5C1PA

Crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
289
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 89
structure length 289
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1pA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1pA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1pA01
2W6PA 4O7RA 3R5XA 3TW6A 1M0WA 2YRWA 3WO0A 4YB8B 4HR7A 2W71A 5LA6F 5J2UF 1KJIA 4YJ2F 2VPQA 4O7YA 2W6NA 5LXTF 2DZDA 3N8DA 3R23A 5GONF 3OUUA 3U9SA 4EG0A 2YZGA 1IOVA 3HB9A 2ZDHA 5BPFA 1W93A 2YRXA 5HV6A 2CNUA 3JZIA 1GGOA 4O7LA 4DLKA 2NU7B 4O4HF 4EAAA 1KBLA 1VBHA 3U9TA 4MV7A 3TQTA 1Z2PX 4IWYA 1IOWA 3Q1KA 4MA0A 3WNZA 3QFFA 3VPBA 4C5AA 2CZGA 4YAKB 4O7VA 3V4ZA 4O86A 3GLKA 1CE8A 1UC9A 4M99A 1ULZA 1EUDB 4XYMB 1Z2NX 1KJQA 3JZFA 4HNVA 3I12A 4MV3A 2DWCA 3K5IA 3UFXB 3KREA 1UC8A 3RV4A 3KAKA 4IHJF 4E4TA 5DMXA 2VR1A 1KJ8A 4M9CA 4HNTA 2FPPB 1BXRA 1OBGA 2Z02A 4MV1A 5JH7F 4FE2A 3NUAA 2GQRA 4C5BA 3R5HA 2R7KA 2PN1A 5KX5F 1I7LA 1CS0A 2VHEA 4EABA 2GLTA 3E5NA 2DLNA 5CAEB 4MV4A 3VPCA 3MWEA 4FFOA 2R87A 2CQYA 1M0TA 5J2TF 1EYZA 2V58A 1JLLB 1VBGA 3MJFA 4M98A 2FB9A 4MV8A 5IYZF 4GGMX 1DV2A 4EA7A 4RZQA 2W6MA 1E4EB 2R7LA 2J9GA 4FFLA 4ZOLF 4EGJA 5CB4F 4I50F 2YL2A 2YS7A 4O82A 4ZQIA 2P0AA 4O7TA 1GSHA 2PVPA 1KJ9A 2FP4B 2C00A 3BSYA 3LWBA 4J6EA 1M6VA 3WO1A 3N6RA 2YYAA 2NU8B 3R9RA 4YAJB 4FGRA 4O4JF 3TINA 5K2MA 1A48A 1KUTA 3AW8A 1B6RA 3TIGA 3ORRA 3U54A 4QSHA 4O7ZA 3R5FA 2YS6A 4O81A 3OUZA 3LP8A 4MV6A 5BMVF 4EA9A 1GLVA 4MV9A 2NU6B 5LYJF 3G8CA 4TV8F 2R82A 4HQ6A 3TIIA 2ZDQA 3G8DA 5H80A 3JRXA 1E4EA 3BG5A 2W6OA 2YZNA 4YBZB 5LP6F 2GQSA 4O2BF 3BFPA 5CA1F 2NU9B 4ZI7F 1KJJA 5LOVF 2DIKA 1JDEA 2R85A 1GSOA 4HNUA 2XCLA 4C5CA 3VA7A 2HJWA 1EUCB 3BSSA 4DIMA 1KEEA 5C1OA 1A9XA 2R7MA 1EHIA 1JDBB 3VMMA 4O4LF 2HGSA 2Z04A 1PX2A 2V5AA 5C1PA 1BNCA 2QF7A 2CNQA 4IWXA 4TV9F 1C30A 2CNVA 2NPOA 2GPWA 2R86A 5CA0F 4MA5A 3K5HA 3RFCA 4O7WA 3U55A 2W6QA 4XYLB 2I80A 1DIKA 3SE7A 5KKNB 1W96A 4O7NA 2YZMA 1AUVA 5FNVF 4L1KA 2OLSA 1C3OA 2YZLA 4O84A 4FFNA 4O4IF 4IIJF 2R7NA 3ETHA 5D8DA 4NYEA 3HO8A 3ETJA 2I87A 2WYOA 4XX0B 4FFRA 4EA8A 2NUAB 3Q2OA 1EZ1A 2QK4A 3GIDA 3AX6A 1AUXA 2FPGB 4WBNF 5JVDF 4M9UA 4O2AF 4ZHQF 5C8YF 5I47A 4I55F 4O7SA 4FFMA 2VQDA 3KAJA 1CQIB 2FPIB 4O83A 4IZOA 3K3PA 1PK8A 2IP4A 1CQJB 1B6SA 3VPDA 2YW2A 3MWDA 1Z2OX 3JRWA 5JQWA 1GSAA 2XD4A 2SCUB 1VKZA 1I7NA 4WD3A 3RV3A 2I8CA 3KALA 3V4SA 1T36A 5EZYF 4Y8VB 3ORQA 5BPHA 4EGQA 2ZDGA 2R6FA 3BSWA 4FU0A 1WR2A 2W6ZA 2R84A 3VOTA 2W70A 2V59A 5HBRB 3RUPA 4ME6A 5JVLA 1SCUB 3DF7A 4XZ3B 2X0SA 1DV1A 2YWVA 1JKJB 4MAMA 3HBLA 4YJ3F 1OBDA 5JQGF 4TUYF 2GPSA 1KC7A 4FFPA 4I4TF 2PBZA
chains in the Genus database with same CATH superfamily
5AH0A 1GRVA 1JHOA 2A9RA 5E0OA 2V6IA 1CW2B 2YV3A 3ORHA 5D1PA 4XWGA 2Q5JA 4JC0A 3WGVA 5EMMA 1UK9A 1D7AA 1UT5A 4E5UA 4ZGBA 4HZIA 3SYNA 4H7DA 1YZHA 1TAUA 3L1HA 1DTWA 2ZJFA 3FGOA 3C6BA 2Z3WA 2HO5A 1UOPA 3TD9A 1AKVA 4TVIA 1WCMA 3W2FA 1L7DA 4O7YA 3WGUA 4P22A 1IN5A 2V5VA 5TARA 3U3XA 2H07A 3FPSA 2OYRA 4LRWA 1GQFA 1UBCA 2IF2A 4RY9A 4KRXA 5KX5A 5J63A 4M0KA 5HG0A 4V0SA 3AM1A 1NNUA 2QW1A 4DBVO 2L82A 1I2CA 4TWRA 1X1SA 4PFJA 3QLEA 3HEBA 5TVGA 3FETA 1QG6A 1JTFA 2J3IA 4IL5A 1ISPA 3M6FA 4FYMA 1I4EB 3TVDA 4CCWA 3GDWA 5LIRA 2XWSA 2E1PA 2M6RA 3CLVA 1M1XB 1J39A 4KQGA 1WB6A 4RXMA 1KS2A 1TYDE 3KOXA 4TZTA 4UHBA 3FPKA 1TCVA 4P4SB 3V8QA 1QO0D 4HDMB 2ZXFA 3I2IA 3L7OA 4KO3S 4KO8A 4TT8A 4QGHA 2VTBA 1GGOA 4KH0A 4WNAB 4GT1A 4BMPB 2Q2UA 1KZGB 2C20A 3GA7A 3PNSA 1MT3A 1O89A 5K8VA 4M8LA 1TXGA 1F3LA 4J43A 4BZZA 3I05A 2FW8A 3M3PA 2PS9A 4NESA 4ESEA 3DKVA 3WV4A 4YMHA 4ZJPA 3CLRC 5I5YA 4TS3A 1F8FA 2VP9A 3WIBA 2IGBA 1F5SA 1K6XA 4PPYA 4TKUB 3MMXA 5IYZB 3IQDB 1LC3A 3NEAA 5JI3E 2BD0A 3AUAA 5ICMA 1E5XA 1M1NB 4GOOD 2WJJA 4K1XA 2ODEA 1CHNA 3VSAA 3KQSA 1U0HC 3TRIA 5LYYA 1P44A 5LA6B 2JAUA 1M72A 4Z7JA 1NUHA 3VPBA 4CLXA 4NECA 1KMNA 3S40A 3W05A 1QP8A 3UAVA 3V4ZA 4J29A 3FUWA 3GLKA 3QG1A 5ALJA 2L17A 1T26A 5AVJA 4BEWA 4V1CB 1AKUA 3WNBA 4ZTUB 3T3OA 2P90A 1CY7A 1JRLA 1QMGA 5BSUA 1VBKA 721PA 1ZJJA 4G63A 4JI7H 4L0DA 3GMTA 5CLGA 2QE6A 4N7JA 2Z6QA 4G5SA 3D6MA 4G5HA 5IMBA 5BR4A 2VF8A 4Y9SA 5LZ2A 1Z2NX 1T2FA 1H0RA 3DAPA 3TG2A 2Q1WA 2ZR0A 3FTCA 3K0CA 1CJMA 4X20A 1J00A 1IWPB 5DFAA 4RU9A 3CNQS 5AI0A 1D4FA 1JAHA 1U1EA 1Z35A 3ABRB 2OWDA 4YHBA 4ZI5A 2B9EA 2DT8A 3CR7A 4UZSA 4MUAA 1XU7A 3LBNA 3MHPA 5COBA 5FPKA 3BJYA 1M6NA 4QA9A 3T9BA 3ECCA 4JUDX 1E5DA 4XWTA 5CLIA 4YTEA 4B45A 1XWIA 3N0XA 4NENA 5J3JA 1FUEA 2Z6VA 3JATB 2ZULA 2Y1WA 4JT8A 1CS4C 2OV4A 3MMSA 4KQEA 2XB8A 4ENWA 3HKEA 1RADA 1XZBA 2CL6X 2VVTA 1P9LA 1C7QA 3IT0A 3S4YA 5AKGA 3UCXA 4EABA 4DMUB 4YPOA 3R8CA 4JI1B 1I14A 2C3OA 5DXFA 3TIXB 1THTA 2EZ8A 3H9CA 4WV3A 4X6UA 3TS1A 1ECFA 3TG8A 2ZBGA 1R4MB 2JIBA 4MV4A 3M9LA 4IIJA 4DCJA 5KT5A 2PZKA 2ZREA 3CZMA 2AOTA 3LA8A 3B1ZA 2EAUA 2AN9A 1LBSA 1YI1A 3NDPA 1T0UA 4X1KB 4X9XA 1XZDA 4NENB 1JECA 2R8EA 3DXYA 4X94A 2V4MA 4B46A 2CBZA 3ZIAA 2UUBH 3THWA 1MEOA 4RCYA 2EHDA 3EIWA 1Y9ZA 1BFKA 4IQ8A 5FX2A 1TUEA 3NRBA 4ZCPA 4YRPA 1A9TA 3T9FA 2G5PA 2Q99A 3PXDA 2DU8A 2RBGA 3UWKA 4A3EG 1T34A 1ZIYA 