5BPHA

Crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 96
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bphA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bphA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bphA01
2R6FA 5I47A 4DIMA 1E4EA 1GSAA 2R7NA 4I50F 4YB8B 4EGQA 3TIGA 2GQSA 1EUDB 4M99A 3V4SA 1SCUB 4O7SA 1PK8A 1GLVA 5CB4F 4EGJA 4O7RA 4IWXA 2FP4B 5JVDF 1KJ9A 2V59A 2YZNA 5J2UF 2FPGB 2CNQA 3VMMA 3GLKA 3V4ZA 2HJWA 1KEEA 1B6SA 4YAJB 2SCUB 2CNUA 3HO8A 5EZYF 4O7NA 4O83A 1KBLA 1EYZA 3K3PA 4MA5A 1M0WA 5C8YF 2I87A 4ZOLF 2W6MA 3RV3A 5LA6F 3BSYA 2P0AA 1EHIA 4MV8A 1KUTA 2ZDQA 4QSHA 3Q2OA 4HNTA 3I12A 4O4JF 2W6ZA 4I55F 1JLLB 4XYMB 3R5XA 2NU9B 2ZDGA 4O4HF 4XYLB 3KAJA 2OLSA 5JVLA 3U9SA 1KJQA 2NPOA 2VQDA 2GPWA 2WYOA 2W6NA 1Z2OX 2Z02A 1A9XA 4TUYF 2FB9A 4FFOA 4O7TA 4FFLA 1DIKA 2R7KA 4O7LA 4O4IF 2PBZA 1AUXA 3BG5A 4EA9A 3R9RA 1GSHA 4TV8F 1Z2NX 2YZMA 2W6QA 3BSSA 3TW6A 1WR2A 1JDEA 4MV1A 4O81A 3MWDA 1W96A 2R82A 2YRXA 3KREA 2FPPB 5BPHA 1GSOA 2IP4A 1C3OA 2YRWA 2R7LA 3JZFA 1I7NA 3TQTA 5D8DA 2VPQA 1VBGA 4M9UA 2YZLA 4FFRA 3G8DA 4EA7A 1EUCB 3HBLA 1GGOA 2YS6A 5LP6F 3R5FA 1ULZA 4O7WA 4O2AF 2DWCA 1CQJB 3QFFA 4C5BA 2PN1A 5BMVF 4MV3A 4EAAA 3VA7A 4HNVA 5CA1F 4M98A 3JZIA 4C5CA 4RZQA 4O84A 2ZDHA 5C1PA 4O7YA 2J9GA 5HV6A 2CZGA 1CQIB 2CQYA 3R23A 5HBRB 4HR7A 4M9CA 1C30A 2YWVA 3Q1KA 3BSWA 4FFPA 2HGSA 3TIIA 2YL2A 2NU7B 2XCLA 3DF7A 1DV2A 4FFMA 5LYJF 4EG0A 3U54A 4IHJF 3JRXA 2VR1A 1JDBB 2X0SA 5DMXA 5FNVF 5KX5F 1BXRA 4TV9F 3NUAA 2FPIB 3RFCA 2DLNA 1UC9A 3G8CA 2DZDA 1CS0A 4MV7A 3AW8A 3ORRA 1OBDA 3VPDA 4MAMA 3TINA 3OUUA 3JRWA 1IOWA 5H80A 5IYZF 2R85A 4O82A 4XZ3B 5LXTF 3N6RA 4ZQIA 5C1OA 1IOVA 3U9TA 4FFNA 4XX0B 5GONF 5CAEB 4O7VA 4GGMX 2R7MA 1M6VA 3E5NA 4YBZB 3VPCA 2V5AA 1CE8A 2QF7A 2YS7A 3RUPA 3K5IA 4I4TF 4FGRA 2PVPA 5J2TF 4FU0A 4O86A 4YAKB 3U55A 4MV6A 4DLKA 1KJJA 4O4LF 2R87A 4Y8VB 1A48A 4J6EA 4WD3A 4IIJF 5JH7F 4ZHQF 4O2BF 4C5AA 4YJ2F 3K5HA 3AX6A 4EABA 2NU8B 1UC8A 4IZOA 1PX2A 2V58A 5LOVF 2W70A 3WO1A 1M0TA 1KJIA 2GQRA 4YJ3F 2XD4A 4L1KA 2W71A 1KJ8A 5CA0F 3ORQA 2GLTA 3UFXB 3VPBA 3MJFA 4IWYA 4HQ6A 1AUVA 2R84A 2C00A 4E4TA 1KC7A 1VBHA 3BFPA 2YYAA 2QK4A 5JQGF 2NUAB 3N8DA 2YZGA 3HB9A 1W93A 2W6PA 3LP8A 4ME6A 4NYEA 4HNUA 3GIDA 2GPSA 5KKNB 3ETHA 4MA0A 4MV4A 3MWEA 1I7LA 1OBGA 1T36A 1DV1A 1BNCA 3ETJA 2Z04A 4MV9A 3WO0A 3LWBA 3R5HA 5K2MA 2W6OA 1E4EB 1VKZA 3KALA 2DIKA 1JKJB 4O7ZA 2YW2A 4ZI7F 3OUZA 3KAKA 4FE2A 5BPFA 3WNZA 2I8CA 2NU6B 1B6RA 1EZ1A 4EA8A 2CNVA 2VHEA 3VOTA 3RV4A 5JQWA 3SE7A 2R86A 1Z2PX 2I80A 4WBNF
chains in the Genus database with same CATH superfamily
3DDCA 1TF5A 5KFLA 5EE5B 3I0NA 4M1SA 3GPLA 4K7JA 2IYXA 1W85A 2YVAA 4NYJQ 5ILGA 4EX6A 1E4EA 2BRUA 3JQPA 3NXSA 2JEGA 3VZPA 5EJGA 2EZ9A 1Z6AA 4Q1DA 4YB8B 2D2VA 3K8ZA 3IXMA 4Y2YA 5ERXA 1WBBA 3IBCA 3LVQE 1QGED 1EXWA 3ZDRA 1E9RA 3ONFA 4XYBA 3UK2A 4DUGD 2RHJA 3CG0A 2BQUA 5K8TA 4ND3A 1Y4UA 3GRVA 3T06B 1K98A 4GKKB 3DL4A 1JH8A 2X86A 2PKEA 1V1RA 1Q7RA 1ZVKA 3CW8X 2VTVA 3HYTA 3IDQA 3MQ4A 4FYHA 4NK5A 3TQQA 3UIEA 4A6XA 2HCRA 4NH0A 5KTTA 1FYDA 2AKAB 4LRQA 3NHRA 3QVXA 1N8KA 5G4LA 4HP8A 2HA0A 4Z0PA 3SXPA 5FOQA 2NP6A 1IYZA 1TWAA 1G3RA 3E2IA 3FPSA 3H11B 4JXKA 5DT2A 5C4GB 5FWAA 5K3EA 4MDFA 3PO3G 2YIMA 2OD2A 1X7YA 1JWAB 3CZ5A 3D6UA 4PCVA 4PONA 4PN3A 5KU1A 1JR4A 2WIAA 1GFZA 5SZHB 4TMYA 5E4JA 2QZ4A 1IIBA 1U94A 3NBMA 1HV8A 821PA 2O8FA 1X1BA 3UN1A 4KHPB 3PGJA 1LY1A 5I48A 1U80A 5DHFA 3WGIA 2SCUA 4A3SA 1S8FA 1T9GR 1A0GA 2JGLA 1U0NA 1D2NA 2CHFA 2WHXA 1LJUA 2H1LA 2I4OA 5D84A 4JR0A 3DG9A 4LSGA 5DH9A 4WRRA 1RAFA 2ZUEA 1TWGA 3VU1A 3KTFA 5AKKA 4HVCA 3K73O 5D1NA 4BNIA 5L3QA 2R0QC 4RVGA 3VVLA 6REQA 3PEYA 1A2KC 2FAXA 3TTXA 4D4HA 1FYVA 1QE0A 1ORDA 2FW1A 1MC4A 2QJOA 3PIIA 5SYMA 3U3DA 4CQMA 1EAMA 4LDZA 4CU2A 4NONA 3R5TA 1U2DA 1FUEA 3Q7PA 4FHCA 2Y1KA 3CEPB 4HEJA 4HRYA 4JCOA 4JVLA 4B76A 5JPDA 3RAPR 3TI9A 2D5BA 2C82A 3C14C 1U04A 5BVHB 4K9OA 1SBHA 1D0IA 3I4NG 4R2XA 2HT1A 4O8CA 3RRXA 1EHIA 2A9PA 3AEZA 3AR2A 2YVKA 2H7XA 4FE7A 4W5HA 2PTGA 2YW9A 3JQ9C 3TQSA 1MKYA 3R77A 2L0XA 1OAAA 2VNIA 4ND8B 3BMOB 4WVFA 1AXEA 4Y8VA 3RWMB 3SE0A 3WLMA 5JBIA 4XIFA 4Z3DA 2FH5B 2ZI6A 1V96A 1N2ZA 1IMJA 2IOHA 3DCNA 3EFHA 3PKZA 4X3OA 5FI1B 3WP0A 1FUIA 3T4XA 3M6XA 5T64A 4ZOBA 3WV4A 3W5OA 4TKVB 3T38A 1KORA 3SIPA 4UD2A 1RBYA 1RYBA 3PYMA 4FZ5A 1XZMA 1SQ6A 4GPTA 1GKLA 1YD7A 2NU9B 4RB3C 2XUHA 1F17A 1MU0A 2W48A 4C7OB 1EG7A 4NZMA 4URYR 2MYUA 1GU1A 2MT9A 2C8KA 3Q6NA 1QTIA 3UJ9A 4OB8A 3F4BA 3VYRB 2PU5A 5CXSA 1B00A 4GOLD 4AKHA 1KJQA 2HCJB 1VCNA 2VQDA 2YJ4A 3KSMA 3P94A 4LX8A 3SSNA 1T6NA 1WTAA 1IJKA 3SI7A 2AR0A 4RB0A 4QXMA 4D6XA 4Q9DA 4JJ7A 1HKUA 2ERXA 3T1YH 4BJ3A 2HJGA 5LBUA 1XT6A 3HOXG 2B0CA 3BK7A 1Z2OX 2Z02A 2QNRA 3DZFA 5DRTA 1LSUA 5HCIA 2Y3IA 5HIMA 4B45A 3B7PA 1JDNA 1PL8A 4B33A 5LQJA 1OW3B 2JEYA 3NOQA 2WUEA 3OOWA 5AKYA 1YKFA 3HNRA 2F43A 4E6NA 3E9DA 2E4ZA 3F3YA 4IDPA 5IJ9A 2JA6G 3R8FA 3RTXA 2NVUA 2OZLA 2QN8A 1FXSA 3OCCA 4PV7A 5H68A 3DVRX 1T3LA 4LE0A 4CG3A 3IG0A 4F6CA 1SQ5A 4HAYA 1S2IA 5CB4B 3NCHA 2CVQA 2PRZA 5IDWA 1TJ5A 3WFZA 3VBCA 2OXCA 2H18A 