2HVRA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 3'-deoxyribonucleotide at the nick
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/rna/dna
total genus 83
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvrA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvrA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvrA01
3RTXA 5D1OA 3BA9A 2HVQA 3W1GA 4LH7A 1CKOA 1P16A 5D1PA 3TY9A 5D1OB 4CC6A 2CFMA 4DRFA 4GLXA 3NBYB 2HVRA 3KYHC 3TY5A 4LH6A 3NC0B 1B04A 3BAAA 3TY8A 2Q2TA 2HVSA 3QWUA 1XK5A 1CKNA 4PZ8A 3UQ8A 2HIVA 4PZ7A 4UCVA 3L2PA 1CKNB 3GDEA 4CC5A 3JSLA 5DISC 1XDNA 4UCSA 1CKMA 4UCRA 3W5OA 1FVIA 4EEQA 3VNNA 5FPOA 1X9NA 2Q2UA 4EFEA 4E6NA 3GB8B 3BABA 3W1BA 1P8LA 1TAEA 3JSNA 1TA8A 3PN1A 2VUGA 3S24A 2HIXA 1S68A 4UCOA 1VS0A 3RR5A 1DGSA 4UCTA 1V9PA 4UCUA 5FPRA 3GJXB 2OWOA 4UFZA 1A0IA 3NBZB 4EFBA 4PZ6A 3BA8A 4EQ5A
chains in the Genus database with same CATH superfamily
4FX0A 5BWTA 3H9JA 3QZ7A 4HPQA 2CW8A 3PSIA 3VB2A 1X1CA 2STWA 3HDDA 1Q1HA 2JRMA 5HDGA 4A3BJ 5FO5A 1BOAA 1B8IA 2JT1A 2V1DA 3LWBA 2KKOA 2KLOA 3I59A 1MMNA 3HT5A 2XHKA 3K70D 2L3DA 2M5WA 2Y0SA 2EILH 5LYJF 3F23A 2XGXA 2LD5A 5K2MA 2FK2A 5LL6b 2QKLB 2DU9A 3LA7A 4I2OA 3FMQA 1EHIA 1LEAA 2YS9A 1R36A 3BG6A 3TY5A 3LFKA 4Z6YA 2HGXA 4JI3H 4XQFA 2IW5A 3TP3A 3FXRA 2CQXA 1IF1A 3OYHA 4DLKA 2XGPA 2X1CA 4XICA 5KKNB 5LLQA 2QA4I 2VKEA 1R5ID 2XAHA 2E7WA 2EQRA 2M8EA 3CP2A 3H35A 4A3CG 2ZFUA 2DLLA 4ZZLA 3C2HA 3TIGA 2BR0A 4EMSA 2YS7A 4U0YA 1CKNA 3RIZA 4BBRG 1SAUA 1XB4A 3RV3A 3U9SA 5KFPA 1XCBA 2ID6A 2XASA 4FE7A 3TW7A 2FNPA 4DL2A 1SFEA 2VT2A 1FTZA 3A1YA 1YFHA 4F50A 1N78A 3ZMSA 4CC5A 2NU8B 4ECTA 3KP7A 4HRIA 2EFOA 3GUDA 4HG2A 3HUGA 1K61A 4IRKA 1W93A 2UUZA 4CYDA 3FK6A 4JI6H 3OS0A 1B4AA 1VZ0A 2V1UA 5FKKA 2DO7A 1HXDA 3G1LA 2JA7G 4A0ZA 1G2HA 4PJJA 5E79C 1FJGH 2V1NA 1Y14B 1I1GA 2P7VB 1PX2A 1VQ7I 1J09A 2W9AA 1C0WA 1P7JA 3ESWB 1PDNC 4PDKA 1XC5A 1A36A 3OWTA 3T7AA 4J9RA 3AG3H 4UV8A 4IR9A 5D5VB 2XAGA 1IN6A 4EVIA 2O0YA 3C7JA 5HDNA 1YRNA 3G2BA 5LBQA 4IL6C 4XM3A 3ZMDA 1ENHA 1YG2A 3QRFF 1W7PA 1FIAA 2KIMA 1XGSA 2FJZA 4A3JG 3GZNB 2H1KA 4ETSA 3T0YA 1T94A 1EKEA 3VYUB 3ECHA 4GCVA 4MTEA 2NU7B 3ZGKA 4QJFA 2J6UA 2MH9A 3G6EI 3CCVI 1P8LA 2DJNA 3PO2G 1ZKGA 2CGPA 1E3PA 3OMYA 3WG9A 1XMOH 1USSA 2TRTA 4IR1A 1F36A 5HNFA 5JVTA 1XS9A 2R7WA 2HDDA 4HQMA 4A69C 1VQNI 1TL8A 3TIIA 4LITA 4UCOA 5JH7F 2AXLA 3RF2A 1KQ0A 1WWXA 2L9VA 2QQAA 3EPZA 3ABUA 5CAEB 4O3QA 4J0MA 3I0TA 1FZPB 4B09A 2WV0A 2H94A 3H9QA 4II2A 2M1BA 4AU7A 4AWXB 2P5LC 2FOKA 2R7TA 2EJ2A 2CUJA 4S0HB 4B47A 5HLTA 1SC7A 1R7JA 3MMYB 3GTOA 1CQIB 3OYCA 2VN2A 6PAXA 1ZHFA 3GLLA 3WHBA 4HSRA 4OU0A 5A2QZ 2VOPA 1JLLB 4MV9A 1P7IA 1TQMA 1OR7A 3LWFA 3LSMA 2VR1A 5EJCA 5KFDA 1ZG5A 1R9TA 4LF4H 3HOWJ 2DABA 4JV1A 4C2TA 3GIMA 3LL7A 5E18F 4O83A 3E6BA 3JRBA 5DGAA 3F3XA 5TGTA 4BYYA 4WHXA 4BWSC 2X4HA 1WRVA 3H1CA 3HTUA 4JK1X 4CDGA 1BL0A 3T54A 1IBLH 2UWMA 3VOEA 2ME0A 1SD5A 2KIQA 5J3LA 3Q1KA 4TM5A 3GQCA 2VKDA 3OTOH 3CQZA 2HVRA 2LK2A 2WY8Q 2V6EA 3K4KA 3KYHC 4DV4H 2JA5A 4B3TH 2DMPA 2E60A 2QSHX 4HQ6A 2GOXB 4C3HJ 1EKVA 5KFYA 4KUMA 2AXTC 2QKMB 5ED4A 4O3MA 4OIOF 5IYBJ 4JUZA 1HOMA 2HKXA 1OISA 2Q2EA 2DK5A 1USTA 3S32A 4B4CA 5GPCA 3Q5FA 2R5YA 4U87A 4Y4RA 2EV0A 4V2GA 5DUKA 4A3EG 3IWZA 5EZGA 4S05A 5KFRA 2JVGA 2E5ZA 1QVTA 4XK4A 1ZG3A 3VSLA 3FMSA 2HOEA 2LP0A 3GO5A 1GV2A 4CYCB 5FLMG 5FLXW 3GDEA 1T36A 1VQ9I 5KFHA 4KFCA 3MVPA 3JSLA 2YS6A 4O7SA 2L9SA 2NS8A 2VIXA 3JZIA 3PIOF 1LNWA 4BE2A 4X64H 1T08B 1H88C 4PJNA 2R92J 3JZFA 3CVZA 1FKAH 5BS6A 1XX5A 4A5MA 3MFHA 1R5HA 5FB2A 3QWLA 2LFBA 4UY8I 4O86A 4XL9A 4XLNF 2C00A 3GIIA 3EDPA 1XN7A 2QEXI 4G3IA 1CE8A 3SYTA 2R3SA 3SE7A 1OKRA 3ABLH 1U9NA 2HQAA 5DYMA 3M9AA 2K9QA 1IJWC 3GFMA 3OS1A 2GLOA 3K2ZA 2X51A 1HA8A 2R93A 2HPIA 1ORKA 3J80W 3BJYA 3BQ2A 4QWQA 3GTLJ 5HVQC 1WSUA 1AHDP 4RNOA 1QO0D 2M0MA 3CD6I 2ABJA 3NAUA 4DR6H 4FASD 1PK8A 2WAFA 2DDAA 3FX3A 4GXOA 3CCRI 3WWHA 4DV3H 2PVPA 4XLCA 2XAFA 3ZQLA 1RETA 1HBXG 3MWEA 4KN4X 4V2FA 3LSGA 5IP6A 2VQEH 2XSDC 4ZDLA 4YR3A 4B3RH 1KBLA 2IT0A 5IP9J 2CW7A 2IJLA 2G7UA 4ED7A 1TQIA 3PR5B 4FFRA 5FLVA 2LYCA 1K4TA 1BNCA 1YTYA 2B0LA 3KP6A 3IUOA 2RF4A 4FS2A 3DBLB 4M71A 3RFCA 3ABTA 2BXYA 2KRCA 2EV6A 5A2QK 1Z2NX 1LEBA 4AQYH 5FGMA 2ACJA 2IS6A 2C2DA 5KFLA 4CCOA 5JFRA 3DU6A 4PK4A 3NBZB 4EFBA 2DA2A 3KZIC 1DIKA 2VPRA 3CF2A 5CA0F 1ETKA 4LG0B 2O9LA 4AYBN 2IS4A 4O4JF 4ESJA 1LQ1A 2K27A 3S1MJ 1W7PD 1AWCA 3BQ0A 4IKFA 1ONVA 3HOUG 3H9GA 1N33H 4L5EA 4BQOA 3R5HA 2KRHA 2CH0A 1ZGWA 2H27A 4ZQIA 5L3DA 3H36A 1QRYA 3KHHA 1ET0A 2LKXA 3HKZE 5IYCJ 1VKZA 2JWTA 1H9GA 1TBXA 2DMTA 5FJ8J 3MKYB 1BGWA 5DD4A 4RGUA 4IJAA 3ZR8X 1FP1D 3GEZA 3MCZA 4ABZA 4BGDA 3J80Z 4DGWB 4GC6A 3NC0B 1XGNA 2DOAA 1YJNI 3GTMJ 1MNMC 4RUAA 3DEUA 3VMMA 1TWAA 3IN5A 2LKPA 4HV5A 5I5YA 1E3OC 5K3WA 3BCAA 1U5TA 1V4YA 1T95A 2JMWA 5CQEA 3N44B 2HOTA 3DBRB 3F22A 2ODTX 4BBSJ 5KFKA 1FEXA 2VE9A 5HS9A 2MD5A 1POGA 2DFEA 1JGSA 4A3IG 4JYKA 3K7AJ 4F55A 2R8HA 1OCCH 1H89C 3HOYJ 1XG1A 2WTEA 3O3KA 4EBDA 2MD0A 3C3WA 2DQRA 4MEXF 2VA2A 1XMXA 4UCVA 2IGMA 4Q0YA 3FKIA 1U0JA 3U1KA 2W9BB 1VF9A 5E8IA 5KNLA 2EINH 1MMSA 4LF6H 2Y9YA 1XDNA 1MZBA 4DL3A 1TWHJ 1Y39A 1GDTA 3A01B 4D0PA 3JREA 2CKZB 1IDYA 2J5PA 1N48A 3HRMA 1VFCA 1W5TA 2YZGA 2DMNA 1XGOA 4ZDPA 1KYWA 2UUCH 2K9NA 3V42A 2OA4A 3HB9A 3HOVJ 1R1TA 3ISPA 5E17F 1SEUA 1JKJB 2A5YB 2KT0A 1HF0A 4JI7H 2JRTA 1MNEA 4CKBA 5KT2A 4LF7H 1XGMA 2BEOA 4EM0B 1TWFA 3OV8A 4E6NA 4YELA 2RC4A 3MJFA 2HS5A 1TQPA 3GIDA 2XDVA 5J4YA 4KMFA 1B9NA 3AG1H 3T9AA 2C2RA 2FPIB 3LMMA 4BQQA 1Z21A 5FRNA 2I8CA 4O7LA 2VQLA 4Y17A 2CV1A 4O82A 1MNDA 1VQMI 3V4SA 1O3TA 1JKOC 3ZPLA 1B59A 4Q8FA 3K4NA 3L2VA 4EJTA 4HOBA 1K1SA 3HBLA 5D4RA 1FOKA 1QHHD 2DAOA 4X62H 1N32H 4TV9F 2L7ZA 2JTVA 1RK6A 2M8GX 1K6OA 3CLQA 4UXNA 1UJ8A 2ZO4A 2XCAA 2KQRA 4NZNA 5ICFA 3EYYA 1RRJA 1JTYA 3G73A 4N4NB 3DPTA 1YX3A 5FROA 3WTUC 1JHFA 4HLYA 4TVIA 4UFZA 3AAFA 4FHTA 1WCMA 1R1VA 4QWBA 5DUIA 1FP2A 3C1DA 3I3LA 3TOAA 4DQ2A 1KYZA 2A07F 3P5JA 5KG6A 3D1NI 3VOTA 3CC7I 9ANTA 1OYYA 2GQQA 2HI3A 3BP8A 4ZHQF 3HOXG 2E34A 3VWBA 4LIVA 2ZXWH 5JHUA 3CDHA 2HXOA 4JP0A 3M7GA 3QAHA 5DCMB 4DBQA 1K83J 5CA1F 4IEJA 1JJ6C 1Y0NA 1D1AA 2JUCA 4HX7A 3JRAA 1Z2OX 3FBIB 4RGRA 3J80K 2QK4A 2HZDA 2VXZA 2KPMA 1IV6A 1QBJA 1UC8A 3G3ZA 2ZXHA 4K0KH 3JR9A 3NUAA 1P16A 3U1DA 5D1OB 3GCMA 3OL4A 1U2WA 4QWEA 2DWCA 2VE8A 4CCNA 3BT9A 4A6EA 4BHCA 5DS9A 2DA3A 4BL0B 3PSFA 4DYRA 3H0GA 2NNNA 4YP3A 4L5JA 5CB4F 4GLXA 4NB5A 1V5FA 1XCVA 3NGDA 3HPGA 4E4TA 4Q4DA 2W6NA 5EG0A 2W9CA 4J9SA 3WHCA 4YG2F 3MR3A 4YAJB 3GLXA 1IXRC 4NQWB 1FOXA 1JXLA 5EGOB 4TV7A 2E2JJ 3WTTC 1ZR4A 1R00A 1ZGJA 2FSWA 2XROA 1QZZA 4A3CJ 5L1LA 3GTPA 5HLGA 5EWGA 3E5UA 2W8LA 4DL5A 2M4KA 2ISZA 1T33A 2HJWA 2X1EA 2LBFB 3LMLA 3S93A 2UVUA 2COGA 2DYRH 3JTHA 4PZ7A 3KX2A 3N43B 4X66H 2YZLA 3OYGA 5DQIA 2AS5F 5J8FA 4BY1G 1E0EA 4ED2A 3V4ZA 2KP6A 4HYKA 4GFBA 4C5AA 4KN7X 2KJCA 4BKXA 3R4KA 5LD2C 4MHGA 1CKMA 3PFFA 1M0TA 4DYQA 3I55I 1IRXA 1S9HA 2WC2A 4L18B 2ZNYA 4FT8A 1MMAA 3O8HA 1IBKH 2JA7J 2HDKA 2ETHA 1TW3A 1OLTA 2BQRA 1U6GA 3CUOA 2IMWP 1F1ZA 1KJJA 2ZFWA 3IKTA 1HW1A 2VI6A 2HQ5A 4H0EA 2IGKA 3K6GA 1DU0A 3V7SA 3LULA 4MA0A 4Q43A 5KFQA 2WB1N 4XNFA 5H20A 4A5NA 5LGTA 4LB5A 3OUUA 1MH4A 5FKNA 2BQ3A 4MAMA 2GA1A 4F4WA 2F2EA 2DW4A 2DPUA 4HEA2 5TISC 2PLYA 2FLNA 1BR2A 2EFWA 3ONQA 1ZQ3P 3S1RJ 3SNOA 2HGWA 2EZKA 2MCTA 2K02A 2R5ZA 1ZLKA 1UG0A 2M2EA 1TAEA 3PO2J 1MJ9A 5GP9A 3G6VA 1XPXA 5AIPA 4NC8A 1JDBB 1EKFA 3RB4A 4FE4A 3HKZN 2GIZA 1OBDA 1D0ZA 1X19A 2CQNA 4M9SA 2Q8KA 2R7SA 4FFLA 1ULYA 3C0FB 1JGGA 1DGSA 3LP8A 4PDBA 3QYFA 4UCUA 2OWOA 1D8KA 5KFXA 2X6WA 2KHMA 3O8GA 3CJQB 2VBYA 5HNHA 2YU9A 3KIOA 1G8XA 1N25A 1UELB 2P4WA 3IHUA 3DV8A 4G12A 5EZYF 4O3PA 3PNYA 4FISA 4MFEA 1SVMA 4RDUA 4OIRF 2F4VH 4PJ0C 1MD0A 3ASNH 5KG5A 2QCOA 4I4TF 3RKYA 3WWIA 3WU1B 3OYMA 3AX6A 1WQ2A 1K79A 4IIJF 3LSPA 2W6OA 4TQSA 2CS3A 1S29A 1X2MA 5IP7G 5FKLA 5I5SA 3MN2A 2K85A 2LF8A 3R60A 3MQ0A 4FGRA 4XKWA 4HW0A 5DM7F 5CYVA 2QQ8A 4O84A 2ZC2A 4IZOA 3PNTA 3ZQIA 3J7YJ 4DBRA 4O2AF 2ATLA 2OTLI 1RR7A 4CKEA 1X3UA 5L3CA 3BCBA 4XRFA 3VFZA 1J5EH 2NUAB 1CF7B 1IXSB 2WADA 2E1OA 3OOPA 4L9TA 4U0WA 3J7AY 5LGUA 2PX9A 1R23A 5C8YF 1MDMB 1G3WA 2PN1A 3I71A 3QWUA 4A3EJ 4O4HF 4NXNH 2ASJA 2XAUA 2ESNA 3UFXB 3BPVA 3K4MA 3DEEA 2PMZA 3Q2OA 2DCEA 4NLGA 2YPRA 2XF7A 4D9JA 3U2RA 2L02A 5KFBA 3TOBA 4DW6A 3DP7A 1HW5A 1WKMA 3EUHC 2Y2ZA 4A3GG 1WJEA 4I50F 2JEIA 1V5EA 2PFBA 3ERED 2Z5UA 3IH4A 2YCHA 4ECYA 2BQUA 1OFCX 1TW2A 1YE9A 3CCQI 2JA5G 1G3SA 3GIPA 1MGTA 2F5VA 2IS1A 1B9MA 5B5EC 4UUTA 1ZHQA 4QPOA 4FX4A 2JEGA 3QQMA 5F0HA 3L2WA 4TQRA 4ZTJA 5J1UA 1Y1WG 3GTGA 3DLAA 2PBIA 4RNMA 3DEWA 4Y8VB 1Y1VJ 2RAEA 5LA6F 4U7BA 4A3KG 5ICGA 4AYBA 4UV9A 5L3EA 2R8KA 1R5GA 2R6FA 2F4MB 4CCKA 1HSJA 5DCFA 3Q8SB 2AHQA 3GWZA 4O81A 3LSTA 5H6RA 1S0MA 3UR3C 1DAAA 3HRUA 3BTLA 4DNCA 2YL2A 4LSAA 5L1KA 2VQDA 3ZQGA 2FU4A 4DAAA 4OMYA 4HBLA 1ZAUA 2MC3A 1U9OA 3FXMA 1Q1VA 3LQQA 3GTQA 2LG4A 1S0OA 3PW5A 2Y9ZA 2FPGB 1FNNA 5D8LB 1D1BA 2LTPA 3F0CA 3QOEA 2NOGA 4PJLA 5KT4A 1KONA 2HOAA 2IVMA 3I4MG 1JJ8C 3P9IA 5L1IA 4E7HA 1JT0A 3S1NJ 2XUBA 4UNOA 3FIWA 4XONA 3GTJJ 1XSVA 4XKCA 3ZMUA 2B63G 2R93G 1S7OA 4P5OA 1IV8A 2KDOA 3DAAA 1W5SA 5FLMJ 1X3ZB 3T9FA 5KG2A 5D8DA 3CCEI 3LA2A 3AFHA 3W6JB 1I6HJ 2HNHA 2EBIA 2P6TA 2HDWA 3IRQA 2JA8J 1YO5C 3U55A 3JRIA 2V59A 3N6XA 3FF5A 4FU0A 5ILVA 3MR5A 3CLOA 5GAGJ 4XYLB 3OR1C 3FXOA 1G59A 3I4NG 2EPFA 2PJPA 4A3LG 3LNQA 2M34A 4AUXA 4Y13A 3JAMW 4TUYF 4RAZA 2D45A 1IO2A 1BN5A 4DOZA 2MYSA 3E1SA 3M9OB 1ZGAA 4ME6A 5LP6F 1KC7A 1T0FC 2GPWA 3BACA 2L7MP 3OYEA 1TP4A 3ZQHA 2YZMA 4LFCH 4GRIA 4ZC3A 2CV0A 2K9LA 1NG6A 5DDGA 2YZNA 3JCUC 1VBGA 3T8RA 1T6SA 3JRFA 2HQNA 4XLEA 5KG1A 4X65H 2E2HJ 1R1UA 2BW3B 2O5RA 1KJQA 2Q2TA 5IT9W 5FKMA 2PMZE 2G0EA 1SMTA 3CESA 4M72A 4CYCA 2OZ6A 3HRSA 1KU3A 3S15J 1EJ9A 4F4ZA 1MBJA 5IY5H 4KT6A 2HIVA 2FF4A 4M3FA 4RLQA 4P55A 1RNLA 4E7ZA 4PGGA 3K3PA 2M7BA 1WI9A 2I8DA 3OL3A 4Y7NJ 1PYVA 3F9KA 2PMUA 2FX0A 3RYRA 3KZZA 4ENKA 2AQEA 3SFZA 2Z33A 3W6VA 4L0ZB 3B6CA 4LFAH 2NVYJ 5D5WB 3D5SC 3P9CA 5EEHA 2NVXJ 1H9TA 4PSXA 1FVIA 2GA2A 2WYOA 2C22A 1W36C 3IV5A 4A3FJ 2W6PA 3KALA 1GSHA 4LK1F 3T5XA 3CC2I 4DQNA 4DIQA 1HW2A 3ZOBA 4AYBE 3H40A 4O2BF 1REPC 2M05A 1GV5A 4CKCA 2Q2UA 1A5JA 2VONA 1IG7A 2R8JA 1MSFC 3JAMZ 1FSHA 2VOBA 3VYRB 4L9VA 3DKYA 1U3EM 4KICA 1JUMA 2DPDA 1VTNC 1Y8RB 1ZTRA 1LJ9A 3FKIG 1S6LA 3FWEA 1WR2A 2OBPA 1TWGA 1T8IA 3W1BA 1MMDA 5DLFA 1MH3A 1OYWA 2Z3YA 4NC7A 2BOLA 3T9DA 3I64A 4M3EA 5C44G 4JQFA 1JXSA 1LB2A 1D3YA 1E4EB 1HC8A 4CZZA 3E6DA 