5C1PA

Crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
289
Chain Sequence
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHSVGMSKVDHASELQKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPKTQYFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARILMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Structure of D-alanine-D-alanine ligase from Yersinia pestis: nucleotide phosphate recognition by the serine loop.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 89
structure length 289
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5c1pA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 5c1pA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5c1pA01
2FP4B 4O7YA 1PK8A 2GLTA 1Z2OX 3TW6A 3RFCA 2I8CA 1ULZA 4MV7A 3Q1KA 1M0TA 1I7LA 2GQSA 4O7LA 5BMVF 2PVPA 4HNUA 2R87A 2HJWA 2NU6B 4HNVA 1EHIA 2FPPB 1DIKA 2NPOA 2YS7A 1B6SA 3U9SA 4YAKB 3ORQA 5JVDF 1C3OA 3JRWA 4L1KA 3LP8A 1GSAA 3JZIA 4YB8B 5D8DA 4ZQIA 1M0WA 4MA5A 4M9CA 3K3PA 2R86A 2R7KA 4FFOA 3TQTA 5J2TF 2DZDA 3U54A 3HBLA 4O7TA 3KAKA 2YZLA 5EZYF 1A48A 3WO0A 1I7NA 5CA0F 2W6QA 4ZOLF 1IOWA 3MWDA 1CE8A 5C1PA 5H80A 4XYLB 1GSHA 1VKZA 1CQJB 2CQYA 2R6FA 2W6MA 3I12A 2V58A 2R85A 5KKNB 3N6RA 3G8CA 1B6RA 5LA6F 4M98A 2W6PA 5LP6F 4FE2A 2R82A 3E5NA 2DWCA 4MV1A 3ETHA 4EABA 2GQRA 3K5IA 4NYEA 1C30A 5C8YF 2GPSA 2P0AA 4EA8A 4E4TA 1IOVA 5C1OA 3BFPA 3AW8A 4EGQA 1KBLA 2XD4A 2W6OA 3BSYA 1W93A 2IP4A 5LYJF 4O4JF 3UFXB 1E4EB 1JDBB 4IIJF 4TV9F 4C5AA 1EUCB 2Z02A 5JQGF 1KUTA 4O7RA 5GONF 2R7MA 4O4HF 4QSHA 3R23A 2J9GA 4I55F 2X0SA 4M99A 4C5CA 4WD3A 3DF7A 3MWEA 3VPCA 2GPWA 2CZGA 1E4EA 4IWYA 3ETJA 3OUUA 4HR7A 4IHJF 1KC7A 1CQIB 2FPGB 4FGRA 3R5XA 3RV4A 1CS0A 2ZDHA 1JLLB 4O81A 2ZDQA 1KJIA 5CAEB 1JDEA 4TUYF 2OLSA 3VPDA 1DV2A 3WNZA 3GIDA 3QFFA 4EA9A 5BPHA 2SCUB 4O7NA 4RZQA 4YAJB 3R5HA 1GLVA 3G8DA 4MV9A 1AUXA 4IZOA 2C00A 4EG0A 1EUDB 3RUPA 4O86A 5CA1F 4TV8F 4WBNF 3V4SA 2CNVA 4IWXA 2NU9B 1DV1A 5HV6A 1BXRA 2DIKA 5JVLA 2NU7B 2YZGA 3V4ZA 4O4IF 4O2AF 1JKJB 4XYMB 4MAMA 4EA7A 3HB9A 3R5FA 3MJFA 4ME6A 2W6NA 3HO8A 3JZFA 4I4TF 1M6VA 2VPQA 2YS6A 2HGSA 1T36A 1OBDA 3KAJA 4C5BA 4HQ6A 5BPFA 3KREA 2W70A 2FB9A 3KALA 2QF7A 1Z2PX 3VOTA 4MV4A 5K2MA 1UC9A 4YJ3F 2R7NA 4MV3A 4DIMA 5LXTF 5FNVF 2VR1A 5JH7F 2YL2A 1VBGA 4DLKA 2XCLA 1KJ9A 4MA0A 2CNUA 3VA7A 4O82A 2ZDGA 4Y8VB 3RV3A 4FFNA 2CNQA 1AUVA 2YW2A 5KX5F 5CB4F 4YBZB 4O2BF 3R9RA 4FU0A 2NU8B 2W71A 4O7WA 1KJJA 1A9XA 2I87A 2R84A 2W6ZA 4O84A 4FFRA 3GLKA 1OBGA 3JRXA 3Q2OA 4FFPA 2V59A 4EAAA 2YRXA 2YWVA 2Z04A 5HBRB 3LWBA 1Z2NX 4XZ3B 1PX2A 3ORRA 3TIGA 5J2UF 3BSSA 3BSWA 4O4LF 2YZMA 2YRWA 4GGMX 3N8DA 1VBHA 2PN1A 3U55A 4O7ZA 3SE7A 1W96A 4ZHQF 5JQWA 3VPBA 1GSOA 4FFLA 4J6EA 4HNTA 5I47A 2R7LA 4MV8A 1SCUB 2I80A 2NUAB 2DLNA 4O83A 3TINA 3U9TA 4EGJA 4MV6A 3OUZA 5IYZF 5LOVF 1EZ1A 1EYZA 1BNCA 2FPIB 2YYAA 3AX6A 1KJ8A 2QK4A 2YZNA 3NUAA 4M9UA 2PBZA 1WR2A 3VMMA 4YJ2F 4XX0B 1KEEA 2VQDA 3WO1A 4O7VA 1GGOA 5DMXA 4I50F 4FFMA 2VHEA 3BG5A 3K5HA 4O7SA 2WYOA 4ZI7F 1UC8A 1KJQA 2V5AA 3TIIA
chains in the Genus database with same CATH superfamily
4HDNB 5FA5A 3ZV5A 2AC4A 4M55A 2C97A 1UDCA 1ZGGA 3TD6A 1CU1A 4CPDA 4MWGA 1Q0TA 2PMKA 4F4DA 1V11B 1YZGA 1CRQA 2JGLA 4MPPA 2CWWA 1Z6QA 3I0ZA 1I1QB 2JJ2A 1YULA 2A58A 2OENG 3WGVA 1UMBA 4J0KA 2GK7A 3JVVA 2NVBA 3OZGA 2WG2A 2OGZA 5T41A 3ENQA 3OX3A 2EL7A 4Q43A 4YVFA 1C0EA 2XUQA 2YFQA 5LKRA 4YUVA 3P2IA 1W73A 1XJ5A 1X42A 2FSHA 2IDKA 3RUIA 4HD8A 5JTUA 1C0KA 3BD9A 3ZN2A 3KVYA 3AUSA 2H48A 5A4JA 1H2YA 3O4GA 2GMWA 1XCMA 3IIJA 5A2QW 4PHFA 3FCYA 4JB8A 3M6FA 4XARA 5BV2P 3D3KA 3NNDA 5BMVA 4RDIA 1E2LA 1ZDMA 1ZCBA 1MH1A 3SX2A 3QPUA 4Q3AA 5ISMA 1ADBA 4Z0PA 3B2QA 5LC1A 3RBEA 1UXGA 4LJ5A 3EQ7A 2UU9B 1C0PA 1C9DB 3IELA 4L28A 3GCWA 4JELA 4HEQA 4PGFA 2G7MC 4B40A 1SQSA 4IDAA 3GUCA 3GD7A 4UU8A 4HTFB 5HQJA 2VVTA 4OHKA 4GKVA 3W1EA 3SBEA 2ZYAA 4O3OA 2GK3A 3VJMA 1PZHA 2EL9A 3GNSA 3L7JA 1I01A 3IV7A 3IG0A 4KGZA 2VRCA 2AFVA 2LNDA 1N2CA 4HZIA 4TRRA 2BMFA 2G0AA 3CB4A 3SZOA 2W6JD 4LF8H 4AYWA 3PFHA 3A6ZA 1RYZA 3OE4A 2QLTA 1D8TA 3FDZB 1X74A 4ZQCB 3RTXA 4E03A 4GXNA 2X5RA 1SHUX 4LN1A 2ZDQA 5JCJA 5AI0A 4LVNA 3EK2A 4AG3A 2J32A 4OAQA 5J3JA 1OXVA 4TMTA 1RZRD 3WK6A 2Q5OA 5EJ4A 3C7DB 2O7SA 2G72A 1D2CA 1D4AA 2CMGA 3THSA 1A50B 4CCSA 1T3SA 5FWNA 1Q14A 2C88A 4HF7A 2HUNA 2OHHA 2A5JA 2HMWA 2O05A 1RXEA 2KJQA 4L4UA 4JLJA 4UZSA 4B71A 2VT2A 3FWPA 3FY4A 2V0CA 1CKOA 1HMPA 1SELA 4UHCA 4LV8B 3WYAA 2WF8A 3RVQA 1CPYA 4BB9A 4L0CA 5EMHA 4BO3A 1WRBA 1LW7A 1SXJD 4FDTA 4LBWA 2WD7A 4LWZA 1COWA 1G42A 3OTHA 2E0IA 1IHDA 3WQSB 4DIUA 2B21A 4TN5A 3AQIA 3CF4G 5E4TA 5C8YB 1GQRA 2FJ0A 4IDNA 4GLJA 3AVYA 1N56A 1YQQA 5CM2Z 5DOVA 5MFZA 2C9CA 2WIKA 3J7AK 1LVUA 2CLFB 4UBJA 3W3AA 4M0FA 3WR5A 3LT5A 1ZA2A 1WIWA 1X13A 3A3OA 5EVJA 1RQ2A 3R3WA 2YRWA 5F9HA 4BS9A 2VAPA 4M1ZA 4TQRA 5G4KA 5JDIA 4G07A 4XUCA 4DCTA 1C1XA 3DOCA 2BP7B 4M9RA 3GNLA 1JSZA 3GDEA 4FMCB 4V0OA 2YHSA 1V47A 3ZEAA 4TLAA 2NUPA 4CFYA 5IYZF 3N05A 3H6KA 4NK4A 3JATA 1GGEA 2BFOA 5CEJA 2YV1A 3E9MA 4ARSA 3BILA 5TT0A 4LIPD 4CODB 3PQ8A 1JQLB 3UKOA 2O7NA 2M1XA 3EFEA 1U81A 3ADKA 3CU5A 2C3YA 1SY7A 4FW8A 1EZZA 1JFLA 