2QI9F 4G1FA 5AUNB 4ZOLB 4OKNA 4CT5A 5ADVA 1VKRA 1BCRB 3KPVA 4E5NA 2IS1A 1NVXQ 3EXHB 1DKNA 2VJYA 3KDSE 1ZCFA 3GAFA 2JASA 1Z74A 3SKVA 5ISMA 4D4MA 4WVLA 5FKJA 1XD2A 5DVZA 4A3BG 1TA9A 4GOMD 3BB1A 3GG2A 2HWXA 3ZTTA 1CIPA 4M86A 3E2PA 1P0PA 1OF1A 4IQFA 2ZXFA 4EVRA 3P2EA 4P7BA 1K7YA 3A6PC 3Q3IA 1VE9A 2VYNA 4KDRA 3RS2A 3QVKA 1VXOA 4HDKB 4HQ0A 1NBME 1ZVMA 2G1UA 4IR1A 1US8B 4ZZ3A 2BFDA 4Z4EA 4YH1A 2YRWA 1B1CA 1W4CA 1X8JA 2W2MA 3CX8A 3FN4A 2X8AA 3JQGB 3PR3A 4KXWA 6LDHA 4PLVA 2FX5A 1I7NA 3HNPA 3EOZA 1Z7WA 4GR9A 2ZJAA 3BQNB 1XKTA 2BAGA 2JGAA 4R9VA 4YBRA 5CDFA 3HYRA 4HGNA 1A9YA 2IIVA 2QR2A 3N87A 5HZHA 4LVNA 3SKXA 3WDMA 2DYKA 3F74A 2GJAA 1HI9A 4DA6A 1QC5B 3PZRA 3QF7A 2I03A 3QLEA 4OV6B 2PMZE 4HQOA 5CT9A 4RHCA 2IXTA 2NZVG 3C6YA 3LBAA 4FUTA 4G4SO 1QUFA 4UM7A 4X7PA 2R8JA 3Q12A 5AUQA 3TNYA 3GFQA 4HWKA 1KQNA 4C07A 1ZHSA 3NHFA 4MQFB 4B9EA 4ETNA 5ICCA 3TE7A 4O4JA 4P6VF 2MR6A 2C2EA 4NULA 3N41B 2G70A 5TARA 3GFSA 3PHIA 5JE8A 3E61A 1MOSA 3MSCA 3BRWD 4NU6A 1PJ3A 2ZKLA 1J2UA 1Z0FA 3EZ9A 4P81A 4AN1A 1S2LA 3N5CA 4JXUA 4EAAA 1YZVA 1KK3A 4QM7A 3F8NA 3EPRA 3HA2A 4RAOA 4R71A 2IV3A 4R8UA 1GNQA 3QW2A 3LUPA 5DDIP 3MT7A 2X3YA 3HCBA 4OFBA 4K3UA 4RX1A 4Q7QA 4UHBA 1XTBA 4TTJA 1XZGA 3OF2A 1MF7A 1DC3A 3U17A 3WHKA 4R1SA 4E70A 4F3TA 2Q3LA 1QIHA 3TKYA 4MW4A 2VP0A 2DFKB 4DA7A 1QGUB 1ZI6A 2BKVA 4O7YA 4NCNA 5EAIA 3IUMA 4BQSA 1WXEA 3VAZA 3QVTA 5DJ5A 1R5BA 2D1YA 2IFTA 4M9XA 2P2NA 1NWHA 3ZKWA 1FTWA 3V6MA 4KN6A 4DC9A 1ZW1A 1Q21A 3MTAA 2Q5HA 4GOJA 1FMTA 4YO7A 3O92A 4UVIA 4BFCA 3VSEA 3CWCA 2WWHA 4RDHA 2GPJA 4P86A 1TTQB 3UXMA 3RKSA 5KIAA 1GPKA 4TKUA 3AF5A 4ZHQA 1IJEA 1NY5A 1VMEA 1ZAKA 1KI7A 2PBRA 3CR3C 3OIDA 4JBGA 5CCXA 1GYFA 4TV9B 3D6VA 3KC2A 1GZ6A 3UWOA 3OCVA 5LU9A 1YQ9A 2WE7A 4QA9A 3FF4A 5LYJF 2LIVA 4JQOA 1WE2A 4IHJF 5DBFA 4P5PA 4RGBA 4COKA 4LPKA 3M7IA 3WICA 3NDRA 5CH8A 3WLRA 3SYNA 4KGZA 2OB1A 1A2QA 3EISA 4ZZ1A 4QNRA 1JHMA 2YHIA 4IYJA 1XPOA 1ELOA 1RQRA 3D43A 3RBEA 4CMGA 1XP5A 3OQVA 3M6LA 4HZGA 1CUCA 1F12A 4P3XA 1DAOA 1MZBA 2XT0A 1L5YA 3R6GA 5DAAA 1I5EA 3BL5A 3H2BA 4WY5A 5HKKA 2YY6A 2XODA 5J4LA 4DPMA 1ZIYA 4OGGA 3BD7A 3DHNA 3VR3A 4QNNA 3OT4A 2CLOB 3JALA 5EVJA 3VYVA 3HDQA 1N34H 2VHVA 4H0FA 3WRYC 4EPTA 3P26A 4QYTA 3A9WA 4TWJA 5DZSA 3GFOA 1WLYA 3DVSX 5IXSA 4IGEA 2C94A 1CY4A 4M0UA 4B2PA 2EWVA 3UBTA 2FA9A 3RLIA 1K7XB 1TE2A 4CC6A 1SKBA 1Q20A 5T3UA 1R5NA 3U9TA 1RMTA 2OAGA 1O8BA 1BX3A 1XSEA 5IKEA 2XDYA 2HAEA 1CKMA 3Q3HA 3H5WA 4N12A 3UANA 5IFKA 1NE7A 3B51X 5JRZA 3PNBA 3N53A 5UKDA 3X0DA 2ZAMA 2ZEJA 3OHBA 2C9OA 2ZSAA 2RB5A 3OOYA 3PR4A 3PG5A 4O3FA 4PHHA 4QXRA 3TLJA 3TSAA 3W77A 1DRUA 4BEVA 2ASLA 4EW6A 1YR6A 2QRKA 4MW0A 3QFHA 3S2UA 3VH1A 1CSEE 3G7SA 1N1MA 3JV7A 2DR0A 4Q9JA 3BZUA 5AXDA 1SVIA 3DFFA 3I5AA 4FT2A 4YFYA 4JI4H 1I13A 2X19A 4NX2A 5REQA 4C4PA 1G8MA 5COBA 2ZTLA 1QSGA 2W8KA 4G0PA 4L02A 3QMPA 2YS7A 1HL3A 4BX0A 3IOEA 2IEYA 4N0QA 3PLAE 1UDWA 1KMMA 2FPSA 4DDVA 3DL0A 2YFQA 5AQ1A 1TTTA 4EF4A 3EGIA 4GLWA 1GR0A 4UTXA 3O1IC 1ZH8A 1IJBA 2AI1A 3C39A 3NFYA 2CNKA 4LN1A 2BCGY 2O1EA 4UMEA 4BVKA 2C2GA 1VL1A 2C1ZA 4BFVA 4ED3A 5JI3E 4GBED 3BTUA 3OEHD 3QENA 3NBUA 1BWPA 3PEVA 4NIMA 2GBIA 4NU5A 3RHSA 2ZM6H 1PD1A 1A7KA 4HV4A 5B55A 2PUAA 4XARA 2FEPA 4EWLA 3BWYA 2PGOA 4JI4B 2P8SA 2TECE 4B84A 5KKAA 1UFRA 2I7XA 4PCUA 4HAXA 1QYDA 2WIKA 5CW1A 4ALJA 3UYLA 1CWUA 1W85B 4YCSA 1AA6A 2UZ4A 1H3NA 2BGTA 1NXPA 2YWJA 4B09A 3CNEA 1YQXA 3HI4A 4J4HA 4DNQA 5AW0A 3O9MA 1WHSB 2OGWA 5T6BA 3U19A 3TFQA 1BIFA 5BSGA 2XRMA 1QP8A 1WRBA 2CMKA 4ZOEA 3A2KA 2GM9A 2WB1A 4OUDB 4PU0A 3NI2A 4G4JA 2W4IA 3IR5A 1JQJC 3A6LA 4G5GA 1UKCA 2I3AA 2J6BA 3BWXA 4R7GA 1U5CA 2NYVA 4ND5A 1CJCA 5FJIA 3GYBA 2IXEA 3MBIA 1UM8A 4BYMA 4ENPA 2V0CA 4HDSA 1MV5A 1BE8A 4MCHA 1C5KA 8LDHA 5ADHA 4ISCA 1TZJA 2CV0A 1N78A 3H4TA 3PVSA 5FUQA 2Y05A 1SUCA 2HTEA 3G88A 1YOVA 3ANXA 1RFGE 4D79A 2J7KA 4AZVA 1I1HA 3IKTA 1QIEA 1QKKA 4YRLA 4H15A 1JIIA 3WJ7A 2QTVB 3TD9A 3S8YA 4K9DA 3BBLA 1IDN1 1L6IA 2GUGA 4QJBA 1M0TA 3FPHA 2ZUTA 2VQEB 4JXZA 3T5JA 2B8NA 3D31A 5I7EA 3AHJA 2HHHH 5F1OA 4E22A 4JBNA 3KKOA 3PR5B 3DC7A 3H5OA 5B3AA 3TJMA 3W5CA 4H6PA 1NNEA 2O7VA 2PJRA 1QB8A 2MYNA 2EW8A 1KJ8A 2Z1DA 1VOTA 4DKJA 3W5HA 1K66A 1XG5A 2NUBA 2JHGA 3RR2A 4X00A 3JTMA 5L6LB 1QFMA 3I8XA 4J3FA 4K05A 2JBHA 4DLYA 3SGIA 1DJMA 1ZD9A 1SB9A 1JJ7A 1LQUA 3SPXA 3F5FA 1LTQA 3G6KA 4OGFA 2AFRA 4ZAFA 2ZM5A 5D3ZA 3T3EA 1OBHA 3ZU4A 3UAWA 4LBYA 5DYYA 3QJ5A 5F2EA 1RWOA 2VA3A 3MGCA 4QAJA 2C4WA 2JCVA 2X4GA 4CL8A 4D5EA 5IYZB 4BY9E 5G41A 1X92A 3NTQA 2IHJA 2IDJA 1YZGA 5FNZA 5KOJB 2XIQA 1O0BA 5JQGF 1R0WA 1GDHA 3BOSA 4FE4A 5BW4A 5EJ7A 4UTVA 4FYKA 4L9WA 1Z83A 4TM8A 3OIVA 1W5FA 3PD7A 3PHBE 5EKTA 1YR1A 4JI6B 3STHA 4ENTA 3KTAB 3EDRA 4C04A 4YMHA 3HJGA 5LBTA 4ZV9A 1KYIA 3F2IA 3DUFA 3LXXA 1L2TA 3GEGA 3O95A 3PHHA 4MHOA 5I7AA 4PSAA 1EBUA 1N2IA 1JZTA 1ZM9A 4K9RA 2IV7A 5HP4A 5EPEA 2PX8A 4LSWA 3ZHRA 3UMMA 4LGCA 5AJXA 4WLFA 4WSOA 4N7BA 3FHTA 5IYCG 2FUNB 4IIHA 2IZ6A 4MQEB 1E7YA 2CXPA 4QC2A 3EF1A 4QQFA 1QHSA 5LIPA 1NUUA 1H1LA 3UUGA 2QUIA 1RLOA 4N5HX 3FIUA 4RPKA 3W8RA 1EFTA 1ID1A 3PE6A 3WMFA 4GVXA 2X4DA 4HAWA 