3KAJA

Apoenzyme structure of homoglutathione synthetase from glycine max in open conformation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
471
structure length
452
Chain Sequence
b'FDYHRIDQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLNADEFTSRLLDIHSKMLQINKKEDIRMGIVRSDYMIDEKTKSLLQIEMNTISTSFALIGCLMTGLHKSLLSQYGKFLGLNSNRVPANNAVDQSAEALAKAWSEYNNPRAAILVVVQVEERNMYEQHYISALLREKHHIRSIRKTLTEIDQEGKILPDGTLSVDGQAISVVYFRAGYTPKDYPSESEWRARLLMEQSSAIKCPTISYHLVGTKKIQQELAKPGVLERFVENKDHIAKLRACFAGLWSLEDSDIVKKAIENPELFVMKPQNIYGDELRETLLKLQYILMQRIFPATSPAILVRDGNWDTGHVISEAGIFGTYLRNKDKIIINNESGYMVRTKISSSYEGGVLPGFGVVDTVYLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoglutathione synthetase
publication title Structural Basis for Evolution of Product Diversity in Soybean Glutathione Biosynthesis.
pubmed doi rcsb
source organism Glycine max
molecule tags Ligase
total genus 155
structure length 452
sequence length 471
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 3kajA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3kajA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kajA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kajA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 3kajA04
3VPCA 3ETJA 3JRWA 2R7NA 4YJ2F 1Z2PX 2I8CA 2FPIB 2DLNA 3KAJA 2CNUA 1B6RA 5GONF 4O7TA 3LP8A 3OUUA 2QF7A 2GLTA 1M6VA 2R82A 4I4TF 2Z02A 1EUDB 1C30A 4O4HF 4O7YA 4O7WA 4FFNA 4EGQA 1CQIB 1B6SA 2GPWA 1KJJA 4O84A 4O7NA 1CE8A 4MAMA 4HQ6A 2VPQA 3N6RA 4MV8A 2HGSA 4O2BF 4O82A 3Q1KA 3K5IA 2YZGA 5IYZF 2CNQA 2QK4A 2OLSA 2PBZA 3U9TA 3UFXB 3JRXA 4MA0A 5CA0F 4YAKB 3K3PA 3LWBA 1WR2A 5JVLA 3RV3A 4M9UA 4FFOA 4XYMB 4O7RA 2X0SA 1GSHA 1KBLA 4E4TA 3NUAA 3I12A 4TUYF 1CS0A 4MV6A 4FFRA 4O4IF 2YS6A 1C3OA 3HB9A 1I7LA 2DIKA 2YWVA 1GLVA 4NYEA 4HNTA 4MA5A 4XYLB 4RZQA 5LOVF 1DIKA 5CB4F 2SCUB 4O2AF 1IOWA 4FFPA 5C8YF 1AUXA 1VKZA 3R9RA 5C1PA 3R23A 3AX6A 3QFFA 4MV7A 2ZDHA 4TV8F 5LP6F 4HNUA 2FP4B 3KAKA 2R7KA 1Z2NX 2CZGA 3V4SA 5JH7F 2C00A 1DV2A 1JDEA 3GLKA 5CAEB 4DLKA 4O7VA 3MWDA 5EZYF 3U55A 3U9SA 2NU7B 4O81A 4MV1A 4EG0A 4FFMA 4EGJA 1A48A 1Z2OX 4YBZB 3RV4A 2R86A 4FU0A 1W96A 2P0AA 1VBGA 2W6ZA 1M0WA 2R84A 1GSOA 4C5BA 1EYZA 1KJ8A 1KJQA 4IZOA 4ZI7F 3TIIA 5C1OA 3HBLA 4ZHQF 2DWCA 1AUVA 2W6OA 2IP4A 4MV9A 1OBGA 3E5NA 3MWEA 4YAJB 3JZFA 4YJ3F 4O7LA 3K5HA 2GQSA 2NUAB 3BG5A 1GSAA 3V4ZA 1VBHA 1GGOA 4C5CA 4O7SA 2HJWA 3TIGA 1JDBB 4FGRA 1KEEA 1E4EB 5J2UF 4TV9F 2YW2A 2W70A 3G8CA 2WYOA 2W71A 2XD4A 2R7MA 5LXTF 2YL2A 2W6PA 2R85A 4YB8B 2ZDGA 1JKJB 2FPPB 3KREA 4QSHA 3VPBA 4O4JF 2R7LA 3GIDA 3ETHA 4C5AA 5CA1F 3WNZA 5HV6A 5BPFA 1A9XA 3TQTA 3R5XA 4I55F 4IIJF 4MV4A 2W6NA 3G8DA 5KKNB 3DF7A 3RFCA 1W93A 4O83A 3JZIA 5JVDF 2V5AA 1EUCB 3ORRA 2YRWA 4FFLA 2V59A 5JQWA 1EZ1A 2I80A 4MV3A 3R5HA 1DV1A 3OUZA 2VQDA 1I7NA 1T36A 4XX0B 2FPGB 3ORQA 2PVPA 2YZNA 4O4LF 5HBRB 2FB9A 4O7ZA 2R87A 5H80A 2DZDA 1CQJB 3TW6A 3VOTA 4L1KA 2YRXA 2YZLA 5JQGF 3SE7A 4O86A 1EHIA 2VR1A 2PN1A 3TINA 4Y8VB 2YS7A 2ZDQA 2J9GA 4XZ3B 1KJIA 3R5FA 2XCLA 2NU6B 1BXRA 3HO8A 4ZQIA 4HNVA 1E4EA 3AW8A 1KJ9A 3VA7A 1OBDA 3Q2OA 5LYJF 1IOVA 3MJFA 4FE2A 4DIMA 5BMVF 4I50F 2YYAA 5J2TF 1SCUB 1PK8A 4ME6A 2V58A 4HR7A 5D8DA 5DMXA 2GQRA 3N8DA 4IHJF 3U54A 3VMMA 2YZMA 2NU8B 2W6MA 1KUTA 4ZOLF 2NU9B 5BPHA 5KX5F 1ULZA 1KC7A 2CNVA 2Z04A 5LA6F 3RUPA 1BNCA 2W6QA 3WO0A 2I87A 3WO1A 1M0TA 4WBNF 2GPSA 1JLLB 3KALA 1PX2A 5FNVF
chains in the Genus database with same CATH superfamily
4UHDA 2XVXA 1ZJZA 1WQ4A 1XALA 4FNAA 2Z2ZA 4BE7B 3DV9A 4H6WA 5C5DA 1EKVA 3H3VH 2HFKA 3UCEA 2C5GA 1YQXA 1LSUA 2B1JA 3RAPR 4FILA 3PWZA 1U28C 3OT5A 1FFDA 3EARA 4WX2B 4IOLA 4PSDA 2R6CA 3TGPA 4OUDB 4AM8A 1WUKS 4LOHA 4JQCA 5D6NA 4BJ6A 1S3IA 3VO8A 3D3WA 5LMCA 1RXCA 2CMGA 3I2JA 3UZOA 1E2KA 4DY4A 2VP5A 1OIWA 4OHVA 5TQJA 4L9WA 3ZU4A 4DKJA 5KQLA 2IBSA 4C4RA 3VPAA 3QPVA 3MINA 4WOPA 5FHRA 3GJ3A 2AFIB 1UMCB 4BQOA 3SAJA 4AMBA 3T7TA 1KHTA 4NMHA 4L51A 5BR7A 3SC4A 4FFOA 4BX2A 3GNQA 3DW3X 1SHLA 5HK8A 1UBJS 3B20A 4FFVA 4B83A 4LHYA 1K1EA 4YJ2A 1XUOA 4LSWA 1F20A 2RK3A 3ZHVA 3KT0A 1PZNA 3S81A 3WIVA 2HIAA 4FDLA 4X64H 1DINA 3ACDA 4EG3A 1HYGA 4F04A 2Q3FA 2FU5C 2ZR7A 3ICPA 3BAFA 1AS2A 1Z9BA 2VBGA 3B3GA 1YUNA 1BE8A 4LKRA 4CM4B 2ZYAA 5C35A 4H16A 2WG0A 1S0NA 1SG6A 1UZNA 2WW8A 2ZM6H 4BC0A 3T12A 2Q3HA 4FFWA 1RXYA 5ARDA 4RMNA 3GCDA 5EC8A 1XJWA 4IAJA 4O7VA 5KWIA 5ALNA 1Z4LA 4BFZA 1WRBA 5ALLA 3KJZA 4KDCA 4EATA 3R0JA 4JI7H 2YIDA 3IAS1 4EEQA 1BMFD 2D0IA 1ZS9A 3IT0A 3QFTA 3BICA 1Q84A 4QD3A 3WDMA 1NZDA 3IEKA 5HZKA 2WUGA 2KLBA 3CRNA 2ZYWX 3TQ1A 1E5LA 3EXFA 3ECAA 1GKUB 2F1HA 1BDIA 1JECA 4PLTA 3AQIA 5CG1A 1ZOLA 1J2TA 2GD0A 3TQIA 1PW5A 4IF6A 4NQRA 9GPBA 5LOVA 1P4HA 3ELYA 4QQRA 3ET5A 1E2GA 2Y05A 3BBPA 3JQEA 2G08A 3RU9A 4MYSA 4M1ZA 4EI2A 4KBGA 4K9NA 2Z2YA 3TPZA 1KK3A 1ZR4A 1OKKD 2VJNA 2GDZA 3LPNA 2P77A 5A3JA 4JITA 5FBRB 4Q1CA 4S1VA 1MRZA 5B58C 4KE9A 4H3SA 2AJCA 2JH9A 4BTEA 2J08A 4FMCF 3UT0A 2DQSA 3CMCO 1KR5A 2CJWB 4L7VA 2AEJA 2MSCB 2G9VA 2LW7A 1NT2A 2Q2WA 3UJPA 2Q4TA 2PV7A 3CEPB 1G0OA 1HE5A 4D0LB 2CW5A 5EAIA 2QQ5A 4DC1A 1EM6A 1YHNA 1FTYA 3U48A 4TLAA 3TW6A 2J0EA 2XRYA 4RY2A 3AW9A 4H7FA 4H17A 2JK1A 2IPOA 3UZBA 4Y6SA 1LK5A 