4UCTA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 102
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4uctA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4uctA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4uctA02
3PN1A 1HNXB 1XMOB 4DV4B 4JI0B 3JSLA 4X64B 4B3SB 2VUGA 5D1OB 3S24A 4CC6A 1HNWB 3JSNA 3W5OA 3NBYB 3VNNA 4YY3B 3OTOB 2HVRA 4LFAB 4DR5B 5FPRA 5DISC 4B3MB 5LMNB 3NBZB 4UCOA 4X66B 1VS0A 1XMQB 1IBLB 3BA9A 4OX9B 4GLXA 4CC5A 4X62B 4JI4B 2UXDB 4DV5B 2Q2TA 3GJXB 4UCUA 4LH7A 1XNRB 2HVSA 4DRFA 4JI8B 4LF7B 1XK5A 1N33B 4LF6B 1CKNA 3NC0B 2E5LB 1N32B 2HIXA 3W1BA 1ZAUA 1IBKB 1J5EB 3GB8B 4JI3B 4NXMB 4DR6B 3GDEA 3RR5A 4GKJB 1CKOA 5IWAB 1I94B 4DV6B 3SGIA 4LF9B 4LFCB 2UXCB 2UU9B 3RTXA 3BAAA 1HNZB 4DV7B 2F4VB 4JV5B 5D1OA 2VQFB 4DV1B 2Q2UA 3BA8A 1IBMB 4JI6B 4JI7B 4B3TB 4B3RB 4PZ8A 3TY8A 2UXBB 4DV0B 2UUCB 1CKNB 1X9NA 4LFBB 3L2PA 4DUZB 4EFBA 4JI2B 3BABA 4EQ5A 5BR8B 4UCRA 4DR2B 2OWOA 4DR4B 1N34B 4KHPB 2HVQA 4DV2B 4JYAB 3TY5A 2ZM6B 4DR3B 1P8LA 4GKKB 2CFMA 3W1GA 4K0KB 4EFEA 5FPOA 1XDNA 3QWUA 4DUYB 4PZ7A 2HHHB 4DV3B 1CKMA 2HIVA 1N36B 4DR1B 4AQYB 4LH6A 1FJGB 1TAEA 1FVIA 4UFZA 4E6NA 1S68A 5LMUB 4EEQA 4LF4B 3T1HB 4JI1B 5D1PA 2UUBB 4UCSA 3T1YB 4NXNB 1XNQB 1TA8A 4X65B 1A0IA 1V9PA 2UUAB 4LF5B 3UQ8A 4TOIA 4DR7B 4LF8B 3KYHC 1B04A 4UCTA 1DGSA 4PZ6A 1P16A 1HR0B 4UCVA 4YHHB 3TY9A 2VQEB 4JI5B
chains in the Genus database with same CATH superfamily
4K0KH 2EIJC 3ZRVA 2VR1A 1F4MA 2E74B 2ZDIC 1KQSU 4FK5C 3N40P 4ECVA 5CMUA 4JAVA 4QWBA 3BCCH 3CHXA 3ZMUA 4BAYA 1LR1A 5IYCO 4X62B 1JJOA 2UUCO 3LULA 5EWEA 4R8CA 2ZDQA 4A3FG 4RB3C 4YJ2B 3WG7B 5CR5A 2DQ3A 4TV9B 2ZGIA 2E3CA 3DF7A 4LF6B 1GM9A 1N32B 2BQRA 1VP7A 1EN4A 1I6UA 4TQDA 5DQGA 4WFEA 1JXLA 3V6HA 2WTFA 1JJ2U 3OSNA 4NXMO 4F6EA 2UXCB 3FAVB 3RW0A 4RAIA 1Y1VA 3DSQA 4FMTA 3UT5A 1IOVA 2JEGA 4ED3A 3BA8A 1N48A 4MTGA 1K3EA 2BTQA 1H2LA 2X0SA 4F4ZA 5L3GA 3JATB 2W6ZA 3QZ8A 2QSAA 2OT5A 5C5JA 5FD6A 1BHBA 2WLMA 2UUAH 3OUSA 3T1CA 5KFNA 1VIBA 2VQDA 3ZHQA 3ETDA 3T9CA 2JGUA 4KHPB 4APMA 3I56V 4DV2B 4J10A 3ABKB 1COWG 3VBBA 5B66Z 3CQZA 2ITDC 1OV9A 2WSSG 3MR3A 2EIYA 3DC5A 4XBFA 2A1HA 3RBDA 3LDCA 4JF3A 4F4XA 2F43G 5IY5B 4O7TA 4UUGA 4K35A 2VPSA 4DUYO 4TVIA 3HB9A 4F4WA 1WPXA 1KC8W 4XYMB 2QWQB 3OE7G 1RYSA 4RUEA 1EZ1A 3DTFA 2R93A 4O2BA 2A9HA 3APOA 2BTOA 1M6VA 5BMVF 3HOWG 4DAAA 3CCEV 1J95A 4MV3A 1DGSA 4GZRB 4PDMA 4J9LA 5I47A 2DYSC 3F7YC 3K9AA 1V4YA 4MV6A 3I5DA 4RQFA 1IOWA 4CKCA 4YJ3B 5IY5C 2R84A 1SFOA 4MVMA 1YF2A 5CE8A 2M6YA 4JAUA 4YY3B 3OTOB 2FKLA 4X62H 2Q9LA 5C8YA 1KT8A 4YHHH 5GW7A 4JYAO 2R82A 2HHFA 2A06H 1VQ8V 3DTGA 4FM2A 1OCCC 5KG0A 2YU9A 5B1AB 3ORQA 1KB9F 3L4KA 5EWGA 1KMIZ 1YJWV 1AUXA 2OTJV 3BG5A 4QW8A 3GVMA 1Z2OX 3AW8A 3CCLV 1L0LH 1R9TA 4DRFA 4MA0A 1E1RG 2YXHA 1XUQA 1AROP 4JI1O 4GX2A 1GM8A 4QSHA 5DQHA 5CB4F 4NZOA 2QJ1A 5DEDA 3M4IA 1Z5VA 1FXKC 2W0XA 3RN4A 1XL6A 2XC9A 2P90A 4HNTA 5LYJF 2R8JA 1IVSA 2IBZH 2ITCC 2XCAA 5K1XA 2ADQB 4TV9F 4O4IA 2PZSA 1JA8A 3KTMA 3GIQA 2CTQA 5FNVF 1HNZB 4ED2A 4GX0A 1Q7YW 2FYUH 3G6YA 4DV6H 1I94H 3SYCA 3SNOA 1EBOA 2C2DA 2R7NA 3M9NB 2RGVA 3JAWB 5KA5A 1DV2A 1I1KA 3HKBA 4BW5A 1TUBA 2Q8VA 1FXKB 1I08A 4DV0B 3N2GB 5C93A 1FXHA 4LF5H 4A93G 2RJZA 2JDIG 2WWWA 3K5OA 4JPRA 3RYCA 3JD1A 2HGSA 2LP7A 5E1AC 4FFPA 2E5LH 1P84F 2DLNA 1KYOF 1QR9A 2JA7G 4J9ZB 2IJJA 1S5JA 2ZDGA 2UXNA 2C35B 1V54B 4DUYB 2ZNIA 1EZVH 2YI9A 4JI3H 2CW7A 5KUMA 3J81N 4UFZA 2OCHA 1Q82W 3AK3A 4AQYO 5DG7A 4PD4F 4DR1H 3R9RA 2GUZA 5D8DA 4G28B 4ED8A 3JARB 4ZIBA 4FVMA 4L1KA 3I12A 4XDJA 4A3EG 3PW0A 1NQTA 4Q20A 1XNQO 3G6BA 2LFRA 3DC6A 2V4DA 2WAMA 4Q0YA 4YHHB 3M7MX 4QPKA 1XMOB 3ZMSA 4JI0B 3JSLA 4U6PA 4GUNA 2JIZG 2AZ2A 2EIMB 3F5TA 4I4TA 4DR4O 2PY5A 1IBLO 4OX9O 3RV3A 3T99A 4UCOA 1AB3A 4O3PA 2Y4UA 4U3JB 4DYLA 1WA8A 5IJ9A 1NU1H 1PX2A 4FLZA 3PR4A 2J6TA 2RN9A 1S5HC 4CMFA 3OGIB 2R93G 3E8HA 1VARA 5B5EZ 2HVSA 3ETEA 2R85A 4EKWA 2JA8G 5F9LA 4DL7A 4EB6B 3T5JA 1WB7A 4JI8O 2R92A 2XGQA 1AP5A 2UVWA 2Y48A 3A0HZ 1J5EH 2X6CA 1P7BA 1DF5A 4YBZB 5J2TF 4DV6B 1I94B 4DW1A 3S3WA 4G27B 5BYBA 5KHIA 4GKJO 4JV5O 3JZFA 2ILMA 1Q5OA 3ASOB 4O86A 4O7LA 4ECSA 3G8DA 4PDLA 3RF2A 4BY1G 1RM1B 4YJ2F 1N0JA 2ZE6A 1JIHA 2QEXV 1VBGA 2OTLV 3LDEA 1BL8A 2Y69B 2NU9B 4OPAA 2DYRB 1JLLB 3LNNA 1AJQA 2B9ZA 2W57A 1K4DC 1K7DA 4YHHO 3CEBA 3H1IH 4PA7A 3PVXA 4FFBA 4LBEC 5IYDG 3LSUA 5FJ8G 2C22A 3K79A 4UCRA 2GSMB 2KKWA 2CNUA 4IIJA 2V4RA 2Q68A 2RF4A 1Z2GA 2QE7G 3ZRWB 1H2GA 3QWUA 4YAJB 4PZ7A 1EKFA 2AGPA 5GONF 1N34H 1Q81W 3Q2OA 2ZXWC 4RNOA 4ED6A 2ZM6H 3RGBA 4AQYB 5LHGA 2QK4A 2RCVA 1S68A 2P4VA 3IFXA 4B08A 3THOA 4PI2A 4X20B 4JI7H 1W2BU 1KD1W 4O4HF 2DWDC 3AK2A 1JFFB 5JVDA 1JOYA 1Y74B 4A5UB 4C5CA 2XIGA 3EPGA 2BE3A 3GIJA 3B40A 4JI1H 3KKYA 3FKIG 3CCRV 1XI1A 2YS8A 3UZOA 5I5VA 3W7UA 1Y74A 2ABJA 5A9GA 2UUAO 2V59A 5KG7A 2WAQA 3HOXG 3SPIA 5IYBO 3GTLA 1WN7A 4WBNB 1HR0B 2DW4A 3ZRSA 3MWEA 1WPBA 4RNNA 5B1BB 3JAKB 2ZKOA 1LUWA 2Z3YA 3U0ZA 1WH2A 2Y0SE 4LNUB 4I5SA 4DL3A 4YR2A 2CTWA 4CC6A 3KHRA 1Q6UA 2KSDA 2QM4A 4MVOA 1SA0A 3N6XA 5K1PA 1B3QA 3BA9A 2I87A 4EBCA 4H33A 4X89A 2JA5G 4O3OA 5KG2A 2N04A 3G6EV 2LO1A 3CCMV 1Z5WA 5EC1C 1BZKA 3RYFA 3S3XA 5EBMC 4Z1MG 5L9XA 4JZGA 3EFFK 4KFMA 4BBRG 1T3NA 1DV1A 2WLJA 1K9MW 2YEVA 2PTMA 3T5KA 5B1OA 2BTQB 5HBRB 3GB8B 4DR7O 4IAJA 1SQGA 2Q73A 1IBMH 4FLTA 1XNQH 1NS1A 2DIKA 1PPJH 4DLKA 4EEYA 2V9WA 1AJNA 3JASA 2WYOA 4CH5A 1PL4A 4O4IB 4MV9A 2QM8A 1VMGA 4C2MA 2QWRB 3A0BZ 4AQYH 3V4SA 3T9DA 2XAFA 1O9GA 1M0TA 3CMAV 4FFBB 4JI6H 4JI7B 2IP4A 3SJCC 4F6RA 1NH2D 3F5WC 4J42A 5B1NA 4ECTA 2HR3A 2IMWP 5KFDA 2RQ6A 1H2NA 2RDCA 5IJ9B 5E25A 4HYKA 4TUYB 5LGTA 3P30A 4B7EA 1CKNB 2YZLA 3MD0A 3LSSA 3TJTA 3HXLA 3L2PA 3HOUG 2IBKA 1V55C 4CS4A 5EZYB 1JKJB 1N34B 3N41B 5DLGA 1LUVA 1M9NA 1G6UA 3W1GA 4YR3A 3H20A 3K0GA 4TQSA 4IWYA 4FS1A 1SRYA 4LF7H 4EYHB 1N36O 1IBKO 2JA6A 1US6A 3U10A 4P9OA 3KAKA 1JR9A 1N36B 2PYLA 1VQPV 4RUFA 3OGCC 1TAEA 5KFBA 3GV7B 2ZQMA 1SS3A 3GQCA 3BPZA 5L3CA 2Y4RA 3RVYA 1BJTA 1GKFA 2PBZA 1E4GT 1CPYA 2FLLA 5IP9G 2FTKA 3ABLB 4A3BG 2DYSB 2W6JG 4YQWA 1IYDA 4X1YB 3G4SV 4ABMA 2W9AA 3N42B 3DAAA 3SPHA 3STLC 2ZD9A 4FPPA 4UCVA 3ZS8C 3OUUA 4NXNH 3N8DA 3RB0A 4ZOLA 5EYPA 4LF8H 3CPWU 5C8YB 4WHXA 3RFCA 4DL5A 1PV0A 5DGHA 3SDLA 1XBLA 3RYCB 1HP8A 3VNNA 4O7WA 1ZHSA 1S0NA 3R65A 5E79Z 2BQUA 2UVUA 4B3RH 5KS8A 3TIGA 2F66C 4FBUA 1XHXA 2ZR2A 1DLBA 3H4DA 3ZCCA 4BIZA 3L70H 3L73H 1S77D 5I5WA 4PA3A 2QTOA 4JYBA 3WG7C 4HQ6A 3WNZA 1F51A 2RMKB 1CKNA 4JYAH 2W6OA 2QKCA 5KG1A 2HIXA 4QGPA 3H01A 4JUZA 1YCIA 2NU6B 4JV0A 1EUCB 4QWDA 5BPFA 3AG4B 2R9IA 3JALA 2AHYA 3HR0A 2LQTA 2IJHA 4MAMA 1I3QA 1AP6A 4KP4A 4WFFA 1YZBA 5C1PA 4R8UA 3RYHB 4GX1A 2OH2A 5JCOC 5KFPA 4X1IB 2ZDIA 2VA2A 1U96A 3QVNA 4NYKA 4E2LA 1S72V 2Z0AA 4DO2A 4JI7O 2SCUB 5DMXA 4HNUA 4R8UB 4YP3A 4JV1A 2JA5A 2NN4A 4X20A 3ML0A 3A2FA 1IBMB 1S97A 4JTDB 3N2GA 2UUCH 4BWSC 4O2BB 4U3JA 1V54C 2R6FA 4HR7A 1Y67A 1VQ4V 5J2UB 1K97A 3A0RA 3HKDA 5CAEB 4FM0A 3BABA 4ETSA 3KG2A 1K34A 1EYZA 3RGXA 4EGQA 4GKKB 2X6AA 4ECXA 2DQ0A 3OTOO 2A0LA 3BEHA 4QW9A 3D3IA 1W96A 4RWUA 2JJ1G 3Q4HB 3SJAC 3J7AU 1YI2V 3IGAC 4LF6O 4Z1VA 5EBWC 4IR1A 3OSPA 2VPQA 5LP6A 3KXYT 3ASNB 4NXNB 4J41A 3UO2A 4FLXA 1A0IA 3W7TA 3T1YO 3BQ1A 3U9SA 4J9OA 1BMFG 2FMAA 1E4EA 5H80A 1GN2A 1QR8A 4UUJC 1VQ9V 3SJBC 1OCZC 2JEIA 4XX0B 2C2RA 5EZYF 3G71V 3N27A 1Q3EA 1FKAH 4DV4B 4NYEA 5KFIA 5KFFA 2JEFA 1JFFA 3W7WA 2EULA 2PVPA 1HNXO 1JQ0A 4XDLA 4MS2A 4DV4O 4J9SA 2JEXA 3NBYB 3MR6A 4DR5B 4BIUA 1Y14B 4B3MB 3CEIA 3M9MB 4QE7A 4GC7A 3KHHA 4J7ZA 1M56B 1PNLA 5JQGF 5L3DA 3T54A 1XMQO 4JI4B 4DV5B 4O7YA 5I5TA 2JGDA 5IYCG 4LC1A 5LA6A 4A3DG 3ASOC 2LFSA 1GSAA 4YXWG 4PWQA 5IDJA 5CBFA 3NC0B 1SQXH 3L72H 2WB1A 1CXZB 2XAQA 3VPDA 2DJVA 4IRKA 1MABG 3F8NA 1ZAUA 4NZNA 4NTWA 3SE7A 2YZNA 3FKSG 1NKDA 4IWXA 4DR6B 1L1FA 3BVOA 1AI5A 5LYJB 4CE5A 1KU9A 3HB3B 2XNDG 4YY3O 2VQFO 3TIIA 5DLFA 5IJ0B 5EYPB 1FFXB 5JJNB 3U0GA 4YIPA 3FDSA 3HOYG 4X88A 5I5XA 4DV1B 2Q2UA 