3KAJA

Apoenzyme structure of homoglutathione synthetase from glycine max in open conformation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
471
structure length
452
Chain Sequence
FDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNIYGDELRETLLKLQYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
molecule keywords Homoglutathione synthetase
total genus 155
structure length 452
sequence length 471
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kajA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kajA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kajA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kajA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kajA04
3VMMA 4YJ3F 5BPFA 4O82A 1KBLA 4MV7A 1GLVA 4I50F 1M6VA 3V4SA 2YL2A 3LP8A 1KUTA 4FFNA 3R5XA 4FGRA 3TINA 3TQTA 1VKZA 4EGQA 2PVPA 4O4HF 5JQWA 1GSHA 2SCUB 3G8CA 4DLKA 1EHIA 3Q2OA 4O4IF 2J9GA 4YAKB 4O7VA 4XYLB 5BPHA 1GSOA 3N8DA 3AW8A 2YRXA 4DIMA 1W93A 5JH7F 3I12A 1EYZA 1DIKA 3ORQA 3OUZA 2I8CA 2C00A 2R7LA 2YZLA 3HO8A 4MV3A 4YJ2F 2W6MA 4O7RA 4MV1A 1EUCB 2HGSA 4WBNF 4ZHQF 5C1OA 2V5AA 1KJ9A 2DLNA 2CNVA 2W6ZA 2W70A 5HV6A 2R86A 5JVDF 3HB9A 4MAMA 4C5CA 4C5BA 3R5HA 4ZQIA 4O7TA 5EZYF 2V59A 2WYOA 5J2TF 5KX5F 3VA7A 1M0WA 2DZDA 4MA5A 2YS6A 3GLKA 2ZDGA 3G8DA 4O4JF 1VBHA 2GPSA 2QF7A 5CAEB 3U55A 2R84A 3VPCA 4E4TA 1EZ1A 4FU0A 5KKNB 4ME6A 1W96A 2X0SA 3E5NA 1JDBB 1E4EA 1E4EB 5JQGF 3KAJA 1Z2NX 4YB8B 1Z2OX 3JZFA 3UFXB 4XZ3B 2YZNA 1KJ8A 2I80A 2YS7A 3MWDA 2YWVA 3N6RA 2NU9B 2R82A 3TIIA 1DV2A 4I55F 1I7LA 2VR1A 4FFLA 5DMXA 3ORRA 4NYEA 1T36A 2VPQA 2R7KA 4L1KA 4TUYF 5LOVF 1DV1A 4FFMA 4M9UA 1IOWA 4EG0A 5C8YF 3R5FA 4ZOLF 3GIDA 1JKJB 3VPBA 4YBZB 1VBGA 5D8DA 1GSAA 4I4TF 3JZIA 1AUVA 5HBRB 2GPWA 2W71A 2W6NA 2ZDHA 3JRXA 1KJJA 3NUAA 3R9RA 3OUUA 2GQRA 3MJFA 4XX0B 1PX2A 3VOTA 2PBZA 4MA0A 2FPGB 3KALA 2YZMA 2FPPB 3TIGA 2Z04A 4O7LA 3AX6A 5J2UF 1C30A 1I7NA 5IYZF 1B6RA 1CQIB 3TW6A 1KJIA 2R87A 3WNZA 3U54A 1CE8A 1B6SA 5CB4F 2QK4A 1JDEA 4O81A 2GLTA 3HBLA 2NU8B 3RFCA 2P0AA 1BXRA 4HNTA 4MV4A 5BMVF 2VQDA 2V58A 4HR7A 2Z02A 2W6QA 1WR2A 4O7NA 4ZI7F 4IHJF 5LXTF 1A48A 2NU6B 2R7MA 3ETJA 3DF7A 3K5HA 3K3PA 1OBDA 4FFRA 4O4LF 4O2AF 1M0TA 2DWCA 2XD4A 2FP4B 3R23A 5FNVF 1CS0A 2HJWA 4FFPA 2GQSA 4XYMB 1OBGA 4Y8VB 4TV9F 2I87A 3BG5A 3U9TA 2DIKA 3V4ZA 5JVLA 5LP6F 1A9XA 3RV3A 2YW2A 1KEEA 1CQJB 4O84A 3RV4A 2ZDQA 2PN1A 2CZGA 1ULZA 3U9SA 4HNVA 4MV6A 2W6OA 2IP4A 4FE2A 1C3OA 5CA0F 1AUXA 1PK8A 2FPIB 4YAJB 5C1PA 1KJQA 2CNQA 3MWEA 3JRWA 2XCLA 1JLLB 2FB9A 2W6PA 1Z2PX 2YRWA 3QFFA 4FFOA 5LA6F 4EGJA 5LYJF 2NUAB 5GONF 2R7NA 3ETHA 4HQ6A 3KAKA 2CNUA 2YYAA 3LWBA 3KREA 4O7YA 4O7WA 4O86A 4TV8F 3SE7A 5CA1F 4O7SA 4IZOA 4O2BF 4QSHA 4C5AA 1KC7A 4O83A 1IOVA 4IIJF 4RZQA 4HNUA 2OLSA 1GGOA 1BNCA 5H80A 2R85A 3Q1KA 3RUPA 2NU7B 1SCUB 3K5IA 4O7ZA 3WO0A 3WO1A 2YZGA 4MV9A 1EUDB 4MV8A
chains in the Genus database with same CATH superfamily
3F3YA 1V37A 1MC4A 3PEFA 4KWIA 3ZS9A 4B2IA 3RRNA 4JQOA 1ZQ9A 4LOJA 3EPLA 3ET4A 4C0JA 5IT9A 3SLKA 2BT4A 3TY5A 4GECA 1TWFA 1JAHA 1WKBA 2JEZA 2PX0A 2K7FA 2QVBA 4DUZH 4TS9A 5AM5A 3T3NA 4IFEA 1CT9A 1TT7A 1T0UA 1DCTA 1GSHA 3ENZA 2WDPA 3IVGA 4FXOA 3GP8A 4RQTA 1O3YA 1IHPA 4E1BA 1RXEA 3FMFA 4CDRA 3CKYA 1YRLA 3FRIA 1G98A 2XWPA 3O1HB 3VOBA 1O08A 1WB6A 2P3OA 1XUOA 3TE7A 1QHHB 4KOEC 3L9WA 3QUBA 4U0JA 5FCDA 2FFHA 4RU9A 4Z4CA 2I66A 5IMSA 5CCXA 5K0LA 2FSFA 4ID3A 3HVJA 4DR2B 1MORA 3HI6A 3BC1A 4UU0A 1GARA 1J9ZA 1YC2A 1GTRA 1R0CA 1M54A 1ZZEA 1NFQA 4C4AA 1QS0B 2YWDA 4GUAA 1RFGE 3EH2A 1OB2A 1EKVA 1X94A 2Z4SA 3RSSA 2X3UA 3WICA 5C9ZA 3KSZO 3PEYA 4JXUA 1WVMA 3JXEA 3O03A 1JH9A 1T8TA 3RGWS 1PS8A 1K9VF 2MOKA 4H31A 4B6PA 5J4LA 4L4SA 3PI7A 3WTBA 1U0FA 4UQLA 1CQZA 2UVRA 1SQ6A 4L6AA 3TRHA 1EFCA 4A2CA 3B13B 4IIJB 2XY4A 4EHHA 2M6RA 1RPJA 4IQFA 2R8RA 3SWWA 2H9IA 3HM9A 2O7SA 2I4MA 1GPNA 2WHQA 4LHVA 3LDGA 3IR5A 4RUKA 2WJZB 3MT7A 3JQAA 2HF2A 1ZEMA 3T1HB 2HO5A 3DLCA 4QM6A 1IOZA 5G0WA 4QUHA 3NEAA 4OUDB 3N2YA 4FSDA 4EHFA 5E9WA 1C2TA 2LGJA 3JALA 3H2JA 1UBCA 1YR8A 2ODBA 3MNFA 4L9AA 3R09A 4RHXA 5EP2A 3V4VB 1G4HA 4F4FA 3DDCA 721PA 3C3AA 2DQKA 4GOXA 4OYYA 5L6LB 5EIWA 5F5NA 1B8UA 4G89A 3PNKA 2F3UA 5I4BA 3ADDA 3H20A 2W6JD 3FFBA 2OESA 3QVKA 4TKVA 3IGFA 2OZLA 4HWTA 5F1PA 5AM2A 1OBFO 1USVA 4HNTA 5BMVA 4ED6A 3H9EO 2Q8QA 2HG8A 1NDUA 1UZMA 4CLDA 3VPAA 4MW0A 2HXSA 5FV7A 3OZXA 2O14A 2XTJA 2QI9C 3MBKA 1V9CA 2J3EA 3F7TA 5EMHA 3Q8KA 3L04A 2JCBA 2Q6LA 4HYKA 2FPLA 2QYHA 3LVRE 5GGYA 5JDCA 2MYTA 5IKPA 4MV0A 3WBJA 3F6PA 4J7AA 2DVMA 2HF7A 3SQLA 1R9TA 4MQEB 4UARA 4DEXA 4QPNA 2FQXA 3CF2A 2ZJBA 4PY2A 2Y1FA 4NENA 2BONA 2CL0X 2ZAMA 3H2KA 1EQ2A 3W4IA 3AKEA 2ZUVA 3VSCA 1C8LA 3C3EA 2VDQB 3U19A 4QICA 1RPZA 3RGZA 4C08A 1YB4A 1RXSA 5DTQA 1J1ZA 3I72A 1OH6A 3RANA 1E2QA 1V8BA 1XL1A 4PSDA 3ETHA 2CNUA 3GWGA 4WN9B 1HTBA 4RD0A 4MJ3A 2P5TB 3X1WA 5IFLA 3CWZA 2X8JB 3M49A 1PDVA 4KXXA 4LIPD 5F77A 4C22A 3WO0A 3W5BA 4BWFB 2W4MA 1V3QE 1RQLA 1WZCA 4P35A 2ANBA 4P3KA 1F38A 1WL8A 2DHEA 1QGED 2C42A 2QW0X 2ZETA 2JH9A 2ZKIA 2ZU0C 3H5NA 5CP8A 3PQDA 4CODB 2EU8A 1FLNA 2OXFA 2XDWA 5HIMA 4ZOBA 4LI0A 3N8NA 4Q00A 