2ODTX

Structure of human inositol 1,3,4-trisphosphate 5/6-kinase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
315
Chain Sequence
KGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPESVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol-tetrakisphosphate 1-kinase
publication title Structure of human Inositol 1,3,4-trisphosphate 5/6-kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 315
sequence length 317
ec nomenclature ec 2.7.1.134: Inositol-tetrakisphosphate 1-kinase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF05770 Ins134_P3_kin Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain
X PF17927 Ins134_P3_kin_N Inositol 1,3,4-trisphosphate 5/6-kinase pre-ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.100 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 2odtX02
3.40.50.11370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2odtX01
3T9DA 3T54A 3T9BA 5DGIA 4HN2A 4Q4CA 2Q7DA 4NZMA 5BYAA 3T9CA 3T99A 4Q4DA 5BYBA 4NZNA 3T7AA 2QB5A 3T9EA 5DGHA 3T9FA 3T9AA 4NZOA 2ODTX
chains in the Genus database with same CATH superfamily
1P91A 2VEDA 2IVZA 1NR5A 2Q21A 4YAJB 2P30A 1XK5A 1K4MA 3PPWA 3FDXA 4Q4AB 1L4YA 3TLJA 3ZE2B 4BN4A 5EJ9A 1VYVA 4OK3A 1AVTA 2VPYA 3TOVA 3CGWA 1V4BA 1EAMA 4DILA 1YZVA 4YJ3A 3L0PA 1HO3A 3WSVA 1CJCA 1K5PA 1EXWA 2CFCA 2MYUA 3GU3A 5EXSA 3G1UA 3ILYA 4QRIA 3GJZA 3VTKA 4RTKA 3TCKA 4PZCA 1NTRA 2NN3C 1KS9A 5TVKA 5TRTA 4BTVA 2WZCA 2ZIZA 3MJCA 4RPHA 4HNUA 5FT9A 4WMLA 2BTQB 3EZ9A 3V4OA 3DD5A 1WDLA 1T9HA 5GONF 1CRQA 5EJEA 4N5LA 2AI3A 4H1HA 3T54A 5DV9A 3VZPA 2OCGA 3TWOA 3VFDA 4AQYB 3ZQJA 1YKGA 3MT8A 1N9GB 1XTPA 4MPTA 4LY3A 1OX6A 3U3OA 3W05A 4OX9B 1LBQA 2CB9A 1LSUA 4N8SA 3OICA 4IHJA 4RPIA 1Z4QA 3HA5A 1NL3A 4JOBA 4RGYA 4E08A 1P7ZA 5A6SB 2W71A 2I0FA 2IH2A 2E18A 1QVRA 4ZO6A 2WA2A 3U4MA 2OHHA 3MOIA 1GN9A 3QYAA 5HKOA 5G3ZA 1DKMA 3WL8A 1RJWA 4US0R 1E8DA 4MVJA 2HK8A 4IMRA 2P3OA 4RGVA 1XQ6A 3V8PA 2QMYA 5LJLA 1W5AA 1JE0A 1GD1O 1M2EA 1ZL2A 3QLTA 5KB3A 3O3CA 4YAOA 5A2QA 5LMZA 1D6JA 2XVZA 4GE0A 1YCGA 4MV8A 1NKTA 4Q1CA 4TRMA 5AI8A 2IZ0A 1B2RA 2B98A 1D2AA 4EI9A 2MOKA 1NVUQ 2Q5OA 3WGVA 5JZMA 2C4NA 4LSZA 1A9ZA 3F8TA 5CA1A 5EZ6B 4KX5A 4HQOA 1KKLA 3OSUA 3VDXA 3O8LA 2BFEA 1EFDN 1EFAA 6ADHA 2ZYVX 5FOSA 4E5DA 3EVTA 4EEKA 3FD8A 5FOWA 4A8JA 3DE5X 2X0FA 2V8OA 1A4IA 1RXEA 3EUAA 4FOPA 4GP7A 2WJYA 1H4QA 5CM8B 5B4TA 1Q7CA 2H4XA 4GD3Q 1U2TA 1UBCA 4MKHA 4QOIA 4UOEA 4PFQA 2OBYA 4A8PA 3PSHA 1SU8A 4YWJA 3U31A 3BMQA 1V25A 1XZLA 4R84A 5C0OE 3UMGA 1AF7A 1RKBA 3OIDA 5L6LB 2R6AA 3F78A 1WP4A 3KV3O 1MQSA 4M87A 3LKBA 3BIWA 3GDEA 1YRAA 4L57A 1EE9A 2XTNA 4YCJA 1UP6A 2O6LA 1HQDA 2HHLA 4C5BA 2IEGA 2OAEA 2XNDA 1NZFA 3NB0A 4HAVA 3ZWQA 1QO9A 1VHTA 2HF9A 1KIMA 3HJCA 4OBXA 5BXYA 2BY4A 3G79A 4YONB 3TXYA 3U7QA 5L7TA 4YRKA 4I1SA 1H2WA 4LH6A 4EMUA 3LOQA 4JQZA 2BR5A 1QS0A 4W4TA 2JLVA 2XHEA 3T9EA 1CKOA 1ND5A 5B1DA 4UQOA 4DDVA 4NEQA 5B1SA 5JPCA 4YHHB 1ZK0A 3SHVA 3UCEA 2ZITA 5JCJA 2CUTA 3MELA 2GPTA 2R6JA 1LDMA 2ILVA 2R4QA 3BERA 3E53A 2WSYB 4FMPA 3HKDA 5KJEA 3ZQ4A 3ZX4A 3RRYA 3P1JA 3O94A 1XP5A 2PMWB 1XEAA 4AMGA 2CBZA 3HO6A 5FJIA 4GOOD 4FT2A 4M2LA 4XZ3A 1TM7E 1C80A 2AFIE 3SSNA 2DTDA 4G8BA 1IZZA 1L3BA 3D3QA 3KD3A 4BP8A 1P5FA 5JSZA 5CCDA 4G1CA 3CT4A 2FW9A 3DAFA 4RZSA 3AUAA 4IKPA 2RK4A 2V6IA 1T8PA 3ZDRA 2WSMA 1L7PA 1SD2A 2NU9B 3OAAD 1L5HA 2CLHB 4GUDA 1L7DA 4ES6A 5SZHB 3K70D 4XEUA 1XCMA 1E2IA 1YFLA 4LVCA 2YOFA 1NBMD 3O9VA 3O2SB 3TB6A 5ITSA 2FPIA 5KVAA 3AF2A 5TDHA 4R1PA 4W6ZA 5HKBA 2HCTA 4UNRA 4CEIA 1IQUA 1JIVA 2XTZA 1TA9A 1YBHA 1J8YF 2ATVA 2HO4A 2PLWA 4GXTA 4KC0A 4F2PA 3QHAA 2ILTA 4QQKA 4PTYA 3TB4A 4D97A 5IH3A 4OX9Y 1A7UA 2PQMA 3VMMA 4ZRMA 4CM7A 1ZD9A 5AKKA 1RFGE 2X7HA 4ZYVA 2XT9A 4AU1A 2A4MA 3C70A 5IH7A 4Q6WA 3X1KA 5P8WA 5HYVA 1BWPA 4CL3A 1CR0A 4JODA 4R54A 5EJ8A 4ENVA 3I61A 1P29A 2PG3A 3GYBA 5CM9C 2X0SA 2CNOA 2D5CA 3KO8A 4BKOA 4RQAA 4WFKA 1TFRA 2PEYA 4B7ZA 3WMFA 1ZUWA 2BFEB 4OQMA 3K6RA 5LZ7A 5AHRA 1U6KA 3AL2A 3M4YA 1H9CA 3K0BA 1TZMA 1ZQ1A 2R4TA 2PU7A 3DQZA 2AF3C 1G7TA 5IJ9B 2VPTA 2ZB4A 3GFRA 3PJGA 4BEJA 4HLUC 3VR5A 1QO7A 1W36C 4JP8A 3UFBA 4J1TA 3BMQB 5CGQB 1NXOA 3EYWA 5FHQA 5JOQA 2CE2X 3HR4A 3OPYI 5HTKA 5ICMA 2CV0A 1XTJA 4V2UA 3D2CA 2P4QA 5J5AA 1LVUA 2JAOA 5FTKA 3C15C 5B36A 5JU6A 2FN9A 3CW2A 1TM2A 3B78A 3U7QB 3W5SA 1H2FA 1PR5A 4KU4A 5CPFA 5ER9A 1Z4LA 4Z9AA 4O4JB 2O1XA 5FBKA 3MJRA 5JZBA 1WMSA 4Z4FA 1E2GA 1P5HA 1Y9JA 4BLTA 5F1YA 4WTOA 2NZYA 3FFAA 1QLJA 4R69A 4UEJA 5HF9A 2VO1A 1FRQA 5EGNA 2EIYA 2HWYA 1TU0A 4ALIA 4RV9A 1ISMA 2Z2YA 2YWJA 3HKDB 5FWXA 4RPKA 5ARCA 2Y1EA 3HXOA 1A2OA 2X6RA 2W4IA 2H11A 3C24A 3TW4A 4KGXA 3IT1A 2EG9A 4XJXA 4E22A 3WB0A 2R6GA 1FL9A 1IWOA 3GJ6A 2X9VA 4OH7A 4OXKA 2NPFA 4LOHA 2V7GA 4XZ3B 3B52X 3L4BC 1I51A 1GPJA 2ZRFA 1FMJA 4BE4A 4GQBA 2Z08A 3KQUA 5JSZB 4QDZA 4YXWA 2IPAB 2V9ZA 1ODKA 4HN4B 2PXAA 2HK7A 5HDQA 4ARCA 3UMFA 2EFDB 2NUTB 3LDHA 2IYNA 4QODA 3ETLA 1BJKA 4JQYA 1D4AA 3IILA 3DG9A 3KJXA 3MILA 1U0SY 1A27A 3CY6A 5JYEA 2PZBA 5TSDA 3GJTA 2HSEA 5DX1A 3RS0A 3VR3A 1G7RA 2DCMA 2H5EA 3LULA 1WUIS 4ZAGA 3IIJA 4CEIB 3OO0A 4KQ6A 4Y1EA 1Q11A 3HSKA 5AUOB 2QTTA 3VU9B 1NT2A 2W2XA 4UU7A 3AU9A 