1B6RA

N5-carboxyaminoimidazole ribonucleotide synthetase from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
355
structure length
349
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of N5-carboxyaminoimidazole ribonucleotide synthetase: a member of the ATP grasp protein superfamily.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
total genus 106
structure length 349
sequence length 355
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 1999-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1b6rA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1b6rA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b6rA01
2GPSA 1M6VA 4FFNA 5LYJF 4TV9F 4XYLB 4O7VA 4Y8VB 5BPHA 3R5HA 4C5AA 2Z02A 3KAKA 3SE7A 4L1KA 1KBLA 3R5XA 2CNVA 4IZOA 2DZDA 4O4JF 3TQTA 5C1OA 3WO1A 1OBGA 3AX6A 1EUDB 2YWVA 4O4HF 5EZYF 3Q1KA 5BMVF 4O4LF 4FFMA 2VQDA 2NU9B 3U9TA 1Z2PX 4IIJF 4EA9A 1CQJB 4YJ2F 4C5CA 5BPFA 2YS6A 4O83A 2ZDHA 2YRWA 1EYZA 2OLSA 5LP6F 2I87A 4DIMA 4O7RA 2YZMA 1DV1A 1VBHA 4O2AF 1JDBB 4XZ3B 4C5BA 3OUZA 2W6OA 4IHJF 3R5FA 1I7NA 1T36A 4MV6A 2WYOA 5CB4F 1UC8A 2GQSA 3VPCA 1JLLB 4O82A 4O7LA 4O2BF 3V4SA 4EABA 3I12A 1A48A 4EA7A 2HJWA 2FPGB 3NUAA 3KAJA 1GSAA 4O84A 3ETHA 2QF7A 2R7MA 1BXRA 4M98A 3BG5A 3JZFA 4TV8F 4HNUA 4EGQA 4O86A 2NU8B 1JKJB 4MV9A 2DLNA 5C8YF 4M9UA 5I47A 2PN1A 1PX2A 1SCUB 2R82A 3TIIA 4EA8A 1E4EB 2W6PA 3V4ZA 3TIGA 5LXTF 2YW2A 1VBGA 1B6SA 5FNVF 4O7TA 3K3PA 5JH7F 1KJ9A 2YL2A 4O81A 4ZQIA 3RV3A 3KALA 3K5HA 4FE2A 4XX0B 2PBZA 2XD4A 1CE8A 4E4TA 5K2MA 4ME6A 5CA0F 5HV6A 3ETJA 2J9GA 5HBRB 1IOWA 1KJ8A 1KC7A 4XYMB 2VHEA 2R7LA 2YS7A 1EUCB 1WR2A 2R84A 4I4TF 1CS0A 4ZHQF 1Z2NX 2FPPB 4NYEA 3VMMA 1E4EA 3HO8A 2CQYA 3HB9A 1B6RA 4FFRA 5KKNB 3RFCA 2R86A 5LA6F 1KJJA 1GLVA 3BFPA 4EGJA 3G8CA 3RV4A 1AUXA 3BSSA 2ZDQA 1IOVA 2R7KA 4WBNF 3U9SA 2YRXA 5JQWA 3VPDA 2X0SA 3GIDA 1W96A 4TUYF 3Q2OA 2VR1A 2I8CA 4O4IF 4FGRA 4YAJB 2CZGA 2NU7B 3UFXB 4DLKA 2ZDGA 4WD3A 3E5NA 4M9CA 4RZQA 2NUAB 4HQ6A 4EG0A 5JQGF 2W6MA 4YBZB 2R6FA 3VA7A 2PVPA 4O7NA 4FFLA 1M0TA 3WNZA 4MV7A 3LWBA 4O7ZA 2Z04A 2VPQA 2DWCA 4HNVA 1PK8A 3JRXA 4I50F 5CA1F 1C30A 1DV2A 2QK4A 4M99A 3G8DA 1M0WA 2W6ZA 2HGSA 4MV4A 4IWXA 1BNCA 1KJIA 2YYAA 4O7SA 4YAKB 3QFFA 5JVLA 1AUVA 3ORQA 1EHIA 2V5AA 4HR7A 5H80A 4YJ3F 5JVDF 1VKZA 4IWYA 2W6NA 3VPBA 4FFOA 3R9RA 3LP8A 3KREA 3U54A 5C1PA 2GLTA 5GONF 3R23A 1JDEA 4MA0A 3OUUA 1KUTA 4MV3A 1GSHA 2FB9A 3WO0A 1GSOA 5LOVF 2YZNA 3AW8A 1DIKA 4ZOLF 1I7LA 4MA5A 2W71A 4GGMX 3VOTA 3MJFA 2GPWA 4FU0A 2R87A 2GQRA 2FP4B 2CNUA 3MWDA 3K5IA 5D8DA 3N6RA 2NPOA 2CNQA 5DMXA 2R7NA 2P0AA 2YZGA 4FFPA 4QSHA 3ORRA 4ZI7F 3MWEA 1KJQA 1GGOA 2NU6B 2W6QA 2V59A 2V58A 2I80A 5J2UF 3RUPA 4I55F 4J6EA 1EZ1A 5J2TF 4EAAA 1KEEA 4YB8B 1W93A 2R85A 1Z2OX 2W70A 1ULZA 1CQIB 2IP4A 4O7WA 3JZIA 1C3OA 3DF7A 2C00A 1UC9A 2SCUB 5KX5F 3JRWA 3BSWA 3HBLA 3U55A 2YZLA 3N8DA 5CAEB 1A9XA 4MAMA 4O7YA 3BSYA 4HNTA 2DIKA 4MV1A 3TW6A 5IYZF 1OBDA 2FPIB 2XCLA 3TINA 4MV8A 3GLKA
chains in the Genus database with same CATH superfamily
4MVJI 2COJA 1JG7A 1I1OA 3BC1A 4JJ8A 4MZXA 2WWVD 7MHTA 1GAXA 2LTAA 2ODNA 2PCLA 4OXKA 5FR2A 3SR3A 4B34A 1C8LA 1ZLXA 2BLLA 2EATA 4J94A 5IXYA 3IKTA 4GC7A 3EOBI 4EEQA 3A0UA 2VLIA 4KXNA 3DGEC 5HKAA 2X5NA 5BSFA 1KWKA 3TUZC 4L1KA 4YBRA 1HT3A 1T9ZA 4LKRA 2QPAA 3ZU5A 4BO3A 3PK0A 1GTSA 2A78A 1OIWA 1T6XA 3LQ1A 5AUNB 4OQPA 4WK4B 1E20A 1O9GA 3RFTA 3VDRA 4ZGBA 1W35A 4DR2H 1Z34A 5IPFA 2VTBA 4C2MA 2JDIA 4EFKA 1U1FA 4HQKA 4DCTA 1VHDA 4AYBA 4ER0A 4KXYA 4U0KA 1K68A 2VYND 1MTOA 3M4JA 5KINB 2JAHA 4LHYA 4QGAA 3HJTA 4D8WA 1T3ZA 4HBZA 2BAGA 3MMZA 4FFMA 3PHHA 2W57A 4YMVA 3VH3A 4ESHA 2W4IA 3UXEA 4C01A 5KFFA 1M8JA 1DUIA 1WF3A 3TEFA 1FY2A 4LF9B 4NCAA 2O8EA 1A8QA 2O5VA 1R9TA 1H42A 2NTJA 2OFXA 2Y77A 3OEED 4J0MA 3EMBA 3CO0S 3VSEA 4F5WA 2B69A 1ZHQA 3U44B 1N32H 5U1PA 2VHZA 1WCIA 2HA6A 1LV8A 4R1LA 5DCUA 3TQFA 2G3YA 5EA2A 5LQSA 3WZ2A 2H1SA 5C8YB 3O8OA 3F7TA 2OORC 5C7LO 1ORIA 3SIWA 4FWTA 1GCAA 3ZJ5A 1SXPA 2AK2A 4GYWA 4Q0YA 2OMKA 4JI3B 3SWWA 4XTCS 1YTUA 4HGZA 3MINB 3UB4A 1OXKB 7GPBA 3L4EA 2ZR0A 3K8QA 3OUZA 1GZ7A 2HF7A 2OV8A 5DH9A 1O95C 2CMDA 1WY7A 1Z45A 4ZYLA 3THWA 1RWPA 4YAUA 4R0NA 2C1EA 2CMFA 1Q0SA 2WTMA 5K0NA 2PDAA 4H6VA 1YI8A 4HNAA 2ZSHA 4M7EA 4MKZA 5TQ2A 5KQPA 3BWVA 4KHPH 4HDAA 2ATXA 3S3TA 1I7NA 2CSUA 1KEWA 4MICA 1PD1A 2VZLA 1P31A 1Y6JA 2WYOA 3KIPA 3BKWA 3LMLA 4JLJA 5CD1A 5A5VA 3HKZA 1SUSA 2QTCA 2O4CA 1TZCA 3D4BA 1GWNA 4R4JA 4UDYX 1KYIA 1NY5A 2B8EA 3P27A 4HLUA 5JTUA 3AEXA 4JOCA 2ZRBA 1SPXA 4N5NA 1DWUA 1I6LA 1JLLB 5DNAA 1X1RA 5LZ8A 1MAUA 1T6YA 3GT7A 5DHFA 2CXXA 5DSXA 3LBYA 2QTZA 1ZIOA 5IULC 2BTQB 3M4YA 1E98A 3PWKA 4YMIA 2HQ1A 1E2IA 4GEGA 3LNTA 4IKPA 4AP9A 2E1RA 1ZOIA 3D6TB 4J9MA 1AKNA 2E4YA 4M8KA 5KI6A 2OV1A 2Q1UA 2O07A 5CTAA 4BJ1A 2X6QA 5L95A 3DDWA 2ZJYA 3MN1A 4K8OA 5D5PA 1TLFA 5FUWA 5CDSA 1I7SB 4US2R 4X1IA 3TNDA 2HSWA 2VSYA 3QW2A 2PL5A 3L4JA 3FRJA 3LECA 3P9NA 4I46A 2C7RA 2JHAA 4LJSA 1VYVA 1ESMA 1VQ1A 3L41A 4G09A 5BWCA 3EPHA 3PVZA 2IU3A 1HQCA 2DHCA 2YH2A 3DDSA 4PNPA 2JCGA 3RQSA 3V32A 4INZA 4TV8F 2QRLA 3FN4A 3GRYA 1VP3A 3AP2A 1I01A 1XQVA 1Y8QA 3LPDA 3BHJA 