4UCTA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
318
structure length
318
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 102
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4uctA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4uctA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4uctA02
3VNNA 2UXDB 4YHHB 4EFBA 3GB8B 4EFEA 5IWAB 4DV1B 1N33B 4LH7A 4X64B 1X9NA 3TY8A 4AQYB 4LH6A 1V9PA 2E5LB 1VS0A 4LF5B 3KYHC 4JI6B 3RR5A 2UUBB 1HNWB 4JI5B 4LF8B 1XMQB 4X66B 4EQ5A 4DR5B 3RTXA 3NBZB 4PZ7A 4DV5B 1N36B 3TY9A 4JI8B 4UCVA 1HR0B 4DR4B 2HIXA 4GKKB 2HVRA 3W1BA 4NXNB 4LF9B 2F4VB 4X65B 4DRFA 4DR3B 1XK5A 5LMUB 4B3RB 4DR6B 4LF6B 3NBYB 4LFCB 1P8LA 1P16A 5D1PA 3BA9A 1N34B 3T1HB 1CKMA 1IBLB 1IBKB 4YY3B 1HNXB 4DR2B 1B04A 2UXBB 1ZAUA 1XMOB 4CC6A 4LF7B 4DV3B 4OX9B 2Q2TA 2Q2UA 1HNZB 4DV4B 4CC5A 1FJGB 1CKOA 1XNRB 3W1GA 3GDEA 2UU9B 3UQ8A 4TOIA 1TA8A 2VUGA 4PZ8A 5DISC 1XDNA 2ZM6B 3JSLA 1N32B 4JI2B 2UXCB 3S24A 4E6NA 2HHHB 4UCRA 2VQFB 4PZ6A 5D1OB 4LF4B 2HVQA 4EEQA 3OTOB 3BAAA 4DR7B 4DV0B 3BABA 1S68A 4B3MB 3JSNA 1J5EB 4NXMB 4DV7B 4JV5B 1FVIA 4LFBB 5FPRA 4JI0B 4GKJB 4DUZB 3L2PA 2HIVA 2UUAB 3GJXB 4GLXA 1I94B 3T1YB 4UCOA 4X62B 4JI7B 4UCUA 1TAEA 1CKNA 4KHPB 1IBMB 2CFMA 1CKNB 5BR8B 4UFZA 5D1OA 5LMNB 1DGSA 5FPOA 3NC0B 3SGIA 2UUCB 4B3TB 4UCSA 3TY5A 4K0KB 2OWOA 4JI1B 4DV2B 4B3SB 3W5OA 4JI3B 4JI4B 4UCTA 3PN1A 4JYAB 4DR1B 1XNQB 2VQEB 4DV6B 3QWUA 4LFAB 1A0IA 4DUYB 2HVSA 3BA8A
chains in the Genus database with same CATH superfamily
1I94H 1CEZA 5E1AC 3TGUH 4DQNA 2HJDA 4LH7A 4OXSA 4PI0A 3H4DA 2YXYA 4BW9A 2QSAA 3HOVG 5F9NA 1TVKB 2WAQE 3PW4A 4UV9A 1Z2OX 4LF8H 2VWJA 4ED6A 4X66B 1Y4MA 3K9SA 2NVYA 3JAKA 4PZ7A 2COIA 1N36B 1DLBA 4W4KA 1KP3A 1WCMA 4FM9A 4A3DG 3KG2A 1M6VA 3C90A 4I5SA 3TQTA 1LUVA 2VOBA 1SQFA 4RAYA 4PDVA 3FKIA 3K5NA 4QWAA 3OHAA 3BA9A 5K3WA 4A3GG 1Y1WA 3PJSK 4CBCA 4J9KA 2J6TA 2XCLA 4FPPA 3L4KA 2UUBH 3J81N 1KBHA 5C5JA 5KG2A 4FBUA 1NTZH 3RVZA 4ZHQB 5LP6C 4LF7B 4QSHA 3TEKA 5EBLC 5KFBA 5BWUA 4TV9B 3JALA 1ORQC 1HNZB 4CC5A 3M9NB 4DV5H 1OZ0A 4ECYA 1WNSA 1GH6A 1YJWV 3PO3G 2W0XA 4TM5A 4FLTA 1ZLZA 5BPFA 1XBLA 1R6TA 4QWCA 1Q6IA 3RUPA 1WP7A 1OBGA 4UCRA 3WO1A 4YR2A 1VF6A 5DGIA 2HFEC 2VPQA 1AUXA 4DV7B 4JI8O 4YY3H 4JGSA 1SF9A 3CSWA 1D5AA 1V54C 2ZKOA 2C35B 1XMOH 4GC7A 2AGPA 3AK1A 5KFAA 3JATA 1Q81W 1FXKC 2DIKA 1OHHG 2W7PA 4LF6O 5LOVA 2HVKC 2CH7B 2W9BA 1M9NA 2ZM6H 1AI4A 4I0XB 2CW8A 5KG1A 1SRYA 2VPSA 1KJIA 5FPOA 4I4TA 2QWRB 2YYAA 4GT1A 3CVZA 3GIKA 3E8BA 3RBZA 3T5HA 3RT3C 4J9YB 5IYCG 2A0LA 4E4TA 3I12A 3K5LA 2UU9O 1EKFA 5BYAA 2XIGA 1JMKC 5JVDB 2N74A 2QWPB 3OW2U 4O86A 4GKJH 1I0HA 2UXCO 2UVWA 5K1PA 2F66C 1VQ4V 1A0GA 3RWRD 5EC1C 4ZI7F 4HNUA 1JOYA 5KFLA 3P3PA 5JCOA 1OCZB 4LFCO 1YTFB 2JEGA 5B5EZ 4PBCA 1DF4A 3ABMC 2HJFC 3ETGA 1LNQA 1I5YA 5L1IA 2IBZH 2FK3A 2UXXA 1I94O 3ETQA 1TUBA 5CAEB 1CQIB 5KUMA 4FLXA 3KHGA 2VA2A 2R93A 4QWEA 3N8DA 3ORRA 2KG7A 1BSMA 3HKCB 2W8KA 4LF4O 3T5KA 4F4LA 4MW8A 4J9SA 4J9LA 1VQPV 2EIJC 2NU9B 2EIKB 5HNEA 2Y0IA 3KHHA 2PN1A 3E8FA 4YQWA 2MW2B 1TVKA 5KG0A 2DE0X 5D1PA 1ZQ7A 4BY1G 1UPGA 3K57A 3DC6A 3ZRSA 3AG4B 3G80A 3H9VA 4KL1A 3CS5A 2ZT9B 1JA8A 2ZXWC 1E1QG 4R6ZA 1M0WA 3PW5A 2EZPA 1QVGU 2RDIA 1KUTA 4XBFA 2VA3A 2WLJA 2DYRC 5CE8A 3E22B 1N32B 3JSLA 5KHGA 3IGAC 1JJOA 3CJHB 3QVNA 3GIDA 4CHIA 3QTCA 2UUBO 3NGDA 1GTOA 2R8HA 5FL7G 4J7KA 4GX5A 4IGGA 5GONF 4E2LA 4O7TA 1NI8A 3ASOC 3OM3B 4FM0A 4BIOA 1NU1H 4DV5O 3GTGA 2Q67A 1FVIA 3ABLB 1OBDA 1IBLH 4X1KB 4I55A 4TV9A 1WA8B 4DV3H 4GX2A 2DWCA 1S9FA 1KC7A 1IURA 3G6YA 1SCUB 1FJGH 4MA0A 4OPHA 2JK5C 5H2FZ 3J80W 5J2UF 3T7AA 1PNKA 3HKEB 3BY6A 3CX5F 5FLXW 5AG2A 4PA9A 4FLYA 2AGQA 1EZVH 2LFRA 5L3GA 4YY3O 4HBNA 5KFOA 2UUCB 4CH6A 3GWOA 2JA5G 1XMOO 3DC5A 4O4IA 3U0ZA 4B3SH 4CKCA 4QE9A 3ZX6A 5CM0A 1RPOA 3R9RA 4C5AA 1FPOA 4C5BA 5D8DA 4MS2A 1M1KW 2ZM6O 4XDKA 2DPIA 2A06H 1Z2NX 4N23A 4YR3A 4TUYB 4ZOLF 3T1YH 2Y0SE 5J2TB 1JLLB 5BWTA 2FKXA 5KFWA 2CH7A 2JEXA 3JARB 2QF7A 3KALA 4LSAA 1J5EO 1W59A 1VIBA 4LFBO 2JGDB 1RYRA 3LP8A 4GKJO 3ZHSA 3RYFA 2A9HA 3SJBC 4K8XA 4E4EA 3HB3B 2XASA 1MMMA 5IYZF 5JVDA 4EQ5A 4DR5B 3HOUG 4X66H 3A8TA 4FFPA 2V1DA 2ABJA 4KHPO 4NTXA 2M7WA 1N36H 1FKAH 4PHZA 2HHHO 4RUFA 2UXDH 2Q7EA 5EWGA 4JV1A 2XCPA 1K4CC 4Q44A 1R3IC 4PV1B 3TXSA 4DV1H 4RU9A 4PA4A 4X64H 4X9QA 4JTAB 3W7TA 1N8RW 2F4VB 3GWKC 3K5HA 4DR3B 4RCNA 5KT2A 3I5DA 4FFMA 2F23A 1YZBA 5LL6Y 3MHSC 1IBKB 3PO2G 2YICA 2ZJTA 3OUZA 4OGQB 2DWEC 3OE7G 1OCOB 1ZHSA 1K5SA 2YI8A 2GBOA 3B09A 1HNZH 4KUMA 3HKCA 4U3FH 3T9FA 1JFFB 4GKKH 2W6QA 1T36A 2P5OA 3P32A 4QE7A 3V6JA 2HGSA 1ZL8B 3RBEA 3E89A 1KJ8A 1K3EA 5KFZA 3HT5A 5CA1F 4DV7H 4Y8VB 3B77A 5B1NA 1RJRA 2CAZC 5EIBC 4HNAB 2DZDA 4MTFA 1BGYH 3MDSA 2AGAA 3F7YC 5F2VO 1I7NA 4QW8A 4RUAA 2CW7A 5JUMA 4TQDA 4JI7B 1L0LH 2GLTA 1GO3E 3SNOA 3VMMA 4ECUA 2ADPA 5LP6B 3JZFA 4ED7A 3V4ZA 4FMTA 3CMAV 2YRWA 4HQ6A 1S0NA 3JD0A 4UUJC 2CE4A 2HDKA 2P67A 4P9OA 4X1KA 5KFEA 4ED1A 1WA8A 2F93B 3FYIB 3QO7A 2ATLA 5C44G 2W71A 4F50A 2OCCC 3IN5A 4KFMA 1VBHA 4R7RA 4X1IB 5ITZB 1UC9A 3HKEA 1QR8A 2BSKB 2O57A 5D5QA 4O3NA 1ZETA 1V54B 3OSNA 5JH7F 4JV5O 1KEEA 3U0GA 2V9WA 3RR5A 3ZRWB 2FLLA 4JYYA 3KREA 2Y0SA 4A3BG 3ETJA 4WFAV 3LULA 1SZTA 3OUSA 4ECXA 4MTOA 2ZDGA 1BMFG 3T1YO 1AI7A 4WFFA 4JI3H 2QM7A 1WJZA 4CMFA 5KT4A 3H1LH 2UVRA 4K8ZA 1IBMO 1DTOA 3GQCA 4B7KA 2Z3YA 1M90W 1RPRA 1QVFU 4TUYA 4FGRA 1GM9A 2XNDG 2HIXA 2P06A 4DUYH 5J2TA 3BEHA 3OTOO 5LYJB 2BCCH 3LDCA 2Q0AA 2W6JG 3JARA 4LF9B 3TW6A 4BBRG 5FD5A 1H2LA 3BFRA 3VQVA 4QNHB 2Z5UA 4LFCB 1VQ6V 4JF3A 4DR1O 5FD6A 2V4QA 3SJQC 2DABA 1CKMA 3R5HA 1FKAO 1KD1W 3QO8A 4GC6A 2UXDO 3FB6C 1GAXA 2ZDIC 2B5UA 1M0TA 1GN3A 4DV1O 4X64O 4DLKA 4LP8A 2W9AA 1XNRB 4WBNB 1XHXA 1ZX3A 3CCUV 5KKNB 4YR0A 2BOCC 5JQGB 5IY5C 1YI2V 1N32H 2HP8A 1GSAA 5D1OB 1EBOA 4O2AB 4LF4B 2EULA 4G28B 3RFCA 5DLGA 2ITDC 4K3AA 4O4JA 4X65H 1QU7A 3K08A 4R7CA 3RN4A 1UC8A 5KLVH 3STZC 4QIWF 5C93A 2YZNA 4JASA 5HBRB 2ZE5A 4RNOA 4NYKA 3LQSA 2EIJB 3U54A 4LC1A 4MVRA 4DUZB 4GKKO 4QWBA 3QZ8A 4J10A 3THOA 2DQ3A 1K1SA 4DRXA 2J9GA 3UM7A 1TAEA 2FLNA 1E1RG 5K2MA 1KQSU 1JFFA 3J80N 1CKNB 1G2WA 4YXWG 4O2BB 4UFZA 2QM4A 4JI2H 5FLXN 4F4ZA 3T5LA 1YEWA 4CS2A 3T9BA 1Y1VA 3CCEV 5LGNA 4K0KB 5EWFA 1XEQA 4W4LA 4RWUA 2FL4A 2QTSA 4AYBE 4JI4B 4B3MH 2RGRA 2R9RB 3BCCH 3Q4HB 1JPXA 5KMGB 1BQZA 3MHHC 4HNAA 4IYIA 2HR3A 1OCCB 3GTQA 2AHZA 2X0LA 4YIPA 2R7KA 3MWMA 2B9ZA 3L71H 4R8CA 1N4CA 5LOVF 3RJ0A 3OT7A 4A3IG 3B8MA 4EG0A 3RW0A 2J6UA 3CCVV 5LP6A 4LH6A 3G8CA 3IFXA 3ASNC 4A2AA 1SETA 4O4LA 5FR9A 3CPWU 2GTAA 2YDEA 2WWWA 3JAMW 3J7AK 3L70H 1EKPA 3U9TA 2Q7HA 3OSPA 2AU0A 3OGIB 3NBZB 4DR5H 4KXRA 3JAKB 3Q8SB 3TY9A 3T54A 4ED8A 2ZR2A 4WF9V 5KFMA 4FLWA 5C8YA 1MOFA 2DYSC 3Q8RB 2BSKA 1K9MW 1RM1B 4JI3O 4O7RA 4A3KG 2F4VH 2Q68A 3GTMA 5LMUB 4B3RB 4DR6B 1NH2D 3WB2A 3ZRWA 2FP4B 4DW1A 3CC2V 1FXKA 4O3SA 1BJTA 1ENVA 4U7CA 4DUYO 3TJTA 2E2IA 1IBKH 1XUQA 5BXZA 1ZTEA 4LNUB 3VPCA 1W93A 5I5TA 2PZSA 5L1KA 2IU0A 1WH2A 4FM1A 3FAVA 3ZN1A 3BQ0A 3JALB 3BJYA 4FLZA 2IH3C 2VUGA 1E4EA 1YITV 4J9OA 4K35A 1HR0H 3HXLA 4FVMA 1AROP 1R9TA 2HHHB 1VAJA 3HKDB 2VQFB 2ZQMA 1RK6A 3M9OB 5D5PA 1MZEA 1G8MA 1A48A 3J7AU 1VBGA 2JDIG 4ED0A 2PF4E 4X89A 2VQEO 2RQ6A 3K58A 5IP7G 3OMIB 1TWFA 4DK1A 2CTQA 2ZGIA 4DW0A 5IWAO 2CK3G 4WBNA 5LA6B 5EZYA 5CB4B 4X65O 3GIIA 4UCUA 2KSDA 1PPJH 1SQQH 5BMVB 3VPDA 4TVIA 2AQ4A 2W9BB 3VA7A 5D1OA 5KT6A 1K83A 4O2AA 2YW2A 3FB7C 4I4TB 1I3QA 1VP7A 1HNXO 4CKBA 4J9PA 2YS6A 1SQPH 4A3FG 3MFIA 1BQ0A 2COGA 3RAXA 1YF2A 2WAMA 5BYBA 4ZHQF 3AG2B 2R92A 5IDJA 5B1AB 2RGVA 3QQMA 3A0RA 3K79A 4TV9F 1XNQB 2PBZA 4O3QA 3RV3A 4JI2O 4A3LG 3BA8A 3O65A 4IAJA 4AYBA 1AUVA 2YXLA 1EN5A 3AW8A 4KP4A 4ME6A 2RJZA 3JCUZ 1HP8A 4B3MO 4DXWA 4MW3A 1KUQA 2MK3A 1R6NA 3WB1A 3KYHC 3HPLC 2EIMC 2NU7B 2RNBA 1YJNV 3IC9A 4O4IF 4CS3A 4U7NA 5JJEB 5KFVA 1A9XA 2LO1A 1AVMA 2ILMA 4JI1H 3Q4HA 2FMLA 4M0JA 1I7FA 3OAAG 3K3WA 1H2GA 4UVAA 5GTIZ 1M7JA 1K7DA 5BR8O 2W8LA 3ZHTA 3RIZA 