4UCTA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
total genus 102
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4uctA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4uctA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4uctA02
4UCRA 2UU9B 5IWAB 1X9NA 2VUGA 1XMOB 3TY8A 4EFEA 4UCUA 4DV0B 1XNQB 3VNNA 1DGSA 1VS0A 4JI0B 4X64B 4DR3B 4UCSA 1XMQB 1S68A 4LF5B 2CFMA 4JV5B 3BA9A 3TY9A 2UUAB 4UCVA 2VQFB 5D1OA 4JYAB 3PN1A 3RTXA 4DR2B 4DR4B 2UXBB 2ZM6B 5D1OB 4EFBA 3W1BA 2VQEB 4UCTA 4DV7B 4GKJB 4DRFA 1I94B 4AQYB 1FVIA 4UFZA 1CKOA 1TAEA 4GKKB 2OWOA 4PZ6A 1HNXB 4K0KB 2UUCB 1XDNA 4B3RB 2HIXA 4JI1B 4DUZB 1IBMB 4LFAB 4DV5B 4JI4B 4CC5A 4GLXA 4OX9B 2UXDB 1HNZB 4LF4B 3S24A 4DV6B 1TA8A 3OTOB 4DV2B 3KYHC 4EEQA 4LF6B 4E6NA 4JI8B 1P8LA 4DR1B 4LF8B 1N32B 2HVQA 3RR5A 3TY5A 3GDEA 4JI7B 4PZ7A 3L2PA 1CKMA 4LH6A 2UUBB 1HNWB 5DISC 4DV3B 4B3MB 4LFBB 1V9PA 5BR8B 1P16A 3GJXB 1ZAUA 3JSNA 5FPOA 4LFCB 3W5OA 4LF7B 3BA8A 1FJGB 1XNRB 2F4VB 2UXCB 3BAAA 4LF9B 3NC0B 3QWUA 3T1YB 2HHHB 4NXMB 4JI6B 4YY3B 2Q2TA 4DUYB 3W1GA 2Q2UA 1IBKB 1XK5A 2HVSA 4JI3B 3NBZB 4X66B 1CKNA 1IBLB 3BABA 2E5LB 1N33B 4YHHB 1N36B 3SGIA 4CC6A 1CKNB 3NBYB 5D1PA 4UCOA 5FPRA 4JI2B 3JSLA 5LMUB 4DR6B 4KHPB 4PZ8A 2HVRA 1HR0B 4X65B 4LH7A 3UQ8A 4DV4B 4DR7B 2HIVA 3GB8B 4DR5B 5LMNB 4X62B 1B04A 1J5EB 4DV1B 4EQ5A 4TOIA 3T1HB 4B3TB 4NXNB 4JI5B 1A0IA 4B3SB 1N34B
chains in the Genus database with same CATH superfamily
1DIKA 2RMKB 1NH2B 5H6QA 4I4TF 4IYIA 1RM1C 4LF5O 2CE4A 4LFAO 3CMEV 1TVKA 3RF2A 1AJPA 2W8LA 5KMGB 1R6TA 2XCAA 3U9SA 4YR0A 3GTLA 5GONA 2W6JG 2CFMA 4YXWG 3HKZE 3MWMA 4DR2H 4O3QA 4F6RB 2R85A 3PVXA 4NYKA 4LF8O 3BHPA 4O4IA 1I94O 4A2AA 3OUSA 1LR1A 4L8JA 4YP3A 2XUMA 5BPHA 4GKJB 4RB2C 4P2ZA 5IWAH 1Y6XA 1FFXB 5FR9A 1P4RA 4X64H 1X4TA 1BXRA 4FZ0A 2AQ4A 1GO3F 4GLXA 1D2DA 5J2TA 4DYLA 4DV7H 4IHJA 4EEQA 5CBGA 1ZHQA 3K3PA 4JPRA 3ZMZA 4GYCB 4HNAB 4A3DG 1Y74A 4MVMA 2ATLA 3Q8QB 4PDMA 5DISC 3H0GG 1AI4A 3FDSA 2W9CB 3GJXB 2JA6G 4ZHQA 2W0XA 4FLTA 5IYZA 3DC5A 1FJGB 3KCXA 4XBFA 4ECXA 4J41A 1H8EG 1FXKB 1BHAA 2W6NA 4X1YA 1KQSU 4YY3H 4U6PA 3KCYA 4MVUA 2HLDG 2R8IA 4DL3A 1KTAA 2R87A 1S72V 1JIHA 1AR1B 3LDEA 2DABA 4RCNA 4JI3H 1SA0A 3L73H 2PBZA 3I4MG 4UB6Z 2EINC 4W4KA 2R92A 4YHHH 1N36H 1I7FA 1AJQA 4I55B 3ABUA 4KP4A 2CGOA 3RGBA 4DR6H 2YIBA 4KHPH 3L70H 2FPGB 1RFYA 3LWBA 3OMNB 4UCOA 3SYQA 1VQ5V 4YJ2F 5LMUB 5L3BA 2HVRA 3HKZA 1Q82W 4XDJA 1R3KC 5EWFA 1N56A 2EJ2A 1L0LH 1XILA 3WB0A 4LSXA 2JEJA 5KFNA 3RFCA 1TGOA 1SQXH 2CH7A 3AK1A 3OTFA 2Q7HA 2F66C 4GZRB 4GKKO 1US6A 2KQXA 4QE9A 1ENVA 2IW5A 4G2KA 2ZDHA 2J6UA 1KJJA 1A0IA 2RGRA 4LSAA 3IFXA 2UVRA 4O81A 1DLBA 1NR1A 2GTAA 3U0GA 4FLYA 4EYIB 1KYOF 2UXDO 2QKSA 3OGCC 1Q6UA 4UCSA 4LC1A 3ASNB 3MAQA 2YU9A 4UCVA 2Q7DA 1GO3E 3APOA 3GQCA 3PN1A 2ZJTA 3SPCA 2FPPB 5D1OB 2A06H 4FE2A 2AGPA 5HNEA 4O86A 4YIPA 2H94A 5KFBA 4GT1A 4BWSC 3N27A 3GIPA 4IWXA 2V7QG 4M0JA 4E2LA 4FS1A 4DUZB 1IBMB 3SYPA 4FFBB 3ZN1A 2PI5A 2FTKA 1UC9A 4MVZA 1IOVA 1ZL8B 4QE7A 3ML0A 3ABLB 1ET0A 2PUSA 2DYRB 4J9YB 2Y4RA 4JV2A 4DUYO 1SEIA 2QGNA 3K5IA 2L6LA 3GB7C 4Z2WA 3LSSA 4G28B 5I5VA 4E6NA 3RV4A 1CS0A 1OBDA 2GPWA 1XBLA 5KFAA 2ZE6A 4XX0B 2NVXA 1HNWO 2HVQA 2C2AA 2RGVA 3C3TA 3QTCA 3JCUZ 4TV9A 4IIJA 3V4ZA 1SRYA 4NTYA 4G27B 2BCCH 2OTLV 1V9PA 4JI4H 2Q4PA 2LFRA 4X62O 1B06A 2P4VA 5C1PA 1I3QA 4Q4CA 3WO1A 4J7KA 2QYZA 2C2RA 3LUTB 3ZJZA 3KG2A 2RDIA 5B3SC 3U11A 4R50A 4ECSA 1MMMA 2DLNA 3CD6V 3CEIA 1BQ0A 4WFGA 4O3PA 2YDEA 4O2AB 4RQFA 1VAJA 5KX5F 2XAHA 3H4BA 3KZIZ 2YYAA 1IBLH 4IR9A 1OCRC 1N33H 4O7SA 2YEVB 1R6NA 2QEXV 2FK1A 1JX9A 3ZMUA 3J80N 3GTQA 2VQFO 4B08A 1GN2A 4HBNA 5IJ0B 1GSHA 3NBYB 2F4VH 1GGOA 3ORRA 3CC2V 3AG4B 4X1KB 3JASB 1URFA 4QPKA 1C30A 1J5EH 4TUYF 1AROP 3FB5C 5BMVF 4HZ3A 2EIMC 2RDCA 4FU0A 1B6QA 4MW8A 4EQ5A 3RWRD 3ETGA 1Y76B 4IRDA 1JQ0A 4NLGA 3CCJV 3JAKA 4TQSA 3T1CA 4JYYA 1K8AW 4JI5B 4DV0O 1YJNV 2FKLA 2HKOA 4XZ3B 1XMQO 2UVVA 4DRXB 5L3CA 3DAAA 1Y1WG 4FBUA 2WLLB 2ASLA 1QLNA 1TUEB 2NU7B 2VUMG 1XDCA 2Z04A 2P67A 4FFOA 3I4NG 2J9GA 2R84A 3TGUH 2P22C 4JTAB 1EHIA 4JYAB 1MABG 3FAVA 1DK1A 1I94H 2WLNA 3PZPA 2XCLA 5KG2A 1SESA 3BRCA 1CP9A 1ZLZA 2Z3YA 4JTDB 2VQEB 4I0XA 2AXTZ 2ZGIA 1HNXH 2W6ZA 2XAQA 4FJCC 4DLKA 5BWXA 3KHLA 2Y4UA 4B3RH 4EEYA 1N0JA 2UUCB 4KFMA 3W7WA 3C3SA 4JYCA 1AR5A 1I7LA 5KFEA 4LFAB 3CX5F 1VQ8V 1SQBH 4LF6O 3HO8A 2HJFC 1PKXA 1S10A 2LW7A 5H5NA 5KA6A 1M56B 4QWBA 4CH5A 5EWEA 4ETSA 3A0BZ 3D36C 1Y14B 1MA1A 4TT3G 4R8UA 1JX4A 4DR1B 4LF8B 5BWUA 3B77A 2V59A 3AG3C 4JI7B 1ZHSA 3HOUG 2QB5A 2YRWA 1VIBA 4U7NA 1I1KA 1B6SA 4DR5O 3T54A 3KHRA 3T9FA 4X1IA 3W5OA 2K9PA 4ZOLB 1U97A 4PA7A 2GPSA 1W0JG 3HXLA 4Q6GA 3AG1B 3JATB 4A3MG 5H2FZ 2PVPA 3D36A 3GLKA 2ZE8A 4B3SO 1EN6A 4IGGA 5FLMG 3ABMC 1N32H 5A9GA 1IBKB 2XASA 5CA1B 2Q6AA 5C8YF 3H1KH 2DWDC 1K7DA 3BABA 2E5LB 3FB6C 1GRJA 2EJ7A 4MT8A 3G6VA 1RYRA 3M8AA 2A1HA 2F23A 2YCHA 1TVKB 3JSLA 4TQFA 3X2QB 1JVMA 2JRIA 5KUMA 5GONB 2N05A 4TSFG 5EIBC 1WPBA 4DV4B 2JGDA 4BIUA 1WPXA 4GC7A 1OZ0A 2CQYA 1SZXA 3ETQA 4MV9A 2BTQA 4O4IB 4C5AA 2FLNA 4A3KG 3JAWB 2YI9A 2CZGA 3JAMN 2V5AA 3CHXA 2YC0A 1PNKA 1IVSA 3TY8A 1LNQA 3B4SA 4MV8A 5KFOA 4JI0B 5J2UF 4JV5B 3BA9A 3TY9A 2F43G 1PP9H 3DXRA 5LL6b 3A8TA 1EKVA 3H9VA 5CA0A 4GKJO 2EJ0A 4ED0A 4WHXA 4C5BA 4HNTA 2P4KA 4B7KA 5J2TB 4NXNH 1K5QA 2JEGA 4IHJB 3K5MA 4YJ3F 1Q90D 1FVIA 5KX5A 4LFBO 4Y8VB 4GKKB 1XNQH 3D3IA 1Z2GA 5LP6F 3HKDA 3L9DA 3E8FA 4MTXA 2KKWA 4HAMA 1YIJV 2VPQA 2R72A 4FFPA 5I5XA 1Z2NX 1I5XA 5IYZB 2UXDB 2AGQA 4LF4B 1R73A 3G80A 4MVRA 4TUYA 1G6UA 4MVSA 1A48A 4J9LA 4GX0A 4X1YB 1IYDA 4N21A 1XOUA 3Q1KA 1NKDA 3KYHC 4JXUA 3Q8RB 3RV3A 4JI8B 3HKBA 4C5CA 4R7RA 2A79B 2R7ZA 2H3OA 3TCUA 1RPRA 2R9IA 5KG7A 5KT6A 1SA0B 4UVCA 3DTFA 3ETEA 5BR8H 1FKAO 2BQUA 4JV1A 1YI2V 1FJGO 3WG7B 4LH6A 1JDBB 4NB5A 1M1KW 5JVDF 1XNRH 1DV1A 2E2IA 3CP1A 3JCZA 3P32A 1LUWA 4DW1A 3DTGA 1HW7A 4DV2H 3GILA 3ZMVA 3BEHA 2W71A 3GTKA 2NLJC 1KMIZ 4I9WA 4GLWA 3SE7A 2JA7G 3OSNA 2IJHA 4FIPC 4I9QA 3OUUA 2CH7B 2EINB 4DUYB 1QVGU 5KT3A 1Z2OX 5EC1C 4MVQA 5L1JA 2LP7A 5LMUO 2FLLA 3U10A 3OMAB 3FYEB 1I1LA 2V4DA 3GV5B 2W6MA 4X65B 4YAKB 4DV1H 4FM0A 4PWQA 2YIBD 2OCCC 4X62B 1B04A 2WLMA 3RJ0A 4JI6H 1WCMA 3BY6A 3STZC 3K57A 2YS8A 4QWDA 3V6HA 3EFFK 2XCPA 4NR1A 1YDXA 2ZNIA 4ZI7F 3HOXG 3I56V 2ZT9B 4FPPA 3R65A 5KFVA 3S3XA 4WF9V 2W7OA 3R9RA 3AYHB 3RYIB 1SKVA 2CTRA 1RJRA 3JZ6A 5KLVH 4LMYA 2E76B 2O03A 4DR4H 2VQFB 3RB6A 3H01A 4ZBMA 1GK9A 1VF5B 2DIKA 2PN1A 2ADQB 3SPIA 4EFBA 3SPJA 5DMXA 4DRFA 1DF5A 3RYCB 4DV3O 4FFLA 1IURA 4EBCA 5KFPA 3E22A 4LFCO 4DUZO 1IBMO 2ZCEA 3Q4HB 5C8YA 3JARA 1IXBA 4TV9B 2PY5A 3TW7A 2WDTA 5KFTA 3H1JH 4LWSA 5LOVF 4UV9A 3NUAA 1BNCA 4RB1A 3Q8PB 2HHHO 1QQCA 1NBMG 5LHIA 5KT4A 2WWWA 5KFMA 1V55B 2A9HA 3P30A 5KKNB 3AEIA 5DLFA 1SF9A 4LF6H 2I8CA 4NKGB 1KP2A 3U0ZA 3HBLA 1DAAA 3ZX6A 3MR2A 3PW5A 2ITDC 1B3QA 1QBZA 1M4UA 1E1RG 3OE7G 4J10A 1KC8W 3TY5A 4B3MH 5I5WA 1ZUQA 1K4CC 2JJ1G 4FLWA 3AG2B 2P5OA 2ZQMA 2IJKA 2CGNA 5KAFZ 4QSHA 2EIJC 4DV5H 1NTMH 3LDCA 3E8BA 1EKPA 1F4MA 4JZGA 4WBNF 3FYIB 3CYOA 5DAAA 4CHIA 1XREA 5BXZA 4B3TO 1L2ZA 5I5SA 4P9PA 5F9NA 3M9NB 5JJNB 4XYMB 3JALB 1N34O 2QR4A 4BWAA 3M9OB 5DGAA 1XMOO 4ED8A 3FKIA 2Y48A 4BAYA 4FFMA 3H1LH 4DL5A 4MS2A 2X0LA 5H6RA 1VQ4V 2XD4A 3N41B 2LGQA 1BHBA 2UUAO 2ZXWB 3ZHRA 4RAYA 1CKNB 1W96A 2D2CB 5LGNA 1ZQ7A 3H40A 4O3SA 3T9DA 3OHAA 2YS6A 1CEZA 4DR5B 3IC9A 2EIMB 1THZA 1NU1H 3IAYA 2KG7A 3FAVB 3ZMTA 3GVMA 1Q6IA 3H1IH 3BQ1A 4PBCA 3FB7C 2LO1A 4TM5A 1AJNA 4B3SB 2GQRA 3H20A 4FFKA 1K1QA 1IYEA 5JVDA 3N8DA 1U96A 3C90A 4JYAO 5L1KA 1UJWB 2NR5A 5CBHA 4CH3A 2B1IA 4F4XA 1VQ6V 3A2FA 2VQEO 1OCCC 1M0WA 1N48A 3Q2OA 2LQTA 1V54C 5FNVF 5KHHA 3RAXA 5CR5A 3RUPA 4A93G 2EBOA 4AQYB 4ASUG 4RB0A 2GDSA 3QO8A 3HB3B 4R8UB 4PA3A 2OWOA 5LYJF 2XAGA 1VMGA 2P7TC 5K2MA 4DAAA 4IT5A 2EX3A 4PI0A 1Z5WA 1A9XA 2V1DA 1OWTA 2P6JA 3GIQA 1I2LA 5FD6A 5EK0A 2X6AA 4Q45A 4OX9B 1KT8A 3TETA 1Q3EA 4DV6B 2RDJA 3DTUB 1S77D 2V58A 