2R85A

Crystal structure of purp from pyrococcus furiosus complexed with amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
334
structure length
330
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords PurP protein PF1517
total genus 108
structure length 330
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r85A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r85A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r85A01
4FFOA 4EGJA 2VR1A 1DV1A 3K5HA 4ZOLF 4XYLB 4MV3A 1CQIB 4O7WA 5H80A 2FB9A 4O7ZA 3VMMA 1KJJA 2DLNA 2YZLA 3BSYA 2YYAA 4FFLA 2NPOA 2V5AA 3R5FA 2R6FA 3N8DA 3U9TA 4YAKB 2DIKA 1B6SA 4ME6A 3BG5A 2GQRA 2VHEA 4IWXA 5CA1F 4EGQA 1KJQA 1W93A 2QF7A 3LP8A 2CZGA 4FFRA 5BPFA 2R82A 2X0SA 3ORRA 3R5XA 4O4LF 2R86A 1C30A 4O86A 4O2BF 5D8DA 4DLKA 4O4HF 1BNCA 5LYJF 2R85A 3WO1A 4M9UA 1KUTA 5CB4F 1CQJB 1KJIA 5C1PA 2P0AA 1VBGA 4FFMA 2NU8B 4HNTA 2V58A 1Z2PX 1EUDB 3U54A 5EZYF 4TV9F 4C5BA 4O84A 4IZOA 3R5HA 2CNUA 2W6NA 5LA6F 2R7LA 4ZHQF 1Z2OX 3ETJA 4EG0A 2W6ZA 2XD4A 4HR7A 3MJFA 2GPWA 2VPQA 4EAAA 2WYOA 3ETHA 4GGMX 4O82A 2W6OA 4O83A 3BSSA 3AW8A 3I12A 5IYZF 5I47A 5J2TF 4HNUA 5JVLA 3RUPA 3V4SA 3WO0A 3WNZA 4M98A 5LP6F 5KX5F 5BPHA 2J9GA 3VPDA 5DMXA 5HV6A 4TUYF 1WR2A 2SCUB 3KREA 2W6QA 4DIMA 4O7SA 4WD3A 4M99A 4I55F 2IP4A 4O7TA 3RFCA 4MV6A 4MV1A 2R7MA 2HJWA 2I87A 2DWCA 1GSOA 4FU0A 4O7LA 1KC7A 2C00A 4FGRA 3TW6A 1W96A 1OBGA 2V59A 1EZ1A 2FPIB 5JVDF 3HO8A 1M0TA 1GLVA 1JDBB 4RZQA 5FNVF 4I50F 4XZ3B 3SE7A 3NUAA 2W6MA 3K3PA 1KJ8A 2ZDHA 4ZI7F 4EA8A 2XCLA 2W71A 4MV4A 4O7RA 2YRWA 2CNQA 3RV4A 4ZQIA 2VQDA 3GIDA 2GQSA 4EA9A 3KALA 5HBRB 3G8DA 3R9RA 2CQYA 5C8YF 4MV7A 4HNVA 4MV8A 3R23A 2YL2A 3BFPA 2YS6A 3JRXA 1A48A 2R84A 4YBZB 5JQWA 2Z04A 5JQGF 4J6EA 4E4TA 5K2MA 4M9CA 2YW2A 1VKZA 3VPCA 1JLLB 2Z02A 3OUUA 1GSHA 1BXRA 1EHIA 4XX0B 3RV3A 2ZDQA 4EABA 1UC8A 1VBHA 2R7KA 1C3OA 2PN1A 3QFFA 4O7NA 1DIKA 3VA7A 1SCUB 2PVPA 4L1KA 2PBZA 4QSHA 3VOTA 3MWDA 1EUCB 4O4JF 5JH7F 3KAJA 4NYEA 4EA7A 1KJ9A 2R7NA 3MWEA 1KBLA 2I80A 4YJ2F 5BMVF 5CAEB 1JKJB 1B6RA 2I8CA 2ZDGA 5J2UF 2HGSA 1M6VA 3BSWA 4YJ3F 1AUXA 1PX2A 1UC9A 1Z2NX 2OLSA 4YAJB 3TINA 4XYMB 4C5AA 2NUAB 5C1OA 1I7NA 5GONF 3TIGA 5LXTF 1E4EA 3OUZA 4Y8VB 4MA5A 1GGOA 2NU7B 3K5IA 3KAKA 2QK4A 4O4IF 4WBNF 4MV9A 4TV8F 2CNVA 1M0WA 2DZDA 3UFXB 1A9XA 1EYZA 3AX6A 3HBLA 3Q1KA 3E5NA 1CS0A 2YZNA 3ORQA 5LOVF 2FPPB 3Q2OA 2NU6B 4IWYA 3LWBA 1AUVA 2W6PA 1DV2A 4O2AF 3N6RA 4HQ6A 4IIJF 2W70A 1JDEA 1I7LA 2YRXA 4O81A 2YWVA 1OBDA 1E4EB 1IOWA 1GSAA 1T36A 1KEEA 1CE8A 4YB8B 3TIIA 4MA0A 4FFPA 4FE2A 4O7VA 3U55A 1PK8A 5CA0F 2YZMA 4IHJF 2NU9B 3VPBA 2FPGB 3V4ZA 1ULZA 2YS7A 3JZIA 3TQTA 3G8CA 3JRWA 4FFNA 2FP4B 3JZFA 1IOVA 3GLKA 4I4TF 3HB9A 3U9SA 2YZGA 4MAMA 5KKNB 2GPSA 3DF7A 2R87A 2GLTA 4C5CA 4O7YA
chains in the Genus database with same CATH superfamily
2CXXA 3COZA 4HG2A 2C4MA 2HN9A 4N18A 4PC2A 3TDNA 5EWFA 1DV1A 1M7GA 2HG8A 1O9GA 2GLXA 2R2GA 1OBVA 3QENA 4QBFA 1HFEL 3EDRA 3RPEA 5J2UA 1KNXA 4GF5A 4OP2A 4RZXA 5HQTA 2GSWA 1RYEA 4LJYA 1AOXA 4CRWB 1I9GA 2P6RA 2Y1OA 2REQA 1WDLA 4I1RA 2XECA 1PEAA 3GDHA 2HHLA 3SSMA 4EGAA 3FDZB 5LQRA 3UQ8A 1FFAA 3LYAA 5KFZA 3IUNA 4LYHA 3PFHA 5ALXA 1GVHA 5A4AA 1M1UA 4FFVA 2BBWA 1A4RA 2RJNA 2YWRA 1CUYA 4ZO8A 2WJGA 1KF0A 5CFMA 3LMLA 2ZRQA 4JODA 1CJKC 4FD2A 5LZ4A 3N76A 4D3XA 2M1ZA 1MXFA 4PRKA 4Q3KA 3S68A 4YHHH 1V7CA 2YYAA 2G9QA 4FFLA 2FWRA 4KBYA 3R5FA 4F2GA 3VAZA 3BRWD 2PS0A 2C9ZA 3EVCA 3L1JA 3U3RA 2CF5A 4R8UB 4YJDA 4MUXA 1JSLA 4U7WA 2XAUA 1DRUA 4U6NA 1X9HA 4H4EA 1JPJA 3FGNA 4HDMB 4OBWA 4XCQA 4FC7A 5FD8A 2YV3A 4R71A 2QT9A 3J80W 2Q9UA 3EJWA 4RVCA 3A4MA 2PSEA 5HF9A 2OXFA 1CS4C 1G21A 1SB8A 2OMEA 4MRNA 1NLFA 5JSZA 2IYPA 5DCUA 5F7OA 3JAKA 2DUWA 1YR7A 3L7BA 1VLJA 2CFRA 2A92A 4H0FA 1LBTA 1ONSA 5BRJA 3DBHA 4OP1A 2JFWA 3LT0A 5JVDA 1BYIA 4LHSA 3AJRA 4CTNA 3JQPA 3I2FA 5JADA 3LIIA 1KDTA 2I4OA 4LBWA 3W1BA 2HHHB 2R82A 4O4LF 1SA0A 1F0NA 1IEXA 3E9YA 4RPCA 3FJOA 3TUIC 5IRCD 2FQYA 2ZFUA 4YR7A 1NI5A 4LH6A 2JH3A 3EG9A 2AJ8A 1YJ5A 3OT5A 3QWIA 3ZDZB 4C05A 1GZVA 4W5NA 4C04A 2QTAA 1ZHQA 1U3FA 1UM9A 2IS2A 2XMZA 4EMSA 4S0XA 4HQKA 4CL2A 4ZO9A 4BXOA 1WU7A 1MQAA 2FFAA 5AKJA 5IUKC 2H7CA 3U6KA 1VC2A 4J1TA 3CJTA 2P3SA 1FYXA 4FS8A 1NFFA 2CW8A 2B7CA 3F5QA 2R85A 4NABA 3HHEA 4X9XA 2Q5HA 1U1CA 4QEKA 3CPJB 1ONBA 1GTSA 1RYRA 4RTPA 2A0YA 4YMWA 5AVOA 2NP6A 4IL5A 1EDDA 1O9BA 1XLWA 2BP7B 1DT3A 3CUTA 5F3RA 5AVQA 3HKCA 3RK1A 3H16A 5IJ9A 2V4QA 5IZ4A 1H1DA 3FPKA 4JT9A 2PH1A 2XNDA 2ZRAA 3EB9A 1NW4A 2Q3MA 4CW7A 4KFCA 4FILA 4NDZA 4WLUA 3RSGA 1CR0A 4JKIA 3UT5A 4YYZA 3UT6A 1G19A 2WUWE 1UEJA 4AYBE 4RD6A 3HU1A 4K9PA 3VSCA 1GD1O 3WC4A 4TTIA 3JX9A 1ECBA 2EFHB 1N2XA 2EXXA 1J8DA 3M1YA 2H2HA 3B3JA 3OQJA 1P91A 3T1OA 4ZCMA 3HFSA 3EW9A 3VR5H 4HMPA 3P9PA 5JC8A 3VNBA 2O3UA 4ZC1A 3MTDA 2KS6A 2OBFA 4JXKA 4CM8A 1HMPA 3MBOA 2Z5GA 2QVXX 5JDCC 4OLAA 3I4FA 1H6BA 2HXGA 4JR0A 5TMEA 4BFCA 4G65A 2OCPA 4XGIA 5AW0A 1ZKDA 1DOAA 5LA6F 1RWXA 2XOKD 1D9ZA 1ND5A 2QZ9A 3L6UA 3OZEA 3QXJA 1ZRNA 5I5XA 3KJQA 1KSGA 5EE0A 4Z99A 2QW1A 5DTEA 2QWXA 3QPVA 1XQ9A 4EG0A 1U81A 2FKLA 4NENB 2JGLA 3CW9A 3A37A 3HEAA 