5BPHA

Crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 96
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bphA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bphA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bphA01
4ME6A 3Q1KA 4ZHQF 2IP4A 3HB9A 3U9SA 4C5AA 3OUZA 1A9XA 2DLNA 2W6MA 3R5HA 3BFPA 4YJ2F 1EZ1A 3K3PA 2YS6A 4GGMX 3VA7A 3RFCA 1GLVA 1GSHA 3ORQA 1I7NA 2ZDGA 1KJIA 2CZGA 2FPPB 2YRWA 3Q2OA 2ZDQA 3R23A 1IOWA 1JDBB 2I80A 5JH7F 2DZDA 2CNVA 4FFMA 2R6FA 5JQGF 2OLSA 5CB4F 2V58A 4WD3A 2YWVA 5BPFA 4FFRA 3VMMA 4FFLA 2FP4B 4O7WA 2FPGB 1GSOA 3LP8A 3WO1A 2NU9B 1VBHA 4IWXA 4FE2A 3KAKA 4XYMB 2GQSA 3V4SA 2DIKA 4O7YA 5BPHA 5IYZF 2FPIB 5LA6F 3TQTA 2ZDHA 4MV8A 3WO0A 4O4LF 5K2MA 2W70A 1JDEA 1KJJA 1GGOA 3KALA 3RV3A 1CS0A 3TW6A 4EAAA 4MAMA 1ULZA 4QSHA 4HQ6A 3VPBA 3TIGA 3RUPA 2W6PA 3V4ZA 5J2TF 1W93A 4IIJF 2XD4A 1OBDA 3R5FA 2W71A 2PBZA 2CNQA 2HJWA 5FNVF 5GONF 3NUAA 5JQWA 4MV6A 2NPOA 3VPCA 4FGRA 3VPDA 1SCUB 5CAEB 1GSAA 1KJ8A 4WBNF 1AUXA 5HV6A 3MWDA 2YL2A 1A48A 1E4EB 2FB9A 1JKJB 3UFXB 4O7RA 2W6QA 3JRWA 3TINA 3KREA 2R86A 4TUYF 4MV3A 2R85A 1KUTA 3JRXA 2V5AA 3GIDA 5JVDF 2GQRA 5C1OA 2QK4A 2I87A 4O7NA 4EA7A 2GPSA 5KX5F 3GLKA 4ZOLF 1EUCB 1VBGA 4XYLB 4YAKB 3K5IA 2R7LA 5DMXA 4FFNA 3E5NA 3HO8A 3TIIA 3BG5A 4O86A 1C3OA 1EUDB 3VOTA 5HBRB 3HBLA 5JVLA 4O81A 2NU7B 3ORRA 5I47A 3I12A 4IHJF 2VR1A 1M6VA 2NU6B 2PN1A 3JZFA 1JLLB 2I8CA 4I50F 1C30A 2R84A 4O83A 4M98A 4O7TA 3RV4A 5C8YF 1I7LA 3G8DA 4EGJA 4I55F 5D8DA 3U55A 2C00A 1M0TA 5BMVF 4IWYA 2VQDA 4I4TF 4M9UA 3BSWA 1CQJB 4FU0A 1BNCA 2DWCA 4E4TA 4IZOA 1IOVA 3QFFA 1E4EA 1OBGA 2W6OA 2VPQA 2NU8B 3N8DA 4DLKA 2R7MA 4EG0A 1CQIB 2P0AA 3OUUA 2NUAB 2Z04A 2YYAA 4O7SA 1KEEA 2Z02A 2PVPA 2SCUB 2CNUA 2YZGA 4M9CA 1DV1A 1M0WA 2GPWA 3R5XA 1DIKA 3AW8A 4O7VA 4XX0B 4YB8B 3N6RA 2HGSA 1B6SA 4O82A 1Z2PX 4EA9A 3BSYA 2W6NA 3U9TA 1CE8A 4HNUA 2YZNA 4Y8VB 4O2BF 3R9RA 3ETJA 4EGQA 4EA8A 4YJ3F 2GLTA 4O7ZA 4YAJB 1KJ9A 2WYOA 2XCLA 4ZI7F 4C5BA 1WR2A 4O84A 4O4HF 5LXTF 4O4JF 5CA1F 4TV8F 4ZQIA 3U54A 2QF7A 3MJFA 5H80A 4DIMA 3K5HA 4HR7A 2YZLA 1Z2NX 3DF7A 4O7LA 4MV7A 1T36A 1UC8A 2R87A 3AX6A 1KJQA 3WNZA 2VHEA 5LP6F 5J2UF 1UC9A 5EZYF 1AUVA 2YZMA 1W96A 1KC7A 1VKZA 2J9GA 4RZQA 1Z2OX 2R7KA 2YW2A 4MV1A 3JZIA 4TV9F 4FFPA 2W6ZA 4YBZB 2YS7A 4HNVA 1EYZA 4L1KA 4XZ3B 5CA0F 4O4IF 1BXRA 4EABA 4MA0A 2R7NA 3LWBA 3BSSA 3SE7A 1DV2A 2CQYA 1KBLA 4O2AF 4MA5A 1EHIA 5C1PA 1PK8A 2V59A 4MV9A 4HNTA 3G8CA 2X0SA 3MWEA 5LYJF 1PX2A 5LOVF 4NYEA 2YRXA 4MV4A 4J6EA 4FFOA 1B6RA 2R82A 4C5CA 3KAJA 5KKNB 3ETHA 4M99A
chains in the Genus database with same CATH superfamily
1TWFA 5BQ5A 4AMGA 5EL0A 3C6YA 4P1ZA 2IU6A 4V0MA 2WT9A 3H1PA 4D9EA 2C88A 1JS1X 1ZMOA 1H2EA 4Z8XA 3F6EX 4B71A 5CLIA 4H7IA 2KWIA 4O02B 3G2JA 1JIUA 5H68A 5K0JA 2H0QA 4QPJC 4C30A 2WNIA 3OKAA 1X1SA 2TSYB 1CG6A 3B1XA 3ROXA 1FDWA 1NRJB 3H2HA 4F1JA 4BCBA 3CVOA 1CJUC 2VYFA 1I8TA 4G67A 2HLDD 2FETA 3X1KA 3UAYA 2PKXA 2OCDA 2IZ5A 1IEVA 4N03A 3QLVC 4YWHA 3AZQA 4DIUA 1E94E 16PKA 2HD4A 2FXIA 1UEIA 1OZAA 3ET4A 1IVNA 3QUCA 1MX1A 4E5VA 1VC2A 5ICEA 3IT2A 2D54A 3IT0A 3CR7A 4NBNA 3I9LA 4TX1A 4MPJA 3VPFA 2HY7A 4GKKH 4NNJA 1NJ1A 1M7GA 4KWCA 2XKAA 2PMZA 2D0OB 4DGSA 3FYDA 3KV3O 2M6LA 1ZMRA 5C1IA 2PUJA 1Q5PA 3NUAA 1RXIA 4O3PA 3TKYA 4WUVA 2VDKB 2HMVA 2JGNA 2HJRA 3DAPA 1VOTA 1EFDN 3N8KA 4Y0NA 1AH2A 2O8FA 5E0OA 1O96A 3V4FA 3TDMA 4B7XA 1G20B 1Z15A 3PC8A 4E31A 5FJIA 1T29A 1AF4A 3QGMA 3H4MA 2QQ5A 1VPLA 4QL3A 4TL6A 2UZ3A 5C80A 4LF7B 1YZ3A 4KPGA 4IHQA 4R1NA 3TD6A 2Q3CA 4LOHA 4XSVA 4KC0A 1GA4A 3RYFA 3BG5A 4DG5A 4M8IA 2VZ9A 1WMBA 3WBBA 2OG1A 5F76A 4YMVA 2YCBA 5ILOA 4KYIB 2FFHA 3DTYA 3ND5A 2VRCA 1AN9A 1CNMA 3LNTA 5DKFA 2J48A 2AFVA 3D4NA 5KMGA 2HHLA 1ZU4A 1RHMA 4RXUA 4IWYA 3T7AA 3UMJA 1DQPA 2NO1A 4HGOA 4BQFA 3F8NA 3DLPX 1QO9A 5F2KA 1OH6A 2R7MA 4FQ8A 2OYCA 1EXMA 3HGQA 5ALHA 4F96A 2PY6A 1ESDA 5B36A 2GDZA 4RHUA 4QOFA 2FLWA 2ZIAA 2P9FA 2XTNA 1TCUA 3ZXSA 2BELA 3GHYA 3CZRA 3KZCA 2Y4RA 5CU7A 2IKSA 5L7WA 2GZAA 4TV8A 3MIIA 3PUXA 2CFTA 3TJRA 2B21A 2V7PA 1TZBA 4JJEA 1M6HA 3IMEA 5M34A 1AOXA 1NQOA 1C9DB 1KI3A 3NBMA 1AGNA 3LBAA 4JQYA 3Q3CA 2ZR7A 3H42B 1H66A 5KFEA 4RZIA 1VKOA 2DPLA 2F1JA 2JFPA 1P2TA 2DQYA 1SKYE 3T7IA 2B8EA 2X4IA 1P16A 2ZIZA 3KSMA 1KEWA 1XCPA 2QRQA 3W7VA 1TNDA 2XNDD 3TFOA 1Z2OX 5K1ZA 3JQBC 5LMNB 2H54A 1KWKA 3GTQA 2M98A 1EYZA 4LF8B 1PL7A 3LBIA 2FN8A 1M1NB 1UADA 1PT7A 3ODGA 1IBSA 1OH7A 1B8NA 4FYYA 3WLTA 2SCUA 3P2YA 4Q44A 4EWLA 2EKLA 3MYYA 1PVOA 2LUOA 4KNWA 3AR6A 4NESA 3DDZX 3U13A 3WDLA 5L8VA 1N5JA 1O8BA 2FP3A 4L57A 5HF5A 4HQFA 4IR1A 4CFSA 2WDTA 4FR0A 1VJ5A 4E46A 1MQ8B 4EF4A 1TT7A 4YRDA 1I2CA 3D8HA 3UGQA 3FNEA 3KXDA 2ODQA 2Z4SA 4PRLA 5FL7D 2ZDGA 1VJ1A 4RX1A 4NR0A 3IR7A 4EB8A 2REXB 2CNWA 4B7UA 1R4NA 2ZSJA 4PV7A 1WV1A 4YMGA 2GD1O 4MRRA 5LQJA 4JDPA 1Q17A 3REQA 1NOKA 4NATA 2ARKA 2NO6A 3L8FA 5BVGA 2FPOA 4GM0A 2EJBA 3QVGB 2EJCA 4P84A 1HQYE 1I14A 4ARIA 2IW3A 1G5FA 4D57A 2WY2D 4DIDA 4ML3A 4LZWA 1SU4A 2NQTA 5EJ4A 1J1UA 5HRCA 1M5UA 4FEYA 4M21A 1R9TA 2BFBA 1JJIA 4CEIA 1HT0A 1J99A 1VMDA 4EGFA 1P6UA 3C7AA 1N2CE 2P3LA 