The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
155
|
sequence length |
471
|
structure length |
452
|
Chain Sequence |
FDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNIYGDELRETLLKLQYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb |
molecule tags |
Ligase
|
source organism |
Glycine max
|
molecule keywords |
Homoglutathione synthetase
|
total genus |
155
|
structure length |
452
|
sequence length |
471
|
chains with identical sequence |
B
|
ec nomenclature |
ec
6.3.2.3: Glutathione synthase. |
pdb deposition date | 2009-10-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03199 | GSH_synthase | Eukaryotic glutathione synthase |
A | PF03917 | GSH_synth_ATP | Eukaryotic glutathione synthase, ATP binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Glutathione Synthetase; Chain A, domain 3 | Glutathione Synthetase; Chain A, domain 3 | ||
Alpha Beta | 2-Layer Sandwich | D-amino Acid Aminotransferase; Chain A, domain 1 | ATP-grasp fold, B domain | ||
Alpha Beta | 2-Layer Sandwich | Dna Ligase; domain 1 | Dna Ligase; domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Dna Ligase; domain 1 | Dna Ligase; domain 1 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Glutathione synthase, substrate-binding domain superfamily, eukaryotic |