1B6RA

N5-carboxyaminoimidazole ribonucleotide synthetase from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
355
structure length
349
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
publication title Three-dimensional structure of N5-carboxyaminoimidazole ribonucleotide synthetase: a member of the ATP grasp protein superfamily.
pubmed doi rcsb
total genus 106
structure length 349
sequence length 355
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 1999-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1b6rA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1b6rA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b6rA01
2W6PA 1VKZA 4FFOA 1JLLB 2GQRA 4XYLB 1JDBB 2CZGA 4HR7A 2XD4A 4EABA 4FFMA 2DLNA 3K5HA 4I55F 4FE2A 2YZMA 4EA9A 1JKJB 3TINA 2NU9B 3N8DA 4O86A 2C00A 3E5NA 2GPWA 4FFPA 3VA7A 4TV9F 3AW8A 1EZ1A 2YRWA 1Z2PX 4RZQA 4XX0B 1KJIA 1GSHA 3OUZA 2YRXA 2W71A 1T36A 2R7KA 4O82A 1CQIB 3LWBA 3R5XA 2GLTA 1VBGA 5I47A 1C3OA 3BSWA 2FP4B 3JRXA 3VPDA 4O4JF 4FU0A 2ZDHA 3ORRA 2CNVA 3GLKA 5LP6F 4HNTA 3VPCA 4YJ2F 2J9GA 5JQWA 2R85A 1IOWA 2X0SA 1IOVA 4O2AF 4L1KA 2W6MA 4O83A 5J2TF 2W6ZA 1A48A 3R5FA 3TIGA 1A9XA 4EA8A 2HJWA 4MAMA 2Z02A 2YS6A 4MA0A 4NYEA 2GQSA 2VQDA 2Z04A 4WD3A 4MV6A 2R7LA 3U9TA 4O7ZA 3WO0A 5EZYF 4YAJB 2VR1A 1KBLA 2NUAB 4ZHQF 1W96A 2I80A 3UFXB 4IWXA 5CB4F 3VPBA 4XZ3B 4Y8VB 1GLVA 4O4LF 3Q2OA 1KJ9A 2YZLA 3U9SA 4O84A 2YWVA 4EAAA 1M0TA 3MWDA 4IWYA 4I50F 5LA6F 3BG5A 4TV8F 2ZDQA 2V5AA 3TQTA 2SCUB 2YZNA 4ME6A 1JDEA 2R6FA 4O7SA 1I7LA 1CS0A 1BXRA 5HV6A 4FFLA 1WR2A 3JZIA 4MV8A 4MA5A 4HNUA 4O7LA 5JH7F 1CQJB 5GONF 3R9RA 4DIMA 2YL2A 4E4TA 3V4ZA 4DLKA 1M0WA 1VBHA 4C5BA 1Z2NX 3VMMA 2W6NA 2CNQA 2R7NA 4IZOA 3HO8A 4ZI7F 3ETJA 2I8CA 1AUXA 3TIIA 1EYZA 5J2UF 4M9UA 5LXTF 3JRWA 1B6RA 4YJ3F 4HQ6A 5D8DA 4YBZB 3ETHA 4J6EA 4IHJF 4EA7A 5BPFA 4MV7A 5FNVF 4C5CA 2PN1A 1BNCA 4MV9A 1OBDA 3ORQA 2VPQA 3K3PA 3KREA 3QFFA 1CE8A 4ZOLF 4ZQIA 2CQYA 4XYMB 5K2MA 2W70A 1EUCB 4MV3A 4C5AA 2DIKA 3MWEA 4O7TA 1UC9A 2R7MA 4MV4A 5DMXA 4EGQA 5CA0F 2CNUA 1KEEA 3RV3A 4M9CA 3G8DA 3U55A 2YS7A 2R87A 2W6OA 2PBZA 4O7VA 4I4TF 2YYAA 5C1PA 1OBGA 2FPPB 3Q1KA 2DZDA 5LOVF 2OLSA 2YW2A 2GPSA 3I12A 2NU8B 2R84A 2ZDGA 4MV1A 1PK8A 1DV2A 4QSHA 5JVLA 3BSSA 1EUDB 1PX2A 2HGSA 5LYJF 4FFNA 1DIKA 3R5HA 3VOTA 4O4IF 1KUTA 4FGRA 3N6RA 3OUUA 2NU6B 3HBLA 2QK4A 3K5IA 5C1OA 4O81A 5JVDF 1KC7A 1E4EB 1GGOA 4O7WA 1W93A 3HB9A 1KJJA 4M99A 3KALA 4EGJA 2R82A 3RUPA 2NPOA 3JZFA 5JQGF 4GGMX 4O7RA 4HNVA 5C8YF 3NUAA 4O7YA 4O2BF 3WO1A 5CAEB 4TUYF 3BFPA 1DV1A 1C30A 2VHEA 4YB8B 2R86A 2FPGB 1ULZA 4O7NA 2P0AA 3U54A 3DF7A 2XCLA 3G8CA 1GSOA 3SE7A 5KKNB 1B6SA 2I87A 1UC8A 1M6VA 2WYOA 3MJFA 1Z2OX 3RFCA 2NU7B 1GSAA 4IIJF 1SCUB 4FFRA 2QF7A 3V4SA 3GIDA 4WBNF 1EHIA 2FPIB 3LP8A 3AX6A 2DWCA 2IP4A 2PVPA 4O4HF 1E4EA 1KJQA 2YZGA 4EG0A 5HBRB 5CA1F 3RV4A 1KJ8A 3TW6A 2FB9A 4YAKB 4M98A 1I7NA 5IYZF 1AUVA 2V58A 3KAKA 5H80A 3BSYA 3WNZA 2V59A 2W6QA 3R23A 5BPHA 5KX5F 3KAJA 5BMVF
chains in the Genus database with same CATH superfamily
1RAAA 1P3Y1 3BF8A 2GAIA 5FWYB 1PDVA 1R6TA 1KZHA 1E1KA 5DGAA 1KJZA 2X0KA 2NSLA 3AR9A 3PGJA 4PSKA 5DLPA 2TMGA 3VVLA 4HATA 3S70A 3R24A 4XUGB 1M7GA 2P6NA 1NNUA 2NADA 2PT6A 4ARCA 4CCAA 3LXUX 4UBOA 4DBLE 3B36A 3AYXB 3NRCA 4JC4A 1RAEA 5ENZA 3KWFA 1P73A 3CPSA 4F92B 5I45A 4IMIB 1LPBB 2A1TS 4OX9Y 4DT1A 2OZKA 5HK8A 4BLUA 1Z06A 4NZZA 5BT9A 5AI9A 2XQJA 3KOZA 3EA4A 3BPSA 3TTXA 3ISVA 1THMA 3HDTA 3IC5A 1F2TA 4B32A 2GFQA 1JKJA 3IQXA 5LR6A 2Z04A 4URFA 1XMXA 3UATA 4I6GA 3R8FA 3WO0A 4M1EA 2OVFA 3BXFA 3GRAA 2C88A 3E1SA 4GC5A 4YR0A 3KSUA 5CDUA 5AQ1A 3IV7A 2F9LA 1MOSA 3LQ2A 3W5BA 4I8DA 3C97A 5DXJA 1M0TA 1JAIA 2W58A 3VSBA 1UJ4A 4D9EA 1EAMA 4N6NA 2ZB7A 1JPNA 4Y1RA 2GZAA 3P4YA 1M83A 4QXOA 2PAAA 5KTRA 1YC2A 2P4QA 5JJIA 2C97A 3DWEX 1D04A 4NECA 4RSMA 4F84A 4CCWA 4DIEA 2C3MA 2ERXA 1K27A 2R7NA 2X8JA 4IZOA 2CUKA 3EGXA 3T0GA 5KNDH 4CLEA 4M1QA 1DI0A 5DISB 1CRZA 4G84A 3Q5DA 3BACA 1YS2X 1YD7A 5I48A 1CRQA 2OD9A 4HRAA 1TEZA 4BNDB 4NQZA 3DDCA 3CX8A 3W04A 4JVSB 4WXHA 2SCUA 2RG7A 2WW8A 3D8BA 4K8OA 1TT5A 1F4VA 1T9GS 1UPUA 3HRIA 5L8VA 3TLCA 1PVDA 4CGYA 2A5YB 5JO0A 3IRUA 4OXNA 4XYGA 4WUTA 4ZOLA 2FQQA 5H7XA 1BXGB 3OTQA 3WS7A 5HZHA 1KWGA 3ET5A 1XZFA 2FFQA 3MR2A 3PSHA 5BWLA 5TPZD 1ZO8A 2Z58A 1I1NA 2YWCA 3TZKA 3IJRA 3UCEA 5L95A 1BMFD 4JBNA 1I7DA 3JQQA 2P2GA 1G4UR 2BTOA 4DLYA 4Y9SA 1GPYA 3E23A 1KY3A 4YWHA 4ZQBA 3O92A 2NPIA 3E53A 3QVGB 3VHQA 3RO7A 2X5XA 3GEMA 3IJPA 3IAXA 4EQ5A 2C99A 2C7QA 2VJLA 3FSJX 1S9FA 5C2JB 1IFXA 2EJWA 1WUIS 1K4MA 4HGOA 3CSUA 5TQJA 2B5OA 3VZPA 3CKYA 1KMMA 5BW4A 2CMKA 4WZBB 4PPNA 1IY9A 3SE7A 3KPYA 3W6OA 4CLXA 2FA9A 3KR2A 5FP0A 2HQRA 3MJFA 5FLXA 2XI4A 4M1WA 2W8ZA 1KVTA 1XLTA 1MW9X 2WUDA 3TQSA 4I55B 1Y8ZA 2ZAYA 1TA0A 4UBKA 2BBOA 2XQVA 4LF9H 3AY7A 3KTDA 4KE6A 4EWLA 4X66H 1R0KA 5C4XG 4UBIA 2X15A 4MDEA 4TT3D 2ABJA 1JAYA 4CKBB 2W0MA 2P9FA 3KNZA 2AWOA 4PC1A 3NONA 4Q05A 3BZBA 3PL1A 2WU3A 2OOKA 4C87A 1XMJA 2AMFA 4YHHB 3HSSA 2Y0CA 1EZZA 2QROA 5T67A 2CDRA 4OI0A 3VJLA 2AC4A 4NK5A 1CRLA 3PKJA 2PA3A 1EFLA 3KHGA 4YCDA 3TVTA 1SPXA 3I32A 3DO6A 1ZNXA 3GJ4A 