5BPHA

Crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 96
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bphA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bphA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bphA01
4ZQIA 2QF7A 2GPWA 4O81A 5CA0F 1I7LA 3HB9A 2CNQA 5JH7F 4IWYA 3BSWA 4EA8A 1E4EB 4O86A 4O4IF 4O7YA 3U55A 3WO0A 2HJWA 4MV9A 1GSHA 2GLTA 1VBHA 2IP4A 1AUXA 1EZ1A 3JRWA 4XYLB 2R7KA 4TUYF 3JZFA 3R23A 5GONF 3GLKA 3R9RA 2HGSA 5BMVF 3TIIA 1A9XA 4EAAA 3BFPA 2DZDA 3JZIA 3Q1KA 3VPCA 1OBDA 3MWDA 4EGJA 4GGMX 4C5BA 4MV1A 2YW2A 4ZHQF 2R7NA 2NPOA 1W93A 2FPIB 2FP4B 2W71A 2R7MA 1UC8A 2FPPB 3V4ZA 5J2UF 4I50F 3BSYA 4FFOA 1EYZA 1VBGA 1W96A 1IOVA 4Y8VB 3RV4A 2ZDGA 5HV6A 4TV9F 4QSHA 2VHEA 2W6PA 4I55F 1KUTA 1JKJB 3SE7A 4M99A 5CA1F 3TIGA 1B6SA 3TINA 2YS7A 2WYOA 1Z2OX 4O7VA 5EZYF 4O83A 3Q2OA 3ETJA 2R7LA 4MV7A 4FFNA 2I80A 3I12A 3K5HA 2VQDA 3R5FA 3RV3A 5LA6F 2QK4A 4MV3A 1WR2A 3BSSA 2PVPA 1KJJA 4EG0A 5C1OA 3VMMA 2W6OA 4O7NA 2R84A 3AX6A 4ZI7F 1DV2A 4MA5A 3N6RA 1GSAA 3QFFA 4DLKA 4YAJB 4YAKB 4DIMA 4FFRA 4WBNF 2V59A 4O2BF 2NU8B 4RZQA 3WNZA 2NU9B 1EUDB 4C5AA 2FB9A 2CNVA 1KBLA 3N8DA 5JVDF 5LXTF 1Z2PX 4J6EA 3KREA 2VPQA 5IYZF 2J9GA 4MV8A 2XCLA 2ZDHA 2GPSA 2R86A 3E5NA 2DWCA 2CQYA 2Z04A 3LP8A 3MWEA 1M0TA 4I4TF 5D8DA 3VOTA 2W6QA 5LYJF 1SCUB 2R85A 4FFPA 1CS0A 4MV4A 1T36A 2XD4A 3K3PA 1CE8A 1I7NA 3BG5A 3GIDA 3ORQA 1KJQA 4EABA 5J2TF 4FFMA 4EA7A 5C1PA 2X0SA 3UFXB 5KX5F 4IWXA 4FFLA 2GQRA 4YJ3F 4EA9A 2YZLA 2W70A 1JLLB 4FE2A 1DV1A 2PBZA 2YZMA 3HBLA 5BPHA 2YYAA 1UC9A 4FU0A 4HNVA 4XZ3B 4NYEA 3VPDA 4O7SA 2FPGB 3DF7A 2R6FA 2ZDQA 4O4JF 1AUVA 3TW6A 2DIKA 2R87A 3NUAA 2CNUA 1KJ9A 1C30A 4EGQA 1DIKA 1GSOA 3K5IA 2GQSA 4HR7A 1JDBB 1OBGA 2DLNA 1C3OA 4IZOA 4E4TA 2NU7B 1BXRA 1EHIA 1GLVA 1KEEA 5I47A 5JQGF 3KALA 3OUZA 2NU6B 3VA7A 5CB4F 2I87A 3AW8A 1KC7A 1EUCB 4O2AF 3WO1A 1M0WA 1VKZA 4O7ZA 3TQTA 3RFCA 1B6RA 3V4SA 3LWBA 4HQ6A 4ME6A 3R5HA 1IOWA 4MA0A 4M9UA 3KAJA 1CQIB 4MAMA 5DMXA 2W6MA 1JDEA 4WD3A 1M6VA 4O4HF 2V5AA 2W6NA 5JQWA 4O7TA 3JRXA 3RUPA 4IHJF 3ORRA 3HO8A 2PN1A 2V58A 1Z2NX 4O7WA 4IIJF 2C00A 4FGRA 1CQJB 1KJIA 2VR1A 2W6ZA 3U54A 3ETHA 2YWVA 4L1KA 4YJ2F 3R5XA 1BNCA 4HNUA 1PX2A 4ZOLF 2NUAB 2YRWA 5HBRB 3MJFA 2OLSA 4O7LA 3U9TA 1E4EA 4XX0B 2YRXA 4O4LF 2YL2A 3KAKA 1GGOA 5LP6F 5BPFA 4C5CA 4O82A 5K2MA 5CAEB 2CZGA 2YS6A 5KKNB 4M9CA 4M98A 5FNVF 1ULZA 4HNTA 5LOVF 2YZGA 1A48A 3OUUA 5JVLA 4MV6A 3U9SA 3G8CA 4YB8B 4O7RA 2Z02A 4O84A 4TV8F 1KJ8A 3VPBA 2R82A 5H80A 3G8DA 2SCUB 5C8YF 1PK8A 2YZNA 2P0AA 4YBZB 2I8CA 4XYMB
chains in the Genus database with same CATH superfamily
4EYKA 3ZDYB 1YZUA 4MR7B 1Y1LA 1NQTA 4ZEWA 2WU4A 3DEJA 3HZOA 5I7VA 1U2QA 3RW9A 3OJFA 4BEJA 1EUYA 1S1MA 3RT9A 4QFBA 4X7RA 1SIUA 4RIIA 4KXXA 5E3JA 2NVWA 4X66H 2VA3A 3HRKA 2EDAA 1G5TA 4YUAA 3WLMA 4CQLB 2W2LD 1QFXA 1A98A 5BY2A 4HAWA 5FOWA 3AEYA 5JT1A 4J0GA 2UUAH 1Q14A 1S1CA 3QUBA 2OFOA 3W6PA 1PT9A 4JY7A 1N1GA 4WZZA 4DR7B 1KQNA 4H27A 3PFWO 1V48A 2BN4A 1P4HA 1GAEO 3ND9A 1JL3A 1G60A 2P77A 4P3NA 1Z4PX 4G2NA 3HB7A 2O3UA 4FEYA 1ANKA 1CQWA 3F1LA 4GR5A 4KAAA 4X3PA 1EGAA 2EIYA 5KWVA 8GPBA 2FLWA 3E1KA 3THYB 4QG3A 2ILTA 5DP1A 4UCRA 1WXDA 3RS7A 2O1SA 5KSOA 4P7KA 3TI9A 4ZTZB 3QEOA 3K4PA 3G2OA 5HFAA 1RNLA 1QGAA 3OM0A 4QJ4A 4BV3A 2ORED 3EIUA 4WBNF 1KJZA 2DVMA 1OLXB 4IJMA 5PGMA 2XZTA 4GZ6A 2ZGIA 4RTJA 4EK9A 1RRGA 4NOJA 5FTMA 1QRUA 5JARA 2FF7A 4YRFA 4BFXA 2VNKA 1V3VA 2NUTA 1VL6A 3H04A 1ZZEA 4HN4B 4ED7A 2VA2A 3L2PA 1FFBA 3IVAA 1C8LA 2OFPA 3U4GA 3H1BA 5CLGA 4KK3A 3OCZA 1SCUB 2DLDA 3NH6A 1OHHD 2AFHE 2C2DA 3GAAA 2E5LB 1BDMA 4TLLB 1RHKA 1YDEA 5TMDA 3L8EA 3VC1A 1T9DA 1QF9A 4A0SA 3R40A 2W43A 2C9MA 4OB7A 1LPNA 1W4BA 4II3A 4P22A 1VKNA 1NAHA 4O25A 4IW3B 4DHWA 3FRIA 1XJWA 3TUJC 1S0NA 1CYEA 1NXTA 1KZ7B 3DMRA 2Y4RA 2JA8G 2H4WA 3KDSE 4M8IA 4U7WA 3LUJA 4TMZA 4CL2A 3GFSA 3UXEA 4RVHA 4Q4JA 3LNCA 1P3DA 5ECDA 3LKVA 1AV7A 1E2BA 5K3FA 4MJXA 3S29A 1FUYB 3KTAB 1Y1TA 5HE9A 2CEKA 3QPBA 3WLOA 4BFVA 3LF1A 1WCV1 1JHPA 2WDTA 4K6HA 2JEYA 3MWJA 1KEEA 4RCNA 1AXRA 3KHTA 1OYOA 1J8DA 1MQ9A 1YR1A 2QLJA 3PXAA 3EZGA 4B6JA 2JI8A 3B9QA 2FW7A 2D74A 3R2JA 1V35A 3QQ5A 2JFXA 3QLTA 2REBA 1T94A 1VM6A 5DCUA 4XCXA 1W5AA 3HEBA 5B36A 1N6RA 4JUBA 5IJWA 3O5AA 5FXMA 5CBPB 3MBKA 5AVSA 3E8MA 3IP3A 5AJWA 4UE6A 1XQ1A 5F9HA 4FCTA 3UZOA 4MRSA 4TL9A 4A2AA 4C4ZA 1CW2B 2QTBA 5AKKA 2RCNA 1U28A 3A3OA 3M4XA 4F8YA 1P1KA 3H1GA 1RYEA 3QEBZ 5EIHA 5BSHA 1ZH0A 5EVCA 2B4YA 2YV5A 2C94A 2Z3ZA 1N92A 3GFFA 2HK8A 2Z1DA 3QE0A 2WNIA 3HJRA 3TB4A 3ZY6A 3EXAA 3PLNA 1V25A 1O6ZA 4MQFB 1KP3A 1PVDA 2VUMG 1USIA 2F2TA 2CWWA 2Y99A 2OTCA 2ECKA 4C4XA 5CPFA 3VKGA 4ED2A 3I2IA 4IWYA 3LFTA 4HDRA 3AL2A 4G5HA 1ST2A 3H6GA 5IKPA 4E13A 5JQGA 2R7KA 5KJ6A 1UH5A 2PT5A 3VHXB 1LSJA 2BBSA 1T6BY 3TG8A 4JWKA 2EQ5A 5AMXA 4UM9D 1N78A 3VDXA 3PE6A 3A9UA 5HF5A 4OKNA 3FAZA 3LX5A 2UVDA 3RRBA 3IJPA 4G1VA 4MWEA 2PZEA 5AH0A 3V7NA 4FHCA 4YROA 1P1JA 1SUDA 4V0NA 4X3CA 2P67A 4Q37A 1GR0A 3M4YA 1WDMA 2AIRA 2I34A 4QNMA 4NP6A 3VKUA 4ZAFA 5LSAA 2HU7A 1QRDA 4X0EA 2D5CA 1NPYA 1XWFA 4QNNA 2VHEA 2OXIA 1I3LA 1HOTA 