5KQPA 1EJ2A 1ZCZA 2BVNA 4AUKA 4ECWA 4QOSA 1FUKA 3CEJA 4GPD1 5AW9A 2Q3CA 3TBFA 3ZJYA 4DCOA 5LIRA 2IYSA 1E5LA 1QAMA 3FVTA 5D5HA 4C3ZA 1VECA 1WX1A 2XYRA 1O9BA 1Z29A 1NVUQ 3T7TA 4KYTA 3SJBA 4IMRA 4BKRA 2BEVB 4B45A 4EI8A 1JEJA 2CNVA 1GL7A 5D1OB 2RB4A 4M6WB 4B4UA 2JA5G 3PFKA 1Y4ZA 4UE2A 5J2TF 4O7TA 2EZTA 3MD0A 4KQGA 1LNZA 1J00A 3S5JA 2JHAA 5HP4A 4UKDA 4M8KA 2XLBA 1W9MA 2Z08A 3BWVA 3G9TA 3D1LA 3LQQA 2WF7A 3Q3CA 4W9RA 4N40A 3E1KA 5CH8A 2AGOA 4GOLD 3VDNB 3OTWA 2X40A 3DFUA 3OFND 3M6IA 2I8AA 1UQTA 4ABYA 1J7JA 1GT91 3DMFA 1OHHD 1T3TA 4IJQA 3IKJA 4GKJB 3GJRA 2GN4A 3BFXA 2COJA 2ZSEA 3RSHA 4PC1A 5KVVA 2D1SA 5JAMA 3I5UA 4NU6A 3QIVA 3B38A 4KLNA 2J0UA 3A70A 4KLCA 2SNIE 2Q21A 3O2NA 5AI8A 5F5LA 2WM3A 3UC5A 5IP5A 2BHSA 4LS3A 3DFZA 4AMVA 3TRIA 1N34H 2HCRA 3CRRA 2XKAA 4JC5A 1PLLA 1Z5PA 3L7DA 3U4IA 5CJPA 5E6UB 3U3OA 3E7WA 3FGPA 2NUTA 4PYKA 4BVBA 5E9AA 3WWIA 1JIKA 1RRMA 2OO7A 3KUKA 1DBRA 1NW9B 1FE8A 2PT9A 1IK6A 3HYSA 2X0FA 1FX0B 1YCGA 4XASA 2BKUA 3VSAA 5D5PA 5AM4A 3I1FA 5C46F 1CE8A 3L6EA 3CPEA 4R1PA 5EQFA 3WIVA 3GLSA 3TN7A 2WKWA 1PBTA 2TMDA 2XUAA 3BE5A 2PZAA 1AB5A 3BGVA 4KQKA 2D06A 6GPBA 5E1BA 2O0MA 4UCOA 4XVRA 2WD7B 1KI4A 5FTMA 3ESRA 2AOTA 4MUJA 1FMTA 4WBNB 3U4AA 1BHJA 2DGDA 1XKLA 2NYUA 1NI4B 3ITNA 3G0IA 3KTMA 1QH0A 2L0XA 3UTDA 3LYLA 3WLAA 3ZX4A 4C7JA 4EABA 3GA5A 3VR2D 1YE3A 5KNLA 2CYAA 1KARA 1NTOA 4JI8B 1V2GA 3RV3A 2GD0A 1PQPA 3KHRA 1Z6AA 4EJ0A 3J80W 4D42A 2B20A 2CHUA 4JI2B 2CV0A 3W8NA 2GHQA 4F06A 5EWJA 3C1AA 1EMDA 1U2DC 3GVHA 3PITA 5FPOA 2W2TA 1SHTX 3TKYA 1CJBA 3F9IA 4UQOA 4FS1A 2G5TA 2VZ8A 3CGGA 3GTMA 4ECVA 1BS2A 1IAQA 1ZINA 3CSSA 2DMRA 2DBVO 1SWVA 2O7QA 1KFEB 4F4WA 1ZU4A 3O7MA 2GBLC 3BK1A 3P2EA 4TKZA 2RGDA 1KT8A 1SZPA 1KU6A 4EPTA 2Y0DA 4WT7A 1WLYA 3OY2A 5FT9A 2B92A 1ZESA 2PL5A 4IGFA 3GFQA 3EF1A 3PD7A 4JUCA 2YZGA 1SCDA 3NFRA 2O8BB 4NICA 5BPFA 2R8ZA 4EYIB 3DMPA 3V3TA 5L7TA 3F6YA 2Z2IA 1Z18A 3O95A 4IFBA 4HUTA 4IIHA 5IKMA 3RFFA 1QNLA 2ATLA 1GGMA 2WF6A 4O1MA 3WI7A 3AVWA 3GIJA 4YPFA 1M75A 3KVRA 4JJIA 1WHSB 1G8AA 1FY2A 2WJWA 2IV3A 3QV1A 3ZE1B 3AERB 1OW3B 3O1JC 1TQ8A 2A0FA 2C77A 4G0YA 2XOXA 2E89A 3FKIG 3K73O 3QEAZ 4HWRA 2JFFA 4HBZA 4UC0A 3WIUA 5KWIA 3BWCA 1ECPA 1N1EA 3B48A 2P65A 3QHQA 1RAAA 4GS5A 1FVFA 5B7GA 4CF5A 1SQ5A 1PNRA 1HNXH 2R44A 2Q6VA 3FW1A 2Z9CA 3F7NA 2K6GA 5HKBA 2ZIEA 1IZ8A 2H1SA 4NMWA 3AJEA 4LA4A 2C94A 4XDYA 2VCEA 4UBLA 3H5TA 2B69A 1FDRA 4Y2VA 5ALNA 3ZWDA 4YAIA 2VUIB 1AE1A 3DD5A 3DBRB 1JSZA 3B9PA 1OBOA 4N3GA 5EINA 1PYDA 5J3JA 5IC4A 3T1HH 1Z12A 2GBIA 2HMUA 1O1YA 3A1CA 3NBZC 1PT6A 1YS7A 4MUFA 3VZPA 1D2EA 4EHIA 2E2HA 4PO1A 3PDJA 1JG3A 4P3OA 1C7RA 1MB2A 4R98A 5FORA 1SO8A 3GLHA 2XVYA 2W43A 1ZUNB 2JFHA 2PVSA 3LCJA 1T36A 1HL7A 4N7BA 4YAUA 4HMPA 3KEGA 2GLUA 4TTRA 3RAEC 3HDHA 3BH6A 3U09A 3RB4A 2BMWA 3AEQA 2H1VA 4TRRA 5G41A 1LSJA 3AF6A 4L5CA 5F7ZA 2BBOA 2JLCA 3R5JA 3TZCA 1TPYA 2ESRA 2HJSA 2VXCA 1RYRA 1CRWG 1GDHA 3OM9A 4XX0B 1RJDA 2J9YB 3IX7A 1GDDA 1UPXA 4BMCA 1AGNA 4D9IA 1B93A 2P3SA 1G6HA 5L9XA 3RVKA 1SHLA 5FL3A 4XIYA 3FMVA 2VDRB 1E0KA 2YZ7A 1YVRA 1SKMA 6CHYA 1E58A 4ED2A 3EE6A 4EG3A 1Z83A 2CZQA 2FCRA 2GAIA 2HRQA 2VJNA 5IP7G 1QCZA 2BI7A 3BHIA 3GAMA 4MZXA 4OH1A 3OT1A 3NVAA 3AVQA 1VJ1A 2IUSA 3FUTA 3ZY4A 2CJPA 3KXPA 4K9QA 1KK1A 1CQXA 2B0JA 4OV6B 1G17A 3B1XA 1XTTA 4UUPA 2H2DA 4JLMA 1AKUA 2B82A 3UAOA 4QKQA 2UVVA 1OBCA 1XNGA 5AHRA 4RIHA 2BR5A 3Q15C 5DTJA 1JX4A 1GQ2A 1ENOA 1QX3A 2A9FA 4IXTA 3PLRA 2IEYA 4EBEA 1A96A 1L7DA 4NJEA 4NESA 1L4HA 1OUMA 1UODA 3PHIA 1RJPA 3GQBB 3HWRA 2NPOA 3VHXB 3DE7X 1R0RE 3I1YA 5DM1A 5FKJA 2RGXA 1H23A 4G4SP 3UXEA 3VNQA 2AU0A 2G9VA 3O91A 3UAZA 4RSGA 2B25A 4Q3EA 4F86A 1Z2PX 5TQ0A 2J59A 3B89A 3MRVA 3VKHA 3EDOA 4GZ3A 5DH9A 1ZUHA 1UC4B 3KAKA 3UAWA 2K87A 1UM9B 2R7AA 2IXGA 3RKRA 1NDHA 5E1DA 4RVSA 3WWCA 5IJWA 3W5AA 4QQRA 3CHYA 1TCBA 4KJZA 4EYKA 3MJCA 3UC9A 3PTLA 1SCUA 2ZYIA 1WF3A 2Q27A 2GN8A 3G5LA 4HNGA 1PR0A 4PR0A 1OASA 3ZVKA 4RDCA 3S7TA 2OHXA 1NNSA 4EKGA 3C48A 4L8FA 5TQ2A 3T0IA 2Y68A 3TQQA 4QC2A 4Y6OA 1TK9A 3GNTA 2BMJA 2VRWA 4BLTA 1SU4A 3PGA1 2XVMA 4EGQA 1BFDA 2Z5VA 4CM4A 5JH7A 1CLEA 2AN9A 4NFYA 3DR5A 3SC6A 4DLKA 4ACAA 4W63A 3KT3A 3MTQA 4RETA 4HDNA 1W49A 1P2UA 2BKAA 4DIMA 2AG5A 4CV1A 2CMFA 4DR1H 3O4GA 5DCWA 3T5TA 4DLPA 2ZJ8A 3BVPA 3GILA 4O7RA 1J5PA 4LWZA 3RJ0A 3HDJA 4X94A 2CJYA 3ZBTA 1JKMA 4WXEA 1CDEA 4J2OA 1X1BA 2H4WA 3W2IA 5HYVA 4YRDA 1Q6YA 4TPKA 1VLMA 2AFHE 2OK7A 3MT8A 2WILA 3GBSA 3TCNA 4YP3A 4FCTA 4JI0H 4HUJA 1U28C 3G2MA 4N3CA 1O0CA 2GFHA 5KU7A 3BACA 1GP2A 5T8KC 2RGNA 3UYLA 1K97A 4ZU1X 3OAAA 4R69A 1OIXA 1RWBA 3LZCA 4HAZA 3VU8A 3BTSA 1CUEA 2PX3A 5IVHA 4JI5B 5A5EA 2ZJ0A 3O26A 3ETNA 2BEUB 3HGTA 1CF4A 5JLAA 4CKCB 1XCMA 1GPYA 2XZDA 1H4SA 5GJBA 2IXFA 2UVPA 3LO5A 5FJIA 5DSXA 4Z3DA 3CNBA 2COKA 3EJ6A 1KMHA 1LJ8A 1PJSA 2HHLA 4ITRC 1UMDB 3EW7A 3WL3A 1JS1X 3EEFA 3KHHA 3ND7A 4JYAB 1B4DA 4DS3A 3D43A 1I32A 3FAKA 1UXKA 3H9CA 4BU1A 3S81A 3RODA 2Q3FA 4I3HA 3EXFB 3WL6A 5IT0A 2V7PA 1XD2B 3GDHA 4O2BB 1G16A 1AKYA 1KI9A 3OU6A 3ORSA 4DGQA 5IASA 3MOIA 4YJFA 4RZXA 3PW5A 5LQSA 3OJLA 5A5VA 5ARDA 2V4UA 1O58A 4PAGA 1IHDA 2FOXA 2I1LA 2J3QA 3R3UA 4MR8B 2RGAA 3GROA 4PRYA 3WLOA 