2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
2Z04A 3U54A 3U9TA 2OLSA 1A9XA 2YZNA 2YZGA 3TQTA 2R6FA 3MJFA 4DLKA 3ETHA 4HNVA 5CA1F 3AW8A 4QSHA 4MA0A 1WR2A 1JKJB 3RV3A 1M0TA 4O7LA 2YRXA 2VPQA 1OBGA 4EA9A 4WBNF 1KJJA 5LP6F 3VA7A 4EGJA 2C00A 5GONF 1DV1A 4HNTA 2YL2A 4O7ZA 4O83A 2CNUA 1W93A 1AUVA 5LXTF 4IHJF 4O2BF 3BSYA 5JQWA 3K3PA 3RUPA 3R9RA 2R82A 4ZQIA 4WD3A 1CQIB 5LA6F 3GIDA 1I7NA 3VMMA 2QF7A 2ZDQA 4YB8B 3MWDA 5CB4F 4IWYA 3KAJA 2V59A 4HNUA 3BFPA 5I47A 3Q2OA 1KUTA 2R7MA 3N8DA 4MV6A 2W6OA 2W6PA 2YYAA 1EZ1A 2DZDA 1GGOA 3LP8A 5LYJF 2CNVA 1GSHA 5KKNB 3VPDA 2GPSA 1JDEA 4E4TA 4YAKB 2NU7B 4C5AA 5C1PA 1Z2NX 4FFMA 2NU9B 3V4ZA 2YRWA 4C5BA 2FP4B 3I12A 2GQSA 2VR1A 4M9UA 2HGSA 2CZGA 1M0WA 5J2UF 2W6QA 3VPBA 1Z2PX 4MV7A 4XZ3B 4O7TA 4O81A 5D8DA 4MV8A 4O7VA 1UC8A 4DIMA 3SE7A 4FE2A 3TIGA 4MA5A 2R86A 5C1OA 3JZFA 3U9SA 4EA8A 4I50F 4TV8F 1EHIA 5CAEB 3MWEA 4IWXA 3RFCA 5C8YF 4ZOLF 1DV2A 4L1KA 4TV9F 4EGQA 4XX0B 1E4EB 4ZHQF 2I80A 3UFXB 5EZYF 1I7LA 4MV3A 2YWVA 4I55F 4GGMX 5BMVF 2YS7A 3RV4A 4O4JF 2V5AA 2DIKA 2YZMA 2YW2A 3OUUA 1CE8A 4M98A 4O4LF 2NPOA 3V4SA 2R87A 3OUZA 3AX6A 3VPCA 2R7KA 1PK8A 2HJWA 2J9GA 1DIKA 4O82A 4IZOA 3R5XA 1AUXA 2W6NA 4O86A 2ZDGA 1W96A 3QFFA 4YAJB 2R7NA 3JRXA 5J2TF 1IOWA 5K2MA 1CS0A 4EAAA 4O84A 3WO0A 5LOVF 4M99A 1SCUB 4O2AF 2GPWA 4YJ2F 4EABA 4MV1A 2W71A 5IYZF 2PN1A 2FPPB 3GLKA 2DWCA 2W6ZA 1IOVA 1EUCB 4EA7A 2SCUB 5HV6A 4MV4A 1E4EA 3HB9A 4O7RA 4HR7A 2XD4A 3ORRA 2R84A 3K5HA 5KX5F 4FGRA 1A48A 3HO8A 2V58A 1OBDA 4FFPA 4XYLB 4FFNA 5JH7F 1KBLA 5CA0F 1PX2A 2CNQA 1JDBB 5JQGF 3N6RA 2W70A 3K5IA 2GQRA 3KREA 3R23A 4FFLA 1VBHA 4IIJF 3JRWA 1KJ8A 3R5HA 3BG5A 3KAKA 2XCLA 2DLNA 2YS6A 3DF7A 5HBRB 1KEEA 1JLLB 4FU0A 2NU8B 1BXRA 3NUAA 4YJ3F 2CQYA 2Z02A 1ULZA 3WO1A 3ETJA 3U55A 4XYMB 3JZIA 4MV9A 2VQDA 5JVLA 2FPGB 1C3OA 1EUDB 2R85A 1KC7A 3ORQA 2P0AA 3G8CA 4HQ6A 5BPFA 4O7WA 2QK4A 1VBGA 3TW6A 3VOTA 1GSOA 4J6EA 2WYOA 4MAMA 4FFOA 2R7LA 4FFRA 5H80A 2I8CA 4NYEA 2FPIB 2FB9A 5JVDF 3TINA 1CQJB 2GLTA 2X0SA 4YBZB 1KJQA 3BSWA 1UC9A 1EYZA 4Y8VB 1GSAA 3E5NA 4O7NA 1T36A 3KALA 4RZQA 3Q1KA 4O4HF 5FNVF 2NUAB 3LWBA 2PVPA 1GLVA 4O7YA 1Z2OX 1KJIA 1B6RA 5DMXA 4TUYF 4EG0A 3TIIA 3G8DA 1VKZA 3R5FA 4ME6A 2YZLA 1C30A 2VHEA 4C5CA 1BNCA 3BSSA 2NU6B 4O4IF 4ZI7F 1B6SA 2ZDHA 4M9CA 2IP4A 1KJ9A 2I87A 4I4TF 3HBLA 5BPHA 1M6VA 4O7SA 3WNZA 2W6MA 2PBZA
chains in the Genus database with same CATH superfamily
3KLBA 5ITSA 4EY4A 4BC1A 5JADA 4TWBA 3H2BA 1BGVA 4LQ4A 2YRFA 3DLTA 2YVUA 4N9WA 4AUMA 5CA1F 1BQ4A 2DFKB 1DIHA 4NBKA 3SSOA 3HB4X 2ZVPX 1T4BA 2H48A 3GYGA 3N2KB 4OKSA 4DPLA 2Q2OA 4F9GA 1R5OA 3TQOA 1BYIA 1V8DA 2BEVB 3NJ4A 3R3YA 4L8VA 3I39X 4L50A 4MDYA 4XJSA 3ZE2B 4R1OA 4NSNA 2O05A 3AU9A 3RG2A 1Z5WA 1ZDMA 3BICA 4HGYA 2XW6A 1YZKA 1P2SA 2VPQA 1WDWB 2GNPA 2XLCA 5EWLB 2CVOA 1PDVA 4B3TH 1USVA 1ST3A 4QSMA 2IGTA 4ZHSA 2XRZA 1PL0A 4P5PA 3OM1A 3IIMA 5BOVA 3MTIA 4NPCA 3EGEA 3VGPA 4RNDB 2VHVA 5ALKA 1AZWA 3U4HA 2XMCA 5CFOA 2H2DA 1XQ1A 2IY9A 4V2UA 4YRCA 2C04A 4ISBA 1JEAA 1D2HA 4ZAYA 2OMEA 3AGPA 1C3EA 5JCJA 4G65A 2P2SA 4GPZA 5AKYA 1M76A 4BLWA 4RK5A 4AZSA 1HXHA 2G72A 2ZSFA 3BQ2A 3F5MA 1I10A 3F9CA 5TLSA 4Q1BA 3LX4A 3N0VA 4DJEC 3FVRA 3NV9A 4KH0A 3OMLA 3N07A 5ALQA 1VL2A 1K3FA 4FKBA 3ICCA 3B82A 1PWZA 1N5RA 4IHJF 1MW9X 4MVCA 4OAPA 4B09A 4HLUA 5BYKA 5JHHB 3TLKA 1CKEA 2CVFA 1N1GA 3MD9A 2DYKA 2OBMA 5F1PA 4EUEA 5FL7A 4V0KA 4RUAA 1DPFA 1YR3A 4CMKA 4NZYA 5J59A 3T99A 2GTHA 5IAGA 3TR0A 3WAKA 4BLVA 3J80W 1QGAA 2LUOA 4N8DA 4RF5A 2FMXA 3BB4A 3ZS9A 4G09A 5DX1A 5FLEX 1SIOA 4BYGA 4CQMD 3HJCA 3IOEA 2O2HA 2VH1A 2C5BA 3KYHC 3GZNB 2BI8A 2V9WA 1KQOA 5DOZA 4DNFA 3VMMA 3QVGA 2BUBA 2Q5CA 2Z08A 3TRDA 1ENZA 1YXMA 5EHIA 2BZ1A 4P36A 4J9UE 4YAIA 1JEJA 4NYJQ 1ZCBA 1DGSA 1RJDA 2IVFA 4KFUA 3HWWA 5CH3A 2D6FA 1MC4A 1S2DA 2QXUA 3GFFA 3NATA 3KPVA 1NR1A 4XD2A 5DHQA 5DM0A 1VECA 4MKIA 1SUAA 2FZGA 5CM8B 5G2OA 1Y6QA 4K6HA 3VJRA 1FOEB 4JI0H 4YIKA 1P45A 2VJCA 1J0CA 2HGXA 4Z99A 3FCXA 1VXOA 5ALMA 4D3FA 3IVXA 1ZVKA 1WKBA 4TUYB 1JAYA 3U1VA 3X43A 4S12A 4B6EA 3RYFA 2BM9A 5I5EA 2WKWA 3QTBA 3SE0A 4OHBA 3KSUA 4L22A 3IG0A 1CZNA 1T4CA 1T8WA 3Q3JB 4QU9A 2JFWA 4R2JA 4OHZA 4EYIB 4FUQA 3W8EA 4Z5XA 1B73A 3AL3A 2AEJA 