1RADA 4C4YA 1OBDA 1VJDA 2VRBA 4WZ6A 3K5PA 3QQ5A 3G9QA 2J6IA 1CZHA 2O2SA 2C97A 4MYCA 4KR6A 1J49A 1Z4QA 3DEAA 5CVJA 4QWDA 3BQNB 1E3QA 5JATA 4M9XA 3LCRA 3WLLA 5AW5A 4RESA 1GRQA 3IP8A 3MQFA 9LDBA 4N40A 4JVNA 1X1BA 4GRDA 1UJBA 4L7VA 3QOWA 4FC7A 2QIOA 3JAWB 1Q3KA 3Q7TA 3AM5A 2V4QA 2EFYA 3KR9A 2FUG1 2D2XA 5B58T 4BAGA 4OH7A 2P8JA 4YQZA 2RC6A 2OM2A 3FAKA 4AYBE 4NU6A 4HFRA 4BYMA 4BFXA 2ZYGA 4B6JA 1GAEO 2RHTA 1J8QA 4BVJA 2W2LD 3LGAA 1YK0A 1QHFA 4EPXA 2OZVA 3PQEA 4L4XA 2ORIA 4JV5H 3ZV4A 4JB3A 4BWGA 5LQMA 3DQPA 2JD2A 2B1GA 1N2CA 2V3WA 3ANMA 1DKOA 2MYTA 2PMKA 4JBHA 2JGRA 3EQ9A 2HF8A 4WLEA 2JA7G 3EXG1 3LHIA 3RF2A 5C7OO 2UVWA 1DX4A 4MVYA 1IOVA 5BY2A 4IOKA 1BD3A 3QHQA 1JEQB 1ZA1A 1GQYA 2GAIA 1C4XA 1FP7A 2OTCA 2YZ2A 3EFHA 3RC2A 3LCUA 1MUUA 1T25A 1YCGA 1X80A 1QFSA 3CUKA 9ATCA 1XWWA 4WFIA 4BWVA 2QI9F 5SYNA 3OAAA 3KKOA 1C2YA 1G7SA 4PO8A 2DWPA 1Y63A 5JYCA 2F7SA 1VXRA 1JG7A 3V8BA 4OIMA 4RFLA 3HE3A 2BZGA 4JUAA 4LZOA 1XELA 1IY0A 4IOLA 4AYBA 3U3XA 4LRWA 4BX0A 1S6YA 2FLPA 1VHLA 1L4YA 1E66A 1V11A 3MCTA 3BL8A 3S2IA 1R6DA 2DM6A 4FUTA 1KBOA 4BWSC 4R0MA 2ZRIA 3U7QA 3BTOA 3PQFA 4HATA 2GEUA 4QWAA 3AR8A 1DUSA 1ODTC 5EZYA 4LRUA 5TV2A 4EBFA 4JV2A 3RYIA 2MSKA 5ISMA 2I2XB 4F4UA 5JPCA 3LO8A 4BKMA 4YUYA 1N2EA 4I4TA 3KZOA 3I4CA 1JZSA 1QMGA 2PVCA 1CQXA 3INRA 1QRTA 2OHJA 4JK3A 5A2QA 5AK6A 4DM3A 5DNCA 1VMAA 2O2IA 2D1FA 4Y67A 2XCRB 3CCCA 1KXJA 3LYHA 3HM2A 3L05A 2KI5A 1CUSA 5EJ2A 2GF9A 4HL6A 4ESOA 1XLTA 4C6TB 5LOVB 3IKTA 3ER8A 3N7UA 2H5IA 5AJHA 2A3NA 4GRIA 1CB0A 1JT9A 2J9FB 2G6BA 2XMPA 1KEZA 2JKYA 3UWDA 4DCTA 1ZGJA 4KQJA 1ZL2A 4QEKA 2FWRA 2B9EA 2A8YA 1X92A 3CR8A 4ADSG 1UBHS 2C31A 3EDOA 2GETA 3T38A 1V7ZA 2V6IA 4JVLA 3BWYA 1M76A 5FBQB 4D41A 5L9AA 4JHLA 1HQCA 4XM1A 3LKBA 4JQCA 3VMMA 1GLGA 3AZOA 4I2NA 4MUFA 1HEYA 1NSFA 4JV1A 2G1JA 1EDDA 2WOJA 1O89A 1SZDA 1JHMA 2XQFA 2TMYA 3UJAA 5A4IS 2B20A 5EQJB 4K9NA 1CUGA 1CUJA 3OKCA 1F5NA 2A9KA 3VOBA 2X3FA 3JZAA 1DO8A 1JQAA 2IHYA 2OENG 1FYWA 3VPHA 4YMHA 1UKBA 1DLJA 4EMTA 2HREA 2PX2A 5DO9A 4C7JA 4CM9A 3FZGA 2J45A 2PV7A 5BW5A 3REFA 1SYXB 3LOUA 4UUBA 4IMJB 1Q0LA 1MNQA 2GTIA 5I9SA 2NVWA 3AF4A 3PEVA 2QX7A 4RMNA 4JUBA 4Y2QA 1T2DA 3WY9A 3RHFA 3EF0A 1K4MA 4LYYA 1R2QA 3D1VA 1A95A 2C2ZA 1NUPA 5CT8A 4QOGA 3VO8A 4PC1A 2GWHA 2ZSUA 3THYA 4GBGA 3SKXA 3BD9A 1VSUA 5TQ0A 4R6WA 1Q14A 1C8LA 2ECKA 1OD6A 1IBMB 3NB0A 4E7PA 5B6IA 1YA8A 4EQZA 1RAIA 2IX9A 1JTEA 4KQKA 4RKQA 1CZRA 1CNEA 1ZINA 5DZSA 3TQRA 4H77A 3GQCA 1CEQA 4AMYA 4OQPA 1L4UA 3OSZA 5AKYA 2J1LA 3JD2A 2VTDA 2OWEA 1V5IA 1ZETA 3UMVA 1M2EA 1Y5IA 3DYIA 3PHBE 3TZHA 3UG7A 2Y27A 1AHNA 2I55A 4CKZA 1I3KA 3WZLA 2Z02A 4EW1A 5A0VA 2BP7B 3NO4A 4X65H 3CY6A 5CJ2A 5JYDA 1AZTA 1ULTA 5FWDA 1K89A 5ICMA 4H27A 4ZCTA 2EWMA 3SJZA 2YZNA 3BN3A 4MTEA 1GAJA 3I92A 3SYNA 2AG1A 3U7EB 1IUOA 3PXCX 1KJ9A 3ROKA 4Z9YA 2Q8NA 2WYOA 3RU9A 2W6JA 2O3UA 5FPYA 1M2GA 5L3SA 3E9MA 4NEGA 2WINI 2OXTA 4JLVA 3LDUA 5F5LA 2X0NA 1ZC4A 3JD4A 1TM5E 2J0UA 5K3BA 5EKSA 1KVTA 3DF7A 1K5DA 2P2DA 2X19A 1PP4A 1W9HA 2CLIB 4BQEA 1BQ3A 2L82A 2O19A 1N33B 4P8RA 1CWUA 4PVCA 4EHDA 1V26A 2QIPA 4BPBA 1I1HA 3O47A 3I42A 5CHYA 2W6ZA 1D3AA 4MEJA 1TMKA 2B4YA 3U40A 3PW0A 2YNMD 5CT5A 2HK9A 2PL3A 1S10A 1SC3A 2EEZA 4EG8A 3VR0A 5B3LA 3SJAA 3HHEA 5TXGA 5KT7A 1SCKA 2X0DA 3JQ9A 3GTGA 3L8YA 1KA9H 1U2EA 4WN9B 1CUFA 1NYLA 2C4TA 3V7WA 5EWLB 1T0JB 1YULA 1K66A 1UR5A 4OVKA 2ZM6H 3WLNA 3RSSA 1H9CA 3P7MA 3NAGA 1OIXA 3Q98A 1FFBA 1YMVA 3DDHA 1G20E 4OEHA 1PGPA 1F17A 3PX7A 4I0WB 1W9MA 2XMCA 5LIPA 2XMZA 3MCAA 4E32A 3N8HA 3MT8A 2DFVA 5JCZA 4LGMA 4F7DA 2QVZX 3DBLB 4FFMA 3EWSA 3HABA 4US0R 5L4LA 1RI3A 1GVHA 2LW7A 1H0HA 3DXFA 3R3JA 5KUTA 1IHYA 5AP9A 1EP3B 3BAAA 5BWUA 4W9MC 2ZXFA 3IV6A 2H92A 4C01A 1H9BA 1DPGA 3GZ4A 1YS9A 4HQKA 2PZAA 3AHJA 4NRDA 3DKIA 5I5TA 3RSQA 4MS4A 3V4SA 1CVRA 1Z28A 3IP5A 1C7FA 3OF3A 1KJJA 4MWCA 5KFVA 3IMKA 1XZLA 2FMFA 1Y8QB 2E85A 1ORIA 2WHQA 4ZT7A 4INZA 1KC3A 4LF7H 1SBHA 1JAIA 1SXJB 1RWPA 2A1UB 3W90A 2EJWA 2H1RA 1ETHA 1H5UA 3CMCO 4IF6A 2GBGA 4XLLA 1KTIA 1F9AA 2H57A 3GRKA 2JJ1D 2PU7A 4WCFC 4UU1A 4C2BA 3PR5B 4P9NA 2FW8A 4CQMB 1KMHB 3QFHA 4GWKA 5IVKA 1EFKA 4JZKA 1YCHA 2E7ZA 4BNKA 1G20A 2GPNA 1NL3A 3Q15C 4RMHA 3F9RA 2R85A 1UK8A 3UWPA 4L4YA 5ICSA 4ILKA 1T9DA 3BH7A 2YY7A 5CB4A 3FOCA 4TRMA 2FX5A 4BX8A 5JMPA 4PINA 4QWCA 3QPWA 3GP8A 3RFTA 1L4MA 4COOA 3W1BA 2PMFA 1TLTA 3DNFA 2OXEA 1HT1E 4CQNA 4O86A 1YQ9A 2XUPA 4N0MA 3AESB 1OAKA 2HSZA 5LA6A 4UHJA 3IJEB 3VNUA 4YFYA 3PVXA 1L4NA 4YRPA 1U4SA 1B8UA 3DOHA 3H2YA 2CV1A 4KP7A 2HT1A 3KHLA 3CSWA 3FNQA 1DRJA 2C2BA 4I4IA 5LZ2A 5BV0A 3GTPA 2IYZA 4CV1A 5KZMB 2V96A 4DLVA 5B57C 4A91A 3WLHA 5T7BA 2WB4A 4EVSA 4GYWA 1QIKA 3U7HB 5T4HA 4Y2TA 4I1IA 2BQ3A 2GD0A 1U2TA 2QTLA 3FFXA 2WTMA 2CNUA 3AEKA 4C22A 1DO2A 4N12A 4PLWA 3Q0EA 4EYSA 4ZEXA 2B2NA 1E2FA 1R0YA 3K9LA 3TSWA 1W4RA 4AQYB 4EA6A 1SXQA 1JX4A 1SHKA 4LF8H 1ZNZA 4RQUA 1PK9A 5L7TA 1DJNA 1Z0SA 1YZLA 1DC8A 1UP7A 1V8ZA 3G6XA 3G9XA 5TLSA 5ECYA 2DHDA 3E81A 1F8YA 2Q3HA 2D2IA 1N77A 4ETWA 2HC9A 4BWYA 2ZE6A 1MC8A 2RI0A 1E1QD 4LJYA 1YI1A 2OK8A 3VYVA 4A1OA 1SC4A 3VU3A 3AYZB 5I9LA 3ZE0B 