3T1HO 1AI7A 4ICGA 5CA0A 3ZHSA 5I5UA 2JVDA 3GTMA 2UU9H 3ZRWA 2C2AA 5F9NA 4JV5H 2Y4TA 4F4LA 4B3RO 3UZBA 1AI4A 4DQNA 5BWUA 5JQWA 3E83A 4DUZB 1NR7A 2RNBA 1M4UA 1S76D 2R7KA 4JI2B 4FFOA 5DM6V 3T4ZA 4DR3O 4HBNA 1VQ6V 4DV7H 4DUZO 5KG4A 2HVQA 2R8GA 3TQTA 2ZXWB 4X66O 4YJ3F 2B5UA 1RK5A 3B8MA 2XASA 1K5SA 3PO2G 3HBLA 1WNSA 4U7NA 1X4TA 4DV3H 1C3OA 1I1LA 3IG0A 1NZ6A 1Z2PX 4L8JA 3PR5B 2Y69C 2R72A 3AEIA 3E22A 4O4JF 2YZMA 4J9NA 1M1KW 5BWWA 4JI1B 4GC6A 4LNUA 1JPXA 2ZE5A 4JASA 3AG2C 4K3AA 3MWDA 3KCXA 2PMZA 3HOZG 2YIBA 5CA1F 2XOKG 5L1JA 4Q8EA 2CKZB 4DV0O 3I4MG 3UKMA 3V6KA 2YL2A 4IYHA 1SCUB 2QM7A 3CXHF 2OIGA 2ZIMA 1XMOO 4ECUA 5IYZB 2WLNA 2IJKA 5H6QA 5D1OB 4DR2H 4AHCA 5L1LA 3HT5A 1SETA 4FS2A 3C90A 3RFRA 4TWKA 2YIDA 3B4SA 2Q7DA 4TSFG 2GTAA 1CQIB 2Q69A 2QA4V 5L3FA 4G3IA 1N33H 4PDVA 3N43B 4TV9A 2YRXA 3Q8SB 2Q2TA 3BJYA 2OLSA 3TETA 4O3QA 3CJHB 2FPIB 4LH7A 1C30A 4O7SA 5JJJB 1M57C 4N23A 4LR3A 5CB4A 2G38A 3RB3A 1QQCA 3QFFA 4WF9V 3IJ4A 1JMKC 4LF4H 4NVPA 1L2ZA 4E4EA 4WFBV 1MZBA 4U7CA 1HWYA 2ETNA 4YB8B 3ZN0A 1ZX3A 3K59A 4LF8O 4PA6A 2AZ0A 2R7LA 1CQJB 2CUGA 3K5MA 2V4QA 2NNUA 1I7LA 4Y8VB 2CH7B 2YI8A 3CRAA 5CA0B 5KFLA 3MFIA 1GAXA 1W93A 3U9TA 2J6UA 5LMNO 1THZA 2YC0A 2ASDA 5KHKA 4P9PA 4JV5B 2UVRA 2JK5C 1SQVH 3Q4HA 4BBSG 3R5FA 3CC2V 2Q0AA 5KA6A 2DMXA 2DYRC 2ODTX 5B1AC 2JA7A 3E35A 1D5NA 1UC8A 2EJ0A 4LF7O 1EFRG 1I7FA 5DECA 3FB5C 1IZ3A 5DG9A 2R7ZA 4FBTA 4LFBB 5L1IA 1I0HA 3OEEG 5EOYA 1RP3B 2UUBH 4DRXB 1HW7A 4LFBO 5FLXW 2EJ2A 1N56A 2ZT9B 1KJ8A 2F23A 2C28A 3N44B 4FLWA 1N36H 1KEEA 2WLHA 5IYZF 4TUYA 2COGA 2RDJA 3CCUV 4ZI7B 3JZ6A 5EIBD 1SF9A 3STZC 2YDEA 2ADPA 3CVZA 1BS3A 5D1PA 2GHYA 5KX5F 1K1QA 3J80N 2IA6A 2W7OA 5IE9A 3E5NA 1GO3F 2PMZE 1P49A 2NU8B 5KX5B 4LF5B 2EIKC 5KFYA 2Q7GA 4L87A 4LF8B 3LUTB 1EKPA 2ATLA 4DV6O 1I94O 1AN7A 1WAZA 3GV8B 1KJJA 3J7AK 5LP6C 2EIJB 3HKDB 3UYYA 5GTHZ 5LGNA 3SJQC 1YIJV 2KB1A 4O2AB 2CH7A 2AQ4A 1S10A 5EK0A 4K6NA 2P7TC 1QCEA 1RSOA 4DV7O 4X1KB 2ZM6O 1MZEA 1XL4A 2XHBA 3ABLC 2JS3A 1PM9A 2WLIB 1FYJA 5DGIA 4M7EA 1EZJA 2V5AA 5FNVB 1B6QA 3GJXB 1H8HG 2F1MA 4UVCA 1ULZA 4K8XA 2A79B 2V1DA 3RYHA 3WO0A 3SYAA 4I55F 3N2KA 2COJA 5DG8A 5LMUH 1GN6A 2GQRA 3JAKA 1VQMV 1G4YB 3EYYA 4IZOA 3T9AA 4ECQA 5EDWA 2R7ZG 1KUQA 2MW2B 4LF9B 1JX9A 2YCHA 5H9CA 2LW1A 1BQZA 3ABTA 1AUVA 2J6SA 4J9QA 5CBHA 2F4VB 5KFOA 5D1OA 4X65O 4AYBE 2CE4A 3RAQA 1W0KG 1P4RA 4QWEA 2V7QG 3JRXA 4JI6B 3TINA 3LMLA 2C00A 1SQFA 2CZGA 3FB8C 1WP8A 5JQGB 4DV2H 2R92G 1O9HA 3K0DA 3K08A 4B7KA 1NVPB 4RNMA 1NVPD 1GSHA 3KHLA 1G8MA 1TVKA 1XNRH 5LHHA 3OEHG 5LA6B 1OCOC 4EBEA 4TQFA 4X8AA 4UVAA 3E2EA 2CFMA 5JCOA 1Y76A 1FXVA 2D3OW 2XTAA 5LOVB 4I4TF 1MG1A 5BWRA 4U3FH 5FPOA 1XDNA 1XEQA 3M9OB 1ENVA 4HAMA 4B3TH 4DIMA 4F50A 4DR6H 4I7ZB 4LF4O 2Q4PA 5KFMA 3IN5A 2DE0X 3GIDA 2WDTA 4UB6Z 2GLTA 2EJ3A 3HOVG 3UM7A 2FB9A 3T1HH 1SYXB 2UXCH 1VF6C 1XREA 3FAVA 3OTFA 2YWVA 2E2IA 4HNVA 3JASB 3ETJA 3T1YH 5EWFA 4AILC 1TA8A 2VQEH 1B6RA 1PP9H 2UUAB 1F23A 2M7WA 4FLVA 2KG7B 1NH2B 1SEIA 2NVYA 1TWHA 4NTYA 1DF4A 1ZHQA 2YZGA 4CH6A 3A8TA 3ZHTA 3B8NA 4I9QA 4IRDA 2W6NA 1VAJA 3OM3B 1ZETA 4DR5H 4LWSA 1BNCA 1H8EG 4JI2H 3T5LA 3S24A 2EBOA 3JSNA 1BXRA 1VF5B 4O7ZA 2W9CB 2QKSA 3IC7A 5KHHA 2ZDHA 3D3QA 1MA1A 3T9BA 3PFFA 4R7CA 3CMEV 3U54A 3VOTA 4O4LF 4A2BA 1Q86W 1CP9A 1AR5A 4X62O 2WPDG 2W6MA 2QYZA 3VMMA 3GIKA 1FXKA 2WLKA 4B3MO 4O2BF 1G1XB 2FK3A 3BFRA 2GUZB 4O4LA 5FR9A 3CCQV 3FKIA 1I5XA 2IH1C 5DGAA 1OCZB 2LGWA 1PD3A 3CD6V 1M0WA 2WE6A 4MA5A 2GDSA 1N32O 1XK5A 2BSKA 1EN6A 4IHJA 1F4NA 1IBKB 1V51A 5FLXN 1WRVA 3R5XA 1J5EB 4IT5A 2DAAA 3PW4A 5LBQA 1R3IC 4NXMB 2JEUA 4GKKO 4EYIB 2UU9O 5IWAB 4RCNA 2FK1A 5KG6A 1K4CC 5LXTA 3T9EA 2ARHA 3UT5B 4A3GG 1RM1C 1KKDA 5D5PA 2V58A 4JGSA 2IU3A 3OUZA 5KFCA 3JCZA 1EM1A 4JTCB 4MVRA 4EG0A 1K1SA 3QO8A 1R6KA 3MDSA 3X2QB 1FJGH 2FK2A 3GTQA 4WFHA 1YSCA 3PZPA 2UXBO 4RQEA 4XZ3B 2Y0IA 3JARA 5KFEA 3VOUA 1BHAA 4DL2A 4PELA 2XCPA 1EN5A 3LDDA 4ECRA 4DV5O 3H4BA 4FZ0A 4EQ5A 1VQKV 4O2AF 2YW2A 1JDBB 1HNWH 2B1IA 3W7SA 3L74H 5JWPA 4NB5A 2E5LO 4K0KB 2QKAA 5KFZA 2XCLA 4TV8B 1H2MA 2F95B 5D5QA 1PNKA 4NXMH 2YRWA 1IXBA 3CC4V 3IAYA 2HIVA 3ZN1A 4IYIA 3J80W 4X1KA 4X9QA 1ZSPA 3G6XA 4GT1A 4NLGA 5B1BC 3CYOA 3GIPA 5EZYA 2BR0A 4G2KA 4O4JB 1R73A 1YTFD 2YICA 1OCRB 1QHTA 2PI4A 4DV0H 2JEJA 5J9PC 1FFTB 3BQ0A 3ZHVA 1A32A 2QTSA 1IBLH 4OX9H 3GWOA 3RAXA 1KUTA 1QBZA 1GK9A 4PA9A 2A3QA 1BCCH 3E86A 4BWAA 1I50A 1OHHG 4X64B 3GWKC 4DR4H 4K0KO 2R8HA 4EGJA 5B3SC 4RZQA 3Q8PB 2NLJC 2QB5A 5KG5A 1I1MA 2JRIA 2HDKA 3D36A 1SQPH 4ZOLB 2HVRA 3CSWA 3Q8RB 5DISC 3B2EE 4XDKA 5FPRA 1HNZO 2M05A 1K92A 4BW9A 2EINB 2P0AA 1XMQB 4JI4O 2YEVB 2CTPA 4O2AA 1IURA 5FD5A 1YJNV 5BXZA 4Q43A 1ZTEA 1NJIW 4IHJB 2FE3A 4YR0A 4B3SH 3BRCA 3ZEDA 3OW2U 1U97A 4GKJH 2E5LB 2GQSA 1R3JC 1J5EO 3T5HA 1MSDA 1N33O 5BWXA 4MVQA 4F6RB 5HFMA 2PYJA 5KFXA 3ZMVA 4LFCO 3AG7A 3TXSA 4CHIA 1XILA 4DR6O 4RB1A 1K33A 5KT4A 4LFCB 4HYOA 5H6RA 3T7AA 3RUPA 1NTZH 3AX6A 3BAAA 3RTXA 3H0GA 4NXNO 5JVDF 3E22B 1YJ9V 4CZZA 1KP2A 2DWEC 2XGPA 1VQLV 4O4LB 4ZQIA 5KHGA 1BE3H 1FKAO 4MTXA 5GONA 3RYIA 5IYZA 2RGRA 5IT9N 3OMIB 5I60A 1RFYA 5I5YA 1Y66A 1KJQA 4O7NA 1Z2NX 5JVLA 1AI6A 2AGAA 1DTOA 5EBLC 3U11A 4PBCA 2F4VH 3QO7A 4DR5O 1ZUQA 4JI2O 3GB7C 3CCJV 2PGGA 3AG1C 4OXSA 4WFAV 2CTRA 2HLDG 3OMNB 3MWMA 5HNEA 1JCHA 2KQXA 4DV3B 1Y1WA 3RVZA 2CW8A 1SA0B 1PNMA 2FPGB 4J9RA 1URFA 2QGNA 4E6NA 5LMUB 4EEQA 4IR9A 3T1HB 1T5EA 3SYQA 5KFRA 3K3VA 3T1YB 3AYHB 2XT9A 2COIA 5EC2C 3CWBH 3ETQA 2DWCA 2FKXA 1FAFA 4ECWA 4TOIA 3GIIA 1Q6HA 4BY7G 2VQFH 4A3LG 4LF5O 2R9RB 4HN2A 5H5NA 3MJFA 4X64O 3CCVV 4JI0O 3ICXA 2CQYA 3SYOA 1E4EB 5JJEB 2N74A 1AILA 2W6PA 3KALA 4DV1O 1TVKB 2L6LA 4RO2A 3CRQA 4RB0A 4FZ1A 3RIZA 4DV3O 3P3PA 5LL6b 4FIPC 3JAWA 1M7JA 5KFGA 5LMNB 1QVFU 2JJ2G 1KJIA 4ZHQF 1B33N 4H37A 4CBCA 4GLXA 2EIKB 4CC5A 4LFAH 2P6JA 1WR2A 2NU7B 3L4JA 4DR3H 4HZ3A 2HGWA 5L3EA 2GV9A 4O83A 4FLUA 2Q5ZA 4CS2A 4Z2WA 2AU0A 1P7GA 5LL6Y 4JZ2A 3KREA 1YTFB 2N05A 1I5YA 3CX5F 4EBDA 1BSMA 4I50F 3QTCA 1RYRA 5JH7B 1JDEA 2HJDA 4MV8A 3PW2A 2H3OA 4O7RA 3L71H 2CK3G 4QNHB 3RBEA 4GKJB 1CEZA 4JXUA 2OCCB 4P30A 5BYAA 3L9DA 3VQYA 1E79G 2W6QA 1A3GA 4FLYA 2FLPA 3ZHRA 5FL7G 4O3RA 5GTIZ 3M99B 3BY6A 1Y6XA 4MVUA 4O3NA 4O3SA 3WB2A 1A0GA 4MV4A 4MVSA 2RDIA 1MSWD 4Q44A 2DABA 2XAGA 4I0XB 1M56C 2HKOA 2MCTA 3LWBA 1KBHA 1IX9A 4JI6O 4OGQB 2XAJA 2CAZC 4RAZA 4B3TO 4XYLB 5K2MA 4D7SA 5C1OA 1GYFA 1VF6A 5KFTA 3R23A 2Z5UA 3LP8A 1NT2B 1ROPA 2BOBC 3K06A 5LP6F 2XAHA 1RSOB 1P8LA 4JI5H 1BT8A 2HEPA 2ZIOA 2WAQE 4N21A 1Y4MA 3H0GG 2HHHB 1NR1A 1ZQ7A 4I50A 1CE8A 2Q6AA 4DR1B 2CNQA 4LP8A 2HHHO 1XNRO 2Y0PA 4TV8A 4LF4B 4A3MG 1ZWIC 4PI0A 4J7JA 2ATKC 3JAMN 1D5AA 1RK6A 4LFCH 3HKZA 2UUBB 2WLLB 3N2KB 1I2KA 3ABKC 5DGBA 1VQ5V 5FNVA 1YHQV 4UV8A 4X65B 1WSCA 1V9PA 5T14A 4JYCA 3F7VC 3I4NG 1OCOB 4J9PA 2LJ2A 4ZHQA 1GSOA 3KYHC 1S03G 4PZ6A 3HKBB 1QVGU 1SERA 1XHZA 4TV8F 3TY9A 3PN1A 4I4TB 1HNWO 3HO8A 4ECZA 1TWFA 3JD2A 1FD9A 2VQEO 1HNWB 4H13B 4DRXA 3B09A 3RB6A 1ZL8A 2CGNA 3OFNG 4MT8A 4LFAB 2I8CA 5HV6A 3FX7A 3NBZB 3GV5B 2F4VO 3FFQA 4YIOA 3L75H 1H2KA 3GTJA 5JQGA 2FP4B 1GN3A 5KT3A 2UUBO 3ZMZA 2ZJTA 4CMDA 5KFWA 1QNMA 2R87A 3GTOA 5BWTA 3ZRXA 2NUAB 3CS5A 1A48A 4NKGB 1RJQA 1N32H 3VPBA 4C7UA 4U7OA 2W9CA 2Y0SA 4JI8H 2R70A 5B3SB 5DAAA 4OPHA 1V55B 1GMGA 3OR6C 3N6RA 3FB7C 3JAMW 2W9BA 4UV9A 1PL0A 4RZRA 3CRCA 4DK1A 1W59A 4Q45A 2WA3A 3K57A 1GTOA 3RB4A 1OCCB 5JUMA 3TW6A 3SYPA 4I50B 5DN6G 1CKOA 3JATA 2LGQA 5KFQA 1QU7A 3DGEA 4CH4A 1F7YA 1TWAA 3MR5A 4BIOA 3D36C 2ZE7A 3ASNC 3KZIZ 5CB4B 3O9OA 4MV7A 4O7VA 4JI0H 2PF4E 4DV7B 4CH3A 1R3KC 3AK1A 3IC9A 3LSQA 1UC9A 3GILA 2W8LA 3EPIA 3U55A 1RJPA 5IT9W 5KUKA 5BZBA 1FPOA 5F2VO 4B3TB 4Q4CA 3GTGA 4ZOLF 3EHBB 4FFMA 4J9KA 3FB6C 4M0JA 1EUDB 5C4XG 3K3WA 2UUCB 3K5HA 5BY1A 1ORQC 2LW7A 1WJZA 2EJ7A 4DK0A 4JYYA 1GGOA 1HR0H 2H8PC 1OZ0A 2ZM6B 5KLVH 4ED7A 5LYJA 3HKCB 5EIBC 2VWJA 3ABMB 3R5HA 2PN1A 1Q90D 2C2EA 2VS0A 1RJRA 4O4HB 3OTOH 4DL4A 4FFRA 3HKZE 