The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
100
|
sequence length |
317
|
structure length |
315
|
Chain Sequence |
KGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPESVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of human Inositol 1,3,4-trisphosphate 5/6-kinase
rcsb |
molecule tags |
Transferase
|
source organism |
Homo sapiens
|
molecule keywords |
Inositol-tetrakisphosphate 1-kinase
|
total genus |
100
|
structure length |
315
|
sequence length |
317
|
ec nomenclature |
ec
2.7.1.134: Inositol-tetrakisphosphate 1-kinase. |
pdb deposition date | 2006-12-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
X | PF05770 | Ins134_P3_kin | Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain |
X | PF17927 | Ins134_P3_kin_N | Inositol 1,3,4-trisphosphate 5/6-kinase pre-ATP-grasp domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | D-amino Acid Aminotransferase; Chain A, domain 1 | D-amino Acid Aminotransferase; Chain A, domain 1 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |