3KAJA

Apoenzyme structure of homoglutathione synthetase from glycine max in open conformation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
471
structure length
452
Chain Sequence
FDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNIYGDELRETLLKLQYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
total genus 155
structure length 452
sequence length 471
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kajA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kajA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kajA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kajA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kajA04
2I87A 2P0AA 2XCLA 4YB8B 3K3PA 3N8DA 4MV4A 3TIGA 2NUAB 1C30A 3MJFA 1VBHA 4XYLB 4MA0A 1W96A 4O7NA 4O7RA 3VMMA 3HO8A 2R84A 2V58A 1Z2PX 3NUAA 1VKZA 3Q1KA 2NU6B 5CA0F 1DV1A 4FU0A 2DZDA 3U9TA 4O7VA 3R5FA 4C5BA 4O7TA 5IYZF 3TIIA 4FE2A 2FPIB 2GPSA 1KJIA 2NU7B 1GSOA 2I80A 3GIDA 3ETHA 1KUTA 1M0WA 1EUCB 2J9GA 2R7LA 1E4EA 4ME6A 2YYAA 3AX6A 3WO1A 5D8DA 3G8DA 3BG5A 4FGRA 1W93A 4ZQIA 2OLSA 3WO0A 2QF7A 5BPFA 4MV3A 4RZQA 4DLKA 2VQDA 1KJJA 4YAKB 2CNVA 2YL2A 4XZ3B 4HNUA 1CS0A 1PX2A 4YJ2F 3DF7A 1C3OA 2R7MA 4ZI7F 1OBDA 3OUZA 3GLKA 1PK8A 4FFMA 1I7LA 5JVDF 2PVPA 5KX5F 4XYMB 2PN1A 1EHIA 4YBZB 4E4TA 4EGQA 3R23A 1T36A 2HGSA 1BNCA 4O4HF 4C5AA 2R7KA 2HJWA 1AUXA 2C00A 2NU9B 2YZLA 3RFCA 2SCUB 2FP4B 4O81A 4FFNA 3TINA 4HNVA 3R5XA 1KC7A 1CQIB 4MV6A 1CQJB 4IZOA 3HB9A 1SCUB 1E4EB 3WNZA 4L1KA 4O4LF 4Y8VB 2YW2A 4I55F 1M6VA 4O7YA 2YZGA 4O86A 3RUPA 3U55A 4FFRA 4FFOA 2YWVA 3V4SA 3VPBA 3JRWA 2IP4A 1GGOA 1IOWA 2R85A 2QK4A 1WR2A 3ORQA 1B6RA 5GONF 5JQWA 4I50F 5KKNB 2DIKA 1AUVA 1EYZA 5C8YF 4HR7A 3UFXB 5H80A 1JDBB 4YJ3F 1DV2A 1JLLB 4HQ6A 2YRWA 1GSAA 2YS6A 4FFPA 5LOVF 2W6QA 5CB4F 4MV7A 2CZGA 4O7WA 2YRXA 1IOVA 4QSHA 4I4TF 4HNTA 4O2AF 5JVLA 2W70A 1B6SA 5DMXA 4WBNF 4O7SA 4YAJB 3RV3A 5J2TF 1DIKA 1GSHA 4ZHQF 5C1OA 1I7NA 1VBGA 3AW8A 2X0SA 4O4JF 2V59A 4TUYF 2YZNA 5JH7F 3KAKA 5HV6A 2W6NA 2GQRA 5LA6F 3ORRA 5BMVF 2DLNA 4IIJF 3VPCA 4DIMA 3KREA 4NYEA 1EZ1A 4ZOLF 1Z2OX 5HBRB 4O7LA 1KEEA 2ZDHA 1A48A 1KJQA 1ULZA 2CNQA 4EGJA 3MWEA 4O83A 2V5AA 2W6PA 5C1PA 1KBLA 3OUUA 5J2UF 5LXTF 3TW6A 2GPWA 5CAEB 3E5NA 2WYOA 2Z02A 3VOTA 3JZFA 3U54A 1OBGA 2W71A 2YS7A 4MV8A 3ETJA 3VA7A 4O4IF 2Z04A 5EZYF 3U9SA 5LYJF 3K5HA 4TV8F 2ZDQA 4MV1A 4O7ZA 2W6MA 5CA1F 4O82A 4MA5A 3HBLA 3LP8A 4XX0B 2GLTA 2R87A 3G8CA 2I8CA 4MAMA 2W6ZA 3Q2OA 3LWBA 4MV9A 3RV4A 2GQSA 2R82A 4FFLA 3SE7A 4TV9F 3JRXA 5FNVF 1GLVA 1Z2NX 3I12A 2DWCA 3KALA 2ZDGA 1JDEA 4EG0A 3TQTA 1KJ9A 4O84A 2R7NA 2CNUA 2VR1A 1JKJB 4C5CA 3N6RA 2FPPB 1M0TA 4IHJF 3KAJA 2VPQA 2XD4A 2PBZA 5LP6F 3K5IA 1CE8A 3R9RA 2W6OA 3MWDA 1EUDB 2FPGB 2FB9A 5JQGF 1KJ8A 2NU8B 3QFFA 3JZIA 1BXRA 2R86A 2YZMA 4O2BF 3V4ZA 4M9UA 3R5HA 1A9XA 5BPHA
chains in the Genus database with same CATH superfamily
2QHXA 2RONA 5H0IA 1Y8QB 4L73A 1SC9A 4UW9A 3KPWA 4LYEA 3RRMA 2FFHA 2W7TA 3GGJA 2OBYA 2R5WA 3A6JA 2OM6A 3D5TA 5CB6A 5KFVA 4RELA 3DDNA 3BL5A 3JATA 4MAFA 4KC0A 5DBIA 3EW9A 3O73A 1UMBA 3JWPA 3ZNOA 3DONA 1MABB 1S8OA 3OKAA 3P45A 2PWPA 4MW9A 3GFPA 2RHTA 2ZOSA 4U2EA 2AIRA 3OAAD 1E1CB 1TOAA 1Z8FA 2NO1A 2R7LA 2FX2A 2ZRCA 3H8SA 4RTPA 1MJFA 3BERA 4G5QA 1E2IA 1QCZA 5F9FA 1M72A 1SD1A 1CK4A 1Z37A 4HKTA 1J23A 3NW9A 4Z4QA 5DGIA 3DDHA 4Q24A 4KFRA 2FLKA 3EIQA 3WHLA 1XLWA 4PLHA 4PFSA 4HL6A 1JQAA 1OBCA 5L45A 4WUVA 9LDTA 4U1RA 3MS2A 2GAIA 5JDIC 1IVNA 3WKDA 5K03A 4OAPA 4PLCA 1QQBA 3TDNA 3PNYA 5EY5B 5KFOA 1D8AA 4A3MG 2C2MA 2WJZB 2PR7A 2JGDA 1OZAA 4HUQA 1Y7LA 3GYBA 5KQMA 1SKUA 2OFXA 2QMHA 4J3JA 5DOZA 2Y9MB 4RK1A 2GGSA 1JTEA 5DM1A 4FBGA 3SSMA 3R6TA 4P3OA 2MSLA 2ZBGA 3T3DA 1C2YA 2Q5LA 3KM0A 3HOXG 5IJZA 3C3WA 3QH4A 2YW2A 3M5WA 1N1EA 4LE2A 3BIOA 3ZBQA 4IQ8A 1NKTA 8ADHA 5ITWA 5E95A 4QQFA 4CN9A 3MIZA 4RLHA 3WLPA 4R6XA 1GVNB 3C48A 5ILQA 4FGUA 3LPMA 3NTQA 4IR7A 1PEKE 4P82A 2QD1A 5DTRA 4Q9HA 2EZ8A 2C9MA 3OP4A 5FO0A 3ORHA 3TLGA 3IVXA 3PDIB 3PR2B 3W2EA 4CMCA 3ETDA 1M7HA 2IXEA 4KQFA 5JXWA 2EVWX 1HZJA 3ZBPA 4DAOA 2GD1O 4GPEA 3EC2A 3DHYA 3TBKA 4BNJA 2V7QA 1T1JA 1U1CA 4NP6A 3D3EA 1U3DA 2R8BA 5A4AA 4B6QA 1L1FA 4NXNB 1VMKA 2WI8A 1BS2A 1M66A 3CX6A 1G8FA 2VEDA 2X1MA 4TS4A 4XZ3A 1W5TA 1ZIDA 1M54A 1NDHA 3LW7A 2JJ2A 1BU8A 4D0LB 1TLFA 3ZVKA 3G0OA 3JQBC 1APBA 3TSAA 3L8FA 2RK3A 4IWYA 3F71A 2A5JA 4AP9A 1IHOA 3WNVA 3C3KA 3I1YA 3QLTA 3ZXIA 1MAUA 3JTEA 1FRQA 1CUAA 2BZGA 1HOTA 5L3RA 5JZMA 1W4LA 2GBCA 1CFJA 5CAEB 3UG7A 2I62A 2NT3A 4IFBA 5BSGA 5T67A 2AN1A 5KWJA 3KB1A 1ZU4A 3PJGA 5H9WA 3GDOA 3AXTA 5DW0A 4EYIB 1ORTA 3KYIB 2VYVA 4DVGA 4IIEA 4KQCA 1AT1A 3L07A 4BKMA 2CBZA 1NR1A 2ZRHA 3RJTA 2QV0A 2DC1A 4LK2A 4CEJB 3HCRA 3K92A 4FDVA 2WHQA 2BFDB 3DYBA 1GPYA 1KSGA 2Y0EA 121PA 4QPZA 3QIVA 1RYDA 4MRAA 3WYEA 1QS0B 5BR8H 2GNPA 2BHNA 1XN1A 3ZHUA 5SYAA 4CF6A 3IDOA 1TTPB 1NSTA 1H2RS 5CDFE 4YRLA 2IRWA 3GQBA 3A2LA 5TPWB 3N6RA 2NUTA 3VOAA 4LJ6A 1AXRA 1KA9H 5C32A 1UK6A 1RLTA 4V38A 4GUDA 2VXCA 2HF2A 1DELA 5D3MA 3GMSA 4OX9Y 3IKJA 4D98A 2P41A 3OFJA 1BN7A 3QLUA 2TS1A 2QSYA 3INYA 3MR6A 3W0LB 5KYTA 3GPDG 4YB8B 2JJYA 5J5VA 1GADO 2K5UA 