1XVAA 3AR4A 3WHKA 4B3DA 2UZAA 4I4CA 4WLNA 1UF9A 1Z7WA 3TEMA 3JQ7B 4H60A 4YAFA 3GEMA 1G8PA 1RACA 1TA8A 3UAWA 5DULA 2D2VA 4B6PA 4UE2A 2JLXA 5LBIA 2ZIGA 3CZCA 2IW1A 4FONA 4B7CA 4HJRA 3D2AA 1JHZA 1PQWA 4NE2A 3ZWXA 5CYPA 4RUCA 2C8KA 4R2JA 4P86A 5CJJA 2QX4A 2XVAA 4EY4A 4Q82A 4CL8A 3PUWA 3G8CA 3CNHA 3MWEA 3U7IA 4NMXB 3UV3A 5E3IA 1AX9A 4QULA 1JF8A 3TRDA 4CU2A 3HVRA 4IP0A 3Q5GA 3WRXC 1KQPA 2PE5A 3GNLA 5CUQA 2WHRA 1YNOA 4MYSA 3HJCA 4RMIA 3EPHA 2YXBA 4PZAA 4EUHA 2I4OA 5GTDA 1GGMA 2O8FB 1Y82A 4EG7A 3T54A 1UBNA 3GT7A 3EUAA 5IJWA 3K71B 5IAAA 1TMGE 4FSHA 4GKKB 4DYHA 3ZZMA 3GJRA 3SEFA 1ML3A 2DRIA 3OLWA 1LS1A 2Q5EA 5TQ2B 1UBGA 3OO1A 3ZWMA 2P2SA 2Y1CA 3RAEC 3U3DA 4JI3H 2NU9B 4XW2A 5DASA 3RYFB 4KGVA 4PBSA 3ASVA 2J4DA 4ALIA 2GZ3A 4HB2A 3HNPA 3S5UA 1VI2A 1MZVA 4OXXA 1LH0A 2E6KA 5JCPA 1RAAA 4BX3A 4WMLA 3NWJA 4JJ8A 3HUDA 3HSSA 2ASDA 3U81A 4Z86A 5LL6P 2O2HA 1TAGA 3H1FA 3CE9A 1SUPA 1PIWA 2EARA 3RGZA 2CNLA 2JA5G 3NEPX 2P90A 4XSHA 4G0MA 4TUYB 4XDZA 2BTQA 2YYZA 2Y3IA 3JAWA 1X19A 1TLLA 2DQKA 4QGSA 3O73A 5JDCA 3L7JA 5HKKD 2AEJA 3TB4A 3W4JA 4K9DA 3RRJA 4UU8A 4Z99A 1Z0ZA 1QDLB 5DSTA 1NXPA 5BWVA 1FUUA 4O25A 3VZSA 4E5PA 2CLCX 4AC9A 2V7BA 3ABOB 1N7GA 1SFOA 3JPYA 4EJ0A 4MW4A 3TSAA 4Q47A 3KDPA 1M1ZA 4G4JA 1G8YA 4PC7A 2O6LA 3TX6A 2F00A 4DL2A 2I8CA 4CMKA 3IDAA 5AW8A 2Q2TA 2QUKA 4Q7KA 2CMKA 4AY3A 5DHQA 2Y1XA 3LUPA 4QRHA 1E79D 1JDNA 4IICA 1A7KA 5TARA 3GJYA 3V1UA 1GT6A 5DVZA 1JKJA 1YDHA 1U6IA 1YUMA 3OJEA 1KFBB 2PQMA 2VAVA 3DFMA 2JEGA 2R7AA 3E1SA 2SCUB 1DIGA 4OL9A 2GPWA 3TBFA 5KYGA 3ZZ0A 3T7JA 3GMTA 1U0OC 1XN4A 3GCDA 1VIDA 2A67A 3NBZB 5JC8A 3NH6A 4AF8A 5G41A 2ST1A 1TQHA 4BP1A 2GLTA 3OM8A 3H0CA 3QBTA 4WKNA 1XVLA 4AO6A 1YIAA 5KQGA 3SX4A 1LX6A 4HMOA 2ENUA 1YDGA 3P9SA 3BGSA 1R4AA 4ZQIA 5JAQA 2C2MA 4E5MA 5HSGA 4HYQA 2ZU6A 3PENA 4DMMA 1EINA 1TPZA 1OT5A 1J23A 1G5HA 1MBZA 3WNDA 3GJ6A 4CMIA 3ID6C 5ALFA 3ED1A 3AX6A 4DY4A 2ZB2A 4INAA 2HL6A 5LP6F 4KV7A 1YJCA 3E8MA 2PL5A 3RBXA 3TM4A 3HG7A 3REQB 3L6DA 4K1LA 3V33A 2A5LA 4QPPA 3FGZA 5BVGB 1QXSA 3NVKI 1YZVA 1K8XB 4GE0A 3GXBA 4IJUA 1ZRNA 2WPDA 3MCWA 3S2GA 3TG2A 4N5DA 5C34B 2BYTA 3PX3A 4J9SA 2BFBB 4CEIB 2R8RA 4BZXA 3KZXA 4UCXA 2EP8A 3WA7A 2J9FA 3PWTA 2BKUA 1SHTX 1YASA 2OYRA 3EF3A 1VDZA 5BWCA 821PA 3O21A 5HWSA 4LTDA 3AU8A 2NSYA 1RJFA 4JWTA 3GDWA 4HWPA 4UCWA 2YX1A 1VP3A 4S1TA 1FPQA 2CWDA 2Y1LA 1E3DA 1W1WA 4U02A 3WK8A 4NE7A 3ORQA 1FUYB 3BXZA 3JD0A 3GJSA 4EPWA 2P6OA 3RABA 2B6HA 1TJ4A 3Q40A 2ZULA 2QD3A 1E8DA 4TWIA 3F5MA 3B1FA 4IVPA 1WUKS 4FFLA 4QYIB 1WZEA 1YQXA 4XD7A 2HJ9A 4JLAA 4WLFA 4O4LA 3GYBA 1QE0A 4FYWA 4RKWA 3KEGA 2O2DA 2AJTA 2V7QA 4B3BA 3C3AA 3X1WA 2EEPA 1LUAA 3IMCA 1IQRA 2BJHA 1E2BA 5KT5A 1SBZA 1LQTA 4A15A 2O3RA 3TGPA 3LVBA 2WKWA 2V7EA 4BMDA 5DN9A 3HDJA 2AGQA 2W71A 5CB8A 1SKUA 2HJWA 1O7JA 2YJZA 3F96A 1I5OA 2OCGA 3F6YA 3GPDG 1GR1A 3A6PC 1L2ZA 1YS1X 2DUUA 5A71A 1C0IA 2BAGA 1VAJA 1Z6XA 4IJVA 3Q3EA 4RTSA 4NYJR 2WDZA 3FKJA 3K2IA 4OX9H 3WSWA 1NR1A 1HNXH 2Z1NA 3GFOA 4YIHA 4YEDA 4NZPA 3DE3X 4G26A 2A0YA 3BORA 1VLVA 1X80B 3LIIA 4JV5B 4M0UA 1P39A 2NT4A 1FBTA 1F6BA 2EP7A 3W8DA 3TZCA 1EK0A 3IUEA 4NU5A 3GLFB 4MW5A 4ZFNA 2QQFA 2Z43A 3KHUA 5MGNA 4QOJA 1GYFA 1UQTA 4G24A 4O8CA 5JFGA 3F6RA 4AJEA 4JUIA 2PR2A 2UYQA 2AXNA 3F2VA 5LVAA 1KBZA 5F5XA 3CSSA 4N41A 3OESA 2BFEB 1DAMA 3U7QB 3MJRA 4L8YA 3K0CA 3JQCA 2MSNA 2NQ8A 4IIVA 4WINA 1S9FA 3GNTA 4KVZA 3R3UA 1QR2A 1DKQA 2ROQA 5BYJA 3T9CA 3JR7A 4YRZA 4BB9A 1KMQA 4GVPA 4QDOA 4I4TB 4EGAA 4J0JA 3QBDA 2K7FA 5ALMA 1JBKA 1P44A 5JDIC 1R64A 4DQXA 4V0LA 1JYFA 2NU8B 2PV0A 3LPCA 3M9OB 2PWAA 2VUTA 4PHGA 4TT3D 4AS3A 1O4WA 1MJGA 1ADGA 1EVZA 3GZTB 4I7EA 2ZK7A 5CCEA 2D13A 3T5PA 5AW7A 3GOHA 1FYVA 2Y71A 4YT2A 2AYZA 4RGBA 4I3GA 4HLNA 1VGVA 1L9KA 4O7ZA 1AZSC 4U2GA 4BFSA 1XZEA 3QVXA 4ECWA 1RRKA 2Y1KA 1P2DA 4U2FA 3FCYA 5K2OA 1ST3A 3U54A 3W2TA 5J4HA 1I2AA 5FUXA 3PPVA 1IHUA 1T5BA 2VF2A 4CYMA 4F2DA 3TF5A 5IWAB 4R8RA 3ZW9A 3NXSA 3ILYA 2VUMA 4GUDA 2WAYA 1LI4A 5G0UA 1CR2A 2UU9H 1RC1A 1Q7CA 4JLPA 5KFMA 1FMCA 4OAPA 5JD6A 1Y33E 3AL0C 3HACA 3GAMA 4YLGA 3RUCA 3SSOA 1VKRA 4ATNA 3UJCA 5AESA 1G9TA 1Z4NA 1XALA 3TSYA 1CP3A 1SXJE 1JYSA 3FPJA 2BFDA 4JCCA 4EW3A 5CX4A 5AJUA 5U4QA 2Q5HA 2Q99A 2FW6A 4KQFA 1KIMA 3B6KA 1DC6A 5C4XG 2D0DA 2R5WA 3OCUA 3GGJA 3IQGX 1RJDA 5IM4A 1OFVA 4XFJA 2XR1A 4ENSA 1ZD4A 2OC4A 2PLWA 3OJOA 3LY8A 4DREA 3JPWA 3OQMA 2W43A 3H2JA 3LLUA 2GBCA 4I6GA 4RU1A 2IEDA 4B75A 4HZUA 1ES9A 1U0TA 1P4JA 1GTVA 2Z2YA 5KFIA 2EF1A 3BILA 4JI1H 3KQKA 3S2FA 4KHZA 3DBLA 4Q4CA 3B1YA 2O2JA 1BA3A 2PWYA 1NQTA 1K6JA 3F9IA 1Z7EA 4Y9RA 3WWHA 1EGVB 2Q28A 2OFXA 2Z0MA 3KWMA 4ENRA 3HLKA 3HWWA 2RGEA 1UQRA 4AY6A 1Q19A 3VR2D 1V45E 1PZNA 2D1QA 4DQNA 2Z2ZA 3L4BC 2OV3A 1AHIA 2QXTA 3W9YA 2ZR0A 5TQ0B 1D4AA 4G41A 1SXJA 1M6WA 3X1DA 4U7DA 4L7QA 1I10A 4D43A 1TX4B 1CR6A 3NYQA 3W4KA 5CCBA 3T94A 1ORWA 3QY0A 1D2EA 5H59A 4QJIA 4BGVA 4AUEA 2ENWA 1L4EA 2R48A 2P67A 3A0RB 2ZIUB 3WLKX 3Q8LA 5L6LB 4TYMA 2CBGA 1W5SA 5EC8A 4RF3A 4DVJA 2VSFA 1RLTA 3CZ9A 3TSCA 3ZEAA 3SI8A 2ORVA 3IUYA 5D3KA 1VSVA 2ZJBA 2C7OA 1NN1A 5GM1A 4TWAA 3ROGA 2ZT8A 2L2QA 3H7AA 