2VUIB 3EVBA 1OAOC 1WXFA 4TRJA 5BSGA 3WKBA 2W5UA 1KZYC 4BVKA 1ESCA 1U1EA 1YNSA 3R20A 1IXYA 1NJ5A 5MGNA 3IRUA 1XGKA 4TRNA 4B43A 2VQEB 3WZLA 5IWAH 1JEAA 2JNWA 2Z1MA 4DXAA 2PD3A 1NNEA 3DLCA 5FI0B 4DR5B 3QGMA 5SY9A 4TSKA 4ECYA 5DYYA 2ZAOA 5E6RB 1H2BA 3N8GA 3O1JC 2PAAA 2JGIA 5C51B 2D59A 4KSCA 3E9NA 4GM0A 2B5OA 1WV1A 2YWGA 1VLVA 2HA0A 4R8UA 3W5VA 2FU5C 3DL2A 4HRAA 4PM4A 4P7GA 1E3QA 1A8IA 3WK6A 4P83A 3U1BA 2Q4OA 3WK8A 4KO3S 1JLLA 4CKZA 1MW8X 5K6TA 1B0ZA 1VIVA 1ARZA 3QW2A 1XJ5A 3EY4A 1QDLB 5J23A 1V5IA 1BH2A 2FPXA 2XWJI 1KHHA 2I7DA 1SU4A 5BYKA 1L8OA 4CKBB 1BMQA 3NEAA 1I7NA 1ZJ5A 3I8XA 2C20A 1N3LA 3RUFA 2AJBA 2IC5A 3WGNA 1FSFA 1YS1X 1M1XB 1SVMA 4FFLA 1JFVA 5CR5A 2VF7A 2H2FA 4H1UA 3UUGA 2B8WA 4ZAWA 4J3NA 3OZIA 1RYBA 2XTMA 4YMUA 5B7GA 4NU8X 4BUZA 3N2IA 4M9XA 5BN5B 4J6FA 2Z5LA 2YICA 1RAAA 4UZSA 1XA3A 1YK1A 1JQ3A 1X0XA 3LWDA 2UZ3A 4TOIA 3H1EA 2BHRA 2VVTA 1B74A 1D03A 4DWOA 4D4MA 5HK9A 1PGJA 5BNFA 2OUIA 1T35A 2AH5A 2MMCA 3K8YA 3OQIA 4RACA 4S1WA 3K6KA 4FFDA 4D4JA 5ENVA 4LQLA 2V5VA 7ADHA 1R2QA 1EB8A 1C3JA 1W73A 4JJGA 2FSFA 3GNQA 1GYRA 3GD5A 2XVAA 3AESB 3WYCA 5HK8A 4K9MA 3RSZA 1QGDA 3TZKA 1CJSA 3HWX1 4PTYA 1TT5A 2PKRA 4JJKA 1KVUA 3ZHXA 4RHEA 1XZDA 1Z4LA 4J9NA 1CQJB 1H8HA 4UATA 4L5JA 1KMHA 1MBZA 1NQUA 1ZJ6A 1M0EA 5B1EA 5HQJA 3H2JA 1EAMA 3ZXYA 1O4VA 1NVTA 3DNPA 2KI5A 3I0NA 1RC1A 3IODA 1CQZA 2UVPB 2QTWB 3TQSA 4QW9A 3H87A 4L7VA 4LOAA 4GX2A 4EECA 3HCBA 5PNTA 2N75A 3H11B 4FDMA 3SX2A 4F9TA 2WAQE 2VZ8A 3QU7A 4G41A 3T99A 2YZNA 1NJSA 3PUJA 3F0TA 2VNSA 1U11A 5LNK6 4EA8A 2IXBA 1CKNB 2G28A 3TSZA 4FNGA 3HOYG 3LUDA 5KEIA 4YHHB 1MO6A 3VR6A 2Q0HA 1V6AA 1ZGGA 4LDZA 3RYIB 4XJTA 4TXMA 1SXIA 1NF2A 1JPNA 2R00C 1FDIA 4FFBA 4ECWA 5B1DA 3NBAA 4KVGA 2H00A 2Q7XA 3SSAA 4JI5H 3R9KA 2XT0A 2FNAA 1XLUA 1U98A 4MPTA 1DJMA 4RNMA 1RE0A 3V2UA 3HVRA 5K8UA 5L3QA 5CDHA 4M1QA 2FETA 5A4AA 1TJYA 1SVWA 3KKMA 2XQVA 1O2DA 2XWPA 2PUBA 3B7PA 2R6DA 4M37A 2G17A 2GXSA 2Q2WA 1OX6A 1EVEA 4PW0A 4F4FA 4RPIA 2FJ0A 4OSOA 3NHJA 4ZO9A 3LUKA 2CMFA 1KI9A 1Y1VA 1D4FA 4IQFA 2Q7OE 5FV4A 3R7FA 2I2BA 3AH8A 4MUGA 3DB1A 4J8PA 2CW7A 3ZV5A 3WKCA 3CH6A 3AP3A 4DBZA 1WMBA 1OSNA 5I5GA 2ERCA 3L79A 3W4JA 4XYEA 1I3OA 4X60A 4FDTA 3K1TA 4W1PA 4XYBA 3A0RB 4BVEA 4N9QA 5CDYA 4FB4A 2IHZA 4RFLA 1I2KA 1MJ5A 5DNYB 1PJRA 4QJBA 4GXRA 3E9QA 5LXTF 5JYBA 2QAGB 5FR9A 2GWHA 5TPZD 3E81A 4KIFA 1ULBA 1ZNZA 2O7RA 4ENVA 5MHTA 2XA1A 2WR8A 1Q92A 1GPKA 5JSZA 3MWEA 4RSMA 2LIPA 1U3GA 2WF9A 1TW3A 2H1OA 4AMYA 3MVEA 1TFRA 4BNNA 2QYSA 4BYGA 3P19A 1CQXA 5EP2A 4L9RA 4M21A 3JSAA 4X66B 1QTRA 3H1TA 3QVXA 4D42A 3IVMA 3SPXA 3KOUA 4M1KA 2QVXX 1D0SA 5LD2C 5D86A 2VAMA 1S2GA 3R6TA 4TTJA 1O8BA 1NU6A 3I9FA 2JLWA 4Y6PA 2UUAB 2P27A 4F1WA 3QBJA 1ZCZA 2Q6VA 1DEHA 5A5VA 3CLTD 5EUMA 1TAEA 5DPMA 1WCIA 3E05A 4PF1A 4BN4A 2XODA 1I5RA 4B76A 1KJ9A 3GT4A 3Q7QA 3LUPA 3OQVA 1NVFA 4F56A 4AN0A 1QVZA 4A6DA 4CKWA 4KQJA 1NXSA 3C5WP 3HB1A 1FX0A 4WBNA 4K9RA 2BR0A 3AP1A 2O52A 1K4KA 3EG9B 3RR2A 5AW2A 1R0KA 2I22A 4PCUA 4BFCA 3D5QA 2WLSA 2AKYA 2ZRMA 4PLYA 1P5FA 2JJ2D 4MJ7A 2NTNA 3A0UA 3QELB 4UXJA 1JHDA 3PEVA 1U2ZA 1ECGA 2DC1A 4EENA 5ECYA 5JQWA 4B3SH 4F97A 2LW7A 5TNXA 3OCCA 1SHJA 3RBAA 2V9ZA 1HQDA 5DQGA 3DE4X 4GR9A 121PA 3O2SB 1E4GT 3HA5A 2JBWA 4KBYA 3TD2A 4DC1A 1WS6A 3AG6A 1P1CA 3IMFA 4Y7CA 1HO3A 4IRKA 3D3NA 4D98A 2XXAB 3W6NA 3P2IA 3ZVKA 4RM3A 3TQHA 2RKOA 5TY0A 4QHSA 4M9RA 3ZN2A 2QY9A 5JG7A 2OLKA 1E79A 1XMIA 5FLEX 2QMZA 3S55A 1K5PA 4NI5A 1GFSA 1YL7A 2Q62A 4FYIA 1KY5A 4KQXA 4B6GA 4CDMA 3C8UA 4X1IA 2WY2D 5E38A 3R6WA 1IIBA 2IKSA 1H3FA 4C2UA 3RC9A 1N2CA 1FUIA 3K70D 3OJXA 1R10A 3ZE7A 2C58A 2WM8A 2GAOA 2C5AA 2AE2A 5BWOA 4YECA 5ED4A 2JGAA 1BYUA 2WIJA 2GCOB 5GV8A 1S96A 1LDNA 4C87A 1SA0A 3I6MA 2AEJA 5CITA 5DSTA 1CF4A 4R8KA 1TMOA 1W9MA 2HK6A 3DDZX 3KLNA 5ELXA 3BPSA 4JT8A 3K15A 4F5ZA 4RULA 2IMWP 4QGHA 2XKBA 5EJ5A 2CSUA 4KRFA 4CMKA 2G9RA 2OA0A 5TXGA 3VVBA 1KIFA 2QL5A 4DQLA 1GGKA 3QKSA 1R9NA 3I1FA 1XZAA 1YMUA 2ADMA 1DOZA 5JY6A 2OCIA 1W4RA 1BSVA 1KO8A 4DCMA 3WI7A 1KK3A 4D6XA 2WG0A 2O3TA 4OPMA 4HQ0A 4EW6A 3WQHA 3ZE1B 3SXUA 1KFEB 2Q3BA 4JI4H 1GCGA 3HZRA 4UHJA 1MGPA 3TD9A 2FZGA 3MT8A 2DSNA 5KYUB 4S1VA 3X1ZA 4ZCQA 1RI1A 3UPDA 2ERYA 4GKAA 1FMTA 2XE6A 4FYXA 3R7NA 4H0NA 3L8CA 4HWPA 5DCYA 5KKCA 1IHUA 6LDHA 5AIAA 1NJFA 4X7PA 2HHJA 2AWOA 1GKIA 1T2FA 1TZMA 4A6PA 2JL1A 3PDUA 1Q1ZA 4F8JA 3C1UA 2F62A 5FUBA 2EG9A 2GVDC 4PEVA 4KAFA 2P9HA 4F12A 3L7IA 3MIZA 4AL4A 1KDTA 4OYHA 1Z38A 1XV5A 4JITA 1IZ7A 4IR9A 3G7NA 3TW7A 3IUYA 2ZJ6A 2C9YA 1QANA 4AP6A 4R8LA 2RIRA 1UDAA 3R3ZA 3WWYA 3VC2A 3HOUG 3HU5A 5H9WA 1V5EA 2RGGA 3WYEA 1P0QA 1PKXA 3RBEA 4XVQA 5KMGA 3FNQA 2E55A 2BHTA 1U0GA 4WHXA 1RLOA 3M2TA 2HMSA 2W2QA 2V0NA 2WHPA 3IQFA 2X5XA 4C7OB 4PU0A 3PHCA 5AM1A 1I2CA 4KQGA 2CNUA 1C30A 1V8BA 5KTKA 2DFNA 4GPTA 5LQRA 1KY3A 4HDSB 5IWAB 2COKA 1J8MF 2CVPA 3ZKWB 2WU8A 3CLRD 4E7PA 4L73A 2RGBA 5CB4F 4N0QA 1MT3A 1T8RA 4DMGA 4S0ZA 2Q5EA 2YN0A 1P7ZA 4M0JA 3NLLA 3OHAA 2NV2B 2A5JA 3I4CA 3WJAA 3R5HA 3B6ZA 1L5KA 1UMBA 4ZZ2A 4UQPA 2X4IA 4G36A 4D43A 4FGSA 2FZCA 5HW0A 4PBRA 1RVDA 1DNPA 1HDYA 3JV7A 4Y2UA 3R5KA 