2HVRA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 3'-deoxyribonucleotide at the nick
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/rna/dna
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
total genus 83
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvrA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvrA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvrA01
4UCVA 1B04A 1TA8A 2HIVA 3TY9A 5D1OB 3GJXB 3BABA 1CKNA 1P8LA 3NBZB 2Q2TA 2OWOA 5FPOA 2HIXA 4LH7A 2HVQA 1DGSA 3GB8B 3NC0B 3W1GA 3JSNA 1A0IA 1V9PA 5DISC 3PN1A 5FPRA 3RTXA 1CKNB 3TY8A 4EEQA 4E6NA 2HVSA 4UCSA 4DRFA 3L2PA 3JSLA 3KYHC 3W5OA 3BA8A 2Q2UA 4EFBA 1FVIA 1S68A 4CC6A 4UCUA 3TY5A 4UFZA 1CKOA 4CC5A 3BA9A 3S24A 1XK5A 4PZ6A 1CKMA 3QWUA 2HVRA 4UCRA 3RR5A 4UCOA 1X9NA 4GLXA 4EFEA 3NBYB 2CFMA 5D1OA 4EQ5A 1VS0A 4PZ7A 1TAEA 3BAAA 4UCTA 1P16A 1XDNA 3W1BA 5D1PA 4PZ8A 3GDEA 3VNNA 2VUGA 3UQ8A 4LH6A
chains in the Genus database with same CATH superfamily
3E6DA 1CS0A 5EWEA 5CPRB 3WTVC 1FTZA 2AQ4A 2OZ6A 2LYCA 3DTEA 5CQEA 1XS9A 3MKYB 4ZYAA 4K2EA 2HFHA 1N78A 2WAQN 3T1BA 4M0JA 1LDDA 3WTUC 4YY3H 4V2GA 5TISC 4LFCH 2FEZA 1VNDA 2KRFA 3CCEI 1S7EA 2ID3A 1XG1A 2ZXWH 5HVQC 1FPQA 2R92A 2CV1A 1PUEE 3PSIA 4II2A 2X6OA 4ECSA 1JT6A 3KE2A 2YU9A 4P55A 5JLXA 3FHNA 3I71A 2M4KA 1APLC 5IT9Z 5C4XG 2FQ4A 4O84A 4L5JA 3KZYA 3RTRA 4JP0A 2GA2A 3D5RC 3ECOA 4XRSA 3QPSA 2FP4B 4RGRA 1OISA 5J40A 5D8KB 3H4DA 3F0CA 1SAXA 3JTHA 4BHCA 1WI3A 4Y7NJ 2HKOA 2W82A 3NWTA 3TY8A 1Y0UA 2UUAH 3HUGA 4FBTA 4KJZA 2L7ZA 3PO3J 5EZGA 3FZVA 3R6SA 1VQ7I 4DV4H 2BYVE 2WC2A 3VFZA 2FA5A 2QENA 2QKMB 4A0ZA 1DPRA 4CICA 4KUMA 1IUYA 1A3GA 3HC7A 4LOCA 2O8XA 1UNNC 3HOXJ 3F3XA 5LHIA 1KJ9A 2R7FA 2X9DA 3HOXG 1TNTA 1H88C 2AS5F 1IYEA 1E17A 1KBLA 2WV1A 2JEJA 4UB6C 1ZH5A 2DAOA 3R23A 3DPTA 5E20A 2H8WA 2H09A 4HRIA 1M0TA 1E4FT 5KG3A 2JA7A 3MWEA 3EYYA 1D0XA 1GVJA 5ICCA 3PIOF 3N42B 4R1HA 3AG3H 3A0BC 3MR5A 5AIQA 4AU7A 3GLXA 3OSPA 4LIVA 4PDBA 1I6UA 3U9GA 4E7JA 3LP8A 2HDDA 1DQUA 4IRKA 4I2OA 3O8HA 4CUGA 2L4AA 4LF9H 3GWZA 1X4OA 4ED8A 1PUFA 5IT9K 1JDBB 1YW7A 1M0WA 1MW7A 3Q8QB 2IW5A 2UXBH 4X1EA 2NOJB 3K9TA 5IYBJ 4JX4A 4UNOA 5GONF 2HYJA 3QYBA 4WF2A 4ECWA 2UXDH 2WTFA 3ETHA 4I7HA 4BU2A 3M4IA 1YJNI 2OZUA 3OYEA 4YR2A 5ILVA 1Y14B 2QQAA 2E36A 4GO1A 3ZR8X 5C1OA 5L3DA 1AUXA 3DBRB 4MTEA 2L0KA 3T0YA 3AKZA 3BA9A 4Q44A 4ECZA 2FF4A 2QSHX 3E5XA 2LRDA 2E2IJ 4AM3A 1Y1WG 3MKLA 1E3HA 2DOAA 2EILH 1JI8A 1W7PB 3KHLA 2HYGD 3E6MA 3PW7A 1X1DA 2DLNA 1RK6A 2EINH 3KIOA 1P16A 2F4IA 3HRSA 2Y9ZA 4NYEA 3BR1A 2EJ3A 3VOTA 3PW2A 2DA2A 2Y0SN 1J5YA 2PBIA 1KU2A 3BTIA 4F4YA 5K1YA 3ASOH 5D1OB 1VAJA 2X48A 5KFPA 1K83A 5BPIA 1BBYA 2VN2A 2GPSA 4O81A 1TTYA 3S1QJ 2LKSA 4G3IA 4UUGA 1QZEA 4WCGA 4QWCA 1K7AA 3RJ0A 4ZH4F 3WO0A 3TL4X 1D1BA 3QAHA 2GZWA 4MA5A 1WH5A 1WRVA 1MBKA 2V26A 4HF2A 5HNHA 1RUOA 5BWVA 1U2WA 4DBQA 1LFPA 5LEJA 4FETA 3M9MB 4AC0A 2V1NA 3L4JA 4EBCA 4Q8FA 2N8GA 1RETA 4XONA 1Z1DA 2I8DA 3V7CA 4ZDLA 2L7FP 5CA1F 2B63A 4IHWA 4ZZDA 4QSHA 2EFQA 4DBRA 3M9NB 1Y1VG 4RAYA 2HGSA 1DV1A 2JA6J 2ZNYA 3T9BA 4EYIB 1JT0A 1TW3A 3MFKA 4FHTA 4EM0B 1QPIA 5LGUA 3BABA 3GIDA 5FO5A 3I5UA 3PQJA 4LSAA 2L02A 2EFWA 4KYWA 3GFIA 1BI0A 1J9IA 2W4SA 2CRGA 2UXXA 2Q2UA 1OJLA 2COJA 5EDWA 1IN7A 3I58A 2DAAA 5KFTA 2UUZA 4A3CG 1TC3C 4CZZA 1HNZH 1XGOA 1S03G 1IGNA 4YFNF 2R7UA 1K1QA 4LB5A 2W7NA 4L18B 2F5EA 4FU0A 4O7LA 1YRNA 3T9EA 2Z16A 2ZBKA 3FMSA 3SDGA 1SFXA 1R4MB 5ICFA 4YFKF 3EYIA 3S14J 3VYUB 4U0VA 3HJEA 5J1RA 2GLOA 1G4DA 3DV8A 3KP6A 1IOWA 3ZQHA 4KMUX 1SVOA 3U1DA 2Z5UA 3WG9A 4BXFA 1R71A 1E4GT 3WGHA 5HLTA 4NUBA 4DV7H 4CE5A 3LQRA 1XDSA 1G2WA 3K4LA 5DGHA 5KFKA 5DLFA 4QIWN 1R00A 4AIDA 1IDZA 5B1AH 1V4YA 4QWAA 3ABLH 3IAS2 1MNEA 2HZTA 3G1LA 2VKDA 4YP3A 1AA7A 2LTPA 2VQHA 4B09A 4EQ5A 3WTXC 4KITB 3BJYA 2W48A 1PUFB 2C22A 2L4MA 1S9HA 2F5FA 4IHTA 1IV8A 2KDOA 3RCOA 1FKAH 2GXGA 3J80W 3Q8RB 5EJCA 3OSGA 2XIGA 3KPHA 3R60A 3E5NA 3GB8B 3MJFA 3KHHA 2XCPA 3GFLA 3JR9A 3MD2A 3JRBA 3EPZA 4YQWA 4A3EJ 3T5XA 4E6NA 2PN6A 4YAJB 3L4KA 1TP4A 2YL2A 1AU7A 4DL7A 1WSCA 2WAFA 3FXOA 4O7SA 2A5YB 5L1JA 2ESNA 2K85A 1FOXA 3FBIB 3RIRA 4J9RA 2BY3A 1K4TA 3PM1A 4J9QA 2VE9A 3GTQA 1V5EA 4L9NA 2C2EA 4EEYA 1ZRCA 3LSMA 4O82A 3DBHB 3DPUA 1WPKA 1VQ9I 1TAEA 3IRQA 5DTDA 2YS7A 3L2QA 2L3DA 4F4ZA 5JVDF 1ZRFA 1F1ZA 5KAFC 3JRHA 3I4MJ 3DTKA 1XSXA 2QF7A 3BZ6A 2R86A 4DL3A 3H1CA 1E3PA 2X4HA 3S15J 1DGSA 4I0AA 2DOEA 2VBZA 1G8XA 4LG3A 5B5EC 4CCKA 3MFIA 2O5RA 1NG7A 3BLYA 1JE8A 2R7VA 1XCVA 1T98A 2A3SA 3E6CC 1R5HA 4DAAA 1V55H 5KFRA 4CHUA 1FYLA 2F4OB 3GTOA 4L5IA 1MSFC 1K78B 4HBLA 4XORA 3ZRGA 1VTNC 1SVLA 2EB7A 3K4NA 3T5KA 4DL6A 4RNOA 4HAMA 3BG3A 4LGWA 2KDZA 4O4IF 3CCJI 1F4KA 2CNVA 3NGDA 2HQAA 2V9VA 3JRIA 2W7OA 5BWTA 4A12A 1MMDA 4RB3C 2LREA 4X0GA 1C30A 2M7AA 1S7AA 1Z6TA 1G59A 1WJAA 2NNYA 3E6BA 5KFDA 2UV1A 4TQRA 1QVUA 2DO7A 1XMXA 1JHHA 3BY6A 5B1BH 4PJMA 3RB3A 2VT3A 2MGQA 1R5ID 1B33N 1N32H 1XD7A 5KG4A 3TO7A 2DMQA 2E35A 2EZHA 2HXIA 5GPAA 5EDNA 3A03A 3BQ0A 2E5LH 2XAQA 2M5WA 4ENKA 2ZC2A 1NK2P 2A6TA 3LQQA 5D5VB 1Y0NA 1R1TA 1Y1VA 3FF5A 5FD6A 1YS7A 3ABUA 1Y6IA 2IPQX 1R7JA 3EDPA 2QA4I 4TV9F 3SE7A 2JZYA 1P2FA 5JVGF 4ED6A 2W6MA 3KHRA 5E25A 1U6GA 2M2EA 2FJ1A 3BCAA 4BY7J 4GLWA 1I27A 5KK1A 4ZZLA 3CF5F 1QA6A 1RJQA 5M5WJ 1ZELA 5H6RA 3B6AA 2E1MC 5J2TF 4TQSA 2YX7A 1ZAOA 1Z3YA 3NUAA 3GCMA 1MJAA 3GFMA 2LR8A 2ZB9A 3L7WA 4B44A 4EQQA 1VBGA 4X64H 2QQ8A 2KP6A 5KX5F 1XGMA 3HBLA 3NWSA 2YX4A 5DG7A 1TZLA 3NQOA 5L3GA 3HOTA 5K3WA 1EUCB 2LKXA 4HQMA 1KEEA 1A04A 2XPVA 4KN4X 2CQKA 3NAUA 4IHVA 2RGRA 1ZAUA 2ASJA 2OPTA 2XPWA 4KA4A 1ZGAA 2NS8A 2ME6A 3OTOH 3LA3A 3ABMH 3HOVJ 3EETA 2P4WA 5C8YF 1KGSA 3T1HH 1H9GA 3VYSB 2HR3A 4RUAA 2WB1E 4ED7A 2EQRA 2L7KA 4UFZA 2Q2EB 1U8RA 1Z6RA 1TWHJ 1DPUA 4ED0A 3RBEA 3SGIA 5LXTF 4HX7A 1RR7A 2VJIA 4DJAA 1X9NA 1YE9A 5DQIA 1HW1A 2R8IA 2K5CA 3A4CA 2XGXA 2DQRA 1EZ1A 5D1PA 1XMAA 4WXCA 2NS7A 3CCQI 3N41B 5EOYA 2R8KA 1JUPA 1O7LA 2HGCA 3KLOA 3WODF 4JXUA 3BROA 5KFSA 2RNJA 1YIJI 4EBEA 2DMTA 3PFYA 2WYOA 3OUZA 1GYFA 1FT9A 3S1RJ 3CMAI 4A3KG 2C2RA 5EG0A 4KMFA 4XLFA 1OR7C 1P6RA 2ZXHA 5IYDJ 4M7EA 4A3EG 1W0TA 3CCLI 3BR3A 3TIGA 2VOBA 2MC4A 2OCEA 4IR1A 3FWEA 2XAJA 4CHIA 1O7FA 4PDKA 1CKOA 4NZMA 3N43B 4Q4DA 3A02A 1HKSA 4XLHA 2GM4A 3LA7A 2XHKA 4MHGA 4OOIA 4CCJA 4UCOA 1K78A 2XAFA 5LRRA 3KP2A 5GAHJ 3T8RA 2GXAA 2UUCH 2AQFA 1IUFA 5FLXZ 3I53A 4ESBA 3OYLA 4C5AA 2EIMH 2UXCH 2C6YA 5FKMA 2X0LA 3H5NA 1W5CC 4OMYA 3H0GG 2LP0A 4U87A 3S16J 3JW4A 4CYCA 2GIVA 5JQWA 4DV6H 3H3UA 1G3YA 2B9SA 3W2WA 3EQLF 2L9SA 5K2MA 2ZM6H 2P5KA 5E17F 5IT3A 1BA5A 1TWHA 4A6EA 4CA0A 3K1NA 4W1UA 1FWZA 2ZFUA 5HS7A 3ZQ7A 1HSJA 2EFOA 4FASD 2FBKA 2Q0OA 2JA5A 1V4RA 1WVRA 1UFMA 3ZPLA 1W5SA 3QP5A 3T5LA 2ZKZA 1MH4A 2UXNA 2MW8A 4P1WA 5BWUA 4LSXA 1U3EM 4GC6A 1X2MA 3PO2G 3J80Z 4O86A 2L9NA 3BTJA 1QHHD 2RF4A 5LL6b 2JVGA 3OOUA 4RNMA 5KFEA 4CXFA 2BZTA 3ELKA 2XRNA 3E5QA 5B3SH 2JN6A 4J9MA 2LMDA 2ZCWA 1GDTA 3H9GA 1HC8A 2XD4A 4XSXF 3Q0VA 4BJTA 4F3QA 5H2FC 1WCMA 1K6OA 3OIOA 3SFZA 1B72A 3OYCA 4S04A 1BR2A 2ELJA 1Q1HA 4F50A 5E1WA 1DAAA 4ED1A 1S72I 2IGMA 3DEWA 5DD8A 4HNVA 2ACJA 4F52A 4XX0B 1O3QA 1BR4A 3ZMZA 2QQ9A 2K02A 1YTYA 3HKZA 2NVUB 1I6HJ 2VI6A 1KUTA 3JZ6A 4Y8VB 2HG8A 2M1BA 2AQEA 5JHUA 3HM5A 1N34H 4C5CA 5FLXK 4K6NA 3GJXB 2HDCA 4JQFA 1H89C 1A0GA 5KFUA 4BHPA 3KEOA 4B3MH 3EUKL 4IZZA 2KT0A 4NZOA 4JBAA 2ISYA 1I2LA 2EJRA 2FPPB 2AGQA 3GX4X 1VZ0A 2XUBA 4A3DJ 4IR9A 2P6TA 3K5HA 4FFRA 4LFBH 2W85A 2FLNA 3RKWA 2DABA 5KFXA 2XB0X 2XGEA 3D5SC 5C4XJ 5FB2A 5FJ8J 2DWCA 2X85A 3F6OA 3JZIA 3ERED 1U9NA 3L00A 5DGBA 4IO9F 2RQPA 1IRGA 1RUNA 1LVAA 1TQMA 4OMZA 2VQCA 1OMIA 1N56A 4I98B 4IOAF 5F9NA 5FPRA 2GIZA 3TO6A 2VKHA 2R5YA 3G8DA 4QW9A 1Y39A 1D0YA 3SZPA 2O6GE 2Q2TA 4II3A 1OCTC 4A3IG 3Q9VA 2XB5A 3OYJA 4GYIA 2K9NA 2XF7A 3I4NG 1DDNA 1FEXA 4ZC3A 1N25A 2WB1A 2VXZA 3I4NJ 1LE8B 2R7XA 2R7DA 1GV2A 1IRFA 2LY1A 4G6DA 4XN3A 4CYDA 3RAQA 4CC5A 4GKKH 1S10A 1TQPA 4BWSC 4HSRA 1W36D 1IDYA 1YITI 1AKHB 1ZRDA 1NH3A 3RR5A 2J6SA 1KYWA 4JI1H 5DM7F 1OFCX 5KG7A 3GIQA 3CCSI 4L0ZB 2MG4A 3W1BA 4IF4A 5C44G 5GTIC 3SEZA 3C18A 2HOAA 4Y4RA 1K6YA 5C44J 1IN8A 2R7WA 1V51A 1O3TA 4BBSJ 5K7FA 3V4ZA 5CVVA 2VKVA 3G2BA 4M9SA 5FKKA 1FIPA 5M5YJ 3JZFA 3KP5A 3PL8A 4BDYA 1I3QA 2VQFH 3FKJA 2DODA 4C30A 1B4AA 5IYDG 4M6YA 2VOPA 1JTXA 1T8IA 2NRAC 5KFCA 5L1LA 2IA1A 3HDDA 2DIKA 1VFCA 3JSLA 1CF7B 3N6RA 4XK4A 3WGGA 2RDPA 4EGJA 1GVDA 4LF7H 2QZ8A 3ORRA 2QBYB 4F4XA 1XK5A 2V58A 4ON0A 3CJNA 2YZGA 2E1MB 2HVRA 4HQ6A 4IHJF 1N36H 2XGQA 3CJRB 5F0CA 2COGA 2CG4A 4QPQA 3AG2H 4RM3A 5IP6A 3Q8PB 3TINA 1MMGA 4CC6A 4J0MA 5KFMA 1Z05A 1TA8A 3WE2A 4MV1A 4MIMA 2MYSA 2R87A 1FMVA 5F1JA 4KNYA 4IHSA 2R82A 4G8XA 4FFMA 5FPOA 5FLMG 3I59A 2ODTX 3BACA 1WJEA 4ITVA 1YX3A 5CA0F 1RESA 2M9HA 2A05A 1G6NA 2QYOA 4PGHA 3PUFA 1R6RA 1KZHA 2JRTA 4HX4A 3V7SA 3ZQLA 3V4SA 5KFFA 2Z04A 3ZCOA 1U5TB 1LDJA 4MFEA 3JCUC 3QZ7A 4BEHA 2IJLA 3PVXA 4NQWB 1T38A 1AN7A 2LY9A 1ZETA 4E7HA 2BY2A 4PFPA 4D9JA 3N05A 4UCTA 3OMYA 3KZZA 3IAM2 4OIQF 4FT8A 4X66H 1UZCA 1GSAA 4XNFA 1MGTA 3F8MA 5KT7A 3WTTC 4XRSG 1BC7C 4A3JG 3DEUA 1AHDP 3MKZA 4XIDA 5DCFA 3ZQGA 5JVTA 1MNMC 3K4CA 1WCMJ 1DIKA 5BPFA 4C2TA 2K27A 2WDTA 1WQ2A 3CF2A 5L9XA 1KTAA 2DI3A 2VC1A 3MR3A 2DA6A 2GAUA 3RB6A 3HB9A 2NS0A 1OCCH 1VQ8I 3HKZE 5IYZF 5I5UA 3W6VA 2Z99A 5K5QA 1DV2A 1T2KA 4OAYA 2FU4A 3FK6A 4PJ0C 4EM1A 3RPUD 5DQHA 3DF8A 2UU9H 2QUFA 2BQUA 2MC3A 2R7ZJ 2KIUA 3GTJA 3NEUA 4GCVA 4LK0F 2IP4A 4C9YA 5F9LA 1O57A 2KISA 2E2IA 3R9RA 1ULYA 3QU6A 4MV3A 3DTGA 2Q2EA 2LG4A 4XOTA 4IKFA 1GGOA 1KU3A 1E4EB 4ECTA 1I1MA 3HXLA 2RDIA 4DYRA 4IQJA 4ZQIA 2FUG2 3CUQC 1HW2A 4YB8B 3CO6C 2EK5A 4XBFA 3GTQJ 5J1UA 2NYXA 4J00A 4ZTFA 2W1OA 4LFUA 2HKXA 2VQGA 2HTJA 3Q9SA 3LSHA 4PJNA 2I8CA 3VB2A 1JDEA 1NG6A 2X51A 5JVLA 2E1OA 1HSTA 4BE0A 1IO2A 2W7PA 2BR0A 4I4TF 1RKTA 1UG2A 1WJDA 4KT6A 1A6IA 4IPAA 4ESJA 2STWA 1T36A 4UUVA 2E19A 4LF8H 2NVYA 3ETJA 4LIUA 2XROA 4YHHH 2R8JA 1OCPA 3ZN1A 1D8KA 1ZLJA 1XC5A 3COAC 2IGNA 3GTMJ 2V4RA 1BI1A 1USTA 5BWRA 1P4XA 3G4SI 3AX6A 2DK8A 5FD5A 1HDDC 2CQYA 3KEQA 3GEZA 4XR6A 1FJGH 2HXOA 4ZYDA 2V9PA 1U5TC 1QGPA 4F7ZA 1YHQI 2IEKA 1ET0A 1VQMI 4IWXA 1HW5A 2R7SA 4NDLA 3GYHX 3RYRA 2KKOA 1UB9A 1FBSA 3HTUA 2BHZA 3I3LA 2DJNA 1RI7A 3K1MA 5DYMA 2FPIB 2FPGB 1YO5C 4NBQA 4EM2A 2ZJTA 3R5FA 4M3BA 3A2KA 1BGWA 3CSWA 1KJ8A 4NHJA 4I6ZA 2L7MP 4YELA 2JA8J 2H94A 4RS8A 1FNNA 4B3XA 5KFLA 1JX4A 1D5YA 1B72B 5EZHA 1Y56A 2HU9A 5DAAA 3BC8A 3LQSA 3HOWJ 5KFBA 5E1XA 3UR3C 2EIYA 4DW6A 4R79A 5CR5A 1SVMA 1SFUA 5J4VA 4GLXA 2X6XA 5DS9A 4ECRA 2CFMA 