5BPHA

Crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
b'MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 96
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bphA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bphA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bphA01
1SCUB 1M0WA 2R87A 3R5XA 4MV6A 1AUVA 4TV8F 2W70A 2PN1A 3JZFA 4Y8VB 2W6NA 4DIMA 2YS7A 3Q1KA 5IYZF 1UC9A 5GONF 3BSYA 1IOWA 4HNTA 2CZGA 1BXRA 4WBNF 4I55F 3QFFA 2R7MA 1T36A 1IOVA 1GGOA 4EGJA 4O4LF 1CS0A 3RFCA 1GSHA 1VBHA 4MV8A 1BNCA 5LOVF 1JDBB 2FPPB 2WYOA 2YWVA 2NU7B 1W93A 5JVLA 2R84A 4ZHQF 3ETHA 4J6EA 2P0AA 2Z04A 4O7VA 3UFXB 3MJFA 3OUZA 4EG0A 4EGQA 4O7SA 2NUAB 4O4HF 3VMMA 2R82A 5KX5F 5CA0F 5DMXA 4IWYA 5LP6F 2CNQA 3BSWA 4O2BF 2W71A 3TIGA 3DF7A 4MV9A 5LA6F 5CB4F 3JRXA 4M9CA 4MV1A 4RZQA 3OUUA 5JH7F 3NUAA 1EHIA 4C5CA 4ME6A 4O82A 5C1PA 1EUDB 1EZ1A 3U55A 4YAKB 2DLNA 2GLTA 3V4SA 2NU6B 4MAMA 2HJWA 2GPWA 2W6MA 2QF7A 4YJ2F 2W6ZA 3N8DA 1KJIA 2YRXA 1EYZA 2FPIB 1M0TA 5HV6A 4MV4A 2OLSA 2FB9A 3KAJA 2V59A 4I50F 5JVDF 2PVPA 2YZLA 1GSOA 3TINA 4EA8A 2IP4A 4TUYF 3RUPA 5KKNB 2I80A 3MWEA 3VPBA 2V5AA 1OBDA 1OBGA 2X0SA 5JQWA 2NU9B 1DV2A 1WR2A 4O86A 2R7NA 2FPGB 4O81A 5FNVF 5D8DA 4FFRA 3TW6A 5CA1F 1KJ9A 1E4EB 4MA0A 1PX2A 2XCLA 2VPQA 5J2UF 2YRWA 2ZDHA 1KJQA 4GGMX 4YB8B 4O84A 3V4ZA 1Z2OX 1CE8A 4FFMA 2R86A 2YZNA 3AX6A 4C5AA 2CNUA 4ZQIA 4TV9F 3VOTA 2DZDA 1ULZA 1EUCB 3VA7A 3G8CA 5K2MA 4O7YA 3WO1A 3WO0A 4MV3A 1M6VA 2HGSA 3KALA 4EAAA 5J2TF 1DIKA 4FFOA 3JRWA 3JZIA 1VBGA 3MWDA 3K5HA 3E5NA 4EA9A 5C8YF 2VHEA 1UC8A 3KREA 3HO8A 4EA7A 3VPCA 1W96A 4HQ6A 4FFNA 2YL2A 3TQTA 4O7LA 5JQGF 4YBZB 5CAEB 5BMVF 2C00A 2R7KA 5H80A 3R5HA 3HBLA 3SE7A 3AW8A 1PK8A 5C1OA 2VR1A 1Z2PX 1GLVA 4IZOA 3U9TA 1CQJB 3I12A 3Q2OA 4O7ZA 2W6QA 2XD4A 4IIJF 3KAKA 2ZDQA 5BPHA 1CQIB 1C30A 2SCUB 1B6SA 1KEEA 2VQDA 1AUXA 4MA5A 3R5FA 5LXTF 4O4IF 4O4JF 1KJJA 1E4EA 4FFPA 2I8CA 1Z2NX 2CNVA 4EABA 4C5BA 3U54A 1GSAA 3TIIA 1I7LA 1A48A 3RV3A 3G8DA 5HBRB 3R9RA 4HNVA 4XZ3B 4NYEA 2GPSA 4YJ3F 3LP8A 2GQRA 2R7LA 4DLKA 2DWCA 4O83A 4YAJB 4WD3A 1JDEA 3LWBA 2Z02A 1JKJB 4XYMB 2CQYA 3WNZA 1JLLB 4ZOLF 3BFPA 1KJ8A 3BG5A 4QSHA 1KUTA 4XYLB 3K3PA 4M9UA 1A9XA 2YYAA 2NU8B 4HNUA 3BSSA 4IHJF 5LYJF 4I4TF 4ZI7F 3GLKA 1DV1A 2NPOA 4HR7A 1B6RA 1VKZA 2V58A 4O7WA 1KBLA 1KC7A 1C3OA 2DIKA 3RV4A 2FP4B 5EZYF 2YZMA 2YZGA 4FU0A 5I47A 4E4TA 3N6RA 3ORRA 4FGRA 2ZDGA 2W6PA 3K5IA 4O7RA 4FFLA 5BPFA 4FE2A 4O7TA 4L1KA 2R85A 2I87A 2YW2A 3VPDA 3HB9A 3R23A 4O2AF 2R6FA 3U9SA 2GQSA 4XX0B 2QK4A 2PBZA 2J9GA 4O7NA 3ORQA 4IWXA 3ETJA 1I7NA 4M98A 4M99A 4MV7A 3GIDA 2YS6A 2W6OA
chains in the Genus database with same CATH superfamily
2YJ5A 2FA9A 3AR2A 2CLIB 3BRWA 2E9SA 1PR2A 3DUWA 3DHNA 4DCUA 2IJGX 1L5QA 5AH0A 5MN4A 5KJFA 2BZGA 4A0GA 4NCAA 3IMEA 1E5DA 1LZKA 4WN3A 5GQSA 3CLHA 1XEXB 1K7SN 4LNHA 3F90A 1AQYA 4RXTA 1GTZA 1QGAA 4M83A 2BFBB 3N53A 3WHKA 2V8BA 3CNQS 2O05A 3BAAA 1SY7A 2ZYSA 1PI3A 1I36A 2IELA 2Q1WA 4GOKA 3H7AA 2FN7A 3PNMA 4FWTA 3ZJTA 4H16A 2D2IA 1E1NA 3HO6A 4IDGA 3VTZA 2ZVDA 3B5IA 1E77A 2AKYA 1DXQA 4NEHB 2V6MA 4LDZA 1Q15A 3GLTA 4I3HA 1INLA 4QVKA 2DLCX 5FPYA 2HU2A 4H7KA 4INJA 2XZLA 2CDRA 3CFYA 3Q9LA 4BBZA 2P9EA 4IDNA 3SHWA 3FKIG 2DPIA 4EHHA 3PN1A 1KMNA 1NKVA 1V16B 2JCGA 1CB0A 4YYEA 1ODKA 2Q6VA 4KOEC 3PNQA 2M6RA 2HFKA 3L7MA 1FSZA 2DWPA 1G0OA 4QBTA 2Y68A 1N8SA 1VKOA 1MT3A 2NVBA 2XV1A 4TUYF 1O89A 2W2LD 2NO9A 4GC5A 1T35A 4KLZA 2QQFA 1ZA2A 3RGWS 1WR2A 4EG6A 3IXMA 1FMJA 3CZ9A 2FPPA 4RV4A 4KLCA 3LRXA 3AEKB 1CQPA 3AK4A 4R3WA 3L4KA 3LCRA 3RB8A 1ZIPA 2IC5A 2FDCA 2VF4X 1OXSC 4X62H 2CHGA 1D6JA 3R9XB 2Z98A 4ND8B 1FVIA 4JQYA 1SEVA 5KUTA 3VHQA 3E2MA 2HIVA 4OXYA 1T4DA 3P2KA 4RUKA 4FM9A 1BC5A 3FWPA 1DIKA 3M9OB 3LA6A 3B8HA 3QWFA 3W2TA 5JRZA 1SO8A 2NXEA 1SBZA 4URFA 3D4NA 2WM3A 4JJ7A 3I9KA 2DPJA 2WPDD 4IKEA 1XWIA 3ESYA 4O7LA 2AZXA 3E3NA 4TV8B 5I5SA 1MV8A 3GNSA 2FE3A 1SKAA 2IV3A 4G1BA 1V9CA 2I33A 2Q2VA 3RT1A 3EIQA 4LF9B 2B37A 5HW0A 4ECUA 2AG1A 3D2LA 5AM4A 3ELUA 1SPBS 1NHGA 1OXXK 3G8AA 1YULA 2ZDQA 3GDWA 2YXBA 3PQ8A 1CUEA 1TTPB 1E0KA 3GGGA 4EW6A 4G0ZA 4QUBA 5AKEA 2PMZA 3EWIA 5LYJB 5ELMA 2QXUA 1H1DA 3ZZMA 1DWUA 4FIDA 3UNXA 2H4ZA 4NENB 3DSRA 4P4GA 1THZA 1PWZA 4NATA 1J42A 3HCEA 3AESA 3ZW9A 5DXAA 3O7MA 2W4IA 4GOXA 4FWBA 1B2RA 1EVJA 3BG5A 4HDMB 1U28A 3S29A 2B8WA 2PKXA 3ZDYB 5JZVA 3AV3A 4K9SA 4ZWNA 3HCCA 3GTOA 3EVBA 4IOJA 2H4YA 1T43A 1HEUA 1GO2A 4YR0A 4EAQA 2CLFB 4DRZA 1Y5IA 3G5AA 1ECBA 5LQDA 4EELA 4OQYA 1E1MA 3OOHA 2GYYA 1J9GA 2QN9A 4TMZA 4JC0A 4UCSA 3HJCA 4KN8A 5CG1A 2I6XA 1BDMA 3VZDA 4TMFA 2FG7C 1SOUA 2XMZA 3ND8A 2CMGA 3ICCA 1SCBA 5A4IS 2HLDD 4QPCA 5IMSA 4OA5A 3ZWPA 4RTRA 2MU1A 3ZDBA 2A9PA 3NBYB 1WKBA 1IPEA 2FW9A 1C0LA 5GJVC 1CT9A 3T52A 4R1MA 4IZ6A 4BIMA 1JQ5A 3GBVA 1MFPA 3OQBA 5JI2E 1BGXT 4IQFA 4KR7A 1RC8A 3WWIA 4FX5A 1OLSA 3GFVA 5DM70 1O96B 2I3GA 5IM5A 1KU6A 4RWZA 4FYXA 4LUCA 3VBEA 2Q4BA 3WKCA 5BV8A 4JUZA 4QRIA 3VH4A 2CFSA 1TOAA 2P2SA 2QHXA 3GTKA 4NQRA 5EEHA 3NEJA 4IQGA 2FDRA 3KTFA 2FZLA 5K0FA 2NP6A 3NHSA 1NJ8A 4MR9B 3LUHA 9LDTA 3S8MA 1XJ0A 2Y2UA 3A04A 3C3AA 