3QQMA

Crystal structure of a putative amino-acid aminotransferase (np_104211.1) from mesorhizobium loti at 2.30 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
214
Chain Sequence
PLRDGDTADFELIETMRWQPGTSFLRFDRHLARLYGSAAELGFACDPQRIAEVLSDALDGARTAMRTRLALARNGDATASAQPYEPLAADKVWILRLARTRLDSQNTLLRHTSRRQLYTHARSEYLVTQADEVLLANERGEICEGTITNVFADFGDGVLATPRLDCGLLPGVLRAELLDEGRAEEAIYSYDDLKSAKALFVGNSLRGLIPAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative amino-acid aminotransferase (NP_104211.1) from Mesorhizobium loti at 2.30 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Transferase
molecule keywords Mlr3007 protein
total genus 67
structure length 214
sequence length 215
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01063 Aminotran_4 Amino-transferase class IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.10.10 Alpha Beta Alpha-Beta Barrel D-amino Acid Aminotransferase; Chain A, domain 2 D-amino Acid Aminotransferase, subunit A, domain 2 3qqmA02
3.30.470.10 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3qqmA01
5I5SA 3CEBA 5CR5A 1I2LA 3HT5A 4TM5A 4PBCA 1I1MA 2HDKA 5CM0A 2Y4RA 3WWJA 3DTFA 1IYDA 3UZBA 2HGWA 1EKPA 5I5YA 3QQMA 1A3GA 1G2WA 3U0GA 1DAAA 2A1HA 2COIA 1WRVA 3SNOA 2HHFB 1EKFA 2ZGIA 2HG8A 3UYYA 4JXUA 4TVIA 5I5TA 4CMFA 5FR9A 5K3WA 2HGXA 4DQNA 5E25A 5I5WA 5I5VA 2ABJA 2COGA 5BWRA 1EKVA 5I60A 2EJ0A 3DTGA 2HHFA 5DAAA 1I2KA 4CMDA 3JZ6A 5BWWA 5I5UA 2DABA 4K6NA 4M0JA 5BWVA 5HNEA 2EJ3A 3CSWA 4CE5A 2DAAA 4UUGA 3WWIA 5BWXA 5I5XA 4CHIA 3DAAA 1I1KA 3UZOA 1IYEA 5BWTA 4DAAA 2EJ2A 3LULA 5CE8A 3LQSA 4WHXA 1KT8A 1ET0A 2EIYA 1A0GA 1I1LA 5BWUA 2COJA 1KTAA 3WWHA
chains in the Genus database with same CATH superfamily