5L1IA 1JBKA 1ZCAA 2RG1A 4P86A 3U17A 3RYCA 5GADl 1JX6A 4I9FA 2JZCA 4MR9A 1BN6A 1E61A 4BLPA 1IIBA 1Z6AA 5CPBA 1NNSA 2I3AA 4ECUA 3OCXA 5FNVB 4GGMX 1PV4A 2P68A 4ISBA 1U8EA 2PZGA 3BA9A 3QLVA 1NRIA 4PONA 3ZE6A 5B7NA 3G0OA 1H1LA 1RWOA 3T41A 2FUKA 2WHPA 3Q8QB 2OHHA 5G0WA 4LRQA 4HLQB 4JXJA 2X1HA 1R4AA 4L9WA 4CQMB 4D4JA 3ANMA 3NHRA 1VIYA 4I5FA 3OKCA 3OETA 3TZLA 4KLCA 4XH9B 1RQPA 4Q00A 3W3ZB 4YJ2B 2C5EA 3FDIA 1L5SA 2GZ2A 4MITA 3DVLA 3VH2A 1MR3F 2I7VA 2NT3A 1GAEO 3AEUB 4RXTA 2GGSA 5ALVA 1CKEA 3S2GA 1A7AA 4DR6H 1L9KA 2X3YA 2AGVA 4UEQA 5EKTA 5I4KA 2P9QA 3KWFA 4DL5A 3GEEA 3ORFA 3VYUB 5BWBA 3CUKA 1JKFA 2SCUB 1FYDA 1ZUNA 1A9YA 2NZVG 1EE2A 2QZJA 3AXTA 4AVYA 2ATEA 3C6QA 1JU9A 3KREA 3L8DA 2YWEA 2G28A 4KQKA 2CKZB 1LS1A 3PNMA 5CXSA 1CBUA 2CLKB 4DBLC 1LZLA 2PH5A 3TBHA 1VXOA 3AHFA 4F56A 1A04A 1JLHA 4XCVA 2AWNA 2Y27A 4Q15A 1LU9A 3E15A 1E9BA 4H0CA 3SZ3A 3TD2A 4OL0A 1XALA 2DECA 2YXPX 2NZ8A 3MWYW 4TKVA 5BN1A 3D3JA 3DA8A 1UZLA 3HDJA 4HI0E 3NNNA 3FKIA 1LDMA 1NUHA 2GK3A 4EPYA 5A06A 1H42A 5ALEA 5F9LA 1J2YA 1ISGA 4CCSA 1V26A 1WOMA 1GRVA 3DTGA 2VYND 3PX7A 3RB6A 1VIVA 3RJMA 4DLVA 1PJCA 1RAHA 5L8VA 3L2PA 4MUAA 1DLIA 1SOMA 2E3JA 4KPUB 4O7LA 3FYUA 4NYIR 4RQUA 4ALNA 1NQOA 2AEJA 4B31A 4R1NA 4OK6A 2C00A 3AEQA 1M54A 3MCUA 2XXJA 1QC5A 3KVVA 1PQPA 1TVKA 5BYJA 2D0DA 4M9RA 3A4NA 3NB0A 4DUYH 4ZQHA 2HDKA 5HQJA 2O8DB 2V7QD 3NHPA 2G09A 2FPIB 4PEVA 1YB7A 3S1AB 5IG2A 2AKYA 1D1TA 4LJAA 1PVVA 1QAOA 4WASA 5BWOA 2WE8A 2HJ9A 1GPBA 1LLDA 4HQFA 1W19A 3VSDA 1SC1A 3ONWA 5EWMB 3SE7A 4UFOA 1TAQA 3ZHVA 2ASLA 4HB0A 2BR4A 2EX4A 3L4JA 4I1UA 4HVTA 1K8RA 1N9GB 2WU0A 1JXLA 3C87A 3EPRA 1ZXXA 3RTAA 2JFUA 5AHRA 4EVRA 4ZI7F 1WM1A 1AGRA 2EZ4A 1E62A 1RCFA 5CB4B 2Q27A 3H2HA 2H51A 4L4SA 1JR2A 2O7NA 2YXEA 4G5OA 1T0HB 5IMBA 3D6VA 2FW6A 3DVSX 3LC7O 1O6GA 2CNQA 1SVNA 5MN5A 1SKMA 1L1EA 1MH9A 2C9DA 2J6SA 1GXSA 1OX5A 1QYRA 1ZP6A 2RH9B 3NOXA 5HG0A 3LZCA 2ZUFA 4WPGA 1RWQA 2GOYA 2JBWA 1QHIA 1IYDA 2BEWA 2R62A 3SN6A 4G5FA 3OEWA 1PZFA 4DLAA 4AQYB 2O06A 4UEKA 3G1WA 2RJOA 3ORHA 3PZBA 1UPBA 4JDUA 3AR7A 1I1QB 2J6CA 5G40A 2LDBA 5CDYA 4MV7A 1K5HA 4KR6A 1ZMOA 1OB5A 2PKYX 3O74A 2BEUA 5H9WA 1OH8A 2QTWB 3QA3E 5H8WA 3BTUA 4HGYA 5J4LA 4GOLD 5BV1A 1B0AA 4NEGA 8ATCA 3LQ4A 5GOZA 2R6DA 2V9CA 2E87A 4INAA 5BMOA 3L7JA 5HGXA 1O4VA 4NVRA 4KUHA 3J81k 1HNWB 4CKZA 4CLOA 1KBQA 3OM9A 4DIUA 1KP2A 1FK8A 4JJIA 3PJFA 3PUIA 5CU7A 1JZQA 2DUMA 4W5HA 3NUGA 5IEBA 2J48A 4V2IA 2B9EA 3QVVA 5LZ7A 1KO7A 4FWBA 4QECA 5BUCA 4IILA 5E2BA 2Q1WA 1UT8A 1T5LA 2QLFA 4KTTE 1IWBB 4WK0B 5F73A 3SHQA 2ZJ2A 1HEYA 1N2JA 1PWXA 2FTKE 2FRXA 2O2DA 4G24A 4J1TC 1GCOA 1MZVA 1XQYA 3UAWA 4CNQA 4EHJA 5ABPA 4RKYA 1JILA 4FB4A 1ZHHA 1Y33E 4B4KA 3T5MA 5C31A 1U99A 2PMDA 1XEFA 2VKTA 2JLUA 5EI5A 2FK1A 1SCNE 3N8NA 4EIWA 3F9RA 4OXIA 4TZ0A 1IEWA 3RV3A 1NR1A 1ESCA 4JLNA 2ZYVX 3O26A 4L4XA 1IHPA 4ZAXA 2WSIA 2R1VB 2XGMA 2AJBA 5JZMA 5D87A 3ANNA 1Q1NA 5D01A 3WGVA 2O0KA 1MENA 1A2OA 3PUJA 5SYAA 4CKWA 5LLTA 1Q14A 2ZXEA 3P0IA 2YV4A 2O3RA 1T36B 2FGJA 3K2IA 4HYTA 1SOVA 1CULC 5C8YB 2OQ2A 1T0IA 3M4JA 4MUNA 2VDPB 1SN7A 2MOKA 2C3UA 5A62A 1W7AA 3H2JA 3T3MB 3UJBA 4YAWA 1WY5A 4OP3A 1EQUA 1QHEA 1OAOA 1VHJA 3PQCA 3ZD8A 4EYOA 1XLVA 2Z2XA 3N3AC 3N86A 2UYGA 3O8QB 4IDEA 3RS9A 4BVBA 4CVNA 4DYHA 2XGOA 3SM3A 5GJCA 1EDBA 2YNMA 3B53X 3ZDCA 4PPGA 1ICEA 2NPIA 1UWLA 5IT9A 2CMDA 5K2OA 4Q4AA 1YZHA 3DOIA 4ER6A 1QE5A 2ZYWX 3AM3A 3V1UA 2QRPA 3ZDYB 3JYLA 3HSSA 3X2SA 1DAHA 3FCAA 4EA7A 4HZGA 4AS1A 3OO1A 5FPYA 1X8KA 1EXVA 1Q0PA 2C57A 4QO8A 5DTMA 3UH0A 4TPKA 5ILGA 5LD2C 1FC0A 4V38A 4OBBA 1SIUA 3H2SA 3OTWA 4I55A 4PZ6A 4P22A 5JYEA 4HGRA 4BAGA 1DP4A 1RJGA 4TZKA 5K3DA 3FKSD 4QPPA 4HWRA 3R9KA 1QG2A 4LJ7A 5TJHA 5HF6A 3M70A 4ZZIA 2J7KA 1AZLA 2KSWA 1E2JA 2C97A 3VO2A 4BNVA 5FTJA 1H2FA 1H93A 1QIGA 2QTMA 1VE1A 3QEJA 3N2LA 3Q85A 3F8WA 4OSOA 5CYFA 3G8AA 5CPFA 4CR8A 2DTXA 3RYFA 1KQOA 1NP6A 3NOQA 4MQMA 4G0WA 2AKAB 3KYHC 2ZJ7A 4PLWA 3ZHXA 4D98A 3W4JA 5LYJB 5CD9A 3HNPA 3L1UA 1UT6A 1V95A 4XYEA 3ZKWB 3DTFA 2YJTD 1LLQA 4AQDA 5IYCG 1J1ZA 3SZLA 2I4NA 2WTFA 1JHYA 4TM5A 1QG4A 2QZPA 2AJDA 4X1YB 5T4EA 5K6RA 4DV2B 1J4AA 2ECQA 4HLUA 1YL5A 4AQ7A 3K35A 4RLSA 1J39A 5KFJA 2V6BA 2C5LA 1OC4A 5ALDA 1YFLA 2V7UA 2XCPA 3JQ9A 4W7HA 3EA4A 3CY6A 4II3A 3SF0A 4AJ2A 4YCMA 2QK4A 1NN1A 1GTZA 2WUFA 4ND7A 5SZHB 4RUKA 4OQPA 2YN0A 3QOFA 1UC5B 4DIOA 2ZWAA 2I54A 3W5AA 4CMKA 4L78A 2YHBA 2GVDC 4ZP1A 3AQIA 1BE0A 2XIQA 1Z12A 4HWTA 1YVUA 2DZDA 3UFXB 2FSFA 4EI2A 1N77A 4KX3A 2F8TA 2IZ7A 4JX9A 1IBLH 3F4LA 1C8KA 2QYTA 1U63A 1BHQ1 4MIYA 1Q0UA 1YB1A 1JXAA 1FMJA 3KP1A 5L3SA 3TVTA 1AB6A 3WA6A 4MPJA 2AE1A 1U0OC 5FD5A 1XDWA 4D4MA 1STOA 1PR2A 4LQDA 3V32A 3N6RA 3OD1A 3DQZA 1NF3A 1C1YA 1XU7A 1RWMA 1Z9BA 1ZIOA 1TMGE 3FI0A 3GFPA 3R77A 1KFEB 4URYR 3M6UA 3UGTA 4PGGA 4YCBA 1P0PA 2YV1A 3FROA 1CUAA 3SXJA 3HCOA 1E3MA 2ZWVA 4EPTA 2PGAA 5JSYA 3CN9A 1UQRA 2J4CA 1KEEA 5EIOA 1X70A 3H4TA 3OUTA 1XQ6A 2NQTA 1W2GA 3OPYA 4MCHA 4W6ZA 4Z0PA 3L1VA 2GK6A 1EX7A 4B79A 1TWFA 5B2EA 4MTEA 3I4LA 1NDQA 1M2HA 1HOTA 4NYJR 2DTDA 2TECE 2VP5A 4F96A 3NYRA 4X94A 3FPAA 1G5HA 1R37A 2IHBA 4YDHB 5EQFA 5FWYB 2IOHA 4C3ZA 4Z7QB 