2HVRA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 3'-deoxyribonucleotide at the nick
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
333
structure length
319
Chain Sequence
b'SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/rna/dna
total genus 83
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvrA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvrA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvrA01
4GLXA 1DGSA 4E6NA 1CKMA 3RR5A 2HVRA 3W1BA 3JSNA 4PZ7A 1CKNB 3NBZB 4UCSA 4UCRA 2HVQA 3BABA 3TY8A 5FPOA 5D1PA 1P8LA 4LH7A 1VS0A 4UCUA 3BA9A 4EFBA 3VNNA 4PZ8A 5D1OA 1S68A 3GDEA 3JSLA 4EFEA 3TY9A 1XDNA 1V9PA 2OWOA 4LH6A 3L2PA 3PN1A 3S24A 4UFZA 4UCOA 4EQ5A 4PZ6A 1P16A 3NBYB 1B04A 4EEQA 5DISC 5D1OB 2CFMA 2Q2UA 3UQ8A 2Q2TA 1FVIA 2VUGA 1CKOA 4CC6A 1A0IA 3W1GA 1TAEA 3BA8A 1XK5A 2HIVA 2HIXA 1TA8A 3W5OA 4UCVA 2HVSA 3NC0B 3BAAA 3QWUA 3GB8B 3RTXA 4CC5A 3GJXB 3KYHC 1X9NA 5FPRA 4DRFA 3TY5A 1CKNA 4UCTA
chains in the Genus database with same CATH superfamily
3VWBA 1TW3A 3WG9A 3TP3A 3WTUC 1FYMA 5DMXA 4LFUA 2R85A 3SZPA 3BZCA 5L1JA 3LSIA 4BQOA 3K70D 3S1NJ 5HVQC 3IRQA 3OTOH 1SVOA 4CO8A 3G1MA 2ASLA 4KT6A 5JQWA 2M4GA 4Q4CA 2UXXA 4ZYAA 5EG0B 3C3WA 2NU9B 5IYBG 2KHMA 1G4DA 4BDZA 1Y8QB 4CA0A 4AQYH 1E2XA 1I2LA 2V6CA 3SEQA 2C6YA 3LSTA 2H27A 5DAAA 3GV8B 1T36A 1OCPA 4HNVA 3T9AA 3QRFF 2H8RA 4JYKA 4MFDA 1OQYA 1V5EA 2XGDA 3GFLA 3KP6A 1YW8A 4HAMA 3RDIA 4BNCA 1CS0A 2I80A 2I5UA 2M3AA 3I0TA 4QIWN 4M6XA 1ORKA 3MWMA 2HPMA 2BXYA 5GAGJ 4HBLA 1W36D 2HHFB 3M8EA 1TWAA 3PIOF 3G6XA 1RRJA 1RK6A 2FF4A 2FNAA 3LA2A 1P2FA 3HIFA 2DPIA 4UVCA 2NU8B 3OUZA 3WWHA 4NZNA 2YX7A 1TWFJ 2QYOA 2DJIA 4M3BA 2Y48A 5HS9A 5FD6A 4A3IJ 4U88A 4CKBA 2YU3A 3M9OB 2DA6A 4LLGF 3LSKA 3ZMUA 3PFYA 1U5TB 1WH7A 1JKOC 2Q2EB 1VFCA 1SFUA 3S24A 1XMQH 3DPUA 2WYOA 2GPSA 5J8CA 4ESJA 2W71A 2Y4RA 1TWCA 4MTEA 4PJNA 1BR1A 2DPJA 2QM3A 5KT6A 2RVCA 2E1CA 3I4MJ 4EGZA 5I5XA 4XRFA 3JRIA 1EZ1A 2FK1A 1VKZA 1YW7A 2CFXA 1I27A 5J1RA 5D5WB 4JV5H 3GTGA 4KYWA 3C7JA 3OIQA 2VIXA 5CLSA 4NDLA 1K78B 4YJ3F 3LAPA 1S72I 3TIIA 4ECRA 3QOEA 1IN6A 1TW2A 1ZKGA 4TQRA 4IX7A 5DQIA 3DEUA 4GYIA 2C2RA 2R7FA 3WTWC 2UUZA 1KQ8A 3FM5A 1Z21A 5T14A 4JV2A 1KJ9A 1VF9A 4OMZA 2BVMA 1JE8A 4FFPA 2KMUA 1IOVA 2ZJPF 5I5SA 4NXNH 1RYSA 5DCMB 3RB0A 2DMPA 4IZOA 1D0XA 3WHCA 2R7RA 4DOZA 2E19A 2FXAA 3BPVA 1W7PD 2XDVA 2IS2A 2IA1A 1I6UA 3RF2A 4N4NB 1DAAA 1VTNC 1SD6A 1EF4A 4QWCA 3RTXA 1V55H 1FIAA 3JRWA 1K1QA 5I5UA 4DUZH 3TL4X 2DTRA 1MNMC 4PCQA 2QYZA 1AWCA 1X1BA 2YUSA 2CW7A 4ITVA 4ENMA 2Y31A 4IQJA 2JSCA 1AUVA 4M0JA 1G3WA 4KN4X 4Y3OA 2QVOA 3JAMK 1V54H 1Y39A 3CCVI 2ID6A 1Y1VJ 2MFZA 2W24A 3FHNA 1DQUA 1JI8A 2R8HA 3KZIC 1K1SA 4HSTA 3MKWB 4FHTA 1PUFB 3FBIB 3WGIA 1CF7A 3KP3A 4X6AJ 2XGPA 4XKCA 1W0UA 4ED6A 3MCZA 3VSLA 4AIHA 1Z9CA 3GIPA 5KFGA 1PYVA 4KMUX 2WV1A 2AGPA 3PR5B 5FLMJ 3QFFA 4C3HJ 3SJMA 5BYAA 4PWQA 4XNFA 5FKOA 4RB2C 1W5CC 2ZXHA 2R8GA 4GCVA 1FWZA 5FFZA 3S16J 2YRXA 1YHQI 2R86A 4IQ4A 9ANTA 3OWTA 4O7ZA 4DR5H 2VE8A 4OWRB 1FBUA 1QGPA 2AXTC 3OYBA 4A3DJ 3GFMA 4YAKB 3GXOA 3KPHA 1UJ8A 4A2AA 2MBFA 4AYBA 2F4IA 5JH7F 4MLOA 1ZRDA 2E2JJ 2CWEA 4UUTA 2DMTA 1ZG3A 3K4NA 5DCFA 1UHMA 5IPAA 3L2VA 4E4TA 2XAFA 2CQXA 3MWDA 1BC7C 2W25A 1D5YA 1KQ0A 2TDXA 2CUEA 4XICA 4RB0A 2XD4A 3KLNA 2VUMJ 2H1KA 4CHIA 2LBFB 2B63J 4HLXA 1IZ1A 3VA7A 1XTAA 1JXLA 3BG9A 3CC4I 3HOZJ 4UXNA 5D8DA 4YHHH 1FY7A 2FA5A 5KS8A 2ZMEB 1GO3E 1ZQ7A 1WJCA 1WPKA 4HQEA 2KIMA 2K4JA 4G94A 3BT9A 1QPIA 2UVRA 1XGOA 2Z16A 3AG1H 5C3EG 1Y8RB 3ZQFA 3CCJI 2EA4A 1AN7A 4HQ6A 5EGOB 1FOXA 2W70A 2XF7A 3JREA 2ESNA 1VBGA 1ON2A 4O83A 3GTPJ 4ZJZA 4BBSG 1F36A 4J9LA 3BQ0A 3OY9A 5KFEA 3TOBA 2JVGA 2LY2A 5DGHA 4NYEA 3UQ8A 3F21A 3RKYA 2Q2TA 3OSPA 1ZG5A 3IH4A 1FYLA 5KFSA 3G8CA 1N78A 3WO0A 3F8MA 3ZMZA 2AQEA 4JI5H 3JRBA 4BACA 2Z1DA 1EUCB 3L00A 2VOOA 5IP9J 4B48A 1UZCA 3KHGA 1YJNI 3T5HA 1HNXH 1KQ9A 2WAFA 1YRNA 5KG0A 1H8AC 1M6VA 2ME0A 1T08B 4HW0A 1T56A 5LBQA 3W5OA 4G6QA 3W6JB 1VQ6I 1S7OA 3OYFA 2XAJA 1SANA 2HKXA 2KZVA 4MEXF 5JVLA 5H20A 2D5VA 4IR1A 3MFHA 3GJXB 1G8XA 1IOWA 4GFBA 3CMYA 3A0BC 4U7DA 4BYYA 4ED8A 4QTRA 4V19K 2NNNA 1I7LA 2OJED 1R1UA 2E1MB 5EWFA 4E4HA 3A4CA 3HKZE 1TWGJ 3ABMH 3GVAA 1Z1DA 5ILUA 1SFOJ 1OCTC 2DPUA 2CV1A 2ELHA 2R7VA 3F6VA 3E1SA 2OUMA 1A36A 2XKPA 4PDKA 4AD9A 4B3TH 4A3GJ 3B6AA 3TP0A 4IHVA 2GWRA 1W4MA 1W7PA 2KL4A 4WK8F 4BQNA 4LK0F 2KIUA 2OCCH 3ZCOA 4IRKA 4BE0A 3BPXA 1XG1A 1OR7C 4LFAH 2BHZA 3I59B 1EHIA 3KZYA 3BG6A 3JSOA 3RV3A 3N44B 2QUFA 5ICEA 2DA1A 3N43B 4AIKA 1BOAA 4FGRA 4N0BA 2GXBA 2J6UA 1FOWA 3S32A 3EUAA 1LE8B 4ZDLA 1OCCH 4ED7A 5IT3A 2ABJA 3BQZA 5TISC 2ZNYA 2GQQA 3E0JB 4RMNA 4DL7A 5FPOA 4FBUA 2EWNA 3KFWX 2LH9A 4EQQA 1GDTA 3Q2OA 3QPHA 5IT9Z 2CW8A 2GM4A 2R87A 4DV7H 1WZ2A 3P9IA 4F7ZA 3VPBA 3WG7H 3VB2A 2R82A 4CHUA 4Q8FA 4CMFA 2RN7A 1ONVA 2JA8J 1GSAA 4XLCA 3MR2A 2G0EA 1U6GA 2CMPA 5CQEA 1XB4A 4M9UA 4XBFA 2X0LA 2V4JC 2E60A 2JEIA 1SAUA 3QPLA 3GFIA 4O7VA 2WADA 2GPWA 3GLLA 1KC7A 1K4TA 3A01B 3LL7A 3NWTA 3S2WA 1IRGA 2P8TA 5LMUH 2OA4A 2PJRB 5KFMA 3H4BA 2Z02A 5GTIC 4TV9F 3ZP5A 1MMNA 4LOCA 1PDNC 3FKIJ 2EQRA 2IGKA 4D0PA 2DIKA 5IYCJ 3BZ6A 3K69A 2DCEA 1A3GA 1OWTA 4IR9A 2KPMA 1XNRH 3AL0B 2HQ5A 1JKJB 5ICGA 1BL0A 2AS5F 3V6JA 4BHCA 3K9TA 5EEGA 3MAJA 1NG6A 5HLHA 1XC5A 4BXUA 3FXOA 2E5NA 2O5RA 1ZAOA 5CJ9A 5JVGF 3ECOA 3ZQIA 3OOPA 3HUGA 1KGSA 1X3WB 3ERMA 2OC6A 3AYHB 1RKTA 5EDWA 4HSRA 1EYZA 4DIMA 3CDIA 2X9DA 1VQ5I 3WNZA 1HQCA 1PVEA 4ZDPA 2EFNA 3PW5A 3WGHA 4WXCA 2QQAA 5C44G 3F72A 4I02A 5CVRA 3E5NA 4O84A 5FJ8J 5LL6b 1IRZA 3KLOA 2L7ZA 1HKSA 1W36C 1Q1VA 2HYJA 2WAQN 4DQNA 2EV5A 1R49A 2LDUA 4XSXF 4LG0B 3M7GA 1ERDA 1FLIA 4HF0A 4ZYEA 3BOQA 2ACJA 2R7OA 2BV6A 4PJLA 5AIQA 5AONA 3DFGA 2ESHA 1VQPI 1S7EA 3U9SA 1GT0C 2FPGB 4LF4H 1AKHA 2SCUB 5IYZF 5EYRA 4E6NA 4C5BA 3RR5A 1BI2A 3OL4A 1RESA 2XPVA 3BQ2A 4UVAA 5FROA 3R9RA 3DEWA 1LVAA 2W6MA 2Q8KA 2KISA 2YZNA 2UZKA 2Y0SE 3CLOA 1J09A 4BWSC 5KAIC 2ZDGA 4Y52J 4O3MA 4BDYA 5L9XA 2RDJA 1V5GA 3V8KA 1BJAA 4B3XA 1OISA 3NBZB 1Y56A 3ZPLA 4OIPF 2M5WA 2NOJB 3RTRA 2Q1ZB 1DV1A 4WBNF 1EV7A 3HSRA 5GADJ 2XUBA 4PDBA 2DTZA 3S2HJ 4RCNA 2VQLA 3DTKA 1N25A 1OCOH 1P7JA 3GCMA 1MIJA 2E2HJ 2OZ6A 5DD4A 3T99A 3RJ0A 4A12A 1S03G 2Y9YA 4EBDA 3IH3A 4I2OA 2R7NA 4BU2A 3DTFA 1GGOA 3BCBA 4RB1A 5D6EA 2P6SA 3GLKA 3H40A 3BTJA 3H5RA 2UVWA 5E3LA 2OTLI 2W84A 3DEEA 4J01A 2DO7A 2YR2A 3O2PE 3OYCA 4A3CJ 2M05A 3RAXA 2HHFA 4Q8EA 4ZDOA 4EFEA 1SFKA 4L1KA 1A0GA 3LULA 2R7QA 3PN1A 2RV8A 4NQWB 5BWWA 2WTFA 4KNYA 5BWVA 1STZA 5DGBA 1MDMB 3HB9A 2RAEA 2FP4B 1V4YA 1BBYA 1Z6TA 5B3SH 4DV5H 3ZQLA 2VQCA 3BQYA 4QPOA 1RIOH 2DAOA 2RKHA 3BR3A 5KG5A 1N77A 1ZHQA 4O4JF 3PFFA 4DJAA 1KT8A 3E5UA 3CSWA 5E1WA 4A5MA 3H0DA 1XX5A 4HQMA 1HBXG 2AHQA 1T6SA 3LSMA 1SD4A 1WSUA 2V1UA 2CNVA 4RGXA 1UFMA 4BJ6C 2DFFA 2O3FA 3SGIA 4AYBE 2YS6A 1XGMA 1E4EA 4A69C 5FFXA 4RAZA 4F93B 4RNNA 1HKTA 4RGRA 2IJLA 2XPUA 1VQ9I 4ECSA 2D1HA 5JQGF 4ED2A 2NU6B 2ATLA 2PG4A 2X6WA 2ZB9A 1ZQ3P 4J9NA 1XPXA 3DPTA 2W4SA 3GLXA 4O7YA 3ZR8X 1P4AA 2QSFX 3ONQA 4IF4A 4AVPA 5F04A 4JI8H 1YITI 3PNTA 4NHJA 3GTQJ 1BA5A 2E71A 5EDNA 1JKRC 3GIIA 1HA8A 3R5FA 1J5YA 4LD5A 4E6KG 2VASA 3VPCA 2DK5A 3N6RA 4DW6A 3KEYA 1W5SA 2A6HF 5J3LA 3PW2A 2EIMH 3TMOA 3SZTA 1RJPA 3ABTA 1XK5A 3CEBA 5CVIA 5ILSA 4QW8A 1D5VA 3RCOA 4L18B 3CUOA 1TWFA 3BY6A 4FISA 4CYDA 3BAAA 2NYXA 3SFIA 4XONA 4ED1A 2BQUA 4IWXA 5C4JJ 3N40P 2Z2SB 3DWLE 4C9YA 4N9HA 3RUPA 1YIOA 1JGGA 4I99C 1ZLKA 1X9NA 5ILVA 2VQFH 2EV0A 3R4KA 2KFDA 5L3BA 4ENJA 2YWVA 5DDGA 4DR7H 4B3RH 2L0KA 1MMAA 2L7FP 4J9PA 4BGDA 3PW7A 1U8RA 1N33H 2WDTA 3I4NG 3EPIA 1LUJB 4ZZDA 5HBRB 1NG7A 3K4CA 5H6RA 1I5ZA 1F9NA 1K4SA 3K4MA 2NOGA 2DYRH 1YOVB 3EQLF 4Y8VB 3I4PA 3JZFA 4EJVA 2LMDA 1P7IA 4U0WA 1MNDA 2R8IA 1HC8A 3OOUA 3H5AA 2DJNA 3BR5A 3ZXSA 2LKSA 3E6CC 2Y0MA 1LQ1A 4U7CA 4DV2H 1WHUA 1RJQA 3IKVA 2FMAA 4J19A 5DG9A 3EUHC 4G7HF 3AG2H 3WWJA 2EILH 3Q8SB 5BPIA 1JJ6C 1IO2A 4MQVA 5DD8A 4AWXB 4RLQA 5BQTA 4MNUA 2FKLA 5KFOA 2MC3A 1HDPA 4X1EA 4A3IG 3ERED 4F91B 1ZR2A 4A3KG 1I1SA 3NUAA 1K6YA 2VQEH 5FKMA 4XQFA 4LSXA 2XGQA 3M1CA 4OU0A 2KSWA 1P4WA 1EH6A 3G2BA 4HF2A 2C00A 2CW0F 1H0MA 1R4MB 5DYMA 3N97A 4A3MG 1I1MA 2VJIA 3KXYT 3I4MG 5D1OA 3JRCA 5LGUA 4B3SH 4UUSA 5GTHC 5TGTA 3SE7A 1CQTA 1M0TA 3EYIA 5EWEA 1E3HA 2WB1N 1XDNA 4EGJA 5IP7G 4QW9A 2RREA 4HZFA 2NNYA 2HFHA 2CNUA 3GIDA 4BJ5C 3BC8A 4PK4A 2DABA 3DF7A 4JI1H 5AIPA 4IOAF 1WR2A 4O7RA 1Z7LA 4ASNA 3F23A 2PN1A 3MD2A 1B8IB 4FE4A 3SNOA 4DAAA 2VKDA 1R5ID 3CP2A 2CRGA 2O61A 3CLQA 5H2FC 4O3QA 3F6OA 1MH4A 1RR8C 5LYJF 2ADUA 3EUKL 2CYYA 1SMTA 1TT5B 3K1NA 4GO1A 1SD5A 2R0QC 4JUZA 1GSOA 2L5QA 4BEHA 4ECTA 4ENKA 2VPQA 4DL3A 1PP8F 1H89C 1A35A 4KMFA 1B6AA 2VLAA 4LF9H 3V7RA 3HTSB 1FVIA 2H1LA 3I5UA 1TWHJ 2V9WA 5ICCA 4IEJA 1IF1A 2W7OA 1ZN2A 3FXLA 2JEFA 2FQ4A 2OCEA 2K40A 1TBXA 4A0YA 3GO5A 2VUMA 3M4IA 5FRMA 1R6RA 2P7VB 2B63A 2ZJ2A 1GVDA 4UB6C 2LSOA 3CDLA 4BKXA 3KP2A 4XKVA 2I8DA 5KHDA 4FU0A 3WTZA 3WO1A 4O4HF 1LDJA 2CH0A 2KZGA 4QJFA 2ZXJA 3I71A 3KYHC 3HKZA 5KT5A 2ETHA 2JUCA 1T39A 1SMYF 3RBDA 3F9KA 1ZG1A 1H9TA 1HKQA 2FSWA 1MZBA 2HPIA 4MV6A 3Q0VA 2LR8A 4YR3A 1T94A 2JA6J 2BZTA 2R84A 1ZK8A 2F4OB 2MYSA 3HOYJ 5JFRA 5KFQA 4OAYA 3HJEA 2HYFA 3HRSA 4JX4A 3WU0A 4PGHA 1CGPA 3ORQA 4A3DG 4KHPH 1ZELA 4G7ZF 1S29A 1MNEA 3WE3A 2B9SA 5LFAA 2DOAA 3GF2A 1WI9A 4LF8H 3LAJA 2XB5A 2LYCA 3TO6A 2MCTA 1B6SA 4YELA 1F43A 4KIFA 2DMQA 3KREA 2W8KA 3T54A 4JX5A 4U87A 3ORRA 5CVVA 1S0MA 4HPQA 3VYSB 2VUMG 5K7HA 3W3CA 4E7JA 2UXNA 3BCAA 2XV4S 5HDNA 2O6GE 2K9LA 2M4KA 5L3EA 5KT3A 1U8BA 4D1QA 1HNZH 4XLHA 5BWUA 3DF8A 4CXFA 1MBKA 2R7TA 1XCBA 3PO3G 2NS7A 3HOSA 1FYKA 1EKPA 3HOZG 1JUSA 2A5WA 5DQGA 4I4TF 1K83J 1POGA 4UVBA 4Y15A 4TQSA 4L5IA 1JX4A 1BR4A 2BEOA 4ZZLA 2HGXA 3V6KA 2GIVA 3TGNA 1NK3P 1L2ZA 1BOBA 2Y75A 4RZRA 2A05A 4JV0A 5HODA 2HEOA 1IXRC 4GRIA 4LJZF 1TTYA 1QZYA 3K4BA 3PL8A 4PZJA 5GP9A 1S10A 3WU2C 1FTTA 2CQQA 5C1OA 2NUAB 2IA6A 3H35A 2RDPA 3J81K 4E7LA 2V1DA 1XS9A 1TWGA 4NUBA 3H9JA 1EKVA 2P0AA 5KFDA 3RSNA 1TLHB 4KN7X 1O3RA 1XMKA 4MFEA 2XC7A 1E4GT 4F3QA 2X4HA 5DUIA 3HT5A 5F9LA 4I6ZA 1F1ZA 1MBEA 3SDGA 3J7YJ 3N05A 1SAXA 3M1EA 1FOKA 2HOTA 1T33A 2M34A 1Z67A 1F4KA 4ZQIA 3HHGA 3S15J 3D5SC 2K5CA 1J75A 4FCYA 4RBOA 4G7OF 2LTPA 2UUCH 1VQOI 4HYEA 3BR1A 1GHCA 4CKEA 5KKNB 2LG4A 2K3FA 2X85A 5ICFA 1KZHA 3MJFA 5BOXA 3MZ8A 3CUQC 5JHUA 1QU3A 1DIKA 3Q3SA 1JDBB 2VUGA 2FNPA 2VBYA 1I3QA 4CDGA 5KT2A 4AIJA 3E5QA 2RDIA 2XCPA 2BE5F 3HHHA 4MGRA 2J6SA 2YSRA 4EGQA 1N48A 4EM0B 4QWQA 4CZCA 2E7WA 2OF7A 3DPLC 3BA8A 2COIA 3TO7A 3J80W 4EYIB 3JZ6A 