2R85A

Crystal structure of purp from pyrococcus furiosus complexed with amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
334
structure length
330
Chain Sequence
b'MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGKGYFLAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurP protein PF1517
publication title Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 108
structure length 330
sequence length 334
chains with identical sequence B
ec nomenclature ec 6.3.4.23: Formate--phosphoribosylaminoimidazolecarboxamide ligase.
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06849 DUF1246 Protein of unknown function (DUF1246)
A PF06973 DUF1297 Domain of unknown function (DUF1297)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2r85A02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r85A03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r85A01
2VPQA 1WR2A 2W6MA 4O2AF 4HQ6A 1C3OA 5CA1F 2J9GA 2C00A 3AX6A 2R85A 2NU9B 2W71A 3HB9A 3BFPA 4IWXA 3JZIA 1A48A 3VA7A 2NU6B 2V5AA 2CNQA 2ZDQA 2YS6A 3BSYA 3UFXB 2CZGA 5K2MA 4I4TF 5BMVF 2YRXA 4DIMA 4YAKB 5D8DA 4O7VA 4O4JF 5KX5F 4ME6A 4YBZB 1BNCA 2W6NA 1Z2PX 2I80A 2ZDHA 4I50F 3U9TA 1VKZA 4MV1A 4IZOA 3R5FA 1PX2A 1DV2A 2GPWA 1W93A 4M98A 2YZMA 1EZ1A 2Z04A 4EABA 1Z2NX 3VPCA 2GPSA 2IP4A 5LP6F 4DLKA 3MWEA 4O82A 4O4LF 2I87A 1EYZA 3BSSA 1CE8A 2YWVA 3E5NA 4HR7A 5KKNB 3NUAA 3RV4A 1KUTA 4XYMB 4EGQA 3MWDA 4MA0A 2X0SA 3U54A 3G8CA 3ORQA 4EA8A 3RV3A 3OUUA 2QF7A 4FFMA 1OBGA 3HO8A 3N8DA 3VPBA 2I8CA 3Q2OA 1JKJB 1E4EA 1GSOA 3ETJA 4O4HF 4O7LA 2PN1A 3SE7A 1EHIA 4IHJF 3TINA 1JLLB 1AUVA 2FP4B 1KBLA 4XYLB 2XD4A 4FFRA 3QFFA 4O84A 5GONF 4FFOA 3K5HA 4O7TA 2OLSA 2W70A 4IIJF 4O7NA 1EUCB 4FFNA 3KALA 3OUZA 4ZOLF 4MV7A 2V58A 4EA9A 2YS7A 4MV4A 1OBDA 1I7LA 3VOTA 4IWYA 4M9CA 4XZ3B 5LYJF 3LWBA 2YYAA 4TV9F 4YAJB 2CQYA 5HV6A 2GQSA 3R9RA 4MV9A 4O4IF 4XX0B 5LXTF 5BPHA 5C8YF 3JRXA 5JVDF 1JDEA 2GQRA 3BG5A 2YRWA 3TW6A 3TIGA 2VHEA 2YZLA 5JH7F 1AUXA 3LP8A 4E4TA 1ULZA 3R23A 4O7RA 3GLKA 2W6QA 3I12A 4FFPA 4YJ2F 3RFCA 5JVLA 1KJIA 2GLTA 1UC9A 1BXRA 1B6SA 4MAMA 4RZQA 5J2TF 5JQWA 3U9SA 4EAAA 3VPDA 5H80A 1KJJA 3HBLA 1CS0A 2R82A 3KAJA 4C5AA 4J6EA 1VBHA 3GIDA 2W6ZA 2VQDA 3K5IA 5LA6F 2SCUB 3DF7A 2HGSA 5I47A 5CAEB 4O7WA 1DIKA 2YW2A 3V4SA 5J2UF 4YJ3F 2V59A 4FE2A 4MA5A 4ZHQF 4O83A 2NPOA 4HNTA 1I7NA 1Z2OX 2NU7B 4C5CA 2DIKA 4HNUA 2W6PA 5HBRB 1SCUB 1M0WA 4ZI7F 5C1PA 4FU0A 4I55F 1C30A 1CQIB 1W96A 2PBZA 4YB8B 3WO1A 1E4EB 1KEEA 1EUDB 5IYZF 4EGJA 2FPGB 2PVPA 4MV8A 4M99A 4O2BF 1B6RA 5FNVF 1CQJB 2CNVA 3MJFA 3N6RA 4O7SA 3AW8A 4EG0A 3G8DA 4Y8VB 2DWCA 2Z02A 4TV8F 2R7LA 2R7NA 2QK4A 2XCLA 2NUAB 2W6OA 5BPFA 2ZDGA 2R6FA 5C1OA 3KAKA 1DV1A 2FPPB 4O81A 2HJWA 1IOWA 1GGOA 4HNVA 1A9XA 3K3PA 3TIIA 3BSWA 1KC7A 2R87A 3RUPA 2CNUA 3KREA 4EA7A 4O7YA 2NU8B 3U55A 4FGRA 3R5HA 3JRWA 4MV3A 2DLNA 3WNZA 3Q1KA 4L1KA 2YZNA 4FFLA 2R84A 3ORRA 1JDBB 1GSHA 4O7ZA 1PK8A 3R5XA 5EZYF 1GSAA 2YZGA 3JZFA 5CA0F 1M0TA 3V4ZA 4GGMX 4WBNF 2R7KA 4ZQIA 1KJQA 2FB9A 4O86A 4QSHA 1M6VA 2R7MA 4TUYF 1VBGA 2R86A 4C5BA 3WO0A 1IOVA 5DMXA 2WYOA 4WD3A 4NYEA 1T36A 1UC8A 2FPIB 2YL2A 1KJ8A 2P0AA 3VMMA 2VR1A 3ETHA 5JQGF 5CB4F 2DZDA 1KJ9A 5LOVF 3TQTA 4M9UA 4MV6A 1GLVA
chains in the Genus database with same CATH superfamily
4DNQA 3I09A 1G8FA 4ADSG 2HHLA 3UY4A 1LBSA 2BKXA 3WHKA 2C78A 3FETA 1HWYA 1G8PA 2R1TB 3THWB 2Z9CA 1F6DA 4JUBA 4CV0A 2X1HA 4DSOA 4G0ZA 1TEHA 3NETA 3AVXA 2P9YA 1II8B 1BJKA 2EJWA 3CMCO 4R6XA 5IXSA 2HXYA 4YVFA 3IJPA 5BMVB 1TJNA 4G4IA 2D00A 3NWOA 3GFQA 4A91A 1U90A 3RUDA 4L75A 2KBEA 3EVAA 4C9BA 1WSDA 4UJ3A 2QTVA 3VAAA 3PITA 2FQ1A 4BUCA 3HN7A 3KDPA 5G4KA 2BFPA 1R0CA 3INNA 2AFHA 4M22A 3HKEA 4RGBA 1NW8A 1Q1NA 1AZWA 4Y2YA 2F1OA 1BMFD 1CUGA 2Q4RA 2XQIA 4NCJA 3ZNQA 3DOOA 3N87A 5TMEA 1VFPA 1I5RA 2AQ4A 2QSYA 2PLRA 4EPVA 2IOYA 5L3RA 1FZTA 1I4OA 1GPJA 2A7XA 1QC5B 4WE3A 2HWKA 4K2HA 5LZ9A 1I0ZA 1L7AA 2Y1CA 2O8BA 2BBOA 3WWOA 5MGBA 1WKVA 1ONSA 4NCHA 3GN1A 2PUCA 2O50A 5CXSA 4ILEA 1P2GA 1SZDA 2PKCA 2V7QA 2PMEA 3FZQA 1UJ5A 4AY5A 5IT5A 1NYQA 2H52A 2PZAA 1QJCA 1WMAA 3GCGA 4FB5A 1BCRA 1QOPB 3LTEA 3PW0A 4L6CA 4MMZB 5TSDA 5AKIA 1F1BA 2XDQB 5DWDA 4FFNA 5KFOA 1CU1A 1XWWA 1A1VA 1J97A 3RWOA 5ALIA 3WLRA 3NP9A 1OUMA 5JYCA 5I5WA 1V7PC 5E2AA 2O2GA 4OP2A 1KI3A 1MABB 1UMBA 4IIFA 5I5TA 1US8A 1L4NA 2F3TA 3QKWA 1FDIA 5CHYA 3WNBA 3DZIA 3NTVA 5FBVB 4RMNA 1EVQA 4NF2A 5EXXA 4EEKA 3ESZA 3EDRA 5KFCA 4NULA 3A25A 1A4IA 1EGHA 1P29A 4ECUA 4LN1A 3NKVA 4Q6BA 1AKUA 4PZ0A 4L74A 1KQFA 2HNKA 1UC9A 2C4KA 3ZY4A 3UK6A 4FHGA 2VP4A 4RFSA 4CLXA 1GPKA 4ZKEA 3CSDA 4AP5A 1X1QA 3BMQB 4R7GA 3SFTA 4EVQA 4KSYA 2SCUB 4E1BA 2Q5EA 3WQRA 2Q2WA 4DSUA 1VB3A 4WLNA 1UDCA 3UK0A 3CXUA 4RDCA 3ZGXA 1ZVKA 1U28C 4YCJA 2YBEA 1OT5A 3AT1A 2EX1A 1Z12A 3PDJA 5LDDC 4B6EA 1BEUB 1P4AA 5KFTA 1RI2A 3L93A 2E2HA 3WWZA 2Z58A 1K7EB 4FZRA 1ILWA 4LBYA 1S6YA 5CLHA 2QJFA 3UEOA 4RXUA 4UNNA 4J07A 4LCJA 1EBFA 1J5EH 2FRXA 4E5DA 4XLTA 3PCRB 3PK0A 5HEKA 3JRWA 3ZDBA 2QRQA 3FCYA 1Z0DA 5IN4A 1V4YA 1AMUA 4HGRA 5KVQA 2MYTA 1E2BA 1VIDA 4HX2A 3OURA 3FGNA 2Y1OA 2WM8A 3EJ6A 3E8SA 1GKUB 4JWKA 2O8DB 1Y3AA 3FJ1A 2J3QA 4A2BA 3E9NA 5EUBA 2DKNA 5HM8A 1MORA 3EVNA 3C97A 3RRFA 4LH6A 3M83A 3PC4A 1TMOA 4X3CA 4BMDA 5B64A 4XD7A 2AGVA 4GPTA 5LQJA 4C08A 3STUA 3G49A 4F4IA 2XEXA 2G1KA 2X8AA 3LNCA 5F73A 4A3JG 4Q0YA 1U3TA 3SYTA 1QRSA 1AGPA 2OP1A 1OFTA 1CB0A 2C5EA 4G07A 2DGDA 2GAAA 4HN9A 2X0EA 4G2NA 4JJKA 2NN3C 4IX9A 3DUWA 3QVXA 3ON5A 2WWVD 5BSGA 3TEMA 1EP1B 4CTNA 2H2IA 3NYIA 4IKPA 2Q0SA 2OENG 3JALA 1PNTA 4UTRA 1DC3A 5EMJA 4KE6A 1DXYA 1E1NA 4RJJA 1QH8A 4OK3A 3SBEA 3PJRA 4RKQA 1KAQA 4UCVA 3J7AK 3U7QB 4O82A 4L0MA 1BXGA 3SR0A 3AINA 4OJMX 3MUOA 4ZQHA 2FJUA 3HV0A 4IOLA 2ZE7A 3RASA 3W06A 3OT1B 2XUHA 4QXMA 3T7JA 2R7ZG 3L1IA 4HS4A 2GRUA 2VTBA 1I0LA 1ZQ1A 3DEAA 3QMWA 1DSSG 1P5FA 1COZA 2L18A 1SN7A 5L3SA 3N5CA 3SSOA 1HI9A 4PWQA 5IWAB 1Y6QA 2HA5A 3SNKA 1RJDA 2PXAA 1W94A 5TPWA 4DQKA 5KTOA 4G84A 4QOSA 2JEIA 2WAOA 5HQ3B 4I5DA 3EDOA 4FLFA 1A7UA 2ACWA 4N3CA 1LTHR 2DUUA 4AICA 2NUAA 3ZE1B 3EPHA 4RULA 3CCFA 5HQJA 1I4DD 2ERCA 1PR9A 3OI7A 1JEYB 1DL5A 4X3OA 4L8WB 4RVNA 2VT3A 4FZVA 3ZHXA 4M7EA 4IIUA 4OQPA 2BKLA 4EBBA 2ZYIA 1GJRA 3WL8A 4KNVA 3CJQA 2XYRA 4HG2A 4O4IF 1XZIA 8LDHA 2ZYGA 4CEHB 3GV7B 3OKPA 1XEWX 1U7DA 1HL7A 4CUZA 1DJOA 3JQRA 1PEAA 2QMYA 3O9MA 1VFNA 2DPGA 1ZD3A 3OZCA 1H0KA 1I3NA 5JWRA 2HJRA 2IRWA 2FSFA 5JUMA 3WOHA 1B0AA 1PWZA 4B73A 4UMFA 1R3UA 1K5DA 4IMIB 3JYHA 3PNOA 2IEDA 4QPCA 4J6EA 5LA6F 1OFUA 4RVGA 1Y1LA 3B6EA 3R3XA 4TQ9A 1PKEA 3EPLA 4I1SA 2ZS8A 1HQCA 4IHJA 1A97A 1YRQA 4L9SA 2NSYA 3UCFA 5GIOE 5KG0A 4EM6A 5J2UB 1QBKC 2RDJA 3UWOA 2CLLB 3G13A 4ECSA 3AVWA 1CY0A 3U7JA 3H4BA 2VUMA 3RODA 5C7LO 1KO7A 3DLPX 1Q95A 5FBLB 4MLCA 1DAOA 1RJFA 4XQ9A 3QMPA 4J9VA 1RWMA 4NARA 3C7TA 4TV8F 1A72A 3DVAB 4GKBA 3TEFA 4U0KA 3ZVNA 4K6MA 1Z5NA 3WNDA 3GEDA 3T5LA 5BN3B 1E8DA 1QF9A 2Y2UA 3JQ7B 1F3OA 1T8PA 4RPIA 4KVZA 5TVKA 2HZ7A 2GWRA 1XDZA 2OXEA 2HMUA 1GGEA 1HUQA 3TD2A 1IUKA 1LVGA 2FQYA 4C7XA 3WWCA 3EXIA 2FW1A 2VNKA 1TC2A 3L02A 2QQEA 1BG6A 6ABPA 1O58A 3SD7A 4DXDA 5LIRA 1ONOA 2KW5A 4BVEA 3HRKA 3JZMA 3HCFA 1VDZA 3BILA 3RRYA 2H3HA 4OHXA 1RJEA 3M4YA 3CLVA 2CXQA 3WGGA 2ZQYA 1SXJE 3OZDA 4RC9A 3HABA 3PX3A 4XZ3A 5I5UA 2AMFA 1HYBA 2QLBA 1R0RE 1MC8A 4BP1A 1ZNXA 3JZIA 1SQGA 3AJ9A 3KOXA 1ECCA 3KPVA 2B37A 3D6VA 1O08A 2PEZA 4FNMA 4U2GA 1CPYA 3HR4A 3NPMA 5KINB 3BWDD 2HRRA 3TJMA 4XDHA 4N3NA 3UC9A 4WXPA 2BISA 3ASZA 3OCJA 4YRIA 1OI2A 4GXRA 4YEDA 4P82A 4YREA 5FA5A 3AFHA 3G6WA 3OWXA 3V4VB 2PL5A 3TUIC 1IZ8A 3BH7A 2WE6A 3IX7A 4YR7A 5UKDA 4DCOA 2CJWA 1MOZA 4CCSA 3IIJA 2Q3FA 3MAAC 2XVYA 4G9BA 2VHCA 1ZBQA 1X7XA 4H4DA 4R6WA 4D0LB 2PD6A 4JKOA 2XWQA 5I51A 3TOXA 1LW6E 4PAGA 3ANLA 1A9XB 1D04A 3HC7A 3C5HA 4PLZA 5SYNA 2EFHB 4TX1A 3B6MA 4B3RH 2UZAA 4UBOA 5KNDA 3VYSB 2ZRDA 3FG9A 1MB0A 1MQSA 4FLMA 3KHRA 1FDSA 4I46A 5BUZA 4O3FA 2YV3A 3KLOA 3AJDA 2G5GX 4URXR 3OQ1A 3MS7A 3LUGA 1NDHA 5T8KC 3ABIA 2BAGA 2WFZA 2JIMA 1BDIA 3KU4A 4GICA 2VJNA 5I4CA 4CBVA 1L7XA 3S2UA 2G6TA 4BO3A 4DABA 1Q3KA 2EGHA 2Z0MA 2QTFA 1QCYA 1K75A 4WIAA 2CJFA 1WZEA 3G6VA 4M76B 4UMDA 2FUG1 4ZVRA 1JF8A 4BQPA 3CX4A 5A5EA 2QMOA 1W47A 4AYXA 4QKQA 3DXYA 1Q0ZA 4IGEA 2PTHA 1XCBA 5KFUA 1GUYA 2O05A 1EU1A 4XVQA 4WL0A 4BGIA 4ZCTA 1PRYA 1LPBB 4P0PB 3MJTA 3ZZ1A 1N6NA 4EKEA 1OD6A 3E2PA 1F8UA 4LC1A 4S0XA 4IIBA 3UBTA 3CW8X 3FDZA 2CJYA 3PFKA 1UBOS 4Y2GA 3BL6A 3HBLA 2HXGA 3FOCA 1SVMA 4YFVA 3WKEA 3MCVA 1YZFA 2EDAA 2B25A 10MHA 5CNIA 3Q0IA 2AYZA 1E66A 4UC0A 4W6QA 3Q7SA 1LF5A 5FTMA 4ZT6A 1ZISA 1GXSA 3UTDA 4H7EA 5AWFC 1TYDE 3GVCA 3LHDA 1NVKA 1H3FA 5IJ0B 3OQVA 2APJA 4O6VA 1V2HE 1XXHE 3K8YA 1ZN8A 3R7DA 3EGEA 4CCAA 2OCDA 4TMZA 1RKUA 4PIPA 4BC1A 1J33A 3QITA 3SFZA 2O2CA 1PNOA 2G6BA 4U2DA 3MWKA 3TZKA 4E2FA 3AIOA 1BS1A 3BBLA 2CMHA 4I19A 3LQQA 1WQ3A 1ZC4A 5B6IA 2C7RA 2WIKA 3D4BA 2V9WA 3HBFA 3DMTA 3L4KA 3E3AA 5ALGA 4AULA 1SXJA 1E6MA 4OB6A 4TLLB 4PYRA 5GP1A 3ROKA 5CFZA 5TT0A 2NYRA 4UBJA 2GM3A 3H5OA 3KQNA 4U5XA 1KEPA 4DM4A 5D3KA 5CA0F 1RWNA 2OB1A 3WQBA 3EARA 1UKCA 4K9PA 3H7IA 3RT9A 2X9LA 2OMEA 1J5EB 2AK2A 3GP3A 1Q19A 4YDRA 2C83A 3FCEA 2JW5A 2YJTD 2NXWA 2P0YA 5BSRA 1BZYA 3UAWA 5K45A 4BWYA 3HOUG 4TLEA 3TGPA 2KSQA 1DC8A 1N9ZA 4R8MA 2ODAA 4W9NA 3QMMA 4QQRA 1GD1O 4X6YA 1IATA 4UFNA 2ASJA 3U3RA 4CZ2A 4KGZA 1BE0A 2GN1A 2P1DA 2H5EA 4BZXA 4B40A 4A2CA 2FR1A 2W6CX 3N2ZB 5BWBA 3PGMA 1ZXBA 4D96A 5EA2A 3TQRA 1JSCA 1N0HA 1TWGA 4MVXA 2E89A 1WO8A 2P1ZA 3PJEA 2WWFA 2YQ5A 4BQQA 4CE5A 1C8LA 1P1HA 1Y81A 3BOSA 2NO6A 4D4MA 3DZJA 1OX6A 5K0TA 5FPYA 5ECDA 1XFDA 5CFPA 1IAVA 4AWXA 4EEYA 4OFWA 4I14A 5L9AA 1GNRA 4BO9A 4BKUA 4MJ3A 1ILEA 1AN9A 3FWYA 3EVCA 5DLEA 1ZIOA 1ZICA 2HMVA 4RANA 1U1FA 2GMWA 3NHPA 3KWFA 3DTGA 5EOYA 3O3OB 1DTEA 1YK0A 1IHUA 4I3FA 3QG1A 1IQUA 1JQDA 3PDUA 3T7IA 1Y3BE 1JN0A 4KXVA 4YCDA 2NSDA 4L76A 2V5VA 4E31A 1JKJB 1Y0BA 4DCCA 3F7MA 1DMSA 1A71A 1IJEA 5FPOA 1FW6A 2PUHA 1ODLA 4UVEA 2WF7A 1YDHA 1LLFA 3I6YA 2ZIUB 3IESA 4LF4B 4DSAA 1WTAA 5GONF 1SVKA 5T6BA 3UXHA 4I1UA 1IY0A 4TLBA 4J75A 4P7KA 5I7FA 4CUJA 2NX2A 1K8QA 2Z5GA 2GO7A 5JRJA 4JSTA 1VAJA 3QYJA 2MU1A 3ZHZA 3F3KA 2PJUA 3RYIB 5JNUA 5HBGA 1L1RA 5JCPA 4YJHA 4MSUA 2CHVA 2ON6A 4C0WA 1WP4A 4PTLA 3C1UA 3KQHA 4ZVMA 5F9LA 4B17A 1JTFA 1NC3A 3ZU6A 1PTJA 1RIFA 1R0LA 2EBUA 2QTGA 1XXHA 2IX3A 3GEIA 5KFHA 1WOYA 5HA5A 1J2UA 3CE9A 3T54A 