2HVRA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 3'-deoxyribonucleotide at the nick
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Ligase/rna/dna
total genus 83
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvrA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvrA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvrA01
4PZ6A 2VUGA 3JSNA 3S24A 4UCUA 3L2PA 2OWOA 3RTXA 3RR5A 3NC0B 1DGSA 1CKNB 3VNNA 4EEQA 3TY9A 1XK5A 1B04A 1VS0A 4LH6A 5FPOA 4UCOA 1S68A 4GLXA 2Q2TA 3KYHC 3BABA 3QWUA 3BA9A 3NBZB 4UCVA 4UFZA 4PZ8A 5D1PA 4DRFA 1P16A 2HVRA 2CFMA 3GB8B 4UCSA 1FVIA 3GDEA 1A0IA 4E6NA 1XDNA 4UCRA 2Q2UA 4CC6A 4LH7A 3W1BA 4CC5A 2HVQA 2HIXA 3TY8A 3JSLA 5DISC 1TAEA 3PN1A 5D1OA 2HVSA 3UQ8A 5FPRA 3GJXB 1X9NA 1CKMA 3W1GA 3W5OA 1P8LA 4PZ7A 1CKOA 4EQ5A 1CKNA 4EFBA 3TY5A 4UCTA 3BA8A 3NBYB 3BAAA 1V9PA 5D1OB 2HIVA 4EFEA 1TA8A
chains in the Genus database with same CATH superfamily
1PUFA 2PEXA 2FOKA 3JRAA 1G4DA 1LFPA 5KCMA 2LYCA 3C18A 4ED2A 5E3NA 2RV8A 3ZMZA 2BGCA 2CQNA 2EA2A 2M4KA 3SE7A 3BACA 2O7OA 2VJJA 2X4HA 2UUZA 3GTPA 1T56A 4H4KC 4YJ2F 4U0YA 2NS8A 4WK8F 3ABUA 1FJLA 5E17F 4EATA 2Q2EA 3TY9A 3TOBA 4IF4A 1GSAA 4EV0A 1ZG3A 1FMWA 2XAGA 4MIMA 4D5FA 5L3FA 1QBJA 4LFCH 4FCYA 4QIWN 4IQ4A 1MNDA 5L1LA 4NNJA 4C5BA 5DUKA 1S97A 1I27A 4I02A 2GA1A 3H5NA 2DA2A 2NS7A 4D7NA 4XYMB 3N40P 1G3SA 2X1CA 3F6OA 5KT5A 2HR3A 3BLYA 3DV8A 2P81A 2YS9A 2RDPA 3SFIA 1EKPA 1S68A 1IW7F 1KTAA 2QSFX 2L7FP 5KT7A 4C9YA 2VPLA 2VJIA 2DPIA 3HOWG 2R7QA 4UHTA 4GDFA 1X3UA 5DDGA 2QF7A 4IVNA 1IRFA 1LVKA 3LSHA 2IBKA 5LBQA 4FE7A 3CVZA 2EIYA 4B3RH 1VQ7I 1ZGJA 1DIKA 2HU9A 1S3JA 3U1DA 4O7YA 2DYSH 4UUSB 4AIJA 1SFOA 1MGTA 2VUMG 3F72A 1I5ZA 2NOJB 3TW6A 5HNHA 1T0FA 1KJJA 4PJNA 3EUKL 1SCUB 3UZBA 2R7OA 3HJEA 1JJ8C 1FOYA 3DTEA 2HS5A 4BBRJ 2QBYA 3MR2A 2GQQA 2MABA 5F04A 4XR6A 2GBYA 2NVQJ 3AG1H 3BQZA 2VOBA 3OHAA 1HSJA 3MWEA 4IZOA 3KZIC 2FJ1A 4YEJA 5F6FA 3U2RA 4BEHB 4BE0A 2M30A 3ERMA 3H0GJ 1N33H 3NWTA 4BYYA 5IYDG 3CESA 1SFEA 1TNSA 4DAAA 4R8HA 2EV6A 3G3ZA 4I4TF 3OYCA 1X1BA 5FKMA 4L5IA 2R6FA 1S03G 5FLXW 4N4NB 4QSHA 5J1RA 5E3LA 5EJCA 3CMMA 4AWXB 2VKEA 2V79A 3QYFA 1T36A 3IL2A 3GTQA 3J80K 2WAQN 4LF5H 4X6AJ 1WSCA 2NVYA 1B59A 5F9NA 5D5WB 2EZIA 2ZMEB 1FMVA 2Y0SA 1U5TA 3A2KA 1WI9A 3G6VA 1W4MA 1T98A 1RESA 5DYMA 1JUPA 3KREA 2G7UA 2O8KA 2HOAA 2PBIA 3K2ZA 2JA2A 4OIQF 3DEUA 5E8IA 2HHFA 3J7ZI 2Z2SB 2NNYA 1MH3A 3EPGA 1O4XA 1XG1A 3L2VA 1BR2A 2CNUA 4EFEA 3GUDA 2VB6A 1MJBA 1VNDA 4U0WA 5JHFA 3JSNA 1TWCJ 3VDXA 4NC7A 1FYMA 2KDZA 1KT8A 4DL5A 2C28A 2DODA 2V9PA 3H3UA 3T9FA 4U6PA 2FLLA 2QZ8A 3L2PA 4ZC3A 2BQUA 4IL6C 3BJ6A 1SANA 1KU9A 3FHZA 4FX4A 1I6UA 3ULQB 2CYYA 4DV2H 1XX5A 4DZJA 4XQFA 1IV6A 1DPUA 4BBRG 3Q0WA 3RKXA 1O3RA 2KFDA 3J7AO 3L2WA 1DU6A 1K78B 4LF9H 3EPZA 1U9OA 3KP2A 3KAJA 3O8GA 5FRNA 4XRSA 3QZ8A 2DJIA 5GAGJ 3LWFA 3DKWA 5KFMA 2FU4A 2HDKA 4EBDA 1X2MA 3HOVJ 2W6NA 4HN2A 1R1TA 2F2EA 4LIUA 2GQSA 3BTIA 2A69F 4O4JF 3K1NA 4XX0B 3H0GG 1FOXA 3GTKJ 1TNTA 1VS0A 4J19A 2F5DA 3S32A 4HX8A 1KQ0A 3DPUA 4KICA 2XGCA 3VYSB 2B63J 4LK0F 3G1LA 3ASOH 1BJAA 5KFZA 2DMTA 4DIQA 3SJMA 5B3SH 2DFEA 1WWXA 3HRSA 4XOPA 3CP2A 4Q45A 1FOWA 2BOLA 3GVAA 3N43B 5JQWA 1HDDC 5KG3A 2R7MA 4N0BA 2JVGA 2RNJA 3IAS2 2DQRA 5GP9A 1J5YA 3QQAA 3TDUC 3WO1A 4ESJA 1N34H 2VKDA 2F5EA 2M45A 4LGWA 1N75A 2BVLA 4O6JA 2KDOA 4XRMA 2LP0A 4KN7X 4DBQA 5BMZA 3N4MA 4BBSJ 4MV1A 3M1CA 4E7KA 1GGOA 1ZHQA 3CC2I 2KMUA 5KG2A 4LLGF 3GB8B 1HW1A 5F9LA 4A93J 5J8FA 4UCSA 1QZYA 4IRIA 4HLYA 1ZN2A 4KISA 1ZHFA 3F22A 2FMAA 5I5TA 5KFSA 2DAOA 2XUBA 2XD4A 5LHIA 2VBZA 2PJPA 4ECVA 2D45A 2W71A 1TWFJ 2RGVA 4HQMA 1YIOA 4AU7A 2K9QA 3JTGA 3GTJA 4HAMA 2ME0A 2HYJA 1M7JA 3BCBA 3CJNA 3MAJA 2ZXWH 1XGOA 2JA5A 3QYBA 2XV4S 3KETA 1QHHD 2W9CA 1A31A 3RKWA 3D0SA 1TLHB 3KIOA 4XL9A 1QNTA 2R7TA 5KFUA 2B63G 4P55A 2HQRA 3KYDB 5IYCG 3K10A 1WI3A 1Z6RA 4LSXA 5L1JA 4MEXF 4J9MA 3L09A 3JRGA 4FM9A 4LFBH 3HOUJ 1K7AA 5CM0A 3G4SI 2D1HA 2WY7Q 2LF8A 5JLWA 5C4XJ 1UNNC 5KT4A 2YS6A 2JMWA 2L3DA 3H92A 4U87A 3ZMUA 3PNTA 3UYYA 4L5EA 3T1HH 1IBLH 4U7DA 2NYXA 5DQGA 3HXLA 3W1GA 2I8CA 2GA2A 1ZAOA 4JV2A 2HFHA 4P1WA 5EG0A 3PNYA 3RCOA 3HOVG 2O6GE 3ZQ7A 2DOFA 1POGA 1KJ8A 3KYCB 4QWQA 5EF6A 2QA4I 3V6HA 2ZC2A 1TP4A 3HIFA 4LG3A 2BXYA 2H27A 3HPHA 3C0FB 2GZWA 5JLXA 2XSJC 1QZEA 3OTOH 1BBYA 3OS0A 2RDJA 1A9XA 1ZG1A 1S0NA 2L9VA 1I6HJ 4M71A 2H94A 5EWGA 3F6VA 4M0JA 3IH4A 5KT6A 2J6TA 5D1OB 3N8DA 2FLPA 4J9LA 4A3IJ 1TA8A 2CV1A 5IT9K 2FRHA 4UVCA 2LY2A 2WV1A 3I56I 4IWYA 2QQAA 3PFYA 4TM5A 5KFKA 3RF2A 1GLNA 3I4PA 3I5UA 3PQJA 3TBIA 4V19K 2I5UA 1B6SA 5EZHA 3S16J 4EYHB 2NVTJ 2R7WA 2ZJPF 4G7ZF 1DGWY 2XB0X 3E5UA 5GTIC 1FTTA 2YZMA 4RB1A 4BBSG 4DR5H 2QK4A 4RLFA 3M07A 4XLCA 3HOZJ 3H0DA 2VKVA 5JHUA 2BBYA 4A93G 1NG7A 4B8XA 1B8IA 1QPMA 3E5NA 2V9VA 2CW0F 1FSHA 4ME6A 1SVMA 4Z2YA 2JT1A 4JI7H 4QW9A 4Y52J 4UV8A 3TOAA 4EBEA 4CSWA 1GT0C 1A6IA 3FZVA 3ABMH 2XCLA 4BDZA 1SFXA 4EM0B 3SDGA 2UVRA 5DGAA 1XDSA 2FNPA 3KLOA 4L18B 4O7WA 5BYBA 4NXNH 4PJJA 1GDTA 3QPLA 1Y56A 5KFWA 1Y6IA 1XC5A 4GLXA 3RB4A 1FYLA 4L1KA 4ZYHA 1ZR2A 2XGEA 1D8KA 2M34A 3ZR8X 2L7MP 1EUDB 2VQDA 3HOUG 3WGHA 1IBMH 1LDKB 1W5CC 4AVPA 4H0EA 5C4XG 3W6KB 1Z77A 1OYIA 5EYRA 3TGNA 4EQQA 3OUUA 1R7JA 4YFXF 1QZZA 1ZQ7A 3TL4X 3ROUA 3SNOA 3RB3A 4LF6H 2VJ4A 1TBXA 4A3BG 1B9MA 1R00A 4E6KG 1QO0D 3JRCA 4U7CA 4NHJA 4B3AA 4DV6H 4Y17A 5HDKA 2IA2A 1JKOC 1KU2A 3ZPLA 2M2EA 3H4BA 5F0FA 2DU9A 4EJUA 2R7SA 2P6SA 1GVJA 3WG7H 1F9NA 4IRGA 5M5XJ 2L4AA 3WTVC 5DCFA 3G8CA 4RBOA 2BW3A 2EWNA 3MD2A 4I01A 2WDTA 1QA6A 1W36D 2V9WA 1XPXA 1U9NA 5A2QZ 2C00A 3FDSA 4A3IG 2UU9H 1RR7A 3TIIA 1UZCA 3BG5A 3G6EI 2KSWA 3G73A 2DZDA 2DWCA 1YOVB 5JVGF 1HQCA 3FBIB 2V26A 2COJA 4R7RA 3BR1A 2XPWA 3JSLA 2R7DA 3VODA 4DYCA 1HW5A 5FR9A 3DPLC 1LJ9A 3KALA 2CGPA 2FLNA 2COGA 3RJ0A 5B66C 2L54A 3RPUA 3RZOJ 3RGXA 3HOZG 2GIVA 2VBXA 2LKPA 1X3WB 4S04A 2HGSA 1SAUA 3J7AY 4HX4A 3QU6A 4LFUA 1RIOH 2BXZA 4HRIA 2R7RA 3BT9A 3LA7A 5IOYA 3FXLA 5BWVA 1RI7A 4YAJB 1ZELA 3C2GA 3UR3C 5C5JA 4J9OA 1P8LA 5BWRA 3LSMA 3DTGA 4BHBA 5HNEA 3Q8QB 4ED3A 1G3YA 4EQ5A 3AFHA 4M9XA 5HS9A 5CR5A 2AU0A 1IN7A 1R23A 1Y1WA 3FM3A 2XGDA 3Q8PB 2R4GA 3TY5A 5E20A 5DV5A 2JA7A 3BA8A 3M9MB 2DT5A 1OLTA 3C2HA 2IS4A 2DOEA 2P7VB 1WR2A 1YW9A 4IHXA 1Y8RB 3F23A 4BWSC 4A0ZA 2R7NA 5IWAH 2ZXHA 4O5VA 5HV6A 5CB4F 3QQMA 5LFAA 2DTRA 4XKWA 5M3MJ 5B1AH 3R23A 5KT3A 3A1YA 2O0YA 2L7KA 2W24A 4O4LF 1S0OA 3JZFA 1O7FA 3COAC 1BI1A 3OUZA 3M9NB 1CF7A 1YX5A 1I1LA 3JZ6A 3PSFA 3DWLE 5KX5F 1B8IB 1MMNA 3BR5A 4LG0A 1SC7A 1FT9A 2GAUA 2HQ5A 1OYWA 1D1BA 1FX7A 2CQQA 2ZKZA 2FF4A 2P0WA 4CKCA 1Y14B 3GIKA 2R7ZA 2E1CA 4XSXF 3ZQIA 4TQRA 2BQ3A 1BC8C 1Z3YA 4ECZA 3OOUA 2LKSA 3KX2A 2PN1A 1ZG5A 2OQGA 3T99A 2JK3A 4KA4A 1EYZA 5K7HA 2W7PA 4DR1H 5C3EJ 1BW5A 4MGRA 5EEGA 1KU3A 2Z1DA 4AYBA 1PDNC 4YIIA 4LLNA 3S2WA 3OSFA 3ZN0A 3BABA 4GLWA 1FZPB 5T14A 2G9WA 2VR1A 4F91B 5DD8A 1OWTA 4LSAA 2GLTA 4IHTA 3TMOA 4CMFA 1VQKI 3RFCA 5KT2A 3OIOA 3E7LA 5BWTA 2IRFG 4O3NA 1F36A 3BWGA 3I59B 2ME6A 4YG2F 1YRNB 3CMAI 1PUEE 5D4RA 3OYIA 2LRDA 1XMXA 3AAFA 2HVRA 1I1MA 5EDWA 4JBAA 3RAQA 2XRNA 2LSOA 1FVIA 1KEEA 1LUJB 5BPDA 5I5UA 2CG4A 4B3SH 4KT6A 1V3FA 4PUSA 5C1PA 3PW0A 4DR4H 3JAMW 4ESFA 1VI0A 2WV0A 4CHUA 4JI4H 5IY5H 3WU0A 2ZMEC 2WB1E 3DU6A 1SD7A 1SYXB 4IOAF 1HF0A 2IGKA 1UHSA 5AIPA 4JI3H 2UWMA 2HVQA 4Y33A 5KAFC 4QTRA 1IN4A 4JOMA 5CQGA 4A69C 3ZCOA 1XNQH 1GYFA 3KHLA 1YW8A 3N42B 5E3MA 2PMZE 4A2AA 5K5RA 1YJWI 1WFXA 3R0AA 2LG4A 5I5XA 5DG9A 3MFKA 3CC4I 4EG0A 3OSNA 1TWAA 1L0OC 1I3QJ 1OPCA 3ECHA 2R85A 3JSPA 1D1CA 5CA0F 2X1DA 2TCTA 3R6SA 1IO2A 1JJ6C 4JXUA 5LMUH 4FS2A 1WVRA 3VB2A 1RNLA 2W7NA 1JTXA 2Q0OA 3OYDA 2WYOA 2FMLA 5L9XA 1B72A 2YU9A 3V4ZA 4BXFA 1GO3E 3OMYA 1KUTA 5HS7A 4EBCA 3GTLJ 4L9JA 4Q48A 5ED4A 2Z9OA 2ZB9A 1W36C 5CVRA 5CAEB 4LIVA 4O7SA 2LBFA 2VQEH 1VQ4I 3K5HA 2JRTA 2NRAC 1HDPA 1OYYA 5C3EG 3N05A 2JQ7A 4FU0A 4CKBA 3Q8RB 4F4ZA 4F4YA 5HLHA 4DW6A 3KHRA 1R9TA 1OFCX 2HGWA 1RJQA 3DP7A 2WTFA 1QRYA 1YIJI 5D5UB 2K5CA 4CCMA 5BPIA 4EGJA 4F52A 2K3FA 3MZ8A 4YFNF 3V6JA 1RETA 1XGNA 4RAGA 2M5WA 5A2QK 1G3TA 4AVZA 2DA4A 2ID6A 2JSCA 4M3FA 4BDYA 4KUMA 1ZLKA 4DLKA 5EWFA 4O81A 1RPWA 1ETKA 5HDGA 2P7CB 2IP4A 2W6PA 4B1RA 2M3AA 1JXSA 4E70A 1FY7A 1A3GA 3PSIA 4ZYEA 4EJWA 2OA4A 4WXCA 2F5VA 4WF2A 2FK3A 1B04A 5K1YA 4YIFA 4FFNA 4DV3H 2ICWG 2XPVA 3TQNA 3Q2OA 4ED8A 1JX4A 2DA5A 4O3RA 3TEDA 3MKLA 2MFZA 5LEJA 4XK4A 4IR1A 1JHHA 1KQ9A 2W6ZA 4ED0A 2V4JC 4EYIB 1ENHA 2SCUB 2KISA 1R36A 4P96A 2DO7A 3LSPA 3W3CA 3RPQA 5EOYA 2Z33A 2HJWA 3DLAA 3KYLA 1EJ9A 2I10A 2YU3A 3GFLA 4G12A 3ZQGA 3BROA 2MD0A 2C22A 5KFCA 1ZGWA 1Z2NX 3P9CA 1AKHA 2HQNA 5KFRA 4DOZA 1U78A 5ILSA 5KG0A 2ZNZA 5KG1A 4YRVA 3N6RA 2KRCA 2QM3A 4DUZH 4JI0H 2LDUA 4HA8A 1Y1VG 4MTDA 1P16A 1BM9A 4WXHA 5LOVF 3Q9SA 4U0VA 1K1SA 2VPSA 5FD5A 3G6XA 1YTYA 4HF1A 2IT0A 2DMNA 2E1OA 2X0SA 2MLGA 1BA5A 3E6CC 4XLPF 3ZQQA 2X85A 3I0TA 3WTTC 4HLXA 2HPMA 4RGSA 2DTZA 2M8GX 2Q7DA 2IEKA 3VPDA 3PUFA 2E1MB 2R5YB 3J80W 2XASA 3GIJA 3E6MA 5LA6F 2OH2A 3I3LA 2K40A 3I64A 1SFUA 1K4SA 1ODDA 2DA6A 3P7NA 3JRXA 3RQ4A 5KFHA 3CCLI 2M4GA 1VFCA 2GIZA 4HYKA 3QP5A 3S8PA 2Y0SE 1MNMC 3IH2A 2DK5A 4PCQA 3CCQI 5L3BA 4O3OA 3W6VA 2XGXA 1IUFA 3GIDA 4TV9F 3OY9A 2R8JA 2HTJA 3TW7A 2MG4A 4CCNA 1FBSA 4KFCA 1CKMA 2YZNA 1N32H 3LFKA 4XLHA 5TJJA 3S2DJ 1KZHA 1Z0XA 2K9LA 2ZXIA 2QQ8A 2EFQA 4NBQA 2K27A 4KT5C 6PAXA 1Y0NA 2V1UA 2C6YA 1CKOA 3DU5A 2DPUA 3FKJA 1MBJA 3VEPA 1WJEA 1S8NA 2YX4A 3ZMTA 4JV5H 3K70C 3GLKA 4M6YA 1BI3A 4HZFA 1W7PA 4DBRA 1HKSA 2R7VA 1Z21A 4R8UA 1I1KA 4M73A 3T9DA 5BWWA 2HXIA 2WB1A 4A3JJ 3H0GA 4BH9A 1BJZA 2V5AA 3R60A 2EPFA 3HOTA 2ISYA 1GVDA 1Z7UA 5FLMJ 2PVPA 4ZI7F 3E3VA 1MMAA 3K4KA 4C5AA 2YRWA 5DGBA 3FXKA 4AIKA 3EUHA 3FMRA 1O75A 1SD4A 2V6EA 4C5CA 2L02A 3RR5A 5HDNA 5KFLA 3JZIA 2CQYA 4BAYA 3J7YJ 5D8DA 1KJIA 4CE5A 4PSXA 2LNBA 4C2TA 3IH3A 1XGSA 3PO3J 5H2FC 4Y13A 1GLVA 5DLGA 3RPUD 4JI6H 2AO9A 4NQWB 2UUAH 3K7AJ 3N44B 2A68F 2JJ7A 3E1SA 4O7NA 2QVOA 3BZKA 4I7HA 1IN6A 4PZJA 3CSWA 1MIJA 3H3ZA 3OSGA 2KT0A 1V4RA 1J0RA 1SMYF 2L7ZA 2IVMA 2E5NA 5KNLA 4DL2A 4L9NA 1NK3P 5L1KA 5LGNA 3MFHA 4FQGA 4ETSA 5B1BH 3JREA 3KCCA 4O7TA 3CDLA 2AQEA 3MVPA 2WC2A 1TQMA 1KONA 4S05A 5GAEJ 1TWCA 4WD3A 4TQSA 2K4JA 4QWBA 5KFBA 3CLOA 1KJ9A 2R93J 1PP7U 2KPMA 1R1UA 1EHIA 2BY0A 1I94H 3CQZA 4DQ2A 3ZQFA 1MBGA 1E4EA 4CKEA 4MFDA 4UB8C 2J5OA 5DCMA 2PJRA 2IPQX 1ZKGA 3AG3H 3GFMA 3GIPA 3JW4A 1IG7A 2FEZA 3NARA 1AN7A 5DQIA 3HKZA 5L3DA 4KIBA 1SEIA 2W00A 5GPAA 3J81Z 1QVTA 5DMXA 3KP6A 4YAKB 1K1QA 5KG5A 2VQGA 4PBCA 5H6RA 3MKZA 3TDZC 