5LMNO 2HVRA 3EPGA 1CXZB 2KG7B 2G38A 3DAAA 4O84A 2Q9LA 2X6BA 5HV6A 4A3EG 1NQTA 3N42B 4LF9H 4DL4A 4AQYH 1B6QA 4DRFA 3NBYB 3SPHA 1KB9F 2OCCB 2W6MA 2VQDA 2E75B 4G2KA 4A2BA 5DG8A 1SC5B 5JVDF 5KFNA 1DAAA 2ZIMA 2Q4PA 3UZOA 1R3KC 3CSXA 4MTXA 2SCUB 2D2CB 1N33O 4JTCB 3PW0A 4DV4B 2BQRA 2FE3A 4X1YA 2BR0A 1XNRH 3R5XA 3KHLA 2YRXA 3GIQA 4EBEA 3H0GA 4ECQA 1N0JA 4DR4H 3OEHG 3RYCB 1AR5A 2JS3A 4JI5O 1KJJA 3T9CA 3LMLA 3OTOB 3BAAA 2W6ZA 4DR7B 3RGBA 3CQZA 5L9XA 3WNZA 2JA6A 3CCJV 5GW7A 3MWEA 2ZNIA 3EYYA 3AG1C 5IYCO 1N34H 3T1HH 5TISZ 1IZ3A 2W6IG 4LNUA 2X6AA 2YIAA 5I5XA 3L2PA 4X88A 3HOZG 2K9PA 4DUZH 4XDLA 4I55B 4JUZA 1VQKV 1IYEA 2J6SA 4J42A 3UZBA 3L9DA 4YBZB 4Z2WA 1SESA 3HKDA 3CXCU 1DGSA 3ORQA 1S3JA 5KFKA 2R87A 2EJ3A 1ZUQA 4GCZA 4H44B 3OUFA 1WPBA 1MG1A 1NH2B 1MSDA 5I5SA 1P49A 1EN6A 3K9AA 4O4IB 1I2KA 1PNMA 2EJ7A 2EJ2A 1AR1B 4JYAB 4MV6A 3TINA 4IWYA 4IIJA 4RB3C 1WP8A 5LA6A 5CB4A 3KXYT 1GMGA 5FLMG 1I1LA 5KS8A 1X9NA 5KHIA 5BMVA 4F6EA 3TY8A 5BWVA 2E5LB 3BG5A 4FU0A 4NXMO 4UUGA 4JI6B 3M4IA 1SQVH 4JI0O 5HFMA 4H0LB 3KZIZ 2CDYA 4HN2A 2R82A 1HNWB 3WG7C 2H94A 5DM6V 1P7BA 4JAAA 3RYFB 3JAMN 4O81A 2WA3A 2ZE7A 2GQSA 3RAQA 5I47A 1KTAA 1L2ZA 3AEIA 1GN6A 3ZN0A 4LFAH 5A2QW 2ASLA 2RMKB 5K1XA 2GUZB 3T2MA 2LGQA 3H1KH 4NXNB 5JJNB 1S0OA 4JI1O 3T5JA 1I5XA 2Q7DA 3LDDA 4LF5H 4B3RH 5EC2C 1V55C 5KFDA 4U6PA 2BTOA 4RQEA 1B6RA 4J41A 1H8EG 1QCEA 3ZMUA 1IOVA 2OT5A 3OR7C 2YUAA 1XMQH 1LR1A 4TUYF 4AQYO 2QR4A 4YJ2B 5J2TF 5DISC 2WAQA 2JRIA 1AI5A 5KUKA 5FNVB 3SDLA 3S24A 1E79G 1UJWB 3ZCCA 4LF8O 2H8PC 4EEYA 3E35A 2KSWA 4DV0B 1SERA 1K1QA 1YJ9V 1SFOA 1NS1A 2X5RA 1I1KA 4DO2A 3GIMA 1SYXB 1YHQV 1EHIA 1TWCA 2RDCA 2UXBH 2UUAB 4Q8FA 4HZ3A 3L75H 5CA0A 1NBMG 4X62B 1R6KA 4MVQA 1SKVA 2XHBA 3T1CA 4L1KA 2B1IA 2EBOA 3RYCA 3L4JA 2CTRA 5CBHA 1N34O 1EZJA 3T1HO 3TXQA 4B3TB 2JA7G 3E2EA 1FYJA 3AG7A 3ZBHA 4XYMB 4H13B 2YZLA 5T14A 2UXNA 4AI8A 3HOWG 2CGOA 5B1BB 1F7YA 1QLEC 3CRAA 4J0MA 2OLSA 3H3VH 3HBLA 1Q6HA 1SQXH 2ZNJA 4O3OA 3RGXA 2WLLA 2VQEB 4DV6B 3QWUA 1XNQH 2FK2A 4YHHB 1PL0A 1DV1A 2JJ1G 5IWAB 1MA1A 1BXRA 3ML0A 5KFCA 4O7WA 2BQ3A 2QM8A 2ZDIA 1AP6A 4I7HA 1KJ9A 3FB5C 2Y48A 5DGBA 3SYQA 3SYOA 4GUNA 2C2EA 4DV2H 5DQIA 3H4BA 3AG3C 2EINB 1EKVA 3HKBB 2A3QA 3B40A 1PX2A 3CB2A 4O83A 1BHBA 2PTMA 4DAAA 4PJ0Z 2W7OA 5LP6F 2ZD9A 5EK0A 4P30A 2GV9A 3ZMSA 4BR6A 1PV0A 4L8JA 3T4ZA 2IMWP 3RFRA 4Q45A 5F9LA 4IWXA 1P4RA 4I50B 5KFUA 3ZHQA 2ODMA 5BZBA 3X2QC 4LFAO 3ABKB 1I08A 2ZR3A 4TQSA 1EFRG 1RSOB 1VQMV 4DR2B 2R7ZG 1ZAUA 2HHFA 4OX9B 1WPXA 3BQ2A 4NKGB 4DV4H 4Q8EA 1KECA 1F4NA 1WB8A 2P0AA 4LF5O 1BGWA 4MTDA 3APOA 2GUZA 1N56A 2PMZE 3GTOA 4LCUC 3VQXA 2HVQA 1Q3EA 3S3XA 4O4HB 4O4JB 4XDJA 4WFGA 4NVPA 4FFKA 1KBLA 1OCRC 2EX3A 2FPGB 4LR3A 1M57C 3G67A 3T9EA 4YAJB 2Q7GA 3G6BA 2IJHA 1DK1A 1WR2A 4LF7H 3GJXB 4F6RB 3HB9A 1SQBH 4YJ2A 3HKZE 2CZGA 5LYJF 2R84A 4DRXB 2NU6B 5I5YA 1FFTB 2LP7A 1W0KG 4RNNA 5FNVA 2FJZA 1R3JC 2CFMA 1UFIA 3CC4V 4PDRA 5KHJA 4A3CG 3H40A 3VOUA 4Q6GA 3STLC 2RF4A 1Y66A 2UXBO 2Y69C 2XAQA 2WSSG 5I5VA 4I9QA 1F51A 1Y14B 2N04A 3ETDA 3BHPA 2FMAA 4BW5A 3TIIA 1WCMG 4IR1A 1G6UA 2P4VA 3D8CA 4JYAH 1GYFA 5H6RA 4WBNF 1GM7A 3MR2A 3M8AA 5L3CA 4ETSA 4BY7G 4EFBA 4J80A 5JQGF 3F5TA 1Q86W 5IT9W 2H3OA 5EBMC 4O2AF 3FKIG 3W7UA 4MT8A 1Y1WG 3MD0A 3R66A 4MVZA 1S76D 3RBDA 2R70A 1IBLO 4O4LB 1GSOA 4JI6H 1VEWA 2XCAA 4M7EA 1Q8IA 2YS7A 4DV3O 1S0MA 1HNWH 4ZBMA 4ECSA 1FJGO 3H1HH 3ZMVA 5LHGA 4GLWA 4B7EA 4P9PA 3MFHA 4FJCC 1NKDA 4JI8B 3CCSV 2EILC 5C8YB 4O2BF 4IR9A 5KX5B 2LFSA 3K0GA 4DV2O 4B3SO 4NXNH 1OJHA 2PUSA 2GPSA 5KG6A 1GKFA 4LF6B 2NNUA 2Z04A 1P8LA 4FBTA 5DECA 1IYDA 1Y74B 5A9GA 4O7LA 3MR5A 3GV8B 1FXKB 2BTQB 2ARHA 1B04A 3LSUA 4PWQA 5KFHA 3OFNG 3K03A 2Q2UA 1NTKH 1TWAA 4QW9A 4EBCA 2N05A 4UB8Z 2COJA 3HKBA 4TWKA 1E4FT 3FAVB 2UU9B 5DLFA 2ASJA 2R8JA 3T4DA 2XAFA 1E4EB 4X8AA 1Q5OA 4PI2A 1QBZA 4PDBA 4ZKIA 2UXCB 1C30A 4NB5A 4FK5C 3SJCC 2WLMA 1JX9A 3QZ7A 4I50A 3UT5A 3BABA 3MJFA 3UO2A 4R8UB 4X66O 3SJAC 2IA6A 3VQYA 2CKZB 1RSOA 1N36O 1DV2A 2PMZA 4IRCA 1CPYA 1Y76B 4CH4A 2VWKA 3QO5A 1EN4A 1VQOV 3RYIB 2JA8G 3BQ1A 1I94B 3K59A 5IYDG 1K34A 1B33N 3ABMB 4IYHA 3K5OA 3P3NA 5BWWA 1YCIA 2FYUH 2XAGA 5EZYB 3D3IA 1I7LA 1GN4A 2Q8VA 1BZKA 2OYQA 3FX7A 4QJFA 5EIBD 3APQA 3K3PA 2P90A 4RB0A 4O4HA 2EIYA 3HKZA 4B3TH 1J95A 4TT3G 4LF7O 5EBWC 5IJ0B 3VBBA 4FLVA 1HNZO 2V5AA 2R93G 5DGHA 3L73H 4UXNA 2Y4UA 4CH5A 4BXXG 4DV6H 4NZMA 1JR9A 4F6RA 4DYLA 2FTKA 4H37A 3GB8B 3EVKA 3IJ4A 1EYZA 4I7ZB 4HAMA 1JXLA 2XTAA 2CNUA 1H2NA 1XI1A 4DV7O 4J7ZA 2ZXWB 3JRWA 3G6XA 3CEBA 3J81W 2UUCH 2UUBB 4RAIA 3GV5B 2L35A 2DYRB 4PELA 5LXTB 4CMDA 4U3JB 1RFYA 5KAFZ 4DV5B 5LA6F 4O7SA 2R7LA 5CB4F 3JASA 2HG5C 4FM2A 3ASOB 3SPJA 5BMVF 1QLEB 1VARA 3U11A 5JVLA 5KHHA 4I4TF 4ED2A 4ICGA 2DQ0A 1JVMA 1K8AW 2R6FA 3V4SA 1XDCA 1S72V 1RYSA 4JV2A 4MSWC 3FB8C 2W0FC 1OCZC 4WCEV 4YY3B 2CNVA 5KA5A 4IL6Z 4DR2H 1K92A 1XMOB 5KG7A 1Z5VA 2A79B 2FKLA 4NYEA 3DSQA 3SPCA 4F4YA 4PZ8A 4X1YB 1XDNA 4IZOA 4DL3A 4IHJB 4MAMA 2ZM6B 5EWEA 4PA7A 5KX5A 1VQ7V 4MA5A 3AG3B 4YIOA 3FDSA 2JEFA 1TWGA 2QE7G 1L0NH 2Z02A 3OTFA 4DR3H 4RUCA 2YEVB 3ZMTA 1Y74A 1J5EB 5JWPA 2BTQA 3EPIA 4LFBB 4PDLA 1IXBA 2FPPB 2EIKC 5IYZA 4GKJB 3NUAA 1I1MA 4MV7A 3VOTA 2V7QG 5HFLA 2CUGA 4UCOA 4HYOA 3JAWB 1D2DA 5FJ8G 3Q8PB 3CXHF 2DW4A 3UO3A 4NTWA 3AG4C 3CWBH 4KHPB 3A2FA 1P84F 4JZ2A 1VQ5V 3SYAA 4UCSA 3CE2A 3FD9A 1OWTA 4R8UA 1AILA 2R72A 3CRRA 5KA6A 4FS1A 3PZPA 2OTLV 3LDEA 3CHXA 3PN1A 4HNTA 3O9OA 1PK8A 5B3SC 3N2KA 5CBFA 1VQNV 5BWXA 5KFYA 1Y76A 5DN6G 4HNVA 3RYIA 1N32O 4IIJB 3ZEDA 2HVSA 3RB3A 3V6KA 3VNNA 2AW9A 2L6LA 3ETHA 4EGJA 4RO2A 4QIWE 2R8IA 4JI7H 5IT9N 1AN7A 5KG5A 2PYLA 4UB6Z 1BS3A 2VUMA 2JIZG 2EJRA 5IJ0A 1H2KA 1E4GT 5J9PC 1NVPD 5KT7A 4F4XA 5CA1A 2V4DA 2YXHA 4I55F 3AX6A 3B8NA 3SYPA 4NLGA 5BY1A 4BWSC 3RB4A 2YSUB 1OV9A 4FFRA 1EZ1A 4J9NA 4DL7A 4JI8H 1AB3A 3CYOA 4CZZA 3FKSG 4PA3A 2UUCO 4JPRA 4RZQA 2DWDC 2P6JA 2HJWA 3UCSC 1AR4A 1R1BA 2IJJA 1S77D 3OGCC 3KCYA 2OH2A 4GX0A 1X4TA 3GIPA 1KU9A 3I56V 1T5EA 1WSCA 5KFRA 2PGGA 3CCMV 1AJNA 3WU2Z 3AK2A 5LXTA 1IBLB 2ZINA 3K04A 4ECRA 4U3JA 1AP5A 2HEPA 4P2ZA 1R3LC 3JD2A 3N6XA 5KT3A 4CC6A 5DEDA 1X59A 1Y6XA 4DV3B 1CP9A 2X7RB 1TWHA 2Q5ZA 3L74H 3CC7V 1FJGB 2NUAB 3WFVA 4R50A 1UNNC 3DTFA 5C1OA 2QKCA 3EHBB 3W7SA 1ZWIC 1MZBA 2W9CB 2ITCC 5H80A 2M6YA 4Z1VA 4FFBB 3D36C 4EEQA 1RJQA 5DG9A 3RF2A 5JH7A 1VQ9V 4Q0YA 4UVBA 3SE7A 1FD9A 5IJ9B 4DR5O 2QK4A 1M93A 4LFCH 1BE3H 4JV5B 2C28A 4WFHA 4J9QA 3PVXA 1NJIW 3E8GA 3LSQA 3K5IA 1NZ6A 1US6A 2HIVA 5L3DA 1A3GA 3T1YB 2FB9A 5CA0B 2F4VO 1Z5WA 4IHJA 3OD4A 4DR3O 4MVUA 4A93G 1QLNA 2FK1A 5CR5A 3OHBA 3CRMA 3M7MX 1IBMB 2F1MA 3MAQA 1OCOC 1IBKO 2LW1A 4LF4H 2KB1A 3WWIA 3MR3A 1M4UA 2YEVA 4TV8B 1Y67A 3G8DA 1XOUA 3N40P 2KQXA 1B3QA 2XT9A 4DR1B 1KKCA 2WLLB 1GLVA 1HR0O 3CP1A 3N2GB 2DLNA 3GTJA 2V59A 3U9SA 4YJ2F 4WHXA 4EGQA 3DTUB 3JAWA 2UXDB 5FNVF 2ASDA 4DV1B 4X64B 3G71V 5LL6b 1M5IA 2YIBA 2MCTA 2A7WA 3E86A 3HOYG 5JJJB 2KKWA 2E2HA 2PI5A 1ULZA 2QTOA 4K0KH 4QIWA 5IYBO 1GSHA 4JI4H 5IY5B 5H5NA 4JI7O 4FFLA 3K5MA 2LJ2A 2QKAA 2E74B 3GTPA 2C2DA 4ED3A 3ZHRA 1NTMH 4DL2A 2D3OW 4GKKB 4A5UB 3HO8A 2Z0AA 2QA4V 1C3OA 3RGZA 2DAAA 3GILA 4YJ3B 3RB0A 2IJIA 1FXVA 2E3CA 1IDSA 3A0BZ 3DXRA 1G4YB 2XGQA 4Q4DA 3ZJZA 2LGWA 1XQ8A 2YL2A 2W70A 2Q2TA 2OCHA 2HHFB 1S97A 3MWDA 2JEIA 3SYCA 4ASUG 3UQ8A 4FFNA 5EYPA 1Y1VG 2B1GA 5EDWA 5E25A 2WLIA 1EM1A 4E6NA 5LHIA 2JEJA 1VQLV 4O7ZA 1S68A 4D7SA 2CNQA 5KFQA 5LMUH 3JSNA 4DR6H 4IT5A 5H6QA 2WE6A 5IYBG 3FFQA 4PDMA 4FZ1A 1J5EH 1NVPB 4QGPA 1K97A 4LFBH 4HYKA 2WPDG 3EFFK 5L3FA 1RJPA 1V51A 3ASNB 1B06A 4DIMA 4JAVA 5BWRA 4LF9O 1PL4A 3PW2A 1S0VA 2W9CA 2P7TC 1FFXB 4Z1MG 3CCRV 3JRXA 2Y4TA 2JEUA 4KHPH 2CTPA 4FFBA 3R5FA 1KJQA 4I50F 4C5CA 1AJPA 1BHAA 2HHHH 5E79Z 3NC0B 2VQFH 4EYIB 1S5HC 5IJ9A 1MABG 1O9GA 1HW7A 3T99A 3IG0A 5KG4A 3CMEV 4JI3B 1JDEA 3L72H 2ZCEA 4QPKA 1XNRO 2DYSB 2PY5A 4UV8A 4MV3A 3OUUA 4M9UA 5I60A 2R8KA 3ZIAG 2P4KA 4EKWA 3CRCA 4DR4O 3RV4A 4RB1A 1KKDA 