2X48A 2CU7A 1ETYA 2QK4A 3G1OA 4HNTA 3CCRI 4L9NA 3WE2A 4JP0A 3H4DA 2VQGA 3CQZJ 3T5XA 2IMWP 1SEUA 2F6CA 4R8HA 2KQRA 2EJ3A 4FFRA 1EH7A 4LITA 4BY1J 2FOWA 4UY8I 2R4GA 3G4SI 5DM6F 1W0TA 4DL5A 1VQ4I 4FFNA 1MJ9A 4JK1X 3IKTA 5J2TF 2E5ZA 2FBIA 1G59A 4Z2YA 4Y7NJ 5FR9A 4L0ZB 2YCHA 4O3OA 5F6FA 1OYIA 4XKWA 5FLXW 2ODTX 3JCUC 3MR6A 1O7LA 1WGXA 3KALA 5FKNA 3FKIA 3UR3C 2FU4A 3R60A 2Y0SA 4UV8A 3RQ4A 1CKMA 4FFMA 1YG2A 3LMLA 4A3EG 4G3IA 4GKJH 2ZSIB 1OR7A 2ZO4A 1U78A 4XLNF 3TEKA 4UB8C 2A61A 1LVKA 3GTJJ 4FE2A 1D0ZA 3AKZA 1IXSB 3U0GA 3FWEA 4B8XA 3J7AO 2YRWA 2ZFUA 3RZDJ 2NVTJ 1NH3A 1SC7A 2LF7A 4C2UA 3FXQA 1XSDA 2YZGA 1UNNC 3H3VH 2LRDA 1HR0H 1OYYA 2OQGA 4II3A 5E20A 1CF7B 2HNHA 2JA8G 3TY8A 2VI6A 3GZ6A 1A04A 4V2GA 5KT4A 5CB4F 2HYGD 5FKLA 4DV3H 4HG2A 1T8IA 4O2AF 1LEAA 4CMDA 1SEIA 2HS5A 1DU0A 1UELB 2ZNZA 4HV6A 4QPQA 4ZTJA 4XMYA 3W2AA 2E34A 4LB5A 1BI0A 3TKYA 2DODA 3R6SA 4JXUA 1R22A 5IY5H 2P6TA 4Y33A 2NVYJ 5IYDJ 3O6BB 2BXZA 4FS2A 2STTA 3O8HA 2UVVA 1IYDA 4A3LJ 1V51A 4JOMA 1AA7A 1O57A 1XGSA 3HDDA 4A3FJ 3WTXC 1IDZA 1C30A 1CE8A 2G7HA 4IHJF 3TY9A 2CZGA 5EZHA 3FKIG 5IYCG 2JEGA 3PSIA 2UXDH 3IH2A 3IAM2 3P7NA 1IG7A 2FLPA 4Y4RA 1RZ4A 2V9KA 2VPRA 4BXFA 2ZXWH 1MMSA 2W6QA 4J9KA 2R8JA 3L2WA 3ECHA 4IHWA 3BR2A 2I87A 3HC7A 4BHPA 2IA2A 4DL6A 1H88C 1OMIA 4KJZA 4PZ6A 4BH9A 4YFXF 4BXXJ 4FT8A 4I0AA 3RB3A 1TNTA 2IGOA 1EKFA 1B04A 4EEQA 2A6TA 2E1NA 2WB1A 2R7MA 2R5ZA 1G2WA 2RF4A 5C5JA 1ZGJA 3L1PA 3HOTA 2VONA 3J80K 3I9V2 2R7UA 5M3FJ 2YU9J 5LP6F 1FBQA 2W00A 4CH7A 5JI6A 3T0YA 1N34H 1V5FA 4UNOA 4EATA 1ZREA 2V7FA 2QKLB 3KHLA 4MAMA 5F1RA 1ULZA 3VFZA 2JSPA 3CJNA 2VR1A 1WJBA 3LSHA 2XSJC 4RA2A 4HDUA 2DPDA 2E2HA 3U2RA 5D5XB 4E70A 1KU2A 2K85A 3ML6A 4BBRG 4JI3H 2NVQJ 3PR4A 4DNCA 2LY1A 5FLXK 1TAEA 4DV1H 3K3PA 4N9IA 4WD3A 2MSYA 2HQRA 2V26A 4L0YB 3NC0B 4F50A 2AU0A 2J5PA 3M3YJ 4I01A 4HR7A 4ZOLF 3H9GA 1B9NA 2HQNA 3OMYA 4LK1F 4EJUA 1FIPA 2OBPA 2GQSA 5KT7A 1N75A 4P9UA 2L3DA 1LFBA 4F4XA 1YJ9I 1RUNA 4ABZA 3G71I 1KUTA 3H0GA 5HLGA 3RZOJ 2CJJA 2UVUA 2EA2A 3T8TA 3U54A 2FQ3A 1YRNB 3GTOA 3VYTB 2YZLA 5FB2A 1RNLA 4ZC3A 5CA0F 5LOVF 3KAKA 2R5YA 4XSZF 2PMZN 4DLKA 4DQ2A 3MR3A 2CS3A 5KFNA 4OIOF 2VC1A 4YFKF 1EJ9A 3SI8A 2BY1A 1R9TA 4JI2H 4D7NA 4BJTA 3QYEA 4G6DA 5HNHA 2UUBH 2Z3YA 4M71A 2M2EA 3G6YA 3ZN0A 2UV1A 2XB0X 4FTHA 1X2MA 4EYHB 4J9OA 2NVXA 1YW9A 3J7AY 4O3RA 2XGCA 3GTQA 2X6YA 3K1PA 3G73A 3F8NA 4I50F 1FJLA 2R8KA 2DFIA 3HPGA 4CZZA 1AUXA 1ZGWA 3D0SA 2EIJH 1S97A 3UFXB 3TINA 1FP2A 4A3BJ 1W7PB 3OYIA 2F5VA 3GILA 2EH3A 5KCMA 1U5TC 3K0LA 2QLZA 2ZFWA 5A2QZ 1S8NA 2VJ5A 2BY2A 3OIPA 3H0GG 4UHTA 2LLKA 1P9QC 2JEJA 3RPUD 3SFZA 2FB9A 3FMRA 4M3GA 2Y2ZA 3L2UA 3QP5A 2K9NA 5C8YF 4PZ8A 5TJJA 3ISPA 1S68A 2D45A 3JSLA 2WE6A 1MGTA 1KYWA 3OV8A 4IXAA 3QWLA 4BQQA 4G12A 2ZM6H 1U0JA 1UG0A 4RAFA 1LFUP 4XK4A 4DZPA 4RB3C 1FX7A 1JJ8C 2WAQE 1QRYA 5KFKA 1H9GA 4NBQA 4PSXA 2EFWA 1XSXA 4O7SA 2L02A 2QQ9A 5E1ZB 3JRHA 4Q44A 2EIYA 3A0HC 1MBGA 3LWBA 3GTLA 2M9HA 1C3OA 2DBBA 3GZNB 3VOEA 2XAUA 1KU7A 3ZQ7A 3S3MA 4ECQA 2Q7DA 4HNUA 4WXHA 1ZRCA 3TDUC 4BE1A 1SD7A 5DISC 1TL8A 4NNJA 2DA4A 4LLLA 1K79A 2E5LH 1YX3A 3G1LA 4YAJB 3VOTA 1O75A 4D9JA 3MWEA 2C28A 2V6EA 2IGNA 2Q2UA 1RJRA 3BG5A 4O5VA 4QIWA 4LFBH 4FFOA 4X64H 4MA0A 2DI3A 3BJ6A 3JW4A 2PI0A 3FK7A 3Q5FA 1GUUA 2VBZA 2P5KA 3RAQA 3DBHB 1ODDA 1D0YA 2VPSA 1QHGA 2VOBA 3L4KA 3U55A 2C2DA 2M8GX 4IJAA 1O3SA 3W1GA 4YJ2F 3K5IA 3J7AK 1X4PA 2F48A 2M8EA 2QGUA 1TWCJ 3DKYA 4Z6YA 3FXUA 2DT7B 2KT0A 2DZDA 4A3JJ 2CFOA 3FDSA 2HIXA 3U21A 4Q4DA 3DKXA 3T1HH 4EV0A 4KIBA 2F2EA 2HVSA 2K9MA 3H3ZA 3V4ZA 3GB8B 1UHWA 3P5JA 4M9SA 2BYVE 2BW3A 2R7WA 5BWXA 5JVDF 2IS4A 2ELJA 4G9YA 4HEA2 2L54A 5D6FA 2X6OA 1QZEA 2W48A 1FSEA 3JSPA 1D1AA 1HCRA 3HUGB 1QA6A 5DLGA 1IGNA 3BTCA 2EIKH 2ZBKA 3T5KA 3R23A 4UV9A 3HPHA 3LOCA 5GPCA 4JI6H 2FEZA 3GW2A 2FJZA 2DLNA 3CDHA 3KETA 2PBZA 4DL2A 1QPMA 2HKOA 5H6QA 4XR6A 3VODA 2GXAA 4XYLB 1KEEA 3GV7B 3P9KA 5KG4A 2O9LA 5JR3A 2OTJI 1DGWY 3EUHA 3PM1A 3A02A 1KJIA 3OYAA 2KDOA 5LA6F 3KTMA 4JYAH 1X2NA 4NC6A 1TT0A 5CVJA 3JSNA 4ED3A 2IBKA 3O3KA 2A69F 2C35B 5LXTF 1I94H 2CO5A 3E6DA 3PO2J 2HXOA 3DTEA 4ZHQF 1WJFA 3RV4A 1HW2A 5KFHA 3OSFA 3GTMA 4TVIA 2EJ2A 2EJ0A 2CQ7A 1GLVA 2CUFA 2P0WA 3TEDA 2CNQA 5CYVA 1UCRA 2VB6A 1HW5A 4C2MJ 2QEXI 4HRIA 4BAYA 4UCSA 3KHHA 4YFNF 1AKHB 2K7LA 4IRDA 2HVQA 2MW8A 1LDKB 3FF5A 5E8IA 1DPRA 3OYEA 1JHHA 3K4KA 3A1YA 3OSGA 4LLNA 4RU9A 3T5JA 2O8XA 3BZKA 2R92A 3PW0A 5B1AH 2HZTA 4P96A 5KFLA 2ZMEC 4HX8A 1R4NB 1M0WA 5GAHJ 1FMVA 4U0YA 3OYHA 1L3LA 1CQJB 1ULYA 4DR4H 3VNNA 1Z2OX 2ASDA 4IO9F 3LP8A 3FISA 4O82A 2M45A 2I10A 2H94A 5DGIA 1FT9A 4LH6A 5C1PA 3DLAA 1I7NA 5FNVF 3ROUA 3UZOA 1YYVA 4APMA 1I50A 4XIDA 4E7HA 4F4ZA 2JA6A 2W82A 4ESBA 1R71A 2CQYA 2IRFG 2XVCA 1IJWC 2F4MB 2YW2A 3BG3A 3VPDA 3UKGA 4F52A 3QQMA 1VNDA 4NB5A 2PMHA 5KFFA 2JPCA 5KFJA 3LSPA 5DG7A 4S0HB 4A0ZA 4EBCA 3V7CA 3J81Z 2VBWA 2DN0A 4MTDA 3I54A 2C22A 1B4AA 1BIBA 3OYDA 2WV0A 2UWMA 4YY3H 5KG7A 4ZTFA 2EFOA 1X4OA 1WH2A 4J9QA 3K4JA 5D8KB 3RPUA 2DWCA 4DR3H 4IKFA 1D1CA 2XAQA 4IHTA 4YP3A 2V1XA 5E3NA 2Z9OA 2VPLA 5A2QW 5KX5F 2R92G 3ABLH 4HYKA 2Y30A 3P9CA 5E8GA 3EPGA 5B1BH 1C0WA 4C2TA 1IYEA 4X66H 2JZYA 3FM3A 2L7MP 5KAFC 4M6VA 3PQKA 3PUFA 4WWCA 3VDXA 3IWZA 1LNWA 4CC6A 1X19A 2QKMB 1PP7U 1UHSA 5LHIA 2ZDQA 3ULQB 1HOMA 1BIAA 2E7XA 1TQMA 1E4EB 4G8XA 4HX7A 2DMUA 4HA8A 3MKLA 5DM7F 4ANJA 2E1MC 1X3ZB 2NXNB 4BUPA 5LEJA 3DTIA 5FD5A 4OIRF 1Y1WJ 2CV0A 4CUGA 4I55F 4TM5A 1Z77A 2JA6G 1EKEA 4QWAA 4ECWA 3HOYG 4WX9A 2FE3A 2DA3A 3M4OJ 3KEOA 4I0BA 1B72A 1R36A 1V3FA 3RB4A 3T1BA 3Q0WA 2WB1E 4JI4H 5LRSA 4O81A 3F8FA 1A6IA 5IT9W 2DLLA 3MFKA 2W6NA 1XMAA 5BWRA 4L9VA 5KFPA 4IPAA 4YR0A 3SEZA 2EZLA 1CKNA 4GDFA 4RZQA 5D8LB 4ZH4F 3UYYA 4FFLA 2DT6A 2DMNA 2P7CB 4Q47A 3CD6I 2V5AA 1S6LA 3S17J 3VYUB 1D1BA 2JA2A 3AG4H 4IRHA 2VT2A 2FK2A 2G9WA 3DKWA 5F0HA 2QQBA 1DU6A 3FMQA 4Q43A 1R23A 1RI7A 4QWDA 3FXKA 2IEKA 4M9ZA 4FE7A 3N6XA 4MV4A 5LD2C 3NWSA 2QBYA 5KFRA 5K5RA 3JRAA 1ITYA 2OH2A 2W6PA 3MKYB 4NZOA 4ECVA 2IP4A 3AW8A 4L5JA 4UCRA 2V59A 4M7EA 1ZETA 2AGQA 4EM2A 4L9JA 5LRRA 2NU7B 2JQ7A 2V4QA 2HZDA 1FBSA 3ELKA 4DYRA 2WY8Q 4OIQF 4FQGA 3VMMA 3CQZA 1DV2A 3FMAA 4EJTA 2IA0A 4IRIA 2LKPA 4YEJA 4XN0A 2X5RA 4HX4A 3R5XA 4GLWA 1VS0A 1SVLA 3BA9A 5LHGA 3A2KA 3COAC 4EFBA 1SFXA 2L4AA 5J4VA 5FRNA 4M6YA 1I2KA 5M5YJ 2XPWA 2N8GA 4XX0B 2X1EA 3FK6A 4HF1A 1YFHA 2R6FA 1GXQA 5F0CA 3GIKA 1KU9A 2H8WA 2O8KA 2B0LA 4Q5SF 3Q1KA 3QYBA 3CCUI 1GVJA 4UFZA 4ECYA 2X6XA 1BC8C 3F0CA 3AL0C 1MSFC 1Z2PX 5EZYF 3HXLA 1ZR4A 3MVPA 4F55A 2V58A 3TBIA 1D3YA 3JAMZ 3FX3A 2W7NA 2F5FA 3VEPA 1HSJA 2EPFA 3BG7A 3ZMTA 2JA7J 1FTZA 3RIZA 3QOPA 3V4GA 5ED4A 3Q8RB 3GTJA 5BNGA 5D1OB 2HI3A 4UUSB 3LFKA 5HDGA 3D5LA 3C0FB 1WJAA 4R1HA 3I58A 2K4BA 3CUQA 1ZLJA 4CCMA 4MV7A 5BWTA 2XASA 1JLLB 4DGWB 2DYSH 3AFHA 1XNQH 1B6RA 1ETVA 1JUMA 3T9DA 2JN6A 3GBGA 3ZRGA 4LF6H 2K3PA 1KU3A 2DOEA 2GAUA 5J1UA 3T9CA 4LIVA 2OLSA 5GAEJ 4L9TA 1Y1VA 2JUGA 5FGMA 4E7ZA 5IOYA 1TC3C 3HOUJ 2HDDA 2HGWA 5LMNH 2W9CA 4B3MH 2KJCA 3CJTB 4BHBA 4R8UA 4FS1A 5C44J 5IT9K 3JZIA 3WHBA 2NVYA 3L4JA 2O0YA 3K10A 3IAS2 5K1YA 3OHBA 5DEQA 4BEHB 3RBEA 5JVTA 3E3VA 1PUEE 2DAAA 1I6HJ 4M72A 4Q4ZF 5BPDA 3OS2A 3J81W 2ZJTA 3KAJA 3E6MA 1RUOA 1DGRM 3HTUA 2J5OA 2EFQA 3E97A 3FHZA 1BJTA 1RR7A 2DFHA 3E6BA 3IC7A 4C30A 3CO7C 2DT5A 3HOVJ 4AC0A 4ESFA 3OYMA 3MN2A 5M5WJ 5EEAA 4D7MA 3G6EI 4QIWE 4MA5A 3UNGC 4XN3A 3CCLI 3DCFA 3Q9VA 5JLWA 1PJRA 3GEZA 1I1GA 1OBGA 2YU9A 5M5XJ 1Y1VG 1Y0NA 3BR6A 3DXJF 4RNOA 4LG3A 3GWZA 2X0SA 2CG4A 3TQTA 1WJDA 4ZI7F 4WXDA 4MO7A 3RGZA 3I12A 1HDDC 3LFUA 4YB8B 1AHDP 2PVPA 4DR1H 3A03A 4J0MA 2AQ4A 1R5HA 4A2BA 1BN5A 4KISA 2JWTA 3JRDA 1LDDA 5FLMG 4XLFA 3OSNA 1KJ8A 3BABA 2H6BA 2HJWA 5KG3A 4PUSA 4A3FG 5EJCA 3CF2A 3PSFA 2R7DA 3SYTA 3IN5A 3GTPA 1ENHA 4HOBA 3V8LA 4BY7J 1ZH5A 4P55A 1J2XA 1IW7F 3CCEI 3T7AA 2GOMA 3WODF 3DBLB 2V9VA 3GMEA 4MV1A 2VBXA 4O7NA 2WAQA 4ED0A 2BY0A 3HSFA 1EUDB 1FKAH 4BXXG 1BI1A 2IPQX 3LMMA 1JUPA 4KA4A 2JA5J 3R0JA 2FOKA 4WCGA 1FZPB 2UUAH 4J9MA 3V6HA 2HTSA 2MLKA 2XRNA 3E7LA 3RKXA 1W96A 4P1WA 2A07F 2IGMA 3LNQA 2H09A 1REPC 2GBYA 3G3ZA 5DUKA 5J1YA 3RGXA 4CYCA 2VXZA 4E7KA 1A48A 1T95A 1I6XA 2KRCA 5F0FA 1ON1A 2Z33A 1JT0A 3H3UA 3W2WA 3JTGA 1N56A 4LGWA 5J8FA 4GC6A 1N36H 1E3OC 1ZHSA 5KFCA 1BNCA 2RGRA 5L1KA 4MQ9F 4PJJA 3D1NI 2XCLA 3HM5A 4B44A 3C2HA 5K5OA 2IBDA 2CFMA 1B9MA 3RB6A 5CVUA 2HU9A 5E3MA 1R1VA 1SFEA 2W1OA 2EFPA 5EWGA 1XDUA 4OINF 4J00A 2JRTA 4A5NA 1SFOA 1ETXA 2GIZA 3MQ0A 3GUDA 4RM3A 5KFIA 3KHRA 2ISZA 1ETWA 1YI2I 3CTAA 2CUZA 2KLOA 2P4WA 5F27A 1FP1D 1JKPC 3C1DA 3V7SA 2UXBH 1IBLH 4B1RA 3RKQA 3HRUA 1BR2A 4IRGA 3JAMW 5IP9G 4JX6A 1XDSA 4MIMA 4I98B 4LMYA 2H6CA 3BTLA 3KE2A 4AUXA 3I4NJ 4GXOA 3V4SA 1OLTA 3MMYB 3ZMSA 5KFXA 3KYCB 2W9BB 3H20A 4YIIA 5EG0A 4XOTA 2X51A 2DU9A 2MLGA 1JIHA 2JJ7A 2HR3A 3IL2A 4E7IA 2LNBA 2VJ4A 5D4RA 3C18A 4UCTA 1LFPA 4Y17A 4EM1A 2BQRA 1VI0A 2HDWA 3O8GA 1QO0D 2LC2A 2A5YB 4HLYA 3HOWJ 1DGSA 1KTAA 1VQLI 5GPAA 5L3CA 2DK8A 2YS9A 1IC8A 2HXIA 2IXSA 1R7JA 3K2AA 4M73A 4BS9A 2Z5UA 3SDBA 2F5EA 4A3BG 4QLCU 5C4XJ 4PFOA 1BXRA 4FETA 2E2IJ 5EOYA 4X0GA 4A3KJ 2UU9H 4A3GG 2LVSA 4PZ7A 2HOEA 5KFZA 2CQNA 2AO9A 2B63G 2TRTA 2E35A 3MKZA 3GTKJ 2DDBA 2RQPA 3BWGA 3H92A 4XLPF 1VZ0A 2R7ZJ 5KFYA 2HHHH 4LF5H 1NHAA 1YS7A 2VKEA 2XKOA 4KICA 1MH3A 2CQKA 4A93J 1U5TA 5KG6A 4A3MJ 2Q2EA 2QENA 1HXDA 4DR2H 5KFAA 2TCTA 1O3QA 5B66C 2W85A 1QVTA 2QWWA 5IP7J 3KYDB 3RPQA 3I56I 1BJZA 1RETA 3RKWA 3DBRB 4C5CA 2CKZB 3JR9A 4P9FA 3F8CA 4JI0H 1OPCA 1YTYA 1BGWA 3KP5A 3S93A 4PJMA 1Z3XA 2XGEA 3ZQGA 1K78A 1ETOA 3M9NB 2MH9A 5I5VA 5LHHA 4Q48A 1GLNA 4CCKA 3FMSA 3WWIA 4EG0A 2EBIA 2A3SA 4M3FA 3WTSC 6PAXA 3H3VK 1S9FA 3R5HA 1OYWA 3SQNA 4O6JA 1YIJI 4IAJA 3RJPA 4O3SA 3CP8A 2ECBA 2L9NA 2MA3A 4D5CA 4EVIA 1GSHA 3CMMA 4UCOA 3RYRA 4EQ5A 2LK2A 4RAGA 5TRDA 2PLYA 2PMZE 2HTJA 5K7FA 2PEXA 2E36A 5DCMA 2MG4A 2PQ8A 4MHGA 2JT1A 5K2MA 1RK5A 2ASJA 1MKMA 1V4RA 4R79A 4DIQA 1MD0A 4XLAA 4O7WA 3BJYA 3FKJA 2EZHA 3CC2I 3DP7A 4KITB 1MMDA 3S3NA 1YJWI 1A31A 4A3JG 4C2MA 1X3UA 5J40A 3OYNA 2JK3A 4GYGA 4IIJF 5CM0A 2BY3A 1S7AA 2EZIA 2X1CA 3CCYA 3IWFA 1MSEC 4IHXA 1PX2A 4O2BF 2QB5A 3K1MA 3S1RJ 1MBHA 2OQRA 2FPPB 2V4RA 1MJAA 1I1LA 2R93J 1VAJA 4IWYA 2P81A 4JQFA 4IHYA 2LF8A 1SVMA 1WCMJ 5L3DA 3L2CA 2R5ZB 2FUG2 3L2RA 4BL0B 2VL8A 2O7OA 4RDUA 2JPBA 3OL3A 2EB7A 5CPRB 1T0FC 1PUFA 1IN8A 4IHSA 3QWUA 2YL2A 2FJ1A 2KIQA 1XMXA 5CQGA 3PJRA 5KFWA 4L5EA 2LD5A 2OPTA 1Z3YA 2WBMA 3W2VA 4YRVA 1M1EB 5CE8A 2V79A 4GGGA 1RYRA 3IHUA 1XGNA 2XRLA 2ZJQF 3GIJA 3FXRA 4M3DA 3HOXJ 2FRHA 1OCZH 4FX4A 