4UE3S 3O9MA 4HQLA 4DL4A 5ALZA 3T6KA 3T3NA 2XOEA 3WHKA 4KVGA 3V8EA 3Q15C 4P53A 1GLGA 1GQQA 5JFTA 4P08A 2QUZA 3EGEA 1OILA 3KJXA 4B0OA 1HEIA 1LVGA 1D2EA 4R4JA 4R8KA 2GRAA 2QRKA 1UXOA 4DUPA 5JAHA 4ZPXA 1HSZA 3KU1A 4LSMA 5SICE 4RWEA 5K6AC 4PYJA 2I3ZA 3PQEA 5EQJB 4Z7OB 4FNAA 3WFIA 2WJ3A 3CLTD 1UBOS 1UKVY 2PNJA 3T7SA 4BHTA 1DEKA 4WZAE 4LECA 4E70A 1II0A 10MHA 2I6TA 3P8ZA 3H3VH 1A5BB 1AGNA 4OHCA 1EMDA 2GKOA 4ZQFA 4LHWA 3ZZUA 5L1KA 3A3PA 4H1UA 3ZBQA 3ZXSA 1R0CA 1GZDA 4EY5A 3UWDA 2OT3B 4BFWA 3N2IA 4C5CA 2PXCA 4EBDA 1A9XB 4K28A 2VTDA 3UHOA 3G5TA 3RT7A 3AF6A 3LA8A 1T9BA 4X1IB 5GJWC 2AFHB 4OXKA 1T9HA 1XK6A 3NYWA 1QYDA 2DUUA 3N6XA 4FM9A 3JATA 4B6QA 1A9ZA 4ITVA 2P2ZA 2Z6VA 4NG4A 5KQSA 4PFSA 2V0GA 4YR3A 3EOBI 4TRMA 2G08A 3COVA 4OREX 3STWA 2DPXA 4B6GA 2HKIA 3T1NA 1BA3A 4MUHA 4RPKA 2VQFB 4BIIA 1T9AA 3B1KA 1R12A 3WRXA 1HLFA 1SC4A 2GCNA 4EMTA 4HTFA 4ZN6A 1E1KA 3N75A 4O7WA 2AGOA 2IYSA 2VLIA 3CGGA 4FR2A 4R9RA 5AOAA 4J29A 4JOQA 2ZUUA 2IV2X 4Y2PA 4BE4A 5L51A 3KQLA 2RSLA 5MHTA 1FRNA 1BW9B 4O7ZA 3C39A 3LHIA 2AZMA 2JGIA 1VYHA 4JA0A 5DISC 2HO5A 4LZJA 4DLWA 4QARA 4JUFA 3K2EA 1TJNA 1KJJA 5HK9A 1IM5A 1C9KA 3PR2B 3P9ZA 4K0RA 4RZSA 3SOPA 4CDRA 5GZ3A 2J3MA 2GFHA 5C4GB 4EY4A 1M6WA 4LX8A 5DBOA 1EVYA 4HHEA 5KG1A 1KJYA 1P17A 1JHRA 3SWWA 2BMDA 1WW8A 4A0FA 3IRVA 4CIVA 1JAYA 4U2FA 3WLEA 1MN6A 2NTYC 2MCTA 2BF7A 2CLOB 1X1BA 4K0KB 3BILA 4Z3DA 3I5YA 1EEXB 3OX3A 3R9IA 2WB2A 1M0EA 4YAKB 1FVOA 4YR2A 4A23A 4GQIA 5AESA 1N5KA 1KBOA 2EIHA 7MDHA 4RVHA 4DBZA 3N53A 3O8BA 1PKEA 1NSTA 5KYUB 2Z95A 5DBFA 3T9DA 2I6XA 4A82A 5EZ6B 1F7VA 1ODKA 2C1ZA 3AW9A 3BHIA 1GTVA 2HHJA 4OQZA 1GAXA 4Q9AA 5AH0A 3QI2A 1C7EA 3UHAA 4JBGA 4QULA 3FNIA 5T4HA 3TVYA 3FWPA 2YFQA 4YP0A 4KU4A 3SAJA 4NBTA 4FDVA 2P1ZA 2XT6A 4MLPA 4I66A 4IS2A 3WWIA 1RI5A 2PD6A 3JVDA 3DEKA 1MV8A 1XWFA 1M2WA 2ZZMA 3H5VA 5JNSA 3ORRA 1L1RA 3M6VA 3AFNA 4LFAH 3AEZA 3RWMB 1G2IA 1SKYE 3UJ3X 1MD9A 2XQJA 2AYXA 1PK9A 4NK5A 5AMXA 4LUCA 2R1UA 3W7VA 1RJWA 3HV2A 3NBZC 4EBCA 3HC7A 1Z3CA 1UK9A 2A3NA 3KYDB 2FK8A 4NE9A 1GKKA 2I8LA 3NBMA 3W9YA 4BAZA 1AKVA 3W3AA 1Y3FE 4RMJA 4ZVMA 5E38A 4ZQBA 4BNNA 1P33A 4AJJA 1LVHA 1SUWA 4TTTS 2HCFA 4RTKA 4NCBA 3ENNA 4BZWA 1WCMG 2JARA 2ZJ6A 3ZGOA 1Z8DA 2BLLA 3D7RA 3G0BA 1U2GC 1GP2A 2BFWA 1TKAA 3VPXA 3MGBA 4J9UE 1M2VB 4MHSA 2WU8A 2E4XA 3D4IA 1SVSA 1ZJZA 3KSMA 3HR7A 3K2QA 4HDCA 3TW0A 4BX0A 4M9XA 3GJ8A 4F45A 4LMAA 4IH1A 4QSMA 3ZHZA 3CCBA 3R6DA 4N6NA 5CRIA 4ZQCB 1DJOA 3E23A 2VSYA 1W5EA 4ITUA 2JGDB 3VYTB 5LMNH 2O2ZA 5DLDA 2PEYA 1X80B 5KAMA 3PNOA 4RGBA 2NSDA 4P4NA 3LHDA 4U3JB 1X2EA 1JR3E 3ZIAA 2PMFA 1G60A 1VKNA 3G2MA 5CX1B 5F1KA 4ARAA 5MFPA 1WIWA 3VNAA 1U2ZA 3HU2A 3AU9A 3HYSA 1KZ1A 1RC0A 4Q7EA 3ZWNA 4BLUA 1U04A 5JCXA 3U5TA 4RY8A 3BMCB 3ZNNA 5B4VA 5I9BA 4MUYA 4JQCA 2YHIA 1KQFA 1LEHA 1NQXA 2R00A 3KOWA 4H4DA 4HGZA 2I6QA 2XTNA 3H5WA 4DV7H 1K7EB 4OJQA 3G0IA 2DR2A 4LGVA 3ISJA 3VJLA 2ZYUX 1MPXA 1HR0B 3A9UA 4QTXA 3P7MA 3OMXA 2CMKA 3L06A 4G4SO 1M10A 3CRW1 2XWQA 3JQCA 2WYWA 3OLVA 1KVUA 2YV5A 1U3CA 3CWQA 4IYRA 1F4PA 3SXPA 4ENWA 2R4UA 3MTBA 2CYBA 1S2GA 1OUMA 5ERGB 2WPNA 2GWHA 3V4LA 1TZKA 2O2HA 4RVUA 3DVAB 5G3ZA 1XKQA 5IZCC 3WLQA 2R96A 2JIMA 5EFZA 1YCHA 2PKEA 2XGPA 3G0CA 3O4VA 3ZJ4A 2G6TA 5CG1A 4MINA 1M2JA 4UTVA 4A6XA 3AIMA 1UKEA 4H08A 1KEVA 5KNCA 1U3VA 3T4PA 5M2QA 5KOHA 4K46A 3OJEA 4KVFA 1NKVA 3EGXB 4IUDS 5LU9A 3ZIUA 3NS7A 4TYMA 5DTIA 2FR0A 3OJFA 3I2HA 1E2GA 2IU6A 2H00A 3A28A 3H9GA 4R7GA 3A1WA 4ER3A 3BIXA 1YJ8A 4WCDA 5D7NA 4Y18A 3K0KA 4F5EA 1PWEA 3VNVA 4EW2A 2JCSA 3RROA 4BC0A 1N56A 2EJ0A 3OA0A 4MS1B 4C76A 3P9YA 4DPLA 1BHJA 1F8UA 1PQYA 1VGVA 1VLZA 1ZSYA 2FMTA 7ABPA 5LP6F 3F6PA 3TEFA 3VPDA 3RKSA 3GV0A 4KQ2A 1MPTA 3ZI0A 1S97A 1SXPA 5LP6C 3B7WA 1IPHA 1AX9A 5ER9A 1ZCFA 2YDYA 1D0VA 2E21A 3BDAA 4MVJG 4U2EA 4D8TA 1RRFA 2UUOA 1T8SA 1LPMA 4TKUA 3COJA 4MWOA 4C4SA 3EAGA 4DA8A 3OI7A 2Q8NA 1Y34E 3I04M 2DPMA 1L5HA 1BHSA 1WD5A 1RJPA 4DV7B 2ZEJA 3D8HA 5AVVA 2I6UA 4AN1A 4TM7A 5LC1A 4G0VA 2F43A 2A33A 3DMGA 2QSYA 5TGDA 2FJUA 1GQ2A 1A2QA 1CRPA 3UAZA 4RUAA 3G5AA 4FNGA 3U81A 1RFLA 5LXTB 3W5VA 3T5CA 4OJNA 3MGAA 4RO0A 4I7EA 3ZU6A 2Q6OA 3JAKB 2C2OA 2DM6A 2MSNA 4MKHA 3AESB 4WOCA 4IGFA 2FZVA 4UQLA 3I83A 3MWLA 3T1VA 1WHSA 5IDVA 3FFWA 1ZD8A 3FN4A 3NFRA 2E4WA 3K4HA 3W6UA 2BBOA 2AA3A 1ZIYA 3IX7A 1NPTO 4QWAA 1YZYA 2AJLI 3R5KA 3HSYA 1UAGA 3VDXA 4CMBA 1LC0A 4J1QA 1KXJA 3W3AH 1MMFB 2NWQA 2OBYA 4BATA 4DQVA 3HN6A 2E5LB 2JATA 2FUG1 2WWXA 3AI3A 5TEWA 4EPWA 4CIYA 3Q7EA 4YP9A 1M0TA 3EGDB 5HE9A 3RYFB 2Q1UA 3WRYA 4F38A 4RZQA 3UFBA 4EB0A 3F8SA 2BP7A 3DMDA 4YP1A 2QUAA 4D8VA 1DG1G 1ZD9A 1ZD5A 1RK6A 5IMSA 3WGGA 2C84A 4C6RA 2PPVA 1MU0A 5AJUA 5K3AA 4JOSA 3RVOA 3ZV6A 3AVOA 3L9XA 3JVIA 4C3UA 4LF8H 3K3PA 1B6TA 4IOKA 4ZI5A 5A05A 2XCTB 4PTLA 1P8AA 1IU9A 2HB6A 4UOEA 1N1GA 3RTBA 2W71A 5KQGA 4WBNB 3GFRA 5AM3A 4PY2A 3CPHA 5EDWA 3PEVA 1CUGA 2A59A 2YJ5A 3E2IA 1IQUA 3GWGA 3EF1A 3BM5A 3D5TA 1PBNA 4LWQA 4XEUA 3SP1A 3TZKA 4P3XA 1RZ3A 1FY2A 1IY0A 2WHYA 3DUFB 3GPDG 3ITDA 4H9GA 4OMFG 2UUBH 1TO1E 3IV9A 1ZVJA 2IYFA 2XTZA 1FNDA 1QYXA 1T0BA 4AKEA 1IC6A 1NVUQ 4X00A 2NUAA 2CE2X 5BNFA 4PTZA 