1ECGA 2NYVA 3CUTA 4WCFA 1S2IA 1JU9A 3O9ZA 5ALSA 3RC2A 2ZZNA 4JBNA 2ADMA 4FGWA 4RVFA 4I50F 2P7HA 1YBFA 2O5RA 3SOPA 4FCVA 5HQ3A 5ICEA 5FULA 1MQ9A 4R8KA 3VMMA 4M4SA 1G5TA 2WUEA 3MJHA 5DYTA 4FT2A 1KC7A 4QULA 1NQTA 2PV0A 3RUPA 4O4IB 4IIFA 2FUNB 1F5NA 5D5PA 2BFMA 1V3UA 1RQLA 3GF4A 4TTIA 4J49A 2ZBGA 5UKDA 5IDWA 2CWWA 4TLEA 1UDWA 2XCSB 2I7VA 3CNLA 2HK7A 5CX1B 1SKUA 1WB5A 3RK0A 3ELBA 3S5UA 3B9PA 3PFCA 3ZI4A 5BN4B 5HCIA 3CX7A 1VRVA 1PJCA 4NXMB 2FKLA 1RYMA 4QWEA 4UBNA 4JODA 2Z9CA 3RS8A 1G20B 2OCIA 1I51A 5BN3B 3HEAA 1FLVA 5H81A 1V6SA 4AMZA 4V24A 3KYHC 1UJ4A 2RHCA 3HNRA 2QZPA 3EIUA 1XRMA 3IELA 4XGQA 3TMYA 1AA6A 3S29A 5C1DA 5P21A 2AMJA 5CM0A 5E2AA 1VYVA 1QG0A 2V4MA 2FPPA 2OUKA 1H6DA 1X1AA 4LIPD 3GFQA 3N5CA 2FK2A 2B8JA 1ID1A 4RADA 1Y89A 3UHJA 4EJ0A 3CTPA 1E66A 3O8RA 1GL7A 5HVNA 1XTUA 4ESHA 3DMFA 3JVVA 3OEED 2QRKA 1KR2A 2GHTA 5K2OA 1DNPA 4DNFA 5LP6A 2DUNA 4JHXA 1AUOA 4EJ6A 1EQ2A 4CG0A 2R8ZA 1Q22A 2NZWA 1T3ZA 1UXHA 2IEZA 1Z22A 4B4OA 4D43A 4K9OA 1UAGA 4CHIA 3EG9B 4J16C 3EZ9A 5FOWA 1W85B 4AMGA 3PN1A 1Y3CE 3R4VA 4KAAA 4DXAA 4RETA 2Q6TA 4REOA 4R1MA 1SXIA 3ORHA 1PKEA 1SK9A 1RYNA 1V45E 4JJEA 4N40A 4PZUA 1FRQA 4MKHA 5T6MA 5DBFA 1OWLA 2PSSA 2J5BA 4EO7A 3OF3A 1VCIA 2OT3B 3DBLB 2OO7A 1D4ZA 4ED3A 4DJDC 4CF7A 1GCAA 4XJVA 4KTTE 5C1OA 3BXFA 1MC8A 1E9VA 3I53A 3AKYA 4KW7A 3ZY2A 1OILA 3KYCA 2BSAA 2VPYA 5KBYA 1KOJA 2ZBUA 4QELA 3D2CA 2WB1E 3AUYA 5AW6A 3JS5A 4XYLA 5BV0A 1VHDA 4KB5A 5ALVA 5GJWC 4PONA 5AWFC 2VYVD 1Y1VG 3U7QA 4Z4HA 1RRFA 1QZUA 1QG2A 3P0HA 3EBPA 1TE2A 4OIFA 2QN2A 4L4SA 3B89A 1VE9A 2DJ5A 3AVVA 3UQZA 1ID8A 1GTG1 5I4IA 2H4FA 5JH7A 1UJ2A 2AX4A 2RDIA 3I42A 1Y3AA 1PD1A 3RDPA 3FZYA 5FLKA 3N0XA 2O14A 1RLJA 4QTZA 2INGX 2ABJA 3FRIA 5HKOA 2GXQA 4D9KA 2QPTA 4JB8A 4IJUA 4LISA 3OUZA 3IP3A 2Q9UA 1DC4A 1LPNA 4IXNA 4R1LA 3FWPA 4CMIB 4Q39A 1BQEA 3N6XA 3CT4A 4MW2A 1LA2A 3E4DA 3GILA 4NCIA 3KTDA 5EWMB 1FFEA 1FDWA 1CUSA 4XWYA 2ZVQX 3ODGA 4FS8A 2GX6A 3R6GA 4ZICA 1G7SA 3MWGA 4KIJA 3FYUA 4O1HA 1GNLA 2Q6VA 3HFJA 4F4WA 4B33A 4MCJA 4AURA 2JGDA 2YY5A 4NV3A 3ADDA 5F1YA 5JNLA 3LCRA 5CFQA 1OE0A 1TZKA 4S1PA 3L06A 3QU9A 1T2FA 4DL3A 2AWOA 4D4IA 4X1OA 2I4NA 1PTJA 4G1CA 3G5MA 2ILVA 4FCWA 3EPGA 3HI6A 2PR2A 1YKGA 3I76A 4CMCA 3HBMA 4BXOB 3H4DA 1ZOPA 3HEBA 3EQ7A 4O4LA 1H9AA 4BN0A 2EATA 4IDNA 2DY0A 4UUGA 4BWGA 3L7KA 2QVBA 3NNNA 3LWNA 2A0YA 4HV4A 1DLIA 1V9SA 3LFTA 5FUXA 1M2VA 2YICA 4F9GA 4W5HA 4GM4A 1AS0A 2R8PA 2ZAMA 5KDLA 2Y9PB 4MUBA 1TQHA 4FMPA 1XK6A 5EI5A 1R4AA 2XDQA 3OLQA 4NEGA 2HWWA 3OX4A 4EOGA 4L28A 3D59A 4NXMH 4RJJA 4DL2A 1RJQA 2Q1UA 4ZGBA 2WIKA 4HOYA 4IHKA 1C8KA 3SC6A 2I22A 4BBJA 4TLCA 1PQPA 2X7HA 2WM3A 4JLPA 1I4TD 2XGOA 4F1KA 4HN2A 4K9SA 2PKCA 3LFUA 1LC3A 3AI1A 1N33B 2PQMA 5T57A 2C78A 4UPVA 2IS1A 3FIUA 1YR7A 3A04A 3B1YA 1KY3A 5I45A 2CXQA 2DM6A 4MKZA 4R0MA 4HJXA 5HSGA 2OHGA 3JATA 4UNNA 3OVMA 2ZAGA 3SYLA 5CA1B 4YAEA 1JLKA 2VSYA 3Q5DA 1UQRA 4EF6A 2CV2A 1GN9A 3OQVA 3INNA 2O0HA 3X1WA 3DMNA 4AS2A 1SPBS 5ICMA 1HTTA 2FZ4A 3HTXA 3PCXA 3AF5A 4ITUA 2Z09A 5DXAA 1GD1O 1T2DA 2H57A 3TLYA 3EA0A 1XVUA 4D26A 3MGKA 4Y0VA 1FNMA 1YR3A 3LT1A 2AOUB 1Z7BA 2J5QA 2JHCA 1S2OA 5BUCA 1T1GA 5KC8A 1UKVY 1RCUA 1CR6A 3CR7A 2PSFA 5I5XA 2YWGA 3AP2A 4TTVA 1X77A 3MWEA 3JQRA 4J4HA 1BD3A 3PB3A 4TLBA 2FSSA 1JUDA 5K0FA 4O7LA 3Q0IA 5BSEA 1ZWKA 5JI3E 1SXJD 3G85A 4Q3NA 1VE5A 4HO1X 2W2QA 1EX6A 4O29A 3WWDA 3TAUA 2IYOA 1GQQA 4I4CA 1PHPA 4Z0PA 4Q0MA 3ZJVA 1ZNYA 1T91A 3FKQA 3G8CA 2REOA 4QNNA 3KB8A 1ZHSA 1A9YA 2MCFA 2A33A 3FCUB 4ZFNA 1CUUA 4G8CA 4LZZA 2C1ZA 4KXNA 5M5BA 1KARA 4DR4B 1SD1A 5ADHA 2IHTA 3WNZA 5HV6A 4R3WA 3OI7A 5AQEA 3H8VA 2IA6A 1R6DA 2FEKA 2PLWA 2FOLA 3DT8A 1C3OB 1L5QA 4Q03A 3JAWB 1ST3A 4V0RA 4BQEA 4EEXA 1ISIA 2R7ZA 3AF3A 4H0CA 1MT0A 3D02A 3LYUA 4QJIA 1ULUA 4CWAA 1U9ZA 1V6CA 2C7BA 1HOXA 4KG7A 1CQJB 3I1YA 3BMOA 2Z2KA 5GINE 4KKVA 4RVHA 3ADOA 3TS1A 2FLWA 3VU9B 1S9FA 5JJKA 4E70A 3DBRA 1Y7TA 2CMFA 1L9KA 4YGXB 2NZXA 2XQKA 4A0RA 4LDNA 5A9SB 3RVSA 2IU6A 1YZNA 3M4XA 3BL6A 3H9QA 1WP9A 3X2FA 2JLQA 2ACWA 4R7ZA 4ZJUA 4Z1MA 1OI2A 2YHSA 2P9BA 4YB8A 5A06A 4P0QB 3GYGA 3QVOA 1XD2B 4HR7A 4B3GA 3WZLA 2IEGA 4QDXA 2FE3A 4TRMA 1GZDA 3C3KA 1O94A 3D6MA 4GO1A 1VMEA 3F96A 3WO1A 2B78A 4BX8A 4C78A 2I3DA 3GUUA 3EODA 2DCUA 5HTOA 4JWTA 5LBTA 1WDKA 2H7YA 4JLNA 2OAGA 3WKEA 5IZCC 4IMJB 2Q0QA 2WHPB 2FVYA 2GN6A 1JZTA 4DMUB 1SAYA 5J3JA 4RPHA 4W9NA 2ZYIA 2ZJ8A 1QIMA 4R8RA 4BNIA 5AP9A 5I4BA 2XTNA 1WZEA 3A11A 1SGWA 1CB0A 5FUMA 1CTQA 4Y6LA 3KKEA 3H1EA 3HA5A 5CM8B 5JYCA 2GM5A 3HDVA 2BFDB 1Z0AA 2J59A 3Q1KA 5IBQA 3L07A 4N0EA 3UAYA 5FWAA 4AFNA 2IE8A 3N2IA 1BCSA 1RM5A 2PQ2A 3EFOA 3G5AA 1CYEA 4IFTA 4B6SA 1E2MA 1Y37A 3P96A 5JRZA 1J56A 3ZU5A 5FOTA 2IYNA 1DRVA 4L8VA 2BP7A 4Y0AA 3CVWA 3B7GA 3DP7A 3O8OB 4FOTA 4TVOA 4PANA 1PQWA 5TPZA 4JLWA 5DOZA 3MLBA 3QWIA 4AZSA 1WP4A 2VA2A 2G5GX 3W77A 2X0FA 5ALTA 1V47A 1N33H 5DCUA 1TYCA 5I8PA 4E5MA 1M1YE 4G9GA 2J85A 2WJJA 1YTUA 1U2SA 3PC4A 4RA6B 1W4LA 4PCVA 1GDDA 3HR4A 1HWYA 3WSTA 5TVGA 3VV3A 3KWJA 4FR0A 1ZISA 1YFZA 2GRUA 3OPXA 4FUQA 4LZNA 2PWYA 2JA5G 3I6MA 1UBLS 3OUTA 1G0NA 2GDJA 3M9XA 4OB6A 5HM8A 1Z62A 3LMLA 3K1AA 3CH6A 4GLLA 4I8XA 5ERXA 3TFOA 1CKOA 3CKYA 4F5DA 4P22A 2C9CA 3GEHA 1PZEA 3B1XA 4BVBA 5K20A 3AIKA 3FCEA 1IZYA 3IMGA 4WFQA 4ECVA 4CHTA 2DSTA 4EA6A 4RV4A 1VIYA 2REXB 1LY1A 4NCAA 5HRUA 1PR3A 1E32A 5DI3B 2NUBA 1GHTA 2O1SA 5IF3A 1JDBB 5KVAA 1E0SA 5CB4A 1JBQA 3E5HA 3LQSA 3V42A 1LPBB 1LXCA 2WTNA 4NBWA 2G72A 5JCXA 1C4KA 1RWBA 1MN6A 3MFYA 2H92A 4LOKA 2HD4A 3LXRA 1IBRA 1F7UA 3HJHA 5JISA 4O63O 4JI3B 4EB8A 4QSHA 4EITA 4ENQA 3TY8A 5I9LA 2R7LA 2ISQA 3IE0A 1Z8FA 1DL5A 4ND8A 2EKDA 5T4BA 4YP3A 2XKKA 4XKJA 1V26A 2IITA 2J3IA 2JIZA 3DOHA 3EZ7A 3OIUA 4DR4H 4ZDKA 4TKVB 1V25A 3V3KA 1QP8A 1SH7A 3WIOA 3C6XA 4F3TA 4OXIA 2DHRA 4TLMB 3OTOB 1XEXA 3TSZA 2NSLA 1TUGA 1VPLA 1IVNA 1HO3A 1N48A 1DJOA 4WFIA 1AKNA 3I83A 1SULA 2L42A 2W8KA 1CQWA 4TLLB 3PA6A 2E4XA 1RTKA 4GZLA 2C98A 3QITA 2I3BA 2PUJA 1K89A 5M04A 3QKTA 4PR3A 4LRSB 1Q16A 1YZ3A 5BSMA 1X86B 1ABEA 3JYOA 2F43A 3UJAA 1IRIA 2DRIA 1HE3A 1CYDA 2IZ0A 4YQFA 5DLPA 2P4UA 1SD5A 4MR8A 3F6YA 1XRJA 1NXTA 3JPWA 4U8GA 4PRKA 4TXNA 3ND8A 5JHHB 4KP7A 2HK6A 1NJGA 3Q5EA 3BQMB 1GG2A 2VKQA 3RHFA 3BE6A 3C1TA 4JLUA 1YIAA 3MSXA 1U63A 3IODA 3NEAA 2O2EA 1VKHA 3NCTA 2NX2A 3DYVA 5KMGA 1T4BA 4K28A 2QG4A 2V4RA 4GPZA 2R6GA 2ZS7A 4E15A 1L8XA 1RRPA 3WTCA 1YC2A 2YWRA 3WGZA 3M6LA 5CH8A 2YXEA 2ZIVB 3DDWA 3KQVA 2P2CA 1G3UA 2E5LB 2QM0A 4X7MA 1T34A 2G7MC 4TRRA 1H4VB 3QX9A 1CR1A 1U5AA 1BDBA 1GFWA 2WJ6A 4RKFA 1NN1A 1Z6PA 1UFOA 4OG2A 1H05A 1Q1QA 3MBOA 2YJ4A 4K9MA 2LNDA 4Q4JB 3KT8A 4WN9A 2H16A 4TKLA 2JI4A 4Z86A 1PFGA 2QM8A 1E6UA 5C5EA 5CHYA 1ZMTA 1SXQA 4KAJA 1HTWA 3LYHA 4Z9FA 4YPVA 4PRLA 2C0CA 5F7JA 5JT1A 1KQFA 1EJ0A 4M0LA 3LBNA 3F3SA 5B37A 4J3FA 1T13A 3BF8A 4HTAA 1M2HA 4BCCA 1MJFA 1TMOA 2BKVA 3V8QA 2RC5A 4HLUA 4MW0A 4DCOA 3QYPA 4DMFA 4WECA 4YCMA 3VNRA 1PNTA 2CL7X 2W8ZA 3GDGA 5LWHA 3O82A 1U2TA 3K3VA 2Y68A 4IEIA 4D6XA 4A8HA 1YUMA 3IIJA 2OV4A 1PS8A 5DT2A 1ZJYA 4YAWA 4JLVA 3E0QA 4JIMA 2IU0A 3K5PA 1MNQA 3RABA 2GXSA 2E0IA 5JG7A 3WX0A 1P5FA 1O5OA 4EBCA 1CPYA 3CR8A 2XOXA 1W76A 1WETA 4DM7A 2D06A 1M0WA 4QTYA 3EPLA 4WV3A 1GSOA 1CUAA 4Y7DA 3L9XA 1J24A 1H1DA 4G0XA 5G1PA 1GRVA 4UC0A 3VR3A 1I2MA 1YR6A 4EECA 2JL1A 1LZKA 3THXB 4R2MA 4DV0B 2A86A 2C1EA 4RDHA 3JZFA 4TTTS 2FNAA 3FSJX 1K7CA 3O4IA 3F4BA 4C6TB 1E4FT 2VXBA 5EIWA 4Z4EA 3NTUA 1FPQA 5C3EG 5EJFA 2XYPA 2HX1A 3SFTA 3DZDA 1V7PC 3RE1A 5J2UB 3UW1A 4A36A 3K0KA 3A6KA 1I2LA 1E1RD 3LOPA 4HGPA 2WSYB 3TLXA 2R7MA 4YRCA 4WKOA 1XTJA 1GKLA 3KLMX 2VJAA 3MCZA 2NTEA 2C3YA 4F84A 2DAAA 4HUQB 5E25A 5TMBA 3F49S 2Z6UA 1XXHB 4UNRA 1YE5A 4DDUA 4P92A 5AXAA 2AG8A 1ORDA 3PGXA 5C5IA 4BGUA 2VWGA 4DR6B 4HH4A 2V5AA 4JI3H 3WGGA 3OX3A 1JB9A 2H2HA 4URFA 4Y30A 1MC1A 2B4TO 4MQFB 1YKFA 2CE7A 1N6NA 3GZNB 4RTQA 1FX0B 2HNAA 3AB8A 3RCBA 5AW3A 1M1UA 4RLHA 5I7VA 1KKUA 1PV1A 4GUDA 2BAGA 3VR2A 4Z4IA 1C30B 2R1VA 3UT5B 3TINA 1NBOA 1PGNA 4PC2A 2SKEA 3L0CA 4FJ1A 1GCIA 4JP2A 1KYIA 4LPSA 4JV0A 3PJDA 3OTOH 2R8JA 2O0MA 5FWYB 2JVJA 4IIXA 4ZHSA 1RQNA 5LL6b 1E1QA 3FH0A 2IF2A 3GLFA 5HBGA 4FIZA 3S8YA 1BZYA 4FX5A 1N9ZA 2ZAIA 4QEZA 2C99A 3WGTA 1V43A 1S4MA 2VJCA 4LTMA 5A9TA 2JVKA 1JMKC 3WNQA 4REMA 4IV0A 1TO6A 1BS9A 3RVMA 5JFOA 3PXEA 1OR8A 2WY2D 2V7UA 3CE6A 3T9BA 2IV7A 2EL9A 1B3BA 3ZY6A 2Z98A 4RNCA 1XC7A 3E8MA 1M1ZA 2IA5A 4C6SA 1HT2E 3H5IA 2HPAA 4Q82A 1G7RA 4EL0A 4FMDF 1DU4A 3S28A 5SV2A 5IDYA 3SBDA 1B6RA 2X2PA 1JHUA 4YREA 2VP0A 4P31A 2C7OA 1RP7A 4FGJA 1E9SA 2HZBA 3AINA 1YZFA 3AL3A 1Q92A 1ZR2A 1D2CA 4OY3A 5G0UA 3MJDA 3UXEA 5U9CA 1A8PA 4PM4A 4WZ6A 1SKBA 1D6NA 1PYDA 2VDJA 1HYHA 2R4TA 2UVPA 1RRKA 2Z3VA 1QG6A 1DIGA 2PL3A 2PS3A 4GW3A 4WZZA 5IYZF 2UV8A 5D87A 3UMVA 2DBYA 3ZE9A 2FQYA 1H2WA 4HX9A 3U19A 1XU7A 4MWSA 4B6GA 2QZZA 3DHWC 1NVVQ 2VSNA 1AA9A 2YJTD 3K73O 3ZWMA 2E5LH 5ESWA 2G4LA 3RRJA 3OZDA 4QSMA 1PF7E 4JGIA 2AZ4A 2X7JA 3P9PA 1Z6GA 2JLUA 3L6BA 3T7JA 5AOCA 1Z18A 1AN0A 1XVVA 1NV8A 1ZVKA 1DCKA 2RB5A 2QJOA 2YVKA 4HVAA 5CHEA 4A3FG 1RBZA 3B6ZA 2MSEB 5JWRA 3BJRA 3LC1O 4BKOA 4CM7A 1CUZA 3OJOA 4S05A 3GN2A 2BLLA 1R4MA 2GVZC 2O8EA 3ENWA 2J6UA 3DE0X 1HC7A 2P9GA 3KELA 3D3JA 5AI9A 1BAPA 4JYAB 3KK0A 4ZMRA 1R0SA 3M3DA 3AGPA 4WAUA 2X40A 2ORVA 1XA0A 3L6OO 4DR3B 4KFUA 3BWEA 3BSFA 3LCMA 4RIHA 1DUIA 1Q77A 4R1NA 1U9JA 3Q7EA 3K70D 1H0HA 4ZHQF 1G38A 3DLTA 4I8IA 3IPRA 2W6OA 1TVKA 5AKYA 2CZCA 4JJGA 4DF3A 3MGBA 3HEMA 4JL5A 5LYJB 3QBJA 4ECUA 4JC4A 3GVXA 4PSVA 5L9XA 3GRAA 5BN1A 2QLBA 1NBAA 4IDEA 4UFNA 2G1PA 1OTHA 3FFXA 4DV0H 3QOWA 3IB3A 3Q98A 3G2OA 1K9VF 1H6CA 3JARB 3PUXA 5I7OA 1G64A 2VTEA 2UUAB 1I1NA 2OKCA 1RYRA 5AJYA 4GOXA 1PJ2A 5CRIA 1SCDA 3MRXA 1N5MA 4I55B 2VQ6A 5CK5A 4N3GA 2K7ZA 4KI7A 3TRFA 5BW5A 5FI5A 4LNUA 3STHA 4F3YA 3RB4A 3EZ2A 4WGFA 4C3UA 4WL0A 3WL7A 1DV1A 2ZT5A 1XDUA 1M3SA 1V8OA 3GJSA 2FB9A 3B8HA 3OD5A 4TQAA 2RK6A 2LKDA 5BQ5A 4DR6H 5H9VA 1JSCA 3WRYA 5C80A 3PHLA 4WY8A 4PGHA 1RWNA 2HTFA 5BW8A 4PZ0A 4W63A 2ALJA 4K9PA 3A1EA 1P4AA 5I7HA 4J9QA 1BXGB 3M2TA 4RTNA 2CNWA 2WAQE 1SXJB 1G5PA 1D9ZA 2XMRA 5CA0B 3KP1A 2OQIA 4LJ6A 3NHFA 4V02A 2ZAYA 1WMEA 4AJNA 1I32A 3ABQB 1J2JA 4L76A 4G9EA 3WGIA 1MIOA 1RLIA 2OLJA 3SF8A 2M6SA 5DM70 1QZZA 4RF4A 3E3NA 3K4PA 1V7QA 4NDZA 4URZR 3LX6A 2R6R1 3DTVD 2DB3A 4NYMR 1NPDA 3PRKE 4MB0A 2QN1A 1ISJA 3F6RA 3ET4A 5CJJA 4G89A 2QSYA 2YWDA 2QE7A 4Q24A 3WL4A 1ZVQA 3QEMB 4NZ9A 3ADPA 3ANLA 3IR7A 5CT6A 3Q2KA 1H69A 4U2GA 2Z02A 3QXHA 1XZKA 3IBYA 2I1LA 