1XREA 1A0IA 3UKMA 3N43B 4DUYB 4EB6B 4GZRB 1KC8W 5I5UA 4EFEA 1WN7A 4FLUA 2I87A 4NR1A 3CCQV 1W2BU 3GIJA 2C2RA 5C3EG 4BIZA 3MR6A 4O4HF 2YI9A 2IH1C 4O4JF 1U96A 2XAJA 2FB5A 1EUDB 1L1FA 5CBGA 2CGNA 4TV8A 4DUZO 5CMUA 4TSFG 2XD4A 2DMXA 5DQHA 5LBQA 1XILA 3WWJA 3RTXA 3N2GA 5KAIZ 4BIUA 2Q0OC 4JYCA 3OMAB 1R73A 2EJ0A 3C3SA 4RUEA 4MV1A 1I6UA 3RVYA 3OEEG 1IX9A 1S10A 4U7OA 1GK9A 5B3SB 4K0KO 2PI4A 5H9CA 1AI6A 4C2MA 4X65B 1OCCC 4JI4O 5KFXA 3PW7A 2C00A 4FIPC 2OIEA 3GB7C 1P16A 1GO3F 1MSWD 1V4YA 5L3BA 3PFFA 5B1OA 4ZHQA 3CCLV 1HNXB 4DL6A 4HR7A 4JYBA 3ETEA 3W1GA 1FAFA 4FS2A 4A3MG 3GLKA 3RB6A 2VR1A 3B4SA 2VUMG 4YB8B 2ZDHA 1JCHA 4JI2B 4ZI7B 1PD3A 1YXBA 2P22C 1CQJB 3ZHUA 1CS0A 2W6PA 1FS0G 2DPJA 4O4LF 2LW7A 5KG3A 3BVOA 2R92G 1WLEA 4YJ3A 2R8GA 3DTGA 1NR1A 3UT5B 4B3MB 2DJVA 4J9ZB 4CH3A 1TGOA 1K5QA 1SZXA 1QR9A 1RM1C 4JV5H 3N41B 4YP3A 3PR4A 2QJ1A 3T9AA 4Q4CA 3P30A 1S03G 3VQWA 4B08A 1Z2PX 4GLXA 2EIMB 1VF7A 2XC9A 2RDJA 4D6TH 4APMA 4GYCB 4XZ3B 1K4DC 4NZOA 3ABUA 5C8YF 5LMUO 5KX5F 4B3RO 1VF5B 3FMAA 4DR6O 2ZDQA 4I0XA 3H01A 2OIGA 5BR8B 1IBMH 2OTJV 5LMNB 4QJFB 3V6HA 3F5WC 4RZRA 3TCUA 3SGIA 2QWOB 1Q7YW 1YSCA 1G1XB 3OTOH 1F23A 1XMQO 4DR7H 3OR6C 4ECVA 2ZE6A 3R23A 4AILC 4O3PA 3C3TA 2ALZA 4EBDA 4DR1H 3U55A 1VF6C 3QNEA 2R86A 1VMGA 3BRCA 3ICXA 2VQFO 4IRKA 4TQFA 1N33B 4QWDA 1FFXA 2VRZA 3N27A 5DMXA 2A1HA 2B63A 3SR2C 4J11A 5IE9A 3I4NG 2YZGA 1A32A 3H1JH 2V58A 5GONB 1CE8A 3KTMA 1H2SB 3TETA 1YIJV 4FE2A 4JI5B 1K73W 1EUCB 3UFXB 3M99B 2IU3A 3BPZA 3ZS8C 3CRQA 3H0GG 4X20B 4MV8A 1NR7A 1GRJA 3S3WA 2XAHA 1PKXA 1M56C 5L1JA 1GM8A 5EZYF 3JASB 4EB6A 3DF7A 4UCVA 1HR0B 3AG2C 4WD3A 1BNCA 1MZFA 5B1AC 2JA6G 4BWAA 2QGNA 1QQCA 3AG1B 3F8NA 1SEIA 5J2UB 1BCCH 4J9RA 5GTHZ 4QPJA 2RCVA 1XK5A 2E5LH 1HWYA 1XNQO 2GHYA 1T94A 4BAYA 5JCOC 3JYCA 5I5WA 2W57A 1W0JG 4TQRA 2Y4RA 3KKYA 2WLKA 3JZIA 2I8CA 2GPWA 2ODTX 4NTYA 1VKZA 2NN4A 3E22A 3ZHVA 5IYDO 4XX0B 4ZOLB 5A2QN 1N0NA 3CJHA 2YIBD 1GGOA 1QHTA 3G6VA 2AZ0A 3K3VA 1THZA 3W7XA 2RN9A 2X0SA 4LSXA 3AK3A 4UVCA 4F4WA 5LXTF 1O75A 2YCHA 4NXMB 5KFIA 3HOXG 4JI0B 2EZOA 5IYZB 4JTDB 1B6SA 3LNNA 4FZ0A 1DIKA 2ETNA 3EXAA 2NU8B 5KFTA 2VS0A 2HG8A 3WG7B 2UVVA 4ZI7A 2YWVA 2UVUA 1SS3A 4J9MA 1F4MA 2WDTA 2Q6AA 2HGXA 2R7NA 2XUMA 3LNMB 3I4MG 3LWBA 4FFOA 3TY5A 3KAKA 4JV0A 2OWOA 2WA4A 1JIHA 4JI1B 3NXSA 4DV0H 5CA3A 4DV4O 3CEIA 4O7VA 4L87A 4K6NA 3OMNB 1N48A 2QWQB 4MVOA 3N2KB 1XHZA 2WLNA 3WWHA 3B2EE 4XYLB 1ET0A 4IHJF 2UUAH 4MV9A 1V55B 4PD4F 3Q2OA 1RK5A 4X62H 4ECTA 4DR7O 2QEXV 3I55V 2FPIB 1XL4A 2HVJC 2YC0A 4AQYB 2C2AA 3JZ6A 3IC7A 2R85A 3QG5A 3PR5B 2WYOA 3IAYA 2IJKA 2JGDA 2BQUA 1WRVA 2PYJA 5DG7A 2ADQB 5L3EA 5DQGA 1URFA 1IOWA 4EYHB 3TIGA 2WB1E 4MVSA 5DAAA 2BE3A 4LF8B 5C4XG 5B66Z 3AYHB 4I9WA 2R9AA 4MV4A 5CA1B 1JKJB 3D36A 2R7MA 4O7NA 3LSSA 1YDXA 3D3QA 4RAZA 2VQEH 2GTSA 4NZNA 2ATKC 1KMIZ 4DR4B 1I2LA 3GVMA 1O9HA 3W1BA 4YHHH 3GV7B 3H20A 3E5NA 5IP9G 5IWAH 2V4RA 5LHHA 2QKSA 4C7UA 4DK0A 4Q43A 3SI8A 3GTKA 4OPAA 5GONA 4JYAO 4ZIBA 3JD3A 4D7TA 1N34B 1WB7A 3T1HB 2QWNB 2YZMA 4PA6A 1PM9A 2F95B 3F7VC 3NR7A 1SA0B 5KHKA 2Q69A 4G27B 1ZSPA 4AHCA 4IIJF 4CE5A 4CKEA 1HNXH 4X20A 1H2MA 3GTLA 1CKOA 2BOBC 3W7WA 1JDBB 3QFFA 4LWSB 3GDEA 2FLPA 2JS5A 1TA8A 2AHYA 2IM9A 5DGAA 2E5LO 1BT8A 5L1LA 3QF7A 4JI6O 4ECWA 1IXMA 4ECZA 4Q20A 1TUEB 5J2UA 3RYHB 2JVDA 1HNWO 1AJQA 2C22A 5KFGA 1ZL8A 5CN0A 5JH7B 3TQ1A 2NR5A 2PVPA 2JJ2G 3HR0A 1LUWA 2Y0PA 4RQFA 2F43G 5KFJA 4G3IA 3WB0A 3E83A 2XOKG 3M9MB 4OX9H 1D5NA 2NLJC 3KCXA 4NXNO 2QB5A 2IBKA 2DN9A 2AGOA 2YU9A 1MNGA 2R9IA 1ROPA 2GDSA 4ZOLA 3ZRXA 5LGUA 5BR8H 4O82A 3N44B 3C0FB 5LMNH 4RNMA 2X6CA 4YAKB 3N6RA 4A3JG 4O7YA 5KFPA 2I80A 5LGTA 4GX1A 4ABMA 4UCTA 5KFSA 1S5JA 1KT8A 4MTEA 5JQWA 5KT5A 3KAJA 4LFAB 2Q73A 1Z2GA 2ZIOA 1U97A 4X1IA 3ZMZA 5ITZA 3X2QB 3TW7A 2YIDA 3R65A 4ZQIA 2NVXA 1N33H 4DV0O 2W6OA 4LMYA 1V9PA 3K0DA 1VS0A 4LF5B 5BPHA 3Q8QB 1L8DA 1DF5A 3ABTA 1ZHQA 5C1PA 1PP9H 2YS8A 2UUAO 4DL5A 3JCZA 4JI5H 3ZRVA 3TK1A 1JX4A 1COWG 4X62O 1XMQB 2JA7A 2O03A 3SPGA 5CA0F 2HLDG 2WB1A 5B1BC 3DGEA 5LYJA 3T9DA 4B3TO 1OCRB 4WFEA 4O3RA 2WLHA 3ABLC 4WFBV 3UYYA 2LQTA 1M57B 2M05A 2E76B 2IW5A 4TV8F 4JAUA 1VQ8V 4DV6O 1H8HG 1I50A 4RB2C 4N21A 3DXRB 2GQRA 2UXBB 4J7JA 1Q43A 4YHHO 1JJ2U 2B63G 2JA5A 2AZ2A 4TOIA 2HKOA 2Y69B 3JATB 1HDJA 1IVSA 2CTWA 5EYPB 5JQGA 1Q6UA 3H1IH 4MTGA 5LOVB 3JD4A 1P7GA 1S5LZ 3Q1KA 2WLIB 1YTFD 4PZ6A 2EINC 3WO0A 3U10A 3G6EV 1RP3B 2K1EA 1M56B 2QYZA 1GN2A 2DOSA 1KP2A 1FXHA 2XGPA 4LF6H 2W6NA 1T3NA 5EOYA 3BACA 4NXMH 5FPRA 1SA0A 2HGWA 3E8HA 1H38A 2GSMB 3SPIA 4JI0H 3VPBA 1K33A 3CD6V 4LWSA 1YVWA 4JZGA 3ABKC 4CS4A 4BBSG 2R7ZA 2ZE8A 2UU9H 2CQYA 1WAZA 1CKNA 1XL6A 1SQGA 4O2BA 3RYHA 2QDOA 1Q90D 5KFFA 3K06A 1JQ0A 4YJ3F 2UXCH 3FYEB 4LBEC 1QNMA 4DR2O 3A0HZ 4OX9O 4DV2B 4B3SB 3W5OA 2AXTZ 1BL8A 3G4SV 2IP4A 2WTFA 3LUTB 2JGUA 4IRDA 2EILB 5KMGA 4JXUA 1TUBB 1KYOF 4MVMA 3KHRA 1NT2B 1PNLA 1W96A 3JD1A 4H33A 1Q82W
chains in the Genus database with same CATH topology
3MWMA 4EB6B 4EFBA 1I94H 4EFEA 3RJ0A 1WN7A 5IT9W 4LH7A 4FLUA 5LP6A 4LH6A 4PI0A 4A2AA 2YI9A 2R70A 4O4LA 4BW9A 4O4LB 4JI6H 1TVKB 4M7EA 3J7AK 1Q8IA 4TV8A 3JAMW 1HNWH 1Z2OX 4LF8H 2VWJA 4X66B 2Q7HA 3RTXA 3N2GA 3JAKA 3NBZB 4PZ7A 4DR5H 3JAKB 1N36B 3TY9A 4JI8B 4FM9A 1I6UA 4FLWA 5C8YA 5C8YB 5KX5B 4NXNH 4X65B 2PUSA 2F4VH 5LMUB 4B3RB 2VOBA 4DR6B 4LF6B 1SQFA 3WB2A 1P16A 1P8LA 4RAYA 3K5NA 1BJTA 3BA9A 2BTQB 4ZHQA 3L4KA 2UUBH 1HNXB 1B04A 1IBKH 4ZHQB 5LP6C 4LNUB 4LF7B 2Q2UA 2PZSA 4TV9B 3JALA 1WH2A 4FM1A 1HNZB 4CC5A 3W1GA 3HKBA 3JALB 1E4FT 2UU9B 4FLZA 4DV5H 2VUGA 1WNSA 1Q5OA 4PI2A 4FLTA 1HR0H 4JI2B 4ZI7B 3HXLA 4PDBA 4FVMA 2UXCB 2P22C 2HHHB 4UCRA 3HKDB 2VQFB 3SJCC 5D5PA 4I50A 4YJ3A 3UT5A 3BABA 3UT5B 4B3MB 3SJAC 4CH3A 1TGOA 2RQ6A 3K58A 3VQYA 4DV7B 1RSOA 4JV5H 3N41B 4DK1A 4CH4A 2QJ1A 2VWKA 4YY3H 1D5AA 3RYIB 1S03G 3VQWA 4B08A 1Z2PX 1XMOH 4GLXA 1I94B 3K59A 1VF7A 4WBNA 5LA6B 3K5OA 3JATA 4GYCB 5EZYA 5CB4B 4APMA 5EZYB 4UCUA 3FMAA 5LOVA 5BMVB 2ZM6H 5BR8B 2OYQA 2CW8A 1IBMH 5D1OA 5LMNB 4O2AA 5FPOA 5EIBD 4I4TA 2VPSA 4I4TB 3SGIA 4RB0A 4O4HA 3CVZA 4B3TH 3OTOH 4DR7H 5IJ0B 4AILC 4FLVA 3K5LA 2XIGA 2RGVA 1JMKC 5JVDB 4CH5A 1XNQB 4DR1H 4DV6H 4GKJH 4F6RA 5K1PA 3BA8A 2F66C 3BRCA 4IAJA 3ICXA 3RWRD 2YXLA 3GB8B 4TQFA 2RJZA 1N33B 5JCOA 1FFXA 3SR2C 3WB1A 3KYHC 1XI1A 4CS3A 5GONB 5JJEB 3J81W 2UUCH 2UUBB 1H2SB 4JI5B 4JI1H 3ETQA 5LXTB 4U3JB 3BPZA 3ZS8C 1TUBA 1I7FA 4X20B 4DV5B 4FLXA 3JASA 3JASB 4EB6A 3DF7A 4UCVA 4FM2A 1HR0B 3RIZA 3HKCB 2HVRA 4BWAA 1QQCA 3F8NA 1SEIA 5J2UB 3U11A 5KHHA 3N42B 4LF9H 4AQYH 4DRFA 1XK5A 2E5LH 3NBYB 1TVKA 5D1PA 3K57A 4A2BA 5JCOC 4YY3B 2W57A 2ZIMA 4KL1A 4DR2H 3CSXA 1XMOB 1Z5VA 4DV4B 1M0WA 2FE3A 4X1YA 3DSQA 1XNRH 4PZ8A 4X1YB 3E22A 1XDNA 4IHJB 3E22B 2ZM6B 3JSLA 4ZOLB 1N32B 4DR4H 5KX5A 2YIBD 3RYCB 5KHGA 1JJOA 3QTCA 1QHTA 3LMLA 3OTOB 3BAAA 3K3VA 4DR7B 3RGBA 3OTFA 4LSXA 4DR3H 2ZNIA 2YCHA 4FM0A 1O75A 1J5EB 3EYYA 4NXMB 2BTQA 1FVIA 4LFBB 1N34H 3T1HH 4JI0B 4LNUA 1IBLH 5IYZA 2YIAA 4GKJB 4X1KB 3L2PA 4I55A 5IYZB 4MV7A 4TV9A 4DUZH 3LNNA 4I55B 4DV3H 4UCOA 3JAWB 1FJGH 3J80W 3HKEB 4ZI7A 5FLXW 4KHPB 4FLYA 3HKDA 2WDTA 1DGSA 3A2FA 4HBNA 2UUCB 4UCSA 4CH6A 3TY5A 3KAKA 2OWOA 1WPBA 2R72A 4O4IA 4JI1B 3U0ZA 4DV0H 1P49A 3CHXA 4O4IB 4B3SH 3PN1A 3N2KA 4JYAB 3N2KB 1XHZA 4IIJA 3RYIA 4RB3C 3B2EE 4IIJB 3ZEDA 2HVSA 1Z2NX 2UUAH 3VNNA 5LA6A 4MV9A 5CB4A 4TUYB 3T1YH 3KXYT 4X62H 5J2TB 1X9NA 5KHIA 5BMVA 4JI7H 3TY8A 4AQYB 1AN7A 3JARB 3KALA 4LSAA 3QG5A 2PYLA 2E5LB 2WYOA 3IAYA 4JI6B 3M4IA 2PYJA 5IJ0A 1E4GT 1HNWB 3RYFA 3SJBC 4LF8B 3RYFB 4K8XA 5CA1A 2R9AA 2V4DA 5JVDA 5CA1B 4DR5B 4EQ5A 4X66H 1L2ZA 4BWSC 2VQEH 4RAZA 4LFAH 5A2QW 1N36H 1FKAH 4PHZA 1KMIZ 4DR4B 4JI8H 1O9HA 5K1XA 3W1BA 2Q7EA 4YHHH 3H20A 2UXDH 4RZQA 4NXNB 5IWAH 5JJNB 4DV1H 4X64H 2F4VB 4DR3B 4DK0A 4LF5H 5GONA 4B3RH 1X4TA 1KU9A 4ZIBA 4D7TA 1T5EA 2PGGA 1N34B 3T1HB 1IBLB 2BTOA 5LXTA 2F95B 2ZINA 1IBKB 1SA0B 4U3JA 2ZJTA 2HEPA 3N6XA 5KHKA 1HNXH 4AHCA 4CC6A 4DV3B 4X20A 1XMQH 1ZHSA 1CKOA 2YI8A 1FJGB 3GDEA 1HNZH 2JS5A 1TA8A 4YJ2B 2IM9A 5DISC 3HKCA 3QF7A 1MZBA 5FNVB 1JFFB 3S24A 5J2UA 4GKKH 3RYHB 2JVDA 4FFBB 4EEQA 3RF2A 5JH7A 2KSWA 2P5OA 4DV0B 4Q0YA 5JH7B 2HGSA 5IJ9B 1M93A 4LFCH 4JV5B 4DV7H 1SYXB 3WB0A 2CAZC 5EIBC 4HNAB 2UXBH 2HIVA 2UUAB 4OX9H 3T1YB 5CA0A 2CW7A 4X62B 4TQDA 5CA0B 1Z5WA 4IHJA 1SKVA 2XHBA 4JI7B 4ZOLA 3L4JA 3RYCA 3M7MX 1IBMB 2F1MA 5LP6B 3MAQA 5BR8H 3N44B 3C0FB 5LMNH 4B3TB 4LF4H 1M4UA 4TV8B 3N40P 4UCTA 4J0MA 1S5JA 2ZNJA 4MTEA 3RGXA 4DR1B 4X1KA 2VQEB 4DV6B 3QWUA 3N2GB 4LFAB 3KAJA 1XNQH 2F93B 2ZIOA 3JAWA 4YHHB 4X1IA 2UXDB 5ITZA 4R7RA 4X1IB 5IWAB 5ITZB 4DV1B 3HKEA 4X64B 1N33H 5LL6b 5D5QA 1M5IA 2YIBA 4LMYA 1V9PA 2MCTA 1VS0A 4LF5B 4I7HA 1L8DA 5JJJB 2KKWA 3RR5A 1ZHQA 4K0KH 4DV2H 4JI5H 4JI3H 4JI4H 1XMQB 2O03A 3K5MA 3HKBB 4K8ZA 3CB2A 4TUYA 2PTMA 4DUYH 2HIXA 4GKKB 5J2TA 5LYJA 5LYJB 2GV9A 2Q0AA 3JARA 4LF9B 3RGZA 4L8JA 5FD5A 3RFRA 3VQVA 4I50B 4YJ3B 4LFCB 5FD6A 2E3CA 1CKMA 4RB2C 1XQ8A 4DR2B 2UXBB 1Q43A 1ZAUA 4OX9B 2Q2TA 1M0TA 1XNRB 4DV4H 4WBNB 4TOIA 1XHXA 3UQ8A 3JATB 5EYPA 1BGWA 5EYPB 5JQGA 4MTDA 5JQGB 5LOVB 1N32H 4E6NA 4PZ6A 5D1OB 4LF4B 4O2AB 3VQXA 2HVQA 1Q3EA 4O4JA 3U10A 4O4HB 4X65H 1S68A 4O4JB 4D7SA 5LMUH 3JSNA 4NVPA 4DR6H 4LF6H 2WE6A 3FFQA 5EOYA 1J5EH 2EX3A 4NXMH 5FPRA 1SA0A 4LR3A 4LFBH 4JI0H 2Q7GA 4DUZB 4LF7H 3GJXB 3THOA 4F6RB 4YJ2A 4DRXA 4CS4A 2UU9H 4DRXB 1TAEA 1CKNA 1FFXB 1SQGA 5FNVA 1JFFA 2CFMA 4O2BA 1CKNB 3RYHA 4KHPH 4O2BB 4UFZA 2QM4A 4FFBA 4JI2H 5KHJA 2UXCH 1YEWA 4CS2A 2HHHH 2VQFH 3NC0B 4Q6GA 4K0KB 5IJ9A 1O9GA 4DV2B 4B3SB 4I9QA 1HW7A 3W5OA 3IG0A 4JI3B 4JI4B 4B3MH 2RGRA 2JGUA 3BHPA 2ZCEA 5KMGA 2PY5A 5KMGB 1G6UA 1TUBB 1GYFA 4JYAH 4HNAA 1NT2B 4RB1A 1A0IA 3N43B 4DUYB 4ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VNN A;  2UXD B;  4YHH B;  4EFB A;  3GB8 B;  4EFE A;  5IWA B;  4DV1 B;  1N33 B;  4LH7 A;  4X64 B;  1X9N A;  3TY8 A;  4AQY B;  4LH6 A;  1V9P A;  2E5L B;  1VS0 A;  4LF5 B;  3KYH C;  4JI6 B;  3RR5 A;  2UUB B;  1HNW B;  4JI5 B;  4LF8 B;  1XMQ B;  4X66 B;  4EQ5 A;  4DR5 B;  3RTX A;  3NBZ B;  4PZ7 A;  4DV5 B;  1N36 B;  3TY9 A;  4JI8 B;  4UCV A;  1HR0 B;  4DR4 B;  2HIX A;  4GKK B;  2HVR A;  3W1B A;  4NXN B;  4LF9 B;  2F4V B;  4X65 B;  4DRF A;  4DR3 B;  1XK5 A;  5LMU B;  4B3R B;  4DR6 B;  4LF6 B;  3NBY B;  4LFC B;  1P8L A;  1P16 A;  5D1P A;  3BA9 A;  1N34 B;  3T1H B;  1CKM A;  1IBL B;  1IBK B;  4YY3 B;  1HNX B;  4DR2 B;  1B04 A;  2UXB B;  1ZAU A;  1XMO B;  4CC6 A;  4LF7 B;  4DV3 B;  4OX9 B;  2Q2T A;  2Q2U A;  1HNZ B;  4DV4 B;  4CC5 A;  1FJG B;  1CKO A;  1XNR B;  3W1G A;  3GDE A;  2UU9 B;  3UQ8 A;  4TOI A;  1TA8 A;  2VUG A;  4PZ8 A;  5DIS C;  1XDN A;  2ZM6 B;  3JSL A;  1N32 B;  4JI2 B;  2UXC B;  3S24 A;  4E6N A;  2HHH B;  4UCR A;  2VQF B;  4PZ6 A;  5D1O B;  4LF4 B;  2HVQ A;  4EEQ A;  3OTO B;  3BAA A;  4DR7 B;  4DV0 B;  3BAB A;  1S68 A;  4B3M B;  3JSN A;  1J5E B;  4NXM B;  4DV7 B;  4JV5 B;  1FVI A;  4LFB B;  5FPR A;  4JI0 B;  4GKJ B;  4DUZ B;  3L2P A;  2HIV A;  2UUA B;  3GJX B;  4GLX A;  1I94 B;  3T1Y B;  4UCO A;  4X62 B;  4JI7 B;  4UCU A;  1TAE A;  1CKN A;  4KHP B;  1IBM B;  2CFM A;  1CKN B;  5BR8 B;  4UFZ A;  5D1O A;  5LMN B;  1DGS A;  5FPO A;  3NC0 B;  3SGI A;  2UUC B;  4B3T B;  4UCS A;  3TY5 A;  4K0K B;  2OWO A;  4JI1 B;  4DV2 B;  4B3S B;  3W5O A;  4JI3 B;  4JI4 B;  4UCT A;  3PN1 A;  4JYA B;  4DR1 B;  1XNQ B;  2VQE B;  4DV6 B;  3QWU A;  4LFA B;  1A0I A;  4DUY B;  2HVS A;  3BA8 A; 
#chains in the Genus database with same CATH topology
 1I94 H;  1CEZ A;  5E1A C;  3TGU H;  4DQN A;  2HJD A;  4LH7 A;  4OXS A;  4PI0 A;  3H4D A;  2YXY A;  4BW9 A;  2QSA A;  3HOV G;  5F9N A;  1TVK B;  2WAQ E;  3PW4 A;  4UV9 A;  1Z2O X;  4LF8 H;  2VWJ A;  4ED6 A;  4X66 B;  1Y4M A;  3K9S A;  2NVY A;  3JAK A;  4PZ7 A;  2COI A;  1N36 B;  1DLB A;  4W4K A;  1KP3 A;  1WCM A;  4FM9 A;  4A3D G;  3KG2 A;  1M6V A;  3C90 A;  4I5S A;  3TQT A;  1LUV A;  2VOB A;  1SQF A;  4RAY A;  4PDV A;  3FKI A;  3K5N A;  4QWA A;  3OHA A;  3BA9 A;  5K3W A;  4A3G G;  1Y1W A;  3PJS K;  4CBC A;  4J9K A;  2J6T A;  2XCL A;  4FPP A;  3L4K A;  2UUB H;  3J81 N;  1KBH A;  5C5J A;  5KG2 A;  4FBU A;  1NTZ H;  3RVZ A;  4ZHQ B;  5LP6 C;  4LF7 B;  4QSH A;  3TEK A;  5EBL C;  5KFB A;  5BWU A;  4TV9 B;  3JAL A;  1ORQ C;  1HNZ B;  4CC5 A;  3M9N B;  4DV5 H;  1OZ0 A;  4ECY A;  1WNS A;  1GH6 A;  1YJW V;  3PO3 G;  2W0X A;  4TM5 A;  4FLT A;  1ZLZ A;  5BPF A;  1XBL A;  1R6T A;  4QWC A;  1Q6I A;  3RUP A;  1WP7 A;  1OBG A;  4UCR A;  3WO1 A;  4YR2 A;  1VF6 A;  5DGI A;  2HFE C;  2VPQ A;  1AUX A;  4DV7 B;  4JI8 O;  4YY3 H;  4JGS A;  1SF9 A;  3CSW A;  1D5A A;  1V54 C;  2ZKO A;  2C35 B;  1XMO H;  4GC7 A;  2AGP A;  3AK1 A;  5KFA A;  3JAT A;  1Q81 W;  1FXK C;  2DIK A;  1OHH G;  2W7P A;  4LF6 O;  5LOV A;  2HVK C;  2CH7 B;  2W9B A;  1M9N A;  2ZM6 H;  1AI4 A;  4I0X B;  2CW8 A;  5KG1 A;  1SRY A;  2VPS A;  1KJI A;  5FPO A;  4I4T A;  2QWR B;  2YYA A;  4GT1 A;  3CVZ A;  3GIK A;  3E8B A;  3RBZ A;  3T5H A;  3RT3 C;  4J9Y B;  5IYC G;  2A0L A;  4E4T A;  3I12 A;  3K5L A;  2UU9 O;  1EKF A;  5BYA A;  2XIG A;  1JMK C;  5JVD B;  2N74 A;  2QWP B;  3OW2 U;  4O86 A;  4GKJ H;  1I0H A;  2UXC O;  2UVW A;  5K1P A;  2F66 C;  1VQ4 V;  1A0G A;  3RWR D;  5EC1 C;  4ZI7 F;  4HNU A;  1JOY A;  5KFL A;  3P3P A;  5JCO A;  1OCZ B;  4LFC O;  1YTF B;  2JEG A;  5B5E Z;  4PBC A;  1DF4 A;  3ABM C;  2HJF C;  3ETG A;  1LNQ A;  1I5Y A;  5L1I A;  2IBZ H;  2FK3 A;  2UXX A;  1I94 O;  3ETQ A;  1TUB A;  5CAE B;  1CQI B;  5KUM A;  4FLX A;  3KHG A;  2VA2 A;  2R93 A;  4QWE A;  3N8D A;  3ORR A;  2KG7 A;  1BSM A;  3HKC B;  2W8K A;  4LF4 O;  3T5K A;  4F4L A;  4MW8 A;  4J9S A;  4J9L A;  1VQP V;  2EIJ C;  2NU9 B;  2EIK B;  5HNE A;  2Y0I A;  3KHH A;  2PN1 A;  3E8F A;  4YQW A;  2MW2 B;  1TVK A;  5KG0 A;  2DE0 X;  5D1P A;  1ZQ7 A;  4BY1 G;  1UPG A;  3K57 A;  3DC6 A;  3ZRS A;  3AG4 B;  3G80 A;  3H9V A;  4KL1 A;  3CS5 A;  2ZT9 B;  1JA8 A;  2ZXW C;  1E1Q G;  4R6Z A;  1M0W A;  3PW5 A;  2EZP A;  1QVG U;  2RDI A;  1KUT A;  4XBF A;  2VA3 A;  2WLJ A;  2DYR C;  5CE8 A;  3E22 B;  1N32 B;  3JSL A;  5KHG A;  3IGA C;  1JJO A;  3CJH B;  3QVN A;  3GID A;  4CHI A;  3QTC A;  2UUB O;  3NGD A;  1GTO A;  2R8H A;  5FL7 G;  4J7K A;  4GX5 A;  4IGG A;  5GON F;  4E2L A;  4O7T A;  1NI8 A;  3ASO C;  3OM3 B;  4FM0 A;  4BIO A;  1NU1 H;  4DV5 O;  3GTG A;  2Q67 A;  1FVI A;  3ABL B;  1OBD A;  1IBL H;  4X1K B;  4I55 A;  4TV9 A;  1WA8 B;  4DV3 H;  4GX2 A;  2DWC A;  1S9F A;  1KC7 A;  1IUR A;  3G6Y A;  1SCU B;  1FJG H;  4MA0 A;  4OPH A;  2JK5 C;  5H2F Z;  3J80 W;  5J2U F;  3T7A A;  1PNK A;  3HKE B;  3BY6 A;  3CX5 F;  5FLX W;  5AG2 A;  4PA9 A;  4FLY A;  2AGQ A;  1EZV H;  2LFR A;  5L3G A;  4YY3 O;  4HBN A;  5KFO A;  2UUC B;  4CH6 A;  3GWO A;  2JA5 G;  1XMO O;  3DC5 A;  4O4I A;  3U0Z A;  4B3S H;  4CKC A;  4QE9 A;  3ZX6 A;  5CM0 A;  1RPO A;  3R9R A;  4C5A A;  1FPO A;  4C5B A;  5D8D A;  4MS2 A;  1M1K W;  2ZM6 O;  4XDK A;  2DPI A;  2A06 H;  1Z2N X;  4N23 A;  4YR3 A;  4TUY B;  4ZOL F;  3T1Y H;  2Y0S E;  5J2T B;  1JLL B;  5BWT A;  2FKX A;  5KFW A;  2CH7 A;  2JEX A;  3JAR B;  2QF7 A;  3KAL A;  4LSA A;  1J5E O;  1W59 A;  1VIB A;  4LFB O;  2JGD B;  1RYR A;  3LP8 A;  4GKJ O;  3ZHS A;  3RYF A;  2A9H A;  3SJB C;  4K8X A;  4E4E A;  3HB3 B;  2XAS A;  1MMM A;  5IYZ F;  5JVD A;  4EQ5 A;  4DR5 B;  3HOU G;  4X66 H;  3A8T A;  4FFP A;  2V1D A;  2ABJ A;  4KHP O;  4NTX A;  2M7W A;  1N36 H;  1FKA H;  4PHZ A;  2HHH O;  4RUF A;  2UXD H;  2Q7E A;  5EWG A;  4JV1 A;  2XCP A;  1K4C C;  4Q44 A;  1R3I C;  4PV1 B;  3TXS A;  4DV1 H;  4RU9 A;  4PA4 A;  4X64 H;  4X9Q A;  4JTA B;  3W7T A;  1N8R W;  2F4V B;  3GWK C;  3K5H A;  4DR3 B;  4RCN A;  5KT2 A;  3I5D A;  4FFM A;  2F23 A;  1YZB A;  5LL6 Y;  3MHS C;  1IBK B;  3PO2 G;  2YIC