2R85A

Crystal structure of purp from pyrococcus furiosus complexed with amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
334
structure length
330
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 108
structure length 330
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r85A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r85A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r85A01
2VQDA 2YL2A 2R7LA 1GSHA 5GONF 4C5AA 2NU7B 4ZHQF 4MV1A 4YAJB 3BSSA 3Q2OA 1GGOA 2NUAB 4O81A 2DWCA 4Y8VB 2R7MA 4EA8A 3KALA 2W70A 4MA0A 2R87A 2W6OA 4ZQIA 2R82A 3G8CA 3SE7A 4HNUA 4MA5A 1DV2A 3ETHA 3DF7A 2R86A 5HBRB 3V4ZA 1DIKA 4O4LF 3U9TA 2Z04A 2YZMA 2NU9B 2R7KA 5C8YF 2I80A 4O4JF 4NYEA 5D8DA 3R5XA 1VBGA 2R7NA 3QFFA 1SCUB 5LYJF 2VHEA 1OBGA 2X0SA 3LWBA 2R6FA 3JRWA 3TW6A 4IHJF 3VMMA 3BFPA 3AW8A 1IOVA 5LP6F 2W6NA 4FFLA 2YZNA 4WD3A 5KX5F 1OBDA 3TIIA 1Z2OX 4YAKB 2GPSA 2CNUA 4EG0A 1GLVA 1KEEA 4O82A 3N6RA 4I4TF 2YRXA 3U54A 5KKNB 2FP4B 4O7SA 2PVPA 3VOTA 5BPHA 3TINA 4HNVA 4HNTA 5JQWA 2C00A 4EA7A 2YW2A 4YJ2F 2DLNA 3HB9A 2YS7A 3JRXA 4MV3A 4XZ3B 3GIDA 4I55F 4EGQA 2ZDGA 4O7RA 2FPPB 5JVDF 3R23A 1EUDB 3BSYA 1KJ8A 1KC7A 2YRWA 4O4IF 1DV1A 4O83A 1VKZA 4GGMX 4J6EA 1C3OA 5CAEB 3BSWA 2OLSA 4FGRA 2FB9A 1C30A 2QF7A 4IZOA 3AX6A 4EA9A 2CZGA 2GPWA 4TV8F 4YJ3F 3RV4A 3VPBA 3OUZA 4FFRA 4YB8B 4EABA 1B6SA 4MV6A 3VA7A 5C1PA 4HR7A 4IWYA 1KJIA 1KJ9A 2DZDA 4FFMA 1B6RA 4M9CA 4M9UA 1CQJB 3Q1KA 4L1KA 2PN1A 1CE8A 2Z02A 3ORQA 1W96A 4XYLB 3VPDA 4IWXA 3MWDA 5IYZF 1E4EA 5DMXA 2CNVA 3JZFA 4O2BF 4O2AF 4O7YA 2WYOA 5H80A 1M0WA 5JVLA 1EZ1A 1VBHA 3MJFA 5CA1F 4O86A 3U55A 2I8CA 1E4EB 1EHIA 1ULZA 2GQSA 3NUAA 4MV8A 1UC8A 2V59A 3LP8A 5JQGF 4WBNF 2XCLA 5JH7F 4M99A 2R84A 4O7ZA 2W6ZA 2W6PA 1KJQA 4FFOA 4YBZB 3RFCA 2XD4A 3GLKA 3BG5A 1I7LA 3VPCA 2SCUB 2PBZA 3ORRA 3R5HA 2CNQA 3TQTA 1PK8A 1WR2A 3RV3A 5K2MA 2NU6B 5EZYF 1M0TA 2V5AA 3WO0A 3WNZA 1KJJA 5LOVF 1A48A 1JKJB 4MV4A 3KREA 3OUUA 1M6VA 4O4HF 4O7WA 1JDBB 1AUXA 1Z2NX 3E5NA 2FPGB 5HV6A 3K5IA 4O7TA 2VR1A 2HJWA 1EYZA 2DIKA 4FFNA 4M98A 1JLLB 4O7NA 1CS0A 2I87A 4DIMA 2YS6A 3N8DA 2YZLA 3KAJA 5J2TF 4EGJA 5BMVF 1A9XA 2VPQA 4ZI7F 2W6MA 4FFPA 1T36A 3K3PA 2CQYA 2W6QA 5BPFA 3V4SA 4C5CA 3JZIA 1I7NA 5FNVF 3KAKA 2GQRA 1IOWA 5CB4F 5CA0F 2YWVA 1PX2A 2W71A 3K5HA 4ZOLF 1Z2PX 4TUYF 3HO8A 3ETJA 3R5FA 1BXRA 4HQ6A 1GSOA 4MV9A 4QSHA 2ZDQA 4I50F 2NPOA 4IIJF 3HBLA 2R85A 2HGSA 3MWEA 4O7VA 3TIGA 2ZDHA 4FE2A 2NU8B 2FPIB 5LXTF 5C1OA 3UFXB 4RZQA 4MV7A 5LA6F 4XX0B 2P0AA 1AUVA 2GLTA 4EAAA 1W93A 5J2UF 2YYAA 4O84A 3R9RA 1JDEA 2V58A 1EUCB 4E4TA 2YZGA 3U9SA 4DLKA 4O7LA 1UC9A 1GSAA 4XYMB 2IP4A 1CQIB 1KUTA 1BNCA 4FU0A 3RUPA 4TV9F 4C5BA 1KBLA 2J9GA 3G8DA 3WO1A 3I12A 4MAMA 5I47A 2QK4A 4ME6A
chains in the Genus database with same CATH superfamily
4CV3A 1J09A 5KNCD 1JKMA 3K2EA 4PV7A 4N01A 4YAUA 3B1KA 3W8NA 3EEOA 2G9VA 2Z2KA 4H9GA 3FLEA 2NV0A 4P4GA 1NYLA 2ZRKA 4POOA 3I9LA 5ITZB 4AN4A 1FMCA 4NS4A 3DDNA 5F23A 3SE7A 3DYBA 3JWPA 3HMQA 2GLUA 2O3TA 3R7SA 2P6OA 1JR3E 4O4LF 1E2QA 2IXTA 3CSDA 5A5GA 2ZRDA 4LMPA 3FUWA 4BV8A 5EHGA 5F3DA 3GD7A 1XCJA 5ECWA 3RIYA 3OOWA 2HU5A 3FN4A 3KEFA 1L4BA 1LSUA 4R8UB 2IUEA 4MVJM 4KYUA 3RJZA 1B4DA 4OSOA 4W5OA 1XMJA 4QOGA 4E1VA 3D7KA 3C3WA 1QQAA 4O1MA 1X92A 1W35A 1ZC3A 1QHYA 1R6UA 4CM4A 4YR9A 2DERA 3PJEA 5EHXA 3RUFA 4QAQA 1Z63A 4RPLA 5BNFA 5TDHA 5G40A 4DIDA 2WB1A 5K03A 3WWCA 1E69A 3O3MB 4YWJA 2PWBA 1D2AA 1IWPB 3E4DA 5C34B 4CFSA 2NIPA 1JLHA 3C3EA 3U81A 1PDOA 4K9NA 1UEIA 4CM9A 2CNLA 1VP9A 3KXYT 2FMHA 1I1QB 4EPRA 4F9FA 3O31A 4ENRA 1BRTA 2X42A 4QQNA 3JQBC 4DJAA 3RV4A 4PR0A 4AM8A 3EIEA 2GF0A 3DM9B 1NIPA 1QJ4A 1Y9AA 3M33A 2XRZA 3CR7A 5FAKA 3EB9A 1TRHA 2EGUA 3W1GA 1XA0A 1X38A 1UOEA 5PNTA 3KSAC 3PO3G 1OAOC 5DNWA 5HE8A 1H94A 3M5PA 5HF6A 3H2BA 4CEHB 3IMFA 3OEYA 1CRZA 3P0RA 4G56A 3Q3EA 3KQLA 3RARA 5DP1A 1EDOA 3GCWA 2VTKA 4L4RA 3QWUA 2HG8A 4MOWA 5SV2A 4GR4A 1FLVA 2BKVA 3KQHA 2FQ1A 1I6MA 2ANCA 1D4OA 1UP6A 1Q7GA 1HPLA 1KJQA 2J6UA 1N75A 3VTFA 1I7LA 2O8EA 4KVZA 4TMFA 1M10A 3ZH2A 3I01A 4P3KA 4UOQA 2A3RA 4YAOA 1QK5A 3NTRA 4M0UA 1JKJB 5IM5A 1DC7A 4EGSA 3VR6H 4WEQA 4HPWA 2A0YA 4MPRA 4NHEA 2H11A 2GD1O 3PL5A 1TIBA 2ECFA 2Y67A 4D0RA 2QRUA 1U99A 1OZ0A 3EVGA 1H9AA 2QD5A 3PD7A 2ZSUA 4ZYTA 2GCNA 2YS6A 4GICA 5K3OA 1DTWB 3EXAA 1Q95A 4GS5A 3AR3A 4MKHA 2X86A 4N0PA 2H1SA 1DBIA 2P1ZA 1NVGA 3KOXA 2E5LB 1E18A 2B4QA 3UVEA 1U8XX 2DQZA 1QWSA 2GJSA 4LGCA 1ZOOA 4GLOA 5AVOA 3FR7A 2BI4A 4E5YA 4KR2A 4UEJA 1EFLA 2ZBVA 2BFEB 3BDVA 1UZAA 4L5BA 3V4LA 5JAPA 2I34A 1L9KA 3FUXA 5G0SA 2DP4E 1FFHA 3OP4A 3IV6A 3JWJA 4YHBA 3BEDA 4G5SA 1JKFA 2JI4A 4E1AA 3OPXA 4DV6H 2V9WA 2RF4A 4KUHA 3A04A 3PUKA 3LXMA 1ULTA 2ZGVA 1YQ9A 3N39C 4XVRA 2BCGY 2AFRA 3M1YA 3R1IA 2ASEA 4FFSA 1VBKA 3H2HA 1UM9A 2EDCA 4BJ1A 1RM3A 2Q2VA 3QITA 3E18A 1OVMA 5JBQA 1LF5A 2BQ3A 3OQMA 1F9AA 3I4MG 5JY1A 2XMCA 4DAOA 1PG2A 2AR7A 3VZQA 4YLEA 2BGLA 3E6AA 1M66A 2MTBA 2DFVA 1AD2A 1QP4A 1CUEA 3HRHA 3GHHA 4G9BA 4LYHA 3FTEA 1RFLA 5G1PA 2GF2A 2YVKA 1SK9A 3VPAA 4MW9A 4JBLA 3RRBA 1O08A 1WY7A 1IWOA 3KYCB 2L0XA 2BH2A 3PEEA 4BLQA 3BJMA 2W4QA 2M6KA 