2P4UA 1W5FA 5CDGA 2IHZA 3R5TA 5KYKA 3HBFA 1OKKD 5DNYB 1EQ2A 4MZXA 1Z47A 2WTNA 3PDHA 1Y98A 4H1TA 2XDAA 5I9MA 1LFDB 1XGKA 3DL4A 3RU9A 1QZ3A 1VDZA 2ZR8A 3F9CA 4BE9A 5FB3A 4G63A 1IIBA 3INYA 4L02A 1G59A 2JLWA 1YIAA 2RH9B 5D7BA 1J2EA 3ZU4A 3LQYA 1SRQA 3LS2A 4DB2A 1BJTA 4E3ZA 1M1XB 3ENKA 2AC4A 1G7SA 3DMTC 3E1GA 1UDWA 3DKIA 2D0DA 3D3KA 5LQJA 1MC4A 3FFBA 1EMDA 5F78A 4NZ9A 1QR2A 3MHTA 2R3SA 1YU9A 1YBFA 4R51A 3L7OA 4GI7A 2Q4OA 2YDXA 3VSEA 1WF6A 1JT2A 1CIPA 1TO2E 3H9CA 3UWPA 3I05A 3ICVA 4JLBA 3U60B 1USWA 2FFHA 3OT1A 4U02A 1P3Y1 2AN1A 2C9MA 2RHRA 1KZHA 3Q8KA 3BE6A 4HUTA 2VSFA 1AZWA 1L7XA 3E2IA 3O8BA 3ZVLA 1GKLA 3GJRA 5HRAA 3BCRA 1SOUA 1F2VA 1NLZA 3KJZA 2WNIA 4GOLD 3KR0A 4O25A 2GTPA 1NUQA 4XYMB 2GHTA 1DCKA 3HRIA 1X38A 5AUNB 1YZYA 4JI8B 4TXNA 2RGUA 2WILA 3C1AA 1N92A 3GWGA 4ZOAA 5ALSA 2HQBA 1F5NA 1RACA 1RZUA 4MPRA 3ZBUA 5AD1A 3BQMB 4HJRA 4URUR 1DSSG 1HQKA 4YRQA 3VKFA 4BNXA 4GSYA 5HZHA 3FDZA 3BKXA 3OCWA 5GVRA 3U17A 4KH0A 5CEEA 1F60A 3CZ4A 2QAGA 4IFBA 1BC5A 3PGJA 1UPFA 4X41A 3AR4A 3PEFA 3HVUA 5KQPA 3QH4A 5FWXB 3L6UA 1XYVA 1JA0A 3CU5A 3IR7A 1Y4AE 4BLOA 4XUGB 3NRJA 2LV8A 3GDHA 5BOVA 2PPVA 4Y98A 4ACBA 3PGLA 4BVGA 4V3CA 1GQOA 1LBHA 4MINA 1QNFA 2IU3A 3R1IA 3IAS1 4PG7A 4NP6A 4I55A 4Z51A 4NCHA 3VV2A 1WEHA 4R6WA 2GRJA 4TN1A 5FTNA 3MAGA 5AXAA 1VE7A 1IG0A 2AMFA 3H5AA 1AKWA 3VNSA 5DTQA 2J0EA 1KBZA 3TOXA 1V96A 1ZSVA 5EUQB 5FPRA 1AD2A 4OXQA 3NKVA 2VQDA 1LC0A 5EMNA 5LNK1 3GNTA 4DLSA 4R81A 3IULA 4UTOA 3LQQA 2JGNA 3KOOA 5DXFA 4TMVA 1EG2A 1NRWA 4K9SA 2F3RA 4BFZA 3CXUA 3R9IA 4EY4A 4D79A 4EG7A 3C43A 4B3TB 2EJ2A 1I94B 1ABFA 4HQRA 2QTMA 1QQBA 4I1VA 2WUDA 5BQPA 4QOEA 4UDNA 1ZIDA 3VR4D 1UIRA 2JIDA 3P9ZA 4P7KA 1VIVA 2X76A 4JLWA 3TXXA 3QUAA 5G2OA 1GTL1 3TNJA 1YUMA 3Q5DA 4HMQA 3G68A 3O93A 3SR3A 4ED9A 5K45A 2CLSA 2FFJA 1RLTA 4N3CA 3F5DA 1D4ZA 4GVLA 4MS4A 3CKLA 2FW7A 4NS4A 4BQEA 5L4SA 2IBSA 1XZKA 2JA2A 2DFTA 2AV6A 2CL7X 3QOFA 4FMCF 5KMGA 5DWVA 4TLLB 1B73A 1T5OA 1RWWA 4AIIA 1ULBA 2W42A 3AZOA 2GGSA 3R0JA 2WNHA 3W4IA 2I2BA 3GPIA 1E2BA 4WDQA 3FYDA 3MUOA 5FA6A 4A15A 2Z8YA 3QPUA 4QAQA 4YB8B 5AXCA 1EI9A 4D0SA 4G41A 4OEHA 4PLPA 3AY7A 4L07A 4F6RA 2BI7A 4JUDX 2AG8A 2J7KA 1CDOA 5K7SA 3OT1B 4ADSG 5A04A 4YDSA 4LVNA 3QMVA 1ZGJA 3OZ7A 1Q7TA 3NGXA 3P2KA 3QA3E 4M83A 4RXTA 4NCBA 3JR3A 4OAPA 3IEPA 1SXJD 4BAZA 2F17A 2I3ZA 3F4BA 3FWNA 3BFJA 5EJ7A 1EWKA 2EJTA 3FNHA 3DFKA 4NMMA 4ZTBA 3LUAA 4B3HA 5A9SA 5CFZA 4UBKA 5TMPA 2CHQA 2WFAA 4OGFA 5KQRA 1R37A 2WZBA 3WYDA 1JLKA 4LJ6A 3RNLA 4B3IA 2N1BA 1Q3TA 1MX3A 3FNEA 2WV9A 4UBIA 3BMOA 4XGKA 1ES9A 2O5EA 4CV3A 1I4OA 4RTQA 3U1BA 4RZQA 2QAGB 1ZW1A 3PQ8A 4RHYA 4YC7A 5AKYA 1Q5PA 3IAXA 4DA4A 4F92B 1PRYA 2DFNA 3IIKA 3IKVA 4QOHA 5JRJA 2X14A 1O0SA 3DZBA 4EZIA 1UDBA 5CH8A 2J3MA 1T9BA 1AG9A 4JI6B 4OK6A 1HLPA 3GNSA 3LXRA 3FDJA 5A05A 5JJCA 2O5CA 3OKAA 5DBFA 2I4NA 4D80A 4M7PA 3ICEA 4RK1A 4I55B 4ZO9A 4FGUA 2BGKA 3KZXA 3KQVA 5EPOA 1MMFB 3H86A 4BLWA 1W88A 1XYGA 4QT4A 5D3KA 1CVIA 4KLNA 1HE5A 1J23A 3DBVO 3V33A 1UBNA 1T9GR 2L82A 1P19A 3C3XA 1MQ9A 1P2VA 2ZR9A 3RVPA 4I1PA 1U7HA 1DV2A 1X86B 2FKAA 3WNDA 1EFHA 2GFHA 5EOVA 1AQJA 1N33B 1M0WA 2B25A 4NCIA 4TKZA 2MR6A 1WQ1R 4LXIA 1SM4A 5EE5B 5GP1A 1EJ0A 5BWXA 1I2DA 1N57A 3OO1A 4IQ4A 3G1TA 1JDVA 3A0RB 1JZQA 4IEFB 4LSGA 1DO0A 3SN6A 1MTZA 1T8WA 4OB7A 1L5GB 2JGRA 2BI4A 2JJ2D 5A4FS 2CNKA 4HV4A 2I7CA 2ZSBA 2J5KA 5HM6A 1OIVA 2FOIA 4G0ZA 4IQGA 1AMNA 3EB9A 4XWOA 1WCYA 1QK4A 4GWLA 4Y6LA 3RT9A 2HMUA 1NRXA 1QYVA 2WP8J 4JJ7A 1NYTA 1ZGBA 3SD7A 2OXIA 1I6WA 1N5JA 2Q8PA 1ISFA 4MS4B 3QJ5A 1P18A 4YAGA 3PLRA 1UC9A 1YASA 2X9QA 3VUFA 2VKTA 5AESA 4AYTA 5EIEA 1FYDA 5L53A 1SO8A 5AW9A 2XNKA 4PYMA 1RXVA 5BSGA 2ZWOA 4MQBA 2C1ZA 2R6FA 2F8MA 1ZP6A 4WKPA 3L5OA 2GD1O 3O1LA 2Q99A 4ZXPA 3ZHQA 2IYUA 1G3UA 3C16C 4ZO8A 3VYVA 2RGNC 1Z26A 1IE3A 3AR8A 4JP3A 3WL4A 2P40A 4BLPA 4BO0A 1EUYA 4WKGA 1JJVA 1LPAB 4O33A 3CCBA 2E5LB 1KYXA 3DZFA 1XHEA 3G13A 3OKPA 2XAAA 3PXXA 4H31A 1CP2A 1LLQA 4B9EA 3AKEA 3MFYA 5IXSA 1EVKA 3M9WA 5B3AA 2OYRA 3RE1A 3DBIA 2RJ3A 3IQXA 5BWCA 2QY9A 2O7SA 3ZWYA 5D1OA 1TDJA 1DHRA 4RY2A 3UMBA 7REQB 1UWLA 3DTTA 5FUQA 2CVQA 5A9SB 1I4DD 3FOCA 4B4UA 2L17A 4K6NA 1DMSA 5K4AA 3OPQA 1SAYA 1VIYA 1XVIA 3LHSA 3ZLVA 4CFZA 3BS4A 4MVJM 3BE4A 3Q2OA 3GLIE 1S89A 1KMQA 2FH5B 4JEUA 4KGZA 4QPJC 1HZZA 3IP6A 3P20A 4AUKA 3QV1A 3BMOB 4IOJA 3GFPA 2PX6A 3PGMA 4RK5A 2ODQA 2WSSA 2H57A 3V1LA 3QXCA 2BLLA 1WDMA 1ZSYA 4NARA 4XVHA 2QYSA 3RS3A 1O1YA 2BSAA 4ZO4A 2EAUA 4NJOA 3D2BA 2R7KA 3DYBA 3DOUA 3MWDA 1KEWA 4AF8A 1Z0DA 1O87A 3PUKA 2QN7A 4ZICA 3R8XA 2VNJA 1DC4A 4BDTA 1B74A 1LNZA 2GTIA 2XEXA 4LJ9A 2COEA 3ASZA 4UM5A 5CJ2A 5THXA 3SSAA 2N46A 4DXDA 5CDSA 3SYMA 3GP5A 4EH1A 1W88B 1BVHA 5BW4A 2CDAA 2WJAA 3DA8A 1Y9EA 3QRWA 3VVCA 1VBHA 1LX6A 1UR5A 3OC6A 1FFCA 1OMOA 1MAVA 1CJKC 2DWUA 1R5BA 2OAGA 3VC2A 3BHNA 2F00A 2ZIUB 2VYCA 5GV7A 5A9TA 1G5PA 3TMKA 3TMAA 1XKTA 3J7TA 3WK7A 4JY7A 3GXBA 1Y82A 4MW9A 4WJZA 1HOTA 1T0PA 3TGWA 2COUA 4OG2A 3U80A 1Z83A 1KH2A 3DLTA 3EAFA 1I30A 2QQGA 4Z7OB 1YQ9A 2ENWA 3TFQA 1SEVA 3TIFA 2ZG6A 3TTYA 5BRNA 3QU5A 1EHYA 1QOZA 4TMKA 1GNSA 3OF3A 3T95A 1YQGA 4LJYA 1ODLA 2UVDA 3KHKA 2JW5A 2PUJA 3IEIA 3PCXA 3PF8A 4DS3A 2RJOA 3WXBA 1V5FA 