2HVRA

Structure of t4 rna ligase 2 with nicked 5'-adenylated nucleic acid duplex containing a 3'-deoxyribonucleotide at the nick
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
333
structure length
319
Chain Sequence
SMFKKYSSLENHYNSKFIEKLYSLGLTGGEWVAREKIHGTNFSLIIERDKVTCAKRTGPILPAEDFFGYEIILKNYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYGDKDFYVFDIIVTTESGDVTYVDDYMMESFCNTFKFKMAPLLGRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKNSKFELSEADNKLVGILACYVTLNRVNNVISKIGEIGPKDFGKVMGLTVQDILEETSREGITLTQADNPSLIKKELVKMVQDVLRPAWIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna/dna
molecule keywords 5'-D(*AP*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*
publication title RNA Ligase Structures Reveal the Basis for RNA Specificity and Conformational Changes that Drive Ligation Forward.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 83
structure length 319
sequence length 333
chains with identical sequence B
ec nomenclature ec 6.5.1.3: RNA ligase (ATP).
pdb deposition date 2006-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18043 T4_Rnl2_C T4 RNA ligase 2 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2hvrA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2hvrA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2hvrA01
3TY9A 4UCSA 3BAAA 2HVQA 4PZ6A 2Q2UA 4E6NA 1CKMA 4CC6A 2HIVA 4UCVA 3PN1A 5FPOA 4PZ8A 4PZ7A 1CKNA 5D1OA 3NBZB 5D1PA 3UQ8A 1VS0A 2Q2TA 4LH6A 1XDNA 1P8LA 4EFBA 1S68A 1DGSA 3TY5A 3W1BA 4CC5A 2VUGA 4UFZA 3BABA 3W1GA 3BA9A 3JSLA 1TA8A 3BA8A 3NC0B 3JSNA 5FPRA 4UCUA 4UCOA 1CKNB 2HVRA 4EEQA 3RR5A 4EQ5A 3TY8A 5D1OB 3L2PA 1B04A 3NBYB 1XK5A 2CFMA 3GJXB 4UCRA 3W5OA 1P16A 4GLXA 4DRFA 1A0IA 3GDEA 2OWOA 4UCTA 3RTXA 3GB8B 4LH7A 1CKOA 2HIXA 3QWUA 5DISC 1X9NA 2HVSA 4EFEA 3KYHC 1FVIA 1TAEA 3VNNA 1V9PA 3S24A
chains in the Genus database with same CATH superfamily
4AIDA 4DIQA 4ECRA 4M0JA 2W82A 1DP7P 2L7MP 2MCTA 1TW3A 2CWEA 4Q8FA 1YW8A 2V59A 1KZHA 1MMDA 2M87A 3QYBA 1CKMA 4CC6A 3CC2I 1SANA 4AYBA 3BT9A 2VPSA 2LYCA 3TEKA 3SDBA 2FOKA 2WY7Q 3PN1A 1MBFA 3CVZA 2DMQA 4FTHA 4EGZA 1WJEA 1I50J 3BZ6A 3TW7A 4PZ7A 3K6GA 2VQHA 3BR0A 2WAFA 2HGWA 2JEGA 3T1YH 1DGRM 3FM3A 2HQRA 2DA2A 4PJNA 4QWQA 4XNFA 3JSOA 1JLLB 2C2EA 1UELB 1JT6A 3IH2A 5LRRA 1KBLA 2VB6A 1BC7C 1FTZA 4XX0B 2Q2TA 3PM1A 2FA5A 1TW2A 3HPGA 1CF7A 4G7OF 3G2BA 4C2MJ 2QLZA 4DR4H 3DTFA 5EZGA 2R5ZB 3QPSA 2L3DA 1GO3E 1VBGA 1IBKH 3VYUB 1FBUA 4XLAA 3J81K 3GTKJ 4OMZA 1DGWY 3KLNA 3PIPF 2VE8A 3OYBA 4EM2A 2K4BA 2ZJTA 4UFZA 4M71A 3O2PE 2R93J 3I58A 4EQQA 3ESWB 2R86A 5BWTA 3BA9A 5JLXA 5JI6A 3AKZA 2FUG2 2WWYA 3HOSA 2W4SA 3ISPA 5FGMA 1KEEA 5F6FA 4N4NB 1EKEA 4AIHA 1ZR2A 4L0YB 1ENHA 3VYTB 3FXKA 5DLGA 2MA3A 3J80W 4BHBA 1X1CA 2NNNA 3B02A 4ESFA 3Q8SB 3PFYA 5HDGA 4BBSG 3N40P 4FQGA 2PBZA 5DUIA 1W93A 3L4JA 2XCLA 1AUVA 1I6XA 2HQAA 3ABMH 2YS7A 4ED2A 3KIOA 4KMFA 2C2RA 1A31A 2JA7J 1F5TA 1EYZA 3G1MA 5J8FA 3CCLI 4JBAA 1ETXA 2EFPA 5JR3A 3CEBA 1U2WA 1MMAA 4BACA 1ETQA 2CNUA 5B66C 2FQ4A 3GTMA 5LYJF 3SI8A 1FBQA 4MFEA 4MV1A 1RJPA 1OR7A 4CDGA 2COMA 2ZXJA 1RIOH 2EFQA 3ZCOA 4F92B 4YIIA 3RZOJ 3ZN1A 5DD8A 4BBSJ 2ACJA 5LA6F 3UKGA 1CKOA 4O81A 1YW7A 3SFIA 1FP2A 4II3A 3IP4B 1QVTA 2HFHA 2KFDA 1JT0A 3BQ1A 1APLC 1RR7A 3GIMA 4GRIA 1B59A 3O3KA 4U88A 4ETSA 4A3IJ 3OR1C 5KFXA 1W0TA 3T1BA 3F8CA 2DU9A 4TV8F 4IEJA 4IKFA 4NYEA 2RAEA 3LA2A 5D5VB 2Z02A 4J9KA 2P81A 2F48A 5I5UA 2IW5A 3QP5A 1AA7A 2V5AA 4WX9A 1ZK8A 3R60A 3MFIA 1E2XA 2FE3A 4LLNA 2HS5A 2HDCA 2VE9A 4UUTA 2IA0A 3I71A 2MH9A 3HTUA 2H1LA 4C2TA 2CFOA 1ZGAA 4CICA 4NZNA 4RNOA 3WU0A 1B1BA 3ERED 4PDKA 3S14J 2AQ4A 3VWBA 3ZPLA 5IT9K 1WHUA 3BJOA 1N36H 1EA3A 2R7DA 4OAZA 1LNWA 4HNVA 4IX7A 1CQIB 1I7NA 3HO8A 2K86A 2XVCA 2AXTC 5FLXW 2FMAA 1GSAA 2V1NA 3HRUA 4HN2A 2W9BA 1BJTA 1ZHQA 5EZHA 5KT5A 3EUAA 3SYTA 2FBHA 3CUQB 3ZN0A 1WCMG 2DJIA 3HOWG 1TLHB 5TJJA 4GGGA 1NK3P 1N33H 3BQZA 1D0YA 4XBFA 1VS0A 3C0FB 4AIJA 1FIPA 1HKSA 4XSXF 2V4QA 2W00A 3KALA 2Z33A 4M74A 2ASLA 2YS9A 1SFOJ 5ICEA 1TWHJ 4Y33A 3K3VA 1HSJA 4DL7A 2F5FA 2HU9A 2A6EF 2QF7A 4FFPA 3ZQCA 3F8MA 2WTFA 4CUGA 3CLOA 2GQSA 2PVPA 2CQYA 2NVUB 3HOXJ 1JI8A 1WH7A 3PL8A 4BEHA 2R7RA 1VQ6I 1L2ZA 1SAUA 4CC5A 1K6YA 1WWXA 1LB2A 1B9MA 4HX7A 1MBJA 3JAMW 2KP6A 4IRCA 4KHPH 1TWFA 1MJAA 2DYRH 5LL6b 5IP6A 2RQQA 4O4LF 4JI0H 1I3QA 2VJJA 4BXUA 1R4MB 2UXNA 2X1EA 4DV6H 2CQQA 1KYZA 4TM5A 1RYSA 4PZJA 1G3TA 3CCSI 5EG0A 5DM6F 3FMAA 2VI6A 3OUUA 2EQRA 3DBLB 1ZYRF 1QZYA 4PSXA 2W7NA 3DPUA 3KEOA 2W6MA 4EQ5A 3ZRGA 3I59A 4DJAA 3R4KA 2ISZA 3OYHA 2ID3A 2K5CA 4NQWB 3HL2A 5IP7J 2ZJPF 2FP4B 3WWIA 3C2GA 3FM5A 4O3PA 1GYFA 2ZMEC 4DGWB 3A01A 4F4WA 2DPIA 2HZTA 1D0XA 3B6CA 4DV7H 1U9NA 3M3YJ 2R6FA 1P4XA 1V5EA 2JA6G 4BQQA 4QIWA 3BG7A 5EWGA 1Z05A 5CVVA 3S3NA 1D8KA 1BC8C 4IR9A 4HLYA 4YHHH 4FE4A 4L9NA 4C2MA 2BHYA 1TWCJ 2DABA 2EJ3A 4Q43A 4IRKA 1ZELA 4M3EA 3T9EA 3OHAA 2Q0OA 4IRGA 4MA0A 4HF1A 3LFUA 1IAWA 1M6VA 2W6NA 4MAMA 2DT5A 4P1WA 3TIIA 2NVXJ 1SD6A 5CVJA 5I5VA 2UUCH 3JR9A 5DGBA 1QU3A 3Q0UA 4XMYA 4RB2C 3CCRI 2K9MA 4FGRA 4A2AA 3TQTA 2M8GX 2FEZA 2X85A 1DPRA 3RGZA 3CDLA 2YCHA 2F4VH 4N9IA 4BE2A 3W2WA 1H88C 2KQRA 3OYNA 2IJLA 4ZYHA 2AHQA 3ZQQA 3OYMA 4WF2A 5GPCA 3IH4A 1S5LC 5DYMA 1I2KA 4J00A 3E5XA 1RK6A 2A5YB 2XKPA 1GV2A 4EEYA 4XRSG 1KJIA 1FZPB 4YQWA 1S7EA 1ZAOA 4M73A 1Z6RA 4PCQA 3ZMDA 4A3GG 2LP0A 4O2BF 2GQQA 2GPSA 3QP6A 2BE5F 2JA7A 3BTLA 4DR1H 1L0OC 2CUZA 1FSHA 3LQQA 2XPUA 4M3FA 4RLFA 4IHTA 3HOVG 1YFHA 4MO7A 1K79A 5HNFA 3HRSA 2X6YA 4A6DA 4Z6YA 1E3OC 1B72A 3CP2A 3OUZA 1F36A 2X6XA 4QLCU 2G9WA 1FMWA 1BN5A 4O6JA 4HX8A 3K70C 3D0SA 1MGTA 1RC9A 3BCBA 3SZPA 4DR2H 4NLGA 1ZTRA 1WI9A 1W36C 1XC5A 3P9IA 4XSZF 3TO6A 4TV7A 5L1JA 1Z2NX 3OMYA 3H0DA 2W9CB 4ESJA 3I12A 2V79A 1D3YA 2CRGA 1V3FA 1OYWA 2ZKZA 2GOXB 2MG4A 3H92A 3QOEA 2K40A 1XN7A 2LNBA 4A5NA 4KT5C 4QSHA 2E2IJ 2XAFA 2E5LH 1JJ8C 3R5HA 1HXDA 3LSIA 4GYGA 4ZZDA 1I39A 3HOVJ 2AGPA 5J40A 1BM9A 1J0RA 2FXAA 3V8KA 3T9CA 2VASA 2R7QA 5KFMA 4BDZA 4BQOA 1R1UA 5KCMA 3LSTA 3CDIA 2EZIA 3KCCA 2XAJA 3RCOA 2EB7A 4NXNH 3OR2C 4KN4X 3NC0B 4ECTA 3CCUI 1FIAA 3TGNA 2DPJA 1LDJA 2UXXA 3V8LA 4XYMB 5FJ8J 1K61A 4HYEA 3RQ4A 3UNGC 4A93J 2OQGA 4XOPA 2BY1A 2Z3YA 2V4RA 4BY7G 1E4EB 2NS0A 4LFCH 4Z2YA 5E18F 4QW8A 2BQUA 2M4KA 1KJQA 4BS9A 2OZ6A 1WJAA 2H6BA 4XN0A 2X6OA 4N9HA 2VKVA 5KK1A 5L3BA 2E5ZA 1DU6A 1YE9A 4MEYF 3W6JB 4R7RA 3D5RC 4OU0A 2AGOA 2WV1A 4JV2A 2OZUA 4EGYA 1R7JA 4DQ2A 3BDDA 2XGXA 4BHCA 1OYYA 2DK8A 3ZP5A 2DMPA 3LSMA 2FK3A 1UC8A 4ECXA 2BVMA 3BJ6A 4I09A 3I55I 5KG4A 2JA8G 1SFOA 1TWHA 2FKLA 2WTEA 4A3JJ 3E97A 5C5JA 3JRCA 4Q48A 1MW7A 1HSTA 1OCZH 3KP2A 5D4SA 1OR7C 4O7WA 2EBIA 4BY7J 1XSVA 4BYYA 1HW5A 2OA4A 3K1NA 2FPGB 2EH3A 3OSFA 5KG5A 2GA1A 5EGOA 3CUOA 3E5QA 1EH6A 4RGRA 4XIDA 1RR8C 3QWUA 5HNEA 3SNOA 4JI6H 3V6HA 3PQJA 5DD4A 2QBYB 2STTA 1UHSA 1GT0C 4KISA 3KAJA 3PR5B 3KAKA 4AM3A 2JRMA 3VSLA 2E60A 1I2LA 4XZ3B 2XB5A 2DA6A 4B47A 1S29A 1FY7A 2HOAA 4LIUA 2M3AA 2L9VA 4XLFA 5CVRA 5I5YA 4FT8A 1J5YA 1SVMA 4DBQA 2JA8J 3ABLH 4JV5H 1H0MA 3MZ8A 3ZQHA 4JI2H 3HOUJ 3GV5B 3K5HA 1RNLA 1HCRA 3ECOA 3DFGA 3HBLA 2JA5J 1Y1VG 1E0EA 5JQWA 2CH0A 5DCMB 4L9VA 2JPCA 3HOWJ 1T94A 1W7PD 2VQFH 1U8RA 2XAHA 1I94H 1O3SA 3GTQJ 2JMWA 2QQ9A 1M0TA 2NUAB 2QWWA 4CCLA 3PW4A 3FISA 1EKVA 1J5EH 2H6CA 2XGCA 4JX6A 2EIKH 3IUOA 3G6EI 4DL4A 3QWLA 3TP0A 2L7FP 4HF0A 1ZR4A 1Y1WJ 1TWCA 4U6PA 5FLMG 3PR4A 3BPVA 1BNCA 3G8CA 3QPTA 4BWSC 4EBCA 3RBEA 2MC3A 1MMGA 1NK2P 2NRAC 2NVXA 4V2FA 5E8GA 5FD5A 3PFFA 3RAQA 2VQEH 3K69A 4TQRA 4PJ0C 3J7AO 2LLKA 4NQWA 2L5QA 2ZM6H 4B1RA 3V7RA 2HYGD 2RGVA 3VOEA 3KETA 3RKYA 6PAXA 1JUPA 2I80A 3DV8A 3LP8A 1KONA 3RBDA 2IRFG 4DZPA 5DMXA 4UUSB 3MZYA 1TP4A 5A2QZ 1VQLI 2O8XA 5C3EG 3HIFA 2R85A 3GCMA 4CCKA 3J7ZI 1HW2A 1T36A 2V58A 3LQSA 4ZYGA 2P4WA 4OIQF 1FTTA 3BABA 1R5GA 1YX5A 2CW8A 3Q0WA 4JQFA 3FZVA 1WR2A 1A35A 3L00A 3TOBA 4B3AA 3JSLA 2MBFA 1OLTA 2CSOA 4YIFA 4LITA 4FX4A 3HPHA 4BE1A 2B9SA 4HR7A 3MD2A 3GV7B 3L2WA 4YP3A 2H94A 1SEUA 1XX5A 3H20A 5IT3A 1OCPA 5LGTA 5M3MJ 1Z7UA 2WY8Q 3SE7A 5JVGF 2WYOA 1S9FA 1XGOA 4QTRA 1Z2OX 2DZDA 2W6OA 4YJ3F 1J75A 2A1HA 4NXMH 1SC7A 3RJ0A 1VQKI 5LBQA 4B48A 1Y56A 4RZQA 4HQMA 2K9LA 3KP4A 3FXMA 4ECZA 3ZMSA 1Z67A 4PDBA 4KT6A 2ESNA 3BG6A 4HNUA 3Q3SA 3K4JA 3BQYA 1GV5A 5F04A 1EH8A 3MEXA 4LG3A 3ASNH 4EM1A 2PMZN 2CNQA 2PJRB 2R7ZG 2CQKA 5E3MA 2JJ7A 4D9JA 1BA5A 2UUBH 2KKOA 2D5VA 2WB1N 5KFNA 2NNYA 2F5CA 3DF8A 2DODA 2XAGA 3GTPJ 4I02A 5DGAA 4FBUA 2LKSA 5DISC 1X1BA 5K7FA 3TDZC 3RV4A 3FIWA 1NHAA 2L0KA 1KQ9A 3KE2A 5JVDF 1CF7B 2VT3A 4EFEA 2MFZA 3I3LA 3L9FA 1J09A 1Q1VA 5KT7A 4DYRA 2X0SA 2XASA 3HJEA 2XF7A 1LEBA 1XDUA 3HXLA 3CMMA 2W9CA 4AYBN 5KFRA 2YZMA 5EWEA 5J1UA 2IGKA 2HPMA 1D5VA 3LQRA 4JK1X 2E7WA 2W48A 5ICCA 1ZG5A 2V9KA 3J80K 1V9PA 4FFNA 4ECYA 4A3FG 1TBXA 3KXYT 3C2HA 4GCVA 1W5TA 3A02A 4F55A 1XSDA 4ZI7F 1IXCA 2Y30A 3VPBA 4D1QA 4KA4A 5CVUA 4H0EA 4FU0A 3FXQA 2KRFA 3TY9A 3U9GA 4RAZA 2LFBA 3T54A 4RU9A 1SVOA 2Z99A 4E6NA 2CV1A 3P5JA 4YJ2F 1SFUA 1JDBB 3BROA 2VA3A 4E7ZA 1E3PA 2O3FA 1FP1D 1LEAA 4IRHA 2AGQA 4IZZA 3CMEI 1T0FA 1M1EB 4LK1F 3BZKA 3SHFA 4RBOA 1UC9A 4E7HA 4M9UA 2EIJH 5D8LB 1U5TA 3C2BA 1GSHA 2JT1A 1OWTA 4GLWA 1RK5A 1TTYA 3RB3A 4EJTA 4J0MA 1H9GA 2MLKA 4UVCA 2E35A 3H0GG 3JZIA 2W24A 2ESHA 1X1PA 1VQNI 4L5JA 5HS8A 1FX7A 3BTJA 1YW9A 4EFBA 5EWFA 2JEIA 4E70A 1S68A 4EJUA 3MN2A 4AVPA 4HV5A 1D1AA 4DW6A 1YOVB 2Z16A 2BVLA 2W57A 2A3SA 5TISC 5L1IA 1MBHA 2NOGA 1ZRDA 3BQ2A 4DV2H 3PVXA 3VEPA 2VR1A 4X62H 1F1ZA 1B9NA 1UAAA 3NARA 4WWCA 1LVKA 1NG6A 1P92A 1TQPA 1SEIA 1I1SA 3T5LA 2UVWA 4DYCA 3CF2A 2JA5A 3JZFA 2L4AA 3MMYB 3M4IA 4M9XA 1RESA 2RDJA 1EKPA 5ILSA 3BC8A 2QBYA 3DLAA 3CDHA 3GTQA 3RPQA 1LVAA 1BOBA 3W2VA 2QUFA 3C3WA 2CU7A 3G1LA 3CCEI 2E5NA 3GZ6A 2HWVA 1OYIA 1JKPC 4TQSA 2MW8A 2JVHA 3KEQA 1EJ9A 2KIFA 2K9QA 1Y1WA 1FJLA 1HNZH 3Q8RB 1B04A 5FLXK 2E1MB 2UV1A 1WH2A 2COIA 2I8DA 3U1KA 1GVDA 1O75A 4YFXF 5E1XA 2KDOA 5GAGJ 5H2FC 1IBMH 5L3EA 5C4JJ 5E25A 5T14A 1QBJA 2QA4I 2FPIB 5DCMA 4G7HF 2YZGA 1KJ8A 1S0NA 3N6RA 1HW1A 1TQIA 5ICFA 1HOMA 3HOZG 1ZARA 4FFLA 3RTXA 5JVLA 1OBGA 2COJA 2PMZE 4LF4H 5DUKA 4W97A 3WE2A 2ELKA 2K4JA 3OS2A 4C3IJ 4HW0A 3OIPA 5KG7A 1X9NA 2QKLB 2AO9A 3DQVC 4DR7H 4Q47A 3DEUA 1MIJA 2J5OA 4P9UA 2EA2A 4GYIA 4DYQA 4HG2A 4MEXF 2UUAH 5EDNA 5CM0A 4RZRA 5F1RA 4TVIA 5LMUH 3CUQC 5IYZF 2ASJA 4BUPA 1MKMA 2ZBKA 1ZKGA 4RA2A 5CVIA 3AX6A 4BEHB 1Z3XA 3VNNA 2HQNA 4V2GA 5LEKA 4O82A 4AYBE 2O8KA 4WBNF 2Y9YA 3F6OA 4A5MA 3MJFA 2OH2A 1Y39A 3IG0A 4LFAH 3RV3A 3L09A 1MD0A 3ZQIA 4HX4A 2PEXA 2VQDA 3QAHA 3T9AA 5KFJA 2RF4A 1HA8A 4QPOA 1UZCA 5EG0B 4R79A 3IV5A 1VBHA 1AN7A 3M8JA 3GYHX 3GV8B 1POGA 