3UNGC 4CC5A 3Q1KA 1JKRC 4JV0A 3NWSA 5FLMG 3Q8SB 3OYEA 2D2WA 3KP3A 1DP3A 3T5LA 2Y9ZA 1XB4A 4RS8A 4O4HF 3FBNB 1H0MA 2PQ8A 5EZYF 3WU2C 3BQ2A 3S1NJ 3CUQA 1LFUP 2YZGA 1TW3A 1WJ5A 1R22A 2CQ7A 5AIQA 3BTLA 2R5ZA 2X6WA 3GTMA 4YR0A 2R0QC 3CDIA 3IRQA 2ASJA 4A6DA 4IHVA 3IAM2 3BQ0A 1D5VA 1WCMA 5IT9W 4OWRB 4PZ7A 4I50F 3TEKA 4NLGA 2EIJH 3K3VA 4ECQA 5E1ZB 3HPGA 4PJMA 3LNQA 2KIQA 4UVBA 1CKNA 4O2AF 4LLLA 4APMA 2WB1N 3G1MA 4EFBA 1F5TA 3KHHA 4HQEA 2R86A 4O2BF 3H20A 3GTOJ 1WRVA 3QPTA 5J4YA 2W9BA 4M6VA 1SMTA 4XIDA 2JVHA 2FQ4A 3T1BA 2CMPA 2HIVA 5BPFA 1EZ1A 2Y4RA 2PMZN 4CGZA 1GUUA 2O03A 2MBFA 4G8XA 2UZKA 4I6ZA 2ATLA 2LREA 4IAJA 4PGHA 1S29A 5KK1A 4CCJA 5DAAA 3OYNA 5KFAA 4IX7A 5IT3A 5CE8A 3M4IA 2R93G 3V6KA 1TT0A 3QAHA 5J1YA 1DQUA 3NC0B 3I12A 1B4AA 1V5FA 4WHXA 2EFOA 5FLXZ 4ECWA 1I7LA 1LQ1A 2M05A 2PMUA 2UVUA 4XYLB 3HUGB 2VBYA 1ETVA 5K2MA 5E3OA 4XOTA 4Z6YA 2XGQA 1E4GT 1NTCA 4RDUA 4RAYA 2EQRA 1U8RA 5KG4A 5ICFA 1SVOA 3KEYA 3X2QH 4Q8FA 3A01B 5LHHA 1N56A 2M7AA 4A3FJ 3SYTA 1K6OA 1PUFB 3J7AK 1OCCH 4RM2A 2NVUB 2EFNA 2VA3A 3DF8A 3ZMSA 4B47A 5D6FA 1XNRH 4BE2A 1JKJB 5H80A 4O7RA 3RB6A 2VN2A 5ERIA 5JR3A 2QB5A 2UXCH 1TW2A 3LSTA 3GYHX 5I5VA 3QWUA 1EH7A 1RZ4A 2QKMB 3H5AA 4FETA 5J6XA 3CF5F 1DAAA 1RKWA 2M7BA 1EKFA 4MV8A 2OU2A 5JUMA 2Q2EB 5ILUA 2RKHA 4OAZA 2ADUA 4XLEA 5EZGA 3K1PA 1JLLB 4CO8A 3DTFA 4L9VA 4I09A 4YR3A 1GHCA 2RVCA 3Q0VA 3NEUA 1J2XA 2L01A 3TO6A 3U1KA 1MZBA 3LQQA 1LVAA 2CW7A 3MWMA 3ZQHA 3GTPJ 5F0HA 4RZRA 4XMYA 1JKQC 5DCMB 1CQIB 2ALZA 1Q1HA 4HSTA 3UZOA 1IOWA 1FJGH 1FKAH 2UXXA 3ZP5A 1B1BA 2IAIA 1FIAA 1E2XA 4MV7A 2L0KA 4IR9A 1IXCA 4DQNA 4YQWA 4GYIA 4ECTA 2NXNB 3W1BA 1UC8A 4HR7A 4KNYA 3MR3A 4J9RA 3MJFA 3LAPA 2Z99A 2ZBKA 2A6HF 4M3DA 1VQOI 2VONA 4ZDLA 5BYAA 2ZNYA 3FF5A 3WTZA 2PN6A 2ODTX 1NG6A 3ABTA 2A3SA 3W2WA 3M7GA 3M4OJ 2QBYB 3WHCA 3S3NA 1JDBB 3PW7A 2R8KA 2EB7A 4JI8H 1JT0A 2MGQA 4YFKF 2X6YA 1JGGA 3U54A 2AS5F 3V7RA 1SFOJ 3GJXB 4HQ6A 5BMVF 4CUGA 4B43A 1YJ9I 3OS2A 3IV5A 3RJPA 1HXDA 4C3IJ 1X3ZB 1GXQA 4OX9H 5D5VB 1U6GA 2HYFA 1MDMA 1S72I 4IRCA 4A3FG 1RYRA 3K6GA 1I2LA 1TTYA 2BEOA 2KJCA 4BQOA 1T3NA 2XKPA 3H9GA 2EA4A 3R61A 3RYPA 2JA6J 2FNAA 4UUTA 3GILA 3ISPA 3GIIA 1LB2A 1P7IA 3HOSA 4BNCA 2IW5A 3ORRA 2AQFA 1X1CA 3PO2J 1KGSA 2STWA 3T5KA 1N48A 1P2FA 2OJED 5FKLA 5KFXA 5KFQA 4N9HA 4F7ZA 2KJBA 1MNEA 3BCAA 3MFIA 2Y0SN 4NZOA 2R92J 4BQAA 2NUAB 3DF7A 2JUCA 2J9GA 4DJAA 3J81K 2YSRA 1R5GA 1ON2A 2E34A 5FRMA 2ZGIA 1BI2A 1U5TB 4G7OF 5LEKA 4XRFA 5ILVA 3MZHA 5D5XB 5E1XA 4KYWA 2QKLB 3CCJI 2VA2A 3G2BA 2MSYA 3ELKA 3GTQJ 1HCRA 3U9GA 3ZN1A 1MMGA 1FWZA 3PZPA 4QPQA 2TRTA 2HHFB 5C4JJ 3HSRA 4X0GA 1GSOA 1J7KA 1Y8QB 4AYBE 1P4WA 3E6DA 2L2OA 2G7HA 3M9AA 3TO7A 1EF4A 3V8LA 4BE1A 2HGCA 3OWTA 1EA3A 1OMIA 3HGYA 2HGXA 3RZDJ 5BR8H 1SVLA 3ML6A 2W6QA 1Z2PX 2XHKA 4ENNA 2DOAA 2QYZA 5FPOA 1KYZA 1ZRFA 4CZZA 3HOXJ 5LGUA 3LSJA 1LEAA 3CTAA 2XB5A 2VXZA 2XAQA 2JA8J 1JUMA 4UCVA 1X4OA 1TT5B 3WE2A 5D8LB 1OQYA 2YCHA 2E1MC 2E60A 2VJ5A 2DI3A 3CO6C 4I0AA 1XMAA 3T0YA 5LGTA 3DKXA 1ACIA 3RDIA 3RUPA 2DQLA 4XLNF 3LAJA 1IN8A 3I4MJ 3A0BC 3TP3A 1K83A 2CUFA 4J9NA 2FBIA 2E7WA 4FTHA 3AG2H 2VPRA 1I1SA 1JDEA 3M1EA 4E6NA 3D5RC 2BQRA 3ZQCA 2JN6A 5KVRA 4L5JA 2JA6G 4A2BA 2AHQA 5FLXK 3R9RA 4CA0A 1X1PA 4RB0A 4FFRA 4DV0H 3PO2G 1U3EM 1UJ8A 3GBGA 4M3BA 1Y39A 4J9KA 2X5RA 2DMUA 2HIXA 2F4VH 4NDLA 4X65H 4FBUA 2R92G 3JRDA 4DR7H 4B3TH 2EILH 4N9IA 3BY6A 3KZYA 3F8MA 3UFXB 2OF7A 5CPRB 3NQOA 1H88C 4HW0A 2FMYA 5BS6A 3BG6A 1LFBA 3MKWB 1BOBA 2H1LA 2R8HA 1R6RA 5KFNA 4HOBA 3KHGA 4WXDA 4O82A 2RREA 2FE3A 4MQ9F 3MWDA 1JT6A 1IJWC 4RGRA 2EJ0A 1P4XA 3MEXA 4G9YA 3FMSA 2HPIA 3B02A 1G2HA 1BNCA 3A0HC 4NUBA 2VLAA 2W9CB 1KBLA 1HLVA 2LF7A 5A2QW 4UUVA 5GAHJ 4G7HF 3MQ0A 4RM3A 5CYVA 2IS1A 4OOIA 3LL7A 3RBEA 4HPQA 3HOXG 4DL7A 3OYFA 3T5HA 2XF5A 2XAFA 3T9BA 1NHAA 5FB2A 1IRZA 2JA8G 2DPDA 3G6YA 4E7JA 4UUGA 2C35B 4MV4A 1M1EB 1STZA 2K9NA 1TQIA 4ASNA 1DUXC 2W70A 1E3HA 1X1AA 3BJAA 5GTHC 3WTSC 1Z2OX 4FFOA 5JH7F 5EWEA 2IP2A 2VASA 5EG0B 2LKXA 1QQIA 3CC7I 4UV9A 4E7LA 4FFPA 2EH3A 2B9SA 1I3QA 3I4MG 1FOKA 2DT7B 3VNNA 1U0JA 3DQVC 3FXJA 2VPQA 4EEQA 2H6BA 3BR0A 2B0LA 3CZ6A 1XSXA 1D5YA 2KIFA 1GSHA 1D0YA 1Y1VA 3OV8A 2LOOA 4BHCA 5FO5A 2E2HJ 4FFMA 3T8RA 3JTHA 3MMYB 3M3YJ 3GTLA 2Y75A 1YI2I 2VQFH 5L1IA 3TIGA 1WH5A 2VIXA 2O3FA 2VL8A 3RBDA 1FC3A 1D3YA 2GM4A 2MH9A 4J0MA 3QP6A 1TC3C 3HM5A 1DGRM 3FK7A 2Q2TA 2ZJRF 2K86A 2HDWA 1LPQA 1IV8A 1RK6A 1W0UA 1KC7A 3L2RA 3S2HJ 4I55F 2AGPA 2DJNA 2CQKA 1BIBA 3F3XA 5HVQC 2GQRA 1E4FT 3MKYB 1DV1A 4RAZA 3ORQA 4IWXA 4N4OB 2XROA 2M87A 3JRHA 1Z9CA 1V55H 2R8GA 4K0KH 1A36A 5KG6A 1B6RA 3FXMA 4J9QA 4HNVA 4LFAH 2DDAA 4PFPA 1XD7A 3O6BB 3DAAA 3DCFA 1QPIA 1VQNI 1UELB 5DD4A 5C1OA 4ZYAA 3S3OA 3H3VK 2QSHX 2RC4A 3S15J 3OIPA 3HRUA 1BIAA 2K7LA 1FP2A 5IP9J 4XICA 2ABJA 2P8TA 1ZETA 1ZHSA 3OYMA 2HOSA 5KFVA 4DV5H 1L2ZA 4TUYF 2QLZA 4AUXA 4FT8A 1PX2A 4O3QA 4ED1A 1OJLA 2LR8A 3SDBA 4BJ6C 2HZTA 5K7FA 3JRIA 4BUPA 3FXQA 3K3PA 1SD6A 4W97A 4Y3OA 2YS7A 3AX6A 4D1QA 3RGZA 2HVSA 3MR5A 2VT2A 3F8CA 1Z91A 4EGYA 2OLSA 4GYGA 2VOOA 4KDPA 3BG3A 2GOXB 3CJQB 1EUCB 2VE8A 4Q4DA 2BW3B 4DL4A 4II3A 4I0BA 4CYCA 3W5OA 5BWUA 1IBKH 4E7ZA 3GLLA 2P0AA 1WJCA 2ZSHB 3C2BA 4LB6B 1FIPA 2FA5A 1OCRH 3G8DA 2Q8KA 2ID3A 2LH9A 3VWBA 2O5RA 1IRGA 1H89C 2FPGB 3O8HA 2H09A 3FXOA 1OR7C 4CCKA 4KITB 1UG0A 1KU7A 2VODA 1FBUA 1N78A 3HT5A 4MEYF 3K9TA 1HSTA 1I1GA 3JCUC 1GV2A 3GF2A 3JAMZ 1IYEA 2ZFUA 1IYDA 4RNNA 2I8DA 1YQAA 3L7WA 2A1HA 1USTA 2JUGA 3CCUI 3F0CA 4UCUA 2WA0A 3DKYA 1KA8A 4C30A 5F1RA 2JEIA 4P9FA 2R8IA 4Q4ZF 4XKBA 2M1BA 1W5SA 3H9QA 1P4AA 4O3PA 4RNOA 5EGOA 1NH3A 1JGSA 2AGQA 1D8JA 1XK5A 3CF2A 1HBXG 2HZDA 3LMLA 3LSKA 2EIKH 3IRRA 4C2UA 3E5XA 3M8FA 2X48A 1S9HA 5I5WA 4EJVA 4CMDA 4YY3H 2L5QA 4OIPF 2GPSA 3GFJA 2ELHA 2K9SA 5BQTA 5IP9G 2EK5A 1FNNA 4A0YA 1YX3A 1UFMA 2KZGA 2JEJA 4XSZF 3SI8A 5KAIC 3SZPA 2UV1A 3KYHC 1JKPC 3GFIA 2V4QA 2BY1A 2ZCWA 2BE5F 3BA9A 1CF7B 1ULZA 4C3HJ 1TWHJ 2YWVA 4PGGA 2XCPA 4M9SA 2CU7A 3IUOA 1BOAA 4LG0B 3EDPA 3VSLA 2W6OA 3R5FA 3K4LA 1SAXA 4Y4RA 5FD6A 3GIMA 3H4DA 3HSFA 1N25A 2JPBA 3L2CA 3G71I 2JEGA 2R3SA 2V58A 3OHBA 3HKZE 2VUMA 4CDGA 1T0FC 2HI3A 4ECXA 4IHYA 4KN4X 5E18F 3SXYA 4AYBN 2LTPA 2E1NA 2OBPA 4YELA 4IKFA 2VC0A 2R7ZJ 3P9KA 1IDZA 5KFEA 2GXGA 1HW2A 4IIJF 2HDDA 4CC6A 2IXSA 3EUAA 4NC6A 1R4MB 3IKVA 4OU0A 1XS9A 3G1OA 5DGHA 1BR4A 4EJTA 2DDBA 1I39A 4K2EA 4YB8B 2GXAA 4WBNF 1EH6A 4RGXA 3VPCA 1HOMA 2Y31A 1ET0A 1TAEA 3KLNA 4XLFA 1Z1DA 2YX7A 2Z5UA 3H36A 3WG9A 3WTUC 4NB5A 4OIOF 1YS6A 1G6NA 2EZKA 3TKYA 2ECBA 3OYBA 4NYEA 2FK1A 1X2NA 1FTZA 2W4SA 5CVJA 3I55I 3KFWX 3CO7C 3AW8A 2C2EA 2A6EF 3C3WA 3D5SC 4MAMA 4ENKA 2BYVE 3DTKA 5L3GA 1U5TC 2XPUA 5FKKA 5HLIA 1K79A 4LK1F 1IDYA 1S7OA 3V4GA 2IBDA 2VOPA 2BY2A 3FWEA 2STTA 5CVVA 5L3CA 1YG2A 4MLOA 1IF1A 2ECCA 3CUOA 4HNUA 1XMQH 1X1DA 3CP8A 4A3KJ 2VT3A 3QYEA 4O7VA 2HEOA 1MH4A 3WTYC 1J09A 2HOEA 4G94A 4B4CA 5AONA 5TISC 4QIWA 2OPTA 1VQLI 3QZ7A 3RI4A 1VQ9I 4LF7H 3OYJA 2FP4B 3ESWB 1E17A 2VUGA 1YE9A 2VXDA 4F93B 4U7BA 1B72B 3S24A 5BPHA 5KG7A 1TWGJ 4DR6H 1FBQA 4NZNA 4A3GJ 2FD5A 3GWZA 2P6TA 4LITA 3N97A 3H1CA 3DEWA 4RB3C 2KRFA 2LMDA 2PMHA 4ZYDA 3RV3A 4A12A 1VF9A 3BOQA 3FIWA 4M3GA 4C2MJ 3K2AA 1DGSA 1I7NA 3PM1A 1KJQA 2QQBA 1CGPA 2LBFB 2YU9J 1MMSA 3BTJA 3SQNA 4I76A 2ASLA 2R7ZG 2OCCH 5HS8A 4UUSA 4J01A 3KEOA 3OOPA 4A3EJ 1PK8A 3BG7A 3HL2A 1YS7A 3U0GA 3OL3A 2IA1A 1GV5A 5CQEA 2V1XA 4GO1A 4DYQA 4ZZLA 5HBRB 1S5LC 4MV3A 4FASD 3MR6A 4A6EA 3PR4A 3R0JA 3ASNH 3S1MJ 3RB0A 2CUZA 3NGDA 4BEHA 4MFEA 3RTRA 2ZJTA 4AQYH 2BVMA 5LP6F 4JYKA 4A3CJ 1E3PA 4TV7A 3WE3A 4ESBA 4IZZA 2ZM6H 3IG0A 1MJ9A 2V4RA 1W0TA 4EGZA 1MBFA 2EJ2A 4M9UA 5KFTA 4LMYA 2BY3A 3PIOF 4EM2A 3LSIA 3JAMK 1RJRA 1WGXA 1OKRA 4OMZA 5LD2C 3HTSB 3GTGJ 4YIRX 1WHUA 4FHTA 3FXRA 5FKNA 1T95A 3Q0UA 2J6SA 4FE2A 4YBZB 5JFRA 3LMMA 2X0LA 1APLC 1A0IA 4Y15A 3CJTB 2PX9A 3K1MA 1XDNA 4DL3A 2MD5A 5GPCA 2ZMEA 4A3KG 2WAQA 2XAJA 4O4IF 3JSOA 3A4CA 4FBTA 4RB2C 1AKHB 1C3OA 3VOTA 3R5XA 5IYZF 3IWFA 3F21A 4AM3A 1ONVA 2XRLA 5DTDA 3L4JA 4O3MA 1S0MA 4Q47A 1D0ZA 3I9V2 4F4WA 2DXIA 3ZXSA 1D0XA 5J8CA 2NU8B 3VYRB 4A3GG 3P9IA 5J2UF 1QGPA 3PUBA 5I60A 5I47A 3L2QA 4J9PA 3ZMVA 4BQQA 4FISA 2R7KA 4ZHQF 5KFPA 1F4KA 3H5RA 4GC7A 3BR3A 2LY9A 2DBBA 3F8NA 3M8JA 5B5EC 1Z7LA 1A0GA 5ICGA 4GKKH 4A3EG 3WO0A 2W84A 2EFPA 1KYWA 2GLOA 3SEQA 1OCTC 1ERDA 1SFKA 3SZTA 2YR2A 2FB9A 3FDYA 4LJZF 2QEXI 5CVUA 4A3JG 2V7FA 2D5VA 2Y48A 2K02A 3GTKA 1PP8F 2R7LA 1K78A 1VQ8I 3J81W 4MTEA 4CZCA 2CUJA 3IWZA 3CMEI 4E7IA 4UCTA 1S7EA 2B63A 3S1RJ 1LDJA 1V9PA 1YLFA 3T9CA 4BKXA 3TQ1A 4ZTFA 4MQVA 5FROA 3V7SA 1YJNI 3QPHA 4ZJZA 4QPOA 3T54A 4RCNA 5C8YF 4A3CG 3LQRA 2QWWA 3HB9A 3KZZA 4G6TB 2EBIA 4WCGA 1HA8A 4PZ6A 5LMNH 2CH0A 3GZ5A 1B33N 2VE9A 3H40A 2A5YB 1XMOH 3PO3G 2JWTA 4AIHA 3CCRI 1HR0H 2OWOA 1UAAA 1ZH5A 3AL0B 1REPC 5EEHA 3U55A 2MA3A 1P92A 1JI8A 2QYOA 1ZRDA 4O84A 1JXLA 2W82A 3W6JB 2ACJA 1VBHA 1I50J 4I98B 5E1WA 3RQIA 5DS9A 3HC7A 2QCOA 2W8KA 3VMMA 4X64H 1W7PB 1WJAA 2E5LH 4R8UB 5EDNA 4ECRA 2XF6A 3GEZA 5H20A 2CV2A 4CH7A 5KS8A 3S14J 1TWFA 3H35A 4KMFA 1IZ1A 2OV7A 3HRTA 4FFLA 3D1NI 2YW2A 3KTMA 1AU7A 3VOEA 2RN7A 1VTNC 2NNNA 3HG9A 3V8JA 3T8TA 3ZQLA 5IT9Z 4Q44A 4RGUA 4HX7A 2YRXA 2EFWA 5CJ9A 2ESHA 3K4NA 1W93A 1T8IA 4TVIA 2WWYA 1CQTA 1OISA 2JA6A 2V1DA 4NZMA 1WH2A 4IO9F 1AUXA 1V5EA 4BHPA 5K5OA 4DIMA 2E2JJ 2M0CA 3T7AA 2MC4A 3CCYA 2FJZA 4PZ8A 4LF4H 5E79C 4PWQA 3AYHB 2GWRA 3BJOA 1TL8A 5KFYA 3RYRA 2R92A 2Y2ZA 4QWEA 3DBRB 1LEBA 5F27A 3N6XA 2NU7B 1M6VA 4B09A 2H6CA 4ECSA 2AGOA 1JTYA 1RK5A 4G6DA 2L9NA 1M0TA 4A3LJ 1LNWA 2RQQA 5L3EA 1R58A 4OMYA 1FP1D 5DM6F 2EIMH 1YFHA 3BR6A 2RF4A 1WJDA 2H8RA 2K4BA 2NAZA 4HDUA 2IS2A 4B3MH 3H9JA 2E2IJ 4CYDA 2M9HA 3OR1C 5KHDA 4ZDOA 3U9SA 3FKIJ 5LYJF 4QWCA 4M74A 1MBEA 3FM5A 5TGTA 4ECYA 4S0HB 3O3KA 2ZSIB 2KHMA 3HDDA 1CQJB 3K4BA 2DAAA 5KFFA 2C2DA 3IC7A 4R79A 2VQCA 4B48A 3PN1A 1KQ8A 3JR9A 4A5NA 4JI2H 5LL6b 1VKZA 1O7LA 5E8GA 3PL8A 5D1OA 2R82A 2NVXA 2EJRA 2W85A 3O2PE 4A0XA 4E7SA 1G8XA 3FHNA 3I58A 4XM3A 1R71A 3HKZN 1WJBA 1C0WA 1E4EB 4K6NA 2PJRB 3ETHA 3SEZA 1ZK8A 3L4KA 4V2GA 5IYCJ 4DUYH 2IGOA 5J2TF 4M7EA 4HG2A 2L9SA 3REOA 3DPTA 2OAZA 3QODA 4IHWA 3CQZJ 4F50A 5E25A 1XCVA 3DEEA 2OCEA 4QJFA 4JV1A 4JYAH 5HLTA 2ZJ2A 1ETQA 2JZYA 4IQJA 2HTSA 1JUSA 4Y8VB 1S6LA 3LQSA 1YITI 2TDXA 2V1NA 3CUQB 1I3AA 3K69A 3CDHA 3CCSI 4Q8EA 4O83A 1ETOA 4LD5A 3LA2A 4CCLA 4CICA 2R5ZB 1FSEA 2DLLA 1LE8A 5ICCA 4D5CA 1X58A 1IXRC 4Y7NJ 5J3LA 1W1WE 4A3DJ 3FK6A 4ZZDA 1X19A 1MMDA 3IP4B 2EZLA 5EEAA 2YUSA 4I99C 2P5LC 1RUOA 2W25A 2W57A 