4HH1A 2FPXA 2OCLA 4C87A 1DAFA 4MB6A 2OVFA 1HG0A 4H16A 3TOXA 5FWNA 2W9CA 1IQRA 1MX3A 3L8EA 2A58A 5HQTA 5JS1A 2RJNA 2AG0A 1LDNA 4L5IA 1GKKA 5AKGA 4PCAA 1HEYA 2J4CA 4RA9B 3RTEA 5JSYA 2VNJA 1GFSA 1NQAO 2F9FA 1P0MA 3MMPA 3T5JA 5AR1A 3GEMA 3HO6A 4QG3A 1DCKA 3SN6A 4GM1A 2CZGA 2ROQA 1JZSA 3B5IA 3FKSD 1MLDA 4RF2A 5JMTA 3R3ZA 3S2GA 2H1OA 1CUWA 1LPOA 2P4EA 1DAHA 1RC8A 4OQFA 4JBWA 4EH1A 4E5MA 2P9FA 3JRWA 1I4TD 3UK6A 3PUJA 2ZUCA 4RIIA 4GM4A 3OSPA 5CCDA 1SD2A 5FTNA 1BYIA 2JIDA 1GCOA 3PTZA 1N92A 5HIIA 4NZYA 3ZKWA 2XA9A 2FU5C 4KQXA 4YI3A 5JLJA 4O83A 4RZQA 3ZGLA 4DW8A 4PANA 5LQMA 1DC4A 3GJ5A 5AJTA 1Y3CE 5AKXA 1EM6A 3PGKA 3OIDA 2L69A 1A9PA 4HRAA 1ORVA 4B3SB 4PWQA 2R8JA 1RC0A 4NBUA 5BNWA 4D8VA 4KXQA 1DOZA 4TL6A 1SYXB 1I4OA 5LQCA 2D1FA 2QR5A 3ZWQA 1KUTA 4JV5H 1ESEA 1JMYA 1W1UA 1XZAA 3NNSA 3Q8XB 2P9CA 2CB9A 3RU3A 3IVMA 4AO8A 5ES3A 3IR6A 1E79A 4PX9A 2G1JA 2QP4A 2R68A 4A0QA 3DCYA 4RJJA 1APBA 2DPMA 3RR2A 3HM2A 3ZDQA 2BP7B 1G8MA 4C7OA 5JCXA 5CDTA 3K32A 2C5FA 3WAJA 1Y3FE 4IZHA 3OI7A 4XSGA 2GR9A 3BICA 2R6FA 4YP9A 4NCJA 3U4HA 1P2FA 1TT5A 3KLOA 3OCJA 2QLMA 1N0HA 3KBBA 4J0DA 4S0ZA 4UUOA 4EYOA 1EFTA 1NQTA 2IHZA 4I6EA 2WPNA 3JWHA 3T95A 3L1IA 4EG4A 1OD6A 2Q49A 4Y1RB 5ENZA 3SBDA 4QBTA 5H3HA 2DHQA 1L7NA 1AGPA 1GCGA 4F5YA 4A6DA 3LCCA 1SA0A 4F5ZA 4MS4A 2FWPA 2W6CX 5IYCG 4EYHB 4ZT7A 1G8GA 1I3LA 2NV0A 3D7MA 3L02A 4K6MA 4LHXA 5E2BA 1KAHA 1T0JB 2E3JA 4NYMR 1RE1A 3QELA 1PFGA 2FWNA 1D1TA 2JFWA 3AIOA 3OC6A 4IR7A 4OHBA 4DRYA 2VPTA 3BERA 5K8VA 2ZVJA 4F6RB 5HPYB 5LLDA 1HX7A 2BUAA 3D4NA 1YB6A 3N8HA 1CF2O 4XWAA 4P32A 4D4GA 2CFOA 2E49A 1W4BA 5GPBA 3ZHYA 1K98A 2VH5R 4A15A 3SIRA 1HBJA 1TEVA 1VSUA 2A9RA 5EJ5A 1N5MA 2PBZA 1UT8A 4BJHB 2FUCA 1TFUA 2L19A 3HA5A 3MZ0A 4NBLA 1Q11A 3UGJA 3O31A 5IYZF 4RMJA 5C4XG 4NMLA 1JEYA 2PUWA 2JF0A 4I4IA 1QO0A 1C1DA 1OA0A 3RC3A 5SZHB 3UA3A 3EXG2 3N05A 1DFHA 2J07A 3ONDA 3QEKA 5T6MA 4C20A 5ADWA 3T61A 1KYQA 1P17A 2WICA 3ORFA 4D82A 1ZETA 1UC9A 3ETJA 1MFPA 3FETA 4G8CA 1AF4A 4M1ZA 3OQMA 1N4DA 3GAFA 3CNEA 1CS0A 4RK5A 1P0PA 4IXNA 4XYMB 2H7XA 4WK6A 3D8HA 2C61A 1CEEA 2C2KA 4REQB 3DLPX 4ZI7B 5C34B 5D1PA 2FMUA 1NC1A 3TFQA 4MV6A 1ZY2A 3OPVA 2ZYSA 3PNSA 3U81A 4EG5A 2HUNA 3DJYA 1Y14B 1YAHA 2GTPA 3QKRB 4WZZA 5A05A 3VR6D 4R7ZA 4BE7B 2AC4A 2G1UA 5JWRA 1UFQA 4ZU6X 3GEDA 1KZHA 3ZCQA 3A6PC 1LX6A 4I8XA 1Y4UA 2CW7A 1BG6A 1IEXA 2X1MA 3MMSA 1R8SA 1D2CA 2ONKA 3Q7TA 2HCBA 3SOZA 3TLYA 4OA8A 1ZJJA 3T3MB 6Q21A 3ZXIA 2PK3A 3SQXA 4BVFA 1XRLA 1CRQA 3D6MA 3ACDA 1ZBDA 4D6YA 4KH0A 421PA 5KWVA 5IHXA 2IXEA 4RDIA 4B2LA 2QNBA 3D1JA 3TLKA 5ICSA 2Y1XA 1DEKA 1IBSA 1T3SA 2MSKA 1KYVA 4OYHA 1BRTA 4DV7H 1QUFA 5DGHA 2EF0A 5NULA 3WDKA 5C53B 1J1UA 2OECA 5T4FA 3KB8A 1MOQA 2I2BA 3S44A 3DAGA 3A6HA 3PQ4A 2GVNA 1YVPA 1GYQA 2OB1A 4NL4H 4DREA 3QK7A 4A8JA 4ZAGA 3OZWA 1YDHA 3MWLA 4QHTA 4EO9A 2HK9A 2GYWA 4HG2A 4KBGA 3W7BA 3KJEA 3IVCA 6PFKA 5KFIA 1AXGA 2BCEA 2PL1A 2ABJA 3EH1A 1QXSA 2FRDC 3F9CA 4BJ1A 2HQBA 3REQB 3BZBA 3NAQA 3RLIA 1Q2UA 3MJEA 2AC2A 5DYYA 3T1YH 3V8NA 4KB5A 4EA8A 5C3EG 2HF9A 3OPXA 3PX7A 2ODAA 2VAVA 2AMJA 2P2CA 3VVBA 4OG2A 2V6IA 5JBQA 4FX2A 5A3RA 5IZ4A 2QRMA 1FSZA 1USWA 1SXIA 1N2XA 5AW0A 1IJEA 4KV9A 3GLKA 2VZEA 4GEGA 2XF8A 1BO6A 2LE0A 4FWBA 1AV7A 4GLLA 4U7HA 1NQXA 2IU3A 1N25A 2VI5A 2WB4A 5DGBA 2QN7A 3ZNNA 8LDHA 3NIDB 1N5DA 3PUKA 3IAS6 3WXBA 5JPDA 3MFHA 2WE8A 4UTRA 3BGOS 5BN1A 2HM7A 1OLXA 1RI3A 4F9FA 1RK5A 4AQYH 1U7WA 2R7ZA 3ORRA 1QRTA 2QYTA 1Z5GA 2IHKA 5FPPA 2EX0A 3SC4A 5ED4A 3KSDO 3SX2A 3HBAA 1WMSA 1TVKA 2GZHA 3L2PA 3NYWA 3M9XA 2LP4Y 3E3AA 4TS3A 3WQSB 1CTQA 5L4LA 1PJ8A 1NF2A 2DKFA 2P5SA 3C8HA 3CO5A 4I4NA 2IRWA 5DO9A 5CB4A 1JLHA 4O8CA 3FIUA 4TZKA 1P6UA 2HK7A 3V8PA 3A7DA 4YUXA 4PYIA 3T1YB 1TTHA 3GV8B 1WDTA 1M72A 3RKUA 2L82A 3R1IA 3WB9A 5BQXA 2PT6A 3TOSA 3I0ZA 5DAAA 4C6RA 3KETA 2QTNA 1UDWA 3Q3JB 2PWAA 3P5BA 4FYVA 2UVUA 1IBMH 3OMLA 4HN9A 1HO3A 4INAA 1P62B 1A9ZA 1Y7IA 1R6XA 4MWEA 4F3YA 4CKWA 1Z7GA 3ICQB 4FHEA 5LDDC 3JWGA 3M2TA 1ZAUA 3Q88A 4KW7A 4B6JA 4F92B 4OBEA 5FLEX 3K9BA 3NWPA 3AI2A 2BLLA 3TAXA 1LDBA 3KJHA 4EGSA 4WXPA 1W4ZA 4J6FA 5FAXA 1JLRA 5TC4A 3MB5A 2AZ4A 4XWTA 2WU0A 4MS3B 3QPBA 4MQEA 4KPUA 3GMDA 3W2FA 2UXDB 3LKVA 1ZI6A 4WLFA 2OV3A 5DLDA 1HDRA 2EBFX 1YS1X 2GCOA 1VL5A 5C5JA 4RVDA 3V2HA 1WSCA 3DUFB 4CEJA 4UCSA 2AZTA 4QXOA 3U7QB 1XHFA 1J8YF 3ER6A 4PLHA 2M6LA 2FRXA 1WCWA 1NBWB 3NHWA 1XEXA 2HEGA 3NBQA 3B8EA 3CEMA 5LA6B 3MPUA 3RQIA 2P3LA 2QMHA 4GYYA 2H18A 3LK7A 4MQBA 3NHAA 4J0EA 5ALZA 1XVUA 1F6DA 2OEPA 4YDRA 4EGCB 1Z62A 2XNJA 3OHBA 1BXGB 1E2GA 2VXOA 4QQFA 4QYSA 4DF3A 4DLXA 3DTVA 2WTMA 4F84A 3E3MA 4CN8A 1OZAA 4AJ4A 4QECA 5JCJA 2G9RA 2Y4RA 1Z0DA 5AUPB 3H0CA 1KOLA 3UUWA 5K0GA 3A0UA 3MT9A 3I2IA 4GGOA 3C3MA 4BECA 1ORIA 3AR8A 2CXSA 1D1PA 1A1SA 1PLKA 1QGDA 4RM2A 4DEVA 3IDSA 4I4CA 2BN4A 4BNXA 4HYTA 4ROTA 4L5YA 5G1PA 1W88B 4J9QA 2ZB2A 3DZBA 4KTVE 3FPFA 2W2QA 4D5EA 5GAJA 2CT8A 3E84A 1B3RA 1Y4SA 2QL5A 3QENA 5TF4A 1YF3A 2IFTA 3E6AA 5F12A 1JDVA 3ILVA 4R54A 5LKRA 2BYTA 2JW5A 4G1MB 4V02A 2VNSA 5D1OA 2YNMD 1S1MA 1TUBB 4I66A 3SXUA 1FTWA 3JSAA 3GLFE 3I37X 5JSZA 4O4LA 5HF8A 3VO9A 3QLEA 8AT1A 3UWOA 2GEJA 4AB1A 3D3QA 2FUKA 1O95D 