3QQMA

Crystal structure of a putative amino-acid aminotransferase (np_104211.1) from mesorhizobium loti at 2.30 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
214
Chain Sequence
PLRDGDTADFELIETMRWQPGTSFLRFDRHLARLYGSAAELGFACDPQRIAEVLSDALDGARTAMRTRLALARNGDATASAQPYEPLAADKVWILRLARTRLDSQNTLLRHTSRRQLYTHARSEYLVTQADEVLLANERGEICEGTITNVFADFGDGVLATPRLDCGLLPGVLRAELLDEGRAEEAIYSYDDLKSAKALFVGNSLRGLIPAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative amino-acid aminotransferase (NP_104211.1) from Mesorhizobium loti at 2.30 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Transferase
molecule keywords Mlr3007 protein
total genus 67
structure length 214
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 3qqmA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3qqmA01
3UZOA 3JZ6A 1I2LA 4CMFA 5FR9A 2COGA 4DAAA 1DAAA 3LULA 3LQSA 5BWRA 5DAAA 2HDKA 3WWJA 3WWHA 2Y4RA 4PBCA 3DTGA 3CSWA 5BWTA 5BWVA 1EKFA 5I60A 2EJ2A 4JXUA 2HGXA 5I5YA 2EJ0A 2COJA 2HG8A 5BWXA 1IYDA 2ABJA 3UYYA 2ZGIA 5I5WA 4CMDA 1WRVA 5CM0A 1IYEA 1EKVA 3DTFA 2HHFA 4DQNA 3QQMA 5I5SA 5E25A 2DABA 5I5VA 2EIYA 2DAAA 1EKPA 3UZBA 4TM5A 5BWUA 3CEBA 1A3GA 1I1MA 3U0GA 2HHFB 1KT8A 4TVIA 3SNOA 1KTAA 2EJ3A 5K3WA 5I5TA 4K6NA 3DAAA 2HGWA 4CHIA 1A0GA 3WWIA 1ET0A 3HT5A 5HNEA 5CE8A 1G2WA 4CE5A 1I1KA 5I5UA 4WHXA 5I5XA 4M0JA 2A1HA 1I1LA 2COIA 5BWWA 5CR5A 4UUGA 1I2KA
chains in the Genus database with same CATH superfamily
4C5BA 5C1OA 3W1BA 3VNNA 4O7ZA 5BPFA 1OBGA 5FR9A 2COGA 4TV9F 3VOTA 3LWBA 5K2MA 5DGHA 3LQSA 3R5XA 3K5IA 1E4EA 4PZ8A 3VPBA 5CB4F 4O84A 1CKNB 5BWVA 2NU9B 2EJ2A 2W6OA 3T9AA 2HGXA 5I5YA 3RV4A 3I12A 3SGIA 1PK8A 1C30A 2EJ0A 4ZQIA 1KC7A 4EFEA 3K3PA 5BWXA 3AW8A 3NBZB 3UYYA 2HVSA 2V58A 2ZGIA 2Z02A 4EGJA 2OLSA 3OUUA 4PZ7A 5HV6A 2GPSA 4HNVA 2W6ZA 5CM0A 3TY9A 5KKNB 1P8LA 3BA9A 4YJ3F 2HVRA 4FFPA 1CQIB 3QWUA 2SCUB 2WYOA 4TUYF 2YZMA 2DAAA 5I47A 4L1KA 3GDEA 3TEKA 4E6NA 5BPHA 4YB8B 1EUCB 1KT8A 3Q2OA 4O2BF 1EYZA 2PVPA 5D1OB 3JZIA 2QK4A 1CKOA 1JLLB 3T9FA 2FPPB 2Q2UA 2ZDHA 1XK5A 5D1PA 1ET0A 3HT5A 5HNEA 5HBRB 1G2WA 3JSLA 4MV9A 4O7WA 1BXRA 4O4JF 1I1KA 3GB8B 3ETHA 4FGRA 3GJXB 2HVQA 4CKBA 2X5RA 3R9RA 4CKEA 4O7NA 3DF7A 1I1LA 4MV4A 3RR5A 4O4LF 5CA0F 2GPWA 4UUGA 2IP4A 1DGSA 1UC9A 3KREA 5LA6F 3GIDA 1Z2NX 5DISC 2W6MA 3UFXB 3UZOA 2R84A 3JZ6A 2FPIB 1I2LA 1JDBB 3BACA 4HNUA 4M9UA 2CNVA 3NUAA 3TW6A 4ZHQF 1JDEA 2QB5A 4FE2A 3TY8A 5DAAA 1GSHA 3WWJA 3WWHA 3AX6A 1KEEA 4UCVA 4I55F 4DRFA 1V9PA 1I7NA 1IOVA 3G8DA 4EQ5A 4FFRA 1DV1A 1SCUB 3MWDA 5JQGF 2HG8A 1BNCA 4O7VA 1FVIA 3U54A 4NZOA 5J2UF 2DIKA 5FPOA 4FU0A 5I5WA 2YWVA 1EZ1A 2PN1A 5CAEB 4CMDA 4C5CA 1KJJA 2PBZA 4NZNA 4NZMA 3JRWA 4UFZA 5JVDF 5C1PA 2P0AA 3QQMA 4O7TA 3VMMA 3U9SA 1UC8A 5I5SA 3T9DA 4YBZB 2ZDQA 3OUZA 5E25A 2DABA 4QSHA 5I5VA 4HQ6A 4UCOA 2EIYA 3UZBA 3WO0A 3BAAA 1A3GA 3U0GA 4FFMA 2HHFB 3BG5A 4TVIA 5D1OA 4Q4CA 3BA8A 3SNOA 1KTAA 1EHIA 2EJ3A 3PFFA 3TIIA 4ME6A 1A0IA 2HGWA 2DLNA 1IOWA 3HBLA 2GQSA 1T36A 1PX2A 4CE5A 1TAEA 3U55A 3VPCA 1P16A 2XCLA 4YJ2F 4WHXA 5I5XA 5FNVF 5KX5F 3VA7A 1B6RA 1VS0A 2A1HA 2COIA 2I87A 1KJIA 5BWWA 3UQ8A 4DIMA 4MV6A 3NC0B 4RZQA 5DMXA 1I2KA 1CKMA 1E4EB 2I8CA 3KYHC 3T54A 3R23A 3KAJA 4MAMA 4MV1A 5EZYF 2W70A 1S68A 4MA0A 4E4TA 3LULA 3U9TA 5JH7F 3N8DA 3MJFA 3DTGA 1I7LA 1JKJB 4UCUA 5BWTA 3KAKA 5KS8A 1OBDA 1CE8A 4O86A 3NBYB 1EUDB 2W6NA 3JZFA 3T9BA 1TA8A 2R7NA 4MV7A 4XYLB 1IYDA 1KJ9A 2ABJA 4Y8VB 1X9NA 1CS0A 2VQDA 2I80A 4MV8A 2R7MA 1KUTA 2YL2A 5IYZF 5CA1F 1IYEA 3KALA 1DIKA 2W6PA 2YRXA 5LXTF 3G8CA 2W6QA 3T99A 3TIGA 4UCTA 2YZGA 4TV8F 4TM5A 5BWUA 4O2AF 2V59A 1I1MA 2R87A 3TINA 4HNTA 4EG0A 4YAJB 3TQTA 1CQJB 2W71A 3W5OA 3R5FA 5JVLA 3LP8A 5K3WA 4HR7A 4UCRA 2ODTX 4O4IF 4K6NA 1ULZA 3WNZA 3WWIA 2YS6A 3JSNA 3ORRA 4XX0B 4O7RA 4IIJF 5LP6F 4LH7A 1B04A 1VBGA 4Q4DA 4M0JA 1Z2OX 3HO8A 3GLKA 3VPDA 4WBNF 2Z04A 4UCSA 1DV2A 4O83A 4EFBA 5CR5A 3V4SA 4FFLA 3RFCA 1A48A 1M0TA 1M6VA 3RTXA 1VKZA 4NYEA 2YRWA 2R7KA 4O81A 2CNUA 3JRXA 3N6RA 4XYMB 4O82A 4CMFA 5FPRA 4DAAA 1DAAA 1C3OA 2VR1A 5DGIA 5BMVF 4GLXA 2NU7B 4O7LA 5BWRA 3W1GA 2HDKA 3HB9A 3QFFA 1VBHA 2HJWA 2Y4RA 4FFOA 4PBCA 2VUGA 4IZOA 4O7SA 3CSWA 3V4ZA 1GLVA 2OWOA 1EKFA 5I60A 4JXUA 2R86A 4I4TF 2COJA 4FFNA 1XDNA 1CKNA 2NU6B 1KBLA 3T9CA 2DZDA 1KJQA 2ZDGA 4LH6A 1W96A 2Q7DA 4C5AA 4IWYA 3RV3A 2HIVA 3MWEA 3S24A 4CC5A 3L2PA 4IHJF 1KJ8A 1WRVA 3T7AA 3Q1KA 3T9EA 4ZI7F 4ZOLF 1EKVA 3DTFA 2HHFA 2X0SA 4DQNA 4XZ3B 4CKCA 2HGSA 2CFMA 2CNQA 1W93A 3RUPA 4EEQA 2DWCA 4YAKB 1GSAA 2XD4A 