5C44G 3GIKA 2AZ4A 1ZGJA 3L1VA 3Q85A 3H5RA 4EKNB 4D8YA 1Z6TA 2ZYGA 1Q20A 5LP6F 1N33H 1T0BA 3CMMA 3IKVA 1UKBA 1VDMA 3UYLA 2VP2A 4WAUA 1IB6A 1PR1A 3NOVA 5LZ8A 4I1UA 2PZKA 2WT4A 3B2EA 4PAWA 4C0SA 4FVTA 2DF8A 3IDZA 1TW2A 2XSZA 3KJHA 3AUTA 4C0JA 5AM5A 3ZGXA 4ABYA 3ELDA 2QTCA 3F2IA 1GP2A 4HFJA 5HMMA 1WZEA 1JEEA 3FDZB 3GCGA 3E58A 2B6NA 1MTZA 2ZBGA 3ZWMA 5L7WA 4JXUA 1P80A 4TYQA 4Q9IA 2F43A 2HNKA 3VKFA 4YCLA 4DLYA 1GWNA 3OWHA 1X7WB 3T7EA 2RC5A 3NDPA 4KYTA 5BMVF 2Q2VA 3DMDA 4J0IA 2GN8A 4C0WA 1N56A 2HPZA 2L0XA 3GXOA 3CJRA 4XVHA 1DDOA 1DMSA 3ZD9A 1J1UA 2WSIA 2JIPA 1P18A 3C3JA 5J1SB 4FYVA 1VE7A 2AFHA 1INLA 4E08A 4ZT2A 1W19A 3O8DA 3W90A 4AMBA 4CEJA 4UCFA 2BFBA 4X7BA 5DNAA 4R6WA 1NUSA 4PZ8A 5LL6b 2C3OA 5THXA 1O0CA 2YQ5A 3HKEA 1OBCA 2F9FA 2E4AA 1EBUA 3UHOA 4MV7A 2X5NA 4XR9A 5AVQA 1WSCA 2PT6A 4BYMA 2PGDA 2G4CA 3TNJA 3KAQA 4NAUA 3R5JA 5A4IS 3AF3A 1GNLA 1NJGA 4BP1A 1S3FA 5C1OA 3UFBA 1ZH6A 2HYIC 3S4YA 1XXHE 4JC8A 4O6VA 3OQHA 3KLPX 1L4UA 2BGMA 3RYTC 2HK7A 4C5AA 1TXGA 1U3FA 4I08A 1DWQA 3HC7A 4P5EA 1KTIA 3O4VA 1UBHS 3Q40A 3HJNA 2JFOA 3EAFA 3HLKA 1ZJZA 2ZSDA 5JBQA 4HYQA 4WLEA 1N2ZA 2V7WA 1XFDA 2HT6A 1GPMA 4FMCB 4IXTA 3FFWA 3HGQA 3CRZA 2AUNA 3QVWA 1KGSA 3AHGA 5H0IA 4BLRA 4C21A 3L05A 4JI5B 2I1WA 2OV6A 1NN3A 1QIMA 2E21A 3LHDA 2B5VA 3L1KA 3HU3A 4EKEA 3IP8A 5REQA 4IR7A 3CF4A 5AW7A 4TUYB 3JD0A 4LYGA 2XRYA 2BSQA 2XDQB 5IDYA 1U7UA 3LPLA 5L95A 3L07A 1M67A 5G0SA 3JYHA 3WB0A 1QUFA 3CRQA 1A0OA 1SKAA 2VPZA 2P8SA 1NWCA 4NOKA 3ED5A 2NPFA 5A3VA 3LDHA 2QTVA 3DAFA 4M9ZA 3NUAA 2DFVA 1NOKA 1H4VB 1D09A 2XGOA 3H4IA 1BGXT 3OSUA 4RSHA 1WCYA 4BZQA 4BO1A 1RI3A 3RVRA 3ILHA 1BXRA 3B51X 2NYAA 4L28A 3UMSA 2Y77A 3EZ2A 2V8OA 4U7TB 4TGLA 4Q3DA 4KJXA 2ZBPA 4JI2H 1ZNWA 4GOJA 3KVOA 1Z83A 5LXTA 3HA3A 1RQPA 1W0KD 3BA6A 3QTTA 3FPBA 4TMVA 2IVFA 3W2EA 5ALKA 3GAMA 4RMJA 3ZDDA 2WT9A 1KP2A 3DEFA 1ZI6A 5CM2Z 1EVZA 1JILA 3ZWQA 1BDHA 4K6FA 4DL9A 2DT8A 4MUKA 4CCWA 3GUCA 3FE2A 3AYXB 2HMAA 5FWXB 3GBSA 3QMVA 5FYQA 4FD2A 2JI9A 4HB2A 4UTRA 1IY8A 3LD9A 4EO4A 3QA3E 2HHAA 4JEMA 2CXTA 4EB0A 2INGX 1X9HA 3L1JA 1M6VB 1AC5A 1MORA 1V3QE 4FS2A 1KEPA 5EKTA 2BFCA 3W4IA 2XE4A 2GPJA 4EBCA 3W9YA 3X1JA 1GUFA 1A5AB 5CJ2A 2OM2A 5KFUA 1ICEA 2Q27A 3HB9A 2MDTA 1Z0DA 2REOA 1LJ8A 3DL0A 1NY5A 4HI0E 3PQDA 2Q8NA 2OV2A 1N2GA 4MOWA 3ITKA 2HREA 3GCWA 3FPAA 3ECCA 5CFZA 1VMAA 1PL8A 2ZIFA 1RKUA 3WGMA 5BWXA 3OPYB 3WL7A 3D6NB 3P4UA 2XBLA 5ES3A 3FKQA 1W93A 4DQDA 1ORTA 1ORHA 2ZUTA 1TM3E 1GG8A 1EE1A 5B1IA 2F1KA 2H9IA 2W8BA 4ON9A 3WWJA 5C7IO 3E7PA 5E8JA 4B85A 4BQSA 4EHBA 2OFXA 5J58A 3NHFA 1QGED 5HIIA 2YN2A 4B81A 2YHIB 4M1EA 3CUYA 4B3SB 4P36A 2XYRA 5IT5A 2XGPA 1TVKB 2WNSA 4LW8A 3R0IA 1QO0A 1LF5A 1PVVA 5KFTA 4YX9A 4WCFB 4H3KB 4JS0A 4FYPA 4QEZA 3I8OA 4DREA 3E9EA 5C8XA 4R3NA 1Y8CA 4QLAA 4YT5A 3P2JA 3M4IA 1H42A 1SD5A 5FOXA 4Y2YA 2A57A 3THRA 1PDWA 2BQRA 1L5HB 1DTWB 2OAEA 2R44A 1QP7A 4UPDA 2F3UA 1S0UA 2DCUA 4MUNA 4CG0A 1JVNA 3F7OA 5JVDF 4JK3A 1YR6A 1QQTA 2C82A 3LPCA 2FV8A 2NTJA 5D6NA 2R7ZG 4EYIB 1P44A 2ECPA 2ZB4A 3VPAA 2R0QC 5EQFA 1XUOA 3I0MA 2AG1A 1HFWA 1NZFA 2VF5X 3FR8A 4AULA 4EP1A 4XZ3A 2QZSA 1OTXA 1FS4A 1UMDB 4HNQA 2C4HA 2AYXA 4LVCA 4PGGA 2VAXA 3WWEA 3BG5A 3JQAB 3A4IA 1IHYA 3ORQA 2VDPB 3WSWA 1GPUA 3T3MB 3SKYA 2BKAA 4RUCA 4Z4QA 3WWZA 3C5CA 1S7CA 2IOFA 2JFZA 4UTOA 3M4ZA 4O63O 3G0OA 3ZU5A 7ABPA 2XMZA 4IDDA 3N39C 2C31A 1U0HC 3PSHA 4LS3A 3OLZA 3RGWS 3SR3A 1IRIA 5CFOA 4F4WA 1FFXA 5DM60 2MYPA 3EOBI 3FYSA 4P0PB 2EX0A 2L17A 1WCXA 3QY9A 2O6LA 3I45A 4PZZA 4B8WA 5CYOA 1LDGA 3C6YA 1N6LA 5DM4A 3AB3A 2WAQA 6Q21A 2FVYA 4EGQA 1F7UA 2M1ZA 4L27A 3OM8A 1FY2A 1G8HA 4I7EA 4ETWA 2JATA 1E1KA 3PFHA 2X15A 3EEOA 4RB3C 5TIIA 4RTKA 1OLSB 1PIWA 4JI4B 1TAHA 1VJGA 4NJOA 4FB5A 3LQQA 1Z17A 1M0WA 4OAPA 2ETVA 4P4LA 1B6RA 1MKYA 3BDIA 1RYSA 2GYYA 3T5GA 2R6HA 1TKBA 2G5PA 4V39A 2VQSA 1JIIA 1R16A 3K9QO 5I5UA 2W9XA 4RD3A 3GV7B 5CM9C 2ZSUA 1JFTA 3QLEA 1UBOS 2OHOA 5K03A 1CR0A 1SQGA 1LK5A 2ONKA 3BH7A 4ZWNA 4I66A 1MABA 3OPYI 1C0LA 1IK4A 3VJMA 4EG8A 5D1OA 1XA4A 2DBRA 2HCJB 2WWIA 3MLAA 1AGNA 1KVSA 2VQ6A 3OUTA 3ODPA 5ICSA 1NR7A 4BJHB 3MEQA 4WNAA 4YPVA 3FMAA 3GWGA 4GL4A 5DLPA 1F8GA 4XOUA 2X8AA 3UM9A 5IYZB 3S3TA 3C70A 5EQDA 3AGPA 1K63A 2HRQA 5J43A 1P1BA 4ARZB 1WUJS 2DQYA 2FEPA 3D3WA 3FUXA 4HNSA 4N01A 5DRTA 1IWPB 2O19A 5ETJA 2E49A 3W3ZB 4MX8A 2A78A 3KTMA 2PWBA 4A6EA 1UT8A 1ENOA 2OCAA 2P9FA 1I6UA 5G3YA 4PXAA 3R3HA 4U2GA 3DF9A 4KPGA 4OQNA 3ZZ0A 3KHLA 3KEOA 1JSLA 1K3TA 3TSWA 5AJHA 2C04A 4LFAH 2OHGA 3KLBA 4ZEOA 3E61A 5CB4A 3HDTA 4ZYZA 3EA5A 4QDUA 1TKCA 2QRPA 3W8FA 4OHUA 3QMPA 5A5FA 4QTTB 3ILSA 1YGYA 2L2QA 1ULUA 5A1TA 1LSUA 3DG9A 3WAJA 2PBRA 1GTJ1 3A4NA 3M5CA 3G6KA 4D0RA 3ETLA 4JKYA 4PN7A 2XBMA 5L9AA 2DMRA 2JKVA 4MGHA 3JALA 3DTVB 3TLXA 2X42A 3SKVA 4IDGA 4KPFC 1U31A 5JAHA 4L3VA 4C0KA 2BBWA 2R7LA 5LP6A 3AHJA 4MLPA 5E2BA 1ONNA 3I12A 3LC7O 3RV3A 3CIFA 3NM6B 2Y8EA 4ARAA 1E6WA 4OHCA 3U3KA 5UKDA 1CR6A 1N33B 1W48A 3K4HA 3AVUA 4I9GA 4YRCA 5IC6A 4J07A 4ZOLB 1HZZC 1RE1A 5SZIA 1XU7A 2IBSA 1QKJA 3UYYA 2NN3C 2VZ9A 4JB3A 4CG2A 2GZ2A 2HVRA 1NOIA 3PGKA 2VSOA 1B33N 1X14A 