4ZAXA 4UOZA 5HQ3A 1JPUA 2YWEA 3ANXA 4GHWA 4L75A 1RJQA 3EAGA 2CNLA 3LUBA 3N2GA 4C03A 4HVCA 2HT1A 3G8YA 1X1QA 3DFIA 5CVUA 1HE8B 4LF8H 1VLVA 2MT9A 1LDNA 3M7IA 1PSWA 3TPZA 3SQWA 2GPSA 1NVXQ 2ZETA 3OZRA 4JLNA 3W5JA 1NRXA 4LJRA 2IXAA 2Y67A 3B3JA 1IEXA 2XBLA 4DNXA 4WCDA 4JEMA 2XXJA 4Y0VA 3WIOA 2PCLA 1G3RA 2QRLA 2WMYA 1VKNA 2AQKA 4ZI5A 2UVVA 3F7TA 3IOYA 3TB4A 1G21E 4DJFC 3NJ8A 4BTVA 3HY3A 5GP1A 4C89A 2W0MA 3DE6X 4B9AA 2G17A 4R8VA 1XTRA 2JHFA 3GCGA 4RU9A 2IELA 2WLTA 2JGLA 3R76A 4DOMA 3FGZA 5CFNA 4F04A 1AUQA 2JGAA 1Y14B 1LZLA 1UZMA 4V1CI 2WWHA 2AD1A 4IMIB 4NEQA 2WF6A 3B51X 3QWAA 4XSGA 2G0AA 3IQZA 3VVCA 3QPBA 1APBA 4EQ5A 1E6LA 3R5KA 3N3BC 4LPSA 2QPOA 2PMEA 1V37A 5TIIA 1VDZA 1OFVA 3MLAA 2FUNB 2NP6A 5FA6A 4PICA 1WVGA 5KX5A 3EPRA 2JFZA 5JNTA 3PSAA 2GCEA 3A4VA 4A3DG 3RYHA 2H0AA 1F0NA 2QORA 1UM8A 3NM4A 2B3DA 4QXAA 4YY3B 2GA9A 2UAGA 4CKBA 5AK4A 1A9QA 3OSUA 1U3CA 1JFFA 1QHHA 5K05A 4U00A 2XVAA 2CMGA 1H2WA 4G0ZA 1IUKA 3D6AA 1QX3A 2J4DA 3LC7O 4HH0A 1IC6A 4WOBA 4Y6LA 3VYSB 3ZY5A 3C1TA 4OBEA 5KG3A 4A3EG 4HZUA 2QTGA 4L02A 1IY8A 2IHNA 5SV2A 1ADYA 1R15A 4KQ2A 2W2XA 2HDKA 3I28A 1T6XA 3H1BA 1S01A 2ODPA 2FPWA 3G23A 5D86A 4AS1A 4XFDA 4YCSA 1AA9A 5CITA 4HDSA 4V1CB 4TV9F 4I1IA 5C9ZA 4MYCA 1OCEA 4HNQA 3NGXA 1WZNA 4ZHQA 4LRSB 4DVJA 2W00A 3K6SA 3KZMA 1ADFA 1D2NA 3C7KA 1Y8QB 3MCVA 2VK1A 2Y0SE 1HG0A 3OLQA 1COWA 5KFKA 1SVIA 2CLHB 5EUMA 2LW7A 3BMQA 1WUKS 1XX6A 5BRJA 1BVHA 3CVZA 2DFLA 2YZ2A 2V7UA 4QC2A 4PZ8A 1PLKA 4BQNA 2C57A 1I14A 1E79A 2ATVA 2JLQA 3PQEA 3G5TA 5EESA 3BK7A 4HH4A 1FXUA 5CDHA 1U4OA 2OAEA 4F96A 3L9XA 3IV6A 5DG7A 4C29A 2Z95A 2A14A 1T9BA 3GAAA 3D3JA 3K6RA 4XARA 4IMPA 5ULLA 4DL2A 2J6HA 3ZDZB 4LG1A 4AWAA 3T4UA 4KFTA 5IEBA 3R0VA 1JYFA 2VTEA 1YL6A 3EC1A 1IAVA 2IOQA 2SICE 2WF9A 3Q7IA 4FILA 4MRNA 4B3GA 2OZEA 3E5HA 3V4SA 1OFUX 1Y1QA 1C1DB 1OU4A 3PF9A 4IIUA 5TY0A 5ILOA 2JKVA 5LQSA 1U9IA 4H2DA 4N18A 3RK1A 8LDHA 1C41A 4NF2A 2Z2ZA 5IM4F 1DVRA 1GG2A 5K3FA 2AIRA 1KBOA 1PLLA 1SPBS 1TIKA 2MINB 1BHO1 5LUBA 3MHPA 4O82A 5BY2A 1WXDA 3NDPA 3VDMA 1XDNA 1EFHA 2BFFA 1ZI8A 3IKJA 3LFUA 2OSBA 4E30A 4EHFA 3J80A 4QICA 4W5WA 1W46A 5SYNA 1RIIA 2YJ6A 3HNPA 5ALGA 4Q05A 3GX1A 1U1GA 3WTBA 5AW6A 1MH9A 1J24A 4QRHA 2J08A 4U2FA 1ZNQO 1RJFA 1J90A 1JF8A 3RS4A 7MDHA 4OB6A 4Q8EA 3F6BX 3R3XA 2VPPA 4LMYA 1NKTA 2TRSB 3L2OB 4O84A 1SEPA 3ITDA 3CKMA 4LHXA 3RJ0A 1BKSB 3IQXA 4P7KA 4LGVA 2IEDA 5D87A 3L8HA 3KKQA 4EUFA 1KO7A 1CDDA 2XNJA 1IBMH 2JGRA 5CEFA 5INTA 2V0GA 2PRJA 4GC7A 4S1VA 1A72A 1A5BB 1ODCA 1LJ8A 2RB5A 1JYEA 1VBFA 2QUHA 4EY7A 1XZCA 1GD1O 3EULA 3KV3O 1ZUIA 2BTQB 5DHTA 2FWJA 2R7AA 4RH0A 1DX6A 3IQFA 5IDXA 4RTMA 4OP2A 1DRUA 3ZDXB 3OLYA 2XNSA 5HV6A 4X7BA 2FLPA 3AUFA 4LA4A 1WDLA 3DEIA 4M1KA 3VYWA 5BNTA 4YMSA 1O94D 1M8GA 3NHSA 2FLKA 4M89A 1RQRA 5MF6A 3ISTA 3VHXB 1EE9A 2EDCA 3KC2A 3D6JA 4XQ9A 9ATCA 2RK6A 1W6RA 4QYTA 4FE3A 4MQEA 1ZG3A 3EMDA 1YVEI 5CGQB 4ZQHA 4EITA 1U0GA 1E61A 2GZMA 2XD4A 4G81A 1UKCA 3GGJA 3KKEA 4IGFA 4II3A 3EGVA 5JY6A 5KFYA 1GA1A 1XRLA 2BFMA 2RONA 3A6HA 1MEJA 4FGRA 2ADFA 2DQZA 3ZI7A 3NOQA 5IYZA 1Z4NA 5KPDA 2WFLA 5IG2A 2BJHA 4YT4A 1HNNA 2V55B 1UFVA 3AKEA 1YZUA 1OBDA 3FSEA 2VPTA 2W2KB 1W9HA 5I8WA 3ZU6A 5ALSA 2X2PA 3TW4A 2F8LA 3A3NA 1G17A 4CHGA 3LL7A 4MX8A 4R0MA 1A4IA 4L3WA 1B3RA 4XKJA 4F6CA 1EP2B 1BCSA 2ZSUA 1NY5A 3HJTA 3KE9A 3OURA 1DNPA 3G9QA 4GX1A 3RUDA 4R8SA 3D54D 5CA0F 1B1CA 4HLUC 4KXWA 3TCXB 4RD2A 4DM4A 4C0XA 4PLZA 1VMEA 4B34A 2ECQA 1RKUA 3W06A 1AQYA 1R0SA 1RYSA 4QQRA 5DGDA 5CR9A 4CETA 2Q46A 1E5TA 1L2TA 5IKOA 5CDFE 2PUFA 4NJEB 4ITRC 2C2BA 2ZAOA 3B8HA 1JX4A 1F06A 5DIFA 3TAXA 3ZU2A 5A2GA 1JA1A 1PFWA 5FFMA 1TJ5A 4IX1A 4H27A 5A2QA 1E6CA 3JAKA 5LYYA 3HUUA 3IBSA 3SIWA 5JECA 5JROA 2W2MA 5BV7A 2RAUA 3QYFA 1YS6A 1XQXA 1V25A 3EZ6A 4LBZA 4RGVA 4YJGA 1VBHA 4GX2A 2CXQA 3CR3C 1OHHD 4HDMB 3GLQA 4XI9A 2DHCA 1PJAA 2V96A 2VAXA 3I04A 3JQRA 3KVVA 4IIGA 4U63A 3TNJA 1HDYA 2V9PA 4BP3A 4BRSA 5JAIA 1OLUB 1PV4A 3MJ4A 1NMEA 3GUHA 3HB1A 4MR9B 3KP1A 1OKKD 1E8DA 1JSXA 4PN3A 1QIHA 1PD0A 2RGVA 1B2LA 1CD5A 1RLJA 4OV6B 2FOLA 4XX1A 4JJIA 2QKYA 5ENZA 5K9ZA 2VDUE 1ZJ6A 3CONA 4PYOA 4P9NA 1E6MA 5KTMA 3DE0X 4TT8A 3I04M 4WV3A 1JP7A 1NJ1A 1O77A 4MRPA 4C78A 2RK4A 4NG4A 5B7NA 