2C6YA 3H3UA 5CVRA 4Z2YA 5IT9Z 1GXQA 4DV1H 4E7SA 1WHUA 1XMKA 2C2EA 1YYVA 5BPFA 1DPUA 2JK3A 4U0VA 1KT8A 3T5KA 4B3XA 3S3OA 4JV5H 5TRDA 1U8RA 2LLKA 2BY3A 5BPDA 1V9PA 1VQLI 2R92A 3Q9SA 3RBDA 2XRLA 4LG0A 1B72B 2UXBH 4NBQA 2OCCH 4EYIB 1DQUA 1RK5A 4NNJA 2PG4A 3CUQB 1ZHSA 3B02A 1TNTA 5EF6A 1OBGA 3VEPA 2R7VA 3RPQA 3JRWA 4IAJA 1UHWA 3H4DA 2M45A 1FOYA 4BQAA 5E20A 3HSEA 2W85A 5JLXA 2HYFA 4ECXA 2KSWA 3LSKA 3V4GA 1TWCJ 3OYDA 2K4JA 2RNGA 4MV3A 3QPLA 3FHZA 1ZRCA 4WBNF 3RGXA 1NK2P 4IWXA 2HKOA 5FNVF 3TGNA 5FR9A 2N8GA 2QYOA 5JQWA 2W70A 3H0GG 1Z7LA 1WCMG 4YHHH 1ZELA 4RAYA 5CQGA 3HGGA 3LAJA 1MBHA 2DA5A 1CQTA 1CQJB 1RUOA 2WB1A 2E35A 2HQRA 4C30A 3KZYA 2L4AA 3FZVA 3QU6A 4CCMA 2LF7A 1KJ9A 3BR5A 3ETJA 4QIWN 3RB3A 2QVOA 4PUSA 3HOZG 2RDIA 2W9BA 3PW4A 4YIIA 2IRFG 4ECWA 1C3OA 3F8NA 3BJAA 3V7CA 1HQCA 2UUBH 4B43A 2W4SA 2UVVA 2VL8A 3L2PA 1IUFA 2G9WA 2KFDA 1QZYA 3A01A 3H3ZA 2UVWA 1R6RA 1YW7A 5K5RA 1BC8C 4G8XA 2MABA 3CUQC 4IF4A 2UXNA 4KITB 2OH2A 3BROA 5LMUH 3HKZA 1GLNA 1I39A 3N8DA 4M6XA 3WG7H 2O3FA 4O7YA 4CZCA 1N36H 2VQHA 1GVJA 3FISA 4EYHB 4ZYAA 5JHFA 1LFPA 5E3LA 2FD5A 2JSCA 4DYCA 4EEQA 4GDFA 5I5WA 1J7KA 4ZDOA 2R0QC 3RAXA 1XDSA 4JXUA 3HM5A 2VJIA 3JAMK 1Y1WA 3RKXA 3PW0A 3M1CA 1R58A 4E70A 2CNVA 2E1MB 1X9NA 4I0AA 4KJZA 5KCMA 1X1PA 1JUSA 2EJRA 3LQSA 4ED3A 2I87A 5JQGF 3OR2C 4EFEA 1R71A 5CKTA 2KRFA 2BVLA 1A0GA 2LSOA 3GZ5A 5BMVF 1OMIA 5BYBA 2VQGA 4OINF 5ICEA 2ZJPF 4RLFA 2DFIA 5IT9K 1Y56A 3G8DA 3BABA 3SQNA 4KA4A 3CCYA 3M8EA 5KFCA 4QW8A 2NRAC 3C2GA 1BR4A 1HKTA 1V55H 4HR7A 2QZ8A 4ZI7F 4XBFA 2COJA 2X6YA 2VUGA 1MBGA 1X2NA 3HGYA 3ZQQA 4E6KG 2GXBA 3VYSB 2ZDQA 1I2LA 4UVAA 3KYDB 1CS0A 2YW2A 3WNZA 1ZQ7A 4FCYA 4Q45A 3TQTA 4A3DG 4O6JA 4BJ5C 1JI8A 1SMYF 3I58A 2LMDA 3ORQA 2B63A 4GC7A 2FBHA 1TWHA 4PGHA 5LMNH 1A35A 4A2AA 1F9NA 2FPPB 1IN8A 4C5BA 3EETA 1V3FA 2ADUA 4WXHA 5DCMA 4ZJZA 5KFWA 4PZ6A 2PMZN 4XX0B 2WE6A 3N4MA 4ED0A 2BYVE 3HTSB 3CMMA 3U54A 5BOXA 1T38A 2E36A 2V9KA 3BTIA 1XNQH 2J9GA 4JI1H 2X9DA 1KU7A 2FXAA 2WV1A 5D1OA 3BA9A 4I09A 2E1MC 3WE3A 4BNCA 1P4AA 2M30A 3M8FA 3IL2A 1Z3XA 3JRHA 1IW7F 2HVQA 1W0UA 5DGHA 4LSXA 2AQ4A 3W1GA 2VT3A 1MW7A 3VPRA 1PVEA 4IX7A 3M4IA 3R5XA 1OJLA 2VOOA 3RUPA 3PM1A 5CVUA 4NQWA 1UG2A 5FLXZ 4ESBA 5EGOA 4Q4ZF 4RZQA 1P2FA 3KCCA 4LH6A 4EGQA 4CCLA 2WB1E 4JX6A 3MKZA 5KFGA 1B04A 2HR3A 3TMOA 5H80A 4G7OF 4RB0A 1Y6IA 1YIJI 5C4XJ 4JX4A 5KAFC 1Z3YA 5ERIA 4BJ6C 4D7NA 1LE8B 3GTOJ 3T9BA 1P4WA 3W2WA 3U9TA 2E71A 2OCEA 3L09A 1D8JA 2LBFA 1IRZA 2R8GA 1Z6TA 2M9HA 2Y4RA 3GIKA 2DODA 2ZSIB 3WU0A 3ZN1A 4CXFA 3K10A 1R9TJ 2HZTA 1BC7C 2RQQA 2V9PA 3A2KA 1ZG1A 1IRGA 1KEEA 3A4CA 3KLOA 2UU9H 1RESA 4PFPA 4HDVA 3CJTB 3WTVC 4HV6A 1XSXA 1KUTA 2VUMJ 2BV6A 3D0SA 4XLHA 2ZGIA 2HU9A 2XC9A 5CR5A 2BHZA 1E17A 3NWTA 5HOOA 4BXXJ 5DISC 2JA6J 1QZEA 2CG4A 2KIUA 5F64A 4I6ZA 1W1WE 5H6QA 2V79A 3RTRA 1Y8QB 3CQZJ 4U88A 2JA5J 1X3WB 3B73A 2FMYA 2ZXIA 3V8KA 2F5EA 4UUSB 5E3MA 3NEUA 1I7LA 2EWNA 3DLLF 5DLGA 1WH2A 2ZBKA 4R79A 2Y48A 1APLC 2QUFA 2IA1A 3MWDA 3TO6A 3T1BA 2DTZA 3LSIA 4DV2H 4EGYA 5M5XJ 3BWGA 2DLNA 4LK0F 2LNBA 3KP5A 4J9KA 2EV5A 2IPQX 5K7HA 2DPJA 1BI3A 4M73A 1AOYA 3L2UA 1HR0H 3BR3A 1AN7A 1WI3A 4EEFG 1M0WA 3HYIA 2OU2A 4YIRX 2XF6A 1RPWA 2L0KA 2IP2A 4MTDA 2STTA 2A3SA 4HNVA 3OYBA 1P92A 2NU9B 5DG8A 2M4GA 1MIJA 4ZYDA 3S24A 3IG0A 3SGIA 1JT6A 2COIA 2FMAA 2VQFH 4ED1A 1O3QA 3V6JA 1L3LA 5IYDJ 2C28A 3EUHA 3ERMA 1ACIA 2PQ8A 5C3EG 1SD7A 3FDYA 2COMA 4ECRA 5FD6A 2IP4A 1BA5A 2R7OA 4IRIA 4JBAA 3WGIA 4ED8A 3PNVA 3K9TA 1ETXA 4BHBA 1T98A 2XRNA 3OY9A 5F1RA 2R93J 4EBEA 3RAQA 1W5CC 2F5DA 2IA2A 3BA8A 4XRSA 4HAMA 2ME6A 4I55F 3ABKH 2DYSH 3S8PA 3ORRA 3TINA 5KFVA 1IN5A 4HZFA 3GTKJ 3T9CA 4EJOA 2MBFA 4P1WA 1K1QA 4YR2A 4IOAF 3M07A 5JR3A 3A0HC 4MQ9F 1LUJB 2NXNB 5TJJA 1ZLJA 5EDNA 5FLXK 2QBYB 1R4MB 4IWYA 2RVCA 3QP6A 4KIGA 1O3RA 1BI0A 4LH7A 4E7KA 1FYMA 3J81W 4P9UA 1I1SA 2FBKA 1K78B 4DZJA 3X2QH 3RI4A 1CF7A 1ZRFA 3GMEA 2V4QA 4EBCA 5KFNA 3NBYB 4HDUA 3BR0A 4W97A 1K4SA 3G6XA 5KT7A 2E1CA 4IRGA 1FY7A 1MDMA 1I3QJ 2NVTJ 2CUFA 3WGGA 5CE8A 4G6QA 2OPTA 3V8LA 1FMWA 1UHSA 3LFUA 4AVZA 3E6MA 1M1EB 5KVRA 1T3NA 2L54A 4J00A 4O3SA 4DR7H 5KS8A 1BJAA 5E1ZB 4B3SH 4XOPA 2CQ7A 2Y0MA 2EJ0A 3S2DJ 1TT0A 3S2WA 3H0DA 2L4MA 5KFOA 1GSAA 3GX4X 4OAZA 2GAUA 1VQOI 4A2BA 4J9NA 5GTIC 3RPUA 1JX4A 2D1HA 1B6RA 1P6RA 1BJZA 2FJ1A 3KFWX 1S72I 4ED6A 1G6NA 3QP5A 4XIDA 1ETYA 4HSTA 3VSKA 5CPRB 2FE3A 3WTXC 2Q1ZB 3OYLA 1W96A 4FE2A 2AGPA 2OAZA 3Q9VA 2DI3A 1Z9CA 5L3BA 1NHAA 2Q0OA 5DMXA 1DPRA 4F52A 4ENNA 1VQPI 1VQKI 1RKTA 2CJJA 4G94A 4YRVA 3GIJA 2MFZA 2EZHA 4QW9A 1KA8A 3U0GA 1NG7A 3BG3A 3OIPA 1MJBA 3J7AO 2D2WA 2P81A 1HNZH 3RBEA 4HF2A 4LD5A 2FQ4A 5FPOA 5I5TA 2GIVA 4CICA 3PVXA 1J59A 1FBUA 5E25A 4M6VA 4XSXF 1T0FA 4BBRJ 4M9XA 5E1XA 4XKVA 4HLXA 1ZETA 3RJPA 3J81Z 4YFNF 3TL4X 2A69F 5D4SA 1G2WA 5KFMA 1FX7A 3K3VA 3BLYA 3IWFA 2L01A 2XF5A 3TW6A 2FK3A 2R87A 2PBZA 4YAKB 1RYRA 2L5QA 1BIBA 1LDJA 2ID3A 4D5CA 5C44J 4ZOLF 2XSJC 5C1PA 3HOWG 4QSHA 2OZUA 4J9QA 5IOZA 3MEXA 4CGZA 2RKHA 1TA8A 5LOVF 4KIBA 4ECVA 1GHCA 1MBFA 2EK5A 4RUCA 2K9SA 3QPSA 2W00A 5EEGA 2WY7Q 3Q8QB 2R7ZA 4RMNA 4RAGA 1GSOA 3E7LA 4JV2A 4IHVA 4O7VA 4N0BA 2M7AA 2RNJA 2VC1A 2K9MA 2ZB9A 3ASOH 5F1JA 3CCUI 1A0IA 4QIWA 4A3JJ 2O8XA 1UZCA 5HLHA 2WDTA 1WZ2A 1WVRA 4RCNA 2KIFA 5IYBG 1S97A 3T5HA 2HYGD 3EUKL 5B1BH 1QHGA 4RU9A 1JKPC 5D8KB 1B6SA 2ICWG 1Y1VA 5M3FJ 1B1BA 3RKWA 2GZWA 3MR2A 1EA3A 5HBRB 2ELKA 5HNEA 3BPXA 2JEFA 4O7WA 2QQ9A 1BXRA 3TY9A 2VPSA 2JQ7A 4CC6A 4L9NA 2GXGA 4O7ZA 4PSWA 5D6EA 3F8BA 4R1HA 2X85A 5LHIA 3KETA 4DRFA 2IXSA 4XN3A 3OS2A 4OIPF 2R92G 2BW3A 1DP3A 1ZREA 3WTZA 1WRJA 2CSOA 3AG4H 5M3MJ 1I3AA 4RA2A 2MLKA 4UB8C 4S04A 4ECZA 3OSPA 3UZBA 3TY8A 4IZZA 2W7PA 1U78A 3F6VA 1D5YA 4IQJA 2CWEA 1JE8A 2RGRA 4Y15A 4JI2H 1YJ9I 2X0LA 2PMHA 3ZQFA 2CUZA 4PZ8A 1RZ4A 3PQKA 4K6NA 2RDJA 3HOZJ 2JA2A 1SANA 2LRDA 3GTJA 4A93G 1NK3P 4HF1A 1SFOA 3ZMZA 1ZAOA 1ON1A 2R7LA 3ROUA 2GOMA 1TZLA 3OSGA 1YITI 3H5RA 4C2MA 1HNWH 1KQ9A 3CMYA 3RZDJ 2Z1DA 3REOA 1QU3A 4GYIA 2AGOA 4IHYA 2PEXA 1HLVA 2WAQN 3FMRA 3BDDA 1J2XA 3JW4A 2W6QA 1BJTA 1VNDA 2BBYA 4YIFA 2Z02A 3OYIA 5J8CA 3G1MA 4FM9A 2JJ7A 2NOJB 3CC4I 4AVPA 1BW5A 2OUMA 3HHHA 3VPCA 4MLOA 4APMA 1F43A 4C3IJ 2Q7DA 5B3SH 4MNUA 5LRSA 2OLSA 1E2XA 3UZOA 3J81K 3L7WA 4BXFA 1WJ5A 3LA3A 1JDEA 1G3TA 3TP0A 5D5UB 1EH7A 4BEHB 4BY7G 5L3FA 2WWYA 3GTPJ 4LIUA 2LVSA 4UVCA 3CCSI 2VXDA 2CFOA 5GTHC 3R5FA 4RB3C 1AKHB 3QPTA 4JV0A 5GPAA 4HYEA 3HOTA 4YR0A 3CMEI 3CJRB 3T8TA 1IN4A 4B8XA 2OD5A 4CE5A 3OIOA 4DV6H 1E4EA 3NQOA 1G4DA 3LSJA 3FXJA 2E2HA 1P9QC 4NZMA 3W6KB 4B48A 4RBOA 2GBYA 4FETA 2DTRA 4J19A 2GQRA 3VODA 3LSHA 3RPUD 1SAXA 2QM3A 3HZJA 3G71I 1N77A 4RGXA 2KZVA 2VBWA 3W3CA 5K7FA 2E2IJ 4IHJF 1FIPA 2F6CA 5KG0A 4LF5H 3IAS2 5BPIA 2HIXA 5D6FA 3DF7A 1VAJA 1WSCA 1VS0A 1B72A 1ITYA 3E3VA 2XGQA 5ILSA 3PR4A 5IYCG 3OSFA 5KFTA 1IGNA 3L2QA 4A3DJ 3D5RC 4QIWE 2V1XA 5LXTF 4B3MH 3L2CA 3A02A 3CUQA 1PUFB 4UCTA 3G6YA 4EEYA 3EYIA 5BWUA 5DEQA 4IQ4A 4M3DA 2HGCA 2LOOA 5CVVA 4BE1A 1L2ZA 2NVXA 4GYGA 1STZA 2QF7A 1PP7U 5DGBA 4UUGA 2R7DA 2ZJ2A 1P4XA 1IZ1A 2M87A 3GFIA 1ZH5A 3TDZC 2YRWA 5H2FC 3KAJA 2XD4A 4EJWA 1TLHB 1ETWA 1ETQA 2XKOA 2Y69H 4FFNA 4DIMA 3IH3A 5DQHA 3DU5A 3V6HA 1HNXH 5KFEA 3MD2A 2V7FA 4ZYEA 5EWEA 3C18A 3S1QJ 5IOYA 5FD5A 3AKZA 1QNTA 3DBHB 3K4BA 2C35B 2JN6A 1ETVA 3RDIA 5D1PA 2Z16A 4Q44A 2QWWA 2TCTA 3BG5A 3PJRA 1N75A 3FKJA 1Z7UA 1T39A 3RB6A 3DF8A 2A6HF 3DWLE 2R82A 2Z04A 3AG2H 4J9MA 2R85A 2F4IA 5T14A 1J5YA 5BWRA 4BQNA 3RB0A 3JRXA 2YU9J 2XVCA 2XGCA 2UXDH 4UB6C 4JI8H 4R7RA 1QQIA 2E19A 3HOVG 1WPKA 3L4KA 1QPIA 4L1KA 3T5JA 4R8UB 4N4OB 3CDLA 3CSWA 2DMQA 2P0AA 2VJ5A 3HOUJ 1XDUA 2RV8A 3K69A 3AW8A 5DQGA 3IC7A 1W36D 2HPMA 1XNRH 3SEZA 5JI6A 4B1RA 1BOBA 4ECUA 3IH2A 1FWZA 4BDZA 5M5WJ 3SJMA 1UCRA 4Y3OA 1O7LA 4BE0A 1YLFA 1IYDA 1I50J 1Z05A 3LAPA 3S17J 4F3QA 4UCRA 2WA0A 3HHGA 4H4KC 2CFXA 2HWVA 4X6AJ 2X0SA 3RIRA 1ERDA 3K4CA 2XB0X 1GXPA 3CCJI 2HDCA 3J7AK 2J5OA 2MG4A 2ZM6H 1TWCA 2Y31A 1VQ6I 4O3NA 4I7HA 2OC6A 4N9HA 1KZHA 2RQPA 2EFPA 3VNNA 1A04A 1HSTA 4CMFA 3L9FA 1DV2A 2HXIA 2XPVA 2NYXA 2DQLA 4ZYGA 4IHTA 5CVJA 4A3IJ 2ZNZA 4HN2A 5KFJA 2A6EF 2I10A 1FTTA 5IT3A 3K1PA 3HOSA 3BOQA 2UXCH 2KL4A 3B6AA 4O7TA 5L1JA 1JKRC 3BG9A 4KT5C 4DR1H 3K2AA 1XMAA 3PUFA 2AU0A 3SZTA 3OHBA 5BNGA 3SZPA 2P5VA 5CM0A 3WU2C 4IVNA 1F4KA 2QENA 4XMYA 1Z1DA 4XLFA 2WAEA 1NTCA 4PZJA 3I4PA 3KEYA 3GVAA 3BR6A 1SYXB 3KYLA 4MV4A 4O7NA 1UMQA 4LB6B 2PJRB 3SFIA 5EYRA 3SXYA 1HDDC 3NRVA 5KX5F 1EH6A 2JZYA 5B66C 5C3EJ 4UVBA 4MV6A 3RGZA 3GTGJ 3DQVC 1S5LC 1AU7A 1VQ4I 3MAJA 4DV7H 2W1OA 2EH3A 1ULZA 2A5WA 3I54A 4IXAA 3OYKA 1I94H 2GM4A 5BWVA 4M6YA 4IOCF 2X6OA 5F27A 1FBSA 3FXLA 1S10A 2R4GA 4AIDA 1TNSA 3E0JB 3EQLF 2BXZA 3BQZA 4M7EA 2ELHA 4ITVA 4Y52J 1PJRA 4DR2H 5JVGF 3N97A 3H3VH 2NNYA 2P7CB 3HL2A 4EGZA 3R23A 4X1EA 3DXJF 3GTQJ 2FNAA 3P9KA 4J9PA 3OSNA 3S2HJ 2R7NA 3T5LA 3LQRA 1XMQH 2COBA 1WGXA 4HX4A 3K5HA 5KT3A 4JI5H 2CFMA 4LF9H 2TDXA 2DDBA 1LE8A 1Y0UA 3H5NA 4M9ZA 3EPIA 4KNYA 5I5UA 4R8HA 1OCTC 5A2QW 1OCPA 5LHHA 4WXCA 4ZH4F 1ZK8A 1VQ5I 1JUPA 4G9YA 1A6IA 2VKVA 4O4LF 1BR1A 2FK1A 4EV0A 4XRSG 3HOXJ 4O4IF 3K70C 5BR8H 2VBXA 2H1LA 4UHTA 5J2TF 2YR2A 1X1BA 2K4BA 1WFXA 3H20A 1GUUA 1S0NA 3QPHA 5J1YA 1XK5A 5KFZA 4GGGA 1EZ1A 3WO0A 3N40P 1Z2PX 3GTLA 2DJIA 3F8CA 1DP7P 2FLLA 5EDWA 3S3MA 1JKQC 2KJBA 1YW9A 1VQ8I 2HTJA 2NS7A 4QPQA 1T56A 3HC7A 1VI0A 3JRDA 2FBIA 3MKWB 4UUSA 4BHPA 2DT6A 3ZMTA 2ZJRF 5E1WA 2XAQA 5FRMA 1FBQA 2WTFA 3U21A 4XKBA 4NYEA 2HHFB 4HF0A 1SCUB 4DR5H 4JOMA 3PO3G 1RI7A 1YX5A 5KFFA 4G7ZF 3GV7B 1EKPA 2OTJI 2LR8A 5I5XA 4E7JA 4D1QA 1NH3A 1H8AC 3CMAI 2JUGA 4N9IA 2BY2A 2Z9OA 1FOWA 2K7LA 2R7QA 3ZQ7A 4KIFA 5KT5A 3TO7A 2VA3A 4CO8A 3D5LA 1GT0C 3PFIA 5KFSA 1DGRM 2BHYA 2XGDA 1S7EA 1KU2A 4LLLA 5E3OA 3GB8B 1RJPA 4RAFA 5KFUA 4BY1J 1E4GT 4GKKH 3H4BA 3R61A 2SCUB 3K4JA 2VPLA 1R4NB 5HS8A 1I1LA 4IHSA 2EIYA 4O3RA 1WJBA 2VJJA 1OQYA 2EIMH 3PL8A 1Z91A 4I76A 5GADJ 2HYJA 1S03G 5F04A 3PN1A 2A05A 2Y0SE 1PUEE 3SEQA 3MZHA 1I7NA 2ZDGA 4OMZA 2VUMA 5K7ZA 3K1MA 4FTHA 4XYMB 1LVKA 3DPUA 5F6FA 1BM9A 5KT6A 3E97A 2H6CA 4O7RA 2JA6A 4I0BA 4Q5SF 4RM3A 4JYAH 2ZMEB 3W2AA 2ASLA 3DTKA 3GTMA 3TDUC 1S7AA 3DKWA 1X1AA 3KYCB 4YY3H 4EQQA 4Q48A 2YWVA 2ESHA 2F48A 2NAZA 5D5XB 4BDYA 2F5FA 2R7FA 2FRHA 3ZXSA 1IYEA 1SVOA 2P8TA 2R7MA 1JIHA 4RS8A 4ANJA 2NS0A 5KHDA 1S3JA 2QBYA 2DOEA 2MGQA 1TWGJ 3BQYA 1TC3C 3PQJA 4DL4A 4G7HF 5F0CA 4EJUA 1LFBA 1Z77A 2BY0A 4XRMA 2K3PA 2LKSA 3ZP5A 1K78A 2LC2A 4FQGA 2EA4A 2WAQA 3KP2A 3JSOA 4MV7A 5KFIA 1UHMA 3H92A 2JSPA 3ZQCA 1FPQA 