2HVRA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 3'-deoxyribonucleotide at the nick
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/rna/dna
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
total genus 83
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvrA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvrA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvrA01
1VS0A 5DISC 2HVRA 4LH7A 1A0IA 1DGSA 3W1BA 4LH6A 1S68A 1XK5A 2HIVA 3GDEA 3PN1A 4UCSA 3RTXA 3JSLA 4UCTA 1FVIA 1CKMA 4UCRA 4CC6A 4CC5A 2Q2TA 1CKOA 2VUGA 3BAAA 4PZ8A 3W5OA 2Q2UA 4EFBA 5FPRA 3NC0B 5FPOA 2OWOA 1CKNB 3JSNA 4UCOA 3RR5A 4UCVA 2HVQA 2CFMA 5D1OA 3BA9A 4DRFA 4UFZA 1XDNA 3TY5A 4EQ5A 1CKNA 1X9NA 2HVSA 3KYHC 3NBZB 3TY9A 3VNNA 3UQ8A 5D1OB 1P16A 3GJXB 3S24A 3TY8A 4EEQA 1TAEA 3BABA 3BA8A 3GB8B 4E6NA 3L2PA 3QWUA 2HIXA 4PZ6A 4GLXA 1V9PA 3NBYB 5D1PA 1B04A 3W1GA 4EFEA 4UCUA 1TA8A 4PZ7A 1P8LA
chains in the Genus database with same CATH superfamily
3SDBA 4L5JA 4I02A 4A0YA 1IAWA 1OR7A 3RIZA 2YZLA 2V4QA 1A6IA 1UELB 4HDVA 3FMQA 1FBQA 1OYIA 1WZ2A 3LAPA 2VONA 4YHHH 5EYRA 1XSDA 1R5HA 1SYXB 3CO6C 4C9YA 1KYZA 4XK4A 4I09A 4N0BA 3RGXA 5IWAH 3QOEA 2VQDA 3HUGA 4II2A 5ICEA 3JTHA 1AA7A 1YFHA 3CCVI 4BY1J 4M6VA 2R8GA 1R7JA 1LUJB 2GBYA 1X1PA 3HKZA 1SC7A 1N25A 1SD4A 1FBSA 4CCKA 2E5NA 3BR0A 1I6XA 1V5EA 1JKPC 1P4XA 4KMFA 1N34H 1MW7A 2FNAA 2LP0A 5F27A 4A3IJ 5DV5A 5DYMA 5JFRA 2CZGA 1YO5C 5IY5H 4KJZA 2BXYA 4KT6A 1QZZA 4NC7A 2MSYA 1BR2A 1JXSA 5JQWA 4XOPA 4XNFA 1TT5B 3TW7A 1X9NA 1BJAA 5K1YA 1XNRH 3KZZA 1JKRC 2K5CA 4IVNA 4QWBA 3K70C 2HKOA 1HC8A 3OIPA 3TOBA 1I2KA 1PYVA 3ZP5A 4HZFA 4QIWA 5D1PA 1T0FA 3U21A 5LRSA 4JQFA 3H3UA 4HOBA 4R8UB 3H4DA 4U87A 2DYRH 3OIQA 4QPOA 3WTYC 4JV0A 1DUXC 2A5WA 4R8UA 4FBUA 4I76A 3RYRA 3VPCA 3PL8A 2JEIA 3RB3A 3GCMA 2HGCA 1Z21A 2BHYA 2E35A 5KX5F 5DG7A 3QZ7A 3CSWA 3L4KA 1LFUP 2QM3A 2Z16A 1MDMA 3A01B 2P4WA 3CDLA 1FWZA 3BR3A 4GO1A 4KIGA 2ZMEB 1Z6TA 3KEYA 1WJEA 3HPHA 2Y48A 1KU3A 1S7AA 4HF1A 3CCEI 3T0YA 3MD2A 4HRIA 4BBSJ 1DAAA 1FY7A 2JN6A 3FHNA 1XG1A 5DUKA 4IXAA 2QK4A 3FM3A 1T94A 2W8KA 3RCOA 2HVRA 4TUYF 3RJ0A 3PSFA 2XKPA 2ZJQF 2NRAC 3DCFA 2B9SA 1FIPA 1GLNA 2CNUA 4CC6A 2EZLA 5CVIA 2IVMA 1YX5A 4HG2A 1YIOA 4NQWB 1VZ0A 3CCUI 3OSFA 1FTZA 1E4EB 3BAAA 2KDOA 1YYVA 3AYHB 3ABTA 4GYGA 2VXDA 2DA3A 2XGQA 3B6AA 3MKYB 4ZYAA 2IS4A 4E6KG 5FJ8J 3TY9A 1FZPB 5KFQA 5D1OB 4TM5A 2KISA 3PW4A 3ZQLA 3RIRA 2PMZN 3VMMA 5BWVA 5E8IA 4OINF 4ED1A 4IHYA 2EB7A 2E1MB 4FU0A 5K5RA 4F91B 2JEGA 3PUFA 1J0RA 2KKOA 4X1EA 2XV4S 1UC9A 1Y8RB 1QA6A 1JT6A 5EG0B 4E7KA 5KVRA 4GC6A 4S04A 3LA7A 2VLAA 3OOPA 3E6DA 3AAFA 1EV7A 1K1SA 3AG3H 3HRUA 1Y8QB 4XLCA 4HQMA 2R7OA 2F4MB 3MZ8A 4JX5A 4BU2A 3N97A 3M4OJ 3PJRA 3JAMW 2ZXJA 5DLFA 5DG8A 3I56I 4JI2H 3MCZA 5KAIC 3H9JA 2XGCA 2DPJA 1X58A 4ZYHA 5E3LA 3K3VA 2X0SA 3GTGA 1B33N 4O3QA 3MWMA 5L3EA 4BWSC 2C22A 2DOEA 2CQYA 3TDZC 3EUAA 3J80W 1S3JA 1W7PD 3IP4B 2ECBA 3ZXSA 5LBQA 4DLKA 3G6XA 1KQ0A 2DJIA 2JJ7A 1G2WA 3BQ1A 5LGTA 2IXSA 2LREA 1KU7A 3CQZA 1QU3A 1T98A 3IH2A 2MFZA 3FDSA 1W0TA 3S93A 3GEZA 3JRAA 4LF5H 2CQXA 2M05A 5LXTF 3CESA 1CF7A 1S5LC 2VUGA 3BR1A 4HSTA 4C3IJ 4EGQA 2FQ3A 4G6QA 2TDXA 1G3SA 3I9V2 3RDIA 3LNQA 4U0YA 1CKNA 2LDUA 2E7XA 5DQHA 2LNBA 2XCAA 1TW3A 4XIDA 2ASJA 2V7FA 4YP3A 4NLGA 2W1OA 3PNYA 4CCOA 3QWUA 5IT9K 2B63J 2PBZA 1U5TB 5EJCA 3RV4A 2AQ4A 4YAKB 1QRYA 3OTOH 3R23A 4X66H 4J9QA 3G6EI 5JVLA 1WCMJ 4BXXJ 1FIAA 2RREA 3KZIC 4KA4A 2IGNA 3HXLA 3EQLF 4BQOA 3ZQQA 5J4YA 2XCLA 1UHMA 4XOTA 1VQ8I 3T5XA 4EFBA 2HZDA 3RR5A 2LOOA 2HDDA 3S1MJ 4F4XA 1BC7C 2LG4A 5BWXA 3PQJA 5KFLA 1B6SA 1ON1A 3O6BB 1TWAJ 5LGNA 3CMYA 1ZGWA 1T2KA 1ZHQA 5CB4F 4BHBA 2CKZB 2ODTX 1MH4A 2CUEA 2QUFA 4HLYA 2EPFA 2FXAA 4OMZA 3HTUA 5CAEB 3S2WA 3M4IA 5KFUA 2KJBA 3LULA 1B72A 2JA5G 4O3PA 1U5TC 5FB2A 4I2OA 2L7FP 4NBQA 5KT7A 5IOYA 3EPGA 2GPSA 3OYKA 2E7WA 1Z7LA 4HX8A 3DKXA 5DGBA 2J6SA 3WHBA 3H3ZA 1TZLA 1CQJB 1T6SA 5BPHA 4AD9A 2GLOA 3DBHB 4DGWB 4XSZF 2JUGA 3GUDA 4G94A 1R9TJ 4X62H 3EPIA 4UCOA 4AU7A 5F1JA 1W96A 1FX7A 4V2GA 3HOXG 2BZTA 3TIIA 2O61A 1A3GA 4YFXF 2YPRA 3BR2A 2JA6A 3BWGA 3H5RA 2NUAB 2R3SA 5KFYA 1MJBA 3FF5A 1STZA 4MA5A 2XF5A 4B44A 1XDUA 2A3SA 2IS6A 1W5CC 3ECOA 4HV5A 1UC8A 2HI3A 2FPPB 2YX4A 3G6YA 3TEKA 2FE3A 5E3NA 1J9IA 2O0YA 2GA1A 2FK2A 1P7IA 5A2QW 2QA4I 3MKLA 1S0MA 4F3QA 1A0GA 2VKEA 3A4CA 3D5LA 1EKVA 1KT8A 5CA0F 2OBPA 4M73A 3QPTA 3JSNA 2V6CA 2E1NA 3CCQI 2PMHA 5ED4A 2M0MA 3GTMA 1KYWA 3FKIJ 4R79A 2K4BA 4QWAA 4A3MG 2ELHA 3DPLC 5EZHA 2P0WA 3PFIA 4D7MA 2P7CB 1S10A 2D2WA 1K6OA 1Z05A 2QBYB 4ZZDA 2F5CA 4ZYDA 5LD2C 3GTLJ 5F0HA 2W7NA 3IH4A 5FKLA 4E7JA 2R7UA 1U5TA 2V58A 2L01A 4FQGA 3I0TA 2CQ7A 3PFYA 1P4WA 3GTGJ 5I5WA 5HS9A 2FK3A 3TP3A 1WGXA 2MGQA 2R7WA 3JREA 1XTAA 2FOWA 2VJ4A 1W36C 2R93J 1EZ1A 4PSXA 3ZMVA 4O7NA 3DEUA 3GIIA 5GAEJ 3OR2C 4XKVA 4N4OB 2H1LA 4Z2YA 3GLKA 5KFPA 1W4MA 5CVVA 3BACA 4CICA 3F21A 3CUQC 4RZQA 5L3BA 3BPXA 3BPVA 2LBFB 2COBA 4KMUX 3D0SA 5IP7J 1OYWA 2HDWA 4OIOF 3SDGA 1NG6A 5B66C 2ZFUA 1SMYF 4DUYH 1D0YA 2CWEA 3CEBA 2MH2A 3BZKA 1XMXA 3TL4X 3L1PA 1KJJA 3SNOA 3KPHA 1V54H 2YYAA 4NNJA 3RZDJ 2R92J 2K3PA 1ZETA 2WC2A 1I3QA 3ESWB 2E60A 3TMOA 4UXNA 3F8NA 2HYGD 2X6XA 3QU6A 2ELJA 3GTKA 3HSRA 5LP6F 4FFOA 3K7AJ 1XSXA 4J9PA 3T9DA 3KP3A 2PN6A 3MQ0A 2Z02A 5KG2A 2Q2EB 4DYRA 2K9LA 4ME6A 3JCUC 4IRDA 2FRHA 2FPGB 2Y75A 2J5PA 2NVXA 2NS8A 3K4NA 1LQ1A 2NU8B 4ESJA 3VSLA 2NNNA 2RF4A 1KGSA 1ZLJA 4EEQA 3JTGA 1ITYA 2X48A 5L3DA 3WGHA 3RV3A 1LJ9A 3GV5B 4FM9A 3V7SA 4BH9A 5KFWA 2FX0A 3KCCA 2V9KA 1WJDA 2V1DA 1S9FA 3RUPA 2M1BA 5J1RA 2V4RA 3M8JA 1HKQA 2CO5A 3VA7A 3H0GG 2V1XA 4EBEA 2QZ8A 2W9BB 2L5QA 4JXUA 3RB4A 3T54A 1W5SA 3F8BA 3N6RA 2R84A 3I4PA 4MTDA 3SE7A 1I7NA 2RDJA 1HF0A 5H6RA 5M5WJ 2EZHA 2OWOA 1G3TA 2DXIA 1BNCA 2Y30A 3LA2A 5EEHA 1Y1VG 2M8EA 3HOYJ 2AGPA 1FPQA 1QQIA 4U7BA 4EJVA 3JRHA 3H92A 2W9AA 2PMUA 2PQ8A 2O03A 2VASA 3S3MA 4WXCA 5KFTA 1TQPA 3DBLB 3MEXA 4HEA2 3N43B 2DMTA 2CMPA 4TQSA 2IA6A 2F4IA 2QB5A 3K5HA 3GILA 2EFOA 3MFIA 2W4SA 3HOTA 1A5JA 1LDDA 1S29A 1FMVA 2XAFA 2KMUA 1FLIA 2Z1DA 4JYKA 4ENJA 4GFBA 3HSEA 1ON2A 1HQCA 4Q45A 4Y4RA 4HF2A 2EH3A 3AW8A 2CRGA 2EBIA 1WCMG 4BXXG 5LYJF 3VYSB 1HW5A 2LF7A 5D4SA 5M3MJ 2DA2A 1QO0D 4A3EG 1BIAA 2COIA 3RB6A 3EUKL 3RJPA 2O8XA 4OIQF 2W7PA 4CKCA 4D7NA 1E17A 3MFHA 2H6BA 2VQGA 4O3RA 3A03A 2WYOA 1OISA 2L3DA 3HRMA 2XCPA 3UYYA 5EOYA 5HS8A 2HJWA 4IRCA 4XLAA 1RZ4A 2DPIA 3SQNA 3M9MB 1KU9A 3R9RA 2LY9A 3LMMA 1IF1A 4IIJF 4ESFA 3ABKH 1WSUA 1IBKH 1RPWA 3L2CA 4RLQA 4ECQA 2GOXB 2LRDA 4L9NA 2EINH 3SFIA 1ZN2A 1XDNA 1KQ9A 4RS8A 2HEOA 4R7RA 2P5LC 3CJNA 1D0XA 3QU3A 1JIHA 1OYYA 1V3FA 4O81A 3HZJA 3BG3A 4FX0A 3L2RA 2WE6A 1Z2OX 1QHGA 1R71A 1OCRH 2HR3A 4OIRF 3FM5A 4CXFA 5J47A 5BWUA 2VC0A 1HXDA 3DTEA 4LLLA 2R93G 3GZNB 3S3NA 3ZQFA 4L18B 3L4JA 1B8IB 2EV0A 1HLVA 3DV8A 1IXSB 1YW7A 5FGMA 1OWTA 2XGPA 2IA0A 2VN2A 2NVQJ 2FBKA 4CYDA 1G2HA 3BJ6A 2O8KA 2STWA 1GLVA 4RMNA 2XSDC 4X64H 3B02A 1VQ9I 4HBLA 2PEXA 1UJ8A 2HVSA 5E20A 4A5MA 2HOAA 2I5UA 3Q8QB 3ASNH 3L2WA 5DGHA 1DP7P 1SEIA 1EUCB 1RETA 3JZFA 4BL0B 2DTZA 3TINA 2WV1A 3S1QJ 3QFFA 4O7VA 3J81Z 4BY1G 1NG7A 3R6SA 3F23A 1AU7A 1UHWA 3ZQ7A 4ED2A 3I53A 3V6KA 3KP6A 1H9TA 3HKZN 2D45A 1GVJA 3KETA 3LFKA 3MJFA 2CUJA 2FA5A 4DL2A 3SHFA 1MKMA 4C5CA 1P92A 2VE8A 3V8JA 1MJ9A 2XD4A 4U7DA 2QYZA 2X1CA 3F8FA 1IRFA 4U0WA 2UVVA 5J6XA 3ZQCA 4BACA 4RZRA 2STTA 2LLKA 1YJ9I 4NQWA 3ULQB 5IYCG 3C3WA 3VDXA 1SEUA 2Z3YA 3HKZE 2E2HA 3TP0A 1SFOA 3I4NG 3HYIA 1SVMA 4CSWA 4OAYA 4XQFA 3OYGA 1FKAH 2R7FA 4K0KH 1VQ6I 4JI1H 3ZMUA 5IP7G 5KFIA 3AFHA 1BI3A 1T95A 4A3KG 4CZCA 1RJQA 2VKVA 4PFPA 1RKWA 1TWFA 4NXMH 1V9PA 4HYEA 1SAXA 1SFEA 2MH9A 4LFBH 3DXJF 1IRGA 1N56A 4J9SA 5LHGA 4IHWA 4YB8B 1Z91A 4RUAA 5KT2A 4F4YA 4PJNA 3M8EA 3IL2A 2KP6A 2DT6A 1Y39A 1XMOH 1L3LA 4IWXA 3WO1A 3W5OA 3HOUG 3VSKA 1FEXA 4B4CA 3CJRB 2ETHA 4L1KA 5KFAA 2CUFA 3I64A 5BMZA 1Z2PX 2G7UA 1FBUA 5KCMA 5KFGA 5KT6A 5FLMG 4IAJA 2X5RA 3KZYA 1P6RA 1Z2NX 1TWFJ 3ZMSA 1I1MA 5BR8H 1VQ4I 3C2HA 3Q2OA 4I50F 1B4AA 4Q8FA 4JV1A 2UZKA 4DV6H 5A2QK 4JBAA 4MV4A 5D8DA 1JXLA 1BOAA 2WA0A 1U8RA 5FD6A 2DDAA 4XZ3B 3H36A 1BC8C 4EJWA 5B1BH 1ODDA 2P81A 3C7JA 1USSA 1DGSA 3LQSA 3RKYA 3HOWJ 2VPLA 1R5ID 4IHJF 2IP2A 4XX0B 1GDTA 4HW0A 1GYFA 4DYCA 3I12A 1AHDP 4B3TH 3Q0WA 3GTPJ 4XSXF 4XMYA 2R7XA 2QVOA 4M6XA 4A3DJ 3OYBA 2DA6A 1MDMB 3VNNA 1BOBA 4W1UA 3K1PA 2VC1A 5JVGF 3DTFA 3E0JB 5TGTA 3OYHA 3PFFA 2LFBA 1SFOJ 2AQFA 3G1OA 4RB1A 1F4KA 1X1CA 2YRWA 4A2BA 4FT8A 3WWHA 2AHQA 5IP9G 1GUUA 1WI3A 4RLFA 5DEQA 1KC7A 4IHSA 3H0GA 5M5XJ 3HM5A 2JSCA 4ZDPA 2QWWA 1BJTA 3IG0A 2CU7A 4LLGF 3OYAA 4DL6A 3WG7H 2LH9A 3NAUA 4IO9F 4JI8H 4XR6A 5JQGF 1FSEA 2JA7J 3SGIA 1XD7A 1DQUA 2RKHA 1O7LA 3J80Z 3MVPA 3K4LA 3SZPA 5D5XB 4RU9A 4YG2F 1GO3E 2FEZA 4WWCA 2L7MP 4ZI7F 4MHGA 2OH2A 3Q8RB 3WTSC 4CYCA 5KFKA 3CP2A 2PBIA 2VR1A 1VNDA 4MLOA 3RKQA 3LWBA 1WVRA 3VPBA 3FMAA 4FETA 4XONA 1AUVA 2ID6A 2W00A 1M1EB 2HOEA 2JVGA 4IQ4A 3Q9VA 1ZREA 2KPMA 2PJRB 2W9BA 5LLQA 1WJ5A 2R6FA 1X3WB 4EYIB 1D1CA 4MEXF 4F7ZA 2HNHA 4L9VA 3ZMZA 4BEHA 5KFZA 1G3WA 5KG7A 2CG4A 4ANJA 4ZTJA 1K1QA 5EDWA 4Q44A 2DABA 4BEHB 2EJ3A 2E19A 2DOAA 1I5ZA 4HA8A 3WWIA 4MV9A 3W2WA 1SFKA 2DO7A 3TBIA 1V55H 4J01A 3TY8A 1GGOA 2OQRA 2H8RA 3P7NA 4I6ZA 1NK3P 4J19A 5HNHA 2C6YA 2VA2A 2ATLA 4FASD 3H1CA 4A3JG 5J3LA 5DMXA 3LSMA 1Y14B 2MD0A 2DU9A 2OZ6A 2XAUA 2P5VA 1GXQA 2HOSA 4DIQA 2L9SA 1MNMC 1X2NA 2K86A 2XKOA 2CS3A 4BQQA 2VUMG 1W93A 1QPMA 2VQLA 3FXQA 2YX7A 4PZ8A 2VKDA 5L1LA 3S17J 5CR5A 1QVUA 5BPDA 1IXCA 2L54A 4UVAA 2QF7A 2OJED 2K9MA 3QPLA 4P9UA 3TGNA 1VBGA 2F5FA 3KYHC 1FC3A 5I47A 3WODF 3E97A 4AC0A 2MD5A 4O4IF 2EV6A 5F0CA 5CA1F 2H94A 2V9PA 4JX6A 3D5RC 1LVAA 4G8XA 2OC6A 5CPRB 4XBFA 4CCMA 5JR3A 1WR2A 4HLXA 3L2VA 5HODA 4FFPA 1LKXA 1I1LA 1UNNC 2HKXA 2RV8A 4LOCA 4UHTA 1ZGAA 4XLFA 1JDBB 4UVCA 2HIVA 4YRVA 3QZ8A 2X85A 2XGXA 4ZDLA 2Q2TA 1ZRCA 3JRBA 2P8TA 1SANA 4UCVA 2VQCA 4M3FA 1W7PA 2M87A 4GDFA 4KYWA 1X3UA 2DWCA 4XN3A 2L9RA 2JEFA 4RNNA 3PR4A 3U9GA 4C3HJ 2LBFA 4ZYEA 3D1NI 4BY7J 3V42A 1ETVA 5L3FA 1WSCA 4HYKA 1IGNA 4OAZA 1AKHB 5ICCA 3BQYA 2JEJA 2SCUB 4EJUA 4RNMA 3OOUA 2MA3A 4LFAH 2COJA 2JA5A 3G3ZA 2MLGA 1I2LA 2KL4A 2R7QA 2XPVA 3N41B 5DISC 2HGWA 2E5LH 4GLWA 3T7AA 1QZEA 2K9QA 3FXOA 3TQ1A 2PJRA 4DV7H 3NQOA 3BP8A 1MGTA 4O4JF 2ZB9A 1RYRA 4A3BJ 1K6YA 4L5EA 4XKWA 1OCPA 2R7NA 4DIMA 4X65H 1I6HJ 2M9HA 2IPQX 4O6JA 4N9IA 3CCYA 4ZHQF 3TY5A 2VT2A 2IBDA 3GFMA 3G1MA 4P9FA 5JH7F 2R92A 4A12A 3EYIA 5IP9J 2L4AA 4J9KA 3JSOA 1MBJA 1OPCA 2O9LA 5DQIA 3IH3A 1OFCX 1WH2A 5B1AH 5LMUH 