2ODTX

Structure of human inositol 1,3,4-trisphosphate 5/6-kinase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
315
Chain Sequence
KGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPESVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Inositol-tetrakisphosphate 1-kinase
publication title Structure of human Inositol 1,3,4-trisphosphate 5/6-kinase
rcsb
source organism Homo sapiens
total genus 100
structure length 315
sequence length 317
ec nomenclature ec 2.7.1.134: Inositol-tetrakisphosphate 1-kinase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF05770 Ins134_P3_kin Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain
X PF17927 Ins134_P3_kin_N Inositol 1,3,4-trisphosphate 5/6-kinase pre-ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.100 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2odtX02
3.40.50.11370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2odtX01
2QB5A 3T9FA 4Q4CA 5DGHA 4Q4DA 3T9CA 2Q7DA 4NZOA 4NZNA 3T54A 5BYAA 3T7AA 2ODTX 3T99A 4NZMA 5DGIA 3T9EA 5BYBA 4HN2A 3T9DA 3T9AA 3T9BA
chains in the Genus database with same CATH superfamily
5LQJA 2VAWA 2D3TA 3D43A 3ZTWA 1DEXA 1DUVG 1Z7WA 2VP6A 3K92A 3PGA1 4NBLA 2IA5A 1PJRA 5FTLA 2LTAA 3IQXA 5FLXA 1QM5A 4U2BA 3QFFA 4OO3A 5ECYA 3GOHA 4KIUA 5ELMA 2D74A 2Q5OA 4PYOA 2RH5A 3E2MA 3TMKA 3TWOA 4YV7A 4MDFA 2IPLA 1KIFA 3K0BA 3TLEA 1F0YA 1R5JA 2XMRA 1GZDA 2N47A 4QOIA 2OHHA 3ELDA 4DREA 3AVVA 5IULC 3IKLA 4H1WA 1CLEA 2ZBFA 3NJ4A 5G1OA 5JH7F 4TKUB 3FCYA 5TPWB 4UPEA 2NZ2A 4U6SA 5T41A 1KZHA 2WP0A 2RK6A 3JTMA 1LVHA 2GPSA 4U5QA 4E4RA 1JFTA 1H93A 4YP5A 1HE3A 5ALEA 4RH1A 1CS0A 1H2BA 2Q7XA 4TTSA 3FETA 3I4LA 3FB4A 1LX7A 5F9HA 2HJHA 5JXJA 3HCEA 1CETA 1YQQA 2NTEA 2HCJB 2EATA 2HWXA 2VT7A 3CRZA 4HNAA 4Q21A 4CF6A 2RHJA 4R31A 3M6MD 5KTRA 4IDHA 4E2YA 2VN8A 4JB8A 3LKVA 2FMXA 3EDCA 4KWHA 2HU7A 4RF5A 5E6UA 6CHYA 2VNJA 2VJAA 4EEQA 5CT9A 4EX7A 1OXTA 3KAJA 2CMHA 1E9CA 4B3BA 2R8PA 2YZGA 1CR4A 1WRVA 3LCJA 4IXDA 2E4VA 1W2GA 2CDRA 3E9NA 3JWHA 4I5DA 4S1NA 3B1JA 4WIAA 4IXMA 4JOCA 1P0FA 3MJSA 4DXDA 1SCUA 5IXJA 1SB8A 1U5CA 2B5VA 1OB2A 3R5HA 2WMDA 3AU9A 4CG2A 1FDUA 2RKWA 3R3JA 3THOA 2D2IA 5MFZA 2N46A 4CUZA 2NP7A 1F4PA 1FXUA 1KFEB 1ZPDA 2BMVA 1JI3A 1ZXBA 2GPYA 2VPXA 2AMFA 2CLOB 4JP2A 1DKPA 4OQQA 1CRQA 4FKBA 2ETXA 3NT4A 3PDIA 3R7WB 1DT5A 1KZYC 1Q0QA 1CPYA 1UBOS 2HK9A 2IVFA 1YA6A 4JODA 5KQLA 2V7EA 2BCEA 1CDDA 2AXQA 3IR5A 4GMHA 3BC1A 4B34A 2XAUA 4R2HA 1J25A 2VHUA 2R44A 1TCAA 2NUPB 3R3VA 4DV7B 3V3KA 1JLLB 5E2AA 5DBFA 3I23A 1CUXA 1I3NA 5IXSA 3BVPA 3RNOA 4L8FA 2VHQA 2ACKA 2J6IA 3EAGA 4PIMA 4X20B 3IAUA 1CUGA 5DISC 1JG7A 1FS5A 1PR0A 4O1IA 1YJXA 3COYA 3EPKA 2MHCA 1G66A 1QFXA 3BXHA 2J1LA 2GAIA 1NVGA 2ZYRA 2J4DA 2VDLB 2B7CA 2WI8A 3L8HA 4IHKA 4HTAA 5EYPA 1NNEA 2F3UA 2IHJA 3LQFA 2P2SA 2VNKA 1H2ZA 4QTZA 3LC7O 3C5WP 4E4YA 2ZM5A 2P9ZA 1LNZA 3L2PA 4NRDA 1THGA 2ES4A 3BFKA 3Q5DA 1HT3A 1AKEA 1HETA 3E8MA 2VYCA 2VJMB 1U0RA 5BQXA 3EGDA 3CBGA 1JR2A 3QOFA 1NBIA 4XOIA 1ISFA 4N6GA 4A6PA 4DDWA 1G4HA 4AUEA 2G77B 4HQKA 3R0JA 3CWZA 2ZAIA 1FX0A 2Q49A 1BDIA 2I0FA 2I1QA 2Q5LA 2X58A 4QT0A 2BFMA 3UWOA 1Z0UA 3IV7A 1WMEA 4O5AA 3U55A 1ZMRA 2KJQA 3GEBA 2W6JA 1U3TA 1RHJA 3E53A 5DNDA 4ERXA 5KUTA 3CCBA 4NPCA 1L5OA 1CXZA 3QITA 1EA7A 1GA1A 4TUYA 2Q5JA 4H08A 4BOYA 4OX9Y 4I1OA 4CR8A 1R0ZA 4R5MA 2B8EA 5HDQA 1C50A 2QS9A 3AZQA 1WZCA 1G17A 2A35A 1NBOA 3CLHA 5EVCA 3VC3A 3U9SA 1HDIA 1N2BA 1VMKA 1PZXA 3NH9A 1BEEA 4HI0E 1IHYA 4QJIA 4R1UA 1N5LA 4B3GA 2NP6A 4D8VA 1VBNA 4WKGA 3MQFA 3ETNA 2ZSEA 5FOSA 2BFEB 5FOUA 1JAZA 2GJAA 1N25A 1E3WB 2E21A 3URKA 1DAMA 4CHGA 3VFDA 1MB0A 1T2DA 1W85A 3EIEA 4L7QA 1BCRB 4MO9A 5GTDA 3ZDBA 1QLWA 4I3FA 3ETHA 2AOUA 2LCFA 1LPOA 3I62A 3CE9A 3IODA 2IDJA 3ONNA 3PUXA 1EXMA 1KJZA 3COSA 5FOVA 4UNNA 1WOMA 3EBLA 4E2WA 3TL3A 4CEIB 3SR4A 2PMCA 3OT4A 1OIWA 2JGDB 4BGVA 1W47A 2XTMA 4UTOA 3DXFA 4G0OA 2IEGA 2H2HA 3H5LA 4UHJA 4PYJA 2GO7A 3CYFA 1VKHA 4RQTA 2PKRA 4BFWA 2XY4A 4GBMA 1PUJA 1BS9A 4ATNA 5A4FS 1CRLA 1SRRA 3NBUA 4RXMA 4AS3A 1D1TA 1XDZA 1YKSA 1Y8CA 4RK6A 3LY5A 4DGQA 4ZCRA 2F9MA 3CFYA 1QZZA 4GUDA 4K46A 4L76A 3WDLA 1UH5A 4KQ6A 5U4XA 4DKJA 2L82A 2XPCA 4MTLA 4W7IA 4BN0A 2GAJA 4A0RA 4EKNB 1R1DA 4DA4A 2O8DA 2J46A 2PX4A 5LQRA 4R83A 1U8YA 2AHOA 1TCBA 1JI0A 3L8CA 5K6AA 1Y5NA 4NXNB 1K75A 1GO2A 1ICIA 1B16A 1OU0A 1IXZA 3WLOA 4DBLE 3H3FA 3FKSA 3SYTA 1FDWA 1IPFA 1NX9A 2BSAA 3DOIA 1M73E 4GPEA 4CDMA 4QZVA 3HKCA 3I76A 3IUPA 3U2QA 1EUZA 1GUFA 1USIA 4KSYA 1YONA 3GJ0A 3AIMA 4IY1A 1FBTA 5JH7A 5I5TA 5EXEA 2RBKA 2P77A 3GFTA 4BB9A 3CIOA 1DNPA 1TCUA 3ACDA 4H3VA 2PH7A 4JVNA 3IQWA 1Q12A 2CK3D 5CYFA 5A9SA 4S2UA 2V96A 4L9WA 3DLBA 3TL6A 3GRRA 4QU8A 1KVUA 4ZHQB 1VYVA 3MS4A 1B23P 1U1CA 3LY7A 4C2UA 1KPGA 2CDCA 3OMLA 1GQRA 5EWMA 3SNHA 4DDKA 4MUKA 3KREA 4YBRA 1EWQA 4URHA 2Z2ZA 3FUTA 4UBKA 4EYQA 5A5EA 5T4BA 2PX0A 3CEMA 4IO0A 2GRJA 3IQIX 4I5EA 4MW1A 4NKRA 2ISQA 3R0XA 3BTOA 2DT5A 2WYOA 1QYDA 3B2QA 2XB9A 1TA0A 1Z5VA 3LFHA 4YACA 2BGIA 5A3SA 3TXXA 2O1WA 2PRSA 1UFVA 5FO1A 4JASB 3ZY5A 4BKQA 2LXNA 5EXXA 3NTUA 4EYOA 5HZMA 4CR7A 1T4MA 2OE2A 4LBWA 4L4SA 1WMFA 2WU1A 3DQQA 1S8OA 2QZSA 5AJXA 1KOFA 4X1IA 1AMNA 1MGPA 