4BY7G 2B63G 4G6TB 1VQPI 4JI2H 2X6YA 3DCFA 2B7EA 2OQRA 3ERMA 4TVIA 2DK5A 3RV4A 3P5JA 1SD7A 1LE8A 3BJ6A 3K0LA 5BNGA 3GTPA 4JYAH 1STZA 1WGXA 1YYVA 4XOPA 5FLMJ 4J9SA 2M8EA 3TOAA 2NU7B 5EGOA 4DV5H 1USSA 4BAYA 1C3OA 1A0IA 2PLYA 2IBKA 1D5VA 2PJPA 5FFZA 2NVXA 2L9VA 3CP8A 4JI4H 2E1CA 3J7AO 4O7NA 2FK2A 2KPMA 3B02A 2PBZA 3VPDA 2OC6A 3AYHB 3DP7A 3Q5FA 1ZQ7A 1XB4A 2EV6A 1JUMA 1S7OA 2Y69H 4B48A 3QRFF 2O8KA 5CB4F 3EUAA 2EWNA 3L2WA 3NBYB 3CUQB 1YLFA 1T3NA 1YX5A 3S3NA 3L2UA 4H0EA 3VMMA 2R5YB 3LL7A 3OYGA 1UC8A 4RDUA 5ILUA 2OV7A 3T54A 1F5TA 2F48A 5DMXA 1NHAA 4LMYA 3ZP5A 3D5LA 3ZQCA 2J6TA 1GT0C 1WFXA 2E7XA 4S05A 1FTTA 1FP2A 3ORQA 3S2WA 4BDZA 3HIFA 1EH6A 2DBBA 2HPIA 3KZIC 2YU9J 2BVMA 2V4QA 3FX3A 4RB2C 1TWCA 3O3KA 1Z91A 1JIHA 3T5HA 2O03A 3Q8SB 1IYDA 1MBJA 4ECUA 1JGGA 4JI5H 4D1QA 1BNCA 4A2AA 1FBUA 1AOYA 2XAHA 4GYGA 2BXZA 4LLNA 5D1OA 3CCYA 1YG2A 3IKTA 1OCOH 1UJ8A 1LKXA 3ZMSA 4YIRX 2OJED 1GSOA 2EPFA 2HOTA 4C2MA 2DTZA 2WB1N 3CP2A 5D5UB 4FCYA 4WWCA 1UHSA 3LAJA 2W57A 2R5ZB 1DP7P 3K5IA 1WHUA 3L2RA 1K4SA 4MNUA 1J7KA 2R93G 1EA3A 2Q1ZB 3RB0A 2STTA 1ON2A 4DL2A 4DRFA 4O3NA 3I4MG 4E7SA 4BACA 2CUFA 4DOZA 5LFAA 2M4GA 3V8JA 3PFFA 2R7ZA 4LF5H 3RIZA 3H0GJ 5M3FJ 2CNUA 3WWJA 3MFHA 2MCTA 1ETXA 2G7HA 2R7NA 4WXHA 5DV5A 4LFAH 3I54A 2KIMA 3CD6I 2UVRA 1BL0A 5JHFA 4BE2A 4PZ8A 2FOKA 1S6LA 1X19A 1B9NA 1W36C 1UC9A 2ECBA 1I50A 4FM9A 1HA8A 4ANJA 1P8LA 3R5HA 4RUCA 4Q43A 5EYRA 2YR2A 3T99A 2VT2A 5A2QK 1TWGJ 4BQOA 3JSOA 1HKTA 3DLAA 2IXSA 1O3RA 2O61A 4Q4ZF 1S8NA 3K4KA 2DTRA 3E0JB 1U5TA 2HOSA 4MAMA 4MV6A 1ZKGA 4CKEA 3J80K 2R8HA 4BHBA 3VOEA 2IS4A 2AU0A 3WTWC 1B9MA 3HOSA 3AAFA 4A0XA 5CM0A 3GIPA 3G6VA 2K4BA 2MBFA 2Y30A 1MH3A 3K1PA 5E8GA 1MBGA 4BUPA 5L1IA 4XMYA 2IA0A 3IH2A 3R4KA 1PJRA 1FOWA 1ZLKA 5KNLA 3HPGA 5DUIA 1RZ4A 5F1RA 3SQNA 1B59A 1BIAA 3O2PE 4XLPF 2VUMG 3H20A 3KREA 3HHHA 3J81W 5LA6F 2JWTA 3E3VA 3TGNA 4BQQA 3NARA 2YZLA 3FKIG 3FXUA 1T33A 2ZJQF 4TM5A 2HTSA 1XMQH 4NLGA 2VL8A 2XCAA 4FBUA 5L3BA 4N0BA 4NXMH 1VQ5I 1HOMA 5IYCG 3CDHA 2PQ8A 2FKLA 1Q1VA 2IBDA 4CKCA 2PFBA 5DLGA 1TT0A 4G12A 2MSYA 2VBWA 3JREA 3GV8B 3LFUA 1FZPB 4KFCA 1WH2A 3HOWG 1Y8QB 5KCMA 2MH2A 1ON1A 2KRCA 5DDGA 4BBRJ 4CKBA 3FIWA 1ZGJA 1P7JA 3KYDB 2E1NA 3OR2C 3S2HJ 4Q45A 3M8JA 3I56I 3T8TA 4FS1A 4HR7A 3J81K 1A35A 4O3SA 3HOYG 2IS6A 2RN7A 3R0JA 4PBCA 1EH7A 1HNXH 4JI8H 4A3BG 1VQKI 5FJ8G 4U7DA 3FM5A 1ETOA 4NXNH 2D1VA 3WU1B 4PUSA 3K70C 2OCCH 1B1BA 3JRGA 4O7TA 2ELKA 4IXAA 3S32A 5EG0B 3OYDA 4IEJA 1KJJA 5H80A 4UVBA 1R9TJ 1HCRA 1TWFA 4M3DA 1OKRA 2PMUA 3N44B 1IN5A 3GTGJ 4L0YB 3RV3A 1XSDA 4LITA 2LD5A 2CQQA 4ETSA 3GTPJ 4JV0A 3PO2J 3GBGA 3BQ2A 2HZDA 1IN4A 3ABTA 1L3LA 3PQKA 4EGZA 4E4HA 1BW5A 3KYLA 4EJWA 2GA1A 4A3GJ 3DTFA 2KJCA 4XYMB 4CMFA 1SD4A 1T08B 3VWBA 2F6CA 3MAJA 2ZJPF 3IHUA 2GBYA 1W0UA 5D6EA 2HJWA 4EJOA 2J5OA 1R49A 5D5WB 2HQRA 3HKZN 2W9BA 2DPIA 1X1CA 3OYKA 2FNPA 2DLLA 1QU3A 4U6PA 1D1AA 2XSDC 4RZRA 4DLKA 3CMMA 3SZTA 3V4GA 5BYBA 1R5GA 2A5WA 4AUXA 3AW8A 2KHMA 4YEJA 2FD5A 2PI0A 2EZKA 5GADJ 3KALA 4QTRA 3GZ5A 4JX6A 1TBXA 2H6CA 4BL0B 2FJZA 3BR0A 5DQGA 5DCMB 5CVUA 3U9SA 1EUDB 4KT5C 3LSKA 1OBDA 4JV2A 2Y48A 1W93A 3S3OA 3GDEA 4CO8A 3CLOA 3P9CA 2HGXA 2DDAA 2OBPA 1F36A 2Y75A 2A61A 2W6OA 5CQGA 2FBHA 3BPVA 5KFHA 4I50F 3DEEA 1R36A 4YRVA 2A6EF 3HSRA 1X3ZB 1JHFA 2ZMEB 5FKLA 3C0FB 3PR5B 2VXDA 5FNVF 4L5EA 4YIIA 5BWWA 2KRHA 4UVCA 1I2KA 4XLNF 3WWHA 1WI9A 1BJAA 2K7LA 1ZHQA 3RQIA 3LSPA 1ZG1A 3GIIA 4Q0YA 2JSCA 3RZDJ 2VJ4A 3W6KB 3OS0A 2FBIA 5IPAA 3H9JA 4A93J 1N33H 1P92A 4IX7A 2XC9A 1VI0A 1Z21A 3H3VH 1CE8A 1KYZA 2DYRH 2M45A 2PG4A 4XM3A 1PK8A 4J9LA 2D2WA 3B6CA 4HF0A 1U0JA 2Z1DA 5HLGA 1MMSA 5I5XA 2V6CA 6PAXA 1T56A 2M0MA 4MV8A 4RM2A 2IA2A 4LH7A 1EV7A 5JQGF 1JLLB 3EUHC 3JRAA 4IOCF 4DYCA 4U7BA 4HG2A 3T5JA 2BQ3A 2VE8A 3MR2A 1KONA 2CNQA 3GIMA 4ECYA 4D5FA 1VKZA 2QVOA 3CQZA 2JPBA 4ENMA 1Z2PX 1YRNB 2C00A 2NAZA 2DYSH 4G6QA 2MLGA 5D8LB 5KFAA 2MLKA 2FE3A 2R3SA 3AL0B 4EVIA 4FE7A 3AFHA 4XRMA 2ECCA 3CESA 1BC8C 2Z9OA 4IJAA 4H4KC 4DQ2A 4N9HA 1TNSA 2LF7A 5JLWA 1JTYA 2K3PA 2GQQA 3RTXA 4CSWA 5IYCJ 1WZ2A 3G8CA 1M7JA 5HODA 4UUSB 5KG0A 1R23A 2FMYA 4YFXF 2MABA 4UB8C 3BQZA 4DNCA 4TUYF 3VYTB 2GPWA 3QYFA 3LAPA 4LG0B 1O4XA 1ZR4A 2Z2SB 4XN0A 2KMUA 2VASA 3CC4I 2W6NA 3FDYA 1VS0A 3DF7A 3KAKA 3FHZA 2M3AA 1VQLI 3HOYJ 1YI2I 3BR5A 1JKRC 5F08A 1W96A 3SJMA 1MBEA 1K83J 1WKMA 2NU8B 1FYMA 3FXRA 1YIOA 3HYIA 4BY1G 4L9VA 2VR1A 1ZG5A 2V1DA 1D8JA 2LH9A 2QWWA 3TMOA 5ICEA 1E0EA 4IZOA 3S8PA 5E18F 4Y3OA 2FNAA 5FRMA 1R22A 5IP9G 2O9LA 5KKNB 3ZXSA 2PVPA 3OSNA 5HLIA 3KFWX 1BJZA 2MFZA 3PJRA 2DFHA 1A48A 3O6BB 2F2EA 4HV6A 1OCZH 4LG0A 1HR0H 1M1EB 5H6QA 2A07F 2C28A 2ZJ2A 4MQ9F 4P5OA 4E7IA 2LFBA 3IWZA 1RJRA 1S5LC 1IW7F 1JUSA 2V6EA 1ODDA 5T14A 1D3YA 3PNVA 5F64A 1IJWC 1GLVA 2CGPA 3AL0C 3HT5A 4BE1A 4XZ3B 3FDSA 2NVXJ 1N75A 2YU3A 3HOUG 1IRXA 2VJ5A 2W6QA 2M30A 1QRYA 1DUXC 2VODA 2LKPA 3DKXA 1J09A 4ZTJA 4DZPA 5KFIA 4ZYGA 4RGSA 3OYMA 2SCUB 3JRCA 1I5ZA 3MMYB 4WHXA 4M71A 2COMA 1BI2A 4S0HB 2ZXIA 3MZHA 2CUZA 4QIWA 4M9ZA 2RKHA 2Q7DA 3J7AY 4O2BF 1QO0D 4EJVA 3M4OJ 4ZI7F 1OLTA 5EWFA 1PDNC 1LEAA 2NVQJ 1S29A 2XF5A 1IAWA 4OAZA 2DA1A 1TW2A 2QCOA 4RBOA 3LSGA 4AIJA 4EATA 1E3OC 3J7ZI 4IRCA 4KICA 2PMZN 1ERDA 5IOZA 1I1LA 2HHFA 1GLNA 2ZO4A 3W2VA 2XF6A 1T0FA 1KQ8A 5IWAH 9ANTA 4TV7A 3KP7A 4OIRF 4DV2H 2I80A 2CJJA 2UZKA 1FSHA 2HHHH 4A3IJ 1RYRA 3IUOA 4NC7A 5D4RA 1ZREA 2P0WA 2JA5J 2QK4A 5J4YA 4B8XA 3G1MA 3TDUC 4DUZH 1OCRH 3GUDA 3QPHA 5JFRA 2LY2A 2QKLB 4PZJA 1YOVB 4B1RA 3QPLA 3TP0A 3PR4A 3L2CA 1OYIA 1F9NA 2IS2A 3LOCA 3RF2A 1KQ9A 1WH7A 2WAQE 2DT6A 3RJPA 3K70D 2YSRA 4ED2A 3RYPA 2YCHA 4DV1H 2DMUA 5BPDA 5E3OA 3L2PA 4DL5A 3Q2OA 1UELB 2JQ7A 3BA8A 3HOZJ 4A3LG 4IL6C 2NVYJ 2KIQA 2LOOA 2W8KA 1IZ1A 3N4MA 4RGXA 4A3FG 5TGTA 2M05A 4R8UB 4GGGA 2V59A 4NQWA 2MH9A 4NNJA 1ZARA 2X6WA 4QWDA 4NB5A 3PNTA 3JTGA 2DU9A 3VYRB 3BTLA 5I5SA 3CZ6A 3QOPA 1Y1VJ 2QEXI 3JSPA 3TY9A 1BI3A 1W4MA 1LB2A 3JAMW 3WGIA 1I7NA 2H6BA 2YZNA 4O83A 4ZJZA 4GFBA 3OHAA 2H1KA 3EPIA 3CJQB 2WADA 2CUJA 4A0YA 3N97A 2PN1A 5C1PA 1DGRM 3PSFA 4DR2H 3CDIA 4RGUA 2VPLA 3OL4A 2VLAA 2B63J 1J75A 4A3CJ 4QJFA 1ENHA 2PMHA 5DEQA 3ZMTA 1XX5A 4LLGF 4DR3H 1QBJA 3OYAA 3BG5A 2IP2A 5JH7F 1D1CA 2CS3A 3CUQA 4XL9A 2HYFA 5HV6A 3RPUA 2FX0A 1FLIA 1FX7A 2AXTC 4GC7A 2ELHA 4EFEA 2W9BB 5M3MJ 3ZMUA 1P9QC 4NC6A 4A3JJ 1HF0A 2KJBA 3HGYA 4XSZF 1JKPC 1UMQA 3GTKJ 5LYJF 2TDXA 3JAMK 2R0QC 4O2AF 3BZKA 4WBNF 3JRWA 3H0DA 1M6VA 3LMLA 2YRXA 2XKPA 4RCNA 2CZGA 4MGRA 3OS1A 1S9FA 1KT8A 2VPRA 3RI4A 4PGGA 4UV8A 1EKFA 3P7NA 3U54A 2QBYA 1GSHA 5L1KA 3B73A 3GXOA 5K7ZA 3OSFA 5D8DA 2Z3YA 1QZZA 3H3ZA 1FP1D 5IP9J 3WHCA 1KC7A 4G7HF 2WA0A 4EEFG 4FFPA 2A68F 3FMQA 5E3MA 4QWQA 3OS2A 4IQ4A 3Q3SA 1IG7A 1E4EA 2YS6A 3MR6A 2JSPA 4C3HJ 2HDWA 3ZN0A 2C35B 4N4NB 2L54A 4Z6YA 1A31A 1WCMG 2R7RA 4UXNA 2XGPA 2V9WA 2HGWA 2FMLA 2HEOA 1SFOA 4B3AA 2HHFB 4FQGA 5IOYA 5FROA 2X1DA 1IF1A 2G9WA 1J0RA 4U0WA 1G2HA 4Y15A 1Z2OX 1XNQH 1YFHA 3DWLE 1CKNB 3ZMVA 4IRGA 2ESHA 3OYHA 2H27A 1W5TA 4V19K 3KP3A 2EFPA 2JRMA 2L9RA 5HBRB 4CCOA 5C3EJ 3KP4A 3ZQFA 4UCUA 1ORKA 4ABZA 1AWCA 3UKGA 2R7ZG 3ABKH 2W25A 1JJ8C 4AYBE 4DR5H 1W7PA 1Z9CA 2CH0A 2W71A 4QIWE 2XVCA 4DR6H 1LDKB 3HZJA 4EJUA 1DP3A 2KQRA 2E5NA 5CVIA 3CCVI 1SEIA 2FLPA 3UQ8A 3H92A 3BWGA 2EV5A 2JT1A 3BP8A 5L3FA 5F04A 5HNEA 2J6UA 4ECVA 3VPCA 1T0FC 4JI6H 2HNHA 5IP7J 4UUTA 5DM6F 2DOFA 1IXRC 1H0MA 4D0PA 4HLYA 2ADUA 2Z02A 1B8IA 4BH9A 5LRSA 3BR6A 2BGCA 1Z0XA 3TKYA 5JR3A 4FFLA 3K6GA 4IAJA 2R85A 2HDKA 1OR7A 2HS5A 2XAUA 4EJTA 4C5BA 3IKVA 3V7RA 3BPXA 4M3GA 2IRFG 3M1EA 3PZPA 3IWFA 4D5CA 1V5FA 4M73A 4HOBA 2WAQA 1FIAA 2FB9A 2ZMEA 1WJFA 3PW5A 2IMWP 5AONA 3SNOA 1XGNA 3GTOJ 1JGSA 5BS6A 1GXPA 3IL2A 3AG4H 4X6AJ 1MBFA 1X1AA 4IIJF 1ETVA 4LD5A 4J9PA 4PCQA 4ED3A 4JV1A 2DA5A 4A3GG 3AG1H 2FOWA 2AGPA 1J5EH 1XGSA 3GTLJ 2OA4A 2F5VA 4OIPF 2M7BA 1JJ6C 4FFOA 2CFXA 4N4OB 4PJLA 3SDBA 2BV6A 3SFIA 2IT0A 1BJTA 5KFVA 4ECXA 1OPCA 4P9FA 1I1KA 4O7RA 4E6KG 3FKIJ 1PP7U 5J2UF 3K4BA 3L09A 3WTSC 3PW0A 3E7LA 3I12A 2E7WA 3G6EI 1NK3P 1JXLA 3BQ1A 1IC8A 1VQNI 5LGTA 2NVTJ 1SFKA 4MLOA 2ATLA 2FQ3A 2OWOA 1PYVA 1X3UA 1QPMA 2LSOA 2JA7J 4O4HF 5E3LA 3H0GA 5GPCA 5M5XJ 2DT5A 5CKTA 4IWYA 2DDBA 4J9NA 1IBKH 2OAZA 3CO7C 4J19A 5BMZA 2K9MA 3TP3A 3GQCA 5E8IA 4CCLA 2R92J 3DBLB 5I47A 4DV0H 4MV4A 3TOBA 2P7VB 2P5LC 1REPC 2JA2A 4A3BJ 2R7LA 4BQNA 4MQVA 1OWTA 3GIKA 2L5QA 3LSJA 2RGVA 2QM3A 1XCBA 2VJJA 1KA8A 5DCMA 4J01A 4E7LA 2R7QA 2YW2A 3FXJA 2V1UA 3WG7H 2HI3A 3F8BA 3F21A 2QGUA 2DW4A 1PVEA 3R5XA 3V8LA 1H8AC 2ZDQA 1VQ6I 1K1SA 3NBZB 3WWIA 4AQYH 3OIQA 2LC2A 1O75A 2COBA 4HQEA 1K61A 4KIGA 4YG2F 1R58A 4C3JJ 1EKPA 3VPRA 1QZYA 4EGQA 1ZG3A 1HLVA 1ETKA 1SCUB 3L2VA 2FLLA 1GV5A 4PSXA 3KYHC 3GTLA 3VODA 1G3TA 3FM3A 3RKXA 1LFUP 1TWAJ 4YJ2F 4DIMA 2DFFA 4ECQA 2GXBA 1JKJB 4M3FA 4D7NA 2CSOA 4UCRA 3LFKA 1OYWA 4ZYHA 1JXSA 4ZHQF 2LK2A 1L0OC 1EHIA 3D1NI 5KFQA 3H4BA 4LB6B 1OQYA 3CCRI 3T9CA 5F0HA 4HLXA 5LMNH 3N40P 2XAGA 1HQCA 2WY8Q 1EF4A 3RKQA 3UZBA 2W00A 3OL3A 4BBSG 1RNLA 4FX0A 3QZ8A 4AVPA 4UHTA 2BHYA 4MFDA 1Y1WA 3WTZA 3K4JA 2VUMJ 1MIJA 3ZOBA 5HNFA 4M3EA 4MV7A 1A36A 1BW6A 4O5VA 3X2QH 1VF9A 2IAIA 3RDIA 4AVZA 3D0SA 4AYBA 1RRJA 2ZDHA 3TY5A 1DU0A 1E2XA 3F6VA 5I5YA 1XNRH 2XCLA 4QWEA 1TWCJ 2C2DA 3S3MA 5KG2A 3P9KA 1L2ZA 1Z7UA 4DIQA 2V5AA 4XLEA 2LBFA 2JJ7A 2JA6A 4UVAA 5BMVF 4RNNA 4X62H 3OYNA 4A5MA 4F4WA 4PJJA 4O7YA 2P6SA 2CW7A 3CMEI 4CH7A 2NXNB 1BIBA 3RZOJ 2Y2ZA 1IXCA 1WR2A 3E97A 4FE4A 5F0FA 1XTAA 4M72A 1MJ9A 2PX9A 3FISA 2Y4RA 4JV5H 4ZYEA 4BGDA 3CTAA 2KFDA 2DA3A 4I99C 1IXSB 3PIPF 1T39A 1CQIB 2IGKA 4K0KH 1EH8A 2XGDA 1I50J 2VBXA 3RQ4A 5ED4A 5I5TA 3GVAA 4P96A 1F43A 2W84A 5CE8A 3I55I 3VDXA 4XICA 2GLTA 2FMAA 1P7IA 5FR9A 4KDPA 1SMTA 2VB6A 3A0HC 3A01B 4LH6A 1B04A 1VBHA 2CV0A 2VQLA 3GF2A 2YZMA 3GZNB 3HSFA 2CYYA 2WTEA 2R7TA 1SEUA 5BYAA 4AWXB 4JOMA 4O7ZA 3I59B 2IVMA 4IRIA 2CWEA 3LSIA 1LNWA 5EEHA 3WU0A 2ZSIB 4CCNA 1XMOH 4MV9A 5FLVA 1WJBA 4I76A 2JVHA 4MO7A 5KFJA 3K3VA 5H20A 2J9GA 2R8GA 2I5UA 2V4JC 2E2HA 3ECHA 4Z2YA 5J8CA 5ICGA 3CVZA 1RPWA 3LWFA 1TWGA 4DUYH 4DR4H 2CO5A 1FY7A 2KLOA 4E7ZA 2OTLI 1S0OA 3F23A 5F27A 2KL4A 5K7HA 4YBZB 2ASLA 3IRRA 3C7JA 1ETWA 2AXLA 2OF7A 3GIJA 3WHBA 2WAEA 4DQNA 1X4PA 4BJ5C 4B43A 3S1MJ 1AKHA 1HDPA 3HG9A 5DGIA 3FMAA 3C1DA 1V9PA 1VQOI 3PN1A 1QHGA 2LDUA 5D5XB 3P9IA 1H9TA 3M8EA 3M1CA 1XDUA 4EMSA 1PX2A 2VUMA 5FFXA 2KSWA 4CGZA 2DMPA 4EV0A 2K40A 2QQBA 2GQRA 3MZ8A 3GO5A 3H36A 2Q8KA 2BOLA 5HLHA 1MDMB 3S1NJ 2R6FA 4HSTA 4DGWB 4BXUA 4RA2A 3QFFA 4IHYA 5FKOA 1LJ9A 2CV2A 4JUZA 2XKOA 3IH3A 4M74A 