5BPHA

Crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 96
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5bphA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5bphA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bphA01
2YZGA 2R85A 5KX5F 3ORQA 2YZMA 1KJ9A 5J2UF 2GPWA 3K3PA 4O82A 2VR1A 4C5CA 4O4LF 1CS0A 4FE2A 1OBGA 4E4TA 5BPFA 1E4EB 4EA7A 1E4EA 2XD4A 2W6QA 3HB9A 3VOTA 2PN1A 3AX6A 2R84A 4C5BA 4MA0A 3TINA 3BFPA 5LOVF 5CB4F 3VA7A 3V4ZA 2YZLA 5LA6F 3BG5A 4DLKA 1PX2A 4HNUA 5JH7F 3I12A 3GLKA 2PBZA 2GQSA 1CQJB 2QF7A 1GLVA 3K5IA 4MA5A 5DMXA 4FU0A 4EA8A 5H80A 3TIGA 3TQTA 4I55F 2I8CA 2Z04A 5HV6A 4IHJF 3K5HA 3ETHA 4YAJB 4Y8VB 2NPOA 4IWYA 4XX0B 4IIJF 4YJ2F 2NU7B 4XYLB 3KALA 1I7NA 4O7WA 1CQIB 4HQ6A 1KBLA 2R7MA 1VBGA 3MJFA 1GSHA 4O7LA 3R23A 2P0AA 4NYEA 1IOWA 1W96A 4YBZB 2CNQA 2R7KA 2ZDGA 2I80A 2R7NA 2Z02A 1KUTA 3WNZA 4MV7A 5C1OA 4ZHQF 5JQGF 3R5HA 2VHEA 2V59A 3WO0A 2IP4A 4O83A 4O4IF 4MV3A 3UFXB 3OUUA 3BSSA 4HNVA 3BSYA 3LWBA 1M6VA 4ME6A 4FFPA 3TIIA 4QSHA 2C00A 1EUDB 5CA1F 1A48A 3U54A 4M9UA 2NUAB 3QFFA 2YS7A 3RV4A 4GGMX 1VBHA 4M98A 4FFLA 2R86A 2CNVA 4IWXA 2W6NA 3NUAA 1JKJB 2ZDHA 2DZDA 3LP8A 5BMVF 4O7NA 4M99A 2PVPA 1EHIA 1EZ1A 5JVLA 2FB9A 1IOVA 1BNCA 1ULZA 1KJIA 1KC7A 4EGJA 2DLNA 5K2MA 2NU6B 4FGRA 1W93A 4O7VA 1KJJA 5FNVF 4MV4A 3BSWA 3Q2OA 3V4SA 2GLTA 2W70A 5JVDF 2R7LA 3N8DA 3KAJA 3VPDA 1B6SA 2NU9B 2VPQA 2HJWA 3WO1A 3ETJA 1JLLB 3Q1KA 4O7TA 4HR7A 3VMMA 5BPHA 4FFOA 4M9CA 3JZFA 4O2BF 4I4TF 1WR2A 5LYJF 1M0WA 2R82A 1VKZA 1OBDA 2I87A 3G8CA 4MV8A 2NU8B 2QK4A 3RV3A 2DIKA 3MWEA 1Z2OX 3TW6A 3N6RA 1AUXA 2YWVA 2SCUB 4O4JF 4O7SA 2ZDQA 3R5FA 1B6RA 1DV2A 1A9XA 3KREA 1EUCB 4YB8B 5C1PA 5J2TF 1Z2PX 2HGSA 2OLSA 1CE8A 3ORRA 3RFCA 3U55A 5HBRB 5KKNB 4L1KA 3VPBA 4WBNF 2XCLA 2YYAA 2GPSA 4I50F 4TUYF 2FPPB 1UC8A 4TV8F 2J9GA 3SE7A 3OUZA 1I7LA 1KJQA 3JZIA 1Z2NX 4O7RA 1UC9A 4FFRA 1JDBB 4RZQA 4YJ3F 2CNUA 1SCUB 1C3OA 1T36A 2W71A 4FFNA 4ZQIA 3DF7A 3AW8A 5GONF 5CA0F 3KAKA 4MV9A 2YS6A 2W6PA 4ZI7F 4EG0A 1M0TA 1AUVA 1KJ8A 4O7ZA 2W6MA 4ZOLF 1C30A 3HO8A 4O86A 3E5NA 4O2AF 2YRXA 4O84A 1EYZA 4J6EA 1DIKA 2CZGA 2YRWA 4EAAA 2R6FA 5LXTF 5CAEB 2W6OA 3RUPA 2VQDA 2GQRA 3G8DA 1JDEA 2YZNA 3HBLA 4XYMB 2FPGB 2FPIB 4FFMA 4MAMA 1GSOA 4TV9F 1PK8A 3JRWA 3R5XA 2CQYA 4MV1A 5I47A 2R87A 5LP6F 2X0SA 3GIDA 5IYZF 4O4HF 1GGOA 3U9TA 4O81A 5D8DA 3U9SA 4EABA 4WD3A 2YW2A 2WYOA 4EA9A 4HNTA 3VPCA 2FP4B 4DIMA 4EGQA 3R9RA 1KEEA 5C8YF 1DV1A 5JQWA 3JRXA 4C5AA 2YL2A 2V58A 4O7YA 4XZ3B 3MWDA 5EZYF 2V5AA 4YAKB 4MV6A 2W6ZA 4IZOA 2DWCA 1GSAA 1BXRA
chains in the Genus database with same CATH superfamily
5EIWA 3OZIA 4OXKA 4IVQA 2GLUA 4JBWA 4DWOA 3MWMA 4GYKA 3D2LA 2G6TA 1VPEA 2EBFX 2W4MA 3ZE8A 5GZ3A 3IE1A 1FFAA 1KTVA 2UYHA 3SF8A 2WB1E 3VJKA 2BFWA 3RS9A 3CSWA 3OZRA 1EK0A 3BQ2A 4I81A 3C6KA 4M0UA 2R1TB 4OMUA 2DETA 1ZRMA 2FN9A 1F6WA 3DAYA 1ZVQA 2QRNA 3ET4A 5KNDD 1II8B 3AFHA 1KVQA 2A0WA 1YKGA 2GB4A 4MKFA 5KFJA 3UWMA 3TSWA 3WL5A 4RDIA 4ERXA 4INOA 2QXUA 3GVPA 3KEGA 3RHZA 4BXOB 1YA4A 3FDSA 1D07A 2O2XA 1CDEA 1ZHHA 3EZ9A 3WKDA 1E4EA 4B47A 1YHNA 2VDJA 4UMFA 5JPIA 3WQQA 3QEMA 4F2HA 2G82A 2NTYC 2HJGA 3VOTA 1PR2A 3CIFA 5TMEA 4QEZA 3H4MA 3U3XA 1LSOA 3AX6A 3GBVA 3CEPB 1YI1A 3INTA 1YS4A 3CPJB 4KNVA 1NXSA 2DCUA 3IE0A 3CY6A 4RX1A 3IMFA 2PAFA 3RB4A 4PTZA 2HW8A 3WSVA 3ZS9A 5CJ2A 1LSJA 1RVV1 2XLCA 3SVLA 3IP3A 1QKJA 3ZTTA 4IMJB 4YAIA 4P93A 4KKVA 5HVNA 5HNEA 3B20A 4IRCA 3A6EA 3CZ4A 1J0EA 5FULA 3UM9A 3L6DA 2WUDA 2HIAA 4NV0A 5DGCA 4QZVA 2IPAB 2AX4A 4F6CA 2H18A 4MP3A 3T12A 1KKMA 1Z73A 5C4XG 3ECCA 3Q7EA 3I12A 4Y6OA 5EWMA 4Z0HO 5JANA 4HX9A 3Q9LA 4B43A 1O54A 3TE7A 3AHDA 5SYNA 3K0AA 3V97A 4IM7A 1CQJB 1GT6A 3EXHC 2FW6A 3G9ZA 4ENVA 2FKLA 1FK8A 4AVYA 1Z63A 1P80A 2W6JA 3KHUA 4S04A 1M33A 3H2YA 1P6UA 1Y14B 1CUAA 1GITA 5CVEA 2V7WA 3L8FA 4L72A 1X7GA 1MEEA 3N8HA 5A6VA 2P6PA 2B5OA 3OWOA 4OQEA 3I9V1 1NSFA 1SHLA 2AR9A 1B0AA 3NP7A 3V4OA 2V3VA 3RC9A 4EG5A 2EJTA 4YV7A 3WWYA 3PHCA 1R37A 5L7WA 3E9RA 1JG7A 1UKBA 2WM2A 3HA5A 3EGWA 3LDFA 3K5HA 1GYFA 3NUQA 3GAZA 2HHFA 4LX0A 5DMHA 1P7CA 1QP8A 4WZBA 2CJYA 4WOBA 2O8DA 1ZD1A 1W4CA 5JAUA 2V0GA 2G8NA 3PC2A 1CUZA 1YDHA 3IOEA 2G1JA 1HURA 3N6VA 1X80A 5A7GA 2D13A 3AMVA 3DGFC 4UCFA 5T4FA 2XW6A 2BM9A 2NU7A 1HDXA 3GJQA 3WWIA 1SMKA 1YONA 4PY2A 2OENG 2ODTX 2G7ZA 3JQAB 4J4HA 4UHCA 3BB1A 2PD4A 3OOWA 4MVJA 1B74A 2CXPA 3R3YA 1RRCA 3W1GA 3NJRA 3Q5EA 1PFGA 4AKEA 1WDLA 1Y63A 2PBFA 2G9QA 5CX1A 3ER9A 4QAJA 1DQRA 2AJCA 3HBNA 2OK8A 4O4LB 3HA3A 5DHRA 4CF6A 3INGA 2XQFA 2EOAA 3HJHA 4A8PA 4JKOA 1LX6A 2YWBA 2IUUA 1KFCB 2C8VA 3DZ8A 3UG6A 1SQ5A 3P9CA 4PTYA 3W5IA 3VTZA 4IXTA 1T6ZA 4MWBA 3OHMA 1FJ2A 2WF7A 1GFIA 1NVFA 3L6BA 2WTMA 3A58B 3Q3VA 3QU5A 2UU9B 1ZK1A 3PPWA 4WADA 2JHAA 2I8AA 4UQLA 4PIVA 2XRYA 3RHTA 5CIQA 1G7CA 2QM7A 1L8XA 4R2XA 4A0GA 2HK9A 2ONZA 3G88A 4U3JA 2CE7A 1K1EA 3OCVA 4EJMA 3PK0A 5SZJA 2R8GA 1XGKA 1EFUA 4CMAA 2WABA 2X41A 3U2QA 2B4AA 1JP7A 3DYBA 4YP7A 2JDIA 1Z29A 3Q0EA 5IDVA 4RZ3A 1HZZC 4J29A 1ZQ7A 1ZP6A 2VOBA 4GC7A 2DGDA 3EA4A 3F2VA 4FMDF 3U44B 4JQOA 5B4TA 5FOVA 3EVBA 2XB4A 4QPPA 4KUHA 