3QQMA

Crystal structure of a putative amino-acid aminotransferase (np_104211.1) from mesorhizobium loti at 2.30 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
214
Chain Sequence
b'PLRDGDTADFELIETMRWQPGTSFLRFDRHLARLYGSAAELGFACDPQRIAEVLSDALDGARTAMRTRLALARNGDATASAQPYEPLAADKVWILRLARTRLDSQNTLLRHTSRRQLYTHARSEYLVTQADEVLLANERGEICEGTITNVFADFGDGVLATPRLDCGLLPGVLRAELLDEGRAEEAIYSYDDLKSAKALFVGNSLRGLIPAKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mlr3007 protein
molecule tags Transferase
source organism Mesorhizobium loti
publication title Crystal structure of a Putative amino-acid aminotransferase (NP_104211.1) from Mesorhizobium loti at 2.30 A resolution
rcsb
total genus 67
structure length 214
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 3qqmA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3qqmA01
5HNEA 5BWRA 5I5WA 4CHIA 4WHXA 5BWTA 5BWXA 2HG8A 3WWJA 3WWIA 1I1MA 2HHFA 2HDKA 1I2KA 1G2WA 3DTGA 3LULA 1I2LA 4CE5A 1IYDA 4K6NA 3CSWA 1WRVA 4TM5A 1EKPA 5BWWA 5CE8A 1DAAA 1EKVA 3HT5A 5E25A 2HGXA 1I1LA 2COGA 4DAAA 2EIYA 1KTAA 2ABJA 3UZOA 3CEBA 3SNOA 2HGWA 3UYYA 4UUGA 5I5UA 5CM0A 4M0JA 3UZBA 3WWHA 5I5XA 1ET0A 5I60A 5CR5A 3DTFA 4CMDA 5DAAA 3U0GA 5BWVA 1I1KA 3JZ6A 1IYEA 2A1HA 2ZGIA 3LQSA 5I5VA 1A3GA 5BWUA 1EKFA 4TVIA 4CMFA 2DAAA 1KT8A 5K3WA 5I5TA 2DABA 2EJ2A 4DQNA 5FR9A 2COIA 5I5SA 2Y4RA 2EJ0A 4JXUA 3QQMA 1A0GA 2HHFB 2COJA 4PBCA 5I5YA 3DAAA 2EJ3A
chains in the Genus database with same CATH superfamily
1GSHA 3R9RA 4MV9A 3OUUA 5HNEA 5BWRA 5I5WA 4O7TA 2WYOA 1KC7A 2CNVA 1Z2PX 1UC9A 3WWJA 5BYAA 1CKMA 2PVPA 1KJJA 3TW7A 3UQ8A 3L2PA 3MJFA 3VNNA 3G8CA 2X0SA 3JRXA 1FVIA 1GSOA 3R5FA 3KAJA 1KBLA 3VMMA 2X5RA 1IYDA 2HVRA 3RV3A 2VR1A 1VBHA 4RCNA 4YJ2F 3T54A 4E4TA 3GIDA 3TY8A 5DGHA 3BA8A 2R7MA 2R84A 4FFOA 5CE8A 1DAAA 3HT5A 4NZNA 5D1OB 3GLKA 4O7YA 2COGA 4DAAA 4FFNA 4HNTA 4O2AF 4MV8A 3SNOA 2ODTX 4HN2A 2HVQA 3UYYA 4UFZA 5H80A 4Y8VB 3WNZA 3UZBA 4O7SA 3HO8A 1CE8A 1E4EA 2GPSA 4ZHQF 2YZLA 3AW8A 5JVDF 3DTFA 4CMDA 5DAAA 1JLLB 1KJ8A 4ME6A 5FPRA 1I1KA 1JDBB 3LQSA 1C3OA 5KKNB 4ZQIA 5FPOA 3ETHA 3BABA 5C1OA 5K3WA 5CA0F 1EZ1A 2OWOA 2SCUB 2COIA 4M9UA 4CKCA 2GLTA 2GPWA 3RFCA 5DGIA 1DV2A 2P0AA 1CKNB 2QF7A 4IZOA 3W1GA 2FB9A 4YB8B 4PBCA 2J9GA 2HVSA 4EFEA 5I5YA 3VA7A 3ORRA 1GGOA 4C5BA 4I50F 2IP4A 1EHIA 3WO0A 4WBNF 3BA9A 3ETJA 2QB5A 4O7ZA 2HG8A 3T9FA 3WWIA 1CKOA 2YL2A 2R7KA 4LH6A 3UFXB 3OUZA 1G2WA 1I7LA 3DTGA 3LULA 3G8DA 3RTXA 3TY9A 2YZMA 3E5NA 5BYBA 3T9AA 1DIKA 4UCRA 2OLSA 4K6NA 1W93A 4YAJB 2Z04A 3TIIA 3VPDA 1S68A 4Q4CA 2YRXA 2DLNA 1WRVA 4YAKB 3TEKA 3W5OA 1W96A 3WO1A 4QSHA 3VPBA 4EQ5A 4NZMA 3JZIA 5BWWA 5D1OA 3S24A 1M6VA 4FFLA 2W70A 1P8LA 2R7NA 3JZFA 3GB8B 2YS6A 3HB9A 4XYMB 3QWUA 1KJIA 1KTAA 3U9SA 2VPQA 4O83A 3TIGA 5GONF 4O4JF 1A0IA 5C1PA 2V59A 3CEBA 3KAKA 3VPCA 4NYEA 3K3PA 5I5UA 1E4EB 2W6ZA 1GSAA 1EUDB 2HIVA 1KJQA 3HBLA 3JSNA 2W6PA 3RR5A 2R85A 4O7NA 3U0GA 2GQRA 4YJ3F 2XD4A 5I5VA 2PN1A 1A3GA 4PZ7A 2W6NA 2Z02A 2XCLA 3GJXB 1GLVA 4Q4DA 1VKZA 2W6QA 2CNUA 4FFRA 4IWXA 5JH7F 1BNCA 4UCUA 2I8CA 2CNQA 5I5TA 3BG5A 2EJ2A 1Z2OX 2DWCA 4E6NA 5FR9A 3AX6A 4HR7A 1P16A 2Y4RA 2R82A 4JXUA 4MV3A 3QQMA 5LA6F 4FU0A 3TY5A 4RZQA 2FPIB 1A0GA 3Q2OA 3BACA 1KJ9A 4FGRA 4O2BF 1IOWA 3MWEA 5J2TF 3T99A 3PFFA 4UCVA 2V58A 5JQGF 5CB4F 3DAAA 1B6RA 3GDEA 2EJ3A 4MAMA 4CHIA 4WHXA 1PX2A 2NU8B 4C5CA 4XX0B 5BWTA 3SGIA 5BWXA 1A48A 4UCSA 2NU6B 3T7AA 5BPFA 1I1MA 2R7LA 2HDKA 5KX5F 1I2KA 3MWDA 4HQ6A 3QFFA 4FFMA 1I2LA 1SCUB 2C00A 4YBZB 4LH7A 1CQJB 4ZOLF 2HJWA 3SE7A 4HNUA 4ZI7F 2HIXA 1B04A 2DIKA 4I4TF 1AUXA 2YS7A 2GQSA 3CSWA 4O4HF 4TM5A 2NU9B 4XYLB 1XDNA 4EG0A 1CS0A 5HBRB 1DGSA 3W1BA 4TV9F 3NBYB 1I1LA 1XK5A 3Q1KA 5EZYF 3TQTA 4EGJA 2ABJA 3UZOA 2CFMA 1WR2A 3RUPA 2HGWA 5LP6F 5CM0A 1TA8A 3NBZB 4MA0A 2YYAA 4IWYA 4GLWA 5K2MA 1OBDA 2Q2UA 5I5XA 5CR5A 3KYHC 2CZGA 3T9EA 5IYZF 5BWVA 1IYEA 2A1HA 4XZ3B 3JRWA 5BWUA 2Q2TA 1EKFA 1I7NA 2HGSA 2ZDQA 4MV4A 5DISC 4TVIA 2YRWA 2ZDHA 5FNVF 3U9TA 5JVLA 4EEQA 4NZOA 3DF7A 2NUAB 4CMFA 3V4ZA 2DAAA 1KT8A 3V4SA 4CKEA 2FP4B 4DQNA 5JQWA 5LOVF 1KUTA 5I5SA 4IHJF 1ULZA 4PZ6A 3R5XA 3N6RA 4FE2A 2HHFB 3T9DA 2W6MA 3K5IA 4MV1A 2COJA 1BXRA 1DV1A 4EFBA 3TINA 4MV6A 1V9PA 4MV7A 1X9NA 1B6SA 1PK8A 1IOVA 1EYZA 3RV4A 2ZDGA 1T36A 4CC6A 4O4IF 3R23A 5BPHA 2HHFA 4DIMA 4IIJF 4CE5A 3T9BA 2PBZA 3U54A 2W6OA 4FFPA 4O7WA 4O84A 4O7RA 1ZAUA 2VQDA 3JSLA 4O86A 5C8YF 4DRFA 2NU7B 4TV8F 4GLXA 5CAEB 4MA5A 3LP8A 5BMVF 1EKPA 4HNVA 1CKNA 3LWBA 5DMXA 4O4LF 2YZGA 1Z2NX 3T9CA 1EKVA 1EUCB 3TW6A 5E25A 2HGXA 4O7LA 5D8DA 2EIYA 2FPPB 5D1PA 4CC5A 4O82A 4L1KA 3NUAA 5KS8A 4UUGA 1JKJB 4M0JA 1TAEA 2W71A 2I87A 2YW2A 5LYJF 4UCOA 3WWHA 4I55F 3KREA 1A9XA 5LXTF 4DLKA 5I47A 2R87A 1ET0A 5I60A 5HV6A 1JDEA 1C30A 3BAAA 3I12A 4CKBA 2FPGB 3JZ6A 2V5AA 2R86A 2ZGIA 3N8DA 1M0WA 3K5HA 3PN1A 3VOTA 1OBGA 2DZDA 4EGQA 1CQIB 3R5HA 3NC0B 1M0TA 3U55A 1VS0A 4C5AA 2Q7DA 1VBGA 5CA1F 2DABA 5J2UF 3ORQA 4TUYF 2EJ0A 1UC8A 4O81A 1KEEA 2YZNA 4PZ8A 4O7VA 1AUVA 2QK4A 2I80A 2VUGA 2YWVA 3KALA 4UCTA
chains in the Genus database with same CATH topology
5HNEA 5BWRA 5I5WA 4CHIA 4WHXA 1UC9A 5BWTA 2QB5A 3SGIA 5BWXA 2HG8A 3WWJA 3T7AA 5BYAA 3T9FA 3TW7A 3WWIA 1I1MA 2HHFA 2HDKA 1I2KA 1G2WA 3DTGA 3LULA 1I2LA 4CE5A 3T9BA 5BYBA 3T9AA 2X5RA 1IYDA 4K6NA 1ZAUA 3VPDA 4RCNA 3CSWA 4Q4CA 3T54A 1WRVA 4TM5A 3TEKA 5DGHA 1EKPA 4NZMA 5BWWA 5CE8A 3T9CA 1DAAA 1EKVA 3HT5A 4NZNA 5E25A 2HGXA 1I1LA 2COGA 4DAAA 2EIYA 1KTAA 2ABJA 3UZOA 3CEBA 3SNOA 2ODTX 4HN2A 5KS8A 2HGWA 3UYYA 4UUGA 5I5UA 5CM0A 4M0JA 3UZBA 3WWHA 4IWYA 4GLWA 5K2MA 5I5XA 5I47A 1ET0A 5I60A 5CR5A 3DTFA 4CMDA 5DAAA 4CKBA 3T9EA 3U0GA 5BWVA 1I1KA 3JZ6A 1IYEA 2A1HA 2ZGIA 3LQSA 5I5VA 1A3GA 5BWUA 1EKFA 4Q4DA 4TVIA 4IWXA 4NZOA 4CMFA 2DAAA 1KT8A 5K3WA 2Q7DA 4CKEA 5I5TA 2DABA 2EJ2A 4DQNA 5FR9A 2COIA 5I5SA 2Y4RA 4CKCA 2EJ0A 4JXUA 1UC8A 3QQMA 1A0GA 3BACA 5DGIA 2HHFB 3T9DA 3T99A 3PFFA 2COJA 4PBCA 5I5YA 3DAAA 2EJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNE A;  5BWR A;  5I5W A;  4CHI A;  4WHX A;  5BWT A;  5BWX A;  2HG8 A;  3WWJ A;  3WWI A;  1I1M A;  2HHF A;  2HDK A;  1I2K A;  1G2W A;  3DTG A;  3LUL A;  1I2L A;  4CE5 A;  1IYD A;  4K6N A;  3CSW A;  1WRV A;  4TM5 A;  1EKP A;  5BWW A;  5CE8 A;  1DAA A;  1EKV A;  3HT5 A;  5E25 A;  2HGX A;  1I1L A;  2COG A;  4DAA A;  2EIY A;  1KTA A;  2ABJ A;  3UZO A;  3CEB A;  3SNO A;  2HGW A;  3UYY A;  4UUG A;  5I5U A;  5CM0 A;  4M0J A;  3UZB A;  3WWH A;  5I5X A;  1ET0 A;  5I60 A;  5CR5 A;  3DTF A;  4CMD A;  5DAA A;  3U0G A;  5BWV A;  1I1K A;  3JZ6 A;  1IYE A;  2A1H A;  2ZGI A;  3LQS A;  5I5V A;  1A3G A;  5BWU A;  1EKF A;  4TVI A;  4CMF A;  2DAA A;  1KT8 A;  5K3W A;  5I5T A;  2DAB A;  2EJ2 A;  4DQN A;  5FR9 A;  2COI A;  5I5S A;  2Y4R A;  2EJ0 A;  4JXU A;  3QQM A;  1A0G A;  2HHF B;  2COJ A;  4PBC A;  5I5Y A;  3DAA A;  2EJ3 A; 