4LMPA 5ALTA 2DLDA 5AM2A 3T7JA 2VDVE 1P72A 1BGVA 3ZOZA 3GLKA 4RMJA 2FLLA 3C3PA 1RE1A 5JQWA 1ZY2A 5BMVB 1IOWA 1DKMA 2BI7A 2PVCA 3VTKA 4FHFA 1G3QA 4BZXA 3I8OA 3HFRA 2C3PA 4A2CA 1PT6A 2IOFK 3HXMA 3MINA 3CZAA 3FPSA 4RXTA 1MA3A 3I9NA 3KZKA 1DWQA 1RADA 4WXPA 3IUMA 3L1JA 3N59A 4ZRMA 1W96A 1YI0A 1KE1A 2YVQA 3VZSA 1MGPA 1NNEA 4UAJA 2FQWA 3VKUA 2NIPA 1Z5VA 3ZVLA 1DLJA 3WWHA 3EISA 4JI3H 5DW3A 3L77A 4M6WB 4LUCA 2A1TR 2XXBA 3DOEA 1N2GA 1G98A 2QD1A 2BMDA 5IUKC 3KSAC 2YMMA 3V42A 3M0EA 1K92A 3OQIB 4DIMA 3N0WA 1W6RA 5KU7A 5AICA 4PQYA 1EE9A 4MVJF 3K5PA 3CR7A 1T3TA 5JCXA 4MS1B 2WIFA 2ZSJA 3KS9A 3PE4A 2OXEA 4TSFD 3GAFA 4YAJA 4CF4A 1Q21A 2OBNA 1NOJA 4YBZB 1X19A 5H82A 2QKYA 3HFGA 1CUEA 4F2DA 1WBJB 1NBME 4GHWA 3H7IA 2IZOA 2I2FA 2VJQA 3WQSB 1FY2A 3HN2A 2QL6A 4JIGA 4RPIA 4NBNA 3GD5A 2GJ8A 4JLBA 4CMBA 2IUUA 4OHYA 1R0BA 4BXOA 3B3AA 3ZGYA 5IC6A 2A35A 1DS6A 3HRHA 2ZLBA 2QT9A 5DNVA 2BBWA 4YI3A 3MTIA 1L5ZA 2XCOA 5DRYA 4P82A 1XMOH 2AX4A 1KY4A 5I7FA 3M9WA 3ZV7A 1A4RA 2YWHA 2MR6A 1VKJA 3BX1A 3W7BA 1AS2A 2O2IA 4IKOA 4JLPA 4JXUA 2VO1A 3P32A 3PDCA 3N6RA 4KYTA 4CM1A 2PSJA 3EC7A 4Q02A 4TV8A 2FPWA 3UPUA 3OESA 1G8KA 4UTPA 3RRYA 3E9YA 1S0NA 5AI4A 4XDZA 1T9GR 4LGVA 1ZIPA 4F4YA 3ZGNA 4BPRA 4BE7B 4Q1BA 1UK6A 3VPAA 1IYZA 4UKDA 3P94A 3HDYA 4I9UA 5CD1A 4XCQA 1E9EA 1N0HA 2AB0A 2WJ4A 1FNSA 4DWVA 1B73A 1GZHB 1U3UA 1TK3A 2TYSB 3O21A 4IINA 4LWOA 2ST1A 1U28C 4BP1A 2NSYA 3WQRA 3FMIA 1NR1A 2GZ2A 2QU8A 4FMCB 2D5IA 1T6BY 3MAGA 3INYA 3X1MA 3PXEA 4BDSA 2UXDB 4FDUA 1T0HB 2OV3A 4HL6A 5K5EA 5DTEA 1E3WB 3HT5A 2WSMA 1WXEA 5I9SA 1WSDA 4U1RA 2W2KB 2QTTA 2IA6A 2Q62A 1EDEA 4U2EA 4XI9A 3S2UA 4PIMA 4D46A 3Q3IA 2NAFA 1NONA 5DNCA 4KMSA 1EVEA 4TRRA 2QN9A 5GM2A 1D1QA 1ISPA 2GTHA 5BSWA 2NZ2A 5IJZA 4Y6RA 1RWOA 3R9WA 3QXJA 4ZTZB 1NW9B 3DGFC 3NWJA 4XPIB 4XD7A 2YFKA 1KWKA 4RPJA 4AO6A 1JHUA 3T7CA 4ZOAA 4RKEA 1OH7A 4XR4A 4LX0A 3N0VA 3IRVA 1APBA 2EWVA 4HF7A 4D74A 1FDOA 3DV0B 4QXPA 1Z38A 5BYKA 3DBVO 4GWKA 3A4IA 5CH3A 3EIWA 3OURA 1R4AA 2WDTA 4FU0A 3K72B 1U80A 3RKUA 5DHUA 2EL9A 2X58A 2XYQA 1KH2A 4DCNA 1I1QB 3LOPA 1IHXA 1MRZA 3K53A 4AAYA 4QWEA 4MAMA 3UQ8A 3UHOA 2FZEA 4ZC8A 2VDRB 4MUMA 4OGGA 1P6UA 2XUJA 4X1YA 1LI5A 4Y30A 2FOXA 3JQDA 3CLRD 4WESA 4IEIA 4PZPA 4N0EA 3VDRA 2E55A 3DL0A 3OX4A 4CMJA 2H2HA 4P98A 1D0VA 2FXIA 4O4JB 5GV7A 3GT7A 2WD7B 1DT5A 3M4XA 1QQ7A 4P31A 3EBOA 3UJ6A 1N7JA 4R40A 1RTTA 1Z0SA 3ESYA 4KCGA 1S9DA 4IW3B 5B1SA 3RS3A 1V39A 1ZGHA 4F72A 3IJ5A 4QBGB 1II8A 4OB8A 2XTZA 3WA6A 3VR6H 2J3DA 4O4LB 1VSUA 4NS1A 4DLSA 2OHXA 3TUZC 4FS8A 5KJ6A 5LP6A 1N5KA 2O8CB 3EVCA 4U6NA 4AY2A 3NWBA 1FPQA 4D4GA 1RBZA 3UXMA 2DUNA 4HXEB 3ZUGA 2BE7A 4YRAA 2XC9A 4BN4A 2FWAA 3A6ZA 4Q7KA 5JASA 4GX2A 1JU3A 4J1TC 2C4NA 4R1MA 4DV5H 4UUQA 3VXKA 1PN3A 1UKZA 3TOXA 5A4KA 1A8UA 4N3AA 4KODA 1PK9A 1MQAA 5A71A 2YXBA 4GM1A 3I37X 1OV6A 3F2IA 3AFIA 2ACVA 4ZDKA 2A4KA 2XZDA 4KUGA 2QTFA 2F17A 1ZMOA 1YHZA 2YZ2A 5CHYA 1R4ZA 2ZGVA 2RGUA 1TQ8A 2V3CC 1J24A 3DR3A 2BAGA 2PSHA 2XBMA 5EQTA 4R0MA 1NLUA 3IE1A 4E03A 3SC3A 3LO8A 5DP2A 1CJKC 3NYQA 1D0IA 2UZ4A 1GKYA 3G02A 2JGDB 3CT4A 1RABA 4EI7A 3GOHA 3EODA 1NF3A 5L7TA 3IT1A 3KTFA 4JI4B 3UICA 1JG2A 1ZICA 1BHSA 4DUGA 3M9OB 3ANYB 3BIXA 1Z88A 4JA0A 3NHBA 3MQ4A 1Y8AA 3UVEA 1X7DA 1TI7A 4EBCA 1YL6A 4W9RA 4B3DA 5DNYB 2I55A 3G17A 4AZWA 5G1PA 5T41A 3NDBB 3LOQA 1AUVA 4ID9A 1CF2O 3SS9X 5A3RA 2I33A 3GIPA 1GKLA 3U4HA 2JLRA 5L4NA 1MJGA 1T5HX 4MGYR 1C41A 3FTEA 4DIKA 3ND9A 1F5SA 2OV4A 1N77A 3N9IA 3AXTA 1J0EA 5BWMA 3DLAA 4KLNA 4MVCA 4QULA 2GETA 3HBAA 2QQEA 2J85A 1VL6A 1LBTA 2YZMA 3FETA 4R84A 5JAHA 3CG0A 4DIBA 2PD6A 3K70B 1M2WA 5C7OO 2GPWA 2XZOA 3ROEA 1J7JA 4CQNA 2AVDA 4B6JA 2JW5A 1G18A 5JCOA 3GQCA 4FSDA 2O1SA 2JBHA 5LZ4A 2HDNB 1VE6A 5JNTA 4HO1X 1ZGZA 1P2VA 3A1UA 2VUMA 5FLMG 3EXHA 3SI7A 2YXEA 1RWKA 3SYKA 1VDMA 5C8YA 4OSEA 2DY1A 4HRYA 1EJ6A 4AS3A 2X0SA 4EL5A 1S03G 2WUVA 4JOCA 3E4DA 2EKPA 3K0FA 3QZ7A 4Y1FA 1P1KA 2DUUA 3HJCA 1NW4A 1CWUA 3GJ7A 4OMDA 1Z63A 3UYKA 4ZI5A 3FY4A 4H0FA 2BFDA 3HYLA 2WWYA 5CXUA 5CXQA 1Z4QA 3TKYA 5EWGA 1KSHA 3GGSA 5IYCG 1M6HA 3O94A 1QPGA 3KEGA 2VUHB 4B81A 3HCPA 4I19A 1Y9DA 1CUSA 1SJ9A 2XHEA 1WD5A 1UH5A 5F33A 2PX8A 4TV8F 3OZCA 4RX1A 1X2EA 2QX6A 2WQ7A 1H4TA 5AQEA 5LQRA 3IERA 3S7TA 5KQPA 4EG4A 4EHLA 2WWFA 2VJCA 4AM8A 5IBRA 3P4UA 3E81A 3IR5A 3H17A 4MKFA 1V4BA 1SHKA 2WC1A 4L8VA 1O57A 1HZZA 1KYQA 8AT1A 1SUEA 2NO1A 3TY9A 1KAMA 3RB8A 1VG0B 4HADA 2Y4NA 3QTLA 3M2TA 3RAFC 2LUOA 4ZI7F 1NNSA 4KITB 2GHTA 3VKVA 4DBZA 3CRRA 1OH5A 5CFLA 2VHCA 2UZIR 5KQSA 3EQ6A 4FB4A 4QJIA 2AKEA 3PWTA 1PZXA 4U8GA 2BFAA 4FSXA 2QB5A 1G6HA 3F1LA 1FQOA 4MKHA 3RJTA 5E7JA 1Y8QA 3FHLA 3D1JA 3F46A 4M8SA 2F8LA 4BVKA 1UDAA 4AJHA 2GPYA 2A5FA 5IJWA 1W25A 1RDFA 1CX9B 3FPBA 4A27A 4RSHA 4LZAA 3FSGD 1GXSB 4GS5A 1CUXA 1A9ZA 3VU9A 3RROA 3GPBA 3UUEA 4XQ9A 4CLHA 3IIKA 3IVGA 1GQSA 1MABA 4A91A 4ZAGA 3DTVA 4KACA 1KUTA 4I5EA 4G1UC 2BIFA 1T8YA 2WAAA 5KYYA 3L8GA 1OIXA 3BAZA 1XVLA 4UCWA 5FOWA 4HK4A 1JQDA 4G86A 2QGZA 3EPJA 2RSLA 1VJCA 4LF8H 4I8XA 5HKAA 3L0YA 2CYCA 1FNCA 4K6HA 2O8EA 1CSEE 4NZPA 1QGAA 3IBSA 4GOOD 3GFVA 1UXJA 4BVJA 2HLNA 2VLBA 1HNXB 2CLMB 1GL9B 4MQUA 3K0CA 4UPVA 3EIXA 5DZSA 