4CIWA 1NI4B 4Y2QA 3PXBA 2PM8A 3NUAA 1MD9A 3KB1A 3I4CA 5D7NA 5EP1A 4IDDA 3W8EA 4D8YA 2D59A 4LXYA 2I6UA 1J42A 3EPHA 4H0CA 1A9OA 3B7PA 2Y1DA 5EHNA 1CRWG 1Y3BE 3WBBA 4ZJZA 2JIQA 5KTNA 3IELA 4CG1A 1GZDA 2P0YA 3H3FA 1U8EA 3BN3A 1K9VF 4KTVE 4LC1A 3ZHYA 4D96A 1GFZA 4F9FA 5CDHA 1R9JA 3G5AA 3G8YA 3SX2A 2C7OA 1YS1X 3MRSA 4L5IA 2GQSA 1VIDA 3S2UA 1ISHA 2FFBA 3LRXA 4RVOA 2X8AA 4KR7A 2WWTA 1K5GA 2R1TA 1PFWA 2NV6A 2YHAA 4ZJPA 2IS6A 3CZQA 2FJPA 4R8SA 4X24A 5K6AC 4M89A 1J99A 4FFNA 2ATXA 1L5OA 2GZDA 4FDAA 1DIGA 1HUQA 2QR2A 5D1OB 4GO1A 4U7DA 4S04A 2IU6A 1YCDA 2CXRA 4OQ4A 5F64A 2AJTA 5E3IA 5B30A 821PA 1X15A 3K09A 3U4HA 2HB6A 2A9FA 2UKDA 2XOEA 2DTEA 3SHTA 2ZSIA 3WSTA 2DAPA 1NF2A 1J5XA 2YXPX 4PLHA 5BYJA 2XRMA 4QQ8A 3WOVA 4YRLA 4F72A 1N34B 4V0LA 2H1OA 1QE3A 1RLMA 2QTNA 4C4ZA 5IM5A 1RZRD 1MF7A 3PA6A 2JH3A 3ZLBA 4FEYA 4QD3A 1K6XA 2W90A 1P2TA 4MUMA 1ZCZA 4FZRA 2J0SA 5E6UA 5K0SA 1NW3A 1Y3FE 1KDYA 2AB0A 2IPLA 3EEYA 3EGEA 4I9FA 4KQ2A 5IF3A 5A5VA 2VJLA 2VJYA 1N9ZA 2O07A 1UJ6A 3M34A 3LWBA 5CIQA 5D1HA 2OC9A 3MWDB 4D92A 3W8FA 2HH9A 5DMXA 3N1UA 5TB5A 3DDUA 2AEEA 3U44A 2ZPUA 5B64A 4RTSA 3PXEA 1JPJA 4DY4A 4GLWA 2AMYA 2JIBA 2ZT8A 3E82A 4P36A 5SY9A 3D3EA 1C3EA 4C89A 2X2OA 4QDXA 1C1XA 2A57A 3K3PA 2HYDA 3FMPB 2XT6A 3PNPA 4GLOA 1I7LA 4MV7A 1QFJA 3CS3A 1C7EA 4WJKB 4N0EA 1JKJA 2GF2A 1NN0A 3ID6C 3QI7A 2IBMA 2WK1A 3NDIA 2FPWA 1EGQA 1K92A 3SY8A 5EWLA 1VLLA 4F0JA 4L9AA 2E87A 1F7VA 3OEHA 3S2EA 1CQIB 2PS1A 5LP6A 5IDWA 2XXJA 4FS3A 3FI0A 4Q1DA 4CMDA 2EQBA 2G06A 5EHXA 1VXOA 5LC1A 1I6KA 1U2EA 1I3NA 1B8NA 1QDEA 2IGTA 2WV7A 1O94D 2O20A 4AZSA 2XQIA 2JBAA 2CJYA 1BMTA 3QMWA 4BQPA 2F1IA 1YB1A 4B3BA 1YQDA 3WGNA 3Q5GA 1GITA 2X22A 4L5JA 2F1HA 1BXRB 1HY3A 2R8OA 2WHEA 3W1VA 1X92A 2OV3A 2VOJA 3AJEA 4PZAA 2HNAA 1P17A 4OHVA 4U39A 3A1EA 3HCNA 1FSZA 2PCLA 4XLLA 1MN6A 5B6JA 1FPQA 3K4HA 1U7TA 1SB9A 4KEAA 1TO1E 4DZTA 2R9VA 2N9UA 5H0IA 1CS4C 1ZJJA 2JI9A 3B36A 5HX7A 3DZCA 5DMHA 4QARA 1FUUA 4AO7A 2I2WA 1JAYA 4R1TA 3ZHZA 1ZU4A 2GN4A 3TR5A 5DHTA 5FPQA 1G8GA 3U4GA 3TZ6A 1E0AA 1E4EB 2E37A 2KLHA 2OV2A 2R1TB 1M0TA 1RJEA 5BSRA 4ZTZB 5JQGA 2IS2A 3G9TA 4K28A 1QZTA 2F6RA 5MN5A 2W4QA 1DUVG 3A9SA 3KAPA 2P0AA 4QEZA 2NTYC 3CMMA 1NR1A 1R88A 2CVZA 3DQPA 1XO1A 4N3AA 3X44A 1Y6ZA 3G59A 1ZSNA 4G2NA 5E1BA 3E0XA 2J41A 1J1UA 1HFKA 3BQNB 3HLYA 3V8VA 3CX8A 4LG1A 2WYWA 5M7EA 4W5OA 1GYPA 1WKVA 3OFVA 5LXTA 2QN8A 3B2NA 3Q98A 3E9MA 3OE7A 3V1YA 4H7HA 4FYHA 1I2LA 3VXKA 4CIXA 5HZMA 3DPIA 4HQKA 1M2KA 4Q9NA 5E6UB 3GXOA 1YQEA 4D8VA 2PAFA 4K0RA 4EY7A 3GCDA 3AT1A 2VRCA 1E0SA 4F9EA 1SBIA 1B3BA 2KQUA 4ZVRA 4ZHSA 3U44B 1K4KA 1YGYA 3E03A 2CW5A 3CCFA 5EHZA 4U1RA 3RYIB 3CW9A 4A0QA 3WWOA 2CMFA 2KW5A 4QDOA 4ZKEA 1V8PA 4UOQA 3N28A 1JZTA 2HNBA 2XITA 3V8QA 5IK2A 2HQSA 3ECSA 4LC0A 2IODA 3OA0A 4GYWA 2K2WA 3V4PB 3BRCA 4ECAA 1C1XB 4J4HA 3IP9A 4WE3A 1M6HA 2FZGA 4B45A 1GRQA 3AF0A 4YCCA 4PAGA 5A7GA 3VYUB 1XRMA 3KETA 5D5HA 2I5PO 2QLFA 4LCBA 1DQNA 1GT6A 1M8FA 3D4NA 2WYVA 2ZKIA 1QB7A 1S8FA 1JKJB 1JN0A 3GB8B 1G291 1MRNA 1YS2X 2FMXA 2JFFA 2BT4A 2C8LA 3ABQB 1QIMA 3NTRA 4NK5A 1WNFA 4TLCA 2WE7A 3RK0A 1YQWA 4U2CA 3KPWA 1IK6A 1N5RA 1ONPA 1S8NA 4IGEA 2RHLA 4PX3A 3ZUPA 5EWLB 1BD3A 2NADA 4U2EA 3O4VA 5LP6B 4ZANA 2Q5HA 3NOVA 4YUAA 3QMPA 3OEEA 4JJ8A 1B1CA 1NYRA 1SUEA 3FMFA 1H4SA 2PSFA 5FRDA 3RBXA 2ZJYA 16PKA 1FMCA 1SKYE 3B9BA 2JBAB 4UCTA 3FZYA 4FE7A 4DQXA 2CV2A 2PMDA 3MGKA 4CUZA 5A0TA 2AC2A 4ERNA 5CLFA 1LQUA 4KRGA 3H2HA 4MYTA 1WU7A 3U7IA 1RYDA 2HA4A 1MFPA 3JQBA 1E2KA 4DPLA 1UBLS 1J0BA 3PEUA 2ZZNA 1N8NA 3BIJA 3NTVA 3LA6A 4PHHA 4M7OA 2BZ1A 3GUVA 2FF5A 4YJ2F 1A96A 3K0HA 4X7RA 1OFTA 2W2LA 1X1DA 4C4TA 5IC4A 4ZQIA 2OK7A 3OY7A 4HWKA 2OV4A 5IF9A 1XQYA 3ZH2A 2IH5A 4BO8A 4D45A 2DMRA 1RHUA 2PMBA 3WHPA 4RKEA 2OCKA 3EZ7A 4RDCA 4RKQA 3UKJA 2VF5X 4X7MA 4ARSA 2V1UA 2HT1A 3AJAA 1BS2A 3M1LA 3UKDA 4MARA 3R75A 4C01A 5JNSA 5JQGB 2RHCA 1M33A 3RU2A 1XHFA 4H60A 3LC2O 4FS8A 4FJ0A 2P9FA 4Y9DA 5L7YA 5JAHA 1GGKA 1OBFO 3PI7A 3RS9A 5DH9A 3MWEA 3GJYA 3TSWA 1FP6A 3BSWA 4PQGA 3USCS 1JJIA 1H42A 3A10A 3NXKA 4I8XA 4KXMA 2G82A 1Z17A 2JFXA 2Y4NA 3PQ2A 4GX5A 4MPDA 4QUJA 5EFOA 5LXTB 4URYR 1TAQA 2FP3A 2P5YA 4J6EA 1MO4A 3RVNA 1H3EA 3E81A 1GN8A 2O0KA 5CDFA 4S1PA 5IJZA 3VX4A 3MQ4A 1XVTA 2RDMA 3KTDA 3R0IA 1NVBA 4GLJA 4JC5A 5HXAA 1JFFA 1U7XA 3BMNA 2G1AA 4DDMA 4F96A 2C59A 2G09A 3WYEA 3AB8A 2JCBA 4EHNA 1B26A 4RZIA 3AJ8A 2IEIA 1JHMA 1PNRA 1D2MA 2ZJ8A 4D41A 4L0DA 3ZYCA 3HN7A 4EYEA 1Q1AA 2BF4A 3AU8A 4G23A 4WERA 1XPOA 5FH9A 2Z8YM 4FOTA 3KTAA 4XGQA 4ONEA 3RABA 1JG7A 1OU4A 1UBEA 4Q1VA 5F3WB 4LAFA 4C2AA 4RPLA 3EVEA 4M9QA 2OECA 2BUBA 4UW9A 4AKHA 1BU8A 7ABPA 4U7WA 1P7YA 2A3NA 2C4KA 2JLSA 3F4KA 3ROTA 3WK6A 2ZBGA 3LUKA 4AZ3B 5C8ZA 4JT4A 4UUPA 3HL0A 2J33A 3RSLA 4QBHA 3TNDA 1X9GA 4CG3A 3JX9A 5AI6A 1AX9A 2WF9A 2ZTUA 5F3DA 3AEZA 4TYNA 1NNEA 4F9GA 5LKRA 5GJCA 4DBZA 4R68A 2O2CA 3CQ9A 4HDRA 5IAEA 1NTOA 3N75A 1VL1A 1TJ5A 4JSTA 2XUPA 3PFBA 1JHOA 1CRZA 1A8QA 4HPXB 2JFPA 4HDAA 4DIOA 2W6JD 3AUSA 5EVCA 3LF1A 1ULSA 1FUYB 2Q3MA 2GHIA 5DGXA 4PNEA 1A3GA 3IBSA 3JWGA 2GBCA 2HJWA 1CB0A 2WR8A 4B3JA 2E1PA 1VBKA 3I76A 4R9RA 1TLTA 2FN4A 2QD2A 5EIAA 3W2FA 3NBYB 1XZNA 2FXVA 3WBFA 2P2GA 4NCAA 5MDHA 