5KG1A 4XICA 2ZM6H 4M3DA 4KN7X 3GW2A 1WPKA 2AXLA 3T5JA 5EZGA 2Q7DA 4PUSA 4U0VA 4BHCA 4AVZA 1TWHJ 2F48A 2XPUA 3AG2H 3F22A 3GTKJ 2R7ZJ 2EIYA 2X6YA 3LQQA 3V6HA 3JSLA 5CYVA 1VBHA 3GYHX 3KYDB 3BTCA 2DT5A 2R7DA 2J5OA 1A48A 4LG0B 2K4JA 3BJOA 4UFZA 3OYFA 1ET0A 3RAXA 3CUQB 1R1VA 3M9OB 1P16A 4NB5A 5F1RA 4M74A 5BWTA 5EWGA 1UG0A 1R5GA 5FKOA 3JRFA 5KG5A 2PX9A 5J2TF 4LGWA 4E4TA 1TW2A 1FOWA 3T9CA 3GTJJ 4X6AJ 2X6WA 1KA8A 1A31A 2A05A 3E3VA 4MIMA 2IT0A 1LEBA 4DV0H 4NC8A 3JRCA 3KHRA 2JMWA 1IV6A 4CHUA 3W1BA 4LITA 3I4MJ 4JI6H 2X1EA 3AG4H 1ORKA 3GF2A 1AN7A 1D8KA 4U6PA 3SFZA 1P7JA 1PUFB 3F8CA 5FLXZ 4TQRA 4QW9A 3D5SC 2G9WA 2JT1A 2ZFWA 2I8DA 1XGMA 3GTQJ 3J80K 2OTJI 3CMAI 1U6GA 2BW3A 4FS1A 5BWRA 3DP7A 1O4XA 3L2UA 2A1HA 2WV0A 4J9MA 2COGA 2K9NA 3SEQA 1GHCA 4E7LA 2NAZA 5C5JA 3M9NB 4ECWA 4CKBA 4TV8F 4Y15A 5BOXA 4A3FG 3ONQA 2MW8A 3BR5A 1Q1VA 3K6GA 2GXBA 5DD8A 1JGSA 2ECCA 2M4GA 2F4VH 4LG3A 5E25A 5FROA 5EEGA 5KFJA 1R9TA 2OAZA 1FMWA 5DGIA 1RR8C 1LEAA 1XMAA 4RGUA 2XASA 1IW7F 3PZPA 3HOXJ 4O5VA 4ENMA 1DIKA 3PVXA 4EQ5A 3F6VA 3GIJA 2RNGA 4A5NA 2Q2EA 3U9SA 4O3SA 2ZNZA 1LB2A 2R7LA 1RESA 4MGRA 3KP2A 2BQRA 1AWCA 2QBYA 1K7AA 4DOZA 1HNZH 4B3XA 2HQAA 2YW2A 3I58A 3FMSA 4ED7A 1B59A 2NS0A 4K6NA 3AL0C 1XC5A 2BYVE 1VS0A 2GQSA 2R8IA 1YRNA 1PJRA 1JUSA 3CCJI 4YQWA 4MQ9F 3SYTA 4Q5SF 5BPIA 1XGSA 2QENA 3BJAA 2DQLA 2MC3A 4FCYA 3DAAA 1IDZA 5C8YF 2FMAA 1DU6A 1MJAA 1HW1A 2MG4A 3ETHA 1LNWA 1SVLA 3T1BA 3V4SA 2Z5UA 3FIWA 3IHUA 4PZJA 1B6AA 4IR1A 4ITVA 2O6GE 5KG4A 3EUHC 2F4OB 1V51A 5CLSA 3J7AO 4PJJA 1TWAA 2W48A 5HNFA 2BOLA 2XF6A 4IF4A 2W6ZA 3H4BA 2CFXA 5FJ8G 3CO7C 5EWFA 1OCZH 3P9CA 2ZDQA 1LVKA 3R0JA 1A35A 4YAJB 3QWLA 3BTIA 3NARA 5JHFA 1Y1WJ 3WG9A 3UKGA 4BAYA 1UAAA 3RPQA 3PN1A 4YFNF 2CW7A 2ZXWH 4UV9A 5GTHC 1ZRFA 4FE2A 1WCMA 5FD5A 3RFCA 3VB2A 3T9FA 1O57A 3KFWX 4E7SA 1C0WA 2JWTA 3H5NA 5J1YA 3KXYT 1A36A 1E3PA 1ZG3A 5KK1A 2MYSA 2V9VA 5LHHA 4XLEA 2KLOA 1CQIB 4LG0A 2R4GA 3I59B 1P2FA 3M1EA 4QWQA 4H0EA 1JI8A 5KG3A 4BBSG 3AG1H 3OS1A 4LIVA 1J5YA 4O82A 1S7EA 5E3MA 3VPDA 1R22A 5DUIA 5IYDG 1BR4A 2XSJC 2O7OA 1GVDA 2R7MA 5HNEA 3X2QH 2BHZA 3MR6A 2Y9YA 1U0JA 4LJZF 2UWMA 1XMKA 4S05A 1YJWI 4IWYA 3RF2A 1YS6A 5KKNB 1P8LA 2VXZA 2LYCA 5ICGA 3O8HA 1FT9A 1S03G 3G1LA 1H88C 2Q0OA 2R85A 1HA8A 5A2QZ 1IO2A 1NTCA 1FVIA 3MR5A 1UCRA 3WGIA 3GTJA 2MLKA 4ABZA 4EGYA 1E4FT 4IRGA 2EZIA 4QPQA 3WTWC 2DZDA 2VBWA 3WTVC 4BHPA 2A61A 1ZR4A 2DFIA 2FD5A 4KIFA 5E3OA 5D6FA 4XN0A 3EUHA 2QKLB 2WB1N 1ZAOA 3MWEA 4RB0A 1I27A 2E1MC 3L2PA 3RBEA 1KTAA 2ISYA 1O75A 3PW0A 3RBDA 4MV8A 4GKKH 3GBGA 3OHBA 5H2FC 4JK1X 4D5FA 1T08B 2V1UA 1JTYA 2C28A 3H5AA 3N05A 2FK1A 2WB1E 1R49A 4I99C 4HNUA 4O7ZA 1QNTA 4A3GG 3E6BA 1WHUA 3K5IA 3ZQHA 1KEEA 2KIUA 5J1UA 5KS8A 2BE5F 5HVQC 1T33A 4M71A 3E5UA 5FRNA 1BA5A 1FTTA 3R60A 3JZ6A 2V9WA 2FSWA 4F4ZA 1S72I 2R7SA 3L09A 2Y0MA 4EJOA 1EYZA 1TWCJ 2Y31A 3P9KA 1TWHA 5KG6A 1D1BA 3T9EA 4BBRJ 4A93G 1EJ9A 2EJ2A 4RUCA 2JA6J 1JTXA 1WI9A 1WQ2A 3QP5A 4YR2A 1A0IA 3GFIA 1ZHFA 3WTTC 1DU0A 2FPIB 1X4OA 1O7FA 2EK5A 3I3LA 2YU9A 2AXTC 5DGAA 4A3EJ 4R1HA 1Y1WA 4RGSA 2Q2UA 3GVAA 3M3YJ 2HTJA 4BS9A 4G7HF 3P5JA 5D8LB 4FTHA 3OR1C 4XKCA 4GC7A 1Z7UA 2EIJH 4UV8A 5FLXK 1E3HA 4MFDA 4IOCF 1M0WA 1I6UA 2EA2A 4I0AA 2X9DA 4FISA 4C5AA 3Q8SB 1BI1A 5E1XA 2XVCA 4XKBA 1D1AA 4JP0A 4IRIA 2BXZA 2XHKA 4IKFA 3DEWA 1T38A 4G7OF 2VA3A 2AO9A 2GIZA 3KLOA 1IBLH 4LK0F 2NNYA 3EYYA 4A3GJ 4R8HA 1MBEA 4LF4H 2HG8A 3BG7A 1KJQA 4EG0A 2QSFX 3HOUJ 1OR7C 1RUOA 3N44B 1VQLI 3K70D 4E70A 2B0LA 1IN7A 3VFZA 3B73A 3GFLA 5J8CA 2C2EA 4BE1A 3W2AA 2WTFA 1WJFA 2HGSA 1F1ZA 4PJ0C 2ZDGA 3MKWB 3L7WA 3ECHA 3OMYA 2Y4RA 2IGOA 2RC4A 4KN4X 2UVRA 2UXDH 1MMGA 2LVSA 3IRQA 3JRGA 4JI0H 1VQKI 3C2GA 1PX2A 5CQGA 1VAJA 4UUTA 5CVUA 4DR3H 6PAXA 4PZ7A 2IP4A 3VOEA 2W25A 4EYHB 1ETYA 4LH6A 4IQJA 2OV7A 3FBNB 2E2IA 3KAJA 4JUZA 5FRMA 1I3AA 3ZPLA 3R5HA 3LOCA 5K7FA 2KRCA 5IT3A 1VF9A 2BVMA 4Q4CA 4FFRA 3AX6A 1ZELA 1MSFC 2IA2A 1UHSA 2FMYA 4KISA 1FP2A 1K61A 2F5EA 3HIFA 3OYDA 3PNVA 5LOVF 4QWDA 2UVWA 4CCNA 3VODA 1G4DA 3H35A 4G6DA 2QEXI 3GTQA 4FFNA 2ACJA 4DAAA 3ERMA 2DA5A 1V4YA 2GPWA 4YR0A 5EF6A 4CZZA 2BY3A 5FR9A 3MN2A 3L2QA 3CC4I 4I55F 3IWFA 3LL7A 4EEYA 1Y1WG 1VTNC 1PP8F 3EETA 1NK2P 3BZ6A 2YL2A 2VJIA 4BQNA 3R61A 3MAJA 2AU0A 2IGMA 5EGOA 1WKMA 2I10A 4DV3H 5I5XA 4O4HF 1BXRA 4G3IA 2DT7B 2DMNA 1Z9CA 4RGRA 1J7KA 3KTMA 1HSTA 4XLHA 2BY2A 1REPC 3W6KB 4DV5H 3H9QA 4N9HA 4A3MJ 3OSGA 1ZAUA 3N6XA 5HS7A 3HOZG 5KFDA 2CW8A 3A1YA 5GP9A 1TLHB 3I5UA 4QTRA 3CCMI 5IYBG 4AYBA 5DM6F 2JA7A 3T9BA 1O3SA 2V1NA 1YHQI 4EQQA 3DLAA 3FMRA 4UY8I 3U9TA 2YUSA 1ZK8A 2WY7Q 3OUZA 1IN8A 4IHXA 4AUXA 4UCTA 1U9OA 1GT0C 1DGWY 2WADA 3V4GA 1CKNB 2VL8A 1OMIA 2FU4A 1RC9A 1CGPA 3DU6A 2BY0A 2CYYA 2AGQA 3QRFF 2EV5A 4QLCU 3JRDA 1WRVA 2Q1ZB 2PLYA 2JSPA 4UVBA 1S9HA 4C30A 2E5ZA 3GTPA 3TW6A 1E4GT 3V8LA 2J6UA 1OLTA 1T0FC 4M72A 3VYUB 2VPQA 5KFXA 1X2MA 2VUMA 4L9TA 1RUNA 2NVYJ 4Y3OA 1FOXA 2W6MA 2O5RA 1ZYRF 5DM7F 1RR7A 4UCSA 3RTXA 1G6NA 5CJ9A 4L9JA 4LF7H 2E2IJ 4KITB 2VPSA 1Y0UA 4IJAA 2KZGA 1WJBA 2VIXA 4RAZA 3ZR8X 3N40P 5JVTA 4LLNA 2L0KA 2B7EA 3GO5A 2Z9OA 1A6QA 1MMDA 4NC6A 5GONF 4YIFA 1S97A 5CM0A 3HBLA 1FOYA 2DA1A 2H8WA 1OBDA 1L0OC 2K3FA 3OYCA 1ERDA 3H40A 5B5EC 3Q5FA 1K78B 1ETQA 2JRMA 4PGGA 2I8CA 3K1MA 5GPCA 4LB5A 2C00A 3ISPA 1JHHA 1B9NA 3DEEA 1YLFA 2GZWA 4G6TB 4ZH4F 4A3LJ 4FBTA 4ECVA 3NC0B 3PNTA 4D1QA 2NS7A 5E8GA 5K3WA 4ED0A 1YOVB 2ZSHB 4O3NA 4ECTA 1TL8A 4CE5A 1SD5A 4KDPA 4O7YA 1W1WE 2CNVA 1S7OA 3GWZA 5JUMA 1IZ1A 3JRXA 5CKTA 4DR7H 4WHXA 1J75A 4KFCA 1TP4A 1RJPA 3HTSB 3LWFA 4BNCA 2W6OA 4M3GA 2NU9B 5JI6A 2NOJB 1ONVA 1UG2A 2QGUA 3E7LA 3HOSA 1K4SA 1BI0A 4PJLA 5F0FA 4D5CA 1S68A 1ZG1A 5LGUA 4O2AF 4Q8EA 4DR1H 1MH3A 5ICFA 2YU9J 1WWXA 3ORQA 4F92B 3TEDA 3S2HJ 1KJ8A 2OCEA 4ETSA 4ECZA 4MQVA 4ECUA 1QPIA 4Y17A 2VUMJ 1UMQA 1R58A 3I54A 4HNTA 2ZJRF 1O3TA 1FJLA 1EKFA 1E0EA 5I5SA 4NXNH 4B3AA 4I7HA 2CNQA 1XDSA 4NUBA 1ZQ3P 4YR3A 3K4KA 4OX9H 2BBYA 1X4PA 3S32A 3QP6A 4YIRX 4RBOA 1MMAA 4B09A 3T1HH 4LF8H 4WXDA 2RQQA 3E5XA 3GV7B 2P5KA 3GLLA 3DTKA 1WJAA 3ASOH 3V6JA 3COAC 4O7SA 2A6TA 3EDPA 2ZGIA 4HV6A 5BYAA 1K83J 5C1PA 4Q43A 3HJEA 2HPIA 1H9GA 2ZJPF 4Q47A 5DG9A 2FKLA 5HLHA 2JVHA 2M30A 3RYPA 2XAHA 1Y1VA 2KRHA 3R0AA 4J9NA 1ENHA 3DF8A 3LP8A 3WE2A 4JV5H 4HNVA 1SCUB 1B1BA 3LSHA 4RAYA 4AYBN 5TRDA 2H27A 3A2KA 1GV5A 2J6TA 5IYBJ 1TWGJ 2NU6B 1PK8A 1ULYA 5DD4A 2Y0SE 3GIQA 1P9QC 2VOOA 3VYRB 1CS0A 4LSXA 4LD5A 3JAMZ 4F93B 4TVIA 5KFBA 4AWXB 1YS7A 5H80A 4YY3H 1N36H 2OA4A 3PO2G 3BY6A 4NHJA 1B8IA 2E34A 3NWSA 3FISA 1C30A 3RGZA 2C2DA 2JA7G 3SJMA 4O7LA 4PBCA 1MBFA 1RYSA 2XROA 4DBRA 5KG0A 4B3MH 3PM1A 2DODA 2W57A 1HSJA 2DFEA 1GSOA 5CE8A 2PMZE 3FKIG 4G7ZF 2VQHA 4II3A 4EM0B 2CQKA 3H0GJ 3ZMTA 1S8NA 2L02A 3KEQA 2HXIA 5AIQA 4DUZH 4JI3H 1S0OA 5GAHJ 2LKXA 2HWVA 2LKSA 3RSNA 2IAIA 2ZCWA 1KZHA 2GQQA 3UFXB 5TJJA 1BW6A 1XX5A 5FLVA 1DGRM 3GZ6A 2IEKA 3SXYA 2KZVA 5FFZA 1VQ5I 1VQOI 2ZMEC 3BABA 3E5NA 3W2VA 4U7CA 3DWLE 1ETOA 3BC8A 4MEYF 4ZQIA 2W24A 1M0TA 1R4NB 2WAQA 5KT3A 5BQTA 3OSPA 3G2BA 2VKHA 2XPWA 1D0ZA 4CMDA 2FBIA 4PDBA 5GADJ 3EPZA 2C35B 5K5OA 5I5TA 4FFLA 2JA8G 3J7YJ 4YELA 1MMSA 2LR8A 1CF7B 2VQFH 1DPRA 1X1BA 3CUQA 3FXUA 1YTYA 1YIJI 1XCVA 5GTIC 4FE4A 3HOZJ 4MV7A 2EQRA 2PVPA 4Y8VB 4IOAF 3GIPA 2V5AA 3T8TA 4XRFA 3U55A 2VBXA 3KP5A 4BE0A 1JKOC 3CC2I 1TAEA 4DR4H 5KFVA 4MTEA 2A07F 2YS7A 2UUBH 4HSRA 3I4MG 2E1OA 4AIKA 3GZ5A 3NBYB 5AONA 1JDEA 4DV4H 1ETWA 2UVUA 4RM2A 4WF2A 1QZYA 1TTYA 2EZKA 1V4RA 4O84A 3ZRGA 1PUFA 5HDKA 2R5ZB 4HQEA 5JHUA 5FLMJ 2HQRA 4DL3A 3BOQA 4B3SH 2P6TA 3BQ0A 1C3OA 3Q3SA 1N77A 1FNNA 5D6EA 1SD7A 1RJRA 1Z3XA 1ZARA 2P6SA 3WWJA 1YITI 2DOFA 3SZTA 4ZOLF 5JLXA 4DQ2A 3NBZB 2RN7A 4KNYA 1IG7A 2YZMA 3OY9A 3GLXA 3S24A 2RQPA 3V7CA 4MV1A 2OUMA 2QYOA 3A02A 2ZMEA 2XC9A 3P9IA 2OZUA 5H20A 3KYLA 2QSGX 2KIFA 3FXRA 1S0NA 5IPAA 3CDIA 2HHFA 2H6CA 3TO6A 2OU2A 1O3QA 2W6PA 4BXUA 3GDEA 3OUUA 2CH0A 1A9XA 3FDYA 5DTDA 3KYCB 3LSTA 4F50A 3U0GA 1XN7A 1TNTA 3MZYA 3ELKA 3G71I 5HV6A 2L7ZA 4J9OA 5KFEA 4A3FJ 1IRXA 3DFGA 2ICWG 3FWEA 1M7JA 5FKKA 4J9LA 3GMEA 3GX4X 4DZPA 3G8DA 3CQZJ 2XB0X 1K4TA 3JZIA 1TWCA 4A3CG 4HAMA 3E1SA 2QKMB 3FZVA 2IS1A 4ESBA 1TBXA 3ML6A 4AIJA 4C2UA 1JLLB 5D5VB 5DCMB 3K9TA 2R93A 2ZXIA 5LMNH 2ZKZA 3N4MA 3OWTA 2V79A 1VI0A 3B6CA 5IT9Z 1R36A 3FK7A 2W6NA 2M0CA 3JRIA 5I5UA 5J2UF 5IT9W 1TWGA 1F43A 1SD6A 1MBHA 5EDNA 3F8MA 3M1CA 3PO3J 1ZRDA 1W36D 4DNCA 2VBYA 2VJJA 2QSHX 2DIKA 1E2XA 3UNGC 4O7TA 5D5UB 2XDVA 2HGXA 2XAGA 2Y0SA 5C1OA 3ABUA 4EJTA 4BE2A 1Y56A 1DV1A 5HLGA 2MBFA 3OYJA 1UB9A 3R4KA 3TQNA 2JTVA 2HIXA 3QODA 1NH3A 2XAQA 4RM3A 2WB1A 1O3RA 3PW2A 4FX4A 4O4LF 4DZJA 4YFKF 1W5TA 4YBZB 1DP3A 5FPOA 5DLGA 4C2MA 5FLXW 3GTLA 3J81K 3LSRA 2UXBH 5DCFA 2HYJA 3BR6A 1HR0H 3VPRA 5D4RA 3BDDA 4A3IG 4CC5A 4U88A 4O7RA 4LSAA 2FB9A 5LFAA 3FKIA 2GA2A 4IL6C 3A0BC 3H3VK 2DDBA 1ZHSA 4DR2H 2R8KA 2HVQA 3KP4A 3BQ2A 3DPUA 2GOMA 2K02A 4IEJA 1PP7U 4EVIA 2WAQN 1DV2A 3LAJA 1ZQ7A 2R86A 2JA6G 2PFBA 4GGGA 4GLXA 2TRTA 2CV0A 3F9KA 4A3BG 4S0HB 3WTZA 3W1GA 2ID3A 1ETKA 1LFBA 4NYEA 4A3JJ 3U2RA 3OSNA 2LMDA 1A04A 1EH7A 1YQAA 2V4JC 2HPMA 3CVZA 2F5VA 2DQRA 1PUEE 1CKMA 4AIDA 2LY1A 2R5ZA 3UZBA 2EWNA 3CCRI 3HEFA 2VB6A 3S14J 4BXFA 4ZJZA 4BJTA 3MKZA 2JK3A 1Y0NA 4NZMA 3K2AA 4J9RA 3T99A 1HDPA 3HDDA 2XGDA 4IR9A 3BZCA 2EIKH 3Q0VA 5B3SH 3V8KA 4EGZA 2GM4A 1CQTA 4MNUA 9ANTA 1KU2A 5CVJA 4A2AA 5KFSA 4N4NB 3ORRA 2Y69H 2CW0F 1X1DA 2FBHA 1PVEA 2F2EA 2VBZA 3U1DA 5C3EJ 3IV5A 4JYAH 1B72B 4QWCA 1OCCH 1EH8A 2RAEA 3LFUA 5C44J 2NOGA 2ZBKA 5HOOA 5FO5A 2DYSH 3IAS2 2GLTA 2I80A 4UCRA 3OYIA 1SFUA 1RK5A 5E1ZB 4UNOA 1TQMA 2G7HA 2XIGA 3LSKA 2ABJA 1KUTA 2H09A 4A6DA 2JA8J 3ABMH 5HLIA 3T5HA 5J4VA 2Z33A 2E2JJ 2HHHH 1HNWH 2DLNA 4A3KJ 2EFWA 2RDPA 2DN0A 3T8RA 5KT5A 1QBJA 2FP4B 2UUAH 4F55A 4HDUA 1J59A 2ZXHA 1PDNC 1XSVA 2NVXJ 3WU1B 3QQAA 4JX4A 2M3AA 1IN5A 2RVCA 4KIBA 3TKYA 4YEJA 3T5KA 2WAFA 1ZTRA 2DFFA 4M9XA 1VQMI 2Z04A 3KX2A 4UUSB 3O8GA 1WFXA 3TO9A 4QIWN 4MV6A 4RDUA 1FOKA 2B63G 2IW5A 2Y2ZA 3C0FB 2OTLI 3M07A 3NEUA 2WWYA 1XCBA 1ZR2A 2W70A 4Y33A 5L9XA 1I3QJ 1N48A 3ZMDA 4DR5H 2Y9ZA 4HQ6A 2CV1A 3BG9A 4KUMA 3KHGA 1N78A 2DLLA 2VT3A 4X0GA 2A5YB 1R1TA 1E3OC 4LK1F 4DJAA 5H6QA 3KE2A 2YSRA 5LL6b 1HOMA 2XGEA 2FJ1A 3OIOA 5EZYF 1MNEA 3UZOA 1UFMA 4PZ6A 1DPUA 3HG9A 3GQCA 1OJLA 2RGRA 2A6HF 1Y6IA 1XB4A 3WGGA 3JR9A 4OMYA 1KJIA 4FFMA 2XF7A 3CLOA 4ON0A 1K78A 2GXGA 3IN5A 4C2MJ 5M5YJ 3FXMA 4BJ5C 4MA0A 5K7ZA 5BS6A 4DL7A 1QHHD 3LA3A 1MZBA 5I5YA 5M3FJ 1MSEC 5EWEA 3JSPA 2CJJA 5GAGJ 1HBXG 4FHTA 3BJYA 4B47A 2IRFG 3ZQGA 