B;  3T9F A;  4LP8 A;  4YJ3 A;  5LYJ F;  4QNH B;  1WB7 A;  4ECV A;  3CWB H;  2NVX A;  2YS7 A;  3K58 A;  2RDC A;  3CCM V;  2F4V B;  2W6I G;  5KFB A;  4RNO A;  5DMX A;  2QM4 A;  1IZ3 A;  4AI8 A;  4J80 A;  1OWT A;  4X1Y B;  1B06 A;  1NJI W; 
#chains in the Genus database with same CATH homology
 3W1B A;  4DR5 B;  2UXB H;  4DRX A;  1I7F A;  4LFC B;  4B3R B;  4DR4 B;  4O4I A;  4JI5 B;  2VPS A;  4IHJ A;  3RYC B;  4M7E A;  1FFX B;  4DUZ B;  3W5O A;  4ZI7 B;  4RB1 A;  3THO A;  4LFA B;  5ITZ B;  3ETQ A;  5KMG B;  2UXD B;  2PYJ A;  3F8N A;  1HR0 H;  3GDE A;  1XHZ A;  2W57 A;  2CAZ C;  4TV9 B;  4K0K B;  4DR6 H;  1S03 G;  4X1Y A;  4ZHQ B;  4DUY B;  2JGU A;  3SJC C;  2F95 B;  5GON B;  1XDN A;  4F6R B;  5LMN H;  2QJ1 A;  2XHB A;  3RYH B;  2ZIN A;  3SR2 C;  3NC0 B;  3MWM A;  1N33 H;  2UXD H;  4CS4 A;  5D1P A;  3N6X A;  4LF9 H;  5IWA H;  5BR8 H;  4LF8 B;  3N43 B;  4O2A B;  4TV8 A;  1QHT A;  1XHX A;  1HNW H;  3OTO H;  2OWO A;  5JVD A;  3KYH C;  2WE6 A;  3JAT A;  4E6N A;  4DR5 H;  1V9P A;  4LR3 A;  1HNW B;  1XI1 A;  4LF8 H;  3LNN A;  4LF9 B;  3TY8 A;  4R7R A;  4FLX A;  4EFB A;  2KKW A;  4ETS A;  4IIJ A;  4O4L B;  1XNR B;  1N34 B;  4PZ8 A;  3L4K A;  5C8Y B;  4X65 H;  4JV5 H;  2UUB B;  3ZS8 C;  4TOI A;  4CS2 A;  1HR0 B;  4DV2 H;  1SYX B;  1JMK C;  2HVS A;  3KXY T;  4LFA H;  1X4T A;  1BGW A;  3JAK A;  2WDT A;  4MTD A;  2ZIM A;  3JAR A;  4DR6 B;  4CH4 A;  4CH3 A;  1E4G T;  3H20 A;  4DK1 A;  1YEW A;  1IBK B;  1X9N A;  3JAW B;  5LP6 A;  2UXB B;  1P49 A;  4DUZ H;  4ZI7 A;  4LF5 B;  3VQX A;  3KAJ A;  1IBK H;  2YI8 A;  1WPB A;  5JJN B;  3N2G A;  3HKC A;  2R72 A;  5EIB C;  1SEI A;  3MAQ A;  3RTX A;  5FPO A;  5JH7 A;  4DV1 H;  4AQY H;  3JAW A;  4YJ2 B;  1WN7 A;  4GKJ B;  1XK5 A;  1N34 H;  3UT5 A;  3T1Y H;  4DV0 B;  2YXL A;  1L2Z A;  1Q43 A;  2YIA A;  4LF4 B;  3WB1 A;  1Q3E A;  4B08 A;  3QG5 A;  5BMV A;  5IYZ A;  4JI2 H;  2PZS A;  4FM2 A;  3JAR B;  4JYA H;  3RYF A;  4JI4 B;  4LNU A;  4EB6 B;  3OTO B;  5EOY A;  4LMY A;  2HGS A;  3N40 P;  2ZCE A;  1N36 H;  5J2U A;  4CC6 A;  4I4T B;  1XQ8 A;  4I55 A;  4B3S H;  1CKN B;  5KHK A;  4PDB A;  4RB3 C;  4DV2 B;  3TY5 A;  4WBN B;  3JAL A;  4YJ2 A;  1XMQ H;  2UUB H;  4UCU A;  4O4H A;  4X65 B;  4K8Z A;  2CW8 A;  4PZ7 A;  4RZQ A;  4DR1 B;  3RYI B;  4JI6 B;  5LA6 A;  5J2T B;  4I50 A;  4I4T A;  1J5E H;  4JI7 B;  3IAY A;  5CA1 B;  4FFB B;  3N2G B;  3HKB A;  4X20 A;  1IBL H;  3RJ0 A;  5FD6 A;  