4Z7OB 2R6ZA 2J32A 5JAIA 4K9QA 4YC7A 1SEVA 4GLLA 4C7BA 4OHCA 1II0A 2GLUA 4V0KA 3CLUC 3C3MA 4OLHA 1OH5A 5IP9G 4G9GA 4DC1A 2ZITA 1JR3E 1EFHA 3ZLJA 4OB6A 4V0ME 4KQGA 1X87A 2PD6A 4OREX 3UZOA 5A1JA 3O74A 2GVZC 5CH3A 4YRSA 5L3SB 2JIQA 5FUVA 2XCAA 2ZTMA 2J0UB 1F7UA 4M1ZA 3IO5A 3LFUA 4URYR 4AQYH 3F7TA 1QJ4A 2QE6A 4X65B 3PNBA 4YO7A 1I0LA 1RP1A 3WDMA 2DOKA 3Q8XB 2GBLA 3MPOA 1GPMA 3O83A 2M05A 1SUCA 2GJKA 5DLQC 4WASA 4Q00A 1E9DA 1OHHD 3M3PA 5FLYA 2B82A 2ZI5A 4MKXA 3QFFA 1Z26A 2VPQA 3UFXA 5I5VA 5E9WA 4OQXA 1EK1A 1T0UA 1JA9A 1QAQA 2VK2A 2VPPA 3M3DA 1RAHA 3CVUA 5IH7A 3P0EA 3SLRA 4LY6A 1GG9A 4G1FA 4TM8A 3BHMA 1K5PA 3LDFA 2RIRA 4PLGA 3A26A 4FQ7A 2BOVA 4G4GA 2CLSA 3KOYA 5H81A 4KLZA 2HK6A 2E55A 1JR3A 1YQUA 4OQDA 3BICA 4UXJA 4GVXA 1CIJA 2QRMA 3RASA 3HU1A 4FGSA 2G8NA 4E2WA 5TT1A 2NXNA 4ZANA 4HR7A 4H0FA 1EJ0A 5JHHB 2YXDA 3JQ7A 2QEQA 5FOTA 4H7HA 1ZIDA 1AU9A 2MTBA 3G5MA 1FDRA 3D64A 5JLAA 3OX3A 4U9UA 1T1IA 4RA9A 3KQPA 2C8LA 1AUVA 4J9RA 3C6MA 1OXBB 2ORYA 5DT9A 2ZM6B 5TE9A 5CCXA 3BRWD 4P58A 3D6NB 4GOMD 4MS4B 3QX7A 1VA5A 3B70A 1LU9A 4IRUB 5D87A 4RXTA 4YUWA 2ZCUA 4BY7G 3ZS8A 1ICEA 4GM1A 2YNMA 5LKAA 2Q3JA 2XW6A 1VG0B 2FR0A 1ITZA 2R6JA 4R6XA 4MVJF 2H2GA 1VLMA 2ATXA 1GU0A 4IINA 3CJQA 2OCKA 3DWGA 1J1ZA 3DFZA 3NU1A 1Z8DA 4RHXA 3DAAA 1I2LA 4FFVA 1HG1A 2RGNC 3ZVKA 3SFVA 3ZCRA 3RGXA 2NZWA 2Z95A 2ATCA 4EBCA 4TYWA 2O20A 4JLUA 3EVNA 1IOWA 4AQ7A 5TQ2A 3A1FA 3QVOA 5CB4B 1DG3A 5A5DA 1DAGA 4FFRA 2NU9A 2WUVA 4JP8A 4PSKA 2ZI4A 4UUGA 3DV9A 3SICE 2G9NA 2H17A 4MIOA 1L8QA 4AWAA 5CT9A 5F51A 2WQ6A 3AH8A 3L9XA 1QU3A 3HUEA 5ADHA 4G25A 4NZMA 5SY4A 5LA6B 2JA5A 4NULA 3A70A 3CX7A 3UUWA 1I3QA 3TSOA 3BBLA 3VOAA 5EHZA 1J22A 4EX6A 1BKYA 5GADl 2DR0A 2GHIA 4TZTA 4CLHA 3PGLA 4OLAA 3FLMA 1WZUA 4RD6A 4K6CA 4A26A 5IM5A 4M83A 4WLOA 3S2YA 1Y3CE 2X41A 2QL9A 1N9GA 1I9CA 3DHYA 4TUYA 4UM7A 4YR3A 2R6R1 4FEEA 2D5BA 1DO0A 3AY3A 3WWYA 5E9JA 1A5ZA 3AEKB 2ZM5A 3Q7RA 3R44A 1KUTA 2VC2B 3CVVA 3ZCPA 4MXDA 4EGCB 1HDRA 3CUSA 2RHGB 4JYBA 4U6QA 4E21A 1DCMA 4Q9LA 3DONA 5BN3A 5AKXA 3MMSA 3PI6A 5EMMA 3UUGA 3IBYA 3Q2IA 2QN8A 1GQRA 4GYKA 4HEQA 1MJGM 2ZAMA 2HSDA 3VR3A 3MBOA 3DW3X 1OU0A 5AW9A 3L07A 3MWYW 2K4MA 1MJNA 5IAJA 5K3EA 2HFKA 1AKEA 2QSYA 2V7UA 2BKVA 2IEZA 5JC1A 3FKQA 1JFRA 4MQ6A 1DNPA 1RPTA 2QYOA 2DVMA 2YMPA 2DPIA 4Y0VA 4XVRA 2R3SA 4HWGA 3BJRA 1JLRA 4UOZA 1Z39A 2VSQA 4AJKA 3JSAA 1JSLA 2IVFA 5KO2A 2P7IA 4HB0A 4M38A 3FJOA 3FA2A 2GMWA 1GTG1 3OG9A 3KQMA 3WMRA 4DJFC 2PUVA 3ABIA 4J0CA 3LQQA 2BW0A 4FDMA 3THWA 2UDPA 2VG8A 1PT6A 1QQBA 2CF5A 2HA0A 3SJUA 2FSVA 3ETJA 5E25A 3MWEB 5F9LA 4J0QA 1H94A 3F97A 2XCQA 2CZCA 1CHNA 3JQGA 4UDYX 3RC1A 4YRCA 4HUQA 3S1AA 2FSSA 4OQLA 1WQ4A 3MMPA 1B00A 3GD5A 4D4GA 1QJCA 1U28A 4AN4A 1HV8A 2W2TA 1QPGA 4Q3OA 4WY8A 4C1NA 2FQ1A 2RGRA 4QVKA 5CGZA 2H06A 1JQJC 3WRYC 1ZHSA 3LUDA 4D97A 4TWBA 2R7KA 5BW4A 1ZNXA 4KUGA 3IT1A 3BOSA 3ADCA 3GL9A 4E4YA 3QJ5A 3DW1X 4BN4A 4L15A 4B73A 4P33A 1PJBA 2HDKA 2Z83A 3UCXA 2QPTA 4CDNA 3ZE2B 4LJKA 4QEZA 2IBTA 2OV8A 4YTEA 1L5VA 1TGYA 2G25A 4F1KA 1JA0A 2W8LA 5LZ5A 3RK0A 2OVFA 1GNTA 3MR5A 4KL8S 1GOTA 2LGJA 1MOZA 2HA7A 3QKIA 2XA2A 3EC7A 4Q9AA 4MTLA 4ZYTA 4GR4A 4R83A 4XWYA 3DFFA 2YOGA 4OB8A 2I5PO 5TPWA 3B1VA 3C6QA 1RWOA 1A9PA 2H08A 1K0FA 3LT4A 1TJ5A 2BY4A 4JI3B 3QU9A 3N6XA 3BFPA 2PUDA 3HXTA 2J5XA 2X5XA 5HF6A 4A8JA 2R1UA 5D85A 3OO0A 1W73A 4XGQA 1F1BA 2BTQB 1MPXA 3GLFE 1U7XA 2C2XA 2JBWA 1J2TA 1J0BA 4N47A 4QYIA 4KBFA 4F9TA 1WXDA 2PG3A 5TRTA 1SRQA 4JR1A 5AI4A 4D45A 1JVNA 2VJKA 3KDAA 2PQ0A 1LDEA 2QZ4A 4IJWA 3LLSA 1T5DX 4K6MA 1ZQ9A 4LZAA 2PSFA 5DLEA 4FYHA 2W98A 4LN1A 1QIGA 1V9SA 5AYVA 4ZVQA 2JGKA 4R2MA 4RXMA 4RTPA 4HZIA 1IY1A 4LQCA 1M2NA 2CLFB 2OUKA 4DGQA 1QIEA 2QRNA 3IE2A 5EQTA 4LE0A 3BHNA 4NYIQ 4DIOA 1XTTA 2JK0A 2Z6VA 3S7ZA 1QKJA 1V6CA 1JKJB 4MROA 4X97A 4KE6A 5D1NA 8LDHA 1C0EA 3WG9A 2JLAA 1BQ4A 2MCTA 3GLFA 1Q44A 3KSZO 2C83A 2W48A 4ZU6X 2I6XA 3EDRA 4FJ0A 1NUQA 5AVWA 4YACA 3G9ZA 3GARA 3E18A 1A2QA 2QRKA 5F3WB 4FJ2A 3AXSA 4IIEA 3K32A 2Q45A 2HCBA 3MOIA 3KKPA 3AV0B 2VP3A 3S70A 1F2UA 4E5DA 1L7MA 4LI0A 2BFEA 3KQLA 4XPZA 2PRYA 2J31A 5JECA 3COPA 3SWWA 3KT6A 3RVRA 1Z36A 2ZQ5A 1T5SA 2XGQA 4UTRA 2VP4A 3IAEA 1YUNA 4NK4A 4YRFA 1MVNA 4OHVA 4X54A 1REQA 4CMIB 3U4GA 1CVLA 1GFIA 4MO2A 3TLCA 4D4JA 5BOSA 4DSNA 2NU8A 3T1VA 3GYGA 1KS2A 4D9CA 5G4KA 2WYUA 2IXDA 1Z0UA 3JQQA 3KYCA 3A1VA 5IWAH 2L69A 4B4DA 1DINA 1H2HA 4Z3OA 1ARZA 1H0KA 4JXXA 3ETNA 3KBBA 2EYUA 2IH4A 4OJTA 2DUWA 5KFJA 2N3ZA 5KJEA 4EKYA 3H8SA 2EV9A 4QYXA 1NVEA 1AS3A 3HN7A 3X1ZA 5JXIA 4HD8A 2X9GA 3EGVA 3GGGA 4DMCA 4XGNA 1O03A 3DZGA 5EGNA 3TAUA 2FUEA 3EFOA 3U62A 2DHRA 4RNOA 4KXXA 1CS4C 2XJ9A 5LQRA 4NJEA 2ANBA 2HUNA 1K98A 2BKAA 2NWQA 1J2EA 2YZMA 1VKZA 4QDZA 4MTDA 4OGWA 1IZ7A 2XAUA 3AP2A 4PR0A 4DARA 2I78A 5H1YA 3A3PA 3DTVD 1Z2CA 2AMLA 4P0TA 4O4LB 4BV3A 2Z1DA 3V3TA 5KB3A 1KR2A 2PJZA 2ZSKA 2WF6A 4QJFA 3ZG6A 1TMYA 1JG1A 1PLLA 1YRBA 3WJ2A 1GARA 4MQEB 2UVQA 2VTVA 4QFBA 4BVEA 3AGQA 4IO0A 2JHGA 5EQDA 1K7XB 5C3MA 4RSMA 3F5QA 1XTJA 3HCEA 2ZIEA 2VA8A 1DEKA 2O3SA 5JCOA 4A73A 2IGTA 1NN3A 2WWRA 2PO7A 4ZQGA 3PR4A 4CNBA 