4DUGA 4MYDA 1WBJB 3PDCA 1V11B 5INTA 1T3HA 2I55A 2GCPA 2J9GA 4EVRA 4Z8XA 1GD1O 3PV0A 5CFMA 1KT8A 1V5GA 4HUJA 3PUVA 4Q48A 4I14A 5I7VA 1F8XA 2PSJA 3EMKA 3OCYA 4MKXA 5KYWB 3KQHA 5KNCD 3H4TA 2FQYA 1IG0A 2ATXA 2WUFA 2XCAA 2CMGA 2PFSA 1QDLB 1OBOA 4U9IS 3B13B 2YL2A 4O82A 4ZANA 5CW1A 5HS6A 3V80A 2EFCB 2CV1A 5C7LO 3QEAZ 2PGIA 2XF2A 3ROPA 4C4OA 1QFXA 3JYQA 4G1EB 4OGLA 5AQ1A 3PHCA 4B8ZA 2RH5A 4PZUA 3VR1A 2EFJA 3LRXA 2QOEA 1O5TA 2JDIA 1ISMA 5JO0A 4E5YA 3UGJA 4ALMA 2C0CA 2DY1A 1LY1A 2LGJA 1E9EA 2XF8A 1NJ1A 13PKA 2P5UA 3D6AA 4OCZA 4OSOA 5DQGA 3VNQA 3Q8QB 2WAMA 1C81A 1ENZA 1ZCZA 4D0GA 1ZN8A 2VSYA 2P2CA 3E7XA 1PDWA 2HNKA 3QVKA 4IDEA 1YNOA 5CNJA 3OTHA 8AT1A 3V8RA 2VT3A 3N2KA 4WA7A 4QICA 1TCAA 1YR2A 1XYVA 1KI7A 3AY3A 4BLSA 2ZJ8A 6GPBA 3I4CA 3WK8A 4C4YA 4YYZA 3H19A 3ONDA 3UYLA 3O26A 4S2EA 4CMKA 4U2CA 4UOZA 4DB4A 4PGAA 1YZQA 3AW8A 1H2RS 1TC1A 2Z5LA 3M49A 2ZTUA 3AHDA 4XWKA 3PQ3A 3PC2A 4QM7A 2Q7XA 4ZAZA 1XAJA 3NDRA 2GN1A 3KAQA 5FD8A 5LP6A 1O95A 3U17A 3U54A 3SEQA 2X15A 4MWDA 4YAWA 3C3KA 2C2OA 1A96A 3M7IA 3ZY2A 3WGNA 4PZLA 4HPXB 2EG5A 2IV3A 3EW7A 4N0EA 2FG6C 4RWZA 1SR8A 3HR4A 5LR6A 2HWKA 3F4LA 5HTKA 3MILA 2RC5A 3Q3EA 2L69A 4XGQA 2YHAA 1AHIA 3MBOA 3PD1A 3WDSA 3JQDA 4ACAA 5JD3A 4EQZA 4ALKA 4C3UA 1YDEA 1ZUNB 3TJRA 3HXQA 5AW6A 1EFTA 5TS3A 3MOSA 4RLSA 3A25A 3P0FA 5LQAA 4GRAA 3ER8A 3T5TA 4CQMA 5AI5A 1XD2A 2ZQYA 2ZZNA 4AQ7A 1JLRA 2B1IA 3AB7A 2G0NA 5IXSA 3GIIA 4JA2A 5FEMA 1XMJA 5G0WA 1FXSA 5EJEA 3Q98A 4J9NA 3FXAA 5BW5A 1Z4PX 3PS9A 2Z09A 4LYEA 2VEOA 1CY4A 1N0UA 4JVOA 5ALGA 5EUBA 2BGWA 3O75A 1TEVA 3OCVA 4MIYA 4OJTA 3BRWD 4K9PA 3T5LA 1Z4OA 1Q0HA 3H5AA 3NCTA 1HDEA 1J0DA 3ICVA 3OHPA 4HF7A 4I5FA 3RS5A 3FDIA 4N3BA 1RXSA 2J5KA 2QRVB 4NMHA 1K5GA 4YJHB 4PLYA 5JNTA 1Q12A 4MS1B 2YDYA 1G7SA 4K2AA 5EP1A 2FLVA 5DT2A 4D45A 5J59A 5F77A 4NLGA 1BRMA 1KMHA 3FAZA 3H97A 3SZRA 3K16A 5KYXB 3IPCA 1N75A 4PXSA 4ZZ2A 5ALZA 5C80A 2QEQA 3GEDA 1KJWA 4GQIA 3TCXB 3B3FA 1PR3A 3TZLA 1RU3A 1HDRA 3OEYA 5EMHA 1M8JA 4TQAA 2P2GA 5C3MA 2WD7A 2WFZA 3QBTA 2XMCA 3RRBA 3GLTA 2VDNB 3Q85A 2PKYX 2NO5A 4UJ5A 5KG5A 5I4CA 4L5YA 2VHUA 2Q3BA 2XQJA 2ZIWB 4MRAA 5DWVA 2C58A 5EJ2A 3TBFA 5JCXA 1Q77A 3A4MA 1E63A 1K1EA 1T24A 4B81A 4CM5A 4DLTA 5F2NA 1K1SA 4DV7H 2QMEA 3RJ9A 2M6KA 2PKWA 1GYQA 1EM8A 3WHIA 2EQBA 4M54A 4LOIA 5AOBA 2VDLB 4HLCA 5TE9A 1VAJA 2W2TA 5DSZA 5HQTA 3PJFA 4BWSC 1ZD9A 2GBPA 3ENZA 1UXIA 3K31A 3KPUA 3N8HA 1E9AA 1P75A 1UBNA 2P27A 2V9PA 5FV4A 2YZKA 4I7HA 4E32A 1O77A 1EHIA 1DC7A 5KQPA 4BKOA 1KOJA 2VNSA 1H1LB 1TTPB 1K63A 4DMKA 4B3XA 1HDCA 4TTQA 1TLFA 3USCS 2DULA 2FSVC 3Q9UA 5IT4A 1JG6A 1ZJWA 4B7XA 2NT3A 2NNLD 3HDTA 5EGNA 1W85B 4AULA 3CZPA 1ZVMA 3NVAA 4MOWA 3IT2A 4ND3A 1I50A 3QUSA 5FLEX 4IO0A 4BV3A 2F1HA 1M34E 3F8WA 1BNCA 3HO1A 4ZVUA 2QF7A 4W99A 1RXVA 3B70A 4DLBA 4PYJA 3UAWA 2C4MA 2X7XA 2Y6VA 4G3IA 1TK3A 3BL6A 3OA0A 4S1VA 4U7PB 4J3JA 4UM5A 1I9CA 4G65A 2XUAA 3HCAA 1A1VA 2C5LA 4MW4A 3QXHA 4YGYA 1QHHB 4A10A 2ZVPX 3E5RA 4V3BA 5GOZA 1NRXA 3QLTA 1CRQA 1EWYA 4WGGA 4AJIA 2ZSEA 5FD5A 4L4SA 3RIXA 2XMBA 2RH9B 3ZBTA 3EHDA 4AURA 1KBZA 2X40A 3RTCA 3DZBA 4A6XA 4BCDA 3UN1A 2ZUWA 2QLBA 5KJFA 2LV8A 3CXRA 2H1LA 5LOVA 4O7NA 2E2WA 4P0TA 1IY8A 3GEGA 3LVQE 4NARA 3NWBA 2D0OB 1R9GA 4NVRA 1NE7A 4QNRA 1YIDA 4A36A 2BHNA 5KO2A 3IKMB 1SBZA 2ZTMA 1IVNA 3CVOA 4CMJA 1XSEA 1DUVG 2RDJA 1XCBA 2JS7A 3LY9A 4FEGA 3D54D 4KIFA 3OMWA 3D6TB 2ZIFA 5KB3A 2BJHA 3L07A 4UOQA 1C0KA 4EH1A 4O0MA 4TTVA 4N18A 4HS9A 2HGXA 1HKUA 1FDUA 1C9NA 3D1LA 1Y3DE 2IPNA 4QLBA 3FOBA 2JRLA 2R7ZG 4IVPA 4X97A 5IJAA 1WZ2A 1IHDA 5I3ZA 1ECCA 4TLBA 5KYXA 4DV4B 4KCGA 5F23A 1AMNA 3UJDA 5BV0A 1AHPA 3R3UA 3KYCA 1NNSA 5CITA 5IZCA 5K0BA 5DGXA 1N0VC 4RMIA 2UXCH 5B3KA 5KFSA 4RHXA 1GPKA 1NJ2A 3EYAA 4R9SA 4BJHB 4NTZA 1JSLA 3AJRA 4E1AA 1A9ZA 4M9UA 1QBGA 2WF6A 3GCZA 1ZH4A 3KWJA 1BAPA 4O7SA 1BRTA 2NSJA 1ZI8A 4WESB 2VJOA 5DDIP 5FFNA 4ZV9A 1SC3A 3ZKWB 3V7YA 1OB2A 1X9NA 2VF5X 3WZMA 1GYPA 1CZHA 2IIQA 3T3GA 1K0FA 4PG8A 1K9SA 1PCXA 1Y6JA 3CUEF 1B0PA 3HYRA 3KOUA 1VL5A 2A5LA 2LE0A 5AIAA 5DX1A 1WR8A 3AEKA 1J8DA 3QF4A 4Q7QA 3F7NA 5F7OA 1YQQA 5DN6D 5HJ5A 2NYAA 3LXRA 2G4VA 1WY5A 3A26A 3HPRA 1ZUNA 1B6SA 3IODA 3KWLA 4BLUA 4HVLA 1SXQA 5JARA 1K6IA 5C34B 2OPHA 1DBSA 4JC5A 3Q40A 1Z0KA 2Q3EA 1NL3A 1FDOA 3IP7A 2C95A 1Q3HA 1E2EA 4TTAA 2JEFA 2JCVA 3I5UA 1ZHFA 2R92A 1YVRA 2JA1A 1F12A 2OCKA 2WP0A 3PFBA 5AM1A 4B2LA 3G0BA 2CCKA 5ED0A 1B6GA 3WSWA 4EHDA 3X44A 1VIAA 1YHZA 3HCCA 2HQ1A 4G25A 2FUNB 4F9GA 1LI4A 1JAIA 2SICE 5EZSA 1ZUD1 1W5FA 1IULA 2WWGA 2A8YA 3V4SA 1M2WA 1H2BA 4IFBA 3ORQA 1QFYA 4TL8A 1E7QA 3CCCA 3HKBA 2ZDGA 1DAGA 3CRQA 4BIIA 2G9UA 3KKNA 2QRKA 4G01B 2VQFH 2YZ2A 4K6GA 5JNVA 2G6TA 2CKMA 3K9GA 4A0RA 3KHGA 2V03A 3ZG6A 1G0OA 3PGVA 2ATIA 1PR0A 2N47A 1BU8A 2EBWA 3FYHA 3G2PA 3V34A 2CYAA 3QELA 2P35A 2IOQA 5T14A 2R93G 1Q0UA 4C4PA 1OROA 2WNHA 4GBGA 1J24A 4GFDA 4MAFA 2F8SA 1BX3A 1YI0A 1DJOA 4PWYA 2NUTA 3UMJA 1NBME 3MJRA 2C1ZA 1NTRA 1GR1A 1RAHA 2X9NA 2QVCA 1KKUA 1W0KA 3PW4A 2G82A 3JALB 3F73A 2IY7A 4CM4B 1M2NA 5LZ9A 1LUAA 3M6LA 3QI2A 5JLJA 1YKGA 3TO5A 3ZE1B 5F98A 1A3CA 2QTWB 3T5JA 3ZDRA 