1O9G A;  4X1I B;  4FLW A;  2F4V H;  4DR3 B;  1N32 B;  1FJG B;  5LMU H;  4NXM B;  2E3C A;  4PI2 A;  4CC5 A;  3L4J A;  3JSL A;  3U10 A;  4FLT A;  4RAY A;  4KL1 A;  4I50 B;  2Q0A A;  3BA8 A;  1N33 B;  4HBN A;  5CA1 A;  5LMN B;  3BHP A;  4ZHQ A;  1Z2N X;  4TQF A;  4X20 B;  3RFR A;  4JI8 B;  3VQW A;  2Q2T A;  1HNX H;  3C0F B;  3HXL A;  3T1H H;  2R9A A;  1SKV A;  2O03 A;  5JCO A;  5JQG A;  2XIG A;  4K0K H;  4RB0 A;  4UFZ A;  4FLZ A;  4DR2 H;  4FFB A;  1I94 H;  2KSW A;  4LH7 A;  2ZJT A;  4DV4 H;  3RR5 A;  2Q7E A;  4PHZ A;  3K5L A;  3HKE A;  4PI0 A;  4EFE A;  3N44 B;  4YHH H;  4LF6 B;  4UCR A;  3FMA A;  1FKA H;  4LFC H;  4B3R H;  4O4J A;  1P8L A;  5EIB D;  2RGR A;  4DV5 B;  5FNV A;  2CFM A;  4X62 H;  4Q6G A;  1ZAU A;  3VQV A;  3CSX A;  3WB0 A;  1O9H A;  2UUC B;  5GON A;  1WH2 A;  4PZ6 A;  2HIX A;  4DV6 B;  1SA0 B;  3RYH A;  2E5L H;  2HVR A;  2ZM6 H;  3N2K B;  1VS0 A;  1XMO H;  1Z5W A;  4FLV A;  1BJT A;  4KHP B;  3JAS B;  5ITZ A;  5KMG A;  3A2F A;  1P16 A;  3RYF B;  3BAA A;  4YY3 B;  1IBM B;  4OX9 B;  3CB2 A;  2RQ6 A;  1SA0 A;  4UCO A;  4O4J B;  2OYQ A;  4BW9 A;  5J2T A;  1H2S B;  4JI0 B;  3E22 A;  4DV3 B;  3HKC B;  4IHJ B;  3RYC A;  1AN7 A;  4X66 B;  4OX9 H;  5CB4 B;  3VQY A;  4A2A A;  1WNS A;  3RGZ A;  4NXN H;  5IT9 W;  3GB8 B;  4JI1 H;  2Q2U A;  4A2B A;  2UUA H;  3JAL B;  3UT5 B;  2HHH H;  1XNQ H;  2IM9 A;  4O4H B;  3JSN A;  1O75 A;  4MV7 A;  3HKD B;  5KX5 B;  4B3M H;  3KAL A;  1CKO A;  5EZY A;  2EX3 A;  4LFB B;  4X1K A;  3N42 B;  4J0M A;  3J7A K;  4U3J A;  2UXC H;  5C8Y A;  3RGX A;  4X64 H;  4LF6 H;  1M0W A;  3J81 W;  3K59 A;  1JFF A;  4B3T H;  1RSO A;  4JI3 H;  3L2P A;  3OTF A;  1TA8 A;  4FVM A;  3WB2 A;  3JAK B;  4X64 B;  2YI9 A;  1A0I A;  4DV3 H;  5LOV A;  1Q8I A;  2VQE B;  4GKK H;  1T5E A;  4X1K B;  5FNV B;  5A2Q W;  1HNZ B;  3K5N A;  1Z5V A;  4WBN A;  1HNX B;  3K5M A;  4K8X A;  2YIB D;  3QTC A;  1JJO A;  1QQC A;  3NBZ B;  5JH7 B;  4DV7 H;  4I55 B;  1E4F T;  4LSX A;  2VUG A;  2VQF B;  2RJZ A;  1NT2 B;  4YJ3 B;  4CH5 A;  2P5O A;  4Q0Y A;  2BTQ B;  1HNZ H;  1L8D A;  1G6U A;  4GKK B;  4RAZ A;  2F1M A;  4ZIB A;  2HEP A;  5LMU B;  2YIB A;  4MTE A;  4I7H A;  1KU9 A;  2WYO A;  4DR7 B;  2UUC H;  4JI3 B;  4B3T B;  4JI0 H;  4DV5 H;  5LOV B;  3ZED A;  4FM1 A;  2FE3 A;  1FFX A;  1CKM A;  5LL6 b;  2UU9 H;  3RYI A;  2F93 B;  5EYP A;  3QF7 A;  4IIJ B;  1I94 B;  5FLX W;  5LP6 C;  2BTQ A;  3VNN A;  3UQ8 A;  