1UG2A 3VSKA 2OAZA 3RIZA 3V4SA 3TOAA 3CQZJ 3VB2A 1O3RA 2DMNA 3KREA 2H09A 3H3UA 4CHUA 2FNAA 2XGQA 3EUKL 5HODA 1JHHA 2STWA 2A61A 2G7UA 2C22A 5LD2C 1IN8A 5B1BH 2D1HA 2XB0X 2ZCWA 3GTPA 4C3HJ 4ED8A 3A01B 5CLSA 1IOWA 2ZDGA 3KP7A 5D1PA 4A3EG 2M8EA 4I4TF 1I3QJ 4U0WA 4J9SA 4HBLA 2C00A 3CCVI 2D2WA 3JZ6A 2HXIA 3QOPA 2R7MA 4UUVA 1JDEA 5FLVA 3RGXA 2O7OA 3T9FA 3EPGA 4O3RA 5I60A 1ZH5A 1Y14B 3NWTA 2XGDA 4CZZA 5H20A 3KP6A 3L2QA 1AKHA 2PJRA 4OIOF 5DGHA 3DPLC 1VFCA 3HG9A 5CPRB 1RKWA 5FR9A 5FNVF 4HF2A 4I99C 4QIWN 3A0HC 2DA4A 3TIGA 4N0BA 1CKNB 3NWSA 4LJZF 1HKQA 4UB6C 2ZJRF 1UHMA 2ECBA 4A2BA 1OISA 2M0MA 4FFMA 3UZBA 3OSGA 2Q8KA 3BG5A 3OL3A 4S0HB 5ICGA 2Y9ZA 4O3SA 4OINF 5EJCA 2DJNA 2KZVA 4PGGA 4O3QA 2EWNA 1QZEA 1T95A 4IOAF 2CFMA 4XLCA 3GIPA 2BR0A 3JTGA 3G6VA 1R58A 3S93A 3GIQA 1N56A 1IN5A 2Q2EA 3D5SC 3CC4I 1HF0A 5I5TA 1B6AA 1ZHSA 3QZ8A 3SXYA 1RUNA 1XMQH 2OC6A 1VQMI 4JI1H 4DR6H 2WA0A 4YELA 1B72B 1FKAH 4FX0A 4AC0A 3VPCA 4DRFA 5KFBA 1R00A 1VQ7I 3H3VK 4B4CA 3CLQA 4UY8I 1FSEA 2I5UA 2Z04A 5JH7F 5C44G 3GTJJ 1S0OA 1EH7A 3CO7C 4TUYF 2LBFA 4I01A 4O84A 1ETKA 1DPUA 2QVOA 5BWXA 4A3MG 2YWVA 2LTPA 4EBDA 2DA5A 3ZXSA 1A36A 1T3NA 4FS1A 4OIRF 1FVIA 1BIBA 2HXOA 1NG7A 4LF7H 4IRIA 4YG2F 1ERDA 4NC7A 3CMYA 1BR2A 3WU2C 1YIJI 2O0YA 2P0WA 4PK4A 3V7CA 3HM5A 3IKTA 2QQ8A 5D4RA 1QQIA 2EJ2A 3QODA 2NU6B 5C44J 1QVUA 1B6SA 1BJAA 5KFDA 4Q0YA 5LLQA 5KFEA 2XRLA 1G8XA 2Q1ZB 3O8HA 4E7IA 2Y0SA 4RUCA 3PSFA 2VKHA 2DFIA 2ZSIB 4GFBA 2R7XA 3CCQI 4G9YA 1N32H 4M72A 1R5HA 2QENA 4RMNA 3TMOA 3L2RA 4A3MJ 2DPDA 4Q5SF 4UCVA 5EOYA 2QSHX 4WK8F 2DQLA 4HDVA 1K78A 2KJCA 1XG1A 1ZHFA 1P7IA 1MSEC 5D5UB 2IP2A 2ZXHA 2DOEA 3UFXB 3NRVA 1JE8A 1KU7A 2GXAA 1YI2I 1PJRA 3HGGA 1FOXA 3IWFA 1JXSA 3FF5A 2XGEA 4A0YA 1R49A 1GXQA 3DXJF 2HDDA 3M9MB 3BR3A 1FLIA 3HSRA 2NVTJ 4LH6A 2D1VA 1T08B 1I7LA 4MTDA 4NDLA 3A0BC 3BG9A 1T39A 3FDSA 4JI8H 3BR6A 4RAYA 4R8HA 2XKOA 1T8IA 2AXLA 5E17F 3Q8PB 4F4ZA 2A07F 2RQPA 1MSFC 2HGXA 1E3HA 3FKJA 2NU9B 5EGOB 1D0ZA 2M5WA 5B5EC 3COAC 4ZTFA 3MWDA 1S10A 2COBA 1YO5C 1R23A 3PNVA 1JKJB 3NAUA 3HC7A 4A69C 2ZO4A 4IHJF 2ZXWH 2X51A 4GC7A 3PO3G 1KYWA 3K1MA 2H27A 4WXCA 4DLKA 4BGDA 4I6ZA 2LSOA 3KP3A 2MABA 2DLNA 5BYAA 2DQRA 2OTLI 3H3VH 2FBIA 4Y7NJ 2UU9H 2VQLA 4CYDA 4QIWE 1W0UA 3CQZA 1R1VA 1XCBA 4QWDA 3HHHA 2PFBA 2LC2A 4G3IA 4IAJA 3QYFA 3OOUA 2ZDHA 3ZQLA 4BBRG 2VQGA 4HLXA 4RB0A 3HOTA 4NUBA 3G8DA 2EA4A 4O7LA 1R36A 3U9TA 5KHDA 1JJ6C 5M3FJ 3DAAA 2VXDA 3N8DA 1WCMJ 2KSWA 1QA6A 3BR5A 1JX4A 2CUFA 2W84A 3WO1A 3PO3J 4GLXA 4BXXG 4LF6H 3CESA 3PUBA 4RNMA 1Q1HA 3I53A 3SEQA 4YEJA 2FMLA 2QSGX 2JN6A 3CJQB 1KQ8A 1IXSB 2L54A 3BR1A 2M9HA 4XYLB 1WH5A 4EGQA 4LMYA 1JGGA 3M9OB 4DZJA 3DPTA 3AL0B 5DQGA 4ZHQF 1P2FA 3G71I 4BNCA 1D8JA 3S1NJ 1FOKA 2MH2A 3DP7A 3V6KA 1AWCA 1AU7A 3FKIG 4BBRJ 2RNJA 5KFWA 4O7NA 2P5LC 1BI2A 5TRDA 5IYBG 4X65H 1VKZA 2YPRA 4AUXA 1MMNA 1IYEA 4NZOA 4EYIB 1MNEA 2A6HF 3ZQFA 2R7WA 2VC1A 2H8RA 1QPIA 2YL2A 3JRAA 1WI3A 3SJMA 1SMTA 3LSHA 2PJPA 2IA2A 4RNNA 3KHHA 3WO0A 4XKWA 4RLQA 5KG6A 2E1CA 2LK2A 2LRDA 2VLAA 2I87A 4QW9A 1OCOH 4MHGA 1S7OA 5BPIA 4IRDA 1B33N 3PW0A 1F43A 3K7AJ 2EFWA 2TRTA 5FROA 2VOBA 4Q45A 4YR0A 3IRRA 3OOPA 4XLPF 1U3EM 3ERMA 4M9ZA 4YB8B 2OUMA 1MH3A 4RDUA 5IYBJ 3RFCA 1MBGA 2JA6J 5IYCG 4QWBA 3T0YA 3A2KA 2BQ3A 3QYEA 5E3NA 5J47A 1CKNA 1K1QA 2Y75A 5E1ZB 1IN7A 1MNDA 1EZ1A 3VODA 3GTJA 2UVRA 5DQIA 2Z2SB 2MD0A 4KNYA 1A48A 4A3BG 2AQFA 2Y0MA 2CQNA 2XCPA 3MZHA 4XR6A 5HOOA 4CKCA 2CG4A 4MV7A 1XDNA 5LMNH 3GWZA 5GONF 4O7ZA 2YUSA 2X1CA 4Q8EA 1QGPA 2E7XA 3I4MG 2IS6A 1KQ0A 4DL3A 1AOYA 2IGOA 2QQBA 4E4TA 5EF6A 3KTMA 4CE5A 3LWBA 4GKJH 2CQXA 5DTDA 4HDUA 4ECSA 1Z6TA 4OIPF 4YBZB 2IVMA 3ABKH 3S8PA 2J9GA 2GWRA 1RJQA 3MKZA 4LK0F 1OBDA 2YRXA 1BGWA 1N77A 3IAM2 4U0VA 1UFMA 5M5YJ 3JSNA 3E0JB 1DQUA 4LIVA 2EV5A 1FNNA 1X1AA 2F4MB 4LGWA 1MDMA 3EUHA 1JKQC 1WGXA 4A3BJ 3FBIB 2W6ZA 1YITI 4A3GJ 3WTVC 3U1DA 5CR5A 3I4PA 1VQ9I 1EUDB 1XMOH 3KZZA 4KICA 3TY8A 3I4MJ 2YX4A 3B73A 4RAFA 2GIVA 3WWJA 4J9RA 4GC6A 2HDWA 1HR0H 2O5RA 5B1AH 2BV6A 3LSGA 4KN7X 1VQPI 1S9HA 5CA0F 1V51A 3ORQA 3KFWX 4CHIA 4DBRA 2OQRA 1LE8B 3KHLA 2IA1A 3HHGA 2KRCA 2ADUA 2BY0A 4J9PA 4BL0B 2EV6A 2XHKA 3RB0A 3ZMZA 1A6IA 1R5ID 2DWCA 2M0CA 2W7PA 4PWQA 1ONVA 5HBRB 1KU9A 4KYWA 2X6WA 3RF2A 2VQCA 1IBLH 1U5TB 3H35A 4RUAA 2ZFUA 3GEZA 2HIXA 3U54A 4BQAA 4ZQIA 2R4GA 2BQRA 3BR2A 4EJWA 2R8GA 2EIYA 4LLGF 1SMYF 4D5FA 1TZLA 4HRIA 3BCAA 2R82A 5KFOA 3BJAA 4O3NA 4F7ZA 5DS9A 4BJTA 4B3TH 2W85A 4O2AF 3LSKA 4XONA 1KU3A 2QM3A 4MGRA 1J59A 2YYAA 2VIXA 3WTUC 1IW7F 2LREA 5LEJA 2PN6A 3FDYA 3JSPA 4LSXA 3W2AA 2ATLA 4Q44A 1Z77A 3L2UA 1REPC 2GA2A 1W7PA 3TW6A 2KMUA 2P5KA 5GTHC 1LDKB 3KEYA 1PDNC 3DEWA 2GIZA 1DV2A 4LLLA 3I54A 4CZCA 3TL4X 1CQJB 2CGPA 5KFTA 1IC8A 3X2QH 2L7KA 5JHFA 3PUFA 1I1GA 3N44B 2FNPA 4S04A 1USTA 2PN1A 3TQ1A 3N42B 5L9XA 4F4YA 2LD5A 4B3MH 3W6KB 3CCYA 3T8RA 5JUMA 2MGQA 3KX2A 3MKWB 1V5GA 1OCCH 1T98A 1WCMA 2DA7A 2K9SA 4E4HA 4UXNA 2EV0A 5K5QA 5IP9G 2HOEA 5HV6A 4ANJA 4B09A 2IBKA 2HEOA 1V4YA 3ULQB 2GPWA 3OYKA 2MYSA 5BMZA 4DQNA 2CZGA 3K4KA 5DEQA 2JEJA 1SD4A 2MLGA 4UHTA 1F9NA 3T5JA 1HQCA 5KNLA 2TCTA 1HNXH 3ZQ7A 2JK3A 1TT0A 5GAHJ 5FB2A 5KFIA 2E1MC 1DU0A 5IWAH 3RKWA 5J4YA 4MNUA 1LJ9A 1BIAA 2BW3B 2HNHA 3RKQA 3N4MA 2VUGA 5F27A 2P6SA 2PMHA 5IP9J 4CCNA 2XAUA 4ZTJA 3OIQA 2QK4A 4DUZH 4Y17A 2CFXA 2CW0F 5LGNA 1TWGA 2OF7A 2JQ7A 2DOAA 2V9PA 2HHFA 4UCOA 5AIQA 2K02A 1Y1VJ 3GTOA 2JEFA 4CKBA 3E5NA 1EHIA 4MIMA 3U2RA 3BTCA 2YU9J 5GADJ 5KFFA 3OSPA 2LOOA 4J9NA 2B63G 2WAEA 4FETA 3OTOH 2FB9A 2JA6A 2ZDQA 4B3XA 4I0AA 5DV5A 4EATA 3HKZA 1G2HA 1VI0A 2R5YA 2R7KA 2KL4A 1CGPA 3LA7A 2VUMG 5FLMJ 1GVJA 2R3SA 5J6XA 4E7SA 3EPZA 3GLXA 2HOTA 2W6PA 1S7AA 2UWMA 4OX9H 2IS1A 5C1OA 1OMIA 2I10A 3T7AA 5KFUA 1KUTA 4R8UA 2JRTA 2NU7B 1BI3A 1X3ZB 3S3MA 1GGOA 4S05A 2W25A 2FOWA 2HR3A 3RZDJ 3HEFA 2JTVA 5FKMA 4ECQA 2BHZA 1MNMC 5AIPA 2GM4A 1TQMA 1J7KA 5C3EJ 3GW2A 3KPHA 3OYFA 4I50F 1IZ1A 3K4MA 5EEHA 2LY1A 1U8BA 1P4AA 4C9YA 2WE6A 2KHMA 4IVNA 4ZDPA 3S2HJ 3CMAI 3MFHA 4BAYA 4AU7A 2LKXA 2OCEA 1FJGH 5IOYA 4XRSA 4NC8A 4ZYEA 1N48A 4XORA 1YX3A 1HNWH 2RGRA 3K9TA 4NBQA 2OLSA 4E7JA 2L9NA 3BJYA 3OWTA 4AVZA 2MC4A 1AKHB 2X5RA 3REOA 2CKZB 4JOMA 3BQ0A 4ED6A 3RKXA 4PJMA 1KA8A 1FYKA 5C1PA 3FXOA 2DFEA 3H5NA 3R5FA 1O4XA 2LDUA 1RYRA 1PUFA 3CP8A 2DTZA 3H4DA 2NVYJ 5I5XA 2ZNZA 4LB6B 5KFKA 1UCRA 1K7AA 2EILH 3LMMA 4UVBA 3HUGA 3PW7A 1STZA 3KYCB 2CV0A 5BPDA 5BWWA 5C4XG 4KIBA 2C2DA 1X3UA 2LH9A 2NXNB 3RQIA 2YS6A 1PK8A 1ULZA 3N43B 5C8YF 2QYZA 2R7ZJ 5L1LA 4ZC3A 2Q2EB 2LY2A 3F8NA 5D8DA 2M45A 4EYHB 1S03G 1I1KA 5GPAA 3S3OA 2XSJC 4E7LA 2BXYA 2ZJ2A 1ZLKA 3F3XA 1VTNC 5DG7A 2QQAA 1LPQA 4XL9A 4JI7H 3GX4X 2HG8A 3J81Z 1LE8A 2BYVE 2EK5A 2AQEA 4AD9A 3L2CA 2W6QA 4E7KA 5C4XJ 1FMVA 4EJVA 4F91B 3AG3H 3R0AA 5FKLA 2JA2A 2LBFB 3JRGA 1O7FA 5DLFA 2VJIA 3G6XA 2NOJB 1R22A 4A3FJ 4C5BA 2PLYA 4FHTA 5K5RA 3UYYA 1B8IA 1WZ2A 4AQYH 5DQHA 3L1PA 4X66H 3TDUC 3V7SA 3PIOF 1O7LA 1IV8A 4ZJZA 2XPWA 4XLHA 4LOCA 4X1EA 4DV1H 3HOYG 4KIFA 2VC0A 3JCUC 1Z21A 3V6JA 5FFXA 1BOAA 3M1EA 3MKYB 4C5CA 3OYCA 4QWAA 4CGZA 1I6HJ 2VODA 1RPWA 2GOMA 5BR8H 4D5CA 3FMSA 4C3JJ 2L9RA 3V42A 4FCYA 2M30A 3F8FA 3SZGA 5D5XB 2R84A 2KIQA 2IP4A 3BOQA 3PNYA 4D0PA 1XNQH 3AFHA 4O4IF 2AU0A 5GP9A 3QQAA 2VN2A 1HDPA 1NTCA 2K27A 1U78A 3E5UA 4L1KA 3M8FA 1K78B 1A0IA 3BACA 2R7VA 3OSNA 1TL8A 4HQ6A 3HOYJ 1PP7U 1BJZA 3H0GJ 5L3FA 2P0AA 4IZOA 3OS1A 3PJRA 4DIMA 2DAAA 2X9DA 1BXRA 5DG9A 5BOXA 1VF9A 3DTGA 2PQ8A 4ASNA 3E6BA 4NHJA 4OMYA 2MD5A 5BQTA 4JV0A 2Q7DA 5BYBA 3MWMA 4HV6A 1HLVA 5KFAA 3MR3A 3N05A 1M7JA 4UV9A 2QZ8A 2X1DA 3AG1H 3ZQGA 2O03A 1ORKA 3K4NA 4OOIA 3S1QJ 1W96A 4O7RA 4EG0A 2CUJA 3T5XA 2F5VA 3DEEA 1Y1VA 2NVQJ 3IHUA 1P7JA 2VJ5A 1K1SA 1LUJB 3S24A 2YX7A 3JRBA 3V4ZA 2YU9A 4MTEA 3K4CA 3ETHA 1YJ9I 2GXGA 1Z2PX 4HSRA 2WDTA 3GLLA 4MV8A 3L7WA 2L4MA 1RJRA 4UCSA 4A12A 3LMLA 4DL5A 2BW3A 2BY2A 3WTZA 2HVQA 4HSTA 3K0LA 1H89C 2IGMA 4P9FA 2R92G 2M7BA 3BTIA 4JI4H 4I2OA 5IT9Z 3OHBA 4Y15A 3TINA 1PUEE 5LHIA 2HGCA 4ZZLA 2XCAA 1OQYA 2LR8A 1S8NA 4M9SA 5L3DA 5JVTA 1K6OA 1BL0A 1OCTC 4O3MA 1DP3A 4EJOA 3KHRA 4HAMA 4NC6A 4F50A 3U55A 2R87A 2UVVA 5L3CA 2EJRA 1T33A 2HOSA 4M6VA 1G3YA 2QEXI 3DF7A 2DIKA 2WADA 2B63A 3HOZJ 1B6RA 2XC9A 4EM0B 1GHCA 2QGUA 5DCFA 4U7DA 4HEA2 3VPRA 4IO9F 4YAKB 1D1BA 1GSOA 1VAJA 1RZ4A 2ZMEA 4XLEA 4D7NA 5F9NA 4O7VA 2WV0A 5A2QK 2R92J 4A3DG 3TY5A 3IH3A 2XF6A 1Y0UA 3SZTA 1A04A 1I5ZA 1X1DA 4FE7A 2Y69H 1OJLA 1XDSA 4FASD 2HJWA 1XCVA 1Z7LA 3H5RA 1IF1A 2IT0A 1A3GA 4IL6C 2JPBA 2LKPA 4QWCA 1G3WA 1XSXA 4J19A 1D1CA 3F21A 5DAAA 1WFXA 4WHXA 4PBCA 1D5YA 3UZOA 5KFCA 1TT5B 1WJCA 2PG4A 4LFUA 1X2NA 3RYPA 1YS7A 3TEDA 1KT8A 3MCZA 3ZMUA 1IV6A 1ZRCA 5ERIA 1W4MA 2NVYA 2W8LA 3AL0C 4U87A 5DDGA 5D1OB 2ME0A 2E1NA 4A3DJ 4LFBH 1IN6A 3NBYB 2QKMB 3WG9A 1IRFA 1EV7A 3F23A 3CJRB 3LSJA 4R1HA 1YRNA 2IS4A 2JSPA 4YR2A 3R5XA 1T6SA 1JKRC 3TBIA 5K3WA 3Q2OA 4ED7A 2OTJI 3GZNB 3C1DA 4JYAH 3QU6A 3R61A 4KJZA 4L5IA 3LSRA 2R7ZA 1I1LA 4A6EA 3W6VA 1G4DA 3K4LA 1A5JA 2J5PA 1YLFA 2K85A 1NH3A 3GBGA 1DV1A 2FRHA 2RVCA 5K1YA 4YFNF 4J9LA 2ZNYA 4A3EJ 1GUUA 4EMSA 3GFIA 3CCJI 1ETWA 4HQEA 1HKTA 1N34H 5KKNB 1IUFA 3KP5A 3LAPA 1MJ9A 2DCEA 1V55H 2WAQE 1UNNC 4ECUA 2A68F 5LGUA 2FPPB 5E3LA 1W5SA 1SD7A 1VQ5I 2HVSA 4AIKA 3FXRA 3GIKA 2P5VA 1TWAJ 5JFRA 1H9TA 1IO2A 2R93G 5F0HA 4MV4A 2QYOA 3ROUA 4B8XA 3QRFF 5JLWA 2EFOA 2UXBH 1XGSA 2R0QC 4HOBA 2R7UA 1TAEA 2CYYA 4E6KG 4ENNA 2Y0SE 4KIGA 4LD5A 2Z5UA 1RKTA 2HI3A 3ELKA 4DV4H 3EETA 1BR4A 1USSA 2RN7A 4XM3A 3WTTC 4M6XA 2JWTA 4UVAA 3QU3A 2DYSH 1BI0A 2CMPA 2W70A 1R71A 1KGSA 4YAJB 2NU8B 2DT7B 3SFZA 5FO5A 5IYDG 3U0GA 4JI5H 1UB9A 2Y4RA 1MDMB 5M5WJ 3T99A 3K2AA 2J6UA 5J1RA 5GAEJ 3P9CA 4ZDOA 2JA7G 4JX4A 2EINH 1KTAA 4QWEA 5DGIA 4ED3A 3PW2A 5CJ9A 3M07A 4I76A 1IDYA 2LF8A 2X0LA 4YY3H 1FT9A 1WRVA 3L4KA 4DL2A 2UXCH 3K70D 1T56A 1KC7A 4MV9A 1SFXA 2E36A 2WAQA 1W36D 4V19K 5LP6F 3H0GA 3A4CA 2XUBA 3Q1KA 4G8XA 2E2JJ 5KG1A 4IHYA 3UQ8A 1BBYA 3E1SA 2E19A 5J3LA 2QB5A 4Y13A 2QCOA 3SQNA 5IYDJ 4PFOA 5IY5H 1ZN2A 3FK6A 1GXPA 3V4GA 4IR1A 1I3AA 5BMVF 3W1BA 5D6EA 3RDIA 4CCOA 2F5EA 5KAFC 4A3IG 2UUZA 1Y0NA 4BQNA 3LULA 4KDPA 4G6DA 5LOVF 1UG0A 2P7CB 3FXUA 3CD6I 3S32A 3W1GA 5KFZA 3QFFA 5FRNA 5F64A 1DUXC 5JQGF 1K83A 3ECHA 5F08A 4A3CG 2LG4A 1GDTA 1TA8A 3BA8A 3PW5A 2OD5A 2VKDA 3PFIA 1X2MA 3H9JA 2XROA 4CKEA 1Z91A 3BPXA 1T0FC 3I9V2 1YJWI 2RNGA 2EIMH 1MMSA 2NYXA 4J9OA 1IXRC 2GLOA 1U5TC 1UJ8A 3JRFA 3TP3A 5CAEB 3J7YJ 2F6CA 4UUGA 3WODF 5LXTF 3RR5A 5CQEA 4GXOA 4P55A 1IRXA 2CV2A 3OYGA 4RS8A 3E6DA 1W7PB 2DDAA 1SYXB 2HQ5A 1ZAUA 4DOZA 3HSFA 3GQCA 2CO5A 4O7TA 2UXDH 2W1OA 2SCUB 3BWGA 4JX5A 4W1UA 3K5IA 5KFYA 2DFHA 3E6MA 3T9DA 