4IQFA 1M74A 3PFNA 2O7VA 3FVTA 2Y1KA 4N18A 1GGEA 4Q4DA 1FBTA 4G0PA 2FQQA 3OZUA 1L9XA 4BU0A 5B3JC 1PZNA 2PZJA 3EPLA 4GVXA 1WOYA 3LP8A 3FCEA 1A8HA 3HM9A 4DJEC 2NTEA 1VYHA 3AFOA 1X1EA 4C0LA 2IUSA 1PVDA 2P2DA 1YB4A 4JENA 2WMNB 3UHOA 4P33A 3DQQA 1HEUA 3FGNA 3LO8A 3Q4GA 2YZKA 1GFSA 1VBFA 1L7AA 4WNIA 3AKZA 2W93A 4PYIA 4B7CA 4D9IA 2ZTHA 2ZRBA 1H5UA 1ZHOA 1QV7A 3GZTB 1E98A 2Z2JA 3WLLA 2WWHA 3F5MA 4JS0A 1PG0A 2QDXA 4QXRA 5A71A 4HNHA 4QPDA 4QRHA 3SJZA 3WHIA 5CFRA 5KZMB 3KD2A 3EXHA 3EGVA 1XLTA 3MWEB 2NM0A 5E4TA 3TL2A 1AQYA 1C8LA 3BH6A 2PVCA 4GPD1 4CCYB 1JR2A 1BRMA 3FOWA 5H83A 5ADHA 1M3SA 3AHJA 4LV6A 2I54A 1BX0A 3FIUA 3D6NB 4BGDA 1Z12A 2HPHA 3I73A 3TQOA 1H05A 1GUAA 4MV5A 1FS6A 4LF4B 1YK0A 1IHXA 1L5SA 4C21A 1PJLA 3BMNB 5DULA 5FBZA 5JALA 3RF7A 1W36D 3RV3A 5CA0F 1YNSA 3VAAA 2FGKA 2ZDHA 1MO5A 2X4LA 3PNBA 1TJNA 4XWAA 5T6MA 4BAGA 3DYIA 4PRLA 3W5JA 2GN6A 4KMSA 3ZH9B 4CF3A 3NHPA 5FEMA 4D25A 5IT0A 4R0NA 1WG8A 4LXHA 4R2JA 1FP7A 1R0BA 1MJGA 1IHUA 2W22A 4NCXA 5KNDH 3GLGA 1YKSA 4K86A 1RYFA 3KTAB 2OP1A 1MFZA 1KSGA 2IXFA 4YV2A 4YUYA 3MD9A 3FB4A 1U80A 2G0TA 3AR5A 2CYBA 4WY2A 4N39A 1Z8NA 1ZUD1 4F4JA 3FCOA 4BLSA 3I09A 3ZEAA 4D9KA 1AS3A 1GGMA 1XZQA 3IP7A 1DX6A 2E4AA 4FDTA 1OI2A 1PL0A 2W2MA 3RAPR 2N3ZA 2VXBA 4AECA 1PNVA 3LVFO 1AY0A 1ETHA 1Q12A 4P54A 4BVHA 2UUAB 3QE3A 1VDMA 1VMDA 3U7JA 1IVYA 4U4AA 1RM3A 2LW7A 2PGAA 4CEJA 1AHPA 4AY5A 1I2BA 4HDRB 4NFSA 4EG4A 4Z7QB 1IIRA 1MRZA 1JEJA 1DCMA 1D9XA 3MRTA 4G07A 2Q9CA 3EFHA 3AETA 2VTKA 1C1DA 3A4MA 2HMAA 3ROMA 3G0CA 1V1JA 1OA1A 2AXQA 4G5XA 4XI9A 1RWBA 4N5DA 4G4SP 3ZHUA 3G7UA 2R66A 2C1XA 4HX9A 5HZKA 2YOHA 2XUIA 2F62A 3QU2A 3VDMA 4DV1B 1P1CA 1E8NA 3ZY5A 3KK0A 1JLLA 1UBGA 3V4ZA 3EGDA 3M6XA 5DNAA 3P7MA 4MVWA 1M10A 4ZKDA 4FFVA 2YRFA 1ZHHA 4UMFA 1RJ9B 4U3JB 3QWFA 4GX1A 4TV8A 4BNHA 3HSSA 4ZCSA 2N75A 4IGKA 2YW9A 4LMRA 3SHOA 4MGIR 1VB3A 4CC6A 1B6TA 1VJDA 2AWNA 2X8JB 3RIHA 3ZWVA 4JUFA 4RHEA 1P1RA 1JDSA 2H92A 3EIXA 3H8WA 4W8HA 1FZTA 2PGIA 4Z0PA 3CSSA 2IE0A 3CX3A 3OKCA 3TRIA 4P35A 1KT8A 2NSHA 2O2HA 3PI6A 5T6BA 4BGIA 2C78A 2ON6A 4O7SA 1CQXA 1DINA 1MEEA 2A0KA 3LVBA 5TGTA 3T7JA 3TI7A 2N1MA 3A9RA 1Y8CA 5E2BA 5FF9A 1RHRA 5KYXA 1G9XA 3LYAA 4EYQA 1XJQA 1M8KA 3E2PA 1QIIA 1SBQA 1G8FA 1X7HA 2R6HA 4BX8A 3OOHA 3TCNA 4IZOA 4BKQA 1GNPA 3EXHB 3OESA 5HIIA 1VE9A 1KI8A 2CGEA 2SBTA 2GASA 3E0QA 4KNVA 4MRRA 4OD0A 5BNZA 4FDLA 3N2YA 1T2CA 3FW1A 3ZS8A 1V5GA 4PU0A 1QU3A 3VNQA 3KSZO 1PJ3A 4CL0A 1KK2A 5AKEA 1DAFA 4M53A 3QFHA 3GY0A 3KTOA 1QUFA 1I7PA 3K94A 1I7DA 4EG5A 1KK1A 1M1UA 1NMSA 1PJQA 2JKZA 2VHTA 3PUHA 2DVMA 4HEHA 4XE5A 1YB6A 2DPXA 1J21A 3ESAA 3QXJA 1RHJA 4ZU6X 3NYQA 3RVRA 2KPOA 2H54A 3HCBA 3PCRB 2JCXA 1JAHA 4HL6A 3RVKA 5KNBH 5IHPA 1NC1A 4RMIA 5H9VA 1SA0A 2HAEA 2XD4A 4B3MB 1J1ZA 1D8TA 4DR3B 1XRLA 4M8KA 1FP1D 4RELA 3OPVA 3T9DA 1Z08A 4INJA 3T94A 1Q15A 5I4IA 1C2TA 2HU2A 3LKDA 2GJ4A 3QUQA 5T67A 2F1KA 3S1AB 4CE6A 2RGAA 1EK2A 2PRJA 1U9IA 3LGAA 1ZEJA 4MRPA 4IVNA 4OA8A 3VH4A 2OV6A 4EA9A 4EI7A 2WQ6A 1ML4A 4Z1MD 1XAHA 1TO6A 4W5TA 2YZMA 4IQ0A 5FOVA 4E0BA 2G40A 3CRNA 1Y42X 4L3WA 3C1TA 2PKCA 5D01A 4O2LA 2EGHA 1CY4A 1J90A 1TT7A 4YMGA 1E9AA 2GA8A 5DGDA 5KBYA 3UWSA 1IZ9A 3KTFA 4CEJB 2CLDX 4TYWA 2YW2A 4OUDB 2ZDGA 1GXSA 2FEWB 2BZ0A 5K3AA 1E64A 3BG5A 2LZ0A 3EA5A 1G4HA 1OGIA 5L51A 4NJEA 3LUBA 3KS9A 3VJKA 3FLEA 1M72A 2ZRMA 1W75A 1C1DB 3AETB 3W04A 4FW9A 4B3CA 3LVQE 1R8SA 1SUAA 2ODNA 4JJIA 3JWJA 4RACA 3TDKA 3KUXA 3Q3IA 3NUGA 1JDPA 4J7CA 1WL8A 1MA0A 1NNSA 1VG9B 2XDQA 4W1QA 2QVYX 2YYSA 5BSFA 1KDPA 1JLLB 3ABSB 3EGDB 4OB8A 3RWBA 4FLMA 4JQSA 1G8PA 4AMYA 4F4HA 5TX7A 1VPTA 2FEOA 5G1NA 5B2EA 4TV8B 2M2IA 4FUQA 4HDMA 4J91A 3C6BA 1JHAA 2I22A 2FFRA 3UYKA 4BP1A 2IF0A 2EWMA 5I7SA 2KYRA 3LWZA 3A2KA 4MVCA 4B33A 4ZGBA 1KARA 4UE6A 5C8YA 1NY5A 4WADA 3TQQA 4BFXA 4A92A 5I4KA 4PYQA 5JY6A 2P0EA 2EFCB 3VKUA 1AGXA 1WZCA 1KMMA 2CLFB 2TRSB 2YVLA 2UXCB 3ZC3A 4D3ZA 1V4VA 3CF4A 1DBWA 3V4SA 4FMDB 1LS6A 4FYPA 2YCBA 3Q15C 3LPCA 5BR1A 3SM3A 5HGXA 5KYXB 5AVUA 1MC1A 2C9CA 2V03A 4II7A 5ALFA 4UEQA 1L4MA 2VK1A 3ETDA 2CCJA 3MCZA 4JWTA 4IWXA 5J4KA 3IEXA 1STOA 1ZNQO 3BFKA 2OFPA 1KVQA 4RFVA 1SBHA 2A1TS 1RJDA 3JWEA 4V3BA 4O7TA 4RVNA 2WWWA 2O1WA 1KDRA 3RC1A 1JDTA 1OV4A 2EC5A 1RVV1 3DO8A 5ALZA 2OKCA 1GPKA 2RARA 5HGJA 1MH1A 1WP9A 2C61A 1WXHA 4B2PA 4KIGA 5BR8B 1GQRA 3EMBA 3TW6A 5FQOA 1RC0A 2WI8A 1SR8A 3HXQA 3IV7A 5GONB 5IHXA 1BA3A 2PR7A 3WQHA 3UFXA 4DNFA 1JIQA 2GBPA 3BC1A 4WKCA 3CZMA 4YK7A 4NVRA 5T57A 2VP3A 5D1PA 2HJHA 4IMIB 4N7RA 4WAUA 3VR6D 2O54A 3GRKA 2HIXA 1JQLB 3DV0A 1OI7A 1JALA 3P2OA 2R65A 2WD7A 1SA0B 2A5DA 3HVRA 2PRSA 1JE1A 3OE4A 9ATCA 4WHXA 3ZBQA 5IVPA 3UF0A 5F9MA 2E85A 1HE2A 2R97A 3D7SA 3H4MA 3HCDA 4QNMA 2V0CA 2GK6A 2XGGA 2PBRA 3BX1A 4A91A 3IMGA 3WK9A 5LU8A 1KAMA 1BHQ1 3GIDA 4PLTA 2NO4A 5HOQA 1F8GA 1NUSA 2Z2IA 4PO1A 5EE1A 3W5CA 2ZYIA 2PUWA 3B1JA 2C9DA 1O5IA 3OQBA 5KVQA 1LV7A 3QOWA 1HTBA 2DUNA 2PEZA 4AF7A 3IVAA 521PA 4C88A 3D1JA 1CR2A 1ARZA 1E99A 3W6ZA 1KAEA 2YFYA 4EHAA 2FGJA 4KNWA 3E9ZA 5T41A 3WLOA 2ZI5A 2H1CA 4C0HA 2BIFA 3BH7A 3N05A 4TOIA 5DGTA 4F04A 3H99A 2EATA 3BWCA 4PPQA 5CG1A 1IN7A 5EIBC 2ZPAA 3GUHA 2NU6A 1HETA 2ZRLA 3RBVA 4NJEB 3LRTA 3W2GA 5CA1B 2QG9A 