2ODTX

Structure of human inositol 1,3,4-trisphosphate 5/6-kinase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
315
Chain Sequence
KGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPESVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human Inositol 1,3,4-trisphosphate 5/6-kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Inositol-tetrakisphosphate 1-kinase
total genus 100
structure length 315
sequence length 317
ec nomenclature ec 2.7.1.134: Inositol-tetrakisphosphate 1-kinase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF05770 Ins134_P3_kin Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain
X PF17927 Ins134_P3_kin_N Inositol 1,3,4-trisphosphate 5/6-kinase pre-ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.100 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2odtX02
3.40.50.11370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2odtX01
3T99A 3T54A 3T9FA 4NZNA 5DGIA 3T9DA 4HN2A 4Q4CA 4NZOA 5DGHA 3T7AA 5BYBA 5BYAA 3T9BA 4NZMA 4Q4DA 3T9CA 2Q7DA 3T9AA 2ODTX 3T9EA 2QB5A
chains in the Genus database with same CATH superfamily
3IP3A 2NVBA 3B1XA 4R7TA 2WIJA 1U0HC 1LTHR 3FFAA 1T4GA 3NCTA 4V2UA 4TYQA 1N2EA 2FLKA 4MI6A 4CDGA 1AGYA 1Q7TA 3QG5A 5GJBA 3HK2A 1UPUA 3O74A 4ZAZA 2VK8A 4LSMA 4RS3A 5T5QA 4KNYA 3QEOA 2LIVA 1IBMB 3ZIAA 1MQ8B 3NZEA 1P2GA 3OFNA 3OTWA 3QH4A 4G6ZA 5IKMA 3LX6A 1P1HA 2GXQA 1K4YA 2F1IA 4GLFA 3HG7A 4Y6LA 5DYYA 3FNGA 5HTKA 1H1LA 3V9AA 2R47A 2AXPA 5JFGA 2O59A 3BDAA 4ZZIA 3AUYA 2B1IA 3FOEC 1DTWB 3UM9A 3LY9A 3RLIA 1CQIB 4YO8A 3NBUA 4NS4A 2I2XB 4F3KA 1V3TA 1B2RA 3TW6A 4H16A 2WMOB 3TNLA 1G4HA 4PIPA 4QJ5A 1Q7CA 4JK3A 2PA3A 2WTBA 5A6SB 4C4RA 2P0AA 1EVIA 3DEAA 2E48A 4LYEA 4BNKA 5HBRA 4Q39A 4DA4A 1CUVA 4R8KA 1LPSA 1GIAA 2B4AA 5JSFA 2XA9A 1M9NA 2PWAA 1HOXA 3COZA 3DM9B 3ND9A 1NJFA 1ET0A 2EFJA 1D1QA 3WQQA 4C3VA 2JF0A 4YJ3F 1MOPA 3PNPA 4RCVA 4DUPA 4TYMA 3EW7A 1JE0A 1KYQA 1UPBA 2DKOA 2I6GA 2ZR7A 4AKEA 1E2FA 4ROTA 4ZEVA 6ABPA 2VRNA 4HWRA 4FFBA 4F85A 4CIBA 5CEFA 3QRWA 3HKDB 4IJUA 3FGOA 3RIHA 1D0SA 4HRYA 4JQOA 3RIYA 4J16C 1XR3A 3EBOA 5FT9A 5JXGA 1M5TA 3OT5A 4XYGA 1J5EB 3K15A 4P5PA 3T3DA 2PLAA 1DZIA 3OJFA 1GFSA 4I9NA 2R86A 1MO2A 5LD2C 4QD3A 1SQ0A 1MDFA 2ASVA 5A9RA 1SWWA 1ID8A 3G8DA 4ZO7A 5ECYA 4AO8A 1TCVA 2WQ7A 2WJJA 1FNCA 2NUBA 2ZB3A 1N8KA 3DO8A 3LKBA 1MB3A 3Q9SA 4PYIA 4WEOA 4WH0A 4Y18A 5JPDA 1M8PA 1M0WA 1YNOA 1E9DA 2YUIA 1CS4C 1NRXA 4X66B 1SUBA 4HP8A 4QFCA 1L5RA 1NLUA 4KVAA 3MWJA 3OZUA 1H23A 3MHTA 1L2TA 3RRNA 5DM4A 3H1GA 4EG3A 1V6CA 4DLSA 4KXXA 3B3FA 4U2CA 1NXVA 3E9NA 4NBLA 4MDHA 2DERA 2FEAA 1YZGA 5FL7A 2VATA 4P81A 2AMYA 3WYEA 2QLJA 2V7WA 2NPFA 1T0PA 3C8DA 1YR8A 3HYRA 1GPAA 1YBFA 2JBAA 3FCEA 3QKRA 3ZXXA 3FDIA 3IR6A 1GAWA 4EW3A 1QRSA 1HLDA 3FIUA 3GCZA 3K0HA 4W8OA 3WGTA 5AI9A 5L4NA 3D4PA 3T3IA 4F84A 1FTYA 2PY6A 1EFHA 1KI1A 2I78A 4QZVA 4E09A 1WRBA 1YB7A 4WBXC 3V1KA 2BUCA 2GS9A 4J75A 2BGJA 3V34A 4G65A 2QRGA 5DMXA 2BTQB 4OVKA 2WQZA 1TZMA 2UZAA 4HPXB 5CVCA 5DE3A 1HO3A 1QIDA 3VYWA 2V0NA 3MJVA 3ND6A 3NDBB 2WF5A 3T1OA 4Q3KA 1IWOA 2IRWA 4IVNA 3RYFB 4CW7A 4EOGA 4EW6A 1NPTO 3ZOZA 2LKDA 1B3RA 1P5HA 1DTSA 5K03A 3CLTD 4XDYA 4B9AA 1QB8A 1NY5A 2GK6A 1VYTA 3PDHA 1JEYA 2NSYA 2WJVA 1ES9A 2H08A 2Z3ZA 1LDNA 1G6KA 2BEWA 4UJ3A 2J4DA 3HSYA 4WNYA 1KH3A 1W6RA 1XZIA 3DEIA 3QXJA 4QTUB 5AJTA 2HADA 2J0QA 2K2WA 3T34A 5T57A 2XAUA 2FEOA 3WGGA 1KZ6A 3FN4A 3GJRA 3M7IA 4Q4HB 4Y7DA 2DM6A 2D0PB 1GL7A 3EMDA 4PC3A 8AT1A 5JW6A 4O82A 3FVQA 5CR5A 1DINA 1WCIA 1ZW6A 4XSGA 4EQ6B 3PPWA 3Q4GA 7MHTA 2GCEA 1E2PA 5J4VA 4ID3A 3IE1A 4Q9DA 1Y5MA 5ICEA 3ACBA 4I0WB 5A7GA 4KPGA 3CBGA 1CQPA 1ZH0A 3FTNA 1QQ6A 4J7XA 4KN9S 1QCZA 1OXXK 2A0UA 2JIZD 4Z3DA 3TY5A 4ERXA 5LD2B 2DGDA 2ZSDA 1MDBA 4OSEA 4CEHB 2XZDA 3EBPA 4BZZA 1HEIA 2GDZA 1FPQA 4F4CA 1DU4A 5H4HA 5F52A 2PH1A 1F7UA 4QM6A 2ZJYA 4PC7A 3REQA 1XMSA 3A1NA 4AZVA 2PO7A 4NBUA 5K09A 3ENKA 9GPBA 4BMNA 1PWHA 3HDHA 5CA0A 1CUBA 1PZHA 4EG0A 1PWEA 2UYQA 4XR9A 5DLPA 4JGBA 4JBWA 2HD4A 2O7QA 3H4VA 1V71A 3GF4A 4W9NC 4JLKA 2ODBA 3LNTA 4X65B 5AOAA 2V58A 1F0KA 1T2FA 1MT3A 3RV4A 3F8WA 4PFQA 5JLAA 3UWMA 1Y48E 4GWGA 3TW8B 3RRYA 5U4XA 5C7OO 2PZGA 3UK0A 1NQWA 3I6QA 2C4WA 4D9JA 1W4ZA 1WNTA 2QJWA 1T0BA 2JPDA 2ZSAA 1X9NA 3FWPA 1VHLA 4OX9B 1BCSA 3WLFA 1JPVA 3B1JA 4E5VA 2EG5A 1SPBS 1BH6A 2IOHA 3SE0A 4URVR 4Z3KA 4U6NA 1YRYE 4ZMSA 2IEZA 4JGIA 3LQYA 5KC8A 2A88A 2QTFA 3OTOB 3RWMB 3RTDA 2OILA 1UKZA 1YSCA 2OSBA 2Y6VA 3BSYA 3MT8A 4N9WA 5C1BA 3SQXA 1J2EA 2B6NA 4J0HA 4NBTA 4XX0A 4ZO6A 2DLCX 3CMMA 1XNJA 4RJ2A 4XYMB 5BNTA 5U9CA 5CXUA 4QJ4A 1GO2A 3GRRA 1M8JA 1XPRA 1YONA 3B70A 3W5AA 3DTGA 1Y9JA 4QREA 3TRDA 3WWJA 1OJ7A 1VSBA 2DULA 4L4YA 3LIIA 4S2EA 4ZARA 1K3UB 3RS0A 3X43A 2CN1A 5L7TA 3TZHA 1YMQA 1OFIA 1H69A 1SC9A 1SXIA 4KHPB 1ZA2A 3VC7A 1DRWA 3WZLA 3H9UA 4AG3A 1U4OA 1SULA 3TW4A 4RPLA 1UBKS 3HFGA 5JRJA 1QP7A 4NENB 5FBKA 4F9FA 4CM9D 4QUAA 3LNCA 1ZGHA 2NGRA 2P3SA 1YS4A 3JRXA 2OV3A 4N01A 4C7KA 2Z57A 3AERA 1Z4OA 2JLCA 3QX7A 2O3TA 1PQUA 1YE3A 4V3CA 1KL7A 1GLVA 4JNKA 4Z8YA 5DT9A 1GRNA 3RARA 3GT3A 4HK4A 1SG6A 1NVMB 4KXMA 5EWLB 3WR5A 3DD1A 1RJWA 2YX1A 4KL8S 4YMHA 4DGSA 3HQ4O 2PMDA 2PRIA 3L7CA 4JNCA 