1TZCA 4FGSA 3CU5A 4F4FA 3S28A 2IHYA 4ZDKA 5DG8A 2ZE5A 1H1LB 5CLQA 4QDUA 1KDPA 2GBLA 3OY7A 3AR4A 3EXHA 2BGWA 4S0XA 4U00A 3EA5A 4N0DA 2CLKB 3KOZA 1KMIY 4JJFA 1PR0A 4O2AB 1PV1A 1HSZA 3IBSA 4OCZA 4GECA 3GEPA 3NHJA 3N6RA 2AG6A 1G3RA 1R74A 2JRLA 1M74A 2MSCB 2FQYA 4FEGA 3RC7A 5EYPB 3K1AB 3WSVA 4O1HA 3V6JA 2R4QA 3AHJA 1Q14A 1VIYA 1F0YA 1BWRA 4Q47A 2FPUA 2WYIA 4Q3OA 1Y1SA 3KKQA 5BQXA 3LPCA 2PE5A 1M34B 2HVRA 3RGZA 1UZLA 1FTSA 2XAUA 4E7OA 5IN4A 5F7OA 1E5DA 5DX0A 1G38A 1YCGA 3ZE1B 4TL9A 4DBLC 2AOUB 4BKOA 2BDEA 3H9BA 4TYPA 3U4DA 3CHYA 5KAPA 4GKVA 1R9GA 2VJOA 5DQGA 3GRKA 4KPGA 5K8LA 2D1SA 2BF7A 1XAGA 2AN9A 1DRVA 5DMHA 1NI4A 1FFAA 2W7TA 3N3AC 2P27A 3L7JA 1E3WB 5L8VA 3M6IA 4UAUA 4BNYA 4U4AA 5AJWA 3W90A 1FVFA 2BW0A 2R6GA 3FMVA 5F33A 4JZYA 5T3UA 3WMEA 1PT8A 2SKCA 2IPOA 3IHLA 2COKA 5BN4A 1OXKB 3WLPA 1QZZA 2GEBA 2RGNC 3EY9A 4CKWB 1UC8A 4X6LA 4L8FA 1XJWA 2C57A 3D9QX 1XXLA 4UNNA 3ROPA 1KYXA 1EFPB 3EG9B 3PJRA 4APMA 3DUFA 2XAAA 1FKAH 3LLVA 4DLXA 1N36B 4HRAA 4MGIR 5KTPA 4Z2YA 1WR2A 3NZEA 4FJ1A 4QUAA 2JGDB 4A3IG 2WWHA 2IYTA 1Z12A 1HETA 3AL2A 5JCJD 3M6AA 3DBOB 3BRSA 3OOYA 2ZM6B 1E9RA 3TJRA 1FB5A 2PUTA 3K5IA 2ZSDA 5ECYA 3HSKA 4H7IA 3R3YA 3T9AA 1OIWA 4TV8A 4PYOA 1CJKC 5H0IA 1MGOA 3TVDA 1NNUA 3ADDA 4AWXA 4XASA 3IDFA 2HQ1A 2C4WA 4D3XA 2V5VA 4BIIA 2L17A 3W5SA 2YN2A 2ANBA 3GJ0A 1O0BA 3MGAA 4LV6A 4UZSA 1X9GA 3OIVA 4R54A 1AO3A 4R81A 3ZHYA 4YGXB 3Q1LA 5DXFA 2WFAA 1GQYA 4FGJA 4YPVA 5DKFA 4N5MA 2IZOA 2OLEA 8LDHA 5IK2A 3N59A 4MSUA 3ZU4A 1H66A 5BSRA 1C1DA 4FXOA 1D2EA 1GGFA 1W1UA 3EPJA 4DFDA 2CV2A 2EJ0A 1LEHA 1PWYE 4EK9A 4FI3F 4URVR 1U65A 5J4VA 1T5DX 4JV2A 5JOQA 1ZH2A 4PO8A 5G02A 1HLDA 5LLSA 1Y1TA 2RHGB 1HZZC 5A4FS 1WIWA 1SVUA 1GNQA 3G79A 1QC5A 4DLKA 2QMHA 1N2IA 3WYEA 4YP9A 1K1SA 2PZBA 4ECYA 3RROA 3ZCXA 1B3RA 4WPGA 3OJLA 1L5WA 2AE1A 4XSGA 4XYBA 4DUYH 3S68A 2PNJA 4B4KA 2P2SA 1ZUIA 4GW3A 1E8DA 2AG8A 2Q2QA 3SQXA 1AY0A 1NJ2A 3AR9A 3GJXB 4RFSB 3PYXA 3BEOA 1Y5LA 4V0NA 3ZJ5A 3W6PA 2ZIFA 1ZBDA 2ZPAA 4M1ZA 1EX7A 1K5HA 1RAHA 1N6IA 3SBOA 4QGSA 2PL1A 4KN6A 1EJ6A 4OOFA 4Q16A 3UJ9A 3L41A 3AW8A 1T24A 4L6IA 4Q4LA 5LXTA 2FK3A 5CH5A 2X8LA 1VSVA 3CUUA 2XMQA 4P5PA 1EXVA 5E6UB 1KEEA 3MCZA 5F3WB 4HZUA 1NN0A 2XT6A 1JAZA 3TQFA 3EDMA 1Z47A 1MTOA 2B0CA 2NU6A 3UA4A 1PGPA 3RADC 3W1EA 5K01A 2Y1LA 4ARCA 6CHYA 2HDKA 3GV5B 3RRJA 3RAPR 5H83A 4HH0A 1KK2A 3TLZA 1VKZA 5FHRA 4KO3S 1P9OA 2P11A 2X6QA 1C30A 4TZ0A 1EDBA 5AOAA 1NZFA 1F1JA 2GPWA 5TY0A 3W8RA 1VMDA 1WB5A 1Y7IA 4YTEA 2JDID 2FLKA 1IG0A 1GXSA 2O19A 2Z1NA 2IA6A 4BV3A 1X13A 2B30A 3KQSA 1UK7A 1TYZA 2H4XA 1EJ0A 2Z8ZA 1COWA 3IEXA 3AFMA 5LUBA 1IZ9A 3QE3A 1FTGA 4TVIA 4MVYA 3KHSA 5FPTA 1MFPA 4G0XA 2KJQA 2GOYA 3MWKA 1GWNA 2CLLB 2ZS7A 5G0VA 3DTVB 4P93A 2E0IA 3CUSA 2WAYA 5JZVA 3ZGYA 2R3SA 3ESAA 3DP9A 4P7BA 5ALMA 5F7ZA 1XZCA 2VYCA 2VH2A 2C58A 3HDQA 2AEFA 2A59A 2J07A 4EQ5A 5J2UB 4ZZ2A 1XT6A 1YOVB 2HRQA 2PBZA 1YQXA 1W1IA 3OX1A 4YO7A 3K9CA 4TQRA 4XFDA 3VR6D 1VA4A 3Q6NA 1V8DA 3RU3A 2AJCA 4ESEA 1YRWA 4CE5A 2QMYA 3GVIA 1QF7A 2P2CA 3N05A 2IV3A 2OGTA 4P3NA 1W0KD 3N8DA 5LC1A 3AVQA 3DFZA 3G2PA 2H54A 4PCLA 2RFLA 3OG9A 3AF3A 2GYWA 5BMVF 3W5VA 2HI0A 2QN6A 5CJJA 5LP1A 1R6TA 1PUXA 4FWTA 1I94B 2ZFUA 3HLTA 4MJLA 3GUHA 1W0JD 1NDHA 3UGTA 1AKMA 2HHCA 4L8VA 1M75A 4J0GA 4DRZA 5ICCA 2Q62A 4U39A 1YZ3A 4JBGA 1MQ9A 4WZAA 1Z0ZA 3HR4A 3TZLA 4K2AA 3VR3D 3OPYA 1Y9EA 3ZHTA 3MPUA 2XRYA 3OLYA 1E4FT 2NUTA 4IGFA 3CC8A 1NNEA 3R5SA 1NVWQ 3IA7A 1QYCA 4R3NA 4BO2A 4Y6GB 4J7AA 2KM1A 3ESDA 5BQPA 3G9TA 5IT5A 1Y8ZA 1YXMA 1Y4UA 3U4QA 1NUSA 3W3AA 4O4HA 1IIBA 2R1VB 2B98A 2OLJA 1KJWA 4YMUA 1I1HA 1XVTA 4YAJB 1NJFA 3GG2A 1UAGA 2FEAA 2O2JA 5M3BA 5JBNA 3K0FA 1JKIA 1U90A 3AP1A 1D6MA 3O6VA 5L4LA 1YASA 3F6PA 5C18A 2QZSA 3N8HA 5JS2A 3NDPA 1L5LA 1U8ZA 1NBWB 4MR9B 4PLVA 4X1KB 3K9HA 1YQGA 3KSRA 1FBTA 3NANA 1VFNA 3TG8A 3BJRA 4W1RA 2KSWA 5HBGA 3V9AA 3HN6A 2H4HA 2Z83A 4CTJA 4G85A 4OQYA 2BBTA 4IFEA 3F4BA 4WINA 4TXHA 5MF6A 2G28A 2AC7A 4CEJB 4R8RA 4US0R 5AW8A 4WXMA 1DWUA 2R25B 5FFNA 4X3PA 4IIDA 2GF9A 3MTDA 3F6BX 1Y6FA 1OI7A 1BJKA 3C7KA 3DEZA 3MIIA 1P0FA 1DINA 2BUBA 4P4LA 1IZYA 1MB2A 2DLNA 3CSSA 4Y2VA 4PSUA 1UWCA 1YR9A 4QDZA 3G5TA 4RETA 3ZU3A 4XGRA 2LBPA 3FZNA 4X1YA 3W4IA 2V4QA 5KMGA 1I7SB 2XQGA 3LGSA 1BXGB 3O2SB 3LO5A 1D1SA 4EY5A 1OU0A 4DLSA 2C7PA 3NHRA 2NTEA 2XZDA 1LBTA 2ALZA 5LMNB 2B63G 2DOKA 2WVAA 1WB4A 2YCHA 3DBRA 4YCJA 1X7ZA 4ZQEA 5BY2A 2ADMA 4RJKA 4BMOB 5ITSA 1SXJE 3U1BA 2FXVA 1WW8A 5GVRA 1NYQA 1H05A 4DYVA 1PD1A 5I7RA 1SQ5A 3CR8A 3FIUA 1PD0A 2UXCB 1WH2A 1YUNA 1SURA 5EE3A 2ZIGA 2QW8A 2YFQA 1WY5A 3G0BA 3H65A 4WVFA 5B2EA 5KNBD 4IRKA 2BBOA 3D6AA 4ZJYA 2EKPA 2CSXA 3PYMA 3U4GA 4FFOA 5G3YA 4I4TB 4V0QA 3DJYA 2PL3A 4LQ4A 3BREA 4KK3A 3ZCRA 2HH9A 3TOXA 2CKZB 1HBJA 1T6BY 2PX3A 3GQVA 2RCNA 1XTQA 4BNNA 4AZWA 1ZK2A 4PQGA 3TCNA 4ZOBA 3KYDA 2FPGB 4G2TA 4MCIA 1EPUA 4LMBA 2LPMA 1JPNA 2YV2A 1SCIA 3H4TA 2IU6A 1C7IA 3K9BA 1CJSA 1OAKA 4IL5A 1YDMA 4CLXA 5AVWA 1M0EA 4W5RA 2C83A 4ZRNA 4OGKA 3X0DA 3V9PA 2PAFA 4DWJA 5ALSA 2RKBA 1TEHA 4RANA 5EY5B 3ZWPA 2O50A 1XCLA 5JNTA 1OLSA 1J0EA 5JU6A 1XVLA 5IN5A 5FNVF 2E5WA 2JCBA 4Y9SA 