4AX4A 5E6UA 4CIXA 1U28A 1JQEA 1ZR2A 4EX7A 3A70A 4DFDA 4J0CA 1WRVA 4EB6A 3E3AA 5JADA 4RKWA 4A3IG 4MO2A 3W6ZA 2HXYA 4R9RA 3EMBA 4J4HA 1XLVA 3GELA 3W7AA 4BOYA 5I5XA 1PJBA 4PG5A 5TE9A 1T3GA 3Q41A 1G3MA 3FPBA 4ZRNA 3G17A 5CFQA 1SFOA 1XLTC 1IJKA 4S1PA 3T7EA 3NWBA 2R11A 3WLKX 1SCIA 3NATA 2QVGA 2Q4OA 1AK9A 3U3JA 1UBSB 2C2MA 2R8EA 3IPXA 4HSGA 3RS3A 2VNIA 1IUKA 1M8PA 2P1ZA 3RGZA 2EU8A 3AY0A 1GUZA 2Y0BA 1C7QA 1HOTA 3RQSA 3TR6A 2XY4A 3EBPA 2NOAA 4JBYA 4DIOA 1OD6A 4R2IA 4BZZA 1NXTA 3FDIA 3MRSA 1M2VB 2Y99A 1UKAA 1AG9A 2OHGA 1NYTA 1PGOA 2C54A 1EX6A 2PLFA 4NZZA 4FYKA 5LP6C 3M5DA 2KHZA 2OBXA 2R8BA 3EPPA 2XE6A 1OI3A 2Q3CA 1JYEA 3NHWA 4XASA 5AUNB 3FUXA 1KEUA 4QUDA 2QYHA 5FEUA 2OR3A 1U2GA 1Y8CA 1I1OA 4YRQA 1XMQB 2ZAOA 3G68A 3VR5H 4C06A 1GPH1 5KWEA 4C5CA 2P35A 3O8LA 4WD3A 1JMVA 1R8XA 3B70A 3W2HA 5ITWA 3HB1A 3CRRA 3DDOA 5KYYB 4BWVA 4CM4A 1IHOA 5A71A 4LZWA 2ZDHA 1CY2A 2B5WA 4XSGA 2XXAB 3I5UA 4OJKA 1R6UA 2P4SA 1BSVA 1UF9A 4ECVA 3E7WA 5IJ9B 1FPQA 4HX5A 2FNAA 4AN4A 1ZBQA 1FFAA 4MV9A 1UCFA 1VOTA 1U3DA 2BFBB 1WCYA 5EQJB 2OORA 1LNSA 4FE4A 2F6RA 4BP9A 3DFUA 2VQFH 1E2QA 3DEIA 3EVAA 2B4KA 2Q62A 1C8VB 1P8JA 4M0UA 3RVDA 1QH1B 1UANA 2AGVA 3DL0A 2FLNA 3PNMA 1ECGA 4G1EB 4JSYA 1EP9A 3KE8A 1ODFA 3U3KA 3I4MG 4PNEA 1FXWA 2X3YA 4A8JA 4ZN6A 5A3RA 2GLUA 4DDMA 4JX9A 1P8LA 3FXAA 3SYKA 3CH6A 3KQSA 1PN3A 1AV7A 1H0SA 2CNUA 2C83A 1YAJA 3VYVA 4BMVA 2YC4C 4IHAA 2IU6A 4L07A 5B7NA 3K20A 2GJSA 2EW1A 1JVNA 3TOZA 2ZIFA 4FFPA 3D2AA 5TNXA 1J8DA 2FWJA 3RC9A 4HZUB 3CG0A 2EP7A 4EECA 3EGXB 1O96A 4DR5B 1W4LA 3TLKA 4I3FA 3IAS1 5IM4A 5JO9A 1C8BA 5BR8H 4CHTA 2SKDA 4ITUA 4CQMA 3SZ3A 2WT4A 4NL4H 4QGSA 2VTVA 3ZG6A 4FM9A 3NBXX 4DV7B 1CJBA 2W2KB 5E9WA 2P68A 4KPEC 3FKIG 4TLMB 3NTUA 2IGBA 2YVAA 4PLVA 1NBIA 2PX3A 1VFNA 3A04A 1DG3A 2ORVA 1Z5PA 4FS8A 4H0NA 5F7JA 4O7SA 3KXKA 3PHGA 1ZOLA 3DCIA 4JC5A 3NBMA 5ILOA 3GB9A 4LYFA 1ONSA 2GM5A 2WIBA 3O8DA 3QPWA 1ZGZA 3ONNA 4J7UA 4NJMA 2YMQA 2YWXA 1QHEA 1EB8A 3HU5A 4L22A 3M0EA 4FFSA 3V32A 2NU6B 1Q1NA 2DEUA 2JA5A 4O3FA 2OXRA 3QLTA 1XZIA 4MQ6A 4WV3A 3OU7A 4F5WA 4NDAA 4CE5A 3NDRA 3NEPX 4PC6A 2NTVA 3B6KA 2P69A 1WLSA 1JV2B 3AUXA 4KHPB 5AW9A 1QMGA 2RAFA 4F06A 5EZYF 5HTKA 3K0AB 3ZK9A 1IMJA 1XTSA 3PXUA 1VG1A 4ZO8A 4OSOA 5LB2A 4CMEA 3WMXA 4NCBA 1D6NA 5CDFA 3TNDA 1Z2CA 2YDXA 2QPTA 2HQOA 1QV6A 2W2LA 4F4UA 2BFEA 4GAEA 4R7GA 3ED5A 5F9NA 2JD1A 5BUSA 4J75A 1WU8A 4G8CA 2EX0A 4GRDA 2DWPA 3CT6A 2R85A 3ST7A 3IOEA 1YDFA 1F17A 5GZ6A 1T8YA 1USIA 2FFQA 3AEYA 3B9RA 3BMNA 1KYXA 4QICA 5KVVA 5KFPA 1BMTA 3VSAA 3D6AA 1IDOA 2P0AA 1DAOA 1LJLA 3AW8A 2BRUC 2DRIA 4A2WA 5JAMA 3HGQA 4QXAA 1R16A 2FW1A 1VXRA 3PP8A 4J94A 1KOFA 4PZCA 1YJQA 4MP8A 2AKEA 2NO0A 1GA4A 4TTAA 4PBRA 4BU0A 4O3SA 2HLPA 4C6RA 4RIHA 1PKEA 2ZJ3A 5C46F 3GO4A 4BP3A 4PGAA 1F6WA 5JASA 3W2TA 2V45A 5A03A 3NKFA 3W06A 2O4CA 4UJ5A 4R81A 2XDQB 3QHAA 4M38A 1RPJA 3ZY2A 4FGRA 3G2NA 1EE1A 3K1AA 3L0OA 2HVRA 3KQLA 2CK3D 4RL4A 1WETA 4NYJQ 3R9XA 2DX7A 4Z8YA 3H4DA 3PD0A 4EYOA 1TIKA 3ISJA 3KXLA 2W0SA 3DA8A 5KFAA 3LLSA 2B25A 2D0IA 1MAAA 3RAEC 3QELB 2IHZA 3WADA 1XQ6A 1TE2A 4DM4A 5AOBA 3TW0A 3HP1A 1SWWA 1GT6A 4JU8A 5ECDA 3B8EA 1AGYA 2A5FA 1EFKA 4J7XA 3F6YA 1VB3A 2GRUA 3SKVA 2CVZA 4Y9TA 3DMHA 4Q82A 3RF7A 2FWNA 4O4IB 4LZLA 3SHWA 4QOGA 2B34A 3ANSA 4KYTA 3E9NA 2KSWA 2Q3JA 1E2NA 4AS1A 4CL3A 3A37A 1YE3A 4WA7A 4WZBE 5GIPE 3V1MA 1VZ3A 3DHEA 4A2PA 3T3DA 4P4GA 1P2TA 1JIJA 1OVMA 2J9FA 4LECA 3F6RA 2YWVA 2FK2A 1L4FA 5DHUA 4BO5A 5JYDA 1Y14B 1Z56C 4J3JA 2PLAA 3UM9A 2EYUA 3S81A 3KVOA 2UYOA 3E8XA 2R6GA 2H6EA 2OLEA 2XWBF 2DUMA 4AVYA 1PWZA 3ZQUA 1QGUB 3URKA 5IYDG 5HRCA 3HJTA 4CKBB 3QNUA 2WINI 2JFXA 1DOAA 3GZJA 2QKYA 5I9LA 1SUAA 2NVYA 2AQHA 2BHSA 2P3SA 1KJ8A 4TYYA 4BKRA 5EIWA 3PHBE 1PV2A 2XD9A 5CW1A 2AC2A 4MCHA 3I73A 2IIQA 4ALMA 2XNSA 2VXBA 3OLXA 3ACDA 5KTOA 3NDPA 5EE3A 4X60A 1ORVA 2QE7A 3WHIA 3RSSA 2WUFA 2WB4A 1TQ4A 2JEJA 2JHCA 3BK1A 5DQIA 5JIBA 1MV8A 1X7WA 3NRJA 3REGA 3QKWA 2J59A 3ZD9A 4LOHA 3OSUA 1D03A 1E0KA 1H2XA 1XMOH 5E6SA 4ETMA 4BAGA 2HSDA 4OXNA 4MROA 3WB9A 4ECRA 3ANMA 4DA8A 1OH5A 1Y89A 1VL1A 3C48A 2AN5A 4BTEA 5HW0A 4PZLA 1H6BA 1AQNA 1WUYA 5C4IA 3E2PA 4MCIA 4BKMA 4ETNA 4OLAA 4YAKA 3L8HA 2BJVA 4XDZA 1EFRD 1TKRA 4R31A 5DGDA 5FYDA 3W9BA 4R9UC 2PRKA 2I6GA 3IBSA 1ZI6A 4F85A 4F1WA 4EHIA 3GT3A 2V0NA 2BJHA 1JZTA 4MIOA 1P8AA 1XRLA 4HGPA 4EHJA 1HQKA 3B6JA 3R7WA 3WA7A 2NNLD 3RT7A 1J24A 4P86A 1UBEA 1OHHD 3CBGA 2AIRA 4KO3S 4D9BA 3TUZC 4TS4A 4N5HX 5T4BA 3TSAA 1UL1X 1P44A 3DUFA 3M4JA 2WWHA 1H3NA 1GY8A 4TV9F 4JP8A 1O8CA 2H1SA 1QPZA 1N2JA 5DMHA 3CURA 4EHHA 4H60A 1QS0A 1XTBA 1C3JA 3VGJA 2PRZA 4CCAA 3MPOA 2JHPA 3O1JC 4O4HF 3AHIA 2J6HA 1T4BA 2PXAA 1DINA 4P8RA 3ROEA 4J03A 4ZU3A 3R40A 2F48A 4PHCA 1G6OA 4O0LA 2I4IA 1YK0A 4DRFA 4Q9IA 5L3QB 1RRCA 5AKHA 2W8BA 2D1FA 4TKLA 3TZEA 2QMHA 2JL1A 4ER7A 4TTIA 4RNCA 1KJIA 3JQ8A 1FFYA 4R2KA 1QQ5A 3PQ6A 3OZFA 1V95A 5JXGA 2EFGA 4RLFA 3GRUA 3FPJA 4I55B 3LY9A 5TEVA 2R79A 3HZRA 3DZFA 4O4JA 3ZD8A 4AKSA 4NJEB 5TXGA 2H51A 2XAUA 1CY7A 5K0LA 2ZRAA 1ADCA 1BXRA 3PYXA 5K8IA 3NALA 4DANA 5JJBA 4BBRG 5BWWA 1L5FA 3E05A 3ESCA 5FJJA 5TQVA 5IW8A 1HDZA 1RS0A 4I5IA 4DSOA 4K9MA 5A02A 4ZTUB 