#chains in the Genus database with same CATH topology
 1GSH A;  3R9R A;  4MV9 A;  3OUU A;  5HNE A;  5BWR A;  5I5W A;  4O7T A;  2WYO A;  1KC7 A;  2CNV A;  1Z2P X;  1UC9 A;  3WWJ A;  5BYA A;  1CKM A;  2PVP A;  1KJJ A;  3TW7 A;  3UQ8 A;  3L2P A;  3MJF A;  3VNN A;  3G8C A;  2X0S A;  3JRX A;  1FVI A;  1GSO A;  3R5F A;  3KAJ A;  1KBL A;  3VMM A;  2X5R A;  1IYD A;  2HVR A;  3RV3 A;  2VR1 A;  1VBH A;  4RCN A;  4YJ2 F;  3T54 A;  4E4T A;  3GID A;  3TY8 A;  5DGH A;  3BA8 A;  2R7M A;  2R84 A;  4FFO A;  5CE8 A;  1DAA A;  3HT5 A;  4NZN A;  5D1O B;  3GLK A;  4O7Y A;  2COG A;  4DAA A;  4FFN A;  4HNT A;  4O2A F;  4MV8 A;  3SNO A;  2ODT X;  4HN2 A;  2HVQ A;  3UYY A;  4UFZ A;  5H80 A;  4Y8V B;  3WNZ A;  3UZB A;  4O7S A;  3HO8 A;  1CE8 A;  1E4E A;  2GPS A;  4ZHQ F;  2YZL A;  3AW8 A;  5JVD F;  3DTF A;  4CMD A;  5DAA A;  1JLL B;  1KJ8 A;  4ME6 A;  5FPR A;  1I1K A;  1JDB B;  3LQS A;  1C3O A;  5KKN B;  4ZQI A;  5FPO A;  3ETH A;  3BAB A;  5C1O A;  5K3W A;  5CA0 F;  1EZ1 A;  2OWO A;  2SCU B;  2COI A;  4M9U A;  4CKC A;  2GLT A;  2GPW A;  3RFC A;  5DGI A;  1DV2 A;  2P0A A;  1CKN B;  2QF7 A;  4IZO A;  3W1G A;  2FB9 A;  4YB8 B;  4PBC A;  2J9G A;  2HVS A;  4EFE A;  5I5Y A;  3VA7 A;  3ORR A;  1GGO A;  4C5B A;  4I50 F;  2IP4 A;  1EHI A;  3WO0 A;  4WBN F;  3BA9 A;  3ETJ A;  2QB5 A;  4O7Z A;  2HG8 A;  3T9F A;  3WWI A;  1CKO A;  2YL2 A;  2R7K A;  4LH6 A;  3UFX B;  3OUZ A;  1G2W A;  1I7L A;  3DTG A;  3LUL A;  3G8D A;  3RTX A;  3TY9 A;  2YZM A;  3E5N A;  5BYB A;  3T9A A;  1DIK A;  4UCR A;  2OLS A;  4K6N A;  1W93 A;  4YAJ B;  2Z04 A;  3TII A;  3VPD A;  1S68 A;  4Q4C A;  2YRX A;  2DLN A;  1WRV A;  4YAK B;  3TEK A;  3W5O A;  1W96 A;  3WO1 A;  4QSH A;  3VPB A;  4EQ5 A;  4NZM A;  3JZI A;  5BWW A;  5D1O A;  3S24 A;  1M6V A;  4FFL A;  2W70 A;  1P8L A;  2R7N A;  3JZF A;  3GB8 B;  2YS6 A;  3HB9 A;  4XYM B;  3QWU A;  1KJI A;  1KTA A;  3U9S A;  2VPQ A;  4O83 A;  3TIG A;  5GON F;  4O4J F;  1A0I A;  5C1P A;  2V59 A;  3CEB A;  3KAK A;  3VPC A;  4NYE A;  3K3P A;  5I5U A;  1E4E B;  2W6Z A;  1GSA A;  1EUD B;  2HIV A;  1KJQ A;  3HBL A;  3JSN A;  2W6P A;  3RR5 A;  2R85 A;  4O7N