3L4JA 4MA5A 3L7MA 3P2IA 3OTOB 4YDSA 1GNSA 3BKXA 4LF7B 5CGZA 4QTXA 1YVDA 1IZYA 2G36A 3RYTC 3AILA 2IS2A 4APMA 1JHRA 1U2TA 1C7FA 2QX9A 3WLFA 3TTVA 4DZRA 5CB0A 1DWUA 3F6RA 1IEQA 3DNFA 3PLNA 1P1FA 5D2CA 1TIBA 3MWDA 1G4AE 1QUEA 5EHGA 1BGXT 3SKXA 3FNBA 4D2IA 4DTIA 4F2PA 3ZVLA 1P7CA 5JQGA 1Z88A 4IEEA 2ZATA 2PRYA 5AI5A 2YWRA 1NV9A 4C4XA 1HL3A 3ABQB 2PWBA 2ZSHA 4MPRA 2XYPA 5H81A 4R1SA 1KQOA 2PO5A 3JZAA 3V42A 1OB5A 2O2SA 1DEAA 4FZJA 4MQ4A 1OF1A 3CLUC 2QZ4A 1GTMA 2J45A 4ZMRA 5IG2A 3FYUA 2RBKA 1JQKA 3QI7A 2Q2WA 2G6TA 4O0MA 5B2EA 2RHBA 3WLEA 5CCEA 5MGNA 3NBXX 3ZD6A 1WQ4A 3MQ2A 4QODA 2CJWB 5A0VA 4MAFA 3NP7A 3QV2A 3KKKA 4IW3B 2DB3A 2WB2A 4QO8A 1N9KA 4DL7A 1EGMB 3MC1A 2HDNB 4R5MA 1UT5A 2EQBA 4DV6B 1FFYA 1RP7A 1RE0A 3GDFA 3ABIA 3IQIX 3DE2X 3ND8A 3E1SA 1EFRA 1XRMA 1FQKA 5CA1A 2JH3A 5DGDA 1ZL0A 3IIKA 3KFVA 1SU8A 5IBRA 2Q4BA 3UT6A 2WKQA 4C4SA 1GN8A 2QAJA 1PR3A 3T3HA 1QFJA 1IUNA 2RGEA 2FKLA 2PE5A 5AOVA 1KIAA 3DZJA 3EIXA 3IDQA 4XPZA 3VBEA 4ZVNA 1NVBA 1S3SA 3QU4A 4H6XA 4IOJA 5T4EA 1B8PA 3VR4A 1X2EA 4MVCA 2ATIA 4MNTA 3OTHA 3KZOA 3T4UA 4X6LA 2OP0A 1L1EA 3NRJA 1SKUA 1POWA 3OG9A 2O0JA 5B1DA 3RBXA 5C1PA 1KJQA 1DX4A 1UXIA 5FUQA 1J0XO 3CRZA 4CMJA 1RPNA 1RADA 4D6PA 2P4UA 1YB5A 1MF7A 2OPBA 2POCA 1BCRB 1Z8HA 2YUTA 1WZIA 3CLUD 4HAVA 4JGBA 4LMBA 4OKNA 1DLJA 2VHUA 2VIIA 1XDSA 2D5LA 2HQOA 3R7SA 2W7PA 4FR2A 3GIWA 1KS2A 1M7HA 4A1FA 1YGPA 2ONZA 3MTBA 5IKXA 2V7BA 5A4KA 5JZSA 4GPAA 1J07A 3ZLBA 4XIJA 1Y34E 2YZLA 1RJFA 2H92A 2I54A 2XF2A 1KEUA 3NASA 4BLWA 1MO3A 1N78A 2O8BA 3T9DA 3Q85A 5EE9A 5KYUB 3W5DA 3JAMW 1UIRA 5ES4B 3AEUB 3EXIB 1TYZA 2DFKB 3JQAD 5KFFA 2YIVX 3PB3A 4E0BA 4F4DA 1W36D 2TSYB 3BWBA 4W5NA 2QRHA 3THXB 1OAAA 2SICE 2B8TA 3VNVA 7REQB 5H02A 2ZRGA 4AJ1A 2DQYA 1O94D 3IQXA 1L5SA 2W2LA 4FDLA 3KRTA 4IDHA 3U80A 2NUBA 2ZYWX 4DDVA 2IGBA 3CKKA 1ISPA 5BQFA 3IQGX 5FDFA 3ABZA 3FZYA 3K0AA 1AQLA 1SVNA 5DVZA 3SE0A 4C3VA 2W8BA 4ERNA 3QUTA 4HDOB 1L4LA 4MI1A 1W5EA 5REQA 1MD9A 5C81A 2JB9A 4ZQIA 4JI8H 1KIFA 4DV4H 2BELA 2B6NA 3G1WA 4MJLA 4KQ9A 1KQNA 4BGEA 1BEEA 3KB1A 1D5CA 1EFDN 4JI2H 2CLFB 2ASDA 1F6BA 2R79A 5GGXA 4RNMA 2EWMA 2RGWA 4GC5A 4OAOA 1PFWA 2R4QA 2EJWA 2ZWIA 5KNDA 4GWKA 1W5BA 5I8ZA 4F97A 1IZZA 3C45A 2FR1A 4A3CG 3R5TA 1NSFA 3EC7A 4Y6RA 3KYDB 2EBWA 3PDIB 1U2PA 1K7YA 2V7GA 2ZBQA 1HT3A 5EZ6B 3ZOZA 1DAEA 1RFLA 1JYSA 2VJKA 4L15A 3T41A 1K3UB 1JTFA 2DSNA 3KO8A 2NQ2C 4UTPA 3O83A 1V5EA 3ZDEA 1HDXA 1ZD5A 5KYVA 1G291 2JI6A 1OXMA 1F8XA 4FR0A 2X7XA 2OCAA 4MVJE 4R71A 4CXMA 5EJ6A 1M10A 4GVPA 1G8PA 2H4FA 4U5QA 4BNDB 3D2LA 1DMRA 2XT9A 2PXAA 1KE1A 5HIKA 4DL4A 1GV0A 2IBMA 1T8RA 3HRHA 4FLFA 5KS2A 1Q7GA 1WRVA 1QTNA 2EFHB 3A27A 3F8SA 3C24A 3KXYT 1Z6PA 2C54A 4JLJA 4M0DA 4AG6A 5CXUA 4N1AA 4DG8A 1PQUA 1JHMA 3NOOA 2QX8A 1PL0A 3R7WB 5JWOA 1T9GR 3K3VA 4H0NA 4OXQA 4CDGA 3EMVA 1DU4A 3E3OA 2C7RA 4BVLA 3K5WA 3L6CA 4JSYA 4BE4A 3V5NA 2JBAB 2K7ZA 1N0VC 2O3RA 2Y0EA 3PYXA 4ZO4A 4YXWD 1VB3A 3CWCA 5HE9A 1SBYA 2HMSA 3TDKA 1ONPA 1LD3A 4UTVA 1RRKA 3O8BA 4JI5H 1E1NA 2HWXA 2FP4A 3LCMA 5HJ5A 4R40A 4O4IB 4BASA 4ZCMA 4KK3A 5AI4A 1B6TA 1D1QA 3VR5H 1CXZA 5LP6F 2OHHA 4OP1A 3IT1A 1UXOA 3GXOA 5A03A 5K6AA 4GR4A 2V4ZA 3K6SB 2XVXA 3B6MA 4K6GA 1V6AA 1WW3A 2QPAA 3GF4A 1KMNA 3GVXA 4JA2A 1B41A 4HHEA 4OGGA 1LPAB 5JOQA 3HA3A 1GEGA 4ZIRB 4OP2A 3DZFA 2C98A 4YTEA 1XNJA 2ECQA 5DTMA 4ZCIA 4GL2A 2I6SA 1IZ0A 4C0XA 4QPDA 2ZIAA 3A3PA 4D02A 1H2AS 1JT9A 1T29A 3IXLA 4GRAA 4TLAA 4U7FA 4C5AA 2WT4A 4J43A 1IZ9A 1QYCA 3IB3A 1OHHA 1F60A 4HNUA 2Q4RA 3ETGA 4B4KA 2IXBA 5D84A 3EZ9A 4WNCA 1ZVKA 5C7OO 3CCBA 1MV8A 4R05A 1WABA 1ZJ5A 5DP1A 3L84A 5TQ2B 1CLUA 1VHLA 3OCWA 1WMAA 1NMXA 1IVNA 2F1HA 4HDKB 1PJBA 3PEEA 2R1ZA 1ZMTA 2O05A 3C6QA 4FFNA 3KWMA 3PT9A 1X1DA 2VAWA 4HZIA 2OA0A 1VKZA 1PNVA 3QVLA 1SULA 4UCUA 2BRUC 3WFIA 3BWXA 4KHPB 1U3FA 5BVHB 1EB8A 1FYWA 1J24A 4XLTA 3I12A 3TRDA 4IGKA 1VDZA 4LRXA 1UOEA 3PNVA 4MCHA 1ONBA 5I45A 5KNCD 5JAIA 2FF5A 1NLYA 1NJ2A 2HPAA 3FXAA 3UUEA 3SY8A 1N32B 1BJRE 4O3QA 2CLSA 4ZTBA 2HZBA 3GUZA 2XQIA 1X39A 3JAMA 3H5AA 3P9XA 7ABPA 1Q6ZA 2R8YA 4LEIA 3AVOA 1DTSA 2GD6A 2PX2A 3ZV4A 5ICEA 2C0PA 3H3JA 3IP1A 4WKPA 3FRHA 3TYXA 2O54A 3QNWA 4MV5A 5DX0A 4DLWA 4UJ5A 3GO4A 2IU6A 1G66A 3GT4A 3MUFA 3PO3G 4XZ3A 2G70A 3H0KA 3WK5A 4BGIA 1BKYA 4I55A 2FMKA 2BEUA 2XRMA 2P9HA 2OFFA 5I9LA 1F0PA 4I55F 1A8IA 3NALA 1O0BA 4LRSB 4DV0B 2AFIA 3VQTA 3I3SR 1QWOA 3ZWPA 2J0VA 5JYCA 2YMLA 1R8YA 1BWPA 4B6SA 2Q1XA 1TW3A 3K8ZA 4KO8A 4E3WA 1YRHA 1QC5B 3OQ6A 4B8ZA 1DWQA 3JD4A 4CKBB 4FI3C 4XX1A 5A2QA 3ZYCA 1PGJA 1TI7A 2OXCA 4Y1EA 4CMDA 3JRXA 4KQCA 4W1SA 2BM1A 5KOYA 3AW9A 1T4CA 1FSSA 1NN1A 1TRHA 1M2WA 1Y4DE 3E35A 5ALMA 3WGQA 4NS4A 4D9MA 2YCHA 2QB5A 5KT3A 1MH9A 1SAYA 1T2CA 1V6SA 4JT2A 4JB8A 5J40A 3T15A 3U5TA 1XD2A 1JG7A 1N6PA 3OU2A 4O2BA 4NLLA 4BMNA 2PKEA 4NK4A 1YJXA 1ZD4A 1KKMA 3DMYA 4HNRA 4Y2HA 4F4CA 3QWUA 4O81A 1VG1A 3ENQA 1T6NA 4KP7A 1X38A 1AKVA 1NYLA 1G9SA 1Q5PA 3QXSA 3ZZTA 4NCHA 3IERA 4XYBA 5T8KA 5J43A 3A58B 1J8VA 4S12A 1AQYA 2NZUG 4C4PA 4E6NA 3WFJA 1SK8A 1PBNA 1L9KA 3KCQA 1CRZA 3WLKX 1SHJA 2AKAB 3LY9A 4JI0B 2PGAA 4KGDA 4MUMA 4KI7A 3ZR4B 5ISMA 1Y8AA 1Y1LA 2WF5A 3G5AA 3SJAA 4XGIA 2X5RA 