1E6WA 1QIFA 3K1JA 2GPNA 2QZSA 4O25A 4X95A 1VCIA 1ENYA 4G5RA 3IH5A 4DJEC 3L7CA 1A5SB 3E7PA 4P5EA 3V2GA 5K2MA 1I4OA 2F4NA 4MLDA 5LMUB 4ILKA 3A2MA 1G5PA 1TC2A 3GARA 2EJUA 1E4FT 5FJIA 3U4QA 4Y18A 4KRYA 3U4IA 4A0QA 5KX5F 2C58A 1KTAA 3R9RA 5TQ2A 1DKOA 3COPA 1L8XA 3X1MA 3VPSA 1F9EA 1JEQA 1NY5A 4N5DA 3KKKA 1WEHA 2ZBDA 3NHUA 2QNIA 3HJUA 4MV5A 4LXHA 3GEEA 2R44A 1ZK1A 2XRMA 1J8YF 3PKJA 5L1JA 4U8GA 1F8YA 3MFIA 1IL0A 3EYAA 4PBTA 4ZI3A 3I6YA 1Y5RA 2R93G 1XRPA 2F43B 1V1MB 2CXHA 3OSZA 1VIYA 1XEFA 3DL4A 4K0KH 3EGOA 1VA4A 3OBIA 3ITKA 3OUZA 2ZS7A 4HC4A 4LXQA 2G8LA 2YNMA 3SIRA 4HYEA 4RNDB 5DTEA 4NPHA 2OXIA 1FRNA 3JQRA 5HKKA 5K8VA 2GYUA 3FDJA 2VA9A 5KAMA 3PQ4A 3IKMB 3QJYA 4Q4AA 1KZHA 2P9TA 4FCCA 1I1MA 5MF6A 1TK2A 3JD0A 5C0OE 3AVWA 4PVCA 1MDFA 2IHKA 3QWUA 2RK4A 2YCLA 4DQNA 2H7XA 3MWFA 1DC6A 2Y0SE 3FKQA 4FUQA 4UHJA 2RB4A 3ONFA 2IHNA 4ARVA 3CR8A 1JXLA 4MWCA 4GM0A 5TSDA 4RD6A 3OX4A 1X0XA 2VPPA 2VBGA 1LVHA 1U1GA 3H8SA 4ED0A 2PMCA 4O5OA 5HK8A 3AH8A 4R2WA 3DS8A 2FPSA 1EAMA 3E8SA 4MRMA 4PX9A 1DADA 1ZCZA 5F77A 1C30B 1J0DA 3G1UA 3BS4A 4HAOA 2XZOA 5F7XA 1SKYE 2VDUE 4W9NA 3QUQA 3WJ2A 4NBUA 4L08A 2QLJA 4KHZA 4DLXA 4EZIA 4FCTA 3BWBA 3U4AA 4DOMA 3WLPA 3PHLA 4EKGA 1XHLA 4GMFA 3DAGA 5CIYA 3D8TA 3TKAA 3UG7A 3T61A 2G4CA 3SEAA 5I7VA 2XUGA 2DYKA 3V8EA 1F0YA 2HBYA 2OLJA 2H7VA 4MMYB 3D3QA 4CWAA 4C0XA 1UZLA 1ZHQA 3NFYA 3OF3A 4IHQA 2WP8J 2JH8A 4WXMA 5LFAA 2VZLA 4UUBA 3AWDA 3T7KA 3GVHA 1P7PA 3B3GA 4UUMA 4JOCA 3AEZA 4L9AA 4UM9D 4ZI2A 1VCMA 2IXFA 2V4RA 5DHSA 4IMRA 4CV3A 2XMGA 1GO3E 4GPTA 1NJFA 1WNFA 2IUSA 3QYAA 5HGJA 2HLDA 1CUZA 3ZDCA 2NO6A 4NBRA 4B32A 1YB1A 1DV2A 4D97A 1JWLA 4MEAA 3HFGA 4C3ZA 1MX3A 3PUZA 5C3EG 3HR4A 4KFRA 5CR5A 1QHHB 4FYXA 2WHXA 1ZM4A 5GWXA 5ICFA 5G0WA 3RS9A 3A6KA 5LNK1 4M0KA 5ALOA 3EY9A 1JT9A 4OJNA 1BKYA 2BN4A 3NM6B 1V71A 1PL7A 4L8GA 5K0ZA 4Q1FA 2O1SA 3PJDA 3Q7TA 2HCFA 2I66A 1MB0A 2NP7A 4PLTA 4BMPB 1EESA 1XMIA 2WAYA 3HZZA 3NVKI 2NZJA 4A3JG 4Z4GA 4Q4JB 2AQIA 5HDQA 4JI8B 2FXIA 4OXIA 2BUBA 3SGIA 3HUDA 5AJHA 3W5CA 4KRXA 3X44A 1JF8A 5D3MA 5JNUA 3SHVA 2PUBA 4RGQA 3I23A 2NVUA 3UCEA 2MYUA 1BEUB 3OY7A 4INAA 1JIIA 3IQHX 5FWXA 2JLZA 3T5JA 4R1MA 1SH7A 1XBTA 4B48A 1VLVA 2H7CA 5ECWA 4IF4A 3KU1A 3EXEA 1IZ0A 3C0KA 3QTLA 1XCGB 4DA9A 2HO4A 5FAKA 3SF8B 3AL3A 3OIUA 1ZNWA 2CDBA 3V1UA 3CW9A 2B36A 3S2IA 2XMRA 3E48A 1ZLYA 2OKGA 4ENWA 2X9QA 4GXRA 7MHTA 1VJGA 4YDHB 1WMDA 4LXTA 2XNDA 2JJMA 4D8TA 3I5MA 5JH7A 2AOWA 3ZQKA 2DFPA 2HMTA 2VDLB 3DPIA 3KWMA 4PG6A 5C7OO 3BBPA 1GKUB 5JATA 4CETA 5LMZA 5SY9A 3IUQA 4RIFA 1YOBA 2GXQA 3MMSA 2ZSDA 4NH4A 1HE2A 1N6LA 1C7EA 1VI2A 1P45A 3PHJA 1CY0A 3O0TA 8MHTA 1E7WA 1VJRA 4A0RA 3CR7A 1OBCA 3I8OA 2PIAA 3WOHA 2R1TA 1LRLA 3V4VB 1UKBA 1T2EA 4AJJA 1KYWA 1OQAA 3GHHA 4KIWA 2ZBUA 5JROA 4LF6B 5C4XG 3IV6A 4GECA 3SSOA 3RD5A 2P1RA 4XJTA 5F98A 3TQTA 3PPXA 3WA6A 1CJVC 4B3SH 1D4OA 3M1IA 5E0KB 1K92A 2AZDA 2O2JA 1MX9A 1ZOOA 3JD2A 3ZI4A 5CITA 4DC0A 1DI0A 5B7PA 1E20A 5KJ6A 3K70D 1LK5A 2RG1A 1Q6ZA 3A27A 4JUFA 5C1PA 2W22A 3OPYB 4DUYB 1W94A 5FL7A 3PA6A 3ROTA 3GLIA 3PE6A 2FQYA 3WRVA 2DH6A 4BWFB 3A4LA 3GZTB 4U00A 2X2EA 2GFHA 1DQNA 3TE7A 2FQWA 1OV4A 3SD7A 2WU4A 1ZONA 3BXOA 4N9QA 4N54A 1TCVA 3V2UA 2IHYA 4TQUS 1TEZA 2PL9A 1YRYE 3AGPA 5TMPA 3PO3G 2C9MA 3BFPA 4BUJA 4ZQHA 2TMDA 4EI8A 2MIIA 4KPGA 2HBRA 2J09A 3CW2A 1UNNC 2QQFA 2ZP1A 2OAEA 2MCTA 2IP4A 2X13A 3AG5A 2PD6A 4D4JA 4YI3A 2QLNA 1IBRA 3UNXA 1S9DA 4RFSA 1CY6A 1N0HA 1T9DA 3VU0A 2VTKA 4DA6A 2Y1XA 5DO9A 3VUEA 3U3ZA 4RD4A 7AT1A 3LVQE 2GHRA 4E5VA 2H1CA 2I8AA 4JI3H 4EB0A 1ESZA 2ZSBA 4NU6A 1YC2A 3TL6A 3B7PA 4CYMA 4PCVA 2VH5R 3GVIA 1R8SA 4P3YA 1E1QD 4P31A 2YJ3A 1E69A 4GFDA 3DEYX 4F92B 1XWWA 2A57A 3FF4A 5DI9A 1AA6A 3D4PA 2PX8A 2JK1A 5DNEA 4GSKA 1N2GA 3CEPB 2QUBA 3R3SA 1AB6A 1OMOA 4BIIA 3CT4A 4O86A 4YR3A 3QQPA 4R9NA 5B3LA 4LY3A 1G4HA 4OOFA 5JLJA 4CGZA 1II0A 3IDOA 3X1ZA 2XGPA 4F9TA 3QXCA 4R6WA 2Q5QA 5KOJA 1Y1WG 4DN6A 1SEIA 1AKTA 2COEA 4Q9DA 1T2NA 1IY9A 5JCJD 3WIUA 4KI7A 4R0VA 4D57A 3ELUA 3KV1A 3BMCA 3ONDA 1RWQA 4R7RA 1QAMA 4MJXA 2A84A 3ZCPA 3MW8A 3O26A 4LSZA 4HDAA 4NICA 3IIKA 5J59A 3SS7X 5JMPA 2JC3A 2ZI3A 5IJZA 2Y67A 2W71A 2PUVA 3IEKA 4ER0A 3RI3A 3W5JA 4O1HA 4RFLA 3U3OA 3F2IA 2ZS8A 4L74A 2ZWIA 4TT3A 2EIHA 1JZQA 5LQNA 1XRQA 3EZYA 3QSGA 4GL4A 1TOAA 1XAIA 4PCUA 1COWD 3BL8A 4WN9A 3ISTA 1LSJA 4K6CA 4CU5A 2YWBA 1FW8A 2E6KA 1B41A 5FFFA 2BD0A 3G8YA 1Z5GA 4QL3A 3JVUA 1QXSA 5J5AA 5FL3A 4I9NA 2QK4A 2CHVA 2XB6A 4B43A 1NUUA 3EEQA 3ETEA 3FG9A 1IXKA 4H1UA 5DT2A 5DE3A 2ODBA 3L8GA 1JBEA 2XQVA 4JNCA 3Q8XB 1GTL1 5B1IA 4QWCA 5IFKA 5J2UA 1VFPA 1E1DA 4JFAA 2XOEA 4ZVLA 3Q1KA 4LXXA 5GJVC 2Y92A 3BWCA 1Q0RA 3GTKA 4AK9A 3CVYA 4HNUA 1OB2A 4RLQA 2Y8EA 1KQNA 1U31A 5JZ9A 3I6ZA 1BD4A 4LXIA 2EZ9A 3PFKA 1N8NA 1E99A 3VSBA 2FR1A 3HFRA 4PHTA 3WKBA 1QAOA 4LE2A 4GF5A 4UMEA 3QW4B 3OM0A 3WGLA 2F1HA 3EF3A 2YC2C 4GLXA 1T8UA 4QFBA 2PIDA 4KWTA 1ESDA 3CZRA 1SC4A 5JR3A 3NKVA 3N0VA 4YRRA 4ZT7A 1ECBA 2AR0A 5CDUA 4LZNA 4IMJB 4JXUA 4H59A 3DC2A 1QIIA 1XQWA 1KH1A 3L7BA 3K0KA 4EUKA 3VOSA 2X0FA 3A4IA 1YQWA 1YTLA 1VTKA 4BGEA 2FDCA 5ICEA 5EWGA 1E6CA 1XKQA 3ZWWA 3VPHA 1U9IA 3IP3A 3MHTA 1G63A 3AVUA 4NP6A 