4B6RA 4FN4A 2ZB3A 1ORTA 2NACA 3T61A 5IP5A 3B3AA 3IG0A 4QWWA 4DSZA 2HRCA 1U8AA 1HZZA 3T5KA 4O6VA 2TYSB 3EHEA 1NJ6A 1DARA 1FYXA 2B99A 3IOBA 3F71A 1KI6A 1Q1BA 4KKVA 1PJ8A 4YGXB 2X9VA 3PNPA 5EIOA 2UUCH 5ESRA 2PKQO 4NVRA 5K6RA 1YTUA 3O38A 1ZUD1 3LFHA 1Q2UA 1DOAA 2DH6A 3MBIA 4OX9B 4HWRA 1HNXB 2ZT5A 2QAGC 1Q0SA 1RRGA 1Z56C 3KE8A 3WK7A 1T9BA 1EXDA 1Q3HA 4BOYA 1VM6A 4PZ0A 4KQIA 5JARA 2CNOA 2YVAA 5G0SA 5JQWA 1ODJA 5EVCA 3QFTA 1H2AS 2ADFA 3CXRA 3KS9A 5LKRA 2Q07A 1MEEA 5KOIA 3RVDA 4EHHA 4LTNA 2JH8A 1FU8A 2ONCA 2CDCA 4G65A 3AFNA 5ARBA 4DLZA 4QUHA 3N59A 2IEGA 1D2HA 2AKYA 3NYWA 4PYKA 4L9SA 3WYGA 3ISTA 4C78A 1Y9JA 2FWBA 3EZ7A 2GK7A 4A7PA 3PE3A 1C3LA 4JB0A 4PQGA 3N7AA 1GGJA 5DM0A 5IHPA 3IERA 3SJBA 3RAPR 5FTWA 2XYVA 2H85A 2CLLB 4XWGA 3ORRA 4L3OA 3IAS6 3UOAB 1RM4A 1GA1A 1PEDA 4W8OA 1GAXA 4A2PA 3AB7A 5KYKA 3UMYA 1AQNA 3B7WA 3D4PA 3M6WA 4A2QA 1PQYA 2C42A 2X4LA 2RCYA 1H6DA 2PT5A 1FW8A 3MRVA 3PXDA 5KJ6A 4M9UA 2WVHA 3W9BA 3T5LA 1Z4KA 5FIUA 1V1JA 2P0AA 4LYJA 4A6EA 1CJTC 2Z04A 3IHWA 4ED9A 3L1IA 3B9BA 4X7PA 2VUMG 2BFDB 2GPJA 1QHNA 1HRDA 2WU4A 2IITA 4BLRA 4CR6A 3IHLA 5IHXA 1E2DA 4O33A 1YZQA 2AUTA 3WB1A 4MQFA 5AI5A 5JR3A 4ZZ2A 2COKA 4DG9A 4UC0A 4RZHA 4R8UA 3AVPA 1R0RE 3RC3A 1H1LA 3H4BA 2UU9B 4QQNA 5I01A 5AIAA 1Q95A 1UBTS 4IOMA 3RKUA 4K6FA 4PPYA 3EIWA 4AJJA 2V7TA 4FXPA 4HZUB 1CF4A 4ZCLA 4F6RA 3COVA 4YGYA 4TVOA 1PEAA 1LB1B 4WFJA 1XRQA 3DLAA 1PW7A 3O26A 3MEQA 4G07A 4CZ2A 5A06A 2EWVA 5COAA 4E22A 3B9RA 4J1TA 3IA2A 4UXIA 5JXGA 3HU3A 1QRRA 4FFPA 1I2DA 3RNLA 1XXLA 4FI3C 4GH5A 3WYDA 4R98A 1UC5B 1GCIA 4XAQA 2XNSA 1ZEMA 4FXOA 1HE2A 1K2WA 4JI1B 3UKDA 3C6KA 1ZZEA 3EXHA 4PW0A 2NVUB 2X8BA 4OHFA 3FYUA 3QFCA 4NZZA 1CBUA 2LCIA 1ORHA 2GZHA 1NBMD 2QTWB 1IPEA 1ODIA 721PA 4ND5A 5K9ZA 2MDTA 2GKSA 1THGA 4MGYR 2BISA 4K0KB 2ZIFA 3FUTA 2JBHA 3IDFA 1SUSA 4GI3A 4HPXB 4FBMA 1YVPA 4EKNB 3PF9A 3JV7A 2RB5A 2J5KA 2CNBA 2C54A 4JQZA 3UBMA 3MRTA 4KEAA 1EB8A 2DTDA 3SVLA 1ODSA 3IQXA 3K8QA 2B98A 5TF4A 5K09A 1ZD9A 1K1QA 4DLSA 1GZ5A 5FEUA 1QYRA 4IDBA 1L4HA 2PZBA 2W6IA 1N7JA 1DJMA 1T6ZA 2BZ1A 4IS3A 8GPBA 4QOHA 2IS4A 3GLSA 3KAPA 2FPGB 4IDPA 2CL7X 2GA8A 4BFVA 4TV9A 3OIVA 3T9BA 2I9PA 4Z4CA 5LMZA 4LDNA 4J9NA 3K16A 3QQMA 2Z3WA 3VR2A 5LCXA 2C5EA 2RKOA 2Q4BA 1HT2E 3L0CA 4A3KG 3N2KB 3FHJA 1C50A 2HEIA 1M10A 2FG5A 1K6XA 2OXRA 1EFVA 4M0PA 3ZHYA 4M1QA 5AKIA 2AOWA 1NYQA 4RKEA 2YJTD 1YVUA 2GEBA 3HMKA 3CW2A 3HPRA 3RB4A 4QWMA 1ILEA 5IJ0A 1V4NA 1OT3A 3DE6X 2KSQA 1UJMA 5BWBA 3UFXB 4KNYA 5IKPA 2RK6A 5HIAA 4GXRA 1VZ3A 1I13A 2JS7A 4KMOA 3L7DA 1HORA 1Y7LA 1SBTA 5I9NA 4GM4A 3JZDA 1BEUB 3I2JA 1U9IC 4EYEA 2CBXA 3AF0A 3DZ8A 3BK1A 4DA7A 3EGXA 3GLKA 2BMWA 3TFWA 1Z8NA 4EMBA 3ZDZB 5C8DA 1RI5A 1ZSVA 4UZSA 4FDAA 2PGIA 1Y6ZA 3RRXA 3SHQA 4K2AA 4M7EA 3AG5A 4D2IA 3D3WB 4J43A 4KDCA 4DEYA 2AJ8A 1HRKA 2FZ4A 2KHZA 1PUIA 1Y8CA 3I6BA 2WTBA 1NPYA 3PWSA 4Q3CA 3O4GA 4BQRA 1GNSA 4NMHA 2Y6UA 2NXJA 3HU2A 1LBQA 1G8FA 3VDQA 3U0VA 4RETA 4RA9B 1PYDA 3M1IA 1RHQA 3HYRA 5I4BA 2FUNB 1XCLA 2PZFA 1SK9A 1KRWA 2MCFA 1IUNA 3T1YH 4YHHB 4AJ2A 1FNBA 1LPAB 2YASA 3IPYA 4IZIA 1Y1KE 2F3UA 2FW7A 5F2NA 2QUIA 1OHHA 1IZZA 1PSDA 2KBFA 1VIVA 1Z08A 5AOAA 4O3NA 2YC2C 1OILA 1Q0HA 1P5FA 2I3GA 1G5TA 1OFGA 4OGKA 3TQCA 3P9CA 4IDQA 4CG2A 3NBFA 4YJ3F 3PNSA 5D1HA 2AK3A 3OF5A 3C14C 2H1OA 1YV9A 3EZ2A 4E2FA 1J07A 1P4GA 2BV3A 2IYLD 3TW8A 1VBNA 3MR3A 3HR8A 1RYBA 1S3IA 2R751 1BAPA 2RHCA 4I36A 5G40A 3MMNA 3GWZA 1QTRA 1YR2A 3P97A 4X45A 6NULA 5MFZA 1P7CA 2W11A 1V25A 1ZOPA 1TADA 1M3SA 4IEIA 2BI4A 5J2UB 2PLNA 3DBHA 4MVCA 1L4LA 1W581 5JG7A 3GEDA 1IHPA 2CMHA 1UT5A 2B4QA 2BBWA 2HLDA 4S05A 2XPCA 4HGNA 4Z2AA 3ZCSA 2PGNA 2C5LA 2VHXA 2VDQB 2VQSA 5DXAA 5CBPA 4CL2A 2OGSA 3HJAA 3VR4D 3WNVA 1NV8A 4ZZ0A 3KJNA 3BXHA 2BZ0A 3UC5A 1B1CA 1G4HA 3ANSA 4C0LA 3EQ6A 4UMDA 2BPOA 1NJFA 1EU1A 1NURA 3L77A 2L19A 1ZESA 1TT5A 4REOA 1EWYA 3ZNPA 1N9GB 1RC8A 4JI0B 2OZLA 4P31A 4CL3A 4KO8A 1H4VB 2VYND 1OWMA 1A9XB 3D4LA 5KPDA 2MINB 1T6YA 3O0DA 4K5QA 3PYMA 1TA4A 4LF9B 1FK8A 5DLFA 2IK8A 1LA2A 1KVRA 3ZU3A 3KR1A 4G81A 5CX1A 5F12A 5BN3B 1XAIA 2Q5CA 5HTKA 2H7VA 4QPDA 1WOMA 4LSGA 2WF5A 1B0ZA 4R1LA 4XGRA 4OX9Y 5JAHA 3BE6A 3MTEA 1C14A 2YMMA 4AG6A 5AOBA 4MV8A 5DGAA 4B3CA 5FOWA 2NVYA 1J5EH 3LVQE 5B1SA 2I2CA 4JJKA 4PHCA 4MAMA 5FAKA 5JAUA 5JE8A 4ZYZA 4J9KA 4RC9A 4HN2A 3QOXA 1J0CA 2IU4A 1RMTA 3CGWA 3L7NA 5AVSA 4RPHA 3I76A 1I6MA 4O5OA 4ZV4A 2ZJAA 2R60A 1HOTA 5B2FA 3UATA 1XV5A 1DTSA 3FCXA 3VKUA 3LUGA 2HSGA 1K5HA 2PL1A 3ZW7A 3D8NA 3KVYA 2YIDA 1VA4A 3KJZA 1J42A 1XFAA 3QNUA 1YJ8A 4D6PA 3TTYA 4B32A 1GZ3A 2Q46A 2ZTHA 3DHEA 4R0VA 2ZATA 3THWB 3IDZA 1V5FA 2NUBA 4LWQA 2XGPA 1IVYA 1USIA 3RKSA 3BJIC 4B5KA 1W52X 1CRWG 4AB1A 3WLAA 3W8FA 3G82C 3RWBA 3RT1A 4R1PA 3JQGB 2RH9B 3QY9A 3VU1A 3QEJA 3K70C 4HUQB 1P33A 3ZY5A 3S1AB 1JJVA 1L6IA 3B1JA 3P5SA 1GTZA 3O4IA 3KLNA 1VP9A 1DEXA 1NZFA 2DSNA 3LL7A 8OHMA 1W0JD 3E7WA 1Z0DA 4JITA 1ZAYA 3PKJA 4ARAA 3VV3A 5KTPA 2BBSA 1ANKA 3NM4A 3HDGA 3KD3A 2YTZA 5KVCA 5KFGA 1JSZA 2FSHA 2XNDA 1EX7A 3LKDA 3HUFA 1XZCA 3DEHA 1ODLA 3UJBA 3OKPA 3RIGA 4BNNA 4HXEB 2WLSA 3K09C 2BTOA 3AERA 4PAWA 