4YV0A 3PZBA 1OLXA 2IDKA 2PYZA 4YAFA 2PR2A 3A9RA 1JU9A 2FN4A 3QLVC 1U8CB 1RRFA 3CW8X 4OLHA 1N2CE 3MOGA 3SMVA 3DKRA 4F72A 4NEGA 5FTMA 1TAQA 2QTAA 3U39A 3ASZA 3GP3A 1JTEA 1GZVA 2HH9A 5LZ8A 4AO8A 4FFPA 1ZCJA 2ZAOA 3IE2A 2ZYHA 1JQEA 1XL0A 3FWPA 2E18A 4G1MB 1CFZA 3GTJA 2PQMA 4KO2S 3RG2A 3VTZA 3HSKA 4V0KA 4IFEA 2PVSA 2ZJ4A 5TT0A 2OYCA 4RTPA 4UXHA 4ZO4A 4HN9A 3UICA 2WU1A 3UW1A 1XEXB 4C6TB 1FL9A 5IVKA 2AZDA 2PL5A 3M3DA 3OHBA 3KSDO 1ECLA 3UOWA 1N9ZA 1RAAA 1UBGA 1NNI1 3E4CA 3FW1A 4R2XA 4AICA 4D3YA 1T3NA 1FVOA 3F90A 5ALSA 1N0WA 2R11A 3O4IA 3AJ8A 4ENVA 5C81A 4JDPA 5JBIA 1G21A 3QXXA 4U7TB 4YMWA 5B2ZA 4GSYA 3BF8A 3PGKA 4N5DA 4JBYA 3WV5A 1UEXC 5C5DA 3U9SA 1SNYA 4AYTA 5TPZD 3MJCA 5TNXA 3KOWA 1WDMA 1X7YB 4A4DA 1MQSA 2YZGA 3OQPA 4RVOA 5CLQA 2W2OA 4DV0B 4PYLA 4MW0A 4ZQCB 4AKTA 4EB6A 1XUOA 3HBNA 2JFPA 2QA5A 1W5SA 2WW8A 2YTZA 1J5XA 3AJEA 3SEAA 4KO1S 3LFHA 4U7HA 4XJVA 2X9VA 1N5LA 2HY7A 3MD0A 2RK6A 4QECA 3GNQA 5MGBA 1PD0A 2QBYB 2O3QA 4KXMA 4EI9A 3BD8A 4W5TA 2F6RA 4O4HA 1Z18A 4Q7MB 2AWOA 2D5CA 5CEJA 4HFRA 3T99A 2A67A 1V4BA 3L46A 1SU4A 4ZAYA 3OT4A 2BKVA 3JQAD 4C6HA 1J33A 4DEYA 3EUAA 4Y1EA 3RSSA 1BIFA 5D6NA 3PO3G 5DTIA 3QKSB 4BV9A 3GLSA 1MHTA 1ULAA 4AC9A 4B34A 4H31A 5F5LA 1VKHA 4ER0A 2BP7B 1DRUA 2Q6VA 4P53A 1T2EA 4HYYA 4Q1DA 3JS5A 3QV1A 4BBZA 1MOSA 1G7TA 4EJ2A 5MFPA 1HMYA 1YVEI 1PAUA 4X62H 5B55A 4ZYXA 4H6WA 3OBIA 1DIAA 3KHLA 1FQOA 2HUNA 4H17A 4NCKA 5DM4A 3SBEA 4FN4A 2HBZA 3NTLA 3VC7A 4EP1A 4W5NA 2YRFA 3I34X 4ARBA 2VG8A 1DZ3A 1TCCA 3B6ZA 1YRBA 3B9QA 4WWHA 2HLPA 5M34A 1Z8DA 2OFXA 1WUTA 2GO1A 2ZJBA 3CWQA 1NUUA 4LF4B 2O2XA 2REOA 3ET5A 4HFJA 3T5AA 3AF5A 2WAQE 2B61A 2WKWA 4DAOA 5K7SA 3MMPA 1O9HA 1G3UA 2VOJA 4MQ5A 4YT4A 4RTMA 2DETA 2BR3A 2GN8A 3EPGA 1AN0A 1ZVQA 2JLAA 3W1EA 2QL9A 4YH1A 1OY1A 4MI3A 2QNRA 3E1KA 3FYTA 2V4UA 2ZT8A 3BIJA 4U9UA 5DBOA 3PQ6A 3WJAA 5C4MA 4QWDA 3WK7A 1Q0LA 4OB8A 1RK6A 1WTAA 3K5IA 1C1DA 1PI3A 4PSDA 1PJTA 4RY0A 4S3MA 1NXPA 3ANNA 3RV4A 1X38A 2HBQA 3DM5A 4A6EA 5JDIA 5KJ1A 3HXOA 4DSTA 1SZPA 4GUDA 1KJ8A 1H8ED 5C3EG 4PXYA 5CB4B 4RHTA 3ROTA 2WSBA 1T8TA 1LLFA 1PSZA 2DBRA 2HHAA 2ZRIA 3ANSA 4Q66C 4ECYA 2BHRA 5DHUA 3WYEA 4WJLA 4S05A 2DPXA 3UWDA 2RAFA 2ENWA 1EXWA 4PLVA 1Z73A 4CW7A 2UUCB 4RM2A 2A35A 2ZUVA 3BTOA 4HNHA 2XOKA 3RLFA 1RRVA 2Q5QA 2RCNA 4P4SA 3SIWA 3DYBA 4ZEXA 1X1AA 1Q1EA 4QQKA 1CS0A 3OIDA 1OZFA 4R7RA 1LSSA 3VH2A 5JWHA 3T12A 2IJGX 4QJFA 1PLLA 4XCXA 4WQMA 2R68A 4MWOA 1VE7A 3KVNA 4JEHA 4CLDA 3ZWMA 5KOIA 3AP2A 1FTSA 3E9DA 2FK2A 3F6RA 3GJ5A 3I28A 3Q6MA 2Q0QA 3GEBA 4F4XA 3OFND 4N5IX 1UWCA 2VSNA 1UNNC 1ESEA 2PRKA 4UJ3A 3TLMA 2ADOA 1QV6A 1XI2A 2YN2A 2V58A 2R8OA 4H3KB 3WNQA 3VTKA 4MRRA 3FHOA 1QH1B 1IXKA 1F06A 4JCCA 1U9IA 4PX2A 1Y4AE 2J85A 1NW3A 1C8VB 1DEHA 2NZVG 2XMRA 3QLVA 1I0ZA 4JP1A 5KJEA 2HQSA 3VAZA 3VKUA 4AXXA 2WUGA 2J3DA 4WKBA 2CCGA 3ZZ0A 4A8HA 3H6KA 5KS8A 4O25A 3RASA 2CV0A 3DUFA 4PONA 1Z47A 5IG2A 2NV0A 2A92A 2JGEA 4DNOA 2KQUA 5K09A 3DWGA 5B7GA 1DEAA 2V9ZA 3OM9A 4XQEA 3O1HB 4E07A 5C1IA 2OK8A 3A4VA 4FDVA 5CJJA 2PUAA 4FFLA 2FSUA 3LZ6A 16PKA 2BPOA 2HHCA 1GOTA 2ODNA 2O3JA 2NVUA 4D43A 3JSXA 3VVCA 5D3MB 3DO8A 3WYBA 1SURA 5JD4A 5JAPA 5JDCA 4RIGA 2GN0A 4NZOA 2FMUA 3ETGA 3KO8A 1MMFB 4R2LA 4EPXA 3RHZA 5GZ1A 4MDFA 1NQ5A 1Z7BA 4FGUA 1NZJA 3FF1A 3IV9A 3FFXA 3OTOH 4MV0A 1MJGA 3L2OB 1F2TA 5TDHA 1A9YA 4Z4QA 2XX3A 4U2EA 2AGPA 5I5EA 4RACA 1XA4A 4NMLA 3TQCA 3TLCA 4UD2A 3UWPA 2AB0A 1H6BA 3GLRA 4TN5A 1R27A 3KQOA 3C0KA 2W9XA 4INPA 4RPIA 5A3SA 4EG3A 2WAXA 2YFHA 2JANA 3OLYA 1DQSA 1NVWQ 3QE3A 3ZQKA 5CJPA 5LIPA 1OXSC 1E3JA 2XWBF 3Q8XB 4U8HA 4D82A 4FS8A 5BN5A 3SXPA 1CP3A 3CO5A 1VHJA 1R5BA 4WECA 1H93A 2DPMA 3WKBA 3LPCA 1T4DA 2B0CA 3I37X 1MCZA 4I1IA 2PMWB 3HNOA 4O4JF 2J6CA 4R8RA 2QYOA 1QC5A 2EG9A 1CNFA 1JILA 2VZLA 3FKJA 4CTKA 1DADA 2IH2A 3FKQA 4CQNA 2XIQA 1A48A 1BGXT 1T2AA 1OTXA 2CMKA 2DVMA 1HG0A 4GI7A 1PSDA 3A0RB 2UU9H 1T5OA 3SEZA 3HTXA 4YRTA 2WA2A 3KIPA 3BA1A 3EAFA 4NYMQ 1XTSA 1SKAA 2E4VA 1V4NA 1ATZA 1W581 1Y7PA 4Y18A 3KYBA 1DBQA 2VP2A 2WG2A 3PDIB 1S9DA 4TRRA 2JGIA 4NBSA 1MJNA 3JSAA 3MWKA 1RWNA 1G5RA 4UU1A 5IASA 3COWA 5A4JA 4BQFA 4KU4A 5FAXA 4UQLA 3PW0A 4ZZIA 3GROA 5KNLA 1NXXA 3C7AA 3GFBA 3JWPA 3KSBC 3JASB 1I4OA 4ZOQI 1HYBA 4E94A 5T3UA 3BH6A 1QOQB 2FUCA 2QAIA 4MWZA 3VR5D 4CL3A 5I4IA 2ZB8A 4GZ6A 2Q4OA 4IZIA 1A3GA 1UXJA 4NY1A 2KSQA 4IHAA 2JLRA 1KKMA 2CK3A 3J81W 1RLIA 2PX5A 5EWEA 2GD0A 2PRIA 3HDVA 4IDQA 2CB0A 1J2JA 2FU5C 2MIIA 4BLOA 4BNVA 1GQOA 3UZOA 5KT4A 3S2FA 3IGFA 4UFNA 4A3IG 4X6LA 2YIVX 3B9RA 5E6UA 5J5CA 1JE0A 3SC6A 1H4SA 2A3NA 3T0IA 1P77A 2BEKA 1TZJA 1YA8A 5IVDA 2R6ZA 4K9RA 4OK6A 3EEFA 4C0SA 2PNJA 3ZLUA 2MSNA 3R4CA 4PSAA 1YZGA 4WBXC 4ZPJA 4ZTBA 4WZAA 3DOIA 3T5GA 2CYBA 4MB0A 3RJMA 3ZGOA 2MSKA 2QNBA 4G4SO 4LYYA 3LVFO 1E7SA 5D00A 3JZAA 1YZYA 2X8JA 4A93G 2ZRNA 5SY9A 3D43A 3LO8A 4BNKA 1L7QA 1N3YA 2B5VA 4RVUA 3QFSA 5EIBD 5C7YA 1ABFA 2Y9MB 1KJNA 3I6MA 1K97A 2Q4DA 3C1TA 3L41A 4KDFA 4F12A 2WHRA 1P62B 4IGFA 4S12A 4Y2QA 1OBFO 1LU9A 5EMKA 5H68A 2AEEA 2UYCA 2EGGA 1LPPA 3H3XA 2WLSA 1OQAA 4XFDA 1IYEA 5JC8A 4K9DA 2CEKA 8ADHA 3CNHA 1L2ZA 1HI9A 1WMBA 