3F8WA 2ZUBA 1QKJA 4XEHA 2WMOB 3IO3A 1UFVA 1GY8A 3EQ8A 1ODCA 2BV3A 1QO0D 3NOOA 2CKMA 1T2CA 2EKQA 2QT9A 3VTAA 2OXEA 4R1OA 3TZBA 3SJCA 2W2XA 1XMOB 2JHAA 3F3KA 4RLSA 1YULA 4RZRA 1HEYA 3NKVA 3ZDEA 4EP1A 2YJ3A 3CLUD 3C3DA 5HJEA 1P9NA 5D3KA 1U7XA 1NWHA 4D96A 1AKTA 1M1YE 4ZI2A 5A5EA 2PT5A 4TSRA 3B1XA 5LKRA 4E6EA 4U5XA 1ML3A 2DWOA 2GF0A 4MV3A 2VNKA 2D5IA 4QQNA 1I33A 3JSXA 2IY7A 2Q5JA 5LMZA 4QEZA 3TPFA 5BW4A 1W44A 1W34A 4QFBA 2M1XA 1EVQA 4NCJA 2FEPA 2I3ZA 3I58A 3GX1A 3EPJA 1TW3A 1ZISA 1KTIA 4MNTA 2GO1A 1HYQA 4JI5B 3HCWA 1YCDA 2OWDA 4JT4A 5KX5F 2IT1A 3T7RA 2VPWA 1KYZA 4XYGA 2BP7A 3W7VA 4DCTA 5A6VA 5G3YA 1R00A 4LDPA 4B3IA 2XGSA 3KYJB 1QVVA 1TM4E 3ADDA 5BSVA 4YFVA 1B7GO 3N7UA 5FUVA 4RKWA 5LA6A 1X7XA 1MBZA 1J0CA 4X1YA 1CUZA 1FTNA 1PQ4A 3MEQA 1VHQA 3IKTA 3MWMA 3DOOA 5B3JC 4L3WA 4BRSA 3MD0A 5M29A 2IEDA 1E79D 5F12A 1R0YA 4H27A 3HJAA 4DKJA 2Q1WA 5EQJB 2G1KA 2OPHA 1FYWA 4N8EA 3ASYA 1OYYA 2PANA 3LCCA 3WKBA 4X85A 4J0QA 2FWJA 3NHZA 3O8QB 3M81A 5KTTA 1NMEA 3I83A 2P77A 3OZDA 4ILKA 5IAEA 4CIWA 2Q2UA 4RORA 3TTSA 3DBLB 4BPRA 3ND7A 3WFJA 3C16C 5KFIA 3F1KA 3ZWNA 2KLBA 4FDMA 2OC9A 4PHCA 4HEA1 3D3KA 5ABPA 2E1RA 1UM8A 4CM8B 1GXSA 4B4VA 5I9IA 1GA6A 4WLOA 4Q44A 2JCVA 4C43A 2FRDA 4EY7A 2GKSA 3WGGA 3FSGD 1I3OA 1LBQA 3KS9A 5F2NA 3QXCA 5KZMB 2FZGA 4P92A 5C34B 1MB9A 4DFDA 2H0AA 2HVRA 3A6FA 4G5RA 5EA2A 4FR2A 5KBYA 2ATIA 3HA3A 5DHFA 1TQHA 3H87A 4H3VA 4JI1H 2BISA 3LBIA 1EFKA 4LXTA 4XM0A 1AZWA 4O02B 2UZAA 4B83A 3FJYA 2CDBA 2QTLA 2A92A 2FR1A 3U9SA 3CB4A 3E1KA 1XMQB 2ZJ8A 3HP7A 1VYVA 1YJ5A 2OHHA 5E7IA 3MCUA 4DLAA 5HSGA 5K4GA 3LSTA 3NWJA 1ZU5A 2ISCA 2P6RA 3SE7A 4UZSA 1QGDA 3GCWA 4NH0A 3IELA 5KYYB 3GLTA 3EZ7A 4TQGA 2B7CA 3Q5DA 5CDSA 5BNIA 3RYCB 2UVQA 2EKZA 2FPPB 1Q1ZA 3ZOZA 1CR4A 1CE8A 4J9RA 1NQUA 3PGMA 3QVMA 2PX2A 4I8DA 2VF7A 3U60B 1XD2A 2A7XA 4AY5A 3GTMA 2ZTUA 2NQ8A 4BV2A 3UBTA 2GEKA 2PR2A 2O0LA 1UDRA 4D8WA 2HA2A 2D06A 3EX7C 5AM2A 3QHQA 5KHOC 3OQIB 1ZJ6A 1XI2A 4PN3A 4LFAH 3H9QA 4J3FA 1K06A 2DQKA 2V8OA 5HPYB 5DSXA 4JBIA 3A4MA 3U4CA 4DSTA 3LK6A 2ZT5A 3I32A 3BVPA 1Z6YA 1TT7A 3OU7A 1B04A 2D2VA 4DMGA 4M0UA 1FYVA 5FUXA 1C3EA 2QF7A 3R8XA 4PZEA 3BL8A 4ECUA 1O03A 2R92G 2LP4Y 2FK8A 1A50B 4AQYB 3TZ6A 4ROTA 1YB6A 2Q2NA 4BJ5A 1G63A 4MUXA 4Q0MA 2XRFA 1V1RB 1P7YA 1YS1X 3C3MA 4AECA 2X6QA 4QOGA 2JLQA 2V9CA 2W42A 2WB1A 1F4PA 1Z6ZA 3CZAA 5EE5B 1LJ8A 1NRWA 3F98A 2SNIE 1XDGA 3KJGA 2XT6A 4C0AC 4DY6A 5DX0A 3DT6A 4S3MA 1IPEA 2RARA 4R8MA 1J8YF 3SN6A 4HDMB 1EWKA 3CT6A 3GPBA 3WLRA 16PKA 4MKGA 1ZMBA 2UUCH 4EUEA 2ZE6A 3EMVA 2ZBDA 4YA6A 4ASUA 3EXIB 4PW0A 3S6JA 1I2AA 3EMDA 4J0JA 3LH5A 4MMYB 4AS3A 1SURA 2H11A 3VTKA 3TVYA 1IVSA 1XZKA 2AXQA 3LYUA 4I3FA 4I55B 3JASA 3WNBA 1RP1A 4CODB 3HB7A 4ESVA 2YASA 2NW6A 2NXWA 4RFSA 4EY5A 4IX9A 3C4QA 4Y1EA 3W9SA 3IV7A 1VJ0A 1MX3A 4TM5A 4AUKA 3A7DA 1EJ2A 4IIDA 2ATXA 4IEFB 4LX8A 4C88A 5E7JA 2P5YA 3LOUA 2Y1LA 1R0RE 4J0DA 2FLPA 2F3QA 3VR2A 1J00A 2PMCA 1T3NA 1SULA 3B51X 3A05A 5F21A 1M83A 2ZAOA 5IASA 1UOQA 4G41A 4ZDJA 4LF7B 4AROA 3DHEA 5KDLA 5ALLA 1QRSA 4HF7A 1EK6A 2HRQA 5HZHA 3GROA 1HTBA 2ZSDA 4RD4A 2VP4A 5CXQA 2NO5A 4INJA 1AHNA 5IVKA 3HDGA 4NECA 2PMWB 1L5QA 3QE3A 3NP7A 5FA8A 2X3UA 5K6TA 1F6BA 1U04A 2MYNA 2BMWA 1Y1VG 1BDIA 3QBEA 5DCYA 1HT0A 4L51A 5F78A 3NBQA 1T34A 3FUCA 3B48A 1WA5A 1V3TA 4XPIA 1GNTA 3WB0A 1QK3A 1Q50A 1QFYA 1V16A 4NNJA 3HOVG 2Y68A 4Y6RA 2ZRMA 1FRFS 1L5ZA 1FSFA 4LI3X 1FP1D 3RFUA 3LBFA 1XKTA 4J0FA 3HQ4O 3HOYG 5HWSA 4CTOA 4KXXA 4IR9A 1PBNA 1YBAA 2Z02A 2WE6A 3BFXA 2FZCA 1RKVA 2H7XA 3R3YA 4MUGA 4ARIA 4IQFA 3KKPA 3SU8A 4COKA 1C0LA 1C3LA 4EI2A 1EGMB 1TK2A 3DZHA 4FS8A 2ZDQA 1Z0IA 4G1CA 2R8OA 4O82A 2ALJA 3ZLTA 1OIXA 3E8XA 3HE3A 3BCHA 4IMJB 4H1HA 3ZCQA 4EA7A 1UBUS 4AQ7A 1PUJA 2G0NA 3NC0C 1X7GA 3QNMA 3MLAA 5ITVA 1KRHA 4JIMA 1Z4KA 1E6EA 3VKHA 2F1KA 4MQ4A 4ZO4A 1YMUA 1K6JA 3CUUA 2JAOA 2COEA 2NXCA 2Y1WA 3KRTA 1VG1A 3GB9A 1TQ8A 2VJCA 3Q98A 4EBBA 3M6IA 4MQLA 3G0GA 4YRFA 2PFKA 2J3HA 2CNBA 1LPAB 3NVDA 3G0CA 3H3JA 3WICA 4KHZA 3MF4A 1RXEA 3FB1A 1VP3A 1TC1A 1RLUA 4P54A 2NSLA 3D3JA 1P2SA 4PANA 3RGWS 1W49A 3EQ7A 2IP1A 1T0PA 3O3CA 3OIGA 2JLZA 4LDAA 2XMPA 1YMVA 1WZUA 3A0RB 3WB2A 5IHPA 2DQ4A 3B6IA 2DR0A 1UBSB 1DTSA 4TS1A 2EFDB 3PC3A 3BHNA 5IU6A 4RS3A 1QP4A 2JGLA 2YWEA 1QIMA 2P62A 4CM1A 2WTFA 4A0FA 4E22A 5ADUS 3AH8A 5SY9A 3PXXA 2PWZA 3MQ4A 1H4QA 1T5BA 4X9XA 5CLHA 3V4VB 3MJ4A 3SQLA 1J7JA 4CMIA 1KI6A 3WNCA 4ZQIA 5H1YA 4HUJA 4EI9A 4UHJA 4IJ6A 1C3JA 2VXYA 3D59A 3VMFA 5CLFA 3JZMA 3OHBA 4F2HA 2V4MA 3WGMA 1NYRA 1UKYA 1T8YA 2VTVA 2H00A 2OKCA 1V4VA 3ISTA 1WDLA 1J2UA 5FTLA 2WYHA 4H4EA 3MT9A 3GWGA 2RHLA 4QPDA 2FE3A 1PJQA 1XZ8A 3ZE6A 1P2BA 5LDDC 2KJQA 4DV5H 1P29A 3CC8A 3O1LA 1AK2A 3ZE9A 1VCHA 4A3EG 4LECA 3EWNA 1AXGA 4XGRA 1N34B 4AMZA 3DB2A 4JV1A 4DC1A 1XFAA 4QYIB 4AUMA 4C01A 3AI1A 1HFJA 3R24A 3ZV6A 5IULC 1YJAA 1TE2A 1Y5MA 4DV4H 4DBLC 4BGIA 3C97A 4YO8A 1GYRA 1U9ZA 3UJDA 1U0FA 3FWKA 3G0IA 2IUFA 3R7BA 4Y2JA 2UXDB 1Z35A 1RDFA 5E2AA 3UJ6A 1E96A 3GEBA 5DFAA 3N43B 2QEQA 1ULTA 2JEFA 2P1RA 1N8TA 1ZUD1 5I7RA 4OJNA 3TJZA 1LX7A 3QLVC 5DV9A 3ZDQA 3KL2A 1B00A 3DXFA 1VXOA 5JRDS 4DUPA 5ANRB 4R3WA 4YRQA 1P9OA 2QG6A 