1Y4AE 1Q17A 1GIAA 1VCOA 4JSYA 2G77B 1YB2A 3R74A 5BMVA 3RVOA 2J5XA 4KWCA 4RXUA 4ZXPA 3UWSA 3QHQA 2ZROA 3JVVA 1JVBA 4HWTA 4RTQA 1SELA 1C3XA 2WSYB 1NE7A 5AOAA 4BJ3A 3RG8A 4EABA 1JR3D 5CA0B 4BMXA 1FYVA 1RKXA 2V55B 1AQ6A 3OE7A 5JH7B 1TWFA 1FJXA 4MCJA 3TTVA 4DVGA 3DP7A 3Q0IA 3OPMA 2Y1OA 1ZNQO 1YRYE 3MAGA 4PLCA 3HB0A 4Y2TA 3KQPA 2NYUA 3IUNA 1I3QA 4OOFA 2PBZA 1IYDA 2GXQA 3LVBA 3HBLA 1O75A 4ZO7A 4M53A 1OZ0A 4FU0A 4DG5A 2VOBA 5HXAA 3EW7A 1X1DA 4WK4B 2FZLA 2J3DA 4GC6A 4YA6A 4ECRA 1E7SA 3AEUA 2IP2A 3CWQA 5CCEA 1Q7CA 4A8HA 3DV2A 4QBHA 1RPJA 1PV2A 4Z7OB 4DWWA 3KVRA 1Q7RA 3H0GA 4HTFA 4R8MA 2HHFA 1Y7TA 3HCFA 4YHBA 1D2GA 2MOKA 4A3EG 2H8GA 4KO8A 1MOQA 1RYYA 3IBSA 1JAIA 3ZD8A 3KOOA 4FHZA 2HADA 1DRJA 5ES4B 2W2KA 4HO1X 2AA3A 5KPDA 4CEIB 1TAUA 1ESNA 4QZVA 1Z5NA 3T9EA 1FJHA 2HJSA 2IHBA 3UJ8A 2HIVA 1A8QA 3PJRA 1QJ4A 3UGTA 2HPHA 3BF8A 4ASUD 1UJNA 1RZRD 3TOXA 3LOPA 2AQ4A 3DHYA 2R8IA 3EDYA 3GLSA 3RYHB 2RHCA 3KTOA 2D62A 5A1JA 1L1FA 4HRVA 1N2SA 1B93A 4DCNA 3MSCA 5DHTA 4MINA 4Q39A 5JDIC 3OTQA 4GM1A 3LYHA 2P0YA 2AK3A 2DWPA 4HH0A 4ZVSA 3KT0A 3FJYA 2HA7A 4JJFA 5I5XA 1FP4A 5T4FA 2AD1A 2COGA 4BMZA 4XKJA 3JCZA 4GOMD 5KJEA 1YZGA 3ZLTA 3NEYA 4MW7A 4IFBA 5DYGA 2O57A 5IULC 1A7KA 3H9CA 2ZEJA 2MHCA 1SCAA 5AK5A 3AR6A 3H9QA 1NM5A 1PVOA 2BDUA 2NO4A 2OAQ1 4ZQIA 2HCTA 2HIGA 3O9VA 1TQ8A 2FPIA 4QXMA 2H0RA 2J6HA 2V4ZA 4CHTA 4S0XA 4UHFA 4O2BA 2XECA 1ZPDA 4HADA 3EMKA 2EF0A 3FWYA 3E82A 4YIKA 2ZYIA 1CIPA 1YE8A 1UJBA 1C4WA 1TTTA 1DOHA 1BWQA 1J99A 2OT3B 5IAGA 3KS9A 1SVUA 1OBDA 3FCOA 1K1QA 4JI2B 5FI5A 2EP5A 4PX3A 1ISRA 1AQUA 3KZXA 2O0HA 1AHPA 4JQSA 3AQ4A 3RS9A 3QMWA 4K2AA 4OIFA 1SQSA 4Q4HA 2C59A 3MMPA 4Y8VB 2CNDA 1SBNE 4DR1H 4FMDF 5DG8A 3D8BA 1I3MA 4AP5A 2Z09A 5JNLA 4R2WA 5I7UA 1J0DA 2HRBA 2R60A 1BA2A 1U8FO 1Q7GA 3K0AA 1TIKA 3V8PA 3DJYA 2JC3A 3D3JA 3TEMA 3G85A 4A73A 3E4DA 4I4LA 4X85A 3ZCXA 4IO1A 4DPMA 1K89A 1RABA 3O95A 4RKQA 4DCCA 3WICA 3R9XA 3M6XA 4GQBA 3ZGYA 4WXRA 3U3RA 4Q45A 4BUCA 4H4DA 3CUSA 2EEZA 3USES 1DQRA 2YX1A 4M0KA 1PYDA 2CUNA 1VL8A 1VJ0A 4NFSA 3LTEA 1YZTA 3EG5A 1KWKA 1GG5A 4L2IB 1KYZA 1M8FA 2BJHA 1JP7A 5KWJA 1PO7A 1VJCA 2XQIA 2RK4A 4DLNA 1C7FA 2YUIA 3TIFA 4HKTA 5HUHA 2WHYA 2DWQA 2C2RA 1N8KA 4CM4A 5FI1B 4HZUB 3N76A 3A1DA 2WJIA 3DBHB 2EBWA 5FX2A 4RVCA 3JAMA 4O4IB 5IH3A 1Y3AA 2HTFA 4MS1B 2GQRA 2PMKA 3OTIA 3OD1A 1KBQA 1Y7PA 3ZWCA 2FK7A 4JYBA 2XCAA 3GJRA 1U8UA 2MWMA 1QE3A 1AZTA 2JA7A 2RFLA 3DXFA 3BACA 3GIMA 3AJRA 3QPUA 5DT2A 4J03A 1GGNA 4QXRA 4KR6A 2ZRCA 4ZYXA 5H59A 4BPBA 4YCNA 3DH0A 2VSNA 1ITZA 1QV9A 1JR4A 4LGVA 4MGEA 2R6FA 2EX1A 5LWHA 3TW8A 2ZE6A 3RCBA 3SX4A 2R87A 3PW7A 4QGSA 1RXCA 4RZIA 1UAAA 4QBGB 3RT7A 4ZFNA 1KRXA 3OFJA 1TM1E 1JBQA 2ATEA 3GRAA 3KQYA 3UK6A 2WHRA 2IZOA 1TQ2A 1IYZA 2V7EA 4BJ6A 4RNCA 3P0EA 2VYVD 1N2BA 1SM4A 1JG1A 3FPEA 4U02A 1OIVA 2Z5VA 5JVDA 5BSRA 1G19A 4LJRA 1MAVA 2FLLA 1J23A 3I3OA 3JASB 1G64A 4WX2B 2C22A 5AI4A 4N6GA 4FOSA 4OH1A 3FPKA 2ZBVA 4MSUA 5DXAA 1EE9A 1QOQB 3PDJA 3AY3A 4ZQGA 3KV1A 2JJYA 4UNQA 3HCCA 3B1KA 4Q7LA 2ORYA 4NH0A 4MV5A 1XSEA 1X1TA 4QELA 4WN9A 4M7WA 1TEXA 3DEZA 3GJSA 4XGRA 1C29B 4L72A 1W36B 1AUOA 3L04A 5FD5A 3K1AB 4JFAA 4BP9A 4O7LA 1WG8A 5TQJA 5HP4A 1GL3A 3EVZA 4HPWA 1CEXA 4G3XA 1X1AA 4D74A 2BCJQ 3TLYA 4NBKA 1W5TA 1DI0A 2JI7A 5LOVF 4ZVQA 2ZJAA 3HXTA 1XTJA 5ALIA 3D6TB 3S24A 1JQEA 2QZPA 1DG9A 2H4YA 4I50B 3F6YA 5EXTA 4UEQA 4ZT5A 2D7DA 1QRAA 4EG1A 3M83A 1XXHA 2WTUA 4TVIA 4DB4A 2B0JA 3OLCX 4OJYA 4Y6LA 4AIRA 1P0CA 2HWUA 3H9BA 4Q34A 5KFQA 3DS8A 3EF1A 4HVLA 3NI2A 3WIEA 1VL0A 2CXRA 2Y1LA 5L7YA 3LXUX 3KZOA 4ZODA 1K06A 4P3XA 4BE9A 2A2ZA 1KYYA 1WMSA 1QGYA 1BW9B 1BU5A 3NT5A 3SIWA 1YXMA 5EMMA 4KQWA 1E0AA 1G4UR 1TTPB 1FNBA 3U3MA 1BEUB 1VCIA 3IIJA 4DLWA 3HMKA 3KJGA 1YI8A 3PXBA 5BW5A 2XTNA 4PYLA 4PCAA 2IYQA 2XQJA 3O8LA 3V6JA 5KX5A 4TV9F 1X38A 5J4KA 2D0IA 2ICAA 1W1IA 2AR0A 1HLFA 1KZ4A 3ICCA 5JI2E 5LNK1 3DL4A 3TIGA 3FDFA 1RM0A 3FM9A 4FILA 2PL5A 2M6RA 5L53A 3TJZA 1XWWA 4NJMA 1JECA 5LUAA 2AN3A 1YB4A 1E3EA 4UTVA 1FU7A 3IP6A 3SHQA 4RZHA 3B2NA 4ND7A 3GRCA 4O4HB 4Y1EA 3CVVA 2OHIA 4FDAA 1SUWA 4ZYYA 4P80A 3SF0A 4D8TA 2BZ1A 1R8YA 2HGZA 2REQB 4NR0A 2ZBFA 3IV6A 2XGJA 1RRCA 3GLVA 1GZUA 5TF0A 2A1IA 4U6QA 5BOSB 1ID1A 1TEZA 3FYDA 4ECTA 3ZV6A 4HJXA 5LU8A 4GW3A 4R31A 2R1VA 2EJUA 4OM7A 1W87A 2YNMA 4KOAA 5IAEA 4L9AA 3KBOA 3MFHA 5IT4A 2E5FA 3CW9A 2J7PD 2UAGA 3RU3A 1EFRD 4OKIA 2HLNA 1V16B 2G8NA 1ENYA 1GKLA 4HNGA 5DGTA 3SZOA 5F33A 2R86A 2GJAA 2DWUA 1YIAA 2C96A 1UXJA 1T4CA 1D2EA 1URPA 2FSVC 1TO2E 1GL9B 4LFAB 1XMVA 3GLGE 4NVRA 1S2NA 1YOBA 2VFAA 4H1TA 4E0BA 3BE4A 3P32A 2H4HA 3X2FA 2W9CB 3MS7A 4K0KH 1JIQA 2J3IA 3H99A 4JUCA 3I5AA 1GYPA 2Y67A 1O58A 2OWEA 5BV7A 3R8CA 4RY2A 2J1LA 4XLZA 2Z98A 3WIBA 1VLQA 3TSYA 1JS1X 1PW5A 2IE8A 3LY5A 5I5TA 4RA9A 5C32A 4LV5B 2PGXA 4KFRA 1DLJA 1ZHHA 5HGXA 3JD2A 5CH3A 5FLXA 1GQSA 4D7AA 2C2BA 4GRAA 3OMWA 4LJ7A 5IH7A 3HJFA 4C07A 5JAZA 1A4UA 1V5GA 2J0UB 2SKCA 2J59A 1FNSA 3PNPA 1HDCA 5C3MA 4LXYA 1KKLA 3S40A 2YHUA 1YZ3A 5D3KA 4GBED 1VLLA 1N0UA 1YH3A 2JFHA 3V46A 1G9SA 3CV3A 2E1PA 4J7XA 4G2TA 3AXTA 3H16A 4ZK6A 2X0NA 4OXRA 