4UCTA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 102
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4uctA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4uctA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4uctA02
4DUYB 1XNQB 1A0IA 4DV6B 4EQ5A 1I94B 4NXNB 4EEQA 1HR0B 2HIXA 4UCOA 4X65B 5DISC 2UUAB 3OTOB 1IBKB 3GB8B 4PZ7A 5D1OA 1XMOB 2ZM6B 1CKNA 4TOIA 2HVSA 4CC6A 1DGSA 4B3MB 4LF8B 4DRFA 4DV5B 1HNWB 2UUCB 4E6NA 4LFCB 4UCTA 1TA8A 2Q2UA 3W1BA 4B3RB 5IWAB 4LH6A 2VUGA 4JI6B 3JSLA 4DV0B 4LF6B 4DR5B 2UXCB 4JI8B 3S24A 4X64B 2CFMA 2UU9B 2HIVA 1N32B 5FPOA 3W5OA 4KHPB 4B3SB 1CKOA 1V9PA 4UFZA 2VQFB 1N33B 4X62B 4PZ6A 5FPRA 4AQYB 1N34B 4GKJB 4UCSA 3BAAA 4DR2B 3NBZB 1S68A 2HVQA 1CKMA 2Q2TA 4JI0B 2UXDB 4X66B 4OX9B 3QWUA 1TAEA 5LMNB 4DR7B 4UCRA 4PZ8A 1X9NA 4LF9B 1B04A 4JI4B 3TY5A 3TY8A 4JI1B 3NBYB 4JYAB 4GKKB 3L2PA 4DR3B 4K0KB 4DV1B 4LF5B 5D1OB 5BR8B 1HNZB 3JSNA 2UXBB 3RR5A 1CKNB 2UUBB 3W1GA 4LF7B 1XDNA 3TY9A 3T1YB 1FJGB 3KYHC 1VS0A 4UCVA 4LF4B 3RTXA 1P16A 4YY3B 4LFBB 1ZAUA 4NXMB 4JI7B 3NC0B 4DR1B 1IBLB 2E5LB 2HVRA 4DV7B 4DV4B 3GJXB 2HHHB 3BA9A 5D1PA 4JI2B 4LFAB 1IBMB 1FVIA 3VNNA 4UCUA 5LMUB 2OWOA 3SGIA 3BABA 1P8LA 4GLXA 4EFBA 4LH7A 4JV5B 3PN1A 2F4VB 1J5EB 4EFEA 4DV2B 3BA8A 1N36B 4B3TB 4DUZB 1HNXB 1XK5A 4DR6B 1XMQB 4YHHB 4CC5A 3T1HB 2VQEB 4JI3B 4JI5B 3GDEA 3UQ8A 4DR4B 4DV3B 1XNRB
chains in the Genus database with same CATH superfamily
4IWXA 1D2DA 4C5CA 2GTSA 2NU7B 4O3SA 4J9OA 1DF5A 4DW1A 3KHLA 1CE8A 2CW7A 3SPGA 2EIMC 2ZXWB 4J9RA 3GTJA 1WR2A 4O7RA 1M57B 5LOVA 4ECWA 4JTCB 4OX9H 3X2QB 2YC0A 2WLIA 4J7JA 2ZM6B 4RNMA 1IX9A 4X88A 4ECSA 1EFRG 3H0GA 2A0LA 4LF9H 3GTKA 5BWWA 1K1QA 5DQGA 4ECUA 4IR9A 4A3KG 2UXBO 1Q5OA 3UO2A 3GIQA 2ASLA 1BHAA 1C3OA 4IRCA 2Q2UA 1F23A 2DW4A 2OYQA 3PR4A 1I1MA 3V6KA 1Q43A 2UXBH 4UVBA 3U11A 1RYSA 2KSWA 1HW7A 1NI8A 4HAMA 1NS1A 3JD1A 4HNAB 4LF6B 1S72V 3DXRB 4X66O 1RSOA 5F9LA 4I7ZB 3UT5B 4YXWG 1N8RW 4NXMH 4ABMA 2CFMA 3AG4B 4QE7A 1OBGA 3UKMA 2CNVA 3CSWA 2R92G 4DV7H 5DM6V 1Y1WG 2EINC 1I3QA 4JAUA 1KP3A 2FMLA 2QWRB 4WBNF 5C8YA 1U97A 1SQGA 3GIJA 1EZVH 4UCSA 2ITCC 5IYZB 5IT9W 1BQZA 4TQSA 3VPCA 4LSXA 3Q4HA 4UVCA 4Q44A 2UXDB 3N42B 2F93B 3ZMSA 2GDSA 1DAAA 2X0SA 2GLTA 1M93A 4UV9A 4A93G 4EB6B 1WA8A 1WCMA 3HKZE 4DK0A 1MOFA 1R3JC 4RZQA 4H37A 3RT3C 4YJ3A 3KG2A 1JX4A 5J2TB 4LFAO 2YIAA 5D1OB 5E25A 2X7RB 1Y6XA 4TUYA 2HJWA 2IH1C 1GYFA 1VS0A 1EM1A 3E8HA 5EBLC 3BACA 5CMUA 4L1KA 3A0HZ 4R7CA 2OIEA 1N0NA 4RQFA 4DR1B 4X20A 3OGIB 3OSPA 3RWRD 3WO1A 3MWMA 4ED6A 1B6SA 3VNNA 3TQ1A 1V4YA 2XAHA 1JJOA 1SYXB 1P8LA 1M1KW 3CC7V 4DV6O 4C5AA 4CH4A 4EBEA 3H3VH 4LF6O 3TK1A 3E8BA 5LOVB 4FGRA 2ASJA 1RM1B 2L6LA 4RWUA 2WLIB 2W6QA 2W9BB 3J7AK 5GW7A 3SJAC 5L1LA 4WFGA 4LF6H 4O4IA 5L3BA 1BGYH 3KHRA 2VRZA 3AG3C 1A0IA 4LF8O 5KFBA 1THZA 2LO1A 3T9CA 4J80A 2YL2A 3KKYA 2ALZA 2COGA 4LF8H 5JJEB 2FKXA 1SZXA 4OXSA 1JOYA 2QM4A 4JYYA 2ODTX 4EEYA 3WNZA 4QIWE 2JA7G 1RSOB 3AG1C 3CB2A 5BXZA 1VQNV 4RZRA 3JALA 2QK4A 3GB8B 4GZRB 3LQSA 2OCCB 4Z1VA 5FLMG 2B63G 4U7NA 2QJ1A 4DV0O 3TCUA 2KB1A 2IA6A 1S76D 1SA0B 4NYEA 2W6MA 4BWAA 2I80A 4NB5A 4DV0H 4EYHB 2QWOB 5C8YB 2P06A 1YJ9V 3N43B 3BRCA 3Q4HB 3T9DA 3WWIA 3HPLC 4CS3A 4UUGA 2GHYA 2VA2A 1BT8A 2HVJC 3L70H 1VQLV 1WA8B 3I5DA 4JI0O 1AR1B 2UXCB 3K0DA 2JRIA 5IP7G 3M99B 2DQ3A 3CHXA 4YJ3B 4X64B 2YXYA 3O9OA 4DR1H 4ETSA 2A06H 2E2IA 4W4KA 2ABJA 1RJPA 3K0GA 4TUYB 2A79B 5BMVB 5LP6A 3RVZA 3ZBHA 3C90A 2CNUA 2Q69A 4F4ZA 4RNNA 5K1PA 3GIDA 1S0NA 3PW5A 4NYKA 4FJCC 3CCSV 5LMNB 4UCRA 1KTAA 4X20B 3CEBA 1KUQA 1N48A 4FVMA 2ZE8A 1JFFA 2NVXA 1A0GA 5BMVF 1MG1A 4NZMA 2CAZC 4K0KB 1BGWA 1SERA 4O2AA 5JH7F 2DJVA 1JQ0A 2R70A 3UZOA 2A9HA 4UCVA 4O4IB 1N36O 4APMA 5LGTA 3ZHVA 1M4UA 1K3EA 3G6EV 1XMQO 2BE3A 3T1HO 1XILA 4DL4A 1YVWA 5KUMA 3GJXB 3E83A 4DV3O 1WJZA 1KKCA 1CEZA 3CXHF 3CMEV 1A32A 2FKLA 4JV5B 1MNGA 5DQHA 3NR7A 3ZRSA 1L8DA 4RAZA 3KALA 3IC7A 1B3QA 1H2NA 4JI5B 2UXCH 4YAKB 4X1YB 4MA0A 5CBFA 1AILA 1GSAA 3N41B 4X64H 2E75B 3RW0A 2YRWA 4JAVA 1WNSA 4XYLB 3H20A 3JYCA 3VPBA 3ASOB 1HDJA 4RUAA 1V55C 1KKDA 1HR0B 5FR9A 2RF4A 5EDWA 1ZQ7A 3G8CA 3RB4A 4FLVA 2F1MA 2XASA 1A3GA 5LMNO 4F4LA 1EYZA 4EBCA 1CQIB 1W59A 3RB0A 1VAJA 4R7RA 5DQIA 2PI5A 5LMNH 3B09A 3G71V 3L4JA 5KT7A 1DGSA 1JDEA 5AG2A 1I2KA 4DRFA 2UU9O 4RB2C 1W96A 1PX2A 5LP6B 2P6JA 4MV4A 4O7VA 4DAAA 4Q20A 1K5QA 4FS1A 2UU9H 3H9VA 4J11A 3AK1A 3SNOA 3F8NA 2YZMA 1AJQA 3SPJA 5CA1B 1JFFB 4PA4A 4FLTA 3T9FA 2F23A 3K3VA 3S3WA 1I7NA 1RYRA 5KLVH 4O2AB 2JEIA 1K34A 4LC1A 5HBRB 2C2RA 5CA1F 4ED1A 4J10A 1QR9A 4GKJB 4FLYA 2VOBA 5H9CA 4JYCA 4JV5H 4EG0A 2QM7A 3CE2A 5L3DA 2IU0A 4ECQA 3RBZA 4CS2A 3QWUA 4XX0B 2JS5A 2R84A 4YY3O 3J81N 3L4KA 3SPHA 4JI5H 4QJFA 3OMIB 4JYAB 3RGBA 5KFTA 2MCTA 5KA6A 3CCEV 2HGWA 3H1IH 1XUQA 2VS0A 3RFRA 1HR0H 4LF7B 1XDNA 3WFVA 2EZPA 1GO3F 2PGGA 2V1DA 5E1AC 1V54C 1ZWIC 4MV3A 1XL4A 1KC8W 2JEXA 1YJWV 2QWQB 2DAAA 2XNDG 1URFA 5LHGA 1IBLB 3GWKC 4JI2B 4IRDA 4MSWC 3ML0A 3HKEA 3M4IA 4BIZA 5KS8A 3H1JH 2ARHA 1GH6A 3CWBH 2XC9A 2ZT9B 1NR7A 1R6TA 4FLUA 1WPBA 2V5AA 1IBKO 1H2MA 3R5HA 1KJIA 4QNHB 5DGBA 2OCHA 3JD2A 4ASUG 4TT3G 5LA6F 1XNRB 2W6NA 1QU7A 2X6BA 4QWDA 2XGPA 2FK2A 4GKJH 3V6HA 1QBZA 4I55A 5IWAO 2JEUA 3HKBA 2R93G 3WG7B 4LBEC 2CE4A 3ABMB 2EIKC 5KT6A 1OCZC 5CN0A 1TWFA 2Q7DA 4JV1A 1M6VA 2AHZA 2R9AA 3H4DA 2COJA 4MA5A 4E6NA 1FXKC 4JYAH 4UCTA 1TA8A 1BXRA 4O4LF 1T5EA 4O2BA 5KG1A 2PUSA 5LYJA 2QB5A 4R8UA 1N34O 4O7TA 3ASNB 1KECA 4X89A 4CMFA 3I4NG 1B6QA 2YXLA 2JGDA 4A3IG 4TV8A 1IBLO 4QPJA 4CZZA 4QJFB 2OLSA 3VQXA 2NN4A 1KD1W 4HQ6A 3ABTA 5KFFA 3KCXA 4U3FH 1KEEA 1UC9A 3HOXG 1IBLH 3A0BZ 4JI2H 2OH2A 4J9KA 4DR3O 3MR6A 4I7HA 2E3CA 4DV1O 4AQYB 4L87A 1QHTA 2RNBA 3BAAA 3LP8A 1O9HA 2HVKC 2DWCA 3FKIG 1Z2OX 1XNRO 1KB9F 1I1LA 3JATA 1T3NA 4ECXA 3G80A 3NBYB 5LXTF 1XNRH 4GKKB 4QWEA 5GONF 2ZR2A 1JLLB 4AI8A 2Y4TA 1HNZB 1GTOA 3TXQA 1I6UA 2UUBB 3SI8A 1IZ3A 1N4CA 3KAKA 4YAJB 2F4VO 3ZMZA 1VQ4V 1Q6UA 3H0GG 3ZEDA 1PL4A 4DR6O 1E1RG 4JZ2A 4QWAA 3CEIA 2YU9A 2F4VH 3DF7A 1K83A 4A3MG 2WSSG 1SC5B 3JCUZ 1AJPA 3CVZA 3PW2A 3RYHA 2EJ0A 2V4QA 1R3LC 5KFSA 4HYOA 4Q0YA 2RDJA 4EGQA 3EPIA 4K35A 4GCZA 4I55B 4LH7A 4EFBA 1NJIW 3HKBB 4NXNO 2VPQA 1O9GA 3K3WA 4CKCA 4NXNH 1PKXA 2IJIA 1PNLA 3UYYA 4O7SA 4O4HF 1ZETA 1QLEC 1GLVA 1KJ8A 3O65A 3HXLA 4GX2A 5H80A 3QG5A 2Y0SE 4O2BB 3JZFA 3FMAA 3R5FA 4LFCO 3L74H 5CA0F 4B3RO 5FD6A 3T5KA 2HKOA 4DO2A 2YS7A 3H1KH 2EILB 4O81A 2JGDB 2YYAA 4LFCH 4TV8B 3GTPA 1WCMG 4ZKIA 1WSCA 4CH6A 1S0VA 4YBZB 2CK3G 1M9NA 2AW9A 2WA4A 5B3SC 3BHPA 3P32A 5LGNA 2AQ4A 4PDVA 2QWPB 1K8AW 2FMAA 5JQGF 1HNZH 2DPJA 2V4RA 2UUBH 3J80W 4IIJA 4JF3A 2VUGA 1NR1A 4Q45A 1OCCB 3HT5A 3G6VA 3SJQC 1IOVA 4QWCA 3JAMN 1DF4A 3FD9A 1XQ8A 4J9YB 4TVIA 2UVUA 4XDLA 2WAQA 4F4YA 5LGUA 4PZ6A 4UXNA 2R82A 2KG7A 4YIOA 5KX5B 2W57A 3SYAA 1B06A 4JZGA 2HG5C 3CCUV 3DGEA 1IOWA 1S0MA 4MVUA 5FD5A 3VPDA 5DAAA 4TQDA 4DR7B 3U55A 2YIBA 3ZHUA 3ZS8C 2E76B 1B04A 4PHZA 3RYHB 4JI4B 4ED0A 2C2EA 4O82A 3ICXA 5IY5C 4LCUC 1QVGU 5KX5F 1IYEA 1RFYA 2ZKOA 3ZJZA 4CKBA 1YITV 3F7VC 3CMAV 5FNVF 2ZJTA 1BHBA 1R73A 2Q7EA 1QR8A 2BOCC 4PI2A 5I5XA 3G6YA 4BY1G 4UVAA 2E5LB 5L3EA 5LBQA 1BQ0A 1Z5WA 1HWYA 4WBNA 2JIZG 4YR0A 4HNAA 4YJ2B 4A3JG 1N56A 1KBLA 2OWOA 5KFAA 5EIBD 1MMMA 1QCEA 3F7YC 4G28B 3PN1A 2FK3A 3BQ2A 3GTOA 2GQSA 2P0AA 3SJBC 3BA8A 5BY1A 1YTFB 2FTKA 3AYHB 3HB9A 4LMYA 2MK3A 2NU8B 2PMZE 4YJ2F 1BCCH 2NUAB 4DR4B 1Q6HA 5KHKA 3ZN0A 3S3XA 3GQCA 2RDCA 2R7LA 4DV5O 2KKWA 3B4SA 2JEJA 4P30A 4FLWA 5BWTA 1BSMA 4DV5H 4DIMA 1T94A 5BYBA 3ZMTA 1KQSU 1RPRA 4ZBMA 2CTWA 2EIJC 3SDLA 1YCIA 1KJQA 1TUBB 4FFOA 5D1OA 2XAGA 2WLLA 3QF7A 3TIGA 4J7KA 3KAJA 4RB0A 1WN7A 3CRCA 1H2LA 1EN6A 2DN9A 2IU3A 2DPIA 1VKZA 5KAIZ 4LR3A 2XHBA 1BS3A 5B1BC 1NTMH 1SQBH 3VQYA 2KG7B 4ED3A 5L9XA 4PD4F 2E74B 2ZDIC 3MR2A 2RGVA 5JQWA 2C00A 5KMGA 1OV9A 4G3IA 1RP3B 2LW7A 2ZXWC 2UXXA 3FB8C 4K6NA 3ZHSA 3TGUH 4CH5A 3PZPA 1P84F 4J9ZB 1AVMA 4OX9O 1M57C 3RGZA 