3U21A 3RPQA 4A5NA 5BR8H 1IBLH 2QSFX 4O3OA 1KJQA 2VBYA 2V9KA 1MMAA 1A6QA 1A9XA 3KEYA 2DQLA 3JAMZ 2ISZA 5CAEB 1ZN2A 2EV0A 2H1LA 3RBDA 3OR1C 2G0EA 2BY1A 1EYZA 4ZDPA 2Y9YA 3MQ0A 3BJOA 4JI7H 1R1UA 3SXYA 4WXDA 4HDUA 3DU5A 3V8KA 1ACIA 2ETHA 2M34A 2R7MA 2ZGIA 1MMNA 1IBMH 3ZQQA 2G7UA 4APMA 4DYQA 4JI0H 3SEQA 3CCUI 1FVIA 5EF6A 5DUKA 1K79A 1BXRA 5EZYF 4QW8A 3GV5B 3T9DA 1MZBA 3C3WA 4I01A 4NC8A 3GW2A 5DD4A 5J1YA 2R5ZA 2JTVA 4I55F 3VA7A 5DG8A 2CMPA 2I10A 4AYBN 1ETYA 3C2BA 5CVJA 3G71I 1J2XA 2XV4S 3LWBA 3S17J 3TW7A 2ID6A 1X58A 3WE3A 3DQVC 1ONVA 1RIOH 4HN2A 5EWGA 2OQGA 4ZOLF 1IOVA 4A3FJ 3W3CA 3BZCA 2QSGX 4L1KA 2UUBH 2ZDGA 2M87A 3J7AK 5E3NA 3OOPA 5ERIA 2K9LA 4C3IJ 1QNTA 1V5GA 1YW8A 5E79C 3M9OB 1WJ5A 1YS6A 1S68A 4CMDA 4M9UA 1T6SA 2O7OA 1Z67A 2DMNA 2Y31A 4PSWA 4U88A 5HDNA 5LLQA 3ISPA 5KFNA 2VA2A 4E70A 4EGYA 2ZFWA 2TCTA 3LSRA 2YYAA 2RNGA 1U8BA 5IYBG 1WRJA 2D5VA 2EJ2A 3ONQA 5FRNA 1BR1A 4LF4H 3M8FA 4YIFA 2OD5A 4QPOA 2PEXA 4RAFA 2E2JJ 3H40A 3G73A 1TT5B 2DCEA 1WJCA 1R4NB 5KT4A 1J59A 5KFOA 4I02A 2NUAB 5JUMA 1ZR2A 2JEGA 2W9AA 1HKQA 1I39A 5EEGA 4O3PA 3LMMA 3QPTA 3BTCA 4UCSA 2DT7B 1S3JA 2P5VA 3F72A 4O3QA 3H5AA 3HSEA 5KHDA 1TWFJ 3IP4B 4A3MJ 1B6AA 3I4PA 4MA0A 3V42A 4OIOF 4A3MG 3OWTA 3S24A 3HGGA 1X1BA 3MEXA 2VPSA 2YPRA 4BXXJ 5KG5A 1U9OA 3QOEA 4HNUA 4XLCA 1DU6A 3TDZC 5J47A 3OYBA 2ABJA 3MKWB 4BQAA 3CMYA 3BDDA 1YW9A 2B0LA 2DA4A 2K3FA 4AIHA 4CZCA 4Y52J 1TL8A 4RZQA 5HDGA 4RB0A 3ML6A 3V6JA 1X3WB 1HBXG 3DPLC 2W6ZA 4EYHB 1P4WA 5EGOB 3JSNA 4O7WA 4IRDA 5TRDA 3K4MA 1Y8RB 2BY0A 4DR7H 3T1YH 2WBMA 4KN7X 4PWQA 1POGA 3Q1KA 2JUCA 1B6RA 3HUGB 5F6FA 5LHGA 4RB1A 3GTJJ 3UYYA 3VEPA 4PZ6A 1CKMA 3HL2A 2EZIA 5HS9A 3MZYA 3H9QA 3ROUA 3TBIA 4FGRA 1KJIA 4O4LF 4O7VA 4F93B 2E60A 5LEKA 3VPBA 4YR3A 1XSVA 4NZNA 3F8NA 4RU9A 4GKJH 3W6JB 2ZMEC 1CQTA 3N6XA 3VNNA 4L9TA 1W7PD 2Y0SA 2MA3A 3MN2A 2V7FA 3KAJA 5KG1A 4A2UA 2DZDA 1YJ9I 2EBIA 3LULA 2EZLA 4G9YA 5BOXA 2W9CA 2NOGA 1UAAA 3WNZA 4DV3H 2D45A 1Z7LA 2E71A 3N8DA 4F55A 2QLZA 4A3DG 3U0GA 1I94H 4MEYF 4ZDOA 2R7KA 3TQTA 3HEFA 5L3EA 1O3SA 2YUSA 2LF8A 4BY1J 3CDLA 3DLLF 2YS9A 1A5JA 2ZSHB 2ICWG 2F5CA 4A6DA 2ALZA 5CVRA 2EA2A 4M6XA 3DKWA 3BAAA 1WWXA 3L1PA 3OHBA 1V3FA 1BOBA 3C2GA 2KZGA 4BYYA 3LSTA 2EA4A 4AIKA 2HIVA 1R9TA 3R0AA 4BS9A 4R8UA 4UUSA 2JA5G 1NTCA 3W2AA 2BW3B 2D1HA 4OU0A 5LOVF 2EJ0A 1YQAA 2HQNA 3KCCA 4WD3A 3M07A 5KT6A 1I6XA 4U0YA 2FK1A 5FLXW 2WY7Q 4JK1X 1QVTA 3FBNB 4XKBA 5ILSA 4HYEA 2WV0A 3TEKA 1MD0A 2VKEA 2CUEA 4IHXA 3G3ZA 1Z77A 1XPXA 4LLLA 3GILA 3RSNA 3GLLA 5CLSA 2XRLA 2JMWA 3GTMA 1PP8F 1MNDA 2W6PA 3IV5A 2K9QA 2VC0A 3SYTA 5HDKA 1IN6A 2YRWA 4HF1A 2F4MB 5BPHA 3H35A 4XRFA 5CJ9A 2XGCA 2JA8G 1SC7A 2VOOA 3T7AA 2X1CA 3NRVA 2BW3A 5E1ZB 4QWBA 2J5PA 3QQMA 3MWDA 3MCZA 2BBYA 3V6HA 5GAEJ 3CUOA 3ASNH 2JUGA 4F91B 2P0AA 3PUBA 3ZMDA 3ZQIA 3T9FA 5LD2C 3G6XA 3BOQA 2AHQA 3FKIA 3MVPA 1HNWH 2JA7G 2RC4A 4C2UA 3KETA 1SMYF 2L2OA 4OWRB 4Y17A 4DL4A 1FSEA 3KXYT 2KIFA 4UY8I 2VPQA 3H5RA 4B3RH 1LQ1A 1SYXB 3RGXA 2CW0F 4A69C 1SFOJ 2K4JA 3RGZA 5BWXA 1G3SA 3WU2C 2XDVA 3OUUA 2R93A 3F9KA 3T9AA 1T94A 5GAGJ 1I1GA 4N9IA 1Y1WJ 5B66C 4JYKA 5C5JA 2L01A 4DR1H 3K7AJ 3K3PA 4L9JA 1ETQA 3W5OA 2EIJH 3DU6A 2ZXJA 4CDGA 4HV5A 4G94A 1RJPA 1OBGA 1RK5A 3WO1A 3E5UA 4DZJA 3EPGA 4HA8A 3UZOA 1FC3A 3F8FA 2ME0A 3HRUA 4QLCU 3PO3G 4BXXG 3K10A 1QQIA 1RYSA 3HOVG 2ZJRF 1ZHFA 3RAXA 2V1XA 3GZ6A 3GFJA 2TRTA 4IVNA 4HPQA 4Q4CA 1JKQC 3BCBA 4A3LJ 1LVKA 4R8HA 3CEBA 4X65H 4EG0A 4XYLB 3VSKA 3PW4A 1S97A 2W24A 5I60A 4LF6H 2EFNA 2OU2A 3FK7A 1EKVA 5A2QZ 3W1GA 2F4VH 1RC9A 1X2NA 2VIXA 2AO9A 4LJZF 4W97A 2M8GX 2CFOA 3F8CA 1FBQA 2DPDA 3CCMI 2MD5A 3G6YA 4C2MJ 2JA6G 5KVRA 1AUVA 4MEXF 4XLAA 4YAKB 3TEDA 3U2RA 3M3YJ 1CGPA 2UWMA 2H8RA 3CC7I 2COIA 2M0CA 4XKWA 4PZ7A 2Y0SE 4GRIA 4GXOA 2ASDA 1T95A 2KZVA 1SD5A 5C3EG 4LK1F 3OYFA 2VUGA 3EUHA 4FTHA 2GOMA 2XC7A 3GV7B 3QYEA 2R93J 1CKNA 4FX4A 2R92G 2HIXA 4HX8A 3SHFA 3HTSB 2UVWA 3OY9A 2IS1A 1V54H 1KQ0A 3OV8A 3E1SA 2JK3A 5IT9W 4FE2A 4OINF 3F22A 3BR2A 1TLHB 1MJBA 3I0TA 2K9SA 4KIBA 4Y33A 5L3CA 3DAAA 1VQ4I 3BT9A 4RAZA 1RKWA 3CQZJ 3BJAA 1R1VA 5LMUH 5I5VA 5K5OA 3BG9A 3ULQB 3ESWB 1GO3E 3HRMA 1BM9A 2PJRB 2IGOA 4ENNA 1N48A 1BOAA 2WE6A 3K69A 4J9KA 3QWLA 1I7LA 3RB4A 4I09A 4HZFA 2PMZA 5GTHC 3DKYA 2FXAA 3KHGA 4YJ3F 4O3MA 3DFGA 3HHGA 4Q47A 2X5RA 1LFBA 2X0SA 4EEQA 1B8IB 5FKNA 2W70A 2LLKA 3WTYC 1SAUA 2A1HA 1ULZA 1YJWI 4ENJA 3KYCB 2XASA 3QP6A 2Y0MA 2FSWA 3BG7A 1LUJB 2BXYA 3A1YA 1I1SA 3PFIA 2QB5A 2DFIA 4RAGA 5LHHA 3TO9A 4BEHB 1XDNA 1TWAA 3V6KA 4AD9A 3KTMA 4E4TA 1UCRA 4BNCA 4EBDA 4G7OF 3DTIA 2HWVA 3RFCA 1I3QJ 3NC0B 1ZTRA 4HDVA 1JKOC 4JX5A 5C4JJ 1MDMA 4Q5SF 3TIIA 4J9OA 2BE5F 2HVSA 2BEOA 4ASNA 4RLQA 2GWRA 2YWVA 2CW8A 2HPMA 4EFBA 1LPQA 3IH4A 4RLFA 3HRTA 3QODA 2Z33A 4BJ6C 1ZHSA 1XMKA 1MSEC 4WK8F 4BBRG 3LA2A 2LVSA 2E2HJ 5KT2A 2R4GA 3SZGA 5KAIC 4TV8F 5AIPA 3RUPA 5TJJA 2RQQA 2LNBA 3IG0A 2W8LA 5IP7G 2CU7A 4Q48A 2RV8A 1WSUA 1KU9A 2I87A 2MD0A 3UFXB 3TQNA 3U55A 2EH3A 2AGOA 2V79A 4GDFA 2UVVA 3DXJF 4O4JF 1HXDA 5I5WA 2NNNA 5KT5A 2W9CB 3L9FA 4FISA 2E5ZA 4B3TH 5JI6A 1EKEA 4HW0A 5LGNA 1FOKA 2R84A 5KFZA 2P7CB 3LNQA 1GXQA 4RMNA 5J3LA 4HYKA 4M6VA 3QQAA 4E7KA 5DGAA 1G3WA 4XQFA 1N77A 1GHCA 1XN7A 3J7YJ 3R61A 3FMRA 4Y13A 3CC2I 1ZK8A 2X1EA 3U9TA 2CKZB 2VA3A 2JEFA 1C0WA 4HEA2 1ZGWA 3K2ZA 5KFYA 4P9UA 4V2FA 5GP9A 1W1WE 1DGWY 2XPUA 3BG6A 4PFOA 1UHWA 4FS2A 4O3RA 2LBFB 5LBQA 2FK3A 2GOXB 3JRXA 4UCVA 3M7GA 3KLNA 5D4SA 1Z3XA 2A6HF 1ITYA 4XKCA 3GTGA 3IC7A 2HQ5A 2HVQA 3FXMA 3TW6A 2K86A 2OTJI 2QYZA 2P8TA 5LP6F 2OUMA 2DJIA 2A69F 1OYYA 3KX2A 1MKMA 3JRFA 3HOUJ 2NU6B 2VQEH 1LEBA 3Q0UA 2DXIA 2NU9B 4G7ZF 2VONA 2R7OA 3ZGKA 1FYKA 2JEIA 3PNYA 3A01A 1UHMA 5J8FA 1U78A 1P4AA 2DFEA 3IN5A 3U1KA 5KS8A 4CYCB 2ZNZA 2PJRA 4B3SH 4I0BA 4ME6A 2E34A 5D6FA 5KFGA 2RVCA 2F5DA 5BQTA 2GQSA 2RDJA 1ZYRF 3QWUA 5HOOA 1IRZA 5EEAA 3J81Z 3GLKA 3GTKA 3CJTB 1X1PA 4A2BA 3SI8A 2EIKH 1ZQ3P 1IV6A 5IY5H 3HO8A 1FOYA 2DN0A 5DG9A 5A2QW 5KT3A 1S0MA 4OX9H 1GUUA 4KIFA 3GMEA 3OIPA 5DISC 1D0ZA 1MBHA 2XSJC 3FXKA 1TQIA 4M9XA 1EJ9A 1Z2NX 3UNGC 2OLSA 5KFWA 1KU7A 3I9V2 4D7MA 4KHPH 4R7RA 4BKXA 4ESFA 4U7CA 2P81A 2IA6A 1S0NA 1FJLA 1UG0A 2O3FA 2RREA 3QU3A 3REOA 2DPUA 4A93G 1CQJB 2BQRA 2OH2A 1CF7A 3K2AA 2BVLA 5K5RA 2PMZE 3O8GA 1SFEA 3BQYA 2FRHA 3C2HA 4XKVA 5J6XA 2JPCA 4B4CA 4FFNA 4KISA 3TQ1A 3MWMA 3VSLA 3CLQA 1RR8C 1B6SA 1FMWA 2CQXA 3G1OA 4Q8EA 4PK4A 3RKYA 1SD6A 3M9AA 3Q0WA 4O6JA 5HS8A 1SANA 5CYVA 3HOZG 3H3VK 3I64A 2UVUA 5FGMA 1BN5A 3S2DJ 4JI3H 3FXQA 3HPHA 2RAEA 4F92B 4HNTA 3OYIA 2DPJA 2CQNA 3FXLA 3S93A 2HOEA 4CCMA 4A3KJ 1I3AA 2O0YA 2WWYA 4YR0A 4B47A 2DA7A 4MTDA 2VQDA 4WX9A 3JRDA 4UV9A 5KG6A 4IRHA 2CQ7A
chains in the Genus database with same CATH topology
1MMAA 3AFHA 3CESA 3KEYA 4H4KC 1D0YA 5CPRB 2Q2TA 4II3A 5CQEA 2LYCA 3DTEA 3OR1C 3MKYB 4ZYAA 4ZDPA 3OYJA 2K3PA 2XF7A 4JI7H 3RTXA 1N78A 3DU5A 4CSWA 4ZC3A 4YY3H 1MMNA 1IBMH 3ZQQA 2WB1A 2VXZA 4APMA 4LFCH 2MABA 4JI0H 3SEQA 2R7XA 4XN3A 2LY1A 1FVIA 4GKKH 4CC5A 5HVQC 4BWSC 2CV1A 4HSRA 3VYTB 1W36D 3PSIA 3QYFA 4NC8A 3RR5A 1MZBA 4JI1H 2Z2SB 4II2A 4XN0A 2KMUA 2VASA 3FDYA 1VS0A 3DF7A 2CMPA 3W1BA 3KAKA 3FHNA 2M3AA 2M4KA 3SEZA 3RTRA 4Y4RA 1K6YA 3D5RC 2R7WA 3DQVC 3G2BA 3W3CA 3PL8A 4BDYA 2UUBH 2LH9A 3FKJA 3TMOA 2VQFH 2W82A 3NWTA 4C30A 1E0EA 3S8PA 3TY8A 3J7AK 2UUAH 2K9LA 4Y3OA 5FRMA 4KJZA 3JSLA 1V5GA 2V9KA 1WJ5A 4DV4H 1S68A 3ZXSA 4LF7H 2MFZA 4PSWA 3PJRA 1XK5A 2QKMB 2E1MB 2HVRA 1N36H 3CJRB 2RNGA 3HC7A 4QPQA 4RM3A 1HR0H 3ONQA 5FRNA 1BR1A 4LF4H 1MMGA 4QPOA 4P5OA 4E7IA 4CC6A 4J0MA 1TA8A 2MYSA 2DCEA 1FMVA 1WJCA 3DPTA 5FPOA 2V6EA 4HRIA 1M0TA 1WJEA 3PNVA 1E4FT 4ITVA 3AL0C 1YX3A 4BE1A 3EYYA 1N75A 1D0XA 1R6RA 1IRXA 2VJ5A 3LMMA 4UCSA 2DT7B 3ZCOA 3N42B 3H5AA 5KHDA 3DKXA 1J09A 3IP4B 4BEHA 4ZTJA 3V42A 3OYMA 4NQWB 1AN7A 3OWTA 4AU7A 3S24A 3MMYB 1X1BA 4LIVA 4PDBA 2VPSA 4E7HA 1I6UA 4E7JA 4PFPA 4D9JA 3QOEA 1DQUA 2ZXIA 4XLCA 4HNUA 2CUZA 3N05A 4CUGA 4UCTA 4LF9H 3OYBA 3OMYA 1X4OA 3MKWB 3IAM2 3J7AY 4CZCA 1OLTA 4RZQA 4X66H 4XNFA 4RB0A 1M0WA 1MW7A 2XF5A 4OAZA 2UXBH 2NOJB 3DPLC 3MKZA 3QYBA 3LSGA 3JSNA 2UXDH 4EATA 3K4MA 4DR7H 3K4CA 3T1YH 4I7HA 4BU2A 3M4IA 2WBMA 1ERDA 3OYEA 4C2TA 2WDTA 1GLNA 3W2VA 2XF6A 3CF2A 3ZR8X 5IWAH 3HUGB 4RB1A 4MTEA 3BA9A 4DV2H 3AKZA 4PZ6A 1CKMA 3HL2A 2LRDA 3TBIA 2HHHH 3H9QA 3IUOA 2DOAA 4NC7A 1JI8A 4F93B 2P0WA 2E60A 1X1DA 1P16A 3F8NA 2F4IA 4GKJH 3N6XA 4DUZH 4OAYA 3VNNA 2Y0SA 2LY2A 2QKLB 3RPUD 2UU9H 2IS2A 2V7FA 5D1OB 3KAJA 3RF2A 4C9YA 2DT6A 1UAAA 3K70D 4DV3H 2YCHA 2LG4A 4XOTA 3TL4X 4IKFA 3RJ0A 4DV1H 1D1BA 1Z7LA 3L2PA 4F55A 1UELB 3HXLA 3BA8A 2V26A 4IQJA 5HNHA 4DBQA 2FUG2 1LFPA 1I94H 4FETA 4ZDOA 2LOOA 2V1NA 4J00A 3L4JA 4ZTFA 2W1OA 4XONA 5TGTA 2I8DA 2VQGA 2ZSHB 4ZDLA 3LSHA 4PJNA 4NNJA 3BAAA 2X6WA 4DBRA 3PNTA 2HGSA 4RAYA 1NG6A 2X51A 3VYRB 1BOBA 3C2GA 3CZ6A 4BE0A 1S03G 1WJDA 4KT6A 2HIVA 3TY9A 3BABA 4BS9A 3JAMW 4LF8H 4ZJZA 3W2AA 4LIUA 4LSAA 2BW3B 4YHHH 3CJQB 2WADA 2CUJA 2IGNA 1DGRM 3PSFA 4DR2H 2W4SA 2VPLA 3OL4A 2VLAA 2Q2UA 2WY7Q 4XKBA 5FD5A 3FBNB 5FLXW 1FJGH 4XR6A 4DR3H 2UUZA 3OYAA 1HNZH 1D1CA 2CS3A 4XL9A 3RSNA 2R7UA 4EFEA 2R7SA 2W7NA 2Z16A 1P9QC 1MNDA 3SYTA 3I3LA 3VYUB 3H0DA 2ZJTA 3LMLA 3H35A 1BGWA 3A2KA 3OS1A 4BXFA 1E4GT 4YELA 2X1CA 2BW3A 5HLTA 4NUBA 4DV7H 4B3XA 3K4LA 1Y56A 2HU9A 2JUGA 3BC8A 2WA0A 4F91B 3PUBA 3UR3C 3OS2A 4R79A 5LD2C 4IQ4A 2JSPA 1HNWH 3IAS2 4C2UA 1MNEA 2VKDA 4GLXA 2HDWA 2L2OA 2X6XA 1AA7A 4OWRB 2VQHA 2CFMA 4N4NB 4EQ5A 3KXYT 4G6TB 4JI2H 2X6YA 3H5RA 4B3RH 1SYXB 4KITB 2R7RA 3RGXA 1S9HA 3RGZA 2KDOA 3RCOA 1FKAH 4JYAH 5FROA 4XOPA 2X1DA 2XDVA 3J80W 3F9KA 3GB8B 2XIGA 4DV5H 1A0IA 1Z2OX 1XNQH 3DWLE 3MD2A 4DR1H 3EPZA 1CKNB 3CP8A 3OYHA 4E6NA 3L4KA 4JI4H 3W5OA 2WAFA 3DU6A 2KPMA 4CCOA 4UCUA 2OC6A 3FBIB 1V5EA 4B48A 3K10A 3EUAA 3LSMA 4DR5H 2CH0A 3L2WA 3NBYB 4DR6H 3DPUA 1LDKB 1YX5A 1TAEA 3S3NA 1DP3A 2KQRA 3L2UA 4HPQA 3L2QA 2E5NA 1SEIA 3LL7A 3OYGA 3UQ8A 3BCBA 1LVKA 4X65H 2OV7A 3DTKA 3VSKA 4LMYA 3D5LA 4LF6H 1WFXA 1DGSA 3W1GA 2F4VH 4BDZA 2VIXA 1G8XA 1T0FC 4LG3A 4JI6H 2HNHA 2HPIA 2CFOA 4CCKA 2BVMA 2O5RA 1NG7A 3BLYA 4RB2C 2R7VA 2O03A 4XLAA 4JI5H 4D1QA 2UWMA 4A2AA 3K6GA 4IAJA 4XORA 3ZRGA 2XAUA 4XKWA 5D1OA 4PZ7A 3K4NA 4GRIA 1LKXA 1T95A 2KZVA 3OYFA 2VUGA 2GOMA 2XC7A 1V5FA 3QYEA 3CP2A 2WAQA 1CKNA 2W57A 2HQAA 2HIXA 1WJFA 3L2RA 1EA3A 2Q1ZB 1MMDA 4RB3C 2LREA 4X0GA 3OY9A 2M7AA 1G59A 2IS1A 1X1AA 3E1SA 5IT9W 1WJAA 4Y33A 2UV1A 4DRFA 1J5EH 4E7SA 4BACA 4RAZA 4PJMA 4DOZA 5LFAA 2F5VA 2M4GA 2M7BA 5LMUH 1N32H 4N4OB 4PJLA 3SDBA 1BJTA 4LF5H 