1PL0A 4D9GA 3RHFA 1DINA 2BTEA 2MIIA 4Q7KA 2CLDX 1NV9A 4XM0A 2P2LA 2GEBA 1O4WA 3X1XA 1PJAA 4PX5A 2N9UA 4QYTA 1OXTA 2HF8A 2NYVA 3L6BA 3RH0A 2VKTA 2I4TA 2EFDB 4NJEB 4BVGA 1U94A 2FPMA 3IDQA 3PC7A 2CMHA 4K81B 4X6LA 1EG2A 2QPOA 1WIWA 2I2XB 2ZI9A 2GK3A 5TARA 4TVOA 4RNDB 4M38A 1JYFA 3WK4A 4C2BA 2GM5A 4DQVA 4O3PA 5A9SB 1KR2A 1EA7A 2BH2A 2AVDA 3SEFA 3GJ4A 5EESA 3M70A 2A9QA 4HAOA 3H2BA 3WFZA 3D6FA 4JJ8A 1L8AA 2PMEA 4IOLA 1MO4A 1KNQA 3NIBA 3VOSA 1Z2DA 4RBNA 1Z6XA 4Z1MA 2O8EA 3S8YA 3I28A 2O03A 4O59O 1QFJA 1EZ1A 2JCXA 2V6FA 3WHPA 3D9QX 4Q21A 3TN7A 2ADFA 4JLNA 1FA9A 2PSEA 4UJ5A 1OKKA 1BQEA 4DSTA 2AUMA 3L7NA 3R3VA 4BGDA 1O1YA 1MNQA 5F1OA 2IBTA 5I3CA 3O4HA 4GBJA 1GEEA 2OHJA 1QG2A 3AF1A 1A2KC 1KTAA 3S2GA 2EKDA 1XPOA 2X2PA 3IPRA 3V1NA 2B34A 2BF7A 1QFZA 2GD1O 3HRHA 5L3SA 5M29A 4MWZA 3BSYA 2J6BA 3UAGA 2G7ZA 5IUJC 4MI9A 2R62A 1MVLA 3AHIA 4PSUA 4B0OA 2WWRA 4ALMA 1G98A 4BCBA 4R1PA 3O84A 5ALRA 3VH4A 4ENTA 4PZ0A 2ERXA 4NS4A 1E6KA 1UDWA 3EA4A 3MG9A 5EIBD 5M7EA 1WHTB 1UK8A 4ARVA 4QDJA 4BO7A 4RW0A 1FPMA 4U2BA 2VQDA 1JIVA 3S28A 2P9CA 3FPGA 4FOOA 3FJOA 3IXMA 4NCIA 1MV5A 4HNAB 4LWPA 5KFLA 2WQZA 2PUJA 4HGQA 4KDFA 2H7XA 3RHSA 1CC1S 4Z5XA 1Q1GA 1GSAA 4BO3A 4YJ2B 2CK3A 3EVAA 4KJZA 1YD7A 1LBIA 1FRNA 2NU8B 2YZ7A 4GZ5A 2O50A 2PLAA 4AICA 3C6MA 1C9KA 4D9NA 4D4LA 3IPYA 1V3TA 1M2WA 4RAQA 4BASA 5IJ0B 1UBMS 4E6NA 3GTJA 3KHKA 3ANSA 4L6AA 4LF8H 3LT2A 3MM4A 5DBHX 5JCXA 3DDWA 4E88A 4WJZA 1SXJE 4WSOA 3Q5DA 3PQFA 4Q02A 1OXXK 3H2GA 3A1NA 2V6IA 3KWFA 4JYCA 2ZT5A 2DPIA 1K8ZB 5CK4A 2JAPA 2Y1WA 3HCNA 3CLKA 5KG0A 4DQKA 1DT3A 4DDVA 3L1HA 1HYBA 4UNNA 4LF7H 4B09A 4H7HA 2VXBA 3CZ4A 4JGIA 2ZCVA 3PU6A 3DLTA 2ILVA 4W8GA 3M6LA 5CTAA 1ZXBA 2QRMA 2X14A 4L57A 1QX3A 1EIWA 3NDRA 5KFPA 2VG8A 2DT5A 4Q93A 4DR1B 3ZIDA 1ZI9A 1T5HX 2PMWB 4BO5A 5BN4A 1GTMA 2I76A 5AUNB 4B7UA 4QPCA 4PAOA 4FIZA 2VKQA 1CK4A 5J9FA 5JPCA 3EQ9A 2CHFA 3NUQA 5IP7G 5JD3A 2UUOA 4B4KA 2AW5A 2EGGA 4KXQA 1QH9A 3GMTA 2G7MC 4K03A 2X2EA 3UJDA 2PZMA 2X5RA 3P0HA 4LXXA 2VZEA 1RQXA 2V7VA 4FJ0A 3OFKA 2VK4A 4JXZA 3I6IA 1OZFA 3TQTA 4EBDA 1E18A 1UDCA 3MTBA 4ONEA 1DT5A 1ORRA 1R0ZA 2X19A 4ZYLA 3CO5A 4Q48A 4EUSA 1KRWA 4M8NE 2C0CA 1ESDA 1P73A 4HWKA 4KQEA 2IXTA 1GFWA 1Q7EA 2C00A 2BM9A 4O8ZA 2FWJA 4LX0A 3P0RA 1QYDA 3HPQA 3BZUA 1CU1A 3G0CA 3W2TA 4Q47A 2JFGA 5ILGA 1Y5RA 4URFA 4Z0HO 1MX5A 1JWLA 1QKIA 4K86A 2VHQA 5BNIA 4TTAA 3NYWA 1X92A 5CAEB 2WNHA 3AY6A 5JUWA 3ICOA 5LQJA 5K3WA 4EYQA 3MUFA 2C7OA 1X1EA 4JI1B 3D0OA 1U65A 1G6HA 1VCMA 2WC1A 4Q43A 3BWYA 4HDOB 4HRYA 3KHSA 2Y4NA 1IBCA 1VKJA 4NCBA 1T5SA 3PA8A 3K9GA 5A6SB 2EKZA 2FR0A 3ZD7A 3R7SA 4G8DA 1DIRA 3HUFA 1E60A 3WGQA 2GNAA 1PZEA 4PTLA 3BJEA 3L3BA 4CLXA 1A9XA 4ND8A 2WUGA 4FI3F 3CWCA 1P2TA 2YV2A 4KPUA 3Q1KA 2G0NA 2CT8A 1I2MA 4Y30A 5AI9A 2DJIA 1FMCA 2QR2A 2A5FA 2AFVA 3REGA 3PJDA 5IVIA 1P6UA 4CTMA 2EKLA 2VRWA 3DCYA 1TA0A 3SY8A 4ZVUA 1ZK3A 2OMEA 5KG2A 3MPOA 2G25A 3NO4A 3CW8X 4RETA 2ZJ7A 3EXG2 2FZKA 4AZSA 2WB1E 4IGAA 4FQ5A 2VJKA 1KJNA 5JRZA 5CB8A 2A30A 4YJFA 1IN6A 1P77A 4DLAA 3G5LA 4EY7A 5LM3A 4BCCA 5FRDA 4CMBA 1Y8RB 2CNWA 2YH2A 1DELA 4WZBB 4A8JA 3CRW1 4LSAA 4MQLA 1F9EA 5LOVA 2XB4A 1PUIA 5LZ5A 1D9ZA 3GGJA 1J5PA 1Y34E 3Q87B 4H35A 3W79A 4M1TA 5EWMB 3TLGB 3MPUA 3ZE2B 2CZCA 1M5UA 1UBKS 3NT4A 5CYFA 5BWNA 3CVUA 1UFRA 1Z26A 1YJBA 4QUBA 5DM1A 2HR1A 3RFUA 3BORA 1ZIOA 3C8MA 3CKKA 5GINE 1J21A 1I50A 1YTLA 1YA6A 5JWOA 1QQ5A 2JHPA 4UBKA 2WBLC 2R85A 3RUHA 2YY6A 1X2BA 4MV4A 2WSSA 3SXJA 4A2PA 3ZXUB 4XQ9A 2FW0A 1H5QA 2C7BA 4Q18A 3ZC3A 2PY6A 3AHDA 3DMTA 3MMXA 5BT9A 3OOYA 4RM2A 2GKSA 3PR1A 1MHTA 4TV9A 1BJRE 1RPTA 2GPYA 5EP1A 1GTG1 1LNZA 1XMJA 2O0MA 3O1IC 5FFNA 4LHXA 2ZU6A 3R76A 4ANFA 3CPHA 3FPFA 3OHPA 1ZN7A 2VZLA 3GGSA 4ID9A 5LQKA 3KQTA 3BXPA 3KIPA 2PJDA 5C46F 2MSCB 3G79A 5EEGA 4Q1FA 4EB6B 5BWRA 3OU7A 1SXGA 2BE7A 2PPVA 4OMCA 3QWBA 4ISBA 1EHIA 4DUZH 2JS7A 5JS8A 2B63G 3PNMA 2ZPUA 4IINA 3AB8A 1BS2A 3A8TA 2LVBA 2BONA 1I4EB 2HIHA 3THWA 2QMHA 3ROZA 1B43A 2KE5A 1QB7A 4J2OA 5K0TA 4G24A 1HDGO 4JYMA 1AGRA 1SU6A 3PT9A 1ZRHA 4LMRA 4LVNA 2JCGA 1MOZA 3WLKX 4RFSA 2FZEA 1L7PA 2GZSA 2IW1A 2MR5A 3SQDA 2RGWA 1MV8A 2ZI6A 4MITA 2QKYA 1VKOA 2QRQA 2MU1A 4BNJA 2B2CA 2PUWA 4EZBA 4KNVA 1JAXA 5HBRB 3RTDA 4AWXA 2YZ2A 3FNBA 4E1AA 4LCEA 4O4LF 2P3LA 3IILA 1JLSA 4DJDC 3EMDA 2JB9A 3EIHA 5HIMA 2WV7A 2C4VA 4D0LB 4K0KB 2ZTLA 2NUPA 4IVPA 3SEAA 1YA8A 1M8JA 2ONCA 3GU3A 4NCAA 4XJVA 2ZZNA 2P2YA 1DXYA 4IKOA 4MVJI 1AK1A 4EJSC 3JVUA 4DV2H 4ZVLA 2FMHA 4ALIA 5JD6A 4YRMA 3VO2A 1GL6A 4E2YA 1I4WA 1Q7BA 4YPOA 2IUSA 3BSWA 2VDRB 2BTQA 3DKRA 1IAQA 2Z30A 3AQIA 2WAAA 3IPAA 2GKOA 5F21A 2H52A 2OPHA 4HJRA 4YV2A 2VJCA 4X8HA 1QGUB 1SEVA 1PS8A 3GA0A 2FTKE 5JU6A 2IUEA 1KI1A 3TCXB 3JQGA 4KWHA 3KJEA 4OGFA 1KYWA 3KQKA 3N42B 4BMVA 2MINA 3JQFC 1YS2X 2J3LA 1DC8A 1LC3A 3QBVA 5J2UF 3UMMA 4MR9A 2QR5A 1AKEA 4WADA 1JXQA 2WJ4A 2QRVB 4TT3A 5FR2A 1WRBA 2PX4A 3I3SR 3SQMA 1JXMA 4D57A 1YS6A 4Z99A 3PR4A 4Q1VA 3Q7PA 1VLMA 3PC3A 2ODNA 1X7HA 1I7DA 2UXCH 2PWPA 4LG1A 3EH2A 5JD4A 1NUQA 1X8XA 3N43B 1KI7A 1S2MA 1Z39A 2GFQA 3JS5A 4YGXB 2KBFA 1NATA 4RCZA 1G8GA 1OXSC 4D8VA 