2CFTA 3U54A 3GJ8A 3IJEB 3QBVA 1P2FA 2BGMA 3A9WA 4YASA 4GP6A 1Y0BA 4Q8FA 3M6UA 4GGPA 2VO1A 3TJMA 3RFTA 3ZCSA 3MTBA 4G0QA 2BGWA 5FQNA 1HMPA 5LSAA 3DFMA 5AKGA 5HE9A 4EEYA 1NPTO 2ODBA 3AFOA 3QE3A 4Q6WA 2A0UA 4EW6A 2YWHA 3KSZO 4HD8A 3B9BA 3PNBA 2Y05A 1MVNA 4TUYA 4R84A 1QU3A 4B79A 1ONSA 2CNVA 1ENZA 1T1IA 1ZU4A 2G8LA 4PCVA 1XZ8A 2FLVA 4UBOA 4DIEA 1YMUA 3DWIA 1RZVA 3E7PA 2WAAA 4S1TA 2PUEA 4PAWA 4TMWA 4QOSA 3E53A 2Z1NA 2E5LB 1X9GA 3MPOA 3GIQA 1BHJA 4DZZA 1T9GR 2W7OA 4U2DA 2H51A 2G6BA 3E9MA 3TZLA 4BLRA 2PGLA 4O3QA 4DCGA 2OY0A 2A5DA 4WLVA 3LX5A 4DWJA 4YAGA 3EISA 5BWBA 4URFA 1FUUA 1JR3D 3ASYA 4AG5A 1C2TA 4YRPA 1SUDA 3GBSA 4IUCS 4BFLA 3O4GA 1UP6A 1NTOA 4M9XA 2HN9A 1ZMBA 5KNDA 1T0IA 3N2GA 4AJKA 2AXQA 3O8OA 4ZDKA 5ERYA 4ND5A 4AMBA 2SECE 2DKOA 5IRCD 1ECCA 1XZJA 2H2FA 3MA0A 3DKRA 3HSKA 1RLJA 2JFXA 1R6TA 5BN5B 5AM3A 2ZXUA 3L6OO 4IO1A 3WLJA 1QDLB 1SKBA 2GM5A 2QG4A 1GYPA 5E6RB 3KSMA 3HOWG 1QYVA 2AUTA 2MMCA 4MH0R 4M49A 5KJEA 1V5GA 3IOYA 4HDMA 1W5TA 2I1VB 3BFVA 1E7SA 2IA5A 2XBLA 4KTVE 4COKA 1U4SA 2XF2A 2HDNB 1MJ5A 5B6JA 1KORA 3LYLA 4RF3A 1PS0A 5JE8A 3PGKA 4D8VA 1NYRA 2OSBA 3K73O 5ITZB 5AVYA 2JGEA 4YCDA 3EDYA 1K5PA 2ZEJA 1HTTA 4B3SB 1EVKA 5TEVA 3VUFA 3F8TA 3NBMA 1E2NA 4UQOA 2FW0A 4FFSA 4YECA 3CZQA 5E8JA 1EIWA 4AZVA 1IG0A 1EDEA 4KAJA 1ZG3A 4JBLA 5A3RA 1ZIOA 1RZUA 2IPLA 1YZQA 3FGZA 3KTOA 5G3ZA 5IVIA 5I7UA 4RAYA 4ED8A 1F38A 1PJCA 3E8MA 4GMDA 2X0EA 3ZCRA 3HVKA 1C1DB 2A0KA 4ASUA 1C1XB 3UPUA 3ZY2A 4IEFB 3HJTA 4KK4A 4EGSA 2C3PA 1RDFA 5BWTA 3H1PA 1FDTA 3S8MA 2ZRDA 4OF4A 2C94A 3ZY5A 1F7VA 4O2BF 2X7XA 4R0MA 5DNEA 4TTQA 1PUJA 1H2BA 5EMHA 3URMA 3E2PA 3NOXA 3MMXA 4W5JA 3CNLA 3KDAA 2OZKA 3GK3A 5DNVA 2FEAA 1ZI6A 2MSDB 2WINI 5ALTA 4F1WA 1DRKA 1LLQA 3GRCA 2AFVA 1W88B 1KQ3A 5JNUA 3FMOB 4KO2S 1UT8A 1E0KA 1OPXA 2D5LA 3TD2A 5T4BA 1PWHA 4JJFA 6AT1A 3MWEB 2NU8B 3AKDA 1QC5A 1X92A 2ORYA 1PJSA 1GLGA 3R7AA 1A04A 1BMFA 1HFKA 4JWTA 1WSCA 4TKUB 3WISA 1QM5A 2BFBA 3P9KA 3L0YA 4EHAA 2PO7A 3LBHA 5L95A 3O8CA 4H18A 2VUTA 2UZAA 5K3AA 2D2EA 1SJ9A 2HGZA 4UOEA 4FVTA 4PVCA 4QM7A 5IYCG 4ODIA 1DQPA 3Q7QA 4B3BA 3PRJA 4HSGA 5FLXW 4TZKA 4KGDA 4TKVA 3BWBA 4EJ2A 3MGKA 5F9NA 5JAMA 3OUTA 4W1SA 4DLAA 4ETNA 2JGMA 2ODEA 2XXAA 1EUCB 1EQAA 3K2IA 3P9RA 1NJSA 2YW9A 4KMMA 4TXNA 1OWOA 5ICFA 3FYUA 1F2VA 2A9KA 4KQEA 4M9QA 3I73A 4YJ2B 4ZTZB 5H5JA 1T94A 4LDNA 4QAQA 5IX8A 1IY1A 4P82A 3C24A 2WC1A 3VTFA 4M3NA 3K0AB 3IL2A 2CFOA 2J32A 4LF6B 2P8JA 1JQKA 3PFFA 4OIFA 3SYMA 3RYCA 3FCAA 3STYA 1MPTA 3PHJA 4Q47A 4R1LA 2HMWA 4KN6A 5E9AA 5FI0B 4BV8A 3HZHA 3V1MA 2I65A 1GL9B 2NT4A 1MDFA 3F5QA 5CRIA 1B16A 4X20B 3PXGA 3AEKA 3SQXA 1K08A 2EATA 3KB8A 3UJCA 2I76A 4BN5A 3MQ4A 1SYXB 1TM7E 2WTBA 2KE5A 4EM6A 4PS1A 3PDIA 3WXBA 5L3SB 4BTVA 3LDAA 1GM5A 4R8RA 3SYNA 4BLVA 5LWQA 2Q2TA 1PZFA 3E48A 4ND2A 1X1TA 4HB4A 2AF4C 4J9QA 2WSMA 2GHTA 3K9QO 1L4HA 2X5RA 1C9YA 1QIGA 1Z82A 1HE4A 4US1R 1I9CA 1SXHA 4TTSA 4N47A 5JYEA 4UCWA 3COJA 1P91A 1I4EB 3AYHB 1Y1SA 1NKTA 1RNLA 1JEEA 1TVKB 2LW7A 1OJ7A 3HE3A 3EVGA 4DLZA 5LDGA 1LUAA 3E23A 1RHJA 4AXXA 4LRUA 4FZVA 4OXYA 3VNQA 2FZ5A 5AJHA 1YZ3A 3NORA 4IL5A 4NARA 1OFIA 3ABZA 4NTZA 4P0TA 4R1PA 5C2JB 1KIFA 1U2EA 1JLHA 3FPFA 3NTXA 1FZQA 3OEED 3A4LA 2AF3C 4MJ3A 1HE8B 4B76A 5G41A 2XZOA 4DLUA 5ALEA 1OPRA 1KK2A 4NENB 2ZITA 4E3ZA 3H0GA 1KQGA 5EUBA 1E2HA 5JS8A 3L9WA 3II6X 3T3EA 2C07A 2W71A 4ESEA 3COYA 4RSHA 2VXCA 3RVRA 2CL5A 4IDHA 5C3UA 2D06A 2VUSA 1WZ2A 3MMNA 4JT8A 5L40A 4OY3A 4LDZA 2FR1A 4RZXA 3PDWA 1UJCA 3L1UA 2ZE6A 4OA5A 1C7JA 2QLJA 2NSLA 3ESCA 3HI4A 3RAJA 1W36C 4ZPJA 1Y1PA 1JTEA 4H0FA 1SVUA 2BKVA 3L7BA 4KOAA 5JLJA 2WTUA 1IONA 3O90A 4JBXA 4Q8EA 2JIPA 2UKDA 2ZSHA 2XEDA 5H3LA 3W1EA 4I2NA 4B40A 4O4IB 1TDJA 2XJ4A 5B4VA 3EQ6A 4LBWA 5ANRB 4MPDA 1VYHA 2QLLA 1ESCA 2Z3ZA 1CVIA 1C30A 4WFQA 4BNVA 1HNZB 4YLYA 5IMBA 4A3FG 5FOSA 4QVKA 2CVOA 3FI9A 3V7WA 1L7PA 3OJ0A 3D81A 1W4RA 3EA5A 2Z43A 4OHXA 2OXTA 1V8BA 4BMVA 4ESVA 2IYNA 4R01A 3THSA 3GLHE 1U80A 3I2YX 3W7VA 3RM3A 2OFPA 2YQ4A 5FQOA 2JFFA 4G5GA 5FFNA 4KXMA 4LC0A 5BSMA 1KTAA 1MFPA 5AI8A 2YUTA 4KQFA 5EY5B 2PXCA 5D1NA 4HC4A 5K3CA 4E5UA 1N2EA 3Q4GA 3CLRD 1OWTA 2BEWA 4HWRA 4OQLA 4IAJA 4LHSA 1YBMA 3BREA 4YUZA 5KFCA 3LG2A 5CLHA 3CNBA 5DI3B 1P73A 1KAMA 3RO7A 1T3NA 3ZU5A 3FPLA 1Z4PX 4CHIA 2AGQA 1JDEA 4XYMB 1BA2A 2FHPA 2GKOA 1FNBA 2PH1A 4DBLC 4MW5A 3PGJA 1V7CA 2FKNA 2C1EA 2Z1DA 4LA4A 4R68A 4ASUD 4BNXA 5J1SB 2QX6A 1F8YA 5JU6A 1U2ZA 2C9MA 3WJ7A 3OQMA 4LDQA 2IHTA 5AK6A 3E1GA 4WNCA 1MCZA 3DXYA 1NV9A 1ZXBA 1MAHA 2H8GA 2EWVA 2YASA 4HJXA 4NEHB 4YRQA 5CLJA 5IYBG 1U4NA 5IBPA 2H11A 4Y2HA 3OTIA 3OT1A 2Z8XA 3H20A 4RTLA 3AKZA 3MHTA 2BBOA 4IRDA 2X58A 4O4HF 2J0UB 3KUDA 3YASA 3ZZTA 4IKEA 5A04A 1U2GA 1JQLB 2QUKA 1V5FA 1RHRA 4QPZA 4ZXPA 3RAFC 4P7BA 1OGYA 3K71B 3ZYCA 2WYOA 2H1OA 1Z0KA 2QGFA 2XCAA 1NJ6A 4IGEA 3LC1O 3KR0A 1F4VA 3N2LA 4JVOA 4I3GA 1SIWA 1H69A 2BE7A 4ZREA 4EO9A 4RQAA 1SFRA 3AQ4A 3W5CA 1ZVKA 1LI5A 2PUWA 2DR2A 3FTDA 3H65A 2QD2A 3U61B 4ISBA 2G72A 1DRUA 5C8YF 1SCBA 4E09A 4BLPA 2X19A 5DYWA 5IVHA 4ND7A 3CR7A 2C3OA 4BNZA 2PRKA 1MO4A 1X1AA 1RJ9A 5AWFC 3O83A 5K0TA 