1XGMA 3IAS2 1JUMA 2DTRA 2YR2A 3GUDA 3MQ0A 3NQOA 2YU3A 4UCRA 4A3CJ 2CJJA 4G12A 3PO2G 3H1CA 3HZJA 2BOLA 2EFNA 1O57A 1VNDA 2FF4A 1ETOA 3KYDB 5KFVA 2FJ1A 1RUOA 4ENMA 2ZXIA 3ZOBA 3ETJA 1EF4A 5HLHA 2R8JA 2R92A 3EDPA 1CQTA 4M7EA 4CCJA 3GLKA 4BKXA 4CA0A 1P9QC 3E3VA 4XQFA 3F9KA 1JTYA 1MBKA 5HVQC 2C6YA 2R7FA 2K7LA 3HOXG 3T9BA 1UHWA 4IHXA 3LAJA 2A05A 2V4JC 1FPQA 3MVPA 1HDDC 3M9NB 4MQVA 1ITYA 5D6FA 3KLOA 4K6NA 3VFZA 3PQKA 4O7YA 3Q8QB 1CE8A 4A3KG 3DCFA 4ZDLA 1LFUP 3I64A 3PO2J 4OWRB 4ED0A 2E1OA 3HDDA 2UVUA 3WHCA 3WWHA 4ABZA 2B0LA 2H8WA 1XB4A 2M1BA 4L5EA 3TO9A 3E6CC 2GAUA 5FD6A 2YRWA 3GTKA 2HTJA 3TQNA 2E2HJ 2XDVA 2BGCA 2R8HA 2RV8A 5ILVA 3OYLA 2VXZA 5I47A 4A3LG 4PFPA 2R7NA 5HLGA 1S6LA 1XS9A 1K4TA 5CYVA 1C3OA 5IP7G 3GTLA 3H9GA 2HHFB 3FX3A 1ZETA 1UMQA 1I27A 5H6QA 3R6SA 5EZYF 5A2QW 2ALZA 5FPOA 2W8KA 2O61A 4GKKH 2YSRA 4PZ8A 3FK7A 2W9AA 5FKNA 1QZZA 2KDZA 3AG2H 4A3KJ 2GBYA 1SAXA 3V8JA 1QPMA 4HA8A 3C18A 1IUYA 1JXLA 4BHPA 2LVSA 2IBDA 4DR5H 4U0YA 3T8TA 2IGNA 2O6GE 4L0ZB 2R5YB 5D1OA 4BXXJ 3KHGA 3G6YA 3G3ZA 1BI1A 1BW5A 1IJWC 1SCUB 1E4GT 4ENJA 1MH4A 3MFKA 3RIRA 5J4VA 1P8LA 3CJTB 1TWAA 2J6SA 2E71A 4A3LJ 2COGA 1JKOC 1SD5A 4CYCA 3RI4A 1LKXA 1Y8RB 3M7GA 3M8EA 3R9RA 1TWGJ 1I50A 1IYDA 4O4JF 1G59A 1WJFA 1G3SA 2L7ZA 4R8UB 3H4BA 4EBEA 3GTOJ 3FKIJ 3RSNA 3AYHB 5BWUA 4IQJA 4EGJA 2YZLA 1XTAA 3FHNA 4PUSA 4ZYAA 4Y52J 3FWEA 3WTXC 4CSWA 1WQ2A 3ORRA 3LL7A 2XSDC 5KT6A 3FHZA 4ESBA 3HKZN 2ELHA 2VPLA 4BH9A 4UCUA 1S3JA 3RPUA 2X4HA 1T38A 3T5KA 2DOFA 2Y2ZA 5EEGA 2HVRA 4BDYA 4APMA 1WSCA 3HYIA 3CZ6A 3R0JA 2Y31A 3ABTA 1IOVA 2OU2A 2ODTX 1FOYA 4DUYH 2R93A 1V4RA 3G4SI 4A2UA 2Z1DA 5LRSA 3DTIA 3F6VA 3MAJA 3ZMTA 1XK5A 2KZGA 4LF5H 5KS8A 2R8IA 3CF5F 3OYJA 2V6EA 5LHHA 4L18B 3M4OJ 2DFFA 5JHUA 1T2KA 4BXFA 2IEKA 4JV1A 3DBRB 5FFZA 5IYCJ 4B43A 1PUFB 1O3TA 4ZOLF 4X64H 1OPCA 3WTSC 2R5ZA 5J2TF 3HUGB 2BBYA 3ZMVA 4KITB 1KU2A 1MJBA 4UV8A 4ME6A 4QJFA 4JI3H 4ON0A 1EUCB 4F4XA 2PBIA 3LNQA 4IOCF 5D5WB 4RGSA 3S2WA 1ACIA 3GB8B 3NUAA 1PVEA 3BG3A 4IHSA 2HKXA 3VA7A 3MR5A 5L1KA 4YR3A 3QQMA 4I55F 3EYYA 3RPUD 2KJBA 3S1MJ 2C35B 1FOWA 3N41B 2FLLA 2XV4S 2ZFWA 2M2EA 4K0KH 4CMFA 1OFCX 2VBWA 4BE0A 2N8GA 2VOPA 3J81W 4G6QA 3OIOA 2ZJQF 4II2A 3LA3A 3KYHC 2FK1A 5HLTA 3DKYA 5KVRA 3T5HA 4NB5A 1ZREA 3BP8A 5I5SA 4MV6A 2E34A 3HT5A 3J80Z 5EDWA 3W3CA 1AUXA 5FJ8G 4DV5H 2G0EA 2V26A 3IC7A 3GFJA 4XOTA 5F9LA 3IRQA 4A93G 3J7AK 4RGUA 2W71A 2XRNA 4GDFA 3BAAA 3WG7H 2IAIA 2V1DA 2DAOA 3M1CA 3LSPA 1V5FA 3FXLA 4NNJA 1R1TA 1B8IB 1ZQ7A 2WC2A 5K2MA 1Z3YA 1FYMA 2CS3A 2EPFA 2OV7A 3IWZA 5J8CA 3KYLA 4G7ZF 1IG7A 4C5AA 1KJJA 1EKFA 2WBMA 5TGTA 3S2DJ 1YS6A 4U7BA 4DNCA 1E17A 1SFKA 1VZ0A 4J01A 3TKYA 1B4AA 3ASOH 3F8BA 3PSIA 4K2EA 3VYRB 4I98B 1ZGWA 2HYFA 1FBSA 4A3JG 3IN5A 4J9MA 1DAAA 1J2XA 1LDDA 3HGYA 5KFSA 3AG4H 4D7MA 4CXFA 2FMYA 2JUCA 2NS8A 4GO1A 5E8IA 3IL2A 1JUSA 3GMEA 1OKRA 1FWZA 3B6AA 2FK2A 2R8KA 2ISYA 4I0BA 3F22A 1PX2A 3LFKA 2V9WA 1TNTA 3K10A 3PZPA 2Z9OA 2R7TA 5I5WA 2A6TA 5LHGA 4FM9A 1X3WB 5BWRA 1WJDA 5KFLA 5HDKA 1CS0A 2DBBA 3DU5A 3FBNB 2EJ0A 5CKTA 4FISA 2RDIA 2FU4A 1U6GA 3GTGJ 3NEUA 1ZRFA 3N6XA 3OV8A 4FE2A 4LG0B 3E7LA 3HRTA 4RM3A 1YYVA 3HRMA 4MFDA 4RB1A 4ENKA 4IWXA 2E2HA 2BY3A 1GLNA 2HKOA 3A1YA 1G2WA 1IRZA 3DWLE 2HZDA 4H4KC 3DKWA 1IRGA 3HOUG 3H3ZA 3HKZE 2HYJA 3ZR8X 2BXZA 2QSFX 2JA5G 2DDBA 2VL8A 4M3BA 3F0CA 4O83A 4EEQA 2OPTA 2VJ4A 3FMQA 2AS5F 5KX5F 1X4OA 2RREA 2JUGA 1RI7A 3SGIA 3L2PA 3CUQA 4EEFG 1Z9CA 2XAQA 4C2UA 2R7SA 3WU1B 4O4HF 4HYKA 2IMWP 5FKKA 5FLXZ 5HS7A 2X48A 5IT9W 2B7EA 2VBXA 5F0FA 2GZWA 3VYSB 1Y1WG 1ETYA 2EZHA 1ULYA 2GLTA 2VBYA 5CQGA 4CO8A 2EZLA 4F52A 5BS6A 4KFCA 5EYRA 5FRMA 3W5OA 3RB6A 2J6TA 3H9QA 2K3PA 3GFLA 2P7VB 1SVLA 2KLOA 1I6UA 3WGIA 2OWOA 3GDEA 1V54H 1IN4A 2DMUA 2ME6A 2UZKA 1QRYA 4HNTA 1R6RA 4DAAA 2VA2A 3MWEA 4LH7A 3GIIA 4RM2A 2FD5A 3FKIA 3GFMA 2DO7A 1WSUA 2XF5A 5KG3A 1X58A 2I8CA 4EVIA 4DR3H 4CCMA 3WGHA 1WPKA 2JZYA 3GIJA 3JAMZ 3OS0A 1ODDA 1JTXA 1N25A 1RETA 5LFAA 4O3OA 3RB4A 2MSYA 2VKEA 2ZMEB 4OAYA 1P6RA 1Z1DA 1IGNA 2LF7A 5E79C 4U7CA 4XK4A 4ED1A 1DIKA 4IQ4A 5DM7F 4G94A 3RUPA 2RKHA 2CQ7A 1QHHD 2DLLA 2RC4A 5KT3A 4BU2A 2OBPA 1ETVA 1WKMA 5H6RA 2VT2A 1S72I 3CSWA 4IXAA 2PMUA 5E1WA 5KFHA 2ZB9A 1U9OA 2A69F 3GZ5A 3I0TA 3K2ZA 3EPIA 2B63J 5HDNA 3OYEA 4FS2A 2P6TA 4I7HA 3Q9SA 2HDKA 2FSWA 2M4GA 2FLNA 1JHFA 1BW6A 1X19A 2DT6A 3DTEA 3DU6A 3TO7A 3GF2A 4ZH4F 3EQLF 3WTYC 2VUMJ 1Y8QB 1RRJA 3H40A 2KIUA 3BLYA 5K7HA 1TNSA 4WXHA 4YRVA 4O7SA 3PNTA 4A0ZA 3QZ7A 2DA1A 4B3RH 1ZLJA 4X6AJ 2L02A 3QPLA 1YRNB 2XC7A 5KAIC 4UNOA 2DI3A 3GVAA 3OY9A 4RB3C 2H1KA 1Y6IA 2ZSHB 2ECCA 4F3QA 5HLIA 3Q0VA 2OJED 1YQAA 9ANTA 1Z0XA 2M05A 4LF8H 2BZTA 2VPQA 1U0JA 4CH7A 2F4IA 2V9VA 3JRDA 4MV3A 2PX9A 3Q9VA 2EZKA 3ONQA 3N97A 3ZGKA 3D5LA 1XMKA 4Q4ZF 2R7OA 3HSEA 4WCGA 2VONA 3JRIA 3S15J 3GIDA 3G1OA 1JGSA 3IKVA 5KFQA 5L3GA 2ABJA 3FMRA 4IJAA 3OL4A 5E20A 4KMUX 4BY1G 2TDXA 4WD3A 4EV0A 2V6CA 2E2IA 4J9QA 3DBHB 5FPRA 1XGNA 2HTSA 1R9TJ 2VPRA 3MR6A 2KIMA 1VQ4I 2CW7A 2XGPA 3MR2A 2ICWG 4M3DA 4Y8VB 4LB5A 1VQOI 3HTSB 2FJZA 2BEOA 4HPQA 5ED4A 2V1XA 3O6BB 4BJ5C 1XD7A 4Q4CA 2A5WA 3CCMI 1ET0A 2FLPA 1YG2A 2DW4A 2V1UA 2FBKA 3ML6A 4XKBA 2HGSA 3NGDA 4RGXA 2IA6A 4IPAA 2DN0A 1YHQI 3S16J 4XKVA 1L3LA 1BR1A 2DK5A 2L01A 3T1HH 3GJXB 3CTAA 4F93B 4Q4DA 4XLNF 5H80A 1E4FT 5IPAA 2ID6A 4BY1J 4RCNA 4A0XA 4CMDA 1AHDP 1P16A 5CE8A 2HHHH 3H5AA 3AW8A 2G7HA 4JXUA 3RJPA 1X4PA 5F0CA 3D1NI 3BY6A 4IHWA 1O3QA 3G73A 5HNHA 4UCTA 3CC7I 2V7FA 4PJJA 1S97A 5J2UF 1ZGJA 2DA3A 3P9KA 2GXBA 2YW2A 2KRHA 5KFGA 5B3SH 1WVRA 3EUHC 4L9JA 1I1MA 3GTGA 1GLVA 4O86A 4O5VA 1ZG1A 3RYRA 3F72A 3O8GA 1XPXA 3C7JA 3I56I 4Y4RA 5F1JA 1OCRH 2XPVA 1ZQ3P 2CUEA 3ABUA 4UB8C 3A03A 5J1YA 5BWVA 3LOCA 1E4EA 2JSCA 5HS9A 1LFPA 5AONA 2ETHA 3AAFA 1WJBA 2ELJA 3VPDA 1C0WA 4YIRX 2VBZA 4IF4A 5FKOA 2KT0A 5EEAA 4DV3H 4LSAA 2HPIA 2XD4A 1W5CC 2RDPA 1XMAA 2WAQN 4JP0A 1W1WE 1YIOA 2PI0A 4XICA 2K9NA 4BJ6C 4PZ6A 2Q2UA 4LG0A 2ZGIA 3JRXA 4XN3A 1KJ9A 3S17J 1LQ1A 2HIVA 4ECVA 3H36A 3GXOA 3WGGA 5KG0A 2W7OA 2Y0SN 3OYIA 1DDNA 2R7LA 4B44A 4X0GA 3J7AY 1PYVA 5ILUA 5E3OA 3QPHA 4Y3OA 3MKLA 1QHGA 2IS2A 4FFOA 3FXJA 4P5OA 4XRFA 3Q5FA 4PSWA 4QPQA 2IXSA 3BZCA 3NBZB 3JRHA 4TV9F 4PGHA 3GTMJ 1K83J 4WXDA 1MZBA 1J9IA 2CNVA 4HZFA 4L9TA 3UR3C 4NZMA 2NS7A 2ZC2A 5KG2A 4PJLA 5BNGA 4XRMA 3WTWC 4MA5A 3EYIA 3HB9A 3DTKA 5IOZA 4YFKF 3K4BA 1DGSA 2IPQX 3SEZA 1HC8A 3K3PA 1M0WA 4DL6A 3CO6C 2ASDA 1MBEA 3U21A 2M7AA 5CA1F 3VOTA 1YJNI 1HBXG 2GQRA 2F4OB 3I4NG 4B3SH 2L2OA 1WJ5A 1FC3A 1ZG3A 1G6NA 3CJNA 1QO0D 2KISA 1N75A 1F4KA 3R23A 2L9SA 3L2VA 3JW4A 4MLOA 1QNTA 2LY9A 5D8KB 5K7ZA 4JUZA 2W9BB 2P8TA 2DPUA 2Y48A 3SDGA 4XKCA 2XIGA 3OYAA 3JREA 3U9SA 4DV0H 2VOOA 5CB4F 2JVGA 4JYKA 4N4OB 1PP8F 3WHBA 2DMTA 5BPHA 4IIJF 2WB1E 5GTIC 5DG8A 3RAXA 2VUMA 5M5XJ 3JAMK 3JTHA 4FFRA 1P4WA 3WNZA 4P96A 2F5DA 3GO5A 3KZYA 4RAGA 1YTYA 2FQ3A 4C30A 1A0GA 3I4NJ 3LWFA 4IWYA 5KFPA 4IHVA 4KUMA 2DXIA 4ZYDA 1ON2A 2FX0A 1TC3C 5K5OA 1FEXA 4M6YA 4UUSA 1K4SA 3WE3A 3P7NA 3DKXA 1C30A 3GILA 2C28A 3M9AA 4LF9H 1H8AC 4MQ9F 4ITVA 1JIHA 3DLLF 2OCCH 5KT2A 1FYLA 1ON1A 2F2EA 2M34A 3K1PA 3OYDA 4FBTA 1A9XA 4ECWA 1SFEA 3S1RJ 2D45A 2O9LA 1N78A 3JRWA 1S0MA 1VQ8I 3I59B 1IDZA 1R4NB 1WRJA 1R9TA 1XNRH 2PMZA 2LMDA 4CYCB 3KZIC 4G6TB 4M3GA 1A6QA 2K3FA 1LFBA 3GTLJ 5KT4A 3VMMA 1XMXA 2WB1A 5BPFA 2KPMA 3VDXA 4AWXB 2YZNA 2NAZA 3I5UA 1TWFJ 3RTRA
chains in the Genus database with same CATH topology
3C2HA 2KMUA 4DIQA 4F55A 1LDKB 3KEYA 2W82A 5FD6A 2MCTA 4D1QA 2XDVA 4CZCA 3TY9A 3TL4X 3OYLA 2VXZA 4RAZA 2L7KA 5JHFA 1MMDA 3QYBA 4E6NA 4PFPA 3N44B 1CKMA 2CV1A 4CC6A 3N42B 4AYBA 4B3MH 3H9GA 4E7ZA 2VPSA 2LYCA 3KX2A 3MKWB 1V5GA 2WY7Q 3SDBA 3PN1A 5A2QW 5FPOA 4IZZA 3CVZA 4E4HA 4PZ8A 4GKKH 1WJEA 4PZ7A 3K6GA 2VQHA 4ANJA 4E7HA 2WAFA 3T1YH 1DGRM 4PJNA 4DR5H 4XNFA 3OYKA 2IGNA 2MYSA 1UELB 5D1OA 2VB6A 1IBLH 3K4KA 4J0MA 2Q2TA 3HPGA 1E4GT 3G2BA 5KNLA 1HNXH 1P8LA 4DR4H 4EFBA 1TT0A 1LKXA 2E1MC 1IBKH 3VYUB 1S68A 4XLAA 5IWAH 1G59A 1WJFA 1D1AA 1DGWY 2Z16A 2BVLA 2W57A 3OYBA 2HNHA 2BW3B 3RSNA 2VUGA 4DV2H 2ZJTA 4IQJA 4UFZA 3FHNA 4X62H 4PUSA 4ZYAA 1UAAA 1LVKA 1NG6A 4CCNA 4CSWA 2XAUA 4ZTJA 1SEIA 3BA9A 3LL7A 3CF2A 3AKZA 3OIQA 2FUG2 4DUZH 3HOSA 3MMYB 2W4SA 3M4IA 4N4NB 2VPLA 4UCUA 3VYTB 3BC8A 3J80W 3DLAA 2DOAA 1X1CA 4UCOA 1BOBA 3W2VA 2HVRA 3PFYA 4BDYA 4APMA 3N40P 3CZ6A 2E5NA 3L4JA 2HQAA 4DUYH 2JVHA 2LOOA 2WAEA 4FETA 3OTOH 1HNZH 2Z1DA 1B04A 3DTIA 4B3XA 2E1MB 2UV1A 4EATA 1WH2A 1XK5A 2I8DA 3HKZA 4LF5H 3OYJA 2V6EA 1O75A 2KL4A 1MMAA 2KDOA 4BACA 4BXFA 1IBMH 4B43A 4X64H 4E7SA 3EPZA 2UWMA 4OX9H 2IS1A 3HUGB 4KITB 3ZCOA 4JI3H 4F92B 3RTXA 3GB8B 2WE6A 1CKOA 4LF4H 3S3MA 3OS2A 3RPUD 4II3A 3EYYA 3IP4B 3OIPA 1X9NA 2QKLB 3DQVC 4DR7H 3N41B 4K0KH 3OYFA 4GRIA 4ETSA 4BE0A 3K4MA 3OR1C 2LY1A 4HG2A 3J81W 2UUAH 4C9YA 4II2A 2KHMA 3KYHC 4ZDPA 4IKFA 5LMUH 5HLTA 4AU7A 3DKYA 4BUPA 1FJGH 4NC8A 4XORA 4BEHB 1Z3XA 1YX3A 3VNNA 1AA7A 1HNWH 3W3CA 2FE3A 4DV5H 4E7JA 2L9NA 3IG0A 3OWTA 4AVZA 2MC4A 4LFAH 2V26A 4XOTA 4JOMA 3J7AK 4PJMA 3BAAA 4C2TA 2CFOA 3M1CA 3H5NA 1HA8A 1V5FA 4QPOA 4NNJA 3VWBA 4R79A 3CP8A 1N36H 1EA3A 4OAZA 4IX7A 3M8JA 1AN7A 4LF9H 1Z3YA 3RIZA 3VSKA 2CS3A 2OV7A 3KYLA 3LMMA 5FLXW 2CV0A 2V1NA 2WBMA 1BJTA 1ZHQA 5TGTA 3EUAA 3EUKL 4U7BA 1SFKA 3SYTA 1VZ0A 4J01A 5LD2C 2DJIA 2LH9A 3PSIA 3VYRB 3N43B 1N33H 5D1PA 1D0YA 4ZC3A 2Q2EB 1VS0A 3C0FB 2LY2A 3F8NA 2W00A 3KALA 1S03G 3K3VA 4Y33A 3S3OA 2XSJC 2HU9A 4E7LA 3K10A 2R7TA 2A6TA 4CUGA 4FM9A 4XL9A 4JI7H 1WJDA 1JI8A 3RGXA 3PL8A 3FBNB 3DU5A 4BEHA 2R7RA 1L2ZA 1SAUA 2AQEA 5CKTA 1K6YA 4CC5A 3NWTA 4E7KA 3N6XA 3JAMW 2KP6A 3L2QA 4KHPH 2PJRA 4RM3A 5LL6b 1FMVA 2RQQA 3DPLC 4F91B 3HG9A 2LBFB 4JI0H 2JA2A 2VJJA 4RB1A 5CPRB 2VJIA 2X1EA 1GLNA 2NOJB 3A1YA 4DV6H 3DWLE 2HZDA 4H4KC 3FMAA 3ZR8X 4AQYH 1CKNB 3NWSA 4X66H 2VL8A 4ZJZA 4EEQA 2VJ4A 4XLHA 4PSXA 2W7NA 4A2BA 4DV1H 3DPUA 1X4OA 2M0MA 2RREA 3ZRGA 4EQ5A 4DJAA 1Z21A 2JUGA 3MKYB 3OYHA 3L2PA 2K5CA 3OL3A 4NQWB 3OYCA 3HL2A 4C2UA 2KZVA 2R7SA 2GOMA 3C2GA 5BR8H 5IT9W 1T95A 1GYFA 2CFMA 4XLCA 4DGWB 3V42A 3VYSB 3SZGA 3S93A 1D0XA 4DV7H 3D5SC 1V5EA 3PNYA 1ZHSA 4BQQA 5CQGA 3BG7A 4F52A 5FRMA 2OC6A 3AFHA 3W5OA 1XMQH 4JI1H 1XNQH 3H9QA 3S3NA 4DR6H 2WA0A 2K3PA 4YHHH 4YELA 1FKAH 2KLOA 1I6UA 4DRFA 1ZELA 1A0IA 3GDEA 2OWOA 4HNTA 3LFUA 1R6RA 2R7VA 4P1WA 4LH7A 2UUCH 4RM2A 1QU3A 4XMYA 2XF5A 3OS1A 3PJRA 4RB2C 2K9MA 2LBFA 4CCMA 4DR3H 4A2AA 2X85A 3OS0A 3RGZA 3MWMA 3ZXSA 2YCHA 2F4VH 5LFAA 3N05A 4BE2A 3W2WA 2X1DA 4OAYA 1FVIA 3K4NA 2KQRA 2O03A 1NG7A 3OYNA 4LF7H 3OYMA 3ZQQA 2CUJA 2F5VA 3DEEA 4IQ4A 1ERDA 4NC7A 2VJ5A 1BR2A 4J00A 3S24A 1QHHD 2P0WA 4PK4A 4BU2A 4MTEA 3K4CA 