2GQRA 3WO1A 2R85A 1EKPA 5D8DA 4DLKA 5BYBA 3SE7A 4CC6A 3CEBA 4PZ6A 1GSOA 2VPQA 4HN2A 1AUVA 3ORQA 5LYJF 2FPGB 5H80A 3R5HA 2YS7A 2Q2TA 5GONF 5I5TA 1Z2PX 3BABA 3TW7A 5JQWA 3E5NA 3ETJA 3PN1A 3DAAA 4CHIA 2YYAA 1A0GA 2R7LA 2FB9A 4GLWA 1M0WA 2FP4B 5CE8A 2V5AA 3TY5A 1GGOA 2R82A 2HIXA 4O4HF 5BYAA 2QF7A 4MA5A 2YZLA 5I5UA 1B6SA 2NU8B 5C8YF 1WR2A 4EGQA 4MV3A 5J2TF 2C00A 4IWXA 2CZGA 5LOVF 2GLTA 2NUAB 4RCNA 2YW2A 4I50F 2J9GA 2YZNA 3K5HA 1AUXA 1ZAUA 4O7YA 1A9XA
chains in the Genus database with same CATH topology
3T54A 3UZOA 3JZ6A 1I2LA 4CMFA 3BACA 5FR9A 2COGA 4DAAA 1DAAA 5DGIA 5K2MA 5DGHA 3LULA 3LQSA 5BWRA 2QB5A 5DAAA 2HDKA 3WWJA 3WWHA 2Y4RA 4PBCA 3DTGA 3CSWA 5KS8A 5BWTA 5BWVA 1EKFA 5I60A 2EJ2A 4JXUA 3T9AA 2HGXA 5I5YA 3SGIA 2EJ0A 2COJA 2HG8A 3T9CA 3T9BA 5BWXA 1IYDA 2ABJA 3UYYA 4NZOA 2ZGIA 2Q7DA 4IWYA 5I5WA 4CMDA 1WRVA 4NZNA 5CM0A 4NZMA 1IYEA 3T7AA 3T9EA 1EKVA 3DTFA 2HHFA 4DQNA 4CKCA 3QQMA 1UC8A 5I5SA 3T9DA 5E25A 2DABA 3T99A 5I5VA 2EIYA 2DAAA 1EKPA 5I47A 3UZBA 4TM5A 5BWUA 5BYBA 3CEBA 1A3GA 1I1MA 3U0GA 3TEKA 2HHFB 4HN2A 1KT8A 4TVIA 4Q4CA 3SNOA 1KTAA 2EJ3A 5K3WA 5I5TA 3PFFA 3TW7A 2ODTX 4K6NA 3DAAA 2HGWA 4CHIA 1A0GA 3T9FA 3WWIA 4GLWA 1ET0A 3HT5A 5HNEA 5CE8A 1G2WA 4CE5A 5BYAA 1I1KA 5I5UA 4CKBA 2X5RA 4WHXA 5I5XA 4Q4DA 4CKEA 4M0JA 2A1HA 4IWXA 1I1LA 2COIA 3VPDA 5BWWA 5CR5A 4RCNA 4UUGA 1UC9A 1I2KA 1ZAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZO A;  3JZ6 A;  1I2L A;  4CMF A;  5FR9 A;  2COG A;  4DAA A;  1DAA A;  3LUL A;  3LQS A;  5BWR A;  5DAA A;  2HDK A;  3WWJ A;  3WWH A;  2Y4R A;  4PBC A;  3DTG A;  3CSW A;  5BWT A;  5BWV A;  1EKF A;  5I60 A;  2EJ2 A;  4JXU A;  2HGX A;  5I5Y A;  2EJ0 A;  2COJ A;  2HG8 A;  5BWX A;  1IYD A;  2ABJ A;  3UYY A;  2ZGI A;  5I5W A;  4CMD A;  1WRV A;  5CM0 A;  1IYE A;  1EKV A;  3DTF A;  2HHF A;  4DQN A;  3QQM A;  5I5S A;  5E25 A;  2DAB A;  5I5V A;  2EIY A;  2DAA A;  1EKP A;  3UZB A;  4TM5 A;  5BWU A;  3CEB A;  1A3G A;  1I1M A;  3U0G A;  2HHF B;  1KT8 A;  4TVI A;  3SNO A;  1KTA A;  2EJ3 A;  5K3W A;  5I5T A;  4K6N A;  3DAA A;  2HGW A;  4CHI A;  1A0G A;  3WWI A;  1ET0 A;  3HT5 A;  5HNE A;  5CE8 A;  1G2W A;  4CE5 A;  1I1K A;  5I5U A;  4WHX A;  5I5X A;  4M0J A;  2A1H A;  1I1L A;  2COI A;  5BWW A;  5CR5 A;  4UUG A;  1I2K A; 