1T4BA 1WUKS 3EFBA 3H97A 3QJGA 4QDTA 1EVIA 3EGCA 2WU0A 3WJAA 3D4OA 3O26A 4ZGBA 4MGIR 2IZ5A 4F2PA 1ORHA 3K53A 3RIEA 5E9AA 5J2TF 5L7TA 1IOZA 3FLMA 5JD6A 3SOPA 4F4DA 2ZAIA 1EGQA 1PJTA 4DLTA 1C4OA 2OXIA 4KDCA 1S2OA 4AY6A 3QNUA 4BO0A 1C4KA 4L9RA 2XCSB 5K3WA 5DISC 3JCZA 3GZJA 4YWJA 1DEXA 4L02A 2VWGA 4AJ1A 2FXVA 4BQEA 5ALOA 4PPFA 3PRKE 3D5QA 3NWPA 4Q66C 5EVJA 3E5MA 2I3AA 2H4XA 1GV0A 3R5SA 4PPQA 2BFBA 1VHWA 1NMZA 4RTLA 1D9XA 3DEKA 3ZXSA 4E5VA 3C43A 1V2GA 3AFGA 3PXAA 4XPZA 3NH6A 3OA0A 3P19A 3B53X 4QIWE 4CF5A 3L8HA 3EJ6A 2XMZA 2AMYA 4QFDA 4RIGA 5KFSA 3NONA 2VPZA 3ECSA 3LZCA 3ZV5A 3E03A 4MUKA 3LIPA 4NV3A 3FRJA 3HJNA 3D31A 3LULA 1MRZA 1L1EA 1R6XA 2BH2A 2RAFA 2ACKA 2FUKA 4TLDA 3IIEA 2GKGA 2CMFA 4ZAYA 3HPQA 3ZCVA 2EZ4A 4P5EA 3FTDA 2PEYA 3QG5A 4ZT3A 4WECA 4RNOA 1AUQA 1ISSA 3KDSE 4G0QA 1RQRA 3PVSA 5K8UA 4LJSA 3N8DA 4HVCA 4RFLA 1QHXA 1C30A 3C3YA 3IEUA 4EARA 3EIHA 1OLUA 5FTWA 4B9EA 2R84A 2J3LA 4PQGA 1E7SA 4HXFB 4Z9XA 1O4VA 4N03A 2AFHE 4P32A 3NAZA 2HMWA 2H1SA 2XXBA 2A1IA 4AIRA 4Z0TA 4CKEB 4NJMB 3VOSA 3NBYB 4E88A 2COUA 1QX4A 4BU1A 4KH1A 2CJWA 5AI8A 2FW8A 2QWXA 1SU4A 4J3NA 4JU8A 3OFND 3D6FA 2AGPA 3SYRA 3ELWA 1Q77A 3KD2A 1WY7A 1UXIA 4MVCA 2D1FA 4LOJA 3LMLA 1U11A 4EYHB 4KYUA 4L5BA 3PGKA 3I39X 1FQJA 4PZ6A 3OAAA 4YMVA 5AVJA 2Q6KA 1YJCA 2X8LA 2VT6A 3EPKA 1C3VA 1ZL2A 3HXMA 3HNOA 1FS6A 4X3OA 5F9NA 2PN1A 2RGGA 3RIMA 3BMCA 3NFRA 2J0VA 4XUEA 3DEZA 4DT1A 1CHNA 3M7IA 4A3BG 3ONVA 1T4GA 4W5NA 4UDNA 1E1YA 1Y9AA 4PTZA 1QQ7A 4UCOA 4BBPA 1YU9A 1XYVA 2HBZA 3AEQB 4QHSA 3NR2A 3WWJA 1XCBA 2VI5A 1QG6A 4BGVA 2K6GA 3IKMB 3SX0A 1OAAA 1EDZA 4XWYA 5GAJA 1CQJB 1Y1KE 4BASA 2TMYA 1XU4A 1GFSA 4JUZA 1QIJA 1QDLB 4KE8A 1DIHA 3F3SA 3DAPA 3KOOA 5MN4A 2AC4A 1WO8A 4HLNA 5A0FA 4CV1A 1SC6A 3DBHA 3GLIE 2W48A 4MR8A 5CA1A 1G8KA 2VDLB 4EDFA 5FULA 1U28C 3GJ8A 1MQ9A 5L9XA 2A0KA 2NWQA 2CCKA 2ZIAA 2E2HA 3F5FA 3BJRA 2ESRA 4H1VA 3FVRA 4Q4HB 4ZVLA 2WT4A 3SSNA 5EXXA 1K7EB 4LQLA 1IAQA 2ASJA 3ZHXA 4X92A 3DO5A 1SZPA 3ELUA 1U0TA 2G36A 3G0BA 2AV6A 2XZLA 9ATCA 1P61B 4AT1A 1WSWA 1O6GA 1RAEA 3J81k 4AX4A 1PV1A 2YXEA 4RVOA 5JZSA 3PNLA 4NYEA 5HBRB 5BYKA 2BFFA 3RS3A 5K2OA 2OP0A 2VCEA 3S2IA 2J46A 4LSAA 1M5TA 1TD1A 1DAFA 2P65A 4MDEA 1KZYC 1V5GA 3OLWA 2YN2A 3M9LA 2WSYB 4K9PA 5JZVA 3JYHA 4AXXA 3I4LA 4WZBE 4FEAA 1MEEA 4H59A 1W5EA 2QD5A 2CK3D 3P2OA 3CSWA 5AK4A 2X2OA 4A3GG 1RVDA 5JCOA 4C0KA 4IZIA 1GDHA 4MRNA 1BIFA 2ZCVA 4ID9A 1BMDA 3H75A 2BTQA 1RABA 1N78A 1ZDMA 4URZR 3OM8A 3OUTA 2I2DA 5JAUA 1XBTA 2D2IA 1R12A 4CM4B 3ZGNA 2G4CA 1L5SA 4L0CA 3FHOA 4NNOA 5KOJA 3KALA 3AB3A 3B1JA 1FQWA 5M2QA 1Z5PA 4BLRA 1HDXA 1NL3A 4F0JA 2JDID 2FVYA 3W8NA 3R0IA 3KTFA 4AN4A 5HJ2A 4GKJH 5EXPA 4A5SA 1OWNA 4FKBA 1EI9A 1YB1A 4E13A 5JAQA 2QAIA 1ST3A 1NC1A 2A9RA 2Y1OA 2CHVA 5H70A 4JQOA 4O2BF 1U9IA 5A02A 3RUIA 2XRYA 1WL8A 1AHIA 4N6OA 4O33A 4AX8A 4DSOA 3LW8A 3HP4A 5KB3A 2NSHA 1P0IA 1P74A 3CTMA 4MVJH 1Z2DA 3VMMA 3QZUA 4YHHH 1ZYUA 2NSYA 1XTPA 3NUAA 1NOJA 1IM5A 1Z2EA 4FU0A 2WAAA 4US2R 2WOOA 1AY0A 3KLMX 1AE1A 2PXXA 2Q5CA 4R2XA 1I51A 3FOAA 2E4YA 1NBWB 4RADA 3PTZA 1MC1A 4OB8A 1WHSB 2HO4A 4O3SA 3ROKA 1N3LA 4MLZA 1VTKA 3PJRA 4L7QA 1Z82A 4FMDF 4OB7A 1E64A 4DLZA 3CLKA 4H6PA 1MR3F 3N75A 1K7CA 5JJBA 1EQAA 3FKIA 4G2NA 1LF0A 1YWGO 2Q0HA 4M7WA 5CCDA 3CRW1 2XCRB 4Z49A 1S03G 1Q57A 5ALUA 1DIRA 3FR8A 3QMWA 2XR1A 3E81A 1CZOA 3TQCA 2QL9A 2JLVA 4HQRA 5CVUA 3M4IA 1NOKA 2WD8A 2B9VA 4UCQA 4TYNA 3ESQA 2R8YA 2NGRA 3NXSA 4V0SA 5LQRA 1GGJA 1L4HA 4LRQA 1AXEA 2VJLA 4CT5A 5LZ8A 3NHPA 4AULA 5HR5A 4WOCA 3UA4A 1TYDE 1KEWA 3SQOA 3CXUA 1FIUA 3VFDA 3QKSB 1NVDA 5EUMA 1CLUA 3RVBA 1O96A 3NYWA 4UXHA 4WWHA 1TVEA 4X8LA 4CMHA 1XZCA 3EIEA 1LW6E 2P27A 4FM9A 5BVHA 4O81A 4NPAA 2A67A 4NEGA 5A04A 2EKLA 2XT9A 1SCUB 4GMXA 3WDLA 2GAJA 4RDIA 3GF4A 1SUBA 2FSGA 5C9ZA 3I4MG 3QFCA 4JBNA 3STVA 4PU0A 1P3DA 1FFXB 4JSYA 2HEIA 3BXFA 3IAFA 1T15A 4R1MA 3F8SA 3LKDA 1OX4B 3E5RA 3BRSA 1N6IA 3S8YA 3FNHA 1ZXXA 3F5SA 4OCZA 3SNKA 1CUDA 2C22A 1MCZA 1Y3BE 2UVWA 2B7LA 2PH3A 4PFKA 3G8AA 3ORQA 1GT6A 3MLEA 3U7QA 4PICA 4JLUA 3SF8B 4HR7A 3JD2A 2G06A 5JAZA 4YJ3F 1F8XA 1VPDA 2OTCA 1E79A 4ARBA 1ZN8A 1HE2A 4IMRA 1QFJA 2VDUE 4JI0H 1NUAA 3H3XA 3CEHA 1TAQA 1YVUA 3FZGA 3RRFA 4RAYA 1QAQA 3ENQA 1JHRA 3NHKA 4HNQA 5DNCA 1G9SA 4WNYA 1B43A 1M10A 5ECDA 3T0GA 3Q7TA 3U7FB 1RKUA 3AYHB 3VR6D 4EW3A 2I4OA 5IYCG 3OMWA 1M0SA 4ND4A 1KSJA 5DQIA 3PE6A 1GUAA 2AW3A 4U8GA 1NX6A 3WJ2A 3ZJVA 3WQHA 5K8TA 5CW1A 4WLEA 2YWDA 4J1TC 4N9WA 1VE7A 1JPVA 3R77A 5AXDA 4UKDA 1R27A 1QE3A 3SVLA 3JR3A 5CFOA 1FS4A 2YYSA 3ZU3A 4OYHA 1U1EA 2X8AA 1T5DX 3FSGA 2G88A 3KXDA 3RC3A 4NQRA 4F2GA 2OH2A 5CCXA 2VHTA 4RETA 4MJXA 1F9EA 2PWBA 3SI8A 3HSKA 2XUZA 1E77A 2QI9C 2DX7A 4II2A 2EFHB 2EW8A 3G8BA 4HYTA 3WK6A 2BFNA 3N59A 2CKDA 2QTMA 4BL5A 3BXHA 3LL7A 1BTOA 3WLFA 2YJTD 1U1IA 2AQ8A 3V1LA 4TQRA 1GZDA 4JYBA 1KPHA 5I9LA 1Z26A 3AEKA 1M2FA 1FLAA 1OXTA 2J6SA 4EFLA 4RM3A 3Q3IA 2CFOA 4OK6A 1YS4A 1N7JA 3G5LA 1RXIA 1GG5A 1UXOA 2ZRDA 3I62A 1ZOLA 1JKFA 1TPZA 1ZGHA 4A3DG 1U94A 3TTUA 3N44B 1BCRA 3ACDA 4LRSB 3CR8A 1M8FA 2WZQA 3REGA 1UEJA 2B30A 2L42A 4AZ3B 3K4HA 5TMPA 1F2TB 2VHJA 1S01A 1SJ9A 1ZJZA 4A3KG 3PJDA 