A;  2ZJT A;  3OUZ A;  4OGQ B;  2DWE C;  3OE7 G;  1OCO B;  1ZHS A;  1K5S A;  2YI8 A;  2GBO A;  3B09 A;  1HNZ H;  4KUM A;  3HKC A;  4U3F H;  3T9F A;  1JFF B;  4GKK H;  2W6Q A;  1T36 A;  2P5O A;  3P32 A;  4QE7 A;  3V6J A;  2HGS A;  1ZL8 B;  3RBE A;  3E89 A;  1KJ8 A;  1K3E A;  5KFZ A;  3HT5 A;  5CA1 F;  4DV7 H;  4Y8V B;  3B77 A;  5B1N A;  1RJR A;  2CAZ C;  5EIB C;  4HNA B;  2DZD A;  4MTF A;  1BGY H;  3MDS A;  2AGA A;  3F7Y C;  5F2V O;  1I7N A;  4QW8 A;  4RUA A;  2CW7 A;  5JUM A;  4TQD A;  4JI7 B;  1L0L H;  2GLT A;  1GO3 E;  3SNO A;  3VMM A;  4ECU A;  2ADP A;  5LP6 B;  3JZF A;  4ED7 A;  3V4Z A;  4FMT A;  3CMA V;  2YRW A;  4HQ6 A;  1S0N A;  3JD0 A;  4UUJ C;  2CE4 A;  2HDK A;  2P67 A;  4P9O A;  4X1K A;  5KFE A;  4ED1 A;  1WA8 A;  2F93 B;  3FYI B;  3QO7 A;  2ATL A;  5C44 G;  2W71 A;  4F50 A;  2OCC C;  3IN5 A;  4KFM A;  1VBH A;  4R7R A;  4X1I B;  5ITZ B;  1UC9 A;  3HKE A;  1QR8 A;  2BSK B;  2O57 A;  5D5Q A;  4O3N A;  1ZET A;  1V54 B;  3OSN A;  5JH7 F;  4JV5 O;  1KEE A;  3U0G A;  2V9W A;  3RR5 A;  3ZRW B;  2FLL A;  4JYY A;  3KRE A;  2Y0S A;  4A3B G;  3ETJ A;  4WFA V;  3LUL A;  1SZT A;  3OUS A;  4ECX A;  4MTO A;  2ZDG A;  1BMF G;  3T1Y O;  1AI7 A;  4WFF A;  4JI3 H;  2QM7 A;  1WJZ A;  4CMF A;  5KT4 A;  3H1L H;  2UVR A;  4K8Z A;  1IBM O;  1DTO A;  3GQC A;  4B7K A;  2Z3Y A;  1M90 W;  1RPR A;  1QVF U;  4TUY A;  4FGR A;  1GM9 A;  2XND G;  2HIX A;  2P06 A;  4DUY H;  5J2T A;  3BEH A;  3OTO O;  5LYJ B;  2BCC H;  3LDC A;  2Q0A A;  2W6J G;  3JAR A;  4LF9 B;  3TW6 A;  4BBR G;  5FD5 A;  1H2L A;  3BFR A;  3VQV A;  4QNH B;  2Z5U A;  4LFC B;  1VQ6 V;  4JF3 A;  4DR1 O;  5FD6 A;  2V4Q A;  3SJQ C;  2DAB A;  1CKM A;  3R5H A;  1FKA O;  1KD1 W;  3QO8 A;  4GC6 A;  2UXD O;  3FB6 C;  1GAX A;  2ZDI C;  2B5U A;  1M0T A;  1GN3 A;  4DV1 O;  4X64 O;  4DLK A;  4LP8 A;  2W9A A;  1XNR B;  4WBN B;  1XHX A;  1ZX3 A;  3CCU V;  5KKN B;  4YR0 A;  2BOC C;  5JQG B;  5IY5 C;  1YI2 V;  1N32 H;  2HP8 A;  1GSA A;  5D1O B;  1EBO A;  4O2A B;  4LF4 B;  2EUL A;  4G28 B;  3RFC A;  5DLG A;  2ITD C;  4K3A A;  4O4J A;  4X65 H;  1QU7 A;  3K08 A;  4R7C A;  3RN4 A;  1UC8 A;  5KLV H;  3STZ C;  4QIW F;  5C93 A;  2YZN A;  4JAS A;  5HBR B;  2ZE5 A;  4RNO A;  4NYK A;  3LQS A;  2EIJ B;  3U54 A;  4LC1 A;  4MVR A;  4DUZ B;  4GKK O;  4QWB A;  3QZ8 A;  4J10 A;  3THO A;  2DQ3 A;  1K1S A;  4DRX A;  2J9G A;  3UM7 A;  1TAE A;  2FLN A;  1E1R G;  5K2M A;  1KQS U;  1JFF A;  3J80 N;  1CKN B;  1G2W A;  4YXW G;  4O2B B;  4UFZ A;  2QM4 A;  4JI2 H;  5FLX N;  4F4Z A;  3T5L A;  1YEW A;  4CS2 A;  3T9B A;  1Y1V A;  3CCE V;  5LGN A;  4K0K B;  5EWF A;  1XEQ A;  4W4L A;  4RWU A;  2FL4 A;  2QTS A;  4AYB E;  4JI4 B;  4B3M H;  2RGR A;  2R9R B;  3BCC H;  3Q4H B;  1JPX A;  5KMG B;  1BQZ A;  3MHH C;  4HNA A;  4IYI A;  2HR3 A;  1OCC B;  3GTQ A;  2AHZ A;  2X0L A;  4YIP A;  2R7K A;  3MWM A;  2B9Z A;  3L71 H;  4R8C A;  1N4C A;  5LOV F;  3RJ0 A;  3OT7 A;  4A3I G;  3B8M A;  4EG0 A;  3RW0 A;  2J6U A;  3CCV V;  5LP6 A;  4LH6 A;  3G8C A;  3IFX A;  3ASN C;  4A2A A;  1SET A;  4O4L A;  5FR9 A;  3CPW U;  2GTA A;  2YDE A;  2WWW A;  3JAM W;  3J7A K;  3L70 H;  1EKP A;  3U9T A;  2Q7H A;  3OSP A;  2AU0 A;  3OGI B;  3NBZ B;  4DR5 H;  4KXR A;  3JAK B;  3Q8S B;  3TY9 A;  3T54 A;  4ED8 A;  2ZR2 A;  4WF9 V;  5KFM A;  4FLW A;  5C8Y A;  1MOF A;  2DYS C;  3Q8R B;  2BSK A;  1K9M W;  1RM1 B;  4JI3 O;  4O7R A;  4A3K G;  2F4V H;  2Q68 A;  3GTM A;  5LMU B;  4B3R B;  4DR6 B;  1NH2 D;  3WB2 A;  3ZRW A;  2FP4 B;  4DW1 A;  3CC2 V;  1FXK A;  4O3S A;  1BJT A;  1ENV A;  4U7C A;  4DUY O;  3TJT A;  2E2I A;  1IBK H;  1XUQ A;  5BXZ A;  1ZTE A;  4LNU B;  3VPC A;  1W93 A;  5I5T A;  2PZS A;  5L1K A;  2IU0 A;  1WH2 A;  4FM1 A;  3FAV A;  3ZN1 A;  3BQ0 A;  3JAL B;  3BJY A;  4FLZ A;  2IH3 C;  2VUG A;  1E4E A;  1YIT V;  4J9O A;  4K35 A;  1HR0 H;  3HXL A;  4FVM A;  1ARO P;  1R9T A;  2HHH B;  1VAJ A;  3HKD B;  2VQF B;  2ZQM A;  1RK6 A;  3M9O B;  5D5P A;  1MZE A;  1G8M A;  1A48 A;  3J7A U;  1VBG A;  2JDI G;  4ED0 A;  2PF4 E;  4X89 A;  2VQE O;  2RQ6 A;  3K58 A;  5IP7 G;  3OMI B;  1TWF A;  4DK1 A;  2CTQ A;  2ZGI A;  4DW0 A;  5IWA O;  2CK3 G;  4WBN A;  5LA6 B;  5EZY A;  5CB4 B;  4X65 O;  3GII A;  4UCU A;  2KSD A;  1PPJ H;  1SQQ H;  5BMV B;  3VPD A;  4TVI A;  2AQ4 A;  2W9B B;  3VA7 A;  5D1O A;  5KT6 A;  1K83 A;  4O2A A;  2YW2 A;  3FB7 C;  4I4T B;  1I3Q A;  1VP7 A;  1HNX O;  4CKB A;  4J9P A;  2YS6 A;  1SQP H;  4A3F G;  3MFI A;  1BQ0 A;  2COG A;  3RAX A;  1YF2 A;  2WAM A;  5BYB A;  4ZHQ F;  3AG2 B;  2R92 A;  5IDJ A;  5B1A B;  2RGV A;  3QQM A;  3A0R A;  3K79 A;  4TV9 F;  1XNQ B;  2PBZ A;  4O3Q A;  3RV3 A;  4JI2 O;  4A3L G;  3BA8 A;  3O65 A;  4IAJ A;  4AYB A;  1AUV A;  2YXL A;  1EN5 A;  3AW8 A;  4KP4 A;  4ME6 A;  2RJZ A;  3JCU Z;  1HP8 A;  4B3M O;  4DXW A;  4MW3 A;  1KUQ A;  2MK3 A;  1R6N A;  3WB1 A;  3KYH C;  3HPL C;  2EIM C;  2NU7 B;  2RNB A;  1YJN V;  3IC9 A;  4O4I F;  4CS3 A;  4U7N A;  5JJE B;  5KFV A;  1A9X A;  2LO1 A;  1AVM A;  2ILM A;  4JI1 H;  3Q4H A;  2FML A;  4M0J A;  1I7F A;  3OAA G;  3K3W A;  1H2G A;  4UVA A;  5GTI Z;  1M7J A;  1K7D A;  5BR8 O;  2W8L A;  3ZHT A;  3RIZ A;  5LMN O;  2HVR A;  3EPG A;  1CXZ B;  2KG7 B;  2G38 A;  3DAA A;  4O84 A;  2Q9L A;  2X6B A;  5HV6 A;  4A3E G;  1NQT A;  3N42 B;  4LF9 H;  4DL4 A;  4AQY H;  1B6Q A;  4DRF A;  3NBY B;  3SPH A;  1KB9 F;  2OCC B;  2W6M A;  2VQD A;  2E75 B;  4G2K A;  4A2B A;  5DG8 A;  1SC5 B;  5JVD F;  5KFN A;  1DAA A;  2ZIM A;  2Q4P A;  3UZO A;  1R3K C;  3CSX A;  4MTX A;  2SCU B;  2D2C B;  1N33 O;  4JTC B;  3PW0 A;  4DV4 B;  2BQR A;  2FE3 A;  4X1Y A;  2BR0 A;  1XNR H;  3R5X A;  3KHL A;  2YRX A;  3GIQ A;  4EBE A;  3H0G A;  4ECQ A;  1N0J A;  4DR4 H;  3OEH G;  3RYC B;  1AR5 A;  2JS3 A;  4JI5 O;  1KJJ A;  3T9C A;  3LML A;  3OTO B;  3BAA A;  2W6Z A;  4DR7 B;  3RGB A;  3CQZ A;  5L9X A;  3WNZ A;  2JA6 A;  3CCJ V;  5GW7 A;  3MWE A;  2ZNI A;  3EYY A;  3AG1 C;  5IYC O;  1N34 H;  3T1H H;  5TIS Z;  1IZ3 A;  2W6I G;  4LNU A;  2X6A A;  2YIA A;  5I5X A;  3L2P A;  4X88 A;  3HOZ G;  2K9P A;  4DUZ H;  4XDL A;  4I55 B;  4JUZ A;  1VQK V;  1IYE A;  2J6S A;  4J42 A;  3UZB A;  3L9D A;  4YBZ B;  4Z2W A;  1SES A;  3HKD A;  3CXC U;  1DGS A;  3ORQ A;  1S3J A;  5KFK A;  2R87 A;  2EJ3 A;  1ZUQ A;  4GCZ A;  4H44 B;  3OUF A;  1WPB A;  1MG1 A;  1NH2 B;  1MSD A;  5I5S A;  1P49 A;  1EN6 A;  3K9A A;  4O4I B;  1I2K A;  1PNM A;  2EJ7 A;  2EJ2 A;  1AR1 B;  4JYA B;  4MV6 A;  3TIN A;  4IWY A;  4IIJ A;  4RB3 C;  1WP8 A;  5LA6 A;  5CB4 A;  3KXY T;  1GMG A;  5FLM G;  1I1L A;  5KS8 A;  1X9N A;  5KHI A;  5BMV A;  4F6E A;  3TY8 A;  5BWV A;  2E5L B;  3BG5 A;  4FU0 A;  4NXM O;  4UUG A;  4JI6 B;  3M4I A;  1SQV H;  4JI0 O;  5HFM A;  4H0L B;  3KZI Z;  2CDY A;  4HN2 A;  2R82 A;  1HNW B;  3WG7 C;  2H94 A;  5DM6 V;  1P7B A;  4JAA A;  3RYF B;  3JAM N;  4O81 A;  2WA3 A;  2ZE7 A;  2GQS A;  3RAQ A;  5I47 A;  1KTA A;  1L2Z A;  3AEI A;  1GN6 A;  3ZN0 A;  4LFA H;  5A2Q W;  2ASL A;  2RMK B;  5K1X A;  2GUZ B;  3T2M A;  2LGQ A;  3H1K H;  4NXN B;  5JJN B;  1S0O A;  4JI1 O;  3T5J A;  1I5X A;  2Q7D A;  3LDD A;  4LF5 H;  4B3R H;  5EC2 C;  1V55 C;  5KFD A;  4U6P A;  2BTO A;  4RQE A;  1B6R A;  4J41 A;  1H8E G;  1QCE A;  3ZMU A;  1IOV A;  2OT5 A;  3OR7 C;  2YUA A;  1XMQ H;  1LR1 A;  4TUY F;  4AQY O;  2QR4 A;  4YJ2 B;  5J2T F;  5DIS C;  2WAQ A;  2JRI A;  1AI5 A;  5KUK A;  5FNV B;  3SDL A;  3S24 A;  1E79 G;  1UJW B;  3ZCC A;  4LF8 O;  2H8P C;  4EEY A;  3E35 A;  2KSW A;  4DV0 B;  1SER A;  1K1Q A;  1YJ9 V;  1SFO A;  1NS1 A;  2X5R A;  1I1K A;  4DO2 A;  3GIM A;  1SYX B;  1YHQ V;  1EHI A;  1TWC A;  2RDC A;  2UXB H;  2UUA B;  4Q8F A;  4HZ3 A;  3L75 H;  5CA0 A;  1NBM G;  4X62 B;  1R6K A;  4MVQ A;  1SKV A;  2XHB A;  3T1C A;  4L1K A;  2B1I A;  2EBO A;  3RYC A;  3L4J A;  