4R98A 2P41A 1PJZA 1U4OA 5CX1B 3VPHA 1MA3A 3R5HA 1ZHFA 2AZTA 4M46A 4G0UA 2Q0HA 2IYSA 1ZI8A 3WV5A 1AXRA 4NKRA 1JIHA 4GBMA 3D8TA 4IHAA 1Y7TA 3FMAA 1RM5A 2NTVA 3GYGA 3K6SA 3OM8A 3A06A 4BPRA 4OLJA 5HYVA 1QOPB 4TLMB 3CPEA 5BSUA 3AESB 1DS6A 2JFBA 4ZI7F 3P9KA 1VHQA 3PC7A 4DQUA 3GLIA 4WK2B 3TY9A 4E5MA 3TQIA 5EYPB 3VJKA 3I28A 5IHXA 1PWHA 1M0EA 2V7QD 1QAOA 1AK2A 1RQNA 4PVDA 5K4HA 5KWIA 2O2HA 4BP3A 3RG2A 1EHCA 1A9QA 2CNVA 4L8YA 3WNVA 2R96A 1LDBA 1ZNZA 2XWQA 4R1OA 1F2DA 5HFJA 5KSZA 4OQXA 2DLDA 3Q10A 1R10A 4S1NA 1NLMA 2WW8A 2HVQA 4IRMA 2OWOA 2BFPA 5CDHA 5JQWA 1E0KA 4ITUA 5ADUS 2E5LB 3P32A 5LDDC 3SE7A 1MABA 2XZDA 3IV9A 1TJYA 4XSVA 2Q9BA 8MHTA 4BOYA 3RJZA 1KT8A 1G9TA 2FR8C 2HZBA 2ZJ1A 1TUBA 3CLSC 3CUTA 3FM9A 2XMZA 3DZGA 1W6RA 1ZN8A 2FRVA 2WUWE 4HH3C 2FRDA 4JNCA 2AH5A 4UMVA 4LRTB 5F33A 3MN1A 4LA4A 4QLBA 1SBZA 4QWAA 3V34A 2OVFA 4BIIA 3ZV7A 4GT1A 4EGSA 2QEQA 5KFWA 1GNSA 1MH9A 4L4RA 2OV3A 2FZVA 4BV8A 5A4FS 2TMGA 3JZ6A 1LEHA 1ECFA 3KOYA 5ICFA 4ZKEA 5KFYA 3T7SA 2R8XA 4WJZA 1OH6A 2PT9A 1PK8A 5KFVA 2GJ4A 1W6UA 5B1IA 1L3BA 1PKXA 1RRKA 4OH7A 2UYCA 4B8YA 5CFOA 4JXXA 4XSGA 4C6RA 1QPBA 3VHRA 5A62A 2C0QA 2FMTA 3B13B 4B17A 4QGGA 4PINA 4MMXB 3GLGE 5ALXA 1M7GA 3GNLA 1BGVA 1MT3A 4RADA 1GEGA 3TEMA 1GYQA 2MR5A 4HD8A 4X3CA 4Y1RA 2QVLA 5DW3A 1O7JA 4L3WA 1FRZA 3G9TA 3NC1C 4JKYA 1HZJA 1R64A 3RTDA 4O3PA 1TM1E 1SOAA 4KLRA 4KN5A 1J49A 2X8LA 4HNAB 1PLKA 4HLCA 2V65A 4UUQA 4TQ9A 2DSTA 3D9QX 4IUCS 3GFGA 3TW0A 3F5SA 2EKQA 1DXQA 3RB6A 1FZQA 1TK9A 4LQ4A 1EYZA 3A9UA 4XQEA 2B2NA 4G4SP 4HOYA 1A8QA 1RE0A 3ZE6A 5IAKA 3RQSA 3ZHSA 4CMIA 4MGYR 5FNVB 1N3BA 5GJWC 5I3CA 3GR6A 2FWIA 1H6BA 1DBQA 2W6MA 4IM7A 4IR9A 3SM3A 4P4UA 5DBIA 2I22A 1RQPA 1MAHA 3GRCA 1WB6A 3CX3A 1P5FA 2IY7A 2N1BA 4MTEA 2V7VA 2IIPA 3BD8A 3HMQA 4ID9A 3AM3A 2DKOA 2PLFA 3ZV3A 2DHEA 4B7ZA 5K0LA 4I5IA 1Z4JA 1U11A 3JYQA 4JOBA 1FCJA 3NPMA 4P4SA 3GLFB 1RWPA 2VBIA 4IWNA 5KVQA 4C2AA 3CLRC 4BLWA 2ZK7A 1Z29A 4DILA 2MIIA 1B6TA 1NBMD 4BNLA 4EKGA 5A0VA 4P38A 4MA4A 3C2QA 1XMJA 2VATA 1YZ3A 2YJ3A 3RC8A 1Z35A 1OFUX 4NPHA 3EJ6A 2FK3A 5E3HA 3FBGA 3C4VA 1XKXA 3GLHA 2EJ0A 3TZEA 3QX8A 1E9AA 3SYRA 1O9GA 4KV9A 3WG9A 5CHYA 2VJMB 3LMLA 2A9JA 3SR0A 2AOVA 2O54A 2X0JA 3ZZ1A 4AC9A 4BNTA 1BHQ1 3BH6A 3MRVA 2VDJA 2VSNA 4E07A 2QR5A 4AP6A 4J7UA 4M0CA 5JD5A 4XD7D 5AW1A 3G1TA 3EY9A 4JSTA 4YMTA 5AVOA 1QO0A 1DZIA 1ZUNA 2BFBB 3CNOA 1JTFA 1T0JB 3DE4X 4P0PB 2FPUA 5FBRB 5C5CA 3OKPA 1UWLA 3THWB 1U28A 4DV3H 3I01M 4O4JB 3PUWA 2Q2UA 4DB4A 1CUVA 3TDMA 5TX7A 2BM0A 2WOJA 4WUVA 5FEUA 4OMDA 3AIIA 1CU1A 3O2QB 3FFBA 5H3CA 2XRZA 1JWLA 3EWAA 1MFPA 4L4ZA 5J59A 1VFNA 3UHAA 2W8BB 2A78A 2WI8A 2ZAGA 4ZYUA 5JSFA 3I9MA 3KNZA 5KEIA 1K6IA 2WNSA 3L4SO 4I08A 4XGRA 3DC2A 3V8MA 5AM5A 4DLWA 2ZUSA 1PIWA 1TLFA 3LGAA 1H22A 2XUKA 1RMYA 1AKQA 2COGA 1N7JA 2UUBB 3F1KA 2V9CA 2MDTA 1I2AA 1TZ2A 1XU4A 4QDJA 4IHJB 4PWQA 1OI3A 3O8BA 4WZZA 1Q0PA 1D07A 3O2SB 1E4GT 5DCLA 5K3FB 2IMWP 1MB2A 2VQ3A 2Y4OA 4A8JC 4DLSA 1R4ZA 2EKBA 2NZWA 3FDJA 1CKNB 1RKXA 2GUWA 4PZUA 3RANA 4AX4A 4TKVA 1SU8A 1U02A 2W6QA 3KKQA 1XZCA 3JAMW 1E2UA 3INYA 2NG1A 3OZDA 1S7CA 4JI7B 1VL6A 4H60A 2R6GA 1N5KA 2L19A 2FZCA 2D4AA 3BWVA 3KQQA 5LKAA 2BM9A 1P18A 2DP4E 1CKNA 3LFHA 1WHTB 2ZYSA 3AHDA 1HQKA 1QKIA 3QM1A 2PT5A 2RGBA 3KZKA 4DNFA 1A71A 1X7ZA 4LV6A 5DHAA 4BP8A 4KPEC 4U0KA 3JQBC 1QH1B 2UU9H 3DAYA 1GARA 1WB5A 2PSDA 3E84A 1RC0A 2IP4A 2IEIA 4MB0A 1G2OA 1OYWA 3RYFB 2Y93A 4DLRA 4EHHA 1BS9A 3FMPB 1LGYA 2ZVPX 3DWFA 3LP6A 2H31A 3G3EA 4Y0VA 1LQ2A 4EZBA 1NI3A 2RJOA 4D4IA 2CLIB 4B43A 2AN3A 3OKFA 4IO1A 4MVJH 1R00A 3HOVG 3P4XA 4MQ6A 2HC9A 3KB2A 4FJ1A 1QR6A 4EEZA 2F1RA 3ZWXA 1Q17A 4AXXA 3IV6A 2YXNA 3NS7A 4WL0A 1JHUA 4HRXA 5F7OA 2C8JA 5HKOA 1Z6PA 3H6GA 3JQAD 4CETA 4KQ1A 4FLEA 2EJCA 2HV8A 1TTPB 2I4MA 1DKMA 1QPGA 3JPYA 1KDVA 3RQIA 3ZE8A 3CNHA 4YMGA 4Y2JA 4IQ4A 2A5DA 2DWCA 1A72A 1YZLA 5KUTA 3TD6A 5IDYA 3ZZUA 5BV0A 3L0DA 4MICA 2QM7A 1FNSA 1QHGA 5EXDA 5T7BA 2PMKA 4J0QA 4KWCA 3AFGA 3P4UA 3IQZA 5FUVA 5JO9A 1MQSA 3BGOS 2XGMA 1T9DA 1YL7A 3K31A 3RIXA 1JWBB 2ZJYA 1P0MA 3L4BC 2VJMA 3HCAA 4PFSA 4GHWA 1ESEA 2C0CA 4XSHA 2XKAA 3RYIA 5KYYA 2BBTA 4D9KA 1UP6A 2JAUA 1NVFA 5HA5A 1AF7A 5JMTA 2LR0A 2NSDA 3FFWA 5BOSA 1FU7A 3U7EB 1DCFA 1USGA 2V74B 3IIMA 1RJQA 3D6FA 1Y33E 1OBVA 5LZ8A 4YUYA 5BUSA 2CXHA 2BR5A 2EZ8A 5FR9A 5EC8A 2QX9A 3NKFA 4CG1A 4QPJC 1KGDA 1PUJA 2WDZA 2PZGA 3GJXC 4EFNA 4RTRA 1DT3A 5B7PA 3G2NA 4HTFB 1MW9X 4NE7A 5HUHA 3FSEA 1AG9A 5YASA 4KU4A 3V2IA 4IFEA 1UP7A 2WYHA 2F3UA 4LF9H 4CG0A 1PJQA 3PRYA 1XEWY 2PDAA 7YASA 2YL2A 2ZQZA 3OFSA 5D87A 2GEBA 2W6JD 3F4LA 3TB6A 5K3OA 1D2MA 4RH0A 1F3OA 1N33H 2JFYA 3NM5A 4EEQA 2XZLA 1A76A 2VDPB 4LHVA 5CNIA 1UFOA 3TQRA 1KETA 1WF3A 1WZUA 4OLHA 3ZGZA 3U5ZB 1GCGA 1KI8A 2JARA 4MINA 1WVIA 1AO3A 4P7JA 3OLVA 5L1LA 2CKZB 2OO5C 4JJ6A 5IAGA 5JCPA 2AYXA 3SQOA 2NMVA 5GPBA 4O2RA 4PCAA 2J6IA 3O93A 3A6KA 3TK1A 2OPBA 1XZ8A 2PYZA 3DPUA 1Y1QA 1ZK1A 4LWPA 4KGVA 2FUCA 1TD9A 3CEHA 2P4HX 3GV5B 3N0XA 2Q7OE 2PL1A 2OFOA 3FCSB 4IH4A 4JT8A 1RYRA 4TYPA 1S02A 3REQB 1UDAA 3ILHA 1F2TB 4M2LA 4PLYA 5IYZF 2Y0SA 3M9XA 4WEOA 2RHOA 