4A3MG 1FC3A 4J01A 1B8IB 4DV0H 2HGSA 2R7ZG 1I1MA 3HEFA 1Z0XA 4C3JJ 4ZYHA 1D0YA 1QGPA 5I47A 3I59B 4LJZF 4XSZF 1SEIA 2R7RA 3GIQA 3ELKA 2KMUA 5KK1A 5J6XA 4AM3A 3F6OA 3SI8A 2IGNA 4AIJA 3S3NA 5K1YA 2DPIA 1V54H 3Q0WA 4NDLA 1IDZA 3VYTB 2R86A 1IAWA 3LSRA 4UUVA 3V8JA 4YEJA 2HEOA 1A9XA 2ECCA 2FUG2 4HX8A 3RKQA 5C4JJ 3PFYA 2YX7A 4L9JA 5IWAH 2V26A 3ZCOA 1IRFA 1Y1VG 5IP7J 2G7HA 2OQRA 4F91B 2XCLA 1IN7A 4BJTA 4A93J 2DN0A 3TQNA 2XV4S 3GYHX 2DA1A 1DU6A 3V7RA 2HOSA 1LFUP 1KU9A 2ZMEC 2ALZA 2XIGA 1CKNB 2JVHA 3FMAA 3CJNA 3GW2A 3IP4B 2LREA 3MFKA 4QWAA 2CQKA 1LDKB 4GLWA 2EB7A 3GTKA 3QFFA 4B3AA 2PI0A 3G8CA 2EIKH 5KG4A 2RGVA 3CCMI 4NXMH 3N6RA 2ZKZA 3OYFA 3M9MB 1EYZA 5BWXA 2KISA 1I5ZA 3HUGB 4AD9A 1HKSA 1DUXC 4LG3A 5F9NA 3QYEA 3IKVA 4DV5H 3T1HH 1LDDA 3RYPA 2CYYA 1V51A 4Q8EA 4BY7J 4W1UA 2B7EA 1BIAA 3RZOJ 4IO9F 2V58A 4MGRA 1I6XA 1IOWA 1RUNA 5JUMA 1I3QA 3QZ8A 2FB9A 4LFUA 2EZIA 4K2EA 4OWRB 1MKMA 3R0JA 5L3GA 3F8FA 1GLVA 3IAM2 5CVIA 4CSWA 4KDPA 4A3GJ 1YRNB 4FFOA 2BY1A 2K5CA 1UC9A 2ZJTA 4M3BA 2P0WA 3GXOA 1W7PB 2HHHH 3IRRA 4GKJH 1K83A 1O75A 3KE2A 3KP3A 3CCLI 1N56A 2JA8G 1FSEA 3UKGA 3FXQA 3I9V2 2GPSA 3WTWC 3Q8PB 5BQTA 4LLGF 4NC6A 1N34H 1S68A 5HLIA 2W25A 2V6CA 1B33N 1BBYA 1ZYRF 2Z99A 1Y1WJ 4JI0H 2E5LH 5I60A 2OQGA 5ILUA 2IS2A 1MMGA 3BTJA 3ZN0A 3EUAA 4FS1A 5FPRA 2BVMA 4LFBH 4A3KJ 3KTMA 4KYWA 2V9WA 3K0LA 1AUXA 2DOFA 3SHFA 4DJAA 1CGPA 3VPDA 4Q4CA 1QA6A 1XTAA 1RJQA 2UVRA 3DPLC 2ZCWA 4XLPF 4EQ5A 2KZGA 1R22A 4ESFA 2CNQA 1WJFA 3RTXA 2FKLA 3GILA 4P9FA 2WAQE 2V9VA 3PIPF 2XPWA 4DZPA 5BWWA 4A3BG 2X48A 1DGWY 3PW7A 2MH2A 3BTCA 3GZ6A 2DXIA 4CHIA 4LF8H 3E6CC 2E7XA 4I01A 3AL0B 4E7LA 2H8RA 3KHLA 3DTFA 4IRHA 2LDUA 3RCOA 1CKOA 1SFUA 4DL6A 4OX9H 2VB6A 3I4MJ 4AIHA 1ZRDA 2YX4A 3HO8A 2O8KA 4E7IA 1U8BA 4DL7A 5CJ9A 3KEOA 3JSPA 2CZGA 2QSFX 4NHJA 2W48A 2RN7A 1ZARA 3MZYA 2B63J 2XAJA 1SFXA 3F21A 3KP4A 3S14J 2X5RA 3H5AA 4HA8A 3ECOA 3JZ6A 2JA7A 4GO1A 3BJ6A 5FFXA 3BZKA 3BJOA 4OIQF 2ASDA 1BW6A 1DV1A 2NU6B 2YYAA 1X1DA 5DV5A 4A3FG 1RYSA 4EM2A 2EFNA 1W4MA 2W82A 1YHQI 2F4OB 4A2UA 2DBBA 5LGNA 4BACA 4CHUA 3N05A 4C2UA 3Q0VA 2EA2A 5J47A 2CU7A 1WJCA 3K5IA 3KREA 2CV2A 5GAHJ 4ZTFA 3HIFA 4IRDA 5EOYA 3KAKA 2Q2EB 4C5CA 4HNUA 4RB1A 3WTSC 4A3LJ 2R5YB 3I4NJ 1O3SA 1OCOH 3SDGA 4CA0A 5JVDF 2V4RA 5DTDA 4QTRA 2W6ZA 3ZRGA 2A1HA 3O2PE 4XN0A 3HXLA 2AGQA 3OOUA 3ML6A 2O61A 4YB8B 2Y0SN 4WD3A 1BI1A 3TEDA 1I27A 4BEHA 2I5UA 2GLTA 2MW8A 1Z67A 1D0XA 4PJMA 2QQBA 4YJ2F 5F08A 4QWCA 3GFJA 4QLCU 4WF2A 4MV8A 3AL0C 1AKHA 3Q3SA 3CZ6A 1OR7C 3GLKA 1VBHA 2H8WA 3KHRA 3GFLA 4RB2C 1WH5A 1YW8A 3E5QA 3TO9A 1UAAA 3GV5B 1IXCA 1TTYA 4WWCA 3DTGA 3FXKA 3BZCA 5IYZF 4BAYA 2QB5A 5F0FA 2BE5F 2EFQA 5EEAA 2DA7A 2VASA 1OWTA 4RZRA 5FFZA 4KHPH 3KXYT 4ASNA 3CDIA 1LKXA 5K5OA 3KEQA 5LEKA 2D5VA 3P7NA 3NWSA 3CO7C 1WH7A 4G6DA 1QPMA 1RKWA 1YIOA 2X6XA 3GF2A 2F5CA 3SZGA 1TWAJ 1PUFA 2OF7A 3FHNA 3QODA 4CH7A 2CQQA 2W84A 3RQIA 4DUZH 1A48A 4O3OA 4O5VA 2VLAA 1RC9A 3KPHA 2ISYA 2K86A 2RDPA 5AONA 1OCRH 3FBNB 1HKQA 2WBMA 4P96A 3Q8RB 3T1YH 3OYNA 4IPAA 1I6UA 2L7KA 3G1OA 3M3YJ 1GGOA 4J9LA 1K6YA 4FBTA 3FKIJ 4I02A 3N41B 5LFAA 1KGSA 4RNNA 4PBCA 1B6AA 2EZLA 1Z6RA 1YS6A 4II3A 4F7ZA 1RIOH 2M3AA 1IBMH 1M7JA 4NZOA 2NVQJ 5M5YJ 5L9XA 2LY2A 2FOWA 2Y30A 5F9LA 1SD6A 2KDZA 2RREA 4KMUX 3COAC 3E5XA 1M6VA 1A6QA 2MSYA 3ZMVA 3WO1A 3A03A 3F72A 4WCGA 4NUBA 2B9SA 2E5NA 3JRGA 3R6SA 3HSFA 5DM6F 4XR6A 4EG0A 1TWFJ 1ON2A 1O7FA 5BMZA 4PFOA 1MBKA 4KISA 4BS9A 4R8UA 2E2IA 2XPUA 2L2OA 2UV1A 2MA3A 1C30A 4B44A 3TEKA 1J9IA 1GO3E 2UUAH 1A3GA 3I56I 2R7UA 4ECQA 3TQ1A 4XZ3B 1ZR2A 2QGUA 4CCJA 4WK8F 2HVSA 3KLNA 4X0GA 5EWFA 4EM1A 4AIKA 2W7OA 1D1CA 2DFHA 3WWJA 3UQ8A 5DG7A 3W2VA 4A0YA 1U5TB 1RJRA 2V5AA 3OIQA 3S16J 1E3HA 4F4YA 3Q0UA 1X4PA 2FA5A 2MLGA 3FK7A 4ZZDA 1EF4A 2W6MA 3WE2A 1JHHA 2H6BA 1XD7A 4U7DA 1IC8A 1J75A 4IHWA 2ZJQF 1T2KA 3R0AA 3CEBA 1J0RA 2W57A 4UCSA 3MFIA 3H0GJ 3PZPA 4XORA 4BH9A 2J6SA 1WCMJ 3WTYC 3W5OA 1S9FA 3U9GA 3PUBA 4TV8F 3R9RA 2FLPA 1UB9A 4RGSA 3BQ1A 4I98B 2OV7A 3PO3J 2DZDA 1MSEC 3ULQB 3KHGA 1O57A 3TKYA 3I5UA 1IUYA 4I99C 5HS7A 1GYFA 2A68F 4HQEA 5EZHA 3OYJA 2GQSA 3T9EA 5C1OA 3M9NB 4YFXF 4ECSA 4D5FA 3O6BB 5DAAA 3GBGA 3HPHA 2VODA 4FBUA 1KQ8A 2M0CA 2D1VA 4D7MA 4JI4H 1SFKA 2E1NA 1L0OC 2BZTA 2L9RA 3CTAA 3M1EA 1RR8C 5GONF 5BYAA 3CO6C 3ETHA 1YS7A 4FFPA 1MJAA 5KG7A 2ZSHB 4L5IA 4MA5A 3OHAA 2R7XA 1QVUA 1SVLA 2CO5A 1EV7A 5DGIA 3PW2A 2HG8A 5HV6A 2PJRA 1V4RA 3WGHA 2ECBA 5IP9G 4BUPA 1AUVA 2IGOA 1IOVA 1V5GA 2CW0F 4OOIA 3K1NA 3BZ6A 2YUSA 4F92B 3HG9A 5J2UF 3RR5A 1U5TC 1KJIA 5HDKA 3VDXA 4WX9A 2CRGA 1XSDA 2W8KA 2Z2SB 1A31A 3J7ZI 3CF5F 1I50A 4F93B 3GJXB 5I5VA 3DCFA 5E3NA 3DFGA 4IHXA 2VPQA 2XGEA 1S8NA 2FMLA 2JPCA 1W0TA 4MQVA 3NARA 5C4XG 3H3VK 1ODDA 2H09A 3L1PA 2JEJA 4U7CA 4XLAA 4L0YB 2W71A 3E5NA 1SD4A 4A12A 3L2RA 1FYKA 2HTSA 2QYZA 3L4JA 2DAAA 2FQ3A 1LPQA 4MV1A 2CMPA 2IEKA 2PN6A 2DFFA 2NVUB 1FLIA 3VA7A 3OYAA 1FYLA 2I80A 3BR1A 3WODF 3RV4A 5GAEJ 2ZDHA 3UNGC 3JTGA 5CLSA 2VJ4A 2DT7B 2XCPA 4M9UA 2UZKA 2UXXA 3QYBA 1HCRA 1YJWI 2VUMG 3MZ8A 5FJ8G 2AQFA 2EJ3A 3OUZA 1FT9A 2GWRA 3BG7A 4A3MJ 4PCQA 2R7ZJ 4DR3H 2XC7A 4BXXG 1PP8F 2YU3A 2JA6G 1EH8A 2NVYA 2LY9A 3MWMA 1OYIA 1G3YA 2L9NA 5K5QA 1D5VA 2VKHA 3V6KA 1O4XA 5E8GA 5LRRA 5JLWA 4XOTA 3BAAA 5JVLA 2Y75A 3N42B 4YQWA 5J40A 2IBKA 4JX5A 2IBDA 3CP8A 4M0JA 4EATA 2J6TA 2K40A 2ELJA 2CQYA 4LLNA 1OCZH 4CUGA 2VC0A 2MC4A 4YBZB 4BBSG 4ON0A 3K4LA 5EG0B 2O03A 3L00A 4A0XA 2W7NA 1EUCB 4ENMA 2W9CB 5DG9A 1UFMA 4A6DA 4MFDA 1KJ8A 1WJDA 3QU3A 4C9YA 3HOYG 2VQCA 1YI2I 2JPBA 4V19K 2R7KA 4OAYA 1ZN2A 3HJEA 4YFKF 4HNTA 2YRXA 5C5JA 1UNNC 5KFAA 5HODA 4DUYH 2LH9A 5IPAA 4YJ3F 2HHFA 4EJVA 2EIJH 2L7FP 5J4VA 2O6GE 5LEJA 3RSNA 5LHGA 3F8MA 5DD8A 2A6TA 2DMUA 3FM3A 3M4OJ 4BU2A 2IA6A 1OPCA 3QQAA 3LOCA 1KTAA 2XB5A 4M74A 4LGWA 4MEYF 2K3FA 4WXDA 2CNUA 2FEZA 3M8JA 3MR6A 5IYDG 3ABMH 2P6SA 4Y33A 1EUDB 3T99A 2YSRA 3RJ0A 2BGCA 4MO7A 1AA7A 1WJAA 3MKLA 2DA4A 1HDPA 4ENJA 1LVAA 4DR4H 4E4HA 2XKPA 4IRCA 1I2KA 3HSRA 2R84A 1DDNA 4BXUA 2X1DA 4EGJA 2OJED 4LOCA 3RQ4A 5J1RA 1SFOJ 2DA6A 3HRTA 2VBZA 3I53A 1ETOA 5ICCA 1E4FT 1TT5B 1R49A 4C2MJ 2R8IA 2A61A 5KG3A 4RM2A 1BI2A 1X58A 2DK8A 1F5TA 3GV8B 4CMDA 2IA0A 3AYHB 2QLZA 2GXAA 3I12A 4MIMA 4QWDA 1FMVA 1MBEA 2LY1A 3FM5A 3JSNA 5KAIC 3JRCA 2P5KA 3EPGA 1YOVB 4M3GA 1GVDA 2HFHA 3FXUA 3BR2A 5AIQA 3G4SI 3VPBA 2R5ZB 2ZXJA 5B1AH 2ZMEA 1H0MA 4U6PA 3TBIA 5FKOA 3UYYA 2DIKA 2CUEA 4F4XA 1YQAA 3DKXA 2W24A 3BC8A 1FJLA 4AC0A 2V4JC 3DTEA 2QSGX 1I1KA 3FDSA 2O7OA 3C2BA 5BPHA 3A0BC 3DTIA 1X4OA 3SDBA 4G6TB 2FP4B 2AO9A 2DT5A 4FFMA 4PWQA 4J9OA 2IAIA 1JTXA 1K7AA 3QOPA 3BY6A 4Q47A 4LMYA
chains in the Genus database with same CATH topology
4ANJA 5KHDA 3H9JA 3S8PA 4HPQA 2CW8A 3PSIA 3OYMA 1X1CA 4P1WA 2CS3A 2K3PA 2KLOA 2LC2A 2WAQA 1MMNA 4MV7A 4LH7A 2JSPA 4E7KA 3K70D 3J81W 2Y0SA 4J01A 4DV0H 2HGSA 4XKWA 5LL6b 2QKLB 1D0YA 1SEIA 2R7RA 3NBYB 3BG6A 3PNTA 3TY5A 4DBRA 2KMUA 4JI3H 4XQFA 3BCBA 2IGNA 1J5EH 3S3NA 3OYHA 1FMWA 2X1CA 3LFUA 4AVZA 2WADA 3J7AY 3VYTB 4J00A 3H35A 3CP2A 4DR7H 2ZFUA 4YEJA 3C2HA 4B3SH 2FUG2 4XOPA 3QWUA 4NXNH 1CKNA 3RIZA 3PFYA 1TT0A 2XAUA 1SAUA 3H0DA 2V26A 5IWAH 3ZCOA 3K4MA 4OAZA 4F91B 3DEEA 4A2BA 2PMZA 4BJTA 2DCEA 2XF7A 4D9JA 3A1YA 1N78A 3EUHC 1CKNB 2JVHA 2XIGA 3FMAA 4CC5A 4HSTA 3VSKA 1WJEA 5CPRB 3IP4B 2Q1ZB 2LREA 3OYLA 4HRIA 1V5EA 4HG2A 2FE3A 1LDKB 2YCHA 2UUZA 1YE9A 4JI6H 3OS0A 1VZ0A 4F52A 2F5VA 2RGVA 4YRVA 4NXMH 2MFZA 3OYFA 2IS1A 4PJJA 3HUGB 1ZHQA 1FJGH 1NG7A 2V1NA 3OIPA 4QPOA 4LG3A 3QYEA 1HNZH 1J09A 4DV5H 5FPOA 3T1HH 3L2WA 4ZTJA 3OWTA 3DLAA 4XKVA 3G2BA 4U7BA 4XM3A 4AYBA 3TL4X 4OWRB 4CCKA 3K3VA 4ETSA 3IAM2 4CSWA 3VYUB 3BLYA 2ZJTA 2K5CA 2XF5A 4MTEA 3UR3C 3ZGKA 4LSAA 2P0WA 2L5QA 1P8LA 2HHHH 4GKJH 2XSJC 1O75A 3OMYA 1XMOH 5HNFA 1TA8A 2LG4A 2R7WA 3I9V2 1N34H 1S68A 4LITA 4UCOA 3RF2A 1D1BA 2W00A 3QOEA 2WY7Q 3EPZA 4JI0H 4PJLA 4J0MA 1KONA 4RMNA 2E5LH 2IS2A 4E7HA 1MMGA 3H9QA 4II2A 3EUAA 4AU7A 2R7TA 2BVMA 5FPRA 4XONA 4LFBH 4XKCA 2M7AA 2CUJA 4B47A 2K9MA 5HLTA 1A0IA 4P5OA 3MMYB 4DJAA 2KDOA 2WDTA 3OYCA 3DPLC 4HSRA 4EQ5A 4MV9A 1WJFA 3AFHA 3RTXA 4LF4H 3LSMA 3EUKL 2HNHA 1QHGA 1DGWY 2HDWA 4C2TA 4LF8H 2DXIA 3LL7A 3N6XA 3AL0B 1EA3A 4E7LA 3OR1C 3RCOA 1G59A 1CKOA 4OX9H 5TGTA 2VPSA 2VB6A 3TY9A 3JAMW 4CC6A 4BWSC 4RAZA 4PSWA 4DOZA 4E7IA 2MYSA 3E1SA 2X85A 2UWMA 1T0FC 4DRFA 4LFCH 2IXSA 4XN3A 3OYEA 3OS2A 2VKDA 4GRIA 4ZC3A 2CV0A 2BW3A 2K9LA 1NG6A 2WY8Q 3K4KA 2HVRA 2V6EA 1DP3A 3KYHC 4DV4H 4B3TH 2E60A 3H5AA 2GOXB 3TY8A 2QKMB 4IZZA 4XLEA 4X65H 1X1DA 4IQJA 2RGRA 2BW3B 2O5RA 3S32A 2Q2TA 5IT9W 2W82A 4JI2H 4U87A 3CESA 4Y4RA 4BACA 3N05A 4C2UA 2JVGA 2CUZA 1WJCA 2E5ZA 4PZ8A 2CV2A 4ZTFA 2JA2A 2LRDA 5EOYA 3KAKA 2Q2EB 4KT6A 4HNUA 2HIVA 3VSLA 4RB1A 4RLQA 4CA0A 5FLXW 4E7ZA 2GOMA 1TZLA 3GDEA 1HNWH 3H5RA 2M7BA 3JSLA 2I8DA 2L9SA 2VIXA 2Z1DA 1PYVA 3F9KA 3OL3A 3ZRGA 1QU3A 3L4JA 1BJTA 4BE2A 4X64H 3CVZA 2AQEA 4PJNA 3HXLA 4XN0A 3OYIA 3OOUA 1FKAH 4LFAH 3D5SC 4FM9A 2NOJB 4PSXA 2OUMA 4BEHA 4MLOA 1FVIA 2WYOA 4APMA 1D0XA 4PJMA 1W36C 4XL9A 3AL0C 3KALA 4BXFA 1WJ5A 4DIQA 3CZ6A 1OR7C 4BEHB 4RB2C 3SYTA 2HQAA 4LIUA 2Q2UA 1UAAA 2VXDA 2CFOA 3OS1A 4RB3C 2X51A 1HA8A 2HPIA 3HOTA 2VOBA 3J80W 3VYRB 3CJRB 5HVQC 3DKYA 2VASA 2M0MA 4DV6H 3KXYT 4KHPH 4DR6H 4FASD 2WAFA 1P9QC 4DV3H 1LKXA 4B48A 3W1BA 1MMDA 4NC7A 4FETA 2BOLA 4XLCA 3NWSA 4JQFA 3LSHA 3LSGA 3RPUD 2VQEH 4ZDLA 4B3RH 1N77A 2KZVA 2X6XA 2CW7A 3W3CA 3SZGA 2F6CA 4DV1H 4E7SA 4LF5H 3IAS2 3FHNA 2HIXA 3QODA 2LYCA 4CH7A 3DF7A 1VS0A 4DUZH 4B3XA 3S3OA 3IUOA 2VLAA 4JV5H 3L2QA 3D5RC 4B3MH 4UCTA 2KRCA 1Z2NX 3FBNB 1V9PA 4IQ4A 2WBMA 4AQYH 2LOOA 4BE1A 3OYNA 3T1YH 1L2ZA 2IS6A 1I6UA 2L7KA 2UXBH 4CCOA 1K6YA 3DU6A 1DQUA 4PK4A 4NNJA 3NBZB 1ZHSA 4EFBA 5LFAA 3N41B 3CF2A 3KAJA 2R7VA 1HNXH 4II3A 3DU5A 1IBMH 2M3AA 2IS4A 4IAJA 3MD2A 2V7FA 2LY2A 4IKFA 2RREA 3AKZA 3H9GA 2KSWA 4BQOA 5FD5A 3K4BA 3LSKA 2KRHA 2CH0A 1N33H 3OYDA 2RNGA 5D1PA 2Z16A 4NUBA 3RGXA 2E5NA 3PJRA 3MKYB 1BGWA 1N75A 3FKJA 3ZR8X 4XR6A 4BGDA 3DWLE 4DGWB 2F4IA 3NC0B 2DOAA 1Z7LA 4YHHH 4BQNA 4PFOA 1ZELA 4KISA 4RAYA 4BS9A 5CQGA 2L2OA 2UV1A 4B44A 2UXDH 2UUAH 2WB1A 4C30A 4CCMA 4JI8H 3BCAA 4R7RA 2R7UA 1T95A 3L4KA 5CQEA 4CCJA 3N44B 2HVSA 4N4OB 4X0GA 4PUSA 1D1CA 2VJ5A 3UQ8A 3W2VA 4F55A 3F8NA 1W36D 2HPMA 2UUBH 3SEZA 2MD0A 1XNRH 3OIQA 2W4SA 1BOBA 4B43A 2VL8A 4UCVA 1X4PA 2IGMA 4BDZA 3L2PA 4Q0YA 1U0JA 1R6RA 4Y3OA 5KNLA 4BE0A 4LF6H 2MABA 4KITB 1XDNA 5LMUH 3HKZA 4UCSA 1MZBA 2W57A 1GLNA 4F3QA 4UCRA 4XORA 2WA0A 4H4KC 4CZCA 2VQHA 3W5OA 1ERDA 3PUBA 