1HNWH 4A7PA 2C57A 4J1TA 4KIGA 3N0TA 1N3IA 4WK0B 4INPA 1Z6QA 2OD7A 3ENKA 3INYA 4O2BF 5K09A 4RPJA 4D6PA 2P6OA 4V2UA 3GQBA 2QL7A 3VOAA 2IXDA 1RAHA 2WJHA 1K86A 4F5YA 2XADA 3DUFB 2R8OA 2DWCA 2ZJ4A 2A5DA 2FQQA 5C18A 4ZAGA 4R16A 1GPAA 2C2MA 4L0MA 3HYNA 4WMLA 4H7KA 5B57C 5E4JA 3TDKA 4PNEA 4GD3Q 4OKSA 4QWCA 1GGMA 3JYPA 1YJ8A 4XLTA 4BXOB 4HP8A 3KPWA 4FOPA 1X9NA 2IU4A 1NBWB 2QZ4A 2A67A 2P9GA 1Z8FA 1RQLA 4EJFA 1FP2A 3NKVA 3R75A 4JUAA 2WFAA 4E5SA 2C9ZA 4EJ6A 5C1BA 3HQ4O 3CX3A 4A3IG 2NAFA 1L7XA 4HS9A 1YE3A 1ISHA 2DTDA 3DPUA 3K1YA 4NIMA 2J8ZA 4RHXA 1VYUA 1G7RA 4ZZ0A 2TMYA 1R4AA 5F3WB 2Y2VA 2CUKA 1MPTA 3VYWA 2G9UA 3TCNA 3LFUA 1JJVA 2QXTA 5HKBA 2FMTA 5G4LA 4BXXG 2QN7A 1MEJA 4DLBA 5ITWA 1BX3A 1J0CA 3TNLA 3PLAE 1L8XA 3KWMA 5DBIA 2AOVA 4KW7A 2RGNC 4PE5B 3R0ZA 2Q4RA 1J20A 2YIJA 1Z37A 4RZXA 1KXZA 1W88B 3DTYA 3FOWA 1JEDA 1ACJA 1YVRA 3UO8B 5F9MA 3ZDRA 1ISMA 2CB0A 2VDWB 4DY4A 2O2ZA 2PZLA 1Y6RA 3W2FA 1KAGA 4KUGA 4GLXA 1BC5A 1NR1A 2JLCA 1DEOA 1Z28A 3BT7A 2W6MA 5ENDA 1WLSA 1RWXA 4CU5A 2HZ7A 4QIWE 1M6NA 5EC8A 2O8CB 4J4TA 4LF8B 3ND7A 2P4SA 4HDKB 3Q9LA 5I8PA 2QV7A 3U54A 3OEWA 4RKWA 4ESHA 4U7PB 4D97A 2NVUB 3TPZA 3IESA 2D3WA 2HMTA 1QIGA 3CNLA 3FMFA 2UU9H 2HBQA 5AW9A 1T1GA 1YULA 5DX8A 1XEWX 1X0VA 3EPJA 1BMFD 2WTFA 5E9QA 2IELA 2OMKA 3RIEA 4LF7B 2CMGA 1MO2A 4QA9A 3L43A 5FUVA 4WXHA 1HR0B 3IDOA 2IVZA 1GCOA 4KCGA 4LFCH 1MXFA 2LIVA 4DNPA 1QBKC 1GCIA 2QF7A 5KJ1A 1I33A 1L9KA 5FV7A 4N7MA 4G01B 4O1HA 1QNLA 1A97A 2VPWA 4B82A 3UB2A 2Z56A 4GLFA 4IUBS 2O3RA 4YJ3B 3AWIA 1U7HA 4O7YA 5IN4A 3ONDA 4AURA 2AL7A 1IE3A 1ZD2P 5YASA 4B44A 1U0OC 3K30A 3AZQA 2J45A 1PWHA 4MCIA 1E4FT 5JNTA 3KL2A 5HZGA 1CZUA 4GRDA 4C88A 2CNNA 4DLUA 2HSEA 3GLGA 3P9IA 4IZIA 1NURA 1KZGB 3BA9A 1U0JA 2ZIXB 3NHWA 5B1HA 5AM3A 1O95A 2JEIA 4E2WA 2ZWAA 1AA9A 3P9NA 1UEJA 1YJAA 3C6ZA 1TWGA 3MCAA 3MJCA 3AYHB 5IVPA 4YQFA 2JLZA 3NAZA 1V2HE 3AEQB 5FP0A 1TVEA 1FE8A 1UMCB 4QO8A 4S2EA 4HGYA 1T5LA 16PKA 4JVLA 4RIEA 3AHHA 1CIVA 2PQ0A 1UJ6A 1UOPA 1EZ4A 4S05A 3ZW9A 3OLVA 2H31A 4M0MA 4ZTBA 1XU4A 1TGYA 2PMCA 3CRRA 4R0MA 4LJ9A 1ELOA 3FFXA 1EINA 3W9SA 3UXYA 1PYGA 3D3EA 4XRGA 2HKIA 3ZD6A 3JYLA 4YV7A 1K4MA 1CJUC 2GASA 4BTVA 4OFBA 4Q4LA 1M2KA 1N7HA 4MI1A 1XEXB 2ASJA 4XD7A 2DHDA 4RY9A 1W5BA 4FXPA 4K6MA 5EZ5A 5GGXA 3JD1A 5B7QA 2Y92A 5KX5F 2JGEA 4C30A 3GV8B 3EVTA 1RWWA 1FIUA 2O2YA 4B8YA 3AFOA 4J2TA 4YAUA 4ISCA 2DFKB 4NEGA 1QAMA 2HXGA 1RWOA 1VPWA 1IOLA 1T0HB 1ZG3A 1RWQA 2VWHA 4YUYA 3NJ4A 3FZEA 1OYWA 1XZGA 1UAYA 3B52X 1PG0A 2VBFA 2RH9B 1KAOA 4NFLA 2GFHA 5ILQA 1N25A 4UUPA 3ZHZA 4KC0A 2EIXA 2P9BA 4HN9A 5GVRA 1MNAA 4NE7A 1Q84A 1FK8A 1VMIA 5C7LO 4B4UA 1O96B 1VE1A 4OMUA 5EERA 4HV4A 1VHJA 1FFWA 4ND4A 3NEJA 3OZXA 3BEDA 5CA1B 3G89A 1L4HA 2Q5QA 1Z75A 1IN5A 2PS3A 3IEPA 1PEKE 1GPH1 1K88A 4AMVA 4W6QA 3A6FA 4HYYA 1E2GA 5HS6A 2CF5A 3IVCA 5FWYB 4DSAA 3AKCA 5E1OA 1NF8A 2WSLA 4E2FA 4BGUA 3QKUA 1GAQA 4FBLA 1J6UA 4EHLA 2PN1A 4ZI7B 4NATA 5KPJA 2EJ3A 3KL4A 3RC3A 2C35B 2GSWA 4TL6A 5G1PA 1ZNXA 3EPKA 1RQNA 1XRQA 2AK2A 1DWOA 4UBJA 1L3IA 1CUEA 2V5UA 4L6IA 5A0TA 1ZD4A 2XVZA 3RHTA 5IARA 2OG2A 2O1XA 3MTIA 3H9JA 2H11A 5IU6A 1XJQA 1EXMA 4IHQA 1NQVA 4DG9A 4G3IA 3LWZA 5KDOA 4RENA 5BXQC 4Q6BA 4RLHA 4G0VA 2P4UA 4AU1A 2EWWA 4ZZ1A 1R6AA 2WPDD 4WFJA 2J33A 1QLWA 4ZT7A 4BO6A 4FLFA 5LP6C 2XCIA 4KXWA 1O0SA 5KYYA 2VJMA 2UYYA 4UUMA 5CVDA 4YRIA 5JNWA 2F17A 2HWWA 5ERYA 4M1OA 3G0BA 2ZETA 1QORA 3KYIB 4M6WA 3M1IA 3ZW8A 1H2ZA 1NQXA 3SVLA 4IO0A 1AMOA 4EMBA 4FQ8A 2XYQA 1BVHA 2N3ZA 4DUZB 4D3XA 3P9ZA 2HBRA 1SXJA 2RGYA 1VI6A 4YRSA 1M7HA 1XQ6A 4QOFA 1XCLA 3G6VA 1AV6A 3EW9A 5AKHA 3U2QA 2WMNB 1JJBA 5B6PA 2CCKA 1Y80A 1C14A 1HFJA 3JD4A 3LUCA 5DSXA 1PJTA 3W2HA 3ZI4A 4AP9A 5AHRA 3N2YA 4R1QA 3O6VA 2QDKA 4FM9A 4JZYA 2HXYA 2F3QA 3M9XA 3NV9A 4E12A 3RUCA 4O4LA 4MWSA 4L8GA 2D1QA 5ER9A 4F4UA 3TOVA 2Q9BA 1PSDA 1J24A 2GN4A 3DAYA 5EUQB 3RIXA 1CCWA 4MV3A 4ZDKA 1E2UA 1EQAA 4LBYA 1RIFA 4TZ6A 1WD7A 1RWPA 4TTTS 2J41A 4IR1A 3U7QB 3Q12A 1ZCAA 2IYZA 2HW8A 4ATNA 1YQWA 3FFBA 4MAFA 4MDFA 4YAKB 3PJEA 1IL0A 1ZQ9A 2PU5A 2JG3A 3IQHX 1J22A 3RFFA 3D5EA 4DV2B 2FMFA 2QTFA 4UZEA 4QFDA 4FT4A 4B3BA 1YT5A 1XALA 1KEWA 5DI3A 2ODBA 4EPRA 5BWTA 3NR2A 1TCAA 3B5JA 3C7AA 3VOTA 4X1KB 4J94A 4FFPA 4Y6GB 3LHSA 4G9GA 2Z95A 2BLLA 1ML3A 2XKKA 2ID9A 4FFSA 3ABSB 4YJHB 5J2UA 2WFLA 5EJ4A 4RZUA 4TKLA 1MX9A 1PJQA 4ZQFA 2IOHA 4UEKA 4G5QA 1E2KA 3RG2A 3HL0A 1Z73A 3EDCA 3RF6A 1QC5B 2I3AA 3PL5A 3J7AC 4HQNA 3BAFA 2QRNA 3NP7A 3CN7A 2PPLA 1UMKA 2R1UA 4KQCA 1NN5A 1CE8B 2MSDB 3DBIA 1OUMA 2UXCB 4UMEA 1KQFA 1OFVA 1XZIA 1CJVC 2D13A 2X0JA 2GN6A 4TYNA 4H4CA 1ZSVA 3JQ7B 2EIHA 3ZJTA 1KJYA 1HNWB 3QKRA 5CM8B 1JJAA 4KMSA 2B36A 5A2QA 2QX4A 3LCJA 3FYCA 3RSGA 5DGHA 1ECBA 1IDOA 1DC5A 1HY3A 3AV3A 3W5UA 4L8LA 1EH5A 3CFYA 3HJAA 5L3ZA 1CEQA 2VP5A 3RRFA 4IX9A 5IDWA 1I2DA 3BMNA 3IAM6 1KS2A 3JQ9A 2VJDA 4YRRA 1XVLA 5FHRA 3PD0A 2ZWOA 2HQRA 1EFPA 2ONJA 5T6MA 2IIBA 1U3UA 1EWKA 2PO7A 3D1LA 3HY6A 4FBMA 3NFYA 1ZICA 5JYEA 4B4OA 2WB1A 2OLEA 5IXYA 2B30A 1J2YA 3HVIA 2YV4A 1EWQA 3CJQA 3DBRB 4AJNA 4N0PA 4QM6A 2I4OA 2OQVA 2X6RA 4M8SA 2VPYA 1CG6A 4MV6A 4F9EA 