2YWEA 4BVJA 2JGRA 3NLLA 2WK1A 3DVAB 3SDBA 1U8EA 1CZUA 4YP9A 4B3HA 1C1DB 4DAEA 1Z29A 4F93B 2GUGA 4EYGA 4D26A 2IYXA 2E6KA 1N9GA 3C6KA 5L7YA 5I9IA 2R82A 4QECA 4ZVLA 4ZTBA 5I9BA 2PS9A 4LA4A 4XOIA 3RYTC 3VXKA 2CF5A 3PHJA 3FJYA 4JKYA 2I7VA 5KYNA 3EOAI 3GEDA 2ASLA 3V6KA 1NDUA 2QGZA 2NMVA 3OPYB 4YAOA 3RASA 1WZUA 3OHBA 1FRQA 1Y48E 1JS1X 3FZNA 3NGXA 1L7QA 4G0MA 3N6XA 4H1TA 4OXQA 3UUFA 2VZ9A 4CJXA 1NMSA 1RYHA 3H5IA 4J0JA 4LZOA 4RETA 1O95A 3GJ3A 4IGAA 1GFWA 4Y2QA 3KD2A 2IYVA 1SBTA 1O8BA 4FWBA 5EPUA 2R1VB 3R6GA 3JATA 2R6HA 3ZN2A 4FBGA 4IX1A 2J5XA 1ZIYA 1QGYA 3ZCXA 3JWEA 3KYDB 2Y1EA 2AHOA 4P4LA 5T67A 1EK0A 2Q8NA 2BI4A 2GS9A 2O7SA 4ME6A 3D6NB 2XMPA 3J7AC 3EF3A 2N46A 4LY0A 2GNPA 2EJ3A 1ZGCA 3K5PA 5JXJA 5KZMB 2JG3A 1QKKA 2BBTA 4TLBA 1KDTA 4M38A 1OVGA 1IOWA 2SKCA 3QE4A 4QGHA 4AO7A 5A5DA 4R5MA 1F7VA 1B0AA 5KTPA 1BVHA 3FMGA 3OZRA 3GIKA 2R7LA 2C1XA 1P4GA 4MDHA 4GMDA 2J59A 3ITEA 2WF9A 4DKXA 1WR2A 2DJIA 1Z88A 4EATA 4YPOA 3DTVD 4RF3A 4KV9A 3HJBA 5IVPA 1JFLA 1LPAB 5B1SA 1CZOA 3RABA 2FZEA 4O3PA 3DBHA 4NBKA 5CLGA 2VJMA 4REMA 4YQEA 1WV1A 2W9XA 5FO0A 3V7NA 4BFTA 4IIGA 1LK7A 2GMWA 3LK6A 1N1EA 2W42A 3UJAA 4ZP1A 3TIFA 4GH5A 5C46F 2FU5C 2W7PA 3RRJA 4EY6A 2AN3A 1UXOA 3LUDA 3M3HA 1N0WA 1RS0A 2QSZA 3PW4A 3WIEA 4DOMA 5EHGA 5JRDS 2XUFA 1E2LA 1HE5A 2DC1A 1R0KA 1U2GA 1XKQA 3RS9A 1B6RA 1IM2A 3LLVA 2CLMB 4LYGA 5FTNA 1JN0A 2C4WA 2OLJA 1WW2A 3EAGA 2I91A 4IOJA 4GMGA 3VSDA 2VEDA 2B2XA 5TT1A 1CEYA 4QICA 2DYKA 2XCIA 3L8YA 1IQ0A 1XCOA 2HA5A 2ZPTX 2JGAA 5ALNA 5TS2A 4KXFB 2OAGA 5L3QB 2CXPA 5DBOA 4YDQA 3NO4A 3IQFA 4NYJR 3IDOA 4BO1A 9ATCA 1JHYA 5JNWA 2R7KA 1E8MA 1P19A 4KIWA 4BO6A 4K40A 3TLZA 3AM4A 5ALXA 1XWFA 2OORA 3U62A 1GQRA 1TADA 3QLUC 2BKUA 5F1YA 3SMVA 3STUA 1MB4A 1L5QA 5KS2A 4UDXX 3BAAA 3QM1A 4M0KA 4B7AA 4Q7EA 1U7UA 2PQ0A 3LSTA 4OHPA 3W34A 4P5DA 5DX1A 4EHLA 4P80A 4FMBB 3WGVA 1XEWY 2WABA 4EIWA 2ZM5A 4URXR 4P3KA 4A0GA 3RWOA 1EFAA 3VNUA 2VR1A 1X94A 1OYVA 2DH6A 1L8QA 1VKNA 3I9OA 5NLLA 5AKIA 1EXWA 3O90A 4AXXA 5AM2A 1ZAYA 3K6RA 3KL4A 2ATVA 1BHJA 5EKXA 4OXIA 3SY8A 3WYDA 3S8YA 1MQ8B 2VSFA 1FNBA 4B71A 4DARA 2E4ZA 4M86A 3ZZUA 3AUKA 4H7EA 5BSKA 3IIKA 1EHYA 2FRDA 3R5SA 3WDSA 3IQIX 1EVJA 2NTNA 4J4BA 5B2ZA 2QROA 3P1JA 3I5UA 2H54A 3WKCA 3SC2B 4P4UA 3O4JA 3AVQA 2WJVA 2YY7A 3UVEA 2TMDA 5EJAA 1KOJA 4ZQFA 1CUIA 1AD2A 5C1IA 2F3PA 4QVKA 1EVEA 2JAWA 3ROGA 3ONEA 4UTPA 1P8LA 2GDJA 2HA2A 3L1JA 4WJLA 1T24A 2PXXA 1WSCA 3RR2A 2VQEB 3R9KA 3ICEA 2RGRA 2H9AA 2O9JA 4A0RA 4UDOA 1YA6A 4I2NA 1K0FA 4Z8YA 3AGPA 1MXHA 4II7A 1VHTA 3O4RA 1IMOA 5KYTA 1D03A 1LXCA 2VN8A 2ZB2A 2LIVA 4BX2A 4X9XA 3O2NA 3WK6A 1L2ZA 4P92A 1B76A 4M1SA 3VH1A 4M0FA 1XLTA 1BWSA 1KRXA 1X8XA 2BFOA 4PZ6A 3L4KA 2BKXA 1QDLB 2QPOA 2VRCA 4G23A 2YIMA 3R40A 4LJ8A 1Q3KA 3NFRA 3FYTA 2WKWA 3IURA 2FSPA 2ZRMA 3MCVA 4BY7G 3UCFA 4E2ZA 4H1VA 4B6EA 5CBPA 3QPUA 3PXCX 2UZIR 4NBWA 3DKPA 3L5OA 3MCZA 1BS9A 4MW0A 4OL9A 3ZD6A 2GKGA 1QFXA 2QQGA 2WJAA 4FEAA 2FHPA 4N65A 3ZGOA 1M6EX 4IW3B 4CCYB 4MYTA 2ZE8A 4IUYA 1YIDA 1P9OA 3OPYA 4KSYA 4RF5A 4UMDA 4YMWA 4B87A 2ZQZA 2HIMA 3Q9UA 1R4AA 3PDCA 4FGZA 3CX3A 4M49A 4A8TA 4GUDA 3GZNB 4G5RA 2G4CA 3NHJA 4Q1FA 1XRPA 4QFMA 4TWJA 2TMGA 3N0WA 2N42A 1ZVKA 2Q3FA 1G19A 1B6GA 3EY4A 4QJ3A 1L5MA 3HCDA 5AQEA 1WNTA 4CTMA 4HSEA 5DX0A 3OM1A 1AUVA 2HMAA 4C2AA 1JJ7A 1OU4A 1EGQA 1Z17A 2ETXA 4X97A 3L77A 5TC4A 3ZE9A 5H80A 1AUOA 2C2MA 3W7AA 4D0SA 4MYDA 4BNLA 1FVHA 2VDMB 2X5OA 3EF0A 3VZSA 5TNXA 5KT4A 3EODA 1KSFX 2C59A 1K27A 4PG6A 3MSXA 3KKEA 4F21A 3HHEA 5KQGA 4CEJB 2PFKA 4ANFA 3K9FC 3LLUA 1BDMA 3DVLA 1RJFA 1M3SA 1FW8A 2GX6A 1C4KA 2R5NA 4QO8A 3REQA 1J24A 3USES 1ZAUA 3IAS6 3II6X 3PT9A 1FUEA 2NN3C 4Q37A 1U5AA 4ZAWA 3SF8A 1ADGA 1NUSA 5D86A 3SDZA 2I71A 4M0DA 1PRYA 4XUCA 1EP3B 3HCNA 1A9YA 4F11A 1XRNA 4ZAFA 4YCLA 2E2IA 5L51A 3WGLA 2D4AA 4BFYA 4CU2A 5T6BA 2I6UA 4I7HA 4RD2A 3IEVA 4RFSB 4LCEA 1MB3A 1T8RA 2BEWA 2BMVA 3O8DA 4WCDA 1D6JA 3D6VA 4LH7A 1ORHA 3K30A 2BF7A 3A1FA 4L9RA 4UNQA 1BMQA 2QR3A 1JDPA 4G5QA 5F12A 4F5EA 3NPMA 3KR9A 1NR1A 2DXIA 5EN4A 3UYLA 1H9CA 4Y9RA 1YULA 2RGXA 2NSHA 4JV5H 2C20A 3E7DA 2G6TA 3J80W 1HTBA 4NYMQ 4ARSA 2QN8A 1I7LA 3DEJA 3Q5EA 3V1MA 3RAXA 1VE3A 1OTYA 1T5DX 2ETVA 2H6EA 3I45A 1CKEA 4UCUA 3EGDA 4R05A 4U5QA 4GGMX 1LB1B 1IYZA 4HMOA 4WNCA 4WBNB 1VJ0A 2JAUA 1M2FA 4ZO7A 2I8AA 4KE6A 5FR9A 4B17A 2QU8A 4HAWA 5CDFA 5EE5B 1MC5A 1IMJA 2J87A 2VXCA 2HI0A 2Z3VA 3BDIA 3CE9A 3OO1A 1IZ7A 5CBKA 3JQAD 4PXYA 3T5CA 4YT5A 4C0KA 4INPA 3DEHA 4LMAA 2YOFA 1IN1A 3IKJA 4Z2YA 3RVSA 4X44A 1V26A 3ZCSA 8OHMA 2FPKA 5BR7A 4YRCA 1PP4A 3KVOA 3WWEA 2X4DA 2HHLA 1P7ZA 1Z4MA 3I9MA 3MIIA 4RQBA 1IIRA 4TLDA 2YZGA 2XVMA 3FJ1A 2P9BA 1WB6A 3VNSA 1A5AB 1J0XO 1EBUA 1Z13A 2ECFA 5J4VA 1CVIA 1BDIA 2GM4A 4U7GA 1KMIY 4ZI7F 4XSHA 4EX6A 3U13A 3A1WA 3PNSA 1P4HA 2ASVA 3D8SA 3V7UA 5JCXA 1MRSA 3Q7PA 5JI3E 1AZWA 3MTBA 4A8JB 2YN4A 1T91A 1G3MA 3EK2A 3LLSA 5KYKA 4EEXA 2HUPA 5K0FA 1YCGA 4IFTA 1SUPA 3U3KA 3A32A 4GPBA 2FK3A 3AY6A 4KEAA 1OR8A 5AK0A 1TMYA 2WSIA 2V9PA 4JOBA 3SK0A 1IBMB 3M0EA 3HY3A 2IUTA 1D2NA 5D51S 3NHRA 2AOXA 5DXFA 5LQUA 1G7TA 3IERA 4HP8A 3SQNA 4Q45A 1FXWF 2ZYDA 5EMLA 3BDVA 3CNBA 1R8YA 4NCJA 3PC7A 