2CTR A;  5CBH A;  1N34 O;  1EZJ A;  3T1H O;  3TXQ A;  4B3T B;  2JA7 G;  3E2E A;  1FYJ A;  3AG7 A;  3ZBH A;  4XYM B;  4H13 B;  2YZL A;  5T14 A;  2UXN A;  4AI8 A;  3HOW G;  2CGO A;  5B1B B;  1F7Y A;  1QLE C;  3CRA A;  4J0M A;  2OLS A;  3H3V H;  3HBL A;  1Q6H A;  1SQX H;  2ZNJ A;  4O3O A;  3RGX A;  2WLL A;  2VQE B;  4DV6 B;  3QWU A;  1XNQ H;  2FK2 A;  4YHH B;  1PL0 A;  1DV1 A;  2JJ1 G;  5IWA B;  1MA1 A;  1BXR A;  3ML0 A;  5KFC A;  4O7W A;  2BQ3 A;  2QM8 A;  2ZDI A;  1AP6 A;  4I7H A;  1KJ9 A;  3FB5 C;  2Y48 A;  5DGB A;  3SYQ A;  3SYO A;  4GUN A;  2C2E A;  4DV2 H;  5DQI A;  3H4B A;  3AG3 C;  2EIN B;  1EKV A;  3HKB B;  2A3Q A;  3B40 A;  1PX2 A;  3CB2 A;  4O83 A;  1BHB A;  2PTM A;  4DAA A;  4PJ0 Z;  2W7O A;  5LP6 F;  2ZD9 A;  5EK0 A;  4P30 A;  2GV9 A;  3ZMS A;  4BR6 A;  1PV0 A;  4L8J A;  3T4Z A;  2IMW P;  3RFR A;  4Q45 A;  5F9L A;  4IWX A;  1P4R A;  4I50 B;  5KFU A;  3ZHQ A;  2ODM A;  5BZB A;  3X2Q C;  4LFA O;  3ABK B;  1I08 A;  2ZR3 A;  4TQS A;  1EFR G;  1RSO B;  1VQM V;  4DR2 B;  2R7Z G;  1ZAU A;  2HHF A;  4OX9 B;  1WPX A;  3BQ2 A;  4NKG B;  4DV4 H;  4Q8E A;  1KEC A;  1F4N A;  1WB8 A;  2P0A A;  4LF5 O;  1BGW A;  4MTD A;  3APO A;  2GUZ A;  1N56 A;  2PMZ E;  3GTO A;  4LCU C;  3VQX A;  2HVQ A;  1Q3E A;  3S3X A;  4O4H B;  4O4J B;  4XDJ A;  4WFG A;  4NVP A;  4FFK A;  1KBL A;  1OCR C;  2EX3 A;  2FPG B;  4LR3 A;  1M57 C;  3G67 A;  3T9E A;  4YAJ B;  2Q7G A;  3G6B A;  2IJH A;  1DK1 A;  1WR2 A;  4LF7 H;  3GJX B;  4F6R B;  3HB9 A;  1SQB H;  4YJ2 A;  3HKZ E;  2CZG A;  5LYJ F;  2R84 A;  4DRX B;  2NU6 B;  5I5Y A;  1FFT B;  2LP7 A;  1W0K G;  4RNN A;  5FNV A;  2FJZ A;  1R3J C;  2CFM A;  1UFI A;  3CC4 V;  4PDR A;  5KHJ A;  4A3C G;  3H40 A;  3VOU A;  4Q6G A;  3STL C;  2RF4 A;  1Y66 A;  2UXB O;  2Y69 C;  2XAQ A;  2WSS G;  5I5V A;  4I9Q A;  1F51 A;  1Y14 B;  2N04 A;  3ETD A;  3BHP A;  2FMA A;  4BW5 A;  3TII A;  1WCM G;  4IR1 A;  1G6U A;  2P4V A;  3D8C A;  4JYA H;  1GYF A;  5H6R A;  4WBN F;  1GM7 A;  3MR2 A;  3M8A A;  5L3C A;  4ETS A;  4BY7 G;  4EFB A;  4J80 A;  5JQG F;  3F5T A;  1Q86 W;  5IT9 W;  2H3O A;  5EBM C;  4O2A F;  3FKI G;  3W7U A;  4MT8 A;  1Y1W G;  3MD0 A;  3R66 A;  4MVZ A;  1S76 D;  3RBD A;  2R70 A;  1IBL O;  4O4L B;  1GSO A;  4JI6 H;  1VEW A;  2XCA A;  4M7E A;  1Q8I A;  2YS7 A;  4DV3 O;  1S0M A;  1HNW H;  4ZBM A;  4ECS A;  1FJG O;  3H1H H;  3ZMV A;  5LHG A;  4GLW A;  4B7E A;  4P9P A;  3MFH A;  4FJC C;  1NKD A;  4JI8 B;  3CCS V;  2EIL C;  5C8Y B;  4O2B F;  4IR9 A;  5KX5 B;  2LFS A;  3K0G A;  4DV2 O;  4B3S O;  4NXN H;  1OJH A;  2PUS A;  2GPS A;  5KG6 A;  1GKF A;  4LF6 B;  2NNU A;  2Z04 A;  1P8L A;  4FBT A;  5DEC A;  1IYD A;  1Y74 B;  5A9G A;  4O7L A;  3MR5 A;  3GV8 B;  1FXK B;  2BTQ B;  2ARH A;  1B04 A;  3LSU A;  4PWQ A;  5KFH A;  3OFN G;  3K03 A;  2Q2U A;  1NTK H;  1TWA A;  4QW9 A;  4EBC A;  2N05 A;  4UB8 Z;  2COJ A;  3HKB A;  4TWK A;  1E4F T;  3FAV B;  2UU9 B;  5DLF A;  2ASJ A;  2R8J A;  3T4D A;  2XAF A;  1E4E B;  4X8A A;  1Q5O A;  4PI2 A;  1QBZ A;  4PDB A;  4ZKI A;  2UXC B;  1C30 A;  4NB5 A;  4FK5 C;  3SJC C;  2WLM A;  1JX9 A;  3QZ7 A;  4I50 A;  3UT5 A;  3BAB A;  3MJF A;  3UO2 A;  4R8U B;  4X66 O;  3SJA C;  2IA6 A;  3VQY A;  2CKZ B;  1RSO A;  1N36 O;  1DV2 A;  2PMZ A;  4IRC A;  1CPY A;  1Y76 B;  4CH4 A;  2VWK A;  3QO5 A;  1EN4 A;  1VQO V;  3RYI B;  2JA8 G;  3BQ1 A;  1I94 B;  3K59 A;  5IYD G;  1K34 A;  1B33 N;  3ABM B;  4IYH A;  3K5O A;  3P3N A;  5BWW A;  1YCI A;  2FYU H;  2XAG A;  5EZY B;  3D3I A;  1I7L A;  1GN4 A;  2Q8V A;  1BZK A;  2OYQ A;  3FX7 A;  4QJF A;  5EIB D;  3APQ A;  3K3P A;  2P90 A;  4RB0 A;  4O4H A;  2EIY A;  3HKZ A;  4B3T H;  1J95 A;  4TT3 G;  4LF7 O;  5EBW C;  5IJ0 B;  3VBB A;  4FLV A;  1HNZ O;  2V5A A;  2R93 G;  5DGH A;  3L73 H;  4UXN A;  2Y4U A;  4CH5 A;  4BXX G;  4DV6 H;  4NZM A;  1JR9 A;  4F6R A;  4DYL A;  2FTK A;  4H37 A;  3GB8 B;  3EVK A;  3IJ4 A;  1EYZ A;  4I7Z B;  4HAM A;  1JXL A;  2XTA A;  2CNU A;  1H2N A;  1XI1 A;  4DV7 O;  4J7Z A;  2ZXW B;  3JRW A;  3G6X A;  3CEB A;  3J81 W;  2UUC H;  2UUB B;  4RAI A;  3GV5 B;  2L35 A;  2DYR B;  4PEL A;  5LXT B;  4CMD A;  4U3J B;  1RFY A;  5KAF Z;  4DV5 B;  5LA6 F;  4O7S A;  2R7L A;  5CB4 F;  3JAS A;  2HG5 C;  4FM2 A;  3ASO B;  3SPJ A;  5BMV F;  1QLE B;  1VAR A;  3U11 A;  5JVL A;  5KHH A;  4I4T F;  4ED2 A;  4ICG A;  2DQ0 A;  1JVM A;  1K8A W;  2R6F A;  3V4S A;  1XDC A;  1S72 V;  1RYS A;  4JV2 A;  4MSW C;  3FB8 C;  2W0F C;  1OCZ C;  4WCE V;  4YY3 B;  2CNV A;  5KA5 A;  4IL6 Z;  4DR2 H;  1K92 A;  1XMO B;  5KG7 A;  1Z5V A;  2A79 B;  2FKL A;  4NYE A;  3DSQ A;  3SPC A;  4F4Y A;  4PZ8 A;  4X1Y B;  1XDN A;  4IZO A;  4DL3 A;  4IHJ B;  4MAM A;  2ZM6 B;  5EWE A;  4PA7 A;  5KX5 A;  1VQ7 V;  4MA5 A;  3AG3 B;  4YIO A;  3FDS A;  2JEF A;  1TWG A;  2QE7 G;  1L0N H;  2Z02 A;  3OTF A;  4DR3 H;  4RUC A;  2YEV B;  3ZMT A;  1Y74 A;  1J5E B;  5JWP A;  2BTQ A;  3EPI A;  4LFB B;  4PDL A;  1IXB A;  2FPP B;  2EIK C;  5IYZ A;  4GKJ B;  3NUA A;  1I1M A;  4MV7 A;  3VOT A;  2V7Q G;  5HFL A;  2CUG A;  4UCO A;  4HYO A;  3JAW B;  1D2D A;  5FJ8 G;  3Q8P B;  3CXH F;  2DW4 A;  3UO3 A;  4NTW A;  3AG4 C;  3CWB H;  4KHP B;  3A2F A;  1P84 F;  4JZ2 A;  1VQ5 V;  3SYA A;  4UCS A;  3CE2 A;  3FD9 A;  1OWT A;  4R8U A;  1AIL A;  2R72 A;  3CRR A;  5KA6 A;  4FS1 A;  3PZP A;  2OTL V;  3LDE A;  3CHX A;  3PN1 A;  4HNT A;  3O9O A;  1PK8 A;  5B3S C;  3N2K A;  5CBF A;  1VQN V;  5BWX A;  5KFY A;  1Y76 A;  5DN6 G;  4HNV A;  3RYI A;  1N32 O;  4IIJ B;  3ZED A;  2HVS A;  3RB3 A;  3V6K A;  3VNN A;  2AW9 A;  2L6L A;  3ETH A;  4EGJ A;  4RO2 A;  4QIW E;  2R8I A;  4JI7 H;  5IT9 N;  1AN7 A;  5KG5 A;  2PYL A;  4UB6 Z;  1BS3 A;  2VUM A;  2JIZ G;  2EJR A;  5IJ0 A;  1H2K A;  1E4G T;  5J9P C;  1NVP D;  5KT7 A;  4F4X A;  5CA1 A;  2V4D A;  2YXH A;  4I55 F;  3AX6 A;  3B8N A;  3SYP A;  4NLG A;  5BY1 A;  4BWS C;  3RB4 A;  2YSU B;  1OV9 A;  4FFR A;  1EZ1 A;  4J9N A;  4DL7 A;  4JI8 H;  1AB3 A;  3CYO A;  4CZZ A;  3FKS G;  4PA3 A;  2UUC O;  4JPR A;  4RZQ A;  2DWD C;  2P6J A;  2HJW A;  3UCS C;  1AR4 A;  1R1B A;  2IJJ A;  1S77 D;  3OGC C;  3KCY A;  2OH2 A;  4GX0 A;  1X4T A;  3GIP A;  1KU9 A;  3I56 V;  1T5E A;  1WSC A;  5KFR A;  2PGG A;  3CCM V;  1AJN A;  3WU2 Z;  3AK2 A;  5LXT A;  1IBL B;  2ZIN A;  3K04 A;  4ECR A;  4U3J A;  1AP5 A;  2HEP A;  4P2Z A;  1R3L C;  3JD2 A;  3N6X A;  5KT3 A;  4CC6 A;  5DED A;  1X59 A;  1Y6X A;  4DV3 B;  1CP9 A;  2X7R B;  1TWH A;  2Q5Z A;  3L74 H;  3CC7 V;  1FJG B;  2NUA B;  3WFV A;  4R50 A;  1UNN C;  3DTF A;  5C1O A;  2QKC A;  3EHB B;  3W7S A;  1ZWI C;  1MZB A;  2W9C B;  2ITC C;  5H80 A;  2M6Y A;  4Z1V A;  4FFB B;  3D36 C;  4EEQ A;  1RJQ A;  5DG9 A;  3RF2 A;  5JH7 A;  1VQ9 V;  4Q0Y A;  4UVB A;  3SE7 A;  1FD9 A;  5IJ9 B;  4DR5 O;  2QK4 A;  1M93 A;  4LFC H;  1BE3 H;  4JV5 B;  2C28 A;  4WFH A;  4J9Q A;  3PVX A;  1NJI W;  3E8G A;  3LSQ A;  3K5I A;  1NZ6 A;  1US6 A;  2HIV A;  5L3D A;  1A3G A;  3T1Y B;  2FB9 A;  5CA0 B;  2F4V O;  1Z5W A;  4IHJ A;  3OD4 A;  4DR3 O;  4MVU A;  4A93 G;  1QLN A;  2FK1 A;  5CR5 A;  3OHB A;  3CRM A;  3M7M X;  1IBM B;  2F1M A;  3MAQ A;  1OCO C;  1IBK O;  2LW1 A;  4LF4 H;  2KB1 A;  3WWI A;  3MR3 A;  1M4U A;  2YEV A;  4TV8 B;  1Y67 A;  3G8D A;  1XOU A;  3N40 P;  2KQX A;  1B3Q A;  2XT9 A;  4DR1 B;  1KKC A;  2WLL B;  1GLV A;  1HR0 O;  3CP1 A;  3N2G B;  2DLN A;  3GTJ A;  2V59 A;  3U9S A;  4YJ2 F;  4WHX A;  4EGQ A;  3DTU B;  3JAW A;  2UXD B;  5FNV F;  2ASD A;  4DV1 B;  4X64 B;  3G71 V;  5LL6 b;  1M5I A;  2YIB A;  2MCT A;  2A7W A;  3E86 A;  3HOY G;  5JJJ B;  2KKW A;  2E2H A;  2PI5 A;  1ULZ A;  2QTO A;  4K0K H;  4QIW A;  5IYB O;  1GSH A;  4JI4 H;  5IY5 B;  5H5N A;  4JI7 O;  4FFL A;  3K5M A;  2LJ2 A;  2QKA A;  2E74 B;  3GTP A;  2C2D A;  4ED3 A;  3ZHR A;  1NTM H;  4DL2 A;  2D3O W;  