1UCRA 3LSGA 3T5JA 2M8EA 2L9RA 4XKCA 1RRJA 3OL4A 1B6AA 3GTMJ 1CKNB 2RDIA 1E3OC 1MBHA 2WTEA 3R5HA 4A3LG 3WWHA 3K4JA 4JX6A 3ZOBA 1R5ID 3I71A 4IHJF 3V42A 1MJAA 2LLKA 5J1UA 3OYHA 2DW4A 1DV2A 4XN3A 1HNZH 4M6XA 1WCMJ 2PG4A 2E5ZA 4HBLA 2W9BB 5FFZA 2QENA 2WAFA 3T5XA 4GXOA 4BXUA 4DYRA 5JVTA 4RMNA 1T94A 3M9OB 4NXMH 2OZ6A 4IRHA 1SD5A 3JRBA 3FKIG 3T9AA 1DU0A 4JUZA 4L9TA 5F0CA 3EQLF 3LFUA 4E4HA 4UCOA 1RJPA 2UXNA 2KQRA 2LC2A 4BACA 1GXPA 2YL2A 2IMWP 1X4PA 3I54A 1ZR4A 4JQFA 1WPKA 5BOXA 1EKEA 3BPXA 4CXFA 2JSPA 2QSGX 3RIRA 3CJRB 2UUCH 5D1PA 2RGRA 3R4KA 4PDKA 4PJLA 2HYGD 3ERED 2MCTA 4ZH4F 4ENMA 1YYVA 4D7MA 2COBA 2NVYJ 3GCMA 4BQNA 4BS9A 3LSRA 4ITVA 2FUG2 2MLKA 2LK2A 1SEUA 4ED7A 1UB9A 3Q9VA 2F4IA 3T9EA 2IJLA 3GZ6A 2LD5A 3NAUA 5HOOA 2UVVA 2CJJA 2XVCA 2WY8Q 2DA7A 5TRDA 1G59A 2XCAA 2PI0A 2FSWA 2HKXA 1WQ2A 2CQXA 3ABLH 1IRXA 4Q43A 3WWIA 4AIDA 1A04A 4A3BJ 1FEXA 1EKVA 2AQ4A 1Z05A 3HHGA 3NRVA 3OYKA 4BGDA 2I80A 1H9GA 1J59A 2E2HA 2EV5A 1B9NA 2P4WA 5CKTA 5M5WJ 4KIGA 2OC6A 3VYUB 4I2OA 4P5OA 1CE8A 3I53A 3ZGKA 3ETJA 3SZGA 3FMAA 1W7PD 4JI5H 3DBHB 1WKMA 1EH8A 4M9ZA 1MSEC 1A35A 3KPHA 3GLXA 4EGQA 2ASDA 4X62H 2FBHA 4A3DG 2HQAA 1USSA 1FYKA 1R4NB 5KFOA 3L00A 3JRFA 2HWVA 4XONA 4RAFA 4RUAA 4ENJA 1IOVA 3ABKH 3TO9A 4B44A 1ULYA 2OUMA 3GMEA 3F9KA 5FPRA 3EPIA 2X6OA 2UXDH 1DP7P 1X9NA 2BZTA 3VPRA 5JVLA 5DQHA 4MHGA 4AC0A 1WCMG 3HTUA 2ZDHA 3L9FA 3V4SA 3LA3A 2COIA 3WGGA 4UXNA 3IHUA 3EYYA 4ZYGA 2X1EA 2VQLA 1WRJA 4U88A 1G3WA 1WH7A 2XDVA 4EVIA 4DV7H 4Q0YA 4JX4A 3KXYT 4HSRA 3WODF 5FFXA 5FNVF 2CKZB 2UUBH 2DFFA 1V4YA 5H6QA 5JVDF 3RSNA 2F4MB 2WADA 4GRIA 1UMQA 1VQPI 2VI6A 1RR8C 4M3EA 1VQ5I 5CA1F 1CS0A 3PW2A 1LE8B 3CMYA 4IOCF 1ON1A 2ZJQF 1AWCA 2YYAA 2GOMA 3HSEA 4C3JJ 2OZUA 2OTLI 2LVSA 3OYGA 4GGGA 4IHSA 3RTXA 2A61A 4IRDA 3HYIA 1MDMB 2NS0A 4O86A 4B3XA 1LDDA 3WU1B 3ZRGA 1VBGA 1Z67A 1XTAA 4GC6A 4A5MA 5IP7J 1W96A 2Y69H 5D8KB 3GTJJ 2V6CA 1N77A 1AA7A 2DFIA 2CFXA 4IPAA 2DMQA 3FX3A 3I59A 4HDVA 2JPCA 1YRNA 3Q5FA 2H8WA 3PFFA 1OBGA 1VAJA 2JA5J 1N36H 2DFHA 3FMQA 2NU6B 2QUFA 2JTVA 3KAKA 4F55A 3EETA 2OTJI 5FGMA 2HXOA 1ETWA 1T33A 2KIMA 3QRFF 5DEQA 2LFBA 4A3MJ 5LLQA 5ICEA 3VA7A 5HLGA 5LRSA 2OD5A 2EJ3A 4L0YB 1VZ0A 3BQYA 2X6XA 4BJ5C 1YW7A 3OYLA 1AHDP 2DK8A 1U2WA 3V7CA 4J00A 1JE8A 4BY1J 3KP4A 3VFZA 3SHFA 4DRFA 4HNTA 2HOTA 3KE2A 2I87A 4PSWA 1A6QA 3LOCA 5CLSA 3I4NJ 3ZMDA 4XRSG 2O8XA 5JI6A 3PJRA 2HDCA 1U8BA 2NOGA 4BXXJ 4G3IA 3MZYA 1HC8A 2QGUA 2R7FA 2CFMA 3GO5A 3DFGA 3KEQA 3HRMA 1O3TA 3K0LA 5FJ8J 4UNOA 4PFOA 4X66H 1XGMA 2Z16A 1AUVA 1S7AA 4UY8I 2XC7A 2WE6A 2UVWA 2WAEA 4JI1H 3HEFA 3OR2C 4Q4CA 5F1JA 2UXBH 4UCRA 2E71A 4XN0A 9ANTA 2QQ9A 4GCVA 2DLNA 2R87A 2BHYA 4ABZA 2KZVA 2Z3YA 4ANJA 4EEFG 2PBZA 2V9KA 1BW6A 3PVXA 3L1PA 1RC9A 4J9SA 4ED6A 3S1QJ 1K61A 4EEYA 2P5VA 4UVAA 5KFJA 2MH2A 5I5SA 1ZLJA 2R84A 3GV7B 2F5FA 2ELJA 2FQ3A 2Y9YA 5K5QA 2IS6A 4YJ3F 1TWHA 3FISA 3RKQA 1ZAUA 5F08A 2RAEA 4DNCA 4AD9A 4CHIA 1ZREA 2YPRA 3B73A 1O57A 3ONQA 1NK2P 3HOYJ 2CS3A 4R1HA 2J6UA 3E5QA 5IP7G 2MW8A 3DTIA 5DLFA 1IXSB 5K7ZA 1G2WA 1WZ2A 2DMPA 1K83J 4CCOA 4GFBA 4MO7A 3AL0C 2IA0A 4QIWE 5KFGA 4HF0A 1L3LA 5KKNB 2JA5G 2VBWA 2F5CA 3BJYA 2PLYA 5IPAA 2E7XA 4NC8A 4FS1A 3B6CA 1MKMA 4TV8F 3K5IA 2CNQA 2XKOA 5LXTF 5IP6A 5DG7A 3CCEI 1AOYA 2O61A 3BAAA 3HO8A 3QWLA 4RU9A 4A3MG 3IN5A 3E0JB 4HV6A 2BV6A 3OYAA 2ETHA 2IGNA 1DDNA 2CO5A 3UKGA 4PK4A 4A2UA 4BY1G 3OSPA 4W1UA 2VKHA 2F48A 1RKTA 2E36A 2R7XA 3AKZA 4XLAA 3T1YH 3I4NG 2CFOA 2Q1ZB 1PVEA 3EUHC 4BXXG 2RNGA 4FE4A 5LRRA 2FPPB 3K4MA 1BR1A 5DM7F 1O3QA 2NU9B 1P6RA 5KFIA 2E19A 1T38A 2W7OA 3HGGA 5FJ8G 2XIGA 2ZDGA 4DV1H 3BP8A 4BL0B 3M8EA 3CCMI 3EYIA 1TZLA 1V54H 4OIRF 1QVUA 4XKVA 1IC8A 4IXAA 2A6TA 2ESNA 1HKTA 3K4CA 3PR5B 3NUAA 2XF7A 3CCVI 1XCBA 3F8BA 1MW7A 1K6YA 2RQPA 3MCZA 1HKQA 1K4TA 5DGIA 4II2A 3TINA 4FX0A 3KP7A 2XGPA 3A02A 3BR2A 2CWEA 1PJRA 4FGRA 2OQRA 2ZFWA 3U21A 1BGWA 1J5EH 3DBLB 2DCEA 3K70D 3NBZB 4JX5A 4QWAA 4O3SA 3QU3A 3C7JA 3GV8B 2R5YA 4E7HA 4EJOA 3RAXA 2EZHA 4LF8H 2HKOA 4XORA 1TWGA 2FPIB 1HNXH 3HOYG 2E35A 3VYTB 3WHBA 5GADJ 3TP0A 1HNWH 1A5JA 3BQ1A 2WAQE 1QHGA 3WTWC 2Y0MA 2DA3A 1J9IA 5J47A 2AXLA 4C2MA 3WNZA 1Y1WJ 1BL0A 3GX4X 1Z6TA 3W2AA 2F6CA 1Y0UA 2CSOA 5KFDA 1WSUA 1UC9A 1BN5A 3PIPF 3AG4H 1Y1VJ 1BI0A 2JA7J 2YZLA 1RYSA 3LULA 5HODA 4LH7A 4G6QA 3CLQA 1P9QC 1MBKA 5DG8A 1ZQ3P 3ECOA 1XMKA 2KKOA 2N8GA 4WX9A 2Z04A 3OIQA 1MSFC 5FKOA 1BXRA 1UHWA 2KP6A 1YO5C 3CEBA 1UHMA 2CRGA 2X9DA 5DISC 1ZTRA 1V5GA 5IYBJ 2W48A 3QOPA 4D0PA 1O3SA 4QWDA 2C2RA 2PFBA 4ON0A 3QOEA 1VQ6I 2V59A 3CUQC 4YP3A 1OCPA 3UQ8A 4EMSA 3CD6I 3V8KA 4IJAA 5M5YJ 1R1VA 5I5YA 1T39A 2HNHA 4M72A 5LHGA 2R7UA 2WBMA 1H9TA 2J5PA 3F8FA 2DYRH 4ECUA 4GKJH 3RV4A 1XDUA 3D5LA 4MNUA 2XSDC 4OAYA 2CZGA 3GTGA 2A07F 3GW2A 2KLOA 2MYSA 2BR0A 3Q3SA 2DABA 5M3FJ 1A48A 1PYVA 4UB6C 3QFFA 1ZGAA 4XNFA 4P9UA 3PFIA 2CV0A 1M0WA 1T6SA 1IN5A 3RKYA 4QW8A 1ETYA 5K3WA 1T08B 1R5HA 2DA1A 4ZOLF 3VPBA 1OCOH 4NQWA 2L4MA 3BZCA 1UG2A 2Z02A 3BPVA 2XC9A 2FX0A 4BJTA 1LKXA 4F92B 2BHZA 4HYEA 1TQPA 4V2FA 3HBLA 1RUNA 2DIKA 4KHPH 2K3PA 2IGMA 2W6MA 2ZO4A 2ZXJA 4MA0A 2VC1A 3FXUA 2O9LA 4CYCB 1J75A 4IEJA 2R93A 5C44J 3P5JA 1F43A 4DV4H 3JRWA 5J40A 3PQKA 1C30A 1BC7C 4XZ3B 4QLCU 1Y1WG 2KL4A 2DN0A 4KJZA 3N41B 4ZTJA 2JA7G 2A5WA 3S17J 3TQTA 2DT6A 3L2UA 1S10A 1Z3XA 4DR3H 4DL6A 2XAHA 4LH6A 1H8AC 1ZRCA 2KIUA 2KRHA 4IRKA 2X51A 3WTXC 1FPQA 5D6EA 4MA5A 3PNVA 2FOWA 1ZARA 1MD0A 3DXJF 4HEA2 4BY7J 4D9JA 3J80Z 3BZ6A 3DLLF 2F4OB 1IAWA 5IYBG 4YR2A 1TWAJ 3B6AA 2H1KA 5EGOB 3S3MA 2COMA 2HHHH 1VQMI 4UFZA 3A03A 4JP0A 2W8LA 4F4XA 5BWXA 1F1ZA 2M0MA 2P5KA 3KP5A 4JK1X 3U9TA 3S93A 2FXAA 3E6BA 2CNVA 1JIHA 4WWCA 4L0ZB 3QPSA 3GIQA 1W5TA 4RNMA 2K85A 2AXTC 2A05A 3E97A 1V51A 3SFZA 4O7ZA 3SGIA 3W2VA 2D1VA 3GZNB 4ZDPA 5HNFA 3GDEA 3LWBA 3PW5A 2Y30A 1JHFA 1I50A 3GQCA 2NVXJ 4Q5SF 2ELKA 2IA6A 2EINH 4PJ0C 5D4SA 5JQGF 3BDDA 4EM1A 2Q2UA 4RLQA 2XAUA 1IGNA 2ZDQA 3GTOA 1R9TJ 2W9AA 4HV5A 1QU3A 3H3VH 4BU2A 2CW8A 4DZPA 2MC3A 4RZQA 1DPRA 4E4TA 5GONF 2DPJA 2ISZA 1OCZH 2CUEA 1P7JA 3HHHA 2FBKA 3OS1A 4X1EA 3RIZA 3HZJA 1YHQI 3GV5B 3TY8A 1IUYA 2HG8A 4OINF 4KMUX 3IKTA 3HOWJ 3MN2A 3BG9A 5C44G 1WJFA 2GPWA 4PDBA 1T2KA 1S9FA 4MV9A 5F64A 1I2KA 3BC8A 4KIFA 5IOZA 2JEFA 4LB5A 1ORKA 4XBFA 1EV7A 5J4VA 2PMZA 5DUIA 1XSDA 5FLVA 2VUMJ 4DR2H 2JRMA 3VSKA 2GXBA 1R49A 3GXOA 2B7EA 3PW4A 1ZYRF 2G0EA 1XN7A 1XSVA 4LOCA 1I6XA 1BJTA 5CVIA 4RUCA 1E0EA 1D1AA 3WGIA 2FKLA 2VQHA 4ZQIA 2LY1A 1ETXA 5BNGA 4O7LA 3WWJA 4YHHH 3HUGA 2EV0A 2K9MA 4DGWB 4HF2A 1OR7A 3LP8A 3NBYB 2E2IA 3C1DA 1Q1VA 1OBDA 4BY7G 1ITYA 2FK2A 3A01A 2W1OA 3BTCA 5IYDJ 4MV6A 4RA2A 4F3QA 3FKIA 1FLIA
chains in the Genus database with same CATH topology
4CCLA 4E7JA 2K5CA 4CCMA 1LFPA 5KCMA 4F52A 2LYCA 1X1AA 1Z2OX 2M4KA 4AVZA 1X19A 1MMDA 3IP4B 4BDYA 2VASA 2VJJA 4E7LA 2W57A 3LSGA 2UUZA 2M3AA 4H4KC 4XKCA 2DT7B 3OL4A 3PSIA 1CKNB 3VNNA 1U0JA 3DQVC 4EEQA 4EATA 3TY9A 3K4JA 2F5VA 3CZ6A 3V42A 1B04A 3OYHA 1FMWA 4XN3A 4DV3H 1HNZH 4LFCH 4IQ4A 1D0YA 1MNDA 2E5ZA 2LOOA 2MFZA 4NNJA 2WAFA 4NXMH 4RMNA 3MMYB 2VQFH 3H5NA 2V4JC 2VIXA 2VL8A 3N40P 2X1CA 3BLYA 3W3CA 3LFUA 4E4HA 4UCOA 4J0MA 5EOYA 1S68A 2KQRA 2LC2A 3DLAA 4BACA 1DGRM 3KYLA 1X4PA 2Q2TA 4JQFA 4C9YA 2HDWA 2VJIA 2VPLA 2R7QA 2MD0A 3LSHA 1LVKA 3L2RA 1Z2NX 2JSPA 3CJRB 3CVZA 4DOZA 2UUCH 4B3RH 5D1PA 2RGRA 5HVQC 2HU9A 4PJLA 1E4FT 3MKYB 2MCTA 4YRVA 4RAZA 2KRCA 4N4OB 4BS9A 4BQNA 4DUZH 4JI0H 2NOJB 5HNHA 4ITVA 2FUG2 4PJNA 3EUKL 4MTDA 1P16A 2R7OA 2F4IA 3DTEA 2VPSA 4K0KH 5FD5A 2MABA 5HOOA 4XR6A 4LFAH 1G59A 2WY8Q 2VOBA 4PFPA 1IRXA 4YEJA 1UELB 3ZQQA 2X85A 4ZYAA 4BEHB 3S3OA 3OYKA 4BE0A 4BGDA 2HPMA 3OIPA 5CKTA 1N33H 3NWTA 2OC6A 3VYUB 4P5OA 3CESA 2E1MB 3ZGKA 3OYMA 1ZHSA 3J80W 3SZGA 3FMAA 3I3LA 4JI5H 4DV5H 1L2ZA 3OYCA 1X1BA 4X62H 3RQ4A 1S03G 5FLXW 2HQAA 2M4GA 3SDBA 4N4NB 3S8PA 4BJ6C 4XONA 4BUPA 4Y3OA 4B44A 3RGZA 4D1QA 2OUMA 2HVSA 3F9KA 3CMMA 5FPRA 3QYFA 3OY9A 4LF5H 2UXDH 1X9NA 4CCNA 1CKMA 2GOXB 3CJQB 2BW3B 4XLHA 4II3A 1N32H 3W5OA 1IBKH 2K9LA 4E7ZA 1FMVA 2Y0SA 2ZXIA 3A2KA 1WJCA 2ZSHB 1CKOA 3EYYA 3DU5A 3FKJA 2VQLA 2X1EA 1WJEA 2LH9A 3VWBA 2XDVA 2O5RA 4DV7H 4Q0YA 4JV5H 3K70C 3KXYT 4HSRA 2JA2A 1OR7C 4CCKA 2UUBH 4DBRA 2Z2SB 4KITB 1UG0A 1Z21A 3RSNA 2WADA 1N78A 2R7VA 4GRIA 2WB1A 3L2VA 1BR2A 4EFEA 2VB6A 2ZFUA 3HOTA 2I8DA 2GOMA 5JHFA 3JSNA 3VDXA 1MMAA 4NC7A 2JUGA 3K4KA 4UCUA 2WA0A 3DKYA 4C30A 3L2PA 4ZC3A 1O75A 4XKBA 2V6EA 3OYGA 3RTXA 3RR5A 1I6UA 3H9QA 4DV2H 4XQFA 4B3XA 4PSXA 4C2TA 3L2WA 3ZRGA 4LF9H 3EPZA 3CF2A 1XK5A 3KAJA 5FRNA 2HZDA 3LMLA 3LSKA 2DJIA 1N77A 1AA7A 3RPUD 4C2UA 4JI6H 1S9HA 4NQWB 2UUAH 4YY3H 3N44B 4LIUA 2L5QA 3E1SA 1VS0A 4I7HA 1N36H 3S32A 3DPUA 3VYSB 4F55A 3KAKA 1YX3A 2E5NA 5KNLA 4DIQA 3KYHC 2UV1A 4XOPA 3CP2A 2BOLA 3BA9A 3N43B 1VZ0A 3OYLA 2X6XA 4BJ5C 4ETSA 4J00A 2AQEA 2JVGA 3IUOA 3IAS2 3VSLA 4DRFA 4HNTA 1N34H 3K4LA 1KONA 4Y4RA 4PSWA 2VKDA 5FD6A 1N75A 2BVLA 2KPMA 2KDOA 3PJRA 1T0FC 4DBQA 1I94H 3M1CA 4E7KA 1ZHQA 2KMUA 2CFMA 3GB8B 4UCSA 4X66H 4PFOA 2WE6A 2Z16A 4YELA 4IKFA 4KISA 2XC7A 2PJRA 2WAEA 4JI1H 3OR2C 1AN7A 2UXBH 3HKZA 4UCRA 4AU7A 4XN0A 2RGVA 4CC6A 2IXSA 3EUAA 1SEIA 2W00A 3BCBA 2KZVA 2VQGA 4CC5A 3MKZA 3UNGC 4ANJA 2V9KA 3NWSA 3QYBA 1BR4A 1QHHD 3OYEA 1DP3A 4XL9A 2R7TA 1TAEA 4XLFA 3FBNB 3K10A 4LSXA 2ELJA 3OYBA 4FM9A 4LFBH 2IS6A 1WJ5A 2WY7Q 2W4SA 2X6WA 4U87A 1IBLH 3PNTA 3T1HH 3ONQA 2CS3A 3D5SC 3DTIA 3HXLA 3W1GA 3IAM2 3DTKA 4P1WA 5IT9W 3PNYA 4OWRB 3RCOA 4CCOA 4PZ7A 3K3VA 3AL0C 3HPGA 4PJMA 1CKNA 4LG3A 3HPHA 3C0FB 4APMA 3OTOH 2XSJC 4NC8A 4EFBA 3OS0A 4MLOA 1XMQH 4HNUA 3H20A 1X1DA 3CP8A 3BAAA 3QYEA 2JVHA 5D1OB 2CMPA 3E0JB 2HIVA 1TA8A 3OYAA 2CV1A 2IGNA 1J09A 2O03A 2LY2A 4PK4A 2LREA 4LF7H 3PFYA 3OYJA 4IAJA 3RF2A 2VKHA 1GLNA 2VUGA 3TBIA 1YE9A 2VXDA 4F93B 4CCJA 4U7BA 3AKZA 2R7XA 3S24A 3OYNA 4DR6H 4XLAA 3T1YH 4IX7A 2CFOA 2Q1ZB 4LITA 2R7WA 3M4IA 1DGWY 4RB3C 1TT0A 3EUHC 2RNGA 4RB1A 1DQUA 3K4MA 1BR1A 4RLFA 4XLCA 3NC0B 4DR5H 1V5FA 3H0DA 1DGSA 1NG7A 3HUGB 2LBFB 2XIGA 4DV1H 4BL0B 4JI7H 4J01A 4XOTA 3BG7A 3HL2A 1E4GT 3OL3A 4RAYA 1TZLA 4XKVA 3KEYA 2A6TA 4CSWA 5CQEA 2M7AA 3K4CA 3SYTA 4BDZA 3J7AK 4RM2A 2XF7A 4B47A 4FASD 1XNRH 1MW7A 1K6YA 4BE2A 4II2A 4NXNH 4PJJA 2UXCH 1Y56A 1Y6IA 2CUZA 4BEHA 4GLXA 3RTRA 1PJRA 2ZJTA 2BVMA 3U21A 4AQYH 3QWUA 1BGWA 1J5EH 2QKMB 3H5AA 4FETA 4IZZA 3ZR8X 2DCEA 3K70D 3NBZB 2ZM6H 2M7BA 3IG0A 1IBMH 1LDKB 2Q2EB 4E7HA 4LF8H 4OAZA 4XLEA 4LMYA 4XORA 3TL4X 1HNXH 3VYTB 3LSIA 4LF6H 2VJ4A 1HNWH 1MZBA 2CW7A 5LD2C 3MWMA 4E6KG 1QHGA 4DV6H 4XMYA 1T95A 3LMMA 