3G89A 5DGXA 5JAPA 2G5TA 3R3ZA 4MR9A 4KQKA 2GD6A 1DXOA 2NUPA 5JVDA 1BD3A 2P75A 2R25B 4NBRA 7REQB 3OLQA 3MR2A 1IQPA 3A4VA 3NYRA 3PEUA 2HNKA 1EX6A 2A14A 4J1NA 3W2IA 2HYIC 2ATCA 1Z8DA 4UNNA 5K09A 2F3QA 5U4QA 3PNYA 4LCEA 4IR7A 5G0UA 2XEDA 2KX7A 4G2TA 3L4KA 1X80A 2YQ4A 4CM5A 1B8OA 4HGYA 4RTKA 3H97A 5CAEB 1NVVR 4D92A 3FRIA 3IELA 4MP8A 2P2GA 3WBKA 3C6ZA 4EI8A 1P1RA 1TUBB 1F14A 1YS1X 4M7RA 2JK0A 1ZICA 4YRBA 3DOEA 4Q7JB 3NTRA 5AK0A 4Z4CA 2K2WA 4ZEMA 4YJKA 3S3TA 4LYAA 1KP2A 5A03A 1IHXA 1PNTA 3FROA 1JKXA 1TZCA 4NBUA 2JLUA 4TYYA 1R6XA 4PE5B 3U09A 3E0XA 1QHHB 1SPBS 2CN1A 2WIDA 1GJRA 2ZRQA 3KTOA 2OZPA 3L0CA 4KQ2A 5GWXA 1TM7E 5FYDA 1CEQA 3CVWA 2J32A 4PZ8A 2PZMA 1LLDA 4EHJA 1VL0A 4QOJA 4RLFA 4Z9FA 4PLHA 3UC9A 1JNXX 3A9VA 4F2PA 4QEKA 3U55A 5LQAA 3H05A 1JLLA 1PS8A 5JALA 1I4LD 3JWIA 2IQIA 3K6RA 3PDCA 3N8KA 4QUAA 2VYFA 3M6UA 3PYXA 4BVHA 1XAIA 2IKQA 2UVVA 3QLJA 1ENYA 1WXIA 4RNDB 1OX6A 1G8KA 4XWTA 2DCMA 2W37A 3G13A 2VT3A 3PXGA 5K4GA 3KT0A 5K1ZA 1PJ4A 4DMRA 5DV9A 2R2AA 4Y2QA 1YZUA 2WICA 4YXWD 3WKCA 3SFZA 1CUBA 3ZIAA 2BEVB 5JU6A 5JCJD 2BUAA 1RHMA 3DVAA 3ENZA 3JYOA 1SIBE 1V43A 1O75A 2AC7A 2GYVA 2QY6A 5E4TA 3ROQA 4BRZA 4CMJA 4EYIB 4EEKA 5IXJA 2R8BA 3AB8A 3PBKA 1YA4A 5KTSA 1ET0A 2ZAYA 4TSFA 3ZCUA 3S81A 3ESZA 2VF5X 4KYUA 1GTVA 1JMKC 3N6XA 2K87A 2FSVA 3P9XA 1ML4A 4AN0A 1Q14A 4R7RA 2NTNA 1Z17A 4J03A 1Y6GA 1RYSA 1R0YA 2W9BB 1PFVA 2YRFA 3B6KA 4MRRA 4UQPA 5I5VA 2W57A 1JU3A 4IDEA 3NGXA 4HQFA 4J0HA 4ARUA 3FCOA 5AM2A 4WN3A 2QLNA 3DUFB 2J67A 1Y37A 3WGQA 1BFUA 5K3AA 1EZZA 4ZALA 1PL6A 5K0EA 2VRCD 3A10A 1F4PA 3KAPA 5IC4A 1UDXA 3UJ3X 1N6LA 1XWIA 3VPSA 5K3BA 4P7FA 3RT7A 2BKEA 1PUIA 3DQPA 4GPAA 3X1XA 3AUSA 3M49A 3PW4A 2FQ1A 3LYUA 4S1VA 1KE1A 3LZ6A 5JCJA 1SVSA 4ECUA 2FLLA 1P4SA 1EWVA 3U60B 5CX1A 3EFEA 2W11A 1NR1A 3N3AC 4I55A 4NV0A 3ORQA 2ECQA 2EG5A 1IFXA 2EW1A 4P31A 3UTDA 5HIJA 4W9NA 4EKEA 3MG9A 5I01A 3BAZA 1YB7A 4JROA 2HA7A 1L5ZA 5TF0A 5BUZA 1U0SY 1T4GA 2NUPB 1JGTA 4UHFA 4BC1A 1HMPA 4RETA 3EGEA 3A05A 4G84A 3NXKA 4RHYA 1IYEA 1H9AA 4GX2A 2XECA 1IUNA 5BWTA 3E5HA 1E0DA 2JLQA 5EWJA 5BXYA 3DDHA 1V4VA 1OGYA 4W99A 2XMBA 4GECA 1SKAA 3O3MB 4I50A 1JDSA 3RBVA 5EMMA 3G6XA 1JU4A 3H9UA 3M9WA 4DV6B 4C30A 2CV1A 3G8BA 3OU7A 4UEJA 1KQ3A 5CBPA 5FDFA 3ZHCA 2CHVA 4ADSG 1RXWA 1GA1A 1XL1A 2X1HA 4MLCA 3PTAA 1RC1A 2Y1GA 3FDFA 1X1SA 1WP4A 4F2HA 3EPJA 3VZCA 2ZI9A 3NRBA 2FN4A 1AN9A 3GIDA 1I2MA 2GTHA 5JS2A 2XSZA 2AXNA 2NSHA 2HGWA 1F2VA 1M5RA 2B21A 3ZWYA 4OQNA 1MQAA 1KXZA 1WPRA 3LFTA 4KXUA 1KRHA 3R3UA 1KZ9A 1KVUA 1XRMA 2OLKA 1E0AA 3UK7A 2PX0A 1UZUA 2C4MA 3SC3A 2VTBB 3B60A 3UJPA 3QE3A 3ROZA 5L3SB 5A5GA 1UC4B 2WKQA 4RTSA 2C0PA 2G36A 3EMDA 3ETJA 1I0IA 5JMOA 2D62A 2WHPA 3IP8A 3QK7A 1AB6A 3KOOA 4W1PA 3F4KA 4F3NA 5CG1A 4INAA 3X1KA 2GCIA 2ARKA 3BEDA 1P2TA 3PLNA 4B83A 1CEXA 5PGMA 5BVGA 1XEAA 5IJ0A 1P39A 1YB2A 2O0HA 2Q3FA 3DEAA 3K1JA 4GXNA 1RPZA 2B7BA 4JVNA 4HNSA 3BL6A 3KJNA 4JP1A 4A6DA 1YE8A 2EJTA 1C9EA 2V6FA 2Q2OA 2XT6A 4G23A 5A3RA 1X1DA 4O7ZA 1LVUA 1MLDA 1Q6ZA 3KLOA 1QHIA 1TJPB 3OCZA 4WLOA 3HZZA 3QPVA 4ED6A 4RD2A 2YZKA 1QG2A 3LC0A 1K63A 3MBKA 4R3NA 4U02A 5L4NA 4OHPA 1N2BA 4RA6A 1E8NA 1X7HA 2GM3A 3D8HA 3TQFA 1Q1NA 1EFCA 4HUQA 1EZ1A 2MHCA 5FB3A 4WIAA 3SOZA 4BO4A 2N46A 2OQ2A 4XTCS 2WLSA 3CUEF 4HDMA 3VMFA 2NN3C 1C7QA 1M33A 2DTEA 4LXQA 1FU4A 4HVTA 4KIWA 4KQ9A 2HIXA 1ZD5A 4F71A 1JAXA 5FO1A 3SC2A 1E9CA 4JV5H 1UH5A 2O8BA 3HYLA 3V2GA 1MX3A 3FAKA 3GTPA 2I54A 2VK1A 1T8RA 5F7JA 3RHFA 1Z38A 2GA9A 2SHKA 3L5OA 3D8UA 3QVUA 2QRJA 2WSSA 4F93B 1E18A 3B7WA 2X5KO 2FFJA 4KBFA 4YJ3B 3MLBA 1EKFA 1Q1EA 4YCBA 3GA7A 1W34A 2QTCA 1A98A 1CDEA 1JDTA 3KYCA 2M9MA 4N8DA 1XWWA 1O0SA 1V71A 2XWBF 4ARSA 3F47A 3IRVA 5JLAA 4YAKA 1UM9A 2PMFA 3L04A 3H5IA 3UICA 4EY6A 3EXIA 1GLVA 1ODJA 4DR3H 3NU1A 1QHYA 1K7EB 2XI4A 3R0VA 1P17A 3DHWC 3MGAA 2ECOA 1J0CA 3O90A 2EJBA 3PC3A 4RGVA 2FW7A 1G2WA 2YJZA 5EXEA 1K5GA 3BGWA 3WYGA 1XVAA 1MZPA 2FE4A 5HRUA 3C8UA 3QVLA 4L5BA 2QX7A 5IAEA 5BR4A 3DP9A 2I91A 3FLMA 4DV4H 1I2DA 2R6ZA 4Y2GA 3NWPA 1RXCA 1WW8A 3W2FA 1KEEB 4A0RA 2V3WA 5BR1A 5EHZA 2BVNA 4Y6GB 3CR8A 5HF8A 2VHCA 4F9FA 2XIGA 4H1WA 4EZEA 1P31A 4X66B 4ZYZA 3A4IA 3S7TA 3ZN2A 5A5VA 3LNCA 1GTZA 1XDDA 4RD0A 4CM7A 5A06A 5EZYF 3WGVA 3Q88A 2B78A 1G60A 1XTZA 2I0FA 3DMDA 3JQAA 3PEEA 1U0GA 2F62A 5FWYA 1XL0A 2NXWA 5J5AA 3V7UA 4ZIRB 1Y1WA 5DM70 3ADBA 3EZFA 1GEEA 1IN5A 5KFQA 4LHXA 1KVSA 2HDNB 3WRYA 3I5UA 1ZXBA 4V0RA 5EUQB 4QBFA 2VZEA 3GUHA 1X70A 2BFOA 4EW1A 4YCAA 2W8ZA 3LBYA 4TT8A 3RVRA 4DJAA 4XVRA 2VRNA 1JLRA 3HDVA 1YIAA 4BNWA 3GMSA 4I4LA 2FJUA 2VTEA 1VTKA 1NFFA 3D6TB 4D9MA 2ONYA 2C5LA 1AHIA 3KM0A 2C83A 4OG2A 4Y1FA 3ZW7A 4DA9A 4PVCA 3UK6A 2OG2A 4XYGA 3TMAA 2I33A 3C5HA 4G63A 4MW7A 3CEJA 5K8LA 5KYWA 1O87A 1U7PA 2C2BA 1MRZA 2SKEA 1CR6A 1WZEA 2F8SA 5DK4A 4CCYA 4KRFA 1TVMA 1U1CA 4S35A 2GK3A 4QULA 4UPVA 4CIDA 3PNKA 3BPSA 3TF5A 2ZE6A 4UBKA 1WL8A 1L5RA 4Q39A 2W9BA 1T5OA 4CQLA 2NZUG 2C20A 1R0BA 3MBOA 5LLTA 2FDRA 4O4HF 2GSDA 1RLMA 3SJZA 1N2CB 4Z9XA 2JFVA 2NZYA 4UBJA 5HK8A 2YWRA 2XNDA 2NUTA 4CQMB 4HMQA 3R3HA 5JSYA 3ZYCA 1P5ZB 4OSOA 2V7WA 2FLNA 