4GKK B;  4A5U B;  3HO8 A;  2Z0A A;  2QA4 V;  1C3O A;  3RGZ A;  2DAA A;  3GIL A;  4YJ3 B;  3RB0 A;  2IJI A;  1FXV A;  2E3C A;  1IDS A;  3A0B Z;  3DXR A;  1G4Y B;  2XGQ A;  4Q4D A;  3ZJZ A;  2LGW A;  1XQ8 A;  2YL2 A;  2W70 A;  2Q2T A;  2OCH A;  2HHF B;  1S97 A;  3MWD A;  2JEI A;  3SYC A;  4ASU G;  3UQ8 A;  4FFN A;  5EYP A;  1Y1V G;  2B1G A;  5EDW A;  5E25 A;  2WLI A;  1EM1 A;  4E6N A;  5LHI A;  2JEJ A;  1VQL V;  4O7Z A;  1S68 A;  4D7S A;  2CNQ A;  5KFQ A;  5LMU H;  3JSN A;  4DR6 H;  4IT5 A;  5H6Q A;  2WE6 A;  5IYB G;  3FFQ A;  4PDM A;  4FZ1 A;  1J5E H;  1NVP B;  4QGP A;  1K97 A;  4LFB H;  4HYK A;  2WPD G;  3EFF K;  5L3F A;  1RJP A;  1V51 A;  3ASN B;  1B06 A;  4DIM A;  4JAV A;  5BWR A;  4LF9 O;  1PL4 A;  3PW2 A;  1S0V A;  2W9C A;  2P7T C;  1FFX B;  4Z1M G;  3CCR V;  3JRX A;  2Y4T A;  2JEU A;  4KHP H;  2CTP A;  4FFB A;  3R5F A;  1KJQ A;  4I50 F;  4C5C A;  1AJP A;  1BHA A;  2HHH H;  5E79 Z;  3NC0 B;  2VQF H;  4EYI B;  1S5H C;  5IJ9 A;  1MAB G;  1O9G A;  1HW7 A;  3T99 A;  3IG0 A;  5KG4 A;  3CME V;  4JI3 B;  1JDE A;  3L72 H;  2ZCE A;  4QPK A;  1XNR O;  2DYS B;  2PY5 A;  4UV8 A;  4MV3 A;  3OUU A;  4M9U A;  5I60 A;  2R8K A;  3ZIA G;  2P4K A;  4EKW A;  3CRC A;  4DR4 O;  3RV4 A;  4RB1 A;  1KKD A;  1XRE A;  1A0I A;  3UKM A;  3N43 B;  4DUY B;  4EB6 B;  4GZR B;  1KC8 W;  5I5U A;  4EFE A;  1WN7 A;  4FLU A;  2I87 A;  4NR1 A;  3CCQ V;  1W2B U;  3GIJ A;  2C2R A;  5C3E G;  4BIZ A;  3MR6 A;  4O4H F;  2YI9 A;  2IH1 C;  4O4J F;  1U96 A;  2XAJ A;  2FB5 A;  1EUD B;  1L1F A;  5CBG A;  2CGN A;  4TV8 A;  4DUZ O;  5CMU A;  4TSF G;  2XD4 A;  2DMX A;  5DQH A;  5LBQ A;  1XIL A;  3WWJ A;  3RTX A;  3N2G A;  5KAI Z;  4BIU A;  2Q0O C;  4JYC A;  3OMA B;  1R73 A;  2EJ0 A;  3C3S A;  4RUE A;  4MV1 A;  1I6U A;  3RVY A;  3OEE G;  1IX9 A;  1S10 A;  4U7O A;  1GK9 A;  5B3S B;  4K0K O;  2PI4 A;  5H9C A;  1AI6 A;  4C2M A;  4X65 B;  1OCC C;  4JI4 O;  5KFX A;  3PW7 A;  2C00 A;  4FIP C;  2OIE A;  3GB7 C;  1P16 A;  1GO3 F;  1MSW D;  1V4Y A;  5L3B A;  3PFF A;  5B1O A;  4ZHQ A;  3CCL V;  1HNX B;  4DL6 A;  4HR7 A;  4JYB A;  3ETE A;  3W1G A;  1FAF A;  4FS2 A;  4A3M G;  3GLK A;  3RB6 A;  2VR1 A;  3B4S A;  2VUM G;  4YB8 B;  2ZDH A;  1JCH A;  4JI2 B;  4ZI7 B;  1PD3 A;  1YXB A;  2P22 C;  1CQJ B;  3ZHU A;  1CS0 A;  2W6P A;  1FS0 G;  2DPJ A;  4O4L F;  2LW7 A;  5KG3 A;  3BVO A;  2R92 G;  1WLE A;  4YJ3 A;  2R8G A;  3DTG A;  1NR1 A;  3UT5 B;  4B3M B;  2DJV A;  4J9Z B;  4CH3 A;  1TGO A;  1K5Q A;  1SZX A;  1QR9 A;  1RM1 C;  4JV5 H;  3N41 B;  4YP3 A;  3PR4 A;  2QJ1 A;  3T9A A;  4Q4C A;  3P30 A;  1S03 G;  3VQW A;  4B08 A;  1Z2P X;  4GLX A;  2EIM B;  1VF7 A;  2XC9 A;  2RDJ A;  4D6T H;  4APM A;  4GYC B;  4XZ3 B;  1K4D C;  4NZO A;  3ABU A;  5C8Y F;  5LMU O;  5KX5 F;  4B3R O;  1VF5 B;  3FMA A;  4DR6 O;  2ZDQ A;  4I0X A;  3H01 A;  2OIG A;  5BR8 B;  1IBM H;  2OTJ V;  5LMN B;  4QJF B;  3V6H A;  3F5W C;  4RZR A;  3TCU A;  3SGI A;  2QWO B;  1Q7Y W;  1YSC A;  1G1X B;  3OTO H;  1F23 A;  1XMQ O;  4DR7 H;  3OR6 C;  4ECV A;  2ZE6 A;  3R23 A;  4AIL C;  4O3P A;  3C3T A;  2ALZ A;  4EBD A;  4DR1 H;  3U55 A;  1VF6 C;  3QNE A;  2R86 A;  1VMG A;  3BRC A;  3ICX A;  2VQF O;  4IRK A;  4TQF A;  1N33 B;  4QWD A;  1FFX A;  2VRZ A;  3N27 A;  5DMX A;  2A1H A;  2B63 A;  3SR2 C;  4J11 A;  5IE9 A;  3I4N G;  2YZG A;  1A32 A;  3H1J H;  2V58 A;  5GON B;  1CE8 A;  3KTM A;  1H2S B;  3TET A;  1YIJ V;  4FE2 A;  4JI5 B;  1K73 W;  1EUC B;  3UFX B;  3M99 B;  2IU3 A;  3BPZ A;  3ZS8 C;  3CRQ A;  3H0G G;  4X20 B;  4MV8 A;  1NR7 A;  1GRJ A;  3S3W A;  2XAH A;  1PKX A;  1M56 C;  5L1J A;  1GM8 A;  5EZY F;  3JAS B;  4EB6 A;  3DF7 A;  4UCV A;  1HR0 B;  3AG2 C;  4WD3 A;  1BNC A;  1MZF A;  5B1A C;  2JA6 G;  4BWA A;  2QGN A;  1QQC A;  3AG1 B;  3F8N A;  1SEI A;  5J2U B;  1BCC H;  4J9R A;  5GTH Z;  4QPJ A;  2RCV A;  1XK5 A;  2E5L H;  1HWY A;  1XNQ O;  2GHY A;  1T94 A;  4BAY A;  5JCO C;  3JYC A;  5I5W A;  2W57 A;  1W0J G;  4TQR A;  2Y4R A;  3KKY A;  2WLK A;  3JZI A;  2I8C A;  2GPW A;  2ODT X;  4NTY A;  1VKZ A;  2NN4 A;  3E22 A;  3ZHV A;  5IYD O;  4XX0 B;  4ZOL B;  5A2Q N;  1N0N A;  3CJH A;  2YIB D;  1GGO A;  1QHT A;  3G6V A;  2AZ0 A;  3K3V A;  1THZ A;  3W7X A;  2RN9 A;  2X0S A;  4LSX A;  3AK3 A;  4UVC A;  4F4W A;  5LXT F;  1O75 A;  2YCH A;  4NXM B;  5KFI A;  3HOX G;  4JI0 B;  2EZO A;  5IYZ B;  4JTD B;  1B6S A;  3LNN A;  4FZ0 A;  1DIK A;  2ETN A;  3EXA A;  2NU8 B;  5KFT A;  2VS0 A;  2HG8 A;  3WG7 B;  2UVV A;  4ZI7 A;  2YWV A;  2UVU A;  1SS3 A;  4J9M A;  1F4M A;  2WDT A;  2Q6A A;  2HGX A;  2R7N A;  2XUM A;  3LNM B;  3I4M G;  3LWB A;  4FFO A;  3TY5 A;  3KAK A;  4JV0 A;  2OWO A;  2WA4 A;  1JIH A;  4JI1 B;  3NXS A;  4DV0 H;  5CA3 A;  4DV4 O;  3CEI A;  4O7V A;  4L87 A;  4K6N A;  3OMN B;  1N48 A;  2QWQ B;  4MVO A;  3N2K B;  1XHZ A;  2WLN A;  3WWH A;  3B2E E;  4XYL B;  1ET0 A;  4IHJ F;  2UUA H;  4MV9 A;  1V55 B;  4PD4 F;  3Q2O A;  1RK5 A;  4X62 H;  4ECT A;  4DR7 O;  2QEX V;  3I55 V;  2FPI B;  1XL4 A;  2HVJ C;  2YC0 A;  4AQY B;  2C2A A;  3JZ6 A;  3IC7 A;  2R85 A;  3QG5 A;  3PR5 B;  2WYO A;  3IAY A;  2IJK A;  2JGD A;  2BQU A;  1WRV A;  2PYJ A;  5DG7 A;  2ADQ B;  5L3E A;  5DQG A;  1URF A;  1IOW A;  4EYH B;  3TIG A;  2WB1 E;  4MVS A;  5DAA A;  2BE3 A;  4LF8 B;  5C4X G;  5B66 Z;  3AYH B;  4I9W A;  2R9A A;  4MV4 A;  5CA1 B;  1JKJ B;  3D36 A;  2R7M A;  4O7N A;  3LSS A;  1YDX A;  3D3Q A;  4RAZ A;  2VQE H;  2GTS A;  4NZN A;  2ATK C;  1KMI Z;  4DR4 B;  1I2L A;  3GVM A;  1O9H A;  3W1B A;  4YHH H;  3GV7 B;  3H20 A;  3E5N A;  5IP9 G;  5IWA H;  2V4R A;  5LHH A;  2QKS A;  4C7U A;  4DK0 A;  4Q43 A;  3SI8 A;  3GTK A;  4OPA A;  5GON A;  4JYA O;  4ZIB A;  3JD3 A;  4D7T A;  1N34 B;  1WB7 A;  3T1H B;  2QWN B;  2YZM A;  4PA6 A;  1PM9 A;  2F95 B;  3F7V C;  3NR7 A;  1SA0 B;  5KHK A;  2Q69 A;  4G27 B;  1ZSP A;  4AHC A;  4IIJ F;  4CE5 A;  4CKE A;  1HNX H;  4X20 A;  1H2M A;  3GTL A;  1CKO A;  2BOB C;  3W7W A;  1JDB B;  3QFF A;  4LWS B;  3GDE A;  2FLP A;  2JS5 A;  1TA8 A;  2AHY A;  2IM9 A;  5DGA A;  2E5L O;  1BT8 A;  5L1L A;  3QF7 A;  4JI6 O;  4ECW A;  1IXM A;  4ECZ A;  4Q20 A;  1TUE B;  5J2U A;  3RYH B;  2JVD A;  1HNW O;  1AJQ A;  2C22 A;  5KFG A;  1ZL8 A;  5CN0 A;  5JH7 B;  3TQ1 A;  2NR5 A;  2PVP A;  2JJ2 G;  3HR0 A;  1LUW A;  2Y0P A;  4RQF A;  2F43 G;  5KFJ A;  4G3I A;  3WB0 A;  3E83 A;  2XOK G;  3M9M B;  4OX9 H;  1D5N A;  2NLJ C;  3KCX A;  4NXN O;  2QB5 A;  2IBK A;  2DN9 A;  2AGO A;  2YU9 A;  1MNG A;  2R9I A;  1ROP A;  2GDS A;  4ZOL A;  3ZRX A;  5LGU A;  5BR8 H;  4O82 A;  3N44 B;  3C0F B;  5LMN H;  4RNM A;  2X6C A;  4YAK B;  3N6R A;  4A3J G;  4O7Y A;  5KFP A;  2I80 A;  5LGT A;  4GX1 A;  4ABM A;  4UCT A;  5KFS A;  1S5J A;  1KT8 A;  4MTE A;  5JQW A;  5KT5 A;  3KAJ A;  4LFA B;  2Q73 A;  1Z2G A;  2ZIO A;  1U97 A;  4X1I A;  3ZMZ A;  5ITZ A;  3X2Q B;  3TW7 A;  2YID A;  3R65 A;  4ZQI A;  2NVX A;  1N33 H;  4DV0 O;  2W6O A;  4LMY A;  1V9P A;  3K0D A;  1VS0 A;  4LF5 B;  5BPH A;  3Q8Q B;  1L8D A;  1DF5 A;  3ABT A;  1ZHQ A;  5C1P A;  1PP9 H;  2YS8 A;  2UUA O;  4DL5 A;  3JCZ A;  4JI5 H;  3ZRV A;  3TK1 A;  1JX4 A;  1COW G;  4X62 O;  1XMQ B;  2JA7 A;  2O03 A;  3SPG A;  5CA0 F;  2HLD G;  2WB1 A;  5B1B C;  3DGE A;  5LYJ A;  3T9D A;  4B3T O;  1OCR B;  4WFE A;  4O3R A;  2WLH A;  3ABL C;  4WFB V;  3UYY A;  2LQT A;  1M57 B;  2M05 A;  2E76 B;  2IW5 A;  4TV8 F;  4JAU A;  1VQ8 V;  4DV6 O;  1H8H G;  1I50 A;  4RB2 C;  4N21 A;  3DXR B;  2GQR A;  2UXB B;  4J7J A;  1Q43 A;  4YHH O;  1JJ2 U;  2B63 G;  2JA5 A;  2AZ2 A;  4TOI A;  2HKO A;  2Y69 B;  3JAT B;  1HDJ A;  1IVS A;  2CTW A;  5EYP B;  5JQG A;  1Q6U A;  3H1I H;  4MTG A;  5LOV B;  3JD4 A;  1P7G A;  1S5L Z;  3Q1K A;  2WLI B;  1YTF D;  4PZ6 A;  2EIN C;  3WO0 A;  3U10 A;  3G6E V;  1RP3 B;  2K1E A;  1M56 B;  2QYZ A;  