3ZDBA 2XXBA 1N5MA 4LZPA 3H18A 4GR4A 2I66A 1HFKA 1M1YE 4YJGB 1V8ZA 2GDZA 5L9XA 5U4XA 1WHSB 5MF6A 3JQCA 5KWSA 3EGIA 1T6NA 1PJBA 3MGCA 4GG1A 3K2BA 2HDHA 3FNIA 2PQ6A 1CY0A 1GDDA 4IDBA 1BX0A 3O2QB 1N3YA 2ZE5A 1VPEA 2Z2KA 2ZREA 4INOA 4MS3A 3E15A 2BFEA 4E5YA 1UM9B 1PK7A 3ANLA 4UUGA 3ADPA 5FUMA 3AO0B 2I2FA 3LHIA 2EYQA 5I8ZA 2IXAA 3MTEA 2PSDA 2BR5A 4TWAA 1DRKA 1BKDR 2VJPA 3T4XA 4E46A 4BEWA 2Z2ZA 4AN1A 3L0ZA 2JGDA 1FFSA 2Q29A 4N0DA 3G0DA 4YAGA 1GPNA 3OU6A 3NBZC 4GDFA 3GDEA 3L6OO 1XCGB 5EIEA 2QQ0A 1N7GA 4E30A 1N2EA 3P45A 3HUDA 2C2KA 4JI1H 3UTCA 3CQZA 2WYOA 1JQDA 3CEHA 2Z4TA 2YTZA 1B41A 1YC5A 1DXQA 2DM6A 3ZZNA 3DC7A 4RV9A 5HIAA 4MKGA 3CKLA 1IVYA 1CJKC 5A05A 2PG3A 2Q5LA 2UU9B 1U28C 1DOAA 1XC7A 3HA2A 1LWNA 2CJPA 2UYHA 4IIJB 4OXXA 1U5BB 1T3GA 2GX6A 1UPFA 3PXXA 4FYYA 2FSIA 5EJ6A 4XGQA 4MVWA 2V59A 1L7VC 1ZD3A 1XDZA 1P8JA 4C08A 1JHZA 2GCNA 4LFCB 1N9GB 3ORSA 3V7FA 2WIBA 1MFZA 4WJLA 1M2VA 3VISA 4J9LA 4F04A 4JLVA 2CKMA 4U9IS 5G0WA 4H9GA 3R0VA 3L4SO 4TYYA 3CVWA 1QP0A 4FGWA 4QQFA 1RYMA 3W9UA 5A7FA 2FPGA 1JU3A 3ESQA 4BO0A 1O77A 3WAGA 2PUDA 4Z1OA 2DTXA 1K8YB 5JAMA 4LPKA 4C14A 1J4AA 1EXNA 3O3MB 1YVDA 1E6CA 1F6DA 3M1YA 2BFPA 4I1YA 4MVJH 3WMFA 4RVFA 1TB4A 3FB1A 3OEHD 2ZJYA 2EGUA 3IUMA 5IC5A 4WA7A 3TEKA 1NJ8A 5FUWA 1L4EA 4LF4H 3ROTA 4FGUA 3SX0A 1C9YA 1LI7A 3N8NA 2WTAA 1XLWA 4XPIA 5DE3A 5FYDA 5EWFA 1VRCA 5B3KA 1J7JA 4RSGA 2BLNA 1Z8NA 1D9XA 5CDGA 4UEOA 4KWEA 4E4TA 4ESEA 1UZNA 4PO3X 5JMPA 4I3HA 2ZAGA 1HWYA 3S1AA 4YLEA 1NRJB 1CERA 3BXOA 3DFIA 3DFMA 2MCFA 5F7XA 1GA6A 3RU7A 4GLJA 1RTKA 1KETA 4FR2A 3AEKB 4TZKA 1U9IA 3O4RA 2N42A 1XO1A 1ZXLA 4TWIA 2XCUA 3LHFA 2X9GA 2MSKA 4ZQEA 2HIAA 5DBGA 4EW1A 4BAGA 2GEJA 3D81A 2JVJA 1CQIB 3BRWD 3FVWA 1MP0A 3RK4A 5B2EA 6ABPA 5CCBA 1PTKA 4PPGA 1TLTA 4ZQBA 2XMBA 4LYDA 1JJFA 3NDBB 3EPPA 2QYTA 1KIAA 4ND5A 1IZZA 2YWVA 3A9VA 1E7MA 1A9TA 3TEFA 3MUEA 4G37A 4PLWA 3QY0A 5IYCG 4BEBA 4UMDA 1R50A 4EKDA 1PJ8A 3UV7A 4V0ME 3W7AA 1NW9B 1W581 2W8LA 4GHWA 1I1KA 4BAUA 5BWCA 2KLBA 2V0GA 2XVXA 3GEHA 5LD2B 4BKRA 4UBIA 5JNSA 4MP6A 4WZAB 5CH5A 2QN9A 2IEBA 3F5FA 1EJ0A 3R3XA 4O7RA 4J0EA 5TF4A 2YC4C 4D92A 3QLUA 4KI0A 1GQQA 1Z74A 3DEHA 3SC6A 2IF2A 1OX4B 3OTWA 5AUPB 2ZFUA 2HA6A 3KFXA 4BRWA 3SGIA 3UQ8A 1LBHA 3L0IB 2SICE 4D9EA 1OA1A 2JA1A 1PR2A 4AROA 4YQEA 1AKNA 1WEKA 2C2OA 5KZMB 1F20A 1ISIA 1JT2A 1RHQA 2XAUA 1JE0A 1PEYA 1VJ5A 4ZHQF 5DGBA 3EGXB 1EGHA 4P53A 2HHHH 4P0TA 3DBLB 3OESA 1T8WA 3VU9A 3EGWA 2DHRA 4IYRA 1XAHA 1UQRA 4OHWA 3CZAA 3A31A 3C85A 1E96A 1LFDB 1NMZA 4IIEA 4J9SA 4Q24A 2NYRA 4LNAA 1EX1A 2O1WA 1Z29A 2IYRA 2VWGA 2JLUA 2IITA 4MYTA 2Z6VA 2NTVA 3RAEC 3ZQ4A 3DYVA 3K32A 4TMFA 4BFYA 4BFLA 3SZMA 3ZU6A 2JW5A 3IELA 2XEXA 4YGYA 3CE6A 1PFQA 1WPRA 4OSEA 3OO0A 5L6LB 4YV1A 2XDAA 2R68A 4EEQA 2IIVA 4FYMA 5U1PA 1Z2EA 1XKTA 2JFPA 5KFJA 1PNOA 5DXJA 5CVUA 4PFJA 1IBMH 5CB0A 3WHLA 2HLHA 4O0LA 2PUFA 3NBQA 5B2ZA 2RDIA 2KPOA 3ZX5A 3PDWA 4MV8A 3ZZUA 4W6ZA 3GRRA 4DCOA 3AR8A 3FYHA 1V6CA 3WA6A 1IG0A 2IOYA 1FC0A 4QYIA 3SC3A 2OEPA 1LFAA 3IXLA 5IMBA 3N3BC 3FTPA 3L46A 5DIFA 1P6XA 2A35A 2X8JB 3FCEA 4QIWA 5CE8A 4MLZA 3AF6A 4KXFB 1H69A 1AKQA 1RBZA 1FFHA 2QP9X 1KJQA 1GL7A 4MKFA 3KJZA 3BA8A 2BE9A 1EWVA 1BS9A 3I52A 3UK2A 1C80A 1C1DB 2VTKA 4C7XA 4UASA 3Q6NA 4EPXA 1J49A 1QK3A 4Q8EA 5ALFA 4EA6A 1QK5A 4YMHA 2C2XA 1KOJA 5KQMA 3L77A 1PUXA 1EK1A 3BABA 4L8WB 4KQFA 5B4VA 4D9KA 2IUFA 2PRKA 1XRMA 4UAJA 3WYBA 3M6UA 2G1AA 1OWMA 1PS9A 4WEQA 4Q1BA 2BEWA 4OHVA 5FL7D 1GSOA 3L4BA 3QWFA 1L5VA 4LH6A 5BWWA 4HFRA 1BCRB 2C83A 5EN4A 1DGQA 2QD5A 2DQ4A 3OZ7A 4W5TA 2CDBA 3UZUA 4ZCIA 3TZCA 2A0WA 3SZUA 4LRQA 4UVDA 3WAKA 4NU0A 1SN7A 4TM5A 1N48A 1WDKA 5EWJB 1G3IA 5HM6A 5CFRA 1AKTA 3QTBA 1XPUA 3STXA 3HTXA 5I5YA 1ZRSA 2IGTA 3D1JA 1QG4A 1P2GA 2HMUA 2MTBA 2B8EA 5T57A 1OI2A 3ZIAD 3VAAA 3PYXA 4D3ZA 4UJ3A 5B4UA 5FWNA 1U3VA 1JQJC 2PNJA 1YRAA 1B0PA 4X6XA 4DMRA 3J81A 1NGSA 1AB5A 1CNEA 1X1SA 3M8KA 4RTMA 4YBZA 4WESB 4CYMA 2DPXA 3FNGA 1G2OA 3WB1A 3SZRA 2HRRA 3EGCA 5DCWA 4XEUA 4OB8A 1JQAA 3ZJYA 4RGQA 2RI6A 2AN1A 3IQIX 2JJ1A 2B37A 2CLMB 4HNTA 3M82A 1I0ZA 2Q0SA 1CIJA 3WBJA 4QT4A 4KEAA 2GRJA 3R5SA 1JZQA 4BVHA 2PS9A 5FUXA 4KLCA 3A58B 4PXSA 1FFCA 1NBMD 2I6FA 5KFRA 1QCYA 4E22A 1ENZA 4PRLA 1USGA 1AQIA 2H3HA 2PS0A 3EXFA 4E4RA 1T3NA 2JBAA 3QU5A 4EFLA 3JQ8A 3DVAB 3O75A 3BXEA 2NGRA 3ZWOA 4N65A 5JECA 3K0FA 3I58A 5F5NA 1V9SA 4P5DA 4DAEA 3PEWA 2WF6A 1BZYA 1G2PA 1PJ4A 3ABQB 2B1GA 3MCTA 3W7VA 3RAJA 4KSBA 5G4KA 2F4NA 5I9LA 4IJKA 2PE5A 1Q5PA 2CNKA 1XZKA 3PCRB 3S44A 4MKZA 2J09A 2WILA 4UNRA 3QOFA 2YFQA 3KNZA 4F3CA 3IC5A 4DMLA 4YAJA 5IFLA 4YWHA 2C98A 3LIIA 2P6RA 3KZCA 2R1ZA 3DT8A 2WD7B 2P78A 4J9PA 1HR0H 1QAQA 4PXYA 1V7ZA 3H6KA 3JQRA 1R4NB 5IJ9A 4F86A 2ZI7A 5T7BA 3V2IA 4Z49A 4RQBA 5K4GA 2ISQA 3VPGA 2G40A 4C6TB 4IGEA 2G08A 4EMSA 4EY6A 1VIAA 4YFVA 4ZEVA 3RS0A 4LBWA 2NZ8A 2YV3A 5LDGA 1JH8A 4LGMA 1QYIA 3RSCA 3ZH9B 1SPBS 4G09A 1Q3TA 3B8HA 3EZNA 2Z2JA 3L7DA 1LS1A 2XCLA 3EWIA 4CEHB 1WU8A 4TXHA 4NWIA 2FWAA 2V7BA 4NMLA 1YDWA 4TL7A 3CVYA 1COWA 5KOJB 1MTOA 1NP6A 2UZAA 1AK9A 2IV7A 4X20A 1AE1A 1P29A 1JHYA 3VH1A 2AWNA 1RQGA 