1Z2PX 4HSRA 3QODA 2WDTA 4Q0YA 4UCSA 3LMLA 2BW3A 1G8XA 2HVQA 2Q1ZB 4E7IA 2Y0SA 4HSTA 4DR1H 2CUZA 3PSFA 2IGMA 4RLFA 2VKHA 2ZSIB 2R7XA 2M7BA 4JI4H 3KXYT 1N32H 3OYEA 4RMNA 3TMOA 5HNFA 3L2RA 2X6YA 4UCVA 4I7HA 5EOYA 3CP2A 2M4GA 2X6XA 2DT6A 1X19A 3DTEA 1FMWA 3DU6A 3K70C 4DR2H 3BCBA 3BLYA 4YRVA 1W36C 4B3RH 3PNTA 1DP3A 2ZXHA 2XC7A 1Z2NX 3OMYA 1PJRA 3H0DA 3OY9A 4RB3C 1Y6IA 2ZSHB 3QOEA 2WADA 4F3QA 3DF7A 2GOXB 4LH6A 4LF8H 1U0JA 4HEA2 4CH7A 4MTDA 2F4IA 2E5LH 1D1BA 4JI8H 3LSIA 4XLEA 3ONQA 4RAYA 3ZGKA 3D5LA 3TY5A 2XF6A 2R7OA 1X1DA 2VASA 2R7QA 4FASD 4BDZA 3FKJA 1Z7LA 5KCMA 4BQOA 3H5RA 1D0ZA 4ZTFA 3RCOA 3PNVA 3OL4A 4NXNH 3OR2C 1D1CA 3HC7A 3NC0B 1WFXA 2X51A 5FPRA 4BGDA 1WJCA 2CW7A 3RQ4A 2MABA 3UNGC 4XOPA 4HPQA 4LFCH 2UU9H 4BJ5C 3AL0C 2VQLA 2A5WA 2M4KA 4U87A 5D1OB 4BS9A 1WJAA 4LFBH 2LC2A 4XKBA 4XN0A 2HGSA 3NBYB 2QKMB 4IAJA 2E5ZA 3QYFA 3CJRB 2IS4A 1YE9A 4R7RA 2JSPA 3OOUA 3D5RC 1BR1A 4XKVA 3T1HH 2VQGA 3GJXB 3TBIA 4F93B 4RB0A 3HOTA 4NUBA 1E4FT 4JYAH 4KJZA 3LSMA 5KHDA 2BVMA 2VXDA 2KSWA 1P16A 3K4LA 2HHHH 3H5AA 4GLXA 3GBGA 1X4PA 1MW7A 4LF6H 3CESA 3PUBA 5HNHA 4UCTA 1OR7C 2V7FA 4PJJA 4YEJA 3SEQA 3CJQB 1N34H 2KRHA 2DCEA 3QWUA 3EUHC 4LMYA 4JI6H 3DPTA 3AL0B 2HVSA 4KISA 3KAJA 3KAKA 3VSLA 2E60A 4Y4RA 4B47A 4X65H 2UXBH 4LIUA 2M3AA 4XLFA 1MMNA 2R7UA 1TAEA 4E6KG 1MNEA 1LFPA 4DBQA 2R7WA 1WJBA 4JV5H 4DV4H 1BR4A 2ELJA 4JI2H 4XM3A 3LSHA 4DV3H 4LSAA 2HPIA 2CMPA 4XKWA 4RLQA 2LRDA 2VLAA 1E0EA 2CH0A 2DT7B 2VQFH 4BJ6C 4PZ6A 1I94H 2Q2UA 4JI5H 1M0TA 5FROA 2VOBA 4XN3A 4CCLA 4ZDOA 2HIVA 1J5EH 2OUMA 3IUOA 3OYIA 4B44A 4YY3H 3L4KA 4X0GA 3J7AY 1PYVA 3A2KA 2UXCH 4BWSC 3QYEA 3K70D 4Y3OA 1CKNA 1MMGA 4MV9A 1QHGA 2WAQA 1MNDA 1W36D 2IS2A 4P5OA 5FD5A 3A4CA 4PSWA 4QPQA 2IXSA 2Z2SB 3NBZB 2MD0A 2VQEH 2AQFA 3UQ8A 3E1SA 2L5QA 4XR6A 5HOOA 1MZBA 2ZM6H 3UR3C 2RGVA 1XDNA 4MV7A 5LMNH 4PJLA 4PFOA 2X1CA 1KONA 3DTKA 2IS6A 3K4BA 1DGSA 2IGOA 3SEZA 4GKJH 3W1BA 4CCOA 2RGRA 4CCKA 2UUZA 4BQNA 1M0WA 3U21A 1UG0A 2M7AA 3BABA 1YX5A 2CW8A 3S8PA 3S32A 3W1GA 4B3SH 2L2OA 3MKZA 1WJ5A 4JQFA 5FRNA 1BGWA 3JSLA 1N77A 2LG4A 1N75A 1OLTA 3IAM2 1TA8A 3BA8A 2L9SA 2VKDA 3L2VA 3H9JA 4MLOA 3E0JB 3JSNA 1DQUA 4LITA 4LIVA 1T0FC 3I9V2 1X1AA 2RNGA 3HPHA 4XKCA 3OYAA 3FBIB 4BE1A 2XIGA 4DV0H 3MD2A 3L2WA 2JVGA 4N4OB 2F6CA 3H20A 3RR5A 5CQEA 2CV2A 2WY8Q 1IRXA 3TY8A 2WYOA 3OYGA 1XMOH 1Z2OX 1SYXB 4NXMH 4DOZA 2HDWA 2UXDH 1HR0H 3RJ0A 2O5RA 2W1OA 3LSGA 4C30A 4B48A 1S9HA 1Y56A 3IAS2 4RZQA 2K9LA 4UCRA 4DBRA 4PDBA 2DXIA 2BOLA 4KT6A 3BG6A 4HNUA 2KRCA 3K4JA 4LG3A 2PJRB 4BL0B 2ZXIA 4D9JA 3DKXA 2UUBH 4M7EA 4CCJA 4CA0A 2X6WA 1P9QC 2VQCA 4ITVA 3F9KA 4XQFA 5HVQC 3H35A 3RF2A 2ZFUA 2HIXA 5DISC 1X1BA 2R4GA 3OYDA 4HRIA 1TZLA 3BCAA 2V4JC 1N78A 2MFZA 3I3LA 4EFEA 1J09A 4BJTA 4B3TH 2XF7A 3HXLA 3LSKA 3CMMA 1XNRH 2PMZA 4XONA 4G6TB 4ZDLA 2VIXA 2LREA 4OWRB 2IGKA 3FDYA 2WB1A 2HPMA 4LSXA 2KPMA 3VDXA 3W2AA 2V9KA 1V9PA 3L2UA 3RTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TY9 A;  4UCS A;  3BAA A;  2HVQ A;  4PZ6 A;  2Q2U A;  4E6N A;  1CKM A;  4CC6 A;  2HIV A;  4UCV A;  3PN1 A;  5FPO A;  4PZ8 A;  4PZ7 A;  1CKN A;  5D1O A;  3NBZ B;  5D1P A;  3UQ8 A;  1VS0 A;  2Q2T A;  4LH6 A;  1XDN A;  1P8L A;  4EFB A;  1S68 A;  1DGS A;  3TY5 A;  3W1B A;  4CC5 A;  2VUG A;  4UFZ A;  3BAB A;  3W1G A;  3BA9 A;  3JSL A;  1TA8 A;  3BA8 A;  3NC0 B;  3JSN A;  5FPR A;  4UCU A;  4UCO A;  1CKN B;  2HVR A;  4EEQ A;  3RR5 A;  4EQ5 A;  3TY8 A;  5D1O B;  3L2P A;  1B04 A;  3NBY B;  1XK5 A;  2CFM A;  3GJX B;  4UCR A;  3W5O A;  1P16 A;  4GLX A;  4DRF A;  1A0I A;  3GDE A;  2OWO A;  4UCT A;  3RTX A;  3GB8 B;  4LH7 A;  1CKO A;  2HIX A;  3QWU A;  5DIS C;  1X9N A;  2HVS A;  4EFE A;  3KYH C;  1FVI A;  1TAE A;  3VNN A;  1V9P A;  3S24 A; 
#chains in the Genus database with same CATH topology
 4AID A;  4DIQ A;  4ECR A;  4M0J A;  2W82 A;  1DP7 P;  2L7M P;  2MCT A;  1TW3 A;  2CWE A;  4Q8F A;  1YW8 A;  2V59 A;  1KZH A;  1MMD A;  2M87 A;  3QYB A;  1CKM A;  4CC6 A;  3CC2 I;  1SAN A;  4AYB A;  3BT9 A;  2VPS A;  2LYC A;  3TEK A;  3SDB A;  2FOK A;  2WY7 Q;  3PN1 A;  1MBF A;  3CVZ A;  2DMQ A;  4FTH A;  4EGZ A;  1WJE A;  1I50 J;  3BZ6 A;  3TW7 A;  4PZ7 A;  3K6G A;  2VQH A;  3BR0 A;  2WAF A;  2HGW A;  2JEG A;  3T1Y H;  1DGR M;  3FM3 A;  2HQR A;  2DA2 A;  4PJN A;  4QWQ A;  4XNF A;  3JSO A;  1JLL B;  2C2E A;  1UEL B;  1JT6 A;  3IH2 A;  5LRR A;  1KBL A;  2VB6 A;  1BC7 C;  1FTZ A;  4XX0 B;  2Q2T A;  3PM1 A;  2FA5 A;  1TW2 A;  3HPG A;  1CF7 A;  4G7O F;  3G2B A;  4C2M J;  2QLZ A;  4DR4 H;  3DTF A;  5EZG A;  2R5Z B;  3QPS A;  2L3D A;  1GO3 E;  1VBG A;  1IBK H;  3VYU B;  1FBU A;  4XLA A;  3J81 K;  3GTK J;  4OMZ A;  1DGW Y;  3KLN A;  3PIP F;  2VE8 A;  3OYB A;  4EM2 A;  2K4B A;  2ZJT A;  4UFZ A;  4M71 A;  3O2P E;  2R93 J;  3I58 A;  4EQQ A;  3ESW B;  2R86 A;  5BWT A;  3BA9 A;  5JLX A;  5JI6 A;  3AKZ A;  2FUG 2;  2WWY A;  3HOS A;  2W4S A;  3ISP A;  5FGM A;  1KEE A;  5F6F A;  4N4N B;  1EKE A;  4AIH A;  1ZR2 A;  4L0Y B;  1ENH A;  3VYT B;  3FXK A;  5DLG A;  2MA3 A;  3J80 W;  4BHB A;  1X1C A;  2NNN A;  3B02 A;  4ESF A;  3Q8S B;  3PFY A;  5HDG A;  4BBS G;  3N40 P;  4FQG A;  2PBZ A;  5DUI A;  1W93 A;  3L4J A;  2XCL A;  1AUV A;  1I6X A;  2HQA A;  3ABM H;  2YS7 A;  4ED2 A;  3KIO A;  4KMF A;  2C2R A;  1A31 A;  2JA7 J;  1F5T A;  1EYZ A;  3G1M A;  5J8F A;  3CCL I;  4JBA A;  1ETX A;  2EFP A;  5JR3 A;  3CEB A;  1U2W A;  1MMA A;  4BAC A;  1ETQ A;  2CNU A;  5B66 C;  2FQ4 A;  3GTM A;  5LYJ F;  3SI8 A;  1FBQ A;  4MFE A;  4MV1 A;  1RJP A;  1OR7 A;  4CDG A;  2COM A;  2ZXJ A;  1RIO H;  2EFQ A;  3ZCO A;  4F92 B;  4YII A;  3RZO J;  3ZN1 A;  5DD8 A;  4BBS J;  2ACJ A;  5LA6 F;  3UKG A;  1CKO A;  4O81 A;  1YW7 A;  3SFI A;  1FP2 A;  4II3 A;  3IP4 B;  1QVT A;  2HFH A;  2KFD A;  1JT0 A;  3BQ1 A;  1APL C;  1RR7 A;  3GIM A;  4GRI A;  1B59 A;  3O3K A;  4U88 A;  4ETS A;  4A3I J;  3OR1 C;  5KFX A;  1W0T A;  3T1B A;  3F8C A;  2DU9 A;  4TV8 F;  4IEJ A;  4IKF A;  4NYE A;  2RAE A;  3LA2 A;  5D5V B;  2Z02 A;  4J9K A;  2P81 A;  2F48 A;  5I5U A;  2IW5 A;  3QP5 A;  1AA7 A;  2V5A A;  4WX9 A;  1ZK8 A;  3R60 A;  3MFI A;  1E2X A;  2FE3 A;  4LLN A;  2HS5 A;  2HDC A;  2VE9 A;  4UUT A;  2IA0 A;  3I71 A;  2MH9 A;  3HTU A;  2H1L A;  4C2T A;  2CFO A;  1ZGA A;  4CIC A;  4NZN A;  4RNO A;  3WU0 A;  1B1B A;  3ERE D;  4PDK A;  3S14 J;  2AQ4 A;  3VWB A;  3ZPL A;  5IT9 K;  1WHU A;  3BJO A;  1N36 H;  1EA3 A;  2R7D A;  4OAZ A;  1LNW A;  4HNV A;  4IX7 A;  1CQI B;  1I7N A;  3HO8 A;  2K86 A;  2XVC A;  2AXT C;  5FLX W;  2FMA A;  1GSA A;  2V1N A;  3HRU A;  4HN2 A;  2W9B A;  1BJT A;  1ZHQ A;  5EZH A;  5KT5 A;  3EUA A;  3SYT A;  2FBH A;  3CUQ B;  3ZN0 A;  1WCM G;  2DJI A;  3HOW G;  1TLH B;  5TJJ A;  4GGG A;  1NK3 P;  1N33 H;  3BQZ A;  1D0Y A;  4XBF A;  1VS0 A;  3C0F B;  4AIJ A;  1FIP A;  1HKS A;  4XSX F;  2V4Q A;  2W00 A;  3KAL A;  2Z33 A;  4M74 A;  2ASL A;  2YS9 A;  1SFO J;  5ICE A;  1TWH J;  4Y33 A;  3K3V A;  1HSJ A;  4DL7 A;  2F5F A;  2HU9 A;  2A6E F;  2QF7 A;  4FFP A;  3ZQC A;  3F8M A;  2WTF A;  4CUG A;  3CLO A;  2GQS A;  2PVP A;  2CQY A;  2NVU B;  3HOX J;  1JI8 A;  1WH7 A;  3PL8 A;  4BEH A;  2R7R A;  1VQ6 I;  1L2Z A;  1SAU A;  4CC5 A;  1K6Y A;  1WWX A;  1LB2 A;  1B9M A;  4HX7 A;  1MBJ A;  3JAM W;  2KP6 A;  4IRC A;  4KHP H;  1TWF A;  1MJA A;  2DYR H;  5LL6 b;  5IP6 A;  2RQQ A;  4O4L F;  4JI0 H;  1I3Q A;  2VJJ A;  4BXU A;  1R4M B;  2UXN A;  2X1E A;  4DV6 H;  2CQQ A;  1KYZ A;  4TM5 A;  1RYS A;  4PZJ A;  1G3T A;  3CCS I;  5EG0 A;  5DM6 F;  3FMA A;  2VI6 A;  3OUU A;  2EQR A;  3DBL B;  1ZYR F;  1QZY A;  4PSX A;  2W7N A;  3DPU A;  3KEO A;  2W6M A;  4EQ5 A;  3ZRG A;  3I59 A;  4DJA A;  3R4K A;  2ISZ A;  3OYH A;  2ID3 A;  2K5C A;  4NQW B;  3HL2 A;  5IP7 J;  2ZJP F;  2FP4 B;  3WWI A;  3C2G A;  3FM5 A;  4O3P A;  1GYF A;  2ZME C;  4DGW B;  3A01 A;  4F4W A;  2DPI A;  2HZT A;  1D0X A;  3B6C A;  4DV7 H;  1U9N A;  3M3Y J;  2R6F A;  1P4X A;  1V5E A;  2JA6 G;  4BQQ A;  4QIW A;  3BG7 A;  5EWG A;  1Z05 A;  5CVV A;  3S3N A;  1D8K A;  1BC8 C;  4IR9 A;  4HLY A;  4YHH H;  4FE4 A;  4L9N A;  4C2M A;  2BHY A;  1TWC J;  2DAB A;  2EJ3 A;  4Q43 A;  4IRK A;  1ZEL A;  4M3E A;  3T9E A;  3OHA A;  2Q0O A;  4IRG A;  4MA0 A;  4HF1 A;  3LFU A;  1IAW A;  1M6V A;  2W6N A;  4MAM A;  2DT5 A;  4P1W A;  3TII A;  2NVX J;  1SD6 A;  5CVJ A;  5I5V A;  2UUC H;  3JR9 A;  5DGB A;  1QU3 A;  3Q0U A;  4XMY A;  4RB2 C;  3CCR I;  2K9M A;  4FGR A;  4A2A A;  3TQT A;  2M8G X;  2FEZ A;  2X85 A;  1DPR A;  3RGZ A;  3CDL A;  2YCH A;  2F4V H;  4N9I A;  4BE2 A;  3W2W A;  1H88 C;  2KQR A;  3OYN A;  2IJL A;  4ZYH A;  2AHQ A;  3ZQQ A;  3OYM A;  4WF2 A;  5GPC A;  3IH4 A;  1S5L C;  5DYM A;  1I2K A;  4J00 A;  3E5X A;  1RK6 A;  2A5Y B;  2XKP A;  1GV2 A;  4EEY A;  4XRS G;  1KJI A;  1FZP B;  4YQW A;  1S7E A;  1ZAO A;  4M73 A;  1Z6R A;  4PCQ A;  3ZMD A;  4A3G G;  2LP0 A;  4O2B F;  2GQQ A;  2GPS A;  3QP6 A;  2BE5 F;  2JA7 A;  3BTL A;  4DR1 H;  1L0O C;  2CUZ A;  1FSH A;  3LQQ A;  2XPU A;  4M3F A;  4RLF A;  4IHT A;  3HOV G;  1YFH A;  4MO7 A;  1K79 A;  5HNF A;  3HRS A;  2X6Y A;  4A6D A;  4Z6Y A;  1E3O C;  1B72 A;  3CP2 A;  3OUZ A;  1F36 A;  2X6X A;  4QLC U;  2G9W A;  1FMW A;  1BN5 A;  4O6J A;  4HX8 A;  3K70 C;  3D0S A;  1MGT A;  1RC9 A;  3BCB A;  3SZP A;  4DR2 H;  4NLG A;  1ZTR A;  1WI9 A;  1W36 C;  1XC5 A;  3P9I A;  4XSZ F;  3TO6 A;  4TV7 A;  5L1J A;  1Z2N X;  3OMY A;  3H0D A;  2W9C B;  4ESJ A;  3I12 A;  2V79 A;  1D3Y A;  2CRG A;  1V3F A;  1OYW A;  2ZKZ A;  2GOX B;  2MG4 A;  3H92 A;  3QOE A;  2K40 A;  1XN7 A;  2LNB A;  4A5N A;  4KT5 C;  4QSH A;  2E2I J;  2XAF A;  2E5L H;  1JJ8 C;  3R5H A;  1HXD A;  3LSI A;  4GYG A;  4ZZD A;  1I39 A;  3HOV J;  2AGP A;  5J40 A;  1BM9 A;  1J0R A;  2FXA A;  3V8K A;  3T9C A;  2VAS A;  2R7Q A;  5KFM A;  4BDZ A;  4BQO A;  1R1U A;  5KCM A;  3LST A;  3CDI A;  2EZI A;  3KCC A;  2XAJ A;  3RCO A;  2EB7 A;  4NXN H;  3OR2 C;  4KN4 X;  3NC0 B;  4ECT A;  3CCU I;  1FIA A;  3TGN A;  2DPJ A;  1LDJ A;  2UXX A;  3V8L A;  4XYM B;  5FJ8 J;  1K61 A;  4HYE A;  3RQ4 A;  3UNG C;  4A93 J;  2OQG A;  4XOP A;  2BY1 A;  2Z3Y A;  2V4R A;  4BY7 G;  1E4E B;  2NS0 A;  4LFC H;  4Z2Y A;  5E18 F;  4QW8 A;  2BQU A;  2M4K A;  1KJQ A;  4BS9 A;  2OZ6 A;  1WJA A;  2H6B A;  4XN0 A;  2X6O A;  4N9H A;  2VKV A;  5KK1 A;  5L3B A;  2E5Z A;  1DU6 A;  1YE9 A;  4MEY F;  3W6J B;  4R7R A;  3D5R C;  4OU0 A;  2AGO A;  2WV1 A;  4JV2 A;  2OZU A;  4EGY A;  1R7J A;  4DQ2 A;  3BDD A;  2XGX A;  4BHC A;  1OYY A;  2DK8 A;  3ZP5 