#chains in the Genus database with same CATH topology
 4C5B A;  5C1O A;  3W1B A;  3VNN A;  4O7Z A;  5BPF A;  1OBG A;  5FR9 A;  2COG A;  4TV9 F;  3VOT A;  3LWB A;  5K2M A;  5DGH A;  3LQS A;  3R5X A;  3K5I A;  1E4E A;  4PZ8 A;  3VPB A;  5CB4 F;  4O84 A;  1CKN B;  5BWV A;  2NU9 B;  2EJ2 A;  2W6O A;  3T9A A;  2HGX A;  5I5Y A;  3RV4 A;  3I12 A;  3SGI A;  1PK8 A;  1C30 A;  2EJ0 A;  4ZQI A;  1KC7 A;  4EFE A;  3K3P A;  5BWX A;  3AW8 A;  3NBZ B;  3UYY A;  2HVS A;  2V58 A;  2ZGI A;  2Z02 A;  4EGJ A;  2OLS A;  3OUU A;  4PZ7 A;  5HV6 A;  2GPS A;  4HNV A;  2W6Z A;  5CM0 A;  3TY9 A;  5KKN B;  1P8L A;  3BA9 A;  4YJ3 F;  2HVR A;  4FFP A;  1CQI B;  3QWU A;  2SCU B;  2WYO A;  4TUY F;  2YZM A;  2DAA A;  5I47 A;  4L1K A;  3GDE A;  3TEK A;  4E6N A;  5BPH A;  4YB8 B;  1EUC B;  1KT8 A;  3Q2O A;  4O2B F;  1EYZ A;  2PVP A;  5D1O B;  3JZI A;  2QK4 A;  1CKO A;  1JLL B;  3T9F A;  2FPP B;  2Q2U A;  2ZDH A;  1XK5 A;  5D1P A;  1ET0 A;  3HT5 A;  5HNE A;  5HBR B;  1G2W A;  3JSL A;  4MV9 A;  4O7W A;  1BXR A;  4O4J F;  1I1K A;  3GB8 B;  3ETH A;  4FGR A;  3GJX B;  2HVQ A;  4CKB A;  2X5R A;  3R9R A;  4CKE A;  4O7N A;  3DF7 A;  1I1L A;  4MV4 A;  3RR5 A;  4O4L F;  5CA0 F;  2GPW A;  4UUG A;  2IP4 A;  1DGS A;  1UC9 A;  3KRE A;  5LA6 F;  3GID A;  1Z2N X;  5DIS C;  2W6M A;  3UFX B;  3UZO A;  2R84 A;  3JZ6 A;  2FPI B;  1I2L A;  1JDB B;  3BAC A;  4HNU A;  4M9U A;  2CNV A;  3NUA A;  3TW6 A;  4ZHQ F;  1JDE A;  2QB5 A;  4FE2 A;  3TY8 A;  5DAA A;  1GSH A;  3WWJ A;  3WWH A;  3AX6 A;  1KEE A;  4UCV A;  4I55 F;  4DRF A;  1V9P A;  1I7N A;  1IOV A;  3G8D A;  4EQ5 A;  4FFR A;  1DV1 A;  1SCU B;  3MWD A;  5JQG F;  2HG8 A;  1BNC A;  4O7V A;  1FVI A;  3U54 A;  4NZO A;  5J2U F;  2DIK A;  5FPO A;  4FU0 A;  5I5W A;  2YWV A;  1EZ1 A;  2PN1 A;  5CAE B;  4CMD A;  4C5C A;  1KJJ A;  2PBZ A;  4NZN A;  4NZM A;  3JRW A;  4UFZ A;  5JVD F;  5C1P A;  2P0A A;  3QQM A;  4O7T A;  3VMM A;  3U9S A;  1UC8 A;  5I5S A;  3T9D A;  4YBZ B;  2ZDQ A;  3OUZ A;  5E25 A;  2DAB A;  4QSH A;  5I5V A;  4HQ6 A;  4UCO A;  2EIY A;  3UZB A;  3WO0 A;  3BAA A;  1A3G A;  3U0G A;  4FFM A;  2HHF B;  3BG5 A;  4TVI A;  5D1O A;  4Q4C A;  3BA8 