5G1NA 2O8BA 4R0MA 2QAIA 3CIFA 4ZT4A 5C37A 3AC0A 1ZQ9A 3A70A 5D1PA 4RXMA 5EXSA 1ISPA 5DQIA 3RCBA 2NMVA 4IHJB 1E59A 4FTWA 3FYCA 3RYFB 5EE1A 3Q7IA 3B6KA 5I5VA 4B17A 4BATA 1W85A 4DL9A 4HVTA 1N32B 1DQRA 3LLMA 4Z3OA 2F1KA 3P8ZA 1KBQA 1Z7EA 2N3ZA 1OV4A 1RJ9A 5JAZA 3BSFA 5LA6F 4DQLA 1KQ3A 1ENPA 5E6RB 1OI4A 1YS7A 2ZG6A 3V1LA 3C7TA 2CCGA 4CMGA 2ZJ8A 2UU9B 1U7XA 1NQWA 3AI1A 3ET5A 4YP3A 3VX4A 3PDIA 4U8HA 1V5GA 3M4ZA 2C1EA 5IRCD 2EIXA 3WFIA 1IUPA 4FPXA 3DYVA 4UTXA 5DHPA 2EBFX 4IHAA 1QGDA 5B1EA 4AMVA 1JFVA 2ZR0A 1C7QA 2JIPA 3AM5A 1K4YA 3RSLA 4J2HA 4MRMB 1ENZA 4MR8A 1SU6A 4IDPA 3OD1A 4AUMA 1ACLA 4I5EA 3OQIB 2WTBA 1OWNA 2XQFA 3KL4A 4CM5A 4UTRA 1U3DA 5JATA 4G24A 1XMOB 1HNXH 3LC0A 5JIBA 5KT5A 4PGAA 3ZLBA 1NR7A 1V47A 3A2MA 3L4KA 4Y2QA 4EX6A 4AWBA 3A1FA 4GOKA 2ZI7A 3PQCA 3ZZ1A 4ZPXA 1WLYA 3ZQ4A 2LGJA 3P0EA 3HKDA 4A8HA 3COSA 2BGJA 4JSTA 2QSJA 1JE1A 1ZD5A 3FLAA 4DAEA 1CR4A 1R9TA 3IVRA 1TO1E 3KZOA 2H9AA 4KIUA 2FPLA 4EPTA 3JX9A 4L50A 4UOEA 1BX3A 5L1KA 1MHTA 1SG0A 4KVGA 4YVFA 1L4NA 2CYAA 1Z8NA 1ZUNB 5ALUA 5L95A 3VVCA 2YN0A 2OQVA 3T3HA 4MUXA 1A4RA 3HA7A 5DISC 4CMFA 2XKBA 1QHHB 2FY8A 3PC8A 4WL0A 4FOPA 1LU9A 1NVVQ 4BN4A 3Q1KA 5ERXA 4CM1A 3HYCA 1CZNA 2FZ4A 3IEPA 3MYRA 2QUJA 3T4EA 1ORIA 4YV7A 3U17A 5C5DA 2IS6A 3H8VA 1W8IA 1ULHA 5JJKA 1GAJA 1O97D 4EYQA 4LF8B 3RFFA 1QRUA 4YBZA 3NEYA 2YWRA 2OQIA 3T1VA 3RU2A 2YCBA 4J0IA 3H84A 1W44A 4LRXA 1FJGB 5CRIA 4C87A 1LNZA 1MMFB 4EVQA 3L0ZA 4I81A 1P73A 1MO2A 2WHXA 1V1MB 4B31A 3VNNA 1K7FB 2HR1A 4RNNA 3MBOA 2JEOA 3GNLA 3MEQA 1RWWA 1VI5A 2BHLA 4X7MA 4C6RA 1GZ5A 4PLTA 3WWEA 4ZEWA 4XIIA 2C54A 1S2OA 1ZN9A 4NFYA 1U6KA 2JRCA 3GY0A 1EYZA 4M37A 1JG4A 1RWKA 5IYDG 1V2GA 1Y42X 4QICA 5KVAA 1X0XA 1V95A 2ETVA 2WJIA 3U16A 2X4GA 1ZGBA 1UJ6A 3TTWA 4FBGA 5I8PA 1DEXA 3O03A 3VJKA 2VZ0A 3YASA 3IQIX 1XSEA 4BP8A 1IBKH 1NXQA 2GTPA 4F6LA 3IIEA 4B34A 2K2QB 3W5AA 1V9CA 4RHXA 3GTPA 1JILA 4RKWA 3CW8X 3Q15C 2O03A 1GL3A 2HFJA 3HTXA 3VZRA 1OVGA 1SVLA 2YNMC 4BFTA 4N9WA 2FGJA 2Y9PB 1FZQA 1Q3HA 4JJKA 1U7UA 2IRWA 3VYUB 5EWGA 2VTDA 1LZKA 2TSYB 3AR6A 5AD1A 2UZ1B 2IY8A 1L4EA 4LZZA 3ICWA 2FZWA 3C24A 2VN8A 4E51A 1IQUA 1OF1A 1NQAO 3RVOA 1D2NA 4KDEA 4MUHA 4BGUA 1XF1A 1A8SA 2O8FA 1E7QA 2WD8A 3D6NB 3F96A 3ZWNA 4DYHA 1O57A 3LSTA 4F4XA 2YHAA 4I5GA 2OO5C 4DRXA 5IYCG 4GMFA 2B20A 2PZLA 3OCUA 4BO1A 1W2GA 4J16A 3ZWAA 1JHAA 4CHGA 1US8A 1DARA 3A1CA 1WXFA 4BNWA 4E11A 3SLRA 2IIPA 4RJIA 3SXUA 4O29A 3N0VA 5A05A 1LV7A 4KJXA 4HNUA 3U6KA 3EOZA 5I9IA 4DMMA 3UK0A 2GKGA 4XPIB 2WAMA 4XPZA 1QRSA 3NOQA 3A05A 5E8RA 5FB3A 2QPTA 1G291 3I42A 5CFOA 3F6CA 1SIWA 4DMFA 1U9ZA 1JAIA 3GDGA 1MZPA 1SCUB 3WTBA 1J2YA 4QJBA 1XR3A 2V4UA 4BZZA 4UXJA 5FDFA 4DF3A 1WPXA 5I6DA 4NYMR 2J3DA 4N6GA 1G3UA 1R3UA 4DDWA 5C80A 4U0JA 3IUBA 2B83A 4PRYA 1N25A 3K53A 5FLXA 1MD9A 4D1YA 5TEWA 3W78A 4TLLB 1I2MA 3ICPA 1T5TA 4CF4A 4NG5A 4DR5B 5K9ZA 2XMBA 5FA5A 2CMGA 3OOSA 4UCRA 4MKZA 1VRCA 2QSZA 5JNRA 4NV0A 1R4MA 4IUBS 1R10A 1IHUA 4RLSA 3SR0A 3H19A 2ID4A 1K6EA 5K6AA 1KDOA 4YACA 1VC2A 1MNAA 4LVCA 4LTMA 1K63A 2CHVA 3ABQB 1RKBA 5E6SA 4P4SA 2O2GA 3NYRA 1O6ZA 4QHYA 3EUEA 1FBNA 2VDJA 1VECA 2ACKA 4L15A 4UBJA 4J76A 1NU6A 3E3NA 1KSJA 2V9CA 4DUGD 3TQHA 2AR0A 5TQJA 3EF0A 2FSGA 5CT5A 2PFSA 3GLIE 1Q11A 2FEXA 5EMLA 4I6GA 4BIMA 4ZO7A 1E9CA 4LV8B 1HYBA 2F8TA 1GRCA 2P30A 3K3VA 1I51A 1F12A 4G81A 2E48A 2X7XA 4XWAA 1BEZA 3ER9A 1DZ3A 2AI3A 3GIJA 5EP1A 3KDAA 4ND2A 2VXOA 3VI4B 4B7AA 2VBCA 4J1NA 2VQFH 3MWYW 4M6WB 2H1RA 2CEAA 3OC6A 5KTOA 4IRUB 1M1NB 2QR5A 2V03A 4J0QA 1XRNA 2XCOA 3ANSA 4TS9A 5AHOA 4BVKA 1NHGA 5CDUA 1HE4A 4FMDF 4FVTA 2J0VA 2WAXA 1F8UA 3SAJA 1ECFA 4NJOA 4Q7EA 4C0HA 1NVUQ 2PMEA 1AB6A 3N2KA 5JO0A 3VTZA 1PQYA 2ZLBA 3WO0A 2PMBA 1R27A 4MUMA 5FBZA 4ICIA 3FBTA 3I72A 1GGNA 2ZUWA 4RV5A 3B70A 1U9JA 5DG7A 3E1GA 5AJYA 1EVQA 4MP3A 3OKAA 5JAIA 1GNPA 4PRZA 1XDGA 4IRXA 3GFSA 4I2NA 1P61B 5A02A 4O7NA 3PEVA 3V7NA 2PH7A 1DRJA 2HWKA 2UYQA 4MDEA 4FOSA 1G6KA 1S7GA 2HHHH 4YV0A 1G9XA 2FRDC 3V4OA 3BFKA 1WR8A 3KB8A 4M53A 1TKRA 3G2NA 1EAMA 2WVHA 1NUHA 3DA8A 3CEPB 3G23A 1EA7A 1RMTA 1WVIA 3C1UA 2ATCA 4BGDA 3OZGA 1E3EA 4AYBA 1Y6JA 2ONJA 4MI9A 2AF3C 4FGLA 4HO1X 4QAJA 3O1HB 3Q8LA 4WHXA 1Z4OA 1FDVA 4I1UA 2C2KA 2JC3A 3FUTA 4JBHA 2C1XA 2CCJA 3OZFA 4ZOQI 5IEJA 3TBFA 4HT3B 5FX2A 3THWA 3VH3A 2Q7DA 1CQIA 3HN7A 4B3DA 3Q8PB 4YUYA 2EGHA 3KWFA 4AP6A 3DFMA 3T7SA 1C8VB 4LYFA 1VMKA 2JHFA 3LMKA 3BKXA 1AZLA 3WBFA 2NU7A 4NEQA 1IBSA 2R1TA 4HAYA 1POXA 3LPLA 3WR5A 3LRTA 3U26A 2YC2C 1YR1A 5C7LO 2OAGA 3K0AA 1B6TA 5IC6A 3R5JA 3DMNA 5ILQA 4RK4A 4U7HA 2JATA 5I5YA 4W5TA 2Q5FA 4WERA 1H6DA 3P97A 1XTVA 4RSRA 1S2IA 2F1OA 1MJGA 2CHUA 2PSJA 5B12A 1XDSA 1R66A 1DUSA 1CDDA 1TCCA 5D8DA 4FEEA 4TWBA 4A3MG 4A8JA 3THYA 2BWJA 1PBNA 2JFGA 2ZJ5A 2RH9B 4NFHA 3QVUA 4KVAA 3V1YA 4R5HA 5DU2A 1QIFA 5FL7D 1ZH8A 4RVFA 1LB1B 3N8NA 3Q0TA 4YXWA 2OAEA 1XZQA 4BMXA 4GPBA 4DABA 3BTSA 3KJFA 2PQ0A 5ALGA 2IQIA 3KB1A 1AQJA 1AB5A 4RA6A 3D6MA 2QT9A 2GFQA 4P83A 2C2RA 1X1AA 2XKJE 1V9PA 3LKDA 4PLCA 3RS0A 4G1CA 4RYDA 3TAUA 3TX2A 4EA7A 1N0WA 5I7VA 2I1WA 5G53C 4OJQA 2B1GA 1EEHA 2WKQA 3DOEA 3GP5A 3IAFA 3BK7A 3HO1A 4D56A 