4E22A 1L4FA 1SKAA 2XTAA 4O7NA 5KINB 1LPPA 4HQ6A 3ZDYB 1P31A 3N6RA 1HFWA 2X58A 4ITRC 4PEVA 5HTKA 4MVJE 1IXYA 4GMHA 3U4QA 1GT6A 1Q3HA 3IG0A 4Q3EA 3WKAA 2NUPA 4NE7A 2DPJA 4MI1A 3BRSA 1C0EA 4Q47A 1SUSA 2A57A 5KTYA 3GFPA 4KGXA 5H02A 1M1XB 1DMRA 2A9QA 2DVMA 3B52X 1Q0HA 1T1JA 2QD3A 5JADA 5EFZA 1A69A 1MABA 4UZEA 4LGCA 3GTJA 1RHMA 5DBGA 3N0VA 3R3XA 1JR3A 1L7AA 4GPBA 2JH8A 1C3XA 3NC4A 4UCRA 1JQDA 2J41A 5E2IA 4CM6A 1JE0A 1RYDA 3PX2A 2I62A 4O4HA 2AD5A 3OMWA 2EYUA 5C1PA 3ADCA 2XUHA 2C7PA 1Q11A 5FYQA 2O03A 4DLLA 4J9LA 4RNOA 4ZIRB 2AXPA 1SXJC 1OCEA 2XUIA 1SKMA 4YX9A 3RBEA 5DJ5A 1JXLA 3F5SA 1ATZA 3S1AA 2PMKA 5K0SA 3GFSA 3ZZMA 1WDWB 2LXNA 5IAKA 2Q8NA 1XB2A 1TTHA 1CUBA 3VC2A 4NLGA 4JYAH 1YR8A 4EA7A 5FAKA 4D92A 1WXDA 1XZBA 3Q1LA 4DR3H 3K5HA 4AP6A 4NARA 1VBKA 2BH2A 1POWA 2N47A 4XQCA 3IV6A 1BOOA 4ZYWA 1TU3A 3G1WA 2X5KO 2J32A 3SKVA 4DIOA 1CF2O 1NDQA 4U2KA 2XSZA 1QGUA 3G1UA 3PR4A 5AM5A 1MJHA 1BW9A 3Q8KA 1NVAA 1UPXA 1LWNA 1SB8A 3N76A 4AQ7A 4DN6A 5IPFA 1VA5A 1BE6A 2BBSA 3ETHA 1R27A 1IUKA 5LLTA 4N3BA 5JVDA 1BDHA 1AX9A 4QUBA 2VFAA 4WOKA 4PG7A 2H8GA 1QORA 3H2YA 2DBVO 2VXYA 3IHWA 3BD8A 3ON5A 4W5WA 2E85A 3TQRA 2UUAH 1XIVA 1KMNA 4XIIA 3KYDA 3I32A 4K7JA 4Q1EA 1OBCA 5CMLA 4NV1A 3L1HA 1AO3A 3WISA 3ORQA 1Z12A 3PK0A 4ZAGA 1IJBA 2CNDA 2XEXA 5TNXA 5COQA 2DZDA 3SVZA 4ND7A 1I01A 1F2TB 2VHQA 2Z3ZA 2I7XA 1Y1VA 1XV5A 5AJHA 2GN9A 4DFDA 4GPEA 2OCLA 1X1DA 3HKBB 3K9WA 3AW8A 4RTSA 3W7VA 2BHLA 4LYYA 1PL6A 5K3EA 1KFBB 2JAOA 3OJWA 3PEFA 4CEJA 3SHOA 5F9FA 1O95A 2FSUA 1NBME 2YRFA 3JALB 3RS7A 3DGEC 4BFYA 4UCOA 1U80A 1V3TA 1NYRA 2BN4A 1ACLA 3WMRA 2R25B 5KX5F 3A1NA 2HGZA 1Z4KA 4PO1A 4BJ1A 4OXRA 4JFAA 3IBFA 4DIUA 2Q0XA 1A04A 3WQHA 1C7RA 1T24A 4A3EG 4FTWA 4QUEA 4BEVA 2CMDA 4EFMA 4Y18A 3U60B 1N5RA 3V46A 1JL3A 4I4TA 5BNFA 3VC3A 1EGAA 3I8SA 1G21B 1JMYA 2O0LA 5LZ9A 2C8KA 3NJ4A 3RADC 2ZWPA 2QP3A 3ONVA 4HWGA 1G5HA 1K7FB 3NBAA 1R8JA 5EJMA 1DTWA 3K4HA 4HSGA 4Y8VA 3WWCA 3TLGB 5DG8A 2RFLA 2GPJA 3UAWA 4CEHB 2ZJOA 2QIOA 1DX9A 2FVXA 3HKDA 2QBYA 2WG1A 3EZNA 2RGUA 3MMZA 5CR5A 4IR9A 5LQNA 4XVHA 1CZHA 4RLSA 4NMMA 5C18A 4RHCA 3L0BA 1MNAA 5DXFA 4XFKA 5JJ5A 2Q6OA 1UT6A 1P33A 3IOMA 1HGXA 2BFOA 4QRHA 5CB6A 1GZ5A 2ID9A 4M7OA 5CCXA 3KHGA 3PLRA 4K3VA 2ZREA 4MKIA 3GX1A 4QM7A 2YCLA 2YASA 4K0KB 4ZVVA 3I3SR 3OTHA 2FRDA 4TUYF 2PL5A 5EKUA 4O4IF 4NOJA 3B82A 4YC7A 2A7QA 5AM4A 3PO3G 3A4NA 1FNSA 3V1UA 4HADA 3DZGA 1AKRA 3BD6A 2MIIA 2O7QA 4OBXA 1AUXA 3CIFA 4XDZA 4ZI3A 1C4OA 2RGEA 5E3JA 3WBJA 4XRGA 4IBOA 3AHHA 2B8EA 1DJNA 3OFKA 2C31A 3LKVA 3T8YA 2C82A 2HYIC 3A58B 5CYGA 4DYDA 4PZEA 1FUIA 3ZDZB 1QF7A 1PGJA 5EZYB 4OOFA 2D4AA 3X43A 3C6KA 1BOFA 3LUKA 1B1AA 1IYZA 1U7ZA 3RWOA 2JLZA 5HDBB 3SM3A 3WKBA 5FOUA 3A6HA 3THSA 3HE3A 4NBLA 1K6MA 3QVKA 5F64A 4K87A 1T2AA 2BONA 1ZK2A 4S04A 2OAP1 3TRKA 1Z0ZA 5T8KC 2PLAA 3OIWA 3W0LB 2BI7A 1FKAH 2ZUWA 3IOYA 3D0KA 4TT3A 3UK6A 1O6FA 5IYDG 3NVKI 1K7XB 2COEA 2PWZA 3IRVA 2X6QA 3QWBA 5KSZA 2IUSA 1ZXLA 4RMGA 2RJ3A 1YASA 1YAHA 4BRUA 4WESB 4NH0A 2ZU6A 3S2ZA 4Z6KA 1USIA 4QDTA 3GDWA 1WV0A 3VSBA 3CLTD 1KP3A 4RA9B 2A59A 4XSHA 4LMAA 2HQOA 3DDCA 1M2NA 1RJ9B 4ZYYA 4BMPB 2W2OA 4KDEA 1BXKA 4OQNA 2C7VA 3UUWA 1YMVA 2YKGA 5BWTA 2W6NA 1Y6RA 4EA8A 1G5QA 3GTPA 1MW8X 3OKCA 1ENYA 4FW8A 4KC0A 4MVXA 1OX6A 5DM1A 4J76A 4KPGA 3VAYA 4X3OA 3N2KA 1L1QA 1IXKA 3MAJA 2I2XB 4P4NA 4MV3A 5IYBG 4LWPA 3T7RA 3E1KA 1NC1A 5IW8A 2XZOA 1P61B 5HBRB 4R6WA 1ORRA 3PPXA 1GEGA 4RWZA 1TWFA 5DHFA 4B74A 4ERNA 4AJPA 3NYWA 1H2YA 5C5CA 3VVCA 1D9XA 2IP2A 4D44A 2QUAA 4UW9A 1E3WA 2IEYA 3Q3IA 2F9LA 3N70A 4ZCPA 3PT9A 1NJ5A 2XMZA 5FD8A 4DYHA 3KG2A 3KWFA 5GPBA 1DFGA 3WB2A 3SJBA 1ZD4A 4LMPA 1I1LA 1CIJA 3MJCA 4CV0A 3WLLA 3L5OA 3F7NA 3JYLA 4XGKA 1O87A 2WA2A 3LLUA 4MRSA 4NVRA 3U26A 5TEWA 3OU7A 2OWDA 3HNPA 1OBFO 3CSUA 5BQFA 3T4EA 1XZHA 2GBFA 1L3BA 3R7WA 2Z5GA 3X1YA 2LGJA 3RYCB 1L7PA 2WQZA 3QX3A 4ECQA 1OAAA 3DDUA 3BQNB 4DCGA 3RFVA 3KQKA 2P79A 1RI5A 1KYXA 5CGZA 4TS3A 4EARA 3FPLA 2D3WA 2I0FA 4KMSA 4XWOA 1I2BA 1I3MA 1PZHA 3MUOA 1L5NA 4EUFA 2O7SA 3PEVA 3Q8LA 3OJEA 4MVJF 3VR5D 4WXYB 1EDEA 1TW3A 3GOHA 4KH1A 2NO0A 4UBJA 3OECA 4XEUA 1TYBE 1G8YA 3FI9A 3BRCA 1TVMA 4J0DA 2VJBA 4H9GA 4BLSA 4AUKA 3DGFC 4M8SA 4UBOA 1KC1A 4MZXA 5DX0A 3RIYA 1QGDA 1Y4SA 2FZCA 1FFSA 1P39A 3NUAA 3JD4A 4MV6A 4QDKA 3L1IA 2V7TA 3R3JA 4UJ5A 1GUYA 3ESZA 3HB9A 5DNUA 1XKXA 2CK3D 4JP1A 3ZIUA 3H8WA 2C7RA 5DNAA 4TSFD 4HVCA 1Z28A 5JAZA 3HOVG 2WMYA 2REBA 3F73A 3OZGA 1LLDA 3W5AA 1SCNE 4K0KH 4F3RA 1VG0B 1QS0B 3GFRA 2Q07A 3U80A 4KQHA 2YHIA 3R23A 3AOGA 2FP4B 5JSZB 2J46A 3Q9UA 5L1LA 5CURA 3SNHA 3UJ6A 5LJIA 5KFIA 2VDOB 2YJ5A 2EIHA 3LXUX 2QAIA 4CM9D 3W7AA 2HDKA 5TLSA 1QV9A 3RU3A 4ED7A 2EWVA 1RPNA 3ZWDA 3U3JA 2OFOA 1UZUA 2GPAA 4ZQGA 4E33A 1P60A 3KUDA 5GM2A 4MPRA 2QD4A 3FB4A 3LUPA 1GAJA 1UT5A 2GCNA 5HRAA 4B3DA 2ZR0A 4NMWA 1I4WA 4FFBB 2JLXA 3BX1A 4PCAA 4WY5A 3N75A 3OP1A 2B7BA 1H4QA 2F1IA 1DAGA 5IAOA 2VNIA 2HVSA 4PPYA 3KVOA 4QGFA 2YWXA 1H85A 2Q1SA 3P9YA 2WUDA 2PLRA 3FNHA 4WGGA 3D0QA 1L4NA 4C7OA 1TT5B 3AHIA 5E1DA 5EUCA 3WOHA 1HE1C 4B47A 2V9PA 1HQKA 3HZZA 2W9AA 5CCEA 4M1MA 1NVUQ 1QTQA 1W4CA 3KU1A 4A6XA 3TVYA 4LDQA 2JA5A 3OPVA 3RYFB 2XUKA 1FFHA 4M2LA 3EXG1 5E8RA 5CA1F 5LNK6 3REGA 3V8EA 3K16A 