1VKZA 2W8LA 2CUZA 3DKWA 3CCSI 5I60A 4M0JA 4B48A 1EUDB 4A0XA 4AYBE 1YX3A 3MFKA 4QSHA 3W3CA 1TQIA 2CGPA 1Z1DA 1D5VA 2BV6A 4P1WA 4G9YA 4IRKA 4TV7A 4E4HA 2KIMA 5ERIA 5F64A 4QJFA 2LK2A 1FYMA 4EM2A 5BWWA 2FMLA 4HX4A 4MV3A 1TNSA 3NUAA 2ASLA 2AGOA 2M5WA 3DF7A 2CSOA 1F36A 3CLQA 1BGWA 4NZOA 1MNDA 1Z6RA 3ETJA 3MMYB 1AUXA 1KQ8A 4M3BA 2WDTA 5DS9A 2COMA 4DL4A 2DA7A 2VQEH 2QLZA 5LHIA 2BVLA 4ASNA 1HKTA 4NZNA 3GIKA 1XMQH 2HU9A 2DFHA 3FX3A 3DLLF 4XRMA 4A3CJ 1BJZA 1BBYA 4H4KC 4BJ6C 2CFMA 4FE7A 2J9GA 3GIDA 3QYEA 1X1AA 2WBMA 3G73A 3VEPA 2X6OA 4DR6H 1V5GA 4XYMB 2GAUA 2KDZA 1U8BA 4IHTA 4EM1A 2JQ7A 3TIGA 3K4JA 1IRZA 2ME6A 3MZHA 3OYMA 4AQYH 1N33H 5BPFA 3QOPA 2DW4A 2Z99A 4GYIA 1GV2A 1U3EM 1T8IA 1W0UA 1HW2A 3R5FA 4UCUA 1F5TA 4LH7A 2A6EF 2M7AA 2KJCA 2DMUA 4CMFA 3J7AK 2XRNA 4E7ZA 2M4KA 1Z67A 3HSFA 5D5WB 5L1KA 2TCTA 4LB6B 3HGGA 3RTRA 2XC7A 1K79A 4UUGA 1HKSA 2EJ0A 5FPRA 4D0PA 2DK5A 4O7WA 3PR5B 4Z6YA 3K0LA 3L00A 2K7LA 2ISZA 2HQNA 1FP1D 3KALA 3QAHA 4CUGA 4DRFA 2XRLA 5HLTA 1I94H 4KT5C 3IKTA 5KFOA 5DQGA 4FGRA 3IRRA 1JJ6C 4CCLA 4LF9H 1SMTA 5E18F 2JA5J 2DAAA 3DTIA 4LMYA 4PFOA 2V6EA 3RAQA 2IBKA 3HOYG 1P4AA 2MABA 2X4HA 1APLC 2YCHA 3AL0B 5DCMA 5T14A 2BR0A 5EEAA 1JJ8C 3FHZA 1TA8A 3T1YH 3LQRA 4LFCH 2NU7B 1I39A 1JT0A 4ZDOA 2OQGA 2WY8Q 3FBIB 3LSJA 4ECRA 2W84A 4P5OA 2O3FA 4GXOA 3F0CA 3QYFA 1MIJA 2NVTJ 3WNZA 1XS9A 5KAFC 2UXXA 3KEOA 4BGDA 2R7VA 3OS2A 3H3VH 3HRSA 2ADUA 3DPTA 1D8JA 2H1KA 1GSAA 2EIMH 2VPRA 3KLNA 3O2PE 4I0BA 4UB8C 1IDYA 5L1JA 4EMSA 4EBDA 3E5QA 2ALZA 4OU0A 3CF5F 2X0LA 4ECSA 3GJXB 1YI2I 5F9LA 1IUYA 4XL9A 2D1VA 1EKEA 1IUFA 2L7KA 2DPDA 3JAMK 1I1SA 2CQQA 3PIPF 5KHDA 4UUSA 4IX7A 2ME0A 3TQTA 3HB9A 3ERED 1WH7A 3W6VA 3ZQIA 3NWTA 2JA2A 2EA4A 2M2EA 4ED3A 1E4EA 2L9NA 4J00A 4WX9A 4AM3A 4RA2A 3OYLA 2B63A 3VWBA 4CA0A 1IOVA 2R0QC 4M7EA 3ZCOA 1M6VA 4Y7NJ 3Q1KA 2HDKA 2K9SA 3I59A 1I1KA 4O3MA 5AIPA 2P7VB 3I71A 1XNQH 1I1GA 3BLYA 3HRTA 4IHVA 1ETXA 3WE3A 5FNVF 4P55A 3N42B 5JLWA 4GRIA 2Z2SB 5HDNA 4IRHA 2W71A 1CE8A 1MBKA 3MR3A 1IC8A 3HOWG 5EG0A 3CMEI 2BQ3A 2X1DA 3LSIA 2YS6A 2ZJTA 4A3LG 5CVRA 2A68F 4L0YB 2R7KA 3R5XA 3O3KA 2OPTA 3OYNA 2UXCH 3CJQB 3V7RA 1R4MB 5LRRA 2CV2A 1G3YA 4Y13A 4EBCA 2VOPA 2UV1A 4WK8F 1IN6A 2F5DA 1G59A 3G8CA 4HN2A 2C2RA 4ZTFA 4CH7A 4HF0A 1YE9A 1FYKA 2K85A 1MMNA 4LIUA 2N8GA 4WCGA 3HGYA 2HXOA 3KREA 5TISC 2EJRA 4ZYGA 1BM9A 1RIOH 1FJGH 1R23A 5DDGA 1JX4A 4J0MA 3JW4A 4XYLB 5KFMA 2DA4A 2FNPA 2K27A 3WU2C 1IBMH 2R7ZA 3LSPA 5LEJA 4QWEA 2OLSA 1X3ZB 3WTXC 3W6JB 3H0DA 1YW8A 1FSHA 3BTLA 4JV2A 2RGVA 2PMZA 4XLPF 1EH6A 2FJZA 2D5VA 2VODA 3GTOJ 2GXAA 3ZN1A 5GPAA 2DJNA 3IC7A 1RNLA 2YS9A 3PSIA 1U9NA 3PW5A 1BI2A 3KAKA 3F72A 5E1WA 1IJWC 1T3NA 3FXLA 1EKPA 2IJLA 4IPAA 4F52A 4DQNA 5F9NA 4CGZA 2MCTA 4A69C 3T5LA 1T56A 5FKNA 3HHGA 5KT4A 5JVDF 4O3OA 2YZNA 1LFPA 4E7HA 2G0EA 4A93J 1EF4A 3OYEA 2WAQE 4APMA 5J40A 4BBRG 4L0ZB 1S6LA 3T9AA 2M34A 2X51A 1L2ZA 4I01A 1IV8A 3WTUC 3E6CC 3SI8A 1V5FA 1F9NA 1XGNA 3A0HC 4EFEA 3GV8B 3G6VA 2PG4A 1QVTA 2ZC2A 3K1NA 5L3CA 1NHAA 4C2TA 3U54A 3VYTB 4JI4H 2GIVA 5IOZA 3RQIA 2DBBA 4K2EA 5ILVA 4XRSA 5F04A 3K3PA 4I4TF 5FFXA 2AQEA 4I98B 3DQVC 4ENKA 1IYEA 3OHAA 1ZH5A 1TT0A 3DKYA 1LDJA 4CYCB 2E71A 3H9GA 4LFUA 4OOIA 1EHIA 2XUBA 3CCLI 3S1NJ 3PQKA 1SVOA 3K4BA 3TDUC 1ZLKA 1UZCA 1ACIA 1B9MA 2WTEA 1J09A 3WHCA 3BG6A 4CDGA 1DDNA 2LF8A 1OKRA 3PUBA 5L3GA 1HDDC 3RZOJ 3JRWA 3WO0A 4CKEA 3KHHA 2OD5A 4RAGA 3I55I 3REOA 4IZOA 1OCTC 1OBGA 4O83A 3HHHA 3K10A 3MWDA 3M9AA 3DTGA 5KFRA 4XORA 3QPHA 1OCOH 4PSWA 4Q48A 5F08A 1VQPI 3TO7A 2ZJ2A 2LKPA 4EEFG 3OV8A 3IWZA 4ED8A 1MBGA 3LSGA 1R00A 4NDLA 2D1HA 3S3OA 2ZNYA 4DV2H 2F6CA 2P0AA 2BEOA 3UQ8A 3E6MA 2M8GX 2Q8KA 3ZGKA 3C2BA 1JE8A 1BW5A 3HPGA 4HPQA 5D8KB 4G12A 5C4JJ 5KFFA 2E1CA 4Y52J 1YG2A 3L9FA 3NGDA 2RNJA 1VFCA 3KIOA 2M45A 3S2DJ 2W82A 3F3XA 5FKMA 3V4ZA 2QQBA 2NVYA 3DU5A 2IS2A 4MAMA 1KBLA 4UUVA 4AVPA 4DV1H 2NXNB 3IUOA 4ED6A 2KSWA 1X19A 2LSOA 4PJMA 1Z0XA 1CKOA 1R1UA 1N75A 2OCCH 3C1DA 4ENNA 1ZG5A 3FXKA 1U78A 1YW9A 3RPUA 3BCAA 2R8HA 2ZO4A 3RQ4A 2BY1A 1HNXH 2LY2A 5ILUA 3QYBA 5HBRB 1ZKGA 2UU9H 2YR2A 3TOAA 4M6YA 2FF4A 3G4SI 2DMQA 4B1RA 3OL3A 3S1RJ 4DL5A 2FLNA 3K69A 1YRNB 1USTA 3Q9SA 2IGKA 4B43A 1KONA 3PO2J 1OQYA 2HFHA 4CCJA 1R6RA 2HQ5A 4YJ3F 3BG5A 4A6EA 4E7IA 3DBRB 3KP7A 5L1IA 2L9VA 2IA1A 3CF2A 2EFPA 4OWRB 3VOTA 4WXHA 3IKVA 1K83A 1IYDA 3M7GA 4XLNF 4RB3C 1AOYA 5I5VA 3I4NJ 5DAAA 4YJ2F 1J2XA 2HS5A 5HDGA 3FK6A 4B3RH 2R7ZG 3OL4A 3GTMJ 3SZGA 4RB2C 1H89C 3QQMA 2R5YA 5ILSA 1SFXA 4IZZA 1IXRC 3ROUA 5LEKA 1JKJB 4TV9F 3OS0A 5J8FA 3CC7I 5K2MA 3BCBA 3CDHA 1XK5A 4ECYA 2R82A 2YRXA 2ZSIB 1POGA 5IYCJ 3Q0UA 2R7TA 2BQUA 5BYBA 2UUZA 3CJTB 2FOKA 4JOMA 2CQNA 4ZC3A 3HT5A 4Q4DA 1TC3C 1FYLA 3BROA 3MR2A 3RKWA 3RB0A 3J81W 2HDCA 1D5YA 2HYFA 2OF7A 4PCQA 1LPQA 2ASDA 4M9UA 1Q1HA 2R8JA 1Z3YA 4PGHA 3BA8A 2R92G 2RDIA 2ESNA 2DI3A 1BL0A 2LC2A 3K4MA 4EATA 1RK6A 2FLPA 2EFNA 4GCVA 3CMMA 1ULZA 3SEZA 2FLLA 3J7AY 4XM3A 4JI5H 2VI6A 2K40A 4A2UA 2KRFA 3J7ZI 1H8AC 4EV0A 1XPXA 3CD6I 5KFNA 3KHLA 1I50J 1RI7A 2JPBA 2W85A 3RKXA 2VE9A 2PN1A 5C4XJ 1VQNI 2A69F 5BNGA 4XRSG 1T39A 2W9CB 1BIBA 2JZYA 2VJ5A 5D1OA 4F4WA 1KJ9A 1JHFA 3QPSA 4V19K 1GSHA 2R87A 5EGOB 2W9CA 3LMLA 1WH5A 3CTAA 2VOBA 2V26A 5LA6F 5K7HA 2DTRA 1JGGA 1IN4A 2HZTA 2BW3B 2FUG2 2KIQA 5E17F 3Q8PB 5K5QA 2JUCA 2YWVA 3UR3C 1AKHA 4BQAA 3K2ZA 2EFQA 1D3YA 4C3JJ 3AKZA 5IYDJ 5BMVF 4PDKA 4RNOA 2UUCH 2QQ8A 4QIWE 5C4XG 5F6FA 4O86A 3CP8A 4YIIA 1YJNI 2GQRA 3PO3G 3FKJA 4EGJA 1I50A 4HX7A 3PW7A 2GWRA 2ELKA 3PIOF 4M9SA 1LDKB 3U1KA 3WU0A 1JUPA 2KT0A 5E79C 4LF6H 1G8XA 1W7PB 2HOTA 2E2HJ 1N32H 3HUGB 2ZDHA 2E36A 2MC4A 2LTPA 2PI0A 3S15J 3HOVG 4CHIA 4DW6A 4HR7A 3A01A 2HTSA 2M7BA 1HCRA 3RPUD 4CO8A 1GXPA 4UB6C 2UXNA 1QGPA 4PK4A 2AS5F 4RAFA 3S16J 3CUOA 2DCEA 2HHFB 2I87A 4BYYA 4ECXA 1RKTA 2XAJA 3GFJA 1XGOA 2QQ9A 4ZZLA 3BTJA 4DYQA 3K4CA 2LD5A 5KFCA 4C5BA 2DK8A 4M3EA 3GTOA 1EA3A 3GIMA 3RI4A 2ESHA 3FXJA 2CFOA 2JRTA 2DPUA 1ZGJA 4RGXA 4QW8A 4M9ZA 4A3DG 2BGCA 4MFEA 4E6NA 3GXOA 3H20A 3S8PA 4PWQA 4KICA 1I7LA 3ZN0A 4BKXA 1B6RA 4BDYA 4D9JA 1WRJA 3NRVA 4WBNF 2WAEA 3HOVJ 1RRJA 4Q0YA 1BR1A 2W6QA 3ZOBA 3GB8B 4O2BF 4Q4ZF 4WD3A 2L4MA 4BUPA 2KQRA 3CZ6A 5C44G 2YU3A 4FS2A 4BY7G 1T36A 4OIPF 3M8FA 2EILH 2V59A 2PJPA 4W97A 3N8DA 2R5YB 3C18A 2KFDA 1IOWA 3HO8A 4JI7H 3BT9A 1SAUA 5CQEA 4A0ZA 2DAOA 4RCNA 2Y0SN 5C3EG 4L5IA 1VQ7I 1Y1VJ 4AIHA 1Z77A 4DBQA 5IP6A 4BDZA 2R7RA 1LE8B 2W7OA 3HC7A 1BN5A 1H0MA 1MD0A 4B8XA 3BA9A 5IYZF 1LE8A 3F6OA 1J5EH 2FQ4A 4P96A 2NYXA 2YZGA 2XB5A 1WJCA 4GKJH 1JKQC 2L2OA 2KHMA 2QCOA 2JPCA 2QQAA 4V2FA 3ABLH 5KNLA 1JUMA 2IMWP 2DMPA 5KFHA 2NVUB 3IAM2 1B04A 4KHPH 3BQZA 4MO7A 3HL2A 1U2WA
chains in the Genus database with same CATH topology
2XF7A 3SDBA 4LH6A 4IQJA 3RIZA 2OV7A 3FBNB 4BJ5C 3KAJA 1UELB 4PJNA 4YHHH 2KP6A 1QHHD 2DT6A 5FRMA 1MZBA 1XMOH 3W5OA 3VSKA 1SYXB 2KRCA 2BVMA 3CJRB 4B47A 4C9YA 1Z2PX 5KCMA 1ZELA 2CUZA 3RGXA 5IWAH 3QOEA 4IAJA 4II2A 4KISA 1AA7A 4B48A 3OYDA 3PNVA 1YX3A 1Z2NX 4CCNA 5BR8H 3W3CA 3C2HA 3HKZA 3H35A 4P1WA 4CCKA 4DV6H 2E5NA 4E4HA 1V5EA 1N34H 2WA0A 1MW7A 5FD6A 3DF7A 1DGSA 3L2QA 4KJZA 2VPLA 1BGWA 1MNDA 3LL7A 3MMYB 2WDTA 1GYFA 4KT6A 2VQEH 4NC7A 2BVLA 2VJIA 4BQNA 1XMQH 1BR2A 2IGMA 4XOPA 4B3TH 4XNFA 2HU9A 4XMYA 2R7XA 2CFMA 4DV3H 4H4KC 4BJ6C 3OYBA 1X9NA 3VNNA 1XNRH 1BOBA 2DT7B 2K5CA 3QYEA 1X1AA 2WBMA 3E0JB 5TGTA 4XLHA 3OYHA 3K70C 4DV5H 3OIPA 3H9QA 4DR6H 1V5GA 2AQFA 3N6XA 4RB1A 1X1CA 1PYVA 4A2BA 3K4JA 2CW8A 3A1YA 3OYMA 4RLFA 5D1PA 3U21A 4AQYH 4AYBA 1N33H 4JQFA 4UCUA 2V1NA 3IG0A 4ZDPA 4LH7A 1BJTA 4U87A 3DLAA 3OIQA 2M7AA 4QPOA 3OYAA 2A5WA 3J7AK 2LH9A 4E7ZA 4JI8H 2M4KA 4XR6A 2WY7Q 3PL8A 4UCTA 2XC7A 3RTRA 1DQUA 1Z21A 1DGWY 2WADA 5FPRA 3L4KA 1CKNB 2Z16A 2VL8A 3K4LA 4DRFA 3KALA 4CUGA 3DU6A 5HLTA 1I94H 2Q1ZB 3KEYA 1WJEA 3CP2A 2JSPA 3HPHA 4MLOA 4CCLA 4LF9H 1S9HA 4C30A 3DTIA 2E5ZA 4PFOA 2V6EA 4FETA 4XONA 4HRIA 3MD2A 2MABA 1E4GT 3FMAA 2W00A 2YCHA 1OLTA 1T0FC 3FHNA 3AL0B 2JVGA 4IQ4A 3VYUB 2KPMA 2PJRB 1TA8A 1WJ5A 3T1YH 4LFCH 3RCOA 2HVRA 4ZDOA 3RJ0A 1D1CA 2WY8Q 3FBIB 3PSFA 4P5OA 2HNHA 4Y3OA 4BEHA 3QYFA 2O5RA 1GLNA 4UCSA 4ANJA 4ZTJA 3RTXA 4CC6A 4BGDA 4LF7H 1YX5A 4HG2A 4NQWB 4BEHB 1VZ0A 4KITB 3OS2A 2R7VA 3DPTA 3BAAA 2KDOA 2DOAA 1WJBA 2VIXA 3ZR8X 3N40P 4RAZA 2VXDA 4MV9A 3MKYB 4ZYAA 2IS4A 3W2WA 4E6KG 3TY9A 1SFKA 5D1OB 3TBIA 1MMDA 3GJXB 4J01A 3TY8A 4XL9A 2L7KA 5HNHA 2E1MB 4F91B 5KHDA 3OYCA 4IX7A 4FASD 1ERDA 3LSMA 2MD0A 2XAUA 4E7KA 3NWTA 2JA2A 4DIQA 2L9SA 2VLAA 2L9NA 4J00A 2CS3A 3DEEA 4BQQA 3OYLA 3VWBA 2VQLA 4G6TB 4CA0A 4XLCA 4BU2A 2R7OA 4PZ8A 2VKDA 4M7EA 3JAMW 3ZCOA 3PJRA 3NC0B 4JI2H 3PNTA 4D1QA 3H9JA 2K9MA 2ZSHB 3KYHC 1XNQH 3BLYA 3K3VA 3MWMA 3N42B 4BWSC 5CKTA 4GRIA 2Z2SB 4DR7H 3D5RC 5CPRB 4CCMA 2OC6A 3EUAA 3J80W 3L2VA 3IP4B 3ZXSA 1LKXA 2X1DA 2DJIA 3LSIA 2ZJTA 2NOJB 2IXSA 2LREA 1QU3A 3HOSA 3OYNA 4PJLA 2MFZA 3CJQB 1S68A 4XLFA 2HIVA 2CV2A 3S93A 4LF5H 4YRVA 2UXCH 2X85A 3CESA 2UV1A 4ZDLA 1G59A 2Q2TA 2VUGA 4ZTFA 4CH7A 1YE9A 4HSTA 4F92B 1MMNA 4ETSA 4LIUA 4UCVA 2VQCA 3I9V2 4HNTA 3LMLA 4XN3A 1CKNA 1FJGH 4NXNH 1E0EA 2LBFA 4I7HA 4J0MA 3V42A 4NUBA 4OAZA 2V7FA 1IBMH 3OOUA 2W1OA 3K4KA 3PNYA 1X4PA 3S32A 4CCOA 3QWUA 3T1HH 1MMAA 4LF8H 4LFAH 2RQQA 3H0DA 2RGVA 2KL4A 2PMZA 2R7QA 3DTKA 4X66H 1WJAA 3OTOH 3N41B 5DISC 2E5LH 2A6TA 2PJRA 4DV7H 2RREA 3PSIA 2HPIA 1K6YA 4XKWA 2IGNA 3HXLA 4BQOA 3ZQQA 4X65H 2JVHA 4XOTA 3KAKA 4EFBA 2HZDA 2KRHA 4F52A 3RR5A 2LOOA 2LG4A 3TY5A 2MCTA 4JV5H 3LSHA 4RAYA 3A2KA 1LFPA 4E7HA 1ZHQA 3OYEA 4APMA 4LSXA 1P9QC 3VYRB 4F93B 1WH2A 2X51A 3M4IA 1L2ZA 5LMUH 4YY3H 1N36H 2ZM6H 1V5FA 4EFEA 3NWSA 3RGZA 4PUSA 4LFBH 4AVZA 4C2TA 4JI4H 3VYTB 2X6YA 4DBRA 1Z7LA 3OYKA 3DKXA 3JSLA 2W57A 4B3MH 1TZLA 2VQHA 4II3A 4DGWB 4X62H 2JUGA 2AQEA 3DQVC 4JI3H 4UCOA 4DUZH 4AU7A 1TT0A 3DKYA 4UFZA 3RSNA 3OYFA 3H9GA 1P16A 1DGRM 3K4BA 2KZVA 3BABA 1UG0A 3H5RA 1J09A 3BG6A 3W2VA 4E6NA 3DWLE 3PUBA 3BC8A 2XF5A 4B44A 2IS6A 1M0TA 2X6WA 2WAQA 4DV0H 4NC8A 3K10A 3G2BA 2VKHA 2FE3A 1D0ZA 4JI6H 3W1BA 4LITA 4XORA 2X1EA 4PSWA 5A2QW 4PDBA 1AN7A 3EPZA 4F3QA 3A4CA 3D5LA 3D5SC 4YELA 3JSNA 2VQFH 2I8DA 3LSGA 1X1BA 2M0MA 3S3OA 4MV7A 4DV2H 2F6CA 2BW3A 4R79A 3UQ8A 3ZGKA 3DPLC 3L2UA 2P0WA 4BE0A 4DR4H 1TAEA 3HPGA 4HPQA 3SEQA 4MTEA 4E7LA 2UUBH 4HSRA 3ONQA 3K6GA 5LD2C 3NBYB 2W82A 2W7NA 4E7JA 2R7UA 4DV4H 4RM2A 2M4GA 3PFYA 2F4VH 3DU5A 4LG3A 2IS2A 3ZRGA 2R7WA 1W36C 2VJ4A 4DV1H 5FROA 3IUOA 4PSXA 2KSWA 1X19A 1FMWA 3OR2C 4PJMA 4XKVA 1CKOA 4N4OB 4B3SH 4LMYA 1N75A 1N77A 4RZQA 1Z3XA 3BCAA 3RQ4A 