3CN9A 1VCHA 3E7FA 1QOQB 4EKYA 4DT1B 2R92A 2V8OA 3PW0A 3FWHA 3RROA 2HK9A 4YGXB 4C6HA 4D0RA 4EECA 3QY0A 4OQLA 1O6FA 4UTZA 4PZZA 3L18A 1UJ5A 3FNEA 3GYGA 2H2GA 4JR1A 4P58A 2YFHA 4DUGA 2Y0PA 1G21E 4LXXA 5CG2A 5KNDD 4DUZH 4FTWA 4QIWE 1Z5WA 2RGWA 1U0RA 3F5DA 3HJNA 4XQCA 3RGGA 3WWOA 4AS1A 3UMCA 1U8XX 1UBNA 4ITUA 4TT3A 2WB1A 3OSUA 1PV1A 2ACVA 3ILVA 4GKBA 4MVJE 1ODKA 4A82A 2B2CA 1U5BA 3OBBA 2ZBPA 5DTEA 4D1YA 2Y6UA 3NZEA 4RYLA 4FUQA 4CE6A 3QBJA 1G8HA 3H4DA 1ZVVA 4QJ5A 3WX0A 1KTAA 4C7KA 5CAEB 5DG9A 2IL1A 3C3DA 2MSNA 1QV7A 4N3AA 5EP4A 2FFQA 4I4LA 2OSBA 1S8OA 1V9CA 1X7WA 3BTVA 3G1WA 4KO4S 4RGBA 4EHFA 4WDQA 3QKTA 1KQNA 3OURA 1G7SA 5FUVA 5LWHA 4A3MG 4QE3A 4CDRA 4BPRA 1CUGA 3KFLA 3LBIA 2RD2A 4RZSA 1GPKA 2HYIC 2OAEA 2H5EA 2H29A 1CQZA 4DPMA 1RYFA 3I28A 2D59A 1GARA 4U7FA 1VCNA 2I1LA 2Q4OA 4F2HA 2Q9BA 1VMDA 2ZI5A 2VJCA 3GLQA 1PWHA 3QWIA 4MV8A 4JX9A 1CZLA 2RIPA 3NHAA 3O94A 4JHXA 3UJBA 2P0YA 3PT5A 5FWNA 2ADMA 1DIAA 2COKA 3NKFA 1IN5A 1UMBA 5HQ3A 2D0PB 1XNRB 1E7RA 3JAWA 4FXOA 3EYWA 4MDYA 2P8JA 4NFHA 3RT7A 4M1ZA 3ZHOA 4PSVA 1OA0A 2J5BA 3EVCA 2VJLA 4H2DA 5A6SB 2Z6VA 3QVMA 4DCOA 1VC2A 2FGJA 2J48A 5IAAA 4C5AA 3JD1A 2DKOA 3TLEA 3TMYA 4QBFA 3ZDYB 4C08A 2Z02A 1INLA 4WXMA 3VYWA 3ZC3A 4DSOA 1IQPA 5JECA 3TQTA 2WFAA 4KFTA 1UMDA 4QJ4A 5LDHA 4NI5A 5D1NA 3ZCRA 1CQWA 4BBRG 4LFBH 4J1TA 4D3DA 4HVLA 3C45A 7AT1A 2GH1A 3V7YA 4DADA 3JSNA 1H1DA 4MIYA 4YB8A 2P2DA 3C24A 2R60A 3ZLVA 1D0SA 1KFEB 3EW7A 4RZIA 5KOHA 2QQ5A 3H5LA 5HYVA 2R3SA 1BEEA 4FE7A 5FPPA 1B3BA 5HTKA 5JNRA 1XHEA 3D6MA 3VTKA 5KFSA 3R3JA 1R1DA 1UT8A 2NW6A 2VF4X 2EKBA 2IP2A 3C97A 3G7SA 3PZPA 4K6OA 3K6SA 1DJNA 4PZCA 2BTOA 1XU9A 2UDPA 4AKTA 1A5BB 1K2VN 1R8JA 2B6NA 3PGA1 5K6AC 4Q44A 3OCCA 3UPTA 3L8GA 3KAQA 4JDPA 2HTEA 3AJ8A 1IATA 3E3MA 3FTPA 3TZKA 3JU3A 1YB5A 4IRCA 4NAHA 1RWVA 5DISC 2BEUB 3S5JA 3UANA 2EGGA 4BQNA 5B1HA 5C51B 3IG0A 5CYOA 2A9JA 1AGRA 2AA3A 3DPIA 5I3CA 4H7PA 3GZ4A 4BV8A 2WWTA 1TZJA 2ZIXA 2EL9A 1R6XA 1WULS 2VI5A 3BB3A 3REGA 4F4JA 5JSHA 4JYMA 3FMAA 3UAWA 1A5SB 2G9ZA 5BSTA 1SVIA 4I14A 4YFVA 2CNWA 5DK4A 1UMBB 4RD4A 3SC3A 3GQBA 4AS2A 1K1SA 2IEDA 4ZMSA 4D9NA 1E7MA 2ACEA 2BQRA 1NQVA 2L17A 4CKBB 8GPBA 1BU5A 3FOZA 2Q9AA 4BO8A 1R0YA 2JH8A 2VHJA 3EQ7A 5HOEA 1MC4A 2QAGB 4A3BG 1CQJA 1NL3A 4S1NA 1UC8A 1JU4A 2QUBA 3IUMA 3LRPA 1E92A 3AR3A 1KJZA 1CUYA 2IUEA 4HATA 4IXNA 4JP3A 3SSMA 3ZK8A 3KJFA 2A57A 3AQIA 3GCWA 4MR7B 5I5UA 4RPHA 3W8DA 4BUCA 4GKKH 4O3MA 2JKYA 3ERCA 5ALRA 1Y1VA 4Q4LA 5EHXA 1RHKA 4O82A 5DM70 5F2OA 1X1CA 4DRXB 1PGOA 1XJ0A 3U5TA 1ZGBA 3W90A 2QM3A 5BRNA 2QVXX 2GSDA 3MM4A 4QIWA 3NDJA 3NP9A 4G36A 1E3TA 5L6LB 4RL4A 3NUAA 1EUDA 4K2AA 2V97A 4QAQA 4XR9A 5FUBA 2CWDA 3GPIA 4LRSB 3VO9A 2XQFA 2ZFUA 5GV7A 1DG3A 3L82B 2C4MA 2P5SA 1W2HA 2QZPA 3E70C 2VBGA 3LDAA 5JNSA 2VQEH 3OT1A 2D1QA 4QBGB 4E22A 2OHVA 3TYXA 1DBQA 2GPYA 4WUVA 4IDFA 3JWIA 1N7IA 4Q9AA 4Y9DA 4EWLA 1JDSA 1LLUA 2DWUA 3BVPA 5CPBA 5J2UA 3HOYG 3DKRA 2XSZA 3P9KA 4QHTA 1SXJE 3R4VA 3T3DA 4KSBA 3GLGE 4NZNA 5KTRA 2PR2A 2ZPUA 2GERA 1G2OA 2JANA 3AJ9A 5HHTA 4DNQA 3IP5A 1NSFA 3BWDD 4MB0A 4PONA 5L53A 5F51A 3MBIA 2OXIA 4FLFA 5FOVA 1IXRC 3OHSX 2AJCA 4RKRA 3RYHB 1BCSB 3GJXC 3NT2A 2GRAA 4YASA 2OE2A 1Q1ZA 1YXMA 4FEYA 3BMNA 5EYPA 2FR0A 2WAAA 1HE3A 4HYQA 1F0YA 2OK7A 4KOAA 3JSXA 3RSCA 1W36B 1WHTB 3MC1A 3U7QA 1WG8A 2W6PA 1NBHA 2Q3CA 1YE5A 4KWTA 4LV6A 2CV1A 1JKFA 4BQSA 3UFBA 4PLFA 3L1HA 2E85A 4C0SA 3QX8A 2FE3A 2BCGY 3B70A 5GVRA 1UAGA 3HT5A 2FETA 1PFUA 2CJWB 1T8UA 3ZDQA 3CWQA 4EPTA 4KKXB 1XZQA 2W2XA 1ICIA 2LKDA 4HBGA 3VMFA 1K6IA 4G0XA 1ESDA 5C5JA 4QDTA 5MFPA 5JYBA 1JZSA 5EJ9A 3ILHA 3K5HA 4TKVB 3BXFA 1SVOA 1J99A 2V0NA 3N5KA 2ASJA 3UXYA 2KBEA 2I1VB 5GZ6A 5B36A 4IGFA 1LDBA 3RYIB 4CI9A 1GZUA 1XB2A 4Q4DA 2VNIA 3BE5A 3NDPA 2HHHH 3CLVA 2C22A 1SUBA 3SI7A 1OX4B 4C0QC 3DAAA 5JNVA 4YMUA 3DP7A 3OZFA 4IR7A 4TWBA 2HNKA 2NUPB 4MKGA 2KMLA 4PPGA 5ALDA 1IBMH 4EA6A 4DV1H 5J59A 5LXTB 3IAS1 4IR1A 4WJZA 4POOA 4OYRA 2ZGIA 2VHTA 3I9NA 3GGJA 3D7NA 4XGRA 3JQDA 5DIFA 1QIGA 2Q6TA 2VJAA 4PPFA 3ZU4A 4KNYA 2QLMA 5BW4A 3W1VA 5DNWA 4C2TA 1MZBA 1N92A 1CK4A 5C0OE 3TSZA 1RXWA 1WDLA 2Y9PB 1A8IA 1GNRA 3ZWOA 3VKFA 3PN1A 4AZSA 1ZQ1A 5DW0A 2PO5A 3MGGA 2I4NA 3OMLA 5FWYB 1RJQA 1NVFA 1HURA 2VP9A 2CDRA 1NW4A 2XRMA 4NJEA 6CHYA 5C80A 1WDWB 4Q0MA 3EAQA 4PQFA 2A92A 4RLQA 4PWZA 2VQ6A 3DMTA 4O4LA 5I9SA 3R7AA 5DLYA 2I8LA 4V02A 3QUAA 1GAWA 4DDUA 1IVNA 2W8ZA 4LWQA 4Y1GA 4RAQA 3PA6A 4Q16A 2W98A 4FMPA 3VSBA 4AMBA 4B09A 2CVZA 2I1WA 2QVGA 5IH7A 5BN4B 3OZEA 1X70A 3Q3IA 4MWSA 5KFKA 2Z2KA 1HLFA 3VNBA 4C1NA 4HC4A 1E9VA 1BIFA 4QTXA 1JECA 4I36A 4XDYA 1U5CA 2H3EA 3VHLB 5LOVA 1H9BA 1TWFA 2FG7C 2HL6A 1RKXA 2XF2A 1BS2A 2CLIB 3W9SA 1G2PA 4KWIA 4UE2A 4UXHA 1KVTA 5I7RA 2K7FA 1J00A 3MGBA 3BXXA 2TMKA 2I9KA 4JI5H 4DDVA 1R4ZA 1RPJA 3KHSA 1IL0A 3NWBA 3Q8QB 4PG7A 1BWPA 3HXPA 5JQWA 3DOIA 3KHLA 1PJ2A 1ILWA 1T1IA 1OB5A 3MRXA 4A91A 2B4KA 3K4PA 4UM7A 2F3QA 4EUEA 2WWRA 5DG7A 1IONA 4JU9A 3OOWA 4WK6A 4XVHA 4LY3A 3J81k 1Y6FA 4QXQA 1Y1TA 3BQ1A 3QFHA 4WFQA 2Q1YA 2CNLA 1NDQA 2CZGA 4AJ2A 3B7PA 4IO1A 3ZK7A 3O75A 2EZ8A 4DLKA 4PXSA 3VKUA 4PLHA 2ZDGA 1T10A 5IC5A 1KWGA 4MMZB 5IKXA 4BAUA 