4G2TA 1J21A 1GDHA 2OMEA 4R6XA 3F97A 1E1CB 3B1WA 2HADA 1LJUA 2GK4A 4FLMA 4BNWA 3QHAA 1ORIA 4Y1FA 4LXTA 3RVRA 1QQ6A 2B5OA 3SYNA 3SWWA 2YRWA 4IVPA 5J40A 2RG7A 2YU9A 1RZRA 2J3KA 5G2OA 1WMAA 4MMXB 1X0XA 3ENZA 4Y2GA 3UKDA 4NU0A 3QFHA 2ZULA 4ZV9A 2ZRDA 1JAHA 1V9PA 1TU4A 1WF3A 2BKLA 4EFKA 4U2EA 4MQ4A 3RS4A 1P19A 3WIUA 3GVIA 3K70B 3GLIE 4ZCRA 1G8HA 2A84A 3H1PA 3CW8X 3GV8B 3GEBA 2JFUA 4PHFA 4G3XA 3LTEA 2NPOA 1A27A 3IB6A 2Y93A 4G24A 2VUSA 4EDHA 3WY9A 2C4TA 2N0SA 3R4CA 4JUDX 3P2EA 3KSMA 4MQEA 1H8HD 4XD7A 3PT5A 3VZRA 1RABA 3THYB 3STYA 4ZDJA 5KPDA 3R40A 4RPLA 1BE0A 3E1SA 1IEVA 3M5DA 3U4IA 3L0IB 4FSXA 2QYZA 3FR7A 3I9V6 3RH0A 2D2VA 4AN4A 3VPCA 4TTSA 5L3RA 3GLHE 4CM8A 1DGSA 3BWDD 4XM1A 2VHCA 2BSQA 5JS6A 1YVEI 3I5AA 5FWXA 1VBNA 4YASA 3KPJA 1UP6A 4Q3KA 3SIXA 2VSXA 1JZQA 4DAOA 3R0VA 1PVOA 2ECOA 2FWAA 3GRYA 3VVMA 5EHZA 5FBWB 1R10A 2WAAA 1OY1A 3EC1A 3HN6A 2VHZA 4YPOA 1HZZC 2IT1A 3KHTA 5E6SA 4C04A 1U9IC 4LDPA 1B2LA 4PGMA 2YFQA 1Z63A 1JFTA 2O8FB 3QG1A 1K1QA 3AM4A 3IP6A 3CSSA 4X1KA 5FJ8G 1VZ3A 1TIKA 2M2IA 2FMTA 2GRAA 2XJ9A 1TJ3A 4MJLA 1W36D 4IP0A 4KUEA 4Z7NB 1SFRA 1L7EA 2PUDA 4CIXA 4ED2A 5IP5A 2IP1A 5EIAA 1TC1A 1HUQA 1NLZA 1CLEA 1CEXA 2B20A 3LECA 3TQCA 2D6FA 2JIRA 2FETA 2ZI4A 3GAAA 3WLEA 2JGIA 4J1TC 2ZRIA 2JGKA 2R60A 5BN5B 4Q43A 3ZY3A 2A1UB 2O2JA 3PW2A 4B31A 3G2QA 4DLTA 4OFBA 2Z4TA 3DTVB 3A0UA 3I1FA 1SEIA 4FMBB 2IYTA 2FWIA 1J8MF 2M6KA 1XCMA 1C3VA 2OXEA 2HVRA 2J9FB 4GVXA 5D1HA 1LRKA 5IWCA 5HEKA 4R3UC 5KNBD 3GJ6A 3R75A 3PU6A 2DQZA 3HY4A 3I62A 3BMNA 4E3WA 4EKIA 1RNLA 4LSAA 1CK4A 1RPAA 1YL5A 3A70A 4V1CB 2FDXA 4MGEA 3ZGOA 1FYEA 4O5AA 4R1TA 1WBJB 3G02A 3S68A 4W6QA 1CRLA 3NKFA 4YAKA 1G4HA 4FKZA 4BQPA 1QGOA 3EGXB 3TTSA 1C0PA 3TE7A 4CFZA 2BKUA 4D1YA 2XMSA 1MZVA 3E48A 1R5BA 5JXGA 2Z5LA 4Q6WA 3OEHD 7GPBA 4C2UA 4P4SA 5YASA 2PLFA 1M6WA 1L5WA 3TD6A 1K2WA 2PRKA 4S1OA 2RSLA 2PXXA 2XPCA 2BGLA 2W70A 1O03A 1IJEA 3HA3A 3HSSA 4H6VA 2BFFB 3FOBA 2AYXA 3H1TA 5JCOA 4HDKA 3H0GA 4LK2A 5F7XA 4FINA 4XW2A 3L7OA 3T5BA 3L93A 3SNOA 1XEWX 4KBFA 2QD5A 3H9EO 3DS8A 1GPMA 2NU7A 2YDXA 3ENKA 3VNUA 5ILQA 3EQ8A 1UKYA 1EFLA 1TTQB 2JANA 3PXXA 3OF5A 3FOAA 1XYGA 3VHQA 1L5ZA 5A5DA 1BRTA 1TM5E 1X2EA 3H5RA 2HK9A 1X1SA 2QP4A 4L3VA 4A7PA 2F1JA 1I1MA 1PR9A 5ALQA 2VZ0A 1P1RA 3IMKA 1R3DA 3EXIA 2YZLA 1XR3A 3EOAI 2ECPA 3VYVA 4L2IA 1QGED 1Z26A 4DMGA 5COAA 2Q5CA 4DJAA 3HVUA 1VPTA 3P2JA 2QRVA 4JZKA 1NVMB 1Z3CA 2BHRA 3L41A 4KR3A 4BWSC 1H9BA 2XVZA 3MJFA 4EW1A 5C3MA 1T4CB 3DLPX 4LWOA 4WSOA 3CPHA 2HLHA 1COWA 1MXFA 4TL9A 4ZYZA 3NBXX 4B3HA 4IIHA 4EPVA 3TLCA 4BZPA 2TECE 3K0AA 2CKDA 4BZXA 2HA7A 4R2JA 1R64A 1SRQA 2QAGA 2ABWA 3DAOA 2NZVG 3VU1A 4B81A 1VGRA 2RIRA 4WRRA 1EEXB 3I4LA 4JYPA 1W0JD 5DYNA 1PQYA 5HFAA 3G2NA 3TKAA 2B35A 3UTDA 1B8OA 2Q7OE 5HFJA 2AYZA 1WHSA 2PJRA 5H3HA 4IOKA 4G4JA 5GJCA 1HT0A 4AG3A 2WU4A 3DZFA 2Y4NA 4PYLA 1ONPA 4UEQA 3LKBA 1LGYA 3QE0A 2VDRB 4WNAA 1L5GB 4IWXA 2PXCA 2UZ0A 3UVEA 3KHRA 3WRVA 4F0JA 2VOJA 2BR3A 1LF5A 3PKZA 2M6RA 4GMDA 4PZ9A 2J0SA 1NASA 3SEQA 3LFHA 1SVNA 1R18A 4IVQA 3OJLA 4EAQA 3C1AA 4UHJA 2F3TA 5CIQA 1TZCA 3DDOA 1RTTA 5D85A 3AETB 1RAHA 4K9KA 5IZ4A 4UU0A 3GV0A 5FTWA 4ADSG 3JYHA 4GP7A 4R8VA 5BQOA 3PHGA 1U7XA 2I66A 2FSIA 1T4MA 4MUNA 2H8KA 4FNGA 5C34B 4PC6A 3I1IA 2PFKA 5FKJA 1REQB 4YRKA 3TLJA 3HDTA 1TUBB 4CR7A 4D3XA 4BTVA 4Y2UA 2DU8A 1JFVA 1EJBA 4MAAA 1LQ2A 3DHVA 4IW3B 3BAZA 3I2GA 2Y0CA 4BV8A 4ZEMA 4QM6A 2RKWA 4UHEA 4DE5A 3R24A 1FZQA 1KSHA 3NGDA 2R62A 1FYVA 5FI3A 1WOYA 2PX5A 3K9NA 1U1CA 1IY2A 1RQPA 3BTOA 4E13A 5DTIA 3CZRA 1JDEA 2WJGA 4UMVA 3QLEA 1RKQA 5L9AA 3TCKA 3HS3A 3B6IA 1CZNA 2YY6A 1R74A 2PS1A 3ICVA 2JJ8A 3FUVA 1YJQA 2NVBA 1PD0A 3CZCA 1PR4A 2QJTA 3AVPA 1TTTA 5LZ5A 1BMQA 5HQJA 3ZHYA 1UBRS 8MHTA 4Y0NA 1IN1A 3UGKA 3NDIA 4Q00A 4LZPA 2ZYRA 4YAJB 3C8HA 4YJ3B 1PV2A 4Q3CA 1R2QA 2V7QD 1T6NA 4LOLA 4JDPA 2HJWA 2CMHA 2PGDA 3L82B 1JR6A 2YIJA 5EHXA 4EPXA 2CHQA 2O8NA 4E88A 3AQ4A 4ECYA 3ZN2A 3EVGA 1GU0A 2ZJ1A 1YRWA 5MDHA 1QV6A 4YIKA 9ABPA 5KVSA 4MW6A 4DIKA 1TX4B 3UNXA 2RBEA 4F60A 2WKPA 4JELA 4XUGB 3SFVA 1Z47A 1J2UA 3OPYA 1NQWA 5JD3A 4DLSA 4CM1A 4EZEA 2BMEA 2FFQA 4MEBA 4S35A 4JSRA 1NY6A 4K05A 5F33A 3H2JA 1ZLXA 3SHWA 2Z3WA 3TX6A 4KGDA 4Q3BA 4OEHA 4WLUA 2J0QA 4BFTA 4EH1A 1OYYA 2WMDA 5AUPB 4YA6A 1IAVA 4L8YA 2YCBA 1JDBC 3IQDB 1WW8A 1NWHA 2YXLA 4ZO4A 4U2CA 3SHVA 4RZRA 5DGAA 2R8EA 2C3MA 1JIQA 2WFZA 3A9VA 4DDKA 3BK7A 5T7BA 1SQGA 1QQAA 2VH2A 2ZJ4A 3KKQA 4P8RA 3QLVC 3FTNA 3FPGA 3FYDA 4JK3A 1I3CA 4N5LA 4WZAB 3SU8A 3HKZE 4DRXB 2W11A 2JLVA 5KT4A 1JF8A 1KAMA 3G7NA 1FU8A 2XNKA 5G0VA 4R83A 1M34A 2V58A 2C4VA 3DMTA 1SKYB 4RGQA 2PQ6A 4J94A 2QMUA 3UBMA 3E0XA 4UQLA 1VPVA 2EBHX 1Z8HA 4FXOA 3DAYA 1DBWA 2JIQA 3PP8A 3U40A 4G5YA 1TTPB 1JR4A 5LWQA 4GX0A 2JFGA 5FCDA 2YFHA 3VPDA 2NUTA 3TF5A 4CKCA 4Q37A 4UDOA 3KJGA 3M6AA 4HGRA 3NCHA 3UO8B 3RSSA 1TQ2A 4YLEA 5ARBA 1PBNA 4LF8B 4G5RA 3BRWA 2C2YA 3JRNA 4RNMA 3TZQA 5ALDA 2EFJA 5BW6B 1E77A 4FOLA 4WK6A 5KT3A 2MU1A 5HP4A 1HRDA 2O1EA 3G8BA 5CFMA 2NO1A 4RK6A 3TMKA 3OJXA 4E11A 3TMAA 2CXNA 1DJMA 3QYAA 2PH5A 1I0LA 1E6EA 1Z5OA 3RVLA 1WF6A 4CF4A 4CQJA 5KYWA 3KQSA 1P9WA 2OQRA 5K05A 2AFIE 5H3CA 3DBHA 3TKLA 1MZBA 1N7GA 4DUYB 3ZHQA 1M83A 3QVMA 4H7HA 1U7DA 4B7UA 3K1JA 3DONA 