5I4KA 3ZHTA 5A6SB 4TROA 1P62B 1IUOA 3LRTA 3BZBA 2O2EA 3AVVA 2GLUA 2VA9A 4XR4A 5EN4A 1T2DA 2AN1A 1VDZA 2NZYA 1I0ZA 3PNYA 1KZ9A 5K3FA 4XJTA 2H65A 3CZ4A 1XWWA 3AEQA 2BEVB 4NYMQ 1WLYA 4YRDA 3ROTA 2QDXA 3IPXA 1D0IA 2P75A 1I6KA 1T0PA 2YMMA 3VPSA 2I65A 3OKPA 3X3HA 2BR5A 3NUAA 1CVIA 1O9BA 3HLKA 5H0IA 3VZPA 3WNDA 3NHBA 4MK4A 2O20A 5HIAA 1WZ2A 3UWPA 1Z0UA 3EGDA 1TO2E 2RGGA 2VP2A 5D3QA 3TPZA 3FTFA 3VJKA 1HKUA 4G41A 1MABB 3NEAA 2H7YA 2NTEA 4O4HA 3GAMA 2B83A 3G13A 1NW8A 3LLVA 1BWPA 3V4OA 1NASA 3IEMA 3PLNA 2EHDA 2OV1A 4YAGA 2Q1SA 1VB5A 2XCAA 5LM3A 1AG9A 4FHEA 1LK0A 5KFIA 5HTOA 3HXPA 2R6DA 1QKKA 1UJBA 1YQ9A 1QGUA 3B85A 2JVJA 2RFLA 4UQOA 2PQ2A 4WCFC 1YTUA 5KG1A 3H5RA 2P8JA 4MMZB 5JS8A 5E8RA 3A26A 2B4RO 3GJ4A 1ODLA 3PW5A 2O8BB 4BWVA 3DFIA 5J2TF 4DBZA 3I6MA 2IYNA 5F5LA 3HVRA 3MWDA 5FA5A 4XPIB 1E7YA 4OI1A 4IOLA 3EOAI 2FZEA 3ASVA 2Z1NA 3TH5A 1BKYA 1X9NA 3GARA 1LRJA 1LI4A 3AM4A 1L8XA 4YAUA 4B6GA 1MKYA 5LNK1 1G2QA 1SKMA 4PS1A 3FTPA 2JA2A 3IHTA 4AP6A 3QKWA 4TTIA 4JAVC 4DKJA 5ALZA 3P97A 3Q1LA 1FZTA 3DGEC 2N42A 1P77A 3LUPA 3M89A 4G9EA 2OFOA 4RMJA 3OWHA 2C99A 4L3VA 1QUEA 1HGXA 4RLQA 5DG8A 3T9CA 1G1MA 1TQHA 1GRVA 3LCJA 4PYRA 1ECCA 4XR9A 1W46A 3HOYG 4TMVA 4QBGB 2PUAA 1Y6FA 3WQBA 3C39A 3GIJA 2VJDA 1WXEA 2YH2A 4FDLA 1UDBA 1EFAA 2FF7A 1M1XB 4ABTA 3PW4A 3KZ1E 2R8BA 5JBQA 4IAOA 2WNSA 3ZGOA 4BFZA 4KL8S 3W4KA 3SSAA 4FIZA 3WP1B 5BNWA 2XB6A 2ZDGA 2I1VB 2AH5A 4S2UA 1Y6RA 1OILA 2QVGA 3ZI7A 2ID8A 3OCWA 2FQXA 3DDNA 4CETA 3NHYA 5DTQA 2F3RA 3K9HA 3OZVA 4C4OA 1JKXA 5JCJD 2I3DA 4Y2UA 2IHVA 1U4SA 3L2PA 1PUXA 2VT2A 4N3CA 3BHNA 2F4VB 1YZKA 1I4TD 3A1EA 3WK8A 4C0SA 3PWKA 4YWHA 3ZQKA 3IE2A 2J1LA 2W70A 4CRWB 1N4AA 3N41B 2JGRA 3SQNA 1J00A 3RWOA 2VHTA 1JLLA 1UPCA 4LYJA 2XRZA 3C3EA 2BRUC 4IMRA 5FWDA 1SPXA 5CB4A 3WFJA 1NPTO 1JNXX 1GR0A 2XJ9A 4MDYA 4O2AA 2HNBA 3KJHA 3HOZG 1DDIA 3NX4A 4URXR 1M2VA 3VKHA 3G85A 2GCGA 5CCBA 4WKCA 3QZUA 3EXAA 3K8YA 4AKIA 2OGWA 4Y67A 4JYAB 2BKXA 1R00A 2BMAA 3ICOA 1MQSA 3EGVA 3DPUA 4ALJA 2Q2QA 3DLAA 4IHQA 1R0YA 4AO6A 2ZYUX 3PUVA 2JHFA 3ZDCA 1OBHA 1XA0A 1EQ2A 2X0JA 2G36A 4DQLA 3EGWA 4Y2GA 4HATA 4F2GA 2RGXA 3SYKA 2IUTA 4TQGA 1AMOA 4EUFA 2C84A 4XVCA 5C1PA 4BP1A 1Q16A 3U55A 3V4SA 5HVNA 1TJYA 2MSNA 3VV2A 3B1FA 1PQYA 2WWWA 3BXGA 2X1MA 3AHDA 4K87A 2QD3A 1XDSA 1GIAA 5A4FS 3TY9A 1ONNA 2HMWA 2WUFA 1VBMA 2M1ZA 3V1TC 3QLJA 3Q9UA 4YMHA 3UV7A 1YZGA 5CEJA 2IYUA 4V0QA 2GM3A 3I30X 5FV7A 5B37A 3G8BA 1EM8B 3OZGA 1DCMA 2WTXA 1JWAB 2IK8A 3DT6A 1T34A 1U0BB 4II3A 4PRLA 1IM5A 3QMWA 1B0UA 4KVGA 2QR5A 3UK6A 4LJ4A 3WMFA 1Z06A 2ALZA 4RVOA 1O94C 1RI1A 4I50A 5DBFA 4DV6B 3D0OA 1G3RA 4DM4A 4FYIA 1K0UA 5KI6A 4BJ6A 4EF4A 4XIJA 1VQ1A 1ZKDA 2H0AA 2OO3A 3DZIA 2J46A 4ENTA 2XNDA 4FDAA 1BHQ1 1SCKA 3SXUA 5A2GA 3DEFA 3SMQA 3AKDA 4K9KA 3ZY3A 2G76A 1F2UB 3TQCA 5KJ1A 3IOMA 4XVHA 3QHPA 1R8XA 1LPOA 2NSJA 1OV6A 1SU4A 5BQOA 2QN7A 1A7AA 4JOSA 4NMXB 1NX6A 1MP0A 1MJ5A 2II6A 1CQIB 4AZ3B 4PHCA 1RW4A 3G5TA 4J9QA 3G1UA 1XV5A 1MQ8B 3WSTA 5EP2A 3EFOB 4BO0A 3TL2A 5KS2A 3IG0A 2ODPA 3HVUA 2LKCA 3Q3JB 4Z5XA 4NF2A 1DFGA 4YREA 1E6MA 2P4QA 3FNEA 5KEIA 4HN9A 4BVEA 2B4YA 3N0WA 3I1YA 1I4WA 1G19A 2YYAA 5D1OB 4N5IX 3L82B 3V6LA 3MT0A 1N1EA 1Y1SA 1HTWA 4BNJA 2G3YA 4F11A 5EKUA 3Q8LA 3BGIA 1NR7A 5BV7A 1NMZA 2Q7DA 1ABFA 3LX4A 2CN1A 3WKEA 4E5NA 4IIBA 2XUFA 2CV0A 3J7AC 5ANRB 2PT9A 3Q3VA 4KQ2A 4L1KA 1AXGA 4CM8A 4Z4FA 2H92A 3RUEA 1L4GA 3BTVA 3NDIA 5HJ5A 4RKWA 5B3JA 3WMGA 4OK3A 4TKVB 1KJWA 4RCZA 4GLBA 5DULA 4JLDA 4H1WA 4MYHA 4E4RA 1ODFA 4KQ1A 3V33A 4BVJA 2VF5X 4DLXA 4BNLA 4CZ2A 3DBVO 1JHUA 3IA7A 5KFEA 5K8VA 4O02B 1B8VA 2RK6A 4WBNF 5EE5B 4EEQA 3M0EA 4FZ5A 1NZFA 4B3HA 2P9QA 3KUDA 1U8XX 3DJYA 2BBWA 3AKYA 1H0RA 1X7GA 4E46A 4PDBA 3QVGA 1B8PA 2EZ4A 2C5EA 1AF4A 1WO8A 3RWBA 3IEUA 4PYOA 1KVTA 4WOKA 5FUQA 1VM6A 2AJBA 3H6HA 2J6HA 2XMDA 3MT9A 2JASA 1UZMA 3BQNB 3CEMA 2GCOA 9GPBA 3AJAA 2GQ0A 3H16A 4RV5A 1FDOA 1G5HA 5FWYB 1USUA 3VR3A 4M7RA 3KKLA 3GVHA 4CQLB 2JGDB 3NHKA 4BRSA 1IONA 5ENDA 3DLBA 1ZSYA 1V35A 3DLCA 1K3TA 2R1VA 2OCAA 4F4UA 4PXAA 3O4IA 1YR3A 3TY8A 2PMWB 3RQIA 5IKXA 1M2OB 1LZLA 1X87A 3B1YA 4RDXA 5KQPA 2VZEA 1GKUB 2X7XA 1OBGA 1GHTA 2AOTB 4O2BA 3C3CA 1QYXA 1RYFA 3L0IB 2NV0A 3SBDA 2X8JA 1NTOA 3TJZA 1B04A 1XJCA 3ND5A 1EB9A 2NZWA 2F3QA 3GP5A 3R7LA 1N6NA 3GHHA 1SIWA 4AY2A 3MINA 3ILVA 4Z8XA 4RD2A 3KZOA 3RYHB 3KCQA 4ENWA 4TV9F 2IOFK 4CXMA 5L4NA 2VTDA 1EA7A 2CDBA 3CZMA 1NIJA 3ETGA 3OCCA 2J3QA 3ZWCA 3NIWA 3QLVA 4BNHA 4E14A 1XFAA 3C0FB 5FWXB 1EKPA 13PKA 5EHNA 1SXPA 1B93A 1QIHA 2PX6A 4D8WA 1BVHA 3C85A 3V34A 3X1MA 4LGVA 2BVNA 4MWCA 4YCNA 2F8SA 1FXWF 3NYQA 5EC8A 3GFRA 3CZRA 2J45A 4TWBA 2OV6A 1NP6A 2HUPA 4H0NA 4XEHA 2PMBA 3GCZA 4BGIA 3GEBA 3IUJA 3BCRA 1F0YA 4BMCA 5IP7G 1CULC 2XVYA 2D1SA 3SF8A 4A0SA 1QZZA 4II2A 1NXWA 1E7RA 2DHRA 3IYLW 1K06A 1L7EA 1WZCA 4CIVA 4GX2A 2JFFA 2ZUSA 4X6YA 1W36B 3LGXA 5KQSA 4ETSA 4DZRA 2JFPA 4QG3A 3LP8A 5EUMA 4LG1A 2FPLA 1H93A 4GZ3A 1US8A 2WU4A 1Y4DE 2COUA 4DVGA 1Q7CA 4W99A 5LQAA 4FR5A 2I71A 4DREA 3TVYA 5B2EA 3O4HA 3EXG2 1Y3FE 3PL1A 4ECYA 1Q17A 2X4IA 4R71A 4JOQA 3CNEA 3TZBA 2ZIWB 3M34A 3SSNA 2R1TB 