1ZHFA 3G5UA 4DLAA 1Y6GA 1V4YA 2O7RA 3BFXA 1IC6A 1C80A 5BSFA 3N2EA 5B3JA 2BKEA 3SZLA 3AM4A 2C31A 3CKKA 4FTWA 1DKLA 4ZO4A 1Z2AA 2BMWA 3HVKA 4KMSA 4UAJA 1B3RA 1RHKA 4JLPA 3UFXB 3IE1A 4IIJF 5IXJA 1I2AA 1JS1X 4GM1A 4UREA 5KU7A 5K3FB 1ST2A 3GDOA 2BF7A 4WLEA 3LDAA 4LV5B 3MZ0A 2YXPX 2OV8A 1OFVA 1F0NA 5L3SB 3GBSA 3FDXA 5THXA 4DLLA 2VDKB 3CRNA 4BMOB 1DMSA 1RLMA 1ICEA 1Z6YA 3PR2B 5CGZA 5LSAA 2AFIA 1Z08A 2EW2A 2C57A 1NF3A 4GPIB 3PQEA 1W0JA 5AI8A 3Q0TA 3GUZA 3VR3D 1BWSA 5TVGA 4E5NA 4Q7MB 3RDPA 2GAFA 2W8ZA 3WQHA 2JA7A 1WZEA 3DP9A 3IS3A 4QDTA 1Z8HA 1HWYA 1MUUA 5KNCH 2VK1A 3BHMA 2PS9A 1Y6ZA 1EKVA 1A7AA 4DMUB 1WXXA 4HDCA 2O5RA 1IK4A 2PT6A 3VH3A 1C14A 4ZOEA 1DEOA 2MSLA 1OLUB 3IUEA 1CDOA 3C1TA 2HIAA 5JMOA 4QGHA 2X15A 4RH0A 5K6TA 1X77A 5BRAA 4PQEA 1NXOA 2C2WA 2W4QA 4LJ6A 1CUUA 4OVKA 1U8AA 3FLEA 2HK9A 3EGDB 2X5XA 4HNAA 2PT5A 4O8ZA 1E1RD 4FP9A 2ZIZA 4FMDB 3N2ZB 3ZCSA 4UBOA 2JGIA 1JAHA 1T9ZA 4JV5B 1VSBA 3VYRB 1LUAA 2WMYA 3A26A 1T26A 3JRXA 1HDOA 1YZQA 3R5KA 3L0DA 5HM8A 1H0RA 4I4TA 4RHUA 1O6CA 2UZIR 2QN6A 3G0BA 3HJNA 3DTNA 4ZREA 4RSRA 4KFTA 3EH2A 1NY6A 1F6BA 4NG5A 3JPYA 1WW3A 2ABJA 1ISRA 4LV6A 4JLAA 2ONJA 4EGFA 4BBPA 2Q99A 3PDIA 5KFGA 1NE2A 4IEEA 2FSFA 3H99A 4FZRA 1V9SA 6GPBA 1LPPA 4N39A 4U3JB 4IDFA 2IV7A 4XJXA 2GN1A 3E7XA 3UWMA 3ZNNA 4JYBA 2X5JO 2GDZA 1A27A 3GJTA 1HM5A 3UTDA 3G7UA 4Q24A 4XB6B 2O59A 4Y7DA 5DH9A 3EXIA 1PJLA 3D8UA 4QFDA 2UDPA 1PYGA 1RZ3A 1K8ZB 1FBNA 4X8MA 3PUKA 4YP3A 4Q4LA 4W7HA 3HT5A 3RFCA 1L5GB 5EWJA 3MQFA 2XTMA 3SKXA 4CQMD 3OBBA 3ZV7A 1I1LA 2CL0X 4ZOCA 1R0WA 4MSUA 3IV9A 4R1SA 2IUYA 2CCGA 4RE6A 2P11A 2XOKA 1MVOA 3PD7A 3B12A 4HUJA 2HHAA 5TQ0B 4PM4A 4RXTA 3RRMA 2ZR0A 3PG5A 1K7SN 5FB3A 5TVKA 4JJ6A 1DEAA 4KE6A 5BWCA 1EH5A 2NYAA 4M9CA 5KOHB 1PHRA 1XQYA 4MQEB 4HLNA 1T9AA 4JHXA 1DAEA 3OPXA 2WD9A 5YASA 2VSNA 3JAWA 1RSZA 4N6NA 3HA2A 1WZNA 5CT6A 2PV7A 2B0CA 3DDUA 3F98A 4MR8B 4N12A 1WLYA 4U2FA 1D7OA 5ALWA 5COAA 2X0KA 1UZMA 2R47A 1TUEA 3ZNOA 3E1SA 4PYOA 4GPD1 5LA6F 4BQRA 2YXBA 4DV2B 5F78A 4JT9A 1OYOA 4EABA 4MVJP 5HA5A 1GARA 2QTZA 4MI1A 4AYBA 2WSMA 4EGQA 1E98A 1T15A 4D3SA 3E5MA 1RCUA 1WDLA 3ZY4A 4OO3A 2RBEA 2I6SA 1RHUA 1SBTA 5FADA 4NMHA 3QKTA 4Z3DA 3TTWA 4DR4B 5DP2A 2X5KO 2JEOA 1GAEO 3RAJA 4MZDA 4PNPA 4L7QA 1DIHA 2Z5GA 3QFRA 1ZRMA 1J5PA 3SSMA 3T4UA 3CJRA 5I8WA 4B46A 3MJRA 3T34A 2FUEA 1B0ZA 1SXIA 4D2IA 2B8TA 2GXAA 1X3LA 3W78A 2VDOB 4AMVA 1O97C 1G7RA 4AL4A 2JIZA 2AZXA 5C7IO 3PXAA 3I62A 3H19A 1MJNA 4QJ3A 3KSBC 4YV1A 4LNHA 5K3WA 5ITZB 2JVIA 4H16A 1CR0A 2EJ3A 2VPWA 3GRZA 3CNHA 5GONA 2WYVA 4U02A 1MQ8B 4MGKR 3R8XA 5CBPB 1B1CA 4IZ6A 4AJLA 4OK3A 1FQJA 4B3XA 4PVDA 4FWBA 5KNDH 5BPFA 4TTTS 3U19A 3LGSA 3OZVA 1G21E 2A35A 3M3DA 3FLAA 5L51A 2VUIB 4TUYA 4XYMA 5MDHA 1U65A 2PZ8A 4AT1A 1SUIA 2MSNA 3U40A 3DOUA 4V24A 1ACMA 5A0VA 3E61A 2PJDA 1RPTA 3WYBA 5AKJA 4Z9AA 4DHEA 2HA5A 4MTCA 1QYIA 2JPDA 1XA4A 1WO8A 4IR9A 5AM0A 3NIDB 4BB5A 2V5UA 4G1MB 5KFMA 3FOBA 4MLCA 3M83A 1SEPA 1VBFA 5D5QA 4FEEA 3COWA 1MFZA 1ADJA 2IYPA 5LXTB 4RXMA 4QBKA 8OHMA 3Q11A 2FN9A 3R74A 4JHLA 3A8TA 1TMGE 3T12A 1GSOA 1EBFA 2EERA 3ILSA 4M3NA 5ENZA 2VT6A 3DXXA 1SOUA 2Q5FA 1BE8A 3RSFA 3TINA 4Q4CA 3RWBA 1DEKA 4ZVPA 1YA8A 1ENPA 2O2XA 2B8WA 4ZQBA 3QLVC 4URVR 1G0NA 4PO3X 4P7BA 1Q22A 2XIGA 1VG9B 1E9BA 2GZRA 5ILGA 1GA6A 4J76A 2PX2A 2Y68A 3UZUA 1UT6A 4XRRA 1K3UB 2J5QA 4AC9A 1KI2A 4O63O 2VHEA 4FOLA 3AL0C 3Q85A 2R0QC 1I0IA 4WZAA 4DEVA 2XJ9A 3CZ9A 3DQPA 3KL4A 5HZGA 5JUMA 4IEIA 3NW9A 4KV9A 1B74A 3ANLA 2ORWA 2HJRA 1PJ4A 1YCHA 5DGTA 4B6GA 2OBMA 3ENWA 1RYEA 4NU5A 2XT9A 1VHDA 3WJ1A 4LBZA 3AC0A 4JLOA 1IK6A 1LDMA 1GSAA 1STOA 1GZDA 1XRNA 1KI9A 2ZT8A 2D3TA 1W19A 4N0PA 3FGPA 3GMSA 4Q15A 5FLXA 1K7CA 5FULA 3SHOA 1CZLA 1E5DA 2RDMA 4LDAA 3GTJA 1N2ZA 4DCNA 5CT9A 1E0JA 3P0IA 2O8CA 3E3OA 2NPFA 4B2IA 3HEBA 3QHPA 1IBKH 3R7AA 5EJ6A 3ADCA 1QIHA 2OO7A 2BZ1A 3O8QA 4F9GA 4YXWA 1FU4A 3WK5A 2QTHA 3E9CA 3GILA 4ZCQA 4HB0A 2FZCA 1WP9A 1YJBA 2FZVA 1HTTA 2CL5A 3U17A 2ZJOA 5L7TA 3PCTA 4UVDA 4BMXA 4LJ7A 3C4JA 1SKAA 1ORRA 3ZH2A 4XDYA 1AUPA 4KH1A 4DSZA 1LJUA 2QT1A 1EK6A 4P38A 3W8NA 1QF9A 4WY8A 2R7ZG 1LEHA 4WVLA 4R6XA 4LZOA 4TS1A 2F3TA 2JEIA 4H7KA 3TQRA 2G4LA 2IS4A 2N9UA 4B1FA 2BGGA 1S89A 3TRHA 3OJCA 4C29A 4RIIA 2PKCA 1QCDA 4X65B 4UDXX 4Y98A 4MB6A 3OZ7A 1E4EA 1KI6B 1HOXA 3ETJA 2OHJA 4JI0B 4YCDA 1K2VN 4GKJH 1SO8A 2EZ4A 2JAQA 1UWKA 1I3LA 4AZ3A 3AUJB 4BX2A 3NHBA 1JIVA 2IW3A 1GKYA 1IJFA 3LO8A 3H2ZA 5AW1A 3DOOA 1NUSA 2O7QA 4UEOA 1CUEA 4RY8A 2ZRNA 3AVOA 1T35A 3DKIA 5KG1A 3Q3VA 1MC4A 5CA1F 3LCVB 3QOFA 1CULC 2CE2X 4I46A 1WQ1R 1Z0AA 4P0PB 1HNXH 1ZM2A 4IKEA 4HATA 1XLUA 3WYCA 4JUDX 4OXQA 2RG7A 4ZCIA 3L9XA 4B82A 3M6VA 1FJHA 1JB9A 3KREA 1W46A 4FMPA 2JLCA 3A1SA 1YR7A 4P08A 4WJLA 3GRVA 3NRCA 3N74A 2ZPTX 1IHYA 1YBMA 1LGYA 4G81A 3RSGA 2PZAA 1YJXA 4L8WB 1J33A 1V96A 2ZAMA 3IOMA 3LNCA 1EBBA 3GR6A 1BMFA 3AVVA 1JDVA 4DUZH 4IVNA 1N9GA 4GPAA 4PG7A 1NVGA 2FK8A 3VPFA 1EE9A 5ECYA 3H2SA 1KL7A 4CL2A 3RBZA 2PX5A 2IWHA 2HIMA 1YC5A 3GGDA 2YIVX 4XXHA 3LYUA 5KSOA 1RQNA 2GXSA 1OFUA 4F91B 2WF5A 3V8VA 4FFLA 2WWRA 2B2CA 3L07A 1Z0UA 4NENA 2CEKA 3LQQA 2A9OA 2V6JA 4UOQA 2ASDA 3CWZA 3H3FA 2R68A 1PSZA 1ZWKA 