3USCS 3T5AA 2DT5A 4R98A 4YB8A 2OXCA 4CGYA 1DMRA 1VG1A 3MRSA 1V2HE 3UMYA 3W9SA 1NMYA 5IFLA 2JF0A 3T4XA 1C1XB 2WU0A 2VUTA 5CG2A 1VBFA 4EJ2A 1KZHA 1JLMA 3LT5A 1FZTA 2XT9A 3A4YA 3FKSA 4DLPA 1INLA 3AEQA 4J9PA 3NJ8A 4C4ZA 2EFDB 1G64A 1E5XA 1YR7A 2CVOA 1Y80A 1C4WA 5A7GA 4GH5A 3O4HA 3NVAA 1GFSA 5TQVA 2ZSFA 2AJ8A 3TL2A 1WF3A 5IHPA 5DLFA 3PF9A 4GU5A 3JSAA 5LP6B 3GFTA 2OV8A 4M83A 3OSNA 2R5NA 3HDHA 1N5KA 4FE3A 1ZFNA 2F3TA 3CZCA 2YZ7A 1WZIA 2QR3A 3OE1A 3ML1A 5AK5A 2J0UB 3ENNA 1P1HA 4RH0A 5DH9A 2OZVA 2NVXA 1VE6A 2FN4A 1VSTA 3SDZA 3DV0B 3OFSA 2YXNA 3LFUA 3OEHD 1R0RE 1E2EA 2HJGA 4BJ3A 4PNPA 3WE7A 3ZHRA 4K9RA 1EINA 4DQUA 3QUTA 3EXEB 5AW1A 3Q40A 1PZNA 3QU2A 1OREA 4AI6A 2B5VA 4BNUA 1I36A 4H7EA 3GIIA 3UK1A 2EX0A 4FS1A 2ZZNA 1VHQA 5ARDA 2W93A 4HRXA 1BDJA 4PYRA 2H52A 1WETA 1ND5A 5HKKD 5LYJB 1Z6XA 1PFKA 4DEVA 3F2IA 3V48A 4A36A 3UT5A 4BWGA 1U0NA 2YJZA 4OFBA 3IS3A 2PEZA 1QOZA 4QG7A 1UMBB 3P9KA 4KO2S 4C3ZA 3SX0A 3GJ6A 2LR0A 4W5HA 5EN4A 3D2BA 4UHHA 2Q4OA 2XJ4A 5CR5A 3GLTA 2D5IA 2MMCA 3DF9A 5LKAA 1XEXB 2GO1A 2XE4A 2YYAA 3FVVA 1PNOA 3H0CA 4GSYA 4B84A 4I2VA 3OO0A 4Q1DA 3I1YA 2E4UA 1Z17A 3CCCA 3P2EA 4EATA 2PZGA 1NI5A 4JL8A 4FOTA 1RQNA 4YQZA 2IP4A 1VTKA 4JQZA 2PZJA 3IT1A 3MPOA 3F5MA 2ZBRA 5IF3A 3FFXA 3FYUB 5JNLA 4A2AA 2VCHA 2AZMA 4ACAA 4KHPB 3UWSA 2WJ3A 4KE8A 4TKMA 2YJGA 2RHHA 3PFBA 5AICA 1F8GA 3KXIA 4JJAA 1P0MA 4FDMA 2GWRA 1FU7A 1U3VA 3D3JA 2YJTD 1J8MF 3JXEA 5K3FB 2NSLA 4H7KA 2P8JA 4UHEA 3HB0A 4YRKA 4NDNE 5B1IA 1TT5A 1A1VA 3R3ZA 3DBVO 2H4FA 1N5LA 2XXAA 1QOQB 4CIVA 1EFCA 5JJIA 2C88A 2UUBB 2ACVA 4JLWA 5JXIA 4KBFA 3KDSE 3IDOA 1DIOB 1ORTA 5LYYA 7MDHA 2O1SA 1JH9A 4IDQA 1PJCA 5D00A 1B8NA 4E5PA 3KJHA 2QJTA 3H97A 4RF4A 1ZETA 4D3SA 3TLEA 4GP7A 4HDCA 4H0FA 3M7IA 4TQAA 4DANA 4TQGA 2ZZKA 2V4MA 3L79A 2ZAOA 3KR0A 3FCYA 3HBJA 2V65A 3FFTA 3BHJA 4MWZA 4YJ2F 5EJAA 4ENSA 3FPJA 2F1IA 4KQ9A 3HFSA 1NVAA 4QRHA 3AZPA 1GCUA 5KYUA 3DTFA 1IL0A 1XNRB 3TI7A 1DV1A 5CM8B 3EZ2A 4CL8A 3OLZA 5BUCA 3PRKE 2BMAA 1RHRA 2NO0A 2ZJBA 4BE7B 3QVSA 2VJCA 1LDBA 4LJAA 4MDFA 2HBZA 2GN9A 1QKKA 3I0ZA 4IEFB 3DUWA 2FZVA 4UM9B 2IKSA 2G6TA 4REQB 4R2WA 1LJ8A 3L6UA 4YJHA 3TZBA 1XNQH 3M5CA 4G4JA 1VCIA 3QV1A 4PG8A 2HA2A 2GR9A 3EARA 4LF9H 2ZKIA 1M1ZA 5AK4A 3L5KA 3KSDO 3PKJA 1VHDA 4QOEA 3AKZA 2ODAA 4IWNA 4XSVA 5JEDA 3TRFA 1JJ7A 1P2SA 2VK4A 3FPFA 5CA1F 2DPYA 2UVPA 2RAUA 1M6NA 3AUUA 1D7AA 5DM1A 3N28A 3WHIA 1YB6A 4DCSA 4DCGA 2J3QA 3UAOA 2HQOA 5EXDA 4XM1A 4HWKA 3Q6IA 2OCYC 3RJTA 2YC4C 1RLTA 3DCYA 1QM5A 3JARA 1IBLH 3SC4A 1YZGA 4J0FA 1BMFD 4ZWNA 4ZMRA 3BE4A 5H9WA 3EGIA 1P6XA 3L1UA 3O3CA 3KDPA 4RTRA 3RYIB 5JROA 4DN6A 3KVVA 2QMEA 3JD0A 3B38A 4U6NA 1VE5A 4IGEA 4I1YA 2QRGA 2O59A 3K71B 4E32A 1BWSA 1VL8A 3IOEA 1EVYA 3PC6A 5FP0A 4L51A 8GPBA 1HNWH 3WXMA 3E7FA 5FI3A 4M9ZA 1L7NA 1OFUX 4GT1A 3E9RA 3K1TA 2DFPA 1LC0A 1TU0A 2PY6A 3J80W 3CNBA 5HF9A 3EDOA 4QEZA 3NR2A 4CMJA 4AS1A 3Q3IA 3WLSA 5GJWC 4KX3A 1P2UA 5A3JA 3GGDA 1DKNA 5C31A 3NMUF 1GTG1 3OT4A 1U2RA 1Y1LA 2IHNA 2WINI 2IYSA 4A1FA 4BMDA 4ZEVA 5FPYA 2MCTA 1WX1A 1X42A 1DI0A 2DLCX 4PBRA 2ZUFA 3M3DA 5F7JA 3U7QA 3GILA 4DR3H 4KJZA 1YNSA 1Z0KA 2TMGA 1OZGA 1F5SA 3P96A 5DCWA 2V58A 3TRHA 2G8LA 5IVHA 5F77A 4MVJG 1K8XB 2AE2A 3OHSX 2G4VA 4F92B 2PTGA 3BIFA 3OC0A 1YL5A 3SF0A 1KI7A 3CO0S 1OOEA 3RB8A 4E3ZA 3DCNA 3L0BA 1A8IA 1SH7A 1W94A 3QKWA 4PZ7A 4GM4A 1CNEA 5JECA 3QBEA 4LRYA 2R82A 2OFPA 3UV7A 1MEJA 4EO4A 2R86A 5FV7A 3NC0C 2NU9B 1X39A 2D8MA 1NP3A 1KBZA 1YQWA 2HDHA 2W8BA 4KCGA 4MB2A 4QD3A 3ELBA 4PYQA 3AHCA 4L9SA 4F8JA 2C3PA 2FNAA 4DNXA 4N0QA 2WVGA 4EDHA 4EYEA 4U2BA 5JZMA 2NTJA 2AI2A 4KWEA 4OI1A 4HDKB 5DLDA 2C5SA 3UENA 3VR0A 3BVPA 4WN9A 2ICAA 4PC3A 2HK7A 3KKZA 3DHVA 3N2GB 5CFQA 4GGPA 3WIEA 1G8PA 2Q3EA 2AC2A 4I7EA 4KKVA 3D2AA 2WD7A 3OETA 1PK7A 4HDNB 2OT3B 1FXWF 2HVQA 4PHFA 1OX6A 4HQRA 1D8AA 3CKLA 3H1EA 5KNBH 4EUEA 4XQEA 5JQWA 4BY9E 1O0CA 3IUJA 2C77A 1B1CA 1LSJA 2FMUA 1CUIA 1U3WA 1ZY2A 3B2NA 2GEFA 4D9KA 4GE3A 2FPXA 2Q4RA 3RU9A 2WTFA 1R88A 4XCVA 2Z9DA 5D85A 1NXXA 1GITA 4L4YA 3GT7A 1XJ0A 1MV5A 3PXGA 3WBKA 3RJ0A 3ISTA 4HFNA 5EIFA 2BGIA 1GT91 2R8GA 3FHTA 4YAWA 3G0DA 4OXRA 1KEZA 1Y37A 2YWCA 4XB1A 1GPH1 2FKLA 1XD8A 1MGPA 3HHEA 4ECZA 1Z18A 1L3IA 4RTQA 2WV7A 5JAQA 3KE8A 5BW5A 5C35A 1CETA 4DZTA 3GC6A 3MAAC 4NCIA 3TCKA 2HQRA 1NURA 3TN7A 2Q28A 4C0LA 1SQ0A 2EHJA 1SCAA 1IM2A 4YIKA 4JVOA 1I5RA 2P35A 3N41B 3UEOA 2O6LA 1OI2A 4ETSA 4JXJA 1QG4A 4WBNF 3JAWB 1I9GA 1XZGA 3WLKX 4HNHA 3VO1A 1T3TA 2ZIXB 4AQYH 5ANRB 1NQVA 4PZEA 4DUZB 1OLUB 3KZKA 4W5QA 2XBLA 2WJWA 2V9PA 4GPIB 5CX4A 3QLUC 1T43A 4IGAA 1S9DA 4WLNA 3WNZA 2OHHA 5T4BA 1T94A 4B75A 3I23A 1ZK3A 4HB3A 2ZUDA 1VYTA 4LTDA 3OMWA 2HXGA 2Q3BA 4QO8A 1A5BB 4BXOA 3EQ7A 5BQFA 2FG6C 4QU9A 3MFHA 2EW8A 2C2DA 4YMGA 3MGKA 5J2TF 3MUEA 1JJIA 1VL1A 2YRFA 4YCCA 3B1ZA 1Q21A 2MYNA 4EHHA 4PQEA 3NDIA 3O74A 3HH8A 2QRHA 4X92A 5I5XA 2OD7A 3FSRA 2X58A 3VR5D 4CDRA 4ZV7A 2G4LA 2YJ3A 1TK2A 5AJXA 1A69A 5LR6A 5CIQA 4D9JA 1ENYA 4EFKA 2HZBA 1GJRA 3PUHA 3HLYA 2HQSA 3QPVA 4WFIA 4D9GA 5CG1A 2QTTA 3QM1A 1OLOA 5L9AA 4P7GA 3LQSA 1ZK1A 1RHMA 2UZ0A 1MRSA 3ZCQA 4MRSA 1G8JA 5B7NA 2ZCVA 