4TWIA 5DNDA 2NU8A 1FNCA 4RWEA 4TLDA 5EYPB 4FYIA 4QO8A 1XTZA 2QV7A 4L75A 4FMPA 4C76A 2PX0A 5KWIA 1Q1BA 4GUDA 3ZXIA 2V5AA 2ZSEA 4WCFC 1SXJA 5ECDA 3VYTB 3MZ0A 4P4TA 3TNYA 3S70A 1ABBA 1PVVA 1GGJA 4OQ4A 3R7NA 5F9MA 4LF9B 3GHYA 1VQ1A 3I37X 5T57A 1BFDA 1N1MA 5FJ8G 1PU2A 4XX0A 4A2QA 3MMPA 3G2PA 2KI5A 3FPCA 3K6JA 1OLSB 1GL6A 4BWVA 2XB2A 1J0AA 1IWPB 2IE8A 4MWZA 1ISFA 3D7NA 1RK6A 5TS2A 2WAOA 5C3MA 3MEQA 3IDFA 1BE1A 2VCEA 4ZT6A 2W4QA 3MGBA 3HJNA 3PIRA 1QTIA 1U3CA 4C4XA 4ZDWA 3W04A 1NVDA 2IW1A 3DTVA 3I92A 2R00C 3FWYA 4J7AA 1DCFA 3NDPA 1ST2A 3RVBA 3F8NA 4EUNA 4HRXA 1XQ9A 2QN1A 3M6VA 5DBEX 4INAA 4RO0A 1H4TA 1DJOA 1NR7A 5KVQA 3MWLA 3VR0A 1P0PA 4AYTA 2RAVA 1WXGA 1Z18A 1T91A 1XCGB 3HN2A 3Q6MA 4B7UA 5AESA 1SXJE 1X7XA 4LVUA 2AGOA 2NYVA 1MIOB 1TE2A 5BYBA 2W11A 2CXTA 3TS1A 1YJXA 2IU3A 3MD9A 4E2XA 1R5JA 3JSNA 3ZGYA 1XTVA 2J3HA 1E3IA 5BP7A 4U6SA 3D6TB 1W8DA 4Y67A 2B63G 1XXHA 5LUBA 2X0KA 1HPLA 2H5JA 4F4HA 4ER5A 1OIVA 5CYPA 1W0CA 3DB2A 2C2HA 2R84A 2FPWA 4J9UE 5H9VA 2ICAA 3A7DA 3GJXB 3N2KB 4FDAA 1RXVA 3GPCA 1SA0B 1W29A 3WP0A 3HJAA 4FSDA 1ODSA 5DB4A 3TMYA 5EG5A 1WOMA 3CEBA 2AYYA 2B82A 4DIDA 4PZYA 5BN1A 2YV4A 2IYUA 5AM1A 1PR3A 2IV2X 2XOKD 4A6PA 3UQYS 2O06A 4MGKR 1PX2A 1KY3A 2PGDA 1N92A 4ON9A 4E51A 1G38A 3NR2A 3LCJA 1ZIDA 3AUYA 3ORSA 4JD5A 1IBMB 4B3SH 3MWFA 2HMTA 5H16A 3U3OA 4AF8A 1M1UA 1G21B 1NOIA 2HCFA 4B8YA 4EKEA 1TTPB 1EVLA 2Z6UA 2ON6A 4ALLA 1FSPA 2XIJA 4NICA 4TXMA 2ZYWX 3LCCA 1M8PA 5EWJB 3SHOA 3UH1A 3RAXA 1RHKA 1PGPA 3OZXA 5CEFA 4MWOA 1XD2B 4H17A 2AKEA 3JXEA 5FWYA 2MHCA 4U5XA 5DMXA 4QUJA 5J1TB 1OMOA 4EY7A 1LLUA 1YZLA 2WA2A 1ECJA 3G1TA 1ACLA 2FWMX 3HO6A 3LO8A 4QUIA 4W5HA 4QUGA 4F38A 3ENWA 4QXQA 4JB8A 4I55F 4EBDA 4MK4A 2R4UA 2JGKA 2G0AA 2R25B 4U5QA 5MN6A 1E6KA 1NMQA 3UJDA 1VMAA 3ZHOA 4GD3Q 2HQBA 2PX4A 1OTXA 1Y3AA 4JQCA 2B69A 3RIEA 3SR4A 4CMHA 2REOA 2VRBA 1XTJA 1L3IA 3T5GA 2NPOA 3BSFA 4CM9A 4J0GA 2XQIA 1SWWA 3KXPA 1BXRB 1DB3A 5I7HA 1BVYF 2BI4A 2Y9PB 3PI6A 1BZYA 2WHPB 2ZJZA 4LWPA 1PGQA 2EGGA 3QVTA 4L08A 4D9GA 3R4CA 2QM0A 5KFHA 2QVBA 3A6FA 4X6UA 5KWSA 4RNMA 3OAAA 4MB0A 2ZQYA 3WWPA 1US8B 2C54A 4KFRA 2EFHB 4WKOA 5BV7A 4K8RB 6GPBA 4ZEXA 1S3SA 3OPYA 4C7JA 4CODB 5CX1B 2WHEA 4X62B 1U0TA 1OIWA 2ODAA 4KU4A 3IIEA 5HGXA 4EFMA 1Z7EA 1GTJ1 1YGPA 4FC7A 4N4AA 5FBWB 1E3WB 1U3TA 2VDWA 3GARA 4LE0A 5FBRB 3HUDA 3HDQA 4HNGA 3GJ6A 3RUDA 1U81A 4HUQA 4X8LA 3GMIA 3ZXXA 1XTBA 3GGCA 3PFNA 5F9LA 4A0QA 2WQ7A 1DFIA 4XGIA 1BMTA 3COZA 4HXFB 1WG8A 2NAPA 4C6TA 1UXGA 5KQSA 3WZMA 1MRNA 2BQUA 2NVBA 2ST1A 5F3DA 5ICMA 1LNSA 5J43A 5F1PA 2X0DA 3ILVA 3JZMA 4IEEA 4MQBA 3GPLA 1LLFA 4LYYA 2CB9A 4MVJD 4X85A 1N4AA 3WGOA 5ILOA 3RUIA 4INPA 4O4IF 3UFXB 1Q22A 3ASVA 3AYZB 1EAMA 3O2JA 5HILA 2GPYA 1OH6A 2A5YB 1P9LA 4EPRA 4NKRA 3E81A 5IJXA 3A6PC 3DLCA 4LMPA 3H99A 4PICA 1E9CA 1ND5A 1ESEA 3F8SA 4LXTA 1YBVA 4RE5A 5K8LA 5C5IA 2YKGA 3RABA 4A8HA 2P3LA 3CLUC 1AUPA 2QGZA 4K5QA 1RXUA 1WUIS 4TKLA 1VOTA 3GD5A 5JCPA 1ZGZA 1VGQA 3PTLA 2QYTA 4CIYA 4CCAA 1KE2A 3E5HA 2PV7A 3F9CA 5LUAA 3RBEA 3JQBC 2JGLA 1W0JA 4G0YA 4NCJA 4OGKA 1HC7A 4RACA 3VC3A 1F2TB 5KBYA 3BL6A 4IY1A 1IBLB 2C4VA 1A1VA 3JZAA 3BXFA 3ZNPA 3MHPA 5HSGA 3UXHA 4ABTA 4DBZA 2UXCB 3LPMA 4PBSA 1AC5A 1NUUA 2GKSA 2IF0A 3LPAA 4MTCA 4LSZA 3OPYI 5ENDA 3IV7A 2RGEA 1XPUA 3H9UA 1NWCA 1TO6A 4FOSA 4YRJA 1E94E 3ICVA 2DZDA 1Z34A 5JBNA 4LJ4A 3HVJA 1EK1A 1ZD9A 1ZINA 4EPXA 2FDXA 1I3NA 2DUNA 4GXQA 4M22A 1YRWA 1RMYA 2QYHA 4EY3A 1PFQA 3DHNA 2C1XA 4N5HX 4ZYXA 4MHTA 4KRFA 5GVRA 3DEFA 3JY6A 3QV2A 5BNFA 1PIWA 4FEEA 5JXJA 4YRSA 3RJZA 5FPSA 3RBDA 2XCUA 2VUMA 2ZVJA 3DYIA 5JD3A 3K0SA 1N8SA 4XGNA 1M8FA 1UMCA 4GEGA 4FC6A 2FB9A 2G9ZA 2HSWA 2W6IA 1IOVA 1ESNA 1MMFB 2D0PB 1EQ2A 4MUFA 3ZXSA 2QTRA 1SVKA 3BJZA 3RRBA 2REBA 4H60A 1JIHA 3VH4A 4MRSA 5HDBB 2CZCA 1JDJA 2JCYA 4OM7A 1Y6JA 2B34A 4QECA 4NOMA 4BO9A 4AAYA 1DC6A 2B25A 3TTVA 4GRDA 5CYOA 2FMTA 5CCDA 5B7PA 2QP4A 4HGPA 3W2HA 1GRRA 1VE5A 1ZW6A 5ESRA 2HCRA 3CZCA 1L7MA 1Q6YA 2C96A 1E2JA 2HXSA 4K6OA 4EYGA 2H31A 1I2BA 1QGOA 1UDCA 2ECKA 3E9DA 4UE6A 4IWNA 5C7IO 3V6MA 2H65A 1I2ZA 1QE3A 2NW6A 3DBLB 1OIXA 3KQUA 5L4NA 3BHIA 2BUCA 1ORRA 4GOMD 2JKYA 3KXDA 4LF6H 1Z4QA 3C0KA 3C6MA 5EIXA 5JJLA 1BC5A 4ZVLA 4LVOA 3BCSA 4O2AB 5AVJA 5IJ9A 3GLGB 2BR4A 2RDIA 2UVWA 4E7OA 5AI0A 2P9YA 1DI0A 5KVVA 2AD1A 2RIRA 3GNTA 5E3JA 2QJFA 3FCOA 4CMFA 1D8AA 1OLSA 1S0NA 2MR6A 2NVOA 3C5VA 2GCEA 2P40A 2Q8NA 3C1AA 3ICWA 4JR0A 5HKOA 5KOHA 2UXBH 2QR2A 4A0HA 2VLIA 3EXG2 3W3AD 1P2BA 2B8WA 4MPJA 1GYRA 2V54A 4CMEA 4CV1A 4YXWA 4NVRA 3LBIA 5C4MA 1JLSA 1I7PA 3ISTA 3LRPA 1RAHA 1V11A 3OJFA 3HWWA 3BRQA 4EG3A 4KQ1A 1PLKA 5C18A 5DTEA 5G0TA 3UWKA 4C3VA 2RF4A 5H9WA 4ZHQB 4IOJA 1OFVA 3AH8A 2R48A 4KK3A 5TARA 1E6LA 5U1PA 4EEKA 3HKDA 2ZSAA 3DEAA 2BR0A 1P2GA 3ZJYA 1G8HA 4B3IA 1ZGGA 5IP5A 4UJ5A 4QX6A 2F4VB 3OIDA 2BDUA 3VGPA 2H7CA 3VKHA 1SD1A 1K7SN 4UM9B 4DV4H 1CNMA 1DIBA 1Y7HA 1EWQA 2ZR7A 4MGEA 4JUCA 4EECA 1GKIA 1KFJB 2IJGX 4JY7A 4I7EA 5DN6D 3AJEA 1KEKA 3CVZA 3C8HA 3IO3A 4QUDA 1HLGA 5JUWA 4KO1S 4YP0A 4JC8A 3RRMA 1D1SA 2VN8A 1ETHA 5G4KB 2KBFA 1A9XA 2Q0XA 3AL0C 4YB8A 2FKAA 