1B6RA

N5-carboxyaminoimidazole ribonucleotide synthetase from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
355
structure length
349
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQLARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
publication title Three-dimensional structure of N5-carboxyaminoimidazole ribonucleotide synthetase: a member of the ATP grasp protein superfamily.
pubmed doi rcsb
molecule tags Lyase
total genus 106
structure length 349
sequence length 355
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 1999-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1b6rA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1b6rA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b6rA01
3R5HA 1Z2OX 3JRWA 4FGRA 2FPIB 4DIMA 4EAAA 4ME6A 5C1PA 5JVLA 4O7YA 2W6PA 4FU0A 2V58A 2YWVA 3VA7A 3I12A 3LP8A 5JQGF 1KJIA 3WNZA 1PX2A 1OBGA 4J6EA 2W6ZA 4YJ2F 1A9XA 1I7LA 3JZIA 2R7MA 3VPDA 3HO8A 1GSAA 4IWXA 4O4HF 1VKZA 4O84A 3HB9A 2NU8B 2R7KA 3AX6A 2YZLA 2HGSA 1KJQA 2W6NA 3KALA 3BSWA 3Q2OA 4FFNA 2I8CA 4Y8VB 4IZOA 4M99A 1CQJB 5CB4F 4XYMB 2R7LA 1M0TA 1Z2PX 4GGMX 2GLTA 3R9RA 1KEEA 4I50F 4E4TA 4O7NA 4XYLB 3JZFA 2NU9B 3U54A 4O2BF 4MV6A 4L1KA 1JDBB 4TUYF 2Z02A 1EZ1A 3UFXB 5KKNB 3KAKA 5IYZF 4O4IF 3ORQA 2V59A 4MA0A 3R5FA 1M6VA 1E4EB 3RFCA 2V5AA 2WYOA 5I47A 1EUDB 1W96A 1C3OA 3V4SA 5C8YF 4EA9A 4FFOA 2J9GA 1JKJB 1VBGA 1SCUB 5KX5F 3GIDA 1BXRA 2CQYA 4ZOLF 3K5IA 3N8DA 2YYAA 4XX0B 5CA0F 1B6SA 2R84A 1A48A 1GSHA 4O86A 4M9CA 1KC7A 5DMXA 4O2AF 4M98A 3TIIA 2PN1A 3QFFA 5HV6A 2NPOA 2I87A 4M9UA 1DV2A 2R86A 4MV9A 2W6MA 1EYZA 2CNQA 1WR2A 3R5XA 1CQIB 2YS6A 4FFRA 4O7LA 2R82A 4MV1A 4IIJF 5GONF 4HQ6A 5J2TF 5LYJF 3RV4A 3K3PA 3VPCA 2VPQA 5LP6F 2FP4B 4HR7A 4ZI7F 5CAEB 3MWDA 2DLNA 4EGQA 2GPWA 2W6QA 4O82A 1KBLA 1GLVA 3ETJA 3DF7A 3GLKA 4FFPA 5LA6F 3MJFA 2XCLA 3E5NA 1CS0A 4YAKB 2GQRA 2QF7A 2VR1A 4ZQIA 5K2MA 4EABA 4NYEA 4TV9F 4YBZB 1UC8A 2YL2A 4O4JF 1Z2NX 4MV8A 2ZDGA 4WBNF 1M0WA 1EHIA 1T36A 2YZGA 5LXTF 2R85A 2R87A 3ETHA 2YW2A 2R7NA 4IHJF 4HNVA 3OUUA 3OUZA 2NUAB 3N6RA 5JVDF 3ORRA 4QSHA 2FPPB 2DZDA 5C1OA 4TV8F 2XD4A 4I4TF 3BSSA 1GGOA 1EUCB 5BMVF 1E4EA 1OBDA 1DIKA 5BPHA 4C5BA 3BFPA 2VQDA 3LWBA 1ULZA 3RUPA 2I80A 3BSYA 5CA1F 4RZQA 1CE8A 5BPFA 3AW8A 2YZMA 3V4ZA 4MA5A 3U55A 2FB9A 5J2UF 1PK8A 3R23A 3K5HA 4ZHQF 1JLLB 5HBRB 2SCUB 2PBZA 4C5AA 1W93A 3HBLA 2CNUA 3RV3A 1VBHA 4FFMA 4O7VA 3VPBA 3WO1A 4I55F 2W6OA 4HNTA 2W70A 3G8CA 3Q1KA 5FNVF 4XZ3B 4O7WA 1JDEA 1GSOA 4MV7A 2X0SA 2CNVA 1UC9A 4YJ3F 4MV3A 4EGJA 4C5CA 2YS7A 3TW6A 4HNUA 1I7NA 4MAMA 3TIGA 3JRXA 1AUXA 2ZDQA 4O4LF 3KAJA 1AUVA 3U9SA 1C30A 4O7RA 3VOTA 1BNCA 4MV4A 2R6FA 4EA7A 5D8DA 4YAJB 2FPGB 2W71A 4O81A 1KJ9A 4FE2A 1DV1A 3TQTA 4WD3A 1IOWA 4O83A 3BG5A 4YB8B 3G8DA 2Z04A 3NUAA 2GPSA 4FFLA 4O7TA 3SE7A 1IOVA 2QK4A 5EZYF 2HJWA 5H80A 3WO0A 2VHEA 2PVPA 3TINA 2YRXA 3MWEA 2NU7B 4O7SA 1KJ8A 4EG0A 2DWCA 2ZDHA 2NU6B 5LOVF 3VMMA 1B6RA 4O7ZA 3KREA 2CZGA 2IP4A 2YZNA 2GQSA 1KJJA 4DLKA 2YRWA 3U9TA 4IWYA 5JH7F 2DIKA 2P0AA 2OLSA 5JQWA 2C00A 1KUTA 4EA8A
chains in the Genus database with same CATH superfamily
2ODPA 4BP3A 4BNWA 4WZ6A 4C1NA 1Y7TA 4D3YA 5LBTA 4O7YA 2R8GA 1DXHA 2CVPA 5AVJA 4NMMA 1UBKS 1AQLA 3PEVA 4JJAA 3TCKA 3VPDA 2H16A 5J40A 3GPLA 1FOEB 3RASA 2D13A 3J81k 3HKEB 2XODA 3TM5A 4HGRA 1ORHA 2OBFA 4Y7CA 1TW3A 3G2IA 1AZTA 2X8WA 3WV4A 2C9ZA 1T0UA 1ID8A 2HMYB 3D31A 5DI3A 6AT1A 4CF3A 1UM9A 3TNDA 1AGXA 4UBKA 3QMMA 4RH0A 1IZ9A 5BSRA 1N6HA 2PCJA 2AMJA 4B0OA 1HRDA 2OYRA 4TMKA 3VYWA 1KNXA 2BRUA 2BMDA 4BNFA 1N6PA 1GNQA 1E9RA 3CX4A 3DAYA 4QT0A 3RIHA 1QFXA 1KJNA 3P4UA 4OL0A 4R7GA 3RIZA 2PMWB 3QEAZ 3ESAA 1YXMA 1EQAA 5I5YA 3DAPA 4ID3A 3GMIA 2IOHA 2ZTVA 4DLXA 2R8IA 1KXJA 1WNFA 3T12A 1Y8ZA 3CF2A 5KYTA 4DV6H 4JJ4A 1BE0A 4DC0A 1PWEA 2WG2A 2BGLA 3T5KA 5C8ZA 2QUIA 3NM5A 2WILA 3A9RA 3KWFA 3BHJA 4J1SA 2YUIA 2C58A 4E5MA 3FUXA 3I01A 2RGAA 2XYQA 4ZAWA 2ZR0A 4DNFA 4JI0H 3T5LA 1TADA 2ZZKA 1I14A 3S8YA 3M5CA 1XMXA 3ETDA 5KQLA 1M75A 2TYSB 4PXAA 4Y1RB 5LA6F 3C48A 3EK2A 4AQYH 2RGEA 1XAIA 3M6WA 3MUEA 4ASUD 1AK2A 2X2OA 5GJVC 3OOHA 3V8PA 1NYLA 2GEUA 3EVZA 1RCUA 4NVRA 1IBLH 3M49A 5ITSA 2ZBEA 3BMCB 1MJGA 2VHJA 1CD5A 2QRGA 3VSEA 2ZSEA 3ZDAA 3OTGA 4QWEA 3LKVA 3TKYA 3LXRA 2E2HA 5EZSA 2XYRA 5KJEA 2V3CC 4H6XA 3W5IA 2XD4A 1V0JA 4S1OA 2VSNA 3Q6IA 2B1JA 2RK6A 1CQPA 2I5PO 4ZC8A 2IYUA 2YWBA 4XCXA 2FWNA 2I34A 4KVAA 1VYHA 2BR5A 4JBIA 1K83A 4MVJM 2Q7XA 3TQCA 5GADl 1XA3A 4KXYA 4X62H 1XMIA 4HX9A 3BIOA 3HYSA 3RU9A 4Q5IA 3IPLA 3VPBA 3W5DA 4LUCA 5F7XA 5CLHA 1PEDA 4YQEA 1P1FA 2HLNA 5JSFA 2C2KA 4X1YB 2CKMA 2P4UA 2JA6G 4LMPA 1ZMXA 3OG9A 1UQTA 4X45A 3DPIA 2OESA 4MAMA 3WB2A 2YWCA 1TT5B 1SCBA 1KGSA 4XW2A 5BWLA 4L4SA 4ARAA 3TW8B 5DCYA 5I60A 4J90A 1IY2A 3IP3A 3MN1A 1A4RA 4GMKA 2GA8A 1ZETA 3GMTA 2RIPA 1X9HA 3IR7A 3CF4G 3KXDA 4JV5H 1IHPA 1ORRA 2A7QA 4M9QA 3R74A 2WWIA 5ENDA 1BE6A 4KDCA 4LFAH 3DYVA 4NF2A 2PE5A 4Y0NA 2QUBA 3C1UA 2PANA 2R48A 3GNTA 5BVGA 4LC1A 5K0ZA 1SU7A 1WBJB 3D2CA 1SU6A 4E1AA 1LPMA 2QRPA 5M7EA 1FS4A 1I3KA 3W1VA 3FCXA 5IDWA 2QOEA 2DIKA 1K0UA 3N8GA 5KYWA 4J1NA 2O0KA 2AQHA 4AYWA 2VWHA 3IQFA 4NPHA 