A;  2DMP A;  3LSM A;  2FK3 A;  1UC8 A;  4ECX A;  2BVM A;  3BJ6 A;  4I09 A;  3I55 I;  5KG4 A;  2JA8 G;  1SFO A;  1TWH A;  2FKL A;  2WTE A;  4A3J J;  3E97 A;  5C5J A;  3JRC A;  4Q48 A;  1MW7 A;  1HST A;  1OCZ H;  3KP2 A;  5D4S A;  1OR7 C;  4O7W A;  2EBI A;  4BY7 J;  1XSV A;  4BYY A;  1HW5 A;  2OA4 A;  3K1N A;  2FPG B;  2EH3 A;  3OSF A;  5KG5 A;  2GA1 A;  5EGO A;  3CUO A;  3E5Q A;  1EH6 A;  4RGR A;  4XID A;  1RR8 C;  3QWU A;  5HNE A;  3SNO A;  4JI6 H;  3V6H A;  3PQJ A;  5DD4 A;  2QBY B;  2STT A;  1UHS A;  1GT0 C;  4KIS A;  3KAJ A;  3PR5 B;  3KAK A;  4AM3 A;  2JRM A;  3VSL A;  2E60 A;  1I2L A;  4XZ3 B;  2XB5 A;  2DA6 A;  4B47 A;  1S29 A;  1FY7 A;  2HOA A;  4LIU A;  2M3A A;  2L9V A;  4XLF A;  5CVR A;  5I5Y A;  4FT8 A;  1J5Y A;  1SVM A;  4DBQ A;  2JA8 J;  3ABL H;  4JV5 H;  1H0M A;  3MZ8 A;  3ZQH A;  4JI2 H;  3HOU J;  3GV5 B;  3K5H A;  1RNL A;  1HCR A;  3ECO A;  3DFG A;  3HBL A;  2JA5 J;  1Y1V G;  1E0E A;  5JQW A;  2CH0 A;  5DCM B;  4L9V A;  2JPC A;  3HOW J;  1T94 A;  1W7P D;  2VQF H;  1U8R A;  2XAH A;  1I94 H;  1O3S A;  3GTQ J;  2JMW A;  2QQ9 A;  1M0T A;  2NUA B;  2QWW A;  4CCL A;  3PW4 A;  3FIS A;  1EKV A;  1J5E H;  2H6C A;  2XGC A;  4JX6 A;  2EIK H;  3IUO A;  3G6E I;  4DL4 A;  3QWL A;  3TP0 A;  2L7F P;  4HF0 A;  1ZR4 A;  1Y1W J;  1TWC A;  4U6P A;  5FLM G;  3PR4 A;  3BPV A;  1BNC A;  3G8C A;  3QPT A;  4BWS C;  4EBC A;  3RBE A;  2MC3 A;  1MMG A;  1NK2 P;  2NRA C;  2NVX A;  4V2F A;  5E8G A;  5FD5 A;  3PFF A;  3RAQ A;  2VQE H;  3K69 A;  4TQR A;  4PJ0 C;  3J7A O;  2LLK A;  4NQW A;  2L5Q A;  2ZM6 H;  4B1R A;  3V7R A;  2HYG D;  2RGV A;  3VOE A;  3KET A;  3RKY A;  6PAX A;  1JUP A;  2I80 A;  3DV8 A;  3LP8 A;  1KON A;  3RBD A;  2IRF G;  4DZP A;  5DMX A;  4UUS B;  3MZY A;  1TP4 A;  5A2Q Z;  1VQL I;  2O8X A;  5C3E G;  3HIF A;  2R85 A;  3GCM A;  4CCK A;  3J7Z I;  1HW2 A;  1T36 A;  2V58 A;  3LQS A;  4ZYG A;  2P4W A;  4OIQ F;  1FTT A;  3BAB A;  1R5G A;  1YX5 A;  2CW8 A;  3Q0W A;  4JQF A;  3FZV A;  1WR2 A;  1A35 A;  3L00 A;  3TOB A;  4B3A A;  3JSL A;  2MBF A;  1OLT A;  2CSO A;  4YIF A;  4LIT A;  4FX4 A;  3HPH A;  4BE1 A;  2B9S A;  4HR7 A;  3MD2 A;  3GV7 B;  3L2W A;  4YP3 A;  2H94 A;  1SEU A;  1XX5 A;  3H20 A;  5IT3 A;  1OCP A;  5LGT A;  5M3M J;  1Z7U A;  2WY8 Q;  3SE7 A;  5JVG F;  2WYO A;  1S9F A;  1XGO A;  4QTR A;  1Z2O X;  2DZD A;  2W6O A;  4YJ3 F;  1J75 A;  2A1H A;  4NXM H;  1SC7 A;  3RJ0 A;  1VQK I;  5LBQ A;  4B48 A;  1Y56 A;  4RZQ A;  4HQM A;  2K9L A;  3KP4 A;  3FXM A;  4ECZ A;  3ZMS A;  1Z67 A;  4PDB A;  4KT6 A;  2ESN A;  3BG6 A;  4HNU A;  3Q3S A;  3K4J A;  3BQY A;  1GV5 A;  5F04 A;  1EH8 A;  3MEX A;  4LG3 A;  3ASN H;  4EM1 A;  2PMZ N;  2CNQ A;  2PJR B;  2R7Z G;  2CQK A;  5E3M A;  2JJ7 A;  4D9J A;  1BA5 A;  2UUB H;  2KKO A;  2D5V A;  2WB1 N;  5KFN A;  2NNY A;  2F5C A;  3DF8 A;  2DOD A;  2XAG A;  3GTP J;  4I02 A;  5DGA A;  4FBU A;  2LKS A;  5DIS C;  1X1B A;  5K7F A;  3TDZ C;  3RV4 A;  3FIW A;  1NHA A;  2L0K A;  1KQ9 A;  3KE2 A;  5JVD F;  1CF7 B;  2VT3 A;  4EFE A;  2MFZ A;  3I3L A;  3L9F A;  1J09 A;  1Q1V A;  5KT7 A;  4DYR A;  2X0S A;  2XAS A;  3HJE A;  2XF7 A;  1LEB A;  1XDU A;  3HXL A;  3CMM A;  2W9C A;  4AYB N;  5KFR A;  2YZM A;  5EWE A;  5J1U A;  2IGK A;  2HPM A;  1D5V A;  3LQR A;  4JK1 X;  2E7W A;  2W48 A;  5ICC A;  1ZG5 A;  2V9K A;  3J80 K;  1V9P A;  4FFN A;  4ECY A;  4A3F G;  1TBX A;  3KXY T;  3C2H A;  4GCV A;  1W5T A;  3A02 A;  4F55 A;  1XSD A;  4ZI7 F;  1IXC A;  2Y30 A;  3VPB A;  4D1Q A;  4KA4 A;  5CVU A;  4H0E A;  4FU0 A;  3FXQ A;  2KRF A;  3TY9 A;  3U9G A;  4RAZ A;  2LFB A;  3T54 A;  4RU9 A;  1SVO A;  2Z99 A;  4E6N A;  2CV1 A;  3P5J A;  4YJ2 F;  1SFU A;  1JDB B;  3BRO A;  2VA3 A;  4E7Z A;  1E3P A;  2O3F A;  1FP1 D;  1LEA A;  4IRH A;  2AGQ A;  4IZZ A;  3CME I;  1T0F A;  1M1E B;  4LK1 F;  3BZK A;  3SHF A;  4RBO A;  1UC9 A;  4E7H A;  4M9U A;  2EIJ H;  5D8L B;  1U5T A;  3C2B A;  1GSH A;  2JT1 A;  1OWT A;  4GLW A;  1RK5 A;  1TTY A;  3RB3 A;  4EJT A;  4J0M A;  1H9G A;  2MLK A;  4UVC A;  2E35 A;  3H0G G;  3JZI A;  2W24 A;  2ESH A;  1X1P A;  1VQN I;  4L5J A;  5HS8 A;  1FX7 A;  3BTJ A;  1YW9 A;  4EFB A;  5EWF A;  2JEI A;  4E70 A;  1S68 A;  4EJU A;  3MN2 A;  4AVP A;  4HV5 A;  1D1A A;  4DW6 A;  1YOV B;  2Z16 A;  2BVL A;  2W57 A;  2A3S A;  5TIS C;  5L1I A;  1MBH A;  2NOG A;  1ZRD A;  3BQ2 A;  4DV2 H;  3PVX A;  3VEP A;  2VR1 A;  4X62 H;  1F1Z A;  1B9N A;  1UAA A;  3NAR A;  4WWC A;  1LVK A;  1NG6 A;  1P92 A;  1TQP A;  1SEI A;  1I1S A;  3T5L A;  2UVW A;  4DYC A;  3CF2 A;  2JA5 A;  3JZF A;  2L4A A;  3MMY B;  3M4I A;  4M9X A;  1RES A;  2RDJ A;  1EKP A;  5ILS A;  3BC8 A;  2QBY A;  3DLA A;  3CDH A;  3GTQ A;  3RPQ A;  1LVA A;  1BOB A;  3W2V A;  2QUF A;  3C3W A;  2CU7 A;  3G1L A;  3CCE I;  2E5N A;  3GZ6 A;  2HWV A;  1OYI A;  1JKP C;  4TQS A;  2MW8 A;  2JVH A;  3KEQ A;  1EJ9 A;  2KIF A;  2K9Q A;  1Y1W A;  1FJL A;  1HNZ H;  3Q8R B;  1B04 A;  5FLX K;  2E1M B;  2UV1 A;  1WH2 A;  2COI A;  2I8D A;  3U1K A;  1GVD A;  1O75 A;  4YFX F;  5E1X A;  2KDO A;  5GAG J;  5H2F C;  1IBM H;  5L3E A;  5C4J J;  5E25 A;  5T14 A;  1QBJ A;  2QA4 I;  2FPI B;  5DCM A;  4G7H F;  2YZG A;  1KJ8 A;  1S0N A;  3N6R A;  1HW1 A;  1TQI A;  5ICF A;  1HOM A;  3HOZ G;  1ZAR A;  4FFL A;  3RTX A;  5JVL A;  1OBG A;  2COJ A;  2PMZ E;  4LF4 H;  5DUK A;  4W97 A;  3WE2 A;  2ELK A;  2K4J A;  3OS2 A;  4C3I J;  4HW0 A;  3OIP A;  5KG7 A;  1X9N A;  2QKL B;  2AO9 A;  3DQV C;  4DR7 H;  4Q47 A;  3DEU A;  1MIJ A;  2J5O A;  4P9U A;  2EA2 A;  4GYI A;  4DYQ A;  4HG2 A;  4MEX F;  2UUA H;  5EDN A;  5CM0 A;  4RZR A;  5F1R A;  4TVI A;  5LMU H;  3CUQ C;  5IYZ F;  2ASJ A;  4BUP A;  1MKM A;  2ZBK A;  1ZKG A;  4RA2 A;  5CVI A;  3AX6 A;  4BEH B;  1Z3X A;  3VNN A;  2HQN A;  4V2G A;  5LEK A;  4O82 A;  4AYB E;  2O8K A;  4WBN F;  2Y9Y A;  3F6O A;  4A5M A;  3MJF A;  2OH2 A;  1Y39 A;  3IG0 A;  4LFA H;  3RV3 A;  3L09 A;  1MD0 A;  3ZQI A;  4HX4 A;  2PEX A;  2VQD A;  3QAH A;  3T9A A;  5KFJ A;  2RF4 A;  1HA8 A;  4QPO A;  1UZC A;  5EG0 B;  4R79 A;  3IV5 A;  1VBH A;  1AN7 A;  3M8J A;  3GYH X;  3GV8 B;  1POG A;  1UG2 A;  3VSK A;  2OAZ A;  3RIZ A;  3V4S A;  3TOA A;  3CQZ J;  3VB2 A;  1O3R A;  2DMN A;  3KRE A;  2H09 A;  3H3U A;  4CHU A;  2FNA A;  2XGQ A;  3EUK L;  5HOD A;  1JHH A;  2STW A;  2A61 A;  2G7U A;  2C22 A;  5LD2 C;  1IN8 A;  5B1B H;  2D1H A;  2XB0 X;  2ZCW A;  3GTP A;  4C3H J;  4ED8 A;  3A01 B;  5CLS A;  1IOW A;  2ZDG A;  3KP7 A;  5D1P A;  4A3E G;  2M8E A;  4I4T F;  1I3Q J;  4U0W A;  4J9S A;  4HBL A;  2C00 A;  3CCV I;  2D2W A;  3JZ6 A;  2HXI A;  3QOP A;  2R7M A;  4UUV A;  1JDE A;  5FLV A;  3RGX A;  2O7O A;  3T9F A;  3EPG A;  4O3R A;  5I60 A;  1ZH5 A;  1Y14 B;  3NWT A;  2XGD A;  4CZZ A;  5H20 A;  3KP6 A;  3L2Q A;  1AKH A;  2PJR A;  4OIO F;  5DGH A;  3DPL C;  1VFC A;  3HG9 A;  5CPR B;  1RKW A;  5FR9 A;  5FNV F;  4HF2 A;  4I99 C;  4QIW N;  3A0H C;  2DA4 A;  3TIG A;  4N0B A;  1CKN B;  3NWS A;  4LJZ F;  1HKQ A;  4UB6 C;  2ZJR F;  1UHM A;  2ECB A;  4A2B A;  1OIS A;  2M0M A;  4FFM A;  3UZB A;  3OSG A;  2Q8K A;  3BG5 A;  3OL3 A;  4S0H B;  5ICG A;  2Y9Z A;  4O3S A;  4OIN F;  5EJC A;  2DJN A;  2KZV A;  4PGG A;  4O3Q A;  2EWN A;  1QZE A;  1T95 A;  4IOA F;  2CFM A;  4XLC A;  3GIP A;  2BR0 A;  3JTG A;  3G6V A;  1R58 A;  3S93 A;  3GIQ A;  1N56 A;  1IN5 A;  2Q2E A;  3D5S C;  3CC4 I;  1HF0 A;  5I5T A;  1B6A A;  1ZHS A;  3QZ8 A;  3SXY A;  1RUN A;  1XMQ H;  2OC6 A;  1VQM I;  4JI1 H;  4DR6 H;  2WA0 A;  4YEL A;  1B72 B;  1FKA H;  4FX0 A;  4AC0 A;  3VPC A;  4DRF A;  5KFB A;  1R00 A;  1VQ7 I;  3H3V K;  4B4C A;  3CLQ A;  4UY8 I;  1FSE A;  2I5U A;  2Z04 A;  5JH7 F;  5C44 G;  3GTJ J;  1S0O A;  1EH7 A;  3CO7 C;  4TUY F;  2LBF A;  4I01 A;  4O84 A;  1ETK A;  1DPU A;  2QVO A;  5BWX A;  4A3M G;  2YWV A;  2LTP A;  4EBD A;  2DA5 A;  3ZXS A;  1A36 A;  1T3N A;  4FS1 A;  4OIR F;  1FVI A;  1BIB A;  2HXO A;  1NG7 A;  4LF7 H;  4IRI A;  4YG2 F;  1ERD A;  4NC7 A;  3CMY A;  1BR2 A;  3WU2 C;  1YIJ I;  2O0Y A;  2P0W A;  4PK4 A;  3V7C A;  3HM5 A;  3IKT A;  2QQ8 A;  5D4R A;  1QQI A;  2EJ2 A;  3QOD A;  2NU6 B;  5C44 J;  1QVU A;  1B6S A;  1BJA A;  5KFD A;  4Q0Y A;  5LLQ A;  5KFE A;  2XRL A;  1G8X A;  2Q1Z B;  3O8H A;  4E7I A;  2Y0S A;  4RUC A;  3PSF A;  2VKH A;  2DFI A;  2ZSI B;  4GFB A;  2R7X A;  3CCQ I;  4G9Y A;  1N32 H;  4M72 A;  1R5H A;  2QEN A;  4RMN A;  3TMO A;  3L2R A;  4A3M J;  2DPD A;  4Q5S F;  4UCV A;  5EOY A;  2QSH X;  4WK8 F;  2DQL A;  4HDV A;  1K78 A;  2KJC A;  1XG1 A;  1ZHF A;  1P7I A;  1MSE C;  5D5U B;  2IP2 A;  2ZXH A;  2DOE A;  3UFX B;  3NRV A;  1JE8 A;  1KU7 A;  2GXA A;  1YI2 I;  1PJR A;  3HGG A;  1FOX A;  3IWF A;  1JXS A;  3FF5 A;  2XGE A;  4A0Y A;  1R49 A;  1GXQ A;  3DXJ F;  2HDD A;  3M9M B;  3BR3 A;  1FLI A;  3HSR A;  2NVT J;  4LH6 A;  2D1V A;  1T08 B;  1I7L A;  4MTD A;  4NDL A;  3A0B C;  3BG9 A;  1T39 A;  3FDS A;  4JI8 H;  3BR6 A;  4RAY A;  4R8H A;  2XKO A;  1T8I A;  2AXL A;  5E17 F;  3Q8P B;  4F4Z A;  2A07 F;  2RQP A;  1MSF C;  2HGX A;  1E3H A;  3FKJ A;  2NU9 B;  5EGO B;  1D0Z A;  2M5W A;  5B5E C;  3COA C;  4ZTF A;  3MWD A;  1S10 A;  2COB A;  1YO5 C;  1R23 A;  3PNV A;  1JKJ B;  3NAU A;  3HC7 A;  4A69 C;  2ZO4 A;  4IHJ F;  2ZXW H;  2X51 A;  4GC7 A;  3PO3 G;  1KYW A;  3K1M A;  2H27 A;  4WXC A;  4DLK A;  4BGD A;  4I6Z A;  2LSO A;  3KP3 A;  2MAB A;  2DLN A;  5BYA A;  2DQR A;  2OTL I;  3H3V H;  2FBI A;  4Y7N J;  2UU9 H;  2VQL A;  4CYD A;  4QIW E;  1W0U A;  3CQZ A;  1R1V A;  1XCB A;  4QWD A;  3HHH A;  2PFB A;  2LC2 A;  4G3I A;  4IAJ A;  3QYF A;  3OOU A;  2ZDH A;  3ZQL A;  4BBR G;  2VQG A;  4HLX A;  4RB0 A;  3HOT A;  4NUB A;  3G8D A;  2EA4 A;  4O7L A;  1R36 A;  3U9T A;  5KHD A;  1JJ6 C;  5M3F J;  3DAA A;  2VXD A;  3N8D A;  1WCM J;  2KSW A;  1QA6 A;  3BR5 A;  1JX4 A;  2CUF A;  2W84 A;  3WO1 A;  3PO3 J;  4GLX A;  4BXX G;  4LF6 H;  3CES A;  3PUB A;  4RNM A;  1Q1H A;  3I53 A;  3SEQ A;  4YEJ A;  2FML A;  2QSG X;  2JN6 A;  3CJQ B;  1KQ8 A;  1IXS B;  2L54 A;  3BR1 A;  2M9H A;  4XYL B;  1WH5 A;  4EGQ A;  4LMY A;  1JGG A;  3M9O B;  4DZJ A;  3DPT A;  3AL0 B;  5DQG A;  4ZHQ F;  1P2F A;  3G71 I;  4BNC A;  1D8J A;  3S1N J;  1FOK A;  2MH2 A;  3DP7 A;  3V6K A;  1AWC A;  1AU7 A;  3FKI G;  4BBR J;  2RNJ A;  5KFW A;  4O7N A;  2P5L C;  1BI2 A;  5TRD A;  5IYB G;  4X65 H;  1VKZ A;  2YPR A;  4AUX A;  1MMN A;  1IYE A;  4NZO A;  4EYI B;  1MNE A;  2A6H F;  3ZQF A;  2R7W A;  2VC1 A;  2H8R A;  1QPI A;  2YL2 A;  