1C9KA 3G7NA 2ZJ7A 2WY2D 1J1UA 3STYA 3DAYA 3IPLA 4V0LA 2PFKA 6ABPA 1G0NA 2GARA 4ZZ3A 3J80W 5DT2A 2WA1A 3IQZA 3VX4A 4M0JA 3DCYA 2FEOA 1HTTA 4KRFA 1DL5A 3PHJA 3QLUC 3VPDA 1OB2A 2L19A 3ED5A 4V0SA 1DWPA 2AZTA 1GAWA 3L6BA 5IYDG 2C57A 1VAJA 4HXEB 1ORHA 5K3AA 3DZKA 5AQEA 1E2BA 3CV3A 5DX0A 2P4HX 5IJ0A 4B6RA 5BWUA 2VOEA 2JHCA 4C0QC 3FZEA 3JASA 1P75A 3ZYCA 3RB3A 1FEZA 3M8KA 2NO4A 1P81A 2FRVA 3OO0A 2ZANA 2ZJ4A 2W83A 3O7WA 3V7UA 2ZTLA 2R1ZA 3P4XA 3H5WA 4RB1A 1I1KA 5IU6A 1W93A 2GTHA 4D3DA 2R84A 4X90A 3BQ2A 3PPXA 1S3GA 3RTEA 3BIFA 1JHVA 1M6EX 4KFTA 1VMKA 1QP0A 5K9ZA 4GUAA 5I51A 4LTMA 1SA0B 2CFMA 4J43A 1QLWA 3JATA 3ENVA 1K4YA 4B2YA 3O73A 2YYYA 3ZVNA 3BYZA 1NOJA 1YASA 1SXJD 2A94A 3AFGA 3KQHA 2M32A 1UL1X 1JVNA 2ZSDA 3HCPA 2NU6B 3OHBA 5KNBH 3I0ZA 4ZYUA 3DO5A 4F1JA 3HUFA 2YRXA 4INPA 3UB4A 4AWXA 3I4FA 2BI4A 5JVDF 3BULA 3IR7A 3QFHA 1DQPA 1L7BA 3VNNA 4JSYA 1G3UA 3AL3A 5KYWB 2IZ6A 4OYRA 4KKXB 4IQ0A 1NVWQ 4DMUB 3VNBA 5KTSA 4EZIA 2J3IA 2O8CA 3UAXA 5KYXB 1Q7EA 3A58B 1NVUQ 1JWLA 3DAFA 1G8MA 3K6SA 4YP3A 4ZTBA 3QK7A 1CTQA 3OAAD 4PLZA 1J49A 5L3SA 4IIHA 1NMYA 4TSRA 1NUTA 2IXEA 1NURA 1TTHA 3NDRA 4CTJA 3RW9A 4CUZA 1Z12A 2FEAA 3WBBA 2FQYA 1N75A 3DZFA 2WV9A 1QMPA 1N36B 3JZIA 4QPPA 3DDSA 1PTJA 1CDDA 4YP5A 4Y2JA 1REQA 1E3WA 2IUSA 1UBJS 1RXCA 2QE7D 1XZFA 4GBMA 2QUBA 2QP9X 3SOZA 1EDDA 2Q1TA 4DNXA 3O0DA 2C7RA 2BE9A 1Q11A 5G4KA 1JHRA 4QNNA 3C3KA 5D6OA 3W2EA 4KE8A 1K8QA 2B3DA 4DTCA 4P54A 2A1TS 3CPSA 2QZSA 3IMCA 3DHVA 2SCUB 3F67A 2C9MA 4Q15A 4QM6A 4RIFA 5ICCA 5FWAA 1YE5A 2PUTA 4RD4A 3RS8A 3CUEF 5TJHA 2VDVE 3OVMA 3KOUA 3PQFA 2QL7A 3JYLA 1K9SA 1E7MA 3I6YA 2DBYA 1J8YF 3D8NA 3QUCA 1M67A 5ER9A 3RJMA 1EJ0A 3IH5A 4DLKA 3PG5A 3NTOA 1KYTA 5CJPA 2XZOA 1U3VA 3Q8SB 1H6AA 2GXAA 2ASVA 1QQTA 5HS6A 1GUBA 2I55A 4Y2VA 1ZMTA 2NXJA 4OFBA 4JUBA 1O95D 4X1IA 1L5NA 2H54A 4EMSA 1N3IA 2V7VA 4MPTA 1WSBA 1FDUA 2RHWA 2PZBA 3H86A 3V8QA 2FR1A 5JE8A 3FCXA 4WXHA 2ZKLA 3TQOA 2WE6A 3F6PA 4UBOA 4DC0A 1VJTA 2Q5QA 3D7KA 3QA9A 3QXXA 2ISCA 3FI0A 3QI2A 3UCXA 1KBLA 4PSAA 1HH4A 2B7BA 1BN7A 1D2MA 4KXNA 3AUJB 1W5FA 2Q4DA 4JLNA 4PS0A 2EZUA 1E32A 5FYQA 4F9FA 3DL7A 3KT6A 5IC4A 1YOVB 5E6RB 3NTUA 1S8AA 4I55B 2M9MA 5SYAA 2NXCA 5KG3A 1IXRC 4TTJA 4Y9TA 4CQJA 2JJYA 4BNZA 1RLJA 1YZTA 2PBZA 2X8AA 4OXRA 2FPWA 1UKYA 1G8HA 2QT0A 5LZ4A 5EDWA 3U5ZB 3E7PA 2IHZA 4AFNA 4OUDA 3W5UA 1R0WA 2J0UA 2DG2A 4BNIA 1YIDA 4LRTB 2CXQA 1W2WB 3K0BA 4ZYZA 3FMVA 2H1CA 4R9RA 2VPZA 5FLXW 3NKVA 4B7UA 3NONA 2VRCA 3NPAA 1YVDA 2ZULA 3F5DA 1W34A 4KGZA 1JFFA 4O2RA 2P6UA 3RFVA 1E2DA 3T3NA 4WIAA 5K6AA 3G49A 4EG5A 4K86A 1CG6A 2IYWA 5EGSA 4MUNA 1D1QA 3MAAC 4FBGA 2H1VA 3BCSA 4X65H 1CJKC 4CDNA 1LBHA 2NUAB 1JEQA 2V6IA 2JCYA 4DUYH 3R7SA 4EW1A 4FVTA 4HAYA 4DMFA 3GTQA 4QARA 4BASA 2Q46A 2ZJ3A 3N2LA 2PD6A 3HE3A 5KG0A 5ALIA 5JDCC 4N41A 2Q9BA 5LA6F 2QGNA 2ODAA 2AZDA 3G0GA 3PFCA 1BW9B 2GO1A 3SR0A 1IZYA 1LBEA 4L8WB 3L5OA 3I5YA 1UOOA 3K4QA 4X62B 2NSLA 1LC3A 4D41A 1Z5OA 4EPYA 2EG5A 3RAXA 3U4CA 5U1PA 4RZUA 4AJHA 3G8YA 4WGGA 3CONA 2H7CA 2C95A 1V9PA 1KFEB 3VAAA 1KY3A 4KFCA 2UVUA 1W76A 4MA4A 5FBZA 2G80A 4O3PA 3RT7A 3JAWB 3D3NA 3LHSA 4PQFA 4U7CA 2O57A 3P9RA 1KZYC 3RS0A 1JTFA 4J9RA 5EJMA 2RHHA 3COVA 4AY4A 2PMFA 2Z5GA 4OGFA 4RIGA 3R9IA 1MT0A 2GZDA 4N0PA 4JJFA 3P2YA 2SICE 5JOQA 4EY7A 4WH0A 1RE0A 3R3WA 4PYMA 2RGUA 5DNAA 4TYNA 3EDRA 1UODA 5E2AA 3A1VA 3EXIB 4M6WB 3UQZA 5BV2P 3T5TA 5A4AA 3KALA 1RJQA 3U7FB 1ZGHA 3NT4A 1SHKA 3SYNA 2JCXA 3MYYA 4LNUA 5EWEA 2XZTA 2QORA 3OH8A 4A1FA 1FSGA 4BVFA 2CV2A 5GZ3A 2OG2A 4JVMA 5MF6A 4MQEA 4Q7QA 1HM5A 4FGZA 3COWA 2JFWA 3T7SA 3GJXC 2HDHA 3P9QA 5BVHA 2BW0A 4IPTA 1SHZA 3QBEA 4A3CG 1E6KA 1SNYA 2VK4A 3T5CA 4M7WA 1DQRA 1UMDB 3K16A 4RELA 4IF4A 2VCYA 3VSCA 1LC0A 4P4LA 3RPEA 3K1TA 3WFIA 4BIIA 5EG5A 3LO8A 4J3NA 5DN9A 3ZVMA 1R27A 1VFNA 3ZCUA 4MPDA 4B8ZA 3ZZTA 1DJMA 4QZVA 4BEVA 3IR5A 3GELA 1DUIA 5KPDA 1DXHA 2Z9CA 2Q2TA 3KVOA 2IWRA 2QU8A 4IG9A 3EBLA 3GLIE 3QVVA 3IHLA 4LWPA 4C29A 3N2KA 3V8PA 3D7RA 1V5IA 4JQOA 4CBVA 3TAHA 1IEXA 2X5JO 3N7TA 4E1VA 2EQ5A 3TQIA 5LYJF 3HB1A 4UEJA 3ROKA 2J9FA 3E8MA 4O4IA 2QMQA 4UM9D 2KW5A 3AP3A 2HHJA 2V6JA 5BUZA 1JJ7A 1NWHA 1SVUA 3T61A 2K2WA 4ZT7A 4FGKA 4FHFA 3Q7SA 5P21A 3MSXA 5GAJA 4DA0A 1FS6A 2E6UX 5J40A 4E5UA 2O1EA 4CCYB 5I9SA 5E1MA 4ZOBA 4M1SA 2ZSKA 4HPWA 2ERCA 4BECA 2UZ1A 3JWJA 4R40A 1FJ2A 4US1R 2G07A 2C5SA 1A9QA 3X2FA 1KBQA 2PCJA 1WQ3A 3I5AA 4XZ3A 4GKJB 3AL2A 3T38A 5E38A 3WRWA 4CIWA 4HAIA 3MBKA 4F4XA 3AR6A 3I8SA 3MWMA 4YX9A 2PLFA 2SNIE 2CF6A 2XTJA 1SIBE 1UBSB 1AV7A 3I32A 2ZSFA 5LP6B 4J0EA 4EMTA 3G59A 3C5VA 3VU1A 4H60A 1DT3A 4MVXA 1FFDA 3P0FA 3LX5A 4ROTA 5AJZA 3MOGA 4BYMA 5KSWB 1YB1A 4JQZA 1FFXA 2E0IA 3PVCA 3CVUA 4RD6A 4JWKA 1L8QA 1OFUX 3GCWA 1CY6A 5DGIA 2G4CA 3HCNA 4LCBA 3K0HA 5FLKA 4BXOA 4KO3S 1SGWA 1VPEA 1K97A 5DTRA 4H7PA 1U5AA 2WYUA 3LJKA 1ZHHA 2FMIA 4FYPA 3F6SA 1TA9A 4QDJA 1TQ2A 2IUFA 4OMDA 4I7HA 4QOFA 1NW7A 3VVMA 4JXUA 3H2JA 3D81A 2XCPA 2RGEA 4IILA 1P1CA 3O82A 3NVDA 3KEMA 5EJFA 2IXTA 1LLDA 5CVUA 3S2GA 1A9RA 3G2QA 4DS3A 1ZH2A 2VHZA 2M6LA 2G6BA 2HCFA 4KWHA 3H1BA 2R1UA 2HQSA 4Q37A 2EP7A 3V8EA 