3RIZA 2PJRB 2IGOA 2MCTA 4E6KG 3K4BA 2WE6A 2E5LH 4LFAH 2A6TA 5JHFA 4BE2A 4PZ8A 1X19A 1SFKA 4MLOA 1W36C 5FD6A 4FM9A 2PMZA 1HA8A 4ANJA 1P8LA 2OWOA 1Y6IA 1PYVA 3DKYA 5CKTA 4EEQA 4BQOA 3BCAA 1IBKH 3DLAA 2IXSA 3K4KA 1SAUA 3E0JB 2K9MA 1ZELA 4CCLA 2E1MC 2IS4A 4DV0H 3HOSA 3BG7A 1Z3YA 2JA2A 4B44A 4BUPA 4BQNA 3A1YA 4XMYA 4X64H 2L5QA 2KP6A 1PJRA 2RGVA 3NWSA 2VJJA 3HPGA 5KNLA 1TZLA 4J01A 3HOTA 4BEHB 4E7LA 1XDNA 2R7QA 3H20A 3J81W 4BQQA 3DTIA 3NBZB 4AQYH 3OIQA 2LC2A 1O75A 2RGRA 3NC0B 1XMQH 2VL8A 3OTOH 4NXMH 2HVSA 3L2VA 4RLQA 3T1HH 4PSXA 3VYSB 3KYHC 2CW8A 2HPMA 4EFBA 1TT0A 4RLFA 3QODA 3LFUA 4BJ6C 2L7KA 1WH2A 4UFZA 2Q2EB 1ZHSA 5KCMA 2KRCA 2R4GA 4UCRA 3SZGA 4DJAA 2VJIA 1X9NA 2RQQA 3OR2C 1YE9A 3IG0A 3M8JA 5LMNH 2K5CA 3A4CA 3N40P 2MD0A 2WY8Q 5D1PA 3N41B 2IS6A 5EOYA 1HNXH 4JI8H 2W00A 3OL3A 3PFYA 2WYOA 4NXNH 1GYFA 4PUSA 3K70C 4B3TH 2E5ZA 3S32A 4XLFA 3OYDA 1OR7C 3K4JA 5HNFA 2ZXHA 4M7EA 4RMNA 2VOBA 4MV7A 4E7KA 3N44B 2MC4A 4XQFA 1N77A 4AVZA 4AYBA 3TY5A 1CKOA 4LITA 3N43B 4ETSA 2X1EA 4XLHA 3GBGA 4HEA2 1XNRH 2HZDA 4UCOA 4CCJA 4E4HA 3KYLA 3S3MA 1L2ZA 1DGWY 3BG6A 4DIQA 4PFOA 2UUCH 2AQFA 4XLEA 2LBFA 2LBFB 2GOXB 4UCVA 3VWBA 2F6CA 1Z3XA 3OYLA 4X62H 3OYNA 2UXCH 4XKCA 4PJJA 3H5NA 1X1CA 3OYKA 2CW7A 2HVQA 4CH7A 4U87A 1QU3A 2OUMA 2DJIA 3KX2A 1D1AA 4DV6H 3CMMA 2VQEH 3W2WA 2DXIA 2A5WA 2L9SA 4JV5H 4BGDA 2KHMA 4YEJA 2ZM6H 2R7OA 3ZGKA 3PNYA 3KALA 4CA0A 2IGKA 4K0KH 4BL0B 2ZFUA 4FASD 3RQ4A 2PJRA 4B3SH 3LSKA 3VDXA 2VB6A 5HOOA 3S3OA 4P1WA 3GDEA 3QWUA 4LH6A 4LSXA 1B04A 4A2BA 2CV0A 2L9NA 2VQLA 1QHHD 5LL6b 2JVGA 3OOUA 2R7TA 5CQGA 3DEEA 4JOMA 5A2QW 4YRVA 4OX9H 3H9GA 3LSIA 5DISC 3OIPA 3C0FB 2VXDA 4BJTA 1D0ZA 2ZSIB 4CCNA 2XSJC 4F3QA 1XMOH 4MV9A 2KRHA 1WJBA 3UNGC 2JVHA 1Z2NX 3K3VA 1ZHQA 3I9V2 3OYCA 1BR2A 2ELJA 2V4JC 4KHPH 4Q0YA 3CVZA 4R7RA 2IGMA 2VJ4A 4DUYH 4DR4H 4F52A 2KLOA 3OS0A 4E7ZA 3H9JA 1BR4A 1UG0A 1N33H 3HKZA 4IX7A 2RREA 1Z21A 2KL4A 2BVLA 4XM3A 2AQEA 1N34H 3C2HA 1U0JA 2Z1DA 2WAEA 3GJXB 1X4PA 4JQFA 4XKVA 4BJ5C 4B43A 2M0MA 4B3MH 4RM2A 4LH7A 4KISA 3EUKL 3FMAA 3HG9A 4IZZA 3MWMA 3VSLA 1V9PA 3PN1A 3EUHC 1QHGA 1FMWA 3M1CA 4PK4A 4U7BA 4HG2A 1VZ0A 2KSWA 4LFBH 1KONA 3D5SC 4JI3H 3HPHA 2BOLA 2X85A 4HNTA 4F92B 3OYIA 1Z2PX 4HSTA 4DGWB 3S93A 4CCMA 2CV2A 3U21A 5BR8H 4B47A 2VQCA 1IBLH 4MTDA 3AL0B 2FE3A 5FPRA 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCV A;  1B04 A;  1TA8 A;  2HIV A;  3TY9 A;  5D1O B;  3GJX B;  3BAB A;  1CKN A;  1P8L A;  3NBZ B;  2Q2T A;  2OWO A;  5FPO A;  2HIX A;  4LH7 A;  2HVQ A;  1DGS A;  3GB8 B;  3NC0 B;  3W1G A;  3JSN A;  1A0I A;  1V9P A;  5DIS C;  3PN1 A;  5FPR A;  3RTX A;  1CKN B;  3TY8 A;  4EEQ A;  4E6N A;  2HVS A;  4UCS A;  4DRF A;  3L2P A;  3JSL A;  3KYH C;  3W5O A;  3BA8 A;  2Q2U A;  4EFB A;  1FVI A;  1S68 A;  4CC6 A;  4UCU A;  3TY5 A;  4UFZ A;  1CKO A;  4CC5 A;  3BA9 A;  3S24 A;  1XK5 A;  4PZ6 A;  1CKM A;  3QWU A;  2HVR A;  4UCR A;  3RR5 A;  4UCO A;  1X9N A;  4GLX A;  4EFE A;  3NBY B;  2CFM A;  5D1O A;  4EQ5 A;  1VS0 A;  4PZ7 A;  1TAE A;  3BAA A;  4UCT A;  1P16 A;  1XDN A;  3W1B A;  5D1P A;  4PZ8 A;  3GDE A;  3VNN A;  2VUG A;  3UQ8 A;  4LH6 A; 
#chains in the Genus database with same CATH topology
 3E6D A;  1CS0 A;  5EWE A;  5CPR B;  3WTV C;  1FTZ A;  2AQ4 A;  2OZ6 A;  2LYC A;  3DTE A;  5CQE A;  1XS9 A;  3MKY B;  4ZYA A;  4K2E A;  2HFH A;  1N78 A;  2WAQ N;  3T1B A;  4M0J A;  1LDD A;  3WTU C;  4YY3 H;  4V2G A;  5TIS C;  4LFC H;  2FEZ A;  1VND A;  2KRF A;  3CCE I;  1S7E A;  2ID3 A;  1XG1 A;  2ZXW H;  5HVQ C;  1FPQ A;  2R92 A;  2CV1 A;  1PUE E;  3PSI A;  4II2 A;  2X6O A;  4ECS A;  1JT6 A;  3KE2 A;  2YU9 A;  4P55 A;  5JLX A;  3FHN A;  3I71 A;  2M4K A;  1APL C;  5IT9 Z;  5C4X G;  2FQ4 A;  4O84 A;  4L5J A;  3KZY A;  3RTR A;  4JP0 A;  2GA2 A;  3D5R C;  3ECO A;  4XRS A;  3QPS A;  2FP4 B;  4RGR A;  1OIS A;  5J40 A;  5D8K B;  3H4D A;  3F0C A;  1SAX A;  3JTH A;  4BHC A;  1WI3 A;  4Y7N J;  2HKO A;  2W82 A;  3NWT A;  3TY8 A;  1Y0U A;  2UUA H;  3HUG A;  4FBT A;  4KJZ A;  2L7Z A;  3PO3 J;  5EZG A;  3FZV A;  3R6S A;  1VQ7 I;  4DV4 H;  2BYV E;  2WC2 A;  3VFZ A;  2FA5 A;  2QEN A;  2QKM B;  4A0Z A;  1DPR A;  4CIC A;  4KUM A;  1IUY A;  1A3G A;  3HC7 A;  4LOC A;  2O8X A;  1UNN C;  3HOX J;  3F3X A;  5LHI A;  1KJ9 A;  2R7F A;  2X9D A;  3HOX G;  1TNT A;  1H88 C;  2AS5 F;  1IYE A;  1E17 A;  1KBL A;  2WV1 A;  2JEJ A;  4UB6 C;  1ZH5 A;  2DAO A;  3R23 A;  3DPT A;  5E20 A;  2H8W A;  2H09 A;  4HRI A;  1M0T A;  1E4F T;  5KG3 A;  2JA7 A;  3MWE A;  3EYY A;  1D0X A;  1GVJ A;  5ICC A;  3PIO F;  3N42 B;  4R1H A;  3AG3 H;  3A0B C;  3MR5 A;  5AIQ A;  4AU7 A;  3GLX A;  3OSP A;  4LIV A;  4PDB A;  1I6U A;  3U9G A;  4E7J A;  3LP8 A;  2HDD A;  1DQU A;  4IRK A;  4I2O A;  3O8H A;  4CUG A;  2L4A A;  4LF9 H;  3GWZ A;  1X4O A;  4ED8 A;  1PUF A;  5IT9 K;  1JDB B;  1YW7 A;  1M0W A;  1MW7 A;  3Q8Q B;  2IW5 A;  2UXB H;  4X1E A;  2NOJ B;  3K9T A;  5IYB J;  4JX4 A;  4UNO A;  5GON F;  2HYJ A;  3QYB A;  4WF2 A;  4ECW A;  2UXD H;  2WTF A;  3ETH A;  4I7H A;  4BU2 A;  3M4I A;  1YJN I;  2OZU A;  3OYE A;  4YR2 A;  5ILV A;  1Y14 B;  2QQA A;  2E36 A;  4GO1 A;  3ZR8 X;  5C1O A;  5L3D A;  1AUX A;  3DBR B;  4MTE A;  2L0K A;  3T0Y A;  3AKZ A;  3BA9 A;  4Q44 A;  4ECZ A;  2FF4 A;  2QSH X;  3E5X A;  2LRD A;  2E2I J;  4AM3 A;  1Y1W G;  3MKL A;  1E3H A;  2DOA A;  2EIL H;  1JI8 A;  1W7P B;  3KHL A;  2HYG D;  3E6M A;  3PW7 A;  1X1D A;  2DLN A;  1RK6 A;  2EIN H;  3KIO A;  1P16 A;  2F4I A;  3HRS A;  2Y9Z A;  4NYE A;  3BR1 A;  2EJ3 A;  3VOT A;  3PW2 A;  2DA2 A;  2Y0S N;  1J5Y A;  2PBI A;  1KU2 A;  3BTI A;  4F4Y A;  5K1Y A;  3ASO H;  5D1O B;  1VAJ A;  2X48 A;  5KFP A;  1K83 A;  5BPI A;  1BBY A;  2VN2 A;  2GPS A;  4O81 A;  1TTY A;  3S1Q J;  2LKS A;  4G3I A;  4UUG A;  1QZE A;  4WCG A;  4QWC A;  1K7A A;  3RJ0 A;  4ZH4 F;  3WO0 A;  3TL4 X;  1D1B A;  3QAH A;  2GZW A;  4MA5 A;  1WH5 A;  1WRV A;  1MBK A;  2V26 A;  4HF2 A;  5HNH A;  1RUO A;  5BWV A;  1U2W A;  4DBQ A;  1LFP A;  5LEJ A;  4FET A;  3M9M B;  4AC0 A;  2V1N A;  3L4J A;  4EBC A;  4Q8F A;  2N8G A;  1RET A;  4XON A;  1Z1D A;  2I8D A;  3V7C A;  4ZDL A;  2L7F P;  5CA1 F;  2B63 A;  4IHW A;  4ZZD A;  4QSH A;  2EFQ A;  4DBR A;  3M9N B;  1Y1V G;  4RAY A;  2HGS A;  1DV1 A;  2JA6 J;  2ZNY A;  3T9B A;  4EYI B;  1JT0 A;  1TW3 A;  3MFK A;  4FHT A;  4EM0 B;  1QPI A;  5LGU A;  3BAB A;  3GID A;  5FO5 A;  3I5U A;  3PQJ A;  4LSA A;  2L02 A;  2EFW A;  4KYW A;  3GFI A;  1BI0 A;  1J9I A;  2W4S A;  2CRG A;  2UXX A;  2Q2U A;  1OJL A;  2COJ A;  5EDW A;  1IN7 A;  3I58 A;  2DAA A;  5KFT A;  2UUZ A;  4A3C G;  1TC3 C;  4CZZ A;  1HNZ H;  1XGO A;  1S03 G;  1IGN A;  4YFN F;  2R7U A;  1K1Q A;  4LB5 A;  2W7N A;  4L18 B;  2F5E A;  4FU0 A;  4O7L A;  1YRN A;  3T9E A;  2Z16 A;  2ZBK A;  3FMS A;  3SDG A;  1SFX A;  1R4M B;  5ICF A;  4YFK F;  3EYI A;  3S14 J;  3VYU B;  4U0V A;  3HJE A;  5J1R A;  2GLO A;  1G4D A;  3DV8 A;  3KP6 A;  1IOW A;  3ZQH A;  4KMU X;  1SVO A;  3U1D A;  2Z5U A;  3WG9 A;  4BXF A;  1R71 A;  1E4G T;  3WGH A;  5HLT A;  4NUB A;  4DV7 H;  4CE5 A;  3LQR A;  1XDS A;  1G2W A;  3K4L A;  5DGH A;  5KFK A;  5DLF A;  4QIW N;  1R00 A;  4AID A;  1IDZ A;  5B1A H;  1V4Y A;  4QWA A;  3ABL H;  3IAS 2;  1MNE A;  2HZT A;  3G1L A;  2VKD A;  4YP3 A;  1AA7 A;  2LTP A;  2VQH A;  4B09 A;  4EQ5 A;  3WTX C;  4KIT B;  3BJY A;  2W48 A;  1PUF B;  2C22 A;  2L4M A;  1S9H A;  2F5F A;  4IHT A;  1IV8 A;  2KDO A;  3RCO A;  1FKA H;  2GXG A;  3J80 W;  3Q8R B;  5EJC A;  3OSG A;  2XIG A;  3KPH A;  3R60 A;  3E5N A;  3GB8 B;  3MJF A;  3KHH A;  2XCP A;  3GFL A;  3JR9 A;  3MD2 A;  3JRB A;  3EPZ A;  4YQW A;  4A3E J;  3T5X A;  4E6N A;  2PN6 A;  4YAJ B;  3L4K A;  1TP4 A;  2YL2 A;  1AU7 A;  4DL7 A;  1WSC A;  2WAF A;  3FXO A;  4O7S A;  2A5Y B;  5L1J A;  2ESN A;  2K85 A;  1FOX A;  3FBI B;  3RIR A;  4J9R A;  2BY3 A;  1K4T A;  3PM1 A;  4J9Q A;  2VE9 A;  3GTQ A;  1V5E A;  4L9N A;  2C2E A;  4EEY A;  1ZRC A;  3LSM A;  4O82 A;  3DBH B;  3DPU A;  1WPK A;  1VQ9 I;  1TAE A;  3IRQ A;  5DTD A;  2YS7 A;  3L2Q A;  2L3D A;  4F4Z A;  5JVD F;  1ZRF A;  1F1Z A;  5KAF C;  3JRH A;  3I4M J;  3DTK A;  1XSX A;  2QF7 A;  3BZ6 A;  2R86 A;  4DL3 A;  3H1C A;  1E3P A;  2X4H A;  3S15 J;  1DGS A;  4I0A A;  2DOE A;  2VBZ A;  1G8X A;  4LG3 A;  5B5E C;  4CCK A;  3MFI A;  2O5R A;  1NG7 A;  3BLY A;  1JE8 A;  2R7V A;  1XCV A;  1T98 A;  2A3S A;  3E6C C;  1R5H A;  4DAA A;  1V55 H;  5KFR A;  4CHU A;  1FYL A;  2F4O B;  3GTO A;  4L5I A;  1MSF C;  1K78 B;  4HBL A;  4XOR A;  3ZRG A;  1VTN C;  1SVL A;  2EB7 A;  3K4N A;  3T5K A;  4DL6 A;  4RNO A;  4HAM A;  3BG3 A;  4LGW A;  2KDZ A;  4O4I F;  3CCJ I;  1F4K A;  2CNV A;  3NGD A;  2HQA A;  2V9V A;  3JRI A;  2W7O A;  5BWT A;  4A12 A;  1MMD A;  4RB3 C;  2LRE A;  4X0G A;  1C30 A;  2M7A A;  1S7A A;  1Z6T A;  1G59 A;  1WJA A;  2NNY A;  3E6B A;  5KFD A;  2UV1 A;  4TQR A;  1QVU A;  2DO7 A;  1XMX A;  1JHH A;  3BY6 A;  5B1B H;  4PJM A;  3RB3 A;  2VT3 A;  2MGQ A;  1R5I D;  1B33 N;  1N32 H;  1XD7 A;  5KG4 A;  3TO7 A;  2DMQ A;  2E35 A;  2EZH A;  2HXI A;  5GPA A;  5EDN A;  3A03 A;  3BQ0 A;  2E5L H;  2XAQ A;  2M5W A;  4ENK A;  2ZC2 A;  1NK2 P;  2A6T A;  3LQQ A;  5D5V B;  1Y0N A;  1R1T A;  1Y1V A;  3FF5 A;  5FD6 A;  1YS7 A;  3ABU A;  1Y6I A;  2IPQ X;  1R7J A;  3EDP A;  2QA4 I;  4TV9 F;  3SE7 A;  2JZY A;  1P2F A;  5JVG F;  4ED6 A;  2W6M A;  3KHR A;  5E25 A;  1U6G A;  2M2E A;  2FJ1 A;  3BCA A;  4BY7 J;  4GLW A;  1I27 A;  5KK1 A;  4ZZL A;  3CF5 F;  1QA6 A;  1RJQ A;  5M5W J;  1ZEL A;  5H6R A;  3B6A A;  2E1M C;  5J2T F;  4TQS A;  2YX7 A;  1ZAO A;  1Z3Y A;  3NUA A;  3GCM A;  1MJA A;  3GFM A;  2LR8 A;  2ZB9 A;  3L7W A;  4B44 A;  4EQQ A;  1VBG A;  4X64 H;  2QQ8 A;  2KP6 A;  5KX5 F;  1XGM A;  3HBL A;  3NWS A;  2YX4 A;  5DG7 A;  1TZL A;  3NQO A;  5L3G A;  3HOT A;  5K3W A;  1EUC B;  2LKX A;  4HQM A;  1KEE A;  1A04 A;  2XPV A;  4KN4 X;  2CQK A;  3NAU A;  4IHV A;  2RGR A;  1ZAU A;  2ASJ A;  2OPT A;  2XPW A;  4KA4 A;  1ZGA A;  2NS8 A;  2ME6 A;  3OTO H;  3LA3 A;  3ABM H;  3HOV J;  3EET A;  2P4W A;  5C8Y F;  1KGS A;  3T1H H;  1H9G A;  3VYS B;  2HR3 A;  4RUA A;  2WB1 E;  4ED7 A;  2EQR A;  2L7K A;  4UFZ A;  2Q2E B;  1U8R A;  1Z6R A;  1TWH J;  1DPU A;  4ED0 A;  3RBE A;  3SGI A;  5LXT F;  4HX7 A;  1RR7 A;  2VJI A;  4DJA A;  1X9N A;  1YE9 A;  5DQI A;  1HW1 A;  2R8I A;  2K5C A;  3A4C A;  2XGX A;  2DQR