4JI5B 2HH9A 4IH4A 4EL5A 2EVWX 2GBLC 1QV6A 3AUXA 3B1ZA 4NZNA 1TW2A 3KOZA 1R0KA 3F5FA 3L8CA 4G4GA 5ER9A 3WJ7A 4DW8A 4KFCA 5JSKA 3LPAA 3BG5A 2ZUFA 1DIBA 4ERNA 3F7NA 3CW2A 3VKGA 2JFFA 1VMIA 5FBRB 3OWHA 2LV8A 4YJFB 4FB4A 5A5EA 3B3GA 2O0KA 5DVZA 3ME5A 5IWCA 3LO5A 2YV2A 4L07A 4Q3OA 1ZK2A 3HJBA 4FUTA 3NWEA 4TV9B 3WZ2A 1QG2A 5FOWA 1YNSA 3H87A 1U6IA 2PBLA 3CF6R 4GYKA 4ZU1X 4ZIRA 1I2BA 1NKSA 2FHPA 4JL6A 5AHRA 2CLLB 1JJAA 3K1JA 2I4IA 2G4CA 3T38A 1XAGA 1Z2EA 2ZRIA 4K0RA 5E6RA 4L8WB 4ZICA 1PS8A 2A86A 3HA7A 5HM8A 3ABIA 1AKEA 1WW8A 3FMPB 3VM6A 4V38A 5FAXA 1PS9A 2FSVC 1FVHA 4V1CB 2XSZA 4ESHA 2HA6A 1C9YA 1N2HA 2JLZA 1D4ZA 2FPGB 1H2XA 3VKWA 1PVDA 4YRBA 3OZDA 2QRLA 3NLLA 1WKCA 2HEGA 4C7VA 2VQFB 1AC5A 1WQ1R 2NYVA 3HRIA 4CCYA 4D3YA 5GOZA 1TUBA 4YT4A 1Z7YA 3BK7A 4OH7A 4F06A 3SC6A 4C0KA 1U0LA 1RRFA 5AUPB 3M9WA 3IOMA 1ZL0A 2X2FA 3CM0A 2I3GA 3EG9B 2R1VB 4K1LA 4URUR 2C8JA 2VUTA 3TF5A 1LNQA 4Y0NA 5HMLA 5CCXA 4NBVA 3RTEA 2W8ZA 3BGDA 2Q2VA 1ZRSA 5JSZB 5EIOA 3QKSA 1FCJA 2GYYA 1ZCJA 2V7XA 2P7IA 2X19A 4W1QA 5FPSA 4L3OA 3RFXA 3OTGA 4R54A 2E87A 4BB0A 2AN4A 3A3YA 2WF9A 3D7RA 3GRFA 4GXQA 1SIUA 3D31A 2B8TA 3FYSA 4XVQA 4CEJA 1EPUA 5ALUA 3REOA 1XNRB 1X1QA 4RK1A 5EKDA 3O38A 2JHAA 3RRZA 1ZCBA 1GPUA 4CNBA 1W76A 5KWEA 3C3CA 4RY9A 3ROFA 4X6UA 4ER3A 1Y9EA 4JIGA 4BNVA 1FBTA 4G56A 1G6HA 3R77A 2A9PA 3GJ6A 2PL5A 4DDVA 2FI1A 1JQJC 1ECFA 2GB4A 1AZTA 1JHYA 2H8GA 1A48A 1RYMA 2ET6A 3D2LA 1PT9A 2WDPA 1I8TA 1WR2A 2EGUA 3MS7A 4J0IA 3UMBA 1O96B 2FDXA 3GLTA 2R00A 4CIVA 4DEVA 3MGCA 4JMLA 3BABA 4MCIA 3OZIA 4WXRA 3VH4A 4QEDA 2JGRA 4ZDIA 4I5FA 5FR2A 1YFLA 3A4YA 5A04A 1A9PA 1UKEA 1V9PA 2Q2WA 2NO7A 5H3HA 3H99A 3V2HA 1UM8A 4GMKA 2RONA 1T1RA 3MOIA 1VL2A 1BH2A 1OHHA 2B30A 2LKCA 4XJSA 1FJXA 5ALDA 3GO4A 4L73A 3GA7A 2X9VA 3O95A 4XI9A 3SX0A 3JRWA 1QNFA 2NUAB 3SOPA 1L1EA 3X1KA 1NWHA 1SQSA 1F6DA 3OH8A 2BEVB 1X39A 3E9RA 4IUDS 3PFIA 4Y9UA 2G3YA 4DUGA 5DI3B 1PEAA 2PZJA 2ZW9A 1LCIA 4FZRA 1IHYA 4G0PA 3TLXA 4EVSA 5KQGA 3UATA 3TE6A 1L6IA 1JHPA 1NMQA 1Z56C 3M1IA 3UUFA 3PQDA 4K6HA 4Y6PA 5LQCA 1V7CA 2V74B 4RHUA 3W1GA 1W9HA 2IEDA 2ST1A 3SK0A 1ZYUA 4A6XA 1M54A 1QWOA 4WI1A 4W63A 3V4OA 1GFZA 1ZIOA 4MGIR 3GPDG 3UXHA 3STYA 1JILA 1C7IA 4N7MA 3ROQA 5KI6A 5MN5A 5AUQA 4Q4DA 3V55A 4JU8A 1CY0A 3CZPA 1OFUA 1CZUA 2QMQA 2XMZA 4MUEA 1Z6QA 2J09A 3CNHA 1HDRA 2OGTA 1FDWA 1O54A 3KJXA 4M86A 3V3KA 5FUMA 4M7WA 2IHYA 2GVZC 1E98A 4KJZA 4K7JA 4CT5A 3I6BA 2DY0A 3T41A 4XJXA 1ZA1A 4XWAA 1Z13A 1CB7A 3R3UA 1WVMA 3U37A 5BSFA 4BX2A 1O89A 1J2JA 1CFZA 1GQSA 1PK9A 1BYIA 2PD4A 3G5AA 2HBZA 3HGMA 1UBOS 3IVXA 1NWCA 4M0FA 2OD2A 4RETA 5DV9A 3RRFA 3CRQA 4A92A 2MMCA 3OTQA 3VVBA 1DCMA 3IMEA 3BMQB 3KT3A 4EITA 4QOJA 4MVJF 3MFQA 1DC6A 1DKUA 2G67A 4EO7A 3CPJB 3KAPA 1ST2A 1HRKA 3PG5A 4D56A 3S8EA 3WG9A 1K6JA 1KNQA 2QORA 4YO7A 1NUSA 2YWXA 2XMSA 2YFHA 3PQCA 2Q3LA 1NXTA 4JLAA 1HFJA 1AS0A 2OL4A 4NFHA 1AV6A 4ISBA 3BXOA 4I4NA 1X0VA 4PYKA 4YALA 2QP9X 4FNMA 3VNUA 1UFQA 2OD9A 5C8DA 4JQSA 3AF6A 1PNOA 3DW3X 1F51E 3CR8A 3DFKA 1FA9A 5AVWA 2XVMA 1J00A 1JI0A 3BX1A 2BP7B 3JYLA 4GT1A 2ALJA 1CZOA 1IEQA 1V48A 3LUHA 3SX2A 1R0SA 4FILA 3QELB 3IO5A 5A0FA 3UGKA 5F23A 5L3VA 2FPPB 3L8DA 1UPTA 3UOAB 3ONFA 1R0RE 3L8ZA 1YQWA 3DTVA 2A0FA 3FTPA 4I5IA 4YRSA 1G5PA 2W7TA 5ALKA 5B1HA 1B04A 2ODQA 5EZYF 3ZE1B 3EVEA 2VHVA 1ZBQA 2IYVA 2QNBA 4PG5A 4Q47A 4EJMA 2KE5A 3K0SA 2QSUA 1AQIA 3AX6A 1CZHA 2I76A 2AWNA 2L69A 4K9MA 1I4EB 4QXQA 5FRDA 1SCQA 2EBHX 3ZY3A 1C41A 1KSHA 4R8MA 3CTMA 2UXDB 1XN4A 5LBTA 1UM9B 2TRSB 3P4XA 3Q6MA 3ONNA 1K6IA 3HGQA 4FX5A 1G3QA 3CFYA 4JJ7A 5ES3A 3O8RA 1U8ZA 2RSLA 4ZZ0A 821PA 1YK1A 3O94A 4M54A 1OREA 3SBEA 4F45A 1GUYA 4PR0A 5HUQA 1YJBA 1W44A 5DLYA 4JBXA 3G2JA 1RVDA 2JLRA 2TS1A 2J3KA 4NOJA 1TJ4A 4FWTA 4PZUA 4B3CA 1BD4A 4PG6A 4YA6A 2PS1A 5AVOA 2DPLA 4Q1FA 2NZUG 3GJQA 4H3SA 4REQA 3CLVA 3S1LA 4E88A 2DPMA 5E2AA 3W6UA 2IZ5A 1IMOA 1BVHA 3HYTA 4CC6A 1VLJA 1MJNA 2X3YA 3BORA 3DWIA 2DPGA 4RCNA 1Y4DE 1N0HA 1JF8A 2REOA 5EP1A 5KNBA 1ZC3A 1K5PA 5E4JA 4KI0A 3TSAA 4DCNA 1YL7A 3HN6A 5GAJA 4WOCA 3O90A 3VHQA 4ER0A 1W87A 2H5JA 4H7FA 3WB1A 4B4WA 7REQA 2OA0A 2WD7B 3IIEA 3EEYA 2X9LA 1XCBA 2FPXA 2BFPA 2GD1O 5B2FA 1VCIA 4BV2A 3CNOA 4TWJA 4J03A 4N8SA 3U17A 4F3RA 5ENZA 3KOYA 3OPYA 1USVA 3QLUA 3F73A 5HXAA 1UZNA 2NAPA 5IKPA 1EIZA 2WV9A 5BN4A 3QWHA 2OBXA 1KZHA 3D6VA 4LHSA 2RD2A 5JZSA 1NIPA 1SHJA 5TIIA 3ZHVA 4JUBA 1AKQA 5L4LA 4F72A 4Q6WA 4WBNA 1Y3BE 2H65A 4MHOA 4MIYA 2J7PA 3OKFA 4ECAA 4BV9A 5A0TA 3U44B 2FFRA 3AWDA 4PBTA 2ZRAA 4QNNA 5AJXA 5A9SA 3UUGA 4YJ3B 4DANA 2JFPA 3KO8A 3EPKA 1XZCA 2CDRA 2IYOA 1NDHA 1X86B 4U2BA 2AYZA 1A8HA 4CKEA 2CXXA 3ACCA 3JQ8A 4UQPA 5G2OA 2JD2A 4L7VA 4TZKA 5SZJA 5ICMA 1R7RA 1XXLA 1AS3A 3GJ7A 3MJSA 1SVKA 2Y6UA 4LGMA 5DW3A 3U4CA 4ZK2A 4UTNA 3BMNA 4D25A 4AI6A 5AKLA 3R3JA 1MFZA 4JY7A 3KQLA 4UEOA 1FLVA 1MC4A 1SCUA 2JATA 2Z9DA 4E1BA 3ER8A 2JI7A 1JZTA 4UCSA 1RS0A 3B51X 5G4KB 2ECKA 1ENPA 3IHTA 3L01A 1OMOA 4HCJA 4PHFA 3HU3A 4PZYA 2CVHA 4FFRA 2ZSEA 1DHTA 1OC2A 4ZO9A 3EK2A 1G291 3O4HA 4U2DA 3KUXA 3G2LA 3NB0A 4OTZA 5D86A 2H0RA 2XNKA 4LVCA 4AMYA 3H0CA 2JLVA 1BKDR 4UBNA 1PIWA 3PHIA 1FFBA 5SZHB 1QMGA 3ZXYA 2ZR8A 2GRUA 3NIBA 1DOHA 4F9EA 3Q3GE 