2C04A 1F5NA 1RM5A 3JSXA 3KVNA 2FZWA 2V45A 1ZY2A 1LF0A 4M0MA 2JEIA 5JIBA 3RBXA 2XRFA 5A0TA 2J5RA 4AUMA 4QBIA 3RIXA 3AJRA 5FDFA 1C0IA 3DZGA 1LX7A 1ZMOA 4CV2A 4TYYA 1ZJJA 3B13B 3BB4A 2V9ZA 1JEOA 3M83A 2W8BB 3RS2A 4JP5A 1ULZA 6NULA 4HT3B 1DEXA 5D3MA 1P73A 1CDZA 2O3RA 4GAEA 2C5AA 1UBMS 4UU8A 3AIKA 2PH3A 4OKIA 4YUZA 4OHFA 1UC8A 4LGMA 1QHNA 3HWWA 3C1UA 1CYDA 2PO5A 3ZNNA 1PR0A 4F97A 3LTNC 5BNZA 3GLQA 2YUTA 1ZISA 5CITA 1GLGA 1B33N 2DETA 1PGJA 3VC1A 1QTNA 2D5IA 4TWJA 1DQNA 3HNRA 1K4KA 1NX9A 4NV1A 2H4FA 1E94E 3VGPA 4DQNA 5CFZA 2VDRB 3Q9NA 4MSUA 4PZ0A 1Q1EA 4PLFA 3WZMA 1CKMA 5FUVA 3A1CA 1M6WA 4LCJA 3H87A 1O1YA 1GZHB 5G0VA 1EZZA 3LF1A 4BQNA 3ZWQA 3FUCA 2I6GA 4WN9A 3SHOA 2QRUA 4DDVA 4D7AA 4A8JA 2XECA 4HQKA 3AUAA 3N05A 2HJVA 1EFPB 4DLNA 1ZZGA 3MS7A 3L4JA 1SXIA 3TZKA 1VLQA 1K1EA 5KQRA 3SCZA 4AP5A 3DUFA 4Z53A 2QG4A 2XYQA 3P9CA 4NRDA 2HXSA 5JNUA 1QC5B 4HBZA 2OB1A 2Y0CA 4QUKA 3CLKA 5LA6B 2BP7A 3GJRA 4MQUA 2YKGA 2YY5A 4F5DA 2FRDA 1VXRA 1R6DA 2HI0A 1UKEA 4RTQA 2VK8A 3SEFA 3D3WB 2JL1A 4AW9A 3MGBA 3I61A 1UMBB 5HKOA 4IHKA 4QYMA 2XXBA 3UWSA 4CW7A 2GJ9A 3VPAA 3QMVA 1E1LA 1YS4A 1MENA 2PMDA 4RZHA 5DP2A 3ZJVA 4ZO9A 2A5FA 3T12A 4JT8A 3WLSA 4B3SH 3QENA 2VC2B 3QA3E 5TJ9A 3K5PA 5KIAA 3CCBA 1YS1X 1JHDA 4BBRG 3HP4A 1Z5UA 5AJHA 1AB5A 2PWBA 5LN1A 3VUFA 3K9FC 4ZQEA 5KYUA 1T15A 4C08A 3OZIA 2R8GA 2R11A 1QQAA 1HDCA 4J8PA 1QRTA 1CS0A 3ZJ5A 3EZ2A 3EPRA 4KFUA 4CV1A 5LZ7A 1I1QB 5LD2B 2FSFA 1K1SA 3G2LA 3FUXA 3W7AA 3LYHA 2VPXA 4C06A 2JCSA 2GVZC 2OLEA 4F92B 4DPLA 3QE9Y 3WGKA 4PZ8A 2AZ4A 4Q39A 1KZ7B 4O8CA 2PUDA 5UKDA 3CW2A 1IVYA 5FI1B 1J8FA 1AQLA 4Q7KA 4R2JA 2ZTVA 4X8MA 3ZHXA 1NBOA 3RCBA 1IPHA 1H1LA 1F8GA 3ZBTA 5HKLA 4R6WA 4CMIB 3KXIA 3IX7A 3QQPA 3E9RA 3PZPA 4LZLA 4L02A 3B7WA 1LLFA 1I2DA 1N2HA 1E58A 1XMQB 4HDRB 2Z4TA 1NQTA 2YFQA 5I7WA 5ITVA 3TLCA 4ARVA 5ARBA 4XQ9A 1DIOB 4HLUC 3QBJA 4NOKA 1WBBA 4LQLA 2P40A 3PKIA 3LC0A 2AD5A 3U4IA 4OU4A 4JS0A 3GBPA 4Z3KA 4XLTA 5DYTA 1W4RA 1U0SY 1MF7A 1KDVA 3QTTA 2GM5A 2ZJZA 4BMYA 4UMEA 3V4ZA 3DOOA 1WEKA 2LGJA 3D43A 1YQTA 3L0CA 1Y1QA 3KYHC 2CFTA 4RF4A 1FUYB 2XVXA 1T8WA 5G0TA 2B82A 3EMVA 3UB3A 5JMWA 3WIDA 3LL7A 4N0EA 2V1XA 1U80A 3B1WA 3Q7TA 2O59A 5LIPA 4V0OA 1ZIXA 1QO0A 4FFNA 4XIYA 3DXZA 3GY0A 3L0YA 1KP3A 2AG6A 3UHPA 5EZ6B 3RB6A 2WYVA 4M60A 1YAJA 1QONA 4RIEA 4K1XA 5HFAA 1JSLA 1X80A 1IOZA 3WXMA 1FU4A 2NVUB 1USVA 2GRJA 3GGOA 4NE2A 1CZNA 1VL5A 1L6IA 3RIYA 2AYYA 2JLRA 4MEJA 2BKAA 2FPGA 1ZN9A 3NGDA 1VHQA 1FTGA 4D57A 5F77A 3IBYA 4RTSA 4EO7A 1QK5A 1HLDA 1XROA 4HNAA 1KC1A 4IS3A 4EHBA 3QY9A 4HUJA 5K8TA 1PR9A 1Z36A 1XQ1A 4YRKA 4X41A 2V7GA 4BZZA 4RNMA 3FOBA 3FCSB 4U2KA 2QENA 2CQYA 1U8CB 2AI3A 4U8HA 4RVNA 3KLBA 5ADVA 3WOVA 4F21A 1HE3A 3O1JC 1K0FA 1HFJA 4GKJH 2R8ZA 4PZUA 1FQWA 2W9BB 3M6AA 5TLSA 1OKKD 3PQ5A 1S1CA 4B3DA 4KW7A 5KJ6A 3EQ6A 2WJ6A 3JQCA 3N6RA 4ZCMA 1UPBA 4M1WA 1E7WA 3RBZA 4KR2A 1YZHA 3C4VA 4LBYA 1N0VC 1WCIA 1CQJA 1JHXA 1GWNA 3S8YA 2VJYA 5JU6A 4RA6A 4YRLA 1XMSA 2AWOA 2ANBA 2QTTA 4NCKA 4NMMA 4HYYA 1RD4A 2EWMA 3LC1O 4D6PA 2UDPA 2OHGA 1QGED 2F43A 3HVJA 4KFSA 4JEMA 2JLVA 4DIBA 3W05A 2I4IA 1ZRSA 1TM4E 3GFPA 2N47A 621PA 1EFVB 3L1VA 1E9FA 1KY4A 2DTDA 4B8WA 1V2GA 4EY6A 5E7JA 3RC8A 1UC9A 3UAWA 1G7TA 2CZGA 2D54A 3BA9A 4HX2A 5ILOA 4L08A 3HO1A 4MYDA 4V1CB 2PWYA 3LKDA 3D6AA 3SG0A 3P2JA 3HKDA 2RDIA 2YVKA 1OFUA 1OA1A 1UDWA 5JNSA 5AVJA 3SS7X 3UQ8A 4WEQA 2H11A 1ZETA 1N5KA 2YVAA 4PZPA 3IQGX 2J0VA 3QITA 4HTFA 1K86A 2OFWA 1P8JA 5KTYA 4BGUA 2FFRA 3GMIA 2QRKA 4DA4A 2UYYA 2CNOA 1WDWB 5KFGA 4RVSA 2J3MA 3UIEA 3IILA 3ZIAA 2K4MA 5BWBA 3DF7A 1M6VB 3UGQA 4PE5B 4HUTA 1TZKA 4EEXA 5K4AA 1W30A 5T3YA 2COJA 3INRA 2JBAB 5IKMA 3DE2X 1WP9A 2PL3A 5CA1B 4GI5A 3DZBA 2GPWA 1NMXA 3FYUC 4FI3F 2I1LA 3KQOA 4PBRA 1HDEA 1WVMA 1HMPA 3N8DA 3HRKA 2QTHA 3OJFA 3V00A 2MSWA 1HURA 3ZBPA 3TDKA 4ARAA 1PUIA 3ESBA 3QEMA 4ND2A 1L4BA 1Z33A 3FOAA 4FEYA 3GILA 4QUIA 2DSTA 2AQ8A 4TYWA 4EB8A 5KVVA 2LR0A 1GTVA 1F2DA 3QV1A 5IK2A 2PLRA 1R66A 1SKYE 4BFUA 3U4AA 3PHBE 1OKKA 4LFAB 1C9NA 2EF0A 1L5SA 3ANXA 1TVKB 4FFMA 2YZNA 2FSUA 2YDYA 5FO0A 4L28A 3LE8A 3GIWA 4UXHA 3M4ZA 3A4TA 2QSUA 4GI1A 3WMXA 4O5OA 2ZREA 3TSAA 5JY1A 4QDTA 4DCSA 5EJ4A 3FRJA 1DUSA 2J48A 3PC8A 2BFOA 5J5CA 3LK7A 3NHUA 2LBPA 3WGOA 3HO8A 1E1CB 4BV8A 5BT9A 3F7TA 1SBIA 3R0JA 3A9UA 2C9BA 4LH6A 5U4QA 1KMHA 4N49A 2ZI6A 1YVUA 5K99A 3L8ZA 3UGKA 5FUMA 4V0MA 4EFMA 4US0R 4Q7EA 2XNDD 4DCNA 3MB5A 1G3IA 1KI7A 4B44A 1WSDA 3VC2A 2A1TR 2Y67A 4E7PA 2VLBA 2MOKA 1XTKA 2QTVA 1HY3A 2B7LA 1U3GA 2XWPA 4ESHA 3GLFE 1M9NA 3UT5A 2HWXA 3ASZA 3JZAA 4A7PA 4H7FA 1J09A 4MYCA 5DLQC 2JEFA 1JKIA 2LCQA 3SR3A 2QMOA 3DQPA 3GGCA 4ECTA 1VA4A 1Y1PA 2Z30A 5K8CA 2AXQA 4CEHB 1ISHA 4FLMA 3K70D 4TWAA 3MSCA 2R93A 4CLXA 2YCLA 1RJDA 5G53C 3DBOB 4B1FA 1TA4A 5HX7A 4HWGA 4KRGA 1ZUD1 1T9HA 1KWGA 1VP3A 5BR8H 3FCAA 2XITA 3JPWA 3L2OB 1JAIA 5DSZA 4IV5A 4A3LG 3DMTA 1RPAA 5KYYA 4C3OB 2H1WA 2TS1A 4KLAA 4I3GA 4G09A 1E7SA 4MO9A 3OJLA 3WLFA 4BFVA 1W59A 3G5MA 5TQ0A 4MUFA 4JC8A 2VTEA 4Y2YA 4ILEA 3KHKA 4FYHA 4CMEC 4RLSA 3TW0A 2R6FA 4UAUA 4EPTA 2Y1KA 1QHYA 5BSFA 4EJSA 4TLCA 5I4IA 5CPFA 