4L2IB 5T3YA 4WBNA 1PEKE 5BSFA 4QOHA 5DSZA 4P83A 2ERXA 2ZOSA 1QIJA 4MR8A 2HGSA 1DHTA 4S1VA 3OA2A 3PQ6A 4XPIA 3OP1A 3IQGX 2V74B 4FLMA 4NJMB 4PGAA 4GPBA 4V0SA 3T4EA 1H1LB 2HHHH 3PHGA 1JDPA 3AESA 3L49A 1ZMXA 1JFLA 4JT4A 1YZNA 3VI3B 4S35A 1XVLA 4OOEA 3GP8A 5BN3A 4DUZH 3VSAA 4W1PA 4UHBA 3IAM6 1K8RA 2OYSA 2ORED 2Q1WA 3FRIA 3MMSA 1IN5A 1P2SA 1QR2A 2OCGA 3QA3E 2ZUDA 2BYTA 2IEDA 4NP6A 4Y2XA 1J90A 2CHEA 4V2UA 2P30A 3HCBA 4BMCA 3NJ8A 3OIWA 3N3AC 4MRMB 1P2VA 4F85A 1Z5OA 4E33A 3SQDA 4XOIA 4BX0A 2PSSA 1E7YA 1NULA 4HLUA 3HUEA 2YC2C 5K6AC 2FV8A 3RJ5A 1DOAA 1NDHA 2FW1A 3LQ1A 2J45A 3P20A 5T6MA 3TL2A 5IS2A 3AXTA 4RV9A 5IC4A 2QENA 2GD2A 4AMUA 4YUWA 3G59A 1N34H 4OYYA 4RQUA 2KW5A 5FRDA 2HMVA 4BHTA 1Y1WA 1MJNA 1E9RA 2PZFA 4I4CA 5KWEA 2E37A 4DNOA 1ZIYA 2P4SA 1GHTA 2VTVA 4X92A 3ZH9B 5JALA 1QFXA 3MIIA 1KI2A 5AI4A 1XJQA 2C5AA 4UPEA 2BEUA 2IQ5A 2W48A 3OPXA 4M86A 4QL3A 5TB5A 3O8RA 4DV6B 4JI8H 4F3NA 4RZQA 2VHXA 4YQZA 3O0TA 5F23A 2W7PA 1NSTA 1PS8A 4Q1AA 1D2MA 3EWAA 4UHHA 5CUQA 3W0LB 5DP1A 5B1SA 3DF7A 1F0PA 5DOVA 1R5NA 3SN6A 3B1FA 2VTBA 2VUMG 4RGYA 1FLDA 3CUKA 2V98A 3ZDQA 3S2SA 2G9RA 2NACA 5E3HA 4C78A 2NN3C 1R88A 4KR2A 1UJ6A 3DAOA 3FVWA 4Y0VA 3HKCB 5K8CA 3MJTA 1ORIA 3H4IA 2JRCA 3HY4A 4H3VA 4IGFA 4RVOA 4ZI7F 5JV5A 5JMWA 2J3DA 4CMKA 5DLFA 3FKSD 2PZJA 4QBKA 2O0HA 3MFYA 4YAFA 5DW0A 5IARA 4XIJA 5EUCA 3WDKA 1XDSA 1SQ0A 2FPRA 1JRLA 2RHWA 3DV0A 3U26A 3DVAB 3T7AA 1SHJA 1ONOA 3UK2A 1GG5A 1CEQA 3MT7A 3PPXA 5K6AA 4H59A 1OXVA 4QOGA 3KG2A 4RK5A 5CBKA 1C3EA 4UNQA 3QMWA 1A0GA 1IB0A 2AMYA 2GHRA 4HDSA 3E5NA 1ZJ5A 3KKQA 4H1VA 4TT8A 1RWNA 3ZE7A 4CLEA 1DHRA 4KKXB 3OTHA 4V1CA 3B1YA 1DBIA 3LKZA 2TMGA 1AIPA 2QLFA 2JIZD 3KKKA 5PNTA 3FETA 1B8NA 2POCA 2W58A 3BX1A 5BYJA 1I3KA 1UEJA 2BMWA 1J2YA 5IAEA 5HJ7A 2EKBA 4UATA 3QHAA 4AYXA 2UUPA 3IPRA 3A11A 2VDUE 4R81A 5LXTF 3SQNA 5BW8A 2AFHB 1LBSA 5JJKA 4BXOA 1D0IA 4OI2A 4RZHA 2P0YA 2QQGA 4PGMA 1M7BA 4XTRA 5J9FA 2IKQA 1GR1A 2Y77A 3CWCA 4UJ3A 2HCBA 3F6YA 3ZH2A 1NKVA 3BXEA 3Q3JB 4RH0A 1QK5A 2ZREA 2RAPA 4H7EA 2HRQA 4EYIB 1I2KA 2J4DA 3HCCA 4NYMR 4OKIA 3EF1A 3ZZUA 2I34A 3TQ1A 3EUFA 1P74A 1SK8A 1PYGA 2GRUA 1M5UA 1EG7A 1K6MA 1V25A 2X0JA 2WOOA 4S2UA 2B94A 5LP6F 1G8JA 4K6GA 2O7SA 1NG1A 3JQQA 3QBDA 1M2FA 4QNRA 2BRUA 2VUHB 2JZNA 5HR5A 1TJNA 3WHIA 4ZVVA 4BP3A 5D7NA 1A96A 4ZODA 1N77A 3KWMA 3QPCA 1PV1A 1D0SA 1WBBA 4D9BA 2BMVA 1KQNA 1UWLA 2HLDA 4YUYA 1Y8ZA 5F5LA 4BO6A 2Y0SE 3GH3A 5AW9A 3TCXB 1YU6A 3K9BA 3P94A 1E5VA 3A9CA 3S2UA 3KVNA 1DC3A 1P1HA 2I4RA 2WZQA 2YVLA 4RKWA 4DAEA 1T0HB 1H2HA 4URZR 621PA 5KNCH 1UKZA 2DR0A 3DLHA 1XTUA 3ZE9A 4JLKA 1X7WB 4OFXA 5KU1A 1QB8A 2P4HX 4H1TA 2WSSA 4K05A 5JQWA 1DQYA 5IP7G 3LUCA 4F93B 5FWXB 1Z9BA 2Z9DA 1U7UA 2I55A 1MABB 2J5BA 2XWPA 5B1IA 4DB2A 4XZ3B 1ACJA 3CLVA 3SC3A 1T2CA 4YV2A 2R8KA 4MQEA 1MJHA 1MX3A 1OFGA 1QS0B 3NGMA 1RKUA 2NMVA 1T1GA 1X1SA 4Q4CA 2J0EA 4ZAGA 5CVCA 4CMGA 1M6VB 4Y2QA 4C3ZA 4EYKA 5HJ5A 2NSDA 4EFKA 4MICA 2JLYA 3MVEA 5FXMA 2Z30A 4CM3A 1XPRA 3GPBA 4LJ6A 3ZLTA 1QU2A 2WYVA 1X80B 2Y0SA 5JCOC 4N3NA 3PEWA 3F6RA 3KJXA 4EGAA 3NC0C 1M0SA 2AQIA 2OV4A 3M6XA 4YMWA 8ABPA 4UD6A 4A23A 2O9JA 3QVLA 4BE9A 2I62A 4DDMA 3DONA 4TMZA 1E5LA 3LHIA 3ST7A 2Q3JA 3IUBA 1T5SA 3NX4A 3RVSA 3V1NA 4YT8A 4NSNA 4EEZA 4DADA 1MLDA 1DWQA 4LDAA 4HQNA 5C1BA 1PZEA 3GXOA 3FMPB 3K8QA 1OLXB 1CJMA 4YJKA 3RLFA 4P80A 1KAQA 1QQ7A 4GE3A 3KXLA 4UTZA 5DRTA 4IQGA 1JA0A 3TNJA 2KLBA 1Y8AA 2B3TA 2OOSA 3BTVA 4RVNA 2FXIA 3ZWDA 4TTTS 5IKOA 2B7LA 3D6AA 3P4XA 4IIJA 4RKRA 1MIOA 1UKCA 4BRWA 4O25A 4C29A 4UUOA 1E0AA 3AINA 2GF2A 2XD4A 1AU9A 3D7KA 2AZ4A 4XVRA 2JATA 1OX4A 3L1IA 4QIHA 4DG8A 1P2DA 2FSUA 1UM9A 3NO4A 3NAMA 4IHJA 4RK7A 3ZD9A 4C5BA 1Q77A 1OXSC 2VWGA 3DOOA 4RLHA 2LXNA 4ZT2A 3GJ3A 4CU5A 4MA0A 5LP6B 4HYQA 1RZRD 4KLZA 2YMPA 3A28A 1WMFA 1LRKA 5CB4F 4TPKA 2XIGA 1H23A 3HI6A 4WK4B 5F2OA 2H16A 4Q05A 2LTAA 4B09A 1LU9A 2O3QA 4JYPA 4N0PA 4Q7LA 4DMHA 1G8MA 1O2DA 2BFCA 2JGNA 4X5OA 1Q0TA 1QRTA 2H29A 2WFZA 4NI5A 2AB0A 2EFGA 2XT9A 2C2BA 5E95A 5KJCA 4IIEA 4BZQA 3FIJA 3QUBA 4PSKA 3VJRA 4PYNA 1OWLA 4OH1A 4WN3A 4OL9A 5FLYA 1OV4A 2POQX 3DMTA 3F78A 5TV2A 1N75A 3IUQA 3PNMA 4E21A 5JJIA 4MGIR 5ER9A 4MA5A 3L4JA 3S81A 2JFBA 3RS2A 5LA6B 3K92A 5HW0A 3O1JC 4PIMA 3X43A 5LL6P 1ZOIA 2WIKA 3R44A 5K7SA 3ZG6A 5EA2A 4DR5B 3T7JA 3OQNA 1Z2DA 1QBGA 4A2PA 1P7VA 2HF9A 3MCVA 1QIHA 4HI0E 4LRXA 4PC3A 1MJGA 4LBYA 1FFYA 5KAPA 5HIKA 1UKAA 1T24A 2DUWA 1GGNA 1QVAA 3OQPA 3QOFA 5LJIA 5LZ4A 5SYMA 5I4BA 2RC5A 4A3IG 4Y8VB 2ES4A 3WJ2A 4KE6A 1W5FA 1J09A 2A86A 4ZQEA 1TU4A 1PD0A 2BFDA 2PX2A 2W93A 2NXCA 3EBOA 4HNRA 1WVIA 5COQA 1YIAA 2LNDA 2RKWA 2YJ6A 4OHCA 3ORYA 3EJ6A 1Y7IA 1LS1A 2WF8A 3E82A 3QKIA 1SVNA 1VRVA 1Y3FE 4WOCA 4GNRA 4BFXA 5B55A 2GLXA 3BGIA 1MEJA 1RBMA 3D3JA 2QY9A 3KKOA 3PYXA 4RGQA 5DU2A 4BDTA 4BKOA 4EHNA 4X6YA 3GXBA 3QKSB 4QWDA 3OM1A 4BPRA 2WZCA 3MTJA 4D3FA 2YWFA 1QX4A 4V1CI 3OCXA 1L5VA 3KQQA 3T5MA 3FZNA 1DFHA 3IN5A 3HLKA 1A2KC 4N54A 2HX1A 3SPXA 3TZ6A 3MJFA 1CS0B 1THGA 1QHYA 1U8EA 3LSTA 3JQPA 5GONA 1J8DA 3SSMA 3CO5A 4P0PB 4P5EA 4DR7B 5H0IA 1N33H 2EJVA 4I66A 1I32A 4LF5H 3WK4A 