1KH2A 2JFFA 2OCPA 5JSQA 3A28A 3M81A 4K9PA 5FPQA 2PUTA 2VWHA 2C5GA 2QRZA 4CDGA 5JZSA 3A26A 1TQ6A 3KL4A 3OQJA 2ID7A 1GA4A 1P72A 3WL4A 3IPYA 3I2GA 4FS2A 3G2KA 5DGTA 5FBLB 3PS9A 5JLJA 2HDWA 2ZUTA 3HJHA 4JXKA 4MV9A 2HDHA 4Q9HA 2ZI4A 1M8KA 2QD1A 3QKIA 1FE8A 5JVLA 2VQ3A 3AT1A 3PHIA 1WCYA 1EP9A 3FUUA 4GQIA 1ET0A 1WP4A 4JL8A 4RMGA 4EB8A 2XDWA 2BM1A 4AKHA 4M6WA 3KFVA 2B1JA 2ZXFA 5FTNA 4LJ7A 2OCXA 2V5UA 4DUPA 4PDBA 3HSKA 3VOTA 3WYBA 4I2VA 4JU8A 5AI5A 3DO8A 3HRIA 3NT5A 4NENB 3RK4A 3WLKX 4BB0A 4EPTA 2BYTA 4KWCA 1T26A 4F4ZA 1XSEA 3OCZA 3AY0A 5JS2A 3MTJA 3PXEA 2JJ1A 2V7EA 1G8HA 3RFXA 4JXZA 3FMOB 4Q1CA 2HA4A 2DULA 2IHZA 1TVCA 1XTBA 2R7LA 1U2PA 2EKLA 4PINA 4RY2A 1VG0B 4DCSA 1E62A 4N39A 1ETUA 3VAZA 3KPUA 4URUR 1XCLA 3Q9NA 1I6KA 3IAEA 1ZAKA 1OZ0A 1Z3CA 2CNOA 2WQZA 3PFKA 1VPEA 2PX2A 3QMMA 1UKVY 5AYVA 3ITKA 3SQLA 4E21A 1WLSA 1YJ8A 1OFUA 2E9SA 3W6UA 1WV0A 3GRVA 3PGA1 2AZMA 4UAGA 3WE7A 5K6AC 4LHZA 2G4CA 4CF4A 1TVKB 5JCZA 1WD5A 1RK6A 3GFVA 5AK3A 1Q14A 3KT0A 4BMZA 3TJZA 4CLEA 1CUUA 3B78A 2IFTA 2ZR7A 3LDHA 5ECDA 2C5AA 1W2HA 2ID9A 3CE9A 2XDAA 4DRFA 5AO9A 4GWKA 1PJ2A 3ZGXA 4E3WA 4BO4A 4MUYA 1Y6JA 2G9QA 4Y6RA 2V8OA 4MH0R 3VU1A 1QGUA 1GZ4A 2FPOA 1KJIA 2UZ3A 3HCAA 1G64A 2GF9A 4ZDWA 3ETNA 1VE7A 3BB1A 4BY7G 2XMZA 1ZIDA 2QN6A 2V4MA 2Z5VA 3A58B 3VNAA 5DDIP 3ZNPA 1YZVA 3OESA 2WE7A 3ZHBA 1GKUB 1JDJA 1X87A 4G9EA 2YC2C 3U5TA 5ALXA 1I3CA 5AP9A 4OX9H 1Z0KA 2XVXA 2ZWPA 3ZLUA 1YL5A 3NDBB 4FHCA 4MTLA 2D5LA 1JWAB 2VHEA 4US0R 4BO5A 4Y67A 1SU7A 1RLOA 1RLMA 1S89A 1TZBA 3K1ZA 5A5DA 3AZOA 4IRUB 4PBTA 5CB4B 2J9RA 5J5AA 5LU9A 4GDFA 4M1YA 5E1OA 3QZ8A 1U7DA 3VUFA 3A4YA 4KXMA 3BE5A 4RB0A 5F3RA 2HQOA 3HBNA 4HDSB 5KYTA 4AMUA 1JIXA 3PZPA 4RPLA 1KIAA 2IP1A 2XA1A 3HEMA 1I4LD 1RXEA 1LFAA 4P31A 4CC6A 1EEXB 1JIQA 2GZSA 5EKDA 1KI2A 1N2OA 2VI5A 3KQHA 3J7AK 5BPHA 1R16A 2G63A 3BREA 5AOCA 3A2LA 3RR2A 3WFJA 5C5EA 1LW6E 3WNZA 2PBZA 1TU3A 2RHLA 3JQAA 4D9KA 2PXAA 3CT4A 2I34A 3DZ8A 1T34A 2C8VA 3VMFA 2ST1A 1YS9A 5ED4A 1XLTA 3U3MA 2E4AA 3G2LA 1E3QA 1QCCA 3BJZA 3H1FA 2NQTA 3U9TA 5IW8A 5EP3A 5B2EA 1A9XA 4L74A 1PRYA 3CLRC 3NBZC 5DLDA 5I7AA 2W98A 3U7QB 3VU3A 5FV4A 4JI3B 4R8MA 3T52A 3JQQA 4EK9A 1EQUA 2NSLA 3SR0A 3A1NA 3ETHA 2X4LA 5ALFA 5KSPA 2P6UA 4TS9A 3ZDDA 1L4LA 5DLQC 4B4KA 4EZEA 1YIOA 4A0HA 1MGOA 5KC9A 3HKCA 1JKJB 3GGSA 3OA0A 4AY2A 3SBDA 5GAJA 3HFJA 3KZ1E 3KDAA 5FI3A 1WXQA 4PO8A 3FRIA 1BC5A 1NT4A 4Y8VA 4BVHA 1EVIA 3K9GA 5B64A 3EB9A 1B14A 5EL0A 3QWIA 3OBBA 3UWSA 4FE7A 5TGDA 4FN4A 3C8MA 4LZZA 1CY0A 1T6BY 1KZGB 5GZ1A 4WBNF 3VFDA 4DUYB 2VUMG 1SXIA 2OKCA 3CT6A 1VCIA 5ES3A 1DCFA 1PS9A 3RAJA 1EFRD 4CMFA 1NQ5A 3HGQA 3I32A 4FGJA 1Z16A 2C00A 2XYHA 2J3LA 2Z6AA 3KOWA 3ZLBA 3QF4B 4QOJA 3D64A 4H15A 1CQZA 3QIVA 3TGPA 2WICA 4LCBA 4QIHA 2ET6A 1GV0A 1OLUA 1A9ZA 1EG2A 4MIEA 2A4MA 3L7IA 1XYGA 1F14A 1L1FA 4J9PA 2OVFA 2VQ6A 1NZJA 1VC2A 5LXTF 1DLIA 1GQYA 1QXSA 3K7EA 3L0PA 4NQRA 4F91B 3P26A 3WAGA 4DWOA 3UAXA 3WQHA 2CHEA 3FGOA 1U6IA 4Z9FA 4YMIA 5F1KA 1Z82A 4G5QA 4BKQA 3RF2A 3GROA 1N5KA 2QJTA 3K16A 4Y9DA 3PC4A 3KTDA 3UC9A 1G60A 3VISA 1EWQA 1UWVA 2VYNA 3OEWA 2XGQA 5EJEA 1X7YA 5K45A 3S6JA 4RWZA 3F6EX 3HCEA 4UBNA 3EN0A 1JLLA 5CGZA 2ODWA 3E0XA 4QA9A 3Q1LA 2CK3A 2RH9B 4PQYA 4IEEA 3P96A 1NYQA 1W0JD 3EA4A 3PNOA 4H16A 1E9DA 1IE3A 1RMTA 3CLTC 5HVNA 3UTDA 2C2MA 3PYXA 3DGFC 1ZVQA 3MBOA 1P74A 1SWVA 4W8GA 2VH2A 1YBFA 1ZPDA 5F5LA 3ER9A 3MG9A 5HF6A 3OF2A 3KAJA 4QQ8A 3W3ZB 4BNUA 1GLGA 5E3HA 1M8JA 4MR8B 4BFZA 3W5UA 3BAFA 2Z6UA 3O8LA 1PU2A 4RETA 3B60A 4PC3A 2KSWA 3LIIA 4A6XA 2X9LA 5LN1A 1ZETA 5DPMA 1FDSA 3L1IA 3BGIA 4N12A 3WHLA 3Q2OA 1RYFA 3CG0A 3IAM1 3OQMA 3PIDA 1KOFA 1F2TB 1F6BA 3IOBA 2BISA 1R37A 2BF7A 3C3BA 4GPIB 3RJ5A 1KDPA 3C3YA 2AB0A 1P2VA 4RM2A 2FCAA 3ANYB 2EWMA 2W0SA 2YYAA 3NHPA 4WDQA 1V47A 4FMDF 1I24A 1MMFB 2GJ4A 3IDSA 3KG2A 1B41A 2FWAA 3RTDA 1MV8A 3VGJA 5IF3A 1Q7BA 2G7ZA 3JD4A 3CWCA 3BL5A 5JAZA 1FQWA 4FOSA 4QTTB 2XUKA 3PC8C 5BNFA 1XHEA 3VR5D 3T1YB 2B98A 1TJPB 4LJSA 4M8LA 1D4AA 3SMQA 5AVUA 3KXKA 1PX0A 5DHPA 4WNYA 3TJRA 3VHQA 3HEBA 4K0RA 1G9SA 1Z2NX 1PJBA 3NVAA 5JISA 3GCXA 4L95C 3ZD8A 2YRWA 4GUAA 4A6DA 4BFXA 2VQFH 4ZQFA 4ASUD 1NVWQ 4MMXB 1WIWA 2NZ8A 3E27A 1NNEA 3RHTA 5K2OA 2B25A 