4MW8A 4R6ZA 3BACA 3TQ1A 2YIAA 3PO3G 4IL6Z 3MHSC 5IWAH 3ZX6A 1QLEC 1K73W 4QJFA 5LXTF 2R8IA 4ZBMA 1Q6IA 3SPCA 1B04A 4UCTA 2DOSA 5CN0A 1N8RW 4UB8Z 3PW5A 4QWAA 4IRCA 1P16A 4LF9O 5CBGA 2FLNA 4QJFB 5KFKA 4X65H 4RB2C 3GTPA 4O4JA 3RT3C 2PI5A 3WB1A 4TQRA 3M8AA 3I55V 2EINC 1M57B 3W5OA 4B3SO 2HG5C 4DV4H 4F4YA 2BQ3A 4DV2O 3BQ2A 2W7PA 4QWCA 3GIMA 3TEKA 3KAJA 1WCMA 2ZR3A 5LOVA 3HPLC 5LHIA 3SPGA 1K83A 1RPRA 2R9AA 1S0VA 5JVDB 5KFJA 3E8BA 1OBGA 2R8KA 4UCUA 3GTKA 5BR8H 2YSUB 1S9FA 2NVXA 1K8AW 5KAIZ 1DK1A 3RWRD 3QQMA 1EKVA 3K3PA 2QWNB 4JI4H 1AVMA 1R3LC 5KFAA 5CA0F 3W1BA 4PDBA 2VOBA 3RGZA 2XD4A 4BR6A 3DTUB 2AXTZ 2HVJC 5C3EG 1SZXA 2WLIA 2F93B 3CCSV 2UXCO 2W8KA 2HJFC 1YXBA 3WFVA 1B06A 2FPPB 2R7MA 4ASUG 5KKNB 2UU9B 3AG2B 3C0FB 1AJPA 1GO3E 4FGRA 2VQFB 3K5NA 4MV1A 2H94A 1TUBB 2IJIA 3ORRA 1WP7A 2CNVA 4ED0A 1IDSA 4PA4A 1XQ8A 5LGUA 3JD0A 4RAYA 2FMLA 3H9VA 1IBMO 1I2LA 3PJSK 3T9FA 3MHHC 1VQNV 1ET0A 1PK8A 2D2CB 4FU0A 4MSWC 2P4KA 2JA6G 2W9BB 1OBDA 3APQA 2JGDB 1KBLA 5KFVA 3D8CA 3K04A 3OT7A 1GRJA 4WBNA 1KP3A 4KL1A 4A3KG 3Q8QB 1UFIA 4O4HA 4DR3B 5C8YF 1G2WA 2KSWA 2WA4A 5IWAO 3AG4C 5LXTB 3MAQA 5K3WA 2B63G 2Q7EA 4HNAA 4AI8A 4X66H 2QWOB 4MW3A 3NGDA 5KHJA 4PHZA 3MR2A 2UXDH 2R86A 3SPJA 2BOCC 4JAAA 4W4LA 3LQSA 5KT5A 4A3CG 1SKVA 1GM7A 3VQXA 4ZKIA 2K9PA 1S5LZ 1SESA 3WWJA 5BMVB 1VKZA 1B6SA 1UNNC 4X64H 1FJGO 4W4KA 4IIJB 3H40A 5KFUA 4IIJF 5KMGB 2AGQA 4YY3H 3OD4A 3CSXA 5TISZ 1OWTA 2EZOA 4J11A 5BMVA 5LOVF 3UQ8A 3RV4A 1XMOH 3ZMTA 5LP6B 1VQOV 3G80A 4ZI7F 4H0LB 2IW5A 2VRZA 3K9SA 3H1KH 1HNXB 1LNQA 3H1LH 4C5AA 2WB1E 4B3SB 4FE2A 4D6TH 1HDJA 4O84A 3JD4A 4FFKA 2UXBH 3NUAA 4NR1A 3DXRA 2UVVA 4DR2O 4LSXA 3OUFA 4LWSB 2GTSA 3PW7A 4X66B 1VS0A 4P2ZA 4R50A 4R7RA 3RYIB 1SQQH 3HKCA 4FJCC 2ZE8A 1IBLB 4OX9B 4ME6A 2HHHH 1TGOA 1PKXA 4IGGA 2K1EA 4QIWA 3TW7A 3WWIA 2HJWA 2W71A 5IYDO 3FYEB 3OHAA 5KFHA 2OIEA 3DXRB 1N33B 1FFXA 1VQ7V 3ZHUA 3K03A 2OCCC 2E2HA 3CRRA 4FFNA 2JS5A 2YUAA 3E8FA 5A2QN 3RR5A 4I0XA 3GDEA 5C44G 1M93A 2FJZA 1HNXH 4J7KA 4PDRA 2QDOA 1YEWA 1X59A 1Y1WG 4DL6A 1FS0G 1MOFA 5KMGA 1NBMG 5J2UA 4LFBH 2KG7A 1A9XA 3CC7V 4IHJF 4CKEA 4J9YB 3G8CA 5DQIA 4J0MA 4B3RB 1MNGA 2HHFB 4PZ8A 4LMYA 4WFGA 5IP7G 3ZBHA 2BCCH 1KJ9A 1VF7A 4DXWA 3QZ7A 2IH3C 3JYCA 1X9NA 2EX3A 2UXDO 4KHPO 2P06A 3CXCU 3G67A 5BR8B 1HNZH 4DR2B 3T4DA 2OWOA 2AHZA 4PV1B 1M5IA 4RUCA 4A2AA 5BR8O 4JYAB 3QG5A 2DPJA 3NR7A 4A3IG 2P22C 4EFEA 3FD9A 1MZFA 1Y1VG 1UPGA 2GPSA 1RPOA 3TCUA 3JALB 4DUYH 2XUMA 4A3JG 5KT7A 2ALZA 2I80A 1FJGB 4LH6A 2ASJA 1FVIA 3ZJZA 1WCMG 4YAKB 5KFSA 1OJHA 4DW0A 2BSKB 4UCSA 1GLVA 3LNMB 3TK1A 2VWKA 3NXSA 2P5OA 2Q0OC 3E89A 2VA3A 2W0FC 1S0OA 3R66A 4LSAA 3VQWA 5LMNH 1YITV 2EJRA 2GPWA 2YIBD 3JCUZ 5CA3A 3H1HH 2HFEC 2MK3A 5JH7A 1TWGA 3QF7A 3TXQA 2Z02A 2WLLA 4DUZH 3OAAG 1Y76B 3CJHA 5CM0A 1I7NA 4I7HA 5J2UF 4DV5H 5ITZB 1CS0A 2PUSA 4QE9A 4J9MA 3CP1A 4QPJA 4TT3G 4Q8FA 5AG2A 2ZNJA 4CKBA 2FL4A 4QIWE 4O4IF 3KHGA 1VEWA 2HVKC 4LCUC 2UXDB 3QNEA 2X7RB 1Q43A 3K5IA 1XNRB 5KX5A 1Q8IA 4LF7B 1VBHA 2GBOA 2DN9A 4E4TA 4BXXG 1E4FT 5BWVA 3X2QC 3B77A 2CGOA 1E1QG 3WO1A 5JH7F 1WB8A 1AR4A 4QIWF 2B1GA 5HFLA 4DV1H 3AG3B 2QWPB 3O65A 4JV2A 4CS3A 4JTAB 2VUMG 2Q7HA 1ZLZA 1BGYH 4FM9A 4ZHQB 4LFAO 2J9GA 2L35A 1MMMA 3Q1KA 3W7XA 1H2SB 3ABMC 4MTEA 4I55A 2ASLA 1TUEB 2W6IG 4YJ3A 3J81W 3V6JA 1N0NA 2HGXA 2CDYA 1L8DA 1K5QA 4C5BA 1DAAA 2AGOA 1HR0O 1ZL8B 4DR4B 4UVBA 3MFHA 3GLKA 3JZIA 1OCRC 2W70A 3TY5A 3FYIB 2YS7A 1QLEB 2EIMC 2QR4A 4KXRA 1KKCA 5LMUO 1SQBH 4GYCB 1CKMA 3H3VH 3AG3C 1O75A 1SC5B 1L0NH 4RUAA 1R1BA 3RBZA 4DR1O 2UXXA 3RYFB 3UO3A 3VQVA 4WD3A 2DZDA 4I9WA 5IJ0A 4X1IA 2YYAA 1NI8A 1D2DA 1XNQB 1GN4A 2QF7A 2ZCEA 3FMAA 3SI8A 3JRWA 1T36A 2A7WA 4TM5A 2EILC 4KUMA 2VQEB 5ITZA 4J80A 4LF9H 4DR7H 5BPHA 4D7TA 5A2QW 2VUGA 1JX4A 2AW9A 4JI5O 4MTDA 4TUYF 1JVMA 2B63A 2Z04A 4Q6GA 5LA6F 3C3TA 3AG1B 1KC7A 5KT2A 5KAFZ 2ODMA 2X6BA 3ETGA 2FB5A 4HNAB 3K58A 3P3NA 3K5LA 2YS6A 4WCEV 3T2MA 1M90W 1QLNA 2EZPA 4GLWA 4O82A 1GH6A 2NR5A 3BHPA 4JI8B 5I5SA 1S3JA 1XDCA 3VA7A 4AYBA 5J2TB 3G6VA 2VUMA 2HP8A 5H2FZ 5L1KA 3HKEA 1YVWA 4YJ2A 3ETHA 3WU2Z 1S0MA 3ABUA 4GX5A 4ZI7A 4FM1A 2IM9A 2HG8A 4JI3B 3C3SA 3HKEB 3KCYA 1EHIA 4LF6H 3OMAB 4Q4DA 1IBKH 3SGIA 4JI3O 1WLEA 2Q67A 4GKKH 5J2TA 1UJWB 4GCZA 1H38A 4FFLA 4EB6A 4MVZA 2P67A 2YXLA 3P32A 3OHBA 1NTMH 3CRMA 3QO5A 4I55B 5KG3A 1XOUA 3OR7C 3WB0A 3ZIAG 3TGUH 1BQ0A 3TY8A 4ED1A 4MTOA 2UXBB 4PJ0Z 1R6NA 1W0JG 4X1YA 2OYQA 4B3MH 5IYBG 4EFBA 1AR1B 1SZTA 1TWCA 4WBNF 3V4ZA 4O81A 2E76B 1KTAA 5FLMG 4K8ZA 4RU9A 1N34O 4NZMA 4UXNA 1XMQH 5CA1B 4NTXA 3UCSC 1IXMA 4MTFA 4H44B 2O03A 3E8GA 3SR2C 5L3BA 2EILB 3WWHA 4M9UA 3JD3A 1T94A 3H1JH 3VPCA 1NTKH 2ZINA 2DPIA 3EXAA 3EVKA 5GONB 2IU0A 5CA1A 1YDXA 2O57A 2X0LA 5KT6A 2YXYA 1DIKA 1KECA 1N4CA 4DR7B 3RJ0A 1BGWA 4ECYA 2X5RA 1IYEA 4KHPH 1WA8B 1R6TA 3CB2A 3UFXB 3CE2A 2E75B 4JI5B
chains in the Genus database with same CATH topology
4ZOLA 5EYPA 4K0KH 4O4JA 4LF8H 4DR5H 5C8YB 4JI2H 3WB1A 3S24A 3JSNA 3W5OA 3N40P 3RYCB 3VNNA 5KHHA 1ZHSA 4DV4H 4A2BA 4B3RH 3CHXA 3KAJA 5LOVA 2F66C 4X62B 1XHXA 1JJOA 2R9AA 5JVDB 4O4LA 4RB3C 4UCUA 5BR8H 1M0WA 4YJ2B 2WE6A 1XK5A 4TV9B 2E3CA 3DF7A 4LF6B 3RWRD 4JYAH 1CKNA 4IHJA 1N32B 4JI4H 2HIXA 1I6UA 4TQDA 3W1BA 1IBKB 4PDBA 2VOBA 3RGZA 1J5EB 3JALA 4NXMB 2F93B 5IWAB 5LXTA 3RYHB 3UT5B 5JCOC 2UXCB 2UU9B 4X1IB 5D5PA 3C0FB 3DSQA 2VQFB 3K5NA 3UT5A 1TUBB 3BA8A 4X20A 3A2FA 1FJGH 1IBMB 3N2GA 2UUCH 2BTQA 1XQ8A 4RAYA 4BWSC 3JATB 3JARA 4O2BB 4U3JA 5FD6A 5J2UB 2UUAH 3HKDA 4FM0A 3BABA 4EQ5A 4WBNA 4KL1A 4ETSA 1HNWH 2JGUA 4KHPB 4APMA 4DV2B 3RGXA 4O4HA 4DR3B 4GKKB 2KSWA 4K0KB 5LXTB 3MAQA 2Q7EA 4TV8B 4HNAA 4X66H 2F95B 5D5QA 5KHJA 4NXMH 4PHZA 2UXDH 3IAYA 2HIVA 1SKVA 3VQXA 2VPSA 3J80W 4X1KA 3SJAC 5EZYA 5BMVB 4X64H 4O4JB 4IIJB 1QHTA 5KMGB 5LP6A 3KXYT 4NXNB 4YY3H 4O2BA 4DV0H 3CSXA 1A0IA 4FLXA 2BTOA 5BMVA 3UQ8A 1XMOH 1IBLH 4OX9H 5LP6B 1DGSA 3SJBC 1Q3EA 1FKAH 4BWAA 1HNXB 4DV4B 4YJ3B 1JFFA 4X64B 4B3SB 4NXNH 4DR4H 4RZQA 2UXBH 3NBYB 4YY3B 3OTOB 2HVRA 4ZOLB 4X62H 4LSXA 4DR5B 3B2EE 5FPRA 5C8YA 5DISC 4B3MB 4YHHH 4BW9A 4X66B 1VS0A 4FM2A 4R7RA 3RYIB 3HKCA 2HHHH 1XMQB 1IBLB 4OX9B 1TGOA 4O2AA 3L4KA 5FD5A 1KMIZ 4JI4B 4DV5B 4IHJB 1Z2OX 2FE3A 4DRFA 5LA6A 4B3SH 3BRCA 3ZEDA 1N33B 1FFXA 4GKJH 3NC0B 2E5LB 2QJ1A 3M4IA 3F8NA 1Z5VA 1ZAUA 2JS5A 4F6RB 3RR5A 4DR6B 3GDEA 2PYJA 5K1XA 5LYJB 4O4IA 1M93A 2PZSA 1KU9A 1HNXH 4RB1A 4LFCB 1YEWA 5IJ0B 5EYPB 1FFXB 3RTXA 3BAAA 5JJNB 1HNZB 5KMGA 3E22B 4DV1B 2Q2UA 4DV6H 5CA0A 5J2UA 1I94H 4LFBH 4O4LB 2RGVA 2JVDA 3JAWB 2UU9H 4J0MA 4B3RB 3HKBA 5KHGA 4PZ8A 4LMYA 5GONA 3RYIA 2RGRA 5IYZA 1TUBA 4JV5H 1VF7A 4DV0B 3N2GB 4LF5H 1X9NA 1Z2NX 2EX3A 2RJZA 4DUZB 1M4UA 4JI2B 3K5OA 3RYCA 3U11A 5BR8B 1HNZH 4HBNA 4DR2B 2OWOA 4DV7H 2F4VH 2HGSA 2HVQA 2E5LH 1M5IA 4A2AA 4JYAB 2PGGA 3QG5A 1S5JA 2P22C 4EFEA 1WNSA 1X4TA 4DUYB 2ZNIA 3MWMA 4DV3H 2YI9A 4JI3H 2CW7A 4DV3B 4DUYH 3IG0A 3JALB 2CW8A 1Z2PX 1SA0B 4L8JA 2R72A 1FJGB 4LH6A 3E22A 1FVIA 4UFZA 4E6NA 5LMUB 4EEQA 3T1HB 4JI1B 1T5EA 4LNUA 3K3VA 4UCSA 3T1YB 4DR1H 3JARB 2VWKA 4ZIBA 2P5OA 3ETQA 4FVMA 2YIBA 4LSAA 3VQWA 5LMNH 4TOIA 2YIBD 2VQFH 2ZIMA 5JH7A 2V4DA 5IYZB 4Q0YA 3QF7A 4YHHB 3ICXA 3M7MX 4DUZH 5JJEB 1XMOB 4JI0B 3JSLA 5D1OB 4I7HA 4DR2H 3KALA 1TVKB 4AHCA 4DV5H 4I4TA 5ITZB 3RFRA 2PY5A 4RB0A 3RIZA 5LL6b 3JAWA 2PUSA 5LMNB 4UCOA 4U3JB 5IJ9A 1N33H 2ZNJA 4GLXA 4FLZA 4CC5A 4LFAH 3N43B 4TV9A 3L4JA 4DR3H 2UXDB 2Q2TA 1Q43A 2GV9A 4LH7A 1XNRB 2HVSA 5KX5A 1Q8IA 4FLUA 4LF7B 4CS2A 5JJJB 4LR3A 1E4FT 4EB6B 5CB4A 1QQCA 3QTCA 1JMKC 5JH7B 4NVPA 4LF4H 1L2ZA 1J5EH 1MZBA 3K59A 4GKJB 3K5MA 4DV6B 3VQYA 1I94B 4DV1H 4FLYA 5KHIA 2YI8A 1Q5OA 5CA0B 4CS3A 5KHKA 4JV5B 2Q7HA 3RF2A 4FM9A 3WB2A 4ZHQB 2Q0AA 2MCTA 1H2SB 3LNNA 2W57A 4MTEA 4I55A 2CAZC 1I7FA 4RAZA 4FFBA 4YJ3A 3J81W 4LFBB 1L8DA 4D7SA 5EOYA 1GYFA 2UUBH 4DRXB 4UCRA 1HW7A 5FLXW 4DR4B 2KKWA 1NT2B 3N44B 4IIJA 4FLWA 3TY5A 1P8LA 1N36H 4JI5H 2HEPA 2ZIOA 3QWUA 