1UOEA 4UEKA 4FHGA 5CLHA 4US1R 3ZIUA 2OXFA 2O2XA 3H9EO 2F62A 3THSA 1CETA 1GEEA 2QSUA 5IJ9A 1JHXA 2PIDA 2EV9A 4DLLA 1IXZA 1H3FA 4D6YA 5BVGB 3KXPA 1J9EA 5DO9A 3LQ4A 3GPDG 2CJWA 5THQA 4JI7B 3WZLA 1UPAA 3PCTA 2FK8A 1RMTA 1P9RA 1HKHA 3TLYA 3MF4A 3TBKA 1NYLA 4PVDA 3W9BA 3I23A 2ZR9A 2IPOA 3VI4B 2QYZA 2XA9A 1U7PA 4ZVPA 4BO7A 4BYMA 4DL6A 2CUZA 1O97C 1QTNA 3DF9A 2D2IA 3GMIA 4R1OA 3D8SA 2VJKA 4XM2A 1TIPA 4KXNA 3EUAA 4WERA 1GPMA 4NESA 3IPYA 5LLTA 3VVCA 1VBNA 2I4MA 4UHBA 3MSXA 1YUNA 1G59A 3K7EA 4KNYA 5TJHA 1ITZA 2IOHA 3CJTA 5LP6F 1M67A 5DNAA 3I58A 4JYAB 3NCTA 1Z9BA 2JJ1A 4KR6A 4KW7A 4ENRA 2B98A 4O83A 3KEMA 1UWKA 1KH1A 4ZGWA 3T5PA 2ZWPA 4BO2A 1Z13A 4DLPA 1Q95A 2W5UA 4AZ0B 3JV7A 2QG9A 2DHQA 4GF5A 3NC1C 3VOBA 4I1IA 3BK7A 4RJ2A 1T4MA 3W9SA 4L3OA 2HSWA 3MJHA 4FIDA 5ADHA 5ALSA 3OT1B 1ZHQA 3ZHSA 2OZPA 4JQYA 5EA2A 1X1TA 1GCGA 2NZXA 4UQOA 1UKEA 1EWYA 5TF4A 1PQPA 1P9LA 1KR5A 5L1JA 5CDHA 4X60A 4C0BA 3B2NA 3RVDA 2I7VA 4CNQA 1KDPA 4DLAA 1HOTA 5LP1A 1XWIA 1H1LA 3RPEA 4QG7A 4B3XA 4MB0A 1HUQA 1O9BA 3JR7A 2BFBB 5CA0B 1OLSA 4WHMA 2QPAA 4DCJA 3QX9A 5C8ZA 1BE6A 2IITA 4D6XA 2IHYA 5DNEA 4G0UA 2Q3FA 1KMHB 4PAMA 2X9LA 3OBIA 2D3WA 2ZXFA 2Q5QA 1ZHHA 2GPTA 2ZVPX 3KFLA 4MMZB 2AF4C 4FBUA 4FQ7A 4IDEA 5BSHA 3GJ6A 2OQ2A 4ZU1X 4BO3A 4IJ6A 5K0FA 2CDNA 2WF7A 2XDAA 5FEMA 4LXIA 4ER7A 4FOPA 4YJ3A 2KE5A 1P4HA 3IP1A 4UAUA 3IE2A 4DWJA 1F7UA 2W70A 2HF7A 3IEUA 1F14A 1FP6A 3BH0A 2DIKA 5K4GA 1CEQA 5G4KA 4GRAA 3L0BA 1OLXB 1E2GA 5DMXA 1ZIDA 4IZ6A 1UBTS 3P9ZA 4O29A 4NMHA 1C7IA 1E61A 1BMQA 3ROFA 4U63A 1OMOA 1OFGA 1LBEA 5FXMA 3ENVA 4BLVA 5CH8A 5EOYA 2VDNB 4LXYA 1GTL1 1TAQA 4DM3A 3JAMA 2ZPTX 3I83A 1SIOA 4OX9B 2RGDA 4QIWE 2R6GA 3N44B 5B5SA 3BFKA 4L95C 2YMPA 1U0GA 3EUWA 3KJXA 2H51A 2ZYAA 4PG4A 4DV7H 1NBEA 2FZLA 2IUEA 5E7IA 3DS8A 3P2MA 3VKGA 5H4GA 2RGNC 3NHMA 5HP4A 1MTZA 2A0UA 2UXBH 1X13A 2J5QA 4BC0A 4NBRA 3VNNA 1RWQA 3V9PA 3TSOA 4QU0A 3RUPA 4JUFA 2WTNA 4MGIR 4KK3A 5C8YF 2P9EA 4MWOA 4B87A 4KSBA 2FV8A 1N2HA 3RVLA 2GJKA 1SR8A 4XJXA 4Q1CA 3KOWA 3DT8A 1Y7PA 3FAKA 5HW0A 2IX9A 3O4JA 4F91B 5K8JB 2V3WA 3DEKA 4O08A 2AOUB 1DHTA 3QELB 2BUAA 2IL1A 2ZIFA 3RC9A 4ZOEA 1ACJA 3GCXA 5MDHA 5JYCA 4NZNA 4FK8A 1K63A 5C7LO 1BU5A 2J41A 5BWXA 2ZU6A 4O5AA 1LPNA 2R8RA 4R0NA 4CG3A 3RTEA 1BE0A 4O0LA 4MGEA 3KAKA 4M89A 5AKKA 5EPEA 1KT8A 2R9VA 1NMYA 1FRVA 3H4MA 4YCAA 1RZRD 4BEBA 5KNBD 4PLVA 2CHEA 3GG2A 4PIVA 2VQ3A 3L79A 3V8PA 3D3QA 4KLRA 2G08A 4BO5A 2JGLA 4PTYA 4RB2C 2P3QA 4GUAA 2KHZA 1R7RA 4CTNA 2GNAA 4AP5A 2DSNA 4N7JA 3FA2A 3GMSA 4FLEA 3B7WA 4II3A 4FEGA 2I6UA 2GQ0A 1ZISA 2H2DA 3DE2X 4S05A 1LWOA 4NOLA 1J8DA 2ZCVA 1KHHA 3AR6A 2P1RA 3V4OA 3N2IA 4A6EA 3ZY6A 1EZ4A 3DTYA 1ZD3A 2ZQYA 3OTOH 2OGTA 1DEOA 1LKZA 3AETA 4JZYA 2CNVA 4ZVNA 5CVJA 2FMXA 1VRWA 3Q6NA 1RIIA 3QWHA 5K8UA 1F2UA 2AEEA 4G85A 3MA0A 4P58A 2Z3VA 3OC6A 4EEZA 2XE8A 3EQ9A 3Q9NA 1AV6A 5KSYA 4OYHA 1E9VA 2ZB8A 3PHIA 1TTPB 4JODA 1K4KA 1SBNE 4GZ6A 3G5UA 4YREA 4TS4A 1YZVA 1C9EA 1MZVA 4IO0A 3TLGA 1K1QA 5M3BA 3V8EA 5LFAA 3E5HA 4D8XA 2WIBA 1VPWA 1R4MB 2ZTHA 5CFOA 1L7DA 2DH6A 4C7JA 4C6TA 4K0RA 4G0QA 3O8BA 4BNMA 1REQA 4GQBA 4FCVA 5AVSA 3L8EA 3RRMA 1KEVA 2IHNA 1OGIA 1D2GA 2XT9A 5F7ZA 1N9GA 2X2PA 3H2JA 1RRMA 4BP3A 3C1UA 1QRSA 2X4GA 4JV1A 3PENA 5TB5A 1FOEB 1ODIA 1HETA 1H2EA 1AUOA 2VK4A 5TC4A 1ORTA 1TMOA 1KARA 4JLKA 3Q15C 4DQLA 1E6KA 3PNBA 2I1VB 1B0ZA 2OECA 1U7UA 5F78A 4MCHA 1E18A 5AKGA 1P31A 1K8RA 2VPPA 3MW8A 1Q3TA 2Y1OA 2Y9PB 3BSFA 2MMGA 1FYXA 1P2TA 1YJCA 4TN5A 2HLDD 3ONEA 2AZ4A 5BN4B 3G89A 5AVQA 4AUNA 3OOWA 2FF7A 1D4ZA 2WIAA 4RGVA 3OOSA 5IVKA 4EELA 3MMNA 4LZZA 1NF9A 1YCHA 4HDMB 3RUCA 1MIOB 1NRIA 1R9NA 3B7GA 3R0JA 3STXA 1OAAA 2ZYUX 3KQMA 2HEGA 5LWHA 3V33A 2FJPA 1UKYA 1Z2CA 2BM8A 3BWDD 3QKSB 2E4UA 4Z51A 4QFBA 3VOTA 3KHSA 1VL8A 5E1MA 1PR6A 5DBOA 2GK4A 1XYYA 1TF2A 3IUJA 3WBKA 3K2IA 3CNHA 2BSAA 4KXQA 4K6OA 4I1SA 2IYAA 3GRUA 3WDMA 4R5HA 2FKLA 2CHGA 2QG6A 3S68A 1HF3A 4P4UA 1BQEA 4LKRA 2JS7A 4YDQA 4CCYB 4TWRA 5D2CA 3SSOA 2NPOA 4X0EA 1VHTA 3H6HA 3KC2A 2M6SA 2VHEA 4BQFA 3NMUF 4BNFA 3EK2A 4IPTA 3AUXA 3GLFB 4P1ZA 4JJEA 5L53A 3CSDA 3ASUA 3LP6A 2ENUA 3ABQB 1TKAA 5A02A 8ADHA 3EGDA 2OA0A 5KJCA 5CYGA 2ATCA 1H2BA 3BWYA 4XCXA 4D5EA 5FL7A 2ZVJA 1A7KA 1HE5A 2LPMA 4DCMA 2B8JA 1QIEA 1Q7RA 4HWSA 3RV4A 1W85B 3ADDA 1KJ8A 1A0GA 4JWTA 5AKYA 1OX6A 4YUVA 1RHQA 3C4JA 2V58A 5I6DA 4GKKB 4LZPA 1Z2AA 5I7UA 5KFLA 1DXOA 4UBLA 4YO7A 1M1YA 2BGTA 5D01A 5EXSA 2Y1WA 5D7BA 1W5FA 3LC2O 2N1BA 1GNQA 3T9FA 4J90A 3G2JA 4NNJA 1C3JA 5A9TA 3G7UA 5HCNA 2R6JA 4XH9B 1T3ZA 2ZI4A 2C96A 1P0PA 1JIIA 4PY2A 2AGOA 3DULA 3U3OA 4A2QA 5FPPA 3FBGA 4EHFA 4Q3KA 2FPIA 4OQ4A 3HMKA 621PA 2ARKA 3JZ6A 1I7PA 1XTZA 2GLTA 1N3YA 4LYFA 3L4BA 1MX3A 1SY7A 3CLVA 3T5HA 3RIXA 2DPLA 4R2HA 2JFQA 3CM0A 1E99A 4PLYA 2WKQA 1L3CA 4L72A 1C0LA 3O38A 2OBBA 5G40A 3FNQA 1N7HA 2YDYA 2DY0A 4C7MA 4B8YA 4EPRA 4NYEA 5EWLB 2G09A 4B17A 4NULA 1R3UA 2CXQA 2RKBA 1QGZA 3UZUA 3IKLA 2V1XA 4JBHA 1V35A 1YMUA 1DKUA 1R9MA 1NQTA 1B1AA 4L4UA 1ZGBA 2FUG6 2X19A 3QUCA 5H0IA 2XVMA 1OHHA 5FJJA 1SM4A 4P33A 2ZJ0A 3IBYA 2J5RA 3ZI7A 2H57A 2PT9A 5LDGA 1DBWA 3PYLA 6CHYA 2F3QA 3D4PA 1DWUA 1M10A 3SQNA 4KPFC 3WRXA 