1T4MA 3FJYA 5ECWA 2W90A 2GQ0A 2NZYA 4OH7A 5EKXA 1HNZH 2MOKA 4EBDA 1J8QA 1K86A 1M0WA 1OF1A 1U1FA 1WDMA 2NNWB 2OD2A 1GQSA 3A1EA 2Z2YA 2CFTA 1TRKA 1L7DA 2ZBQA 1I4WA 3NYRA 1T35A 3U4CA 3DBLB 4XWWA 4C7XA 2R92A 1YHNA 1O8CA 1DEHA 1QZUA 3BS4A 4LJ9A 2AMLA 5BW4A 4UNIA 2C83A 2JGJA 3BMNA 4U6NA 5CA0A 2IHVA 4BCBA 5KWJA 4AY6A 4Q43A 1Z6GA 2P2YA 2HSDA 2WD7A 1HMPA 3EWAA 2G1AA 2NO6A 3ABIA 3PD7A 1Y1RA 5SY4A 1JR6A 2WZCA 3NU1A 3U9SA 3H86A 2YXNA 3BFXA 3GUYA 1EHIA 3NWEA 5BUSA 1B1AA 1IXKA 1HLPA 2B0CA 1RE0A 4KQIA 2Y1FA 1H2ZA 3JD2A 4ND3A 1X7XB 1PHRA 1XZPA 3AP3A 1CPYA 3EZXA 3L8GA 4G07A 2BMDA 3GD5A 3GNQA 4OEHA 5DYNA 2IV3A 3VBEA 2JVKA 4RPJA 1QS0A 3T1OA 3DMTA 5HUHA 4O3OA 1WXGA 4MCIA 4BUCA 2XKBA 4A3IG 4DL4A 1T3TA 2ACWA 2BVNA 4K6GA 1EKVA 2CV1A 2YXDA 3NH6A 3PT9A 1D04A 5PNTA 4ZHQF 1NSFA 5TV2A 3VO9A 2O3UA 1E4GT 1JX6A 2FPLA 3QVXA 4OQPA 2FA9A 4TV8B 4FZVA 2AE1A 4RIFA 3GMSA 4CBVA 2C5FA 3SC6A 3RWBA 1GADO 1K4YA 1HQCA 3V3KA 3H4MA 4C3OB 3H9JA 2B7BA 3W5BA 3NHYA 2A9PA 1VLZA 2HMUA 3CLUD 3Q3CA 4FHDA 3BQ1A 4KH1A 4TRMA 9MHTA 4OLJA 4EPXA 1KU0A 4B7AA 5C4XG 3WK8A 4ESEA 3DLCA 9GPBA 3Q72A 3KHUA 1RPJA 3Q5EA 3QVKA 1PIWA 2FZ5A 1B0AA 4KEAA 4MO9A 4C4RA 3AZPA 4KWTA 4CMIA 1GPKA 2JGDB 4OGLA 1NDHA 4CGZA 2RK3A 2DWQA 1IDOA 3PEUA 5DGAA 5CFQA 4JI1H 1PR5A 2D74A 2NPOA 4FWBA 5BN3A 2XH8A 3QJYA 2XKJE 1OE0A 1NVBA 1T5TA 1VE6A 1T5BA 1ZMXA 1MIOA 3LXRA 3NAGA 5LKAA 5EQJB 3CIOA 4YMVA 2QRKA 1KMHB 3O3MB 3PGMA 2X7XA 1H2BA 3PRYA 4G9GA 4B0PA 4BJHB 6AT1A 1EFRA 2UXDB 1ODSA 5JPIA 3JVVA 3R24A 3GTKA 1JZQA 4IXNA 1E2NA 1S7GA 3OF3A 5DCWA 4KNYA 4L8WB 2XB9A 1MVNA 2M1XA 3I8SA 4LYEA 3P9CA 4KO2S 5DN9A 3SOPA 3TTVA 3AFNA 1W5TA 3D7NA 4PTLA 5CD1A 2B8WA 3H7AA 4RGQA 2QY9A 2PS3A 4RV4A 3T7DA 3TO5A 4F45A 2QAGB 1K8YB 2MHCA 2ODTX 2NNLD 2QW8A 3KKZA 4XTCS 5BSTA 2FG5A 5LZ5A 1V9PA 2ZBEA 3VDNB 4Z3DA 3JYHA 2WHYA 5K8VA 2QY6A 3T5MA 5HOEA 2L69A 3VR5A 2Y1LA 3UJ6A 3WL6A 3OFJA 2X15A 2MSWA 3GJ5A 2PAAA 4MPRA 1CU1A 2ZSDA 1L4KA 4FTWA 1I9GA 1TEHA 5BSRA 3R7AA 4D9NA 1HYQA 3NC4A 4FYHA 4E46A 1YB7A 3O8DA 1EUQA 5F51A 3A9SA 4GLXA 3QLVA 3MT7A 1AJEA 5BR1A 1UFKA 1ZU5A 2D1FA 3E1GA 4F12A 3QP9A 1X1TA 1Q11A 5EE3A 3QVLA 3WJ2A 3VR4D 4ILEA 5FTKA 1TECE 3DNPA 1PWXA 3QVVA 4UCRA 4PLYA 2PUCA 1NVKA 3OIYA 2PO7A 4ABYA 2J0QA 2I8LA 2RDIA 3TSWA 1E2MA 1J2TA 3JRNA 2UVDA 1SQFA 3FAZA 4QPJC 2QSZA 4EA7A 1GPJA 4YMTA 1JLHA 4R8UB 3GU3A 4HWOA 5UKDA 1SG6A 2CNBA 3NBXX 4L5IA 1SKUA 4WOJA 3LY5A 1KC1A 2GO1A 1L5YA 2GZ1A 2IHTA 4WXHA 5EQDA 2UDPA 2XKKA 2L18A 5D01A 1ZIPA 1CY1A 4RHYA 3ND8A 4AF7A 1CHDA 1Z5NA 3DCJA 4KHZA 1BAPA 3IAUA 2QLNA 1DXQA 2PKCA 3U13A 1D1QA 4GP7A 4D4MA 3B1KA 4C6SA 3A4IA 2R84A 2ABJA 1AKUA 2NQ2C 1Y5IA 2QVBA 3ACDA 4OQQA 5FJ8G 2HBRA 1N2JA 2IYZA 1H6DA 3DOCA 3ZGYA 1HNWH 2PRZA 1RI3A 3W5OA 1Y48E 1ZN9A 2JFOA 4QYXA 3UUWA 2H4FA 2NAPA 2AZXA 2AZTA 1XZQA 2QIOA 2ZJTA 1ZUWA 1LXCA 1AQIA 3HVUA 1JTFA 3EWNA 3PQDA 4G0MA 3ZWPA 3CU5A 4PIMA 1E5LA 4C4OA 4COOA 2V74B 3H9BA 2AN3A 1QGZA 3S2IA 1DQZA 3STUA 5KKCA 3GDWA 1ODFA 1Y4SA 5M7EA 2XTNA 3GB9A 5BYAA 1PL8A 2QTHA 3PA6A 5IUKC 3TAHA 1WHTA 1JEYB 1EP1B 1BDIA 4F2WA 5EXTA 3R8XA 2IVZA 2MYTA 5F9MA 5JMPA 2MDTA 3PO3G 3ORSA 2D2XA 3PVCA 1B0PA 1PEKE 2FHSA 1N77A 2R6DA 1IXSB 5DIZA 1YS2X 3P32A 3LPNA 2Z83A 2E3JA 3A2MA 4LNAA 3L84A 2EWVA 1WTAA 3AU8A 4XCXA 1PTJC 1ZCAA 1VBKA 2P7IA 3DHWC 1MRNA 4HRYA 4Y2HA 5K0TA 1JHQA 3O2JA 4CT0A 4EL5A 5HIKA 3N2LA 1MO5A 4CUJA 4U9UA 4M36A 4EPVA 3NYWA 2BOVA 3ZYZA 3CH7A 3P2OA 4IIJF 1YVUA 3SQXA 3AVUA 2YV2A 3NUZA 4I1YA 4MVXA 3AF3A 2A5YB 5H0IA 4B7UA 1YK1A 3ABQB 1CUGA 1JEOA 5HIJA 2H1OA 4W1SA 1Y1VA 4HTFA 4UAVA 3E2IA 1XAHA 1LV8A 3NFYA 1KEEA 3T0GA 4AN4A 3NCTA 5IS2A 1W44A 3OKCA 2UYGA 5BV2P 1M0SA 1WP9A 3IGFA 4RPCA 1BA2A 3HPRA 1XDDA 1BA3A 2ZYHA 3NUAA 2Z8ZA 4FYMA 2A5FA 2RH8A 3CZAA 3MJTA 4FOTA 4HZIA 4MS1B 2C4WA 5NLLA 2CL7X 4FINA 1B76A 1Q0SA 1XNGA 3ESYA 2IOFA 4GMDA 1S1CA 2RI1A 4IRDA 1V3QE 3U37A 1KQ3A 5KOJA 3ZV6A 2J6UA 3NKVA 3WHIA 4XYMB 4FGZA 1FDRA 4JHXA 4CTOA 1ZSNA 1CK4A 1PR6A 2CXRA 3GW8A 5GWXA 5HRCA 3LC0A 4BKRA 3P19A 5HKKA 1BIFA 1O9HA 4JC8A 2KQUA 3T61A 3NBUA 5L7WA 3L1UA 2GTPA 1XTPA 2YJTD 2BM8A 4HDMA 1CEEA 1QOZA 2A84A 2HNBA 4PCLA 1UODA 2P0AA 1Q92A 2Q4DA 2XF2A 2J5RA 4LXQA 4TYPA 4Y9UA 4O3QA 1KIFA 2WAYA 1K3UB 3SMVA 