3OY7A 4DCJA 3V80A 3EYAA 4FCTA 4XGRA 5HIAA 3PR5B 5TQVA 2XODA 2FRVA 3UCFA 5AYVA 1O6CA 5C8YF 3JALB 4KWEA 2QLJA 5JXGA 2IUSA 3U0VA 5CJ2A 4UAVA 3C5HA 4Q7JB 3RSQA 4YT8A 2JI4A 2VKQA 4RU1A 2X19A 4BO3A 2KLHA 3VJRA 4BZZA 2ODTX 5HRAA 2UYOA 3OCUA 2ZAMA 2IMWP 2PRIA 4IZ6A 1Z38A 4R8VA 2RGNA 4FDUA 5DM0A 4X20A 1YQXA 1E4OA 2P2DA 1FDUA 3PVZA 3W78A 5BSWA 1H2HA 3OTHA 3V4RA 2CV2A 2ZBDA 1CHNA 4A3FG 3SKXA 1VHDA 1GA6A 4OQFA 4BO6A 3LLSA 2XNSA 4XRRA 1C1XB 2B36A 2CVPA 3QKIA 1YZTA 4TROA 4IXNA 3UWOA 4IF4A 4Q1DA 3RVMA 4M9SA 4GSLA 4JSRA 4DLXA 2GXAA 3T06B 3HS3A 4IUYA 4NF2A 1NG9A 3O75A 3OHMA 5BR1A 3HK2A 2FXVA 4TTVA 3D59A 1OJ7A 1ST3A 2ZYDA 3E1SA 5E3JA 4D46A 2Y9MB 5K5EA 1YAHA 2O8CA 3OFND 4KXYA 4JWTA 1K5GA 1OV4A 3IB6A 5EXSA 3MLBA 5FWXA 1HSOA 5FPOA 3ZKAA 2FW0A 3M6AA 4YXFA 1NJGA 1ZNYA 4HXEB 1VBHA 2UVPA 1YB5A 1O5TA 4GXTA 4WMLA 3RT1A 5UKDA 4DDMA 4B9EA 4CMDA 1C3OA 2IHUA 1U3WA 4JLOA 3GUUA 1Z37A 2J3DA 2ZRKA 4OB7A 1PR9A 3DJFA 3SI7A 3W06A 1UOOA 3BOSA 4IVPA 2CF6A 4LY0A 2WF9A 3VA7A 5JECA 2R1ZA 3OP1A 5KFXA 1TOAA 4HDNA 3BK1A 4MRSA 4RNCA 1HI9A 2WP0A 2IPLA 4LSGA 4X84A 4ALMA 1KHHA 3IESA 2P2YA 2IOQA 2YWCA 2DPIA 3EDYA 3LUHA 3X3HA 2A86A 4RPJA 5JAUA 3KL4A 3D1JA 3BRSA 3ICCA 1OSNA 2QP3A 4RHYA 4C78A 4J9QA 3EMKA 2NVYA 2W22A 5I9MA 4OAOA 1U8CB 5LMUH 4N7BA 5AKYA 1LK0A 1VHLA 1VOTA 4UCXA 3SHWA 4Y1GA 3U09A 4WN9B 4GLXA 5FNZA 4XR4A 1G6HA 1RYFA 2ZRCA 3F4KA 4S1NA 2QRQA 4L85A 1BFUA 4K8OA 5TT1A 3OTIA 8AT1A 3WQSB 3U4DA 2WAOA 4ZQGA 3ZS8A 3TQRA 4DUYB 2PQ0A 3MGKA 3V55A 2G72A 3VC7A 3WLNA 1JBEA 4ENRA 721PA 1H2XA 2PZLA 5A0TA 1T1IA 4EG1A 1VIDA 1Q1AA 1NUTA 3EUWA 2QD5A 4E5SA 2TMKA 1QKJA 4ZMRA 3IEVA 3UHPA 2ZSDA 2ZIGA 4F1WA 4F4XA 2W2XA 5I7EA 4OQYA 1ECCA 2JFOA 4ZARA 2VDKB 2Y05A 1NONA 1NV8A 1VFNA 2B1GA 5FNVA 3W77A 5HJEA 3PXGA 2DP4E 1UAAA 3U4CA 3V7WA 1KAHA 1KH1A 1ZM9A 5KT6A 4YP3A 3JQ6A 5HUHA 2FWNA 2IY9A 5FO1A 1Z68A 4L6AA 1PX2A 1UBJS 2Q4EA 3IOBA 4Y2VA 1N2SA 4C5AA 4XYMB 3D54D 3K1AA 5DXAA 5IJAA 1URPA 1Z7EA 2CJFA 2QIOA 2KWIA 3L04A 2LP4Y 2W8ZA 3EFEA 2JL1A 1BX1A 5JFOA 2QTLA 3AYZB 2Z5LA 3CLHA 5E2IA 4MA5A 3PSHA 2F9LA 2VOBA 2ZGIA 2CYCA 2GBCA 3B2EA 2RHLA 3D0KA 3THSA 4EGFA 1E5QA 2A3RA 3W2GA 1CZRA 4ECVA 1HRKA 2CL7X 3OFJA 4MUMA 1FW6A 1JRLA 1MIHA 1GPDG 4PO3X 1UMDB 2YFKA 5L7YA 4YQFA 2CJWA 2A0FA 1MO4A 2D00A 3G2JA 5F52A 4EB6A 4F3NA 2MU1A 1OOEA 3A9VA 3LKVA 4QRDA 5LZ8A 3W3AD 1QAQA 2IGTA 4Z53A 4UJ3A 2HNKA 3EASA 4V02A 1YK0A 5FB3A 2AOUA 3QVOA 3O73A 5JISA 1AKRA 1NBAA 1T3GA 2OCDA 4M88A 4Y30A 3MQ4A 3NBZB 1F1BA 1HKUA 5KU7A 4PQEA 3W6NA 4YJFA 2VSXA 3I1IA 4X45A 4Y7DA 1G64A 1UWVA 2F3UA 3C5EA 3QPDA 3SYRA 4Z2YA 3GFGA 2G06A 3R7NA 5IVIA 4O81A 4IGAA 3GFSA 1Z5PA 2QYSA 4RK7A 3BE8A 3P94A 4OAPA 5CM8B 3EF3A 4CT4B 1VJGA 2M6RA 3NBQA 1BXGA 3L8GA 2JA1A 4OIFA 1J42A 1DCKA 4S35A 1WY7A 4YB8B 1FDWA 3ICPA 3PHBE 4I4TB 1Q74A 1RC8A 4Y2JA 2AUTA 1Q3HA 2NSHA 2P9ZA 2NN3C 2HQ1A 2DY1A 4EMBA 5I60A 2XYRA 5FOQA 4MWZA 1YKFA 3NHYA 4HX9A 4N3NA 4D79A 4DQNA 1CY7A 1B8NA 5K0TA 4IHKA 3MJEA 2VQEB 2HL6A 2IYWA 1PK8A 3H0CA 4WI1A 1S68A 4Q1EA 1XAIA 2ZIEA 4IV8A 4R1SA 4ANFA 4DV0B 2R11A 2I66A 1Q44A 1RDFA 1GGMA 3AINA 5FTWA 1WWKA 3VHLB 3H8WA 4GOKA 3K71B 1XQ1A 4UHFA 4Y2XA 5BMVA 3UMYA 1MG0A 2PNFA 4ZOLB 4NCKA 4O5OA 1RI3A 2O3SA 3EUAA 2BY4A 2PGLA 4C0BA 5JBIA 4L5IA 4Q8EA 1ISFA 3OHBA 3G8CA 1T2VA 3P9SA 1XCOA 4G5GA 1ZNQO 5FIUA 3VVBA 4EFMA 2IH5A 1LBIA 2EBWA 2FP4B 4CHGA 1RRCA 2FMUA 2DWOA 3DQQA 5KFSA 2HJRA 4M3NA 4BGEA 1M83A 2Q0HA 2FR1A 4MQLA 5IKMA 3N2YA 4UCUA 4D81A 4WKCA 4WIAA 3HCWA 4KHZA 2L82A 4NK4A 2J3KA 3TGPA 3JU3A 2QKYA 5I7WA 3N87A 2ZQZA 4IGKA 5H59A 4JVLA 4CLHA 3LO5A 5CGQB 3PEWA 2X5RA 2VDRB 4JVSB 1U6JA 2LNDA 4LX0A 4MQFA 3SHOA 3JQ7B 4FYIA 1EXNA 2CXRA 4GE0A 2OVBA 5A2QW 2BWJA 3IHKA 3BQ0A 1SXJB 3IKLA 3AMVA 3K7EA 1WVIA 4QYXA 4F4JA 4YFVA 1IVYA 1C2TA 4XYLB 4O0LA 5E6SB 3VKWA 3EC1A 4HOYA 1UAYA 1GZHB 4C0LA 3GTGA 1YNOA 3MC1A 2EBHX 1X8XA 5T8KC 2FRDA 1XTIA 2NLOA 1T10A 1S02A 1E0DA 1XJ0A 5HSGA 3R0JA 2H85A 4A0GA 3AHHA 1TPYA 2OWEA 4XPZA 5TE9A 2IUEA 3VMMA 1L8QA 3LVRE 1XSEA 1QQ6A 3W8DA 2XMRA 1ZHOA 1A7KA 1XJ5A 2PLNA 2PWPA 1Z8NA 3HVUA 5L3ZA 5GAJA 3S27A 4RQBA 5TGTA 4EENA 3E3NA 5D6NA 2XBMA 2BFDB 1YQWA 3PWTA 2C5BA 4JLPA 2R6FA 4FQ8A 4D8UA 5IFKA 5IVHA 2Q6KA 2HDNB 4PZUA 5B1SA 3IGFA 1V51A 4RJKA 4IIJA 1N32H 3LGAA 3ZXUB 4YMTA 1I3MA 3DVRX 2EVWX 3BMQA 3F6RA 2FN3A 2C7PA 2WTNA 2FDCA 2QA5A 4QGAA 3PNSA 1UMBB 3H0KA 5ALYA 3W5BA 1VQ1A 3MCZA 4Y0VA 3EEYA 1L2ZA 1CQIA 2HJHA 1YV9A 2WMOB 3K0AA 4EX7A 4C4RA 4YV0A 4FIZA 4ARCA 1H22A 1TTHA 4ZICA 1G7CA 4CEJB 1LPNA 1NUAA 1RZRA 2FJPA 1O95D 4FWIB 4HPJB 5EVJA 2PZ8A 2B7BA 2QVLA 1JZSA 3MR2A 3DBOB 1EM8A 2FEMA 1RI2A 2ODPA 1O5IA 3IE1A 2R5WA 4BBAA 3GCWA 2UVPB 4R31A 3SQOA 2HA7A 1R9TA 4HUQB 4E15A 2NVOA 3GHHA 1J22A 1T5OA 1FDIA 3K9FC 3P20A 2G17A 1BVUA 5JROA 3QBJA 5BYBA 3KOZA 2Z8YA 1K2WA 4ICIA 4BO9A 5FLXW 1BE6A 1J00A 1EK0A 1HFWA 1Q91A 1Z7YA 3FKSA 5CVCA 3I52A 3MCTA 1PG5A 1J23A 2EX1A 3AZOA 4I8DA 3WYNA 4BZXA 4J7AA 2VBCA 2W2VA 4CFSA 1HQDA 2GN8A 5EUBA 1F38A 1ISHA 1ICIA 3A6KA 4GG1A 3RVDA 1SXHA 1U6IA 3F6EX 3DS8A 2FUNB 1GYPA 1N2OA 3RUFA 2IXEA 5JJKA 1XX6A 3DF9A 4LZNA 5LA6B 3REFA 3INRA 1CK4A 2FZEA 4F93B 