1U0LA 4I7HA 3TLZA 3JPYA 5KAPA 2NQTA 5ALNA 1QZUA 4MMXB 5ENDA 3HVIA 2N46A 4KV9A 1SXJE 2O52A 1KARA 2B3DA 4Q7QA 2XPCA 1IIBA 3HP1A 3NORA 4PZUA 2AKAB 4YT5A 4DMCA 2R93A 2EYUA 4Y9RA 5D8DA 1SIBE 4RHFA 3JY6A 2PBFA 3FGZA 3A6ZA 2FWRA 3EPHA 2QZPA 4DVJA 1OPXA 1OFTA 2HA5A 3GTKA 2PGIA 1JAXA 1OILA 5LLDA 4PPGA 1UT8A 4FFMA 5EE0A 2JFYA 4KR6A 2ANBA 4UQOA 4IL5A 2V7WA 1KKMA 2VP9A 4N01A 2XUDA 2PV7A 3C70A 3T4PA 3OQHA 3SX2A 3LGXA 3T5LA 5HM6A 3T5MA 2KB0A 2YJGA 4UNSA 3E9CA 5KFQA 1L7NA 4B6PA 1FBNA 1MA3A 1ODSA 2HSGA 2C5LA 3FYUB 5I7FA 2OORC 2WA2A 3CF6R 4LMRA 5ERXA 1TAHA 4QJ5A 2O8DB 4EHHA 2RGUA 1QZXA 2EFGA 2HN9A 2ZJ1A 1ANKA 1PLJA 4ZEXA 1Y89A 1F8YA 4FGJA 1EXVA 1DC3A 1D3AA 3TAHA 3DAGA 4QNMA 4BO2A 1W46A 3EDYA 1IN6A 1U7DA 1SUDA 1OREA 1T29A 1X2EA 2GRAA 2H59A 1LDGA 3H7IA 3AETB 4A91A 1C1YA 5GONF 3E27A 1AUVA 1Q15A 2ETVA 5KFBA 1NC3A 5L7YA 4TL8A 4PGMA 4BIMA 2Q2OA 3RK4A 4UUMA 3K0HA 4WCFA 1RYEA 3HCCA 1MAVA 3AC0A 4TV9A 4MIOA 2D4AA 4D5GA 1GYPA 3CNBA 1NVMB 3CZ9A 2MINA 1WV1A 4O3RA 1B6SA 4A92A 1RK5A 2CVPA 3N41B 2H31A 5CYGA 2GBIA 2BF4A 2ZITA 1RYYA 1YR8A 5BV2P 2ECOA 5FR2A 2C7GA 1OVGA 2GM5A 1XU9A 3BRQA 4TMZA 1N5RA 4OXXA 3AHHA 4U2BA 2HJVA 1LKZA 3BWCA 3DAYA 5FLKA 1W36D 1XK5A 2H2DA 3K94A 1U2DC 3QSYA 1Z4NA 4IJWA 4RY2A 4RTRA 1SCJA 3SXUA 4A73A 2GLUA 3ET4A 2OV4A 4LJRA 4KQ9A 1HR0H 3NEJA 5LJIA 4KMOA 1E2MA 3R09A 1M34E 1PFQA 4AYTA 3EVDA 3CRQA 3K8ZA 1PZMA 3QMPA 5JO0A 3AVWA 1PV4A 4LCBA 3C4VA 2VF4X 4BBZA 3WQRA 1OXVA 4PFQA 4M7PA 1WMAA 4I5IA 4QEDA 3S40A 3KC2A 1DAEA 4PC7A 4F1WA 3FPLA 5FYQA 5EQDA 4YAUA 1R88A 5FNVA 1HQYE 1MAAA 3N9IA 2DGDA 4DEXA 3MSCA 3GCDA 1THMA 4N7RA 1E4YA 1IHYA 3GP8A 5G53C 5DWQA 2JH9A 3Q8MA 1KYVA 3ROMA 2FGKA 2D1TA 1CXZA 4QUAA 3C7KA 2P7IA 3A1FA 4KXMA 4QGHA 3F7TA 3AGQA 2CL0X 4CIDA 1Y1WA 4GYWA 1M2EA 2WFLA 4XSVA 3EMBA 4ZAFA 1JJFA 5JDCC 4LCEA 3RVLA 2PKYX 4O7NA 2PYIA 1ODLA 3N86A 4I4CA 4KX3A 3TLBA 3BL6A 5EERA 3W5DA 5C4XG 3ZK9A 4BV3A 2JLYA 1XG5A 4OYRA 3TI7A 3GP5A 4LF5B 5DHUA 3PPXA 1ETUA 3FN4A 3G82C 4XVHA 2FJPA 2C9OA 2V5VA 5LL6P 3V7NA 4JSTA 3FOZA 3OPXA 2OSVA 1F5NA 3BMOA 5IKPA 3FNEA 1SM4A 1DIBA 5TB5A 4RZQA 2G71A 1V4YA 4V3CA 1GTZA 4K0KH 2IDJA 1BAPA 4RTJA 3FAKA 1OAOA 5F77A 4YI5A 2AK3A 3INGA 3FDFA 2J0UB 3O9ZA 2FCRA 3DSRA 3BF8A 3MXOA 4MUYA 1KDZA 2ZJ5A 1V3VA 1PR1A 2G0TA 4HQKA 5EIHA 3ZKAA 4OQNA 4M8KA 1L8AA 4AKEA 5HDBB 5A3RA 3NDRA 1R8QA 3U3JA 1UAYA 3ADBA 5DH9A 1XGKA 3T5TA 2C98A 4RJIA 3L7MA 5EHNA 1WZIA 4Q93A 2RCNA 4L9WA 3WGKA 1CUGA 3PIIA 2R7ZG 2JRLA 3M6XA 1QV6A 5BV7A 3ER8A 4CUJA 2XI4A 3AUTA 4PYMA 3VOBA 4EO7A 2FG6C 3HB9A 2CC2A 4R68A 4WCDA 1PFUA 3UCXA 3D6NB 2JEIA 1ZK2A 1YI8A 1M33A 1A1VA 2IYLD 2HWYA 3GLHB 3QE9Y 4RC9A 2B1JA 1ABBA 4G67A 3UH1A 5JISA 3QLJA 2JGKA 3O93A 5B1DA 3R0QA 1OYWA 5FO1A 3FFTA 2ZYAA 3VV2A 2D2EA 2B4TO 1B8NA 1EVZA 4WACA 1A98A 3TTYA 7MHTA 1M6EX 4FQ5A 4LOAA 4I4TF 4G9BA 5CX4A 2ZETA 5FA6A 2W6ID 2QZ9A 1P8LA 1KOGA 3R1IA 4ECYA 4TPKA 1O58A 3NBZB 2B8TA 5TF0A 1C7QA 4IOJA 4IUCS 1ZD9A 2J6TA 2O1SA 3R9KA 1XAIA 1M2OA 3Q0EA 3HKBB 3B38A 2C2EA 1JG4A 1COZA 1LB1B 2C7RA 1UBMS 1GYQA 2CV1A 2R8EA 5LDGA 4N49A 3BUSA 4N6GA 2CLLB 2GHIA 2ENWA 4R71A 4MVJP 1JHQA 1E99A 2DRIA 1DDIA 1IJEA 2Y1GA 3UUGA 4ZEVA 4R16A 2V7GA 5DLEA 4NYJQ 3WDMA 4JYMA 5IEJA 2QN6A 2PS0A 5IDXA 4CWAA 2BCEA 4GO1A 5FUMA 1MH1A 3FPCA 3WX0A 4EZBA 3IN5A 2P5UA 5CDGA 3OZVA 4O4IF 5A5VA 3T99A 4ZV9A 2Q4RA 1FLNA 4F4IA 5IYZA 4JYZA 4H7FA 2NO6A 1JWAB 4MA5A 4UCWA 2C57A 4M1ZA 5A4KA 2GDZA 1U2SA 3GIWA 5B4UA 2EKPA 4Q1FA 2NV2B 3OOHA 1Z4PX 4V2IA 4OOEA 2O3TA 1C50A 4QWBA 3OCJA 1J2RA 3HCFA 5EPUA 4ARCA 4AURA 3MUNA 4PONA 5LZ4A 3IP5A 5EINA 3FB4A 4CRWB 3HVHA 2MR6A 4FXOA 5JWHA 4V0OA 2VDKB 4O59O 2C04A 3MC1A 3LQQA 2QN9A 4B2PA 2FEMA 3E8MA 2OGSA 3ZD6A 3PF8A 2DJ5A 1NXXA 4AWBA 4OGKA 2Y99A 4RDCA 4BC1A 1NE2A 1HC7A 2BELA 4WFQA 1DC4A 3U49A 2IW3A 2R8KA 1EIWA 4LNUA 3I37X 4CE5A 3NOVA 3KHGA 1TF7A 1HSOA 1Y6JA 3FJ1A 2H2HA 4KO3S 3LBYA 5IK2D 4BKRA 3E35A 3X1WA 4WPGA 2WF8A 3W2TA 3PI6A 4JIGA 5DYWA 1DDGA 3HCDA 1P8AA 1ZIYA 2RAVA 2ZWAA 1Q0RA 4N12A 1U2QA 4F5ZA 2WU3A 4XXHA 1TYBE 1NTRA 3SJZA 4HYYA 2UU9B 1Z74A 4YUVA 4A2CA 1KQFA 1Q11A 5BWBA 1TDJA 1Y6ZA 3A6LA 4GMGA 2BF7A 4F3NA 3FOWA 2RSLA 3BN3A 4R40A 3Q8QB 4QASA 4DOMA 4HHEA 4RNDB 5AKJA 1TZBA 2ODTX 3OJWA 3BMNA 3RUCA 4H35A 5CP8A 4L28A 4YV2A 3PEFA 3NLLA 4AAYA 3W6OA 2XNCA 2DECA 1IBRA 1ECPA 4BX9A 1Z63A 2ZIGA 2JF0A 3HKDA 1USWA 2BY4A 1XMXA 1LF5A 3IEIA 3PUJA 4K8OA 3AOEA 1RYRA 3OFNA 2F1RA 3UAOA 4GGMX 5FI1B 3A6EA 3FPAA 1JDJA 4LV6A 1FJ2A 4W5RA 1YRAA 3HABA 4CF3A 1W75A 4H18A 4M99A 4I5DA 4D82A 3OMXA 2R8RA 2V65A 2QVCA 3TW8A 2JAQA 1ESMA 3UO8B 1Z34A 1JEYB 2JFVA 1ZRHA 2QRMA 3CH7A 5LQCA 1YZKA 2Q3EA 2BGMA 4OM8A 3TZCA 1P1FA 1EG2A 1YT5A 3TLMA 3FHLA 1UBEA 4JAVC 4BBSG 3Q41A 1XZNA 4FR0A 4RA9B 4DGQA 2VDVE 1GGOA 4M0JA 2XX3A 3SOZA 4FZJA 1M7JA 1YQUA 3RC2A 2PA3A 4A8TA 1TCCA 4HQ6A 2WUFA 1R9JA 1XR3A 2O2XA 2O48X 3K0CC 2NZJA 2WFZA 4JNCA 2CSXA 4PNPA 3S5UA 3RVMA 1I4OA 3OQJA 1TVCA 3N3AC 1DAMA 4YXWD 2W2KA 1RXWA 1W85A 3NWBA 1L5MA 1KFEB 2YJ5A 2F3SA 3W6NA 3ROGA 4YTEA 1XAGA 1KMHB 3P4YA 5DM2A 4PC1A 4QSMA 1U2GC 2IYXA 1EPUA 5HG0A 3U0GA 2LXNA 2G9UA 2FMTA 4NHEA 3FI0A 2JD1A 2HUPA 1BQ3A 3M3HA 3QY9A 