1RQRA 2C31A 2IZ6A 3PL5A 5CYGA 4TTQA 1WKCA 1GLNA 1ZXLA 4R1TA 3OPYB 1I94B 2JGFA 1IZYA 3KJEA 4NENB 1N77A 3I9V6 4J0QA 4ADSG 4B4KA 4ILKA 1E7WA 1JWBB 2HZ7A 4NCKA 3ZI0A 4F3KA 1MO4A 4BRZA 2DOKA 3E4DA 1VI6A 3TIGA 2AWNA 1A5AB 4I81A 4ARIA 4KFSA 2UVPB 2HGZA 3JPYA 3JALA 5JY6A 1M2WA 2XVMA 1XNHA 1REQA 2Z3ZA 4LXIA 2C95A 4BLWA 5ICGA 2I9KA 1TQDA 1WBDA 1DC4A 1MRSA 1YS2X 1QK5A 1Z75A 1ZIYA 2GGSA 5KJEA 4O2BA 2A1UB 3DYIA 3HDVA 1FJ2A 1O97C 4QEKA 5EKUA 2V7XA 4YX9A 3HJAA 1MVNA 1UDXA 4FGRA 1XEAA 2ZU0C 4Y9RA 3AM4A 1KE2A 5IJ0B 1RXVA 3WZ2A 1EINA 1T0BA 4O7VA 4KHZA 1SQ5A 3T94A 1ZHFA 4F2PA 1S3IA 3U61B 1ZH8A 4DJAA 1G4AE 3H83A 2BR4A 4H6WA 1HE1C 3WKDA 1KO8A 4RK5A 2FUEA 5CA0F 3JW8A 3OX1A 5IG2A 5FNZA 3KQKA 3IAXA 3ZZTA 4IIYA 3L4BA 5D51S 2OP1A 4LVCA 4EZBA 5JHGB 4O2LA 2BFAA 3WSVA 4MYTA 2MYNA 3FVVA 3WRWA 1Y7PA 2N42A 3KB6A 3GJXB 1NY5A 2YBDA 3AI7A 5JO0A 2FFRA 1DBWA 3O3NB 5PGMA 4BQSA 1MC1A 4ZI7B 2A9RA 3NHPA 4HEHA 4ZU6X 3LS2A 3HZZA 4FEEA 1JHRA 3NC0C 2PLRA 2WIJA 5DYNA 5KTMA 3GUZA 2H1HA 3G5LA 4H0CA 2H2DA 2NYRA 2VWQA 4K86A 3ROQA 4Q5IA 1N3YA 1NW4A 3RTXA 1JVNA 3CVUA 5D5HA 3R9XB 1HTWA 4FIDA 1JBQA 1YRBA 3RRFA 1BQ4A 1P74A 2HLNA 3ZWPA 3CNLA 1P6QA 5D5QA 2VTKA 2O9JA 3EGWA 4GBED 1NXVA 3GXBA 3UPUA 3EMVA 2P68A 2XIJA 4IICA 4XDHA 1J5EB 4QQKA 1KRWA 1LEHA 2PVPA 2ODBA 1KJWA 4AC9A 1EWYA 5LZ9A 1OA0A 3L7MA 1B74A 3K3PA 4M21A 4PX5A 3G8BA 2JCSA 4PW0A 3HT5A 5KKNB 1XAHA 3P2MA 3RABA 1O5IA 1TUBA 2W6JD 3ENNA 1SA0A 5FPOA 3NYQA 4E08A 1ULAA 4QU5A 4G0NA 3C14C 3X2SA 3JRNA 5IBQA 1N3BA 4BNHA 1N7GA 3QBJA 4NR0A 1TL7C 5KWSA 2MSDB 1CJTC 2R751 3KQPA 2ZJ4A 2MSWA 4R51A 2BGWA 2ZI6A 2JLRA 3BIWA 1PJBA 2CVOA 5KCZA 3UHAA 3DHVA 1TMOA 1FYWA 2F59A 3K9GA 3MTAA 4IVPA 2XCLA 3K16A 4E5YA 5K8TA 5HMMA 4BQFA 2Q3LA 5BR1A 2ENWA 3F6BX 1DINA 1YB7A 2VJDA 1WX1A 4MUFA 4D9KA 5JASA 4L07A 3GK3A 4M0FA 3OM1A 1E2KA 1ZD8A 3FY4A 2Q46A 3KJHA 3SFZA 3K71B 2OHVA 3K32A 4M38A 3IMEA 4KBFA 1IM8A 2CLDX 4GR5A 4XCVA 1WR8A 1E61A 5TMDA 1E7YA 2FPUA 3W4KA 2PJRA 4R3UC 3P0IA 1MAHA 1ST3A 4G26A 2WD7A 1L5HB 4EA8A 5ERYA 4EQ5A 2PGOA 3ZWVA 4ETIA 3NHYA 3A36A 4L0QA 5ESDA 5IVDA 1ND5A 1NVVR 3UAVA 3EIQA 2V58A 1P2BA 4QG7A 5A7FA 8GPBA 3W5DA 2UKDA 5JROA 3OIVA 1LBSA 1E0SA 2YFKA 1O5OA 4F21A 3EEIA 1L5LA 4E51A 3FYUC 4Q3NA 2H7VA 4GGMX 5DTJA 4CL3A 5HA5A 3A26A 1V48A 5CPBA 4BO3A 3HUUA 1JH9A 3W0LB 3BOSA 1RWNA 4B6GA 5CH5A 1GTSA 1BGWA 3K2IA 2XNJA 2GUGA 5DOZA 2IWRA 2HHFB 4ND4A 4CKXA 4D4HA 1I3MA 1VHQA 1AKUA 1Z06A 1E77A 2PMKA 5K3CA 4YJ3F 3F7NA 3F78A 1PT7A 4FZ3A 4ER3A 1YOBA 3C1OA 3LT4A 3NV7A 4OMUA 4EB6A 5EJFA 2COEA 5H81A 1YFJA 3DAHA 2PHZA 3HB5X 2OQVA 3CO5A 2ZIAA 3NOXA 5C80A 1SU4A 2W4QA 4DV1B 1F8XA 2JLCA 3D5QA 3HZRA 1XEWX 1SOVA 1BIFA 3ET4A 3FKSD 1WTAA 4NHOA 4X65B 4XPIB 4B3MB 3CWCA 4HAOA 2HHJA 2XDQB 4U7DA 2O7VA 1HTBA 4RDHA 3B6JA 4HDNA 2ZUUA 3BL5A 3LE8A 2E37A 5JLAA 1BQEA 3OQ6A 1QVRA 3T95A 1ZUNB 2OVFA 2PJZA 1E89A 1AXGA 5I8ZA 3ZI4A 1S3SA 4ZJZA 3TY5A 2V55B 4JP1A 5INTA 1JDZA 5A0VA 1BWRA 5CEJA 1NI3A 3CU5A 1QE3A 4GLOA 4LWOA 4NYMR 3A9VA 4O2AA 1GV0A 3OE1A 4J0DA 4R01A 3UMFA 1DL5A 1OR8A 1OXMA 1PR3A 3ESCA 3KKQA 3MYRA 1SXPA 3TCXB 3M6UA 1BW9B 3WLQA 4O4HF 5E7IA 2XGGA 4MYRA 2E48A 3QEAZ 4U00A 1IFXA 1QH8B 1RKQA 5HYVA 2Z08A 3GZNA 2XMBA 1TJ3A 5DIFA 2DB3A 2PUAA 3U81A 2F2TA 1Z7YA 4QJ4A 1G5TA 3U48A 1L4UA 2F90A 3IPYA 4G01B 2QL5A 4UBIA 2FW7A 2A8YA 2C4WA 5HCIA 2HZBA 2BAGA 3H8SA 3LBYA 4OSPA 3TUJC 1TT5B 5T4FA 4BFUA 2DBYA 1F0KA 2H4JA 3BB4A 3C6QA 2A30A 4EGAA 3BBPA 3OURA 4IIBA 3R6LA 3BF8A 4MQMA 1I4TD 3DF7A 5TS3A 2ZTMA 3O4FA 1SQGA 4LGVA 5YASA 4IMRA 2W8BA 4RTQA 3LAWA 3OTWA 3KYCB 3Q87B 3M6VA 2PGJA 3PD7A 1KU6A 3MSCA 4IOMA 3R09A 4I6GA 2WWIA 4JUFA 1T4DA 1XZJA 3SNOA 2B61A 2HBZA 2JIZD 4BZQA 2WU3A 3H17A 4CMJA 3T61A 2SCUB 1Z22A 3TQHA 3ZWXA 3CNBA 1HL7A 2L0XA 4JSTA 4Q4JA 4X1OA 3TSYA 5I48A 4D4KA 5JSZA 2QYSA 1JHVA 1FDTA 1Q74A 1D0VA 2C0CA 3UWPA 4WOBA 3D5TA 4RGYA 2CL7X 4U2CA 4MULA 2VH2A 3EHEA 4Y6OA 5C8YA 3DE1X 3DNPA 4ZQEA 1XCLA 1GEEA 4ENRA 2G07A 1G2PA 2Y1EA 3LDFA 4CGYA 3L4KA 3DFZA 1IAQA 4UVHA 3KSBC 1YQGA 3S2SA 4HGZA 2AEJA 4IBOA 4Q34A 4MUHA 1TQ8A 4G63A 1NYTA 2OYCA 3R3SA 4BV2A 2Q1UA 1N57A 5BN5A 2Q2TA 2JLSA 4J6FA 3UNXA 2IBSA 4NBTA 1WDKA 3FPCA 4BV9A 2ZR7A 1X7XB 3ANLA 4KO2S 2W6OA 4RA6A 5T3YA 5C1DA 2JATA 2IPXA 4WN9A 1J7JA 2I1VB 1GAEO 2JA2A 3Q5GA 4AWBA 3L0OA 3TZ6A 1JDSA 2YXDA 1GCGA 1CFZA 4ZU3A 5L45A 5HKAA 1PYDA 2F3TA 5FQOA 2UZ3A 2H2GA 2AFIB 2F64A 3E9CA 3VKUA 2PY6A 1XB2A 3DFFA 1SUFA 3V8BA 2RH8A 1HZZC 4LN1A 1G8FA 3H86A 4OHCA 1C2YA 3T34A 2RG7A 5KVSA 3BRQA 4N7JA 5A5DA 1JBKA 1BDMA 4BL5A 2ODAA 4AJ1A 4Y1RA 5JVLA 3D8RA 3A06A 2OL4A 3NR2A 3M6IA 1AN9A 1Q91A 3MGBA 2PKWA 3G82C 3WSWA 4P98A 2QMZA 1KE1A 3VU9A 3ZHXA 3ONWA 4LRQA 4XQ9A 2WKRA 2F3PA 1JZQA 4X6LA 2ZJBA 1G18A 3NNSA 4ZT7A 1ZGBA 2EL9A 3OEED 4A2PA 3IT0A 4C6SA 3BHIA 5KDLA 3RS9A 1PL7A 4LMPA 3IILA 1EK0A 1EP3B 3R7DA 3C43A 4WBXC 3U1TA 2BKVA 1WB9A 5TQJA 1U0FA 1R2QA 4YMHA 1WMSA 1NJ5A 3FPAA 2XUPA 4QYMA 1O8BA 1TVKB 5I6DA 2RHBA 1OZAA 4MQ4A 2C2WA 3ICPA 3TEJA 1AMOA 3A2LA 3D2LA 3DA8A 3WSTA 4TYMA 5L7YA 1TECE 2HO5A 3I05A 4OI0A 1LK0A 2ORWA 1E6KA 1E4OA 2QD5A 5C46F 3HJCA 3ND5A 4HDRB 4TT8A 1T29A 3PNSA 2X4LA 3CLUD 3QVVA 2AX4A 2XE8A 4KV7A 4L15A 3U44B 4YCLA 2XZDA 2FZVA 