4PZ7A 4TUYA 2HHHB 1N34H 4I50A 4ZI7B 4GYCB 5EIBD 1CKMA 2ZM6H 4DR1B 3RGBA 4AQYB 1O75A 3CVZA 1S68A 4TV8A 4LF4B 4B08A 4X20B 4PI0A 4PI2A 3THOA 5D1PA 3RYFB 1D5AA 3VQVA 4JI7H 4LFCH 2UUBB 3N2KB 5IJ0A 4X1IA 5JVDA 1JFFB 2XIGA 5FNVA 1XNQB 4X65B 1P49A 1V9PA 5KX5B 4LF5B 4JI1H 2Q7GA 2ZCEA 3FMAA 4ZHQA 1XI1A 4LF8B 3KYHC 1S03G 4PZ6A 3HKBB 1WN7A 4WBNB 1HR0B 1WPBA 1XHZA 3TY9A 3JAKB 2VQEB 1AN7A 1WH2A 3U0ZA 3PN1A 4I4TB 5ITZA 4LF9H 4LNUB 3J7AK 5LP6C 4DR7H 3HKDB 4D7TA 5A2QW 2VUGA 4CC6A 1HNWB 4MTDA 4DRXA 4Q6GA 4O2AB 4LFAB 2QM4A 1SA0A 3N6XA 3NBZB 1RSOA 3FFQA 4X1KB 5JQGA 5K1PA 3BA9A 2XHBA 4HNAB 3K58A 3K5LA 2ZJTA 4M7EA 3GJXB 5FNVB 2F1MA 1N32H 4K8XA 3RYHA 4JI8B 3BHPA 1Z5WA 4JI8H 2R70A 5J2TB 3RYFA 3N2KA 3JAMW 4DK1A 3HKEA 5LMUH 3K57A 4YJ2A 3JAKA 2PTMA 3EYYA 4I50B 4ZI7A 2BTQB 4FM1A 2IM9A 3GB8B 4JI3B 4IAJA 1SQGA 3HKEB 3JATA 1CKOA 4LF6H 1IBMH 4FLTA 3SGIA 1IBKH 1XNQH 4LF9B 4CH4A 4GKKH 2YCHA 5J2TA 4EB6A 5CB4B 3JASA 2WYOA 4MV7A 4JI0H 4DV7B 2F4VB 4CH5A 4CH3A 5D1OA 2YXLA 4O4IB 4MV9A 4I55B 4AQYH 1O9GA 1M0TA 4JI6B 3WB0A 3LMLA 4FFBB 4JI6H 4JI7B 5IT9W 3SJCC 1SQFA 4F6RA 4B3TB 5JQGB 2RQ6A 5IJ9B 3TY8A 4DV2H 4TUYB 1O9HA 2UXBB 2UUCB 1CKNB 4X1YA 2OYQA 3HXLA 3L2PA 4B3MH 4EFBA 4DK0A 1TVKA 1XNRH 4CS4A 5LA6B 5EZYB 1N34B 3N41B 4TQFA 4K8ZA 1HR0H 1G6UA 2ZM6B 5JCOA 2CFMA 3W1GA 5LYJA 3H20A 3HKCB 4LF7H 1XMQH 5LOVB 5EIBC 5CA1B 2VWJA 5FPOA 1XDNA 4B3TH 4DR6H 3U10A 3KAKA 1N36B 4O4HB 2PYLA 2O03A 3OTOH 3SR2C 1TAEA 2WDTA 2UXCH 3T1HH 1SYXB 2ZINA 2YIAA 3OTFA 3BPZA 3JASB 1BJTA 5IWAH 3T1YH 4AILC 1TA8A 5GONB 1E4GT 2VQEH 2UUAB 5CA1A 4FLVA 1SEIA 4X1YB 4DR7B 1B04A 4UCTA 1BGWA 3RJ0A 1ZHQA 4KHPH 1P16A 3N42B 4CH6A 3CB2A 4UCVA 3ZS8C 4I9QA 4X65H 4JI5B 4RB2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN1 A;  1HNX B;  1XMO B;  4DV4 B;  4JI0 B;  3JSL A;  4X64 B;  4B3S B;  2VUG A;  5D1O B;  3S24 A;  4CC6 A;  1HNW B;  3JSN A;  3W5O A;  3NBY B;  3VNN A;  4YY3 B;  3OTO B;  2HVR A;  4LFA B;  4DR5 B;  5FPR A;  5DIS C;  4B3M B;  5LMN B;  3NBZ B;  4UCO A;  4X66 B;  1VS0 A;  1XMQ B;  1IBL B;  3BA9 A;  4OX9 B;  4GLX A;  4CC5 A;  4X62 B;  4JI4 B;  2UXD B;  4DV5 B;  2Q2T A;  3GJX B;  4UCU A;  4LH7 A;  1XNR B;  2HVS A;  4DRF A;  4JI8 B;  4LF7 B;  1XK5 A;  1N33 B;  4LF6 B;  1CKN A;  3NC0 B;  2E5L B;  1N32 B;  2HIX A;  3W1B A;  1ZAU A;  1IBK B;  1J5E B;  3GB8 B;  4JI3 B;  4NXM B;  4DR6 B;  3GDE A;  3RR5 A;  4GKJ B;  1CKO A;  5IWA B;  1I94 B;  4DV6 B;  3SGI A;  4LF9 B;  4LFC B;  2UXC B;  2UU9 B;  3RTX A;  3BAA A;  1HNZ B;  4DV7 B;  2F4V B;  4JV5 B;  5D1O A;  2VQF B;  4DV1 B;  2Q2U A;  3BA8 A;  1IBM B;  4JI6 B;  4JI7 B;  4B3T B;  4B3R B;  4PZ8 A;  3TY8 A;  2UXB B;  4DV0 B;  2UUC B;  1CKN B;  1X9N A;  4LFB B;  3L2P A;  4DUZ B;  4EFB A;  4JI2 B;  3BAB A;  4EQ5 A;  5BR8 B;  4UCR A;  4DR2 B;  2OWO A;  4DR4 B;  1N34 B;  4KHP B;  2HVQ A;  4DV2 B;  4JYA B;  3TY5 A;  2ZM6 B;  4DR3 B;  1P8L A;  4GKK B;  2CFM A;  3W1G A;  4K0K B;  4EFE A;  5FPO A;  1XDN A;  3QWU A;  4DUY B;  4PZ7 A;  2HHH B;  4DV3 B;  1CKM A;  2HIV A;  1N36 B;  4DR1 B;  4AQY B;  4LH6 A;  1FJG B;  1TAE A;  1FVI A;  4UFZ A;  4E6N A;  1S68 A;  5LMU B;  4EEQ A;  4LF4 B;  3T1H B;  4JI1 B;  5D1P A;  2UUB B;  4UCS A;  3T1Y B;  4NXN B;  1XNQ B;  1TA8 A;  4X65 B;  1A0I A;  1V9P A;  2UUA B;  4LF5 B;  3UQ8 A;  4TOI A;  4DR7 B;  4LF8 B;  3KYH C;  1B04 A;  4UCT A;  1DGS A;  4PZ6 A;  1P16 A;  1HR0 B;  4UCV A;  4YHH B;  3TY9 A;  2VQE B;  4JI5 B; 
#chains in the Genus database with same CATH topology
 4K0K H;  2EIJ C;  3ZRV A;  2VR1 A;  1F4M A;  2E74 B;  2ZDI C;  1KQS U;  4FK5 C;  3N40 P;  4ECV A;  5CMU A;  4JAV A;  4QWB A;  3BCC H;  3CHX A;  3ZMU A;  4BAY A;  1LR1 A;  5IYC O;  4X62 B;  1JJO A;  2UUC O;  3LUL A;  5EWE A;  4R8C A;  2ZDQ A;  4A3F G;  4RB3 C;  4YJ2 B;  3WG7 B;  5CR5 A;  2DQ3 A;  4TV9 B;  2ZGI A;  2E3C A;  3DF7 A;  4LF6 B;  1GM9 A;  1N32 B;  2BQR A;  1VP7 A;  1EN4 A;  1I6U A;  4TQD A;  5DQG A;  4WFE A;  1JXL A;  3V6H A;  2WTF A;  1JJ2 U;  3OSN A;  4NXM O;  4F6E A;  2UXC B;  3FAV B;  3RW0 A;  4RAI A;  1Y1V A;  3DSQ A;  4FMT A;  3UT5 A;  1IOV A;  2JEG A;  4ED3 A;  3BA8 A;  1N48 A;  4MTG A;  1K3E A;  2BTQ A;  1H2L A;  2X0S A;  4F4Z A;  5L3G A;  3JAT B;  2W6Z A;  3QZ8 A;  2QSA A;  2OT5 A;  5C5J A;  5FD6 A;  1BHB A;  2WLM A;  2UUA H;  3OUS A;  3T1C A;  5KFN A;  1VIB A;  2VQD A;  3ZHQ A;  3ETD A;  3T9C A;  2JGU A;  4KHP B;  4APM A;  3I56 V;  4DV2 B;  4J10 A;  3ABK B;  1COW G;  3VBB A;  5B66 Z;  3CQZ A;  2ITD C;  1OV9 A;  2WSS G;  3MR3 A;  2EIY A;  3DC5 A;  4XBF A;  2A1H A;  3RBD A;  3LDC A;  4JF3 A;  4F4X A;  2F43 G;  5IY5 B;  4O7T A;  4UUG A;  4K35 A;  2VPS A;  4DUY O;  4TVI A;  3HB9 A;  4F4W A;  1WPX A;  1KC8 W;  4XYM B;  2QWQ B;  3OE7 G;  1RYS A;  4RUE A;  1EZ1 A;  3DTF A;  2R93 A;  4O2B A;  2A9H A;  3APO A;  2BTO A;  1M6V A;  5BMV F;  3HOW G;  4DAA A;  3CCE V;  1J95 A;  4MV3 A;  1DGS A;  4GZR B;  4PDM A;  4J9L A;  5I47 A;  2DYS C;  3F7Y C;  3K9A A;  1V4Y A;  4MV6 A;  3I5D A;  4RQF A;  1IOW A;  4CKC A;  4YJ3 B;  5IY5 C;  2R84 A;  1SFO A;  4MVM A;  1YF2 A;  5CE8 A;  2M6Y A;  4JAU A;  4YY3 B;  3OTO B;  2FKL A;  4X62 H;  2Q9L A;  5C8Y A;  1KT8 A;  4YHH H;  5GW7 A;  4JYA O;  2R82 A;  2HHF A;  2A06 H;  1VQ8 V;  3DTG A;  4FM2 A;  1OCC C;  5KG0 A;  2YU9 A;  5B1A B;  3ORQ A;  1KB9 F;  3L4K A;  5EWG A;  1KMI Z;  1YJW V;  1AUX A;  2OTJ V;  3BG5 A;  4QW8 A;  3GVM A;  1Z2O X;  3AW8 A;  3CCL V;  1L0L H;  1R9T A;  4DRF A;  4MA0 A;  1E1R G;  2YXH A;  1XUQ A;  1ARO P;  4JI1 O;  4GX2 A;  1GM8 A;  4QSH A;  5DQH A;  5CB4 F;  4NZO A;  2QJ1 A;  5DED A;  3M4I A;  1Z5V A;  1FXK C;  2W0X A;  3RN4 A;  1XL6 A;  2XC9 A;  2P90 A;  4HNT A;  5LYJ F;  2R8J A;  1IVS A;  2IBZ H;  2ITC C;  2XCA A;  5K1X A;  2ADQ B;  4TV9 F;  4O4I A;  2PZS A;  1JA8 A;  3KTM A;  3GIQ A;  2CTQ A;  5FNV F;  1HNZ B;  4ED2 A;  4GX0 A;  1Q7Y W;  2FYU H;  3G6Y A;  4DV6 H;  1I94 H;  3SYC A;  3SNO A;  1EBO A;  2C2D A;  2R7N A;  3M9N B;  2RGV A;  3JAW B;  5KA5 A;  1DV2 A;  1I1K A;  3HKB A;  4BW5 A;  1TUB A;  2Q8V A;  1FXK B;  1I08 A;  4DV0 B;  3N2G B;  5C93 A;  1FXH A;  4LF5 H;  4A93 G;  2RJZ A;  2JDI G;  2WWW A;  3K5O A;  4JPR A;  3RYC A;  3JD1 A;  2HGS A;  2LP7 A;  5E1A C;  4FFP A;  2E5L H;  1P84 F;  2DLN A;  1KYO F;  1QR9 A;  2JA7 G;  4J9Z B;  2IJJ A;  1S5J A;  2ZDG A;  2UXN A;  2C35 B;  1V54 B;  4DUY B;  2ZNI A;  1EZV H;  2YI9 A;  4JI3 H;  2CW7 A;  5KUM A;  3J81 N;  4UFZ A;  2OCH A;  1Q82 W;  3AK3 A;  4AQY O;  5DG7 A;  4PD4 F;  4DR1 H;  3R9R A;  2GUZ A;  5D8D A;  4G28 B;  4ED8 A;  3JAR B;  4ZIB A;  4FVM A;  4L1K A;  3I12 A;  4XDJ A;  4A3E G;  3PW0 A;  1NQT A;  4Q20 A;  1XNQ O;  3G6B A;  2LFR A;  3DC6 A;  2V4D A;  2WAM A;  4Q0Y A;  4YHH B;  3M7M X;  4QPK A;  1XMO B;  3ZMS A;  4JI0 B;  3JSL A;  4U6P A;  4GUN A;  2JIZ G;  2AZ2 A;  2EIM B;  3F5T A;  4I4T A;  4DR4 O;  2PY5 A;  1IBL O;  4OX9 O;  3RV3 A;  3T99 A;  4UCO A;  1AB3 A;  4O3P A;  2Y4U A;  4U3J B;  4DYL A;  1WA8 A;  5IJ9 A;  1NU1 H;  1PX2 A;  4FLZ A;  3PR4 A;  2J6T A;  2RN9 A;  1S5H C;  4CMF A;  3OGI B;  2R93 G;  3E8H A;  1VAR A;  5B5E Z;  2HVS A;  3ETE A;  2R85 A;  4EKW A;  2JA8 G;  5F9L A;  4DL7 A;  4EB6 B;  3T5J A;  1WB7 A;  4JI8 O;  2R92 A;  2XGQ A;  1AP5 A;  2UVW A;  2Y48 A;  3A0H Z;  1J5E H;  2X6C A;  1P7B A;  1DF5 A;  4YBZ B;  5J2T F;  4DV6 B;  1I94 B;  4DW1 A;  3S3W A;  4G27 B;  5BYB A;  5KHI A;  4GKJ O;  4JV5 O;  3JZF A;  2ILM A;  1Q5O A;  3ASO B;  4O86 A;  4O7L A;  4ECS A;  3G8D A;  4PDL A;  3RF2 A;  4BY1 G;  1RM1 B;  4YJ2 F;  1N0J A;  2ZE6 A;  1JIH A;  2QEX V;  1VBG A;  2OTL V;  3LDE A;  1BL8 A;  2Y69 B;  2NU9 B;  4OPA A;  2DYR B;  1JLL B;  3LNN A;  1AJQ A;  2B9Z A;  2W57 A;  1K4D C;  1K7D A;  4YHH O;  3CEB A;  3H1I H;  4PA7 A;  3PVX A;  4FFB A;  4LBE C;  5IYD G;  3LSU A;  5FJ8 G;  2C22 A;  3K79 A;  4UCR A;  