1C1YA 4X1KA 4RPHA 2WZDA 4ZHQB 2AC4A 4Z0TA 4HQRA 2IU0A 3W6NA 1WMDA 1Z4KA 2HJVA 4RD3A 3EVZA 2IEBA 4RESA 1OXMA 3N2KA 3O3NB 5KDLA 2OHFA 4CF5A 1IZ9A 1KOJA 3IDAA 1DX4A 3KVVA 4FLMA 3U0BA 3V80A 3S8EA 3NTOA 1XD9A 1XMOH 2JHPA 3SXJA 1A9XA 1EBBA 1ACLA 3ZVLA 3D4OA 3MLEA 5E7MA 5LOVA 1K8RA 3E7WA 2DSNA 3QBVA 5DBOA 4YCCA 1ZW6A 3OPXA 5DTQA 2H3EA 1QCCA 4GI7A 1IG3A 1VIYA 4BNGA 3ELWA 4WASA 4OI2A 2E2HA 3CZPA 2FX3A 3I45A 3S2SA 1GKKA 2GZMA 4L9SA 1AUXA 2QPLA 4MUFA 4AAYA 4F06A 4NJMA 3QE2A 5EHIA 5T3YA 3ELUA 3AZOA 4TTSA 5HF6A 4FWBA 5I5UA 3KZXA 4TTTS 4B32A 4C7VA 5SYAA 5CJJA 4DAEA 4YRZA 2GASA 1US8A 1J0EA 4IXMA 4J43A 3ZHOA 3OPNA 2P7HA 3C8MA 1CE8B 5DTJA 1AZLA 3SEAA 1N6PA 3U3OA 2XCRB 2PEZA 3MCAA 4HRVA 2XGJA 4NYMR 3OWHA 3TM5A 3P19A 3WYEA 1GPH1 1BCSA 3AEQB 3DEJA 4JT9A 2W2VA 5FAXA 4YXWA 3EFBA 1PGOA 2NUAA 3AUAA 4EZIA 2R48A 4Z51A 4DQLA 5JV5A 2H9AA 2V6JA 4ZK2A 4IEIA 2R93A 3R3JA 4R9RA 4YCMA 4QIHA 5DNAA 1D1SA 1YHZA 1BXRB 4X1OA 2CFCA 2CSUA 1SVMA 2EARA 2PTHA 2OXFA 4W5WA 3T12A 1XAHA 2ZPUA 1C3OA 4Y9UA 3UXYA 2RE8A 3JD4A 1G5PA 2XOEA 1ZNYA 2QJFA 2Z2ZA 2B5WA 2NQ8A 4XLZA 4XPIA 3WQSB 4D97A 3FPGA 2I67A 9LDTA 1G4HA 1HF3A 4NE9A 1HOTA 5A4IS 2X5XA 3X1WA 7ABPA 4PPQA 2E6UX 1ZCBA 1OI2A 4DIKA 3F6YA 1BE0A 3FGZA 1X7ZB 4EW3A 1W0KD 4J76A 4QXOA 1EDEA 2IUEA 3VU9A 1JXMA 3REQA 3SJBA 2ZAOA 1Z16A 5HRCA 1WZNA 3NM6B 1ZNXA 1XDUA 1C7ZA 4IOLA 4UBNA 2KBEA 4R2IA 1VHTA 4S1TA 2X77A 3VC1A 1KEUA 2R92G 2QTMA 3E5RA 3LCUA 2PXAA 4PAMA 1S2MA 1GRRA 2QSJA 4O2AF 4CN9A 3F1LA 2IITA 4LHWA 3AEUA 4R2HA 5AKLA 3K0CA 3A1NA 3Q2KA 2QAGC 3KV3O 4Q03A 4QU8A 4HUTA 4MHTA 1TCBA 4L07A 4PAOA 4MWBA 5A5FA 2Q0QA 2YQ5A 2WM8A 5D7BA 1E6UA 4OU5A 3WGHA 2ORVA 2BI4A 5G53C 1OHHA 2Z58A 4Y2XA 4G0XA 2AMVA 3V1MA 1G20A 1XZAA 3AY7A 3SBDA 3INTA 1GPJA 2JJ2D 3DSRA 4JR1A 4C5CA 3KSUA 3R76A 1D8AA 5F9HA 4D9EA 2HEIA 5M2QA 2OT3B 4XD2A 1M10A 1JFVA 4O84A 4HLUC 4X92A 2NVUB 1CUHA 1MO5A 1N3LA 2G40A 1OASA 1WDLA 2FWJA 4E5VA 3A04A 3L7AA 4BAUA 2AR9A 4JUFA 5M5BA 2MCFA 2VUGA 1EWRA 5AHWA 4D9CA 3KOUA 4IVPA 4GUDA 1FFDA 4MQ4A 3ZZTA 1FJGH 4UAJA 1J0XO 1DT5A 3R7LA 1L9KA 4CU5A 1SCNE 1Y5NA 1U9ZA 3BSWA 1KOFA 4WWHA 5HVNA 4Y6RA 3USZA 1Y6JA 1ZMBA 1ZETA 1TI7A 2CKDA 3U3RA 4O5AA 4EQ6A 4IFIA 2CDAA 2JVKA 3SC6A 1XCOA 4YO8A 2YMQA 3VI4B 3C7DB 4GQBA 1YRWA 1D2RA 4TTQA 1VBFA 2Q4RA 3ZV5A 2YTZA 4RULA 2NU9A 4XDHA 1JDBB 1QH8B 2M1XA 1W88A 2YJ6A 4AMVA 4DDKA 1NQUA 2H5LA 4PLZA 5FTJA 3O3CA 3U4HA 3NUAA 2BUBA 3C5CA 3E05A 4LOKA 4NENB 3TLYA 1J20A 5REQB 4MUMA 4UCQA 3G8CA 2VDKB 3G79A 4YK7A 2ZVJA 4UNPA 3TSZA 1OYYA 2B83A 4PZYA 1VRVA 4QBKA 4QDKA 3STXA 3Q8QB 2F48A 1L8XA 4EG7A 3TBKA 4RW0A 4MWOA 1N5JA 1KGSA 5TMDA 4UM8B 1ZCZA 5HKAA 5DG9A 1VJTA 2BW0A 3T1HH 1ULUA 3EG9B 3OUUA 1F2UA 1KTVA 3V55A 2ZTMA 1KOLA 1LBHA 3RT9A 3WLSA 1CD5A 1LK0A 3CQ9A 3SQDA 4WXEA 2FSIA 4JJ8A 4DAAA 3LF1A 10MHA 4XZ3B 1PNVA 2A5GA 2PD6A 1Y1RA 4CC5A 2O9JA 3BCHA 3BJIC 5ED4A 5EQFA 3COYA 2O23A 3W9SA 2ODQA 2HO5A 2VHXA 3DQQA 4LIPD 3DV2A 1F20A 4B4OA 3VR6H 5BR7A 1S96A 1J0AA 1P2BA 3HS3A 4CF4A 5EOVA 4WNAB 4U8GA 3WLHA 4JC8A 1E9FA 1GKUB 2HJRA 1WPQA 3OA2A 4PYKA 2YFKA 2ATEA 3EC1A 4IDNA 2FW8A 1GL6A 3AYHB 1HYEA 2HRZA 2HA5A 2YUTA 4JSYA 2V4ZA 5JAIA 1MJNA 2IH2A 2UZAA 1ULTA 1DOHA 2JCGA 3OOHA 4P08A 1W46A 3AIMA 4TGLA 1H2FA 4YA6A 4DBLC 4Z7NB 2DGDA 4AKGA 3PFNA 4DV5H 4U7WA 5C53B 1IL0A 3EXEA 1U9IC 3FJOA 5G1NA 3HCWA 4RKEA 3L43A 3UQ8A 2CJXA 4S24A 5IDXA 1Y3DE 1U0BB 4JQSA 1KR5A 2ASEA 5F5XA 3PFFA 5IJWA 2DPIA 1PWYE 4XH9B 4QWBA 1DI0A 2PVPA 1HDGO 1R12A 2E4UA 1RK6A 1A69A 1HC7A 2XVYA 3DKRA 3JQDA 4BFWA 1F7VA 2YHUA 1QONA 5KG1A 1XMIA 3HYCA 3KKNA 5FBKA 3D3QA 3KCNA 1IY8A 3NVDA 3AJDA 3PJEA 3UHJA 1WAMA 4GWGA 3WLTA 2XAAA 2DY0A 1L5LA 4MARA 1XJ0A 1M72A 5JQGB 3SS8A 2DPLA 2XD9A 3BA6A 3DOOA 3OT1B 4U5QA 3FJ1A 2IWHA 3OE5A 3AEYA 4XJTA 4A2PA 4J6EA 5JJ5A 2P6UA 1K97A 2E0IA 4B3RH 2PHZA 5A6SB 1SURA 5KTYA 1TQ6A 2F8LA 5I7FA 2E48A 2J6SA 2CLKB 4WCFA 3DMTA 3LIPA 5LWQA 3K0FB 4C5AA 1QB7A 3NJ4A 2QRMA 1RJWA 1H8HD 3A1EA 4ND7A 5CJ2A 4LKRA 1R1DA 4X7BA 1QWSA 2Q5JA 5EZSA 2BONA 1G5QA 2VFAA 3EOAI 1HE4A 3ZI4A 4FFDA 3W2GA 5EHNA 2NUTB 3AM4A 3KHLA 4FD2A 4D57A 3QYJA 3NHJA 1Y1WG 1UBFA 2GF9A 5B6JA 1B7GO 3TDNA 3AK4A 1YGYA 4BAZA 3OMXA 1XKQA 2OHHA 1SC6A 5FOSA 3L7IA 5IDVA 3UGJA 3CBGA 1YQEA 1IQ0A 1NQVA 4L72A 4P53A 3RHZA 5IABA 4RHFA 3W6UA 2RHWA 3HCNA 1MJGM 4BBZA 3WL4A 3K9CA 4Z2YA 1OBCA 5GGXA 5JAZA 2BSXA 2YJGA 1ZQ1A 1QR2A 2M1ZA 4FFBB 3L9XA 4GRIA 2G07A 4ZU3A 2BGNA 1XEXA 2YIDA 3H13A 4BP9A 1A8IA 1IUPA 1S3GA 1W59A 2B8JA 2Q0XA 3CUVA 5C8ZA 3ABIA 3I34X 1ILEA 4MQUA 4ZICA 3OLYA 4CLHA 1R16A 3AVYA 3JVDA 1E9SA 1CT9A 1Y98A 4D9NA 5E6RB 1YDHA 4AJIA 2V0GA 4J7XA 4MTLA 3D1JA 2AI2A 3UFXB 1SCAA 2BMDA 4MWSA 3EQ8A 4CHGA 1CEEA 2IUYA 5KNLA 2WM3A 1GTG1 2KLBA 3OWOA 4G5YA 5A5DA 2VP5A 2C1XA 3B3FA 1BW9B 3N5KA 3RUDA 3O8NA 4OREX 2MYPA 4WCDA 3BDIA 1O6FA 4BMDA 1WY5A 1ANKA 4MYSA 3RAEC 1J6UA 4G3IA 2GBFA 3IR6A 3KX2A 4B2YA 5CFNA 4JWTA 1ZGAA 4JVOA 4NNOA 3FPBA 2FQWA 1N2JA 3IVRA 3T7JA 2O20A 5CK5A 3UOWA 1HZZC 1L7QA 5LCXA 3ADCA 1NSFA 1NATA 1OWNA 4A36A 1Y9EA 2QTFA 1UKAA 2REOA 3AY6A 1PX0A 3HB9A 1GU7A 4UC0A 2PXHA 3KBBA 4D8UA 1PGPA 