1VBGA 3X2QC 2ZD9A 4LF9O 2IW5A 3HB3B 2W9BA 4B3SB 1ZHQA 2CH7A 1ROPA 5FPRA 4WD3A 1FFTB 3ETJA 4J42A 3AG2B 4DR2B 1Q86W 1E1QG 1NH2B 4DR4O 1OJHA 3AK2A 2VQDA 4GUNA 5KT5A 2XUMA 5DG7A 4N21A 4WBNB 4A3CG 4NXMO 4DR4H 3CCJV 2R85A 1EKVA 4X9QA 4ZHQB 4O84A 4NZOA 4DV7O 3AG4C 1XOUA 3BCCH 4H13B 2HG8A 5A9GA 5J2UF 4IL6Z 4YB8B 2LW1A 2ZE7A 3KREA 4MV8A 2YWVA 5D5PA 1SA0A 3M7MX 2HJFC 3ETHA 3L75H 4IAJA 5H2FZ 3RTXA 5FLXN 4ZHQF 1BJTA 4FFNA 2YS8A 2GV9A 3TJTA 3CRAA 3NGDA 1S9FA 3OE7G 4JI7B 4FZ1A 2PBZA 2FPGB 2A7WA 2P4VA 3E8GA 1WP8A 4WFBV 5KG3A 1KT8A 2W9CA 2EJ2A 2XIGA 4FM1A 2PN1A 3SR2C 1GGOA 4IGGA 4NVPA 4A2BA 4MV1A 2WLLB 3STZC 4EKWA 3TIIA 3WB1A 5BMVA 5I60A 4M7EA 3D3IA 1H2SB 4DK1A 4O3RA 2ZM6O 3OTFA 4FFMA 5JH7A 1F4MA 2ZM6H 1DIKA 5KMGB 4B3SH 1R6NA 5B1NA 2Q9LA 3CCLV 4QW9A 5KFEA 2JEGA 1S03G 3IN5A 4MAMA 2AXTZ 3M9OB 2R7ZA 4XDJA 3PW7A 2WLJA 4QPKA 1IXBA 4DR2H 2ADPA 3BY6A 1RM1C 4PWQA 1S0OA 4JYBA 2GUZA 2BSKA 1VIBA 5EC2C 5EWGA 5EBMC 2ILMA 3WB0A 2JA5G 2CH7B 2XGQA 1P7GA 1LUWA 4YR3A 4A3FG 1NVPD 1Z2NX 4BIUA 3CSXA 2R7NA 2ZNIA 5KUKA 3RB6A 2JEFA 4BWSC 2F43G 2VWJA 4U7CA 2Q5ZA 4JI6B 3VBBA 2Q0AA 1KYOF 2QGNA 3RN4A 2UXDO 4B7EA 4AYBE 4UV8A 2OCCC 2C2DA 2UXDH 2HFEC 4MTGA 3W7SA 4R8CA 4EGJA 4MW3A 5I5TA 1N33B 3OUFA 3CXCU 4X1YA 3V4SA 2P5OA 4J9LA 4CE5A 1Y66A 4NTYA 3JCZA 4HZ3A 2V4DA 2HR3A 2LFRA 4GT1A 4K8XA 5BWUA 2ZDQA 4O7LA 4KL1A 5K3WA 4DLKA 4O7YA 1AROP 3K3PA 1MABG 1Q8IA 3RBDA 4I50F 1KJ9A 2EJRA 2BR0A 3AX6A 1Y67A 4KXRA 2W9CB 4BY7G 3TY5A 5C4XG 4DR1O 1TUEB 2BOBC 2IM9A 3OAAG 4MVZA 1BNCA 3QNEA 3Q8SB 2EULA 4WFFA 4QIWF 1W0KG 3ZHRA 3EHBB 3QQMA 1K4DC 1JCHA 1A48A 1Y1VA 4F50A 2AZ2A 3QVNA 1PL0A 3MWDA 4G27B 4LFBB 1VQ8V 4ZOLF 2W8LA 2VA3A 5DGHA 2HEPA 5JH7B 3JD3A 4GX1A 5CA1A 2XCPA 3E22A 2W6OA 2Y4RA 4YP3A 5DG9A 1M0TA 2FK1A 3SGIA 3DC5A 1W0JG 1Q82W 4FU0A 3JASA 2AZ0A 3JAWA 1N0JA 1M0WA 1J5EB 1YZBA 3ZRWA 5C5JA 3HKCB 4CBCA 2GUZB 3JZ6A 2BSKB 4JI6H 2GBOA 1L1FA 2AGPA 3L72H 5KFKA 2K9PA 2B9ZA 3PJSK 1SZTA 4U7OA 1VQPV 1XNQB 1IYDA 1N33H 1JR9A 2JJ2G 3LNNA 3RVYA 4X65B 1JKJB 4QWBA 1EZ1A 1ENVA 3OSNA 1EHIA 1VQMV 4LSAA 1MZEA 1I0HA 3MD0A 1YDXA 2UXCO 3K9SA 5EYPB 5KG0A 3MFHA 3ZMUA 4J41A 4X64O 2UUCB 4XZ3B 3HKDA 3BG5A 5KT2A 4R50A 3W1BA 5IYBO 3ASOC 4ED7A 1CQJB 2CDYA 4YQWA 4RB3C 4X8AA 3GIMA 5EZYF 2ZGIA 2QTSA 3RBEA 2R8HA 2VPSA 5LA6A 4LFBH 4JI8B 1S97A 2YICA 5LL6b 1IURA 4FM9A 4D7SA 1XHZA 2C2AA 1N32B 3W5OA 4FFLA 2VQFB 4UFZA 4PDBA 2NNUA 4K0KO 5LP6C 4FE2A 1GRJA 1UFIA 3P3NA 1NU1H 2GPSA 3ZIAG 3NBZB 4K0KH 1GSOA 1XL6A 2QE7G 4QW8A 1H8EG 1J95A 2R7KA 1Z2PX 4A2AA 2LGWA 1M56B 1G1XB 1XNQO 3E22B 2YUAA 4O4LA 3LUTB 3EYYA 4IRKA 1BMFG 2QYZA 1XNQH 1AN7A 4WFAV 3JASB 5BR8B 3T9BA 3JAWB 3OEHG 3STLC 5A2QN 1EN4A 4FZ0A 3P30A 5JJJB 3ZRWB 3IG0A 4X65H 4JV5O 1FJGB 4EBDA 3KYHC 3I56V 4LF4B 3Q8PB 4BXXG 3Q8RB 3BQ1A 3KCYA 3K03A 4ICGA 2UUCO 2WA3A 3T4DA 4A3GG 2Y69B 1UNNC 4JI5O 2HVRA 1K1SA 3M9MB 4Z2WA 5KFNA 2HHHB 1F51A 4DL7A 2EBOA 3HBLA 5KG7A 2W9AA 2UUCH 1L2ZA 2R9RB 3FYEB 4IZOA 5DG8A 5DLGA 3GIIA 3N40P 1HR0O 3ABKB 4CKEA 4H44B 2QWNB 4JI8O 3PFFA 3RYCB 1HNXB 4MTFA 5KHJA 2O03A 3RB3A 5LHIA 4YHHB 3D3QA 2J6TA 3FYIB 4JI3B 3B8MA 2VQEB 1H2GA 2WTFA 5LXTA 4JI8H 1PM9A 3BPZA 5GONA 3HKDB 1P7BA 2VQFO 2Q8VA 2L35A 2PVPA 3H1LH 4IT5A 1N32H 2IJKA 3ZRVA 4O3OA 2VQFH 4IWYA 5CR5A 5T14A 1DV2A 1FYJA 1WB8A 1CS0A 5LA6B 2PY5A 1FKAH 3OTOB 5BWVA 1OWTA 2Y0PA 4I4TF 4C7UA 5JCOA 3H1HH 4BW9A 3M8AA 4ECYA 3AW8A 2Y48A 3E2EA 4GX0A 2DIKA 4D6TH 1BZKA 1I08A 4O7ZA 2JA8G 1UPGA 1OZ0A 2YDEA 4I9QA 3A2FA 5BR8H 1Q3EA 5JJNB 3CCMV 1I5YA 5KFZA 4GKJO 3B40A 1Q81W 1FJGH 4O4HA 1KC7A 4LF4H 3LWBA 4Q4CA 4DR5B 2DLNA 1WRVA 2RDIA 1WP7A 3WG7C 2ZE6A 4O4LB 3D36A 3ABMC 2GQRA 5F2VO 2P7TC 2COIA 3LSSA 5CA0A 2BQRA 2HHHH 1BL8A 4JYAO 5KFJA 4NTXA 5FLXW 1RK5A 2DYSB 5KFQA 3K59A 1DTOA 2XAQA 3UZBA 4ZQIA 4YHHO 4LF7O 2VQEO 5IT9N 1ZL8A 3GTLA 1X59A 1CKMA 1HNXH 1K5SA 2Q68A 2Z5UA 3ASNC 4OGQB 1YJNV 4PZ8A 3FX7A 5EC1C 4YHHH 2W71A 4LF7H 2VQEH 3G8DA 4JI3H 2ZDHA 4TV9F 5KFDA 2XOKG 2QM8A 2WB1E 3KZIZ 2QA4V 2WYOA 5JQGA 1EUDB 1AI6A 1VF6A 1Y4MA 2H94A 2UXNA 2PZSA 4JI2O 4FFBA 1B6RA 2EZOA 2Y0IA 4IHJF 4PBCA 3U9SA 2XT9A 3T1YB 5B1AB 3T5HA 3CRMA 4FBTA 2XTAA 4O4JB 3HOZG 3V6JA 5LXTB 2R8GA 5BYAA 5GONB 3U54A 4JPRA 2AGQA 2MW2B 4DV4B 4LNUB 4HNVA 1IBMB 1E4GT 4O4JF 2Z04A 1JJ2U 1SQPH 3N44B 2Z02A 2P4KA 5JCOC 4DUZB 2A1HA 2X5RA 2ATLA 3HOVG 1TWHA 2CTQA 2JGUA 2CZGA 3VA7A 3UQ8A 5KX5A 2DOSA 3CP1A 3RF2A 4O86A 5D8DA 1SS3A 3R66A 5K1XA 1I94B 3L71H 5FNVA 1VEWA 3ABLB 4O4HB 3ZX6A 5DISC 2V7QG 5CE8A 4PJ0Z 3TEKA 3L9DA 2I87A 4RAYA 4X1KB 3C3SA 3SYOA 1YSCA 1R1BA 2YIDA 1XMOB 5DGAA 5CA0B 2FPPB 4YIPA 2N74A 2QKAA 2Q73A 2W0XA 1GN6A 2QR4A 2CKZB 2BTQA 2W6JG 1EBOA 1Y76A 4B3MB 1C30A 1HNWB 4FFRA 3R5XA 2P22C 5C1PA 1K7DA 4BBSG 2Q67A 1TWGA 3VMMA 3UCSC 2RN9A 1ZL8B 2QKCA 3CCVV 4AQYO 2YW2A 1DK1A 4MV6A 3LDCA 3OMAB 3T1YH 2EILC 4YJ2A 3SE7A 4AQYH 3I55V 1CXZB 1EZJA 4PDRA 2Q4PA 3IFXA 5JQGB 1FXVA 2BCCH 3WB2A 1YF2A 4FFBB 2ZCEA 4DV4H 2XCLA 1CKOA 1V9PA 4GKKO 1AUVA 4D7TA 4X62B 3QO7A 2R8KA 1HNZO 5IYBG 3QO8A 2UUBO 4GKKH 3E8FA 1L0LH 1I1KA 1VF7A 1WH2A 2X6AA 2WE6A 1EN5A 2HVQA 2V9WA 4DUZH 5CM0A 1SESA 5CA3A 1OHHG 4TQRA 4YR2A 4FS2A 4BR6A 1V51A 2LQTA 1OCCC 1H2KA 4MVOA 2PI4A 3WO0A 3GV8B 1BE3H 5D5QA 3CD6V 5KHHA 1QLNA 1AI5A 3L2PA 1TUBA 2R7ZG 5JVLA 3OM3B 2W7PA 4U3JA 1I94H 2J6UA 3JSNA 4MVQA 2FB5A 5I5UA 3W7TA 3THOA 1ZX3A 4PA7A 1H8HG 1FXHA 4NLGA 4FLZA 4MV7A 5IYCG 4LP8A 4RUCA 2V58A 2HGSA 4AILC 1HNWO 3MJFA 3K08A 3FAVA 2BQUA 1OCOB 4MVMA 2C28A 3TXSA 5D1PA 4B7KA 4B3MH 2CW8A 5EWEA 5FNVB 1HNWH 1F4NA 1OCRB 5LMUB 2H8PC 4J9NA 1EKPA 2W7OA 2HHFA 1SF9A 3ORQA 2RQ6A 2I8CA 5C93A 1AR5A 1NT2B 3ETDA 3N2GA 1TWAA 4KP4A 4ZI7F 3T5JA 1WB7A 2BTQB 1NZ6A 1Y76B 2QEXV 3ZHTA 3CCQV 1Q7YW 4EYIB 5J2UA 2AGAA 4X62O 1I2LA 3OHBA 4EQ5A 3VOUA 1F7YA 1IVSA 2HIXA 4X62H 4LWSA 4UCOA 3L73H 4I0XB 5ITZA 1KU9A 4ZHQA 5CBHA 4P9PA 3H01A 3MWEA 3QFFA 3N6RA 3K04A 4JAAA 2UVWA 1NBMG 1DLBA 2R72A 1Y14B 3FB6C 1Y1VG 1CPYA 4DYLA 4QGPA 2FL4A 3ZMVA 1ULZA 3UFXB 3OFNG 4GC6A 4AHCA 2WLHA 2YZNA 5CB4F 4DR7O 3KTMA 5A2QW 3CX5F 2DYRB 5E79Z 1XI1A 2HIVA 5DLFA 3I12A 4JI4O 3B77A 3R65A 4R6ZA 4U3JB 4A3LG 4DR7H 4J7ZA 1S10A 3RAQA 3JD0A 4I5SA 1COWG 4N23A 3JD4A 3DTGA 4JI4H 1SQQH 2NU6B 2FLLA 2YI9A 2Z0AA 1VQ6V 4RNOA 5JUMA 5DMXA 2ZDGA 3CJHA 3HKZA 1S68A 1AP5A 2WAQE 3B8NA 4X66B 2X0LA 1SFOA 3J81W 1TAEA 3MFIA 3FAVB 1WLEA 2ITDC 4RQEA 5KFOA 1GN2A 5KT3A 4UB8Z 2E5LO 4M0JA 4IYHA 3T9AA 5KFWA 2HHFB 2QSAA 5H6RA 1VBHA 2FB9A 2YEVA 2E5LH 4XYMB 5KFRA 1CKNB 2Y4UA 4DXWA 1NH2D 1GAXA 4O7WA 3W1GA 4IR1A 1Y74A 3N2GB 4PI0A 1XREA 2KQXA 2OTLV 4GX5A 5KAFZ 1W93A 3FDSA 3AG2C 2M7WA 3G6BA 4DL2A 2Q0OC 1NTZH 4MW8A 5J2UB 4BAYA 5IJ0B 2ZIMA 3BA9A 4MTDA 4LFAB 3QZ7A 4LWSB 5KG6A 5ITZB 2EIMB 4J9MA 1KP2A 5TISZ 2QF7A 5EWFA 1I5XA 4DW0A 3CC4V 2W8KA 2HJDA 5IDJA 3W7WA 2DMXA 3RJ0A 2J9GA 4B3TB 3MHSC 2WWWA 4I50A 3U0ZA 1ZHSA 3NUAA 4P2ZA 1SRYA 4ME6A 2UVRA 3GDEA 2RJZA 1PNKA 2CQYA 1GSHA 3OUZA 4AYBA 1VQ9V 4M9UA 3MHHC 4DV6B 4QIWA 4EEQA 3MDSA 5DECA 3FB5C 2Q7GA 1X4TA 4FBUA 5IP9G 2GPWA 4RAIA 3EPGA 1O75A 5F9NA 1P4RA 3OMNB 2FLPA 4QE9A 1ZTEA 3EVKA 1I50A 4ZOLA 3ZCCA 2ZQMA 4P9OA 4MV9A 2WDTA 4X66H 3V4ZA 2LP7A 4TOIA 5H5NA 3HR0A 3RV4A 4LF8B 2EINB 3SYPA 3HOWG 2YRXA 3WWJA 1R9TA 4B3SO 1ZLZA 2N04A 4NTWA 3GTMA 3CJHB 3LNMB 2F95B 3T54A 3N2KB 3A0RA 3F5WC 1W2BU 1PPJH 4DR2O 1GKFA 2VR1A 4DV0B 3W7UA 2VWKA 5IYZF 3RV3A 2FYUH 1RJRA 3AK3A 2DZDA 2R8JA 4KHPB 2JK5C 2YEVB 3HKCA 4LFAH 1S3JA 3MR3A 1M90W 4Q8FA 1AI4A 1Y74B 5KFIA 4DL3A 1K97A 1VF5B 4B3TO 1AB3A 2D2CB 1IDSA 5J2TF 5KFYA 3ORRA 2D3OW 4B3TH 4JI0B 5KT4A 4JTAB 3RYFA 1VARA 4MTXA 1K73W 1X9NA 1RK6A 1PNMA 1SKVA 3JRWA 4K8ZA 2WLMA 3T4ZA 1SCUB 2XAJA 2VUMA 4JASA 2RCVA 4JI7O 3U10A 2QDOA 2WAMA 2CTPA 1VMGA 2JA6A 2HLDG 2Q7HA 4BIOA 1JPXA 4DV6H 1S5LZ 4JI7H 4O3PA 1S5HC 3J7AU 4CS4A 5EZYA 2WPDG 3UM7A 1KJJA 5K2MA 3TY9A 4I50B 3A8TA 5EYPA 4PELA 4TQFA 3LDDA 3RUPA 2EJ3A 1KMIZ 3E89A 4TSFG 1GMGA 5LOVF 3VQVA 1WPXA 3AG3B 2M05A 5KG4A 4HR7A 3T9EA 3JARA 1RJQA 2BTOA 5IE9A 4NKGB 4RUEA 1G2WA 3W7XA 4J0MA 1NVPB 3BFRA 1G6UA 3BABA 2V59A 1VQKV 4ZOLB 3SYCA 3AG1B 3Q2OA 1N36B 3BEHA 1XDCA 1XMQB 3T1HB 3OT7A 3K5HA 2YZLA 3HOUG 2JS3A 4KHPO 3IGAC 4DV3B 5BWRA 4OPHA 3TETA 1R3KC 3CCRV 1QQCA 4E2LA 4UB6Z 5BPFA 4KHPH 1JDBB 1Q90D 2YSUB 1UC8A 2EIYA 5IYDO 1NTKH 3N8DA 1XHXA 1AR4A 1UJWB 5C8YF 3DC6A 1GM8A 3HOYG 1JXLA 4JI0H 4JI6O 1JA8A 3FB7C 1Z5VA 3K5IA 3CQZA 2FLNA 1T36A 2JVDA 2W6PA 4J9QA 2GSMB 1GN3A 4PDLA 1JIHA 1YI2V 3QZ8A 4YJ3F 1N33O 2CGOA 3OEEG 2ZE5A 4WHXA 2YI8A 5HFMA 4FPPA 3R9RA 2P67A 3RYFB 3J80N 3PW0A 4O3NA 4TUYF 5DEDA 1A9XA 4TM5A 2ZINA 3KHGA 3S24A 3BQ0A 5KG5A 2UU9B 3JAMW 3UO3A 2WLNA 3RYCA 2R9IA 2YXHA 5EZYB 3D8CA 1SQFA 3ZHQA 5CBGA 2R6FA 1PP9H 4MS2A 4FK5C 1MZFA 4I4TA 4PA9A 3TINA 1N36H 2ETNA 3P3PA 3OR6C 1E4EA 2FJZA 4ECVA 1XMQH 3T1HH 4LFBO 3JARB 2A3QA 4FFKA 1FPOA 4O4IF 4DV3H 4JI1B 5HFLA 3EXAA 1GM7A 5B5EZ 3VOTA 3JALB 3MR5A 4CMDA 3GILA 4I9WA 4B08A 3OGCC 1KBHA 4GLWA 4H0LB 5BWXA 1IXMA 2ZIOA 2J6SA 3T1CA 1J5EO 3ETQA 4YY3B 3U0GA 5IJ9A 4XDKA 3K5MA 1MA1A 3TQTA 5I5WA 2OT5A 1J5EH 3KXYT 1FFXA 5IYCO 5KFPA 1M56C 4F6RA 5KHIA 3CC2V 1V55B 3R23A 3VQWA 5KHGA 1FVIA 4UCUA 1LR1A 5KFMA 5L1IA 5KFCA 4GLXA 2R92A 2Q6AA 1Q6IA 4JGSA 3T99A 3OUSA 3JRXA 2W70A 2IMWP 1Y1WA 2OTJV 1JX9A 4X65O 3PO3G 5EK0A 2AGOA 2CUGA 1XK5A 4TV9A 3QO5A 3JZIA 4WFHA 5FL7G 3GIKA 1NQTA 4Q43A 4UUJC 3BVOA 4KFMA 1SQVH 2Y69C 4HNUA 1E79G 2NLJC 2O57A 2PYLA 4IHJA 1M7JA 1ZUQA 1XBLA 5CAEB 1FS0G 4MT8A 3GIPA 2UUAB 3JAKA 5LP6F 1QVFU 3ABKC 3ZRXA 2B1GA 4HYKA 3G4SV 1P49A 1IBKB 2DABA 3K9AA 1GO3E 4PZ7A 4A3DG 2M6YA 1QNMA 2ODMA 4PA6A 3ETGA 3FFQA 4JI1O 4Q8EA 2HVSA 3GV5B 1R3IC 3IAYA 1FXKA 4O4JA 4JI1H 2P90A 1N32O 3T7AA 1LNQA 2HP8A 2WB1A 2YCHA 1Z2GA 4I4TB 4Z1MG 4E4TA 2X6CA 4HBNA 5IWAB 4JXUA 1PV0A 4O2AF 1E4EB 4LNUA 1FKAO 3JSLA 2PF4E 4YY3H 5KFUA 1EKFA 2Z3YA 3K5NA 3T2MA 4A5UB 4GC7A 2RMKB 1CP9A 5BR8O 1N34B 4DQNA 4JV2A 1V54B 4FIPC 4Q6GA 5IJ9B 3OW2U 2N05A 3WU2Z 1FJGO 4LF4O 1G8MA 1FFXB 3AG7A 4F6RB 2JA7A 2JA5A 1L0NH 2B63A 1K9MW 1HP8A 4FLXA 2NR5A 4J9SA 1TVKA 4X1KA 4DR3B 2HHHO 4DV1B 4LF5B 2UUAO 4BBRG 4Y8VB 5GTHZ 2DYSC 2IJJA 4TV9B 2UUAH 2IBKA 5DGIA 2C35B 1HNXO 1IBKH 3GVMA 1GN4A 2ATKC 1VQOV 3B2EE 4JI3O 3NC0B 2QTOA 4IHJB 4HN2A 2SCUB 4OPAA 4ECRA 3DAAA 1TWCA 4ECTA 2FP4B 2CGNA 2LFSA 2IBZH 3CPWU 3E5NA 5I5YA 3JAKB 3M9NB 5H6QA 4L8JA 2W6IG 2F4VB 3Q8QB 5IWAH 4C2MA 2EIKB 4DV2B 1OCZB 4ED2A 5C44G 5B1AC 4DR6B 1OBDA 3FKSG 3OTOO 5C1OA 2Y0SA 3GTGA 3RAXA 3ETEA 1FXKB 2HDKA 4C5BA 3OTOH 5L1KA 2K1EA 2NU9B 3TW7A 2NVYA 4RU9A 2F66C 3OR7C 1KUTA 3GTQA 4NXNB 4DL5A 2QKSA 3C0FB 4JV0A 1VP7A 3Q1KA 1S5JA 1YHQV 1N34H 2OIGA 3PO2G 4X1IA 3ZN1A 4TWKA 1AP6A 4MTEA 3E35A 5KFGA 5KFXA 4DR5O 2DWDC 4DRXA 4O83A 2DE0X 3GB7C 4LF5O 4JTDB 1PK8A 1B33N 4LFCB 4DR5H 1EUCB 2CNQA 4Q4DA 4DR3H 4B3RB 4DV1H 2YZGA 4LF5H 4F4XA 3G6XA 3ABLC 4K3AA 5IYDG 3ABUA 4LH6A 3RYIA 4ZI7A 4IYIA 3QTCA 3HKEB 2B5UA 3PVXA 3D36C 2R8IA 3BJYA 4DL6A 1MSWD 2ASDA 2H3OA 3NXSA 1TVKB 5L3CA 1LUVA 4HNTA 5C3EG 5BPHA 3LDEA 2DQ0A 5JVDA 2ADQB 2W0FC 3APOA 3T5LA 3IJ4A 1SQXH 1TGOA 4WFEA 2E2HA 1US6A 2IP4A 3OUUA 4DV2O 2W6ZA 4BW5A 3TW6A 5EBWC 3T1YO 1MSDA 3LMLA 2ZNJA 2Q2TA 4DV2H 4DR6H 2YS6A 4I0XA 2PTMA 3H4BA 5JWPA 3RFCA 2RGRA 2EJ7A 3TY8A 1VF6C 5J9PC 3SPIA 4DV4O 3E86A 1IBMO 3RIZA 2FPIB 2R7MA 2G38A 2B1IA 5GTIZ 2FE3A 1AJNA 1K92A 3CYOA 1IBMH 2R87A 3K5OA 1YIJV 3U9TA 1QLEB 1P16A 4RUFA 4F6EA 5I5SA 3CS5A 5CB4A 2WLKA 4DUZO 1ET0A 4I55F 3DTUB 3EFFK 3CRQA 1ZAUA 1SETA 5LYJB 3AEIA 5KKNB 4R8UB 2AHYA 3APQA 4MVRA 1GK9A 2R86A 5B66Z 4PV1B 3KHHA 1I94O 2ZR3A 4B3RH 1FD9A 1R6KA 1M5IA 3GWOA 4GYCB 4X1IB 1S77D 2PMZA 3RGXA 4W4LA 1U96A 4O2BF 4EFEA 3WWHA 5LYJF 5EOYA 5KA5A 4CC5A 3LSUA 4DRXB 5B3SB 3C3TA 3K57A 1XMOO 4TV8F 1MZBA 2XAFA 3K06A 4DUYB 4RB1A 1OCOC 4B3MO 5LHHA 1XMOH 3K79A 4MTOA 4U6PA 1OCRC 4H33A 5I5VA 3RYIB 4ZI7B 4WF9V 3CRRA 3JATB 4JUZA 3K58A 2DWEC 2VUMG 2XCAA 5KG2A 2KSDA 1E4FT 4A3EG 3SYQA 3I4MG 1CKNA 5JVDB 2JA6G 4CC6A 4ZIBA 4DV5B 1NKDA 3DSQA 2JDIG 1PD3A 1D5AA 3SJCC 1VQ7V 4O3QA 2ZDIA 3SPCA 5IJ0A 4ED8A 1AI7A 3MAQA 5HV6A 3OHAA 5JVDF 1JVMA 3K5LA 1VQ5V 3F5TA 1YTFD 2AU0A 3DTFA 5I47A 3LSQA 5KFHA 3PW4A 4FM2A 1G4YB 5IY5B 5KFLA 1ORQC 5FJ8G 2IJHA 1FAFA 5FPOA 5L3FA 1SEIA 4RCNA 2C22A 1YEWA 2UVVA 2IH3C 3PR5B 2CTRA 5CB4B 2XD4A 1JMKC 1WAZA 4QSHA 3H40A 4OX9B 5KFVA 2GTAA 2PYJA 4LF9B 1I7FA 4DUYO 3LULA 2R93A 4FMTA 5L3GA 4NZNA 3OD4A 2JJ1G 3DXRA 5BZBA 4F4WA 4NR1A 3GV7B 3UT5A 4PDMA 4J9PA 4DUYH 2DYRC 4RO2A 1I7LA 5LL6Y 5EIBC 5LMUO 2UXBB 3RR5A 2HGXA 2LGQA 2EX3A 1YXBA 3HO8A 1RPOA 4E4EA 4FFPA 3N6XA 4MVSA 5L1JA 5LMUH 5IYZA 4XBFA 4FM0A 1D5NA 3GLKA 2YIBD 4PA3A 4CHIA 4NXMB 1XEQA 5DN6G 4IIJB 3N2KA 5B1OA 1K33A 4WCEV 4DV7B 1DV1A 4EB6A 4KUMA 4A3BG 4CH3A 1K4CC 1GM9A 1ZSPA 4G2KA 5J2TA 3IC9A 2BQ3A 2EIJB 4O7NA 2LJ2A 1H38A 4IIJF 3G67A 1AUXA 3N27A 5HNEA 4ECZA 5B1BB 3FKIA
chains in the Genus database with same CATH topology
1QQCA 3QG5A 1N32H 4O2BB 4KHPH 3FMAA 2VQFH 2CW7A 5FD6A 3HXLA 1XHXA 4LFCH 4TV8B 5LA6B 2PY5A 1FKAH 3OTOB 5LOVA 4JI0H 4CH6A 4OX9H 1Z5VA 5JCOA 2ZM6B 4BW9A 4LF9H 2JVDA 3BHPA 1Q5OA 2Q2UA 2OYQA 4I9QA 3A2FA 5BR8H 1HNZH 1Q3EA 5JJNB 1Q43A 2YI8A 3U11A 2UXBH 2UUBH 3J80W 4IIJA 2KSWA 3RYFB 2VUGA 1FJGH 4O4HA 1HW7A 4HNAB 4LF4H 4LF6B 4DR5B 2ZINA 1RSOA 4O4LB 3S24A 3UT5B 4NXMH 2CFMA 2UU9B 3JAMW 5CA0A 4DV7H 3RYCA 2HHHH 1XQ8A 5EZYB 5FLXW 1SQFA 4PZ6A 5C8YA 3K59A 1SQGA 5KX5B 4UCSA 5IYZB 2W57A 5IT9W 4LSXA 4I4TA 1CKMA 1N36H 2UXDB 3N42B 1HNXH 2F93B 5FD5A 4PZ8A 4TQDA 4DR7B 1M93A 4YHHH 3T1HH 1XMQH 4LF7H 2VQEH 2YIBA 4JI3H 3ZS8C 3JARB 1B04A 4EB6B 4PHZA 3RYHB 4JI4B 4DK0A 4DV3H 4JI1B 3ICXA 2WYOA 4RZQA 5JQGA 4YJ3A 5J2TB 3JALB 2PZSA 2YIAA 5D1OB 4FFBA 4B08A 4TUYA 3T1YB 2ZJTA 1GYFA 1VS0A 2ZIOA 4O4JB 2Q7EA 3ETQA 5LXTB 4YY3B 5IJ9A 3K5MA 4PI2A 5GONB 1J5EH 3KXYT 1FFXA 4DR1B 2E5LB 4X20A 1Z5WA 3RWRD 4F6RA 5KHIA 4DV4B 4LNUB 4WBNA 3MWMA 3VQWA 1IBMB 4HNAA 4YJ2B 5KHGA 1FVIA 3VNNA 4UCUA 2OWOA 1JJOA 5EIBD 1E4GT 1SYXB 1P8LA 4GLXA 3PN1A 4CH4A 3N44B 5JCOC 5LOVB 3SJBC 3BA8A 4DUZB 1XK5A 3J7AK 4TV9A 3SJAC 4LMYA 2JGUA 4LF6H 4O4IA 3UQ8A 5KX5A 4DR4B 3RF2A 5KHKA 2PYLA 1A0IA 5K1XA 2KKWA 4IHJA 1I94B 4FLWA 5FNVA 4O4HB 4LF8H 5DISC 5JJEB 4DV5H 2UUAB 3JAKA 2QM4A 4RAYA 1P49A 3CB2A 4X1KB 1IBKB 3JALA 3GB8B 1TUBB 4PZ7A 5D1OA 3QF7A 2QJ1A 1XMOB 3FFQA 3KAJA 4RB0A 1WN7A 5CA0B 1SA0B 2HVSA 4BWAA 2BTQA 4B3MB 3IAYA 1HNWB 4DV0H 4LR3A 4O4JA 2XHBA 2P22C 5C8YB 4JI1H 3VQYA 3N43B 3BRCA 2YCHA 2RGVA 4I4TB 5KMGA 4HBNA 5IWAB 3T1YH 4CS3A 4LNUA 4YJ2A 3JSLA 4DV3B 4CH5A 4AQYH 2UXCB 4YY3H 3K5NA 3RGZA 5JQGB 3CHXA 4YJ3B 4X64B 4DR1H 3WB2A 4ETSA 4FFBB 2ZCEA 4DV4H 4B3SB 1CKOA 1V9PA 1ZHQA 4TUYB 4D7TA 5BMVB 4X62B 5FPRA 5LP6A 1N34B 4GKKH 4Q6GA 1WH2A 1VF7A 5IJ9B 4DR2B 2WE6A 2HVQA 5K1PA 4DUZH 5LMNB 1FFXB 4UCRA 4X20B 4F6RB 4FVMA 4WBNB 1JFFA 4DR4H 4FLXA 4ZHQB 2CAZC 1TVKA 4X1KA 3L2PA 5D5QA 4DR3B 5KHHA 4K0KB 1TUBA 4DV1B 4LF5B 1BGWA 4U3JA 1I94H 4O2AA 3JSNA 5D5PA 1SA0A 2R70A 3M7MX 4TV9B 2UUAH 3THOA 4UCVA 4IAJA 3RTXA 4O4IB 4FLZA 4MV7A 4APMA 1IBKH 1BJTA 1M4UA 2GV9A 2HGSA 4AILC 4JI7B 3B2EE 3NC0B 4IHJB 3GJXB 5D1PA 4B3MH 2CW8A 1HNWH 5FNVB 5LMUB 2XIGA 4FM1A 3SR2C 3JAKB 4JV5B 4L8JA 4NVPA 2RQ6A 2F4VB 5IWAH 4A2BA 1NT2B 4DV2B 3N2GA 4DR6B 1L8DA 4RAZA 3KALA 3WB1A 5BMVA 4M7EA 2BTQB 4JI5B 4DK1A 1H2SB 2UXCH 4X1YB 3OTOH 3N41B 3OTFA 5J2UA 4X64H 1WNSA 3H20A 5JH7A 2F66C 2ZM6H 4EQ5A 5KMGB 4NXNB 4B3SH 1HR0B 2HIXA 3C0FB 4X62H 4UCOA 1S03G 5ITZA 1KU9A 1S5JA 4FLVA 1N34H 2F1MA 4ZHQA 4X1IA 4DR2H 4MTEA 4R7RA 5LMNH 4DRXA 3L4JA 3WB0A 1DGSA 4DRFA 4RB2C 4DR5H 4LFCB 5LP6B 2R72A 4DR3H 4B3RB 4DV1H 4LF5H 1Z2NX 3CSXA 2ZNIA 2UU9H 4BWSC 3F8NA 4LH6A 3RYIA 4ZI7A 2VWJA 5CA1B 4JI6B 4AHCA 3QTCA 3HKEB 2Q0AA 1JFFB 5A2QW 4FLTA 1TVKB 3K3VA 1XI1A 2UXDH 2HIVA 5JVDA 4U3JB 4O2AB 4DR7H 1N33B 1TGOA 4JI4H 4X1YA 2P5OA 4GKJB 4FLYA 2YI9A 2VOBA 4JV5H 2V4DA 1S68A 3LMLA 2ZNJA 4K8XA 2Q2TA 4DV2H 4X66B 4KL1A 4CS2A 3QWUA 3J81W 4DR6H 1TAEA 1Q8IA 2JS5A 