4ZYAA 3K4CA 5JHFA 1LFPA 4EEQA 3J7AK 2OV7A 4ZDOA 2ZM6H 4I7HA 2OC6A 2VJIA 4ZDPA 2UUCH 3V42A 3VNNA 1GYFA 3M1CA 1X9NA 2E1MB 4JI7H 3OYJA 4KJZA 5KCMA 1MNEA 3GBGA 3HPHA 4LF7H 3OR2C 4EFEA 5CKTA 4E6NA 2UXCH 2BVLA 4YELA 3HOSA 2KL4A 4JI4H 1SFKA 2XDVA 4DR1H 2VQGA 4RLFA 1Y56A 3BABA 3LMMA 2ZSHB 4BQQA 1Z21A 5FRNA 2R7XA 2VQLA 2CV1A 1MNDA 2PJRA 3C2GA 1BR4A 4XMYA 4XLFA 2WAEA 3K4NA 3KEYA 4BUPA 3L2VA 2IGOA 2X6YA 2VUGA 1V5GA 4E6KG 3ZQQA 3VYSB 1QHHD 1SYXB 3KYLA 4X62H 1N32H 4F92B 3HG9A 3RR5A 2PJRB 4BJ5C 1JI8A 3VDXA 2Z2SB 3RGZA 2KQRA 3DQVC 3EYYA 4F93B 3GJXB 4DV7H 2W1OA 4N4NB 3DPTA 1YX3A 2A5WA 5FROA 3OYKA 4UFZA 5LMNH 4A2AA 1I94H 3I3LA 4ZJZA 4XLAA 2R4GA 3OTOH 4PZ6A 2WE6A 3L2RA 3CMMA 3VWBA 2V9KA 3E0JB 4LIVA 1XNQH 2CMPA 4JI1H 4M7EA 4ITVA 1PJRA 4DR2H 5D1OA 4DBQA 3BA9A 3OYAA 3HL2A 1Z2OX 1D1AA 2E1MC 1N36H 3FBIB 2HZDA 1Z3XA 2KPMA 2VXZA 2HVQA 3UNGC 4LSXA 2VJ4A 2DT7B 2ZXHA 3W1GA 4K0KH 1P16A 1XMQH 3QYBA 1MW7A 2AQFA 3OL4A 5D1OB 1IBLH 3BG7A 4DR3H 4IX7A 3M4IA 4JI5H 4CCNA 2XC7A 2CFMA 4LF9H 4BL0B 3PSFA 3H5NA 4GLXA 3MWMA 2L9NA 4RZQA 1V5FA 4LH6A 5A2QW 4CCLA 2VKHA 3MKZA 3HPGA 1B04A 3TMOA 4RB0A 1Y6IA 4XOTA 3BAAA 3N42B 1Z3YA 4BJ6C 1BR1A 3W2WA 3CP8A 4NQWB 4EATA 2LBFA 2ELJA 3K70C 5BR8H 4CUGA 2MC4A 1X1BA 1WFXA 2ZSIB 3H20A 3K4LA 2W7NA 3K10A 2O03A 1XK5A 2RQQA 3A2KA 2M4KA 3A4CA 1WJDA 4C9YA 2UU9H 3N40P 2VQCA 2X1EA 2LBFB 2DJIA 4PFPA 3S93A 1Z2PX 3LMLA 3S3MA 4OAYA 3N43B 4PZ7A 4X66H 3KX2A 4HNTA 4XLHA 4QPQA 4DUYH 3OYGA 2LH9A 2HU9A 3HC7A 3MKWB 1E0EA 3NWTA 5HOOA 5DISC 2KP6A 2DT6A 3RSNA 5FRMA 5LD2C 3RTRA 1CKMA 2A6TA 1M0TA 3U21A 4XKBA 1IRXA 1S9HA 4BU2A 4DR5H 1MMAA 4JOMA 1IBKH 2ZXIA 1YX5A 1OLTA 3M8JA 4E7JA 4D1QA 1WH2A 4Y33A 4R79A 2JUGA 3RJ0A 1AA7A 3LSIA 4DV2H 1WJAA 2IGKA 3K6GA 4DR4H 2R7QA 4E4HA 4XNFA 3D5LA 1DGRM 2X1DA 3RQ4A 3GB8B 3L2UA 1E4FT 1HR0H 4HEA2 1AN7A 1BR2A 3ONQA 4RM2A 1E4GT 1M0WA 4GKKH 2XF6A 3K4JA 2VPLA 2MCTA 1UG0A 1WJBA 2VJJA 1FMVA 3PL8A 1TAEA 4MTDA 2LY1A 3OYBA 3JSNA 1S03G 3PN1A 2M4GA 4NC8A 3S24A 3IG0A 3SEQA 2VQFH 3TBIA 1D0ZA 1LVKA 3DPUA 1X19A 2R7SA 3FDYA 5FD6A 3C0FB 2R7OA 1DGSA 4PDBA 3DKXA 3QYFA 3BC8A 4RM3A 4UCUA 2OWOA 2V4JC 3DTEA 3W2AA 4JYAH 3DTKA 2KHMA 2X6WA 3CJQB 3PNVA 5HNHA 1X1AA 1G8XA 1UELB 3DTIA 4YY3H 1X4OA 3SDBA 4G6TB 3OY9A 3PNYA 4BDYA 2F4VH 3ZXSA 3BA8A 4LMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTX A;  5D1O A;  3BA9 A;  2HVQ A;  3W1G A;  4LH7 A;  1CKO A;  1P16 A;  5D1P A;  3TY9 A;  5D1O B;  4CC6 A;  2CFM A;  4DRF A;  4GLX A;  3NBY B;  2HVR A;  3KYH C;  3TY5 A;  4LH6 A;  3NC0 B;  1B04 A;  3BAA A;  3TY8 A;  2Q2T A;  2HVS A;  3QWU A;  1XK5 A;  1CKN A;  4PZ8 A;  3UQ8 A;  2HIV A;  4PZ7 A;  4UCV A;  3L2P A;  1CKN B;  3GDE A;  4CC5 A;  3JSL A;  5DIS C;  1XDN A;  4UCS A;  1CKM A;  4UCR A;  3W5O A;  1FVI A;  4EEQ A;  3VNN A;  5FPO A;  1X9N A;  2Q2U A;  4EFE A;  4E6N A;  3GB8 B;  3BAB A;  3W1B A;  1P8L A;  1TAE A;  3JSN A;  1TA8 A;  3PN1 A;  2VUG A;  3S24 A;  2HIX A;  1S68 A;  4UCO A;  1VS0 A;  3RR5 A;  1DGS A;  4UCT A;  1V9P A;  4UCU A;  5FPR A;  3GJX B;  2OWO A;  4UFZ A;  1A0I A;  3NBZ B;  4EFB A;  4PZ6 A;  3BA8 A;  4EQ5 A; 
#chains in the Genus database with same CATH topology
 4FX0 A;  5BWT A;  3H9J A;  3QZ7 A;  4HPQ A;  2CW8 A;  3PSI A;  3VB2 A;  1X1C A;  2STW A;  3HDD A;  1Q1H A;  2JRM A;  5HDG A;  4A3B J;  5FO5 A;  1BOA A;  1B8I A;  2JT1 A;  2V1D A;  3LWB A;  2KKO A;  2KLO A;  3I59 A;  1MMN A;  3HT5 A;  2XHK A;  3K70 D;  2L3D A;  2M5W A;  2Y0S A;  2EIL H;  5LYJ F;  3F23 A;  2XGX A;  2LD5 A;  5K2M A;  2FK2 A;  5LL6 b;  2QKL B;  2DU9 A;  3LA7 A;  4I2O A;  3FMQ A;  1EHI A;  1LEA A;  2YS9 A;  1R36 A;  3BG6 A;  3TY5 A;  3LFK A;  4Z6Y A;  2HGX A;  4JI3 H;  4XQF A;  2IW5 A;  3TP3 A;  3FXR A;  2CQX A;  1IF1 A;  3OYH A;  4DLK A;  2XGP A;  2X1C A;  4XIC A;  5KKN B;  5LLQ A;  2QA4 I;  2VKE A;  1R5I D;  2XAH A;  2E7W A;  2EQR A;  2M8E A;  3CP2 A;  3H35 A;  4A3C G;  2ZFU A;  2DLL A;  4ZZL A;  3C2H A;  3TIG A;  2BR0 A;  4EMS A;  2YS7 A;  4U0Y A;  1CKN A;  3RIZ A;  4BBR G;  1SAU A;  1XB4 A;  3RV3 A;  3U9S A;  5KFP A;  1XCB A;  2ID6 A;  2XAS A;  4FE7 A;  3TW7 A;  2FNP A;  4DL2 A;  1SFE A;  2VT2 A;  1FTZ A;  3A1Y A;  1YFH A;  4F50 A;  1N78 A;  3ZMS A;  4CC5 A;  2NU8 B;  4ECT A;  3KP7 A;  4HRI A;  2EFO A;  3GUD A;  4HG2 A;  3HUG A;  1K61 A;  4IRK A;  1W93 A;  2UUZ A;  4CYD A;  3FK6 A;  4JI6 H;  3OS0 A;  1B4A A;  1VZ0 A;  2V1U A;  5FKK A;  2DO7 A;  1HXD A;  3G1L A;  2JA7 G;  4A0Z A;  1G2H A;  4PJJ A;  5E79 C;  1FJG H;  2V1N A;  1Y14 B;  1I1G A;  2P7V B;  1PX2 A;  1VQ7 I;  1J09 A;  2W9A A;  1C0W A;  1P7J A;  3ESW B;  1PDN C;  4PDK A;  1XC5 A;  1A36 A;  3OWT A;  3T7A A;  4J9R A;  3AG3 H;  4UV8 A;  4IR9 A;  5D5V B;  2XAG A;  1IN6 A;  4EVI A;  2O0Y A;  3C7J A;  5HDN A;  1YRN A;  3G2B A;  5LBQ A;  4IL6 C;  4XM3 A;  3ZMD A;  1ENH A;  1YG2 A;  3QRF F;  1W7P A;  1FIA A;  2KIM A;  1XGS A;  2FJZ A;  4A3J G;  3GZN B;  2H1K A;  4ETS A;  3T0Y A;  1T94 A;  1EKE A;  3VYU B;  3ECH A;  4GCV A;  4MTE A;  2NU7 B;  3ZGK A;  4QJF A;  2J6U A;  2MH9 A;  3G6E I;  3CCV I;  1P8L A;  2DJN A;  3PO2 G;  1ZKG A;  2CGP A;  1E3P A;  3OMY A;  3WG9 A;  1XMO H;  1USS A;  2TRT A;  4IR1 A;  1F36 A;  5HNF A;  5JVT A;  1XS9 A;  2R7W A;  2HDD A;  4HQM A;  4A69 C;  1VQN I;  1TL8 A;  3TII A;  4LIT A;  4UCO A;  5JH7 F;  2AXL A;  3RF2 A;  1KQ0 A;  1WWX A;  2L9V A;  2QQA A;  3EPZ A;  3ABU A;  5CAE B;  4O3Q A;  4J0M A;  3I0T A;  1FZP B;  4B09 A;  2WV0 A;  2H94 A;  3H9Q A;  4II2 A;  2M1B A;  4AU7 A;  4AWX B;  2P5L C;  2FOK A;  2R7T A;  2EJ2 A;  2CUJ A;  4S0H B;  4B47 A;  5HLT A;  1SC7 A;  1R7J A;  3MMY B;  3GTO A;  1CQI B;  3OYC A;  2VN2 A;  6PAX A;  1ZHF A;  3GLL A;  3WHB A;  4HSR A;  4OU0 A;  5A2Q Z;  2VOP A;  1JLL B;  4MV9 A;  1P7I A;  1TQM A;  1OR7 A;  3LWF A;  3LSM A;  2VR1 A;  5EJC A;  5KFD A;  1ZG5 A;  1R9T A;  4LF4 H;  3HOW J;  2DAB A;  4JV1 A;  4C2T A;  3GIM A;  3LL7 A;  5E18 F;  4O83 A;  3E6B A;  3JRB A;  5DGA A;  3F3X A;  5TGT A;  4BYY A;  4WHX A;  4BWS C;  2X4H A;  1WRV A;  3H1C A;  3HTU A;  4JK1 X;  4CDG A;  1BL0 A;  3T54 A;  1IBL H;  2UWM A;  3VOE A;  2ME0 A;  1SD5 A;  2KIQ A;  5J3L A;  3Q1K A;  4TM5 A;  3GQC A;  2VKD A;  3OTO H;  3CQZ A;  2HVR A;  2LK2 A;  2WY8 Q;  2V6E A;  3K4K A;  3KYH C;  4DV4 H;  2JA5 A;  4B3T H;  2DMP A;  2E60 A;  2QSH X;  4HQ6 A;  2GOX B;  4C3H J;  1EKV A;  5KFY A;  4KUM A;  2AXT C;  2QKM B;  5ED4 A;  4O3M A;  4OIO F;  5IYB J;  4JUZ A;  1HOM A;  2HKX A;  1OIS A;  2Q2E A;  2DK5 A;  1UST A;  3S32 A;  4B4C A;  5GPC A;  3Q5F A;  2R5Y A;  4U87 A;  4Y4R A;  2EV0 A;  4V2G A;  5DUK A;  4A3E G;  3IWZ A;  5EZG A;  4S05 A;  5KFR A;  2JVG A;  2E5Z A;  1QVT A;  4XK4 A;  1ZG3 A;  3VSL A;  3FMS A;  2HOE A;  2LP0 A;  3GO5 A;  1GV2 A;  4CYC B;  5FLM G;  5FLX W;  3GDE A;  1T36 A;  1VQ9 I;  5KFH A;  4KFC A;  3MVP A;  3JSL A;  2YS6 A;  4O7S A;  2L9S A;  2NS8 A;  2VIX A;  3JZI A;  3PIO F;  1LNW A;  4BE2 A;  4X64 H;  1T08 B;  1H88 C;  4PJN A;  2R92 J;  3JZF A;  3CVZ A;  1FKA H;  5BS6 A;  1XX5 A;  4A5M A;  3MFH A;  1R5H A;  5FB2 A;  3QWL A;  2LFB A;  4UY8 I;  4O86 A;  4XL9 A;  4XLN F;  2C00 A;  3GII A;  3EDP A;  1XN7 A;  2QEX I;  4G3I A;  1CE8 A;  3SYT A;  2R3S A;  3SE7 A;  1OKR A;  3ABL H;  1U9N A;  2HQA A;  5DYM A;  3M9A A;  2K9Q A;  1IJW C;  3GFM A;  3OS1 A;  2GLO A;  3K2Z A;  2X51 A;  1HA8 A;  2R93 A;  2HPI A;  1ORK A;  3J80 W;  3BJY A;  3BQ2 A;  4QWQ A;  3GTL J;  5HVQ C;  1WSU A;  1AHD P;  4RNO A;  1QO0 D;  2M0M A;  3CD6 I;  2ABJ A;  3NAU A;  4DR6 H;  4FAS D;  1PK8 A;  2WAF A;  2DDA A;  3FX3 A;  4GXO A;  3CCR I;  3WWH A;  4DV3 H;  2PVP A;  4XLC A;  2XAF A;  3ZQL A;  1RET A;  1HBX G;  3MWE A;  4KN4 X;  4V2F A;  3LSG A;  5IP6 A;  2VQE H;  2XSD C;  4ZDL A;  4YR3 A;  4B3R H;  1KBL A;  2IT0 A;  5IP9 J;  2CW7 A;  2IJL A;  2G7U A;  4ED7 A;  1TQI A;  3PR5 B;  4FFR A;  5FLV A;  2LYC A;  1K4T A;  1BNC A;  1YTY A;  2B0L A;  3KP6 A;  3IUO A;  2RF4 A;  4FS2 A;  3DBL B;  4M71 A;  3RFC A;  3ABT A;  2BXY A;  2KRC A;  2EV6 A;  5A2Q K;  1Z2N X;  1LEB A;  4AQY H;  5FGM A;  2ACJ A;  2IS6 A;  2C2D A;  5KFL A;  4CCO A;  5JFR A;  3DU6 A;  4PK4 A;  3NBZ B;  4EFB A;  2DA2 A;  3KZI C;  1DIK A;  2VPR A;  3CF2 A;  5CA0 F;  1ETK A;  4LG0 B;  2O9L A;  4AYB N;  2IS4 A;  4O4J F;  4ESJ A;  1LQ1 A;  2K27 A;  3S1M J;  1W7P D;  1AWC A;  3BQ0 A;  4IKF A;  1ONV A;  3HOU G;  3H9G A;  1N33 H;  4L5E A;  4BQO A;  3R5H A;  2KRH A;  2CH0 A;  1ZGW A;  2H27 A;  4ZQI A;  5L3D A;  3H36 A;  1QRY A;  3KHH A;  1ET0 A;  2LKX A;  3HKZ E;  5IYC J;  1VKZ A;  2JWT A;  1H9G A;  1TBX A;  2DMT A;  5FJ8 J;  3MKY B;  1BGW A;  5DD4 A;  4RGU A;  4IJA A;  3ZR8 X;  1FP1 D;  3GEZ A;  3MCZ A;  4ABZ A;  4BGD A;  3J80 Z;  4DGW B;  4GC6 A;  3NC0 B;  1XGN A;  2DOA A;  1YJN I;  3GTM J;  1MNM C;  4RUA A;  3DEU A;  3VMM A;  1TWA A;  3IN5 A;  2LKP A;  4HV5 A;  5I5Y A;  1E3O C;  5K3W A;  3BCA A;  1U5T A;  1V4Y A;  1T95 A;  2JMW A;  5CQE A;  3N44 B;  2HOT A;  3DBR B;  3F22 A;  2ODT X;  4BBS J;  5KFK A;  1FEX A;  2VE9 A;  5HS9 A;  2MD5 A;  1POG A;  2DFE A;  1JGS A;  4A3I G;  4JYK A;  3K7A J;  4F55 A;  2R8H A;  1OCC H;  1H89 C;  3HOY J;  1XG1 A;  2WTE A;  3O3K A;  4EBD A;  2MD0 A;  3C3W A;  2DQR A;  4MEX F;  2VA2 A;  1XMX A;  4UCV A;  2IGM A;  4Q0Y A;  3FKI A;  1U0J A;  3U1K A;  2W9B B;  1VF9 A;  5E8I A;  5KNL A;  2EIN H;  1MMS A;  4LF6 H;  2Y9Y A;  1XDN A;  1MZB A;  4DL3 A;  1TWH J;  1Y39 A;  1GDT A;  3A01 B;  4D0P A;  3JRE A;  2CKZ B;  1IDY A;  2J5P A;  1N48 A;  3HRM A;  1VFC A;  1W5T A;  2YZG A;  2DMN A;  1XGO A;  4ZDP A;  1KYW A;  2UUC H;  2K9N A;  3V42 A;  2OA4 A;  3HB9 A;  3HOV J;  1R1T A;  3ISP A;  5E17 F;  1SEU A;  1JKJ B;  2A5Y B;  2KT0 A;  1HF0 A;  4JI7 H;  2JRT A;  1MNE A;  4CKB A;  5KT2 A;  4LF7 H;  1XGM A;  2BEO A;  4EM0 B;  1TWF A;  3OV8 A;  4E6N A;  4YEL A;  2RC4 A;  3MJF A;  2HS5 A;  1TQP A;  3GID A;  2XDV A;  5J4Y A;  4KMF A;  1B9N A;  3AG1 H;  3T9A A;  2C2R A;  2FPI B;  3LMM A;  4BQQ A;  1Z21 A;  5FRN A;  2I8C A;  4O7L A;  2VQL A;  4Y17 A;  2CV1 A;  4O82 A;  1MND A;  1VQM I;  3V4S A;  1O3T A;  1JKO C;  3ZPL A;  1B59 A;  4Q8F A;  3K4N A;  3L2V A;  4EJT A;  4HOB A;  1K1S A;  3HBL A;  5D4R A;  1FOK A;  1QHH D;  2DAO A;  4X62 H;  1N32 H;  4TV9 F;  2L7Z A;  2JTV A;  1RK6 A;  2M8G X;  1K6O A;  3CLQ A;  4UXN A;  1UJ8 A;  2ZO4 A;  2XCA A;  2KQR A;  4NZN A;  5ICF A;  3EYY A;  1RRJ A;  1JTY