1S0MA 1U5BB 3U40A 5MGBA 1QG4A 2ZSUA 3VKWA 4EAQA 3CLKA 3L8CA 2FF5A 1W52X 5E0KB 3ZWOA 3A6HA 4X95A 1A9OA 2C5FA 4PW0A 2JS7A 1Y9JA 2MSCB 5KKNB 1SXJE 1YR8A 3QLUC 1KNQA 2GOYA 4GD3Q 3DP7A 4X6XA 4YR7A 3ZDBA 3MWEA 5IBRA 2FSFA 3KQYA 1IB0A 3T35A 4RXMA 3OHSX 4DMCA 1DV1A 1R4NA 2OOSA 1JQ5A 2FX2A 2ZBRA 2IHYA 3KHRA 4V2UA 3KYCB 5FLYA 5H4HA 1V0JA 1IG0A 3G6YA 4HNGA 4WK0B 1AY0A 5BOVA 4H16A 2Q5OA 4JKOA 1C3XA 1LD3A 1FS6A 2ZS8A 3UHOA 5A3JA 5C18A 1B0UA 2C7GA 2J8ZA 3HKCB 1U1FA 2VF7A 3UV6A 3WDKA 1DCMA 3GTQA 1CY0A 2PUVA 2Y0EA 3GGCA 4GDMA 4XFDA 1CQIA 1EA7A 3M6IA 3V8VA 1J8VA 4DUYH 1V5IA 4IS3A 4D3FA 1VHJA 1V8OA 3LOQA 2OCPA 4A0SA 1H2ZA 2HHJA 1DARA 3FYTA 2ADOA 1T1IA 1YOVB 3Q11A 3H0EA 1VXRA 2Q46A 4LJYA 5JC8A 1T36B 3OQIB 5ALGA 3GT7A 3WWCA 4GOXA 5DGDA 5E7IA 3NBXX 4AJJA 4BNVA 3FA2A 1X1EA 4GC6A 1KJYA 5KFEA 1JT9A 2CNBA 1VYVA 4L4SA 3FDIA 3KT8A 1VECA 3WGLA 1T1RA 3B12A 4GI5A 3WB0A 1RRCA 2FY8A 1UWKA 4QUEA 3ESRA 4RIHA 4TZTA 4RTOA 1GNVA 2VDRB 1JR2A 2GCOA 3Q3CA 2B7LA 3QYAA 2MSKA 3EXFA 2HKIA 5C3MA 5IXYA 2D0PB 5IK2D 1E2PA 4GPZA 3RS3A 4B3SB 1IXSB 1Z2PX 3G9XA 3IBGA 3FR8A 4RZRA 4B35A 5KHOC 1ABBA 4FKMA 1N25A 3D8BA 2FEKA 4TS9A 3WK8A 1FLAA 1NQ5A 3MOGA 4IAJA 4S1PA 4MS4B 3U7QB 4LSAA 1ADBA 4GNKA 1SOMA 3IQHX 2O0KA 3OT1A 4TQRA 2VC2B 5BUCA 5KTNA 3EUFA 4M9SA 1NP3A 4R2MA 3U6KA 1QIJA 4QUGA 4DEYA 3FPKA 3H4VA 4MPJA 1VJCA 1L4LA 3DOCA 4DCGA 2LNDA 2WF6A 3GGPA 2JZOA 5DWDA 2QMYA 3QIVA 4DUPA 2A58A 3BMXA 1Q50A 3PC2A 4ZVRA 1AH2A 3PT9A 4FZ3A 1JDBC 4CM4B 2NAFA 1QV7A 2W22A 5KYYB 1USUA 2NLOA 4EBBA 3K9WA 1ISPA 5KFTA 2EIXA 4S3MA 3WFJA 3KL2A 3EPLA 1GL7A 4HYYA 2A0UA 3K6KA 2B1JA 1NIJA 2Y76A 2A3NA 3AG6A 4M6WA 5TPWA 4EKIA 4N82A 2OGZA 3U61B 4KMMA 4PSUA 3CZCA 1PNQA 1FF9A 1LWOA 1QOZA 2BBSA 3A4TA 5CVJA 1DIAA 2FJ0A 2IU3A 4ZYVA 3C7TA 5MN5A 1EVYA 3HFGA 1ZN9A 4YAOA 1H1TA 2WAXA 2NXJA 2X5NA 2Y0SE 1FMLA 4J1QA 2VDWB 1FA9A 4C2MA 2E18A 2WM9B 1QHNA 3CLTD 4ZEXA 3TCKA 3V4ZA 3HDJA 5DN6D 1URPA 4G36A 4JR2A 2HPAA 1SKMA 3OM0A 4RCNA 1VHDA 4ER3A 1TC2A 1G5RA 3BM5A 2A7XA 3SQNA 5K6RA 1BO6A 1FLDA 4J9MA 1CPYA 3VM6A 2UVWA 4XUCA 3GVIA 3U3MA 4JELA 2RIPA 3WZMA 5EWGA 1D2GA 1FXWF 5FP0A 1XI2A 2F4VH 4I6GA 4GOKA 1K4YA 1U0FA 4MIOA 4NHEA 2C4TA 1DIOB 2PLRA 3ND9A 4G0OA 4RU1A 4PGGA 4OI0A 1HEIA 4D6YA 4LMBA 1VKHA 3FVTA 1X15A 5JMPA 4YXFA 1T0HB 1KK2A 3HK2A 4FNGA 1K7SN 4OJNA 2PS0A 5E8JA 3ZLUA 1LPBB 4AYTA 5KNDD 1JS1X 2RGNA 2AZDA 2C28A 1FQOA 4Q4AB 1KI1A 4O02B 1E7SA 1P44A 4ZQBA 3SFTA 3GTKA 5IN5A 3JALB 3I9KA 3IHLA 4KXMA 1FP1D 2NM0A 3KJQA 3S68A 2KWIA 5FHRA 4EVQA 5JS6A 1QDEA 2XDWA 4KJXA 2OM6A 4BZWA 4LF7B 1SCQA 3HB5X 3LOUA 2QN1A 3LQ2A 1THGA 1PHRA 4B4KA 1CRLA 2QGNA 4E88A 1F6DA 3HCRA 4BNXA 4OPMA 4UTOA 4GLFA 1PDOA 3BQMB 2Q7DA 2ILTA 3I2JA 3LX4A 1CP3A 4TMTA 4ZGGA 3F9RA 3X1YA 4YV7A 4KR6A 5CMLA 3ZLBA 4KWTA 3R5XA 3IAS1 1M1YE 2WUFA 3W3AA 4GQIA 1LFAA 4UE2A 3ANLA 3WAGA 4S04A 4QG3A 5BMVA 1YQQA 3U44A 3VZBA 6ABPA 4JI2B 2H16A 1JAIA 4C78A 2PWZA 4CLXA 4I99A 1FQJA 1VGVA 4TV9A 4GPEA 5EIAA 1ODLA 1T9ZA 1RJDA 2LUOA 2AOUA 2Q28A 2MU1A 2ZSKA 4DG8A 5LMNB 1DEHA 4A3MG 2FEWB 2J6HA 2XMSA 1TPZA 1F1JA 4DL3A 4IIJB 3DCJA 3EC7A 5E1DA 1ENOA 1D0VA 4E08A 5B3LA 5IM4A 1ZJ4A 1OXBB 1W36C 3T3MB 3OWXA 3TLCA 5GGYA 5JYDA 4AKIA 1I50A 1VPTA 1AQ6A 1ZN7A 4FQ5A 1T91A 2PVSA 2REQB 3FSGA 1NNLA 3JATA 4F3KA 4DWJA 4F2DA 1L5HA 3ZXXA 4CJXA 2BCJQ 1ORIA 2D0IA 1JI3A 2VL7A 3A58B 3FDZB 4OQFA 1YJBA 1ZK0A 5E9WA 3THWA 3K4QA 3PHCA 1SHJA 4O4IF 3DFKA 1NPYA 2AFIB 4BY1G 3CE9A 5EJAA 5ADWA 4IXTA 3TI7A 5I9LA 3F6PA 3FTQA 4YACA 1T9GS 1NJGA 1UMDA 1H8ED 2VBCA 2VPXA 3HB1A 4RY9A 4TRJA 3L0BA 3VDQA 5I6DA 2WTFA 4G8DA 3PTLA 2YYSA 4EA9A 3GGGA 1Q0RA 4NH4A 1R37A 2WJ4A 1CZHA 1TZKA 2FKNA 3EIQA 4N8EA 2VA2A 1WMAA 4XD7A 3CLUC 4YPFA 4BCDA 2JA8G 2RMKA 3KXIA 4LZOA 3ORSA 1F51E 1XPJA 2HFKA 2KLHA 1JKIA 1SWWA 2C3MA 2HSZA 3MFQA 4GYWA 5H7XA 1J90A 3UWSA 3HLYA 3VH2A 4BQFA 1N6IA 4ZO9A 4DY6A 3FKIG 5HQJA 4UEKA 2KI5A 2QMZA 1Y8RA 1OFTA 1KY3A 4I9GA 4NFSA 3CVVA 2ZJBA 3IAM1 1XMVA 2G1KA 1I6WA 3OC0A 4K9QA 1X80B 2WAYA 1LBEA 1A97A 5BQ3A 2HSGA 1I24A 3IAUA 4PTZA 5EHXA 2ONCA 2XYVA 3IDOA 4GPIB 3UGKA 4I9NA 3U48A 5K0ZA 2KHZA 1P1HA 3UAXA 1IZ8A 3C5EA 1SXGA 4JP8A 1WCIB 4NZZA 3T7RA 5GVRA 3PGVA 1M6EX 4J1TA 3M4ZA 2NTJA 1N0WA 1OUMA 2QNIA 2AG6A 3CURA 1OXKB 4TKUB 3KEQA 1X42A 5JSKA 3Q0EA 1W75A 4OHZA 4RMGA 2LPMA 1AN0A 1J7JA 1G18A 2YJTD 1GGJA 3CT4A 3LW8A 4X93A 4MKHA 1U0HC 1M54A 2VZ0A 3K9BA 3OJFA 4WUTA 1AHHA 2CNOA 4TZ0A 2CWDA 2UUPA 3PRHA 5E1MA 5G4KA 1YQWA 1WCYA 3KWMA 3QWHA 3LI2A 2ZBGA 5ARCA 4B8ZA 4Q43A 2QT0A 2O7RA 2UUAH 3GLUA 3PB3A 4J0GA 1MDBA 1B93A 4EG1A 2CXNA 3H8JA 3GAAA 4JBWA 4IL5A 2BFBA 4PWZA 1K4KA 1JTVA 3LF2A 4WZAB 5AKGA 1UOQA 2PN1A 3ROFA 2PO7A 5FUWA 2UUAB 5FHQA 2LV8A 4OHMA 3HBMA 4QSMA 5CR5A 1JILA 1OR8A 5ER9A 2GT1A 3DD1A 5DNYB 1GKYA 1WEHA 1FMJA 4HNVA 4ECTA 3ULKA 1U0JA 4IDOA 3ZCTA 1BD4A 5T57A 4U7CA 2JCYA 3NETA 3QNMA 2BR0A 1H9BA 2OCIA 4YRQA 2X0KA 4FNMA 4I5FA 4TYMA 3R3WA 4J9RA 4JYPA 4NMWA 2ZDHA 4J9PA 1ZH4A 1YR2A 2WTEA 2BBOA 2QT9A 2ZYGA 3FPFA 4INJA 3TQ1A 3D7SA 3ZCRA 2CZGA 4PC3A 5K05A 1CQIB 1WDMA 4AO7A 3W2EA 2DR3A 4QRHA 3DAFA 1F0NA 3PXBA 1R6BX 1PLLA 4NS4A 