4MQLA 1LK7A 4KXUA 2W2OA 5GM1A 2CY0A 4PCVA 4G0MA 5JADA 1KMIY 1UP6A 1DQYA 3IIEA 1HFWA 4DL9A 2JLSA 4EP1A 3NM4A 4ZWNA 3DZ8A 3QOWA 4N6OA 3WK5A 4HDAA 4PSVA 4JYMA 4QREA 3Q2KA 4IIBA 1RBYA 2VDWB 3ECCA 3VO8A 2YXLA 2X1LA 4TL8A 1CE8A 2X1VA 4BGDA 2CFIA 2AZXA 4EUFA 3THXB 2NVUA 1K7EB 1OAKA 1GRRA 1ZN9A 1C4XA 1SOMA 3MWEA 2IQ5A 4KDEA 1GDDA 5KWJA 5LD2B 1NMZA 4ESHA 2PJZA 1A4UA 4WASA 3PVZA 2GD1O 3QEAZ 4UBNA 4D0GA 1V4VA 4DR2B 1ZIYA 3AINA 3G85A 2H29A 3EZNA 5C81A 3OHPA 1QYRA 1LDEA 4K26A 1HFKA 2EFJA 4TVOA 5JALA 3T94A 4CDGA 1KRWA 1N2SA 1LBHA 1C50A 4CETA 3ETEA 2YHUA 1ZVVA 3GJTA 1WVMA 3B52X 4QJ5A 3VX3A 5KTTA 2V9PA 4FDTA 3T3HA 2XITA 1TX4B 1PVVA 2P62A 4PFQA 1AN7A 2VJMB 1N9ZA 3BFVA 2X42A 3TRHA 1DAMA 4D26A 2ACEA 2X3YA 4JJIA 3JAWB 5FTWA 1HLDA 3JX9A 3M3DA 4MPRA 3A04A 4MA4A 4CU5A 3OP4A 4OG2A 2VUSA 1RXUA 4R8UB 3MRXA 3GEBA 3RBVA 3UT0A 4ZCLA 4RMHA 2GEJA 4PX9A 2WEKA 4BE4A 2ISCA 4FFRA 3P4XA 1Q14A 3HRKA 4KRGA 2CN1A 1ZEMA 1CQZA 3IHTA 5I7RA 4FWIB 5ESWA 4MZDA 5JAIA 2C7GA 3OA0A 1Y81A 3Q9LA 5ALQA 1CUWA 1KU6A 3AGQA 4YMWA 2B34A 1P1RA 4EB6A 3O26A 4NE7A 2W48A 2EJTA 2R8OA 4KXVA 2CW7A 1AKEA 2FW0A 4S1WA 2C2BA 3EGVA 1ZK4A 3MCVA 2R25B 4L85A 3QG1A 1IB0A 2XVYA 2NAPA 3PC8C 1N3IA 2FR8A 3PR2B 1KSJA 1KDYA 1RACA 3WGQA 2QXYA 1W4CA 4LV8B 4CMAA 3MJSA 3PNQA 3TH5A 2FJZA 1XHLA 4QAQA 4Q4LA 5DBFA 3E84A 1S8NA 1DG3A 4D9FA 4MP8A 3Q8MA 2I1QA 2WNHA 3HDGA 3IDFA 3LGAA 3UUWA 4OJYA 5AR1A 4W99A 2VXYA 1KKUA 3CVYA 3RU7A 3AI1A 3BL8A 3MMXA 3VZQA 1SXJA 4YHHH 4LWZA 1M2VA 1H8ED 3LUGA 5E1OA 2W37A 4YQFA 1K5GA 4Q12A 1WZ2A 5HGXA 4YAIA 5GJCA 1PL6A 2PMKA 2VF4X 2J4DA 5HJ7A 3S44A 7AT1A 4QELA 4TTJA 4C43A 3K9BA 1LD3A 4YRQA 4FI3F 4XWAA 4DAEA 3M9MB 3O4IA 1Q6YA 3QOFA 3HY4A 4G4JA 4BNJA 4CKEA 5FLYA 3DMPA 3R0XA 3L6BA 3T1OA 1EGVB 1XRQA 4KN9S 4CM5A 4EEXA 3JZMA 1B74A 3QU2A 1D1TA 3OQJA 2CK3A 4FZ5A 3BN3A 3SK0A 1CS0A 5E9QA 1TUEA 4CKCB 4H1WA 5E9AA 1WB9A 2QMYA 1U31A 3BWXA 2OO5A 1Z3IX 1S8AA 1AKVA 2DH5A 2A1IA 2OCIA 1B3RA 2H5JA 3KQQA 4N7RA 3UWOA 1XPRA 4C5BA 1AGNA 1JBEA 3DMRA 5KMGA 2O5VA 5A3SA 2PKQP 4EPXA 4JXZA 8MHTA 5LPNA 3N40P 4GZ3A 1W8IA 3EXAA 3OWOA 4AI6A 3MJDA 5D7NA 3RVMA 5BNIA 4XIFA 5DLQC 3IVMA 1CUUA 1SBYA 4BZZA 1EEXB 4JFAA 3T5GA 3AT1A 2GM4A 1EQUA 4JI1B 2IYWA 1F6DA 2RHTA 4D45A 4J91A 1YB5A 1QH0A 1LQUA 2PA0A 2GLXA 3OM9A 3CUWA 4O1HA 4RD1A 2YWXA 2YY6A 3BBLA 3U62A 1ENOA 4KMMA 4JEHA 1DKNA 1M34E 2I7XA 1EG2A 1KOLA 3TJZA 1COWD 2J5XA 4QU9A 2X5OA 5EKXA 1M73E 1OXXK 3AIKA 2G9NA 4MX8A 3H9QA 3P5BA 3J81k 3FYTA 4GBMA 1O3YA 4CF3A 4ZT7A 3EARA 4HH4A 4Q7MB 1EBFA 3EVAA 3P0HA 1JHRA 4M0MA 4CV3A 2PS0A 3ND6A 2OORA 2XNKA 1SN7A 4J9UE 4Q45A 2Q0QA 5COQA 1W1IA 2M6RA 1I36A 2ASVA 4PICA 3CZQA 1IY2A 1DXHA 4NYMR 5FPSA 1NXXA 4Q47A 4ESVA 3OMWA 2GCOB 1JIQA 4QBIA 1KZ1A 4RS4A 3OKFA 2ODTX 5IS2A 3GB8B 3TTYA 1TO6A 1XTJA 3HJFA 1CF9A 2G76A 3BMQB 10MHA 1O97D 4YMIA 1NXPA 1EUQA 1P16A 5HZGA 1JQ5A 3IOEA 1KTAA 4GR5A 4ZO6A 1E9DA 4GVPA 3DZHA 2XCPA 1OWLA 2CVHA 4PW0A 3C3DA 1V3VA 3GGGA 4Q9LA 1BQ3A 1SXGA 2FDXA 3QEBZ 2H1RA 2EX4A 3RJ5A 1TIKA 1XXLA 4ECQA 2Y76A 1ZL0A 3E9NA 1G5PA 4J7XA 1ORHA 3JZDA 3GIJA 4TUYB 2GBGA 4A3LG 4HDNA 4K9SA 4AROA 5FA5A 3O1IC 2A3NA 3FGOA 4XGKA 2UXDH 4B46A 5C46F 4R6XA 3Q7IA 3GI1A 2B20A 1YS1X 1LVUA 3VA7A 4F3RA 5DCWA 3KV3O 3IS3A 3C3XA 1FFBA 5LU8A 3BHMA 4D9JA 1UFVA 5K1ZA 2FFHA 3L43A 1GZ6A 3LWBA 1YWGO 2G5CA 2QTMA 1M1UA 5FBRB 3L0ZA 1A27A 1U90A 2AJTA 5DI3B 3CEBA 1IUKA 4MWZA 2BUBA 1YZKA 4GLFA 1GM5A 4C2UA 4A2BA 4GFDA 1L6RA 2DYKA 3QH4A 1PQUA 2ROQA 3OIUA 2IYYA 3UW3A 3DFMA 2JGKA 1YQWA 2O1EA 3W5SA 2G5PA 1YVEI 1UMCA 3PYMA 1BWSA 3CV3A 2X9NA 3NHFA 3QVUA 2OHGA 1ISIA 1SRQA 5H81A 3GZTB 3RRJA 4B5LA 1U0TA 1BS1A 4X6XA 4E0BA 4BPBA 2C57A 1MO2A 1ZYUA 2PQMA 2Y67A 1ZEJA 3GTKA 5CLQA 4DIUA 1QTQA 4CG1A 3ZKAA 3U6KA 4MARA 2R751 3IEIA 1L7QA 4HAYA 1MDFA 1P62B 1X7YA 1ELOA 1I6WA 4AVYA 2GVDC 1V45E 1CLEA 3TWOA 5EVJA 3CX3A 3AJ8A 3KO8A 4W5HA 1NUQA 4ZZIA 2QN8A 2W2MA 5JRZA 2Y1KA 3WQQA 1A82A 1WZNA 2VSFA 4UATA 4TVKA 4Z4QA 2BR5A 2HJSA 1GZUA 3NIFB 4G0XA 1UBCA 4CT5A 1N36B 4DEVA 4UMFA 2KSQA 3NUZA 3EZLA 2CC2A 2BMFA 4YRPA 5ALZA 2BLNA 3RNLA 1BIFA 1YS4A 1N0IA 3HCOA 5ITVA 2WFLA 2B0CA 2JASA 4FBLA 2ERYA 2E18A 3WBBA 4ZI7A 4XUDA 3TI9A 4PBRA 4C0XA 3G2LA 2ZRKA 5JO9A 2GOYA 4C5AA 4IYJA 4X41A 1UC9A 2NUPA 3QITA 4XVUA 3DFFA 3PC4A 1PR1A 4IWNA 3Q0TA 1YRWA 4M7RA 3K6RA 1IJEA 4N5NA 1UXOA 4G4GA 3E58A 4TWIA 3JZAA 2E5FA 1USUA 3GFSA 2Z09A 1EUDB 1E9AA 1F6BA 3AL3A 2PBFA 4UM9B 3PJEA 1YE5A 4H3VA 2IPNA 5BYJA 4X8OA 3X1KA 3RU9A 1YFKA 4EYEA 4RORA 2VN8A 3IOYA 2C9DA 2HHJA 1XEXB 1ISRA 2X40A 4EW2A 3ZTWA 2QRKA 1XF1A 4N82A 1FMLA 1NE7A 3GRYA 4ENVA 4KAFA 4K1XA 2YWRA 2UU9B 2Z1DA 3S29A 1H2RS 1B42A 3JQAB 4U3JB 4FBGA 1YACA 1U8CB 5FH9A 2DM6A 4ALJA 2BEWB 1T13A 2FSIA 2JFWA 2PMDA 4KLAA 1CUCA 3FDJA 2UYCA 3H5NA 1VPVA 3WWDA 3DMGA 3M82A 821PA 2ZQZA 3L3BA 4M3NA 1A0IA 5HQTA 1I5RA 1TUGA 1OXBB 2GZRA 4IHJA 4WK0B 2X6TA 2IEIA 1LBSA 4OYLA 3VYUB 3PITA 3I2HA 3PEWA 1P2UA 1FKAH 3AERA 1M8FA 3K09A 3KTAA 4TQ9A 2MYNA 1FXWA 3RVBA 4E6EA 1NY5A 3QQMA 1P77A 3CNBA 3FMGA 3V8BA 2VDPB 4WCVA 3CIFA 2LP4Y 1S8FA 1ECGA 4CUKA 5D3KA 4R71A 4Y6SA 1KAOA 1BN6A 3CUVA 4AK9A 3INGA 3QLVC 2TECE 1A9PA 4ZEMA 2BFOA 3Q3EA 