A;  3G73 A;  4N4N B;  3DPT A;  1YX3 A;  5FRO A;  3WTU C;  1JHF A;  4HLY A;  4TVI A;  4UFZ A;  3AAF A;  4FHT A;  1WCM A;  1R1V A;  4QWB A;  5DUI A;  1FP2 A;  3C1D A;  3I3L A;  3TOA A;  4DQ2 A;  1KYZ A;  2A07 F;  3P5J A;  5KG6 A;  3D1N I;  3VOT A;  3CC7 I;  9ANT A;  1OYY A;  2GQQ A;  2HI3 A;  3BP8 A;  4ZHQ F;  3HOX G;  2E34 A;  3VWB A;  4LIV A;  2ZXW H;  5JHU A;  3CDH A;  2HXO A;  4JP0 A;  3M7G A;  3QAH A;  5DCM B;  4DBQ A;  1K83 J;  5CA1 F;  4IEJ A;  1JJ6 C;  1Y0N A;  1D1A A;  2JUC A;  4HX7 A;  3JRA A;  1Z2O X;  3FBI B;  4RGR A;  3J80 K;  2QK4 A;  2HZD A;  2VXZ A;  2KPM A;  1IV6 A;  1QBJ A;  1UC8 A;  3G3Z A;  2ZXH A;  4K0K H;  3JR9 A;  3NUA A;  1P16 A;  3U1D A;  5D1O B;  3GCM A;  3OL4 A;  1U2W A;  4QWE A;  2DWC A;  2VE8 A;  4CCN A;  3BT9 A;  4A6E A;  4BHC A;  5DS9 A;  2DA3 A;  4BL0 B;  3PSF A;  4DYR A;  3H0G A;  2NNN A;  4YP3 A;  4L5J A;  5CB4 F;  4GLX A;  4NB5 A;  1V5F A;  1XCV A;  3NGD A;  3HPG A;  4E4T A;  4Q4D A;  2W6N A;  5EG0 A;  2W9C A;  4J9S A;  3WHC A;  4YG2 F;  3MR3 A;  4YAJ B;  3GLX A;  1IXR C;  4NQW B;  1FOX A;  1JXL A;  5EGO B;  4TV7 A;  2E2J J;  3WTT C;  1ZR4 A;  1R00 A;  1ZGJ A;  2FSW A;  2XRO A;  1QZZ A;  4A3C J;  5L1L A;  3GTP A;  5HLG A;  5EWG A;  3E5U A;  2W8L A;  4DL5 A;  2M4K A;  2ISZ A;  1T33 A;  2HJW A;  2X1E A;  2LBF B;  3LML A;  3S93 A;  2UVU A;  2COG A;  2DYR H;  3JTH A;  4PZ7 A;  3KX2 A;  3N43 B;  4X66 H;  2YZL A;  3OYG A;  5DQI A;  2AS5 F;  5J8F A;  4BY1 G;  1E0E A;  4ED2 A;  3V4Z A;  2KP6 A;  4HYK A;  4GFB A;  4C5A A;  4KN7 X;  2KJC A;  4BKX A;  3R4K A;  5LD2 C;  4MHG A;  1CKM A;  3PFF A;  1M0T A;  4DYQ A;  3I55 I;  1IRX A;  1S9H A;  2WC2 A;  4L18 B;  2ZNY A;  4FT8 A;  1MMA A;  3O8H A;  1IBK H;  2JA7 J;  2HDK A;  2ETH A;  1TW3 A;  1OLT A;  2BQR A;  1U6G A;  3CUO A;  2IMW P;  1F1Z A;  1KJJ A;  2ZFW A;  3IKT A;  1HW1 A;  2VI6 A;  2HQ5 A;  4H0E A;  2IGK A;  3K6G A;  1DU0 A;  3V7S A;  3LUL A;  4MA0 A;  4Q43 A;  5KFQ A;  2WB1 N;  4XNF A;  5H20 A;  4A5N A;  5LGT A;  4LB5 A;  3OUU A;  1MH4 A;  5FKN A;  2BQ3 A;  4MAM A;  2GA1 A;  4F4W A;  2F2E A;  2DW4 A;  2DPU A;  4HEA 2;  5TIS C;  2PLY A;  2FLN A;  1BR2 A;  2EFW A;  3ONQ A;  1ZQ3 P;  3S1R J;  3SNO A;  2HGW A;  2EZK A;  2MCT A;  2K02 A;  2R5Z A;  1ZLK A;  1UG0 A;  2M2E A;  1TAE A;  3PO2 J;  1MJ9 A;  5GP9 A;  3G6V A;  1XPX A;  5AIP A;  4NC8 A;  1JDB B;  1EKF A;  3RB4 A;  4FE4 A;  3HKZ N;  2GIZ A;  1OBD A;  1D0Z A;  1X19 A;  2CQN A;  4M9S A;  2Q8K A;  2R7S A;  4FFL A;  1ULY A;  3C0F B;  1JGG A;  1DGS A;  3LP8 A;  4PDB A;  3QYF A;  4UCU A;  2OWO A;  1D8K A;  5KFX A;  2X6W A;  2KHM A;  3O8G A;  3CJQ B;  2VBY A;  5HNH A;  2YU9 A;  3KIO A;  1G8X A;  1N25 A;  1UEL B;  2P4W A;  3IHU A;  3DV8 A;  4G12 A;  5EZY F;  4O3P A;  3PNY A;  4FIS A;  4MFE A;  1SVM A;  4RDU A;  4OIR F;  2F4V H;  4PJ0 C;  1MD0 A;  3ASN H;  5KG5 A;  2QCO A;  4I4T F;  3RKY A;  3WWI A;  3WU1 B;  3OYM A;  3AX6 A;  1WQ2 A;  1K79 A;  4IIJ F;  3LSP A;  2W6O A;  4TQS A;  2CS3 A;  1S29 A;  1X2M A;  5IP7 G;  5FKL A;  5I5S A;  3MN2 A;  2K85 A;  2LF8 A;  3R60 A;  3MQ0 A;  4FGR A;  4XKW A;  4HW0 A;  5DM7 F;  5CYV A;  2QQ8 A;  4O84 A;  2ZC2 A;  4IZO A;  3PNT A;  3ZQI A;  3J7Y J;  4DBR A;  4O2A F;  2ATL A;  2OTL I;  1RR7 A;  4CKE A;  1X3U A;  5L3C A;  3BCB A;  4XRF A;  3VFZ A;  1J5E H;  2NUA B;  1CF7 B;  1IXS B;  2WAD A;  2E1O A;  3OOP A;  4L9T A;  4U0W A;  3J7A Y;  5LGU A;  2PX9 A;  1R23 A;  5C8Y F;  1MDM B;  1G3W A;  2PN1 A;  3I71 A;  3QWU A;  4A3E J;  4O4H F;  4NXN H;  2ASJ A;  2XAU A;  2ESN A;  3UFX B;  3BPV A;  3K4M A;  3DEE A;  2PMZ A;  3Q2O A;  2DCE A;  4NLG A;  2YPR A;  2XF7 A;  4D9J A;  3U2R A;  2L02 A;  5KFB A;  3TOB A;  4DW6 A;  3DP7 A;  1HW5 A;  1WKM A;  3EUH C;  2Y2Z A;  4A3G G;  1WJE A;  4I50 F;  2JEI A;  1V5E A;  2PFB A;  3ERE D;  2Z5U A;  3IH4 A;  2YCH A;  4ECY A;  2BQU A;  1OFC X;  1TW2 A;  1YE9 A;  3CCQ I;  2JA5 G;  1G3S A;  3GIP A;  1MGT A;  2F5V A;  2IS1 A;  1B9M A;  5B5E C;  4UUT A;  1ZHQ A;  4QPO A;  4FX4 A;  2JEG A;  3QQM A;  5F0H A;  3L2W A;  4TQR A;  4ZTJ A;  5J1U A;  1Y1W G;  3GTG A;  3DLA A;  2PBI A;  4RNM A;  3DEW A;  4Y8V B;  1Y1V J;  2RAE A;  5LA6 F;  4U7B A;  4A3K G;  5ICG A;  4AYB A;  4UV9 A;  5L3E A;  2R8K A;  1R5G A;  2R6F A;  2F4M B;  4CCK A;  1HSJ A;  5DCF A;  3Q8S B;  2AHQ A;  3GWZ A;  4O81 A;  3LST A;  5H6R A;  1S0M A;  3UR3 C;  1DAA A;  3HRU A;  3BTL A;  4DNC A;  2YL2 A;  4LSA A;  5L1K A;  2VQD A;  3ZQG A;  2FU4 A;  4DAA A;  4OMY A;  4HBL A;  1ZAU A;  2MC3 A;  1U9O A;  3FXM A;  1Q1V A;  3LQQ A;  3GTQ A;  2LG4 A;  1S0O A;  3PW5 A;  2Y9Z A;  2FPG B;  1FNN A;  5D8L B;  1D1B A;  2LTP A;  3F0C A;  3QOE A;  2NOG A;  4PJL A;  5KT4 A;  1KON A;  2HOA A;  2IVM A;  3I4M G;  1JJ8 C;  3P9I A;  5L1I A;  4E7H A;  1JT0 A;  3S1N J;  2XUB A;  4UNO A;  3FIW A;  4XON A;  3GTJ J;  1XSV A;  4XKC A;  3ZMU A;  2B63 G;  2R93 G;  1S7O A;  4P5O A;  1IV8 A;  2KDO A;  3DAA A;  1W5S A;  5FLM J;  1X3Z B;  3T9F A;  5KG2 A;  5D8D A;  3CCE I;  3LA2 A;  3AFH A;  3W6J B;  1I6H J;  2HNH A;  2EBI A;  2P6T A;  2HDW A;  3IRQ A;  2JA8 J;  1YO5 C;  3U55 A;  3JRI A;  2V59 A;  3N6X A;  3FF5 A;  4FU0 A;  5ILV A;  3MR5 A;  3CLO A;  5GAG J;  4XYL B;  3OR1 C;  3FXO A;  1G59 A;  3I4N G;  2EPF A;  2PJP A;  4A3L G;  3LNQ A;  2M34 A;  4AUX A;  4Y13 A;  3JAM W;  4TUY F;  4RAZ A;  2D45 A;  1IO2 A;  1BN5 A;  4DOZ A;  2MYS A;  3E1S A;  3M9O B;  1ZGA A;  4ME6 A;  5LP6 F;  1KC7 A;  1T0F C;  2GPW A;  3BAC A;  2L7M P;  3OYE A;  1TP4 A;  3ZQH A;  2YZM A;  4LFC H;  4GRI A;  4ZC3 A;  2CV0 A;  2K9L A;  1NG6 A;  5DDG A;  2YZN A;  3JCU C;  1VBG A;  3T8R A;  1T6S A;  3JRF A;  2HQN A;  4XLE A;  5KG1 A;  4X65 H;  2E2H J;  1R1U A;  2BW3 B;  2O5R A;  1KJQ A;  2Q2T A;  5IT9 W;  5FKM A;  2PMZ E;  2G0E A;  1SMT A;  3CES A;  4M72 A;  4CYC A;  2OZ6 A;  3HRS A;  1KU3 A;  3S15 J;  1EJ9 A;  4F4Z A;  1MBJ A;  5IY5 H;  4KT6 A;  2HIV A;  2FF4 A;  4M3F A;  4RLQ A;  4P55 A;  1RNL A;  4E7Z A;  4PGG A;  3K3P A;  2M7B A;  1WI9 A;  2I8D A;  3OL3 A;  4Y7N J;  1PYV A;  3F9K A;  2PMU A;  2FX0 A;  3RYR A;  3KZZ A;  4ENK A;  2AQE A;  3SFZ A;  2Z33 A;  3W6V A;  4L0Z B;  3B6C A;  4LFA H;  2NVY J;  5D5W B;  3D5S C;  3P9C A;  5EEH A;  2NVX J;  1H9T A;  4PSX A;  1FVI A;  2GA2 A;  2WYO A;  2C22 A;  1W36 C;  3IV5 A;  4A3F J;  2W6P A;  3KAL A;  1GSH A;  4LK1 F;  3T5X A;  3CC2 I;  4DQN A;  4DIQ A;  1HW2 A;  3ZOB A;  4AYB E;  3H40 A;  4O2B F;  1REP C;  2M05 A;  1GV5 A;  4CKC A;  2Q2U A;  1A5J A;  2VON A;  1IG7 A;  2R8J A;  1MSF C;  3JAM Z;  1FSH A;  2VOB A;  3VYR B;  4L9V A;  3DKY A;  1U3E M;  4KIC A;  1JUM A;  2DPD A;  1VTN C;  1Y8R B;  1ZTR A;  1LJ9 A;  3FKI G;  1S6L A;  3FWE A;  1WR2 A;  2OBP A;  1TWG A;  1T8I A;  3W1B A;  1MMD A;  5DLF A;  1MH3 A;  1OYW A;  2Z3Y A;  4NC7 A;  2BOL A;  3T9D A;  3I64 A;  4M3E A;  5C44 G;  4JQF A;  1JXS A;  1LB2 A;  1D3Y A;  1E4E B;  1HC8 A;  4CZZ A;  3E6D A;  2C6Y A;  3H3U A;  5CVR A;  4Z2Y A;  5IT9 Z;  1GXQ A;  4DV1 H;  4E7S A;  1WHU A;  1XMK A;  2C2E A;  1YYV A;  5BPF A;  1DPU A;  2JK3 A;  4U0V A;  1KT8 A;  3T5K A;  4B3X A;  3S3O A;  4JV5 H;  5TRD A;  1U8R A;  2LLK A;  2BY3 A;  5BPD A;  1V9P A;  1VQL I;  2R92 A;  3Q9S A;  3RBD A;  2XRL A;  4LG0 A;  1B72 B;  2UXB H;  4NBQ A;  2OCC H;  4EYI B;  1DQU A;  1RK5 A;  4NNJ A;  2PG4 A;  3CUQ B;  1ZHS A;  3B02 A;  1TNT A;  5EF6 A;  1OBG A;  3VEP A;  2R7V A;  3RPQ A;  3JRW A;  4IAJ A;  1UHW A;  3H4D A;  2M45 A;  1FOY A;  4BQA A;  5E20 A;  3HSE A;  2W85 A;  5JLX A;  2HYF A;  4ECX A;  2KSW A;  3LSK A;  3V4G A;  1TWC J;  3OYD A;  2K4J A;  2RNG A;  4MV3 A;  3QPL A;  3FHZ A;  1ZRC A;  4WBN F;  3RGX A;  1NK2 P;  4IWX A;  2HKO A;  5FNV F;  3TGN A;  5FR9 A;  2N8G A;  2QYO A;  5JQW A;  2W70 A;  3H0G G;  1Z7L A;  1WCM G;  4YHH H;  1ZEL A;  4RAY A;  5CQG A;  3HGG A;  3LAJ A;  1MBH A;  2DA5 A;  1CQT A;  1CQJ B;  1RUO A;  2WB1 A;  2E35 A;  2HQR A;  4C30 A;  3KZY A;  2L4A A;  3FZV A;  3QU6 A;  4CCM A;  2LF7 A;  1KJ9 A;  3BR5 A;  3ETJ A;  4QIW N;  3RB3 A;  2QVO A;  4PUS A;  3HOZ G;  2RDI A;  2W9B A;  3PW4 A;  4YII A;  2IRF G;  4ECW A;  1C3O A;  3F8N A;  3BJA A;  3V7C A;  1HQC A;  2UUB H;  4B43 A;  2W4S A;  2UVV A;  2VL8 A;  3L2P A;  1IUF A;  2G9W A;  2KFD A;  1QZY A;  3A01 A;  3H3Z A;  2UVW A;  1R6R A;  1YW7 A;  5K5R A;  1BC8 C;  4G8X A;  2MAB A;  3CUQ C;  4IF4 A;  2UXN A;  4KIT B;  2OH2 A;  3BRO A;  5LMU H;  3HKZ A;  1GLN A;  1I39 A;  3N8D A;  4M6X A;  3WG7 H;  2O3F A;  4O7Y A;  4CZC A;  1N36 H;  2VQH A;  1GVJ A;  3FIS A;  4EYH B;  4ZYA A;  5JHF A;  1LFP A;  5E3L A;  2FD5 A;  2JSC A;  4DYC A;  4EEQ A;  4GDF A;  5I5W A;  1J7K A;  4ZDO A;  2R0Q C;  3RAX A;  1XDS A;  4JXU A;  3HM5 A;  2VJI A;  3JAM K;  1Y1W A;  3RKX A;  3PW0 A;  3M1C A;  1R58 A;  4E70 A;  2CNV A;  2E1M B;  1X9N A;  4I0A A;  4KJZ A;  5KCM A;  1X1P A;  1JUS A;  2EJR A;  3LQS A;  4ED3 A;  2I87 A;  5JQG F;  3OR2 C;  4EFE A;  1R71 A;  5CKT A;  2KRF A;  2BVL A;  1A0G A;  2LSO A;  3GZ5 A;  5BMV F;  1OMI A;  5BYB A;  2VQG A;  4OIN F;  5ICE A;  2ZJP F;  4RLF A;  2DFI A;  5IT9 K;  1Y56 A;  3G8D A;  3BAB A;  3SQN A;  4KA4 A;  3CCY A;  3M8E A;  5KFC A;  4QW8 A;  2NRA C;  3C2G A;  1BR4 A;  1HKT A;  1V55 H;  4HR7 A;  2QZ8 A;  4ZI7 F;  4XBF A;  2COJ A;  2X6Y A;  2VUG A;  1MBG A;  1X2N A;  3HGY A;  3ZQQ A;  4E6K G;  2GXB A;  3VYS B;  2ZDQ A;  1I2L A;  4UVA A;  3KYD B;  1CS0 A;  2YW2 A;  3WNZ A;  1ZQ7 A;  4FCY A;  4Q45 A;  3TQT A;  4A3D G;  4O6J A;  4BJ5 C;  1JI8 A;  1SMY F;  3I58 A;  2LMD A;  3ORQ A;  2B63 A;  4GC7 A;  2FBH A;  1TWH A;  4PGH A;  5LMN H;  1A35 A;  4A2A A;  1F9N A;  2FPP B;  1IN8 A;  4C5B A;  3EET A;  1V3F A;  2ADU A;  4WXH A;  5DCM A;  4ZJZ A;  5KFW A;  4PZ6 A;  2PMZ N;  4XX0 B;  2WE6 A;  3N4M A;  4ED0 A;  2BYV E;  3HTS B;  3CMM A;  3U54 A;  5BOX A;  1T38 A;  2E36 A;  2V9K A;  3BTI A;  1XNQ H;  2J9G A;  4JI1 H;  2X9D A;  1KU7 A;  2FXA A;  2WV1 A;  5D1O A;  3BA9 A;  4I09 A;  2E1M C;  3WE3 A;  4BNC A;  1P4A A;  2M30 A;  3M8F A;  3IL2 A;  1Z3X A;  3JRH A;  1IW7 F;  2HVQ A;  1W0U A;  5DGH A;  4LSX A;  2AQ4 A;  3W1G A;  2VT3 A;  1MW7 A;  3VPR A;  1PVE A;  4IX7 A;  3M4I A;  3R5X A;  1OJL A;  2VOO A;  3RUP A;  3PM1 A;  5CVU A;  4NQW A;  1UG2 A;  5FLX Z;  4ESB A;  5EGO A;  4Q4Z F;  4RZQ A;  1P2F A;  3KCC A;  4LH6 A;  4EGQ A;  4CCL A;  2WB1 E;  4JX6 A;  3MKZ A;  5KFG A;  