5KJ6A 1ZGHA 2HU2A 3M9XA 2ZM5A 1HDEA 5AOAA 3ZHCA 2IXDA 4JKOA 4BO7A 3W78A 1NVTA 2I67A 4KN5A 1QPGA 3I9V6 4D4GA 4TN5A 1YK0A 3C14C 1CJCA 2DQSA 4J9KA 1RI1A 3UMJA 1KZHA 5L3QB 1QO0D 2QTLA 2IT1A 1Q0ZA 5LFAA 2FK8A 2O14A 2P9YA 1K7XB 4TLDA 4UULA 1C0KA 1QIIA 5K0LA 3VSAA 4LZAA 2PXCA 5BR4A 5L3SA 3GBSA 2PFKA 1KQNA 1TTPB 1FFDA 1ORIA 3FUXA 1G2OA 2HLPA 2NU9A 1CQJB 3BDAA 2C1ZA 2GAJA 1J0XO 2I6TA 3EHEA 5AI9A 1ZR4A 3NCHA 1E9SA 3EFHA 1Y34E 3C7DB 3GYBA 1TIPA 3Q7QA 1EYZA 1ODTC 4XCQA 1AS3A 2R6GA 4I5FA 4M3NA 4L5AA 2WKRA 2Q2UA 3AR4A 3A32A 4G8CA 3A2KA 4KHPB 5EDWA 3F98A 3I1YA 1WF3A 4I9NA 3TWOA 4M0MA 2EV9A 1XHFA 2P0EA 3WNDA 1SUWA 3QXHA 4O4IA 2AR9A 3RT7A 1CB7A 3O7MA 3RBDA 2XT0A 2CNWD 3G7UA 3M6XA 1YBMA 2MR5A 2BSAA 5G4LA 2OHFA 3WISA 3UICA 1HTBA 3KT6A 4GECA 3P9PA 2DY1A 4JODA 4WHMA 1SZJG 2JI8A 3D2LA 2PKWA 1CY7A 3P2IA 1L5SA 2Y2VA 5DBFA 5KJCA 1U0EA 5JJIA 5A6SB 2WJ3A 2DPYA 3D81A 4ND7A 3REFA 1U8UA 1FVXA 5LP6A 4QT4A 4PXAA 4DV6B 4LYJA 1Q0RA 1XCOA 2VDLB 1XVIA 5LD2B 2IDKA 2PUDA 2GEUA 3T0FA 4ME6A 1WH2A 3BA9A 2WRZA 4Q9JA 2J3IA 4ENRA 1OI7A 1FFBA 3N2ZB 4OXQA 3RSGA 5C81A 4PGGA 2YKGA 1PG5A 4G5YA 1PUIA 2AC2A 1U0OC 1QE3A 4TMKA 3DZDA 3ZHOA 2B7LA 3CLSD 4MDHA 5EY5B 4OFWA 2YIMA 4DV0B 5DLYA 5K3EA 4OQDA 3VH3A 3DOUA 1IAQA 1KEEB 1ORRA 5L4NA 5LL6P 2BD0A 2C9ZA 1WNTA 1U1DA 4WK4B 1EWYA 1JMVA 3FLBA 3GF4A 4YRDA 1VSBA 2QZPA 3HM9A 4I4TF 5HNKA 3AR2A 1OHHA 2RHJA 2M6SA 3D1JA 1Q3KA 3OEED 1FFEA 1MNAA 2Q50A 3UV7A 1M6VA 3ZBUA 4ZV4A 1D2GA 1UAYA 3SEZA 1G20B 4INOA 5FR1A 2XOKD 3LLUA 3NX4A 2QYZA 2VJMA 5EIEA 1MC5A 4W7SA 3TZQA 4WZAA 5IF9A 3G1WA 2AE2A 4G86A 1YE3A 2CXXA 2DY0A 3AY3A 4HNRA 3W05A 3U54A 2ALZA 2R9VA 5H3LA 3SC2B 5JO0A 2COEA 4HB0A 5CLQA 2VHCA 2R6FA 4CIDA 3MNFA 2ZPAA 4DL3A 3E03A 2HRZA 2ZE8A 1IDN1 3RS0A 3G2JA 1GG5A 1NUSA 2FMIA 2N3ZA 1MQSA 5TC4A 4YXFA 1XE3A 4I46A 3CKYA 4YWHA 1V5WA 1VKRA 1P5ZB 4QRIA 4B73A 1M2GA 4BZPA 3WWCA 1NF8A 4YV7A 5BVGB 1WR2A 2NOAA 3RV3A 3LP6A 1MDBA 4UE6A 1BRMA 1V51A 4I08A 4B82A 5SZJA 4QYIB 4O0MA 4QTYA 1MIOB 4PYNA 3J81W 1HEUA 1C2TA 1AK2A 3OOEA 2UXCH 4PC2A 4WKPA 1KMCA 3E3MA 4DLVA 4EA9A 2OZPA 4J7UA 3V7WA 4MYTA 4EDHA 3QITA 4GI5A 3EWSA 1ULAA 2O9JA 4QQKA 3IFSA 1RQPA 2I1LA 2QP9X 3E7PA 1ULTA 1TKCA 1IXRC 4HS4A 4JP1A 2BGWA 4CEIB 5F76A 4BQEA 2RSLA 4DA8A 1LFDB 3SLGA 4ODIA 3V3TA 4ZI3A 4ZD6A 2GYVA 5IEJA 4ZZ2A 2GKSA 3JQ9C 3OZGA 4PX5A 2BPOA 3TVDA 4UCFA 4KLNA 5JDIC 5JSZB 2A88A 1XNRH 2ZRPA 3FTFA 3SXPA 1TVEA 1SQGA 3MWMA 1OYOA 2VHTA 4QM7A 5A4DA 2FSUA 2CNUA 3FLMA 1AUVA 1RBZA 3IDZA 4WLNA 4NFSA 3BDIA 4DJAA 2EGGA 1Y0BA 5BVHB 4EP1A 1R8QA 1T94A 1MB4A 2R00C 1GCGA 3BSYA 2XMSA 3NHBA 3Q3EA 3QLTA 4KV9A 1KS2A 1P91A 4NOMA 3V97A 4E1AA 3P2KA 4U7DA 5THKA 4ZQIA 4IRKA 4FYKA 3A11A 3Q7TA 3ICQB 3N44B 4NK5A 1J42A 2C5EA 3GTMA 1KDYA 2JEIA 1F20A 3R1IA 3AB3A 4A1OA 1IBKH 4CKBB 4E13A 5IMBA 4LY6A 3NWBA 5AW7A 3V8VA 5JV5A 4PHFA 4RPHA 2JARA 1V3VA 2X3FA 2CXUA 1K89A 3BXEA 3OE1A 3SY8A 3KCNA 4KXLA 4KMMA 4O4JB 1UBMS 3JQFC 1O75A 3LVFO 4X1IB 4UU7A 1PR1A 4OIMA 1KBQA 4N65A 4X20A 4YR9A 3H7IA 4M0CA 4DUGA 5KJ1A 4DV2H 4WY8A 4QJBA 5D3QA 3I9LA 3ZDRA 1N8NA 2PZBA 4DEYA 5GIPE 1MN6A 1JR3E 1DAEA 1YR1A 2B78A 5GGXA 2VTVA 2XOKA 4LXYA 3DBHB 3FWZA 5FTMA 1L5WA 1T1GA 4QLAA 4CV3A 5B1IA 2FZKA 4EVQA 1H9BA 4KWEA 4CM4A 5EP4A 1CX9B 2LIPA 2A9RA 1UDRA 1ZRHA 3L40A 4WUTA 5DULA 4BUZA 2AT1A 3N0XA 4FZRA 3W1BA 1U28A 4YUYA 4Z4EA 3DV0A 1S0MA 3RS9A 2FR8C 1KH1A 1WABA 3N5CA 1SIUA 3QVUA 3AYZB 4PG5A 1W1WA 1BROA 5KFQA 3ZWYA 3UBTA 3FCSB 2JI6A 3HHEA 5G3YA 5I5WA 1SVNA 2WF5A 3OQIB 1E18A 4RTPA 3UB2A 4CODB 2CJPA 2BGJA 4LVOA 2FK3A 2FI1A 2GT1A 2L2QA 3DZJA 5AWFC 3TL6A 2IYAA 3UJ3X 2YVQA 4OH1A 1R3DA 2QX8A 5I60A 4DTIA 1N7HA 2Y1GA 4RSHA 4OAQA 3RSFA 1XYYA 4CLXA 1Z63A 3R7DA 1A77A 3F6YA 3CO5A 3N43B 2JAHA 4UVDA 4FFMA 1U3GA 2LVBA 5M5BA 2AN9A 1RWQA 4LJLA 5IK2D 5TEVA 1M6NA 1UDCA 2QTVB 4WW0A 3OEYA 2O7QA 4UMVA 5FBQB 1G8KA 1CJSA 1E0KA 4LFAH 2YOHA 3SNHA 3C2QA 2CE7A 4DSZA 4NTZA 5EJFA 1NA5A 3I53A 3MBIA 2X42A 1NAIA 4Y1RB 3OAAD 2DECA 1H6CA 1P0PA 3AVOA 1L4UA 2XGSA 3OIDA 4P3OA 2A86A 2V6BA 3CVJA 4D4JA 5LDHA 4D6PA 1XZ8A 4GKJH 4J1TC 4UU1A 4B3BA 4U6PA 5E25A 2M6KA 1MTZA 4Q1VA 4CM9D 2Y0DA 5AW8A 2Q5LA 1R8SA 4LNUB 4RKQA 4TMWA 3TLBA 2YWRA 5EZYB 5D1PA 3MFHA 3DMTC 