5FPSA 4HGPA 4P5EA 4OM8A 4O4LF 2QT1A 4FGWA 4UVIA 3QKIA 4X92A 1AQNA 5DM4A 2QVBA 3OCYA 2XDQB 3L82B 3N76A 1N2HA 2P1DA 4ZT6A 1BOFA 2H1LA 4GBMA 4HH3C 2QYHA 3NKFA 3ZTTA 4R3NA 1XA4A 1OBCA 2VCEA 3E3AA 4UD6A 4RH1A 4H0FA 5TQ0A 3PNMA 4J0EA 5DYTA 1GU0A 3E3LA 4HDMB 5A1TA 2BMEA 2NNLD 2J6HA 3B6JA 1MO2A 2MSDB 3LW8A 3EGOA 1JYSA 2NVUA 4KSBA 4KH1A 3G7SA 4LHSA 2IZZA 4OQZA 5C8YB 1FS5A 5CDTA 2P6UA 2OY0A 1POWA 2WTBA 2BH2A 2UXDB 5IULC 2X0RA 2HSDA 5G0SA 3AR2A 4XGIA 3P0JA 5EPUA 2WFZA 4KJXA 1P6QA 1GZ6A 3KXLA 4J29A 2ROQA 3LM8A 3MJTA 2EKDA 5D87A 2XYPA 1C8VB 4L5YA 5CGZA 3ER8A 4BL5A 1M6VA 4I3FA 5AI9A 1EIWA 1A76A 1KYVA 1X39A 1R5OA 3H9QA 4UM9D 4W1SA 5CVVA 3V46A 2FSVA 1ET0A 1NJSA 4JN6B 4LXQA 2UYGA 3ROKA 2ZWIA 2GPYA 2CJXA 3U7GA 1BKDR 4B3DA 2P6PA 4KXNA 1TKAA 4NOJA 1TVEA 1WB4A 1N5KA 1TT5A 1EP2B 1IM2A 2NPOA 1JHUA 3AWDA 3U0VA 3W79A 4QELA 1EVIA 3DB1A 4LBVA 1Q91A 4RVDA 2OE2A 4IOMA 1HQYE 1KEEA 1CUZA 1HC7A 2R00C 3S8MA 3G2JA 2I6TA 1BKSB 3BT7A 4R2WA 3A1UA 3HUEA 3UFXB 1NMXA 3K0CA 4MV3A 1J9EA 1YMVA 1PTKA 1G20E 2QTRA 3LH5A 3NT5A 4HAOA 3I0ZA 2I1VB 2VDRB 5DLDA 3ZIAD 3TKAA 1SY7A 3DV0B 3CG4A 2E1RA 2EWVA 3FY4A 5AK4A 4PQYA 2YQ5A 4YCDA 4HEJA 4L6CA 2H4JA 4MQLA 3CIOA 1BWRA 1MR3F 3KJEA 3CA8A 4KQWA 4IG4A 1WB6A 3HHPA 1H2AS 2D2FA 5H4GA 1GY8A 3Q1KA 2P2CA 3H04A 3QKSA 1V6CA 4LJ4A 1KKUA 2L42A 3GFFA 3RC7A 3QEKA 5AVVA 4Q34A 3IMCA 1T3SA 3VU1A 8ATCA 2BYTA 1GNLA 1PR6A 3BA9A 3CRW1 4OXNA 4DLZA 1MVLA 2ZSAA 1BDMA 4FILA 1PX2A 2K2QB 2DKOA 3M1IA 121PA 5HBRA 3HRHA 4KN5A 3FYUB 3G02A 3AG6A 2HUPA 2Q4EA 4F3RA 5JUWA 1ZISA 2R6R1 1FC0A 1N32B 3F3YA 3VVLA 1N2EA 2P4SA 4L8YA 2OVBA 3FF4A 3PNYA 3OZSA 4KO4S 2IS4A 1KOLA 2QL6A 1TEZA 1BEZA 4AP5A 1RQ2A 1YHYA 2NU6B 1ML3A 4D4LA 1W1IA 1MX9A 2IEBA 1U0JA 2PMFA 3UICA 1ZRMA 1RPJA 2DM6A 3WLTA 3GEHA 4KI0A 4OQEA 2J3IA 4KXQA 3WGQA 1JR3E 2FN3A 2Q3JA 3ZZ0A 5F7OA 2YV1A 2V7TA 3ND8A 3GBPA 3AFHA 1OWMA 5LB4A 1XC7A 1Y37A 1R6DA 1A5BB 4UU0A 2VUUA 1ZC3A 1Q92A 3LLCA 1BFKA 4JI2B 5IJXA 5IAAA 2Z58A 1KE2A 2VYNA 2I6SA 1XXHA 1T36B 5LIRA 2GEJA 5TQ0B 5DW0A 3OU2A 3ZE1B 5K4HA 1C7IA 2ENUA 5I8ZA 2QMEA 5DO9A 4G5GA 2JCYA 4GICA 2FHPA 1XDGA 4PXSA 3HS3A 5TMBA 2NVUB 4CL8A 2CV1A 4P86A 1V8DA 1KQ3A 3DZJA 1R1DA 1O4WA 2ZBEA 3KKPA 3TY9A 2BTOA 2PX2A 4KLAA 3HEAA 5EI5A 4IHQA 1PFVA 1VKRA 3H1TA 3E5MA 4Y9RA 2ACWA 2QVCA 4RABA 5JD5A 2BPOA 1W9HA 2HFKA 3KB6A 2XJ9A 2YXLA 3WDLA 2PK3A 5AI0A 2I34A 5IP5A 1KTIA 3C4JA 1CX9B 1VPWA 2CDCA 2HHFA 3PC7A 1M6VB 1NQTA 2Z2KA 5TC4A 1IG3A 3CUKA 2IUYA 3DVSX 3C5VA 1FXSA 3PIDA 2IF2A 3DGFC 3O9ZA 4HSGA 1I4EB 3TUIC 2W8BB 4EJSA 3JYNA 2ECKA 1C9DB 4X93A 1E1QD 2DJ5A 4EFEA 5THKA 4JR2A 5BXQC 4OLJA 3WKCA 4CCYA 1TT5B 2HKIA 4K9MA 1Z6XA 4XLTA 1G3IA 5HHTA 2O8CA 1CNFA 1L7EA 2WMOB 5EJFA 2C2MA 5E7JA 2Z6AA 2JIPA 1FXUA 1KEEB 5BWBA 3PR3A 4FE3A 3PL5A 1U4OA 4QXAA 2IW3A 2WUFA 4LHEA 1KC3A 4AJ9A 5ARBA 5JLAA 2AXPA 2CVPA 2FN8A 1T2DA 5IVIA 5JWHA 4WY5A 3WYCA 2QROA 5KU1A 1H85A 3CUUA 3E84A 3RV4A 4R16A 2WAOA 1A8IA 3H1EA 4LMBA 4DMCA 1OIXA 3IKJA 2Y0PA 3NONA 2R85A 4UXJA 1G2WA 4N5HX 5GGXA 2HU5A 3WGMA 5I9LA 3LZCA 1Z4MA 3CRRA 4L08A 3VX3A 2RBEA 3NTOA 3N6VA 3TZCA 1J22A 4TUYF 2CFIA 2W8ZA 1BVYF 2MMGA 4GECA 4R7ZA 3QKSB 1VCIA 5ANRB 2VDQB 1P6UA 3IXLA 3GA7A 3PNLA 4J0DA 4O5AA 4I9HA 3REFA 2AQ8A 3TLKA 4ANFA 1E5VA 1Q83A 1QORA 2AK3A 5NLLA 1XMSA 1M1YE 1ZINA 1N7IA 1Q20A 2AFHA 2G07A 2VWGA 3JZDA 4ND8A 1TCUA 4UUQA 1P2BA 1A9QA 3DHWC 1PUXA 4KGDA 4BMOB 1A9YA 3V6MA 3A27A 3PHIA 3I5UA 5HBRB 5E95A 3SIWA 3HMQA 3M83A 3ZX5A 3OQMA 1LVHA 2K7FA 2LNDA 4UNIA 2I6XA 1CJSA 3G2LA 4GF5A 1IMJA 3SC2A 1RYHA 1A5AB 2AL7A 2HLDA 2ICAA 5BUCA 3V8NA 2HBYA 5B58C 4UEWA 4OQQA 3CNHA 4LY6A 3RAEC 4QGGA 3P9CA 4AUMA 4AROA 3HB5X 1P33A 5EMJA 3C14C 4HVLA 3GLFA 1N6PA 1AKRA 1W96A 3FPEA 4G4SO 4Y6PA 1Y7IA 3C8UA 1SUDA 1UT5A 2YWFA 4JJ6A 4W5JA 3GELA 3U49A 4BNLA 1N8SA 1LZKA 1EK1A 3NHRA 4NH4A 1XAIA 3RS5A 5H9WA 1ID8A 5HA5A 1ID1A 1UFKA 1Z22A 1ZJ4A 1JEQA 4FFDA 2QN9A 1MG0A 2F7SA 3TTTA 2OBFA 3VHLB 1I1MA 2GVZC 1TF5A 4XM1A 3X3HA 1IZYA 3OT5A 1I1NA 1VBGA 4BO9A 1XXHB 5AM3A 2ATCA 3GLUA 1MJGM 3LYLA 4R7GA 2ZXUA 1Z39A 2ANCA 3I9JA 4NULA 4HDSA 4MR9B 2DXIA 4XDGA 1DOAA 2IZ1A 1A8UA 1RPAA 2HPVA 4HAZA 2YHBA 4Q7KA 4DTCA 3RJMA 1QHGA 1G5IA 4RH0A 5CVUA 1T5DX 5AM0A 4Z7NB 4DMKA 1P0IA 5BYKA 4WJLA 2PWAA 5BSEA 4F2WA 1IXRC 3EVGA 1UFVA 1KSHA 1X13A 1OZ0A 2IYQA 2YIJA 5E2AA 4LDJA 2IYOA 2ZIAA 4Y6SA 2NSLA 4AO6A 2HHFB 1I0ZA 1Z13A 3MWYW 5FR2A 4DQUA 2ZSEA 2P8JA 3PRHA 4PSCA 4F38A 2Q2NA 4EJSB 2YV2A 5FBQB 1A3CA 4UHJA 4DIMA 5LWHA 4C5CA 4FYKA 2CB0A 2YHUA 5JI2E 4MOWA 4EUFA 1RP7A 2W98A 1H1TA 2VJBA 2O8CB 2EJCA 4F7DA 1EXMA 2A9OA 4QICA 3TEFA 3U3MA 4YPVA 3EX7C 5E1MA 4AO8A 2GD6A 1OAOC 1E2EA 1HT3A 3A2NA 3B3GA 4QXQA 5CAEA 4GS5A 4A8JC 3FCCA 1FDVA 1OXBB 5AVQA 4LTDA 3S8YA 3F6CA 1U3GA 1O95A 2ZSKA 3AK4A 3CRQA 4KUHA 4BNGA 2EVWX 1N25A 2DC1A 4BB0A 3RGGA 1Z4PX 4U0JA 3TLXA 3Q7RA 4MUHA 3TX6A 1YA6A 2W6ZA 1Z0IA 2QZ9A 3EH1A 2FEKA 1HLFA 5DHAA 5TGZA 4AN4A 4CIDA 1ZS9A 1YIOA 2GRAA 3BD9A 4LCJA 5THQA 2Q3CA 3UVEA 2W4MA 3KR1A 4C9BA 2OQ2A 3AESB 2VI5A 4CMGA 5C18A 1S2OA 1FDTA 2JH9A 3AILA 1KK0A 1Z5ZA 4ND8B 1X2BA 2AFHB 4HWSA 3V6LA 4H1WA 2W0SA 3CPHA 3SZGA 5G41A 2OHFA 1KZYC 5ADWA 2V0GA 1R0RE 3GJ8A 3RUIA 5LPNA 2C7PA 4GI2A 1YRYE 