1L5LA 5K3EA 4MPTA 4P92A 4ZEOA 3RHFA 2PL5A 3ONVA 3KLBA 4FGUA 3TM4A 4MYDA 4WNAB 4V0SA 2FW9A 2PUTA 5I9SA 2O8EA 4NZOA 4W9MC 4OYHA 1GTVA 1YA4A 4D9JA 4MV7A 3FPGA 3PCXA 4AJEA 1KI1A 4LMPA 4F2GA 2D1RA 2VP6A 2V97A 5BMVF 4UUAA 3WK8A 3KPVA 2DPJA 1SC3A 2NTJA 3E0XA 3H2HA 1R1DA 3BZUA 1EGQA 3QVKA 3RRJA 5SYAA 4X00A 1U02A 4XIGS 1ESEA 3T3MB 4ZI7B 5K5EA 3OWHA 4G23A 5HKKD 1DHTA 3KZNA 5IFLA 2QXTA 5KFYA 4YP9A 3OEEA 2ICAA 1CZOA 3RAPR 2GN8A 4BN0A 5EJ8A 2EW8A 2XNCA 4F5EA 4UBLA 3CCBA 2GEFA 3ZHQA 3RH0A 3TR0A 3NC0B 1P3DA 4D4MA 4LTDA 1XZQA 2JCSA 3A25A 1RMYA 4K9LA 3CONA 1SXJE 3S29A 1TECE 1P39A 2RFLA 1QIJA 3GGPA 1KP2A 4LDPA 2IA5A 4PPNA 3LXMA 1UZNA 2I2XB 4ECYA 4KMRA 4RTOA 3JQGA 4ZDIA 4DLSA 2WDZA 3ZWXA 2X14A 1SCNE 3LGXA 5JVDA 3DWFA 2A7QA 3FSGD 4MV1A 1ABBA 2XYVA 2H4HA 5E95A 7GPBA 3CB2A 2V5VA 4EA8A 4P1ZA 2RE8A 1AKYA 3H5AA 5A1TA 5AW0A 3EMKA 5JE8A 2F9FA 1UMCA 4TLCA 1G3QA 5K3SA 5J63A 2H2FA 1XDDA 4EDHA 5JXJA 3E3MA 2P5TB 3M9LA 5B1EA 2VKTA 3IHTA 4OQNA 3JWEA 3QXSA 3H87A 3HLTA 4TYMA 5KAPA 3KXIA 5BSTA 2ZVJA 1QIGA 4W6ZA 4FK8A 4CM9A 5HRUA 2XUFA 1WUIS 1FP6A 3V4FA 2RH4A 5IAAA 1ID8A 2JFQA 5DLPA 2YMPA 4WXHA 3B1KA 3C6ZA 4ZMBA 4L2IA 2A8YA 3R3YA 4FYYA 3STTA 5KYNA 5KFWA 3B9BA 3JQ9C 3PD1A 2COGA 4P84A 1NMXA 3PEVA 3PGXA 5IJAA 2XNJA 5CVCA 4E51A 1LJ8A 4LJRA 4TKVB 1QGYA 3GK3A 4IO1A 4DMCA 2WSSA 4B3MB 2ZJTA 1E9SA 2OAP1 3QMVA 1GNQA 4G0XA 3X0DA 5HNKA 1U5CA 2IRWA 3BE8A 2RDJA 3AEXA 2ZETA 2P2ZA 2HRDA 3DLPX 3ZJTA 4JQSA 1EFVA 5CJ2A 5DSXA 2OZLB 3FOAA 1U4OA 3L8FA 5F64A 4GE0A 4PGGA 5A4IS 3BXZA 4MV4A 1E1KA 4W63A 1N2XA 2MINA 3MSCA 1MBZA 4J0EA 4FT2A 3D8HA 5CEEA 1SXJC 2FWBA 3OKAA 3GIWA 2PSSA 1O0BA 3UWSA 4Y2HA 4CV0A 1R6TA 4LJAA 3PL1A 2VQFB 4WBNA 2VP0A 4LEIA 1NHGA 4ZEWA 3KV3O 3OKPA 4QE3A 3RSLA 1TTTA 4CXMA 1YDGA 4RGVA 3PRKE 4D8VA 3M4IA 3CCCA 4K9SA 4MVJG 4RVHA 2Z2XA 1KYZA 3UGQA 4NMMA 2OGUA 4I8XA 3GT0A 1AUQA 1ZJ6A 1M2GA 3CF4A 1OZFA 3FOFC 4OH7A 2IZ1A 4X7PA 4NRDA 1HE8B 1D5CA 4L73A 3EE6A 5D2CA 1XOIA 2WJ3A 1A4UA 4NYMQ 2H59A 3K8ZA 3OAAA 4EM6A 3D1JA 4M8NE 3WNCA 1M1YE 3RG2A 2A67A 4TKZA 4FOOA 1XO1A 4EJFA 2VJKA 2NGRA 2E2HA 4QT4A 5JWOA 1EUZA 4QJ4A 3K9BA 4YJKA 1YJ8A 4X63A 1KY4A 3PGJA 2CVQA 1G20B 2J0SA 4C4OA 1G8KA 2C2HA 5A9SA 2DSNA 3H1AA 4MKHA 4EG1A 4KNYA 4ZVTA 3SC6A 1DAKA 1RP1A 4G0UA 2Y1KA 3TFOA 2WP0A 1VE7A 3N42B 3ZIAA 4K86A 2ATLA 3DV0A 4TKUA 3FR7A 2SHKA 4ZVOA 2OM6A 3GGCA 1RKXA 1AS2A 2RHJA 2HHHH 2CXTA 1MB2A 3B9QA 5EE1A 4URYR 3C14C 4F04A 3IUBA 4O7TA 2WQZA 1N4AA 2G1KA 3BFVA 1NWCA 1Q92A 2G9RA 2WW8A 7MDHA 2F3SA 2DULA 4BNTA 5F7OA 2ZIXB 4WK2B 2WJVA 3RYFB 3TJMA 1R12A 1ZRSA 4KEAA 2GPAA 4HMPA 1QHIA 1RWVA 1H8ED 4N3GA 2R48A 4EL5A 4XQ0A 4EHDA 1QC5B 2A0YA 3F9IA 3J7TA 2QL7A 4MUBA 1JA0A 3ZC3A 3WIVA 2BFDA 1L5HB 2OQRA 1RI5A 1WS6A 3FTDA 3QVSA 2QP9X 4RXUA 4BGIA 5IZ4A 3SP1A 1T8RA 2DBQA 2UZ3A 2GQRA 1QP0A 3TCXB 3DQZA 4HDQB 3WGTA 721PA 1CQJA 1JUDA 1JTFA 3OJEA 1YL6A 5GAJA 5ENDA 4LJ8A 1TQ8A 3FROA 2J7PD 4KX3A 3GUVA 3HOXG 3BE6A 1I2CA 2Q3LA 1F20A 1IZ7A 4GL2A 5CE8A 2X6RA 4BWSC 1S97A 5AVTA 1NUTA 4KLZA 4A15A 2GAIA 4HGYA 4YBRA 2X77A 2C8JA 1NQXA 1QORA 4EKYA 2WLSA 3DF7A 4AAYA 2IKQA 2WIDA 5KYVA 4BNFA 1NVBA 4HXYA 1FXWF 1WPXA 3VR0A 2Y93A 3IMKA 1EHCA 2IZ6A 4EVQA 3UJ9A 3G2JA 4FDMA 3TPCA 2JLVA 3R09A 4P4SB 2HU5A 3W8FA 3HA3A 2IYEA 3F74A 1IUNA 2CN1A 5EP1A 2ESRA 2HK7A 4YCBA 1QVRA 5K99A 5K8JB 2JLUA 4PG8A 2FKLA 3FMIA 3VPAA 4BNZA 3V7YA 4QRHA 2JF0A 4FZVA 1U2ZA 1S5PA 1T6YA 2CNVA 2B92A 1VLQA 3V33A 3T99A 3PZRA 2ASJA 5LN1A 3L1VA 5E9QA 3C1OA 4W5OA 1NGSA 4D4GA 3QMWA 3KALA 1DC7A 1FMJA 3EDOA 5HFJA 3DMDA 3Q3EA 5IM4F 1E3JA 3ND8A 1FS6A 3LY5A 4LQLA 2CEAA 1M34B 2ZBRA 4Q3NA 3T15A 3P45A 2Z9CA 3ND5A 3CSDA 3F9CA 1KVTA 1FS5A 2DBRA 4ECZA 1KY3A 3REQA 1F14A 2O0JA 1YE5A 3QE0A 3C2QA 3OT5A 3I5AA 1ZESA 4PC1A 3JTEA 1KIMA 4AO7A 2VDJA 2AQ8A 4RVFA 1F12A 1IN5A 3VC7A 4R8UA 4M1TA 3C3EA 3IUYA 1PG5A 3H4MA 3DLBA 4Y8VA 4YGXB 1UJNA 4EUSA 3PDCA 3U44A 3W8RA 2WV9A 2PK3A 1ISFA 3NIWA 2BV3A 2C1XA 2IYAA 1U0JA 4FBMA 3CY6A 3SJUA 2AOUB 2MJLA 3RSQA 1U0TA 1G6Q1 1DZIA 4FDAA 3IBTA 5CCBA 3HDGA 3ODPA 3VQTA 5BP7A 2D8MA 5J9FA 4M9UA 1N3LA 3JZAA 3ZWOA 5JC1A 1YL7A 4V0MA 3AG6A 4NONA 3MSXA 4LX0A 3M1YA 2ZJYA 1VSTA 1NXVA 1I36A 1CF2O 4LSGA 3HU1A 4QJ5A 4CEJB 4Q7LA 3AO0B 4N0DA 2ZB2A 1QZ3A 3ZZMA 3EYYA 2G5GX 1VSQA 3FMPB 2MSDB 4RPHA 3VYTB 3T7IA 1W4RA 4WLVA 4JC4A 4CMHA 1TQHA 3FKIA 5DTMA 2CJWB 4BN4A 2C4WA 3SWWA 2QT9A 2H9YA 3HWX1 4IQ0A 3ZJUA 1JEYA 2C5EA 2IK8A 4CKYA 2PH7A 4RO0A 3WWDA 1ZIDA 5AO9A 3PNOA 4GW3A 3HVHA 4ZEXA 2RHDA 2QVYX 1P5ZB 2OVFA 4KACA 1UFVA 5HE9A 4YPOA 2ISCA 1V35A 1H9BA 3IVMA 2HDWA 2IYOA 2IY9A 5D1PA 3GQVA 3R7NA 4B8WA 5D3KA 1GFWA 3K72B 1SIOA 5FCDA 5KTMA 1U0HC 3B1XA 3SLRA 1O7JA 4X9XA 2CLEB 1TJ5A 1A97A 5HOEA 1U8CB 5JCPA 2PL1A 2P27A 4I14A 5CT4A 1P72A 1UINA 2GJAA 3ZE6A 1PBNA 4B75A 4G0PA 3BMQA 3UYKA 4RJIA 2N0SA 5EIHA 3P20A 3H1GA 1R0KA 2QL9A 2XGMA 2W48A 3KQQA 1RE0A 4XWOA 1UBRS 1B23P 3LPCA 3E9DA 4RBNA 2QLBA 4Z4IA 3HEAA 1LBSA 1MCZA 5D1OB 2C7QA 4HMQA 2ZXFA 4JUCA 3DE4X 1XTVA 3UG6A 2Q5LA 4QNNA 1UPXA 4OXXA 2YY5A 3LU1A 2FEKA 5JSKA 1UT5A 3EEIA 4AMYA 1ZNZA 1POWA 2ZIUB 4DIDA 3JTMA 4UCQA 4XIFA 3GUHA 1TM1E 1ILWA 3HPRA 1A1SA 1E89A 1CQZA 4IF6A 2I3BA 