3H8JA 3OI7A 3KJGA 4FYJA 2A0KA 2CK3A 5CB6A 4EVSA 4INOA 2FK2A 4ECVA 3AB3A 4JYPA 1YKFA 5IRCD 3MZ0A 3QUSA 4Q05A 2FKNA 2A84A 4UFNA 3GLGB 2BISA 2VHWA 4IMJB 2YWRA 3G3EA 2QTCA 4A6EA 3WK4A 1UOPA 1OLXA 2CXSA 2I2CA 3QVOA 4WCDA 2HWUA 4AF8A 3LI2A 4PZEA 1JDVA 1Q1BA 2HMAA 1I2CA 3OA0A 3TXAA 3GTGA 1RRCA 3IBSA 1W19A 5JH7B 2PMEA 1QH9A 1XMQH 1LBQA 5AM1A 4CU2A 3IQEA 1WCMA 1HUQA 1NOKA 2VXYA 4TM7A 3THXA 5EI5A 1KDYA 3KYDA 3B3GA 4E07A 4RHTA 1YR7A 2O8NA 3PGVA 4K9PA 2ODNA 5E6SB 5FUXA 3T5MA 1Q22A 3NYRA 3BQ0A 4ACAA 4XI9A 4XCVA 3RYFB 3KEOA 4K6CA 3NBZC 3T1VA 2JFGA 5CLFA 2PBFA 3RS4A 2ZRGA 2L69A 2A9VA 2HM7A 1Z56C 2IE0A 1T4BA 2X2EA 1CUYA 1E2QA 4MRPA 3VR3D 4P3PA 3ZCRA 2ATCA 1KGSA 3HDHA 1Z26A 2PLAA 1CRLA 2YX1A 1AKQA 2OWDA 1P2VA 1PWXA 2LZ0A 5E4TA 2NP7A 1N48A 3GLRA 4MR8B 3WBFA 4XUDA 1GQQA 2P9BA 1QDUA 1WUIS 5JV5A 4WY5A 2V7XA 2YJ3A 2QQ5A 2NU9B 5AM5A 3CIOA 2YOHA 4C7KA 3TW6A 2O0HA 1BJTA 2AJTA 2NU7A 1V4YA 4RLFA 2P62A 3FJ1A 4I8IA 2JIOA 4KQ9A 4DSTA 1PVVA 4HUQB 2CSXA 2ZS8A 4X1KB 1ZH4A 4DR7H 4L15A 1TWCA 2QX9A 3AF0A 3T7KA 1L3BA 2BFEA 1T2EA 3S3TA 4C07A 3R74A 3JQGA 1UK9A 2R92G 3ADBA 2BONA 3QFCA 4UPDA 2XX3A 4LDRA 2VHCA 2OESA 5CUQA 1OWNA 4YRNA 1OI2A 1WKCA 2RGWA 4OBEA 2F9LA 1L4YA 5C4MA 4YIKA 5KFSA 1EQUA 2Y1DA 3EGXA 4LMAA 3C6YA 4Z4IA 4MS3B 4CG1A 3D3QA 3MJEA 1OZHA 9ATCA 1NLYA 4KP7A 2WR8A 1MU0A 5IG2A 4HEJA 5PNTA 3HVIA 3PR5B 5EMKA 3D5QA 5C37A 2JA6G 1CR4A 2PKQO 5IWCA 3EPKA 1KXZA 1BOFA 1RZRA 3IOCA 2YV5A 1XR3A 3KB8A 5BMVA 4PSVA 5ECGC 4B6EA 1GXSA 4YRTA 3GGSA 1MIOB 3OIDA 3SJ7A 1R74A 2HA4A 4JD5A 5GM1A 1LVGA 3MHTA 3VKGA 2QGZA 4GM1A 1E5TA 1J22A 4OD0A 3GV5B 4X3PA 3A6KA 2Y8EA 2NU8B 2ZBPA 2YJZA 4RY2A 2WT9A 1LS6A 3EJ6A 3I53A 4H1UA 1PWHA 3K4HA 4ND3A 4GGPA 1JJBA 5CFMA 1UAAA 1KAEA 2J6TA 4ZN6A 4ZV7A 3MUOA 3R3SA 4MP3A 3IRVA 1NRIA 4B7XA 3IESA 4BP3A 4W9RA 1JGTA 1NXPA 3SEAA 1OX6A 1Z6XA 1A04A 3GLIA 4D26A 1YU6A 2I7VA 4CN9A 3G5LA 5TGZA 5KWEA 4GLWA 1N32H 4OGWA 2XDQA 1CUUA 1ONSA 4DA7A 1W0KA 4YV1A 3TN7A 4WZAE 4JI5B 3LXMA 3I9FA 1L7RA 3Q4GA 3O2JA 1XELA 2W8LA 2OECA 3BE8A 4GX5A 1P4RA 5C4XG 2P9HA 4J0JA 1PNRA 1NSYA 4L85A 2RH4A 3FR8A 2WD9A 2OXIA 3INYA 3RRJA 3KLNA 1M6HA 5F1PA 4UFOA 5LMNH 4I55F 5JR3A 3F8TA 4X65B 1A2BA 4HEA6 1ZOIA 1IUNA 2E82A 1RQRA 4DUYB 5HIMA 4K2HA 4IYRA 3H9JA 1FW8A 1JDUA 3D1LA 1T8SA 3JY6A 1E9BA 1MXHA 1UBOS 1DJPA 4U9UA 3NCTA 5A9SB 2C7QA 2PS0A 1XF9A 4BTEA 2MSKA 4CT4B 4XDYA 5C35A 4MWEA 1SQ5A 2CXHA 1TFUA 3O74A 2Q9AA 3GTJA 2HNAA 1X7WA 1U7ZA 3THWB 2C4MA 1F9AA 4RIIA 4LFAH 4D6YA 2C5BA 2JATA 2OCGA 4EYSA 3NIGB 5D3ZA 4C5CA 2ZIXB 3DM5A 5EIAA 5J59A 4EYKA 3I6BA 1QVVA 2CW7A 4PHFA 3ISJA 2VJQA 3EZ6A 4MTEA 2WG0A 2C7VA 4GMGA 5HJEA 2OV3A 3C5HA 2VPTA 3K2BA 4XW2A 1PYDA 1CY7A 4ENQA 4N76A 4J9KA 3D7MA 4UCVA 4M8IA 1YCDA 5EWJA 1DKPA 3DTYA 3W6NA 4YRAA 4TL9A 4KOAA 3SVZA 1T91A 3OECA 1JQEA 4O8ZA 2OY0A 1HE5A 3UGJA 1P0FA 4JUIA 4KVAA 4BQSA 4NDNE 1YFJA 1JEAA 3FMGA 2EFEB 3AM1A 2WD8A 1FMLA 4E5DA 2E49A 1WW2A 4F5YA 3G0OA 4U00A 5EMMA 3KOMA 3RVJA 5HTKA 1JDNA 4I1PA 3SKYA 2FXVA 2ILTA 3B82A 2AQKA 1S1MA 3GDOA 3AUYA 4E2XA 3CCCA 2CNDA 3WWCA 4ENUA 4WV3A 3G7SA 2AIRA 4GMDA 4UBMA 3NBKA 2ZGIA 4MB6A 3CLVA 2HVQA 3KUCA 1M7GA 1GYQA 2VDMB 5FNVA 4N4AA 4E3ZA 3W2GA 4MQFB 3GV8B 3FF1A 1JB9A 4J9OA 1IM8A 4DN6A 5JC1A 2CHFA 3H75A 3KPWA 1D2AA 2XQVA 1DX9A 3S7TA 3BS4A 3Q40A 4DCPA 2HRCA 1U7PA 3RUAA 1EDEA 1T4MA 3CVZA 2W00A 3VPXA 1MRSA 2JD1A 4HAZA 3DMPA 4FHZA 1NN5A 3A37A 1JJAA 2IHUA 5BRNA 2R5FA 2FF5A 2I6TA 1OASA 1AO3A 1FXUA 3P0RA 1MRNA 4A1OA 4DC1A 2HGZA 3P19A 4CMAA 2JG3A 3TTSA 2Q49A 2QRNA 4ZO6A 5FKJA 5HJ2A 4R69A 2G7MC 2VJBA 1OE0A 2GFHA 1PJ3A 1SVKA 3M70A 5KFYA 1F0NA 1FTNA 3L7YA 3PQ4A 3AETB 3QYAA 1Y9DA 3RK0A 3IEVA 3UJPA 7AT1A 4BWYA 2EYUA 2HCJB 3CPJB 5FA6A 4OO3A 2ZE8A 5G02A 2GEDA 2A5JA 4YBZA 3EBPA 1G59A 3D2CA 4D74A 4MHTA 2H57A 5A0FA 2OVFA 1KDTA 3B12A 3H2IA 2D74A 3DFZA 1A7JA 3S27A 1UMCA 2H52A 5LQUA 5KWVA 3VU0A 3HJTA 5JHGB 1I2KA 1U02A 3I37X 4LYYA 2PNJA 2J9YB 3VNSA 4PZ6A 4AO8A 2QVBA 3EZ9A 4KDFA 3FG9A 4RGYA 4DV1H 3ORQA 2DT8A 1CBUA 4KQXA 3M6MD 4AO7A 4R8RA 2B78A 2CVHA 3L7NA 1WQ1R 2YS7A 4CE6A 2P9TA 4ZHQB 2NVXA 1C9JA 4YRFA 4CEJB 1RJPA 2BDUA 1AKRA 1JIKA 1FFCA 1VC2A 1NF9A 1YMUA 1EXWA 1G38A 4TQUS 2PXXA 2PVSA 2KBFA 1U2PA 4W5TA 1A9SA 2KLHA 4GVXA 5IF9A 2OD2A 2Y71A 3KQQA 2BOVA 3MQ4A 3OPXA 2PT6A 1P0PA 1J2EA 1EX6A 1LRLA 1DAAA 5THKA 3Q3GE 3S2YA 1JDBB 3NWPA 3R6LA 4ZKDA 1OYWA 4DLWA 5EAIA 2VRCD 3KHTA 3MFYA 2GD2A 4GR5A 3RYTC 1NE2A 1UJ5A 2F67A 4DLSA 1PLLA 2WKPA 2GHRA 4PO3X 2EYQA 3PXAA 3W9BA 5LP6F 4LQDA 5CDYA 4E5MA 3PC2A 4OM8A 3ZE1B 4QBHA 3S2SA 1ZGZA 2HPAA 1VP9A 3OPQA 4ALMA 5FBRB 1JLMA 5DCUA 1E89A 4YAKB 3O3NB 2P30A 2ZK7A 2AKAB 3LDFA 5LCXA 5EXDA 4I9NA 2ZR8A 4MV4A 3HHEA 2A3NA 1ORDA 3RC1A 2G0NA 3E53A 4Q8EA 5EINA 5A2QA 1B73A 5FUBA 5AVXA 1H23A 3OCZA 5DZSA 5C7YA 2FX2A 4AMVA 1EXVA 4Q3EA 3ANSA 1HYEA 4A2AA 1MHPA 4S0XA 3HDGA 2OGUA 3RU2A 1OZGA 2HT6A 1L5HB 3AF3A 1WZIA 4TXHA 1F8UA 5AMXA 1Z62A 3Q8QB 4FOSA 5TXGA 3QEKA 5AVRA 3RIZA 3G9TA 3TL6A 3O8OB 5NULA 3L7JA 5L6LB 2AGQA 1AM4D 3FMIA 1Y89A 1G9XA 3W77A 3R5SA 4KUHA 1TIBA 3ZXXA 1P9OA 2P90A 3QJYA 4WI1A 5T6MA 3A14A 4JASB 5I9MA 2B63A 