5BW8A 2DT5A 5KMGA 2JATA 2CGEA 5HKAA 3AINA 3KTOA 3M6VA 3UB2A 1RS0A 3QTTA 1GCIA 3I05A 3PWZA 2P4UA 3IVMA 1DX6A 1NP3A 2HK7A 3F5DA 1ZUNB 4D02A 5EZYF 3WZLA 1K5PA 4NYJR 2FQ1A 3OQPA 2C28A 4OLFA 1PZEA 1ES9A 2E85A 4LJ8A 1BHQ1 4GOLD 2GJKA 1HI9A 4JXXA 5EXTA 2BUBA 4X0EA 3WWZA 1VMDA 2WV9A 4WK2B 3WLNA 4YY3B 4JZKA 5FP0A 4NNPA 5JYCA 2YIDA 5EUCA 1TMOA 2J8ZA 5FLEX 4EG0A 5C5IA 4G4SP 4P81A 1ZH8A 2CK3A 3RI3A 4FHEA 3PFKA 5KVQA 1JP7A 5K51A 3NNNA 4XIFA 3OTQA 1WUYA 4KGDA 1O89A 3B6ZA 1GL9B 3NBXX 2HD4A 4AN1A 2XIJA 2GN9A 4Q7KA 4H7KA 3Q8PB 3DLCA 2W4IA 4X00A 1ZM2A 1DAGA 4H1WA 3WIVA 1G6OA 1Z0KA 2Y0SA 4TRNA 3VNSA 3KXKA 4DG5A 4ARSA 4QHTA 3EPPA 4JOQA 1WV0A 3RTDA 3I09A 3LCVB 2JDIA 5C31A 4LN1A 4N5NA 3ZS8A 4B3XA 1G7CA 5K8VA 3HM9A 1M2JA 2X4DA 4CV3A 1JF8A 7ADHA 4AB1A 4MS1B 3GUHA 2BT4A 4A26A 3ZKWB 1C7ZA 3GBSA 1Z38A 1JLMA 2BJWA 4KFUA 3CBQA 1Q91A 2NVOA 1VS0A 2BYTA 4DDUA 3RGGA 1AMOA 1UXGA 4NBKA 3RVDA 4OXIA 4PX3A 2E2IA 1XZLA 3TPZA 1DC6A 4YMIA 1TRKA 1YHZA 2PO7A 3RTXA 3UW1A 1O0BA 3ZK8A 3H9JA 1DSSG 1K1EA 3EGDA 2RIRA 3EEFA 4UULA 2W2VA 3V4FA 4LXQA 3PKJA 3KLNA 2NPOA 1BW9A 1J6UA 3K7EA 1PHRA 4B6FA 4DTIA 1K8QA 3FOFC 3VHLB 2QNBA 4JKYA 2PS3A 4H3KB 4S0XA 4F2DA 3GLFB 3VDRA 3Q6IA 4ACAA 4XIJA 1HORA 3S2YA 1RWMA 3WK4A 3N3BC 2QMYA 3IO5A 4F84A 2H63A 2JIZD 1EA7A 5DM4A 3WZMA 4MUBA 3WNDA 5IT5A 2AG0A 1VSUA 4CEIA 5HJ7A 1FYEA 4A2AA 1QZTA 3KJXA 4W82A 3PNSA 2EIYA 3RB3A 1X39A 2WKQA 4I4IA 1RQPA 1FXSA 5FQNA 5EZSA 3B5EA 1LWOA 1X7YA 4I9GA 3GEGA 4BGUA 4GGOA 1F20A 3NVAA 3L93A 3MJCA 3PRJA 1ZJYA 1E4VA 1SUPA 3O3MB 3NHJA 3NIDB 2PQMA 4HEA6 5ALMA 2PH1A 1UM9A 3JZ6A 1E20A 4HDNA 3U44A 4NENB 1MF7A 1FP4B 4E46A 2N1MA 2OZKA 4QWWA 2QM8A 1FVXA 4KQGA 3AM4A 4ED0A 1J0AA 3GLRA 4UEKA 4H3SA 2FP3A 1W88A 2CLFB 4RVFA 5EJ8A 1JR3E 5FPSA 1CJSA 2YIJA 2XIQA 1U5CA 4DQKA 1U5BB 5IANA 3E53A 1NQWA 1E2BA 3IX7A 3MWDB 5D3QA 1TO6A 1U0OC 4Q34A 1LFAA 3ZE7A 3L8DA 4L5IA 3M6LA 4J1NA 4HJXA 3WRWA 4FLFA 1KYQA 3PG5A 2FWAA 2A8YA 4BN0A 4AQDA 2ORYA 1VBGA 1A9RA 2Q7XA 3R0JA 2XNDD 5JATA 3QJ5A 1CLEA 2PPVA 3UENA 5CYFA 1J8QA 2PBLA 4XFKA 1SG6A 3FCAA 2G1UA 1RI3A 2MSNA 4KLNA 2RGCA 5FAXA 2JKZA 5HMMA 4HNRA 1Z2OX 4ZRDA 5B6PA 1FDVA 2AHRA 4ML3A 3IOEA 4KIJA 4EVIA 1T9BA 1L5GB 3HYSA 1GZSA 2V96A 1T0IA 3R3UA 3G89A 1Z06A 4Y6LA 1KU6A 5CB8A 1FW6A 3M34A 2EDCA 4EJSB 3HU3A 2J0EA 1PRYA 3VR6A 3TLKA 5DCWA 1CR0A 4Z54A 1N5OX 2Q62A 1OXSC 4DDTA 3NBUA 4W6ZA 5HS4A 5D5HA 2XUGA 4D6PA 2CD7A 2RK6A 1OB2A 5LQJA 3IC5A 2QL6A 2VKTA 3OEED 1XZEA 4JEIA 1T9GR 3K15A 4UBNA 2JGAA 3BWBA 4ANFA 2IYTA 1KAMA 5E7MA 3PKIA 4JLWA 3SLKA 2IIQA 3ESAA 3CVXA 3BE8A 2C2RA 4U2KA 1UPXA 5IPFA 2ON6A 1KJ9A 4AJOA 4UU7A 3T95A 4EUKA 2Q5OA 1ZA2A 1SEPA 2KLHA 1YQTA 4YJ2A 4C3VA 2WAQE 4F04A 1BO6A 4OSOA 1LBTA 3JQ9C 1PGQA 3WS7A 2YIVX 2PZAA 1N57A 1B41A 3PP8A 4C0BA 2AUMA 1L4MA 3WMEA 2UYGA 4AKIA 4BZZA 2AC2A 4J2HA 4JKIA 5BSWA 4DRFA 2WU4A 2DFLA 4AG5A 4IV0A 2WYWA 1LJLA 5KDOA 2GZSA 3T7IA 4LH6A 1T13A 1SXJC 2X40A 4P84A 1XQ6A 4J9UE 4KWCA 3SYNA 4F4CA 4E2WA 4MPDA 5AVXA 3A7EA 1KFJB 2A5YB 4EBDA 4DCMA 1RHUA 3LUHA 1CRWG 5DHSA 2I67A 1AQ6A 4OHBA 4B3RH 1CZNA 5F3DA 3TN7A 3VO8A 2FV8A 5IKXA 1ZY2A 1BKYA 1DBRA 2XSZD 2ZI3A 3HADA 2F62A 3AHDA 4LHSA 3ED5A 3PGA1 1J8DA 3ICCA 3PSHA 1LBEA 1C7IA 4LXUA 2XVZA 3WWOA 3WB9A 4AS1A 3CRVA 2XF8A 2B0CA 1ZVKA 4N1AA 3S29A 3IUSA 4K9KA 4CU5A 4A10A 3HFGA 4QDJA 1KE2A 4DSZA 2PKCA 3W5CA 1AQUA 3DLPX 2PUEA 1B42A 4RVDA 4WBNA 4DXAA 4FEYA 2JFUA 3ZY2A 3OT1A 4N8DA 1GEEA 1R3UA 1PW7A 2LCQA 4C2MA 3SP1A 5IBRA 3TSWA 2YQ5A 5AKHA 3AUSA 2R2GA 3HKEA 2W83A 2GK6A 4IS3A 3R6LA 4TL9A 1BMFD 1L8OA 3LQ1A 1X0VA 4WQMA 5EI5A 1Y1LA 4B33A 2V45A 3KHLA 1CVLA 3KX2A 1VSQA 4O6VA 4N5MA 1WNTA 2EJTA 5JMPA 4R5HA 1ZJWA 5H8WA 1IQ0A 5FTMA 1I4TD 2YMQA 2HVSA 3EG9A 1RWVA 2I65A 1K9VF 1EWYA 1SVIA 3V8MA 5JUMA 1BHJA 4P83A 2IP4A 4RPGA 3TWOA 4YAEA 1QWOA 3EVAA 5IM4A 1ESNA 1T5LA 1WR2A 4R51A 1NJ1A 4WRRA 3WMRA 3MBOA 4D56A 3C3PA 1V7PC 2HADA 2O50A 1JU3A 2ZSHA 3FVVA 1R6AA 5L6MB 5CFMA 1YB4A 1L4KA 1WMBA 4RLQA 4F12A 4EA6A 4BXXG 1QORA 3QX9A 4X7MA 4W8HA 4X7PA 3TQOA 2NQ2C 4CQJA 3R3VA 1ZZEA 3EDCA 1BD4A 2FY8A 3EAFA 3E4CA 1ACLA 1E6LA 4GZ3A 1ZSYA 3WWYA 4XDHA 3OWHA 1OFIA 4N5HX 2N42A 2HREA 2B36A 3BDIA 4DNFA 1I4LD 5K6AA 3OJCA 4GYKA 4XJSA 5F9MA 5I4CA 1REQB 3KOYA 5BRJA 3KREA 1JDTA 1P9RA 5MFPA 1BEZA 3SVZA 4JBYA 1XTSA 3C1OA 3BZUA 1ZK3A 4C1NA 1EFVB 4KNYA 4L8GA 4U7WA 5LIRA 2HK8A 2PCJA 1Y8QA 2GILA 3CRMA 1BC5A 4UHDA 1UIMA 3LCUA 3I5UA 3UCEA 3IR6A 4M49A 2AX3A 1H93A 2XGGA 3CF0A 1Z88A 1J2EA 4R7TA 3VR6H 1CSEE 2QRJA 4U7FA 4LV8B 1B3RA 3QELA 5ESRA 1PS9A 4ECSA 4JGBA 1N32B 1QYVA 3W1WA 1EM6A 3TGLA 4XLZA 2VA2A 5KVCA 4KHPH 4BP3A 5A62A 2F64A 1C1DA 1PGJA 2ZJAA 2C4MA 4XQ9A 1CJVC 2V1XA 4UPVA 5NLLA 1THTA 4BPBA 1FU4A 2XYVA 4X97A 5K0BA 4X61A 3SKVA 1ML4A 3QPBA 4JC5A 1XKQA 3QOXA 2W9AA 4ZD6A 3EGVA 4IHJF 3F0TA 2QM3A 3L92A 2V54A 2HA0A 13PKA 2WFAA 3GZ4A 5B5SA 2ZXEA 3E2PA 4L74A 4B44A 4NYMQ 4BVHA 1XCLA 4NR0A 3AP2A 4UQPA 5JROA 1KDOA 3OY2A 4EYQA 3DS8A 3BH6A 4KNVA 4JI6B 1GZ7A 3IEVA 2UKDA 2CF5A 1VL5A 2ZKIA 3QU5A 3DOIA 1P6QA 2JVJA 4WXYB 5CA0F 2FJUA 1RC8A 2DFVA 4EVSA 3VU0A 3W5BA 5J23A 1JAZA 4KO2S 3W5IA 2WJHA 5K3FB 4HN4B 3G7SA 2BEJA 2QD3A 4AUEA 