3W2AA 4HSTA 2F6CA 2R7SA 1A0IA 1FKAH 1FJGH 4MV7A 1XDNA 2WDTA 2BW3A 3MD2A 4LH7A 3W1BA 2WAQA 1W36D 3A4CA 1P9QC 4RB2C 2UU9H 2KSWA 3OIQA 4R7RA 3FBIB 2V26A 3L4JA 2KP6A 4ZDLA 1D0ZA 3I9V2 3JSLA 1NG6A 5DISC 2DXIA 3ZXSA 1D0XA 3DPLC 1V5GA 3VYRB 3W2WA 3KALA 3PUBA 3S3NA 3L2QA 3RJ0A 4BQQA 3QOEA 3RGXA 4JI8H 3H5RA 2HGSA 3UQ8A 2X6YA 1SAUA 3J7AY 3F8NA 4HRIA 3GJXB 3M8JA 2R7RA 1Z7LA 2HNHA 4GKKH 4CUGA 2R7UA 2WBMA 4B43A 3OS2A 1ZELA 3C2GA 3UR3C 3SEQA 1P8LA 3LSMA 4OX9H 3D5LA 1ERDA 4GKJH 4OAYA 1SFKA 3FDYA 2KLOA 4EQ5A 3AFHA 2MYSA 2V7FA 3K6GA 1PYVA 4BQOA 4XNFA 3J81W 2R4GA 3TY5A 4CZCA 3H9GA 4MTEA 2CV0A 1M0WA 2CUJA 4E7IA 3BA8A 4UCTA 1OLTA 3C2HA 1V9PA 2IS4A 3HOSA 4ZTFA 2AQFA 5FROA 1X1CA 4ZJZA 4QPOA 4BWSC 4BJTA 1LKXA 4F92B 5IWAH 4KHPH 2ZXHA 1MNEA 4G6TB 3BCAA 4PZ6A 1HA8A 5LMNH 2K3PA 5LFAA 2IGMA 2CH0A 4XKWA 3DF7A 4DJAA 3A1YA 1XMOH 2L7KA 5FRMA 1HR0H 2OWOA 1UAAA 3AL0B 4DV4H 1YX5A 1JI8A 2QKLB 3G2BA 3PSFA 2W82A 3DWLE 1MMNA 1MMGA 4QPQA 2KL4A 3HC7A 4KJZA 3N41B 1D1BA 4X64H 2P0WA 4ZTJA 1WJAA 2E5LH 4X0GA 2A5WA 2XF6A 2CV2A 2DT6A 2L2OA 4CH7A 3L2UA 3H35A 4BE1A 1Z3YA 2OV7A 3OWTA 1EA3A 3OOUA 1Z3XA 3KX2A 5BR8H 4DR3H 4LH6A 1Z2PX 3HG9A 2DOAA 5FPOA 2KRHA 4DR1H 2X51A 3K4NA 2Z1DA 4AYBA 3PNVA 1WH2A 4HEA2 4D9JA 3BABA 1V5EA 2VXZA 2MC4A 3S3MA 2HHHH 4UCVA 4UFZA 4PZ8A 4F91B 4LF4H 1X4OA 4LSAA 2YCHA 2E1MC 2E60A 3TMOA 2VJ5A 2M0MA 3S93A 3DKXA 3N6XA 2HVRA 3OYIA 2LRDA 2L9NA 1M0TA 3W2VA 1FVIA 4ZDPA 2RQQA 5HNFA 3GDEA 4E6NA 1WJDA 3D5RC 4KT6A 4B3SH 4PUSA 4DR4H 3JAMW 2Q2UA 2IS2A 4A2BA 3H9JA 4RLQA 2XAUA 4B3MH 4JI4H 4ZDOA 3OR1C 4CA0A 5KHDA 3DU6A 1QU3A 1SYXB 2IGKA 4RB0A 4BU2A 4JI3H 2CW8A 2UWMA 4RZQA 5TGTA 4DV0H 2HVQA 3GBGA 4Y33A 1XNQH 4JOMA 5CQGA 3OS1A 3ZCOA 3RIZA 2HIXA 1GYFA 2ZSIB 2KHMA 2F4VH 3K4BA 4X65H 3TY8A 3N42B 4R79A 2VQCA 4A2AA 4B3TH 4B48A 4DR7H 1WFXA 3PN1A 2LG4A 4JI2H 5LL6b 5CPRB 5D1OA 3PL8A 1WJFA 4PDBA 1D1CA 2X1DA 4E7SA 1G8XA 3BG6A 3FHNA 4MV9A 4XM3A 3MKWB 5LMUH 1BOBA 1WJBA 3BC8A 2W7NA 2PJRB 3OYDA 2WYOA 1R6RA 3SEZA 4DR2H 2PMZA 3L4KA 4BXFA 3VSKA 4DUYH 2IGOA 2RREA 2FE3A 3OMYA 4HG2A 4M7EA 2L9SA 3DPTA 3QODA 1BJTA 2HPIA 1E0EA 1D1AA 3DEEA 2VQHA 1W36C 2LY1A 4NUBA 2VLAA 4JYAH 5HLTA 4LIVA 4YHHH 2LBFA 2VQEH 4IQJA 2K9MA 4DGWB 5A2QW 2IS1A 3N05A 4RM3A 3NBYB 3LL7A 4HPQA 3OYFA 2XF5A 2V1NA 2W1OA 4F3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ6 A;  2VUG A;  3JSN A;  3S24 A;  4UCU A;  3L2P A;  2OWO A;  3RTX A;  3RR5 A;  3NC0 B;  1DGS A;  1CKN B;  3VNN A;  4EEQ A;  3TY9 A;  1XK5 A;  1B04 A;  1VS0 A;  4LH6 A;  5FPO A;  4UCO A;  1S68 A;  4GLX A;  2Q2T A;  3KYH C;  3BAB A;  3QWU A;  3BA9 A;  3NBZ B;  4UCV A;  4UFZ A;  4PZ8 A;  5D1P A;  4DRF A;  1P16 A;  2HVR A;  2CFM A;  3GB8 B;  4UCS A;  1FVI A;  3GDE A;  1A0I A;  4E6N A;  1XDN A;  4UCR A;  2Q2U A;  4CC6 A;  4LH7 A;  3W1B A;  4CC5 A;  2HVQ A;  2HIX A;  3TY8 A;  3JSL A;  5DIS C;  1TAE A;  3PN1 A;  5D1O A;  2HVS A;  3UQ8 A;  5FPR A;  3GJX B;  1X9N A;  1CKM A;  3W1G A;  3W5O A;  1P8L A;  4PZ7 A;  1CKO A;  4EQ5 A;  1CKN A;  4EFB A;  3TY5 A;  4UCT A;  3BA8 A;  3NBY B;  3BAA A;  1V9P A;  5D1O B;  2HIV A;  4EFE A;  1TA8 A; 
#chains in the Genus database with same CATH topology
 1PUF A;  2PEX A;  2FOK A;  3JRA A;  1G4D A;  1LFP A;  5KCM A;  2LYC A;  3C18 A;  4ED2 A;  5E3N A;  2RV8 A;  3ZMZ A;  2BGC A;  2CQN A;  2EA2 A;  2M4K A;  3SE7 A;  3BAC A;  2O7O A;  2VJJ A;  2X4H A;  2UUZ A;  3GTP A;  1T56 A;  4H4K C;  4YJ2 F;  4U0Y A;  2NS8 A;  4WK8 F;  3ABU A;  1FJL A;  5E17 F;  4EAT A;  2Q2E A;  3TY9 A;  3TOB A;  4IF4 A;  1GSA A;  4EV0 A;  1ZG3 A;  1FMW A;  2XAG A;  4MIM A;  4D5F A;  5L3F A;  1QBJ A;  4LFC H;  4FCY A;  4QIW N;  4IQ4 A;  1MND A;  5L1L A;  4NNJ A;  4C5B A;  5DUK A;  1S97 A;  1I27 A;  4I02 A;  2GA1 A;  3H5N A;  2DA2 A;  2NS7 A;  4D7N A;  4XYM B;  3N40 P;  1G3S A;  2X1C A;  3F6O A;  5KT5 A;  2HR3 A;  3BLY A;  3DV8 A;  2P81 A;  2YS9 A;  2RDP A;  3SFI A;  1EKP A;  1S68 A;  1IW7 F;  1KTA A;  2QSF X;  2L7F P;  5KT7 A;  4C9Y A;  2VPL A;  2VJI A;  2DPI A;  3HOW G;  2R7Q A;  4UHT A;  4GDF A;  1X3U A;  5DDG A;  2QF7 A;  4IVN A;  1IRF A;  1LVK A;  3LSH A;  2IBK A;  5LBQ A;  4FE7 A;  3CVZ A;  2EIY A;  4B3R H;  1VQ7 I;  1ZGJ A;  1DIK A;  2HU9 A;  1S3J A;  3U1D A;  4O7Y A;  2DYS H;  4UUS B;  4AIJ A;  1SFO A;  1MGT A;  2VUM G;  3F72 A;  1I5Z A;  2NOJ B;  3TW6 A;  5HNH A;  1T0F A;  1KJJ A;  4PJN A;  3EUK L;  1SCU B;  3UZB A;  2R7O A;  3HJE A;  1JJ8 C;  1FOY A;  3DTE A;  2HS5 A;  4BBR J;  2QBY A;  3MR2 A;  2GQQ A;  2MAB A;  5F04 A;  4XR6 A;  2GBY A;  2NVQ J;  3AG1 H;  3BQZ A;  2VOB A;  3OHA A;  1HSJ A;  3MWE A;  4IZO A;  3KZI C;  2FJ1 A;  4YEJ A;  5F6F A;  3U2R A;  4BEH B;  4BE0 A;  2M30 A;  3ERM A;  3H0G J;  1N33 H;  3NWT A;  4BYY A;  5IYD G;  3CES A;  1SFE A;  1TNS A;  4DAA A;  4R8H A;  2EV6 A;  3G3Z A;  4I4T F;  3OYC A;  1X1B A;  5FKM A;  4L5I A;  2R6F A;  1S03 G;  5FLX W;  4N4N B;  4QSH A;  5J1R A;  5E3L A;  5EJC A;  3CMM A;  4AWX B;  2VKE A;  2V79 A;  3QYF A;  1T36 A;  3IL2 A;  3GTQ A;  3J80 K;  2WAQ N;  4LF5 H;  4X6A J;  1WSC A;  2NVY A;  1B59 A;  5F9N A;  5D5W B;  2EZI A;  2ZME B;  1FMV A;  2Y0S A;  1U5T A;  3A2K A;  1WI9 A;  3G6V A;  1W4M A;  1T98 A;  1RES A;  5DYM A;  1JUP A;  3KRE A;  2G7U A;  2O8K A;  2HOA A;  2PBI A;  3K2Z A;  2JA2 A;  4OIQ F;  3DEU A;  5E8I A;  2HHF A;  3J7Z I;  2Z2S B;  2NNY A;  1MH3 A;  3EPG A;  1O4X A;  1XG1 A;  3L2V A;  1BR2 A;  2CNU A;  4EFE A;  3GUD A;  2VB6 A;  1MJB A;  1VND A;  4U0W A;  5JHF A;  3JSN A;  1TWC J;  3VDX A;  4NC7 A;  1FYM A;  2KDZ A;  1KT8 A;  4DL5 A;  2C28 A;  2DOD A;  2V9P A;  3H3U A;  3T9F A;  4U6P A;  2FLL A;  2QZ8 A;  3L2P A;  4ZC3 A;  2BQU A;  4IL6 C;  3BJ6 A;  1SAN A;  1KU9 A;  3FHZ A;  4FX4 A;  1I6U A;  3ULQ B;  2CYY A;  4DV2 H;  1XX5 A;  4DZJ A;  4XQF A;  1IV6 A;  1DPU A;  4BBR G;  3Q0W A;  3RKX A;  1O3R A;  2KFD A;  3J7A O;  3L2W A;  1DU6 A;  1K78 B;  4LF9 H;  3EPZ A;  1U9O A;  3KP2 A;  3KAJ A;  3O8G A;  5FRN A;  4XRS A;  3QZ8 A;  2DJI A;  5GAG J;  3LWF A;  3DKW A;  5KFM A;  2FU4 A;  2HDK A;  4EBD A;  1X2M A;  3HOV J;  2W6N A;  4HN2 A;  1R1T A;  2F2E A;  4LIU A;  2GQS A;  3BTI A;  2A69 F;  4O4J F;  3K1N A;  4XX0 B;  3H0G G;  1FOX A;  3GTK J;  1TNT A;  1VS0 A;  4J19 A;  2F5D A;  3S32 A;  4HX8 A;  1KQ0 A;  3DPU A;  4KIC A;  2XGC A;  3VYS B;  2B63 J;  4LK0 F;  3G1L A;  3ASO H;  1BJA A;  5KFZ A;  2DMT A;  4DIQ A;  3SJM A;  5B3S H;  2DFE A;  1WWX A;  3HRS A;  4XOP A;  3CP2 A;  4Q45 A;  1FOW A;  2BOL A;  3GVA A;  3N43 B;  5JQW A;  1HDD C;  5KG3 A;  2R7M A;  4N0B A;  2JVG A;  2RNJ A;  3IAS 2;  2DQR A;  5GP9 A;  1J5Y A;  3QQA A;  3TDU C;  3WO1 A;  4ESJ A;  1N34 H;  2VKD A;  2F5E A;  2M45 A;  4LGW A;  1N75 A;  2BVL A;  4O6J A;  2KDO A;  4XRM A;  2LP0 A;  4KN7 X;  4DBQ A;  5BMZ A;  3N4M A;  4BBS J;  4MV1 A;  3M1C A;  4E7K A;  1GGO A;  1ZHQ A;  3CC2 I;  2KMU A;  5KG2 A;  4LLG F;  3GB8 B;  1HW1 A;  5F9L A;  4A93 J;  5J8F A;  4UCS A;  1QZY A;  4IRI A;  4HLY A;  1ZN2 A;  4KIS A;  1ZHF A;  3F22 A;  2FMA A;  5I5T A;  5KFS A;  2DAO A;  2XUB A;  2XD4 A;  5LHI A;  2VBZ A;  2PJP A;  4ECV A;  2D45 A;  2W71 A;  1TWF J;  2RGV A;  4HQM A;  1YIO A;  4AU7 A;  2K9Q A;  3JTG A;  3GTJ A;  4HAM A;  2ME0 A;  2HYJ A;  1M7J A;  3BCB A;  3CJN A;  3MAJ A;  2ZXW H;  1XGO A;  2JA5 A;  3QYB A;  2XV4 S;  3KET A;  1QHH D;  2W9C A;  1A31 A;  3RKW A;  3D0S A;  1TLH B;  3KIO A;  4XL9 A;  1QNT A;  2R7T A;  5KFU A;  2B63 G;  4P55 A;  2HQR A;  3KYD B;  5IYC G;  3K10 A;  1WI3 A;  1Z6R A;  4LSX A;  5L1J A;  4MEX F;  4J9M A;  3L09 A;  3JRG A;  4FM9 A;  4LFB H;  3HOU J;  1K7A A;  5CM0 A;  3G4S I;  2D1H A;  2WY7 Q;  2LF8 A;  5JLW A;  5C4X J;  1UNN C;  5KT4 A;  2YS6 A;  2JMW A;  2L3D A;  3H92 A;  4U87 A;  3ZMU A;  3PNT A;  3UYY A;  4L5E A;  3T1H H;  1IBL H;  4U7D A;  2NYX A;  5DQG A;  3HXL A;  3W1G A;  2I8C A;  2GA2 A;  1ZAO A;  4JV2 A;  2HFH A;  4P1W A;  5EG0 A;  3PNY A;  3RCO A;  3HOV G;  2O6G E;  3ZQ7 A;  2DOF A;  1POG A;  1KJ8 A;  3KYC B;  4QWQ A;  5EF6 A;  2QA4 I;  3V6H A;  2ZC2 A;  1TP4 A;  3HIF A;  4LG3 A;  2BXY A;  2H27 A;  3HPH A;  3C0F B;  2GZW A;  5JLX A;  2XSJ C;  1QZE A;  3OTO H;  1BBY A;  3OS0 A;  2RDJ A;  1A9X A;  1ZG1 A;  1S0N A;  2L9V A;  1I6H J;  4M71 A;  2H94 A;  5EWG A;  3F6V A;  4M0J A;  3IH4 A;  5KT6 A;  2J6T A;  5D1O B;  3N8D A;  2FLP A;  4J9L A;  4A3I J;  1TA8 A;  2CV1 A;  5IT9 K;  2FRH A;  4UVC A;  2LY2 A;  2WV1 A;  3I56 I;  4IWY A;  2QQA A;  3PFY A;  4TM5 A;  5KFK A;  3RF2 A;  1GLN A;  3I4P A;  3I5U A;  3PQJ A;  3TBI A;  4V19 K;  2I5U A;  1B6S A;  5EZH A;  3S16 J;  4EYH B;  2NVT J;  2R7W A;  2ZJP F;  4G7Z F;  1DGW Y;  2XB0 X;  3E5U A;  5GTI C;  1FTT A;  2YZM A;  4RB1 A;  4BBS G;  4DR5 H;  2QK4 A;  4RLF A;  3M07 A;  4XLC A;  3HOZ J;  3H0D A;  2VKV A;  5JHU A;  2BBY A;  4A93 G;  1NG7 A;  4B8X A;  1B8I A;  1QPM A;  3E5N A;  2V9V A;  2CW0 F;  1FSH A;  4ME6 A;  1SVM A;  4Z2Y A;  2JT1 A;  4JI7 H;  4QW9 A;  4Y52 J;  4UV8 A;  3TOA A;  4EBE A;  4CSW A;  1GT0 C;  1A6I A;  3FZV A;  3ABM H;  2XCL A;  4BDZ A;  1SFX A;  4EM0 B;  3SDG A;  2UVR A;  5DGA A;  1XDS A;  2FNP A;  3KLO A;  4L18 B;  4O7W A;  5BYB A;  4NXN H;  4PJJ A;  1GDT A;  3QPL A;  1Y56 A;  5KFW A;  1Y6I A;  1XC5 A;  4GLX A;  3RB4 A;  1FYL A;  4L1K A;  4ZYH A;  1ZR2 A;  2XGE A;  1D8K A;  2M34 A;  3ZR8 X;  2L7M P;  1EUD B;  2VQD A;  3HOU G;  3WGH A;  1IBM H;  1LDK B;  1W5C C;  4AVP A;  4H0E A;  5C4X G;  3W6K B;  1Z77 A;  1OYI A;  5EYR A;  3TGN A;  4EQQ A;  3OUU A;  1R7J A;  4YFX F;  1QZZ A;  1ZQ7 A;  3TL4 X;  3ROU A;  3SNO A;  3RB3 A;  4LF6 H;  2VJ4 A;  1TBX A;  4A3B G;  1B9M A;  1R00 A;  4E6K G;  1QO0 D;  3JRC A;  4U7C A;  4NHJ A;  4B3A A;  4DV6 H;  4Y17 A;  5HDK A;  2IA2 A;  1JKO C;  1KU2 A;  3ZPL A;  2M2E A;  3H4B A;  5F0F A;  2DU9 A;  4EJU A;  2R7S A;  2P6S A;  1GVJ A;  3WG7 H;  1F9N A;  4IRG A;  5M5X J;  2L4A A;  3WTV C;  5DCF A;  3G8C A;  4RBO A;  2BW3 A;  2EWN A;  3MD2 A;  4I01 A;  2WDT A;  1QA6 A;  1W36 D;  2V9W A;  1XPX A;  1U9N A;  5A2Q Z;  2C00 A;  3FDS A;  4A3I G;  2UU9 H;  1RR7 A;  3TII A;  1UZC A;  3BG5 A;  3G6E I;  2KSW A;  3G73 A;  2DZD A;  2DWC A;  1YOV B;  5JVG F;  1HQC A;  3FBI B;  2V26 A;  2COJ A;  4R7R A;  3BR1 A;  2XPW A;  3JSL A;  2R7D A;  3VOD A;  4DYC A;  1HW5 A;  5FR9 A;  3DPL C;  1LJ9 A;  3KAL A;  2CGP A;  2FLN A;  2COG A;  3RJ0 A;  5B66 C;  2L54 A;  3RPU A;  3RZO J;  3RGX A;  3HOZ G;  2GIV A;  2VBX A;  2LKP A;  1X3W B;  4S04 A;  2HGS A;  1SAU A;  3J7A Y;  4HX4 A;  3QU6 A;  4LFU A;  1RIO H;  2BXZ A;  4HRI A;  2R7R A;  3BT9 A;  3LA7 A;  5IOY A;  3FXL A;  5BWV A;  1RI7 A;  4YAJ B;  1ZEL A;  3C2G A;  3UR3 C;  5C5J A;  4J9O A;  1P8L A;  5BWR A;  3LSM A;  3DTG A;  4BHB A;  5HNE A;  3Q8Q B;  4ED3 A;  1G3Y A;  4EQ5 A;  3AFH A;  4M9X A;  5HS9 A;  5CR5 A;  2AU0 A;  1IN7 A;  1R23 A;  1Y1W A;  3FM3 A;  2XGD A;  3Q8P B;  2R4G A;  3TY5 A;  5E20 A;  5DV5 A;  2JA7 A;  3BA8 A;  3M9M B;  2DT5 A;  1OLT A;  3C2H A;  2IS4 A;  2DOE A;  2P7V B;  1WR2 A;  1YW9 A;  4IHX A;  1Y8R B;  3F23 A;  4BWS C;  4A0Z A;  2R7N A;  5IWA H;  2ZXH A;  4O5V A;  5HV6 A;  5CB4 F;  3QQM A;  5LFA A;  2DTR A;  4XKW A;  5M3M J;  5B1A H;  3R23 A;  5KT3 A;  3A1Y A;  2O0Y A;  2L7K A;  2W24 A;  4O4L F;  1S0O A;  3JZF A;  1O7F A;  3COA C;  1BI1 A;  3OUZ A;  3M9N B;  1CF7 A;  1YX5 A;  1I1L A;  3JZ6 A;  3PSF A;  3DWL E;  5KX5 F;  1B8I B;  1MMN A;  3BR5 A;  4LG0 A;  1SC7 A;  1FT9 A;  2GAU A;  2HQ5 A;  1OYW A;  1D1B A;  1FX7 A;  2CQQ A;  2ZKZ A;  2FF4 A;  2P0W A;  4CKC A;  1Y14 B;  3GIK A;  2R7Z A;  2E1C A;  4XSX F;  3ZQI A;  4TQR A;  2BQ3 A;  1BC8 C;  1Z3Y A;  4ECZ A;  3OOU A;  2LKS A;  3KX2 A;  2PN1 A;  1ZG5 A;  2OQG A;  3T99 A;  2JK3 A;  4KA4 A;  1EYZ A;  5K7H A;  2W7P A;  4DR1 H;  5C3E J;  1BW5 A;  4MGR A;  5EEG A;  1KU3 A;  2Z1D A;  4AYB A;  1PDN C;  4YII A;  4LLN A;  3S2W A;  3OSF A;  3ZN0 A;  3BAB A;  4GLW A;  1FZP B;  5T14 A;  2G9W A;  2VR1 A;  4F91 B;  5DD8 A;  1OWT A;  4LSA A;  2GLT A;  4IHT A;  3TMO A;  4CMF A;  1VQK I;  3RFC A;  5KT2 A;  3OIO A;  3E7L A;  5BWT A;  2IRF G;  4O3N A;  1F36 A;  3BWG A;  3I59 B;  2ME6 A;  4YG2 F;  1YRN B;  3CMA I;  1PUE E;  5D4R A;  3OYI A;  2LRD A;  1XMX A;  3AAF A;  2HVR A;  1I1M A;  5EDW A;  4JBA A;  3RAQ A;  2XRN A;  2LSO A;  1FVI A;  1KEE A;  1LUJ B;  5BPD A;  5I5U A;  2CG4 A;  4B3S H;  4KT6 A;  1V3F A;  4PUS A;  5C1P A;  3PW0 A;  4DR4 H;  3JAM W;  4ESF A;  1VI0 A;  2WV0 A;  4CHU A;  4JI4 H;  5IY5 H;  3WU0 A;  2ZME C;  2WB1 E;  3DU6 A;  1SD7 A;  1SYX B;  4IOA F;  1HF0 A;  2IGK A;  1UHS A;  5AIP A;  4JI3 H;  2UWM A;  2HVQ A;  4Y33 A;  5KAF C;  4QTR A;  1IN4 A;  4JOM A;  5CQG A;  4A69 C;  3ZCO A;  1XNQ H;  1GYF A;  3KHL A;  1YW8 A;  3N42 B;  5E3M A;  2PMZ E;  4A2A A;  5K5R A;  1YJW I;  1WFX A;  3R0A A;  2LG4 A;  5I5X A;  5DG9 A;  3MFK A;  3CC4 I;  4EG0 A;  3OSN A;  1TWA A;  1L0O C;  1I3Q J;  1OPC A;  3ECH A;  2R85 A;  3JSP A;  1D1C A;  5CA0 F;  2X1D A;  2TCT A;  3R6S A;  1IO2 A;  1JJ6 C;  4JXU A;  5LMU H;  4FS2 A;  1WVR A;  3VB2 A;  1RNL A;  2W7N A;  1JTX A;  2Q0O A;  3OYD A;  2WYO A;  2FML A;  5L9X A;  1B72 A;  2YU9 A;  3V4Z A;  4BXF A;  1GO3 E;  3OMY A;  1KUT A;  5HS7 A;  4EBC A;  3GTL J;  4L9J A;  4Q48 A;  5ED4 A;  2Z9O A;  2ZB9 A;  1W36 C;  5CVR A;  5CAE B;  4LIV A;  4O7S A;  2LBF A;  2VQE H;  1VQ4 I;  3K5H A;  2JRT A;  2NRA C;  1HDP A;  1OYY A;  5C3E G;  3N05 A;  2JQ7 A;  4FU0 A;  4CKB A;  3Q8R B;  4F4Z A;  4F4Y A;  5HLH A;  4DW6 A;  3KHR A;  1R9T A;  1OFC X;  2HGW A;  1RJQ A;  3DP7 A;  2WTF A;  1QRY A;  1YIJ I;  5D5U B;  2K5C A;  4CCM A;  5BPI A;  4EGJ A;  4F52 A;  2K3F A;  3MZ8 A;  4YFN F;  3V6J A;  1RET A;  1XGN A;  4RAG A;  2M5W A;  5A2Q K;  1G3T A;  4AVZ A;  2DA4 A;  2ID6 A;  2JSC A;  4M3F A;  4BDY A;  4KUM A;  1ZLK A;  4DLK A;  5EWF A;  4O81 A;  1RPW A;  1ETK A;  5HDG A;  2P7C B;  2IP4 A;  2W6P A;  4B1R A;  2M3A A;  1JXS A;  4E70 A;  1FY7 A;  1A3G A;  3PSI A;  4ZYE A;  4EJW A;  2OA4 A;  4WXC A;  2F5V A;  4WF2 A;  2FK3 A;  1B04 A;  5K1Y A;  4YIF A;  4FFN A;  4DV3 H;  2ICW G;  2XPV A;  3TQN A;  3Q2O A;  4ED8 A;  1JX4 A;  2DA5 A;  4O3R A;  3TED A;  3MKL A;  2MFZ A;  5LEJ A;  4XK4 A;  4IR1 A;  1JHH A;  1KQ9 A;  2W6Z A;  4ED0 A;  2V4J C;  4EYI B;  1ENH A;  2SCU B;  2KIS A;  1R36 A;  4P96 A;  2DO7 A;  3LSP A;  3W3C A;  3RPQ A;  5EOY A;  2Z33 A;  2HJW A;  3DLA A;  3KYL A;  1EJ9 A;  2I10 A;  2YU3 A;  3GFL A;  4G12 A;  3ZQG A;  3BRO A;  2MD0 A;  2C22 A;  5KFC A;  1ZGW A;  1Z2N X;  3P9C A;  1AKH A;  2HQN A;  5KFR A;  4DOZ A;  1U78 A;  5ILS A;  5KG0 A;  2ZNZ A;  5KG1 A;  4YRV A;  3N6R A;  2KRC A;  2QM3 A;  4DUZ H;  4JI0 H;  2LDU A;  4HA8 A;  1Y1V G;  4MTD A;  1P16 A;  1BM9 A;  4WXH A;  5LOV F;  3Q9S A;  4U0V A;  1K1S A;  2VPS A;  5FD5 A;  3G6X A;  1YTY A;  4HF1 A;  2IT0 A;  2DMN A;  2E1O A;  2X0S A;  2MLG A;  1BA5 A;  3E6C C;  4XLP F;  3ZQQ A;  2X85 A;  3I0T A;  3WTT C;  4HLX A;  2HPM A;  4RGS A;  2DTZ A;  2M8G X;  2Q7D A;  2IEK A;  3VPD A;  3PUF A;  2E1M B;  2R5Y B;  3J80 W;  2XAS A;  3GIJ A;  3E6M A;  5LA6 F;  2OH2 A;  3I3L A;  2K40 A;  3I64 A;  1SFU A;  1K4S A;  1ODD A;  2DA6 A;  3P7N A;  3JRX A;  3RQ4 A;  5KFH A;  3CCL I;  2M4G A;  1VFC A;  2GIZ A;  4HYK A;  3QP5 A;  3S8P A;  2Y0S E;  1MNM C;  3IH2 A;  2DK5 A;  4PCQ A;  3CCQ I;  5L3B A;  4O3O A;  3W6V A;  2XGX A;  1IUF A;  3GID A;  4TV9 F;  3OY9 A;  2R8J A;  2HTJ A;  3TW7 A;  2MG4 A;  4CCN A;  1FBS A;  4KFC A;  1CKM A;  2YZN A;  1N32 H;  3LFK A;  4XLH A;  5TJJ A;  3S2D J;  1KZH A;  1Z0X A;  2K9L A;  2ZXI A;  2QQ8 A;  2EFQ A;  4NBQ A;  2K27 A;  4KT5 C;  6PAX A;  1Y0N A;  2V1U A;  2C6Y A;  1CKO A;  3DU5 A;  2DPU A;  3FKJ A;  1MBJ A;  3VEP A;  1WJE A;  1S8N A;  2YX4 A;  3ZMT A;  4JV5 H;  3K70 C;  3GLK A;  4M6Y A;  1BI3 A;  4HZF A;  1W7P A;  4DBR A;  1HKS A;  2R7V A;  1Z21 A;  4R8U A;  1I1K A;  4M73 A;  3T9D A;  5BWW A;  2HXI A;  2WB1 A;  4A3J J;  3H0G A;  4BH9 A;  1BJZ A;  2V5A A;  3R60 A;  2EPF A;  3HOT A;  2ISY A;  1GVD A;  1Z7U A;  5FLM J;  2PVP A;  4ZI7 F;  3E3V A;  1MMA A;  3K4K A;  4C5A A;  2YRW A;  5DGB A;  3FXK A;  4AIK A;  3EUH A;  3FMR A;  1O75 A;  1SD4 A;  2V6E A;  4C5C A;  2L02 A;  3RR5 A;  5HDN A;  5KFL A;  3JZI A;  2CQY A;  4BAY A;  3J7Y J;  5D8D A;  1KJI A;  4CE5 A;  4PSX A;  2LNB A;  4C2T A;  3IH3 A;  1XGS A;  3PO3 J;  5H2F C;  4Y13 A;  1GLV A;  5DLG A;  3RPU D;  4JI6 H;  2AO9 A;  4NQW B;  2UUA H;  3K7A J;  3N44 B;  2A68 F;  2JJ7 A;  3E1S A;  4O7N A;  2QVO A;  3BZK A;  4I7H A;  1IN6 A;  4PZJ A;  3CSW A;  1MIJ A;  3H3Z A;  3OSG A;  2KT0 A;  1V4R A;  1J0R A;  1SMY F;  2L7Z A;  2IVM A;  2E5N A;  5KNL A;  4DL2 A;  4L9N A;  1NK3 P;  5L1K A;  5LGN A;  3MFH A;  4FQG A;  4ETS A;  5B1B H;  3JRE A;  3KCC A;  4O7T A;  3CDL A;  2AQE A;  3MVP A;  2WC2 A;  1TQM A;  1KON A;  4S05 A;  5GAE J;  1TWC A;  4WD3 A;  4TQS A;  2K4J A;  4QWB A;  5KFB A;  3CLO A;  1KJ9 A;  2R93 J;  1PP7 U;  2KPM A;  1R1U A;  1EHI A;  2BY0 A;  1I94 H;  3CQZ A;  4DQ2 A;  3ZQF A;  1MBG A;  1E4E A;  4CKE A;  4MFD A;  4UB8 C;  2J5O A;  5DCM A;  2PJR A;  2IPQ X;  1ZKG A;  3AG3 H;  3GFM A;  3GIP A;  3JW4 A;  1IG7 A;  2FEZ A;  3NAR A;  1AN7 A;  5DQI A;  3HKZ A;  5L3D A;  4KIB A;  1SEI A;  2W00 A;  5GPA A;  3J81 Z;  1QVT A;  5DMX A;  3KP6 A;  4YAK B;  1K1Q A;  5KG5 A;  2VQG A;  4PBC A;  5H6R A;  3MKZ A;  3TDZ C;  3UNG C;  4CC5 A;  3Q1K A;  1JKR C;  4JV0 A;  3NWS A;  5FLM G;  3Q8S B;  3OYE A;  2D2W A;  3KP3 A;  1DP3 A;  3T5L A;  2Y9Z A;  1XB4 A;  4RS8 A;  4O4H F;  3FBN B;  1H0M A;  2PQ8 A;  5EZY F;  3WU2 C;  3BQ2 A;  3S1N J;  3CUQ A;  1LFU P;  2YZG A;  1TW3 A;  1WJ5 A;  1R22 A;  2CQ7 A;  5AIQ A;  3BTL A;  2R5Z A;  2X6W A;  3GTM A;  4YR0 A;  2R0Q C;  3CDI A;  3IRQ A;  2ASJ A;  4A6D A;  4IHV A;  3IAM 2;  3BQ0 A;  1D5V A;  1WCM A;  5IT9 W;  4OWR B;  4PZ7 A;  4I50 F;  3TEK A;  4NLG A;  2EIJ H;  3K3V A;  4ECQ A;  5E1Z B;  3HPG A;  4PJM A;  3LNQ A;  2KIQ A;  4UVB A;  1CKN A;  4O2A F;  4LLL A;  4APM A;  2WB1 N;  3G1M A;  4EFB A;  1F5T A;  3KHH A;  4HQE A;  2R86 A;  4O2B F;  3H20 A;  3GTO J;  1WRV A;  3QPT A;  5J4Y A;  2W9B A;  4M6V A;  1SMT A;  4XID A;  2JVH A;  2FQ4 A;  3T1B A;  2CMP A;  2HIV A;  5BPF A;  1EZ1 A;  2Y4R A;  2PMZ N;  4CGZ A;  1GUU A;  2O03 A;  2MBF A;  4G8X A;  2UZK A;  4I6Z A;  2ATL A;  2LRE A;  4IAJ A;  4PGH A;  1S29 A;  5KK1 A;  4CCJ A;  5DAA A;  3OYN A;  5KFA A;  4IX7 A;  5IT3 A;  5CE8 A;  3M4I A;  2R93 G;  3V6K A;  1TT0 A;  3QAH A;  5J1Y A;  1DQU A;  3NC0 B;  3I12 A;  1B4A A;  1V5F A;  4WHX A;  2EFO A;  5FLX Z;  4ECW A;  1I7L A;  1LQ1 A;  2M05 A;  2PMU A;  2UVU A;  4XYL B;  3HUG B;  2VBY A;  1ETV A;  5K2M A;  5E3O A;  4XOT A;  4Z6Y A;  2XGQ A;  1E4G T;  1NTC A;  4RDU A;  4RAY A;  2EQR A;  1U8R A;  5KG4 A;  5ICF A;  1SVO A;  3KEY A;  3X2Q H;  4Q8F A;  3A01 B;  5LHH A;  1N56 A;  2M7A A;  4A3F J;  3SYT A;  1K6O A;  1PUF B;  3J7A K;  1OCC H;  4RM2 A;  2NVU B;  2EFN A;  2VA3 A;  3DF8 A;  3ZMS A;  4B47 A;  5D6F A;  1XNR H;  4BE2 A;  1JKJ B;  5H80 A;  4O7R A;  3RB6 A;  2VN2 A;  5ERI A;  5JR3 A;  2QB5 A;  2UXC H;  1TW2 A;  3LST A;  3GYH X;  5I5V A;  3QWU A;  1EH7 A;  1RZ4 A;  2QKM B;  3H5A A;  4FET A;  5J6X A;  3CF5 F;  1DAA A;  1RKW A;  2M7B A;  1EKF A;  4MV8 A;  2OU2 A;  5JUM A;  2Q2E B;  5ILU A;  2RKH A;  4OAZ A;  2ADU A;  4XLE A;  5EZG A;  3K1P A;  1JLL B;  4CO8 A;  3DTF A;  4L9V A;  4I09 A;  4YR3 A;  1GHC A;  2RVC A;  3Q0V A;  3NEU A;  1J2X A;  2L01 A;  3TO6 A;  3U1K A;  1MZB A;  3LQQ A;  1LVA A;  2CW7 A;  3MWM A;  3ZQH A;  3GTP J;  5F0H A;  4RZR A;  4XMY A;  1JKQ C;  5DCM B;  1CQI B;  2ALZ A;  1Q1H A;  4HST A;  3UZO A;  1IOW A;  1FJG H;  1FKA H;  2UXX A;  3ZP5 A;  1B1B A;  2IAI A;  1FIA A;  1E2X A;  4MV7 A;  2L0K A;  4IR9 A;  1IXC A;  4DQN A;  4YQW A;  4GYI A;  4ECT A;  2NXN B;  3W1B A;  1UC8 A;  4HR7 A;  4KNY A;  3MR3 A;  4J9R A;  3MJF A;  3LAP A;  2Z99 A;  2ZBK A;  2A6H F;  4M3D A;  1VQO I;  2VON A;  4ZDL A;  5BYA A;  2ZNY A;  3FF5 A;  3WTZ A;  2PN6 A;  2ODT X;  1NG6 A;  3ABT A;  2A3S A;  3W2W A;  3M7G A;  3M4O J;  2QBY B;  3WHC A;  3S3N A;  1JDB B;  3PW7 A;  2R8K A;  2EB7 A;  4JI8 H;  1JT0 A;  2MGQ A;  4YFK F;  2X6Y A;  1JGG A;  3U54 A;  2AS5 F;  3V7R A;  1SFO J;  3GJX B;  4HQ6 A;  5BMV F;  4CUG A;  4B43 A;  1YJ9 I;  3OS2 A;  3IV5 A;  3RJP A;  1HXD A;  4C3I J;  1X3Z B;  1GXQ A;  4OX9 H;  5D5V B;  1U6G A;  2HYF A;  1MDM A;  1S72 I;  4IRC A;  4A3F G;  1RYR A;  3K6G A;  1I2L A;  1TTY A;  2BEO A;  2KJC A;  4BQO A;  1T3N A;  2XKP A;  3H9G A;  2EA4 A;  3R61 A;  3RYP A;  2JA6 J;  2FNA A;  4UUT A;  3GIL A;  3ISP A;  3GII A;  1LB2 A;  1P7I A;  3HOS A;  4BNC A;  2IW5 A;  3ORR A;  2AQF A;  1X1C A;  3PO2 J;  1KGS A;  2STW A;  3T5K A;  1N48 A;  1P2F A;  2OJE D;  5FKL A;  5KFX A;  5KFQ A;  4N9H A;  4F7Z A;  2KJB A;  