5E7MA 2J8ZA 5A3RA 2FEOA 3ZKWB 4RIFA 3DHWC 2I4IA 4NMHA 1NXSA 5K3CA 1FYWA 2QK4A 4IIBA 4UU8A 1JW9B 1EDEA 5L6LB 1PR6A 2QBYA 3IPLA 2WB4A 1VSQA 3KT6A 1U0FA 1T5LA 2FHPA 4HGNA 1SUWA 2AQHA 1ZHQA 3RHFA 1P9RA 3BBLA 3QE0A 4ND5A 3N2ZB 2FWBA 4QFBA 1C0PA 1QG2A 3DPIA 3D7LA 1K66A 4O4JF 3K70D 4YRFA 1N2OA 1U94A 1PI3A 1ZCFA 4UHJA 1QDLB 4RPIA 1G5IA 5K0LA 4UDNA 2OMKA 2NUPB 2MSKA 1R15A 3ANYB 2O4CA 4YQYA 1W4ZA 2P5TB 4FHEA 1YI8A 4QDKA 1L6IA 3OZUA 1KQFA 4PSCA 2FP3A 4KWIA 4M1TA 1WDWB 5BSWA 1ZM4A 5BV7A 3L0OA 3DPUA 1QIJA 3TXXA 1O94A 2SHKA 3UGQA 4DPKA 3N40P 1VIMA 1JYEA 2D5CA 3EC1A 1E60A 1I1NA 1KOLA 2J9XB 3CE9A 1XDUA 1JZQA 3PBKA 5KG7A 3WMGA 1S5PA 2BE9A 1WUKS 4GP9A 1RJFA 1YHNA 2AFHA 1RRGA 3RNLA 1U8UA 3R20A 2YVAA 1U98A 4DDHA 1ZIOA 1LJLA 3NWBA 4O4IF 1C81A 1W46A 2GVNA 2H4WA 4ZODA 1DBPA 4Y3UA 2YXPX 3N7UA 2JJ1D 1HQCA 2VK8A 2P5SA 4ABYA 3U49A 4OQXA 2R4TA 3L84A 4GLBA 1UQTA 2R48A 1JZSA 1KJIA 2WTEA 4OUDB 2A78A 5FORA 1AN7A 1LNSA 4FSDA 1NJSA 1KP2A 4OMDA 4Q9AA 4AU1A 2LIVA 4NV1A 3BA9A 4EBDA 2Q3FA 3L4EA 4Y2XA 4O2BF 1C8KA 1SKYB 3CRNA 2HKIA 1PLJA 2VAWA 6Q21A 1E2FA 5DLYA 4R01A 1VI2A 3PXUA 4AX8A 3AF1A 4ZPJA 3NKFA 4TKLA 3W2HA 1VCNA 5B64A 3QEOA 5D7BA 1YVUA 3OF2A 3DZBA 3TXAA 2FUNB 4WBXC 3TL3A 3EC7A 5AUQA 3VO8A 3T3PB 1VKRA 3BL8A 2CLSA 4TV9B 3A7DA 3FCEA 2UVUA 4RZIA 6REQA 2WAAA 1SBCA 4UHBA 4Z0TA 4BMZA 2J5QA 2QORA 3C3BA 5H70A 1U1EA 2QYZA 1JLLB 4ZVQA 3BIXA 4X00A 5COBA 1SA0B 1KETA 1MFZA 1G3IA 3IP6A 3QXSA 2QTVA 1F7VA 2REQA 1GA6A 3H3VH 4HSEA 3CPSA 3PE6A 1UODA 4MVCA 3LQKA 4EBEA 5I7SA 4I8IA 1GGJA 2G76A 3H5VA 3IKLA 4JI8H 3KSUA 4C6HA 3G85A 2PS9A 3ZDFA 5L40A 4RTKA 4C6TA 2D1FA 4CLOA 1Q50A 2H1CA 5F21A 3L1KA 4NLLA 1P5ZB 4DXDA 3B9PA 5BYAA 1T36B 2ZZMA 1JAYA 5I45A 1WZNA 2WD9A 1UIMA 4ZCSA 1QRRA 3ZJYA 5HW0A 5G41A 1CY4A 4Y1GA 2CVQA 2I6XA 2XUJA 1JB1A 5EKUA 4V3CA 5CTAA 4X65H 2LD4A 2PMCA 5JH7A 4L0MA 4JXUA 4HGOA 2JA7A 3O4RA 3T7AA 3GVPA 3RVKA 2JJ8A 2H1FA 5DRYA 3QVGB 4B6FA 2Y1FA 3G7UA 4G5OA 5F3RA 1ODFA 3A1EA 3R41A 4HDRA 3B85A 3KZCA 2EKDA 1CZRA 2B36A 4KB5A 4MCJA 4WBSA 4Q1FA 3RUPA 1V35A 3ABSB 3KTAA 1RJGA 1WZ2A 1TZ2A 1GPAA 1RYEA 2YHBA 5HP4A 2A84A 3GZNB 3ED5A 2ISCA 4H4DA 2YXBA 3KYBA 1AHIA 4N8SA 4GMKA 3UGJA 1Q7CA 4V0ME 1G17A 4EF6A 3CWCA 4PLYA 1TEXA 2AD1A 5AVXA 1ZPDA 5CFLA 4XWYA 2Z95A 221PA 3IOYA 2YUIA 4UE2A 2EJ2A 2X0JA 3AVXA 1XZBA 4R5MA 5CK4A 1RRPA 4MARA 2HWYA 1X1BA 5AW9A 3EVNA 4CEIB 3K4HA 5KSZA 1MU0A 4GMGA 5LZ8A 2HCTA 1WXQA 3FOCA 2OP1A 2V1UA 2OB2A 1KI9A 3EMBA 2Z9BA 3PLAE 4WLVA 3QOWA 4EYKA 2IYLD 4IV8A 2GDZA 2IU3A 4YREA 1ZIDA 2QIOA 4G0WA 4L8GA 3PT5A 1OXBB 3OM8A 3MQ2A 1KEUA 1FMJA 3ASVA 1CY7A 3CF0A 5GM2A 1XWIA 4EB0A 4BB5A 3RPEA 5BOSA 4S2UA 4N40A 1I1LA 4E12A 3C8UA 3IAM6 1ZNQO 2QUIA 2PUCA 4M0MA 4Z1MD 1E4YA 4IFTA 2NPIA 3C3PA 4BN5A 1G2PA 1Z4LA 2RHCA 4V1CA 1PFQA 4WXPA 2AYXA 5BN3B 2F3UA 1V26A 2B4TO 1XD2A 2J41A 4BY1G 2DFNA 1ZC4A 1QLJA 2IZ6A 2ZVDA 3F67A 1I4TD 1X3LA 7AT1A 4EJSA 3BM5A 2BFCB 2ZTVA 1H0SA 1IC6A 1DPFA 3UK6A 2VJNA 2O52A 1IOZA 1G3MA 2ZROA 4ARIA 1IATA 2V7QA 3LUCA 4UVHA 3X1KA 2OHGA 4KI0A 2W42A 5U4XA 1SC6A 4RTOA 2GBLC 2BUCA 1A76A 3UCFA 3R7DA 1T2NA 4GQBA 1MJFA 1QRAA 5FOSA 5K0JA 4FQ5A 2C78A 4FIDA 5IABA 2IXBA 5I60A 3GRRA 3B82A 4TRJA 2DCUA 3KELA 3F2VA 2A94A 3UV3A 3GX1A 1KNQA 2B4RO 1E0KA 1U81A 4BBRG 1Z13A 5JXJA 1YO6A 4NBKA 1E0SA 4LPSA 1Y3FE 4RNOA 5CVJA 1PS0A 4R71A 5L3QB 4EG1A 1QGZA 3EXFA 3M89A 2QTGA 5MDHA 2JGFA 4DMCA 1S8OA 1U7HA 3Q3CA 4L76A 4QASA 1Y1KE 2ZRHA 3G2HA 4W9NA 2JAPA 1QR6A 3TLGB 4BAZA 3C98A 4LZNA 1KJJA 5LOVF 3BD7A 4AMUA 1L2TA 1Q57A 4B9AA 4AKEA 4BXXG 2E2WA 2CLFB 2NO7A 3IMKA 2QIPA 4ZO8A 4ZHQB 1E1DA 1C7ZA 4IG9A 5BMOA 1S2DA 2FSSA 1YVPA 5E2BA 3AZOA 1UXJA 3CVWA 4MWTA 1ICEA 2C7GA 3EHDA 5HM8A 3IHTA 3G68A 4PU0A 1B42A 3RI3A 4JYAB 2W6MA 4F1JA 1HXHA 1XZJA 1AO0A 1FQJA 1WB9A 4JQSA 1K6MA 1CF9A 1J2UA 1RQGA 2R9VA 5LDHA 2ZETA 1PX2A 2EVWX 3H11A 2BE7A 1X7DA 4OHPA 3TEMA 2AI1A 4N9QA 5CH3A 1Z2DA 4RQTA 2Y1WA 1Z4JA 4Q18A 4N03A 1XX6A 4QU5A 5ES4B 3LX4A 4M36A 1C0LA 2BFDA 3L4BA 2Z8YA 3BS4A 3GF4A 3NOVA 1NT2A 3BQ9A 5FUMA 4Y6QA 3ZOKA 2NT3A 4PO1A 1OPXA 2JS7A 2WTNA 2OUKA 4V02A 1RKVA 1ABEA 5DCUA 3UPTA 4I66A 3FAZA 1UFRA 2ZBPA 1UDBA 5BSHA 2JPDA 2H8GA 3SWWA 1WMFA 1NMXA 2OHXA 5CE8A 2WM3A 3DOIA 1O9HA 4R8SA 1Y4SA 3IQFA 5AIBA 2LP4Y 3DMHA 3SHOA 1PFYA 3CUVA 2NN3C 2DWPA 1TTQB 4EY7A 4LY9A 4HQ0A 4J0KA 4O81A 1JHXA 1WZCA 3BFVA 3ZQ6A 4XWWA 4ILEA 5E8JA 2BGTA 2Z6VA 3I9MA 4FS2A 3IVMA 4X60A 4UCXA 1GYFA 5I9NA 5E38A 4OIMA 3ED1A 5FLYA 3ZQJA 5E3JA 1CERA 1CVLA 4EKEA 1KMNA 2COUA 2P9YA 4EHNA 1KZ1A 5BYKA 4TUYA 2GETA 1VSBA 3OSUA 3LUDA 4UVIA 3AEXA 3LFHA 1W2HA 1WG8A 4P7FA 2RCYA 3H6GA 2GBFA 3K5WA 4CKZA 2YZNA 1FFDA 1THZA 3O83A 3C8DA 4RMGA 4RHUA 4X1IB 2JIBA 5I5TA 4B6EA 1YBVA 2XWQA 4XCQA 4JC4A 1SVIA 3KNZA 4FWBA 4GDMA 5IDQA 1ZN8A 4JI3H 4J9VA 2E9SA 2NNLD 1KVTA 3CEHA 5HZMA 1W5SA 2B7LA 1EFRD 1UCFA 1KIAA 3R6WA 1U8EA 4UHDA 4NMXB 2Y77A 2VCYA 2W58A 1CX9B 1SD1A 3KQPA 1XYYA 4B45A 1JSZA 4R4JA 1GN9A 4DSZA 3ZYZA 4GMHA 3EZNA 4LBVA 1RMQA 3GN1A 2PKCA 4C04A 2F4NA 4PWQA 2EJ3A 4OK6A 1G60A 4Z2AA 4PM4A 1AF7A 4DGSA 2GPBA 4IXMA 1Y33E 3BWVA 3MLAA 1EFVA 3I8SA 4F46A 4Z6KA 3WLMA 3I5YA 