4JXKA 1T3SA 2QTZA 1W2HA 3NV7A 5AK5A 3A2NA 4ER7A 2E87A 4BNZA 4HTFB 1FBTA 2GSWA 1W47A 1JIKA 4RDHA 2Z4SA 3PS9A 1V8BA 3CVYA 1GN8A 2BKVA 2AX4A 4DANA 3KPJA 1X1RA 4M0CA 4XYBA 3I0ZA 4ZHSA 6NULA 3FZEA 2ZANA 5HNEA 1NJFA 4IJQA 4NQZA 4H1UA 4O1IA 1Z83A 1JT2A 1GPLA 2IKQA 3BXOA 1BXRB 4BO3A 4NBUA 3KXPA 3PDIA 3G85A 1RT9A 3OSPA 1EFRD 2OXRA 3FKQA 4LOHA 2A9QA 1G98A 3PQDA 3EWSA 2B99A 4I1YA 1JWLA 4BHTA 4OBEA 2FE1A 1NJGA 2G9ZA 5K8IA 3BA6A 3I1IA 5G4KB 1P4JA 1Z33A 3KZKA 4AF7A 1Z8HA 5F73A 3BK2A 2FSFA 2W0MA 4I6GA 3P94A 4ED3A 2XUIA 2P75A 3L2OB 1QH9A 4MV6A 1VYUA 5KG6A 4MR7B 4DHWA 3I1JA 3WGYA 2VJBA 2PZFA 4BTLA 2O7SA 3KR2A 4PRKA 1EZ4A 1RJPA 3EVFA 4Q9IA 3H7AA 1CS4C 5DJ5A 3CPJB 2Z2IA 5HGXA 1I5OA 2VPPA 3ASVA 4QDZA 4OMUA 1N9KA 5CAEA 4K0RA 1TLLA 1Z5WA 1XDSA 2EEPA 5SY4A 1QRRA 3AWDA 4RDXA 2PZGA 4LH7A 2V0GA 3E48A 5FIUA 3HO6A 3AG6A 2HNBA 5C8YF 1A77A 1KI3A 5JSFA 2Q5EA 4GKKH 4HTAA 4DKXA 4EGAA 2EQ5A 5IP7G 4CEJA 3TM5A 1DZ3A 2ZE7A 4HAWA 4TKZA 1Z56C 5HBGA 5AVVA 1E1MA 1N1GA 3E70C 3KZCA 5KNBD 2BFDA 2VSYA 2XB2A 4BVBA 3VNAA 3NGMA 2OVFA 4YWHA 4RM2A 4K9OA 3HCPA 4B7AA 2QE7D 4QPPA 4AJHA 1JA9A 3ADOA 3QVGB 5KTMA 3P9CA 4LJ4A 4WNCA 3TSZA 3QKTA 1CETA 4URVR 3GC6A 3LIIA 3AY3A 2OMEA 2IELA 5TPWA 1H1TA 4TZ0A 1IYZA 3IAUA 4Z4CA 4M7OA 4RH3A 1J20A 2W6IA 2IZ7A 3LV8A 5FUYA 5IDYA 5JPDA 1TL7C 2GN6A 1X19A 5CYOA 4B09A 3KQQA 2QAJA 1MT3A 3RJ9A 2AGQA 4NPHA 5BSKA 4TXLA 1HT2E 4MB6A 4D0NA 3RQSA 4DLBA 3UV7A 2NYRA 4DR4B 3UUEA 3OURA 2CFCA 3NHFA 5JNWA 3Q4GA 1X1AA 1K1QA 5LUBA 5ES4B 1HL7A 3R76A 2FWBA 2R82A 1X42A 3MOSA 4YDSA 3H1AA 4OLBA 4DCOA 3BSYA 1Z6XA 1N0VC 3IQGX 1G18A 2NV0A 1XOIA 1TWFA 1VE1A 2R4QA 4O4JB 3H6KA 3R7FA 3LPCA 1WX1A 2CDCA 2ID8A 2Z1MA 3GRYA 1I1HA 3LX4A 3PL1A 3MRTA 2Y0PA 4B8YA 3MTJA 2YCLA 2YOGA 2VTKA 1H3NA 1Z5GA 4Q4CA 3GAZA 2PKEA 3OZAA 2X9VA 3CJQA 3EZFA 1J9GA 5ECGC 1JYSA 1YIAA 1YBHA 2WJ4A 1ICIA 3WIOA 3TUIC 3ZYZA 1PAUA 2FR8C 2D1SA 5BWCA 4RCNA 3HFSA 5ICEA 1KO1A 3OZUA 4K6GA 3RB4A 4HZIA 3KJHA 3CIFA 4X8HA 2PQ0A 3HHPA 1RYBA 4EEQA 1U4SA 1XO1A 4EUFA 4QQ8A 3VPGA 3VPSA 1JL3A 3L4JA 4LXYA 3VNVA 4K7JA 1ZLXA 4UHCA 1U2PA 4OREX 3AF4A 1D07A 1IATA 3AX6A 3LQ4A 1TF5A 4KQMA 5IK2A 5YASA 4R0NA 3N2YA 3H2ZA 1X9IA 1D04A 1M1XB 4BP9A 3OE5A 3NI2A 5IAGA 2Q0XA 1X70A 1GOTA 4L4SA 3PHJA 3RS4A 1PS0A 4ARZB 4M53A 5C4GB 2YWGA 5E2IA 2W4QA 3G2QA 4KR0A 5A5DA 1U7ZA 3WWCA 4DR2B 1I5RA 1FNMA 3GLKA 1LRKA 3ICQB 1A8HA 3GFFA 1FNDA 4JENA 3I2YX 3MSXA 4DF3A 2W9CB 3DBLA 2X0JA 3BOSA 3KQTA 3ISVA 1L7XA 3DZ8A 4HD8A 4C4SA 4ZCIA 2XDQA 3UUFA 3BHIA 4CUKA 4BKQA 4CM8A 4ZEMA 1X14A 2HHHB 2WC1A 1KWKA 3T1YH 2KQUA 2PJUA 3CEJA 4F38A 4Y6GB 3GJXC 5I9TA 1JTFA 4PG8A 2I99A 2OZVA 4MUAA 2I4LA 4JJZA 3PXEA 1LDMA 1ZG3A 5H3CA 4BO6A 3AUFA 4PC2A 5T4FA 2N3ZA 1Q7TA 1WSAA 1SKYE 4CYMA 3JQPA 1DX9A 4AF8A 2VO1A 4WK6A 3ORYA 4U7CA 3D6JA 2QR3A 3VGPA 2QAGA 1N5IA 5K8JB 1UPAA 2A7QA 4GIBA 4NATA 1CB0A 1DQNA 3TTXA 3Q7EA 2CJXA 1FMCA 4C1BA 4HAZA 5ES3A 5CB4F 4H2DA 4CMKA 5I4KA 3DDCA 4MI6A 4AYBE 4L9SA 5GV8A 5I7VA 4PM4A 4DRZA 4S1VA 5EZ5A 3HWRA 4GOKA 2AWOA 1IL0A 1E6CA 5FR9A 4NZZA 2J3IA 4OX9B 4BBRG 2XDWA 4O1MA 5KSPA 4PWQA 2G17A 4TKUB 3DQZA 3L82B 5C3EG 4BX8A 4DLNA 4OL0A 3PC6A 3Q7QA 4IHQA 4CGZA 3M6FA 5JH7F 3DMTA 2FPPA 1NBME 1G5TA 2AMFA 5LXTB 1ET0A 4BNHA 4R84A 1P16A 4ER6A 1SWWA 3KZ1E 3WWIA 4AP5A 2BIFA 4OQ4A 4Q19A 1TKAA 3GAAA 3GYGA 2CSUA 4YXWA 1G7RA 3GJYA 2QVZX 3EUEA 3BWMA 4EFEA 4F2WA 3X44A 5ECYA 1YQ9A 3KVOA 4PAQA 1TA4A 1VKRA 3JU3A 2AFIA 1E2EA 1UFRA 3U7RA 1JSXA 3BA1A 4IG9A 8ABPA 5A9SB 2NZYA 2DB3A 2R25B 4WADA 3O7MA 5ALDA 3EE6A 1XMOH 4BQNA 3WGIA 2QGFA 1SBIA 3GWZA 4OJQA 4JJIA 3OTIA 5CUQA 1P2FA 3I6QA 3LTNC 2YCHA 4PC6A 2FSVC 2ZE5A 2Q9BA 3VZPA 3FLBA 4N3BA 1B93A 1B73A 4C5CA 4OHPA 1ZAYA 4R9UC 3R75A 1NZFA 3CW2A 4DV3H 3VC2A 4DSUA 3ACCA 3HVJA 4A0HA 1U9YA 2ZJBA 721PA 4WNIA 3A3NA 3ETNA 2C42A 2IGTA 1M7GA 4HWSA 7GPBA 1U7OA 3F6EX 1JHMA 5BPHA 3UIEA 1OROA 5L3VA 1R15A 5JAOA 4IXTA 2MCFA 3ZWXA 4PRYA 4ED2A 3MD9A 1ZH6A 4JL5A 4N4AA 2ZWMA 3TIGA 4EHKA 1R0SA 1UF9A 2CLKB 5JS2A 3CNHA 5J3JA 5FWNA 3RU7A 5DTMA 4FJ2A 1FUYB 4DJAA 2IPMA 5DLYA 4ONEA 4KH0A 2AVDA 5B1YA 3VU9B 3Q1KA 5CDHA 2NU6B 2JFWA 3EXIA 3H4BA 4IO0A 1WB6A 1O57A 4C5BA 2B4AA 2N75A 5E2BA 2FLWA 4A6PA 1DZIA 4GX2A 3GIDA 3PICA 5BWRA 4I55A 1JIJA 4K5QA 4P2BA 3G9QA 4D44A 1QTQA 1YZGA 4ZARA 3IDFA 1NFQA 4CNBA 2HVQA 1DARA 4ZZ3A 5BUZA 3EAGA 2PQ6A 5CMLA 1EIZA 4IDOA 3EGWA 2YMPA 3X1MA 4OSPA 3FPEA 5AT1A 2HHFA 4TLLB 2QL5A 4DBVO 4QYSA 4HVLA 1CS0A 4F4YA 4ED7A 1WD5A 2GXUA 5ULLA 1DWPA 3UMBA 1A2KC 1MO3A 1OBDA 3ZWMA 3HVRA 2APJA 4PQRA 1MJNA 5CD9A 4CQNA 5JRZA 2P2NA 1PYOA 4NRDA 3MMNA 3D7SA 4YV0A 1NXPA 4RAZA 3CPEA 3G0DA 2QSZA 2O8CA 4IIFA 3VJKA 1XDDA 1U8FO 3PO3G 4GR4A 1IBLH 1TQ6A 3QHPA 4E4YA 3F78A 4O2RA 1WRVA 2SCUB 1NVAA 2I33A 1KU0A 3IH5A 4R4JA 2I1VB 1NFRA 2ZGIA 4HWPA 2Y05A 4Z4GA 3D1VA 3L0YA 2JI7A 1NONA 3TQIA 3LMKA 5REQA 4KJXA 1P2GA 2D5LA 2JIZA 4OLHA 2NUAA 2EBFX 2HF7A 3Q6MA 5F4BA 4EABA 4R8UB 1WVIA 2DP4E 3PFIA 5KTSA 4AO6A 4DL2A 3AF3A 4RV9A 2YBDA 1K98A 4EAQA 4RPIA 3GUVA 5KWSA 4ZQGA 2X1VA 1NV8A 2Q1UA 3QHAA 1ZUWA 1FYXA 3PDCA 1YDGA 1XMQH 2F7SA 4RHTA 4H16A 2G7MC 4QGBA 5CIWA 1UNNC 2PMFA 3ITKA 2VUHB 3M9XA 3RYFB 2H4JA 