1MNE A;  3BCA A;  3MFI A;  2Y0S N;  4NZO A;  2R92 J;  4BQA A;  2NUA B;  3DF7 A;  2JUC A;  2J9G A;  4DJA A;  3J81 K;  2YSR A;  1R5G A;  1ON2 A;  2E34 A;  5FRM A;  2ZGI A;  1BI2 A;  1U5T B;  4G7O F;  5LEK A;  4XRF A;  5ILV A;  3MZH A;  5D5X B;  5E1X A;  4KYW A;  2QKL B;  3CCJ I;  2VA2 A;  3G2B A;  2MSY A;  3ELK A;  3GTQ J;  1HCR A;  3U9G A;  3ZN1 A;  1MMG A;  1FWZ A;  3PZP A;  4QPQ A;  2TRT A;  2HHF B;  5C4J J;  3HSR A;  4X0G A;  1GSO A;  1J7K A;  1Y8Q B;  4AYB E;  1P4W A;  3E6D A;  2L2O A;  2G7H A;  3M9A A;  3TO7 A;  1EF4 A;  3V8L A;  4BE1 A;  2HGC A;  3OWT A;  1EA3 A;  1OMI A;  3HGY A;  2HGX A;  3RZD J;  5BR8 H;  1SVL A;  3ML6 A;  2W6Q A;  1Z2P X;  2XHK A;  4ENN A;  2DOA A;  2QYZ A;  5FPO A;  1KYZ A;  1ZRF A;  4CZZ A;  3HOX J;  5LGU A;  3LSJ A;  1LEA A;  3CTA A;  2XB5 A;  2VXZ A;  2XAQ A;  2JA8 J;  1JUM A;  4UCV A;  1X4O A;  1TT5 B;  3WE2 A;  5D8L B;  1OQY A;  2YCH A;  2E1M C;  2E60 A;  2VJ5 A;  2DI3 A;  3CO6 C;  4I0A A;  1XMA A;  3T0Y A;  5LGT A;  3DKX A;  1ACI A;  3RDI A;  3RUP A;  2DQL A;  4XLN F;  3LAJ A;  1IN8 A;  3I4M J;  3A0B C;  3TP3 A;  1K83 A;  2CUF A;  4J9N A;  2FBI A;  2E7W A;  4FTH A;  3AG2 H;  2VPR A;  1I1S A;  1JDE A;  3M1E A;  4E6N A;  3D5R C;  2BQR A;  3ZQC A;  2JN6 A;  5KVR A;  4L5J A;  2JA6 G;  4A2B A;  2AHQ A;  5FLX K;  3R9R A;  4CA0 A;  1X1P A;  4RB0 A;  4FFR A;  4DV0 H;  3PO2 G;  1U3E M;  1UJ8 A;  3GBG A;  4M3B A;  1Y39 A;  4J9K A;  2X5R A;  2DMU A;  2HIX A;  2F4V H;  4NDL A;  4X65 H;  4FBU A;  2R92 G;  3JRD A;  4DR7 H;  4B3T H;  2EIL H;  4N9I A;  3BY6 A;  3KZY A;  3F8M A;  3UFX B;  2OF7 A;  5CPR B;  3NQO A;  1H88 C;  4HW0 A;  2FMY A;  5BS6 A;  3BG6 A;  1LFB A;  3MKW B;  1BOB A;  2H1L A;  2R8H A;  1R6R A;  5KFN A;  4HOB A;  3KHG A;  4WXD A;  4O82 A;  2RRE A;  2FE3 A;  4MQ9 F;  3MWD A;  1JT6 A;  1IJW C;  4RGR A;  2EJ0 A;  1P4X A;  3MEX A;  4G9Y A;  3FMS A;  2HPI A;  3B02 A;  1G2H A;  1BNC A;  3A0H C;  4NUB A;  2VLA A;  2W9C B;  1KBL A;  1HLV A;  2LF7 A;  5A2Q W;  4UUV A;  5GAH J;  4G7H F;  3MQ0 A;  4RM3 A;  5CYV A;  2IS1 A;  4OOI A;  3LL7 A;  3RBE A;  4HPQ A;  3HOX G;  4DL7 A;  3OYF A;  3T5H A;  2XF5 A;  2XAF A;  3T9B A;  1NHA A;  5FB2 A;  1IRZ A;  2JA8 G;  2DPD A;  3G6Y A;  4E7J A;  4UUG A;  2C35 B;  4MV4 A;  1M1E B;  1STZ A;  2K9N A;  1TQI A;  4ASN A;  1DUX C;  2W70 A;  1E3H A;  1X1A A;  3BJA A;  5GTH C;  3WTS C;  1Z2O X;  4FFO A;  5JH7 F;  5EWE A;  2IP2 A;  2VAS A;  5EG0 B;  2LKX A;  1QQI A;  3CC7 I;  4UV9 A;  4E7L A;  4FFP A;  2EH3 A;  2B9S A;  1I3Q A;  3I4M G;  1FOK A;  2DT7 B;  3VNN A;  1U0J A;  3DQV C;  3FXJ A;  2VPQ A;  4EEQ A;  2H6B A;  3BR0 A;  2B0L A;  3CZ6 A;  1XSX A;  1D5Y A;  2KIF A;  1GSH A;  1D0Y A;  1Y1V A;  3OV8 A;  2LOO A;  4BHC A;  5FO5 A;  2E2H J;  4FFM A;  3T8R A;  3JTH A;  3MMY B;  3M3Y J;  3GTL A;  2Y75 A;  1YI2 I;  2VQF H;  5L1I A;  3TIG A;  1WH5 A;  2VIX A;  2O3F A;  2VL8 A;  3RBD A;  1FC3 A;  1D3Y A;  2GM4 A;  2MH9 A;  4J0M A;  3QP6 A;  1TC3 C;  3HM5 A;  1DGR M;  3FK7 A;  2Q2T A;  2ZJR F;  2K86 A;  2HDW A;  1LPQ A;  1IV8 A;  1RK6 A;  1W0U A;  1KC7 A;  3L2R A;  3S2H J;  4I55 F;  2AGP A;  2DJN A;  2CQK A;  1BIB A;  3F3X A;  5HVQ C;  2GQR A;  1E4F T;  3MKY B;  1DV1 A;  4RAZ A;  3ORQ A;  4IWX A;  4N4O B;  2XRO A;  2M87 A;  3JRH A;  1Z9C A;  1V55 H;  2R8G A;  4K0K H;  1A36 A;  5KG6 A;  1B6R A;  3FXM A;  4J9Q A;  4HNV A;  4LFA H;  2DDA A;  4PFP A;  1XD7 A;  3O6B B;  3DAA A;  3DCF A;  1QPI A;  1VQN I;  1UEL B;  5DD4 A;  5C1O A;  4ZYA A;  3S3O A;  3H3V K;  2QSH X;  2RC4 A;  3S15 J;  3OIP A;  3HRU A;  1BIA A;  2K7L A;  1FP2 A;  5IP9 J;  4XIC A;  2ABJ A;  2P8T A;  1ZET A;  1ZHS A;  3OYM A;  2HOS A;  5KFV A;  4DV5 H;  1L2Z A;  4TUY F;  2QLZ A;  4AUX A;  4FT8 A;  1PX2 A;  4O3Q A;  4ED1 A;  1OJL A;  2LR8 A;  3SDB A;  4BJ6 C;  2HZT A;  5K7F A;  3JRI A;  4BUP A;  3FXQ A;  3K3P A;  1SD6 A;  4W97 A;  4Y3O A;  2YS7 A;  3AX6 A;  4D1Q A;  3RGZ A;  2HVS A;  3MR5 A;  2VT2 A;  3F8C A;  1Z91 A;  4EGY A;  2OLS A;  4GYG A;  2VOO A;  4KDP A;  3BG3 A;  2GOX B;  3CJQ B;  1EUC B;  2VE8 A;  4Q4D A;  2BW3 B;  4DL4 A;  4II3 A;  4I0B A;  4CYC A;  3W5O A;  5BWU A;  1IBK H;  4E7Z A;  3GLL A;  2P0A A;  1WJC A;  2ZSH B;  3C2B A;  4LB6 B;  1FIP A;  2FA5 A;  1OCR H;  3G8D A;  2Q8K A;  2ID3 A;  2LH9 A;  3VWB A;  2O5R A;  1IRG A;  1H89 C;  2FPG B;  3O8H A;  2H09 A;  3FXO A;  1OR7 C;  4CCK A;  4KIT B;  1UG0 A;  1KU7 A;  2VOD A;  1FBU A;  1N78 A;  3HT5 A;  4MEY F;  3K9T A;  1HST A;  1I1G A;  3JCU C;  1GV2 A;  3GF2 A;  3JAM Z;  1IYE A;  2ZFU A;  1IYD A;  4RNN A;  2I8D A;  1YQA A;  3L7W A;  2A1H A;  1UST A;  2JUG A;  3CCU I;  3F0C A;  4UCU A;  2WA0 A;  3DKY A;  1KA8 A;  4C30 A;  5F1R A;  2JEI A;  4P9F A;  2R8I A;  4Q4Z F;  4XKB A;  2M1B A;  1W5S A;  3H9Q A;  1P4A A;  4O3P A;  4RNO A;  5EGO A;  1NH3 A;  1JGS A;  2AGQ A;  1D8J A;  1XK5 A;  3CF2 A;  1HBX G;  2HZD A;  3LML A;  3LSK A;  2EIK H;  3IRR A;  4C2U A;  3E5X A;  3M8F A;  2X48 A;  1S9H A;  5I5W A;  4EJV A;  4CMD A;  4YY3 H;  2L5Q A;  4OIP F;  2GPS A;  3GFJ A;  2ELH A;  2K9S A;  5BQT A;  5IP9 G;  2EK5 A;  1FNN A;  4A0Y A;  1YX3 A;  1UFM A;  2KZG A;  2JEJ A;  4XSZ F;  3SI8 A;  5KAI C;  3SZP A;  2UV1 A;  3KYH C;  1JKP C;  3GFI A;  2V4Q A;  2BY1 A;  2ZCW A;  2BE5 F;  3BA9 A;  1CF7 B;  1ULZ A;  4C3H J;  1TWH J;  2YWV A;  4PGG A;  2XCP A;  4M9S A;  2CU7 A;  3IUO A;  1BOA A;  4LG0 B;  3EDP A;  3VSL A;  2W6O A;  3R5F A;  3K4L A;  1SAX A;  4Y4R A;  5FD6 A;  3GIM A;  3H4D A;  3HSF A;  1N25 A;  2JPB A;  3L2C A;  3G71 I;  2JEG A;  2R3S A;  2V58 A;  3OHB A;  3HKZ E;  2VUM A;  4CDG A;  1T0F C;  2HI3 A;  4ECX A;  4IHY A;  4KN4 X;  5E18 F;  3SXY A;  4AYB N;  2LTP A;  2E1N A;  2OBP A;  4YEL A;  4IKF A;  2VC0 A;  2R7Z J;  3P9K A;  1IDZ A;  5KFE A;  2GXG A;  1HW2 A;  4IIJ F;  2HDD A;  4CC6 A;  2IXS A;  3EUA A;  4NC6 A;  1R4M B;  3IKV A;  4OU0 A;  1XS9 A;  3G1O A;  5DGH A;  1BR4 A;  4EJT A;  2DDB A;  1I39 A;  4K2E A;  4YB8 B;  2GXA A;  4WBN F;  1EH6 A;  4RGX A;  3VPC A;  1HOM A;  2Y31 A;  1ET0 A;  1TAE A;  3KLN A;  4XLF A;  1Z1D A;  2YX7 A;  2Z5U A;  3H36 A;  3WG9 A;  3WTU C;  4NB5 A;  4OIO F;  1YS6 A;  1G6N A;  2EZK A;  3TKY A;  2ECB A;  3OYB A;  4NYE A;  2FK1 A;  1X2N A;  1FTZ A;  2W4S A;  5CVJ A;  3I55 I;  3KFW X;  3CO7 C;  3AW8 A;  2C2E A;  2A6E F;  3C3W A;  3D5S C;  4MAM A;  4ENK A;  2BYV E;  3DTK A;  5L3G A;  1U5T C;  2XPU A;  5FKK A;  5HLI A;  1K79 A;  4LK1 F;  1IDY A;  1S7O A;  3V4G A;  2IBD A;  2VOP A;  2BY2 A;  3FWE A;  2STT A;  5CVV A;  5L3C A;  1YG2 A;  4MLO A;  1IF1 A;  2ECC A;  3CUO A;  4HNU A;  1XMQ H;  1X1D A;  3CP8 A;  4A3K J;  2VT3 A;  3QYE A;  4O7V A;  2HEO A;  1MH4 A;  3WTY C;  1J09 A;  2HOE A;  4G94 A;  4B4C A;  5AON A;  5TIS C;  4QIW A;  2OPT A;  1VQL I;  3QZ7 A;  3RI4 A;  1VQ9 I;  4LF7 H;  3OYJ A;  2FP4 B;  3ESW B;  1E17 A;  2VUG A;  1YE9 A;  2VXD A;  4F93 B;  4U7B A;  1B72 B;  3S24 A;  5BPH A;  5KG7 A;  1TWG J;  4DR6 H;  1FBQ A;  4NZN A;  4A3G J;  2FD5 A;  3GWZ A;  2P6T A;  4LIT A;  3N97 A;  3H1C A;  3DEW A;  4RB3 C;  2KRF A;  2LMD A;  2PMH A;  4ZYD A;  3RV3 A;  4A12 A;  1VF9 A;  3BOQ A;  3FIW A;  4M3G A;  4C2M J;  3K2A A;  1DGS A;  1I7N A;  3PM1 A;  1KJQ A;  2QQB A;  1CGP A;  2LBF B;  2YU9 J;  1MMS A;  3BTJ A;  3SQN A;  4I76 A;  2ASL A;  2R7Z G;  2OCC H;  5HS8 A;  4UUS A;  4J01 A;  3KEO A;  3OOP A;  4A3E J;  1PK8 A;  3BG7 A;  3HL2 A;  1YS7 A;  3U0G A;  3OL3 A;  2IA1 A;  1GV5 A;  5CQE A;  2V1X A;  4GO1 A;  4DYQ A;  4ZZL A;  5HBR B;  1S5L C;  4MV3 A;  4FAS D;  3MR6 A;  4A6E A;  3PR4 A;  3R0J A;  3ASN H;  3S1M J;  3RB0 A;  2CUZ A;  3NGD A;  4BEH A;  4MFE A;  3RTR A;  2ZJT A;  4AQY H;  2BVM A;  5LP6 F;  4JYK A;  4A3C J;  1E3P A;  4TV7 A;  3WE3 A;  4ESB A;  4IZZ A;  2ZM6 H;  3IG0 A;  1MJ9 A;  2V4R A;  1W0T A;  4EGZ A;  1MBF A;  2EJ2 A;  4M9U A;  5KFT A;  4LMY A;  2BY3 A;  3PIO F;  4EM2 A;  3LSI A;  3JAM K;  1RJR A;  1WGX A;  1OKR A;  4OMZ A;  5LD2 C;  3HTS B;  3GTG J;  4YIR X;  1WHU A;  4FHT A;  3FXR A;  5FKN A;  1T95 A;  3Q0U A;  2J6S A;  4FE2 A;  4YBZ B;  5JFR A;  3LMM A;  2X0L A;  1APL C;  1A0I A;  4Y15 A;  3CJT B;  2PX9 A;  3K1M A;  1XDN A;  4DL3 A;  2MD5 A;  5GPC A;  2ZME A;  4A3K G;  2WAQ A;  2XAJ A;  4O4I F;  3JSO A;  3A4C A;  4FBT A;  4RB2 C;  1AKH B;  1C3O A;  3VOT A;  3R5X A;  5IYZ F;  3IWF A;  3F21 A;  4AM3 A;  1ONV A;  2XRL A;  5DTD A;  3L4J A;  4O3M A;  1S0M A;  4Q47 A;  1D0Z A;  3I9V 2;  4F4W A;  2DXI A;  3ZXS A;  1D0X A;  5J8C A;  2NU8 B;  3VYR B;  4A3G G;  3P9I A;  5J2U F;  1QGP A;  3PUB A;  5I60 A;  5I47 A;  3L2Q A;  4J9P A;  3ZMV A;  4BQQ A;  4FIS A;  2R7K A;  4ZHQ F;  5KFP A;  1F4K A;  3H5R A;  4GC7 A;  3BR3 A;  2LY9 A;  2DBB A;  3F8N A;  3M8J A;  5B5E C;  1Z7L A;  1A0G A;  5ICG A;  4GKK H;  4A3E G;  3WO0 A;  2W84 A;  2EFP A;  1KYW A;  2GLO A;  3SEQ A;  1OCT C;  1ERD A;  1SFK A;  3SZT A;  2YR2 A;  2FB9 A;  3FDY A;  4LJZ F;  2QEX I;  5CVU A;  4A3J G;  2V7F A;  2D5V A;  2Y48 A;  2K02 A;  3GTK A;  1PP8 F;  2R7L A;  1K78 A;  1VQ8 I;  3J81 W;  4MTE A;  4CZC A;  2CUJ A;  3IWZ A;  3CME I;  4E7I A;  4UCT A;  1S7E A;  2B63 A;  3S1R J;  1LDJ A;  1V9P A;  1YLF A;  3T9C A;  4BKX A;  3TQ1 A;  4ZTF A;  4MQV A;  5FRO A;  3V7S A;  1YJN I;  3QPH A;  4ZJZ A;  4QPO A;  3T54 A;  4RCN A;  5C8Y F;  4A3C G;  3LQR A;  2QWW A;  3HB9 A;  3KZZ A;  4G6T B;  2EBI A;  4WCG A;  1HA8 A;  4PZ6 A;  5LMN H;  2CH0 A;  3GZ5 A;  1B33 N;  2VE9 A;  3H40 A;  2A5Y B;  1XMO H;  3PO3 G;  2JWT A;  4AIH A;  3CCR I;  1HR0 H;  2OWO A;  1UAA A;  1ZH5 A;  3AL0 B;  1REP C;  5EEH A;  3U55 A;  2MA3 A;  1P92 A;  1JI8 A;  2QYO A;  1ZRD A;  4O84 A;  1JXL A;  2W82 A;  3W6J B;  2ACJ A;  1VBH A;  1I50 J;  4I98 B;  5E1W A;  3RQI A;  5DS9 A;  3HC7 A;  2QCO A;  2W8K A;  3VMM A;  4X64 H;  1W7P B;  1WJA A;  2E5L H;  4R8U B;  5EDN A;  4ECR A;  2XF6 A;  3GEZ A;  5H20 A;  2CV2 A;  4CH7 A;  5KS8 A;  3S14 J;  1TWF A;  3H35 A;  4KMF A;  1IZ1 A;  2OV7 A;  3HRT A;  4FFL A;  3D1N I;  2YW2 A;  3KTM A;  1AU7 A;  3VOE A;  2RN7 A;  1VTN C;  2NNN A;  3HG9 A;  3V8J A;  3T8T A;  3ZQL A;  5IT9 Z;  4Q44 A;  4RGU A;  4HX7 A;  2YRX A;  2EFW A;  5CJ9 A;  2ESH A;  3K4N A;  1W93 A;  1T8I A;  4TVI A;  2WWY A;  1CQT A;  1OIS A;  2JA6 A;  2V1D A;  4NZM A;  1WH2 A;  4IO9 F;  1AUX A;  1V5E A;  4BHP A;  5K5O A;  4DIM A;  2E2J J;  2M0C A;  3T7A A;  2MC4 A;  3CCY