3FNRA 2EEZA 2RGNA 1OBCA 2VT2A 5A2QW 4PO9A 4ZN6A 4DJDC 1A96A 1ZWKA 4RVGA 3EDOA 3S44A 5CLFA 3H16A 1QB7A 3N5CA 4AWBA 3JYNA 4HQ6A 3A4IA 1UDWA 1E6KA 1WXQA 3IKVA 3EFEA 1IY8A 4X24A 4TKLA 5EG5A 2W8KA 2ALZA 1D7OA 3LVQE 1TL7C 3E84A 1SD1A 3A31A 1FYEA 3WGUA 1YB2A 5JISA 3RAGA 5H16A 4WEQA 2OM2A 4EYQA 2VAMA 3DOCA 5FD6A 2I6TA 3ZOKA 4TVSA 3R0JA 2XCTB 2RG1A 2A9VA 4ZCQA 3DT8A 4AY6A 3MTEA 4JJ6A 2M6KA 1V8ZA 3MOIA 5K4GA 1SOWA 3SLRA 1T0IA 1XV5A 1YB4A 2C8KA 2HCRA 3ON5A 3W5OA 5CPFA 3R74A 3V34A 1Z6GA 3PENA 4MV7A 1Z4LA 3RK4A 1U11A 1NVUQ 2BI8A 3H4TA 3PXAA 4DB2A 3KSUA 3C2QA 2Q1XA 4PLTA 1JDJA 3GFQA 4EFBA 3I52A 1H2ZA 1S10A 1IUOA 1K7XB 3FOFC 1KKLA 3TZ6A 2AWOA 4E5NA 2GBGA 4BX9A 3AVXA 1IHYA 1TX4B 2F62A 3QMVA 3W7VA 3I1JA 2P90A 2UV8A 3ML1A 2H59A 3O8RA 1JWAB 3TM5A 1SK8A 2ES4A 1JX6A 3ORYA 4IZIA 4KXVA 13PKA 1Y6ZA 2NXNA 3JALA 3I04M 3C87A 3JQAB 3LL7A 3ONVA 4KQHA 1D2EA 2XW6A 5ALQA 4ENSA 4CGZA 3B2EA 3NT5A 3T7JA 3U3JA 4B82A 5LQRA 1SCKA 3NHWA 4NE2A 4OK3A 3TMKA 3H4VA 1UWVA 4MS4B 2Z4RA 4TTIA 3G9UA 3EG5A 3TPFA 1QGDA 3QFFA 4EPRA 1XT6A 1Z4QA 1OI7A 2VDVE 2WJZB 1JVBA 2QT1A 3LUPA 3VH4A 2AJLI 2Y1DA 3ELBA 1TAEA 4B2LA 5FP0A 4JR0A 2QX9A 3BB1A 2AEEA 1T9BA 5HK8A 1PJCA 2OKCA 3SFVA 1T9CA 4GVXA 4Q9DA 4Y2HA 3D0OA 2IW3A 2RK4A 3AUFA 4CIWA 2AK3A 3FNHA 4UHKA 2FJPA 3GCDA 3NS7A 4W1QA 3KJEA 1V1RB 3MWKA 4R7RA 3PEWA 2ASEA 1GXSA 1Y1SA 5CNJA 1BXGB 4DNFA 4A5SA 1G2QA 1L7DA 2R4QA 1X9NA 1SKBA 3QKSB 2A0FA 2IJGX 3RUFA 3LUKA 3R23A 4J9RA 2A3NA 2C2WA 3EZ6A 2AB0A 1YBAA 2DPXA 2QRMA 1QANA 2X86A 3BJZA 3FYCA 1JVSA 2XVAA 4INOA 2W9CB 4LNUA 1QSGA 4PX5A 1NOJA 3U1VA 4BS9A 3BX1A 1OXBB 1DXQA 2VG8A 3HDYA 1YZUA 1GSHA 3U1BA 5CLHA 3VQTA 1F8FA 4QXAA 2VF5X 3VVBA 1GNQA 5ELXA 3HV0A 4GHWA 2WZQA 1VE7A 5HMMA 3ZCQA 1TEVA 3OP4A 3OKPA 2ONKA 2WUDA 4JJFA 2NX2A 4XA8A 1DIKA 4IIXA 1ZS9A 3DE5X 1QHGA 5CDUA 2XCOA 4M9ZA 4WKCA 5BQ5A 4CDNA 5FTLA 3ULKA 4EPXA 4UFZA 1CUCA 1H1TA 2HIGA 3E3NA 4Q47A 3G0DA 3WRYC 2XLCA 1KQGA 1YQUA 1BMFA 1H23A 1RCFA 5L9AA 1GTG1 3PQ2A 1COWD 4QBHA 2G88A 3IE1A 3A1SA 3VU8A 4A6EA 3CNEA 4MV5A 1S2GA 4LYHA 4MEBA 2CL0X 3K5IA 4OIFA 4D4IA 3W4KA 3SU8A 4G0OA 5JY1A 5DU2A 4QXMA 3UM9A 3OTGA 2WMYA 1U7TA 2VJMB 5LQKA 4BNDB 4ZXFA 2CXUA 1VGVA 2VUTA 3RB0A 3INGA 2CLCX 5D00A 1HORA 4UVHA 1J8FA 2I2FA 2RDIA 1NVXQ 5HFNA 4C3VA 4EO4A 3OQ6A 2O8BA 5HZMA 1RFLA 5JS8A 3FOWA 3KC2A 5DBHX 1JILA 2FCRA 1TQ4A 4ZVUA 4HJRA 4D9IA 2DQSA 1KI7A 1DCFA 4ALNA 5AW8A 3CW8X 3X44A 4NENB 3UC9A 1TE2A 3TOCA 1JAHA 3CY6A 3C7TA 2XWJI 1F12A 1JWBB 1TU0A 4MJXA 5KB3A 3VYRB 5K9ZA 1KQOA 1O95D 3FUTA 5L3QA 3HR4A 1W5BA 2AQHA 3D2BA 4LNUB 1FVFA 4NG5A 3ZZNA 2GPTA 2BQ3A 3TZHA 1LW7A 4HLQB 3PEYA 2LPMA 4RJIA 3DYIA 2H0QA 5GONB 4ATNA 5K3WA 3DW1X 4HTFB 3TZCA 5KFIA 2EG9A 4HHEA 4ZCMA 5ICSA 4MWDA 2BH2A 1L6IA 4EPVA 4A73A 1W88A 5JVDB 2Q7OE 4GIBA 3T1HH 4RVDA 1JFVA 3IQHX 1FLNA 2HQSA 1ET0A 4W8GA 4O7WA 4YBZA 4FBUA 2R7AA 3PX3A 4J7AA 4JVNA 5AKXA 3EPPA 4FYYA 7ABPA 2WT4A 5IHXA 2MSEB 2ZTMA 5IASA 3FPFA 1JI0A 1MV8A 1QNFA 2A1TR 1A2QA 3C0KA 3D8NA 4CMFA 2JIMA 2D1YA 4KIUA 5B64A 3EJWA 2AC4A 3CEBA 4R2IA 1NRIA 3EHEA 3U37A 1WZNA 1E0JA 1A9XA 1MA3A 4G0YA 4R1NA 3AO0B 4D9EA 2ZEJA 4IMPA 4Y1EA 5HTOA 4JBLA 4UUBA 3L8FA 3T1QA 4PYKA 3UT5B 1FFWA 4KCGA 1ZD2P 2J3HA 1AK1A 9LDTA 3I8SA 4EHIA 4YCSA 3EC1A 5HNEA 4LYDA 1RBZA 1XZ8A 1SVKA 1Q0TA 2OQ2A 4CLOB 4AMUA 2XKJE 1DKMA 3E82A 3FVWA 2BMWA 4JT2A 1C4XA 3GEPA 2ATCA 1EHCA 1UK9A 2OKGA 1RZVA 1H2AS 4HXYA 4Z9FA 3AIKA 1SXGA 4K6MA 2JGLA 4TV9F 1ZICA 1QG6A 2P0EA 4YQWA 1MG5A 2O7NA 1I5EA 4Q6WA 2CL7X 4I9UA 1G8KA 2CW8A 1PQYA 4NNOA 4PPYA 1W48A 1P3JA 5J5CA 1KS9A 1GCGA 1L4MA 4QDUA 1Q0UA 4GZLA 4K2HA 2GZMA 4QXOA 3LLCA 4Z4HA 3OLXA 2D7CA 4X6XA 4AG3A 3E35A 5LP6B 3HL4A 4MW6A 4EDHA 5DM4A 1J23A 4JWTA 3N0XA 5BNTA 4GEKA 2I3ZA 4I2VA 4A93G 1A2BA 1EUCA 1I14A 2I29A 5FPOA 3BA8A 3OICA 2XYQA 2JZNA 4Y1RA 2RH5A 4OK5A 3SJCA 2ECOA 2JCBA 1FBNA 2UVUA 4O4LF 5G3YA 1FK8A 4QGGA 4WZ6A 2GBFA 3R9XB 4JI6H 5HRUA 3P7MA 2PRZA 1K4YA 3FVRA 3HXLA 4UVDA 3WWPA 1O97C 2O3QA 1GCIA 1JHDA 2XMRA 4F2WA 2VP2A 4YMHA 2IE0A 4INAA 1Y33E 3ID6C 3KNZA 4DMRA 5IWCA 1KJYA 4QM6A 1P0PA 2CBXA 4OI2A 6AT1A 2XGSA 1D1TA 1R4MA 2IKQA 3EUFA 4J4HA 4TKUA 2HPVA 2OVFA 2ZRKA 1YNOA 5DOZA 4DJTA 3OTOH 3DTFA 1DKUA 3HWSA 1KYTA 1NVBA 3B89A 1NE2A 5HS4A 3CMMA 4FFVA 5BXYA 5JS6A 4G81A 2IHTA 4LF6H 4CMAA 1U63A 1RJDA 1M8PA 3H9JA 2JH9A 1JDBB 1T5HX 3I6ZA 1NP6A 1WDTA 1V43A 2B25A 3ECSA 3PRHA 4XR4A 1AB5A 5LKAA 1TC1A 3TQQA 2GHQA 3SI8A 3NC1C 3N8KA 5FLKA 1O94D 1FUYB 4ZRNA 2XIJA 4ARAA 1RCUA 3PQ6A 2CYAA 4D9GA 4F8EA 1C4OA 3R7WA 5GOZA 5EWMB 1C9JA 1NNLA 2VFAA 4COOA 4DY4A 1U99A 2ZJAA 3P5BA 3ZIDA 3RB4A 1GNPA 3NEJA 1DC7A 1N8TA 1T1JA 1EB8A 1YZNA 4RY8A 4GRDA 5BNZA 3WWHA 3GPCA 3IJ5A 3T1YB 3ZZ0A 4YRJA 4KR7A 2XB9A 1BYIA 1Q21A 3I0NA 4DNPA 4IZ6A 3PXBA 1WX1A 3SHFA 3UFXA 4YQYA 3GHHA 4CKCB 2ILTA 1GGFA 1N5IA 4NZOA 2AN5A 4G37A 1ZH8A 4MUYA 4QQFA 5TGZA 2HWUA 1G4AE 2DT8A 5EUCA 3SJAA 1SKAA 1Z5PA 4BMYA 1US8A 1IK4A 3FCYA 4H4CA 4M3NA 4O4HB 1LX7A 2VDPB 5J4HA 2QQFA 5HBGA 5K8JB 5ALVA 3PC6A 1IM5A 2UAGA 3STVA 1VRVA 3IT1A 3P4YA 3ETEA 3T1NA 2BR3A 2XCPA 3D3QA 3B1VA 1W4ZA 3KP1A 5CXSA 2XYRA 1T2AA 3DHNA 3FWNA 3KXYT 4FLMA 2QRVB 5AR1A 5SZJA 5HJ7A 