3BACA 3PFFA 2FP4B 3TY5A 4FFMA 3R9RA 2W71A 1I2LA 4TM5A 5JVDF 1A0IA 4HQ6A 1I1MA 2HDKA 1DGSA 4O81A 5CM0A 2Y4RA 4O4LF 2VPQA 4NZOA 4YAKB 3UZBA 5GONF 1M0WA 2J9GA 1OBGA 4FFPA 4MV9A 1P8LA 3JRWA 2GLTA 3ORRA 2Z04A 1JDBB 2XD4A 2YRWA 1KJ9A 4O7SA 4O4JF 1KJIA 4MA0A 1M0TA 4CKCA 4ZHQF 1IOVA 3W1GA 1CQJB 4O7YA 4PZ7A 2FPIB 3WO0A 1DAAA 2V59A 4UCSA 4CC5A 2A1HA 2GQRA 5K2MA 4CKEA 2YRXA 2ZDGA 3E5NA 5BYBA 2VQDA 3KALA 1CKMA 4HR7A 3TY9A 4Y8VB 5FR9A 5KKNB 5K3WA 2HGXA 4NZMA 3KREA 4UCRA 1VS0A 2COGA 3Q2OA 4EGJA 2W6QA 3G8DA 4I50F 4MV4A 1EKVA 5I60A 5C1PA 1C30A 1GSHA 1I2KA 4O7WA 1KJQA 5BWWA 2Q2TA 3UQ8A 3I12A 2ZDHA 3TINA 3GDEA 5FNVF 2DAAA 2QB5A 5CA0F 4DRFA 1CKNB 4UUGA 3ETHA 3MJFA 3K5HA 3WWIA 5BWXA 5C1OA 3HO8A 2R85A 2XCLA 3VPCA 4YB8B 1BXRA 4DAAA 2W6MA 3TW7A 2GPWA 4O7ZA 2C00A 3JSLA 3LQSA 4TV8F 3R5HA 5BPHA 3GJXB 1ET0A 3R5XA 4UCOA 2COJA 1KTAA 2CNUA 4UCVA 4O7RA 3TQTA 3JSNA 3HT5A 4E4TA 4TV9F 5LYJF 1KUTA 4RCNA 4EFBA 4WBNF 2PN1A 3DTFA 4IWYA 2NUAB 2WYOA 4MV8A 2HVSA 4YJ3F 3T9CA 4O7NA 1P16A 1EUDB 4GLWA 4L1KA 3L2PA 2NU9B 2FB9A 4IZOA 3JZFA 3JRXA 1Z2OX 3TEKA 1S68A 1G2WA 5LXTF 1GGOA 2W6OA 1EKFA 1EUCB 2HG8A 2R7KA 4TVIA 2DLNA 2YZMA 1V9PA 2YZNA 5E25A 2NU6B 2QF7A 4I55F 2P0AA 5I5VA 2ABJA 2CNVA 1JKJB 4XYLB 5BWRA 2W6ZA 5D1OA 3T9FA 1KEEA 5CAEB 2R7LA 4O2AF 3RTXA 2ODTX 3NBYB 4PZ6A 5DAAA 3WNZA 2DWCA 3TIGA 4UCTA 2Z02A 3JZ6A 3N8DA 2DIKA 1W96A 5I5UA 3BG5A 4M0JA 3HB9A 4MV1A 3CSWA 3KYHC 4EGQA 4CE5A 1C3OA 1GSAA 3U54A 5I47A 1EZ1A 2CFMA 4EG0A 2OWOA 3AW8A 5DMXA 4IHJF 3U9SA 1JDEA 5BPFA 2YWVA 1I1KA 4CC6A 1IYEA 1CKOA 4FFRA 5C8YF 2HVRA 3DF7A 4TUYF 3T54A 5FPRA 4NZNA 5J2TF 2OLSA 2EIYA 1A0GA 5DGIA 5BWUA 2HJWA 3WWHA 4YBZB 4O84A 5I5SA 3S24A 3CEBA 1KBLA 1OBDA 3RR5A 3T9BA 2NU7B 2HIVA 4C5AA 3ETJA 5LOVF 3TW6A 4O82A 2GPSA 1IYDA 1UC9A 3V4ZA 3KAJA 5DISC 3K5IA 2DZDA 2VR1A 4FFNA 1X9NA 5H80A 1E4EB 3T9AA 2R7MA 3NC0B 1SCUB 5JVLA 1VBGA 1EKPA 1CKNA 1B6RA 5BYAA 3TIIA 3RV4A 2V58A 4O7TA 3QQMA 1TAEA 1A3GA 1CS0A 4MV7A 5D8DA 3TY8A 5D1PA 2QK4A 3BA8A 2FPPB 3T9EA 4FFOA 3W5OA 5JQGF 2IP4A 4RZQA 1IOWA 1KJJA 4DLKA 3RUPA 1WRVA 1ZAUA 2VUGA 2ZGIA 4UFZA 4JXUA 1B6SA 5I5TA 4CMFA 3V4SA 1T36A 1AUVA 3WO1A 4HNUA 5I5WA 2I8CA 4EQ5A 5BMVF 