1MMGA 2MC4A 2FLLA 2EV6A 1ZAUA 1YS6A 4LB6B 3PO2G 3BTIA 5FJ8G 2DA5A 5I5TA 1VQMI 1A6QA 4MV8A 3JRXA 5FKKA 1FOYA 1G2HA 2W6OA 4OAZA 2M7AA 5EF6A 1IBKH 2VA2A 4B3AA 3REOA 2V9PA 5I60A 3OYJA 2WA0A 2VXDA 3T9FA 1J59A 2HOAA 2K9QA 2KKOA 1O3TA 4MV3A 3BR0A 3TIGA 3W1BA 1IUYA 1Q1HA 2M1BA 5K3WA 3T1YH 3F8BA 3LQRA 1JTXA 5E18F 4CE5A 2LBFA 4LFCH 4ZYHA 1WRJA 2PN6A 2Y9ZA 3NAUA 3IP4B 2VOPA 2ZSHB 3ESWB 1VQ7I 5KFVA 4XORA 3TW7A 2R7KA 2R5YB 1GV2A 1GXPA 4ON0A 2VQHA 2YX4A 4ENNA 2ZMEA 1J9IA 4XYMB 1OCRH 2COMA 4RUCA 2CV2A 1JXSA 1S0OA 1Y1WA 4O7TA 5D1PA 5IYBJ 2FLNA 4UUGA 1FPQA 3ZMDA 1M7JA 3Q8QB 2HDCA 4WHXA 4DZJA 1YX5A 3H36A 2HGSA 4LH7A 4NC7A 5EGOA 4FASD 4II2A 4W1UA 5D5VB 1K7AA 3GDEA 1OJLA 2G7UA 3MEXA 3PNVA 2K27A 2STWA 1D8KA 2ME6A 4AIDA 4PBCA 2W9AA 4KDPA 5KFUA 2XIGA 2F5CA 3HZJA 3AAFA 2OAZA 2VC0A 4A3CG 2BVLA 2OU2A 3S14J 1TNSA 4NXMH 3ZQHA 1UC9A 4KT5C 4CCOA 5CA1F 3ASOH 1LJ9A 2LFBA 3Q0UA 3HL2A 1EH8A 1ZGAA 5H80A 1UB9A 3KYLA 2GA1A 1KJJA 3NEUA 1B33N 1Y0UA 4DV6H 1A9XA 1APLC 3M8JA 1Y14B 4XRSA 4RM2A 4M9XA 2XROA 4I7HA 1Y1WG 3HBLA 3RQIA 1UC8A 3C2GA 5BYBA 3TQNA 2HG8A 5BPFA 4F4YA 2Y69H 1JKQC 2L7KA 4YG2F 3AG3H 3L7WA 3CC7I 1S0NA 1KONA 2COBA 2Q0OA 3BQ1A 4PSWA 2R7XA 1ET0A 4CICA 5LGNA 2HIVA 1WSCA 3E5XA 5KVRA 2A68F 1A5JA 4EMSA 1HNWH 2RC4A 5J4YA 1D8JA 5E3OA 1R5GA 1WKMA 3QAHA 4IZZA 4CC5A 2O03A 2IT0A 3MFIA 1TWAJ 4E7SA 2W8LA 1X58A 2DA2A 4PJ0C 2R3SA 3VYRB 4DL4A 1T2KA 1E4FT 3QQAA 4TV7A 4RNMA 1IRFA 2CUJA 2L9SA 3FIWA 1X1CA 5HLTA 4A6DA 5FPRA 4LF7H 4RGUA 4A3EJ 4DRFA 1Z7UA 3I59A 3I64A 2LKXA 3UZBA 2BR0A 1TP4A 2VE9A 2ICWG 3IUOA 1I3QJ 1DDNA 2JA7A 4HDVA 2L2OA 3U9TA 5I5YA 4DBRA 2ZCWA 2XGXA 1I1KA 2VKVA 1QQIA 1U2WA 1LE8A 5BPHA 2VQDA 4XRSG 4O3NA 2RQQA 2BW3B 4I76A 3GYHX 2M30A 5I5WA 2OV7A 4XRMA 2WWYA 1BW5A 5LLQA 1K6OA 3WTYC 5JHFA 2COGA 1USTA 2VJJA 4FM9A 1Z05A 2XHKA 4CCNA 5EZGA 1LEBA 3AX6A 3GTGJ 3BJOA 5F08A 1U3EM 4O4LF 3IG0A 1IXCA 3QZ8A 3S8PA 4MEYF 3BP8A 2J6TA 4YR2A 3W6VA 3DTGA 2L01A 4EBEA 5L3FA 3MZHA 3Q9SA 3BROA 3VSKA 1TQPA 2YYAA 5CAEB 2BHYA 2RNJA 4M3EA 4XL9A 3J7ZI 4V2FA 4KUMA 3OS1A 3BACA 2X1DA 2NAZA 2CGPA 2GA2A 2YPRA 4GKKH 4U7BA 3NQOA 2DQLA 1UAAA 1E3PA 4A6EA 3PNYA 3FZVA 2HQAA 2P5VA 3A01A 1KYZA 1E0EA 2XC9A 3G6VA 4ZYDA 4U6PA 3HEFA 5F1JA 3OR1C 4CCJA 4XLEA 1HW1A 2PJRA 4UCUA 4F92B 2MGQA 2L4MA 2QQ8A 2FMYA 2PFBA 3ZGKA 3QODA 5HNFA 1Y6IA 3FXJA 5KNLA 3CCMI 3LQSA 2R7LA 2DDAA 3GV5B 1DP3A 3M8FA 4N4OB 4PFPA 4QWEA 2JA7G 3OHAA 2EK5A 3ZMVA 1XSVA 3IRRA 2QA4I 1YQAA 2EINH 1TWHA 3CESA 3K70C 5J2UF 3LSRA 3N4MA 1IRXA 3QPTA 4RGSA 4BQAA 3ETHA 2D1VA 2E1OA 5DTDA 5GONF 4GC7A 1J5EH 2ISYA 3C2BA 4M74A 4CGZA 1JT6A 2VODA 2J9GA 1LKXA 3HKZN 4NLGA 1P92A 1XCVA 4KIGA 3U1DA 1QBJA 5HDKA 5DLFA 1W5TA 2CSOA 1T38A 4O7LA 3LSGA 1IV8A 2HDKA 5EEHA 5K5QA 3PVXA 4Q45A 3HOUG 1MJBA 2ZXIA 3GIQA 4EEYA 3S1MJ 1T3NA 5E1XA 1WI3A 4EJWA 2ZGIA 5ERIA 3K4LA 4Y13A 4DYCA 3X2QH 3PO3J 4CKCA 3FDYA 4DBQA 3S1QJ 4D5FA 2IP2A 1QZZA 4IRCA 1VQ8I 1I39A 3K7AJ 4EGYA 1XMOH 3V42A 1W1WE 4BBRJ 4C3IJ 5C3EJ 4Q0YA 1WWXA 1Z0XA 4XKBA 2QSGX 3BLYA 2BOLA 3EPZA 5E79C 2AQFA 3ABKH 1ZYRF 3SHFA 3TDZC 3V8JA 2OD5A 3H1CA 5FO5A 1B59A 2MH2A 4EJOA 3L2QA 4BBSJ 1KJQA 3EYYA 4RS8A 4QSHA 2QCOA 3CO6C 2VT3A 1R58A 1S3JA 3HYIA 3MZYA 4OMYA 2A1HA 2JRMA 4LG0A 2XSDC 3LQQA 5CKTA 4X65H 1ETQA 3QU3A 4JBAA 1WJ5A 5HS7A 3QZ7A 2XCAA 2K9SA 4UCVA 1MW7A 1KBLA 3Q8PB 5HS8A 2IAIA 3GQCA 3HOVG 2JA5A 1BW6A 5BMVF 1MBJA 2K86A 4P5OA 2XF6A 3S3OA 2K02A 2PX9A 5J6XA 3NGDA 2HGCA 2JTVA 2NRAC 5HLIA 4XZ3B 1JDEA 4CCLA 2FX0A 3T9EA 3WGGA 2PBIA 2WY7Q 2VN2A 3CJQB 3KIOA 4B4CA 3WU1B 3L09A 4X62H 3PQJA 5B5EC 2QZ8A 4IL6C 2DW4A 4A2UA 1ETKA 1K83A 2D2WA 1E17A 5I47A 2ALZA 2COJA 4O4IF 5KG1A 1P6RA 2M87A 3EETA 5JUMA 3MR5A 3HG9A 1T98A 2IS6A 4J9RA 1GYFA 1ACIA 4FX0A 3I3LA 3M9AA 3DQVC 3QYFA 1B72B 1OBDA 2ID3A 2LREA 3U9GA 2V1NA 2GQRA 4ECXA 5IOZA 4HN2A 4BY7G 3K2ZA 1U9NA 1ZHFA 3RIRA 3JTHA 1FEXA 1USSA 1BM9A 3ZOBA 1AOYA 1KA8A 1FSHA 4WF2A 3ABUA 1CKNB 1J7KA 4K0KH 1VQNI 5DQHA 3CVZA 2JA5G 1FNNA 3H0GJ 1RC9A 1GV5A 5KK1A 1DP7P 5HNEA 4IVNA 3HGYA 4NQWA 1HLVA 1IAWA 3GTOJ 2AGOA 2C2EA 1MDMA 2F4VH 1FMWA 3HGGA 3OYLA 1W93A 3HRMA 2L9RA 2ZC2A 2FD5A 3T9BA 2IVMA 3HO8A 5BR8H 3K6GA 1WVRA 2DOFA 2JMWA 3NRVA 2Z04A 2VKHA 2QBYB 4XM3A 1R9TJ 1IV6A 4PGGA 2W9BA 3F3XA 5D4SA 3JRGA 3TQ1A 2LOOA 1JTYA 2HWVA 3FXMA 4DYQA 1B1BA 3DAAA 3VPRA 3ZN1A 4H4KC 4C3JJ 2W57A 4ME6A 2NVXJ 5DS9A 3N42B 2PMZA 3HSEA 4G6TB 2KP6A 2QF7A 3U1KA 3R61A 3OR2C 1XN7A 2L9VA 3TOAA 2I8CA 5F9NA 3TW6A 4DR6H 4LIUA 3ETJA 3CCQI 3DU6A 4ETSA 2RNGA 5K7ZA 3DLLF 2W7PA 2ELKA 3KEQA 4EEFG 3QU6A 5D5UB 1UMQA 1ZTRA 4IOCF 3ZQCA 4DUYH 2UXCH 2E2IA 1Z91A 4JV1A 3CMEI 3KX2A 2DA7A 4BE2A 2DXIA 1Z2NX 4LSAA 4MV9A 2Y0SN 4YIFA 4AVZA 3GTKA 2R7ZA 1WQ2A 4S04A 1NK2P 2BBYA 2DFEA 1UG2A 2W6ZA 4C5AA 3RI4A 3H9QA 4U0VA 1LPQA 3GIMA 3CZ6A 3W6KB 4B09A 1CKOA 4ECUA 1RPWA 1IN5A 1DUXC 4JI7H 5A2QK 1L0OC 4ZYGA 3M9MB 1MBFA 3GZ5A 5DG8A 4K2EA 1YO5C 1WFXA 2HOSA 2ZDHA 3GTLJ 3DU5A 2R7SA 3CUQB 1Z6RA 3KZZA 5FLVA 3PFIA 1TA8A 1U9OA 2IW5A 5JLXA 5BS6A 1O7FA 5HOOA 1K61A 2QSHX 3CCSI 1G3YA 2MD0A 2XAHA 4S05A 3WTTC 4FBTA 3HOWG 3DV8A 5LGTA 5E17F 2NVUB 3BJAA 1ZRFA 4KFCA 1JGSA 4A0XA 2ZJRF 3LA7A 2W9CB 3NARA 1OFCX 1X1AA 2WTEA 3M07A 1F5TA 4R8UB 1OKRA 5C4XG 4HV5A 1PK8A 2PJPA 3TY5A 4QWBA 4YIRX 1HSTA 3SZGA 4BY1G 1CQIB 4UUVA 5CR5A 4GLXA 3RYPA 3BDDA 1YLFA 2PMUA 1O4XA 3OYGA 2R7ZG 1AU7A 2EJRA 3SXYA 2LY9A 3T8RA 1J0RA 4AYBN 5M3MJ 4A93G 2HVRA 2M7BA 2DQRA 3OIOA 5IP6A 2P5LC 4F4WA 1VQKI 1S5LC 2FMLA 1LB2A 1IN4A 3LA3A 1QNTA 2OZUA 4RLFA 2FBHA 2NS0A 4ECZA 3QP6A 3PW4A 2R93A 3LWFA 3J80Z 3PIPF 1WCMA 5HV6A 2MABA 2Z99A 4TV8F 1WH5A 3K5HA 3RFCA 4I09A 4RAYA 3B6CA 2BQ3A 1R1TA 5LEKA 2NS8A 1WJEA 3CMAI 2IS1A 1BI3A 3L9FA 4XOPA 5L3GA 1P4XA 2ZKZA 1P8LA 3T5LA 1S9HA 3PUBA 1B8IA 1G3SA 3I55I 5FLXZ 3I53A 2LP0A 1G6NA 3R0AA 3OS0A 2KIFA 4CSWA 3FBNB 2YS7A 3TO9A 3G8DA 3ASNH 3QPSA 1V9PA 3D5RC 1NTCA 1RKWA 2OWOA 5E25A 4R7RA 3L2PA 1I3AA 2JVHA 2WAEA 5F64A 4B43A 4NZMA 5KG2A 3GTMJ 5IYDG 5KFBA 2BGCA 3N8DA 5J47A 4A3LG 2GZWA 1FJGH 1VBHA 3KP7A 2B7EA 3KCCA 1R00A 1P16A 3HRTA 4AU7A 1XD7A 2ECCA 5DGAA 2KDZA 4DV0H 2RGVA 3NBYB 3B02A 5DV5A 4O86A 3KP4A 4DV4H 2R92J 2F5DA 4AM3A 2R93G 3LSJA 2YZMA 1FC3A 1WCMG 1SCUB 2AXLA 4YBZB 1IDYA 2XF5A 4TUYF 1IBMH 5L1LA 4YQWA 1QVUA 1IUFA 2EZKA 3S2DJ 5KFTA 1WRVA 3ZQQA 4CYCB 1I50J 4H0EA 5IWAH 3OUUA 1TQIA 2GLOA 2VA3A 3WTVC 1A0IA 2FK3A 1T0FA 1IN7A 2GLTA 3HOXG 2A6EF 4W97A 1YE9A 3OYKA 2XAGA 2FPIB 3CJRB 1TZLA 4B47A 4O3PA 3B73A 3GX4X 2WC2A 3K3VA 2KJBA 4OX9H 1N32H 5BMZA 2GOXB 1X1DA 1ZARA 3EDPA 2FBKA 1JHFA 1G3TA 4K6NA 3H5NA 1DPUA 2KRFA 3CF5F 1QHHD 4OOIA 3F22A 1EA3A 2M0MA 3JRFA 3N41B 3PZPA 4J9SA 1SYXB 2KRHA 2MD5A 4RUAA 1HF0A 2M0CA 5L1IA 2GXGA 3IV5A 1X1PA 3GFJA 4NC8A
chains in the Genus database with same CATH topology
1NG7A 3K4CA 3VWBA 3K4MA 4XR6A 4OAZA 2M7AA 1IBKH 3LSIA 4BQOA 1MNDA 1DGWY 3OYJA 2WA0A 3K70D 2VXDA 3OOUA 5HVQC 2KDOA 3OYAA 3H5AA 3OTOH 4JYAH 3ZXSA 1TT0A 3JSNA 3W1BA 4KT6A 4DV2H 2M4GA 4ZYAA 3T1YH 2KHMA 1I94H 3EUHC 4CA0A 4BDZA 3DTEA 4AQYH 2LBFA 1WJFA 4LFCH 3SEQA 3IP4B 2ZSHB 4RLQA 2P0WA 4XORA 2VB6A 4UCSA 4HRIA 1V5EA 2VQHA 2HVQA 1LDKB 4F91B 3OYEA 3K4KA 2M3AA 3A1YA 1K6YA 2VQEH 2CV2A 3MWMA 4XQFA 4LSXA 5D1PA 3M1CA 2HPMA 2KSWA 1W36D 1M0WA 1YX5A 3G2BA 1FMVA 4LH7A 4NC7A 2HGSA 4FASD 4II2A 3OYHA 2VJIA 4DR4H 3VNNA 1Z2OX 3KXYT 5D1OA 5FD6A 2DJIA 3GDEA 4B3SH 5TGTA 1M0TA 1XDNA 3PNVA 4LH6A 4APMA 3DLAA 3LSKA 2RREA 3PFYA 4E7HA 2Q2EB 2W82A 3BC8A 4PK4A 4BJ5C 2XIGA 3S24A 3DF7A 3DPUA 1XMQH 4JI1H 4F52A 4MTEA 4PJNA 1BR1A 1Z7LA 2BVLA 3MD2A 4NXMH 4CCOA 2VKDA 3CP2A 4MTDA 4JV5H 3OYDA 3HL2A 2UWMA 3OIQA 4YY3H 2VIXA 3KYLA 4ZTFA 1X4OA 3QOEA 1WH2A 3K4JA 3EUKL 4DR3H 4DV6H 4IKFA 1D1CA 3M8JA 4IX7A 2L5QA 4RM2A 4BEHA 2VPLA 5A2QW 4I7HA 4LF9H 2VLAA 2UUZA 1FVIA 3C2GA 4X66H 1Z21A 4C2TA 2BVMA 2KMUA 2L7KA 3VDXA 4NXNH 4CC6A 1X19A 2QKMB 1KONA 4PSWA 1D0XA 2R7XA 2R7RA 4DOZA 2HIVA 3M4IA 2XDVA 5FRMA 2IS2A 1R6RA 4ANJA 1I6UA 1HNWH 2E1MC 3RF2A 4N4NB 4BUPA 3DTIA 2CV0A 5FD5A 4CUGA 4IZZA 4CC5A 3RTXA 2O03A 4XKVA 2I8DA 5KHDA 4E7SA 2FE3A 4DUZH 3TL4X 2CH0A 3VYRB 1E4FT 4IQJA 1X1BA 3HKZA 2CW7A 4ITVA 3KYHC 4JI4H 5HLTA 2CUJA 2L9SA 4LF7H 1X1CA 4Y3OA 5FPRA 3F9KA 5IT9W 4DRFA 2HPIA 2MFZA 1MZBA 3FHNA 1DQUA 1JI8A 3SEZA 3IUOA 1CKNA 4RZQA 2L2OA 4HSTA 4DBRA 3MKWB 2MYSA 4OAYA 3FBIB 2DT6A 4KHPH 4XKCA 2RQQA 1ZELA 2BW3B 3VSLA 3VYUB 1MNEA 2OV7A 5LFAA 1D1BA 1PYVA 2DOAA 2JA2A 4LF8H 5JHFA 2LYCA 2VJJA 2MCTA 4FM9A 4YELA 4CCNA 4XNFA 4RB2C 4U87A 3IG0A 2ZXHA 3N6XA 4HPQA 3S8PA 5LD2C 3NWSA 4IQ4A 3VYSB 3OWTA 4DR5H 4OWRB 3MKYB 3W3CA 3OYBA 4E7JA 3BCAA 2K9LA 2M4KA 3VSKA 4UCRA 4A2AA 4D1QA 1HNZH 4AYBA 2F4IA 4XLHA 4XL9A 4M7EA 4MLOA 3OS1A 2R7TA 2X1DA 3K4NA 3HOSA 4GKKH 3L2VA 4U7BA 2A5WA 1UAAA 2HZDA 1E0EA 3PNYA 2HQAA 2WY8Q 1BR4A 4RB0A 3FMAA 3OR1C 4CCJA 4XLEA 4YEJA 4XN0A 2PJRA 1L2ZA 1BOBA 1VS0A 4F92B 5HNFA 3BA9A 2LBFB 3ZGKA 3A2KA 4UCUA 3QODA 5KNLA 1Y6IA 4EFBA 5FRNA 4GRIA 1DP3A 4N4OB 4PFPA 3K4BA 3PL8A 2X1EA 4YHHH 3CESA 3K70C 3H35A 1IRXA 4E7LA 1WJCA 4NUBA 3H9JA 1J5EH 3RSNA 3QYBA 4UFZA 2X6XA 2XC7A 1LKXA 3AL0C 2Z16A 1E4GT 1Z2PX 4F3QA 3HXLA 4F55A 3TBIA 4LSAA 2W7NA 3LSGA 3N05A 1AN7A 3BG7A 2XF7A 2ZXIA 3RIZA 4ZJZA 5D1OB 3D5LA 3C0FB 1WJAA 3K4LA 1XNRH 3D5SC 3OY9A 3FDYA 4DBQA 2K5CA 2UUCH 4CCMA 4MV7A 2JVGA 2LY2A 4DGWB 1XNQH 3AFHA 1XMOH 3V42A 2LG4A 3UQ8A 2X85A 4Q0YA 3ZRGA 3GBGA 2Q2TA 4LF6H 2K3PA 4XKBA 1QU3A 4LIVA 3BLYA 2JUGA 2BOLA 3EPZA 4E7ZA 2AQFA 1N78A 2VUGA 2AQEA 4JI5H 3L2QA 5LMNH 4BACA 3EYYA 2Z1DA 4B3MH 4B48A 1HNXH 2WAFA 4X65H 5CKTA 4CZCA 3DPLC 3BA8A 3J80W 3L4JA 1WJ5A 3W5OA 4UCVA 1MW7A 4HNTA 3K10A 3OYFA 3IAS2 4BEHB 2KZVA 2VQGA 4P5OA 2F6CA 2XF6A 3S3OA 2KQRA 3GJXB 1G8XA 4LITA 3OS2A 2R4GA 3J81W 4CCLA 2ZJTA 3KAJA 2E5ZA 1DGRM 2WY7Q 2E1MB 1G59A 3CJQB 5FLXW 2YCHA 1BJTA 4XKWA 4E4HA 3A4CA 4X62H 4C30A 2CV1A 3OYMA 2R7VA 3KALA 3E1SA 2OUMA 3UR3C 3UNGC 4XN3A 3HG9A 2IS6A 2Y0SA 3RQ4A 1CKMA 4B3TH 1PJRA 3LMLA 4GKJH 1GYFA 2ZSIB 3I3LA 3DQVC 3QYFA 2KL4A 4LG3A 4BQNA 2LREA 1WJDA 2V1NA 1LVKA 3ZCOA 3RGZA 1D0ZA 3AKZA 4BE0A 1OR7C 2ZFUA 4LFAH 3LFUA 4DR1H 4J0MA 3BG6A 4C2UA 1CKNB 4KISA 3N44B 4A2BA 2LRDA 3N43B 1HR0H 4K0KH 3CVZA 4II3A 4XLFA 3EUAA 3S32A 3BABA 4ZDLA 2HNHA 4PUSA 3TY8A 3CF2A 3PSFA 3SYTA 3E0JB 4DV3H 4RMNA 2F4VH 4HG2A 5FPOA 1SEIA 1FMWA 2LH9A 3OYLA 1UELB 4ZTJA 4QPQA 4XMYA 3W2AA 2GOMA 5BR8H 2CW8A 3K6GA 4DV7H 4Y33A 2WAQA 2VKHA 4XM3A 1FKAH 3LMMA 2LOOA 4JOMA 1AA7A 2UUAH 4XLCA 3TY9A 2CMPA 2UXDH 5CQEA 4H4KC 3PSIA 3IAM2 2W57A 2V4JC 2E60A 1SAUA 4Y4RA 2PMZA 4P1WA 2V9KA 4BXFA 3N42B 2WADA 2IGMA 4G6TB 2KP6A 