4DR1O 2B1GA 2C35B 1JFFA 4JI7O 1PV0A 2COGA 1Y67A 3R66A 2ODTX 3GDEA 4BY7G 5HFMA 2CKZB 1JJ2U 1BGWA 2YXLA 2HHFB 2UUBB 2DWCA 4MA5A 2E75B 1HP8A 1VQOV 4LFBB 3WO0A 2YIDA 4JGSA 5JQGF 2ADPA 3VQYA 4U3JB 4FLUA 3U54A 5IP7G 4J9OA 3T5JA 2OTJV 4EGJA 3WU2Z 3QWUA 4J0MA 2AHZA 3E83A 5K3WA 2BQ3A 1Q5OA 3ZS8C 1VQNV 2FL4A 2QKCA 3HOVG 1IBKO 3SYOA 3APQA 1M57B 2NNUA 3ABMB 3N2KB 1WJZA 2BTQB 2E5LO 2W6IG 3CJHB 1H2LA 2EILC 1XHZA 4HYOA 1O75A 5LMUH 3BQ2A 2YZMA 3SGIA 3CRAA 2HGWA 3NGDA 4DV4O 2FMLA 5FPRA 3C0FB 3T1YH 5KFSA 3TK1A 2J6SA 1B33N 1QLEB 3DXRB 4BBRG 2X5RA 3VQWA 3U55A 5JJEB 3W7SA 1Q43A 2DYSB 4O4JF 4IWYA 5CA0B 3KTMA 5JCOC 2RF4A 2HJDA 4O2BB 3BACA 4ECVA 2L35A 4H44B 4JI0O 4F6EA 4I50F 5IWAB 4RNNA 2VUGA 1NI8A 3RYFA 5KG4A 4JV5O 4EFEA 2RN9A 2YRXA 2YICA 3HKDB 4X64B 2AHYA 3CRRA 3CCRV 4QGPA 5H80A 1ZTEA 4BIZA 1PM9A 1AUVA 3O65A 5JCOA 5FLXN 3SYAA 4NTXA 1E4EA 1A32A 1M5IA 3B8MA 5FD5A 1JPXA 5EIBD 2ETNA 5BYBA 4WD3A 1NVPB 4KXRA 1NR7A 1M0TA 2X6CA 4UCTA 4DV7B 5KG0A 3SYCA 3N40P 3HKBB 4RAIA 4MV4A 1S3JA 3N2GA 3ZRWB 4ECZA 1JLLB 2YUAA 2ILMA 3MFIA 2GV9A 1C3OA 4H0LB 4JI1B 4XYLB 4LF4O 3L72H 2R93G 3CCMV 5CB4F 4JI8O 1WP8A 4FGRA 3OUZA 1S5JA 2IA6A 4FLVA 2BOCC 2IH1C 1OV9A 4MV7A 5BYAA 5LXTB 1KJ9A 3RT3C 3OW2U 1I50A 2H8PC 1NVPD 2ZDGA 3L2PA 1ULZA 3QQMA 4DV3B 1M7JA 1P16A 3MR6A 1ZAUA 4LFCB 1XL4A 2W0FC 2XOKG 5JJJB 3R5FA 5JH7A 4A3CG 3F7YC 2COIA 3G67A 3NC0B 1TWFA 1K5SA 1RK5A 5DG8A 2BSKB 2HHHB 4HN2A 2GUZA 2WSSG 1RSOA 3W1GA 3CE2A 1IOWA 4J7ZA 4MAMA 3TIIA 2R8GA 5BWVA 1KD1W 3K5HA 5J9PC 1Y66A 4X65O 3BJYA 5LL6Y 2VOBA 4I4TA 4IAJA 2QDOA 3ICXA 4JAAA 2YXYA 1RJPA 1GM9A 4OPHA 2DJVA 2UXBO 1BJTA 3BFRA 3VQXA 4UV8A 3A0HZ 3VMMA 3WB2A 4QNHB 2Q0AA 4GUNA 3ETDA 2K1EA 2DW4A 5B1AB 1E4GT 3T1HB 4JI5H 3RVZA 5KT2A 5JUMA 1WR2A 1K33A 5IP9G 4B3TB 1VP7A 1M93A 2CTPA 4NVPA 2B63A 1N34B 3DC6A 4UCRA 1JDEA 5C3EG 3OEHG 1XMOB 1HDJA 1BE3H 2Z0AA 3E22B 4CKBA 4JAUA 1PX2A 3SDLA 3WWHA 1HR0H 3JARB 4Q8EA 2KB1A 2E2HA 4JYAH 5I5YA 1PNMA 3CXCU 2UUAB 2YXHA 5IY5C 3CS5A 3IGAC 1PPJH 5EZYB 3THOA 2JEXA 3K08A 1EKFA 4X20A 5IJ9B 3JZFA 4GC6A 1NJIW 1EZJA 4FMTA 3RW0A 1KJIA 4I55F 5BWTA 4M7EA 1K73W 2BE3A 3EHBB 2UU9H 3P3NA 2UUCH 4A3LG 3MHSC 5C5JA 2BR0A 4PDBA 1GN6A 2IBZH 4Q44A 4X88A 4K0KB 3FX7A 3CC7V 4LFAH 4LF5H 3UCSC 4CZZA 3KKYA 3T7AA 3G71V 5ITZA 3QO5A 3B8NA 1WP7A 4JI4B 4NXMO 4CC5A 3ABKC 3M9MB 3UT5A 5E79Z 1YVWA 4UVAA 4F4YA 2YSUB 1H8HG 3T9BA 2EULA 4LF8H 2HVJC 1AN7A 4X66O 4O4JA 3ORQA 3MFHA 4EB6A 2R7ZG 3S3WA 5L3GA 4RNOA 5B1BB 4R7CA 4PZ7A 3B2EE 3ASOB 2FLPA 1O9HA 2X6BA 4MTEA 1OCZC 1NS1A 2VWJA 3BPZA 1PL0A 5LMNO 3J81W 2Q68A 2QM4A 1K1SA 3MR5A 2F4VB 2UXCB 2N74A 2IJJA 3PR4A 4YJ2A 4CKEA 1Y4MA 5A2QW 4UUGA 2W7PA 4O7RA 1P84F 2DZDA 1GSAA 1NTKH 5JQWA 2HGXA 1IBKH 4TV8B 1YXBA 1WNSA 4O4LB 4J9PA 2KG7B 3WWIA 3JD4A 2XAFA 2PYLA 2Q2UA 1BT8A 3KAKA 4RNMA 5EDWA 3AW8A 2JK5C 2ZD9A 3G6BA 3ZN0A 3CVZA 3T4ZA 3VPDA 4J7JA 2LW1A 3RFRA 1UC8A 2UXNA 4JI2B 4DV4H 1PD3A 3K9AA 1S76D 1VKZA 1DTOA 4PD4F 3ZMSA 3CC4V 3EVKA 2ZM6O 2OYQA 1OCOC 4O83A 1JR9A 2AGOA 4J9KA 5CB4A 4ZKIA 1A3GA 1G4YB 3RYHA 2C22A 1ZWIC 2EZOA 4MV1A 1I6UA 1RK6A 5IT9W 5DG7A 3GWOA 2A3QA 1YHQV 1K83A 3QFFA 3E35A 5KMGA 4H37A 1EYZA 2ZE5A 4JI0H 4QWEA 2VR1A 1WH2A 2KSWA 1R3JC 2QE7G 4LP8A 3HOYG 5KA5A 4EG0A 2FK2A 3GIKA 4J9MA 3HR0A 3I5DA 3JYCA 2OCHA 5BY1A 1I08A 3CRCA 2C28A 4O2AF 3JD3A 4B7EA 1L0NH 2CAZC 1OBGA 4AQYO 4NTWA 5B1NA 4A3IG 2WLHA 2UVWA 1FFXA 4C7UA 1ZETA 4GKKH 3UZOA 1Q86W 1Q7YW 3F5TA 1YITV 1KUTA 3ZRXA 2P90A 1UPGA 3N43B 2HJWA 5TISZ 1RM1B 3RB3A 4UUJC 3KHHA 2CNUA 1M6VA 3N44B 4APMA 2HIXA 4OX9O 1V4YA 2UXDH 1H38A 3KAJA 4LF4H 4DV6O 3T5HA 1TUBA 4MTFA 2QKAA 2GHYA 4JI8H 4QW8A 2ODMA 5HFLA 4YBZB 4HNAA 3BG5A 2Q7GA 2R6FA 4Q4DA 4WFHA 3AX6A 2UUBO 1N32B 2OLSA 1JJOA 3GV7B 1L1FA 3JD2A 1Y74B 2R7NA 3TEKA 2W9AA 1FFTB 2OH2A 2BTOA 4ZHQB 1GKFA 1Z2PX 3G8CA 3PFFA 2NN4A 4HQ6A 1VBHA 4DUYH 1NT2B 4A3JG 2V9WA 5BMVA 3FKIG 2PF4E 3R5XA 1YCIA 1HWYA 2VPSA 1SQQH 5I47A 1KJ8A 3PW7A 1SETA 3VQVA 1E1QG 3NBZB 2WTFA 1HNWH 3ZIAG 3MDSA 5B66Z 4X65H 3CB2A 4A3GG 2VRZA 2VWKA 4DR2O 4BY1G 3ASNC 4X62H 1H2MA 3OEEG 5C4XG 5CE8A 1MG1A 2Y4TA 3GTGA 4YB8B 4A5UB 3W7TA 3DGEA 3V4SA 3JRXA 1OJHA 2PZSA 4FS2A 3GIIA 3TQTA 5KFRA 5IWAO 5F2VO 5IYCG 1WRVA 4NXNB 5IE9A 5KFUA 3NR7A 1GAXA 5DM6V 2XNDG 4X64O 2HEPA 4ZOLF 5CAEB 1XNQB 3N2GB 4F4ZA 1VS0A 1T5EA 4K35A 3LSQA 5KFXA 4QW9A 2VQFH 2LGWA 4O7YA 4DL7A 2IJIA 4WFAV 4BXXG 2HDKA 5I5TA 3RGXA 5CBFA 3ABLC 1GMGA 5D1OA 3L74H 2DYRC 3RN4A 2FJZA 5C44G 5CA1F 3ZBHA 2ZINA 2QTSA 4DV7O 1LUVA 2XT9A 2DQ0A 2UXBB 2XIGA 2WLJA 5DG9A 1COWG 5DGHA 2VA2A 1XEQA 3W1BA 2ATKC 2M7WA 3JRWA 1CKOA 4JI1O 4DV0H 4X8AA 4W4LA 4PZ6A 1AI7A 5F9LA 1XMQH 4FFNA 1CE8A 4OPAA 1KB9F 4YIOA 3CXHF 1N0NA 3RBDA 2F93B 2O57A 4O4IF 5JH7B 1HNZB 2WB1E 4IRCA 2YL2A 4FM1A 1EBOA 4DV2B 1XHXA 3ETJA 2AZ0A 2GUZB 4YHHO 2ZDQA 1IXMA 1OHHG 1M90W 3I55V 2JEUA 4KHPO 4DR6O 3L4JA 1CKMA 3GTMA 4RUAA 3K59A 4IIJB 4MSWC 2HGSA 1JMKC 4I4TB 4LF7B 2ARHA 4FVMA 3AG4C 4TVIA 2NU6B 1SS3A 2JS3A 5J2TF 4LF9B 4DK1A 3CCEV 4IHJF 4O3NA 3SR2C 3G6EV 2XHBA 1B6RA 4KL1A 4NXMB 5FL7G 4TQRA 1SQVH 1GH6A 1YJ9V 4JI6B 3IG0A 3J7AK 1FAFA 5EWGA 4NZMA 3A0RA 3FD9A 3OT7A 5IJ0A 4X66B 1BS3A 3RGZA 1WA8A 5IYZF 5DQIA 3UZBA 5KG3A 1H2GA 5K1XA 1W2BU 5IYBG 4DR5H 4FFRA 4PDLA 1K34A 1EN5A 4IL6Z 4MTOA 5LP6C 3T1HO 2HIVA 5J2UA 4DR7B 4PJ0Z 4Z1MG 1Y76A 3IC7A 5B3SB 5LMNB 3UFXB 3RAQA 3K58A 4A2BA 1Q8IA 2D3OW 4D6TH 1G2WA 3CPWU 4B3SH 3AK2A 1P7BA 4X20B 3J80W 4ED6A 3G6YA 3CMAV 2GSMB 1OCRB 4DRXA 2R92G 3UO3A 3JAKB 1YZBA 1GM8A 1R6KA 4YJ3A 2R8HA 4DXWA 1DGSA 1UNNC 3FMAA 4DR3B 5LP6A 5KFQA 4RB3C 5IY5B 3OD4A 2WB1A 3F7VC 2DPJA 2J6TA 2W57A 3FKSG 2ASJA 2PTMA 4FZ1A 2CNVA 2W6OA 2Q67A 2ZM6B 2JVDA 1M56C 3T9AA 1GLVA 3CEBA 1W93A 2IP4A 5T14A 5EBWC 2PMZE 1VQKV 1EZVH 1BCCH 5A2QN 4K0KO 5E1AC 4I0XB 5B1OA 5DEDA 3VPCA 5L1LA 1KU9A 3GTJA 1EM1A 4JI4O 1AP6A 1XDNA 1G8MA 3STLC 4R8CA 2COJA 3BQ0A 4DV5B 4WFFA 5KUKA 1CXZB 3F5WC 3AG1C 1R9TA 1AB3A 2EIKC 5LA6F 3K5OA 3K9SA 4YJ2B 1TA8A 3OTOB 4YR3A 4GX1A 4GKJH 2Y0SE 1F23A 3E2EA 1F51A 1XUQA 4AI8A 3ZRVA 1VQPV 2R9AA 3EPIA 1N33O 2YWVA 2C2DA 2R8JA 4U7OA 1WSCA 3RR5A 3LDDA 2FP4B 2UUBH 2CUGA 4LFBH 2N04A 1W59A 5KG5A 2XGPA 4O7WA 1K97A 2F4VO 4CS2A 1VQ9V 2UXCO 5L9XA 2OIGA 2M6YA 2Q73A 1J5EO 4K8XA 2BOBC 3UM7A 3CCQV 1K92A 2GTSA 2R9RB 3HKCA 4PV1B 4C2MA 4X1IB 3PO2G 5BWRA 5GTHZ 4O4HF 2I80A 2R8KA 4AYBE 3RBZA 5CA1A 3RYHB 5IYCO 4O3RA 1A0GA 3P3PA 4BW9A 3J7AU 2SCUB 1S9FA 2IH3C 2UXXA 2G38A 3WFVA 1GTOA 1H2NA 2QWRB 3AG3B 4DL2A 5GTIZ 4JI2O 2B9ZA 3EXAA 1V51A 4HR7A 2QK4A 3JZIA 3JD0A 3NXSA 4ZI7A 1FKAH 2CNQA 3E86A 1FJGH 1T94A 4EBEA 4MV6A 1PK8A 1OCOB 1QHTA 2R70A 2YS7A 2PYJA 5KFGA 1FYJA 5DLGA 3K79A 2IBKA 3JAWA 5E25A 2JGDB 2PMZA 3BCCH 4RUCA 1HNXO 2HR3A 1SCUB 4B3RO 3ABTA 2B63G 1XI1A 4WCEV 1X9NA 4ECRA 2JJ2G 1O9GA 3PW0A 1CQIB 3ZEDA 5KFDA 2ZNJA 1NH2D 4FM9A 4O82A 3ZHSA 3OAAG 4PHZA 5LOVA 1WN7A 4IZOA 2FPIB 3LP8A 2QM8A 3JAMW 1TUBB 4DR2B 3QZ7A 2Y0SA 2QWPB 3WB1A 2W9BA 4BBSG 4MTDA 1KECA 1H2KA 4D7TA 4IYHA 1ROPA 4D7SA 5L3EA 3GTOA 4CMDA 1Y1VA 4WFBV 2RJZA 5DGBA 2QM7A 3B09A 4JASA 5HV6A 2KSDA 4JI1H 5KS8A 5KX5B 4CKCA 1QCEA 3WG7C 1TWAA 1KEEA 2B5UA 4ZQIA 5BZBA 2HG5C 2DOSA 1RJQA 1PNLA 3SPGA 5JWPA 5CA3A 1MZBA 5KFZA 4AYBA 3PW2A 2W6QA 4WBNA 2WLKA 2JEFA 1BL8A 4H33A 4QWAA 1N32O 4TUYB 1JXLA 1E4FT 4RAZA 2CW7A 1KUQA 3N42B 5BMVB 2JS5A 2QF7A 1L8DA 4DV3H 3JD1A 4O7LA 5KHGA 4E4TA 3QNEA 4Q20A 4LFCH 4DW0A 4DUZH 1SZTA 1IBMH 3MJFA 5IYBO 4BIOA 3SNOA 3T2MA 3B40A 3QO7A 5FPOA 1QNMA 2R7MA 4PELA 5GW7A 4JZ2A 5KFFA 5KT5A 2HHHH 3VPBA 1YTFB 4N23A 3MD0A 1EN4A 3T1YB 1GN4A 1EFRG 3LNNA 4ECQA 4LNUA 2ZE7A 3TINA 1Q81W 4YY3B 1S0VA 5HBRB 2Q2TA 2VS0A 2XGQA 2FB5A 1XL6A 1YF2A 4JI3B 3W7XA 1GSOA 3MWDA 4YHHB 1N36B 3KHGA 1N4CA 4CC6A 4CH6A 5D1PA 2JA5A 4KHPB 4DR6B 1QR8A 5KFCA 4QIWF 2P0AA 4I5SA 3GB8B 4CE5A 3T1HH 2QSAA 4ED3A 5DQHA 2IMWP 3OGIB 4IRKA 4YQWA 4NXNO 5LA6A 2A7WA 4OXSA 4EKWA 5LBQA 3GIDA 4B3TH 1YTFD 3HOWG 3CCUV 1N34H 2DWEC 1T3NA 1XMOH 1YJWV 1SC5B 