3H05A 3EPIA 1V8BA 1KI3A 1LUAA 5AHOA 3WB2A 1YMQA 1G5TA 3A6HA 3OA2A 4IIYA 3V1YA 5J63A 2AR0A 2R7KA 1ZONA 3ED1A 2OAQ1 1P5HA 1R6XA 7REQA 4TS1A 1P74A 1ESEA 4L3OA 3ZV3A 3OX4A 1FE8A 3R3VA 4Y98A 4G5XA 4MQ6A 3X0DA 3PBKA 4BLPA 3LUAA 1Z5GA 5EUBA 1WW8A 3N8HA 1WB9A 3ZD6A 1R4NB 4YDQA 3GTLA 1ZM2A 2OAEA 3IUEA 3VO9A 2A7XA 1C9DB 1PFQA 2DEUA 1XCBA 1E1DA 3UOGA 4RZRA 4UTPA 1KY5A 2NZXA 5KT6A 2OBFA 4AX4A 1PFUA 1KPIA 2FLWA 3FCYA 1AX9A 2VUUA 2QEQA 4JI5H 3KLPX 2PBLA 3OP4A 2ZE7A 4IF6A 4EEZA 4DYVA 1ZEJA 1CZRA 4FEEA 2EC5A 3MWJA 5C32A 1NG9A 1XDZA 3PNOA 4U7GA 1FMCA 3DEJA 3E9CA 5DP1A 4D42A 2ZI9A 2CY0A 3FYDA 3A70A 2VLIA 4B3RH 4H1TA 4CN8A 1QPZA 5H9VA 4L9SA 1XVAA 4UBJA 4WACA 5BYJA 4B3SB 2WU1A 2XLBA 3T7EA 3DOCA 2FOXA 1PR5A 1XRNA 1M2HA 1C4XA 2P68A 4HNSA 5IZCC 2A3RA 4H6XA 1RMTA 1ZRMA 4FB5A 1ATZA 1D2RA 4KHZA 4M21A 3OQIB 3RJTA 1ZGAA 4IHJA 2R7AA 3GF4A 1TYZA 3BCUA 3HCDA 3T7TA 1T94A 3TSCA 3SBXA 2G17A 4TTPA 1G4AE 2X8BA 4JI0H 1S97A 1SCUB 1GO3E 1FJGB 2VATA 2X86A 4JDPA 1CY0A 1F38A 2G1JA 2PYDA 2X9QA 2JPDA 4A4DA 4LC0A 1U0OC 5EUQB 3U80A 3GXOA 1FL9A 2PZAA 3RSHA 1JBQA 1PUJA 4OI4A 1BNCA 3P5SA 1G8FA 2EX0A 3ZLUA 3U0BA 3PCTA 1TT5B 2Y93A 6ADHA 1SG6A 1J7KA 3Q3CA 3ORHA 4QWAA 3AGPA 1XCLA 4O7VA 5CCDA 1KQFA 3SGLA 1C7FA 5BNIA 5A3VA 1GQ2A 2QM7A 3KHLA 4NX2A 1FY2A 2WAYA 3LY7A 1EK2A 5AJYA 3NXKA 4N7BA 1XTIA 3F46A 4RPGA 2FZVA 1N9ZA 1WD5A 2ESRA 1TKBA 3W06A 3PX2A 4F2DA 4ED9A 1H5NA 2PUGA 1FXSA 1J2JA 3WIOA 2D1YA 3CLRD 2Q6OA 4U5QA 3V5NA 5JXGA 5C80A 4K8OA 4HNQA 2YV3A 3DFKA 4XD2A 2OCPA 3GQCA 4ROSA 1T8YA 1A3CA 2FWPA 3WK7A 3BK7A 5I3ZA 2HMUA 3C3BA 4XWGA 2IT1A 1CFZA 3A11A 1S0OA 3IAM1 1O6GA 4CHIA 1KZ6A 2I99A 4G3IA 1TZCA 4WXYB 2V03A 4JODA 1MOPA 1WQ4A 5KNDH 4PZDA 3NLLA 1LQUA 3S55A 2YFKA 1N57A 5I7RA 4ND1A 3JVIA 5C5EA 5KMGB 3PVSA 4HEQA 2E3JA 4A0FA 1WSAA 3RS3A 1DIRA 2HOQA 3NM6B 4CKYA 3F9CA 1NQAO 1RQNA 1JZQA 3ZC3A 4Z4EA 3U7RA 3KUUA 4G1EB 3H3JA 5CP8A 4MCIA 2GF9A 4BMSA 1PZNA 4LY6A 5DSTA 3ELYA 2ZWAA 3ZD8A 4K9DA 1BDHA 2O2ZA 1M54A 2VHEA 4UAJA 4MW6A 1DQYA 4WJLA 2IYTA 1W581 1DG9A 4V2UA 2VKTA 3FNIA 1R0RE 1OR8A 1H0HA 1P60A 2YL2A 4TZ0A 4MROA 4ZQFA 2HJGA 2XNKA 3NC1C 3E7DA 4ETNA 2HIXA 2WZCA 2XI4A 2C88A 1Q7TA 1ZD5A 5FEUA 1UJ4A 5EERA 2ZYRA 3DULA 3M49A 3P9ZA 2BLNA 3SQMA 5IAKA 3CJTA 1E5LA 4YMTA 1OZFA 3FRIA 1QTIA 5LLDA 1E99A 3KAKA 1EX1A 3LAWA 5M5BA 4B83A 4YMUA 1ZI6A 1KJJA 1Z39A 2G25A 5KFRA 1GJRA 5IFLA 3V97A 4JKOA 2V9WA 4ZDIA 4PGAA 5L4SA 4MV0A 1I2LA 2HRRA 3T6KA 4OB7A 4I46A 1Y48E 3NJ8A 3JARB 1SVOA 2IMWP 1ML3A 3VDRA 3KYBA 1X1TA 4B3BA 2B25A 4WTOA 4MJ7A 4QATA 3WLLA 1T9BA 1PEDA 4XDZA 2OBLA 4UEKA 4H7HA 3O4VA 1GNRA 3TRJA 3GLFA 5CR5A 3BXEA 1POXA 2D3TA 2QX4A 4QO8A 1QFMA 3RARA 2RB5A 3RTAA 3VPHA 4S1NA 2V98A 2LWIA 3L7DA 4Y2XA 5JCXA 3ILHA 3L8GA 5A9TA 2ILVA 2JEGA 5ECWA 1NW4A 4U7WA 1YQXA 5A04A 2YHIA 3VYRB 2PXCA 2IX3A 3AW9A 4E2WA 1PN3A 2QLTA 2ZM5A 3LVQE 2ZZMA 3TIXB 2O1XA 4ZZ2A 1M5RA 4F2WA 2QK4A 1I32A 4O7NA 5LQKA 3EH2A 4LJSA 3KLOA 3R0IA 5LOVB 3BBPA 2CLLB 3NUGA 5ALJA 2H1LA 3VISA 5HILA 4HDKB 3B9QA 2JFVA 4Z9YA 4D4IA 1MQ9A 2NADA 1YONA 5F3RA 4KE6A 1WL8A 1IZZA 2IRWA 1N56A 1BCRB 1FLDA 3MM4A 2YWJA 3CKKA 3O8QA 2IPOA 2EX4A 1D8TA 3GMTA 2D62A 2OO5C 1A77A 3COSA 3V6MA 2FGKA 1ENYA 4EHNA 4YDHB 2C5FA 3CNLA 4XGIA 5A1JA 4APMA 2P4EA 4YJ2B 1WM1A 3EBOA 4RABA 1RPJA 1UK6A 4ZQCB 1KYIA 1RZVA 1Q77A 3I3SR 2I5PO 2PKCA 3RT9A 3JRNA 5IJ9A 4P7JA 2DH5A 3MCTA 3QXSA 1NMEA 4PCLA 1G6OA 2BMDA 2P27A 4I9HA 2HPVA 1P1JA 3I58A 4DR5B 3S1AB 3PDIA 3CG4A 3S8EA 3L8EA 4EQZA 3TNJA 1I1OA 5I7HA 3JQEA 3KAJA 2NTNA 4J9PA 1YD7A 4X85A 3J81A 3I5UA 3IFSA 4ML3A 3I9V1 4AT1A 3W2FA 1E66A 2YWFA 4LZPA 4REQA 2V5AA 1XNGA 3IJ5A 1MX5A 3IEIA 2A92A 1N8TA 5CA1F 1VLVA 3T4XA 4LXQA 4QHTA 1GARA 3I6ZA 2QVXX 3MFIA 2HW8A 1I7PA 4LX0A 4ZEXA 5L7TA 3LK6A 2CW5A 1JF8A 4A36A 1UP6A 2O7QA 1T2AA 1V51A 3SHVA 1Y42X 3N44B 5EIBD 5M7EA 1BE6A 2NXNA 2IS2A 3ITKA 4GQAA 4C5AA 2YQ5A 2FVYA 3GYGA 3HXQA 2ZWIA 3GJTA 3VHLB 2ZZKA 4N8DA 3EXFB 3BILA 1C5KA 4BHTA 5DTEA 5AVSA 3WGVA 1PDVA 3WGYA 4KTTE 4I9FA 1B41A 1CF4A 2W2VA 5REQB 1PR4A 3GC6A 2KBEA 3G2KA 3ROPA 3FUUA 3LQ4A 1GU1A 3FSGA 4LF5B 4IGEA 5ELXA 3A3NA 4A15A 3SE7A 1L4LA 2QD1A 4YWJA 2V9CA 3QXHA 3DOFA 1JU3A 2BFWA 1OZ0A 3ZR4B 3REQA 5HK8A 2OQIA 3L8MA 2VNIA 4R84A 3RADC 1QO0D 4OX9Y 4PLTA 4RF5A 3QLTA 4IIEA 1W44A 2GEFA 1BEZA 1CUHA 3ESCA 1GYFA 2UVQA 1IBMB 5BR8B 1RI2A 3K1JA 4BMOB 4ZI5A 1V1RB 2J5BA 3O8DA 4LGYA 1RYMA 1S4QA 2NOAA 5CK5A 3IXQA 4RYDA 3NVMB 4JLPA 2Q7OE 4R2HA 5KG7A 2OV2A 3R09A 2IVZA 1FJGH 1NXVA 4G5GA 4R1LA 3ZCVA 1Y5NA 1RXWA 4MDFA 3K9LA 1A4XA 2FMAA 5K8LA 2F8TA 2WQZA 3PD1A 1Z6ZA 2GM9A 1ITZA 3MCUA 4RY8A 4P35A 1AHPA 1UOQA 1YXMA 1X92A 4UBLA 9ABPA 1KI2A 1TYCA 1YHNA 3QRWA 4YCLA 2BHSA 4CT5A 3GN2A 2GD0A 4EEKA 3WQHA 4KR9A 4WY2A 5FFMA 1AZTA 4PF1A 1BROA 2EKZA 3MJ4A 1JT9A 5DAAA 4DQDA 3WRYC 4UCXA 1DHTA 5EIEA 4F6RB 1WZEA 4YAIA 1PZXA 3B36A 2F48A 3C48A 2YS6A 4EX6A 4OQPA 5HR5A 1BMFA 4X8OA 4IDAA 5JW6A 3GEGA 1R5OA 4CMGA 1OD6A 4GHWA 3WG9A 3V8MA 2V65A 4GF5A 3MAJA 1P0MA 4MKZA 2QAGA 3WGTA 3VH3A 3HDTA 1Y8RA 1E60A 3NR2A 4MRAA 4JROA 4WZAA 1CNEA 4YRZA 3LX8A 4QTUB 4FS3A 2QUAA 1Y98A 5DI9A 5DGXA 