1IC6A 1A7KA 3VFDA 1V7QA 1KJZA 2YIVX 2RGDA 3R2JA 4HMPA 5IHPA 3I4NG 3HCPA 4JP5A 2PMZE 2HGZA 4KN6A 3IVAA 4G09A 1YL5A 3BXEA 4LE0A 4HPXB 1L5ZA 1CD5A 4E1VA 3Q11A 3JYNA 4CLDA 2Q46A 3EXHB 3IYLW 3DPIA 1I7NA 3F7TA 3WLFA 5EESA 2JA5A 4DL6A 1PEYA 2XB8A 4CYMA 2O9JA 4NCBA 1CSEE 2GM4A 3JZDA 5AM5A 2A9KA 1QFZA 1KE2A 3PUKA 3PF9A 5C35A 1T25A 4UE6A 1Y7IA 3CGGA 2H4YA 1G8YA 1SUCA 3KXYT 4ZT3A 5CM9C 2OWDA 1DKLA 5BOSB 3OZAA 1WCIB 3HKBB 3W5CA 1X87A 1WLSA 3ROTA 4MUKA 4NPHA 2BDUA 2IOFK 3H2ZA 4BBPA 3GH3A 1Z22A 1YJXA 2WD8A 1KO4A 3DKKA 1IDN1 1PGJA 2A3NA 1NRJB 4NIMA 2CL6X 2NAPA 1GGJA 5IFKA 4GVXA 5EJIA 2YWJA 2EP5A 2V4MA 3MWMA 4DR1H 2A0XA 4NFHA 4M4SA 3AR4A 4HLQB 4S24A 1ODKA 3C24A 1RHUA 1OLUA 4OHCA 4TWZA 4JROA 5J43A 1KK0A 1C80A 5LYYA 4K9MA 1MUUA 2YQ4A 3KP1A 2B94A 2Q2OA 3AERB 3PJDA 3VQTA 3GNTA 2J4FA 5FUYA 1EZ4A 2Q6OA 5IAGA 3VR3D 5LKRA 1HYGA 3KJEA 2HNAA 3QHAA 3AMVA 4FMPA 2WWXA 5EIEA 3G59A 3H6KA 5AQEA 5ALXA 4KPEC 2Q2NA 3SLGA 4MHOA 4Y18A 3KKEA 1YV9A 3ZJ5A 5BQFA 4IG4A 3ZW9A 3I1YA 1QONA 2H0QA 5LWQA 2ZIWB 3KXLA 3AUFA 1LNSA 1J20A 3V2IA 4WN3A 3BCSA 3KLBA 5DW3A 1QCCA 3ROFA 3I3OA 3AWIA 4YR9A 2IBMA 1E62A 4OFBA 4ES6A 2D59A 4UXJA 1F2UB 2ECOA 4HK4A 5CM8B 4LXYA 1QM5A 3SK0A 5B1DA 1E3IA 3M4XA 3N2KB 4U9IS 5CE8A 1HMYA 1E3WB 4MW2A 4UTZA 2G71A 1FFHA 4NZMA 3FMGA 4JC0A 4HWSA 4CM1A 3T3EA 3NYQA 4JUFA 2QPLA 2IDMA 3L8YA 1WUHS 2P4EA 5FWYA 1JSRA 1WDLA 3IILA 2YXPX 1Z08A 3Q7IA 1VS0A 5D51S 1XTJA 5JVDB 3WBJA 2B92A 3DNPA 1AKRA 1WAMA 1IULA 5K3AA 1ZW1A 5A6SA 2PZKA 2ZG6A 5B3LA 3EBLA 2DFTA 3K2EA 5DVZA 2HQOA 3KKKA 1T9AA 3B1KA 1F20A 3E48A 4KX5A 1KMHA 3KVYA 1G63A 3R6DA 3QQMA 3EIEA 3M9NB 2Z6UA 2NAFA 4ZVSA 4CQMD 1GSOA 2AN3A 4I8IA 1CUBA 3W05A 1V26A 1VHWA 2RHMA 2EAUA 5JNTA 3RWBA 1QH1A 1NVAA 4P0QB 2XUQA 4MGEA 2C2GA 2O2ZA 2GT1A 3EISA 5HJ7A 2R2GA 3QFFA 4YH1A 1SXQA 4GYJA 1Y1RA 3R5TA 4B3RB 1TMGE 4K6CA 4BMYA 5AVRA 1I7LA 1W88B 1MG0A 3WZMA 1NLZA 4DTIA 1I2BA 5KSWB 2AX4A 1JR3D 2PMZA 4EGCB 2NO4A 2ZAOA 2GQSA 3PE3A 5AHWA 4Y6GB 3VR4H 2CFTA 1RWVA 3AOEA 2BLLA 1PGNA 4YQFA 3UH0A 5B30A 2AXQA 4MNTA 1G6Q1 3GDFA 4DR4H 1M10A 5FI0B 1Z2EA 3FTPA 4ZK2A 1OXUA 1KXZA 1QIFA 4ZO6A 4P6VF 4JI2B 3ILHA 4QOIA 4G8CA 3TR6A 5EJ9A 4MK4A 2ZJ5A 4P7BA 2QYZA 2CMGA 1ZK4A 1FQKA 3B89A 1NBMD 2OQIA 4HWOA 1A5SB 4YMWA 1UC5B 3KSMA 4MYDA 1JVSA 2QIPA 3OU7A 4JJFA 4PGAA 4GC7A 1Z15A 4YT2A 3CH4B 1FJXA 3OEYA 2G36A 2DLCX 3LHSA 2NPOA 4AJNA 1ZCZA 4FQ8A 1AK1A 3MD9A 5KFQA 3DMHA 4ZHQB 1TCUA 3HVRA 4BY1G 1D2HA 2VXYA 4TMKA 1TM7E 1P31A 5TGZA 4PICA 4R84A 2VCYA 4CFSA 3EPRA 3TLMA 2J31A 3TRIA 3JQFA 3IRUA 1ZG3A 4EGFA 5IN5A 4PFQA 4ZYWA 4LYFA 3HEBA 4NYJQ 2I55A 4J1SA 2PH5A 5INTA 4O3PA 2PXHA 3G2IA 5J47A 3TLCA 1N7JA 1ZYUA 4J9LA 3STYA 2W00A 3IP5A 1RCTE 3PL5A 5EQDA 4EFDA 1Z39A 3FOBA 3TOVA 4EPXA 2ODBA 4QEKA 4BQEA 4KO4S 2C3YA 2YJ6A 5IASA 4UBIA 5HRCA 1L3IA 1SBTA 5HIJA 3GG9A 1K6IA 1IYEA 2X0JA 2PRZA 1O77A 5MN4A 1EIZA 3FYUB 5C37A 2NW6A 5CAEA 2CEKA 5C3EG 2Z9DA 1OKKA 1NI3A 5E6RB 5CYGA 4Q93A 4WGFA 2B5VA 3EMVA 4NJMA 3W7AA 3PGXA 4LF9H 3RSHA 1E1QA 5AI5A 5FCDA 4ZV9A 2O2YA 4IW3B 521PA 1LDGA 5JLJA 2AC2A 2OV8A 3E0QA 3C3PA 4X00A 4EVSA 5C5EA 5IZCA 3H1TA 4P31A 3QMVA 2FLPA 5GPBA 2CBXA 2HHHH 4RSHA 4NCNA 3BFPA 3CU5A 3H4MA 3OZ7A 1HNWH 4R9UC 1VL2A 4OHBA 5JD6A 3EG5A 2QMZA 3Q5DA 2WTNA 2ZDQA 2BR0A 4O4IA 4YRLA 5JRZA 3BIOA 3BHNA 1FX0A 2G5PA 3QBJA 4IILA 3ST7A 2C3OA 3CUTA 2YKGA 4WN9B 1N6OA 1RYMA 1H4QA 1DVRA 4LDZA 1IWOA 2W8BA 1KSFX 3AJAA 1F3LA 2OFFA 3DL2A 1XHFA 3B7PA 3OWOA 1VMAA 4ZVTA 3QENA 1OVGA 4UW9A 3H2SA 2JK1A 3MR2A 3QZUA 3WVNA 1N2CE 1KDZA 5LA6A 3DBRB 4Y6PA 1IBSA 3BGDA 2X5JO 3UMJA 3AKZA 3AHDA 2PVSA 5DISB 1KU6A 3KAPA 3H13A 1SK8A 4PZDA 4CQMB 5L53A 2WG1A 3MINB 4UD2A 1C4KA 2DLDA 3OAAA 1V9LA 3RFUA 1X8LA 2LUOA 2AR7A 1KRXA 3OZEA 3PYXA 2OD7A 4MQ5A 3EULA 5BWRA 4RPCA 4QXPA 3OLCX 2X4LA 4OXQA 1PR5A 1QTRA 4HQ0A 4TV8A 3IMFA 2UYOA 4LOJA 3AF1A 1QZZA 5NULA 4ZOEA 4CEIB 4EG1A 3PV0A 3A31A 2IBSA 4Q7KA 3OX3A 1DAKA 3D7MA 4KJZA 3CUEF 2AOUB 3EGXB 2DQKA 2OV2A 4BLQA 3D9QX 4XUEA 4MIEA 3KYHC 2VZEA 3AEQB 3B36A 2HX1A 2X40A 3RBZA 4ZV7A 4QW8A 3I5YA 5F9FA 2YZLA 1AH2A 1KC3A 1QMGA 4RQAA 2ID4A 2KS6A 4QC2A 1XOIA 4MVJG 2JLUA 4H1VA 4DG5A 3BH0A 2GLXA 1FNBA 4IRCA 2GLTA 4LF8H 1AC5A 4IEIA 1T4CB 2H54A 4MVJF 4BQIA 2MSCB 4QDTA 2Q1YA 2JA6G 1FSSA 2ANBA 3HPQA 1DEOA 3AGPA 1QP0A 5C5IA 4MVJI 1E96A 5L4NA 3VR4D 2FEMA 2HRBA 2NZUG 5KFZA 1LU9A 2HWXA 4HNQA 1OZHA 4PZPA 1NNSA 2NQTA 5TY0A 3NH6A 2G76A 3I0NA 1GDDA 2J33A 4YHHH 1NQ5A 4PN7A 3DBHB 1J7JA 1QIJA 1RTTA 1WUTA 2EBFX 4AURA 1L5FA 4ZEOA 2D2VA 3BHMA 2CNBA 1L1EA 2H1HA 3NZEA 4Z4QA 1W4AA 1FUYB 3QJGA 2FSUA 5KFJA 2C4WA 1P81A 1YASA 2H4JA 1EXDA 4FCCA 4B83A 4CF6A 3I62A 1QOZA 5IP5A 3WDKA 2PD4A 3E18A 1QDUA 2ATIA 1GGHA 5BP7A 2HHFB 2JLQA 3QP9A 2DUMA 3QE3A 1L8LA 1YGPA 5REQA 5KDDA 2R1VB 2WUVA 1XCJA 4CKWB 2ZJ0A 4DQLA 1C4XA 4UCXA 1EDZA 3OC6A 4V2IA 2Z95A 5IAAA 3L7JA 5I4KA 2AEMA 3A6JA 1TADA 4D9MA 1R66A 3W7BA 4C6RA 2WF9A 1W9MA 3R0JA 2YIJA 1WH2A 3T7DA 2AOTA 1ULAA 2BHSA 3N6VA 1IAQA 1LSUA 4LJ8A 3C0KA 3ZY5A 3UAGA 2BGKA 1NNEA 2FMXA 2W6ID 1PYGA 1M1YE 3N8IA 1C7RA 1RMYA 1X1TA 4C89A 2L42A 3VU8A 3WR5A 4I5FA 3DWEX 5AVYA 5SICE 1W2WB 3TQFA 2BM0A 1YBMA 2UYCA 3HUTA 1HT1E 1OOEA 5KFAA 3GFTA 3GIIA 