2HU5A 3IA7A 4MWEA 3KTAB 4NY1A 4UNQA 4FMCF 7ABPA 1QGYA 1B0ZA 1TUGA 1TPZA 4UDYX 4RTJA 1X9GA 2ECPA 3WIUA 2IYNA 3PRJA 3V7NA 4EA8A 2ZJ7A 4IH1A 1UAGA 1VZ2A 1CJKC 4G1VA 4HC4A 3VPSA 5FBZA 4DIBA 2HWYA 4Z7NB 3O1LA 4AW9A 5IULC 1I2CA 4BNDB 1ZH8A 3FOWA 2C61A 5ALIA 5T67A 2P3OA 5LQMA 3FPFA 5KIAA 2BW0A 2Q2QA 1EUZA 1UBOS 1P5RA 3ITNA 2HM7A 3AIMA 3KEOA 2ZVJA 1THTA 4J0FA 4EW1A 1QH1A 2V4UA 3AFMA 3OAAA 1O8BA 2P9FA 3AV3A 3WDMA 1UKZA 3RB3A 3I6IA 3CNHA 2ONJA 3DE3X 3HR8A 3CF0A 4PFSA 4BWYA 4PIVA 4MJXA 2PH7A 3MW8A 3MYYA 5JS8A 4DUZB 3LGSA 2D1SA 3WLOA 2RHBA 4F3TA 2ZVDA 4JLAA 5BSUA 1HQYE 1LSJA 1B15A 4GD3Q 3W8DA 4I55A 2HGZA 3B20A 1FDVA 3F90A 4XR9A 3CSWA 1RAGA 3RK0A 2JCVA 2QEQA 2QR2A 2HJHA 4EUSA 1ZISA 4UHDA 5LU8A 4ZTUB 4J90A 1HETA 1YONA 3KB1A 2EJTA 4XUCA 1IBSA 1E1MA 5HCNA 4O2AB 1RABA 4HEA1 4TTIA 4JEHA 5AVRA 1CTQA 3WWDA 1ECLA 2K2WA 1AKMA 2Q4EA 2VRWA 4Q7KA 3DLIA 4MULA 3WZ2A 2W9BB 2JA5G 2DPHA 5DK6A 5TRTA 3SC4A 3N0WA 4IOMA 4DS3A 2EP5A 4BBPA 5BNWA 2CV2A 2GEBA 5E1DA 3M1LA 4CI9A 2AEEA 2OQVA 3P7MA 2O5EA 4MKZA 1M9NA 2B37A 2C9MA 2GAFA 5L9XA 1NLYA 1ZEMA 3HZOA 3RHSA 3K2IA 3M5PA 2HV9A 2XMPA 5B1YA 3TRKA 1DEAA 3D2CA 1V8OA 5M3BA 3E9DA 3E9QA 1UEXC 2JEOA 2OILA 1DQPA 4PQRA 1DDOA 1NC1A 1S96A 1CY8A 1DC7A 1QYXA 2CJWA 3JZAA 2BEJA 3N70A 3QBVA 4KGDA 3TG8A 2WU4A 3LT5A 1MPTA 4BAGA 1EE2A 4IZOA 1EVJA 2YMQA 1F4LA 2IUEA 4X3PA 4OLBA 5EWMB 4EI2A 4ZPJA 5JSUA 1GTRA 1RHMA 3U61B 1N8SA 1OBOA 4AJ1A 1QHGA 4RDIA 2B82A 1U7PA 1BDJA 4UHHA 4YMLA 5IKPA 3D1VA 3IH5A 1T25A 4CHIA 1GPLA 3JQ7A 4G24A 4KQCA 4DCPA 3V8EA 2MWMA 3IMFA 1NVEA 3LM8A 5K2MA 3KSMA 3NP7A 4JVNA 4B33A 1CHNA 1Z5UA 2OD9A 3E3LA 4KW7A 4AIIA 1ZH4A 4WBSA 3OJFA 2Z0MA 1HEIA 3TNLA 4MVJM 4NZPA 4KOEC 3ZOKA 3AMVA 4M21A 4WQMA 4DYDA 3UYYA 3U62A 3CLKA 1Z2AA 4D9IA 1QCZA 2OAQ1 2W7OA 3TIFA 5LBUA 3UGTA 5IFLA 4UNRA 4XGQA 1I0LA 1JHDA 3V8MA 1JDBC 4EG7A 5JXIA 2FFBA 1ITZA 2WP0A 3NASA 5KSZA 1ISRA 4RD0A 4ZGGA 5F7OA 2Z4TA 1Z4MA 2SCUB 3VTKA 2YWXA 3WLNA 1E58A 1EHYA 3N74A 4XX0A 3QLUA 3SVLA 4R1LA 3SCZA 2CZQA 4J8PA 2YHIA 2ZKIA 4FGUA 3HV2A 2ZSAA 3CEJA 4YDHB 5ERYA 3GRZA 2QTVA 4YJDA 3LO5A 5DCYA 1RKXA 4KPYA 3TDMA 3BB3A 3JSXA 4PZEA 2QV0A 2WFAA 5IN4A 1WSAA 3GJ6A 2V0NA 4ZOLA 2PYDA 2LD4A 2R60A 4L5CA 5KFXA 2C77A 3UJDA 1KRHA 2W8LA 4FBGA 1GZ5A 3DYBA 3HB0A 4PLGA 3IT1A 4D79A 1A4UA 2ROQA 3FM9A 1VI2A 1Y7PA 1TEVA 4POAA 5KNCA 2ZUBA 4ZJUA 2HK9A 4U9IS 4I8IA 3THXB 2YNMC 5A4IS 1Y1WG 3A1FA 3QWHA 5AJXA 3U6BA 3WGUA 1ZHFA 2ODQA 4KU4A 1RK5A 1DLJA 2PX4A 3QLJA 1EJ0A 1I3OA 1ZOOA 4QPPA 1FMCA 1ZAUA 4ZZ1A 3VZQA 1GZVA 1XFDA 2QN7A 4HDCA 2R2GA 3CJTA 3OWHA 3EG9B 2XAUA 4HMPA 5KTSA 5GONB 5TPZA 4C2UA 4FNMA 1UT8A 4XGKA 1AHNA 1SD1A 4Q66C 5TSDA 2B1IA 4A2CA 1IHPA 5AR1A 5HCIA 4HYKA 3D3NA 4QIWA 3FLAA 2LWIA 2WJGA 5E2BA 1EVLA 3DVAA 4CR7A 1O6FA 4ICIA 1FUYB 1P4GA 1T3SA 3ESQA 4CV1A 4PPQA 3N6RA 1YDGA 1DC4A 2ZB3A 3EH1A 3BBPA 3GLVA 4N82A 5A0FA 1HNWB 4ZJPA 2ZJ8A 4ZVMA 3L6EA 5BQ5A 4CU2A 1JPJA 1QORA 4QVIA 3SEQA 3IQWA 3W2GA 1XMQB 3B38A 1N2CB 2X1MA 3NXKA 4OSOA 2XD9A 3HA7A 3SQNA 4QWBA 5HDQA 4F71A 2CLOB 1OVGA 2CKMA 3R5HA 4A3JG 3QEMB 2GH1A 5DN6A 2XCLA 4UAUA 5C18A 1XD8A 1YOVB 2QX9A 4GSLA 1T8UA 4C21A 4AYWA 1J5XA 4FHFA 4TQGA 2G28A 2BE7A 1ISHA 1TJ3A 1LTKA 1N4DA 1GP2A 2A9VA 4WTOA 2BEVA 4AL4A 5JNWA 1PLJA 2QI9F 5FPPA 4BBSG 4J75A 2IYWA 3DZGA 4AJHA 1UUFA 3L06A 2FQXA 4HMOA 1R12A 2JRCA 1GY8A 1TGYA 1U9YA 3F49S 1M2EA 4RKWA 4XDZA 4DG5A 1XJWA 5FLXA 4QQNA 1SXJA 4MRMB 2O4CA 4Y1FA 1ULZA 1OYWA 2E6UX 2ZP1A 3CLHA 4ND8B 4OYHA 4QULA 4DC1A 1B43A 2HQSA 4BNNA 4DV3B 2E5WA 3E9CA 1NAHA 3CZRA 2TMKA 1XCMA 1K1QA 3KWJA 3W9YA 3D0QA 3QKSB 1URPA 2BELA 5ALLA 4EJSB 2I6GA 1VA4A 2HX1A 4XSHA 3KO8A 2QZSA 3KPJA 4WXYB 1EUDB 2AR7A 2I4RA 4LECA 4EX7A 4EZBA 4TL6A 5EPUA 5AVVA 3PEWA 1ZOIA 1G21B 4ZMSA 1H4TA 2I2AA 1D8AA 3MT9A 4G0NA 4G36A 1PT5A 4KXXA 4PRLA 4AYTA 1EM8A 5FEUA 3NUGA 4QHSA 4CQNA 2H1CA 2ZTSA 4DPMA 4ENPA 3ZW8A 3THSA 4X6YA 1W581 1YKSA 3TE7A 4CM8B 2OO3A 4IDFA 3O83A 1LDGA 5H81A 2JEGA 1KYQA 4HAVA 1TA9A 3QXSA 1Y3DE 3VDRA 3UAWA 4ZO6A 2P2CA 5REQA 2OGSA 1KQFA 3C5CA 4YGXB 1CDOA 4QWDA 2Y0EA 4Y2UA 5JXWA 3T9AA 4ZOLB 2COJA 4ZCQA 5BYJA 2CUTA 1EWTA 1KYYA 4IEIA 4G85A 4MP8A 1EU1A 1MB2A 5LBTA 1QVAA 4AECA 4E22A 1C2YA 2OFOA 4Y9SA 1JI3A 3K0CC 