4UNRA 2I8LA 5HFNA 4A91A 3UK2A 3CEJA 3C7AA 2CDCA 1T5HX 4PRLA 4TLDA 5LQCA 2K87A 5I9MA 2CE2X 2PN1A 5GIPE 1UPCA 4ENVA 2Z0MA 3ROEA 4EGAA 4U9UA 2F3QA 3MM4A 4YMIA 1XHFA 4CU5A 5B7GA 1ZMTA 5KFFA 4EF4A 3OLXA 3PNOA 2I62A 2QLFA 2CJFA 4UASA 2DY0A 3STHA 1WL8A 3VC3A 4FUTA 4B4VA 4Z51A 2GQSA 1RXYA 5M04A 4P84A 4BLUA 4HAXA 1H93A 2VLBA 1DWPA 4JROA 2NOAA 3RYCB 4KQWA 2P2DA 4Y9TA 2Q6VA 3IN5A 4RK7A 1J56A 4C2BA 4BVFA 2PT9A 4JNKA 4KPUA 1PRYA 4B7UA 3QOYA 2AOWA 5DBOA 1NM5A 2CL0X 4B76A 4UUAA 4M54A 2P3LA 4BFWA 5FO0A 4LYYA 1BG6A 2JNWA 4D98A 1HE3A 1XALA 5A7HA 4MS1A 2VDOB 1HL3A 3CIOA 3SX2A 5IWCA 4BBPA 4RHCA 1GV1A 5EKTA 4GE0A 2JGMA 4Q1EA 1RXCA 1IH8A 5KG3A 1YQEA 1YUMA 4LCBA 1DWOA 3EZYA 1GHTA 2WRZA 2WDZA 3Q12A 2DSNA 1CZHA 1NATA 1KI2A 3WWPA 1QO0A 5EC8A 3N2IA 1D0IA 3V7UA 4YLYA 1YJBA 4WH0A 3L9XA 4HV4A 4C6SA 1HDEA 3I62A 1DX9A 4E2FA 3QPUA 1JHVA 3FJ1A 5HEKA 3ZN2A 2ZIEA 4M4SA 4HFRA 1VLHA 5E1DA 2HD4A 4CKYA 4F50A 3U60B 1W36C 3ZZNA 5BQOA 4DMLA 4YP7A 3CA8A 5D5PA 1Z8FA 4D9BA 3R7FA 2O48X 4ZT3A 1UXOA 2JK1A 4FT2A 5JAUA 4OYHA 1VLQA 3F7MA 4IH4A 2Y2UA 1AQIA 4PCVA 4FR5A 2X3YA 1GSAA 2PUGA 3PGMA 3OY2A 3P2JA 5L4SA 2Z3VA 4II3A 2WQZA 3BHIA 2VDNB 1ESZA 2M1XA 2O07A 1KJZA 4BNDB 3O4VA 3PN1A 3OJFA 5IH3A 2LTAA 5D2CA 2WNIA 3W3ZB 2GN4A 2H59A 4C7VA 5DGTA 4EOGA 1NBHA 1PTJA 2V7WA 3E2MA 4XXHA 3FRIA 1EIZA 1LSSA 5A62A 3HKBB 4JNCA 5FI0B 1E66A 4DJTA 4DR1B 4U3JB 1UOQA 1TX4B 3JQAB 1U9IA 2X40A 2IQ5A 1OZHA 4WLFA 3W5IA 4NDZA 5KWVA 2AR9A 5AJZA 2D5BA 1KIFA 4FGUA 4YJFA 4AZ3B 1N92A 4MTEA 2Z5FA 2XOKD 5L3RA 5D1OA 5TQ2B 4JJ4A 1QGAA 2EFYA 3DD1A 4DCPA 3IEMA 1WEKA 2G63A 4KPYA 4QGFA 2GZ1A 2QVBA 3RAXA 4Y2YA 4KACA 4E6EA 1MTZA 2IWRA 3T5HA 2WYVA 3AUTA 3SIXA 1GR1A 4RDHA 1CRWG 1HMPA 4D8TA 3TFQA 3MB5A 1HQKA 3SZOA 5TARA 1QB8A 3AINA 4RH1A 2QX9A 2WHPB 4F60A 2X19A 4RB2C 3O73A 5E1OA 3N2NA 3OPYI 5A4JA 3GFPA 3ZK8A 1VPLA 3RJ5A 4DA4A 2POQX 4ND8A 4UEQA 1JR3D 4ZAXA 3ROZA 3PHHA 3QU4A 4Q02A 2A4KA 4Z7JA 5CDHA 1UMDA 1VB3A 1C3OB 4ERXA 5GGXA 4NOLA 3H1BA 4G36A 4Q9LA 3W6UA 1L7AA 2HNAA 4CDMA 5LKRA 2GEUA 5DISB 1EK6A 3K73O 1IN8A 2BQUA 4RJ2A 1H23A 5F73A 3PPVA 3EAFA 2IE0A 1J5PA 1IEXA 3D3QA 3DO5A 2PJDA 3BFXA 4QFDA 2G71A 3A3YA 3BQ2A 1M1UA 3UJAA 4NAVA 4CKCB 4IH1A 2ZRAA 5AJVB 3WGJA 3F9CA 5JI3E 3GRAA 2XXJA 3G0CA 3FNFA 1OB5A 2CK3D 3PGVA 3B78A 2NSDA 2GCOA 3CRZA 1VXOA 1L1EA 2EX4A 5DBFA 4JYMA 1KKMA 2ZSBA 2QL6A 5CFPA 4A5SA 2VR1A 2WTMA 3ZEAA 4DV5B 2J6HA 3A1DA 2G9RA 1A7AA 3O7WA 4YRIA 4OGFA 4E5KA 2PSSA 3W06A 4WDRA 3BZUA 4D02A 2WF8A 2GD6A 2BZGA 4LFCH 1UJBA 1JQ5A 1AXRA 1BOFA 2B9EA 3AU8A 1T1EA 1M34E 4ZRDA 2VSNA 4Q24A 1RZUA 1ACJA 3FJYA 2C9BA 3SHWA 2C7VA 4CHIA 3UOWA 2ZJ6A 1TU4A 3H5NA 2FSUA 5JCZA 3A6LA 4HPXB 3ZNOA 2H4JA 1UXIA 2CXUA 4UUOA 2JZNA 2IODA 3N0WA 1FNMA 2J7PD 3EIHA 1YDEA 1RPJA 3ZY6A 3WMFA 2BSAA 5T14A 4RD6A 4U02A 4NR0A 3ODGA 1DGQA 1XDNA 2X8JA 3RSOA 4QDJA 3JTEA 2OBLA 4D4IA 3NBUA 2BP7A 4ECXA 4BJ5A 1EJ2A 1ZJZA 2DPJA 3G6VA 5LQNA 3BZWA 3FIJA 2HMSA 2BEUA 1ZAKA 1RQRA 4Y9RA 4ED7A 2Q3CA 1UT8A 2PPLA 4KOAA 3B2EA 4V24A 2YZ2A 2GGSA 3EIFA 3RC3A 2MJLA 3FWHA 4MYCA 3CTPA 1V5FA 1AZTA 4J9KA 2X76A 4L22A 3L1JA 4UFNA 2VHVA 3ZVRA 1USVA 4JP2A 2D2FA 3D4BA 2CNKA 3SBDA 3D0KA 2MMGA 1KVRA 4TSKA 4J07A 1KO4A 3UQ8A 1WSDA 4FS8A 2OSBA 3ZXXA 1UIRA 4HWRA 1HLFA 3IQEA 4DMHA 1ZAYA 2C31A 4W7SA 3ADOA 4X1OA 3BJEA 3VMFA 5K20A 2XCSB 1IB0A 3LDUA 1AK1A 2H08A 5KOHB 1K27A 4IVQA 2G83A 4M86A 1P2TA 1VLLA 3L7AA 4HQLA 4PAQA 5KFDA 4LY3A 3EGDA 5D1HA 3FHLA 4M1MA 2V54A 2XCIA 4B3SB 5ESWA 4I36A 3IULA 2QZZA 3MOIA 1WD7A 3M81A 3GJZA 1GTJ1 3T1OA 3MT8A 4QIWE 4PX9A 4GKJB 1MVNA 4F4WA 3L8FA 1ZRSA 2H5LA 3OE4A 1HC7A 1XEWX 3DBLA 1SUCA 5EXXA 3GPDG 3IV9A 1NXOA 2DFLA 1Q0QA 3AIMA 1ZP6A 4IY1A 3C4JA 1Z8HA 3AX6A 4CN8A 3M6UA 3DDUA 3C87A 1E94E 2OTCA 5CDTA 4Q05A 1XJ5A 3WL6A 3FLMA 4Q9KA 3KJXA 5KCMA 2GS9A 4KYIB 4RA9A 2GZ3A 4J0HA 3CLTC 2IX3A 4E2XA 4Y30A 1NDQA 3ENZA 3HNOA 3ADBA 4IDFA 3VR5H 1UKVY 1QKJA 1MEEA 5EJ6A 1FFBA 4K0KB 1RADA 4MR7B 2GZ2A 4RJTA 2GEDA 4AMGA 1TK3A 3GT4A 4EFNA 3RTGA 5LLTA 3MW8A 4Q9JA 2QXYA 5I4CA 4S24A 4NRDA 4G97A 2OAQ1 2VF2A 1Q1QA 4HMOA 1N9GA 4FIZA 1JEQA 3HCWA 4JU8A 2FAXA 5K0CA 3U5ZB 1G7SA 3WKAA 4JGGA 5ICFA 1CYDA 1LWOA 3NWPA 2YIJA 4QUJA 1WE2A 3M9NB 1E3LA 1NW6A 1XTKA 4NMWA 3PXEA 1L0BA 4HH4A 2GESA 4H1UA 3K92A 4TYMA 3UMJA 2XTNA 4V0KA 5J4YA 5GY7A 3BOSA 1EX9A 2PU7A 4YJ3A 1TRKA 1UM8A 2CLHB 3GEMA 4BTVA 4E1BA 5FBQB 3AM4A 5B6IA 3TTTA 3K8ZA 1U8YA 2XTAA 1UJ2A 2OZLB 3B48A 3IDQA 2XADA 5F1OA 5KQMA 4EGJA 1DP4A 4OATA 5CNJA 2VPPA 3ABZA 4LOHA 4RU1A 4HDAA 1T0HB 1JI0A 1RYHA 5ALNA 2ON6A 2RDJA 4EQ6A 5F2NA 1IOWA 4TMWA 1B6GA 2R97A 4OQLA 2XVYA 1WXWA 2H1HA 3NAZA 2XMDA 3P45A 3LBIA 4A0HA 5DN9A 1BXRA 1L9XA 5IXSA 3V4FA 1JEDA 1TADA 3TIGA 3LL7A 1Q1NA 3EPIA 1SXHA 4RF3A 2ZR7A 1I2LA 4YX9A 5CT9A 3D7NA 1XP5A 2AW5A 1F5NA 1XCMA 3IE2A 4JVSB 5I9SA 2O8DA 3KR9A 1G21A 1QZUA 4XOUA 5KI6A 1SBHA 1TM3E 4KK4A 5C5CA 1VM6A 5I9LA 5K8CA 1L5QA 2C5HA 1B00A 3GUCA 4EW2A 1TI7A 4CMIB 4N5IX 2M2IA 5EZYB 3OIDA 2CD7A 2JGJA 4KQFA 4WK6A 2W6JA 4KIJA 3MILA 2GZSA 3UJ7A 3H6HA 5FFMA 3LQFA 2BHNA 1QPGA 2WIDA 3L0PA 3R3VA 4RDIA 3QEJA 4XRGA 1U0JA 1XLUA 3VZBA 1NP7A 5EWLB 4R2LA 