3L2WA 3HC7A 3LL7A 3NWTA 3OR2C 3RGXA 4E7KA 2VXZA 4KJZA 5LMUH 4DR6H 1T95A 2KRCA 4PZ6A 4LIUA 2PJRB 3DU6A 3W2WA 4ETSA 2RNGA 2IGOA 1MMNA 1B04A 4EEQA 2A6TA 2WB1A 1N36H 2IGKA 1ZHSA 4DUYH 2UXCH 2RGRA 3HOTA 2DCEA 2R7UA 4PJJA 3I9V2 2KPMA 3KX2A 4BE2A 4B44A 3C2HA 2DXIA 3AL0B 2CFMA 2W00A 4CH7A 1Z2NX 4MV9A 1N34H 4AVZA 2HU9A 1NG6A 2W1OA 1V5FA 2E5NA 2O5RA 2V7FA 4EATA 2QKLB 4J00A 3H9QA 2JSPA 3CZ6A 1WJBA 3LSHA 2XSJC 1CKOA 4RM3A 4JI7H 2OC6A 4JI3H 4HSRA 2CUZA 2KLOA 2LY1A 1TAEA 4DV1H 1WFXA 3DU5A 2R7SA 1TA8A 2V26A 2UXBH 3NC0B 5HOOA 1IBLH 4ZDPA 1BR2A 2MD0A 3H9GA 3JAMW 3OMYA 4LMYA 1N75A 5LL6b 1OLTA 3MMYB 3H20A 1W36C 4XOTA 2X51A 1X1AA 1ERDA 3TY5A 4E7IA 2VJ4A 3VYTB 3SZGA 4ZC3A 4UCTA 1LFPA 2R7OA 4PJLA 2HDWA 4GLXA 2LC2A 3KAKA 1DGSA 4LF4H 4E6NA 3OYGA 2CS3A 3RR5A 3OL4A 2IXSA 4BS9A 4JI2H 5FROA 3SDBA 4BJTA 3QYEA 5HNHA 2UUBH 2HVRA 2M7BA 4PFOA 4FETA 5EOYA 2UV1A 4X0GA 4RLFA 1J09A 4BWSC 2UU9H 4PZ7A 4BDYA 3J7AY 1V5GA 2X6YA 3NBZB 3MKZA 4B3XA 1Y56A 4LF5H 3F8NA 2NOJB 1VZ0A 3RTRA 2Q1ZB 2HHHH 3HPGA 2MABA 4PDBA 2VQLA 3DTKA 4RAYA 3OYIA 4DR2H 2F5VA 3RJ0A 1S03G 1WJEA 5KCMA 2IS1A 4BU2A 4XOPA 1P8LA 3BCBA 4RB1A 1S9HA 3PUBA 2VJ5A 3OIPA 1P9QC 3RPUD 3H5RA 4JI0H 1BGWA 3L2UA 3DEEA 3OS0A 3S93A 4PJMA 1Z3XA 4J01A 1S68A 3JSLA 4CSWA 3OYCA 4PZ8A 3FBNB 2WE6A 4BQQA 4ZDOA 4EFEA 1SFKA 2ZM6H 1U0JA 1UG0A 1V9PA 3D5RC 2OWOA 4R7RA 4RB3C 3L2PA 1GLNA 4CCKA 2JVHA 2WAEA 2R7QA 4B43A 4NQWB 4PSXA 3PN1A 4IAJA 1FJGH 3CP8A 4DV5H 2L9NA 2VQCA 4UCOA 4QPOA 3CMMA 4EQ5A 1N77A 1ZHQA 1P16A 4DJAA 4AU7A 2XAUA 4DV0H 3H0DA 3S3MA 3NBYB 4HNUA 2RGVA 4DV4H 3LSMA 5DISC 4BE1A 4BJ6C 4NNJA 4R79A 4DIQA 4F93B 4RAZA 1YX3A 4XLAA 2E5LH 3FKJA 1O75A 4D9JA 2V6EA 2XF5A 4KITB 1IBMH 1MMDA 3S3NA 2X6WA 2IGNA 2Q2UA 3DPTA 3OYNA 2W4SA 4LFBH 2X1CA 3ZR8X 4X64H 3ONQA 3ZQQA 4JI8H 5IWAH 3PNTA 4JQFA 1HA8A 1D0YA 2VPSA 1QHGA 4E6KG 2VASA 2VOBA 1A0IA 3L4KA 3W1GA 3J7AK 2FUG2 1X4PA 3KEYA 3L2RA 4BL0B 3DKYA 3TMOA 2VL8A 2DT7B 1XK5A 1YE9A 2CFOA 3OYKA 3OL3A 2HIXA 3RCOA 3U21A 3DKXA 3T1HH 3CJRB 5CPRB 1TZLA 1T0FC 4B47A 2HVSA 2K9MA 3K3VA 3BAAA 3QWUA 3GB8B 4OX9H 4XONA 1N32H 2GOXB 5CQGA 1X1DA 3PJRA 2BW3A 2R7WA 2IS4A 1Z3YA 2ELJA 2WBMA 2Z2SB 3DWLE 4HEA2 3W2VA 4C9YA 4YRVA 3H5NA 3N40P 1D1AA 3HUGB 1X9NA 2VQFH 1QHHD 3N41B 1EA3A 2M0MA 1MMGA 1SYXB 2KRHA 2MC4A 4DR7H 4B3RH 1MMAA 1N33H 3HPHA 4BGDA 2WDTA 4JI6H 2WYOA 4NC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLX A;  1DGS A;  4E6N A;  1CKM A;  3RR5 A;  2HVR A;  3W1B A;  3JSN A;  4PZ7 A;  1CKN B;  3NBZ B;  4UCS A;  4UCR A;  2HVQ A;  3BAB A;  3TY8 A;  5FPO A;  5D1P A;  1P8L A;  4LH7 A;  1VS0 A;  4UCU A;  3BA9 A;  4EFB A;  3VNN A;  4PZ8 A;  5D1O A;  1S68 A;  3GDE A;  3JSL A;  4EFE A;  3TY9 A;  1XDN A;  1V9P A;  2OWO A;  4LH6 A;  3L2P A;  3PN1 A;  3S24 A;  4UFZ A;  4UCO A;  4EQ5 A;  4PZ6 A;  1P16 A;  3NBY B;  1B04 A;  4EEQ A;  5DIS C;  5D1O B;  2CFM A;  2Q2U A;  3UQ8 A;  2Q2T A;  1FVI A;  2VUG A;  1CKO A;  4CC6 A;  1A0I A;  3W1G A;  1TAE A;  3BA8 A;  1XK5 A;  2HIV A;  2HIX A;  1TA8 A;  3W5O A;  4UCV A;  2HVS A;  3NC0 B;  3BAA A;  3QWU A;  3GB8 B;  3RTX A;  4CC5 A;  3GJX B;  3KYH C;  1X9N A;  5FPR A;  4DRF A;  3TY5 A;  1CKN A;  4UCT A; 
#chains in the Genus database with same CATH topology
 3VWB A;  1TW3 A;  3WG9 A;  3TP3 A;  3WTU C;  1FYM A;  5DMX A;  4LFU A;  2R85 A;  3SZP A;  3BZC A;  5L1J A;  3LSI A;  4BQO A;  3K70 D;  3S1N J;  5HVQ C;  3IRQ A;  3OTO H;  1SVO A;  4CO8 A;  3G1M A;  2ASL A;  4KT6 A;  5JQW A;  2M4G A;  4Q4C A;  2UXX A;  4ZYA A;  5EG0 B;  3C3W A;  2NU9 B;  5IYB G;  2KHM A;  1G4D A;  4BDZ A;  1Y8Q B;  4CA0 A;  4AQY H;  1E2X A;  1I2L A;  2V6C A;  3SEQ A;  2C6Y A;  3LST A;  2H27 A;  5DAA A;  3GV8 B;  1T36 A;  1OCP A;  4HNV A;  3T9A A;  3QRF F;  2H8R A;  4JYK A;  4MFD A;  1OQY A;  1V5E A;  2XGD A;  3GFL A;  3KP6 A;  1YW8 A;  4HAM A;  3RDI A;  4BNC A;  1CS0 A;  2I80 A;  2I5U A;  2M3A A;  3I0T A;  4QIW N;  4M6X A;  1ORK A;  3MWM A;  2HPM A;  2BXY A;  5GAG J;  4HBL A;  1W36 D;  2HHF B;  3M8E A;  1TWA A;  3PIO F;  3G6X A;  1RRJ A;  1RK6 A;  2FF4 A;  2FNA A;  3LA2 A;  1P2F A;  3HIF A;  2DPI A;  4UVC A;  2NU8 B;  3OUZ A;  3WWH A;  4NZN A;  2YX7 A;  1TWF J;  2QYO A;  2DJI A;  4M3B A;  2Y48 A;  5HS9 A;  5FD6 A;  4A3I J;  4U88 A;  4CKB A;  2YU3 A;  3M9O B;  2DA6 A;  4LLG F;  3LSK A;  3ZMU A;  3PFY A;  1U5T B;  1WH7 A;  1JKO C;  2Q2E B;  1VFC A;  1SFU A;  3S24 A;  1XMQ H;  3DPU A;  2WYO A;  2GPS A;  5J8C A;  4ESJ A;  2W71 A;  2Y4R A;  1TWC A;  4MTE A;  4PJN A;  1BR1 A;  2DPJ A;  2QM3 A;  5KT6 A;  2RVC A;  2E1C A;  3I4M J;  4EGZ A;  5I5X A;  4XRF A;  3JRI A;  1EZ1 A;  2FK1 A;  1VKZ A;  1YW7 A;  2CFX A;  1I27 A;  5J1R A;  5D5W B;  4JV5 H;  3GTG A;  4KYW A;  3C7J A;  3OIQ A;  2VIX A;  5CLS A;  4NDL A;  1K78 B;  4YJ3 F;  3LAP A;  1S72 I;  3TII A;  4ECR A;  3QOE A;  1IN6 A;  1TW2 A;  1ZKG A;  4TQR A;  4IX7 A;  5DQI A;  3DEU A;  4GYI A;  2C2R A;  2R7F A;  3WTW C;  2UUZ A;  1KQ8 A;  3FM5 A;  1Z21 A;  5T14 A;  4JV2 A;  1KJ9 A;  1VF9 A;  4OMZ A;  2BVM A;  1JE8 A;  4FFP A;  2KMU A;  1IOV A;  2ZJP F;  5I5S A;  4NXN H;  1RYS A;  5DCM B;  3RB0 A;  2DMP A;  4IZO A;  1D0X A;  3WHC A;  2R7R A;  4DOZ A;  2E19 A;  2FXA A;  3BPV A;  1W7P D;  2XDV A;  2IS2 A;  2IA1 A;  1I6U A;  3RF2 A;  4N4N B;  1DAA A;  1VTN C;  1SD6 A;  1EF4 A;  4QWC A;  3RTX A;  1V55 H;  1FIA A;  3JRW A;  1K1Q A;  5I5U A;  4DUZ H;  3TL4 X;  2DTR A;  1MNM C;  4PCQ A;  2QYZ A;  1AWC A;  1X1B A;  2YUS A;  2CW7 A;  4ITV A;  4ENM A;  2Y31 A;  4IQJ A;  2JSC A;  1AUV A;  4M0J A;  1G3W A;  4KN4 X;  4Y3O A;  2QVO A;  3JAM K;  1V54 H;  1Y39 A;  3CCV I;  2ID6 A;  1Y1V J;  2MFZ A;  2W24 A;  3FHN A;  1DQU A;  1JI8 A;  2R8H A;  3KZI C;  1K1S A;  4HST A;  3MKW B;  4FHT A;  1PUF B;  3FBI B;  3WGI A;  1CF7 A;  3KP3 A;  4X6A J;  2XGP A;  4XKC A;  1W0U A;  4ED6 A;  3MCZ A;  3VSL A;  4AIH A;  1Z9C A;  3GIP A;  5KFG A;  1PYV A;  4KMU X;  2WV1 A;  2AGP A;  3PR5 B;  5FLM J;  3QFF A;  4C3H J;  3SJM A;  5BYA A;  4PWQ A;  4XNF A;  5FKO A;  4RB2 C;  1W5C C;  2ZXH A;  2R8G A;  4GCV A;  1FWZ A;  5FFZ A;  3S16 J;  2YRX A;  1YHQ I;  2R86 A;  4IQ4 A;  9ANT A;  3OWT A;  4O7Z A;  4DR5 H;  2VE8 A;  4OWR B;  1FBU A;  1QGP A;  2AXT C;  3OYB A;  4A3D J;  3GFM A;  4YAK B;  3GXO A;  3KPH A;  1UJ8 A;  4A2A A;  2MBF A;  4AYB A;  2F4I A;  5JH7 F;  4MLO A;  1ZRD A;  2E2J J;  2CWE A;  4UUT A;  2DMT A;  1ZG3 A;  3K4N A;  5DCF A;  1UHM A;  5IPA A;  3L2V A;  4E4T A;  2XAF A;  2CQX A;  3MWD A;  1BC7 C;  2W25 A;  1D5Y A;  1KQ0 A;  2TDX A;  2CUE A;  4XIC A;  4RB0 A;  2XD4 A;  3KLN A;  2VUM J;  2H1K A;  4CHI A;  2LBF B;  2B63 J;  4HLX A;  1IZ1 A;  3VA7 A;  1XTA A;  1JXL A;  3BG9 A;  3CC4 I;  3HOZ J;  4UXN A;  5D8D A;  4YHH H;  1FY7 A;  2FA5 A;  5KS8 A;  2ZME B;  1GO3 E;  1ZQ7 A;  1WJC A;  1WPK A;  4HQE A;  2KIM A;  2K4J A;  4G94 A;  3BT9 A;  1QPI A;  2UVR A;  1XGO A;  2Z16 A;  3AG1 H;  5C3E G;  1Y8R B;  3ZQF A;  3CCJ I;  2EA4 A;  1AN7 A;  4HQ6 A;  5EGO B;  1FOX A;  2W70 A;  2XF7 A;  3JRE A;  2ESN A;  1VBG A;  1ON2 A;  4O83 A;  3GTP J;  4ZJZ A;  4BBS G;  1F36 A;  4J9L A;  3BQ0 A;  3OY9 A;  5KFE A;  3TOB A;  2JVG A;  2LY2 A;  5DGH A;  4NYE A;  3UQ8 A;  3F21 A;  3RKY A;  2Q2T A;  3OSP A;  1ZG5 A;  3IH4 A;  1FYL A;  5KFS A;  3G8C A;  1N78 A;  3WO0 A;  3F8M A;  3ZMZ A;  2AQE A;  4JI5 H;  3JRB A;  4BAC A;  2Z1D A;  1EUC B;  3L00 A;  2VOO A;  5IP9 J;  4B48 A;  1UZC A;  3KHG A;  1YJN I;  3T5H A;  1HNX H;  1KQ9 A;  2WAF A;  1YRN A;  5KG0 A;  1H8A C;  1M6V A;  2ME0 A;  1T08 B;  4HW0 A;  1T56 A;  5LBQ A;  3W5O A;  4G6Q A;  3W6J B;  1VQ6 I;  1S7O A;  3OYF A;  2XAJ A;  1SAN A;  2HKX A;  2KZV A;  4MEX F;  5JVL A;  5H20 A;  2D5V A;  4IR1 A;  3MFH A;  3GJX B;  1G8X A;  1IOW A;  4GFB A;  3CMY A;  3A0B C;  4U7D A;  4BYY A;  4ED8 A;  4QTR A;  4V19 K;  2NNN A;  1I7L A;  2OJE D;  1R1U A;  2E1M B;  5EWF A;  4E4H A;  3A4C A;  3HKZ E;  1TWG J;  3ABM H;  3GVA A;  1Z1D A;  5ILU A;  1SFO J;  1OCT C;  2DPU A;  2CV1 A;  2ELH A;  2R7V A;  3F6V A;  3E1S A;  2OUM A;  1A36 A;  2XKP A;  4PDK A;  4AD9 A;  4B3T H;  4A3G J;  3B6A A;  3TP0 A;  4IHV A;  2GWR A;  1W4M A;  1W7P A;  2KL4 A;  4WK8 F;  4BQN A;  4LK0 F;  2KIU A;  2OCC H;  3ZCO A;  4IRK A;  4BE0 A;  3BPX A;  1XG1 A;  1OR7 C;  4LFA H;  2BHZ A;  3I59 B;  1EHI A;  3KZY A;  3BG6 A;  3JSO A;  3RV3 A;  3N44 B;  2QUF A;  5ICE A;  2DA1 A;  3N43 B;  4AIK A;  1BOA A;  4FGR A;  4N0B A;  2GXB A;  2J6U A;  1FOW A;  3S32 A;  3EUA A;  1LE8 B;  4ZDL A;  1OCC H;  4ED7 A;  5IT3 A;  2ABJ A;  3BQZ A;  5TIS C;  2ZNY A;  2GQQ A;  3E0J B;  4RMN A;  4DL7 A;  5FPO A;  4FBU A;  2EWN A;  3KFW X;  2LH9 A;  4EQQ A;  1GDT A;  3Q2O A;  3QPH A;  5IT9 Z;  2CW8 A;  2GM4 A;  2R87 A;  4DV7 H;  1WZ2 A;  3P9I A;  4F7Z A;  3VPB A;  3WG7 H;  3VB2 A;  2R82 A;  4CHU A;  4Q8F A;  4CMF A;  2RN7 A;  1ONV A;  2JA8 J;  1GSA A;  4XLC A;  3MR2 A;  2G0E A;  1U6G A;  2CMP A;  5CQE A;  1XB4 A;  4M9U A;  4XBF A;  2X0L A;  2V4J C;  2E60 A;  2JEI A;  1SAU A;  3QPL A;  3GFI A;  4O7V A;  2WAD A;  2GPW A;  3GLL A;  1KC7 A;  1K4T A;  3A01 B;  3LL7 A;  3NWT A;  3S2W A;  1IRG A;  2P8T A;  5LMU H;  2OA4 A;  2PJR B;  5KFM A;  3H4B A;  2Z02 A;  5GTI C;  4TV9 F;  3ZP5 A;  1MMN A;  4LOC A;  1PDN C;  3FKI J;  2EQR A;  2IGK A;  4D0P A;  2DIK A;  5IYC J;  3BZ6 A;  3K69 A;  2DCE A;  1A3G A;  1OWT A;  4IR9 A;  2KPM A;  1XNR H;  3AL0 B;  2HQ5 A;  1JKJ B;  5ICG A;  1BL0 A;  2AS5 F;  3V6J A;  4BHC A;  3K9T A;  5EEG A;  3MAJ A;  1NG6 A;  5HLH A;  1XC5 A;  4BXU A;  3FXO A;  2E5N A;  2O5R A;  1ZAO A;  5CJ9 A;  5JVG F;  3ECO A;  3ZQI A;  3OOP A;  3HUG A;  1KGS A;  1X3W B;  3ERM A;  2OC6 A;  3AYH B;  1RKT A;  5EDW A;  4HSR A;  1EYZ A;  4DIM A;  3CDI A;  2X9D A;  1VQ5 I;  3WNZ A;  1HQC A;  1PVE A;  4ZDP A;  2EFN A;  3PW5 A;  3WGH A;  4WXC A;  2QQA A;  5C44 G;  3F72 A;  4I02 A;  5CVR A;  3E5N A;  4O84 A;  5FJ8 J;  5LL6 b;  1IRZ A;  3KLO A;  2L7Z A;  1HKS A;  1W36 C;  1Q1V A;  2HYJ A;  2WAQ N;  4DQN A;  2EV5 A;  1R49 A;  2LDU A;  4XSX F;  4LG0 B;  3M7G A;  1ERD A;  1FLI A;  4HF0 A;  4ZYE A;  3BOQ A;  2ACJ A;  2R7O A;  2BV6 A;  4PJL A;  5AIQ A;  5AON A;  3DFG A;  2ESH A;  1VQP I;  1S7E A;  3U9S A;  1GT0 C;  2FPG B;  4LF4 H;  1AKH A;  2SCU B;  5IYZ F;  5EYR A;  4E6N A;  4C5B A;  3RR5 A;  1BI2 A;  3OL4 A;  1RES A;  2XPV A;  3BQ2 A;  4UVA A;  5FRO A;  3R9R A;  3DEW A;  1LVA A;  2W6M A;  2Q8K A;  2KIS A;  2YZN