3ZJUA 2XRYA 4BGEA 2V6MA 2VAPA 2OKGA 1LSUA 3N2LA 5KMGA 5I4BA 5C44G 3HXKA 4O4JA 5TGZA 1XAHA 1JKIA 3U62A 3W2TA 3NUZA 1T9HA 1CY1A 1YOBA 4W6ZA 3SZMA 3VUFA 2O8CB 4WUTA 4LF9B 3TF5A 3UJBA 1K8YB 1EHYA 1G3QA 1USIA 1XJCA 1NMSA 3H5LA 1UDCA 4QFBA 1Q0TA 4JLVA 4MWGA 2BUCA 4IIGA 4LI0A 4X6XA 3UHAA 1R7RA 4KZPA 2JCSA 4W4TA 1GTZA 2DQKA 2V55B 1P33A 1ZCFA 2YXNA 3EWAA 4V38A 1A69A 4ZI3A 3EODA 2O0MA 2NNWB 2QR2A 4ZCIA 2I4OA 4AT1A 1E3WA 3MLAA 2F3UA 3ECSA 1TK2A 2WJAA 4BAUA 4RAOA 3WQQA 1WD7A 2CL0X 1O8BA 4HGNA 4WMLA 1ZH2A 2ZBPA 3SKXA 1BGVA 1QG0A 3KOYA 5HE8A 3VPSA 4N39A 5JSZB 1EGQA 5AWFC 2BFAA 4WI1A 4TTJA 2GILA 4NOJA 2RG7A 4HQOA 3ZV3A 4ALJA 4F4ZA 1IZ9A 2NSYA 4DDWA 1K7SN 4FT4A 1NF2A 2FEXA 4RCZA 2EIXA 2HK6A 4ZT5A 2DJ5A 4O3OA 3HOVG 1P0FA 3U3MA 1I3LA 1XF1A 2YUTA 3ETEA 1SQFA 4DLXA 2NPFA 1II9A 2NSDA 2OQIA 2ZVDA 5CA0F 1AKRA 1X77A 3AESA 3TI7A 5ESWA 3AC0A 4AMVA 1NVAA 2P4EA 3T5CA 3RYTC 4CF7A 2EWWA 4HX9A 4KLRA 3VOAA 3HBJA 4EKDA 1P29A 1U63A 1UBJS 2RGUA 1G291 2CC2A 1Y9DA 3O4RA 4Q6BA 3SE7A 4M86A 1PJZA 2HD4A 4EHHA 1YRAA 5JXHA 3LJKA 5BN1A 1GYFA 1T8WA 1AUVA 1ZD1A 4F56A 2X5RA 3NASA 4ZDJA 3I04A 3ENVA 4KE7A 2XNCA 4TMXA 3P2YA 5TEWA 2OOKA 3WRXA 1ZKMA 3E9ZA 1BHQ1 1ACMA 1SB9A 4ZVVA 3QJYA 4L4YA 1PE0A 1KJZA 3FWYA 1ID1A 2VDRB 2PLWA 3FNBA 4URUR 2I6FA 1JQAA 1Z38A 2TS1A 5JXGA 4IXNA 2PSFA 3D2BA 4BRZA 1W30A 4NZ9A 3HO8A 3KM0A 3ETJA 1FXUA 3W0LB 1TPZA 3RUCA 3WWEA 1DDGA 3IQWA 2VPIA 4FFRA 3HA7A 1Z82A 3EUWA 3GCGA 2OZKA 4JK3A 4KVFA 4LZAA 2VBCA 1ZMBA 2L0XA 4ZK2A 5B6IA 3DL4A 5KNDH 2BMWA 3L0CA 4DTCA 2Z95A 2CLLB 3DAOA 3PXXA 1F8UA 2PSSA 1CIJA 3GRVA 4URYR 2C31A 3V9PA 2Y93A 2ZRBA 3H1TA 4ZDKA 3RYHB 2ZIXA 6REQA 3LHDA 4ZOAA 4MVJH 2V6BA 2V7UA 1CUEA 3FLAA 3N76A 4ARZB 1RWQA 1G21E 4M1KA 1LNZA 2QQGA 5HFAA 2V3CC 3L7MA 1K92A 3AGQA 5B7NA 2B30A 4M37A 1U02A 1VSQA 2C7BA 3NEYA 3OURA 2TMDA 4G41A 4LWPA 4MEAA 4CFYA 4Q9NA 3IEMA 3KTFA 2GLXA 2VUHB 4IR1A 1YHYA 2E89A 2WKSA 1N2SA 3FBTA 3R0ZA 1M8KA 1Q0QA 4BFYA 2KI5A 2VNAA 7MDHA 3WAGA 1UZUA 1O94A 5KDDA 4D4MA 3HJUA 4JYZA 1TF5A 4OYYA 3VPDA 1RYDA 4ESHA 3BMXA 4KR0A 5KFOA 1HMPA 1IHOA 4MRMB 2X6RA 3RYHA 3RR5A 1E1RD 3COPA 1HSOA 3PC3A 4RFSA 2YC2C 3VDQA 2IEIA 3IQZA 2NUPB 3AOGA 2MSDB 4GAEA 4I5EA 1E4OA 1FNCA 3SEFA 3BXZA 3H2BA 5K0NA 4BFLA 2NG1A 3P27A 3SZGA 4QDTA 4OAPA 2H2WA 3STXA 4RTSA 4LFAH 5LLSA 2ZUEA 3RK0A 3U44B 1U7UA 4QJ5A 1CJKC 2B7CA 1WXQA 1OYWA 3ACDA 5BWVA 4ERNA 4GYKA 1JT2A 1PGPA 1WUKS 3C6MA 3R0QA 2C98A 4FKBA 4R69A 1V6CA 5EPEA 4PHCA 2GFIA 2EZ4A 3C6YA 3KLBA 2AQIA 4ZVQA 2EJBA 3BTVA 3G49A 3ISJA 1CJBA 4J1NA 1AHHA 2RK3A 5ESRA 5IFLA 5DLYA 1S4MA 1VPLA 4F21A 4CR7A 3FDFA 3K9HA 1RJ9B 2V59A 2FJPA 1KYVA 1ODJA 1WXHA 2HIGA 3N43B 1SCJA 5NULA 1YZNA 2H4ZA 2PZFA 3I39X 4GOXA 3VU8A 2OA0A 1AGNA 2VLIA 3KFXA 3K53A 1G60A 4L4RA 1WABA 1FNNA 1XK7A 2W2QA 2JEJA 4YP9A 2R6CA 3P19A 1JIUA 2IYYA 1XXHE 3OTGA 4YI5A 4AJ9A 2B99A 4KITB 1FQKA 3HKCB 3OZIA 2OO5A 4O2AB 2P1RA 4Q00A 4Z8YA 1HE4A 4MVJI 3LT4A 4WCDA 4B47A 4BVEA 2NO0A 2XBMA 5G1NA 1I3QA 4Y2UA 5AT1A 4W9NC 3SC2A 3S55A 3QMVA 2HC9A 1OBDA 4RPLA 5FA6A 2Y4OA 2YJTD 3RAXA 1M74A 2ZP1A 2ODTX 5KFGA 3SSOA 4UCOA 2C2YA 3O8QA 4MQFA 4KQFA 1YB5A 2SECE 3NDBB 3LX5A 3BGSA 3ZDAA 5AVVA 2FEAA 1U4NA 5KFFA 4KQXA 1A5BB 4IWNA 2J5BA 2P1ZA 4ZOLB 4E15A 2BM0A 2I1WA 3PSAA 4P3NA 5CB8A 2XXAB 3LXMA 1QK4A 2UZ1A 4R1PA 1ZUIA 4JYAH 1P9NA 2P68A 3PZRA 3H5OA 2HHFA 1T0BA 2P3OA 2HTEA 5TSDA 2E5LH 4BVAA 3PWTA 1DI0A 1EFHA 5FBKA 2G67A 3KOZA 4L5CA 5JAMA 4R7TA 3GRPA 4KNWA 3ZKWA 2DXIA 2OQ2A 2IBTA 3FTQA 3KOMA 5FO0A 3K3VA 4DG5A 2BQRA 4IDGA 4H7EA 3LW7A 3S2YA 4YRBA 2YV4A 4BNIA 1HV8A 3PA6A 1HWYA 2XKKA 4XDHA 4F11A 1CUJA 1NVXQ 1RYHA 3ZDZB 2G8NA 5KIAA 2O8DA 3I2FA 1AZTA 4HDNA 5AXBA 2KE5A 2VP5A 4FSHA 2OV3A 1EFVA 4L8LA 2OORA 3OPYB 4FZRA 4DXAA 3MZ0A 5JH7A 3COJA 3O9MA 4LY3A 1R64A 5GVRA 2NTYC 4GIBA 5AKYA 4HNQA 3OPXA 4MR8B 1S3IA 1JLMA 3OICA 1A76A 4QE3A 2DJIA 3A58B 1UPBA 4M21A 1DG9A 5CK4A 1N48A 3D4PA 2F62A 2YINC 4JJEA 5JPIA 1I4TD 3VNSA 3D8RA 4PY2A 1SMKA 1UOOA 3W7VA 3LLMA 4XM2A 3NHLA 3G9UA 4IS3A 2Y67A 3D6VA 1NN1A 5F2KA 4DVJA 1UIRA 1QYWA 2V7BA 3DMTC 5ALRA 3V1UA 4D9FA 2NU7B 2HJRA 4MW1A 5KFNA 2RGRA 2FMXA 2ZJAA 3OX1A 3VHXB 3V8MA 3W8NA 2FOLA 1WUJS 3URMA 3I2YX 1WZCA 1EP9A 1XVUA 4I1OA 4Z6KA 2IS2A 3CXUA 1OFGA 1XD8A 4H6VA 1MP0A 1QIDA 5A7GA 1VLMA 2AJBA 2CFTA 4R83A 5DM70 5FUXA 1D0VA 3GAFA 2C35B 4YUAA 1QQ7A 4MA0A 1G8JA 3O9VA 2A78A 1D04A 4GM0A 5TPWA 1N5KA 4X66B 1FFXA 4GOJA 3GK3A 1HRDA 1KVRA 4Q9AA 2XDAA 4BYMA 2ZTHA 1H2FA 5SV2A 3RIHA 4A8TA 5T6BA 5CX4A 3JSNA 4KXYA 1BQ4A 1NIJA 3HJHA 3O6VA 2E5WA 3NPAA 2BFFB 4RHCA 1E3TA 4I1SA 5K0EA 1Y8AA 4GX0A 2I7CA 1SXJA 3U4GA 1URPA 3V55A 4XVRA 1NY6A 5KFZA 3N86A 1O6GA 4K8RB 4V0ME 5AHOA 5A2GA 3L7CA 4MS4A 4LDNA 3LUBA 4HS4A 4U02A 4CJXA 5JAIA 2CNNA 3FCEA 1R3UA 3IVXA 4J1QA 1BJRE 2C8VA 4MV3A 1NBEA 2EOAA 1VI2A 4MEJA 1KO5A 2OKCA 2ZSBA 1KXJA 4PYKA 5EXSA 1BD3A 5K4GA 1ECBA 4AMYA 4C4RA 1NJ6A 4MVXA 4U5QA 2O3RA 3MAGA 4HBGA 2DFPA 1H2AS 2FPPB 2ZRHA 3HMKA 4ND6A 5JLAA 3C3YA 2CFIA 4W7SA 4C20A 4CIAA 1U0LA 4J6FA 4CMBA 2AOWA 1XDDA 1ZNXA 1V1RB 3K8YA 4I9GA 3P9CA 4FXOA 1CJTC 5DHFA 1NX9A 3UJ8A 1L6IA 3I6YA 4JI8B 