A;  1EZ1 A;  5D1P A;  1XMA A;  4WXC A;  2NS7 A;  3CCQ I;  3N41 B;  5EOY A;  2R8K A;  1JUP A;  1O7L A;  2HGC A;  3KLO A;  3WOD F;  4JXU A;  3BRO A;  5KFS A;  2RNJ A;  1YIJ I;  4EBE A;  2DMT A;  3PFY A;  2WYO A;  3OUZ A;  1GYF A;  1FT9 A;  3S1R J;  3CMA I;  4A3K G;  2C2R A;  5EG0 A;  4KMF A;  4XLF A;  1OR7 C;  1P6R A;  2ZXH A;  5IYD J;  4M7E A;  4A3E G;  1W0T A;  3CCL I;  3BR3 A;  3TIG A;  2VOB A;  2MC4 A;  2OCE A;  4IR1 A;  3FWE A;  2XAJ A;  4CHI A;  1O7F A;  4PDK A;  1CKO A;  4NZM A;  3N43 B;  4Q4D A;  3A02 A;  1HKS A;  4XLH A;  2GM4 A;  3LA7 A;  2XHK A;  4MHG A;  4OOI A;  4CCJ A;  4UCO A;  1K78 A;  2XAF A;  5LRR A;  3KP2 A;  5GAH J;  3T8R A;  2GXA A;  2UUC H;  2AQF A;  1IUF A;  5FLX Z;  3I53 A;  4ESB A;  3OYL A;  4C5A A;  2EIM H;  2UXC H;  2C6Y A;  5FKM A;  2X0L A;  3H5N A;  1W5C C;  4OMY A;  3H0G G;  2LP0 A;  4U87 A;  3S16 J;  3JW4 A;  4CYC A;  2GIV A;  5JQW A;  4DV6 H;  3H3U A;  1G3Y A;  2B9S A;  3W2W A;  3EQL F;  2L9S A;  5K2M A;  2ZM6 H;  2P5K A;  5E17 F;  5IT3 A;  1BA5 A;  1TWH A;  4A6E A;  4CA0 A;  3K1N A;  4W1U A;  1FWZ A;  2ZFU A;  5HS7 A;  3ZQ7 A;  1HSJ A;  2EFO A;  4FAS D;  2FBK A;  2Q0O A;  2JA5 A;  1V4R A;  1WVR A;  1UFM A;  3ZPL A;  1W5S A;  3QP5 A;  3T5L A;  2ZKZ A;  1MH4 A;  2UXN A;  2MW8 A;  4P1W A;  5BWU A;  4LSX A;  1U3E M;  4GC6 A;  1X2M A;  3PO2 G;  3J80 Z;  4O86 A;  2L9N A;  3BTJ A;  1QHH D;  2RF4 A;  5LL6 b;  2JVG A;  3OOU A;  4RNM A;  5KFE A;  4CXF A;  2BZT A;  3ELK A;  2XRN A;  3E5Q A;  5B3S H;  2JN6 A;  4J9M A;  2LMD A;  2ZCW A;  1GDT A;  3H9G A;  1HC8 A;  2XD4 A;  4XSX F;  3Q0V A;  4BJT A;  4F3Q A;  5H2F C;  1WCM A;  1K6O A;  3OIO A;  3SFZ A;  1B72 A;  3OYC A;  4S04 A;  1BR2 A;  2ELJ A;  1Q1H A;  4F50 A;  5E1W A;  1DAA A;  4ED1 A;  1S72 I;  2IGM A;  3DEW A;  5DD8 A;  4HNV A;  2ACJ A;  4F52 A;  4XX0 B;  1O3Q A;  1BR4 A;  3ZMZ A;  2QQ9 A;  2K02 A;  1YTY A;  3HKZ A;  2NVU B;  1I6H J;  2VI6 A;  1KUT A;  3JZ6 A;  4Y8V B;  2HG8 A;  2M1B A;  2AQE A;  5JHU A;  3HM5 A;  1N34 H;  4C5C A;  5FLX K;  4K6N A;  3GJX B;  2HDC A;  4JQF A;  1H89 C;  1A0G A;  5KFU A;  4BHP A;  3KEO A;  4B3M H;  3EUK L;  4IZZ A;  2KT0 A;  4NZO A;  4JBA A;  2ISY A;  1I2L A;  2EJR A;  2FPP B;  2AGQ A;  3GX4 X;  1VZ0 A;  2XUB A;  4A3D J;  4IR9 A;  2P6T A;  3K5H A;  4FFR A;  4LFB H;  2W85 A;  2FLN A;  3RKW A;  2DAB A;  5KFX A;  2XB0 X;  2XGE A;  3D5S C;  5C4X J;  5FB2 A;  5FJ8 J;  2DWC A;  2X85 A;  3F6O A;  3JZI A;  3ERE D;  1U9N A;  3L00 A;  5DGB A;  4IO9 F;  2RQP A;  1IRG A;  1RUN A;  1LVA A;  1TQM A;  4OMZ A;  2VQC A;  1OMI A;  1N56 A;  4I98 B;  4IOA F;  5F9N A;  5FPR A;  2GIZ A;  3TO6 A;  2VKH A;  2R5Y A;  3G8D A;  4QW9 A;  1Y39 A;  1D0Y A;  3SZP A;  2O6G E;  2Q2T A;  4II3 A;  1OCT C;  4A3I G;  3Q9V A;  2XB5 A;  3OYJ A;  4GYI A;  2K9N A;  2XF7 A;  3I4N G;  1DDN A;  1FEX A;  4ZC3 A;  1N25 A;  2WB1 A;  2VXZ A;  3I4N J;  1LE8 B;  2R7X A;  2R7D A;  1GV2 A;  1IRF A;  2LY1 A;  4G6D A;  4XN3 A;  4CYD A;  3RAQ A;  4CC5 A;  4GKK H;  1S10 A;  1TQP A;  4BWS C;  4HSR A;  1W36 D;  1IDY A;  1YIT I;  1AKH B;  1ZRD A;  1NH3 A;  3RR5 A;  2J6S A;  1KYW A;  4JI1 H;  5DM7 F;  1OFC X;  5KG7 A;  3GIQ A;  3CCS I;  4L0Z B;  2MG4 A;  3W1B A;  4IF4 A;  5C44 G;  5GTI C;  3SEZ A;  3C18 A;  2HOA A;  4Y4R A;  1K6Y A;  5C44 J;  1IN8 A;  2R7W A;  1V51 A;  1O3T A;  4BBS J;  5K7F A;  3V4Z A;  5CVV A;  2VKV A;  3G2B A;  4M9S A;  5FKK A;  1FIP A;  5M5Y J;  3JZF A;  3KP5 A;  3PL8 A;  4BDY A;  1I3Q A;  2VQF H;  3FKJ A;  2DOD A;  4C30 A;  1B4A A;  5IYD G;  4M6Y A;  2VOP A;  1JTX A;  1T8I A;  2NRA C;  5KFC A;  5L1L A;  2IA1 A;  3HDD A;  2DIK A;  1VFC A;  3JSL A;  1CF7 B;  3N6R A;  4XK4 A;  3WGG A;  2RDP A;  4EGJ A;  1GVD A;  4LF7 H;  2QZ8 A;  3ORR A;  2QBY B;  4F4X A;  1XK5 A;  2V58 A;  4ON0 A;  3CJN A;  2YZG A;  2E1M B;  2HVR A;  4HQ6 A;  4IHJ F;  1N36 H;  2XGQ A;  3CJR B;  5F0C A;  2COG A;  2CG4 A;  4QPQ A;  3AG2 H;  4RM3 A;  5IP6 A;  3Q8P B;  3TIN A;  1MMG A;  4CC6 A;  4J0M A;  5KFM A;  1Z05 A;  1TA8 A;  3WE2 A;  4MV1 A;  4MIM A;  2MYS A;  2R87 A;  1FMV A;  5F1J A;  4KNY A;  4IHS A;  2R82 A;  4G8X A;  4FFM A;  5FPO A;  5FLM G;  3I59 A;  2ODT X;  3BAC A;  1WJE A;  4ITV A;  1YX3 A;  5CA0 F;  1RES A;  2M9H A;  2A05 A;  1G6N A;  2QYO A;  4PGH A;  3PUF A;  1R6R A;  1KZH A;  2JRT A;  4HX4 A;  3V7S A;  3ZQL A;  3V4S A;  5KFF A;  2Z04 A;  3ZCO A;  1U5T B;  1LDJ A;  4MFE A;  3JCU C;  3QZ7 A;  4BEH A;  2IJL A;  3PVX A;  4NQW B;  1T38 A;  1AN7 A;  2LY9 A;  1ZET A;  4E7H A;  2BY2 A;  4PFP A;  4D9J A;  3N05 A;  4UCT A;  3OMY A;  3KZZ A;  3IAM 2;  4OIQ F;  4FT8 A;  4X66 H;  1UZC A;  1GSA A;  4XNF A;  1MGT A;  3F8M A;  5KT7 A;  3WTT C;  4XRS G;  1BC7 C;  4A3J G;  3DEU A;  1AHD P;  3MKZ A;  4XID A;  5DCF A;  3ZQG A;  5JVT A;  1MNM C;  3K4C A;  1WCM J;  1DIK A;  5BPF A;  4C2T A;  2K27 A;  2WDT A;  1WQ2 A;  3CF2 A;  5L9X A;  1KTA A;  2DI3 A;  2VC1 A;  3MR3 A;  2DA6 A;  2GAU A;  3RB6 A;  3HB9 A;  2NS0 A;  1OCC H;  1VQ8 I;  3HKZ E;  5IYZ F;  5I5U A;  3W6V A;  2Z99 A;  5K5Q A;  1DV2 A;  1T2K A;  4OAY A;  2FU4 A;  3FK6 A;  4PJ0 C;  4EM1 A;  3RPU D;  5DQH A;  3DF8 A;  2UU9 H;  2QUF A;  2BQU A;  2MC3 A;  2R7Z J;  2KIU A;  3GTJ A;  3NEU A;  4GCV A;  4LK0 F;  2IP4 A;  4C9Y A;  5F9L A;  1O57 A;  2KIS A;  2E2I A;  3R9R A;  1ULY A;  3QU6 A;  4MV3 A;  3DTG A;  2Q2E A;  2LG4 A;  4XOT A;  4IKF A;  1GGO A;  1KU3 A;  1E4E B;  4ECT A;  1I1M A;  3HXL A;  2RDI A;  4DYR A;  4IQJ A;  4ZQI A;  2FUG 2;  3CUQ C;  1HW2 A;  4YB8 B;  3CO6 C;  2EK5 A;  4XBF A;  3GTQ J;  5J1U A;  2NYX A;  4J00 A;  4ZTF A;  2W1O A;  4LFU A;  2HKX A;  2VQG A;  2HTJ A;  3Q9S A;  3LSH A;  4PJN A;  2I8C A;  3VB2 A;  1JDE A;  1NG6 A;  2X51 A;  5JVL A;  2E1O A;  1HST A;  4BE0 A;  1IO2 A;  2W7P A;  2BR0 A;  4I4T F;  1RKT A;  1UG2 A;  1WJD A;  4KT6 A;  1A6I A;  4IPA A;  4ESJ A;  2STW A;  1T36 A;  4UUV A;  2E19 A;  4LF8 H;  2NVY A;  3ETJ A;  4LIU A;  2XRO A;  4YHH H;  2R8J A;  1OCP A;  3ZN1 A;  1D8K A;  1ZLJ A;  1XC5 A;  3COA C;  2IGN A;  3GTM J;  2V4R A;  1BI1 A;  1UST A;  5BWR A;  1P4X A;  3G4S I;  3AX6 A;  2DK8 A;  5FD5 A;  1HDD C;  2CQY A;  3KEQ A;  3GEZ A;  4XR6 A;  1FJG H;  2HXO A;  4ZYD A;  2V9P A;  1U5T C;  1QGP A;  4F7Z A;  1YHQ I;  2IEK A;  1ET0 A;  1VQM I;  4IWX A;  1HW5 A;  2R7S A;  4NDL A;  3GYH X;  3RYR A;  2KKO A;  1UB9 A;  1FBS A;  3HTU A;  2BHZ A;  3I3L A;  2DJN A;  1RI7 A;  3K1M A;  5DYM A;  2FPI B;  2FPG B;  1YO5 C;  4NBQ A;  4EM2 A;  2ZJT A;  3R5F A;  4M3B A;  3A2K A;  1BGW A;  3CSW A;  1KJ8 A;  4NHJ A;  4I6Z A;  2L7M P;  4YEL A;  2JA8 J;  2H94 A;  4RS8 A;  1FNN A;  4B3X A;  5KFL A;  1JX4 A;  1D5Y A;  1B72 B;  5EZH A;  1Y56 A;  2HU9 A;  5DAA A;  3BC8 A;  3LQS A;  3HOW J;  5KFB A;  5E1X A;  3UR3 C;  2EIY A;  4DW6 A;  4R79 A;  5CR5 A;  1SVM A;  1SFU A;  5J4V A;  4GLX A;  2X6X A;  5DS9 A;  4ECR A;  2CFM A;  4BY7 G;  2B63 G;  4G6T B;  1VQP I;  4JI2 H;  2X6Y A;  3DCF A;  2B7E A;  2OQR A;  3ERM A;  4TVI A;  2DK5 A;  3RV4 A;  3P5J A;  1SD7 A;  1LE8 A;  3BJ6 A;  3K0L A;  5BNG A;  3GTP A;  4JYA H;  1STZ A;  1WGX A;  1YYV A;  4XOP A;  5FLM J;  4J9S A;  2M8E A;  3TOA A;  2NU7 B;  5EGO A;  4DV5 H;  1USS A;  4BAY A;  1C3O A;  1A0I A;  2PLY A;  2IBK A;  1D5V A;  2PJP A;  5FFZ A;  2NVX A;  2L9V A;  3CP8 A;  4JI4 H;  2E1C A;  3J7A O;  4O7N A;  2FK2 A;  2KPM A;  3B02 A;  2PBZ A;  3VPD A;  2OC6 A;  3AYH B;  3DP7 A;  3Q5F A;  1ZQ7 A;  1XB4 A;  2EV6 A;  1JUM A;  1S7O A;  2Y69 H;  4B48 A;  3QRF F;  2O8K A;  5CB4 F;  3EUA A;  2EWN A;  3L2W A;  3NBY B;  3CUQ B;  1YLF A;  1T3N A;  1YX5 A;  3S3N A;  3L2U A;  4H0E A;  3VMM A;  2R5Y B;  3LL7 A;  3OYG A;  1UC8 A;  4RDU A;  5ILU A;  2OV7 A;  3T54 A;  1F5T A;  2F48 A;  5DMX A;  1NHA A;  4LMY A;  3ZP5 A;  3D5L A;  3ZQC A;  2J6T A;  1GT0 C;  1WFX A;  2E7X A;  4S05 A;  1FTT A;  1FP2 A;  3ORQ A;  3S2W A;  4BDZ A;  3HIF A;  1EH6 A;  2DBB A;  2HPI A;  3KZI C;  2YU9 J;  2BVM A;  2V4Q A;  3FX3 A;  4RB2 C;  1TWC A;  3O3K A;  1Z91 A;  1JIH A;  3T5H A;  2O03 A;  3Q8S B;  1IYD A;  1MBJ A;  4ECU A;  1JGG A;  4JI5 H;  4D1Q A;  1BNC A;  4A2A A;  1FBU A;  1AOY A;  2XAH A;  4GYG A;  2BXZ A;  4LLN A;  5D1O A;  3CCY A;  1YG2 A;  3IKT A;  1OCO H;  1UJ8 A;  1LKX A;  3ZMS A;  4YIR X;  2OJE D;  1GSO A;  2EPF A;  2HOT A;  4C2M A;  2DTZ A;  2WB1 N;  3CP2 A;  5D5U B;  4FCY A;  4WWC A;  1UHS A;  3LAJ A;  2W57 A;  2R5Z B;  1DP7 P;  3K5I A;  1WHU A;  3L2R A;  1K4S A;  4MNU A;  1J7K A;  2R93 G;  1EA3 A;  2Q1Z B;  3RB0 A;  2STT A;  1ON2 A;  4DL2 A;  4DRF A;  4O3N A;  3I4M G;  4E7S A;  4BAC A;  2CUF A;  4DOZ A;  5LFA A;  2M4G A;  3V8J A;  3PFF A;  2R7Z A;  4LF5 H;  3RIZ A;  3H0G J;  5M3F J;  2CNU A;  3WWJ A;  3MFH A;  2MCT A;  1ETX A;  2G7H A;  2R7N A;  4WXH A;  5DV5 A;  4LFA H;  3I54 A;  2KIM A;  3CD6 I;  2UVR A;  1BL0 A;  5JHF A;  4BE2 A;  4PZ8 A;  2FOK A;  1S6L A;  1X19 A;  1B9N A;  1W36 C;  1UC9 A;  2ECB A;  1I50 A;  4FM9 A;  1HA8 A;  4ANJ A;  1P8L A;  3R5H A;  4RUC A;  4Q43 A;  5EYR A;  2YR2 A;  3T99 A;  2VT2 A;  5A2Q K;  1TWG J;  4BQO A;  3JSO A;  1HKT A;  3DLA A;  2IXS A;  1O3R A;  2O61 A;  4Q4Z F;  1S8N A;  3K4K A;  2DTR A;  3E0J B;  1U5T A;  2HOS A;  4MAM A;  4MV6 A;  1ZKG A;  4CKE A;  3J80 K;  2R8H A;  4BHB A;  3VOE A;  2IS4 A;  2AU0 A;  3WTW C;  1B9M A;  3HOS A;  3AAF A;  4A0X A;  5CM0 A;  3GIP A;  3G6V A;  2K4B A;  2MBF A;  2Y30 A;  1MH3 A;  3K1P A;  5E8G A;  1MBG A;  4BUP A;  5L1I A;  4XMY A;  2IA0 A;  3IH2 A;  3R4K A;  1PJR A;  1FOW A;  1ZLK A;  5KNL A;  3HPG A;  5DUI A;  1RZ4 A;  5F1R A;  3SQN A;  1B59 A;  1BIA A;  3O2P E;  4XLP F;  2VUM G;  3H20 A;  3KRE A;  3HHH A;  3J81 W;  5LA6 F;  2JWT A;  3E3V A;  3TGN A;  4BQQ A;  3NAR A;  2YZL A;  3FKI G;  3FXU A;  1T33 A;  2ZJQ F;  4TM5 A;  2HTS A;  1XMQ H;  4NLG A;  2VL8 A;  2XCA A;  4FBU A;  5L3B A;  4N0B A;  4NXM H;  1VQ5 I;  1HOM A;  5IYC G;  3CDH A;  2PQ8 A;  2FKL A;  1Q1V A;  2IBD A;  4CKC A;  2PFB A;  5DLG A;  1TT0 A;  4G12 A;  2MSY A;  2VBW A;  3JRE A;  3GV8 B;  3LFU A;  1FZP B;  4KFC A;  1WH2 A;  3HOW G;  1Y8Q B;  5KCM A;  2MH2 A;  1ON1 A;  2KRC A;  5DDG A;  4BBR J;  4CKB A;  3FIW A;  1ZGJ A;  1P7J A;  3KYD B;  2E1N A;  3OR2 C;  3S2H J;  4Q45 A;  3M8J A;  3I56 I;  3T8T A;  4FS1 A;  4HR7 A;  3J81 K;  1A35 A;  4O3S A;  3HOY G;  2IS6 A;  2RN7 A;  3R0J A;  4PBC A;  1EH7 A;  1HNX H;  4JI8 H;  4A3B