3O1HB 3Q3EA 2EZ9A 1XBTA 3M3PA 4NYEA 1O95D 1IOWA 4HUQB 1W96A 4CDNA 1U1GA 2E48A 4EKIA 1JWBB 3ZI4A 3EG9B 3QI7A 4YPOA 4PZ7A 1VLQA 3WLHA 2F43B 3A06A 3R9XA 1R6AA 3ZVRA 4D4KA 3WNDA 4MV7A 1X1BA 3ADDA 5EXXA 2VQSA 1RBQA 4JQYA 3HU1A 5IUKC 2DSNA 4LG1A 4ANFA 2Q5IA 4LAFA 1RYZA 3CNOA 3GFSA 5E38A 1DARA 1GCAA 3OUUA 3B12A 3KEMA 5ER6A 4BO3A 5J58A 2CVFA 3REFA 2R65A 1H93A 1D1PA 4D46A 5DZSA 5KQPA 3FLAA 1V7PC 3H9QA 1A9OA 1NBAA 1N3IA 4TRJA 3LCMA 1VYUA 1UBUS 3KQHA 2IBSA 4UEWA 2ZWAA 3IKTA 1NBIA 3G6XA 4B17A 1J33A 1OOEA 4IINA 4IEIA 3SLRA 4E3WA 1K89A 3GUCA 3HR7A 3FWHA 1UWVA 3VDXA 1RYRA 4QXOA 4Q7QA 1N25A 1N5DA 5AK0A 3CG0A 5KX5A 3O94A 3OPVA 1FLAA 3E15A 1V1JA 4N0DA 3GLIA 4K40A 3H42B 1JYSA 3HZOA 4XFKA 4BJ5A 1IRXA 1OTYA 5TGTA 4CE6A 1G8PA 3MNFA 4LJKA 4QW8A 3QJYA 1T3ZA 4ZIRB 5IYZA 3HG7A 4O2RA 1TOAA 1QK3A 2FMKA 5JSYA 2VSNA 4QQ8A 2MSEB 1TYDE 1Y1RA 4HN9A 4OHMA 3EK2A 2JIOA 3FCCA 3H11B 3HU2A 4GOOD 3ESXA 1EBBA 4I5EA 3TY8A 1SC3A 3CRQA 1YQWA 4G5OA 4LVNA 1SRQA 1JKJA 1NASA 1WB5A 2AW5A 3A3YA 1BFUA 3I39X 1BHSA 3NHJA 3ONWA 2ZDHA 3QMPA 3QV1A 3QY9A 4FS8A 5FTKA 4H16A 1JJIA 3E84A 4MP6A 3D8TA 2EERA 1O89A 1KU0A 2RHOA 1YXMA 4FJ0A 3HK2A 2HSZA 2XKKA 1CZUA 4CMJA 4E5KA 5LWHA 3SWWA 3SP1A 2NVUB 1JAZA 3O8QA 4QDJA 1Q16A 3I2HA 1L9XA 4EO7A 1E6CA 2PKWA 2FE3A 2VYFA 1Y7PA 3MCWA 3UXYA 2EJ0A 1CUUA 1VLLA 2VZ0A 4LWOA 1AXRA 4S0XA 1FXSA 1I5OA 1M2VA 2PA0A 2PE5A 1EP2B 3FRJA 4FBMA 2ADOA 3P2YA 2OG2A 2DUMA 3MF4A 5AXAA 1BFKA 2M1XA 3OFVA 3TDKA 3D64A 1VPWA 4M83A 2PHZA 1PZHA 4CTNA 1A82A 2YBDA 3KEFA 3RVLA 4JCCA 5K0JA 3DE3X 5FT9A 3NWPA 4ZVMA 3ZU2A 3DHWC 3P0HA 4PYMA 1D2GA 4TMFA 1T2NA 2QAGC 4FR5A 4HEA1 4GKJH 3CCBA 3AB7A 5CVUA 2IYRA 3GJTA 2P6UA 2PLAA 4LOIA 1VLVA 1J1UA 3MB8A 3KTFA 1QHHB 4LNUB 3ZLVA 1ZD3A 4DXDA 3HB0A 3IVCA 2OBLA 3KL2A 4NH0A 2C3UA 2VNIA 3LA6A 3DLPX 3T8YA 4BLWA 3QVGB 2C4MA 2C9YA 3Q5DA 4JIMA 1YMQA 5IWAH 1NUAA 2QRLA 2W5UA 3JWIA 3C4JA 3LQYA 4O8CA 1BW9B 1JEAA 3L40A 4RWZA 3KQTA 2OYCA 2F8TA 3C8ZA 5DKFA 4BQRA 2F1IA 2F9LA 3SX4A 1QO9A 2QUJA 5FOQA 4MWEA 3W9BA 2BEKA 1AQLA 3V3TA 5LYJA 1GUYA 1JGTA 1Z88A 1GZSA 2FZ4A 4LHVA 4RDCA 2CDNA 2O6HA 1XLVA 1HSZA 1IBKH 3NIBA 4HDAA 2O5EA 1K7EB 4BU1A 1YVPA 1AK2A 2AFRA 3ICCA 1JLLB 3F6BX 1ZQ9A 4QC2A 3H0CA 5IXSA 1VJDA 4JI5B 3OZCA 2YICA 4MQFB 4RD0A 5ALMA 4DB4A 1IN7A 4JOCA 1KQOA 3ZV3A 4AJ9A 1NNEA 2KBEA 3E9NA 4D0GA 2OUKA 5AJUA 1JPNA 4GSYA 3B5JA 4PANA 5HS6A 3ME5A 4PPYA 5EKXA 1BOFA 1BWPA 2CL0X 2ZCUA 4MP8A 2G63A 5GAJA 1EXWA 2P5SA 4Q34A 4UVDA 1JSXA 3QMMA 1HRKA 2OCXA 4ND8B 3SBOA 4ENUA 1VL6A 4G56A 4UE3S 4PXYA 2BCJQ 1S1MA 3D6HA 2ALZA 4LMAA 5CK4A 5DLEA 1XPJA 1HGXA 3GT3A 1GNTA 1Z36A 2D3WA 1ZCBA 3ZW8A 1G0NA 5IK2D 4JBNA 3VDQA 1CEXA 2NO0A 2WM9B 2R93G 3FMFA 3ZK7A 4NBNA 1N4DA 4Q6BA 4ZV9A 4CKBB 5BUZA 1UPTA 2ACVA 4X93A 1NU6A 1UM9B 3LOUA 1O8CA 5LZ5A 4N01A 2DRIA 4IHJB 4Z3DA 4DJEC 3K1TA 4OQQA 3CH7A 2Y9MB 4BLQA 3Q8PB 3IP1A 4O4JF 1G66A 1ODCA 2WSSD 4B7CA 2GD6A 2W8BA 4QXAA 3T4XA 3THOA 1DXHA 1F8GA 3GVCA 5CLGA 1O9BA 2NUTA 1SVLA 5HG0A 4KH0A 2JF0A 1FVHA 2TYSB 3PG5A 4U7CA 4YALA 5HFJA 5JZBA 3L06A 2COIA 1QH9A 3K70B 4DV2H 4KO8A 5FO0A 3G5TA 4WZAE 4JOBA 4L7VA 4IHAA 4ALKA 4BCDA 5JC8A 3T5DA 1F0KA 3VOSA 5JXGA 4E70A 1DADA 4V2IA 2UAGA 5J63A 4Y0NA 3TW0A 1J8QA 1EWVA 3EJWA 3HO1A 4KN5A 3SBEA 3CUSA 4CF5A 2I9KA 1BIFA 1V8FA 4QJFA 4ML3A 1A69A 1OLOA 1N57A 2O05A 4OH7A 4R31A 1JKMA 3ZE2B 4ESOA 5I3CA 3TVYA 2EL7A 2FRVA 2QRZA 4LSAA 1WRVA 1IPEA 3F7NA 4QFBA 4R6WA 5LB4A 4F4UA 4IIBA 2CLCX 4PAMA 1C8BA 3LO5A 4Z7NB 4RTRA 2W8LA 5FBQB 2VNKA 3FCUB 1FTSA 1MHPA 4JQZA 1A71A 1N6KA 3KLBA 2IGBA 4M55A 4XRRA 4ZRDA 3R7WB 3I5XA 1RCUA 2AHRA 2J6CA 4IF6A 2NSYA 2FJZA 4Q0YA 1U9CA 1UPXA 1Z8HA 1U2DC 2AFIB 4W8OA 3T35A 2C03A 5KSZA 5KYXB 3W06A 3ITEA 1DELA 5DO9A 4DWVA 4PR3A 1DS6A 4Y9RA 2YWXA 1DX4A 4YP9A 3C85A 4LJAA 4RIHA 1WDTA 5AIAA 2F4NA 1CR0A 1U11A 1U5BA 3BH0A 4GM0A 3VPSA 1M1ZA 4N40A 5DIZA 1JEYA 1IZ8A 1NW6A 4CQMD 1OGJA 1XMXA 2V97A 5EJFA 3PHLA 5AM2A 2F9MA 3K0HA 5JNTA 1UXKA 4Y3UA 1O97C 2Q7XA 3LBFA 2NM0A 1MH9A 1FXWA 1JG4A 3JQAA 2ZETA 3A27A 1ZIPA 1T9ZA 8AT1A 4ERNA 3UJNA 4O7RA 3JQCA 4G67A 5CNJA 4PG8A 3PCRB 2CYAA 3CINA 4Z99A 4BP9A 3RSOA 1OWPA 1HYEA 3KJHA 1IWBB 4FMCB 4EPVA 1G16A 4P2BA 2QZSA 2GDZA 2SKDA 3RCBA 3WSTA 5JZSA 1NVVR 4EBEA 1W36B 1D5WA 2Z1MA 2IXDA 3NIWA 1KVUA 3DZHA 3KVRA 4N7RA 4NRDA 5EHXA 2AZTA 3FUXA 1X3LA 3GI1A 4HP8A 4NCKA 4WNYA 4RM3A 1TT5A 3M82A 2A0YA 3GWGA 3LOPA 4C4RA 4YRGA 4RVFA 2D2XA 3CLTC 5D7BA 2QYSA 1F2DA 2UDPA 1KF0A 4NBVA 4IAOA 3I4NG 4DPLA 5IDWA 1E3MA 1E1RA 1PG5A 4EX7A 5KQGA 2O8FB 5IAOA 5I5XA 2WB1A 4PZ0A 2O2YA 5K8UA 1TK2A 2LD4A 3FDXA 4N7BA 4RDXA 3OZSA 2O07A 1H2FA 1POWA 2XCOA 3EBPA 4JEMA 1VMIA 4G26A 4QUBA 3RSHA 3FE2A 5F98A 2GZSA 2D0DA 1FBNA 3BB4A 2X86A 3PJRA 4BB0A 3PGMA 2OLKA 1DKQA 2IVFA 2XNCA 1XRNA 4R1SA 5KYNA 2IEBA 1X77A 3CNNA 4WVFA 3ON5A 3ZEIA 3GIJA 1N0UA 2VP9A 4KH1A 2CCJA 4TYQA 1UZLA 5KFTA 4K03A 3BK1A 2JAUA 1J23A 1KOLA 1QYIA 3UMBA 4AY5A 2ZSFA 2P2CA 2VYND 2WHRA 2PSHA 4IDGA 4QEKA 1T8YA 3ZWMA 2P1DA 3TR5A 1DTSA 4JDPA 4P38A 2PXXA 1N2SA 3PB3A 1A9ZA 1V5WA 4HQRA 3SOPA 4OHUA 3RVJA 1NYQA 3RS4A 5C52B 2YHAA 4MUEA 4G5YA 