1NONA 2HLPA 3DV9A 4EF4A 2GCOA 2X4GA 3CSSA 3T1OA 1CNFA 2Z5VA 4M98A 1LFAA 2CHEA 2RC6A 3GV0A 3C6ZA 4AY2A 2O8EB 4IEFB 1N7GA 2ZJBA 2BKAA 3KB8A 1ZXLA 3ESXA 3H13A 5GGYA 1RXIA 4PSUA 4XX1A 4YP6A 3T9EA 4JB0A 1ZNQO 1KC3A 3NHFA 1GKLA 3W6PA 1E9DA 2PQMA 1S2IA 1SKYE 4PZ8A 1DIRA 2ZE6A 9LDBA 2W6CX 4CT5A 3L46A 1JJFA 1SCUB 3ROFA 1DEKA 4ZZ0A 2DPMA 1M76A 4A3KG 4GYKA 2OP1A 3UGQA 1WP4A 3EXAA 3OHAA 1XDWA 1ZCAA 1SRRA 3EFBA 1G9TA 3JWHA 3R5JA 3G82C 4G9EA 5EP1A 2JFPA 3ESCA 3TFOA 2NACA 1E4GT 1C41A 2E21A 2QUZA 2W2OA 3KUKA 2HK8A 5AHRA 1YQXA 2C9CA 1Y9JA 1THMA 4UTOA 4K9RA 4BN4A 4ZK2A 2FFAA 4F50A 2P4SA 3AUXA 3BTUA 5JH7F 4MVJG 2PL1A 3VTZA 3BEOA 3RJ9A 1ORTA 4LCBA 1RAAA 4TTJA 3TQOA 2P6PA 3WGGA 1ZIPA 2RH9B 2WMDA 3O91A 2AI3A 2P40A 3L7LA 1WU8A 4NOLA 2DETA 2Q3DA 2SKEA 3OJLA 1CHDA 2VAPA 4DSZA 1OYWA 1HFKA 3RYFA 3SEFA 4E4TA 1QTRA 4X1KB 2WYIA 5DCWA 3TLAA 4RTMA 3BIXA 1XZNA 4Q1VA 2QUAA 4UHFA 2JI7A 5I9NA 4P7FA 4QXPA 2I55A 3C8MA 1D09A 1U7ZA 1V95A 2IY8A 2F6RA 4F38A 2XKKA 5LZ2A 2ZBDA 3MHPA 5BWNA 2E5LB 1ZSYA 1ISJA 1Q1BA 1YCHA 2QZJA 5KVQA 1EDDA 1GPYA 3DVAA 1FU4A 3QYPA 4I19A 3M3DA 1CJBA 1LZLA 2EFCB 3MT8A 4IFEA 4DJJA 2GT1A 3KWJA 4HGYA 3G68A 3THRA 2R84A 5CVDA 2KM1A 4WOPA 3OEYA 2FJ0A 3WWYA 4CM9A 1YZLA 1H3NA 4DCUA 1PWYE 4EKNB 1WR8A 4F4HA 1IBLB 2JA8G 4DIEA 3LMKA 2RH4A 4BRWA 4MKIA 3TQHA 4RUKA 3ZHSA 5BR8H 2XGJA 1NKTA 1IG0A 1DUVG 3PUVA 4A92A 5JUMA 1C1YA 1IG3A 4HK4A 3V4PB 4ASUD 4B73A 4DTCA 2XECA 4X94A 3W3AA 4BO5A 5K0ZA 1SU8A 3WNQA 1F06A 3QWBA 4AJEA 3H04A 5F9LA 4PFSA 3M5DA 4RACA 4AJIA 3GNTA 3HO8A 3MELA 3E2MA 2MSWA 3HB9A 4LG1A 3U9LA 1I3CA 2ARKA 2ZVJA 3CUSA 4OXXA 4ZQGA 1R15A 1OX4A 1TZKA 5DKFA 3WHLA 5E7JA 1SA0B 5CXQA 1XP8A 2ZYTX 4Z3OA 4BKQA 2ZVPX 5FOUA 5AP9A 2DKFA 4FZRA 4L15A 4CC6A 2Z4TA 1J1ZA 2QLJA 4H7IA 4UOQA 4EW1A 4PCVA 3SBDA 2C98A 4OJNA 3STWA 1MEOA 3BIJA 3LQKA 5CCBA 3PLNA 5AW9A 3DFIA 1DWQA 2EJVA 2QMUA 1HE4A 1W46A 2XUZA 1AS0A 3E81A 5HIIA 1L4GA 1PTJA 5LQCA 2P2LA 2IPMA 2PJRA 1LA2A 4OHOA 1Z4IA 1ZNZA 1NZDA 3E5MA 4DLRA 4LJ5A 1E7YA 3G85A 2P3QA 1QR2A 4XFJA 4BFUA 1DRKA 3FDJA 3T54A 3USCS 1VG8A 5ALOA 2NZ8A 3R3YA 1YOVB 4HAXA 4ZVSA 2PMZA 3I8OA 5KFOA 3AXSA 4DQDA 1RWNA 1J8YF 4X7RA 4REOA 2KI5A 3LJKA 4AUKA 3AYXB 2YNMC 4TWRA 3RTGA 2JFXA 5FULA 1B8OA 4EGSA 1EB9A 2BE7A 2EDAA 4UCWA 1D9XA 3RBDA 1IHOA 2DR0A 3V1UA 2WFZA 2VUIB 5KKAA 1SCDA 3BA9A 5TV2A 1NW7A 4L28A 3D5QA 4LZAA 2JKVA 1J0EA 1PAUA 1OAOC 1NF8A 2F00A 4Q24A 3HMQA 1YNSA 2ECPA 5HFJA 5A4MS 4B84A 4DIFA 1TZBA 2QRVA 4PYIA 1KQPA 3KT0A 5E8RA 4F1JA 2XHZA 4GPAA 4ZHSA 1F38A 2D7DA 4F3KA 4YBZB 1M10A 4RTQA 4WKBA 3HS3A 4B44A 1A8UA 2DBZA 2BW0A 4NU5A 3O83A 3AK4A 2BEWB 2VTDA 3HPQA 1L5YA 4X8MA 3ZY3A 3JQBA 3FLEA 4XI9A 2C8LA 1N1MA 1YJ5A 3GPBA 2I6FA 4IMRA 2NYVA 1M0TA 2H0AA 3LWBA 2WIJA 4Y8VA 1ZVJA 2HJHA 3S2GA 3V4LA 3H99A 3L8HA 4E2YA 3GRKA 2BV3A 5FI0B 4JT4A 3G23A 2YASA 3S2FA 1JLKA 1FFSA 1M2VA 2GF0A 2Z98A 3H11B 2O3TA 2VCEA 2YVLA 1U3WA 3CX7A 3K8OE 5EHNA 1OTHA 5BNFA 4YJGB 4C06A 1N2IA 4EPWA 3OLVA 3N05A 4PINA 4OB7A 4GGOA 4YHHH 4X6YA 3V1TC 1R3UA 5K8VA 1V6SA 2PUBA 4QFDA 3OOYA 1JQLB 3T41A 5BR1A 2PV0A 3A6DA 4GOND 4BMNA 5LPNA 1EJ0A 3BQNB 4OV6B 4LXTA 4XD7D 1A50B 2WD7B 4X20A 4UATA 4BQIA 1Y63A 1UBCA 3DNPA 3UXMA 1Z0UA 2G04A 4GVPA 3UBMA 1SNYA 2GEKA 4L4XA 5JVLA 1Z18A 1EFPA 2JJ2A 4PEVA 4KYTA 4RVCA 2GARA 5AKHA 3C1AA 2ZQ5A 4N5LA 5L7TA 1L4FA 3WRXC 2DTEA 1YAHA 2PRYA 5A0FA 1E2BA 3OSNA 4AJNA 1IC6A 2ECQA 5FTJA 1KO5A 2PPVA 3EZLA 3QU5A 4JLSA 4G07A 1XNGA 3E27A 3UH0A 3MSCA 1SCAA 3P2OA 4EVQA 4FEEA 3A3PA 5IFLA 3MOSA 1QS0A 1S1CA 2C3YA 4Q01A 1YR2A 2R6JA 2YV3A 3DB1A 3NYWA 4BNHA 3I83A 4LZWA 2R93G 2ORVA 3EZYA 3NTRA 3X1JA 4LSGA 1FDTA 5D3MB 5AK5A 4D96A 3T99A 5FRDA 2MIIA 3NG1A 5GONF 4CDGA 2E2HA 5IKEA 3PLAE 3RK1A 2WUEA 4P7JA 5BNWA 5LMZA 2F4VB 4EZBA 2VK1A 4NSNA 1DJOA 3TB4A 1KPGA 1LJLA 1EGAA 1W87A 1STOA 2Q5OA 4QWMA 3PPVA 4MV3A 1CERA 3E61A 3PXDA 3U4IA 2FLPA 2D62A 4FIZA 3ZS8A 3DE6X 3RU9A 2PKQP 4BJ5A 2YMQA 4I5EA 3I2IA 2QB5A 2C5SA 4P7GA 4QYMA 2HEIA 3JYQA 4KIFA 3RC3A 3WFJA 3A3NA 2H3HA 1IBSA 1XWWA 2B3TA 3R3SA 4FGUA 2XMQA 2PAFA 5C7IO 2VXOA 5AJTA 2E9SA 3OSPA 3LSYA 4ZOLF 2O3SA 3CWZA 2V55B 5FPSA 4C0XA 5JHHB 1Y42X 5EWLA 3M70A 5FADA 1YZYA 2V7BA 4RB0A 3GRCA 5T3YA 2FKLA 3WLRA 5CAEA 2GZHA 2QXUA 2XQIA 2QYOA 2PD3A 1LRKA 4I4IA 1LPMA 3HCRA 2GPWA 5DBIA 4M83A 2ZVDA 4P82A 1RVDA 1VCMA 2EWVA 3QQ5A 4YS6A 1Z38A 1KEZA 3DNMA 2FP4B 1U8FO 2JFUA 1MW9X 1QVZA 1J2UA 3N2LA 4R2JA 4UUQA 3IA7A 1U0GA 1HLDA 4E5UA 3GA0A 1QNLA 1ADYA 4MS4A 4U39A 1KY5A 1T3LA 1V7QA 3OM0A 1VXOA 5L1JA 3AHIA 3R3WA 1ZGJA 2F9FA 2J6SA 2P9FA 4Q3EA 5A3RA 1Z7WA 1UDBA 1Z0IA 1L1QA 1FFDA 2AIRA 2B35A 2WKQA 3GRPA 4YTEA 5FEUA 1N6LA 3F5QA 3VDMA 4BZXA 2WVGA 4BQFA 5EJ8A 2GCOB 1ECFA 3V2GA 4LFBB 1YA4A 1QCYA 3PDJA 5I7HA 3RYCA 1G3RA 2NNWB 2I4LA 4HOYA 5D1OB 4R2WA 1RCTE 1RPNA 1J09A 1J20A 5F33A 3RNLA 2G4LA 3NAQA 1J5PA 2CB9A 5LMCA 4J6EA 4FKBA 1QE0A 3QXSA 3PR5B 3EH1A 1DLJA 4L74A 4YWJA 3A10A 5HM6A 4MQ6A 3TKAA 1DOZA 1Y9EA 3GDFA 3IQZA 4C30A 1P4RA 1WB9A 2DTDA 2HQBA 3AI2A 3WTCA 4ECQA 1K3FA 3QF4B 4U2EA 4CKWA 1YGPA 1TGVA 4KFSA 1ZUNA 2ZT7A 4HQOA 3EXIB 2LR0A 2Q2OA 3LWZA 5IBPA 4N5IX 1SEVA 5LLSA 2C00A 4O33A 4AAYA 5L3SA 2HF2A 