1VJCA 4Y7DA 2ARKA 1N6RA 3DGEC 5KYYA 3OF2A 4ETMA 5C1BA 1Y1QA 4YQFA 5C3UA 3FTFA 3G8BA 1YFLA 2BFEB 2UVUA 3O83A 2XE6A 1KQOA 2VTKA 4GLJA 1LX6A 4DYVA 4DR1B 1IN7A 3H8VA 3SZLA 4ZKDA 3KYDB 1I2DA 2QZPA 2B63A 1O97C 3MAAC 2I4RA 3VC2A 4YR7A 5BW4A 3QYPA 1KAMA 2ZRKA 2MDTA 4HPWA 5IKEA 2PZAA 3PRYA 3GDFA 3AEXA 2G76A 1PLJA 4QGSA 3A4YA 3HJNA 1GKYA 4IO1A 1RQGA 5CT4A 3L8ZA 3BTSA 3O03A 3ABOB 4JSTA 4OU4A 3CH6A 1JPVA 3A2NA 3AUJB 4WNCA 2QJFA 3HB1A 1K75A 1UXKA 3WBBA 1VRVA 1GT91 2FB9A 3H0GG 2CFRA 1NW9B 2WZDA 3HWX1 3L8MA 3MIIA 3NORA 4RXUA 4TLEA 3SF0A 1OAAA 4ES6A 3AM3A 3UUEA 3PNYA 2VDOB 4FBTA 3PUWA 1JHYA 4HAWA 4IRXA 2HTFA 2YICA 4MZXA 4QEDA 2IU6A 4UU0A 4UBJA 1WCV1 4PLWA 4XD2A 4Y2PA 3ZE6A 2IA6A 3FZGA 3EUFA 1KNQA 3G68A 4HTAA 3ZWAA 3WGJA 3D8UA 2IHYA 3I5AA 5IKPA 3BAFA 2DQSA 5I60A 3GT7A 3KKQA 1JR3E 3DWIA 2UZIR 1WCWA 2VFAA 2LKDA 3AGPA 3F7MA 4G9BA 5E2BA 1N2GA 3ZWOA 1YASA 4O59O 4D8TA 4TT3A 3HA2A 4ARCA 3QFCA 2Z2ZA 2EVWX 1BE8A 1PIWA 4BJ1A 3GHHA 2FX3A 4GEKA 5JTTA 5BSFA 1WQ1R 1NP7A 3EGWA 1DCMA 1ADJA 1U80A 3DKPA 1UC4B 1T0IA 3IAFA 3FHLA 3L77A 4Q8FA 3SJZA 2WWRA 4HXYA 5JAQA 3T7SA 4Y6PA 1G2WA 2BUAA 1SK9A 3TCKA 5AW0A 4AKIA 3H20A 3L93A 1CBUA 1C5KA 1NNLA 5BMOA 3EGXA 3REOA 4QJ3A 1UT6A 3O2JA 1MF7A 4LHSA 1PYGA 3GQCA 2WIBA 1FMCA 1ZVKA 2BW0A 2WJYA 4IJUA 3SI8A 4M7WA 4CMCA 2UXDH 4GP6A 1DB3A 1DBRA 1ZLXA 2HZ7A 3ABZA 4G0PA 3GARA 4HEJA 4WERA 1FNMA 5B4UA 1W8DA 1PWYE 3Q0TA 3WYCA 2CNKA 3DGFC 4J2OA 4X1OA 5LZ4A 5JOQA 3TY8A 1EVKA 2X0JA 3PTAA 5J4KA 1DJNA 3PNBA 5LM3A 3W3AA 3HUTA 1HKHA 3HCBA 5DMHA 4LJ6A 4X64H 2VNKA 3HOZG 2Y1OA 1C1DB 5IAJA 5I7UA 1OF1A 1YFJA 1RM0A 4MDYA 1EA7A 3TLYA 4HMQA 5FV7A 3ICWA 2GXUA 4JI0B 3HVIA 2RARA 5AUNB 1H8EA 4AECA 3CF4G 1R5NA 1QRDA 5C5IA 3ZGZA 3NHYA 4HMPA 3WC4A 3AY7A 3JQBC 1N6PA 2FN7A 4JLJA 3P2OA 5REQA 2VWPA 3S99A 3A9UA 2ZTLA 4Y2HA 3NM6B 4O4IB 4LJ5A 1GPNA 3B48A 1XZGA 2HF7A 4YDRA 5BQFA 4RNCA 3PEYA 2QLJA 4JBWA 1BSVA 3KS9A 1A8UA 1W88B 2EBHX 1PFYA 2RC6A 4H4DA 4JGIA 2I5PO 4RHFA 3RS3A 1HM5A 4C78A 2ZJ2A 3QKRB 1NQUA 4NBUA 5FJIA 4P9NA 4X8MA 4DNPA 5TLSA 3RWBA 4UTOA 3I9JA 3IHTA 3ZU4A 7REQB 4HQNA 3J80A 1ZSVA 3QHPA 1G59A 4ZDWA 3WJ2A 3ZGVA 4ECEA 2FE3A 2DPHA 3CUYA 1DUIA 3AHHA 3SNOA 3EVEA 4GXTA 1MEEA 1K7EB 1SBIA 1TMKA 3E7DA 1IPFA 3U7IA 3T3PB 1BG6A 2EWMA 3K1YA 3M83A 3NHPA 4HWPA 4DM3A 3ZJTA 2ONYA 5HRUA 5CA0B 3KJGA 3HZHA 1Y1WA 1VMKA 5CU7A 4Z2AA 2WWTA 2K87A 4JAVC 5TY0A 2PL1A 2IPMA 3O91A 1SRQA 2B34A 4XD7A 4BNZA 2HEIA 4J4HA 1T1EA 3KFVA 1YJCA 5EEGA 4TYNA 2ZUBA 4WW0A 3JYLA 2FDCA 1E4EA 3GV5B 1N6NA 3PVXA 5HOEA 4O1HA 5FH9A 2FK3A 2NU9A 4YBZB 1UDWA 3MQ2A 2EIYA 2H17A 3P2MA 1NKSA 3LRTA 3K72B 1NU6A 1KQ3A 1SUAA 4OHBA 5CUQA 4OA8A 1ZJZA 2FCRA 3N44B 1SD1A 3V5NA 3R7WB 4FOTA 2NU9B 3K9WA 2CSUA 1QF9A 3SF8B 3BGWA 4C3ZA 1OBCA 2CLEB 4TGLA 3U6KA 3EDOA 1Y98A 3AQIA 1L7NA 3PEVA 5CYGA 5KYKA 3BMNB 4UM8B 4Y67A 4LISA 3GTOA 1PJRA 3T1NA 4PLGA 1Y1VG 1FUIA 4TXLA 1A71A 4C07A 3VNVA 3DDZX 5JRJA 3QVJA 1I3MA 3P9PA 3SG0A 4EGSA 1BFDA 4IRCA 2O2DA 5CA0A 4EI7A 1E1MA 3L4SO 3LYAA 4F4UA 4MVCA 4O02B 4DF3A 1KZ9A 2C03A 3GD5A 1RLUA 3ZHRA 4LCEA 1JHXA 5JWOA 2HWYA 3CZ9A 4QTXA 4AUEA 3M4IA 3R41A 3ZWYA 2VAMA 3OKCA 4AW9A 2C9OA 4DJEC 2MSCB 1FDSA 3FSJX 1HQDA 2H1FA 4WLNA 4PLHA 5FOSA 1Z0DA 3VMMA 3L7DA 5U4QA 2Q2TA 5JRZA 2BR0A 3L7JA 3EF0A 2QN8A 5CBKA 2YKGA 3L6RA 1GA1A 3UH1A 1P1RA 3OJXA 3I5YA 4PRYA 4RQBA 2CXUA 5GAJA 1OXVA 1IK6A 3PUJA 3EA4A 5DHAA 4N3NA 4R5HA 2G8LA 1UBHS 1WLSA 3GNSA 3MCAA 4YRRA 2B2CA 4ETNA 1A8HA 1T2VA 1G2PA 1XKXA 3DV0A 1GVHA 1O6BA 2I2XB 2X3YA 3ILVA 1N6OA 3QSGA 4N7RA 3IR6A 5AVTA 4NH0A 1NYTA 1SCIA 1UR5A 1M1NA 2Q5IA 4M0CA 1SC4A 1XKLA 3C8HA 4U39A 5I9TA 4KB5A 2WWWA 2XUQA 1FS4A 3TNLA 1VKRA 1EX1A 2AEFA 4LSXA 2FZGA 4NL4H 4RPKA 2RGGA 3CH4B 3IJEB 3RU9A 3IQEA 3I9FA 3CKYA 5IBPA 5AW8A 1W4CA 5EL0A 4L8FA 2M1XA 2O0LA 1J2YA 1S7CA 3Q0EA 4P32A 2X5XA 1EP1B 4ZOBA 5FNVF 4BTLA 4X92A 2K4MA 1WO8A 4IUCS 3D1JA 2JKYA 3KTDA 2BJVA 4MVJG 1YB2A 3OSZA 1S0MA 2YZLA 3H8SA 3L0SA 4FFNA 3NBUA 5IZCC 1DHRA 1KORA 4BWYA 4PSVA 4QZVA 3BERA 4BNLA 1ZR4A 1TEHA 2XCSB 1WCIA 1YQXA 4IEIA 3U1BA 3AVVA 1ISHA 1KH1A 3V33A 4TLAA 3PC8C 4Z4GA 2EJ2A 3DTNA 4LECA 3GRUA 4NEQA 4R2KA 2JA5G 2I87A 4PG6A 5AHWA 3MPOA 5LBUA 4BO1A 4Q12A 5DGTA 1XNQH 4DQLA 1CUFA 2C54A 1NUPA 4MW2A 2PT5A 1BE6A 1UQRA 2CJWB 4EO4A 3BWCA 3KQNA 3AR8A 3Q3HA 4LVOA 3WLMA 2PRSA 3T9AA 1T5IA 3T5HA 4JJ4A 4E11A 3M34A 4A6PA 1WULS 1JZQA 4W1RA 1PDVA 1HXHA 4DDHA 2ZI4A 4A2BA 3EEOA 3F6CA 3MTAA 1Z5PA 3HYLA 4H6PA 4IPTA 3GG2A 3EQ6A 1GPAA 3PENA 4LDZA 1J9GA 4LBYA 4KLZA 4V0OA 1A0OA 4IFTA 4DDUA 1JR4A 2Z9DA 1MGPA 2Z98A 3I1YA 4O83A 3X1KA 2W8KA 4Q4LA 3TPCA 1HC7A 5GTDA 1U8EA 4MQEB 1JBQA 4D9CA 4MKZA 2DFLA 5KFDA 3LV8A 4EBCA 5C7IO 1D1TA 5JJ5A 2C7RA 5FR9A 2D00A 4B76A 5JJKA 3LF2A 5BQXA 4RJLA 3B51X 2R8YA 4A91A 1DUSA 3RG8A 1HRKA 2GTPA 4OSEA 1XPOA 1UZNA 5FTWA 3S2IA 2NO7A 4W5OA 2Q62A 2FXVA 2C5AA 4LF5H 2WWIA 2AC4A 2COGA 4CWAA 4YMVA 4EJ6A 5LMNB 1DEXA 1TTTA 3CVXA 4RVSA 2EJVA 1VKZA 1R8QA 4QUIA 5LP1A 3KYDA 4P5PA 5ABPA 2WE7A 5A0VA 4P08A 1Z7WA 4R9VA 1V2HE 4R1NA 4RH3A 3QX7A 4P3KA 5BRNA 2J6TA 3CWCA 3ZQUA 5JY6A 1Z83A 4Y8VB 1JA9A 4YMUA 4CIYA 2AMVA 