2GSM B;  2KKW A;  2CNU A;  4IIJ A;  2V4R A;  2Q68 A;  2RF4 A;  1Z2G A;  2QE7 G;  3ZRW B;  1H2G A;  3QWU A;  4YAJ B;  4PZ7 A;  1EKF A;  2AGP A;  5GON F;  1N34 H;  1Q81 W;  3Q2O A;  2ZXW C;  4RNO A;  4ED6 A;  2ZM6 H;  3RGB A;  4AQY B;  5LHG A;  2QK4 A;  2RCV A;  1S68 A;  2P4V A;  3IFX A;  4B08 A;  3THO A;  4PI2 A;  4X20 B;  4JI7 H;  1W2B U;  1KD1 W;  4O4H F;  2DWD C;  3AK2 A;  1JFF B;  5JVD A;  1JOY A;  1Y74 B;  4A5U B;  4C5C A;  2XIG A;  3EPG A;  2BE3 A;  3GIJ A;  3B40 A;  4JI1 H;  3KKY A;  3FKI G;  3CCR V;  1XI1 A;  2YS8 A;  3UZO A;  5I5V A;  3W7U A;  1Y74 A;  2ABJ A;  5A9G A;  2UUA O;  2V59 A;  5KG7 A;  2WAQ A;  3HOX G;  3SPI A;  5IYB O;  3GTL A;  1WN7 A;  4WBN B;  1HR0 B;  2DW4 A;  3ZRS A;  3MWE A;  1WPB A;  4RNN A;  5B1B B;  3JAK B;  2ZKO A;  1LUW A;  2Z3Y A;  3U0Z A;  1WH2 A;  2Y0S E;  4LNU B;  4I5S A;  4DL3 A;  4YR2 A;  2CTW A;  4CC6 A;  3KHR A;  1Q6U A;  2KSD A;  2QM4 A;  4MVO A;  1SA0 A;  3N6X A;  5K1P A;  1B3Q A;  3BA9 A;  2I87 A;  4EBC A;  4H33 A;  4X89 A;  2JA5 G;  4O3O A;  5KG2 A;  2N04 A;  3G6E V;  2LO1 A;  3CCM V;  1Z5W A;  5EC1 C;  1BZK A;  3RYF A;  3S3X A;  5EBM C;  4Z1M G;  5L9X A;  4JZG A;  3EFF K;  4KFM A;  4BBR G;  1T3N A;  1DV1 A;  2WLJ A;  1K9M W;  2YEV A;  2PTM A;  3T5K A;  5B1O A;  2BTQ B;  5HBR B;  3GB8 B;  4DR7 O;  4IAJ A;  1SQG A;  2Q73 A;  1IBM H;  4FLT A;  1XNQ H;  1NS1 A;  2DIK A;  1PPJ H;  4DLK A;  4EEY A;  2V9W A;  1AJN A;  3JAS A;  2WYO A;  4CH5 A;  1PL4 A;  4O4I B;  4MV9 A;  2QM8 A;  1VMG A;  4C2M A;  2QWR B;  3A0B Z;  4AQY H;  3V4S A;  3T9D A;  2XAF A;  1O9G A;  1M0T A;  3CMA V;  4FFB B;  4JI6 H;  4JI7 B;  2IP4 A;  3SJC C;  4F6R A;  1NH2 D;  3F5W C;  4J42 A;  5B1N A;  4ECT A;  2HR3 A;  2IMW P;  5KFD A;  2RQ6 A;  1H2N A;  2RDC A;  5IJ9 B;  5E25 A;  4HYK A;  4TUY B;  5LGT A;  3P30 A;  4B7E A;  1CKN B;  2YZL A;  3MD0 A;  3LSS A;  3TJT A;  3HXL A;  3L2P A;  3HOU G;  2IBK A;  1V55 C;  4CS4 A;  5EZY B;  1JKJ B;  1N34 B;  3N41 B;  5DLG A;  1LUV A;  1M9N A;  1G6U A;  3W1G A;  4YR3 A;  3H20 A;  3K0G A;  4TQS A;  4IWY A;  4FS1 A;  1SRY A;  4LF7 H;  4EYH B;  1N36 O;  1IBK O;  2JA6 A;  1US6 A;  3U10 A;  4P9O A;  3KAK A;  1JR9 A;  1N36 B;  2PYL A;  1VQP V;  4RUF A;  3OGC C;  1TAE A;  5KFB A;  3GV7 B;  2ZQM A;  1SS3 A;  3GQC A;  3BPZ A;  5L3C A;  2Y4R A;  3RVY A;  1BJT A;  1GKF A;  2PBZ A;  1E4G T;  1CPY A;  2FLL A;  5IP9 G;  2FTK A;  3ABL B;  4A3B G;  2DYS B;  2W6J G;  4YQW A;  1IYD A;  4X1Y B;  3G4S V;  4ABM A;  2W9A A;  3N42 B;  3DAA A;  3SPH A;  3STL C;  2ZD9 A;  4FPP A;  4UCV A;  3ZS8 C;  3OUU A;  4NXN H;  3N8D A;  3RB0 A;  4ZOL A;  5EYP A;  4LF8 H;  3CPW U;  5C8Y B;  4WHX A;  3RFC A;  4DL5 A;  1PV0 A;  5DGH A;  3SDL A;  1XBL A;  3RYC B;  1HP8 A;  3VNN A;  4O7W A;  1ZHS A;  1S0N A;  3R65 A;  5E79 Z;  2BQU A;  2UVU A;  4B3R H;  5KS8 A;  3TIG A;  2F66 C;  4FBU A;  1XHX A;  2ZR2 A;  1DLB A;  3H4D A;  3ZCC A;  4BIZ A;  3L70 H;  3L73 H;  1S77 D;  5I5W A;  4PA3 A;  2QTO A;  4JYB A;  3WG7 C;  4HQ6 A;  3WNZ A;  1F51 A;  2RMK B;  1CKN A;  4JYA H;  2W6O A;  2QKC A;  5KG1 A;  2HIX A;  4QGP A;  3H01 A;  4JUZ A;  1YCI A;  2NU6 B;  4JV0 A;  1EUC B;  4QWD A;  5BPF A;  3AG4 B;  2R9I A;  3JAL A;  2AHY A;  3HR0 A;  2LQT A;  2IJH A;  4MAM A;  1I3Q A;  1AP6 A;  4KP4 A;  4WFF A;  1YZB A;  5C1P A;  4R8U A;  3RYH B;  4GX1 A;  2OH2 A;  5JCO C;  5KFP A;  4X1I B;  2ZDI A;  2VA2 A;  1U96 A;  3QVN A;  4NYK A;  4E2L A;  1S72 V;  2Z0A A;  4DO2 A;  4JI7 O;  2SCU B;  5DMX A;  4HNU A;  4R8U B;  4YP3 A;  4JV1 A;  2JA5 A;  2NN4 A;  4X20 A;  3ML0 A;  3A2F A;  1IBM B;  1S97 A;  4JTD B;  3N2G A;  2UUC H;  4BWS C;  4O2B B;  4U3J A;  1V54 C;  2R6F A;  4HR7 A;  1Y67 A;  1VQ4 V;  5J2U B;  1K97 A;  3A0R A;  3HKD A;  5CAE B;  4FM0 A;  3BAB A;  4ETS A;  3KG2 A;  1K34 A;  1EYZ A;  3RGX A;  4EGQ A;  4GKK B;  2X6A A;  4ECX A;  2DQ0 A;  3OTO O;  2A0L A;  3BEH A;  4QW9 A;  3D3I A;  1W96 A;  4RWU A;  2JJ1 G;  3Q4H B;  3SJA C;  3J7A U;  1YI2 V;  3IGA C;  4LF6 O;  4Z1V A;  5EBW C;  4IR1 A;  3OSP A;  2VPQ A;  5LP6 A;  3KXY T;  3ASN B;  4NXN B;  4J41 A;  3UO2 A;  4FLX A;  1A0I A;  3W7T A;  3T1Y O;  3BQ1 A;  3U9S A;  4J9O A;  1BMF G;  2FMA A;  1E4E A;  5H80 A;  1GN2 A;  1QR8 A;  4UUJ C;  1VQ9 V;  3SJB C;  1OCZ C;  2JEI A;  4XX0 B;  2C2R A;  5EZY F;  3G71 V;  3N27 A;  1Q3E A;  1FKA H;  4DV4 B;  4NYE A;  5KFI A;  5KFF A;  2JEF A;  1JFF A;  3W7W A;  2EUL A;  2PVP A;  1HNX O;  1JQ0 A;  4XDL A;  4MS2 A;  4DV4 O;  4J9S A;  2JEX A;  3NBY B;  3MR6 A;  4DR5 B;  4BIU A;  1Y14 B;  4B3M B;  3CEI A;  3M9M B;  4QE7 A;  4GC7 A;  3KHH A;  4J7Z A;  1M56 B;  1PNL A;  5JQG F;  5L3D A;  3T54 A;  1XMQ O;  4JI4 B;  4DV5 B;  4O7Y A;  5I5T A;  2JGD A;  5IYC G;  4LC1 A;  5LA6 A;  4A3D G;  3ASO C;  2LFS A;  1GSA A;  4YXW G;  4PWQ A;  5IDJ A;  5CBF A;  3NC0 B;  1SQX H;  3L72 H;  2WB1 A;  1CXZ B;  2XAQ A;  3VPD A;  2DJV A;  4IRK A;  1MAB G;  3F8N A;  1ZAU A;  4NZN A;  4NTW A;  3SE7 A;  2YZN A;  3FKS G;  1NKD A;  4IWX A;  4DR6 B;  1L1F A;  3BVO A;  1AI5 A;  5LYJ B;  4CE5 A;  1KU9 A;  3HB3 B;  2XND G;  4YY3 O;  2VQF O;  3TII A;  5DLF A;  5IJ0 B;  5EYP B;  1FFX B;  5JJN B;  3U0G A;  4YIP A;  3FDS A;  3HOY G;  4X88 A;  5I5X A;  4DV1 B;  2Q2U A;  3T1H O;  1AI7 A;  4ICG A;  5CA0 A;  3ZHS A;  5I5U A;  2JVD A;  3GTM A;  2UU9 H;  3ZRW A;  2C2A A;  5F9N A;  4JV5 H;  2Y4T A;  4F4L A;  4B3R O;  3UZB A;  1AI4 A;  4DQN A;  5BWU A;  5JQW A;  3E83 A;  4DUZ B;  1NR7 A;  2RNB A;  1M4U A;  1S76 D;  2R7K A;  4JI2 B;  4FFO A;  5DM6 V;  3T4Z A;  4DR3 O;  4HBN A;  1VQ6 V;  4DV7 H;  4DUZ O;  5KG4 A;  2HVQ A;  2R8G A;  3TQT A;  2ZXW B;  4X66 O;  4YJ3 F;  2B5U A;  1RK5 A;  3B8M A;  2XAS A;  1K5S A;  3PO2 G;  3HBL A;  1WNS A;  4U7N A;  1X4T A;  4DV3 H;  1C3O A;  1I1L A;  3IG0 A;  1NZ6 A;  1Z2P X;  4L8J A;  3PR5 B;  2Y69 C;  2R72 A;  3AEI A;  3E22 A;  4O4J F;  2YZM A;  4J9N A;  1M1K W;  5BWW A;  4JI1 B;  4GC6 A;  4LNU A;  1JPX A;  2ZE5 A;  4JAS A;  3AG2 C;  4K3A A;  3MWD A;  3KCX A;  2PMZ A;  3HOZ G;  2YIB A;  5CA1 F;  2XOK G;  5L1J A;  4Q8E A;  2CKZ B;  4DV0 O;  3I4M G;  3UKM A;  3V6K A;  2YL2 A;  4IYH A;  1SCU B;  2QM7 A;  3CXH F;  2OIG A;  2ZIM A;  1XMO O;  4ECU A;  5IYZ B;  2WLN A;  2IJK A;  5H6Q A;  5D1O B;  4DR2 H;  4AHC A;  5L1L A;  3HT5 A;  1SET A;  4FS2 A;  3C90 A;  3RFR A;  4TWK A;  2YID A;  3B4S A;  2Q7D A;  4TSF G;  2GTA A;  1CQI B;  2Q69 A;  2QA4 V;  5L3F A;  4G3I A;  1N33 H;  4PDV A;  3N43 B;  4TV9 A;  2YRX A;  3Q8S B;  2Q2T A;  3BJY A;  2OLS A;  3TET A;  4O3Q A;  3CJH B;  2FPI B;  4LH7 A;  1C30 A;  4O7S A;  5JJJ B;  1M57 C;  4N23 A;  4LR3 A;  5CB4 A;  2G38 A;  3RB3 A;  1QQC A;  3QFF A;  4WF9 V;  3IJ4 A;  1JMK C;  4LF4 H;  4NVP A;  1L2Z A;  4E4E A;  4WFB V;  1MZB A;  4U7C A;  1HWY A;  2ETN A;  4YB8 B;  3ZN0 A;  1ZX3 A;  3K59 A;  4LF8 O;  4PA6 A;  2AZ0 A;  2R7L A;  1CQJ B;  2CUG A;  3K5M A;  2V4Q A;  2NNU A;  1I7L A;  4Y8V B;  2CH7 B;  2YI8 A;  3CRA A;  5CA0 B;  5KFL A;  3MFI A;  1GAX A;  1W93 A;  3U9T A;  2J6U A;  5LMN O;  1THZ A;  2YC0 A;  2ASD A;  5KHK A;  4P9P A;  4JV5 B;  2UVR A;  2JK5 C;  1SQV H;  3Q4H A;  4BBS G;  3R5F A;  3CC2 V;  2Q0A A;  5KA6 A;  2DMX A;  2DYR C;  2ODT X;  5B1A C;  2JA7 A;  3E35 A;  1D5N A;  1UC8 A;  2EJ0 A;  4LF7 O;  1EFR G;  1I7F A;  5DEC A;  3FB5 C;  1IZ3 A;  5DG9 A;  2R7Z A;  4FBT A;  4LFB B;  5L1I A;  1I0H A;  3OEE G;  5EOY A;  1RP3 B;  2UUB H;  4DRX B;  1HW7 A;  4LFB O;  5FLX W;  2EJ2 A;  1N56 A;  2ZT9 B;  1KJ8 A;  2F23 A;  2C28 A;  3N44 B;  4FLW A;  1N36 H;  1KEE A;  2WLH A;  5IYZ F;  4TUY A;  2COG A;  2RDJ A;  3CCU V;  4ZI7 B;  3JZ6 A;  5EIB D;  1SF9 A;  3STZ C;  2YDE A;  2ADP A;  3CVZ A;  1BS3 A;  5D1P A;  2GHY A;  5KX5 F;  1K1Q A;  3J80 N;  2IA6 A;  2W7O A;  5IE9 A;  3E5N A;  1GO3 F;  2PMZ E;  1P49 A;  2NU8 B;  