2YZGA 3LP8A 4YJ2F 4C5CA 3DTGA 4MA5A 2SCUB 5IYZF 4NYEA 4XYMB 1BNCA 4XZ3B 3ORQA 1PK8A 4XX0B 4HN2A 4I4TF 3VPDA 5HNEA 4ZI7F 3W1BA 4YAJB 4O4IF 3SGIA 1A48A 1W93A 4MAMA 5LA6F 5HBRB 3BAAA 4UCUA 4M9UA 1UC8A 1EYZA 3BA9A 5EZYF 4Q4CA 3NUAA 3DAAA 2X5RA 3UZOA 4LH7A 2R7NA 2YS7A 2V5AA 2R82A 4O86A 2EJ2A 3VNNA 1KJ8A 3R23A 2W6NA 4WHXA 2X0SA 2R87A 1DV1A 4HNVA 1KT8A 1E4EA 5JQWA 4GLXA 3GB8B 5JH7F 3QWUA 3VPBA 5CR5A 1XDNA 2YW2A 3T9DA 4PBCA 2W70A 3OUZA 4QSHA 3MWDA 3OUUA 2PBZA 3WWJA 3K3PA 3QFFA 5LP6F 2R86A 2NU8B 1M6VA 2HGWA 1Z2NX 4O2BF 4O7LA 4EEQA 3T7AA 2PVPA 3U9TA 5I5YA 4O83A 3AX6A 2GQSA 4ZQIA 1ULZA 3VOTA 5KS8A 5J2UF 4MV3A 2I80A 3U0GA 2COIA 2I87A 5CA1F 5D1OB 3T99A 3SNOA 2HHFB 2R84A 4LH6A 3UYYA 3UFXB 2YS6A 3NBZB 3SE7A 4FFLA 4DQNA 1XK5A 5DGHA 4E6NA 4DIMA 1I7NA 4O7VA 3RFCA 2YYAA 4O4HF 3VA7A 2FPGB 3JZIA 1GSOA 2HVQA 4ZOLF 4EFEA 4HNTA 2EJ0A 4ME6A 3PN1A 2Q2UA 2HHFA 1B04A 3RV3A 1EHIA 4CMDA 1DV2A 5FPOA 1WR2A 1A9XA 1VBHA 2HIXA 2DABA 4K6NA 4MV6A 4FU0A 3N6RA 5BWVA 3KAKA 1DIKA 4C5BA 2EJ3A 3GIDA 5KX5F 2CZGA 3HBLA 2YL2A 5CB4F 3MWEA 1I7LA 1GLVA 1Z2PX 5I5XA 4CHIA 4CKBA 4Q4DA 1PX2A 1CE8A 2CNQA 4FGRA 2YZLA 4FE2A 4IIJF 5BWTA 4PZ8A 1CQIB 1AUXA 2HGSA 3GLKA 1KC7A 1FVIA 3LULA 2W6PA 5CE8A 3BABA 3R5FA 3Q1KA 1TA8A 3U55A 1JLLB 3VMMA 1VKZA 4IWXA 2ZDQA 1I1LA 3LWBA 2Q7DA 3G8CA 5HV6A
chains in the Genus database with same CATH topology
5I5SA 3BACA 3PFFA 3CEBA 5CR5A 3T9BA 1I2LA 3HT5A 4TM5A 3T9DA 4PBCA 1I1MA 2HDKA 4RCNA 5CM0A 2Y4RA 3WWJA 3DTFA 4NZOA 4IWYA 1IYDA 3UZBA 1UC9A 3T9CA 2HGWA 3T9AA 1EKPA 3T7AA 5BYAA 4GLWA 4CKCA 5I5YA 3QQMA 1A3GA 3TEKA 5KS8A 1G2WA 3U0GA 1DAAA 2A1HA 3T9EA 5K2MA 4CKEA 2COIA 3T99A 1WRVA 3SNOA 2HHFB 1ZAUA 1EKFA 2ZGIA 2HG8A 3UYYA 4JXUA 4TVIA 5I5TA 5BYBA 4CMFA 5FR9A 5K3WA 2HGXA 4DQNA 4NZMA 5E25A 5DGHA 5I5WA 5I5VA 2ABJA 2COGA 5BWRA 3T9FA 1EKVA 5I60A 2EJ0A 3DTGA 2HHFA 2ODTX 5DAAA 1I2KA 4CMDA 3JZ6A 5BWWA 5I5UA 4HN2A 2DABA 4K6NA 4M0JA 5BWVA 3VPDA 5HNEA 2EJ3A 3CSWA 4CE5A 