A;  3SNO A;  1KTA A;  1EHI A;  2EJ3 A;  3PFF A;  3TII A;  4ME6 A;  1A0I A;  2HGW A;  2DLN A;  1IOW A;  3HBL A;  2GQS A;  1T36 A;  1PX2 A;  4CE5 A;  1TAE A;  3U55 A;  3VPC A;  1P16 A;  2XCL A;  4YJ2 F;  4WHX A;  5I5X A;  5FNV F;  5KX5 F;  3VA7 A;  1B6R A;  1VS0 A;  2A1H A;  2COI A;  2I87 A;  1KJI A;  5BWW A;  3UQ8 A;  4DIM A;  4MV6 A;  3NC0 B;  4RZQ A;  5DMX A;  1I2K A;  1CKM A;  1E4E B;  2I8C A;  3KYH C;  3T54 A;  3R23 A;  3KAJ A;  4MAM A;  4MV1 A;  5EZY F;  2W70 A;  1S68 A;  4MA0 A;  4E4T A;  3LUL A;  3U9T A;  5JH7 F;  3N8D A;  3MJF A;  3DTG A;  1I7L A;  1JKJ B;  4UCU A;  5BWT A;  3KAK A;  5KS8 A;  1OBD A;  1CE8 A;  4O86 A;  3NBY B;  1EUD B;  2W6N A;  3JZF A;  3T9B A;  1TA8 A;  2R7N A;  4MV7 A;  4XYL B;  1IYD A;  1KJ9 A;  2ABJ A;  4Y8V B;  1X9N A;  1CS0 A;  2VQD A;  2I80 A;  4MV8 A;  2R7M A;  1KUT A;  2YL2 A;  5IYZ F;  5CA1 F;  1IYE A;  3KAL A;  1DIK A;  2W6P A;  2YRX A;  5LXT F;  3G8C A;  2W6Q A;  3T99 A;  3TIG A;  4UCT A;  2YZG A;  4TV8 F;  4TM5 A;  5BWU A;  4O2A F;  2V59 A;  1I1M A;  2R87 A;  3TIN A;  4HNT A;  4EG0 A;  4YAJ B;  3TQT A;  1CQJ B;  2W71 A;  3W5O A;  3R5F A;  5JVL A;  3LP8 A;  5K3W A;  4HR7 A;  4UCR A;  2ODT X;  4O4I F;  4K6N A;  1ULZ A;  3WNZ A;  3WWI A;  2YS6 A;  3JSN A;  3ORR A;  4XX0 B;  4O7R A;  4IIJ F;  5LP6 F;  4LH7 A;  1B04 A;  1VBG A;  4Q4D A;  4M0J A;  1Z2O X;  3HO8 A;  3GLK A;  3VPD A;  4WBN F;  2Z04 A;  4UCS A;  1DV2 A;  4O83 A;  4EFB A;  5CR5 A;  3V4S A;  4FFL A;  3RFC A;  1A48 A;  1M0T A;  1M6V A;  3RTX A;  1VKZ A;  4NYE A;  2YRW A;  2R7K A;  4O81 A;  2CNU A;  3JRX A;  3N6R A;  4XYM B;  4O82 A;  4CMF A;  5FPR A;  4DAA A;  1DAA A;  1C3O A;  2VR1 A;  5DGI A;  5BMV F;  4GLX A;  2NU7 B;  4O7L A;  5BWR A;  3W1G A;  2HDK A;  3HB9 A;  3QFF A;  1VBH A;  2HJW A;  2Y4R A;  4FFO A;  4PBC A;  2VUG A;  4IZO A;  4O7S A;  3CSW A;  3V4Z A;  1GLV A;  2OWO A;  1EKF A;  5I60 A;  4JXU A;  2R86 A;  4I4T F;  2COJ A;  4FFN A;  1XDN A;  1CKN A;  2NU6 B;  1KBL A;  3T9C A;  2DZD A;  1KJQ A;  2ZDG A;  4LH6 A;  1W96 A;  2Q7D A;  4C5A A;  4IWY A;  3RV3 A;  2HIV A;  3MWE A;  3S24 A;  4CC5 A;  3L2P A;  4IHJ F;  1KJ8 A;  1WRV A;  3T7A A;  3Q1K A;  3T9E A;  4ZI7 F;  4ZOL F;  1EKV A;  