A;  2UZK A;  2Y0S E;  3CLO A;  1J09 A;  4BWS C;  5KAI C;  2ZDG A;  4Y52 J;  4O3M A;  4BDY A;  5L9X A;  2RDJ A;  1V5G A;  3V8K A;  1BJA A;  4B3X A;  1OIS A;  3NBZ B;  1Y56 A;  3ZPL A;  4OIP F;  2M5W A;  2NOJ B;  3RTR A;  2Q1Z B;  1DV1 A;  4WBN F;  1EV7 A;  3HSR A;  5GAD J;  2XUB A;  4PDB A;  2DTZ A;  3S2H J;  4RCN A;  2VQL A;  3DTK A;  1N25 A;  1OCO H;  1P7J A;  3GCM A;  1MIJ A;  2E2H J;  2OZ6 A;  5DD4 A;  3T99 A;  3RJ0 A;  4A12 A;  1S03 G;  2Y9Y A;  4EBD A;  3IH3 A;  4I2O A;  2R7N A;  4BU2 A;  3DTF A;  1GGO A;  3BCB A;  4RB1 A;  5D6E A;  2P6S A;  3GLK A;  3H40 A;  3BTJ A;  3H5R A;  2UVW A;  5E3L A;  2OTL I;  2W84 A;  3DEE A;  4J01 A;  2DO7 A;  2YR2 A;  3O2P E;  3OYC A;  4A3C J;  2M05 A;  3RAX A;  2HHF A;  4Q8E A;  4ZDO A;  4EFE A;  1SFK A;  4L1K A;  1A0G A;  3LUL A;  2R7Q A;  3PN1 A;  2RV8 A;  4NQW B;  5BWW A;  2WTF A;  4KNY A;  5BWV A;  1STZ A;  5DGB A;  1MDM B;  3HB9 A;  2RAE A;  2FP4 B;  1V4Y A;  1BBY A;  1Z6T A;  5B3S H;  4DV5 H;  3ZQL A;  2VQC A;  3BQY A;  4QPO A;  1RIO H;  2DAO A;  2RKH A;  3BR3 A;  5KG5 A;  1N77 A;  1ZHQ A;  4O4J F;  3PFF A;  4DJA A;  1KT8 A;  3E5U A;  3CSW A;  5E1W A;  4A5M A;  3H0D A;  1XX5 A;  4HQM A;  1HBX G;  2AHQ A;  1T6S A;  3LSM A;  1SD4 A;  1WSU A;  2V1U A;  2CNV A;  4RGX A;  1UFM A;  4BJ6 C;  2DFF A;  2O3F A;  3SGI A;  4AYB E;  2YS6 A;  1XGM A;  1E4E A;  4A69 C;  5FFX A;  4RAZ A;  4F93 B;  4RNN A;  1HKT A;  4RGR A;  2IJL A;  2XPU A;  1VQ9 I;  4ECS A;  2D1H A;  5JQG F;  4ED2 A;  2NU6 B;  2ATL A;  2PG4 A;  2X6W A;  2ZB9 A;  1ZQ3 P;  4J9N A;  1XPX A;  3DPT A;  2W4S A;  3GLX A;  4O7Y A;  3ZR8 X;  1P4A A;  2QSF X;  3ONQ A;  4IF4 A;  4AVP A;  5F04 A;  4JI8 H;  1YIT I;  3PNT A;  4NHJ A;  3GTQ J;  1BA5 A;  2E71 A;  5EDN A;  1JKR C;  3GII A;  1HA8 A;  3R5F A;  1J5Y A;  4LD5 A;  4E6K G;  2VAS A;  3VPC A;  2DK5 A;  3N6R A;  4DW6 A;  3KEY A;  1W5S A;  2A6H F;  5J3L A;  3PW2 A;  2EIM H;  3TMO A;  3SZT A;  1RJP A;  3ABT A;  1XK5 A;  3CEB A;  5CVI A;  5ILS A;  4QW8 A;  1D5V A;  3RCO A;  4L18 B;  3CUO A;  1TWF A;  3BY6 A;  4FIS A;  4CYD A;  3BAA A;  2NYX A;  3SFI A;  4XON A;  4ED1 A;  2BQU A;  4IWX A;  5C4J J;  3N40 P;  2Z2S B;  3DWL E;  4C9Y A;  4N9H A;  3RUP A;  1YIO A;  1JGG A;  4I99 C;  1ZLK A;  1X9N A;  5ILV A;  2VQF H;  2EV0 A;  3R4K A;  2KFD A;  5L3B A;  4ENJ A;  2YWV A;  5DDG A;  4DR7 H;  4B3R H;  2L0K A;  1MMA A;  2L7F P;  4J9P A;  4BGD A;  3PW7 A;  1U8R A;  1N33 H;  2WDT A;  3I4N G;  3EPI A;  1LUJ B;  4ZZD A;  5HBR B;  1NG7 A;  3K4C A;  5H6R A;  1I5Z A;  1F9N A;  1K4S A;  3K4M A;  2NOG A;  2DYR H;  1YOV B;  3EQL F;  4Y8V B;  3I4P A;  3JZF A;  4EJV A;  2LMD A;  1P7I A;  4U0W A;  1MND A;  2R8I A;  1HC8 A;  3OOU A;  3H5A A;  2DJN A;  3BR5 A;  3ZXS A;  2LKS A;  3E6C C;  2Y0M A;  1LQ1 A;  4U7C A;  4DV2 H;  1WHU A;  1RJQ A;  3IKV A;  2FMA A;  4J19 A;  5DG9 A;  3EUH C;  4G7H F;  3AG2 H;  3WWJ A;  2EIL H;  3Q8S B;  5BPI A;  1JJ6 C;  1IO2 A;  4MQV A;  5DD8 A;  4AWX B;  4RLQ A;  5BQT A;  4MNU A;  2FKL A;  5KFO A;  2MC3 A;  1HDP A;  4X1E A;  4A3I G;  3ERE D;  4F91 B;  1ZR2 A;  4A3K G;  1I1S A;  3NUA A;  1K6Y A;  2VQE H;  5FKM A;  4XQF A;  4LSX A;  2XGQ A;  3M1C A;  4OU0 A;  2KSW A;  1P4W A;  1EH6 A;  3G2B A;  4HF2 A;  2C00 A;  2CW0 F;  1H0M A;  1R4M B;  5DYM A;  3N97 A;  4A3M G;  1I1M A;  2VJI A;  3KXY T;  3I4M G;  5D1O A;  3JRC A;  5LGU A;  4B3S H;  4UUS A;  5GTH C;  5TGT A;  3SE7 A;  1CQT A;  1M0T A;  3EYI A;  5EWE A;  1E3H A;  2WB1 N;  1XDN A;  4EGJ A;  5IP7 G;  4QW9 A;  2RRE A;  4HZF A;  2NNY A;  2HFH A;  2CNU A;  3GID A;  4BJ5 C;  3BC8 A;  4PK4 A;  2DAB A;  3DF7 A;  4JI1 H;  5AIP A;  4IOA F;  1WR2 A;  4O7R A;  1Z7L A;  4ASN A;  3F23 A;  2PN1 A;  3MD2 A;  1B8I B;  4FE4 A;  3SNO A;  4DAA A;  2VKD A;  1R5I D;  3CP2 A;  2CRG A;  2O61 A;  3CLQ A;  5H2F C;  4O3Q A;  3F6O A;  1MH4 A;  1RR8 C;  5LYJ F;  2ADU A;  3EUK L;  2CYY A;  1SMT A;  1TT5 B;  3K1N A;  4GO1 A;  1SD5 A;  2R0Q C;  4JUZ A;  1GSO A;  2L5Q A;  4BEH A;  4ECT A;  4ENK A;  2VPQ A;  4DL3 A;  1PP8 F;  1H89 C;  1A35 A;  4KMF A;  1B6A A;  2VLA A;  4LF9 H;  3V7R A;  3HTS B;  1FVI A;  2H1L A;  3I5U A;  1TWH J;  2V9W A;  5ICC A;  4IEJ A;  1IF1 A;  2W7O A;  1ZN2 A;  3FXL A;  2JEF A;  2FQ4 A;  2OCE A;  2K40 A;  1TBX A;  4A0Y A;  3GO5 A;  2VUM A;  3M4I A;  5FRM A;  1R6R A;  2P7V B;  2B63 A;  2ZJ2 A;  1GVD A;  4UB6 C;  2LSO A;  3CDL A;  4BKX A;  3KP2 A;  4XKV A;  2I8D A;  5KHD A;  4FU0 A;  3WTZ A;  3WO1 A;  4O4H F;  1LDJ A;  2CH0 A;  2KZG A;  4QJF A;  2ZXJ A;  3I71 A;  3KYH C;  3HKZ A;  5KT5 A;  2ETH A;  2JUC A;  1T39 A;  1SMY F;  3RBD A;  3F9K A;  1ZG1 A;  1H9T A;  1HKQ A;  2FSW A;  1MZB A;  2HPI A;  4MV6 A;  3Q0V A;  2LR8 A;  4YR3 A;  1T94 A;  2JA6 J;  2BZT A;  2R84 A;  1ZK8 A;  2F4O B;  2MYS A;  3HOY J;  5JFR A;  5KFQ A;  4OAY A;  3HJE A;  2HYF A;  3HRS A;  4JX4 A;  3WU0 A;  4PGH A;  1CGP A;  3ORQ A;  4A3D G;  4KHP H;  1ZEL A;  4G7Z F;  1S29 A;  1MNE A;  3WE3 A;  2B9S A;  5LFA A;  2DOA A;  3GF2 A;  1WI9 A;  4LF8 H;  3LAJ A;  2XB5 A;  2LYC A;  3TO6 A;  2MCT A;  1B6S A;  4YEL A;  1F43 A;  4KIF A;  2DMQ A;  3KRE A;  2W8K A;  3T54 A;  4JX5 A;  4U87 A;  3ORR A;  5CVV A;  1S0M A;  4HPQ A;  3VYS B;  2VUM G;  5K7H A;  3W3C A;  4E7J A;  2UXN A;  3BCA A;  2XV4 S;  5HDN A;  2O6G E;  2K9L A;  2M4K A;  5L3E A;  5KT3 A;  1U8B A;  4D1Q A;  1HNZ H;  4XLH A;  5BWU A;  3DF8 A;  4CXF A;  1MBK A;  2R7T A;  1XCB A;  3PO3 G;  2NS7 A;  3HOS A;  1FYK A;  1EKP A;  3HOZ G;  1JUS A;  2A5W A;  5DQG A;  4I4T F;  1K83 J;  1POG A;  4UVB A;  4Y15 A;  4TQS A;  4L5I A;  1JX4 A;  1BR4 A;  2BEO A;  4ZZL A;  2HGX A;  3V6K A;  2GIV A;  3TGN A;  1NK3 P;  1L2Z A;  1BOB A;  2Y75 A;  4RZR A;  2A05 A;  4JV0 A;  5HOD A;  2HEO A;  1IXR C;  4GRI A;  4LJZ F;  1TTY A;  1QZY A;  3K4B A;  3PL8 A;  4PZJ A;  5GP9 A;  1S10 A;  3WU2 C;  1FTT A;  2CQQ A;  5C1O A;  2NUA B;  2IA6 A;  3H35 A;  2RDP A;  3J81 K;  4E7L A;  2V1D A;  1XS9 A;  1TWG A;  4NUB A;  3H9J A;  1EKV A;  2P0A A;  5KFD A;  3RSN A;  1TLH B;  4KN7 X;  1O3R A;  1XMK A;  4MFE A;  2XC7 A;  1E4G T;  4F3Q A;  2X4H A;  5DUI A;  3HT5 A;  5F9L A;  4I6Z A;  1F1Z A;  1MBE A;  3SDG A;  3J7Y J;  3N05 A;  1SAX A;  3M1E A;  1FOK A;  2HOT A;  1T33 A;  2M34 A;  1Z67 A;  1F4K A;  4ZQI A;  3HHG A;  3S15 J;  3D5S C;  2K5C A;  1J75 A;  4FCY A;  4RBO A;  4G7O F;  2LTP A;  2UUC H;  1VQO I;  4HYE A;  3BR1 A;  1GHC A;  4CKE A;  5KKN B;  2LG4 A;  2K3F A;  2X85 A;  5ICF A;  1KZH A;  3MJF A;  5BOX A;  3MZ8 A;  3CUQ C;  5JHU A;  1QU3 A;  1DIK A;  3Q3S A;  1JDB B;  2VUG A;  2FNP A;  2VBY A;  1I3Q A;  4CDG A;  5KT2 A;  4AIJ A;  3E5Q A;  2RDI A;  2XCP A;  2BE5 F;  3HHH A;  4MGR A;  2J6S A;  2YSR A;  4EGQ A;  1N48 A;  4EM0 B;  4QWQ A;  4CZC A;  2E7W A;  2OF7 A;  3DPL C;  3BA8 A;  2COI A;  3TO7 A;  3J80 W;  4EYI B;  3JZ6 A;  2X48 A;  2CU7 A;  1ETY A;  2QK4 A;  3G1O A;  4HNT A;  3CCR I;  4L9N A;  3WE2 A;  4JP0 A;  3H4D A;  2VQG A;  3CQZ J;  3T5X A;  2IMW P;  1SEU A;  2F6C A;  4R8H A;  2KQR A;  2EJ3 A;  4FFR A;  1EH7 A;  4LIT A;  4BY1 J;  2FOW A;  4UY8 I;  2R4G A;  3G4S I;  5DM6 F;  1W0T A;  4DL5 A;  1VQ4 I;  4FFN A;  1MJ9 A;  4JK1 X;  3IKT A;  5J2T F;  2E5Z A;  2FBI A;  1G59 A;  4Z2Y A;  4Y7N J;  5FR9 A;  4L0Z B;  2YCH A;  4O3O A;  5F6F A;  1OYI A;  4XKW A;  5FLX W;  2ODT X;  3JCU C;  3MR6 A;  1O7L A;  1WGX A;  3KAL A;  5FKN A;  3FKI A;  3UR3 C;  2FU4 A;  3R60 A;  2Y0S A;  4UV8 A;  3RQ4 A;  1CKM A;  4FFM A;  1YG2 A;  3LML A;  4A3E G;  4G3I A;  4GKJ H;  2ZSI B;  1OR7 A;  2ZO4 A;  1U78 A;  4XLN F;  3TEK A;  4UB8 C;  2A61 A;  1LVK A;  3GTJ J;  4FE2 A;  1D0Z A;  3AKZ A;  1IXS B;  3U0G A;  3FWE A;  4B8X A;  3J7A O;  2YRW A;  2ZFU A;  3RZD J;  2NVT J;  1NH3 A;  1SC7 A;  2LF7 A;  4C2U A;  3FXQ A;  1XSD A;  2YZG A;  1UNN C;  3H3V H;  2LRD A;  1HR0 H;  1OYY A;  2OQG A;  4II3 A;  5E20 A;  1CF7 B;  2HNH A;  2JA8 G;  3TY8 A;  2VI6 A;  3GZ6 A;  1A04 A;  4V2G A;  5KT4 A;  5CB4 F;  2HYG D;  5FKL A;  4DV3 H;  4HG2 A;  1T8I A;  4O2A F;  1LEA A;  4CMD A;  1SEI A;  2HS5 A;  1DU0 A;  1UEL B;  2ZNZ A;  4HV6 A;  4QPQ A;  4ZTJ A;  4XMY A;  3W2A A;  2E34 A;  4LB5 A;  1BI0 A;  3TKY A;  2DOD A;  3R6S A;  4JXU A;  1R22 A;  5IY5 H;  2P6T A;  4Y33 A;  2NVY J;  5IYD J;  3O6B B;  2BXZ A;  4FS2 A;  2STT A;  3O8H A;  2UVV A;  1IYD A;  4A3L J;  1V51 A;  4JOM A;  1AA7 A;  1O57 A;  1XGS A;  3HDD A;  4A3F J;  3WTX C;  1IDZ A;  1C30 A;  1CE8 A;  2G7H A;  4IHJ F;  3TY9 A;  2CZG A;  5EZH A;  3FKI G;  5IYC G;  2JEG A;  3PSI A;  2UXD H;  3IH2 A;  3IAM 2;  3P7N A;  1IG7 A;  2FLP A;  4Y4R A;  1RZ4 A;  2V9K A;  2VPR A;  4BXF A;  2ZXW H;  1MMS A;  2W6Q A;  4J9K A;  2R8J A;  3L2W A;  3ECH A;  4IHW A;  3BR2 A;  2I87 A;  3HC7 A;  4BHP A;  2IA2 A;  4DL6 A;  1H88 C;  1OMI A;  4KJZ A;  4PZ6 A;  4BH9 A;  4YFX F;  4BXX J;  4FT8 A;  4I0A A;  3RB3 A;  1TNT A;  2IGO A;  1EKF A;  1B04 A;  4EEQ A;  2A6T A;  2E1N A;  2WB1 A;  2R7M A;  2R5Z A;  1G2W A;  2RF4 A;  5C5J A;  1ZGJ A;  3L1P A;  3HOT A;  2VON A;  3J80 K;  3I9V 2;  2R7U A;  5M3F J;  2YU9 J;  5LP6 F;  1FBQ A;  2W00 A;  4CH7 A;  5JI6 A;  3T0Y A;  1N34 H;  1V5F A;  4UNO A;  4EAT A;  1ZRE A;  2V7F A;  2QKL B;  3KHL A;  4MAM A;  5F1R A;  1ULZ A;  3VFZ A;  2JSP A;  3CJN A;  2VR1 A;  1WJB A;  3LSH A;  2XSJ C;  4RA2 A;  4HDU A;  2DPD A;  2E2H A;  3U2R A;  5D5X B;  4E70 A;  1KU2 A;  2K85 A;  3ML6 A;  4BBR G;  4JI3 H;  2NVQ J;  3PR4 A;  4DNC A;  2LY1 A;  5FLX K;  1TAE A;  4DV1 H;  3K3P A;  4N9I A;  4WD3 A;  2MSY A;  2HQR A;  2V26 A;  4L0Y B;  3NC0 B;  4F50 A;  2AU0 A;  2J5P A;  3M3Y J;  4I01 A;  4HR7 A;  4ZOL F;  3H9G A;  1B9N A;  2HQN A;  3OMY A;  4LK1 F;  4EJU A;  1FIP A;  2OBP A;  2GQS A;  5KT7 A;  1N75 A;  4P9U A;  2L3D A;  1LFB A;  4F4X A;  1YJ9 I;  1RUN A;  4ABZ A;  3G71 I;  1KUT A;  3H0G A;  5HLG A;  3RZO J;  2CJJ A;  2UVU A;  2EA2 A;  3T8T A;  3U54 A;  2FQ3 A;  1YRN B;  3GTO A;  3VYT B;  2YZL A;  5FB2 A;  1RNL A;  4ZC3 A;  5CA0 F;  5LOV F;  3KAK A;  2R5Y A;  4XSZ F;  2PMZ N;  4DLK A;  4DQ2 A;  3MR3 A;  2CS3 A;  5KFN A;  4OIO F;  2VC1 A;  4YFK F;  1EJ9 A;  3SI8 A;  2BY1 A;  1R9T A;  4JI2 H;  4D7N A;  4BJT A;  3QYE A;  4G6D A;  5HNH A;  2UUB H;  2Z3Y A;  4M71 A;  2M2E A;  3G6Y A;  3ZN0 A;  2UV1 A;  2XB0 X;  4FTH A;  1X2M A;  4EYH B;  4J9O A;  2NVX A;  1YW9 A;  3J7A Y;  4O3R A;  2XGC A;  3GTQ A;  2X6Y A;  3K1P A;  