2EJ3A 3ROXA 2BRUA 4E13A 1P8LA 3GR6A 1ID8A 4AIRA 3U4QA 2ZJ1A 4HADA 2DWQA 4Q3CA 3G02A 3QGMA 4RGYA 1Z9BA 1VRCA 1UM9A 4C87A 1CCWA 1FJGB 3E3AA 2MSLA 2Q0SA 3MELA 3RB8A 3W1WA 4Z7QB 1GGEA 2ID9A 3JQAA 3BGOS 5LOVB 2R8ZA 3FFBA 2ZIUB 1IBKB 3W8EA 1P74A 1YNSA 2NZXA 2G4LA 1IXRC 4YP5A 4LV8B 5DCLA 8MHTA 2MINB 5FUWA 3ZGNA 2JJ8A 1B23P 2CHVA 4OHOA 1OILA 4XLTA 1R00A 2VJPA 2E37A 3T5DA 3IR5A 4Z3KA 4FHEA 4JBHA 3MPUA 4KGXA 4ZI2A 4KQWA 3T3HA 5KREA 5MF6A 3U0BA 3OQIB 5KFHA 4I36A 1W52X 5GJBA 3FVQA 4MAMA 1NOJA 3SHFA 2VA3A 4NLLA 4BGDA 2FF7A 3BOSA 4TVBA 2IXEA 4X65B 2AOUB 3N2IA 2AQKA 1GCIA 3SX2A 3OIUA 4RL6A 1N1DA 1RWMA 1U2GC 4QOSA 5CX1A 1XZNA 4DWWA 4ZIRA 1W85A 1I2ZA 1ZD5A 4Q0YA 2BEUB 4Q3OA 1B4DA 3KZOA 3ZXIA 1XNRB 4QYTA 3WSVA 4ETIA 3QPAA 4FS2A 4DY4A 2W6PA 2VZ0A 4OP3A 4Z7NB 2UVWA 2LW7A 3TLGA 3T1YH 1UJ4A 1Y48E 1PTJC 3NM5A 4UBLA 4O6VA 1UWKA 1QZTA 3D8SA 4AN1A 4N82A 3RJ5A 3OZVA 1VJGA 2E4UA 2BFCA 3H2SA 2CVZA 3VDXA 1NXWA 3HOXG 3J7AK 4MPDA 5HXAA 5IJZA 1T6XA 2HHHH 1V1MB 4QXQA 3RRJA 1V7CA 3SVTA 1L7BA 3AFHA 2I2DA 5KNDA 3TM5A 1X70A 1BMDA 1RE0A 1AGYA 2VPQA 2RF4A 4D8VA 4R0NA 1FDRA 1TRKA 1QM5A 3M6IA 4D3XA 5LXTF 1QGYA 5IUJC 4N7BA 4E2XA 2GVNA 3N8DA 1USGA 4EG0A 3PIIA 1ZGBA 2M6SA 4G2NA 4XR4A 2WY2D 1KE1A 3THOA 1T9AA 2H52A 3I9NA 2WJHA 2ZFUA 4Y6RA 1T5LA 3ZEAA 2NO1A 2WDZA 3DCYA 4FM9A 3S5JA 1Z5GA 3T94A 4ENSA 5K8JB 1A0GA 1T9GS 1MJFA 3TRFA 3EVCA 3OPYA 5DYTA 1SUDA 3KVRA 3LLSA 5LDHA 1CNEA 3DNMA 3H11A 4KG7A 4W9NA 1XDZA 2IC5A 5E6RA 4ZD6A 1FYVA 1M6YA 1XPJA 2YFYA 2YBEA 4RPGA 5K6RA 4Y2VA 3EEIA 3TQRA 3LMKA 5BYBA 3NG1A 1XMXA 3GIMA 3O2SB 2JJQA 3HOYG 3O1IC 2QYHA 5B64A 3P4XA 5K99A 3UKDA 3IBFA 4UBMA 3H65A 3AHJA 4FONA 4EJMA 5DNUA 5A0TA 1HE2A 3FKSD 3V8NA 1GRQA 1KO8A 3FWNA 3VVLA 1AD2A 2DBYA 3WSTA 1W47A 3B12A 3SKYA 3ZGXA 3AV0B 4L8YA 4E0BA 1CRPA 2O59A 4REMA 3TWOA 3ADPA 3LGAA 2D1QA 3W9UA 1MNAA 4ZWNA 5TX7A 1RM4A 4YN3A 1NI4A 2YHIA 5C4XG 3DQPA 1BZYA 1QP4A 1RRMA 2FW9A 3HSSA 1P3JA 3P71T 4IMPA 5ALDA 9LDBA 4R1MA 5I5UA 2GMWA 1VSUA 2XBLA 1OFIA 3STWA 3U7QB 5I9SA 2RH4A 5COAA 1ADFA 2ZWPA 4EPWA 2FUG6 4D25A 4CEIA 4GOND 1JJIA 2AG5A 1U0NA 2WKPA 1RVV1 1S2LA 2X1VA 4R8MA 1V16B 1V9LA 2QNIA 5EMLA 3V1YA 2EEZA 2JFZA 5F9LA 3HOWG 1B26A 2KYRA 1MX3A 4JU9A 1V43A 4Q19A 1PN3A 2WMYA 3AEYA 1Z74A 3DZIA 3E84A 4N8SA 3O8RA 2Q1YA 2FOXA 4E3ZA 3IBTA 3ZDYB 4ZYZA 2B8EA 4GI2A 1A8PA 4PYOA 1QH8A 1MX5A 2ZJ3A 1MJGM 1UMKA 3I8OA 4MARA 4IDPA 3WAKA 3RVJA 1SC6A 3WMRA 1SHZA 3ZV5A 2IXGA 4C03A 4CDGA 1H42A 1YFZA 5KMGB 4L6CA 2UU9B 1JDZA 1X7WA 2WJ6A 3AUTA 1JIKA 3CJTA 2GN9A 2B1QA 1OJ7A 1Z4LA 1SWVA 4US1R 5BWNA 3VXKA 2PO5A 2X9GA 4FYPA 1T9KA 2FZCA 3DFKA 5EZQA 4MWTA 4S04A 1M1YE 1UBEA 4HFMA 4P5DA 4RA9A 4UMEA 3RS0A 3UC5A 2VQ3A 4MUYA 4QXAA 3ZU2A 3QEKA 3CB2A 4H0NA 4F60A 1QCZA 3OEEA 4G8DA 1A82A 2BWJA 4KPUA 1TQHA 4IIBA 2FMTA 2OG1A 3L4BC 3C39A 2WT4A 4B6RA 4JI4B 3HT5A 3UJ7A 5DG9A 3WRWA 2WE8A 1GL7A 5FTKA 5EJIA 1VM6A 4O5AA 5DHQA 3IAM6 5EQFA 1P4RA 3GJXC 1U28C 3NAMA 3OE1A 4MQ4A 3TYXA 2A88A 1JAXA 4LW8A 3U4HA 3EEQA 3UFBA 5FLXW 4DN6A 4F2GA 1KERA 2Q8PA 5SZIA 1KOLA 2RHCA 4N3AA 4OHUA 1QO9A 4DM7A 2NO9A 3TB6A 1HFWA 3B82A 1ZD8A 4PR0A 1C7IA 4LRQA 4D1YA 2NU8A 3SSMA 1HOTA 2OBBA 3F6YA 3JQFC 2DKFA 4HAZA 1W29A 3QBEA 4FYJA 1XRSB 4IKPA 4WFQA 4HEA6 3U40A 1RAFA 5AVXA 1JI3A 1TDJA 4IXDA 4IOMA 5SZHB 3HY4A 3T8YA 3K9QO 3E9CA 2P6OA 3ROGA 2CVOA 5IDYA 5EUCA 5KYVA 1NR7A 3L1IA 1QE5A 3EBPA 2D8AA 1RPZA 2VPXA 2PM8A 3PUHA 4N5LA 2OCGA 1UK7A 2DTXA 1ENPA 1DBIA 2V7PA 2EX1A 3KXLA 4M0MA 1S6YA 5ALEA 3WXBA 4RSMA 1QTRA 3FCUB 1YT5A 2WUWE 1DT3A 4DR1H 4MHTA 3I32A 4OAOA 2LIPA 2BF7A 4C08A 4HDAA 1Y9JA 4I55B 5DNDA 3HPQA 3WQSB 4ZOLF 2XVMA 1J21A 4OO3A 5BNTA 1WHSA 5JSYA 4FHCA 3TLKA 1EG7A 3VU3A 5B12A 3VI4B 2BMAA 1G2OA 1N6LA 1V8ZA 2FH5B 2D1SA 2I6UA 3NT5A 4I0WB 3BMNA 3QEMB 4MHSA 3VZQA 2W9AA 4X7MA 4BQRA 4J4BA 1GEGA 5ERGB 1WCYA 2PGNA 4DWOA 5I51A 3D5TA 4EEQA 5CK5A 3TMYA 1TI7A 2RAVA 4C0QC 4FQ8A 4IIJB 1SVNA 3MLBA 4FFVA 4KMRA 3I1JA 1X1EA 3LWBA 3BSYA 1RWWA 2VOEA 3QOXA 1T3SA 2IBMA 3EGDA 4M83A 2GPNA 3FPHA 3TSAA 4H7FA 2YJGA 3K8QA 3OZDA 1ZJYA 4IUBS 3NT2A 1OLUB 1NASA 5ER6A 3AVWA 1DKRA 1DDIA 1QZZA 4CE5A 1ATIA 1MFPA 1TQ2A 5E4YA 2I1QA 1YACA 4HL6A 4KYVA 3TZCA 1PVDA 2GN4A 2R8PA 1IN8A 2ES4A 4J3FA 1SO8A 5DXJA 3DDHA 2HMTA 3E23A 3NNSA 2W6CX 5EIWA 2B4QA 4P2BA 1E5TA 1JL3A 1U2QA 5F4BA 1FQJA 3KZCA 1QV9A 5SYAA 3AEUB 2ZJZA 2C2HA 2XNHA 3EVBA 4MCIA 4N3CA 5CJ2A 1V6AA 2VL7A 3TR5A 4WOJA 2ZYWX 3H5VA 2OHJA 3P9RA 4RK1A 3DDSA 4ZFNA 2WTBA 4CT5A 4EYSA 4QRHA 5LFAA 3SM3A 1E0KA 1PUJA 2FW6A 4OXIA 3KVVA 5I9BA 4D74A 2G1AA 4ZODA 1TWGA 1NKTA 1UMBA 1NMEA 3WDLA 1B41A 3LDFA 3S3TA 3FCCA 3AUFA 5G0UA 1RBMA 1EXMA 2X1MA 3C1AA 3K1ZA 3OOEA 1MG5A 2YUIA 3CT6A 4K9OA 4RB0A 3RHFA 1BS2A 5FHQA 2DH5A 2Q3LA 5I45A 4G8JA 4Y6LA 4Z3DA 4K81B 3HVHA 2AKYA 1XJWA 1RI2A 2DPLA 2FWRA 2XMSA 3BMCB 1GA4A 1S97A 3LSYA 1KGDA 4OFXA 4B0OA 4X61A 3GC6A 3EA0A 2YASA 4IEFB 1RR6A 5L3SB 2UVPB 4M46A 3F49S 3QP9A 1K98A 1KDZA 2W2MA 1QPGA 3ICEA 4ZYLA 5TIIA 3GLIA 5F5XA 3FHJA 1K0UA 2G7ZA 3PX3A 4CQLB 1I0IA 3OIFA 4R8UA 2YJ6A 4BDSA 3DE2X 2AMJA 3FDZB 1CE8B 3JWJA 4GM1A 4QDXA 4LNUA 4QASA 1A9XB 