A;  2FJZ A;  4PZ8 A;  4LF4 H;  5E79 C;  4PWQ A;  3AYH B;  2GWR A;  3BJO A;  1TL8 A;  5KFY A;  3RYR A;  2R92 A;  2Y2Z A;  4QWE A;  3DBR B;  1LEB A;  5F27 A;  3N6X A;  2NU7 B;  1M6V A;  4B09 A;  2H6C A;  4ECS A;  2AGO A;  1JTY A;  1RK5 A;  4G6D A;  2L9N A;  1M0T A;  4A3L J;  1LNW A;  2RQQ A;  5L3E A;  1R58 A;  4OMY A;  1FP1 D;  5DM6 F;  2EIM H;  1YFH A;  3BR6 A;  2RF4 A;  1WJD A;  2H8R A;  2K4B A;  2NAZ A;  4HDU A;  2IS2 A;  4B3M H;  3H9J A;  2E2I J;  4CYD A;  2M9H A;  3OR1 C;  5KHD A;  4ZDO A;  3U9S A;  3FKI J;  5LYJ F;  4QWC A;  4M74 A;  1MBE A;  3FM5 A;  5TGT A;  4ECY A;  4S0H B;  3O3K A;  2ZSI B;  2KHM A;  3HDD A;  1CQJ B;  3K4B A;  2DAA A;  5KFF A;  2C2D A;  3IC7 A;  4R79 A;  2VQC A;  4B48 A;  3PN1 A;  1KQ8 A;  3JR9 A;  4A5N A;  4JI2 H;  5LL6 b;  1VKZ A;  1O7L A;  5E8G A;  3PL8 A;  5D1O A;  2R82 A;  2NVX A;  2EJR A;  2W85 A;  3O2P E;  4A0X A;  4E7S A;  1G8X A;  3FHN A;  3I58 A;  4XM3 A;  1R71 A;  3HKZ N;  1WJB A;  1C0W A;  1E4E B;  4K6N A;  2PJR B;  3ETH A;  3SEZ A;  1ZK8 A;  3L4K A;  4V2G A;  5IYC J;  4DUY H;  2IGO A;  5J2T F;  4M7E A;  4HG2 A;  2L9S A;  3REO A;  3DPT A;  2OAZ A;  3QOD A;  4IHW A;  3CQZ J;  4F50 A;  5E25 A;  1XCV A;  3DEE A;  2OCE A;  4QJF A;  4JV1 A;  4JYA H;  5HLT A;  2ZJ2 A;  1ETQ A;  2JZY A;  4IQJ A;  2HTS A;  1JUS A;  4Y8V B;  1S6L A;  3LQS A;  1YIT I;  2TDX A;  2V1N A;  3CUQ B;  1I3A A;  3K69 A;  3CDH A;  3CCS I;  4Q8E A;  4O83 A;  1ETO A;  4LD5 A;  3LA2 A;  4CCL A;  4CIC A;  2R5Z B;  1FSE A;  2DLL A;  1LE8 A;  5ICC A;  4D5C A;  1X58 A;  1IXR C;  4Y7N J;  5J3L A;  1W1W E;  4A3D J;  3FK6 A;  4ZZD A;  1X19 A;  1MMD A;  3IP4 B;  2EZL A;  5EEA A;  2YUS A;  4I99 C;  2P5L C;  1RUO A;  2W25 A;  2W57 A;  1UCR A;  3LSG A;  3T5J A;  2M8E A;  2L9R A;  4XKC A;  1RRJ A;  3OL4 A;  1B6A A;  3GTM J;  1CKN B;  2RDI A;  1E3O C;  1MBH A;  2WTE A;  3R5H A;  4A3L G;  3WWH A;  3K4J A;  4JX6 A;  3ZOB A;  1R5I D;  3I71 A;  4IHJ F;  3V42 A;  1MJA A;  2LLK A;  5J1U A;  3OYH A;  2DW4 A;  1DV2 A;  4XN3 A;  1HNZ H;  4M6X A;  1WCM J;  2PG4 A;  2E5Z A;  4HBL A;  2W9B B;  5FFZ A;  2QEN A;  2WAF A;  3T5X A;  4GXO A;  4BXU A;  4DYR A;  5JVT A;  4RMN A;  1T94 A;  3M9O B;  4NXM H;  2OZ6 A;  4IRH A;  1SD5 A;  3JRB A;  3FKI G;  3T9A A;  1DU0 A;  4JUZ A;  4L9T A;  5F0C A;  3EQL F;  3LFU A;  4E4H A;  4UCO A;  1RJP A;  2UXN A;  2KQR A;  2LC2 A;  4BAC A;  1GXP A;  2YL2 A;  2IMW P;  1X4P A;  3I54 A;  1ZR4 A;  4JQF A;  1WPK A;  5BOX A;  1EKE A;  3BPX A;  4CXF A;  2JSP A;  2QSG X;  3RIR A;  3CJR B;  2UUC H;  5D1P A;  2RGR A;  3R4K A;  4PDK A;  4PJL A;  2HYG D;  3ERE D;  2MCT A;  4ZH4 F;  4ENM A;  1YYV A;  4D7M A;  2COB A;  2NVY J;  3GCM A;  4BQN A;  4BS9 A;  3LSR A;  4ITV A;  2FUG 2;  2MLK A;  2LK2 A;  1SEU A;  4ED7 A;  1UB9 A;  3Q9V A;  2F4I A;  3T9E A;  2IJL A;  3GZ6 A;  2LD5 A;  3NAU A;  5HOO A;  2UVV A;  2CJJ A;  2XVC A;  2WY8 Q;  2DA7 A;  5TRD A;  1G59 A;  2XCA A;  2PI0 A;  2FSW A;  2HKX A;  1WQ2 A;  2CQX A;  3ABL H;  1IRX A;  4Q43 A;  3WWI A;  4AID A;  1A04 A;  4A3B J;  1FEX A;  1EKV A;  2AQ4 A;  1Z05 A;  3HHG A;  3NRV A;  3OYK A;  4BGD A;  2I80 A;  1H9G A;  1J59 A;  2E2H A;  2EV5 A;  1B9N A;  2P4W A;  5CKT A;  5M5W J;  4KIG A;  2OC6 A;  3VYU B;  4I2O A;  4P5O A;  1CE8 A;  3I53 A;  3ZGK A;  3ETJ A;  3SZG A;  3FMA A;  1W7P D;  4JI5 H;  3DBH B;  1WKM A;  1EH8 A;  4M9Z A;  1MSE C;  1A35 A;  3KPH A;  3GLX A;  4EGQ A;  2ASD A;  4X62 H;  2FBH A;  4A3D G;  2HQA A;  1USS A;  1FYK A;  1R4N B;  5KFO A;  3L00 A;  3JRF A;  2HWV A;  4XON A;  4RAF A;  4RUA A;  4ENJ A;  1IOV A;  3ABK H;  3TO9 A;  4B44 A;  1ULY A;  2OUM A;  3GME A;  3F9K A;  5FPR A;  3EPI A;  2X6O A;  2UXD H;  1DP7 P;  1X9N A;  2BZT A;  3VPR A;  5JVL A;  5DQH A;  4MHG A;  4AC0 A;  1WCM G;  3HTU A;  2ZDH A;  3L9F A;  3V4S A;  3LA3 A;  2COI A;  3WGG A;  4UXN A;  3IHU A;  3EYY A;  4ZYG A;  2X1E A;  2VQL A;  1WRJ A;  4U88 A;  1G3W A;  1WH7 A;  2XDV A;  4EVI A;  4DV7 H;  4Q0Y A;  4JX4 A;  3KXY T;  4HSR A;  3WOD F;  5FFX A;  5FNV F;  2CKZ B;  2UUB H;  2DFF A;  1V4Y A;  5H6Q A;  5JVD F;  3RSN A;  2F4M B;  2WAD A;  4GRI A;  1UMQ A;  1VQP I;  2VI6 A;  1RR8 C;  4M3E A;  1VQ5 I;  5CA1 F;  1CS0 A;  3PW2 A;  1LE8 B;  3CMY A;  4IOC F;  1ON1 A;  2ZJQ F;  1AWC A;  2YYA A;  2GOM A;  3HSE A;  4C3J J;  2OZU A;  2OTL I;  2LVS A;  3OYG A;  4GGG A;  4IHS A;  3RTX A;  2A61 A;  4IRD A;  3HYI A;  1MDM B;  2NS0 A;  4O86 A;  4B3X A;  1LDD A;  3WU1 B;  3ZRG A;  1VBG A;  1Z67 A;  1XTA A;  4GC6 A;  4A5M A;  5IP7 J;  1W96 A;  2Y69 H;  5D8K B;  3GTJ J;  2V6C A;  1N77 A;  1AA7 A;  2DFI A;  2CFX A;  4IPA A;  2DMQ A;  3FX3 A;  3I59 A;  4HDV A;  2JPC A;  1YRN A;  3Q5F A;  2H8W A;  3PFF A;  1OBG A;  1VAJ A;  2JA5 J;  1N36 H;  2DFH A;  3FMQ A;  2NU6 B;  2QUF A;  2JTV A;  3KAK A;  4F55 A;  3EET A;  2OTJ I;  5FGM A;  2HXO A;  1ETW A;  1T33 A;  2KIM A;  3QRF F;  5DEQ A;  2LFB A;  4A3M J;  5LLQ A;  5ICE A;  3VA7 A;  5HLG A;  5LRS A;  2OD5 A;  2EJ3 A;  4L0Y B;  1VZ0 A;  3BQY A;  2X6X A;  4BJ5 C;  1YW7 A;  3OYL A;  1AHD P;  2DK8 A;  1U2W A;  3V7C A;  4J00 A;  1JE8 A;  4BY1 J;  3KP4 A;  3VFZ A;  3SHF A;  4DRF A;  4HNT A;  2HOT A;  3KE2 A;  2I87 A;  4PSW A;  1A6Q A;  3LOC A;  5CLS A;  3I4N J;  3ZMD A;  4XRS G;  2O8X A;  5JI6 A;  3PJR A;  2HDC A;  1U8B A;  2NOG A;  4BXX J;  4G3I A;  3MZY A;  1HC8 A;  2QGU A;  2R7F A;  2CFM A;  3GO5 A;  3DFG A;  3KEQ A;  3HRM A;  1O3T A;  3K0L A;  5FJ8 J;  4UNO A;  4PFO A;  4X66 H;  1XGM A;  2Z16 A;  1AUV A;  1S7A A;  4UY8 I;  2XC7 A;  2WE6 A;  2UVW A;  2WAE A;  4JI1 H;  3HEF A;  3OR2 C;  4Q4C A;  5F1J A;  2UXB H;  4UCR A;  2E71 A;  4XN0 A;  9ANT A;  2QQ9 A;  4GCV A;  2DLN A;  2R87 A;  2BHY A;  4ABZ A;  2KZV A;  2Z3Y A;  4ANJ A;  4EEF G;  2PBZ A;  2V9K A;  1BW6 A;  3PVX A;  3L1P A;  1RC9 A;  4J9S A;  4ED6 A;  3S1Q J;  1K61 A;  4EEY A;  2P5V A;  4UVA A;  5KFJ A;  2MH2 A;  5I5S A;  1ZLJ A;  2R84 A;  3GV7 B;  2F5F A;  2ELJ A;  2FQ3 A;  2Y9Y A;  5K5Q A;  2IS6 A;  4YJ3 F;  1TWH A;  3FIS A;  3RKQ A;  1ZAU A;  5F08 A;  2RAE A;  4DNC A;  4AD9 A;  4CHI A;  1ZRE A;  2YPR A;  3B73 A;  1O57 A;  3ONQ A;  1NK2 P;  3HOY J;  2CS3 A;  4R1H A;  2J6U A;  3E5Q A;  5IP7 G;  2MW8 A;  3DTI A;  5DLF A;  1IXS B;  5K7Z A;  1G2W A;  1WZ2 A;  2DMP A;  1K83 J;  4CCO A;  4GFB A;  4MO7 A;  3AL0 C;  2IA0 A;  4QIW E;  5KFG A;  4HF0 A;  1L3L A;  5KKN B;  2JA5 G;  2VBW A;  2F5C A;  3BJY A;  2PLY A;  5IPA A;  2E7X A;  4NC8 A;  4FS1 A;  3B6C A;  1MKM A;  4TV8 F;  3K5I A;  2CNQ A;  2XKO A;  5LXT F;  5IP6 A;  5DG7 A;  3CCE I;  1AOY A;  2O61 A;  3BAA A;  3HO8 A;  3QWL A;  4RU9 A;  4A3M G;  3IN5 A;  3E0J B;  4HV6 A;  2BV6 A;  3OYA A;  2ETH A;  2IGN A;  1DDN A;  2CO5 A;  3UKG A;  4PK4 A;  4A2U A;  4BY1 G;  3OSP A;  4W1U A;  2VKH A;  2F48 A;  1RKT A;  2E36 A;  2R7X A;  3AKZ A;  4XLA A;  3T1Y H;  3I4N G;  2CFO A;  2Q1Z B;  1PVE A;  3EUH C;  4BXX G;  2RNG A;  4FE4 A;  5LRR A;  2FPP B;  3K4M A;  1BR1 A;  5DM7 F;  1O3Q A;  2NU9 B;  1P6R A;  5KFI A;  2E19 A;  1T38 A;  2W7O A;  3HGG A;  5FJ8 G;  2XIG A;  2ZDG A;  4DV1 H;  3BP8 A;  4BL0 B;  3M8E A;  3CCM I;  3EYI A;  1TZL A;  1V54 H;  4OIR F;  1QVU A;  4XKV A;  1IC8 A;  4IXA A;  2A6T A;  2ESN A;  1HKT A;  3K4C A;  3PR5 B;  3NUA A;  2XF7 A;  3CCV I;  1XCB A;  3F8B A;  1MW7 A;  1K6Y A;  2RQP A;  3MCZ A;  1HKQ A;  1K4T A;  5DGI A;  4II2 A;  3TIN A;  4FX0 A;  3KP7 A;  2XGP A;  3A02 A;  3BR2 A;  2CWE A;  1PJR A;  4FGR A;  2OQR A;  2ZFW A;  3U21 A;  1BGW A;  1J5E H;  3DBL B;  2DCE A;  3K70 D;  3NBZ B;  4JX5 A;  4QWA A;  4O3S A;  3QU3 A;  3C7J A;  3GV8 B;  2R5Y A;  4E7H A;  4EJO A;  3RAX A;  2EZH A;  4LF8 H;  2HKO A;  4XOR A;  1TWG A;  2FPI B;  1HNX H;  3HOY G;  2E35 A;  3VYT B;  3WHB A;  5GAD J;  3TP0 A;  1HNW H;  1A5J A;  3BQ1 A;  2WAQ E;  1QHG A;  3WTW C;  2Y0M A;  2DA3 A;  1J9I A;  5J47 A;  2AXL A;  4C2M A;  3WNZ A;  1Y1W J;  1BL0 A;  3GX4 X;  1Z6T A;  3W2A A;  2F6C A;  1Y0U A;  2CSO A;  5KFD A;  1WSU A;  1UC9 A;  1BN5 A;  3PIP F;  3AG4 H;  1Y1V J;  1BI0 A;  2JA7 J;  2YZL A;  1RYS A;  3LUL A;  5HOD A;  4LH7 A;  4G6Q A;  3CLQ A;  1P9Q C;  1MBK A;  5DG8 A;  1ZQ3 P;  3ECO A;  1XMK A;  2KKO A;  2N8G A;  4WX9 A;  2Z04 A;  3OIQ A;  1MSF C;  5FKO A;  1BXR A;  1UHW A;  2KP6 A;  1YO5 C;  3CEB A;  1UHM A;  2CRG A;  2X9D A;  5DIS C;  1ZTR A;  1V5G A;  5IYB J;  2W48 A;  3QOP A;  4D0P A;  1O3S A;  4QWD A;  2C2R A;  2PFB A;  4ON0 A;  3QOE A;  1VQ6 I;  2V59 A;  3CUQ C;  4YP3 A;  1OCP A;  3UQ8 A;  4EMS A;  3CD6 I;  3V8K A;  4IJA A;  5M5Y J;  1R1V A;  5I5Y A;  1T39 A;  2HNH A;  4M72 A;  5LHG A;  2R7U A;  2WBM A;  1H9T A;  2J5P A;  3F8F A;  2DYR H;  4ECU A;  4GKJ H;  3RV4 A;  1XDU A;  3D5L A;  4MNU A;  2XSD C;  4OAY A;  2CZG A;  3GTG A;  2A07 F;  3GW2 A;  2KLO A;  2MYS A;  2BR0 A;  3Q3S A;  2DAB A;  5M3F J;  1A48 A;  1PYV A;  4UB6 C;  3QFF A;  1ZGA A;  4XNF A;  4P9U A;  3PFI A;  2CV0 A;  1M0W A;  1T6S A;  1IN5 A;  3RKY A;  4QW8 A;  1ETY A;  5K3W A;  1T08 B;  1R5H A;  2DA1 A;  4ZOL F;  3VPB A;  1OCO H;  4NQW A;  2L4M A;  3BZC A;  1UG2 A;  2Z02 A;  3BPV A;  2XC9 A;  2FX0 A;  4BJT A;  1LKX A;  4F92 B;  2BHZ A;  4HYE A;  1TQP A;  4V2F A;  3HBL A;  1RUN A;  2DIK A;  4KHP H;  2K3P A;  2IGM A;  2W6M A;  2ZO4 A;  2ZXJ A;  4MA0 A;  2VC1 A;  3FXU A;  2O9L A;  4CYC B;  1J75 A;  4IEJ A;  2R93 A;  5C44 J;  3P5J A;  1F43 A;  4DV4 H;  3JRW A;  5J40 A;  3PQK A;  1C30 A;  1BC7 C;  4XZ3 B;  4QLC U;  1Y1W G;  2KL4 A;  2DN0 A;  4KJZ A;  3N41 B;  4ZTJ A;  2JA7 G;  2A5W A;  3S17 J;  3TQT A;  2DT6 A;  3L2U A;  1S10 A;  1Z3X A;  4DR3 H;  4DL6 A;  2XAH A;  4LH6 A;  1H8A C;  1ZRC A;  2KIU A;  2KRH A;  4IRK A;  2X51 A;  3WTX C;  1FPQ A;  5D6E A;  4MA5 A;  3PNV A;  2FOW A;  1ZAR A;  1MD0 A;  3DXJ F;  4HEA 2;  4BY7 J;  4D9J A;  3J80 Z;  3BZ6 A;  3DLL F;  2F4O B;  1IAW A;  5IYB G;  4YR2 A;  1TWA J;  3B6A A;  2H1K A;  5EGO B;  3S3M A;  2COM A;  2HHH H;  1VQM I;  4UFZ A;  3A03 A;  4JP0 A;  2W8L A;  4F4X A;  5BWX A;  1F1Z A;  2M0M A;  2P5K A;  3KP5 A;  4JK1 X;  3U9T A;  3S93 A;  2FXA A;  3E6B A;  2CNV A;  1JIH A;  4WWC A;  4L0Z B;  3QPS A;  3GIQ A;  1W5T A;  4RNM A;  2K85 A;  2AXT C;  2A05 A;  3E97 A;  1V51 A;  3SFZ A;  4O7Z A;  3SGI A;  3W2V A;  2D1V A;  3GZN B;  4ZDP A;  5HNF A;  3GDE A;  3LWB A;  3PW5 A;  2Y30 A;  1JHF A;  1I50 A;  3GQC A;  2NVX J;  4Q5S F;  2ELK A;  2IA6 A;  2EIN H;  4PJ0 C;  5D4S A;  5JQG F;  3BDD A;  4EM1 A;  2Q2U A;  4RLQ A;  2XAU A;  1IGN A;  2ZDQ A;  3GTO A;  1R9T J;  2W9A A;  4HV5 A;  1QU3 A;  3H3V H;  4BU2 A;  2CW8 A;  4DZP A;  2MC3 A;  4RZQ A;  1DPR A;  4E4T A;  5GON F;  2DPJ A;  2ISZ A;  1OCZ H;  2CUE A;  1P7J A;  3HHH A;  2FBK A;  3OS1 A;  4X1E A;  3RIZ A;  3HZJ A;  1YHQ I;  3GV5 B;  3TY8 A;  1IUY A;  2HG8 A;  4OIN F;  4KMU X;  3IKT A;  3HOW J;  3MN2 A;  3BG9 A;  5C44 G;  1WJF A;  2GPW A;  4PDB A;  1T2K A;  1S9F A;  4MV9 A;  5F64 A;  1I2K A;  3BC8 A;  4KIF A;  5IOZ A;  2JEF A;  4LB5 A;  1ORK A;  4XBF A;  1EV7 A;  5J4V A;  2PMZ A;  5DUI A;  1XSD A;  5FLV A;  2VUM J;  4DR2 H;  2JRM A;  3VSK A;  2GXB A;  1R49 A;  3GXO A;  2B7E A;  3PW4 A;  1ZYR F;  2G0E A;  1XN7 A;  1XSV A;  4LOC A;  1I6X A;  1BJT A;  5CVI A;  4RUC A;  1E0E A;  1D1A A;  3WGI A;  2FKL A;  2VQH A;  4ZQI A;  2LY1 A;  1ETX A;  5BNG A;  4O7L A;  3WWJ A;  4YHH H;  3HUG A;  2EV0 A;  2K9M A;  4DGW B;  4HF2 A;  1OR7 A;  3LP8 A;  3NBY B;  2E2I A;  3C1D A;  1Q1V A;  1OBD A;  4BY7 G;  1ITY A;  2FK2 A;  3A01 A;  2W1O A;  3BTC A;  5IYD J;  4MV6 A;  4RA2 A;  4F3Q A;  3FKI A;  1FLI A; 
