2R85A

Crystal structure of purp from pyrococcus furiosus complexed with amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
334
structure length
330
Chain Sequence
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 108
structure length 330
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r85A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r85A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r85A01
4FFNA 3KALA 4YAKB 4MV6A 4TV9F 3QFFA 4MV1A 1UC9A 2FPIB 4YJ3F 5LXTF 1T36A 3WNZA 4FE2A 2YL2A 1BXRA 5IYZF 5EZYF 4O84A 1B6SA 3MJFA 4WD3A 3I12A 2R82A 3ORQA 1Z2NX 3R5HA 3VPDA 3BG5A 4M98A 3JRWA 2VR1A 2FPGB 1I7LA 1Z2OX 3DF7A 2NPOA 4O7TA 4XZ3B 1E4EB 3KAJA 2YZMA 4EGQA 2P0AA 2NUAB 3TQTA 4L1KA 2CNQA 3LP8A 5C8YF 1KJQA 1A9XA 3V4ZA 2FB9A 2DIKA 4MA0A 5HV6A 3HB9A 2HGSA 2OLSA 3TIIA 2VPQA 4MA5A 5JVLA 4MAMA 3BSSA 4O7VA 1JLLB 3OUZA 4J6EA 4I55F 3GLKA 4FFRA 3Q2OA 4O2AF 4HNUA 4YAJB 4ZHQF 5J2TF 3WO0A 2YZNA 2C00A 3KREA 2PVPA 1KJ9A 1GSHA 1GSOA 2HJWA 4IWXA 4HNVA 3N6RA 2W6ZA 1CE8A 2R7KA 2R6FA 1ULZA 1PX2A 2X0SA 2I87A 3BSWA 4ZOLF 2CNVA 2DWCA 4MV8A 3TINA 4FFLA 1GLVA 2R85A 1AUVA 4XYMB 1DV2A 3KAKA 5J2UF 2QK4A 2QF7A 1KJ8A 4HQ6A 4EA8A 1CQJB 4YB8B 3JZIA 4XX0B 2SCUB 2J9GA 2W70A 3WO1A 3R9RA 1KEEA 1JDBB 1VBHA 4M99A 1VBGA 3K3PA 2YS6A 1GSAA 2R7MA 4FGRA 5D8DA 1EUDB 1C3OA 1KJIA 2GPWA 3ETJA 4MV9A 2YRXA 4E4TA 2PN1A 1EYZA 4YBZB 1BNCA 4O4LF 4O83A 5CA0F 2V5AA 3RV4A 2YW2A 3G8CA 2VHEA 4FFPA 2GLTA 1OBGA 4O86A 4EGJA 5BPHA 4O7NA 4IHJF 5LA6F 1C30A 4O4HF 3SE7A 4O7YA 2WYOA 4DLKA 2FPPB 3ORRA 2GPSA 4WBNF 2GQRA 1KJJA 3JRXA 4EAAA 3VMMA 1KBLA 4TUYF 1B6RA 4O7LA 2ZDGA 4I50F 5BMVF 2CQYA 2DLNA 3ETHA 3VPBA 1IOVA 3R5XA 1M0TA 3K5IA 4ME6A 2I80A 5H80A 4O4JF 4O2BF 3Q1KA 1VKZA 5C1OA 3UFXB 3BFPA 2NU6B 4IWYA 3TW6A 1IOWA 3AW8A 4HR7A 4IIJF 4C5CA 5LOVF 2YZLA 4I4TF 5CB4F 5JH7F 5FNVF 4DIMA 3MWDA 4ZI7F 4TV8F 1AUXA 3N8DA 4M9UA 5I47A 1PK8A 4FFMA 1WR2A 4EA7A 2ZDQA 4O7WA 2NU8B 3GIDA 3LWBA 1GGOA 3R23A 4O7SA 1EUCB 4GGMX 1DV1A 4MV4A 4C5BA 1M0WA 2V58A 1UC8A 1KUTA 4FFOA 2W71A 4MV7A 2NU9B 4Y8VB 4FU0A 3R5FA 1OBDA 4O7ZA 3RV3A 3RFCA 3V4SA 5CAEB 4IZOA 2CZGA 5JQGF 1CS0A 2GQSA 1Z2PX 3U9SA 4C5AA 3VOTA 5KKNB 3VPCA 5JVDF 2FP4B 2VQDA 3U9TA 3K5HA 3JZFA 1JKJB 4XYLB 5BPFA 5LYJF 2I8CA 4HNTA 2YS7A 4M9CA 4O81A 5DMXA 4EG0A 3E5NA 4RZQA 5KX5F 5GONF 1JDEA 3HO8A 4YJ2F 1E4EA 1SCUB 2YYAA 3NUAA 2YZGA 2R7NA 1CQIB 1EZ1A 4O82A 2W6PA 4MV3A 1A48A 3RUPA 3VA7A 2IP4A 2W6QA 4QSHA 3G8DA 2ZDHA 1I7NA 2W6OA 1W93A 5C1PA 2XD4A 3U55A 1W96A 2Z02A 4EABA 4ZQIA 2YWVA 2YRWA 4O7RA 2CNUA 3OUUA 5CA1F 2XCLA 5K2MA 2Z04A 3U54A 3MWEA 4NYEA 2V59A 2R86A 2W6NA 4EA9A 2R87A 2W6MA 5LP6F 4O4IF 3AX6A 3HBLA 2NU7B 1KC7A 5JQWA 2PBZA 5HBRB 2DZDA 1M6VA 3TIGA 2R84A 1EHIA 3BSYA 1DIKA 2R7LA
chains in the Genus database with same CATH superfamily
4HPJB 4P33A 3AETA 5SZIA 2CDNA 4YTEA 2NUPB 3N39C 5D5HA 4N0MA 1JA0A 4D82A 5BVGB 1JKFA 3RGXA 1JNYA 2DUWA 3I04A 4BAGA 2JH8A 2VH1A 1BGXT 3EEFA 2GGSA 2XJ9A 1HNZH 3NEYA 1YR2A 1TM3E 1E7WA 3AF2A 3COYA 4QPCA 3SF8A 3BAZA 3K16A 1OLUB 2E4XA 4Z1OA 3EGDA 1XMOB 4RSRA 1L4NA 1ENYA 2FK1A 2JIDA 1GG5A 2O05A 1EB8A 4AD8A 5BRNA 2H7XA 1GV1A 2H4FA 3F9CA 4F4CA 1NDHA 2CEKA 1YTLA 4YVFA 4QT4A 2VSFA 4QQKA 2R93A 4XUCA 3OFND 1MTOA 4BZPA 3HADA 2PGIA 1QH1A 3CO5A 4RX1A 2LPMA 3CIFA 2PR7A 2IDZA 4ZZ2A 4NC9A 2UZIR 2XT0A 1GA6A 1UBFA 4MVJP 3LC0A 3CRVA 5E4TA 4K87A 2JA8G 3O4IA 4FXPA 1DOAA 4FMBB 4RNCA 3R5TA 3SZLA 2ZRDA 2O2CA 5CLGA 3ABIA 2W8LA 2BSQA 1YHYA 1WV0A 3CJRA 1HFEL 3COJA 2WG0A 3RBAA 5DH9A 3ZBUA 1KQ3A 1SIOA 1MA3A 5DLDA 4G0QA 3B3JA 5I5EA 1Z6PA 2IEDA 1JALA 3DDOA 1U7OA 5TR9A 2A57A 1C9EA 1YQDA 1HEIA 1K89A 2YS6A 2JA7A 2O5EA 3TM4A 1NG9A 2ZBVA 3LC1O 3NU1A 2SICE 4BC1A 4WXRA 2Z95A 3RS9A 1UAAA 2ONZA 3LUGA 1DUIA 4NDAA 1PGJA 1D2GA 1AZTA 1E6CA 1RXSA 4PC3A 2QLNA 4GLJA 4UMFA 1R0KA 3BL6A 4IEEA 3QVGA 1SVKA 1PUIA 4ISCA 2EKPA 4YMWA 5ALFA 3WHKA 1DQNA 4IXDA 4KXUA 4OSEA 3R44A 3DT8A 2I4IA 1ZUNB 5BWXA 1GDDA 4AY4A 1MN6A 3UF0A 421PA 1O5OA 1VOTA 1N48A 5K51A 1XXLA 3RTXA 4D46A 5IKMA 1VKZA 1CUSA 5TARA 3NP9A 2JGFA 1QMGA 3SC3A 4NJEB 3IOEA 3WMEA 2BCEA 3G8AA 3LO8A 4QOSA 4XWAA 4IF6A 4F12A 5CB8A 1ILWA 3EEYA 4YRNA 1IUOA 4DL2A 4KXFB 4TZTA 4EA7A 4HLUC 4PR3A 3R77A 3HS3A 3R6LA 2C78A 5FLYA 4WJLA 4JI3B 4FKZA 4A8JC 2WAQE 2V7QD 1OKKD 4CLEA 4C0QC 4FK8A 3SYRA 3QWHA 4J9SA 2RK4A 4P3YA 2EFJA 3RC9A 3ZQUA 4AS2A 3TZQA 4OBXA 2H54A 1XTSA 2OGWA 1NM5A 3K0SA 2HMYB 3OAAA 4QXOA 2QRPA 1K97A 2Y66A 1TC2A 4LPKA 1Z3CA 4RVFA 3VKWA 1MG0A 2IXAA 1EXNA 5EP4A 4K5QA 1IG0A 4R1UA 3SEAA 2D0IA 2UVUA 5BSVA 3A1TA 3BA8A 4G2NA 2ZRMA 1HR0B 3BD8A 1O87A 3TCKA 1VE6A 1PR6A 4JP3A 3PR2B 2HXSA 4JLNA 3IIKA 3TBHA 3DWEX 3PFWO 4LQDA 5EEGA 4MCJA 4MNTA 2NOAA 2DPHA 2P5SA 1LX7A 5KFWA 2JGDB 3ZJYA 4ZI5A 3THWA 5EDWA 5JVDB 4BN5A 3VHLB 1E2EA 2ZI9A 2AQ8A 3LQFA 1WKCA 1PFGA 4ND6A 4GM4A 1N2OA 1RRFA 3AL0C 3AF5A 2HT6A 2Z5VA 2GPAA 3NBAA 2VUSA 5KG4A 3PGVA 3CXUA 3PXEA 1QHGA 1USVA 5KJ1A 2DHRA 3LK7A 4JVOA 4UW9A 1I1MA 1GYFA 3EH1A 4RFSA 3OT1A 3G9UA 3OA2A 2G6BA 2ZGIA 5FQOA 4HEA1 4DMCA 3QZ8A 5F7XA 2P11A 5JXHA 1I7QB 1JWLA 2YV2A 4J2TA 4GXRA 3H13A 2R8GA 3DFMA 