G;  1VQK I;  5FJ8 G;  4U7D A;  3FM5 A;  1ETO A;  4NXN H;  2D1V A;  3WU1 B;  4PUS A;  3K70 C;  2OCC H;  1B1B A;  3JRG A;  4O7T A;  2ELK A;  4IXA A;  3S32 A;  5EG0 B;  3OYD A;  4IEJ A;  1KJJ A;  5H80 A;  4UVB A;  1R9T J;  1HCR A;  1TWF A;  4M3D A;  1OKR A;  2PMU A;  3N44 B;  1IN5 A;  3GTG J;  4L0Y B;  3RV3 A;  1XSD A;  4LIT A;  2LD5 A;  2CQQ A;  4ETS A;  3GTP J;  4JV0 A;  3PO2 J;  3GBG A;  3BQ2 A;  2HZD A;  1IN4 A;  3ABT A;  1L3L A;  3PQK A;  4EGZ A;  4E4H A;  1BW5 A;  3KYL A;  4EJW A;  2GA1 A;  4A3G J;  3DTF A;  2KJC A;  4XYM B;  4CMF A;  1SD4 A;  1T08 B;  3VWB A;  2F6C A;  3MAJ A;  2ZJP F;  3IHU A;  2GBY A;  1W0U A;  5D6E A;  2HJW A;  4EJO A;  2J5O A;  1R49 A;  5D5W B;  2HQR A;  3HKZ N;  2W9B A;  2DPI A;  1X1C A;  3OYK A;  2FNP A;  2DLL A;  1QU3 A;  4U6P A;  1D1A A;  2XSD C;  4RZR A;  4DLK A;  3CMM A;  3SZT A;  3V4G A;  5BYB A;  1R5G A;  2A5W A;  4AUX A;  3AW8 A;  2KHM A;  4YEJ A;  2FD5 A;  2PI0 A;  2EZK A;  5GAD J;  3KAL A;  4QTR A;  3GZ5 A;  4JX6 A;  1TBX A;  2H6C A;  4BL0 B;  2FJZ A;  3BR0 A;  5DQG A;  5DCM B;  5CVU A;  3U9S A;  1EUD B;  4KT5 C;  3LSK A;  1OBD A;  4JV2 A;  2Y48 A;  1W93 A;  3S3O A;  3GDE A;  4CO8 A;  3CLO A;  3P9C A;  2HGX A;  2DDA A;  2OBP A;  1F36 A;  2Y75 A;  2A61 A;  2W6O A;  5CQG A;  2FBH A;  3BPV A;  5KFH A;  4I50 F;  3DEE A;  1R36 A;  4YRV A;  2A6E F;  3HSR A;  1X3Z B;  1JHF A;  2ZME B;  5FKL A;  3C0F B;  3PR5 B;  2VXD A;  5FNV F;  4L5E A;  4YII A;  5BWW A;  2KRH A;  4UVC A;  1I2K A;  4XLN F;  3WWH A;  1WI9 A;  1BJA A;  2K7L A;  1ZHQ A;  3RQI A;  3LSP A;  1ZG1 A;  3GII A;  4Q0Y A;  2JSC A;  3RZD J;  2VJ4 A;  3W6K B;  3OS0 A;  2FBI A;  5IPA A;  3H9J A;  4A93 J;  1N33 H;  1P92 A;  4IX7 A;  2XC9 A;  1VI0 A;  1Z21 A;  3H3V H;  1CE8 A;  1KYZ A;  2DYR H;  2M45 A;  2PG4 A;  4XM3 A;  1PK8 A;  4J9L A;  2D2W A;  3B6C A;  4HF0 A;  1U0J A;  2Z1D A;  5HLG A;  1MMS A;  5I5X A;  2V6C A;  6PAX A;  1T56 A;  2M0M A;  4MV8 A;  4RM2 A;  2IA2 A;  4LH7 A;  1EV7 A;  5JQG F;  1JLL B;  3EUH C;  3JRA A;  4IOC F;  4DYC A;  4U7B A;  4HG2 A;  3T5J A;  2BQ3 A;  2VE8 A;  3MR2 A;  1KON A;  2CNQ A;  3GIM A;  4ECY A;  4D5F A;  1VKZ A;  2QVO A;  3CQZ A;  2JPB A;  4ENM A;  1Z2P X;  1YRN B;  2C00 A;  2NAZ A;  2DYS H;  4G6Q A;  2MLG A;  5D8L B;  5KFA A;  2MLK A;  2FE3 A;  2R3S A;  3AL0 B;  4EVI A;  4FE7 A;  3AFH A;  4XRM A;  2ECC A;  3CES A;  1BC8 C;  2Z9O A;  4IJA A;  4H4K C;  4DQ2 A;  4N9H A;  1TNS A;  2LF7 A;  5JLW A;  1JTY A;  2K3P A;  2GQQ A;  3RTX A;  4CSW A;  5IYC J;  1WZ2 A;  3G8C A;  1M7J A;  5HOD A;  4UUS B;  5KG0 A;  1R23 A;  2FMY A;  4YFX F;  2MAB A;  4UB8 C;  3BQZ A;  4DNC A;  4TUY F;  3VYT B;  2GPW A;  3QYF A;  3LAP A;  4LG0 B;  1O4X A;  1ZR4 A;  2Z2S B;  4XN0 A;  2KMU A;  2VAS A;  3CC4 I;  2W6N A;  3FDY A;  1VS0 A;  3DF7 A;  3KAK A;  3FHZ A;  2M3A A;  1VQL I;  3HOY J;  1YI2 I;  3BR5 A;  1JKR C;  5F08 A;  1W96 A;  3SJM A;  1MBE A;  1K83 J;  1WKM A;  2NU8 B;  1FYM A;  3FXR A;  1YIO A;  3HYI A;  4BY1 G;  4L9V A;  2VR1 A;  1ZG5 A;  2V1D A;  1D8J A;  2LH9 A;  2QWW A;  3TMO A;  5ICE A;  1E0E A;  4IZO A;  3S8P A;  5E18 F;  4Y3O A;  2FNA A;  5FRM A;  1R22 A;  5IP9 G;  2O9L A;  5KKN B;  3ZXS A;  2PVP A;  3OSN A;  5HLI A;  3KFW X;  1BJZ A;  2MFZ A;  3PJR A;  2DFH A;  1A48 A;  3O6B B;  2F2E A;  4HV6 A;  1OCZ H;  4LG0 A;  1HR0 H;  1M1E B;  5H6Q A;  2A07 F;  2C28 A;  2ZJ2 A;  4MQ9 F;  4P5O A;  4E7I A;  2LFB A;  3IWZ A;  1RJR A;  1S5L C;  1IW7 F;  1JUS A;  2V6E A;  1ODD A;  5T14 A;  1D3Y A;  3PNV A;  5F64 A;  1IJW C;  1GLV A;  2CGP A;  3AL0 C;  3HT5 A;  4BE1 A;  4XZ3 B;  3FDS A;  2NVX J;  1N75 A;  2YU3 A;  3HOU G;  1IRX A;  2VJ5 A;  2W6Q A;  2M30 A;  1QRY A;  1DUX C;  2VOD A;  2LKP A;  3DKX A;  1J09 A;  4ZTJ A;  4DZP A;  5KFI A;  4ZYG A;  4RGS A;  3OYM A;  2SCU B;  3JRC A;  1I5Z A;  3MMY B;  4WHX A;  4M71 A;  2COM A;  1BI2 A;  4S0H B;  2ZXI A;  3MZH A;  2CUZ A;  4QIW A;  4M9Z A;  2RKH A;  2Q7D A;  3J7A Y;  4O2B F;  1QO0 D;  4EJV A;  3M4O J;  4ZI7 F;  1OLT A;  5EWF A;  1PDN C;  1LEA A;  2NVQ J;  1S29 A;  2XF5 A;  1IAW A;  4OAZ A;  2DA1 A;  1TW2 A;  2QCO A;  4RBO A;  3LSG A;  4AIJ A;  4EAT A;  1E3O C;  3J7Z I;  4IRC A;  4KIC A;  2PMZ N;  1ERD A;  5IOZ A;  1I1L A;  2HHF A;  1GLN A;  2ZO4 A;  3W2V A;  2XF6 A;  1T0F A;  1KQ8 A;  5IWA H;  9ANT A;  4TV7 A;  3KP7 A;  4OIR F;  4DV2 H;  2I80 A;  2CJJ A;  2UZK A;  1FSH A;  2HHH H;  4A3I J;  1RYR A;  3IUO A;  4NC7 A;  5D4R A;  1ZRE A;  2P0W A;  2JA5 J;  2QK4 A;  5J4Y A;  4B8X A;  3G1M A;  3TDU C;  4DUZ H;  1OCR H;  3GUD A;  3QPH A;  5JFR A;  2LY2 A;  2QKL B;  4PZJ A;  1YOV B;  4B1R A;  3QPL A;  3TP0 A;  3PR4 A;  3L2C A;  1OYI A;  1F9N A;  2IS2 A;  3LOC A;  3RF2 A;  1KQ9 A;  1WH7 A;  2WAQ E;  2DT6 A;  3RJP A;  3K70 D;  2YSR A;  4ED2 A;  3RYP A;  2YCH A;  4DV1 H;  2DMU A;  5BPD A;  5E3O A;  3L2P A;  4DL5 A;  3Q2O A;  1UEL B;  2JQ7 A;  3BA8 A;  3HOZ J;  4A3L G;  4IL6 C;  2NVY J;  2KIQ A;  2LOO A;  2W8K A;  1IZ1 A;  3N4M A;  4RGX A;  4A3F G;  5TGT A;  2M05 A;  4R8U B;  4GGG A;  2V59 A;  4NQW A;  2MH9 A;  4NNJ A;  1ZAR A;  2X6W A;  4QWD A;  4NB5 A;  3PNT A;  3JTG A;  2DU9 A;  3VYR B;  3BTL A;  5I5S A;  3CZ6 A;  3QOP A;  1Y1V J;  2QEX I;  3JSP A;  3TY9 A;  1BI3 A;  1W4M A;  1LB2 A;  3JAM W;  3WGI A;  1I7N A;  2H6B A;  2YZN A;  4O83 A;  4ZJZ A;  4GFB A;  3OHA A;  2H1K A;  3EPI A;  3CJQ B;  2WAD A;  2CUJ A;  4A0Y A;  3N97 A;  2PN1 A;  5C1P A;  1DGR M;  3PSF A;  4DR2 H;  3CDI A;  4RGU A;  2VPL A;  3OL4 A;  2VLA A;  2B63 J;  1J75 A;  4A3C J;  4QJF A;  1ENH A;  2PMH A;  5DEQ A;  3ZMT A;  1XX5 A;  4LLG F;  4DR3 H;  1QBJ A;  3OYA A;  3BG5 A;  2IP2 A;  5JH7 F;  1D1C A;  2CS3 A;  3CUQ A;  4XL9 A;  2HYF A;  5HV6 A;  3RPU A;  2FX0 A;  1FLI A;  1FX7 A;  2AXT C;  4GC7 A;  2ELH A;  4EFE A;  2W9B B;  5M3M J;  3ZMU A;  1P9Q C;  4NC6 A;  4A3J J;  1HF0 A;  2KJB A;  3HGY A;  4XSZ F;  1JKP C;  1UMQ A;  3GTK J;  5LYJ F;  2TDX A;  3JAM K;  2R0Q C;  4O2A F;  3BZK A;  4WBN F;  3JRW A;  3H0D A;  1M6V A;  3LML A;  2YRX A;  2XKP A;  4RCN A;  2CZG A;  4MGR A;  3OS1 A;  1S9F A;  1KT8 A;  2VPR A;  3RI4 A;  4PGG A;  4UV8 A;  1EKF A;  3P7N A;  3U54 A;  2QBY A;  1GSH A;  5L1K A;  3B73 A;  3GXO A;  5K7Z A;  3OSF A;  5D8D A;  2Z3Y A;  1QZZ A;  3H3Z A;  1FP1 D;  5IP9 J;  3WHC A;  1KC7 A;  4G7H F;  2WA0 A;  4EEF G;  4FFP A;  2A68 F;  3FMQ A;  5E3M A;  4QWQ A;  3OS2 A;  4IQ4 A;  3Q3S A;  1IG7 A;  1E4E A;  2YS6 A;  3MR6 A;  2JSP A;  4C3H J;  2HDW A;  3ZN0 A;  2C35 B;  4N4N B;  2L54 A;  4Z6Y A;  1A31 A;  1WCM G;  2R7R A;  4UXN A;  2XGP A;  2V9W A;  2HGW A;  2FML A;  2HEO A;  1SFO A;  4B3A A;  2HHF B;  4FQG A;  5IOY A;  5FRO A;  2X1D A;  1IF1 A;  2G9W A;  1J0R A;  4U0W A;  1G2H A;  4Y15 A;  1Z2O X;  1XNQ H;  1YFH A;  3DWL E;  1CKN B;  3ZMV A;  4IRG A;  2ESH A;  3OYH A;  2H27 A;  1W5T A;  4V19 K;  3KP3 A;  2EFP A;  2JRM A;  2L9R A;  5HBR B;  4CCO A;  5C3E J;  3KP4 A;  3ZQF A;  4UCU A;  1ORK A;  4ABZ A;  1AWC A;  3UKG A;  2R7Z G;  3ABK H;  2W25 A;  1JJ8 C;  4AYB E;  4DR5 H;  1W7P A;  1Z9C A;  2CH0 A;  2W71 A;  4QIW E;  2XVC A;  4DR6 H;  1LDK B;  3HZJ A;  4EJU A;  1DP3 A;  2KQR A;  2E5N A;  5CVI A;  3CCV I;  1SEI A;  2FLP A;  3UQ8 A;  3H92 A;  3BWG A;  2EV5 A;  2JT1 A;  3BP8 A;  5L3F A;  5F04 A;  5HNE A;  2J6U A;  4ECV A;  3VPC A;  1T0F C;  4JI6 H;  2HNH A;  5IP7 J;  4UUT A;  5DM6 F;  2DOF A;  1IXR C;  1H0M A;  4D0P A;  4HLY A;  2ADU A;  2Z02 A;  1B8I A;  4BH9 A;  5LRS A;  3BR6 A;  2BGC A;  1Z0X A;  3TKY A;  5JR3 A;  4FFL A;  3K6G A;  4IAJ A;  2R85 A;  2HDK A;  1OR7 A;  2HS5 A;  2XAU A;  4EJT A;  4C5B A;  3IKV A;  3V7R A;  3BPX A;  4M3G A;  2IRF G;  3M1E A;  3PZP A;  3IWF A;  4D5C A;  1V5F A;  4M73 A;  4HOB A;  2WAQ A;  1FIA A;  2FB9 A;  2ZME A;  1WJF A;  3PW5 A;  2IMW P;  5AON A;  3SNO A;  1XGN A;  3GTO J;  1JGS A;  5BS6 A;  1GXP A;  3IL2 A;  3AG4 H;  4X6A J;  1MBF A;  1X1A A;  4IIJ F;  1ETV A;  4LD5 A;  4J9P A;  4PCQ A;  4ED3 A;  4JV1 A;  2DA5 A;  4A3G G;  3AG1 H;  2FOW A;  2AGP A;  1J5E H;  1XGS A;  3GTL J;  2OA4 A;  2F5V A;  4OIP F;  2M7B A;  1JJ6 C;  4FFO A;  2CFX A;  4N4O B;  4PJL A;  3SDB A;  2BV6 A;  3SFI A;  2IT0 A;  1BJT A;  5KFV A;  4ECX A;  1OPC A;  4P9F A;  1I1K A;  4O7R A;  4E6K G;  3FKI J;  1PP7 U;  5J2U F;  3K4B A;  3L09 A;  3WTS C;  3PW0 A;  3E7L A;  3I12 A;  2E7W A;  3G6E I;  1NK3 P;  1JXL A;  3BQ1 A;  1IC8 A;  1VQN I;  5LGT A;  2NVT J;  1SFK A;  4MLO A;  2ATL A;  2FQ3 A;  2OWO A;  1PYV A;  1X3U A;  1QPM A;  2LSO A;  2JA7 J;  4O4H F;  5E3L A;  3H0G A;  5GPC A;  5M5X J;  2DT5 A;  5CKT A;  4IWY A;  2DDB A;  4J9N A;  1IBK H;  2OAZ A;  3CO7 C;  4J19 A;  5BMZ A;  2K9M A;  3TP3 A;  3GQC A;  5E8I A;  4CCL A;  2R92 J;  3DBL B;  5I47 A;  4DV0 H;  4MV4 A;  3TOB A;  2P7V B;  2P5L C;  1REP C;  2JA2 A;  4A3B J;  2R7L A;  4BQN A;  4MQV A;  1OWT A;  3GIK A;  2L5Q A;  3LSJ A;  2RGV A;  2QM3 A;  1XCB A;  2VJJ A;  1KA8 A;  5DCM A;  4J01 A;  4E7L A;  2R7Q A;  2YW2 A;  3FXJ A;  2V1U A;  3WG7 H;  2HI3 A;  3F8B A;  3F21 A;  2QGU A;  2DW4 A;  1PVE A;  3R5X A;  3V8L A;  1H8A C;  2ZDQ A;  1VQ6 I;  1K1S A;  3NBZ B;  3WWI A;  4AQY H;  3OIQ A;  2LC2 A;  1O75 A;  2COB A;  4HQE A;  1K61 A;  4KIG A;  4YG2 F;  1R58 A;  4C3J J;  1EKP A;  3VPR A;  1QZY A;  4EGQ A;  1ZG3 A;  1HLV A;  1ETK A;  1SCU B;  3L2V A;  2FLL A;  1GV5 A;  4PSX A;  3KYH C;  3GTL A;  3VOD A;  1G3T A;  3FM3 A;  3RKX A;  1LFU P;  1TWA J;  4YJ2 F;  4DIM A;  2DFF A;  4ECQ A;  2GXB A;  1JKJ B;  4M3F A;  4D7N A;  2CSO A;  4UCR A;  3LFK A;  1OYW A;  4ZYH A;  1JXS A;  4ZHQ F;  2LK2 A;  1L0O C;  1EHI A;  3D1N I;  5KFQ A;  3H4B A;  4LB6 B;  1OQY A;  3CCR I;  3T9C A;  5F0H A;  4HLX A;  5LMN H;  3N40 P;  2XAG A;  1HQC A;  2WY8 Q;  1EF4 A;  3RKQ A;  3UZB A;  2W00 A;  3OL3 A;  4BBS G;  1RNL A;  4FX0 A;  3QZ8 A;  4AVP A;  4UHT A;  2BHY A;  4MFD A;  1Y1W A;  3WTZ A;  3K4J A;  2VUM J;  1MIJ A;  3ZOB A;  5HNF A;  4M3E A;  4MV7 A;  1A36 A;  1BW6 A;  4O5V A;  3X2Q H;  1VF9 A;  2IAI A;  3RDI A;  4AVZ A;  3D0S A;  4AYB A;  1RRJ A;  2ZDH A;  3TY5 A;  1DU0 A;  1E2X A;  3F6V A;  5I5Y A;  1XNR H;  2XCL A;  4QWE A;  1TWC J;  2C2D A;  3S3M A;  5KG2 A;  3P9K A;  1L2Z A;  1Z7U A;  4DIQ A;  2V5A A;  4XLE A;  2LBF A;  2JJ7 A;  2JA6 A;  4UVA A;  5BMV F;  4RNN A;  4X62 H;  3OYN A;  4A5M A;  4F4W A;  4PJJ A;  4O7Y A;  2P6S A;  2CW7 A;  3CME I;  4CH7 A;  