3JRA A;  1WI3 A;  3SJM A;  1SMT A;  3LSH A;  2PJP A;  2IA2 A;  4RNN A;  3KHH A;  3WO0 A;  4XKW A;  4RLQ A;  5KG6 A;  2E1C A;  2LK2 A;  2LRD A;  2VLA A;  2I87 A;  4QW9 A;  1OCO H;  4MHG A;  1S7O A;  5BPI A;  4IRD A;  1B33 N;  3PW0 A;  1F43 A;  3K7A J;  2EFW A;  2TRT A;  5FRO A;  2VOB A;  4Q45 A;  4YR0 A;  3IRR A;  3OOP A;  4XLP F;  1U3E M;  3ERM A;  4M9Z A;  4YB8 B;  2OUM A;  1MH3 A;  4RDU A;  5IYB J;  3RFC A;  1MBG A;  2JA6 J;  5IYC G;  4QWB A;  3T0Y A;  3A2K A;  2BQ3 A;  3QYE A;  5E3N A;  5J47 A;  1CKN A;  1K1Q A;  2Y75 A;  5E1Z B;  1IN7 A;  1MND A;  1EZ1 A;  3VOD A;  3GTJ A;  2UVR A;  5DQI A;  2Z2S B;  2MD0 A;  4KNY A;  1A48 A;  4A3B G;  2AQF A;  2Y0M A;  2CQN A;  2XCP A;  3MZH A;  4XR6 A;  5HOO A;  4CKC A;  2CG4 A;  4MV7 A;  1XDN A;  5LMN H;  3GWZ A;  5GON F;  4O7Z A;  2YUS A;  2X1C A;  4Q8E A;  1QGP A;  2E7X A;  3I4M G;  2IS6 A;  1KQ0 A;  4DL3 A;  1AOY A;  2IGO A;  2QQB A;  4E4T A;  5EF6 A;  3KTM A;  4CE5 A;  3LWB A;  4GKJ H;  2CQX A;  5DTD A;  4HDU A;  4ECS A;  1Z6T A;  4OIP F;  4YBZ B;  2IVM A;  3ABK H;  3S8P A;  2J9G A;  2GWR A;  1RJQ A;  3MKZ A;  4LK0 F;  1OBD A;  2YRX A;  1BGW A;  1N77 A;  3IAM 2;  4U0V A;  1UFM A;  5M5Y J;  3JSN A;  3E0J B;  1DQU A;  4LIV A;  2EV5 A;  1FNN A;  1X1A A;  2F4M B;  4LGW A;  1MDM A;  3EUH A;  1JKQ C;  1WGX A;  4A3B J;  3FBI B;  2W6Z A;  1YIT I;  4A3G J;  3WTV C;  3U1D A;  5CR5 A;  3I4P A;  1VQ9 I;  1EUD B;  1XMO H;  3KZZ A;  4KIC A;  3TY8 A;  3I4M J;  2YX4 A;  3B73 A;  4RAF A;  2GIV A;  3WWJ A;  4J9R A;  4GC6 A;  2HDW A;  1HR0 H;  2O5R A;  5B1A H;  2BV6 A;  3LSG A;  4KN7 X;  1VQP I;  1S9H A;  5CA0 F;  1V51 A;  3ORQ A;  3KFW X;  4CHI A;  4DBR A;  2OQR A;  1LE8 B;  3KHL A;  2IA1 A;  3HHG A;  2KRC A;  2ADU A;  2BY0 A;  4J9P A;  4BL0 B;  2EV6 A;  2XHK A;  3RB0 A;  3ZMZ A;  1A6I A;  1R5I D;  2DWC A;  2M0C A;  2W7P A;  4PWQ A;  1ONV A;  5HBR B;  1KU9 A;  4KYW A;  2X6W A;  3RF2 A;  2VQC A;  1IBL H;  1U5T B;  3H35 A;  4RUA A;  2ZFU A;  3GEZ A;  2HIX A;  3U54 A;  4BQA A;  4ZQI A;  2R4G A;  2BQR A;  3BR2 A;  4EJW A;  2R8G A;  2EIY A;  4LLG F;  1SMY F;  4D5F A;  1TZL A;  4HRI A;  3BCA A;  2R82 A;  5KFO A;  3BJA A;  4O3N A;  4F7Z A;  5DS9 A;  4BJT A;  4B3T H;  2W85 A;  4O2A F;  3LSK A;  4XON A;  1KU3 A;  2QM3 A;  4MGR A;  1J59 A;  2YYA A;  2VIX A;  3WTU C;  1IW7 F;  2LRE A;  5LEJ A;  2PN6 A;  3FDY A;  3JSP A;  4LSX A;  3W2A A;  2ATL A;  4Q44 A;  1Z77 A;  3L2U A;  1REP C;  2GA2 A;  1W7P A;  3TW6 A;  2KMU A;  2P5K A;  5GTH C;  1LDK B;  3KEY A;  1PDN C;  3DEW A;  2GIZ A;  1DV2 A;  4LLL A;  3I54 A;  4CZC A;  3TL4 X;  1CQJ B;  2CGP A;  5KFT A;  1IC8 A;  3X2Q H;  2L7K A;  5JHF A;  3PUF A;  1I1G A;  3N44 B;  2FNP A;  4S04 A;  1UST A;  2PN1 A;  3TQ1 A;  3N42 B;  5L9X A;  4F4Y A;  2LD5 A;  4B3M H;  3W6K B;  3CCY A;  3T8R A;  5JUM A;  2MGQ A;  3KX2 A;  3MKW B;  1V5G A;  1OCC H;  1T98 A;  1WCM A;  2DA7 A;  2K9S A;  4E4H A;  4UXN A;  2EV0 A;  5K5Q A;  5IP9 G;  2HOE A;  5HV6 A;  4ANJ A;  4B09 A;  2IBK A;  2HEO A;  1V4Y A;  3ULQ B;  2GPW A;  3OYK A;  2MYS A;  5BMZ A;  4DQN A;  2CZG A;  3K4K A;  5DEQ A;  2JEJ A;  1SD4 A;  2MLG A;  4UHT A;  1F9N A;  3T5J A;  1HQC A;  5KNL A;  2TCT A;  1HNX H;  3ZQ7 A;  2JK3 A;  1TT0 A;  5GAH J;  5FB2 A;  5KFI A;  2E1M C;  1DU0 A;  5IWA H;  3RKW A;  5J4Y A;  4MNU A;  1LJ9 A;  1BIA A;  2BW3 B;  2HNH A;  3RKQ A;  3N4M A;  2VUG A;  5F27 A;  2P6S A;  2PMH A;  5IP9 J;  4CCN A;  2XAU A;  4ZTJ A;  3OIQ A;  2QK4 A;  4DUZ H;  4Y17 A;  2CFX A;  2CW0 F;  5LGN A;  1TWG A;  2OF7 A;  2JQ7 A;  2DOA A;  2V9P A;  2HHF A;  4UCO A;  5AIQ A;  2K02 A;  1Y1V J;  3GTO A;  2JEF A;  4CKB A;  3E5N A;  1EHI A;  4MIM A;  3U2R A;  3BTC A;  2YU9 J;  5GAD J;  5KFF A;  3OSP A;  2LOO A;  4J9N A;  2B63 G;  2WAE A;  4FET A;  3OTO H;  2FB9 A;  2JA6 A;  2ZDQ A;  4B3X A;  4I0A A;  5DV5 A;  4EAT A;  3HKZ A;  1G2H A;  1VI0 A;  2R5Y A;  2R7K A;  2KL4 A;  1CGP A;  3LA7 A;  2VUM G;  5FLM J;  1GVJ A;  2R3S A;  5J6X A;  4E7S A;  3EPZ A;  3GLX A;  2HOT A;  2W6P A;  1S7A A;  2UWM A;  4OX9 H;  2IS1 A;  5C1O A;  1OMI A;  2I10 A;  3T7A A;  5KFU A;  1KUT A;  4R8U A;  2JRT A;  2NU7 B;  1BI3 A;  1X3Z B;  3S3M A;  1GGO A;  4S05 A;  2W25 A;  2FOW A;  2HR3 A;  3RZD J;  3HEF A;  2JTV A;  5FKM A;  4ECQ A;  2BHZ A;  1MNM C;  5AIP A;  2GM4 A;  1TQM A;  1J7K A;  5C3E J;  3GW2 A;  3KPH A;  3OYF A;  4I50 F;  1IZ1 A;  3K4M A;  5EEH A;  2LY1 A;  1U8B A;  1P4A A;  4C9Y A;  2WE6 A;  2KHM A;  4IVN A;  4ZDP A;  3S2H J;  3CMA I;  3MFH A;  4BAY A;  4AU7 A;  2LKX A;  2OCE A;  1FJG H;  5IOY A;  4XRS A;  4NC8 A;  4ZYE A;  1N48 A;  4XOR A;  1YX3 A;  1HNW H;  2RGR A;  3K9T A;  4NBQ A;  2OLS A;  4E7J A;  2L9N A;  3BJY A;  3OWT A;  4AVZ A;  2MC4 A;  1AKH B;  2X5R A;  3REO A;  2CKZ B;  4JOM A;  3BQ0 A;  4ED6 A;  3RKX A;  4PJM A;  1KA8 A;  1FYK A;  5C1P A;  3FXO A;  2DFE A;  3H5N A;  3R5F A;  1O4X A;  2LDU A;  1RYR A;  1PUF A;  3CP8 A;  2DTZ A;  3H4D A;  2NVY J;  5I5X A;  2ZNZ A;  4LB6 B;  5KFK A;  1UCR A;  1K7A A;  2EIL H;  3LMM A;  4UVB A;  3HUG A;  3PW7 A;  1STZ A;  3KYC B;  2CV0 A;  5BPD A;  5BWW A;  5C4X G;  4KIB A;  2C2D A;  1X3U A;  2LH9 A;  2NXN B;  3RQI A;  2YS6 A;  1PK8 A;  1ULZ A;  3N43 B;  5C8Y F;  2QYZ A;  2R7Z J;  5L1L A;  4ZC3 A;  2Q2E B;  2LY2 A;  3F8N A;  5D8D A;  2M45 A;  4EYH B;  1S03 G;  1I1K A;  5GPA A;  3S3O A;  2XSJ C;  4E7L A;  2BXY A;  2ZJ2 A;  1ZLK A;  3F3X A;  1VTN C;  5DG7 A;  2QQA A;  1LPQ A;  4XL9 A;  4JI7 H;  3GX4 X;  2HG8 A;  3J81 Z;  1LE8 A;  2BYV E;  2EK5 A;  2AQE A;  4AD9 A;  3L2C A;  2W6Q A;  4E7K A;  5C4X J;  1FMV A;  4EJV A;  4F91 B;  3AG3 H;  3R0A A;  5FKL A;  2JA2 A;  2LBF B;  3JRG A;  1O7F A;  5DLF A;  2VJI A;  3G6X A;  2NOJ B;  1R22 A;  4A3F J;  4C5B A;  2PLY A;  4FHT A;  5K5R A;  3UYY A;  1B8I A;  1WZ2 A;  4AQY H;  5DQH A;  3L1P A;  4X66 H;  3TDU C;  3V7S A;  3PIO F;  1O7L A;  1IV8 A;  4ZJZ A;  2XPW A;  4XLH A;  4LOC A;  4X1E A;  4DV1 H;  3HOY G;  4KIF A;  2VC0 A;  3JCU C;  1Z21 A;  3V6J A;  5FFX A;  1BOA A;  3M1E A;  3MKY B;  4C5C A;  3OYC A;  4QWA A;  4CGZ A;  1I6H J;  2VOD A;  1RPW A;  2GOM A;  5BR8 H;  4D5C A;  3FMS A;  4C3J J;  2L9R A;  3V42 A;  4FCY A;  2M30 A;  3F8F A;  3SZG A;  5D5X B;  2R84 A;  2KIQ A;  2IP4 A;  3BOQ A;  3PNY A;  4D0P A;  1XNQ H;  3AFH A;  4O4I F;  2AU0 A;  5GP9 A;  3QQA A;  2VN2 A;  1HDP A;  1NTC A;  2K27 A;  1U78 A;  3E5U A;  4L1K A;  3M8F A;  1K78 B;  1A0I A;  3BAC A;  2R7V A;  3OSN A;  1TL8 A;  4HQ6 A;  3HOY J;  1PP7 U;  1BJZ A;  3H0G J;  5L3F A;  2P0A A;  4IZO A;  3OS1 A;  3PJR A;  4DIM A;  2DAA A;  2X9D A;  1BXR A;  5DG9 A;  5BOX A;  1VF9 A;  3DTG A;  2PQ8 A;  4ASN A;  3E6B A;  4NHJ A;  4OMY A;  2MD5 A;  5BQT A;  4JV0 A;  2Q7D A;  5BYB A;  3MWM A;  4HV6 A;  1HLV A;  5KFA A;  3MR3 A;  3N05 A;  1M7J A;  4UV9 A;  2QZ8 A;  2X1D A;  3AG1 H;  3ZQG A;  2O03 A;  1ORK A;  3K4N A;  4OOI A;  3S1Q J;  1W96 A;  4O7R A;  4EG0 A;  2CUJ A;  3T5X A;  2F5V A;  3DEE A;  1Y1V A;  2NVQ J;  3IHU A;  1P7J A;  2VJ5 A;  1K1S A;  1LUJ B;  3S24 A;  2YX7 A;  3JRB A;  3V4Z A;  2YU9 A;  4MTE A;  3K4C A;  3ETH A;  1YJ9 I;  2GXG A;  1Z2P X;  4HSR A;  2WDT A;  3GLL A;  4MV8 A;  3L7W A;  2L4M A;  1RJR A;  4UCS A;  4A12 A;  3LML A;  4DL5 A;  2BW3 A;  2BY2 A;  3WTZ A;  2HVQ A;  4HST A;  3K0L A;  1H89 C;  2IGM A;  4P9F A;  2R92 G;  2M7B A;  3BTI A;  4JI4 H;  4I2O A;  5IT9 Z;  3OHB A;  4Y15 A;  3TIN A;  1PUE E;  5LHI A;  2HGC A;  4ZZL A;  2XCA A;  1OQY A;  2LR8 A;  1S8N A;  4M9S A;  5L3D A;  5JVT A;  1K6O A;  1BL0 A;  1OCT C;  4O3M A;  1DP3 A;  4EJO A;  3KHR A;  4HAM A;  4NC6 A;  4F50 A;  3U55 A;  2R87 A;  2UVV A;  5L3C A;  2EJR A;  1T33 A;  2HOS A;  4M6V A;  1G3Y A;  2QEX I;  3DF7 A;  2DIK A;  2WAD A;  2B63 A;  3HOZ J;  1B6R A;  2XC9 A;  4EM0 B;  1GHC A;  2QGU A;  5DCF A;  4U7D A;  4HEA 2;  3VPR A;  4IO9 F;  4YAK B;  1D1B A;  1GSO A;  1VAJ A;  1RZ4 A;  2ZME A;  4XLE A;  4D7N A;  5F9N A;  4O7V A;  2WV0 A;  5A2Q K;  2R92 J;  4A3D G;  3TY5 A;  3IH3 A;  2XF6 A;  1Y0U A;  3SZT A;  1A04 A;  1I5Z A;  1X1D A;  4FE7 A;  2Y69 H;  1OJL A;  1XDS A;  4FAS D;  2HJW A;  1XCV A;  1Z7L A;  3H5R A;  1IF1 A;  2IT0 A;  1A3G A;  4IL6 C;  2JPB A;  2LKP A;  4QWC A;  1G3W A;  1XSX A;  4J19 A;  1D1C A;  3F21 A;  5DAA A;  1WFX A;  4WHX A;  4PBC A;  1D5Y A;  3UZO A;  5KFC A;  1TT5 B;  1WJC A;  2PG4 A;  4LFU A;  1X2N A;  3RYP A;  1YS7 A;  3TED A;  1KT8 A;  3MCZ A;  3ZMU A;  1IV6 A;  1ZRC A;  5ERI A;  1W4M A;  2NVY A;  2W8L A;  3AL0 C;  4U87 A;  5DDG A;  5D1O B;  2ME0 A;  2E1N A;  4A3D J;  4LFB H;  1IN6 A;  3NBY B;  2QKM B;  3WG9 A;  1IRF A;  1EV7 A;  3F23 A;  3CJR B;  3LSJ A;  4R1H A;  1YRN A;  2IS4 A;  2JSP A;  4YR2 A;  3R5X A;  1T6S A;  1JKR C;  3TBI A;  5K3W A;  3Q2O A;  4ED7 A;  2OTJ I;  3GZN B;  3C1D A;  4JYA H;  3QU6 A;  3R61 A;  4KJZ A;  4L5I A;  3LSR A;  2R7Z A;  1I1L A;  4A6E A;  3W6V A;  1G4D A;  3K4L A;  1A5J A;  2J5P A;  1YLF A;  2K85 A;  1NH3 A;  3GBG A;  1DV1 A;  2FRH A;  2RVC A;  5K1Y A;  4YFN F;  4J9L A;  2ZNY A;  4A3E J;  1GUU A;  4EMS A;  3GFI A;  3CCJ I;  1ETW A;  4HQE A;  1HKT A;  1N34 H;  5KKN B;  1IUF A;  3KP5 A;  3LAP A;  1MJ9 A;  2DCE A;  1V55 H;  2WAQ E;  1UNN C;  4ECU A;  2A68 F;  5LGU A;  2FPP B;  5E3L A;  1W5S A;  1SD7 A;  1VQ5 I;  2HVS A;  4AIK A;  3FXR A;  3GIK A;  2P5V A;  1TWA J;  5JFR A;  1H9T A;  1IO2 A;  2R93 G;  5F0H A;  4MV4 A;  2QYO A;  3ROU A;  4B8X A;  3QRF F;  5JLW A;  2EFO A;  2UXB H;  1XGS A;  2R0Q C;  4HOB A;  2R7U A;  1TAE A;  2CYY A;  4E6K G;  4ENN A;  2Y0S E;  4KIG A;  4LD5 A;  2Z5U A;  1RKT A;  2HI3 A;  3ELK A;  4DV4 H;  3EET A;  1BR4 A;  1USS A;  2RN7 A;  4XM3 A;  3WTT C;  4M6X A;  2JWT A;  4UVA A;  3QU3 A;  2DYS H;  1BI0 A;  2CMP A;  2W70 A;  1R71 A;  1KGS A;  4YAJ B;  2NU8 B;  2DT7 B;  3SFZ A;  5FO5 A;  5IYD G;  3U0G A;  4JI5 H;  1UB9 A;  2Y4R A;  1MDM B;  5M5W J;  3T99 A;  3K2A A;  2J6U A;  5J1R A;  5GAE J;  3P9C A;  4ZDO A;  2JA7 G;  4JX4 A;  2EIN H;  1KTA A;  4QWE A;  5DGI A;  4ED3 A;  3PW2 A;  5CJ9 A;  3M07 A;  4I76 A;  1IDY A;  2LF8 A;  2X0L A;  4YY3 H;  1FT9 A;  1WRV A;  3L4K A;  4DL2 A;  2UXC H;  3K70 D;  1T56 A;  1KC7 A;  4MV9 A;  1SFX A;  2E36 A;  2WAQ A;  1W36 D;  4V19 K;  5LP6 F;  3H0G A;  3A4C A;  2XUB A;  3Q1K A;  4G8X A;  2E2J J;  5KG1 A;  4IHY A;  3UQ8 A;  1BBY A;  3E1S A;  2E19 A;  5J3L A;  2QB5 A;  4Y13 A;  2QCO A;  3SQN A;  5IYD J;  4PFO A;  5IY5 H;  1ZN2 A;  3FK6 A;  1GXP A;  3V4G A;  4IR1 A;  1I3A A;  5BMV F;  3W1B