3EW9A 4UNPA 5ANRB 3LRPA 4JLOA 4TKZA 1RVDA 1I7LA 2A0UA 4B3MB 1SYXB 4A91A 5D3ZA 4OF4A 1FE8A 5FA5A 4L3WA 2GMWA 3V4VB 2VSQA 5K8VA 4XDHA 1BD4A 2R8KA 2Z6VA 1PJRA 3L6RA 4BP9A 4ASUD 3UMYA 5C3UA 1NHGA 3TFQA 4E5KA 1OI3A 2HU5A 4P32A 1Z2NX 4QYXA 4I7HA 5E1MA 3V48A 1JFRA 2Y67A 3KLOA 3TLMA 2WP0A 1KOFA 4LXHA 4P4TA 2E5WA 3JWHA 3QHQA 3A14A 2ZRKA 4FFMA 1KMHA 3THWA 4BV9A 4AP9A 5DNCA 3A6EA 4FU0A 1U9CA 2R8RA 3BHIA 1W9HA 3B48A 2VA9A 1OVGA 3GIIA 4R40A 1E2NA 3T94A 1G2QA 4YXWD 4QTTB 1T2VA 3HFSA 3ZCTA 1QH8B 1WU8A 3CLTC 5F23A 3DQQA 1PG0A 2JEIA 3ECCA 4DVGA 4Z0HO 5INTA 1F9EA 5F5NA 4Q3AA 1M6EX 1QFZA 2BCEA 1MVNA 5FQNA 3M6FA 2X9VA 1JQKA 8GPBA 1I7DA 3NDBB 3KXPA 1KYTA 1EK2A 1ZLYA 2D7DA 4BHTA 1NNEA 3DYIA 3NM6B 1ZJJA 1FTSA 3LA6A 1K7EB 4G86A 2FZWA 3GXBA 1VJ1A 1RWOA 2H9YA 3KQNA 2PG3A 2DECA 3W5UA 3OX2A 1V71A 4MR7A 1WJGA 3HPRA 2GKGA 2UVRA 2W6ID 2ZUTA 2J87A 3W1BA 1A9TA 1D8AA 3AJ9A 4C7KA 1F8GA 3AR9A 1Y5MA 3SXUA 1E6LA 1OJ7A 2FPLA 4JH0A 3OLCX 3SHQA 2R7AA 5JZMA 3WHIA 4HRYA 2Q5OA 1PJ3A 4RNNA 4AY6A 1CR4A 5K3DA 3N43B 2OZEA 1KY5A 3R74A 3PDIB 3QNMA 4WCVA 4EZBA 4Y2PA 4MAFA 1A7UA 5DIZA 4DA8A 1CP2A 5CPFA 1N5LA 4EX6A 2XNSA 4KYUA 3CX4A 5B36A 4TV9A 5LYJF 3IE2A 2IOQA 2PAFA 2HUNA 4KYIB 2VF5X 4DV5B 2HZ7A 2HOQA 5JSHA 4IGEA 3B7WA 3TQFA 4RCNA 1J39A 4KO3S 3UN1A 3T7KA 3RRXA 3CH7A 1P1CA 5EINA 2Y1DA 5G1OA 4MDHA 3B9BA 2VUGA 4BZWA 3ZIAD 3BEDA 2Y4OA 1N4DA 3O75A 3O8QB 2YMLA 3IURA 1VIAA 1U0JA 2XJ4A 4JMPA 3R9WA 2G4VA 3AR8A 4URYR 2WJVA 3AERB 1T43A 5DM4A 2WKQA 1V3QE 4FSHA 3UKJA 2PBRA 1CY8A 2XVAA 5CDSA 2EZ8A 2QXUA 1TW2A 3M5PA 2ZRAA 3LYLA 2XY4A 5D6OA 2ZU0C 1AOXA 4M3NA 1LFAA 4G0UA 3MLAA 4FZ3A 1M2GA 4OHYA 2UYHA 1KO5A 3AR5A 4MVJI 1CJBA 4U00A 2H31A 2YOGA 1QIFA 4KYTA 1G20E 4PIVA 2XWJI 3HWX1 2YV4A 2FTKE 2XVYA 3D8HA 4LF8H 1E6WA 4UFPA 1VI2A 2GESA 5BMVA 3W79A 1JG6A 1LVUA 4JWKA 1VLZA 2V97A 4JUFA 4Q66C 2WFLA 3WK4A 3AVTA 2NIPA 4A6DA 1XNQB 1FYWA 3N2EA 3OAAD 3MTEA 4GG1A 5CA0F 3TTXA 5ALIA 5ITVA 1LQUA 2AGVA 3HXKA 4GR4A 3HCNA 4ZRDA 3RTDA 2DX7A 1TKAA 3RB8A 4BMSA 1CF9A 4RD0A 1C4WA 3WWIA 4WINA 4U3JA 4DV7B 2XNDD 4PZDA 3P9XA 3HCEA 3GFFA 1QFJA 4I2VA 5LDDC 4DUYH 3BXZA 5IVHA 2ZIUB 2AF4C 1GLVA 1OROA 2BZSA 2A4MA 1BXZA 3VJKA 1V8FA 4KX5A 2JPDA 4WY2A 4A3JG 2HA2A 4BEBA 1QIHA 3M6UA 4UVIA 2R2GA 4X94A 2NPFA 1KDVA 3U7EB 4B3MH 4KN8A 1HI9A 4NPAA 3UAZA 4RHTA 4ALKA 1QWOA 1YZLA 1DQZA 1KP2A 1Y98A 4UU8A 1Q17A 1K5PA 3T5CA 2ZVPX 4HGYA 4KQJA 2IXEA 2ZT7A 2QTTA 5J47A 3MJTA 2ENUA 1S8FA 4XRRA 5C7IO 1L4EA 3OOYA 4ED9A 4INPA 1KEKA 2AT1A 3NBQA 3QWAA 5TMDA 1PNQA 3KOXA 4QLOA 3WDLA 2HMWA 4PYQA 2EL7A 1J22A 1DAFA 2R86A 4KPEC 4Y9RA 5AH0A 1AVTA 1JWBB 5T3YA 2R84A 4WVLA 2FQQA 4FEAA 4FC6A 2P2ZA 3L0SA 1FSSA 1W36B 2AWNA 3CS3A 2F3PA 2ATVA 3PWSA 3VR5H 3V5NA 1Z2DA 1XKLA 1Y8AA 2XGPA 1P44A 2W9XA 4RSRA 4A5OA 3IX7A 1CB7A 4KJXA 1KWGA 5ADWA 4MDYA 2HM7A 5A5VA 1NBIA 4U7JA 2W2PA 4JU9A 3SDZA 4AX4A 1Z06A 3I04A 1OX4A 2WYOA 4LJRA 1ESMA 3L0DA 4MS3A 2FW9A 3HV0A 3WA7A 3O5AA 3HH8A 3QYFA 3L8MA 1OXMA 4QU5A 1ULHA 1ADFA 4DIFA 1E60A 1Z5WA 3N2GB 4ILKA 2JNWA 4QNRA 4R0VA 4IGKA 3CIOA 2WC1A 4Q0YA 5E38A 3EWAA 5L1JA 1TEZA 1A0GA 4IDAA 3OY2A 3LMKA 4OX9B 2ZSDA 5JQWA 2AA3A 1FXWA 4HDRA 4C0WA 4H08A 2M1XA 4HB0A 3PR1A 3EXHB 3ETLA 4G2NA 5IAAA 4MVJP 5BRNA 3WLHA 4EGFA 1HQYE 5KFFA 1T0PA 1C7EA 4YMVA 1Q6YA 1L7MA 3U7JA 1QAQA 1OFUX 2OK8A 4PPGA 5KYNA 1ABBA 1W5SA 3L0OA 1DIHA 2G25A 1V5EA 3S24A 4PYJA 4F4IA 3GT0A 1IUPA 2EEPA 3C7TA 1WKVA 4P7KA 2GJ8A 2DR2A 5F3RA 3ZH2A 2BYTA 4NWIA 1B6GA 3UB4A 1X80B 4Y2XA 1EWRA 1GYFA 1NYQA 3BXPA 1XTBA 1SEPA 3KKMA 5CDTA 5KNCA 4DJEC 2YZMA 2W6MA 4BGIA 1Z6AA 1CDEA 4YCSA 4O8ZA 1CDDA 4UAUA 4TL7A 4F5WA 1R0KA 2KMLA 1HLDA 4DV5H 3ESCA 3BT7A 4ABTA 3DEHA 3BMQA 3PW4A 1VPDA 3BD9A 3NAZA 1EUZA 3JVDA 3PNQA 4R84A 1T9ZA 5CTJA 4LX8A 5LM3A 4M9RA 2GZ2A 4NLLA 3GBSA 3PD7A 4BIMA 4YMUA 3SX0A 1WM1A 3O03A 3TEFA 3QSGA 1GAQA 2Y0EA 3X44A 5HG0A 3G8AA 3WYDA 5KFKA 2PMWB 3BIOA 3GZ4A 4DABA 3MTJA 4CMEC 4O84A 3WNDA 4BMDA 3QX8A 2C0PA 1Y1QA 3N40P 3H16A 3L0ZA 4ESEA 2OYRA 1E4OA 2V4UA 4LNHA 3FIJA 4AD8A 2BGTA 3PENA 1YQUA 4BNGA 1KVSA 1XPRA 2H4ZA 5H1YA 4B45A 4YMHA 1QM5A 3L6DA 1P7CA 2AS0A 1ZRSA 4RXMA 1Y33E 4X85A 5F21A 1JXMA 3RHZA 4GI3A 4ZMSA 3NIBA 3LCJA 3G6WA 5F5LA 1XNQH 4HWSA 5CLLA 4NECA 2JJ1A 5AXBA 1XGKA 2C1XA 3ZY4A 3EXHC 1KKMA 2P1ZA 4RZQA 1UMBA 2YYYA 4J4BA 3RUEA 4GPIB 2H11A 2WJYA 4EF5A 4DV7H 1E2DA 3NFYA 3KYBA 3L7DA 4TMFA 4BATA 3DMYA 3H11A 4DWVA 2VZLA 5I7UA 3EIXA 4IWYA 1O5IA 3I9OA 4QDOA 1Q0UA 4EI7A 2EZ9A 1FLAA 1N9KA 1U2QA 5AKXA 4D42A 1DV2A 2HT6A 4X1YA 2XYVA 1M1NB 3H0EA 5KUTA 5AW2A 4ZKDA 3VPHA 2NW6A 4EGJA 4Z8XA 3UA4A 3IAFA 1I1QB 3ZHOA 1GU7A 3WFZA 3S5JA 2OHVA 1JJBA 5LDHA 2GEKA 4QIWE 3QQ5A 2BISA 3BFPA 1GRQA 5JFGA 4LY3A 3O3CA 3NBZB 1SWVA 3L05A 3GZTB 2FUG1 2AMYA 1Q95A 5T4HA 1G3MA 1U2PA 2DXIA 5KT6A 2IGBA 3DSRA 4MP8A 1H5NA 4HY3A 2JA7G 5FBVB 4K2HA 1THZA 5LQUA 2WICA 2BGNA 4O5OA 4BY9E 1CP3A 2PTHA 2MSKA 1KZ6A 4EG5A 1YB7A 4ZJPA 1ZD5A 4RO0A 2B8TA 4YI5A 4QO7A 1U0LA 2BKXA 2HWUA 3TW8B 1USUA 3P2IA 3IAM1 4O33A 5EYPB 2FZEA 3D43A 4FBMA 1T2UA 4E31A 2BKEA 4IJ6A 4C07A 2BDUA 5A71A 2YXDA 2QP9X 3OCUA 3RG2A 1QOZA 1E4YA 2IZ1A 3U7IA 5KYXA 2Y1GA 4XB2A 4TYMA 3EVDA 3HMQA 1SBQA 2NM0A 2IXDA 3V4FA 1T36A 3I92A 5KNBH 4LQDA 3RR5A 4JY7A 