2PN1A 1RLJA 4R4JA 3FDSA 1WG8A 5JD4A 1RZRA 4Z53A 1FZQA 1FSPA 1T10A 4Q7EA 4EEKA 4FE2A 2K5UA 1AUXA 4CMIA 3TGWA 2J3HA 4TOIA 5ALGA 1NQWA 4ILKA 1KA9H 3CH5A 1AS0A 3K31A 4DXAA 1GA4A 1L5MA 2V0CA 3KXLA 4H27A 4Y1GA 3QTBA 1P3Y1 3PVSA 2HXGA 4AUEA 3NHPA 4C05A 1NVGA 3KREA 1AB6A 1U8AA 2XR1A 1XTBA 2NT3A 1QQTA 3KKLA 1GTG1 3PA6A 2BFPA 4MRNA 1OI2A 1UPTA 1P9OA 2TECE 5J4VA 4ASUD 2IW1A 4WEQA 4R2XA 4DUGA 2ASJA 2YYZA 5SZJA 3FMGA 1P5FA 5J2TB 4NAUA 4ALLA 3PG5A 1U1IA 2PKRA 4TSFD 4RTRA 1V1JA 2OZEA 2RHJA 2QUBA 2PU7A 2Q5QA 4H0CA 4YQYA 3RYFB 2FG7C 4BMSA 4PBTA 1J8FA 1MGOA 2X4DA 4JVSB 4M3NA 3Q2OA 4B5KA 1WMFA 4ECTA 2BFFA 4G0UA 3B7PA 1QANA 1GPDG 5AW3A 4ZYVA 1Y1WG 3FWZA 3OA0A 4IBOA 5WRFA 4TMVA 1SXJA 1XXHB 1MAHA 2IDZA 2X5XA 4TRNA 2J46A 4ENRA 5C4MA 4WXRA 4GGMX 2C35B 1Z2DA 4HRYA 3H7IA 4LJYA 2OAGA 3EYAA 4XDHA 1NU8A 1JR2A 3LA8A 4X91A 4BRUA 3PC7A 1LBTA 4TZ0A 4G86A 4GPEA 3ON5A 2R6HA 1PSWA 1IN5A 2W2KA 4EENA 4EJFA 4EUEA 1RMYA 3HN7A 4C7VA 3K9FC 2VUGA 1Y5MA 5F64A 3M5CA 4M8IA 5TPZA 5HUJA 1MAAA 5JCOC 1HXHA 4GOKA 3TBHA 1KVQA 4BBPA 3OICA 1U5BA 1GTJ1 3NV7A 3QX8A 2AOUA 3D6TB 1L8AA 3LD9A 4D3FA 5KJ6A 1RZUA 4JI4H 4ALIA 2HSWA 1EWQA 1YWGO 3COZA 3LHDA 1MPXA 3NX4A 2C20A 2VJOA 5KFLA 4NZMA 2V9CA 1SU7A 1A9QA 1LA2A 2WVJA 3LQKA 1U3WA 3OTIA 3PFWO 2I6TA 3TZKA 3VV3A 4DM7A 2F62A 2H9AA 1SHZA 5EIAA 1YB1A 4IRDA 2JD0A 4HTFA 1QGYA 2PGLA 1ESCA 4A26A 2C3PA 2FF7A 3ODGA 1UOOA 2HMYB 1JRLA 4UHJA 2QM3A 1MGPA 2AI3A 2IELA 4E1VA 1IUKA 3GP3A 4XVUA 2NP6A 3D6JA 2HCTA 4NCKA 1CIPA 3HJHA 4M4SA 5B37A 1H65A 4QXRA 5ALFA 2CLDX 3MD9A 4KQIA 4WK0B 2LD4A 3V97A 3GTOA 1CZHA 5CXSA 1NY6A 4ED3A 1G2IA 1DRVA 1F3LA 1C1DB 5TS2A 2PCLA 4R31A 1T0BA 3B6KA 3R0ZA 5TARA 1HC7A 4K7JA 4S35A 4X95A 1W9HA 4B76A 4DSAA 3KPWA 5BW6B 5JISA 4B82A 1ONSA 2WJPA 4KVFA 4B3HA 4JU9A 1A3CA 4YRGA 1NPDA 3VKGA 1L2ZA 2FW8A 3L0CA 4KIGA 4ZO9A 4REOA 4Z7JA 2DXIA 1HA3A 1SPBS 2WB1A 2R96A 3O92A 1RYZA 4DMUB 1FDVA 4R8MA 2J3LA 4EM6A 3AVUA 1QF6A 5BSRA 3STXA 4RENA 2DBZA 2QBYB 1E6CA 1QNFA 1WMDA 2OCIA 2C0QA 2H0AA 4JJFA 4CR6A 4XLZA 4QBHA 3O9ZA 3VO8A 3ZCSA 1H0RA 2FHSA 1QGUA 3CVOA 3L4BC 4NJOA 4PFQA 1B8OA 2HIXA 1F6WA 2C8LA 3KWJA 4GI5A 5FUXA 4R2HA 3ZHCA 3I4FA 2AK2A 2FB9A 5KWEA 1X8LA 1NZJA 4ML3A 1Y33E 4E6EA 1VCNA 1H2HA 3EGOA 4CIWA 3F8TA 3HVUA 3QE0A 5D85A 4DNXA 5I9BA 2HA6A 2PMBA 4LJ8A 3PJGA 2QRLA 4MR9A 1ISGA 3BXOA 4PO3X 1V3TA 3CZ9A 1OXBB 4XRRA 2QYZA 1J4AA 2NO0A 3I9NA 4TMTA 4ZVQA 3RSQA 1I1QB 3UBTA 3BZWA 2E5WA 2FN9A 4EPYA 4P36A 1UBEA 1U9YA 5ITSA 3JTMA 1GXSB 3L6UA 2YL2A 3WRVA 1YK1A 1N32H 4HGPA 4QUBA 3WL5A 2FSPA 3WQQA 3B6JA 3HI4A 4A8JB 2IY8A 3J81A 4G85A 2IS4A 1JSLA 4PYJA 1XZIA 1AY0A 2QMYA 3FWYA 4J0HA 2IYZA 5EUMA 3F78A 1XZGA 5AHWA 4TMWA 4L28A 4Y0NA 1E60A 2I33A 4YUAA 1JFSA 3MUOA 1H9BA 4ZZIA 3TECE 4J4BA 4NF2A 2CL5A 2V0GA 1GQOA 4UVDA 4BUCA 1GL9B 1DG1G 2IHTA 3FM9A 3LW7A 1DIKA 2OLJA 3OKPA 3OVMA 1Y6ZA 4M7PA 3M4ZA 3UHAA 4BMYA 1WP9A 3L5KA 4KMSA 4HDQB 4F46A 3X1MA 1JAXA 3MXOA 1HF3A 2B5OA 3Q98A 1G1MA 1VZ3A 2AN3A 3FPKA 3ZQUA 4F5DA 4UNRA 3D4BA 4S0XA 4IFTA 1GRRA 1L3IA 3AHEA 1MFZA 1R6VA 4K6NA 2BD0A 4FZ3A 4ZHQA 2M2IA 3PC6A 5JJ5A 1IN7A 2OD7A 4HWOA 4J94A 2PMEA 2QD4A 4NX2A 3DOHA 4B1FA 3L7IA 3IP7A 4DR6B 1VL0A 3CLTD 3I9FA 1H1LB 5CVTA 5JSQA 3KQVA 1NE2A 1WUJS 2JA2A 4NOLA 5T4HA 1C80A 1LPBB 3IHLA 2I2FA 4KZPA 1IATA 4IY1A 3RYCA 4OP3A 4UOEA 2ZI6A 1L7EA 1SUCA 4FILA 3DDWA 1I7LA 2RCNA 2M98A 1O6BA 4CW7A 3OCZA 3KZVA 1P2TA 2WUFA 3R5FA 1MENA 2VEDA 1JKJA 1JE1A 2AQKA 3EHEA 4XSHA 3PJFA 2HKIA 4BXOA 5F21A 4F56A 4PZDA 3T5GA 4RDHA 3TX6A 3UQZA 5AW7A 2IS1A 4KRYA 2NSJA 4IP0A 1IBRA 5I5YA 2Z9DA 5JPCA 3E18A 1OU4A 3G0CA 4IQ8A 4Q66C 4AJEA 3L01A 4RM3A 3T52A 3FY4A 4E46A 4IRKA 2HK6A 1C4KA 3DLAA 4H7IA 3WBKA 4QTTB 2EVWX 2JVJA 2LCFA 1L6IA 3I73A 2WJ6A 3IIIA 1O94C 1H6CA 4PX5A 1I5EA 3S2YA 4ROSA 3USZA 3H8JA 1YULA 4CCAA 3BXFA 4HX2A 1EX6A 2ZVPX 2ZRKA 3BMXA 5CDUA 4WN3A 4WINA 4XD2A 1NNI1 2PZJA 5C1BA 3QITA 4PHTA 1SB9A 4ZJUA 1E89A 3O8RA 1U8UA 1PN3A 5DOVA 16PKA 1SVKA 2QTGA 2ZRCA 5B55A 3R0QA 3DO8A 1PL7A 4YAGA 1J2UA 5CYGA 6NULA 3BDAA 2WABA 3JR7A 3LDAA 1W1IA 4HX9A 2RH9B 4FMCF 4LYYA 4RY2A 1W581 1PVOA 1GV1A 1BW9B 5DE3A 3TQOA 3WISA 1G9TA 3DCJA 2EAUA 1TLLA 5GP1A 5CFPA 3TAHA 4JDPA 2QX7A 2DQZA 2BMEA 4GKKH 3OEHD 3PNQA 3RTAA 4AQYB 1WBDA 5CMLA 2CMHA 1Y0BA 2ENUA 1L1FA 4E33A 3FN4A 3GDGA 4QNMA 4WLNA 4RVFA 1L4YA 2EJBA 4MVWA 1BU8A 4LY0A 3CZMA 3FKJA 4TVSA 3OP1A 1QJ4A 3ERCA 4ENQA 1NRIA 2JJ1A 3ISTA 2YASA 4M9ZA 2E87A 1Q3TA 3KZXA 4K03A 2AGQA 2BEJA 4U6SA 4JITA 1MOZA 3MLAA 1Z6YA 1RJWA 2BR3A 5FX2A 4B5LA 1IBMB 3V7YA 3A2LA 5KVSA 4RNCA 1JQ5A 4H3HB 6ABPA 2R1TB 3PT5A 1EDDA 1CRLA 5KNBH 2X1VA 3P4UA 2F8TA 2RHGB 3KQUA 2BGJA 3BRCA 4LQLA 1UUFA 4W82A 1VPEA 2VFAA 1UBGA 2NG1A 2B37A 1GUZA 4PNPA 1O9GA 1R3DA 4UU8A 5HZKA 2Y1LA 4FOOA 5JNUA 2BSXA 2E5LB 1EUCB 3GLGE 4E32A 2DLNA 2PANA 3HR7A 4YGYA 4JXJA 3GRCA 3DMDA 2FRDA 1M73E 2GUWA 3OOYA 2HEIA 4DSNA 2Q2OA 3L8MA 4RJIA 4URUR 4BQOA 3W34A 1RR6A 5CAEA 1GGNA 3GNSA 3HCDA 2BGNA 3GUHA 2VF4X 3G13A 1VPLA 1J9EA 3A9VA 1FFHA 1GCAA 3ZE7A 1VL1A 3AYXB 1E2UA 1GRVA 2Q4TA 3AEYA 3T5KA 3LBNA 5AHXA 5F76A 4JSTA 1LB1B 5HKKD 3HWX1 1TAEA 4AUMA 1E3WA 1AMNA 3I4NG 1E3LA 1E9EA 1FFDA 