5HE8A 2VJLA 1Z45A 2NSHA 3RJZA 3KPWA 3K6SB 5AYVA 2ZS8A 1Q1AA 1AD2A 2Q5LA 4EEYA 3WGNA 2F2TA 5K7SA 3E7DA 1ATZA 5KG2A 5F3WB 4KL8S 3SGIA 1V5EA 3GEBA 2WZQA 2BR4A 4N3GA 5CXQA 1KQGA 1JLLB 1XQWA 1I9GA 4YCLA 1JILA 1ZI6A 4G07A 3LY8A 2J3QA 2GN1A 1JE1A 3LWNA 3TW0A 2FDCA 3EVCA 3K15A 2I2BA 4U0JA 1JQ3A 4PHTA 2ZSUA 3UGKA 3F46A 3MINA 4CWAA 3P9PA 3FZQA 4X65H 1JLHA 1NBMA 1MX1A 1Z4KA 4IPTA 4C4RA 4YP6A 2EJ0A 5IAGA 4YROA 1SEIA 3N2EA 3GTLA 3MSXA 1R12A 1NNEA 3SJCA 4JA2A 4G5OA 2VUTA 3UOAB 3GVXA 4ECZA 2XPCA 3WLOA 2YV3A 5EP3A 3I52A 3GFQA 4BV8A 1WDLA 3HCCA 3QEBZ 4INOA 1FP4A 2XD9A 3GEGA 1EDBA 3NHSA 3UWPA 3JWHA 1BSVA 5ELMA 2CEAA 1CETA 3VR2A 4NOKA 4MIOA 5LR6A 4ZCQA 1P3Y1 1F6DA 3I2FA 4M22A 2RHMA 1GUBA 3ESCA 2NU9A 3OIGA 3V1MA 4ZO8A 1T3LA 1CNFA 5KTRA 1MKYA 1ZC4A 3MMNA 4ZOQI 3AFHA 3D7MA 3W5CA 3IEXA 4UPDA 2HQ1A 4B87A 3TY9A 1U3FA 3I5AA 4O4JA 1FYEA 4EKEA 3PU6A 1FQWA 4IKOA 2V65A 3CWQA 2DPIA 3RS3A 4OKIA 1EDEA 3EVFA 3PC4A 4IDGA 2RDIA 4OGGA 2CXUA 1XX6A 1YB7A 4O7LA 5HBGA 1K6JA 1XMQH 1C3EA 2ZAIA 5DK6A 1VC2A 4W4TA 5FH9A 5L3SB 4L4RA 1PVDA 6REQA 1J9ZA 3B3QA 3BCHA 5C1OA 2Y1CA 3GI1A 2BKXA 3QX7A 5A3RA 1QP4A 2GZMA 1PN3A 1UQRA 3FPJA 3UN1A 4B2PA 1OZHA 3DUFB 2XUGA 3F90A 3IHKA 9ABPA 2UKDA 2HMWA 4WEOA 2Q49A 2G67A 5D3KA 4H0CA 3N75A 4GXQA 1L5HB 1G8PA 1ADCA 5AHXA 4DMLA 2OAEA 3JASA 3G49A 5J59A 2PX6A 4UU7A 4AXBA 2ASLA 5ITZA 1MB2A 1ZD2P 5EZ5A 3SHWA 1P6UA 3DL0A 1PNOA 1FRFS 5EMNA 2ZSFA 2GH1A 5FBLB 3QE4A 1JXOA 4OQ4A 3FYUA 3I64A 4U0KA 2QAGB 1VBKA 4U5XA 2O8DA 3HCFA 1I94B 4TMZA 4UMVA 1E4FT 4ZAGA 4OHVA 4PTLA 4N5IX 3LKVA 3IP6A 4AUEA 4NFHA 4DR5H 4C0KA 1G6HA 3DE2X 4B7CA 4F72A 4LC9A 5TB5A 3RODA 3HCWA 3HABA 1Y81A 1GCAA 3GJRA 1HC7A 3LY7A 1BEEA 4RJTA 3W9SA 1DRWA 3LDGA 4AYXA 1E69A 1N78A 2BHSA 3GC6A 1RYHA 4S3MA 3MWKA 3U1VA 4OTZA 2GCOA 4F4DA 1Z38A 1ZH8A 4A93G 4HUQA 4EHHA 4W1QA 5L9AA 3STYA 5CA1F 4PBSA 3PO3G 1SOWA 4BC0A 5JADA 3PEYA 3R40A 2FUNB 1DAPA 1O97D 3B6ZA 3WB2A 1JWBB 2GXSA 1NU6A 2HJRA 3WYBA 2XB8A 3SC2A 3PFGA 3KTOA 1AB6A 3TTXA 5DM1A 4OGFA 3FCEA 4KCGA 1MV5A 3R6TA 1YDGA 1LS6A 1KDOA 3KVYA 3DM5A 3VDMA 3WL8A 2OPHA 4JMLA 4BN4A 1J9EA 3ADOA 4UCVA 1MB4A 4E6EA 1D7OA 2JARA 1COWA 4KLZA 2O8NA 1U2EA 4AC9A 1JEOA 4O0MA 2CFOA 4PSUA 5JS8A 3N5CA 3Q8LA 2AJTA 5KTTA 3EPRA 3OWHA 1Y5LA 1N2ZA 3ZHTA 3ZDQA 3SX0A 2B8EA 4EFLA 3GLFA 3OY7A 4Y98A 3F8TA 3BBPA 1GSHA 1V6CA 4NCHA 3EXIA 2J09A 4YT2A 3RIGA 3NVMB 3EWAA 2QY9A 1JMVA 4GSLA 2VJMB 1K88A 1ZVQA 1CU1A 4CHGA 4CM4B 2GI4A 3IVRA 3P0EA 5IJWA 3NGDA 2X0SA 2A1IA 5REQB 3FWPA 4QNNA 1E3EA 2YXDA 4PRKA 4BMCA 2H5JA 3BRSA 2COKA 2Z1DA 1W6UA 2CVQA 1KYZA 1FX0B 1A69A 1RLUA 5LMNH 4YYZA 4TTSA 5BW4A 1CY7A 1KJZA 1J5PA 3GYBA 4B6SA 1WMFA 1K0UA 4NSNA 3ZWPA 5ALYA 3WWOA 4CMIA 1R0RE 1G5PA 3R2JA 1GPDG 2FR0A 2EJCA 1WCWA 3KJXA 4DJ5X 3C3YA 4TVIA 5SV2A 4OQEA 4JV5H 1UJ2A 1J8YF 3WWHA 4HNRA 2PGJA 2O8VA 4YMUA 5KJEA 4EATA 4G0VA 2Y9PB 3B9QA 1AHIA 3P26A 1QGDA 4BZXA 2HIGA 4URWR 2O57A 2DSNA 1ZCZA 4DC1A 4M7OA 4D0SA 4YCCA 5F9FA 1RZRA 3M1LA 2GNPA 4KXQA 1O58A 2ZRCA 3FAZA 4OP3A 3WGLA 3L7KA 3ELDA 1RXUA 2J07A 5HCNA 3UPTA 3U7IA 4W9MC 3KQMA 16PKA 1TUEA 1L5FA 3ROKA 3N70A 3RU3A 4UEWA 2JC3A 3QKIA 3TG8A 4ZVVA 2WE8A 3GDWA 3TECE 2ZYGA 2PU7A 1GQYA 1K75A 5IBRA 5JBIA 2BGKA 2B7LA 3RVJA 3RR2A 3BB1A 2JS7A 4APMA 4EL0A 3CKKA 1UC8A 2PR2A 3P9XA 2DPGA 1GA4A 4R83A 2QSUA 3QEAZ 4FU0A 4UHBA 4L85A 2PQ2A 2FZLA 2CJPA 3L0DA 4RESA 3TLKA 1WO8A 4C6HA 4LKRA 4QWBA 2BFEA 5KB3A 3VH3A 5KKNB 1ETHA 4D3DA 1F2DA 2RFLA 1IJEA 4B9AA 1Z4PX 4BVLA 3HBMA 1I1NA 4V0OA 4HJXA 1T13A 2EJ3A 5FJ8G 1TCUA 1KYVA 4MULA 3Q7IA 1UODA 4EBDA 1N25A 1DBRA 1NASA 5K6TA 1YUMA 1IEQA 2FZVA 3RDPA 2HCJB 3UMVA 5KFCA 3ANLA 3TLGB 3NHAA 3V4PB 1D2RA 1Y3HA 3H87A 3RKSA 2FF5A 2GPYA 2NIPA 3RJ5A 1QUFA 3ONNA 3A32A 4Y1RB 3QBVA 4W9NC 4N8DA 1SVLA 3FHOA 2VJOA 1JHPA 3L8MA 1Z37A 1E7QA 1WZIA 3DV9A 4LMYA 1ZCFA 2N46A 5F73A 5LJLA 3Q98A 3O94A 2H8KA 1V8FA 2GBFA 3FCXA 1LCIA 5E4JA 3MJSA 1NXXA 3ETDA 5JXIA 1O6CA 4C0XA 5HHTA 1AQJA 3WK6A 4J6FA 4GGPA 2ZBDA 2IVZA 4KXYA 2ZUVA 1DBIA 3VI3B 1PDWA 3HG7A 1A5ZA 4MJXA 1EEXB 1OXKB 3E9EA 4Q4AB 2WAYA 2XX3A 4WRRA 4FFBA 3L8HA 2PL3A 1ZJ5A 5KYUB 1WD7A 4FEAA 1EK2A 2BFFB 1OPXA 3CZ4A 5GM1A 5AVZA 2EG9A 4TRRA 2H63A 1Z8DA 1ADJA 3MR3A 1OPRA 5T7BA 2VDUE 4CL0A 2QHXA 4G4SP 1XUOA 5DTEA 5FIUA 2G1KA 5KG5A 1OT5A 1CUCA 4BO7A 4LCJA 1SCQA 3NFYA 4RL4A 1Q57A 4AX4A 2I8AA 3NPMA 1T9ZA 1UJ6A 2HFKA 2HRRA 1KDVA 1IZYA 3ZVRA 2KSQA 3G13A 2I6GA 3O84A 4JL5A 3FUXA 2K6GA 1E6EA 3ZYZA 1I3CA 1TZ2A 1QNFA 7REQB 4D9BA 1H5NA 5HKAA 1VZ3A 4CFYA 1PEAA 4KN5A 2E1PA 1Q1EA 2RCYA 4OGWA 1NRIA 4DADA 5KU7A 4F8JA 4ZYVA 3TGPA 4FBMA 2NU6A 1P1HA 5ED4A 4B31A 1WNFA 1CIJA 4JJZA 3ITEA 4FZ5A 2I7DA 2MYTA 1S03G 1GU7A 5F5NA 1UEIA 1WZEA 1UNNC 5BUZA 3EY9A 2CCKA 1D07A 2QG9A 4WK0B 2ZG6A 4YK7A 2HWWA 2PD3A 3ON5A 4O2AA 4RD0A 3FWKA 4K6OA 5FAKA 3HKDA 3H4TA 1GTSA 2VA9A 2AOXA 2X0NA 1Q0LA 4X7BA 2VRCD 3UZUA 2F3UA 4JYPA 1VP9A 3GZTB 2H2WA 1MQ8B 3VDQA 2BOVA 4XWTA 4K03A 4E6PA 1AT1A 5BN5A 4ER5A 3B1YA 4KIUA 4KR6A 2J8ZA 2LNDA 3G2IA 2DULA 4OX9Y 4I50F 1TD9A 1Q7RA 2HBRA 3HN7A 4IYJA 4MVYA 1UEXC 3TOSA 5DCWA 2QQEA 3O4FA 3TB6A 3B70A 3DG9A 3INYA 4LWOA 1Y33E 4ICIA 4MQBA 3SDSA 2ZSHA 4W7HA 2YV1A 5E9JA 1JJFA 3G8BA 3R7FA 1JSCA 4MQFA 1VB5A 1E6MA 1LGYA 1LSOA 2OO5A 1KO1A 1BGWA 3B51X 4BS9A 4MCAA 3QUTA 5BWRA 2FQQA 3C3EA 1UOPA 1Z83A 3GFPA 2QTWB 4H31A 1TDJA 1Q1NA 1ZK2A 4EHDA 5D5PA 5CK4A 4CG1A 2H8GA 3C3XA 3LYUA 1AA6A 1W1WA 1OA0A 4B4UA 1GDHA 3D6HA 2CXHA 2FG6C 3LDHA 3DL2A 1E2QA 4MYRA 4QUGA 2HA3A 5IDYA 2W43A 2QTBA 2ZR7A 4F5DA 4LVNA 4DE5A 3QOXA 3UAZA 1E7YA 1H8ED 1LWNA 4A3DG 1MTZA 4GR5A 4B3RB 5F3DA 2PT9A 2ZM6B 1M67A 3C3DA 3VX3A 3R9WA 3I2GA 1XPOA 5DHUA 1K66A 1W35A 4AZ0A 1UM9A 2PQ0A 4KGZA 4W5QA 5FWXB 1S0NA 3HACA 4MVJE 3PTAA 1ZA2A 4F71A 1E2FA 2RH4A 1BDHA 2UYHA 3P0FA 3YASA 4NYEA 4YHHB 1KKUA 2C7VA 4EA9A 4LH7A 4QULA 2JHCA 1O6GA 5FTKA 3R8FA 2AXNA 5T6MA 1Z8HA 3NTLA 3CR7A 1L3CA 3GJTA 3ZGXA 1Q15A 2DPYA 1PJZA 4CKZA 4RNMA 1Y0BA 2XNJA 4UVHA 2FA9A 1P75A 4ZKEA 4Z51A 1N0WA 3OIUA 1QQ5A 4DLUA 1SQ0A 1U65A 4XX0A 3DOUA 2IUEA 4JC8A 5HILA 2SBTA 1R8XA 4IJVA 4ZHQA 5LQAA 3JU3A 1PRYA 3IO3A 3LP8A 4AY6A 4AKSA 3JALA 2AR9A 4YI3A 3Q9SA 5TGTA 4BKUA 1T0JB 2FDRA 2XZDA 2JANA 1XZEA 2H29A 3QE2A 3KJQA 5J4YA 1XJQA 1NP7A 4FYPA 2G0NA 5E9WA 2BIFA 3BE6A 2B61A 4LOIA 3LVBA 5JSKA 1TGYA 7GPBA 3DGFC 2IC5A 5KOJB 4FDUA 4MWGA 4HUTA 1X9GA 3UMYA 3VYWA 3MELA 4MR8A 1O3YA 3MLAA 6LDHA 2PXCA 5NLLA 1OAOC 1EU1A 4EF4A 5C5IA 4AJKA 2ZB2A 3AETB 1F06A 3EQ8A 4YRRA 3OLXA 2I71A 1BJKA 4PR0A 2HR1A 4DL7A 4A0RA 3N41B 2ZVQX 2AXQA 1YS4A 3FKSD 4K05A 4E5PA 1M76A 2QF7A 2B36A 1I4WA 4EA8A 3Q5DA 3GVCA 5SZHB 5KHLB 4YDRA 4P32A 1BFUA 3SF8B 3VR4A 4H6VA 3EGDB 2J31A 3EVBA 4Q3KA 4QWEA 1R5BA 3G0IA 3KTMA 1HI9A 5EJFA 3QA3E 3AEYA 2QZSA 3D7LA 3N53A 4QLOA 2FPWA 1OASA 2JLSA 3A2NA 3QYPA 1MO5A 3RV4A 1W25A 1X0XA 3WIUA 3ZZUA 2VAWA 2XUZA 1PR3A 2JIBA 5IC4A 5TT0A 1FFDA 1BTOA 1QH1B 4HEHA 2JA5A 5CH8A 2VT3A 4A0FA 3OUTA 2IW3A 3LJKA 1BEZA 5JJIA 1WEHA 4WA8A 2WSSA 3KVRA 2D74A 2PUAA 4GI7A 4XLTA 1OR8A 1AN7A 4HZUA 5DXAA 3SYKA 4E4RA 2FFJA 3OM0A 2Q99A 1E3MA 3W0LB 1GU0A 5TRTA 2BFDB 3EDRA 3I45A 1SA0A 4IDBA 4Q1AA 2FKLA 1BMTA 2WFAA 1IH8A 3DDNA 3KXIA 1ZD5A 3GRUA 3KZ1E 2AJCA 1E3DA 1KZ4A 3JYOA 4NFYA 2NNWB 1C0IA 4GZ5A 3D4BA 3LHDA 3GUZA 2VUMA 1R4MB 4PVDA 2C2DA 4BWYA 4RD4A 5LBTA 3R0VA 2O8EA 4PYLA 3UJCA 5JZBA 2FUG6 4QDZA 3HMKA 3QVKA 4NE7A 3H9BA 2REOA 1Y98A 4MVJD 1SC3A 2AVNA 3QVGB 2JFQA 4P3KA 4R6XA 4DZTA 5H4HA 4RK6A 2GAIA 5JO0A 1RWOA 2QT1A 1H2ZA 5AICA 4M9CA 1MR3F 3HWRA 5DDIP 4DCVA 4YASA 4PAOA 4IHKA 4RTNA 3RRJA 3O8QA 1V35A 1RRKA 5BQOA 3GLGE 5B3JA 3OKPA 2UUOA 4PNPA 2JGNA 2R66A 4BIIA 1PTKA 5GZ1A 4ZU6X 5JDCA 3FFBA 4Q02A 3CNLA 5ADWA 3ZOZA 2HU8A 4TZKA 3NETA 2C3MA 5BOSB 2CHGA 2V7PA 4WY5A 2BQRA 1DIOB 4OSPA 2XRZA 1ISHA 5L7TA 5L9XA 3KJGA 2IS1A 1FP1D 4XOUA 1NVDA 4BX8A 3W90A 3WG9A 4BMXA 1Z5OA 1QB7A 4LOHA 1OLOA 5DRYA 4R2HA 3OJFA 3P2EA 2WTNA 2XNKA 4HXYA 4X1KA 2A0UA 3PNSA 4JLPA 3SVTA 2XW6A 4IDDA 2Z5GA 1RWVA 1B42A 2Z2XA 1H6AA 4I1OA 3RGZA 3QU7A 1FUKA 3AP2A 4ETMA 1GT6A 4WZZA 3G1WA 1YAJA 3V7FA 2W9CA 1ZKMA 5LCXA 4YAGA 1XJ5A 4AIIA 4B4KA 4H3SA 5HV6A 3V1YA 1Z7GA 5EMMA 3U3RA 2QDXA 4GFDA 1NMXA 3A10A 1CRLA 4OL9A 5KQRA 2WC1A 1F4LA 2GN4A 1R3DA 3EYAA 1RE1A 1QVAA 2VQ6A 4HPXB 1ONBA 5ISMA 3K6KA 2R4UA 1E1YA 1MZBA 1DCKA 1DO8A 1B00A 4QHTA 3DFFA 3X1DA 4CXMA 3B12A 3A26A 4GKKH 2I6TA 1UK7A 2WUGA 1CKEA 3LDAA 1DEKA 4RFSB 3OT1B 4AULA 3A7DA 2DBZA 4OBBA 3H2ZA 4I0WB 4KYIB 2AE1A 1IOLA 4NJMA 1Q92A 3MFQA 5K3DA 3VOAA 3RVMA 1MO4A 2O23A 2JGMA 2VAVA 5LDDC 2WVGA 1J2RA 2YMMA 3VKUA 5HYVA 3H2IA 1T9GR 2OFWA 1D09A 1Z5ZA 1BX0A 3OU7A 1ZAKA 4LOJA 4BRUA 4DMKA 2ZJ4A 1HV8A 1PFWA 1WF3A 4Q1EA 4KDRA 1HQKA 3MC1A 3I4NG 1XCPA 4QX6A 1FCJA 2J7PA 2IV3A 3T6KA 3CCCA 1SFOA 4RGBA 3MINB 4TMVA 4OLAA 2ZRAA 1VHQA 4PEVA 2NMVA 4FI3F 2VP0A 2EARA 4EHKA 5HJ5A 3ZWXA 1WOYA 4OVKA 4P83A 1JHAA 4IW3B 3MTQA 5C7IO 1XAIA 4AYBA 2O3JA 1YD7A 5KG0A 3FGPA 4H7DA 3GG2A 3ANMA 1NMZA 3DP9A 1GKUB 3ZTTA 3Q8SB 3STVA 4XWKA 1E3SA 3O2JA 2B94A 3ET4A 2XXBA 3CLRC 1UT8A 4NU5A 5A2GA 2CBZA 1BCSA 5CBKA 2UYQA 1E3TA 4UPVA 3LUJA 1MRZA 1FP4B 2HCTA 5JJKA 4CI9A 3QFTA 4DHEA 4KVAA 2KS6A 2ZR9A 2H9AA 3T61A 1SQGA 1CUBA 3V2IA 2P6UA 1XVIA 4EI9A 1QLJA 4R05A 3PJDA 3SK0A 5I3ZA 5LQDA 3NS7A 2NU9B 2FKAA 3LIIA 3DO5A 4OGLA 3HOWG 3WWCA 2AF3C 3DB1A 1TI7A 1VDZA 1YZFA 3TX2A 5E95A 4LY6A 5DHRA 3M4NA 4O4JB 1H9BA 1Y3FE 5KNDA 5LYJF 3CLVA 3CZQA 2PYDA 2PO5A 1F2VA 3N1UA 5ULLA 4D9KA 1KI6A 5K45A 3HTXA 1R16A 2AW3A 3KWLA 4ECRA 5EFOA 4UFOA 1W52X 2W2MA 6REQB 3K0CA 2Y2VA 5HE9A 4KFCA 1LNSA 5LL6b 2A0KA 3PCTA 5E4YA 3UWKA 4LE1A 5JY6A 1WMBA 3LW7A 4LJ6A 2VP9A 2YXLA 3OOJA 3AKCA 3OAAD 1YR7A 4XB6B 3E2MA 2PU5A 2MR5A 5HF9A 4J9VA 3JASB 4Z4FA 5EIEA 4BGUA 3B48A 1D7AA 3ADKA 1MA0A 5ITZB 4Y3UA 2AX3A 1Z4MA 3KZVA 4LZAA 5KSPA 5E6SA 1GNPA 1UAGA 2ODNA 2V03A 3FYUB 5D01A 3CLSC 3OG9A 4DR7B 2O8DB 3VPXA 2ZR8A 2WWXA 3LY5A 5H70A 4ZYUA 3IT3A 3K32A 1S4MA 1G41A 1PE0A 3CU5A 4DIDA 1QK3A 2G9QA 1H1LA 5FPPA 5FUBA 3FTCA 3HKCA 4ZANA 5K8IA 2JFOA 4Y0VA 5J3JA 3UHPA 2ODAA 4D41A 2Q6IA 2LVBA 3H9JA 2YCLA 2FB9A 1TAQA 3DPUA 2WJHA 2W00A 1NIJA 2NWQA 5TF0A 4KQ6A 3RVQA 2IEBA 3IO5A 4DY4A 3V00A 2GCOB 3H1AA 4HUQB 4BV2A 3F47A 3EODA 2QRLA 1KO5A 1RVV1 5DX1A 5FL7A 3GB8B 1U1FA 5AKIA 3DC2A 4PLTA 1M2NA 4NBVA 2IYPA 4J0IA 