A;  5D6E A;  3RDI A;  4CCO A;  2F5E A;  5KAF C;  4A3I G;  2UUZ A;  1Y0N A;  4BQN A;  3LUL A;  4KDP A;  4G6D A;  5LOV F;  1UG0 A;  2P7C B;  3FXU A;  3CD6 I;  3S32 A;  3W1G A;  5KFZ A;  3QFF A;  5FRN A;  5F64 A;  1DUX C;  5JQG F;  1K83 A;  3ECH A;  5F08 A;  4A3C G;  2LG4 A;  1GDT A;  1TA8 A;  3BA8 A;  3PW5 A;  2OD5 A;  2VKD A;  3PFI A;  1X2M A;  3H9J A;  2XRO A;  4CKE A;  1Z91 A;  3BPX A;  1T0F C;  3I9V 2;  1YJW I;  2RNG A;  2EIM H;  1MMS A;  2NYX A;  4J9O A;  1IXR C;  2GLO A;  1U5T C;  1UJ8 A;  3JRF A;  3TP3 A;  5CAE B;  3J7Y J;  2F6C A;  4UUG A;  3WOD F;  5LXT F;  3RR5 A;  5CQE A;  4GXO A;  4P55 A;  1IRX A;  2CV2 A;  3OYG A;  4RS8 A;  3E6D A;  1W7P B;  2DDA A;  1SYX B;  2HQ5 A;  1ZAU A;  4DOZ A;  3HSF A;  3GQC A;  2CO5 A;  4O7T A;  2UXD H;  2W1O A;  2SCU B;  3BWG A;  4JX5 A;  4W1U A;  3K5I A;  5KFY A;  2DFH A;  3E6M A;  3T9D A;  1XGM A;  3IAS 2;  1JUM A;  2DTR A;  2YR2 A;  3GUD A;  3MQ0 A;  3NQO A;  2YU3 A;  4UCR A;  4A3C J;  2CJJ A;  4G12 A;  3PO2 G;  3H1C A;  3HZJ A;  2BOL A;  2EFN A;  1O57 A;  1VND A;  2FF4 A;  1ETO A;  3KYD B;  5KFV A;  2FJ1 A;  1RUO A;  4ENM A;  2ZXI A;  3ZOB A;  3ETJ A;  1EF4 A;  5HLH A;  2R8J A;  2R92 A;  3EDP A;  1CQT A;  4M7E A;  4CCJ A;  3GLK A;  4BKX A;  4CA0 A;  1P9Q C;  3E3V A;  4XQF A;  3F9K A;  1JTY A;  1MBK A;  5HVQ C;  2C6Y A;  2R7F A;  2K7L A;  3HOX G;  3T9B A;  1UHW A;  4IHX A;  3LAJ A;  2A05 A;  2V4J C;  1FPQ A;  3MVP A;  1HDD C;  3M9N B;  4MQV A;  1ITY A;  5D6F A;  3KLO A;  4K6N A;  3VFZ A;  3PQK A;  4O7Y A;  3Q8Q B;  1CE8 A;  4A3K G;  3DCF A;  4ZDL A;  1LFU P;  3I64 A;  3PO2 J;  4OWR B;  4ED0 A;  2E1O A;  3HDD A;  2UVU A;  3WHC A;  3WWH A;  4ABZ A;  2B0L A;  2H8W A;  1XB4 A;  2M1B A;  4L5E A;  3TO9 A;  3E6C C;  2GAU A;  5FD6 A;  2YRW A;  3GTK A;  2HTJ A;  3TQN A;  2E2H J;  2XDV A;  2BGC A;  2R8H A;  2RV8 A;  5ILV A;  3OYL A;  2VXZ A;  5I47 A;  4A3L G;  4PFP A;  2R7N A;  5HLG A;  1S6L A;  1XS9 A;  1K4T A;  5CYV A;  1C3O A;  5IP7 G;  3GTL A;  3H9G A;  2HHF B;  3FX3 A;  1ZET A;  1UMQ A;  1I27 A;  5H6Q A;  3R6S A;  5EZY F;  5A2Q W;  2ALZ A;  5FPO A;  2W8K A;  2O61 A;  4GKK H;  2YSR A;  4PZ8 A;  3FK7 A;  2W9A A;  5FKN A;  1QZZ A;  2KDZ A;  3AG2 H;  4A3K J;  2GBY A;  1SAX A;  3V8J A;  1QPM A;  4HA8 A;  3C18 A;  1IUY A;  1JXL A;  4BHP A;  2LVS A;  2IBD A;  4DR5 H;  4U0Y A;  3T8T A;  2IGN A;  2O6G E;  4L0Z B;  2R5Y B;  5D1O A;  4BXX J;  3KHG A;  3G6Y A;  3G3Z A;  1BI1 A;  1BW5 A;  1IJW C;  1SCU B;  1E4G T;  4ENJ A;  1MH4 A;  3MFK A;  3RIR A;  5J4V A;  1P8L A;  3CJT B;  1TWA A;  2J6S A;  2E71 A;  4A3L J;  2COG A;  1JKO C;  1SD5 A;  4CYC A;  3RI4 A;  1LKX A;  1Y8R B;  3M7G A;  3M8E A;  3R9R A;  1TWG J;  1I50 A;  1IYD A;  4O4J F;  1G59 A;  1WJF A;  1G3S A;  2L7Z A;  4R8U B;  3H4B A;  4EBE A;  3GTO J;  3FKI J;  3RSN A;  3AYH B;  5BWU A;  4IQJ A;  4EGJ A;  2YZL A;  1XTA A;  3FHN A;  4PUS A;  4ZYA A;  4Y52 J;  3FWE A;  3WTX C;  4CSW A;  1WQ2 A;  3ORR A;  3LL7 A;  2XSD C;  5KT6 A;  3FHZ A;  4ESB A;  3HKZ N;  2ELH A;  2VPL A;  4BH9 A;  4UCU A;  1S3J A;  3RPU A;  2X4H A;  1T38 A;  3T5K A;  2DOF A;  2Y2Z A;  5EEG A;  2HVR A;  4BDY A;  4APM A;  1WSC A;  3HYI A;  3CZ6 A;  3R0J A;  2Y31 A;  3ABT A;  1IOV A;  2OU2 A;  2ODT X;  1FOY A;  4DUY H;  2R93 A;  1V4R A;  3G4S I;  4A2U A;  2Z1D A;  5LRS A;  3DTI A;  3F6V A;  3MAJ A;  3ZMT A;  1XK5 A;  2KZG A;  4LF5 H;  5KS8 A;  2R8I A;  3CF5 F;  3OYJ A;  2V6E A;  5LHH A;  4L18 B;  3M4O J;  2DFF A;  5JHU A;  1T2K A;  4BXF A;  2IEK A;  4JV1 A;  3DBR B;  5FFZ A;  5IYC J;  4B43 A;  1PUF B;  1O3T A;  4ZOL F;  4X64 H;  1OPC A;  3WTS C;  2R5Z A;  5J2T F;  3HUG B;  2BBY A;  3ZMV A;  4KIT B;  1KU2 A;  1MJB A;  4UV8 A;  4ME6 A;  4QJF A;  4JI3 H;  4ON0 A;  1EUC B;  4F4X A;  2PBI A;  3LNQ A;  4IOC F;  5D5W B;  4RGS A;  3S2W A;  1ACI A;  3GB8 B;  3NUA A;  1PVE A;  3BG3 A;  4IHS A;  2HKX A;  3VA7 A;  3MR5 A;  5L1K A;  4YR3 A;  3QQM A;  4I55 F;  3EYY A;  3RPU D;  2KJB A;  3S1M J;  2C35 B;  1FOW A;  3N41 B;  2FLL A;  2XV4 S;  2ZFW A;  2M2E A;  4K0K H;  4CMF A;  1OFC X;  2VBW A;  4BE0 A;  2N8G A;  2VOP A;  3J81 W;  4G6Q A;  3OIO A;  2ZJQ F;  4II2 A;  3LA3 A;  3KYH C;  2FK1 A;  5HLT A;  3DKY A;  5KVR A;  3T5H A;  4NB5 A;  1ZRE A;  3BP8 A;  5I5S A;  4MV6 A;  2E34 A;  3HT5 A;  3J80 Z;  5EDW A;  3W3C A;  1AUX A;  5FJ8 G;  4DV5 H;  2G0E A;  2V26 A;  3IC7 A;  3GFJ A;  4XOT A;  5F9L A;  3IRQ A;  4A93 G;  3J7A K;  4RGU A;  2W71 A;  2XRN A;  4GDF A;  3BAA A;  3WG7 H;  2IAI A;  2V1D A;  2DAO A;  3M1C A;  3LSP A;  1V5F A;  3FXL A;  4NNJ A;  1R1T A;  1B8I B;  1ZQ7 A;  2WC2 A;  5K2M A;  1Z3Y A;  1FYM A;  2CS3 A;  2EPF A;  2OV7 A;  3IWZ A;  5J8C A;  3KYL A;  4G7Z F;  1IG7 A;  4C5A A;  1KJJ A;  1EKF A;  2WBM A;  5TGT A;  3S2D J;  1YS6 A;  4U7B A;  4DNC A;  1E17 A;  1SFK A;  1VZ0 A;  4J01 A;  3TKY A;  1B4A A;  3ASO H;  3F8B A;  3PSI A;  4K2E A;  3VYR B;  4I98 B;  1ZGW A;  2HYF A;  1FBS A;  4A3J G;  3IN5 A;  4J9M A;  1DAA A;  1J2X A;  1LDD A;  3HGY A;  5KFS A;  3AG4 H;  4D7M A;  4CXF A;  2FMY A;  2JUC A;  2NS8 A;  4GO1 A;  5E8I A;  3IL2 A;  1JUS A;  3GME A;  1OKR A;  1FWZ A;  3B6A A;  2FK2 A;  2R8K A;  2ISY A;  4I0B A;  3F22 A;  1PX2 A;  3LFK A;  2V9W A;  1TNT A;  3K10 A;  3PZP A;  2Z9O A;  2R7T A;  5I5W A;  2A6T A;  5LHG A;  4FM9 A;  1X3W B;  5BWR A;  1WJD A;  5KFL A;  5HDK A;  1CS0 A;  2DBB A;  3DU5 A;  3FBN B;  2EJ0 A;  5CKT A;  4FIS A;  2RDI A;  2FU4 A;  1U6G A;  3GTG J;  3NEU A;  1ZRF A;  3N6X A;  3OV8 A;  4FE2 A;  4LG0 B;  3E7L A;  3HRT A;  4RM3 A;  1YYV A;  3HRM A;  4MFD A;  4RB1 A;  4ENK A;  4IWX A;  2E2H A;  2BY3 A;  1GLN A;  2HKO A;  3A1Y A;  1G2W A;  1IRZ A;  3DWL E;  2HZD A;  4H4K C;  3DKW A;  1IRG A;  3HOU G;  3H3Z A;  3HKZ E;  2HYJ A;  3ZR8 X;  2BXZ A;  2QSF X;  2JA5 G;  2DDB A;  2VL8 A;  4M3B A;  3F0C A;  4O83 A;  4EEQ A;  2OPT A;  2VJ4 A;  3FMQ A;  2AS5 F;  5KX5 F;  1X4O A;  2RRE A;  2JUG A;  1RI7 A;  3SGI A;  3L2P A;  3CUQ A;  4EEF G;  1Z9C A;  2XAQ A;  4C2U A;  2R7S A;  3WU1 B;  4O4H F;  4HYK A;  2IMW P;  5FKK A;  5FLX Z;  5HS7 A;  2X48 A;  5IT9 W;  2B7E A;  2VBX A;  5F0F A;  2GZW A;  3VYS B;  1Y1W G;  1ETY A;  2EZH A;  1ULY A;  2GLT A;  2VBY A;  5CQG A;  4CO8 A;  2EZL A;  4F52 A;  5BS6 A;  4KFC A;  5EYR A;  5FRM A;  3W5O A;  3RB6 A;  2J6T A;  3H9Q A;  2K3P A;  3GFL A;  2P7V B;  1SVL A;  2KLO A;  1I6U A;  3WGI A;  2OWO A;  3GDE A;  1V54 H;  1IN4 A;  2DMU A;  2ME6 A;  2UZK A;  1QRY A;  4HNT A;  1R6R A;  4DAA A;  2VA2 A;  3MWE A;  4LH7 A;  3GII A;  4RM2 A;  2FD5 A;  3FKI A;  3GFM A;  2DO7 A;  1WSU A;  2XF5 A;  5KG3 A;  1X58 A;  2I8C A;  4EVI A;  4DR3 H;  4CCM A;  3WGH A;  1WPK A;  2JZY A;  3GIJ A;  3JAM Z;  3OS0 A;  1ODD A;  1JTX A;  1N25 A;  1RET A;  5LFA A;  4O3O A;  3RB4 A;  2MSY A;  2VKE A;  2ZME B;  4OAY A;  1P6R A;  1Z1D A;  1IGN A;  2LF7 A;  5E79 C;  4U7C A;  4XK4 A;  4ED1 A;  1DIK A;  4IQ4 A;  5DM7 F;  4G94 A;  3RUP A;  2RKH A;  2CQ7 A;  1QHH D;  2DLL A;  2RC4 A;  5KT3 A;  4BU2 A;  2OBP A;  1ETV A;  1WKM A;  5H6R A;  2VT2 A;  1S72 I;  3CSW A;  4IXA A;  2PMU A;  5E1W A;  5KFH A;  2ZB9 A;  1U9O A;  2A69 F;  3GZ5 A;  3I0T A;  3K2Z A;  3EPI A;  2B63 J;  5HDN A;  3OYE A;  4FS2 A;  2P6T A;  4I7H A;  3Q9S A;  2HDK A;  2FSW A;  2M4G A;  2FLN A;  1JHF A;  1BW6 A;  1X19 A;  2DT6 A;  3DTE A;  3DU6 A;  3TO7 A;  3GF2 A;  4ZH4 F;  3EQL F;  3WTY C;  2VUM J;  1Y8Q B;  1RRJ A;  3H40 A;  2KIU A;  3BLY A;  5K7H A;  1TNS A;  4WXH A;  4YRV A;  4O7S A;  3PNT A;  4A0Z A;  3QZ7 A;  2DA1 A;  4B3R H;  1ZLJ A;  4X6A J;  2L02 A;  3QPL A;  1YRN B;  2XC7 A;  5KAI C;  4UNO A;  2DI3 A;  3GVA A;  3OY9 A;  4RB3 C;  2H1K A;  1Y6I A;  2ZSH B;  2ECC A;  4F3Q A;  5HLI A;  3Q0V A;  2OJE D;  1YQA A;  9ANT A;  1Z0X A;  2M05 A;  4LF8 H;  2BZT A;  2VPQ A;  1U0J A;  4CH7 A;  2F4I A;  2V9V A;  3JRD A;  4MV3 A;  2PX9 A;  3Q9V A;  2EZK A;  3ONQ A;  3N97 A;  3ZGK A;  3D5L A;  1XMK A;  4Q4Z F;  2R7O A;  3HSE A;  4WCG A;  2VON A;  3JRI A;  3S15 J;  3GID A;  3G1O A;  1JGS A;  3IKV A;  5KFQ A;  5L3G A;  2ABJ A;  3FMR A;  4IJA A;  3OL4 A;  5E20 A;  4KMU X;  4BY1 G;  2TDX A;  4WD3 A;  4EV0 A;  2V6C A;  2E2I A;  4J9Q A;  3DBH B;  5FPR A;  1XGN A;  2HTS A;  1R9T J;  2VPR A;  3MR6 A;  2KIM A;  1VQ4 I;  2CW7 A;  2XGP A;  3MR2 A;  2ICW G;  4M3D A;  4Y8V B;  4LB5 A;  1VQO I;  3HTS B;  2FJZ A;  2BEO A;  4HPQ A;  5ED4 A;  2V1X A;  3O6B B;  4BJ5 C;  1XD7 A;  4Q4C A;  2A5W A;  3CCM I;  1ET0 A;  2FLP A;  1YG2 A;  2DW4 A;  2V1U A;  2FBK A;  3ML6 A;  4XKB A;  2HGS A;  3NGD A;  4RGX A;  2IA6 A;  4IPA A;  2DN0 A;  1YHQ I;  3S16 J;  4XKV A;  1L3L A;  1BR1 A;  2DK5 A;  2L01 A;  3T1H H;  3GJX B;  3CTA A;  4F93 B;  4Q4D A;  4XLN F;  5H80 A;  1E4F T;  5IPA A;  2ID6 A;  4BY1 J;  4RCN A;  4A0X A;  4CMD A;  1AHD P;  1P16 A;  5CE8 A;  2HHH H;  3H5A A;  3AW8 A;  2G7H A;  4JXU A;  3RJP A;  1X4P A;  5F0C A;  3D1N I;  3BY6 A;  4IHW A;  1O3Q A;  3G73 A;  5HNH A;  4UCT A;  3CC7 I;  2V7F A;  4PJJ A;  1S97 A;  5J2U F;  1ZGJ A;  2DA3 A;  3P9K A;  2GXB A;  2YW2 A;  2KRH A;  5KFG A;  5B3S H;  1WVR A;  3EUH C;  4L9J A;  1I1M A;  3GTG A;  1GLV A;  4O86 A;  4O5V A;  1ZG1 A;  3RYR A;  3F72 A;  3O8G A;  1XPX A;  3C7J A;  3I56 I;  4Y4R A;  5F1J A;  1OCR H;  2XPV A;  1ZQ3 P;  2CUE A;  3ABU A;  4UB8 C;  3A03 A;  5J1Y A;  5BWV A;  3LOC A;  1E4E A;  2JSC A;  5HS9 A;  1LFP A;  5AON A;  2ETH A;  3AAF A;  1WJB A;  2ELJ A;  3VPD A;  1C0W A;  4YIR X;  2VBZ A;  4IF4 A;  5FKO A;  2KT0 A;  5EEA A;  4DV3 H;  4LSA A;  2HPI A;  2XD4 A;  1W5C C;  2RDP A;  1XMA A;  2WAQ N;  4JP0 A;  1W1W E;  1YIO A;  2PI0 A;  4XIC A;  2K9N A;  4BJ6 C;  4PZ6 A;  2Q2U A;  4LG0 A;  2ZGI A;  3JRX A;  4XN3 A;  1KJ9 A;  3S17 J;  1LQ1 A;  2HIV A;  4ECV A;  3H36 A;  3GXO A;  3WGG A;  5KG0 A;  2W7O A;  2Y0S N;  3OYI A;  1DDN A;  2R7L A;  4B44 A;  4X0G A;  3J7A Y;  1PYV A;  5ILU A;  5E3O A;  3QPH A;  4Y3O A;  3MKL A;  1QHG A;  2IS2 A;  4FFO A;  3FXJ A;  4P5O A;  4XRF A;  3Q5F A;  4PSW A;  4QPQ A;  2IXS A;  3BZC A;  3NBZ B;  3JRH A;  4TV9 F;  4PGH A;  3GTM J;  1K83 J;  4WXD A;  1MZB A;  1J9I A;  2CNV A;  4HZF A;  4L9T A;  3UR3 C;  4NZM A;  2NS7 A;  2ZC2 A;  5KG2 A;  4PJL A;  5BNG A;  4XRM A;  3WTW C;  4MA5 A;  3EYI A;  3HB9 A;  3DTK A;  5IOZ A;  4YFK F;  3K4B A;  1DGS A;  2IPQ X;  3SEZ A;  1HC8 A;  3K3P A;  1M0W A;  4DL6 A;  3CO6 C;  2ASD A;  1MBE A;  3U21 A;  2M7A A;  5CA1 F;  3VOT A;  1YJN I;  1HBX G;  2GQR A;  2F4O B;  3I4N G;  4B3S H;  2L2O A;  1WJ5 A;  1FC3 A;  1ZG3 A;  1G6N A;  3CJN A;  1QO0 D;  2KIS A;  1N75 A;  1F4K A;  3R23 A;  2L9S A;  3L2V A;  3JW4 A;  4MLO A;  1QNT A;  2LY9 A;  5D8K B;  5K7Z A;  4JUZ A;  2W9B B;  2P8T A;  2DPU A;  2Y48 A;  3SDG A;  4XKC A;  2XIG A;  3OYA A;  3JRE A;  3U9S A;  4DV0 H;  2VOO A;  5CB4 F;  2JVG A;  4JYK A;  4N4O B;  1PP8 F;  3WHB A;  2DMT A;  5BPH A;  4IIJ F;  2WB1 E;  5GTI C;  5DG8 A;  3RAX A;  2VUM A;  5M5X J;  3JAM K;  3JTH A;  4FFR A;  1P4W A;  3WNZ A;  4P96 A;  2F5D A;  3GO5 A;  3KZY A;  4RAG A;  1YTY A;  2FQ3 A;  4C30 A;  1A0G A;  3I4N J;  3LWF A;  4IWY A;  5KFP A;  4IHV A;  4KUM A;  2DXI A;  4ZYD A;  1ON2 A;  2FX0 A;  1TC3 C;  5K5O A;  1FEX A;  4M6Y A;  4UUS A;  1K4S A;  3WE3 A;  3P7N A;  3DKX A;  1C30 A;  3GIL A;  2C28 A;  3M9A A;  4LF9 H;  1H8A C;  4MQ9 F;  4ITV A;  1JIH A;  3DLL F;  2OCC H;  5KT2 A;  1FYL A;  1ON1 A;  2F2E A;  2M34 A;  3K1P A;  3OYD A;  4FBT A;  1A9X A;  4ECW A;  1SFE A;  3S1R J;  2D45 A;  2O9L A;  1N78 A;  3JRW A;  1S0M A;  1VQ8 I;  3I59 B;  1IDZ A;  1R4N B;  1WRJ A;  1R9T A;  1XNR H;  2PMZ A;  2LMD A;  4CYC B;  3KZI C;  4G6T B;  4M3G A;  1A6Q A;  2K3F A;  1LFB A;  3GTL J;  5KT4 A;  3VMM A;  1XMX A;  2WB1 A;  5BPF A;  2KPM A;  3VDX A;  4AWX B;  2YZN A;  2NAZ A;  3I5U A;  1TWF J;  3RTR A; 