3U4DA 4KN8A 2BKUA 1LPBB 4NMWA 5HF5A 1N0VC 4PBCA 4IHJB 4J0DA 4BDTA 2B5OA 1L5KA 1LEHA 3SQDA 1RXIA 3FGPA 4O7NA 4DDTA 4QUHA 3R5SA 1CZRA 3QX8A 3HK2A 1H0HA 1N5DA 4XOUA 2C1EA 4PYKA 4KR2A 1IZ0A 4UM7A 2VHUA 3VHLB 5HF9A 2HRQA 3BKXA 2IXGA 3DVLA 4JA2A 2ZCUA 4LC9A 1GLVA 1A8QA 5AVOA 4PYMA 3VTAA 4ZVOA 1I0IA 2WHEA 2ZWOA 3JVIA 3Q88A 4X45A 5DMXA 3BWBA 5HEKA 2R6R1 3KCQA 3AEYA 1M2OB 5HM6A 5B1SA 2IY8A 4K86A 4U2GA 2WG1A 4IR9A 2K4MA 3KJHA 2GAIA 3HNOA 3GTOA 3QMVA 1NJ5A 3CEHA 4L7QA 4TVIA 4HAOA 2J9ZB 2X0IA 3GRAA 4H3SA 4L08A 1E2EA 1HPLA 2JA2A 4TL8A 5A2QW 2HPHA 4W7IA 5DXJA 5HK8A 3QELB 1RWKA 1T1SA 3PEYA 4RK0A 3LHIA 1A97A 3UOWA 5J47A 4AZVA 3DUFB 3B1FA 3EQ8A 3AUYA 1Y1LA 5D5PA 1Z4PX 5JWOA 1AX9A 1UT5A 3S5UA 1R0WA 3CZCA 4PFJA 3HKCB 3M6WA 1OX6A 1QV6A 2R62A 1LZKA 1B6SA 2G4LA 2HIGA 3VR2A 3PXUA 4IMJB 3KYJB 5HUQA 5ESDA 3CEPB 3ZWCA 5MFPA 2EERA 4JQCA 3R7WB 1QVWA 1W85A 4TMVA 5P21A 4D92A 5ELXA 2A1HA 1GTL1 3A25A 4B2IA 1U0BB 3NANA 3HOZG 13PKA 1MRZA 2WTMA 3MJVA 3O8NA 2V6FA 4FOOA 4J7XA 4AY4A 1G59A 1Z13A 4KDFA 1EVZA 4MRRA 4YQFA 2XB2A 3VOSA 2ZS8A 3PCTA 4PWZA 5EZ6B 2OUIA 2RJ3A 1IZ9A 4TGLA 1LKZA 1Z17A 2YWFA 1XLTC 4QWAA 3PC7A 3WTCA 1ZM2A 1I50A 2ZI6A 2HHFA 1QLHA 4HNHA 3G13A 3LDUA 1VRCA 3KJNA 3WDLA 3B70A 1L4BA 2DPMA 2VC2B 4IO0A 4TSKA 1A98A 3R7LA 4NCHA 1VPLA 1W4CA 4P58A 4G5HA 2EXXA 3A6JA 2VUUA 3GJ3A 1FRZA 3H1TA 1D2EA 4ID3A 3AV0B 4M87A 4Q5IA 1P62B 3H05A 2IPMA 1EXVA 2DCMA 3R9XA 2PX0A 3EY4A 1V8PA 1NN5A 5BSFA 1RXVA 1FRVA 5FUYA 3ZUPA 3HKEB 3O8QA 2IZ7A 1DO0A 1H1TA 1ILWA 2V97A 1ZKDA 3JYLA 4H1HA 2JA5A 4N6GA 4U7GA 3HXOA 2ZEJA 2COUA 4JKIA 2G80A 3D8NA 2DQ4A 4UFZA 3DGEC 3OOJA 5LP6F 4H3KB 3FMGA 2Q6KA 3NH9A 4GW3A 4ZGWA 3NW9A 5FI0B 3I62A 2ZSJA 3M9LA 4AG6A 1EA5A 2XGOA 3WB1A 3DHYA 1E1YA 2F90A 4D56A 2R47A 3JS5A 4E14A 3ZCQA 5IT4A 1G5TA 3A1VA 3AINA 4OBXA 2GMWA 4C0JA 4L0MA 4KMSA 1QP8A 3DLHA 1F0KA 1OD6A 1OLXA 1PKXA 1NI5A 1Y98A 3DYIA 2H4ZA 2FW7A 1M72A 4FGKA 3COYA 4FYVA 1D6JA 5AVYA 2WUDA 3NPMA 5I8ZA 2H0RA 1OAKA 2BLNA 2UUCH 4XQCA 5FYDA 1PZFA 4IUDS 1C3LA 3CX3A 3R6LA 4DR6H 5LB2A 1F5NA 1HKHA 4YECA 3VR6H 5U1PA 1WW8A 1KR2A 1L8OA 3FCUB 3DA8A 3PFBA 5CM2Z 3CE6A 2C7QA 3MTDA 1PBNA 2JH8A 4OOEA 4R16A 3ONNA 2F43B 3WA7A 2K87A 4WD3A 2KS6A 4DDMA 2RIRA 1CQIB 4D8WA 4NNOA 1NBAA 1IHYA 2YR0A 3ETDA 4P2BA 3ORFA 2Z1MA 3P2MA 4UBJA 1CW2B 5TR9A 2M32A 4F4CA 4KNVA 1DBIA 1ZJ5A 2ZM6B 1UJNA 3EF1A 4X1OA 5J2UA 3M6VA 4GL2A 4JI6B 4TQRA 3IX7A 1XRJA 2GD6A 1D09A 1WPQA 2BFPA 2GYUA 1SXGA 2RJOA 2PSFA 1QFJA 2ISQA 4W9RA 3OZ7A 1P81A 5CB4F 1E7RA 4DIOA 1SN7A 2GKOA 1XVTA 3DSRA 4GKAA 4DCOA 1O5OA 4NXMH 1JKIA 3AHGA 1DE0A 1U8XX 1JVBA 5KCMA 1HDRA 4EJ2A 2BEWA 1P8LA 3RVRA 4RL6A 2BH9A 2EC5A 2O6HA 2PMCA 2VBIA 4HNUA 3GTPA 4AYXA 1RZVA 1Y1WA 2QGNA 3N7TA 3QX7A 3GDHA 4ZAFA 4HFMA 5IHXA 3ZHYA 2DERA 1II9A 2GEFA 2GCIA 2R7MA 2IUFA 3N8DA 2VXCA 2VXOA 4BVJA 2JI9A 4YV1A 1J5EH 1BYUA 1F9EA 2X9NA 1GG8A 5JAQA 3OPYI 3X1DA 3NKLA 1W48A 4BNXA 1KERA 1KYVA 4PZYA 2IF2A 1OAAA 4C6TA 5ENVA 1USWA 1JAXA 3OLCX 3FKSA 4JLPA 5KYWB 2DZDA 1KDRA 1IXZA 4MVJD 4KV7A 2C7VA 4F4XA 3QV1A 2ZAIA 5KEIA 3MGBA 3G5AA 2FPXA 3T15A 4EHJA 1NG1A 4TQSA 4ED0A 3U48A 1E3LA 4CR8A 2O1SA 5LQJA 1D1PA 1QQBA 3GA0A 3EDMA 3Q6MA 1EQ2A 4B5LA 1PQWA 5FIUA 3OKPA 3H8SA 3PQ5A 3STHA 4TMZA 4FNOA 2HWUA 3VNRA 3BXXA 3Q2IA 3Q6IA 2CL5A 4ALMA 4YQWA 5ADUS 1VG8A 1AY0A 3TTXA 2B21A 2YOGA 5KG2A 4Q7EA 2AOTB 3TRFA 4M9UA 3OHMA 2H5LA 2OHIA 1E94E 3I8XA 4LOIA 5BNZA 1K9SA 1JQDA 1YOBA 1SR8A 1E2FA 2I7VA 2OENG 1ZNYA 3KT3A 3V80A 1Q17A 5JASA 3D4LA 4AYBE 2BZ0A 4R68A 5I5VA 1NDQA 2JIOA 1XTZA 3GLHA 4BWSC 1WEHA 4P4GA 1YQWA 1J23A 3OIUA 4B4DA 4U7TB 3K35A 3PW4A 4JUIA 2O5VA 3RVOA 4HDAA 4K87A 3GJRA 2J0SA 1YBVA 2BGRA 2ONKA 1A5SB 1JFTA 4NYJR 3PQFA 2F3TA 2CBZA 3O21A 3IE2A 3PXXA 1SUEA 3Q5GA 3SN6A 1Q7TA 3GAZA 4FFVA 3TIVA 3K5PA 4EJSA 2WOJA 2UZ1B 1KE2A 2YUTA 4BTEA 3ZOZA 3ZVKA 5DKFA 4IWXA 1N2BA 2J3HA 4ZCIA 2AFHA 1SBYA 2YWDA 4RFVA 1PWHA 3EYWA 2WB1A 5FUBA 3UKDA 4HQFA 3HXPA 3L18A 4ZEMA 1R9MA 4CV0A 4OHYA 4ETNA 1QP0A 1Q1GA 4AJNA 2WPDA 1KAQA 1GWNA 1OXUA 3H2GA 3K4HA 4XPIB 4BIMA 1CZOA 2F43A 1VJCA 1ZNZA 3BF7A 4YRQA 1RI2A 1DKRA 4JI8B 4GC9A 3L8ZA 2D1RA 1XMSA 3H6GA 5ICEA 1QQ5A 4PZPA 1E4EB 4TKZA 1YJQA 3KLPX 1VCOA 2NG1A 3CZ4A 1YS7A 4FWIB 