3NBMA 1EAYA 2IZ5A 3QPUA 3G8CA 2FK8A 4Q21A 4WXYB 4OLBA 3R24A 2RGDA 4H59A 3S28A 4R1SA 3UK6A 4F6RB 4LWOA 5A2QW 4YMSA 1WB9A 3GPCA 4TVKA 1DQNA 3GFRA 3K1TA 1E4VA 1STOA 2VQSA 1R0SA 5AICA 1CUHA 1R88A 3CHYA 4AMZA 4DSNA 1E4GT 4GKJH 2JATA 5EJGA 1NVDA 3AXSA 2QX6A 3EDQA 3FMIA 1TA4A 5B7PA 4KUHA 1X8LA 2OBLA 1RHMA 4BP1A 3UQYS 1RD4A 4FFWA 2WQ6A 1TUBA 4PIVA 3I4LA 3A4NA 5BWMA 1UFQA 4M1EA 1E1CB 1UP7A 2BFWA 3LHKA 1GTL1 4IJKA 3F97A 4NBNA 5C37A 2CDBA 1YQWA 1U2PA 3EBLA 2FF5A 3JYHA 4XSVA 2FZ5A 3M1AA 4URVR 3AVYA 4JI2H 3GFOA 3V8PA 1ZPDA 4BX2A 5JALA 3R2JA 2E5LB 1PFVA 4FDAA 1QRRA 3DJYA 3OZCA 5ENZA 2ZSAA 2QJTA 1K86A 2SCUA 1MKYA 5LOVF 1GPMA 1V5EA 3C8DA 4RIIA 4WNIA 3TOZA 2JAHA 3IP5A 4C0JA 1ZBDA 4CUJA 3UMFA 4X6YA 3NHFA 3WNCA 4XLZA 1I1NA 1RXCA 1J22A 5EJ7A 1EKFA 3TQQA 4EATA 3G2MA 3QPWA 5LQMA 1XMPA 1ONPA 1YJXA 2JVKA 3DV0B 3GXOA 1SJ9A 2BIFA 3A7EA 4J07A 4KLAA 1KMMA 2BGKA 2HDKA 2AI2A 5ALMA 1P61B 5EWJB 4AZWA 4F5WA 3L0IB 2O19A 4YP0A 5A05A 4G3XA 2FPLA 2ZBDA 3FCSB 2XITA 4I7EA 5IX8A 1MO5A 1PG5A 1R9NA 1PR9A 3PEEA 4S1NA 4IGAA 4KWIA 2GA8A 4BRWA 1M2OB 5DGDA 1WM1A 1BDHA 4JGGA 1KYZA 1T3ZA 1M10A 4I4NA 3TM4A 4XPZA 1MW9X 1ISJA 1BQEA 3IB6A 5FLMG 4G5FA 4TKMA 3AM5A 3SHVA 3T54A 2FP4A 1GITA 1XN1A 1V7PC 1E2UA 2HEGA 2HM7A 3QVTA 4LPSA 4D57A 4F6CA 4H1WA 3MHTA 3IPXA 1L1QA 1J9EA 1MXHA 3BWYA 4C4XA 2GI4A 1A5SB 5DCYA 3V1KA 1B14A 1PT6A 2OV2A 3TXAA 4BN0A 3OM8A 5ARCA 1WPQA 3BE5A 3JPYA 2LCIA 4PYQA 1F4VA 1X1DA 5HCNA 2I8AA 4JUBA 3D8BA 2VHWA 3WHKA 4DLYA 5A03A 2W6QA 2C3YA 3ERCA 4MLCA 5JY1A 2QBYA 2ECOA 2C5SA 4E51A 3U5TA 5KKNB 1GYRA 4Q44A 4TSFA 3GJ4A 5CH3A 3QXGA 1MVNA 4ZO8A 4R1TA 1YIOA 4W5WA 5EJ6A 4JJAA 2XNSA 1VMAA 4XFJA 1FX0B 4OU5A 3HDJA 4D0LB 3DCIA 4L1KA 2YNMA 1X3SA 4YNBA 5I4KA 1H4QA 1C3XA 1G8HA 2OFWA 3SJBA 2QGNA 1YUBA 1C29B 1GSIA 4RZUA 3T7DA 4ZCMA 5JPCA 3QSYA 2V0GA 5CDFE 2X4LA 1GAEO 2A94A 2BSXA 2PLNA 3D9QX 5L4LA 2W8BA 3USZA 2R48A 2H7XA 3TVTA 4B31A 1SVMA 3FSGA 1RK5A 5GY7A 3AUSA 4A3GG 1J0AA 3D7MA 1IUOA 1DRKA 5CD1A 4XX0B 2P77A 4OHWA 3K70C 3H83A 3BDIA 3MTEA 1EDBA 3A32A 4RV5A 4UEJA 3WBKA 1KHTA 4D4HA 4YMLA 3IMGA 2D5LA 2I65A 1HDYA 1K1QA 5BVGB 1VGQA 2QZZA 1II8A 2BKXA 3M5CA 4QWBA 2ZXUA 2WZBA 3W5HA 1SVLA 1BU5A 1V39A 3DFFA 2WAQA 3QE2A 3K1AA 4ZVTA 4WKNA 3ZCSA 2N0SA 4XIIA 3A6GA 1E5VA 3C6XA 1CUUA 3IMFA 4HGRA 4KQ9A 3ZNQA 1GILA 1US8A 2XVZA 3EIHA 2EWVA 3CR8A 3KKPA 4OB6A 3R7SA 2JFQA 3F46A 4LOJA 4RJKA 4DBLE 1GUYA 5A1TA 5EE9A 1VJ5A 4P7JA 5AI8A 4I9FA 1Y8QB 2AK2A 2O23A 1AF7A 1HYQA 4XM0A 1R9MA 2W90A 4L5JA 1AKQA 5DBIA 4LQCA 3IPAA 3HWSA 1GKIA 2B7LA 4NMMA 1TWCA 4ECWA 2IPLA 1YZ3A 4DMFA 3LO5A 2BTQA 5AJZA 1VMEA 4XEHA 1F7VA 3UZUA 2XTJA 1JKMA 3ACCA 4QJBA 4U9HS 4UVIA 2JFUA 3JALA 2JBAB 4XE5A 2ID4A 1L7PA 4FINA 3FPGA 2YMQA 2J6IA 4JXJA 4PV7A 4RBNA 3BA8A 1FP2A 1AKYA 1DG1G 1OIWA 5JQWA 1T8RA 3EW9A 1GSAA 4FNGA 4MW7A 3SQXA 1JE1A 4G0OA 5FPOA 1Y42X 3IIIA 1WZIA 2ZVQX 3E1SA 4NEHB 3ZLBA 1I7NA 4DV2H 3F9CA 4IDCA 3QXJA 2UVRA 4R8UB 5ALQA 3L4JA 1PL6A 1IY2A 2VDKB 2JVJA 4FOSA 4QBHA 4QU9A 1K7XB 4XZ3A 1Y5IA 4BB0A 5BWLA 5L40A 5L6LB 1ODSA 1XTPA 2FQ1A 2NGRA 3BD7A 4KAXA 5MFZA 2QVGA 3A2KA 1NR5A 3AJ9A 3QH4A 3FSGD 5LB2A 1BWRA 3BBLA 2J3QA 1QAMA 1EPUA 1R8XA 1JFLA 1I1QB 2JA2A 2NYRA 3ZW7A 2QB5A 2CE7A 5K6AC 3JAMA 3HJFA 2DKNA 3JAMW 1JEQA 3CUUA 1DWOA 1I1HA 4CLEA 3JD2A 2W6ZA 3DKKA 3O8CA 3VV2A 2WE6A 3OT5A 4P7FA 4QBIA 2IV2X 1YQDA 3TLJA 4DM4A 1QH9A 1IUKA 1U1CA 4MYRA 3GIPA 4KR7A 5KOHA 3ONNA 1LFAA 4Q7LA 5TT1A 1CKNA 2GK7A 2R62A 2C59A 4N5MA 3FWHA 3LPLA 1ULUA 2RGYA 5IXJA 3LOUA 4B17A 2W2KB 2I6QA 5ITZB 3B52X 4E88A 5DOZA 4HSEA 3VKWA 2VDUE 4EF4A 1ESDA 5A5FA 3S2EA 4ESVA 2VCEA 4BKUA 4D9EA 3DONA 4JR2A 3FKIG 1JQLB 1SY7A 2LIVA 1GO3E 3L8FA 1MB2A 2GPBA 1QHSA 1EDZA 2UVPA 1HQKA 1VG0B 4FOOA 4Y2JA 3FHTA 1GT6A 2CW7A 1ML3A 4BX9A 1TADA 3RI3A 4PXAA 3VH3A 4HGOA 1FYDA 2XUOA 1GTG1 3TAUA 5IUNC 5LPNA 5CCXA 3NIDB 2A1UA 3UUGA 4MTEA 3DNFA 4XFKA 2PBZA 4F8YA 1CUIA 2OCBA 3J80W 4H60A 2DWOA 3B1WA 2ZSFA 3DEFA 3WGYA 1JLLA 1E7RA 1RAEA 2B8TA 2PJUA 1KYTA 4UFZA 3LG2A 3Q88A 2Q4TA 2IYUA 4HYKA 3E9EA 1XNQB 1SVUA 1CDOA 3OFSA 4S0XA 1P7WA 5CDTA 4DC9A 1XRJA 1AQLA 2ZBEA 1ZXLA 3AV3A 1BW9A 3KC2A 2GFQA 4LX0A 3HQ4O 3ZWCA 3K0KA 2HIXA 4WACA 3OE7D 1UDRA 2W58A 5AR1A 4LF5B 2AN5A 3WOHA 1EWTA 4H18A 2DT5A 3B7PA 5ALKA 3KSUA 3IB3A 2ASDA 1QXSA 1NLZA 5IDVA 4ZEVA 1PR6A 2WTXA 1JZSA 3QBVA 4KPGA 3O8LA 4BMYA 4D4IA 4F7WA 6YASA 2PKRA 4HQKA 5I7AA 3BQ9A 4ZU3A 5G0TA 1SKYB 2X3FA 1VE6A 3LDGA 5CPBA 5CB6A 1UIMA 4H4EA 3TQFA 5FL3A 3C3PA 3C7DB 4YFVA 4N40A 1CEQA 4LXGA 1YONA 4JJGA 3ZOZA 3QU2A 4KXWA 3KNZA 5LC1A 1W93A 2YRXA 1D1PA 1MVOA 1QO7A 2ISQA 3G6YA 3BKWA 3N05A 2F2TA 5EIXA 1WXFA 3ADKA 3QVOA 4PZDA 1Q22A 1NTOA 4WLOA 1X7GA 2QTVA 3X0DA 1QPZA 1M2KA 2XT6A 1PR4A 4AZ0B 4ZVLA 3JQEA 3K09C 1SBYA 4BU0A 3CF0A 4GLXA 1XZQA 2NWQA 2BSQA 4Y1GA 1U65A 1W5EA 3X1JA 4HSGA 3KDAA 5BVHB 2G4CA 1YS9A 4R0VA 2MJLA 5G0VA 4EOGA 1GU1A 3NALA 2MSEB 1TVKB 1NLUA 5L6MB 1OZAA 3U9TA 3KPJA 1AK9A 4ZA2A 4ZYYA 4UE6A 3IVGA 1W2GA 4TUYA 2FPSA 2X5OA 1H2WA 1BVHA 3FGNA 1QCYA 4B3TH 4IWYA 4MPJA 2IWRA 2Q6OA 1CPYA 2UXDB 2OGUA 2XCTB 2ECKA 4YLYA 3IO3A 3VSCA 3AIMA 5C46F 2GPTA 