1RAGA 5H7XA 4B3IA 2CT8A 3K09A 1JAIA 4LE1A 1DBIA 4YR2A 3NV9A 1Z2AA 3WQRA 2Q2QA 4O84A 2G08A 1ABFA 3HY4A 3JQRA 5D3MA 5ITVA 5LIPA 1OBCA 2QYHA 4MQMA 3V3KA 2ZT5A 1A9SA 4WHXA 4K6KA 1QOPB 5F1PA 4YMWA 3DZBA 2Z2XA 1QCCA 2JLXA 4QIHA 4Z4HA 1UPFA 5DVZA 2ZRNA 1OH8A 4NL4H 4RADA 4N47A 2Q9UA 3G2LA 1YOVA 1C50A 1P0QA 2BN4A 5AESA 2NP6A 1UBLS 4MWDA 5JQGB 3N0TA 1FSSA 3V7NA 2J9YB 4C7VA 4MIEA 2O8BA 4GD3Q 4RBNA 1WZEA 3MT8A 5BN4A 1Z5GA 4IXTA 2VK2A 1P7CA 3N8DA 5I5VA 1EK0A 4NZOA 1S0NA 3KZMA 4F93B 3EVTA 1JJAA 4RPCA 4F3NA 4LWPA 4G1CA 2JZNA 3X1XA 3FOZA 3TZHA 4PBSA 1QRTA 1DX4A 3A26A 9ABPA 2H9IA 4ZVUA 3N9IA 2AR0A 5BR8B 4Z4GA 4DR3H 4A3EG 2IEAA 5KQGA 1OOEA 3NPMA 1HUQA 1YF3A 3Q8RB 3BOSA 3X1MA 1T25A 4MI6A 4WASA 3N58A 2WIJA 4CLRA 1NVVQ 5IKPA 3K53A 5TB5A 2O7QA 4WUTA 1TYCA 4KAJA 4FC7A 5KT2A 5KMGA 1T9KA 1VFPA 3AHEA 3TB6A 1N8TA 4PPQA 3PSHA 3QY0A 3AEUA 5KS8A 4YHHH 3C8DA 5JY6A 4UM9D 4K0KH 1OAAA 1UBHS 5J2TB 1E4OA 3GHYA 5C4GB 1RK5A 1H0KA 3SOZA 4PLGA 5FKJA 1NMQA 3KOOA 2JIQA 3LY5A 1OI3A 4FYVA 1KEWA 3U17A 7GPBA 1BQ3A 5TIIA 1XQWA 3AW8A 5AXCA 2FU5C 2ASDA 4NK4A 4GMXA 2YWXA 2P6RA 3WADA 3QA9A 4Z4QA 4F04A 1QIDA 1VCHA 2AUMA 4QDKA 5YASA 5ELMA 3BIWA 5IHPA 4XJXA 2I4NA 4C2MA 4Z3KA 3PUKA 4RHTA 1LZLA 4UTRA 3QW2A 1CKOA 2AKEA 3NR2A 4BX9A 4C6TA 3PNKA 4A15A 4P86A 3OZRA 2B6HA 3ESRA 1C0LA 1P29A 3PLRA 1GA1A 1XAHA 4OXKA 1P7PA 2HIVA 1E61A 3AO0B 1KAGA 4WY2A 3TOZA 2GZMA 5ALIA 2QRZA 2OMEA 2P1ZA 3B8HA 4LSXA 1ZGJA 4KU4A 2GRJA 3NXKA 1JN0A 2C54A 3EA4A 1TTTA 1JAZA 5FO0A 4JI8H 5ILQA 1YS9A 3AVWA 5K09A 5BWWA 5FBHA 2P1RA 2VTBA 1L5MA 3KRTA 4RLSA 4Q43A 2Q49A 4ZZ3A 5KINB 5BP7A 3HJGA 4U0KA 3NBUA 4GVLA 5IP7G 3L7OA 4RANA 5G0VA 3RIGA 1CLUA 1GA6A 3TI9A 4LHZA 2XE7A 4NBWA 1T1EA 2IP4A 3VDNB 1LZKA 4FZ5A 2RC5A 2VOBA 1L5WA 4WCFB 2PKQP 2QX7A 1BXZA 2IV2X 2VL7A 2WP0A 2BH2A 4IJWA 1FDTA 1HE1C 1L6IA 5LA6A 4AJIA 4KFUA 2ZWAA 3RAFC 4XR9A 2QX6A 4FYMA 3NBXX 3KTDA 1ZUWA 1KZ7B 1T5HX 2E5FA 2IBKA 1M2VA 1RRGA 2QLTA 3WGUA 3KQNA 3IOYA 4M8SA 3SYRA 2I1VB 4COOA 3QXHA 1I4DD 3OE7D 2ERXA 2BFCA 2QN1A 4D8XA 3UW3A 4C0LA 1QIGA 2JK0A 1GUDA 2OKCA 3M9XA 5EESA 1RLTA 2BBSA 3TY8A 3OJLA 1PT8A 2DFDA 4GGMX 1HWYA 1M34E 3GTKA 1KEEA 2DFVA 5DOVA 3L41A 1GQOA 5BWVA 2ODQA 4WOPA 5DX1A 2G9RA 4CMCA 2GYYA 4V24A 3IERA 3HJFA 7REQB 4Z4CA 2WVHA 5DULA 2CYBA 2I2FA 1E18A 3F74A 5TS3A 5IC4A 2LKCA 1JR4A 4OIFA 1WTAA 2MSCB 2OV4A 1P62B 4D4JA 4NC9A 2A78A 1ORIA 3GUZA 2IQ5A 3TXYA 4CMEA 4MUKA 5LNK1 2BMJA 3BJZA 4PYLA 3V8MA 4DEYA 3I1FA 3EQ7A 4ALLA 2FHSA 3WP1B 3PGJA 4NDNE 3JQ7B 5HG0A 2XDQB 3K9GA 4MIYA 3Q5GA 2BMVA 1N8SA 4XWWA 4YUZA 1PN3A 2BKEA 5A05A 2FW8A 1F7VA 3HKDA 2H4WA 3EGWA 1C7EA 1GZSA 4Z86A 3GFVA 4JEUA 5F2OA 1NNUA 5DFAA 2IZOA 2QMYA 2V3VA 4EQ6B 1AZWA 1SUWA 1CDDA 4JI3H 3SXUB 1YVEI 3WHPA 1GPLA 4TLAA 3AL0C 4DLYA 1GLVA 2Y0SE 1FNDA 3H20A 5A71A 4EBEA 4YAWA 4RVDA 1FNBA 2QBYB 1NX9A 4CT4B 3RRZA 1WCIB 2BFDB 2W4QA 3OPYA 5IP9G 2RGWA 3IDOA 2YL2A 2IXFA 3ZW7A 4B3FX 2HHFB 4MV8A 1YZNA 1FZQA 3VZBA 1JR6A 1EPUA 3GVXA 2R7NA 1ECLA 2PHZA 3Q0TA 1CDEA 4A0GA 4FINA 3K2IA 3AONB 2JAOA 3G9ZA 2XA9A 1JXQA 3GA7A 3VAZA 4P2GA 1V37A 3A1EA 3K4QA 3RG2A 3LOPA 4YV1A 2H5JA 1BJRE 3NDBB 4LZZA 4PLHA 3A04A 2Q4TA 1ZISA 3WB1A 1SGWA 1Z75A 4F56A 2R8RA 1W5TA 3WIBA 9ATCA 1RVV1 4Y2VA 2VT3A 1ODFA 1P4JA 4BNDA 1U1IA 5A4KA 3EJ6A 5KIAA 4QW8A 4PYKA 3AF0A 1PK8A 2XMBA 5GIOE 3DV0B 2C2HA 4KR0A 3IQEA 1KDYA 1FIUA 4B4DA 2OK8A 1QO0D 4MZXA 1JLKA 3TOSA 2JGDA 4KE8A 1FFXB 5LB2A 2DH6A 5JPIA 4PG5A 3O90A 1Q0RA 5LZ5A 1M2GA 5BNIA 2OO7A 1ZC3A 2JFQA 1GKUB 5FBWB 4WCVA 5FTKA 4OHFA 4I8DA 1DOZA 3BILA 4PRYA 2IA6A 2BGUA 4IMRA 4GKAA 1EM8B 5AM5A 1CTQA 4DJ5X 2I6UA 5ARDA 5GWXA 3MIIA 1LBIA 2CDCA 3FG9A 3GRPA 5AD1A 4GNKA 1S4QA 2OB2A 1AKEA 2GBGA 1AKVA 4IDDA 5M34A 2J3IA 1T3HA 3H7AA 5K0GA 1O6CA 3IPAA 3KXIA 4BIMA 4IUCS 4R40A 3WHLA 2VAWA 3I6MA 4X6UA 5DWDA 4QYIB 2N75A 3WRYA 1X9IA 3R9IA 1VB3A 3P1JA 1UBJS 4HQ0A 4I4NA 3AVTA 4Z1OA 4BMYA 2INGX 3QTLA 4INZA 1BE8A 5M5BA 3DPSA 1C1XA 1HR0H 3FOAA 3RK0A 3SD7A 4LA4A 3BPSA 3LVQE 1YGPA 4PZYA 3C74A 1Y80A 4DUZB 3MAAC 5AICA 4BLRA 2BELA 4IO0A 4YUYA 3FE2A 2ZJ2A 1UKEA 3HFJA 3S29A 1M6YA 3IMEA 3U5ZB 2RK3A 4RK6A 1JAYA 5CBPA 1LRLA 3N2KA 4MI3A 5L53A 1N3LA 1OWPA 1YIAA 4R5HA 1NPYA 3TR0A 2RI0A 4MVWA 5HF8A 5C32A 1V16B 3QOWA 1Y8RB 4JU9A 2WMDA 5I9SA 4A6PA 5DBGA 5EDWA 2OBLA 2GD2A 1VPWA 5IYZA 3ZNQA 3KQLA 2O54A 4AF7A 2AC4A 4FN5A 4S24A 1JS1X 2BGRA 4DV1H 2QUZA 3HCRA 4LG1A 1GN8A 3EAGA 4MVJI 4RACA 2OLJA 3MRTA 2VZLA 3W05A 4JXKA 4P4SA 5CR9A 1N3BA 2HLDD 2VBFA 1GGVA 4PIVA 3QFHA 5TE9A 2J6HA 1B26A 3EWNA 4LJSA 3L8EA 3BIJA 1YJXA 2JF0A 2YV2A 1E1YA 2NGRA 3LHKA 1F60A 1H8HA 2HIAA 4OAQA 3K0AA 1XI2A 2XMSA 5ELLA 4H6PA 3SHOA 2X0KA 5CEEA 4YJ2B 5EIOA 1FVXA 3KYDA 3VZQA 3UWMA 2OENG 4U2EA 1OXBB 1WPXA 4GI2A 4I2NA 4RS4A 5CNJA 2ADFA 5AQEA 3NHAA 3O91A 5I8WA 1MVLA 4MJXA 2Z1NA 4CG1A 3VFDA 5AO9A 4B74A 1KVQA 4QM7A 3CBQA 3Q8SB 4WX2B 4BGUA 3A05A 3DG9A 4WIAA 1G5HA 3U3XA 5CB0A 4RENA 5KFIA 4DNOA 1YRBA 1UKVY 4FFRA 3UJHA 3BRQA 3TQSA 3TN7A 2O0HA 4B3GA 4IH9A 3DUFB 2JFWA 2H4HA 4IJUA 1NL3A 2F1IA 1RHRA 1SMKA 2A7XA 2J9FA 2OHXA 4PFJA 3S5UA 2XNDA 2NSDA 3C15C 3GLUA 3PPWA 4WAUA 5K2MA 2OXFA 3Q11A 1MHPA 2YNMA 4LVUA 1L7VC 1MB2A 5CA0B 