1P1KA 4BFZA 3A7DA 1KSHA 5HF5A 1PJ8A 1Q0LA 1JG3A 4GU5A 1QR2A 4HAUA 4IRMA 3NBAA 2JFZA 3DYVA 2QBYB 4JV0A 1N3BA 2HQRA 2AXEA 2FR8A 3NRBA 2PYZA 2R97A 2XMZA 2ZVPX 4AZTA 2DUUA 2FP3A 3U56A 3LL7A 4D5EA 1XU9A 3QFFA 1QUEA 3Q6NA 4HQOA 1TZBA 1H3EA 1HV8A 4KLAA 4MJLA 4AJ2A 3GLHE 2AXPA 3BABA 5FRDA 2BR3A 2ZBVA 4EJSC 5BN4B 4B3FX 1F2TA 2VSQA 3KX2A 3GD5A 2QQEA 4X44A 2W98A 3IOYA 4JKOA 1WOMA 2JIRA 4YGYA 1WDMA 3TTTA 3VJKA 2OILA 4EA7A 4EEKA 1GTG1 3KVRA 4RQUA 2IZZA 3G88A 1RRMA 2CBGA 3LHKA 3HV0A 5CH3A 5L45A 1TRHA 5LU9A 1DG9A 2HTFA 3THYA 5EYPB 2C59A 3OD1A 2AI3A 1W0JD 5C52B 5KBYA 1DX6A 4B83A 5GZ3A 2IH5A 2ATVA 3TSZA 1FFXA 5A5VA 4QIHA 4G89A 2IOFA 3DVSX 2C4UA 5JEEA 2QUKA 3G49A 4FONA 2UVPB 4TSFA 5DYYA 2D4HA 5C8VA 2F1OA 1QJCA 4MHOA 1PR1A 5AOVA 3NH6A 4FZ5A 3OG9A 5KJCA 4TVKA 3UXHA 1KZ4A 2HEGA 3EOAI 5IH3A 4YRPA 2GI4A 3I64A 3QBEA 2QVZX 2W5UA 1IOZA 2FK1A 3TIGA 2NG1A 3N2IA 4NLLA 1IQPA 1R0LA 1SCKA 4UPEA 2FETA 3UC9A 1XEXB 3CNQS 5GM1A 4POAA 5E9AA 5FR9A 5EC8A 4D80A 4AB1A 1K5GA 4BNIA 1AMUA 2QNBA 4YQEA 3G23A 4YUZA 4KPUB 5PGMA 4C6HA 1E0SA 2QGNA 4UW9A 1DNPA 2JJ2D 1D0VA 5DG8A 2GGSA 2YQZA 3HKZA 1X19A 1Q2XA 4HDSA 4ZZ3A 3NUAA 4IRDA 4WLFA 1E3MA 2C2EA 4H1TA 2G82A 2OQIA 3I5XA 3NT2A 4C2TA 2R8XA 5JT1A 4PG4A 2IEIA 4F71A 4EARA 5FJ8G 1CQPA 5I48A 3D5QA 3PXGA 4K9OA 3T5DA 4OF4A 3ZLTA 2XTJA 1NW7A 4BVHA 2DT5A 4CQLB 1T3NA 3EFHA 1XZEA 3KXYT 5HCUA 2JG3A 4HY3A 1CIJA 4DR6B 1WHTB 3LYHA 1G7TA 2J30A 1ODLA 4R71A 4ZO6A 1VRVA 4LHYA 4H3HB 2ZUBA 4G86A 3K53A 4EX6A 4FS3A 5D8DA 3D5EA 2CHQA 2ZRBA 1YRQA 5B6PA 5DYWA 2FUNB 4RTQA 3CUYA 4DV6H 2HHCA 1OLSA 3LT2A 1E5VA 5CFZA 4EG7A 4ZOLF 5KI6A 1E3WA 3KR9A 1JPNA 2R4TA 3NHMA 5KFKA 4HOYA 4NE9A 4IFBA 3D5TA 4LHEA 2OGWA 3HV2A 2VRCD 2X76A 4Q47A 3UJHA 2ZWOA 2DCUA 4C3UA 4HVAA 2A5LA 2DFNA 1CKMA 1SVSA 4X85A 1ET0A 2OCPA 5GV7A 3ZD6A 4MMZB 1T0BA 4R5MA 3BDVA 2Z08A 3EA0A 2BKVA 4OKIA 1OU4A 1W29A 1I6KA 1GZ6A 3H11B 4PWZA 5EWFA 1BXKA 4O4JF 5KT2A 2RGUA 1W88A 3FTEA 4ZCLA 5E4JA 2OPBA 3N8GA 4KQKA 4BFCA 5EJ7A 4WESB 3DMTC 3W5UA 1N1DA 4OP1A 4MRPA 3F73A 1YV9A 1FMLA 1NU8A 2EZ8A 2QE6A 4F8EA 4LI3X 2PZEA 1UJ2A 2C0CA 3DBOB 1RACA 4AJPA 1KWKA 3U48A 3ORYA 2PZKA 5KS8A 4YMHA 5B2FA 1MW8X 5DLDA 4MNTA 3HLYA 7ABPA 4BEBA 1Y8RB 2YRFA 2B7BA 4GI7A 3T4PA 2B30A 3DCNA 5K09A 3KKPA 4HH1A 4JNKA 1RI4A 5I7AA 4D79A 2XKJE 2EF0A 2FSUA 3PU6A 1WY5A 1OTHA 4QQKA 1PZMA 4H6XA 5AHXA 3EZNA 1KQFA 1WUTA 1MJGM 4MUEA 3IE0A 4G4GA 3E22A 5HF9A 3UJNA 4YAJA 1ZBDA 4CLHA 3W3AD 1QB8A 3TTSA 4Q03A 3NYRA 2Q3DA 1OWLA 4RTKA 2RGBA 4ENTA 3L4JA 2AGQA 2Q6OA 3C7KA 4EBEA 1TUBA 1A9XB 2IOFK 3MAAC 3OIGA 1N48A 3EODA 1PL6A 3T94A 2RGDA 1N78A 5E3JA 4DB4A 3OZAA 4RH1A 1Y8QB 2XGQA 1GSIA 3VDQA 3RC3A 1G64A 1EJ6A 1GADO 2Y4OA 2MWMA 1Y8AA 1X7YB 2I3AA 5DT9A 3WAKA 1YR3A 3QPDA 3TO5A 4KQ6A 4DMRA 2OO5A 2G80A 4QIWE 1HTWA 4ESEA 1U4SA 3HKEA 3IEUA 3IPYA 2QJWA 1XNGA 2ZI4A 3BIOA 4A0FA 1ND6A 4GGMX 1E7YA 4WCVA 4AUMA 4RQTA 3C7TA 3U4DA 1Z0IA 2OUKA 3HWWA 1PP4A 1X6VA 4BO8A 5BUZA 3N28A 4JC8A 1U5BA 3Q9UA 4YRAA 4DB2A 2FPIB 2OV6A 1N7HA 3A6JA 5IAKA 4KWCA 1NMQA 1T2UA 5FXMA 3FZQA 3BEOA 3NNSA 3L7IA 2YFHA 3VDNB 1PJTA 4D26A 5EAIA 3VRHA 3QFCA 3NGDA 4MWOA 1U2PA 5AXDA 1EKXA 4XCXA 5LDGA 4RWEA 1NT4A 1R9MA 5JRZA 2AN4A 2UXDH 3ESAA 2BGIA 1QFSA 2JGKA 1P18A 2E37A 4KDFA 4MYUA 4JYCA 4YAIA 1CT9A 4TPKA 1DXHA 2I1LA 1MIOB 2ST1A 1L1EA 1H0KA 5GV8A 4EQ6A 4HFMA 3C5VA 4FDLA 4D25A 1YHYA 3JQ7B 4BCBA 5CTAA 1MC5A 4ILEA 1RW4A 2OZKA 3GLUA 2AEEA 3NBYB 2DHCA 4P3OA 2XF2A 3EVTA 1NATA 4BJ1A 4KJZA 5EMNA 1REQB 1JLMA 3UA3A 4EYHB 2VWQA 2C9YA 4NEGA 3WLMA 2X2OA 1ZN7A 9MHTA 2FZKA 3HHPA 4W5TA 1ZQ9A 4IX1A 2JEZA 1XJQA 2VJDA 3VTAA 4RKQA 1M9NA 3EXFB 4HYYA 4BFXA 3HUUA 1Z18A 5BSUA 3IMGA 1J25A 5T7BA 3WLIA 4PBCA 4R9VA 2GJ8A 4JMPA 3G2OA 3NDJA 1IRXA 2YV3A 1LNQA 4DGQA 3V1YA 2WA1A 3QIVA 4B3SB 1Y6JA 2GM3A 4LYEA 1YRAA 5H1YA 1QK5A 2F2TA 1MEJA 1GXSA 3BIJA 3QXJA 1ZUNB 2QPOA 4AZ0B 5ERXA 1EA7A 3FOWA 1NJ2A 3HWRA 4CKZA 1E2PA 1PEKE 3NGXA 3ADOA 4NDZA 1DQRA 4CIWA 4IDPA 4OY3A 2RIPA 1E6KA 2XGJA 3C15C 5K4AA 4BVEA 4FS2A 5HG0A 1NP3A 3W5IA 4FYIA 4MS3A 1HEYA 2ID9A 1NJ1A 4YMGA 5FH9A 1GILA 1W35A 2QN2A 3B3JA 4WGFA 1SZDA 1D9XA 2NO9A 4DXHA 2BKXA 1C9MA 4ENSA 1QB7A 3AF0A 4V0LA 1XPOA 1N1MA 4PZ6A 2O7VA 5MN6A 3H40A 2CV2A 1IE3A 1EIWA 1ZLXA 4MUXA 1Z2EA 4MAMA 4ALNA 4MIYA 3WLNA 3KDSE 1T6ZA 3SNHA 2GK4A 2DABA 1RKVA 3EPLA 1W1UA 2IPMA 1DP4A 3K4PA 5IK2A 2FLKA 3RBXA 1N1GA 3H2IA 5ES4B 2B99A 5JH7F 1WSAA 5HDBB 4YCAA 4EMBA 1QWSA 3MILA 1AZSC 3DPSA 5IC6A 4S2EA 3DL7A 3H8WA 5I5UA 4B45A 4D9KA 4YREA 2R6JA 5K01A 1DIAA 3OFNA 1W48A 3D2LA 4IMIB 1S1MA 1S0OA 1PFWA 5TPZA 4R3NA 4ZJZA 4CM8A 3V1TC 3AEKA 5H70A 3T8YA 4O3MA 2ZE5A 3UH1A 4Q1EA 1DEXA 4QYIA 2HMYB 1LZKA 1L5KA 3KETA 3O2SB 4GVXA 2GN6A 1GM5A 4UHDA 5ILQA 5BWUA 3PT9A 3TAXA 3Q8RB 1BMFD 4GT1A 2P7HA 3WMFA 4I66A 1XYGA 3O1HB 3CIOA 5EEGA 5K51A 2VHTA 4QPDA 2CUZA 2IS1A 2QXUA 1R3UA 3S6JA 4AQYH 1JJBA 2FHPA 1DRJA 1PT6A 2P8SA 1MZVA 4GX0A 2I2WA 4PZPA 3PPIA 4N0MA 1PUJA 2IZ0A 4XWTA 5EEHA 1QYVA 4EP1A 5F7ZA 1P1CA 3J7AC 3B6IA 5IZCC 1KDRA 3C3MA 2IV2X 1L2TA 1O0CA 1R74A 2X23A 4X1YB 3O4VA 3E1GA 1HG0A 2PS1A 2W2LD 3GU3A 4XRGA 1Z29A 2XXJA 2J08A 1KAOA 3IDAA 4X1KA 1KQGA 3QKIA 4B09A 1OSNA 