5KX5 B;  4LF5 B;  2EIK C;  5KFY A;  2Q7G A;  4L87 A;  4LF8 B;  3LUT B;  1EKP A;  2ATL A;  4DV6 O;  1I94 O;  1AN7 A;  1WAZ A;  3GV8 B;  1KJJ A;  3J7A K;  5LP6 C;  2EIJ B;  3HKD B;  3UYY A;  5GTH Z;  5LGN A;  3SJQ C;  1YIJ V;  2KB1 A;  4O2A B;  2CH7 A;  2AQ4 A;  1S10 A;  5EK0 A;  4K6N A;  2P7T C;  1QCE A;  1RSO A;  4DV7 O;  4X1K B;  2ZM6 O;  1MZE A;  1XL4 A;  2XHB A;  3ABL C;  2JS3 A;  1PM9 A;  2WLI B;  1FYJ A;  5DGI A;  4M7E A;  1EZJ A;  2V5A A;  5FNV B;  1B6Q A;  3GJX B;  1H8H G;  2F1M A;  4UVC A;  1ULZ A;  4K8X A;  2A79 B;  2V1D A;  3RYH A;  3WO0 A;  3SYA A;  4I55 F;  3N2K A;  2COJ A;  5DG8 A;  5LMU H;  1GN6 A;  2GQR A;  3JAK A;  1VQM V;  1G4Y B;  3EYY A;  4IZO A;  3T9A A;  4ECQ A;  5EDW A;  2R7Z G;  1KUQ A;  2MW2 B;  4LF9 B;  1JX9 A;  2YCH A;  5H9C A;  2LW1 A;  1BQZ A;  3ABT A;  1AUV A;  2J6S A;  4J9Q A;  5CBH A;  2F4V B;  5KFO A;  5D1O A;  4X65 O;  4AYB E;  2CE4 A;  3RAQ A;  1W0K G;  1P4R A;  4QWE A;  2V7Q G;  3JRX A;  4JI6 B;  3TIN A;  3LML A;  2C00 A;  1SQF A;  2CZG A;  3FB8 C;  1WP8 A;  5JQG B;  4DV2 H;  2R92 G;  1O9H A;  3K0D A;  3K08 A;  4B7K A;  1NVP B;  4RNM A;  1NVP D;  1GSH A;  3KHL A;  1G8M A;  1TVK A;  1XNR H;  5LHH A;  3OEH G;  5LA6 B;  1OCO C;  4EBE A;  4TQF A;  4X8A A;  4UVA A;  3E2E A;  2CFM A;  5JCO A;  1Y76 A;  1FXV A;  2D3O W;  2XTA A;  5LOV B;  4I4T F;  1MG1 A;  5BWR A;  4U3F H;  5FPO A;  1XDN A;  1XEQ A;  3M9O B;  1ENV A;  4HAM A;  4B3T H;  4DIM A;  4F50 A;  4DR6 H;  4I7Z B;  4LF4 O;  2Q4P A;  5KFM A;  3IN5 A;  2DE0 X;  3GID A;  2WDT A;  4UB6 Z;  2GLT A;  2EJ3 A;  3HOV G;  3UM7 A;  2FB9 A;  3T1H H;  1SYX B;  2UXC H;  1VF6 C;  1XRE A;  3FAV A;  3OTF A;  2YWV A;  2E2I A;  4HNV A;  3JAS B;  3ETJ A;  3T1Y H;  5EWF A;  4AIL C;  1TA8 A;  2VQE H;  1B6R A;  1PP9 H;  2UUA B;  1F23 A;  2M7W A;  4FLV A;  2KG7 B;  1NH2 B;  1SEI A;  2NVY A;  1TWH A;  4NTY A;  1DF4 A;  1ZHQ A;  2YZG A;  4CH6 A;  3A8T A;  3ZHT A;  3B8N A;  4I9Q A;  4IRD A;  2W6N A;  1VAJ A;  3OM3 B;  1ZET A;  4DR5 H;  4LWS A;  1BNC A;  1H8E G;  4JI2 H;  3T5L A;  3S24 A;  2EBO A;  3JSN A;  1BXR A;  1VF5 B;  4O7Z A;  2W9C B;  2QKS A;  3IC7 A;  5KHH A;  2ZDH A;  3D3Q A;  1MA1 A;  3T9B A;  3PFF A;  4R7C A;  3CME V;  3U54 A;  3VOT A;  4O4L F;  4A2B A;  1Q86 W;  1CP9 A;  1AR5 A;  4X62 O;  2WPD G;  2W6M A;  2QYZ A;  3VMM A;  3GIK A;  1FXK A;  2WLK A;  4B3M O;  4O2B F;  1G1X B;  2FK3 A;  3BFR A;  2GUZ B;  4O4L A;  5FR9 A;  3CCQ V;  3FKI A;  1I5X A;  2IH1 C;  5DGA A;  1OCZ B;  2LGW A;  1PD3 A;  3CD6 V;  1M0W A;  2WE6 A;  4MA5 A;  2GDS A;  1N32 O;  1XK5 A;  2BSK A;  1EN6 A;  4IHJ A;  1F4N A;  1IBK B;  1V51 A;  5FLX N;  1WRV A;  3R5X A;  1J5E B;  4IT5 A;  2DAA A;  3PW4 A;  5LBQ A;  1R3I C;  4NXM B;  2JEU A;  4GKK O;  4EYI B;  2UU9 O;  5IWA B;  4RCN A;  2FK1 A;  5KG6 A;  1K4C C;  5LXT A;  3T9E A;  2ARH A;  3UT5 B;  4A3G G;  1RM1 C;  1KKD A;  5D5P A;  2V58 A;  4JGS A;  2IU3 A;  3OUZ A;  5KFC A;  3JCZ A;  1EM1 A;  4JTC B;  4MVR A;  4EG0 A;  1K1S A;  3QO8 A;  1R6K A;  3MDS A;  3X2Q B;  1FJG H;  2FK2 A;  3GTQ A;  4WFH A;  1YSC A;  3PZP A;  2UXB O;  4RQE A;  4XZ3 B;  2Y0I A;  3JAR A;  5KFE A;  3VOU A;  1BHA A;  4DL2 A;  4PEL A;  2XCP A;  1EN5 A;  3LDD A;  4ECR A;  4DV5 O;  3H4B A;  4FZ0 A;  4EQ5 A;  1VQK V;  4O2A F;  2YW2 A;  1JDB B;  1HNW H;  2B1I A;  3W7S A;  3L74 H;  5JWP A;  4NB5 A;  2E5L O;  4K0K B;  2QKA A;  5KFZ A;  2XCL A;  4TV8 B;  1H2M A;  2F95 B;  5D5Q A;  1PNK A;  4NXM H;  2YRW A;  1IXB A;  3CC4 V;  3IAY A;  2HIV A;  3ZN1 A;  4IYI A;  3J80 W;  4X1K A;  4X9Q A;  1ZSP A;  3G6X A;  4GT1 A;  4NLG A;  5B1B C;  3CYO A;  3GIP A;  5EZY A;  2BR0 A;  4G2K A;  4O4J B;  1R73 A;  1YTF D;  2YIC A;  1OCR B;  1QHT A;  2PI4 A;  4DV0 H;  2JEJ A;  5J9P C;  1FFT B;  3BQ0 A;  3ZHV A;  1A32 A;  2QTS A;  1IBL H;  4OX9 H;  3GWO A;  3RAX A;  1KUT A;  1QBZ A;  1GK9 A;  4PA9 A;  2A3Q A;  1BCC H;  3E86 A;  4BWA A;  1I50 A;  1OHH G;  4X64 B;  3GWK C;  4DR4 H;  4K0K O;  2R8H A;  4EGJ A;  5B3S C;  4RZQ A;  3Q8P B;  2NLJ C;  2QB5 A;  5KG5 A;  1I1M A;  2JRI A;  2HDK A;  3D36 A;  1SQP H;  4ZOL B;  2HVR A;  3CSW A;  3Q8R B;  5DIS C;  3B2E E;  4XDK A;  5FPR A;  1HNZ O;  2M05 A;  1K92 A;  4BW9 A;  2EIN B;  2P0A A;  1XMQ B;  4JI4 O;  2YEV B;  2CTP A;  4O2A A;  1IUR A;  5FD5 A;  1YJN V;  5BXZ A;  4Q43 A;  1ZTE A;  1NJI W;  4IHJ B;  2FE3 A;  4YR0 A;  4B3S H;  3BRC A;  3ZED A;  3OW2 U;  1U97 A;  4GKJ H;  2E5L B;  2GQS A;  1R3J C;  1J5E O;  3T5H A;  1MSD A;  1N33 O;  5BWX A;  4MVQ A;  4F6R B;  5HFM A;  2PYJ A;  5KFX A;  3ZMV A;  4LFC O;  3AG7 A;  3TXS A;  4CHI A;  1XIL A;  4DR6 O;  4RB1 A;  1K33 A;  5KT4 A;  4LFC B;  4HYO A;  5H6R A;  3T7A A;  3RUP A;  1NTZ H;  3AX6 A;  3BAA A;  3RTX A;  3H0G A;  4NXN O;  5JVD F;  3E22 B;  1YJ9 V;  4CZZ A;  1KP2 A;  2DWE C;  2XGP A;  1VQL V;  4O4L B;  4ZQI A;  5KHG A;  1BE3 H;  1FKA O;  4MTX A;  5GON A;  3RYI A;  5IYZ A;  2RGR A;  5IT9 N;  3OMI B;  5I60 A;  1RFY A;  5I5Y A;  1Y66 A;  1KJQ A;  4O7N A;  1Z2N X;  5JVL A;  1AI6 A;  2AGA A;  1DTO A;  5EBL C;  3U11 A;  4PBC A;  2F4V H;  3QO7 A;  4DR5 O;  1ZUQ A;  4JI2 O;  3GB7 C;  3CCJ V;  2PGG A;  3AG1 C;  4OXS A;  4WFA V;  2CTR A;  2HLD G;  3OMN B;  3MWM A;  5HNE A;  1JCH A;  2KQX A;  4DV3 B;  1Y1W A;  3RVZ A;  2CW8 A;  1SA0 B;  1PNM A;  2FPG B;  4J9R A;  1URF A;  2QGN A;  4E6N A;  5LMU B;  4EEQ A;  4IR9 A;  3T1H B;  1T5E A;  3SYQ A;  5KFR A;  3K3V A;  3T1Y B;  3AYH B;  2XT9 A;  2COI A;  5EC2 C;  3CWB H;  3ETQ A;  2DWC A;  2FKX A;  1FAF A;  4ECW A;  4TOI A;  3GII A;  1Q6H A;  4BY7 G;  2VQF H;  4A3L G;  4LF5 O;  2R9R B;  4HN2 A;  5H5N A;  3MJF A;  4X64 O;  3CCV V;  4JI0 O;  3ICX A;  2CQY A;  3SYO A;  1E4E B;  5JJE B;  2N74 A;  1AIL A;  2W6P A;  3KAL A;  4DV1 O;  1TVK B;  2L6L A;  4RO2 A;  3CRQ A;  4RB0 A;  4FZ1 A;  3RIZ A;  4DV3 O;  3P3P A;  5LL6 b;  4FIP C;  3JAW A;  1M7J A;  5KFG A;  5LMN B;  1QVF U;  2JJ2 G;  1KJI A;  4ZHQ F;  1B33 N;  4H37 A;  4CBC A;  4GLX A;  2EIK B;  4CC5 A;  4LFA H;  2P6J A;  1WR2 A;  2NU7 B;  3L4J A;  4DR3 H;  4HZ3 A;  2HGW A;  5L3E A;  2GV9 A;  4O83 A;  4FLU A;  2Q5Z A;  4CS2 A;  4Z2W A;  2AU0 A;  1P7G A;  5LL6 Y;  4JZ2 A;  3KRE A;  1YTF B;  2N05 A;  1I5Y A;  3CX5 F;  4EBD A;  1BSM A;  4I50 F;  3QTC A;  1RYR A;  5JH7 B;  1JDE A;  2HJD A;  4MV8 A;  3PW2 A;  2H3O A;  4O7R A;  3L71 H;  2CK3 G;  4QNH B;  3RBE A;  4GKJ B;  1CEZ A;  4JXU A;  2OCC B;  4P30 A;  5BYA A;  3L9D A;  3VQY A;  1E79 G;  2W6Q A;  1A3G A;  4FLY A;  2FLP A;  3ZHR A;  5FL7 G;  4O3R A;  5GTI Z;  3M99 B;  3BY6 A;  1Y6X A;  4MVU A;  4O3N A;  4O3S A;  3WB2 A;  1A0G A;  4MV4 A;  4MVS A;  2RDI A;  1MSW D;  4Q44 A;  2DAB A;  2XAG A;  4I0X B;  1M56 C;  2HKO A;  2MCT A;  3LWB A;  1KBH A;  1IX9 A;  4JI6 O;  4OGQ B;  2XAJ A;  2CAZ C;  4RAZ A;  4B3T O;  4XYL B;  5K2M A;  4D7S A;  5C1O A;  1GYF A;  1VF6 A;  5KFT A;  3R23 A;  2Z5U A;  3LP8 A;  1NT2 B;  1ROP A;  2BOB C;  3K06 A;  5LP6 F;  2XAH A;  1RSO B;  1P8L A;  4JI5 H;  1BT8 A;  2HEP A;  2ZIO A;  2WAQ E;  4N21 A;  1Y4M A;  3H0G G;  2HHH B;  1NR1 A;  1ZQ7 A;  4I50 A;  1CE8 A;  2Q6A A;  4DR1 B;  2CNQ A;  4LP8 A;  2HHH O;  1XNR O;  2Y0P A;  4TV8 A;  4LF4 B;  4A3M G;  1ZWI C;  4PI0 A;  4J7J A;  2ATK C;  3JAM N;  1D5A A;  1RK6 A;  4LFC H;  3HKZ A;  2UUB B;  2WLL B;  3N2K B;  1I2K A;  3ABK C;  5DGB A;  1VQ5 V;  5FNV A;  1YHQ V;  4UV8 A;  4X65 B;  1WSC A;  1V9P A;  5T14 A;  4JYC A;  3F7V C;  3I4N G;  1OCO B;  4J9P A;  2LJ2 A;  4ZHQ A;  1GSO A;  3KYH C;  1S03 G;  4PZ6 A;  3HKB B;  1QVG U;  1SER A;  1XHZ A;  4TV8 F;  3TY9 A;  3PN1 A;  4I4T B;  1HNW O;  3HO8 A;  4ECZ A;  1TWF A;  3JD2 A;  1FD9 A;  2VQE O;  1HNW B;  4H13 B;  4DRX A;  3B09 A;  3RB6 A;  1ZL8 A;  2CGN A;  3OFN G;  4MT8 A;  4LFA B;  2I8C A;  5HV6 A;  3FX7 A;  3NBZ B;  3GV5 B;  2F4V O;  3FFQ A;  4YIO A;  3L75 H;  1H2K A;  3GTJ A;  5JQG A;  2FP4 B;  1GN3 A;  5KT3 A;  2UUB O;  3ZMZ A;  2ZJT A;  4CMD A;  5KFW A;  1QNM A;  2R87 A;  3GTO A;  5BWT A;  3ZRX A;  2NUA B;  3CS5 A;  1A48 A;  4NKG B;  1RJQ A;  1N32 H;  3VPB A;  4C7U A;  4U7O A;  2W9C A;  2Y0S A;  4JI8 H;  2R70 A;  5B3S B;  5DAA A;  4OPH A;  1V55 B;  1GMG A;  3OR6 C;  3N6R A;  3FB7 C;  3JAM W;  2W9B A;  4UV9 A;  1PL0 A;  4RZR A;  3CRC A;  4DK1 A;  1W59 A;  4Q45 A;  2WA3 A;  3K57 A;  1GTO A;  3RB4 A;  1OCC B;  5JUM A;  3TW6 A;  3SYP A;  4I50 B;  5DN6 G;  1CKO A;  3JAT A;  2LGQ A;  5KFQ A;  1QU7 A;  3DGE A;  4CH4 A;  1F7Y A;  1TWA A;  3MR5 A;  4BIO A;  3D36 C;  2ZE7 A;  3ASN C;  3KZI Z;  5CB4 B;  3O9O A;  4MV7 A;  4O7V A;  4JI0 H;  2PF4 E;  4DV7 B;  4CH3 A;  1R3K C;  3AK1 A;  3IC9 A;  3LSQ A;  1UC9 A;  3GIL A;  2W8L A;  3EPI A;  3U55 A;  1RJP A;  5IT9 W;  5KUK A;  5BZB A;  1FPO A;  5F2V O;  4B3T B;  4Q4C A;  3GTG A;  4ZOL F;  3EHB B;  4FFM A;  4J9K A;  3FB6 C;  4M0J A;  1EUD B;  5C4X G;  3K3W A;  2UUC B;  3K5H A;  5BY1 A;  1ORQ C;  2LW7 A;  1WJZ A;  2EJ7 A;  4DK0 A;  4JYY A;  1GGO A;  1HR0 H;  2H8P C;  1OZ0 A;  2ZM6 B;  5KLV H;  4ED7 A;  5LYJ A;  3HKC B;  5EIB C;  2VWJ A;  3ABM B;  3R5H A;  2PN1 A;  1Q90 D;  2C2E A;  2VS0 A;  1RJR A;  4O4H B;  3OTO H;  4DL4 A;  4FFR A;  3HKZ E;  4MW8 A;  4R6Z A;  3BAC A;  3TQ1 A;  2YIA A;  3PO3 G;  4IL6 Z;  3MHS C;  5IWA H;  3ZX6 A;  1QLE C;  1K73 W;  4QJF A;  5LXT F;  2R8I A;  4ZBM A;  1Q6I A;  3SPC A;  1B04 A;  4UCT A;  2DOS A;  5CN0 A;  1N8R W;  4UB8 Z;  3PW5 A;  4QWA A;  4IRC A;  1P16 A;  4LF9 O;  5CBG A;  2FLN A;  4QJF B;  5KFK A;  4X65 H;  4RB2 C;  3GTP A;  4O4J A;  3RT3 C;  2PI5 A;  3WB1 A;  4TQR A;  3M8A A;  3I55 V;  2EIN C;  1M57 B;  3W5O A;  4B3S O;  2HG5 C;  4DV4 H;  4F4Y A;  2BQ3 A;  4DV2 O;  3BQ2 A;  2W7P A;  4QWC A;  3GIM A;  3TEK A;  3KAJ A;  1WCM A;  2ZR3 A;  5LOV A;  3HPL C;  5LHI A;  3SPG A;  1K83 A;  1RPR A;  2R9A A;  1S0V A;  5JVD B;  5KFJ A;  3E8B A;  1OBG A;  2R8K A;  4UCU A;  3GTK A;  5BR8 H;  2YSU B;  1S9F A;  2NVX A;  1K8A W;  5KAI Z;  1DK1 A;  3RWR D;  3QQM A;  1EKV A;  3K3P A;  2QWN B;  4JI4 H;  1AVM A;  1R3L C;  5KFA A;  5CA0 F;  3W1B A;  4PDB A;  2VOB A;  3RGZ A;  2XD4 A;  4BR6 A;  3DTU B;  2AXT Z;  2HVJ C;  5C3E G;  1SZX A;  2WLI A;  2F93 B;  3CCS V;  2UXC O;  2W8K A;  2HJF C;  1YXB A;  3WFV A;  1B06 A;  2FPP B;  2R7M A;  4ASU G;  5KKN B;  2UU9 B;  3AG2 B;  3C0F B;  1AJP A;  1GO3 E;  4FGR A;  2VQF B;  3K5N A;  4MV1 A;  2H94 A;  1TUB B;  2IJI A;  3ORR A;  1WP7 A;  2CNV A;  4ED0 A;  1IDS A;  4PA4 A;  1XQ8 A;  5LGU A;  3JD0 A;  4RAY A;  2FML A;  3H9V A;  1IBM O;  1I2L A;  3PJS K;  3T9F A;  3MHH C;  1VQN V;  1ET0 A;  1PK8 A;  2D2C B;  4FU0 A;  4MSW C;  2P4K A;  2JA6 G;  2W9B B;  1OBD A;  3APQ A;  2JGD B;  1KBL A;  5KFV A;  3D8C A;  3K04 A;  3OT7 A;  1GRJ A;  4WBN A;  1KP3 A;  4KL1 A;  4A3K G;  3Q8Q B;  1UFI A;  4O4H A;  4DR3 B;  5C8Y F;  1G2W A;  2KSW A;  2WA4 A;  5IWA O;  3AG4 C;  5LXT B;  3MAQ A;  5K3W A;  2B63 G;  2Q7E A;  4HNA A;  4AI8 A;  4X66 H;  2QWO B;  4MW3 A;  3NGD A;  5KHJ A;  4PHZ A;  3MR2 A;  2UXD H;  2R86 A;  3SPJ A;  2BOC C;  4JAA A;  4W4L A;  3LQS A;  5KT5 A;  4A3C G;  1SKV A;  1GM7 A;  3VQX A;  4ZKI A;  2K9P A;  1S5L Z;  1SES A;  3WWJ A;  5BMV B;  1VKZ A;  1B6S A;  1UNN C;  4X64 H;  1FJG O;  4W4K A;  4IIJ B;  3H40 A;  5KFU A;  4IIJ F;  5KMG B;  2AGQ A;  4YY3 H;  3OD4 A;  3CSX A;  5TIS Z;  1OWT A;  2EZO A;  4J11 A;  5BMV A;  5LOV F;  3UQ8 A;  3RV4 A;  1XMO H;  3ZMT A;  5LP6 B;  1VQO V;  3G80 A;  4ZI7 F;  4H0L B;  2IW5 A;  2VRZ A;  3K9S A;  3H1K H;  1HNX B;  1LNQ A;  3H1L H;  4C5A A;  2WB1 E;  4B3S B;  4FE2 A;  4D6T H;  1HDJ A;  4O84 A;  3JD4 A;  4FFK A;  2UXB H;  3NUA A;  4NR1 A;  3DXR A;  2UVV A;  4DR2 O;  4LSX A;  3OUF A;  4LWS B;  2GTS A;  3PW7 A;  4X66 B;  1VS0 A;  4P2Z A;  4R50 A;  4R7R A;  3RYI B;  1SQQ H;  3HKC A;  4FJC C;  2ZE8 A;  1IBL B;  4OX9 B;  4ME6 A;  2HHH H;  1TGO A;  1PKX A;  4IGG A;  2K1E A;  4QIW A;  3TW7 A;  3WWI A;  2HJW A;  2W71 A;  5IYD O;  3FYE B;  3OHA A;  5KFH A;  2OIE A;  3DXR B;  1N33 B;  1FFX A;  1VQ7 V;  3ZHU A;  3K03 A;  2OCC C;  2E2H A;  3CRR A;  4FFN A;  2JS5 A;  2YUA A;  3E8F A;  5A2Q N;  3RR5 A;  4I0X A;  3GDE A;  5C44 G;  1M93 A;  2FJZ A;  1HNX H;  4J7K A;  4PDR A;  2QDO A;  1YEW A;  1X59 A;  1Y1W G;  4DL6 A;  1FS0 G;  1MOF A;  5KMG A;  1NBM G;  5J2U A;  4LFB H;  2KG7 A;  1A9X A;  3CC7 V;  4IHJ F;  4CKE A;  4J9Y B;  3G8C A;  5DQI A;  4J0M A;  4B3R B;  1MNG A;  2HHF B;  4PZ8 A;  4LMY A;  4WFG A;  5IP7 G;  3ZBH A;  2BCC H;  1KJ9 A;  1VF7 A;  4DXW A;  3QZ7 A;  2IH3 C;  3JYC A;  1X9N A;  2EX3 A;  2UXD O;  4KHP O;  2P06 A;  3CXC U;  3G67 A;  5BR8 B;  1HNZ H;  4DR2 B;  3T4D A;  2OWO A;  2AHZ A;  4PV1 B;  1M5I A;  4RUC A;  4A2A A;  5BR8 O;  4JYA B;  3QG5 A;  2DPJ A;  3NR7 A;  4A3I G;  2P22 C;  4EFE A;  3FD9 A;  1MZF A;  1Y1V G;  1UPG A;  2GPS A;  1RPO A;  3TCU A;  3JAL B;  4DUY H;  2XUM A;  4A3J G;  5KT7 A;  2ALZ A;  2I80 A;  1FJG B;  4LH6 A;  2ASJ A;  1FVI A;  3ZJZ A;  1WCM G;  4YAK B;  5KFS A;  1OJH A;  4DW0 A;  2BSK B;  4UCS A;  1GLV A;  3LNM B;  3TK1 A;  2VWK A;  3NXS A;  2P5O A;  2Q0O C;  3E89 A;  2VA3 A;  2W0F C;  1S0O A;  3R66 A;  4LSA A;  3VQW A;  5LMN H;  1YIT V;  2EJR A;  2GPW A;  2YIB D;  3JCU Z;  5CA3 A;  3H1H H;  2HFE C;  2MK3 A;  5JH7 A;  1TWG A;  3QF7 A;  3TXQ A;  2Z02 A;  2WLL A;  4DUZ H;  3OAA G;  1Y76 B;  3CJH A;  5CM0 A;  1I7N A;  4I7H A;  5J2U F;  4DV5 H;  5ITZ B;  1CS0 A;  2PUS A;  4QE9 A;  4J9M A;  3CP1 A;  4QPJ A;  4TT3 G;  4Q8F A;  5AG2 A;  2ZNJ A;  4CKB A;  2FL4 A;  4QIW E;  4O4I F;  3KHG A;  1VEW A;  2HVK C;  4LCU C;  2UXD B;  3QNE A;  2X7R B;  1Q43 A;  3K5I A;  1XNR B;  5KX5 A;  1Q8I A;  4LF7 B;  1VBH A;  2GBO A;  2DN9 A;  4E4T A;  4BXX G;  1E4F T;  5BWV A;  3X2Q C;  3B77 A;  2CGO A;  1E1Q G;  3WO1 A;  5JH7 F;  1WB8 A;  1AR4 A;  4QIW F;  2B1G A;  5HFL A;  4DV1 H;  3AG3 B;  2QWP B;  3O65 A;  4JV2 A;  4CS3 A;  4JTA B;  2VUM G;  2Q7H A;  1ZLZ A;  1BGY H;  4FM9 A;  4ZHQ B;  4LFA O;  2J9G A;  2L35 A;  1MMM A;  3Q1K A;  3W7X A;  1H2S B;  3ABM C;  4MTE A;  4I55 A;  2ASL A;  1TUE B;  2W6I G;  4YJ3 A;  3J81 W;  3V6J A;  1N0N A;  2HGX A;  2CDY A;  1L8D A;  1K5Q A;  4C5B A;  1DAA A;  2AGO A;  1HR0 O;  1ZL8 B;  4DR4 B;  4UVB A;  3MFH A;  3GLK A;  3JZI A;  1OCR C;  2W70 A;  3TY5 A;  3FYI B;  2YS7 A;  1QLE B;  2EIM C;  2QR4 A;  4KXR A;  1KKC A;  5LMU O;  1SQB H;  4GYC B;  1CKM A;  3H3V H;  3AG3 C;  1O75 A;  1SC5 B;  1L0N H;  4RUA A;  1R1B A;  3RBZ A;  4DR1 O;  2UXX A;  3RYF B;  3UO3 A;  3VQV A;  4WD3 A;  2DZD A;  4I9W A;  5IJ0 A;  4X1I A;  2YYA A;  1NI8 A;  1D2D A;  1XNQ B;  1GN4 A;  2QF7 A;  2ZCE A;  3FMA A;  3SI8 A;  3JRW A;  1T36 A;  2A7W A;  4TM5 A;  2EIL C;  4KUM A;  2VQE B;  5ITZ A;  4J80 A;  4LF9 H;  4DR7 H;  5BPH A;  4D7T A;  5A2Q W;  2VUG A;  1JX4 A;  2AW9 A;  4JI5 O;  4MTD A;  4TUY F;  1JVM A;  2B63 A;  2Z04 A;  4Q6G A;  5LA6 F;  3C3T A;  3AG1 B;  1KC7 A;  5KT2 A;  5KAF Z;  2ODM A;  2X6B A;  3ETG A;  2FB5 A;  4HNA B;  3K58 A;  3P3N A;  3K5L A;  2YS6 A;  4WCE V;  3T2M A;  1M90 W;  1QLN A;  2EZP A;  4GLW A;  4O82 A;  1GH6 A;  2NR5 A;  3BHP A;  4JI8 B;  5I5S A;  1S3J A;  1XDC A;  3VA7 A;  4AYB A;  5J2T B;  3G6V A;  2VUM A;  2HP8 A;  5H2F Z;  5L1K A;  3HKE A;  1YVW A;  4YJ2 A;  3ETH A;  3WU2 Z;  1S0M A;  3ABU A;  4GX5 A;  4ZI7 A;  4FM1 A;  2IM9 A;  2HG8 A;  4JI3 B;  3C3S A;  3HKE B;  3KCY A;  1EHI A;  4LF6 H;  3OMA B;  4Q4D A;  1IBK H;  3SGI A;  4JI3 O;  1WLE A;  2Q67 A;  4GKK H;  5J2T A;  1UJW B;  4GCZ A;  1H38 A;  4FFL A;  4EB6 A;  4MVZ A;  2P67 A;  2YXL A;  3P32 A;  3OHB A;  1NTM H;  3CRM A;  3QO5 A;  4I55 B;  5KG3 A;  1XOU A;  3OR7 C;  3WB0 A;  3ZIA G;  3TGU H;  1BQ0 A;  3TY8 A;  4ED1 A;  4MTO A;  2UXB B;  4PJ0 Z;  1R6N A;  1W0J G;  4X1Y A;  2OYQ A;  4B3M H;  5IYB G;  4EFB A;  1AR1 B;  1SZT A;  1TWC A;  4WBN F;  3V4Z A;  4O81 A;  2E76 B;  1KTA A;  5FLM G;  4K8Z A;  4RU9 A;  1N34 O;  4NZM A;  4UXN A;  1XMQ H;  5CA1 B;  4NTX A;  3UCS C;  1IXM A;  4MTF A;  4H44 B;  2O03 A;  3E8G A;  3SR2 C;  5L3B A;  2EIL B;  3WWH A;  4M9U A;  3JD3 A;  1T94 A;  3H1J H;  3VPC A;  1NTK H;  2ZIN A;  2DPI A;  3EXA A;  3EVK A;  5GON B;  2IU0 A;  5CA1 A;  1YDX A;  2O57 A;  2X0L A;  5KT6 A;  2YXY A;  1DIK A;  1KEC A;  1N4C A;  4DR7 B;  3RJ0 A;  1BGW A;  4ECY A;  2X5R A;  1IYE A;  4KHP H;  1WA8 B;  1R6T A;  3CB2 A;  3UFX B;  3CE2 A;  2E75 B;  4JI5 B; 