3L4KA 4JI5H 2PTMA 2RGRA 3TY5A 3TY8A 4JYAB 3RGBA 2IM9A 2MCTA 2E5LH 3RIZA 3RFRA 1CKNB 1HR0H 3W1GA 4LF7B 1XDNA 3N2GB 2FE3A 4PI0A 1IBMH 2PGGA 3K5OA 1P16A 5CB4A 4LFBB 1ZAUA 5J2UB 5IJ0B 5LYJB 1IBLB 2HEPA 2ZIMA 5JH7B 3BA9A 5CA1A 4MTDA 4JI2B 4LFAB 3E22A 1M0TA 3HKEA 3SGIA 5ITZB 3M4IA 4B3RH 1M5IA 4X1IB 4GYCB 3JASA 3RGXA 3JAWA 1M0WA 4FLUA 1J5EB 4EFEA 3RJ0A 4B3TB 1WPBA 4I50A 3U0ZA 3HKCB 1ZHSA 5EOYA 4JI6H 4CC5A 4DRXB 3GDEA 3K57A 2RJZA 1MZBA 1XNRB 4DUYB 4RB1A 1XNQB 4DV6B 1XMOH 4EEQA 2Q7GA 1N33H 1X4TA 3LNNA 3RYIB 4ZI7B 4X65B 1O75A 3JATB 4GKJH 4I55A 3HKBA 4ZOLA 3K58A 4LSAA 1E4FT 2WDTA 4MV9A 4X66H 1CKNA 4TOIA 5JVDB 2R9AA 5EYPB 4CC6A 4LF8B 4E6NA 4ZIBA 4DV5B 3DSQA 3HKDB 2UUCB 4JYAH 3HKDA 4UCTA 1TA8A 1D5AA 3SJCC 3W1BA 1T5EA 4O2BA 2PUSA 5LYJA 5IJ0A 3MAQA 2F95B 4RB3C 3N2KB 3K5LA 2YXLA 4DV0B 2VPSA 4TV8A 5LA6A 4LFBH 4JI8B 3VQXA 2VWKA 4FM2A 5LL6b 4FM9A 4D7SA 1IBLH 1XHZA 1N32B 5FPOA 3W5OA 4KHPB 3HKCA 4JI2H 1SEIA 4LFAH 2VQFB 4UFZA 4PDBA 4I7HA 1YEWA 2E3CA 5LP6C 4AQYB 5CB4B 1QHTA 3BAAA 3NBZB 4K0KH 1JMKC 4B3TH 4JI0B 1O9HA 3RYFA 4OX9B 1Z2OX 1X9NA 1SKVA 4LF9B 2PYJA 1Z2PX 4A2AA 1I7FA 3JATA 4K8ZA 3E22B 4O4LA 3U10A 3UT5A 3EYYA 3NBYB 1XNRH 4GKKB 4DUYH 1XNQH 1AN7A 2Q7HA 4DV6H 3JASB 5BR8B 1HNZB 4JI7H 3JAWB 5EIBC 4CS4A 5EZYA 2UXBB 2UUBB 3RR5A 1I6UA 5JJJB 2EX3A 3TY9A 4I50B 3IG0A 1FJGB 5EYPA 4X65H 3KYHC 4TQFA 3KAKA 3N6XA 4LF4B 5LMUH 5IYZA 4FM0A 3ZEDA 1KMIZ 2YIBD 4NXMB 2F4VH 3DF7A 3VQVA 2HVRA 4IIJB 3N2KA 4DV7B 3JARA 2HHHB 3CVZA 4EB6A 2BTOA 3RYHA 4CH3A 2UUCH 1L2ZA 4J0MA 1G6UA 3BABA 4Q0YA 5J2TA 4EFBA 4LH7A 4I55B 3HKBB 3N40P 4ZOLB 1O9GA 1N36B 3RYCB 1HNXB 5KHJA 2O03A 4NXNH 4YHHB 1XMQB 3T1HB 2VQEB 4JI3B 5LXTA 4JI8H 3BPZA 5GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY B;  1XNQ B;  1A0I A;  4DV6 B;  4EQ5 A;  1I94 B;  4NXN B;  4EEQ A;  1HR0 B;  2HIX A;  4UCO A;  4X65 B;  5DIS C;  2UUA B;  3OTO B;  1IBK B;  3GB8 B;  4PZ7 A;  5D1O A;  1XMO B;  2ZM6 B;  1CKN A;  4TOI A;  2HVS A;  4CC6 A;  1DGS A;  4B3M B;  4LF8 B;  4DRF A;  4DV5 B;  1HNW B;  2UUC B;  4E6N A;  4LFC B;  4UCT A;  1TA8 A;  2Q2U A;  3W1B A;  4B3R B;  5IWA B;  4LH6 A;  2VUG A;  4JI6 B;  3JSL A;  4DV0 B;  4LF6 B;  4DR5 B;  2UXC B;  4JI8 B;  3S24 A;  4X64 B;  2CFM A;  2UU9 B;  2HIV A;  1N32 B;  5FPO A;  3W5O A;  4KHP B;  4B3S B;  1CKO A;  1V9P A;  4UFZ A;  2VQF B;  1N33 B;  4X62 B;  4PZ6 A;  5FPR A;  4AQY B;  1N34 B;  4GKJ B;  4UCS A;  3BAA A;  4DR2 B;  3NBZ B;  1S68 A;  2HVQ A;  1CKM A;  2Q2T A;  4JI0 B;  2UXD B;  4X66 B;  4OX9 B;  3QWU A;  1TAE A;  5LMN B;  4DR7 B;  4UCR A;  4PZ8 A;  1X9N A;  4LF9 B;  1B04 A;  4JI4 B;  3TY5 A;  3TY8 A;  4JI1 B;  3NBY B;  4JYA B;  4GKK B;  3L2P A;  4DR3 B;  4K0K B;  4DV1 B;  4LF5 B;  5D1O B;  5BR8 B;  1HNZ B;  3JSN A;  2UXB B;  3RR5 A;  1CKN B;  2UUB B;  3W1G A;  4LF7 B;  1XDN A;  3TY9 A;  3T1Y B;  1FJG B;  3KYH C;  1VS0 A;  4UCV A;  4LF4 B;  3RTX A;  1P16 A;  4YY3 B;  4LFB B;  1ZAU A;  4NXM B;  4JI7 B;  3NC0 B;  4DR1 B;  1IBL B;  2E5L B;  2HVR A;  4DV7 B;  4DV4 B;  3GJX B;  2HHH B;  3BA9 A;  5D1P A;  4JI2 B;  4LFA B;  1IBM B;  1FVI A;  3VNN A;  4UCU A;  5LMU B;  2OWO A;  3SGI A;  3BAB A;  1P8L A;  4GLX A;  4EFB A;  4LH7 A;  4JV5 B;  3PN1 A;  2F4V B;  1J5E B;  4EFE A;  4DV2 B;  3BA8 A;  1N36 B;  4B3T B;  4DUZ B;  1HNX B;  1XK5 A;  4DR6 B;  1XMQ B;  4YHH B;  4CC5 A;  3T1H B;  2VQE B;  4JI3 B;  4JI5 B;  3GDE A;  3UQ8 A;  4DR4 B;  4DV3 B;  1XNR B; 
#chains in the Genus database with same CATH topology
 4IWX A;  1D2D A;  4C5C A;  2GTS A;  2NU7 B;  4O3S A;  4J9O A;  1DF5 A;  4DW1 A;  3KHL A;  1CE8 A;  2CW7 A;  3SPG A;  2EIM C;  2ZXW B;  4J9R A;  3GTJ A;  1WR2 A;  4O7R A;  1M57 B;  5LOV A;  4ECW A;  4JTC B;  4OX9 H;  3X2Q B;  2YC0 A;  2WLI A;  4J7J A;  2ZM6 B;  4RNM A;  1IX9 A;  4X88 A;  4ECS A;  1EFR G;  3H0G A;  2A0L A;  4LF9 H;  3GTK A;  5BWW A;  1K1Q A;  5DQG A;  4ECU A;  4IR9 A;  4A3K G;  2UXB O;  1Q5O A;  3UO2 A;  3GIQ A;  2ASL A;  1BHA A;  1C3O A;  4IRC A;  2Q2U A;  1F23 A;  2DW4 A;  2OYQ A;  3PR4 A;  1I1M A;  3V6K A;  1Q43 A;  2UXB H;  4UVB A;  3U11 A;  1RYS A;  2KSW A;  1HW7 A;  1NI8 A;  4HAM A;  1NS1 A;  3JD1 A;  4HNA B;  4LF6 B;  1S72 V;  3DXR B;  4X66 O;  1RSO A;  5F9L A;  4I7Z B;  3UT5 B;  4YXW G;  1N8R W;  4NXM H;  4ABM A;  2CFM A;  3AG4 B;  4QE7 A;  1OBG A;  3UKM A;  2CNV A;  3CSW A;  2R92 G;  4DV7 H;  5DM6 V;  1Y1W G;  2EIN C;  1I3Q A;  4JAU A;  1KP3 A;  2FML A;  2QWR B;  4WBN F;  5C8Y A;  1U97 A;  1SQG A;  3GIJ A;  1EZV H;  4UCS A;  2ITC C;  5IYZ B;  5IT9 W;  1BQZ A;  4TQS A;  3VPC A;  4LSX A;  3Q4H A;  4UVC A;  4Q44 A;  2UXD B;  3N42 B;  2F93 B;  3ZMS A;  2GDS A;  1DAA A;  2X0S A;  2GLT A;  1M93 A;  4UV9 A;  4A93 G;  4EB6 B;  1WA8 A;  1WCM A;  3HKZ E;  4DK0 A;  1MOF A;  1R3J C;  4RZQ A;  4H37 A;  3RT3 C;  4YJ3 A;  3KG2 A;  1JX4 A;  5J2T B;  4LFA O;  2YIA A;  5D1O B;  5E25 A;  2X7R B;  1Y6X A;  4TUY A;  2HJW A;  2IH1 C;  1GYF A;  1VS0 A;  1EM1 A;  3E8H A;  5EBL C;  3BAC A;  5CMU A;  4L1K A;  3A0H Z;  4R7C A;  2OIE A;  1N0N A;  4RQF A;  4DR1 B;  4X20 A;  3OGI B;  3OSP A;  3RWR D;  3WO1 A;  3MWM A;  4ED6 A;  1B6S A;  3VNN A;  3TQ1 A;  1V4Y A;  2XAH A;  1JJO A;  1SYX B;  1P8L A;  1M1K W;  3CC7 V;  4DV6 O;  4C5A A;  4CH4 A;  4EBE A;  3H3V H;  4LF6 O;  3TK1 A;  3E8B A;  5LOV B;  4FGR A;  2ASJ A;  1RM1 B;  2L6L A;  4RWU A;  2WLI B;  2W6Q A;  2W9B B;  3J7A K;  5GW7 A;  3SJA C;  5L1L A;  4WFG A;  4LF6 H;  4O4I A;  5L3B A;  1BGY H;  3KHR A;  2VRZ A;  3AG3 C;  1A0I A;  4LF8 O;  5KFB A;  1THZ A;  2LO1 A;  3T9C A;  4J80 A;  2YL2 A;  3KKY A;  2ALZ A;  2COG A;  4LF8 H;  5JJE B;  2FKX A;  1SZX A;  4OXS A;  1JOY A;  2QM4 A;  4JYY A;  2ODT X;  4EEY A;  3WNZ A;  4QIW E;  2JA7 G;  1RSO B;  3AG1 C;  3CB2 A;  5BXZ A;  1VQN V;  4RZR A;  3JAL A;  2QK4 A;  3GB8 B;  4GZR B;  3LQS A;  2OCC B;  4Z1V A;  5FLM G;  2B63 G;  4U7N A;  2QJ1 A;  4DV0 O;  3TCU A;  2KB1 A;  2IA6 A;  1S76 D;  1SA0 B;  4NYE A;  2W6M A;  4BWA A;  2I80 A;  4NB5 A;  4DV0 H;  4EYH B;  2QWO B;  5C8Y B;  2P06 A;  1YJ9 V;  3N43 B;  3BRC A;  3Q4H B;  3T9D A;  3WWI A;  3HPL C;  4CS3 A;  4UUG A;  2GHY A;  2VA2 A;  1BT8 A;  2HVJ C;  3L70 H;  1VQL V;  1WA8 B;  3I5D A;  4JI0 O;  1AR1 B;  2UXC B;  3K0D A;  2JRI A;  5IP7 G;  3M99 B;  2DQ3 A;  3CHX A;  4YJ3 B;  4X64 B;  2YXY A;  3O9O A;  4DR1 H;  4ETS A;  2A06 H;  2E2I A;  4W4K A;  2ABJ A;  1RJP A;  3K0G A;  4TUY B;  2A79 B;  5BMV B;  5LP6 A;  3RVZ A;  3ZBH A;  3C90 A;  2CNU A;  2Q69 A;  4F4Z A;  4RNN A;  5K1P A;  3GID A;  1S0N A;  3PW5 A;  4NYK A;  4FJC C;  3CCS V;  5LMN B;  4UCR A;  1KTA A;  4X20 B;  3CEB A;  1KUQ A;  1N48 A;  4FVM A;  2ZE8 A;  1JFF A;  2NVX A;  1A0G A;  5BMV F;  1MG1 A;  4NZM A;  2CAZ C;  4K0K B;  1BGW A;  1SER A;  4O2A A;  5JH7 F;  2DJV A;  1JQ0 A;  2R70 A;  3UZO A;  2A9H A;  4UCV A;  4O4I B;  1N36 O;  4APM A;  5LGT A;  3ZHV A;  1M4U A;  1K3E A;  3G6E V;  1XMQ O;  2BE3 A;  3T1H O;  1XIL A;  4DL4 A;  1YVW A;  5KUM A;  3GJX B;  3E83 A;  4DV3 O;  1WJZ A;  1KKC A;  1CEZ A;  3CXH F;  3CME V;  1A32 A;  2FKL A;  4JV5 B;  1MNG A;  5DQH A;  3NR7 A;  3ZRS A;  1L8D A;  4RAZ A;  3KAL A;  3IC7 A;  1B3Q A;  1H2N A;  4JI5 B;  2UXC H;  4YAK B;  4X1Y B;  4MA0 A;  5CBF A;  1AIL A;  1GSA A;  3N41 B;  4X64 H;  2E75 B;  3RW0 A;  2YRW A;  4JAV A;  1WNS A;  4XYL B;  3H20 A;  3JYC A;  3VPB A;  3ASO B;  1HDJ A;  4RUA A;  1V55 C;  1KKD A;  1HR0 B;  5FR9 A;  2RF4 A;  5EDW A;  1ZQ7 A;  3G8C A;  3RB4 A;  4FLV A;  2F1M A;  2XAS A;  1A3G A;  5LMN O;  4F4L A;  1EYZ A;  4EBC A;  1CQI B;  1W59 A;  3RB0 A;  1VAJ A;  4R7R A;  5DQI A;  2PI5 A;  5LMN H;  3B09 A;  3G71 V;  3L4J A;  5KT7 A;  1DGS A;  1JDE A;  5AG2 A;  1I2K A;  4DRF A;  2UU9 O;  4RB2 C;  1W96 A;  1PX2 A;  5LP6 B;  2P6J A;  4MV4 A;  4O7V A;  4DAA A;  4Q20 A;  1K5Q A;  4FS1 A;  2UU9 H;  