3G73 A;  3F8N A;  4I50 F;  1FJL A;  2R8K A;  2DFI A;  3HPG A;  4CZZ A;  1AUX A;  1ZGW A;  3D0S A;  2EIJ H;  1S97 A;  3UFX B;  3TIN A;  1FP2 A;  4A3B J;  1W7P B;  3OYI A;  2F5V A;  3GIL A;  2EH3 A;  5KCM A;  1U5T C;  3K0L A;  2QLZ A;  2ZFW A;  5A2Q Z;  1S8N A;  2VJ5 A;  2BY2 A;  3OIP A;  3H0G G;  4UHT A;  2LLK A;  1P9Q C;  2JEJ A;  3RPU D;  3SFZ A;  2FB9 A;  3FMR A;  4M3G A;  2Y2Z A;  3L2U A;  3QP5 A;  2K9N A;  5C8Y F;  4PZ8 A;  5TJJ A;  3ISP A;  1S68 A;  2D45 A;  3JSL A;  2WE6 A;  1MGT A;  1KYW A;  3OV8 A;  4IXA A;  3QWL A;  4BQQ A;  4G12 A;  2ZM6 H;  1U0J A;  1UG0 A;  4RAF A;  1LFU P;  4XK4 A;  4DZP A;  4RB3 C;  1FX7 A;  1JJ8 C;  2WAQ E;  1QRY A;  5KFK A;  1H9G A;  4NBQ A;  4PSX A;  2EFW A;  1XSX A;  4O7S A;  2L02 A;  2QQ9 A;  5E1Z B;  3JRH A;  4Q44 A;  2EIY A;  3A0H C;  1MBG A;  3LWB A;  3GTL A;  2M9H A;  1C3O A;  2DBB A;  3GZN B;  3VOE A;  2XAU A;  1KU7 A;  3ZQ7 A;  3S3M A;  4ECQ A;  2Q7D A;  4HNU A;  4WXH A;  1ZRC A;  3TDU C;  4BE1 A;  1SD7 A;  5DIS C;  1TL8 A;  4NNJ A;  2DA4 A;  4LLL A;  1K79 A;  2E5L H;  1YX3 A;  3G1L A;  4YAJ B;  3VOT A;  1O75 A;  4D9J A;  3MWE A;  2C28 A;  2V6E A;  2IGN A;  2Q2U A;  1RJR A;  3BG5 A;  4O5V A;  4QIW A;  4LFB H;  4FFO A;  4X64 H;  4MA0 A;  2DI3 A;  3BJ6 A;  3JW4 A;  2PI0 A;  3FK7 A;  3Q5F A;  1GUU A;  2VBZ A;  2P5K A;  3RAQ A;  3DBH B;  1ODD A;  1D0Y A;  2VPS A;  1QHG A;  2VOB A;  3L4K A;  3U55 A;  2C2D A;  2M8G X;  4IJA A;  1O3S A;  3W1G A;  4YJ2 F;  3K5I A;  3J7A K;  1X4P A;  2F48 A;  2M8E A;  2QGU A;  1TWC J;  3DKY A;  4Z6Y A;  3FXU A;  2DT7 B;  2KT0 A;  2DZD A;  4A3J J;  2CFO A;  3FDS A;  2HIX A;  3U21 A;  4Q4D A;  3DKX A;  3T1H H;  4EV0 A;  4KIB A;  2F2E A;  2HVS A;  2K9M A;  3H3Z A;  3V4Z A;  3GB8 B;  1UHW A;  3P5J A;  4M9S A;  2BYV E;  2BW3 A;  2R7W A;  5BWX A;  5JVD F;  2IS4 A;  2ELJ A;  4G9Y A;  4HEA 2;  2L54 A;  5D6F A;  2X6O A;  1QZE A;  2W48 A;  1FSE A;  3JSP A;  1D1A A;  1HCR A;  3HUG B;  1QA6 A;  5DLG A;  1IGN A;  3BTC A;  2EIK H;  2ZBK A;  3T5K A;  3R23 A;  4UV9 A;  3HPH A;  3LOC A;  5GPC A;  4JI6 H;  2FEZ A;  3GW2 A;  2FJZ A;  2DLN A;  3CDH A;  3KET A;  2PBZ A;  4DL2 A;  1QPM A;  2HKO A;  5H6Q A;  4XR6 A;  3VOD A;  2GXA A;  4XYL B;  1KEE A;  3GV7 B;  3P9K A;  5KG4 A;  2O9L A;  5JR3 A;  2OTJ I;  1DGW Y;  3EUH A;  3PM1 A;  3A02 A;  1KJI A;  3OYA A;  2KDO A;  5LA6 F;  3KTM A;  4JYA H;  1X2N A;  4NC6 A;  1TT0 A;  5CVJ A;  3JSN A;  4ED3 A;  2IBK A;  3O3K A;  2A69 F;  2C35 B;  5LXT F;  1I94 H;  2CO5 A;  3E6D A;  3PO2 J;  2HXO A;  3DTE A;  4ZHQ F;  1WJF A;  3RV4 A;  1HW2 A;  5KFH A;  3OSF A;  3GTM A;  4TVI A;  2EJ2 A;  2EJ0 A;  2CQ7 A;  1GLV A;  2CUF A;  2P0W A;  3TED A;  2CNQ A;  5CYV A;  1UCR A;  2VB6 A;  1HW5 A;  4C2M J;  2QEX I;  4HRI A;  4BAY A;  4UCS A;  3KHH A;  4YFN F;  1AKH B;  2K7L A;  4IRD A;  2HVQ A;  2MW8 A;  1LDK B;  3FF5 A;  5E8I A;  1DPR A;  3OYE A;  1JHH A;  3K4K A;  3A1Y A;  3OSG A;  4LLN A;  4RU9 A;  3T5J A;  2O8X A;  3BZK A;  2R92 A;  3PW0 A;  5B1A H;  2HZT A;  4P96 A;  5KFL A;  2ZME C;  4HX8 A;  1R4N B;  1M0W A;  5GAH J;  1FMV A;  4U0Y A;  3OYH A;  1L3L A;  1CQJ B;  1ULY A;  4DR4 H;  3VNN A;  1Z2O X;  2ASD A;  4IO9 F;  3LP8 A;  3FIS A;  4O82 A;  2M45 A;  2I10 A;  2H94 A;  5DGI A;  1FT9 A;  4LH6 A;  5C1P A;  3DLA A;  1I7N A;  5FNV F;  3ROU A;  3UZO A;  1YYV A;  4APM A;  1I50 A;  4XID A;  4E7H A;  4F4Z A;  2JA6 A;  2W82 A;  4ESB A;  1R71 A;  2CQY A;  2IRF G;  2XVC A;  1IJW C;  2F4M B;  2YW2 A;  3BG3 A;  3VPD A;  3UKG A;  4F52 A;  3QQM A;  1VND A;  4NB5 A;  2PMH A;  5KFF A;  2JPC A;  5KFJ A;  3LSP A;  5DG7 A;  4S0H B;  4A0Z A;  4EBC A;  3V7C A;  3J81 Z;  2VBW A;  2DN0 A;  4MTD A;  3I54 A;  2C22 A;  1B4A A;  1BIB A;  3OYD A;  2WV0 A;  2UWM A;  4YY3 H;  5KG7 A;  4ZTF A;  2EFO A;  1X4O A;  1WH2 A;  4J9Q A;  3K4J A;  5D8K B;  3RPU A;  2DWC A;  4DR3 H;  4IKF A;  1D1C A;  2XAQ A;  4IHT A;  4YP3 A;  2V1X A;  5E3N A;  2Z9O A;  2VPL A;  5A2Q W;  5KX5 F;  2R92 G;  3ABL H;  4HYK A;  2Y30 A;  3P9C A;  5E8G A;  3EPG A;  5B1B H;  1C0W A;  4C2T A;  1IYE A;  4X66 H;  2JZY A;  3FM3 A;  2L7M P;  5KAF C;  4M6V A;  3PQK A;  3PUF A;  4WWC A;  3VDX A;  3IWZ A;  1LNW A;  4CC6 A;  1X19 A;  2QKM B;  1PP7 U;  1UHS A;  5LHI A;  2ZDQ A;  3ULQ B;  1HOM A;  1BIA A;  2E7X A;  1TQM A;  1E4E B;  4G8X A;  4HX7 A;  2DMU A;  4HA8 A;  3MKL A;  5DM7 F;  4ANJ A;  2E1M C;  1X3Z B;  2NXN B;  4BUP A;  5LEJ A;  3DTI A;  5FD5 A;  4OIR F;  1Y1W J;  2CV0 A;  4CUG A;  4I55 F;  4TM5 A;  1Z77 A;  2JA6 G;  1EKE A;  4QWA A;  4ECW A;  3HOY G;  4WX9 A;  2FE3 A;  2DA3 A;  3M4O J;  3KEO A;  4I0B A;  1B72 A;  1R36 A;  1V3F A;  3RB4 A;  3T1B A;  3Q0W A;  2WB1 E;  4JI4 H;  5LRS A;  4O81 A;  3F8F A;  1A6I A;  5IT9 W;  2DLL A;  3MFK A;  2W6N A;  1XMA A;  5BWR A;  4L9V A;  5KFP A;  4IPA A;  4YR0 A;  3SEZ A;  2EZL A;  1CKN A;  4GDF A;  4RZQ A;  5D8L B;  4ZH4 F;  3UYY A;  4FFL A;  2DT6 A;  2DMN A;  2P7C B;  4Q47 A;  3CD6 I;  2V5A A;  1S6L A;  3S17 J;  3VYU B;  1D1B A;  2JA2 A;  3AG4 H;  4IRH A;  2VT2 A;  2FK2 A;  2G9W A;  3DKW A;  5F0H A;  2QQB A;  1DU6 A;  3FMQ A;  4Q43 A;  1R23 A;  1RI7 A;  4QWD A;  3FXK A;  2IEK A;  4M9Z A;  4FE7 A;  3N6X A;  4MV4 A;  5LD2 C;  3NWS A;  2QBY A;  5KFR A;  5K5R A;  3JRA A;  1ITY A;  2OH2 A;  2W6P A;  3MKY B;  4NZO A;  4ECV A;  2IP4 A;  3AW8 A;  4L5J A;  4UCR A;  2V59 A;  4M7E A;  1ZET A;  2AGQ A;  4EM2 A;  4L9J A;  5LRR A;  2NU7 B;  2JQ7 A;  2V4Q A;  2HZD A;  1FBS A;  3ELK A;  4DYR A;  2WY8 Q;  4OIQ F;  4FQG A;  3VMM A;  3CQZ A;  1DV2 A;  3FMA A;  4EJT A;  2IA0 A;  4IRI A;  2LKP A;  4YEJ A;  4XN0 A;  2X5R A;  4HX4 A;  3R5X A;  4GLW A;  1VS0 A;  1SVL A;  3BA9 A;  5LHG A;  3A2K A;  3COA C;  4EFB A;  1SFX A;  2L4A A;  5J4V A;  5FRN A;  4M6Y A;  1I2K A;  5M5Y J;  2XPW A;  2N8G A;  4XX0 B;  2X1E A;  3FK6 A;  4HF1 A;  1YFH A;  2R6F A;  1GXQ A;  5F0C A;  3GIK A;  1KU9 A;  2H8W A;  2O8K A;  2B0L A;  4Q5S F;  3Q1K A;  3QYB A;  3CCU I;  1GVJ A;  4UFZ A;  4ECY A;  2X6X A;  1BC8 C;  3F0C A;  3AL0 C;  1MSF C;  1Z2P X;  5EZY F;  3HXL A;  1ZR4 A;  3MVP A;  4F55 A;  2V58 A;  3TBI A;  1D3Y A;  3JAM Z;  3FX3 A;  2W7N A;  2F5F A;  3VEP A;  1HSJ A;  2EPF A;  3BG7 A;  3ZMT A;  2JA7 J;  1FTZ A;  3RIZ A;  3QOP A;  3V4G A;  5ED4 A;  3Q8R B;  3GTJ A;  5BNG A;  5D1O B;  2HI3 A;  4UUS B;  3LFK A;  5HDG A;  3D5L A;  3C0F B;  1WJA A;  4R1H A;  3I58 A;  2K4B A;  3CUQ A;  1ZLJ A;  4CCM A;  4MV7 A;  5BWT A;  2XAS A;  1JLL B;  4DGW B;  2DYS H;  3AFH A;  1XNQ H;  1B6R A;  1ETV A;  1JUM A;  3T9D A;  2JN6 A;  3GBG A;  3ZRG A;  4LF6 H;  2K3P A;  1KU3 A;  2DOE A;  2GAU A;  5J1U A;  3T9C A;  4LIV A;  2OLS A;  5GAE J;  4L9T A;  1Y1V A;  2JUG A;  5FGM A;  4E7Z A;  5IOY A;  1TC3 C;  3HOU J;  2HDD A;  2HGW A;  5LMN H;  2W9C A;  4B3M H;  2KJC A;  3CJT B;  4BHB A;  4R8U A;  4FS1 A;  5C44 J;  5IT9 K;  3JZI A;  3WHB A;  2NVY A;  3L4J A;  2O0Y A;  3K10 A;  3IAS 2;  5K1Y A;  3OHB A;  5DEQ A;  4BEH B;  3RBE A;  5JVT A;  3E3V A;  1PUE E;  2DAA A;  1I6H J;  4M72 A;  4Q4Z F;  5BPD A;  3OS2 A;  3J81 W;  2ZJT A;  3KAJ A;  3E6M A;  1RUO A;  1DGR M;  3HTU A;  2J5O A;  2EFQ A;  3E97 A;  3FHZ A;  1BJT A;  1RR7 A;  2DFH A;  3E6B A;  3IC7 A;  4C30 A;  3CO7 C;  2DT5 A;  3HOV J;  4AC0 A;  4ESF A;  3OYM A;  3MN2 A;  5M5W J;  5EEA A;  4D7M A;  3G6E I;  4QIW E;  4MA5 A;  3UNG C;  4XN3 A;  3CCL I;  3DCF A;  3Q9V A;  5JLW A;  1PJR A;  3GEZ A;  1I1G A;  1OBG A;  2YU9 A;  5M5X J;  1Y1V G;  1Y0N A;  3BR6 A;  3DXJ F;  4RNO A;  4LG3 A;  3GWZ A;  2X0S A;  2CG4 A;  3TQT A;  1WJD A;  4ZI7 F;  4WXD A;  4MO7 A;  3RGZ A;  3I12 A;  1HDD C;  3LFU A;  4YB8 B;  1AHD P;  2PVP A;  4DR1 H;  3A03 A;  4J0M A;  2AQ4 A;  1R5H A;  4A2B A;  1BN5 A;  4KIS A;  2JWT A;  3JRD A;  1LDD A;  5FLM G;  4XLF A;  3OSN A;  1KJ8 A;  3BAB A;  2H6B A;  2HJW A;  5KG3 A;  4PUS A;  4A3F G;  5EJC A;  3CF2 A;  3PSF A;  2R7D A;  3SYT A;  3IN5 A;  3GTP A;  1ENH A;  4HOB A;  3V8L A;  4BY7 J;  1ZH5 A;  4P55 A;  1J2X A;  1IW7 F;  3CCE I;  3T7A A;  2GOM A;  3WOD F;  3DBL B;  2V9V A;  3GME A;  4MV1 A;  2VBX A;  4O7N A;  2WAQ A;  4ED0 A;  2BY0 A;  3HSF A;  1EUD B;  1FKA H;  4BXX G;  1BI1 A;  2IPQ X;  3LMM A;  1JUP A;  4KA4 A;  2JA5 J;  3R0J A;  2FOK A;  4WCG A;  1FZP B;  2UUA H;  4J9M A;  3V6H A;  2HTS A;  2MLK A;  2XRN A;  3E7L A;  3RKX A;  1W96 A;  4P1W A;  2A07 F;  2IGM A;  3LNQ A;  2H09 A;  1REP C;  2GBY A;  3G3Z A;  5DUK A;  5J1Y A;  3RGX A;  4CYC A;  2VXZ A;  4E7K A;  1A48 A;  1T95 A;  1I6X A;  2KRC A;  5F0F A;  1ON1 A;  2Z33 A;  1JT0 A;  3H3U A;  3W2W A;  3JTG A;  1N56 A;  4LGW A;  5J8F A;  4GC6 A;  1N36 H;  1E3O C;  1ZHS A;  5KFC A;  1BNC A;  2RGR A;  5L1K A;  4MQ9 F;  4PJJ A;  3D1N I;  2XCL A;  3HM5 A;  4B44 A;  3C2H A;  5K5O A;  2IBD A;  2CFM A;  1B9M A;  3RB6 A;  5CVU A;  2HU9 A;  5E3M A;  1R1V A;  1SFE A;  2W1O A;  2EFP A;  5EWG A;  1XDU A;  4OIN F;  4J00 A;  2JRT A;  4A5N A;  1SFO A;  1ETX A;  2GIZ A;  3MQ0 A;  3GUD A;  4RM3 A;  5KFI A;  3KHR A;  2ISZ A;  1ETW A;  1YI2 I;  3CTA A;  2CUZ A;  2KLO A;  2P4W A;  5F27 A;  1FP1 D;  1JKP C;  3C1D A;  3V7S A;  2UXB H;  1IBL H;  4B1R A;  3RKQ A;  3HRU A;  1BR2 A;  4IRG A;  3JAM W;  5IP9 G;  4JX6 A;  1XDS A;  4MIM A;  4I98 B;  4LMY A;  2H6C A;  3BTL A;  3KE2 A;  4AUX A;  3I4N J;  4GXO A;  3V4S A;  1OLT A;  3MMY B;  3ZMS A;  5KFX A;  3KYC B;  2W9B B;  3H20 A;  4YII A;  5EG0 A;  4XOT A;  2X51 A;  2DU9 A;  2MLG A;  1JIH A;  2JJ7 A;  2HR3 A;  3IL2 A;  4E7I A;  2LNB A;  2VJ4 A;  5D4R A;  3C18 A;  4UCT A;  1LFP A;  4Y17 A;  4EM1 A;  2BQR A;  1VI0 A;  2HDW A;  3O8G A;  1QO0 D;  2LC2 A;  2A5Y B;  4HLY A;  3HOW J;  1DGS A;  1KTA A;  1VQL I;  5GPA A;  5L3C A;  2DK8 A;  2YS9 A;  1IC8 A;  2HXI A;  2IXS A;  1R7J A;  3K2A A;  4M73 A;  4BS9 A;  2Z5U A;  3SDB A;  2F5E A;  4A3B G;  4QLC U;  5C4X J;  4PFO A;  1BXR A;  4FET A;  2E2I J;  5EOY A;  4X0G A;  4A3K J;  2UU9 H;  4A3G G;  2LVS A;  4PZ7 A;  2HOE A;  5KFZ A;  2CQN A;  2AO9 A;  2B63 G;  2TRT A;  2E35 A;  3MKZ A;  3GTK J;  2DDB A;  2RQP A;  3BWG A;  3H92 A;  4XLP F;  1VZ0 A;  2R7Z J;  5KFY A;  2HHH H;  4LF5 H;  1NHA A;  1YS7 A;  2VKE A;  2XKO A;  4KIC A;  1MH3 A;  2CQK A;  4A93 J;  1U5T A;  5KG6 A;  4A3M J;  2Q2E A;  2QEN A;  1HXD A;  4DR2 H;  5KFA A;  2TCT A;  1O3Q A;  5B66 C;  2W85 A;  1QVT A;  2QWW A;  5IP7 J;  3KYD B;  3RPQ A;  3I56 I;  1BJZ A;  