3LK6A 3I45A 2PLAA 3FPSA 4MUYA 5A7HA 3UYYA 4RW0A 4D0NA 2V6JA 4WRRA 4JDUA 4B3MB 3DAGA 1KDRA 4KRFA 3PR3A 3IAM6 2JL1A 2XWQA 4AZVA 2OO5C 3W5HA 1UJCA 1KI1A 1BS1A 3NP7A 4TRNA 1NVXQ 5TPWB 3M89A 5IT0A 1DHRA 2FOLA 4NCBA 3IIJA 2Z3ZA 3DT6A 1SA0B 1NIJA 3GJ3A 2FK8A 3A4LA 5DYYA 4E5KA 4XVQA 4A8JB 1OF1A 4DR6H 5FJ8G 1V8FA 4RNMA 5FL7A 3A6EA 2PWPA 3R0ZA 4DV2H 1UBJS 4IFTA 1RYSA 4MLPA 3NHMA 1E6UA 5B30A 1HBJA 5FJJA 4AZSA 3TTTA 3ETLA 3RIZA 1U2DC 2ZBUA 3AUJB 2XI4A 2ZWMA 1XRLA 1EVEA 1E3LA 2ZANA 3F6PA 1Y9DA 3ENNA 2PUWA 3B82A 3IILA 2JAXA 2I22A 1E4VA 1VHDA 1EWKA 2XCIA 1SO8A 3PD1A 4NCIA 3ESYA 5GVSA 4OM7A 3C1AA 1ZX1A 4MQEA 4G1EB 1IWBB 3JQ6A 1W35A 5KPJA 4JNKA 1J39A 4XJTA 5JTTA 3DEYX 3RM3A 3N2GA 1FSPA 1E5TA 2IODA 2XHZA 5J3JA 4QIHA 3M6FA 1ZCAA 4U8HA 1ZVJA 4DR2B 1T4GA 3MOGA 2AKEA 1SC9A 1ZISA 1IM5A 1XRMA 1TRHA 4OYYA 2C98A 1GUZA 3WZMA 2PS9A 2WIDA 4K88A 1QPBA 3R1IA 3DLTA 4MMZB 1T10A 4ZK2A 5A3RA 2PH5A 3HN2A 4ZYVA 4GC6A 3IIIA 2G1AA 1WB6A 1ICIA 4Y2JA 2W2NA 1MZPA 3L2PA 4P32A 1KIAA 3FDXA 1ZUNA 1K06A 1IQPA 4WFQA 3EC2A 4HDRA 5HEKA 1UKAA 2C9YA 4NP6A 3VPSA 4IWNA 2AW5A 2FCRA 4CG3A 1ZVVA 3L4EA 1F2UB 4PPGA 4YONB 3JALA 1SD2A 4D9MA 1W5AA 5K0EA 3M2PA 4WY2A 4QODA 1WMEA 5ILQA 1X8JA 5HUQA 2JHCA 4J9QA 3A32A 2W2LA 4FYJA 1AKQA 4AP5A 4RLQA 2HR1A 4FR5A 2P68A 1CUAA 1REQB 2O8CA 3KKZA 3V4ZA 3TLYA 5DW0A 1MGOA 3QLEA 1OLOA 1X1RA 1S4QA 2C8JA 2GI4A 2XCPA 1E9VA 3HS3A 2NZ8A 5BOSB 2REBA 4F5YA 2EFEB 5F77A 1A04A 1ZD2P 1PDVA 2UZ0A 5G4KB 4ED2A 1Y3FE 3ICPA 2JI9A 1SPXA 4TKZA 3KYCB 3EXG2 5DWQA 3VZPA 1PJTA 4PVDA 3HKCA 4C07A 5BXQC 2FK7A 4OO3A 5TS3A 2HLPA 4ZGBA 1I01A 1MCZA 1AKRA 3KVVA 1TZMA 5LUAA 4J7CA 1FA9A 1TYCA 3KPJA 1WPXA 3M4JA 2YXPX 4Q6WA 4MIKA 4CFZA 1UKZA 4I5FA 5HNEA 3AOEC 1G41A 3TVYA 4EO9A 5MF6A 4P34A 3G0GA 2ZBRA 1F38A 4JJ6A 1M6NA 3ANNA 4YCCA 1OJ7A 1XEWX 5AT1A 2JGAA 2VKQA 2P30A 1N6NA 5KTKA 3BZWA 3SBDA 3SC6A 2O05A 1ADJA 3EFOB 1CKEA 4DA9A 1U11A 4RDIA 3K0FA 1F2VA 4HMPA 2VQFH 3UAOA 4MEAA 2FJZA 2XTZA 2N1MA 1BWSA 4DB2A 4NJEB 5C8VA 4FT4A 1SN7A 1T2NA 4D9GA 3H5WA 2I2FA 2WE8A 4H7DA 2V5UA 1Q21A 3WGQA 4BKUA 1QVWA 1VE9A 4ZP1A 5JJBA 1KK2A 5AQEA 1T34A 2J5QA 3ZTYA 4KFRA 4KXNA 4P4UA 4EHFA 5FWNA 2FMAA 1K92A 3U6BA 3BRCA 1YO6A 4I8IA 5DQIA 3KYHC 1WUIS 1G19A 3RRNA 2VHYA 5A3QA 1DJOA 4HNUA 5I5SA 4X6YA 4OXQA 1DTEA 4F3NA 2OHOA 2VJDA 4B9AA 4LY0A 1RWQA 3H8VA 2V8OA 3WLOA 1OI7A 4J6FA 3MJHA 2E5FA 4DCJA 1B76A 4NBTA 5HDBB 3CUVA 4HH1A 4YAUA 1EG2A 3ZC3A 3G6KA 1KOLA 2VPXA 2PBRA 3GTJA 1IRXA 2HPHA 4K0KH 3C3DA 3SR3A 3T3PB 4BRWA 1DZIA 1QVZA 1VIYA 1R74A 4JEMA 1P74A 3EXFA 4AG5A 1HEIA 1JAHA 1FRZA 3RS0A 3KUXA 3DO6A 3M33A 4GPBA 1KI6B 3C15C 2JHPA 2Q4EA 2XDQA 2NVUA 2ZP1A 2SBTA 3EDYA 4X94A 4GYJA 2A78A 3QI2A 1VFNA 4KG7A 1L9XA 4GMXA 4HT3B 5B6PA 1EGAA 3KBOA 3NFYA 4DRXA 5CVUA 3CSDA 4RLHA 4D02A 3J81W 1HE8B 3W05A 4M9RA 4WXPA 4M99A 3Q1KA 1G8MA 4IW3B 2GEKA 5KNDD 1E1MA 3LBNA 2IP4A 3WKCA 2SKCA 4J8PA 1RM3A 4O4JA 2Q3MA 3NWEA 1Z07A 2QD2A 1EJ6A 3WWCA 1T2FA 1HNWB 2FWAA 4C08A 2UUCB 3TQIA 2HZ7A 4HV4A 2PA3A 1BU8A 1GU7A 4WACA 4C4ZA 2ATEA 4C29A 4EPVA 1JIIA 4UEJA 2W2QA 4I9FA 2DR2A 2FPGA 3KEOA 2JJQA 2VAWA 5KS2A 4F4FA 4JASB 1SXIA 4YWJA 1VBKA 2IA5A 4RMGA 3OQHA 4FYVA 1WZ2A 4DG8A 3SKYA 2JG3A 3N2KA 2PJDA 1ZVQA 1V4VA 1SOUA 1MZBA 4V39A 2ZYDA 4BRUA 3OIGA 3TCKA 3F7OA 4WX2B 4QHYA 1ISPA 2Z6UA 3Q8MA 3TY5A 4Q3AA 1R1DA 2HJSA 3VISA 2RH8A 3OMWA 1EFUA 1FSZA 1MVLA 5KG1A 1GTJ1 2Q3EA 3LQSA 3WGVA 1KSJA 1YJQA 4FNAA 1US8A 2GFQA 3LY7A 2VBCA 1ISIA 1TAQA 2R8PA 3OT1A 2BM0A 3DHNA 2E2HA 1H6CA 2AZ4A 2EJUA 4IF4A 3PZRA 1ZOLA 1ZWKA 2JEJA 4C7XA 2YWXA 2HK7A 4Q48A 5U1PA 2E48A 4KRXA 2FX2A 1U8EA 5G0WA 4C6HA 5B7QA 4NDZA 4JLKA 4S2EA 3PF8A 4YHHH 4PYOA 2AGVA 4MQFB 4AG3A 1PL0A 3MFQA 4AJNA 4R8UB 3PFNA 1FUEA 5F3RA 5DFAA 1H1LB 3D3WA 3EIXA 3RGGA 4ND7A 2HM7A 4U39A 1FBNA 4DJJA 1MB3A 4PWQA 5JVLA 4O81A 2ZI6A 1UIRA 4F6RB 2HUPA 3PHCA 1T8WA 1WZCA 1PR3A 3R0VA 3ONVA 2IOHA 4NHOA 3U61B 2FPSA 2WA1A 1GTSA 1PS9A 2PZLA 1VJGA 5CB0A 1JDSA 1JUDA 1JPJA 2VCHA 4V3CA 3G1WA 2HJVA 2RH5A 5EE5B 4IFIA 4MYDA 2WB1E 3ON5A 2VNKA 2FEMA 1BG6A 1CUBA 4FN5A 1QCZA 5BMVF 3DXXA 1TAEA 3RS5A 3H3VH 2XNHA 5F52A 3LPNA 5CAEA 1JH9A 2O3TA 5DGXA 4K6HA 4U2EA 5FBWB 4YPOA 4S35A 3L7MA 2LNDA 5AR1A 2E4ZA 2NO4A 3C45A 3B6MA 1QIFA 4AJIA 3ZU2A 4QBGB 3EXHB 2EIXA 4B81A 4N6GA 3FYUB 4XWOA 4GP6A 4H1TA 1Q2XA 5FFNA 3P27A 1TUEA 2POCA 2BBOA 1P7VA 3LIPA 2PX6A 1PDOA 4UBNA 3URMA 2WM9B 4DBVO 4DR1H 4CM8A 2FJPA 3BXFA 2CHVA 4KRYA 1XA3A 5T67A 3A2KA 2WU0A 3I05A 5F98A 2CUZA 3LA6A 2QQEA 1PZMA 3HEMA 4O0LA 5J2UA 2OB1A 3ZJUA 4EP1A 1ADFA 4UBMA 4ZARA 3FWHA 5EEGA 1GQQA 2C78A 1SK8A 2HCTA 2WB1A 4FHZA 4HSGA 3FSJX 4A0QA 4BUZA 4Q3NA 4JI0H 4JNCA 4QPZA 5E4FA 2FF7A 1ESNA 4TV9B 1SKQA 4PXAA 1Y1LA 2GN1A 4YV7A 4ZO8A 2I4LA 5K4AA 1T8TA 5HA5A 2AN9A 2UVPA 4LF9H 5M04A 1P4HA 1ZFNA 1O4VA 3RGWS 4CGZA 2ZRQA 1XZFA 2QYZA 2QORA 2VPYA 4GT1A 3NIWA 2GK6A 2QD4A 1EFCA 4CI0B 2YJ3A 4CG1A 1EFVB 1HZJA 1IPFA 2AJLI 2JJ1A 4KN8A 1GILA 3Q5DA 2C7VA 2XGGA 4WK2B 2RE8A 3EBPA 5IJ0B 1A9XA 3RG8A 5JFOA 5EHXA 3Q0TA 4URZR 1K86A 1E2JA 2MINA 2PX5A 1M8JA 3BZBA 3MWLA 3WJ1A 1Z3IX 4B2YA 2FNAA 5TEWA 1I3MA 4EBDA 