3WTCA 3UA3A 1T0UA 1QNFA 4MW0A 4GX1A 4JBLA 4ECXA 4DV2B 3PG5A 1UIRA 3KSBC 4PHCA 3O74A 4RQBA 3LPAA 1T36A 3VGPA 2O03A 2IGBA 2Q3DA 3CZCA 4YUZA 4NONA 4BX0A 4B7ZA 1G5TA 3MHTA 4RH3A 3B82A 1NXTA 2IHTA 1U5CA 3S27A 5B3KA 3TM4A 2UKDA 5AVTA 1TYAE 2C4UA 4GC7A 3DVRX 3REGA 2A0WA 1CRPA 1HV8A 4LV5B 5CDFA 4PGMA 2BV3A 3OZUA 5PGMA 2BGWA 3WQBA 3HKCA 1XN4A 1T10A 3CKLA 2NQ8A 3L6RA 2BFFB 3BQ9A 1E7SA 3NNNA 5K8LA 4LY6A 3WNQA 1E4OA 2CB0A 3DCIA 3G2IA 1PFKA 3SM9A 2E85A 4GM0A 5FULA 2WM3A 1DOAA 1CDOA 4ETNA 4CQMA 2VZLA 1XT6A 3SLRA 4OI4A 4QECA 3UFXB 3GLUA 4UVGA 2RD2A 2F4VH 2WSSA 5EHXA 1IE3A 4GYKA 4NOKA 3UB3A 1J23A 1R64A 3UCFA 1G7RA 4DBVO 2HGZA 1LPPA 1QKJA 1JIXA 1NN0A 5HE8A 3J7AK 5FUMA 4O3NA 4UDNA 1IPHA 4ME6A 1JDEA 1SGWA 5HTOA 3E70C 3PUKA 1OGJA 2R8XA 1DCTA 1XMPA 4JS0A 3I9LA 5G2OA 1T91A 4AC9A 3V1LA 4D4HA 3AR2A 3UGQA 2QLBA 4WE3A 3H04A 1X86B 2BI4A 1NY6A 3GZNB 1T2VA 4CKYA 1PW5A 1U1GA 2UVPA 4QEZA 4QOEA 5E1DA 1VPEA 4IJUA 1N9KA 1E3TA 5T4EA 4UE2A 4BWVA 1XP8A 3V2GA 4TKMA 3UMGA 5EJEA 4CEHA 4RZXA 3G1TA 4M9UA 1I2AA 2IXDA 3S1LA 4OSPA 1MEOA 4P92A 1KQNA 5HSGA 4HGRA 4S0XA 3CUYA 4JVLA 3PNOA 3NAQA 2B69A 1XCOA 3H97A 1YU9A 2JA7A 3IBGA 2GMWA 1M1NA 3BJEA 2ZEJA 4YV0A 1WTCA 4F4DA 3V4PB 1BDBA 2OESA 4G9GA 3UAVA 2VC2B 4NWIA 2XECA 4Z2AA 5AVWA 3TECE 5B30A 4MV4A 4TTQA 4MIYA 2X0IA 4LBWA 3FAZA 4KNVA 2PFSA 2DZDA 2VK2A 3UKJA 5L45A 3A1TA 2IYUA 4R8KA 3K8OE 1NATA 2Q6KA 1L5SA 3C5WP 4HWPA 4LJYA 2HYIC 2Q6OA 1CR4A 4CEJA 2CGEA 1MLDA 5JYBA 4HEHA 2EP7A 2A8YA 2FQ1A 2VPXA 2RK3A 5CNJA 2C9CA 1GIAA 4BFVA 1PJCA 2BRUA 2P3SA 3NC0C 2RHJA 4KVGA 1N5MA 5HQ3A 1PT7A 5ESDA 1XWWA 4XTCS 1HNNA 3PYXA 4IH4A 3DGEC 3DO8A 1D2CA 3GH1A 3HQ4O 3U3XA 2VP6A 1U9IA 3B70A 2CNDA 3H40A 2G40A 1BVUA 1M2OB 4LQ4A 1UJ2A 3O8OB 3CPEA 3KUXA 3ITEA 3S8EA 3T4XA 4FNGA 3DD1A 3TI7A 4XD7D 4P35A 3ZC3A 5F21A 4JI2B 2KS6A 3DMTA 1MX1A 3BFJA 1JQJC 4JUZA 3E9DA 4BB0A 2CJFA 1HFJA 5LMUB 4JHXA 4DR4H 4QFMA 1J99A 2JGIA 4GXQA 2XH8A 1BCSA 2MIIA 4J9PA 3R4VA 1CR2A 4ACBA 1VLHA 3TF5A 3M4NA 3RLFA 5LVAA 4XM1A 4UVHA 3ZKWA 1JSCA 3G2PA 4CV1A 3T1QA 4UNRA 2C9MA 1J20A 1G20E 2Q0HA 4FW8A 3E48A 4YJGA 1SBTA 2H7CA 2GJ9A 5JNWA 2X9GA 1HNXH 4HB4A 1N6NA 5L7YA 3B48A 2BDUA 2ZUCA 1VKZA 2VTVA 4CF7A 1GG5A 3CZ9A 1RE0A 3OE5A 3TINA 3R4CA 5EUQB 1JIVA 1FUYB 4UTNA 2DERA 5KREA 1MB2A 2EBWA 4DXAA 5CJPA 2NUTB 3CPHA 3H5AA 5L1KA 2WU4A 1NVGA 2HCFA 5EE5B 3FVRA 2VDJA 1QP0A 1S2DA 3PHJA 3ZNPA 5BO5A 4JI7H 3KQTA 2WSLA 2I8AA 1PNOA 3GWZA 2DUMA 3HOYG 2FN7A 1YDFA 4A2PA 1X7HA 5EHQA 2F1IA 4ARVA 4YBRA 3E9MA 4RUKA 5GVRA 2HK7A 4AF8A 4YFVA 4QGSA 5H4HA 5IYDG 1OYOA 1N92A 1JQLB 4L3WA 4MRPA 1ZOSA 2X8AA 4UEQA 1LFDB 3CLHA 3MJTA 4TSRA 2HXSA 5JSQA 3NHRA 1C9NA 1S6YA 4EO4A 2DPJA 1H0KA 2VJAA 4YR2A 4GOND 3BH7A 3WTBA 1T6ZA 5BVHB 4EFBA 2CVQA 2JK0A 1ZQ7A 1G6KA 5B57C 3ED5A 2C2YA 4JYAH 3ISTA 2NTVA 5FLKA 2CKMA 1KJ9A 1N4DA 2GN2A 3FOWA 2XKKA 3A0UA 4UM7A 1RQPA 1G21A 3N74A 4RTQA 2CV2A 4HB2A 4Y0VA 1WMDA 1MEEA 3VX4A 2FLPA 2EHJA 5DYTA 4HNUA 2AFIE 1JT9A 1M7BA 3CCCA 1QU2A 3BABA 5FWDA 2H17A 3IDQA 1LRLA 3FRHA 4X95A 4LHXA 3ZXXA 4BFYA 4TYPA 2XWBF 1JJAA 1H65A 4MHTA 3DB1A 4OLBA 4JGBA 2PDAA 1E0JA 4UU8A 2FZ5A 3OFJA 4MUXA 1HYBA 2WAYA 4IVQA 4U2GA 1XQ6A 1ZN2A 4MTCA 5LXTF 4F4XA 1YB4A 2RKWA 3FJYA 1JW9B 4KTVE 3NBYC 4IHJF 1N0WA 3OQBA 1K4YA 2RGXA 5MN5A 3L2PA 3RRNA 4NBTA 2C3UA 2HDOA 1Y6FA 5D1NA 3ZV3A 3Q3CA 3THWB 4KR7A 4L7VA 2GFHA 1QIHA 4F6LA 4LRUA 2QTVB 3ACDA 3EYAA 1FXWF 3G8AA 5JE8A 3P97A 1Z5UA 1Y1SA 3B51X 1PQYA 2Q5LA 5AVKA 3SZUA 4U2DA 1K83A 2QAGA 4ZO8A 1XI2A 1I32A 1O95A 3IEVA 5B6JA 5ICMA 4I99A 4X63A 2PWBA 3QWUA 4ONEA 3HLYA 5IDYA 3KDPA 5HR5A 1CJSA 4P0TA 1GTZA 2BFCA 1GL3A 4IJMA 1KY2A 1TU0A 4FBMA 3OECA 3HJBA 3WLEA 3SX2A 1I1LA 4ZI3A 3WYAA 5IEBA 2CXRA 1Q22A 2B9EA 5EIXA 5K45A 4QQRA 2VHUA 4LWQA 3H1PA 3PD0A 3DWGA 1ZG3A 1THZA 1BKYA 3ZK8A 3K73O 2PLNA 1SO8A 3TNDA 1NZFA 4BO0A 4BEJA 4MEBA 4QPDA 4ZXPA 5KFTA 2DR0A 1CQXA 3UPDA 4QGHA 1CUZA 3KYHC 3KEOA 3TQOA 5EFOA 2JCYA 3ML1A 4DB4A 1Q3HA 1T5OA 5L3SB 3AVQA 2N1MA 1T9KA 2APJA 4PO9A 3HKEB 1Q0ZA 4PR0A 4F56A 3HOWG 2FZKA 4M76B 3D9QX 3G2OA 5KYXB 1SCUB 2C29D 2POCA 3FKJA 5BWUA 1Q6ZA 2DWCA 3D8UA 3P9SA 3RBEA 4W82A 2HR1A 1L5LA 1YIOA 3FOCA 1WHSB 1ZJYA 5H80A 2CCKA 2RHGB 2FWNA 3R23A 4DA6A 5IT4A 4RM2A 4DJDC 4I6JA 2GQRA 4ZARA 2P7HA 2OQRA 3O3MB 1YRHA 4O8ZA 1F51E 5K8IA 4NCXA 1QO0A 4H7FA 2XV1A 1NW3A 4R69A 4QTXA 2FW6A 2X6RA 4NTZA 2ZR0A 3S2FA 4AY5A 2WOJA 2E5LB 5CE8A 3T61A 3QVWA 4ZCMA 1PBNA 1CTQA 3BICA 5IF3A 1CS4C 2Z2ZA 4YIKA 4YAKA 4Q48A 3HU3A 2DTDA 3J81A 2P2NA 4YPFA 2XKJE 2FG6C 3EGIA 3OWHA 1UZAA 5KFAA 2I4RA 3AU9A 2GEUA 1G5FA 5KFBA 4YR3A 3PQ5A 4NZMA 1FSSA 3JWIA 1RQLA 4UCQA 1IC6A 1ZCBA 3NGLA 1PRYA 5K3DA 4G56A 1OI7A 3DVAA 3D5QA 4R16A 1V4NA 5CMLA 1OKKA 3LULA 4IIVA 4E12A 2VHYA 4KQ1A 1XYGA 2QHXA 2VAVA 5DK4A 5AJXA 3FWYA 3Q2OA 3V8RA 4A92A 2YZLA 3HFSA 4YP9A 4HNAA 1OX4B 4IUDS 1X80A 5JSHA 5K6RA 4REOA 3BG5A 1LJ8A 4A26A 1EQ2A 2B4QA 3SBOA 3IKTA 4LPSA 3CO5A 5KFIA 3HBJA 5D3MB 5MHTA 4KFUA 2OZEA 2HIVA 4OMFG 4M7WA 2VH5R 2O2EA 2BHLA 4MA5A 5CK4A 4HVAA 2VBCA 3H2SA 3AKCA 3CN9A 4JT2A 1SC4A 2YL2A 3EAFA 3KZVA 4HMOA 2J9XB 3WMWA 5AMXA 4DLXA 3L18A 2NZJA 4G63A 3DKRA 3FYUB 3DTVD 2V5UA 1N5RA 3BVPA 