3TG8A 4IEFB 4KIGA 5KYUA 2GPBA 1RWXA 4UKDA 4OX9H 2Q4OA 3PQ2A 3G2KA 2ZRFA 4H60A 4O2BB 4EMBA 2HF7A 1GTL1 3C1OA 1ZW6A 4QYIA 2IH4A 5K01A 1P0QA 5F98A 1TYEB 4IIBA 3USZA 5TQ0A 3GJ7A 3G0HA 5AW4A 5GJVC 3KJQA 3D4LA 1VSQA 3FR8A 4FZ5A 3NWJA 3DZKA 1EDZA 5B55A 3GP3A 2JCXA 4AQDA 2ONJA 3AZQA 1QQTA 1K5DA 3WYAA 1VYTA 3OZIA 1XCJA 3DOCA 4PFQA 3K32A 2V9CA 5CG2A 3KV1A 2AN3A 5CBKA 1LPOA 2D5AA 3T5DA 3KALA 1LVHA 5IM4F 1XPJA 4UM5A 1ZN7A 3VSEA 2E21A 2XC9A 2VG8A 4WKCA 3JRWA 1X7XB 2NXNA 4IJ5A 4W99A 1FVHA 4QRIA 3SEAA 1TLTA 3LY5A 5DP1A 3LK7A 4ENVA 3BXHA 3ZK7A 3QU4A 3LDFA 5IVDA 1OWPA 3CSWA 2H59A 3NBZC 1H8ED 5JROA 3GT4A 1KRHA 2G80A 4DLNA 3RU7A 4X84A 5EP3A 2CJPA 1ODJA 4Y9UA 1L1FA 3PNOA 3VUFA 1H4SA 2BV3A 2UYCA 5CJ2A 2HF2A 3ZZNA 3OJFA 3MA0A 2IIPA 3V6MA 2PKRA 1C7ZA 5IHXA 3R7FA 5IDQA 1FDSA 1DWQA 1CUDA 3X1KA 1R0WA 5JCZA 5TRTA 3VZBA 3IAS6 4JI5B 1SCQA 5I60A 4BQSA 4D8XA 3H86A 5L3QA 3VDNB 2R65A 1QB7A 3QFSA 5CLIA 2FUEA 5F9LA 1NP7A 4M0EA 3ZWYA 1B16A 5HDQA 3GMSA 2XODA 1H2ZA 4RCYA 2LD4A 4L7QA 2WUVA 3EAGA 1C1DB 2CD9A 4BNUA 1LTQA 3QIAA 1EFVB 4Y6PA 4L4UA 3EDYA 4DIDA 1QMGA 3ANSA 3CA8A 4EVQA 2PRJA 2P41A 3TQSA 1ZD2P 2OBFA 2YNMD 1L4BA 1USWA 1NVBA 4XCVA 4PAGA 3QNWA 5JDCC 4NG4A 1N5IA 2IZOA 1ZZEA 4UZFA 1PNRA 3EQZA 3ORFA 3R0QA 3IUPA 3BE8A 1D09A 1A5SB 1IC6A 4I1OA 1JXAA 3NAQA 3RRNA 4YBZB 1EDDA 4LYDA 1ITZA 3I5MA 4J0HA 4WN3A 1ECBA 3KB1A 5JQGB 4DSAA 3LP5A 1OFTA 2A9PA 3MGCA 3B3AA 1QK4A 2FN9A 2CKMA 5FDFA 4BP1A 1JEQB 4HF7A 3UWPA 5C4IA 3NYQA 5DRTA 3G82C 3ELDA 3LDGA 4HYQA 5KFYA 1WCIB 1Z25A 3HYLA 4GP6A 2PKQP 4GF5A 5EWJA 1P0CA 3U3XA 4FGRA 2WTBA 3P20A 4GD3Q 1GFZA 3EXG2 2HKIA 3KL2A 3HKCA 3QXSA 3ZQKA 3L4EA 2CXRA 5JATA 2H1HA 3FRHA 5C31A 3AHCA 5LA6B 3EIEA 1T6BY 2OV3A 3IVXA 3PYLA 3IT3A 4A6EA 2PRZA 1QIDA 1XTRA 1RQRA 3GLVA 5JXHA 4PLWA 5DLFA 3BB4A 3GJ8A 1EFAA 3DD1A 1EFCA 1JA0A 5C4GB 3ZZ0A 1EUCB 1ULAA 3F46A 4WFJA 2HA3A 4Y3UA 2RHLA 3U1TA 1V11A 5DW0A 3K6KA 3ABIA 1Q50A 4B3BA 4UQPA 4JLAA 1BVYF 5H5JA 3ZDDA 3ZW9A 2Q41A 2H52A 5DG7A 4GC7A 5DHSA 2JA8G 3QU7A 2GFHA 1IBKB 1DO8A 3T3DA 1Z56C 1ZA2A 1A1SA 3ZU2A 1G8JA 3WOVA 1W5TA 5LL6P 1J0XO 1OZFA 1U3DA 1IUNA 4BO6A 2RJOA 1S5PA 3LZDA 4ETMA 3S55A 1EK6A 2G1UA 4TGLA 3FZGA 3SR3A 1JDZA 1XZPA 4V0QA 3NHPA 4FM9A 2GQRA 2I2BA 1I10A 5CYPA 7YASA 3E9QA 3WYCA 5ENDA 4AMYA 3MQ2A 3V55A 2BGJA 1ZGGA 4UD6A 2YV2A 4EFBA 4A16A 3U37A 2Y2UA 4J0EA 1EVIA 3ZK8A 3VHRA 5AKLA 2IS2A 2Z8XA 4JX8A 3PI6A 2OGWA 1E5TA 1XTZA 2R97A 4CDNA 3QXXA 4Z7JA 5EZ6B 1VMAA 2DOKA 1NUTA 3BZUA 3BFXA 1SRRA 1XPOA 1XMOH 2RDJA 4WIAA 2VPZA 3R7DA 5JD4A 5HUQA 4RWEA 1AU9A 3DMPA 2WHYA 3X1MA 4NULA 1UPTA 3WBKA 1NX9A 1P0PA 2UYYA 2ZQ5A 2D0DA 4UEJA 4CKBA 1XZ8A 5DISB 3KSDO 5TC4A 5A62A 2Z2JA 2HGSA 1SBCA 4KE7A 5B1HA 1RHJA 2ZG6A 5E6UB 1NW8A 2ZBPA 4MUKA 1M8JA 1U2ZA 1P9OA 4RELA 5EE1A 2HHJA 1E9AA 4R1OA 4CF6A 2A58A 2M05A 2QIPA 2WFMA 1JQBA 1JWLA 1A2BA 2RAVA 1PV4A 3GJZA 2E3JA 3A3NA 1OZGA 1S8OA 2JRCA 5AKZA 4Y1RA 1DWUA 3WGYA 1GFSA 3RT9A 3R76A 1ICIA 1R50A 5HE8A 1X7GA 1H2BA 3L84A 1DT5A 1X92A 2VAMA 5A0TA 4ENUA 2FW6A 4KRXA 4JI5H 2FLVA 3H1FA 2JDIA 3SIPA 1LI5A 1XMVA 4XQGA 3RAQA 2HSDA 1KEEB 1KAQA 3JQBA 4DYVA 3IP7A 3DYBA 2YXBA 2ADOA 1KVQA 1YS4A 3Q6NA 2QTMA 1S2NA 1Q91A 3U4CA 5JHGB 2QYTA 3C5CA 2IKSA 4YN3A 5BOSB 1FX1A 4M0PA 2XXAA 5BSHA 3F2IA 3ZDQA 3UFXA 3UAXA 3U9SA 3RVQA 2VC2B 2X8WA 5KNDD 1V1JA 4JBLA 1H9CA 4PO8A 5BT9A 5M7EA 2A92A 1M8KA 4EW3A 2G5PA 2YMPA 3GELA 2P90A 4IR1A 1FFXB 2E2IA 3GDHA 3N0RA 1TDJA 5AHRA 1YGYA 2E2HA 4ZVUA 3V4OA 3ZQUA 4ZQCB 3NT2A 4WZBB 2B61A 2O19A 3KU4A 5KVQA 3FMGA 1L9XA 1WUIS 1XP5A 2AFHA 4RV5A 4D3FA 1HYQA 2V0NA 3TUIC 5HJ5A 1J25A 5EXTA 1Z5PA 3EQ6A 3M70A 5F7OA 3ITNA 5C52B 4AX8A 4N76A 5HW0A 1VLQA 1JYFA 5GVRA 1XOIA 4WLOA 4N3AA 1M0SA 4BFSA 4NFYA 1MPXA 2ZDGA 3BH7A 3S2FA 2W58A 5DISC 3IH5A 3LQ4A 3SMVA 3OESA 5BUZA 2IH2A 1CG6A 4QUKA 2JIBA 1Y6JA 5KOJB 1NG1A 4AJLA 3O4GA 1AQ6A 1XAGA 1DKQA 1XXHE 1SVUA 2AG0A 4Q7MB 2V7BA 3OPNA 4LVCA 4A73A 2PZMA 3SNKA 5JDIC 1RIFA 4P5DA 3FCOA 5T41A 2P27A 3OHPA 1PZFA 3E4CA 4NE9A 4PY2A 1NDUA 2JJQA 3H17A 1CBUA 1MV5A 4Z7OB 1TQ8A 4C2BA 4C4ZA 3MFQA 2O5VA 1US8B 3S4YA 3WLPA 2ZGIA 1ZNXA 1KEUA 3WGUA 2VP6A 4UQOA 1RHUA 4ZI2A 1FFCA 1ANKA 2ZSHA 1ND5A 1M8PA 1IOVA 1OLXA 4PAWA 4Q4CA 4LEIA 4DIMA 4PHGA 2PKWA 5BWBA 2SECE 2W83A 3HOXG 1QB8A 4HB2A 1IBKH 2I6QA 4B9AA 1E1DA 1E64A 1R9NA 1OOEA 3F7MA 3WWOA 1JPJA 4MJ3A 2VZ9A 2JAHA 4XM0A 1UP7A 2F3SA 5ERYA 2QMYA 2QTVB 4MA4A 3E9RA 5B5SA 3VQTA 2J6BA 5AUOB 4UASA 2FPGA 4OQDA 4C03A 1UR5A 1TGYA 1XLWA 3ESAA 3K70C 2P2SA 3KOMA 3A7EA 2BFBB 3HRHA 3FUCA 5ALEA 2RGDA 2Y77A 5KFAA 4M0JA 4JVNA 2YJ6A 2J5KA 1DAIA 3FVVA 3WK8A 5G53C 1Z7YA 3ILXA 2VPQA 3C3XA 4LOAA 3TR6A 1J0AA 3KXYT 3BGWA 4J3JA 3JQ7B 4TZ0A 5FTKA 5KQPA 2JFWA 2C4WA 2GKSA 4JVOA 1K75A 3OOHA 3EZGA 2YYSA 1GXSB 1I14A 2Q6LA 5JCJD 4GR9A 2CXTA 3K0CA 2F90A 3V97A 1OWMA 4GVLA 3TZLA 3WLOA 1JXQA 4WXPA 1U02A 2H1SA 4XWAA 5ED4A 2CF6A 2H2DA 2M32A 4RHUA 2GCIA 2ZUVA 1PG2A 4IUCS 5KKCA 3PHCA 3P7MA 3AI2A 1EXWA 3GQBB 1VJDA 4RIEA 8OHMA 1T0BA 4LF6B 5SZKB 4MLDA 4DQLA 4IUDS 4R4JA 4GEKA 1OLSA 2VT6A 2DBZA 4YHBA 1TZMA 2QT1A 1ACJA 3AILA 1ZH2A 1IWBB 3ZCVA 5LQMA 1HDOA 1EGQA 5JPCA 4MYRA 4HNGA 5KCMA 4KSBA 1BQ3A 4GNRA 1XQ9A 3LU1A 1XU9A 2QN7A 4D8WA 2PK3A 2IHZA 1NVWQ 1UZLA 