2XZDA 3LA8A 5HCNA 5BSRA 1T5BA 4CJXA 2XCOA 1PL8A 5ALVA 3V8RA 2R7KA 2W0MA 3TVYA 2ATXA 5EIAA 4CKEA 1KYTA 1FEZA 3PHHA 1QF6A 4IGFA 2CJPA 3NO4A 3HRIA 2BDUA 1TEHA 1BS2A 1TMYA 4OX9B 3K70C 2QROA 4MWTA 3FMVA 3H9BA 3CX4A 4JOQA 3IVXA 1HT1E 3HCFA 2H5JA 5EXTA 5DM2A 1ACLA 5FTWA 2FZGA 1A9YA 4PO9A 3OEED 4LOJA 1IQUA 2QTWB 4QPJC 3PUJA 2IEYA 5D00A 1UFRA 3SK0A 1T4DA 4NNPA 4UCFA 4N3CA 4E5DA 1E7RA 3TB4A 4HQ0A 2GSDA 1G16A 1FK8A 2J3JA 2QAGA 4MAAA 3AU9A 4WK4B 3ZDQA 1JDBB 1GAWA 1J7JA 2H07A 4QUEA 4DJJA 4J9PA 4RKFA 3OOJA 4GOLD 3I4LA 1HT2E 3IAM6 3NTQA 4ZV7A 2FFRA 2QYSA 4ABYA 3DTYA 1XT6A 4PXAA 3D6FA 3OX1A 3E1KA 1Y1SA 1XVAA 1DJPA 3DH0A 3IE2A 4YACA 4C4TA 1TM7E 1RK5A 1V3TA 2XDYA 4YONB 4V1CB 1JPJA 2R8IA 3JQDA 4M4SA 3EBOA 3RHSA 2E9SA 5EY5B 3TNJA 3RR2A 4E08A 2A94A 3CVXA 3OZUA 2EG9A 3TBKA 5LM3A 4CM9D 4YP5A 1JLLA 1DV1A 4QBFA 4MUJA 2WR8A 4PSKA 4KK4A 1NPYA 4MJ7A 3WKAA 3C8HA 4LHVA 4CT0A 4ME6A 4CV1A 3RODA 1CWUA 2ENWA 2VHYA 3BICA 1Z16A 3TL3A 1N5MA 1AA9A 2X19A 5EKDA 2COUA 3I32A 2NU7A 3CRZA 1CZKA 2PCLA 5AKZA 3GY0A 3F5MA 1DJQA 3RTDA 4DUGA 5HKLA 4MV3A 3HS3A 1DVRA 3QVXA 3T7DA 5JXHA 1PJAA 1KJ9A 3HHEA 3L04A 2TMGA 1UQUA 3TY5A 1V9LA 2X41A 4ND8B 4BHTA 1NQ5A 2QIOA 2QRKA 4B80A 1VE1A 3PXCX 4OJQA 5DM0A 1NXXA 1CVLA 4EBBA 3TUJC 3LF1A 1XZMA 4LMRA 5J2UF 4YCNA 2ODWA 4I1VA 1JLRA 3O8CA 2PSHA 1GITA 2QE7D 3HYTA 4R3WA 2G8NA 1NYLA 3TK1A 3EXHB 2DGDA 3QU7A 1IATA 1J39A 3UT0A 2DY1A 4M0DA 3IMCA 5CM8B 2NUAB 4PZZA 1KHTA 4BB0A 3SG0A 1AKWA 3QUTA 2GR9A 4Z6KA 5FI5A 3ZCVA 2F55A 3A1TA 3FVQA 2E55A 4X45A 3AXSA 3IVGA 1NBEA 1T13A 3HCAA 5FLYA 4I9HA 1EEXB 2IXEA 1NVAA 1M74A 3CJQA 4BNLA 4Y0VA 1KJQA 2ZB3A 4UD6A 1MF7A 5IN4A 1E6MA 2CDCA 1CW2B 3GYBA 3M49A 4MYHA 1X1QA 1VLHA 3S55A 1O3YA 1EM8B 3IAFA 3LKZA 3NIFB 5JDIC 1II8B 3R0IA 3EUWA 2ID4A 1W5EA 3ETDA 3OAAD 2BGKA 5JALA 3NIGB 3FH0A 1UZAA 3UAZA 1R6AA 3NT5A 1JBQA 4LJYA 2GRJA 4CMIA 1QHXA 4TT8A 2Z9BA 3DO6A 3R9KA 2Q6LA 4QBHA 4O59O 5AJYA 1Y8ZA 3O4FA 5CLGA 1OH8A 1OOEA 1PTKA 4BGUA 4Q4HA 3GP5A 4UVHA 1CEXA 2VBFA 4ZD6A 1WE2A 2IH4A 4R69A 4RNMA 1TT5B 3T9BA 2V9WA 3ZWAA 1U28C 1B0AA 2D0PB 4HO1X 1YNSA 3ZIAD 4UFNA 1AK2A 4W99A 3RLIA 2GEDA 1UEJA 1RQGA 1WMAA 3G79A 3FLBA 4O2BA 4RTLA 2PGLA 2P5SA 2I2FA 2WM3A 4TL6A 4PZ8A 3EZ6A 1DFHA 2JIMA 1RWOA 1Q0HA 4XGIA 3LX4A 2HU7A 5I6DA 3QEMB 3OOEA 3EVEA 3RAGA 4LF8B 4NS4A 2IPAB 1E6UA 3DXYA 6YASA 3SYTA 1Z6AA 1CERA 4OGKA 2RHHA 4EVSA 1GQOA 4LZZA 1E59A 5LU8A 2O0LA 3TMKA 1JIKA 5AI4A 3KHRA 4DQXA 2FQ1A 1NJGA 1YZNA 4TROA 3MT7A 3OQNA 3RJZA 4F4XA 4L50A 4QSHA 3D64A 4V0QA 2IGTA 1RJWA 2VYVA 4TZKA 4ZVKA 2B3DA 3PW0A 3BGVA 3A9VA 2DE0X 4KUHA 1I5RA 3KPWA 2E4YA 2HSEA 3T3PB 3UT6A 4QELA 4K40A 5LWQA 4QTUB 1E3QA 1P75A 4UNRA 4OU5A 3T54A 4Q7JB 4X6YA 1ZW6A 2JD0A 5BSVA 3G8DA 3A1UA 5AUQA 2C00A 3K6SB 4TXNA 1RM5A 4KQIA 2UYCA 1HG1A 2WZDA 5I7SA 4DM3A 1VE3A 5JVLA 3QE2A 4S0XA 1E8DA 1KSGA 1CUXA 2CUTA 4IV0A 2FCRA 5DXJA 4I4TF 2CYCA 4MAFA 2ZJ1A 1UC4B 1FLVA 2JBAA 2NZVG 3MUNA 4PX5A 5A62A 5H3HA 4YAUA 3Q8QB 4OMCA 1C7RA 4A1OA 1WXHA 4KN5A 1O94A 1QCYA 1R50A 1L7VC 1OA0A 3KBOA 4KI0A 3W8EA 4IKOA 2H63A 1GGVA 4IFEA 4LVCA 1E2FA 4YH1A 5JAZA 1QFXA 2XUAA 1DMRA 5IH7A 2YNMD 2NU8B 2VUTA 4B4UA 2J6BA 3ZHVA 1RXUA 3PI6A 1DAHA 3PSHA 1Z5ZA 4A10A 3CWQA 2E4AA 1WUKS 3T95A 1ZZGA 4JJZA 1XRMA 2V6FA 4EUNA 2PUGA 3G5AA 5SZHB 2IMWP 4F38A 3G0GA 5EWEA 4CUKA 5EXPA 4O2LA 4URHA 1IZZA 3E9QA 3COVA 4PTYA 3U9TA 1H1LA 4LJ9A 2VF2A 1I24A 4D9MA 1ML4A 2J5RA 2FG6C 2GD0A 3K96A 3A11A 4WMLA 4ED2A 4MK4A 4WCFB 4K6GA 2P3OA 1NE7A 3KPUA 4OLBA 1IVSA 3DFFA 1P16A 3QZ7A 1YBHA 1HFKA 1KDYA 3KU4A 3ACCA 3NBZB 4GR4A 1GIAA 4MUFA 4MI6A 1ABEA 3UV7A 2C7PA 4DTCA 1YCGA 2NN3C 1CNFA 3NHLA 5HWSA 5EWLB 2AG8A 3DVAA 2RGAA 4YC7A 2G9UA 4OUDB 4MWSA 1X7XB 1UBOS 4CDRA 2XRYA 3PUHA 1NVDA 2FMXA 5AOCA 4MA5A 3G8BA 3KUUA 2AJCA 1QH8B 1XR3A 2X1LA 4NCXA 3C3AA 2C2DA 3FMFA 3JCZA 3QKSA 3SDZA 3AILA 2Q21A 1P9OA 4LTMA 2CXPA 3FBWA 3HVRA 4J1QA 4QZVA 2YASA 1OXSC 1OT5A 2HWYA 2O5CA 1TO6A 2G63A 4R8MA 4C0BA 1WNTA 3WISA 2XSZA 3VYWA 1OA1A 2HPAA 1DO0A 3LOUA 4DDTA 2H11A 1CQWA 3EJWA 4E31A 5G40A 4YAEA 3UANA 4N47A 4MA4A 2J5XA 2W6PA 2VKQA 5KOIA 2D2IA 4TL8A 5KQLA 4NCHA 1DCTA 2RGXA 2GCOB 4OV6B 3ZV4A 3B52X 5AVJA 2HLDD 5KZMB 2IODA 3GLQA 2Y76A 4LI0A 3G6YA 1P2SA 4ZAWA 3MF4A 3WSTA 1SVMA 4CMEC 3OQ6A 2H4ZA 2MOKA 2XJ4A 2WOJA 4BNKA 1C0IA 2I7TA 5PNTA 2ZI9A 4J91A 1RM0A 1ABFA 2PUJA 5GONF 3U60B 1IRIA 3LLCA 4HPJB 4DUPA 2OYRA 4H7PA 4LNUA 2AYXA 2NU6A 1Z3IX 1ZD1A 4G0QA 5E2AA 4BBSG 3O03A 3LSYA 1NM5A 1DDIA 5HF6A 4F93B 5FPKA 3WMGA 4TUYF 2J6UA 2YIJA 1QU3A 3G13A 2VJQA 3GUYA 4PU0A 5LCXA 5HR5A 1UBMS 3ILXA 5K03A 3TPZA 4JUBA 1RKUA 1BEZA 3BD8A 1KRWA 2JLRA 5BQ5A 4AY5A 2BFFA 4Q3LA 3AMVA 4LYGA 9GPBA 3TMYA 4QC2A 3N3AC 3FVTA 1O0SA 4RUAA 4BY9E 2ZBQA 1U0LA 4M83A 2O14A 1YF3A 4GKJB 5GJCA 1H1DA 3FTNA 2Y9PB 1J0CA 1OLXB 1WF3A 5HS6A 2Q0SA 2Z2YA 4YV7A 3RFUA 3JYOA 3RRNA 2WQ6A 3KIPA 2BKUA 3ORHA 2XNDD 4I5DA 3ZE9A 1JWBB 1TUIA 5BR8B 1M2WA 4BP1A 4FD3A 2Q8QA 4RJ2A 4MW5A 3QPCA 1OROA 2JGNA 4BO1A 3DOJA 2OBYA 1AGRA 4FFRA 5B55A 4QU9A 4QXQA 4ROTA 1V41E 1HNXB 3LWBA 4GX5A 5LMNH 1A9SA 4K6KA 2HXGA 4QOIA 4R1QA 5FNVB 3G5LA 2QAJA 3KHLA 5JCOA 5M29A 1G1MA 4H2DA 5CNMA 3GT4A 1H5QA 