3M6FA 5KJ6A 1CF9A 4EAAA 3WGZA 1GA4A 1BXGB 1J5XA 1W19A 1F6DA 1NHGA 2EIXA 2RGDA 3E3OA 3NKFA 4IIHA 1G42A 3DZFA 5FP0A 5GOTA 4F2PA 1XZDA 4CMEC 3GTOA 4E30A 2XD9A 1GG2A 2YFKA 5AMXA 4OX9H 3HDTA 4U3JB 3S1LA 3N8GA 6PFKA 4JYAB 3W5VA 3RAEC 3FA2A 1E5XA 1XWFA 1V3VA 5SY4A 3HL4A 5KMGA 3FB1A 2YOFA 4D0NA 1TXGA 1NXXA 4M8IA 5HFAA 2NTEA 1I3LA 3VAZA 3NU1A 1R5OA 4PG6A 5D6OA 1PK8A 1XCPA 5LLSA 3OTGA 4QYTA 1WUYA 4X8HA 2UYQA 3AI3A 3K4HA 4FXOA 1FNNA 2XGSA 1ISIA 2ONCA 3R2JA 5FA6A 4YHBA 5AVSA 5HF8A 3STTA 1TKAA 3LX4A 3WLOA 3Q40A 5ES3A 1G55A 3E9EA 3NTUA 3KXIA 3VR1A 5K6RA 4JNKA 1CQIA 1XYVA 3A1VA 4QYWA 2I6TA 3U9TA 3G8AA 1SXJD 1HLFA 3B9RA 4N5DA 3C5EA 2XCTB 1OXBB 1S68A 2PRJA 3DE6X 3UTCA 1P1IA 3HFRA 3I5UA 4JVMA 4PAGA 4TVOA 2Y1OA 1YL6A 2WD7B 3DCJA 4E22A 2BGJA 3KTDA 4V0NA 1P9OA 1G5FA 2RGAA 1PJ3A 4KWIA 1OI3A 2B36A 3HKEA 2WU0A 4M0FA 1C80A 3LDGA 4MW6A 3ZE1B 4AULA 5J2TB 4JGIA 4P3PA 3UAGA 2GHQA 3TXXA 3UPTA 3O38A 5K99A 2WPDD 4FDMA 4CKCA 4JBYA 1GZVA 3K05A 3QVGA 1FYVA 2EYUA 3VDNB 2QUZA 3CGGA 4JI1B 4NS4A 2BKUA 3HJBA 3PC8C 3X0DA 3WB9A 4XX1A 1A8UA 3OZVA 4EF4A 4EYSA 2OORC 1RAEA 2PU7A 1JWAB 2ZTLA 3VNUA 4YRIA 3KZMA 1ELOA 3TNDA 3WBFA 4MW0A 2OP1A 4IZOA 1M34A 1C81A 1SB9A 2M2IA 2WAQA 2VXYA 2FEMA 3JAKB 3NUZA 3HEMA 4U2EA 2QE7D 3GDWA 3V48A 3H5TA 1X9HA 3ANMA 4QULA 2BEJA 2XUKA 3ND6A 3HCRA 1N5OX 3A6JA 4NDNE 4EQZA 3U0VA 1WZEA 3PKIA 2GUWA 1ZGJA 3NFYA 3NRCA 4D79A 5T8KA 4M21A 5EP2A 2UZ0A 4A0RA 1LW7A 4KZKA 5J2UF 5BORA 5K0ZA 1T4GA 1G8YA 4I8IA 5BR4A 2CMKA 1ZGCA 2D54A 3AJRA 3VR6A 1JU4A 1TEXA 1T5TA 2Y2VA 4MUKA 1T13A 1U2QA 2OFWA 2ASLA 2QEQA 5KFDA 3SIXA 3ZK8A 4CW7A 2R8PA 1JU3A 3NIGB 1ZH8A 1NMXA 1JR4A 1LFAA 1VSBA 5F76A 4O33A 4CZ2A 2EEZA 1DTWA 3BORA 3L0CA 2QSUA 4Q02A 1C3LA 2AQ8A 2FNAA 2J33A 3KKEA 1LTHR 3I23A 3ZTYA 3RANA 4CM5A 3O8BA 2Y4RA 1B1AA 1I51A 2VA8A 2OXIA 3QPBA 3B3GA 4B3MB 3ERCA 1M76A 3L4BA 3LP5A 2IPXA 2N1BA 4BVLA 5AVQA 3EEFA 5EJ7A 1FKAH 4RC9A 4IDOA 2IHVA 4RTJA 5H4HA 4AKTA 4XQ9A 3K53A 2R7ZG 4MKXA 5TEWA 4BFTA 1O5TA 3CSUA 4IS2A 1YR6A 5K3WA 1TAGA 3EGOA 1TI7A 1I4LD 1RQXA 3PV0A 5TRTA 4OJNA 3TR6A 2PL9A 3BC1A 3DNPA 1QCYA 5LP6A 2BF7A 3GEEA 2V8BA 1ISHA 1QHGA 3C3EA 3R3WA 4P4GA 3H3XA 1TF5A 4FILA 3GX1A 2JDID 3IXQA 4I1VA 4Y7DA 4XIGS 3O6VA 3L6CA 2WE8A 3B6IA 1TIKA 2KJQA 2HTFA 2XUJA 3HPQA 5EIHA 1BEZA 3UANA 2L18A 3A36A 3USCS 3UYLA 2VK4A 2QNBA 4DG5A 4KQXA 3B7PA 4C0SA 4ARCA 3BHJA 2PMWB 3VH1A 2GCIA 1EGQA 1Z22A 3D5TA 4BO1A 4C88A 4HH0A 3W5BA 2G06A 2ZS7A 4DGSA 5KZMB 1KU6A 3WC4A 2OV1A 6YASA 3OP4A 3RRFA 4EA8A 4WZAA 1RQGA 1Y1VG 5LA6A 1QQBA 2XUDA 3R7WA 4R8UB 4HZGA 2C99A 1BKYA 5H80A 5FV4A 5IEJA 4NBUA 3TQTA 4CV3A 4XI9A 5TMPA 3FR8A 4DZRA 1QFSA 3GT4A 2NO6A 4E94A 3IQDB 1K1QA 3AUXA 5EINA 1KYTA 1WB6A 5CXQA 2GOYA 2Q9UA 3IVAA 4H2DA 3RE1A 4IRUB 4YAJA 1JEYB 3JVVA 4NAUA 5A9TA 2RG7A 2VDLB 4FM9A 1T1JA 2RI1A 2ZROA 3CSDA 3GMTA 2MSKA 2AEMA 4BNHA 5HJEA 4D8YA 3EW7A 1JFFB 3QX3A 2C9ZA 1V35A 4PSCA 1VCOA 1V16A 3HBFA 3ITKA 2FEPA 4WKNA 4COOA 1JR3A 3ZGOA 3FKQA 5DQHA 3G2IA 1URPA 1FMLA 1LX7A 1ONNA 2FHSA 3AZPA 1BS9A 3RF7A 2C57A 3AIMA 4JUDX 4XWTA 3BA8A 4ZK2A 6REQB 2ZVDA 2Q5EA 1QO7A 4MUHA 2ZIGA 1K9VF 2Z4TA 4DA7A 1RAGA 2OXCA 3R7DA 2PLNA 1QOQB 3ECSA 1UJ5A 2P7HA 3ZQ6A 2CDRA 2GZ2A 1W0KA 3QVOA 2C35B 3KQVA 2QUIA 1HE1C 2FZGA 3KOZA 4MAFA 4R9VA 2ZE8A 5H81A 1QKKA 2QLNA 5CVTA 4YMGA 1XU4A 2ZDGA 2A5LA 1U4OA 1E9VA 3SEFA 3AY3A 1JIXA 3GEGA 1V9CA 2CJFA 4LDPA 4RQBA 1ND6A 2IUSA 3ULKA 1FLNA 3B7WA 5HFNA 1D5CA 1YJQA 2SKCA 4XE5A 5EWLA 2LDXA 2Q6OA 1KMMA 1SBCA 1M1YE 4YO8A 3U7QB 1U7TA 2V59A 5JATA 3TDMA 2DG2A 5KTMA 2TMDA 1LWOA 1JWLA 2WJWA 5KFYA 1QPBA 4E08A 1BJKA 3JQ9A 3P0FA 1B15A 2ISCA 5EUMA 4UM8B 5EPOA 4BMDA 4EFLA 4AIIA 1PHRA 4RFVA 5KU7A 3BQ1A 1COZA 1Y81A 1BWQA 1UJ4A 5IFKA 3R3JA 2HGWA 4QSHA 1L4YA 1IHXA 3NRBA 1C30B 3ZDEA 4UCRA 1MXHA 4FYVA 2F3QA 1NYLA 2O2IA 5EMMA 3VSBA 2W2NA 5DYTA 3L2PA 1X0VA 2C3YA 3OCJA 2YS7A 4OREX 3CSSA 1SZJG 4JLMA 1CJSA 1NQVA 3VTKA 5L9AA 4ADSG 3LLUA 1CFZA 2PBLA 4UFOA 2OBYA 4DILA 1GU0A 1IUOA 2V7QD 3CIOA 1E1QA 3OH8A 3G2HA 4FYJA 4ARBA 1E2IA 3CRNA 2C9BA 4F5EA 4GH5A 1T6BY 4GVLA 3WHKA 1RVDA 3PD1A 4HL6A 4IJQA 4AZ3B 1HBJA 2F8LA 4EZIA 3SEQA 1ZD2P 1GPJA 5ECGC 2IYYA 2O8VA 1CIPA 2J6HA 4CCSA 1PT6A 4TV9A 4HY3A 2H0AA 2H4XA 3QZ7A 2K6GA 2PTHA 1XNRB 3GTJA 1PO7A 4KJZA 4XYMA 3NOOA 1P4JA 1TTQB 3DF9A 4UEKA 2ONJA 3RF2A 1UFKA 1CJKC 5DTQA 4OLBA 1ZH0A 1AKEA 1R2QA 4M99A 2VWQA 2V6JA 1VJRA 3BD7A 4HGOA 3NTVA 4N39A 4WCFA 3ZU3A 2BMJA 4PBRA 3WGVA 5JECA 4AO6A 3GUUA 1KWKA 2A1IA 3ZZ1A 3NBUA 3T5PA 3VGJA 4K9NA 4DM7A 2BE9A 4MLDA 4ER0A 5KJFA 4Y6RA 1BS1A 3EDMA 2P69A 2IUEA 3H1BA 4JXZA 3QTTA 1GDTA 3X1WA 2NP7A 2F00A 5I4CA 4ALIA 3DVQX 4W1QA 3KT0A 5K8TA 4JYZA 1RC0A 2NWQA 3D3KA 5IKXA 1HA3A 4FGRA 3B1XA 4JVNA 5KHLB 4FFBA 4XDYA 1ZISA 4MV4A 1YDWA 5EKTA 3AOEC 3BAFA 1N2HA 1QHHA 4L5CA 4RZSA 3QP9A 2DBYA 4EQ6A 5KFMA 5I5TA 1DGSA 3FROA 4UTNA 4K0KH 1YL7A 1GTMA 1RJWA 1IQ0A 2AEJA 3DDZX 1TUGA 1EX6A 3EQZA 4L22A 4MQ4A 2LKCA 3W6NA 1P3Y1 3I01M 4DV3H 1VG0B 4QT0A 1VMEA 5FUMA 2Q2NA 1SXJC 1HLDA 5E9QA 3SJ7A 1V3QE 2WWRA 3RC2A 2Y4OA 1L5HA 2V3CC 3N8KA 1YASA 3K4PA 1AMUA 1O58A 4J16A 4R5HA 