2QRMA 2I2DA 4UDNA 4EKIA 2EJCA 4BO0A 1QG2A 1R7RA 2EJ2A 1QIMA 1U2GA 3I32A 2O8NA 2PX2A 3TRKA 1ZNXA 2REQB 1RQLA 4UCUA 2BDTA 2I71A 2NU6A 2XLBA 1GN8A 4ARZB 1I8TA 1V71A 4J0KA 2O8FB 4UCFA 3MQ4A 4QXMA 2W00A 5EHQA 5E3JA 1QR6A 2ZSFA 4IPTA 4YRFA 4A8JB 2X0JA 4Q9DA 3HI6A 3I2GA 1AA9A 1E1DA 2DFNA 2Q2VA 4GLFA 2OB2A 2O2SA 1I30A 3LHDA 1V39A 4NU6A 2ZAGA 5C7LO 1ZK0A 2X4GA 4Q9NA 1Q5PA 2D4HA 1RWPA 5JQGB 4RXUA 3EVAA 4B09A 2VRCA 3QUTA 1JE1A 5I5YA 1VZ3A 1X77A 3PIRA 4RY2A 5EPOA 2OWDA 3ZR4B 3RT7A 1B4DA 3VR1A 3DMNA 1LC0A 1BSVA 3BWBA 2GCNA 1JHZA 4PX9A 1B73A 4H16A 3N58A 3RGGA 4Z99A 3RASA 1WNTA 2C58A 1CVIA 5CXUA 2AL7A 4CU5A 5HTOA 1U5BA 2CE2X 1G21A 4KE7A 4DLVA 2VLBA 1ISIA 1N3IA 3P5BA 4G97A 2BR3A 4Q9AA 2WMNB 2B5WA 5B1DA 5BR8B 1GQOA 3E23A 2ADMA 1FQJA 2IYXA 2I3ZA 3ZV3A 3TSAA 5JARA 3CEAA 3CVVA 2IU0A 4MW7A 1CBUA 2PUHA 2EQAA 6YASA 1LLDA 1Q1AA 3UCXA 2JEOA 2YV5A 4M1KA 2Y0CA 3GROA 2ACWA 1OC2A 3KUUA 4IF6A 3MERA 3E70C 2NVBA 4FE4A 4TYYA 4Q19A 2VTVA 3E7FA 2ZANA 2HX1A 1B42A 2YOGA 3F3KA 1OASA 2GZRA 5EPUA 2FJPA 4L02A 1RHUA 4JT9A 3KTDA 1YQUA 2A5JA 3ZDAA 4JBIA 4WCDA 1HNZB 4ZFNA 1RQXA 4KYIB 2ZTLA 5E38A 3LFUA 3STTA 2O8CB 5CB4A 3KUXA 1XO1A 1RKUA 3FMIA 4HJRA 3VNVA 5HOQA 4QYTA 3QMVA 3MPUA 1PNOA 2OBFA 4EP1A 4LOIA 4R8KA 3LF1A 2OUKA 1GKYA 1YV9A 3X2EA 1IDOA 2CY0A 3A1VA 1FSFA 1GRCA 1NLFA 2NTVA 1JDNA 2R1ZA 4FMCB 4IJ5A 4NZZA 1N78A 2H11A 1J9GA 4G5RA 3UV3A 4PG6A 5ITVA 4E4TA 1TGYA 2DR2A 3KWJA 5ELLA 1CNFA 4MLPA 2VT6A 2EX4A 4TQUS 5BSVA 1J0BA 2X9QA 2PX6A 2HDKA 1U1GA 1VE7A 1LXCA 1I0LA 3ZDDA 3L05A 2WW8A 4PSCA 2R7LA 1VYTA 4FDTA 3ZQUA 3M3HA 1N0WA 3AVPA 3W1GA 4IZ6A 4KQHA 1L8XA 1RXIA 5BOSA 4PGHA 3S27A 5ADHA 2A0UA 2Y05A 4M60A 4REOA 1KFJB 3PDUA 2PTHA 3AR5A 3LP5A 1FVHA 3IR7A 3OQJA 4MVJF 2FCRA 1XX6A 3AHGA 1P4HA 5FPPA 3H2JA 1YR1A 3FNHA 3C7CB 3KYDA 5HM6A 5LPNA 3WBKA 3X1WA 3F6RA 4D43A 2OZKA 1RHMA 3RTBA 3OKCA 1L7EA 4EEXA 5FL3A 1M1YE 3HUFA 3QIAA 4UNSA 4BYGA 4COKA 5I5XA 3QLTA 2XI4A 1DIGA 2V9PA 3NGXA 4CMIA 3CUKA 3IJ5A 5F5XA 1RKVA 2PUJA 4YAKB 4YPVA 9ABPA 1CVRA 2Z04A 2N75A 4WK0B 2FSHA 1DIRA 1KGSA 2C07A 1HZJA 4ND1A 3A8TA 5LVAA 3QYPA 2GK4A 3LT1A 4HQLA 4HDMA 3ONVA 5AJYA 4AYXA 2ASEA 4AK9A 1H2RS 2VXBA 1PHPA 1JEYB 4UULA 4X71A 2Z57A 4Z4EA 1HLDA 3TAXA 4X6XA 3ZGZA 1S68A 4N8SA 3AU8A 5CB6A 2VK2A 2XD4A 5I5SA 2Q6IA 2I4NA 2HBQA 1ZCAA 3DV2A 5REQB 1AA6A 1WHTB 3ZU4A 2VVTA 4B6FA 1GGOA 4B5KA 1W2WB 5B4TA 3HKBB 2YYAA 1DJOA 4MEBA 2ZEJA 3THYB 3VH1A 5C1PA 3KQVA 3H1AA 2H1OA 2RB5A 3AF6A 1XMPA 5EMKA 2X5RA 1OXVA 4QPNA 3RRNA 3K5PA 2OLSA 2CHEA 2Z58A 4LE1A 5LCXA 5J2UA 1HYEA 4OHKA 1L6RA 1N8TA 4D5EA 4H7IA 1UQUA 3ZE7A 1DC3A 1FYEA 1WMBA 2A4MA 4ZOLB 1J22A 2AK3A 3VYUB 4Y2HA 1HEIA 3K20A 3KOWA 3SZLA 1G42A 4DTIA 1AB5A 3M6FA 1E99A 2FFJA 2ZYSA 5ED0A 5GM1A 3WRYA 1Y7HA 3MCUA 2QF7A 1FVOA 3FDXA 3T7KA 1Z25A 2HAEA 2ZT6A 4EKEA 1CUSA 4P4GA 3IURA 1E64A 1CQIA 1U4NA 1OAOC 3L1JA 1VSVA 1M8JA 2XMSA 4N8DA 2BUAA 2QZJA 3PKJA 1XLVA 2G28A 5E4TA 1WG8A 1L5NA 3MMPA 2WF5A 4CEJA 1V9SA 4XB1A 5FAXA 1NI4B 1ATIA 4P4UA 3F6SA 3RNLA 4W4TA 1A98A 4G4JA 5CFPA 1Y3CE 4JKOA 4XYMB 4V0RA 4ZVKA 4RIGA 5DYYA 5E9JA 4HX5A 3F6PA 3KB8A 5L6MB 1MJFA 1GSAA 4URZR 2GFHA 3A2MA 3UAOA 2JZCA 4JEIA 5D1HA 3WQQA 3KNZA 1JFLA 3KR2A 1D8AA 1WBJB 1EHYA 2AOVA 4FILA 1KT8A 3V55A 3VR4H 4J4BA 1J8DA 3CZQA 4Q3DA 4XIIA 1OBDA 1R8XA 3PXCX 4DNOA 2FA9A 1LRKA 3MWDB 4LDPA 2W2TA 1DCMA 2JAHA 3HV0A 3WGGA 1ZLXA 2A9OA 1L5YA 1P2FA 3KJNA 4H3KB 2I78A 1H1DA 4R1OA 3KWLA 1XD9A 4POAA 4QBIA 3JVDA 5FLYA 3GT0A 4A6DA 1F38A 1FVXA 4WFJA 5GPBA 3OFVA 1BOFA 2GZHA 1FMJA 1T9GR 3AQIA 4C22A 1QGZA 2IEAA 2A1IA 3QU9A 3KYHC 5K5EA 1P5FA 3RM3A 1T9ZA 3UJBA 4DCGA 4F85A 4YUWA 2Y71A 4HRVA 1HE2A 2DUNA 3NJRA 3RRBA 1S2NA 2QD1A 1CUBA 4XTCS 5DLPA 2OV2A 1RYDA 3R5SA 4W9NC 1AGXA 4QBFA 4GL2A 2JW5A 1I3OA 2R8XA 2PSDA 3ITEA 4HS4A 4TZ6A 1XMIA 4AJJA 1HWYA 1GCOA 5TF0A 4CPDA 4LV6A 1XSEA 3PGXA 3EGIA 1RADA 1V1RA 4B3DA 3EH1A 5KNCA 4BAGA 1UBEA 3OZXA 2AR9A 5ILQA 5CNMA 5C35A 1R6XA 3V4VB 5LZ8A 4AMVA 5IYZF 4QNRA 1MEEA 2Z6VA 1E2QA 4UQOA 5DZSA 3OZIA 5FV7A 4EYSA 3AL0C 2B2NA 1DS6A 3CG4A 5GAJA 1OI7A 4OMDA 3HXMA 1L7AA 1PDVA 3D4NA 3OPVA 4J7CA 4UBNA 3AFMA 1N2XA 1ZM2A 3AMVA 3N7TA 4V03A 4GF5A 3H2SA 4LISA 1QHEA 4Q1EA 3V46A 2C5AA 4JLWA 3GUHA 4U7FA 5GWXA 3RTDA 4YJ2B 4O7SA 2BMWA 2WWXA 2XUGA 3EVEA 4FSDA 3M70A 1NPDA 4LXXA 5HJEA 2H51A 4ARCA 2GZMA 5FLKA 2GD2A 3DZCA 4RVGA 1O94C 3Q9UA 1IHUA 4BBAA 5JPDA 1SBTA 1WIWA 3X0DA 5GM2A 4C1NA 2J0QA 2C5FA 2BTOA 3T3HA 3BG5A 3JAKB 3DW3X 3VR0A 3BIJA 1Z5NA 3F9RA 3WGYA 5IM4A 4Q03A 1M8FA 3THSA 2PRKA 4LSMA 3BSSA 4C01A 3WV4A 3P2JA 2QX6A 5H59A 3PQ7A 3KOUA 3UMYA 1ZONA 1AHNA 3DDSA 2DECA 1BO6A 4QGHA 2A0WA 5E0OA 5AIBA 5LBIA 3SJZA 2HRDA 1KJQA 5DM4A 3THXB 2ZTSA 1MH9A 1JA0A 4LDRA 4K40A 4BASA 1Z7BA 3BJIC 5H8WA 1PVOA 1Z4JA 1UQRA 4HDSB 4UEOA 3RQSA 1Q0RA 2CMGA 3HU5A 4M9RA 1EK5A 1YB1A 2XUAA 2I7XA 4HLNA 4TV9A 3Q8LA 2P67A 3DKPA 3AT1A 4ZYLA 4MWSA 2VJLA 4Z3KA 1C30B 4C78A 2FPGA 1Z3IX 4BN5A 3FI9A 5CLLA 3PSAA 2B7LA 3UB2A 2WE8A 1K6XA 4LSZA 5H82A 3NIDB 5B3KA 2EARA 3RVKA 1C7QA 5T8KC 1Q6YA 3PWTA 3LPAA 3LXUX 3LVRE 1M2KA 2HNAA 5F35A 1QHFA 2XCQA 1GA4A 4RVFA 2P79A 3OQHA 7MDHA 3BTVA 3OJOA 1FB5A 1C4KA 1QC5B 2J0VA 3FUWA 3OPNA 4CC6A 4HB4A 4MUYA 3H05A 