4R0VA 1KETA 2PZGA 3B53X 1Y1WG 5AVKA 1QPBA 2YHIA 3M2PA 4MGIR 2VUSA 3PF8A 5AI8A 5AIAA 3K1TA 3UK2A 2J6CA 3PRJA 4K9QA 3ESRA 2FVYA 3PFCA 3O9MA 3OQJA 1KIFA 4J3FA 4O29A 4QFCA 3DZCA 4TRRA 1XMOB 1T35A 4PSDA 1XI2A 1C14A 4K9LA 4ZYUA 1GGKA 4UM8B 3SG0A 4CIXA 1TW3A 1QRRA 2O8DB 3BSYA 4YRIA 3ET5A 2J5RA 5F76A 1KT8A 4XW2A 3QELB 4C6TB 2GK4A 4MQUA 4M7PA 3OZ7A 1XCBA 2PK3A 2RKWA 3JPYA 2VHUA 5D2CA 3RCBA 4E1VA 3MUFA 3T3IA 5F9MA 3ROZA 4UEWA 1KE2A 3ODGA 1CZHA 2Y1FA 1L8LA 3L7OA 1OFIA 2WUGA 4IR9A 5KJEA 3WP1B 4UTRA 1VG9B 1CIPA 2C28A 3EMVA 4FCWA 4KDFA 4PNEA 2Q1WA 1P4AA 3AB8A 3DZBA 3KQOA 1HE8B 1KAOA 3L8ZA 4D98A 1AU9A 4RTSA 2I6QA 3C7CB 1YQ9A 1IEQA 1Y98A 3MEQA 4P38A 4YPVA 4U00A 3B2QA 1NG1A 1D4AA 5M3BA 2WJHA 4A15A 4DQXA 4WCVA 2C7BA 2ILVA 2GK3A 1KA9H 4XYLB 4BP3A 4C4OA 4QTYA 4Z7JA 3SJBA 1C29B 3KE8A 4J0GA 3LPLA 5DEOA 3VAYA 3L7DA 3PDUA 3VZCA 4KSCA 1YGYA 3GRFA 4ZT2A 1L9XA 1NYRA 3LUBA 4KQFA 3E23A 2WQZA 4G0QA 3DH0A 4PC6A 1P2SA 4IZOA 1DIHA 1QC5A 5H9VA 3N2GA 3TLGA 1GFZA 5ICCA 5I7EA 3A6HA 4DC9A 1RRFA 2ZR8A 3DBHB 3LQYA 2VWGA 2NZYA 4YV7A 3IHWA 3GILA 2FW9A 2VJQA 5CB4A 1RJ9A 2YN2A 2XNHA 2C99A 4DIUA 4FOLA 3Q1KA 5IF3A 3WQSB 2JDID 4LY6A 3KKKA 3RFXA 1J33A 3E18A 1U3VA 3BKXA 1G4HA 3ZJTA 3VYUB 1X2BA 1N6HA 3LO5A 4HZIA 2QTWB 5L4NA 2OAQ1 2X2EA 2XCUA 3NGMA 3PGVA 1Y3FE 5I01A 1QP4A 1TTTA 3ZWXA 3W6UA 3PF9A 3FKIG 4AF8A 1OYYA 4EGAA 1TJYA 2ESRA 3C3CA 3S1SA 4L75A 3E15A 1XEAA 2GBLA 2ODEA 3LUCA 1W4BA 3JQ9C 3BMOB 1A9SA 1Z6YA 3I73A 1OJ7A 3QBVA 1HYQA 5K3FB 2O8FA 1EPUA 1OWTA 1N5KA 2WC1A 3NYRA 5LIRA 1DV1A 4JC0A 1K7SN 2CXSA 2H8KA 3UT6A 1DAEA 1RAIA 3V8PA 2EX1A 4OQZA 4MUJA 2NT3A 4TLLB 3HVKA 1Q92A 4PPQA 2W6OA 3VR6A 1TA0A 4IX9A 5HDQA 2OHJA 3LX5A 5DHRA 4P36A 2XUJA 3N75A 4Z0TA 5FV4A 1GKYA 2Q2QA 3LS2A 4GNRA 1BGVA 1VM6A 4E3WA 1SCNE 1PR2A 3U6KA 4R6XA 1FEZA 5LYJB 1E3QA 4J91A 3ZNQA 3QX9A 4F7DA 4EHAA 4AJHA 3KHUA 4LRQA 4TL8A 2IXTA 2V8BA 4HWKA 1VPTA 4ASUA 1B8PA 5DWVA 1DVRA 1EFVA 1SHTX 5EOVA 5IARA 1CF4A 2GQSA 1KZYC 2DQKA 1WLYA 4HNGA 1U0JA 1Y9AA 1JQDA 1T43A 2DKNA 2ZAIA 3BGIA 4Q02A 5CCEA 1KK0A 2OXRA 3FHLA 4FHDA 4B5KA 4E21A 4EFNA 1ZKMA 2HFKA 3QEJA 1RJ9B 3W9BA 3ZWAA 1S02A 5D1OA 1UKCA 5IAOA 2HJWA 2DHRA 4EEKA 2YWGA 3MRVA 3K9NA 2E18A 1L5KA 3KAJA 3QITA 4W9NA 1WCIB 1V5WA 4KN9S 3RIEA 1A4XA 1BDBA 2O2HA 1ONSA 3MF4A 5G0VA 1R9JA 3QJYA 4MWZA 3RKSA 4P81A 3T7DA 4BB0A 4RLHA 6LDHA 1V2GA 3TJRA 5CDYA 3EPLA 1TGYA 2ZXFA 2QL5A 2F3TA 1GPAA 1CULC 2ON6A 1XKXA 1B73A 1ZJJA 6YASA 5AVWA 4JJ4A 3H17A 1L7XA 1J06A 2FUEA 4DV6B 2PRKA 4NDNE 4N5MA 2X5RA 3KRTA 5GJBA 2BBSA 1B1CA 3COPA 4WFIA 1IXZA 5J1TB 4KPYA 2HXGA 3K35A 4GECA 3P9XA 4KWCA 1R0WA 4WZAE 3SLKA 3WYNA 1YMVA 4BGVA 4JS0A 1ESZA 1THZA 4B7CA 4O86A 2H1RA 3WNDA 4CMIA 1N6RA 1ZH6A 1IEWA 3ZD8A 4CFSA 4UQOA 4I3GA 2NAFA 4KGZA 1GZHB 4B32A 3DCJA 4K0RA 1SCJA 2BFMA 1ZM2A 2VVTA 3L05A 1JBEA 1RLTA 3BE8A 2BJVA 4G5YA 4KGDA 2XMZA 4HNHA 2VQFH 1Y3BE 4GLXA 1QZZA 2ZIEA 4KKVA 5FBLB 4XE5A 3ESZA 2J3KA 3QBDA 2CKMA 3GJYA 3STHA 4C6TA 4K6GA 1APBA 2ZTSA 1NY6A 2FWMX 4UCFA 1CV2A 1TO6A 2P6OA 2QP4A 2R8YA 1A7KA 1W76A 5BWRA 4IGEA 2ZUTA 1BU8A 3P4XA 2DB3A 3B52X 1VS0A 3H2JA 4IXTA 2ORWA 4W5OA 1FX1A 3NH6A 5JSQA 4MJ3A 3HADA 3TNFA 4JA2A 5M29A 5DTQA 4C2BA 1IUPA 1W1IA 3NH9A 2QW0X 1BX1A 4OQDA 3QGMA 5D7BA 4ED6A 1L3CA 3M4XA 2ZBUA 1PV4A 1QGUA 3WSTA 5FEMA 1FX0B 1P75A 2OGSA 3IA2A 3HQ4O 1AMOA 2J3MA 1Z5GA 4BAGA 1Y1WA 2QD5A 2HTFA 4JXXA 4JP1A 1XZGA 4EZEA 3BT7A 5JMWA 2B5VA 1TC2A 4I8DA 3FSEA 3HUEA 4NBVA 3TAXA 2F1IA 1T34A 4UC0A 4BN0A 3TRIA 4BMVA 4IXMA 3LT2A 3U80A 821PA 3I6MA 2PIAA 3RRXA 1HQDA 1A7AA 2BOVA 1NU6A 2X0JA 4TQAA 4MVJH 2CFRA 3I4FA 2G07A 2ZQYA 1P45A 1HC7A 7REQB 2X14A 1X14A 1ZZGA 3MERA 2AT1A 5EMJA 4KP7A 2DHDA 5I4KA 3E48A 1ZMOA 1X87A 2ZYGA 4URHA 1DG9A 4KRYA 2XB2A 4BBJA 1MORA 1V5FA 1T15A 4BC0A 3G2JA 3JWJA 2WJPA 1RI5A 1TXGA 4XWGA 3D8TA 4JGGA 3TN7A 2UVQA 3SZRA 4C0WA 4GGPA 3JD0A 2PT5A 3KEMA 1XRJA 4G8BA 4PU0A 4CQLA 5CLJA 4IVNA 2K6GA 3RT9A 5A3QA 1DJMA 1Z9BA 2MSDB 4NKRA 2J9FA 1AHIA 3PQDA 3CSWA 3BH0A 5BSVA 1KRHA 1Q44A 5KT7A 3HXTA 3G17A 3IQGX 4GBGA 4UNPA 2IYNA 2JF0A 4BTVA 5AW4A 4NR0A 2C7PA 3FLBA 4F7WA 4OH1A 2HHFA 4OM7A 1FS5A 2HJ9A 1EEXB 3AKDA 3LRTA 1RLOA 2DPHA 1GJRA 3K0CC 2IUSA 5E1DA 5KBYA 2XTZA 3JCZA 4I4TB 4QA9A 4BO7A 1WPRA 5LKRA 1F7UA 1YQTA 1RXUA 2FF7A 3N2YA 4LPKA 1QRAA 3A1UA 1DXHA 3RS5A 4RTJA 1F4LA 3MWDB 4RW0A 3AUYA 3PEEA 4MAAA 4TL9A 3L1IA 2JHPA 4LBWA 1VSTA 4H0NA 1U0NA 4YI5A 5HF6A 5BWVA 1G8PA 1H2RS 3H18A 3HJRA 1IHXA 3FGZA 1JRLA 5CX1A 1XROA 3TTVA 4NBUA 5JXHA 1XTRA 2H4JA 3GNLA 3GFVA 3EPGA 1XRQA 5G0WA 3G0OA 1SWWA 1E4VA 4C4XA 2JD0A 4DMHA 5IK2D 1QIDA 3PRKE 5KSYA 4P5EA 1SUCA 2FOLA 4CMKA 4J9UE 2CK3A 2JCVA 4JGBA 1SUDA 3H87A 2CUZA 1WXXA 5E4FA 3O3CA 4KXQA 5AKKA 3ZIAD 4B4OA 4EMTA 4I8IA 3IBSA 5A0VA 621PA 1XQYA 1ZK3A 4QYXA 5JAUA 5JRJA 3ER6A 2UYQA 2XMCA 3Q7IA 4YJ3B 3TD9A 4C07A 3MYYA 2NUPA 1E79A 1FVOA 2R8ZA 3WB0A 4M60A 2RHWA 3V6HA 3BXGA 5E1MA 2F59A 3NANA 3WWDA 4Q8EA 1SZDA 2CHQA 3INRA 1T8SA 1TTPB 1UBLS 3DG9A 2FSUA 4RYDA 1RJEA 4LV5B 1S3FA 2ZWPA 4Q4JA 3U56A 1S68A 1QUEA 5IBRA 2XTNA 3AF1A 4JLUA 4IDPA 2FMXA 4CKEB 5EIXA 3C8HA 2C2XA 4D92A 1UDAA 1PLKA 4Y6LA 1JIVA 3GT4A 1US8B 5B58C 5AM3A 1QGZA 