1HURA 4IL5A 3MRVA 1FX0A 3GUCA 4HX5A 2VP9A 2G9NA 3CEMA 3SC2B 5BURA 3OZGA 4U63A 3HDYA 1DC7A 4F97A 4RTJA 4DZRA 3G88A 1PR1A 3CRMA 1Y80A 4EKGA 1OHHA 2NXNA 4QU5A 3GLFB 1CVLA 3QHQA 4LF6B 3HA2A 4RJTA 1P2FA 3OTHA 2JD0A 1D07A 2WJ6A 1ZRSA 3WNZA 2QMZA 3ESQA 3GJ4A 3HN2A 3ZE8A 4UE2A 3A58B 3F2VA 3RR5A 1ACLA 2P4EA 4KIJA 3S29A 1JEQB 1Y5NA 1PKXA 4B76A 4ZCMA 3UUGA 5JZVA 2UZAA 5CYGA 4CLRB 4NXMB 1B3RA 1GQSA 4UASA 1YCHA 4YS6A 1YA8A 4PWZA 5E3HA 1MORA 2CMDA 2Q2TA 4KMMA 2J7PA 4L8GA 4YI5A 3OWXA 1WTCA 1TA4A 1Z6PA 2IC5A 3MMXA 2AC7A 4GZMA 3ZS9A 2QNIA 3HKCA 4DLWA 1DXHA 1C7RA 1F8FA 1U8YA 2G1UA 2BM1A 3G0IA 3DEZA 1MAUA 4KYUA 4NPAA 5CX1B 5BPHA 4EMTA 4O08A 5F2EA 3RTGA 5BN3A 3SR4A 4X45A 2G83A 1P81A 2P6OA 1KVSA 4Y1FA 3VYSB 1G1MA 2HADA 3X1XA 1J2JA 3ROGA 3ZCVA 4C43A 2DEUA 1Y5LA 2JZNA 1CUAA 4LGYA 3NGLA 1DRWA 2WM2A 3PUVA 4GR9A 2EBWA 1P7VA 2YMPA 1OUMA 3VI4B 4PXAA 2VOEA 3O83A 5DM2A 1VI5A 4JYPA 5ADVA 4AI6A 1ZR4A 2BMFA 3DAGA 5ECWA 4PAQA 3NV7A 4HJXA 4ITRC 4DLVA 2QRKA 2UZIR 3C6XA 2P68A 5C8XA 3PDCA 5KVVA 4DLUA 3K9CA 5DHUA 4K2HA 4E6NA 2DHRA 1O5OA 4MKIA 5JZ9A 4M1YA 5DGIA 2IHKA 2XE7A 3GH1A 4CM6A 2AF4C 3ZWXA 4UDYX 4E46A 1XN4A 3DDOA 1M1ZA 3P97A 3Q8WA 1JJAA 2C57A 3N7AA 4J2TA 3D3JA 2LDXA 3I6YA 3V55A 4E30A 1DBIA 1L4BA 2BMWA 3L06A 1Z74A 1U3CA 2UYYA 2WVHA 3E5HA 1I01A 4QE3A 4TM8A 2QX4A 5JQWA 3ZZ1A 1XTKA 1ZVJA 2FSPA 1QIJA 1Z6ZA 5LDGA 1O5TA 3KPYA 3NCTA 2IP4A 2NTVA 5JSKA 2WVGA 2YV4A 4LDNA 4MUXA 4WZBA 1D04A 4MS1B 1GKIA 3N86A 4NECA 5J1SB 1PS8A 1U1DA 1YVDA 2I8AA 3BZBA 4BN0A 2BBWA 3AP2A 1FRFS 1JYFA 1RW4A 3NYRA 4HUQA 3T5TA 1W4RA 1IN1A 3EGCA 4XM2A 2QVZX 3WMRA 1VPEA 3EPRA 4RQTA 4C6RA 2H59A 5KNCA 2FJUA 3N39C 1KGSA 3KJGA 1VKZA 1HL7A 1KH3A 5FR9A 2FZLA 4OBBA 4TMYA 4EO9A 1QFMA 5GINE 1YZGA 3PL1A 1O77A 4PGMA 4BEVA 5J2UF 4PAMA 1UJNA 5BUSA 5MF6A 3PXAA 4GMKA 1GZUA 2R25B 3KEQA 2GPBA 3K9QO 4Z3KA 3RT1A 2V45A 2AW5A 1RLJA 3L79A 3FCAA 1Z18A 3AUKA 2BGWA 3C6QA 2NUPA 4M6WA 4LDRA 3GOQA 3NH9A 4NU0A 2W58A 3G17A 3T5BA 2AG1A 4EB8A 2X7XA 2J08A 1ESNA 4EA6A 4HNAB 4A5SA 4AY2A 2VTDA 4PC3A 1Q0TA 2B99A 3FTCA 1PQ4A 5A3SA 4Y0VA 2QE7D 4MR8A 4C7MA 5CT8A 4JZYA 5LQMA 2B2CA 1K63A 2QL5A 3FWZA 2RCYA 1G3RA 3C98A 3EGXA 1IZ7A 3SP1A 4PAOA 2E49A 3GGGA 4JXJA 3I2YX 2BHLA 2OD7A 5KCMA 5AW0A 4QTYA 3HDVA 2LR0A 1KERA 2P9ZA 1EM8A 2O8VA 3C7CB 2EKQA 5D2CA 4N01A 5E7IA 3DLIA 3UO8B 3HKCB 4KZKA 1DAPA 4E5SA 3FOEC 4CBVA 3AKCA 1UKCA 3GLSA 4XAQA 2BUAA 2XTAA 5K3DA 2FDCA 5BN3B 1OWNA 3U4CA 1GG5A 1U1EA 1W581 2XV1A 3GD5A 4OFBA 3W4KA 1I24A 4C7BA 3VH2A 4FB5A 1N1EA 3CO5A 3C7TA 2D0IA 4OOFA 5I4CA 4ZREA 4UQPA 3L4KA 2Z5VA 3BM5A 3JQ8A 1XA3A 3DJYA 3J81A 2CVOA 3E7DA 3RYCB 3ESDA 1T2AA 2ZIGA 3CB4A 3FTQA 2VSXA 5DNCA 4BJ3A 3VZDA 4F21A 5LKAA 2Q41A 3EG9A 1X3SA 2VT7A 5J58A 2YMQA 1E6KA 2OFOA 5HK9A 2HA2A 1DJPA 5CLLA 2GN8A 2HMTA 3N9IA 4Y0NA 1TCAA 4XVUA 4EYKA 2PIDA 5IMSA 3L6CA 2KSQA 1H1LB 3EUWA 3GDGA 5FL7D 5JHGB 3JQGA 1BXGA 1UMBA 2H65A 2OGZA 1RAAA 4JL6A 5TEWA 3RSSA 2EFEB 4L28A 3V5NA 2D5AA 4B7XA 4EPYA 1WD7A 2C00A 2VRBA 1NXSA 4CIVA 1L1QA 4A73A 4Y6OA 4Q4CA 4WZBB 4F6CA 3CBQA 4BBPA 4CMBA 5AJYA 2BUCA 4MV1A 1B0UA 1UK6A 1XE3A 2G70A 3HEBA 4PICA 2NSYA 3DBLA 4QFMA 1LPSA 3UJHA 4C87A 2O2IA 4P31A 2B4TO 3FHOA 1SBNE 2IUFA 2P5TB 3PFKA 3OQ1A 4J6FA 1YIDA 3OCJA 1WMAA 2VEOA 3IQEA 2NW6A 4XQ0A 1ULAA 3RKUA 4AXBA 5LDHA 3OTGA 5DT2A 2VRWA 3D6TB 4CG2A 5I48A 1A88A 4O83A 5KKNB 1YOVB 3K9BA 4TM7A 1YC2A 2HT6A 4UMVA 2H2GA 3ONNA 1KEUA 5CM2Z 2QRMA 4XWTA 3JQEA 3ELYA 3NDPA 4RCZA 1PT8A 3HNPA 4L72A 2ORYA 4I5IA 4H7IA 3QEAZ 1X19A 1Z4OA 2NUPB 4M6WB 4GOJA 4OSOA 4YFYA 4URXR 3U6KA 1NX6A 3QJYA 4DV5B 2OYSA 3R5SA 5EIHA 3BWVA 3ESBA 3EEFA 1YTUA 2CLKB 2RHHA 1IQPA 4N40A 2F4VB 1A0GA 2NSJA 3A8TA 4MI9A 4Q4HA 5FUVA 5J5CA 2IOFA 3WISA 3HI4A 4R1LA 5K0LA 3WWCA 1VE1A 2IYTA 3P96A 3U3KA 4EKNB 3DFMA 3PDUA 3AQIA 4YCAA 4U2GA 1SK8A 2B7CA 3QLEA 5ERGB 3EGXB 4RXMA 4BNIA 5DSXA 1F7UA 3VKWA 4ZCQA 1SZCA 3CF2A 3CSUA 3DW1X 3P0FA 5GGYA 4COKA 2WQ7A 3IJ5A 3QNUA 1C8KA 5BOSA 3ANXA 1EM8B 5JAMA 1HMPA 3ND7A 1QFZA 2AHRA 3KFLA 3PUWA 3EQZA 4EAAA 3RS4A 2HK6A 2CNWD 3MQ2A 5EJMA 2WP0A 3N8DA 3ETNA 2GM3A 4ODIA 1L8OA 4CE5A 4KCGA 2DR3A 2JLBA 3HUTA 1KNQA 3ND9A 3TGPA 2VSOA 1DARA 1WVIA 2Q8QA 3L6DA 4QHSA 4W7IA 1KE1A 1DZIA 4ALNA 2FHSA 4X8HA 5KC9A 2J87A 1FXWF 3VVMA 4D02A 2IUEA 2O9JA 1NRJB 1P1KA 2C2OA 4INZA 4IWNA 3HC7A 3JQ8B 4I1YA 3ZHSA 3I9OA 4AKEA 5C4MA 4QOJA 5JCZA 2RIRA 3S27A 4LJRA 4U00A 2JHFA 3HVJA 2QDKA 2YY6A 1QPBA 3FVRA 3L04A 3KP1A 4QLOA 5ES3A 1XVAA 2E4UA 4LRYA 5D86A 4HOYA 1FE8A 3EMDA 3EG9B 4HB0A 4LTNA 4BV2A 1YWGO 1GFIA 1KOFA 2DYKA 1C4OA 3WGUA 1JG2A 4PNPA 2A94A 3L6RA 3W5IA 3SVLA 4G09A 1XNJA 2Y71A 3PKIA 1O0CA 1MJFA 2YX1A 5EA2A 3N8IA 3UUEA 5DZSA 4EENA 5J4LA 1ZITA 3UZOA 2Q5LA 2HEIA 3K9HA 2WTEA 1SKQA 5COQA 3JQGB 1BXGB 1UMBB 3QHPA 4R5MA 1DJLA 1GL9B 2WVJA 2Z4TA 1OBOA 4LIPD 2CK3A 5K3SA 4EHIA 5JR3A 2IYFA 5BN5A 3WLPA 4JDUA 1JPUA 3NS7A 2KBFA 1ODFA 3OHPA 4LYYA 4E51A 1EVJA 5C3UA 2PKYX 4LV8B 1HBJA 2DULA 3BD7A 2YOGA 3DBLB 4NHEA 1HNXB 4MYUA 3VDQA 4ETWA 2IXBA 1XWWA 3RARA 3AGPA 1YDGA 4HH4A 4GQAA 4IYJA 1QIHA 4MQEB 3V7WA 2QM8A 3JASA 3Q7SA 1R12A 1Z8HA 4UEOA 3PD7A 1MCZA 4PG5A 4N49A 2MSNA 4KAXA 4ZP1A 5JI3E 1N4AA 5JDCA 3RVQA 2DHCA 2VDVE 