4Z54A 3TJMA 2Y4RA 3IAM6 1N6HA 5JSKA 2B8WA 3TRFA 4RSRA 2X2EA 5EP4A 4L08A 1ODTC 1U3VA 2BGUA 3ZVMA 2AOTA 1KVQA 1GGVA 1JHMA 3A2LA 2P0YA 3M7IA 5TQ2A 4EBBA 2Y3IA 5FWYA 1N2CE 1Y89A 3PUIA 1AKMA 4ZICA 3QW2A 5ITZB 1PD0A 3T35A 2PH3A 4U6SA 4P34A 1XLTC 4FXPA 4B40A 3G8DA 1QK5A 5FFFA 1XLWA 3KVOA 2VYVD 4ZU6X 2OLSA 4NQRA 1I3NA 3GNQA 4RK0A 3L7BA 2IDMA 3NTVA 3UMMA 4A8PA 4K40A 4MSUA 3NHKA 3ZEAA 3VPHA 2EZUA 3ZHCA 2C2WA 1AF7A 4Z99A 3GUUA 1YMQA 4R6WA 3F3KA 3VC2A 4CJXA 4L8YA 5BSMA 1C3LA 3NOVA 2OH2A 1EP1B 1Y0BA 4LSMA 4X20B 1ZOLA 4UC0A 5LWQA 1J4AA 3BZUA 3IAFA 3UMBA 4POOA 2AOVA 4MW1A 3ILXA 3TD6A 1Z0AA 2YHBA 1NJ8A 3JZFA 2R6AA 2ZULA 2RH9B 4FJ0A 2HT1A 3ELYA 3SU8A 1QIGA 5KHLB 1ENZA 3B13B 4J9VA 3T7DA 1MZBA 2I78A 3I4NG 2OQVA 1TCBA 2C1XA 4E88A 4EPWA 5ADUS 3ZCTA 2YICA 4KR2A 1ZI6A 1WOMA 1T4CA 5B12A 1I3CA 1P8LA 2VL7A 2YVLA 2CT8A 4JOBA 2OTCA 4HLCA 2LR0A 4RKYA 3LP8A 3WISA 3IG0A 2O5RA 4W5WA 4DCCA 4URVR 1SUIA 3OQOA 1WETA 5B4TA 5BN3A 1TT7A 1QJCA 2IBTA 1N5DA 2WJGA 4WLNA 3AHCA 4JXKA 1YR1A 4AUKA 2G83A 3CW8X 5LOVA 4GX5A 4JMLA 1AO3A 3Q8WA 2QEQA 1XL0A 3SYMA 2IXTA 1VL2A 4ZCSA 4PTLA 2P1ZA 3WIDA 1FJGB 1UMDA 3K96A 4FCTA 4EA9A 2Z5GA 4BNDA 3H86A 3I9MA 1YOBA 3ZLVA 1ZGGA 3HWWA 4K3UA 1Z2PX 4RZQA 2W42A 3RQIA 4YP7A 2VA3A 4OHKA 1B1CA 3DQPA 3E2MA 3FI0A 3UMVA 1CQIB 4EFNA 3DP9A 4BLSA 1CKEA 3FIJA 1XZMA 2CZCA 1ESNA 1XQ1A 5LZ9A 1G6OA 2QQ0A 3UJHA 4RUCA 2SHKA 1N1EA 3G6YA 4HXYA 4P81A 2IYXA 5E4YA 2O0MA 1AKWA 1RAHA 1Q16A 2W7TA 2RONA 4LRQA 5EPUA 4RZ2A 2MDTA 3VH3A 2J30A 1QO9A 5J1TB 4G67A 3QVKA 5FR1A 1DKPA 5HS6A 1ONOA 1OPRA 1CZLA 3DTFA 1U81A 4CFZA 4BE9A 1LVGA 2G1AA 3DQZA 4BXXG 2ZAGA 1AT1A 2XGJA 2QW1A 4HVCA 3QVGA 1F8UA 2BFNA 3GLHA 1IXKA 4ON9A 1V26A 2IZ7A 1IG0A 1E5QA 1JFLA 5JWRA 4BUZA 4LECA 4LGCA 2IE0A 3MD0A 3HY3A 4L2IB 3HZZA 4RDXA 5K3FA 4V2IA 5KNLA 3S2EA 2JANA 3G5AA 4UHHA 2MINB 4WZBA 2BKVA 1EX6A 1JDNA 4PLGA 1Z18A 2Y68A 1KEUA 5DHQA 2Z83A 4PGFA 3D5TA 2XKBA 3GBPA 1X3LA 2ECQA 4DUZB 4O7LA 5JH7F 1IBRA 2JEOA 1CQJB 5I8PA 3RK0A 5JAOA 5KQMA 1U3TA 4I55A 1R8SA 1JKIA 2EW2A 4MR9B 4X3PA 3ZWMA 2H52A 1FFGA 4BMYA 2I5PO 2VWQA 5CFNA 3L8DA 2JZCA 1OT3A 4F9GA 1UAAA 3PO3G 1RJRA 3SQLA 3KXLA 5B6IA 6Q21A 3DAOA 1GPKA 2QTAA 4GYJA 2H0AA 5KNDA 5FUQA 1SCQA 2PYDA 5AW1A 3H20A 1EFKA 1QH9A 3HSYA 1PGOA 1YOVA 1N2EA 1V1JA 4B7UA 2E82A 2R4UA 5BN5B 1KZ6A 5J63A 1TZBA 1NKSA 2J7PA 5FQNA 4AY4A 2YV1A 4TTAA 3IAS1 1YJAA 5LM3A 4JP2A 1I51A 3V8VA 2OGWA 1TYCA 4YRGA 5HHTA 1DEKA 3DDWA 4FMDF 2A5JA 1QQAA 2GF2A 2XW6A 3FGPA 4K3VA 1CY7A 2Z8YA 1Z29A 1JJVA 2YYYA 1JG1A 3JYNA 1SOWA 4L3VA 1CFJA 4WW0A 5L3QB 5HCIA 3TRKA 2JB9A 4PN7A 4CM4A 1S2GA 1SVLA 4LSZA 4BTLA 3MGAA 1H0SA 2PKYX 2BDTA 2ZIAA 1VKNA 4GXTA 1XA4A 5JTTA 4QUEA 1YZHA 4KHZA 5EIFA 1U8XX 1U0FA 5FBWB 2H1IA 1AK2A 1T2EA 3GLSA 3B8HA 3S81A 2WG1A 4DR2H 4YROA 3TZ6A 2JDIA 5HCUA 4OTZA 3WGHA 2WTXA 4Z7JA 3RYIA 1L4FA 5FTMA 4G2TA 1NR7A 1WKBA 2WINI 4KR0A 2FRVA 1NI4A 1U02A 1OXSC 1GR0A 5BQFA 3LT5A 3FR8A 4M22A 2H5IA 2Q2UA 4D81A 2FNAA 4C6RA 1NJ1A 3JQBA 1Y5LA 1LLUA 3ZCRA 2ODQA 2N42A 2ZJOA 4BFCA 3SQXA 1XTRA 3HKDA 2OUIA 1KVRA 3WK6A 4CUJA 5HNEA 4KU4A 3MFYA 3BK2A 2V7QA 3A1WA 2IYOA 4AB1A 4YBZA 5LQSA 4KNWA 1GCUA 4B3JA 1QGED 4UZFA 3HOZG 2AK2A 3DD5A 4O2AB 2K7ZA 4JQCA 2CVZA 3U16A 3R3SA 3OZDA 4WUVA 2O0LA 1C7QA 2NUBA 1C29B 4K2HA 2QN7A 3NTRA 4UOZA 4N0PA 4OO3A 4NYIR 3UMRA 3TQCA 1GAEO 1G1MA 3P0FA 4LJ4A 3LLSA 4OQZA 5AUNB 4AJ9A 1V3UA 5HKKD 5CFZA 4RVDA 4DJFC 3IHKA 5FEUA 2GN0A 5LP6C 2GEDA 3K2QA 4KN8A 3H5VA 5BSGA 3SFTA 4KXXA 1NJFA 2G7MC 4E13A 2B6HA 2IODA 2C98A 4BIIA 2O19A 2FK7A 3CKKA 3TSYA 4KRYA 3PD1A 1A8QA 1EJBA 1RJPA 1P39A 2PS1A 4NCNA 3TTUA 4FB5A 1R5BA 4W9MC 3ZJUA 1GZSA 4YRSA 1JFFA 1O6BA 2BP7B 2E87A 2YZNA 3QXXA 3AHEA 1RWMA 4KV7A 5ILOA 3CN7A 4H7EA 2J9FB 1PKXA 4GP6A 2RJ3A 2D1QA 1RYRA 3Q98A 5I7AA 4D9NA 1R16A 2G1UA 3OIWA 2GTPA 1CYEA 1U1IA 2ZBFA 3DR5A 3OSPA 4GMKA 1S97A 5ICSA 4OD0A 1EVJA 3DOIA 3U4QA 2X5NA 2QGNA 1SC9A 4M54A 4KAXA 3LSTA 3GO4A 2FGJA 4TTSA 3MGCA 3NCHA 4JMPA 1GZ5A 4CDRA 2BFEB 3IUBA 1EMDA 4CMDA 4KREA 3KK0A 4C20A 3W5JA 4KGXA 4ND1A 2WJ3A 5F23A 3K31A 1NX9A 3MCUA 2FKNA 5TVGA 5EDWA 1QZUA 4Q9IA 1LXCA 1YO6A 2D5LA 2OBFA 2VWHA 3PEFA 4L5AA 1BE8A 1SFOA 5DHTA 4YUWA 4CT4B 1TVKB 1MHPA 1W44A 2GBCA 2AC7A 5LOVF 2E21A 1V7CA 1QDEA 2WJIA 3GLIB 4O3MA 2HHCA 5JSUA 3ANLA 4C06A 1A9RA 2FEAA 1BJKA 1PK8A 4QSHA 4QXAA 4KQCA 3UV7A 5DE3A 3EPPA 4TL7A 1YA4A 3L7LA 1LDGA 1NVVQ 4MW4A 4JI1H 2REQA 1RU3A 3ELUA 4EAQA 1E1RA 4OAPA 1RAFA 1PL0A 4RVGA 3A27A 2Q5HA 3BKXA 4YO8A 2QD2A 3GCZA 3W4KA 3TE6A 2WB1E 2YWJA 3R75A 3B3JA 2GWRA 4YEDA 2R3SA 5KVAA 4ND7A 4TMTA 1L1QA 3FVTA 2Z2JA 1O6ZA 2HWKA 4GPD1 1NG1A 5JCOC 4NJMA 4HDSB 4RLSA 2D5BA 5AJZA 4RULA 3FCSB 1E2PA 1EVZA 1ZVJA 4GPZA 2QYSA 4L5IA 4HTFA 3HXKA 1PWXA 1I50A 1E3LA 3EXHC 3NHUA 1E7YA 3I8SA 3G2QA 2JGEA 3AR5A 4QICA 3R7AA 3MNFA 4U6PA 4K9OA 3I5UA 1F6WA 2L17A 1K6EA 3U09A 1PSZA 5IX8A 1WSWA 1OJ7A 1NUPA 4LJAA 1SVNA 1QLWA 3U81A 3GGJA 3W1WA 1G3MA 3LRTA 1H5UA 4L27A 5DYIA 5FOTA 5REQB 4UNNA 2VQ6A 1U5BA 1ZGCA 3ND7A 4ARBA 1MJ5A 3STVA 4J9LA 4Y9RA 4LISA 1USIA 1P5RA 4IRMA 4C89A 1B15A 2JAHA 4D9GA 2Z4SA 4I4LA 2JC3A 521PA 1FK8A 2Z1MA 3L0DA 1G64A 2Z0MA 2GN6A 4AMVA 5C4GB 