2PXCA 3OPYI 2DY1A 3MAJA 1K5GA 2QU7A 2FEOA 3RIEA 4AX8A 7MDHA 3GIWA 3EGXB 4P80A 1TXGA 2J7PD 3PRYA 1FLVA 1H2XA 1FY2A 3GR6A 4QZVA 3WYFA 2LPMA 4NYIR 3EPLA 3SOPA 4P3KA 3TLAA 4D8WA 4QUDA 3Q72A 3Q6IA 1KOJA 4IUBS 3JQPA 2PFGA 3UQZA 4EAAA 3H2ZA 2ZUFA 1RYHA 3VBEA 1Y5MA 1LK5A 1NN5A 4XCXA 5AO9A 2YXEA 2QVGA 3CO0S 3V00A 4QU0A 4GLJA 1E6WA 1E9CA 4R5MA 1M75A 3C48A 3DR3A 1LKZA 3GJ7A 2NSLA 2IHJA 3L6CA 4N5LA 3D7SA 2HCRA 1C7IA 3VDMA 3FCUB 2G17A 2B2XA 1QO7A 4UUPA 4ZU3A 1UBKS 3DBVO 4QTUB 1LSOA 3O93A 3A6FA 4XD2A 1CVIA 3NV9A 4P7JA 4KU4A 3WK5A 4TL9A 5L7YA 3LY5A 3ZZNA 2IIPA 2V98A 3OQ1A 2CXNA 4BX9A 3AJDA 5KQSA 7GPBA 3EPKA 2C04A 3T1YB 4KXWA 3TW8B 2AVNA 4NLGA 3KB6A 5KDDA 1J90A 1VLJA 1ATIA 3DL0A 1M5RA 4B3MH 1CP2A 3QMMA 3QSGA 2H9AA 1JH8A 1G9SA 4IHJF 2OMKA 3IESA 4LC9A 1E1QA 4Q8FA 2OOKA 3AM4A 2VHUA 3N0XA 1XZIA 3JYQA 4WK4B 4HB4A 4JEHA 4MTCA 3RVQA 2VT3A 1UFVA 4AX4A 4AS2A 3PUVA 4QUBA 4R1UA 3ZDXB 1NMSA 2QQ0A 3PEUA 3WIOA 1JFVA 3DBHB 2FKNA 1OBOA 3I5XA 3V6JA 2HDOA 1X0XA 2X9LA 3DVRX 4D1YA 3N3AC 1XPUA 4G8DA 1RWMA 2BQRA 2JKVA 1BMDA 1NJSA 5G53C 2P2YA 3GFRA 3IJPA 3ROZA 3ITKA 2E37A 3HKEB 1F8FA 4RL4A 1YFJA 3I1JA 4QUIA 2BEVA 5CBPB 2FQWA 4OMDA 3WDKA 4YMIA 5DTMA 3WMXA 3KHSA 3VHXB 1KS9A 2IQIA 1ECLA 3KCQA 2B37A 1EBFA 5J43A 5KG5A 1SA0A 5EE9A 1LF5A 3DMNA 1PWXA 4BGIA 2GCOA 4LSMA 3PHLA 1TT5B 1XEWY 4EB3A 2JZNA 2NU7A 5F7XA 2OZLB 1KRHA 1NDQA 5AHRA 1JRLA 3C3BA 3E3MA 4RVGA 4A0FA 1FQKA 4ZRMA 4G0VA 1ZIPA 4MSUA 3CFYA 1IK4A 5C5JA 1PFKA 1QNFA 4DR2H 2G9UA 3NVDA 3UAXA 3OETA 5FBLB 5KT4A 2WW8A 2OEPA 3R0IA 5CX1B 2CKMA 1WY5A 1UBUS 3DD1A 1MX5A 5DX1A 1FFAA 2PUCA 4AVYA 4HNVA 4KXVA 5B1IA 4G8BA 2BFFA 2XNKA 1NUHA 1DIBA 4TKUA 4OG2A 3F1KA 1AB6A 3SE7A 1P5JA 2Y0BA 4ZWNA 1NTRA 5HCUA 3SXUA 4FD2A 1LI5A 1W4AA 5KWJA 2VA9A 3TXAA 4N6OA 4O2BA 1AHHA 2O8VA 1XZAA 3SXJA 5FH9A 5K01A 2VP2A 2BMAA 1V6SA 4MVJP 1J2RA 1Y1WA 5FQNA 4HKTA 4Q3DA 5C51B 1SCDA 2I33A 5IJXA 4YJ2B 3PTLA 3Q3GE 4MZXA 3TGLA 2ONZA 2YS6A 5JUMA 1FFCA 2QRGA 3HV2A 4CT4B 4GXTA 5HJ5A 1J5EB 5KVVA 5KINB 3SZ3A 1HOXA 4YROA 4P3NA 2VYNA 2OCIA 2VDPB 3HCRA 4GQBA 4ODIA 5EWFA 1NJ2A 1KTAA 2V58A 5HKKA 1NP3A 4AKTA 3VFDA 3BMXA 3MIZA 2BUCA 3IALA 1ZJJA 1UPBA 2IYQA 2LKCA 1UDRA 2NZJA 1M2OA 4BQNA 3G2QA 4HVAA 1NXXA 2I7VA 1JDZA 3GLVA 4AM8A 2JB9A 1IBLB 4PG7A 4DYDA 4LX0A 4MUBA 2XRMA 3BKWA 1RQNA 1HC7A 4HEHA 4D9IA 2A5GA 1JNXX 5DM2A 5CEEA 2Q4DA 4MHSA 3LK7A 5IEJA 4XTRA 1Y1VA 4BJ5A 1NUUA 4DAAA 4M22A 2HRDA 3HA3A 2GBIA 3OZBA 5LP1A 1E79A 1FUKA 2WYHA 3B6IA 1NW9B 2PS0A 3Q3HA 2P41A 1SCUB 3BDVA 3R7AA 5TDHA 2G5GX 3IEIA 2WV7A 1WSBA 3V2HA 3AERB 3G2MA 2JA2A 2PH3A 4INPA 2ZXUA 2PIDA 4FZJA 4YMLA 2WIJA 1V16A 1SXGA 3K92A 1JXMA 2OCPA 1AGYA 3GTOA 3QV1A 3VM6A 2I6SA 3UEOA 3NHFA 4CIDA 2C07A 1L5SA 2QRJA 3LPDA 4O7NA 4EA7A 2AW3A 2W5UA 4M6WB 1FJXA 1AO3A 2PJUA 1W5EA 4NCNA 4NWIA 4G56A 3M81A 1LBTA 4U9HS 5K8CA 1KK3A 3T3IA 4RPCA 1XDUA 4BZWA 4DDHA 5DLYA 1GCUA 1U04A 4HFJA 3IAAA 5FPHA 1PEKE 5CFNA 4HK4A 3E35A 4DLUA 4YCBA 3INTA 1VLHA 4EKDA 5DTQA 3OKFA 3THSA 5CFZA 1W0JA 3MC1A 1BXZA 1QTIA 5P21A 5KNLA 2RI6A 1P2FA 4TVBA 1KPIA 4BUJA 3BSWA 2QL6A 4YRIA 4C0HA 1ISMA 3HZHA 1PR0A 1K97A 4XVCA 1NVTA 4J9LA 5D6NA 4J2OA 4EW6A 2Q4RA 1Y5LA 1H4SA 1WHSA 4WDQA 1JR2A 1QYIA 3V34A 4DR6B 2I99A 4R41A 4QAQA 3S24A 2F1HA 4Z7NB 5AVUA 4ZRDA 4DV2B 4DV3H 3AHHA 3CEJA 3N2GB 1EH5A 4HDOB 3VPXA 4ZOLA 4GBED 1P3Y1 3OPYB 1M73E 5EJEA 1NRIA 1JAYA 4O4HB 3R8FA 2GXUA 3WX0A 2HB6A 3ZE8A 5IAEA 2FMKA 1W5TA 1YE3A 4ZKEA 5CVVA 2VDUE 1I4OA 5CYGA 3QVTA 4KQWA 1B0UA 1E0KA 4I08A 3OTOB 1F5SA 3LYUA 3ZHVA 1SBIA 4TTSA 1R66A 4IYRA 3BMNA 1DFIA 3O31A 1OGJA 1ZUNB 1HNWH 1GPYA 3OU6A 1UP4A 2OHXA 4HDRB 4MWTA 1YL5A 3M4XA 4NH0A 4YUZA 4BLWA 4BU0A 5DNWA 2GXSA 4BCCA 3NANA 4DV1B 3JALB 4ZEVA 4RB0A 1P1CA 3KCNA 5REQA 3CNEA 1NVMB 1R10A 3GEIA 2JCVA 5IXJA 4I3HA 4OXKA 3RS3A 2O8CB 1O6FA 5JCJD 2VOEA 3TBKA 1R0CA 5FQOA 4EJ6A 5ILGA 1UK6A 2Q6KA 3OWHA 1S1MA 1QS0B 1URPA 5A4JA 3VTFA 2NYRA 2VHQA 4BNUA 4HRAA 2IELA 3MGAA 1U98A 2PHZA 4LIPD 2PWZA 3F47A 4TN5A 1P29A 3FWZA 1OTYA 4ES6A 3HKCB 3I2IA 4XJSA 2QUJA 1I1OA 5JAPA 1QP0A 4KR0A 1XVUA 1KARA 2CYAA 5K05A 5KT6A 4IQ4A 4ZQHA 5HKBA 3ZDRA 2YWBA 2ZKLA 1MENA 2LKDA 1BYUA 4E08A 2VO1A 1OWOA 1USVA 3T1NA 3D59A 4OFZA 1HMYA 1H1DA 3RTEA 4MQLA 3QKSA 3WS7A 1HYHA 4CIAA 1RXCA 4EB6A 1CR0A 1ELOA 3OD5A 2NNLD 3N41B 5FTNA 2XOKD 4AMBA 4MA4A 1W36C 3K0FB 3C4JA 1KEUA 4MUNA 3THOA 2IFTA 4UBOA 1F4LA 3LRTA 2ZRDA 5J2TF 4B40A 4OLFA 2RB4A 1ZH2A 2DY0A 2G06A 1FJ2A 2YIJA 1ESCA 3SS9X 3W78A 4R05A 5KTSA 2OAEA 4LJ7A 3RS2A 3FNIA 5D51S 4E6EA 3CEBA 4LMYA 3DPIA 1T1JA 4PDBA 4TT3A 2TMDA 4QU9A 4X61A 5I8ZA 4XDYA 1ZONA 4ETMA 3P0IA 3V48A 4PFSA 1IXRC 3ZXYA 5IK2D 2HT6A 2VQFB 1B26A 2GQRA 3GFTA 3CNQS 1IN6A 4TKVB 2DT5A 3MK31 3IEMA 2NG1A 5EPEA 3LUJA 2E5WA 1DQZA 3RPEA 4F56A 4EJSA 5DMXA 4FFNA 3PD7A 4WEQA 1YB1A 4KTVE 3DNPA 1WDTA 1EUDB 3QH4A 1BHO1 2HMWA 4LYAA 3DNMA 1NMYA 2GH1A 3UJ9A 1V9CA 1XMSA 4FTWA 4JJ7A 3H5AA 5KFLA 4W99A 1Y3HA 2XTJA 4XKJA 4LGCA 1U81A 4IH1A 1VJTA 2R8EA 2IS1A 4Z3KA 1NATA 4O08A 3EXFB 4DLTA 4F7WA 4JL5A 1PJQA 4P5PA 4FU0A 1SIUA 4MLZA 3ICWA 4F5WA 3KWLA 1OROA 3WWEA 1UK7A 1ZCFA 