3QYJA 1UK8A 4CG3A 4DCGA 1ECCA 1ODTC 3SC2B 1PT5A 4HGYA 2ZIUB 3ESXA 5EIBD 1E0AA 2FPUA 1H0RA 5A7FA 1FW6A 5FBZA 1GNSA 2I6FA 1K92A 5FUVA 1S8AA 5SICE 2R8IA 3G6XA 4OKNA 1PVOA 4ABTA 1JSXA 1I4OA 4DJFC 1N1DA 3HYSA 3FDFA 2ZTLA 1Z15A 4DSUA 4L4UA 4ZVUA 4IEFB 3AILA 2RIRA 3GLHA 4F0JA 2HH9A 5H83A 4BJHB 4Y8VA 2C92A 3DE0X 1JHQA 5EZSA 1U9IC 4FGSA 4MTEA 3PDIB 2R25B 3GIQA 4EMTA 4FDLA 1CFZA 5AKGA 3K1ZA 1OOEA 1U2DA 4DC9A 2QRMA 3DF9A 4OHZA 3GLFB 3DBRA 4FQ8A 3COVA 3OLWA 3P9RA 3EXIB 1W5SA 2VYNA 1ZP6A 3EXEA 2AK2A 3EBLA 3PR1A 2HM7A 3VR2D 2JIZA 1ISFA 4ITUA 2DVMA 3W5HA 3EQ2A 1S68A 3U2QA 1JAXA 5CR5A 3BZUA 3EOAI 2Q3BA 3GFSA 3G2OA 4IIJF 3TUJC 5JH7F 4ZT4A 3ZTWA 1VJTA 3V3TA 5IUKC 4F3CA 2GJSA 2Q8NA 3CLUD 1UK6A 1N32B 4NR0A 3SQNA 1IOZA 1GRCA 1Z0UA 3A2LA 3HBAA 1TEVA 3LT4A 3QMMA 4HDQB 4Q7LA 4M46A 4TXMA 4RJKA 2PBLA 4PPYA 2X2OA 2HDWA 3KOMA 1U9JA 2C57A 4M76B 1B73A 2WWWA 2GWRA 1ATIA 1PFKA 2XUOA 3WBBA 5KVQA 3EDOA 3IOCA 2G9VA 1ENOA 2UUBB 1I9CA 2RSLA 4KOEC 2JLBA 4K2HA 4EDFA 2GCGA 4IKPA 2W42A 3WIBA 2HN9A 3KXYT 5GGYA 3NUAA 3AT1A 4B43A 1LPAB 3V2HA 4A3FG 3LYHA 3LLVA 3ZCPA 3GZ4A 3IODA 1G4UR 2HY7A 5KG7A 5T41A 1UKCA 3G8DA 1ND5A 3IEVA 3PW4A 2P67A 3HKEA 3TSYA 4TMTA 2QWXA 1LQTA 1GQ2A 1T1EA 2VNSA 5IJ0A 1HMPA 4KQGA 4ZOAA 4NH4A 3HKBA 3GRKA 2IV7A 1RYRA 1MJFA 1H9AA 5CU7A 3DLHA 4BO2A 1HX7A 1VP3A 2EWVA 5E0KB 2FNAA 3F78A 2V6MA 4OHPA 1BU5A 4TXHA 4TL7A 1SUIA 2BFEB 1LFAA 3RBXA 3MRSA 4ABYA 2VQFH 1ADFA 1GO3E 1BU8A 1JAYA 5FTLA 2B69A 1ZBQA 3M9NB 1G3RA 4GNRA 3PDHA 4RAZA 1KYTA 5DG8A 2B2CA 4XFJA 3JAMA 1F2TA 3BDAA 1OIWA 3FETA 4D42A 4MI3A 4BLWA 3DAPA 4MWOA 1PO7A 5EP1A 3OM8A 4ZTBA 2UVPB 3D0RA 4BWGA 1L7QA 4Q9NA 4PPQA 4ESVA 4LJKA 2Y0CA 3HE3A 3KWFA 1X1CA 4BNKA 3GOQA 4UJ5A 1SXJA 4D1YA 1N0UA 4WZBA 5KWVA 1N8NA 1OXUA 1UDWA 4PZ6A 2ZRPA 1RLOA 3O74A 4PWZA 3OT4A 4WI1A 4ENWA 4D3SA 2QP4A 1COWD 1CUDA 3EIEA 1QTRA 1Q3TA 4GX0A 4Z9FA 1HTBA 1NMYA 1H2AS 3OOHA 1E96A 3AO0B 4YLEA 2BWJA 1OLXA 4EB0A 1XZAA 3WQRA 2GJKA 2X76A 2ODWA 2I6QA 3AJRA 1X42A 2ZJ6A 3UPDA 2M6SA 1I51A 1QKIA 1ZUIA 4HDCA 4LW8A 1SM4A 2BP7A 3GGSA 4QPJC 4U8GA 1QQTA 4HEQA 4L4XA 4JJ4A 4C7BA 4FFBB 4HN9A 3VSAA 3SHTA 2ZB8A 4IHJA 1R6DA 4IY1A 2H2GA 3MJHA 4ZP1A 1OMOA 2OCDA 4IDCA 5AM0A 5LL6P 1QYCA 3HJRA 5HUJA 2BUAA 3OZRA 1OYOA 4LC1A 4RTMA 4GZ3A 3RO7A 1G55A 1T4BA 4QA9A 1ZHHA 1TJNA 2C22A 1F5NA 4GC9A 1NRWA 4U7FA 3SM3A 1KRWA 3PSHA 5IBPA 4B3CA 3A9VA 2ETXA 2VQ3A 1IULA 3L8CA 3PV0A 4OEHA 3NTQA 2PRYA 1LLFA 1L4GA 3GIMA 3U5TA 3EWSA 2DR0A 1L7MA 3ZXYA 5J4HA 2C03A 3S2YA 3OPYI 2NYAA 3AQIA 5BYJA 4HV4A 4MA4A 2MCTA 4QDOA 2NU6B 4QM7A 3WA6A 4HN2A 1ZW1A 3U39A 3NWBA 4ZQEA 3VXKA 1EMDA 4OJYA 2HJHA 3BH6A 3QSYA 4XRGA 2FRDC 2OL4A 5DP1A 3PEVA 1NXPA 4ZI2A 3J7TA 1KAOA 2JFBA 3WWZA 4I14A 3WB0A 3STUA 5EVJA 2Z2KA 1BKSB 3VC3A 4PHHA 4O2AB 4MV7A 4QASA 1RZRD 4XW2A 3ZCSA 3S0JA 3S2UA 1GJRA 4LFAB 3TJMA 2CZGA 3HKDB 5AKJA 3TRFA 3NH6A 5DSTA 1CDOA 2CSUA 4Y2VA 5EWFA 1NP6A 1CY0A 5CD1A 1S8OA 4S0ZA 1EP1B 3OZWA 2WWRA 3WLTA 4URVR 1LPNA 1UCFA 2VUHB 4S04A 1EXDA 2DTDA 3C8UA 3LT5A 3B6IA 3DKKA 1M6WA 2IZZA 3GIJA 3LFTA 3C6MA 4CUKA 3EXG2 2PJRA 3A6KA 5F5XA 3LYLA 5ESWA 2QY6A 4ZCLA 2IP4A 4RCNA 3UWMA 3HXTA 1Z22A 1U4OA 4S1VA 5F64A 5MF6A 2A59A 3R3SA 4MQFB 4YAJA 4CETA 2O20A 3AUTA 5TF4A 4CEHA 4R98A 2EL7A 4AF6A 3L8YA 1VHJA 1USUA 2VNIA 4R1TA 2AE2A 4WQMA 3NOXA 2Y0DA 1R15A 4UCFA 3G2PA 5HIKA 3NM5A 1YFLA 4ZEWA 2RC6A 5JWRA 1VMDA 3CW2A 3DTVA 4OYLA 4UDOA 2GN8A 5ALTA 2Y68A 2O1SA 4KXXA 2CXTA 1DEOA 3TG2A 4LZNA 3EHDA 3CF4A 1Q20A 4B32A 5EZYF 2XTZA 4RU1A 4HFMA 3LLMA 3MTBA 4NBRA 3ENQA 3SKXA 1RW4A 3VNUA 1EVEA 2Q2QA 3H3FA 1E2IA 1CJTC 3TZ6A 3NT2A 2CWDA 3Q6IA 5BVHA 1PWYE 2TSYB 3NGLA 3J81A 4QREA 1DS6A 3ORYA 3AR7A 4ZC1A 1GT91 3T7SA 3B36A 4G5HA 3GO4A 4RQUA 3DD1A 4UTRA 3ZG6A 1RSZA 1GGKA 5A0FA 3RWBA 3T1HH 4R3WA 4RHCA 4AZ0B 1UM9B 4U00A 2RHCA 4V0SA 2A9VA 2PX0A 3K09A 3PW5A 4WN9A 1MU0A 2FYTA 4IMPA 1KJ9A 2I6XA 1XROA 4MUEA 1BQ4A 3OCXA 1V37A 1BFDA 5C32A 3IUNA 1EJ0A 4J9NA 1N77A 3VPSA 1UBLS 4ALNA 2XGGA 4W5OA 4B3TH 3K0EA 1NT4A 3RT7A 4EJ6A 3GWZA 1G8KA 3MMSA 1QHYA 5K3WA 3H97A 4MV8A 3AM5A 1RI3A 3ZNPA 2H1OA 4QGGA 3RSZA 3DBIA 4EARA 2A67A 4WKPA 4IRXA 4U9UA 1OHHA 1ID1A 4N3AA 1IWPB 2AI3A 4E14A 3R5JA 5CM0A 5EPEA 4XX0B 1M8GA 2ZR0A 2VO1A 3Q7TA 4ZHQB 4D0GA 1V16A 3P1JA 5IRCD 2CN1A 5AJXA 3PUHA 2E37A 2VTBA 3JALB 3QJGA 2IZ1A 3HDHA 3MLEA 1DAHA 1A9SA 4X7PA 1PWEA 2E82A 4HLQB 3RFUA 4I9FA 4B85A 1NDQA 3TW7A 5CTJA 3K5PA 1E99A 4LJ8A 3GYGA 3KJZA 1G59A 4P38A 4X6XA 1DU4A 3ZU3A 5ICMA 3BGWA 2L42A 1YRBA 1OTYA 3QUSA 4EB6A 1SQ6A 1XK5A 1ADYA 3TOZA 2FMFA 3SKVA 1UMKA 3ER6A 3QVTA 4MR8B 4QKQA 5TPZA 4KJXA 4FYYA 4KE8A 1N4AA 2YJ5A 1TLLA 9GPBA 4MQ4A 3KQQA 2RGRA 3WGGA 3S70A 1XDNA 4V1CA 5A4FS 2FG7C 4XM2A 4IWYA 2C2XA 1XZLA 1MENA 5AUNB 4NZPA 5FNVF 4WCFA 2XLCA 1TTTA 3U19A 1SHLA 4KPYA 2J6CA 2QJTA 4OO3A 1G17A 2AT1A 1OTHA 4GI2A 4YAOA 5BSHA 2CMGA 1H6BA 3T3IA 3E9QA 3P9QA 3A9UA 3CEAA 2BQUA 1YT5A 1YXMA 1DBVO 4ED7A 2HU5A 4PGGA 3FF1A 5JMWA 5U4QA 2FPIA 1DE0A 3B7PA 5D51S 2PFGA 2XYRA 5FUYA 5IMBA 4HLDA 1GRNA 4MXDA 4Q3DA 2IT1A 3WKBA 2X0JA 1KHHA 1XRLA 4H0FA 3DAGA 1UJBA 1K6MA 1SU8A 3R3HA 3ZE9A 2Y4OA 2QRUA 4E51A 3BZWA 5KVSA 5CFQA 3BORA 3WISA 1KI1A 1VECA 3GU3A 4HZUB 4OXNA 3GUYA 4QBGB 3LWZA 5EE5B 3RSHA 4MMZB 4EHAA 1SA0B 4ENTA 1JFSA 2G4CA 3WFIA 2Z5LA 3SICE 2A4MA 4AL4A 5E6UA 4YMGA 4DUZB 3MWYW 1YKFA 4KEAA 1JR4A 2FN8A 5I9IA 4FSHA 1TW2A 4UOZA 3MT0A 3DLPX 5KNLA 5A3SA 2IXEA 5LP6F 1CUAA 4Y6PA 2WHYA 5EKXA 4HH3C 1JIQA 4CLDA 1FDOA 2O8EB 1M6VA 4A3JG 3I9MA 2Y76A 1VPWA 3GQBA 1L7NA 4LJLA 1L4UA 3PF9A 2C88A 5IJ9A 4A03A 2WB4A 4MLZA 5FXMA 1TD1A 3EUWA 4KWIA 1IZ7A 1C81A 2Q07A 4YFVA 4CW7A 4JJKA 1TQ4A 3T7KA 4ECXA 4WD3A 1JHRA 1O54A 3A1DA 2SECE 3O8QB 3K2QA 3OA0A 3JQGA 4FN5A 4YALA 4QQFA 3OQHA 3O3MB 1O95A 3GIWA 2V9CA 5EJIA 4IV5A 3H4DA 3BHJA 5EMKA 1KERA 1PNQA 4LRTB 2NADA 4BQEA 1U2GA 1WH2A 3W5SA 1X8KA 3PW7A 1CP2A 4E03A 4BV3A 2ADMA 1DG3A 5AW6A 4IOLA 2AS0A 1Z6XA 4ONEA 3H0GG 2P3SA 2LW7A 2HMUA 2QYTA 1QRAA 1QR6A 3S68A 2JVKA 3D4IA 1YZVA 1NOKA 1QYDA 1HZZA 2G5CA 4UHFA 3L01A 1CKOA 1T15A 1J0DA 3UAVA 4X1KB 3HT5A 1RNLA 1CUFA 3H18A 2VTEA 4P82A 3SFZA 1VLJA 1YGYA 4MWDA 3DNFA 5LNK1 1YJBA 3N74A 3CW8X 3EXAA 1UPFA 5ERGB 3ZX5A 2FE1A 4BO3A 3R9XA 3PNKA 1RYYA 2QK4A 2Z6QA 2D7JA 1Z2EA 3DEZA 1K68A 4TT3A 1S1MA 2W9CB 3TSCA 3V1LA 3LM8A 3VSEA 3TZCA 3PJRA 5JR3A 2QPLA 2ET6A 4LHXA 4RF2A 1LD3A 3UUEA 5BRJA 4O8ZA 5H9WA 2I2XB 1XKQA 1ZH6A 2N47A 1QGYA 2V98A 4BVEA 3GTGA 2XKJE 4F3RA 1A0OA 5K3CA 4O3MA 3TF5A 3LYAA 1FXSA 1YKGA 1YUBA 4K6HA 3O9ZA 4RTPA 2RGWA 1N33B 4XYLA 4EGJA 2XDWA 5LA6F 3WNQA 4YMSA 3WOVA 3DFUA 1OBHA 3KQWA 2FSFA 1YR9A 1XPJA 1ZGHA 3T4UA 2AF4C 3G9XA 4RANA 3VR4D 4DZZA 2CNNA 1P7VA 2C2WA 3T7IA 4BNDA 4HH4A 1YCFA 2WMOB 5DIZA 1U28C 5DRTA 4NJMB 2Q2VA 1NWCA 4W6ZA 4A6EA 1USKA 1DQSA 2XWSA 4LRSB 2HYIC 1UPXA 1E6WA 2EYQA 5K3FA 3RTEA 2UXBB 3VR1A 4JENA 1DLJA 2WG1A 3W6ZA 5CRIA 1KUTA 2BAGA 3MXOA 2HU2A 3SNKA 1JEJA 4BOYA 3AGQA 1JIHA 3VHQA 3HPRA 2WSSD 3TQSA 2RCNA 2K5UA 3L4BA 3DUWA 1QFZA 1Q0SA 3KPUA 1HF3A 5EGNA 5THQA 2WAXA 4W7SA 4KVZA 1QCDA 1UIRA 4A91A 3H11A 2YQ5A 4MWBA 1N6IA 1JBEA 1PEKE 1SXPA 1SRRA 3D54D 4DKJA 4N8EA 1JDEA 1VGRA 3O1IC 4RUKA 4FMDF 2ERXA 3IYLW 2QA5A 3IV7A 2P79A 4A3LG 3T9EA 2AG5A 4QOEA 2HJ9A 4JU9A 3DOEA 4MAAA 1QF6A 2DHEA 4AYBE 3PLRA 4LGMA 1BCSB 4DQVA 4QWMA 2O7NA 2GETA 1U8CB 3TKLA 2ZROA 4LRQA 5H68A 4OMCA 3IPAA 4WLNA 4WFKA 3V42A 3ANXA 4DDHA 6YASA 2Z9BA 5E38A 1GAXA 1LKZA 1HZJA 2OCAA 3L02A 2W6NA 4WCDA 4UU8A 1FMLA 1FVFA 4PLCA 4F4UA 1YRYE 2NV0A 3EXHA 5BN3A 3ACCA 1A76A 4L6IA 3HOZG 1WEKA 1AQNA 1O0SA 3AH8A 4JVMA 5I9SA 1B6SA 3F6BX 1DT5A 4QLAA 3CY6A 3COWA 4KI7A 4JEIA 1GUDA 2QLTA 2FJ0A 1KI6B 3N05A 3UJ9A 4CU5A 4JLKA 2XHEA 3OQMA 5IDQA 4DLNA 1WVMA 4K88A 2SKEA 1NBHA 3H1PA 2I6SA 2WFLA 2FW9A 2RDJA 1AOXA 1FC0A 4M1MA 2V8BA 3MRVA 2HHFA 5IFLA 1IHDA 4LECA 4Q12A 4M89A 5JASA 5D7NA 1T8RA 3AKZA 4X64B 2B21A 1AHNA 5BQ5A 5CCEA 3A3KA 3GUHA 2VCEA 4KRXA 4BDSA 3LQ4A 4X6YA 1K8RA 4LZWA 3U3OA 4YRPA 3H9CA 4C4ZA 1U7DA 2CVOA 2KSWA 4ZYLA 1P9OA 4BO0A 4CTOA 4AAYA 4PX5A 4FONA 3DW1X 4Q3LA 3WAKA 4GYJA 1XLTC 2H2HA 3Q3VA 1QE0A 3ASZA 4MTDA 3P45A 2Z9CA 3MZ0A 1TWCA 1H1LB 1PJ3A 2VBFA 3HKCB 3KUDA 2ZTUA 2F1KA 3NVAA 3RARA 3HGTA 1Q95A 4CZ2A 3PLNA 1DP4A 1LBQA 4RELA 3U62A 2OM2A 1PW7A 3QU5A 4HZIA 4NABA 3C8DA 1J2EA 1Z0KA 1J33A 3LDFA 1RHUA 3RYHA 3I1IA 2WJWA 2CV0A 4C29A 2P2YA 4LHVA 5J5VA 3QRWA 3KETA 2R9VA 5K0FA 2P6OA 2CNDA 3V4OA 9MHTA 1FOEB 1NP3A 4PZZA 1VL8A 2G07A 4HNGA 4WKBA 1GCGA 1XALA 1IB6A 4RLHA 4GKAA 1G42A 3IAHA 2H1CA 2GASA 1DZ3A 5CLHA 4ZEMA 1FVHA 1KE2A 4YUZA 3FSGA 4K28A 3GMSA 3LGAA 3EFBA 1R4AA 4M1TA 2HA0A 1MNQA 1Y9JA 1JNXX 4LY0A 4WBXC 2PLWA 3Q8QB 3O47A 5ARCA 1PK8A 4Q3AA 2PUDA 4GC6A 2J7PD 1D8AA 2XMPA 5L3RA 3W5AA 2QTZA 1C1HA 3TQ1A 4AUNA 1F5SA 3GLHB 1YHNA 4Y8VB 1U5BA 1FDIA 4ZVMA 2C8JA 4PBTA 2JGLA 4O4HA 1RYEA 3GLHE 1TQ2A 4L5IA 4F4JA 3DBRB 2UUCH 3U44A 1LVHA 5JROA 4FHFA 4HLUA 3WGIA 5F9HA 3G5UA 1U90A 4RJLA 3LX6A 4PX2A 5KFMA 3H1FA 4OQQA 4FDAA 3EXEB 3KUKA 1SCJA 5FBWB 1WBJB 4HGRA 3NATA 1OUMA 4HX5A 4YJ2F 3RB6A 1IN8A 4H3KB 4DVJA 1GAJA 2PLNA 4FZJA 5HG0A 3UM9A 3AHFA 3OH8A 2XKBA 3Q8KA 5DT2A 1BS9A 3UQ8A 1RMQA 2GAJA 2AL7A 1PJSA 3IGFA 1JSRA 4Z86A 4IDNA 2RHJA 3B1FA 4PLWA 4YLYA 4TKLA 1QBGA 4RPCA 3EVNA 2AN4A 2H57A 3ZHUA 2ZM5A 5JS7A 4YR2A 5KNDD 3DNPA 4CC6A 5EE1A 3GGJA 3T7RA 1AKYA 1UR5A 3EC7A 4FB5A 4B6OA 4QQRA 4BBSG 1RJGA 2FDXA 1IN6A 1EBFA 2ZJYA 2W8BA 4GDFA 3I9JA 2FR1A 1ODSA 3ICOA 1SG9A 4FE2A 1EHCA 3QPBA 5BO5A 1P60A 5EUBA 3LUKA 4FWBA 3KXKA 2CJYA 3UNXA 3MGGA 1TFUA 5G0TA 3DV2A 1ES9A 4WN3A 3UT0A 4FUQA 1A7JA 3FJOA 2OZKA 1ABFA 1A8UA 1N36H 4E2XA 4ZRNA 3DYIA 4C0JA 3GFBA 1KDYA 2MSLA 2IXGA 1LVUA 1Z4QA 5A4IS 4BNWA 3NIWA 5JVLA 3DZHA 1W44A 2I3ZA 3KX2A 1CYEA 2C5LA 3NHMA 2NM0A 2P6PA 4UM5A 1XPUA 1GG9A 3HKEB 4AICA 3TPFA 1R8YA 3Q4GA 4D7AA 3NALA 3WWPA 2REXB 3SQOA 1OI4A 1XMSA 1MC8A 3HKBB 2AQHA 3DCNA 1G291 2YZNA 1XRSB 2MR6A 3T54A 2ZJFA 4JB3A 3TX6A 3TZEA 3A11A 4UTZA 3DMGA 4A5SA 4RMGA 4BCBA 3T4XA 5JYBA 5IAEA 4YQEA 3OJWA 1Z2AA 4KSCA 4Z8YA 3TTUA 4XTRA 1TNDA 2CD9A 2JEZA 2F3TA 5HOQA 5G3ZA 3L1UA 1Q12A 3RYIA 3PGLA 4Z0HO 4JC0A 4MEAA 2WB1A 3CEMA 3NCTA 2GEFA 1AUVA 1ECBA 2UZ0A 3GK3A 1SMKA 1YBMA 5KG3A 3AJ8A 1K1SA 3HCRA 1DAMA 2LIPA 3JZIA 1VGQA 3T3HA 2OQ2A 1F2TB 3K4PA 3GEEA 5FOXA 4PZYA 3TAHA 