3H9V A;  4J11 A;  3AK1 A;  3SNO A;  3F8N A;  2YZM A;  1AJQ A;  3SPJ A;  5CA1 B;  1JFF B;  4PA4 A;  4FLT A;  3T9F A;  2F23 A;  3K3V A;  3S3W A;  1I7N A;  1RYR A;  5KLV H;  4O2A B;  2JEI A;  1K34 A;  4LC1 A;  5HBR B;  2C2R A;  5CA1 F;  4ED1 A;  4J10 A;  1QR9 A;  4GKJ B;  4FLY A;  2VOB A;  5H9C A;  4JYC A;  4JV5 H;  4EG0 A;  2QM7 A;  3CE2 A;  5L3D A;  2IU0 A;  4ECQ A;  3RBZ A;  4CS2 A;  3QWU A;  4XX0 B;  2JS5 A;  2R84 A;  4YY3 O;  3J81 N;  3L4K A;  3SPH A;  4JI5 H;  4QJF A;  3OMI B;  4JYA B;  3RGB A;  5KFT A;  2MCT A;  5KA6 A;  3CCE V;  2HGW A;  3H1I H;  1XUQ A;  2VS0 A;  3RFR A;  1HR0 H;  4LF7 B;  1XDN A;  3WFV A;  2EZP A;  1GO3 F;  2PGG A;  2V1D A;  5E1A C;  1V54 C;  1ZWI C;  4MV3 A;  1XL4 A;  1KC8 W;  2JEX A;  1YJW V;  2QWQ B;  2DAA A;  2XND G;  1URF A;  5LHG A;  1IBL B;  3GWK C;  4JI2 B;  4IRD A;  4MSW C;  3ML0 A;  3HKE A;  3M4I A;  4BIZ A;  5KS8 A;  3H1J H;  2ARH A;  1GH6 A;  3CWB H;  2XC9 A;  2ZT9 B;  1NR7 A;  1R6T A;  4FLU A;  1WPB A;  2V5A A;  1IBK O;  1H2M A;  3R5H A;  1KJI A;  4QNH B;  5DGB A;  2OCH A;  3JD2 A;  4ASU G;  4TT3 G;  5LA6 F;  1XNR B;  2W6N A;  1QU7 A;  2X6B A;  4QWD A;  2XGP A;  2FK2 A;  4GKJ H;  3V6H A;  1QBZ A;  4I55 A;  5IWA O;  2JEU A;  3HKB A;  2R93 G;  3WG7 B;  4LBE C;  2CE4 A;  3ABM B;  2EIK C;  5KT6 A;  1OCZ C;  5CN0 A;  1TWF A;  2Q7D A;  4JV1 A;  1M6V A;  2AHZ A;  2R9A A;  3H4D A;  2COJ A;  4MA5 A;  4E6N A;  1FXK C;  4JYA H;  4UCT A;  1TA8 A;  1BXR A;  4O4L F;  1T5E A;  4O2B A;  5KG1 A;  2PUS A;  5LYJ A;  2QB5 A;  4R8U A;  1N34 O;  4O7T A;  3ASN B;  1KEC A;  4X89 A;  4CMF A;  3I4N G;  1B6Q A;  2YXL A;  2JGD A;  4A3I G;  4TV8 A;  1IBL O;  4QPJ A;  4CZZ A;  4QJF B;  2OLS A;  3VQX A;  2NN4 A;  1KD1 W;  4HQ6 A;  3ABT A;  5KFF A;  3KCX A;  4U3F H;  1KEE A;  1UC9 A;  3HOX G;  1IBL H;  3A0B Z;  4JI2 H;  2OH2 A;  4J9K A;  4DR3 O;  3MR6 A;  4I7H A;  2E3C A;  4DV1 O;  4AQY B;  4L87 A;  1QHT A;  2RNB A;  3BAA A;  3LP8 A;  1O9H A;  2HVK C;  2DWC A;  3FKI G;  1Z2O X;  1XNR O;  1KB9 F;  1I1L A;  3JAT A;  1T3N A;  4ECX A;  3G80 A;  3NBY B;  5LXT F;  1XNR H;  4GKK B;  4QWE A;  5GON F;  2ZR2 A;  1JLL B;  4AI8 A;  2Y4T A;  1HNZ B;  1GTO A;  3TXQ A;  1I6U A;  2UUB B;  3SI8 A;  1IZ3 A;  1N4C A;  3KAK A;  4YAJ B;  2F4V O;  3ZMZ A;  1VQ4 V;  1Q6U A;  3H0G G;  3ZED A;  1PL4 A;  4DR6 O;  1E1R G;  4JZ2 A;  4QWA A;  3CEI A;  2YU9 A;  2F4V H;  3DF7 A;  1K83 A;  4A3M G;  2WSS G;  1SC5 B;  3JCU Z;  1AJP A;  3CVZ A;  3PW2 A;  3RYH A;  2EJ0 A;  2V4Q A;  1R3L C;  5KFS A;  4HYO A;  4Q0Y A;  2RDJ A;  4EGQ A;  3EPI A;  4K35 A;  4GCZ A;  4I55 B;  4LH7 A;  4EFB A;  1NJI W;  3HKB B;  4NXN O;  2VPQ A;  1O9G A;  3K3W A;  4CKC A;  4NXN H;  1PKX A;  2IJI A;  1PNL A;  3UYY A;  4O7S A;  4O4H F;  1ZET A;  1QLE C;  1GLV A;  1KJ8 A;  3O65 A;  3HXL A;  4GX2 A;  5H80 A;  3QG5 A;  2Y0S E;  4O2B B;  3JZF A;  3FMA A;  3R5F A;  4LFC O;  3L74 H;  5CA0 F;  4B3R O;  5FD6 A;  3T5K A;  2HKO A;  4DO2 A;  2YS7 A;  3H1K H;  2EIL B;  4O81 A;  2JGD B;  2YYA A;  4LFC H;  4TV8 B;  3GTP A;  1WCM G;  4ZKI A;  1WSC A;  4CH6 A;  1S0V A;  4YBZ B;  2CK3 G;  1M9N A;  2AW9 A;  2WA4 A;  5B3S C;  3BHP A;  3P32 A;  5LGN A;  2AQ4 A;  4PDV A;  2QWP B;  1K8A W;  2FMA A;  5JQG F;  1HNZ H;  2DPJ A;  2V4R A;  2UUB H;  3J80 W;  4IIJ A;  4JF3 A;  2VUG A;  1NR1 A;  4Q45 A;  1OCC B;  3HT5 A;  3G6V A;  3SJQ C;  1IOV A;  4QWC A;  3JAM N;  1DF4 A;  3FD9 A;  1XQ8 A;  4J9Y B;  4TVI A;  2UVU A;  4XDL A;  2WAQ A;  4F4Y A;  5LGU A;  4PZ6 A;  4UXN A;  2R82 A;  2KG7 A;  4YIO A;  5KX5 B;  2W57 A;  3SYA A;  1B06 A;  4JZG A;  2HG5 C;  3CCU V;  3DGE A;  1IOW A;  1S0M A;  4MVU A;  5FD5 A;  3VPD A;  5DAA A;  4TQD A;  4DR7 B;  3U55 A;  2YIB A;  3ZHU A;  3ZS8 C;  2E76 B;  1B04 A;  4PHZ A;  3RYH B;  4JI4 B;  4ED0 A;  2C2E A;  4O82 A;  3ICX A;  5IY5 C;  4LCU C;  1QVG U;  5KX5 F;  1IYE A;  1RFY A;  2ZKO A;  3ZJZ A;  4CKB A;  1YIT V;  3F7V C;  3CMA V;  5FNV F;  2ZJT A;  1BHB A;  1R73 A;  2Q7E A;  1QR8 A;  2BOC C;  4PI2 A;  5I5X A;  3G6Y A;  4BY1 G;  4UVA A;  2E5L B;  5L3E A;  5LBQ A;  1BQ0 A;  1Z5W A;  1HWY A;  4WBN A;  2JIZ G;  4YR0 A;  4HNA A;  4YJ2 B;  4A3J G;  1N56 A;  1KBL A;  2OWO A;  5KFA A;  5EIB D;  1MMM A;  1QCE A;  3F7Y C;  4G28 B;  3PN1 A;  2FK3 A;  3BQ2 A;  3GTO A;  2GQS A;  2P0A A;  3SJB C;  3BA8 A;  5BY1 A;  1YTF B;  2FTK A;  3AYH B;  3HB9 A;  4LMY A;  2MK3 A;  2NU8 B;  2PMZ E;  4YJ2 F;  1BCC H;  2NUA B;  4DR4 B;  1Q6H A;  5KHK A;  3ZN0 A;  3S3X A;  3GQC A;  2RDC A;  2R7L A;  4DV5 O;  2KKW A;  3B4S A;  2JEJ A;  4P30 A;  4FLW A;  5BWT A;  1BSM A;  4DV5 H;  4DIM A;  1T94 A;  5BYB A;  3ZMT A;  1KQS U;  1RPR A;  4ZBM A;  2CTW A;  2EIJ C;  3SDL A;  1YCI A;  1KJQ A;  1TUB B;  4FFO A;  5D1O A;  2XAG A;  2WLL A;  3QF7 A;  3TIG A;  4J7K A;  3KAJ A;  4RB0 A;  1WN7 A;  3CRC A;  1H2L A;  1EN6 A;  2DN9 A;  2IU3 A;  2DPI A;  1VKZ A;  5KAI Z;  4LR3 A;  2XHB A;  1BS3 A;  5B1B C;  1NTM H;  1SQB H;  3VQY A;  2KG7 B;  4ED3 A;  5L9X A;  4PD4 F;  2E74 B;  2ZDI C;  3MR2 A;  2RGV A;  5JQW A;  2C00 A;  5KMG A;  1OV9 A;  4G3I A;  1RP3 B;  2LW7 A;  2ZXW C;  2UXX A;  3FB8 C;  4K6N A;  3ZHS A;  3TGU H;  4CH5 A;  3PZP A;  1P84 F;  4J9Z B;  1AVM A;  4OX9 O;  1M57 C;  3RGZ A;  1VBG A;  3X2Q C;  2ZD9 A;  4LF9 O;  2IW5 A;  3HB3 B;  2W9B A;  4B3S B;  1ZHQ A;  2CH7 A;  1ROP A;  5FPR A;  4WD3 A;  1FFT B;  3ETJ A;  4J42 A;  3AG2 B;  4DR2 B;  1Q86 W;  1E1Q G;  1NH2 B;  4DR4 O;  1OJH A;  3AK2 A;  2VQD A;  4GUN A;  5KT5 A;  2XUM A;  5DG7 A;  4N21 A;  4WBN B;  4A3C G;  4NXM O;  4DR4 H;  3CCJ V;  2R85 A;  1EKV A;  4X9Q A;  4ZHQ B;  4O84 A;  4NZO A;  4DV7 O;  3AG4 C;  1XOU A;  3BCC H;  4H13 B;  2HG8 A;  5A9G A;  5J2U F;  4IL6 Z;  4YB8 B;  2LW1 A;  2ZE7 A;  3KRE A;  4MV8 A;  2YWV A;  5D5P A;  1SA0 A;  3M7M X;  2HJF C;  3ETH A;  3L75 H;  4IAJ A;  5H2F Z;  3RTX A;  5FLX N;  4ZHQ F;  1BJT A;  4FFN A;  2YS8 A;  2GV9 A;  3TJT A;  3CRA A;  3NGD A;  1S9F A;  3OE7 G;  4JI7 B;  4FZ1 A;  2PBZ A;  2FPG B;  2A7W A;  2P4V A;  3E8G A;  1WP8 A;  4WFB V;  5KG3 A;  1KT8 A;  2W9C A;  2EJ2 A;  2XIG A;  4FM1 A;  2PN1 A;  3SR2 C;  1GGO A;  4IGG A;  4NVP A;  4A2B A;  4MV1 A;  2WLL B;  3STZ C;  4EKW A;  3TII A;  3WB1 A;  5BMV A;  5I60 A;  4M7E A;  3D3I A;  1H2S B;  4DK1 A;  4O3R A;  2ZM6 O;  3OTF A;  4FFM A;  5JH7 A;  1F4M A;  2ZM6 H;  1DIK A;  5KMG B;  4B3S H;  1R6N A;  5B1N A;  2Q9L A;  3CCL V;  4QW9 A;  5KFE A;  2JEG A;  1S03 G;  3IN5 A;  4MAM A;  2AXT Z;  3M9O B;  2R7Z A;  4XDJ A;  3PW7 A;  2WLJ A;  4QPK A;  1IXB A;  4DR2 H;  2ADP A;  3BY6 A;  1RM1 C;  4PWQ A;  1S0O A;  4JYB A;  2GUZ A;  2BSK A;  1VIB A;  5EC2 C;  5EWG A;  5EBM C;  2ILM A;  3WB0 A;  2JA5 G;  2CH7 B;  2XGQ A;  1P7G A;  1LUW A;  4YR3 A;  4A3F G;  1NVP D;  1Z2N X;  4BIU A;  3CSX A;  2R7N A;  2ZNI A;  5KUK A;  3RB6 A;  2JEF A;  4BWS C;  2F43 G;  2VWJ A;  4U7C A;  2Q5Z A;  4JI6 B;  3VBB A;  2Q0A A;  1KYO F;  2QGN A;  3RN4 A;  2UXD O;  4B7E A;  4AYB E;  4UV8 A;  2OCC C;  2C2D A;  2UXD H;  2HFE C;  4MTG A;  3W7S A;  4R8C A;  4EGJ A;  4MW3 A;  5I5T A;  1N33 B;  3OUF A;  3CXC U;  4X1Y A;  3V4S A;  2P5O A;  4J9L A;  4CE5 A;  1Y66 A;  4NTY A;  3JCZ A;  4HZ3 A;  2V4D A;  2HR3 A;  2LFR A;  4GT1 A;  4K8X A;  5BWU A;  2ZDQ A;  4O7L A;  4KL1 A;  5K3W A;  4DLK A;  4O7Y A;  1ARO P;  3K3P A;  1MAB G;  1Q8I A;  3RBD A;  4I50 F;  1KJ9 A;  2EJR A;  2BR0 A;  3AX6 A;  1Y67 A;  4KXR A;  2W9C B;  4BY7 G;  3TY5 A;  5C4X G;  4DR1 O;  1TUE B;  2BOB C;  2IM9 A;  3OAA G;  4MVZ A;  1BNC A;  3QNE A;  3Q8S B;  2EUL A;  4WFF A;  4QIW F;  1W0K G;  3ZHR A;  3EHB B;  3QQM A;  1K4D C;  1JCH A;  1A48 A;  1Y1V A;  4F50 A;  2AZ2 A;  3QVN A;  1PL0 A;  3MWD A;  4G27 B;  4LFB B;  1VQ8 V;  4ZOL F;  2W8L A;  2VA3 A;  5DGH A;  2HEP A;  5JH7 B;  3JD3 A;  4GX1 A;  5CA1 A;  2XCP A;  