2NXN B;  1BIB A;  3RZO J;  2Y2Z A;  1IXC A;  1WR2 A;  3E97 A;  4FE4 A;  5F0F A;  1XTA A;  4M72 A;  1MJ9 A;  2PX9 A;  3FIS A;  2Y4R A;  4JV5 H;  4ZYE A;  4BGD A;  3CTA A;  2KFD A;  2DA3 A;  4I99 C;  1IXS B;  3PIP F;  1T39 A;  1CQI B;  2IGK A;  4K0K H;  1EH8 A;  2XGD A;  1I50 J;  2VBX A;  3RQ4 A;  5ED4 A;  5I5T A;  3GVA A;  4P96 A;  1F43 A;  2W84 A;  5CE8 A;  3I55 I;  3VDX A;  4XIC A;  2GLT A;  2FMA A;  1P7I A;  5FR9 A;  4KDP A;  1SMT A;  2VB6 A;  3A0H C;  3A01 B;  4LH6 A;  1B04 A;  1VBH A;  2CV0 A;  2VQL A;  3GF2 A;  2YZM A;  3GZN B;  3HSF A;  2CYY A;  2WTE A;  2R7T A;  1SEU A;  5BYA A;  4AWX B;  4JOM A;  4O7Z A;  3I59 B;  2IVM A;  4IRI A;  2CWE A;  3LSI A;  1LNW A;  5EEH A;  3WU0 A;  2ZSI B;  4CCN A;  1XMO H;  4MV9 A;  5FLV A;  1WJB A;  4I76 A;  2JVH A;  4MO7 A;  5KFJ A;  3K3V A;  5H20 A;  2J9G A;  2R8G A;  2I5U A;  2V4J C;  2E2H A;  3ECH A;  4Z2Y A;  5J8C A;  5ICG A;  3CVZ A;  1RPW A;  3LWF A;  1TWG A;  4DUY H;  4DR4 H;  2CO5 A;  1FY7 A;  2KLO A;  4E7Z A;  2OTL I;  1S0O A;  3F23 A;  5F27 A;  2KL4 A;  5K7H A;  4YBZ B;  2ASL A;  3IRR A;  3C7J A;  1ETW A;  2AXL A;  2OF7 A;  3GIJ A;  3WHB A;  2WAE A;  4DQN A;  1X4P A;  4BJ5 C;  4B43 A;  3S1M J;  1AKH A;  1HDP A;  3HG9 A;  5DGI A;  3FMA A;  3C1D A;  1V9P A;  1VQO I;  3PN1 A;  1QHG A;  2LDU A;  5D5X B;  3P9I A;  1H9T A;  3M8E A;  3M1C A;  1XDU A;  4EMS A;  1PX2 A;  2VUM A;  5FFX A;  2KSW A;  4CGZ A;  2DMP A;  4EV0 A;  2K40 A;  2QQB A;  2GQR A;  3MZ8 A;  3GO5 A;  3H36 A;  2Q8K A;  2BOL A;  5HLH A;  1MDM B;  3S1N J;  2R6F A;  4HST A;  4DGW B;  4BXU A;  4RA2 A;  3QFF A;  4IHY A;  5FKO A;  1LJ9 A;  2CV2 A;  4JUZ A;  2XKO A;  3IH3 A;  4M74 A;  3U21 A;  3RPQ A;  4A5N A;  5BR8 H;  1IBL H;  2QSF X;  4O3O A;  1KJQ A;  2VBY A;  2V9K A;  1MMA A;  1A6Q A;  1A9X A;  3KEY A;  2DQL A;  3JAM Z;  2ISZ A;  5CAE B;  1ZN2 A;  2EV0 A;  2H1L A;  3RBD A;  3OR1 C;  2G0E A;  2BY1 A;  1EYZ A;  4ZDP A;  2Y9Y A;  3MQ0 A;  3BJO A;  4JI7 H;  1R1U A;  3SXY A;  4WXD A;  4HDU A;  3DU5 A;  3V8K A;  1ACI A;  2ETH A;  2M34 A;  2R7M A;  2ZGI A;  1MMN A;  1IBM H;  3ZQQ A;  2G7U A;  4APM A;  4DYQ A;  4JI0 H;  3SEQ A;  3CCU I;  1FVI A;  5EF6 A;  5DUK A;  1K79 A;  1BXR A;  5EZY F;  4QW8 A;  3GV5 B;  3T9D A;  1MZB A;  3C3W A;  4I01 A;  4NC8 A;  3GW2 A;  5DD4 A;  5J1Y A;  2R5Z A;  2JTV A;  4I55 F;  3VA7 A;  5DG8 A;  2CMP A;  2I10 A;  4AYB N;  1ETY A;  3C2B A;  5CVJ A;  3G71 I;  1J2X A;  2XV4 S;  3LWB A;  3S17 J;  3TW7 A;  2ID6 A;  1X58 A;  3WE3 A;  3DQV C;  1ONV A;  1RIO H;  4HN2 A;  5EWG A;  2OQG A;  4ZOL F;  1IOV A;  4A3F J;  3W3C A;  3BZC A;  2QSG X;  4L1K A;  2UUB H;  2ZDG A;  2M87 A;  3J7A K;  5E3N A;  3OOP A;  5ERI A;  2K9L A;  4C3I J;  1QNT A;  1V5G A;  1YW8 A;  5E79 C;  3M9O B;  1WJ5 A;  1YS6 A;  1S68 A;  4CMD A;  4M9U A;  1T6S A;  2O7O A;  1Z67 A;  2DMN A;  2Y31 A;  4PSW A;  4U88 A;  5HDN A;  5LLQ A;  3ISP A;  5KFN A;  2VA2 A;  4E70 A;  4EGY A;  2ZFW A;  2TCT A;  3LSR A;  2YYA A;  2RNG A;  1U8B A;  5IYB G;  1WRJ A;  2D5V A;  2EJ2 A;  3ONQ A;  5FRN A;  1BR1 A;  4LF4 H;  3M8F A;  4YIF A;  2OD5 A;  4QPO A;  2PEX A;  4RAF A;  2E2J J;  3H40 A;  3G73 A;  1TT5 B;  2DCE A;  1WJC A;  1R4N B;  5KT4 A;  1J59 A;  5KFO A;  4I02 A;  2NUA B;  5JUM A;  1ZR2 A;  2JEG A;  2W9A A;  1HKQ A;  1I39 A;  5EEG A;  4O3P A;  3LMM A;  3QPT A;  3BTC A;  4UCS A;  2DT7 B;  1S3J A;  2P5V A;  3F72 A;  4O3Q A;  3H5A A;  3HSE A;  5KHD A;  1TWF J;  3IP4 B;  4A3M J;  1B6A A;  3I4P A;  4MA0 A;  3V42 A;  4OIO F;  4A3M G;  3OWT A;  3S24 A;  3HGG A;  1X1B A;  3MEX A;  2VPS A;  2YPR A;  4BXX J;  5KG5 A;  1U9O A;  3QOE A;  4HNU A;  4XLC A;  1DU6 A;  3TDZ C;  5J47 A;  3OYB A;  2ABJ A;  3MKW B;  4BQA A;  3CMY A;  3BDD A;  1YW9 A;  2B0L A;  2DA4 A;  2K3F A;  4AIH A;  4CZC A;  4Y52 J;  1TL8 A;  4RZQ A;  5HDG A;  4RB0 A;  3ML6 A;  3V6J A;  1X3W B;  1HBX G;  3DPL C;  2W6Z A;  4EYH B;  1P4W A;  5EGO B;  3JSN A;  4O7W A;  4IRD A;  5TRD A;  3K4M A;  1Y8R B;  2BY0 A;  4DR7 H;  3T1Y H;  2WBM A;  4KN7 X;  4PWQ A;  1POG A;  3Q1K A;  2JUC A;  1B6R A;  3HUG B;  5F6F A;  5LHG A;  4RB1 A;  3GTJ J;  3UYY A;  3VEP A;  4PZ6 A;  1CKM A;  3HL2 A;  2EZI A;  5HS9 A;  3MZY A;  3H9Q A;  3ROU A;  3TBI A;  4FGR A;  1KJI A;  4O4L F;  4O7V A;  4F93 B;  2E60 A;  5LEK A;  3VPB A;  4YR3 A;  1XSV A;  4NZN A;  3F8N A;  4RU9 A;  4GKJ H;  3W6J B;  2ZME C;  1CQT A;  3N6X A;  3VNN A;  4L9T A;  1W7P D;  2Y0S A;  2MA3 A;  3MN2 A;  2V7F A;  3KAJ A;  5KG1 A;  4A2U A;  2DZD A;  1YJ9 I;  2EBI A;  3LUL A;  2EZL A;  4G9Y A;  5BOX A;  2W9C A;  2NOG A;  1UAA A;  3WNZ A;  4DV3 H;  2D45 A;  1Z7L A;  2E71 A;  3N8D A;  4F55 A;  2QLZ A;  4A3D G;  3U0G A;  1I94 H;  4MEY F;  4ZDO A;  2R7K A;  3TQT A;  3HEF A;  5L3E A;  1O3S A;  2YUS A;  2LF8 A;  4BY1 J;  3CDL A;  3DLL F;  2YS9 A;  1A5J A;  2ZSH B;  2ICW G;  2F5C A;  4A6D A;  2ALZ A;  5CVR A;  2EA2 A;  4M6X A;  3DKW A;  3BAA A;  1WWX A;  3L1P A;  3OHB A;  1V3F A;  1BOB A;  3C2G A;  2KZG A;  4BYY A;  3LST A;  2EA4 A;  4AIK A;  2HIV A;  1R9T A;  3R0A A;  4BS9 A;  4R8U A;  4UUS A;  2JA5 G;  1NTC A;  3W2A A;  2BW3 B;  2D1H A;  4OU0 A;  5LOV F;  2EJ0 A;  1YQA A;  2HQN A;  3KCC A;  4WD3 A;  3M07 A;  5KT6 A;  1I6X A;  4U0Y A;  2FK1 A;  5FLX W;  2WY7 Q;  4JK1 X;  1QVT A;  3FBN B;  4XKB A;  5ILS A;  4HYE A;  2WV0 A;  3TEK A;  1MD0 A;  2VKE A;  2CUE A;  4IHX A;  3G3Z A;  1Z77 A;  1XPX A;  4LLL A;  3GIL A;  3RSN A;  3GLL A;  5CLS A;  2XRL A;  2JMW A;  3GTM A;  1PP8 F;  1MND A;  2W6P A;  3IV5 A;  2K9Q A;  2VC0 A;  3SYT A;  5HDK A;  1IN6 A;  2YRW A;  4HF1 A;  2F4M B;  5BPH A;  3H35 A;  4XRF A;  5CJ9 A;  2XGC A;  2JA8 G;  1SC7 A;  2VOO A;  3T7A A;  2X1C A;  3NRV A;  2BW3 A;  5E1Z B;  4QWB A;  2J5P A;  3QQM A;  3MWD A;  3MCZ A;  2BBY A;  3V6H A;  5GAE J;  3CUO A;  3ASN H;  2JUG A;  4F91 B;  2P0A A;  3PUB A;  3ZMD A;  3ZQI A;  3T9F A;  5LD2 C;  3G6X A;  3BOQ A;  2AHQ A;  3FKI A;  3MVP A;  1HNW H;  2JA7 G;  2RC4 A;  4C2U A;  3KET A;  1SMY F;  2L2O A;  4OWR B;  4Y17 A;  4DL4 A;  1FSE A;  3KXY T;  2KIF A;  4UY8 I;  2VPQ A;  3H5R A;  4B3R H;  1LQ1 A;  1SYX B;  3RGX A;  2CW0 F;  4A69 C;  1SFO J;  2K4J A;  3RGZ A;  5BWX A;  1G3S A;  3WU2 C;  2XDV A;  3OUU A;  2R93 A;  3F9K A;  3T9A A;  1T94 A;  5GAG J;  1I1G A;  4N9I A;  1Y1W J;  5B66 C;  4JYK A;  5C5J A;  2L01 A;  4DR1 H;  3K7A J;  3K3P A;  4L9J A;  1ETQ A;  3W5O A;  2EIJ H;  3DU6 A;  2ZXJ A;  4CDG A;  4HV5 A;  4G94 A;  1RJP A;  1OBG A;  1RK5 A;  3WO1 A;  3E5U A;  4DZJ A;  3EPG A;  4HA8 A;  3UZO A;  1FC3 A;  3F8F A;  2ME0 A;  3HRU A;  4QLC U;  3PO3 G;  4BXX G;  3K10 A;  1QQI A;  1RYS A;  3HOV G;  2ZJR F;  1ZHF A;  3RAX A;  2V1X A;  3GZ6 A;  3GFJ A;  2TRT A;  4IVN A;  4HPQ A;  4Q4C A;  1JKQ C;  3BCB A;  4A3L J;  1LVK A;  4R8H A;  3CEB A;  4X65 H;  4EG0 A;  4XYL B;  3VSK A;  3PW4 A;  1S97 A;  2W24 A;  5I60 A;  4LF6 H;  2EFN A;  2OU2 A;  3FK7 A;  1EKV A;  5A2Q Z;  3W1G A;  2F4V H;  1RC9 A;  1X2N A;  2VIX A;  2AO9 A;  4LJZ F;  4W97 A;  2M8G X;  2CFO A;  3F8C A;  1FBQ A;  2DPD A;  3CCM I;  2MD5 A;  3G6Y A;  4C2M J;  2JA6 G;  5KVR A;  1AUV A;  4MEX F;  4XLA A;  4YAK B;  3TED A;  3U2R A;  3M3Y J;  1CGP A;  2UWM A;  2H8R A;  3CC7 I;  2COI A;  2M0C A;  4XKW A;  4PZ7 A;  2Y0S E;  4GRI A;  4GXO A;  2ASD A;  1T95 A;  2KZV A;  1SD5 A;  5C3E G;  4LK1 F;  3OYF A;  2VUG A;  3EUH A;  4FTH A;  2GOM A;  2XC7 A;  3GV7 B;  3QYE A;  2R93 J;  1CKN A;  4FX4 A;  2R92 G;  2HIX A;  4HX8 A;  3SHF A;  3HTS B;  2UVW A;  3OY9 A;  2IS1 A;  1V54 H;  1KQ0 A;  3OV8 A;  3E1S A;  2JK3 A;  5IT9 W;  4FE2 A;  4OIN F;  3F22 A;  3BR2 A;  1TLH B;  1MJB A;  3I0T A;  2K9S A;  4KIB A;  4Y33 A;  5L3C A;  3DAA A;  1VQ4 I;  3BT9 A;  4RAZ A;  1RKW A;  3CQZ J;  3BJA A;  1R1V A;  5LMU H;  5I5V A;  5K5O A;  3BG9 A;  3ULQ B;  3ESW B;  1GO3 E;  3HRM A;  1BM9 A;  2PJR B;  2IGO A;  4ENN A;  1N48 A;  1BOA A;  2WE6 A;  3K69 A;  4J9K A;  3QWL A;  1I7L A;  3RB4 A;  4I09 A;  4HZF A;  2PMZ A;  5GTH C;  3DKY A;  2FXA A;  3KHG A;  4YJ3 F;  4O3M A;  3DFG A;  3HHG A;  4Q47 A;  2X5R A;  1LFB A;  2X0S A;  4EEQ A;  1B8I B;  5FKN A;  2W70 A;  2LLK A;  3WTY C;  1SAU A;  2A1H A;  1ULZ A;  1YJW I;  4ENJ A;  3KYC B;  2XAS A;  3QP6 A;  2Y0M A;  2FSW A;  3BG7 A;  1LUJ B;  2BXY A;  3A1Y A;  1I1S A;  3PFI A;  2QB5 A;  2DFI A;  4RAG A;  5LHH A;  3TO9 A;  4BEH B;  1XDN A;  1TWA A;  3V6K A;  4AD9 A;  3KTM A;  4E4T A;  1UCR A;  4BNC A;  4EBD A;  4G7O F;  3DTI A;  2HWV A;  3RFC A;  1I3Q J;  3NC0 B;  1ZTR A;  4HDV A;  1JKO C;  4JX5 A;  5C4J J;  1MDM A;  4Q5S F;  3TII A;  4J9O A;  2BE5 F;  2HVS A;  2BEO A;  4ASN A;  4RLQ A;  2GWR A;  2YWV A;  2CW8 A;  2HPM A;  4EFB A;  1LPQ A;  3IH4 A;  4RLF A;  3HRT A;  3QOD A;  2Z33 A;  4BJ6 C;  1ZHS A;  1XMK A;  1MSE C;  4WK8 F;  4BBR G;  3LA2 A;  2LVS A;  2E2H J;  5KT2 A;  2R4G A;  3SZG A;  5KAI C;  4TV8 F;  5AIP A;  3RUP A;  5TJJ A;  2RQQ A;  2LNB A;  3IG0 A;  2W8L A;  5IP7 G;  2CU7 A;  4Q48 A;  2RV8 A;  1WSU A;  1KU9 A;  2I87 A;  2MD0 A;  3UFX B;  3TQN A;  3U55 A;  2EH3 A;  2AGO A;  2V79 A;  4GDF A;  2UVV A;  3DXJ F;  4O4J F;  1HXD A;  5I5W A;  2NNN A;  5KT5 A;  2W9C B;  3L9F A;  4FIS A;  2E5Z A;  4B3T H;  5JI6 A;  1EKE A;  4HW0 A;  5LGN A;  1FOK A;  2R84 A;  5KFZ A;  2P7C B;  3LNQ A;  1GXQ A;  4RMN A;  5J3L A;  4HYK A;  4M6V A;  3QQA A;  4E7K A;  5DGA A;  1G3W A;  4XQF A;  1N77 A;  1GHC A;  1XN7 A;  3J7Y J;  3R61 A;  3FMR A;  4Y13 A;  3CC2 I;  1ZK8 A;  2X1E A;  3U9T A;  2CKZ B;  2VA3 A;  2JEF A;  1C0W A;  4HEA 2;  1ZGW A;  3K2Z A;  5KFY A;  4P9U A;  4V2F A;  5GP9 A;  1W1W E;  1DGW Y;  2XPU A;  3BG6 A;  4PFO A;  1UHW A;  4FS2 A;  4O3R A;  2LBF B;  5LBQ A;  2FK3 A;  2GOX B;  3JRX A;  4UCV A;  3M7G A;  3KLN A;  5D4S A;  1Z3X A;  2A6H F;  1ITY A;  4XKC A;  3GTG A;  3IC7 A;  2HQ5 A;  2HVQ A;  3FXM A;  3TW6 A;  2K86 A;  2OTJ I;  2QYZ A;  2P8T A;  5LP6 F;  2OUM A;  2DJI A;  2A69 F;  1OYY A;  3KX2 A;  1MKM A;  3JRF A;  3HOU J;  2NU6 B;  2VQE H;  1LEB A;  3Q0U A;  2DXI A;  2NU9 B;  4G7Z F;  2VON A;  2R7O A;  3ZGK A;  1FYK A;  2JEI A;  3PNY A;  3A01 A;  1UHM A;  5J8F A;  1U78 A;  1P4A A;  2DFE A;  3IN5 A;  3U1K A;  5KS8 A;  4CYC B;  2ZNZ A;  2PJR A;  4B3S H;  4I0B A;  4ME6 A;  2E34 A;  5D6F A;  5KFG A;  2RVC A;  2F5D A;  5BQT A;  2GQS A;  2RDJ A;  1ZYR F;  3QWU A;  5HOO A;  1IRZ A;  5EEA A;  3J81 Z;  3GLK A;  3GTK A;  3CJT B;  1X1P A;  4A2B A;  3SI8 A;  2EIK H;  1ZQ3 P;  1IV6 A;  5IY5 H;  3HO8 A;  1FOY A;  2DN0 A;  5DG9 A;  5A2Q W;  5KT3 A;  1S0M A;  4OX9 H;  1GUU A;  4KIF A;  3GME A;  3OIP A;  5DIS C;  1D0Z A;  1MBH A;  2XSJ C;  3FXK A;  1TQI A;  4M9X A;  1EJ9 A;  1Z2N X;  3UNG C;  2OLS A;  5KFW A;  1KU7 A;  3I9V 2;  4D7M A;  4KHP H;  4R7R A;  4BKX A;  4ESF A;  4U7C A;  2P81 A;  2IA6 A;  1S0N A;  1FJL A;  1UG0 A;  2O3F A;  2RRE A;  3QU3 A;  3REO A;  2DPU A;  4A93 G;  1CQJ B;  2BQR A;  2OH2 A;  1CF7 A;  3K2A A;  2BVL A;  5K5R A;  2PMZ E;  3O8G A;  1SFE A;  3BQY A;  2FRH A;  3C2H A;  4XKV A;  5J6X A;  2JPC A;  4B4C A;  4FFN A;  4KIS A;  3TQ1 A;  3MWM A;  3VSL A;  3CLQ A;  1RR8 C;  1B6S A;  1FMW A;  2CQX A;  3G1O A;  4Q8E A;  4PK4 A;  3RKY A;  1SD6 A;  3M9A A;  3Q0W A;  4O6J A;  5HS8 A;  1SAN A;  5CYV A;  3HOZ G;  3H3V K;  3I64 A;  2UVU A;  5FGM A;  1BN5 A;  3S2D J;  4JI3 H;  3FXQ A;  3HPH A;  2RAE A;  4F92 B;  4HNT A;  3OYI A;  2DPJ A;  2CQN A;  3FXL A;  3S93 A;  2HOE A;  4CCM A;  4A3K J;  1I3A A;  2O0Y A;  2WWY A;  4YR0 A;  4B47 A;  2DA7 A;  4MTD A;  2VQD A;  4WX9 A;  3JRD A;  4UV9 A;  5KG6 A;  4IRH A;  2CQ7 A; 