3WHIA 3VR3D 1C30A 2E4AA 4DJTA 1JJFA 1GFSA 4FYYA 4EK9A 5KREA 2P9GA 2WJPA 3VNSA 3ZNQA 2B8EA 4QIWA 2AMLA 2OAP1 1AGNA 2RHHA 4GX0A 3LWZA 4L8VA 1JG7A 1UADA 1XTUA 3GJ3A 3V2UA 5B3JC 1F7UA 1GQOA 3E9NA 4YRDA 2J7PA 5KT5A 2FPOA 3EGXA 1GPNA 1JPNA 2BKUA 3EUWA 3U54A 3OE7D 1G55A 2QD1A 4U7FA 4HLNA 3T34A 4F38A 2MMCA 3LC2O 2OBBA 1AXGA 3M4JA 4WQMA 3R7NA 2I2FA 4F45A 3ZWMA 5DM4A 5KVAA 3QWUA 2GTIA 4G5HA 4P7KA 3WL5A 5LYJB 2C4VA 3BAFA 2ZBFA 4X71A 1I2BA 1WW2A 3IBTA 2A1UB 2AF3C 5G0VA 2UYHA 1AIPA 2AJLI 3I5YA 2ZRJA 1YU9A 4B3SH 4IW3B 4RVCA 3HI6A 1YC2A 1A04A 1OFUA 2C5GA 4IJUA 3E1KA 3RM3A 1G98A 3PF8A 1RYFA 1WNTA 2HU7A 2OYRA 4BX3A 1U81A 1TECE 1ZZGA 3LUHA 3OF5A 1QZTA 1DXHA 4K3VA 1E9BA 2X13A 3BZBA 3FYDA 4MAMA 3G2QA 3QKRB 4G1CA 4F1KA 1ZGHA 4DR2H 1Q7EA 5JLJA 3PVCA 1FX0B 3Q85A 2FGKA 4MUJA 3IEXA 1UFKA 2JK1A 5JTUA 3SJCA 4EECA 5LA6B 3U4MA 4MCAA 2JA5A 4E7OA 2BZGA 5L40A 3C6KA 5I7WA 2GBLA 2C2RA 2AW3A 2UAGA 3KVYA 4EEYA 3NJ8A 4Y6SA 3L7BA 3UB2A 1UDRA 4Y9TA 4YT4A 1MT0A 1JEOA 4HG2A 3CLRD 3NATA 5LSAA 2JFHA 1E3DA 3FNEA 3OQBA 1YVUA 4BFLA 4Z49A 1N5MA 1W19A 3O31A 5TV2A 4Q3DA 1USWA 1UPBA 2QUHA 4Q0YA 2J3HA 5GONF 4JP3A 4Q7LA 3ZEIA 1Z73A 3AWDA 1HE8B 1CJSA 2O06A 2ZIWB 4QARA 1D8TA 1RQGA 2FEAA 2HBQA 3L02A 2C84A 4DSOA 3LZDA 4I7EA 4MGKR 4U9IS 4BGUA 3K8OE 3ID6C 4K46A 5DHTA 3WRVA 2QKYA 2GZSA 2PQMA 4DMKA 1WKVA 3NUQA 4QGAA 4QOSA 3HU2A 4OMCA 3WE7A 3SIRA 1ONBA 4FGSA 1YK0A 2AI3A 3O0DA 5B3KA 1U0RA 3EDOA 3RUPA 5ALIA 5KTPA 3KB1A 3FETA 1BXGB 1WBDA 1NVAA 5EHGA 2XNSA 4PSVA 2ZT7A 2W42A 4FR0A 1JLKA 4O86A 1X1CA 3ANMA 1GFWA 1OC4A 4TQSA 3QY0A 4IZIA 1XXHA 4TM7A 1O94D 3Q7SA 4FDAA 2AGQA 3OEED 2BR4A 4JL5A 4LY0A 2RGXA 1HA3A 2OBYA 5BN3B 1CNFA 5IZCC 4OXIA 5JXIA 1NMEA 3AV0B 1BE1A 3GCDA 1ARZA 3HWWA 4BX2A 5BN5A 3PUXA 2ACVA 4TUYB 4V2IA 4FS1A 1UKZA 1EUZA 4J7AA 4O4LF 4EBEA 2HN9A 4MWGA 1X87A 1KY2A 3HB4X 5AHXA 5GQSA 4KOEC 1T29A 1OAOC 4Q9IA 1QP7A 2FN8A 1A8PA 2NIPA 4FYXA 4I66A 1DGQA 5F9FA 4OF4A 4PXAA 2HQSA 4AUEA 3E27A 3LVFO 4U2DA 3AJEA 1ECLA 2IHUA 3OPYA 4DV6H 1IEVA 2JVJA 3KZMA 3ABRB 4POAA 2FSHA 4Z53A 1G20E 4KRGA 4CKCA 4PG4A 1A2OA 2XGGA 4WCFC 4MZXA 1OSNA 2PGIA 3USCS 3IA7A 3AX6A 1QIIA 2D2IA 4YJHA 1ZLYA 4CKWB 3C3AA 4TLBA 3ZJ4A 2QVZX 2JA7G 4LXUA 3WBFA 4BNMA 2I9KA 1OD6A 3IULA 3ZWAA 5L8VA 4BMZA 3B2NA 1GQ2A 4W1RA 3JQAB 5AYVA 1Y3FE 3P9YA 1MB4A 1YI0A 2FUKA 4NJEA 3I3SR 3W1EA 3AFOA 3L7YA 2D1QA 3X43A 3G2MA 2QX4A 3V8QA 2P0EA 4JB8A 2A0XA 2W9XA 1O54A 3NT2A 4B47A 4JZKA 1IVSA 4NOLA 1TC1A 4AZ0A 1J22A 1MAAA 2O3SA 3HLKA 1AO0A 1DIHA 3ADOA 3PQFA 3STYA 4EB6B 4EM6A 2PA3A 1ZL2A 5T14A 3PZPA 3OTQA 1QYVA 3DB2A 3IAHA 5CA0F 3ZWDA 1YMVA 1GDTA 1GQRA 2M6SA 4G26A 3FZEA 1Y8QB 3P0HA 1PNOA 1P9RA 4AN4A 2GKOA 3GZJA 3ZCQA 5CTJA 4HGPA 2XCQA 1KYQA 2ZVQX 5FBQB 3WGTA 2KJQA 1W87A 1ZVVA 3KEGA 3F90A 3FYCA 3N86A 3W7BA 4B3JA 1QO0D 4DL5A 4P34A 4JYBA 4X97A 3SDBA 5ELXA 3VR4H 1EP2B 1QVZA 1T2AA 1P80A 1FBNA 1NXXA 2QWXA 1P1JA 3HP7A 1DFGA 3D3NA 4YGYA 3VHQA 3U5TA 3PDWA 2VPIA 4RHTA 3T5HA 1GNTA 4IKEA 1PUXA 3FSGD 5JHHB 1FC0A 1Y8RB 3UPUA 3VDXA 5BUQA 1PI3A 4Q4DA 4Z9YA 4BUJA 2YZGA 4PIPA 1ZPDA 3GBSA 4YYEA 1IBLB 4DLAA 3Q5GA 1EXDA 4YP1A 3NDBB 1OKKA 1YZNA 5M3BA 1GHTA 1M76A 2CC2A 2QE7A 1IPEA 3CR7A 4R2JA 4II7A 2UXDH 1B16A 2CB0A 3HSYA 2A9QA 2I2XB 3LG2A 3PUYA 4BQQA 3HP1A 2F55A 1OILA 4E5UA 3N59A 2QE7D 4MI9A 4JQZA 5KNDH 2WUVA 2HDKA 3ETHA 5CEFA 1VPVA 1Z33A 1WX1A 3KQLA 2HLNA 5LMNH 1PQ4A 3H6KA 4EDHA 4IMRA 3GV8B 2QUZA 4XAQA 5C34B 2A9RA 2Z9DA 2ATVA 3KXDA 2WSIA 5A3QA 1Q7CA 4OUDA 5LZ5A 4N65A 4ZVLA 3VR1A 3ZDXB 1M1YA 2F2TA 2FVXA 2Y71A 2Y92A 3OX4A 3QPAA 4M7EA 2FMAA 1DAIA 2OBMA 4R6XA 1FFYA 2X3FA 3H04A 3I4LA 4GMGA 2JI8A 3K70D 3DTYA 4AULA 4BRUA 3U4QB 2YV3A 1A9XB 3PDIA 4DMFA 3FPCA 2JD2A 1E5TA 4INZA 2ZJZA 1SXPA 3I8OA 5JH7A 1LNSA 3DYVA 2P1DA 4JJEA 3RAXA 4LFBB 2JATA 5AW2A 3PT5A 4UVEA 3BFKA 1JKJB 4J90A 1T3GA 5SICE 3WSVA 2OV8A 4RKWA 3C87A 3D0OA 4E6PA 3FH0A 5H70A 5BYKA 2R44A 1QV6A 1H2BA 2JGEA 4M87A 1YRBA 1Z26A 2Z2IA 3JR7A 3BZWA 4U39A 1G9SA 3HWSA 1G8FA 4N5DA 4H7EA 3ESAA 3IA2A 3IURA 3WNZA 1F6WA 1HBJA 5D1HA 3CH7A 3RYHB 2OCAA 5LXTA 3CXUA 1MOQA 1GG9A 3V7WA 2B4RO 2XVAA 3AY3A 1PYOA 3UMBA 1M34B 1YJ5A 2HVSA 2GN0A 4RNNA 1E89A 1ZRSA 1L7PA 1NYRA 3WWDA 4EOGA 1YC5A 4GMDA 5DSTA 3QV1A 4HPJB 4N9WA 3QXSA 4HXYA 5B2FA 4N5LA 1WPGA 2R8RA 3I04M 4JLDA 3W0LB 2Y1CA 1BFDA 1R0RE 5LQDA 1FRFS 1CUYA 3AF3A 3ZIAD 2BMVA 3AEUB 3QXGA 1I8TA 1KSJA 2W2XA 4YRKA 3PITA 1J42A 2PX6A 4KSBA 2XKKA 3RC3A 4MUGA 1B6GA 4QGHA 3NKLA 2OBFA 4RKRA 5AI5A 5F12A 1TGYA 5SY6A 2BYTA 4KVFA 3VC2A 1M2GA 4EGQA 3BRWA 4X65B 2VDNB 3W1VA 3VU9B 1E6MA 4QQKA 3U1BA 1A9SA 4QHSA 4BKPA 4QXAA 5L4LA 2IUTA 3JS5A 4H3KB 4B7XA 3DTVB 3HE3A 4Q3OA 3AJ9A 5L6MB 3RFVA 4MVJG 4FYWA 4LKOA 3DULA 5HOEA 4IWXA 1OFGA 3LWNA 2XWPA 1CJMA 4KDCA 4OHCA 5HWSA 1PR0A 5CVUA 4P0QB 3CO5A 3F78A 4YEDA 5FR1A 3TOSA 2KYRA 2WU1A 3D3EA 3SBOA 3VDMA 1KDTA 3IP1A 3KWLA 4XE5A 4UTRA 5HX7A 2Y1WA 3R0ZA 4HB3A 5DX1A 3GJZA 4K6FA 5LLSA 1RXSA 1EB8A 4YTEA 3ZDZB 1DWOA 5ENDA 1BS1A 4BCCA 5J2UF 3JQ9A 2IODA 1M2OB 3NCTA 4YJ2B 2E4WA 2V4MA 3EIFA 5IVIA 1XZHA 4R1LA 3FCXA 2XTMA 3UF0A 4IIDA 1EDOA 2G4VA 2AEJA 