3T4DA 1XNQO 5FNVA 3CSXA 1P7GA 3K3WA 3L71H 4NZOA 1S97A 2JGUA 3RYIA 4HNVA 4PA6A 2QWNB 4UCUA 3UYYA 4JYBA 1TWCA 4CS4A 4MTGA 2UUAH 4EBDA 2XC9A 5LYJA 2CK3G 2Q69A 2XAJA 2HP8A 4J42A 1RYSA 3HOZG 2ABJA 5DN6G 3DF7A 3LMLA 1PL4A 2EZPA 1V55C 2NU8B 4ECUA 1X59A 2OCCB 2FMAA 5KT7A 4ICGA 3RYCA 4O4HA 1T36A 1I7NA 4O7TA 3T5LA 4JF3A 2QJ1A 3E8HA 3Q4HA 4K0KH 5BR8O 1TAEA 4O7ZA 3HKEA 3GWKC 1XNRO 4ME6A 4XDKA 3AG2C 1AI5A 4FLZA 4WFEA 1HNZO 5C8YB 1SERA 3KALA 2YZGA 2W70A 5FJ8G 1IDSA 2Y69C 5CA0F 4LWSB 4O7VA 4DV2O 4O2BF 5JQGA 4FBTA 4MV3A 2VQEH 2ZKOA 5H9CA 1Z5VA 3WNZA 3OR6C 2EIYA 2X0SA 3LQSA 4A3FG 2F1MA 1R1BA 4K3AA 4LF7O 2AW9A 2ZXWC 2LFSA 3FFQA 4LF9O 3H0GA 2UXCH 2W8KA 2JA6A 1WA8B 4JV0A 4DV1O 1ZX3A 2QWQB 2MCTA 3JALA 5EYPA 4R6ZA 4JI6O 3K06A 4QIWE 5J2UB 2I87A 4DR1H 3H1HH 1RPOA 3TW6A 4JI7H 3CQZA 1VBGA 2FKXA 3G8DA 4PA9A 3E5NA 3ZHVA 1QVFU 1CKNA 1IBLB 4JI2H 3BVOA 1N33B 4Q0YA 2EIJB 3T5KA 4I50A 4X89A 4YJ3B 5IYDG 4DR7O 1BGYH 3OR7C 4DR4O 1HR0B 1K4DC 5LP6B 4LH7A 4LR3A 3K0DA 2NUAB 3VOTA 4ED2A 4QJFA 2EJRA 2C00A 5LXTF 3HT5A 3TQ1A 1J5EB 2DN9A 4HYKA 4TQDA 2ZR2A 1KC7A 2ZIOA 5I60A 4ECWA 2E5LH 4P9OA 5D8DA 1EZ1A 1VEWA 4DR3O 2UU9B 3VBBA 3LNMB 4QPJA 4UVBA 1S0MA 4J9QA 2ASDA 3K3VA 5EBLC 4ED7A 2R93A 4LF5B 2Q9LA 4CH4A 5KHJA 1CPYA 5JVDB 1KKDA 4RU9A 1WLEA 3RVYA 3RTXA 2WLIA 1K3EA 5D5PA 1WCMG 5EC2C 4NYEA 1NZ6A 3ZCCA 1I2KA 2CW8A 3RBEA 1S03G 1I0HA 1Q6HA 3CRMA 2BQRA 3HB9A 1I94B 2Q5ZA 4B3MO 3M7MX 3O9OA 1F7YA 1HNXB 1J95A 4DV5O 3VA7A 4B3RB 4JV5H 1GYFA 1S5LZ 2IM9A 3ZHQA 4YR2A 4UB8Z 3QVNA 4AILC 4F6RA 4EYHB 2EIKB 1FS0G 3OTOO 3WWJA 4QIWA 2V4RA 2PGGA 1OCCB 3HKCB 3OUFA 3R23A 2Q7EA 3UKMA 3KXYT 5L3FA 5KFHA 1M57C 1V54B 1SYXB 1VQLV 1DV2A 4JAVA 2FB9A 1VF7A 1JFFB 2HHFA 2NU9B 4O7NA 4MA0A 3SI8A 1AP5A 4DK0A 4BW5A 5EZYF 4U3JA 3PO3G 1TWHA 3OFNG 1DF4A 2GLTA 5CN0A 4ZI7B 3OSPA 4NZNA 3CRQA 1M9NA 3BA8A 2DPIA 4A3BG 5JVLA 3K03A 1VF6C 4L1KA 2A0LA 3PW4A 1QLEC 1MSDA 3N2KA 2YZNA 1FXKC 3RB4A 2OIEA 1D5NA 1JA8A 1AR4A 2DYSC 5EBMC 2CTWA 2RCVA 3CJHA 3EYYA 2RNBA 4J9NA 4PA4A 4RO2A 2C2EA 1I1MA 1P49A 4Q8FA 2HVSA 2OT5A 2W9CA 4FLXA 4J80A 3AK3A 1VF6A 4ABMA 4PZ8A 4L87A 1FXKA 3TIGA 1EUDB 2HFEC 2Y0IA 1QU7A 1F4NA 2DMXA 5LOVB 5I5UA 4O2BA 3E8GA 5CMUA 3CCVV 1ORQC 4TOIA 2W9BB 4F4WA 4DIMA 2YZLA 1I5YA 5C1OA 3IJ4A 3MHHC 1IX9A 5BWWA 5KFYA 4XDLA 4I55A 3PR5B 1SQFA 2EILB 1WB7A 1AUXA 2YIAA 4E4EA 5LHGA 4J9RA 1MOFA 4KUMA 4A3EG 1Y1WA 4DL4A 1AVMA 3RYFB 4ED1A 2Z5UA 1S68A 3H4DA 2VUMA 3ETHA 4TV8F 1NTZH 4O4LF 2UXBH 3GV8B 4U7CA 2CDYA 2R86A 5KFKA 1K9MW 2WAMA 3AG7A 1ZSPA 4WBNB 3SJQC 1E4EB 3T99A 2QA4V 3ZRWA 5BPFA 4O3OA 3OHBA 2V4QA 4GCZA 5KHIA 1WAZA 5C93A 1S0OA 2ZIMA 4CS3A 4K6NA 3RIZA 3ZHTA 4YAJB 2XTAA 5FLXW 3D8CA 2GQSA 2YW2A 2ALZA 2WYOA 2VA3A 1HNZH 1BZKA 3QG5A 4QWCA 2IU0A 1D5AA 4J9SA 3QZ8A 1W0KG 2HG8A 4GX5A 1FXHA 3S24A 2IU3A 4DO2A 2WAQE 4IR1A 5LXTA 2NVYA 1VARA 2Y0PA 3QF7A 3HPLC 2UVUA 4LNUB 1P8LA 2R82A 5LGTA 4RWUA 1G1XB 1R3IC 1JOYA 4RQEA 3Q8SB 5KFJA 2AGAA 5IYDO 4LF7H 3VOUA 5GONF 1HNWB 4FFBA 1YEWA 4LF9H 5BR8B 4JTCB 3T1YO 3JSNA 5KHKA 1ZL8A 1XNRB 4J11A 2BSKA 3BAAA 1EUCB 2P06A 2WPDG 4Q43A 3M99B 4NXMH 3KREA 5K1PA 4YY3O 3G4SV 1MNGA 2JIZG 1TWGA 2AZ2A 1JCHA 5B1AC 3TXQA 4CBCA 5LA6B 1SFOA 4JI3O 2ZDIC 1IZ3A 4X66H 4LBEC 1N36O 3N6XA 1XK5A 1RSOB 2QTOA 5FNVB 4MVOA 4K8ZA 2JEIA 4DL6A 5KG1A 1KBLA 1GN3A 4DR7H 2W6PA 5LMNH 5LYJB 2ITCC 3UQ8A 2VQDA 2R7KA 3V6KA 3N6RA 3PJSK 4DQNA 4RZQA 2MW2B 2MK3A 2ZDIA 4TWKA 4O2AA 1S5HC 3W7UA 5IDJA 1QR9A 4P30A 4DV1B 3U9TA 4CMFA 1FXVA 2YEVA 3L4KA 2Q8VA 4O4HB 3E89A 1FD9A 5DECA 1E79G 1SQPH 4HNUA 4GX2A 4DR3H 3V6JA 4ZHQF 4DV0B 3HKEB 3VNNA 2ZR3A 3H3VH 4X1KA 3JASA 5EZYA 1XMQB 5KFIA 3GIJA 2DQ3A 2LJ2A 2FYUH 1GM7A 2JA8G 2DE0X 4PI2A 5AG2A 5IJ9A 5LGUA 2ZM6H 3LULA 3K5NA 3K0GA 1N8RW 1MSWD 3CSWA 3SJCC 2WAQA 5JQGB 4DR4B 2M05A 5D5QA 5KFLA 2AU0A 2DAAA 3FB8C 1YSCA 1R3LC 2JDIG 4UXNA 3UO2A 4FM2A 4JUZA 1MZEA 1Y1VG 2E3CA 3SJAC 4UFZA 4G3IA 5B1BC 5KG6A 4RUEA 4BR6A 4Z1VA 3ASOC 1WB8A 1VQMV 2WLLA 3I12A 2WE6A 4H13B 2R7LA 3ZHUA 4M9UA 1SQGA 3GIMA 3R5HA 2Y69B 4X9QA 4RZRA 4RUFA 2YI8A 2Q0OC 3OTOH 2CTQA 5ITZB 3GTPA 5B5EZ 5L3DA 3CWBH 4J9ZB 5DGIA 5EYPB 3J81N 3UT5B 3RB0A 1KJQA 1S0NA 4LF6B 4AQYH 3F8NA 3G6XA 1MZFA 1H2SB 4FK5C 3LSUA 3IN5A 1JKJB 2GBOA 3D3QA 4O4JB 3SPHA 4EB6B 3TXSA 3M4IA 5CM0A 4B3MB 4AHCA 1KBHA 2QWOB 4EGQA 5EOYA 4OX9H 4I50B 2HVKC 1UFIA 3ABKB 2FK3A 4DV6H 3CCSV 4TV8A 4O4LA 2WA3A 4PDVA 4QJFB 4JI5O 3K5LA 1CQJB 3DSQA 2JA7A 4PDRA 5KFWA 2F95B 1RP3B 2E74B 1IBLO 3T9EA 4ECYA 1BSMA 4MW3A 1NQTA 2X7RB 3TJTA 3MWEA 4F4LA 5IT9N 1OCZB 1HR0O 3MR3A 2Z02A 4O84A 3L75H 5JH7F 2EJ3A 5DQGA 4LCUC 4ZOLA 5L1IA 2JA5G 1KP3A 1AILA 1KKCA 3JATA 3K04A 2PI4A 4OGQB 1BQZA 3X2QC 3CCLV 1FPOA 2RQ6A 5LHHA 1AI6A 3OM3B 4U3FH 4I7ZB 3SJBC 3T9CA 4F50A 1BMFG 5KAIZ 1XQ8A 3OMIB 3EPGA 2WLIB 4ZIBA 5CB4B 2UU9O 4I7HA 2UUCO 4TV9F 2FE3A 3ZRSA 4ECTA 4IIJF 1VQ7V 2WA4A
chains in the Genus database with same CATH topology
5FNVA 3CSXA 4JI0H 5KMGA 2JGUA 3RYIA 4UCUA 1WH2A 1TVKA 3RF2A 2KSWA 4CS4A 2UUAH 5KMGB 5LYJA 3RYIB 1SKVA 5GONA 2CFMA 4LMYA 4DR2H 3MWMA 4DR4H 2O03A 3DF7A 3LMLA 4F6RB 2VQFB 2CAZC 3BHPA 4O4IA 4A2AA 4L8JA 3RYCA 4O4HA 4EFBA 1FFXA 4GKJB 4GKKH 4RB2C 4DRFA 5IWAH 2QJ1A 3RYCB 4K0KH 1FFXB 3N43B 1TAEA 3E22A 3HKEA 2ZCEA 4X64H 5C8YA 3JARA 4TV9B 2PY5A 2WDTA 1X4TA 4FLZA 3N44B 4APMA 2HIXA 4RB1A 2UXDH 3KALA 5C8YB 3KAJA 4LF4H 1QQCA 4GLXA 1TUBA 5JQGA 4LF6H 4JI8H 5J2TA 2VQEH 3U0ZA 4DV7H 1Z5VA 4IHJA 4EEQA 4HNAA 2Q7GA 1ZHQA 1M4UA 4GYCB 4HNAB 1N32B 3TY5A 4B3MH 1JJOA 2F1MA 4FLWA 2P5OA 3FFQA 5DISC 2UXCH 4DV5H 3GJXB 4ZHQA 4FLTA 5IYZA 1FJGB 2BTOA 2MCTA 4ZHQB 1Z2PX 3JALA 5EYPA 4X1YA 1L2ZA 4YY3H 5J2UB 5JJNB 4DUYH 3JALB 1NT2B 4BWAA 4DR1H 5BMVA 4JI3H 1SA0A 2VPSA 4JI7H 4YHHH 1N36H 1I7FA 3VQVA 3N41B 3NBZB 1HNWH 1CKNA 4I55B 1IBLB 4JI2H 3RGBA 4KHPH 4DR6H 2YIBA 1N33B 4X65H 4Q0YA 3CB2A 4RAYA 4I50A 4YJ3B 1CKNB 2VWKA 4UCOA 5LMUB 2HVRA 1HR0B 4X62H 5LP6B 4LH7A 4LR3A 3WB0A 4LSXA 4DR5B 1J5EB 3IAYA 1TGOA 3OTFA 4TQDA 2Q7HA 2PZSA 2F66C 2ZIOA 4NXNB 1A0IA 4B3SB 2E5LH 2RGRA 4LSAA 2UU9B 2HEPA 4FLYA 3N2GB 1XNQB 3H20A 1VS0A 1T5EA 3K3VA 5JVDA 4UCSA 2VQFH 4LF5B 3MAQA 4CH4A 4UCVA 5KHJA 3RGXA 5JVDB 4CH3A 5D1OA 3PN1A 3A2FA 3RTXA 2ZJTA 2ZINA 1M0WA 5D5PA 2UXBB 5D1OB 2CW8A 2XIGA 1S03G 5KHHA 3W1BA 1I94B 4AQYB 4RB0A 4BWSC 3M7MX 1CKOA 4DV0H 2OWOA 4PZ6A 1HNXB 1XMQH 2EX3A 4PI0A 1Z5WA 4B3RB 4JV5H 1GYFA 4DUZB 2IM9A 1IBMB 4FFBB 4AILC 4F6RA 5FD6A 2F93B 4OX9B 5JH7B 2PUSA 1HNZB 2PGGA 1Q3EA 3HKCB 4DV6B 1SEIA 4FM1A 4DV2B 2Q7EA 3KXYT 1XHXA 1SYXB 4E6NA 1JFFA 1VF7A 2RGVA 1JFFB 2HVQA 4TV9A 3QTCA 3GDEA 4IIJA 3L4JA 1CKMA 4DK0A 1BGWA 3K59A 2YXLA 4U3JA 2UUBB 4IIJB 4LFBB 1V9PA 1JMKC 2HGSA 4JI4H 4ZI7B 4I4TB 3VQYA 4FVMA 3BA8A 4U3JB 4FLUA 4LF7B 4LF9B 3QWUA 4J0MA 4DK1A 3N2KA 3SR2C 1Q5OA 3U11A 3ZS8C 2XHBA 4KL1A 4NXMB 3N2KB 4JI6B 4O2AB 3IG0A 3J7AK 3EYYA 2BTQB 1IBLH 1P49A 1N33H 2HVSA 5IJ0A 4X66B 1XHZA 1O75A 5LMUH 3RGZA 4FLXA 3SGIA 4B08A 4HBNA 5IJ0B 3NBYB 5K1XA 5FPRA 2F4VH 4PZ8A 3C0FB 4DR5H 4X1KB 3JASB 3T1YH 1J5EH 5LP6C 2HIVA 5J2UA 4DR7B 3VQWA 5LOVB 5LMNB 5JJEB 4O2BA 3K58A 4A2BA 1Q8IA 4EQ5A 1Q43A 4TOIA 3RWRD 5CA0B 5JCOC 4B3SH 4O2BB 3JAKA 4X20B 3J80W 4JI5B 4DRXA 4I55A 1SQFA 3JAKB 5IWAB 2VUGA 3RYFA 4YJ3A 2YIAA 4DRXB 4EFEA 1DGSA 3FMAA 3HKDB 4X64B 3RYFB 5LP6A 4DR3B 4RB3C 1S68A 2UXBH 2P22C 2W57A 5JCOA 4JYAB 2PTMA 1M5IA 5FD5A 2ZM6B 2JVDA 5EIBD 1I94H 3BRCA 4WBNB 1M0TA 2VQEB 4UCTA 4DV7B 3N40P 1HNXH 3HKBB 4B3RH 1KU9A 3N2GA 5KHIA 2ZIMA 4CS3A 3RIZA 2UUCB 1XDNA 2GV9A 5FLXW 4JI1B 2WYOA 1HNZH 3QG5A 4DV5B 4LFAB 1D5AA 3S24A 3K5OA 4YJ2B 1S5JA 1TA8A 3OTOB 5LXTA 4GKJH 4CH5A 4FLVA 4ETSA 3QF7A 4LNUB 1P8LA 2R9AA 4MV7A 5LXTB 4DR1B 4LF8B 3RR5A 2UUBH 4JI7B 4LFBH 3L2PA 1ZHSA 4LF7H 4CS2A 1HNWB 4DV3B 4FFBA 1YEWA 4LF9H 5BR8B 1P16A 1ZAUA 3JSNA 4LFCB 4X1IA 5JJJB 5KHKA 4K8XA 3W5OA 5JH7A 1XNRB 4ZOLB 3BAAA 3HXLA 4Q6GA 3JATB 3NC0B 3HKCA 4NXMH 4X1IB 5K1PA 2HHHB 5CA1A 3RYHB 5LA6B 4BW9A 1N32H 1RSOA 