1IHYA 4KFCA 4P36A 1TKAA 5JSQA 2J6IA 3EQ8A 3OHMA 3W3AH 4KQ6A 5AKGA 5BR4A 2W8LA 2R85A 5H68A 1N2CA 4PGMA 5KOJB 1C0KA 1Y1KE 1SC9A 2ACEA 3K1AB 2CNQA 2IFTA 3ASUA 1QDLB 1E61A 2CZGA 2A8YA 2JLVA 4G97A 3ND9A 5DNYB 2N75A 2AK3A 5G2OA 4OB7A 4BMNA 3CEBA 1FDWA 2PGDA 1ZNZA 1N6RA 3ICPA 4YXWD 4G0NA 2R4QA 4M0PA 2W9XA 3BKWA 4ECRA 4DARA 4DMUB 3HU1A 1WVGA 3BRWD 2GCOA 1O94D 1Y6ZA 1A8SA 1O95C 1HE3A 1X70A 4EBCA 1DJNA 3ZXUB 4NNOA 1T9GR 1QTIA 5LP6F 1AG9A 3AFOA 3DDUA 3C8DA 1RZUA 4DA0A 1NKVA 3W78A 2HCFA 4MRPA 3SAJA 2OCXA 4BJ5A 3M6IA 1QYIA 4FX5A 1YBHA 1U3CA 4KI7A 4J7UA 2GOYA 4HGYA 1DUVG 4B7AA 4HQFA 1IJBA 1VKNA 1QK4A 2YVKA 4LGYA 1UMDB 3ND5A 4R1UA 4ECTA 3IRVA 3TTVA 4R7RA 3DZ8A 1QSGA 1W52X 4KYUA 8ATCA 1WMSA 3A28A 4CM9A 1HRKA 5F12A 1VG8A 4OU5A 4FYHA 4UU7A 1YB2A 1YI1A 1M6HA 1SWWA 8ABPA 4ZT4A 2IOFA 3FPEA 1KPIA 5E25A 3U56A 1S97A 3DMFA 1RM0A 1MO6A 3IELA 4V2UA 1LK0A 3I8OA 1FTQA 2FR8C 2HSWA 3KVVA 4MS3B 4LJRA 2GD1O 5K8UA 4JI4B 1KI4A 4WNAA 2OHIA 4D4LA 4MRAA 3PJFA 1WQ4A 4Q21A 5D1HA 2QAGC 2YV4A 2ENUA 2II6A 1H42A 4V02A 5CA0A 3AYXB 1YQEA 4AKEA 2IY9A 4RD3A 4EK9A 2JVKA 4M7OA 4J0JA 2BGGA 2QJWA 4Q18A 5A9RA 1TAQA 4YCNA 4MXDA 2FDCA 3A1FA 3OLYA 1KJJA 3OCYA 3VHRA 4EB0A 4BVFA 2FQXA 4O3NA 4G86A 3A1CA 2DUJA 4Y3UA 4X66H 3ZD7A 1JX6A 4DR4B 3AO0B 4HDNB 4DLAA 1W0JD 1O6FA 5LQMA 3V8MA 3NV9A 4P86A 4E6NA 4NQZA 3GRAA 3FA2A 3SHVA 1EEHA 5A5DA 5CGQB 5I5XA 3C98A 4FU0A 3L43A 4TL7A 4W8HA 5KFRA 2RJ3A 4RY2A 1ENYA 1W30A 3KXDA 3U4QA 5LZ7A 2D7CA 1DTWA 1M1YA 1JZQA 4P54A 1GQOA 3KX2A 1F8GA 1ULHA 3GRRA 1XWFA 1YVEI 3A6DA 2ODWA 3ZCQA 2Z02A 5GMOA 4D0GA 1Z9BA 3MR5A 3ZV3A 3L8ZA 2BLNA 1NVVQ 4HFMA 4FBUA 1OLSB 3LIIA 3IFSA 3NBXX 2G9VA 1IXSB 2ASLA 5MN6A 2B61A 1GA4A 4E46A 5BV2P 1JPVA 1XAHA 1B16A 1KIFA 2OD9A 4X95A 1XDSA 2NZXA 1R5OA 3HCBA 4CE6A 3LLVA 1MDBA 2C9BA 4PLVA 2WZQA 4KWEA 4A4DA 3P52A 4OA8A 4JI0H 1CY8A 1YB1A 4OFZA 3MELA 3EZ2A 1Z73A 3F4KA 1X7ZB 2JH9A 2WSSA 1CRPA 3TAUA 4Y2PA 3GRZA 1ZCJA 2I1LA 5EMKA 2H2AA 4EKIA 3GDEA 3M6XA 1MNAA 1FFYA 1U7PA 4BWFB 4E6EA 4CKEA 3RU7A 3AX6A 1PVDA 2GEBA 4R9SA 3DTNA 2E82A 1JIVA 3H9GA 4LXHA 1FYWA 3ND8A 4LF9B 1YULA 4KWHA 3E9RA 2AJ8A 3V1MA 2H1LA 5EHIA 1YR2A 3CKLA 1JZTA 3B1XA 5THQA 1R4MB 5JXHA 1P4RA 4K9RA 4XSHA 1JLMA 1SBQA 2CD9A 1IBCA 3I04M 5CBPB 3MGCA 3JAMW 1TGYA 4ED1A 3ZCXA 2I80A 3IXLA 3W1EA 3W3AD 3RS8A 3RGZA 1IE3A 1K5HA 2B20A 4CQLB 3UW3A 4LV5B 3ER6A 3C74A 4BQSA 4XPZA 4JL6A 4QVKA 1Z5PA 1IN6A 3LT1A 1WB4A 1ORTA 4IHKA 1GL9B 3W2GA 1CP3A 2IHYA 4XWAA 2IJGX 1W44A 3LI2A 3RVMA 3I9MA 1LLCA 4B2YA 4IXMA 3EGIA 5FPSA 3AEYA 1G3RA 5HR5A 1NPYA 3MCUA 4QQNA 2Y4OA 3F3SA 3U62A 3A2KA 4BNVA 3IAS6 1H6DA 3IBGA 5B3JA 4EG5A 2V3WA 1XZPA 5AXBA 2MWMA 3HOYG 3JD0A 3TH5A 2QLTA 3BZBA 3WY9A 1TI7A 2NVUA 1ODFA 4RK7A 2X77A 4XRGA 3DZCA 4BV8A 2V4QA 3NCHA 2OPBA 1V5IA 3C6XA 5CH8A 1S68A 2HAEA 3IQIX 2O48X 2XGSA 4GKAA 4I50A 1E4OA 5FNVB 2Q41A 3KIPA 4PZ8A 4JGBA 1B73A 4W5RA 5J63A 3HSSA 5HKAA 4POOA 2CWDA 4KRYA 4URUR 4YP6A 3A9RA 4FVTA 4KWCA 3HYNA 2E5LH 1UEJA 3ZHBA 4EYIB 5ALDA 3QNMA 2BGWA 4L28A 2VKQA 4RTNA 1KJYA 1RQGA 4CG0A 1UH5A 4LGCA 1XQWA 3F71A 3N59A 3I0ZA 1QFJA 2CL0X 2ONKA 4MVJP 4ZCIA 3P32A 4XA8A 4V0RA 2E4WA 1UBEA 3PXEA 1DEKA 3PRYA 5KFXA 1ZRHA 4HGNA 3F6CA 4A0SA 3NHWA 2YWEA 4RPHA 4ER6A 4JJ4A 5CYPA 3M7IA 1M2GA 5FPHA 4LF8B 2HGWA 2GA9A 1M67A 3GW8A 4NFLA 4V0LA 4DL5A 3P4YA 2H4FA 2WT9A 1Q0TA 3GJQA 2G1AA 1NDQA 4JQYA 4Q3AA 1QNFA 3RQIA 4M99A 1LQ2A 1LJUA 1XEXB 5HRAA 1NVGA 1Q22A 4YHHB 3NIBA 1Q7CA 2B34A 3UHFA 1JHPA 2B63G 5FBKA 4AY6A 1XVTA 2CE7A 1DB3A 1L7MA 5F1YA 3UOWA 4BLRA 3OCWA 1Z7BA 4J0IA 1DOZA 3FZEA 1J0DA 4CW7A 4J0GA 2H5LA 1CEEA 2WJIA 3CIFA 4CJXA 4MYSA 3T34A 2HYDA 2ZSBA 1PFYA 2X4IA 2BEWB 3WA7A 4Q6WA 4URYR 4AZ0B 2W37A 4DQNA 5DXFA 1D4FA 1DEHA 2NG1A 4MH0R 3VZDA 3ZDQA 3VI4B 1YK1A 1Z26A 2Z6VA 1QQ5A 1ECLA 3OD1A 2C0QA 4QM6A 2J07A 4RB3C 4Y6OA 4FXOA 1S5PA 2ISSD 4LJKA 3BL8A 4GE3A 2WSYB 1V1MA 3Q0EA 4DDMA 2WQ6A 3PL1A 1J1ZA 5IXYA 4F1KA 4N0DA 1XP5A 5HGJA 4B2PA 3OX1A 4QRHA 3JARB 5ERYA 2QUZA 2ILVA 2BOVA 4OI1A 3F5QA 3M9MB 4BX0A 4UAUA 1JQLB 3VA7A 2A58A 3Q8XB 2YASA 4H7FA 1T9KA 1G5IA 5T4FA 3P96A 2FN3A 2E6UX 3S44A 4HXEB 3K9NA 5CLIA 1JSLA 3P5SA 2CDBA 2XGMA 3GV0A 1PG2A 5B55A 1NTRA 2RK4A 1Z5ZA 4F93B 5CDUA 3S55A 3OCUA 3DSRA 1TYAE 4JLPA 2QRGA 2R4TA 1CUVA 3FPGA 5DHAA 5I8PA 2VATA 5LVAA 1E1RD 1P9LA 2IWRA 2QL5A 1L8QA 1BDJA 1SRRA 3P45A 1SGWA 4C1NA 5LPNA 3WZ2A 2XZDA 4JEUA 3AESA 2XUAA 4NBKA 4EFEA 2R6ZA 4DJEC 5KVCA 1UXKA 4BUZA 4EF4A 4L3OA 3GFSA 4BCBA 2P2LA 4U2BA 2OZKA 5I7OA 4XAQA 4EI2A 1M1ZA 4LXXA 5E9JA 1U1CA 2B8EA 1OYWA 3KKPA 4H6WA 4M83A 4B3TH 1XZGA 4ARZA 4MVJE 5H16A 4Q05A 1G7RA 1NRWA 2WT4A 1V5EA 4RHEA 2Z98A 5ETJA 1C7EA 3NI2A 3MA0A 1IXKA 1JALA 1XTKA 5B58C 4KFRA 5MFPA 3AIKA 1X7GA 4XFDA 5G0VA 3V1TC 2PCJA 3BWMA 2F9LA 1AU9A 3AF3A 4CV2A 1RQXA 4NESA 1Z4PX 2C95A 5JYEA 4A5OA 2H2WA 4LHYA 1FS6A 4UM9D 3SDZA 4II7A 4LI3X 1U9JA 3C45A 3ZZUA 1YR8A 2AUTA 5JH7F 5LZ8A 2HA2A 2QN1A 3WQSB 2WBLC 3MNFA 3D5TA 3H84A 4YS6A 2YN4A 3O90A 3CGWA 1GDHA 5HFAA 3W4IA 2R66A 4COOA 2FXIA 4Q4JB 3BK2A 1JLSA 3Q87B 1AK9A 3DAGA 4D1YA 5K4AA 1KVTA 2COIA 3VPDA 1Y1TA 4ENPA 1EHCA 1RAEA 1DXQA 5KMGA 4AKTA 2RONA 5BOVA 4J4TA 3RJTA 1B3BA 2J3IA 3TQ1A 5ALVA 4XM0A 