1B04 A;  2HR3 A;  3TMO A;  5H80 A;  4G7O F;  4RB0 A;  1Y6I A;  1YIJ I;  5C4X J;  4JX4 A;  5KAF C;  1Z3Y A;  5ERI A;  4BJ6 C;  4D7N A;  1LE8 B;  3GTO J;  3T9B A;  1P4W A;  3W2W A;  3U9T A;  2E71 A;  2OCE A;  3L09 A;  1D8J A;  2LBF A;  1IRZ A;  2R8G A;  1Z6T A;  2M9H A;  2Y4R A;  3GIK A;  2DOD A;  2ZSI B;  3WU0 A;  3ZN1 A;  4CXF A;  3K10 A;  1R9T J;  2HZT A;  1BC7 C;  2RQQ A;  2V9P A;  3A2K A;  1ZG1 A;  1IRG A;  1KEE A;  3A4C A;  3KLO A;  2UU9 H;  1RES A;  4PFP A;  4HDV A;  3CJT B;  3WTV C;  4HV6 A;  1XSX A;  1KUT A;  2VUM J;  2BV6 A;  3D0S A;  4XLH A;  2ZGI A;  2HU9 A;  2XC9 A;  5CR5 A;  2BHZ A;  1E17 A;  3NWT A;  5HOO A;  4BXX J;  5DIS C;  2JA6 J;  1QZE A;  2CG4 A;  2KIU A;  5F64 A;  4I6Z A;  1W1W E;  5H6Q A;  2V79 A;  3RTR A;  1Y8Q B;  3CQZ J;  4U88 A;  2JA5 J;  1X3W B;  3B73 A;  2FMY A;  2ZXI A;  3V8K A;  2F5E A;  4UUS B;  5E3M A;  3NEU A;  1I7L A;  2EWN A;  3DLL F;  5DLG A;  1WH2 A;  2ZBK A;  4R79 A;  2Y48 A;  1APL C;  2QUF A;  2IA1 A;  3MWD A;  3TO6 A;  3T1B A;  2DTZ A;  3LSI A;  4DV2 H;  4EGY A;  5M5X J;  3BWG A;  2DLN A;  4LK0 F;  2LNB A;  3KP5 A;  4J9K A;  2EV5 A;  2IPQ X;  5K7H A;  2DPJ A;  1BI3 A;  4M73 A;  1AOY A;  3L2U A;  1HR0 H;  3BR3 A;  1AN7 A;  1WI3 A;  4EEF G;  1M0W A;  3HYI A;  2OU2 A;  4YIR X;  2XF6 A;  1RPW A;  2L0K A;  2IP2 A;  4MTD A;  2STT A;  2A3S A;  4HNV A;  3OYB A;  1P92 A;  2NU9 B;  5DG8 A;  2M4G A;  1MIJ A;  4ZYD A;  3S24 A;  3IG0 A;  3SGI A;  1JT6 A;  2COI A;  2FMA A;  2VQF H;  4ED1 A;  1O3Q A;  3V6J A;  1L3L A;  5IYD J;  2C28 A;  3EUH A;  3ERM A;  1ACI A;  2PQ8 A;  5C3E G;  1SD7 A;  3FDY A;  2COM A;  4ECR A;  5FD6 A;  2IP4 A;  1BA5 A;  2R7O A;  4IRI A;  4JBA A;  3WGI A;  4ED8 A;  3PNV A;  3K9T A;  1ETX A;  4BHB A;  1T98 A;  2XRN A;  3OY9 A;  5F1R A;  2R93 J;  4EBE A;  3RAQ A;  1W5C C;  2F5D A;  2IA2 A;  3BA8 A;  4XRS A;  4HAM A;  2ME6 A;  4I55 F;  3ABK H;  2DYS H;  3S8P A;  3ORR A;  3TIN A;  5KFV A;  1IN5 A;  4HZF A;  3GTK J;  3T9C A;  4EJO A;  2MBF A;  4P1W A;  1K1Q A;  4YR2 A;  4IOA F;  3M07 A;  5JR3 A;  3A0H C;  4MQ9 F;  1LUJ B;  2NXN B;  5TJJ A;  1ZLJ A;  5EDN A;  5FLX K;  2QBY B;  1R4M B;  4IWY A;  2RVC A;  3QP6 A;  4KIG A;  1O3R A;  1BI0 A;  4LH7 A;  4E7K A;  1FYM A;  3J81 W;  4P9U A;  1I1S A;  2FBK A;  1K78 B;  4DZJ A;  3X2Q H;  3RI4 A;  1CF7 A;  1ZRF A;  3GME A;  2V4Q A;  4EBC A;  5KFN A;  3NBY B;  4HDU A;  3BR0 A;  4W97 A;  1K4S A;  3G6X A;  5KT7 A;  2E1C A;  4IRG A;  1FY7 A;  1MDM A;  1I3Q J;  2NVT J;  2CUF A;  3WGG A;  5CE8 A;  4G6Q A;  2OPT A;  3V8L A;  1FMW A;  1UHS A;  3LFU A;  4AVZ A;  3E6M A;  1M1E B;  5KVR A;  1T3N A;  2L54 A;  4J00 A;  4O3S A;  4DR7 H;  5KS8 A;  1BJA A;  5E1Z B;  4B3S H;  4XOP A;  2CQ7 A;  2Y0M A;  2EJ0 A;  3S2D J;  1TT0 A;  3S2W A;  3H0D A;  2L4M A;  5KFO A;  1GSA A;  3GX4 X;  4OAZ A;  2GAU A;  1VQO I;  4A2B A;  4J9N A;  5GTI C;  3RPU A;  1JX4 A;  2D1H A;  1B6R A;  1P6R A;  1BJZ A;  2FJ1 A;  3KFW X;  1S72 I;  4ED6 A;  1G6N A;  3QP5 A;  4XID A;  1ETY A;  4HST A;  3VSK A;  5CPR B;  2FE3 A;  3WTX C;  2Q1Z B;  3OYL A;  1W96 A;  4FE2 A;  2AGP A;  2OAZ A;  3Q9V A;  2DI3 A;  1Z9C A;  5L3B A;  1NHA A;  2Q0O A;  5DMX A;  1DPR A;  4F52 A;  4ENN A;  1VQP I;  1VQK I;  1RKT A;  2CJJ A;  4G94 A;  4YRV A;  3GIJ A;  2MFZ A;  2EZH A;  4QW9 A;  1KA8 A;  3U0G A;  1NG7 A;  3BG3 A;  3OIP A;  1MJB A;  3J7A O;  2D2W A;  2P81 A;  1HNZ H;  3RBE A;  4HF2 A;  4LD5 A;  2FQ4 A;  5FPO A;  5I5T A;  2GIV A;  4CIC A;  3PVX A;  1J59 A;  1FBU A;  5E25 A;  4M6V A;  4XSX F;  1T0F A;  4BBR J;  4M9X A;  5E1X A;  4XKV A;  4HLX A;  1ZET A;  3RJP A;  3J81 Z;  4YFN F;  3TL4 X;  2A69 F;  5D4S A;  1G2W A;  5KFM A;  1FX7 A;  3K3V A;  3BLY A;  3IWF A;  2L01 A;  2XF5 A;  3TW6 A;  2FK3 A;  2R87 A;  2PBZ A;  4YAK B;  1RYR A;  2L5Q A;  1BIB A;  1LDJ A;  2ID3 A;  4D5C A;  5C44 J;  4ZOL F;  2XSJ C;  5C1P A;  3HOW G;  4QSH A;  2OZU A;  4J9Q A;  5IOZ A;  3MEX A;  4CGZ A;  2RKH A;  1TA8 A;  5LOV F;  4KIB A;  4ECV A;  1GHC A;  1MBF A;  2EK5 A;  4RUC A;  2K9S A;  3QPS A;  2W00 A;  5EEG A;  2WY7 Q;  3Q8Q B;  2R7Z A;  4RMN A;  4RAG A;  1GSO A;  3E7L A;  4JV2 A;  4IHV A;  4O7V A;  4N0B A;  2M7A A;  2RNJ A;  2VC1 A;  2K9M A;  2ZB9 A;  3ASO H;  5F1J A;  3CCU I;  1A0I A;  4QIW A;  4A3J J;  2O8X A;  1UZC A;  5HLH A;  2WDT A;  1WZ2 A;  1WVR A;  4RCN A;  2KIF A;  5IYB G;  1S97 A;  3T5H A;  2HYG D;  3EUK L;  5B1B H;  1QHG A;  4RU9 A;  1JKP C;  5D8K B;  1B6S A;  2ICW G;  1Y1V A;  5M3F J;  1B1B A;  3RKW A;  2GZW A;  3MR2 A;  1EA3 A;  5HBR B;  2ELK A;  5HNE A;  3BPX A;  2JEF A;  4O7W A;  2QQ9 A;  1BXR A;  3TY9 A;  2VPS A;  2JQ7 A;  4CC6 A;  4L9N A;  2GXG A;  4O7Z A;  4PSW A;  5D6E A;  3F8B A;  4R1H A;  2X85 A;  5LHI A;  3KET A;  4DRF A;  2IXS A;  4XN3 A;  3OS2 A;  4OIP F;  2R92 G;  2BW3 A;  1DP3 A;  1ZRE A;  3WTZ A;  1WRJ A;  2CSO A;  3AG4 H;  5M3M J;  1I3A A;  4RA2 A;  2MLK A;  4UB8 C;  4S04 A;  4ECZ A;  3OSP A;  3UZB A;  3TY8 A;  4IZZ A;  2W7P A;  1U78 A;  3F6V A;  1D5Y A;  4IQJ A;  2CWE A;  1JE8 A;  2RGR A;  4Y15 A;  4JI2 H;  1YJ9 I;  2X0L A;  2PMH A;  3ZQF A;  2CUZ A;  4PZ8 A;  1RZ4 A;  3PQK A;  4K6N A;  2RDJ A;  3HOZ J;  2JA2 A;  1SAN A;  2LRD A;  3GTJ A;  4A93 G;  1NK3 P;  4HF1 A;  1SFO A;  3ZMZ A;  1ZAO A;  1ON1 A;  2R7L A;  3ROU A;  2GOM A;  1TZL A;  3OSG A;  1YIT I;  3H5R A;  4C2M A;  1HNW H;  1KQ9 A;  3CMY A;  3RZD J;  2Z1D A;  3REO A;  1QU3 A;  4GYI A;  2AGO A;  4IHY A;  2PEX A;  1HLV A;  2WAQ N;  3FMR A;  3BDD A;  1J2X A;  3JW4 A;  2W6Q A;  1BJT A;  1VND A;  2BBY A;  4YIF A;  2Z02 A;  3OYI A;  5J8C A;  3G1M A;  4FM9 A;  2JJ7 A;  2NOJ B;  3CC4 I;  4AVP A;  1BW5 A;  2OUM A;  3HHH A;  3VPC A;  4MLO A;  4APM A;  1F43 A;  4C3I J;  2Q7D A;  5B3S H;  4MNU A;  5LRS A;  2OLS A;  1E2X A;  3UZO A;  3J81 K;  3L7W A;  4BXF A;  1WJ5 A;  3LA3 A;  1JDE A;  1G3T A;  3TP0 A;  5D5U B;  1EH7 A;  4BEH B;  4BY7 G;  5L3F A;  2WWY A;  3GTP J;  4LIU A;  2LVS A;  4UVC A;  3CCS I;  2VXD A;  2CFO A;  5GTH C;  3R5F A;  4RB3 C;  1AKH B;  3QPT A;  4JV0 A;  5GPA A;  4HYE A;  3HOT A;  4YR0 A;  3CME I;  3CJR B;  3T8T A;  1IN4 A;  4B8X A;  2OD5 A;  4CE5 A;  3OIO A;  4DV6 H;  1E4E A;  3NQO A;  1G4D A;  3LSJ A;  3FXJ A;  2E2H A;  1P9Q C;  4NZM A;  3W6K B;  4B48 A;  4RBO A;  2GBY A;  4FET A;  2DTR A;  4J19 A;  2GQR A;  3VOD A;  3LSH A;  3RPU D;  1SAX A;  2QM3 A;  3HZJ A;  3G71 I;  1N77 A;  4RGX A;  2KZV A;  2VBW A;  3W3C A;  5K7F A;  2E2I J;  4IHJ F;  1FIP A;  2F6C A;  5KG0 A;  4LF5 H;  3IAS 2;  5BPI A;  2HIX A;  5D6F A;  3DF7 A;  1VAJ A;  1WSC A;  1VS0 A;  1B72 A;  1ITY A;  3E3V A;  2XGQ A;  5ILS A;  3PR4 A;  5IYC G;  3OSF A;  5KFT A;  1IGN A;  3L2Q A;  4A3D J;  3D5R C;  4QIW E;  2V1X A;  5LXT F;  4B3M H;  3L2C A;  3A02 A;  3CUQ A;  1PUF B;  4UCT A;  3G6Y A;  4EEY A;  3EYI A;  5BWU A;  5DEQ A;  4IQ4 A;  4M3D A;  2HGC A;  2LOO A;  5CVV A;  4BE1 A;  1L2Z A;  2NVX A;  4GYG A;  1STZ A;  2QF7 A;  1PP7 U;  5DGB A;  4UUG A;  2R7D A;  2ZJ2 A;  1P4X A;  1IZ1 A;  2M87 A;  3GFI A;  1ZH5 A;  3TDZ C;  2YRW A;  5H2F C;  3KAJ A;  2XD4 A;  4EJW A;  1TLH B;  1ETW A;  1ETQ A;  2XKO A;  2Y69 H;  4FFN A;  4DIM A;  3IH3 A;  5DQH A;  3DU5 A;  3V6H A;  1HNX H;  5KFE A;  3MD2 A;  2V7F A;  4ZYE A;  5EWE A;  3C18 A;  3S1Q J;  5IOY A;  5FD5 A;  3AKZ A;  1QNT A;  3DBH B;  3K4B A;  2C35 B;  2JN6 A;  1ETV A;  3RDI A;  5D1P A;  2Z16 A;  4Q44 A;  2QWW A;  2TCT A;  3BG5 A;  3PJR A;  1N75 A;  3FKJ A;  1Z7U A;  1T39 A;  3RB6 A;  3DF8 A;  2A6H F;  3DWL E;  2R82 A;  2Z04 A;  3AG2 H;  4J9M A;  2R85 A;  2F4I A;  5T14 A;  1J5Y A;  5BWR A;  4BQN A;  3RB0 A;  3JRX A;  2YU9 J;  2XVC A;  2XGC A;  2UXD H;  4UB6 C;  4JI8 H;  4R7R A;  1QQI A;  2E19 A;  3HOV G;  1WPK A;  3L4K A;  1QPI A;  4L1K A;  3T5J A;  4R8U B;  4N4O B;  3CDL A;  3CSW A;  2DMQ A;  2P0A A;  2VJ5 A;  3HOU J;  1XDU A;  2RV8 A;  3K69 A;  3AW8 A;  5DQG A;  3IC7 A;  1W36 D;  2HPM A;  1XNR H;  3SEZ A;  5JI6 A;  4B1R A;  1BOB A;  4ECU A;  3IH2 A;  1FWZ A;  4BDZ A;  5M5W J;  3SJM A;  1UCR A;  4Y3O A;  1O7L A;  4BE0 A;  1YLF A;  1IYD A;  1I50 J;  1Z05 A;  3LAP A;  3S17 J;  4F3Q A;  4UCR A;  2WA0 A;  3HHG A;  4H4K C;  2CFX A;  2HWV A;  4X6A J;  2X0S A;  3RIR A;  1ERD A;  3K4C A;  2XB0 X;  1GXP A;  3CCJ I;  2HDC A;  3J7A K;  2J5O A;  2MG4 A;  2ZM6 H;  1TWC A;  2Y31 A;  1VQ6 I;  4O3N A;  4I7H A;  2OC6 A;  4N9H A;  1KZH A;  2RQP A;  2EFP A;  3VNN A;  1A04 A;  1HST A;  4CMF A;  3L9F A;  1DV2 A;  2HXI A;  2XPV A;  2NYX A;  2DQL A;  4ZYG A;  4IHT A;  5CVJ A;  4A3I J;  2ZNZ A;  4HN2 A;  5KFJ A;  2A6E F;  2I10 A;  1FTT A;  5IT3 A;  3K1P A;  3HOS A;  3BOQ A;  2UXC H;  2KL4 A;  3B6A A;  4O7T A;  5L1J A;  1JKR C;  3BG9 A;  4KT5 C;  4DR1 H;  3K2A A;  1XMA A;  3PUF A;  2AU0 A;  3SZT A;  3OHB A;  5BNG A;  3SZP A;  2P5V A;  5CM0 A;  3WU2 C;  4IVN A;  1F4K A;  2QEN A;  4XMY A;  1Z1D A;  4XLF A;  2WAE A;  1NTC A;  4PZJ A;  3I4P A;  3KEY A;  3GVA A;  3BR6 A;  1SYX B;  3KYL A;  4MV4 A;  4O7N A;  1UMQ A;  4LB6 B;  2PJR B;  3SFI A;  5EYR A;  3SXY A;  1HDD C;  3NRV A;  5KX5 F;  1EH6 A;  2JZY A;  5B66 C;  5C3E J;  4UVB A;  4MV6 A;  3RGZ A;  3GTG J;  3DQV C;  1S5L C;  1AU7 A;  1VQ4 I;  3MAJ A;  4DV7 H;  2W1O A;  2EH3 A;  1ULZ A;  2A5W A;  3I54 A;  4IXA A;  3OYK A;  1I94 H;  2GM4 A;  5BWV A;  4M6Y A;  4IOC F;  2X6O A;  5F27 A;  1FBS A;  3FXL A;  1S10 A;  2R4G A;  4AID A;  1TNS A;  3E0J B;  3EQL F;  2BXZ A;  3BQZ A;  4M7E A;  2ELH A;  4ITV A;  4Y52 J;  1PJR A;  4DR2 H;  5JVG F;  3N97 A;  3H3V H;  2NNY A;  2P7C B;  3HL2 A;  4EGZ A;  3R23 A;  4X1E A;  3DXJ F;  3GTQ J;  2FNA A;  3P9K A;  4J9P A;  3OSN A;  3S2H J;  2R7N A;  3T5L A;  3LQR A;  1XMQ H;  2COB A;  1WGX A;  4HX4 A;  3K5H A;  5KT3 A;  4JI5 H;  2CFM A;  4LF9 H;  2TDX A;  2DDB A;  1LE8 A;  1Y0U A;  3H5N A;  4M9Z A;  3EPI A;  4KNY A;  5I5U A;  4R8H A;  1OCT C;  5A2Q W;  1OCP A;  5LHH A;  4WXC A;  4ZH4 F;  1ZK8 A;  1VQ5 I;  1JUP A;  4G9Y A;  1A6I A;  2VKV A;  4O4L F;  1BR1 A;  2FK1 A;  4EV0 A;  4XRS G;  3HOX J;  4O4I F;  3K70 C;  5BR8 H;  2VBX A;  2H1L A;  4UHT A;  5J2T F;  2YR2 A;  1X1B A;  2K4B A;  1WFX A;  3H20 A;  1GUU A;  1S0N A;  3QPH A;  5J1Y A;  1XK5 A;  5KFZ A;  4GGG A;  1EZ1 A;  3WO0 A;  3N40 P;  1Z2P X;  3GTL A;  2DJI A;  3F8C A;  1DP7 P;  2FLL A;  5EDW A;  3S3M A;  1JKQ C;  2KJB A;  1YW9 A;  1VQ8 I;  2HTJ A;  2NS7 A;  4QPQ A;  1T56 A;  3HC7 A;  1VI0 A;  3JRD A;  2FBI A;  3MKW B;  4UUS A;  4BHP A;  2DT6 A;  3ZMT A;  2ZJR F;  5E1W A;  2XAQ A;  5FRM A;  1FBQ A;  2WTF A;  3U21 A;  4XKB A;  4NYE A;  2HHF B;  4HF0 A;  1SCU B;  4DR5 H;  4JOM A;  3PO3 G;  1RI7 A;  1YX5 A;  5KFF A;  4G7Z F;  3GV7 B;  1EKP A;  2OTJ I;  2LR8 A;  5I5X A;  4E7J A;  4D1Q A;  1NH3 A;  1H8A C;  3CMA I;  2JUG A;  4N9I A;  2BY2 A;  2Z9O A;  1FOW A;  2K7L A;  2R7Q A;  3ZQ7 A;  4KIF A;  5KT5 A;  3TO7 A;  2VA3 A;  4CO8 A;  3D5L A;  1GT0 C;  3PFI A;  5KFS A;  1DGR M;  2BHY A;  2XGD A;  1S7E A;  1KU2 A;  4LLL A;  5E3O A;  3GB8 B;  1RJP A;  4RAF A;  5KFU A;  4BY1 J;  1E4G T;  4GKK H;  3H4B A;  3R61 A;  2SCU B;  3K4J A;  2VPL A;  1R4N B;  5HS8 A;  1I1L A;  4IHS A;  2EIY A;  4O3R A;  1WJB A;  2VJJ A;  1OQY A;  2EIM H;  3PL8 A;  1Z91 A;  4I76 A;  5GAD J;  2HYJ A;  1S03 G;  5F04 A;  3PN1 A;  2A05 A;  2Y0S E;  1PUE E;  3SEQ A;  3MZH A;  1I7N A;  2ZDG A;  4OMZ A;  2VUM A;  5K7Z A;  3K1M A;  4FTH A;  4XYM B;  1LVK A;  3DPU A;  5F6F A;  1BM9 A;  5KT6 A;  3E97 A;  2H6C A;  4O7R A;  2JA6 A;  4I0B A;  4Q5S F;  4RM3 A;  4JYA H;  2ZME B;  3W2A A;  2ASL A;  3DTK A;  3GTM A;  3TDU C;  1S7A A;  3DKW A;  1X1A A;  3KYC B;  4YY3 H;  4EQQ A;  4Q48 A;  2YWV A;  2ESH A;  2F48 A;  2NAZ A;  5D5X B;  4BDY A;  2F5F A;  2R7F A;  2FRH A;  3ZXS A;  1IYE A;  1SVO A;  2P8T A;  2R7M A;  1JIH A;  4RS8 A;  4ANJ A;  2NS0 A;  5KHD A;  1S3J A;  2QBY A;  2DOE A;  2MGQ A;  1TWG J;  3BQY A;  1TC3 C;  3PQJ A;  4DL4 A;  4G7H F;  5F0C A;  4EJU A;  1LFB A;  1Z77 A;  2BY0 A;  4XRM A;  2K3P A;  2LKS A;  3ZP5 A;  1K78 A;  2LC2 A;  4FQG A;  2EA4 A;  2WAQ A;  3KP2 A;  3JSO A;  4MV7 A;  5KFI A;  1UHM A;  3H92 A;  2JSP A;  3ZQC A;  1FPQ A;  4A3M G;  1FC3 A;  4J01 A;  1B8I B;  4DV0 H;  2HGS A;  2R7Z G;  1I1M A;  3HEF A;  1Z0X A;  4C3J J;  4ZYH A;  1D0Y A;  1QGP A;  5I47 A;  3I59 B;  4LJZ F;  4XSZ F;  1SEI A;  2R7R A;  3GIQ A;  3ELK A;  2KMU A;  5KK1 A;  5J6X A;  4AM3 A;  3F6O A;  3SI8 A;  2IGN A;  4AIJ A;  3S3N A;  5K1Y A;  2DPI A;  1V54 H;  3Q0W A;  4NDL A;  1IDZ A;  3VYT B;  2R86 A;  1IAW A;  3LSR A;  4UUV A;  3V8J A;  4YEJ A;  2HEO A;  1A9X A;  2ECC A;  2FUG 2;  4HX8 A;  3RKQ A;  5C4J J;  3PFY A;  2YX7 A;  4L9J A;  5IWA H;  2V26 A;  3ZCO A;  1IRF A;  1Y1V G;  5IP7 J;  2G7H A;  2OQR A;  4F91 B;  2XCL A;  1IN7 A;  4BJT A;  4A93 J;  2DN0 A;  3TQN A;  2XV4 S;  3GYH X;  2DA1 A;  1DU6 A;  3V7R A;  2HOS A;  1LFU P;  1KU9 A;  2ZME C;  2ALZ A;  2XIG A;  1CKN B;  2JVH A;  3FMA A;  3CJN A;  3GW2 A;  3IP4 B;  2LRE A;  3MFK A;  4QWA A;  2CQK A;  1LDK B;  4GLW A;  2EB7 A;  3GTK A;  3QFF A;  4B3A A;  2PI0 A;  3G8C A;  2EIK H;  5KG4 A;  2RGV A;  3CCM I;  4NXM H;  3N6R A;  2ZKZ A;  3OYF A;  3M9M B;  1EYZ A;  5BWX A;  2KIS A;  1I5Z A;  3HUG B;  4AD9 A;  1HKS A;  1DUX C;  4LG3 A;  5F9N A;  3QYE A;  3IKV A;  4DV5 H;  3T1H H;  1LDD A;  3RYP A;  2CYY A;  1V51 A;  4Q8E A;  4BY7 J;  4W1U A;  2B7E A;  1BIA A;  3RZO J;  4IO9 F;  2V58 A;  4MGR A;  1I6X A;  1IOW A;  1RUN A;  5JUM A;  1I3Q A;  3QZ8 A;  2FB9 A;  4LFU A;  2EZI A;  4K2E A;  4OWR B;  1MKM A;  3R0J A;  5L3G A;  3F8F A;  1GLV A;  3IAM 2;  5CVI A;  4CSW A;  4KDP A;  4A3G J;  1YRN B;  4FFO A;  2BY1 A;  2K5C A;  1UC9 A;  2ZJT A;  4M3B A;  2P0W A;  3GXO A;  1W7P B;  2HHH H;  3IRR A;  4GKJ H;  1K83 A;  1O75 A;  3KE2 A;  3KP3 A;  3CCL I;  1N56 A;  2JA8 G;  1FSE A;  3UKG A;  3FXQ A;  3I9V 2;  2GPS A;  3WTW C;  3Q8P B;  5BQT A;  4LLG F;  4NC6 A;  1N34 H;  1S68 A;  5HLI A;  2W25 A;  2V6C A;  1B33 N;  1BBY A;  1ZYR F;  2Z99 A;  1Y1W J;  4JI0 H;  2E5L H;  5I60 A;  2OQG A;  5ILU A;  2IS2 A;  1MMG A;  3BTJ A;  3ZN0 A;  3EUA A;  4FS1 A;  5FPR A;  2BVM A;  4LFB H;  4A3K J;  3KTM A;  4KYW A;  2V9W A;  3K0L A;  1AUX A;  2DOF A;  3SHF A;  4DJA A;  1CGP A;  3VPD A;  4Q4C A;  1QA6 A;  1XTA A;  1RJQ A;  2UVR A;  3DPL C;  2ZCW A;  4XLP F;  4EQ5 A;  2KZG A;  1R22 A;  4ESF A;  2CNQ A;  1WJF A;  3RTX A;  2FKL A;  3GIL A;  4P9F A;  2WAQ E;  2V9V A;  3PIP F;  2XPW A;  4DZP A;  5BWW A;  4A3B G;  2X48 A;  1DGW Y;  3PW7 A;  2MH2 A;  3BTC A;  3GZ6 A;  2DXI A;  4CHI A;  4LF8 H;  3E6C C;  2E7X A;  4I01 A;  3AL0 B;  4E7L A;  2H8R A;  3KHL A;  3DTF A;  4IRH A;  2LDU A;  3RCO A;  1CKO A;  1SFU A;  4DL6 A;  4OX9 H;  2VB6 A;  3I4M J;  4AIH A;  1ZRD A;  2YX4 A;  3HO8 A;  2O8K A;  4E7I A;  1U8B A;  4DL7 A;  5CJ9 A;  3KEO A;  3JSP A;  2CZG A;  2QSF X;  4NHJ A;  2W48 A;  2RN7 A;  1ZAR A;  3MZY A;  2B63 J;  2XAJ A;  1SFX A;  3F21 A;  3KP4 A;  3S14 J;  2X5R A;  3H5A A;  4HA8 A;  3ECO A;  3JZ6 A;  2JA7 A;  4GO1 A;  3BJ6 A;  5FFX A;  3BZK A;  3BJO A;  4OIQ F;  2ASD A;  1BW6 A;  1DV1 A;  2NU6 B;  2YYA A;  1X1D A;  5DV5 A;  4A3F G;  1RYS A;  4EM2 A;  2EFN A;  1W4M A;  2W82 A;  1YHQ I;  2F4O B;  4A2U A;  2DBB A;  5LGN A;  4BAC A;  4CHU A;  3N05 A;  4C2U A;  3Q0V A;  2EA2 A;  5J47 A;  2CU7 A;  1WJC A;  3K5I A;  3KRE A;  2CV2 A;  5GAH J;  4ZTF A;  3HIF A;  4IRD A;  5EOY A;  3KAK A;  2Q2E B;  4C5C A;  4HNU A;  4RB1 A;  3WTS C;  4A3L J;  2R5Y B;  3I4N J;  1O3S A;  1OCO H;  3SDG A;  4CA0 A;  5JVD F;  2V4R A;  5DTD A;  4QTR A;  2W6Z A;  3ZRG A;  2A1H A;  3O2P E;  4XN0 A;  3HXL A;  2AGQ A;  3OOU A;  3ML6 A;  2O61 A;  4YB8 B;  2Y0S N;  4WD3 A;  1BI1 A;  3TED A;  1I27 A;  4BEH A;  2I5U A;  2GLT A;  2MW8 A;  1Z67 A;  1D0X A;  4PJM A;  2QQB A;  4YJ2 F;  5F08 A;  4QWC A;  3GFJ A;  4QLC U;  4WF2 A;  4MV8 A;  3AL0 C;  1AKH A;  3Q3S A;  3CZ6 A;  1OR7 C;  3GLK A;  1VBH A;  2H8W A;  3KHR A;  3GFL A;  4RB2 C;  1WH5 A;  1YW8 A;  3E5Q A;  3TO9 A;  1UAA A;  3GV5 B;  1IXC A;  1TTY A;  4WWC A;  3DTG A;  3FXK A;  3BZC A;  5IYZ F;  4BAY A;  2QB5 A;  5F0F A;  2BE5 F;  2EFQ A;  5EEA A;  2DA7 A;  2VAS A;  1OWT A;  4RZR A;  5FFZ A;  4KHP H;  3KXY T;  4ASN A;  3CDI A;  1LKX A;  5K5O A;  3KEQ A;  5LEK A;  2D5V A;  3P7N A;  3NWS A;  3CO7 C;  1WH7 A;  4G6D A;  1QPM A;  1RKW A;  1YIO A;  2X6X A;  3GF2 A;  2F5C A;  3SZG A;  1TWA J;  1PUF A;  2OF7 A;  3FHN A;  3QOD A;  4CH7 A;  2CQQ A;  2W84 A;  3RQI A;  4DUZ H;  1A48 A;  4O3O A;  4O5V A;  2VLA A;  1RC9 A;  3KPH A;  2ISY A;  2K86 A;  2RDP A;  5AON A;  1OCR H;  3FBN B;  1HKQ A;  2WBM A;  4P96 A;  3Q8R B;  3T1Y H;  3OYN A;  4IPA A;  1I6U A;  2L7K A;  3G1O A;  3M3Y J;  1GGO A;  4J9L A;  1K6Y A;  4FBT A;  3FKI J;  4I02 A;  3N41 B;  5LFA A;  1KGS A;  4RNN A;  4PBC A;  1B6A A;  2EZL A;  1Z6R A;  1YS6 A;  4II3 A;  4F7Z A;  1RIO H;  2M3A A;  1IBM H;  1M7J A;  4NZO A;  2NVQ J;  5M5Y J;  5L9X A;  2LY2 A;  2FOW A;  2Y30 A;  5F9L A;  1SD6 A;  2KDZ A;  2RRE A;  4KMU X;  3COA C;  3E5X A;  1M6V A;  1A6Q A;  2MSY A;  3ZMV A;  3WO1 A;  3A03 A;  3F72 A;  4WCG A;  4NUB A;  2B9S A;  2E5N A;  3JRG A;  3R6S A;  3HSF A;  5DM6 F;  4XR6 A;  4EG0 A;  1TWF J;  1ON2 A;  1O7F A;  5BMZ A;  4PFO A;  1MBK A;  4KIS A;  4BS9 A;  4R8U A;  2E2I A;  2XPU A;  2L2O A;  2UV1 A;  2MA3 A;  1C30 A;  4B44 A;  3TEK A;  1J9I A;  1GO3 E;  2UUA H;  1A3G A;  3I56 I;  2R7U A;  4ECQ A;  3TQ1 A;  4XZ3 B;  1ZR2 A;  2QGU A;  4CCJ A;  4WK8 F;  2HVS A;  3KLN A;  4X0G A;  5EWF A;  4EM1 A;  4AIK A;  2W7O A;  1D1C A;  2DFH A;  3WWJ A;  3UQ8 A;  5DG7 A;  3W2V A;  4A0Y A;  1U5T B;  1RJR A;  2V5A A;  3OIQ A;  3S16 J;  1E3H A;  4F4Y A;  3Q0U A;  1X4P A;  2FA5 A;  2MLG A;  3FK7 A;  4ZZD A;  1EF4 A;  2W6M A;  3WE2 A;  1JHH A;  2H6B A;  1XD7 A;  4U7D A;  1IC8 A;  1J75 A;  4IHW A;  2ZJQ F;  1T2K A;  3R0A A;  3CEB A;  1J0R A;  2W57 A;  4UCS A;  3MFI A;  3H0G J;  3PZP A;  4XOR A;  4BH9 A;  2J6S A;  1WCM J;  3WTY C;  3W5O A;  1S9F A;  3U9G A;  3PUB A;  4TV8 F;  3R9R A;  2FLP A;  1UB9 A;  4RGS A;  3BQ1 A;  4I98 B;  2OV7 A;  3PO3 J;  2DZD A;  1MSE C;  3ULQ B;  3KHG A;  1O57 A;  3TKY A;  3I5U A;  1IUY A;  4I99 C;  5HS7 A;  1GYF A;  2A68 F;  4HQE A;  5EZH A;  3OYJ A;  2GQS A;  3T9E A;  5C1O A;  3M9N B;  4YFX F;  4ECS A;  4D5F A;  3O6B B;  5DAA A;  3GBG A;  3HPH A;  2VOD A;  4FBU A;  1KQ8 A;  2M0C A;  2D1V A;  4D7M A;  4JI4 H;  1SFK A;  2E1N A;  1L0O C;  2BZT A;  2L9R A;  3CTA A;  3M1E A;  1RR8 C;  5GON F;  5BYA A;  3CO6 C;  3ETH A;  1YS7 A;  4FFP A;  1MJA A;  5KG7 A;  2ZSH B;  4L5I A;  4MA5 A;  3OHA A;  2R7X A;  1QVU A;  1SVL A;  2CO5 A;  1EV7 A;  5DGI A;  3PW2 A;  2HG8 A;  5HV6 A;  2PJR A;  1V4R A;  3WGH A;  2ECB A;  5IP9 G;  4BUP A;  1AUV A;  2IGO A;  1IOV A;  1V5G A;  2CW0 F;  4OOI A;  3K1N A;  3BZ6 A;  2YUS A;  4F92 B;  3HG9 A;  5J2U F;  3RR5 A;  1U5T C;  1KJI A;  5HDK A;  3VDX A;  4WX9 A;  2CRG A;  1XSD A;  2W8K A;  2Z2S B;  1A31 A;  3J7Z I;  3CF5 F;  1I50 A;  4F93 B;  3GJX B;  5I5V A;  3DCF A;  5E3N A;  3DFG A;  4IHX A;  2VPQ A;  2XGE A;  1S8N A;  2FML A;  2JPC A;  1W0T A;  4MQV A;  3NAR A;  5C4X G;  3H3V K;  1ODD A;  2H09 A;  3L1P A;  2JEJ A;  4U7C A;  4XLA A;  4L0Y B;  2W71 A;  3E5N A;  1SD4 A;  4A12 A;  3L2R A;  1FYK A;  2HTS A;  2QYZ A;  3L4J A;  2DAA A;  2FQ3 A;  1LPQ A;  4MV1 A;  2CMP A;  2IEK A;  2PN6 A;  2DFF A;  2NVU B;  1FLI A;  3VA7 A;  3OYA A;  1FYL A;  2I80 A;  3BR1 A;  3WOD F;  3RV4 A;  5GAE J;  2ZDH A;  3UNG C;  3JTG A;  5CLS A;  2VJ4 A;  2DT7 B;  2XCP A;  4M9U A;  2UZK A;  2UXX A;  3QYB A;  1HCR A;  1YJW I;  2VUM G;  3MZ8 A;  5FJ8 G;  2AQF A;  2EJ3 A;  3OUZ A;  1FT9 A;  2GWR A;  3BG7 A;  4A3M J;  4PCQ A;  2R7Z J;  4DR3 H;  2XC7 A;  4BXX G;  1PP8 F;  2YU3 A;  2JA6 G;  1EH8 A;  2NVY A;  2LY9 A;  3MWM A;  1OYI A;  1G3Y A;  2L9N A;  5K5Q A;  1D5V A;  2VKH A;  3V6K A;  1O4X A;  5E8G A;  5LRR A;  5JLW A;  4XOT A;  3BAA A;  5JVL A;  2Y75 A;  3N42 B;  4YQW A;  5J40 A;  2IBK A;  4JX5 A;  2IBD A;  3CP8 A;  4M0J A;  4EAT A;  2J6T A;  2K40 A;  2ELJ A;  2CQY A;  4LLN A;  1OCZ H;  4CUG A;  2VC0 A;  2MC4 A;  4YBZ B;  4BBS G;  4ON0 A;  3K4L A;  5EG0 B;  2O03 A;  3L00 A;  4A0X A;  2W7N A;  1EUC B;  4ENM A;  2W9C B;  5DG9 A;  1UFM A;  4A6D A;  4MFD A;  1KJ8 A;  1WJD A;  3QU3 A;  4C9Y A;  3HOY G;  2VQC A;  1YI2 I;  2JPB A;  4V19 K;  2R7K A;  4OAY A;  1ZN2 A;  3HJE A;  4YFK F;  4HNT A;  2YRX A;  5C5J A;  1UNN C;  5KFA A;  5HOD A;  4DUY H;  2LH9 A;  5IPA A;  4YJ3 F;  2HHF A;  4EJV A;  2EIJ H;  2L7F P;  5J4V A;  2O6G E;  5LEJ A;  3RSN A;  5LHG A;  3F8M A;  5DD8 A;  2A6T A;  2DMU A;  3FM3 A;  3M4O J;  4BU2 A;  2IA6 A;  1OPC A;  3QQA A;  3LOC A;  1KTA A;  2XB5 A;  4M74 A;  4LGW A;  4MEY F;  2K3F A;  4WXD A;  2CNU A;  2FEZ A;  3M8J A;  3MR6 A;  5IYD G;  3ABM H;  2P6S A;  4Y33 A;  1EUD B;  3T99 A;  2YSR A;  3RJ0 A;  2BGC A;  4MO7 A;  1AA7 A;  1WJA A;  3MKL A;  2DA4 A;  1HDP A;  4ENJ A;  1LVA A;  4DR4 H;  4E4H A;  2XKP A;  4IRC A;  1I2K A;  3HSR A;  2R84 A;  1DDN A;  4BXU A;  2X1D A;  4EGJ A;  2OJE D;  4LOC A;  3RQ4 A;  5J1R A;  1SFO J;  2DA6 A;  3HRT A;  2VBZ A;  3I53 A;  1ETO A;  5ICC A;  1E4F T;  1TT5 B;  1R49 A;  4C2M J;  2R8I A;  2A61 A;  5KG3 A;  4RM2 A;  1BI2 A;  1X58 A;  2DK8 A;  1F5T A;  3GV8 B;  4CMD A;  2IA0 A;  3AYH B;  2QLZ A;  2GXA A;  3I12 A;  4MIM A;  4QWD A;  1FMV A;  1MBE A;  2LY1 A;  3FM5 A;  3JSN A;  5KAI C;  3JRC A;  2P5K A;  3EPG A;  1YOV B;  4M3G A;  1GVD A;  2HFH A;  3FXU A;  3BR2 A;  5AIQ A;  3G4S I;  3VPB A;  2R5Z B;  2ZXJ A;  5B1A H;  2ZME A;  1H0M A;  4U6P A;  3TBI A;  5FKO A;  3UYY A;  2DIK A;  2CUE A;  4F4X A;  1YQA A;  3DKX A;  2W24 A;  3BC8 A;  1FJL A;  4AC0 A;  2V4J C;  3DTE A;  2QSG X;  1I1K A;  3FDS A;  2O7O A;  3C2B A;  5BPH A;  3A0B C;  3DTI A;  1X4O A;  3SDB A;  4G6T B;  2FP4 B;  2AO9 A;  2DT5 A;  4FFM A;  4PWQ A;  4J9O A;  2IAI A;  1JTX A;  1K7A A;  3QOP A;  3BY6 A;  4Q47 A;  4LMY A; 