5KCZA 1KQOA 4N7BA 2HA2A 2WTAA 3QVMA 5FL7D 4B46A 4BRZA 1WXDA 4PINA 4G8BA 3EN0A 5EY5B 3N42B 2G1UA 1VMKA 5IXJA 1JW9B 5T4BA 3GNTA 4K9NA 3PT9A 4BXOA 4TUYA 1QE5A 1SQ5A 2G82A 2QRVA 3DMYA 3FN4A 4QYTA 2MIIA 2OH2A 1JKJA 3HP7A 3ZWDA 2I8LA 1SXJB 5AW8A 4WZBB 1KBOA 2HLNA 4D5GA 4W5TA 4YY3H 2VJNA 1LDEA 2V74B 3AZQA 4NS1A 4AS1A 5CIQA 1TRHA 1SXJE 2G5GX 2QZZA 3HSKA 4WZBE 3K5IA 3EZ7A 3W9UA 4ECWA 4BBJA 1OLXB 1O6ZA 5LOVF 4Y6OA 5CFNA 2R8EA 1L4BA 1W88A 4OQDA 3S40A 4HDSA 3EQ9A 3PUIA 4OQFA 2BP7B 5LQNA 2PM8A 1EK1A 2JFWA 3KDPA 1ZN8A 1H2RS 3DCJA 2PKXA 4EG7A 5B2EA 3NWPA 4WW0A 3N8HA 4V38A 1K5PA 2VYND 4QXAA 1CUZA 1SZDA 4D4HA 4IHJB 5P21A 5AVRA 2V3CC 3KSDO 2JIZD 1XVLA 4K8OA 4YJHA 3VO9A 3EAGA 1CR2A 2C20A 1DAEA 1NTRA 3HUEA 2A7XA 2HRCA 2VDWA 2YWJA 3DAYA 5I7UA 1XRNA 4OV6B 3T3GA 3EPLA 4NBUA 1ZOLA 2WNHA 3O4JA 2WE6A 5A0VA 4MMYB 2ZAGA 2FWAA 1SXIA 4QU8A 3SLKA 2OAP1 1TKBA 5A04A 3H1EA 1XIVA 5AK0A 1T9GS 2QVCA 4I2VA 4L57A 4BEJA 4YECA 3WNCA 5HM8A 4IOMA 3THWB 1EUZA 4KN6A 1K8YB 4DNPA 1QFMA 3JARA 3BE4A 4P4GA 4WHXA 1I2DA 2FFRA 3NO4A 3AR5A 5B2ZA 2VK1A 1QHIA 3N28A 5DGIA 2YUIA 2BHRA 3QFCA 4JGBA 4M9QA 3LV8A 2JGKA 2FOXA 3IHWA 2JIQA 2H92A 3DXZA 1UMDA 3EUEA 2ZCVA 2DLDA 2R6AA 1MVLA 1CHNA 4DV6B 3BMOA 4TKVA 4XIYA 4M1SA 1JKIA 1XK6A 3S7TA 3PL1A 4NYJQ 2LXNA 3P0RA 4P7FA 4E5UA 3ADDA 2P77A 3H84A 3G88A 3JRWA 1OTXA 1DELA 3JXEA 3M82A 3OLYA 1GZ6A 3AEKA 4NYIQ 3L6UA 5FOUA 1M9NA 2IV2X 2AC4A 2EOAA 1I1OA 3M5CA 4ZJUA 5KMGA 2CVPA 3RANA 2NUAA 2E55A 2OE2A 4GOKA 5H0IA 1NGSA 4KN9S 3GARA 4RA9A 4Q0MA 2A94A 3AHIA 4YAJB 2DBVO 3QVJA 3FM9A 1RU3A 2BGLA 4CEHB 3D5TA 3QWFA 1E2UA 3I9V1 3U31A 3N07A 5JALA 3X1MA 1ST2A 3B3FA 1SBIA 1ULBA 1NBME 2HNKA 1CDEA 4PFQA 2VP6A 3JR3A 3HDGA 4KV9A 4AY3A 3ESYA 3DLBA 2AFVA 3DTVB 4MYCA 1JG4A 1FFBA 3NQ41 1KSJA 4JX9A 2BONA 2OCPA 4ZOLF 4KO3S 3N7AA 5JJBA 3CBQA 3GJZA 4ILEA 5TQVA 2V6BA 3FOFC 3FOZA 3DJFA 2GAFA 3HOUG 1V9CA 3IEUA 3SZMA 1BWSA 4DLZA 2VTDA 3RAPR 1PK7A 4TS3A 2ZP1A 1M73E 1W76A 1SXJD 1M7HA 4AKHA 3HVRA 3ZDXB 5A4DA 5BVHB 2HUNA 1E3LA 2IHZA 1BC5A 3M9WA 5DLFA 4A92A 2PPVA 4R3UC 3TNYA 5ANRB 4AJEA 4KR0A 3DB2A 4MUHA 4XOIA 4ARVA 2FUKA 2I76A 1Q21A 2LIVA 4A0SA 1P6QA 1PS0A 4XYGA 4WN9B 4IRMA 1P2VA 1EWKA 5L6MB 1DKMA 4DR4H 5IT9W 3QELA 1L5ZA 4U2BA 1ZD3A 4I08A 4DR3H 2HU7A 3H7AA 5EERA 4PYMA 2CHQA 1RWWA 1B6RA 3DQZA 2QJWA 3BL8A 2C28A 2O9JA 2E1RA 3IBFA 1NNI1 3JVVA 3HL0A 2EQAA 2II6A 4BEVA 2CE7A 3JW8A 4C3VA 1I0ZA 4P2BA 3EE6A 2OHHA 3HLKA 3BMXA 3VC1A 4NZ9A 4ODIA 2XEXA 3FBGA 1ZC3A 3T0GA 4BBRG 4BLRA 2IEAA 3OKCA 5C4GB 5DHFA 1I3QA 3ZKWA 3PZBA 3N44B 4JXJA 2AEMA 4XSGA 4F3KA 3KL2A 3ZHYA 3IP8A 4MIEA 3NUGA 1V3QE 4LGVA 4GGMX 3GTOA 1V16B 5LSAA 3K1YA 3QYFA 4Q7QA 3T3PB 5JTUA 2DF8A 2VTBB 2RH8A 2AYYA 4R9VA 3RABA 1KS9A 3CUEF 4JELA 2VRNA 4GXTA 2H3EA 1I7SB 1NLMA 2VNJA 3T9BA 5CLQA 2XIQA 3D3QA 1JXMA 3I4LA 1OIVA 1KRHA 1OJLA 4AJJA 4RB0A 2VHQA 2FW0A 1UFRA 3FKIA 2ZIZA 2O2EA 3ZCRA 2CJWA 2YC4C 4YQFA 2ZTHA 1PGPA 1S0UA 2ID8A 5AJTA 3F98A 4G89A 4KX3A 2IPMA 5FO1A 2P7IA 4N49A 2EJ2A 3PPYA 1HT2E 2IBKA 4R5MA 4XQGA 2CL7X 3BKXA 1JA1A 2I55A 2OCYC 4V1CB 3TAUA 2WKQA 1HDGO 4WCFB 4NBTA 1BE8A 4RAQA 1GNQA 2B0JA 1W34A 2HLHA 5DMHA 1M0SA 1SU7A 4JI5H 1HYQA 5EWEA 1RFGE 4LK2A 5DCYA 4BASA 4YAUA 4CR8A 4LJAA 2XCIA 5B7PA 2H48A 3BCUA 4F9TA 1P19A 1T0PA 4WV3A 2A9QA 5BSRA 3N6VA 3KUUA 2A0FA 1FDRA 1DEAA 2BV3A 1J2JA 1BDIA 3GUVA 1H2FA 3FOWA 1RRMA 4E21A 2FPIB 2HV9A 3GBPA 2Q3DA 3V8RA 4LYEA 4C7VA 4GP6A 1VLMA 4KXNA 2BM8A 4W9NA 1DIHA 5IWAB 1BVUA 4DARA 1M1YA 1WULS 1W4CA 1LVGA 4HQFA 1NBMD 2SCUA 2B92A 3WMGA 2BFMA 1F3LA 3WGOA 3DE1X 2GF9A 4RVGA 3FFWA 4TM5A 3OTOB 2WJPA 2DAAA 4HWRA 1J0XO 1R7RA 4BJ1A 2JB9A 1GZUA 4HQRA 4BVJA 4BX9A 2HTFA 3DTVD 2UYGA 1CF4A 2WF6A 5KWJA 4Z99A 1FRZA 2XADA 4F96A 1UUFA 1QFXA 5E6UB 5TX7A 4X84A 4ZEXA 2FPOA 5IAAA 1X1AA 1HQDA 3IAS6 3GLFE 2G1PA 1N9ZA 3TZKA 4OMFG 2B98A 2XQJA 3LUBA 4R7ZA 2WM8A 3QBEA 1MAVA 3D4PA 4F5ZA 4B5LA 1M33A 4UBMA 3UHFA 4DQUA 3GQBB 2R8ZA 3OZGA 3OF5A 4PU0A 4J94A 3PFFA 5IJ9B 3AR6A 4HC4A 2FZEA 3UJ8A 2VLIA 3WIEA 4RHYA 1QDEA 5LQCA 3ZJVA 3L7CA 3KLOA 1ZHFA 2M1ZA 2IPAB 5FTNA 5JC1A 4CMIB 1ZJWA 2ICAA 1QGZA 4QL3A 2CJFA 4I9GA 3JQGB 3I2JA 2EXXA 1QV7A 4US1R 5HIAA 2Q50A 3FVRA 4BP9A 2WUFA 4H9GA 4JASB 2EFDB 4ZU1X 4E5VA 3RVOA 1MX3A 4J2HA 2JVIA 1AKRA 3H20A 4TZ0A 1WCIA 1B76A 3SR3A 5JUWA 1CUGA 1QHFA 2BFNA 2ZW9A 1G9TA 4DSAA 4PYOA 1PJAA 3U0BA 1GLNA 4O7NA 2D1YA 4RZRA 1RWQA 4FZ3A 3TBFA 2NVWA 1RHRA 3LXUX 1OHHD 1XNJA 2GQRA 2H9IA 5B55A 4NFSA 3DHEA 2O5CA 5HNEA 1WUTA 3VMFA 5E0OA 4J1QA 1G66A 4TXJA 1BHSA 5G0VA 2XR1A 2I4LA 1GZ7A 2K4MA 5JNRA 1INLA 2OHXA 4KQWA 3JSLA 4Q3BA 1GQQA 1VCHA 4RCVA 4JI2H 1PX0A 1P0IA 1NZDA 1NVVR 4IUDS 2PX2A 5EXTA 5T6BA 2Q4OA 5MN6A 2JEYA 4NV3A 4DLWA 1XYGA 2AFIA 4GEKA 4C0HA 1QHXA 4S2UA 1NJ6A 2V7VA 1UWCA 4YUXA 3G85A 4JQOA 4BVHA 4FFDA 5IASA 1Z68A 4JI0H 3S44A 4JI4B 3SQMA 2A9FA 3ONWA 3RS7A 3OIFA 3ADCA 2NVOA 1EKPA 4DV5H 1GZ5A 2XITA 4ZO7A 5TPZD 4BQRA 4DLTA 1CS0A 1XMVA 1T8YA 3ZE6A 4I4LA 1UKVY 3PDUA 4ZQBA 4MGKR 5CYFA 2BM9A 3K1TA 2OC4A 4XYLB 2FG5A 1D04A 3INGA 3RTAA 1FDVA 1Y1VA 2XBLA 3O9MA 2HK9A 2WJVA 1FLNA 4BV9A 1QF9A 3D3JA 3U61B 3Q87B 4DSNA 4ZAYA 4JLDA 4J9OA 2JCSA 3FMAA 4OXIA 2Q9CA 2Q29A 4TXNA 2VJCA 5A4MS 3EMBA 4E07A 4JI1H 4BNDB 4LQLA 2H2AA 3OP4A 4IIFA 5BNZA 1YTUA 1IBLB 1T5OA 5KNBH 3HFJA 2XD4A 2Z02A 2CSXA 2I3BA 1KYYA 1B41A 3KU4A 5IEJA 2CNUA 3NKVA 2XKKA 3ZW9A 4W5HA 4IUCS 5D6NA 1B15A 5K3FB 4EM6A 4FDMA 3RB3A 3ROFA 3FWNA 1XWFA 3LK6A 3O0DA 4CDGA 1B0PA 1YDFA 1NLFA 2ZYVX 1TIBA 4MYTA 2NP7A 1DC3A 1TMOA 4YJ3F 3VNAA 2AJLI 1NNSA 1X3SA 3TYXA 2VF8A 4KX5A 1FYDA 5DBGA 2B0CA 1G9SA 1J4AA 2J0VA 3H11B 2PMWB 4BO5A 5BR4A 1DPFA 4IJUA 4PLFA 4ZJYA 1V3VA 4RTOA 1WUJS 2ZB3A 1TF5A 4Z8XA 2OG1A 1VG0B 3FPFA 1EFDN 1AQYA 3IKVA 3L7IA 3HOVG 2EX4A 1KGDA 4O25A 2FPKA 5A06A 4KHZA 3HUFA 4J0CA 3ZDDA 3HJCA 3H9GA 1U8FO 2OHIA 3QQMA 5DIFA 3KB2A 1SY7A 4G01B 1EQAA 1YMVA 4M1OA 3EQZA 4YP9A 3CGWA 1LLUA 1X9IA 1E7SA 4Z0TA 3E5RA 1QANA 5H3LA 3FPLA 1XNGA 5BWMA 2OXTA 3JATA 1NW3A 1GFZA 3MYRA 3UZBA 4DDWA 5L45A 4Y2PA 4AJPA 4A2QA 3PGJA 3EXHB 4X8HA 5BN3B 2J9RA 4PZ9A 4AQDA 1Y3CE 3IP7A 4MUBA 4K7JA 4ZRDA 4MVJM 3R3XA 3IERA 3VR0A 5KQLA 1O95D 4NECA 5H3CA 2O3TA 4LFCB 3SS9X 1WW2A 4DAAA 1GLVA 4ZCIA 1DRUA 1RAEA 2WQZA 1SXHA 3LD9A 2B9EA 4LF8H 2ASJA 1QH0A 3D8BA 5DTJA 3WADA 3OM9A 5TJHA 1OAOA 1E3WA 3GNQA 4FXOA 3R74A 1TA0A 4J7AA 1TIPA 4KYVA 3NW9A 4N82A 3OZUA 2V6GA 1KJIA 2WFLB 1GITA 2HHFB 3UV7A 5HWSA 1NUHA 3OQ1A 1ZUWA 2C3YA 3UYYA 2IJGX 4O2BA 5BPHA 5BN5B 1BG6A 5DYWA 3G8YA 4NFLA 2J9FA 1OC2A 3PQ7A 3U13A 4TT3D 4P80A 2JRCA 5KYXA 1PJBA 1M0TA 3UJNA 1WXQA 2VEDA 4NMXB 4RYLA 3GN1A 5HUHA 3V7WA 3Q1KA 2AFRA 4MX8A 2OENG 1NPTO 3NPAA 1P1IA 4X95A 2CW5A 3WLSA 4F60A 3LVQE 3WGTA 4C4AA 2C2KA 5JBQA 3J7AK 3AVPA 1VG8A 5DGHA 1PK9A 5FB3A 2VHYA 4KBFA 2NO5A 3SC4A 5I5UA 1R8SA 3ZW8A 1P4AA 2CLIB 1ESDA 1D0SA 4XPZA 1U1GA 4A2BA 1ZRHA 2AJ8A 3ABOB 1EVKA 4RVCA 2WSIA 1EA7A 4IQFA 4YRMA 4Q01A 3PSAA 2C61A 5DQGA 1YS9A 1SZCA 1C9NA 4WK2B 1ZX1A 2PZEA 3V8QA 3RYHB 2BRUC 3CRZA 1UZLA 3IT2A 3ZI7A 3I04M 4JDPA 2HTEA 3SJ7A 2FTKE 1FYVA 1SUEA 3WAGA 1HDYA 1ISSA 5ES4B 5A3QA 1RWPA 3B9PA 3FYTA 2WPDA 4GH5A 3MRTA 2Q2WA 3ANYB 3ESZA 1SIWA 2QSJA 2YV5A 3QF4A 4Q7EA 3PB3A 3QMVA 1G2OA 3MHTA 4D99A 4TWZA 5KYKA 1HRDA 1XD8A 5HF8A 3BILA 4NPAA 4QO7A 3NJ8A 5K0TA 2BBSA 4LF5H 3SOZA 3R9KA 4BNXA 3CE9A 5FFMA 3BFJA 3A1SA 1FJXA 4J9LA 2IODA 1P3JA 3CB4A 2AQ4A 1CY6A 1E9SA 2DJ5A 1F4VA 1XDBA 2R87A 9LDTA 3D0OA 1VKRA 3QJ5A 4G8JA 5E6RA 1LPMA 1B3BA 2IHJA 4DDVA 1U5BB 5BUSA 4KNYA 1YVRA 1MVNA 1KY3A 3BIXA 5DLPA 5F7OA 4O4HB 4DL9A 3VYRB 3GLSA 1L1RA 2LCQA 1PP4A 4HSGA 2WABA 1KFJB 3DWFA 3H17A 3BJRA 5CDFA 3I4MG 5GJWC 1MO2A 5KYWA 1K9VF 1DIBA 1I6UA 1Y7HA 3MMXA 3A4VA 3L18A 5CEFA 2PMFA 5K1ZA 3OIWA 4I46A 2MJLA 1HTWA 1TK3A 1NXQA 3KAJA 1T6ZA 2HF9A 3CN7A 2C98A 3NONA 5FKJA 3R3ZA 3CVVA 5JSUA 5EIFA 2QN1A 2APJA 3U09A 3NTXA 2VNKA 4L75A 5KWSA 5HKOA 4XVRA 4NS4A 1Z5NA 1PLKA 3RRNA 2Y4RA 3F1KA 4M1WA 4PIVA 4U5QA 3WO0A 2PL5A 2C00A 3ZJ4A 2AX4A 3GT7A 1JQAA 4F4HA 2GUWA 2JAXA 4KIGA 3T5KA 1EVYA 3IQFA 3C85A 1FDTA 3UMCA 1Y6JA 1SOVA 4ZPJA 1ULZA 3N7UA 1C3XA 4RWZA 1O8CA 3IALA 3D5EA 4AS3A 3C1TA 3D0QA 3L49A 5TC4A 3G6KA 2W8BB 5IC5A 1N8SA 1GKKA 1XLWA 2ZIFA 5HGXA 4QUIA 2J6HA 4LX0A 5K4HA 1OVGA 3WL5A 4YRJA 1G63A 3I9NA 1TQ8A 5T8KC 4H6WA 3D3EA 2ATLA 1G1AA 2W70A 3NNSA 1F48A 1Y7PA 3UKOA 2JD1A 3G9QA 5KFYA 1OE0A 5T57A 4MQ5A 3H5OA 5HOEA 4WNYA 3GCXA 2PUTA 2N1BA 2R6JA 1TIKA 3WNBA 2FWBA 1HE5A 4J43A 4YMVA 1D1TA 1P33A 2C1XA 5A5FA 1QE3A 4C7KA 4B40A 3BYZA 2DY1A 3AXTA 2NTEA 1UPTA 5FRDA 3VJLA 3ZS9A 4Y9SA 1XAHA 5E8JA 1NXOA 1UH5A 4GZLA 4JDUA 3L7LA 2GJ8A 1DC8A 3P4YA 4PYNA 3CKYA 3AM1A 3W05A 5AK3A 4DV2H 4GWLA 1EI9A 2X7JA 3RYIB 3ZVMA 4QBTA 4YPVA 3HUDA 4RPHA 3CX8A 1HDEA 1H0SA 4PM4A 3K94A 4UATA 3ZNQA 4LF6B 3WDLA 3KB8A 1GCOA 3WWEA 1OWOA 4JI6B 1RBMA 2WB1E 3QOFA 4MJ3A 2BE7A 5IJXA 3ZGZA 2W71A 3HDJA 5K8VA 1OBDA 1FNDA 3S24A 4Z4GA 4Y2GA 4H0NA 1DC5A 4BXOB 4TUYB 4KSBA 2QRVB 2Q0QA 3UYKA 3FSGD 4UHKA 4OQXA 5AVQA 1I13A 1JKJB 3L7JA 4P4SA 1T2VA 3JVIA 1VE7A 3AKYA 2QRJA 2E85A 4NJOA 1T4MA 3B1JA 3D9QX 3ZU6A 1AXRA 3B1WA 2V5UA 1NSTA 2H1WA 4M21A 1U8AA 3ME5A 3HB7A 2I1VB 3NDRA 3ZI0A 3RR5A 1ZXLA 4IICA 1HORA 4TV8A 1KMIY 1G2IA 5DO9A 1JQ5A 6Q21A 4DS3A 2RDMA 2PRKA 2W6QA 1SIBE 3LOQA 1G5QA 2A5YB 2HBYA 1W88B 1JSLA 4HDSB 3WRXA 2Q0SA 3EFHA 4HXEB 1L7PA 1SC9A 1DKRA 4H08A 3MS2A 3E2PA 1X7HA 4FIZA 3LPCA 3IILA 3O8NA 3U3XA 5ER6A 4B8YA 1E9BA 3DC7A 3VSDA 2ZT8A 1Y6ZA 3DVLA 2JL1A 1D3AA 2P5YA 4BVAA 1X74A 4BVKA 5AJVB 4MRVA 2Z98A 4YJHB 2X40A 4PYQA 1E79A 3MEQA 4BVFA 2X0RA 2VDWB 3W5JA 2PYIA 1YNOA 5K0NA 3HPQA 4V0RA 4A8HA 1RI2A 3DDUA 3SZOA 2BHLA 2JFYA 4Z9XA 4C7JA 5CT6A 4RO0A 3A9TA 3C8HA 3BG5A 1KSHA 3HXOA 3FHCB 3TFQA 3VC2A 3GV5B 4MIYA 1VJ1A 3F4LA 3DGEC 2RGYA 4EJ0A 3OHBA 4LI3X 5EXSA 2IYLD 4I8IA 3W4IA 1SGWA 1KZ7B 3RFVA 5CXSA 1Y6RA 4C2AA 3KKOA 4OFWA 4J6EA 2ACKA 3AUJB 4RKRA 1UBSB 2XZPA 3JARB 3W5UA 2UXDH 3C5WP 2XV1A 4DLYA 4OLHA 2Q27A 4F4IA 5ALDA 2XAAA 4HNVA 3NGMA 3F49S 2QVGA 2IYVA 4BQPA 5L7WA 1MGPA 5EUCA 4U7JA 1DOHA 2PG3A 4DLVA 2XYHA 4NP6A 2ALJA 1PV4A 2WLTA 1FP2A 4FYKA 1UMDB 1CLEA 1EH5A 2X9QA 1NW7A 4IJWA 4TLMB 2XYGA 1XQYA 3ZHSA 3BMOB 1LSUA 4TKVB 1USIA 4R1PA 3AUAA 1OFGA 2Q0HA 2Q8PA 4EW3A 2YNMC 4E88A 3W79A 5JZ9A 3SX2A 4NESA 2Y1FA 3QUBA 2B35A 