5FX2A 1K9SA 3R8FA 1I32A 5ALOA 1ZAUA 1PYOA 3EEQA 1E96A 1BEUB 1V16B 4LZWA 3IJ5A 3V5NA 1DHTA 1TD9A 3O4HA 5HA5A 4EL5A 3Q5EA 2VJBA 2B6HA 3V2IA 4BKUA 3KU4A 3Q12A 2BQ3A 2CFOA 3DZDA 3TY9A 2HHFB 4IPTA 1L8AA 1ZUNB 2DWPA 2IGBA 1I1LA 1CY6A 2SCUA 3JQFA 3VTAA 5DI3A 3RFFA 4M9ZA 5GZ1A 3ZVNA 3JALA 3N05A 2AD5A 2NTVA 5ARBA 1M73E 1HO3A 3ENQA 1QH0A 5HRUA 3EC2A 5KSPA 3ESZA 4NCNA 2ORVA 4ZREA 1GITA 1NJSA 3KLBA 3GHYA 5GGXA 1UMBA 2Z9BA 2IEZA 4FFBB 1QIIA 4RCZA 5AVWA 1L5OA 2DKFA 1FRFS 2QSZA 4JI6B 2ZSUA 1IB6A 3FR8A 3PQ8A 4LRXA 3C5CA 2VP4A 2IA5A 3PEEA 1I1HA 3PFIA 4J0QA 4R3NA 4D57A 1NNI1 1L5RA 5DLPA 1SK8A 5IVDA 5TQJA 4BEWA 2FZGA 2Y67A 2DQYA 4R8UA 1UWCA 3BE6A 4XIYA 1Z4LA 1Y3HA 1RPAA 2VPQA 4L8LA 3VX3A 1QKIA 3C48A 3IVAA 1NFQA 4NMWA 1KZYC 3KIPA 4Q3OA 2YBDA 4HCJA 1EX9A 4N76A 3QLUA 2DAPA 1EBUA 3Q5DA 4RH3A 2X6QA 1R6VA 5BWLA 2UYCA 3QLEA 2HRZA 4F6LA 5JAPA 3RC7A 2VF8A 3SC2B 2F9FA 5E25A 4E11A 3CHYA 3ZV3A 1L7EA 3I12A 1LW6E 3E3MA 3EXG1 1Q7RA 1B8PA 1NJ2A 2I2XB 4PCUA 5BQOA 2Q5EA 4YAEA 3UUFA 5FTKA 4D3YA 4LZAA 2PU7A 4AF8A 3G5LA 3WO0A 3FUWA 2GN1A 3FDJA 3PR4A 3UM9A 2FLWA 3SHVA 3ZE7A 1Z74A 5ESDA 4LV6A 4U6QA 4YQWA 2B7LA 2YWXA 3LCMA 4GKVA 3IIEA 1CUIA 2HSEA 4GRDA 3GILA 3FTDA 1H3FA 4GC6A 2B6NA 2WU4A 4MR7A 2J9GA 1JA0A 1S3FA 2H2WA 2ODAA 2XA2A 1CY8A 1WX1A 1QRAA 2M6SA 3DXYA 4PX2A 3ZX5A 3CX7A 3MAGA 4RCNA 4PGAA 5DM2A 1B76A 3Q10A 4M6WA 1JSZA 1QORA 4NPHA 1RT9A 2HPHA 1Z13A 1KQ3A 4ZMBA 2PLRA 1N6HA 1YT5A 5KYXB 3CXRA 1JIJA 4BCCA 2IX9A 3TQSA 1YVDA 1EUCA 2PD4A 1EWTA 1CY1A 2XSZA 1PR5A 3DE0X 5U9CA 5F77A 4IZIA 3I6IA 2W8LA 1I51A 3I6MA 3K92A 1DU4A 1OLUB 1W8IA 3SZGA 1OZ0A 1Z45A 2PSSA 4G0OA 5A02A 2G71A 2JGMA 2ZYTX 2OCLA 3FE2A 1GILA 1IAQA 4EFNA 3GPLA 4RCVA 2Q7DA 4MV6A 4G8DA 4DL2A 3FOZA 3QFRA 2P91A 5IHPA 2H0AA 4MV1A 5KSYA 1XTRA 1U4NA 2H8KA 1M6NA 1K5PA 1EX1A 4GI7A 1XZQA 2I87A 3FPHA 3RJTA 4XQCA 4R2XA 3M6XA 3C3KA 4H6PA 4YQEA 5LP6B 1CFZA 4ECSA 3AKCA 3HEMA 5I48A 2ZJ1A 1ZD4A 5GWXA 3FTFA 1KEPA 3CTPA 3GVHA 3RSFA 4TUYB 1F8YA 1ZR2A 1K89A 2V59A 4QD3A 1RPJA 4LXTA 4EKEA 1TZ2A 1V1RB 3FNQA 4W7SA 4XB2A 3SGIA 1YC5A 4BBJA 1UKBA 1JPVA 1O4WA 1JDBB 2AOXA 3QELB 4I50F 1E64A 1MV5A 1UODA 3IQDB 1CJTC 2Z56A 4TKMA 3BQ9A 3TZ6A 1YIAA 4S1OA 1N75A 2QPTA 3HKEB 3CSWA 1SXJD 1ZJ6A 4OKNA 1TGVA 2C35B 1YTLA 1FF9A 3BE4A 5FLEX 3KCQA 2XCLA 2LXNA 3L6EA 2WJJA 3T1HH 3WGLA 4OHXA 4DR1B 1LVUA 2WTAA 4R16A 1S2NA 2OTCA 4IUCS 4BWSC 4HNRA 5HEKA 4DAOA 2QZSA 4G9EA 3LP6A 3WLIA 3KJFA 3KHKA 5HTOA 4HS9A 3FUVA 2B5WA 3PENA 4BMZA 1N5OX 5KFDA 4OXQA 1OGIA 5KOJA 1FUEA 3C3PA 4Q3AA 3ZOZA 2CFTA 2DETA 3VR2D 1LNZA 2H1OA 1BXRB 4Z9FA 5AW6A 5FI3A 1RBYA 4DG8A 2OO3A 3DMPA 5AM4A 1NLZA 4IO0A 4YT5A 1W88A 3SIPA 1U0TA 1ZCJA 2RBKA 3TRDA 1I6WA 3RSZA 1WBDA 1FEZA 3H1GA 1B74A 2BZ1A 5FPRA 1QH1A 3AY3A 1CJVC 3Q5GA 4R6WA 1J5EB 1QCYA 4MARA 1MGPA 4MICA 2C8VA 4DIDA 3JRXA 5D51S 1SU7A 1X7WA 3AEKA 4JJFA 3WRWA 4X7MA 4R83A 4MI3A 3GIQA 6GPBA 4BBSG 3K1JA 3SKYA 5IM4F 2FPWA 4NEQA 3GOHA 4N9QA 1X1RA 2W5UA 1IQRA 4TV9A 3ZBTA 3LX8A 4V0SA 1Q57A 3PS9A 4BB0A 3AP1A 1DHRA 2CK3A 4GBGA 4ZEVA 4D3SA 1L4FA 4EO9A 2D7DA 3B12A 3DKVA 3KUKA 1DBSA 2HMAA 4MRRA 4KH0A 4HN9A 1BIFA 1SVWA 1UXJA 4B80A 1T3SA 4N8DA 4U7JA 4E5NA 3OTGA 1M1YB 1K0UA 5AJYA 1EHIA 4IZHA 4I1PA 1HEUA 3BIJA 2M05A 3FYHA 4IINA 2E2IA 2VF7A 4OYYA 4WY8A 4AF6A 4CM6A 4CMEC 3QLTA 4QXQA 4GZ3A 4WGFA 3EDQA 3X43A 3L40A 2QB5A 3E18A 3Q0EA 2RAVA 1XLTA 4BNYA 3AF3A 4I1VA 2P79A 1Z2AA 2Z43A 1T1EA 3IBTA 2NO5A 4J9RA 3ROZA 2UZ0A 4D02A 4LG1A 1TAGA 3FNRA 3KKOA 4NNOA 3PX3A 5ESRA 3ZS9A 3EPHA 2PVPA 1C7ZA 4S2UA 1E92A 3KOOA 4IMPA 5E9AA 3E2MA 3WR5A 4CM8B 4EF5A 4DV1H 3G2NA 3ZLBA 2ATXA 1O7JA 4QQKA 2P2SA 3IQEA 2FWPA 3VOTA 1YGYA 3FMAA 1W48A 2CY0A 4Y2QA 4B6EA 4I5EA 2ID7A 2QVZX 1IK4A 1XU9A 2KBFA 4QVKA 1F4LA 5I45A 2H1FA 2ZSEA 3BH0A 1Q7BA 4RF2A 4UHBA 1S6YA 2G0TA 2Y4OA 2E4UA 3ZDAA 3ZQUA 3FMVA 1YCDA 3TJMA 2FCAA 5KNDA 2YXNA 3HB0A 1EFRA 2AGPA 3FH0A 4G0XA 1N0UA 3NEJA 4ZVSA 3VZPA 3D9QX 5C5CA 4RJ2A 4RA9B 2H18A 1T9GS 2QXTA 2QRJA 3OF5A 3FWNA 3AEYA 2A84A 1IBRA 2Q2OA 1TW3A 1HURA 3HLKA 1K0FA 3TZQA 1KBLA 4ED8A 2OCKA 3GD7A 4FEAA 4OYRA 3SZOA 3VYSB 3WLMA 2CHQA 1TIKA 3T99A 5FJ8G 2W6JD 5HDBB 5JWHA 4E3ZA 1KI8A 3LHKA 4DYDA 4IO1A 4J0KA 4BYGA 2QX9A 4FD3A 1EKPA 3BJZA 2BM1A 4I1YA 4AYXA 4WY5A 1T4GA 4NV3A 1W581 4GPEA 1L5HB 1AV6A 1JWBB 2ZDGA 1XVAA 4TLEA 2PO7A 1HTTA 1BMFA 2F6RA 2FP3A 2QN6A 2RCYA 3ND9A 4MW9A 1EA7A 2PKXA 4PU0A 4YRIA 3UH1A 3DE7X 3HNOA 1R8XA 2GD1O 2CUZA 3I01M 2QTRA 2HGSA 1E59A 3DR5A 3GNTA 2L2QA 1HNZB 3EVFA 4RBNA 1I14A 1OI7A 3M82A 4UTNA 5KNLA 1PJRA 4C2AA 2OBBA 4C4OA 3QWHA 1FRVA 1Q7EA 2C61A 4P7BA 1TAUA 3P4UA 2AL7A 3OJXA 3Q9UA 2GCGA 2RKWA 1E1CA 3I32A 4PZ9A 3U2QA 3ANSA 4Q9DA 3TINA 3GV7B 4JN6B 4RNOA 4Y7CA 3SF8B 3IQHX 1TECE 5CFQA 3RBDA 4J0IA 1B00A 1L3BA 1F2UA 1X77A 2PRYA 3N2KA 2IQIA 4V0RA 3WLLA 3LTNC 3L3BA 1PZHA 5DVZA 4Q3DA 4YLYA 4WKPA 3SMVA 2FSUA 4CIBA 3ZJVA 4ENUA 2ZR9A 5D5QA 1GA1A 2XF2A 2CVZA 4IQ8A 3KAKA 3KNZA 1W85B 1ZM4A 3O1IC 4RC9A 1MC5A 2CDCA 2KQUA 4H7JA 3V46A 1FP2A 3E7WA 3EYWA 2HRDA 4L16A 4KXLA 2D6FA 2EJVA 3PGKA 2GUGA 5DE3A 3HY6A 4EKDA 4O63O 1VPDA 1V4VA 2P27A 3TIFA 3GLIA 4FBTA 1K97A 3G1UA 3QF4B 