3E22 A;  2W6O A;  2Y4R A;  4YP3 A;  5DG9 A;  1M0T A;  2FK1 A;  3SGI A;  3DC5 A;  1W0J G;  1Q82 W;  4FU0 A;  3JAS A;  2AZ0 A;  3JAW A;  1N0J A;  1M0W A;  1J5E B;  1YZB A;  3ZRW A;  5C5J A;  3HKC B;  4CBC A;  2GUZ B;  3JZ6 A;  2BSK B;  4JI6 H;  2GBO A;  1L1F A;  2AGP A;  3L72 H;  5KFK A;  2K9P A;  2B9Z A;  3PJS K;  1SZT A;  4U7O A;  1VQP V;  1XNQ B;  1IYD A;  1N33 H;  1JR9 A;  2JJ2 G;  3LNN A;  3RVY A;  4X65 B;  1JKJ B;  4QWB A;  1EZ1 A;  1ENV A;  3OSN A;  1EHI A;  1VQM V;  4LSA A;  1MZE A;  1I0H A;  3MD0 A;  1YDX A;  2UXC O;  3K9S A;  5EYP B;  5KG0 A;  3MFH A;  3ZMU A;  4J41 A;  4X64 O;  2UUC B;  4XZ3 B;  3HKD A;  3BG5 A;  5KT2 A;  4R50 A;  3W1B A;  5IYB O;  3ASO C;  4ED7 A;  1CQJ B;  2CDY A;  4YQW A;  4RB3 C;  4X8A A;  3GIM A;  5EZY F;  2ZGI A;  2QTS A;  3RBE A;  2R8H A;  2VPS A;  5LA6 A;  4LFB H;  4JI8 B;  1S97 A;  2YIC A;  5LL6 b;  1IUR A;  4FM9 A;  4D7S A;  1XHZ A;  2C2A A;  1N32 B;  3W5O A;  4FFL A;  2VQF B;  4UFZ A;  4PDB A;  2NNU A;  4K0K O;  5LP6 C;  4FE2 A;  1GRJ A;  1UFI A;  3P3N A;  1NU1 H;  2GPS A;  3ZIA G;  3NBZ B;  4K0K H;  1GSO A;  1XL6 A;  2QE7 G;  4QW8 A;  1H8E G;  1J95 A;  2R7K A;  1Z2P X;  4A2A A;  2LGW A;  1M56 B;  1G1X B;  1XNQ O;  3E22 B;  2YUA A;  4O4L A;  3LUT B;  3EYY A;  4IRK A;  1BMF G;  2QYZ A;  1XNQ H;  1AN7 A;  4WFA V;  3JAS B;  5BR8 B;  3T9B A;  3JAW B;  3OEH G;  3STL C;  5A2Q N;  1EN4 A;  4FZ0 A;  3P30 A;  5JJJ B;  3ZRW B;  3IG0 A;  4X65 H;  4JV5 O;  1FJG B;  4EBD A;  3KYH C;  3I56 V;  4LF4 B;  3Q8P B;  4BXX G;  3Q8R B;  3BQ1 A;  3KCY A;  3K03 A;  4ICG A;  2UUC O;  2WA3 A;  3T4D A;  4A3G G;  2Y69 B;  1UNN C;  4JI5 O;  2HVR A;  1K1S A;  3M9M B;  4Z2W A;  5KFN A;  2HHH B;  1F51 A;  4DL7 A;  2EBO A;  3HBL A;  5KG7 A;  2W9A A;  2UUC H;  1L2Z A;  2R9R B;  3FYE B;  4IZO A;  5DG8 A;  5DLG A;  3GII A;  3N40 P;  1HR0 O;  3ABK B;  4CKE A;  4H44 B;  2QWN B;  4JI8 O;  3PFF A;  3RYC B;  1HNX B;  4MTF A;  5KHJ A;  2O03 A;  3RB3 A;  5LHI A;  4YHH B;  3D3Q A;  2J6T A;  3FYI B;  4JI3 B;  3B8M A;  2VQE B;  1H2G A;  2WTF A;  5LXT A;  4JI8 H;  1PM9 A;  3BPZ A;  5GON A;  3HKD B;  1P7B A;  2VQF O;  2Q8V A;  2L35 A;  2PVP A;  3H1L H;  4IT5 A;  1N32 H;  2IJK A;  3ZRV A;  4O3O A;  2VQF H;  4IWY A;  5CR5 A;  5T14 A;  1DV2 A;  1FYJ A;  1WB8 A;  1CS0 A;  5LA6 B;  2PY5 A;  1FKA H;  3OTO B;  5BWV A;  1OWT A;  2Y0P A;  4I4T F;  4C7U A;  5JCO A;  3H1H H;  4BW9 A;  3M8A A;  4ECY A;  3AW8 A;  2Y48 A;  3E2E A;  4GX0 A;  2DIK A;  4D6T H;  1BZK A;  1I08 A;  4O7Z A;  2JA8 G;  1UPG A;  1OZ0 A;  2YDE A;  4I9Q A;  3A2F A;  5BR8 H;  1Q3E A;  5JJN B;  3CCM V;  1I5Y A;  5KFZ A;  4GKJ O;  3B40 A;  1Q81 W;  1FJG H;  4O4H A;  1KC7 A;  4LF4 H;  3LWB A;  4Q4C A;  4DR5 B;  2DLN A;  1WRV A;  2RDI A;  1WP7 A;  3WG7 C;  2ZE6 A;  4O4L B;  3D36 A;  3ABM C;  2GQR A;  5F2V O;  2P7T C;  2COI A;  3LSS A;  5CA0 A;  2BQR A;  2HHH H;  1BL8 A;  4JYA O;  5KFJ A;  4NTX A;  5FLX W;  1RK5 A;  2DYS B;  5KFQ A;  3K59 A;  1DTO A;  2XAQ A;  3UZB A;  4ZQI A;  4YHH O;  4LF7 O;  2VQE O;  5IT9 N;  1ZL8 A;  3GTL A;  1X59 A;  1CKM A;  1HNX H;  1K5S A;  2Q68 A;  2Z5U A;  3ASN C;  4OGQ B;  1YJN V;  4PZ8 A;  3FX7 A;  5EC1 C;  4YHH H;  2W71 A;  4LF7 H;  2VQE H;  3G8D A;  4JI3 H;  2ZDH A;  4TV9 F;  5KFD A;  2XOK G;  2QM8 A;  2WB1 E;  3KZI Z;  2QA4 V;  2WYO A;  5JQG A;  1EUD B;  1AI6 A;  1VF6 A;  1Y4M A;  2H94 A;  2UXN A;  2PZS A;  4JI2 O;  4FFB A;  1B6R A;  2EZO A;  2Y0I A;  4IHJ F;  4PBC A;  3U9S A;  2XT9 A;  3T1Y B;  5B1A B;  3T5H A;  3CRM A;  4FBT A;  2XTA A;  4O4J B;  3HOZ G;  3V6J A;  5LXT B;  2R8G A;  5BYA A;  5GON B;  3U54 A;  4JPR A;  2AGQ A;  2MW2 B;  4DV4 B;  4LNU B;  4HNV A;  1IBM B;  1E4G T;  4O4J F;  2Z04 A;  1JJ2 U;  1SQP H;  3N44 B;  2Z02 A;  2P4K A;  5JCO C;  4DUZ B;  2A1H A;  2X5R A;  2ATL A;  3HOV G;  1TWH A;  2CTQ A;  2JGU A;  2CZG A;  3VA7 A;  3UQ8 A;  5KX5 A;  2DOS A;  3CP1 A;  3RF2 A;  4O86 A;  5D8D A;  1SS3 A;  3R66 A;  5K1X A;  1I94 B;  3L71 H;  5FNV A;  1VEW A;  3ABL B;  4O4H B;  3ZX6 A;  5DIS C;  2V7Q G;  5CE8 A;  4PJ0 Z;  3TEK A;  3L9D A;  2I87 A;  4RAY A;  4X1K B;  3C3S A;  3SYO A;  1YSC A;  1R1B A;  2YID A;  1XMO B;  5DGA A;  5CA0 B;  2FPP B;  4YIP A;  2N74 A;  2QKA A;  2Q73 A;  2W0X A;  1GN6 A;  2QR4 A;  2CKZ B;  2BTQ A;  2W6J G;  1EBO A;  1Y76 A;  4B3M B;  1C30 A;  1HNW B;  4FFR A;  3R5X A;  2P22 C;  5C1P A;  1K7D A;  4BBS G;  2Q67 A;  1TWG A;  3VMM A;  3UCS C;  2RN9 A;  1ZL8 B;  2QKC A;  3CCV V;  4AQY O;  2YW2 A;  1DK1 A;  4MV6 A;  3LDC A;  3OMA B;  3T1Y H;  2EIL C;  4YJ2 A;  3SE7 A;  4AQY H;  3I55 V;  1CXZ B;  1EZJ A;  4PDR A;  2Q4P A;  3IFX A;  5JQG B;  1FXV A;  2BCC H;  3WB2 A;  1YF2 A;  4FFB B;  2ZCE A;  4DV4 H;  2XCL A;  1CKO A;  1V9P A;  4GKK O;  1AUV A;  4D7T A;  4X62 B;  3QO7 A;  2R8K A;  1HNZ O;  5IYB G;  3QO8 A;  2UUB O;  4GKK H;  3E8F A;  1L0L H;  1I1K A;  1VF7 A;  1WH2 A;  2X6A A;  2WE6 A;  1EN5 A;  2HVQ A;  2V9W A;  4DUZ H;  5CM0 A;  1SES A;  5CA3 A;  1OHH G;  4TQR A;  4YR2 A;  4FS2 A;  4BR6 A;  1V51 A;  2LQT A;  1OCC C;  1H2K A;  4MVO A;  2PI4 A;  3WO0 A;  3GV8 B;  1BE3 H;  5D5Q A;  3CD6 V;  5KHH A;  1QLN A;  1AI5 A;  3L2P A;  1TUB A;  2R7Z G;  5JVL A;  3OM3 B;  2W7P A;  4U3J A;  1I94 H;  2J6U A;  3JSN A;  4MVQ A;  2FB5 A;  5I5U A;  3W7T A;  3THO A;  1ZX3 A;  4PA7 A;  1H8H G;  1FXH A;  4NLG A;  4FLZ A;  4MV7 A;  5IYC G;  4LP8 A;  4RUC A;  2V58 A;  2HGS A;  4AIL C;  1HNW O;  3MJF A;  3K08 A;  3FAV A;  2BQU A;  1OCO B;  4MVM A;  2C28 A;  3TXS A;  5D1P A;  4B7K A;  4B3M H;  2CW8 A;  5EWE A;  5FNV B;  1HNW H;  1F4N A;  1OCR B;  5LMU B;  2H8P C;  4J9N A;  1EKP A;  2W7O A;  2HHF A;  1SF9 A;  3ORQ A;  2RQ6 A;  2I8C A;  5C93 A;  1AR5 A;  1NT2 B;  3ETD A;  3N2G A;  1TWA A;  4KP4 A;  4ZI7 F;  3T5J A;  1WB7 A;  2BTQ B;  1NZ6 A;  1Y76 B;  2QEX V;  3ZHT A;  3CCQ V;  1Q7Y W;  4EYI B;  5J2U A;  2AGA A;  4X62 O;  1I2L A;  3OHB A;  4EQ5 A;  3VOU A;  1F7Y A;  1IVS A;  2HIX A;  4X62 H;  4LWS A;  4UCO A;  3L73 H;  4I0X B;  5ITZ A;  1KU9 A;  4ZHQ A;  5CBH A;  4P9P A;  3H01 A;  3MWE A;  3QFF A;  3N6R A;  3K04 A;  4JAA A;  2UVW A;  1NBM G;  1DLB A;  2R72 A;  1Y14 B;  3FB6 C;  1Y1V G;  1CPY A;  4DYL A;  4QGP A;  2FL4 A;  3ZMV A;  1ULZ A;  3UFX B;  3OFN G;  4GC6 A;  4AHC A;  2WLH A;  2YZN A;  5CB4 F;  4DR7 O;  3KTM A;  5A2Q W;  3CX5 F;  2DYR B;  5E79 Z;  1XI1 A;  2HIV A;  5DLF A;  3I12 A;  4JI4 O;  3B77 A;  3R65 A;  4R6Z A;  4U3J B;  4A3L G;  4DR7 H;  4J7Z A;  1S10 A;  3RAQ A;  3JD0 A;  4I5S A;  1COW G;  4N23 A;  3JD4 A;  3DTG A;  4JI4 H;  1SQQ H;  2NU6 B;  2FLL A;  2YI9 A;  2Z0A A;  1VQ6 V;  4RNO A;  5JUM A;  5DMX A;  2ZDG A;  3CJH A;  3HKZ A;  1S68 A;  1AP5 A;  2WAQ E;  3B8N A;  4X66 B;  2X0L A;  1SFO A;  3J81 W;  1TAE A;  3MFI A;  3FAV B;  1WLE A;  2ITD C;  4RQE A;  5KFO A;  1GN2 A;  5KT3 A;  4UB8 Z;  2E5L O;  4M0J A;  4IYH A;  3T9A A;  5KFW A;  2HHF B;  2QSA A;  5H6R A;  1VBH A;  2FB9 A;  2YEV A;  2E5L H;  4XYM B;  5KFR A;  1CKN B;  2Y4U A;  4DXW A;  1NH2 D;  1GAX A;  4O7W A;  3W1G A;  4IR1 A;  1Y74 A;  3N2G B;  4PI0 A;  1XRE A;  2KQX A;  2OTL V;  4GX5 A;  5KAF Z;  1W93 A;  3FDS A;  3AG2 C;  2M7W A;  3G6B A;  4DL2 A;  2Q0O C;  1NTZ H;  4MW8 A;  5J2U B;  4BAY A;  5IJ0 B;  2ZIM A;  3BA9 A;  4MTD A;  4LFA B;  3QZ7 A;  4LWS B;  5KG6 A;  5ITZ B;  2EIM B;  4J9M A;  1KP2 A;  5TIS Z;  2QF7 A;  5EWF A;  1I5X A;  4DW0 A;  3CC4 V;  2W8K A;  2HJD A;  5IDJ A;  3W7W A;  2DMX A;  3RJ0 A;  2J9G A;  4B3T B;  3MHS C;  2WWW A;  4I50 A;  3U0Z A;  1ZHS A;  3NUA A;  4P2Z A;  1SRY A;  4ME6 A;  2UVR A;  3GDE A;  2RJZ A;  1PNK A;  2CQY A;  1GSH A;  3OUZ A;  4AYB A;  1VQ9 V;  4M9U A;  3MHH C;  4DV6 B;  4QIW A;  4EEQ A;  3MDS A;  5DEC A;  3FB5 C;  2Q7G A;  1X4T A;  4FBU A;  5IP9 G;  2GPW A;  4RAI A;  3EPG A;  1O75 A;  5F9N A;  