#chains in the Genus database with same CATH homology
 4ZOL A;  5EYP A;  4K0K H;  4O4J A;  4LF8 H;  4DR5 H;  5C8Y B;  4JI2 H;  3WB1 A;  3S24 A;  3JSN A;  3W5O A;  3N40 P;  3RYC B;  3VNN A;  5KHH A;  1ZHS A;  4DV4 H;  4A2B A;  4B3R H;  3CHX A;  3KAJ A;  5LOV A;  2F66 C;  4X62 B;  1XHX A;  1JJO A;  2R9A A;  5JVD B;  4O4L A;  4RB3 C;  4UCU A;  5BR8 H;  1M0W A;  4YJ2 B;  2WE6 A;  1XK5 A;  4TV9 B;  2E3C A;  3DF7 A;  4LF6 B;  3RWR D;  4JYA H;  1CKN A;  4IHJ A;  1N32 B;  4JI4 H;  2HIX A;  1I6U A;  4TQD A;  3W1B A;  1IBK B;  4PDB A;  2VOB A;  3RGZ A;  1J5E B;  3JAL A;  4NXM B;  2F93 B;  5IWA B;  5LXT A;  3RYH B;  3UT5 B;  5JCO C;  2UXC B;  2UU9 B;  4X1I B;  5D5P A;  3C0F B;  3DSQ A;  2VQF B;  3K5N A;  3UT5 A;  1TUB B;  3BA8 A;  4X20 A;  3A2F A;  1FJG H;  1IBM B;  3N2G A;  2UUC H;  2BTQ A;  1XQ8 A;  4RAY A;  4BWS C;  3JAT B;  3JAR A;  4O2B B;  4U3J A;  5FD6 A;  5J2U B;  2UUA H;  3HKD A;  4FM0 A;  3BAB A;  4EQ5 A;  4WBN A;  4KL1 A;  4ETS A;  1HNW H;  2JGU A;  4KHP B;  4APM A;  4DV2 B;  3RGX A;  4O4H A;  4DR3 B;  4GKK B;  2KSW A;  4K0K B;  5LXT B;  3MAQ A;  2Q7E A;  4TV8 B;  4HNA A;  4X66 H;  2F95 B;  5D5Q A;  5KHJ A;  4NXM H;  4PHZ A;  2UXD H;  3IAY A;  2HIV A;  1SKV A;  3VQX A;  2VPS A;  3J80 W;  4X1K A;  3SJA C;  5EZY A;  5BMV B;  4X64 H;  4O4J B;  4IIJ B;  1QHT A;  5KMG B;  5LP6 A;  3KXY T;  4NXN B;  4YY3 H;  4O2B A;  4DV0 H;  3CSX A;  1A0I A;  4FLX A;  2BTO A;  5BMV A;  3UQ8 A;  1XMO H;  1IBL H;  4OX9 H;  5LP6 B;  1DGS A;  3SJB C;  1Q3E A;  1FKA H;  4BWA A;  1HNX B;  4DV4 B;  4YJ3 B;  1JFF A;  4X64 B;  4B3S B;  4NXN H;  4DR4 H;  4RZQ A;  2UXB H;  3NBY B;  4YY3 B;  3OTO B;  2HVR A;  4ZOL B;  4X62 H;  4LSX A;  4DR5 B;  3B2E E;  5FPR A;  5C8Y A;  5DIS C;  4B3M B;  4YHH H;  4BW9 A;  4X66 B;  1VS0 A;  4FM2 A;  4R7R A;  3RYI B;  3HKC A;  2HHH H;  1XMQ B;  1IBL B;  4OX9 B;  1TGO A;  4O2A A;  3L4K A;  5FD5 A;  1KMI Z;  4JI4 B;  4DV5 B;  4IHJ B;  1Z2O X;  2FE3 A;  4DRF A;  5LA6 A;  4B3S H;  3BRC A;  3ZED A;  1N33 B;  1FFX A;  4GKJ H;  3NC0 B;  2E5L B;  2QJ1 A;  3M4I A;  3F8N A;  1Z5V A;  1ZAU A;  2JS5 A;  4F6R B;  3RR5 A;  4DR6 B;  3GDE A;  2PYJ A;  5K1X A;  5LYJ B;  4O4I A;  1M93 A;  2PZS A;  1KU9 A;  1HNX H;  4RB1 A;  4LFC B;  1YEW A;  5IJ0 B;  5EYP B;  1FFX B;  3RTX A;  3BAA A;  5JJN B;  1HNZ B;  5KMG A;  3E22 B;  4DV1 B;  2Q2U A;  4DV6 H;  5CA0 A;  5J2U A;  1I94 H;  4LFB H;  4O4L B;  2RGV A;  2JVD A;  3JAW B;  2UU9 H;  4J0M A;  4B3R B;  3HKB A;  5KHG A;  4PZ8 A;  4LMY A;  5GON A;  3RYI A;  2RGR A;  5IYZ A;  1TUB A;  4JV5 H;  1VF7 A;  4DV0 B;  3N2G B;  4LF5 H;  1X9N A;  1Z2N X;  2EX3 A;  2RJZ A;  4DUZ B;  1M4U A;  4JI2 B;  3K5O A;  3RYC A;  3U11 A;  5BR8 B;  1HNZ H;  4HBN A;  4DR2 B;  2OWO A;  4DV7 H;  2F4V H;  2HGS A;  2HVQ A;  2E5L H;  1M5I A;  4A2A A;  4JYA B;  2PGG A;  3QG5 A;  1S5J A;  2P22 C;  4EFE A;  1WNS A;  1X4T A;  4DUY B;  2ZNI A;  3MWM A;  4DV3 H;  2YI9 A;  4JI3 H;  2CW7 A;  4DV3 B;  4DUY H;  3IG0 A;  3JAL B;  2CW8 A;  1Z2P X;  1SA0 B;  4L8J A;  2R72 A;  1FJG B;  4LH6 A;  3E22 A;  1FVI A;  4UFZ A;  4E6N A;  5LMU B;  4EEQ A;  3T1H B;  4JI1 B;  1T5E A;  4LNU A;  3K3V A;  4UCS A;  3T1Y B;  4DR1 H;  3JAR B;  2VWK A;  4ZIB A;  2P5O A;  3ETQ A;  4FVM A;  2YIB A;  4LSA A;  3VQW A;  5LMN H;  4TOI A;  2YIB D;  2VQF H;  2ZIM A;  5JH7 A;  2V4D A;  5IYZ B;  4Q0Y A;  3QF7 A;  4YHH B;  3ICX A;  3M7M X;  4DUZ H;  5JJE B;  1XMO B;  4JI0 B;  3JSL A;  5D1O B;  4I7H A;  4DR2 H;  3KAL A;  1TVK B;  4AHC A;  4DV5 H;  4I4T A;  5ITZ B;  3RFR A;  2PY5 A;  4RB0 A;  3RIZ A;  5LL6 b;  3JAW A;  2PUS A;  5LMN B;  4UCO A;  4U3J B;  5IJ9 A;  1N33 H;  2ZNJ A;  4GLX A;  4FLZ A;  4CC5 A;  4LFA H;  3N43 B;  4TV9 A;  3L4J A;  4DR3 H;  2UXD B;  2Q2T A;  1Q43 A;  2GV9 A;  4LH7 A;  1XNR B;  2HVS A;  5KX5 A;  1Q8I A;  4FLU A;  4LF7 B;  4CS2 A;  5JJJ B;  4LR3 A;  1E4F T;  4EB6 B;  5CB4 A;  1QQC A;  3QTC A;  1JMK C;  5JH7 B;  4NVP A;  4LF4 H;  1L2Z A;  1J5E H;  1MZB A;  3K59 A;  4GKJ B;  3K5M A;  4DV6 B;  3VQY A;  1I94 B;  4DV1 H;  4FLY A;  5KHI A;  2YI8 A;  1Q5O A;  5CA0 B;  4CS3 A;  5KHK A;  4JV5 B;  2Q7H A;  3RF2 A;  4FM9 A;  3WB2 A;  4ZHQ B;  2Q0A A;  2MCT A;  1H2S B;  3LNN A;  2W57 A;  4MTE A;  4I55 A;  2CAZ C;  1I7F A;  4RAZ A;  4FFB A;  4YJ3 A;  3J81 W;  4LFB B;  1L8D A;  4D7S A;  5EOY A;  1GYF A;  2UUB H;  4DRX B;  4UCR A;  1HW7 A;  5FLX W;  4DR4 B;  2KKW A;  1NT2 B;  3N44 B;  4IIJ A;  4FLW A;  3TY5 A;  1P8L A;  1N36 H;  4JI5 H;  2HEP A;  2ZIO A;  3QWU A;  4PZ7 A;  4TUY A;  2HHH B;  1N34 H;  4I50 A;  4ZI7 B;  4GYC B;  5EIB D;  1CKM A;  2ZM6 H;  4DR1 B;  3RGB A;  4AQY B;  1O75 A;  3CVZ A;  1S68 A;  4TV8 A;  4LF4 B;  4B08 A;  4X20 B;  4PI0 A;  4PI2 A;  3THO A;  5D1P A;  3RYF B;  1D5A A;  3VQV A;  4JI7 H;  4LFC H;  2UUB B;  3N2K B;  5IJ0 A;  4X1I A;  5JVD A;  1JFF B;  2XIG A;  5FNV A;  1XNQ B;  4X65 B;  1P49 A;  1V9P A;  5KX5 B;  4LF5 B;  4JI1 H;  2Q7G A;  2ZCE A;  3FMA A;  4ZHQ A;  1XI1 A;  4LF8 B;  3KYH C;  1S03 G;  4PZ6 A;  3HKB B;  1WN7 A;  4WBN B;  1HR0 B;  1WPB A;  1XHZ A;  3TY9 A;  3JAK B;  2VQE B;  1AN7 A;  1WH2 A;  3U0Z A;  3PN1 A;  4I4T B;  5ITZ A;  4LF9 H;  4LNU B;  3J7A K;  5LP6 C;  4DR7 H;  3HKD B;  4D7T A;  5A2Q W;  2VUG A;  4CC6 A;  1HNW B;  4MTD A;  4DRX A;  4Q6G A;  4O2A B;  4LFA B;  2QM4 A;  1SA0 A;  3N6X A;  3NBZ B;  1RSO A;  3FFQ A;  4X1K B;  5JQG A;  5K1P A;  3BA9 A;  2XHB A;  4HNA B;  3K58 A;  3K5L A;  2ZJT A;  4M7E A;  3GJX B;  5FNV B;  2F1M A;  1N32 H;  4K8X A;  3RYH A;  4JI8 B;  3BHP A;  1Z5W A;  4JI8 H;  2R70 A;  5J2T B;  3RYF A;  3N2K A;  3JAM W;  4DK1 A;  3HKE A;  5LMU H;  3K57 A;  4YJ2 A;  3JAK A;  2PTM A;  3EYY A;  4I50 B;  4ZI7 A;  2BTQ B;  4FM1 A;  2IM9 A;  3GB8 B;  4JI3 B;  4IAJ A;  1SQG A;  3HKE B;  3JAT A;  1CKO A;  4LF6 H;  1IBM H;  4FLT A;  3SGI A;  1IBK H;  1XNQ H;  4LF9 B;  4CH4 A;  4GKK H;  2YCH A;  5J2T A;  4EB6 A;  5CB4 B;  3JAS A;  2WYO A;  4MV7 A;  4JI0 H;  4DV7 B;  2F4V B;  4CH5 A;  4CH3 A;  5D1O A;  2YXL A;  4O4I B;  4MV9 A;  4I55 B;  4AQY H;  1O9G A;  1M0T A;  4JI6 B;  3WB0 A;  3LML A;  4FFB B;  4JI6 H;  4JI7 B;  5IT9 W;  3SJC C;  1SQF A;  4F6R A;  4B3T B;  5JQG B;  2RQ6 A;  5IJ9 B;  3TY8 A;  4DV2 H;  4TUY B;  1O9H A;  2UXB B;  2UUC B;  1CKN B;  4X1Y A;  2OYQ A;  3HXL A;  3L2P A;  4B3M H;  4EFB A;  4DK0 A;  1TVK A;  1XNR H;  4CS4 A;  5LA6 B;  5EZY B;  1N34 B;  3N41 B;  4TQF A;  4K8Z A;  1HR0 H;  1G6U A;  2ZM6 B;  5JCO A;  2CFM A;  3W1G A;  5LYJ A;  3H20 A;  3HKC B;  4LF7 H;  1XMQ H;  5LOV B;  5EIB C;  5CA1 B;  2VWJ A;  5FPO A;  1XDN A;  4B3T H;  4DR6 H;  3U10 A;  3KAK A;  1N36 B;  4O4H B;  2PYL A;  2O03 A;  3OTO H;  3SR2 C;  1TAE A;  2WDT A;  2UXC H;  3T1H H;  1SYX B;  2ZIN A;  2YIA A;  3OTF A;  3BPZ A;  3JAS B;  1BJT A;  5IWA H;  3T1Y H;  4AIL C;  1TA8 A;  5GON B;  1E4G T;  2VQE H;  2UUA B;  5CA1 A;  4FLV A;  1SEI A;  4X1Y B;  4DR7 B;  1B04 A;  4UCT A;  1BGW A;  3RJ0 A;  1ZHQ A;  4KHP H;  1P16 A;  3N42 B;  4CH6 A;  3CB2 A;  4UCV A;  3ZS8 C;  4I9Q A;  4X65 H;  4JI5 B;  4RB2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...