1K8XB 4BJ1A 1Z4PX 3B1WA 4JLSA 3I62A 2HX1A 3L2OB 4DLNA 4L8VA 5A7FA 2V7VA 3DWGA 3WNVA 3TIXB 1YZHA 3H16A 4PZCA 2JFXA 5FOSA 1KK0A 3O1LA 3NEPX 5A4AA 4DQKA 3N05A 2GO7A 2JA1A 3GUCA 3HI4A 3I42A 1Q84A 4TQ9A 4KE8A 3K9GA 4ZALA 2BMWA 1DFGA 3SYKA 2I62A 4L85A 3PPYA 2BOVA 5C8YA 4H4CA 4L8LA 5IT4A 3VKUA 3N75A 4JB3A 4BNXA 4PX2A 2IWRA 4DMMA 5CT4A 5HG0A 3PJEA 5HUHA 1YT5A 3LC0A 4UHDA 1QH9A 1Y81A 3UVEA 4D44A 1ENYA 1G3UA 3H2GA 4NWIA 1SO8A 1Z5VA 2FXVA 4DTIA 1EGMB 4CKCA 8GPBA 5REQB 4CBVA 3KXIA 1ZN2A 3TAHA 2MWMA 4AP6A 2Q46A 3T7JA 3DKIA 1V1MA 2OKCA 2W6JA 4Q7EA 4FXOA 3R7LA 2WKRA 4JVMA 4HDSB 3SZMA 2Q5HA 3IC5A 2ZWPA 3N76A 3ZV6A 2C83A 2FF5A 3OEHD 4AS3A 4CMIB 3TOSA 2J3DA 5F98A 2Q9UA 2C59A 2G4VA 2W37A 2OXTA 1LPNA 1LZLA 2H48A 2REXB 3GH1A 3V7NA 1FFXB 3P9CA 2PYDA 1WPGA 2H54A 3WGJA 4AG6A 3OFVA 2G63A 4RESA 5FL7D 3RREA 3GLFA 3AHIA 1O08A 4ZOEA 4PLYA 3TQQA 3PP8A 1C8LA 1H1DA 3D6NB 3OJXA 5AXBA 1MW9X 3P2YA 4ZEOA 1YQGA 1JHDA 4DSOA 3KYDB 4UBMA 3PF9A 1S2LA 3GBSA 4JBGA 1DBIA 1M76A 4KAFA 2HIMA 1CF9A 2O0LA 4JJGA 4KO3S 4O7VA 1ACLA 3UCXA 3LUAA 3GJ4A 5ENVA 3UH0A 3AP3A 1D3AA 2R11A 3OD1A 2VOEA 3U40A 3LFHA 2KPOA 2OMKA 5SY9A 4GQBA 2IW3A 4HT3B 1HYQA 2A0XA 1HSOA 4LOHA 1LFAA 4CM8B 5T4EA 2RGAA 3I8SA 4X7MA 4PLWA 1KOFA 3PVSA 3K8OE 5MFZA 1P7ZA 2P2NA 3UHJA 4YWJA 2X0EA 4QQRA 1JVNA 3BRQA 3T9FA 2PZKA 2V65A 3TZLA 5K01A 5ILOA 3MTIA 3H2BA 4AZ3A 1S4MA 1YZUA 5ICSA 3NIGB 1EYZA 3E58A 3KRTA 3DLHA 2J45A 4TRNA 5D01A 2RBGA 3PWZA 4NJMB 3VZBA 4ZYVA 4DWOA 1JU4A 1U9ZA 1QIEA 4RHXA 2FN8A 2HK9A 3AF4A 1KIMA 3IR5A 3PL1A 4K86A 4RXMA 2I2AA 4EAQA 3B38A 3QVLA 1LWNA 1QHIA 3L41A 1GPLA 3RYTC 3R75A 4D4IA 1VJGA 3R41A 4GZ5A 2ZXFA 4PNZA 3EZLA 3T3GA 3B7PA 3BRSA 4JUIA 2X3UA 5BOVA 3UAZA 4EGSA 6CHYA 1VBFA 3PV0A 1GARA 3PFCA 3SJZA 4AG5A 3T0IA 1FU4A 4IQ0A 2CNBA 5DWVA 1IU9A 2B5VA 5E1OA 3FWZA 3I09A 2H9YA 4G81A 1T8WA 3AB8A 4R41A 4UULA 4LFBB 3PJGA 2B0CA 1BCRA 3PDIA 5DOVA 1MAUA 3NHKA 2H3EA 4ETWA 3BFVA 4NJEB 4Y1RB 2QVZX 3ONEA 4P3OA 1N6RA 2H52A 3R5TA 4FGJA 3IKJA 5IAKA 5LDGA 1IM2A 3C5VA 3JCZA 1DNPA 3PZBA 2YVUA 5KEIA 5A9SB 3BHNA 2YRXA 5EE0A 5T67A 5IP5A 3WLLA 5ARCA 4WN3A 4MW2A 1BXGA 2A0YA 3LY5A 1QIJA 4ANFA 3LGSA 1ZOLA 2DWUA 3TM5A 2D6FA 4D0SA 5HFJA 5E3JA 5GONB 3T8YA 1RYHA 4X84A 2J32A 1CW2B 1GGHA 3LLVA 3UJHA 3LDHA 5KHLB 2JJ1D 4FEYA 4ND5A 4LJ9A 4WCFB 3ZZUA 1YBMA 2ZB2A 2QJRA 3MM4A 4MGKR 3IKMB 4U7HA 4YAGA 2DWPA 3GP5A 3OHMA 3EYWA 5JJKA 1KMCA 4HF7A 4KREA 2XBLA 4EG1A 4BZXA 3BXPA 1YUNA 2G1KA 3NEAA 2BT4A 2VBCA 4LJAA 3TDMA 4K03A 5JMTA 4OYLA 4QYIB 1GYRA 1ORWA 2IPAB 3JVDA 2CWWA 4EDHA 4IUYA 3JSAA 4G3XA 4LWQA 4O1IA 2IU3A 5IT0A 3HCPA 3OCJA 4MS3A 1WQ4A 1PYOA 5B64A 3KKEA 3BXHA 3NAQA 4J0CA 1YL5A 3CEPB 3RK4A 4BO7A 1L4NA 2IIPA 3E84A 3FCCA 1PJSA 1EFVB 1VLZA 4PLCA 1CC1S 5GADl 2JCYA 3P94A 2CDCA 2FRDA 2LGJA 3A1WA 1LRJA 3CKMA 4QULA 5COBA 5GJCA 5HIJA 3U3MA 2EL7A 1T0HB 3SMVA 2F8LA 4C0JA 4JENA 3AFOA 2W2LA 2GN1A 3N5CA 4AN1A 1IZZA 1XU9A 2FFBA 4YCSA 4YRMA 3ZD7A 4QXRA 1Z5OA 2B5OA 2R4UA 4QLAA 3S2ZA 5LQRA 3NGMA 3TXAA 3OG9A 1UADA 2YN4A 2DFNA 3SMQA 2LCQA 2QMHA 4HNQA 1M1NB 1CIJA 1GA4A 1ULTA 1WV0A 2B7LA 1EA7A 2WVHA 4H6PA 4RKYA 4Q9KA 1DKOA 1YQ9A 4H7KA 3JD2A 4I5GA 2AN9A 3THSA 1B4DA 1NN5A 3W5UA 3KAJA 1ZINA 3EUWA 3TL2A 3AH8A 5I8ZA 3VR6A 2WC1A 4X45A 2QBYA 4K81B 1PGQA 3TN7A 1G2OA 1QCCA 2CKMA 2J3LA 2QX4A 1YFJA 4Q1VA 1DAPA 1HH4A 3ZWWA 4F2GA 1GPJA 5K20A 1QO7A 3H8WA 5ARBA 3RU9A 3KQHA 3PQ6A 3W5JA 3BSFA 4WECA 5DM70 4R5HA 3N2LA 5FO1A 2VHCA 4O4LB 4YAKA 4CTKA 4MHTA 1LW7A 3WFIA 4HY3A 5FNZA 3ZD6A 2WAOA 3W4KA 5KMGB 3GT7A 4HNHA 1E3QA 2AFHB 4XR4A 4BXOA 2WHEA 4RTNA 2GBIA 5BPHA 3D8HA 4F56A 2HRCA 4FFPA 3FBWA 3LC1O 1AY0A 3MRXA 4I4TA 4LXGA 3TE7A 3NI2A 3BSWA 3GQBB 5I9NA 1HFKA 4TZ0A 3OP4A 4EO9A 3NGLA 5IC4A 5J58A 5IT9A 3L4JA 2MR6A 1WDTA 5FEUA 1UEIA 4MI3A 5KUTA 4P2GA 4GBJA 5C8ZA 2P9CA 4FEAA 4RNDB 3LPMA 4B3RB 3ZWNA 3OT4A 3I9V6 1XQXA 1G41A 2YY7A 2BFDB 2VYVA 1O87A 3GNLA 4GI2A 4ZDKA 4CMJA 2GN2A 2KI5A 3JQAB 3AP1A 4WMLA 4ALIA 1PYDA 4XVHA 2Z6VA 4DM4A 4EL0A 3DE5X 3L82B 3G49A 2FW6A 4DPLA 2C2XA 3O4JA 2GKSA 4GZ3A 4IAOA 3UJ9A 4KR7A 2AOXA 3WIBA 2EG9A 3I28A 1GFIA 2P5TB 2VSFA 3SJ7A 3ZZ1A 3CYFA 4H0NA 3AKYA 4WUVA 5DEIA 2IY7A 1USWA 4WJLA 4K6OA 4P34A 3VDMA 4Z1OA 5JD4A 1GZ7A 1T15A 3BC1A 6AT1A 3QQ5A 5JI3E 3KX2A 4REOA 4EMSA 2WR8A 1MJGM 5EZ6B 4DLPA 1I6LA 3ZQJA 2GCOA 3N8HA 1VL6A 3RYHA 3U7QB 3X0DA 1M6NA 3T4UA 3NTXA 1GPNA 4UQOA 2FA9A 4QGFA 2BRUC 1UIMA 3EQ7A 3EWSA 4CQMD 5I47A 1S1CA 2AX4A 3BAZA 3GJ3A 3WRYC 4CIXA 1MJFA 3QMMA 3DG9A 3ETDA 1OTHA 3QJ5A 3SXPA 4D3DA 4YQEA 4DLVA 1GZHB 1GZ4A 3KTOA 3QPBA 2A30A 1E9VA 4B47A 1HMYA 2F3RA 4C08A 4U0JA 4X1IB 1LBHA 4M9CA 5ITZA 4QXMA 5KTOA 4B76A 3C1TA 1CETA 3QVTA 3PZRA 4GPTA 4YFVA 1MXFA 5H82A 1SKAA 1TYZA 4N49A 3SR3A 1C2YA 1Q7EA 3I5AA 2UYHA 1N6KA 4IMIB 1WMSA 2ZJ1A 4QUGA 3TTUA 4EPXA 5T7BA 5IN4A 1ZUHA 1V6SA 4NARA 3RH0A 3DVSX 2H1CA 2PZLA 2OG1A 3G2NA 1P9WA 1NFRA 4HX5A 1T36A 2O2JA 1KAGA 4O84A 4PZ8A 5TQ0B 1CKMA 1ZUNA 5BR7A 1YF3A 4XTCS 1GR0A 2XB6A 1SHTX 4XDGA 4EI9A 5AFSA 3V1YA 5JXIA 2Q4RA 1NJ5A 1Y6JA 4KFTA 1DT3A 2GHTA 2DRIA 1DKNA 1ECJA 1MENA 4EX7A 4F6CA 5DP1A 2R97A 2QR3A 1E1DA 2AZDA 2P40A 3M6AA 4MYDA 2QD4A 1QZTA 2QNRA 5B3JA 1CQWA 5BWMA 1HZZA 1S02A 2O2HA 