2PUS A;  5KHJ A;  3DF7 A;  5FD5 A;  5LA6 B;  5D1O A;  2HVQ A;  4B3M B;  2CW7 A;  2UU9 B;  4O4L A;  4DV7 B;  4FM0 A;  4O4I B;  3N41 B;  4X62 B;  1Z2P X;  5LXT B;  3TY9 A;  5CA0 B;  5JJE B;  4EQ5 A;  4TV8 B;  2MCT A;  4O2B B;  1MZB A;  4UCV A;  5K1P A;  4AHC A;  4DR7 H;  4JI4 H;  5FPR A;  1M93 A;  4NXN B;  3S24 A;  2Q7G A;  4JI2 B;  3U11 A;  2Q7H A;  4TQD A;  3FFQ A;  4F6R A;  5LP6 B;  4LH6 A;  1J5E B;  4TUY B;  4GLX A;  4CS3 A;  2VQF H;  4DV0 H;  2ZNJ A;  4DRF A;  3T1Y B;  1TVK B;  3QWU A;  2PTM A;  3N2K A;  4NVP A;  4X1I A;  3BAB A;  2R70 A;  4FM9 A;  3NBY B;  4TV9 A;  2GV9 A;  5LYJ B;  4FLY A;  1GYF A;  3SGI A;  1FVI A;  4NXM H;  5D5Q A;  2ZM6 B;  2HHH B;  1XNQ B;  4DV6 H;  2UUA B;  4JI1 B;  4LF5 H;  2PYL A;  3HKB B;  5KHH A;  4DV4 B;  4O2B A;  3U0Z A;  1DGS A;  4APM A;  3E22 B;  4JI6 H;  1D5A A;  3BPZ A;  3K5O A;  5JVD B;  3RWR D;  4YHH B;  3ICX A;  1HW7 A;  4DR2 B;  2V4D A;  1B04 A;  1M4U A;  3JAT B;  5CA0 A;  3SJB C;  1KMI Z;  2RGV A;  4GYC B;  2F66 C;  2PGG A;  3GJX B;  5K1X A;  4LF4 H;  3M7M X;  1CKN A;  4IAJ A;  3T1H B;  4B3S B;  1TGO A;  4U3J B;  1XNR H;  4MV9 A;  4KHP H;  2BTO A;  1TVK A;  1XMO B;  5D5P A;  4ZOL B;  4TUY A;  4X66 H;  1S5J A;  1M0T A;  2VQE H;  4DRX B;  3RF2 A;  3B2E E;  3RIZ A;  1SQF A;  4EEQ A;  3EYY A;  1IBL B;  1IBM H;  5IWA B;  5BR8 B;  4UCT A;  5CB4 A;  5JCO C;  3JAS A;  1TUB A;  4HNA B;  5IJ9 B;  1XMQ B;  3W1G A;  4BWA A;  2UXC B;  4D7T A;  4DR1 H;  4UCS A;  4LFB H;  4O2A A;  3CVZ A;  5LXT A;  2JVD A;  2VWK A;  3JAM W;  4DUY H;  5KX5 A;  2HIV A;  2YCH A;  2E5L B;  4AQY B;  5JJJ B;  1ZHQ A;  4L8J A;  1M5I A;  2PY5 A;  4JV5 B;  1S68 A;  4RB2 C;  5JQG B;  1VF7 A;  4AIL C;  5LYJ A;  1N36 B;  3CHX A;  1TAE A;  3DSQ A;  4JI5 H;  1SQG A;  2VWJ A;  4DR4 H;  4ZOL A;  1FJG H;  4DR3 H;  3J80 W;  4I9Q A;  5BMV B;  2ZIO A;  5J2U B;  5IYZ B;  5KHI A;  3IG0 A;  4LSA A;  2JS5 A;  5EYP B;  3RGB A;  2VOB A;  3M4I A;  3BRC A;  1ZHS A;  4LNU B;  4EB6 A;  4FLU A;  4JI7 H;  4LF7 B;  5EZY B;  4JYA B;  1JFF B;  4JI8 H;  3BA9 A;  2P22 C;  4BWS C;  2ZNI A;  5IJ0 A;  4YY3 H;  3HKD A;  4D7S A;  4GKJ H;  3PN1 A;  5DIS C;  1Z2O X;  1I6U A;  3LML A;  3K3V A;  4YJ3 A;  3HKE B;  1TUB B;  4HNA A;  5IJ9 A;  5KHG A;  5D1O B;  4LF7 H;  1N32 H;  4DK0 A;  3K58 A;  2F4V B;  4DV1 B;  3KAK A;  4CH6 A;  1Q5O A;  3SJA C;  2QM4 A;  3K57 A;  4X1Y B;  5IJ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...