#chains in the Genus database with same CATH homology
 4CCL A;  4E7J A;  2K5C A;  4CCM A;  1LFP A;  5KCM A;  4F52 A;  2LYC A;  1X1A A;  1Z2O X;  2M4K A;  4AVZ A;  1X19 A;  1MMD A;  3IP4 B;  4BDY A;  2VAS A;  2VJJ A;  4E7L A;  2W57 A;  3LSG A;  2UUZ A;  2M3A A;  4H4K C;  4XKC A;  2DT7 B;  3OL4 A;  3PSI A;  1CKN B;  3VNN A;  1U0J A;  3DQV C;  4EEQ A;  4EAT A;  3TY9 A;  3K4J A;  2F5V A;  3CZ6 A;  3V42 A;  1B04 A;  3OYH A;  1FMW A;  4XN3 A;  4DV3 H;  1HNZ H;  4LFC H;  4IQ4 A;  1D0Y A;  1MND A;  2E5Z A;  2LOO A;  2MFZ A;  4NNJ A;  2WAF A;  4NXM H;  4RMN A;  3MMY B;  2VQF H;  3H5N A;  2V4J C;  2VIX A;  2VL8 A;  3N40 P;  2X1C A;  3BLY A;  3W3C A;  3LFU A;  4E4H A;  4UCO A;  4J0M A;  5EOY A;  1S68 A;  2KQR A;  2LC2 A;  3DLA A;  4BAC A;  1DGR M;  3KYL A;  1X4P A;  2Q2T A;  4JQF A;  4C9Y A;  2HDW A;  2VJI A;  2VPL A;  2R7Q A;  2MD0 A;  3LSH A;  1LVK A;  3L2R A;  1Z2N X;  2JSP A;  3CJR B;  3CVZ A;  4DOZ A;  2UUC H;  4B3R H;  5D1P A;  2RGR A;  5HVQ C;  2HU9 A;  4PJL A;  1E4F T;  3MKY B;  2MCT A;  4YRV A;  4RAZ A;  2KRC A;  4N4O B;  4BS9 A;  4BQN A;  4DUZ H;  4JI0 H;  2NOJ B;  5HNH A;  4ITV A;  2FUG 2;  4PJN A;  3EUK L;  4MTD A;  1P16 A;  2R7O A;  2F4I A;  3DTE A;  2VPS A;  4K0K H;  5FD5 A;  2MAB A;  5HOO A;  4XR6 A;  4LFA H;  1G59 A;  2WY8 Q;  2VOB A;  4PFP A;  1IRX A;  4YEJ A;  1UEL B;  3ZQQ A;  2X85 A;  4ZYA A;  4BEH B;  3S3O A;  3OYK A;  4BE0 A;  4BGD A;  2HPM A;  3OIP A;  5CKT A;  1N33 H;  3NWT A;  2OC6 A;  3VYU B;  4P5O A;  3CES A;  2E1M B;  3ZGK A;  3OYM A;  1ZHS A;  3J80 W;  3SZG A;  3FMA A;  3I3L A;  4JI5 H;  4DV5 H;  1L2Z A;  3OYC A;  1X1B A;  4X62 H;  3RQ4 A;  1S03 G;  5FLX W;  2HQA A;  2M4G A;  3SDB A;  4N4N B;  3S8P A;  4BJ6 C;  4XON A;  4BUP A;  4Y3O A;  4B44 A;  3RGZ A;  4D1Q A;  2OUM A;  2HVS A;  3F9K A;  3CMM A;  5FPR A;  3QYF A;  3OY9 A;  4LF5 H;  2UXD H;  1X9N A;  4CCN A;  1CKM A;  2GOX B;  3CJQ B;  2BW3 B;  4XLH A;  4II3 A;  1N32 H;  3W5O A;  1IBK H;  2K9L A;  4E7Z A;  1FMV A;  2Y0S A;  2ZXI A;  3A2K A;  1WJC A;  2ZSH B;  1CKO A;  3EYY A;  3DU5 A;  3FKJ A;  2VQL A;  2X1E A;  1WJE A;  2LH9 A;  3VWB A;  2XDV A;  2O5R A;  4DV7 H;  4Q0Y A;  4JV5 H;  3K70 C;  3KXY T;  4HSR A;  2JA2 A;  1OR7 C;  4CCK A;  2UUB H;  4DBR A;  2Z2S B;  4KIT B;  1UG0 A;  1Z21 A;  3RSN A;  2WAD A;  1N78 A;  2R7V A;  4GRI A;  2WB1 A;  3L2V A;  1BR2 A;  4EFE A;  2VB6 A;  2ZFU A;  3HOT A;  2I8D A;  2GOM A;  5JHF A;  3JSN A;  3VDX A;  1MMA A;  4NC7 A;  2JUG A;  3K4K A;  4UCU A;  2WA0 A;  3DKY A;  4C30 A;  3L2P A;  4ZC3 A;  1O75 A;  4XKB A;  2V6E A;  3OYG A;  3RTX A;  3RR5 A;  1I6U A;  3H9Q A;  4DV2 H;  4XQF A;  4B3X A;  4PSX A;  4C2T A;  3L2W A;  3ZRG A;  4LF9 H;  3EPZ A;  3CF2 A;  1XK5 A;  3KAJ A;  5FRN A;  2HZD A;  3LML A;  3LSK A;  2DJI A;  1N77 A;  1AA7 A;  3RPU D;  4C2U A;  4JI6 H;  1S9H A;  4NQW B;  2UUA H;  4YY3 H;  3N44 B;  4LIU A;  2L5Q A;  3E1S A;  1VS0 A;  4I7H A;  1N36 H;  3S32 A;  3DPU A;  3VYS B;  4F55 A;  3KAK A;  1YX3 A;  2E5N A;  5KNL A;  4DIQ A;  3KYH C;  2UV1 A;  4XOP A;  3CP2 A;  2BOL A;  3BA9 A;  3N43 B;  1VZ0 A;  3OYL A;  2X6X A;  4BJ5 C;  4ETS A;  4J00 A;  2AQE A;  2JVG A;  3IUO A;  3IAS 2;  3VSL A;  4DRF A;  4HNT A;  1N34 H;  3K4L A;  1KON A;  4Y4R A;  4PSW A;  2VKD A;  5FD6 A;  1N75 A;  2BVL A;  2KPM A;  2KDO A;  3PJR A;  1T0F C;  4DBQ A;  1I94 H;  3M1C A;  4E7K A;  1ZHQ A;  2KMU A;  2CFM A;  3GB8 B;  4UCS A;  4X66 H;  4PFO A;  2WE6 A;  2Z16 A;  4YEL A;  4IKF A;  4KIS A;  2XC7 A;  2PJR A;  2WAE A;  4JI1 H;  3OR2 C;  1AN7 A;  2UXB H;  3HKZ A;  4UCR A;  4AU7 A;  4XN0 A;  2RGV A;  4CC6 A;  2IXS A;  3EUA A;  1SEI A;  2W00 A;  3BCB A;  2KZV A;  2VQG A;  4CC5 A;  3MKZ A;  3UNG C;  4ANJ A;  2V9K A;  3NWS A;  3QYB A;  1BR4 A;  1QHH D;  3OYE A;  1DP3 A;  4XL9 A;  2R7T A;  1TAE A;  4XLF A;  3FBN B;  3K10 A;  4LSX A;  2ELJ A;  3OYB A;  4FM9 A;  4LFB H;  2IS6 A;  1WJ5 A;  2WY7 Q;  2W4S A;  2X6W A;  4U87 A;  1IBL H;  3PNT A;  3T1H H;  3ONQ A;  2CS3 A;  3D5S C;  3DTI A;  3HXL A;  3W1G A;  3IAM 2;  3DTK A;  4P1W A;  5IT9 W;  3PNY A;  4OWR B;  3RCO A;  4CCO A;  4PZ7 A;  3K3V A;  3AL0 C;  3HPG A;  4PJM A;  1CKN A;  4LG3 A;  3HPH A;  3C0F B;  4APM A;  3OTO H;  2XSJ C;  4NC8 A;  4EFB A;  3OS0 A;  4MLO A;  1XMQ H;  4HNU A;  3H20 A;  1X1D A;  3CP8 A;  3BAA A;  3QYE A;  2JVH A;  5D1O B;  2CMP A;  3E0J B;  2HIV A;  1TA8 A;  3OYA A;  2CV1 A;  2IGN A;  1J09 A;  2O03 A;  2LY2 A;  4PK4 A;  2LRE A;  4LF7 H;  3PFY A;  3OYJ A;  4IAJ A;  3RF2 A;  2VKH A;  1GLN A;  2VUG A;  3TBI A;  1YE9 A;  2VXD A;  4F93 B;  4CCJ A;  4U7B A;  3AKZ A;  2R7X A;  3S24 A;  3OYN A;  4DR6 H;  4XLA A;  3T1Y H;  4IX7 A;  2CFO A;  2Q1Z B;  4LIT A;  2R7W A;  3M4I A;  1DGW Y;  4RB3 C;  1TT0 A;  3EUH C;  2RNG A;  4RB1 A;  1DQU A;  3K4M A;  1BR1 A;  4RLF A;  4XLC A;  3NC0 B;  4DR5 H;  1V5F A;  3H0D A;  1DGS A;  1NG7 A;  3HUG B;  2LBF B;  2XIG A;  4DV1 H;  4BL0 B;  4JI7 H;  4J01 A;  4XOT A;  3BG7 A;  3HL2 A;  1E4G T;  3OL3 A;  4RAY A;  1TZL A;  4XKV A;  3KEY A;  2A6T A;  4CSW A;  5CQE A;  2M7A A;  3K4C A;  3SYT A;  4BDZ A;  3J7A K;  4RM2 A;  2XF7 A;  4B47 A;  4FAS D;  1XNR H;  1MW7 A;  1K6Y A;  4BE2 A;  4II2 A;  4NXN H;  4PJJ A;  2UXC H;  1Y56 A;  1Y6I A;  2CUZ A;  4BEH A;  4GLX A;  3RTR A;  1PJR A;  2ZJT A;  2BVM A;  3U21 A;  4AQY H;  3QWU A;  1BGW A;  1J5E H;  2QKM B;  3H5A A;  4FET A;  4IZZ A;  3ZR8 X;  2DCE A;  3K70 D;  3NBZ B;  2ZM6 H;  2M7B A;  3IG0 A;  1IBM H;  1LDK B;  2Q2E B;  4E7H A;  4LF8 H;  4OAZ A;  4XLE A;  4LMY A;  4XOR A;  3TL4 X;  1HNX H;  3VYT B;  3LSI A;  4LF6 H;  2VJ4 A;  1HNW H;  1MZB A;  2CW7 A;  5LD2 C;  3MWM A;  4E6K G;  1QHG A;  4DV6 H;  4XMY A;  1T95 A;  3LMM A;  3W2A A;  4HST A;  2F6C A;  2R7S A;  1A0I A;  1FKA H;  1FJG H;  4MV7 A;  1XDN A;  2WDT A;  2BW3 A;  3MD2 A;  4LH7 A;  3W1B A;  2WAQ A;  1W36 D;  3A4C A;  1P9Q C;  4RB2 C;  2UU9 H;  2KSW A;  3OIQ A;  4R7R A;  3FBI B;  2V26 A;  3L4J A;  2KP6 A;  4ZDL A;  1D0Z A;  3I9V 2;  3JSL A;  1NG6 A;  5DIS C;  2DXI A;  3ZXS A;  1D0X A;  3DPL C;  1V5G A;  3VYR B;  3W2W A;  3KAL A;  3PUB A;  3S3N A;  3L2Q A;  3RJ0 A;  4BQQ A;  3QOE A;  3RGX A;  4JI8 H;  3H5R A;  2HGS A;  3UQ8 A;  2X6Y A;  1SAU A;  3J7A Y;  3F8N A;  4HRI A;  3GJX B;  3M8J A;  2R7R A;  1Z7L A;  2HNH A;  4GKK H;  4CUG A;  2R7U A;  2WBM A;  4B43 A;  3OS2 A;  1ZEL A;  3C2G A;  3UR3 C;  3SEQ A;  1P8L A;  3LSM A;  4OX9 H;  3D5L A;  1ERD A;  4GKJ H;  4OAY A;  1SFK A;  3FDY A;  2KLO A;  4EQ5 A;  3AFH A;  2MYS A;  2V7F A;  3K6G A;  1PYV A;  4BQO A;  4XNF A;  3J81 W;  2R4G A;  3TY5 A;  4CZC A;  3H9G A;  4MTE A;  2CV0 A;  1M0W A;  2CUJ A;  4E7I A;  3BA8 A;  4UCT A;  1OLT A;  3C2H A;  1V9P A;  2IS4 A;  3HOS A;  4ZTF A;  2AQF A;  5FRO A;  1X1C A;  4ZJZ A;  4QPO A;  4BWS C;  4BJT A;  1LKX A;  4F92 B;  5IWA H;  4KHP H;  2ZXH A;  1MNE A;  4G6T B;  3BCA A;  4PZ6 A;  1HA8 A;  5LMN H;  2K3P A;  5LFA A;  2IGM A;  2CH0 A;  4XKW A;  3DF7 A;  4DJA A;  3A1Y A;  1XMO H;  2L7K A;  5FRM A;  1HR0 H;  2OWO A;  1UAA A;  3AL0 B;  4DV4 H;  1YX5 A;  1JI8 A;  2QKL B;  3G2B A;  3PSF A;  2W82 A;  3DWL E;  1MMN A;  1MMG A;  4QPQ A;  2KL4 A;  3HC7 A;  4KJZ A;  3N41 B;  1D1B A;  4X64 H;  2P0W A;  4ZTJ A;  1WJA A;  2E5L H;  4X0G A;  2A5W A;  2XF6 A;  2CV2 A;  2DT6 A;  2L2O A;  4CH7 A;  3L2U A;  3H35 A;  4BE1 A;  1Z3Y A;  2OV7 A;  3OWT A;  1EA3 A;  3OOU A;  1Z3X A;  3KX2 A;  5BR8 H;  4DR3 H;  4LH6 A;  1Z2P X;  3HG9 A;  2DOA A;  5FPO A;  2KRH A;  4DR1 H;  2X51 A;  3K4N A;  2Z1D A;  4AYB A;  3PNV A;  1WH2 A;  4HEA 2;  4D9J A;  3BAB A;  1V5E A;  2VXZ A;  2MC4 A;  3S3M A;  2HHH H;  4UCV A;  4UFZ A;  4PZ8 A;  4F91 B;  4LF4 H;  1X4O A;  4LSA A;  2YCH A;  2E1M C;  2E60 A;  3TMO A;  2VJ5 A;  2M0M A;  3S93 A;  3DKX A;  3N6X A;  2HVR A;  3OYI A;  2LRD A;  2L9N A;  1M0T A;  3W2V A;  1FVI A;  4ZDP A;  2RQQ A;  5HNF A;  3GDE A;  4E6N A;  1WJD A;  3D5R C;  4KT6 A;  4B3S H;  4PUS A;  4DR4 H;  3JAM W;  2Q2U A;  2IS2 A;  4A2B A;  3H9J A;  4RLQ A;  2XAU A;  4B3M H;  4JI4 H;  4ZDO A;  3OR1 C;  4CA0 A;  5KHD A;  3DU6 A;  1QU3 A;  1SYX B;  2IGK A;  4RB0 A;  4BU2 A;  4JI3 H;  2CW8 A;  2UWM A;  4RZQ A;  5TGT A;  4DV0 H;  2HVQ A;  3GBG A;  4Y33 A;  1XNQ H;  4JOM A;  5CQG A;  3OS1 A;  3ZCO A;  3RIZ A;  2HIX A;  1GYF A;  2ZSI B;  2KHM A;  2F4V H;  3K4B A;  4X65 H;  3TY8 A;  3N42 B;  4R79 A;  2VQC A;  4A2A A;  4B3T H;  4B48 A;  4DR7 H;  1WFX A;  3PN1 A;  2LG4 A;  4JI2 H;  5LL6 b;  5CPR B;  5D1O A;  3PL8 A;  1WJF A;  4PDB A;  1D1C A;  2X1D A;  4E7S A;  1G8X A;  3BG6 A;  3FHN A;  4MV9 A;  4XM3 A;  3MKW B;  5LMU H;  1BOB A;  1WJB A;  3BC8 A;  2W7N A;  2PJR B;  3OYD A;  2WYO A;  1R6R A;  3SEZ A;  4DR2 H;  2PMZ A;  3L4K A;  4BXF A;  3VSK A;  4DUY H;  2IGO A;  2RRE A;  2FE3 A;  3OMY A;  4HG2 A;  4M7E A;  2L9S A;  3DPT A;  3QOD A;  1BJT A;  2HPI A;  1E0E A;  1D1A A;  3DEE A;  2VQH A;  1W36 C;  2LY1 A;  4NUB A;  2VLA A;  4JYA H;  5HLT A;  4LIV A;  4YHH H;  2LBF A;  2VQE H;  4IQJ A;  2K9M A;  4DGW B;  5A2Q W;  2IS1 A;  3N05 A;  4RM3 A;  3NBY B;  3LL7 A;  4HPQ A;  3OYF A;  2XF5 A;  2V1N A;  2W1O A;  4F3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...