4EQ5A 2LBFB 1HNXH 2RNGA 2LY2A 3NBZB 2HDWA 3QYBA 1NG6A 3OY9A 3S24A 2ZFUA 4DUYH 1D0YA 2UU9H 4DOZA 2OUMA 1HNZH 4B3XA 3TL4X 2HQAA 4NNJA 3OL3A 3KYLA 2K3PA 3AL0C 2IGKA 1VS0A 3TMOA 2E60A 4B43A 1KONA 1PJRA 4CCJA 1R6RA 3F8NA 2X6XA 3GDEA 2CH0A 2ELJA 3SYTA 4E7IA 3FDYA 3CF2A 4OWRB 2Q2EB 2K9LA 3K4NA 4ITVA 3EUHC 1IRXA 3VSLA 4PJJA 4EEQA 5HNFA 4RB3C 2BOLA 2XF6A 4FM9A 2V9KA 1WJDA 3E1SA 2QKMB 4B3RH 3OL4A 1LVKA 3SZGA 2IS1A 4RB2C 3M8JA 4C2UA 5JHFA 4IZZA 1UAAA 3OS0A 2L5QA 2ZXIA 5LMNH 3BCBA 1XK5A 3PN1A 3OWTA 2CW7A 2ZSIB 4MTDA 5FD5A 2R7TA 2UUZA 4E7SA 4ZC3A 4JOMA 2OWOA 3H5NA 3KXYT 3M1CA 2DXIA 1W36D 2MYSA 2VJJA 3J81W 4XLEA 2KLOA 2R4GA 3UNGC 1JI8A 4U7BA 2XDVA 2Y0SA 3OS1A 4LIVA 4DR1H 2O03A 2VASA 4BE2A 3S3MA 1Z3YA 1Y56A 3BA8A 1BR4A 2XSJC 3OYJA 2LC2A 3K4MA 4HEA2 4EATA 2HIXA 3N43B 2CMPA 3QODA 1U0JA 2F4IA 3CMMA 2WB1A 4RM3A 2UWMA 3SEZA 3J7AY 4XM3A 2W4SA 3HOTA 4JI5H 3RF2A 5IT9W 1P8LA 1DP3A 2VXZA 5FPOA 1FMVA 2LYCA 2KMUA 5FLXW 1S03G 2UXBH 2Z1DA 1HA8A 1HR0H 4Y4RA 1FVIA 4CC5A 4LSAA 5LFAA 3VYSB 1E4FT 4QPQA 1ZHSA 4DR2H 2VJ5A 2HVQA 5D1OA 3DPUA 2GOMA 3EUKL 2VOBA 2V26A 4XN0A 2QKLB 2BW3B 2FUG2 2VQGA 4RB0A 2E1MC 3L2PA 2WYOA 3UR3C 1O75A 4GLXA 4GKKH 3GBGA 3F9KA 3AKZA 2CV0A 3W1GA 2UUCH 5EOYA 4XLAA 3CP8A 3H5AA 3N05A 3FKJA 2HPMA 2V4JC 3CVZA 3LMMA 4HNUA 2F5VA 1CKMA 1IBKH 1LDKB 2LY1A 4LF6H 1G8XA 4RLQA 2VB6A 2GOXB 2LRDA 4BXFA 1N32H 3HUGB 4ZJZA 4BJTA 2MC4A 5HVQC 1XDNA 3MKZA 4R7RA 1D0XA 2M7BA 5FRNA 3RPUD 3L2RA 2WE6A 2R7SA 1Z2OX 1QHGA 4PK4A 4A2AA 4N4NB 1D1BA 2DCEA 1X1DA 3DTEA 3S3NA 4JYAH 3K4CA 3L4JA 1A0IA 3LFUA 1X4OA 5HOOA 3I3LA 3IAS2 1EA3A 4UCRA 3OYIA 2CFOA 2Q2UA 2XIGA 4BS9A 3LSKA 4X64H 3OR1C 4RMNA 4XKCA 3H20A 3S8PA 2HHHH 1HNWH 2HVSA 1M0WA 3L2WA 4D9JA 4BDYA 1I6UA 1SEIA 2UUAH 4F55A 2WAEA 4BL0B 4Q0YA 1BR1A 4XKBA 1D1AA 2ZXHA 4IKFA 3GB8B 4BUPA 3CZ6A 2KQRA 2M3AA 1NG7A 4YEJA 1IBLH 2WAFA 3EYYA 3KX2A 4LF4H 1WFXA 2CUJA 3BG7A 4JI7H 1OR7C 1SAUA 5CQEA 3C0FB 3N44B 2X1CA 3K70D 4BACA 4Y33A 4DBQA 4BDZA 2VPSA 2R7RA 4DR5H 2CV1A 3HC7A 3VDXA 4BE1A 3BA9A 1N78A 1J5EH 3W2AA 4X0GA 1WJFA 2HGSA 3MKWB 4CSWA 4DJAA 4OAYA 4XQFA 3OYGA 1WJCA 1FKAH 3OMYA 4GKJH 4K0KH 4JI1H 2L2OA 2KHMA 2IGOA 5LL6b 5KNLA 3AFHA 1T95A 1MNEA 4CZCA 4OX9H 4PFPA 1MMGA 4PZ6A 3IAM2 2UXDH 3HG9A 4JI0H 3C2GA 1V9PA 5CQGA 2RGRA 1B04A 4NXMH 4KHPH 4DR3H 1Y6IA 3HL2A 4PZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VS0 A;  5DIS C;  2HVR A;  4LH7 A;  1A0I A;  1DGS A;  3W1B A;  4LH6 A;  1S68 A;  1XK5 A;  2HIV A;  3GDE A;  3PN1 A;  4UCS A;  3RTX A;  3JSL A;  4UCT A;  1FVI A;  1CKM A;  4UCR A;  4CC6 A;  4CC5 A;  2Q2T A;  1CKO A;  2VUG A;  3BAA A;  4PZ8 A;  3W5O A;  2Q2U A;  4EFB A;  5FPR A;  3NC0 B;  5FPO A;  2OWO A;  1CKN B;  3JSN A;  4UCO A;  3RR5 A;  4UCV A;  2HVQ A;  2CFM A;  5D1O A;  3BA9 A;  4DRF A;  4UFZ A;  1XDN A;  3TY5 A;  4EQ5 A;  1CKN A;  1X9N A;  2HVS A;  3KYH C;  3NBZ B;  3TY9 A;  3VNN A;  3UQ8 A;  5D1O B;  1P16 A;  3GJX B;  3S24 A;  3TY8 A;  4EEQ A;  1TAE A;  3BAB A;  3BA8 A;  3GB8 B;  4E6N A;  3L2P A;  3QWU A;  2HIX A;  4PZ6 A;  4GLX A;  1V9P A;  3NBY B;  5D1P A;  1B04 A;  3W1G A;  4EFE A;  4UCU A;  1TA8 A;  4PZ7 A;  1P8L A; 
#chains in the Genus database with same CATH topology
 3SDB A;  4L5J A;  4I02 A;  4A0Y A;  1IAW A;  1OR7 A;  3RIZ A;  2YZL A;  2V4Q A;  1A6I A;  1UEL B;  4HDV A;  3FMQ A;  1FBQ A;  1OYI A;  1WZ2 A;  3LAP A;  2VON A;  4YHH H;  5EYR A;  1XSD A;  1R5H A;  1SYX B;  3CO6 C;  4C9Y A;  1KYZ A;  4XK4 A;  4I09 A;  4N0B A;  3RGX A;  5IWA H;  3QOE A;  2VQD A;  3HUG A;  4II2 A;  5ICE A;  3JTH A;  1AA7 A;  1YFH A;  3CCV I;  4BY1 J;  4M6V A;  2R8G A;  1R7J A;  1LUJ B;  2GBY A;  1X1P A;  3HKZ A;  1SC7 A;  1N25 A;  1SD4 A;  1FBS A;  4CCK A;  2E5N A;  3BR0 A;  1I6X A;  1V5E A;  1JKP C;  1P4X A;  4KMF A;  1N34 H;  1MW7 A;  2FNA A;  2LP0 A;  5F27 A;  4A3I J;  5DV5 A;  5DYM A;  5JFR A;  2CZG A;  1YO5 C;  5IY5 H;  4KJZ A;  2BXY A;  4KT6 A;  1QZZ A;  4NC7 A;  2MSY A;  1BR2 A;  1JXS A;  5JQW A;  4XOP A;  4XNF A;  1TT5 B;  3TW7 A;  1X9N A;  1BJA A;  5K1Y A;  1XNR H;  3KZZ A;  1JKR C;  2K5C A;  4IVN A;  4QWB A;  3K70 C;  2HKO A;  1HC8 A;  3OIP A;  3TOB A;  1I2K A;  1PYV A;  3ZP5 A;  4HZF A;  4QIW A;  5D1P A;  1T0F A;  3U21 A;  5LRS A;  4JQF A;  3H3U A;  4HOB A;  4R8U B;  3H4D A;  4U87 A;  2DYR H;  3OIQ A;  4QPO A;  3WTY C;  4JV0 A;  1DUX C;  2A5W A;  4R8U A;  4FBU A;  4I76 A;  3RYR A;  3VPC A;  3PL8 A;  2JEI A;  3RB3 A;  3GCM A;  2HGC A;  1Z21 A;  2BHY A;  2E35 A;  5KX5 F;  5DG7 A;  3QZ7 A;  3CSW A;  3L4K A;  1LFU P;  2QM3 A;  2Z16 A;  1MDM A;  3A01 B;  2P4W A;  3CDL A;  1FWZ A;  3BR3 A;  4GO1 A;  4KIG A;  2ZME B;  1Z6T A;  3KEY A;  1WJE A;  3HPH A;  2Y48 A;  1KU3 A;  1S7A A;  4HF1 A;  3CCE I;  3T0Y A;  3MD2 A;  4HRI A;  4BBS J;  1DAA A;  1FY7 A;  2JN6 A;  3FHN A;  1XG1 A;  5DUK A;  4IXA A;  2QK4 A;  3FM3 A;  1T94 A;  2W8K A;  3RCO A;  2HVR A;  4TUY F;  3RJ0 A;  3PSF A;  2XKP A;  2ZJQ F;  2NRA C;  3DCF A;  2B9S A;  1FIP A;  1GLN A;  2CNU A;  4CC6 A;  2EZL A;  5CVI A;  2IVM A;  1YX5 A;  4HG2 A;  1YIO A;  4NQW B;  1VZ0 A;  3CCU I;  3OSF A;  1FTZ A;  1E4E B;  3BAA A;  2KDO A;  1YYV A;  3AYH B;  3ABT A;  4GYG A;  2VXD A;  2DA3 A;  2XGQ A;  3B6A A;  3MKY B;  4ZYA A;  2IS4 A;  4E6K G;  5FJ8 J;  3TY9 A;  1FZP B;  5KFQ A;  5D1O B;  4TM5 A;  2KIS A;  3PW4 A;  3ZQL A;  3RIR A;  2PMZ N;  3VMM A;  5BWV A;  5E8I A;  4OIN F;  4ED1 A;  4IHY A;  2EB7 A;  2E1M B;  4FU0 A;  5K5R A;  4F91 B;  2JEG A;  3PUF A;  1J0R A;  2KKO A;  4X1E A;  2XV4 S;  1UC9 A;  1Y8R B;  1QA6 A;  1JT6 A;  5EG0 B;  4E7K A;  5KVR A;  4GC6 A;  4S04 A;  3LA7 A;  2VLA A;  3OOP A;  3E6D A;  3AAF A;  1EV7 A;  1K1S A;  3AG3 H;  3HRU A;  1Y8Q B;  4XLC A;  4HQM A;  2R7O A;  2F4M B;  3MZ8 A;  4JX5 A;  4BU2 A;  3N97 A;  3M4O J;  3PJR A;  3JAM W;  2ZXJ A;  5DLF A;  5DG8 A;  3I56 I;  4JI2 H;  3MCZ A;  5KAI C;  3H9J A;  2XGC A;  2DPJ A;  1X58 A;  4ZYH A;  5E3L A;  3K3V A;  2X0S A;  3GTG A;  1B33 N;  4O3Q A;  3MWM A;  5L3E A;  4BWS C;  2C22 A;  2DOE A;  2CQY A;  3TDZ C;  3EUA A;  3J80 W;  1S3J A;  1W7P D;  3IP4 B;  2ECB A;  3ZXS A;  5LBQ A;  4DLK A;  3G6X A;  1KQ0 A;  2DJI A;  2JJ7 A;  1G2W A;  3BQ1 A;  5LGT A;  2IXS A;  2LRE A;  1KU7 A;  3CQZ A;  1QU3 A;  1T98 A;  3IH2 A;  2MFZ A;  3FDS A;  1W0T A;  3S93 A;  3GEZ A;  3JRA A;  4LF5 H;  2CQX A;  2M05 A;  5LXT F;  3CES A;  1CF7 A;  1S5L C;  2VUG A;  3BR1 A;  4HST A;  4C3I J;  4EGQ A;  2FQ3 A;  4G6Q A;  2TDX A;  1G3S A;  3I9V 2;  3RDI A;  3LNQ A;  4U0Y A;  1CKN A;  2LDU A;  2E7X A;  5DQH A;  2LNB A;  2XCA A;  1TW3 A;  4XID A;  2ASJ A;  2V7F A;  4YP3 A;  4NLG A;  2W1O A;  3PNY A;  4CCO A;  3QWU A;  5IT9 K;  2B63 J;  2PBZ A;  1U5T B;  5EJC A;  3RV4 A;  2AQ4 A;  4YAK B;  1QRY A;  3OTO H;  3R23 A;  4X66 H;  4J9Q A;  3G6E I;  5JVL A;  1WCM J;  4BXX J;  1FIA A;  2RRE A;  3KZI C;  4KA4 A;  2IGN A;  3HXL A;  3EQL F;  4BQO A;  3ZQQ A;  5J4Y A;  2XCL A;  1UHM A;  4XOT A;  1VQ8 I;  3T5X A;  4EFB A;  2HZD A;  3RR5 A;  2LOO A;  2HDD A;  3S1M J;  4F4X A;  1BC7 C;  2LG4 A;  5BWX A;  3PQJ A;  5KFL A;  1B6S A;  1ON1 A;  3O6B B;  1TWA J;  5LGN A;  3CMY A;  1ZGW A;  1T2K A;  1ZHQ A;  5CB4 F;  4BHB A;  2CKZ B;  2ODT X;  1MH4 A;  2CUE A;  2QUF A;  4HLY A;  2EPF A;  2FXA A;  4OMZ A;  3HTU A;  5CAE B;  3S2W A;  3M4I A;  5KFU A;  2KJB A;  3LUL A;  1B72 A;  2JA5 G;  4O3P A;  1U5T C;  5FB2 A;  4I2O A;  2L7F P;  4NBQ A;  5KT7 A;  5IOY A;  3EPG A;  2GPS A;  3OYK A;  2E7W A;  1Z7L A;  4HX8 A;  3DKX A;  5DGB A;  2J6S A;  3WHB A;  3H3Z A;  1TZL A;  1CQJ B;  1T6S A;  5BPH A;  4AD9 A;  2GLO A;  3DBH B;  4DGW B;  4XSZ F;  2JUG A;  3GUD A;  4G94 A;  1R9T J;  4X62 H;  3EPI A;  4UCO A;  4AU7 A;  5F1J A;  1W96 A;  1FX7 A;  4V2G A;  3HOX G;  2BZT A;  3TII A;  2O61 A;  1A3G A;  4YFX F;  2YPR A;  3BR2 A;  2JA6 A;  3BWG A;  3H5R A;  2NUA B;  2R3S A;  5KFY A;  1MJB A;  3FF5 A;  1STZ A;  4MA5 A;  2XF5 A;  4B44 A;  1XDU A;  2A3S A;  2IS6 A;  1W5C C;  3ECO A;  4HV5 A;  1UC8 A;  2HI3 A;  2FPP B;  2YX4 A;  3G6Y A;  3TEK A;  2FE3 A;  5E3N A;  1J9I A;  2O0Y A;  2GA1 A;  2FK2 A;  1P7I A;  5A2Q W;  2QA4 I;  3MKL A;  1S0M A;  4F3Q A;  1A0G A;  2VKE A;  3A4C A;  3D5L A;  1EKV A;  1KT8 A;  5CA0 F;  2OBP A;  4M73 A;  3QPT A;  3JSN A;  2V6C A;  2E1N A;  3CCQ I;  2PMH A;  5ED4 A;  2M0M A;  3GTM A;  1KYW A;  3FKI J;  4R79 A;  2K4B A;  4QWA A;  4A3M G;  2ELH A;  3DPL C;  5EZH A;  2P0W A;  3PFI A;  4D7M A;  2P7C B;  1S10 A;  2D2W A;  1K6O A;  1Z05 A;  2QBY B;  4ZZD A;  2F5C A;  4ZYD A;  5LD2 C;  3GTL J;  5F0H A;  2W7N A;  3IH4 A;  5FKL A;  4E7J A;  2R7U A;  1U5T A;  2V58 A;  2L01 A;  4FQG A;  3I0T A;  2CQ7 A;  3PFY A;  1P4W A;  3GTG J;  5I5W A;  5HS9 A;  2FK3 A;  3TP3 A;  1WGX A;  2MGQ A;  2R7W A;  3JRE A;  1XTA A;  2FOW A;  2VJ4 A;  1W36 C;  2R93 J;  1EZ1 A;  4PSX A;  3ZMV A;  4O7N A;  3DEU A;  3GII A;  5GAE J;  3OR2 C;  4XKV A;  4N4O B;  2H1L A;  4Z2Y A;  3GLK A;  5KFP A;  1W4M A;  5CVV A;  3BAC A;  4CIC A;  3F21 A;  3CUQ C;  4RZQ A;  5L3B A;  3BPX A;  3BPV A;  2LBF B;  2COB A;  4KMU X;  3D0S A;  5IP7 J;  1OYW A;  2HDW A;  4OIO F;  3SDG A;  1NG6 A;  5B66 C;  2ZFU A;  1SMY F;  4DUY H;  1D0Y A;  2CWE A;  3CEB A;  2MH2 A;  3BZK A;  1XMX A;  3TL4 X;  3L1P A;  1KJJ A;  3SNO A;  3KPH A;  1V54 H;  2YYA A;  4NNJ A;  3RZD J;  2R92 J;  2K3P A;  1ZET A;  2WC2 A;  1I3Q A;  3ESW B;  2E60 A;  3TMO A;  4UXN A;  3F8N A;  2HYG D;  2X6X A;  3QU6 A;  2ELJ A;  3GTK A;  3HSR A;  5LP6 F;  4FFO A;  3K7A J;  1XSX A;  4J9P A;  3T9D A;  3KP3 A;  2PN6 A;  3MQ0 A;  2Z02 A;  5KG2 A;  2Q2E B;  4DYR A;  2K9L A;  4ME6 A;  3JCU C;  4IRD A;  2FRH A;  2FPG B;  2Y75 A;  2J5P A;  2NVX A;  2NS8 A;  3K4N A;  1LQ1 A;  2NU8 B;  4ESJ A;  3VSL A;  2NNN A;  2RF4 A;  1KGS A;  1ZLJ A;  4EEQ A;  3JTG A;  1ITY A;  2X48 A;  5L3D A;  3WGH A;  3RV3 A;  1LJ9 A;  3GV5 B;  4FM9 A;  3V7S A;  4BH9 A;  5KFW A;  2FX0 A;  3KCC A;  2V9K A;  1WJD A;  2V1D A;  1S9F A;  3RUP A;  2M1B A;  5J1R A;  2V4R A;  3M8J A;  1HKQ A;  2CO5 A;  3VA7 A;  3H0G G;  2V1X A;  4EBE A;  2QZ8 A;  2W9B B;  2L5Q A;  4JXU A;  3RB4 A;  3T54 A;  1W5S A;  3F8B A;  3N6R A;  2R84 A;  3I4P A;  4MTD A;  3SE7 A;  1I7N A;  2RDJ A;  1HF0 A;  5H6R A;  5M5W J;  2EZH A;  2OWO A;  1G3T A;  2DXI A;  1BNC A;  2Y30 A;  3LA2 A;  5EEH A;  1Y1V G;  2M8E A;  3HOY J;  2AGP A;  1FPQ A;  1QQI A;  4U7B A;  4EJV A;  3JRH A;  3H92 A;  2W9A