1P4R A;  3OMN B;  2FLP A;  4QE9 A;  1ZTE A;  3EVK A;  1I50 A;  4ZOL A;  3ZCC A;  2ZQM A;  4P9O A;  4MV9 A;  2WDT A;  4X66 H;  3V4Z A;  2LP7 A;  4TOI A;  5H5N A;  3HR0 A;  3RV4 A;  4LF8 B;  2EIN B;  3SYP A;  3HOW G;  2YRX A;  3WWJ A;  1R9T A;  4B3S O;  1ZLZ A;  2N04 A;  4NTW A;  3GTM A;  3CJH B;  3LNM B;  2F95 B;  3T54 A;  3N2K B;  3A0R A;  3F5W C;  1W2B U;  1PPJ H;  4DR2 O;  1GKF A;  2VR1 A;  4DV0 B;  3W7U A;  2VWK A;  5IYZ F;  3RV3 A;  2FYU H;  1RJR A;  3AK3 A;  2DZD A;  2R8J A;  4KHP B;  2JK5 C;  2YEV B;  3HKC A;  4LFA H;  1S3J A;  3MR3 A;  1M90 W;  4Q8F A;  1AI4 A;  1Y74 B;  5KFI A;  4DL3 A;  1K97 A;  1VF5 B;  4B3T O;  1AB3 A;  2D2C B;  1IDS A;  5J2T F;  5KFY A;  3ORR A;  2D3O W;  4B3T H;  4JI0 B;  5KT4 A;  4JTA B;  3RYF A;  1VAR A;  4MTX A;  1K73 W;  1X9N A;  1RK6 A;  1PNM A;  1SKV A;  3JRW A;  4K8Z A;  2WLM A;  3T4Z A;  1SCU B;  2XAJ A;  2VUM A;  4JAS A;  2RCV A;  4JI7 O;  3U10 A;  2QDO A;  2WAM A;  2CTP A;  1VMG A;  2JA6 A;  2HLD G;  2Q7H A;  4BIO A;  1JPX A;  4DV6 H;  1S5L Z;  4JI7 H;  4O3P A;  1S5H C;  3J7A U;  4CS4 A;  5EZY A;  2WPD G;  3UM7 A;  1KJJ A;  5K2M A;  3TY9 A;  4I50 B;  3A8T A;  5EYP A;  4PEL A;  4TQF A;  3LDD A;  3RUP A;  2EJ3 A;  1KMI Z;  3E89 A;  4TSF G;  1GMG A;  5LOV F;  3VQV A;  1WPX A;  3AG3 B;  2M05 A;  5KG4 A;  4HR7 A;  3T9E A;  3JAR A;  1RJQ A;  2BTO A;  5IE9 A;  4NKG B;  4RUE A;  1G2W A;  3W7X A;  4J0M A;  1NVP B;  3BFR A;  1G6U A;  3BAB A;  2V59 A;  1VQK V;  4ZOL B;  3SYC A;  3AG1 B;  3Q2O A;  1N36 B;  3BEH A;  1XDC A;  1XMQ B;  3T1H B;  3OT7 A;  3K5H A;  2YZL A;  3HOU G;  2JS3 A;  4KHP O;  3IGA C;  4DV3 B;  5BWR A;  4OPH A;  3TET A;  1R3K C;  3CCR V;  1QQC A;  4E2L A;  4UB6 Z;  5BPF A;  4KHP H;  1JDB B;  1Q90 D;  2YSU B;  1UC8 A;  2EIY A;  5IYD O;  1NTK H;  3N8D A;  1XHX A;  1AR4 A;  1UJW B;  5C8Y F;  3DC6 A;  1GM8 A;  3HOY G;  1JXL A;  4JI0 H;  4JI6 O;  1JA8 A;  3FB7 C;  1Z5V A;  3K5I A;  3CQZ A;  2FLN A;  1T36 A;  2JVD A;  2W6P A;  4J9Q A;  2GSM B;  1GN3 A;  4PDL A;  1JIH A;  1YI2 V;  3QZ8 A;  4YJ3 F;  1N33 O;  2CGO A;  3OEE G;  2ZE5 A;  4WHX A;  2YI8 A;  5HFM A;  4FPP A;  3R9R A;  2P67 A;  3RYF B;  3J80 N;  3PW0 A;  4O3N A;  4TUY F;  5DED A;  1A9X A;  4TM5 A;  2ZIN A;  3KHG A;  3S24 A;  3BQ0 A;  5KG5 A;  2UU9 B;  3JAM W;  3UO3 A;  2WLN A;  3RYC A;  2R9I A;  2YXH A;  5EZY B;  3D8C A;  1SQF A;  3ZHQ A;  5CBG A;  2R6F A;  1PP9 H;  4MS2 A;  4FK5 C;  1MZF A;  4I4T A;  4PA9 A;  3TIN A;  1N36 H;  2ETN A;  3P3P A;  3OR6 C;  1E4E A;  2FJZ A;  4ECV A;  1XMQ H;  3T1H H;  4LFB O;  3JAR B;  2A3Q A;  4FFK A;  1FPO A;  4O4I F;  4DV3 H;  4JI1 B;  5HFL A;  3EXA A;  1GM7 A;  5B5E Z;  3VOT A;  3JAL B;  3MR5 A;  4CMD A;  3GIL A;  4I9W A;  4B08 A;  3OGC C;  1KBH A;  4GLW A;  4H0L B;  5BWX A;  1IXM A;  2ZIO A;  2J6S A;  3T1C A;  1J5E O;  3ETQ A;  4YY3 B;  3U0G A;  5IJ9 A;  4XDK A;  3K5M A;  1MA1 A;  3TQT A;  5I5W A;  2OT5 A;  1J5E H;  3KXY T;  1FFX A;  5IYC O;  5KFP A;  1M56 C;  4F6R A;  5KHI A;  3CC2 V;  1V55 B;  3R23 A;  3VQW A;  5KHG A;  1FVI A;  4UCU A;  1LR1 A;  5KFM A;  5L1I A;  5KFC A;  4GLX A;  2R92 A;  2Q6A A;  1Q6I A;  4JGS A;  3T99 A;  3OUS A;  3JRX A;  2W70 A;  2IMW P;  1Y1W A;  2OTJ V;  1JX9 A;  4X65 O;  3PO3 G;  5EK0 A;  2AGO A;  2CUG A;  1XK5 A;  4TV9 A;  3QO5 A;  3JZI A;  4WFH A;  5FL7 G;  3GIK A;  1NQT A;  4Q43 A;  4UUJ C;  3BVO A;  4KFM A;  1SQV H;  2Y69 C;  4HNU A;  1E79 G;  2NLJ C;  2O57 A;  2PYL A;  4IHJ A;  1M7J A;  1ZUQ A;  1XBL A;  5CAE B;  1FS0 G;  4MT8 A;  3GIP A;  2UUA B;  3JAK A;  5LP6 F;  1QVF U;  3ABK C;  3ZRX A;  2B1G A;  4HYK A;  3G4S V;  1P49 A;  1IBK B;  2DAB A;  3K9A A;  1GO3 E;  4PZ7 A;  4A3D G;  2M6Y A;  1QNM A;  2ODM A;  4PA6 A;  3ETG A;  3FFQ A;  4JI1 O;  4Q8E A;  2HVS A;  3GV5 B;  1R3I C;  3IAY A;  1FXK A;  4O4J A;  4JI1 H;  2P90 A;  1N32 O;  3T7A A;  1LNQ A;  2HP8 A;  2WB1 A;  2YCH A;  1Z2G A;  4I4T B;  4Z1M G;  4E4T A;  2X6C A;  4HBN A;  5IWA B;  4JXU A;  1PV0 A;  4O2A F;  1E4E B;  4LNU A;  1FKA O;  3JSL A;  2PF4 E;  4YY3 H;  5KFU A;  1EKF A;  2Z3Y A;  3K5N A;  3T2M A;  4A5U B;  4GC7 A;  2RMK B;  1CP9 A;  5BR8 O;  1N34 B;  4DQN A;  4JV2 A;  1V54 B;  4FIP C;  4Q6G A;  5IJ9 B;  3OW2 U;  2N05 A;  3WU2 Z;  1FJG O;  4LF4 O;  1G8M A;  1FFX B;  3AG7 A;  4F6R B;  2JA7 A;  2JA5 A;  1L0N H;  2B63 A;  1K9M W;  1HP8 A;  4FLX A;  2NR5 A;  4J9S A;  1TVK A;  4X1K A;  4DR3 B;  2HHH O;  4DV1 B;  4LF5 B;  2UUA O;  4BBR G;  4Y8V B;  5GTH Z;  2DYS C;  2IJJ A;  4TV9 B;  2UUA H;  2IBK A;  5DGI A;  2C35 B;  1HNX O;  1IBK H;  3GVM A;  1GN4 A;  2ATK C;  1VQO V;  3B2E E;  4JI3 O;  3NC0 B;  2QTO A;  4IHJ B;  4HN2 A;  2SCU B;  4OPA A;  4ECR A;  3DAA A;  1TWC A;  4ECT A;  2FP4 B;  2CGN A;  2LFS A;  2IBZ H;  3CPW U;  3E5N A;  5I5Y A;  3JAK B;  3M9N B;  5H6Q A;  4L8J A;  2W6I G;  2F4V B;  3Q8Q B;  5IWA H;  4C2M A;  2EIK B;  4DV2 B;  1OCZ B;  4ED2 A;  5C44 G;  5B1A C;  4DR6 B;  1OBD A;  3FKS G;  3OTO O;  5C1O A;  2Y0S A;  3GTG A;  3RAX A;  3ETE A;  1FXK B;  2HDK A;  4C5B A;  3OTO H;  5L1K A;  2K1E A;  2NU9 B;  3TW7 A;  2NVY A;  4RU9 A;  2F66 C;  3OR7 C;  1KUT A;  3GTQ A;  4NXN B;  4DL5 A;  2QKS A;  3C0F B;  4JV0 A;  1VP7 A;  3Q1K A;  1S5J A;  1YHQ V;  1N34 H;  2OIG A;  3PO2 G;  4X1I A;  3ZN1 A;  4TWK A;  1AP6 A;  4MTE A;  3E35 A;  5KFG A;  5KFX A;  4DR5 O;  2DWD C;  4DRX A;  4O83 A;  2DE0 X;  3GB7 C;  4LF5 O;  4JTD B;  1PK8 A;  1B33 N;  4LFC B;  4DR5 H;  1EUC B;  2CNQ A;  4Q4D A;  4DR3 H;  4B3R B;  4DV1 H;  2YZG A;  4LF5 H;  4F4X A;  3G6X A;  3ABL C;  4K3A A;  5IYD G;  3ABU A;  4LH6 A;  3RYI A;  4ZI7 A;  4IYI A;  3QTC A;  3HKE B;  2B5U A;  3PVX A;  3D36 C;  2R8I A;  3BJY A;  4DL6 A;  1MSW D;  2ASD A;  2H3O A;  3NXS A;  1TVK B;  5L3C A;  1LUV A;  4HNT A;  5C3E G;  5BPH A;  3LDE A;  2DQ0 A;  5JVD A;  2ADQ B;  2W0F C;  3APO A;  3T5L A;  3IJ4 A;  1SQX H;  1TGO A;  4WFE A;  2E2H A;  1US6 A;  2IP4 A;  3OUU A;  4DV2 O;  2W6Z A;  4BW5 A;  3TW6 A;  5EBW C;  3T1Y O;  1MSD A;  3LML A;  2ZNJ A;  2Q2T A;  4DV2 H;  4DR6 H;  2YS6 A;  4I0X A;  2PTM A;  3H4B A;  5JWP A;  3RFC A;  2RGR A;  2EJ7 A;  3TY8 A;  1VF6 C;  5J9P C;  3SPI A;  4DV4 O;  3E86 A;  1IBM O;  3RIZ A;  2FPI B;  2R7M A;  2G38 A;  2B1I A;  5GTI Z;  2FE3 A;  1AJN A;  1K92 A;  3CYO A;  1IBM H;  2R87 A;  3K5O A;  1YIJ V;  3U9T A;  1QLE B;  1P16 A;  4RUF A;  4F6E A;  5I5S A;  3CS5 A;  5CB4 A;  2WLK A;  4DUZ O;  1ET0 A;  4I55 F;  3DTU B;  3EFF K;  3CRQ A;  1ZAU A;  1SET A;  5LYJ B;  3AEI A;  5KKN B;  4R8U B;  2AHY A;  3APQ A;  4MVR A;  1GK9 A;  2R86 A;  5B66 Z;  4PV1 B;  3KHH A;  1I94 O;  2ZR3 A;  4B3R H;  1FD9 A;  1R6K A;  1M5I A;  3GWO A;  4GYC B;  4X1I B;  1S77 D;  2PMZ A;  3RGX A;  4W4L A;  1U96 A;  4O2B F;  4EFE A;  3WWH A;  5LYJ F;  5EOY A;  5KA5 A;  4CC5 A;  3LSU A;  4DRX B;  5B3S B;  3C3T A;  3K57 A;  1XMO O;  4TV8 F;  1MZB A;  2XAF A;  3K06 A;  4DUY B;  4RB1 A;  1OCO C;  4B3M O;  5LHH A;  1XMO H;  3K79 A;  4MTO A;  4U6P A;  1OCR C;  4H33 A;  5I5V A;  3RYI B;  4ZI7 B;  4WF9 V;  3CRR A;  3JAT B;  4JUZ A;  3K58 A;  2DWE C;  2VUM G;  2XCA A;  5KG2 A;  2KSD A;  1E4F T;  4A3E G;  3SYQ A;  3I4M G;  1CKN A;  5JVD B;  2JA6 G;  4CC6 A;  4ZIB A;  4DV5 B;  1NKD A;  3DSQ A;  2JDI G;  1PD3 A;  1D5A A;  3SJC C;  1VQ7 V;  4O3Q A;  2ZDI A;  3SPC A;  5IJ0 A;  4ED8 A;  1AI7 A;  3MAQ A;  5HV6 A;  3OHA A;  5JVD F;  1JVM A;  3K5L A;  1VQ5 V;  3F5T A;  1YTF D;  2AU0 A;  3DTF A;  5I47 A;  3LSQ A;  5KFH A;  3PW4 A;  4FM2 A;  1G4Y B;  5IY5 B;  5KFL A;  1ORQ C;  5FJ8 G;  2IJH A;  1FAF A;  5FPO A;  5L3F A;  1SEI A;  4RCN A;  2C22 A;  1YEW A;  2UVV A;  2IH3 C;  3PR5 B;  2CTR A;  5CB4 B;  2XD4 A;  1JMK C;  1WAZ A;  4QSH A;  3H40 A;  4OX9 B;  5KFV A;  2GTA A;  2PYJ A;  4LF9 B;  1I7F A;  4DUY O;  3LUL A;  2R93 A;  4FMT A;  5L3G A;  4NZN A;  3OD4 A;  2JJ1 G;  3DXR A;  5BZB A;  4F4W A;  4NR1 A;  3GV7 B;  3UT5 A;  4PDM A;  4J9P A;  4DUY H;  2DYR C;  4RO2 A;  1I7L A;  5LL6 Y;  5EIB C;  5LMU O;  2UXB B;  3RR5 A;  2HGX A;  2LGQ A;  2EX3 A;  1YXB A;  3HO8 A;  1RPO A;  4E4E A;  4FFP A;  3N6X A;  4MVS A;  5L1J A;  5LMU H;  5IYZ A;  4XBF A;  4FM0 A;  1D5N A;  3GLK A;  2YIB D;  4PA3 A;  4CHI A;  4NXM B;  1XEQ A;  5DN6 G;  4IIJ B;  3N2K A;  5B1O A;  1K33 A;  4WCE V;  4DV7 B;  1DV1 A;  4EB6 A;  4KUM A;  4A3B G;  4CH3 A;  1K4C C;  1GM9 A;  1ZSP A;  4G2K A;  5J2T A;  3IC9 A;  2BQ3 A;  2EIJ B;  4O7N A;  2LJ2 A;  1H38 A;  4IIJ F;  3G67 A;  1AUX A;  3N27 A;  5HNE A;  4ECZ A;  5B1B B;  3FKI A; 