4BGEA 2IEZA 2PYZA 2CXPA 2QTCA 5K01A 1W48A 4Z8XA 3ZYCA 3HN2A 2I7XA 4Y2RA 2H18A 3SGIA 2OO5C 4EFKA 3KV3O 4PLVA 1JQ3A 1SPBS 1HDCA 2GFHA 5TNXA 4ZQFA 3DFUA 3TZLA 4GZ5A 1ADBA 4D8XA 4KUGA 3SR0A 4LYFA 4NBWA 3CZRA 4CBVA 3RSLA 4B4DA 4Y2TA 4F8EA 2H1RA 4RIIA 4ECWA 5EIAA 1RC0A 1U3FA 3UPUA 2OV6A 2DWUA 5KT5A 3UOAB 4KPEC 2IL1A 3SSOA 4JYCA 1TIKA 3P9RA 2XNDA 4KVFA 3K6SB 4DHEA 3KT8A 3THXB 3IUJA 3E15A 2C0QA 3A9TA 3F5MA 2BPOA 1NZJA 3OQ6A 3KKQA 3WP1B 3RYIB 2GLTA 2QMOA 4PXAA 4Q15A 3N0RA 4Y8VA 3NDBB 2VHYA 3H0CA 3LT2A 2NN3C 5FUBA 7YASA 4DREA 3LNCA 4RMJA 2Y4RA 4KN8A 3DJYA 3DP9A 2OCPA 4QVGA 2C4VA 4TTPA 1I3LA 3KTDA 4AYXA 2IFTA 1Z07A 3M4NA 1VFNA 1D2GA 5F7JA 3ZWDA 1DRWA 1GGKA 3R5TA 4LF9B 3SR4A 3VZRA 3OEEA 4E07A 5DTQA 5FA5A 1EP2B 3CZ4A 1K63A 3MWFA 2IOFK 1X13A 2XODA 3U37A 4BY9E 5KNDD 5BWMA 1GPH1 2GWHA 5EXEA 3WYNA 3GEDA 3AUKA 1QCCA 1OZFA 4XYLB 2RCYA 3OY7A 2FLNA 1CB7A 1LW7A 4MHTA 2JIDA 2GZ3A 1U90A 4NCIA 2NZVG 4DJ5X 4RA6B 3BIXA 3ZWAA 3DE0X 4LY6A 1OFGA 1M2GA 1PHPA 3KKOA 4KSYA 2B6NA 3V9AA 1VJCA 3JV7A 4GMKA 1H2XA 4QYIA 3C6BA 2IOYA 1WXDA 4ZICA 3V7UA 4OA8A 3CR3C 3C1UA 3K16A 1HE1C 2W2OA 2OWOA 3RBXA 2XGJA 1YSCA 4JNKA 1E7MA 1USVA 4GQBA 4BFCA 3OETA 4OBBA 3RSGA 3AGPA 3W34A 1CY1A 2I6GA 3A06A 2A0FA 3H5RA 1D9ZA 1X1CA 2EG5A 2JHGA 2HLDD 2QJRA 2RHMA 1AK9A 3RVKA 1J5EH 1LDBA 1F3LA 1GLGA 1HNXB 4YP9A 5TQVA 5FLXW 5AHWA 2BQUA 1PG5A 4X94A 2ZJYA 1VYTA 5BNZA 4PNHA 3SM3A 3CJRA 3P52A 2XSZA 3QPCA 3ZE0B 3L1IA 2B8EA 5DNWA 4Q4AB 3HC7A 1BN6A 5KQGA 1T6YA 4ZAZA 3PD7A 5JRJA 4PSCA 4PYOA 1E59A 1SZJG 3L1HA 1MG0A 3VKFA 4K6KA 1FRNA 4QXPA 1SA0B 1KO7A 3FIUA 2ZBPA 4NTZA 2JHCA 1UAAA 4YHBA 2W9BA 1PWHA 4OQFA 1OA1A 3DTGA 1EUDA 2BL4A 1XXHA 4GR9A 2WUVA 5A9TA 1C9NA 3TD2A 2V4UA 3M1AA 1ZETA 1IY9A 4U8HA 2MYTA 4E1VA 4TTSA 3T9FA 3CVUA 1BZYA 2VJKA 2G1PA 2VP6A 5JXIA 1QVWA 2EJWA 1FLVA 1GPAA 2QI9F 4W1QA 3M6AA 2REBA 4YJFA 5FD6A 4G5HA 5E4YA 4YRBA 3B3QA 2WIFA 2GUWA 1XNQB 3ESZA 3L41A 4FJ0A 1WMSA 2D0PB 1BMFA 2I55A 5G0TA 1M2KA 2RGEA 1AN7A 1CY6A 4DMFA 5DSTA 4L4UA 3QXGA 4V39A 1L4NA 4B6OA 1NHGA 1EFUA 1GQOA 4CT4B 5TMEA 1GWNA 3FF1A 4X6UA 4PS1A 4MZXA 3OTGA 2C61A 4G0XA 4TUYB 4Z8YA 3EGEA 4MQEA 2X22A 4YMWA 1KP9A 5SZIA 3DHVA 2XE4A 2EJ3A 3LUDA 4MWSA 1JWBB 4QJIA 2IOQA 3PD1A 2X0DA 3ZUGA 3KSDO 1QCDA 4ZOLF 2R6R1 2ZVQX 4UBOA 2KBEA 5E1MA 1FDRA 3VM6A 4ZK6A 4CVNA 2XUQA 4URHA 3K3VA 4DL5A 4P2GA 4ZDIA 3VYUB 3HM2A 2QY9A 3LDAA 3DDZX 3KKZA 1EDBA 1CWUA 2B4KA 4LVNA 1AB6A 1YD7A 4IDQA 5EE3A 3T1HB 1QGOA 2BGTA 3VUFA 3PUKA 2OD7A 3FUWA 5EEGA 5KAMA 1J42A 5T4BA 4NFSA 2E5FA 3AKYA 1EQUA 3KSBC 4KUEA 2XOKD 4ZI3A 1M2WA 4GOJA 2IH5A 1T26A 2I4MA 4D4MA 2G72A 3AYZB 4CKEA 3HUUA 3VISA 4O3QA 3DTVB 4DR7H 1F12A 4FZ5A 1XUOA 1Z2NX 1XEXB 4JP2A 4E09A 2CHUA 1RPZA 3V8RA 4M1YA 4HX2A 3MTQA 4JQZA 4UCFA 1NRJB 1JMVA 1O7JA 3QQ5A 2WD9A 2YICA 4C4PA 2W6OA 4MTLA 3LA8A 2C97A 1TWHA 1GFIA 3LQYA 1HDOA 4QBHA 3EVBA 1HDEA 4B32A 3AERB 4LW8A 2AXEA 3AR2A 2M6KA 4PZ0A 1L1QA 3UTCA 4CT0A 3KP1A 2M6RA 1NP6A 4C6HA 4LBVA 1MJGM 4BQIA 4UUNA 3AEXA 1XAJA 2O8BB 2YMLA 4O7VA 3K0EA 2XB4A 2FW9A 3AEQA 2WJPA 3ITEA 2C03A 1N34H 1ONBA 4JYAB 4Q3AA 1CQJA 4BRUA 3TRDA 4ME6A 1I6WA 4UVEA 5B2ZA 3RBEA 3MT0A 3KELA 4B80A 3ZGOA 4P08A 5K0LA 4Q03A 1NATA 4RHXA 2WABA 2I9PA 3NDIA 1VXRA 1R1DA 4QFCA 2UXDH 3T9EA 1Y34E 2HSDA 1QIKA 1R7RA 2FWIA 2VSNA 1OIWA 3MTAA 4NESA 1CR2A 3EHDA 2FZVA 3GRUA 2GTHA 4P9NA 3JWEA 3MR3A 4M9RA 2I7VA 1NF9A 1RCTE 2G6TA 2J6CA 3IQEA 2VQ6A 3AVVA 2JI9A 1CY2A 1EVJA 3OSUA 1UQRA 1ND6A 1NQXA 2FW0A 3I04M 2JA8G 2HSZA 5DYIA 3I6ZA 2FW1A 2GLXA 2ISSD 3RFCA 5I5TA 4F8JA 3WADA 3PW5A 3FGNA 4LC9A 2EP5A 5I4IA 1EFRA 3AR9A 5AVTA 2R3SA 4TM7A 1KK3A 3GNQA 4NC9A 3ZV3A 3TX2A 4O4LF 3EBLA 1Q2XA 1QYDA 4RCYA 2GN1A 3L6BA 2P35A 2C2WA 2VUIB 3HZZA 3R44A 1RXYA 5EWFA 3FW1A 3BMQB 4HLUA 1AGNA 5G0WA 4I2NA 4YR3A 4ZU1X 1B6RA 5EMKA 1WHTB 2P6UA 1QR2A 3OHSX 4UHBA 4R1QA 3ZR4B 1DGSA 3PR4A 1DCKA 1JT9A 4LHYA 1VOTA 2OGUA 4EYKA 3EYYA 5L1JA 5KX5B 3WKCA 2QIPA 1CHDA 1PD1A 1TT5A 5WRFA 1KDVA 1KI9A 2FMFA 4IVQA 1UBRS 3LTEA 3R6GA 4TVOA 4UXIA 1NNSA 3EIFA 4B6SA 1NJ8A 4Q47A 3G5UA 4U63A 2D4HA 1PFVA 1VPLA 1JI3A 5KPJA 3LQRA 4CG1A 4J9SA 1WP4A 5GJVC 5HFNA 5PGMA 4B85A 1FYDA 1YDEA 3OOSA 1S10A 4U2DA 4CM9A 3HXQA 4H77A 4KQ2A 2NVWA 4X7BA 5KNBA 2O4UX 3GIQA 2I1QA 4PC3A 3AF5A 4YBZA 2QE7A 2JCXA 4TXMA 2CWWA 5DB4A 2JA1A 2DQYA 2J1LA 3HRKA 3RGXA 4DIUA 3QEMA 5ALIA 2HQRA 1AHPA 4RZIA 2FPMA 2DR2A 1ZSNA 4RMGA 1N5LA 1LK5A 3WC4A 2DPGA 4O7ZA 5EXDA 1P1KA 4C6SA 4E2XA 4LYAA 1L7BA 2D7JA 3A27A 5LWQA 5AVWA 2VPYA 2IXBA 2WVHA 3N7TA 3NO4A 4EBFA 4LGVA 1WHSA 5FLXA 4KPUB 3C5VA 2LGJA 2DLCX 3ZU2A 4L27A 1AV6A 1MJHA 2QRVB 1L5RA 2DU8A 1Y6FA 2GJ9A 1LRLA 2C2DA 3Q11A 4QUJA 3GV7B 4BWVA 2PX8A 4A36A 4AMYA 2Z2XA 1MDFA 3P96A 4KRXA 2VHQA 5JBNA 4C76A 1S02A 4K28A 4D6YA 5JVDA 3H9GA 2OD9A 4G07A 4GPZA 5ESXA 1OH8A 3GNLA 1QRTA 2J5QA 1M2NA 4KKXB 4XGQA 2W98A 3THSA 1XHEA 1O9HA 1ZINA 4QVIA 3NTXA 3AR3A 2R2AA 3CX4A 2C2HA 4FS3A 3W4IA 1ECLA 1FX1A 3KQMA 1S0MA 4MYUA 4J2OA 2ODEA 4QBGB 4YUWA 3WP0A 3DTFA 2DZDA 1HT1E 4ZMBA 2AUNA 1W6RA 1JUDA 2VF5X 4UMVA 3N2EA 3EIUA 2B1QA 2CBXA 1WPXA 1WCMA 2PSSA 4GZMA 4RWZA 4RYDA 3HTXA 4RTKA 4DEYA 3S28A 3RBZA 3FTEA 3R74A 