4X66H 3W1GA 1IBKB 5CA1B 3N6XA 1XK5A 3BABA 5FNVB 2E5LB 4ZI7A 4K8ZA 2VOBA 1FKAH 4I4TA 4IAJA 1FJGH 3ICXA 2YCHA 1TVKB 3JSLA 4TQFA 4DR7H 5LMNH 5LYJB 1BJTA 5GONB 1QHTA 2R70A 3UQ8A 3VQXA 5EIBC 1WPBA 4DV4B 2PYJA 3WB2A 2Q0AA 4RZQA 4O2AA 4DV1B 3JAWA 1E4GT 3ETQA 4MV9A 3T1HB 4JI5H 2BTQA 4O4IB 4B3TB 3JAWB 2YI9A 4O4HB 3L4KA 1M93A 4NVPA 1N34B 1XI1A 4UCRA 3CHXA 1X9NA 4DR3H 1XMOB 1O9GA 3TY8A 3E22B 4DV0B 3HKEB 3ZEDA 3VNNA 1HR0H 4X1KA 2ZNJA 3JASA 3JARB 4JI0B 4FM9A 5EZYA 1XMQB 4JYAH 4JV5B 3BA9A 3TY9A 2UUAB 4PHZA 5LOVA 1WN7A 5LL6b 5EZYB 3THOA 4PI2A 5IJ9A 2ZM6H 3K5NA 5CA0A 3JAMW 1TUBB 3SJCC 5JQGB 4DR2B 4DR4B 3WB1A 4X20A 5IJ9B 4MTDA 4M7EA 5D5QA 5J2TB 4D7TA 4NXNH 4FM2A 4D7SA 4IHJB 3K5MA 2UU9H 2E3CA 2RJZA 3SJAC 1FVIA 5KX5A 4UFZA 2UUCH 4GKKB 1XNQH 4PDBA 4JI1H 3HKDA 5KX5B 4K0KB 2WE6A 4LFAH 4LF5H 1SQGA 2KKWA 5ITZA 2R72A 4JI4B 4CC5A 2YI8A 1Z2NX 3OTOH 5IYZB 5ITZB 2UXDB 3UT5A 4LF4B 4TUYA 1G6UA 1MZBA 5EYPB 4WBNA 4X1YB 3UT5B 4LF8H 4TUYB 3KYHC 1AN7A 4LF6B 4AQYH 1E4FT 3F8NA 4RAZA 4JI8B 4O4JA 3HKBA 2CW7A 1H2SB 4R7RA 4EB6A 3N42B 5BMVB 2JS5A 1L8DA 1SA0B 4O4JB 4DV3H 4PZ7A 3B2EE 4EB6B 5KHGA 5BR8H 1O9HA 3M4IA 4MTEA 4LFCH 4DUZH 4LH6A 1IBMH 2VWJA 1XNRH 4B3MB 3BPZA 4AHCA 5EOYA 3J81W 2QM4A 5FPOA 4OX9H 4I50B 2F4VB 2UXCB 2HHHH 4DV6H 4YJ2A 1HW7A 4DV2H 4TV8A 3T1YB 4O4LA 5A2QW 3LNNA 1KMIZ 4LNUA 3K5LA 3DSQA 1IBKH 4TV8B 1WNSA 2F95B 4O4LB 4I9QA 4YY3B 2Q2TA 4DUYB 2PYLA 2Q2UA 3KAKA 1Z2OX 4JI3B 3U10A 4YHHB 1N36B 3CVZA 3RFRA 4CC6A 2V4DA 4ZOLA 4CH6A 4JI2B 5D1PA 4DV4H 4KHPB 4DR6B 3JATA 4X65B 4DV1H 2RQ6A 4FM0A 2OYQA 3GB8B 2YIBD 3T1HH 3SJBC 4X62B 3RJ0A 1B04A 5CB4A 4JI6H 3RYHA 5LA6A 4B3TH 1XQ8A 1I6UA 4ZIBA 3K57A 5CB4B 1N34H 5IT9W 4I7HA 1XMOH 2FE3A 2ZNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCR A;  2UU9 B;  5IWA B;  1X9N A;  2VUG A;  1XMO B;  3TY8 A;  4EFE A;  4UCU A;  4DV0 B;  1XNQ B;  3VNN A;  1DGS A;  1VS0 A;  4JI0 B;  4X64 B;  4DR3 B;  4UCS A;  1XMQ B;  1S68 A;  4LF5 B;  2CFM A;  4JV5 B;  3BA9 A;  3TY9 A;  2UUA B;  4UCV A;  2VQF B;  5D1O A;  4JYA B;  3PN1 A;  3RTX A;  4DR2 B;  4DR4 B;  2UXB B;  2ZM6 B;  5D1O B;  4EFB A;  3W1B A;  2VQE B;  4UCT A;  4DV7 B;  4GKJ B;  4DRF A;  1I94 B;  4AQY B;  1FVI A;  4UFZ A;  1CKO A;  1TAE A;  4GKK B;  2OWO A;  4PZ6 A;  1HNX B;  4K0K B;  2UUC B;  1XDN A;  4B3R B;  2HIX A;  4JI1 B;  4DUZ B;  1IBM B;  4LFA B;  4DV5 B;  4JI4 B;  4CC5 A;  4GLX A;  4OX9 B;  2UXD B;  1HNZ B;  4LF4 B;  3S24 A;  4DV6 B;  1TA8 A;  3OTO B;  4DV2 B;  3KYH C;  4EEQ A;  4LF6 B;  4E6N A;  4JI8 B;  1P8L A;  4DR1 B;  4LF8 B;  1N32 B;  2HVQ A;  3RR5 A;  3TY5 A;  3GDE A;  4JI7 B;  4PZ7 A;  3L2P A;  1CKM A;  4LH6 A;  2UUB B;  1HNW B;  5DIS C;  4DV3 B;  4B3M B;  4LFB B;  1V9P A;  5BR8 B;  1P16 A;  3GJX B;  1ZAU A;  3JSN A;  5FPO A;  4LFC B;  3W5O A;  4LF7 B;  3BA8 A;  1FJG B;  1XNR B;  2F4V B;  2UXC B;  3BAA A;  4LF9 B;  3NC0 B;  3QWU A;  3T1Y B;  2HHH B;  4NXM B;  4JI6 B;  4YY3 B;  2Q2T A;  4DUY B;  3W1G A;  2Q2U A;  1IBK B;  1XK5 A;  2HVS A;  4JI3 B;  3NBZ B;  4X66 B;  1CKN A;  1IBL B;  3BAB A;  2E5L B;  1N33 B;  4YHH B;  1N36 B;  3SGI A;  4CC6 A;  1CKN B;  3NBY B;  5D1P A;  4UCO A;  5FPR A;  4JI2 B;  3JSL A;  5LMU B;  4DR6 B;  4KHP B;  4PZ8 A;  2HVR A;  1HR0 B;  4X65 B;  4LH7 A;  3UQ8 A;  4DV4 B;  4DR7 B;  2HIV A;  3GB8 B;  4DR5 B;  5LMN B;  4X62 B;  1B04 A;  1J5E B;  4DV1 B;  4EQ5 A;  4TOI A;  3T1H B;  4B3T B;  4NXN B;  4JI5 B;  1A0I A;  4B3S B;  1N34 B; 
#chains in the Genus database with same CATH topology
 1DIK A;  2RMK B;  1NH2 B;  5H6Q A;  4I4T F;  4IYI A;  1RM1 C;  4LF5 O;  2CE4 A;  4LFA O;  3CME V;  1TVK A;  3RF2 A;  1AJP A;  2W8L A;  5KMG B;  1R6T A;  2XCA A;  3U9S A;  4YR0 A;  3GTL A;  5GON A;  2W6J G;  2CFM A;  4YXW G;  3HKZ E;  3MWM A;  4DR2 H;  4O3Q A;  4F6R B;  2R85 A;  3PVX A;  4NYK A;  4LF8 O;  3BHP A;  4O4I A;  1I94 O;  4A2A A;  3OUS A;  1LR1 A;  4L8J A;  4YP3 A;  2XUM A;  5BPH A;  4GKJ B;  4RB2 C;  4P2Z A;  5IWA H;  1Y6X A;  1FFX B;  5FR9 A;  1P4R A;  4X64 H;  1X4T A;  1BXR A;  4FZ0 A;  2AQ4 A;  1GO3 F;  4GLX A;  1D2D A;  5J2T A;  4DYL A;  4DV7 H;  4IHJ A;  4EEQ A;  5CBG A;  1ZHQ A;  3K3P A;  4JPR A;  3ZMZ A;  4GYC B;  4HNA B;  4A3D G;  1Y74 A;  4MVM A;  2ATL A;  3Q8Q B;  4PDM A;  5DIS C;  3H0G G;  1AI4 A;  3FDS A;  2W9C B;  3GJX B;  2JA6 G;  4ZHQ A;  2W0X A;  4FLT A;  5IYZ A;  3DC5 A;  1FJG B;  3KCX A;  4XBF A;  4ECX A;  4J41 A;  1H8E G;  1FXK B;  1BHA A;  2W6N A;  4X1Y A;  1KQS U;  4YY3 H;  4U6P A;  3KCY A;  4MVU A;  2HLD G;  2R8I A;  4DL3 A;  1KTA A;  2R87 A;  1S72 V;  1JIH A;  1AR1 B;  3LDE A;  2DAB A;  4RCN A;  4JI3 H;  1SA0 A;  3L73 H;  2PBZ A;  3I4M G;  4UB6 Z;  2EIN C;  4W4K A;  2R92 A;  4YHH H;  1N36 H;  1I7F A;  1AJQ A;  4I55 B;  3ABU A;  4KP4 A;  2CGO A;  3RGB A;  4DR6 H;  2YIB A;  4KHP H;  3L70 H;  2FPG B;  1RFY A;  3LWB A;  3OMN B;  4UCO A;  3SYQ A;  1VQ5 V;  4YJ2 F;  5LMU B;  5L3B A;  2HVR A;  3HKZ A;  1Q82 W;  4XDJ A;  1R3K C;  5EWF A;  1N56 A;  2EJ2 A;  1L0L H;  1XIL A;  3WB0 A;  4LSX A;  2JEJ A;  5KFN A;  3RFC A;  1TGO A;  1SQX H;  2CH7 A;  3AK1 A;  3OTF A;  2Q7H A;  2F66 C;  4GZR B;  4GKK O;  1US6 A;  2KQX A;  4QE9 A;  1ENV A;  2IW5 A;  4G2K A;  2ZDH A;  2J6U A;  1KJJ A;  1A0I A;  2RGR A;  4LSA A;  3IFX A;  2UVR A;  4O81 A;  1DLB A;  1NR1 A;  2GTA A;  3U0G A;  4FLY A;  4EYI B;  1KYO F;  2UXD O;  2QKS A;  3OGC C;  1Q6U A;  4UCS A;  4LC1 A;  3ASN B;  3MAQ A;  2YU9 A;  4UCV A;  2Q7D A;  1GO3 E;  3APO A;  3GQC A;  3PN1 A;  2ZJT A;  3SPC A;  2FPP B;  5D1O B;  2A06 H;  4FE2 A;  2AGP A;  5HNE A;  4O86 A;  4YIP A;  2H94 A;  5KFB A;  4GT1 A;  4BWS C;  3N27 A;  3GIP A;  4IWX A;  2V7Q G;  4M0J A;  4E2L A;  4FS1 A;  4DUZ B;  1IBM B;  3SYP A;  4FFB B;  3ZN1 A;  2PI5 A;  2FTK A;  1UC9 A;  4MVZ A;  1IOV A;  1ZL8 B;  4QE7 A;  3ML0 A;  3ABL B;  1ET0 A;  2PUS A;  2DYR B;  4J9Y B;  2Y4R A;  4JV2 A;  4DUY O;  1SEI A;  2QGN A;  3K5I A;  2L6L A;  3GB7 C;  4Z2W A;  3LSS A;  4G28 B;  5I5V A;  4E6N A;  3RV4 A;  1CS0 A;  1OBD A;  2GPW A;  1XBL A;  5KFA A;  2ZE6 A;  4XX0 B;  2NVX A;  1HNW O;  2HVQ A;  2C2A A;  2RGV A;  3C3T A;  3QTC A;  3JCU Z;  4TV9 A;  4IIJ A;  3V4Z A;  1SRY A;  4NTY A;  4G27 B;  2BCC H;  2OTL V;  1V9P A;  4JI4 H;  2Q4P A;  2LFR A;  4X62 O;  1B06 A;  2P4V A;  5C1P A;  1I3Q A;  4Q4C A;  3WO1 A;  4J7K A;  2QYZ A;  2C2R A;  3LUT B;  3ZJZ A;  3KG2 A;  2RDI A;  5B3S C;  3U11 A;  4R50 A;  4ECS A;  1MMM A;  2DLN A;  3CD6 V;  3CEI A;  1BQ0 A;  4WFG A;  4O3P A;  2YDE A;  4O2A B;  4RQF A;  1VAJ A;  5KX5 F;  2XAH A;  3H4B A;  3KZI Z;  2YYA A;  1IBL H;  4IR9 A;  1OCR C;  1N33 H;  4O7S A;  2YEV B;  1R6N A;  2QEX V;  2FK1 A;  1JX9 A;  3ZMU A;  3J80 N;  3GTQ A;  2VQF O;  4B08 A;  1GN2 A;  4HBN A;  5IJ0 B;  1GSH A;  3NBY B;  2F4V H;  1GGO A;  3ORR A;  3CC2 V;  3AG4 B;  4X1K B;  3JAS B;  1URF A;  4QPK A;  1C30 A;  1J5E H;  4TUY F;  1ARO P;  3FB5 C;  5BMV F;  4HZ3 A;  2EIM C;  2RDC A;  4FU0 A;  1B6Q A;  4MW8 A;  4EQ5 A;  3RWR D;  3ETG A;  1Y76 B;  4IRD A;  1JQ0 A;  4NLG A;  3CCJ V;  3JAK A;  4TQS A;  3T1C A;  4JYY A;  1K8A W;  4JI5 B;  4DV0 O;  1YJN V;  2FKL A;  2HKO A;  4XZ3 B;  1XMQ O;  2UVV A;  4DRX B;  5L3C A;  3DAA A;  1Y1W G;  4FBU A;  2WLL B;  2ASL A;  1QLN A;  1TUE B;  2NU7 B;  2VUM G;  1XDC A;  2Z04 A;  2P67 A;  4FFO A;  3I4N G;  2J9G A;  2R84 A;  3TGU H;  2P22 C;  4JTA B;  1EHI A;  4JYA B;  1MAB G;  3FAV A;  1DK1 A;  1I94 H;  2WLN A;  3PZP A;  2XCL A;  5KG2 A;  1SES A;  3BRC A;  1CP9 A;  1ZLZ A;  2Z3Y A;  4JTD B;  2VQE B;  4I0X A;  2AXT Z;  2ZGI A;  1HNX H;  2W6Z A;  2XAQ A;  4FJC C;  4DLK A;  5BWX A;  3KHL A;  2Y4U A;  4B3R H;  4EEY A;  1N0J A;  2UUC B;  4KFM A;  3W7W A;  3C3S A;  4JYC A;  1AR5 A;  1I7L A;  5KFE A;  4LFA B;  3CX5 F;  1VQ8 V;  1SQB H;  4LF6 O;  3HO8 A;  2HJF C;  1PKX A;  1S10 A;  2LW7 A;  