2XTJA 4PLFA 4PIPA 3ORYA 2VPSA 4TTJA 4GO1A 4WOBA 2WSIA 4P92A 4X7PA 3E15A 3VYWA 4WZ6A 1CF4A 4NK5A 1ZNZA 1UXKA 2H16A 5K3WA 4YUXA 2G1PA 2PUEA 2B7CA 4I50A 5IWAH 3SZLA 2O57A 3BYZA 4G0ZA 2IX9A 4MW1A 1QHNA 2D7DA 1N3BA 1LS6A 4HYTA 3PE4A 2B21A 2DB3A 4D8YA 4JSRA 3S29A 1V5IA 3DVAB 2OXTA 2G80A 3DZFA 2MYPA 5JMTA 1A3CA 1G20A 4JT8A 3AR7A 4L8LA 4JV5H 3OCCA 1XVIA 2J59A 3ZWVA 1Z2AA 3UHOA 3SJBA 3W9UA 3RF7A 2XNCA 5DNAA 1P31A 2JJYA 5JYCA 4I55F 4J16C 4ZREA 1X77A 1DT5A 4JH0A 3I2IA 4RHTA 1ECCA 3PUYA 1MBZA 4OM7A 2WUFA 2I6FA 3TOZA 2W2KA 3RIXA 1EGAA 2VZEA 4DEYA 4NJEA 4NCNA 2EJBA 3T9DA 1LDNA 4H1VA 2IH4A 3P4XA 4D4JA 3KVYA 2B1QA 1B7GO 3HJTA 2V7EA 5BSTA 2Z2ZA 1XMPA 1H85A 2FUKA 1RI4A 3K09A 4FR2A 3DQPA 3ROTA 4UZEA 2OECA 1N3IA 3AEKA 2J7KA 4N82A 4AJNA 3KM0A 4OFWA 3WBJA 1Z2CA 5GZ3A 2HHFA 3EULA 4Y2SA 3OP1A 4JC0A 3L7YA 3O8DA 3QLTA 5JZ9A 2VK1A 3VHRA 4ZOLB 1JT2A 2ZTLA 1KDRA 3SNKA 2GZRA 1N2CA 1QR2A 1E0AA 3BDAA 5DV9A 3KT8A 1I13A 4QGHA 1JDZA 3NHFA 4ZYXA 3GLUA 5FWDA 1SYXB 1TT7A 2IHUA 5DPMA 4KQIA 2AQKA 7REQB 1QAMA 4FONA 2XUKA 1Q22A 3EBOA 3GRZA 5K6AC 1HDOA 3PPXA 3T5BA 4IP0A 2BFBA 2AJBA 1ULSA 1F0NA 1ULUA 1R5OA 3AL3A 1EVLA 2PA0A 1J23A 2WSSD 1Z5PA 4H7JA 4L28A 5I7OA 4O7WA 1AKTA 3ZGNA 1OTHA 5A5VA 4H1WA 4CGZA 1K06A 1WZEA 1YJXA 1TWFA 4CLRA 4V03A 2H8KA 3HNPA 1ECBA 3X2FA 3T0IA 4XD7A 3CG4A 4B3HA 3J81k 2DQKA 4GLLA 4JXXA 4LDPA 2WUWE 4RL4A 4WESA 1T6ZA 4HYEA 4U7FA 3GLFA 1G16A 3FTNA 4LY0A 4WOKA 4IIHA 1XYGA 2AMYA 3WVNA 1QE5A 2VSFA 3GIKA 2X13A 4AB1A 5K8JB 3Q98A 3SU8A 4PSVA 4YAFA 4UEOA 3LUHA 1U3FA 1S7CA 2PKEA 3EMVA 2OWEA 1J4AA 2CNDA 3AVUA 1WOMA 2XCUA 3LTNC 5AIAA 3ICQB 4YUZA 1DDOA 3IP9A 4GZLA 5DHSA 5T4HA 4M55A 4HY3A 2ZDQA 2PGDA 2QGFA 2OCIA 1XQ9A 2QV7A 1R8QA 5A6SB 3TD6A 4Q8EA 3CUYA 4MTCA 1M0SA 2FN3A 3F6RA 2XTZA 2WICA 1YDHA 3BWEA 2M9MA 2F8SA 4CR6A 5AESA 3X1YA 3RWBA 1G8GA 2R2AA 4B8YA 5GZ1A 1P4HA 4LDJA 3D02A 1JVNA 4NBNA 4G5FA 2DT8A 3ECCA 3O3NB 5AM1A 3EHEA 3VRHA 1C3JA 1CPYA 1QJCA 5FBHA 1L4GA 1E2UA 4A0RA 3UXYA 4G67A 3I3OA 2FK2A 3Q2OA 4B6OA 5KT7A 3SM3A 3E9ZA 4LGVA 3ZNPA 5F7XA 3PI7A 3EVEA 4RKYA 4GWLA 2XW6A 5AM5A 4WFKA 121PA 4AZ0B 2C82A 2F6RA 4V0SA 1RWXA 2J45A 4DJEC 3LMLA 1UZMA 3IUSA 4DJFC 1TMKA 3VNUA 4IH9A 3DCJA 2G9QA 4B6SA 2BHSA 3A27A 2IDZA 1P5FA 2O3SA 1S8FA 2QQEA 1NV8A 1W88A 2VPIA 3PNMA 5BWWA 3TIXB 1PJAA 4MRRA 1IBCA 5KJFA 3T1TA 4TVOA 1SXPA 5TT0A 2OZKA 1QHEA 1OBDA 3K16A 1I8TA 1X8LA 2ISQA 4CL3A 3MLBA 1FYVA 2IYQA 5LIPA 1HEUA 1VCOA 3TLJA 5KFYA 4Q3KA 4H7PA 3FTPA 1Y63A 1M5UA 4NYIQ 3BCUA 3ZHSA 4IF6A 1HORA 1Z5ZA 1U0HC 4M0EA 4TZ6A 4MVJA 1WW2A 3GO4A 1IZ7A 3JRNA 3LUFA 2WU8A 2WM8A 3DH0A 3UA3A 5SYAA 1VG0B 4IMPA 2FUEA 2Q8PA 2VP5A 2AFIA 2ZUUA 3DSRA 4NQRA 2WY2D 2Q8QA 1O1YA 3DE7X 4B3RB 4US2R 2WOOA 2HJSA 1KI6A 4DCTA 3VSAA 3C3KA 1WW3A 3D6HA 1XN4A 3L6DA 1X1QA 5FOWA 3SFVA 4YH1A 2VRNA 1N2HA 2A9JA 3HPRA 1NAHA 4A8JC 3OEED 1BDMA 2I4TA 1W19A 1W96A 3WIUA 2ZSEA 3D4IA 4DC0A 2WKRA 1H3FA 2NQTA 3BXPA 5MGNA 3K9GA 3GRCA 2E2IA 4L02A 2A14A 3Q3HA 2J0EA 4RXUA 5KWSA 3RG2A 4JI5H 4L3WA 4G8CA 4P4NA 3NUAA 3V3TA 3E0QA 4URYR 3TE6A 5LBTA 3RS5A 4B3IA 1XXHB 1LVHA 2R84A 4OQ4A 2XITA 4G8DA 4JEMA 1D03A 4C88A 1K3UB 2JJ2D 1N5RA 3CX8A 3OLCX 3FZYA 3QJGA 1VYHA 4DGQA 4ED6A 5AJTA 1U1IA 1Y89A 3PJFA 3QNUA 3T5CA 4M0JA 3PQDA 4H35A 3DMTA 2PUVA 2FUG1 1Z2NX 1HFKA 5FI1B 1SKMA 1B16A 1Z29A 2PXHA 4OQFA 5CCDA 4Q82A 3K9QO 2VYNA 3OQNA 1T9GR 1N0VC 3HO6A 3DLHA 1DVRA 3FMPB 3FHCB 3SN6A 3EG5A 2CW7A 1JNXX 3O4JA 5IKPA 4UUBA 1SXJD 3FFAA 4F7WA 2Z5LA 3IBYA 2AF4C 3NIFB 1JG3A 4YPFA 2IP1A 3SQMA 3UBMA 2YVLA 4Q4AB 1FFSA 1K8RA 2KB0A 1GD1O 2NZVG 2QTLA 2R6CA 2GQRA 3TJMA 4KQGA 1I50A 5C3EG 2UUPA 3H13A 1YAJA 3W5HA 3RC9A 1YKSA 2GJ9A 2J87A 2ZYAA 1ZUWA 4OAOA 2MINB 3D0QA 2J08A 5DM4A 1A0GA 1SULA 1KKLA 1W4AA 2FRXA 3CZ9A 4RE6A 1NRWA 4Y2JA 1I4WA 4E3WA 1YDWA 4EWLA 3C39A 6YASA 4GWKA 2VP9A 4MPDA 2C99A 4IV0A 4N3CA 4Q1VA 1EUDA 2Q5CA 5KQRA 2KHZA 3QYJA 1KSFX 3A58B 2YKGA 3G8DA 2G06A 1OJLA 3S8YA 3NWJA 5CT4A 5I7HA 4NWIA 4JLPA 1UDWA 5KWIA 3VPXA 2Y8EA 4K26A 1Z56C 5GAJA 3DMPA 3PV0A 4HQNA 2PMZA 2WU1A 1SHUX 3TBHA 1IBMH 4QWDA 4HEA6 1C4OA 4BRUA 2AN5A 2AOXA 1C50A 3H0KA 5IAOA 3OICA 3PFNA 2I2AA 1I4DD 3WADA 5DNYB 2RK3A 4OP2A 3CZ5A 3K8QA 3WYCA 3GAFA 1JXMA 3SC2B 1QU2A 3NC0B 1JSCA 4HTFB 1WHSB 2PJZA 4PLWA 4RW0A 1XRJA 4EKIA 5FI5A 3GLGB 5AVYA 5IAGA 3SHQA 4WD3A 1I6LA 3P2KA 3KLPX 2ATVA 5HIMA 3Q2IA 2ZJAA 3PU6A 4JHLA 3L82B 2QTWB 4ZCLA 5KNCA 3LQYA 3DAYA 3UZUA 4ZVNA 1SZCA 5E95A 1V71A 1S3SA 1KE2A 2OGWA 4Q7JB 2QEQA 4EHJA 1E3MA 3H9GA 2XCTB 4WY2A 1U5BB 3BMNB 3KYIB 1W5EA 1RU3A 5BORA 3AGPA 1GNVA 4O83A 2Z8XA 2AJDA 4OXIA 2O7VA 3AESB 2WV9A 5H68A 1SPXA 2DTXA 3AUXA 1KTVA 4CM6A 4GQAA 4IJKA 3D59A 2AWNA 3D8SA 1FRZA 4PLHA 4QRDA 2FCAA 4PZ9A 1A7KA 2RC6A 3BMCB 2H1WA 4UU0A 1H22A 1SNYA 1TZBA 1CIJA 3M6WA 1Q5PA 1USIA 1VQ1A 2PXCA 4M9UA 3H2KA 4ITRC 1KS9A 3O9VA 2HEIA 2BMJA 1P45A 2A1TS 3QUAA 4B3XA 3EXG1 4OG2A 4QYXA 3PC4A 3AHFA 4FQ8A 1CULC 4WZBB 1PW5A 4DZZA 2NAFA 3NYQA 1VE9A 3DL7A 2O3UA 3WAJA 2VDRB 1PP4A 1M0WA 5KTKA 3ORHA 3NPMA 4MQEB 3I30X 1E1CA 5JCOA 3WNVA 2B8JA 3V33A 4AURA 4FHFA 1BKYA 4Z53A 3HCAA 5E4JA 3UANA 2P4EA 1Z6TA 2DY1A 