4TZTA 3OUUA 5DHAA 2FB9A 3ILHA 4Q82A 2IELA 2M1XA 4U3JA 4FN4A 4EGFA 4BN5A 1FNNA 2COEA 5GM2A 1M2HA 2VHTA 3A1EA 1BEUB 4Y6GB 2EF0A 3HCOA 3NBYB 4JD5A 3R8CA 3EPRA 3Q5EA 1H2FA 1P9LA 3P9NA 4FZVA 5A0VA 2JVIA 2VPIA 2A9QA 1FP1D 3EIUA 2XMGA 2ZTVA 4V39A 4YPFA 3D3NA 3QENA 3UJPA 3MWDB 1V7QA 2JCXA 4B3XA 2AG8A 2WWIA 3IESA 2WWWA 4RL4A 2RCNA 2IL1A 1OYYA 3FZGA 2HKIA 3PUWA 3TTSA 4ZXPA 1PNTA 4X9XA 5ELXA 3RG2A 1SRQA 2OC9A 1ZISA 2FWIA 2YVQA 1EI9A 3V4ZA 3VUFA 4XPIA 4BMPB 2CWDA 5DMHA 4DIFA 1QRRA 3H1BA 1NNI1 3TRIA 1Y3AA 2H1RA 1ZGBA 3ZWKA 3VDNB 1XRJA 4DRXA 3AM1A 1TMGE 3HXLA 1PLJA 5E6RB 2B37A 2BFCA 3KPWA 4O4JA 3H8VA 3AI1A 4IINA 4ZDWA 3NNNA 2CXUA 1ESZA 1P74A 3N2IA 5KYXB 5BWWA 1JWBB 1VSTA 1C9JA 2VH1A 4X20B 1MGOA 3H5TA 4GKAA 4IF6A 1ZOPA 5HFAA 3QBEA 5ICFA 3U81A 1EX1A 1M6YA 4EHIA 1IY0A 3QE4A 3C4VA 4G63A 4GEKA 1M34A 3R9IA 4OB6A 1Z2CA 4RFVA 3GRAA 1UPFA 4U8HA 3RKUA 2H9AA 2YWVA 1N5RA 4KAXA 2VRCD 2QLNA 2XADA 3ZXSA 3KQKA 3L7AA 5T41A 3K3PA 1TQ6A 4QELA 4XIIA 1XZHA 2GDJA 5BT9A 5MGNA 3AHJA 3WKBA 1CFJA 5J2TA 1JTVA 1RYBA 4FMCB 4YJKA 4AJOA 4JBHA 1RT9A 3K1AB 1K97A 3A1UA 5CYGA 2R7NA 1VSQA 5C7YA 2OMEA 2P2SA 4G9GA 5G02A 2DIKA 2ZUTA 3EVAA 3EGIA 2EZ4A 4IIJB 4BGDA 4FGUA 1R1DA 3FSGA 1UAAA 2ZGVA 3BGIA 3K20A 4ENQA 4TXNA 1US8A 3ADCA 5A4JA 1ZNYA 4HH4A 3NATA 2G77B 1FNMA 2Z2KA 3B36A 2PWZA 2VTEA 4GM0A 4C6SA 1FDUA 2PJRA 4W82A 3S7ZA 4D8YA 4KDRA 3HV2A 2D1QA 4XTRA 5BRJA 3RRMA 4YQYA 1EFRA 2JGLA 1HT1E 2WWFA 2XHZA 3K1AA 3IEIA 3OQBA 4NYMR 2GHIA 1H0KA 2C2OA 4ND7A 2XYGA 4RYDA 2YJ4A 2VXBA 3OZTA 5BNZA 3PNLA 4YMIA 2GN9A 5HKKD 2O1SA 3ANNA 3KTAA 3E1KA 3JARB 2I34A 4XYMA 1PP4A 4LXTA 4Y2UA 4LFCB 2YBDA 4FJ0A 4OBXA 4FCCA 1QDUA 4UE2A 4AKHA 1PV2A 1Q0QA 3RTXA 3PIIA 4DCUA 3OTHA 4HGZA 4RD6A 5EAIA 2QTTA 1HQCA 4HQ6A 2O7RA 3AUAA 3FNEA 1XTZA 4X20A 2FEMA 4OAPA 4Z51A 4XSHA 4IPTA 3ZU3A 1Z06A 2UZIR 1ZMTA 4XASA 4H3VA 1T26A 2H0AA 3SDZA 2ZYWX 1Y4AE 4HQ0A 3X44A 2BFCB 3A27A 4QDUA 521PA 1PSZA 4UNSA 1JKMA 4O02B 5F4BA 4OLHA 1E61A 1VHDA 3O5AA 4XD2A 2ECOA 2FDRA 4AJJA 4FQ8A 4RXUA 4L9AA 3OOSA 4IICA 1CRQA 2NO0A 3O8BA 5K8IA 4J76A 3JAKB 5CG1A 3EODA 2HY7A 4NBWA 2RK3A 3CE9A 3G9UA 4UNNA 2FZEA 1A4XA 3KQPA 2XODA 4FYVA 5D3MA 2R44A 3LCRA 5TSDA 3VYVA 4BN4A 1BN6A 3MWDA 4R3NA 4F4UA 3OIVA 5FXMA 3K70D 1L5NA 3Q2OA 1V9SA 2EJTA 3CQ9A 5EHIA 3JSXA 4CI9A 1DIOB 2IW1A 2NUPB 4R2IA 5IJWA 3BUSA 4IGFA 1XPUA 1N75A 3JQBA 4BMZA 3A70A 1ATZA 1YS7A 3DZBA 1RHUA 2AB0A 3GDEA 3HEMA 4LDZA 3MMXA 4AP9A 4D57A 1M6HA 1ZD3A 1ENOA 1YZKA 1JQBA 2X5NA 2QF7A 4WA7A 3RU3A 1XDWA 2CVOA 1J8VA 1Y5RA 2EX4A 3JR7A 5M34A 2JEOA 3BH0A 3BZBA 3CSUA 2EJ3A 1TQ2A 3PNKA 4OOFA 1D07A 3PR1A 4UTXA 4ZQHA 5JE8A 3V97A 1V5IA 3VH3A 3N0WA 4B1FA 3P8ZA 3VR4A 5HRAA 1NYRA 5HZGA 1C1XB 1X0XA 2W6JD 3P7MA 3BL5A 2RHJA 3UC5A 1EP1B 3TRFA 3BCSA 4C4PA 4E5NA 1IAQA 2WKQA 1A9YA 5TF4A 4EPTA 2BEWB 5MN6A 4B83A 3KJGA 3L0PA 1JE1A 4YBRA 5AXDA 3WLAA 5TVKA 3WJ2A 3GCDA 4KFUA 5TQ0A 1QFSA 3EZ7A 1GKKA 4NYIQ 1JB1A 1FZQA 1RNLA 2OZPA 1KWGA 3KJNA 3HP1A 2F4VB 3QU9A 2V4ZA 4MWBA 3QWUA 2V7QD 3TX6A 4BMYA 5FP0A 1TJ5A 1X77A 3E5RA 2QQFA 4YV0A 2CZGA 2NZJA 2PGDA 1YS6A 2WMDA 2XQKA 1TAUA 2VAMA 2Q6KA 1JQAA 1I2DA 4MGZR 4XGRA 5EJ5A 1ZC4A 2PPLA 3S6JA 3MSXA 4LOIA 1T3GA 2OCAA 2VZEA 3KQWA 5ITZB 3U16A 2WU1A 2XR1A 2B8NA 2Z5GA 1MF7A 1SXGA 4ENSA 3OIUA 1WSBA 1DXQA 4MA4A 4HNGA 5EJ2A 4O29A 2Y92A 1QIMA 3W7AA 3P0EA 3FLEA 3N28A 4BO3A 3L0CA 5K0JA 1C50A 1R6DA 4PRLA 3VSAA 1KAHA 1Q74A 1DQZA 2ERXA 2Q1SA 3CF2A 3AR6A 4WTOA 2G06A 1M10A 2OGZA 3CBQA 4WPGA 2NTEA 4RM3A 4DQ0A 3AVTA 1F2TB 2EW2A 4EMUA 2HZ7A 3CLTC 1Q15A 1KMIY 2YOFA 1BW9A 1LTQA 3PFNA 4Y2HA 2X77A 2HGWA 4RLSA 4JDPA 2H18A 3DCIA 3O8OA 2ID7A 1QHYA 1ETHA 4TPKA 1B6TA 2ZIZA 4LZWA 2ONKA 4D4LA 5BSMA 2C5LA 3LHFA 4O2RA 1UKYA 4BUCA 4PBRA 3NWJA 1NF3A 2W4MA 3RU7A 4UXIA 1L8OA 1TTHA 1Y82A 1ZOOA 5E8RA 1H9CA 3LH5A 5DFAA 2FRVA 3K2QA 3MVEA 5JFOA 4OH1A 4DXAA 4Z5XA 3NT2A 1RR6A 2GCNA 4KBGA 1FSPA 4R9SA 5ESRA 5FX2A 1LBQA 1PYGA 3LWZA 1CX9B 2BKXA 3IO3A 3UCEA 2D7JA 5LNK6 3WQBA 3ABSB 3GJYA 1M2VB 1MQ9A 1C5KA 3P9SA 1R0ZA 2RHDA 2L19A 4WLEA 4EVIA 3FJ1A 4X63A 1CQZA 3L1HA 4WE3A 2P6MA 1USGA 2Y0CA 3PKIA 4HUTA 2HNAA 3D5QA 1F06A 4PAGA 3LOQA 4ZYZA 1IQUA 2P5SA 2B61A 1MV8A 2ERCA 4AVYA 3KKPA 2O8NA 3KUCA 4ISCA 1TGVA 1I36A 4V2IA 4Y2XA 5HZHA 3WSVA 4OQLA 4K9RA 1WCWA 2I2WA 1X7GA 1KHTA 4P7JA 1ODLA 1HE4A 1L1QA 4TVSA 1AU9A 2EWMA 3HFSA 5CW2A 5DN6A 4I1UA 4C9BA 3AF5A 4YAKB 1Q1AA 2GN6A 3SBDA 1IN6A 3PCRB 1H2AS 4DILA 2BJHA 2RH8A 4V1CI 4L9SA 5JZBA 4R71A 1A2OA 5D6OA 2QP3A 4UAJA 2Q1YA 2NYUA 3OX2A 1JHMA 3JWGA 4E4RA 4JYMA 4EKDA 4AKTA 3ZC3A 4C5BA 5TT0A 4OA8A 4IIDA 4MYUA 3PQ5A 4KUEA 3B5EA 2CMKA 3LMKA 1CQIA 5D1OB 3FE2A 1DTWA 1TZ2A 5AOVA 1A5TA 2QRPA 3LLSA 5JDCA 4YRFA 2I2DA 1C9MA 1JPUA 1ZHFA 4INZA 1CF2O 2RH5A 2RGNC 1V1RB 4ZMBA 2WB4A 5IDQA 2YV1A 1SY7A 2HRQA 5FL3A 4MKXA 1AKYA 2DMRA 2ZYAA 4NMMA 2IH2A 4M8IA 2J0UA 2GQ0A 1M2VA 3KU1A 4R6WA 3OZFA 5AW5A 1KYXA 1LQ2A 3MUNA 4A5SA 1IQ0A 1VBGA 13PKA 4HWTA 2OLKA 3ONDA 3S2IA 5DWQA 2YOGA 3NAZA 4F6RA 1JG2A 1YAJA 4URFA 4BP8A 4YCCA 1P2BA 8ADHA 1USIA 1K8QA 3N2NA 4HVTA 4MS3B 1T6NA 2FP3A 1UBHS 2R5NA 3QLVC 4GFDA 2CFOA 1X2EA 2DTDA 2ZB8A 5IF9A 1W93A 2WJAA 5KINB 4DDUA 4NCNA 3AM5A 3KR9A 1J5PA 3CHYA 2Z5FA 