3CJRA 5J4HA 1II0A 3O84A 3ES9A 1E2BA 2OHGA 2V8BA 4Q0YA 1JHVA 2QGNA 3I9OA 5C4IA 2JANA 3T38A 5IWCA 2GGSA 4HLUC 4MRSA 5DB4A 3I2KA 3IUNA 4I4TF 3DOJA 2D1QA 1QP0A 1T24A 1Z0SA 4WL0A 2XHEA 4CJXA 4QBGB 3AEZA 4PSUA 4RB0A 1HT0A 1VG8A 1NBMA 4E70A 4NXMH 1O97D 3CC8A 1NF3A 1NF8A 3D8BA 4JEMA 2PMWB 3ZV7A 3ROTA 5E3JA 5E8RA 2B63G 3WL4A 1YU6A 5CA1B 1U7TA 2HA0A 1QVVA 1EXWA 1TLTA 2Q1UA 2XBLA 4PLYA 5H3LA 4PSAA 5CIQA 4F5EA 4ZQFA 1LDMA 1Q1ZA 1SXPA 4A5SA 2BEKA 5FB3A 3TNDA 4UVIA 2VSFA 1B14A 1YMQA 3NR2A 2JAUA 4TTJA 3MG9A 5KU1A 3VKVA 4S04A 1PL8A 4GLXA 2IXDA 2V9PA 4WERA 3KHSA 3M1AA 3OFKA 3PGVA 1UADA 4YCSA 5BNZA 5KDDA 3T06B 4AM8A 5EPEA 2H1LA 3HDTA 3H19A 2CF6A 2QTAA 3SIPA 2GS9A 2BMAA 1VHQA 1WCYA 1R12A 1YRAA 1T9HA 1W59A 1ZIXA 4Q1FA 3E7DA 3IV7A 3MJDA 4YJ3A 2Y1CA 3DQZA 3FB4A 1QIFA 5ESWA 1GRCA 3T7EA 5J5AA 1G5TA 3OQIA 4UDYX 3S8YA 1O87A 3O74A 1V4BA 3I9V1 5EG5A 2OTCA 1EFAA 1F51E 3FDXA 2PZKA 1L5QA 3EZGA 3K8OE 1SEPA 1GEEA 1K7FB 5DU2A 2HPHA 4DCUA 5TLSA 4ARUA 4EHDA 4UTOA 5CFRA 2OFOA 1X1SA 3C3DA 4MDYA 4ETMA 2CSXA 2XYVA 5KIAA 1WXQA 1V5IA 2XQJA 2AFHA 2NWQA 3R5XA 2BL4A 2REBA 4I1UA 3ZZUA 1QKJA 4C2BA 2GERA 1E6WA 3DMNA 1YQQA 4RACA 3OZBA 2Z6UA 3HYCA 1VKRA 2PUCA 3HGQA 1EP2B 2WF8A 1XQ9A 1KR5A 3DB1A 7REQA 2UUCH 4Z4GA 3AJRA 3C7KA 3HU3A 3KLPX 1E96A 4IUYA 3E9QA 1IXSB 4GQAA 2HGSA 2BEVA 4JJ7A 3V1LA 1SXJC 5BWXA 4R0VA 4XUCA 1BWSA 1OAOA 2IZ7A 3CYFA 3Q0IA 3IIMA 4E14A 1HYEA 1Y89A 2BTQB 1Z37A 3AM5A 4BGUA 3P20A 3AVXA 4AYBE 3G8DA 2JL1A 2AJLI 3ELBA 3MM4A 1X7WB 4Q6WA 4M1OA 1JDTA 1OYYA 2ZWOA 5TMEA 4ZYWA 3KUUA 1JJIA 4AAYA 5IU6A 4OMUA 3D2BA 1JYEA 3LL4A 3OEWA 4LYDA 2B34A 2HNAA 4HC4A 4PTYA 3RU9A 1ISIA 1J2RA 4FKZA 3CLSC 2D13A 2ISCA 3W3AA 4DZZA 1XPJA 2H5IA 5TQJA 1DAKA 3ZBUA 3IQWA 2Q9AA 3I04M 1YBVA 1SXHA 1ACJA 4F3RA 3PHHA 2YICA 4RAQA 1WHTA 5C37A 5MN5A 1EUQA 3K1JA 1RWNA 2GPWA 4GXTA 3RO7A 1SBTA 4B71A 3QIAA 1VE3A 5JALA 1D04A 4EBBA 1D9ZA 3K92A 5BUQA 4EY8A 5T67A 3TG2A 1DKLA 2REXB 4EB0A 4HDRB 2WIKA 3BXPA 4LC0A 4CWAA 1K6EA 3B12A 1UOQA 1KGDA 4IH4A 3S6JA 3U6BA 3NWJA 5LQJA 5GWXA 4M1KA 3WK4A 1LRLA 1NNLA 5TF0A 3HPQA 1TUGA 1LI7A 2AD1A 3I32A 4J4TA 3CRMA 2XH8A 4P0PB 3SDSA 4JJAA 2DP4E 2EG9A 4A2QA 1XMXA 4D9HA 2RE8A 1N3IA 3BN3A 4INZA 4X54A 1ZM2A 3UMVA 6ADHA 2RBGA 3H9JA 3IEPA 1NMSA 4H7KA 1YQGA 2AOTB 2ZXFA 2O2HA 3CUEF 5J5CA 3AFNA 4D8YA 2P2ZA 4BS9A 3SEZA 2WU1A 3EGDB 3MFYA 3KQYA 4XCQA 4KXLA 1T9GS 2CXUA 3UF0A 4IWXA 3JQ8B 3KU4A 2XNHA 4DCGA 5JNRA 5K20A 4G0QA 4UU7A 5JVLA 2Q28A 3M6WA 3PR3A 3AM1A 1CQJB 4I9FA 3D02A 2E37A 1XG5A 3QLVC 4QLBA 5BUCA 1M6NA 1V47A 4DDUA 4HAOA 1PT8A 3VTKA 4E5DA 2E4AA 3WWEA 4D92A 1FMFA 4XWWA 3RRXA 3W2GA 2IPXA 1L4UA 1CZUA 3UKJA 5CR5A 5CBPA 3R5KA 1WSWA 4UZEA 1VYUA 3OIGA 2IYQA 3DBOB 3QLJA 2YMMA 3BMOA 3VR5A 4FOPA 1Y8RA 5G0UA 4RKRA 3A6JA 1TUEA 4Q16A 3A4IA 4FYWA 3IAM6 4LXQA 4LH6A 1G60A 4O7ZA 1C50A 3SP1A 5KQRA 5K51A 2F8MA 3VO1A 3KC2A 4L73A 4UNPA 3M7IA 1FFBA 1M76A 2I67A 4R51A 1WXWA 3WLTA 3CNHA 1VCOA 1QHFA 3II6X 1I2MA 3SHQA 4Q48A 2ZBGA 2QZ9A 4F21A 5KNBD 2GVZC 1IAVA 2V7EA 3OOEA 4GX0A 1O2DA 1QLWA 2HH9A 4RUAA 3OT5A 1QMGA 2YVUA 4Y2UA 1Q16A 2C4WA 4M87A 4LXTA 1Q14A 4IL5A 2WT8A 2UV8A 2A67A 2X3FA 4OFBA 4RD6A 1RM3A 3HB0A 1T5DX 2YFQA 4GD3Q 5BVHA 3L8ZA 1A2KC 4MVYA 5JYBA 2AMVA 1NG1A 2X0NA 3O21A 3PC3A 3HJFA 4GAEA 5IDQA 1Z0ZA 4UD2A 4QEKA 3ELUA 4DYHA 2GCPA 5BOVA 1TIPA 3HP4A 1WSDA 3LRXA 1ZK1A 2IYOA 4FYPA 5KFNA 2QDXA 4OL9A 3ZU4A 5C8VA 2H59A 4HP8A 2AA3A 1N7JA 4NATA 3DW3X 3MB8A 1Q0QA 4B17A 2MSDB 1R8XA 2X23A 1YR1A 2VRCD 3KEMA 4OI4A 4E1AA 4YCLA 1BQEA 4JUDX 2OHVA 4AJNA 2DR3A 3U55A 1XDGA 4JOSA 1XP8A 2BFWA 2H4JA 4YN3A 3RG2A 2Z6QA 2V98A 1E1RD 5IAEA 3AY6A 5LUAA 4JI6B 5JR3A 2CL6X 3FTNA 4N5DA 4EW1A 3EGVA 1RQ7A 5EOVA 2YV3A 1SQSA 3PK0A 2JHGA 2YNMC 4KN8A 4MW6A 3T4PA 3SK0A 3UMJA 4C04A 1C3XA 4N8SA 4M60A 4M99A 3UXHA 4OHWA 3GLHB 3JQRA 2VNHA 3EBPA 4R6WA 1KZ6A 3PHBE 5IUNC 4UM9D 5J2UB 4G65A 5AJYA 1KAEA 3ZIDA 1A50B 4CKBA 2WIDA 4F4XA 3LFUA 3THOA 3HCFA 4DRZA 3CNQS 5J4KA 3EPKA 1I3KA 1U4NA 1T5IA 2O2IA 2XUGA 4N0MA 1T6BY 4EY4A 5BRAA 2WZQA 5IN5A 2YYYA 4BNIA 1KZYC 3ZCUA 1WVGA 3GUCA 4FUTA 3LDHA 2AIRA 1W6UA 5EE0A 2JZCA 1C30B 3CB4A 5JVDA 3QKSB 3SLRA 5U4XA 2R92G 3IEIA 5B57C 5L3VA 4BRZA 3WYCA 1Z16A 2V45A 3BQ1A 3CVWA 1I2ZA 5NLLA 1JDEA 2ZTMA 3ROQA 5EHQA 5A6SA 4IFIA 2JFBA 5KMGA 2VUUA 2ZI9A 5JFTA 1ST2A 3OT1B 2A9KA 4P2GA 4BMZA 4XJSA 4LC1A 4X85A 4IHJF 1U31A 3G0BA 3MGKA 5F3RA 5G53C 4TV8F 4C30A 1VCIA 3RC2A 1XHLA 3DO6A 3KVYA 3L1KA 4N0EA 4YX9A 1Z4QA 4IEFB 1RC1A 4J2TA 3SOPA 1EDOA 1O94A 4MINA 3IILA 3X1KA 1CF9A 2RGVA 2A88A 5ICGA 2WD8A 4PQGA 3UENA 4B48A 3JPWA 3O90A 2B7LA 5KPJA 2P6RA 2ZIVB 3OPYI 1PZFA 1AKEA 1RXIA 1Z74A 2PBFA 3V55A 1FFCA 2H07A 2HT1A 3I0MA 4KN9S 1WEKA 2GJSA 4Y6PA 3VHXA 3SX0A 3G9UA 4LF8B 3B3AA 2J0SA 3K0CA 1CY6A 5EKXA 1LXCA 4AT1A 1K86A 3LHFA 4RSRA 1SU6A 4GMDA 1KSJA 5EIFA 4K8RB 4FHZA 4D45A 3PNPA 3HNPA 4UHCA 3SNKA 2JA6A 1F20A 2ZI5A 1IM8A 5DYNA 1IY8A 4M22A 4WVFA 1NFFA 1P3JA 2AHRA 5A9TA 3Q1KA 4JR0A 2NU7A 2IKQA 3CN7A 4TMFA 5KSWB 1JF8A 1WU7A 4EY7A 1SH7A 2DH6A 2IEZA 3A6ZA 2YXNA 4Z7NB 4KI0A 8MHTA 2ADOA 4QYWA 3MWGA 1I6UA 1Z6TA 3G82C 1KJZA 4AP9A 1IY1A 1NP3A 3QUCA 2I6XA 4ID9A 4MP6A 4J03A 