4KDRA 5AOCA 3WK8A 1NUUA 1V4YA 2VSXA 3L0CA 1KEVA 3C6KA 3NHKA 1R1DA 1T5OA 1DELA 4EKDA 5EQJB 3TNJA 2EF0A 2DPXA 4RM3A 4NC9A 4C7KA 4CM3A 2RHBA 4OXQA 5C3UA 1S68A 4WN3A 3P2IA 2QYOA 5BWVA 1E1NA 4RKQA 2LDXA 1JQ3A 3VISA 4WW0A 1S1CA 2TYSB 2Y1XA 2OV3A 1WRVA 4U7PB 3FPHA 4MQ5A 3T3MB 1A2BA 1ULBA 2QGZA 2DUUA 1VGQA 4L73A 4MUYA 3U4MA 3HRIA 3A9CA 5AVTA 4TZTA 4ZI7F 1BVYF 1E3QA 3I2GA 3GEDA 3IT3A 5EXTA 3LCMA 1P1RA 5A0VA 3SJ7A 4ZVOA 5HM6A 3WL4A 2D8AA 3QUCA 4DMGA 2X3UA 2I7DA 2CFSA 4B6GA 1NLFA 4PNEA 4XQ0A 3I6YA 3AB7A 2XUOA 3P9PA 4IR9A 4L6CA 5FPOA 3K05A 5H3HA 3RVRA 1QF9A 3R24A 3UUFA 5GGYA 4H6WA 1WUTA 1EX1A 4RX1A 2VHXA 2AC4A 2BSQA 2UDPA 2GRJA 5F9MA 5KVSA 4EZIA 4P54A 3QELA 5BVHB 1OI3A 3UXEA 1XV5A 2PRKA 3F9IA 1GGVA 3D1VA 2CEKA 4D80A 4ECWA 3R7WA 1IOLA 3TR0A 5I47A 1ZVQA 4BDTA 3W7BA 1Z28A 2QN1A 5CNKA 4UTOA 3JWHA 1BZYA 5HTKA 3FMGA 4LOKA 3ZNNA 4MGEA 2FLLA 3OOHA 1GZVA 1YS2X 2I9PA 1Q44A 4LWPA 1RYRA 2W2OA 4DHEA 1W8DA 2R5FA 4DNFA 2XD9A 2W70A 1DBSA 5A1JA 2OM2A 2ZB3A 4EVSA 4GI7A 5JPCA 4C7XA 4MLZA 3QBDA 1P8AA 1RXWA 4L4XA 3Q8WA 4JFRA 1GQRA 2VT7A 3WOHA 1ISSA 1M2HA 4A2PA 2DHEA 4ZEMA 1KMQA 2XGGA 1GPKA 5DNUA 4D8UA 4DQNA 4ZV4A 2HLDD 1NN3A 2RMKA 2AOTA 3HYLA 2AUNA 1ORRA 3U37A 4ED8A 3EXHC 2EZ8A 2VDUE 4LYEA 1TDJA 2JFWA 2D0IA 4KQKA 2A0UA 3C48A 2OQ2A 4YAKB 3PNYA 2ZXUA 1GLVA 4MKIA 1KJYA 2JAOA 4KU4A 2LWIA 2HWXA 1K92A 4OO3A 2PVPA 3SDSA 1WBBA 2HA6A 3B12A 5JZBA 1JPUA 1OT3A 3C0KA 2NVUA 1ZI8A 4UBIA 2X77A 1MC1A 4ZAZA 2P2NA 1Y4DE 2F62A 1MX3A 2P6MA 1D6JA 5M5BA 3GA7A 5CAEB 2I67A 3GBVA 4GEKA 3GTMA 4Q3AA 2FB9A 4I5IA 4OQMA 1DBVO 1XZNA 4PYIA 5KFPA 4YRAA 2FEWB 1YK1A 1S3GA 2QJOA 1KVUA 3HWRA 1I4LD 2ACWA 1NSTA 1NRJB 2ID8A 4KDCA 2ZIUB 1FVIA 2B63A 3NTLA 2NXJA 3KHGA 4GVLA 4GC9A 1XZMA 4UMDA 3CUEF 2F2TA 4CTKA 1FLNA 3I5XA 3OF5A 1RFGE 4ZYYA 4OLHA 1CUDA 1NUQA 1L5GB 5CB4B 5J4KA 3FB4A 5IT0A 3IRUA 1Y3IA 2DTDA 3PDUA 1FS5A 3IEVA 1KMHB 1MAAA 1E9VA 4B3TB 3BD6A 3FPAA 4F1KA 4CKXA 3ZVKA 2VNKA 1A8PA 4LOLA 3PA6A 2BGNA 2HIGA 1CJVC 4IJMA 4DJDC 1KIMA 4NCXA 3VR4D 3HEMA 3RBXA 2PSHA 3RJMA 5D3QA 2J4CA 4NBRA 1QYWA 1IHPA 3WLEA 2AVNA 4TSRA 4LXXA 4ZO4A 4CR8A 3GUUA 2Y27A 3D7RA 5JSUA 4R68A 4K1LA 4D0NA 4DBZA 2HFKA 3REQB 4TX1A 1NFQA 4JY7A 4HGRA 1NW3A 1O4VA 1RJQA 1KI8A 1IRXA 2O0KA 3LNTA 5K6TA 4JYBA 1QTNA 4LF4H 4M98A 1MORA 4YPOA 3BMOA 3K0EA 2V7TA 3GCZA 1EE1A 1E3SA 4PFJA 5FRDA 1JWLA 3GPBA 4X9XA 2ZB8A 4HAIA 1RPNA 2Y0CA 3K9WA 2OCBA 4P1ZA 5KOIA 2FOXA 5A0FA 3BJYA 4L27A 5G0UA 1OXMA 4IJWA 2IIBA 3OHBA 1MNQA 5F52A 3TDKA 5IYZA 5CA0F 2XRMA 3L7IA 2X7JA 2C3UA 2FK7A 2C2YA 1G42A 2V96A 3QZ7A 5FKJA 3LAWA 2YDXA 1XROA 5AOVA 4LSGA 2W6CX 2X4DA 3I6QA 1DJPA 1ZNYA 5ILGA 2XJ9A 4NY1A 4B3MB 4TZKA 3UFBA 3P0JA 3ZHXA 1AMOA 3KJEA 5JPDA 5JCJA 1L7OA 3ILYA 2JGAA 5AVKA 3WJ7A 4DV1B 3HI4A 1FDUA 2L18A 5J40A 2X2PA 3AJEA 3EVFA 3KKNA 1KFKB 4QPNA 1JI3A 4HS4A 1RCUA 2A0FA 5AKLA 4ZT6A 4FEYA 4MS3A 5CLGA 5AQEA 2C35B 4ZYUA 1CY2A 4XE5A 4IHQA 5TMBA 5KU1A 2FR1A 3BIOA 4IIXA 4YMWA 4KWCA 4S2EA 2VYVD 1HYGA 4EKNB 3FYHA 1P7VA 2C5EA 1HMYA 1QE3A 3PB3A 4GZMA 4F7DA 1B41A 1JHQA 1I2KA 5E9JA 5KS8A 3ETHA 4GIBA 1EVEA 2DM6A 2I29A 1FVXA 4ZQFA 3HJUA 1SFRA 5TNXA 5KSPA 2ZYHA 4KRFA 2PWZA 3T54A 2VHZA 3MMXA 1A04A 3M9LA 3ZY2A 2H2HA 4EG8A 3WDKA 2RGYA 5CDFA 4RO0A 1T13A 3AEUA 1KK1A 2WJGA 4CTMA 2SKDA 5LMCA 3PW2A 5H02A 3D4NA 3ZJTA 3RABA 2P4SA 3IAHA 1AVTA 3HCRA 1QH8A 3PDCA 4J4TA 4ND3A 4QXMA 3VUFA 4MYHA 1E2PA 2GK3A 4CCYA 5KDOA 1QX3A 4E30A 4LHYA 4N1AA 2CFTA 4EUFA 1GVHA 1QG6A 4F86A 2DJIA 1U8AA 1C41A 3MTIA 4KN5A 5DNEA 2C96A 4FKMA 5BSGA 3WLIA 1QNLA 1UM9B 3W7AA 2PZKA 3QUQA 2XMGA 3KJIA 3SCZA 3CLSC 2Y93A 2ZE7A 3VC1A 4B48A 3NX4A 1NR5A 5DLEA 2MIIA 3WLFA 5DGBA 3IUQA 2PX8A 5I48A 3QSGA 2WOJA 1RLIA 4QYTA 1E79D 3PNSA 3FNRA 3JQDA 2HHAA 2ZT8A 4PZCA 2IEBA 5EE9A 3T7EA 3ZW9A 5B30A 4L78A 2LCIA 2VNSA 4ZEXA 1P8JA 5CXUA 3B1FA 4BRWA 4LNUA 2D0PB 1OROA 2ZJZA 2R65A 2QHXA 4MLDA 1L4HA 3KXPA 2XQKA 3UCEA 4RIHA 4TMYA 3KS9A 1SG9A 3CN9A 4ISCA 1RPTA 2O1EA 4YRNA 1P6QA 3B89A 3N5KA 1P5RA 4HWOA 1P16A 4K6GA 4LC1A 1FFEA 2H2WA 4KXLA 2HQBA 4AQ7A 2JIZD 4Q0YA 1V3UA 2ECKA 4ISBA 1EZ1A 3ETLA 3GHYA 1N8KA 2VWHA 1P18A 4XWKA 1J90A 4AK9A 4QT4A 3IA2A 4J49A 1DL5A 5F9FA 3LO8A 3DOUA 3NHUA 1LDEA 1NTRA 3GLHA 3U3XA 1E8MA 3T3IA 1UBNA 5AW3A 3L0DA 2I2DA 1JEJA 1PSZA 3NCHA 4PRKA 2C9YA 1EKPA 5DSXA 3K5PA 4KGXA 1ADFA 4IVRA 4AS3A 1G7RA 2JDIA 1A7JA 2QG9A 3VR2D 3TZ6A 3R6LA 3QHAA 4QE3A 3PUZA 3VXKA 2PZFA 2RD2A 5JDIA 4W1PA 3PZBA 1L4UA 3EAQA 2G1JA 4JX8A 4ROSA 5I4BA 1D1QA 2IUFA 1AHHA 2QUZA 3PW0A 3AIIA 1MB3A 2H7VA 1PFUA 1LPMA 1RBZA 3IUPA 4TGLA 1ZGHA 3LVFO 2FMXA 1Z22A 4Y2TA 3K3PA 4JVLA 1YSCA 2TRSB 5BNZA 4CRWB 4RUKA 1P1BA 1D5WA 1G5RA 2Z98A 1SOWA 3WDLA 1JG7A 4ROTA 1NI4B 3DW1X 4WZZA 5EP4A 1KY5A 1LBSA 1L7XA 3ETJA 1V4BA 1JYFA 4WLOA 1QQ6A 2Q9BA 5L7YA 5ADWA 3SR4A 1QZXA 1E0JA 3VR6A 2ATLA 1RWOA 1HKUA 1IVSA 2WLSA 4PANA 5FF9A 5F9LA 3K7EA 3H2SA 4E21A 5BN4B 1COZA 4ES6A 4BU0A 1TJ5A 1MO5A 3W2IA 1QG0A 4EJ0A 4UXIA 5LNK6 1UPBA 3CKMA 1W0KA 4U63A 1HKHA 5FR1A 4C2MA 5JSZA 5DHRA 5TC4A 3DUFB 1MC4A 4RGVA 2GHTA 3ADCA 1JHZA 2ZRNA 4D4HA 4MTLA 3I12A 1ADJA 4WA8A 3QF7A 1WTAA 3PXAA 2FZKA 2MT9A 3OZXA