4S24A 5CIQA 1RLJA 1HWYA 3VAAA 5L4LA 2PL5A 4JENA 3H2IA 5ITZB 4B74A 4KR2A 4WW0A 2HK7A 4PPQA 2G9RA 5A9SA 5SZKB 3R0XA 5IH3A 5D7BA 1XCJA 2ZRMA 2GT1A 4E1VA 1EGHA 4XD7D 4HAYA 5DTRA 5AW9A 4B3BA 1H4VB 2AK3A 1TU4A 2POQX 2AK2A 4MUBA 5IBCA 1ZH8A 2QMQA 4RK4A 1AKUA 1XRLA 2R6R1 3N5KA 3A9RA 1I7LA 2GMWA 2WJ4A 5CB8A 1L8OA 4FI3C 4IVRA 4EFBA 1QRRA 3D3WB 2C2XA 4PBCA 3G9QA 3MLAA 4PFJA 3TL3A 2J0VA 4WOJA 1YZQA 5ANRB 4B7UA 4BKQA 1IBMB 1LPPA 3K9HA 3FLAA 5GOTA 1M67A 1LKZA 1C3OB 2JEYA 2ZBQA 4EG7A 5KQMA 2FJ0A 4IQ0A 2WFAA 3NTXA 3O1LA 4QDUA 3PL5A 1YZLA 4G25A 3UKDA 3KBBA 3IAM6 4M8KA 4GLFA 4F4DA 1P60A 1NAHA 2A58A 3HGTA 4ZT2A 3TQOA 2EW8A 3Q3CA 4WACA 5EHNA 1P4RA 4NLLA 2JVJA 3EVZA 4B3RB 4JMPA 5B3LA 2X9NA 2XMBA 4MJ3A 5EJ2A 2QQFA 4AX8A 4MGEA 4UUQA 3S2FA 1Z2EA 2ZSHA 3QHPA 4BPBA 3GRZA 2ILVA 3AGQA 5KFPA 1E6KA 1I4TD 2IUFA 3VR4D 4P54A 3NNSA 4KLRA 3RKUA 4EUKA 3CX4A 4A8HA 3DFMA 3MUOA 3DLTA 1ULBA 4D5EA 1P9OA 4OPMA 3OZXA 2EG9A 1ULAA 2GYUA 3LQYA 5CITA 3JRWA 2JA6G 4LYEA 3DZFA 3CO0S 4CTKA 5CM9C 2D54A 4RB3C 5BQXA 3HUDA 3OE5A 1IOVA 4D9IA 2BZ0A 2WM2A 2XPCA 2K7ZA 3CIOA 2UU9H 1T94A 1PR0A 2X7JA 3OIDA 4R1UA 3JVVA 5EGSA 2Y3IA 4KG7A 3HY4A 4LMYA 3LC0A 1PV2A 2FOXA 4J7XA 4MULA 5JOQA 2EWWA 1ILWA 4AJPA 3VJMA 2WAQE 1F6WA 2WFLB 3GGJA 3RC2A 3STHA 5A03A 2P62A 1MC8A 3RTCA 4A0QA 3WHPA 1E2DA 3GGOA 4KH1A 2VUTA 1JLLA 1S2DA 1J21A 1TQ6A 1ZD3A 2H63A 2VYNA 3CEAA 4NBVA 3RGWS 4AZTA 5BQ3A 1A50B 1IBCA 3GPCA 1E3QA 3DWFA 3HB1A 3IPXA 2KX7A 4ZHSA 1ZR4A 5EXTA 4ERXA 2GESA 1XNQH 3DTVB 3H2BA 5IXJA 3SYKA 3PFCA 2Q9BA 3EH2A 4DSOA 4QQNA 3F49S 4EG6A 2DQZA 3DAFA 3IMKA 4HEHA 1B0UA 1XZDA 4EJ0A 1VB3A 3DCIA 5JNUA 1K6XA 1ZL2A 4DN6A 3CISA 1NR7A 4QRHA 1LFAA 1G8PA 1QP8A 2OENG 4AW9A 5DHFA 4LMPA 4UCQA 1K66A 2QUKA 3S55A 5A1TA 1CUBA 2PQ2A 1SG0A 3I1YA 1U1DA 3OZAA 4IAOA 1JDNA 2OAGA 2QN8A 4N03A 2EERA 4YDSA 3VI3B 2EKPA 1P73A 3Q9NA 5AT1A 3SSAA 5HX7A 2EU8A 3QXGA 4OU5A 4TX1A 1MCZA 2I4RA 2CD9A 4JLMA 5EGNA 1PNRA 3SQNA 3VO9A 3KV1A 3PFFA 4UAUA 1NRWA 5DTJA 2YWHA 2ZSFA 3CRZA 3NHZA 3QVJA 3T5GA 3CWCA 4U5XA 1FYFA 1ZK2A 1JZTA 3DLBA 4CKBA 2WKWA 3MTGA 4C7MA 4CQNA 5AHXA 4YDQA 2FFRA 2SHKA 4WERA 2NVWA 3RRFA 1AT1A 5KAPA 1THMA 1HT2E 2IL1A 3M7IA 5BV0A 3J80A 3C1UA 1YA8A 5AKZA 2VXYA 2C9CA 2BJHA 2ERYA 2VJNA 3B2NA 1SUPA 2YTZA 3T5HA 3JW8A 3QIAA 4NMXB 4RFVA 4BUZA 4FGWA 1W93A 1JI0A 1NXSA 2J3LA 2CNDA 2OSVA 3JD3A 4HGPA 4RIIA 4NJEA 5BOVA 1E9VA 5IS2A 3IS3A 5BPFA 2EQAA 2JLCA 3DDWA 3UF0A 3GTKA 1N2CA 5JEDA 4JFRA 4OXYA 1BKYA 2JEIA 4N7JA 2W2NA 1SY7A 4F3KA 4UPEA 3QW4B 1CKNB 5DGIA 4II2A 3K53A 3UVEA 4ZHQA 4ZRNA 4JLKA 3REQA 4O3RA 2F4NA 1OTHA 4RANA 4JGGA 1PX0A 4KWHA 2PJZA 4AZ3B 5AW3A 2O5EA 4YX9A 3ZTWA 2OM6A 1JI3A 3RTDA 4AY3A 3DO8A 2A57A 3M1AA 4LHZA 1NOJA 2CCGA 4OY3A 4Z3OA 2P9FA 2X77A 3EIOA 2J32A 4TWZA 4YEDA 5B3KA 3KZXA 4EYIB 1Y5RA 3D8SA 3GMTA 1IXKA 4OXRA 4BNWA 2VQEH 2ZANA 4B7CA 1DINA 2REQB 2XOXA 4NYMR 3U4HA 1DAKA 4DUZB 2B5VA 4GR5A 4IHAA 4C06A 3BCSA 1O96A 1GYQA 3H7AA 3NGXA 1XK7A 1N48A 1PD1A 1SU4A 2BGUA 1Y82A 1N1MA 2X76A 1NVEA 1NR5A 4GP6A 5ALUA 1TZJA 3VH3A 5BRAA 1Q21A 4IICA 5LLSA 1CUCA 4GUAA 5IEJA 2EW1A 1Q83A 4DCUA 4HNTA 1PWHA 4M7RA 4CIXA 2VPWA 4EAQA 1C81A 3U0BA 3EVDA 2OVFA 3I5UA 3ICWA 3MRSA 4OUDB 4DKJA 2C29D 1GGEA 4RD3A 3WQBA 1SC3A 1X8JA 1XN1A 3LDAA 2IY7A 1XZAA 3IR7A 2P6UA 1I10A 5A6SB 2OV8A 2QVYX 1S8FA 3OPVA 1NT4A 2B4YA 2H8GA 3EX7C 1WKCA 3ZD9A 3WZ2A 4BMOB 1W4RA 3VKHA 4BRSA 3NDRA 4EHDA 3GLTA 4BB5A 5H7XA 2HA2A 2OKCA 1N6KA 4HNSA 3QTBA 4JKYA 5ERYA 4OB8A 4EFDA 2CLCX 1EVKA 2Q6IA 4KFSA 3DHEA 3ASUA 5KFIA 5SY6A 2GNAA 5JPDA 3ANLA 3NONA 5FR1A 3SOZA 3WADA 4LE0A 1E2UA 1WQ1R 1GSIA 1ZUD1 2CXPA 3PXEA 3TL2A 5FBQB 3I6YA 5IP5A 1PS0A 3JASA 2C9OA 2GHQA 1CLEA 5K03A 3KWJA 4B44A 3TL6A 4B82A 1Q3TA 1ZOIA 5PGMA 2Z2ZA 2X13A 4FDAA 1GZ6A 1XDNA 3G2IA 3HVHA 5EWMA 3SNHA 3W1EA 5L9AA 4CETA 2PANA 3H6HA 2W6OA 1LSSA 1NN3A 2QNRA 3GVIA 4LF4B 2IVZA 3A1VA 1NMYA 3VO8A 2AI2A 5FAXA 1JXQA 1FSSA 1G0OA 1D6JA 4FYWA 1M74A 5HMMA 4BQFA 3SXUB 3IL2A 2YJZA 3SJCA 3NGDA 1SBZA 5LQCA 4BNIA 2WB1E 1YMUA 1FTQA 1UJ6A 3Q7PA 1FW8A 1P45A 1QHGA 2Q5IA 1ISPA 2R65A 3OIYA 2P6NA 1NE2A 2ZS9A 4QEZA 4IR1A 1A69A 3EH1A 5DF1A 4KMOA 3F1KA 2ENWA 3SDZA 5KINB 4REQB 1IMOA 2X8BA 5DNEA 3LXUX 3N2GA 3TNFA 5ELXA 3OSZA 1W0KA 2VF2A 1UNNC 1IQ0A 4IDCA 3VYVA 1KFKB 2PGNA 4YWJA 4ER7A 2XKBA 3EMDA 2Y1WA 4TWRA 5LDHA 1ZI6A 1E5TA 2A4MA 5ENDA 3RG8A 1JFSA 1WR2A 4C14A 1RYNA 2JEFA 3UUWA 4WKBA 3E9ZA 2ZP1A 1FU8A 1FTYA 3BQNB 4CE6A 2Q4BA 1Z34A 3FPEA 3Q8SB 2O2YA 2OCBA 1P18A 1DAEA 3F5DA 4KXXA 3F2VA 3ZYZA 1KGDA 2VG8A 2OD2A 5EJEA 4NJOA 1SR8A 4O4HB 5K99A 3BAZA 3WWEA 3RFCA 2GPTA 5LBIA 5JPCA 3DR3A 3LPDA 1NQTA 3K9GA 3OOHA 3ACBA 4L73A 3DM5A 1CZKA 1IXSB 2EX0A 1J8QA 3DB2A 1M34B 3OJCA 4N5NA 5EP2A 1UKZA 1VBKA 2IYYA 3K1ZA 1NLUA 3C45A 3DSRA 3R2JA 4JBWA 2HBQA 1GNVA 3WHLA 4ARVA 4B1FA 3PE4A 5DXFA 1JSCA 3JYHA 4KMRA 1EHCA 3GU3A 1KI9A 3PE6A 4YH1A 4IIJB 4RPHA 1JR3D 3NMUF 5KTKA 3DW3X 1J24A 3ROMA 3W1VA 3QE3A 1YE3A 1RZRD 1KMCA 3QZ8A 2D0IA 1U9JA 1RWWA 3LPCA 5L7WA 1N3BA 1WSDA 2CNWD 4F3CA 3PEYA 4JQSA 3E22A 4HDSB 4JV1A 5CYGA 1QCZA 2V65A 2C07A 4QOHA 5KOJB 4L0CA 4B35A 1LUAA 1N1DA 2CEAA 1MOPA 