5H5N A;  5KA6 A;  1M56 B;  4QWB A;  4CH5 A;  5EWE A;  4ETS A;  3A0B Z;  3D36 C;  1Y14 B;  1MA1 A;  4TT3 G;  4R8U A;  1JX4 A;  4DR1 B;  4LF8 B;  5BWU A;  3B77 A;  2V59 A;  3AG3 C;  4JI7 B;  1ZHS A;  3HOU G;  2QB5 A;  2YRW A;  1VIB A;  4U7N A;  1I1K A;  1B6S A;  4DR5 O;  3T54 A;  3KHR A;  3T9F A;  4X1I A;  3W5O A;  2K9P A;  4ZOL B;  1U97 A;  4PA7 A;  2GPS A;  1W0J G;  3HXL A;  4Q6G A;  3AG1 B;  3JAT B;  4A3M G;  5H2F Z;  2PVP A;  3D36 A;  3GLK A;  2ZE8 A;  4B3S O;  1EN6 A;  4IGG A;  5FLM G;  3ABM C;  1N32 H;  5A9G A;  1IBK B;  2XAS A;  5CA1 B;  2Q6A A;  5C8Y F;  3H1K H;  2DWD C;  1K7D A;  3BAB A;  2E5L B;  3FB6 C;  1GRJ A;  2EJ7 A;  4MT8 A;  3G6V A;  1RYR A;  3M8A A;  2A1H A;  2F23 A;  2YCH A;  1TVK B;  3JSL A;  4TQF A;  3X2Q B;  1JVM A;  2JRI A;  5KUM A;  5GON B;  2N05 A;  4TSF G;  5EIB C;  1WPB A;  4DV4 B;  2JGD A;  4BIU A;  1WPX A;  4GC7 A;  1OZ0 A;  2CQY A;  1SZX A;  3ETQ A;  4MV9 A;  2BTQ A;  4O4I B;  4C5A A;  2FLN A;  4A3K G;  3JAW B;  2YI9 A;  2CZG A;  3JAM N;  2V5A A;  3CHX A;  2YC0 A;  1PNK A;  1IVS A;  3TY8 A;  1LNQ A;  3B4S A;  4MV8 A;  5KFO A;  4JI0 B;  5J2U F;  4JV5 B;  3BA9 A;  3TY9 A;  2F43 G;  1PP9 H;  3DXR A;  5LL6 b;  3A8T A;  1EKV A;  3H9V A;  5CA0 A;  4GKJ O;  2EJ0 A;  4ED0 A;  4WHX A;  4C5B A;  4HNT A;  2P4K A;  4B7K A;  5J2T B;  4NXN H;  1K5Q A;  2JEG A;  4IHJ B;  3K5M A;  4YJ3 F;  1Q90 D;  1FVI A;  5KX5 A;  4LFB O;  4Y8V B;  4GKK B;  1XNQ H;  3D3I A;  1Z2G A;  5LP6 F;  3HKD A;  3L9D A;  3E8F A;  4MTX A;  2KKW A;  4HAM A;  1YIJ V;  2VPQ A;  2R72 A;  4FFP A;  5I5X A;  1Z2N X;  1I5X A;  5IYZ B;  2UXD B;  2AGQ A;  4LF4 B;  1R73 A;  3G80 A;  4MVR A;  4TUY A;  1G6U A;  4MVS A;  1A48 A;  4J9L A;  4GX0 A;  4X1Y B;  1IYD A;  4N21 A;  1XOU A;  3Q1K A;  1NKD A;  3KYH C;  4JXU A;  3Q8R B;  3RV3 A;  4JI8 B;  3HKB A;  4C5C A;  4R7R A;  2A79 B;  2R7Z A;  2H3O A;  3TCU A;  1RPR A;  2R9I A;  5KG7 A;  5KT6 A;  1SA0 B;  4UVC A;  3DTF A;  3ETE A;  5BR8 H;  1FKA O;  2BQU A;  4JV1 A;  1YI2 V;  1FJG O;  3WG7 B;  4LH6 A;  1JDB B;  4NB5 A;  1M1K W;  5JVD F;  1XNR H;  1DV1 A;  2E2I A;  3CP1 A;  3JCZ A;  3P32 A;  1LUW A;  4DW1 A;  3DTG A;  1HW7 A;  4DV2 H;  3GIL A;  3ZMV A;  3BEH A;  2W71 A;  3GTK A;  2NLJ C;  1KMI Z;  4I9W A;  4GLW A;  3SE7 A;  2JA7 G;  3OSN A;  2IJH A;  4FIP C;  4I9Q A;  3OUU A;  2CH7 B;  2EIN B;  4DUY B;  1QVG U;  5KT3 A;  1Z2O X;  5EC1 C;  4MVQ A;  5L1J A;  2LP7 A;  5LMU O;  2FLL A;  3U10 A;  3OMA B;  3FYE B;  1I1L A;  2V4D A;  3GV5 B;  2W6M A;  4X65 B;  4YAK B;  4DV1 H;  4FM0 A;  4PWQ A;  2YIB D;  2OCC C;  4X62 B;  1B04 A;  2WLM A;  3RJ0 A;  4JI6 H;  1WCM A;  3BY6 A;  3STZ C;  3K57 A;  2YS8 A;  4QWD A;  3V6H A;  3EFF K;  2XCP A;  4NR1 A;  1YDX A;  2ZNI A;  4ZI7 F;  3HOX G;  3I56 V;  2ZT9 B;  4FPP A;  3R65 A;  5KFV A;  3S3X A;  4WF9 V;  2W7O A;  3R9R A;  3AYH B;  3RYI B;  1SKV A;  2CTR A;  1RJR A;  3JZ6 A;  5KLV H;  4LMY A;  2E76 B;  2O03 A;  4DR4 H;  2VQF B;  3RB6 A;  3H01 A;  4ZBM A;  1GK9 A;  1VF5 B;  2DIK A;  2PN1 A;  2ADQ B;  3SPI A;  4EFB A;  3SPJ A;  5DMX A;  4DRF A;  1DF5 A;  3RYC B;  4DV3 O;  4FFL A;  1IUR A;  4EBC A;  5KFP A;  3E22 A;  4LFC O;  4DUZ O;  1IBM O;  2ZCE A;  3Q4H B;  5C8Y A;  3JAR A;  1IXB A;  4TV9 B;  2PY5 A;  3TW7 A;  2WDT A;  5KFT A;  3H1J H;  4LWS A;  5LOV F;  4UV9 A;  3NUA A;  1BNC A;  4RB1 A;  3Q8P B;  2HHH O;  1QQC A;  1NBM G;  5LHI A;  5KT4 A;  2WWW A;  5KFM A;  1V55 B;  2A9H A;  3P30 A;  5KKN B;  3AEI A;  5DLF A;  1SF9 A;  4LF6 H;  2I8C A;  4NKG B;  1KP2 A;  3U0Z A;  3HBL A;  1DAA A;  3ZX6 A;  3MR2 A;  3PW5 A;  2ITD C;  1B3Q A;  1QBZ A;  1M4U A;  1E1R G;  3OE7 G;  4J10 A;  1KC8 W;  3TY5 A;  4B3M H;  5I5W A;  1ZUQ A;  1K4C C;  2JJ1 G;  4FLW A;  3AG2 B;  2P5O A;  2ZQM A;  2IJK A;  2CGN A;  5KAF Z;  4QSH A;  2EIJ C;  4DV5 H;  1NTM H;  3LDC A;  3E8B A;  1EKP A;  1F4M A;  4JZG A;  4WBN F;  3FYI B;  3CYO A;  5DAA A;  4CHI A;  1XRE A;  5BXZ A;  4B3T O;  1L2Z A;  5I5S A;  4P9P A;  5F9N A;  3M9N B;  5JJN B;  4XYM B;  3JAL B;  1N34 O;  2QR4 A;  4BWA A;  3M9O B;  5DGA A;  1XMO O;  4ED8 A;  3FKI A;  2Y48 A;  4BAY A;  4FFM A;  3H1L H;  4DL5 A;  4MS2 A;  2X0L A;  5H6R A;  1VQ4 V;  2XD4 A;  3N41 B;  2LGQ A;  1BHB A;  2UUA O;  2ZXW B;  3ZHR A;  4RAY A;  1CKN B;  1W96 A;  2D2C B;  5LGN A;  1ZQ7 A;  3H40 A;  4O3S A;  3T9D A;  3OHA A;  2YS6 A;  1CEZ A;  4DR5 B;  3IC9 A;  2EIM B;  1THZ A;  1NU1 H;  3IAY A;  2KG7 A;  3FAV B;  3ZMT A;  3GVM A;  1Q6I A;  3H1I H;  3BQ1 A;  4PBC A;  3FB7 C;  2LO1 A;  4TM5 A;  1AJN A;  4B3S B;  2GQR A;  3H20 A;  4FFK A;  1K1Q A;  1IYE A;  5JVD A;  3N8D A;  1U96 A;  3C90 A;  4JYA O;  5L1K A;  1UJW B;  2NR5 A;  5CBH A;  4CH3 A;  2B1I A;  4F4X A;  1VQ6 V;  3A2F A;  2VQE O;  1OCC C;  1M0W A;  1N48 A;  3Q2O A;  2LQT A;  1V54 C;  5FNV F;  5KHH A;  3RAX A;  5CR5 A;  3RUP A;  4A93 G;  2EBO A;  4AQY B;  4ASU G;  4RB0 A;  2GDS A;  3QO8 A;  3HB3 B;  4R8U B;  4PA3 A;  2OWO A;  5LYJ F;  2XAG A;  1VMG A;  2P7T C;  5K2M A;  4DAA A;  4IT5 A;  2EX3 A;  4PI0 A;  1Z5W A;  1A9X A;  2V1D A;  1OWT A;  2P6J A;  3GIQ A;  1I2L A;  5FD6 A;  5EK0 A;  2X6A A;  4Q45 A;  4OX9 B;  1KT8 A;  3TET A;  1Q3E A;  4DV6 B;  2RDJ A;  3DTU B;  1S77 D;  2V58 A;  4DR1 O;  2B1G A;  2C35 B;  1JFF A;  4JI7 O;  1PV0 A;  2COG A;  1Y67 A;  3R66 A;  2ODT X;  3GDE A;  4BY7 G;  5HFM A;  2CKZ B;  1JJ2 U;  1BGW A;  2YXL A;  2HHF B;  2UUB B;  2DWC A;  4MA5 A;  2E75 B;  1HP8 A;  1VQO V;  4LFB B;  3WO0 A;  2YID A;  4JGS A;  5JQG F;  2ADP A;  3VQY A;  4U3J B;  4FLU A;  3U54 A;  5IP7 G;  4J9O A;  3T5J A;  2OTJ V;  4EGJ A;  3WU2 Z;  3QWU A;  4J0M A;  2AHZ A;  3E83 A;  5K3W A;  2BQ3 A;  1Q5O A;  3ZS8 C;  1VQN V;  2FL4 A;  2QKC A;  3HOV G;  1IBK O;  3SYO A;  3APQ A;  1M57 B;  2NNU A;  3ABM B;  3N2K B;  1WJZ A;  2BTQ B;  2E5L O;  2W6I G;  3CJH B;  1H2L A;  2EIL C;  1XHZ A;  4HYO A;  1O75 A;  5LMU H;  3BQ2 A;  2YZM A;  3SGI A;  3CRA A;  2HGW A;  3NGD A;  4DV4 O;  2FML A;  5FPR A;  3C0F B;  3T1Y H;  5KFS A;  3TK1 A;  2J6S A;  1B33 N;  1QLE B;  3DXR B;  4BBR G;  2X5R A;  3VQW A;  3U55 A;  5JJE B;  3W7S A;  1Q43 A;  2DYS B;  4O4J F;  4IWY A;  5CA0 B;  3KTM A;  5JCO C;  2RF4 A;  2HJD A;  4O2B B;  3BAC A;  4ECV A;  2L35 A;  4H44 B;  4JI0 O;  4F6E A;  4I50 F;  5IWA B;  4RNN A;  2VUG A;  1NI8 A;  3RYF A;  5KG4 A;  4JV5 O;  4EFE A;  2RN9 A;  2YRX A;  2YIC A;  3HKD B;  4X64 B;  2AHY A;  3CRR A;  3CCR V;  4QGP A;  5H80 A;  1ZTE A;  4BIZ A;  1PM9 A;  1AUV A;  3O65 A;  5JCO A;  5FLX N;  3SYA A;  4NTX A;  1E4E A;  1A32 A;  1M5I A;  3B8M A;  5FD5 A;  1JPX A;  5EIB D;  2ETN A;  5BYB A;  4WD3 A;  1NVP B;  4KXR A;  1NR7 A;  1M0T A;  2X6C A;  4UCT A;  4DV7 B;  5KG0 A;  3SYC A;  3N40 P;  3HKB B;  4RAI A;  4MV4 A;  1S3J A;  3N2G A;  3ZRW B;  4ECZ A;  1JLL B;  2YUA A;  2ILM A;  3MFI A;  2GV9 A;  1C3O A;  4H0L B;  4JI1 B;  4XYL B;  4LF4 O;  3L72 H;  2R93 G;  3CCM V;  5CB4 F;  4JI8 O;  1WP8 A;  4FGR A;  3OUZ A;  1S5J A;  2IA6 A;  4FLV A;  2BOC C;  2IH1 C;  1OV9 A;  4MV7 A;  5BYA A;  5LXT B;  1KJ9 A;  3RT3 C;  3OW2 U;  1I50 A;  2H8P C;  1NVP D;  2ZDG A;  3L2P A;  1ULZ A;  3QQM A;  4DV3 B;  1M7J A;  1P16 A;  3MR6 A;  1ZAU A;  4LFC B;  1XL4 A;  2W0F C;  2XOK G;  5JJJ B;  3R5F A;  5JH7 A;  4A3C G;  3F7Y C;  2COI A;  3G67 A;  3NC0 B;  1TWF A;  1K5S A;  1RK5 A;  5DG8 A;  2BSK B;  2HHH B;  4HN2 A;  2GUZ A;  2WSS G;  1RSO A;  3W1G A;  3CE2 A;  1IOW A;  4J7Z A;  4MAM A;  3TII A;  2R8G A;  5BWV A;  1KD1 W;  3K5H A;  5J9P C;  1Y66 A;  4X65 O;  3BJY A;  5LL6 Y;  2VOB A;  4I4T A;  4IAJ A;  2QDO A;  3ICX A;  4JAA A;  2YXY A;  1RJP A;  1GM9 A;  4OPH A;  2DJV A;  2UXB O;  1BJT A;  3BFR A;  3VQX A;  4UV8 A;  3A0H Z;  3VMM A;  3WB2 A;  4QNH B;  2Q0A A;  4GUN A;  3ETD A;  2K1E A;  2DW4 A;  5B1A B;  1E4G T;  3T1H B;  4JI5 H;  3RVZ A;  5KT2 A;  5JUM A;  1WR2 A;  1K33 A;  5IP9 G;  4B3T B;  1VP7 A;  1M93 A;  2CTP A;  4NVP A;  2B63 A;  1N34 B;  3DC6 A;  4UCR A;  1JDE A;  5C3E G;  3OEH G;  1XMO B;  1HDJ A;  1BE3 H;  2Z0A A;  3E22 B;  4CKB A;  4JAU A;  1PX2 A;  3SDL A;  3WWH A;  1HR0 H;  3JAR B;  4Q8E A;  2KB1 A;  2E2H A;  4JYA H;  5I5Y A;  1PNM A;  3CXC U;  2UUA B;  2YXH A;  5IY5 C;  3CS5 A;  3IGA C;  1PPJ H;  5EZY B;  3THO A;  2JEX A;  3K08 A;  1EKF A;  4X20 A;  5IJ9 B;  3JZF A;  4GC6 A;  1NJI W;  1EZJ A;  4FMT A;  3RW0 A;  1KJI A;  4I55 F;  5BWT A;  4M7E A;  1K73 W;  2BE3 A;  3EHB B;  2UU9 H;  3P3N A;  2UUC H;  4A3L G;  3MHS C;  5C5J A;  2BR0 A;  4PDB A;  1GN6 A;  2IBZ H;  4Q44 A;  4X88 A;  4K0K B;  3FX7 A;  3CC7 V;  4LFA H;  4LF5 H;  3UCS C;  4CZZ A;  3KKY A;  3T7A A;  3G71 V;  5ITZ A;  3QO5 A;  3B8N A;  1WP7 A;  4JI4 B;  4NXM O;  4CC5 A;  3ABK C;  3M9M B;  3UT5 A;  5E79 Z;  1YVW A;  4UVA A;  4F4Y A;  2YSU B;  1H8H G;  3T9B A;  2EUL A;  4LF8 H;  2HVJ C;  1AN7 A;  4X66 O;  4O4J A;  3ORQ A;  3MFH A;  4EB6 A;  2R7Z G;  3S3W A;  5L3G A;  4RNO A;  5B1B B;  4R7C A;  4PZ7 A;  3B2E E;  3ASO B;  2FLP A;  1O9H A;  2X6B A;  4MTE A;  1OCZ C;  1NS1 A;  2VWJ A;  3BPZ A;  1PL0 A;  5LMN O;  3J81 W;  2Q68 A;  2QM4 A;  1K1S A;  3MR5 A;  2F4V B;  2UXC B;  2N74 A;  2IJJ A;  3PR4 A;  4YJ2 A;  4CKE A;  1Y4M A;  5A2Q W;  4UUG A;  2W7P A;  4O7R A;  1P84 F;  2DZD A;  1GSA A;  1NTK H;  5JQW A;  2HGX A;  1IBK H;  4TV8 B;  1YXB A;  1WNS A;  4O4L B;  4J9P A;  2KG7 B;  3WWI A;  3JD4 A;  2XAF A;  2PYL A;  2Q2U A;  1BT8 A;  3KAK A;  4RNM A;  5EDW A;  3AW8 A;  2JK5 C;  2ZD9 A;  3G6B A;  3ZN0 A;  3CVZ A;  3T4Z A;  3VPD A;  4J7J A;  2LW1 A;  3RFR A;  1UC8 A;  2UXN A;  4JI2 B;  4DV4 H;  1PD3 A;  3K9A A;  1S76 D;  1VKZ A;  1DTO A;  4PD4 F;  3ZMS A;  3CC4 V;  3EVK A;  2ZM6 O;  2OYQ A;  1OCO C;  4O83 A;  1JR9 A;  2AGO A;  4J9K A;  5CB4 A;  4ZKI A;  1A3G A;  1G4Y B;  3RYH A;  2C22 A;  1ZWI C;  2EZO A;  4MV1 A;  1I6U A;  1RK6 A;  5IT9 W;  5DG7 A;  3GWO A;  2A3Q A;  1YHQ V;  1K83 A;  3QFF A;  3E35 A;  5KMG A;  4H37 A;  1EYZ A;  2ZE5 A;  4JI0 H;  4QWE A;  2VR1 A;  1WH2 A;  2KSW A;  1R3J C;  2QE7 G;  4LP8 A;  3HOY G;  5KA5 A;  4EG0 A;  2FK2 A;  3GIK A;  4J9M A;  3HR0 A;  3I5D A;  3JYC A;  2OCH A;  5BY1 A;  1I08 A;  3CRC A;  2C28 A;  4O2A F;  3JD3 A;  4B7E A;  1L0N H;  2CAZ C;  1OBG A;  4AQY O;  4NTW A;  5B1N A;  4A3I G;  2WLH A;  2UVW A;  1FFX A;  4C7U A;  1ZET A;  4GKK H;  3UZO A;  1Q86 W;  1Q7Y W;  3F5T A;  1YIT V;  1KUT A;  3ZRX A;  2P90 A;  1UPG A;  3N43 B;  2HJW A;  5TIS Z;  1RM1 B;  3RB3 A;  4UUJ C;  3KHH A;  2CNU A;  1M6V A;  3N44 B;  4APM A;  2HIX A;  4OX9 O;  1V4Y A;  2UXD H;  1H38 A;  3KAJ A;  4LF4 H;  4DV6 O;  3T5H A;  1TUB A;  4MTF A;  2QKA A;  2GHY A;  4JI8 H;  4QW8 A;  2ODM A;  5HFL A;  4YBZ B;  4HNA A;  3BG5 A;  2Q7G A;  2R6F A;  4Q4D A;  4WFH A;  3AX6 A;  2UUB O;  1N32 B;  2OLS A;  1JJO A;  3GV7 B;  1L1F A;  3JD2 A;  1Y74 B;  2R7N A;  3TEK A;  2W9A A;  1FFT B;  2OH2 A;  2BTO A;  4ZHQ B;  1GKF A;  1Z2P X;  3G8C A;  3PFF A;  2NN4 A;  4HQ6 A;  1VBH A;  4DUY H;  1NT2 B;  4A3J G;  2V9W A;  5BMV A;  3FKI G;  2PF4 E;  3R5X A;  1YCI A;  1HWY A;  2VPS A;  1SQQ H;  5I47 A;  1KJ8 A;  3PW7 A;  1SET A;  3VQV A;  1E1Q G;  3NBZ B;  2WTF A;  1HNW H;  3ZIA G;  3MDS A;  5B66 Z;  4X65 H;  3CB2 A;  4A3G G;  2VRZ A;  2VWK A;  4DR2 O;  4BY1 G;  3ASN C;  4X62 H;  1H2M A;  3OEE G;  5C4X G;  5CE8 A;  1MG1 A;  2Y4T A;  3GTG A;  4YB8 B;  4A5U B;  3W7T A;  3DGE A;  3V4S A;  3JRX A;  1OJH A;  2PZS A;  4FS2 A;  3GII A;  3TQT A;  5KFR A;  5IWA O;  5F2V O;  5IYC G;  1WRV A;  4NXN B;  5IE9 A;  5KFU A;  3NR7 A;  1GAX A;  5DM6 V;  2XND G;  4X64 O;  2HEP A;  4ZOL F;  5CAE B;  1XNQ B;  3N2G B;  4F4Z A;  1VS0 A;  1T5E A;  4K35 A;  3LSQ A;  5KFX A;  4QW9 A;  2VQF H;  2LGW A;  4O7Y A;  4DL7 A;  2IJI A;  4WFA V;  4BXX G;  2HDK A;  5I5T A;  3RGX A;  5CBF A;  3ABL C;  1GMG A;  5D1O A;  3L74 H;  2DYR C;  3RN4 A;  2FJZ A;  5C44 G;  5CA1 F;  3ZBH A;  2ZIN A;  2QTS A;  4DV7 O;  1LUV A;  2XT9 A;  2DQ0 A;  2UXB B;  2XIG A;  2WLJ A;  5DG9 A;  1COW G;  5DGH A;  2VA2 A;  1XEQ A;  3W1B A;  2ATK C;  2M7W A;  3JRW A;  1CKO A;  4JI1 O;  4DV0 H;  4X8A A;  4W4L A;  4PZ6 A;  1AI7 A;  5F9L A;  1XMQ H;  4FFN A;  1CE8 A;  4OPA A;  1KB9 F;  4YIO A;  3CXH F;  1N0N A;  3RBD A;  2F93 B;  2O57 A;  4O4I F;  5JH7 B;  1HNZ B;  2WB1 E;  4IRC A;  2YL2 A;  4FM1 A;  1EBO A;  4DV2 B;  1XHX A;  3ETJ A;  2AZ0 A;  2GUZ B;  4YHH O;  2ZDQ A;  1IXM A;  1OHH G;  1M90 W;  3I55 V;  2JEU A;  4KHP O;  4DR6 O;  3L4J A;  1CKM A;  3GTM A;  4RUA A;  3K59 A;  4IIJ B;  4MSW C;  2HGS A;  1JMK C;  4I4T B;  4LF7 B;  2ARH A;  4FVM A;  3AG4 C;  4TVI A;  2NU6 B;  1SS3 A;  2JS3 A;  5J2T F;  4LF9 B;  4DK1 A;  3CCE V;  4IHJ F;  4O3N A;  3SR2 C;  3G6E V;  2XHB A;  1B6R A;  4KL1 A;  4NXM B;  5FL7 G;  4TQR A;  1SQV H;  1GH6 A;  1YJ9 V;  4JI6 B;  3IG0 A;  3J7A K;  1FAF A;  5EWG A;  4NZM A;  3A0R A;  3FD9 A;  3OT7 A;  5IJ0 A;  4X66 B;  1BS3 A;  3RGZ A;  1WA8 A;  5IYZ F;  5DQI A;  3UZB A;  5KG3 A;  1H2G A;  5K1X A;  1W2B U;  5IYB G;  4DR5 H;  4FFR A;  4PDL A;  1K34 A;  1EN5 A;  4IL6 Z;  4MTO A;  5LP6 C;  3T1H O;  2HIV A;  5J2U A;  4DR7 B;  4PJ0 Z;  4Z1M G;  1Y76 A;  3IC7 A;  5B3S B;  5LMN B;  3UFX B;  3RAQ A;  3K58 A;  4A2B A;  1Q8I A;  2D3O W;  4D6T H;  1G2W A;  3CPW U;  4B3S H;  3AK2 A;  1P7B A;  4X20 B;  3J80 W;  4ED6 A;  3G6Y A;  3CMA V;  2GSM B;  1OCR B;  4DRX A;  2R92 G;  3UO3 A;  3JAK B;  1YZB A;  1GM8 A;  1R6K A;  4YJ3 A;  2R8H A;  4DXW A;  1DGS A;  1UNN C;  3FMA A;  4DR3 B;  5LP6 A;  5KFQ A;  4RB3 C;  5IY5 B;  3OD4 A;  2WB1 A;  3F7V C;  2DPJ A;  2J6T A;  2W57 A;  3FKS G;  2ASJ A;  2PTM A;  4FZ1 A;  2CNV A;  2W6O A;  2Q67 A;  2ZM6 B;  2JVD A;  1M56 C;  3T9A A;  1GLV A;  3CEB A;  1W93 A;  2IP4 A;  5T14 A;  5EBW C;  2PMZ E;  1VQK V;  1EZV H;  1BCC H;  5A2Q N;  4K0K O;  5E1A C;  4I0X B;  5B1O A;  5DED A;  3VPC A;  5L1L A;  1KU9 A;  3GTJ A;  1EM1 A;  4JI4 O;  1AP6 A;  1XDN A;  1G8M A;  3STL C;  4R8C A;  2COJ A;  3BQ0 A;  4DV5 B;  4WFF A;  5KUK A;  1CXZ B;  3F5W C;  3AG1 C;  1R9T A;  1AB3 A;  2EIK C;  5LA6 F;  3K5O A;  3K9S A;  4YJ2 B;  1TA8 A;  3OTO B;  4YR3 A;  4GX1 A;  4GKJ H;  2Y0S E;  1F23 A;  3E2E A;  1F51 A;  1XUQ A;  4AI8 A;  3ZRV A;  1VQP V;  2R9A A;  3EPI A;  1N33 O;  2YWV A;  2C2D A;  2R8J A;  4U7O A;  1WSC A;  3RR5 A;  3LDD A;  2FP4 B;  2UUB H;  2CUG A;  4LFB H;  2N04 A;  1W59 A;  5KG5 A;  2XGP A;  4O7W A;  1K97 A;  2F4V O;  4CS2 A;  1VQ9 V;  2UXC O;  5L9X A;  2OIG A;  2M6Y A;  2Q73 A;  1J5E O;  4K8X A;  2BOB C;  3UM7 A;  3CCQ V;  1K92 A;  2GTS A;  2R9R B;  3HKC A;  4PV1 B;  4C2M A;  4X1I B;  3PO2 G;  5BWR A;  5GTH Z;  4O4H F;  2I80 A;  2R8K A;  4AYB E;  3RBZ A;  5CA1 A;  3RYH B;  5IYC O;  4O3R A;  1A0G A;  3P3P A;  4BW9 A;  3J7A U;  2SCU B;  1S9F A;  2IH3 C;  2UXX A;  2G38 A;  3WFV A;  1GTO A;  1H2N A;  2QWR B;  3AG3 B;  4DL2 A;  5GTI Z;  4JI2 O;  2B9Z A;  3EXA A;  1V51 A;  4HR7 A;  2QK4 A;  3JZI A;  3JD0 A;  3NXS A;  4ZI7 A;  1FKA H;  2CNQ A;  3E86 A;  1FJG H;  1T94 A;  4EBE A;  4MV6 A;  1PK8 A;  1OCO B;  1QHT A;  2R70 A;  2YS7 A;  2PYJ A;  5KFG A;  1FYJ A;  5DLG A;  3K79 A;  2IBK A;  3JAW A;  5E25 A;  2JGD B;  2PMZ A;  3BCC H;  4RUC A;  1HNX O;  2HR3 A;  1SCU B;  4B3R O;  3ABT A;  2B63 G;  1XI1 A;  4WCE V;  1X9N A;  4ECR A;  2JJ2 G;  1O9G A;  3PW0 A;  1CQI B;  3ZED A;  5KFD A;  2ZNJ A;  1NH2 D;  4FM9 A;  4O82 A;  3ZHS A;  3OAA G;  4PHZ A;  5LOV A;  1WN7 A;  4IZO A;  2FPI B;  3LP8 A;  2QM8 A;  3JAM W;  1TUB B;  4DR2 B;  3QZ7 A;  2Y0S A;  2QWP B;  3WB1 A;  2W9B A;  4BBS G;  4MTD A;  1KEC A;  1H2K A;  4D7T A;  4IYH A;  1ROP A;  4D7S A;  5L3E A;  3GTO A;  4CMD A;  1Y1V A;  4WFB V;  2RJZ A;  5DGB A;  2QM7 A;  3B09 A;  4JAS A;  