2O8FB 2HOQA 4LXGA 5HKKA 4ZVTA 3H0GG 1SXJB 1GKIA 1LTQA 4ZOEA 1UP7A 3EHDA 1ECGA 2ZRHA 4TV8A 3VKWA 1JIXA 1NM5C 3GT0A 4Q3AA 4EB0A 3TDKA 4PHHA 1YZGA 3G6XA 3B2NA 3VAZA 1K3TA 4AYWA 3JAWB 1XZHA 3WRVA 3AL0C 2NGRA 3ANTA 4R3UC 2JEFA 1GPMA 3BD6A 4ZEXA 2OPBA 4IBOA 3NALA 1G9XA 2Y67A 1A3CA 1S2OA 2O2JA 3FJOA 4FFWA 4FQ8A 3HE3A 4GR5A 3UW3A 4JYZA 3LPMA 1RMYA 2NVUB 2VPQA 4KC0A 5C5DA 2E55A 2HU2A 4L2IB 1FQJA 2P9QA 4PX3A 4X00A 2O2DA 4U3JB 4EFMA 2HCJB 4O6VA 5JJIA 2DEUA 4I50F 2XUAA 2WHYA 3JAKA 1LX6A 1W5AA 1RYEA 5B53A 3QA9A 3GV5B 1P7YA 4B4DA 4BQQA 1E3IA 1M73E 2GPAA 2WHRA 3JXEA 4HWOA 4XTRA 5ES4B 1AQJA 4HDOB 4U7TB 2H5JA 3KPYA 1PJBA 2ZYVX 3PZBA 5ILOA 3ORFA 1JA0A 1A4UA 2A5GA 2GJ4A 2V6GA 1BCRB 3AILA 2HK7A 4J7UA 4UVGA 1I1QB 1N5MA 2J32A 3M9NB 1IAQA 3HCAA 3UQ8A 4DR7H 1LSSA 3H9QA 3ONNA 1EI9A 4DRFA 4MVYA 3T7SA 3GDEA 3ZGVA 2RHLA 4AJ1A 5CW2A 4FYJA 2V7TA 3I3OA 1U3CA 4BC1A 1NXVA 2J7PA 3RANA 4V1CI 1GQYA 2NO9A 4YY3H 1P9LA 2OV2A 4EH1A 4TT8A 2DBQA 4IH1A 1UWLA 1SU6A 4A3JG 1V25A 3CBQA 2DERA 3R8CA 2BEUA 2BDEA 4IQFA 4MUKA 4B2IA 3C85A 4MVWA 1LLCA 1GPH1 1YASA 5EJEA 4G5FA 2JI4A 2EF1A 5A3SA 1JIJA 4N82A 5AI9A 3SHTA 1MAHA 1IY1A 4FW9A 3R9XA 2ZBQA 4G56A 1THTA 4H16A 1DNPA 2ZJ5A 4OY3A 4AWXA 1KHTA 4WL0A 3V8RA 1LBIA 2AW3A 3PE4A 1WZ2A 3HUFA 3AP3A 2IODA 4Z2AA 3CUYA 2IOHA 1OF1A 3AEKB 3LA6A 3MAAC 4F56A 4B3RH 2UKDA 4HAUA 4RJKA 1YFKA 3WOVA 1CYEA 3WJ1A 4KJXA 2Q4RA 1SPBS 3FKJA 4YAKA 3IT2A 1X7YB 1OROA 1Q0ZA 1A69A 2NVUA 4XUGB 1IY2A 5B1IA 4EF6A 4TL7A 1ACJA 3K70D 1FFYA 5ERXA 2VUUA 1M2VB 3B60A 3P2KA 8AT1A 5KNDH 1JJBA 2D2IA 2ZIXB 4FKZA 5HCUA 2VF7A 3FA2A 4JKOA 5KFPA 2EBUA 3WIBA 1FX0A 1KY2A 1OU0A 4I55A 1O5IA 5K6RA 1PG0A 4KQGA 4LJ9A 3KQSA 1PNRA 2BEVA 1KO4A 4MQLA 1QO9A 2QA5A 1SXQA 1SBQA 3T0GA 3OX1A 2II6A 4B3MB 2N9UA 3CF2A 5C18A 4B46A 1IN4A 1X7DA 1ECBA 1LBEA 2VDUE 3EG9A 3GG2A 1GFSA 3PKZA 4UBNA 2XAAA 4RIIA 4V3CA 5CDTA 4B7XA 3WL8A 4XDZA 5KSOA 2F9MA 3CWCA 1Z47A 1VP9A 1W581 2AG5A 3K2IA 4J9KA 1R8XA 3H4BA 2XSZD 2NPOA 3EH2A 2GJ8A 3KVYA 4YLEA 4AF7A 4NK5A 3AEKA 3P0FA 1JDTA 4JUAA 4BNVA 2C8VA 4EF5A 1MZPA 4HDNB 4LQLA 5BV1A 3U4QB 1NI3A 4GKAA 4BLQA 4XUEA 3RRBA 3THYB 3P2YA 3QPWA 3WE7A 2AOVA 4BVGA 5K0EA 1CEEA 1DEAA 3RB3A 1AN7A 1G6KA 1NRXA 2Y0CA 3UWOA 4E6EA 1CP3A 2JNWA 4PX2A 2P3SA 4F3RA 2J1LA 2RGDA 3TFQA 4F84A 4WPGA 2W6QA 1ZNXA 2YV4A 3HRIA 3OOEA 4HX2A 4Q9NA 3SYMA 5E8JA 2Q4BA 5JD5A 3G0HA 2ZSBA 2DABA 1Z62A 3I6YA 4PG5A 4EAQA 2I80A 8ATCA 1E3MA 1ECCA 3P0HA 4BNYA 4P54A 5C35A 4QG7A 2I5PO 2ZE5A 1XK5A 1CNMA 1KNXA 1X77A 3C3BA 2PEYA 3A1EA 3DUFB 3WSVA 1RQLA 2YWXA 3ZLUA 4ER7A 1QRTA 2P2YA 5CD9A 2YMMA 4EAAA 1RHMA 1NUHA 2ACKA 1LLFA 4L22A 1JQBA 1KEEA 3AEYA 5HILA 4CMCA 4UTVA 1SC9A 1LVGA 4NEHB 1XBTA 5E6RB 1QDUA 4GXRA 1PL0A 2MINA 3DXFA 1JHZA 2R8RA 4ZV4A 5C8ZA 3DAOA 5AI5A 3UCEA 3CLUC 4EQZA 4PR0A 4NAUA 2QRHA 4K88A 4JWKA 4QATA 4FOSA 4UBMA 2QW1A 4D81A 3VI3B 1YACA 1WEKA 1ZOPA 4JXJA 4MW7A 2A0XA 3H20A 5DM60 4ZEWA 3W04A 2EJ0A 2UU9B 2UVDA 4QIHA 3DKVA 2P9HA 3Q3VA 4B7UA 1XTJA 4WA7A 4EYSA 3VNRA 1MO3A 3VR1A 1A9ZA 4FWIB 2O8BB 1IB6A 2X1MA 3T3EA 4G9BA 1XU4A 4DYDA 4HB2A 3THXA 1XPUA 4ZZ3A 1SURA 2M05A 2R4UA 4CTJA 3M34A 3VHRA 2R8JA 3OOJA 3QJ5A 4QDZA 3RBEA 1Z5VA 2CDCA 2HMYB 4L27A 4YALA 3OO0A 2RCNA 4WT7A 1Y4UA 5C4MA 1I1MA 3S2EA 1O54A 4LXIA 3EEIA 5AVZA 2A35A 5FX2A 1CR0A 2FH5B 4I9FA 4F2PA 1SCQA 1UBHS 4RXUA 2OP0A 1F2UB 1W5SA 1ZCZA 2IW1A 8LDHA 5JALA 2G77B 3FCSB 5MN6A 1TYCA 1JLRA 2DPLA 2JA1A 5DBEX 5JD6A 2JLSA 2A94A 2C35B 4Q21A 1FUIA 2Q41A 1VG1A 3PC2A 4LHXA 4NCHA 5FBHA 1J5EB 5LYJF 1E1RA 2R6ZA 3H2BA 3IHKA 3AHGA 3K31A 3SNOA 1KFCB 3DXZA 3QXGA 4JUCA 3OKCA 4NMHA 4HXEB 2D5CA 2BH9A 1L5RA 1W0KD 2C3OA 3ZK9A 2G1PA 1C7EA 1RXYA 5ENVA 4W6QA 5ULLA 4LJAA 4YRMA 1D4OA 5KNDA 5C1OA 5KYYA 1VCOA 4EQ6B 3FDZA 4YT8A 5TSDA 1KGSA 3IEXA 3OJ0A 3ZGXA 2QP9X 3GGOA 5B7PA 2Y8EA 3ANNA 3IL2A 4WOCA 4EYEA 1OFUA 1P0MA 1P7CA 1UBFA 2QKYA 3D81A 1H93A 3EXFB 4I1SA 4RL6A 3WA6A 4CIVA 5FL7A 4YIHA 1F2TA 2J9YB 1AN9A 1NAIA 1VE1A 4D79A 1P5JA 2PRJA 4MDEA 2O7VA 4S0ZA 1I36A 3B36A 2O7QA 2PS1A 3IMFA 4DVJA 1XQ1A 3UJ3X 1AG9A 2GD2A 1YH3A 3DHYA 4RIEA 1HA3A 1BSVA 1HMPA 4KLCA 3TTWA 4EKEA 3I2HA 1JE1A 4ZQBA 2A1UB 3QOXA 3QVGB 1VLVA 2ZUUA 3TRJA 3TW7A 1U6JA 3V00A 2ABJA 2O23A 3NIGB 1KAEA 3FHCB 2WIAA 2VP5A 3X1MA 1RP7A 4QUHA 4JJGA 3LPCA 2H7CA 2AKEA 4Q8FA 5J63A 3EPIA 3G7UA 2IYEA 4IS3A 4UQPA 4X1OA 5DE3A 5AKLA 3VO8A 3EX7C 3QELA 4DV5B 5LYYA 2EBHX 5PGMA 2FWAA 4ZO8A 5JNTA 4ARCA 3TNYA 4LJYA 4OKSA 1LPNA 2I3BA 4KQXA 4LNAA 1BHQ1 1XFAA 1AJEA 1DC5A 3LGXA 3VUEA 4Z7OB 2FMTA 2B3DA 4Z4IA 2A33A 4XZ3B 2YOHA 5WRFA 4YR2A 2WAQA 1VZ3A 4FGWA 2GESA 5C1BA 2IDKA 3CISA 3D1LA 5KC8A 1WV0A 1YA8A 4XPZA 3S4YA 3UNXA 1S9HA 1QYDA 2AGVA 3D8RA 5FD8A 1G8YA 2JD1A 3CO5A 3R4CA 1H6BA 4QELA 4A6XA 3AXTA 2Z0MA 5JBQA 5KTTA 2Z8YA 3PIDA 3DONA 4R81A 3U6BA 1VPLA 5T3UA 2JLBA 3DC7A 4TYMA 3E2PA 2NXEA 1UM8A 1CHNA 3I5XA 4EUHA 3BEDA 2BFCB 3RVMA 5T8KA 1VL5A 2RHHA 4URYR 3VPCA 4HYKA 1ORWA 2CHFA 3SSOA 1AY0A 3O9ZA 1XEXB 1RYYA 5CVEA 2NYAA 1BFDA 3CMCO 1CDZA 2RGEA 3DM9B 3K32A 4MQEB 2VF2A 4B74A 4C1BA 2C4KA 4EY8A 1QZUA 1WQ4A 1SVNA 1HDXA 3AR5A 3RIHA 3RU2A 4HZUA 2CMGA 1UEIA 1IBLH 1TM2A 2GEJA 4Q93A 4QEKA 3OECA 