A;  3U0G A;  2GQR A;  4YJ3 F;  2XD4 A;  5I5V A;  2PN1 A;  1A3G A;  4PZ7 A;  2W6N A;  2Z02 A;  2XCL A;  3GJX B;  1GLV A;  4Q4D A;  1VKZ A;  2W6Q A;  2CNU A;  4FFR A;  4IWX A;  5JH7 F;  1BNC A;  4UCU A;  2I8C A;  2CNQ A;  5I5T A;  3BG5 A;  2EJ2 A;  1Z2O X;  2DWC A;  4E6N A;  5FR9 A;  3AX6 A;  4HR7 A;  1P16 A;  2Y4R A;  2R82 A;  4JXU A;  4MV3 A;  3QQM A;  5LA6 F;  4FU0 A;  3TY5 A;  4RZQ A;  2FPI B;  1A0G A;  3Q2O A;  3BAC A;  1KJ9 A;  4FGR A;  4O2B F;  1IOW A;  3MWE A;  5J2T F;  3T99 A;  3PFF A;  4UCV A;  2V58 A;  5JQG F;  5CB4 F;  3DAA A;  1B6R A;  3GDE A;  2EJ3 A;  4MAM A;  4CHI A;  4WHX A;  1PX2 A;  2NU8 B;  4C5C A;  4XX0 B;  5BWT A;  3SGI A;  5BWX A;  1A48 A;  4UCS A;  2NU6 B;  3T7A A;  5BPF A;  1I1M A;  2R7L A;  2HDK A;  5KX5 F;  1I2K A;  3MWD A;  4HQ6 A;  3QFF A;  4FFM A;  1I2L A;  1SCU B;  2C00 A;  4YBZ B;  4LH7 A;  1CQJ B;  4ZOL F;  2HJW A;  3SE7 A;  4HNU A;  4ZI7 F;  2HIX A;  1B04 A;  2DIK A;  4I4T F;  1AUX A;  2YS7 A;  2GQS A;  3CSW A;  4O4H F;  4TM5 A;  2NU9 B;  4XYL B;  1XDN A;  4EG0 A;  1CS0 A;  5HBR B;  1DGS A;  3W1B A;  4TV9 F;  3NBY B;  1I1L A;  1XK5 A;  3Q1K A;  5EZY F;  3TQT A;  4EGJ A;  2ABJ A;  3UZO A;  2CFM A;  1WR2 A;  3RUP A;  2HGW A;  5LP6 F;  5CM0 A;  1TA8 A;  3NBZ B;  4MA0 A;  2YYA A;  4IWY A;  4GLW A;  5K2M A;  1OBD A;  2Q2U A;  5I5X A;  5CR5 A;  3KYH C;  2CZG A;  3T9E A;  5IYZ F;  5BWV A;  1IYE A;  2A1H A;  4XZ3 B;  3JRW A;  5BWU A;  2Q2T A;  1EKF A;  1I7N A;  2HGS A;  2ZDQ A;  4MV4 A;  5DIS C;  4TVI A;  2YRW A;  2ZDH A;  5FNV F;  3U9T A;  5JVL A;  4EEQ A;  4NZO A;  3DF7 A;  2NUA B;  4CMF A;  3V4Z A;  2DAA A;  1KT8 A;  3V4S A;  4CKE A;  2FP4 B;  4DQN A;  5JQW A;  5LOV F;  1KUT A;  5I5S A;  4IHJ F;  1ULZ A;  4PZ6 A;  3R5X A;  3N6R A;  4FE2 A;  2HHF B;  3T9D A;  2W6M A;  3K5I A;  4MV1 A;  2COJ A;  1BXR A;  1DV1 A;  4EFB A;  3TIN A;  4MV6 A;  1V9P A;  4MV7 A;  1X9N A;  1B6S A;  1PK8 A;  1IOV A;  1EYZ A;  3RV4 A;  2ZDG A;  1T36 A;  4CC6 A;  4O4I F;  3R23 A;  5BPH A;  2HHF A;  4DIM A;  4IIJ F;  4CE5 A;  3T9B A;  2PBZ A;  3U54 A;  2W6O A;  4FFP A;  4O7W A;  4O84 A;  4O7R A;  1ZAU A;  2VQD A;  3JSL A;  4O86 A;  5C8Y F;  4DRF A;  2NU7 B;  4TV8 F;  4GLX A;  5CAE B;  4MA5 A;  