2UUPA 3DHEA 4IH4A 3EOBI 4S1VA 3D6HA 3R3JA 4COOA 3L0OA 1FS5A 2IS4A 3T0GA 2DUMA 2HLNA 3HHPA 3TAXA 2ZWPA 2QVYX 2QIOA 1BAPA 1E5XA 2UYQA 5FP0A 2ZUDA 3JWIA 5C46F 2HO5A 2V3CC 1P8LA 1CRZA 3O8NA 4C4TA 3EDQA 3H8WA 2Z2KA 4FS2A 4R54A 4MRMB 4ZO7A 3TFOA 4LHWA 1I14A 3F98A 2JAWA 1H66A 4PX5A 2AFIB 4MUBA 5JH7F 3WWHA 2B20A 3HCRA 1SH7A 5AVUA 4OXKA 2P8SA 1GYPA 1SWVA 1X1DA 2X22A 1E1KA 1EESA 1Y7TA 2IZ7A 3ZIAD 3DKKA 3PEWA 5JD3A 3H0GA 4IH1A 3RBVA 1A2OA 1EK5A 4ETMA 4G4SP 4DR7B 1B14A 3AHEA 1UXHA 2GWHA 4XSGA 1XZEA 2ZRJA 3MT7A 4B85A 3LHFA 3OE1A 3OX1A 5KNLA 4U7HA 5A5GA 4OL9A 4IL5A 4ZO4A 5ALVA 2B6NA 3L93A 2H1SA 5BSMA 3OCUA 1U9IA 3SQXA 1J90A 3M9NB 2DUWA 1T4CB 1C8BA 4P3KA 4UMDA 1E3LA 5IBPA 5C8ZA 2VJMA 3L1UA 3LLSA 4NU6A 3CLSC 2O48X 4G97A 1GPMA 4PG4A 4U9IS 1OX4B 4DA9A 4Y9RA 3ZTTA 5A4JA 4Y9UA 1WETA 4KTVE 5IK2D 4JSRA 4AMUA 2AMVA 3W8NA 4GBGA 1IFXA 1THGA 4ND7A 2JKZA 3H3FA 4TLLB 5CFQA 5FHQA 1B0ZA 1K7XB 2ZYWX 3MT8A 3CNOA 5ALOA 4LQCA 3R5HA 3UCFA 2ZPUA 5KTTA 5KPJA 2JARA 1WLSA 3A06A 4F46A 3KOYA 4OQEA 1UP4A 2GX6A 1QF6A 3FDSA 5CDUA 3Q2OA 4WW0A 2V5UA 2XUGA 4KIUA 5P8WA 3IOBA 2J41A 3FWZA 3MLEA 3MD0A 4G1MB 4XASA 1B2LA 1QH1A 3W5HA 4TTVA 1KDPA 4CMFA 1W36C 2Z3ZA 4B5LA 4OHBA 3CF2A 1RBZA 1R88A 2EU8A 3V8BA 5EXXA 4N6NA 3ZY6A 2XTNA 1GN8A 2FU5C 4U5XA 2AOVA 4C0BA 4N1AA 4KPUA 4E2YA 3OETA 3PTZA 4DQ0A 4DLPA 2QMZA 4H1VA 4LDQA 3VAYA 1G3QA 1DZ3A 3FWKA 4GZLA 3KT8A 1AH2A 2GEJA 4GMKA 1N32B 2PTHA 1JAZA 2NQTA 1SC9A 2BMFA 3AXSA 1ZVVA 2IYZA 1HF3A 4EFNA 1FRZA 4NCIA 1G2OA 1RVV1 1AKMA 2AMFA 1OXVA 2FG5A 3R75A 2HREA 3JSAA 1QFXA 5IVKA 5CFPA 4GI2A 4A6DA 3TJMA 3MUEA 3BX1A 1HKHA 3JQDA 1J06A 1JG6A 4HG2A 5LMNB 2AUTA 1JIVA 1XAGA 1XPUA 1QFSA 4WXMA 1B4DA 2YW2A 1UMKA 4GZ5A 3GGJA 3HL0A 4QHSA 1QWSA 1SULA 2ZAYA 1SKBA 1FRVA 3G2JA 4RVGA 1A27A 4W1QA 2PSJA 1SD1A 2B92A 1RWBA 4BGDA 5BN3A 3VJRA 1SOAA 5FA8A 1PAUA 3RASA 4WL0A 1VYUA 4NBTA 3RFUA 2WF7A 1PD0A 1BXRA 3CB2A 3RVBA 1X8LA 1WTCA 1FQOA 1I2BA 1U81A 1O0CA 4KDRA 2R00C 4DR5H 3URMA 2NT4A 5H16A 2CK3D 5F23A 2XVAA 1KSFX 3LPMA 1IHPA 3MN1A 5KFWA 1V1MB 4DM3A 3IAHA 3DWFA 3HXMA 1U8UA 1IJEA 2E4XA 4UMVA 2X0FA 2ZCJA 3BPSA 2AG0A 2OR3A 3VNAA 1IJKA 2Z5VA 2EJ3A 3NUZA 1ECLA 3WLPA 3BXXA 2RMKA 4L2IA 2VP6A 3UMSA 3G7UA 3P52A 2G08A 3COPA 4QECA 2XEXA 2NO7A 4JC5A 1X3LA 3WHIA 4JR2A 2MWMA 4A10A 4QOIA 5GGYA 1WBDA 4AF7A 3OWOA 4P4SA 2IZ1A 1N1MA 1AS2A 5JBIA 4MV9A 3AB8A 3A4VA 2P6OA 1BVYF 4G5YA 4QIWE 3HG7A 5GWXA 2P4SA 1QRAA 4EY8A 1W0CA 2CLKB 4IS2A 3OPVA 3GLHE 5FJIA 5HYVA 3RSCA 1E6UA 3UXMA 3V8VA 4LOIA 1KFKB 5BSKA 1TWGA 3GIPA 1T2FA 3UA4A 3R8XA 1HFEL 2GUGA 4UBIA 4KQEA 4ALNA 5KFZA 2W2KB 3AG6A 4K7JA 2AE2A 3RC9A 2QYTA 1Z6TA 3LWZA 1L8OA 1UKCA 4D0RA 2QN6A 1F2TA 4LF5H 3SNOA 1PWEA 1KJ9A 4P2GA 1T2CA 1MO3A 3TNLA 4FXPA 1I1HA 1APBA 4FFBB 1AKEA 4GUDA 3ZGZA 1FNCA 2FSVA 4C3ZA 4GOJA 4OXNA 2B5WA 4R05A 1TEHA 5KVQA 1JVSA 3VOTA 2DZDA 3SBEA 3G2HA 1WY5A 1X86B 3PC7A 3AONB 5AW8A 4F2HA 5ADHA 4X1YB 1HE8B 3JD3A 5AJUA 5CYPA 3OQVA 2UZ3A 5LXTA 5FJ8G 3DXXA 1NUAA 4CM9A 1NSFA 1RXIA 1IBMH 3S0JA 3BABA 1P3DA 3AU8A 2DUNA 5HEKA 3PJFA 2NTJA 4KREA 1RBQA 4LCEA 5BW6B 4ED3A 3QYPA 3OY2A 3OIYA 2RGVA 4AULA 1V71A 4NYJR 4BP8A 3BHMA 1VKHA 3VV3A 3TZEA 2P6RA 3BDVA 1Y1LA 1GGNA 2W2MA 4HDOB 3T7IA 3C70A 3FETA 1XXLA 1Z5WA 2PFGA 4EHDA 4MR7A 2RHBA 3OPYI 2SKCA 4LXYA 4NYJQ 2NUTA 3WQQA 2QLMA 2QWXA 1RXEA 2ZWOA 4ZT2A 1OVMA 5K0NA 3SU8A 3N76A 1YA8A 3A4NA 3SZMA 3QVWA 3U31A 5FOXA 4CM3A 2ZT8A 1G5PA 4AWBA 1VJRA 4BWSC 1DIGA 4WZBB 3TSZA 1JH8A 2NZJA 1N77A 4B31A 2ORIA 1NM5C 2DR3A 4W8OA 1OV4A 2I22A 4J9MA 4PLVA 3VKVA 4H7DA 1R1DA 3OCXA 4I8DA 2ZIZA 5EJ9A 1H9BA 3PDHA 2E4ZA 3RIMA 3BSSA 3WK5A 2FAXA 1RZRD 1YIAA 5EA2A 4P84A 3WGGA 3HSSA 2HPHA 1WY7A 4F06A 4ZYTA 1MGPA 1XTQA 5AKZA 3QU2A 5H70A 4ECXA 3PC6A 2VQEH 2NQ2C 3OC6A 1KC3A 2FCRA 4PFJA 4DV1B 3MR2A 2J9RA 4EDFA 3I72A 3M9LA 3R6TA 4A3KG 7ABPA 4AICA 3K09A 1NNUA 1GTSA 4FDUA 2X4LA 3M82A 2BM8A 1B15A 1FDWA 4IGAA 5BWLA 2G6TA 3R9KA 3ZUPA 4KPYA 5I7FA 2G5GX 4R81A 4LHXA 4AJ1A 3GH1A 1I4EB 3KS9A 4W8HA 3LZDA 1XCOA 1XMOH 2YOGA 5GJBA 3N43B 4KI0A 3O47A 3FGZA 4HAOA 4F5ZA 2AOUB 3RS5A 3LQQA 1T0IA 3X44A 1W0KD 1MCZA 3VZCA 3H5IA 1RM0A 1EINA 3IDZA 4LVNA 1II0A 5DBOA 3UMVA 2B2XA 2W5UA 4LIPD 1IPFA 5FAXA 4OH1A 2HA7A 3EPGA 4G4JA 5B1SA 4J0HA 2RHOA 5KX5B 5AW0A 1F9EA 1UBGA 4KXFB 1GP2A 4HSEA 4MGKR 2FY8A 1ORVA 1R64A 4EA6A 1ESZA 4ZHQF 1WJGA 4CF4A 4QJFA 2P0AA 4GR4A 4I9UA 3ILSA 2GXUA 5KG5A 2JI9A 2FCAA 5HWSA 1U9CA 4EHKA 4ED1A 4QEZA 5ALTA 5KFHA 1PX0A 2WFLA 2W71A 2XXJA 4YCJA 1K8RA 4M53A 1LQTA 3ITDA 4G01B 3FDXA 1I1NA 2D7DA 1BEEA 3VU9B 2JFQA 1MB9A 2IKQA 3UV6A 2GJ8A 3CUYA 1XWFA 4HLQB 2QR3A 1HZZA 3AQ4A 2VDKB 3PEUA 2D5AA 2C7PA 1NT2A 3GDHA 2ST1A 5AK6A 3H3VH 1BIFA 1ICEA 3MMXA 5E4FA 3EA0A 2O7SA 2WICA 2FWIA 5IJZA 1YMVA 4QYIB 2EKDA 1RI3A 1E6EA 1AA6A 2IVFA 4FT2A 5I48A 4KPEC 1HQKA 5TNXA 3AR7A 2UVPA 2C9DA 2PJRA 3THSA 2QAIA 1JHAA 4C1NA 2ZI5A 5C4GB 1T9ZA 4ED8A 1XCPA 4JI2B 3ZVRA 2C5LA 3VHXA 2F8MA 4DDKA 5DM0A 5JS1A 5J2UF 1T29A 5TB5A 3BCHA 4LF4B 1S9FA 3ND9A 2RD2A 5KT2A 5JRJA 3QHQA 2RHGB 1GU0A 5G40A 3WHPA 3MVEA 2Z56A 4OHPA 1B26A 3OQHA 3FIUA 5BWOA 5B1HA 1RYSA 