2WWHA 1CP3A 3SXPA 2DLCX 4GKVA 3AEKB 4BQQA 4DCCA 1T3GA 3P2IA 3ZR4B 4FM9A 1E2JA 4UNPA 2G40A 5KMGB 4L8LA 3PC3A 3ZVKA 3O0TA 2C4MA 1I50A 3LVRE 5KVAA 4RA9B 1NVWQ 3GAFA 1RTTA 5IU6A 1WCXA 3RC1A 3TEMA 1XCMA 5LN1A 4R1OA 4S35A 3U7HB 4XUEA 3OZBA 3LQKA 3OTGA 1P31A 2FEMA 4HNAA 4DFDA 3MNFA 1U9IA 2HL6A 4NCBA 3IIJA 3PDJA 4FPXA 3M2TA 3KKKA 3AKDA 3V33A 3MD0A 4JROA 4Q4DA 3IC5A 2YTZA 3AHCA 4TT8A 4TWBA 2FFQA 3DE5X 3QPVA 4D98A 5FJJA 1ZISA 3KC2A 1I4TD 3I8XA 1E7RA 1JIIA 4RK1A 4KKXB 4H1VA 4CHIA 3C5HA 4IFIA 2AD5A 2KQUA 4PZ8A 3LT0A 2ZQZA 4RD3A 4HDRA 3UJ7A 3F8WA 2F8SA 1CY4A 2NU8A 3D6MA 5BSWA 4L02A 1ELOA 2AUTA 4C0SA 3PX3A 1N5JA 4EG8A 4NNJA 4I4NA 4KHPB 1TEHA 5JVDF 4S1TA 3DTNA 4NXNH 2ZLBA 2JASA 1OYWA 3CF0A 2PO7A 3QELB 4DG9A 3D8NA 4F06A 4PXAA 4AI6A 2JA6G 2OP1A 4YT8A 3NDPA 2H1FA 5C52B 2XCOA 3JV7A 1TYZA 3ECCA 1IN5A 3WKCA 2MMGA 2A5GA 5F12A 3HB0A 4PAGA 1A9OA 2IHBA 2JGIA 4QJFA 3NUZA 1I2ZA 3FMOB 5IUJC 3ZCXA 1G8GA 3ZKWB 4CPDA 1RZ3A 3A6FA 3G17A 2B63A 2NN3C 7ABPA 5DAAA 2VUIB 4KKVA 5LXTA 1AGNA 3KE9A 2X4DA 3AUYA 2ZRLA 1N7JA 1XNRB 3VU0A 3OCWA 1H65A 5E6SB 2PZ8A 3G2HA 2VFAA 3A25A 3G2KA 3KQYA 3SS8A 1GR1A 4HZGA 4D0LB 5EJGA 2RARA 5CFOA 1H6CA 5ITSA 4ROSA 4G86A 1YB4A 3VH4A 1QX4A 1K7CA 2HB6A 4A0QA 1Z6YA 3NBFA 4CR7A 3IIIA 4QJ3A 2B9VA 3MERA 2CJWB 4A73A 3FCSB 2JD0A 5K6AC 3DAAA 1KMNA 1MB9A 4LZOA 3P27A 3BB4A 2BSXA 1B6TA 4D9NA 2FMKA 2GEUA 4HWKA 3BXXA 3ETEA 2ZAMA 3IPRA 4O3RA 3BFKA 5KREA 4ZVPA 3THYA 4MB0A 1PDVA 3OFJA 5EPOA 2GLUA 4OAQA 3VZCA 4MJ7A 4RIEA 2JEFA 4BNNA 2R7ZA 1MC1A 4M1QA 1V2HE 2FX2A 4HDAA 2G72A 1RAFA 2R11A 1HQYE 4BNZA 2FLLA 1O0CA 3OMLA 1OZAA 1KXZA 3ZBQA 2Y0SA 1ZZEA 4MWTA 4CLOA 3RIMA 1KZ9A 5GJBA 5EWLA 4EW6A 4QLBA 4CLRA 4U2CA 4CTJA 2MSCB 3HJNA 4OX9H 5CB6A 2HJVA 2E89A 3IXMA 5ERXA 4RMJA 2E4YA 2F3QA 1TM1E 1M1YB 1R1DA 5CA0A 3Q2KA 3EBPA 1WDMA 1QFJA 2ZB7A 2SCUB 5CJPA 4ZJPA 5LMUB 3O8OA 1EUCA 3BRQA 3H8WA 3CZMA 2XI4A 4OLFA 1M1YE 2O4CA 3EFOA 4BUJA 1GVNB 1R10A 3VAYA 3W2GA 3SYTA 4KAJA 1QHEA 3TBKA 3B8EA 121PA 1Z4IA 3L2PA 3KDSE 4MCHA 2MCFA 3RT9A 3K9FC 5HFNA 5KDOA 2GN2A 4L2IA 4A8JA 2OQRA 2E5FA 3QKUA 2A9PA 4O7YA 3QWIA 1VIYA 4M0CA 2B34A 2CCGA 2YFKA 2VPSA 3BQ1A 1GQSA 1CQIA 1M2WA 3DO8A 2GXAA 5C37A 4DSZA 5AQEA 3KYIB 3HR7A 4WE3A 2GFIA 1WU7A 3MMZA 3NYWA 1XP8A 3T7TA 4YIKA 5I7RA 3NWJA 4KDEA 2E49A 1GADO 3EBOA 1GRQA 2PGDA 4JBLA 2VXBA 3IHLA 3CISA 3E9RA 3WWDA 2HHJA 1I30A 3MS4A 3RAEC 2PL9A 1M0WA 3DEYX 5BQFA 2HOQA 3RV3A 4OFXA 5FI1B 1I14A 4BB0A 5J43A 5KQMA 4BX0A 3C5VA 5EJEA 1T6NA 1O89A 4HSEA 3E0QA 1WCIB 2CT8A 3W6PA 2OBXA 1IQRA 3KJNA 2FRDA 2Y92A 1ZSVA 1FNMA 3IVGA 1COZA 4TLDA 2WWGA 2HVSA 2ODPA 3RNOA 1ZN7A 3DEHA 1IWOA 1ZAYA 4OHRA 4H59A 1E4EA 3T1OA 5IDXA 4A82A 5IM4F 3S81A 4KGVA 4L0CA 5E9QA 4H7PA 3HBNA 4ARAA 3OOYA 1RJPA 4UCUA 2X9NA 4YT4A 4AJOA 3EPIA 4JUIA 1U9CA 3KPYA 5IJ0B 2F7SA 3LHIA 2CKMA 1VLHA 4LSXA 3H40A 2O6HA 2AFIB 2I7XA 5ELLA 2HA7A 3ZHOA 4YUYA 1YS1X 2CLMB 2TS1A 4PZUA 3IVXA 1AN9A 2C0PA 1Y82A 2AGVA 2FPSA 3GDEA 4AQYH 2GJ4A 5FPHA 4BFYA 1KOFA 2CHFA 1Y48E 2IWRA 3RFFA 5GINE 4CL8A 1VDMA 2CD7A 2O5VA 2Z2JA 4HYQA 4WK6A 4RVUA 3KRTA 1CS0B 4PZ0A 5CG1A 2MTBA 4C30A 3ISVA 3O82A 4NCAA 1W4BA 4A0HA 4IJMA 2ZZKA 1OA1A 3JPYA 1Z35A 4QATA 2E4WA 2ZSEA 4E46A 3D6TB 5GZ3A 2RH9B 1R6TA 1YL5A 1NBEA 1P7PA 1Z2NX 1JBKA 2W2KA 3GPCA 1KP2A 1SHTX 5C7YA 4EGQA 2BI4A 5L95A 2VYFA 2YU9A 4D8XA 4LISA 4B4WA 4ZXFA 2IYQA 4LYAA 3W8FA 2HGSA 1XQ9A 1A9YA 4IGKA 1RQGA 2FGKA 3B85A 1H6DA 1C3LA 4BO4A 4YEDA 1IB0A 2MT9A 5J4LA 2G09A 2VQEH 4LYYA 2HKIA 1YDEA 3SKYA 1UWKA 1YMQA 1NAIA 4DM4A 3W3AA 1ZJJA 3IT0A 3DBOB 4D44A 2ONKA 2YQ4A 4Z3DA 2HMAA 4JC5A 3JQEA 1I2MA 3L8GA 3HJBA 2VTVA 2FK8A 3BACA 2CCJA 4AO8A 1V47A 3TDMA 1ZM4A 1K63A 4RXUA 2ECFA 5HSGA 2QXUA 4X93A 4V0LA 1OH8A 3VBCA 2VDVE 3K73O 1Q2UA 4N5MA 4BDTA 3AHDA 4B76A 5K8TA 1DJOA 1H69A 3D3WA 4CV2A 4UC0A 3WO1A 2WF7A 5KVCA 4EKDA 1A8QA 5FL3A 1CEEA 1VKHA 4Q9JA 2F1OA 4F3TA 3GJXC 3HDYA 4F85A 1NKSA 2B3TA 1XEXA 2WMDA 1SO8A 3HNPA 1NVTA 3RHSA 1EZ4A 4N0PA 1WSDA 2YWCA 4QE3A 3MN1A 1WRBA 1Z06A 4TVKA 1KMHA 3F5SA 3GFFA 5HS6A 5LZ9A 5EMHA 1Q0UA 4WLUA 4DV7H 4F3YA 2E2HA 3NHYA 2WUDA 3KTAA 5ALKA 2QXTA 3JATB 3N2IA 4X94A 1V9PA 1R5OA 1S96A 2Q62A 3FUWA 4XFKA 2G06A 2ZJ0A 3SCZA 3DDWA 2HLDA 2DXIA 3I01A 3OCJA 2PRZA 5D1HA 5CEJA 3K31A 1L5KA 1EUYA 3NVKI 1ML3A 3VNBA 2CNLA 1AY0A 1U0HC 1LH0A 1LF5A 2Q1TA 3OIVA 2NT3A 4IR1A 2KPOA 3PNBA 1C0LA 2LR0A 3QIVA 4ZYWA 1GGOA 1E3WB 4JJFA 4BXXG 4MV4A 4FLMA 1YACA 1WCMA 1QG6A 2BTQA 4N3BA 4UUAA 3OE5A 4IDEA 2Y1LA 1YCHA 5IP5A 4M8NE 1NMEA 4NOJA 1GILA 5EJ7A 2ACVA 4MUAA 3MR6A 4RZ3A 1R9JA 4KFTA 4L50A 1J24A 4LDZA 5FUQA 4O2BB 5BPFA 2J48A 1E77A 3ZEAA 3HZZA 2HX1A 1WXHA 1TAGA 3QU4A 3EOBI 2RHBA 5FUWA 2J9FB 2W4IA 2JIRA 1QGOA 1GFSA 3CRQA 2A3NA 1M34A 1WWKA 1Q84A 5KYXB 4H7IA 3O4VA 4ESEA 2X3YA 1QXSA 5EXPA 1G7TA 5K0GA 3KJEA 4U6NA 1QTIA 2ZI7A 4U63A 4EG3A 4AO6A 2PX4A 3OIDA 5FTWA 1KDTA 4BNGA 3LDUA 4IVPA 3KEGA 4NMMA 2Q3MA 5I9LA 3F5FA 4D4IA 3BXZA 1S2DA 1WTCA 1JDBC 5CLJA 2ZSKA 3HV2A 2R84A 5LP1A 3A4LA 4YX9A 4RNNA 2VJBA 3REOA 3KALA 4HRVA 3K9QO 4B4VA 5SZKB 2V0CA 1J5EB 4IVRA 3BIWA 2AN5A 3HZHA 2XUDA 2Q4RA 4XSVA 4JT9A 4RVDA 2O3UA 1JA9