1RET A;  3RKW A;  3DBR B;  4C5C A;  2CKZ B;  3JR9 A;  4P9F A;  3F8C A;  4JI0 H;  1OPC A;  1YTY A;  1BGW A;  3KP5 A;  3S93 A;  4PJM A;  1Z3X A;  2XGE A;  3ZQG A;  1K78 A;  1ETO A;  3M9N B;  2MH9 A;  5I5V A;  5LHH A;  4Q48 A;  1GLN A;  4CCK A;  3FMS A;  3WWI A;  4EG0 A;  2EBI A;  2A3S A;  4M3F A;  3WTS C;  6PAX A;  3H3V K;  1S9F A;  3R5H A;  1OYW A;  3SQN A;  4O6J A;  1YIJ I;  4IAJ A;  3RJP A;  4O3S A;  3CP8 A;  2ECB A;  2L9N A;  2MA3 A;  4D5C A;  4EVI A;  1GSH A;  3CMM A;  4UCO A;  3RYR A;  4EQ5 A;  2LK2 A;  4RAG A;  5TRD A;  2PLY A;  2PMZ E;  2HTJ A;  5K7F A;  2PEX A;  2E36 A;  5DCM A;  2MG4 A;  2PQ8 A;  4MHG A;  2JT1 A;  5K2M A;  1RK5 A;  2ASJ A;  1MKM A;  1V4R A;  4R79 A;  4DIQ A;  1MD0 A;  4XLA A;  4O7W A;  3BJY A;  3FKJ A;  2EZH A;  3CC2 I;  3DP7 A;  4KIT B;  1MMD A;  3S3N A;  1YJW I;  1A31 A;  4A3J G;  4C2M A;  1X3U A;  5J40 A;  3OYN A;  2JK3 A;  4GYG A;  4IIJ F;  5CM0 A;  2BY3 A;  1S7A A;  2EZI A;  2X1C A;  3CCY A;  3IWF A;  1MSE C;  4IHX A;  1PX2 A;  4O2B F;  2QB5 A;  3K1M A;  3S1R J;  1MBH A;  2OQR A;  2FPP B;  2V4R A;  1MJA A;  1I1L A;  2R93 J;  1VAJ A;  4IWY A;  2P81 A;  4JQF A;  4IHY A;  2LF8 A;  1SVM A;  1WCM J;  5L3D A;  3L2C A;  2R5Z B;  2FUG 2;  3L2R A;  4BL0 B;  2VL8 A;  2O7O A;  4RDU A;  2JPB A;  3OL3 A;  2EB7 A;  5CPR B;  1T0F C;  1PUF A;  1IN8 A;  4IHS A;  3QWU A;  2YL2 A;  2FJ1 A;  2KIQ A;  1XMX A;  5CQG A;  3PJR A;  5KFW A;  4L5E A;  2LD5 A;  2OPT A;  1Z3Y A;  2WBM A;  3W2V A;  4YRV A;  1M1E B;  5CE8 A;  2V79 A;  4GGG A;  1RYR A;  3IHU A;  1XGN A;  2XRL A;  2ZJQ F;  3GIJ A;  3FXR A;  4M3D A;  3HOX J;  2FRH A;  1OCZ H;  4FX4 A;  1MMG A;  2MC4 A;  2FLL A;  2EV6 A;  1ZAU A;  1YS6 A;  4LB6 B;  3PO2 G;  3BTI A;  5FJ8 G;  2DA5 A;  5I5T A;  1VQM I;  1A6Q A;  4MV8 A;  3JRX A;  5FKK A;  1FOY A;  1G2H A;  2W6O A;  4OAZ A;  2M7A A;  5EF6 A;  1IBK H;  2VA2 A;  4B3A A;  3REO A;  2V9P A;  5I60 A;  3OYJ A;  2WA0 A;  2VXD A;  3T9F A;  1J59 A;  2HOA A;  2K9Q A;  2KKO A;  1O3T A;  4MV3 A;  3BR0 A;  3TIG A;  3W1B A;  1IUY A;  1Q1H A;  2M1B A;  5K3W A;  3T1Y H;  3F8B A;  3LQR A;  1JTX A;  5E18 F;  4CE5 A;  2LBF A;  4LFC H;  4ZYH A;  1WRJ A;  2PN6 A;  2Y9Z A;  3NAU A;  3IP4 B;  2VOP A;  2ZSH B;  3ESW B;  1VQ7 I;  5KFV A;  4XOR A;  3TW7 A;  2R7K A;  2R5Y B;  1GV2 A;  1GXP A;  4ON0 A;  2VQH A;  2YX4 A;  4ENN A;  2ZME A;  1J9I A;  4XYM B;  1OCR H;  2COM A;  4RUC A;  2CV2 A;  1JXS A;  1S0O A;  1Y1W A;  4O7T A;  5D1P A;  5IYB J;  2FLN A;  4UUG A;  1FPQ A;  3ZMD A;  1M7J A;  3Q8Q B;  2HDC A;  4WHX A;  4DZJ A;  1YX5 A;  3H36 A;  2HGS A;  4LH7 A;  4NC7 A;  5EGO A;  4FAS D;  4II2 A;  4W1U A;  5D5V B;  1K7A A;  3GDE A;  1OJL A;  2G7U A;  3MEX A;  3PNV A;  2K27 A;  2STW A;  1D8K A;  2ME6 A;  4AID A;  4PBC A;  2W9A A;  4KDP A;  5KFU A;  2XIG A;  2F5C A;  3HZJ A;  3AAF A;  2OAZ A;  2VC0 A;  4A3C G;  2BVL A;  2OU2 A;  3S14 J;  1TNS A;  4NXM H;  3ZQH A;  1UC9 A;  4KT5 C;  4CCO A;  5CA1 F;  3ASO H;  1LJ9 A;  2LFB A;  3Q0U A;  3HL2 A;  1EH8 A;  1ZGA A;  5H80 A;  1UB9 A;  3KYL A;  2GA1 A;  1KJJ A;  3NEU A;  1B33 N;  1Y0U A;  4DV6 H;  1A9X A;  1APL C;  3M8J A;  1Y14 B;  4XRS A;  4RM2 A;  4M9X A;  2XRO A;  4I7H A;  1Y1W G;  3HBL A;  3RQI A;  1UC8 A;  3C2G A;  5BYB A;  3TQN A;  2HG8 A;  5BPF A;  4F4Y A;  2Y69 H;  1JKQ C;  2L7K A;  4YG2 F;  3AG3 H;  3L7W A;  3CC7 I;  1S0N A;  1KON A;  2COB A;  2Q0O A;  3BQ1 A;  4PSW A;  2R7X A;  1ET0 A;  4CIC A;  5LGN A;  2HIV A;  1WSC A;  3E5X A;  5KVR A;  2A68 F;  1A5J A;  4EMS A;  1HNW H;  2RC4 A;  5J4Y A;  1D8J A;  5E3O A;  1R5G A;  1WKM A;  3QAH A;  4IZZ A;  4CC5 A;  2O03 A;  2IT0 A;  3MFI A;  1TWA J;  4E7S A;  2W8L A;  1X58 A;  2DA2 A;  4PJ0 C;  2R3S A;  3VYR B;  4DL4 A;  1T2K A;  1E4F T;  3QQA A;  4TV7 A;  4RNM A;  1IRF A;  2CUJ A;  2L9S A;  3FIW A;  1X1C A;  5HLT A;  4A6D A;  5FPR A;  4LF7 H;  4RGU A;  4A3E J;  4DRF A;  1Z7U A;  3I59 A;  3I64 A;  2LKX A;  3UZB A;  2BR0 A;  1TP4 A;  2VE9 A;  2ICW G;  3IUO A;  1I3Q J;  1DDN A;  2JA7 A;  4HDV A;  2L2O A;  3U9T A;  5I5Y A;  4DBR A;  2ZCW A;  2XGX A;  1I1K A;  2VKV A;  1QQI A;  1U2W A;  1LE8 A;  5BPH A;  2VQD A;  4XRS G;  4O3N A;  2RQQ A;  2BW3 B;  4I76 A;  3GYH X;  2M30 A;  5I5W A;  2OV7 A;  4XRM A;  2WWY A;  1BW5 A;  5LLQ A;  1K6O A;  3WTY C;  5JHF A;  2COG A;  1UST A;  2VJJ A;  4FM9 A;  1Z05 A;  2XHK A;  4CCN A;  5EZG A;  1LEB A;  3AX6 A;  3GTG J;  3BJO A;  5F08 A;  1U3E M;  4O4L F;  3IG0 A;  1IXC A;  3QZ8 A;  3S8P A;  4MEY F;  3BP8 A;  2J6T A;  4YR2 A;  3W6V A;  3DTG A;  2L01 A;  4EBE A;  5L3F A;  3MZH A;  3Q9S A;  3BRO A;  3VSK A;  1TQP A;  2YYA A;  5CAE B;  2BHY A;  2RNJ A;  4M3E A;  4XL9 A;  3J7Z I;  4V2F A;  4KUM A;  3OS1 A;  3BAC A;  2X1D A;  2NAZ A;  2CGP A;  2GA2 A;  2YPR A;  4GKK H;  4U7B A;  3NQO A;  2DQL A;  1UAA A;  1E3P A;  4A6E A;  3PNY A;  3FZV A;  2HQA A;  2P5V A;  3A01 A;  1KYZ A;  1E0E A;  2XC9 A;  3G6V A;  4ZYD A;  4U6P A;  3HEF A;  5F1J A;  3OR1 C;  4CCJ A;  4XLE A;  1HW1 A;  2PJR A;  4UCU A;  4F92 B;  2MGQ A;  2L4M A;  2QQ8 A;  2FMY A;  2PFB A;  3ZGK A;  3QOD A;  5HNF A;  1Y6I A;  3FXJ A;  5KNL A;  3CCM I;  3LQS A;  2R7L A;  2DDA A;  3GV5 B;  1DP3 A;  3M8F A;  4N4O B;  4PFP A;  4QWE A;  2JA7 G;  3OHA A;  2EK5 A;  3ZMV A;  1XSV A;  3IRR A;  2QA4 I;  1YQA A;  2EIN H;  1TWH A;  3CES A;  3K70 C;  5J2U F;  3LSR A;  3N4M A;  1IRX A;  3QPT A;  4RGS A;  4BQA A;  3ETH A;  2D1V A;  2E1O A;  5DTD A;  5GON F;  4GC7 A;  1J5E H;  2ISY A;  3C2B A;  4M74 A;  4CGZ A;  1JT6 A;  2VOD A;  2J9G A;  1LKX A;  3HKZ N;  4NLG A;  1P92 A;  1XCV A;  4KIG A;  3U1D A;  1QBJ A;  5HDK A;  5DLF A;  1W5T A;  2CSO A;  1T38 A;  4O7L A;  3LSG A;  1IV8 A;  2HDK A;  5EEH A;  5K5Q A;  3PVX A;  4Q45 A;  3HOU G;  1MJB A;  2ZXI A;  3GIQ A;  4EEY A;  3S1M J;  1T3N A;  5E1X A;  1WI3 A;  4EJW A;  2ZGI A;  5ERI A;  3K4L A;  4Y13 A;  4DYC A;  3X2Q H;  3PO3 J;  4CKC A;  3FDY A;  4DBQ A;  3S1Q J;  4D5F A;  2IP2 A;  1QZZ A;  4IRC A;  1VQ8 I;  1I39 A;  3K7A J;  4EGY A;  1XMO H;  3V42 A;  1W1W E;  4BBR J;  4C3I J;  5C3E J;  4Q0Y A;  1WWX A;  1Z0X A;  4XKB A;  2QSG X;  3BLY A;  2BOL A;  3EPZ A;  5E79 C;  2AQF A;  3ABK H;  1ZYR F;  3SHF A;  3TDZ C;  3V8J A;  2OD5 A;  3H1C A;  5FO5 A;  1B59 A;  2MH2 A;  4EJO A;  3L2Q A;  4BBS J;  1KJQ A;  3EYY A;  4RS8 A;  4QSH A;  2QCO A;  3CO6 C;  2VT3 A;  1R58 A;  1S3J A;  3HYI A;  3MZY A;  4OMY A;  2A1H A;  2JRM A;  4LG0 A;  2XSD C;  3LQQ A;  5CKT A;  4X65 H;  1ETQ A;  3QU3 A;  4JBA A;  1WJ5 A;  5HS7 A;  3QZ7 A;  2XCA A;  2K9S A;  4UCV A;  1MW7 A;  1KBL A;  3Q8P B;  5HS8 A;  2IAI A;  3GQC A;  3HOV G;  2JA5 A;  1BW6 A;  5BMV F;  1MBJ A;  2K86 A;  4P5O A;  2XF6 A;  3S3O A;  2K02 A;  2PX9 A;  5J6X A;  3NGD A;  2HGC A;  2JTV A;  2NRA C;  5HLI A;  4XZ3 B;  1JDE A;  4CCL A;  2FX0 A;  3T9E A;  3WGG A;  2PBI A;  2WY7 Q;  2VN2 A;  3CJQ B;  3KIO A;  4B4C A;  3WU1 B;  3L09 A;  4X62 H;  3PQJ A;  5B5E C;  2QZ8 A;  4IL6 C;  2DW4 A;  4A2U A;  1ETK A;  1K83 A;  2D2W A;  1E17 A;  5I47 A;  2ALZ A;  2COJ A;  4O4I F;  5KG1 A;  1P6R A;  2M87 A;  3EET A;  5JUM A;  3MR5 A;  3HG9 A;  1T98 A;  2IS6 A;  4J9R A;  1GYF A;  1ACI A;  4FX0 A;  3I3L A;  3M9A A;  3DQV C;  3QYF A;  1B72 B;  1OBD A;  2ID3 A;  2LRE A;  3U9G A;  2V1N A;  2GQR A;  4ECX A;  5IOZ A;  4HN2 A;  4BY7 G;  3K2Z A;  1U9N A;  1ZHF A;  3RIR A;  3JTH A;  1FEX A;  1USS A;  1BM9 A;  3ZOB A;  1AOY A;  1KA8 A;  1FSH A;  4WF2 A;  3ABU A;  1CKN B;  1J7K A;  4K0K H;  1VQN I;  5DQH A;  3CVZ A;  2JA5 G;  1FNN A;  3H0G J;  1RC9 A;  1GV5 A;  5KK1 A;  1DP7 P;  5HNE A;  4IVN A;  3HGY A;  4NQW A;  1HLV A;  1IAW A;  3GTO J;  2AGO A;  2C2E A;  1MDM A;  2F4V H;  1FMW A;  3HGG A;  3OYL A;  1W93 A;  3HRM A;  2L9R A;  2ZC2 A;  2FD5 A;  3T9B A;  2IVM A;  3HO8 A;  5BR8 H;  3K6G A;  1WVR A;  2DOF A;  2JMW A;  3NRV A;  2Z04 A;  2VKH A;  2QBY B;  4XM3 A;  1R9T J;  1IV6 A;  4PGG A;  2W9B A;  3F3X A;  5D4S A;  3JRG A;  3TQ1 A;  2LOO A;  1JTY A;  2HWV A;  3FXM A;  4DYQ A;  1B1B A;  3DAA A;  3VPR A;  3ZN1 A;  4H4K C;  4C3J J;  2W57 A;  4ME6 A;  2NVX J;  5DS9 A;  3N42 B;  2PMZ A;  3HSE A;  4G6T B;  2KP6 A;  2QF7 A;  3U1K A;  3R61 A;  3OR2 C;  1XN7 A;  2L9V A;  3TOA A;  2I8C A;  5F9N A;  3TW6 A;  4DR6 H;  4LIU A;  3ETJ A;  3CCQ I;  3DU6 A;  4ETS A;  2RNG A;  5K7Z A;  3DLL F;  2W7P A;  2ELK A;  3KEQ A;  4EEF G;  3QU6 A;  5D5U B;  1UMQ A;  1ZTR A;  4IOC F;  3ZQC A;  4DUY H;  2UXC H;  2E2I A;  1Z91 A;  4JV1 A;  3CME I;  3KX2 A;  2DA7 A;  4BE2 A;  2DXI A;  1Z2N X;  4LSA A;  4MV9 A;  2Y0S N;  4YIF A;  4AVZ A;  3GTK A;  2R7Z A;  1WQ2 A;  4S04 A;  1NK2 P;  2BBY A;  2DFE A;  1UG2 A;  2W6Z A;  4C5A A;  3RI4 A;  3H9Q A;  4U0V A;  1LPQ A;  3GIM A;  3CZ6 A;  3W6K B;  4B09 A;  1CKO A;  4ECU A;  1RPW A;  1IN5 A;  1DUX C;  4JI7 H;  5A2Q K;  1L0O C;  4ZYG A;  3M9M B;  1MBF A;  3GZ5 A;  5DG8 A;  4K2E A;  1YO5 C;  1WFX A;  2HOS A;  2ZDH A;  3GTL J;  3DU5 A;  2R7S A;  3CUQ B;  1Z6R A;  3KZZ A;  5FLV A;  3PFI A;  1TA8 A;  1U9O A;  2IW5 A;  5JLX A;  5BS6 A;  1O7F A;  5HOO A;  1K61 A;  2QSH X;  3CCS I;  1G3Y A;  2MD0 A;  2XAH A;  4S05 A;  3WTT C;  4FBT A;  3HOW G;  3DV8 A;  5LGT A;  5E17 F;  2NVU B;  3BJA A;  1ZRF A;  4KFC A;  1JGS A;  4A0X A;  2ZJR F;  3LA7 A;  2W9C B;  3NAR A;  1OFC X;  1X1A A;  2WTE A;  3M07 A;  1F5T A;  4R8U B;  1OKR A;  5C4X G;  4HV5 A;  1PK8 A;  2PJP A;  3TY5 A;  4QWB A;  4YIR X;  1HST A;  3SZG A;  4BY1 G;  1CQI B;  4UUV A;  5CR5 A;  4GLX A;  3RYP A;  3BDD A;  1YLF A;  2PMU A;  1O4X A;  3OYG A;  2R7Z G;  1AU7 A;  2EJR A;  3SXY A;  2LY9 A;  3T8R A;  1J0R A;  4AYB N;  5M3M J;  4A93 G;  2HVR A;  2M7B A;  2DQR A;  3OIO A;  5IP6 A;  2P5L C;  4F4W A;  1VQK I;  1S5L C;  2FML A;  1LB2 A;  1IN4 A;  3LA3 A;  1QNT A;  2OZU A;  4RLF A;  2FBH A;  2NS0 A;  4ECZ A;  3QP6 A;  3PW4 A;  2R93 A;  3LWF A;  3J80 Z;  3PIP F;  1WCM A;  5HV6 A;  2MAB A;  2Z99 A;  4TV8 F;  1WH5 A;  3K5H A;  3RFC A;  4I09 A;  4RAY A;  3B6C A;  2BQ3 A;  1R1T A;  5LEK A;  2NS8 A;  1WJE A;  3CMA I;  2IS1 A;  1BI3 A;  3L9F A;  4XOP A;  5L3G A;  1P4X A;  2ZKZ A;  1P8L A;  3T5L A;  1S9H A;  3PUB A;  1B8I A;  1G3S A;  3I55 I;  5FLX Z;  3I53 A;  2LP0 A;  1G6N A;  3R0A A;  3OS0 A;  2KIF A;  4CSW A;  3FBN B;  2YS7 A;  3TO9 A;  3G8D A;  3ASN H;  3QPS A;  1V9P A;  3D5R C;  1NTC A;  1RKW A;  2OWO A;  5E25 A;  4R7R A;  3L2P A;  1I3A A;  2JVH A;  2WAE A;  5F64 A;  4B43 A;  4NZM A;  5KG2 A;  3GTM J;  5IYD G;  5KFB A;  2BGC A;  3N8D A;  5J47 A;  4A3L G;  2GZW A;  1FJG H;  1VBH A;  3KP7 A;  2B7E A;  3KCC A;  1R00 A;  1P16 A;  3HRT A;  4AU7 A;  1XD7 A;  2ECC A;  5DGA A;  2KDZ A;  4DV0 H;  2RGV A;  3NBY B;  3B02 A;  5DV5 A;  4O86 A;  3KP4 A;  4DV4 H;  2R92 J;  2F5D A;  4AM3 A;  2R93 G;  3LSJ A;  2YZM A;  1FC3 A;  1WCM G;  1SCU B;  2AXL A;  4YBZ B;  1IDY A;  2XF5 A;  4TUY F;  1IBM H;  5L1L A;  4YQW A;  1QVU A;  1IUF A;  2EZK A;  3S2D J;  5KFT A;  1WRV A;  3ZQQ A;  4CYC B;  1I50 J;  4H0E A;  5IWA H;  3OUU A;  1TQI A;  2GLO A;  2VA3 A;  3WTV C;  1A0I A;  2FK3 A;  1T0F A;  1IN7 A;  2GLT A;  3HOX G;  2A6E F;  4W97 A;  1YE9 A;  3OYK A;  2XAG A;  2FPI B;  3CJR B;  1TZL A;  4B47 A;  4O3P A;  3B73 A;  3GX4 X;  2WC2 A;  3K3V A;  2KJB A;  4OX9 H;  1N32 H;  5BMZ A;  2GOX B;  1X1D A;  1ZAR A;  3EDP A;  2FBK A;  1JHF A;  1G3T A;  4K6N A;  3H5N A;  1DPU A;  2KRF A;  3CF5 F;  1QHH D;  4OOI A;  3F22 A;  1EA3 A;  2M0M A;  3JRF A;  3N41 B;  3PZP A;  4J9S A;  1SYX B;  2KRH A;  2MD5 A;  4RUA A;  1HF0 A;  2M0C A;  5L1I A;  2GXG A;  3IV5 A;  1X1P A;  3GFJ A;  4NC8 A; 