#chains in the Genus database with same CATH homology
 1QQC A;  3QG5 A;  1N32 H;  4O2B B;  4KHP H;  3FMA A;  2VQF H;  2CW7 A;  5FD6 A;  3HXL A;  1XHX A;  4LFC H;  4TV8 B;  5LA6 B;  2PY5 A;  1FKA H;  3OTO B;  5LOV A;  4JI0 H;  4CH6 A;  4OX9 H;  1Z5V A;  5JCO A;  2ZM6 B;  4BW9 A;  4LF9 H;  2JVD A;  3BHP A;  1Q5O A;  2Q2U A;  2OYQ A;  4I9Q A;  3A2F A;  5BR8 H;  1HNZ H;  1Q3E A;  5JJN B;  1Q43 A;  2YI8 A;  3U11 A;  2UXB H;  2UUB H;  3J80 W;  4IIJ A;  2KSW A;  3RYF B;  2VUG A;  1FJG H;  4O4H A;  1HW7 A;  4HNA B;  4LF4 H;  4LF6 B;  4DR5 B;  2ZIN A;  1RSO A;  4O4L B;  3S24 A;  3UT5 B;  4NXM H;  2CFM A;  2UU9 B;  3JAM W;  5CA0 A;  4DV7 H;  3RYC A;  2HHH H;  1XQ8 A;  5EZY B;  5FLX W;  1SQF A;  4PZ6 A;  5C8Y A;  3K59 A;  1SQG A;  5KX5 B;  4UCS A;  5IYZ B;  2W57 A;  5IT9 W;  4LSX A;  4I4T A;  1CKM A;  1N36 H;  2UXD B;  3N42 B;  1HNX H;  2F93 B;  5FD5 A;  4PZ8 A;  4TQD A;  4DR7 B;  1M93 A;  4YHH H;  3T1H H;  1XMQ H;  4LF7 H;  2VQE H;  2YIB A;  4JI3 H;  3ZS8 C;  3JAR B;  1B04 A;  4EB6 B;  4PHZ A;  3RYH B;  4JI4 B;  4DK0 A;  4DV3 H;  4JI1 B;  3ICX A;  2WYO A;  4RZQ A;  5JQG A;  4YJ3 A;  5J2T B;  3JAL B;  2PZS A;  2YIA A;  5D1O B;  4FFB A;  4B08 A;  4TUY A;  3T1Y B;  2ZJT A;  1GYF A;  1VS0 A;  2ZIO A;  4O4J B;  2Q7E A;  3ETQ A;  5LXT B;  4YY3 B;  5IJ9 A;  3K5M A;  4PI2 A;  5GON B;  1J5E H;  3KXY T;  1FFX A;  4DR1 B;  2E5L B;  4X20 A;  1Z5W A;  3RWR D;  4F6R A;  5KHI A;  4DV4 B;  4LNU B;  4WBN A;  3MWM A;  3VQW A;  1IBM B;  4HNA A;  4YJ2 B;  5KHG A;  1FVI A;  3VNN A;  4UCU A;  2OWO A;  1JJO A;  5EIB D;  1E4G T;  1SYX B;  1P8L A;  4GLX A;  3PN1 A;  4CH4 A;  3N44 B;  5JCO C;  5LOV B;  3SJB C;  3BA8 A;  4DUZ B;  1XK5 A;  3J7A K;  4TV9 A;  3SJA C;  4LMY A;  2JGU A;  4LF6 H;  4O4I A;  3UQ8 A;  5KX5 A;  4DR4 B;  3RF2 A;  5KHK A;  2PYL A;  1A0I A;  5K1X A;  2KKW A;  4IHJ A;  1I94 B;  4FLW A;  5FNV A;  4O4H B;  4LF8 H;  5DIS C;  5JJE B;  4DV5 H;  2UUA B;  3JAK A;  2QM4 A;  4RAY A;  1P49 A;  3CB2 A;  4X1K B;  1IBK B;  3JAL A;  3GB8 B;  1TUB B;  4PZ7 A;  5D1O A;  3QF7 A;  2QJ1 A;  1XMO B;  3FFQ A;  3KAJ A;  4RB0 A;  1WN7 A;  5CA0 B;  1SA0 B;  2HVS A;  4BWA A;  2BTQ A;  4B3M B;  3IAY A;  1HNW B;  4DV0 H;  4LR3 A;  4O4J A;  2XHB A;  2P22 C;  5C8Y B;  4JI1 H;  3VQY A;  3N43 B;  3BRC A;  2YCH A;  2RGV A;  4I4T B;  5KMG A;  4HBN A;  5IWA B;  3T1Y H;  4CS3 A;  4LNU A;  4YJ2 A;  3JSL A;  4DV3 B;  4CH5 A;  4AQY H;  2UXC B;  4YY3 H;  3K5N A;  3RGZ A;  5JQG B;  3CHX A;  4YJ3 B;  4X64 B;  4DR1 H;  3WB2 A;  4ETS A;  4FFB B;  2ZCE A;  4DV4 H;  4B3S B;  1CKO A;  1V9P A;  1ZHQ A;  4TUY B;  4D7T A;  5BMV B;  4X62 B;  5FPR A;  5LP6 A;  1N34 B;  4GKK H;  4Q6G A;  1WH2 A;  1VF7 A;  5IJ9 B;  4DR2 B;  2WE6 A;  2HVQ A;  5K1P A;  4DUZ H;  5LMN B;  1FFX B;  4UCR A;  4X20 B;  4F6R B;  4FVM A;  4WBN B;  1JFF A;  4DR4 H;  4FLX A;  4ZHQ B;  2CAZ C;  1TVK A;  4X1K A;  3L2P A;  5D5Q A;  4DR3 B;  5KHH A;  4K0K B;  1TUB A;  4DV1 B;  4LF5 B;  1BGW A;  4U3J A;  1I94 H;  4O2A A;  3JSN A;  5D5P A;  1SA0 A;  2R70 A;  3M7M X;  4TV9 B;  2UUA H;  3THO A;  4UCV A;  4IAJ A;  3RTX A;  4O4I B;  4FLZ A;  4MV7 A;  4APM A;  1IBK H;  1BJT A;  1M4U A;  2GV9 A;  2HGS A;  4AIL C;  4JI7 B;  3B2E E;  3NC0 B;  4IHJ B;  3GJX B;  5D1P A;  4B3M H;  2CW8 A;  1HNW H;  5FNV B;  5LMU B;  2XIG A;  4FM1 A;  3SR2 C;  3JAK B;  4JV5 B;  4L8J A;  4NVP A;  2RQ6 A;  2F4V B;  5IWA H;  4A2B A;  1NT2 B;  4DV2 B;  3N2G A;  4DR6 B;  1L8D A;  4RAZ A;  3KAL A;  3WB1 A;  5BMV A;  4M7E A;  2BTQ B;  4JI5 B;  4DK1 A;  1H2S B;  2UXC H;  4X1Y B;  3OTO H;  3N41 B;  3OTF A;  5J2U A;  4X64 H;  1WNS A;  3H20 A;  5JH7 A;  2F66 C;  2ZM6 H;  4EQ5 A;  5KMG B;  4NXN B;  4B3S H;  1HR0 B;  2HIX A;  3C0F B;  4X62 H;  4UCO A;  1S03 G;  5ITZ A;  1KU9 A;  1S5J A;  4FLV A;  1N34 H;  2F1M A;  4ZHQ A;  4X1I A;  4DR2 H;  4MTE A;  4R7R A;  5LMN H;  4DRX A;  3L4J A;  3WB0 A;  1DGS A;  4DRF A;  4RB2 C;  4DR5 H;  4LFC B;  5LP6 B;  2R72 A;  4DR3 H;  4B3R B;  4DV1 H;  4LF5 H;  1Z2N X;  3CSX A;  2ZNI A;  2UU9 H;  4BWS C;  3F8N A;  4LH6 A;  3RYI A;  4ZI7 A;  2VWJ A;  5CA1 B;  4JI6 B;  4AHC A;  3QTC A;  3HKE B;  2Q0A A;  1JFF B;  5A2Q W;  4FLT A;  1TVK B;  3K3V A;  1XI1 A;  2UXD H;  2HIV A;  5JVD A;  4U3J B;  4O2A B;  4DR7 H;  1N33 B;  1TGO A;  4JI4 H;  4X1Y A;  2P5O A;  4GKJ B;  4FLY A;  2YI9 A;  2VOB A;  4JV5 H;  2V4D A;  1S68 A;  3LML A;  2ZNJ A;  4K8X A;  2Q2T A;  4DV2 H;  4X66 B;  4KL1 A;  4CS2 A;  3QWU A;  3J81 W;  4DR6 H;  1TAE A;  1Q8I A;  2JS5 A;  3L4K A;  4JI5 H;  2PTM A;  2RGR A;  3TY5 A;  3TY8 A;  4JYA B;  3RGB A;  2IM9 A;  2MCT A;  2E5L H;  3RIZ A;  3RFR A;  1CKN B;  1HR0 H;  3W1G A;  4LF7 B;  1XDN A;  3N2G B;  2FE3 A;  4PI0 A;  1IBM H;  2PGG A;  3K5O A;  1P16 A;  5CB4 A;  4LFB B;  1ZAU A;  5J2U B;  5IJ0 B;  5LYJ B;  1IBL B;  2HEP A;  2ZIM A;  5JH7 B;  3BA9 A;  5CA1 A;  4MTD A;  4JI2 B;  4LFA B;  3E22 A;  1M0T A;  3HKE A;  3SGI A;  5ITZ B;  3M4I A;  4B3R H;  1M5I A;  4X1I B;  4GYC B;  3JAS A;  3RGX A;  3JAW A;  1M0W A;  4FLU A;  1J5E B;  4EFE A;  3RJ0 A;  4B3T B;  1WPB A;  4I50 A;  3U0Z A;  3HKC B;  1ZHS A;  5EOY A;  4JI6 H;  4CC5 A;  4DRX B;  3GDE A;  3K57 A;  2RJZ A;  1MZB A;  1XNR B;  4DUY B;  4RB1 A;  1XNQ B;  4DV6 B;  1XMO H;  4EEQ A;  2Q7G A;  1N33 H;  1X4T A;  3LNN A;  3RYI B;  4ZI7 B;  4X65 B;  1O75 A;  3JAT B;  4GKJ H;  4I55 A;  3HKB A;  4ZOL A;  3K58 A;  4LSA A;  1E4F T;  2WDT A;  4MV9 A;  4X66 H;  1CKN A;  4TOI A;  5JVD B;  2R9A A;  5EYP B;  4CC6 A;  4LF8 B;  4E6N A;  4ZIB A;  4DV5 B;  3DSQ A;  3HKD B;  2UUC B;  4JYA H;  3HKD A;  4UCT A;  1TA8 A;  1D5A A;  3SJC C;  3W1B A;  1T5E A;  4O2B A;  2PUS A;  5LYJ A;  5IJ0 A;  3MAQ A;  2F95 B;  4RB3 C;  3N2K B;  3K5L A;  2YXL A;  4DV0 B;  2VPS A;  4TV8 A;  5LA6 A;  4LFB H;  4JI8 B;  3VQX A;  2VWK A;  4FM2 A;  5LL6 b;  4FM9 A;  4D7S A;  1IBL H;  1XHZ A;  1N32 B;  5FPO A;  3W5O A;  4KHP B;  3HKC A;  4JI2 H;  1SEI A;  4LFA H;  2VQF B;  4UFZ A;  4PDB A;  4I7H A;  1YEW A;  2E3C A;  5LP6 C;  4AQY B;  5CB4 B;  1QHT A;  3BAA A;  3NBZ B;  4K0K H;  1JMK C;  4B3T H;  4JI0 B;  1O9H A;  3RYF A;  4OX9 B;  1Z2O X;  1X9N A;  1SKV A;  4LF9 B;  2PYJ A;  1Z2P X;  4A2A A;  1I7F A;  3JAT A;  4K8Z A;  3E22 B;  4O4L A;  3U10 A;  3UT5 A;  3EYY A;  3NBY B;  1XNR H;  4GKK B;  4DUY H;  1XNQ H;  1AN7 A;  2Q7H A;  4DV6 H;  3JAS B;  5BR8 B;  1HNZ B;  4JI7 H;  3JAW B;  5EIB C;  4CS4 A;  5EZY A;  2UXB B;  2UUB B;  3RR5 A;  1I6U A;  5JJJ B;  2EX3 A;  3TY9 A;  4I50 B;  3IG0 A;  1FJG B;  5EYP A;  4X65 H;  3KYH C;  4TQF A;  3KAK A;  3N6X A;  4LF4 B;  5LMU H;  5IYZ A;  4FM0 A;  3ZED A;  1KMI Z;  2YIB D;  4NXM B;  2F4V H;  3DF7 A;  3VQV A;  2HVR A;  4IIJ B;  3N2K A;  4DV7 B;  3JAR A;  2HHH B;  3CVZ A;  4EB6 A;  2BTO A;  3RYH A;  4CH3 A;  2UUC H;  1L2Z A;  4J0M A;  1G6U A;  3BAB A;  4Q0Y A;  5J2T A;  4EFB A;  4LH7 A;  4I55 B;  3HKB B;  3N40 P;  4ZOL B;  1O9G A;  1N36 B;  3RYC B;  1HNX B;  5KHJ A;  2O03 A;  4NXN H;  4YHH B;  1XMQ B;  3T1H B;  2VQE B;  4JI3 B;  5LXT A;  4JI8 H;  3BPZ A;  5GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...