2FWMX 3WHKA 4US1R 4EEXA 4RHFA 4QULA 2JIOA 2QTTA 2JDIA 2ZQZA 1G21E 3DDHA 3KJIA 2OBMA 3PHIA 1KSJA 5FADA 1IQUA 4K05A 2F55A 4L07A 4INJA 4M1ZA 2J0EA 2KSWA 1T3ZA 2QQFA 5MFZA 5BP7A 1S8OA 4TWBA 2Z9CA 1PRYA 1UP6A 3EX7C 1DV1A 4A3LG 2D5LA 1SULA 3UT5B 1KMIY 1UC9A 2KX7A 4DMMA 3ORHA 3G6YA 5KG3A 3WBBA 1NRWA 2RH5A 4IVRA 1JEYB 1E5XA 3C4JA 4EF6A 5A4MS 3FKIA 1FJ2A 1QTNA 4V38A 2JLBA 5H4GA 3GJYA 3COPA 3FOEC 2DUWA 1GLVA 3UH1A 4H60A 4K3UA 1UP7A 2G3YA 2IH5A 3G02A 4HSGA 3C5HA 3DM9B 3MWLA 4R8RA 3MOIA 4RS3A 3H4TA 1NL3A 2FQYA 3ET5A 2Z8YM 1GPJA 1NC1A 4QHYA 1NMSA 2PUCA 2R6AA 2H4XA 2DBYA 1T9CA 3O8QA 4B0PA 1GN9A 1YCHA 3L9WA 4UPEA 3AI7A 1Q1BA 3TRIA 3SD7A 4QDOA 3ZGLA 3BULA 5FWDA 2E1RA 2VSQA 3RIHA 3E23A 3QXHA 1L1QA 5AUQA 1F3LA 2E5WA 3JVEA 1BNCA 3GRYA 1IZYA 3D4BA 1PKEA 2NZUG 4U9HS 5KYXA 2NSJA 4QOEA 3TH5A 4OBXA 1YJ5A 1B6TA 4ZGBA 3T3GA 2ZWIA 2IWHA 2O3JA 2QM0A 1O3YA 4N5NA 1QIEA 1UBTS 2D1SA 5H70A 1PEAA 2PZGA 4XYLA 1LBEA 3RB8A 1GKYA 2WB2A 4M9CA 3TLAA 5GV7A 3FHLA 5FNVF 4DLTA 1OC2A 3SHFA 2RAPA 4A16A 3F4KA 4PG8A 4F7DA 3SIXA 5TDHA 4Q4DA 5T3UA 3LKBA 3JZMA 4KE7A 4MRMA 1C1HA 4ZRMA 3V8MA 4R1OA 2Y76A 3JAKA 4JEUA 2GPBA 1PLLA 2ZR7A 4LF4B 4XQCA 1N75A 3PF8A 4W1QA 4YQWA 3WBFA 1IG3A 1TMKA 3GY0A 1QLHA 5CXQA 3I1JA 4G0WA 1OWOA 4C7MA 3SQXA 2WWFA 4CG3A 2WWVD 4EHFA 4MGIR 1PZNA 2GZ3A 2ZB3A 4BGVA 4MW4A 2AZTA 2XUPA 3WSVA 1WVMA 3PO2G 4GQAA 1ONBA 4QDKA 2OKCA 4GYJA 3KQOA 3E5RA 2EJBA 3GLFB 4S1OA 1D1PA 4FSXA 1PQPA 1X13A 2YASA 1VE3A 3EBPA 4MW9A 4A9AA 3GILA 4LXGA 4ZALA 9GPBA 1YONA 2UZ0A 3H7AA 5C31A 4XVCA 4PWZA 5G0TA 1NSTA 2PX2A 4KFTA 2XQKA 3K71B 4US2R 4AJ9A 3MAAC 4TPKA 3TINA 3E53A 4IAOA 2GN0A 5JJKA 4H7IA 1JLHA 1K2VN 4K7JA 1XAIA 3ZVLA 1VHTA 4BC1A 3RS3A 2CXPA 1N34H 8ADHA 1BRMA 2IYXA 4BBZA 2XXJA 1IZ9A 2RHGB 1QDUA 3EHDA 1P4RA 1MC4A 3VUFA 1UFOA 2GH1A 3ZJ5A 1ST3A 2ORWA 1UPTA 1K3FA 3E5MA 1C1YA 1SURA 2KS6A 2HH9A 1DAEA 1JFSA 1TAQA 4RDXA 4PYMA 2GNPA 5ENZA 4MQUA 3M7IA 1KK1A 2AG6A 3N6VA 3QJ5A 4XW2A 4A4DA 2SHKA 2XUFA 3KXLA 4AFNA 4XWKA 4BBAA 1S0OA 3F8WA 3RF2A 4ZHQA 2ZBQA 2FDRA 3CGWA 1L2ZA 3U09A 3LZ6A 2X40A 1IXZA 1SVSA 4AIIA 4Z3OA 3FHJA 2HHHB 4BE4A 1UKAA 3ZUPA 2UUCH 2C2YA 4QOSA 1STOA 3W5OA 3EQZA 2GLUA 1EUCA 4HDMA 5DTJA 2JLXA 4MRNA 3TQFA 2Q9UA 3ZGVA 2QYOA 3V1UA 1CHDA 4MO9A 1U8ZA 2OPBA 2DIKA 5E7QA 4M87A 1U5CA 3I64A 4NMWA 4E11A 1NVVR 2A0XA 4J3JA 4A0RA 1M1YA 1AG9A 2YWBA 5M5BA 1WSAA 4IRDA 3WQBA 1UOEA 2WUFA 4NTZA 5EYPA 3F4BA 5HHTA 4RXTA 2C0QA 4ZZ3A 3QUQA 2VTBB 3VZCA 3BMXA 3U26A 2OZLB 4BX0A 1ZAYA 1GXSA 1U3DA 1PN3A 4LHEA 3EFEA 2ZJ5A 3S0JA 1IBMB 1YRLA 4D25A 3MT7A 4MAMA 1GDTA 4U2EA 1JR2A 4DDUA 2Y27A 1YU9A 4CKYA 5DP2A 5HJ2A 1KOGA 4JUZA 2AGOA 2DCMA 2RHLA 4O3OA 2C2HA 5EMHA 5GOTA 1OILA 1VMKA 3ETEA 4KVZA 2QD2A 5AKEA 3EFOB 4DMHA 2M9MA 2CDRA 1Q44A 2OZEA 5I45A 3I23A 3MGGA 4ZP1A 3E22B 1PFGA 1JDJA 1L7NA 3FSGA 3JWIA 3B9RA 4FFWA 1BO6A 4MJ3A 4FCWA 1II8A 1OCEA 4HSEA 4XYMB 1EWYA 1GRCA 4RPKA 3RTAA 3GZ4A 3FWPA 5C5JA 2Z57A 1MB3A 4TQAA 2OB2A 4LRYA 2FPPA 4PGHA 2MCTA 4IPTA 2I2CA 2HJWA 2OV8A 3ZCUA 1U8YA 3BMOB 4G8CA 4YRKA 1HX7A 2AKEA 2QL6A 2GTIA 2PT7A 4K6CA 4G0YA 1PD0A 1ZRNA 4B3RH 1M10A 2BUAA 4QU9A 3RAPR 1GKUB 2H9YA 4GGMX 1H4SA 5EFOA 4O4JB 3G2PA 4R2KA 2GF0A 3B70A 5FO1A 4KIUA 2RD2A 1YACA 5BW4A 2FWIA 1ULSA 4CM7A 4KO2S 2ZRDA 4B3HA 2G1UA 3ES9A 5JC8A 4XQ0A 4G9EA 4P93A 4IQ8A 1JPJA 4KYIB 4WACA 3GEDA 1CR2A 4G5FA 3HN2A 1T8PA 1FDSA 3L82B 5J4HA 5CYPA 2UDPA 1LA2A 1P0IA 3SHVA 5FPHA 3WWCA 3ZYCA 3T1OA 1W35A 5HKOA 1UWVA 4H7DA 3TDMA 5JZBA 5AUOB 1MLDA 4G84A 3C3CA 4GVXA 5HF8A 2DETA 1IVNA 4MB6A 3VR4D 1IPFA 4HGNA 4D9JA 1XVIA 4R1SA 4KREA 4G56A 2W8ZA 4U3JA 2VXOA 4L50A 1OWNA 1NJ2A 2OD9A 5LMZA 3KSRA 4V3BA 1JBKA 1R64A 1KBLA 7REQB 3N8DA 5HDBB 1SUPA 5I7EA 2VPQA 4V02A 2QI9F 1X70A 5ERGB 3N70A 3P94A 4WT7A 4X1YB 3W3AA 4R1MA 3FB4A 4ED8A 4F21A 3P20A 3QVLA 2BBOA 1K7EB 3V97A 3LCVB 3OLYA 3FOAA 5BWMA 1IHDA 3G9QA 3WG9A 5GJVC 1I5OA 2X3UA 2J0QA 1T36A 4TWRA 3RYCA 1GFIA 4LDQA 2QN2A 3WK5A 1OASA 4N3NA 3TCKA 4QG7A 1ORWA 2CXSA 2GCIA 2V74B 3DAAA 2DERA 4IWXA 3RBZA 2LDXA 1QTIA 3QFCA 3H86A 3BMCB 4YAIA 2ZRHA 3TKAA 1SRRA 1F3OA 4V0MA 4FHEA 2IEAA 4ECQA 4JLJA 3WYDA 3HJTA 3C3BA 1CR4A 2AR9A 2JZCA 3ND8A 3MFQA 5IZCA 2QG6A 3HNRA 2IXFA 5CK5A 1Y3IA 3IDAA 2WWGA 5L1JA 3JQQA 4YVFA 3BTOA 3NDJA 3S7TA 2NV0A 1QRRA 5H1YA 2JZOA 4D26A 4A8PA 4RORA 4JLPA 4PRKA 1EEHA 5C80A 1ZVJA 1AQLA 1KO4A 2QUIA 4TN1A 2AD5A 4J4BA 3EXEB 3CLUD 2IQIA 4HX2A 2X41A 1VE9A 1U7TA 3OTHA 4DDKA 1OZHA 3K53A 6REQA 3GWZA 2ZRLA 4JQYA 1GZ5A 1B14A 1EMDA 3QE9Y 3VR6H 2A0FA 2AXQA 5IUNC 1P45A 4LTDA 3NHUA 1UC5B 2ZAMA 3F2VA 2QT1A 4P86A 2QA5A 1GNRA 3FHTA 2BV3A 4M9SA 1A5ZA 3RC1A 2V6MA 4ZDIA 2I6UA 2ZITA 3H42B 2H4FA 2QM8A 1LSOA 3VZBA 1I6LA 4DQNA 1CLUA 4RL4A 1ZUHA 3RSOA 1O95C 3GB8B 1KKUA 2VP9A 4DZTA 3R6GA 5DHSA 3PRJA 1ZEJA 1X19A 4F60A 2OQRA 1TF5A 3AF5A 5DG7A 2ZIVB 1ZOSA 4WDRA 2PFGA 3HKDA 3L8HA 3VHQA 2ZSKA 3ZY4A 2GEFA 3N58A 4LKOA 1RI5A 2FOXA 4I1SA 2AYYA 4OLHA 2AZXA 2QE7D 1DCMA 3NHRA 2AEEA 1QHHA 2W2MA 3U7IA 2VCYA 2B8JA 3IOYA 4CQMA 3AG5A 2KLHA 5IVHA 1Z6GA 3GLRA 4B83A 3ADCA 4B3GA 1BCSA 2Q5CA 3IBGA 2DFDA 1HYGA 5AQ1A 3QVTA