3U1BA 3KKKA 4CMBA 1ETHA 4OMDA 1FFXA 2WJ3A 5I60A 4JC0A 4DLKA 3P4XA 4OM7A 3TTTA 2YN0A 4C14A 5I8PA 1Y14B 1MENA 2CVOA 2N47A 4EFBA 2JA7G 3O83A 4OHFA 1YBVA 3L6RA 1Z47A 4PO1A 4R8RA 1PR6A 5ALTA 3KB6A 3GO4A 1K2WA 3SF8A 3TJMA 4OFZA 4UBJA 3ZCTA 4M0LA 1TEHA 4YYZA 1BHSA 2A6PA 4DA6A 1CP3A 3GP3A 1V1JA 3W8RA 3O4VA 1NVFA 5KKCA 3JAWB 2CLCX 1Q21A 2OYRA 4H4DA 4TVIA 2VZ9A 2FP4B 3HA2A 1SD5A 4ZK2A 3T5CA 1PNQA 3G7UA 3OJFA 3HXKA 2GNOA 2JLWA 3F2VA 3S99A 3O8OA 3MMXA 2YWBA 2JI8A 3GARA 3WFIA 3CCFA 3A32A 4FHDA 2G1AA 4NAUA 3QJYA 4JCCA 1P39A 2BUCA 4TN1A 4TMTA 1HNWB 5ALSA 5EP2A 3I2GA 2NXNA 4FT4A 1PYGA 1MO6A 2QTFA 3CLTD 4I50F 1MV8A 4W99A 3P2MA 1BE1A 1AD2A 4O2AB 2W9XA 4B7XA 3NXKA 4JBLA 2G5GX 3VO9A 4PLFA 5LOVF 1DJQA 1P91A 2IYQA 1IBMB 2CLEB 3PPWA 5JAPA 1IMJA 3PHHA 3X1DA 3I34X 4B87A 4ZHQF 4AD8A 2GJSA 5HDQA 4KWIA 2IVZA 4ED6A 1E2LA 1NMSA 2V9WA 1PFYA 3EFHA 2QR5A 3CRNA 2PSHA 4J8PA 2XCAA 4L3VA 3D0OA 2Z30A 3ANTA 2Z5FA 3TY5A 1XDBA 4B4UA 5BN3A 3LFTA 3AESA 4HLDA 3KBBA 3EF1A 4LY9A 2XMSA 1ZJ4A 5KNBH 4M0KA 3WKEA 4BO4A 1S6YA 2ZXUA 2IHNA 4NV0A 4ZTZB 4RMHA 4N39A 4UM9B 4GSYA 4GP7A 4NIMA 4AZ3A 3ZGXA 1RIFA 4FQ7A 1F2TA 1RCFA 1KERA 4TVBA 2DUWA 4CQLB 2WIAA 2H8KA 3DKKA 2E1PA 1OI2A 4OHWA 1CPYA 3WAJA 5FBZA 2C20A 4M0DA 2PZ8A 1SUSA 1N2CE 4E30A 2DBVO 4Z3DA 5BRNA 3BZBA 2GPBA 2B0JA 4YPFA 2WM3A 4J7AA 2UUPA 3OX1A 5J43A 2QTAA 2JGJA 3EWIA 3ROPA 3L4KA 2XUOA 1JLRA 1CTQA 3MGAA 1JEDA 3NC4A 3BXXA 1GCOA 1MW9X 3COVA 4E14A 3BSFA 1C7RA 3JQQA 4ISCA 4Q1VA 2XCIA 3EMKA 1F0PA 2VAMA 4YAJA 1J9ZA 3NM6B 1OASA 1S3SA 2Z3ZA 5ALHA 2CLSA 1OD6A 2ZFUA 2Y6VA 3RG8A 4HFJA 3EAQA 3N2GB 1A1SA 2YNMC 2H1WA 5JD5A 4TX1A 3RSHA 1GPUA 3QENA 2GPSA 3QBDA 3IXQA 4X20B 2IEYA 4X84A 3D4BA 2G25A 2I76A 4YRPA 4KGXA 3SQDA 4PZLA 3CG0A 8LDHA 4URXR 4P4SB 2OFWA 3B9RA 5FR1A 1P60A 2FA9A 2RI0A 2ZBVA 4CTJA 3RSQA 4N48A 1JS1X 2HDOA 4PCLA 2D6FA 1UBFA 3DE7X 1JQBA 3ONEA 2Q5FA 4I7EA 5ED4A 3PHCA 4TTAA 2J0QA 1NQVA 2JAPA 2VYQA 3EDMA 1XPJA 1UP6A 4FYMA 1V4NA 4DCPA 1SPXA 4LGMA 3UV6A 1CY0A 1FW8A 1E4GT 1ISJA 5I8ZA 3JVEA 3GHHA 2QUIA 4PQYA 1BJRE 1H0KA 2BFMA 4XWOA 2BGGA 1XQ9A 1NDUA 3UB4A 4NEHB 1Y5NA 4IP0A 3C24A 4TQUS 5LLSA 5CDYA 3SHOA 4G36A 4JVLA 1XCMA 2P9QA 3ED1A 1Y3DE 5DGAA 1B3BA 3A37A 1P5ZB 2J41A 5THKA 1PLLA 3BEDA 2LDBA 1U6IA 3GHYA 4EG7A 1II0A 1MOSA 2ZIFA 1PJLA 3GJ5A 3MB8A 1G8YA 2G09A 1PJ8A 5G1PA 4HQOA 4QKQA 3U4DA 1LLQA 2ZT7A 4KXQA 3PVCA 5M34A 3V97A 4TMYA 4DCUA 1VCOA 2CE7A 1MABA 3QPDA 3PW4A 1AKMA 4IIVA 3PZRA 1VL2A 1ZNYA 3CF4A 1HNZH 1E1CA 3HEBA 3LECA 4PEVA 1J8MF 4PSVA 4GC9A 3SICE 2IP2A 3SBXA 4WY2A 4CMEC 3D8RA 4JA2A 4Q3EA 2ZR7A 1NBIA 4UCXA 5DP1A 3BABA 4X3PA 3ND8A 4YCCA 3T7AA 3QE4A 2HW8A 1SUCA 5FBVB 2H1OA 4BDTA 2DTXA 3L6DA 1XVUA 2AOWA 1JVBA 4G8JA 1TYEB 1U8CB 2DLNA 2RGAA 2X0RA 2QN7A 4JP1A 4DMMA 2A9PA 5HFJA 1SG0A 4LJKA 3N2IA 4G5FA 4S1NA 3U9LA 1R0CA 2X7HA 1DHRA 4CDRA 3BQ2A 2GEDA 1K6XA 5BUSA 1O94D 2D8AA 1EUQA 4YCAA 4XR9A 4RVUA 1TADA 2GF2A 4XTCS 1P1RA 3WL7A 4MLDA 1AO3A 1FVIA 3IV9A 3VSEA 3KSRA 1ZGGA 5JS8A 2J4FA 5LMCA 1MXFA 1R4ZA 1TQDA 5IUNC 2XCUA 2IMWP 5J2TB 421PA 5JJIA 4P80A 3G59A 5KFDA 1CIVA 1NYTA 2NYVA 4RZXA 5P8WA 4BVLA 1ATZA 3WY9A 4IVPA 1UZNA 4KODA 5A4DA 2G5TA 1ZVJA 2A9OA 3LUKA 2C4TA 1UMKA 3EPGA 3UC5A 4XVUA 1UMDB 2QUHA 1UJBA 4E5MA 2R6JA 1JQEA 2E5LH 3IPRA 1P4AA 1WB5A 4D4KA 1ZNWA 5FPTA 4X1OA 3U4QB 4UTPA 3TL3A 2V58A 2AN4A 1GHTA 1Y3FE 3DWGA 4IFIA 4Z9BA 4JJKA 5ENVA 1K7SN 4R7ZA 4O3OA 3WTBA 4RJKA 3HHEA 3T3HA 2FFQA 1YR2A 3L7NA 2BEWB 5HQJA 5D86A 4RUKA 4MVXA 2J3DA 3KJNA 2ZAMA 4YIKA 3GJQA 3HBMA 1GTVA 1H05A 5KNDA 3VSDA 2H1FA 4LHXA 1GU7A 1E6UA 3EH2A 5ERYA 5AVRA 1O9BA 1P9LA 1SVMA 3G8DA 5KG5A 4DUYB 3M2PA 4P4LA 4QPJC 5EEHA 5LMNB 3GLHA 5DMHA 3UJBA 3OQMA 4N82A 3MRVA 3UEOA 6PFKA 2C92A 5DNUA 1OLXB 2ZB2A 4M86A 4INAA 3HV2A 1GTSA 2VPXA 4CM9D 4HV4A 1KZ6A 2X19A 2QNIA 3B78A 4QYXA 2OLEA 1QS0A 4ID3A 2HLDA 4MW2A 2Y92A 2EZ9A 3IGFA 3PNVA 3TGWA 1JDSA 1E6MA 2A14A 3BJZA 4J16A 3FNQA 3P7MA 4HAOA 2ODAA 2P6MA 3CSDA 5FJJA 3Q8RB 1PTJC 2VJAA 3QV2A 4OLAA 4FC6A 2EARA 3A6GA 3BKWA 4XUDA 3GPLA 4BDSA 3ZI0A 4QOJA 2X86A 4DR6B 2WNSA 2IHKA 2WP0A 1NXOA 2JZCA 3F1LA 4B84A 4XX1A 1ND5A 4OQLA 4YB8A 1JR6A 3QVLA 1QHGA 3RUPA 1H2AS 1N6KA 4BNTA 4B74A 4BKOA 4LTNA 2BRUA 3ZS9A 5JG7A 5JTTA 4Z9AA 1P72A 4J0CA 3AJ8A 4EH1A 4QJ3A 1N2JA 4B3SB 4O1HA 3SC4A 4CLOB 4EHNA 3RB6A 2ERCA 3C3BA 4BZQA 1OHHD 3KZVA 1E3SA 3L7CA 1O75A 4L6CA 3ZIAD 1S1MA 4P31A 3ZHRA 5B1EA 2HPHA 4OB6A 1TJ3A 3H04A 2BBSA 1VKHA 5HUQA 3NHSA 1T4CB 1HSZA 5JS1A 4WZAB 1S7GA 3QI2A 3RH0A 1O1YA 1DVRA 2IHYA 4ZT5A 4GPBA 2FK7A 1PR9A 4UNRA 2Q7DA 4JEHA 3VHXB 4JBGA 3T9CA 1ARZA 4E3ZA 3DZFA 3IODA 3KKMA 2A1HA 1T9ZA 3TOXA 5LSAA 2JKVA 1HQKA 3AM5A 4US0R 2RKBA 2WDZA 1OBOA 1YHYA 2A1TR 1G64A 3W79A 1NQ5A 1YA6A 2AR0A 2AR9A 5E38A 1G5QA 4NYMR 1GG2A 4RAQA 3ZCXA 2X3YA 3S2SA 4DXDA 4GLLA 4ND3A 2JLBA 4V0RA 2IV7A 4KDEA 3RRYA 1FPMA 4D42A 1V2HE 4G4JA 3FCEA 1E3QA 2HPVA 2P9JA 1VMAA 4LF5H 2ZJOA 2BN4A 2EP7A 3RAGA 3LKZA 4OHXA 1RRFA 2ZWVA 1M0EA 4ENUA 1J2TA 3WRYA 4RZHA 2WFMA 4R05A 2OP1A 3BXGA 3AK4A 1MXHA 4IFEA 5A5FA 1Z5ZA 1FFEA 3O8QA 5JANA 3NASA 2ZVPX 3F97A 2XOKA 2XJ9A 2N1BA 5I6DA 1SBNE 3WLOA 3WYGA 1WF6A 2K7ZA 4OAQA 1K83A