2ISQA 1E3LA 1G3IA 4WFKA 1MV8A 1QX3A 1T2CA 3IIJA 4LCBA 1C9NA 2ZJ0A 1J00A 4Y18A 3RSOA 4AS2A 5J4YA 1PVVA 2ZWPA 3BILA 2II6A 3MGBA 3PEFA 4G97A 1XR3A 3K3PA 1KXJA 2BZSA 3A2MA 3EAFA 4V0NA 1VLMA 4RJLA 3FKSA 1EHYA 1MIOA 4LK3A 4N03A 3H9EO 2GF2A 2NNLD 1II8A 2PGAA 2RHRA 1FP6A 1NVKA 2KBFA 4MIYA 3ZU5A 2F59A 2NV2B 2HCBA 1D6JA 1FNNA 1YDWA 3EEQA 4TSKA 5EIHA 3GW8A 1QVAA 1PR5A 3JAMA 1THZA 1LCIA 3QFRA 3A37A 3ENVA 4X66H 1VE1A 4TMKA 2JI4A 4I4TB 2P0AA 1DAHA 3DBHA 3VGJA 1ONOA 1TU3A 2Y77A 3DTVD 4OFWA 3AP3A 8GPBA 3ZH9B 3O8QA 5EWFA 4U6PA 3AUTA 5EPUA 4GF5A 1PGJA 3DTFA 3I6MA 4QSHA 5B6PA 4P9NA 3DHVA 3EULA 2I34A 1HGXA 3CW9A 3HWX1 3EA4A 3BJRA 3P9IA 1GNPA 3N2KB 4UHDA 2RH8A 1JTEA 1N0UA 2H07A 3RLFA 4BEBA 4EMSA 3Q3JB 3L6DA 4W5JA 4MR7A 3QKTA 2XVZA 3A4YA 1E60A 1PG0A 1ZKDA 1AUOA 4GXQA 2JD0A 3ZZMA 3P5SA 2CJFA 4KPUB 1RCUA 4J91A 4PYNA 3FFAA 4DCVA 2GXUA 4TYWA 4H77A 2VRBA 3HKBB 3GFPA 4FB5A 1ZRHA 1YBVA 3BD6A 3B6ZA 5KFIA 4KBYA 4IVQA 4MLDA 3RU9A 3SR4A 1TKBA 1YI1A 1JE1A 1CR1A 4CQLB 2XH8A 2XLCA 1TDJA 2D2FA 3IC5A 5IJ9B 5DBEX 1W76A 3A3YA 3ZJVA 2H4FA 3U0VA 4FR2A 3RVPA 4PO9A 4XB6B 2WD7B 4Q4CA 5BWLA 4KKXB 3ZBUA 1DQSA 2QL5A 4AS3A 1KAHA 4D0LB 4CEJA 3SQMA 3S2GA 3A1VA 4GKVA 2RG7A 1SAYA 1CUFA 3AZPA 3C5WP 1GP2A 4Q7KA 2P9JA 2R7ZA 4NFLA 1DIKA 1P61B 1XEWX 5H9WA 3SZGA 5KFJA 1NRXA 1XCPA 5AK3A 1HDYA 2DKFA 2E89A 3GQVA 4K28A 1K0FA 2R5WA 2ZR8A 5MHTA 4PGFA 1ZH6A 3OCWA 3RUFA 5BW8A 1IBMH 1HURA 5KWEA 3GC6A 4NBTA 3QUCA 4EYGA 5I7UA 4YROA 4MOWA 4FBGA 3FAZA 4ETSA 4DNOA 2EW2A 4RHEA 1P6UA 1WD5A 4NPCA 1Z7YA 1XK5A 4RF4A 5BYJA 3R9RA 1XWFA 2A84A 2YUIA 4L5JA 3AF6A 3ENQA 3V33A 5I9IA 1N7GA 1UQUA 4QVIA 4JI7H 4RTJA 4DNXA 3MGKA 4L8FA 5MFPA 1N8TA 4TV8F 3O75A 3IJRA 2CV2A 1OA0A 4HADA 3WA7A 5T4FA 3E8MA 3ZDQA 1MPXA 3LWDA 4Q3AA 4WZBB 2YDXA 3EY4A 4AFNA 4BYGA 3OP4A 3NNNA 3VJLA 1YJXA 3NYQA 1U4SA 2C07A 3QU9A 4YX9A 4J07A 1CR0A 4G5FA 2OLEA 3HACA 3MWDA 4LDPA 4UE6A 4YP7A 3ZIUA 1D4OA 2BUCA 1FL9A 4RF2A 4B46A 5K0JA 3QI7A 1CCWA 4Q12A 2ZR0A 3MTEA 3QYPA 4QJFA 5AW7A 4IIUA 1BRTA 4PM4A 4MUNA 2UUCB 1SPXA 1W5BA 3K4PA 4B6GA 2L18A 1ZWKA 4JYMA 5HIIA 1FRQA 3R40A 5JJIA 5DB4A 3FTCA 3O1JC 2FCAA 4LF5B 5KYTA 3HEBA 3VX3A 3G8DA 4EYHB 2FLVA 5ULLA 4Q3EA 5A05A 4EA7A 3ZLJA 1RXYA 2FZLA 2GJSA 2X6TA 3L3BA 2RGCA 3EG9A 1AJEA 2WSBA 2I1WA 3D2LA 3MYRA 3KSZO 4HX9A 5JG7A 3WI7A 4FDMA 4D26A 1SMKA 4XGNA 2I6GA 1NUHA 3ORYA 5HBRA 3SHVA 1NW4A 3MCWA 2Q27A 3HVUA 1U8TA 2Q3MA 3G5LA 3N8IA 3OHPA 4W6QA 2FZGA 3MD9A 4DWWA 3H7AA 5CB0A 2YR0A 1X3SA 3G0CA 1H4TA 3BE6A 4JI5B 4MK4A 1K6JA 4X1IB 1DAAA 2WZQA 4KSYA 3J7AC 1VE6A 2R751 4U00A 4BO6A 3DAGA 3ZWBA 1XHFA 3ILXA 1SQFA 4KQFA 4FKBA 1W88B 2FOLA 1APBA 5IYDG 4ENWA 2QTWB 2Y1FA 4KFRA 3OD1A 4PZZA 3RAJA 1B8NA 1G19A 1VB5A 3L4EA 4JL8A 4IIFA 4PS0A 1XCMA 4X90A 4A1FA 2O7SA 2OCYC 2VDUE 4MX8A 5KYNA 4RTNA 2ZREA 4ZKDA 5A4KA 5JDCA 2H4JA 3L92A 3O8CA 2IYQA 4CEHA 3FG9A 2B4TO 2O1WA 2QP9X 3FHLA 4P98A 2QTNA 4L2IA 2Y0BA 4IQGA 3GEDA 3ACCA 5ALHA 3OVMA 4RANA 1COZA 2JI7A 2R00C 3MWLA 1Y6ZA 3O4RA 5IULC 4D45A 1CUJA 3DXXA 3GQBA 4QDOA 4EJMA 2O2JA 4RS4A 1QNLA 5IEBA 3B7GA 1RR6A 2LRHA 3PKIA 2QAIA 4TWIA 3GLVA 3LFUA 3U1TA 3IAEA 1IXKA 3A3OA 3NBYC 4LYFA 1YR7A 2V7BA 4DMUB 5C44G 3DYIA 3WOHA 5HUJA 5JNWA 3PQCA 2P65A 1CJUC 2W4QA 2BGUA 2M98A 4E7PA 4ARZA 5BN3A 4A27A 1GTMA 4RK4A 2NU7B 2WG1A 3H3XA 4UHEA 3LU1A 3TPCA 2GCOB 2GEVA 4FFVA 4AYBE 1PFYA 3I37X 3HDYA 3NM4A 1G21A 2RJNA 3WAKA 4E31A 4Y3UA 3I4FA 4NOJA 2EEPA 4WHXA 2VR1A 4KAJA 4LEIA 3GFTA 3U4CA 2EJ2A 1FKAH 4JI0H 3AF1A 4KO2S 5HE9A 1DADA 1Z6TA 2CLFB 1C4OA 2PH5A 2YHSA 1EVZA 3R09A 3N43B 3MFHA 1IHYA 4FK8A 5B53A 3TOXA 2FPIB 4BMSA 4DV0B 4MEJA 4YMWA 1B41A 2ZJ8A 5IT9W 2DLNA 3A11A 2JFOA 4MV7A 1GTL1 1C2YA 1YUMA 1G5IA 1IK6A 2WJHA 3QPBA 4QJ3A 4DL7A 2ZBQA 5T4BA 3WGJA 4JUCA 3WB2A 3BRCA 1HDOA 4B0PA 1DUSA 1B0PA 2KM1A 2YXDA 5I9NA 1IXYA 2NXEA 1DBIA 4LMRA 3VR2D 1Y9ZA 5AOCA 3B5EA 1QNFA 4QNMA 5CH5A 1Q95A 1KRXA 4ZI7A 1DTWA 3N2NA 1UBNA 4WOBA 1CF9A 3OFJA 1PT7A 4CR7A 4JMLA 4XQ0A 4JMPA 2E5WA 3Q2IA 2RHCA 1CUSA 4Q16A 2FZ4A 4MR9B 5J1SB 3FNIA 3AW9A 3JX9A 3U3ZA 3I2KA 3K9NA 1QBGA 1S89A 3SHFA 3DEZA 1NULA 1FP4B 5ALLA 1V2GA 3LQYA 2AA3A 5KOHA 4YJGB 1XK6A 4NLGA 1PSDA 1VBNA 1L7XA 5LR6A 4L0MA 1TLLA 1XLVA 4XX0B 2Y6UA 3AERB 3L6BA 5ALUA 4H0CA 1U8EA 1YJCA 4O7VA 2X0NA 4HN2A 1U3WA 2ZJFA 3I1FA 4GGMX 4E2XA 1IK4A 4JSRA 2JAOA 5TT0A 5FD6A 4G0ZA 3WWZA 2C5HA 5AW8A 3BWDD 1G63A 4W4TA 3RUHA 4RXUA 4LMAA 4EHNA 2Z6UA 3TW7A 5TMPA 2FPGA 4N54A 1R3UA 3B8EA 2IW1A 3W04A 2EF1A 3TLZA 3BDVA 3QEJA 2ATLA 5FLXW 1R6TA 4JKIA 1NYQA 1S6YA 3B8HA 1TCUA 1XDZA 3A32A 3P9NA 1Z9BA 1ZD4A 5KYXB 2Q1XA 3AVWA 1G59A 1SXHA 1N2GA 5EERA 3SICE 2Q2QA 3KQMA 4MDEA 3O84A 1W25A 4HAOA 3IODA 3BWCA 1C1HA 5CDTA 3BYZA 3C98A 1RYDA 4EFLA 5KFCA 3EPHA 4PYJA 1ES9A 2QZZA 1QS0B 2XDQA 4MQLA 4DUZB 1XNRB 2VF8A 3GOHA 4RIGA 1X7DA 4DLNA 5K3SA 2VK2A 1K6MA 1T1JA 1V7QA 4LDJA 4AO6A 1RJEA 4E5PA 1YCDA 2G77B 3KR9A 4IUDS 3SMQA 1NT2A 3OJWA 5CFZA 1ZR2A 1Y6FA 2Y66A 5FV7A 2WVAA 3KXPA 5CH3A 2F3SA 4P3PA 4A7PA 3E22A 4GMXA 4R8SA 3RRZA 1L4UA 4J7CA 1JHOA 3AM1A 2QW0X 3JPWA 3MERA 2FEXA 3QTTA 5JZOA 5LZ2A 1Q57A 1VLJA 4W6ZA