3W6NA 3HKEB 3QMMA 1IY8A 2FFHA 3LUHA 3TNLA 3NFRA 3AV0B 1QRRA 1SHKA 3TX2A 3TQQA 1FXUA 5JYBA 3R6WA 3TBHA 2GZMA 3WWHA 2V7PA 2V6JA 1LBSA 4WJZA 2O5EA 1FS6A 1QWSA 4RSMA 2AL7A 3MTIA 2XWQA 4LBZA 3ZUGA 3SJUA 3VSCA 3PUYA 4QBHA 1FSPA 4C6HA 2P91A 3UWSA 1YS1X 3WHKA 3MCAA 3NGMA 1J9EA 3ZDCA 2HMVA 1H5UA 3TG2A 4XOUA 4TXJA 3C0FB 4KR0A 4WLEA 4I1RA 2EZ4A 1PK7A 1I80A 2OZLB 3HLYA 4QJ4A 2QT0A 5DN9A 2BF4A 1SCAA 3OZBA 3DHEA 5TSDA 4AC9A 2D1YA 5DN6D 4TV8A 3C3CA 2X8JB 1RIIA 1RJDA 1XU4A 2VATA 4C5AA 3NIDB 1PJAA 2NG1A 1A9XA 3WGOA 1E2JA 4BMVA 1E3QA 2E1RA 2H7CA 2NLOA 5L3SA 5JMOA 4MXDA 4WHXA 2IYXA 1UADA 5EJGA 2CDBA 5FOSA 4UE6A 3LK6A 3ZE0B 4KNWA 2Y1OA 4OCZA 1D5WA 1VGVA 1NFQA 3VR4A 2PA3A 5BQXA 5JXJA 5H4GA 1V1MA 4HTFB 2F48A 1P2VA 4QATA 4OK5A 4DSZA 4BBAA 2C5EA 5KS8A 3E27A 4HDCA 2WJHA 4DA4A 4XZ3B 5L7YA 1DAAA 1TLFA 4YRSA 1FTQA 3GNTA 3NDJA 1CQZA 4PZZA 4LN1A 2CE2X 2H85A 4ZO9A 1ULSA 1HE4A 3A8TA 2FR8C 1HLPA 1YRYE 2Q3JA 2WPDD 1VB3A 3KYIB 1OHHD 1SXJE 3GIKA 3PGJA 4X62B 2XV1A 1IMJA 2QL6A 2NAPA 4ZVMA 2ZE7A 3M9MB 5B64A 4G1VA 4RFLA 4Q93A 3RYIA 4QJ5A 4B40A 1I13A 2BMDA 2N9UA 2C9BA 1E3JA 2CHEA 2ZOSA 5ITZB 3IKTA 1KOLA 1VSVA 3ZS8A 4BWVA 4XUDA 2C94A 4BNZA 5DHRA 4PG6A 4J0QA 4V39A 4BPRA 1E3DA 2P2DA 3II6X 3N7TA 3MR2A 2OE2A 4N65A 2ZRLA 4JV2A 4FQ8A 1C29B 1H0KA 2X4DA 5CFNA 2VQEB 3DDHA 2R00C 2Z95A 1E5VA 2R5WA 3EDOA 2TMDA 1KU0A 3OPQA 1HDXA 2N42A 4J0CA 5K0BA 4EHNA 2NUAA 1DKUA 7ABPA 3V8RA 4HZUA 1XA3A 3L8ZA 1JDJA 2P0EA 4RTOA 4ARZB 2QTWB 4CQLA 4Y2SA 3ZDFA 1IFXA 5KJFA 3EHDA 5E6RB 4EAAA 2EBFX 4OU4A 1B8PA 1K8ZB 2V1XA 1VSUA 3L7YA 2COUA 2AG5A 3N42B 4EY7A 2HRBA 2YWHA 1M6YA 2GJKA 3HOUG 2SICE 1HNXB 3KDPA 2GR9A 2GAFA 3DBVO 4XJTA 1RFGE 3FTEA 4IRUB 1JQJC 3REQA 3ZZ1A 4MPPA 2SHKA 5L40A 2GUGA 3BC1A 1YWGO 1AB5A 4NRDA 5FEUA 4MDEA 5KFMA 5CH3A 4EA9A 3B85A 4LF6H 4HPWA 3UXYA 1EFRD 5EVCA 1T8RA 3S8MA 3ZVNA 4RESA 5JZVA 4N6GA 3G7SA 2G82A 1IONA 3TOSA 1A2OA 5E9AA 2KM1A 4B17A 5IJ9B 1LZLA 1VTKA 3T5KA 4XYEA 5KTPA 1R6XA 3V9AA 5CB0A 4IO0A 4C4TA 3VXKA 3PXAA 4F2DA 3UM9A 5HNKA 5IVIA 3KJFA 4U0JA 4DPKA 2WLTA 1KJ8A 1O75A 4Q7JB 4NNJA 3L77A 2XXBA 3WWYA 2FW1A 4N6NA 1OFUA 5EKDA 3PQ6A 4RQBA 4GGMX 1MPTA 3HCOA 1AUPA 4A2CA 2EZTA 1AN9A 3GAFA 4LH6A 5CT8A 4CM3A 4M60A 3CW9A 2ZWMA 1G16A 2AG6A 3S7ZA 1T15A 2AIRA 4MS1A 4HQRA 1Q1GA 2ZJ7A 2AUNA 5J2UF 3ZCPA 2OFFA 5BWXA 3MCVA 1Y9AA 3USES 2JGLA 2ZFUA 2O52A 3ENNA 4E1AA 3TY5A 1Y1WG 3MWMA 2X1MA 5LXTB 2TMGA 2ZPUA 5ESXA 1X42A 1J7JA 3IJEB 5TT1A 3HB7A 2XB8A 3KHLA 1ZVVA 2Y1FA 1JHPA 4WOJA 1Z0DA 1F4VA 2D62A 3NR2A 4LRQA 5EZSA 1G66A 3AFOA 5IJ0A 4LY0A 1Z3IX 1O6BA 3A3OA 4HVTA 2AEEA 1VOTA 3CFYA 2CFTA 1NU8A 1SBTA 4ZDIA 4KFSA 1HDIA 2WU8A 3K71B 1T8SA 3BA8A 1KEZA 1JWAB 4OXXA 1F51E 4D3SA 2G06A 1I2KA 4EO4A 3ZHTA 5EIEA 4J4TA 5FHQA 2IYWA 3RU2A 3KQTA 1CJTC 4RBNA 3GEGA 3IMCA 2V6GA 3TFWA 4MUMA 2RGWA 1GZVA 3ND7A 4LGMA 2P9FA 4OHFA 3GNLA 4PLCA 1KO7A 2P0YA 4DRYA 4TVIA 1GUFA 3AY0A 1R88A 2OO5A 1P8AA 1CE8B 1Y81A 3KTOA 4D02A 3ZU6A 1M73E 3LUGA 5DFAA 4R9SA 1HYBA 3KSAC 1J49A 1QCCA 1GPNA 3T5TA 3DVAA 1ZSYA 1C1YA 1CRQA 3WJ1A 3SJAA 5I5EA 1Z88A 4JB2A 3HNOA 4ZOLB 4BV3A 3ZUPA 3V2UA 1WVIA 2XCQA 2H0AA 4ECEA 1EWTA 2D1TA 1E8NA 2EFDB 4JXJA 3W5CA 1T0JB 4X62H 1RZUA 3UG6A 1XLTC 1SQ6A 3GI1A 2FWNA 3DPIA 2EKPA 2PZFA 4JDUA 5LD2B 3G9UA 4ZQFA 4PRZA 5DSXA 3SCZA 1JHZA 4MRMA 1NBEA 2ZXUA 1KVRA 3V4LA 1G21E 5L6MB 1ZI8A 4UCTA 1N1EA 3DW1X 1HNNA 4B3IA 2C2OA 3ASYA 1K92A 3LLMA 3PJRA 4XE5A 1I30A 4RC9A 1UMDA 2GBLA 4YTEA 4B71A 4LF4B 3VNBA 3EPRA 2WD7A 3TNDA 3KXDA 4ENWA 3GHHA 1ADYA 2DLDA 1FVOA 1NMXA 4DG9A 4HH3C 3V7YA 3PO2G 2GSDA 4CMKA 1QRUA 3VR6A 2IEIA 1QONA 5TJHA 2VQEH 5JBNA 2BE7A 4DBVO 4NENB 2BE9A 3C3DA 1X7YB 4E7PA 3VI4B 3LUDA 1PU2A 1XN1A 1I9CA 2KE5A 1AN7A 2WSMA 1W0KD 2EQAA 1LDEA 3HWSA 2X86A 3WNVA 4IX9A 1MH1A 1LLFA 2Y0BA 1GZ6A 4LRUA 2X0SA 3EGDA 1X1EA 4K1XA 4M9SA 3R7AA 1TA0A 2RF4A 1D2RA 5CDUA 3AYHB 2XYRA 3ZV7A 3WVNA 3P0IA 4NYJR 2V03A 3WFIA 5B6PA 1E5DA 3OM0A 3FZEA 4I9HA 1HNXH 4FBGA 2GBGA 1QUEA 2OK7A 3AG6A 1BWQA 2UDPA 4RD3A 3EASA 3W1GA 3SPXA 4RV9A 3M9LA 4RCZA 4TX1A 1S02A 1PLLA 3Q11A 2QAJA 4ODIA 2XCOA 3M9OB 1S9DA 2FCAA 3P4XA 2IPXA 4BUZA 4TROA 2XQIA 3KD3A 4XIGS 4EPRA 2WWGA 4QPZA 4URWR 2M9MA 4EEKA 4X8HA 5DOVA 1SOVA 3Q7IA 4YV0A 3RV4A 4KX3A 3S7TA 1X8XA 5KQSA 2P0AA 1GZSA 1RFLA 2Y76A 4BIIA 1G3QA 3NWEA 2XOKD 2BUAA 2DGDA 2HI0A 1DAMA 3BL8A 2FGKA 2Q9AA 4HP8A 3VHXB 1YT5A 3E7DA 3VU8A 5JMWA 1PVDA 5LD2C 3F78A 3GPCA 1EHCA 3QXCA 3WB9A 3PHJA 4XWGA 5EZQA 4QWBA 2XB9A 2KB0A 3JQ9A 2F64A 4QPDA 3Q3EA 2ZPTX 4ZTUB 5IANA 1P7PA 1KI6A 2O2ZA 5BSKA 2XLCA 4OGKA 5HQTA 5IAJA 2F3RA 5KVCA 4XQEA 4DL9A 4C43A 3PQ8A 1LUAA 3QWFA 2CVQA 3IERA 3VZSA 3KSZO 4I55F 1MO4A 3NW9A 5CW2A 4DQXA 2J07A 4J0IA 5AESA 5BXYA 1W93A 1UBTS 5I9MA 2HRZA 1JLSA 4CI9A 3T1YB 4IXDA 4RFSB 1Z82A 3F8SA 3CONA 4R5MA 2IV2X 3T7SA 4UFOA 4NJOA 2Z8ZA 2AFRA 4E09A 1RYBA 4R7GA 2BD0A 5AK5A 3J81k 1SUIA 3JQFA 1IB0A 1QUFA 3H9UA 1KAHA 1KJNA 4P81A 3LI2A 2FEWB 4DMRA 1DJQA 2BMAA 4BN5A 2VO1A 3NBKA 2PM8A 4B6JA 3GQCA 2WEKA 4MYCA 2XT0A 1A9PA 3DM5A 1NNUA 5DM2A 3CRRA 4AO6A 4E6NA 3D2BA 2JA7A 5K0GA 4G0VA 2BTQA 3F2VA 3A4MA 4GBMA 2GCGA 4D41A 2QZ4A 3CINA 4L5AA 1VIDA 2PZGA 1K4MA 4P54A 1N78A 1YIDA 3FMFA 1IJFA 2GBIA 3UZUA 4WK0B 4G67A 1XF1A 3QVUA 2GA8A