3DTF A;  2HHF A;  2X0S A;  4DQN A;  4XZ3 B;  4CKC A;  2HGS A;  2CFM A;  2CNQ A;  1W93 A;  3RUP A;  4EEQ A;  2DWC A;  4YAK B;  1GSA A;  2XD4 A;  2GQR A;  3WO1 A;  2R85 A;  1EKP A;  5D8D A;  4DLK A;  5BYB A;  3SE7 A;  4CC6 A;  3CEB A;  4PZ6 A;  1GSO A;  2VPQ A;  4HN2 A;  1AUV A;  3ORQ A;  5LYJ F;  2FPG B;  5H80 A;  3R5H A;  2YS7 A;  2Q2T A;  5GON F;  5I5T A;  1Z2P X;  3BAB A;  3TW7 A;  5JQW A;  3E5N A;  3ETJ A;  3PN1 A;  3DAA A;  4CHI A;  2YYA A;  1A0G A;  2R7L A;  2FB9 A;  4GLW A;  1M0W A;  2FP4 B;  5CE8 A;  2V5A A;  3TY5 A;  1GGO A;  2R82 A;  2HIX A;  4O4H F;  5BYA A;  2QF7 A;  4MA5 A;  2YZL A;  5I5U A;  1B6S A;  2NU8 B;  5C8Y F;  1WR2 A;  4EGQ A;  4MV3 A;  5J2T F;  2C00 A;  4IWX A;  2CZG A;  5LOV F;  2GLT A;  2NUA B;  4RCN A;  2YW2 A;  4I50 F;  2J9G A;  2YZN A;  3K5H A;  1AUX A;  1ZAU A;  4O7Y A;  1A9X A; 
#chains in the Genus database with same CATH homology
 3T54 A;  3UZO A;  3JZ6 A;  1I2L A;  4CMF A;  3BAC A;  5FR9 A;  2COG A;  4DAA A;  1DAA A;  5DGI A;  5K2M A;  5DGH A;  3LUL A;  3LQS A;  5BWR A;  2QB5 A;  5DAA A;  2HDK A;  3WWJ A;  3WWH A;  2Y4R A;  4PBC A;  3DTG A;  3CSW A;  5KS8 A;  5BWT A;  5BWV A;  1EKF A;  5I60 A;  2EJ2 A;  4JXU A;  3T9A A;  2HGX A;  5I5Y A;  3SGI A;  2EJ0 A;  2COJ A;  2HG8 A;  3T9C A;  3T9B A;  5BWX A;  1IYD A;  2ABJ A;  3UYY A;  4NZO A;  2ZGI A;  2Q7D A;  4IWY A;  5I5W A;  4CMD A;  1WRV A;  4NZN A;  5CM0 A;  4NZM A;  1IYE A;  3T7A A;  3T9E A;  1EKV A;  3DTF A;  2HHF A;  4DQN A;  4CKC A;  3QQM A;  1UC8 A;  5I5S A;  3T9D A;  5E25 A;  2DAB A;  3T99 A;  5I5V A;  2EIY A;  2DAA A;  1EKP A;  5I47 A;  3UZB A;  4TM5 A;  5BWU A;  5BYB A;  3CEB A;  1A3G A;  1I1M A;  3U0G A;  3TEK A;  2HHF B;  4HN2 A;  1KT8 A;  4TVI A;  4Q4C A;  3SNO A;  1KTA A;  2EJ3 A;  5K3W A;  5I5T A;  3PFF A;  3TW7 A;  2ODT X;  4K6N A;  3DAA A;  2HGW A;  4CHI A;  1A0G A;  3T9F A;  3WWI A;  4GLW A;  1ET0 A;  3HT5 A;  5HNE A;  5CE8 A;  1G2W A;  4CE5 A;  5BYA A;  1I1K A;  5I5U A;  4CKB A;  2X5R A;  4WHX A;  5I5X A;  4Q4D A;  4CKE A;  4M0J A;  2A1H A;  4IWX A;  1I1L A;  2COI A;  3VPD A;  5BWW A;  5CR5 A;  4RCN A;  4UUG A;  1UC9 A;  1I2K A;  1ZAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...