5AM2A 1VKNA 1N5LA 5EP4A 3EZ2A 3N8IA 1E94E 3HO8A 2ZRMA 1P4JA 1OIVA 1A76A 1T1EA 3OZ7A 1E6UA 4LYGA 3K7EA 3RTBA 3WGKA 1PJ3A 3BFXA 4B8ZA 3IBTA 4UHKA 1A8IA 3GJ8A 4MUJA 5AQEA 1ZVVA 1YD7A 3AIKA 3PEWA 1YJXA 3BEDA 4TV8A 4WCFA 4HR7A 3L2PA 1X8JA 4JAVC 3IUBA 5DTRA 5BWBA 5E9WA 1TK2A 2O3RA 3AI7A 4HB0A 2PMBA 4S24A 4EX6A 3COVA 1RQLA 3KQUA 4FC6A 4Q18A 3VSEA 2X0DA 2EW1A 3G2OA 3OE1A 4BQRA 3AW8A 1RI5A 2YQZA 2A78A 3EMBA 5KOJB 5CB8A 1BXGB 1ZSVA 2YBEA 1NXOA 4FBGA 2AOTB 4OQDA 3K6SB 2Q6LA 5K3FA 4HXFB 2A1TR 4LRXA 4UPDA 3ZZNA 2XGOA 2AYXA 5IDWA 2OBBA 3MAJA 4PZLA 3IELA 5EUBA 3SVLA 1JJVA 1DOAA 3TNFA 3D2AA 3HB0A 3IUMA 1EUYA 4UOQA 4GWKA 2QN9A 3H18A 3IT1A 3ZS8A 1DE0A 5C4MA 3BULA 3I01M 1KEVA 4MPTA 1PW7A 1QGUA 4LQCA 2VWQA 5T8KA 3S27A 5CG2A 4D9MA 1UDCA 3IP1A 1K6MA 4LJLA 2Q9AA 3F4KA 3C97A 4MYCA 4S0XA 1F38A 3ES9A 2DWQA 1C2TA 5BVHA 3BK1A 3VNAA 2ZT5A 4PAMA 1IWBB 3SEZA 1JAHA 4IKEA 1M2KA 2G7MC 5AVXA 5HQJA 5JH7B 4U2GA 4DCGA 1NLFA 3QEAZ 2F62A 2PR2A 3KKOA 2BDUA 3PD7A 5CVVA 3U1TA 3VHXB 5K4HA 4AZ3B 1XMXA 2LVBA 2BR3A 4BTEA 4BKOA 1Q1QA 1QYIA 4J1SA 1Z2OX 3IQGX 1LPMA 3A3OA 3LPCA 4WW0A 5KDOA 4LAFA 5I60A 3EY9A 1LX6A 3NH6A 5C4GB 3W1EA 1AQUA 5KTMA 4WCFC 4B2YA 4BP1A 1KA9H 2VYQA 2JAQA 4QO7A 2FSIA 1E2JA 4IYJA 4L5BA 2P2YA 3KUKA 4KVFA 5AKKA 4QL3A 5L8VA 2V96A 2XMQA 3MD9A 3MRVA 3GLIE 3UXYA 3DMYA 1QPZA 2OYCA 1GKLA 2Y67A 2AF4C 2BSQA 3LF2A 2JLSA 5EJIA 1WZIA 2RGWA 1R6TA 4PTLA 1OI7A 4G5QA 2GLXA 3WRYA 2C57A 2G9RA 2Q9CA 4ILKA 1ZHOA 1LXCA 3FYDA 4JLVA 5AW1A 5EPUA 3Q0TA 2H57A 2AMJA 2NZWA 4ER5A 4N65A 2N9UA 2WB2A 3UV3A 5IFLA 3D6TB 1Q7GA 1W35A 2P3QA 4DG8A 1FXWF 4R3WA 1VB5A 4FIDA 1RC1A 2PCJA 3G0BA 4UMEA 1MW8X 1S7CA 3BH6A 3RPEA 1V95A 3VU9A 2PMWB 5CX4A 5JROA 4TMFA 2ZJ0A 5CVUA 1DKRA 1YB4A 3KTAB 3R9KA 1RZUA 4RLFA 5EMMA 5FJJA 3HPQA 2O1EA 5DK4A 4AO6A 2VJOA 4AYXA 3GLSA 3P45A 4MZXA 4CIWA 2JLAA 2FUG1 3L6CA 1W5FA 2ZQZA 3HB4X 4XUGB 1LKZA 1Z6XA 2HJSA 1I4TD 2HNKA 4IQ8A 4E5DA 3TSWA 3NJ8A 5JQWA 1P2SA 4CQNA 3T3EA 5ADWA 5LA6F 3ZLUA 3QXGA 3H3XA 3LZCA 3NMUF 4X1YB 2ZI3A 3E48A 4RM2A 1OY1A 1LF0A 2PQ6A 3GCWA 1ZD2P 3WWHA 3IAFA 4J7UA 2R0QC 5ALEA 2VA9A 3KZKA 4RDCA 1LVUA 5EJAA 1OVGA 3THWB 4GX2A 2W2NA 3THXA 2LCFA 3HDQA 2XMBA 4W5WA 4N5LA 2WVAA 4Z4FA 2RHCA 1KR5A 2REQA 3VC2A 3HB5X 1WX1A 3AF2A 3QWBA 1G7CA 2NUTB 3WA6A 1J24A 4GMHA 5ECGC 5DGIA 5TR9A 3WWIA 3GEPA 1MHTA 2O52A 5KNCH 2ORWA 4PR3A 1W6UA 3K0CA 1KMQA 3DYIA 3PGXA 1M34B 2GBPA 2PUTA 4JJ8A 1CJKC 1OIWA 3QEMB 3KD3A 1WBDA 4C88A 1NNEA 3GLQA 1CY4A 1KO5A 4FJ2A 1V8BA 3HSSA 4RSMA 4RHFA 3WLKX 4QWMA 1F5NA 4E5KA 2HYIC 2P1DA 4X00A 1AK9A 1RI3A 3FSRA 4U2KA 2QUJA 1RXYA 2PEYA 1EK5A 1IJFA 1NW6A 4TWAA 5H59A 3TKLA 1J8DA 5CM2Z 5EP2A 4WK2B 5T3YA 4CG3A 3VOAA 2YV3A 1KETA 1N25A 1EKVA 1XPJA 4BMDA 2IEAA 1N8SA 1Z6AA 1SOMA 4NG4A 4CKEB 4DRXB 4E2XA 3OIGA 4BOYA 5A06A 2IYSA 2I6QA 2XECA 4TXLA 5JI2E 3WO0A 2PX5A 2H5LA 5JZVA 4TT3D 4COKA 1Q3KA 4ZODA 1NC3A 2AN3A 2I3DA 2NACA 4UMDA 4AIRA 5CDHA 3WV4A 3E8SA 3W1BA 1EFTA 4OJQA 2G9QA 4D42A 2D7DA 4OXQA 1SQFA 3FZEA 4M60A 3ZGNA 5JCPA 3BE4A 3HRKA 1P7PA 3R0VA 4BNFA 4KOEC 5ITSA 2VQEB 2CW5A 1A2KC 4GE0A 2VTVA 1PL8A 4DLWA 4EPVA 1T2VA 2YJTD 1F8XA 3PJDA 3RU2A 5F3WB 1TJPB 3L1UA 3P9PA 3RVNA 4M0LA 1YQUA 1EQUA 4ZOLF 4I7EA 3TLGA 4ME6A 1XZLA 2O3SA 5B6JA 2BPOA 3SBOA 4CKYA 5KTKA 1WLSA 4C6TB 4Z2AA 5ED0A 1WDWB 4I50B 2Y99A 4WNCA 2W6CX 3DB1A 4XW2A 2ZREA 1H6AA 2YZLA 2DABA 1DDIA 1TCUA 2HXYA 3G2IA 3ILYA 3PNVA 4Y6OA 3RRJA 5K9ZA 1SKQA 1J99A 3DBIA 3H1EA 4FZ3A 3RODA 3U3KA 1PGPA 1QRUA 1XDZA 5D6NA 3W2FA 2IUUA 1U8CB 2ZULA 1B2LA 3QX9A 4FSXA 1L7NA 2RG7A 3D81A 1H65A 4U1RA 4EDFA 3IL2A 5HDBB 2YIVX 1L4BA 3I52A 1K9VF 4LTDA 1P8AA 4LV5B 2YKGA 4NESA 4W99A 3ROZA 3G0IA 2EZTA 4PYLA 4YUXA 4OU4A 1ZIXA 1GNTA 2PX6A 4MJLA 3ZS9A 5CP8A 3E3AA 4WINA 3PITA 4P58A 1EJ0A 4MR9B 1U7XA 1PCXA 4Y9RA 1PT8A 3QBTA 3ROPA 3WWYA 4CT0A 5KVCA 4Q3BA 1P5FA 2GERA 4DWVA 2VRWA 2HWWA 2AD5A 3IMFA 1Z07A 3IOEA 3WRXA 2UYCA 4LZAA 3W3AH 4LXYA 2IHKA 1RVV1 4NLLA 4DMHA 1E89A 3H3FA 3M70A 3HNPA 4OM8A 4Q1BA 2IBMA 3FPAA 4LCEA 4WRRA 4ND6A 3U80A 5B55A 3HLYA 4BO2A 5DLDA 4GLOA 1IG3A 2I9PA 4BX0A 2AQ8A 3BWBA 1XDBA 2ZJ8A 3K05A 1MOSA 3GUUA 3EA4A 4KW7A 4PGHA 3RIGA 1TFUA 1D2HA 1P60A 2ZTSA 5A6VA 2I4NA 1U8EA 2QPTA 3AOEC 3FPEA 3RW9A 4RGBA 2DT8A 2FPPA 2XVZA 4UVGA 4I3HA 1E1YA 3PJFA 4PXAA 3VPHA 4NCAA 3ZX4A 4MQ6A 1AQYA 3UF0A 5BNFA 1T8TA 3WGNA 2DT5A 2RGYA 3EXEA 4EHAA 2H4XA 1Y6GA 1GZ3A 3EEBA 1I01A 3DV9A 4RPCA 3EA0A 3A26A 1NDUA 1KK2A 2OM2A 4IOMA 4YMLA 4XYLA 4ZI7B 4FFSA 2W0MA 4B32A 5L3SB 2RHOA 3TEKA 4A27A 5BN1A 5IANA 3L92A 5E1MA 4AUNA 3W5IA 3W05A 4FMBB 1F5SA 1MO3A 2G72A 3JQAA 2C07A 4J0JA 1TLTA 4R4JA 4UU7A 4DV3B 3N6RA 1TYAE 1HC7A 4HGPA 2C4NA 4QXAA 5GJVC 2P2CA 4C0QC 5HCIA 1OYWA 1Y7PA 4FEEA 2BFDA 4RADA 3W5VA 1SD2A 3RHZA 3ZG6A 3K70C 1DUVG 1S5PA 1N3IA 1PR0A 3BHJA 3WMXA 3FCSB 4KIUA 2R60A 2WZCA 4ARCA 2YXNA 4UD6A 3ONWA 5JAOA 4NYEA 4YASA 3QJYA 4JGGA 4WUTA 3RM3A 4M88A 1CJSA 4L5JA 2M6LA 3QYAA 3ROGA 2A57A 5IC5A 4AJ1A 1UQTA 2EYQA 1JEOA 3ZZ0A 2OOKA 4NP6A 2FN9A 2ZBUA 5FHQA 1XO1A 4L57A 3PK0A 3FLAA 3I04M 3U61B 3SNOA 2ZIEA 4G4JA 4PCLA 2BFFB 2GWHA 3JTMA 4QECA 2XE6A 3EVFA 3DXFA 4MK4A 1Y6ZA 3FFWA 3N2YA 4MVJM 1CXZA 3K53A 4O4LA 3VSDA 3GEGA 3WLJA 4B75A 