1WX1A 1Y3BE 1RTKA 3GC6A 3I42A 3KAJA 3DBOB 2XVAA 3HZRA 4WZBB 4CWAA 5DX0A 4C7KA 4IV5A 4Z5XA 5IULC 3RG8A 3Q0IA 4AN4A 1ISGA 4FONA 3GRPA 4UCVA 3VNSA 4Y9DA 1SU4A 3IPCA 3ZQJA 2IYPA 3JWHA 1SHZA 4CHGA 2HVRA 3ANLA 3BM5A 3MJDA 4MYTA 4YBRA 3C3YA 3MRVA 2PGIA 2ZJ6A 4XCVA 1CLEA 1L2ZA 3W4IA 1TM1E 4XJTA 3SF8B 1Z0SA 5KI6A 2QE6A 3CHYA 3EQ7A 2VH2A 2OORA 2W42A 1DAEA 3RK1A 4NWIA 3ZDFA 4BBSG 4H31A 4AUEA 6LDHA 2EF0A 2Q8PA 5LYJF 1O9GA 1OQAA 1BGXT 1XMVA 3BCHA 4HGRA 5DCYA 2V1XA 3MB5A 5FPPA 4OP2A 1JH8A 2R7ZA 1T6NA 1TU3A 1YVEI 2RB4A 3UG7A 4B3TB 1TPYA 1P1RA 1HEUA 5C7LO 1K75A 2I87A 1P0MA 4MWDA 4PFKA 3U56A 1RW4A 4KPYA 5EJ6A 4EQ5A 2GKGA 3L7YA 4TM8A 3UO8B 4DCMA 5I7VA 2VQEB 2EIHA 4H7FA 4LY0A 4OLAA 4RJIA 4WXYB 3TECE 4K81B 2OH2A 4HYYA 4XJXA 3PRKE 3W5OA 2W9BB 4RJJA 2OR3A 2QM3A 4IPTA 4QDTA 1IM2A 4A27A 4QODA 3W2FA 1WZIA 3Q3GE 1G4HA 3HXPA 2ZSIA 4JU9A 4RJKA 3ZWBA 2J7PD 4EL5A 1RM0A 3HU3A 2YJZA 1YDEA 3MOGA 1UXIA 1VG8A 1XMOB 1S7GA 3IDOA 2X7HA 2PKRA 5FFFA 2ID7A 3E7XA 4Y9SA 4MWSA 3FSGD 2CUKA 3DO8A 3KREA 1MC4A 1XVIA 2GARA 4M8KA 5ALWA 2B78A 1LH0A 2C5LA 4DBLE 5JXHA 4D9HA 5J2TF 1RYMA 4G1MB 4WRRA 1L7VC 3BKWA 4PC6A 3B38A 1ZD8A 2VJOA 4WEQA 3VH2A 4X3PA 4RA6B 1EEHA 2EKLA 1CY1A 3RFCA 1Z4LA 2OHVA 1WHTA 3AFMA 2ZATA 3DEJA 2QUHA 3CRMA 3U1VA 2ZBEA 2Q9CA 4LPSA 2VJLA 4FGUA 4DR3H 1L5RA 1NNI1 3C1UA 3NAGA 4A3EG 2P6MA 2XDYA 3PKJA 1G9SA 2C2EA 3JAWA 3O4RA 4ND4A 4WZAB 3RROA 4DIOA 5J47A 3LBNA 2GPSA 1CY4A 3WLTA 3QH4A 4C4OA 1WUJS 2OV6A 2WG0A 2VDOB 3S1AA 4K88A 2WDZA 1UIMA 3TGLA 2AT1A 4EZBA 1DMSA 2QDXA 2OXEA 4HNAA 1HDZA 1ZR4A 3N2EA 2O5RA 4MINA 2FUCA 1A9QA 3KELA 4DC1A 4RFSA 2J46A 4ZCRA 1JDZA 4DCSA 1Q74A 3GNLA 1OAOC 3BGVA 5L4SA 1YQTA 1A72A 1G2PA 4JMLA 5EC8A 3D8BA 5AW2A 1SUPA 1XRPA 4X8MA 3OE5A 4KQ2A 4B33A 1Y1WG 2PO5A 2ATLA 3IILA 2HJSA 4KE8A 1QAMA 4D9CA 5AVUA 3DLTA 4C0JA 4ENQA 5KNDH 2X2OA 3D0OA 3EGCA 2X5XA 2BV3A 2H1HA 2VYVA 3LXMA 1FX1A 3NPAA 5DGDA 4LY9A 3T9BA 3W6OA 4YMLA 1II9A 2BMDA 3H2GA 5TQ0B 5FLXA 3Q8QB 3UOAB 1ZM3A 3G13A 4DAOA 1P1BA 3KPWA 1UC9A 1NRJB 4DPMA 2RBKA 3ZBUA 3JQFA 4RAZA 4JODA 4CLRA 3O8OB 1CUGA 1QV6A 3ABOB 3I58A 4XQ0A 2JFZA 1VHDA 3O9ZA 4GKJB 2WKPA 1SG9A 4K28A 3IJRA 2X9GA 1H05A 4WINA 2VAMA 3ZHSA 1DEOA 4QG7A 5DQIA 2CBXA 3K31A 5LMNB 4J6FA 5GJWC 3DC7A 5C46F 4H0CA 4RY8A 4UU1A 3BKXA 3HVIA 4O8ZA 4BMZA 3E7FA 1LDBA 4WI1A 2ZI6A 1CUVA 3QELA 3ZCPA 2P2SA 4C3UA 3VX3A 1ZJYA 3TLMA 5TLSA 3EEIA 2J31A 2RFLA 16PKA 1PBNA 2WJGA 3PQ4A 4IX9A 3PJFA 1MQAA 4JI3B 5JVDA 4LHYA 3AHGA 4ZQBA 1XXLA 3ID6C 5LMUB 5DT2A 3BWXA 4N03A 4DR2B 1RP1A 3TFQA 3WZ2A 5DSXA 3UXEA 3GFVA 5EZYB 3W2IA 2B9VA 5B36A 2B8EA 3EZLA 4BGDA 5JFOA 1GNVA 2Q3DA 2JFUA 4EPTA 5K3OA 1WF6A 4QFMA 2FE1A 1HNWH 1E0SA 1RPZA 1KBOA 4H3SA 1AKWA 4F60A 1Z4OA 3VAYA 1NU8A 3O74A 3E7DA 1U8TA 2GZ1A 1WCWA 2H07A 2WA1A 3WSWA 2X1MA 3PE3A 2JGDA 1D9XA 1S96A 4EB6A 2WSYB 2JIRA 5LQSA 5B3KA 3OY2A 2Q0QA 3GLFA 1UT6A 3CVVA 4IZHA 3O3NB 2DQ4A 2YMLA 2IA6A 1ETUA 1LA2A 4GBJA 4PLGA 3T3HA 3X2FA 1NLMA 1VKOA 3ZWAA 4BWFB 3V80A 4IDCA 4HAVA 1T1SA 3E27A 5IN4A 2NXJA 1G3IA 2HPZA 2WFAA 3C41J 1OX6A 1HQCA 1TUIA 2K4MA 1X15A 3DAGA 3P0JA 2WP0A 1GGMA 2AMJA 4NBRA 3BK2A 4IBOA 1K2WA 1UPUA 2JCXA 2CUTA 2P9CA 4NMHA 4RKYA 3OCYA 1GT91 2QVXX 3RGGA 5K3DA 4LYJA 3ZYZA 2NVXA 3IIIA 1KZ1A 5HE8A 2NGRA 3MJEA 1NDQA 1NXOA 5FI1B 4AQYH 3C1TA 1RJGA 4I08A 2MYTA 5KO2A 3IIJA 1B3RA 2EW1A 3NONA 4WCFB 1L5GB 1U31A 5CLIA 4LTNA 3QPUA 1B8PA 4Q43A 2I67A 3TSZA 3GJZA 1J6UA 1FQKA 1T15A 2ZSJA 3FBTA 3BH7A 4Y2JA 2FUG6 3GIDA 4L4UA 5EQDA 2BSQA 1K68A 3S40A 7REQA 2R96A 1KO1A 2PUFA 1GGOA 3GJSA 1EUCA 1RP7A 3MR5A 1TVCA 2HZ7A 3DWGA 1DKPA 3I8SA 4MVJI 4P7KA 4DV6H 4RY0A 3N8NA 5J59A 2WAMA 4A03A 1Z2AA 4MDHA 4KR3A 4I5IA 5GADl 1KEWA 1P1FA 1TKCA 1IZYA 1LVUA 1Z0ZA 2ZJ4A 1DG3A 4FGZA 2YIMA 3VPCA 2ZYIA 4UDYX 4Z2YA 2E89A 5JFGA 4DLWA 2YOHA 1SELA 3P4UA 3BIWA 1IXYA 2F1JA 4P7GA 2HWKA 4XSHA 3FXAA 1U02A 1KBZA 1H94A 3KKLA 5I48A 1KL7A 1P62B 1VHWA 1K88A 1J2UA 3D0RA 1Y1LA 3AI2A 4IGAA 4D02A 3OIVA 5AO9A 5JS1A 2L0XA 2DY0A 5EEGA 1X3SA 1DRJA 1ZOSA 1Z7WA 1QPGA 4C5AA 3PO3G 1CIJA 1G6Q1 1EVQA 2DWUA 1QDUA 2VDPB 4O7YA 2IZ6A 2PX8A 3AUUA 1B26A 3BXHA 2W9CA 3GFTA 5KFPA 3GMSA 1MOZA 4PQEA 5HCNA 5I7FA 1ZA2A 2UZIR 3OZFA 4KYVA 3ZWCA 2CY0A 2G1KA 2BEVA 2A59A 3FDJA 2Y1KA 3H3JA 3DV2A 2EX4A 5JYCA 4JI5H 2Q5FA 1E96A 5JQGB 1J0XO 2ZI4A 4OK6A 1T10A 3F7OA 1WLSA 1OXTA 2R85A 4I8DA 1QVWA 2GCPA 4GPZA 4R16A 2IWHA 5TJ9A 1JMVA 5J4LA 2PZLA 2H8KA 1WDMA 3DTYA 1Y6ZA 1KE1A 1MH1A 1F51E 5CM2Z 4C14A 3GROA 3I28A 4UULA 4WBXC 4CG3A 3LT4A 1FP2A 2DHDA 2IYLD 2VSOA 3HCPA 1YE5A 4B9EA 1ZWKA 3BXXA 3T9AA 1OFHA 2ILTA 3BE4A 5AUQA 2AUNA 4C5CA 2WWHA 4ID9A 4J0CA 2OFFA 2XSZA 5JSFA 4QBHA 4XD7D 3GFGA 3IALA 5CJJA 3MJ4A 1YJCA 2HBYA 1OI7A 2VNAA 4UHJA 2GX6A 1W6RA 1E2LA 5LQKA 3FHLA 1N2JA 2PLFA 1K7XB 2W43A 3BJIC 4Z0PA 4ZVUA 4RV4A 2VG8A 5ELLA 3EIWA 3INRA 4UBLA 3N53A 4PQYA 2B99A 5JD5A 2GBIA 1CVRA 4EPWA 1R27A 1GQFA 4J2TA 4G2NA 5HRUA 3W6UA 5A0VA 2ALJA 4J91A 2CFRA 1N0VC 3L0DA 4RZIA 4B87A 1HTWA 2PKEA 1P9RA 1XIVA 3L7DA 3Q8WA 3KYDA 1NLYA 2P9EA 4NZPA 4ECYA 4TM7A 2WTNA 2EKDA 3KKNA 4ZGGA 3TL6A 3WWEA 3GDOA 1PL0A 2VSYA 2H92A 