2XVMA 2X2OA 3K1JA 1N4DA 2BP7B 5AJVB 4KTVE 3P97A 2XCOA 3ACCA 3B48A 1OFUX 3OE1A 3CVYA 3GPBA 3DCNA 3RRMA 2N3ZA 3L6BA 4Q9KA 4RAYA 4J0QA 3I2JA 1KEVA 1FK8A 2HD4A 2COKA 2NMVA 5KFNA 3I52A 3ONFA 3D5QA 4XPIA 3IJ5A 3IXQA 4QOJA 4OFXA 5GM1A 1TT5B 2JJMA 3W1BA 1EFDN 3CYFA 4X66B 1C41A 4PQFA 5JSKA 2HO4A 3KZ1E 4BCDA 4AZSA 2XA2A 4L72A 4Z1OA 3TW0A 1VIMA 2JI4A 2GN2A 4DEYA 5C1OA 1L5QA 1DKMA 2RGNC 3IQFA 3EW9A 2B83A 4N48A 2GPBA 2QX7A 1MQAA 3GJSA 4KQ1A 4MUMA 421PA 3FLAA 3KT3A 5JYBA 2C9OA 1VJRA 2PMCA 1KK3A 4BBRG 5KREA 1R6BX 4QPJC 1MR3F 4PXAA 3RADC 3WGYA 3GGGA 3WWYA 2ZZMA 2BR3A 5K5EA 1M6VA 1TL7C 2VPSA 1WDMA 4NWIA 3RVBA 3WQQA 1Q0UA 2CDCA 4R1NA 3L4BA 2WNSA 4LE2A 2P0AA 4LF7H 1T2NA 1WB6A 1A9PA 3ETHA 2CCKA 4NOMA 4BDSA 3I2HA 3HJNA 3GIQA 4LNAA 5GV7A 4MO2A 4O4HB 4Q24A 2FUEA 5EKUA 5JSYA 3FFBA 4ZICA 3KZKA 4CIAA 1Q0RA 4IRXA 4R3NA 4JI0B 4GMDA 4Q0MA 4U5QA 1ZAUA 2GK4A 3VR2A 4MITA 4FYXA 3L5KA 1CIJA 4RAQA 4P35A 3VDMA 3TM4A 3PIIA 4M8SA 2A14A 1MPXA 2Q9AA 3ESAA 1E3DA 2EATA 4YPVA 2CE2X 2FLVA 3EG9A 3VZBA 2VSQA 2G7MC 3SVZA 4WA8A 3L01A 1KORA 1WPQA 3OFVA 4D9CA 5HZMA 3JPWA 4MVJA 4D6YA 4DCMA 1Q7BA 1Y9ZA 4H35A 4P58A 5FBZA 2PM8A 5CVJA 4F8JA 3ZHYA 4QFBA 2VBGA 2HCRA 2UAGA 4O4LF 4UCQA 4YBRA 1WRVA 3CRVA 1LK5A 3DQPA 3OPQA 4P5PA 1ZMXA 4ECEA 1E6WA 1M1XB 4HWTA 2BDEA 4XOIA 1LD3A 3BMCA 1D4AA 4IMRA 5HCIA 4JCCA 1EVJA 3E7PA 5K0SA 4TT8A 5FDFA 3DYBA 4N5NA 4MKXA 4XWWA 2I8CA 3Q2OA 1V6SA 2OHHA 1KEWA 1T0IA 2W90A 4QULA 3E81A 3K0FB 4DQVA 4EHDA 3TG8A 4EPYA 1VYUA 5FTLA 2EWVA 3C6BA 1PHPA 3QQPA 4MV0A 3MWJA 1UM9B 4JV1A 2QU8A 4Y8VA 4RUKA 4OSEA 3U80A 1GTG1 3ZPXA 5IC5A 1UKAA 2N0SA 4EQZA 4TSFD 1TFRA 2IYFA 3NEPX 3E7WA 2BZSA 1KO1A 4JYMA 1Y63A 4G4GA 2UV8A 1I3LA 1CR4A 4TKVA 1XAIA 3W90A 2OG2A 4UM9B 2LXNA 4BMXA 1GGFA 3VU3A 4O5OA 3AUKA 2PGIA 4MCIA 3HKDB 2WHQA 4IL5A 1I3MA 3QKRA 1L2ZA 3PHHA 2G77B 2IV2X 1B15A 4LBVA 4PC1A 5DQHA 3RM3A 1I8TA 4IYJA 5EVCA 4FOLA 1NXVA 1HDGO 2AG0A 2VPWA 1CHDA 2I6GA 4FBTA 3KTMA 3W2FA 4JI8H 4BKPA 4PG8A 5IDQA 1G5QA 1EK0A 2HLPA 4ZOQI 3HYRA 5L7WA 3A7DA 2I66A 1FDTA 3CTPA 1BCSA 4Z86A 1NM5C 4LXGA 3L6DA 2W2NA 1M7BA 5DK4A 3H7AA 3HDQA 2E5LB 3TN7A 2WG0A 3CR3C 5E4YA 2PKQO 1HEUA 3DFUA 3GIWA 4R05A 3THYB 3TXXA 3UJBA 3VOBA 5I3ZA 1VMDA 1CWUA 5IVPA 2OO5A 2ZPTX 4N01A 5GADl 3HYTA 3RTXA 1P6XA 5LB4A 3OH8A 2Q1WA 2VO1A 3EIOA 3I28A 2P5YA 4BGVA 4MJLA 3NBZB 4Q47A 3MJFA 4O7SA 3LFHA 1UBUS 1F5SA 1FTWA 3UM9A 4K9LA 2ECQA 4QYTA 4FM9A 1YMQA 3GLGE 4GMGA 2R60A 4ID9A 4GRDA 4ZCMA 5E8JA 2D62A 1ABEA 4HN4B 4O8ZA 2HJWA 5LP6A 4FDAA 2WIFA 2H08A 4U7PB 2RI1A 3LGSA 1N2OA 1UWLA 4MVYA 4IIHA 3BEOA 3IUBA 2X23A 3I6MA 3NNSA 3ISJA 2M6SA 1H9AA 1G4AE 3M70A 4V1CI 3CXRA 2XX3A 1AT1A 2PT9A 3CF6R 16PKA 3N2GA 4XSGA 2NUTB 4YAIA 3IUNA 1MO3A 3JQ9A 1QLHA 1DTSA 4V0NA 4UVGA 5CT4A 5B58T 4UAGA 2XOEA 3DFFA 3GH1A 3FVWA 3SLRA 1E4YA 4XM2A 2IXFA 4WBNF 2MJLA 1V16A 4D7AA 1W85A 1YI8A 3MWEB 1TQ6A 2ABWA 4FS2A 5BXYA 5HW0A 4YMHA 1PHRA 5JCXA 2J3EA 4WCFC 5CB4F 2FPLA 4AMZA 1MZBA 3R4VA 3PDWA 2YUIA 3IR7A 3L8HA 1LK7A 4WWHA 4JASB 2XC9A 5IT9A 1FLDA 1GQSA 4I9FA 1TPZA 1GU1A 3W2HA 3HBJA 2YC2C 4XX0A 1S7CA 5DBHX 4PY2A 3WI7A 4CTKA 2BZ1A 1LVUA 4Q5IA 2BWJA 4ZK6A 1KOFA 1FCJA 2QYTA 1EZZA 3NC1C 5KX5F 3M4ZA 1H3EA 1XZHA 1F2TB 3RE1A 3DOJA 1OILA 3WLEA 1XQVA 1KEEB 3S81A 4PLHA 4ECVA 1UPBA 2OHGA 4GLOA 2VLBA 1I1QB 2A5GA 1POWA 2ZJBA 1MAHA 2YHUA 2XUKA 4TL6A 4R3UC 1C3VA 3A2MA 3HOWG 2AS0A 3PQ4A 3VVLA 1Z2NX 1VKOA 5C8VA 2IPAB 4HXYA 2ZOSA 4F0JA 3B6KA 1PFUA 1GPMA 4EKGA 3H40A 1KTVA 4KZKA 1TM1E 3H20A 3UJCA 3MM4A 1AQLA 1KQOA 5LQDA 3CEAA 3ZLJA 5BMOA 3FDJA 3T9CA 2QXUA 2WDTA 3OLWA 3QBDA 2BI4A 4X0EA 4IRMA 3SIRA 2ZETA 1FXWA 2EKDA 4B46A 4BNDB 4JMPA 2LE0A 3UWMA 4WOPA 5DXJA 3H4DA 2DPJA 4IDAA 4F45A 3OLXA 2OFXA 4S1NA 2YZKA 4ZO9A 1CUYA 1JXQA 1I14A 4FINA 1V8DA 4AF8A 4PDBA 1P61B 1V9CA 1Y48E 1G7SA 2BEUA 3FKIG 2O6HA 1DIAA 5F98A 3DBLA 2QV7A 1QPGA 1GCIA 3FCCA 3KALA 2XQVA 3CO5A 3P4UA 4UNIA 4E3WA 5EDWA 2GO1A 5D6NA 3AOEC 2HR1A 4DBVO 4RD6A 2DFKB 1UZMA 4B3TB 1OAKA 1L4BA 2ZGIA 4HZUB 1S4QA 1BC5A 3LLSA 1Y33E 3L3BA 2WZCA 4BMSA 5KB3A 4AG6A 1JKFA 4L50A 4HLUA 3TW6A 4MQFB 1U5AA 1C7JA 2VJBA 3AZQA 4Q01A 4PRLA 3A27A 1EFUA 4HPJB 3ILVA 4QG3A 2XIQA 4ZAVA 3W2IA 4CGYA 4G5QA 1WL8A 4BEBA 3DVRX 2R6CA 4EY5A 4KL8S 4Q9JA 3BTSA 2HO5A 2QE7A 1J7KA 3C3DA 2QTZA 3CUSA 2P78A 3EPIA 3PLRA 2YRFA 1UEXC 3OQHA 2I54A 4F4FA 3LYHA 3C6MA 3GLGA 5FLKA 2JGKA 1Z36A 4Z9XA 1M83A 2PO5A 2ZT5A 4YI3A 4QFCA 4LUCA 1IMJA 2C77A 3JQFC 4R9NA 3RTGA 3U61B 2E49A 5HF5A 3U60B 1L2TA 4GECA 1XSEA 3DEYX 3IIEA 2OPHA 3TKAA 4TTPA 1ZCAA 2PS1A 5DK6A 3ROZA 1DBPA 2Q99A 1WDTA 4Z0HO 5JXGA 1I2MA 5KTMA 2ZKLA 2QRZA 2WU4A 2OM2A 4IBOA 4QIHA 1PGOA 1PUXA 1MA3A 2WY2D 3P8ZA 4X45A 1E60A 2DERA 1KH3A 3L07A 4IDFA 1KMIY 3F5FA 3PQCA 1A2OA 3FTFA 4U6PA 4NENA 2D2EA 4QTTB 4IDQA 3NUGA 3WNZA 2XYQA 2C5BA 1NT4A 1HDOA 1AQNA 3O92A 3BGIA 1UFQA 2BSXA 3K1TA 3G2MA 2G67A 1WETA 3L7KA 4BU1A 4EFBA 1IQ0A 5LLTA 1VI5A 3W9SA 1SNYA 4PG5A 3WLTA 2VH2A 5T5QA 1MF7A 1XK5A 1BJRE 2WOOA 4ZHSA 3W4KA 3EWIA 3KHUA 2Q8QA 3C3YA 2C0PA 2ZUVA 3EH1A 3UV7A 4YP1A 3BH6A 1UFKA 2EW8A 4A8HA 2FOXA 3NT2A 3MXOA 2DQ4A 4HT3B 3NUQA 4GSKA 4IMPA 3CLRC 3EQ2A 3TZQA 4BMVA 2CUZA 1D07A 3QRWA 5EWLA 4O8CA 1EEXB 2G3YA 