3WMFA 2FJ0A 3ACCA 4A0GA 3QF7A 1NXTA 3NHJA 5ALLA 2CDNA 4JLPA 1GSOA 2A57A 5ALRA 3D4IA 2ZBDA 2QGFA 4XGKA 2WUVA 2JRLA 4Q9IA 1Z17A 1CP2A 1SKAA 2YN0A 4V24A 3TPZA 3FDIA 5CH3A 3VR1A 2X5JO 2DPHA 3MAJA 1L5KA 4IV0A 4AP5A 3IRUA 3MGGA 4A8HA 1XNRH 2XT6A 2CBXA 2MHCA 2ZJ5A 2Y99A 2Z6AA 4F38A 3KQTA 3F5MA 3AR3A 3R41A 5EAIA 3Q40A 2E1PA 3U3MA 4F2HA 2CK3D 4JOQA 2AZDA 3QSYA 3KSAC 1FVOA 4DV5H 3FB1A 3N7TA 1C41A 1R6AA 2R84A 1CQWA 1HE8B 1XJWA 2OD9A 4Q44A 3C7TA 3O2JA 3PC8A 2JAHA 4CC5A 3RS8A 3DBIA 2VPPA 1TF2A 3H0EA 3G1UA 4NHEA 4GX1A 2N1BA 3WIDA 3GV5B 3AJDA 4FJ0A 3L18A 1NBIA 5DPMA 5IH3A 2OZVA 1KI6B 3PPYA 4YRNA 4I6GA 3T5CA 1BHO1 1K7SN 5CE8A 1XDWA 3RU7A 4KUEA 4ZC8A 1L5NA 5K6TA 1ADYA 1VSTA 1DEHA 2IHUA 1UEJA 1FMCA 3D8SA 4EJMA 2A8YA 4JZKA 3N6XA 1F12A 3LQRA 3IVXA 5TIIA 2GILA 1LBSA 2XWBF 1OIVA 4BIIA 5C80A 2QPLA 4V0NA 4CIDA 2GO1A 4RTMA 1CETA 1NXXA 4CI0B 1PR5A 1UFKA 1RHJA 2BFAA 4MQLA 4U1RA 5CVDA 3Q7QA 1HR0B 3EA4A 5FFNA 2Y2UA 2J9RA 1VE7A 2JLXA 4JWKA 1G8KA 2GRUA 4DV6H 4M55A 4HVCA 3BOSA 4QG7A 2XUZA 3CSUA 3ZBPA 3BXZA 4A2PA 3LWZA 3PFHA 4PU0A 5JRZA 2QZJA 1OWMA 1ML4A 2GN1A 2NYVA 3LT5A 5CJJA 4R2JA 2RI6A 3K6JA 3R74A 4DSZA 3LW8A 1KFBB 3BB1A 1GFZA 2DU8A 4RPLA 3FMPB 1H2FA 3VGJA 3RUHA 3J7AC 3TQSA 4C0HA 4QHSA 1KBZA 3P1JA 5JNLA 4UPVA 2JS7A 2NUPA 5I6DA 1RAGA 4JYPA 3GOHA 2BZSA 1USUA 1E1QD 2VDNB 3I6BA 4ZAWA 3WWYA 2O0LA 1GJRA 2WVAA 1R6DA 1ZXLA 2Z2JA 4LXXA 4ESOA 4OTZA 1XU9A 4R3NA 1NBME 3KTDA 1JFFB 5KNCA 3TNJA 4DILA 4JNCA 2P90A 2H17A 2WFMA 1JHQA 4JX8A 4LHSA 4RX1A 2FSHA 2QAGC 2QS9A 3HOUG 1K6MA 1QHSA 1Z38A 1AZSC 2Q3BA 2X0KA 3ROKA 5E6SA 2WIGA 1E6KA 1PV4A 3GTLA 4FYJA 3TR5A 1USKA 2Y1DA 4LBYA 5IHPA 1JNXX 1XLTC 2IHVA 2V3VA 2DT8A 4UMVA 4O25A 3OQOA 3LHSA 3UJ7A 1M34E 2VPXA 3EEOA 4YMUA 3K15A 1TWCA 4PYNA 5HJEA 1E32A 1PJRA 2CFCA 2WUDA 2RIRA 3F4LA 3AESB 3FBGA 5KOHB 3MRXA 4YQWA 2IZ5A 4ZCLA 4MV7A 3LPNA 5JY1A 3ANLA 3P9ZA 4TYPA 3H6GA 1LVGA 3P96A 3PUZA 4KXNA 4PLGA 4XEUA 4J6EA 7YASA 3JZDA 4ZRNA 3R76A 3TSZA 4DCSA 1I7SB 2AHOA 1XZMA 2BCJQ 3FD8A 1OLUA 2NO1A 3JVEA 5HRAA 1KO1A 1FOEB 1AD2A 3TXXA 4RH3A 1HOTA 1ECJA 3U7FB 3FPCA 4JJEA 1DRUA 5KYYA 4A0RA 4LJLA 3PW0A 2Q5EA 5FEMA 3NONA 3HXKA 4NEGA 1JIVA 4UNQA 2I8CA 2GAOA 2QU7A 4YDQA 1DIGA 4ETNA 4RCZA 1WSAA 4LXIA 4CR7A 3X1ZA 1Q15A 4EZEA 4Q9LA 4B4OA 4GKKB 2WLSA 5A7FA 3BD7A 1DGSA 1NW5A 2CKDA 1AS2A 2B4TO 4FEGA 3O7WA 4IDBA 4M1YA 3TK1A 1J6UA 4Z1OA 4H6WA 2BWJA 4PG7A 1VA4A 4JJKA 1T8UA 2FWIA 5BSWA 1EUYA 4G4GA 4DJ5X 1QBKC 1Q3HA 1CVIA 2BZ1A 2G0NA 2AXPA 1KYTA 1CWUA 1V1MB 2UYOA 1HDIA 3C3CA 4RADA 1PT9A 5BN5B 1UBJS 3FA2A 3RJ5A 4DBLC 3AXSA 3SHOA 1RPAA 2QE7A 3USCS 4EA9A 3ANNA 5AUNB 2QJOA 3B1FA 1LTQA 3JV7A 3WJ1A 1ZS9A 3U39A 4LSZA 2MYPA 2FN4A 3DE5X 3DKKA 4EKIA 1RZRD 3QELB 5GIOE 4N6NA 2IS6A 5EESA 3HBJA 3KSMA 1MJ5A 3QVWA 3AFIA 4LMRA 5KT4A 4MJXA 4AYBA 4UFOA 3L0IB 1UBMS 4BXOB 5KINB 2OAP1 3QY0A 3RLFA 2C1EA 5BWVA 2O8CA 4KSCA 4X24A 4X3CA 4BKUA 1OILA 1V16A 4N5HX 1KNXA 3R9KA 1UWVA 4R5HA 3HOXG 2ZSAA 4EG1A 1ZN8A 3C8MA 3ZLVA 1YTUA 2JGEA 1CQIA 1IB0A 2HJVA 3A25A 3JQQA 1Y8ZA 3MMXA 1JEYB 2O2ZA 3DL4A 4K28A 1ECBA 3GEGA 5GIPE 3RAFC 1I94B 1VLVA 4TSFA 1HK7A 4D97A 5BORA 1DAAA 2P78A 3M89A 3U56A 4PZ0A 1YA6A 2HRDA 2XB9A 4S2EA 1R6TA 4LHWA 4IIUA 4NYJR 4RGBA 1JR6A 2OD2A 2E6UX 1NURA 3HQ4O 2H63A 3MFIA 1EEXB 1NR7A 1R5BA 1RQRA 3IXMA 3K2EA 4N9QA 3VR4H 1CEQA 1YZTA 4D9GA 4R1MA 5IDYA 4OA5A 2GMWA 3H1GA 3I9LA 5BWTA 1MZVA 2I7DA 2J09A 4DCJA 3RW9A 1GUAA 1IQUA 2ECKA 2X2FA 1HZZA 3CZ4A 4RWEA 1BW9A 1LBHA 1WQ1R 1ZZGA 1MJFA 2I1QA 4E5NA 1YBHA 3E8XA 3ETCA 3Q0EA 2GHIA 3MMZA 1E6EA 3WJ7A 4CLEA 2X13A 4MWSA 5ENVA 3U13A 3QU2A 1J70A 4E4YA 1WV1A 1GL3A 1LZLA 1U2SA 2RGYA 3A3OA 4RVHA 5JNTA 2CJXA 1XTJA 2D1TA 2OCXA 2ZRNA 3AZPA 3C1UA 3DV9A 1CDDA 1GGKA 1MVLA 4NFSA 3TPCA 3TXYA 4O2BF 5CG1A 4AS3A 2VUTA 3FWNA 3GCZA 4ZVKA 5KJEA 4CMHA 4EHNA 2QGZA 3W1WA 2PLWA 5JS2A 4QQNA 3RF6A 1V4VA 3BA6A 2M32A 4OHMA 1ODFA 2EOAA 4JVOA 4G01B 1KEKA 4URYR 3NIFB 3LPCA 4RHUA 2GNAA 4G5YA 1H94A 4MYSA 1CUIA 2OK8A 1J7KA 3LGSA 2BM0A 1Q83A 4A0HA 1Q84A 1U4SA 2XXJA 4IINA 2Q6OA 4DQLA 4NTZA 3TO5A 4EB6A 4ZYLA 1NX9A 4N01A 3CKMA 3WTCA 1WBBA 1PR4A 1SQGA 2ARKA 4HAUA 4NBWA 3SX4A 3D8TA 4HGNA 5EL0A 3WB1A 1N5LA 5JHGB 1I7DA 1KBOA 1MC8A 3JYHA 4K40A 1JQEA 5ALUA 4ECEA 1E0AA 3RUAA 3R3HA 5G4LA 4O3FA 5HGXA 5DASA 1EUCA 2OV2A 4G1VA 1WF6A 4L16A 4EZIA 1P1RA 5DBHX 3LIPA 1S02A 2JFNA 4PQRA 5ESXA 2G82A 2LBPA 2HLNA 3CX4A 2IYYA 2EW8A 1ORWA 3R6DA 3JYQA 3R0IA 3U0VA 4F4JA 3WYFA 3U40A 2BGGA 3VNNA 2OLSA 1P2GA 1BCSA 1XYGA 4HZUA 4NV1A 3RAPR 4EX7A 5KT6A 3BCSA 1Z13A 1W2WB 1OTXA 4TWBA 3KR2A 3RRJA 1D6JA 2FLKA 5DNWA 2DULA 3LOPA 3VX3A 1RM4A 1GPBA 2I80A 1XELA 1ZUD1 1P74A 3DF9A 4XFJA 2ZS8A 3EULA 1EWTA 1WWKA 4WOBA 1SK9A 1H9AA 3CR7A 1ELOA 2VDOB 1E9BA 4FGUA 3MRSA 3A6LA 4EW6A 4KL8S 3C39A 4EG0A 3EDRA 2Q5FA 2YBEA 4C88A 2XCIA 2ZIGA 1GPH1 4ECXA 2HRBA 5D8DA 3MGCA 4C0QC 1Z9BA 4NY1A 1L5HB 2B8NA 5ALQA 4IICA 1Q1GA 1VP3A 2XNKA 1FFSA 3GHYA 1HNZB 1JU9A 2DFDA 2ZB4A 3NBMA 1NT4A 2ZPUA 4ND2A 4O7LA 3S1AA 3DVAB 3Q72A 2ZJYA 1SVLA 4KPFC 3A1NA 10MHA 4NCIA 4HB3A 1OWNA 1Z35A 1Z82A 3P45A 1JJAA 3E7PA 4TV9A 4J7XA 1DJOA 1E5VA 4DR4H 4G1UC 4XA8A 3I04A 2G06A 1RLIA 3DF7A 