1GN2 A;  2DOS A;  1KP2 A;  1FXH A;  2XGP A;  4LF6 H;  2W6N A;  1T3N A;  5EOY A;  3BAC A;  4NXM H;  5FPR A;  1SA0 A;  2HGW A;  3E8H A;  1H38 A;  2GSM B;  3SPI A;  4JI0 H;  3VPB A;  1K33 A;  3CD6 V;  4LWS A;  1YVW A;  4JZG A;  3ABK C;  4CS4 A;  4BBS G;  2R7Z A;  2ZE8 A;  2UU9 H;  2CQY A;  1WAZ A;  1CKN A;  1XL6 A;  1SQG A;  4O2B A;  3RYH A;  2QDO A;  1Q90 D;  5KFF A;  3K06 A;  1JQ0 A;  4YJ3 F;  2UXC H;  3FYE B;  4LBE C;  1QNM A;  4DR2 O;  3A0H Z;  4OX9 O;  4DV2 B;  4B3S B;  3W5O A;  2AXT Z;  1BL8 A;  3G4S V;  2IP4 A;  2WTF A;  3LUT B;  2JGU A;  4IRD A;  2EIL B;  5KMG A;  4JXU A;  1TUB B;  1KYO F;  4MVM A;  3KHR A;  1NT2 B;  1PNL A;  1W96 A;  3JD1 A;  4H33 A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 3MWM A;  4EB6 B;  4EFB A;  1I94 H;  4EFE A;  3RJ0 A;  1WN7 A;  5IT9 W;  4LH7 A;  4FLU A;  5LP6 A;  4LH6 A;  4PI0 A;  4A2A A;  2YI9 A;  2R70 A;  4O4L A;  4BW9 A;  4O4L B;  4JI6 H;  1TVK B;  4M7E A;  3J7A K;  1Q8I A;  4TV8 A;  3JAM W;  1HNW H;  1Z2O X;  4LF8 H;  2VWJ A;  4X66 B;  2Q7H A;  3RTX A;  3N2G A;  3JAK A;  3NBZ B;  4PZ7 A;  4DR5 H;  3JAK B;  1N36 B;  3TY9 A;  4JI8 B;  4FM9 A;  1I6U A;  4FLW A;  5C8Y A;  5C8Y B;  5KX5 B;  4NXN H;  4X65 B;  2PUS A;  2F4V H;  5LMU B;  4B3R B;  2VOB A;  4DR6 B;  4LF6 B;  1SQF A;  3WB2 A;  1P16 A;  1P8L A;  4RAY A;  3K5N A;  1BJT A;  3BA9 A;  2BTQ B;  4ZHQ A;  3L4K A;  2UUB H;  1HNX B;  1B04 A;  1IBK H;  4ZHQ B;  5LP6 C;  4LNU B;  4LF7 B;  2Q2U A;  2PZS A;  4TV9 B;  3JAL A;  1WH2 A;  4FM1 A;  1HNZ B;  4CC5 A;  3W1G A;  3HKB A;  3JAL B;  1E4F T;  2UU9 B;  4FLZ A;  4DV5 H;  2VUG A;  1WNS A;  1Q5O A;  4PI2 A;  4FLT A;  1HR0 H;  4JI2 B;  4ZI7 B;  3HXL A;  4PDB A;  4FVM A;  2UXC B;  2P22 C;  2HHH B;  4UCR A;  3HKD B;  2VQF B;  3SJC C;  5D5P A;  4I50 A;  4YJ3 A;  3UT5 A;  3BAB A;  3UT5 B;  4B3M B;  3SJA C;  4CH3 A;  1TGO A;  2RQ6 A;  3K58 A;  3VQY A;  4DV7 B;  1RSO A;  4JV5 H;  3N41 B;  4DK1 A;  4CH4 A;  2QJ1 A;  2VWK A;  4YY3 H;  1D5A A;  3RYI B;  1S03 G;  3VQW A;  4B08 A;  1Z2P X;  1XMO H;  4GLX A;  1I94 B;  3K59 A;  1VF7 A;  4WBN A;  5LA6 B;  3K5O A;  3JAT A;  4GYC B;  5EZY A;  5CB4 B;  4APM A;  5EZY B;  4UCU A;  3FMA A;  5LOV A;  5BMV B;  2ZM6 H;  5BR8 B;  2OYQ A;  2CW8 A;  1IBM H;  5D1O A;  5LMN B;  4O2A A;  5FPO A;  5EIB D;  4I4T A;  2VPS A;  4I4T B;  3SGI A;  4RB0 A;  4O4H A;  3CVZ A;  4B3T H;  3OTO H;  4DR7 H;  5IJ0 B;  4AIL C;  4FLV A;  3K5L A;  2XIG A;  2RGV A;  1JMK C;  5JVD B;  4CH5 A;  1XNQ B;  4DR1 H;  4DV6 H;  4GKJ H;  4F6R A;  5K1P A;  3BA8 A;  2F66 C;  3BRC A;  4IAJ A;  3ICX A;  3RWR D;  2YXL A;  3GB8 B;  4TQF A;  2RJZ A;  1N33 B;  5JCO A;  1FFX A;  3SR2 C;  3WB1 A;  3KYH C;  1XI1 A;  4CS3 A;  5GON B;  5JJE B;  3J81 W;  2UUC H;  2UUB B;  1H2S B;  4JI5 B;  4JI1 H;  3ETQ A;  5LXT B;  4U3J B;  3BPZ A;  3ZS8 C;  1TUB A;  1I7F A;  4X20 B;  4DV5 B;  4FLX A;  3JAS A;  3JAS B;  4EB6 A;  3DF7 A;  4UCV A;  4FM2 A;  1HR0 B;  3RIZ A;  3HKC B;  2HVR A;  4BWA A;  1QQC A;  3F8N A;  1SEI A;  5J2U B;  3U11 A;  5KHH A;  3N42 B;  4LF9 H;  4AQY H;  4DRF A;  1XK5 A;  2E5L H;  3NBY B;  1TVK A;  5D1P A;  3K57 A;  4A2B A;  5JCO C;  4YY3 B;  2W57 A;  2ZIM A;  4KL1 A;  4DR2 H;  3CSX A;  1XMO B;  1Z5V A;  4DV4 B;  1M0W A;  2FE3 A;  4X1Y A;  3DSQ A;  1XNR H;  4PZ8 A;  4X1Y B;  3E22 A;  1XDN A;  4IHJ B;  3E22 B;  2ZM6 B;  3JSL A;  4ZOL B;  1N32 B;  4DR4 H;  5KX5 A;  2YIB D;  3RYC B;  5KHG A;  1JJO A;  3QTC A;  1QHT A;  3LML A;  3OTO B;  3BAA A;  3K3V A;  4DR7 B;  3RGB A;  3OTF A;  4LSX A;  4DR3 H;  2ZNI A;  2YCH A;  4FM0 A;  1O75 A;  1J5E B;  3EYY A;  4NXM B;  2BTQ A;  1FVI A;  4LFB B;  1N34 H;  3T1H H;  4JI0 B;  4LNU A;  1IBL H;  5IYZ A;  2YIA A;  4GKJ B;  4X1K B;  3L2P A;  4I55 A;  5IYZ B;  4MV7 A;  4TV9 A;  4DUZ H;  3LNN A;  4I55 B;  4DV3 H;  4UCO A;  3JAW B;  1FJG H;  3J80 W;  3HKE B;  4ZI7 A;  5FLX W;  4KHP B;  4FLY A;  3HKD A;  2WDT A;  1DGS A;  3A2F A;  4HBN A;  2UUC B;  4UCS A;  4CH6 A;  3TY5 A;  3KAK A;  2OWO A;  1WPB A;  2R72 A;  4O4I A;  4JI1 B;  3U0Z A;  4DV0 H;  1P49 A;  3CHX A;  4O4I B;  4B3S H;  3PN1 A;  3N2K A;  4JYA B;  3N2K B;  1XHZ A;  4IIJ A;  3RYI A;  4RB3 C;  3B2E E;  4IIJ B;  3ZED A;  2HVS A;  1Z2N X;  2UUA H;  3VNN A;  5LA6 A;  4MV9 A;  5CB4 A;  4TUY B;  3T1Y H;  3KXY T;  4X62 H;  5J2T B;  1X9N A;  5KHI A;  5BMV A;  4JI7 H;  3TY8 A;  4AQY B;  1AN7 A;  3JAR B;  3KAL A;  4LSA A;  3QG5 A;  2PYL A;  2E5L B;  2WYO A;  3IAY A;  4JI6 B;  3M4I A;  2PYJ A;  5IJ0 A;  1E4G T;  1HNW B;  3RYF A;  3SJB C;  4LF8 B;  3RYF B;  4K8X A;  5CA1 A;  2R9A A;  2V4D A;  5JVD A;  5CA1 B;  4DR5 B;  4EQ5 A;  4X66 H;  1L2Z A;  4BWS C;  2VQE H;  4RAZ A;  4LFA H;  5A2Q W;  1N36 H;  1FKA H;  4PHZ A;  1KMI Z;  4DR4 B;  4JI8 H;  1O9H A;  5K1X A;  3W1B A;  2Q7E A;  4YHH H;  3H20 A;  2UXD H;  4RZQ A;  4NXN B;  5IWA H;  5JJN B;  4DV1 H;  4X64 H;  2F4V B;  4DR3 B;  4DK0 A;  4LF5 H;  5GON A;  4B3R H;  1X4T A;  1KU9 A;  4ZIB A;  4D7T A;  1T5E A;  2PGG A;  1N34 B;  3T1H B;  1IBL B;  2BTO A;  5LXT A;  2F95 B;  2ZIN A;  1IBK B;  1SA0 B;  4U3J A;  2ZJT A;  2HEP A;  3N6X A;  5KHK A;  1HNX H;  4AHC A;  4CC6 A;  4DV3 B;  4X20 A;  1XMQ H;  1ZHS A;  1CKO A;  2YI8 A;  1FJG B;  3GDE A;  1HNZ H;  2JS5 A;  1TA8 A;  4YJ2 B;  2IM9 A;  5DIS C;  3HKC A;  3QF7 A;  1MZB A;  5FNV B;  1JFF B;  3S24 A;  5J2U A;  4GKK H;  3RYH B;  2JVD A;  4FFB B;  4EEQ A;  3RF2 A;  5JH7 A;  2KSW A;  2P5O A;  4DV0 B;  4Q0Y A;  5JH7 B;  2HGS A;  5IJ9 B;  1M93 A;  4LFC H;  4JV5 B;  4DV7 H;  1SYX B;  3WB0 A;  2CAZ C;  5EIB C;  4HNA B;  2UXB H;  2HIV A;  2UUA B;  4OX9 H;  3T1Y B;  5CA0 A;  2CW7 A;  4X62 B;  4TQD A;  5CA0 B;  1Z5W A;  4IHJ A;  1SKV A;  2XHB A;  4JI7 B;  4ZOL A;  3L4J A;  3RYC A;  3M7M X;  1IBM B;  2F1M A;  5LP6 B;  3MAQ A;  5BR8 H;  3N44 B;  3C0F B;  5LMN H;  4B3T B;  4LF4 H;  1M4U A;  4TV8 B;  3N40 P;  4UCT A;  4J0M A;  1S5J A;  2ZNJ A;  4MTE A;  3RGX A;  4DR1 B;  4X1K A;  2VQE B;  4DV6 B;  3QWU A;  3N2G B;  4LFA B;  3KAJ A;  1XNQ H;  2F93 B;  2ZIO A;  3JAW A;  4YHH B;  4X1I A;  2UXD B;  5ITZ A;  4R7R A;  4X1I B;  5IWA B;  5ITZ B;  4DV1 B;  3HKE A;  4X64 B;  1N33 H;  5LL6 b;  5D5Q A;  1M5I A;  2YIB A;  4LMY A;  1V9P A;  2MCT A;  1VS0 A;  4LF5 B;  4I7H A;  1L8D A;  5JJJ B;  2KKW A;  3RR5 A;  1ZHQ A;  4K0K H;  4DV2 H;  4JI5 H;  4JI3 H;  4JI4 H;  1XMQ B;  2O03 A;  3K5M A;  3HKB B;  4K8Z A;  3CB2 A;  4TUY A;  2PTM A;  4DUY H;  2HIX A;  4GKK B;  5J2T A;  5LYJ A;  5LYJ B;  2GV9 A;  2Q0A A;  3JAR A;  4LF9 B;  3RGZ A;  4L8J A;  5FD5 A;  3RFR A;  3VQV A;  4I50 B;  4YJ3 B;  4LFC B;  5FD6 A;  2E3C A;  1CKM A;  4RB2 C;  1XQ8 A;  4DR2 B;  2UXB B;  1Q43 A;  1ZAU A;  4OX9 B;  2Q2T A;  1M0T A;  1XNR B;  4DV4 H;  4WBN B;  4TOI A;  1XHX A;  3UQ8 A;  3JAT B;  5EYP A;  1BGW A;  5EYP B;  5JQG A;  4MTD A;  5JQG B;  5LOV B;  1N32 H;  4E6N A;  4PZ6 A;  5D1O B;  4LF4 B;  4O2A B;  3VQX A;  2HVQ A;  1Q3E A;  4O4J A;  3U10 A;  4O4H B;  4X65 H;  1S68 A;  4O4J B;  4D7S A;  5LMU H;  3JSN A;  4NVP A;  4DR6 H;  4LF6 H;  2WE6 A;  3FFQ A;  5EOY A;  1J5E H;  2EX3 A;  4NXM H;  5FPR A;  1SA0 A;  4LR3 A;  4LFB H;  4JI0 H;  2Q7G A;  4DUZ B;  4LF7 H;  3GJX B;  3THO A;  4F6R B;  4YJ2 A;  4DRX A;  4CS4 A;  2UU9 H;  4DRX B;  1TAE A;  1CKN A;  1FFX B;  1SQG A;  5FNV A;  1JFF A;  2CFM A;  4O2B A;  1CKN B;  3RYH A;  4KHP H;  4O2B B;  4UFZ A;  2QM4 A;  4FFB A;  4JI2 H;  5KHJ A;  2UXC H;  1YEW A;  4CS2 A;  2HHH H;  2VQF H;  3NC0 B;  4Q6G A;  4K0K B;  5IJ9 A;  1O9G A;  4DV2 B;  4B3S B;  4I9Q A;  1HW7 A;  3W5O A;  3IG0 A;  4JI3 B;  4JI4 B;  4B3M H;  2RGR A;  2JGU A;  3BHP A;  2ZCE A;  5KMG A;  2PY5 A;  5KMG B;  1G6U A;  1TUB B;  1GYF A;  4JYA H;  4HNA A;  1NT2 B;  4RB1 A;  1A0I A;  3N43 B;  4DUY B;  4ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...