1AIPA 4PIMA 4RY2A 1GIAA 1ZONA 4TYPA 4MOWA 2R7ZA 3WWJA 5EYPB 4A8PA 1R5BA 3EEFA 3HCNA 4K9LA 3EY9A 2EP5A 4JI5H 3WI7A 5C51B 1VI6A 121PA 1LBSA 3EVGA 2ZTSA 4C07A 4FOSA 2C3YA 4R2JA 3GIIA 4Q9JA 3I61A 4GMDA 3UG7A 1PBTA 2NZUG 4ENQA 4FXOA 4ISCA 1GARA 3AI1A 3QLVC 4KLNA 3AM5A 4O3PA 3IP8A 4QIHA 3X1YA 1F17A 4L72A 1QZ3A 1DUIA 3GLGE 2C2GA 5H4HA 2VNSA 1GPWB 3MVEA 1GPYA 3F5FA 4GKBA 5KVCA 2FNAA 4Q4JB 5C5IA 2EG5A 1K7YA 3OQHA 3ROXA 2QQ0A 4PR0A 3TX6A 9GPBA 2JFBA 2VPSA 2V6MA 1MO3A 1E7QA 1POWA 2WOJA 1UMCA 3HDVA 3C8DA 5JJ5A 2FA9A 1P6QA 1XL0A 3DNMA 4F5YA 5DHTA 1Z6TA 3I0ZA 4JIMA 2HSWA 4RESA 3N8HA 4EYSA 5A6VA 1KQPA 3OOWA 3I0NA 2QG9A 2YIDA 2P8SA 1T5DX 1W5AA 3H4VA 4GL2A 4RMNA 4TTPA 1SQ0A 3WV5A 2K2QB 4OQNA 1S0NA 2LR0A 4G5SA 4KJZA 2WSSD 3V6JA 4G8JA 4E4TA 1TRHA 3X2FA 3AEXA 4UAJA 2VSFA 4IDFA 2A0KA 2ZCUA 1TYDE 3E3OA 5GV8A 1S8NA 4WNYA 1M6EX 4LXHA 4IFTA 1U2RA 3DOEA 3TR5A 4ZIRB 3RIZA 4BVJA 3RIGA 4YGXB 3O7WA 4JV0A 4PG6A 4NBNA 4QE3A 4B3TB 4BEBA 3KE8A 4MVJP 2VYFA 1X0XA 1Z5ZA 2F8MA 2A1TR 3F7NA 3Q7RA 4P4SA 1IN7A 1QHYA 4U63A 1MAUA 3GRAA 5F12A 1H8EA 2IYZA 1J7JA 2CLFB 4MGHA 5GM1A 2GO1A 2P9GA 4PXYA 4C7OB 4JUZA 2QGNA 3IAM1 5EAIA 2ZCJA 2ABWA 3WYGA 3T52A 4HTFB 3T3IA 4E30A 3SDBA 2R8BA 4G41A 2X9VA 5E6UA 3JR7A 3NG1A 2IHKA 1TIBA 4UNNA 1W5FA 4ZAFA 5EJGA 6LDHA 9MHTA 1ZVMA 4LYGA 2BELA 3JCZA 3BFXA 2QU7A 3DHNA 5JJBA 2NACA 3D0OA 4CR7A 4GC7A 4A3IG 5CYPA 2XA9A 4YMVA 3A3NA 3QWBA 4QUDA 2JDIA 3G49A 3WWCA 2Q5OA 5JXIA 2D2IA 3WA7A 1FTNA 1BZYA 4LJ5A 3QPAA 1WHTA 4U2DA 2BH2A 3TJRA 1JQBA 4UTXA 3HUEA 3HQ4O 4A73A 3NEYA 1FTGA 2QQEA 3G79A 3JQDA 2ZU0C 3LP5A 3MJRA 3MXOA 4NV1A 1ORWA 4W99A 3S7ZA 1EUCB 3AFIA 4EHBA 2W58A 3V8MA 3SX4A 1V0JA 1RRMA 4TQAA 2Q8QA 1JHUA 4DQKA 2HF9A 3WB9A 4NXNB 3W2FA 2REXB 3LOPA 3NC4A 1U7DA 5I9LA 1J5EH 3KZ1E 3F8NA 1GGKA 4MUEA 1W0JA 1NBEA 3WGMA 5JCJD 4DDUA 2I80A 3MINB 4TMWA 3N8GA 4QT0A 3ON5A 3H1EA 1X7XA 2W8BB 5BMVF 1D9XA 2X2FA 1XEAA 2IZOA 4C6TA 3TXYA 3Q4GA 3ESBA 2XYHA 1CS0B 1TE2A 2OORC 3K0CC 4TQ9A 5LJLA 2Q3FA 2AOWA 3QE9Y 1SQ6A 4BE9A 1J0CA 2PAFA 4XOIA 3BMQB 5B53A 4CUJA 3WKAA 4BNGA 1V35A 2GPNA 4K40A 4H1WA 5B6JA 2JJQA 3SC2A 3USES 1DL5A 1AUXA 3V7UA 4IKOA 4L22A 4XUGB 1AS3A 2M9MA 3LW8A 4Y6GB 2QRGA 2G76A 3YASA 5I8WA 3UB2A 4IRCA 1Z2NX 1GUDA 2GM4A 1VSBA 2GBLA 3KSAC 1X7HA 3H4IA 1BCRB 4DWJA 3U26A 4BNDB 1I7NA 5GONF 3STVA 2C3PA 3TIGA 5C4IA 1ZN9A 4LC9A 1T35A 5IJWA 3C3MA 2Q4RA 1SPXA 3E4CA 2CJXA 2BGNA 2QR2A 4MB0A 3RJZA 4UVIA 2CXQA 3HJTA 3FETA 3HBMA 5I7SA 1R4MB 1L5WA 2VVTA 3B3AA 4OFZA 3K5IA 3IDSA 4BQOA 3FOFC 4NFLA 5A3SA 1EFTA 3HADA 3DZCA 4FLFA 3SYLA 1GNQA 5KSWB 4L4ZA 1MQSA 3AERB 2B94A 3L02A 3WBBA 3ZD7A 3DW1X 1X80A 3G7UA 5B1IA 3AYXB 4E32A 1QMGA 1A9XA 4E4YA 2IH4A 3NHLA 1R4NA 1XNHA 1G7RA 2OCIA 3HBLA 1Y8CA 1U7PA 2WFZA 2ASJA 2PQMA 1DBQA 1KJWA 2GPYA 4GLOA 3TOSA 5CFNA 3CVOA 3T5TA 1DCMA 1YVRA 1M5TA 4KYVA 1AQYA 1L5YA 5LOVF 1I9CA 3KT8A 3NR2A 1JHOA 1TA0A 3R3HA 2PUAA 3G0HA 3PF9A 4HAZA 2HIXA 1GPKA 1X86B 2IYVA 3ET5A 2A94A 4PFQA 3VZDA 3PDWA 2R4QA 1M2NA 3DNFA 1WU8A 1V16A 4MK4A 4P3OA 3AWDA 1E3LA 3H86A 4PAOA 5DGXA 3IODA 3IBCA 3IOEA 1MKYA 4DUZH 2E89A 2QN2A 3IV6A 4JOCA 5CEFA 5KHOC 1G59A 3OEED 1T36A 3PFWO 4A10A 4Q4DA 4E07A 1L3IA 3IP3A 4HAUA 3H0GG 2Z5FA 4WNAA 1FSZA 4XM1A 1VXRA 2I3DA 2JFHA 1TT5B 4EYHB 2NUBA 3AJAA 3OZWA 1L0BA 4Q34A 4P5PA 4R9SA 2ISQA 3B52X 4INJA 3T1QA 4ZI7B 4HDRA 5I7AA 2IYEA 4O4LA 1Q12A 4AJKA 3FKQA 5IT5A 5KOHB 4JI1H 1CD5A 4FOTA 4I5DA 1P5FA 4G0ZA 1JXMA 2X1LA 1IRXA 2FRDC 3W34A 3U19A 3DWIA 2BBSA 1ACMA 4XB6B 3VBEA 3U55A 4CI0B 3TIXB 3DDZX 3UWMA 1WULS 3GRUA 1JN0A 1SM4A 1XV5A 1OH7A 3N42B 1VRVA 5EKDA 4EYEA 5J58A 2JLQA 2AJTA 4MLCA 3NM4A 3PO2G 3WG9A 1W4LA 1T2EA 3JD4A 2ZRHA 3QVGA 1XP5A 4GPBA 4WKNA 1G8JA 1RABA 2YQZA 4G1VA 3C5WP 1B15A 5TMDA 4GWLA 4BLWA 3BXHA 4Y6RA 2NO7A 2JRCA 3UMBA 4JOBA 1F2DA 3B9QA 4W82A 3TSOA 3T54A 1Q0QA 2BT4A 5EVCA 4ZDJA 5AVTA 1KZ9A 5G0VA 4Q82A 1P72A 1XCGB 3H9QA 1BOFA 4J0JA 3O4IA 3U9SA 3VZBA 1ECLA 2ZB2A 4HYYA 1X1CA 5EIHA 3WLPA 4DKXA 4N41A 4F3YA 4K5QA 1GAWA 5EHGA 1Q17A 2HOQA 3WK6A 1Z4MA 1B3BA 4CEHA 1E6UA 4N40A 3WZLA 1P7YA 3HDHA 3UFXA 3BXPA 3W2TA 2JJ2D 4G89A 2NXJA 4QU8A 5EUMA 1C50A 4JXZA 2XHEA 3T1YB 1LK7A 4LA4A 3C74A 2HYDA 2GHIA 4WNIA 4QWBA 1PJBA 4YALA 4LE2A 5LMUB 3TYXA 1EVLA 1O9HA 1JFRA 1UXHA 3CT6A 1KL7A 3QF7A 5CT6A 5EKXA 3UZUA 2QMHA 4YJ2A 1I4WA 4P7FA 3SX2A 1YQEA 5AUOB 3CIFA 1EVIA 2HQRA 2KMLA 3KPJA 1G21B 3SZRA 3RRZA 4E6EA 2AC2A 1Q6ZA 3OAAD 5JSFA 3G2KA 1HDCA 3HYTA 4YMIA 3F0TA 1JDPA 2BKXA 4XSHA 3LYLA 5FBHA 1RQ2A 4GZ5A 4J1NA 1IZ8A 1Q2UA 2OCGA 4NYMQ 4UUAA 1XEWY 2B2CA 3D6FA 1M8JA 2C77A 3P2KA 1UBUS 4MXDA 3JTMA 1UBNA 1EUYA 4MYDA 5BMVB 3A32A 2AGQA 3GK3A 3FWYA 3H5NA 3HO6A 3L0PA 4LJ8A 2P3OA 1CF2O 1NU8A 1WLSA 2KHZA 2RIRA 3CZPA 3KUXA 4UJ5A 1PZEA 3FMFA 3KO8A 4G85A 1NXQA 5BSHA 1Y8RB 5CFLA 4FMCF 4TOIA 3SSNA 5DNYB 1HDIA 4KQMA 4RWZA 2ETXA 3TR6A 3BL5A 1B42A 4GOJA 1A9TA 3TMYA 3K70D 4DR3B 4PNZA 1P7VA 1GKUB 4RHUA 2K5UA 2O7QA 4JELA 1UKAA 4KO1S 4Y6QA 5GGYA 2XUGA 3FYUB 4RFSA 4F06A 5B1YA 2YVKA 1DNPA 3LDUA 5I9TA 4GDFA 1WSBA 1JR3A 4G81A 4L2IA 3BG5A 4LHXA 3V2UA 3WGZA 5JI3E 1W59A 4U9HS 4AZ3A 2Y1DA 3EEBA 4QIWA 