3IRUA 3PDIA 2IS6A 3DFIA 4TL8A 2BLNA 3FHOA 2I2BA 1JQDA 1HEUA 3A6JA 3P0FA 3K70B 4WLVA 5AW6A 4JXUA 4FNGA 4U5QA 5EAIA 5F1OA 4HAZA 4ZGGA 4FFBA 1IQRA 1IYEA 1U4NA 1PV2A 3HJRA 2HMWA 1PJSA 5D86A 1L0BA 2ZI6A 3MMSA 1HE5A 2IPNA 5E7IA 4FHZA 2G80A 1FL9A 2XX3A 4KSCA 5BN5A 1O1YA 3QEMB 1WUTA 3TXAA 1PR4A 4N3GA 4DBLC 4FOTA 1O96A 4ZO9A 2GB4A 2FKNA 3ZK9A 3CLTC 1PCXA 3GEHA 2PVSA 4UVGA 4DRXB 1ULBA 1R8QA 2Q4OA 1Y63A 1EBFA 4O29A 4L8YA 4O0LA 3SYTA 1E5QA 1MR3F 5DE3A 4EKGA 5F23A 1KFBB 4C30A 1SPXA 4JFAA 4BFXA 3CEMA 1IHOA 3F5SA 5I5SA 4RIEA 1WDTA 4RMJA 4JV0A 1D4OA 2BRUC 3N0RA 1M6VB 4JS0A 2F00A 1YNSA 3TSOA 3NZEA 1UBOS 2CLOB 4N5LA 3SSOA 1I2DA 1Y4AE 2AN4A 4UXJA 2FXVA 2WV7A 4CMAA 1CIPA 3THWB 4QO7A 4QJ5A 2KM1A 3O3CA 2POQX 3FHLA 2VVTA 4IG4A 4NPCA 1XD2B 4V2UA 1EXMA 3KREA 4OUDA 2AI2A 4TWJA 3D6AA 1UM8A 3IB3A 3OQHA 2B8JA 5CHEA 1I7SB 3OI7A 1TCVA 3T4EA 1ZK0A 2WM9B 3MHPA 3RH0A 2ZB3A 5ANRB 3Q98A 2H6EA 5KREA 4GR4A 3E6AA 2BV3A 4F3YA 4CEIA 3H42B 2R1TB 3UH1A 3T5PA 4N8SA 1P1JA 3ZNOA 1RKUA 3EBOA 3E9ZA 4HPJB 4RDIA 1ZXXA 3BD6A 1LXCA 1K68A 2Q5FA 1P7YA 3O7WA 2YC4C 1VPDA 2JLQA 2WIBA 2IA5A 3WRVA 1TA9A 1RWOA 4HWRA 2O3TA 4TMWA 4H3KB 4GOOD 1QHXA 1R9JA 3SMVA 1THMA 2ATEA 4B2IA 2Q1WA 4KHZA 5BV2P 3IPRA 1EK6A 1QQ7A 5IDVA 2NU9B 3M4NA 3FVRA 5K3FA 4JI2H 1RXVA 1WV0A 5IWCA 4QLOA 3LLMA 4KQ1A 4AKTA 5PGMA 4O2AA 2C9OA 4MRNA 4K40A 4J0KA 3IP5A 3CLUD 3LPLA 4XPIA 3GQVA 2WVGA 2BIFA 3M34A 2P9FA 3JAKB 1YKGA 3OQNA 4B6JA 3CNBA 4A7PA 3SBXA 3PPYA 3HOUG 1IY0A 1NURA 3T3MB 3Q15C 3QVJA 3G3EA 2B7LA 4D82A 3FGNA 5IJWA 3P7MA 3C43A 3UQ8A 4A3GG 3ETGA 1C29B 4RMNA 2WWGA 1RADA 5KNCH 2XECA 1T8UA 2QVYX 5SZIA 2VPQA 1SN7A 4QRDA 5SYNA 2Z4SA 3NJ8A 2XITA 1FJ2A 2VUTA 1WWKA 4DV7B 2DPXA 2VHUA 1AIPA 3LQ1A 1HDGO 3LKBA 1VJ5A 4NFSA 1TK9A 1HEYA 3L40A 4MLPA 1JBKA 2R4UA 4BO5A 5JMTA 4X66B 1XRPA 1K97A 4OI4A 1XU4A 4LPKA 5EJEA 2W2NA 1VA5A 5KAMA 1GZHB 1FMFA 2AR9A 3CSUA 3HWWA 2CNWA 3LCJA 1WB4A 1B8VA 3WQHA 3KVYA 3EUFA 1YFKA 4RM3A 1RPTA 2Z2YA 4CKCB 5IAJA 1FP2A 1SH7A 2AOUA 1XZMA 3M4XA 4AY6A 1I24A 1PKXA 4L72A 1GZ3A 3AINA 2H92A 4JI7B 1Z0JA 2DMRA 3K2BA 3EHDA 4PWZA 5C1IA 1HLGA 3OSUA 1VLLA 5F2KA 3CG0A 2BMEA 2HMAA 3BK7A 3JQ8B 1FEZA 3NP7A 3GBVA 3JRNA 4GSLA 3R3VA 2IXGA 4LOKA 5CVVA 3IV6A 1MT0A 2A9OA 1DI0A 2R92A 4HP8A 3OPVA 5AOBA 4EGJA 1KMIY 3HEBA 1NM5A 3OMWA 3QKIA 3L49A 1LJ8A 1UJ5A 3DZFA 4UMFA 2FP4A 3IBSA 4Z49A 2BL4A 1GCOA 3QX3A 2J07A 3I2HA 4DXDA 4V1CA 2BDTA 4F2DA 4X20B 3TAUA 2Q3MA 2B0JA 3QF4A 4ZZ0A 2DT8A 5HW0A 2WM8A 4OTZA 4OQ4A 3EPRA 2QTNA 4QYMA 3ZDFA 1IUKA 2Y0BA 5C4XG 3ZE8A 3JS5A 3NBZC 3SE7A 3TFWA 2X1LA 1U8FO 4WBXC 3A0RB 1OGIA 4CLHA 1O03A 5BYBA 1U0JA 1PZMA 3IQIX 2C9CA 2ZJFA 4FNAA 2MCFA 1WLYA 1E4FT 1XP5A 4X44A 5CFMA 1N32B 3DE2X 1CUIA 2YMMA 1DWQA 1T4BA 4AZ3A 3DE3X 5EJ8A 1YONA 3UQZA 3LWDA 2O14A 3C6BA 1WHSB 4MGKR 4BFLA 1UINA 3KXPA 3OCXA 2WY2D 4ER7A 1H2WA 2YCHA 2L19A 3PFWO 4OKIA 2DY1A 4BQNA 4BN4A 1A9XA 4GBGA 1OH7A 2C2WA 3MT7A 1OVMA 1YUMA 1ID1A 4AN1A 5C5DA 3L7AA 2FN9A 4O59O 2MR5A 4KMOA 1NFQA 2BGJA 4GIBA 5J4HA 4UEWA 2O2DA 1IEQA 4PSVA 3A6FA 3GUHA 3I2FA 4GKJH 5KFJA 4MUEA 4J9RA 1Y1PA 3GLIB 3DT9A 3RADC 4BATA 1NT2A 4OLHA 3DBHA 4A8TA 2YDYA 3DBIA 3WGOA 2FK8A 3BUSA 1FDIA 2OV8A 2ES4A 2FCRA 4MUXA 3RFCA 2WYOA 1E2IA 4IGFA 2AN5A 2XVYA 3AMVA 3C5VA 1DGSA 4N7JA 4QYTA 2XCOA 5LZ8A 2XMPA 2VH1A 1ZOLA 1IAQA 5JD4A 2DM6A 1P9LA 2OBMA 4HUTA 3FYCA 1N0VC 4QEZA 3U39A 5KS2A 1PTJA 4TTVA 3V32A 3VH3A 3GLRA 3G2HA 4QGSA 2X40A 4DS3A 3NW9A 3PUWA 5BN3B 1MV5A 4JR1A 3HDJA 5AI8A 3U4DA 4J75A 3KVOA 3R0JA 2FN4A 1NXTA 1JIHA 3FDFA 1J8MF 4PPGA 2HSGA 4PHCA 2JEOA 1RYRA 4KO2S 2CCKA 2O8CB 2G0NA 3H1TA 4M1EA 1P1IA 4AWBA 1YQQA 5D5PA 4F4FA 3LFUA 3I83A 2OZPA 2Q5JA 4WH0A 3WY9A 1II8B 2Y1KA 3ZU3A 3RNLA 2IITA 1JSCA 1Z0UA 1DT3A 2YW9A 1GL6A 4DUYB 5DBIA 3KV3O 3PD7A 3VR3A 5LCXA 5B3JA 5BWBA 3NBAA 3SHFA 4PQYA 1KAEA 4FE4A 3I52A 3BN3A 1CNFA 4IEIA 2VDKB 2P75A 3EAQA 5AW0A 3FNIA 4QYIA 4M1WA 4MIKA 1UP4A 1AKNA 1QP7A 1XU7A 4L3OA 2BGIA 5FV4A 1NDQA 4AMZA 1ILWA 3H2SA 3IO5A 3D6NB 1HZZA 4BMSA 3Q9UA 3CW8X 3ZZ1A 4X41A 4P4TA 1BAPA 4OHCA 1B93A 2FLNA 3NHKA 5FL7A 3SJAA 1RRKA 2XCUA 4ZZ2A 4U2GA 2QD3A 5K0NA 2DAPA 3DE0X 5GJWC 3T3GA 4DXAA 3EZNA 3I9JA 4ARBA 2VT6A 2QUHA 2JBAA 1EM6A 4DLZA 1ZH2A 1H5NA 2VS1A 1KMNA 3Q1KA 5LYYA 1Z2DA 2RCNA 5BQXA 1YMUA 1VLZA 5JNLA 4P83A 3LL4A 3FLBA 4G9EA 1CHDA 3WWHA 1SK8A 1ISMA 4GMHA 1UDXA 3RIMA 3H9JA 1MX9A 3TX6A 2NVUA 1PNOA 2ZE7A 3GH1A 4Q4AA 3BGVA 4E94A 2FRVA 2O57A 4TRNA 3PEFA 1IY8A 2FLWA 1L1FA 5C52B 3PW5A 1R1DA 1JG1A 5KSWB 4JJGA 5DWQA 2QPAA 5BWOA 2P78A 5TLSA 1MX1A 5D8DA 3GLHA 5HRAA 1Z6QA 2CVZA 1I4LD 3AYXB 1U7DA 1NC3A 2XLCA 1NJFA 3IDZA 3IIMA 4EB3A 1UK9A 4KQEA 2CJWA 5DDIP 2VNAA 3HO1A 4OJQA 2NZWA 5H80A 2X8BA 3TR6A 3VH2A 1C9YA 3LCUA 4JH0A 1JR2A 3O8OA 1MOSA 2F2TA 1TZBA 3LVRE 2NU6B 4WGGA 4C89A 1U04A 5ALSA 4HEJA 4C3UA 3DNPA 4ADSG 4NZPA 4WZZA 5CYGA 1YS2X 4OB8A 3PR1A 1BHO1 2KSQA 5DGAA 4R8VA 3U4QB 1KUTA 3WR5A 4Q8FA 2A9PA 2HMVA 3PSAA 1RWBA 1M7GA 1TWFA 2VRNA 4UHCA 4FU0A 2V58A 4IDQA 4L16A 2H0AA 2Q2TA 1SBZA 2QAGB 3LZDA 1Z0ZA 4EVQA 4W8GA 5B53A 2BR4A 1E2UA 5JYEA 4EW6A 5K4HA 3ZDBA 1Q84A 1Z0AA 5JC8A 1OXUA 2GEDA 1N56A 1XG5A 3OBIA 2YV5A 4TKLA 4V3CA 3VAAA 2XRFA 