1JT2A 1PWEA 2A94A 2AJ8A 3CZRA 5AM3A 2XD4A 4G09A 1K8YB 3B7WA 2VZLA 3R8XA 1N2CB 1Z75A 3B9QA 2O8EB 2A3NA 4MULA 5CX4A 1IIBA 4DA4A 2QTWB 1ZD1A 3OFSA 4P7GA 1UL1X 1SXQA 3G2LA 3WMXA 2C4MA 1M2NA 1YC5A 1Z22A 4N82A 1TMYA 2W0MA 1XBTA 3IFSA 3RH0A 2HDKA 4NONA 1CCWA 1NXQA 4WXYB 3VU9A 2QMQA 1Y1VA 3HVHA 1U3TA 3BT7A 1YQ9A 4UNIA 2CBZA 1BC5A 1MW9X 1UPUA 1KF0A 1LLQA 4M1EA 3ZU2A 4YQFA 2C4KA 1AKNA 5HTOA 4OHUA 1ZR4A 1VE9A 4JI1B 1V4NA 3IPRA 3S0JA 2VL7A 4O0LA 3I64A 4OLAA 1RJGA 4O86A 3E9YA 3O4VA 4MPDA 5FO1A 5HS6A 3RBZA 3RJ9A 4IZOA 4LHEA 5HXAA 2TMGA 3DV2A 2Z4RA 4H18A 4KO4S 4OQQA 4IXDA 4ZA2A 2VZ0A 4LMAA 5AW6A 4MQMA 1DDOA 3ZLTA 3NEYA 3S8EA 1Z33A 5FL7D 3MK31 2XLCA 2DWUA 5LYYA 1HLPA 1U9JA 2XUJA 3JD0A 5I7EA 2V3CC 2C88A 2VDUE 4JQCA 3W3ZB 4YR3A 3TD9A 3AU9A 4QATA 1DRWA 3DW1X 2NO6A 3KPUA 4PQEA 5FXMA 4CIYA 4RULA 3G8BA 4ENUA 2HOQA 1KEPA 1NX6A 1DQPA 1RPTA 1UK9A 1YR7A 2QRGA 3H6KA 2REQB 3NGLA 2ZLBA 3N8DA 3AHCA 4PLFA 3HCCA 3UICA 3JASB 4BHTA 1TB4A 4J0GA 1AA6A 1JAZA 1NVAA 1NJ1A 3ZK7A 1RLMA 1G6KA 2A0XA 2OVBA 5C8YA 3FFAA 5K8CA 4RHTA 2AQHA 2LWIA 4F72A 5KSZA 4M7RA 3QOWA 4BOYA 5HMLA 4CT0A 2I03A 2XOKA 1KZGB 4HT3B 3DDUA 4AY6A 1E4GT 1HSZA 1IXKA 1HE3A 3LP6A 4K26A 4PVCA 2YINC 3HKBA 3N0TA 2C2WA 1T13A 4L6IA 1ZK0A 2NTYC 3OZDA 2CXRA 5P8WA 4EI9A 4CM9A 4EW3A 1OIWA 3A11A 2YHIB 3RVJA 5JEEA 4IMIB 5DLQC 5CD9A 4BFVA 1DXYA 2XRYA 1W5TA 3AUUA 1ZQ7A 2LV8A 1Z2NX 2FLLA 1PVVA 1EVJA 1L4KA 3CX8A 4WSOA 3ZV5A 5F2NA 3OQJA 1HRKA 1RWPA 4PWZA 1DUSA 1GPUA 4V03A 4YFYA 5EVCA 3EPIA 3WOHA 2QRPA 3SKVA 2YWVA 4V1CB 1KZ4A 2XITA 4BX9A 1Q7BA 4CM7A 3CW2A 3AV3A 4Z9FA 1CJVC 2Q3HA 2WFLB 4QRHA 4A3IG 2IC5A 1EM8A 4MUEA 1VI2A 5D3MB 4V3CA 2W58A 1T5HX 5I5GA 5IYZA 3EUFA 3FYUB 4IJUA 2DJ5A 3DEIA 1P18A 2VJMB 4U2GA 5IJ0A 3PKIA 3I53A 4WY8A 2FPGA 3RK1A 3GLFA 3PXUA 3TIGA 3W5VA 5ALYA 4LFCB 4U3JA 4QO7A 5FEUA 4UXIA 2D2VA 4O08A 3D7NA 1H0SA 1A9SA 3LYAA 1J90A 1VI5A 4WOPA 1I3OA 4FYIA 2FMTA 1AKTA 4IDFA 4P80A 3UCFA 3WYAA 2BBSA 1GPJA 4AWBA 2E5LH 4A91A 3UZOA 2ZIWB 3FLEA 3GLIE 2WSIA 4KSBA 4HB0A 3G6WA 2HJWA 1JEQB 1V8FA 3ZS8A 1K1EA 3KXDA 3OLQA 3D0OA 4I50A 4Q39A 4FIZA 5HF6A 1G6OA 2YY6A 3ABRB 4QXMA 4Z8XA 1A9XB 3ZVMA 4JI7H 3H0GG 1A88A 2HMWA 3CISA 3JAKB 2C9BA 4YMIA 3PR2B 4B44A 4CFZA 2QXTA 3NJ8A 4CHIA 2Q99A 1SUEA 1ZJWA 4RE6A 1Z7EA 3EF3A 3EQ7A 4YAJA 3WNQA 3KOWA 2CXNA 3LSTA 4C07A 4DQKA 5EJEA 1SUDA 1Z73A 3LU1A 1WCIA 1ES9A 2DWPA 2R11A 1Z4JA 2IZ1A 5DYGA 5FBRB 4LFCH 1G5RA 1RABA 3UB4A 2H5EA 3N75A 1QX4A 4UBMA 2ILTA 4AKSA 2X22A 2BDUA 3NJRA 1ZOOA 2B4AA 3NG1A 3UPUA 1ZEJA 3A1EA 5LOVA 1ABFA 3F5SA 1XZPA 1CFZA 3CVXA 3JU3A 3KJXA 1G21A 1WR8A 3ORHA 1GGJA 4LGVA 3Q3IA 1M6VB 3K96A 2QT9A 1EBFA 5EHNA 3WGUA 3VZSA 3Q8QB 2ET6A 2XZLA 4R9NA 5FLXW 2C4VA 1XK5A 1YZVA 1Z5WA 2GWHA 1SG0A 3BMQA 1SN7A 4LSAA 1SZJG 1Z0UA 4WKCA 3EWNA 3VU3A 3F3KA 3N2LA 1W0CA 1E3MA 4P7KA 3V3KA 4RB2C 1FYDA 2PTGA 4P92A 2PQ0A 2C7VA 4FQ5A 4C14A 3EG9A 5I3ZA 2HYIC 3V8EA 4AULA 1TC2A 3QWAA 5EXTA 4K6HA 3UUGA 2W42A 1TCCA 2XMGA 4JK3A 2PWZA 4PFSA 2PRJA 3UT5B 4DIKA 1IOLA 1Q0TA 4P4SA 2D5IA 3RTXA 2JGMA 2NTNA 3V6HA 1OX6A 1P3DA 2D3WA 3IBGA 4K2AA 4RXTA 2ZBFA 1M6WA 1P9LA 2VQ3A 1K92A 4WECA 2OBLA 1RCUA 1G8JA 2C9DA 4BNZA 4CBVA 1KQPA 1LZKA 2JLQA 3DM9B 4CU2A 4YR9A 3INYA 1VC2A 5EMNA 3CSDA 3FFWA 1N56A 2QXYA 3M9NB 3AL3A 3AQIA 3B8HA 2P6PA 4G0XA 4RIFA 3HBMA 1MCZA 5E2AA 4PO9A 2ZRJA 4CLXA 1AMOA 1PLJA 1WB5A 2ZUUA 3KOYA 3VKFA 1QCCA 4EO7A 3KZ1E 3W5OA 2IVZA 2NQTA 3BJMA 3PZRA 3EUAA 4EAQA 4IIEA 3R9XA 1WD7A 1DBSA 3G1TA 4FDMA 3RVLA 3VDQA 3AIMA 2P69A 5FBKA 4DPKA 4HJRA 1VLQA 3EGXA 4BNDA 1V8DA 1Q1QA 4OKIA 5SYNA 2O5VA 1VSVA 3F5DA 1ORHA 2DKOA 4N39A 2D54A 3HJGA 3O2QB 3WRYC 1V2HE 3VV2A 5B4TA 3STTA 4MA0A 1MBZA 1YFZA 1QLJA 2EATA 3I05A 3KEOA 3V46A 4EEXA 5L45A 1PTKA 1KMCA 3HDYA 3N0VA 4Q47A 3ZVNA 2E4UA 1LTHR 4FUQA 2WYUA 3C8UA 1IXRC 4X3PA 2UAGA 3C41J 4C89A 4JLAA 2ZM6B 1HE5A 2WTNA 4L2IB 3QJ5A 5C8DA 2H2AA 3OSUA 3HB1A 5DHUA 4D9BA 1C2YA 4Z4FA 1N6LA 4PLPA 3K0BA 3WHIA 3WIOA 1BN7A 3QE2A 4WFIA 4JXKA 3C3JA 1KZ7B 1YZYA 4CIVA 1YASA 2CHEA 2C2XA 4O4IA 4Y8VA 1RBYA 4U2CA 1QGAA 3GEEA 5EEHA 3CZAA 2WYHA 5COBA 1YZUA 1LFAA 1YR3A 3GFBA 2OCDA 2OZKA 4BZQA 1I6KA 5BUZA 5CLLA 5IAOA 1GCIA 4ENSA 4I99A 2IUYA 1PR2A 2JI4A 3JARA 1TM2A 4W8GA 4MUAA 5FPRA 3BK2A 4UFNA 5F9FA 1M1UA 2OCPA 1FTSA 4HQNA 4DV4B 5K99A 2GD1O 1Y6RA 2J3MA 2HRCA 3FGOA 1XZJA 2ODPA 4Q9AA 5HRUA 2BBWA 4LHYA 1OGYA 4WRRA 4G07A 1HYQA 1WCV1 3D7LA 4JVLA 4P8RA 4HQFA 3EXAA 1YUMA 3GZNB 4D0NA 4ZZ3A 3DYVA 1NXSA 4KMRA 3RSLA 4B7UA 1B6GA 4RLSA 3WOVA 2F3RA 2WWRA 1RZ3A 2UZ3A 4PHHA 4QOFA 3ZGNA 3NGDA 5ESRA 1GQYA 1ZWKA 2EL9A 4MTCA 1UCFA 5I5XA 1BQ4A 1KP3A 1S4MA 1JIQA 3CLTC 3INNA 3QJYA 2OQVA 1DGQA 4ZT6A 4ZOEA 1DO0A 2H08A 4GC9A 3IE2A 1AF7A 4U6NA 1GNTA 2LVBA 4CG2A 2PS1A 3NTVA 2CN1A 3HEBA 1EGVB 1QV7A 4GOOD 4P4GA 1R00A 4ZN6A 2WFZA 1K7XB 2JFOA 2O3UA 4LNUA 2Q9CA 4F50A 4F91B 3WGMA 5GONA 2V6BA 5A4AA 5FO0A 4AWXA 4G3IA 4M53A 2W6ZA 1UK6A 1BGVA 3C6ZA 1DHRA 4I5GA 3CZQA 4Q82A 4R8RA 4XE5A 4XCXA 2PL3A 3RTBA 3WMWA 3ZHUA 1BH2A 4KO3S 4BNJA 5AVTA 1KGSA 4YROA 4AY4A 4N0DA 3WGTA 3Q5EA 1PHPA 1YOBA 3NBUA 3GUYA 4YRPA 2RCYA 4EWLA 3UT0A 1ZW1A 5H83A 2ZAGA 1G38A 3AG5A 4DGSA 4H35A 3TMKA