#chains in the Genus database with same CATH homology
 3C2H A;  2KMU A;  4DIQ A;  4F55 A;  1LDK B;  3KEY A;  2W82 A;  5FD6 A;  2MCT A;  4D1Q A;  2XDV A;  4CZC A;  3TY9 A;  3TL4 X;  3OYL A;  2VXZ A;  4RAZ A;  2L7K A;  5JHF A;  1MMD A;  3QYB A;  4E6N A;  4PFP A;  3N44 B;  1CKM A;  2CV1 A;  4CC6 A;  3N42 B;  4AYB A;  4B3M H;  3H9G A;  4E7Z A;  2VPS A;  2LYC A;  3KX2 A;  3MKW B;  1V5G A;  2WY7 Q;  3SDB A;  3PN1 A;  5A2Q W;  5FPO A;  4IZZ A;  3CVZ A;  4E4H A;  4PZ8 A;  4GKK H;  1WJE A;  4PZ7 A;  3K6G A;  2VQH A;  4ANJ A;  4E7H A;  2WAF A;  3T1Y H;  1DGR M;  4PJN A;  4DR5 H;  4XNF A;  3OYK A;  2IGN A;  2MYS A;  1UEL B;  5D1O A;  2VB6 A;  1IBL H;  3K4K A;  4J0M A;  2Q2T A;  3HPG A;  1E4G T;  3G2B A;  5KNL A;  1HNX H;  1P8L A;  4DR4 H;  4EFB A;  1TT0 A;  1LKX A;  2E1M C;  1IBK H;  3VYU B;  1S68 A;  4XLA A;  5IWA H;  1G59 A;  1WJF A;  1D1A A;  1DGW Y;  2Z16 A;  2BVL A;  2W57 A;  3OYB A;  2HNH A;  2BW3 B;  3RSN A;  2VUG A;  4DV2 H;  2ZJT A;  4IQJ A;  4UFZ A;  3FHN A;  4X62 H;  4PUS A;  4ZYA A;  1UAA A;  1LVK A;  1NG6 A;  4CCN A;  4CSW A;  2XAU A;  4ZTJ A;  1SEI A;  3BA9 A;  3LL7 A;  3CF2 A;  3AKZ A;  3OIQ A;  2FUG 2;  4DUZ H;  3HOS A;  3MMY B;  2W4S A;  3M4I A;  4N4N B;  2VPL A;  4UCU A;  3VYT B;  3BC8 A;  3J80 W;  3DLA A;  2DOA A;  1X1C A;  4UCO A;  1BOB A;  3W2V A;  2HVR A;  3PFY A;  4BDY A;  4APM A;  3N40 P;  3CZ6 A;  2E5N A;  3L4J A;  2HQA A;  4DUY H;  2JVH A;  2LOO A;  2WAE A;  4FET A;  3OTO H;  1HNZ H;  2Z1D A;  1B04 A;  3DTI A;  4B3X A;  2E1M B;  2UV1 A;  4EAT A;  1WH2 A;  1XK5 A;  2I8D A;  3HKZ A;  4LF5 H;  3OYJ A;  2V6E A;  1O75 A;  2KL4 A;  1MMA A;  2KDO A;  4BAC A;  4BXF A;  1IBM H;  4B43 A;  4X64 H;  4E7S A;  3EPZ A;  2UWM A;  4OX9 H;  2IS1 A;  3HUG B;  4KIT B;  3ZCO A;  4JI3 H;  4F92 B;  3RTX A;  3GB8 B;  2WE6 A;  1CKO A;  4LF4 H;  3S3M A;  3OS2 A;  3RPU D;  4II3 A;  3EYY A;  3IP4 B;  3OIP A;  1X9N A;  2QKL B;  3DQV C;  4DR7 H;  3N41 B;  4K0K H;  3OYF A;  4GRI A;  4ETS A;  4BE0 A;  3K4M A;  3OR1 C;  2LY1 A;  4HG2 A;  3J81 W;  2UUA H;  4C9Y A;  4II2 A;  2KHM A;  3KYH C;  4ZDP A;  4IKF A;  5LMU H;  5HLT A;  4AU7 A;  3DKY A;  4BUP A;  1FJG H;  4NC8 A;  4XOR A;  4BEH B;  1Z3X A;  1YX3 A;  3VNN A;  1AA7 A;  1HNW H;  3W3C A;  2FE3 A;  4DV5 H;  4E7J A;  2L9N A;  3IG0 A;  3OWT A;  4AVZ A;  2MC4 A;  4LFA H;  2V26 A;  4XOT A;  4JOM A;  3J7A K;  4PJM A;  3BAA A;  4C2T A;  2CFO A;  3M1C A;  3H5N A;  1HA8 A;  1V5F A;  4QPO A;  4NNJ A;  3VWB A;  4R79 A;  3CP8 A;  1N36 H;  1EA3 A;  4OAZ A;  4IX7 A;  3M8J A;  1AN7 A;  4LF9 H;  1Z3Y A;  3RIZ A;  3VSK A;  2CS3 A;  2OV7 A;  3KYL A;  3LMM A;  5FLX W;  2CV0 A;  2V1N A;  2WBM A;  1BJT A;  1ZHQ A;  5TGT A;  3EUA A;  3EUK L;  4U7B A;  1SFK A;  3SYT A;  1VZ0 A;  4J01 A;  5LD2 C;  2DJI A;  2LH9 A;  3PSI A;  3VYR B;  3N43 B;  1N33 H;  5D1P A;  1D0Y A;  4ZC3 A;  2Q2E B;  1VS0 A;  3C0F B;  2LY2 A;  3F8N A;  2W00 A;  3KAL A;  1S03 G;  3K3V A;  4Y33 A;  3S3O A;  2XSJ C;  2HU9 A;  4E7L A;  3K10 A;  2R7T A;  2A6T A;  4CUG A;  4FM9 A;  4XL9 A;  4JI7 H;  1WJD A;  1JI8 A;  3RGX A;  3PL8 A;  3FBN B;  3DU5 A;  4BEH A;  2R7R A;  1L2Z A;  1SAU A;  2AQE A;  5CKT A;  1K6Y A;  4CC5 A;  3NWT A;  4E7K A;  3N6X A;  3JAM W;  2KP6 A;  3L2Q A;  4KHP H;  2PJR A;  4RM3 A;  5LL6 b;  1FMV A;  2RQQ A;  3DPL C;  4F91 B;  3HG9 A;  2LBF B;  4JI0 H;  2JA2 A;  2VJJ A;  4RB1 A;  5CPR B;  2VJI A;  2X1E A;  1GLN A;  2NOJ B;  3A1Y A;  4DV6 H;  3DWL E;  2HZD A;  4H4K C;  3FMA A;  3ZR8 X;  4AQY H;  1CKN B;  3NWS A;  4X66 H;  2VL8 A;  4ZJZ A;  4EEQ A;  2VJ4 A;  4XLH A;  4PSX A;  2W7N A;  4A2B A;  4DV1 H;  3DPU A;  1X4O A;  2M0M A;  2RRE A;  3ZRG A;  4EQ5 A;  4DJA A;  1Z21 A;  2JUG A;  3MKY B;  3OYH A;  3L2P A;  2K5C A;  3OL3 A;  4NQW B;  3OYC A;  3HL2 A;  4C2U A;  2KZV A;  2R7S A;  2GOM A;  3C2G A;  5BR8 H;  5IT9 W;  1T95 A;  1GYF A;  2CFM A;  4XLC A;  4DGW B;  3V42 A;  3VYS B;  3SZG A;  3S93 A;  1D0X A;  4DV7 H;  3D5S C;  1V5E A;  3PNY A;  1ZHS A;  4BQQ A;  5CQG A;  3BG7 A;  4F52 A;  5FRM A;  2OC6 A;  3AFH A;  3W5O A;  1XMQ H;  4JI1 H;  1XNQ H;  3H9Q A;  3S3N A;  4DR6 H;  2WA0 A;  2K3P A;  4YHH H;  4YEL A;  1FKA H;  2KLO A;  1I6U A;  4DRF A;  1ZEL A;  1A0I A;  3GDE A;  2OWO A;  4HNT A;  3LFU A;  1R6R A;  2R7V A;  4P1W A;  4LH7 A;  2UUC H;  4RM2 A;  1QU3 A;  4XMY A;  2XF5 A;  3OS1 A;  3PJR A;  4RB2 C;  2K9M A;  2LBF A;  4CCM A;  4DR3 H;  4A2A A;  2X85 A;  3OS0 A;  3RGZ A;  3MWM A;  3ZXS A;  2YCH A;  2F4V H;  5LFA A;  3N05 A;  4BE2 A;  3W2W A;  2X1D A;  4OAY A;  1FVI A;  3K4N A;  2KQR A;  2O03 A;  1NG7 A;  3OYN A;  4LF7 H;  3OYM A;  3ZQQ A;  2CUJ A;  2F5V A;  3DEE A;  4IQ4 A;  1ERD A;  4NC7 A;  2VJ5 A;  1BR2 A;  4J00 A;  3S24 A;  1QHH D;  2P0W A;  4PK4 A;  4BU2 A;  4MTE A;  3K4C A;  1Z2P X;  4HSR A;  3QOD A;  2WDT A;  4Q0Y A;  4UCS A;  3LML A;  2BW3 A;  1G8X A;  2HVQ A;  2Q1Z B;  4E7I A;  2Y0S A;  4HST A;  4DR1 H;  2CUZ A;  3PSF A;  2IGM A;  4RLF A;  2VKH A;  2ZSI B;  2R7X A;  2M7B A;  4JI4 H;  3KXY T;  1N32 H;  3OYE A;  4RMN A;  3TMO A;  5HNF A;  3L2R A;  2X6Y A;  4UCV A;  4I7H A;  5EOY A;  3CP2 A;  2M4G A;  2X6X A;  2DT6 A;  1X19 A;  3DTE A;  1FMW A;  3DU6 A;  3K70 C;  4DR2 H;  3BCB A;  3BLY A;  4YRV A;  1W36 C;  4B3R H;  3PNT A;  1DP3 A;  2ZXH A;  2XC7 A;  1Z2N X;  3OMY A;  1PJR A;  3H0D A;  3OY9 A;  4RB3 C;  1Y6I A;  2ZSH B;  3QOE A;  2WAD A;  4F3Q A;  3DF7 A;  2GOX B;  4LH6 A;  4LF8 H;  1U0J A;  4HEA 2;  4CH7 A;  4MTD A;  2F4I A;  2E5L H;  1D1B A;  4JI8 H;  3LSI A;  4XLE A;  3ONQ A;  4RAY A;  3ZGK A;  3D5L A;  3TY5 A;  2XF6 A;  2R7O A;  1X1D A;  2VAS A;  2R7Q A;  4FAS D;  4BDZ A;  3FKJ A;  1Z7L A;  5KCM A;  4BQO A;  3H5R A;  1D0Z A;  4ZTF A;  3RCO A;  3PNV A;  3OL4 A;  4NXN H;  3OR2 C;  1D1C A;  3HC7 A;  3NC0 B;  1WFX A;  2X51 A;  5FPR A;  4BGD A;  1WJC A;  2CW7 A;  3RQ4 A;  2MAB A;  3UNG C;  4XOP A;  4HPQ A;  4LFC H;  2UU9 H;  4BJ5 C;  3AL0 C;  2VQL A;  2A5W A;  2M4K A;  4U87 A;  5D1O B;  4BS9 A;  1WJA A;  4LFB H;  2LC2 A;  4XKB A;  4XN0 A;  2HGS A;  3NBY B;  2QKM B;  4IAJ A;  2E5Z A;  3QYF A;  3CJR B;  2IS4 A;  1YE9 A;  4R7R A;  2JSP A;  3OOU A;  3D5R C;  1BR1 A;  4XKV A;  3T1H H;  2VQG A;  3GJX B;  3TBI A;  4F93 B;  4RB0 A;  3HOT A;  4NUB A;  1E4F T;  4JYA H;  4KJZ A;  3LSM A;  5KHD A;  2BVM A;  2VXD A;  2KSW A;  1P16 A;  3K4L A;  2HHH H;  3H5A A;  4GLX A;  3GBG A;  1X4P A;  1MW7 A;  4LF6 H;  3CES A;  3PUB A;  5HNH A;  4UCT A;  1OR7 C;  2V7F A;  4PJJ A;  4YEJ A;  3SEQ A;  3CJQ B;  1N34 H;  2KRH A;  2DCE A;  3QWU A;  3EUH C;  4LMY A;  4JI6 H;  3DPT A;  3AL0 B;  2HVS A;  4KIS A;  3KAJ A;  3KAK A;  3VSL A;  2E60 A;  4Y4R A;  4B47 A;  4X65 H;  2UXB H;  4LIU A;  2M3A A;  4XLF A;  1MMN A;  2R7U A;  1TAE A;  4E6K G;  1MNE A;  1LFP A;  4DBQ A;  2R7W A;  1WJB A;  4JV5 H;  4DV4 H;  1BR4 A;  2ELJ A;  4JI2 H;  4XM3 A;  3LSH A;  4DV3 H;  4LSA A;  2HPI A;  2CMP A;  4XKW A;  4RLQ A;  2LRD A;  2VLA A;  1E0E A;  2CH0 A;  2DT7 B;  2VQF H;  4BJ6 C;  4PZ6 A;  1I94 H;  2Q2U A;  4JI5 H;  1M0T A;  5FRO A;  2VOB A;  4XN3 A;  4CCL A;  4ZDO A;  2HIV A;  1J5E H;  2OUM A;  3IUO A;  3OYI A;  4B44 A;  4YY3 H;  3L4K A;  4X0G A;  3J7A Y;  1PYV A;  3A2K A;  2UXC H;  4BWS C;  3QYE A;  3K70 D;  4Y3O A;  1CKN A;  1MMG A;  4MV9 A;  1QHG A;  2WAQ A;  1MND A;  1W36 D;  2IS2 A;  4P5O A;  5FD5 A;  3A4C A;  4PSW A;  4QPQ A;  2IXS A;  2Z2S B;  3NBZ B;  2MD0 A;  2VQE H;  2AQF A;  3UQ8 A;  3E1S A;  2L5Q A;  4XR6 A;  5HOO A;  1MZB A;  2ZM6 H;  3UR3 C;  2RGV A;  1XDN A;  4MV7 A;  5LMN H;  4PJL A;  4PFO A;  2X1C A;  1KON A;  3DTK A;  2IS6 A;  3K4B A;  1DGS A;  2IGO A;  3SEZ A;  4GKJ H;  3W1B A;  4CCO A;  2RGR A;  4CCK A;  2UUZ A;  4BQN A;  1M0W A;  3U21 A;  1UG0 A;  2M7A A;  3BAB A;  1YX5 A;  2CW8 A;  3S8P A;  3S32 A;  3W1G A;  4B3S H;  2L2O A;  3MKZ A;  1WJ5 A;  4JQF A;  5FRN A;  1BGW A;  3JSL A;  1N77 A;  2LG4 A;  1N75 A;  1OLT A;  3IAM 2;  1TA8 A;  3BA8 A;  2L9S A;  2VKD A;  3L2V A;  3H9J A;  4MLO A;  3E0J B;  3JSN A;  1DQU A;  4LIT A;  4LIV A;  1T0F C;  3I9V 2;  1X1A A;  2RNG A;  3HPH A;  4XKC A;  3OYA A;  3FBI B;  4BE1 A;  2XIG A;  4DV0 H;  3MD2 A;  3L2W A;  2JVG A;  4N4O B;  2F6C A;  3H20 A;  3RR5 A;  5CQE A;  2CV2 A;  2WY8 Q;  1IRX A;  3TY8 A;  2WYO A;  3OYG A;  1XMO H;  1Z2O X;  1SYX B;  4NXM H;  4DOZ A;  2HDW A;  2UXD H;  1HR0 H;  3RJ0 A;  2O5R A;  2W1O A;  3LSG A;  4C30 A;  4B48 A;  1S9H A;  1Y56 A;  3IAS 2;  4RZQ A;  2K9L A;  4UCR A;  4DBR A;  4PDB A;  2DXI A;  2BOL A;  4KT6 A;  3BG6 A;  4HNU A;  2KRC A;  3K4J A;  4LG3 A;  2PJR B;  4BL0 B;  2ZXI A;  4D9J A;  3DKX A;  2UUB H;  4M7E A;  4CCJ A;  4CA0 A;  2X6W A;  1P9Q C;  2VQC A;  4ITV A;  3F9K A;  4XQF A;  5HVQ C;  3H35 A;  3RF2 A;  2ZFU A;  2HIX A;  5DIS C;  1X1B A;  2R4G A;  3OYD A;  4HRI A;  1TZL A;  3BCA A;  2V4J C;  1N78 A;  2MFZ A;  3I3L A;  4EFE A;  1J09 A;  4BJT A;  4B3T H;  2XF7 A;  3HXL A;  3LSK A;  3CMM A;  1XNR H;  2PMZ A;  4XON A;  4G6T B;  4ZDL A;  2VIX A;  2LRE A;  4OWR B;  2IGK A;  3FDY A;  2WB1 A;  2HPM A;  4LSX A;  2KPM A;  3VDX A;  3W2A A;  2V9K A;  1V9P A;  3L2U A;  3RTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...