#chains in the Genus database with same CATH homology
 4ANJ A;  5KHD A;  3H9J A;  3S8P A;  4HPQ A;  2CW8 A;  3PSI A;  3OYM A;  1X1C A;  4P1W A;  2CS3 A;  2K3P A;  2KLO A;  2LC2 A;  2WAQ A;  1MMN A;  4MV7 A;  4LH7 A;  2JSP A;  4E7K A;  3K70 D;  3J81 W;  2Y0S A;  4J01 A;  4DV0 H;  2HGS A;  4XKW A;  5LL6 b;  2QKL B;  1D0Y A;  1SEI A;  2R7R A;  3NBY B;  3BG6 A;  3PNT A;  3TY5 A;  4DBR A;  2KMU A;  4JI3 H;  4XQF A;  3BCB A;  2IGN A;  1J5E H;  3S3N A;  3OYH A;  1FMW A;  2X1C A;  3LFU A;  4AVZ A;  2WAD A;  3J7A Y;  3VYT B;  4J00 A;  3H35 A;  3CP2 A;  4DR7 H;  2ZFU A;  4YEJ A;  3C2H A;  4B3S H;  2FUG 2;  4XOP A;  3QWU A;  4NXN H;  1CKN A;  3RIZ A;  3PFY A;  1TT0 A;  2XAU A;  1SAU A;  3H0D A;  2V26 A;  5IWA H;  3ZCO A;  3K4M A;  4OAZ A;  4F91 B;  3DEE A;  4A2B A;  2PMZ A;  4BJT A;  2DCE A;  2XF7 A;  4D9J A;  3A1Y A;  1N78 A;  3EUH C;  1CKN B;  2JVH A;  2XIG A;  3FMA A;  4CC5 A;  4HST A;  3VSK A;  1WJE A;  5CPR B;  3IP4 B;  2Q1Z B;  2LRE A;  3OYL A;  4HRI A;  1V5E A;  4HG2 A;  2FE3 A;  1LDK B;  2YCH A;  2UUZ A;  1YE9 A;  4JI6 H;  3OS0 A;  1VZ0 A;  4F52 A;  2F5V A;  2RGV A;  4YRV A;  4NXM H;  2MFZ A;  3OYF A;  2IS1 A;  4PJJ A;  3HUG B;  1ZHQ A;  1FJG H;  1NG7 A;  2V1N A;  3OIP A;  4QPO A;  4LG3 A;  3QYE A;  1HNZ H;  1J09 A;  4DV5 H;  5FPO A;  3T1H H;  3L2W A;  4ZTJ A;  3OWT A;  3DLA A;  4XKV A;  3G2B A;  4U7B A;  4XM3 A;  4AYB A;  3TL4 X;  4OWR B;  4CCK A;  3K3V A;  4ETS A;  3IAM 2;  4CSW A;  3VYU B;  3BLY A;  2ZJT A;  2K5C A;  2XF5 A;  4MTE A;  3UR3 C;  3ZGK A;  4LSA A;  2P0W A;  2L5Q A;  1P8L A;  2HHH H;  4GKJ H;  2XSJ C;  1O75 A;  3OMY A;  1XMO H;  5HNF A;  1TA8 A;  2LG4 A;  2R7W A;  3I9V 2;  1N34 H;  1S68 A;  4LIT A;  4UCO A;  3RF2 A;  1D1B A;  2W00 A;  3QOE A;  2WY7 Q;  3EPZ A;  4JI0 H;  4PJL A;  4J0M A;  1KON A;  4RMN A;  2E5L H;  2IS2 A;  4E7H A;  1MMG A;  3H9Q A;  4II2 A;  3EUA A;  4AU7 A;  2R7T A;  2BVM A;  5FPR A;  4XON A;  4LFB H;  4XKC A;  2M7A A;  2CUJ A;  4B47 A;  2K9M A;  5HLT A;  1A0I A;  4P5O A;  3MMY B;  4DJA A;  2KDO A;  2WDT A;  3OYC A;  3DPL C;  4HSR A;  4EQ5 A;  4MV9 A;  1WJF A;  3AFH A;  3RTX A;  4LF4 H;  3LSM A;  3EUK L;  2HNH A;  1QHG A;  1DGW Y;  2HDW A;  4C2T A;  4LF8 H;  2DXI A;  3LL7 A;  3N6X A;  3AL0 B;  1EA3 A;  4E7L A;  3OR1 C;  3RCO A;  1G59 A;  1CKO A;  4OX9 H;  5TGT A;  2VPS A;  2VB6 A;  3TY9 A;  3JAM W;  4CC6 A;  4BWS C;  4RAZ A;  4PSW A;  4DOZ A;  4E7I A;  2MYS A;  3E1S A;  2X85 A;  2UWM A;  1T0F C;  4DRF A;  4LFC H;  2IXS A;  4XN3 A;  3OYE A;  3OS2 A;  2VKD A;  4GRI A;  4ZC3 A;  2CV0 A;  2BW3 A;  2K9L A;  1NG6 A;  2WY8 Q;  3K4K A;  2HVR A;  2V6E A;  1DP3 A;  3KYH C;  4DV4 H;  4B3T H;  2E60 A;  3H5A A;  2GOX B;  3TY8 A;  2QKM B;  4IZZ A;  4XLE A;  4X65 H;  1X1D A;  4IQJ A;  2RGR A;  2BW3 B;  2O5R A;  3S32 A;  2Q2T A;  5IT9 W;  2W82 A;  4JI2 H;  4U87 A;  3CES A;  4Y4R A;  4BAC A;  3N05 A;  4C2U A;  2JVG A;  2CUZ A;  1WJC A;  2E5Z A;  4PZ8 A;  2CV2 A;  4ZTF A;  2JA2 A;  2LRD A;  5EOY A;  3KAK A;  2Q2E B;  4KT6 A;  4HNU A;  2HIV A;  3VSL A;  4RB1 A;  4RLQ A;  4CA0 A;  5FLX W;  4E7Z A;  2GOM A;  1TZL A;  3GDE A;  1HNW H;  3H5R A;  2M7B A;  3JSL A;  2I8D A;  2L9S A;  2VIX A;  2Z1D A;  1PYV A;  3F9K A;  3OL3 A;  3ZRG A;  1QU3 A;  3L4J A;  1BJT A;  4BE2 A;  4X64 H;  3CVZ A;  2AQE A;  4PJN A;  3HXL A;  4XN0 A;  3OYI A;  3OOU A;  1FKA H;  4LFA H;  3D5S C;  4FM9 A;  2NOJ B;  4PSX A;  2OUM A;  4BEH A;  4MLO A;  1FVI A;  2WYO A;  4APM A;  1D0X A;  4PJM A;  1W36 C;  4XL9 A;  3AL0 C;  3KAL A;  4BXF A;  1WJ5 A;  4DIQ A;  3CZ6 A;  1OR7 C;  4BEH B;  4RB2 C;  3SYT A;  2HQA A;  4LIU A;  2Q2U A;  1UAA A;  2VXD A;  2CFO A;  3OS1 A;  4RB3 C;  2X51 A;  1HA8 A;  2HPI A;  3HOT A;  2VOB A;  3J80 W;  3VYR B;  3CJR B;  5HVQ C;  3DKY A;  2VAS A;  2M0M A;  4DV6 H;  3KXY T;  4KHP H;  4DR6 H;  4FAS D;  2WAF A;  1P9Q C;  4DV3 H;  1LKX A;  4B48 A;  3W1B A;  1MMD A;  4NC7 A;  4FET A;  2BOL A;  4XLC A;  3NWS A;  4JQF A;  3LSH A;  3LSG A;  3RPU D;  2VQE H;  4ZDL A;  4B3R H;  1N77 A;  2KZV A;  2X6X A;  2CW7 A;  3W3C A;  3SZG A;  2F6C A;  4DV1 H;  4E7S A;  4LF5 H;  3IAS 2;  3FHN A;  2HIX A;  3QOD A;  2LYC A;  4CH7 A;  3DF7 A;  1VS0 A;  4DUZ H;  4B3X A;  3S3O A;  3IUO A;  2VLA A;  4JV5 H;  3L2Q A;  3D5R C;  4B3M H;  4UCT A;  2KRC A;  1Z2N X;  3FBN B;  1V9P A;  4IQ4 A;  2WBM A;  4AQY H;  2LOO A;  4BE1 A;  3OYN A;  3T1Y H;  1L2Z A;  2IS6 A;  1I6U A;  2L7K A;  2UXB H;  4CCO A;  1K6Y A;  3DU6 A;  1DQU A;  4PK4 A;  4NNJ A;  3NBZ B;  1ZHS A;  4EFB A;  5LFA A;  3N41 B;  3CF2 A;  3KAJ A;  2R7V A;  1HNX H;  4II3 A;  3DU5 A;  1IBM H;  2M3A A;  2IS4 A;  4IAJ A;  3MD2 A;  2V7F A;  2LY2 A;  4IKF A;  2RRE A;  3AKZ A;  3H9G A;  2KSW A;  4BQO A;  5FD5 A;  3K4B A;  3LSK A;  2KRH A;  2CH0 A;  1N33 H;  3OYD A;  2RNG A;  5D1P A;  2Z16 A;  4NUB A;  3RGX A;  2E5N A;  3PJR A;  3MKY B;  1BGW A;  1N75 A;  3FKJ A;  3ZR8 X;  4XR6 A;  4BGD A;  3DWL E;  4DGW B;  2F4I A;  3NC0 B;  2DOA A;  1Z7L A;  4YHH H;  4BQN A;  4PFO A;  1ZEL A;  4KIS A;  4RAY A;  4BS9 A;  5CQG A;  2L2O A;  2UV1 A;  4B44 A;  2UXD H;  2UUA H;  2WB1 A;  4C30 A;  4CCM A;  4JI8 H;  3BCA A;  4R7R A;  2R7U A;  1T95 A;  3L4K A;  5CQE A;  4CCJ A;  3N44 B;  2HVS A;  4N4O B;  4X0G A;  4PUS A;  1D1C A;  2VJ5 A;  3UQ8 A;  3W2V A;  4F55 A;  3F8N A;  1W36 D;  2HPM A;  2UUB H;  3SEZ A;  2MD0 A;  1XNR H;  3OIQ A;  2W4S A;  1BOB A;  4B43 A;  2VL8 A;  4UCV A;  1X4P A;  2IGM A;  4BDZ A;  3L2P A;  4Q0Y A;  1U0J A;  1R6R A;  4Y3O A;  5KNL A;  4BE0 A;  4LF6 H;  2MAB A;  4KIT B;  1XDN A;  5LMU H;  3HKZ A;  4UCS A;  1MZB A;  2W57 A;  1GLN A;  4F3Q A;  4UCR A;  4XOR A;  2WA0 A;  4H4K C;  4CZC A;  2VQH A;  3W5O A;  1ERD A;  3PUB A;  4ZYA A;  3K4C A;  5JHF A;  1LFP A;  4EEQ A;  3J7A K;  2OV7 A;  4ZDO A;  2ZM6 H;  4I7H A;  2OC6 A;  2VJI A;  4ZDP A;  2UUC H;  3V42 A;  3VNN A;  1GYF A;  3M1C A;  1X9N A;  2E1M B;  4JI7 H;  3OYJ A;  4KJZ A;  5KCM A;  1MNE A;  3GBG A;  3HPH A;  4LF7 H;  3OR2 C;  4EFE A;  5CKT A;  4E6N A;  2UXC H;  2BVL A;  4YEL A;  3HOS A;  2KL4 A;  4JI4 H;  1SFK A;  2XDV A;  4DR1 H;  2VQG A;  4RLF A;  1Y56 A;  3BAB A;  3LMM A;  2ZSH B;  4BQQ A;  1Z21 A;  5FRN A;  2R7X A;  2VQL A;  2CV1 A;  1MND A;  2PJR A;  3C2G A;  1BR4 A;  4XMY A;  4XLF A;  2WAE A;  3K4N A;  3KEY A;  4BUP A;  3L2V A;  2IGO A;  2X6Y A;  2VUG A;  1V5G A;  4E6K G;  3ZQQ A;  3VYS B;  1QHH D;  1SYX B;  3KYL A;  4X62 H;  1N32 H;  4F92 B;  3HG9 A;  3RR5 A;  2PJR B;  4BJ5 C;  1JI8 A;  3VDX A;  2Z2S B;  3RGZ A;  2KQR A;  3DQV C;  3EYY A;  4F93 B;  3GJX B;  4DV7 H;  2W1O A;  4N4N B;  3DPT A;  1YX3 A;  2A5W A;  5FRO A;  3OYK A;  4UFZ A;  5LMN H;  4A2A A;  1I94 H;  3I3L A;  4ZJZ A;  4XLA A;  2R4G A;  3OTO H;  4PZ6 A;  2WE6 A;  3L2R A;  3CMM A;  3VWB A;  2V9K A;  3E0J B;  4LIV A;  1XNQ H;  2CMP A;  4JI1 H;  4M7E A;  4ITV A;  1PJR A;  4DR2 H;  5D1O A;  4DBQ A;  3BA9 A;  3OYA A;  3HL2 A;  1Z2O X;  1D1A A;  2E1M C;  1N36 H;  3FBI B;  2HZD A;  1Z3X A;  2KPM A;  2VXZ A;  2HVQ A;  3UNG C;  4LSX A;  2VJ4 A;  2DT7 B;  2ZXH A;  3W1G A;  4K0K H;  1P16 A;  1XMQ H;  3QYB A;  1MW7 A;  2AQF A;  3OL4 A;  5D1O B;  1IBL H;  3BG7 A;  4DR3 H;  4IX7 A;  3M4I A;  4JI5 H;  4CCN A;  2XC7 A;  2CFM A;  4LF9 H;  4BL0 B;  3PSF A;  3H5N A;  4GLX A;  3MWM A;  2L9N A;  4RZQ A;  1V5F A;  4LH6 A;  5A2Q W;  4CCL A;  2VKH A;  3MKZ A;  3HPG A;  1B04 A;  3TMO A;  4RB0 A;  1Y6I A;  4XOT A;  3BAA A;  3N42 B;  1Z3Y A;  4BJ6 C;  1BR1 A;  3W2W A;  3CP8 A;  4NQW B;  4EAT A;  2LBF A;  2ELJ A;  3K70 C;  5BR8 H;  4CUG A;  2MC4 A;  1X1B A;  1WFX A;  2ZSI B;  3H20 A;  3K4L A;  2W7N A;  3K10 A;  2O03 A;  1XK5 A;  2RQQ A;  3A2K A;  2M4K A;  3A4C A;  1WJD A;  4C9Y A;  2UU9 H;  3N40 P;  2VQC A;  2X1E A;  2LBF B;  2DJI A;  4PFP A;  3S93 A;  1Z2P X;  3LML A;  3S3M A;  4OAY A;  3N43 B;  4PZ7 A;  4X66 H;  3KX2 A;  4HNT A;  4XLH A;  4QPQ A;  4DUY H;  3OYG A;  2LH9 A;  2HU9 A;  3HC7 A;  3MKW B;  1E0E A;  3NWT A;  5HOO A;  5DIS C;  2KP6 A;  2DT6 A;  3RSN A;  5FRM A;  5LD2 C;  3RTR A;  1CKM A;  2A6T A;  1M0T A;  3U21 A;  4XKB A;  1IRX A;  1S9H A;  4BU2 A;  4DR5 H;  1MMA A;  4JOM A;  1IBK H;  2ZXI A;  1YX5 A;  1OLT A;  3M8J A;  4E7J A;  4D1Q A;  1WH2 A;  4Y33 A;  4R79 A;  2JUG A;  3RJ0 A;  1AA7 A;  3LSI A;  4DV2 H;  1WJA A;  2IGK A;  3K6G A;  4DR4 H;  2R7Q A;  4E4H A;  4XNF A;  3D5L A;  1DGR M;  2X1D A;  3RQ4 A;  3GB8 B;  3L2U A;  1E4F T;  1HR0 H;  4HEA 2;  1AN7 A;  1BR2 A;  3ONQ A;  4RM2 A;  1E4G T;  1M0W A;  4GKK H;  2XF6 A;  3K4J A;  2VPL A;  2MCT A;  1UG0 A;  1WJB A;  2VJJ A;  1FMV A;  3PL8 A;  1TAE A;  4MTD A;  2LY1 A;  3OYB A;  3JSN A;  1S03 G;  3PN1 A;  2M4G A;  4NC8 A;  3S24 A;  3IG0 A;  3SEQ A;  2VQF H;  3TBI A;  1D0Z A;  1LVK A;  3DPU A;  1X19 A;  2R7S A;  3FDY A;  5FD6 A;  3C0F B;  2R7O A;  1DGS A;  4PDB A;  3DKX A;  3QYF A;  3BC8 A;  4RM3 A;  4UCU A;  2OWO A;  2V4J C;  3DTE A;  3W2A A;  4JYA H;  3DTK A;  2KHM A;  2X6W A;  3CJQ B;  3PNV A;  5HNH A;  1X1A A;  1G8X A;  1UEL B;  3DTI A;  4YY3 H;  1X4O A;  3SDB A;  4G6T B;  3OY9 A;  3PNY A;  4BDY A;  2F4V H;  3ZXS A;  3BA8 A;  4LMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...