3VSCA 2PMFA 2RGNC 1A4UA 1VCIA 3S2ZA 4DSOA 1XRNA 1ZOIA 3W90A 3DV0B 1SUPA 2AOXA 3EIXA 3NALA 3PLRA 4FHEA 4GFDA 3BWVA 4NE2A 1Q3HA 5DISB 4NNJA 4B3FX 1ZISA 2R2GA 3VYWA 3AEUA 8ADHA 2Q1YA 4K9DA 1KNQA 3JQFC 2FWRA 3TKYA 8LDHA 2PX5A 1UWCA 4KRGA 1U31A 5CVDA 1XZPA 1SUIA 3CZMA 3DUFB 3OIDA 4O4LF 3AR8A 3OCZA 5LZ7A 4MJ3A 2PQ2A 1NUSA 3Q6MA 1Z7EA 1XMJA 4RTLA 2AEEA 3EQ2A 1MR3F 4S1TA 4C43A 1UPFA 3TE7A 3H9JA 3N5KA 1DC7A 1K6MA 1MC5A 4NH4A 3KCQA 1P2VA 4HUQB 2FDRA 4U0JA 1O08A 3DR5A 3SHWA 1R9JA 3X2FA 4LF8B 5J23A 3AC0A 2AH5A 1D2CA 1P0MA 4UE2A 3BN3A 5A71A 3W9BA 3PFFA 2PKQP 4JT8A 5FFMA 1VE5A 2JBAB 4UC0A 2DWCA 3MCWA 3U60B 4ZN6A 5HOEA 5FUXA 2A5LA 2EKZA 4PICA 1UBNA 1MW9X 4BLOA 4JI8B 4UM7A 2Q4RA 3M5PA 3HEAA 5DGDA 1EAYA 3FYCA 4AP6A 4YRAA 4ZI3A 3EGCA 5JAHA 4RTOA 4DLXA 2D5IA 2ZJOA 3AIKA 3MQ2A 4RDCA 3FX2A 3QU4A 2O14A 4EF6A 1WCV1 1IBMB 3EVZA 3MN1A 4YXFA 5JV5A 1QMPA 1K3TA 1XXHE 3ABSB 3G13A 4L6AA 1Q16A 2ZS8A 1KI9A 3NHLA 3H11A 2EFEB 3FNBA 9ATCA 5FB3A 3GDEA 1L4NA 1EXNA 1JTEA 1A2QA 3TI7A 3MFQA 1EBFA 1G20B 1FA9A 1I33A 3W5BA 2V59A 4XGKA 5JECA 4RVOA 4EVIA 1A88A 1LPMA 4EIWA 2FMHA 3RR5A 4ZT6A 1BTOA 3S2YA 3ZNQA 2GXSA 4C7MA 1NMZA 1X7DA 1RXCA 3CR7A 3HI4A 3PGLA 5CJPA 4WBNB 5KOJB 1BE6A 2WJPA 4HWPA 5DV9A 1GUBA 4DILA 3SXUB 2PCJA 5IW8A 2HQOA 5J9FA 4XYEA 1YMVA 3EWSA 4PR0A 1C1YA 4TKVB 3TRIA 1R9GA 3UENA 2NPIA 4LZNA 3GNQA 3NWPA 4B6PA 3EWAA 1HGXA 4D81A 1RXSA 1XRQA 4FLFA 1EPUA 2EBFX 3W6ZA 4MICA 1Y89A 2HQ1A 3ZDRA 3R7LA 5CYPA 3NCTA 1HDZA 4M7OA 3TB4A 2HSEA 4O59O 2G08A 3E81A 3ZU2A 1CHNA 4NCNA 1V1MA 1UWKA 3UXYA 5EUCA 1GY8A 5AJVB 2PMDA 1QIJA 5IANA 1X1RA 3H9QA 1GPYA 3EC1A 4JP3A 5CCDA 2HPVA 3QIVA 4OQPA 4DVGA 5DNUA 2C94A 2XW6A 3O9MA 1D7OA 4QT4A 2PBLA 1Z47A 2Z1NA 4RHFA 4A0GA 4RE5A 3OT1A 3Q8WA 4D9HA 5IN4A 1TM5E 2E7ZA 4JJFA 1SOAA 4D6XA 3C15C 3BCUA 4MR7A 2DHDA 3CGWA 1QV6A 1XNJA 3TMAA 2BFPA 1HQCA 1NQOA 1VIDA 1T26A 1LV8A 5H80A 4DBLC 4GVXA 4EQ6A 2WLSA 3D6UA 1L4BA 3U4MA 2ONKA 3MCTA 3LY8A 4Q18A 5DSTA 3V6MA 3KDAA 4RQAA 2JIRA 4HWKA 3ECSA 5AM2A 2EDCA 4DL9A 1MABB 1KYWA 1NXTA 2FB9A 3T7JA 3PXXA 5LA6F 2WWVD 1IIBA 2X7JA 4M37A 4C4ZA 4DA8A 5KNCD 2R7AA 3KQNA 4OL9A 3H13A 4PYQA 4GX1A 4QLAA 3JD4A 4QELA 9MHTA 4WGGA 5ENDA 3CT4A 3WWJA 1KBQA 5IAEA 1OVGA 4KN8A 1JSXA 5JDIC 4H3HB 3K0AB 1GZHB 1F6DA 1I3LA 3KSUA 4OIFA 1WXGA 1BKDR 1ENPA 2P3SA 3D8HA 5JJBA 4M7PA 3NHSA 4UARA 5EJIA 1RXYA 2B21A 1L9XA 9LDBA 4M9XA 3ZVMA 3KT3A 3DHWC 3MGGA 4YRLA 2G06A 1HE5A 1T2AA 2Q8NA 4KQMA 1W30A 1I1HA 2EKQA 1DIHA 2I2CA 3P45A 3QI7A 1ORDA 3HJBA 3OZWA 3ILYA 4AZ0B 3LCRA 3R3YA 2FR1A 4BQRA 5I4BA 1J90A 1ML3A 4D9BA 3CLVA 1IB0A 4QVGA 3O9ZA 5FO0A 3REOA 4J90A 4WAUA 5KSZA 1VRWA 4Y6GB 3HU2A 1RMYA 4AUKA 4BNUA 4MRAA 3HN7A 6LDHA 2AZXA 4RIFA 2BN4A 3BICA 2Z3WA 5BXYA 1CQJA 2AOWA 3K1ZA 3VVLA 2IY8A 1D2GA 3AVOA 5EMLA 2RFLA 3ETJA 4C1BA 4GLXA 4MTCA 4WLEA 2HA6A 5KZMB 5SICE 2VQDA 1Y9JA 3Q3VA 3DAOA 3S2GA 2GJ8A 2R1VB 3T3IA 4E09A 3VR5A 1OB5A 4WOJA 2ZI3A 2HA4A 1P3JA 2GYVA 2PLNA 2CLIB 2GAAA 1PT8A 3DEJA 1NSTA 4LZLA 5ALJA 3LX8A 1Q7RA 3HCBA 5GMOA 5J1SB 3A2NA 3OHPA 3CF6R 1VL8A 4QU0A 1I4OA 1UAAA 5JDCC 2HIXA 4DFDA 1LLUA 3FPKA 4MRPA 3FTNA 2JRCA 2CL5A 3UJCA 4I1SA 1PZHA 1ZM7A 4HLDA 4BKRA 1H5UA 4MVJE 1O58A 2ZYVX 3B5JA 3LFTA 1OX4A 4UREA 1BGVA 4HLUC 3NBZC 1D1SA 2VQ3A 4PZDA 3WRXA 1QHXA 5C53B 2AMVA 4M9ZA 5LLTA 1PKEA 1TTPB 4I9NA 4KTTE 4EOGA 2C4KA 4N7MA 1A8SA 3OF3A 3V9AA 1L7BA 3H1TA 3ZU5A 1PEDA 1CY2A 1KI6B 1VXRA 2F62A 2VYVD 4R8VA 1IMOA 4HYTA 4C05A 3NKVA 4Y8VA 3C24A 1EQAA 4OQLA 4V3BA 3BGIA 3E1KA 1C3OB 1RAAA 2IOFK 2WWGA 4ALNA 5A04A 4NG5A 1DPGA 4D9GA 1T3SA 3HHEA 2H5LA 5CTAA 3VU3A 3NKLA 1LJUA 4GMFA 5B2ZA 1NXOA 4OXYA 3P0HA 3IPXA 3E7PA 2J3JA 5CH8A 2O6HA 3NG1A 5U9CA 1U6KA 5FP0A 2YMMA 4TSFA 1VIAA 4N5LA 2X9LA 3JZFA 3EZFA 3DB2A 5A5FA 3DE2X 3QE3A 1FVIA 3CR8A 2EL7A 4JKIA 1GPJA 4LHZA 1QX4A 2WJ6A 3FJOA 4DCNA 5EJEA 3TLCA 4ES6A 1YL6A 1HC7A 1U7PA 5A4JA 3V8MA 1TIBA 1EFKA 1WQ1R 4MUJA 3RJ5A 5GINE 3R76A 3L3BA 5DBOA 3UJAA 3JQBC 4D8YA 1DRKA 4L4YA 4FONA 1UOEA 4B3SB 4UFNA 3LA6A 3W2FA 5TJHA 1Z34A 3ADKA 3JZDA 3QEMB 3GNLA 1YMQA 5CLFA 4JQYA 4MRNA 2I2AA 1QTQA 4AIRA 1OV4A 5CR5A 2YCLA 1EJBA 2YINC 1Q0PA 4JLSA 3E8SA 1XVIA 4FCCA 3C87A 1Q95A 4WUVA 3CRRA 2WR8A 5AHKA 5K99A 2WIFA 1Y6GA 1UODA 2PWZA 3I2FA 1ADFA 1MAUA 1JTFA 1E6CA 1MV5A 2C61A 3RJZA 1GUZA 2QUIA 1I2MA 4EG5A 1YKGA 2DQZA 3Q7SA 4X8OA 5C1BA 2H4XA 4FTWA 4PIPA 4DUPA 3P2EA 1B8OA 1O4VA 2H1RA 2EJ0A 2H7XA 4TL7A 4AN0A 4C0SA 1RAGA 2LPMA 5M7EA 1K8XB 3JR3A 1P7CA 3M6LA 5BMOA 1LS1A 5JHHB 1T6XA 2HA3A 3GGPA 4LZPA 3DFKA 3VPHA 2CJWA 2P4HX 3SC4A 4PO9A 2KQUA 4DQDA 1Z6PA 4EHLA 3EASA 4WY2A 1CEQA 3GQVA 3STWA 5DM60 4UZFA 2XWJI 2AG8A 4RFLA 3FOFC 2CVHA 3TG8A 3HGMA 1NJ1A 4EHFA 1UBUS 1XN4A 3GLHE 3NTRA 1A95A 2YWEA 4EHBA 4YRMA 5HFAA 1US8A 5I5EA 1E9BA 4KLRA 4Y6RA 4C29A 3LYLA 3OTGA 3W5SA 1M9NA 4GKAA 4I46A 1YIOA 4KPGA 5KVQA 2TECE 1QGED 1CY8A 3H42B 3TR5A 3U3JA 4DSNA 4RDIA 3I53A 2QMQA 5G4KA 4P4LA 3A1DA 2VHEA 3BMQA 2O7RA 3AR3A 2OO5C 3ZW7A 4G5GA 2P4SA 3LIPA 1C14A 1RZ3A 4YMWA 4ZRMA 2VS1A 3PGMA 4Y2JA 5G1PA 4NJOA 1B8NA 2VWPA 1LDBA 3BMCA 3DC7A 1QH9A 4Q6BA 3GU3A 1QYCA 4EGQA 2FMKA 3HJFA 4F86A 4J3NA 5AKEA 5SY9A 3WLFA 7REQA 2BGLA 5KYYB 2FPLA 2H9YA 1W88B 3AETB 2HT1A 4PLCA 4JOBA 2XTAA 1JIVA 4Q1DA 1DAHA 4M1EA 4L08A 4IQ4A 4XKJA 2P6NA 3VAYA 4YP6A 4EJMA 2GCOB 3PR1A 1KK1A 1GTG1 3H84A 2H07A 3I04A 3QHQA 2X2OA 2OLKA 4UNIA 5ALZA 1X13A 3CSUA 4MK4A 1M0EA 4X1KA 4KR2A 3CA8A 1XPUA 3T5MA 4J0EA 3AFHA 1ST2A 3AONB 4IS2A 5A4AA 3DB1A 1AQUA 4TRNA 4ZQHA 3UUWA 1SH7A 3V1TC 1TQ2A 1YGYA 4JLVA 1TYAE 1V2HE 1L5GB 3UWDA 1KF0A 2XB8A 2AZDA 4IDNA 1ACLA 4FBGA 5I7SA 4JI4B 2Q0QA 3X1MA 4I1IA 3O4JA 2Q5HA 4LQLA 2QVCA 1NQVA 1ORTA 1L7OA 1T43A 2BVNA 2EVWX 2HREA 3IP9A 4O82A 3FDJA 2C4HA 3K0FB 4S3MA 5TRTA 2JVKA 1VJDA 3GD7A 3W9UA 2JHFA 4HF7A 5ALTA 4UHDA 4UM9D 5E1BA 1QQTA 2FGKA 1CC1S 1NBEA 3RU2A 2NSDA 1A96A 3EE6A 3P32A 3X3HA 6Q21A 2H4HA 4EVSA 1Z17A 1RYZA 3BL8A 2SKEA 2YV2A 2WPDA 4JMPA 2PMWB 4FFRA 1KWKA 2XCTB 5IVIA 2XB6A 4GDFA 4NCIA 2QTLA 2I54A 3LO5A 3WOVA 1HT0A 3V1KA 3MOSA 4Z7JA 2EP8A 3B70A 1VLZA 2HTFA 2ETVA 2JD2A 3RB8A 1JIIA 4L8WB 1Y9ZA 3WGUA 4CIAA 1B6SA 1PTJA 2YWVA 4FFMA 2XCRB 1JHQA 2FVYA 4HAUA 5MDHA 3VR5D 4GWLA 2YS6A 4C4PA 4UMEA 5DI3A 1UKYA 4GOND 5BYJA 1C3VA 3F1LA 2PGIA 4LA4A 4MUMA 3JAMA 4OM8A 3KKOA 4O81A 1MIHA 1YBAA 3OWOA 4OK5A 4Q12A 5ER9A 5KYUB 1GP2A 1YULA 1BHJA 2EKBA 2ZR0A 3NT2A 3T8YA 2BMAA 1WSBA 5JAQA 4KR7A 2FSFA 2AOTA 3ZHUA 1DRWA 2Y92A 1Z3CA 3DH0A 3B1VA 1GUDA 4ZT4A 1J07A 1Y1KE 2I2BA 2I1WA 3ZIDA 4F45A 3DYBA 1YBMA 3SIRA 1BX3A 1QVVA 4R81A 3D4PA 3E5RA 3WOHA 2O8BB 4QPCA 4X92A 4UPVA 5CCEA 2HXYA 2IKSA 4IVRA 4TL6A 4GIBA 4URUR 3HB7A 3IUMA 2YXNA 3FOBA 5EJGA 3WHKA 2WHPA 1VOTA 2ZR9A 3GPBA 1W93A 2E2WA 1GGVA 3KUCA 3LJKA 5BSUA 3QF4A 2Y1DA 2ZUSA 4DIFA 5CURA 3CBQA 4IX1A 5DKFA 3ZKWB 5L4LA 1CD5A 2QVBA 1H94A 5E7QA 1U4SA 4C3UA 2F8TA 3KE8A 1RBZA 3C97A 2IK8A 1FBNA 3QE2A 4PZ0A 4U8HA 3M3PA 1WW2A 2EWVA 2HWKA 2HF2A 4JENA 4HMOA 4MVXA 1I7PA 1N5KA 1NW3A 5AKLA 3TDKA 4E03A 3A4TA 3G9UA 3KKPA 2QSJA 1XRRA 3ROZA 2EW8A 5HBRB 4O4IF 1J0CA 2YMLA 4YDHB 4DUGA 1A72A 3O0TA 4BVEA 1JFFA 1DI0A 1CE8B 5C2JB 2BFDB 4TSFD 3A6EA 4FOOA 4CL0A 2FK8A 5BPFA 1J4AA 3TUIC 3ER9A 1KVRA 4J03A 5CAEB 1LDGA 1N9KA 1OXXK 2V9CA 3FAZA 1VA4A 3MJRA 5AH0A 2R0QC 2ZRGA 3C3PA 2XADA 4J94A 4MI6A 5AM4A 2GN9A 3D1JA 4DR3B 4HNVA 2B1RA 4EHHA 4EYGA 3QLEA 3K1TA 1UBTS 4P31A 5A3JA 2HIMA 3I1JA 3IUJA 3FTFA 1ORIA 1KTVA 3UKJA 5EWJA 2CNLA 3AESB 2AKYA 2J9FA 2YIMA 3ID6C 3DOFA 4CI9A 5FUQA 1NR7A 3EA4A 1ZYUA 1J0XO 3O1JC 4GQIA 3GI1A 1SVUA 1T0JB 3A10A 4X3OA 3CJTA 2V1UA 4QL3A 5IJXA 1S2DA 2QV7A 1T5TA 1ZC3A 1UINA 4DR2B 1MB2A 4CKEA 1WOYA 2JC3A 4JGIA 1A3GA 3E22B 4CKWB 3GNSA 4G5SA 4P36A 1XTPA 4QBHA 1XZAA 3INGA 1RWMA 1PGOA 1V5GA 2B1GA 5AK6A 1AM4D 1JVSA 2ODPA 4M2LA 1X2EA 4KG7A 4OYRA 1E6UA 3H6GA 4S35A 2QW0X 4QQNA 3LYAA 5TEWA 3DE6X 3AW8A 5LUAA 1S2LA 5DNEA 2HPHA 3VU0A 4JLPA 4C7KA 3FWKA 3MRXA 4ALKA 4C08A 4ZJYA 3N0VA 1NE2A 1TVEA 2QMOA 3LCVB 1VPDA 2XYGA 4N5HX 1RJWA 1N7HA 4IDOA 4NYEA 3GUUA 4TXNA 4Z7OB 1CUEA 3CUTA 3KB1A 1G9TA 1ODJA 1RZRA 4OJNA 4Q7LA 4L50A 4KGVA 1RMQA 2E6UX 4PZUA 1JJAA 1G0NA 2QDKA 1T5LA 3K8QA 1XF9A 4MPDA 3DQPA 1UDRA 5EGNA 4TS9A 3DVAA 1I2DA 3NEJA 4B47A 3NVMB 5A62A 5DTEA 3V4SA 5ADVA 1H05A 2WAYA 2WDPA 5BUQA 1QJCA 1TYZA 4PVDA 1DEKA 1QIHA 2QBYA 1S2MA 3HG7A 2XNDA 4FHZA 4UCSA 4NFLA 1KMNA 1YZTA 2GQ0A 1Q17A 3OMXA 1A7JA 3SEAA 3OQOA 3GRFA 1P0CA 1SEVA 3VPAA 3HZHA 1N2HA 1WY7A 2C82A 4KYVA 4HYYA 4W8GA 3RAGA 3ASVA 4U7JA 3TLAA 4YAUA 4DQXA 1LUAA 2CLFB 1RAFA 1DV2A 5I5UA 2V7PA 1UZNA 3WWPA 1PX2A 4BE7B 1ADGA 3HVHA 2GI4A 3CCCA 3PUZA 2EFYA 4BNZA 4YFYA 3SC2A 4I4TF 4ZI7F 4UD6A 3WLSA 2VYQA 1LGYA 3EBOA 3WJ7A 5BNFA 3CMCO 3BMNA 1T2FA 2X3UA 4FFSA 5EZ5A 3L7CA 4M99A 1XP5A 1GKIA 2GTHA 3SS8A 5JQWA 1XALA 2VUIB 3IUBA 3DOJA 4MS4A 4P84A 3U7EB 3QY9A 2BI7A 5AXDA 4OHWA 1RDFA 2V3WA 2FQYA 4C7OA 3AUUA 2OZEA 3PFKA 3QI2A 3MWKA 2JASA 2W8ZA 3P97A 4Z1MA 1SMKA 1XCOA 3L77A 2BL4A 1JQEA 4JELA 1YDGA 1Z4PX 5F5LA 3PX7A 5GONA 4BJ6A 3ON5A 4D26A 2RMKA 2HB6A 1IZ8A 2IU3A 3NAMA 2D8MA 1M7HA 4II7A 3VYVA 1L8OA 1EXWA 2ZQZA 4UOEA 3O4IA 1K08A 2NZVG 4F4HA 2QN9A 1A77A 2IW1A 4MPTA 4RHYA 1K7EB 2VF4X 4C2BA 2ZBDA 3W3AA 4X45A 5CFRA 3QKRB 5GQSA 3AY6A 2Q5EA 3FBWA 2RHLA 2W2XA 3ZHQA 3O3CA 4YH1A 4KQ1A 3GUVA 4NEHB 4J1SA 1J2UA 1KA9H 4ZCSA 3RFFA 2WV9A 2G1KA 3WLHA 4JAVC 3CZCA 3MMSA 2GM4A 4J7XA 2WPDD 1XYGA 1Y6QA 1IJFA 3JWIA 1TAUA 2Y99A 3OJXA 2DABA 2OPBA 1NLYA 1RI2A 1JT2A 2NU7A 4FFBB 3U26A 3TTTA 3W34A 1P9NA 4JSYA 1CQXA 1ZRHA 1IHXA 3BXFA 5B3LA 1KO1A 1OA1A 1P29A 1AHIA 1KYQA 2AMYA 3NBXX 4LGCA 1ZXXA 4HNTA 5LIRA 4N9WA 2ZPAA 3NDPA 2KI5A 1HTTA 3A3KA 3LUHA 3QXCA 4IRXA 1SVOA 4RM3A 1TEXA 3WWEA 5AI4A 2CYBA 3N1UA 2IPMA 2GPTA 5ALOA 3LPMA 1JL3A 2QB5A 2EAUA 3DMTA 3G85A 3C5HA 4XYLB 2XWBF 1J5XA 4KVZA 1OF1A 5EE5B 4UUAA 3UYKA 4BQEA 3C8ZA 2V1XA 3DJYA 4HRYA 4ZAXA 5K3FA 3FHOA 1QYXA 3DAGA 2J3EA 4BO2A 3GA5A 4P0TA 1RTKA 1RYEA 2AN4A 2JA1A 1NBAA 1N3LA 1JXQA 1X9HA 3QX9A 1UXGA 2Q3JA 4Q66C 4MGIR 3RC3A 1UUFA 4TTIA 2OAGA 1RHQA 2EOAA 2W11A 4KE9A 1BHO1 1OT5A 1U7OA 4IGEA 1VI5A 3IRVA 3KXLA 4NZNA 1K3UB 5F78A 1HFEL 4LOJA 3RODA 4CMKA 1ABFA 1JSLA 3LP6A 4I50A 3JQPA 2OHXA 1JQ3A 3E0XA 3OBBA 4G1EB 3D4IA 4UCXA 4B75A 5GADl 1KMIY 1SQ0A 2B4AA 2NX2A 1WB6A 2IDKA 3L79A 5HIAA 1P72A 3F3MA 2YOFA 3TIVA 2HSGA 2XYHA 2PS9A 4KK3A 1N5RA 3UAXA 1VJGA 4L5CA 3GJRA 3HN6A 5BT9A 1XA0A 4U3JB 2G1UA 2JZOA 4ZCPA 1WEKA 5CA1F 2AWOA 