1SRQA 2LDXA 5L1KA 4TTTS 1B6GA 1G19A 4LF5B 3T52A 4Y9SA 1X94A 1F4VA 3AJAA 4JHLA 3Q8QB 5IVDA 1SXJE 1KEZA 1Q6ZA 3I6QA 2G1PA 4U7GA 1E0KA 1WZCA 2JHCA 4ASUA 4YCCA 4QVIA 4XSVA 3E0XA 1K8XB 2FWAA 3EG9A 3RYFB 1TAEA 1LX6A 4K05A 4Q0YA 4GX1A 4A8JB 3GLSA 2G04A 4BWYA 2B4KA 4JI6H 1FUEA 3GJ0A 3HA2A 4M7PA 2YZ7A 5LMUH 5DZSA 1LVGA 2BKAA 4OLBA 2FLLA 4XIJA 1CZKA 1GQRA 2PZAA 1EGVB 4IIJF 3ZZNA 1SUSA 2G7ZA 4MRRA 1NW3A 1KQFA 3ZQUA 1JDVA 1NVTA 4HDMA 5TR9A 1OSNA 4X6YA 3IVCA 4B4KA 1CQXA 5KOHA 1Z74A 1RQ2A 1JZSA 1LDYA 3MJFA 3CZMA 3HLTA 1EHCA 2R6HA 5KTMA 4K9OA 2IUTA 2VR1A 2ASJA 4OSEA 2C2EA 4MB2A 3AYHB 1P0FA 5JD3A 5AW2A 2BCJQ 4Y8VA 2ZE8A 1Q11A 1MAAA 3N6RA 1KVSA 1WP9A 1SHZA 1BH2A 3ZV4A 3NYIA 4AYTA 1E99A 2IYEA 2AC7A 3C85A 3G0IA 3GNSA 5BQ5A 3THWA 1CPYA 2ZKLA 4OHYA 1NV8A 5KUTA 1OT3A 4MTDA 1T3NA 4NICA 1MOZA 2KBEA 3KLOA 1ZM9A 4UDXX 3OLXA 1BMDA 1JQ3A 3WBKA 4YFYA 3WZLA 3DDUA 5B4TA 3BA6A 2Y93A 1JR3E 3UGQA 3VHXA 3ME5A 1YK0A 1AN0A 3O21A 1H2EA 1Z4NA 2ATCA 3C8HA 4N54A 1PV1A 3ERCA 2DUJA 4ECEA 5AJZA 3VYSB 1XTJA 1TMYA 3LYUA 4JLVA 3KJQA 2Q3LA 4B3JA 3WKCA 2WJ6A 1NMYA 1YDFA 3LUPA 2TMYA 5JRZA 1G66A 2RCYA 4HDQB 5AVRA 3U4HA 2BZSA 1JHZA 4IOMA 4KLCA 5EIXA 1QU3A 3A11A 3KJEA 3R9WA 2C5EA 4RZXA 1S97A 1N0HA 4NIMA 4P84A 3F4KA 2PKCA 1U9ZA 1BN6A 4WJLA 3PXAA 3ZDDA 3EDCA 3VH4A 2HHAA 3NBYC 2GYVA 4JGBA 2NTJA 4MCIA 3KQUA 4HH3C 2PMDA 4D99A 4Q18A 2PKEA 2P4SA 4P32A 2WE6A 4WLEA 2BR0A 2ZRDA 1E7WA 3EA0A 1HOXA 2WNSA 3CX8A 2K7FA 4KK4A 1VXOA 2BE7A 4Q4LA 2XKBA 4E51A 1FQJA 1NXQA 2HC9A 4MRPA 4A3MG 1IN5A 4ETWA 2WW8A 3TZEA 2AKYA 1EFHA 1PX2A 4L4ZA 2QR3A 2QY9A 4RNNA 2AFIB 3KCNA 3AEYA 1NE7A 1MD9A 2HNKA 4ARZA 2YY5A 1O3YA 2BWJA 3ZV5A 2QIOA 3K70D 4DR5B 2RJ3A 1TZJA 4X9XA 4KOEC 3UT0A 1X0XA 2V4RA 2G4CA 2GEKA 2Y67A 4HFJA 1M0SA 3L7CA 2PZLA 3LQYA 4JJKA 4PS0A 4ALNA 4YXWD 4GF5A 2D7CA 2PX6A 3C6MA 3WRWA 2OG2A 1KERA 1XGKA 4RH1A 2IPOA 3ORQA 2JZCA 3KDSE 4LXIA 4MRAA 3V4LA 1IBKH 1VE6A 4EL5A 3HDVA 3WLSA 3SNHA 4XGIA 5DT2A 4D81A 1MP0A 2H63A 1XTPA 3K1TA 4IMIB 2J5XA 3WS7A 2Z6UA 3PO2G 1MAUA 2GF9A 2XIJA 2R84A 1YQ9A 3PIDA 1ATIA 3R0IA 4Q1AA 3RGZA 1OA0A 1FJGH 1D4FA 1Y3AA 1YH3A 1LWNA 3F46A 3EODA 1AKQA 3Q9SA 1I3QA 2CLEB 1A2OA 3T5CA 1A9QA 4RU1A 2Y77A 1XTZA 1O97C 1Z07A 1XQ6A 3OAAD 3W6PA 3VPCA 3ANMA 3OOSA 1S8OA 1PWHA 2QNRA 3IPYA 4PYNA 1HC7A 3CH7A 3TECE 2AFHA 4PLVA 3CRVA 2J9RA 1EDZA 4PNPA 4D5EA 4FLMA 2OHIA 4JYCA 4WKPA 3HHPA 1ZP6A 2HU2A 4L4YA 2HGXA 4GWKA 1SQGA 3GFQA 3DEFA 3KTAA 2NXCA 2OA0A 3IKJA 3G2NA 1QJCA 4JN6B 3WL3A 3H87A 1DJPA 5BXYA 1ULUA 4JB3A 1PV4A 1NJGA 2ZI7A 2WTNA 2XKAA 3KZOA 2NSLA 5LFAA 1M8JA 2QP4A 4FC6A 1G38A 3PQDA 4B82A 1NUAA 1G8YA 2GARA 1FVHA 4QYSA 1AS0A 3QKRB 1KP2A 2B35A 2PPVA 1NONA 2PIDA 5C7IO 4FX2A 2FPUA 3D2LA 1HDRA 2IYQA 3RJ0A 3QI7A 3RQSA 1HTWA 5EJ7A 4BC0A 4L9AA 1KRHA 4KB5A 5DXJA 2P6NA 4UVDA 2AGVA 4RE5A 2OLKA 2BFEB 3RUIA 5JJBA 2H51A 1QH9A 4KW7A 2ZJ3A 2I7CA 1FFEA 3ZLJA 4LRWA 3KKKA 3FLEA 5IJZA 4S04A 2PUWA 3TTYA 2OV3A 2H54A 4C76A 3KUCA 4G0XA 4ZJYA 2W9BA 4YCNA 3C7AA 4DSNA 3ZCPA 5CJJA 1A9TA 3ROXA 5TRTA 5IVPA 2O5RA 1I6UA 1FP1D 5AK0A 4UBNA 3WGYA 3GFGA 4MWCA 2P2YA 3GIMA 3L0CA 3B1FA 3CRMA 2HBYA 3VSBA 2WVAA 3OE7A 1P7VA 4CQMB 2NO4A 3D7NA 2VRWA 4MWEA 2A1TS 4JLSA 1Y1VG 2QTMA 1RM4A 1NQTA 4YAGA 1BS9A 3IT1A 4XA8A 3MWEA 3GFOA 3W5BA 3ILSA 2OTCA 2GFIA 3I01M 2WKSA 4IIJA 1ZNYA 4KNYA 2DY0A 1EUCA 5BSVA 1GUBA 4UPDA 1T43A 1VE7A 1JHYA 4V02A 5JCZA 4LWZA 2PO5A 4F72A 1E9FA 1X8JA 1YHZA 3AL2A 3L9XA 5CW2A 5LLDA 2CUKA 1M1NB 4ABYA 2W6ZA 5F1KA 4MWOA 3DQZA 1MJGM 2LCFA 3TD6A 1ZM2A 3UMMA 2VATA 2JI7A 2HHHH 2AF4C 3K0CC 4E6PA 3BSWA 4OB6A 2H5LA 3ZC3A 1O54A 4KYTA 3DYIA 2CZQA 1NVGA 2XF8A 1JFFB 5C80A 1SC9A 2GK6A 1PR3A 1S1MA 4LSZA 1IMJA 1PWZA 5IYZF 3FHCB 4MS3A 3QU7A 5HM8A 3D4OA 3L1HA 3DGEC 5CDSA 3KOXA 1K6XA 2XMRA 4R6XA 3L6BA 4DQLA 2J0UA 2OOSA 3KB8A 4RZRA 1HQYE 5F33A 2IVFA 5I9TA 4WI1A 4BNUA 4UCRA 2E9SA 2BP7A 5CLIA 4XH9B 1EESA 4TYNA 2AQ4A 1QF7A 4Q4JA 1KDTA 2QS9A 1JB9A 1K1EA 1HNWB 2LGJA 5F9LA 4JI0B 2FLVA 3HDGA 5GIPE 1LSOA 1M2OB 1T4DA 1QAMA 1UEXC 2BDEA 1BCSB 4ZU6X 4AQYB 1FUKA 1NM5C 1WE2A 4FHCA 1E3QA 1SVSA 4D41A 4N5MA 4HHEA 3AP2A 2OH2A 2B34A 1GVNB 1IBLB 2IH4A 2PL9A 3LHFA 4JBNA 1Z56C 5I9IA 3VVLA 3PXDA 3QVUA 3Q8KA 4MJ3A 1WCXA 4E5KA 3T0IA 5L3SA 3A2MA 4GECA 1W0KD 4B4OA 1VSUA 2ZBQA 3TJZA 4HMOA 4FYJA 1GZ6A 2W98A 3QELB 5JSQA 2TS1A 3QBVA 3FPLA 3GRYA 3LXXA 4UQLA 5C8DA 4I1PA 2OHFA 2ASEA 1M7JA 1YMQA 2VP2A 1XQYA 5CYFA 1JIVA 1KI6A 3STHA 1RPZA 2VDPB 5DTEA 4KVFA 3AQ4A 1AUOA 1JRLA 3FB4A 3U3OA 5K6AC 3LPMA 3NP9A 2GXUA 4Z2YA 3AXTA 1KRXA 2JA5A 1TUEA 2OCIA 1W1WA 3OA0A 2CLCX 3MD0A 2I6GA 1S6YA 1W9HA 5EN4A 4TQUS 2X19A 3UMGA 2Z6AA 4XEUA 1V47A 1INLA 3UWKA 4PO1A 1EB9A 4FDVA 3P9KA 2B82A 2ZETA 2C03A 1G3IA 5AXDA 3FZNA 3VHQA 3T54A 2WIDA 5FL3A 1A8IA 2W2TA 4GMDA 5K0LA 3G2OA 5TEWA 2D1SA 3QV2A 3BB1A 3S44A 1T6XA 5ILOA 1Y1QA 1KK2A 5FTWA 3FZGA 2F6RA 3KR1A 4NU8X 4NJMB 2F1OA 2H3EA 1USUA 2EX0A 2I3AA 1UJMA 1EP2B 4B32A 4U7JA 3ZWYA 3Q7RA 1EUYA 1U80A 1R10A 1XTKA 2Q8QA 1QLWA 4NFYA 1F0KA 1HOTA 2RHGB 3LVBA 1Y3HA 4U9IS 5AYVA 4JB0A 2F59A 2IEYA 1EFKA 2RG1A 1KEKA 4M46A 2Q0QA 4DCPA 4XGKA 5KYUA 5C18A 4MGYR 4HB0A 4N9WA 1SEVA 1PTJC 4B6SA 2W2QA 4BGIA 1X1SA 