2XDQB 5AWFC 3DTVB 2I3BA 4K6OA 3K2BA 2JAUA 3BB3A 4GWGA 4LHWA 3HOWG 4DRXB 3I6YA 4TVKA 3ILVA 1Q1GA 3GUYA 4G86A 3RHZA 4KACA 4N5MA 2DBQA 1IRIA 2CLOB 3NV7A 3VOSA 1MO2A 1THTA 1O97C 5NULA 4YPVA 2Q1UA 3FOWA 4O4JB 2DECA 3BULA 3MSCA 4ARCA 5J1SB 1ZS9A 4NTZA 3G8AA 4M88A 2QP3A 3I64A 4RACA 1NKSA 5DDIP 3UB4A 4FFSA 5DLGA 5E2IA 3L7OA 5IKOA 4RD2A 5L3VA 4OHKA 3FZQA 2KX7A 3O1LA 2YHAA 4PGGA 1M6YA 3G2NA 5JI3E 5T8KC 2O50A 2XE6A 2AZXA 4JV0A 1L1RA 4HN9A 3FOAA 3UF0A 2JA8G 1Y4AE 3GGSA 4JGBA 4Y18A 4DHWA 3PDJA 3VSCA 1S03G 4O4IF 1A50B 5CLHA 3QTLA 1EXVA 1YDMA 2VP0A 3PPIA 1E60A 4YLYA 5G3YA 1HL3A 2BT4A 2NZVG 4KYTA 3WVNA 1D07A 5EXEA 5FAXA 1JTVA 4MJXA 1UXKA 1T1GA 2FOIA 1E69A 2WJGA 3H04A 3L7LA 4TTIA 4GX0A 5BN1A 2X42A 4B8WA 3Q7IA 4FKZA 1TQ8A 2Q7DA 1US8B 2CHQA 4Q12A 1HYBA 1P45A 1DE0A 3OT1B 4CUZA 5A04A 4H17A 2VOBA 5JS8A 5SY9A 5FKJA 3EAGA 5C5EA 2L0XA 3QOYA 1T8PA 3LKVA 5HZKA 4LBWA 2DBYA 4FLEA 2Z1MA 3CWQA 1EMDA 4G0XA 4OI4A 1ND5A 3K9QO 4OJKA 5HMMA 2YDXA 2A9QA 1Q6ZA 2RJ3A 2R6HA 4IS2A 2ORWA 3GGCA 2WIFA 3WTBA 3DMYA 1GFWA 2QGZA 3KWJA 4YT8A 3WLQA 2BR4A 1YJ5A 3V9AA 4U3JA 3ZYCA 2EX4A 2H4FA 2WEKA 3EW9A 1PV1A 4LHXA 5HG0A 4AULA 5JD5A 4PAQA 1CUYA 3WAKA 4E1BA 1T5HX 1H2ZA 5ELMA 1R6BX 1ESEA 2HHCA 3NJ8A 4DXAA 1OIWA 3D9QX 3C5WP 5KG0A 3AYHB 4RV5A 1P3DA 3ILSA 3UV6A 2PANA 4C6RA 4MKGA 4E33A 1TWAA 3UXEA 3ICEA 5CAEB 4KK4A 1ONNA 4UVIA 2EBUA 1S0NA 4L72A 3ZBQA 1EFPA 5J9FA 3GPLA 3GT4A 4G09A 3O7WA 2W0SA 4ZRNA 5BV1A 4B74A 1E7MA 4PICA 2MU1A 1J00A 5G2OA 5HJ7A 4DL5A 3QPAA 2BR5A 1GYRA 3EH2A 1YBAA 3PVZA 3T4EA 3W6UA 4D3FA 3C85A 4D3DA 1TTTA 2CVHA 1QP7A 3PUIA 4QJBA 3TBHA 5CNJA 5D84A 1DQRA 3N39C 4DA0A 5IDWA 4QECA 4ESVA 4RKYA 1XCMA 4CM8B 2LDBA 1CUCA 1XYYA 4RY9A 3R40A 4X20A 1HT3A 5JWRA 5ADWA 2R66A 1VGQA 1NOJA 1KAQA 4DM4A 4KODA 2M6RA 4DNXA 4LJSA 4XUEA 3F78A 5IZ4A 3RRZA 1I51A 3EWNA 2JZCA 4EI2A 3ZNOA 1QRAA 2DYKA 3BQ2A 3VVBA 2NGRA 4DPKA 3USES 2OBBA 1N2JA 3U55A 4M3NA 2AUMA 2X58A 3C3CA 4W6ZA 1SU6A 1D7OA 1EWRA 2HAEA 3H1EA 4W1QA 4P7BA 3AJEA 3HKEA 1VPDA 2FY8A 1JHRA 4DR1B 3UB2A 3N42B 1ORVA 3BRWA 1T1SA 2QS9A 4G97A 2UVPB 3G7NA 2QWXA 4C4AA 1KNXA 2WWWA 1TUGA 3RC8A 3VHXA 3D3QA 2WQZA 3VI4B 1ZCBA 2Q41A 2Q5LA 4BNJA 3TNDA 2GARA 1CKNA 3RROA 1DC7A 2HWKA 1P0FA 4W5OA 1ONSA 1PJSA 4E3WA 4MJ7A 3GEGA 1R37A 4Z9FA 1PZFA 5FUBA 4Y6RA 3SX0A 3AJAA 1UZLA 1UPXA 3AVOA 1O6ZA 5JNLA 4TV8F 4JLWA 1VKHA 1RXEA 1YJBA 3L6RA 3PGVA 2BFCA 5DM70 2FPWA 3K5HA 1GTRA 2HIAA 5FLMG 3WE7A 5EP3A 3AY7A 4C0QC 3WB0A 4BVGA 2GJSA 1H8ED 1SKAA 5HUJA 3KSUA 3LDAA 4EYHB 3HCWA 3N8GA 5E95A 1KTVA 2OSVA 1KAGA 3KL2A 1UDCA 1GU1A 4KPUA 4KDFA 1P60A 5AXBA 4DLPA 5K8JB 1IEQA 1AGRA 3RJ5A 2H2FA 4UZFA 2C9DA 5JBIA 1U1DA 3TW7A 1GN9A 2B3DA 3TPCA 1YQDA 2PXXA 3BSSA 5A0FA 1WDLA 2O1WA 6GPBA 4K6GA 4EG3A 2RGDA 4I9NA 4B9EA 4YIKA 4PM4A 1Y1RA 5A5FA 5HP4A 3RSOA 4XB2A 4HVLA 1RTKA 2BGNA 1MO3A 3S28A 5K3AA 4FD3A 4BRSA 2O7VA 5AQ1A 2XBUA 2XMBA 4FWIB 1IBLH 3PVSA 2VZ8A 4YJ2A 3R0JA 3NI2A 4L4UA 1I33A 2HHHH 5CG2A 1PN3A 4Z0PA 4GKVA 3K4HA 3HYTA 5KQLA 2QT0A 2FFJA 4B3RH 4HGZA 4KK3A 3TNFA 4XJXA 1EJ2A 3RFCA 1I4WA 4N01A 5AW6A 2WMYA 1U2GC 3EZYA 1E3EA 3ZCQA 4M0FA 3HYNA 4YDRA 1ZUHA 4RTJA 4R4JA 1B8VA 2FR8A 4BC0A 5DGCA 4AF6A 4POOA 3G5TA 1VB3A 2AEMA 1D6JA 1HNZH 4W5RA 2DWQA 2BSAA 5T3YA 2J7PA 1U8FO 3T7KA 4IQ8A 2ZI3A 3OQIA 1BMFD 2G80A 3BM5A 2PUTA 3II6X 1GIAA 3FUUA 1LBEA 1SCUA 2D3TA 4IIJB 5EMJA 3FLBA 2WZCA 2JIMA 3SJ7A 2VBGA 3SHTA 1W2GA 4GGPA 4ZOEA 3ZBPA 4WXHA 3EWIA 4PG5A 2X8AA 2QVCA 3HRHA 2W9CB 3GOQA 4ZXFA 5IABA 3ZCXA 4LYEA 1YVEI 1QF6A 1WKCA 3LUFA 2B4KA 2QTAA 1IFXA 2BEVB 3SSMA 2YDYA 3CT6A 1LGYA 4M6WA 5HOEA 3RR5A 2ZUSA 3PICA 1VG8A 3DCYA 1PG0A 2FLKA 3LWDA 4UMFA 3TTSA 2XUZA 3BJZA 4RHEA 2VH2A 1XO1A 1SZCA 3KXPA 5BWNA 2ZB4A 3DM9B 2V9PA 3IURA 2GCOB 1N0IA 4MKZA 1FYEA 2PKYX 1YONA 3D7RA 1BOFA 3U3MA 1XCGB 1DC5A 2NU7B 4DUZH 5IBPA 3P2MA 2GOYA 3TR6A 1ZH6A 2PN1A 1QLJA 4DV6H 3B6ZA 4RGVA 3PQ6A 2Q8PA 1ISJA 4O83A 2OBLA 2JJ8A 5A3SA 2QXYA 1N3BA 5GPBA 1XRSB 2VQ6A 3FNBA 2IBMA 3I8SA 3EVCA 5BQFA 4EGJA 1CUZA 2VBIA 1QK4A 4I55B 4HGRA 3V42A 10MHA 5GONA 2BMVA 2VT2A 1YOBA 2Y8EA 4II2A 4ED7A 2Q3DA 3U4HA 3K8OE 1H85A 2QR2A 2BFFB 4P36A 4RDXA 2HPZA 3OTOH 3CR3C 5CW2A 4TKUB 2CYBA 1MQ9A 3EGEA 4JC0A 1X1DA 1QV6A 3Q2KA 4XX0B 1KDPA 4TWRA 3SXUB 3FGNA 5JU6A 1KE2A 4JB2A 4ED6A 2GNOA 3OPYA 4O2BB 3H8WA 3IAUA 1SNYA 3O3CA 1BDBA 4ED0A 3NORA 1Z18A 4O4HA 4LK2A 3HVHA 4MS1A 4DV1H 4E2YA 5I45A 1M8KA 1XDDA 4M8LA 1UT6A 5E1DA 2CLMB 1QB8A 3D3NA 5ESWA 2YVLA 1QH1A 5EWEA 1JIJA 1ZN8A 1XNGA 3TJMA 3STXA 3BFKA 4QOIA 3N7TA 3TVTA 3QVVA 1Y1WG 1S7GA 1LZLA 3QVKA 2PFKA 5EZYF 4YDQA 3P94A 2XXAA 4XEHA 1MOSA 2AG0A 4F3YA 3K9HA 4NH4A 2VP6A 1M2OB 3BWEA 1PZXA 5CM2Z 5L9XA 4BKRA 1CEEA 3AW9A 1O75A 3E7DA 3I01A 2WUDA 4G6ZA 3G0OA 1EFAA 1H93A 1TM3E 1FE8A 3G3EA 3OC0A 3LE8A 4A5SA 1WP4A 3KHGA 4OHMA 4B6FA 3L3BA 3HJFA 1VYHA 1QS0A 4Y2UA 3UJPA 4J6EA 1QFMA 1WDWB 4L6AA 4NCXA 2D62A 5DHAA 3W4IA 3KSDO 3U44A 1X42A 2HQ1A 4ZVUA 5KYYA 1W59A 1Z0AA 1MC1A 4DE5A 4BBPA 4ENVA 1FP1D 2QNRA 3TSZA 4K81B 2BGMA 1Y1VG 3G2OA 1V16B 2GM5A 2FLVA 1TVCA 2G1KA 4MV5A 2YINC 2WIKA 1H2BA 2LIVA 2Q6OA 1I0ZA 5ALXA