2ZYAA 4OQFA 1OFTA 1XD2A 2ZJ5A 4ZMSA 1RLOA 4FMPA 1GNTA 2Y4NA 3AKDA 3G0CA 4NICA 2XWSA 1ZA2A 1UBCA 2C4TA 1QUFA 2RBGA 4UW9A 4BLUA 1N33B 4FGKA 3QLJA 3GGOA 3CXUA 1GILA 1XVUA 2O52A 1D6SA 5DHQA 1A5SB 3BHNA 4WV3A 5LDHA 3ZYCA 3WLPA 1I01A 2ORVA 4PS0A 4V2IA 1SQ6A 3O7MA 5EKDA 2F1JA 5AW6A 1T4BA 4G2NA 2FR0A 3FVQA 1HY3A 3QVXA 3OEHA 5FULA 4WZAB 5CJJA 2PEYA 1SZJG 4FGWA 2F67A 3UBTA 1NFRA 2JI8A 3N53A 3SF8B 2B8WA 3D7SA 2HDHA 2WVHA 3AB8A 4YROA 5DWVA 3OQNA 1UFQA 2BEVB 5IDQA 5LQKA 3TBKA 4NESA 1JR4A 1G5RA 3TTSA 4S12A 3VPXA 5AFSA 1B0UA 1PS0A 2CNNA 4Q4HB 5KJ6A 2BI4A 2A9JA 2D0DA 2RI1A 1QHHB 2ORIA 1XVVA 4FJ0A 2E87A 3ROGA 2YW9A 3RVBA 3ND6A 4AYTA 1EK1A 1M2NA 2H16A 2SKDA 5CU7A 1V8ZA 5DHRA 3NBMA 2CBXA 4ZA2A 4CG3A 4YAJB 2GNPA 1FP4A 4Q3OA 5B36A 2YYSA 3IUSA 3G1UA 4WXEA 4UATA 1OGYA 2Y67A 3U4HA 3EFBA 5CM0A 2DLDA 3TECE 5K8VA 3SBEA 1V16A 3NWEA 3QG1A 3Q6IA 4FHDA 3H18A 4GKVA 4D79A 1XR3A 3PHHA 1OROA 3I8XA 5AJZA 4Q4DA 3JASA 2UYGA 4P1ZA 2XGOA 5JT1A 4PLHA 2JFNA 2WT8A 4QFCA 3EOBI 5CM9C 1KDRA 4O0MA 4EI8A 3VKHA 1B8PA 5I45A 4NZOA 2V74B 1WTCA 1OHHA 3YASA 2I6TA 3KK0A 2HDNB 2OQ2A 2TMYA 2OZLA 2J30A 3E7WA 3MAJA 4PHHA 3OD5A 2VG8A 4M9CA 4OBWA 4OV6B 2ZM6B 1RZRD 1V4NA 3BWXA 3RUAA 2PA0A 3AUXA 4BZXA 4F97A 2EHDA 4IDFA 3K9WA 3Q2KA 3WGJA 1UCFA 4EG4A 5HILA 3G9TA 1WHSB 3RHSA 3U13A 2PUBA 4GI1A 4X6YA 1Y63A 1D5CA 1MT0A 5D3MB 5LL6P 2DETA 3IIKA 3KVOA 1NF2A 2XNDD 3W05A 2LW7A 4RD6A 2EZ4A 3P9YA 1QFJA 1PQPA 221PA 4EPRA 3DT9A 4JJ4A 3LQQA 5JZMA 4AI6A 4EG3A 2GTPA 1OZGA 2G7ZA 3UJ6A 5M3BA 5K0ZA 1AOXA 1ZMTA 3TBHA 1MTZA 2G25A 4FPXA 5FUBA 3UMGA 5CDHA 5HZHA 3RH0A 3U0GA 3NCHA 2FETA 4OKIA 3RSGA 5FAKA 1U9IC 3TDMA 1ZGCA 3W78A 1XA4A 3PDCA 3HA2A 3ADCA 4Y6LA 5P8WA 2P4EA 1I7QB 4GM4A 4V0SA 5JJCA 2GM5A 2B3TA 5LQNA 4JK3A 3PEEA 1LD3A 4UCRA 5JYBA 4C89A 1JG3A 4J8PA 2GZ3A 2GFIA 1CS0B 3D0QA 1ZH0A 3IP7A 3PC8C 1HQDA 2FEXA 4FFLA 1VJTA 2BT4A 3QVSA 4TTVA 1CG6A 1T3LA 5BSRA 2JJMA 5IN5A 4CMBA 1UC4B 4KXQA 3AR6A 4F2GA 5BQPA 3VPBA 1E5QA 3I52A 1IM5A 1MQ9A 2H57A 2VL7A 3FUVA 5E6UB 3GJYA 2Z2XA 4Y2UA 2FMUA 2BHSA 2JGLA 4M0MA 1N0HA 1WU7A 4MYCA 4AS2A 5A6VA 3WBBA 4B3XA 4JV5B 2NMVA 3WK7A 4BQIA 4M86A 3NPAA 2PO5A 1GIAA 1NN0A 3P7MA 4HJXA 5FFFA 3W3AD 4EGCB 2B34A 2AJBA 5KQMA 1U7HA 3DM9B 3P2YA 1SCUB 1FOEB 1T6YA 2ACEA 3C3CA 3EARA 4FYPA 4D4GA 4DMKA 5KYXB 1FFSA 3ENZA 4NF2A 5AK3A 4C7VA 5F1PA 1NXWA 1Y81A 5LC1A 1A1VA 2ONJA 1AKYA 3LO8A 1TK9A 3F7TA 3WY9A 2YZ7A 4PZZA 2OYSA 3ZU6A 1CF2O 4GPAA 5KSPA 3QKWA 1HT1E 2ERYA 5AJTA 3ST7A 5JG7A 3FWPA 3TTVA 2VDUE 1SVWA 4L8VA 3QEBZ 2GK3A 4Z4QA 2FZWA 2O0JA 3PDIB 2XUHA 2E89A 2PYIA 4LHSA 2HVSA 2C9OA 2B8TA 3ITKA 2GYYA 3KX2A 4Z49A 4G0WA 4M87A 3OEWA 2QG4A 2FPSA 3QEJA 2PVSA 3GN2A 4HQFA 1XFDA 3EW9A 3NHBA 4L8LA 2O2ZA 1GAJA 2ZSAA 1VDZA 4WVLA 3TTYA 4DG8A 5CDSA 3KQMA 1LU9A 4URWR 4Z2YA 5M04A 1CZUA 4AM8A 2GASA 1UMBA 5C31A 4RK0A 3LP8A 1E2MA 2O2HA 2I1LA 3F96A 5GGYA 1QONA 1EEXB 3BAZA 1Y80A 2JI7A 1ETHA 4N5DA 4O6VA 4EJSC 4KQEA 3CX7A 2OXEA 5EYPB 3JYLA 3IYLW 1PS9A 5HQ3B 3SQXA 4JP5A 1A5TA 2P7IA 5AM1A 3T5BA 3L7LA 2XUJA 3K6SA 2RGYA 3N3BC 1J7KA 4NC9A 4IIEA 3KQYA 2AC4A 5JQGF 4NU5A 3EGDB 3CVYA 4G5XA 3KKZA 5B4UA 4JLKA 2KHZA 2GKSA 3FROA 4QUJA 3ZGOA 2PGAA 2ZUCA 1SVKA 3AEKA 2YS7A 4XB2A 3DV9A 4YBZA 2XUFA 3D3NA 1E0AA 5LLDA 1F3LA 1E1QA 5LB2A 5HQJA 3RW9A 4ZO8A 2NLOA 5IMBA 3DAPA 1EVLA 1XCBA 4NMHA 3KUDA 1WXFA 4ALLA 3LOUA 4BQNA 1E4EA 3I4FA 1Y9AA 1NUQA 4LJAA 3PE3A 1O57A 3QM1A 3EULA 3F5QA 2HEIA 3IVRA 3KHSA 1AKVA 3CIFA 3D6JA 3K53A 3PX2A 3KXIA 5EZSA 2UXCB 4J1QA 2Q6KA 1ODKA 4UQLA 2QMHA 4FR2A 5COAA 1UMCA 3AH8A 3QVKA 1YWGO 4GDMA 3V4FA 5B53A 1H2YA 4QBTA 4NQZA 4EAAA 4DR4B 4R7TA 3OEHD 2DF8A 3L1UA 1W4CA 2NTNA 1FLAA 4BE4A 2VEDA 1ATZA 2WB4A 4MQBA 3UWSA 4PNHA 2JFYA 4Y2QA 3AI3A 3A0UA 1X7WA 4GWGA 4QATA 2ODWA 4EY7A 2DHCA 5IKEA 4FOSA 2BY4A 4BO5A 2R4TA 1Z39A 1TZKA 2W6IA 3LC1O 4G4GA 1KJYA 2I6XA 1UC9A 3KVNA 1UM9A 4IHQA 4KRXA 2JGNA 4D6PA 1U0NA 3O82A 3KR1A 3KWFA 2JBHA 4A0QA 4MR9A 3A1TA 4QO7A 4MQEB 1BYIA 2JL1A 3WWIA 2IUEA 2QR2A 4JFAA 1XAGA 3DDHA 4XYBA 3TD9A 2VUHB 1G2IA 4HVAA 2IV3A 4QKQA 1TMYA 4GRDA 4ROSA 1VBGA 3BIXA 3IE0A 3QGMA 4YXWA 5ARDA 3G6WA 2OECA 5DSXA 3KV1A 1UZMA 1VRCA 3ZVNA 2CJXA 4PYMA 1ZD9A 3K9LA 2ZYDA 1A0IA 3QENA 4YLEA 3VHRA 2QJRA 3R7SA 5JLJA 4FSXA 5FUYA 2BHTA 1QUEA 4GZLA 1GQYA 2HV9A 2JHGA 3CQ9A 2Q3DA 4O7ZA 3ZJTA 1AIPA 1HFWA 1OLSB 1Q57A 3THWB 3WISA 4F92B 5A9TA 4AJ4A 2REBA 3VR6D 1EHCA 3JU3A 4F8JA 1EWKA 3G2HA 2DQ4A 1OIVA 1EFCA 5KINB 1CU1A 1ZGHA 2DH5A 2J3LA 3LD9A 4PPFA 2PIDA 5FBQB 2O7NA 3OZUA 3VNQA 3QFTA 4J0IA 4I5GA 5ADUS 4OMCA 3Q7QA 4PCUA 1P77A 4TWJA 5FD8A 3RADC 2FH5B 2YNMA 4WRRA 3W8DA 3SYRA 3C3YA 1KOJA 1OREA 3P0JA 4GLJA 4LHWA 2PT9A 4KFUA 3VA7A 5L3QA 5H9WA 1L4KA 4LJRA 1L7PA 4N3NA 5JCOA 4YY3B 3IDOA 4XX0A 3PC6A 3FCEA 5FPKA 3QELA 3VTAA 5LP6A 1MPXA 3UMMA 3H9BA 5JS1A 1UWLA 3UQYS 3AOEC 3DBOB 3ND9A 2O3RA 4LJ6A 3KALA 4LWZA 2AB0A 1ESMA 2QRPA 1WW3A 4HGQA 4UM8B 2JJYA 5A1JA 1KGDA 3BKWA 5EHXA 1LZKA 3I6IA 1F4VA 3KOMA 3IEXA 4G4SP 3SZMA 3I58A 3I01M 3WQBA 2EJUA 3BYZA 5CYOA 2JGKA 3UWMA 2I4MA 4UUGA 2VDOB 3OOEA 1GAXA 3MWLA 4FYHA 1JJFA 3DG9A 1A9YA 2HF9A 2PZJA 1GZ6A 2OC9A 4X1IB 1J2YA 1U90A 4DNFA 2JFBA 4HNGA 4NE9A 5CFZA 2R68A 3G2NA 2I4OA 1OJ7A 