3G2KA 3WIVA 4BGEA 2XYVA 4U2DA 1NLFA 1XYYA 1WEKA 4L95C 2JL1A 4OU4A 1UZAA 2X1LA 3GVPA 3L0CA 4E2YA 2EGGA 3H4IA 1ZMOA 4KTTE 3N8NA 1F20A 1XCJA 3EZ6A 4Y2YA 5AXBA 1C14A 4BWGA 4EW2A 5JYBA 5LVAA 3QFCA 1JWLA 1QHYA 2I4IA 1PBNA 4C1BA 3HXKA 4MPJA 5TPZD 4O63O 2CVHA 2C07A 2GBFA 3LAWA 4GEKA 4QDUA 1K3UB 1U90A 1OH6A 1GPDG 1ORDA 3A28A 2GPWA 4ZVOA 4CT0A 5A3QA 1TIPA 4BGUA 2BZGA 2ZPTX 3SZMA 3N5KA 2PLAA 2QY6A 4NAVA 3YASA 4I5EA 1L5NA 2NYAA 4O2AF 1P1HA 2JLXA 3LIIA 3EIOA 1Z6GA 2I76A 5ALXA 3VOBA 3GN1A 3ZDFA 3WAKA 2Q4RA 3CWCA 4YRZA 4G5RA 5ALQA 2Y1XA 2JAPA 2OHVA 1U0EA 2FE1A 2ODEA 3P8ZA 4PZ9A 4E94A 4IXMA 1PLLA 4XQGA 3L1JA 2FV8A 1YA4A 2A5FA 3NTQA 4XQEA 1SG6A 3EEBA 4D9MA 5DP2A 4EUKA 1IHDA 1TK9A 4CMJA 2Y9PB 4MW6A 1RQGA 2ZSFA 3E5RA 3TLCA 4K2AA 4FYWA 3AUXA 3JWPA 1EQUA 2IYLD 2JAXA 5TQJA 3WLMA 3X2SA 2ZANA 3V1MA 3CLTC 3JAMA 1KY5A 4YEDA 3UHAA 1XEWY 1TM5E 3IL2A 4M0UA 2IV2X 3SSMA 1EGMB 2OO7A 4JLOA 2V59A 1QP8A 3TXAA 3WA7A 2FOLA 2ZB3A 4MH0R 4BNWA 1QRSA 3LFTA 3KZVA 2GXAA 4KBFA 4HWTA 1X1CA 4Q47A 3AW8A 3B1VA 1KMCA 3NP7A 3HCFA 4MP6A 1YNOA 3BORA 4IUDS 2AMLA 4QUBA 2VZ8A 1L4UA 3IIMA 1EX7A 4JJAA 1UQTA 1CKNA 2HVQA 3R9WA 3G2MA 3RFCA 1VHWA 1TUEA 3A32A 1YS9A 4WBNA 1CUJA 3D4LA 1W7AA 5KX5F 4MGEA 2P35A 5GM2A 2PQ6A 3QZUA 1P4GA 2G8NA 3M6WA 2HF7A 4Y7CA 2P2NA 2X9GA 5CNKA 3G6KA 5D51S 2LD4A 5BN5B 3ZD6A 4FWIB 1CUVA 1VL6A 1IBSA 2P5SA 1AHHA 3I4LA 4G65A 4JR0A 4EX6A 3ZVKA 3U9TA 4YLYA 1LRJA 1B16A 5FUWA 4C7OA 1R8XA 2QT0A 1QLHA 2FLWA 5ECGC 4A2PA 4BBZA 4ZVQA 2I78A 3QPVA 1E96A 2PSSA 2P3LA 2GN1A 4BBAA 4DL9A 4IJ6A 1FNDA 1YR9A 2B78A 1K7SN 1M6EX 2B4RO 3GJ7A 2VHYA 4EFDA 1KJQA 1M75A 2GJAA 3NKLA 3P9RA 4ETMA 2J6BA 1EM6A 2GLUA 4WUVA 5LQAA 3A6LA 2QLLA 4HH1A 4CLEA 1TKRA 1T3LA 3V7UA 4CTJA 1YHNA 5BWWA 1IY9A 4IX1A 3HCOA 9MHTA 1F38A 5JANA 1PFQA 3SFZA 1NOIA 2O3SA 5AIAA 1YI8A 4D9EA 1JU3A 4WXEA 1VTKA 5DDIP 3UYLA 3V48A 4AMZA 1Z2PX 3VO1A 5K09A 3L7YA 3BL5A 2IOQA 4LK3A 1RSZA 3R3UA 4F5YA 3BJZA 1W52X 1WX1A 3ZXIA 3C5CA 3T5DA 4YT8A 3O2NA 2A7QA 1ZJYA 4Z1OA 1OBGA 4IZIA 2JVKA 5BWVA 3ANYB 4Y1RA 1C4WA 1EA7A 5J59A 4BATA 2YZNA 4EOGA 1VLZA 3UWMA 3NTXA 1B8OA 3CIFA 5K51A 4AWBA 4XJSA 3T5CA 4ESVA 2WUGA 3HGMA 1TQ6A 3E8SA 3IAM6 4OU5A 5LM3A 4IUBS 3ABZA 4Z7JA 1U94A 2CKDA 4Y6QA 2BLNA 5KVSA 4TVKA 9LDTA 4JOCA 2UU9B 5IZ4A 5AJHA 2PL5A 4ZYXA 4B09A 2J31A 3FVWA 1U3DA 2ORIA 2X5XA 3GL9A 4GUAA 4D0RA 4YRIA 3FMIA 5J23A 2H1RA 4ITUA 4KWEA 2PYIA 3MOGA 1SQ5A 1NDQA 3IJRA 3AEKA 4Z9XA 2C1EA 2Q5FA 2VAXA 3THYA 1NJ5A 3M5PA 1YGPA 2ECPA 4FFRA 2VUHB 1WAMA 1FFGA 2QUZA 1YBAA 3HFSA 3GR6A 4KXUA 1GZVA 3H9EO 3KJIA 5DEIA 2PKRA 4HT3B 4KWCA 1EIZA 5LR6A 3AV3A 3NUZA 4J2HA 3GCWA 2RB5A 4KQMA 3FSEA 1EHIA 1CNMA 1Z3IX 4Q1AA 4RV5A 4AJPA 2DKFA 4WBNB 1J5EB 1HOXA 2PLRA 4I9NA 2P6MA 2XMBA 3CLSC 1EESA 3JRWA 5IFKA 5BYBA 1K2VN 1LD3A 1KNXA 2QVGA 2WDPA 4OLFA 3ZK8A 5ELXA 2D1SA 2VBIA 1I7SB 3W3AD 1PGOA 3KLBA 4QYIA 1DAOA 1LDGA 1OGYA 4BV3A 2HJVA 4C7OB 1FSPA 3B51X 3STXA 4Z49A 1R3DA 4QNRA 4PYJA 1J33A 2PKQP 2G4CA 3THSA 1SNYA 3H8SA 4BJ1A 3EZFA 1X8LA 2QX9A 3HGTA 2OD2A 1U8UA 3K09C 5HOEA 3DC2A 4BLVA 2GILA 5KWIA 4DPKA 1SPXA 4LDZA 1B14A 4X8OA 4HEA6 5H3LA 4ND1A 4H9GA 2H08A 3H42B 5LIPA 1RCFA 3R23A 1E2UA 2SKCA 4I3HA 3Q7IA 2IT1A 2PRZA 4MI3A 5IBCA 4LZJA 4C6TA 1KQOA 4E2ZA 1QRAA 1FJ2A 1DOHA 4OI4A 2XNSA 4TLAA 4UCXA 2I3DA 3F5FA 4RSGA 1GTG1 4E4RA 1DADA 3NTLA 3ZBTA 3AHDA 1DPFA 4ZCTA 1SVMA 1H6AA 1JXOA 4OVKA 4AM8A 2BELA 2PX0A 3ZD8A 4CVNA 3SQDA 2XB8A 5K6RA 3NWBA 2F64A 3Q11A 3MW8A 1EXDA 2FCAA 3UOWA 1Z34A 2CYAA 3STHA 4ZVVA 1YT5A 1PU2A 2AG0A 1UKVY 1X7XA 2X2EA 3I9V6 2XRYA 3M81A 4TKUA 4Y1RB 5DW3A 1VXRA 4E5NA 4U6NA 5E25A 2CSUA 3T9CA 4HAXA 2AQKA 3ADPA 2D06A 4J90A 1G4AE 4PHGA 4WOKA 4C7XA 2OUKA 1UZMA 4JUBA 4UCQA 1N1MA 3BXOA 4I4IA 5AXDA 5IUNC 4WCVA 2VP4A 1RYZA 2P65A 4JX9A 1CEQA 1ZEMA 2FPLA 2J6CA 3HL4A 4ZVKA 1SKBA 3O4GA 3OHMA 1UXIA 5LP6C 4DLTA 3BCSA 2WIDA 2YWCA 2ZE7A 3GUZA 3VBCA 3WGHA 4GL2A 4EMSA 2FUG1 4R0VA 5JAPA 1F12A 4TSFA 4BNVA 1TI7A 2XUOA 4EB3A 1JT9A 1YDMA 4O82A 2HA7A 3C7DB 5FPPA 3V8BA 1K8ZB 5LLTA 5JH7F 1GAWA 1P5JA 2W2QA 5CA0B 2Q0HA 3OVMA 1DEHA 1PCXA 3LQ1A 2GD0A 4NY1A 3FJ1A 2UYQA 5K8JB 1IY8A 1O03A 1PIWA 2XGMA 4MB0A 2YZ7A 4RW0A 5ULLA 4B31A 4EG8A 3UBMA 3DDWA 2YC4C 5SICE 3QX8A 1XZCA 2X6QA 4NIMA 5JAUA 3ZI7A 4L27A 4BBJA 4GKVA 4CCWA 5BWUA 4RX1A 1T5HX 3KXKA 2A67A 2C8JA 4CFSA 3OQPA 1NULA 3COVA 3M6LA 4JFRA 5AVSA 1JILA 1U3WA 2P9GA 2XECA 3MUFA 1E6CA 2PWYA 2GM5A 2YVKA 1GLGA 2FW8A 3ABRB 4K46A 1G42A 3IKLA 5ILOA 1IYZA 1XPJA 4FFBA 1PWHA 5A3RA 4A2WA 4JI0B 1CSEE 4EVSA 1LQ2A 1KY4A 3CNEA 2VH1A 2HBQA 1TYEB 4QYIB 2BGIA 4W7HA 5KYYA 2J3JA 4FFMA 3CEAA 3CE6A 4YQZA 5JAIA 3CT6A 2DBVO 2AUTA 3L0ZA 4L3OA 3LSYA 2OO5A 2AKYA 2H8KA 4KYVA 4Q93A 3KBBA 5JRZA 3K32A 4J0CA 5KYVA 3IP5A 1EUQA 1R8YA 3D8NA 3H16A 3C3KA 1OB2A 1HORA 4PW0A 5F23A 2IY9A 3TSOA 2WU0A 1NVGA 5FDFA 4FR2A 3D5TA 5DCWA 4WGFA 4A2CA 4JBHA 4H7KA 4MJXA 4WESA 4EPTA 3I5XA 4GVPA 4C6TB 4C22A 1TQHA 1NVDA 5CVEA 1EKFA 4ZHQA 2G5CA 4REMA 2P2ZA 1FSGA 3EVNA 5HSGA 4BMCA 3SXPA 4TS4A 4BS9A 3ZWDA 3UJAA 1BNCA 2G36A 2PY6A 3H18A 5A5DA 4XEHA 1XI2A 3E3OA 2WT9A 2BSXA 2VRNA 2ZS9A 4M46A 3ME5A 4LECA 4H6PA 1V9PA 2KS6A 1CZRA 3S70A 4C20A 4RY8A 4OA5A 1HE3A 3M9XA 4TKUB 1X7XB 