4OQYA 5I47A 1GL9B 3JARA 3USZA 1DQSA 1CDZA 1Q1AA 3EEFA 4KXWA 1DO2A 3RT1A 3VX3A 1IM5A 3ZNPA 2FU5C 1A95A 3MC1A 2PBZA 1WBDA 2NVWA 1E0AA 2G67A 3R4CA 4X1IA 2OCYC 5IVHA 4TXLA 1T9CA 4QJBA 1FKAH 5IJ0A 2L69A 3PEEA 1ECCA 4RE5A 1ZVJA 1YRLA 3SXUB 4PS0A 2LGJA 2BLLA 3I2FA 3CZCA 4AU1A 2Z4SA 1U8YA 1Y63A 4OB8A 1IBMH 1IBCA 3B3QA 4IL5A 3BERA 4B5LA 4P35A 1R0SA 1QGOA 1BX3A 3GA0A 3KOZA 3GEHA 2EZUA 1R0CA 1UC5B 2UYHA 1RKBA 2VXOA 3CXRA 1PJSA 5FL7D 5CDHA 3ZHYA 3WGUA 3CZAA 3PPYA 1HQDA 1C3OA 1TA8A 1QJ4A 2AZ4A 4H1VA 3L4BA 4JI1H 2V3WA 4OGFA 4O33A 3RB3A 4V02A 2EEPA 3TLGB 1J06A 3NOVA 2P2GA 3GIMA 2IV3A 3E23A 5CEFA 2YY7A 1JX4A 4FILA 4M54A 4KSCA 1TVCA 2AUMA 2K4MA 3TQ1A 2VDNB 5CB4B 2J6SA 1DDGA 4AXBA 3DLTA 3FB4A 3GEGA 3G59A 4HAYA 1DT5A 2ZK7A 4W1PA 2BGMA 2H8GA 3VNQA 1JWAB 4WXPA 1P4SA 2B98A 2XUJA 1JBKA 5CFRA 4BNGA 2W2NA 1U2EA 4DTIA 1Y34E 2C5HA 5FDFA 2P4QA 2YIMA 4AMGA 4Q1BA 2R60A 5IWCA 3EGCA 3SXPA 3EYWA 5JS2A 1Y4UA 5TGZA 3LLVA 3RYHB 1YQXA 2C5GA 4CF4A 2PUEA 2WTAA 4L4SA 1RTKA 4LXGA 4C78A 4GC7A 5TF4A 1O08A 1P31A 4RF2A 3D0KA 3WTBA 3BMOA 3H5LA 3ZS9A 4X5OA 3VSCA 4LWOA 5DI3A 1PQPA 1GRNA 1XA3A 1IPHA 3A6GA 4F2PA 3GZNB 5BW8A 4TS9A 1B6TA 2P75A 4RK6A 3F1KA 2WIJA 2PCJA 3DHYA 1I7PA 1N8SA 1Q83A 1C9JA 2A5DA 2K5UA 2WAXA 5IAEA 1L9KA 2D7JA 4JT4A 5IDXA 2J6IA 5FAXA 2R7ZA 1N2HA 4BBJA 1H5NA 1YOVA 2NTEA 3I53A 1CQIB 4NZMA 2KI5A 1W85A 1GZVA 1E4GT 2XQJA 3UGKA 4MARA 2O3TA 3RB6A 4YTEA 1DOHA 4K81B 1RJ9B 3MJDA 3ROXA 1L9XA 5EZQA 2QD2A 1AQIA 3T5GA 2HR1A 4W6QA 3WIDA 3R6TA 5KC9A 4AYXA 3JQBA 4BV8A 1KOJA 1N0UA 2HZ7A 4GPEA 1VM6A 2O0MA 1GRCA 4G6ZA 2RHRA 1K5DA 4XCVA 4UCTA 3GLGE 2X2PA 1Y1VG 2KB0A 5I9IA 4EELA 2I91A 4TT3D 3EZGA 4ZPJA 2EHDA 5LD2C 5FI0B 1WUJS 5C8XA 4Y1RB 2G76A 1TRKA 4J9MA 1U3GA 3QWBA 3WTCA 4Q9JA 3AFMA 2FLWA 3RRBA 1J42A 1T94A 3FWHA 1HNWH 1C4OA 3RO7A 4I7HA 5GTDA 4ZI5A 2XADA 1JJ7A 3C8DA 4BLVA 2VRWA 3V8BA 1GNPA 5BWMA 1XTQA 5HVNA 3ICPA 4C3VA 1YU6A 3P32A 3MT8A 4BFLA 5JS1A 4WK0B 3LW7A 4R40A 4CR6A 4W1SA 3WWJA 3PC4A 3P2EA 1R0YA 3PDJA 1FSPA 4QDUA 1ULSA 1IUPA 2WJIA 2RBGA 1E5TA 2HIVA 3T7SA 3R0JA 2ZANA 3EFOB 5F1OA 3SFVA 3QQMA 1NVVR 4BXXG 4WSOA 1X2BA 1TC1A 1NLZA 4U2CA 1Y48E 4X1OA 3TOXA 4MW1A 1W36B 3TW8A 4ZT3A 3TZLA 2BFNA 4W4TA 3IRUA 2FG5A 1W0CA 4H7IA 2A5GA 4CTJA 1ZS9A 5DLYA 3FCOA 3AX6A 1X39A 3QFTA 3RBVA 3WHLA 6PFKA 1J1UA 4ND1A 5MGNA 4G0YA 1C1DA 1XMOB 4J4BA 1VHTA 3M9XA 3GHYA 4B3TH 3KTMA 4B6FA 3D2CA 3PVXA 3CX8A 3BA9A 4CKXA 2WM9B 5AXAA 2YFYA 2VDWB 3C8UA 1Q11A 2ZB7A 2X3UA 2PGDA 3B53X 1X7ZA 4LF4H 2DLCX 1ULZA 1IULA 1YJ5A 1FFEA 2B83A 1M0TA 1S7GA 4HDMA 1RD4A 3HDJA 5JFOA 4OUKX 2E21A 2FN8A 4I50B 3OIFA 5C31A 2ZS9A 3DD5A 3AEQB 4MWDA 5JVDF 1M72A 2BEUA 2JRCA 3FN4A 2YNMC 4G0MA 2K7ZA 1SXHA 4B7UA 4YT5A 2J3KA 3V1NA 2HY7A 4J1TA 2H06A 5L40A 1C7ZA 3U7GA 5JZSA 3G5TA 2D59A 2VJAA 2Z1MA 4CLEA 1K6EA 1YE8A 3EUAA 1G8JA 1U9CA 2W6QA 1TWCA 2XNHA 1ZJJA 3L8YA 3DAHA 3ZCRA 2SNIE 4AZVA 1Y7IA 1GSHA 2DH5A 2AMYA 3RS7A 4A3FG 3RNLA 1SZCA 1T4GA 4UTRA 3KJEA 4C07A 4CTKA 5FTLA 1XAJA 2J8ZA 2YWDA 4M98A 4CIAA 1DAAA 1HY3A 2HHHB 4ZV4A 1OAAA 2Q7DA 1P61B 3TQHA 4Z86A 2WB1A 4OL9A 3SC2A 1NNI1 4E33A 2PH1A 4FDUA 3W05A 4J1NA 5C1OA 2PJZA 2GLXA 3VKUA 4K3VA 3FDFA 3M6UA 1W93A 3QX3A 3S2GA 1BW9A 2OAQ1 3KLNA 4RDXA 1GEEA 4WACA 4E11A 4RZHA 3EGVA 2JBWA 4Q0YA 2C2KA 3DE0X 4F4WA 2B1RA 3BCUA 2ZUEA 4M1OA 5EXSA 2ADFA 3PDUA 3F1LA 1RAEA 5A3VA 3TLEA 1BJKA 4MP3A 3PICA 2FMHA 1GTSA 3HDYA 5DQGA 3VZSA 2J3MA 3BAFA 3BDIA 3MRXA 1L4LA 1TM5E 3VR6H 1OFGA 1R5JA 2VA2A 3KZ1E 3AUUA 5CFPA 3LUDA 2R8OA 2XKKA 5AKLA 3ZY5A 1KVSA 4EKNB 3T3OA 3N2YA 1CNEA 4R8RA 1Y1LA 1IONA 1YQTA 5IXSA 3L4EA 1V6AA 2C7VA 2C9OA 1KTIA 4WBNF 5AK5A 5I9TA 2CHUA 2NU9B 2B94A 3NUQA 5GADl 2Y0PA 2WJJA 3T6KA 4HDKB 1C3XA 3HU3A 2CNNA 3S5UA 1W8DA 4G4SP 4BFTA 3O4JA 1MT0A 4DLWA 2J3DA 2GQ0A 4PAQA 1KWGA 3ZVNA 1NBWB 3AT1A 1WV1A 2P9CA 1XZDA 3S68A 1Y3DE 5FLEX 5L4NA 5A0TA 1X92A 2QYZA 4YJHB 2FG7C 2GTIA 3GBVA 2OCKA 4TWBA 5JOQA 5FOSA 3W2EA 3O74A 2BFPA 1WCIB 2XMPA 2QQ5A 4L78A 3DP7A 3OIDA 2IZOA 3HXLA 4JUAA 3GPLA 3IAEA 3RUEA 2P9EA 4K0KB 4DKXA 1MXHA 2XB2A 2XCQA 3BVPA 1V37A 3LWZA 5LJLA 3CINA 4KGDA 3AIKA 4TV8A 1BDBA 3RF2A 3KYDA 3C24A 3LY8A 2Y1EA 4YLEA 2B78A 4B85A 2PSFA 4M37A 3HBFA 4JAVC 4V3BA 3RC8A 4A5OA 1RE1A 3TB6A 1FDTA 1KEWA 3OP4A 1ORIA 1P29A 4JQOA 2FPLA 3FYDA 3I6MA 1GFZA 2DWOA 4G5OA 1TGVA 1EP1B 1CUDA 4YRCA 2Q9CA 3EN0A 2QG4A 1CF9A 1SXGA 1XXHB 5HXAA 1XZPA 3JR7A 3I61A 2QGZA 4U2KA 2XTAA 1FDOA 2HG8A 4Z0NA 4DRYA 1Z0FA 4ZCTA 2OV4A 1KZ1A 2ZJFA 3NPAA 4K2HA 2V6GA 4FEGA 4J9RA 4ATNA 3K9GA 2I62A 2Q4RA 1WHSB 3GGSA 3LCRA 2XOKD 4FHDA 4J0HA 1YKFA 4MVJA 4CTNA 4BMCA 3KLOA 3KD3A 3OFND 4UNQA 1LS1A 2VATA 3BJZA 5TPZD 1Y9ZA 1PR4A 5DMXA 1V2GA 1EEHA 2I76A 4M49A 1H2RS 3WYEA 2JLWA 5BQPA 2NXCA 1HZZA 3L06A 3MTQA 4DNOA 1JR6A 4BQFA 4E15A 1L7QA 2COKA 1WPRA 3JW8A 3I4NG 5ARCA 1JAXA 1WXIA 3BWYA 4JOBA 4JD5A 1P0CA 3DZHA 3GJRA 2OPHA 4F11A 2OMKA 4ZICA 1R88A 2ZT5A 3QKUA 2P41A 4QUBA 2PY6A 3KKMA 2D0OB 4BNNA 1E8NA 3LX6A 3ZXXA 4OHPA 3QU5A 4UVGA 2PS0A 4D96A 3F8WA 2B8JA 1K7FB 2OWOA 1MNQA 4FX5A 1UK8A 2FK3A 4L5CA 4Z4HA 1QHNA 4LDRA 1O75A 3OY2A 2G4VA 3IYLW 3LRPA 2E2WA 2GT1A 1PNVA 1BJTA 1JFFA 2LPMA 4EJMA 3LPMA 3MMNA