#chains in the Genus database with same CATH homology
 1NG7 A;  3K4C A;  3VWB A;  3K4M A;  4XR6 A;  4OAZ A;  2M7A A;  1IBK H;  3LSI A;  4BQO A;  1MND A;  1DGW Y;  3OYJ A;  2WA0 A;  3K70 D;  2VXD A;  3OOU A;  5HVQ C;  2KDO A;  3OYA A;  3H5A A;  3OTO H;  4JYA H;  3ZXS A;  1TT0 A;  3JSN A;  3W1B A;  4KT6 A;  4DV2 H;  2M4G A;  4ZYA A;  3T1Y H;  2KHM A;  1I94 H;  3EUH C;  4CA0 A;  4BDZ A;  3DTE A;  4AQY H;  2LBF A;  1WJF A;  4LFC H;  3SEQ A;  3IP4 B;  2ZSH B;  4RLQ A;  2P0W A;  4XOR A;  2VB6 A;  4UCS A;  4HRI A;  1V5E A;  2VQH A;  2HVQ A;  1LDK B;  4F91 B;  3OYE A;  3K4K A;  2M3A A;  3A1Y A;  1K6Y A;  2VQE H;  2CV2 A;  3MWM A;  4XQF A;  4LSX A;  5D1P A;  3M1C A;  2HPM A;  2KSW A;  1W36 D;  1M0W A;  1YX5 A;  3G2B A;  1FMV A;  4LH7 A;  4NC7 A;  2HGS A;  4FAS D;  4II2 A;  3OYH A;  2VJI A;  4DR4 H;  3VNN A;  1Z2O X;  3KXY T;  5D1O A;  5FD6 A;  2DJI A;  3GDE A;  4B3S H;  5TGT A;  1M0T A;  1XDN A;  3PNV A;  4LH6 A;  4APM A;  3DLA A;  3LSK A;  2RRE A;  3PFY A;  4E7H A;  2Q2E B;  2W82 A;  3BC8 A;  4PK4 A;  4BJ5 C;  2XIG A;  3S24 A;  3DF7 A;  3DPU A;  1XMQ H;  4JI1 H;  4F52 A;  4MTE A;  4PJN A;  1BR1 A;  1Z7L A;  2BVL A;  3MD2 A;  4NXM H;  4CCO A;  2VKD A;  3CP2 A;  4MTD A;  4JV5 H;  3OYD A;  3HL2 A;  2UWM A;  3OIQ A;  4YY3 H;  2VIX A;  3KYL A;  4ZTF A;  1X4O A;  3QOE A;  1WH2 A;  3K4J A;  3EUK L;  4DR3 H;  4DV6 H;  4IKF A;  1D1C A;  3M8J A;  4IX7 A;  2L5Q A;  4RM2 A;  4BEH A;  2VPL A;  5A2Q W;  4I7H A;  4LF9 H;  2VLA A;  2UUZ A;  1FVI A;  3C2G A;  4X66 H;  1Z21 A;  4C2T A;  2BVM A;  2KMU A;  2L7K A;  3VDX A;  4NXN H;  4CC6 A;  1X19 A;  2QKM B;  1KON A;  4PSW A;  1D0X A;  2R7X A;  2R7R A;  4DOZ A;  2HIV A;  3M4I A;  2XDV A;  5FRM A;  2IS2 A;  1R6R A;  4ANJ A;  1I6U A;  1HNW H;  2E1M C;  3RF2 A;  4N4N B;  4BUP A;  3DTI A;  2CV0 A;  5FD5 A;  4CUG A;  4IZZ A;  4CC5 A;  3RTX A;  2O03 A;  4XKV A;  2I8D A;  5KHD A;  4E7S A;  2FE3 A;  4DUZ H;  3TL4 X;  2CH0 A;  3VYR B;  1E4F T;  4IQJ A;  1X1B A;  3HKZ A;  2CW7 A;  4ITV A;  3KYH C;  4JI4 H;  5HLT A;  2CUJ A;  2L9S A;  4LF7 H;  1X1C A;  4Y3O A;  5FPR A;  3F9K A;  5IT9 W;  4DRF A;  2HPI A;  2MFZ A;  1MZB A;  3FHN A;  1DQU A;  1JI8 A;  3SEZ A;  3IUO A;  1CKN A;  4RZQ A;  2L2O A;  4HST A;  4DBR A;  3MKW B;  2MYS A;  4OAY A;  3FBI B;  2DT6 A;  4KHP H;  4XKC A;  2RQQ A;  1ZEL A;  2BW3 B;  3VSL A;  3VYU B;  1MNE A;  2OV7 A;  5LFA A;  1D1B A;  1PYV A;  2DOA A;  2JA2 A;  4LF8 H;  5JHF A;  2LYC A;  2VJJ A;  2MCT A;  4FM9 A;  4YEL A;  4CCN A;  4XNF A;  4RB2 C;  4U87 A;  3IG0 A;  2ZXH A;  3N6X A;  4HPQ A;  3S8P A;  5LD2 C;  3NWS A;  4IQ4 A;  3VYS B;  3OWT A;  4DR5 H;  4OWR B;  3MKY B;  3W3C A;  3OYB A;  4E7J A;  3BCA A;  2K9L A;  2M4K A;  3VSK A;  4UCR A;  4A2A A;  4D1Q A;  1HNZ H;  4AYB A;  2F4I A;  4XLH A;  4XL9 A;  4M7E A;  4MLO A;  3OS1 A;  2R7T A;  2X1D A;  3K4N A;  3HOS A;  4GKK H;  3L2V A;  4U7B A;  2A5W A;  1UAA A;  2HZD A;  1E0E A;  3PNY A;  2HQA A;  2WY8 Q;  1BR4 A;  4RB0 A;  3FMA A;  3OR1 C;  4CCJ A;  4XLE A;  4YEJ A;  4XN0 A;  2PJR A;  1L2Z A;  1BOB A;  1VS0 A;  4F92 B;  5HNF A;  3BA9 A;  2LBF B;  3ZGK A;  3A2K A;  4UCU A;  3QOD A;  5KNL A;  1Y6I A;  4EFB A;  5FRN A;  4GRI A;  1DP3 A;  4N4O B;  4PFP A;  3K4B A;  3PL8 A;  2X1E A;  4YHH H;  3CES A;  3K70 C;  3H35 A;  1IRX A;  4E7L A;  1WJC A;  4NUB A;  3H9J A;  1J5E H;  3RSN A;  3QYB A;  4UFZ A;  2X6X A;  2XC7 A;  1LKX A;  3AL0 C;  2Z16 A;  1E4G T;  1Z2P X;  4F3Q A;  3HXL A;  4F55 A;  3TBI A;  4LSA A;  2W7N A;  3LSG A;  3N05 A;  1AN7 A;  3BG7 A;  2XF7 A;  2ZXI A;  3RIZ A;  4ZJZ A;  5D1O B;  3D5L A;  3C0F B;  1WJA A;  3K4L A;  1XNR H;  3D5S C;  3OY9 A;  3FDY A;  4DBQ A;  2K5C A;  2UUC H;  4CCM A;  4MV7 A;  2JVG A;  2LY2 A;  4DGW B;  1XNQ H;  3AFH A;  1XMO H;  3V42 A;  2LG4 A;  3UQ8 A;  2X85 A;  4Q0Y A;  3ZRG A;  3GBG A;  2Q2T A;  4LF6 H;  2K3P A;  4XKB A;  1QU3 A;  4LIV A;  3BLY A;  2JUG A;  2BOL A;  3EPZ A;  4E7Z A;  2AQF A;  1N78 A;  2VUG A;  2AQE A;  4JI5 H;  3L2Q A;  5LMN H;  4BAC A;  3EYY A;  2Z1D A;  4B3M H;  4B48 A;  1HNX H;  2WAF A;  4X65 H;  5CKT A;  4CZC A;  3DPL C;  3BA8 A;  3J80 W;  3L4J A;  1WJ5 A;  3W5O A;  4UCV A;  1MW7 A;  4HNT A;  3K10 A;  3OYF A;  3IAS 2;  4BEH B;  2KZV A;  2VQG A;  4P5O A;  2F6C A;  2XF6 A;  3S3O A;  2KQR A;  3GJX B;  1G8X A;  4LIT A;  3OS2 A;  2R4G A;  3J81 W;  4CCL A;  2ZJT A;  3KAJ A;  2E5Z A;  1DGR M;  2WY7 Q;  2E1M B;  1G59 A;  3CJQ B;  5FLX W;  2YCH A;  1BJT A;  4XKW A;  4E4H A;  3A4C A;  4X62 H;  4C30 A;  2CV1 A;  3OYM A;  2R7V A;  3KAL A;  3E1S A;  2OUM A;  3UR3 C;  3UNG C;  4XN3 A;  3HG9 A;  2IS6 A;  2Y0S A;  3RQ4 A;  1CKM A;  4B3T H;  1PJR A;  3LML A;  4GKJ H;  1GYF A;  2ZSI B;  3I3L A;  3DQV C;  3QYF A;  2KL4 A;  4LG3 A;  4BQN A;  2LRE A;  1WJD A;  2V1N A;  1LVK A;  3ZCO A;  3RGZ A;  1D0Z A;  3AKZ A;  4BE0 A;  1OR7 C;  2ZFU A;  4LFA H;  3LFU A;  4DR1 H;  4J0M A;  3BG6 A;  4C2U A;  1CKN B;  4KIS A;  3N44 B;  4A2B A;  2LRD A;  3N43 B;  1HR0 H;  4K0K H;  3CVZ A;  4II3 A;  4XLF A;  3EUA A;  3S32 A;  3BAB A;  4ZDL A;  2HNH A;  4PUS A;  3TY8 A;  3CF2 A;  3PSF A;  3SYT A;  3E0J B;  4DV3 H;  4RMN A;  2F4V H;  4HG2 A;  5FPO A;  1SEI A;  1FMW A;  2LH9 A;  3OYL A;  1UEL B;  4ZTJ A;  4QPQ A;  4XMY A;  3W2A A;  2GOM A;  5BR8 H;  2CW8 A;  3K6G A;  4DV7 H;  4Y33 A;  2WAQ A;  2VKH A;  4XM3 A;  1FKA H;  3LMM A;  2LOO A;  4JOM A;  1AA7 A;  2UUA H;  4XLC A;  3TY9 A;  2CMP A;  2UXD H;  5CQE A;  4H4K C;  3PSI A;  3IAM 2;  2W57 A;  2V4J C;  2E60 A;  1SAU A;  4Y4R A;  2PMZ A;  4P1W A;  2V9K A;  4BXF A;  3N42 B;  2WAD A;  2IGM A;  4G6T B;  2KP6 A;  3L2W A;  3HC7 A;  3LL7 A;  3NWT A;  3OR2 C;  3RGX A;  4E7K A;  2VXZ A;  4KJZ A;  5LMU H;  4DR6 H;  1T95 A;  2KRC A;  4PZ6 A;  4LIU A;  2PJR B;  3DU6 A;  3W2W A;  4ETS A;  2RNG A;  2IGO A;  1MMN A;  1B04 A;  4EEQ A;  2A6T A;  2WB1 A;  1N36 H;  2IGK A;  1ZHS A;  4DUY H;  2UXC H;  2RGR A;  3HOT A;  2DCE A;  2R7U A;  4PJJ A;  3I9V 2;  2KPM A;  3KX2 A;  4BE2 A;  4B44 A;  3C2H A;  2DXI A;  3AL0 B;  2CFM A;  2W00 A;  4CH7 A;  1Z2N X;  4MV9 A;  1N34 H;  4AVZ A;  2HU9 A;  1NG6 A;  2W1O A;  1V5F A;  2E5N A;  2O5R A;  2V7F A;  4EAT A;  2QKL B;  4J00 A;  3H9Q A;  2JSP A;  3CZ6 A;  1WJB A;  3LSH A;  2XSJ C;  1CKO A;  4RM3 A;  4JI7 H;  2OC6 A;  4JI3 H;  4HSR A;  2CUZ A;  2KLO A;  2LY1 A;  1TAE A;  4DV1 H;  1WFX A;  3DU5 A;  2R7S A;  1TA8 A;  2V26 A;  2UXB H;  3NC0 B;  5HOO A;  1IBL H;  4ZDP A;  1BR2 A;  2MD0 A;  3H9G A;  3JAM W;  3OMY A;  4LMY A;  1N75 A;  5LL6 b;  1OLT A;  3MMY B;  3H20 A;  1W36 C;  4XOT A;  2X51 A;  1X1A A;  1ERD A;  3TY5 A;  4E7I A;  2VJ4 A;  3VYT B;  3SZG A;  4ZC3 A;  4UCT A;  1LFP A;  2R7O A;  4PJL A;  2HDW A;  4GLX A;  2LC2 A;  3KAK A;  1DGS A;  4LF4 H;  4E6N A;  3OYG A;  2CS3 A;  3RR5 A;  3OL4 A;  2IXS A;  4BS9 A;  4JI2 H;  5FRO A;  3SDB A;  4BJT A;  3QYE A;  5HNH A;  2UUB H;  2HVR A;  2M7B A;  4PFO A;  4FET A;  5EOY A;  2UV1 A;  4X0G A;  4RLF A;  1J09 A;  4BWS C;  2UU9 H;  4PZ7 A;  4BDY A;  3J7A Y;  1V5G A;  2X6Y A;  3NBZ B;  3MKZ A;  4B3X A;  1Y56 A;  4LF5 H;  3F8N A;  2NOJ B;  1VZ0 A;  3RTR A;  2Q1Z B;  2HHH H;  3HPG A;  2MAB A;  4PDB A;  2VQL A;  3DTK A;  4RAY A;  3OYI A;  4DR2 H;  2F5V A;  3RJ0 A;  1S03 G;  1WJE A;  5KCM A;  2IS1 A;  4BU2 A;  4XOP A;  1P8L A;  3BCB A;  4RB1 A;  1S9H A;  3PUB A;  2VJ5 A;  3OIP A;  1P9Q C;  3RPU D;  3H5R A;  4JI0 H;  1BGW A;  3L2U A;  3DEE A;  3OS0 A;  3S93 A;  4PJM A;  1Z3X A;  4J01 A;  1S68 A;  3JSL A;  4CSW A;  3OYC A;  4PZ8 A;  3FBN B;  2WE6 A;  4BQQ A;  4ZDO A;  4EFE A;  1SFK A;  2ZM6 H;  1U0J A;  1UG0 A;  1V9P A;  3D5R C;  2OWO A;  4R7R A;  4RB3 C;  3L2P A;  1GLN A;  4CCK A;  2JVH A;  2WAE A;  2R7Q A;  4B43 A;  4NQW B;  4PSX A;  3PN1 A;  4IAJ A;  1FJG H;  3CP8 A;  4DV5 H;  2L9N A;  2VQC A;  4UCO A;  4QPO A;  3CMM A;  4EQ5 A;  1N77 A;  1ZHQ A;  1P16 A;  4DJA A;  4AU7 A;  2XAU A;  4DV0 H;  3H0D A;  3S3M A;  3NBY B;  4HNU A;  2RGV A;  4DV4 H;  3LSM A;  5DIS C;  4BE1 A;  4BJ6 C;  4NNJ A;  4R79 A;  4DIQ A;  4F93 B;  4RAZ A;  1YX3 A;  4XLA A;  2E5L H;  3FKJ A;  1O75 A;  4D9J A;  2V6E A;  2XF5 A;  4KIT B;  1IBM H;  1MMD A;  3S3N A;  2X6W A;  2IGN A;  2Q2U A;  3DPT A;  3OYN A;  2W4S A;  4LFB H;  2X1C A;  3ZR8 X;  4X64 H;  3ONQ A;  3ZQQ A;  4JI8 H;  5IWA H;  3PNT A;  4JQF A;  1HA8 A;  1D0Y A;  2VPS A;  1QHG A;  4E6K G;  2VAS A;  2VOB A;  1A0I A;  3L4K A;  3W1G A;  3J7A K;  2FUG 2;  1X4P A;  3KEY A;  3L2R A;  4BL0 B;  3DKY A;  3TMO A;  2VL8 A;  2DT7 B;  1XK5 A;  1YE9 A;  2CFO A;  3OYK A;  3OL3 A;  2HIX A;  3RCO A;  3U21 A;  3DKX A;  3T1H H;  3CJR B;  5CPR B;  1TZL A;  1T0F C;  4B47 A;  2HVS A;  2K9M A;  3K3V A;  3BAA A;  3QWU A;  3GB8 B;  4OX9 H;  4XON A;  1N32 H;  2GOX B;  5CQG A;  1X1D A;  3PJR A;  2BW3 A;  2R7W A;  2IS4 A;  1Z3Y A;  2ELJ A;  2WBM A;  2Z2S B;  3DWL E;  4HEA 2;  3W2V A;  4C9Y A;  4YRV A;  3H5N A;  3N40 P;  1D1A A;  3HUG B;  1X9N A;  2VQF H;  1QHH D;  3N41 B;  1EA3 A;  2M0M A;  1MMG A;  1SYX B;  2KRH A;  2MC4 A;  4DR7 H;  4B3R H;  1MMA A;  1N33 H;  3HPH A;  4BGD A;  2WDT A;  4JI6 H;  2WYO A;  4NC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...