3EXEB 3HB9A 1XRNA 2XT0A 4FDLA 3CUWA 1BOOA 3VZPA 1E7MA 1WWKA 3NBZB 2HXSA 2YWFA 4UBLA 2NMVA 3L7OA 3W8EA 1J1ZA 2WSYB 3VOTA 1BE8A 1ULAA 2C04A 5AIBA 5NULA 1N5MA 5FWAA 5GTDA 3GGOA 4R1UA 4ITVA 4IIEA 3WDLA 4FYHA 2F1JA 1HFWA 1RXIA 2AHOA 1OAOA 1CB0A 2HU2A 4JA0A 4X1KB 3TZEA 4JA2A 1M1NA 3C5EA 3EEOA 3ND7A 4AUEA 1W49A 2VQDA 3C7DB 3TKYA 4B3SB 2HCBA 4LH7A 2QUBA 3F74A 2J5BA 2AW5A 2BL4A 5KOIA 2CLOB 3NC1C 3V8BA 5A2GA 3WI7A 3U4GA 4A0QA 2X6QA 4D43A 4P3KA 2O6HA 2BR4A 3FFXA 1G5IA 3COSA 4DADA 5KJ6A 4QVIA 1QSGA 3OIDA 2I87A 4R1NA 2EFCB 4J2HA 5G0TA 1FS5A 4ZYWA 3SQWA 3RVSA 1B00A 2OFPA 2RK4A 1X92A 5DI9A 4FT2A 1IXRC 4WK6A 3R40A 2NZ8A 4RLQA 5H83A 1WB9A 3ABRB 1YZQA 1O96A 3KLOA 3KR0A 2XI4A 4OB7A 2QTCA 3LTEA 4PANA 5M04A 1IXSB 2I2FA 3H9GA 1E2UA 4DCCA 1Y42X 2WKPA 5LQDA 3TBFA 1FSGA 4C0XA 1E0KA 3E5MA 1NR1A 1PVVA 2OQRA 2CL0X 1SIBE 3QUAA 1P17A 1JSRA 2I67A 1OLUA 4YXWA 3PTAA 1KTIA 3QVJA 2AE2A 2G5GX 2DC1A 1JPNA 1C0LA 4KPUA 1EK1A 5DU2A 2Z58A 4M0KA 2IBTA 1Z5ZA 2W6QA 2H2FA 1T9GR 4HOYA 2IP1A 3DBVO 1FLDA 4PZDA 4QGAA 5JDCC 1M2NA 4GMXA 3TMYA 4D97A 1C9DB 2VKTA 3L4BC 4KRYA 2ARKA 2GM9A 3QKSB 1W19A 2VYVD 3X2FA 3CS3A 2VJAA 5LMUB 3R7NA 1GV0A 2JJ8A 1U0OC 2PRKA 4I4TF 3EG9A 3T06B 4YYEA 3ZHXA 1BO6A 4A6PA 3URKA 3OLYA 5EJFA 1E4YA 4R1PA 1IHXA 1OH5A 1EE9A 2VDPB 3C6QA 4I1RA 1ZIPA 1DO0A 1GCAA 1VIDA 4PF1A 4BRSA 4PAOA 1QHFA 4S05A 3PHCA 4V0ME 5LB2A 3F6EX 3RBVA 4N3NA 3GW8A 4MUFA 4G37A 4DC1A 3LQ2A 1TVKB 1NTOA 1LSUA 4P0TA 1AOXA 4R98A 1ZI8A 4RF2A 2BGIA 5SICE 8OHMA 3WDMA 3QSGA 2YZMA 3F1LA 3KB2A 3F2IA 3SI7A 3W1VA 4QM7A 1UR5A 3T99A 5JDIC 4IIUA 3AR3A 5AW9A 4B4DA 2E4ZA 3CRMA 4QPNA 3VTZA 1UBUS 4L75A 9LDBA 2GILA 3HJRA 2O2IA 1CUEA 5K4AA 3BDVA 5KTNA 1SPXA 3GJSA 3HUFA 1NBMD 5LQKA 2VJQA 2W90A 2XJ9A 3PN1A 1CDOA 4KKXB 3DZGA 2Y4RA 4MWZA 4C76A 2WBLC 4ZQGA 4CL2A 2Q8PA 3EWAA 4FLEA 1R6AA 3IDQA 2CCGA 4JROA 2Q0XA 1INLA 1JA9A 3E7FA 3IQFA 3ST7A 3E1GA 3LM8A 2Q4EA 1GQOA 2VBGA 3RJ5A 3W6NA 2Q99A 3BHIA 1ZRMA 1C1HA 4HNSA 2VTBB 1P19A 1XB2A 1Q0SA 4C01A 1JI3A 3H9JA 3E15A 1L4FA 4EG5A 2ZJ4A 1PD1A 1H42A 1XXHB 3FPLA 1NNSA 2IVZA 1JDPA 3NYWA 4GIBA 4HDAA 3VDQA 4AIIA 4B3HA 4KPYA 3CEMA 1IJKA 1JJIA 1CUXA 1F8GA 3HE3A 3I5XA 1U98A 4IMJB 4NS1A 4ZKDA 5THXA 3DM5A 1EEHA 2XUGA 4C22A 4LBWA 5JYCA 2D4HA 1VPWA 1PK8A 4UCVA 3AUKA 3ZI7A 2RJNA 1JDUA 1PL6A 2QL5A 1T4CA 3HR4A 4IMPA 2I8AA 1U9JA 1UXKA 4F3TA 4DIDA 4N3CA 1S7GA 1YB1A 4CUKA 2WJ3A 1FFAA 1C0IA 3OJEA 4MQ5A 4JUCA 4UUNA 2QM7A 2PKQP 2CK3A 1SOAA 2V6JA 2YQ5A 3FROA 4HDCA 2D2VA 1SJ9A 1TCBA 5AJHA 5K0CA 3JATA 3OSZA 4ITRC 4GOXA 3NPAA 4OU5A 1SD1A 3X1ZA 2IDJA 2D8MA 1KZ9A 4HJRA 5GPBA 1V8PA 1B0ZA 3EUFA 1VDMA 2WE7A 1D2CA 2C84A 1B0PA 1Q77A 2QG9A 4B85A 1MRSA 3V9PA 1ORRA 5JR3A 1COWA 4LJSA 3CISA 4KITB 4RH0A 2QROA 1IDOA 2C3UA 3QNUA 5IT5A 3A6KA 4CM9A 4R2JA 4IX1A 5CHYA 3PC8C 1J1IA 1UT5A 5M5BA 2G40A 4RGQA 5CYPA 2AEJA 4CFZA 1CR6A 2JGKA 3I2FA 1EWTA 4ZP1A 4P38A 4BNDA 2G7ZA 3AC0A 4O2AF 3DWFA 4GUAA 1PFYA 2VP9A 4WAUA 5DULA 1YGYA 1SBQA 3HI6A 2P65A 3FYUA 2C5EA 3SAJA 3U9TA 2LIPA 1EK2A 5EUCA 1RM3A 3TW8A 3IFSA 5KKCA 1NJGA 2QX9A 4M0EA 4MVYA 5GZ6A 4UEJA 1H3FA 3EIFA 4TUYA 4X7RA 3QPDA 4QHSA 4LC0A 2IPLA 2BM8A 5LZ5A 1XDDA 4UKDA 2Q5OA 2JS7A 3W77A 2BN4A 5DIFA 4MS1A 4FZ5A 1P91A 1UAGA 3SIXA 2I3ZA 2Z30A 4ILEA 5EWMB 4YRRA 3R7DA 3ULKA 1XEWY 4MEJA 4RX1A 3SNKA 2FF7A 1O6BA 2EATA 3V1TC 3WO1A 1X2BA 3EQ6A 5IXYA 3KETA 1IOVA 5IWAB 4CLOB 3VYRB 3F71A 5JAHA 3VR6D 2CEAA 4URWR 4DY4A 5C5IA 4Z9FA 3F1KA 4DCVA 4QTXA 5IEJA 4K2HA 4IHJB 3HYSA 3A4VA 1D03A 4MQBA 1GHTA 1QH0A 2E4XA 1KY3A 1OZAA 1VE6A 4L15A 4N76A 1SVIA 1BJKA 3UYYA 4IEIA 4YRCA 5P8WA 1TIPA 2O2GA 1P0MA 4PM4A 3D0OA 1EUDB 1OA1A 3N6VA 1RKQA 4F91B 5BVHB 2C42A 4CIYA 1YZ3A 3QBDA 4HZGA 4BRUA 2C98A 3E53A 5D7BA 1DIGA 1HTBA 4JLPA 5CRIA 3DMTA 4LFAB 1QGUB 4AB1A 5CH8A 4G67A 5J2TB 2RGDA 4IXMA 3VYTB 4LF5B 4AN0A 2XTNA 2Q3HA 3ASZA 1CUHA 2VHUA 3L4BA 3SXUA 1K75A 3NHSA 4A1OA 5J63A 2O5CA 4ARVA 3LX5A 4L9WA 5G1PA 4EQ5A 4BQQA 2HA4A 1IB0A 4G4SP 2F1KA 4XAQA 3BACA 2JK1A 3K9CA 3NRBA 5IJAA 5DTIA 2QAGA 1AH2A 5JXWA 2UYYA 4H7PA 3E7PA 5KYUA 3U19A 1L5VA 4MVJA 4NCHA 3UKJA 1E77A 5TJHA 1E1LA 1LVHA 4LSGA 4B6QA 2YZ2A 4AK9A 1CRPA 3T9BA 2OHGA 5D51S 3RNLA 1GNQA 2BVNA 2FEWB 1Q6YA 1G0NA 1WXDA 1GGMA 3EIQA 2ROQA 1K88A 1G5HA 4YRGA 3QOYA 4BB5A 3H97A 5CFNA 4P8RA 5CVTA 4IOKA 2CLHB 4II2A 1E9CA 2GUWA 3Q9LA 1ORVA 4U39A 1QIGA 1I9GA 5DHPA 4YCNA 1U8AA 3PTLA 4DLBA 4QPZA 1H4VB 3ZTWA 3V4SA 1LFDB 1UKVY 4JUFA 2GZMA 2ZSBA 1GTL1 5FTMA 5HKBA 4TTRA 2Y1DA 1E3DA 1NVXQ 3N70A 4XJVA 2JHPA 4JWTA 3I58A 5FA8A 3TCKA 3WXMA 4DBVO 2GCPA 2VBFA 4MB2A 1QQ5A 5EJ6A 2CJWB 4BRZA 4DRYA 4I99A 1Z6TA 1C3LA 4B3JA 3UJNA 4A0GA 3IS3A 1UH5A 2EWWA 5JARA 3VKHA 2B8WA 1Y5IA 4E5PA 2ZAOA 1CP3A 4JR0A 5EZYA 3S8MA 3T5CA 1TEVA 4MQFA 1ZMOA 1XEAA 1YZVA 5LZ4A 3MCVA 1HDCA 3H65A 2X5OA 4J4BA 4Y9TA 5F3RA 2J0SA 2NPIA 3NDPA 4NX2A 5KJEA 1SUFA 2ZVDA 1M8KA 1MGPA 1WW3A 1SIWA 5IAGA 1W47A 5AUOB 1ZJZA 4IIXA 5EIFA 3UT5B 1QONA 4DV4B 2J48A 3PXXA 4P0PB 2J0UB 3IKVA 3EXFB 3GIWA 1UM9A 1Y8RB 4WFQA 2NVOA 4Y67A 2WD9A 2VSYA 1U7PA 1U8TA 3TNYA 1L4MA 1O77A 4H0CA 2AT1A 3LQ1A 4Z4CA 4IY1A 2CL7X 2I6UA 4YUWA 3HKDA 3KL4A 2NXEA 3ZW8A 5J4HA 5CAEB 1A2BA 1GZUA 3ORYA 4OAQA 1TMYA 3HN2A 2Y93A 