2DAAA 3SGIA 2QB5A 4UUGA 3WWIA 5I47A 5BWXA 1UC8A 5I5XA 4CHIA 4CKBA 4Q4DA 4Q4CA 3DAAA 2X5RA 1I1KA 3UZOA 1IYEA 5BWTA 4DAAA 2EJ2A 3LULA 3TW7A 5CE8A 3LQSA 3T54A 4WHXA 4NZNA 1KT8A 1ET0A 2EIYA 4IWXA 1A0GA 1I1LA 5DGIA 2Q7DA 5BWUA 2COJA 1KTAA 3WWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5S A;  3CEB A;  5CR5 A;  1I2L A;  3HT5 A;  4TM5 A;  4PBC A;  1I1M A;  2HDK A;  5CM0 A;  2Y4R A;  3WWJ A;  3DTF A;  1IYD A;  3UZB A;  2HGW A;  1EKP A;  5I5Y A;  3QQM A;  1A3G A;  1G2W A;  3U0G A;  1DAA A;  2A1H A;  2COI A;  1WRV A;  3SNO A;  2HHF B;  1EKF A;  2ZGI A;  2HG8 A;  3UYY A;  4JXU A;  4TVI A;  5I5T A;  4CMF A;  5FR9 A;  5K3W A;  2HGX A;  4DQN A;  5E25 A;  5I5W A;  5I5V A;  2ABJ A;  2COG A;  5BWR A;  1EKV A;  5I60 A;  2EJ0 A;  3DTG A;  2HHF A;  5DAA A;  1I2K A;  4CMD A;  3JZ6 A;  5BWW A;  5I5U A;  2DAB A;  4K6N A;  4M0J A;  5BWV A;  5HNE A;  2EJ3 A;  3CSW A;  4CE5 A;  2DAA A;  4UUG A;  3WWI A;  5BWX A;  5I5X A;  4CHI A;  3DAA A;  1I1K A;  3UZO A;  1IYE A;  5BWT A;  4DAA A;  2EJ2 A;  3LUL A;  5CE8 A;  3LQS A;  4WHX A;  1KT8 A;  1ET0 A;  2EIY A;  1A0G A;  1I1L A;  5BWU A;  2COJ A;  1KTA A;  3WWH A; 
#chains in the Genus database with same CATH topology
 3BAC A;  3PFF A;  2FP4 B;  3TY5 A;  4FFM A;  3R9R A;  2W71 A;  1I2L A;  4TM5 A;  5JVD F;  1A0I A;  4HQ6 A;  1I1M A;  2HDK A;  1DGS A;  4O81 A;  5CM0 A;  2Y4R A;  4O4L F;  2VPQ A;  4NZO A;  4YAK B;  3UZB A;  5GON F;  1M0W A;  2J9G A;  1OBG A;  4FFP A;  4MV9 A;  1P8L A;  3JRW A;  2GLT A;  3ORR A;  2Z04 A;  1JDB B;  2XD4 A;  2YRW A;  1KJ9 A;  4O7S A;  4O4J F;  1KJI A;  4MA0 A;  1M0T A;  4CKC A;  4ZHQ F;  1IOV A;  3W1G A;  1CQJ B;  4O7Y A;  4PZ7 A;  2FPI B;  3WO0 A;  1DAA A;  2V59 A;  4UCS A;  4CC5 A;  2A1H A;  2GQR A;  5K2M A;  4CKE A;  2YRX A;  2ZDG A;  3E5N A;  5BYB A;  2VQD A;  3KAL A;  1CKM A;  4HR7 A;  3TY9 A;  4Y8V B;  5FR9 A;  5KKN B;  5K3W A;  2HGX A;  4NZM A;  3KRE A;  4UCR A;  