2Q6VA 3BTVA 4OL9A 1ISPA 1R3DA 2H17A 2OE2A 1BC5A 3C0FB 2HLDA 4NU0A 2CKZB 5F78A 5L9AA 4BLTA 3OZUA 4HXEB 1NQAO 4G01B 5SY6A 3D6MA 1YS7A 2GZSA 3GDWA 4RJKA 3QA3E 4REMA 1ZVQA 4QGBA 3HXOA 3KOUA 1Z5ZA 1E64A 4EJ2A 2W37A 4YN3A 3J7TA 3AUXA 4G5RA 1YBVA 5JLJA 5C53B 3G7SA 3O03A 5IC6A 2O6LA 4ZT4A 4DRZA 2REOA 1B2RA 5AK5A 1YFZA 5EQTA 1UMCB 1M33A 1PQ4A 5BORA 1PDWA 5I5WA 5JQGF 5FD5A 5DHAA 1MT3A 1KZ6A 3LGAA 2E4XA 2XCRB 2HWKA 3LQSA 1EVYA 5B3JC 4CMHA 4L5IA 2OD7A 1YA8A 3NHRA 1ECPA 4PXYA 4PGAA 4B6RA 1VYVA 5HKBA 3KCQA 5KG3A 1G21E 4UPEA 5HEKA 4LOLA 3A6HA 3HGQA 3QVGB 4DCNA 1J49A 3A06A 1CFZA 3RIXA 4BJHB 4J9MA 3N44B 4BY9E 2PKQO 4LNAA 1EFVB 2ZJ8A 1MGPA 4QG7A 5MFPA 3BFKA 1EE1A 4HRXA 3JQFA 1HZZC 3H0CA 3JASB 1D6JA 3UKDA 1Z2EA 4JC5A 3TJRA 2R65A 4MRSA 5IT5A 4UCUA 1DC4A 1CX9B 2CEAA 3R3SA 1DOHA 2EBUA 2W4IA 4YPOA 4OGLA 4N4AA 2NYUA 4QWCA 1UMBA 2IV7A 4DMCA 4HLQB 1QM5A 2O52A 3IBGA 4FYYA 1AKTA 3U61B 4UCXA 3RC9A 5AM1A 2ZS9A 2GM3A 2R1UA 4MUIA 2YCLA 3HUTA 1TT7A 1FQKA 5DYIA 4O2AF 4EEQA 4CM1A 2YJ5A 1K98A 4CDNA 3R7FA 5E6RB 5J2TF 4YK7A 1HV8A 3CKMA 3NVMB 4OGWA 2WYIA 4ZEVA 5ADUS 1PSZA 4OJNA 5MN6A 1XK6A 4JQCA 4M38A 3HB7A 2AQIA 4EMTA 4YHHB 5H83A 1UBUS 1CJVC 1UKYA 3C7KA 3HKEA 1EQUA 4XPZA 3HJCA 1M0EA 4H18A 1WCYA 3QOFA 2OK7A 3RWOA 4KRFA 5CH8A 5CEFA 1QIHA 3KU4A 5C8VA 1O58A 2IS4A 4MPJA 5AKKA 3H40A 3T38A 1TZCA 3K4HA 1YA4A 1LJUA 4K9MA 2VJDA 3SVLA 1KVTA 5KAPA 3BCRA 1Q0TA 3EXHC 1VCIA 5FORA 2M1ZA 3OF5A 5IAAA 2R8OA 3KETA 3EVAA 3CRW1 5B6PA 4P7BA 4JP3A 5ADHA 4M1YA 2VQ3A 5J63A 2AG6A 4EDFA 3W9YA 5EIWA 1GPBA 3OUTA 4RABA 2QY6A 3R7DA 5HSGA 3SIRA 4K87A 1FLNA 2FHPA 2OC9A 1ZGGA 2GHIA 5AW9A 2DFNA 3NKFA 4LYDA 4JI8B 1N78A 3R3HA 4BBJA 4EUFA 4LGMA 4HVCA 4S1WA 3W7VA 3J7AC 3T1YH 1ZN9A 2ZR7A 4V38A 1JSLA 4KQKA 3UK7A 3SR4A 1C8VB 4Y1RA 2PO7A 1T0JB 4AJOA 3NWJA 3ZPXA 4ZIRB 1MB3A 3GPDG 2RMKA 4IEEA 3S70A 4C4SA 5DQHA 1IRXA 4Z9BA 1NG9A 3BMCA 1IOVA 4M1KA 4KXWA 4O2RA 1ZNXA 3ENZA 4LQDA 3A1CA 4GRAA 1WLSA 3DLAA 4O7SA 1XKQA 2RHTA 3RAGA 3L0IB 3C3WA 1KJJA 4DLKA 2Z2JA 5C7YA 3SKYA 1XVTA 2UVQA 4O4LB 2RHRA 1XZFA 2P5TB 1QG6A 3HBNA 2CXTA 2ZSIA 1SQFA 3UAYA 3V42A 2CLFB 3G6XA 3A6KA 4KAAA 3IEKA 2B36A 1QRUA 2IPMA 2FQYA 1NIJA 2HXSA 1CVLA 1KQOA 1UANA 1EDBA 2I55A 1UKBA 3C8ZA 3F1LA 4RTOA 3GR6A 2NNWB 4B3HA 3DDOA 2PMFA 4K1XA 4HDSB 3L05A 4X1YA 1CY4A 5BSWA 4OQEA 1DOAA 4TZKA 4IIEA 3AUKA 4NBUA 2YDXA 1Y33E 1TT5A 1JDBB 1K3TA 2Z02A 2CV1A 1O5IA 1J9EA 2Q6IA 5L4LA 3D3WB 3TW8A 2AK3A 1Y1WA 3BJYA 4RY8A 4TXLA 4OXRA 2PRJA 1LEHA 4OM8A 5PNTA 4S1PA 4MKGA 2R11A 1RCTE 1P73A 4B5KA 1NOIA 5JOQA 5T8KA 3SX4A 4YJGB 3JD3A 3MLEA 2EX1A 1FF9A 1S3GA 5F76A 4ER3A 4XD7D 3DS8A 1ZVVA 4WXHA 2ODBA 2ZB2A 4JI3B 1A96A 4MW2A 1HM5A 4RKFA 2PX2A 2D6FA 4CLDA 5TXGA 2JI8A 1Q7EA 1LV8A 3BA1A 1GR0A 1CQIB 4BKUA 3VKUA 5JZOA 2BBTA 2AYZA 5GVRA 1TRHA 1EA7A 3BC1A 1PL7A 2QG4A 4RDHA 3CZAA 1W6UA 1PT6A 4UZSA 1RJDA 2C4UA 4N0QA 1NV9A 2ZTUA 4FBMA 1GRQA 2VLIA 3IIJA 3TRIA 3GDEA 1L4LA 3FPGA 4L9SA 4AZTA 1TCCA 2CE7A 4FEGA 3OUZA 3PYLA 3DP9A 1WKBA 2PMBA 3ZU5A 2QENA 3GJQA 3K9HA 3RVSA 1LSJA 2XHEA 4NX2A 4KQ9A 3U6BA 4JQZA 2CDNA 4MVYA 3HJUA 5JMWA 5EWLB 2V4MA 4J2OA 4FOOA 4P5PA 4DL3A 2CWDA 4R2XA 5BPHA 3LWBA 5FA5A 3UJ6A 5JQGA 4EUNA 3KEFA 3HCCA 2H2AA 1P4GA 3NBQA 4UUPA 3QXJA 3T9DA 5DX0A 2UYHA 1J06A 4LHXA 4U00A 5LKRA 1FP6A 5FI3A 2QSUA 4JROA 2VSOA 3I2GA 2Z95A 4JX9A 4GYYA 3DDHA 5AUNB 4UNIA 1NXXA 4R2HA 1RHUA 3I5MA 4GICA 1YVPA 3N07A 2OZVA 1Z0IA 3JYOA 4MPPA 4E5YA 3BXGA 5C5JA 1J09A 1U8CB 1AH2A 1OZ0A 1YUNA 3G02A 3UWOA 1WD5A 5BSTA 2C9MA 4H0CA 3QTTA 1VP3A 2V3WA 5KFAA 3I8SA 1SOVA 1Z2CA 2A5DA 1V3TA 4MLZA 1W59A 3KC2A 1HR0B 4PZ7A 5TEVA 4P82A 4YS6A 4IRXA 1JFVA 2HWWA 5FUXA 1E3DA 3CC8A 2FK2A 3X44A 4QEKA 3TTWA 2YMQA 2F3SA 5B57C 2DFPA 2DB3A 2QRVB 4ED8A 2FG7C 2QM8A 1GAEO 4L9RA 2WJJA 2D4HA 4EG3A 1S68A 4FQ5A 1QMPA 4X1OA 2VYFA 4QUJA 4ERXA 4DLUA 5KSOA 4LOHA 5J2TA 2JIZD 4Q19A 4ZQBA 2IEGA 3KQMA 2HCBA 2KW5A 3VTKA 2F55A 3TZKA 4DV1B 3VVMA 4Z9FA 1ZJJA 3DW1X 2RDMA 2GPJA 3MIZA 3P32A 1N25A 5GY7A 3MTEA 3M9MB 1X13A 4GL2A 5E7JA 1BCSA 1Q7BA 4IRCA 4BJ3A 4MW9A 1I6MA 2XZOA 3PW4A 2D1YA 3H5NA 1S8FA 4YJ2F 3HO6A 1I1QB 4XOIA 2XB9A 3S1AB 2IYSA 3D6JA 5T3YA 1G8HA 3MWYW 4DL2A 3STUA 4J16A 2KB0A 3KALA 2QU8A 1W4AA 4MW4A 5CT9A 1J1IA 4C03A 3KKPA 1G64A 4JENA 4TOIA 3OCWA 5J4LA 1FPQA 4JC8A 2V6MA 2B6NA 4EFNA 1S2LA 3DT6A 5JAHA 4CXMA 2WEKA 5B7GA 3B2QA 2ZATA 2FMKA 2Z30A 2ZU6A 3ZY4A 2AYXA 4AM8A 2AQKA 1JDZA 2RGUA 1QNLA 4ILEA 1CEXA 3KLBA 4QE3A 4L22A 4LFCB 4QWAA 5TX7A 5FDFA 521PA 1K9VF 1RC1A 1PS8A 5IAGA 3WVNA 2OAEA 3OX2A 5CA0F 2N1BA 3TAXA 4QNRA 2IHZA 3RTBA 3K09C 4GBED 5E7QA 5B1HA 3X2EA 3BZWA 4L8VA 4EP1A 3DMFA 5HDBB 1X7ZB 2YJ6A 4WCFA 5FOVA 1ZSNA 3ND5A 5CW1A 2WC1A 3NETA 3I61A 1BG6A 2A0YA 4S1NA 3VR0A 1B8OA 4PZCA 1GRCA 4I46A 1UDRA 4BBRG 1Q0PA 1ZICA 3M7IA 1A7KA 1PNVA 4PBTA 4BKRA 4BRSA 1P8JA 2G4LA 4IG9A 4URWR 4YJFB 8ABPA 5BUCA 4QDJA 3BDIA 4OHPA 1LPSA 1U9IA 1S1CA 5DB4A 1IZZA 4CQMD 3VX3A 3ZV6A 3MUNA 3RFFA 1Y9EA 3H8SA 4RCZA 2VDNB 4CODB 1M83A 2DBQA 2R6GA 4MUFA 2PZGA 4DWVA 4HN9A 1JPNA 4DL9A 4Q37A 4K6MA 3VH1A 2UKDA 2GHQA 2JLWA 1RXEA 2ORED 2OQIA 2HWUA 2PZMA 3S68A 6GPBA 7REQA 4P38A 4PY2A 1XD8A 1YQDA 1EWRA 4LEIA 1KWGA 