1KDRA 5TE9A 3OOEA 4PM4A 1JEYB 5FPRA 4YRRA 3WGJA 5AFSA 1QP7A 4B43A 3P9PA 1MHTA 1SVWA 1JW9B 1CUIA 3PPYA 3D0RA 4ZQBA 4J0GA 4FOTA 5BYBA 9MHTA 4AKHA 2GZ2A 3QKSB 4Q1CA 3D4PA 2HIGA 1WAMA 2RONA 4GT1A 2H3EA 5CE8A 3ELWA 4JL8A 4AJJA 1LX6A 2RK4A 1IZ8A 3CF4A 4R83A 4RKYA 4OAOA 2XD4A 2VKQA 2C3OA 1NQVA 4J2HA 2I2XB 2QUKA 4JITA 4KNVA 1CWUA 2FNAA 4CU5A 2QTNA 4UHEA 1AMUA 2NO1A 2BSAA 2Q5IA 3NDPA 4JK3A 1I8TA 1BEUB 1YB7A 3HU3A 4B3RB 3OEWA 4KKVA 4DMMA 4CKWB 4JV1A 2GPSA 4I19A 3FGNA 3HI4A 2ZQYA 2R5WA 4JYZA 3Q10A 4WNCA 4E32A 2J9ZB 3NATA 4GVPA 5CH8A 1T5LA 1CUAA 1Q50A 4MDHA 2NPFA 1UK8A 3VZBA 2VF7A 4X20A 3H1GA 2D8MA 4QGGA 4CIDA 1IY1A 2H17A 3C3MA 3U62A 5TARA 3VQTA 4OATA 2ZB4A 4O7WA 4QUAA 1XYVA 4OXQA 2C8JA 3LUBA 5E9QA 4JI0B 5K8UA 1VECA 4YH1A 2JLSA 3AFHA 2RC5A 2CT8A 4PC2A 4CFYA 1UK7A 5DNWA 4QX6A 5BT8A 3K6KA 1NW3A 2V8OA 1MX1A 3PFIA 3WP0A 3QE0A 3ASUA 1ZI9A 5HQTA 3UICA 2WM9B 4ZXFA 2B3TA 4U2EA 4UTXA 2CHUA 4GSLA 4XWTA 5I5UA 4X97A 2D5CA 4E6EA 2Q5CA 1V5GA 4YRPA 2WIGA 3GU3A 1Q3KA 5J4HA 3PUXA 4PIPA 3I52A 1Z4QA 4R2IA 1XDDA 1RAGA 1H8EA 5GONF 4FMCB 2F8LA 3TKAA 5DHPA 3W9YA 3BD7A 4B81A 4DGSA 4BLQA 1A1VA 5LMUH 1Y1RA 4W1SA 1EK1A 3IV9A 3TR6A 2EDCA 4CM1A 3OIVA 2JA5G 1HG0A 1JA1A 1DAEA 2H07A 5DF1A 1JPVA 4G0NA 1XTRA 1OAOC 4DCGA 5JPDA 1RRGA 1J39A 1AUPA 4EHLA 3BMOB 1A0IA 4JV0A 1NC1A 1XLUA 2BGJA 3KO8A 3ZWVA 4F8EA 4RZQA 4Q8FA 4RL6A 1S2IA 4WFKA 4KAXA 5A5FA 1YVEI 1UBNA 4X71A 1GG8A 4AK9A 2P2YA 3AFIA 1DHRA 4PIMA 1NI4B 4DARA 1A88A 2HYDA 2D1RA 2WQ6A 2OXEA 2AB0A 1G8GA 1NYLA 5KOJA 5DXFA 3HCBA 1EWQA 1PW7A 3QX8A 5DHSA 1XQYA 4ZRMA 4OHOA 3BE4A 3LU1A 4QOGA 1MFZA 3B1KA 2EVWX 1PV4A 4EI2A 4KYIB 2XF8A 4Q7JB 3ZI0A 1U0HC 3ZDZB 2IUEA 5CEEA 1CE8A 4MEAA 4DMLA 4UDOA 3IQFA 4QXQA 4ESVA 1QG2A 2HZ7A 3M9MB 5FULA 2IHBA 5L1JA 3G8CA 5CM2Z 3PK0A 3QVMA 4BN0A 4FX2A 1CS4C 1U9ZA 3I42A 1II9A 3L1JA 1XKQA 4WVFA 5T8KC 3ZLBA 4EJFA 3GMDA 4G9BA 1H2ZA 2YHSA 3ZI4A 3O4RA 4BNFA 3BA1A 5HZMA 4JEHA 2QRLA 2VJCA 1CRQA 2F1RA 2FK8A 3WLOA 4XLLA 4BEJA 2O0KA 3CMCO 1HC7A 3EVNA 5IAAA 1G66A 2ORED 2C2GA 3OD1A 3WISA 4ZVTA 2E5LH 4Y1RB 5TEWA 4MRSA 1B6SA 4KIGA 1UZAA 1MZPA 2ZRLA 4ZOAA 1GVHA 3CUWA 3NC4A 1RBMA 1UFOA 2ZRIA 4AC9A 1HDRA 2MHCA 3RGZA 3UM9A 1VJDA 3BHIA 1GTJ1 4ENVA 4CMBA 5ES4B 2DWQA 2B1GA 4CIBA 5EXEA 4PHGA 1U1IA 2CWWA 5A4MS 3EYWA 3WGHA 3TGPA 4DUGA 2KS6A 5A5DA 1SKUA 4M9UA 3FDFA 2G9NA 1QX4A 1J0BA 1S3FA 1SBYA 3SWWA 1CK4A 3CLUC 3ORSA 3WWZA 1W6RA 1J56A 1XFDA 4EQ6B 2HL6A 5B3AA 1V8FA 1P2BA 4P8RA 2XBLA 5DW0A 4AROA 2XRYA 5EYPA 4L4ZA 3FMPB 1BVUA 3SY8A 3O38A 3IJEB 1QV6A 5ITZB 5B7GA 3GCXA 1S02A 3I4MG 1SD2A 4OY3A 1XSEA 3EIHA 3BXZA 4JC4A 5DOZA 2OENG 4IJKA 721PA 1I6UA 4CF5A 5JCZA 3S24A 4FW8A 5KS8A 4EHIA 1KP2A 4LMBA 3EN0A 4O4LB 3BD6A 2REQA 2VP9A 3UATA 1J2RA 1HNZH 2YBDA 5J2UB 4F38A 4URYR 5IDWA 3TG8A 4FBUA 1T6ZA 4Y8VB 1E2MA 4AB1A 3IBTA 3SXPA 1JQ3A 5EMJA 2X6TA 3DDOA 1ADGA 3B3JA 2OAGA 4CNBA 1UIMA 1GU7A 3F2VA 1XDGA 4RHCA 5LD2C 2VHYA 3IAAA 2H59A 5LOVF 2FQWA 4M9RA 4Q4AB 4QODA 2HH9A 3DC2A 2K5UA 4OK5A 4ND6A 3NBFA 1MAWA 4FINA 1N0WA 1P4AA 4BY9E 4C4AA 1YRQA 1GFSA 2OXTA 4AM8A 2UUCB 3F3MA 1UJ6A 2Z04A 4J0QA 4RVHA 4K8RB 3AR5A 1TM7E 4AJIA 3HXTA 4EX7A 5I5GA 2CJFA 3OC0A 1FTQA 4DY4A 1I6LA 1W9MA 3KTAA 4ZVPA 3RBAA 1QDEA 3DWEX 2GFQA 1HE2A 2COGA 3RG2A 3IR6A 4JI2H 3FGOA 4INAA 3CRW1 3NKFA 3OJXA 2EJCA 4LF4H 1HV8A 5EJ8A 2NUPB 1DIAA 2RBKA 3PA6A 3EVDA 3GNTA 3QPCA 4Q00A 2NXWA 4JI7B 1FF9A 2BTQB 3GXBA 5COBA 1PNOA 3M9XA 4L4YA 3PSAA 5GP1A 2NW6A 2OBXA 3N74A 4YJ2F 4NZ9A 5FORA 3WR5A 1KJIA 2WTFA 1U1CA 3KSBC 3ISTA 4HGQA 4ZU6X 3ZQJA 5CIYA 1GZDA 1BMDA 4QEDA 2Z83A 3DKRA 3EUAA 3UJ7A 4B73A 3S2UA 4LVUA 3G9QA 4MWBA 1KK3A 1OYYA 3ZGNA 1OLUB 2ZSAA 4OP3A 1CXZA 4V0RA 4UPVA 3KHSA 3HKEA 1UUFA 1X9IA 3OQNA 1Y14B 2PAAA 4G25A 3DV0A 1PWYE 3LY9A 4BQEA 1VMAA 3WJAA 4O3RA 5FTMA 1RI4A 5KYKA 3KQUA 4L27A 3VNVA 2WOOA 3NW9A 5DM2A 1E9SA 2HJRA 2GRUA 4BMZA 3AVWA 2R60A 4IINA 4MYSA 1XHEA 3NM4A 5K3BA 3T5DA 3DV9A 4DRXA 1U2EA 4AY6A 5LSAA 3N5KA 2IV2X 2JH9A 4YV7A 2VI5A 4PYJA 3DB1A 4CDGA 4DQXA 4QUHA 1QR2A 5J5AA 2KX7A 1LPBB 1X42A 1CJCA 3TB6A 3ZY5A 2FX3A 3NBYC 5GONB 3HADA 2PX3A 2BEWA 1Z4NA 4X60A 1QP4A 2DE0X 1IY0A 4KLRA 1EHYA 1DJNA 5EWMB 4FR0A 4IIJF 3O3MB 4UUGA 1R16A 3BJMA 5J23A 1RXVA 4ISBA 1Z18A 4MGHA 1S8NA 4C21A 5C44G 3GEEA 4Q24A 2MSLA 3G9UA 3OZTA 2NT3A 5IAOA 3V7FA 4LS3A 5BVGB 1A48A 4JBHA 2ZBUA 3E7XA 3T7DA 1GNTA 2IA5A 3O3CA 4YACA 4KYVA 2GQRA 3OPNA 1ILEA 4PCAA 2W7OA 3UAOA 1EP3B 1H05A 2H5JA 4QDXA 1M8GA 1RAEA 1T8TA 1UP7A 1V41E 1EH5A 1NQUA 4TT8A 1BE1A 1A0OA 5DYNA 4JLUA 1QFZA 5L7YA 1L4MA 3A1TA 5EESA 1Z8NA 1DDOA 4EHJA 4N18A 3BGOS 2WSSA 3PFNA 3SSMA 3UYLA 3RC2A 1ZC4A 4QWMA 1Z3CA 3EMDA 1C1DB 2FR8C 3RR2A 1H2HA 1WHTB 2OB2A 3ENWA 4TN1A 2HK8A 4U3JB 2WP0A 5FOTA 3EQ2A 2AE1A 1HBJA 1M73E 5AVZA 2ZRDA 1OXTA 1WHSB 1KIMA 3LFUA 1S0UA 2RDJA 2KJQA 2ID7A 2OUKA 2V5VA 4XJSA 1AQIA 4LYAA 2OKCA 3L1HA 4WZ6A 1C3VA 5JY6A 2N1MA 2RBEA 4P3OA 4BE7B 4MH0R 5HMMA 5DLPA 1YB4A 1FSFA 2GILA 4FZVA 5JAHA 2Q6IA 1Q1AA 1Y81A 3F49S 3OF5A 4AG6A 2ZRQA 3I0MA 2HXGA 3B9RA 3A7EA 2Y0BA 4DL7A 3FDIA 1KAMA 2ATEA 2H9IA 4DA8A 2XT0A 3QUBA 2WJ4A 2OGTA 1T3SA 4GPEA