A;  2PMU A;  2PQ8 A;  2O03 A;  2VAS A;  3S3M A;  4WXC A;  5KFT A;  1TQP A;  3DBL B;  3MEX A;  4HEA 2;  3N43 B;  2DMT A;  2CMP A;  4TQS A;  2IA6 A;  2F4I A;  2QB5 A;  3K5H A;  3GIL A;  2EFO A;  3MFI A;  2W4S A;  3HOT A;  1A5J A;  1LDD A;  1S29 A;  1FMV A;  2XAF A;  2KMU A;  1FLI A;  2Z1D A;  4JYK A;  4ENJ A;  4GFB A;  3HSE A;  1ON2 A;  1HQC A;  4Q45 A;  4Y4R A;  4HF2 A;  2EH3 A;  3AW8 A;  2CRG A;  2EBI A;  1WCM G;  4BXX G;  5LYJ F;  3VYS B;  1HW5 A;  2LF7 A;  5D4S A;  5M3M J;  2DA2 A;  1QO0 D;  4A3E G;  1BIA A;  2COI A;  3RB6 A;  3EUK L;  3RJP A;  2O8X A;  4OIQ F;  2W7P A;  4CKC A;  4D7N A;  1E17 A;  3MFH A;  2H6B A;  2VQG A;  4O3R A;  3A03 A;  2WYO A;  1OIS A;  2L3D A;  3HRM A;  2XCP A;  3UYY A;  5EOY A;  5HS8 A;  2HJW A;  4IRC A;  4XLA A;  1RZ4 A;  2DPI A;  3SQN A;  3M9M B;  1KU9 A;  3R9R A;  2LY9 A;  3LMM A;  1IF1 A;  4IIJ F;  4ESF A;  3ABK H;  1WSU A;  1IBK H;  1RPW A;  3L2C A;  4RLQ A;  4ECQ A;  2GOX B;  2LRD A;  4L9N A;  2EIN H;  3SFI A;  1ZN2 A;  1XDN A;  1KQ9 A;  4RS8 A;  2HEO A;  4R7R A;  2P5L C;  3CJN A;  1D0X A;  3QU3 A;  1JIH A;  1OYY A;  1V3F A;  4O81 A;  3HZJ A;  3BG3 A;  4FX0 A;  3L2R A;  2WE6 A;  1Z2O X;  1QHG A;  1R71 A;  1OCR H;  2HR3 A;  4OIR F;  3FM5 A;  4CXF A;  5J47 A;  5BWU A;  2VC0 A;  1HXD A;  3DTE A;  4LLL A;  2R93 G;  3GZN B;  3S3N A;  3ZQF A;  4L18 B;  3L4J A;  1B8I B;  2EV0 A;  1HLV A;  3DV8 A;  1IXS B;  1YW7 A;  5FGM A;  1OWT A;  2XGP A;  2IA0 A;  2VN2 A;  2NVQ J;  2FBK A;  4CYD A;  1G2H A;  3BJ6 A;  2O8K A;  2STW A;  1GLV A;  4RMN A;  2XSD C;  4X64 H;  3B02 A;  1VQ9 I;  4HBL A;  2PEX A;  1UJ8 A;  2HVS A;  5E20 A;  4A5M A;  2HOA A;  2I5U A;  3Q8Q B;  3ASN H;  3L2W A;  5DGH A;  1DP7 P;  1SEI A;  1EUC B;  1RET A;  3JZF A;  4BL0 B;  2DTZ A;  3TIN A;  2WV1 A;  3S1Q J;  3QFF A;  4O7V A;  3J81 Z;  4BY1 G;  1NG7 A;  3R6S A;  3F23 A;  1AU7 A;  1UHW A;  3ZQ7 A;  4ED2 A;  3I53 A;  3V6K A;  3KP6 A;  1H9T A;  3HKZ N;  2D45 A;  1GVJ A;  3KET A;  3LFK A;  3MJF A;  2CUJ A;  2FA5 A;  4DL2 A;  3SHF A;  1MKM A;  4C5C A;  1P92 A;  2VE8 A;  3V8J A;  1MJ9 A;  2XD4 A;  4U7D A;  2QYZ A;  2X1C A;  3F8F A;  1IRF A;  4U0W A;  2UVV A;  5J6X A;  3ZQC A;  4BAC A;  4RZR A;  2STT A;  2LLK A;  1YJ9 I;  4NQW A;  3ULQ B;  5IYC G;  3C3W A;  3VDX A;  1SEU A;  2Z3Y A;  3HKZ E;  2E2H A;  3TP0 A;  1SFO A;  3I4N G;  3HYI A;  1SVM A;  4CSW A;  4OAY A;  4XQF A;  3OYG A;  1FKA H;  2R7F A;  4K0K H;  1VQ6 I;  4JI1 H;  3ZMU A;  5IP7 G;  5KFI A;  3AFH A;  1BI3 A;  1T95 A;  4A3K G;  4CZC A;  1RJQ A;  2VKV A;  4PFP A;  1RKW A;  1TWF A;  4NXM H;  1V9P A;  4HYE A;  1SAX A;  1SFE A;  2MH9 A;  4LFB H;  3DXJ F;  1IRG A;  1N56 A;  4J9S A;  5LHG A;  4IHW A;  4YB8 B;  1Z91 A;  4RUA A;  5KT2 A;  4F4Y A;  4PJN A;  3M8E A;  3IL2 A;  2KP6 A;  2DT6 A;  1Y39 A;  1XMO H;  1L3L A;  4IWX A;  3WO1 A;  3W5O A;  3HOU G;  3VSK A;  1FEX A;  4B4C A;  3CJR B;  2ETH A;  4L1K A;  5KFA A;  2CUF A;  3I64 A;  5BMZ A;  1Z2P X;  2G7U A;  1FBU A;  5KCM A;  5KFG A;  5KT6 A;  5FLM G;  4IAJ A;  2X5R A;  3KZY A;  1P6R A;  1Z2N X;  1TWF J;  3ZMS A;  1I1M A;  5BR8 H;  1VQ4 I;  3C2H A;  3Q2O A;  4I50 F;  1B4A A;  4Q8F A;  4JV1 A;  2UZK A;  4DV6 H;  5A2Q K;  4JBA A;  4MV4 A;  5D8D A;  1JXL A;  1BOA A;  2WA0 A;  1U8R A;  5FD6 A;  2DDA A;  4XZ3 B;  3H36 A;  1BC8 C;  4EJW A;  5B1B H;  1ODD A;  2P81 A;  3C7J A;  1USS A;  1DGS A;  3LQS A;  3RKY A;  3HOW J;  2VPL A;  1R5I D;  4IHJ F;  2IP2 A;  4XX0 B;  1GDT A;  4HW0 A;  1GYF A;  4DYC A;  3I12 A;  1AHD P;  4B3T H;  3Q0W A;  3GTP J;  4XSX F;  4XMY A;  2R7X A;  2QVO A;  4M6X A;  4A3D J;  3OYB A;  2DA6 A;  1MDM B;  3VNN A;  1BOB A;  4W1U A;  3K1P A;  2VC1 A;  5JVG F;  3DTF A;  3E0J B;  5TGT A;  3OYH A;  3PFF A;  2LFB A;  1SFO J;  2AQF A;  3G1O A;  4RB1 A;  1F4K A;  1X1C A;  2YRW A;  4A2B A;  4FT8 A;  3WWH A;  2AHQ A;  5IP9 G;  1GUU A;  1WI3 A;  4RLF A;  5DEQ A;  1KC7 A;  4IHS A;  3H0G A;  5M5X J;  3HM5 A;  2JSC A;  4ZDP A;  2QWW A;  1BJT A;  3IG0 A;  2CU7 A;  4LLG F;  3OYA A;  4DL6 A;  3WG7 H;  2LH9 A;  3NAU A;  4IO9 F;  4JI8 H;  4XR6 A;  5JQG F;  1FSE A;  2JA7 J;  3SGI A;  1XD7 A;  1DQU A;  2RKH A;  1O7L A;  3J80 Z;  3MVP A;  3K4L A;  3SZP A;  5D5X B;  4RU9 A;  4YG2 F;  1GO3 E;  2FEZ A;  4WWC A;  2L7M P;  4ZI7 F;  4MHG A;  2OH2 A;  3Q8R B;  3WTS C;  4CYC A;  5KFK A;  3CP2 A;  2PBI A;  2VR1 A;  1VND A;  4MLO A;  3RKQ A;  3LWB A;  1WVR A;  3VPB A;  3FMA A;  4FET A;  4XON A;  1AUV A;  2ID6 A;  2W00 A;  1M1E B;  2HOE A;  2JVG A;  4IQ4 A;  3Q9V A;  1ZRE A;  2KPM A;  2PJR B;  2W9B A;  5LLQ A;  1WJ5 A;  2R6F A;  1X3W B;  4EYI B;  1D1C A;  4MEX F;  4F7Z A;  2HNH A;  4L9V A;  3ZMZ A;  4BEH A;  5KFZ A;  1G3W A;  5KG7 A;  2CG4 A;  4ANJ A;  4ZTJ A;  1K1Q A;  5EDW A;  4Q44 A;  2DAB A;  4BEH B;  2EJ3 A;  2E19 A;  2DOA A;  1I5Z A;  4HA8 A;  3WWI A;  4MV9 A;  3W2W A;  1SFK A;  2DO7 A;  3TBI A;  1V55 H;  4J01 A;  3TY8 A;  1GGO A;  2OQR A;  2H8R A;  3P7N A;  4I6Z A;  1NK3 P;  4J19 A;  5HNH A;  2C6Y A;  2VA2 A;  2ATL A;  4FAS D;  3H1C A;  4A3J G;  5J3L A;  5DMX A;  3LSM A;  1Y14 B;  2MD0 A;  2DU9 A;  2OZ6 A;  2XAU A;  2P5V A;  1GXQ A;  2HOS A;  4DIQ A;  2L9S A;  1MNM C;  1X2N A;  2K86 A;  2XKO A;  2CS3 A;  4BQQ A;  2VUM G;  1W93 A;  1QPM A;  2VQL A;  3FXQ A;  2YX7 A;  4PZ8 A;  2VKD A;  5L1L A;  3S17 J;  5CR5 A;  1QVU A;  5BPD A;  1IXC A;  2L54 A;  4UVA A;  2QF7 A;  2OJE D;  2K9M A;  3QPL A;  4P9U A;  3TGN A;  1VBG A;  2F5F A;  3KYH C;  1FC3 A;  5I47 A;  3WOD F;  3E97 A;  4AC0 A;  2MD5 A;  4O4I F;  2EV6 A;  5F0C A;  5CA1 F;  2H94 A;  2V9P A;  4JX6 A;  3D5R C;  1LVA A;  4G8X A;  2OC6 A;  5CPR B;  4XBF A;  4CCM A;  5JR3 A;  1WR2 A;  4HLX A;  3L2V A;  5HOD A;  4FFP A;  1LKX A;  1I1L A;  1UNN C;  2HKX A;  2RV8 A;  4LOC A;  4UHT A;  1ZGA A;  4XLF A;  1JDB B;  4UVC A;  2HIV A;  4YRV A;  3QZ8 A;  2X85 A;  2XGX A;  4ZDL A;  2Q2T A;  1ZRC A;  3JRB A;  2P8T A;  1SAN A;  4UCV A;  2VQC A;  4M3F A;  1W7P A;  2M87 A;  4GDF A;  4KYW A;  1X3U A;  2DWC A;  4XN3 A;  2L9R A;  2JEF A;  4RNN A;  3PR4 A;  3U9G A;  4C3H J;  2LBF A;  4ZYE A;  3D1N I;  4BY7 J;  3V42 A;  1ETV A;  5L3F A;  1WSC A;  4HYK A;  1IGN A;  4OAZ A;  1AKH B;  5ICC A;  3BQY A;  2JEJ A;  2SCU B;  4EJU A;  4RNM A;  3OOU A;  2MA3 A;  4LFA H;  2COJ A;  2JA5 A;  3G3Z A;  2MLG A;  1I2L A;  2KL4 A;  2R7Q A;  2XPV A;  3N41 B;  5DIS C;  2HGW A;  2E5L H;  4GLW A;  3T7A A;  1QZE A;  2K9Q A;  3FXO A;  3TQ1 A;  2PJR A;  4DV7 H;  3NQO A;  3BP8 A;  1MGT A;  4O4J F;  2ZB9 A;  1RYR A;  4A3B J;  1K6Y A;  4L5E A;  4XKW A;  1OCP A;  2R7N A;  4DIM A;  4X65 H;  1I6H J;  2M9H A;  2IPQ X;  4O6J A;  4N9I A;  3CCY A;  4ZHQ F;  3TY5 A;  2VT2 A;  2IBD A;  3GFM A;  3G1M A;  4P9F A;  5JH7 F;  2R92 A;  4A12 A;  3EYI A;  5IP9 J;  2L4A A;  4J9K A;  3JSO A;  1MBJ A;  1OPC A;  2O9L A;  5DQI A;  3IH3 A;  1OFC X;  1WH2 A;  5B1A H;  5LMU H;  5KG1 A;  4XIC A;  2ZM6 H;  4M3D A;  4KN7 X;  3GW2 A;  1WPK A;  2AXL A;  3T5J A;  5EZG A;  2Q7D A;  4PUS A;  4U0V A;  4BHC A;  4AVZ A;  1TWH J;  2F48 A;  2XPU A;  3AG2 H;  3F22 A;  3GTK J;  2R7Z J;  2EIY A;  2X6Y A;  3LQQ A;  3V6H A;  3JSL A;  5CYV A;  1VBH A;  3GYH X;  3KYD B;  3BTC A;  2DT5 A;  2R7D A;  2J5O A;  1A48 A;  4LG0 B;  2K4J A;  3BJO A;  4UFZ A;  3OYF A;  1ET0 A;  3RAX A;  3CUQ B;  1R1V A;  3M9O B;  1P16 A;  4NB5 A;  5F1R A;  4M74 A;  5BWT A;  5EWG A;  1UG0 A;  1R5G A;  5FKO A;  3JRF A;  5KG5 A;  2PX9 A;  5J2T F;  4LGW A;  4E4T A;  1TW2 A;  1FOW A;  3T9C A;  3GTJ J;  4X6A J;  2X6W A;  1KA8 A;  1A31 A;  2A05 A;  3E3V A;  4MIM A;  2IT0 A;  1LEB A;  4DV0 H;  4NC8 A;  3JRC A;  3KHR A;  2JMW A;  1IV6 A;  4CHU A;  3W1B A;  4LIT A;  3I4M J;  4JI6 H;  2X1E A;  3AG4 H;  1ORK A;  3GF2 A;  1AN7 A;  1D8K A;  4U6P A;  3SFZ A;  1P7J A;  1PUF B;  3F8C A;  5FLX Z;  4TQR A;  4QW9 A;  3D5S C;  2G9W A;  2JT1 A;  2ZFW A;  2I8D A;  1XGM A;  3GTQ J;  3J80 K;  2OTJ I;  3CMA I;  1U6G A;  2BW3 A;  4FS1 A;  5BWR A;  3DP7 A;  1O4X A;  3L2U A;  2A1H A;  2WV0 A;  4J9M A;  2COG A;  2K9N A;  3SEQ A;  1GHC A;  4E7L A;  2NAZ A;  5C5J A;  3M9N B;  4ECW A;  4CKB A;  4TV8 F;  4Y15 A;  5BOX A;  4A3F G;  3ONQ A;  2MW8 A;  3BR5 A;  1Q1V A;  3K6G A;  2GXB A;  5DD8 A;  1JGS A;  2ECC A;  2M4G A;  2F4V H;  4LG3 A;  5E25 A;  5FRO A;  5EEG A;  5KFJ A;  1R9T A;  2OAZ A;  1FMW A;  5DGI A;  1RR8 C;  1LEA A;  1XMA A;  4RGU A;  2XAS A;  1IW7 F;  3PZP A;  3HOX J;  4O5V A;  4ENM A;  1DIK A;  3PVX A;  4EQ5 A;  3F6V A;  3GIJ A;  2RNG A;  4A5N A;  2Q2E A;  3U9S A;  4O3S A;  2ZNZ A;  1LB2 A;  2R7L A;  1RES A;  4MGR A;  3KP2 A;  2BQR A;  1AWC A;  2QBY A;  1K7A A;  4DOZ A;  1HNZ H;  4B3X A;  2HQA A;  2YW2 A;  3I58 A;  3FMS A;  4ED7 A;  1B59 A;  2NS0 A;  4K6N A;  3AL0 C;  1XC5 A;  2BYV E;  1VS0 A;  2GQS A;  2R8I A;  1YRN A;  1PJR A;  1JUS A;  3CCJ I;  4YQW A;  4MQ9 F;  3SYT A;  4Q5S F;  5BPI A;  1XGS A;  2QEN A;  3BJA A;  2DQL A;  2MC3 A;  4FCY A;  3DAA A;  1IDZ A;  5C8Y F;  2FMA A;  1DU6 A;  1MJA A;  1HW1 A;  2MG4 A;  3ETH A;  1LNW A;  1SVL A;  3T1B A;  3V4S A;  2Z5U A;  3FIW A;  3IHU A;  4PZJ A;  1B6A A;  4IR1 A;  4ITV A;  2O6G E;  5KG4 A;  3EUH C;  2F4O B;  1V51 A;  5CLS A;  3J7A O;  4PJJ A;  1TWA A;  2W48 A;  5HNF A;  2BOL A;  2XF6 A;  4IF4 A;  2W6Z A;  3H4B A;  2CFX A;  5FJ8 G;  3CO7 C;  5EWF A;  1OCZ H;  3P9C A;  2ZDQ A;  1LVK A;  3R0J A;  1A35 A;  4YAJ B;  3QWL A;  3BTI A;  3NAR A;  5JHF A;  1Y1W J;  3WG9 A;  3UKG A;  4BAY A;  1UAA A;  3RPQ A;  3PN1 A;  4YFN F;  2CW7 A;  2ZXW H;  4UV9 A;  5GTH C;  1ZRF A;  4FE2 A;  1WCM A;  5FD5 A;  3RFC A;  3VB2 A;  3T9F A;  1O57 A;  3KFW X;  4E7S A;  1C0W A;  2JWT A;  3H5N A;  5J1Y A;  3KXY T;  1A36 A;  1E3P A;  1ZG3 A;  5KK1 A;  2MYS A;  2V9V A;  5LHH A;  4XLE A;  2KLO A;  1CQI B;  4LG0 A;  2R4G A;  3I59 B;  1P2F A;  3M1E A;  4QWQ A;  4H0E A;  1JI8 A;  5KG3 A;  4BBS G;  3AG1 H;  3OS1 A;  4LIV A;  1J5Y A;  4O82 A;  1S7E A;  5E3M A;  3VPD A;  1R22 A;  5DUI A;  5IYD G;  1BR4 A;  2XSJ C;  2O7O A;  1GVD A;  2R7M A;  5HNE A;  3X2Q H;  2BHZ A;  3MR6 A;  2Y9Y A;  1U0J A;  4LJZ F;  2UWM A;  1XMK A;  4S05 A;  1YJW I;  4IWY A;  3RF2 A;  1YS6 A;  5KKN B;  1P8L A;  2VXZ A;  2LYC A;  5ICG A;  3O8H A;  1FT9 A;  1S03 G;  3G1L A;  1H88 C;  2Q0O A;  2R85 A;  1HA8 A;  5A2Q Z;  1IO2 A;  1NTC A;  1FVI A;  3MR5 A;  1UCR A;  3WGI A;  3GTJ A;  2MLK A;  4ABZ A;  4EGY A;  