5HV6 A;  2KSD A;  4JI1 H;  5KS8 A;  5KX5 B;  4CKC A;  1QCE A;  3WG7 C;  1TWA A;  1KEE A;  2B5U A;  4ZQI A;  5BZB A;  2HG5 C;  2DOS A;  1RJQ A;  1PNL A;  3SPG A;  5JWP A;  5CA3 A;  1MZB A;  5KFZ A;  4AYB A;  3PW2 A;  2W6Q A;  4WBN A;  2WLK A;  2JEF A;  1BL8 A;  4H33 A;  4QWA A;  1N32 O;  4TUY B;  1JXL A;  1E4F T;  4RAZ A;  2CW7 A;  1KUQ A;  3N42 B;  5BMV B;  2JS5 A;  2QF7 A;  1L8D A;  4DV3 H;  3JD1 A;  4O7L A;  5KHG A;  4E4T A;  3QNE A;  4Q20 A;  4LFC H;  4DW0 A;  4DUZ H;  1SZT A;  1IBM H;  3MJF A;  5IYB O;  4BIO A;  3SNO A;  3T2M A;  3B40 A;  3QO7 A;  5FPO A;  1QNM A;  2R7M A;  4PEL A;  5GW7 A;  4JZ2 A;  5KFF A;  5KT5 A;  2HHH H;  3VPB A;  1YTF B;  4N23 A;  3MD0 A;  1EN4 A;  3T1Y B;  1GN4 A;  1EFR G;  3LNN A;  4ECQ A;  4LNU A;  2ZE7 A;  3TIN A;  1Q81 W;  4YY3 B;  1S0V A;  5HBR B;  2Q2T A;  2VS0 A;  2XGQ A;  2FB5 A;  1XL6 A;  1YF2 A;  4JI3 B;  3W7X A;  1GSO A;  3MWD A;  4YHH B;  1N36 B;  3KHG A;  1N4C A;  4CC6 A;  4CH6 A;  5D1P A;  2JA5 A;  4KHP B;  4DR6 B;  1QR8 A;  5KFC A;  4QIW F;  2P0A A;  4I5S A;  3GB8 B;  4CE5 A;  3T1H H;  2QSA A;  4ED3 A;  5DQH A;  2IMW P;  3OGI B;  4IRK A;  4YQW A;  4NXN O;  5LA6 A;  2A7W A;  4OXS A;  4EKW A;  5LBQ A;  3GID A;  4B3T H;  1YTF D;  3HOW G;  3CCU V;  1N34 H;  2DWE C;  1T3N A;  1XMO H;  1YJW V;  1SC5 B;  3T4D A;  1XNQ O;  5FNV A;  3CSX A;  1P7G A;  3K3W A;  3L71 H;  4NZO A;  1S97 A;  2JGU A;  3RYI A;  4HNV A;  4PA6 A;  2QWN B;  4UCU A;  3UYY A;  4JYB A;  1TWC A;  4CS4 A;  4MTG A;  2UUA H;  4EBD A;  2XC9 A;  5LYJ A;  2CK3 G;  2Q69 A;  2XAJ A;  2HP8 A;  4J42 A;  1RYS A;  3HOZ G;  2ABJ A;  5DN6 G;  3DF7 A;  3LML A;  1PL4 A;  2EZP A;  1V55 C;  2NU8 B;  4ECU A;  1X59 A;  2OCC B;  2FMA A;  5KT7 A;  4ICG A;  3RYC A;  4O4H A;  1T36 A;  1I7N A;  4O7T A;  3T5L A;  4JF3 A;  2QJ1 A;  3E8H A;  3Q4H A;  4K0K H;  5BR8 O;  1TAE A;  4O7Z A;  3HKE A;  3GWK C;  1XNR O;  4ME6 A;  4XDK A;  3AG2 C;  1AI5 A;  4FLZ A;  4WFE A;  1HNZ O;  5C8Y B;  1SER A;  3KAL A;  2YZG A;  2W70 A;  5FJ8 G;  1IDS A;  2Y69 C;  5CA0 F;  4LWS B;  4O7V A;  4DV2 O;  4O2B F;  5JQG A;  4FBT A;  4MV3 A;  2VQE H;  2ZKO A;  5H9C A;  1Z5V A;  3WNZ A;  3OR6 C;  2EIY A;  2X0S A;  3LQS A;  4A3F G;  2F1M A;  1R1B A;  4K3A A;  4LF7 O;  2AW9 A;  2ZXW C;  2LFS A;  3FFQ A;  4LF9 O;  3H0G A;  2UXC H;  2W8K A;  2JA6 A;  1WA8 B;  4JV0 A;  4DV1 O;  1ZX3 A;  2QWQ B;  2MCT A;  3JAL A;  5EYP A;  4R6Z A;  4JI6 O;  3K06 A;  4QIW E;  5J2U B;  2I87 A;  4DR1 H;  3H1H H;  1RPO A;  3TW6 A;  4JI7 H;  3CQZ A;  1VBG A;  2FKX A;  3G8D A;  4PA9 A;  3E5N A;  3ZHV A;  1QVF U;  1CKN A;  1IBL B;  4JI2 H;  3BVO A;  1N33 B;  4Q0Y A;  2EIJ B;  3T5K A;  4I50 A;  4X89 A;  4YJ3 B;  5IYD G;  4DR7 O;  1BGY H;  3OR7 C;  4DR4 O;  1HR0 B;  1K4D C;  5LP6 B;  4LH7 A;  4LR3 A;  3K0D A;  2NUA B;  3VOT A;  4ED2 A;  4QJF A;  2EJR A;  2C00 A;  5LXT F;  3HT5 A;  3TQ1 A;  1J5E B;  2DN9 A;  4HYK A;  4TQD A;  2ZR2 A;  1KC7 A;  2ZIO A;  5I60 A;  4ECW A;  2E5L H;  4P9O A;  5D8D A;  1EZ1 A;  1VEW A;  4DR3 O;  2UU9 B;  3VBB A;  3LNM B;  4QPJ A;  4UVB A;  1S0M A;  4J9Q A;  2ASD A;  3K3V A;  5EBL C;  4ED7 A;  2R93 A;  4LF5 B;  2Q9L A;  4CH4 A;  5KHJ A;  1CPY A;  5JVD B;  1KKD A;  4RU9 A;  1WLE A;  3RVY A;  3RTX A;  2WLI A;  1K3E A;  5D5P A;  1WCM G;  5EC2 C;  4NYE A;  1NZ6 A;  3ZCC A;  1I2K A;  2CW8 A;  3RBE A;  1S03 G;  1I0H A;  1Q6H A;  3CRM A;  2BQR A;  3HB9 A;  1I94 B;  2Q5Z A;  4B3M O;  3M7M X;  3O9O A;  1F7Y A;  1HNX B;  1J95 A;  4DV5 O;  3VA7 A;  4B3R B;  4JV5 H;  1GYF A;  1S5L Z;  2IM9 A;  3ZHQ A;  4YR2 A;  4UB8 Z;  3QVN A;  4AIL C;  4F6R A;  4EYH B;  2EIK B;  1FS0 G;  3OTO O;  3WWJ A;  4QIW A;  2V4R A;  2PGG A;  1OCC B;  3HKC B;  3OUF A;  3R23 A;  2Q7E A;  3UKM A;  3KXY T;  5L3F A;  5KFH A;  1M57 C;  1V54 B;  1SYX B;  1VQL V;  1DV2 A;  4JAV A;  2FB9 A;  1VF7 A;  1JFF B;  2HHF A;  2NU9 B;  4O7N A;  4MA0 A;  3SI8 A;  1AP5 A;  4DK0 A;  4BW5 A;  5EZY F;  4U3J A;  3PO3 G;  1TWH A;  3OFN G;  1DF4 A;  2GLT A;  5CN0 A;  4ZI7 B;  3OSP A;  4NZN A;  3CRQ A;  1M9N A;  3BA8 A;  2DPI A;  4A3B G;  5JVL A;  3K03 A;  1VF6 C;  4L1K A;  2A0L A;  3PW4 A;  1QLE C;  1MSD A;  3N2K A;  2YZN A;  1FXK C;  3RB4 A;  2OIE A;  1D5N A;  1JA8 A;  1AR4 A;  2DYS C;  5EBM C;  2CTW A;  2RCV A;  3CJH A;  3EYY A;  2RNB A;  4J9N A;  4PA4 A;  4RO2 A;  2C2E A;  1I1M A;  1P49 A;  4Q8F A;  2HVS A;  2OT5 A;  2W9C A;  4FLX A;  4J80 A;  3AK3 A;  1VF6 A;  4ABM A;  4PZ8 A;  4L87 A;  1FXK A;  3TIG A;  1EUD B;  2HFE C;  2Y0I A;  1QU7 A;  1F4N A;  2DMX A;  5LOV B;  5I5U A;  4O2B A;  3E8G A;  5CMU A;  3CCV V;  1ORQ C;  4TOI A;  2W9B B;  4F4W A;  4DIM A;  2YZL A;  1I5Y A;  5C1O A;  3IJ4 A;  3MHH C;  1IX9 A;  5BWW A;  5KFY A;  4XDL A;  4I55 A;  3PR5 B;  1SQF A;  2EIL B;  1WB7 A;  1AUX A;  2YIA A;  4E4E A;  5LHG A;  4J9R A;  1MOF A;  4KUM A;  4A3E G;  1Y1W A;  4DL4 A;  1AVM A;  3RYF B;  4ED1 A;  2Z5U A;  1S68 A;  3H4D A;  2VUM A;  3ETH A;  4TV8 F;  1NTZ H;  4O4L F;  2UXB H;  3GV8 B;  4U7C A;  2CDY A;  2R86 A;  5KFK A;  1K9M W;  2WAM A;  3AG7 A;  1ZSP A;  4WBN B;  3SJQ C;  1E4E B;  3T99 A;  2QA4 V;  3ZRW A;  5BPF A;  4O3O A;  3OHB A;  2V4Q A;  4GCZ A;  5KHI A;  1WAZ A;  5C93 A;  1S0O A;  2ZIM A;  4CS3 A;  4K6N A;  3RIZ A;  3ZHT A;  4YAJ B;  2XTA A;  5FLX W;  3D8C A;  2GQS A;  2YW2 A;  2ALZ A;  2WYO A;  2VA3 A;  1HNZ H;  1BZK A;  3QG5 A;  4QWC A;  2IU0 A;  1D5A A;  4J9S A;  3QZ8 A;  1W0K G;  2HG8 A;  4GX5 A;  1FXH A;  3S24 A;  2IU3 A;  4DO2 A;  2WAQ E;  4IR1 A;  5LXT A;  2NVY A;  1VAR A;  2Y0P A;  3QF7 A;  3HPL C;  2UVU A;  4LNU B;  1P8L A;  2R82 A;  5LGT A;  4RWU A;  1G1X B;  1R3I C;  1JOY A;  4RQE A;  3Q8S B;  5KFJ A;  2AGA A;  5IYD O;  4LF7 H;  3VOU A;  5GON F;  1HNW B;  4FFB A;  1YEW A;  4LF9 H;  5BR8 B;  4JTC B;  3T1Y O;  3JSN A;  5KHK A;  1ZL8 A;  1XNR B;  4J11 A;  2BSK A;  3BAA A;  1EUC B;  2P06 A;  2WPD G;  4Q43 A;  3M99 B;  4NXM H;  3KRE A;  5K1P A;  4YY3 O;  3G4S V;  1MNG A;  2JIZ G;  1TWG A;  2AZ2 A;  1JCH A;  5B1A C;  3TXQ A;  4CBC A;  5LA6 B;  1SFO A;  4JI3 O;  2ZDI C;  1IZ3 A;  4X66 H;  4LBE C;  1N36 O;  3N6X A;  1XK5 A;  1RSO B;  2QTO A;  5FNV B;  4MVO A;  4K8Z A;  2JEI A;  4DL6 A;  5KG1 A;  1KBL A;  1GN3 A;  4DR7 H;  2W6P A;  5LMN H;  5LYJ B;  2ITC C;  3UQ8 A;  2VQD A;  2R7K A;  3V6K A;  3N6R A;  3PJS K;  4DQN A;  4RZQ A;  2MW2 B;  2MK3 A;  2ZDI A;  4TWK A;  4O2A A;  1S5H C;  3W7U A;  5IDJ A;  1QR9 A;  4P30 A;  4DV1 B;  3U9T A;  4CMF A;  1FXV A;  2YEV A;  3L4K A;  2Q8V A;  4O4H B;  3E89 A;  1FD9 A;  5DEC A;  1E79 G;  1SQP H;  4HNU A;  4GX2 A;  4DR3 H;  3V6J A;  4ZHQ F;  4DV0 B;  3HKE B;  3VNN A;  2ZR3 A;  3H3V H;  4X1K A;  3JAS A;  5EZY A;  1XMQ B;  5KFI A;  3GIJ A;  2DQ3 A;  2LJ2 A;  2FYU H;  1GM7 A;  2JA8 G;  2DE0 X;  4PI2 A;  5AG2 A;  5IJ9 A;  5LGU A;  2ZM6 H;  3LUL A;  3K5N A;  3K0G A;  1N8R W;  1MSW D;  3CSW A;  3SJC C;  2WAQ A;  5JQG B;  4DR4 B;  2M05 A;  5D5Q A;  5KFL A;  2AU0 A;  2DAA A;  3FB8 C;  1YSC A;  1R3L C;  2JDI G;  4UXN A;  3UO2 A;  4FM2 A;  4JUZ A;  1MZE A;  1Y1V G;  2E3C A;  3SJA C;  4UFZ A;  4G3I A;  5B1B C;  5KG6 A;  4RUE A;  4BR6 A;  4Z1V A;  3ASO C;  1WB8 A;  1VQM V;  2WLL A;  3I12 A;  2WE6 A;  4H13 B;  2R7L A;  3ZHU A;  4M9U A;  1SQG A;  3GIM A;  3R5H A;  2Y69 B;  4X9Q A;  4RZR A;  4RUF A;  2YI8 A;  2Q0O C;  3OTO H;  2CTQ A;  5ITZ B;  3GTP A;  5B5E Z;  5L3D A;  3CWB H;  4J9Z B;  5DGI A;  5EYP B;  3J81 N;  3UT5 B;  3RB0 A;  1KJQ A;  1S0N A;  4LF6 B;  4AQY H;  3F8N A;  3G6X A;  1MZF A;  1H2S B;  4FK5 C;  3LSU A;  3IN5 A;  1JKJ B;  2GBO A;  3D3Q A;  4O4J B;  3SPH A;  4EB6 B;  3TXS A;  3M4I A;  5CM0 A;  4B3M B;  4AHC A;  1KBH A;  2QWO B;  4EGQ A;  5EOY A;  4OX9 H;  4I50 B;  2HVK C;  1UFI A;  3ABK B;  2FK3 A;  4DV6 H;  3CCS V;  4TV8 A;  4O4L A;  2WA3 A;  4PDV A;  4QJF B;  4JI5 O;  3K5L A;  1CQJ B;  3DSQ A;  2JA7 A;  4PDR A;  5KFW A;  2F95 B;  1RP3 B;  2E74 B;  1IBL O;  3T9E A;  4ECY A;  1BSM A;  4MW3 A;  1NQT A;  2X7R B;  3TJT A;  3MWE A;  4F4L A;  5IT9 N;  1OCZ B;  1HR0 O;  3MR3 A;  2Z02 A;  4O84 A;  3L75 H;  5JH7 F;  2EJ3 A;  5DQG A;  4LCU C;  4ZOL A;  5L1I A;  2JA5 G;  1KP3 A;  1AIL A;  1KKC A;  3JAT A;  3K04 A;  2PI4 A;  4OGQ B;  1BQZ A;  3X2Q C;  3CCL V;  1FPO A;  2RQ6 A;  5LHH A;  1AI6 A;  3OM3 B;  4U3F H;  4I7Z B;  3SJB C;  3T9C A;  4F50 A;  1BMF G;  5KAI Z;  1XQ8 A;  3OMI B;  3EPG A;  2WLI B;  4ZIB A;  5CB4 B;  2UU9 O;  4I7H A;  2UUC O;  4TV9 F;  2FE3 A;  3ZRS A;  4ECT A;  4IIJ F;  1VQ7 V;  2WA4 A; 