2OAP1 3NOQA 3A70A 4ZPXA 4B80A 1JEAA 4PDBA 1GTJ1 3UV6A 3B2EA 3BBPA 1BW9B 1JG7A 1G8YA 3AMVA 2DTDA 4YS6A 2X0EA 4O7VA 2NTEA 1Y3AA 1U3UA 1Y4UA 4RUCA 4FZJA 4H0FA 5BY2A 3FBGA 3NM4A 3FDSA 5GJCA 1RJWA 4Q1BA 5SY4A 5AVYA 4KR3A 4RO0A 5HVNA 1RLTA 1HEUA 1M3SA 2VPTA 1FFDA 3FKSA 2X13A 3HHPA 4FGLA 4K2HA 1IHXA 2HA2A 2IY8A 4KAAA 4PYRA 4QW8A 4UHFA 2IVFA 1F0PA 1Z6PA 4FMDB 4KAJA 1AU9A 4L9RA 4WK2B 6CHYA 3TTXA 1QP0A 4D44A 1AQJA 2INGX 1Z6GA 1Z4MA 5A3VA 1G8GA 3ZLVA 3MWEB 3KAKA 1L1RA 5E6SA 1RP1A 3DKIA 1JMYA 1CUDA 3GYBA 4URFA 1B2LA 1AY0A 3GGPA 4HNTA 1Y8CA 3K96A 1BXRA 1OBGA 4HNGA 1U31A 1LJUA 2YY7A 5E3IA 4KE9A 4HBZA 1ODKA 3F4KA 4FE2A 4XDGA 1TJPB 1QG4A 1E60A 1R0XA 1MPTA 1EQUA 1U9CA 1M7GA 3DAAA 1ZNZA 4OGWA 4W82A 4KGDA 1W36D 1G42A 2PN1A 5KX5F 3MGGA 4IDNA 1D4AA 1GGJA 4WXPA 1UCFA 4PE5B 4TMKA 3IKTA 3CUVA 4D4LA 3P7MA 4L51A 3FH0A 2ADMA 3LC0A 3NHKA 2FK1A 4QGFA 1BC5A 3OY7A 1DWUA 1NQOA 2A1IA 4A15A 4LK3A 1LQ2A 4JV5H 1CUCA 3IAAA 3N8GA 1EVQA 3OCZA 1JA1A 1VSBA 3SXUB 4W8GA 4AY5A 1JYEA 4P3PA 2ZYIA 1JTVA 3EAQA 1H1TA 3B7WA 3DHNA 3VOSA 2Y0CA 4MYTA 1YRLA 1JHDA 4CEIB 1YBMA 4X3PA 4ASUA 4BV8A 1FSFA 1K4YA 1KTVA 2RKWA 5L9XA 1NN0A 1RM5A 1YB4A 4LRXA 2F43B 3U7HB 5KBYA 2XZDA 2CL5A 1NI4B 2YHIB 2GAIA 3EHEA 4FILA 2W6MA 1G2IA 2RHBA 4P7GA 3TDMA 5IYBG 4K0KB 3SHWA 2WB1A 1Y1TA 3E3OA 3TGLA 1GXSA 1L4YA 4ZAWA 4EGCB 2LP4Y 1JFVA 3OZRA 3TQSA 1IPHA 2V65A 3IDZA 3IUBA 1SVSA 4RK6A 5E9JA 4HEQA 3L6CA 3SAJA 1RZVA 1WV1A 1A88A 2RBEA 3NP7A 4I4LA 2VJKA 4WY2A 2OAGA 2PX8A 2NX2A 3DDUA 1QWSA 2CHGA 4U0KA 2CXRA 3WK5A 5JXJA 4BMDA 1B8PA 4BU1A 1Y8QA 1SIOA 1OMOA 2CY0A 3INYA 2PVPA 4FD3A 4OAQA 4OHXA 4PO1A 1Y37A 4C2TA 1XLUA 2A0UA 2X14A 4D4JA 1AUPA 2HK9A 4JLUA 1KEKA 4A3FG 4RQUA 3K9FC 4GXRA 3ITNA 1P1JA 5LYJB 3C5VA 3BK1A 4BAGA 2HLDD 2P41A 3LKVA 3N5CA 4R6XA 1L8AA 1AGPA 3JASA 2I6XA 4JLPA 3SZUA 1VLLA 1N5MA 2HIHA 2TMGA 4M0EA 4F93B 1CZOA 3LRPA 4GR5A 3GPBA 2MCFA 3ZHZA 5FR2A 2ERYA 4TXJA 1WMSA 4B87A 4BLPA 3F47A 4K86A 3NB0A 1LNSA 2WNIA 4INZA 4B85A 4YMGA 1LCIA 2C77A 2WF7A 5LQDA 1KOGA 2WI8A 1ESMA 1MH1A 3COSA 3MSXA 3U3DA 1T1SA 5ALVA 2IZ6A 3G23A 5DIFA 5ER9A 2BFCB 1CF4A 4LMYA 3BF7A 3MM4A 5JNWA 3MW8A 2WDTA 4HVAA 2JLUA 4O2BA 1OH6A 2DCUA 3DFZA 2OUIA 2BR4A 3HP1A 1YQGA 2EZ9A 2GQ0A 4NS1A 2QQ5A 1X9GA 4H1VA 4M6WA 1S1CA 3VR3A 1K7FB 1Y9EA 2BMVA 3KR1A 4XA8A 4AJNA 4YROA 5D7BA 1YQTA 3IA7A 4LHYA 2H9AA 2QVXX 4XQGA 1O2DA 5C1DA 3AHGA 1QK3A 2P2LA 3OECA 3GLHE 1ZGHA 1C3LA 1JXAA 2CUKA 2WHPB 3QHAA 2P2DA 3Q5EA 3OPVA 1QAQA 2YHUA 3OQIA 3CLSC 4I8XA 4BJ3A 1OH8A 2O8EA 1KDPA 4G5XA 2HV9A 1KF0A 2HRQA 4ZCTA 5GZ6A 4MUGA 5BSGA 4ARZA 2J8ZA 2HLNA 4HNAA 3U48A 1E99A 3A1DA 5K0TA 2F3PA 4HQRA 4LJ7A 5EIOA 2PU5A 2Y0BA 5FOWA 1B3BA 1Y6GA 1M2GA 2Q2QA 1R5OA 1EHCA 2AOTB 3DZGA 3TSYA 1ZEJA 3DBLB 4J0GA 1POWA 3TX2A 5ICCA 1LF5A 2QJRA 1T2CA 5UKDA 1PJLA 1J06A 4U3JA 4OREX 3GZNA 2ZDQA 3WLRA 4TS4A 5HSGA 1T8UA 3I2GA 4JY7A 3IQFA 5T64A 1VKOA 3NHSA 4GH5A 1JSCA 1ZW1A 4HDSA 1A5TA 4NI5A 4YV7A 2WHEA 4KQCA 4AN4A 3TE6A 1M2OA 1OYVA 4KQKA 4B6OA 2RIPA 2FPGA 1Z7YA 2Z8XA 3JYPA 5J4YA 4ER5A 4OXRA 3QVLA 4P3XA 2GZMA 1V3UA 2IA5A 2JKZA 4Z5XA 1DC5A 4YO8A 4DRYA 3ME5A 1OX5A 4GVLA 1VXRA 1YJ5A 1FOEB 2IUYA 1JB1A 2GYVA 3QJ5A 2VLBA 1QP7A 4FI3F 3R9WA 5K20A 3P1JA 4AFNA 3JZ6A 4DSOA 3LQ2A 3GLGA 2AFIB 1FZQA 4HJRA 4EHKA 5EIAA 3GFPA 2J67A 4I5GA 3BC1A 3F3YA 3WRVA 4O2BF 1J2UA 5TB5A 2AKEA 2LRHA 3THYB 2JH8A 4LOLA 2I91A 4GBMA 1AN9A 2KBEA 4URHA 2R8IA 5HE9A 3SLRA 4DBZA 4HOYA 2AV6A 3DEJA 3EDRA 4FMCB 2WB1E 1UP4A 4IH1A 4V0QA 1NW7A 5DTEA 5AW3A 5FD6A 1N2XA 3K15A 3SVLA 1GQSA 1H2HA 1RHKA 3AI3A 2D0DA 3ZCQA 5LQUA 2E3JA 4DA4A 4P5EA 3T5KA 1R5JA 1F3OA 2WTMA 2C7QA 1OWPA 2ONZA 1PJBA 2IOFK 1SQGA 2WYVA 4M0UA 1I5OA 4RZ3A 4DXHA 3A3PA 1Z26A 2CHEA 3AZPA 1EUCB 5BV2P 3HFJA 4HRAA 421PA 1RRCA 1THZA 4TROA 4XSHA 2B1JA 2P4QA 5AKIA 1GV1A 1U8XX 4MQEA 4FFBA 5FPPA 1WY7A 4G6ZA 1G55A 1YL5A 5F7XA 2P3SA 2QAGA 2AZMA 1JKXA 1EFPB 2R1VB 1J2RA 1YVUA 1EUQA 1E89A 4UU8A 4P36A 5CTJA 5GOTA 3W2HA 4ZMRA 4QOEA 4CEJA 5HF6A 3X1YA 2XB2A 2C4VA 3DMGA 4J1TC 4JASB 4JLOA 5FIUA 1GFIA 4QELA 3OEWA 5HA5A 5D85A 1GFZA 1P9WA 2O3SA 1P7YA 3VOBA 1GPYA 1MQAA 1LWOA 2Y6UA 3RREA 4CDRA 1IZ0A 3VR2A 1C4OA 4YIHA 4TV9F 3ITEA 4MUMA 4OQZA 1M2VB 1N5DA 1RHQA 1MOPA 1YBVA 3ZLTA 3N75A 4YCNA 2FAXA 2JJ2A 4BXOB 3W9BA 2CNVA 1SXGA 3RJ0A 2R86A 3CEMA 4PZCA 4M2LA 3CRZA 1LPMA 2IU4A 4OQYA 2CB9A 3RFCA 2JGDB 4GE3A 4KMOA 3JQ6A 3NC0C 2VQEB 3DEYX 3AHCA 1NDUA 3QVGA 1VHQA 3GRAA 4TS9A 5L3SA 1ECGA 2F3SA 2MR6A 1T6NA 4TMZA 1AKMA 3PT9A 2I80A 1M1YB 1SCBA 2AX3A 4ED0A 2OSBA 5HUHA 1UJMA 4I8IA 4PRZA 4FQ7A 4D6YA 3GOHA 3L40A 1RHRA 1Q1NA 1N9KA 2MWMA 4EEYA 1JP7A 4G37A 4IV5A 4ED6A 4NATA 4EKGA 2H0QA 1VL1A 1E79A 1KARA 1V9CA 2HMWA 3DZHA 4G0ZA 4ED9A 3DLIA 1X39A 2ZIEA 1C3OA 1PR5A 4H27A 5EWLA 4JB8A 1N2OA 1RJGA 4KHPB 2FRDA 3O92A 1B76A 2R5FA 3LLCA 4JOSA 4M22A 4EI2A 1UBFA 5HIJA 4R0MA 4XOIA 1CIPA 2QL5A 4CYMA 4WZAB 4AKHA 1KO4A 1PNQA 2FG7C 2WFMA 3TGPA 1WPRA 2WSSD 5EVCA 5FPTA 4MA4A 1FRQA 2QD1A 3D7NA 1YULA 1UAAA 2FHPA 3D3EA 1EXDA 4YCAA 2C28A 3KJXA 3NIWA 3WQBA 3KKLA 1NM5C 4QU5A 1Q7RA 5TVKA 1TQDA 1D03A 4KZKA 1B0AA 1NFRA 2GZ3A 3WNDA