1E4F T;  4IRG A;  2EZI A;  4QPQ A;  3WTW C;  2DZD A;  2VBW A;  3WTV C;  4BHP A;  2A61 A;  1ZR4 A;  2DFI A;  2FD5 A;  4KIF A;  5E3O A;  5D6F A;  4XN0 A;  3EUH A;  2QKL B;  2WB1 N;  1ZAO A;  3MWE A;  4RB0 A;  1I27 A;  2E1M C;  3L2P A;  3RBE A;  1KTA A;  2ISY A;  1O75 A;  3PW0 A;  3RBD A;  4MV8 A;  4GKK H;  3GBG A;  3OHB A;  5H2F C;  4JK1 X;  4D5F A;  1T08 B;  2V1U A;  1JTY A;  2C28 A;  3H5A A;  3N05 A;  2FK1 A;  2WB1 E;  1R49 A;  4I99 C;  4HNU A;  4O7Z A;  1QNT A;  4A3G G;  3E6B A;  1WHU A;  3K5I A;  3ZQH A;  1KEE A;  2KIU A;  5J1U A;  5KS8 A;  2BE5 F;  5HVQ C;  1T33 A;  4M71 A;  3E5U A;  5FRN A;  1BA5 A;  1FTT A;  3R60 A;  3JZ6 A;  2V9W A;  2FSW A;  4F4Z A;  1S72 I;  2R7S A;  3L09 A;  2Y0M A;  4EJO A;  1EYZ A;  1TWC J;  2Y31 A;  3P9K A;  1TWH A;  5KG6 A;  1D1B A;  3T9E A;  4BBR J;  4A93 G;  1EJ9 A;  2EJ2 A;  4RUC A;  2JA6 J;  1JTX A;  1WI9 A;  1WQ2 A;  3QP5 A;  4YR2 A;  1A0I A;  3GFI A;  1ZHF A;  3WTT C;  1DU0 A;  2FPI B;  1X4O A;  1O7F A;  2EK5 A;  3I3L A;  2YU9 A;  2AXT C;  5DGA A;  4A3E J;  4R1H A;  1Y1W A;  4RGS A;  2Q2U A;  3GVA A;  3M3Y J;  2HTJ A;  4BS9 A;  4G7H F;  3P5J A;  5D8L B;  4FTH A;  3OR1 C;  4XKC A;  4GC7 A;  1Z7U A;  2EIJ H;  4UV8 A;  5FLX K;  1E3H A;  4MFD A;  4IOC F;  1M0W A;  1I6U A;  2EA2 A;  4I0A A;  2X9D A;  4FIS A;  4C5A A;  3Q8S B;  1BI1 A;  5E1X A;  2XVC A;  4XKB A;  1D1A A;  4JP0 A;  4IRI A;  2BXZ A;  2XHK A;  4IKF A;  3DEW A;  1T38 A;  4G7O F;  2VA3 A;  2AO9 A;  2GIZ A;  3KLO A;  1IBL H;  4LK0 F;  2NNY A;  3EYY A;  4A3G J;  4R8H A;  1MBE A;  4LF4 H;  2HG8 A;  3BG7 A;  1KJQ A;  4EG0 A;  2QSF X;  3HOU J;  1OR7 C;  1RUO A;  3N44 B;  1VQL I;  3K70 D;  4E70 A;  2B0L A;  1IN7 A;  3VFZ A;  3B73 A;  3GFL A;  5J8C A;  2C2E A;  4BE1 A;  3W2A A;  2WTF A;  1WJF A;  2HGS A;  1F1Z A;  4PJ0 C;  2ZDG A;  3MKW B;  3L7W A;  3ECH A;  3OMY A;  2Y4R A;  2IGO A;  2RC4 A;  4KN4 X;  2UVR A;  2UXD H;  1MMG A;  2LVS A;  3IRQ A;  3JRG A;  4JI0 H;  1VQK I;  3C2G A;  1PX2 A;  5CQG A;  1VAJ A;  4UUT A;  5CVU A;  4DR3 H;  6PAX A;  4PZ7 A;  2IP4 A;  3VOE A;  2W25 A;  4EYH B;  1ETY A;  4LH6 A;  4IQJ A;  2OV7 A;  3FBN B;  2E2I A;  3KAJ A;  4JUZ A;  5FRM A;  1I3A A;  3ZPL A;  3R5H A;  3LOC A;  5K7F A;  2KRC A;  5IT3 A;  1VF9 A;  2BVM A;  4Q4C A;  4FFR A;  3AX6 A;  1ZEL A;  1MSF C;  2IA2 A;  1UHS A;  2FMY A;  4KIS A;  1FP2 A;  1K61 A;  2F5E A;  3HIF A;  3OYD A;  3PNV A;  5LOV F;  4QWD A;  2UVW A;  4CCN A;  3VOD A;  1G4D A;  3H35 A;  4G6D A;  2QEX I;  3GTQ A;  4FFN A;  2ACJ A;  4DAA A;  3ERM A;  2DA5 A;  1V4Y A;  2GPW A;  4YR0 A;  5EF6 A;  4CZZ A;  2BY3 A;  5FR9 A;  3MN2 A;  3L2Q A;  3CC4 I;  4I55 F;  3IWF A;  3LL7 A;  4EEY A;  1Y1W G;  1VTN C;  1PP8 F;  3EET A;  1NK2 P;  3BZ6 A;  2YL2 A;  2VJI A;  4BQN A;  3R61 A;  3MAJ A;  2AU0 A;  2IGM A;  5EGO A;  1WKM A;  2I10 A;  4DV3 H;  5I5X A;  4O4H F;  1BXR A;  4G3I A;  2DT7 B;  2DMN A;  1Z9C A;  4RGR A;  1J7K A;  3KTM A;  1HST A;  4XLH A;  2BY2 A;  1REP C;  3W6K B;  4DV5 H;  3H9Q A;  4N9H A;  4A3M J;  3OSG A;  1ZAU A;  3N6X A;  5HS7 A;  3HOZ G;  5KFD A;  2CW8 A;  3A1Y A;  5GP9 A;  1TLH B;  3I5U A;  4QTR A;  3CCM I;  5IYB G;  4AYB A;  5DM6 F;  2JA7 A;  3T9B A;  1O3S A;  2V1N A;  1YHQ I;  4EQQ A;  3DLA A;  3FMR A;  4UY8 I;  3U9T A;  2YUS A;  1ZK8 A;  2WY7 Q;  3OUZ A;  1IN8 A;  4IHX A;  4AUX A;  4UCT A;  1U9O A;  1GT0 C;  1DGW Y;  2WAD A;  3V4G A;  1CKN B;  2VL8 A;  1OMI A;  2FU4 A;  1RC9 A;  1CGP A;  3DU6 A;  2BY0 A;  2CYY A;  2AGQ A;  3QRF F;  2EV5 A;  4QLC U;  3JRD A;  1WRV A;  2Q1Z B;  2PLY A;  2JSP A;  4UVB A;  1S9H A;  4C30 A;  2E5Z A;  3GTP A;  3TW6 A;  1E4G T;  3V8L A;  2J6U A;  1OLT A;  1T0F C;  4M72 A;  3VYU B;  2VPQ A;  5KFX A;  1X2M A;  2VUM A;  4L9T A;  1RUN A;  2NVY J;  4Y3O A;  1FOX A;  2W6M A;  2O5R A;  1ZYR F;  5DM7 F;  1RR7 A;  4UCS A;  3RTX A;  1G6N A;  5CJ9 A;  4L9J A;  4LF7 H;  2E2I J;  4KIT B;  2VPS A;  1Y0U A;  4IJA A;  2KZG A;  1WJB A;  2VIX A;  4RAZ A;  3ZR8 X;  3N40 P;  5JVT A;  4LLN A;  2L0K A;  2B7E A;  3GO5 A;  2Z9O A;  1A6Q A;  1MMD A;  4NC6 A;  5GON F;  4YIF A;  1S97 A;  5CM0 A;  3HBL A;  1FOY A;  2DA1 A;  2H8W A;  1OBD A;  1L0O C;  2K3F A;  3OYC A;  1ERD A;  3H40 A;  5B5E C;  3Q5F A;  1K78 B;  1ETQ A;  2JRM A;  4PGG A;  2I8C A;  3K1M A;  5GPC A;  4LB5 A;  2C00 A;  3ISP A;  1JHH A;  1B9N A;  3DEE A;  1YLF A;  2GZW A;  4G6T B;  4ZH4 F;  4A3L J;  4FBT A;  4ECV A;  3NC0 B;  3PNT A;  4D1Q A;  2NS7 A;  5E8G A;  5K3W A;  4ED0 A;  1YOV B;  2ZSH B;  4O3N A;  4ECT A;  1TL8 A;  4CE5 A;  1SD5 A;  4KDP A;  4O7Y A;  1W1W E;  2CNV A;  1S7O A;  3GWZ A;  5JUM A;  1IZ1 A;  3JRX A;  5CKT A;  4DR7 H;  4WHX A;  1J75 A;  4KFC A;  1TP4 A;  1RJP A;  3HTS B;  3LWF A;  4BNC A;  2W6O A;  4M3G A;  2NU9 B;  5JI6 A;  2NOJ B;  1ONV A;  1UG2 A;  2QGU A;  3E7L A;  3HOS A;  1K4S A;  1BI0 A;  4PJL A;  5F0F A;  4D5C A;  1S68 A;  1ZG1 A;  5LGU A;  4O2A F;  4Q8E A;  4DR1 H;  1MH3 A;  5ICF A;  2YU9 J;  1WWX A;  3ORQ A;  4F92 B;  3TED A;  3S2H J;  1KJ8 A;  2OCE A;  4ETS A;  4ECZ A;  4MQV A;  4ECU A;  1QPI A;  4Y17 A;  2VUM J;  1UMQ A;  1R58 A;  3I54 A;  4HNT A;  2ZJR F;  1O3T A;  1FJL A;  1EKF A;  1E0E A;  5I5S A;  4NXN H;  4B3A A;  4I7H A;  2CNQ A;  1XDS A;  4NUB A;  1ZQ3 P;  4YR3 A;  3K4K A;  4OX9 H;  2BBY A;  1X4P A;  3S32 A;  3QP6 A;  4YIR X;  4RBO A;  1MMA A;  4B09 A;  3T1H H;  4LF8 H;  4WXD A;  2RQQ A;  3E5X A;  3GV7 B;  2P5K A;  3GLL A;  3DTK A;  1WJA A;  3ASO H;  3V6J A;  3COA C;  4O7S A;  2A6T A;  3EDP A;  2ZGI A;  4HV6 A;  5BYA A;  1K83 J;  5C1P A;  4Q43 A;  3HJE A;  2HPI A;  1H9G A;  2ZJP F;  4Q47 A;  5DG9 A;  2FKL A;  5HLH A;  2JVH A;  2M30 A;  3RYP A;  2XAH A;  1Y1V A;  2KRH A;  3R0A A;  4J9N A;  1ENH A;  3DF8 A;  3LP8 A;  3WE2 A;  4JV5 H;  4HNV A;  1SCU B;  1B1B A;  3LSH A;  4RAY A;  4AYB N;  5TRD A;  2H27 A;  3A2K A;  1GV5 A;  2J6T A;  5IYB J;  1TWG J;  2NU6 B;  1PK8 A;  1ULY A;  5DD4 A;  2Y0S E;  3GIQ A;  1P9Q C;  2VOO A;  3VYR B;  1CS0 A;  4LSX A;  4LD5 A;  3JAM Z;  4F93 B;  4TVI A;  5KFB A;  4AWX B;  1YS7 A;  5H80 A;  4YY3 H;  1N36 H;  2OA4 A;  3PO2 G;  3BY6 A;  4NHJ A;  1B8I A;  2E34 A;  3NWS A;  3FIS A;  1C30 A;  3RGZ A;  2C2D A;  2JA7 G;  3SJM A;  4O7L A;  4PBC A;  1MBF A;  1RYS A;  2XRO A;  4DBR A;  5KG0 A;  4B3M H;  3PM1 A;  2DOD A;  2W57 A;  1HSJ A;  2DFE A;  1GSO A;  5CE8 A;  2PMZ E;  3FKI G;  4G7Z F;  2VQH A;  4II3 A;  4EM0 B;  2CQK A;  3H0G J;  3ZMT A;  1S8N A;  2L02 A;  3KEQ A;  2HXI A;  5AIQ A;  4DUZ H;  4JI3 H;  1S0O A;  5GAH J;  2LKX A;  2HWV A;  2LKS A;  3RSN A;  2IAI A;  2ZCW A;  1KZH A;  2GQQ A;  3UFX B;  5TJJ A;  1BW6 A;  1XX5 A;  5FLV A;  1DGR M;  3GZ6 A;  2IEK A;  3SXY A;  2KZV A;  5FFZ A;  1VQ5 I;  1VQO I;  2ZME C;  3BAB A;  3E5N A;  3W2V A;  4U7C A;  3DWL E;  1ETO A;  3BC8 A;  4MEY F;  4ZQI A;  2W24 A;  1M0T A;  1R4N B;  2WAQ A;  5KT3 A;  5BQT A;  3OSP A;  3G2B A;  2VKH A;  2XPW A;  1D0Z A;  4CMD A;  2FBI A;  4PDB A;  5GAD J;  3EPZ A;  2C35 B;  5K5O A;  5I5T A;  4FFL A;  2JA8 G;  3J7Y J;  4YEL A;  1MMS A;  2LR8 A;  1CF7 B;  2VQF H;  1DPR A;  1X1B A;  3CUQ A;  3FXU A;  1YTY A;  1YIJ I;  1XCV A;  5GTI C;  4FE4 A;  3HOZ J;  4MV7 A;  2EQR A;  2PVP A;  4Y8V B;  4IOA F;  3GIP A;  2V5A A;  3T8T A;  4XRF A;  3U55 A;  2VBX A;  3KP5 A;  4BE0 A;  1JKO C;  3CC2 I;  1TAE A;  4DR4 H;  5KFV A;  4MTE A;  2A07 F;  2YS7 A;  2UUB H;  4HSR A;  3I4M G;  2E1O A;  4AIK A;  3GZ5 A;  3NBY B;  5AON A;  1JDE A;  4DV4 H;  1ETW A;  2UVU A;  4RM2 A;  4WF2 A;  1QZY A;  1TTY A;  2EZK A;  1V4R A;  4O84 A;  3ZRG A;  1PUF A;  5HDK A;  2R5Z B;  4HQE A;  5JHU A;  5FLM J;  2HQR A;  4DL3 A;  3BOQ A;  4B3S H;  2P6T A;  3BQ0 A;  1C3O A;  3Q3S A;  1N77 A;  1FNN A;  5D6E A;  1SD7 A;  1RJR A;  1Z3X A;  1ZAR A;  2P6S A;  3WWJ A;  1YIT I;  2DOF A;  3SZT A;  4ZOL F;  5JLX A;  4DQ2 A;  3NBZ B;  2RN7 A;  4KNY A;  1IG7 A;  2YZM A;  3OY9 A;  3GLX A;  3S24 A;  2RQP A;  3V7C A;  4MV1 A;  2OUM A;  2QYO A;  3A02 A;  2ZME A;  2XC9 A;  3P9I A;  2OZU A;  5H20 A;  3KYL A;  2QSG X;  2KIF A;  3FXR A;  1S0N A;  5IPA A;  3CDI A;  2HHF A;  2H6C A;  3TO6 A;  2OU2 A;  1O3Q A;  2W6P A;  4BXU A;  3GDE A;  3OUU A;  2CH0 A;  1A9X A;  3FDY A;  5DTD A;  3KYC B;  3LST A;  4F50 A;  3U0G A;  1XN7 A;  1TNT A;  3MZY A;  3ELK A;  3G71 I;  5HV6 A;  2L7Z A;  4J9O A;  5KFE A;  4A3F J;  1IRX A;  3DFG A;  2ICW G;  3FWE A;  1M7J A;  5FKK A;  4J9L A;  3GME A;  3GX4 X;  4DZP A;  3G8D A;  3CQZ J;  2XB0 X;  1K4T A;  3JZI A;  1TWC A;  4A3C G;  4HAM A;  3E1S A;  2QKM B;  3FZV A;  2IS1 A;  4ESB A;  1TBX A;  3ML6 A;  4AIJ A;  4C2U A;  1JLL B;  5D5V B;  5DCM B;  3K9T A;  2R93 A;  2ZXI A;  5LMN H;  2ZKZ A;  3N4M A;  3OWT A;  2V79 A;  1VI0 A;  3B6C A;  5IT9 Z;  1R36 A;  3FK7 A;  2W6N A;  2M0C A;  3JRI A;  5I5U A;  5J2U F;  5IT9 W;  1TWG A;  1F43 A;  1SD6 A;  1MBH A;  5EDN A;  3F8M A;  3M1C A;  3PO3 J;  1ZRD A;  1W36 D;  4DNC A;  2VBY A;  2VJJ A;  2QSH X;  2DIK A;  1E2X A;  3UNG C;  4O7T A;  5D5U B;  2XDV A;  2HGX A;  2XAG A;  2Y0S A;  5C1O A;  3ABU A;  4EJT A;  4BE2 A;  1Y56 A;  1DV1 A;  5HLG A;  2MBF A;  3OYJ A;  1UB9 A;  3R4K A;  3TQN A;  2JTV A;  2HIX A;  3QOD A;  1NH3 A;  2XAQ A;  4RM3 A;  2WB1 A;  1O3R A;  3PW2 A;  4FX4 A;  4O4L F;  4DZJ A;  4YFK F;  1W5T A;  4YBZ B;  1DP3 A;  5FPO A;  5DLG A;  4C2M A;  5FLX W;  3GTL A;  3J81 K;  3LSR A;  2UXB H;  5DCF A;  2HYJ A;  3BR6 A;  1HR0 H;  3VPR A;  5D4R A;  3BDD A;  4A3I G;  4CC5 A;  4U88 A;  4O7R A;  4LSA A;  2FB9 A;  5LFA A;  3FKI A;  2GA2 A;  4IL6 C;  3A0B C;  3H3V K;  2DDB A;  1ZHS A;  4DR2 H;  2R8K A;  2HVQ A;  3KP4 A;  3BQ2 A;  3DPU A;  2GOM A;  2K02 A;  4IEJ A;  1PP7 U;  4EVI A;  2WAQ N;  1DV2 A;  3LAJ A;  1ZQ7 A;  2R86 A;  2JA6 G;  2PFB A;  4GGG A;  4GLX A;  2TRT A;  2CV0 A;  3F9K A;  4A3B G;  4S0H B;  3WTZ A;  3W1G A;  2ID3 A;  1ETK A;  1LFB A;  4NYE A;  4A3J J;  3U2R A;  3OSN A;  2LMD A;  1A04 A;  1EH7 A;  1YQA A;  2V4J C;  2HPM A;  3CVZ A;  2F5V A;  2DQR A;  1PUE E;  1CKM A;  4AID A;  2LY1 A;  2R5Z A;  3UZB A;  2EWN A;  3CCR I;  3HEF A;  2VB6 A;  3S14 J;  4BXF A;  4ZJZ A;  4BJT A;  3MKZ A;  2JK3 A;  1Y0N A;  4NZM A;  3K2A A;  4J9R A;  3T99 A;  1HDP A;  3HDD A;  2XGD A;  4IR9 A;  3BZC A;  2EIK H;  3Q0V A;  5B3S H;  3V8K A;  4EGZ A;  2GM4 A;  1CQT A;  4MNU A;  9ANT A;  1KU2 A;  5CVJ A;  4A2A A;  5KFS A;  4N4N B;  3ORR A;  