3WFIA 3MEQA 4JYAB 2FDXA 2PUDA 4IM7A 3A6GA 2IWHA 2FOLA 2BUCA 4EHHA 1FRZA 4OYHA 4BMNA 5DHTA 1UNNC 4YA6A 4IRDA 4W5TA 3QUBA 1V1RB 1UMDB 5FOUA 1DU4A 5KTYA 3RDPA 2H1SA 1ZFNA 4LHVA 1R8YA 5DCUA 3JQ7A 1I7PA 4O7VA 3AVVA 5KT4A 2XDQA 1N33B 5F3DA 4RQUA 1GPAA 2CJPA 1T2DA 4G1FA 1UMCA 1OXXK 5BNZA 4A93G 3GXOA 4WTOA 1EXWA 3WKEA 4A03A 2PYIA 4PS1A 1GQYA 2YWDA 1GLGA 4FHEA 2YS7A 4C04A 2WTEA 5L3VA 2F8SA 4UAVA 3IUSA 5FP0A 4EQ6A 1T26A 4FQ8A 3QQPA 3ZCSA 5DLQC 3SXUA 2YWGA 4QL3A 4ZQGA 5F7OA 3O4IA 1KKMA 2WUWE 2G71A 2QBYA 2DPMA 3QVGA 3PQFA 1WCIA 2BFDA 5H9WA 3DAHA 4GLJA 3KXYT 3FPAA 4RXTA 2HHFA 1PX0A 3IT3A 3KOWA 4M7EA 4F12A 1I7DA 1T1JA 1GYPA 3R20A 3IXMA 1VDMA 3QSGA 4X65B 1F17A 1MO6A 3KOZA 1XCLA 1XBTA 3AEKB 1QF6A 1TAQA 5SY4A 1G16A 3UH0A 2VBCA 5BRAA 4B46A 3WGLA 1XWIA 2WF8A 2IUFA 1V6SA 3H1FA 3HY6A 4ED9A 3T5DA 2ZIZA 2J6BA 5ICGA 1H9BA 2WTXA 2ACEA 1L4UA 5CX1B 3NRJA 3VR2A 4B7CA 4POOA 4IIUA 4QQ8A 1I1OA 2QVZX 3QEOA 3DV0A 1GDDA 5TT0A 3U7EB 3V6KA 4TZTA 5FWNA 3RRBA 1FFXA 2QR5A 4B8WA 1Z36A 5HP4A 1GNLA 2V6BA 5SYMA 4KVZA 3DQQA 2YJ3A 2YFHA 1WF3A 2H2IA 3H97A 3IAXA 2HEGA 1M6EX 2HGSA 1GRNA 2AOVA 1EM8A 5K05A 3NOQA 2XTNA 1ZCZA 4G9GA 1TCUA 3LUHA 4BRUA 3R9RA 1PGNA 4LF6B 4LTDA 1D2AA 1XPJA 1DCKA 3OVMA 3KYCB 2R93A 4GR9A 1Z38A 3AHFA 1CKMA 1HZJA 5EC8A 1W96A 4RHCA 1SUAA 4B3MH 4F4XA 3BORA 1VL1A 4PC7A 4TXJA 4AY3A 5I51A 4L5YA 1GADO 1X7DA 3MAGA 3L0DA 3PFNA 1KJWA 3LYAA 3OQ6A 4NHEA 2Z6VA 1E5TA 1EX9A 4AYBA 5L1JA 2EZ4A 3QENA 2QVBA 4AKIA 4M8LA 4B0PA 2DECA 4WWHA 1MNAA 1J9GA 1TUBB 3UHJA 4PICA 2RAFA 4NCBA 4OJYA 4MR8B 2VYQA 3D02A 4MQBA 2X6RA 2XC9A 4MKFA 1ZOIA 1G8SA 3R7LA 2BEUB 4KACA 3NI2A 1S01A 5GJCA 3GEMA 2R1VB 5KYKA 4F6CA 3BVPA 1B73A 4CQJA 3SIXA 2RAUA 3WNQA 2OFWA 1G3RA 5EP2A 1TVEA 2QD2A 1V16A 1ZI8A 2POCA 1Y8RA 3JQBA 1BFKA 2J45A 4LQ4A 4MQ6A 3OA2A 4GLFA 4L6IA 5FOSA 3R3WA 3ID6C 2VWPA 4R8UB 4LDQA 2RIRA 4J0GA 1O5TA 2VUSA 2C3YA 3EDMA 2NXWA 2EATA 2Q0SA 3GP5A 2C95A 1VL6A 3QWBA 1KOLA 4HVLA 3OPYI 5HCUA 3NJ4A 3FGOA 4KXFB 4CMEC 1Z29A 4HYYA 3ZWNA 2CNLA 4II2A 4UUMA 5LYJB 1ZRNA 3V4RA 3KQTA 4ZYYA 1U94A 4P6VF 2EVWX 2PU7A 3BRWD 5DWVA 3H2BA 2FETA 3S1LA 3VO9A 4AWAA 2VAPA 4YJ2A 5FTNA 1XD9A 2QNIA 3AWIA 2CMGA 5DM4A 4F91B 1KSGA 4PZ6A 4I14A 4OH1A 2JFYA 4WCDA 1T2NA 4BO7A 1V5GA 4EWLA 1EGHA 3AF6A 1A3GA 1GU1A 3BSFA 1OC2A 4YMVA 4RK4A 3KHSA 4ZOQI 5HCNA 2O8DB 4OGFA 5CVEA 3USZA 3DKPA 3FN4A 5REQB 1NNEA 1NJ6A 3SDZA 2ISQA 4RHUA 3KSRA 5CLLA 3S6JA 3H5WA 3QVVA 1BX3A 3GILA 4WKOA 1XHLA 3E84A 4PZPA 5F9NA 3FA2A 4DQUA 1ZJZA 2IUEA 1ADFA 4DLAA 4DAOA 3TQFA 4Q9KA 4DLLA 1K6MA 2YXDA 3DUFA 2BTQB 2BI8A 5E4YA 6Q21A 2F17A 1ICIA 5COQA 1LW7A 2QL9A 4IAOA 5C8XA 3GLGB 4XM1A 5ADVA 4X1IB 1FFWA 2VSQA 1G8JA 5CA0A 4QOSA 4I7HA 1G7RA 3VYTB 3RHTA 4X90A 3F6RA 1EMDA 4MTEA 5IZCA 3P9XA 1HSZA 5FNVB 2WB2A 2FDCA 4MWZA 2CDRA 4Y98A 1J0DA 2VSYA 3LO5A 4YXWA 4L8GA 2O20A 2PZ8A 3GRRA 2JVKA 3H2HA 1JQJC 1QDEA 3WGMA 1RRFA 5ITZB 2VFAA 4EYOA 3QEMA 3DBVO 3MC1A 2C42A 4G5YA 5ENZA 3WMWA 4GKJB 4ENSA 2FQQA 1WP4A 2XQGA 2GZAA 4UULA 5FRDA 4LE0A 2OQVA 4DRXA 2COGA 4IFTA 2QVLA 1LI4A 3RROA 3HB9A 1RNLA 4O08A 3CZ9A 4JELA 2NADA 2YKGA 3HVRA 2BGNA 4XYMB 1HL3A 1B3RA 2FSVA 3PX2A 1CJSA 2UYCA 3WRYC 4RESA 3WLNA 1J2UA 2VJOA 4UD6A 1SNYA 3OAAA 3T5HA 3ZVKA 1PJZA 3HNOA 1EZ1A 3WBFA 3UFXB 5DO9A 3OJEA 4H7PA 5BW4A 1BDIA 1OX5A 4ZOEA 5FLXW 1M6VA 4EGFA 4WHMA 2WAXA 4ND2A 5TQJA 3I5UA 2XVXA 3V33A 4O5OA 3R0QA 1I94H 4JBHA 1V4YA 3ZOZA 3RREA 5KCZA 4BVFA 4N5HX 2PS1A 1DPFA 2XRYA 5FPQA 2C8LA 1Y6GA 3CNLA 2HHJA 4F4CA 1ZONA 1PUJA 4YJHB 4IY1A 3AXSA 1XD2A 1QPBA 2YFKA 4EG5A 2P0YA 4WOBA 4CIAA 3HH8A 1CUSA 5JWRA 2LIPA 3UB3A 1O5OA 4PE5B 3E0QA 3K3PA 3W3AD 3R7WB 4JBXA 2WRZA 4HAXA 4G0VA 1V1JA 1NQOA 5I5XA 2A6PA 1W7AA 1V45E 2R1TA 5BUQA 2ANBA 5IVKA 2EGUA 3JYLA 4MMXB 3WL4A 1ADBA 1TVKB 3A4IA 5CP8A 4CM9D 1NI3A 3W1BA 3QYJA 5LQJA 2HQ1A 3A9SA 1UC8A 1ZESA 4GM1A 2BPOA 2DOKA 1JIQA 3H9QA 4P7GA 4XVQA 3UVEA 4J9QA 1MW8X 2OAP1 5FWAA 2J6CA 2NU9A 4BE7B 3TGLA 4EEXA 2DZDA 1A4IA 3Q7EA 2VPXA 4MR9B 1TYBE 1OREA 2QW0X 1W88B 2JBHA 1EBBA 1BQ4A 1SC4A 2JJYA 1H65A 1V95A 3U4GA 3CLUC 1DO2A 5KFSA 1W2HA 2OD9A 2GCOB 5FT9A 4QBHA 3VU1A 2GUWA 1OTXA 1J0BA 4QX6A 3OQJA 4GP9A 5BPFA 1TKAA 5F4ZA 4KZPA 3IAM6 2R1ZA 4GLXA 4KITB 3JAKA 2M9MA 4LZNA 3GH3A 2QI9F 3SWWA 4MV5A 1F8UA 4UXHA 4HAIA 3VKGA 4Y6QA 3R8XA 5HTKA 3OZTA 1P6QA 2AF3C 3CZPA 4HDOB 2CY0A 1SFOA 1XLUA 2X9LA 3INTA 1BXKA 3H3XA 5BYJA 4QARA 1RAFA 1XMSA 1VXRA 3TPCA 2X3UA 3AR8A 4GVPA 5JCXA 4B73A 1LPNA 2Z56A 4P1ZA 1VG8A 3ZWKA 4E13A 2OKGA 5C8YB 1SVNA 4DPKA 3D0KA 3DTVB 2YNMC 2I7VA 2Y4NA 4R1SA 2G4VA 5JYDA 2ROQA 1Y1LA 3D8RA 4XCQA 3N0XA 3TDNA 2O8FB 3LT5A 5G41A 1D6SA 4LXQA 3OP1A 4X60A 3AUJB 1JH8A 4QWBA 4M9XA 3VOTA 3IEVA 3TEJA 3OFVA 3T34A 2VWGA 4RPHA 5T8KC 3V6MA 2I91A 3UATA 2C2BA 2YXPX 5FBLB 3LUCA 1KO1A 3FRHA 1XL1A 1OTHA 4R8MA 3GJSA 5AKEA 1OVGA 1RWVA 2E55A 1NZDA 3PGLA 2C2MA 2AFRA 3HR7A 1N1MA 1JXLA 1COZA 3ROQA 1IJKA 1SK9A 1II0A 3TR5A 4L2IB 1GKYA 3PX3A 2RKBA 2GHRA 4DG8A 1HLDA 2C4HA 3TRJA 2C7VA 4U6QA 2FPMA 3OZCA 5CB6A 2X8JB 2XAAA 4CKCA 4POAA 5KSYA 4EJ0A 2GTHA 1CRPA 4F2GA 1AJEA 3Q2KA 3GEGA 2KE5A 5K4GA 4ZDJA 3OE5A 1XZKA 3G9UA 4TVSA 2NIPA 4LF7H 1JECA 4LDNA 3U7GA 1R9GA 