3AR4A 1KEPA 4I55F 2Z43A 5ERYA 2MYUA 3JQFA 1Y7LA 1JR3E 2PLRA 2NU9B 1VMEA 3ZHTA 3FFWA 5BW5A 4MQEB 5FD5A 3P9YA 1YVPA 3TW8A 4E31A 3PTLA 3DHNA 2MSCB 1J2TA 3CX4A 5GAJA 1HZZC 1XD2A 2ECPA 2VDUE 4HMQA 3Q8XB 1OHHD 1YJ8A 1KI9A 3N2NA 4NXNB 2X5JO 3EGWA 5G0WA 2J6HA 4OXXA 4P84A 2BD0A 1ECJA 2SKCA 1JDVA 2O06A 3UOAB 4BVAA 1ZH0A 4N41A 3WGGA 3RT7A 1SWWA 4TM5A 2CV0A 4G5FA 2O7VA 3DBIA 4QGGA 3B1KA 2ID9A 1CIJA 4YQZA 3DUWA 2J9RA 1XPJA 2OAQ1 1P1FA 3FDZB 4JB2A 1CIPA 4LMYA 4R8SA 1YMVA 3FYDA 3PFHA 4C3OB 2P9HA 1DEXA 4MVJD 4IDQA 1P80A 2YIJA 1NVMB 1CP3A 2P77A 3ONVA 4P7JA 1Q11A 1U0BB 1QQTA 3KRTA 3PV0A 4GLJA 4BBSG 1WG8A 4JV2A 4G3XA 1UBEA 4WWHA 3K6SB 3OCZA 3U9SA 1SCJA 1HR0B 3BXOA 3VKHA 1UDBA 1TPZA 1H22A 3FUTA 1M6VB 2UYQA 2H54A 3N2KB 4KH1A 4QBFA 1ZNQO 5I4IA 3AF1A 5KFKA 2BMVA 2YUTA 1ZW6A 1ILEA 1GG2A 3TW7A 4I2NA 3V8MA 5C37A 5CNKA 3WL5A 3LW7A 4DLKA 4FHZA 3N5KA 2E4YA 3I0NA 3FWPA 4R31A 4E1VA 1P2GA 4LTDA 2BZ1A 4YRIA 3DEFA 1KF0A 3C5HA 1ATIA 1ULTA 4IRKA 4YXFA 3GTJA 1UXIA 1I10A 2DHEA 4GKBA 4IDGA 2A78A 3UOWA 3Q6MA 3ESXA 1U8EA 2FRDA 5FLXW 5LN1A 2PXHA 1E2UA 2UVRA 5ARCA 3LHDA 4UBJA 3FTPA 3VR6A 4AO8A 2XE7A 3RFTA 3K0CC 3WWPA 1KQPA 4Q4AB 5H70A 3KAPA 3L7AA 5A2QA 1H2YA 4B3SB 4GMHA 1N36H 3LHFA 5EWJB 4B1FA 1EP9A 1OVMA 4PS1A 3LDFA 4Y0NA 3TXYA 3U55A 3EVNA 1VGVA 3IDAA 4LOLA 4B80A 1DIRA 2AI3A 1GGKA 1TZCA 5KPDA 1ZM3A 3RB6A 5TPWB 3L84A 1I8TA 2BR3A 1K9VF 1EIWA 3NJRA 3T7TA 5KFQA 2DP4E 2WKWA 4PPFA 1VSQA 4ZAXA 3FDIA 2H2FA 3KOYA 1XR3A 4RVHA 7MDHA 3EFOB 1S2IA 1QX3A 5JNRA 3PU6A 4C0JA 2XUOA 1K7FB 1C80A 1Q0TA 4AT1A 3OIYA 1FSPA 2OQIA 1GPH1 2Q6VA 2ZWIA 4OBEA 1Z7YA 3GIKA 2A92A 1ULBA 3TL3A 1RYSA 2X9QA 3UAXA 3I64A 3WB0A 3I73A 3AEUB 1NW7A 2JJ8A 1IUPA 5E2AA 1Z7BA 1XUOA 4A5OA 5EXXA 2YWGA 1NNLA 1PQWA 1FBNA 4LWPA 4RL6A 1VHQA 1Y80A 2O3QA 3F7NA 1WP9A 4RPGA 4WEQA 4WKBA 2R8HA 2C2MA 1QOPB 3PDJA 3IEXA 1CUDA 3QVXA 4PCAA 2UU9H 3L7KA 2EJUA 4HC4A 5JPDA 1P17A 2C0PA 1YB6A 3VC7A 1A7UA 1WB5A 1HDEA 5HILA 3PI6A 2FPRA 4RVSA 3RTAA 3SHVA 2ZGIA 5AW6A 2R8JA 2FW9A 3KQWA 4HT3B 2Y1GA 3Q72A 5DYNA 3TOSA 2I67A 5AK0A 3GJXB 2HSJA 4ZV4A 4N54A 3QLTA 1JR2A 1MD9A 2XD4A 3LBHA 5JU6A 2X2FA 1XTIA 2G25A 4ARUA 1QVVA 1W2WB 4DA8A 1OA1A 2BGKA 5BSRA 1RYMA 4PYJA 4RACA 2BTQA 1BSVA 2O7QA 3LH5A 1PR5A 4HP8A 4UCVA 3L92A 1GXSA 1EFTA 2F8MA 4M87A 1ZL2A 2QOEA 4PPQA 1FP4A 3QVJA 1G5IA 1SUSA 2G17A 1NVUQ 2NLOA 1PFGA 4P7FA 3ETLA 1L7NA 1R3DA 3PFFA 4PO8A 1SVMA 3QNUA 4BNIA 1XZKA 1TJ5A 1Z62A 3LUJA 4ZIRA 4DV2H 5FFMA 5CR5A 2BBSA 2DU8A 1NR5A 5GONB 1U1DA 1XNQB 4O7ZA 3RR5A 3PE3A 4HDQB 4WNAB 4ETMA 3F9CA 3STUA 4IJVA 3JWGA 2FG7C 2WT4A 4RTRA 1V5GA 3K1JA 2C5AA 4MK4A 4CMCA 1YV9A 3MK31 4O59O 3RIEA 2JFPA 4ITRC 5EHGA 3FF1A 3OM8A 5KTOA 1TE2A 3JARB 3NAGA 2ODPA 4FFLA 3KZNA 1WR2A 4MAFA 5LNK6 1G5RA 4UOEA 4RD0A 4LXHA 3KUKA 4LYAA 5IWAB 3KQUA 2WR8A 2V4MA 3VSDA 2PT7A 4MO9A 2WPNA 3ZWOA 1H2WA 3SY8A 1GHTA 1M0SA 4EHHA 5K0JA 1KO8A 3VDNB 4X1IA 5BVGA 1ZOOA 1BXZA 4MVYA 3H9JA 3L6DA 1DINA 4F86A 4KDFA 3KQLA 4EA7A 3FR7A 2PN1A 3VNVA 5LL6P 1E66A 3S55A 3QLUA 4MMYB 5AVOA 4PYIA 4EJSB 5LXTA 3C3CA 1ZDMA 3Q8LA 3W5UA 3L7IA 1B6GA 1WUTA 4CNBA 3QU4A 4DMKA 2WMNB 3N2LA 3U1TA 4A1FA 1T6NA 4RGQA 3JSLA 1KOGA 3WXBA 1C8VB 4B73A 4CR6A 3L49A 4HZGA 2UUAB 3LP5A 1GZDA 2ZPUA 1FQKA 4LAFA 1RP7A 3K9FC 2NQ2C 1KS2A 3F8WA 2NU8B 3NZEA 9LDBA 4D99A 3UKOA 1CNMA 5KTKA 1X7WB 4TKVA 1I24A 2WF8A 5GTDA 2WTMA 4F9EA 2ZIZA 3QV2A 1RWWA 1JV2B 3QF4A 3SHFA 4JI4H 5LMNB 4QXRA 2R1UA 2EAUA 4URUR 3K0HA 4YCBA 3TY8A 5AJYA 2H1FA 3C8DA 2GGSA 1BN7A 2HRDA 2IZ1A 4I9GA 4BKRA 2QP4A 3P9IA 1K8XB 4IVPA 2Q4TA 1R6VA 5EHIA 2B4KA 3RGXA 3A1VA 3GLVA 1NLZA 3AEZA 4IOMA 1KYTA 2QV0A 4HAIA 4JWKA 2P4UA 5KYWA 5I5GA 4H17A 4OUDB 4B09A 1FFSA 2YUIA 3RU2A 1NX6A 1ES9A 3IP6A 1T9BA 1L5KA 4I0WB 2H11A 4KYUA 1GYQA 3PQCA 4MYDA 4ZEVA 1JWBB 1PZEA 3N53A 1MRNA 4ITVA 3NHLA 1FUEA 1X9IA 3AB7A 4QYTA 2XRMA 2JKZA 2YZGA 4DRYA 1MENA 4FYKA 1KOFA 1C3OB 2ACWA 4B3MB 2VT6A 3AZPA 5FR9A 2C9OA 3RG8A 1KFJB 3B6ZA 1BWPA 2QYTA 2V7BA 5KOJA 3BA6A 3C6MA 3EQZA 4D79A 2W6QA 1L7MA 4JI2H 1YDEA 1GNLA 5C3UA 1S89A 2ZYDA 4C6SA 4DRZA 4H6PA 3GU3A 1WD7A 4IP0A 1JIJA 2B4TO 1F12A 4MGZR 1AMUA 3DHEA 2XPCA 4M38A 3WLQA 4KQJA 3D8TA 2H00A 1V48A 1DO2A 1GZVA 5FOUA 1F0NA 3HYCA 3D3WA 3O4GA 2A7QA 1GCAA 2OBYA 1DFGA 5FL3A 4MS4A 3HL0A 3VQTA 4WFQA 1SEPA 3L40A 4Q4CA 3K2EA 3SHOA 3N39C 4ZTBA 5LQNA 2RH5A 1C1YA 1RXIA 1JQEA 1ZHSA 1O03A 4WOKA 1CUVA 5BR8B 5K6TA 3TD2A 5AIAA 1EGHA 2D2EA 4L28A 3BC1A 1DUSA 1ESCA 4CG2A 3RQSA 3PICA 3TLAA 3LYLA 4JN6B 4PX2A 1ZXBA 3F96A 5HJ5A 4L0QA 1B93A 4M0LA 4X00A 2A1UB 2Y77A 1P8JA 4C30A 3AV0B 5FD8A 5AHWA 2OD7A 3I76A 3P0EA 1NV9A 4BMOB 4H59A 2VJPA 4BY9E 1TJPB 1X8LA 4ZO4A 5KDOA 1VCOA 1V16B 4FI3C 4LGYA 3VAZA 2FZVA 1C1DB 5EE9A 3A6FA 2B61A 2VSXA 1WPXA 5B55A 2X7XA 3C74A 2C7BA 1D9ZA 3RGZA 1SUDA 2OHIA 1CHNA 5CJ2A 5LQAA 1U8YA 2YTZA 4ER6A 4XQEA 1XDZA 1ZBQA 3GIQA 4CDMA 3X2SA 1WEHA 4X65B 2N75A 1MT0A 3ONDA 2AE2A 4C2BA 1NUSA 2DBZA 1NQUA 4F4WA 1ZAUA 3E9CA 4QDTA 3BGDA 3OKCA 3OG9A 2ZPAA 1KFBB 5FT9A 3S2IA 5I5UA 3B5JA 2I22A 1KE2A 1S3GA 2YWEA 2XCUA 1QHEA 4MPDA 2VPQA 1DQSA 3ZEIA 2VJOA 2AKYA 2GBLA 4F5DA 1H42A 4DDHA 4WKGA 1UXKA 2H06A 1TO1E 3GTGA 2CHUA 1NXQA 