2Y69 H;  2CW0 F;  1X1D A;  2FBH A;  1PVE A;  2F2E A;  2VBZ A;  3U1D A;  5C3E J;  3IV5 A;  4JYA H;  1B72 B;  4QWC A;  1OCC H;  1EH8 A;  2RAE A;  3LFU A;  5C44 J;  2NOG A;  2ZBK A;  5HOO A;  5FO5 A;  2DYS H;  3IAS 2;  2GLT A;  2I80 A;  4UCR A;  3OYI A;  1SFU A;  1RK5 A;  5E1Z B;  4UNO A;  1TQM A;  2G7H A;  2XIG A;  3LSK A;  2ABJ A;  1KUT A;  2H09 A;  4A6D A;  2JA8 J;  3ABM H;  5HLI A;  3T5H A;  5J4V A;  2Z33 A;  2E2J J;  2HHH H;  1HNW H;  2DLN A;  4A3K J;  2EFW A;  2RDP A;  2DN0 A;  3T8R A;  5KT5 A;  1QBJ A;  2FP4 B;  2UUA H;  4F55 A;  4HDU A;  1J59 A;  2ZXH A;  1PDN C;  1XSV A;  2NVX J;  3WU1 B;  3QQA A;  4JX4 A;  2M3A A;  1IN5 A;  2RVC A;  4KIB A;  3TKY A;  4YEJ A;  3T5K A;  2WAF A;  1ZTR A;  2DFF A;  4M9X A;  1VQM I;  2Z04 A;  3KX2 A;  4UUS B;  3O8G A;  1WFX A;  3TO9 A;  4QIW N;  4MV6 A;  4RDU A;  1FOK A;  2B63 G;  2IW5 A;  2Y2Z A;  3C0F B;  2OTL I;  3M07 A;  3NEU A;  2WWY A;  1XCB A;  1ZR2 A;  2W70 A;  4Y33 A;  5L9X A;  1I3Q J;  1N48 A;  3ZMD A;  4DR5 H;  2Y9Z A;  4HQ6 A;  2CV1 A;  3BG9 A;  4KUM A;  3KHG A;  1N78 A;  2DLL A;  2VT3 A;  4X0G A;  2A5Y B;  1R1T A;  1E3O C;  4LK1 F;  4DJA A;  5H6Q A;  3KE2 A;  2YSR A;  5LL6 b;  1HOM A;  2XGE A;  2FJ1 A;  3OIO A;  5EZY F;  1MNE A;  3UZO A;  1UFM A;  4PZ6 A;  1DPU A;  3HG9 A;  3GQC A;  1OJL A;  2RGR A;  2A6H F;  1Y6I A;  1XB4 A;  3WGG A;  3JR9 A;  4OMY A;  1KJI A;  4FFM A;  2XF7 A;  3CLO A;  4ON0 A;  1K78 A;  2GXG A;  3IN5 A;  4C2M J;  5M5Y J;  3FXM A;  4BJ5 C;  4MA0 A;  5K7Z A;  5BS6 A;  4DL7 A;  1QHH D;  3LA3 A;  1MZB A;  5I5Y A;  5M3F J;  1MSE C;  5EWE A;  3JSP A;  2CJJ A;  5GAG J;  1HBX G;  4FHT A;  3BJY A;  4B47 A;  2IRF G;  3ZQG A;  1VKZ A;  2W8L A;  2CUZ A;  3DKW A;  3CCS I;  5I60 A;  4M0J A;  4B48 A;  1EUD B;  4A0X A;  4AYB E;  1YX3 A;  3MFK A;  4QSH A;  3W3C A;  1TQI A;  2CGP A;  1Z1D A;  1D5V A;  2BV6 A;  4P1W A;  4G9Y A;  4IRK A;  4TV7 A;  4E4H A;  2KIM A;  5ERI A;  5F64 A;  4QJF A;  2LK2 A;  1FYM A;  4EM2 A;  5BWW A;  2FML A;  4HX4 A;  4MV3 A;  1TNS A;  3NUA A;  2ASL A;  2AGO A;  2M5W A;  3DF7 A;  2CSO A;  1F36 A;  3CLQ A;  1BGW A;  4NZO A;  1MND A;  1Z6R A;  3ETJ A;  3MMY B;  1AUX A;  1KQ8 A;  4M3B A;  2WDT A;  5DS9 A;  2COM A;  4DL4 A;  2DA7 A;  2VQE H;  2QLZ A;  5LHI A;  2BVL A;  4ASN A;  1HKT A;  4NZN A;  3GIK A;  1XMQ H;  2HU9 A;  2DFH A;  3FX3 A;  3DLL F;  4XRM A;  4A3C J;  1BJZ A;  1BBY A;  4H4K C;  4BJ6 C;  2CFM A;  4FE7 A;  2J9G A;  3GID A;  3QYE A;  1X1A A;  2WBM A;  3G73 A;  3VEP A;  2X6O A;  4DR6 H;  1V5G A;  4XYM B;  2GAU A;  2KDZ A;  1U8B A;  4IHT A;  4EM1 A;  2JQ7 A;  3TIG A;  3K4J A;  1IRZ A;  2ME6 A;  3MZH A;  3OYM A;  4AQY H;  1N33 H;  5BPF A;  3QOP A;  2DW4 A;  2Z99 A;  4GYI A;  1GV2 A;  1U3E M;  1T8I A;  1W0U A;  1HW2 A;  3R5F A;  4UCU A;  1F5T A;  4LH7 A;  2A6E F;  2M7A A;  2KJC A;  2DMU A;  4CMF A;  3J7A K;  2XRN A;  4E7Z A;  2M4K A;  1Z67 A;  3HSF A;  5D5W B;  5L1K A;  2TCT A;  4LB6 B;  3HGG A;  3RTR A;  2XC7 A;  1K79 A;  4UUG A;  1HKS A;  2EJ0 A;  5FPR A;  4D0P A;  2DK5 A;  4O7W A;  3PR5 B;  4Z6Y A;  3K0L A;  3L00 A;  2K7L A;  2ISZ A;  2HQN A;  1FP1 D;  3KAL A;  3QAH A;  4CUG A;  4DRF A;  2XRL A;  5HLT A;  1I94 H;  4KT5 C;  3IKT A;  5KFO A;  5DQG A;  4FGR A;  3IRR A;  1JJ6 C;  4CCL A;  4LF9 H;  1SMT A;  5E18 F;  2JA5 J;  2DAA A;  3DTI A;  4LMY A;  4PFO A;  2V6E A;  3RAQ A;  2IBK A;  3HOY G;  1P4A A;  2MAB A;  2X4H A;  1APL C;  2YCH A;  3AL0 B;  5DCM A;  5T14 A;  2BR0 A;  5EEA A;  1JJ8 C;  3FHZ A;  1TA8 A;  3T1Y H;  3LQR A;  4LFC H;  2NU7 B;  1I39 A;  1JT0 A;  4ZDO A;  2OQG A;  2WY8 Q;  3FBI B;  3LSJ A;  4ECR A;  2W84 A;  4P5O A;  2O3F A;  4GXO A;  3F0C A;  3QYF A;  1MIJ A;  2NVT J;  3WNZ A;  1XS9 A;  5KAF C;  2UXX A;  3KEO A;  4BGD A;  2R7V A;  3OS2 A;  3H3V H;  3HRS A;  2ADU A;  3DPT A;  1D8J A;  2H1K A;  1GSA A;  2EIM H;  2VPR A;  3KLN A;  3O2P E;  4I0B A;  4UB8 C;  1IDY A;  5L1J A;  4EMS A;  4EBD A;  3E5Q A;  2ALZ A;  4OU0 A;  3CF5 F;  2X0L A;  4ECS A;  3GJX B;  1YI2 I;  5F9L A;  1IUY A;  4XL9 A;  2D1V A;  1EKE A;  1IUF A;  2L7K A;  2DPD A;  3JAM K;  1I1S A;  2CQQ A;  3PIP F;  5KHD A;  4UUS A;  4IX7 A;  2ME0 A;  3TQT A;  3HB9 A;  3ERE D;  1WH7 A;  3W6V A;  3ZQI A;  3NWT A;  2JA2 A;  2EA4 A;  2M2E A;  4ED3 A;  1E4E A;  2L9N A;  4J00 A;  4WX9 A;  4AM3 A;  4RA2 A;  3OYL A;  2B63 A;  3VWB A;  4CA0 A;  1IOV A;  2R0Q C;  4M7E A;  3ZCO A;  1M6V A;  4Y7N J;  3Q1K A;  2HDK A;  2K9S A;  3I59 A;  1I1K A;  4O3M A;  5AIP A;  2P7V B;  3I71 A;  1XNQ H;  1I1G A;  3BLY A;  3HRT A;  4IHV A;  1ETX A;  3WE3 A;  5FNV F;  4P55 A;  3N42 B;  5JLW A;  4GRI A;  2Z2S B;  5HDN A;  4IRH A;  2W71 A;  1CE8 A;  1MBK A;  3MR3 A;  1IC8 A;  3HOW G;  5EG0 A;  3CME I;  2BQ3 A;  2X1D A;  3LSI A;  2YS6 A;  2ZJT A;  4A3L G;  5CVR A;  2A68 F;  4L0Y B;  2R7K A;  3R5X A;  3O3K A;  2OPT A;  3OYN A;  2UXC H;  3CJQ B;  3V7R A;  1R4M B;  5LRR A;  2CV2 A;  1G3Y A;  4Y13 A;  4EBC A;  2VOP A;  2UV1 A;  4WK8 F;  1IN6 A;  2F5D A;  1G59 A;  3G8C A;  4HN2 A;  2C2R A;  4ZTF A;  4CH7 A;  4HF0 A;  1YE9 A;  1FYK A;  2K85 A;  1MMN A;  4LIU A;  2N8G A;  4WCG A;  3HGY A;  2HXO A;  3KRE A;  5TIS C;  2EJR A;  4ZYG A;  1BM9 A;  1RIO H;  1FJG H;  1R23 A;  5DDG A;  1JX4 A;  4J0M A;  3JW4 A;  4XYL B;  5KFM A;  2DA4 A;  2FNP A;  2K27 A;  3WU2 C;  1IBM H;  2R7Z A;  3LSP A;  5LEJ A;  4QWE A;  2OLS A;  1X3Z B;  3WTX C;  3W6J B;  3H0D A;  1YW8 A;  1FSH A;  3BTL A;  4JV2 A;  2RGV A;  2PMZ A;  4XLP F;  1EH6 A;  2FJZ A;  2D5V A;  2VOD A;  3GTO J;  2GXA A;  3ZN1 A;  5GPA A;  2DJN A;  3IC7 A;  1RNL A;  2YS9 A;  3PSI A;  1U9N A;  3PW5 A;  1BI2 A;  3KAK A;  3F72 A;  5E1W A;  1IJW C;  1T3N A;  3FXL A;  1EKP A;  2IJL A;  4IPA A;  4F52 A;  4DQN A;  5F9N A;  4CGZ A;  2MCT A;  4A69 C;  3T5L A;  1T56 A;  5FKN A;  3HHG A;  5KT4 A;  5JVD F;  4O3O A;  2YZN A;  1LFP A;  4E7H A;  2G0E A;  4A93 J;  1EF4 A;  3OYE A;  2WAQ E;  4APM A;  5J40 A;  4BBR G;  4L0Z B;  1S6L A;  3T9A A;  2M34 A;  2X51 A;  1L2Z A;  4I01 A;  1IV8 A;  3WTU C;  3E6C C;  3SI8 A;  1V5F A;  1F9N A;  1XGN A;  3A0H C;  4EFE A;  3GV8 B;  3G6V A;  2PG4 A;  1QVT A;  2ZC2 A;  3K1N A;  5L3C A;  1NHA A;  4C2T A;  3U54 A;  3VYT B;  4JI4 H;  2GIV A;  5IOZ A;  3RQI A;  2DBB A;  4K2E A;  5ILV A;  4XRS A;  5F04 A;  3K3P A;  4I4T F;  5FFX A;  2AQE A;  4I98 B;  3DQV C;  4ENK A;  1IYE A;  3OHA A;  1ZH5 A;  1TT0 A;  3DKY A;  1LDJ A;  4CYC B;  2E71 A;  3H9G A;  4LFU A;  4OOI A;  1EHI A;  2XUB A;  3CCL I;  3S1N J;  3PQK A;  1SVO A;  3K4B A;  3TDU C;  1ZLK A;  1UZC A;  1ACI A;  1B9M A;  2WTE A;  1J09 A;  3WHC A;  3BG6 A;  4CDG A;  1DDN A;  2LF8 A;  1OKR A;  3PUB A;  5L3G A;  1HDD C;  3RZO J;  3JRW A;  3WO0 A;  4CKE A;  3KHH A;  2OD5 A;  4RAG A;  3I55 I;  3REO A;  4IZO A;  1OCT C;  1OBG A;  4O83 A;  3HHH A;  3K10 A;  3MWD A;  3M9A A;  3DTG A;  5KFR A;  4XOR A;  3QPH A;  1OCO H;  4PSW A;  4Q48 A;  5F08 A;  1VQP I;  3TO7 A;  2ZJ2 A;  2LKP A;  4EEF G;  3OV8 A;  3IWZ A;  4ED8 A;  1MBG A;  3LSG A;  1R00 A;  4NDL A;  2D1H A;  3S3O A;  2ZNY A;  4DV2 H;  2F6C A;  2P0A A;  2BEO A;  3UQ8 A;  3E6M A;  2M8G X;  2Q8K A;  3ZGK A;  3C2B A;  1JE8 A;  1BW5 A;  3HPG A;  4HPQ A;  5D8K B;  4G12 A;  5C4J J;  5KFF A;  2E1C A;  4Y52 J;  1YG2 A;  3L9F A;  3NGD A;  2RNJ A;  1VFC A;  3KIO A;  2M45 A;  3S2D J;  2W82 A;  3F3X A;  5FKM A;  3V4Z A;  2QQB A;  2NVY A;  3DU5 A;  2IS2 A;  4MAM A;  1KBL A;  4UUV A;  4AVP A;  4DV1 H;  2NXN B;  3IUO A;  4ED6 A;  2KSW A;  1X19 A;  2LSO A;  4PJM A;  1Z0X A;  1CKO A;  1R1U A;  1N75 A;  2OCC H;  3C1D A;  4ENN A;  1ZG5 A;  3FXK A;  1U78 A;  1YW9 A;  3RPU A;  3BCA A;  2R8H A;  2ZO4 A;  3RQ4 A;  2BY1 A;  1HNX H;  2LY2 A;  5ILU A;  3QYB A;  5HBR B;  1ZKG A;  2UU9 H;  2YR2 A;  3TOA A;  4M6Y A;  2FF4 A;  3G4S I;  2DMQ A;  4B1R A;  3OL3 A;  3S1R J;  4DL5 A;  2FLN A;  3K69 A;  1YRN B;  1UST A;  3Q9S A;  2IGK A;  4B43 A;  1KON A;  3PO2 J;  1OQY A;  2HFH A;  4CCJ A;  1R6R A;  2HQ5 A;  4YJ3 F;  3BG5 A;  4A6E A;  4E7I A;  3DBR B;  3KP7 A;  5L1I A;  2L9V A;  2IA1 A;  3CF2 A;  2EFP A;  4OWR B;  3VOT A;  4WXH A;  3IKV A;  1K83 A;  1IYD A;  3M7G A;  4XLN F;  4RB3 C;  1AOY A;  5I5V A;  3I4N J;  5DAA A;  4YJ2 F;  1J2X A;  2HS5 A;  5HDG A;  3FK6 A;  4B3R H;  2R7Z G;  3OL4 A;  3GTM J;  3SZG A;  4RB2 C;  1H89 C;  3QQM A;  2R5Y A;  5ILS A;  1SFX A;  4IZZ A;  1IXR C;  3ROU A;  5LEK A;  1JKJ B;  4TV9 F;  3OS0 A;  5J8F A;  3CC7 I;  5K2M A;  3BCB A;  3CDH A;  1XK5 A;  4ECY A;  2R82 A;  2YRX A;  2ZSI B;  1POG A;  5IYC J;  3Q0U A;  2R7T A;  2BQU A;  5BYB A;  2UUZ A;  3CJT B;  2FOK A;  4JOM A;  2CQN A;  4ZC3 A;  3HT5 A;  4Q4D A;  1TC3 C;  1FYL A;  3BRO A;  3MR2 A;  3RKW A;  3RB0 A;  3J81 W;  2HDC A;  1D5Y A;  2HYF A;  2OF7 A;  4PCQ A;  1LPQ A;  2ASD A;  4M9U A;  1Q1H A;  2R8J A;  1Z3Y A;  4PGH A;  3BA8 A;  2R92 G;  2RDI A;  2ESN A;  2DI3 A;  1BL0 A;  2LC2 A;  3K4M A;  4EAT A;  1RK6 A;  2FLP A;  2EFN A;  4GCV A;  3CMM A;  1ULZ A;  3SEZ A;  2FLL A;  3J7A Y;  4XM3 A;  4JI5 H;  2VI6 A;  2K40 A;  4A2U A;  2KRF A;  3J7Z I;  1H8A C;  4EV0 A;  1XPX A;  3CD6 I;  5KFN A;  3KHL A;  1I50 J;  1RI7 A;  2JPB A;  2W85 A;  3RKX A;  2VE9 A;  2PN1 A;  5C4X J;  1VQN I;  2A69 F;  5BNG A;  4XRS G;  1T39 A;  2W9C B;  1BIB A;  2JZY A;  2VJ5 A;  5D1O A;  4F4W A;  1KJ9 A;  1JHF A;  3QPS A;  4V19 K;  1GSH A;  2R87 A;  5EGO B;  2W9C A;  3LML A;  1WH5 A;  3CTA A;  2VOB A;  2V26 A;  5LA6 F;  5K7H A;  2DTR A;  1JGG A;  1IN4 A;  2HZT A;  2BW3 B;  2FUG 2;  2KIQ A;  5E17 F;  3Q8P B;  5K5Q A;  2JUC A;  2YWV A;  3UR3 C;  1AKH A;  4BQA A;  3K2Z A;  2EFQ A;  1D3Y A;  4C3J J;  3AKZ A;  5IYD J;  5BMV F;  4PDK A;  4RNO A;  2UUC H;  2QQ8 A;  4QIW E;  5C4X G;  5F6F A;  4O86 A;  3CP8 A;  4YII A;  1YJN I;  2GQR A;  3PO3 G;  3FKJ A;  4EGJ A;  1I50 A;  4HX7 A;  3PW7 A;  2GWR A;  2ELK A;  3PIO F;  4M9S A;  1LDK B;  3U1K A;  3WU0 A;  1JUP A;  2KT0 A;  5E79 C;  4LF6 H;  1G8X A;  1W7P B;  2HOT A;  2E2H J;  1N32 H;  3HUG B;  2ZDH A;  2E36 A;  2MC4 A;  2LTP A;  2PI0 A;  3S15 J;  3HOV G;  4CHI A;  4DW6 A;  4HR7 A;  3A01 A;  2HTS A;  2M7B A;  1HCR A;  3RPU D;  4CO8 A;  1GXP A;  4UB6 C;  2UXN A;  1QGP A;  4PK4 A;  2AS5 F;  4RAF A;  3S16 J;  3CUO A;  2DCE A;  2HHF B;  2I87 A;  4BYY A;  4ECX A;  1RKT A;  2XAJ A;  3GFJ A;  1XGO A;  2QQ9 A;  4ZZL A;  3BTJ A;  4DYQ A;  3K4C A;  2LD5 A;  5KFC A;  4C5B A;  2DK8 A;  4M3E A;  3GTO A;  1EA3 A;  3GIM A;  3RI4 A;  2ESH A;  3FXJ A;  2CFO A;  2JRT A;  2DPU A;  1ZGJ A;  4RGX A;  4QW8 A;  4M9Z A;  4A3D G;  2BGC A;  4MFE A;  4E6N A;  3GXO A;  3H20 A;  3S8P A;  4PWQ A;  4KIC A;  1I7L A;  3ZN0 A;  4BKX A;  1B6R A;  4BDY A;  4D9J A;  1WRJ A;  3NRV A;  4WBN F;  2WAE A;  3HOV J;  1RRJ A;  4Q0Y A;  1BR1 A;  2W6Q A;  3ZOB A;  3GB8 B;  4O2B F;  4Q4Z F;  4WD3 A;  2L4M A;  4BUP A;  2KQR A;  3CZ6 A;  5C44 G;  2YU3 A;  4FS2 A;  4BY7 G;  1T36 A;  4OIP F;  3M8F A;  2EIL H;  2V59 A;  2PJP A;  4W97 A;  3N8D A;  2R5Y B;  3C18 A;  2KFD A;  1IOW A;  3HO8 A;  4JI7 H;  3BT9 A;  1SAU A;  5CQE A;  4A0Z A;  2DAO A;  4RCN A;  2Y0S N;  5C3E G;  4L5I A;  1VQ7 I;  1Y1V J;  4AIH A;  1Z77 A;  4DBQ A;  5IP6 A;  4BDZ A;  2R7R A;  1LE8 B;  2W7O A;  3HC7 A;  1BN5 A;  1H0M A;  1MD0 A;  4B8X A;  3BA9 A;  5IYZ F;  1LE8 A;  3F6O A;  1J5E H;  2FQ4 A;  4P96 A;  2NYX A;  2YZG A;  2XB5 A;  1WJC A;  4GKJ H;  1JKQ C;  2L2O A;  2KHM A;  2QCO A;  2JPC A;  2QQA A;  4V2F A;  3ABL H;  5KNL A;  1JUM A;  2IMW P;  2DMP A;  5KFH A;  2NVU B;  3IAM 2;  1B04 A;  4KHP H;  3BQZ A;  4MO7 A;  3HL2 A;  1U2W A; 