1UJ2A 3GZJA 4R2WA 1PT5A 4KXLA 2AE2A 2B30A 4TL7A 3SNOA 3BACA 2GJ9A 3ONVA 3PNPA 3JQ8A 3IEIA 4Q6WA 5H68A 4W1RA 3RYIB 2IXDA 4PCAA 5HS6A 2A33A 2I3BA 5F51A 1E9CA 5TMBA 1P7WA 1JHMA 1A82A 1RYNA 2ZWPA 1U1GA 5NLLA 1F5SA 3VNBA 3ZGYA 3DGFC 4P5DA 3WK8A 2CCJA 4BCBA 1FLAA 4ZVOA 1MG0A 2WKWA 4JLOA 3KHLA 1R64A 3OM1A 2NOAA 4G5QA 3O8NA 1L1RA 1TQ4A 5H3HA 5AW5A 2VG8A 3FSEA 1W0KA 4X20A 4JT2A 1BU8A 4YQWA 3X0DA 1E3WB 4JI6B 1AGYA 5EVCA 4EENA 3GJRA 4MQEB 2EKDA 4W9RA 5LMUB 3QLEA 4B3DA 1L4BA 3DOFA 1IG3A 1WX1A 5AWFC 3A6PC 3WJ7A 3MGGA 4EW3A 2IHVA 1DKOA 1A48A 1JHVA 3W5UA 4DR6B 4BLOA 2WOOA 2XJ9A 4RVOA 1KXZA 4EKYA 5LUAA 1M2NA 2R5FA 4OP1A 1D6MA 2GAOA 6ABPA 1H0RA 4ZQCB 5EMLA 4G1VA 2R8JA 1PKEA 4C7BA 3EUEA 3T5AA 2FCAA 5JJ5A 2W4MA 1C1YA 2C99A 2CWWA 5EZYB 1OXTA 2A9RA 4PG7A 3BAFA 1QH1B 1FDRA 1R7RA 1WHSA 2VHYA 4B4UA 5I3ZA 4GYWA 3GA5A 4HMPA 1G3MA 2Q1UA 1WL8A 1CUCA 4H15A 5ARCA 3H8WA 4WNAB 4UCTA 4KLZA 1J25A 2RI6A 3KVRA 1V2GA 1Z6XA 4JP8A 2XF2A 4G25A 3UA4A 4FYXA 2ECQA 4FJ2A 3CWCA 2ZS7A 3EEYA 2V4ZA 4ZZIA 3ORFA 3RJ9A 3NEYA 1F9EA 2CNDA 4DL4A 1KETA 3GLIA 3RTCA 4AZ0B 4YPVA 3B5EA 1P2FA 1X7GA 2PJDA 4WVFA 1H2XA 3MELA 1UJCA 3CEPB 2ZYGA 3H0GG 4PHTA 1M74A 1DRKA 4EJMA 6REQB 2YVKA 4GFDA 1ZBQA 5KZMB 3AEKA 3JV7A 1ESZA 4OAOA 4DA6A 4MROA 4FZVA 3LO8A 1F3LA 4R8KA 2QLMA 5HOEA 4LZAA 5EPEA 3LTNC 2ZG6A 1TZ2A 1W4CA 1FSPA 2DHDA 2CLSA 2E5LH 5BN3A 2IODA 3RS0A 4Q7KA 4PX2A 1WSCA 3QF7A 2QSZA 3VPHA 4PU0A 4FEAA 3RRXA 1Z9BA 2P30A 4YYEA 2C2YA 2O8CA 2V7TA 4Y1EA 1SWVA 3UTDA 4U63A 3LV8A 1J0AA 4KG7A 1XQ9A 3IUBA 4BVLA 3NM6B 3QE0A 1DG9A 3R6GA 1LRJA 1RAIA 1L4YA 1P4HA 1ZKDA 1II8A 2B69A 2P2LA 3C87A 4D9CA 3GLFE 3FMFA 1NI5A 2VNKA 2Q1SA 4IRKA 4US2R 3PR2B 4DWWA 4V1CI 5DPMA 2F8MA 2O4UX 1L9KA 1EP3B 3H4MA 1WB5A 1N3IA 2F1JA 1DDGA 4DV6B 3G23A 3GTOA 4JEIA 3QNUA 2DFKB 4OQXA 2JEIA 3W0LB 3EGVA 3KPJA 4Q3CA 2ZPTX 1TF5A 1DCTA 3VV3A 4G26A 2JS7A 5B64A 4YDHB 5KFYA 4CC5A 2C5BA 1P61B 4D1YA 1KI9A 1SD5A 4YV2A 4N48A 2PWPA 1NVFA 1YR1A 2Y2VA 3LPAA 3WV5A 5GOTA 3EN0A 4E2WA 2VCEA 3HXMA 1ZAKA 2R96A 5SZKB 2CXUA 1P33A 1AQJA 2LDBA 3RTAA 4AX8A 5D51S 3KE8A 1V51A 5BSEA 1U9IC 4FKBA 3TBHA 5F3RA 3JYNA 2D0DA 1DP4A 1FJXA 3E22B 5HILA 3G5TA 1E6KA 4BNHA 4L95C 3OEED 3DMRA 1ODLA 3CUUA 4XTCS 3T5GA 1PUXA 1IBKB 4KIGA 3GEEA 1I30A 3OOWA 2P40A 4P8RA 1QO0A 3U80A 2I62A 4FHFA 2WWRA 3ZD6A 5EFOA 2QM0A 4BFUA 4S0ZA 1ZUIA 3AT1A 5JWOA 3PHCA 5CLFA 2O1XA 3QVMA 2QTCA 5EL0A 1UDBA 4K6NA 3K9FC 4GWGA 4G0PA 2LIVA 1HFJA 2NAPA 1EZ4A 4E15A 4BB0A 4DLWA 5C37A 3B70A 4X62B 1TIKA 2Q2NA 3QIAA 3M6IA 1PBTA 4R0MA 1LDEA 3AIMA 2PLRA 2Y66A 1ZJ4A 4KR9A 3PN1A 4RCNA 1NP3A 3ZLTA 3MT9A 4O3MA 2XUPA 2NU6A 3L07A 1M1UA 5EE5B 1QG0A 4PV7A 3SIWA 3HM2A 2O05A 2ECPA 4FKMA 3KKQA 3L8HA 4UTXA 3U4QA 1ENOA 4URVR 2GEJA 1FDWA 3IMFA 3H04A 5E3JA 3RTXA 2EHJA 3VR4H 4JV5B 4JUAA 1Z6GA 4IDPA 3NHYA 1YB6A 4GH5A 4MTCA 3JQQA 4CIXA 2QAGA 4LFAB 2Y4RA 2RD2A 1VI5A 4FZRA 2WTBA 3ANLA 2C7QA 3ET5A 4AFNA 2OYCA 2BTQA 4O3OA 2O03A 4CIYA 1BWRA 4PPFA 3VDMA 4UDNA 3ABSB 1QBGA 2E4WA 5BNTA 4D98A 1PLJA 2FR0A 3FDZB 3TDKA 3GMSA 5JAZA 4XI9A 3DXFA 3USES 2DX7A 3PW7A 4HLNA 2P3OA 5H1YA 1NVMB 3ABIA 3WDSA 2I22A 1ZCFA 3BFVA 3BFPA 3V48A 4UMEA 3KEOA 2BM9A 4ZCSA 1PJ4A 1EX7A 2VYVD 1G2WA 5C5CA 1TD9A 2VEOA 3QQMA 1KS9A 2HVQA 3R23A 2M1XA 2ZI4A 4X91A 2EWVA 2IKQA 3SDSA 4DSOA 3RYFA 1Z5PA 2C5GA 4N3AA 1RKXA 1K89A 1TJ3A 2G9UA 4BRZA 4QOIA 5DXFA 3G8CA 4BAZA 4A8JA 3TQRA 4N8DA 3HRKA 5CPBA 2Q1XA 3KZ1E 3UPUA 5KTSA 2DHRA 5A9SB 1K08A 3RQIA 1RRPA 1UWCA 2QJFA 2EKZA 4LH7A 1KYZA 5D3ZA 4IYRA 4MW5A 3EG5A 5FV7A 1E6CA 2V7VA 2ZJ0A 4WOJA 4FM9A 3PD1A 4FCVA 2WA2A 4LI3X 4JOSA 4HB2A 3V55A 4UE6A 1YBFA 4HFMA 5TT1A 4IIVA 2EZUA 4BTEA 2Q0HA 4YB8B 4H7DA 5F4BA 2WU4A 3T5MA 4HMQA 5A9RA 5TS2A 3GPCA 721PA 1E8NA 1YZHA 4A23A 2IWRA 3GG9A 3UMBA 3WL8A 4ZO8A 3J7AK 3TWOA 3KYJB 4NCKA 3B52X 1JHXA 3TTTA 5T4BA 5EI5A 3GCGA 4Q1DA 5K0TA 1VG0B 2WJGA 4AG3A 3EPGA 2FUG1 4BQIA 1BA3A 2AV6A 3QNMA 4A16A 4WNIA 1AY0A 4GP7A 3KSDO 4GXTA 1E58A 3FCOA 2V74B 3THXB 1KTVA 3IE2A 4DR3B 1IB0A 2PRZA 1YI1A 3DMDA 2FPIB 1CB0A 3JQBC 4YUVA 5TGDA 1JMVA 5LU9A 3ZCRA 1RRCA 2AFVA 4B31A 3A1NA 3HOWG 1NY5A 2G36A 2ATXA 2FZWA 1ML3A 4XD7A 4MLCA 4IRMA 3L4KA 1N6LA 5KFWA 2ONKA 4LTNA 2HCJB 4Q3LA 5MDHA 2IHNA 2A5FA 3KUDA 4JBYA 3VPXA 3KWMA 2OEPA 4K0KB 2OGSA 3SBOA 1MORA 4F1WA 3PFCA 2ZGVA 1FDOA 1N2CB 1IEWA 3MQ2A 4BDSA 1M8KA 1JFLA 3AFHA 2OCAA 2GN1A 3QNWA 1X77A 3DHWC 2C7PA 3U09A 3S99A 1ZIPA 4P3KA 3LBAA 1E4EB 1OYYA 3KJFA 2AX3A 4HGOA 1JSRA 5EMJA 4K1LA 4NYMR 2UYGA 5ITWA 4OV6B 2ZUBA 3CLRD 3IQXA 1YB4A 3ROTA 1N77A 1EK1A 2AK2A 3AUAA 4CNQA 4AB1A 4EO4A 4UCFA 5KFRA 4F92B 1U7ZA 3OBBA 2AJDA 1IXZA 2C7GA 2VCHA 5A4IS 1PWXA 3TZLA 3PNQA 4HUJA 4D3DA 2M6SA 4ZQHA 4RKEA 3P9CA 2OGUA 4C2AA 3FKIG 4OJTA 5L8VA 1NSYA 3KSAC 2Q6OA 1FFHA 3DEAA 5C31A 1Y6ZA 1PSWA 2JA8G 5EERA 4UUAA 1IBCA 2I7TA 4BZWA 2IPXA 3A4LA 1M72A 2P9EA 4JCOA 5JZ9A 5DP2A 4EFEA 2H4XA 5FLMG 3IYLW 5L95A 1JLRA 2AFIA 4IGEA 3LLSA 1QGUB 1TU3A 2E4ZA 4R1TA 1RM3A 4IPTA 3K70C 3JVVA 5IZCC 5ECYA 1WUHS 2SKDA 1EHIA 5CD9A 3ABRB 3ETHA 2VH5R 2XEDA 1YQXA 2BZGA 4RD1A 2CUTA 2I7DA 2C3UA 1U1CA 4I1YA 4KSBA 3L0BA 3I6BA 3V6LA 3A9CA 4JD5A 5K2OA 3KL2A 5IHXA 4RTPA 1UPBA 3IUPA 