#chains in the Genus database with same CATH homology
 5FNV A;  3CSX A;  4JI0 H;  5KMG A;  2JGU A;  3RYI A;  4UCU A;  1WH2 A;  1TVK A;  3RF2 A;  2KSW A;  4CS4 A;  2UUA H;  5KMG B;  5LYJ A;  3RYI B;  1SKV A;  5GON A;  2CFM A;  4LMY A;  4DR2 H;  3MWM A;  4DR4 H;  2O03 A;  3DF7 A;  3LML A;  4F6R B;  2VQF B;  2CAZ C;  3BHP A;  4O4I A;  4A2A A;  4L8J A;  3RYC A;  4O4H A;  4EFB A;  1FFX A;  4GKJ B;  4GKK H;  4RB2 C;  4DRF A;  5IWA H;  2QJ1 A;  3RYC B;  4K0K H;  1FFX B;  3N43 B;  1TAE A;  3E22 A;  3HKE A;  2ZCE A;  4X64 H;  5C8Y A;  3JAR A;  4TV9 B;  2PY5 A;  2WDT A;  1X4T A;  4FLZ A;  3N44 B;  4APM A;  2HIX A;  4RB1 A;  2UXD H;  3KAL A;  5C8Y B;  3KAJ A;  4LF4 H;  1QQC A;  4GLX A;  1TUB A;  5JQG A;  4LF6 H;  4JI8 H;  5J2T A;  2VQE H;  3U0Z A;  4DV7 H;  1Z5V A;  4IHJ A;  4EEQ A;  4HNA A;  2Q7G A;  1ZHQ A;  1M4U A;  4GYC B;  4HNA B;  1N32 B;  3TY5 A;  4B3M H;  1JJO A;  2F1M A;  4FLW A;  2P5O A;  3FFQ A;  5DIS C;  2UXC H;  4DV5 H;  3GJX B;  4ZHQ A;  4FLT A;  5IYZ A;  1FJG B;  2BTO A;  2MCT A;  4ZHQ B;  1Z2P X;  3JAL A;  5EYP A;  4X1Y A;  1L2Z A;  4YY3 H;  5J2U B;  5JJN B;  4DUY H;  3JAL B;  1NT2 B;  4BWA A;  4DR1 H;  5BMV A;  4JI3 H;  1SA0 A;  2VPS A;  4JI7 H;  4YHH H;  1N36 H;  1I7F A;  3VQV A;  3N41 B;  3NBZ B;  1HNW H;  1CKN A;  4I55 B;  1IBL B;  4JI2 H;  3RGB A;  4KHP H;  4DR6 H;  2YIB A;  1N33 B;  4X65 H;  4Q0Y A;  3CB2 A;  4RAY A;  4I50 A;  4YJ3 B;  1CKN B;  2VWK A;  4UCO A;  5LMU B;  2HVR A;  1HR0 B;  4X62 H;  5LP6 B;  4LH7 A;  4LR3 A;  3WB0 A;  4LSX A;  4DR5 B;  1J5E B;  3IAY A;  1TGO A;  3OTF A;  4TQD A;  2Q7H A;  2PZS A;  2F66 C;  2ZIO A;  4NXN B;  1A0I A;  4B3S B;  2E5L H;  2RGR A;  4LSA A;  2UU9 B;  2HEP A;  4FLY A;  3N2G B;  1XNQ B;  3H20 A;  1VS0 A;  1T5E A;  3K3V A;  5JVD A;  4UCS A;  2VQF H;  4LF5 B;  3MAQ A;  4CH4 A;  4UCV A;  5KHJ A;  3RGX A;  5JVD B;  4CH3 A;  5D1O A;  3PN1 A;  3A2F A;  3RTX A;  2ZJT A;  2ZIN A;  1M0W A;  5D5P A;  2UXB B;  5D1O B;  2CW8 A;  2XIG A;  1S03 G;  5KHH A;  3W1B A;  1I94 B;  4AQY B;  4RB0 A;  4BWS C;  3M7M X;  1CKO A;  4DV0 H;  2OWO A;  4PZ6 A;  1HNX B;  1XMQ H;  2EX3 A;  4PI0 A;  1Z5W A;  4B3R B;  4JV5 H;  1GYF A;  4DUZ B;  2IM9 A;  1IBM B;  4FFB B;  4AIL C;  4F6R A;  5FD6 A;  2F93 B;  4OX9 B;  5JH7 B;  2PUS A;  1HNZ B;  2PGG A;  1Q3E A;  3HKC B;  4DV6 B;  1SEI A;  4FM1 A;  4DV2 B;  2Q7E A;  3KXY T;  1XHX A;  1SYX B;  4E6N A;  1JFF A;  1VF7 A;  2RGV A;  1JFF B;  2HVQ A;  4TV9 A;  3QTC A;  3GDE A;  4IIJ A;  3L4J A;  1CKM A;  4DK0 A;  1BGW A;  3K59 A;  2YXL A;  4U3J A;  2UUB B;  4IIJ B;  4LFB B;  1V9P A;  1JMK C;  2HGS A;  4JI4 H;  4ZI7 B;  4I4T B;  3VQY A;  4FVM A;  3BA8 A;  4U3J B;  4FLU A;  4LF7 B;  4LF9 B;  3QWU A;  4J0M A;  4DK1 A;  3N2K A;  3SR2 C;  1Q5O A;  3U11 A;  3ZS8 C;  2XHB A;  4KL1 A;  4NXM B;  3N2K B;  4JI6 B;  4O2A B;  3IG0 A;  3J7A K;  3EYY A;  2BTQ B;  1IBL H;  1P49 A;  1N33 H;  2HVS A;  5IJ0 A;  4X66 B;  1XHZ A;  1O75 A;  5LMU H;  3RGZ A;  4FLX A;  3SGI A;  4B08 A;  4HBN A;  5IJ0 B;  3NBY B;  5K1X A;  5FPR A;  2F4V H;  4PZ8 A;  3C0F B;  4DR5 H;  4X1K B;  3JAS B;  3T1Y H;  1J5E H;  5LP6 C;  2HIV A;  5J2U A;  4DR7 B;  3VQW A;  5LOV B;  5LMN B;  5JJE B;  4O2B A;  3K58 A;  4A2B A;  1Q8I A;  4EQ5 A;  1Q43 A;  4TOI A;  3RWR D;  5CA0 B;  5JCO C;  4B3S H;  4O2B B;  3JAK A;  4X20 B;  3J80 W;  4JI5 B;  4DRX A;  4I55 A;  1SQF A;  3JAK B;  5IWA B;  2VUG A;  3RYF A;  4YJ3 A;  2YIA A;  4DRX B;  4EFE A;  1DGS A;  3FMA A;  3HKD B;  4X64 B;  3RYF B;  5LP6 A;  4DR3 B;  4RB3 C;  1S68 A;  2UXB H;  2P22 C;  2W57 A;  5JCO A;  4JYA B;  2PTM A;  1M5I A;  5FD5 A;  2ZM6 B;  2JVD A;  5EIB D;  1I94 H;  3BRC A;  4WBN B;  1M0T A;  2VQE B;  4UCT A;  4DV7 B;  3N40 P;  1HNX H;  3HKB B;  4B3R H;  1KU9 A;  3N2G A;  5KHI A;  2ZIM A;  4CS3 A;  3RIZ A;  2UUC B;  1XDN A;  2GV9 A;  5FLX W;  4JI1 B;  2WYO A;  1HNZ H;  3QG5 A;  4DV5 B;  4LFA B;  1D5A A;  3S24 A;  3K5O A;  4YJ2 B;  1S5J A;  1TA8 A;  3OTO B;  5LXT A;  4GKJ H;  4CH5 A;  4FLV A;  4ETS A;  3QF7 A;  4LNU B;  1P8L A;  2R9A A;  4MV7 A;  5LXT B;  4DR1 B;  4LF8 B;  3RR5 A;  2UUB H;  4JI7 B;  4LFB H;  3L2P A;  1ZHS A;  4LF7 H;  4CS2 A;  1HNW B;  4DV3 B;  4FFB A;  1YEW A;  4LF9 H;  5BR8 B;  1P16 A;  1ZAU A;  3JSN A;  4LFC B;  4X1I A;  5JJJ B;  5KHK A;  4K8X A;  3W5O A;  5JH7 A;  1XNR B;  4ZOL B;  3BAA A;  3HXL A;  4Q6G A;  3JAT B;  3NC0 B;  3HKC A;  4NXM H;  4X1I B;  5K1P A;  2HHH B;  5CA1 A;  3RYH B;  5LA6 B;  4BW9 A;  1N32 H;  1RSO A;  4X66 H;  3W1G A;  1IBK B;  5CA1 B;  3N6X A;  1XK5 A;  3BAB A;  5FNV B;  2E5L B;  4ZI7 A;  4K8Z A;  2VOB A;  1FKA H;  4I4T A;  4IAJ A;  1FJG H;  3ICX A;  2YCH A;  1TVK B;  3JSL A;  4TQF A;  4DR7 H;  5LMN H;  5LYJ B;  1BJT A;  5GON B;  1QHT A;  2R70 A;  3UQ8 A;  3VQX A;  5EIB C;  1WPB A;  4DV4 B;  2PYJ A;  3WB2 A;  2Q0A A;  4RZQ A;  4O2A A;  4DV1 B;  3JAW A;  1E4G T;  3ETQ A;  4MV9 A;  3T1H B;  4JI5 H;  2BTQ A;  4O4I B;  4B3T B;  3JAW B;  2YI9 A;  4O4H B;  3L4K A;  1M93 A;  4NVP A;  1N34 B;  1XI1 A;  4UCR A;  3CHX A;  1X9N A;  4DR3 H;  1XMO B;  1O9G A;  3TY8 A;  3E22 B;  4DV0 B;  3HKE B;  3ZED A;  3VNN A;  1HR0 H;  4X1K A;  2ZNJ A;  3JAS A;  3JAR B;  4JI0 B;  4FM9 A;  5EZY A;  1XMQ B;  4JYA H;  4JV5 B;  3BA9 A;  3TY9 A;  2UUA B;  4PHZ A;  5LOV A;  1WN7 A;  5LL6 b;  5EZY B;  3THO A;  4PI2 A;  5IJ9 A;  2ZM6 H;  3K5N A;  5CA0 A;  3JAM W;  1TUB B;  3SJC C;  5JQG B;  4DR2 B;  4DR4 B;  3WB1 A;  4X20 A;  5IJ9 B;  4MTD A;  4M7E A;  5D5Q A;  5J2T B;  4D7T A;  4NXN H;  4FM2 A;  4D7S A;  4IHJ B;  3K5M A;  2UU9 H;  2E3C A;  2RJZ A;  3SJA C;  1FVI A;  5KX5 A;  4UFZ A;  2UUC H;  4GKK B;  1XNQ H;  4PDB A;  4JI1 H;  3HKD A;  5KX5 B;  4K0K B;  2WE6 A;  4LFA H;  4LF5 H;  1SQG A;  2KKW A;  5ITZ A;  2R72 A;  4JI4 B;  4CC5 A;  2YI8 A;  1Z2N X;  3OTO H;  5IYZ B;  5ITZ B;  2UXD B;  3UT5 A;  4LF4 B;  4TUY A;  1G6U A;  1MZB A;  5EYP B;  4WBN A;  4X1Y B;  3UT5 B;  4LF8 H;  4TUY B;  3KYH C;  1AN7 A;  4LF6 B;  4AQY H;  1E4F T;  3F8N A;  4RAZ A;  4JI8 B;  4O4J A;  3HKB A;  2CW7 A;  1H2S B;  4R7R A;  4EB6 A;  3N42 B;  5BMV B;  2JS5 A;  1L8D A;  1SA0 B;  4O4J B;  4DV3 H;  4PZ7 A;  3B2E E;  4EB6 B;  5KHG A;  5BR8 H;  1O9H A;  3M4I A;  4MTE A;  4LFC H;  4DUZ H;  4LH6 A;  1IBM H;  2VWJ A;  1XNR H;  4B3M B;  3BPZ A;  4AHC A;  5EOY A;  3J81 W;  2QM4 A;  5FPO A;  4OX9 H;  4I50 B;  2F4V B;  2UXC B;  2HHH H;  4DV6 H;  4YJ2 A;  1HW7 A;  4DV2 H;  4TV8 A;  3T1Y B;  4O4L A;  5A2Q W;  3LNN A;  1KMI Z;  4LNU A;  3K5L A;  3DSQ A;  1IBK H;  4TV8 B;  1WNS A;  2F95 B;  4O4L B;  4I9Q A;  4YY3 B;  2Q2T A;  4DUY B;  2PYL A;  2Q2U A;  3KAK A;  1Z2O X;  4JI3 B;  3U10 A;  4YHH B;  1N36 B;  3CVZ A;  3RFR A;  4CC6 A;  2V4D A;  4ZOL A;  4CH6 A;  4JI2 B;  5D1P A;  4DV4 H;  4KHP B;  4DR6 B;  3JAT A;  4X65 B;  4DV1 H;  2RQ6 A;  4FM0 A;  2OYQ A;  3GB8 B;  2YIB D;  3T1H H;  3SJB C;  4X62 B;  3RJ0 A;  1B04 A;  5CB4 A;  4JI6 H;  3RYH A;  5LA6 A;  4B3T H;  1XQ8 A;  1I6U A;  4ZIB A;  3K57 A;  5CB4 B;  1N34 H;  5IT9 W;  4I7H A;  1XMO H;  2FE3 A;  2ZNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...