#chains in the Genus database with same CATH homology
 2XF7 A;  3SDB A;  4LH6 A;  4IQJ A;  3RIZ A;  2OV7 A;  3FBN B;  4BJ5 C;  3KAJ A;  1UEL B;  4PJN A;  4YHH H;  2KP6 A;  1QHH D;  2DT6 A;  5FRM A;  1MZB A;  1XMO H;  3W5O A;  3VSK A;  1SYX B;  2KRC A;  2BVM A;  3CJR B;  4B47 A;  4C9Y A;  1Z2P X;  5KCM A;  1ZEL A;  2CUZ A;  3RGX A;  5IWA H;  3QOE A;  4IAJ A;  4II2 A;  4KIS A;  1AA7 A;  4B48 A;  3OYD A;  3PNV A;  1YX3 A;  1Z2N X;  4CCN A;  5BR8 H;  3W3C A;  3C2H A;  3HKZ A;  3H35 A;  4P1W A;  4CCK A;  4DV6 H;  2E5N A;  4E4H A;  1V5E A;  1N34 H;  2WA0 A;  1MW7 A;  5FD6 A;  3DF7 A;  1DGS A;  3L2Q A;  4KJZ A;  2VPL A;  1BGW A;  1MND A;  3LL7 A;  3MMY B;  2WDT A;  1GYF A;  4KT6 A;  2VQE H;  4NC7 A;  2BVL A;  2VJI A;  4BQN A;  1XMQ H;  1BR2 A;  2IGM A;  4XOP A;  4B3T H;  4XNF A;  2HU9 A;  4XMY A;  2R7X A;  2CFM A;  4DV3 H;  4H4K C;  4BJ6 C;  3OYB A;  1X9N A;  3VNN A;  1XNR H;  1BOB A;  2DT7 B;  2K5C A;  3QYE A;  1X1A A;  2WBM A;  3E0J B;  5TGT A;  4XLH A;  3OYH A;  3K70 C;  4DV5 H;  3OIP A;  3H9Q A;  4DR6 H;  1V5G A;  2AQF A;  3N6X A;  4RB1 A;  1X1C A;  1PYV A;  4A2B A;  3K4J A;  2CW8 A;  3A1Y A;  3OYM A;  4RLF A;  5D1P A;  3U21 A;  4AQY H;  4AYB A;  1N33 H;  4JQF A;  4UCU A;  2V1N A;  3IG0 A;  4ZDP A;  4LH7 A;  1BJT A;  4U87 A;  3DLA A;  3OIQ A;  2M7A A;  4QPO A;  3OYA A;  2A5W A;  3J7A K;  2LH9 A;  4E7Z A;  4JI8 H;  2M4K A;  4XR6 A;  2WY7 Q;  3PL8 A;  4UCT A;  2XC7 A;  3RTR A;  1DQU A;  1Z21 A;  1DGW Y;  2WAD A;  5FPR A;  3L4K A;  1CKN B;  2Z16 A;  2VL8 A;  3K4L A;  4DRF A;  3KAL A;  4CUG A;  3DU6 A;  5HLT A;  1I94 H;  2Q1Z B;  3KEY A;  1WJE A;  3CP2 A;  2JSP A;  3HPH A;  4MLO A;  4CCL A;  4LF9 H;  1S9H A;  4C30 A;  3DTI A;  2E5Z A;  4PFO A;  2V6E A;  4FET A;  4XON A;  4HRI A;  3MD2 A;  2MAB A;  1E4G T;  3FMA A;  2W00 A;  2YCH A;  1OLT A;  1T0F C;  3FHN A;  3AL0 B;  2JVG A;  4IQ4 A;  3VYU B;  2KPM A;  2PJR B;  1TA8 A;  1WJ5 A;  3T1Y H;  4LFC H;  3RCO A;  2HVR A;  4ZDO A;  3RJ0 A;  1D1C A;  2WY8 Q;  3FBI B;  3PSF A;  4P5O A;  2HNH A;  4Y3O A;  4BEH A;  3QYF A;  2O5R A;  1GLN A;  4UCS A;  4ANJ A;  4ZTJ A;  3RTX A;  4CC6 A;  4BGD A;  4LF7 H;  1YX5 A;  4HG2 A;  4NQW B;  4BEH B;  1VZ0 A;  4KIT B;  3OS2 A;  2R7V A;  3DPT A;  3BAA A;  2KDO A;  2DOA A;  1WJB A;  2VIX A;  3ZR8 X;  3N40 P;  4RAZ A;  2VXD A;  4MV9 A;  3MKY B;  4ZYA A;  2IS4 A;  3W2W A;  4E6K G;  3TY9 A;  1SFK A;  5D1O B;  3TBI A;  1MMD A;  3GJX B;  4J01 A;  3TY8 A;  4XL9 A;  2L7K A;  5HNH A;  2E1M B;  4F91 B;  5KHD A;  3OYC A;  4IX7 A;  4FAS D;  1ERD A;  3LSM A;  2MD0 A;  2XAU A;  4E7K A;  3NWT A;  2JA2 A;  4DIQ A;  2L9S A;  2VLA A;  2L9N A;  4J00 A;  2CS3 A;  3DEE A;  4BQQ A;  3OYL A;  3VWB A;  2VQL A;  4G6T B;  4CA0 A;  4XLC A;  4BU2 A;  2R7O A;  4PZ8 A;  2VKD A;  4M7E A;  3JAM W;  3ZCO A;  3PJR A;  3NC0 B;  4JI2 H;  3PNT A;  4D1Q A;  3H9J A;  2K9M A;  2ZSH B;  3KYH C;  1XNQ H;  3BLY A;  3K3V A;  3MWM A;  3N42 B;  4BWS C;  5CKT A;  4GRI A;  2Z2S B;  4DR7 H;  3D5R C;  5CPR B;  4CCM A;  2OC6 A;  3EUA A;  3J80 W;  3L2V A;  3IP4 B;  3ZXS A;  1LKX A;  2X1D A;  2DJI A;  3LSI A;  2ZJT A;  2NOJ B;  2IXS A;  2LRE A;  1QU3 A;  3HOS A;  3OYN A;  4PJL A;  2MFZ A;  3CJQ B;  1S68 A;  4XLF A;  2HIV A;  2CV2 A;  3S93 A;  4LF5 H;  4YRV A;  2UXC H;  2X85 A;  3CES A;  2UV1 A;  4ZDL A;  1G59 A;  2Q2T A;  2VUG A;  4ZTF A;  4CH7 A;  1YE9 A;  4HST A;  4F92 B;  1MMN A;  4ETS A;  4LIU A;  4UCV A;  2VQC A;  3I9V 2;  4HNT A;  3LML A;  4XN3 A;  1CKN A;  1FJG H;  4NXN H;  1E0E A;  2LBF A;  4I7H A;  4J0M A;  3V42 A;  4NUB A;  4OAZ A;  2V7F A;  1IBM H;  3OOU A;  2W1O A;  3K4K A;  3PNY A;  1X4P A;  3S32 A;  4CCO A;  3QWU A;  3T1H H;  1MMA A;  4LF8 H;  4LFA H;  2RQQ A;  3H0D A;  2RGV A;  2KL4 A;  2PMZ A;  2R7Q A;  3DTK A;  4X66 H;  1WJA A;  3OTO H;  3N41 B;  5DIS C;  2E5L H;  2A6T A;  2PJR A;  4DV7 H;  2RRE A;  3PSI A;  2HPI A;  1K6Y A;  4XKW A;  2IGN A;  3HXL A;  4BQO A;  3ZQQ A;  4X65 H;  2JVH A;  4XOT A;  3KAK A;  4EFB A;  2HZD A;  2KRH A;  4F52 A;  3RR5 A;  2LOO A;  2LG4 A;  3TY5 A;  2MCT A;  4JV5 H;  3LSH A;  4RAY A;  3A2K A;  1LFP A;  4E7H A;  1ZHQ A;  3OYE A;  4APM A;  4LSX A;  1P9Q C;  3VYR B;  4F93 B;  1WH2 A;  2X51 A;  3M4I A;  1L2Z A;  5LMU H;  4YY3 H;  1N36 H;  2ZM6 H;  1V5F A;  4EFE A;  3NWS A;  3RGZ A;  4PUS A;  4LFB H;  4AVZ A;  4C2T A;  4JI4 H;  3VYT B;  2X6Y A;  4DBR A;  1Z7L A;  3OYK A;  3DKX A;  3JSL A;  2W57 A;  4B3M H;  1TZL A;  2VQH A;  4II3 A;  4DGW B;  4X62 H;  2JUG A;  2AQE A;  3DQV C;  4JI3 H;  4UCO A;  4DUZ H;  4AU7 A;  1TT0 A;  3DKY A;  4UFZ A;  3RSN A;  3OYF A;  3H9G A;  1P16 A;  1DGR M;  3K4B A;  2KZV A;  3BAB A;  1UG0 A;  3H5R A;  1J09 A;  3BG6 A;  3W2V A;  4E6N A;  3DWL E;  3PUB A;  3BC8 A;  2XF5 A;  4B44 A;  2IS6 A;  1M0T A;  2X6W A;  2WAQ A;  4DV0 H;  4NC8 A;  3K10 A;  3G2B A;  2VKH A;  2FE3 A;  1D0Z A;  4JI6 H;  3W1B A;  4LIT A;  4XOR A;  2X1E A;  4PSW A;  5A2Q W;  4PDB A;  1AN7 A;  3EPZ A;  4F3Q A;  3A4C A;  3D5L A;  3D5S C;  4YEL A;  3JSN A;  2VQF H;  2I8D A;  3LSG A;  1X1B A;  2M0M A;  3S3O A;  4MV7 A;  4DV2 H;  2F6C A;  2BW3 A;  4R79 A;  3UQ8 A;  3ZGK A;  3DPL C;  3L2U A;  2P0W A;  4BE0 A;  4DR4 H;  1TAE A;  3HPG A;  4HPQ A;  3SEQ A;  4MTE A;  4E7L A;  2UUB H;  4HSR A;  3ONQ A;  3K6G A;  5LD2 C;  3NBY B;  2W82 A;  2W7N A;  4E7J A;  2R7U A;  4DV4 H;  4RM2 A;  2M4G A;  3PFY A;  2F4V H;  3DU5 A;  4LG3 A;  2IS2 A;  3ZRG A;  2R7W A;  1W36 C;  2VJ4 A;  4DV1 H;  5FRO A;  3IUO A;  4PSX A;  2KSW A;  1X19 A;  1FMW A;  3OR2 C;  4PJM A;  4XKV A;  1CKO A;  4N4O B;  4B3S H;  4LMY A;  1N75 A;  1N77 A;  4RZQ A;  1Z3X A;  3BCA A;  3RQ4 A;  4EQ5 A;  2LBF B;  1HNX H;  2RNG A;  2LY2 A;  3NBZ B;  2HDW A;  3QYB A;  1NG6 A;  3OY9 A;  3S24 A;  2ZFU A;  4DUY H;  1D0Y A;  2UU9 H;  4DOZ A;  2OUM A;  1HNZ H;  4B3X A;  3TL4 X;  2HQA A;  4NNJ A;  3OL3 A;  3KYL A;  2K3P A;  3AL0 C;  2IGK A;  1VS0 A;  3TMO A;  2E60 A;  4B43 A;  1KON A;  1PJR A;  4CCJ A;  1R6R A;  3F8N A;  2X6X A;  3GDE A;  2CH0 A;  2ELJ A;  3SYT A;  4E7I A;  3FDY A;  3CF2 A;  4OWR B;  2Q2E B;  2K9L A;  3K4N A;  4ITV A;  3EUH C;  1IRX A;  3VSL A;  4PJJ A;  4EEQ A;  5HNF A;  4RB3 C;  2BOL A;  2XF6 A;  4FM9 A;  2V9K A;  1WJD A;  3E1S A;  2QKM B;  4B3R H;  3OL4 A;  1LVK A;  3SZG A;  2IS1 A;  4RB2 C;  3M8J A;  4C2U A;  5JHF A;  4IZZ A;  1UAA A;  3OS0 A;  2L5Q A;  2ZXI A;  5LMN H;  3BCB A;  1XK5 A;  3PN1 A;  3OWT A;  2CW7 A;  2ZSI B;  4MTD A;  5FD5 A;  2R7T A;  2UUZ A;  4E7S A;  4ZC3 A;  4JOM A;  2OWO A;  3H5N A;  3KXY T;  3M1C A;  2DXI A;  1W36 D;  2MYS A;  2VJJ A;  3J81 W;  4XLE A;  2KLO A;  2R4G A;  3UNG C;  1JI8 A;  4U7B A;  2XDV A;  2Y0S A;  3OS1 A;  4LIV A;  4DR1 H;  2O03 A;  2VAS A;  4BE2 A;  3S3M A;  1Z3Y A;  1Y56 A;  3BA8 A;  1BR4 A;  2XSJ C;  3OYJ A;  2LC2 A;  3K4M A;  4HEA 2;  4EAT A;  2HIX A;  3N43 B;  2CMP A;  3QOD A;  1U0J A;  2F4I A;  3CMM A;  2WB1 A;  4RM3 A;  2UWM A;  3SEZ A;  3J7A Y;  4XM3 A;  2W4S A;  3HOT A;  4JI5 H;  3RF2 A;  5IT9 W;  1P8L A;  1DP3 A;  2VXZ A;  5FPO A;  1FMV A;  2LYC A;  2KMU A;  5FLX W;  1S03 G;  2UXB H;  2Z1D A;  1HA8 A;  1HR0 H;  4Y4R A;  1FVI A;  4CC5 A;  4LSA A;  5LFA A;  3VYS B;  1E4F T;  4QPQ A;  1ZHS A;  4DR2 H;  2VJ5 A;  2HVQ A;  5D1O A;  3DPU A;  2GOM A;  3EUK L;  2VOB A;  2V26 A;  4XN0 A;  2QKL B;  2BW3 B;  2FUG 2;  2VQG A;  4RB0 A;  2E1M C;  3L2P A;  2WYO A;  3UR3 C;  1O75 A;  4GLX A;  4GKK H;  3GBG A;  3F9K A;  3AKZ A;  2CV0 A;  3W1G A;  2UUC H;  5EOY A;  4XLA A;  3CP8 A;  3H5A A;  3N05 A;  3FKJ A;  2HPM A;  2V4J C;  3CVZ A;  3LMM A;  4HNU A;  2F5V A;  1CKM A;  1IBK H;  1LDK B;  2LY1 A;  4LF6 H;  1G8X A;  4RLQ A;  2VB6 A;  2GOX B;  2LRD A;  4BXF A;  1N32 H;  3HUG B;  4ZJZ A;  4BJT A;  2MC4 A;  5HVQ C;  1XDN A;  3MKZ A;  4R7R A;  1D0X A;  2M7B A;  5FRN A;  3RPU D;  3L2R A;  2WE6 A;  2R7S A;  1Z2O X;  1QHG A;  4PK4 A;  4A2A A;  4N4N B;  1D1B A;  2DCE A;  1X1D A;  3DTE A;  3S3N A;  4JYA H;  3K4C A;  3L4J A;  1A0I A;  3LFU A;  1X4O A;  5HOO A;  3I3L A;  3IAS 2;  1EA3 A;  4UCR A;  3OYI A;  2CFO A;  2Q2U A;  2XIG A;  4BS9 A;  3LSK A;  4X64 H;  3OR1 C;  4RMN A;  4XKC A;  3H20 A;  3S8P A;  2HHH H;  1HNW H;  2HVS A;  1M0W A;  3L2W A;  4D9J A;  4BDY A;  1I6U A;  1SEI A;  2UUA H;  4F55 A;  2WAE A;  4BL0 B;  4Q0Y A;  1BR1 A;  4XKB A;  1D1A A;  2ZXH A;  4IKF A;  3GB8 B;  4BUP A;  3CZ6 A;  2KQR A;  2M3A A;  1NG7 A;  4YEJ A;  1IBL H;  2WAF A;  3EYY A;  3KX2 A;  4LF4 H;  1WFX A;  2CUJ A;  3BG7 A;  4JI7 H;  1OR7 C;  1SAU A;  5CQE A;  3C0F B;  3N44 B;  2X1C A;  3K70 D;  4BAC A;  4Y33 A;  4DBQ A;  4BDZ A;  2VPS A;  2R7R A;  4DR5 H;  2CV1 A;  3HC7 A;  3VDX A;  4BE1 A;  3BA9 A;  1N78 A;  1J5E H;  3W2A A;  4X0G A;  1WJF A;  2HGS A;  3MKW B;  4CSW A;  4DJA A;  4OAY A;  4XQF A;  3OYG A;  1WJC A;  1FKA H;  3OMY A;  4GKJ H;  4K0K H;  4JI1 H;  2L2O A;  2KHM A;  2IGO A;  5LL6 b;  5KNL A;  3AFH A;  1T95 A;  1MNE A;  4CZC A;  4OX9 H;  4PFP A;  1MMG A;  4PZ6 A;  3IAM 2;  2UXD H;  3HG9 A;  4JI0 H;  3C2G A;  1V9P A;  5CQG A;  2RGR A;  1B04 A;  4NXM H;  4KHP H;  4DR3 H;  1Y6I A;  3HL2 A;  4PZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...