4ZI3A 2W58A 2VCYA 4UEWA 5IPFA 3I32A 1EXVA 2WVGA 4N40A 4FGRA 1A9OA 2N75A 1EBBA 1CDDA 3QELA 4OXYA 4E22A 4BO8A 1ZI9A 2ZCJA 2POQX 2XQFA 2OQVA 3RSSA 3BRWA 3PQ8A 3N8KA 3AL0C 4G36A 1SK8A 1KI9A 1MH9A 1PU2A 4GPEA 2FUEA 4KQ6A 1NXSA 1TYCA 2QJTA 1ODSA 2NXNA 3HVUA 1C7ZA 3CMCO 3TL6A 3OZRA 4YHBA 4DCTA 3AYZB 5KO2A 2VWHA 3EQ8A 3OEYA 1C7RA 3W2HA 4WESB 2D5LA 5K0SA 1J22A 3LT0A 3R7WB 4UOEA 2C4HA 1PS0A 4KN8A 4NPAA 1H1LB 3DVAB 2ORED 4D9GA 3E18A 2NU8B 3M2TA 1SBTA 3IQWA 3Q7RA 1WHTB 1I0IA 1XZGA 4ATNA 5AVQA 3B7WA 1N2JA 3W78A 1ZK3A 5COQA 5G0SA 2G1JA 3HCAA 3G89A 3LUGA 4KQCA 4RSHA 5AXAA 4W5TA 4FBMA 3KJQA 5DHFA 4LJ6A 1WDMA 1FDTA 4FFNA 3CW9A 1Z37A 3H2HA 2J1LA 4E21A 3HJTA 2VDWA 4AL4A 1MEOA 3R0IA 1KQNA 2D1FA 3QX8A 4NV3A 1R6XA 1WBBA 3GGPA 3AHFA 1X7DA 3H2JA 1Q1GA 2DHDA 4QDOA 1WB4A 4I9GA 1OT3A 4BNNA 4BWYA 4H7DA 4IDNA 2I4OA 4WFJA 5HX7A 1E3EA 2I1QA 3LQRA 1XDNA 4LNAA 4C30A 3D6HA 2JCBA 2O7NA 4ZI7A 5JRDS 3IIKA 4BAZA 1NP7A 2B2XA 2XB9A 3OQNA 1N3LA 1ZJ5A 5G3YA 3U39A 4A0RA 4DLRA 2BE7A 5F7ZA 3GNTA 3KLBA 1Y3HA 3GXBA 5D5PA 4K9KA 1R8QA 2XOXA 1S8AA 4HH0A 2HLHA 5LPNA 1T34A 3I1YA 1RC0A 3C7KA 1IY1A 1QFZA 2JANA 3RRXA 4BATA 6NULA 1QJCA 1R15A 4GR9A 2NU7A 4E1VA 1ILWA 5LQMA 2GHRA 2GZDA 2IV3A 2GNOA 4XWTA 4YMGA 2XCTB 1E20A 1KFJB 4YAWA 2TYSB 3ROEA 3RT9A 3LBNA 2DLDA 4B6JA 4BZQA 3GARA 4NONA 2X40A 1EB8A 4XQEA 3SE7A 2HBRA 3ET5A 2ATVA 2O5VA 2XXBA 1UJ6A 2AI3A 3PPXA 4RENA 4E7PA 1SOUA 2X14A 1IB6A 1W2WB 3IUSA 3AIOA 3L06A 3QW2A 1E3MA 2CFTA 2FU5C 3BH7A 5AK5A 5EIAA 4CFYA 3JQAD 5K0FA 1Z17A 2WP0A 3SF8B 3PRKE 1SCAA 3IAM1 3FLBA 1G4AE 4RDIA 3ZKAA 4X90A 1G63A 5K3WA 1I3MA 2GM3A 2I33A 3DFIA 5E6SB 1EFPB 2OGSA 4IVQA 1EFRD 4MQLA 4DSTA 1VM6A 4D8WA 2HI0A 5KS2A 3BIXA 1ZM4A 1HKHA 4WZAB 1GZDA 1XQ1A 5DNAA 3FTFA 3BF7A 4KG7A 1AA6A 1AUVA 1F12A 1QOZA 4OF4A 5LXTF 3GUVA 1ICEA 1KI3A 1XKQA 3JVVA 3KHKA 4MRSA 4PSVA 1J09A 3OA2A 4OK3A 1HDOA 4YDSA 4ZTUB 3DR5A 1YXMA 2PTHA 4H6WA 4E15A 2IK8A 3O0DA 4DLKA 3BPSA 1YFKA 1WL8A 3VV2A 1U9IA 3O83A 4M76B 5KU7A 3N8DA 3WRWA 1QU2A 3GRPA 1GEEA 4BJ3A 4BVLA 4FGWA 1X7WB 3GGCA 4JVSB 5EI5A 1WUIS 4R8LA 2UUBB 2HDOA 1KU6A 3QTLA 4GOOD 4HDNA 5JSZA 3B1FA 3FXAA 3IA2A 3F2VA 4Z7NB 2UAGA 2L18A 1ETUA 1U3GA 1QLHA 3PXBA 1Y3CE 16PKA 1B8PA 1FFHA 2QRKA 3JWEA 3ANXA 5LA6A 1MJ5A 1LDYA 2XNHA 4YLEA 1O0BA 2OC4A 3C5CA 2MINA 2X9GA 3DE7X 5KNBH 3NORA 1DAOA 1QH8A 1JHUA 1SCJA 2HHFB 2PFKA 3DMFA 3IAXA 4MCJA 4XYEA 1C8KA 2AFIE 5CYOA 4L5CA 5H81A 4JV5B 3KOXA 2QLMA 2A67A 2XWJI 3VNBA 3HZRA 2PRZA 3WLIA 2K2QB 3KCNA 4MLDA 2XYVA 4HQFA 2HK8A 4LMAA 4Q05A 3W9YA 3Q3HA 3O2NA 2R1TB 1NY6A 5LZ9A 4JC4A 4YMUA 3CINA 1TCAA 2PU5A 2WLSA 1NV8A 4NCJA 2RKWA 5AKIA 3TZBA 3UT0A 4ETIA 1Y8AA 1D2EA 6GPBA 1TQ4A 2Y1OA 2QE7D 1IN4A 4QVGA 4UCXA 4N47A 2HIGA 2WUWE 2VL7A 3MQFA 1M1XB 2HL6A 3I9V1 3OO1A 5FEMA 3C3DA 4G2TA 4EW1A 1BXZA 1U1CA 3B20A 4H08A 2ORVA 4YJGA 3RR2A 3ND5A 5M7EA 1F6BA 3M3PA 3FTQA 4EZIA 4X60A 2WWVD 4DXHA 4NOMA 4OBWA 1GR1A 1ZRHA 5BWTA 2WI8A 2Z4SA 4Y2RA 3WSTA 4TWRA 4TV9A 1WB6A 3LGAA 4PLZA 4L74A 3RVJA 3TOZA 4M89A 4ZO8A 5JDIA 3TI7A 4NU8X 4HDKA 2YOHA 4JZKA 2OAQ1 3OTIA 1E0JA 1NVBA 3RS3A 1Q11A 5EKXA 1T3ZA 1AIPA 4O63O 1T10A 3HB1A 4RFSB 1DX6A 4L2IB 4LHEA 1SFRA 4DAOA 4QX6A 2AR9A 5IAJA 3SSOA 1G4UR 3DC2A 4RZQA 5JMWA 1L1FA 5LDHA 5CGZA 1IRIA 3CG4A 3UV6A 3ZHYA 2VP4A 2CZQA 1C4OA 1ODTC 4WOKA 1JAIA 2LPMA 2BTOA 3KYCA 4IOJA 4JITA 3ZVLA 3U54A 1N7HA 1RJ9B 1SD5A 4MUBA 2R87A 1K89A 4RKEA 4WGGA 3QFTA 4R8RA 1I6MA 4KSYA 5LBUA 3ZU5A 1IBLB 4LXHA 3AERB 1RW4A 1E4OA 1PX0A 1Q22A 4KMOA 3ZDXB 3KYHC 2PH3A 2JH9A 3MWKA 4ICIA 1DQSA 3AO0B 3UO8B 3HBFA 2I2CA 4NENA 4X1YA 1KI7A 4Q5IA 4US1R 3KYCB 5A4KA 3KWJA 4BFWA 3TX2A 4XRGA 3CJTA 2G1AA 1RI1A 3BZUA 1C9EA 3T3MB 2C5GA 4FGZA 5E2IA 5KHAA 4OXIA 2UYGA 3VYUB 1UJNA 2I29A 1SAYA 3K09A 1O6ZA 1EMDA 1QIFA 4G26A 4INPA 4L2IA 5DNEA 2RFLA 3F47A 1XZNA 1DBQA 2GAIA 2C77A 2H92A 2PX8A 2WW8A 3IE2A 2EAUA 2IYAA 2CJXA 2JGFA 5DGHA 4WK4B 4YACA 1QAOA 3MT0A 4JSRA 3PGVA 1XK6A 3CF4G 5A7HA 1PG0A 3VPAA 5F1KA 2APJA 4HFMA 1QBGA 4YT8A 4I8IA 1AMUA 2SNIE 5JNVA 1VLHA 1Q2UA 2AFVA 2OOSA 2Z1NA 5BSVA 5HM6A 4M7RA 1D1PA 2QVLA 4YJGB 3AY0A 3MTDA 4KGZA 1DV2A 2ICAA 2R751 2VP6A 4BP9A 2NV6A 4FE7A 2FW7A 1F48A 3ZJ5A 4EHLA 4H59A 3VI4B 2WIBA 2FMIA 2QVXX 3EXHC 3M6VA 3QHQA 3QYJA 5LFAA 1PJTA 1XQVA 4KV7A 4UUAA 1WABA 1CUSA 1FNBA 2F7SA 4CL8A 1A1SA 3NIDB 1R18A 3I9KA 1ZUIA 3NTQA 4MO2A 3V8NA 2ZRGA 2D7CA 2X0IA 4KO2S 4IFIA 2IZ0A 3RUEA 1KYVA 4M99A 4YRIA 1JIIA 1RPZA 2RB4A 5GV7A 5FTNA 1NM5A 2JJQA 4A26A 2QVCA 2YL2A 1RMTA 2HHFA 1MCZA 2WKWA 1QH8B 2GN0A 4R2WA 3D8TA 1THMA 3ZDZB 5KHOC 4GXTA 4MAAA 2ODWA 1KVSA 3ACDA 3WK6A 3CZ9A 3DDNA 4O3FA 4PPYA 4RIEA 3NBZC 3W5BA 2FR8C 4OAOA 3ESRA 1PV1A 1QE5A 2Q7XA 2YZKA 4QFBA 5HEKA 4HV4A 5JV5A 3CPEA 1EJBA 1ZXBA 2XA2A 3ZJYA 3GT0A 3VJKA 1FFWA 3NJRA 2WTUA 5A02A 1EU1A 1TLLA 4CV3A 3VC3A 3AU9A 4ZCSA 4LK2A 2GPBA 3CH4B 4C7XA 2B34A 3DEHA 2ANBA 5AW7A 1STOA 4OFBA 1YC5A 3COYA 3AKEA 3GA5A 3NOVA 3N2GA 3ZBUA 1EFCA 1Y1TA 4CMKA 2EKDA 2QTBA 4YPOA 2ZRLA 1BN7A 1R64A 3X2EA 3G02A 2IOFK 3W06A 5EE9A 3KKLA 4QQNA 4ZJPA 3SP1A 4KN6A 4LSZA 4ZKEA 2ODEA 4G8BA 1YC2A 1ZUNB 1Q19A 1EKXA 2C0QA 2PGAA 4QDXA 4ZGWA 1JN0A 1NHWA 5AW0A 3F6YA 3CN7A 4WZAA 4ZDJA 4G0UA 3EPPA 1NBIA 