2UVQA 3DFIA 1HH4A 1E98A 2FE3A 4JLSA 4ZDIA 4EDFA 1U0OC 2IS1A 1TA8A 4DCGA 3A6FA 3K70C 4GBGA 4ZD6A 4H77A 4WOJA 4CETA 4LF7B 2M05A 1PG5A 1ZGCA 2AKAB 5L3QB 1UXIA 1UFOA 4BNWA 4X61A 5FXMA 3K92A 3E3OA 4MRMA 3R7LA 4CN9A 3KNZA 4KB5A 4WLFA 4CKBA 2G82A 4DCPA 3BE5A 3GJXC 5CVDA 1DV2A 2LDXA 1G9XA 1XP8A 5DRYA 3QLVC 4RXTA 2FP3A 1NWHA 1SYXB 5CVUA 3WIDA 3HNOA 4AXBA 5AVSA 4FE4A 3GEPA 2A5YB 1SD1A 2YH2A 3F73A 1MB4A 1KU0A 2JI7A 5DCUA 1I50A 5E9AA 2OYCA 4II2A 3AQIA 3SP1A 1XMPA 2O8VA 4DWJA 4ZT5A 3AHGA 2HTFA 3HO8A 4EYQA 2BT4A 3HFGA 4G5HA 4ALIA 4U7HA 3C8HA 4PLCA 5A9SB 1EFCA 4ZALA 3WDMA 2A0YA 3E27A 3WNCA 4LMBA 2IU3A 2ZJ2A 2XD4A 1W34A 3LUKA 3IAXA 4DVJA 4HFNA 3KSDO 3GQBA 3GLFE 1GADO 2OK7A 1CY6A 2WYHA 2YYAA 3QPCA 1OB5A 2XMBA 2AMVA 3EZXA 3CRQA 4JUIA 2QW1A 1QRTA 1ZJ6A 3TMAA 3HN2A 1MP0A 4X85A 4BMZA 3INGA 5HNKA 4D26A 2C98A 1NXPA 2Q2VA 3SR3A 2PYZA 3EZYA 4TT3D 4B85A 5A3RA 2FPRA 3L2OB 2A92A 1GCOA 1R8JA 8ADHA 3RFCA 2J41A 3K09A 1U0RA 3BK7A 2VTEA 3RFTA 4DR3H 4PG7A 4GFDA 1SR8A 3K2IA 4TQGA 2R7ZA 3P7MA 4J43A 3QNUA 2O0JA 5K0JA 3OQOA 2C8VA 1ITZA 1DKNA 3P2MA 9ATCA 4B47A 1QTNA 3G0BA 4A93G 1A4XA 2FHPA 4R2MA 1ZFNA 1XMIA 2I1VB 4ZT7A 4JI8B 3PLAE 3F0TA 4JVSB 3TQQA 1EE9A 3FKQA 1GG9A 3U1TA 5KNCA 4W6ZA 2WP0A 3GU3A 1CDZA 3KJFA 1NONA 2BEVB 2H48A 1TJ4A 2ZSAA 2OR3A 5GAJA 1LPPA 2Y0EA 1T3SA 2ZBUA 3I1IA 3AR3A 2ZEJA 3TW7A 4NBRA 1S8AA 3ED5A 1N4AA 3BGSA 4YO7A 2ZUTA 4MKGA 2X22A 3TKLA 3VR0A 2CNOA 1RU3A 3FVVA 5HF9A 3TX2A 3WX0A 3CPEA 1Q84A 4WFKA 1U0SY 2R84A 2I9PA 4QXAA 3UANA 5EGSA 2VYNA 4LY3A 1S8FA 2I7TA 4N0QA 5JNLA 3OQNA 3EVGA 3W77A 4M1TA 5K3FA 4DJJA 1R9JA 1W4RA 2XMSA 1XBTA 4FNOA 1PJLA 5AKYA 4AUEA 3PS9A 3FUXA 2AG5A 4RV9A 2DKFA 4M8IA 4AB1A 3WJ2A 2JAQA 5CXQA 5DMXA 1HOTA 3H86A 1BWQA 1Z5UA 4ZP1A 4DRXB 3GLHE 3VU9A 5AVXA 2WV7A 4AP6A 3AR8A 4DW8A 5TQ2A 3OJLA 3NBYB 3SS9X 2JI8A 2JBWA 4HQ6A 1RZRD 4MW1A 3ZV5A 2R6JA 3O4IA 1IYDA 3A1EA 4M6WB 4A27A 2A3RA 5DYIA 1AZLA 3D02A 1MVNA 1NX6A 1VL5A 3T52A 3EFOA 3IAM1 3FBGA 4ZCQA 5WRFA 3V46A 3QPDA 4R2WA 1O2DA 5HG0A 1BGWA 2CUKA 2ONYA 4TL8A 4AL4A 1H8ED 3FTCA 3RSOA 2R96A 2ZIGA 1T6XA 3PGLA 2YVQA 3WYGA 1NXSA 5KFFA 2QPTA 2NLOA 4WA7A 1EFVB 1KKUA 2W43A 4TLCA 1PQ4A 5JEDA 3HU5A 3WWHA 4NZ9A 2JVIA 1VG9B 3JTMA 4QGGA 3PBKA 5L9XA 1GPYA 5KEIA 4PVCA 3GVIA 4LZZA 2QW0X 1ODSA 4IJMA 3AXSA 5DGAA 5GWXA 1U7WA 3WK4A 2X6TA 3GLFA 3TPFA 4YP3A 5I7AA 2O7QA 4JQCA 4YI5A 5F2EA 1GUDA 5JWHA 5A5VA 2GKGA 3LT2A 2G8NA 3INYA 3T4UA 3OQMA 4R9RA 4XE5A 1ZIPA 3WL3A 3K72B 3LKDA 3FY4A 3MMSA 4P3XA 2JAWA 1XYGA 1IBKH 4HUTA 3D7KA 4XD2A 4ZDWA 2ZT6A 3HS3A 2EJVA 2VFAA 4HX9A 2V58A 4IR9A 3PNQA 3NP7A 4MI3A 3RS0A 2F90A 1BHSA 1G3QA 4OMUA 5H7XA 3O95A 4PQRA 4LZAA 1C3OB 1MKYA 3B7WA 3IKMB 1XZNA 4FFSA 2C61A 1CUZA 4A6DA 1PD1A 2PVCA 4K6HA 4L9WA 4ZEVA 2X1LA 3UPTA 3N7TA 1N8KA 1Q1EA 3IP7A 5D7NA 3CT4A 2PIAA 1E9FA 3V1YA 1QORA 3TVDA 221PA 2ZWVA 3GPDG 4ZMSA 4RTQA 1GAEO 4ZGGA 3D3WA 3EJWA 1Y8AA 2HIHA 5KKAA 4CLRA 1NMXA 3KAJA 4BBSG 2OA0A 3V4FA 1M72A 1R6UA 1RLMA 1T91A 2EKLA 3EB9A 2NVWA 3F1LA 1DAFA 2WM2A 4G3IA 4KMOA 3H5NA 5FQOA 4DR1B 2C9ZA 1B2LA 1X0VA 4RDHA 2RC6A 1SEPA 3CA8A 4DEVA 2JGFA 4EWLA 1BROA 5ALQA 4OMCA 1V47A 3K71B 2HK9A 3EPGA 1DIOB 3KUKA 1MRZA 4IUDS 2KSWA 1ZC3A 2NV0A 4OY3A 3NTOA 3CB2A 4GU5A 1E2DA 1ZKMA 2JJ1A 4LY6A 4LMAA 4BNYA 1MJFA 4FZ5A 3KR0A 1ZGBA 4JT2A 3QOYA 3RRJA 2RIPA 2O4UX 2W6OA 2R6FA 1IQPA 2WJWA 1MHTA 4O4LA 3GLHA 3RH0A 1PEDA 2X76A 3EN0A 1IUPA 1EX9A 1NIPA 3MW8A 1E7MA 2ZYUX 2QG9A 4RTSA 3Q6IA 1XNJA 4NJOA 4JB2A 1MJHA 3RAPR 1GGKA 2XODA 4L6IA 3AETA 2BI8A 3L0SA 1REQA 3L1VA 4RA9A 2BFDB 2W4MA 3O3NB 1ETUA 5IYCG 1FFXA 3SBDA 4Y0AA 2OHJA 1MHPA 5E95A 3LPMA 1QWOA 3Q5EA 2YNMD 3TI9A 3QG5A 3ICCA 2D2FA 4H6XA 2KI5A 1GM5A 3GZTB 4TWAA 3BXGA 1KFKB 4HPWA 3RK4A 3FSJX 2A1UB 4GXTA 1Z35A 1QU3A 3AWDA 3A4NA 2C7BA 3AP3A 1SBYA 3MCWA 4FMBB 4AWAA 2NU9B 1U2ZA 2E4YA 4O2AB 5HWSA 3SOZA 5F5LA 2NU6B 3UHOA 1TUGA 1N2ZA 3HWRA 3UFXB 3R0XA 2I99A 4NOKA 3W4JA 1Z5OA 3IPRA 4F5WA 2CKZB 1YAHA 5I7UA 2Q5CA 5JS1A 4KBGA 1GV1A 1WVIA 2REQB 3OP1A 5FAKA 3AI2A 3NHYA 1VZ3A 5E6UA 3CLHA 1EVEA 2YXEA 1G64A 5ES4B 2X86A 1XELA 2ZI7A 2QZJA 1ZUNB 1SPBS 3QF4A 1QHSA 1CQXA 1HLPA 2VQEH 3ZV7A 1N5OX 1Q1QA 2A35A 1Z8NA 4QDUA 2J0SA 3O31A 3SJAA 4C6TB 2C9MA 4GOJA 3V4OA 4H0FA 4FOTA 3U37A 3PIRA 3GRKA 1GUZA 4LNUA 3QIVA 4N49A 3BD8A 1KOLA 2XIJA 4YJ2B 3W6OA 2X42A 5KNBH 2Q3CA 1L6IA 2CFIA 4GF5A 4DOMA 2ZWPA 2YY7A 1H69A 1IVYA 1DWOA 5B3JC 4GC5A 3CVVA 4EI8A 4Q4AA 3DOHA 2HIVA 3VYVA 4IVNA 5ADHA 1AV7A 1ZLYA 2XVXA 3A3OA 1JFSA 3TSWA 4YASA 2ZTMA 4DB2A 3BWYA 5AHXA 5IM5A 2ETXA 3WWDA 2QTLA 2GR9A 1MCZA 2ORIA 2X8LA 3E70C 4D4JA 3N0RA 3HXMA 2VRNA 2ZRJA 4QRDA 1P17A 2F4NA 4F4ZA 4AZTA 4DFDA 4V1CA 2Y3IA 3BQ0A 1U8TA 3HLKA 2XCQA 1O0SA 3BEDA 3MJEA 2CXXA 3HDYA 1RAHA 2IH4A 4ZMBA 1CYDA 1VRWA 3JYOA 4U6SA 1QGYA 4I2NA 3M6VA 3GJ0A 4PYIA 3KWLA 3T5DA 1QIEA 4RB2C 2PPVA 1H6CA 3ER8A 3RYCB 4BMCA 1YE8A 1PNVA 4IQ8A 4MKRA 1ABBA 4KR7A 3U3DA 4QGSA 1TOAA 7AT1A 2ZS9A 4OJQA 2X8JA 4MA4A 1TTPB 5FI1B 3U9SA 4OLFA 5CXUA 3ZHVA 1X7WB 4YROA 4AYTA 1DKOA 3K5WA 1MQ8B 5ECWA 1YQTA 2CDNA 4R41A 4Y1RA 1MFPA 2X0NA 4B48A 1IWPB 2F8LA 4X94A 1YB7A 1ZMBA 4XCQA 3DDSA 1M7HA 1CUCA 3TJZA 3MWYW 3DDCA 2CLFB 4YT4A 3DAAA 3CX7A 