2JANA 3DJFA 3FNQA 3LDUA 4PAGA 5CT8A 3RYFA 3VV2A 4C07A 1BVRA 1O4WA 2H4WA 4KGXA 4F91B 4GPZA 3QRWA 3K09A 1FP6A 4INPA 3U7QA 3M8KA 2D1YA 2L69A 1NHWA 3OCXA 1M0TA 1NQAO 4ZOLF 4NAVA 3G49A 3JQAB 4ZV4A 3HU3A 1BJKA 2PZBA 3PKIA 4HQOA 2H8GA 4OBEA 1ID8A 4XVCA 1RNLA 3PXBA 3RQIA 3JALB 4ON9A 1E0KA 4MHTA 3OTOB 2WAOA 4IIUA 2H4YA 1XUOA 4C9BA 3HU1A 5BNWA 3B20A 2XT6A 1T6BY 3HCCA 5C5EA 2AG1A 4N0QA 1Z74A 4BEWA 2FYTA 2IOYA 4L6CA 4H77A 3H1PA 1EESA 1AB6A 1K06A 4FHFA 1CP2A 3MMNA 2OAEA 2P6PA 1F9AA 3C6KA 3ORSA 4PPNA 3LKZA 4OOEA 1ZN8A 1Y48E 2XKJE 2W5UA 3ILXA 2Q5CA 5DBHX 1TEZA 1PLLA 1Z28A 2JCGA 4JEMA 1ORWA 1UKBA 1MP0A 1TLFA 2XB4A 3THRA 2D0OB 3AERA 1FPQA 5HR5A 4PZ8A 5BVHA 3TE6A 3NBZB 1Q1BA 4J75A 2C2OA 2Q21A 4Q7MB 2XZLA 2OILA 3FH0A 5IZCA 4ZOEA 4TMVA 1LRJA 1H1LA 1U8FO 2MR5A 3FLEA 3H9GA 2GBLA 1R12A 3TTWA 3M4NA 4OXIA 4CHIA 2G1AA 1ACMA 1O9GA 4QUBA 2WPNA 1UJMA 5EJAA 2CW5A 3VJKA 1RC0A 4RLFA 3OLCX 5JAUA 1UDCA 3KYIB 5JNWA 1GYRA 1JV2B 2HQBA 2JLBA 3OZCA 3UWKA 4FB4A 5LMNB 4P0PB 1VG1A 3GELA 1R50A 5HEKA 4X91A 2DC1A 5KU7A 1B0PA 3JZIA 1YUNA 1RJEA 4LYHA 5FBWB 4EYEA 1XHEA 4AQYB 3QJYA 3Q2OA 4AMYA 3RF6A 1ZUIA 1O03A 4TKZA 3ZHBA 3K72B 5AM3A 1EBBA 1GNPA 3ZV7A 4LSGA 1SCJA 3DNMA 3B48A 2W90A 4ASUD 2YJNA 3LVBA 3WKEA 4LS3A 3OPMA 3WLMA 1N75A 2WT9A 1HORA 3ABIA 3TSOA 5CIQA 2NVUB 1RBYA 3NHMA 4AX4A 5B7PA 1KQFA 5C5CA 4MVJP 3FSRA 4M1QA 4M83A 4MKRA 1E1QD 5ULLA 1DG9A 3WO1A 3C41J 1SD5A 1W75A 2PWBA 1KY5A 2ENUA 2PS0A 1QGAA 2HU5A 4MWZA 4R1MA 2WVAA 4MAAA 1OAKA 1XEWY 4HGRA 4CL8A 3B2NA 2BF7A 3CXRA 4JA0A 4R1SA 2D4AA 4OA8A 3UJNA 3LUCA 2UXBB 1MA0A 5CA0A 1PGJA 3H6KA 3Q12A 3HB4X 3V6LA 5BWMA 4DAOA 4LZOA 2COUA 5BOVA 3LQSA 4BFSA 1SXJC 5EEGA 2HRBA 2ZAOA 4HDCA 1IMJA 1JMKC 1QK4A 2UZIR 5EUQB 4C4RA 1L5KA 5BV2P 3NRCA 2K87A 2PTGA 3EOAI 3KEOA 4NV3A 1R4NA 3TNLA 2FTKE 1QANA 5LQUA 2ZJAA 4N9QA 3TW7A 5FBVB 3USZA 4B3HA 3ITNA 3VJMA 4PFQA 2YL2A 3IDSA 1EWVA 3QWAA 5IU6A 1KO4A 3N2KB 4LMBA 4PE5B 3CSSA 3OQVA 2EKDA 2ON6A 2ZETA 1DBSA 1XLUA 2A84A 2FP4A 2G7MC 3EYAA 4OIMA 2W6ID 1ZNZA 1T9HA 4RSRA 4H1TA 1ZJWA 2LRHA 7GPBA 3W1BA 1U5AA 4WY5A 4B46A 5B64A 1RYHA 3ROTA 3OBIA 4MKFA 1RR6A 4MKIA 3VOSA 3DFUA 2G9NA 1ILEA 1RKBA 2EFGA 3RFVA 1NVDA 4CQLA 3ROKA 1U8UA 2I7DA 3RKSA 2A7XA 2JAXA 4AP9A 1HA3A 4YAFA 1EKFA 1GFSA 1KQPA 1KARA 3CPHA 1CK4A 1W4AA 1K0UA 3MCVA 5G0TA 4B7CA 4YXWD 2OP0A 1QQBA 4ARBA 4YRDA 2CSXA 1R9MA 1D8TA 1W8IA 1C9YA 4ZDIA 1XJ0A 4U39A 3Q2IA 4ZWNA 1I4DD 4KO8A 4TPKA 1KTAA 3HO8A 2NNLD 2VUTA 1UXHA 3JAWB 1SKMA 1S4QA 2AF4C 3CSDA 2WSSA 3K9NA 5ILOA 1JXAA 1QKJA 1Q92A 5EIEA 1K2VN 2EQ5A 2B2XA 2QRVA 3OIWA 1FZTA 3GARA 3HXKA 1BFKA 2QI9C 3AEZA 3CLTD 3H7AA 4PQRA 1EVKA 5AP9A 1G7SA 4EHAA 4AS1A 4L5AA 3DZJA 5L7TA 1W1UA 2BISA 4BLQA 4TYWA 4JQSA 2ZWMA 2IZZA 2WJAA 1MEJA 2FSGA 3BD7A 3H8VA 3I3OA 4BX0A 1D4ZA 5AO9A 4D02A 4HDNB 1XJWA 4CM1A 1EG7A 1C8BA 1UPXA 1EVZA 3T0FA 3TFWA 5J5AA 1FRNA 4YRKA 1ZJ5A 4ALJA 4BBJA 1KY4A 2G88A 4DGSA 3QXJA 2R1TB 4AAYA 4Q15A 3RR2A 5CW1A 1XU7A 5ALXA 5B30A 3E18A 2FQWA 2YWFA 1VMIA 3F3YA 1LPBB 3O6VA 2C4MA 2PL3A 4O2AB 1CW2B 1VQ1A 2JVJA 3W77A 2A5DA 3RYCB 1X9IA 4A1OA 3F2IA 3NORA 4D3YA 2CFTA 2ZSDA 1R88A 4RCZA 4V1CA 4BX2A 2OCGA 2QWXA 4OI2A 4TROA 1M3SA 4YASA 3RF7A 5D7NA 3B53X 2CLLB 3WYDA 3RTGA 4CC5A 2JAWA 4KZKA 4Q37A 4F8EA 3GZNB 3L7AA 4U9UA 1IBCA 4PAQA 3P8ZA 5AVYA 1KORA 4QARA 4EA6A 4CLXA 1Y1QA 3MW8A 2AFIE 4I99A 4B32A 2N3ZA 3TLJA 1Q7CA 4AMBA 4YJ3A 3NDBB 4A3SA 4HVTA 4OYYA 1FE8A 3ICVA 1VL0A 4LYDA 4N39A 3WYCA 1V25A 4I9UA 3HPRA 1AKMA 2OKCA 1LBQA 1BS2A 4IFIA 3S40A 3N2IA 3RUPA 1Y4UA 1QAMA 2WD9A 3PR3A 1UKZA 3CZ5A 4WHXA 1DRJA 1YRQA 1P91A 2FGJA 4EEZA 4Y3UA 3R0VA 2CMFA 1WXXA 5B6PA 4RL4A 1JR3A 2WRZA 3G17A 4Y6PA 2WOJA 3V1UA 2GXAA 2OV6A 2AI1A 5LOVF 1SUSA 2XA1A 2B9EA 3T3DA 4X85A 1VM6A 1XTRA 1RMTA 2YXBA 2ZB2A 4LC9A 1L7NA 2J3DA 4KQ2A 4DJJA 1PR2A 1SBZA 3U7GA 4NS4A 5C4MA 2ZE6A 4WBNF 4C7JA 4PHCA 1DG1G 2WQ7A 4QASA 3GT4A 2C2GA 2B69A 1QP8A 2ISSD 1NL3A 1JEEA 2CFCA 1A82A 2Q2QA 2UYYA 4LV5B 2G67A 4O4HA 5FWDA 1SVMA 2EG5A 4G65A 3K2EA 3GC6A 1U7WA 1S2IA 2AIRA 4OP3A 5FNVB 4PFKA 4BUJA 3R24A 4R0NA 4UXHA 4EJ6A 2D06A 4Q3EA 3NYIA 4TT3D 5E7JA 1XTJA 3H5VA 1PJSA 2N0SA 3DPSA 3HR8A 3KR9A 3SQNA 2AI2A 2IYNA 3DE0X 4JZKA 1KOLA 3HADA 4DBVO 3OCVA 3LHIA 5AW9A 4J29A 4WN9B 3E05A 1KZGB 5TMEA 4Z4HA 2NU8A 4E88A 3T1YB 1Q20A 3KVRA 3TI9A 2YH2A 1LQUA 4K6FA 2GDZA 3ZLJA 3P9QA 1U7DA 1N4DA 4A23A 2NOAA 4QHSA 4JB0A 2M98A 4Q3BA 4OXKA 1M8KA 2EGHA 4R84A 4ZAZA 2HH9A 3GB8B 4QE3A 4BVKA 2ZRPA 3BWDD 2FHPA 4UHFA 1Z2EA 2IOFA 3ELBA 3SM3A 2W0MA 2IEIA 4I9FA 2AE2A 3EPRA 2GR9A 3ZDXB 1M1NA 1MG0A 2OGWA 3F6EX 2Z8YA 4Y1RB 3PHIA 2C9ZA 5G41A 2P6UA 4FM9A 2GLUA 4MR8A 1LPAB 5IC4A 3LKDA 4BXOA 4OHZA 4RFSA 2IYYA 1LSSA 3PNKA 1N5IA 3L0CA 3E7XA 3PNQA 3INRA 3D3EA 4D74A 3S24A 1ENZA 1EGQA 2BTQA 2E5LB 1H6AA 4TKLA 1U04A 2ZRJA 2AUTA 3KJZA 4J3FA 1X7GA 4JU9A 4DSTA 5DE3A 1GPMA 4B2IA 2PBFA 2CHVA 1Q0TA 3SDZA 1ADCA 5AW4A 3P4XA 1ZUWA 2J45A 3Q8XB 4OGLA 3D4LA 5JNVA 1RABA 4O33A 4QYSA 4A16A 5ABPA 2MYTA 3KPWA 1KEVA 4IIJB 3SMQA 5B6JA 2OXRA 1WDWB 3CURA 3NU1A 1JSCA 4E2FA 4OAQA 1WS6A 2PZ8A 3EVGA 1FNSA 3GP5A 3PFBA 2ZSIA 1E6MA 4JUIA 3BA9A 2W48A 1L3CA 2C7BA 2H8KA 3LIIA 1QO0D 3WLTA 4MKHA 1JHYA 3DEFA 1YZYA 3GJ4A 3LH5A 