1VS0 A;  2COG A;  3Q2O A;  4EGJ A;  2W6Q A;  3G8D A;  4I50 F;  4MV4 A;  1EKV A;  5I60 A;  5C1P A;  1C30 A;  1GSH A;  1I2K A;  4O7W A;  1KJQ A;  5BWW A;  2Q2T A;  3UQ8 A;  3I12 A;  2ZDH A;  3TIN A;  3GDE A;  5FNV F;  2DAA A;  2QB5 A;  5CA0 F;  4DRF A;  1CKN B;  4UUG A;  3ETH A;  3MJF A;  3K5H A;  3WWI A;  5BWX A;  5C1O A;  3HO8 A;  2R85 A;  2XCL A;  3VPC A;  4YB8 B;  1BXR A;  4DAA A;  2W6M A;  3TW7 A;  2GPW A;  4O7Z A;  2C00 A;  3JSL A;  3LQS A;  4TV8 F;  3R5H A;  5BPH A;  3GJX B;  1ET0 A;  3R5X A;  4UCO A;  2COJ A;  1KTA A;  2CNU A;  4UCV A;  4O7R A;  3TQT A;  3JSN A;  3HT5 A;  4E4T A;  4TV9 F;  5LYJ F;  1KUT A;  4RCN A;  4EFB A;  4WBN F;  2PN1 A;  3DTF A;  4IWY A;  2NUA B;  2WYO A;  4MV8 A;  2HVS A;  4YJ3 F;  3T9C A;  4O7N A;  1P16 A;  1EUD B;  4GLW A;  4L1K A;  3L2P A;  2NU9 B;  2FB9 A;  4IZO A;  3JZF A;  3JRX A;  1Z2O X;  3TEK A;  1S68 A;  1G2W A;  5LXT F;  1GGO A;  2W6O A;  1EKF A;  1EUC B;  2HG8 A;  2R7K A;  4TVI A;  2DLN A;  2YZM A;  1V9P A;  2YZN A;  5E25 A;  2NU6 B;  2QF7 A;  4I55 F;  2P0A A;  5I5V A;  2ABJ A;  2CNV A;  1JKJ B;  4XYL B;  5BWR A;  2W6Z A;  5D1O A;  3T9F A;  1KEE A;  5CAE B;  2R7L A;  4O2A F;  3RTX A;  2ODT X;  3NBY B;  4PZ6 A;  5DAA A;  3WNZ A;  2DWC A;  3TIG A;  4UCT A;  2Z02 A;  3JZ6 A;  3N8D A;  2DIK A;  1W96 A;  5I5U A;  3BG5 A;  4M0J A;  3HB9 A;  4MV1 A;  3CSW A;  3KYH C;  4EGQ A;  4CE5 A;  1C3O A;  1GSA A;  3U54 A;  5I47 A;  1EZ1 A;  2CFM A;  4EG0 A;  2OWO A;  3AW8 A;  5DMX A;  4IHJ F;  3U9S A;  1JDE A;  5BPF A;  2YWV A;  1I1K A;  4CC6 A;  1IYE A;  1CKO A;  4FFR A;  5C8Y F;  2HVR A;  3DF7 A;  4TUY F;  3T54 A;  5FPR A;  4NZN A;  5J2T F;  2OLS A;  2EIY A;  1A0G A;  5DGI A;  5BWU A;  2HJW A;  3WWH A;  4YBZ B;  4O84 A;  5I5S A;  3S24 A;  3CEB A;  1KBL A;  1OBD A;  3RR5 A;  3T9B A;  2NU7 B;  2HIV A;  4C5A A;  3ETJ A;  5LOV F;  3TW6 A;  4O82 A;  2GPS A;  1IYD A;  1UC9 A;  3V4Z A;  3KAJ A;  5DIS C;  