2WJZB 1QFXA 4AJ1A 1CR6A 5GONA 1T5LA 5KS8A 1CY4A 3P0HA 1LA2A 5DHRA 4TTVA 3FFWA 4PSVA 1ZO8A 2B4QA 3PSAA 2OOKA 3HXTA 4Q4LA 5KX5A 1S0MA 4GC9A 3AFNA 2IIBA 3SI7A 3LCUA 5KQMA 3E0XA 3NNDA 1ZHFA 4Y6RA 4OV6B 1DCTA 4ZQBA 2FZVA 3CWCA 2R8BA 3NNNA 3SQNA 2Q1XA 4HVAA 2IYPA 3GEHA 4M3NA 4TKZA 4DG9A 4J0CA 4ED3A 2F43B 1ZL2A 1CJMA 1XJQA 1GLGA 3T1HH 2HHHB 2MINB 2VQ3A 2W9BB 3L8DA 1HNWB 1EGQA 4EYKA 3ICWA 3EVDA 4TXLA 4L51A 3COZA 4HB2A 2A5DA 5DI9A 3FWKA 1JMKC 3SMQA 1RAFA 4WEQA 2CVHA 3TNYA 3PVCA 1X8XA 4X62H 2CUNA 3M33A 4J0MA 3A6EA 4YCLA 2HDWA 4ED0A 4WBSA 2OCLA 1K98A 4L5YA 3A58B 2FSSA 4MIKA 3Q1LA 4D0SA 3OPYB 3PFNA 3SKVA 4MV6A 1E58A 1R74A 3T41A 3LUDA 4M9SA 2DC1A 2OK8A 1Z33A 3MIZA 3SGLA 2L0XA 3C7DB 4HAOA 4U2FA 1WPXA 5FUVA 3TM5A 4H0NA 4RVHA 1NATA 3V34A 5CJJA 1SUIA 2Y0CA 3ZLVA 2FPPA 4Q3BA 3KQOA 2DR2A 2C88A 4NMMA 1KRHA 1P0CA 5IVKA 1CCWA 3RYFB 4JJ7A 4JQOA 1B1AA 1E0DA 1J70A 1G20E 1LV8A 3HDVA 2QRLA 3R5FA 5EHQA 2NO9A 4GW3A 2QL9A 4B44A 1MEJA 5C8YB 3EX7C 3PDHA 4P80A 1EDEA 3PQ7A 2Z04A 4EHAA 4D80A 4BO4A 4O0LA 1G7CA 2P5TB 2BZGA 1ZM4A 2GAFA 1KTIA 2GETA 4A8JB 3VU0A 4QWMA 2VPZA 5JAZA 4DYDA 2X9QA 1UP6A 2BM9A 2UVDA 4YUVA 2UXDH 5CVCA 3CTMA 1P77A 1YS1X 1X8JA 1PBTA 5D1OA 4JYBA 3WV5A 1G2IA 1XDGA 4GRAA 3I3SR 1DINA 1S3GA 2BBTA 1EQUA 1J8FA 4D8XA 4TSKA 4MV5A 4DCVA 4NS1A 1AUPA 1OV6A 3FR8A 1HTBA 2K2QB 2BCJQ 5AK3A 1G60A 4B3FX 1G8MA 2P4HX 5CM2Z 1TO1E 1J06A 5KNBD 1PUJA 2I2BA 4Q7JB 4DA9A 4IUCS 3T12A 3LHIA 5IANA 1UBKS 3U6BA 2FZKA 3KKNA 4PXYA 4BNLA 3O91A 2PX5A 1D0VA 5LYJB 2HMSA 3UK2A 1YS9A 2PFKA 3JRXA 1E20A 2OFOA 1KIAA 3EA4A 1IBKB 2DPXA 1ZY2A 1HEYA 3O8BA 4HGZA 3T7AA 5FO0A 2AA3A 2Y9PB 3GAMA 4QGHA 1L4YA 3WAJA 3JWPA 4ZTBA 3QY9A 5FPKA 4WFJA 5AQ1A 3T5AA 1QNLA 1YE5A 3UG6A 3ABZA 2GEVA 3S2FA 3H5TA 2QQFA 1K7YA 4FEEA 4JLBA 1D6NA 4JJEA 4UAJA 3DEHA 2P77A 1CZHA 2V1XA 5ENVA 1ZSVA 2DJ5A 4OOFA 1XVUA 2XUFA 1D09A 2YUTA 2XPCA 4FX2A 4O7WA 4QUJA 3PPWA 3L0ZA 2EVWX 4TMWA 3HZRA 4XFKA 4GOND 3L8CA 2ATXA 1QQTA 3WRXA 6REQB 4LJAA 1VLZA 3NHBA 3E9CA 3AW9A 4K5QA 2H8KA 2O3JA 4MW0A 2JD1A 3VH3A 3TY5A 2EKQA 4ZI7B 1C1DB 3EXFA 2CLSA 2QYHA 2FN7A 2R6GA 2C5AA 2YXNA 2B78A 3SVLA 2PWZA 1LZLA 1NW4A 3G5MA 5DNEA 1DAIA 3UGTA 1B8OA 3T06B 4E94A 4QE3A 4AQ7A 5TQVA 5EJEA 1OBVA 2QI9F 1FQJA 2W93A 3IP8A 4NK5A 3EXEB 1W4LA 3LW7A 4XVHA 4RABA 2TMYA 1Y5NA 4RZ2A 3BSWA 3VPXA 4MLZA 3PNMA 1EFPB 3Q1KA 3H11B 5KG7A 1M34B 4WLUA 2RH9B 1EWRA 4B9EA 1NNUA 3H3JA 3DF9A 4F6RA 4CMEA 1P60A 3D0KA 1N2HA 1SURA 1L0BA 3UTCA 4B4UA 1YOVA 3GMDA 2PZJA 3NC0C 2OV6A 4AD8A 3B3JA 2VYQA 1E0AA 1U11A 1MFZA 2ZVQX 1E9EA 4DNXA 5LJIA 1DX9A 4ENTA 3JD4A 1MC4A 4TUYF 4TVKA 3H9CA 2PU5A 1UIMA 1E18A 4QJIA 4ZODA 4F4HA 3U5ZB 5J4HA 1M8JA 1G20A 2JGDB 3IV6A 4TTAA 3KHTA 3O4FA 3HUDA 3DJFA 4KQCA 1CDOA 3MTBA 4A03A 4WZBE 1RXWA 1XZFA 2BMEA 3KL2A 4X8LA 1TUBA 1U98A 3Q5GA 5AM1A 1CF2O 3A9SA 3KB1A 1GKYA 3NEYA 3E2MA 1BJTA 4ZYYA 5JXJA 2A78A 2TS1A 1FVIA 2WJVA 3TRKA 1T2DA 1FIUA 5H82A 1VLHA 5EE0A 3WWJA 2IUFA 1ICIA 2D13A 3HJGA 1OC2A 3HL0A 2MR6A 1VSUA 2GZAA 4CM5A 4R8VA 2DTXA 4G8JA 3WIBA 4YX9A 1DLIA 1PJQA 3E5MA 1V48A 1FFDA 4EB6B 5DM2A 5KYUA 5F5NA 4L02A 3F2IA 3BCRA 1CETA 1QRDA 1D2GA 3O2JA 3DNFA 3D1LA 3A8TA 4RIGA 1EUZA 1MU0A 2IUEA 5F77A 2VQEB 3KQSA 4IZIA 4B6QA 3UUGA 1S2IA 4X7MA 5LJLA 3MYRA 2P91A 1BFDA 2OUKA 3EBPA 4JBGA 4RB0A 1E2IA 1G4HA 4BWSC 2VJYA 3HCDA 4QGAA 1AQ6A 2E21A 3WLOA 4CHGA 3A1SA 4ZPXA 3UOAB 4E5YA 2R62A 3O8NA 2RHDA 3OU6A 4F71A 2X2FA 3EYAA 2QM0A 2ZATA 3DMTC 2ST1A 2G9NA 1EKFA 1SXJC 2IF2A 3TNFA 3X1YA 2X9VA 4MYCA 4UFOA 5H02A 2RMKA 3K8QA 4G85A 3K9QO 5C3UA 1RJRA 3D3QA 3WMRA 1EFRD 2Q5LA 4LY0A 3RBEA 3TD6A 4OQLA 1XMVA 1Z4NA 1AF7A 1OIWA 2H63A 1DAPA 2Q3DA 3ND6A 1Z0UA 3QUAA 1RBZA 2G5CA 1XZAA 7ADHA 3A1NA 4I3GA 4IEEA 4TLAA 4HO1X 5BVGA 4L3VA 1XDUA 2PL3A 1P2SA 2Q6VA 2CCJA 4KFTA 5EN4A 1GITA 2IXGA 3IGFA 2F59A 3JASA 4WFQA 1JQKA 1UM8A 3QYFA 4TM5A 4X7PA 1FLAA 2PZLA 4CKYA 4W9NC 1BU5A 2OO5C 4YCSA 2I4OA 1JWBB 1LX7A 3OX4A 1E2HA 1K68A 3LQSA 1UMKA 2ZFUA 4LXTA 4XIIA 4QVIA 5LOVB 4ND1A 3SYRA 3NT4A 4E1AA 1K6JA 3I9LA 3GLIB 3NKFA 1A69A 2J48A 1XCGB 3MPUA 5DLYA 1T0HB 4F38A 3RI3A 3RBVA 3GRPA 2F48A 1SG9A 2DG2A 3KSAC 1CB7A 1LBTA 4D8UA 1TAGA 2XA9A 4HNVA 3VKUA 6LDHA 5JHGB 3H5AA 2XJ9A 1ATZA 1Y1QA 2JIZD 2FDXA 2JS7A 3T8YA 1Z0JA 2B1QA 2HI0A 4YRRA 3ORRA 3E9DA 3M6WA 2BJWA 4HQKA 3MCAA 1DDOA 2R1UA 1IY9A 1QG4A 3HG7A 2P6RA 2NVYA 1FXSA 2AL7A 4ML3A 2C7QA 1ENPA 2JA6A 4N76A 3OT5A 1Q17A 1TQHA 4B2IA 4E0BA 1M2EA 3OJXA 1QGAA 3RSFA 1NFRA 1YHZA 4U0JA 4EJMA 1TGVA 1TO6A 2CY0A 2HU8A 4D9KA 3LA6A 2IKSA 2XQFA 3T1HB 3BT7A 5A2QA 2FPIB 1MJNA 1D1TA 2QZSA 1EJ2A 3C5VA 4CM8A 2FLKA 1PR6A 3IODA 2CNNA 4A16A 3WAGA 3N75A 1RQRA 5K09A 4HDRA 4P38A 5JD4A 3QV1A 1GEGA 2WILA 3ZWKA 1PO7A 4M0FA 1QHIA 1I1NA 3KV1A 2J0UA 3BWVA 4GOXA 5BWWA 2RHTA 4X62B 4A15A 4Q1BA 1HT0A 2WU1A 1KJWA 3MHPA 3OKAA 3VO2A 2IEYA 4GRIA 4M49A 3D4LA 3A6PC 1BVUA 2XHEA 4UUPA 3DFKA 2HU7A 3TEKA 2TMDA 4L7QA 2NZJA 1PTJC 4MR7A 4ZCLA 4RH1A 1GZDA 5BW4A 3MJ4A 4TQUS 2G83A 3GDWA 3W79A 4FR5A 1O96B 4RWZA 2NTEA 2J3HA 4JHLA 1PFGA 4LCEA 4W8OA 3VNBA 3CQZA 1TZBA 2W7TA 1J0XO 3QUSA 4BNMA 1EXMA 1TLFA 3DO6A 5CX1A 2R8RA 1J90A 3KHLA 5H3HA 4NONA 1FNMA 1M73E 2J5XA 3KYDB 1KP3A 1LQTA 