2P1RA 2J09A 5KYUB 1V16A 1RKUA 3NBYB 1B16A 1ACMA 1N57A 1SXJD 1Z4KA 5DLPA 3MHTA 3I0MA 4NV1A 4QRHA 3IUSA 3I72A 4O3NA 1P81A 3NM4A 4RGYA 4JI2H 1QVRA 3GZNA 3QIAA 4FE4A 5T57A 2I54A 4YX9A 5AQ1A 2IU6A 5AJWA 4M0UA 1KZGB 5KWIA 1RJWA 2V98A 3NHYA 1RI3A 3TNLA 1N78A 5LB2A 5HRAA 1XU7A 3E9DA 1FSSA 3FWPA 1O0CA 4FBLA 1G9SA 2YJZA 5D01A 5IN4A 1JKJB 3EUAA 2XB6A 6REQB 2OO3A 4F4IA 3RYCB 1RMQA 3AQ4A 2FSHA 4DREA 3OFND 4TKMA 2W7TA 4C05A 3OTOB 2E87A 1V35A 2GYYA 3NP7A 4MRVA 2WWGA 1XFDA 3GU3A 3R3XA 4D3FA 2JLXA 3EVGA 4TMZA 1E4EB 1G8MA 1RXVA 5A3VA 4QYIA 1CLUA 2A5LA 3VISA 1CUUA 2W9BA 4ZOAA 2HHHB 4RGQA 1J2YA 1JLSA 3WAJA 2V5VA 1D2CA 1EAYA 2VRWA 3LUHA 4KOEC 2YW2A 2D00A 2GKSA 4LI3X 2AGQA 3ABOB 5EGNA 1WU7A 2CHUA 2YWBA 3V46A 4R5HA 3H1PA 1XDGA 1Y1LA 2R93A 2DJ5A 2XVXA 3C1OA 3UJ6A 3GTPA 3D7LA 1J90A 1KJ9A 1UOPA 3KLPX 3DLIA 5CRIA 1X38A 4KPUA 3LBFA 1TPYA 4AKEA 3ADDA 3IH5A 1JG2A 2V7XA 2VP4A 3VPAA 5E7QA 2DR2A 2Y1XA 1JPJA 3JQ8A 3H3JA 4UXIA 4U8GA 5ARCA 3T1TA 1WQ1R 3K1AB 3ASVA 4PGGA 1OX5A 3OAAA 3LG2A 3W2TA 1CE8A 3C6YA 2WD8A 5JDCC 2YKGA 2HHJA 3AEZA 5EZQA 4EUKA 1CRZA 1Z75A 1QPZA 3Q7TA 1VE6A 2P5UA 1RLUA 4MI1A 3EC2A 5DN6A 4MX8A 3F6BX 1Y7HA 1N9ZA 2QRPA 1T4MA 2VOEA 3SHVA 1DL5A 4UZSA 4F8JA 2DUNA 3I42A 2IYTA 2BFEA 2XBLA 3LV8A 3TZEA 2H65A 1I4LD 3UHAA 1J49A 2BLNA 3V3TA 3STXA 4FS2A 4YJHA 3OJCA 3V4FA 3ZXXA 2WYVA 4DV2B 1U2DC 3L92A 4R69A 5L7WA 3HI6A 2WE7A 4KW7A 2X9VA 4RAZA 1NIPA 2BJHA 3AHFA 3GXBA 3NONA 4FOOA 2PKCA 1JR3D 2OG2A 2PH7A 5CLQA 2H7VA 4AX8A 3KZVA 5IVHA 1Z2NX 2ZTUA 4RWZA 5GOTA 4KPGA 2Q4TA 4XOUA 1NUUA 1BVRA 3LDFA 1TA8A 3W5BA 2OBMA 3L0BA 1WWKA 3S1AA 3A1TA 1X86B 3DO5A 1E66A 4Y2GA 1IBKH 1E4EA 3KEGA 2FW6A 1G6HA 1XAGA 4PZYA 1KYYA 2FLNA 4GRAA 1XRLA 2BGMA 3NV9A 3F98A 2Z5GA 2BEVB 5AK4A 4LK3A 2IZZA 1LDEA 3QFTA 3FFBA 2MCTA 4LJ7A 2X0EA 2ZR9A 1NVEA 2R86A 3KFVA 4NPAA 2EP5A 5KU1A 3FPCA 3KEFA 4YDHB 2QNBA 4KHPB 1JHQA 4A3GG 3L8EA 5FBVB 5E1OA 4ACBA 1B04A 1T26A 3ETNA 3EXFA 4BBPA 2Z6UA 1R0CA 1XTIA 1CP2A 2ZDQA 1ST2A 5BOSA 4DV3B 2G9NA 3CH5A 5JO0A 2WJ6A 5KTSA 3E7WA 4IGIA 1DQNA 1Q0PA 1QYXA 1VKOA 1Q7RA 3M9LA 4QFBA 1J07A 1J9ZA 5EVJA 4IFBA 4ND2A 4MRSA 4DQKA 1RI1A 1DC6A 1T2CA 2YFQA 4J03A 3GJ7A 2QTMA 2ADOA 4CQMB 3WNBA 4N54A 3TCXB 1JTFA 3ZOZA 1AQ6A 3GP3A 4GXQA 2R5WA 4ZAGA 3T61A 3FY4A 1ZUNB 3OVMA 4F91B 5KQMA 4XJSA 3OWXA 4ZGGA 3NXSA 3U44A 1H2EA 3PO3G 3ACDA 1NBME 1N5RA 1YT5A 1NW6A 3L93A 4HRXA 4CLEA 3AKYA 3PSAA 4LF9H 4B5LA 2BMAA 3LA8A 4KXUA 2P1DA 2G0NA 3TUIC 4PYJA 1TUEA 5DHAA 4JYBA 2GZ2A 5HGJA 3Q85A 1VYUA 3QLEA 1QJ4A 4JI1B 4DBLE 5CJJA 2OA0A 1YL6A 2P9JA 4KNVA 3W6ZA 2DH5A 3C1UA 4S1VA 4PFKA 2QMHA 3S2SA 4R83A 5JG7A 2OCKA 3HH8A 3GJRA 3SPXA 3LY8A 3U0GA 2VP0A 3HCFA 3GEHA 4EBBA 3ABIA 5ALUA 1SO8A 2GCEA 3BF8A 3CUVA 1XVVA 3TW8A 3KS9A 5FAKA 1TB4A 3D7MA 3X1DA 3HKDA 2KJQA 1AGXA 3KZ1E 3N76A 4K87A 1GKUB 2CFOA 2HDHA 3ONDA 1KFJB 1NOKA 4IDDA 2H2HA 3GOHA 2J30A 4FFBB 4KMOA 3MWGA 2P9CA 4QUIA 1FDWA 2XCQA 1WMBA 3PE6A 4QRDA 2UUAH 5FLXW 4YAGA 5FHQA 3ZHVA 4LSMA 1F8XA 1SKYB 2Z57A 3B1YA 4K6FA 5EIOA 2Z04A 3KWLA 4OVKA 3W06A 1KO1A 2GPNA 3PUIA 2Z09A 4ED3A 2DFDA 4H7FA 2B8TA 3GEEA 4M2LA 2CWWA 2JW5A 3I4MG 2JAQA 2VA2A 2KSWA 1NW8A 1T5BA 2H2IA 1PK8A 2VH5R 3EPRA 3F3KA 4RHYA 4TVBA 1FFAA 2C88A 1UPXA 1W0JD 2DHQA 2X40A 3BUSA 4JKIA 5AO9A 5ARBA 1P91A 3NJRA 3A6PC 2C9OA 4EJFA 5A03A 5ER9A 4RS3A 1M2EA 2JIOA 1JYEA 1UT5A 4AURA 4Z51A 3AINA 3KT6A 4OHMA 1TT7A 4WOJA 3VC7A 1KJIA 2H48A 1JHAA 3UOGA 4DR3B 2OD2A 1HO3A 2C4VA 3KO8A 4QODA 1OCEA 4EG8A 1C9MA 9GPBA 5JAOA 1FRZA 2WV9A 2ZBFA 1J70A 2X8LA 3PQ3A 2I7DA 4MHOA 5B4UA 2OR3A 1HH4A 3HABA 5IP5A 3WBBA 3AF0A 1ZOLA 1QX4A 3HKCA 2A3RA 3PSHA 3C3PA 2O52A 4LHZA 3U7QB 2G1AA 2COUA 5IWAB 2OCPA 1RU3A 4YRBA 3GZJA 4JQZA 5JVDF 2I2AA 5G53C 1U1DA 2O2XA 3OLCX 1VKZA 4ZZ2A 1NUPA 5ESRA 1G2WA 3VR4A 3N7AA 2OGTA 4A1FA 2WQ6A 1TF2A 1U7OA 2C84A 3FKIA 4POAA 1W0CA 1W7AA 3C39A 3GLTA 3VPBA 3Q2KA 5HCNA 2OENG 1P73A 3H2IA 4EI8A 1OC4A 3ILYA 4KK4A 1OFUX 3QVXA 4MWOA 2HJSA 3AKCA 4YJKA 2O5RA 5AVTA 2ZCUA 2PX5A 1CUVA 3DD5A 4GBED 4MMXB 3TXXA 1J0DA 2VHVA 4MVJD 4ZYZA 2GLTA 1WXFA 2VSQA 5KOHB 5CT5A 2HCBA 2IA5A 4FHFA 4UU1A 4HXFB 5BYKA 2IELA 5LU9A 1G291 1W75A 2VPYA 3WICA 1UODA 3FDFA 1CJUC 3GRZA 3LL4A 1AKQA 2EDCA 4V0RA 1MAAA 1W5EA 1ZRNA 1KUTA 1R37A 2M6RA 2ZANA 4H6PA 5I7WA 3IRUA 1DO2A 2Z56A 4FMDF 3HDJA 3HRHA 2F43A 1F8YA 3U3ZA 4RTPA 4JLDA 4FI3C 3C3EA 1VYTA 3DZKA 4MQ4A 4DIKA 2OAP1 1BHSA 3IP8A 5JEDA 1L7MA 1LSOA 3D7KA 5HKLA 2IZ6A 4BX0A 1HWYA 3L7AA 2C9DA 1K7FB 4NFLA 2OEPA 3I53A 5BY2A 5HX7A 3C5VA 3PIIA 5IFKA 4WESB 1IEVA 2BPOA 3GARA 4YCAA 4W1RA 5C32A 4MOWA 4U3JA 4RA6A 2G8NA 1LBTA 2WTFA 4UCXA 3DDNA 5FI3A 3WWIA 3OUTA 5IJAA 2CF6A 4M8LA 1GU0A 3TTYA 3M3PA 3OF2A 3PNBA 4IJWA 3TSCA 1JEQB 3WQBA 1PVOA 3TFWA 1HQYE 2Z95A 3RU7A 3HXMA 5CUQA 4GM4A 4HNAB 3IDAA 4F6LA 2H17A 5A9SA 3T9AA 4AJPA 1N2JA 1MXFA 1TQ8A 3QU9A 4S12A 4Q9LA 1NVVQ 2F64A 4BAZA 2O14A 4KE7A 3AFHA 4WH0A 1E0SA 4E7PA 2HXYA 3LQRA 3JR7A 1X13A 1XJCA 2CL6X 3H1FA 2YXEA 1HT2E 3MWEA 3OM8A 3AHDA 1N0VC 4G1FA 3SBXA 2AV6A 2Y1GA 4JI1H 3IDZA 3NIWA 2ODWA 5CM8B 2QI9F 1DFHA 4K9PA 1M83A 3T1HB 4PYNA 4FBMA 4EI9A 2P6RA 1M2HA 2ZYRA 3D9QX 3AWIA 4X5OA 4G89A 5K6AA 2J46A