4G6ZA 3OT1B 2PV0A 3ZWXA 2B4KA 1MVLA 2N46A 5DB4A 4CG0A 2O1EA 4RMHA 1VE6A 4HAIA 4GOOD 2X2PA 2JVIA 1NVMB 2DXIA 2L42A 1F8GA 5CNMA 3RC3A 1YFKA 1QGOA 2BEUB 4RABA 3RF2A 1EFRD 1XQWA 2V6FA 3UT5B 1YQUA 2JZNA 2LBPA 3I6BA 4XARA 3ZGNA 1ORIA 2WA1A 2JIBA 4PAQA 5HZHA 5ITZA 2R25B 5YASA 5SYNA 1X13A 3GIKA 3R5XA 1C9DB 1CVIA 1ES9A 1ZOSA 2I67A 4GR9A 2DGDA 4ZEOA 5KVVA 3RB3A 1K83A 5KG5A 3KVRA 4YAIA 4JBLA 1A95A 1DC3A 2BV3A 3DD1A 5BORA 3CUWA 1O6BA 3B6EA 4XQGA 1RQ7A 1Z0SA 2E6UX 4HTAA 5EE5B 3SYMA 5T4BA 4DQDA 5DYIA 1E5LA 2P41A 1WDTA 4HNAA 1NPDA 2FSHA 1ZMRA 3N1UA 4E88A 2RE8A 1JQDA 1LJLA 5AFSA 3UKJA 1PNOA 1YASA 5JI2E 4LVUA 1M6HA 1XXHA 4PO9A 3RSCA 1X7ZB 3LUJA 1SNYA 2C28A 3M1IA 4MWEA 5LYJF 3RRYA 4WVLA 5JJIA 1LQTA 2HK6A 2WIGA 3N7UA 2ZB7A 4WBSA 1AKTA 3UK1A 2NO0A 3GJSA 3H20A 5A4IS 1QLWA 3NASA 3K1TA 1XZEA 3QU9A 4AYBA 1MIOA 4FBGA 3ICEA 2VJLA 5KFFA 2BFEA 4NG5A 4CT0A 3HB5X 4PPYA 1H1LB 1VBGA 1BXZA 3IUYA 3QLJA 4R9UC 3TS1A 1ZPDA 4B2IA 1N4AA 3EGWA 1QCDA 1KAGA 4J91A 3BL6A 1E2BA 3HZRA 4EEYA 4IIDA 1UADA 3CB2A 5G4KA 3V7YA 3ZQKA 3DBHB 3OLXA 2OPBA 5JVDB 3U3MA 4COOA 4MEAA 3CJQA 3RU9A 2VCYA 1P8JA 1A9QA 2X5JO 4L57A 1X38A 3CLSD 4NY1A 1KDYA 2RG7A 3BTVA 1NVAA 4GZMA 4D4KA 4ND6A 1PE0A 3RREA 4UM9B 3M6FA 2YWDA 4MLDA 2VJKA 5EIEA 1TB4A 3BD7A 2Q4TA 2QY9A 3PC3A 2AR9A 4CZ2A 2PS3A 5THKA 1OFVA 1MOZA 4DV0H 4L4UA 4U2KA 5CCEA 2W7OA 1U1FA 4Z7JA 3AJDA 2DCMA 2WJWA 1FNCA 2BH9A 2YX1A 3MB8A 5CH5A 5BN5B 3WY9A 3BGSA 4Z86A 5MN4A 1Q0HA 3KT3A 1TQ4A 3FM9A 4LCEA 4KNWA 3AF5A 4KHPB 1XNQB 3WQHA 3IVCA 2ZPUA 1X7YB 1VG9B 2QIPA 4TLBA 3TPZA 3PHGA 2XYVA 2H9AA 3RT9A 2CV0A 3GLUA 2AEEA 3CUUA 1K1QA 2Z58A 3HVIA 4ZU6X 3ZX4A 5BT8A 2QAGC 2ZJ3A 4JR2A 5A5FA 3WAGA 1OD6A 4O82A 4OYHA 5FTMA 3ZH2A 3VR5A 4AP5A 2CMGA 4MO9A 4DCMA 1E69A 2DR0A 2ZTHA 2WAYA 2GN9A 3BSSA 3PGLA 1FJ2A 4D9HA 5BSVA 2VDQB 2Z4TA 1TCCA 3E35A 3T3EA 4OJKA 4PX5A 4W1RA 5HFAA 2HHFA 2G9NA 4F71A 3ZVMA 4ZV9A 3DAYA 2ZJ5A 3P97A 4L5AA 4ZOCA 2GYYA 2X58A 3DTVA 4UFPA 2XXBA 3KB8A 3JSNA 1XNRB 1AKYA 1G63A 3IA2A 3RUPA 4EYKA 3PN1A 3ZJYA 2OGUA 2WJHA 4JP3A 4ZDKA 4KVAA 2C2HA 2V0CA 2EDCA 2ZE6A 4EB8A 4F4UA 2VJMA 4M98A 2PY6A 2XDQB 4WLVA 2XB4A 3B5JA 2AR0A 5CFPA 2CN1A 3HMKA 3JATB 5P8WA 4YRRA 1C9YA 2FPIA 4OFWA 3UAYA 3GEMA 3ZCRA 1QHFA 2A88A 4IJUA 2WU3A 4IIYA 2W00A 2I4LA 3ESCA 4Y1FA 1IHDA 4BX9A 4EARA 4MR9B 2H07A 1UOPA 2MCFA 1F2TA 3DDCA 4REMA 4N3BA 3ST7A 1ISSA 1QVAA 4I55F 2BFFB 2JI9A 4JLSA 1TF7A 3I9V6 3L7AA 4CM9A 5AJTA 4DV2H 2VHXA 4QW8A 3GLFB 3E05A 2XNDD 1U0RA 5M04A 3MJSA 3RABA 1X8LA 3FVRA 3KM0A 2LPMA 3HOUG 1WCWA 1U2SA 2CFIA 2JEGA 4B4VA 5MGBA 1VIMA 1ATIA 1R0YA 4M54A 3WJ1A 1LNQA 1VDMA 2Q6VA 3GGPA 1AS2A 3IJRA 5IUNC 1IWPB 3HP7A 2YCBA 2DWCA 4FMDB 3S1LA 3ILVA 4HDMA 3R6LA 5KREA 3NIDB 4YLEA 1PRYA 4LXIA 3IMCA 2O1WA 5F4BA 4P84A 4NI5A 3TAHA 2UUAH 3E7FA 1RW4A 4XYGA 1AJEA 5CNIA 1O94A 1OBGA 1JFFB 4O2AB 5IW8A 1IHYA 2X8AA 3FOBA 1KIMA 3A1SA 3H1FA 4OGKA 1EKFA 1KMHB 2JIRA 2NXWA 3U3XA 5FWXB 3U60B 3EIXA 3FCSB 2ZE5A 4E5UA 3CH7A 1CJUC 1ND6A 1ML4A 1OXSC 3TM5A 1GQYA 2I4MA 4NR0A 1IH8A 4RZIA 5E7JA 2BZGA 5HKLA 3FHJA 4RTOA 4F4HA 1U9CA 3R4CA 2ZVJA 1KGSA 4CLOB 3D8UA 1U3UA 1NMZA 3QSGA 3LQ1A 5KHLB 4D0LB 3AR6A 2COGA 5C7YA 5AKEA 2FLVA 2H9YA 4X61A 2OFFA 1LBQA 3SCZA 4IFEA 2H65A 2PYZA 4UD2A 4BKPA 1E99A 2GN4A 5GIPE 2B2XA 3P4XA 4J3FA 5KNBH 1FIUA 4BXOB 1TKRA 2C1XA 4B6RA 4ENTA 2UUCB 1IPFA 4QASA 4M8IA 2LKDA 4LFCB 4W8GA 4A8JB 4DA4A 3LQSA 3CLUD 3D4LA 1TX4B 3O8OA 3LLVA 3SVZA 4ED0A 3GT3A 4N9WA 4EITA 2NV2B 5F5NA 3NV7A 2UVUA 3BC1A 3CR3C 1QYIA 4WN9A 3TNJA 1HKHA 1QFXA 1WUHS 4BY7G 2C2KA 4C88A 2VH5R 2PUJA 4WZZA 1SXJE 1P6UA 2AZ4A 1RYZA 2QLMA 3B6MA 4FOLA 1C4XA 4KNVA 5E9WA 4AICA 4WZBA 5JD5A 4GNRA 1XPOA 1WXFA 4JBHA 3UJNA 3CEJA 3KQQA 1SCAA 2HTFA 2RGVA 3DL4A 2HIMA 5GY7A 2BR0A 3ITNA 4KR7A 2IEBA 2UXCH 1NI3A 2QVCA 3ZNPA 1BMFD 2IYLD 5G3YA 1G8YA 1CY4A 3C6BA 4F3RA 2X14A 3QBDA 4B45A 3A7DA 3BXGA 1OXKB 2JJMA 1D7AA 1L4KA 4U3JA 1Z62A 5F76A 5C8ZA 2GS9A 1PGPA 1TZCA 1YH3A 2QJRA 1B0ZA 1R6AA 4Q18A 4G2NA 1RRGA 2RCNA 1WW2A 1QK5A 3EUEA 3GZNB 4XJSA 2FG7C 2SICE 2ZVQX 3S3TA 3SR0A 3K32A 5DYWA 2X0FA 4B8YA 2OHIA 4INOA 2DPGA 2YW9A 1FYWA 4Y0AA 4Y9RA 2YRFA 4IX1A 3RB4A 3PKJA 3ZVKA 1M3SA 3L5OA 3H42B 4A0RA 2XB2A 1TRKA 3H99A 1E2PA 3ETCA 4DL3A 2COUA 5COAA 2WPDA 2IZ0A 4UDXX 4MKRA 4M49A 3FW1A 2HT1A 3VV3A 4Q9NA 5GJVC 1KYXA 1WB5A 3GT7A 1HRDA 2QE7A 3I2IA 3EK2A 3KC2A 2QROA 3TB4A 4OB6A 1ISIA 1IHOA 5KKCA 1VE5A 2PBRA 4JGBA 4KN5A 1YF3A 3PD1A 4GMGA 1VMKA 1Z4JA 3RBEA 2A2ZA 4Q02A 3W5UA 4U2BA 4BQIA 3WP0A 5CB6A 3HWRA 1AZTA 1ENOA 2VNKA 3C14C 2K7FA 5D5PA 3AESA 3A9CA 1B04A 1AKNA 4K9SA 3OEHA 4X60A 4YCAA 5BURA 4HGQA 3NM6B 3QELA 1USVA 3W1GA 4M22A 4OLHA 4B6PA 2WWGA 4XFJA 2PBZA 4YRNA 2BGTA 3GLIB 1KZ7B 3THRA 1UM8A 3BK7A 4KIGA 1XTUA 2IYQA 1CZLA 2FVXA 2F3QA 4FHEA 4WXYB 5KWEA 1CKOA 4UHCA 3Q9SA 1OB2A 1KIFA 2CHEA 1IM8A 1UUFA 4M89A 4AY4A 4F4CA 3B9PA 3O3CA 5BWXA 1ZW1A 2XYGA 1H4QA 3R6GA 4UBKA 1BCSA 1J0XO 4TQUS 3FDXA 3ZU3A 1MX3A 3BGOS 2J41A 2QTCA 2W4QA 1FRZA 2JC3A 4IMIB 4P7KA 4X41A 3R8CA 1I3OA 1DFGA 2I65A 3TLMA 4FDMA 1C7QA 1GR0A 4QUGA 2GK4A 1T4CA 4KVZA 1R0WA 3A0RB 4DV5B 3L0OA 5D84A 2OD9A 3RVBA 4CTJA