4H60A 1Q0SA 1U0HC 4Z6KA 2ERCA 4A8PA 2QP3A 4GO1A 3N8HA 3VTAA 1Q2UA 3ETEA 1WA5A 1QR2A 4LQCA 4RNMA 4DB2A 2QQFA 2FUCA 4QJIA 3LP6A 3CNOA 3U5TA 2L18A 1W93A 2AX4A 3FUTA 1KO4A 1R50A 1ZD3A 2J1LA 4IHQA 1WW3A 1GKIA 1U0OC 1CQWA 3N40P 2D5IA 2JIZA 1MDFA 4MW0A 1J20A 1QYRA 1V9SA 2V9CA 4KWIA 4NG4A 1ONBA 2Y1XA 3BF7A 1AQIA 4JKYA 3ROGA 4JI5H 2N9UA 4NFHA 3OO0A 4H1UA 5CVTA 3RAXA 3BWMA 2GZDA 3U3ZA 2FWRA 3DWIA 1K5HA 3TLJA 4CMBA 3TIXB 3WB0A 1SCAA 4RB0A 4P0TA 3B3FA 1E2HA 2QN9A 4NTZA 5AVKA 5L6MB 2H2GA 4K9NA 3EGOA 1F2TB 3ZTYA 4HS9A 4J3NA 1TYAE 4YJKA 5HIAA 4RVSA 1CFJA 4OXXA 1T4MA 2NVBA 2A58A 4HQNA 3E05A 1HE8B 1Z7YA 2A3RA 3EULA 3V4FA 4XQCA 8MHTA 2QHXA 1XVAA 2AWOA 3RRFA 2HTFA 4US0R 3GO4A 1ZHFA 1HT3A 4NV1A 3K9WA 2J3JA 3RS9A 5IWAH 1JQAA 2G72A 3QKRA 4NZ9A 4EA6A 4E30A 4QGGA 2D7JA 5ER6A 4ZQEA 1DQPA 3R9XB 3EZ6A 1EFLA 2ADOA 2TSYB 3EW7A 2OO5A 1JAXA 3HA7A 2XMQA 4OLAA 2P7IA 1GKKA 3GWZA 2R8YA 2YWRA 4GEKA 4TTPA 3P2EA 2Q5CA 3AX6A 2GK4A 2BFEA 2O2JA 3ZD9A 4BP8A 2WWXA 2BUBA 1OH5A 4HN4B 4ZVRA 2DSTA 3U7QB 1E94E 3CVWA 4OJMX 3WB9A 1JPUA 3FSGD 3CU5A 1YTUA 1CP2A 1TA4A 1Z16A 3BH0A 3PC6A 2JKYA 5AHWA 3F97A 3PWKA 4GZ6A 3QMWA 1E1RD 1Z5OA 1GPYA 4L76A 3VOAA 5LZ7A 1SHLA 2G67A 3DWGA 4RVCA 1YQUA 1OAKA 5DG7A 5MFZA 1SFRA 2J08A 4CQMA 1EJ6A 2PSDA 2ZR8A 1GRRA 2I4MA 3KTFA 2ECOA 2MSDB 5A06A 4QBIA 8ADHA 5JSKA 2ZIVB 3A2LA 2Q5LA 3EVGA 3PA6A 4ID9A 4DDUA 3FPEA 3FWZA 2ZRFA 1HDCA 3BICA 1IN7A 1LLUA 5LLSA 1RPJA 1WR2A 4RSMA 3DTVD 5HF5A 1Z5VA 2V54A 1HNNA 2QGFA 4LNHA 4UE2A 3TFOA 4UEQA 3B51X 3SC6A 2GPNA 2L0XA 4MDHA 5H59A 1Z7BA 4P3PA 5HF9A 4HR7A 3LY8A 3RUCA 1M1NA 2E49A 4YAKB 5KTOA 2NZXA 3MILA 3Q7IA 4ZQIA 4N8EA 4X24A 4KE9A 4XQ0A 3ZH2A 4I9HA 2A9KA 3PJEA 3EGCA 3O1LA 1XZHA 3PWTA 2FZ5A 3KQOA 2BOVA 2JGIA 5CFRA 1JFFA 1ULTA 4URYR 4MAAA 2MJLA 3JQDA 2D59A 3JSXA 1J99A 3G68A 1B7GO 4L4UA 4BP9A 3AEZA 1R0WA 2FLPA 1KU0A 2YZ2A 4HY3A 1ISFA 2I1QA 2V5VA 2ZRCA 3GU3A 2HJ9A 5GJBA 4IHKA 2COIA 4QGHA 2QTZA 2WA1A 3T9FA 5KFDA 2QQ5A 1Z7EA 3HS3A 3TE7A 4GZMA 3I1YA 1V5WA 4GC5A 3L7IA 1N2HA 1FYDA 3IL2A 2WU8A 3X43A 3I2JA 5B30A 1HH4A 1E3JA 2MTBA 3AKDA 1U2QA 4G5GA 5T6BA 1M2OA 5EJ2A 5DTQA 3PQ3A 4RZ3A 1YULA 4MYCA 4BO2A 2CN1A 2V55B 2XIGA 4D02A 1T0PA 5EG5A 5KFQA 4IDFA 3CIFA 5DF1A 2HQSA 1PGOA 3DEIA 1FXWF 1GAQA 2R44A 4DANA 3P4XA 2VDWB 3K6SB 1CF9A 1Q1QA 4B80A 4INJA 3PCRB 2GD6A 4XAQA 2AXNA 3MMZA 4O4LF 1YZUA 2Q4BA 4RK1A 5FTJA 3NHJA 3GIJA 1EWQA 3MUFA 3TLKA 4B45A 1TM4E 5EJGA 3QELA 3EF1A 4LZPA 4HRYA 5ES4B 4QU0A 3ICVA 4TRJA 2PQ6A 1NXSA 4JL6A 5E3IA 3UIEA 2VQEH 4C3VA 5JNUA 4I55B 2GJAA 3B2NA 1ZM7A 1YI8A 4JUDX 3PV0A 5CDYA 2PGXA 2P7HA 2F7SA 5J59A 4NNPA 5CM9C 1X8LA 3KT8A 2WQ7A 3I64A 3RVRA 3AGPA 3GJ5A 2YXBA 2O5CA 3LQRA 1YU6A 2P3SA 1DO0A 1XO1A 4K9QA 3ZWBA 3B6JA 4QD3A 1NDUA 1AS2A 2HOQA 3V9AA 2VKQA 4W7IA 2UZ0A 2FN8A 1DTWB 7AT1A 3QEBZ 1JFRA 1UFKA 4P7JA 2CFOA 3SF0A 4QXRA 2PZFA 3LOQA 1VGRA 1WCMG 1UT5A 3ON5A 4UVEA 5JS1A 3M9LA 3H4IA 4D97A 4K6OA 4W5JA 2BJWA 5J4KA 3L8CA 1C3LA 3WSWA 4CIBA 4EUEA 4QAJA 4KQXA 3Q2OA 3CZ4A 5LOVB 2EIHA 4NJMA 5C2JB 3A9WA 3CR3C 1XZAA 3DR5A 5ALHA 2H5EA 2RHCA 3E1KA 3K8QA 4NZZA 4LXTA 1CU1A 2R8EA 1OIXA 4C7XA 2JC3A 4ARSA 3OX4A 4FYWA 2QX9A 1NBHA 4NHOA 2PBRA 5KKNB 2YVQA 1QTIA 2PEZA 4PYIA 3ZCVA 5K3WA 3OHAA 2AZDA 4TS4A 2FMUA 1EUDB 3Q3VA 4LIPD 5EMMA 5C3EG 2X41A 1J70A 1NAHA 2IFTA 1TTPB 4NWIA 5CYOA 3I1JA 5JD6A 4F97A 1F0YA 4L15A 3G2JA 5EIEA 3RJMA 1E92A 1TXGA 5CVCA 1UK6A 4OB7A 4OFWA 4LJ4A 4X64H 2R7ZA 2PKWA 2FX3A 4D46A 3CNHA 1YZQA 3K5IA 4LV6A 2AJ8A 3AF3A 1XMQH 4J1TA 3E7FA 5AUQA 5GINE 2NZ8A 4L6CA 2ZYAA 5DGIA 2F1KA 4TSRA 5FTMA 4EI8A 2WJ3A 5JNWA 4CCAA 2NUBA 2G1JA 3PQ4A 5DM70 3BRWA 3GNQA 2AZMA 2Z9CA 2OAQ1 4UTZA 3MOIA 5H8WA 1IVNA 1XXHB 1IE3A 2PWZA 4S12A 3UWSA 1RWXA 4NP6A 5JZMA 2YV4A 3JQGB 4EF6A 5D87A 4UBOA 4M2LA 2CB0A 2IYPA 1HY3A 4WL0A 4NBLA 1O57A 2D62A 2GQRA 4YUAA 2CHEA 5LR6A 2CBGA 3P2YA 1K5GA 1KEPA 1N2JA 2JLBA 1DADA 4M54A 1A7JA 1MEOA 3C0KA 1KR5A 4KI7A 3WLJA 1R16A 1EEHA 1PFGA 3WLRA 4W8OA 4EKDA 3MJSA 3IX7A 4CV3A 1IY1A 2UUCH 4L78A 4CKYA 1JG7A 3IKVA 1EFVA 3SJBA 2LPMA 3USCS 3C3AA 3IODA 1PR9A 4FLFA 3U7JA 4DW8A 4ZCMA 3I0ZA 3JASA 4Z0PA 1GTVA 2DR0A 1PLLA 1HA3A 4C0QC 3O1JC 4O0MA 3BHNA 2HJVA 1GEGA 1XMPA 3HCFA 4HKTA 5CCXA 1PVDA 1HT2E 1FDSA 4ZYXA 2W8BB 1A4XA 5EE0A 3UWPA 2DE0X 4KEAA 3UCEA 3TTVA 2QZ9A 3KBOA 4OXNA 3PD0A 4HNRA 1TEVA 3PQCA 5A2GA 5CYPA 1D1TA 3CEBA 5FLXA 4RKWA 4D3SA 3NT4A 2Y1CA 4RL6A 3R5JA 3KKEA 3PPIA 1DB3A 2I66A 3WK7A 2QQ0A 1NN1A 4BJ1A 5H9VA 5J1SB 3SQMA 3HXQA 5HHTA 5I7FA 4OQZA 4JI2B 5E6RA 1HDYA 7YASA 3CLSD 3CWQA 2OP0A 1L4HA 1BFDA 3ENWA 2WJAA 2HNBA 5IAKA 3DL4A 2QI9C 1N8KA 4EGCB 2ZJ1A 4IIYA 3C6YA 1RQGA 3LECA 1THGA 1IM2A 2FZ4A 3CUEF 4O81A 4JP2A 1F4PA 2A88A 3NHZA 6LDHA 4FR2A 3WAKA 3OT5A 1Y4SA 1ZO8A 4C43A 4OF4A 1PLKA 2G40A 3QVSA 2CMHA 4I7EA 3H4DA 1NVDA 3F3YA 4S35A 5FH9A 3JAMW 1XRNA 3OPQA 2GM5A 1Q6YA 3C6ZA 5I7VA 1ADCA 2O3UA 1FBNA 4PZ9A 4H7FA 4IF4A 4DCGA 2J09A 2DKNA 2HPAA 1YZFA 1PJ2A 2XZTA 3P9ZA 3UOAB 1WH2A 3GRFA 3HLYA 2QDXA 3FCSB 4GX0A 9LDBA 1USKA 4J4TA 2O2EA 3DVRX 4ZOAA 1U7PA 4RK0A 1JU4A 4GOJA 1CQZA 2Q50A 5C1PA 5C35A 3M5PA 3P9YA 4PONA 1F5NA 1M1XB 1RI2A 4QHSA 4BLQA 2IU6A 4X85A 1XTSA 2B5OA 2R68A