3C16C 1I5OA 4RS4A 1I36A 4RTJA 2P0EA 2FZWA 2NIPA 5E6SB 4M1OA 1CQWA 1RADA 2YXBA 1XT6A 5C80A 2SICE 3PKZA 4OQNA 4LSXA 1C3JA 4M0KA 4RKWA 2XNHA 1Z7YA 3C6KA 2EYUA 2UXDB 4O08A 1DNPA 2TECE 1HEIA 1M8PA 4WFIA 4AQDA 5AVZA 3I8SA 3FPCA 3QELA 2ZJ4A 3WSWA 2E1PA 5TR9A 3VOTA 3D59A 1FDVA 2AV6A 1WKBA 2F9FA 2QTTA 3I6ZA 4DA6A 1QB8A 5DBEX 4L8FA 3OEEA 3GILA 1T1IA 1GL6A 3J7AC 5A5GA 1F60A 4UOZA 1JU4A 1YZLA 4BO2A 1OBOA 2NZ8A 3ZD8A 1DBVO 2AFIB 1WHSA 4UVHA 5BRJA 5KVVA 1R50A 3OOYA 5JJLA 4JOSA 4HVLA 1OMOA 4KH1A 2XNSA 4CR7A 2CLIB 4EYSA 3AJ8A 3L41A 3A2LA 5JMPA 4D3DA 1YBFA 2JAUA 4LG1A 5ER6A 4FT4A 4B35A 1SUBA 2VF2A 4B3XA 1Q14A 2BFCA 2WAXA 2CLOB 3NTQA 3LGXA 5JRDS 2FI1A 1LSOA 4D56A 1B2RA 3I04A 1A0GA 4XJTA 1QG6A 4KMSA 1B00A 2VRBA 1H1TA 2YY5A 3FBTA 1KARA 2CLKB 2VJMA 1ZI9A 3ENWA 4FWIB 2R8HA 2HQRA 3KDSE 4C5CA 3V5NA 3V1KA 1OXMA 1HQKA 3ADOA 4PNZA 4RU1A 2K7ZA 4M1MA 1SOAA 3PC8A 5C44G 2QZ9A 2P11A 1NXTA 5ILQA 4Y9UA 4BB5A 1K5GA 4M9XA 2WAQE 5F7XA 6ADHA 3B9QA 4DDWA 3COSA 5EYPA 1IH8A 1XD2A 2R8EA 1ZM2A 3PKJA 3CUYA 2P68A 3W9YA 3RF6A 3S27A 1SFRA 2LW7A 5JAUA 4Q7EA 5KC8A 5A2GA 2DX7A 3QOXA 2ID7A 5KTKA 1GFWA 4EMSA 1Z7WA 2JGLA 3DV0B 1NF2A 1TEZA 3DVLA 4K3VA 3OQIB 5EIBD 4N47A 4LRQA 3QPAA 4D6XA 2QPAA 1X42A 5KSYA 5ESDA 1RRGA 1WWKA 2FETA 4I9NA 1AUQA 3WFIA 4QPDA 1GKIA 3DBVO 4LE1A 3A9UA 4YRQA 2CNWA 2AWNA 1GZ6A 3BXOA 2WSMA 4EBDA 4UMEA 3MR3A 3GJRA 3O7MA 2KLBA 2X5OA 4GI1A 4BP8A 3WWPA 4LSZA 2Q5QA 3L7CA 5KG1A 1JHYA 3AL3A 4EG8A 3RWMB 4MW7A 3E05A 4E88A 2GBGA 3I4FA 1U2PA 3ASVA 5CYFA 4BV9A 2BI7A 1MRSA 4R83A 1T2AA 5CA1B 2B6HA 5DI3A 3NHSA 2N1BA 4I9GA 3DW1X 1SA0B 3UMVA 3G9QA 2ODNA 1IVNA 2C3UA 2PFSA 4MYHA 3DQZA 4GM0A 2Y1LA 2ZZKA 4I4TB 3Q8RB 4CMIA 2NXCA 2H17A 4HEJA 2W4QA 3BMNA 1G98A 4J9PA 2Q4DA 3ZTTA 2FWPA 1UBTS 3RK0A 3VR5A 3GQVA 3DZKA 1TZKA 4OQQA 3AF4A 2CK3A 4N7JA 4MYTA 3NRJA 3V32A 1PJCA 3KB6A 4EUKA 1SKYE 2XTMA 4HS9A 5KKCA 5LXTB 5ALZA 1WABA 2XWSA 4PS0A 1HT2E 2G72A 3PA6A 5TC4A 1QX4A 3CZAA 3THSA 2JFBA 2Q7XA 1Y8RB 3M8KA 1ZMOA 3NDPA 4EKNB 4INAA 2OCIA 3GWZA 1FMFA 4MAFA 3LLCA 4KYTA 5G40A 3WGHA 1FUUA 1L5LA 1I4EB 3EASA 2OP0A 2YOHA 1IY1A 3IG0A 4PS1A 1FLNA 3B1WA 3JYQA 2FPGA 5ANRB 4H6VA 4G5OA 5JJBA 4QTUB 2ZUBA 4XH9B 2VHVA 1NQVA 3QVWA 2HU5A 1KL7A 2WU8A 4AJJA 2FKAA 4GHWA 4IHAA 4JLKA 4Y2UA 4D02A 4XQEA 4P3YA 5DDIP 3LCVB 3I64A 1TJ3A 3V2GA 4G0VA 1XPRA 3HN6A 5KFYA 2IZ7A 5K8IA 4J4BA 4WK6A 2AZDA 4PW0A 2HK7A 5H3CA 1KFBB 4YXFA 2JJ2A 5C1DA 3QKUA 4E4TA 5ELXA 1PAUA 4ZJYA 2Y8EA 1KPGA 1AHNA 5B36A 4P2BA 1T5SA 3S7ZA 2A2ZA 2XKBA 2QRKA 3T3PB 5SY6A 3I83A 4LZPA 2WAQA 5K9ZA 3PNSA 3ZWCA 3AFMA 3SZMA 3ZKWB 3DXZA 3RVJA 4FMDB 3LJKA 3IE0A 5IZCC 1OWNA 2ZSEA 4UEKA 1RVDA 3RC7A 1RKBA 1FP7A 1RRPA 5FTWA 1VKRA 3OO0A 2OECA 3ZK7A 4JB8A 3KZOA 3QBEA 4FI3F 1HM5A 2W6PA 2WHPB 4PIVA 1KMNA 1T36B 3LBAA 5CNJA 2WUWE 3RBDA 2ENWA 3AVUA 4YBZA 3UF0A 4ZOAA 3N58A 4JLJA 3LVQE 2ZVJA 5DTRA 1CZOA 2EV9A 4Z2YA 4JS0A 3RIEA 2C35B 2Y4NA 3DTFA 4BP3A 4FP9A 4Y7DA 1QLJA 2GERA 1FVFA 1WCWA 1G9SA 3BS4A 3UXEA 3TL3A 1WCMG 3BJIC 3BPSA 4R54A 1OB2A 1HLGA 2JHPA 3Q40A 1K92A 1GQFA 5KG5A 3K3PA 3A32A 3SIWA 4GPAA 1TEVA 3D81A 4HDSA 1UZLA 3CM0A 4JFAA 1UP4A 2MCFA 1VPWA 3R9KA 1EVLA 4GZ5A 2CFCA 1P8AA 2YMQA 2JFXA 2QDKA 3U1BA 4JYAH 5D01A 1OYOA 4LSGA 1J1IA 3USZA 2C28A 4ENQA 1XL1A 3G2LA 3ULKA 4WY8A 3QYAA 3QXSA 1WSCA 2LBPA 4JYPA 1KK2A 5PNTA 2WU3A 1I6MA 1FC0A 4G89A 1U8FO 2WD7B 4YDQA 2R00A 2UUPA 3VX3A 2V96A 2CFMA 1JRLA 2VXCA 2PTGA 4P4GA 5JI3E 4WGGA 4Y9TA 2CHQA 1D0IA 4N82A 3PI7A 1MX1A 3HB4X 4H3KB 2Y1WA 1WBJB 4UCOA 3PICA 5A7GA 3T1YH 2VPQA 1D1SA 5JTUA 5EI5A 1LRKA 4MDEA 3DE3X 2YVAA 5DU2A 4JBYA 3UWDA 4PSUA 2O8FA 1BMQA 2AIRA 4XVCA 2C2DA 1TMYA 3E15A 5IUJC 1VRCA 4C2AA 3DWFA 2NWQA 4O2LA 1HX7A 3ABOB 1DC6A 1RBMA 4HLNA 1YAJA 1QMPA 4LDNA 2B63A 2XUOA 5JCJD 2DF8A 1IK4A 1PVOA 1DBRA 1QIHA 3UWSA 3P9PA 1K0UA 4NEHB 1NFFA 5JFGA 2V4ZA 3OICA 2VYVA 1UK6A 4ARCA 4DUGA 3MHTA 2VPIA 5JNVA 5EHNA 2J4DA 3ZQJA 3RSCA 5ITZB 2OBNA 3DDHA 2YHAA 2ZTVA 5BWTA 2JANA 3CV3A 3VYWA 2J9FB 4M0DA 5KKNB 1Y3IA 1YMUA 3HADA 2OCPA 4XYMB 3GB8B 2ZZNA 4B1FA 1MIOB 2JDIA 2PGLA 3SC3A 3HI4A 4EA8A 3CH5A 5IDWA 3VPSA 2CMDA 2VWGA 3FUTA 1YCDA 4BMPB 3BA1A 1KAHA 2EJ0A 1H2FA 2YZ7A 3R0VA 4J9QA 4W1SA 2Z2YA 2Y0BA 2QLNA 3NTLA 4KQWA 5FV4A 3DBOB 4MKFA 2A94A 1GTMA 3D2CA 4FS3A 5CK5A 5IBPA 1KQGA 2IHKA 1NBWB 2F55A 3S2IA 2H8GA 5JFOA 1K88A 1H1LB 5CM0A 5D7BA 5JT1A 3OTQA 4QJFA 4UAVA 4LRYA 4QQ8A 1T9HA 5GVRA 3BRCA 2IUTA 2ZU6A 2EQAA 3M6FA 2VHTA 3VH4A 4MV4A 1O5IA 4OU4A 2X58A 3E2IA 4MPTA 4EW2A 3AJRA 3BWCA 2IH2A 3KZCA 3AILA 1R6XA 1VJ0A 1U1IA 3NHRA 2VJQA 3MBKA 5CJ2A 5C18A 1X39A 1W7AA 3F78A 4IV5A 4JU9A 4DG8A 2GBLA 2DPIA 3U44A 4EFMA 3L7LA 1I4TD 4CR6A 4EX6A 1EFTA 3JVIA 2X8WA 4TUYA 1VTKA 2XOXA 5EEGA 2OMKA 1ANKA 3G7UA 4MUIA 4V0SA 1KAEA 2RJNA 2OL4A 1N1MA 3WLJA 4PSCA 5FWXB 5BR7A 2JI6A 4NBNA 5IABA 3TSCA 4LOKA 2CHUA 4AJEA 1U5BA 2ZUEA 4MI1A 5JJKA 1XNQH 3OP4A 1Y98A 4EJSA 4YJ3B 1TZMA 3I76A 1NT2A 3V48A 2Y68A 2JFUA 1CUJA 4WXEA 1CEYA 3PUYA 4FJ2A 3R77A 2HF7A 2JA8G 1L7NA 5IPFA 3A3KA 2OCKA 3WK8A 2GTPA 2B3TA 4LK3A 3IO5A 2GPNA 3N3BC 3V9AA 3L05A 2K7FA 4D9BA 4ZT2A 1OROA 3EC1A 4FNGA 3RIYA 1IEVA 5HZHA 1QLWA 3FHJA 5JH7A 1QV9A 4GZ6A 3G9ZA 3O9VA 2G40A 4DZRA