4DADA 4EGQA 4X62B 4OJTA 1CKNB 2F43B 2ZU0C 2R87A 2VHTA 3LQ1A 1HYEA 2C2XA 3MD9A 1DNPA 3KJFA 4W6ZA 2J6TA 4MV1A 5BT8A 4ZVOA 3CRNA 1DRUA 3IMEA 4Q1EA 2R8YA 4X7PA 3AH8A 4JP8A 4LRWA 2PCJA 4R2XA 5EQFA 3DUFB 5AOAA 1G9XA 4DWOA 2MT9A 3VV2A 5CVTA 4FDLA 4LXGA 3DLTA 2R44A 3EH1A 1KK1A 3WYEA 1XJCA 5MGBA 5MFPA 2ZWOA 2GPJA 2XTAA 2GYVA 4CUZA 3K16A 3AG6A 1N8NA 4QQFA 4E09A 5DGCA 2HIAA 1G60A 3JASA 3IMFA 4L9RA 2AFHE 3O82A 3ZWDA 3UJAA 1L5MA 2G04A 3I05A 3MPUA 2QTHA 4LSAA 5JJKA 4XIGS 3L4BC 3JALA 1UL1X 3RJZA 4LC0A 1XKXA 2JIQA 4P4TA 3T54A 1JLKA 1TA9A 2DT8A 1NT2A 2PMWB 1R9GA 3ZBTA 2ZANA 4YPOA 4DV1B 2W9BA 4I3FA 3LJKA 1T2NA 3PLRA 2DWQA 3BJMA 1VOTA 2Q07A 4D1YA 1E4YA 3HJNA 4QYIA 1T8WA 4IXDA 4CDNA 1UT8A 3BD9A 4AUMA 1G63A 1FDSA 4I5GA 5JAZA 3SOPA 2IEZA 1I2KA 3ENZA 3QMPA 2JVIA 5E95A 5KOHA 4P3YA 3SC2B 3PDHA 2ZT8A 3T1HB 3EVTA 3A3NA 1IPFA 3N76A 1E60A 1WTAA 1VCNA 1L5QA 3MWKA 3OT4A 2WSSD 3OSUA 1VJDA 5GWXA 4TTIA 2WTAA 1AE1A 1OIVA 2JH3A 4MGHA 4U02A 2C2KA 4KFCA 4RFSA 1QGDA 1AKTA 1OZFA 4IIDA 3OUZA 4O82A 3N0RA 3WRXC 3RUFA 5IYZB 5I47A 1IBMB 3BXPA 3EIFA 2GCEA 4PZDA 3GTMA 4ZMBA 1JB1A 5DM1A 1Y4SA 4GLXA 2BSQA 4LV6A 5KX5B 3AUFA 3A8TA 1DZIA 4L76A 3PUZA 2QRMA 3ADPA 2P40A 3I6YA 2ANBA 5IP5A 3BREA 3PD7A 4Q16A 1Q57A 3CYFA 4FFDA 2OSBA 3OJFA 1H2HA 1H0HA 1JDBC 4GH5A 3MJVA 2IYTA 1XMSA 4C7OB 4GBED 3V6MA 1PWEA 3A7EA 4V0RA 5IVDA 5EKTA 1OV4A 3ROZA 4IGEA 3CLSD 2VXBA 2ID7A 2ATVA 4CCYA 3JQCA 4A15A 4BMPB 4JJFA 2R1VB 1KH3A 3PRKE 3UZBA 1JG4A 4QIHA 4IWYA 4DUGD 1P0CA 1L8LA 2ZDQA 1TLFA 1NW6A 4YMVA 3KT6A 4J0EA 3DJYA 2PG3A 3JQ8A 4F7WA 2AMJA 4CW7A 2XMPA 4JVOA 1XKLA 3HYSA 2BR0A 3K0AB 5KFSA 3KJHA 4IR1A 3OPNA 1W36B 5ANRB 4FR0A 4C08A 4JX9A 1V6CA 5JH7A 3TLZA 4ECSA 4U7WA 3N6XA 3T0FA 4LZWA 2CVFA 4I4TB 4NAUA 2ZBVA 5DIFA 1PZGA 1G8JA 1Q1ZA 4B85A 2L82A 2I3AA 5ALYA 2RKOA 4OX9H 4C1NA 4GLLA 5L6LB 2DG2A 1V9CA 3USES 4D56A 1OJLA 3HR4A 4P4SA 3H42B 4K6GA 2VDOB 1Z4LA 2O3JA 5DAAA 2DGDA 1EWQA 3NIDB 1YQEA 1GFWA 3U7QB 4L5CA 4JROA 4WMLA 4ARAA 2LXNA 3AP2A 3D3NA 5CA0F 4D98A 3BTOA 4N3NA 4DE5A 2AMYA 4FYHA 2YMLA 3G5MA 1ZM2A 4P53A 2AFIB 3EZXA 1KVSA 4PVCA 1FNDA 3A1NA 2B83A 2C28A 4BX2A 3PRHA 2HA3A 2Q7DA 5T3YA 4OLAA 3GDOA 4CLOA 3C98A 2C3OA 3CRMA 1KO1A 2J1LA 4BCDA 3GTPA 4QOHA 1KO4A 3SR0A 3KKMA 3TZLA 3ZCVA 4GZLA 4BO1A 1QPBA 4AXBA 1W4AA 2FR8C 2PHZA 4Q21A 4PZEA 4HBZA 3MJCA 5K4AA 1QNLA 3E3OA 1S2LA 4E33A 3AUAA 2Z57A 2MWMA 3IMGA 2QM0A 4AN1A 3ISJA 5B7PA 5EYPB 4BVEA 5LQDA 1N6PA 3S4YA 1CULC 5H3CA 3U7RA 2D0IA 3EUEA 4RHEA 2AMLA 2ZJ5A 2DPHA 4QARA 2P30A 4BTVA 3CRZA 1IUNA 1H5NA 1OU0A 3STWA 1SXJC 5IAAA 3Q8RB 4ZU3A 4MKIA 3TFWA 4GOJA 5GJWC 2BF4A 3FCOA 3D0RA 3H8SA 3SE0A 1P9NA 5IF9A 4BQIA 1BOOA 4KE8A 2D8AA 4LXXA 4BJ5A 3T38A 3G0BA 1B16A 3PHBE 4H6VA 1I7NA 4IFTA 2C83A 2ANCA 3I8XA 4RM3A 5F3WB 4JKOA 5DTQA 3GV7B 1EE2A 1RRCA 2EFGA 1RRPA 4EYGA 3FSEA 2Q3LA 5FA6A 2QVLA 4P7KA 2OZVA 5KQGA 1ZX1A 3Q4GA 1EFAA 5DLYA 4YJ2B 2KSWA 4FFMA 1NM5A 1L5RA 1U0JA 2CXPA 3TNYA 2FEPA 3AIOA 1GPBA 4NE9A 3T9DA 2J46A 3THXA 4OJKA 3DFIA 3ESBA 1DWOA 3JQFC 3QKUA 1O77A 1IM2A 5JZSA 1IPEA 4J9OA 2OO5C 3PDIA 3UWSA 2HRZA 5FX2A 4MUJA 3VNRA 1XVIA 2NO4A 4BMSA 2GF0A 3H9GA 3WLJA 1QYVA 2ZS7A 4W7IA 4BAUA 3LDHA 1YRQA 1MG0A 5JXGA 4DGQA 3ORYA 4B6SA 1FJGH 2W6MA 4EGFA 3SKVA 4Q03A 2B94A 3QLJA 3EIEA 3MG9A 1TJ3A 3ZQ4A 2PEZA 3F6CA 3MS2A 4OFWA 4UREA 2YJTD 1CERA 3B85A 2C20A 3T1YB 1CY4A 5HF5A 4H1UA 1L2ZA 5CCDA 3JAMW 3AO0B 3M4JA 3ON5A 4IWXA 3GG9A 2I4NA 4ZO7A 1FE8A 1X8XA 3KHRA 5M04A 2RI0A 4WLEA 4D7AA 2PZAA 4UUGA 5DSTA 5E0KB 2VZEA 3JAWA 4EBDA 5JD3A 5GADl 2W2LA 3D8NA 5JZVA 4H6XA 1QHYA 4MV8A 4N5HX 4BNXA 1N7IA 2OORC 1T3HA 3DOFA 1UPXA 4GNRA 4E5UA 1ETUA 1LTQA 4DMRA 3KZCA 1J39A 1AGPA 4YGYA 1BFKA 1J21A 1FS6A 2FDCA 2DFLA 4QGFA 3UXHA 2GRUA 2ZJ7A 3NM6B 5AESA 4BVBA 3O8LA 1PFVA 2WG0A 4Y2XA 3W06A 2Z6VA 4K1LA 4QUDA 3SJZA 3X1JA 3VPFA 4EW1A 1ONNA 5LLDA 1LSJA 3AHHA 3C4VA 3EA0A 4ZVTA 4HSGA 4OI1A 4UARA 1B33N 4H15A 4WKPA 2YX1A 1AK1A 1ZXLA 2XHZA 4DUZH 3FOAA 1JI3A 2JBWA 2AT1A 1WXDA 2FE3A 1FW6A 5JTUA 1U7DA 3WZMA 1FYWA 5D6OA 2WIGA 5K8TA 2XB4A 2EKBA 3E6AA 5CM9C 2ZIWB 3FUCA 3CMCO 3GX1A 4KN6A 4A73A 2E4ZA 2GT1A 1E5TA 4UEWA 1KDTA 4MUKA 4MWBA 1XK5A 2HCTA 2JJ1D 1LW7A 4RO0A 4OREX 1W1UA 1FSFA 3ZJ4A 2EDCA 2XUZA 2PRKA 5SY6A 2OXTA 3CFYA 4V0NA 2B7CA 4CMIB 5E9JA 1G9SA 3LUAA 1DKLA 3DYIA 3FG9A 5JEDA 3CG4A 2PMFA 4YRMA 5HDQA 1GPNA 3U2QA 4MLZA 1Y3DE 3R8XA 4DLWA 3TQQA 2FMAA 4GE3A 4MRRA 4D3FA 5B4UA 2ONKA 2HLHA 3AILA 4YCJA 1JH8A 2ZTVA 5IP7G 2H9IA 3GELA 3F74A 4GKKH 1BXGA 1USKA 1XXHE 1T26A 4MVJM 2JCVA 1QO0D 5ELMA 2DB3A 3DO5A 2O20A 3VISA 1UBLS 2CDCA 3RM3A 4UULA 2CDAA 2ZRIA 2QDXA 4NEGA 1VMIA 3TGWA 2OCBA 4RAQA 3AFMA 4DSTA 2HBZA 3AC0A 1Q12A 2ZRJA 3T9BA 1HMPA 3L5KA 4NSNA 3UOGA 4TYNA 4URHA 1N7GA 1GILA 5CU7A 1KZ4A 3U61B 2L69A 3MB8A 4E6PA 5EJ2A 2Z5LA 4GLOA 2QUIA 3BMOB 1GGMA 5EHNA 1EVQA 4QYSA 5CURA 3AY6A 1NQOA 2RC5A 3UMYA 1FTWA 1NF2A 3LDUA 1OKKD 3EGOA 2V03A 1E9BA 3PWZA 4PBSA 2WABA 4QNRA 3MXTA 1WM1A 4TVSA 1LI7A 4E5NA 2TMDA 1EM8B 2KQUA 1EB9A 4KVFA 3T1VA 4X3OA 2O2YA 3IUEA 2JF0A 2Q99A 3H4IA 1H1TA 4W4TA 5DX0A 3PO2G 3NYIA 4J3NA 1FVHA 4NYJR 4OB7A 4B71A 1M2NA 3SR3A 3CLTD 5I4CA 3RSGA 1BVHA 4CKBA 1XKQA