#chains in the Genus database with same CATH homology
 1MMA A;  3AFH A;  3CES A;  3KEY A;  4H4K C;  1D0Y A;  5CPR B;  2Q2T A;  4II3 A;  5CQE A;  2LYC A;  3DTE A;  3OR1 C;  3MKY B;  4ZYA A;  4ZDP A;  3OYJ A;  2K3P A;  2XF7 A;  4JI7 H;  3RTX A;  1N78 A;  3DU5 A;  4CSW A;  4ZC3 A;  4YY3 H;  1MMN A;  1IBM H;  3ZQQ A;  2WB1 A;  2VXZ A;  4APM A;  4LFC H;  2MAB A;  4JI0 H;  3SEQ A;  2R7X A;  4XN3 A;  2LY1 A;  1FVI A;  4GKK H;  4CC5 A;  5HVQ C;  4BWS C;  2CV1 A;  4HSR A;  3VYT B;  1W36 D;  3PSI A;  3QYF A;  4NC8 A;  3RR5 A;  1MZB A;  4JI1 H;  2Z2S B;  4II2 A;  4XN0 A;  2KMU A;  2VAS A;  3FDY A;  1VS0 A;  3DF7 A;  2CMP A;  3W1B A;  3KAK A;  3FHN A;  2M3A A;  2M4K A;  3SEZ A;  3RTR A;  4Y4R A;  1K6Y A;  3D5R C;  2R7W A;  3DQV C;  3G2B A;  3W3C A;  3PL8 A;  4BDY A;  2UUB H;  2LH9 A;  3FKJ A;  3TMO A;  2VQF H;  2W82 A;  3NWT A;  4C30 A;  1E0E A;  3S8P A;  3TY8 A;  3J7A K;  2UUA H;  2K9L A;  4Y3O A;  5FRM A;  4KJZ A;  3JSL A;  1V5G A;  2V9K A;  1WJ5 A;  4DV4 H;  1S68 A;  3ZXS A;  4LF7 H;  2MFZ A;  4PSW A;  3PJR A;  1XK5 A;  2QKM B;  2E1M B;  2HVR A;  1N36 H;  3CJR B;  2RNG A;  3HC7 A;  4QPQ A;  4RM3 A;  1HR0 H;  3ONQ A;  5FRN A;  1BR1 A;  4LF4 H;  1MMG A;  4QPO A;  4P5O A;  4E7I A;  4CC6 A;  4J0M A;  1TA8 A;  2MYS A;  2DCE A;  1FMV A;  1WJC A;  3DPT A;  5FPO A;  2V6E A;  4HRI A;  1M0T A;  1WJE A;  3PNV A;  1E4F T;  4ITV A;  3AL0 C;  1YX3 A;  4BE1 A;  3EYY A;  1N75 A;  1D0X A;  1R6R A;  1IRX A;  2VJ5 A;  3LMM A;  4UCS A;  2DT7 B;  3ZCO A;  3N42 B;  3H5A A;  5KHD A;  3DKX A;  1J09 A;  3IP4 B;  4BEH A;  4ZTJ A;  3V42 A;  3OYM A;  4NQW B;  1AN7 A;  3OWT A;  4AU7 A;  3S24 A;  3MMY B;  1X1B A;  4LIV A;  4PDB A;  2VPS A;  4E7H A;  1I6U A;  4E7J A;  4PFP A;  4D9J A;  3QOE A;  1DQU A;  2ZXI A;  4XLC A;  4HNU A;  2CUZ A;  3N05 A;  4CUG A;  4UCT A;  4LF9 H;  3OYB A;  3OMY A;  1X4O A;  3MKW B;  3IAM 2;  3J7A Y;  4CZC A;  1OLT A;  4RZQ A;  4X66 H;  4XNF A;  4RB0 A;  1M0W A;  1MW7 A;  2XF5 A;  4OAZ A;  2UXB H;  2NOJ B;  3DPL C;  3MKZ A;  3QYB A;  3LSG A;  3JSN A;  2UXD H;  4EAT A;  3K4M A;  4DR7 H;  3K4C A;  3T1Y H;  4I7H A;  4BU2 A;  3M4I A;  2WBM A;  1ERD A;  3OYE A;  4C2T A;  2WDT A;  1GLN A;  3W2V A;  2XF6 A;  3CF2 A;  3ZR8 X;  5IWA H;  3HUG B;  4RB1 A;  4MTE A;  3BA9 A;  4DV2 H;  3AKZ A;  4PZ6 A;  1CKM A;  3HL2 A;  2LRD A;  3TBI A;  2HHH H;  3H9Q A;  3IUO A;  2DOA A;  4NC7 A;  1JI8 A;  4F93 B;  2P0W A;  2E60 A;  1X1D A;  1P16 A;  3F8N A;  2F4I A;  4GKJ H;  3N6X A;  4DUZ H;  4OAY A;  3VNN A;  2Y0S A;  2LY2 A;  2QKL B;  3RPU D;  2UU9 H;  2IS2 A;  2V7F A;  5D1O B;  3KAJ A;  3RF2 A;  4C9Y A;  2DT6 A;  1UAA A;  3K70 D;  4DV3 H;  2YCH A;  2LG4 A;  4XOT A;  3TL4 X;  4IKF A;  3RJ0 A;  4DV1 H;  1D1B A;  1Z7L A;  3L2P A;  4F55 A;  1UEL B;  3HXL A;  3BA8 A;  2V26 A;  4IQJ A;  5HNH A;  4DBQ A;  2FUG 2;  1LFP A;  1I94 H;  4FET A;  4ZDO A;  2LOO A;  2V1N A;  4J00 A;  3L4J A;  4ZTF A;  2W1O A;  4XON A;  5TGT A;  2I8D A;  2VQG A;  2ZSH B;  4ZDL A;  3LSH A;  4PJN A;  4NNJ A;  3BAA A;  2X6W A;  4DBR A;  3PNT A;  2HGS A;  4RAY A;  1NG6 A;  2X51 A;  3VYR B;  1BOB A;  3C2G A;  3CZ6 A;  4BE0 A;  1S03 G;  1WJD A;  4KT6 A;  2HIV A;  3TY9 A;  3BAB A;  4BS9 A;  3JAM W;  4LF8 H;  4ZJZ A;  3W2A A;  4LIU A;  4LSA A;  2BW3 B;  4YHH H;  3CJQ B;  2WAD A;  2CUJ A;  2IGN A;  1DGR M;  3PSF A;  4DR2 H;  2W4S A;  2VPL A;  3OL4 A;  2VLA A;  2Q2U A;  2WY7 Q;  4XKB A;  5FD5 A;  3FBN B;  5FLX W;  1FJG H;  4XR6 A;  4DR3 H;  2UUZ A;  3OYA A;  1HNZ H;  1D1C A;  2CS3 A;  4XL9 A;  3RSN A;  2R7U A;  4EFE A;  2R7S A;  2W7N A;  2Z16 A;  1P9Q C;  1MND A;  3SYT A;  3I3L A;  3VYU B;  3H0D A;  2ZJT A;  3LML A;  3H35 A;  1BGW A;  3A2K A;  3OS1 A;  4BXF A;  1E4G T;  4YEL A;  2X1C A;  2BW3 A;  5HLT A;  4NUB A;  4DV7 H;  4B3X A;  3K4L A;  1Y56 A;  2HU9 A;  2JUG A;  3BC8 A;  2WA0 A;  4F91 B;  3PUB A;  3UR3 C;  3OS2 A;  4R79 A;  5LD2 C;  4IQ4 A;  2JSP A;  1HNW H;  3IAS 2;  4C2U A;  1MNE A;  2VKD A;  4GLX A;  2HDW A;  2L2O A;  2X6X A;  1AA7 A;  4OWR B;  2VQH A;  2CFM A;  4N4N B;  4EQ5 A;  3KXY T;  4G6T B;  4JI2 H;  2X6Y A;  3H5R A;  4B3R H;  1SYX B;  4KIT B;  2R7R A;  3RGX A;  1S9H A;  3RGZ A;  2KDO A;  3RCO A;  1FKA H;  4JYA H;  5FRO A;  4XOP A;  2X1D A;  2XDV A;  3J80 W;  3F9K A;  3GB8 B;  2XIG A;  4DV5 H;  1A0I A;  1Z2O X;  1XNQ H;  3DWL E;  3MD2 A;  4DR1 H;  3EPZ A;  1CKN B;  3CP8 A;  3OYH A;  4E6N A;  3L4K A;  4JI4 H;  3W5O A;  2WAF A;  3DU6 A;  2KPM A;  4CCO A;  4UCU A;  2OC6 A;  3FBI B;  1V5E A;  4B48 A;  3K10 A;  3EUA A;  3LSM A;  4DR5 H;  2CH0 A;  3L2W A;  3NBY B;  4DR6 H;  3DPU A;  1LDK B;  1YX5 A;  1TAE A;  3S3N A;  1DP3 A;  2KQR A;  3L2U A;  4HPQ A;  3L2Q A;  2E5N A;  1SEI A;  3LL7 A;  3OYG A;  3UQ8 A;  3BCB A;  1LVK A;  4X65 H;  2OV7 A;  3DTK A;  3VSK A;  4LMY A;  3D5L A;  4LF6 H;  1WFX A;  1DGS A;  3W1G A;  2F4V H;  4BDZ A;  2VIX A;  1G8X A;  1T0F C;  4LG3 A;  4JI6 H;  2HNH A;  2HPI A;  2CFO A;  4CCK A;  2BVM A;  2O5R A;  1NG7 A;  3BLY A;  4RB2 C;  2R7V A;  2O03 A;  4XLA A;  4JI5 H;  4D1Q A;  2UWM A;  4A2A A;  3K6G A;  4IAJ A;  4XOR A;  3ZRG A;  2XAU A;  4XKW A;  5D1O A;  4PZ7 A;  3K4N A;  4GRI A;  1LKX A;  1T95 A;  2KZV A;  3OYF A;  2VUG A;  2GOM A;  2XC7 A;  1V5F A;  3QYE A;  3CP2 A;  2WAQ A;  1CKN A;  2W57 A;  2HQA A;  2HIX A;  1WJF A;  3L2R A;  1EA3 A;  2Q1Z B;  1MMD A;  4RB3 C;  2LRE A;  4X0G A;  3OY9 A;  2M7A A;  1G59 A;  2IS1 A;  1X1A A;  3E1S A;  5IT9 W;  1WJA A;  4Y33 A;  2UV1 A;  4DRF A;  1J5E H;  4E7S A;  4BAC A;  4RAZ A;  4PJM A;  4DOZ A;  5LFA A;  2F5V A;  2M4G A;  2M7B A;  5LMU H;  1N32 H;  4N4O B;  4PJL A;  3SDB A;  1BJT A;  4LF5 H;  3RIZ A;  2PJR B;  2IGO A;  2MCT A;  4E6K G;  3K4B A;  2WE6 A;  2E5L H;  4LFA H;  2A6T A;  5JHF A;  4BE2 A;  4PZ8 A;  1X19 A;  1SFK A;  4MLO A;  1W36 C;  5FD6 A;  4FM9 A;  2PMZ A;  1HA8 A;  4ANJ A;  1P8L A;  2OWO A;  1Y6I A;  1PYV A;  3DKY A;  5CKT A;  4EEQ A;  4BQO A;  3BCA A;  1IBK H;  3DLA A;  2IXS A;  3K4K A;  1SAU A;  3E0J B;  2K9M A;  1ZEL A;  4CCL A;  2E1M C;  2IS4 A;  4DV0 H;  3HOS A;  3BG7 A;  1Z3Y A;  2JA2 A;  4B44 A;  4BUP A;  4BQN A;  3A1Y A;  4XMY A;  4X64 H;  2L5Q A;  2KP6 A;  1PJR A;  2RGV A;  3NWS A;  2VJJ A;  3HPG A;  5KNL A;  1TZL A;  4J01 A;  3HOT A;  4BEH B;  4E7L A;  1XDN A;  2R7Q A;  3H20 A;  3J81 W;  4BQQ A;  3DTI A;  3NBZ B;  4AQY H;  3OIQ A;  2LC2 A;  1O75 A;  2RGR A;  3NC0 B;  1XMQ H;  2VL8 A;  3OTO H;  4NXM H;  2HVS A;  3L2V A;  4RLQ A;  3T1H H;  4PSX A;  3VYS B;  3KYH C;  2CW8 A;  2HPM A;  4EFB A;  1TT0 A;  4RLF A;  3QOD A;  3LFU A;  4BJ6 C;  2L7K A;  1WH2 A;  4UFZ A;  2Q2E B;  1ZHS A;  5KCM A;  2KRC A;  2R4G A;  4UCR A;  3SZG A;  4DJA A;  2VJI A;  1X9N A;  2RQQ A;  3OR2 C;  1YE9 A;  3IG0 A;  3M8J A;  5LMN H;  2K5C A;  3A4C A;  3N40 P;  2MD0 A;  2WY8 Q;  5D1P A;  3N41 B;  2IS6 A;  5EOY A;  1HNX H;  4JI8 H;  2W00 A;  3OL3 A;  3PFY A;  2WYO A;  4NXN H;  1GYF A;  4PUS A;  3K70 C;  4B3T H;  2E5Z A;  3S32 A;  4XLF A;  3OYD A;  1OR7 C;  3K4J A;  5HNF A;  2ZXH A;  4M7E A;  4RMN A;  2VOB A;  4MV7 A;  4E7K A;  3N44 B;  2MC4 A;  4XQF A;  1N77 A;  4AVZ A;  4AYB A;  3TY5 A;  1CKO A;  4LIT A;  3N43 B;  4ETS A;  2X1E A;  4XLH A;  3GBG A;  4HEA 2;  1XNR H;  2HZD A;  4UCO A;  4CCJ A;  4E4H A;  3KYL A;  3S3M A;  1L2Z A;  1DGW Y;  3BG6 A;  4DIQ A;  4PFO A;  2UUC H;  2AQF A;  4XLE A;  2LBF A;  2LBF B;  2GOX B;  4UCV A;  3VWB A;  2F6C A;  1Z3X A;  3OYL A;  4X62 H;  3OYN A;  2UXC H;  4XKC A;  4PJJ A;  3H5N A;  1X1C A;  3OYK A;  2CW7 A;  2HVQ A;  4CH7 A;  4U87 A;  1QU3 A;  2OUM A;  2DJI A;  3KX2 A;  1D1A A;  4DV6 H;  3CMM A;  2VQE H;  3W2W A;  2DXI A;  2A5W A;  2L9S A;  4JV5 H;  4BGD A;  2KHM A;  4YEJ A;  2ZM6 H;  2R7O A;  3ZGK A;  3PNY A;  3KAL A;  4CA0 A;  2IGK A;  4K0K H;  4BL0 B;  2ZFU A;  4FAS D;  3RQ4 A;  2PJR A;  4B3S H;  3LSK A;  3VDX A;  2VB6 A;  5HOO A;  3S3O A;  4P1W A;  3GDE A;  3QWU A;  4LH6 A;  4LSX A;  1B04 A;  4A2B A;  2CV0 A;  2L9N A;  2VQL A;  1QHH D;  5LL6 b;  2JVG A;  3OOU A;  2R7T A;  5CQG A;  3DEE A;  4JOM A;  5A2Q W;  4YRV A;  4OX9 H;  3H9G A;  3LSI A;  5DIS C;  3OIP A;  3C0F B;  2VXD A;  4BJT A;  1D0Z A;  2ZSI B;  4CCN A;  2XSJ C;  4F3Q A;  1XMO H;  4MV9 A;  2KRH A;  1WJB A;  3UNG C;  2JVH A;  1Z2N X;  3K3V A;  1ZHQ A;  3I9V 2;  3OYC A;  1BR2 A;  2ELJ A;  2V4J C;  4KHP H;  4Q0Y A;  3CVZ A;  4R7R A;  2IGM A;  2VJ4 A;  4DUY H;  4DR4 H;  4F52 A;  2KLO A;  3OS0 A;  4E7Z A;  3H9J A;  1BR4 A;  1UG0 A;  1N33 H;  3HKZ A;  4IX7 A;  2RRE A;  1Z21 A;  2KL4 A;  2BVL A;  4XM3 A;  2AQE A;  1N34 H;  3C2H A;  1U0J A;  2Z1D A;  2WAE A;  3GJX B;  1X4P A;  4JQF A;  4XKV A;  4BJ5 C;  4B43 A;  2M0M A;  4B3M H;  4RM2 A;  4LH7 A;  4KIS A;  3EUK L;  3FMA A;  3HG9 A;  4IZZ A;  3MWM A;  3VSL A;  1V9P A;  3PN1 A;  3EUH C;  1QHG A;  1FMW A;  3M1C A;  4PK4 A;  4U7B A;  4HG2 A;  1VZ0 A;  2KSW A;  4LFB H;  1KON A;  3D5S C;  4JI3 H;  3HPH A;  2BOL A;  2X85 A;  4HNT A;  4F92 B;  3OYI A;  1Z2P X;  4HST A;  4DGW B;  3S93 A;  4CCM A;  2CV2 A;  3U21 A;  5BR8 H;  4B47 A;  2VQC A;  1IBL H;  4MTD A;  3AL0 B;  2FE3 A;  5FPR A;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...