2FZWA 2YWRA 3OZBA 3GOHA 3WLHA 4DV0B 4NH0A 1GAEO 3TEFA 5I4CA 1TEXA 3KOMA 1AT1A 3GRCA 3G5LA 4G24A 4O4HB 1TX4B 4K1XA 1MQAA 1SVNA 1V0JA 1EZZA 2FN3A 3G5MA 3OHPA 4HJXA 5CA1A 5TMEA 4GKVA 4ZZ2A 1HZZC 3CB2A 1IZYA 1XMVA 2C1ZA 2Z02A 4NDZA 2H1FA 4S35A 1KVUA 3AKZA 1KO1A 3P5SA 3OE5A 4Q48A 4XLLA 5TPWB 3ILXA 4RV5A 2UYOA 1NXPA 2CLCX 1HLFA 2IIVA 3QIAA 2RMKA 1OXVA 4PYRA 4EY6A 4CKWB 3B6IA 2GX6A 2Z3WA 3LHIA 2O6LA 1MG5A 3UMRA 3SYMA 4BQFA 3PXCX 4LRSB 4O81A 4PPGA 4TQUS 2VPXA 4PSKA 4D4JA 1JR6A 4F4DA 3LT2A 3HY3A 2YMPA 1FX0B 1N5IA 3MIZA 5LKRA 3A9VA 1R16A 3U7IA 3JSNA 5CVJA 4WSOA 1XJCA 2GPTA 2JLXA 4BGUA 1AM4D 3QW4B 5K45A 1JBQA 1OWPA 2QX7A 4O8CA 1R4MB 2O4CA 1VC2A 3E3OA 3EMVA 3KP1A 4D9EA 1IBCA 2RBKA 3UFBA 3PYMA 3U4IA 1QGED 1WTCA 2H1HA 1XV5A 1PWXA 2WOJA 1BSVA 3AJRA 3STUA 1NVWQ 1YCFA 2RHBA 5B58T 3FRIA 2D5CA 4BRWA 4I3GA 1NURA 1YS9A 2YW2A 2SICE 3PQ3A 4V0LA 4ZOCA 4F6RB 4XGKA 3I53A 4PO9A 5NLLA 1NC1A 1PGNA 2F1RA 2VDWB 1UMCB 4RMJA 4YI5A 1NIJA 2G88A 4D3XA 4F4JA 2Q2NA 1SQ6A 2FW0A 2AXNA 1KU0A 4RWZA 5DCLA 3BWVA 2G25A 4MSUA 3INYA 2JJYA 1JIQA 1C8VB 3EC7A 4UM7A 4HWOA 5FNVA 2ZT6A 4UDNA 1O0CA 3L4EA 1X7XB 3EVDA 2GPJA 4JOSA 2ZIWB 4RY2A 4PV7A 4FQ5A 1WD5A 4RIFA 3UH1A 3GQBA 5JPCA 1WHTA 1Z75A 3FOAA 3ROXA 1MVLA 3IP6A 2NU8A 2JD1A 1E32A 3ZU6A 4GRAA 4GUDA 1IPEA 4TSFD 1TO1E 4FFBB 3DOFA 1QV7A 2I66A 3KVNA 3OCWA 4Z0TA 3SLGA 1T4BA 3STWA 1QK4A 2I4LA 4KLNA 2A0WA 2FMFA 4YGXB 1KPIA 1ZU5A 1GCIA 1XGKA 3S2SA 4BAUA 3ADDA 3EIXA 4O3MA 3ZNPA 4OMDA 5FBZA 3AF3A 4KGVA 5FYDA 3IUPA 3O4GA 2M9MA 1JL3A 1UT6A 4AZTA 4ZT5A 5CBPB 4IGKA 4NXMB 1TZCA 2YQ4A 1EAMA 4GVLA 1XDUA 3FHLA 4J9VA 4DQUA 4NZOA 1GOTA 3E27A 3ZCRA 2HW8A 3S5JA 4IO1A 2WAAA 4FDMA 2GF2A 1MB2A 3B5IA 1N0WA 2PJZA 3LZDA 3DDUA 5AJUA 3U31A 3V7WA 4TKZA 3V7UA 1DJQA 1EWYA 2GCIA 4FB5A 4MWDA 3QQMA 3LPDA 2OUIA 2PIDA 4M0UA 1HTWA 5E0OA 3BXGA 1KY2A 1N1DA 1DQPA 5ALGA 4OHPA 1MIHA 2GF9A 1ZNXA 3SY8A 2DAAA 1R6VA 1Y8RA 3GDGA 3JYOA 1DRUA 1I1LA 2XJ4A 1E2MA 3PGKA 4IL5A 4PSCA 5HKLA 1C9NA 1TQ8A 1W25A 1DBVO 3IHWA 2B21A 3UT5A 5JPIA 3HJCA 5LB4A 5HHTA 1LNZA 2PX4A 3DVRX 2GJKA 3O4RA 4PLVA 4OMFG 5CPBA 4ZT6A 4G07A 5LUBA 1N9ZA 4GM4A 4U8GA 3IILA 5HSGA 3A2KA 1W4BA 5D5HA 1HKUA 2V4UA 2ONYA 4BYGA 1R4MA 4DM3A 4QYIA 3JX9A 2JL1A 1L5HB 4XM0A 5EZYB 5KPJA 4FYWA 1U9IC 4AJLA 1IK6A 2CNQA 1BWPA 1O8CA 1SQGA 1T13A 2F9FA 2PWBA 2WUFA 3LRTA 5CNKA 1F0YA 2JLYA 3AMVA 3KYBA 5I7WA 4OKSA 4B7CA 2W93A 4OATA 3KJIA 1BW9B 5FLYA 4ED9A 1XXHE 1SA0A 3KXDA 3R20A 3T7DA 1J2TA 4LNUB 3DCNA 5AHXA 1Y8ZA 4MWEA 4RPJA 4CKWA 1NSFA 1RWBA 2VDMB 1B1CA 4UFOA 5FV7A 2GYWA 5GWXA 4ESOA 4DKJA 4UTZA 5I9IA 1G8KA 5GONA 4WZZA 3CF4A 1WCYA 2OQIA 2L17A 1D0VA 1JMVA 4XZ3A 2R65A 5D85A 3PENA 3JR3A 2RC5A 2HA7A 2QAGB 4M9QA 3EGDA 5TQVA 5FV4A 1FJHA 1X3LA 4DMFA 3S8YA 4DUZB 4PXSA 3IRUA 4Q34A 5ALRA 3S2EA 4CHGA 1IEWA 3MBOA 1LDEA 1LDGA 3UJ7A 2C9BA 1RI4A 2P5YA 4IWYA 2JEZA 4DSZA 1I7SB 1TM7E 1QHGA 2HRBA 3DZJA 5CUQA 3ZGLA 1Z7EA 3DKRA 1NVKA 3SBXA 4JB8A 4M46A 2J4FA 2XDWA 2Y0PA 1YDFA 2Z83A 3MRSA 3AQ4A 3AM3A 1N2ZA 3KVVA 4EA6A 2W6ZA 2IODA 3KQVA 3R0XA 4CTJA 2MT9A 4HNRA 3KZXA 2PGIA 3DBOB 1D6SA 1O58A 5E2BA 5SYNA 2X3FA 5AOBA 1B3BA 1LK0A 3TBKA 1E2GA 1K5GA 4L22A 1RLUA 3AR4A 1CEYA 5FLEX 1IN8A 1OI3A 3LBHA 2QN1A 5K1ZA 4JVLA 4E1AA 1II0A 1K8YB 1PR6A 2A5FA 4FI3F 3KBBA 4W5HA 1WMAA 2XUQA 4ALNA 1L5MA 2VDJA 5BQXA 4R2LA 1FXUA 1DAIA 1VJ5A 2PSSA 3C43A 2C8KA 2PSJA 1RTKA 2PNFA 3VU3A 1N34B 3DUWA 4BNYA 2QK4A 4GQAA 3T5BA 1E1QD 3TQFA 3FSJX 4JP8A 1Z5UA 2WSMA 4I2VA 4L51A 5DYNA 4BO4A 1JHXA 3GY0A 1QVAA 2QTWB 4RF3A 3VSBA 5BMVF 1JT2A 2IZOA 5A4IS 3DXXA 4EFBA 4YBZA 4LF7B 4JI2B 3U4MA 3TQSA 2EQ5A 5IH3A 1TI7A 5H9VA 2F00A 2OV1A 1TKAA 3L7DA 1N32B 2BAGA 1VL8A 1KJQA 1ZAUA 1VI5A 3WKAA 2D2FA 3GJTA 5CB0A 4V02A 3MCWA 1RAEA 4Q9IA 4ZU3A 4MV4A 1HDIA 3PFFA 3GDWA 1QQTA 5I5SA 1RPAA 4MKHA 2GRJA 3HVIA 2PN1A 1K3TA 3CCCA 3WWDA 2CNDA 2IYQA 1G0OA 1VL0A 2NVUA 2YZ7A 1IIRA 2OCKA 4RQBA 2OK8A 3EARA 4GVXA 1HI9A 8ATCA 2WA1A 3RVOA 3LDGA 3WRVA 4HDSA 3RSHA 3FKSA 1RLTA 4PSDA 1PKXA 4E14A 1SUCA 3DEFA 2P41A 5I9BA 4DXDA 3D6FA 1DBRA 4GX5A 5CCEA 1UBJS 4J94A 3CA8A 4FOOA 4U5XA 3C85A 2DVMA 3HL4A 4BFYA 2IUTA 1NE7A 1E3IA 1UOOA 3LPLA 4QOEA 1M33A 4C7MA 4Z1MA 1JB9A 1OXMA 1Z7WA 5DGDA 1DRVA 3INRA 2Q50A 2HMVA 4UFNA 1GAXA 3LL4A 3DVLA 3I39X 3VBCA 2NP6A 1Z9BA 4S1VA 3DEKA 3AHHA 3L6DA 2WJPA 3GG9A 1X13A 5F2KA 4JX9A 1JP7A 4I66A 5DHQA 1B15A 2B1JA 2FPKA 1XZEA 2HJGA 1EEXB 3PFGA 3SSAA 3JATB 2WOOA 3DV0B 5T4HA 2YHSA 3I4FA 2C7GA 4FUQA 4G25A 4HVAA 3K71B 1SCIA 1US8B 1C80A 2W2MA 2QA5A 4RQUA 5I5YA 5AI6A 4NE9A 2HA3A 5BV1A 2O1XA 5KB3A 3EGXA 3C45A 4I9UA 4MI9A 5C51B 3A6FA 2CMDA 3KT0A 3VVMA 2O7SA 4YMSA 4B0OA 3RT7A 5J9FA 3OM0A 2PCLA 5HKKA 4XIFA 3C3YA 4JYAB 1YTUA 3GFPA 1BE6A 4EG4A 1YI0A 3ZN2A 3PB3A 4YP6A 4DQLA 1TRHA 2PS3A 5ESXA 1UQRA 3P2KA 2VYNA 1U2EA 2ZTHA 4HZIA 3UZUA 1I1KA 1U5CA 2LD4A 4D0NA 1C0PA 4MLPA 3P9KA 4P3XA 5HOQA 2Z5LA 4FHDA 2X42A 3X1DA 1XYVA 2FPIA 2MHCA 4M0DA 4ZV9A 3ZX5A 2G08A 1V2GA 2F64A 5C1OA 1JZSA 3MCZA 5A4MS 2O8EB 3OKCA 4L0DA 3QFFA 2GEJA 1RJEA 1RRKA 3D7MA 4MVJI 4O1MA 3GVHA 5E1BA 5G4KA 5BWNA 4JHXA 4EEZA 3OCYA 5K0NA 1ADJA 3GVIA 4LQ4A 1RJFA 3UJBA 2XZLA 2IPMA 3KKMA 1EDEA 4FK8A 4O4JB 4X24A 3B8EA 3KHUA 5JZMA