3LP8 A;  5BMV F;  1EKP A;  4HNV A;  1CKN A;  3LWB A;  5DMX A;  4O4L F;  2YZG A;  1Z2N X;  3T9C A;  1EKV A;  1EUC B;  3TW6 A;  5E25 A;  2HGX A;  4O7L A;  5D8D A;  2EIY A;  2FPP B;  5D1P A;  4CC5 A;  4O82 A;  4L1K A;  3NUA A;  5KS8 A;  4UUG A;  1JKJ B;  4M0J A;  1TAE A;  2W71 A;  2I87 A;  2YW2 A;  5LYJ F;  4UCO A;  3WWH A;  4I55 F;  3KRE A;  1A9X A;  5LXT F;  4DLK A;  5I47 A;  2R87 A;  1ET0 A;  5I60 A;  5HV6 A;  1JDE A;  1C30 A;  3BAA A;  3I12 A;  4CKB A;  2FPG B;  3JZ6 A;  2V5A A;  2R86 A;  2ZGI A;  3N8D A;  1M0W A;  3K5H A;  3PN1 A;  3VOT A;  1OBG A;  2DZD A;  4EGQ A;  1CQI B;  3R5H A;  3NC0 B;  1M0T A;  3U55 A;  1VS0 A;  4C5A A;  2Q7D A;  1VBG A;  5CA1 F;  2DAB A;  5J2U F;  3ORQ A;  4TUY F;  2EJ0 A;  1UC8 A;  4O81 A;  1KEE A;  2YZN A;  4PZ8 A;  4O7V A;  1AUV A;  2QK4 A;  2I80 A;  2VUG A;  2YWV A;  3KAL A;  4UCT A; 
#chains in the Genus database with same CATH homology
 5HNE A;  5BWR A;  5I5W A;  4CHI A;  4WHX A;  1UC9 A;  5BWT A;  2QB5 A;  3SGI A;  5BWX A;  2HG8 A;  3WWJ A;  3T7A A;  5BYA A;  3T9F A;  3TW7 A;  3WWI A;  1I1M A;  2HHF A;  2HDK A;  1I2K A;  1G2W A;  3DTG A;  3LUL A;  1I2L A;  4CE5 A;  3T9B A;  5BYB A;  3T9A A;  2X5R A;  1IYD A;  4K6N A;  1ZAU A;  3VPD A;  4RCN A;  3CSW A;  4Q4C A;  3T54 A;  1WRV A;  4TM5 A;  3TEK A;  5DGH A;  1EKP A;  4NZM A;  5BWW A;  5CE8 A;  3T9C A;  1DAA A;  1EKV A;  3HT5 A;  4NZN A;  5E25 A;  2HGX A;  1I1L A;  2COG A;  4DAA A;  2EIY A;  1KTA A;  2ABJ A;  3UZO A;  3CEB A;  3SNO A;  2ODT X;  4HN2 A;  5KS8 A;  2HGW A;  3UYY A;  4UUG A;  5I5U A;  5CM0 A;  4M0J A;  3UZB A;  3WWH A;  4IWY A;  4GLW A;  5K2M A;  5I5X A;  5I47 A;  1ET0 A;  5I60 A;  5CR5 A;  3DTF A;  4CMD A;  5DAA A;  4CKB A;  3T9E A;  3U0G A;  5BWV A;  1I1K A;  3JZ6 A;  1IYE A;  2A1H A;  2ZGI A;  3LQS A;  5I5V A;  1A3G A;  5BWU A;  1EKF A;  4Q4D A;  4TVI A;  4IWX A;  4NZO A;  4CMF A;  2DAA A;  1KT8 A;  5K3W A;  2Q7D A;  4CKE A;  5I5T A;  2DAB A;  2EJ2 A;  4DQN A;  5FR9 A;  2COI A;  5I5S A;  2Y4R A;  4CKC A;  2EJ0 A;  4JXU A;  1UC8 A;  3QQM A;  1A0G A;  3BAC A;  5DGI A;  2HHF B;  3T9D A;  3T99 A;  3PFF A;  2COJ A;  4PBC A;  5I5Y A;  3DAA A;  2EJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...