1GN9A 5K3AA 2QSZA 4IEEA 2WMOB 1MN6A 3WGKA 4B4WA 1QFZA 2XMZA 4UFOA 1CUAA 5DASA 4DVJA 1AQYA 2NU6B 3N86A 3IALA 3FNGA 5EAIA 5E1DA 1XLTA 2XX3A 1NPTO 2J41A 3IAM1 5T5QA 3S81A 2OHIA 1OILA 1P18A 1XHFA 4MPJA 5AUOB 4GZ6A 3LGXA 5JW6A 4DS3A 1MB9A 4HEJA 3IL2A 1F2TA 1PL6A 3KSAC 1DX9A 3EXAA 821PA 1PEYA 2QAGA 4GMXA 3W5OA 1QTRA 2O7QA 5JSUA 4RGBA 2KB0A 4CN9A 1I5RA 1GNSA 2WA2A 2XUOA 4AWXA 3MXOA 5KAMA 2FDCA 1GG9A 1N6PA 1I6KA 1R6DA 4EKYA 3EF0A 5BWRA 4WEQA 3ZD7A 2HIAA 5HGXA 4KUGA 1QQ6A 4EY8A 2DWPA 3P9KA 3R5KA 4WFKA 4JBXA 4REMA 2J31A 1U5BB 1U9YA 3OCYA 1FLNA 1GL9B 1G21B 2WSSD 2IY9A 1G3RA 3LU1A 4FYIA 4RH3A 4U4AA 5D3QA 4EVRA 1CB7A 3E9RA 4KQWA 3HXPA 1PKXA 4X3PA 4EUKA 4PZLA 3QWHA 3O1HB 1TGVA 4KO1S 5DOVA 3GG2A 4HB0A 1JHOA 4C4XA 1ZK2A 2I8AA 5ALIA 1UIRA 4MA5A 3A1WA 3SBOA 3WV5A 5ES3A 1I1LA 3PN1A 1MQ8B 2F1KA 5JNTA 4K87A 3SLKA 4DE5A 1VKJA 4PAWA 4Q4AA 2OR3A 3V8PA 1IY2A 3PVCA 4HFJA 4EJ2A 1KERA 1JQDA 3HS3A 3K94A 3LNTA 3QFCA 4GP7A 1IN6A 1DDIA 1TADA 1U3CA 3N2GA 1ABBA 4HNSA 1R8JA 1DIAA 4DIUA 3ZE8A 2UYQA 2A6PA 3SQMA 4G84A 4GO1A 2VSOA 2QLMA 2IE0A 4JWKA 3ORFA 2WC1A 3KRTA 4G1CA 5F4BA 1MO3A 3MCAA 3DCIA 3A1FA 4BX8A 1OD6A 5J40A 4DJFC 4FU0A 3M6WA 3OHMA 3O73A 4TYNA 4U7TB 5HG0A 2V6MA 1FUYB 3BSYA 3GLGB 3HVKA 1G98A 2B20A 3R8XA 1KK0A 1ONPA 2AG0A 4IG4A 4DJTA 5BN3B 1JQAA 4AUNA 3HGTA 3ESQA 3EDOA 3I2HA 4QU9A 2J33A 3COJA 1BS1A 1COWA 3VSAA 2ZUFA 3TOSA 2NZWA 4B9EA 2C2ZA 3QVGA 1E2JA 4G0MA 4KMMA 3DAFA 1G60A 2WG0A 1FQKA 3RVNA 4BGIA 1HR0B 1GKKA 2F3RA 1AZLA 1XZNA 4XIYA 5SZIA 5CB0A 5IJWA 3THWA 2F43B 2P9EA 3K4QA 4DV4B 3SEQA 4MAMA 1XVTA 2ZYUX 1VHTA 3HJGA 3VZSA 3WMEA 6AT1A 5IKMA 3FOEC 3KQLA 3ADDA 5B3JA 1EIWA 4YJHA 2P0YA 2Z83A 4ZZIA 2PIAA 2IYEA 3W8NA 1HDXA 1NT4A 2OORC 2NYAA 1ZOPA 3UAZA 4QGAA 2NIPA 1WO8A 2I03A 1K89A 1Y42X 1G6HA 1G8JA 5KEIA 1UDAA 3U7JA 4BVGA 3ETCA 1P4AA 1MDFA 3RSSA 1LQ2A 3GIDA 1X15A 3UGQA 2XQKA 4YMIA 5CCXA 2WU0A 1Z2NX 1Q0LA 4QTTB 5IVHA 5EL0A 1CEYA 4BAUA 1E3TA 1N0VC 2JFGA 2JNWA 2V6IA 2BFWA 2IGBA 2ONYA 2V0CA 2JFUA 4JJ7A 4U7GA 4MS1B 5CDFA 3H3XA 1CKNA 5TR9A 1ETUA 3CMMA 5JNUA 1JEJA 1TKCA 3G02A 1B14A 4C0BA 2I2FA 4OHFA 1U0HC 3VDNB 3LL7A 3PUYA 1XPRA 3C7TA 1JQKA 1RYFA 4PLFA 4URXR 4KKXB 2XMQA 3LQKA 4R6WA 3DDWA 5C7OO 1UWVA 1I7NA 3V2GA 3BXEA 3BREA 4GSLA 5GP1A 1PV2A 4CQMA 1VRVA 3WK8A 4AU1A 1P0PA 5SYMA 1YK0A 2EX1A 2WKQA 1B8VA 1P9RA 3T5DA 5L6LB 3QTTA 2Z1MA 3BCHA 5AVSA 1D9XA 1XTIA 3LY9A 4PBRA 3OQBA 2FSSA 2ZJZA 2H1CA 3AXTA 3T3OA 3PF9A 4MVCA 4M0EA 5F21A 3B51X 3MC1A 4C4TA 2XXAB 1OFIA 3EBPA 3T1TA 5G2OA 3IKTA 5HF8A 1WDMA 4F4JA 3PQDA 1TO6A 3K30A 1YHYA 2BE9A 4D9MA 3EZ6A 3Q1LA 1BNCA 3L04A 1Q1EA 1D5WA 2CB9A 2Z2KA 1G38A 4IH1A 1N1GA 1CJMA 4XJSA 1GLVA 2IUSA 4BCCA 3CC8A 4E14A 1Q50A 2DAPA 4IL5A 4NAUA 1PEKE 4ITVA 1VJ0A 3B6KA 4HLQB 4MVJA 2AYXA 4R69A 1IQ0A 4EFEA 4WBSA 2WTBA 5I5VA 3SC3A 4DG9A 2XVAA 5DX8A 3ESDA 1JAXA 2ZSHA 5EP3A 4AFNA 5CT6A 5CCBA 4AO7A 1R74A 3ZPXA 1AH2A 4X97A 5HS4A 4N41A 2Q9AA 4OI4A 4V2UA 3QW4B 3GGDA 3FZGA 4OF4A 2YZLA 3AI1A 1A8IA 1KBZA 1IHOA 4MIKA 4RVUA 3M6XA 4F4DA 3PV0A 4UUQA 2DWUA 1SHLA 5D84A 3COZA 1N6IA 2A9QA 2G5TA 5LUBA 3WNVA 4PZCA 5LLSA 2BV3A 3GF4A 3F67A 3OSZA 3DKKA 3PUVA 3QXSA 6NULA 2C7RA 5BSHA 3ODGA 5D87A 5B1SA 4RTKA 5B37A 4XASA 5HUQA 4MCJA 4HYQA 1HEYA 1QKKA 1TT7A 2HI0A 4XD7A 4RVNA 4A2CA 1JF8A 1QGUA 4V0LA 1MOQA 3TAHA 1LV7A 1X39A 3OE4A 2VRBA 4JVMA 4P34A 1QSGA 1G5QA 3PF8A 4JR2A 2H1LA 3KHKA 4HEQA 4KSBA 1MVOA 5CVUA 2FPXA 1YT5A 3GFFA 2MINB 3A7EA 4KEAA 3SIXA 3LYHA 3K0SA 3H99A 2PFSA 1EGAA 3HN2A 1ZAKA 3BTUA 4URVR 3UJDA 3H5TA 2EP7A 1DAIA 1DJPA 1EK2A 1YDWA 2PSSA 1HM5A 3NM4A 3O03A 1OFUX 3LBIA 1Y1RA 1EX9A 1ADBA 2V7TA 4DLUA 4FX5A 3BGSA 5LWHA 4OFXA 2FJUA 4E6EA 2UU9B 2DTXA 1TJYA 5HUHA 3UMBA 3E3MA 3U7HB 4C5BA 3CM0A 3GR6A 1KJIA 4PXSA 2ZDQA 3GFQA 3R6GA 1U2EA 1I2KA 3B1FA 4OFWA 4C0LA 4ZYZA 1XZHA 1N7IA 1C9NA 1IOZA 2CXSA 1H2WA 5TS2A 4EW3A 5KOHA 3EXIB 4ZRDA 3LUFA 5HGJA 1TIKA 1YS6A 3L6OO 3LT5A 4WLNA 4DIOA 1P1CA 5AOBA 2VBFA 4OJMX 3JATB 3T15A 3EFOA 1LDNA 4F11A 3NVDA 3QMWA 4QTUB 1TCVA 1M34A 2QUHA 3BEOA 3Q98A 1E62A 2X9VA 4Y2RA 5B7QA 3VC1A 2YJ4A 4KIGA 2K2QB 4P58A 1LTQA 1ZCFA 2QQFA 1FSSA 1G8GA 4LEIA 2H29A 5D2CA 3DTNA 1OBVA 3STXA 2EP5A 5DM0A 3V2HA 1V1RB 1SEPA 4ZYTA 1Z8FA 3PFNA 1X38A 3WQHA 4BB6A 4GRIA 3BHMA 3CRMA 4PO8A 1NNSA 1JJBA 4MGEA 5LQSA 1ZJYA 4HGPA 2ECQA 1MD9A 3AR2A 4O5OA 2FN9A 2PV0A 1DSSG 1TU3A 3KT8A 3QKSA 4RF4A 5GJCA 1YASA 1ANKA 2IKQA 3JD3A 1X9NA 1MJGA 4QSHA 2HRCA 3G89A 2FKAA 3PFWO 5ALDA 2G4CA 5KREA 2BYTA 4AKTA 3EQ8A 1J39A 1YC2A 2M1XA 3F9IA 3N05A 2Q1XA 2R00C 4EW1A 1SKQA 1EZZA 3X1ZA 3WIBA 3MHPA 4D7AA 2EGUA 1ZVKA 4RHEA 1JIUA 2WG1A 3JQ8A 1LNQA 3F98A 1XTKA 2Q9BA 1Z5ZA 8MHTA 2I8LA 2Y1WA 3JPWA 3HCDA 1Q2UA 3ZHRA 2D5CA 3AKZA 4HH0A 3U9LA 4ILEA 1OLOA 3RYIB 1VBHA 5BSGA 2PZAA 4KVGA 2IYRA 2Z2JA 4M55A 4HDKA 1YAJA 13PKA 4IJUA 1RXWA 2XR1A 5EJ4A 4QOFA 2GD6A 1J70A 2M2IA 4ZO4A 3ZK8A 4L73A 2YUIA 1FSGA 1JP7A 1R9NA 4NONA 2FZ5A 2P9QA 1G8SA 3CZ9A 3PD0A 2IHTA 5CVTA 1VGQA 5K0BA 3TQTA 1COWD 5E1OA 1GTRA 2YV4A 4FUTA 4EB0A 1P7VA 4P9NA 3R1IA 3IMKA 5F7JA 1T0PA 3TLMA 3RS0A 3QSYA 2IUTA 3BJRA 3EZ7A 1SJ9A 4AF8A 3IBTA 2VZ8A 1NOJA 3NETA 1QPBA 2IRWA 3OQPA 5K0LA 3RDPA 1W4BA 4B17A 3TY9A 1NYQA 1T9GS