3IUYA 3IT0A 3QENA 2UUCB 1YRWA 3V7NA 3QKTA 1QGDA 2DB3A 1J8DA 3SICE 4HPWA 3SVZA 1JIUA 3IS3A 4G4GA 2CXQA 3E7WA 3T38A 3ZHBA 4B8WA 5KYYB 1BE0A 2JD1A 4CHIA 1Z28A 3NC0B 4ZN6A 3GQBA 4LF9B 2IXGA 3C3DA 4IVPA 1H8HA 5CYPA 5AM5A 3QFFA 4EP1A 1QIGA 3SDSA 3PYXA 4M7WA 4F06A 3GZ4A 2J45A 4I66A 1XN1A 3UA4A 1QTNA 1RHQA 4IVQA 4YGYA 4G0UA 4EW6A 5DIFA 2QXTA 1V0JA 3H5LA 2QT9A 5TR9A 1JBEA 1QNLA 3DF7A 3LFHA 3N59A 1PR2A 4MAMA 1LZLA 2B1JA 2JVJA 2O23A 3UG7A 4MQEA 5EP4A 3RHSA 1T5LA 1Y0BA 4DMLA 1JSZA 2VCYA 4P80A 1I3OA 3JQBC 4DCMA 2EFYA 3AVPA 4IVRA 1ZAUA 4DIEA 4TMWA 2ZJ2A 3TNFA 4L6IA 2DFPA 2J3QA 1X7WA 3U9LA 4BRWA 2D0OB 1UWCA 4V0OA 3VA7A 1IBCA 4MRMA 4EKYA 5BSKA 2COIA 2Q2VA 3DD1A 2YYAA 3C85A 3QQPA 3IBTA 3EWSA 4QATA 4AAYA 1KYTA 1FFYA 2HVRA 1QIDA 2OLKA 3QVGA 1JVSA 1IFXA 2WFLA 3DOIA 3MLBA 1Q7BA 4KPEC 4QUIA 5T8KC 4GNRA 5I60A 3G5MA 1VLMA 4MVJD 1AGNA 1J2TA 4IOKA 2J5XA 3VUEA 2Y0EA 3WI7A 2BMVA 2JRCA 4FFBB 2YN4A 2FPMA 2XX3A 2ZRKA 3DFIA 2Y66A 3SS8A 1KMHA 1A0OA 4DSTA 3MMSA 1XZ8A 3BIOA 3MPUA 5IVDA 4BB9A 4TV9F 1ZN2A 1TLFA 3DKPA 3FFTA 4TGLA 3W6NA 2GDJA 3BMXA 4BQQA 4PN7A 4YTEA 1T0UA 1C0KA 4EIWA 3GJXB 1LK5A 1ADGA 2VDWA 3EE6A 4KN8A 3DMYA 4L5CA 4NDAA 4OI1A 1US8A 3E9QA 5DLPA 4ZAFA 4D0NA 2YL2A 1KMNA 3AIKA 4O1MA 4P08A 1QMPA 4IWYA 3U4DA 2OKGA 3EFOA 5LQSA 2QOEA 1RAHA 1P2SA 2X58A 3AHEA 4CMCA 5L95A 1VGRA 5HQTA 1Y9AA 4GGMX 1RI2A 4WESB 3UBTA 5LYJA 3HXMA 3TINA 1DB3A 3Q0TA 3M6VA 2XMCA 2YHSA 5JBIA 2BHNA 2YDYA 4LE2A 4MW5A 1XVUA 4BX2A 3SQWA 2PWBA 3U3ZA 1P7WA 2G72A 5TMDA 2FF7A 2IXDA 4KQXA 4B5LA 5CTAA 1G8YA 5CVDA 2OBBA 5AW4A 4ZU3A 4WUTA 2FKNA 1IU9A 1FVFA 3JYOA 3A4LA 4FDVA 1FU4A 2XNDD 4HZGA 2TYSB 3GLTA 4MRVA 3A7EA 1MABA 1QWOA 2HGZA 4X60A 1SKMA 2Q3HA 2JNWA 1O9GA 3FMOB 5FFMA 3UY4A 3LI2A 2ZRCA 5AM2A 3JQ7B 3BVPA 4NH0A 4Y2UA 2IDZA 4K9RA 2L0XA 2XQJA 3HWSA 4W8OA 1QRUA 1Z2DA 1D3AA 4PRZA 5C35A 2GH1A 1NU6A 2H16A 1ZN7A 2J4CA 4NCNA 1RZ3A 2X15A 5GY7A 3UXMA 4OK5A 5JCJD 1YI0A 1QHSA 3DOCA 4EM6A 4DA9A 1AN0A 5LWQA 2X9NA 1PEDA 4HY3A 1TADA 4M55A 2ORVA 4PZYA 1F6BA 3JS5A 2FSIA 5HCNA 1L4GA 1P8LA 1USUA 4X8MA 2PUBA 4KFTA 4MO2A 4RZ3A 2BZSA 3ZNNA 3TIXB 1JX6A 2ZCUA 1XMXA 3HFGA 4DRXA 3L5KA 1EUZA 1AKYA 1EAYA 2B94A 1GWNA 2BFOA 2VHEA 1ZICA 2IX9A 3QY9A 5EWJB 3ZW8A 5K3CA 3NAGA 1ZCBA 2NT3A 2WYIA 3Q85A 4HO1X 3KXDA 4HTFA 4V02A 2EBFX 3I9LA 3LT0A 3CVYA 1HH4A 1N3YA 2BKXA 3C39A 3L1VA 2XH8A 1E1RA 3LCRA 3NUQA 3GLKA 3TI9A 4UHEA 4E6EA 2HBRA 2AE2A 1TW2A 1GNRA 3HZZA 3NAZA 3TLYA 1DJMA 1X7WB 3OQIA 1IEWA 2Y0BA 4NV1A 3SXUA 2ARKA 3WL5A 1P9OA 1TD1A 4RHXA 1BWQA 3PBKA 4M1QA 3RKSA 1F9EA 1NBME 1Z06A 3F5QA 3BL6A 1R0LA 1XJ0A 2JDIA 3AQ4A 4RK0A 1QYIA 4RJLA 4XD7A 1QIKA 3H05A 2RAPA 4BP3A 3Q7QA 1FB5A 4K1LA 5BV0A 1RBMA 3FPFA 4P3KA 5AOCA 3WGJA 3K7EA 4NFLA 3V2IA 1YZKA 5TQ2A 4RIGA 3PGXA 2RHGB 4OKSA 3IT3A 2GHQA 2NVWA 1VPDA 1XRJA 5I7RA 4U0KA 3QUSA 3UPDA 1HL3A 4MMXB 1VJ5A 4F45A 4OMDA 5ES4B 1IB6A 4ZYLA 3AV0B 3L93A 3V2HA 1G0OA 1B7GO 3B7WA 5CLIA 5AM1A 2EV9A 2P1ZA 3D4IA 3TKYA 3QWUA 5JRDS 1Y9DA 2X4DA 1GA1A 2POCA 2RI1A 4FFSA 2YXBA 1DBQA 4JSYA 3IUQA 5FI3A 3WLQA 2JIZA 3GUUA 1HTWA 1U7ZA 1RAGA 3VR5D 2IIPA 4R3UC 4Q9IA 1UEJA 3PEYA 4XIYA 3I72A 2BFMA 2HHCA 3WBJA 4V0ME 1M34A 1SUFA 3K9GA 4QUHA 1YE5A 2CNUA 3KT6A 1QMGA 4L0QA 3ET5A 4GLFA 4AUNA 3UJNA 1ZKMA 3HJBA 4ENTA 2Q1XA 1C81A 3M8KA 4L2IA 3ZJ5A 5CU7A 2VBFA 3D6HA 1ACMA 3ZE0B 1CUIA 4N47A 1QZUA 3WRXC 3ZHVA 2ZRAA 1PI3A 4TXMA 4MCHA 1RRKA 1V1RB 4TT3A 4GOKA 2QM0A 2GEBA 1TQ2A 4EJ0A 5IDXA 1FDUA 1LTKA 2P9YA 1B43A 1FOEB 1HSOA 4D4MA 4DG5A 2ERYA 2QGZA 4YP1A 1KO4A 1MDFA 3C3CA 3CURA 3FPCA 3MTIA 3ROPA 1VOTA 1RKQA 4JCCA 3UB4A 2NP7A 2IHVA 5E1OA 1K7FB 4Q3AA 2HCBA 2J85A 3R4CA 4RD4A 4BJ5A 2OORC 2YICA 2CXSA 1I2ZA 3JW8A 1C3XA 2GOYA 1JI0A 3NNNA 2XZLA 2O19A 3JATA 2VH5R 1I1KA 1BHO1 4IX9A 3LK6A 1W0KA 1TM1E 3DKRA 4UBJA 3QOYA 2H0QA 4S1NA 1YKFA 2VJOA 4P4LA 3WK4A 3PNVA 4II3A 1M6NA 2GJ8A 2HDKA 1DG1G 1Y5IA 3AMVA 1N8TA 3KE8A 3GRFA 4FT4A 4HTFB 4YXWD 3MWJA 5JMTA 2I2DA 2QSZA 4MPPA 2QU7A 1CR4A 3THWB 1FRZA 1TC2A 4MB6A 2YWVA 1TCCA 3TD9A 3TDMA 5TNXA 3OAAA 1S3FA 4URFA 1W5EA 2WLSA 1L3IA 2ZRNA 5CYFA 1ADJA 1P0QA 5EIOA 5FHRA 3HYSA 3OQIB 1Z45A 3IIIA 3JCZA 3K1YA 3TQFA 3RASA 3SXUB 2QUIA 4YQEA 1ZWKA 1LW7A 4JP5A 4B75A 4GKAA 3VR3D 2B6HA 3LYHA 3H87A 1B6RA 2AMJA 3BE8A 1POXA 3RSZA 1NBWB 1NVMB 4Q7MB 2Z9DA 3I2JA 1KGDA 2WU1A 4C05A 5EVJA 5M34A 1EP9A 1LLCA 2CLCX 3DSRA 3KVYA 2PH5A 4EFBA 4MLZA 2C2WA 2W37A 2QK4A 2AOXA 4JI3B 1RKUA 3B9QA 3FPSA 3HVKA 3L49A 5H80A 1Y7LA 3ORQA 2BKUA 3NHSA 1DIRA 1I2MA 3PJDA 4PF1A 2AZDA 5EZYA 1N78A 2IOYA 3TZHA 4KK4A 1PG2A 4PX2A 4KACA 1XTBA 3K8YA 1I9GA 5TQ2B 4ENSA 3BYZA 1I5RA 1DI0A 1RPZA 3R5JA 4P3YA 5JEDA 2YIMA 3LDGA 4PCLA 5C2JB 3N8HA 4NBLA 3AR3A 1S2GA 3TE7A 3B3QA 3CX7A 4UAVA 1MGPA 1IJKA 1WMFA 2CXHA 3QXXA 4JJFA 1ATIA 1DS6A 2ZJ6A 2R60A 2HK9A 2I2FA 3QJGA 4LX8A 2QZZA 4Z4CA 1P16A 3KFVA 4I9UA 2ZM5A 2ONZA 4WNCA 1Y8ZA 2V3VA 4QOSA 4HWRA 3ITNA 2C84A 3H11A 4OO3A 1EB9A 5BWLA 1Y1PA 4PBRA 5CXQA 1ZH0A 4BNKA 5IYZA 1M34B 2AYZA 2JFUA 3UH1A 4XIIA 5KWSA 2HEGA 5KU7A 4RSHA 4CPDA 1X6VA 4HMOA 3VI3B 3DBOB 3HPRA 2O8NA 3IGFA 2VJAA 3KZMA 1SVIA 1ZKDA 3GCGA 2HXGA 3U0GA 2NWQA 1TVKA 2ZUVA 4L4ZA 2P75A 4Y1GA 5E38A 4TTAA 2VZEA 3GYGA 2C77A 1N3IA