3D2BA 1C4OA 3EWIA 3NOQA 3RUFA 3TZKA 1ZD5A 3T5HA 1BH6A 2AG8A 4AFNA 5HQTA 3TSAA 2B35A 1IZ9A 2MMGA 4FHDA 2ZT6A 3ZGVA 2XZLA 2QX7A 4A91A 4DYVA 2V5UA 3WIBA 4LV8B 1QWOA 4J94A 3FPAA 3I45A 4Q4HA 4H3KB 3DVSX 3C70A 1Q1AA 4XPIB 5EN4A 3OFKA 3WKCA 4ACAA 1YA8A 4UARA 2VZ8A 4AG3A 4EAQA 2KLHA 2Z0MA 3EPKA 2C7QA 1BVHA 2L19A 4BFCA 2O1EA 3VKGA 1H1LA 1EEXB 4RY2A 4IGKA 5D87A 4DV0B 3NDBB 4RTSA 2HU7A 4B0PA 5B6PA 2QQFA 2DH5A 3L8MA 2DUJA 4FU0A 3OTOH 5BQPA 3JTEA 5IDYA 3GUVA 4UFPA 1IHDA 1QHFA 3VV2A 1XJCA 3TIGA 4QREA 4X20A 3TQFA 3AEKB 5DG7A 5DCUA 3WYCA 3V4VB 4IOKA 1Q7GA 4C4PA 3V7NA 1P39A 2UUBB 3UJ9A 1EFCA 4HYKA 3HN7A 5KFEA 3UGKA 2VPWA 3MCTA 1H3NA 4MW4A 4G5QA 3GP5A 1R0ZA 4J9OA 1ZFNA 4TS3A 2CUZA 2BF4A 3RSSA 1I1QB 1M5TA 4HCJA 4YAOA 3HOVG 1H9CA 1CUXA 1ZMOA 2P3QA 1OVMA 1Y42X 1KYYA 1GU1A 4ZALA 3DBVO 4B80A 5IT5A 3UCXA 1WTAA 3BGDA 4DL2A 3U7HB 2NO4A 1LS6A 2J85A 1J8VA 1XL1A 3SEAA 1NPYA 4WEOA 3KKZA 3ZC3A 4RD1A 1CV2A 5ECWA 1T5LA 2GPBA 3LVRE 1J07A 4JBGA 2JLVA 1HI9A 3FCYA 5CP8A 4M7WA 4A2BA 2O1XA 1TQ4A 4LF9H 2R7MA 1WCMA 3VR5A 4I7HA 1CCWA 3PZPA 3F5DA 4J1NA 4KGZA 1SN7A 2Q0HA 3MELA 3KEOA 4DJAA 4QIWA 3G2JA 4LH6A 1XL0A 3T3PB 4UEJA 4AF7A 4FI3C 4ZMSA 1FC0A 1N9ZA 3R23A 3AERA 3PA8A 1Q11A 2HD4A 4IR9A 3RIZA 1ZK3A 3RYHB 3GN1A 2IWRA 5JJBA 2R7KA 1XMPA 3DZBA 4UMVA 4PLYA 4ZMRA 3HYLA 4OSOA 1TJPB 1EJ0A 1Y9ZA 2I4IA 1KZ7B 1P4GA 3HY3A 4KC0A 3TLBA 5TQ2B 3ZNOA 4C22A 3KDSE 1TIPA 2OO3A 4MGZR 4EH1A 3ORFA 2VTEA 4UM7A 3IAS6 5JQGF 1QSGA 4HDKB 2WVGA 3LVFO 2Q2OA 1N7HA 4Z9FA 4L9WA 5G0UA 4JV5B 5A5FA 4FHFA 4J9MA 5M5BA 4O83A 3SHFA 3P32A 2ODWA 2JJQA 5A7HA 1MOPA 4YR2A 4L4RA 3HJUA 2VSFA 3ONFA 5FD8A 3HXOA 1MGOA 3MUFA 1RKBA 4TRMA 4OX9Y 4ZJPA 4ME6A 3AXSA 2C2WA 3QPVA 4Z53A 2HKIA 4U9HS 3TIIA 4ENTA 3AF1A 1WP4A 5KVSA 3H2IA 2JLSA 2P9FA 2VOJA 3IUYA 2AQ4A 3HEBA 2CVQA 4JHXA 4E13A 5IFLA 5E0OA 3PU6A 4OHFA 3PX7A 4IH9A 2Y1GA 2KWIA 3SQOA 1GTSA 4G85A 3MT9A 4J0DA 1XZNA 3G2QA 5ALNA 3TUJC 2D1RA 1KQPA 1G20E 2AYZA 2B8TA 2JLRA 4XR9A 4A92A 5LLDA 1QRAA 5HM6A 1FFEA 2LIVA 3W5AA 1GSIA 3LGAA 4X6XA 4AXBA 4DLYA 1QG0A 2DX7A 3WGHA 2UYYA 3I09A 1T35A 4C0AC 1N8TA 3Q41A 2BGGA 2P35A 1MPXA 4EA6A 2COJA 2ISSD 3OIGA 5CH3A 2VP4A 4ALNA 1WVGA 2CK3A 3EFEA 5KUTA 1J1ZA 2R47A 2IBMA 3A04A 1SGWA 3UMYA 3QWHA 1D2HA 4YJHA 4LQDA 1SIOA 1KO4A 3GILA 3LF1A 1OWMA 3JSXA 3L7NA 5E25A 1KETA 2YY6A 1Q50A 4HNQA 5E7JA 1E0JA 2DBRA 1FF9A 1EM8A 1S9DA 1TZBA 2WAYA 1XOIA 2X76A 1RHUA 3EVTA 3O47A 3QVSA 4WA8A 1MVOA 4KQMA 2C31A 2ZYVX 3OHAA 5G40A 1T6YA 1ADCA 1PR0A 1N3BA 1USGA 2Z8ZA 4E5SA 2B92A 3MERA 1OU4A 3V2HA 4DN6A 2D7CA 3E9QA 3SDBA 4U9UA 4JENA 1F8FA 4QXRA 3UK7A 4A6EA 1P0CA 4D74A 2FFHA 4E5VA 4JSYA 5CFRA 4DR1B 3CQ9A 4LZAA 2RCNA 4U2CA 1H3FA 4MYUA 4EGJA 1RBZA 1U90A 1IU9A 5K3SA 3WMFA 1KBQA 4ZQCB 5JRJA 2DJ5A 1QG2A 1FFGA 1JIJA 2VWPA 5D3KA 3WGGA 5CFOA 1JAYA 3OEHD 2LCFA 4WNAB 1OT5A 4ZU3A 1A9PA 1ML3A 2G5GX 1GAXA 2O1WA 3DFZA 4X71A 2E4ZA 5G1NA 3T1NA 3R6TA 3TXYA 5KSWB 5A3JA 5JNLA 3H8VA 3V4SA 4YUAA 1PZGA 1U65A 1FP4B 4EKNB 4TYNA 3GAFA 4BY7G 3GLUA 4MS1B 1N6HA 2WUWE 3DZJA 2WNHA 1LJLA 2TECE 4J7CA 4XZ3A 1R8JA 1GJRA 1SAYA 4D8UA 3COWA 3Q10A 2R7LA 4QXPA 4BMNA 2ZBVA 2G4CA 4WXPA 2X5KO 3CX3A 1CRQA 1FUKA 1QV9A 3EXHA 3F5MA 3IIMA 4Y2VA 2XHEA 1F48A 3JQRA 4HTFA 1A4RA 3G02A 1V9SA 1E77A 3I52A 4JWKA 4OJKA 3MMZA 3KS9A 3WO1A 3LIPA 4U8HA 4A16A 1JL3A 3K0CA 4HDNA 1YV9A 4JNCA 4ZYLA 1IN6A 3Q1KA 4O7TA 2OHIA 1P1CA 1J0CA 3CKLA 2RGXA 3PEUA 1EE1A 2JAQA 3D6VA 4NY1A 3T5BA 1X87A 3EE6A 5KTOA 3C3AA 3CE6A 3A6ZA 5A62A 3I2FA 3T54A 5LM3A 1GFSA 2NXNA 1G1MA 2G4VA 4UAVA 1V6CA 3CMMA 3MUOA 3W8RA 3FTEA 2BFFB 4UZEA 5JMPA 2QRUA 5DVZA 3I53A 2C92A 3FMVA 3M6LA 3RFUA 2OZLB 1XMIA 1SEIA 2FN8A 2EAUA 2GEKA 2GI4A 2WNSA 4II7A 3G8CA 3N59A 1X7XB 3ILXA 3K9LA 4L5BA 5ARCA 3GUYA 4LNAA 5H3HA 1DG9A 2X6QA 1I4OA 4AP5A 1EVEA 4UREA 2WB4A 3LQFA 4BKMA 4DIKA 3MWEA 3IDAA 1ISMA 1SKUA 4J9PA 1QC5B 1VCIA 3H9JA 4KQ9A 4KI0A 2UUCH 4V24A 3BMQA 3EAQA 1MC1A 1D2EA 5ALYA 1QORA 4PRKA 5P21A 4ECEA 1LJUA 4JOSA 4HWPA 5TS3A 5A4DA 1K8XB 3UWPA 4NBWA 4LJ5A 1GAJA 2GETA 2ZDQA 2CZQA 3PC3A 4AYBE 3BN3A 1C14A 4OAPA 1EVJA 1UC4B 2AA3A 2R8YA 3LD9A 2RHDA 4K9DA 4OGGA 2E4UA 3A9SA 3DHEA 2LDBA 4NZZA 5CIWA 1ZJZA 3D8SA 3D7LA 3CT4A 3M9OB 2XUIA 3THYB 5ALHA 4YGYA 1KI1A 3EPLA 1EFRD 2OCIA 2AN5A 3P4YA 4PWYA 4G0PA 5BWRA 4DEXA 4A6DA 3U55A 1P0QA 2P68A 3ED1A 2P3OA 4E2YA 3ZZMA 2BN4A 5EWJA 4PV7A 3ASZA 1H0HA 3JYNA 2FUG1 1UZAA 1QH1A 4YAUA 5BWUA 3C7KA 4C0HA 4YYZA 1F2TA 1XDZA 4BS9A 4DT1B 3BL8A 3M0EA 3A9UA 3WGUA 2W2QA 2ZAOA 1FEZA 3VJMA 4TUYF 4RD3A 1FVFA 2TMKA 1IG3A 4ENWA 4MB2A 4JP5A 4N6GA 4WNIA 2P5TB 4F6RB 3BBPA 3E22A 4IILA 1KAOA 3RC3A 1T8PA 1APBA 1H6AA 1EWKA 2QV0A 4Z9YA 1ZHFA 2Y1WA 2QG9A 1LVGA 1A5AB 2ZS9A 1P33A 4ZO6A 2X1VA 5AVVA 3UAOA 3SZRA 1XKQA 3R6WA 4GU5A 3QFCA 4R8VA 4TVSA 5HKLA 5ITVA 1QF6A 1U3DA 1QOPB 1T8TA 1GDHA 1W0JD 3QM1A 3EULA 3QVJA 3GT0A 2AOTB 1PV4A 1KFKB 2R6JA 5FOUA 3V3KA 2G83A 4D56A 3QWBA 2HHJA 3P9ZA 1O96A 1W76A 1EU1A 3OWHA 3KFXA 2UV8A 5LP1A 1BRMA 2IODA 1NXTA 1YB5A 1DXQA 5CCEA 1KHHA 1S89A 1QKIA 1CUCA 4OBBA 4WN9A 1SVOA 1FU7A 2R8ZA 3IEIA 4KN9S 4R2WA 2V0CA 3EBLA 3JALA