3K5I A;  2DZD A;  2VR1 A;  4FFN A;  1X9N A;  5H80 A;  1E4E B;  3T9A A;  2R7M A;  3NC0 B;  1SCU B;  5JVL A;  1VBG A;  1EKP A;  1CKN A;  1B6R A;  5BYA A;  3TII A;  3RV4 A;  2V58 A;  4O7T A;  3QQM A;  1TAE A;  1A3G A;  1CS0 A;  4MV7 A;  5D8D A;  3TY8 A;  5D1P A;  2QK4 A;  3BA8 A;  2FPP B;  3T9E A;  4FFO A;  3W5O A;  5JQG F;  2IP4 A;  4RZQ A;  1IOW A;  1KJJ A;  4DLK A;  3RUP A;  1WRV A;  1ZAU A;  2VUG A;  2ZGI A;  4UFZ A;  4JXU A;  1B6S A;  5I5T A;  4CMF A;  3V4S A;  1T36 A;  1AUV A;  3WO1 A;  4HNU A;  5I5W A;  2I8C A;  4EQ5 A;  5BMV F;  2YZG A;  3LP8 A;  4YJ2 F;  4C5C A;  3DTG A;  4MA5 A;  2SCU B;  5IYZ F;  4NYE A;  4XYM B;  1BNC A;  4XZ3 B;  3ORQ A;  1PK8 A;  4XX0 B;  4HN2 A;  4I4T F;  3VPD A;  5HNE A;  4ZI7 F;  3W1B A;  4YAJ B;  4O4I F;  3SGI A;  1A48 A;  1W93 A;  4MAM A;  5LA6 F;  5HBR B;  3BAA A;  4UCU A;  4M9U A;  1UC8 A;  1EYZ A;  3BA9 A;  5EZY F;  4Q4C A;  3NUA A;  3DAA A;  2X5R A;  3UZO A;  4LH7 A;  2R7N A;  2YS7 A;  2V5A A;  2R82 A;  4O86 A;  2EJ2 A;  3VNN A;  1KJ8 A;  3R23 A;  2W6N A;  4WHX A;  2X0S A;  2R87 A;  1DV1 A;  4HNV A;  1KT8 A;  1E4E A;  5JQW A;  4GLX A;  3GB8 B;  5JH7 F;  3QWU A;  3VPB A;  5CR5 A;  1XDN A;  2YW2 A;  3T9D A;  4PBC A;  2W70 A;  3OUZ A;  4QSH A;  3MWD A;  3OUU A;  2PBZ A;  3WWJ A;  3K3P A;  3QFF A;  5LP6 F;  2R86 A;  2NU8 B;  1M6V A;  2HGW A;  1Z2N X;  4O2B F;  4O7L A;  4EEQ A;  3T7A A;  2PVP A;  3U9T A;  5I5Y A;  4O83 A;  3AX6 A;  2GQS A;  4ZQI A;  1ULZ A;  3VOT A;  5KS8 A;  5J2U F;  4MV3 A;  2I80 A;  3U0G A;  2COI A;  2I87 A;  5CA1 F;  5D1O B;  3T99 A;  3SNO A;  2HHF B;  2R84 A;  4LH6 A;  3UYY A;  3UFX B;  2YS6 A;  3NBZ B;  3SE7 A;  4FFL A;  4DQN A;  1XK5 A;  5DGH A;  4E6N A;  4DIM A;  1I7N A;  4O7V A;  3RFC A;  2YYA A;  4O4H F;  3VA7 A;  2FPG B;  3JZI A;  1GSO A;  2HVQ A;  4ZOL F;  4EFE A;  4HNT A;  2EJ0 A;  4ME6 A;  3PN1 A;  2Q2U A;  2HHF A;  1B04 A;  3RV3 A;  1EHI A;  4CMD A;  1DV2 A;  5FPO A;  1WR2 A;  1A9X A;  1VBH A;  2HIX A;  2DAB A;  4K6N A;  4MV6 A;  4FU0 A;  3N6R A;  5BWV A;  3KAK A;  1DIK A;  4C5B A;  2EJ3 A;  3GID A;  5KX5 F;  2CZG A;  3HBL A;  2YL2 A;  5CB4 F;  3MWE A;  1I7L A;  1GLV A;  1Z2P X;  5I5X A;  4CHI A;  4CKB A;  4Q4D A;  1PX2 A;  1CE8 A;  2CNQ A;  4FGR A;  2YZL A;  4FE2 A;  4IIJ F;  5BWT A;  4PZ8 A;  1CQI B;  1AUX A;  2HGS A;  3GLK A;  1KC7 A;  1FVI A;  3LUL A;  2W6P A;  5CE8 A;  3BAB A;  3R5F A;  3Q1K A;  1TA8 A;  3U55 A;  1JLL B;  3VMM A;  1VKZ A;  4IWX A;  2ZDQ A;  1I1L A;  3LWB A;  2Q7D A;  3G8C A;  5HV6 A; 
#chains in the Genus database with same CATH homology
 5I5S A;  3BAC A;  3PFF A;  3CEB A;  5CR5 A;  3T9B A;  1I2L A;  3HT5 A;  4TM5 A;  3T9D A;  4PBC A;  1I1M A;  2HDK A;  4RCN A;  5CM0 A;  2Y4R A;  3WWJ A;  3DTF A;  4NZO A;  4IWY A;  1IYD A;  3UZB A;  1UC9 A;  3T9C A;  2HGW A;  3T9A A;  1EKP A;  3T7A A;  5BYA A;  4GLW A;  4CKC A;  5I5Y A;  3QQM A;  1A3G A;  3TEK A;  5KS8 A;  1G2W A;  3U0G A;  1DAA A;  2A1H A;  3T9E A;  5K2M A;  4CKE A;  2COI A;  3T99 A;  1WRV A;  3SNO A;  2HHF B;  1ZAU A;  1EKF A;  2ZGI A;  2HG8 A;  3UYY A;  4JXU A;  4TVI A;  5I5T A;  5BYB A;  4CMF A;  5FR9 A;  5K3W A;  2HGX A;  4DQN A;  4NZM A;  5E25 A;  5DGH A;  5I5W A;  5I5V A;  2ABJ A;  2COG A;  5BWR A;  3T9F A;  1EKV A;  5I60 A;  2EJ0 A;  3DTG A;  2HHF A;  2ODT X;  5DAA A;  1I2K A;  4CMD A;  3JZ6 A;  5BWW A;  5I5U A;  4HN2 A;  2DAB A;  4K6N A;  4M0J A;  5BWV A;  3VPD A;  5HNE A;  2EJ3 A;  3CSW A;  4CE5 A;  2DAA A;  3SGI A;  2QB5 A;  4UUG A;  3WWI A;  5I47 A;  5BWX A;  1UC8 A;  5I5X A;  4CHI A;  4CKB A;  4Q4D A;  4Q4C A;  3DAA A;  2X5R A;  1I1K A;  3UZO A;  1IYE A;  5BWT A;  4DAA A;  2EJ2 A;  3LUL A;  3TW7 A;  5CE8 A;  3LQS A;  3T54 A;  4WHX A;  4NZN A;  1KT8 A;  1ET0 A;  2EIY A;  4IWX A;  1A0G A;  1I1L A;  5DGI A;  2Q7D A;  5BWU A;  2COJ A;  1KTA A;  3WWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...