1MT3A 2WINI 4D9MA 5TPZD 2IS4A 4E5PA 2H00A 1UMKA 2C4KA 1SFRA 4RZRA 1KORA 1X8XA 2EU8A 2WD7B 2FLNA 3OZAA 1A71A 1JRLA 3BD7A 3NHFA 1OBFO 2HJRA 4FYIA 4LDRA 4PZLA 3UK2A 2AYZA 1IH8A 2JCSA 4FCVA 3ICOA 4L9WA 4TX1A 2QTWB 3FYTA 4LBVA 5DQIA 2YBEA 4OGFA 4KPUB 5BMVF 2EEZA 1LQTA 2IYQA 5YASA 1SXJD 2CW8A 2EFGA 2GBIA 1L8QA 2PZFA 2YFYA 3HU2A 3GN1A 1CETA 4RWEA 4QNMA 5ADVA 1MUUA 2OZVA 2XVYA 4L27A 2G70A 4V03A 4G4SP 4NDAA 1PS0A 4M7PA 1OXVA 4YT5A 4LY9A 1CE8A 2FMKA 4HP8A 1DEXA 4LSGA 3TNDA 4QUEA 4S2UA 2GBLC 2EQBA 2PSSA 2JFPA 3K0SA 4QJ4A 1CUAA 3E81A 2WHPB 2ZULA 1NYLA 1EXMA 2ZYIA 3DHVA 3TCNA 5G0UA 3TQSA 3EZLA 4E5NA 4YRMA 2JHPA 4KJXA 5IXJA 4TMFA 5KYYA 4E6PA 4ECAA 3V00A 1YRQA 4A6EA 4HYQA 4MVJH 5JD5A 4WCFA 1YIAA 3LHDA 3GVCA 3PUXA 4TVSA 1EFVA 2DLDA 4RIHA 3UHOA 1FX0B 2XA9A 5EMMA 4ZOEA 3TZHA 5LLTA 1IQPA 1G291 4YH1A 4LDAA 2F62A 5TXGA 2W6NA 4EKDA 3ZGZA 1GRCA 2HTEA 3GEHA 1ONBA 3K8YA 4MQBA 2HXSA 1E9AA 1EJ6A 1SOUA 2Q5FA 2XCPA 3F4LA 3A3OA 5F3DA 4AKTA 1Y6RA 1V6AA 2C7GA 1KETA 3LCMA 1OXKB 1N1MA 2EJ0A 1QKIA 4KACA 4L73A 5EHQA 1YB6A 1GYRA 5CFPA 1I4OA 3QG5A 3ZZUA 4C87A 2EHJA 2GXQA 4E4RA 3WO0A 1P8JA 5FQNA 4G4SO 4XRGA 1QKJA 4XLLA 3GTGA 3EFOA 1NTOA 3GIWA 4JLUA 2P6PA 1JA0A 4LPKA 2C5SA 4DEVA 3QX9A 1R5JA 3QEOA 4KQKA 4YJ2F 5FWYB 1ISIA 4ZN6A 1MPXA 5E9QA 1KGDA 1R4MB 4JYZA 4IPTA 1LPMA 3TY8A 4RTSA 1K06A 3R2JA 1KI6A 1UK9A 4GOOD 4BNVA 1TX4B 4BOYA 4HWTA 1K8QA 5KVAA 2RF4A 1QH8B 2CLEB 3GFOA 4RD3A 5FOUA 1SWWA 4MV4A 4OYRA 4LV8B 3RG8A 3RFUA 4RJLA 3O38A 2DLCX 4M1SA 3WRXC 5HS4A 3MR6A 1ID1A 3RB0A 1Z7YA 3PTLA 1GILA 2A92A 1NVDA 3S1LA 3U17A 5A1TA 2GZ3A 3PNMA 3TOSA 2I76A 1RWXA 2XRMA 3WJAA 3W1GA 3H3VH 2QTCA 4NH4A 4IIYA 3DXXA 4HEJA 3QBDA 5DBOA 4C7JA 4AY3A 1ZITA 4C7VA 1LRLA 4RKFA 5L40A 1GPNA 3G5LA 3LXUX 3KFXA 2R1ZA 2QIPA 3LCVB 3PHBE 1I1MA 3P9QA 1JQLB 4ILKA 4M2LA 3EQ6A 4R41A 3W4KA 5K8CA 2IE0A 2WJIA 4YAFA 1G16A 2DC1A 2DSTA 1THGA 3AB8A 3QA9A 4FHZA 1JZSA 2WWVD 4BL5A 1DJMA 3SQOA 3EOBI 3LP5A 2PE5A 3KEGA 4P22A 1M1NA 3I92A 4ZU6X 1MH1A 1V26A 4NS4A 4Z4CA 4WZ6A 3ZIAD 4R83A 4A5SA 4HT3B 1P3DA 2C9DA 3A1SA 3NVMB 4WFQA 1LF5A 5SZKB 2Y6VA 3NEPX 4MNTA 2VIIA 3D3QA 5LMZA 2IU3A 2ZCVA 4UTRA 5K51A 3KZCA 3DKIA 4LXXA 4D7AA 3PUZA 3ORYA 2VTBB 4IGKA 5TX7A 4M1MA 5IN5A 3R3UA 3H8WA 4PXYA 5EJMA 4DBLC 1Y5RA 2F67A 2QW1A 4L8FA 1GAJA 5J2TB 4R7RA 2AJCA 2PSHA 3EMVA 3PQ3A 1ONNA 4JYPA 1JG3A 2ERXA 1Z74A 4ACBA 1RWWA 2VDKB 4F7DA 3GRRA 3RRFA 4GI1A 2XB8A 4JI8H 3FNGA 4RV5A 3QPWA 3BG5A 1OAOA 3VZCA 4D45A 1UBJS 2GJSA 2B92A 3MWFA 3NTUA 1JLLB 4FU0A 4GBGA 2GN9A 4M0JA 1UKAA 4J0IA 4WY5A 5K4GA 5H4GA 1X14A 2J9FA 2ZRFA 3LECA 4PLTA 1C0EA 3PO2G 2Z5GA 3G8BA 5ALYA 4BAZA 2PJUA 4BX0A 3UV6A 3UHJA 3TSCA 3FZEA 4X71A 2FQ1A 2WIKA 4DF3A 1N32B 1FW8A 5KNDH 5HW0A 3AVWA 4JV5B 2FPPA 4MS3A 2H31A 2JIMA 1X86B 1OC4A 4QW9A 1AUPA 2YV4A 3JQPA 3FOZA 5KOIA 4GOKA 4X8MA 3FH0A 2X41A 4MQLA 3RIHA 1G38A 2JVIA 3I9OA 5IZCA 1I3QA 2O8NA 1JHMA 3QLVC 4QFCA 3OTOH 1OLSB 3JSAA 3LAWA 3NV7A 3V9PA 5JZMA 3DG9A 4WN9B 3DFMA 4DPKA 4KO1S 1OTHA 4OO3A 1YTLA 5CDFA 2A78A 1RRFA 3SKXA 3ZIDA 4ZIRB 4I55B 2QRPA 2Q7OE 3W2FA 4YRSA 4OX9B 1K75A 3LKBA 3A06A 5TEWA 2B35A 3RVPA 5CPFA 2Q2VA 2W8BB 4KXNA 4BFTA 3GLIA 3MQ2A 3QOWA 4O59O 2WF8A 5ICGA 4O7WA 2YU9A 1JGTA 2GPTA 3DE2X 4MA4A 4QPZA 3OZBA 5FV7A 1EJBA 1XEAA 4P1ZA 5DXAA 5H3HA 4BNMA 1LX7A 4R84A 5CW1A 4WZBE 5CEJA 2E4UA 6PFKA 1Y82A 5IWAB 1FFWA 2NPFA 4CKWA 5JQGA 3KHHA 3OCVA 4IW3B 1GGEA 4AYBA 1GYFA 4WLFA 2FN9A 1XXHE 2PS1A 2YFHA 1FS4A 1D6NA 1NMQA 4J49A 2H1HA 4ONEA 3ROZA 1KI9A 1XA3A 5H80A 1IFXA 3DV0B 4EMSA 3HP1A 5FOSA 3ST7A 1O2DA 2HIHA 4II2A 3MS7A 3TKAA 5J4LA 4BFWA 3HM2A 4ETIA 3AF1A 2BONA 1DXOA 1QFMA 1EK0A 1VHJA 3BTUA 4FD2A 4IILA 1TMYA 3GD7A 3WGGA 2GEKA 4H1VA 1TLFA 2O1EA 3CF4A 1ZLYA 3KOXA 2ASVA 2N1BA 2NTVA 3T5KA 2JIZA 3PCXA 4K6KA 4U2EA 5IMSA 1DDGA 3E2PA 4DCGA 4FFSA 3M1IA 2I7XA 3KR2A 3TEJA 1IOZA 4Q3LA 2C2YA 3TRIA 2PT7A 1I9CA 1KYIA 2NGRA 4PZAA 3S8YA 2OWOA 4RADA 2OESA 1IVYA 2IEBA 1UDBA 1VL5A 1SXHA 1PQYA 2MCTA 3I4NG 2X23A 2BT4A 2QVZX 2ZJBA 5IP9G 2XMRA 1U7ZA 1Y9ZA 3K0FA 3OPQA 4GMHA 4LZWA 3WZMA 4AS2A 1PFVA 1P80A 1P7ZA 3M34A 3BQMB 1GJRA 2DP4E 5KNBH 2WB2A 4TUYF 3BXZA 4YO8A 3R4VA 1EJ2A 4NKRA 5KFMA 5AI0A 4MWBA 4IDCA 3RC9A 1NLUA 3VX3A 4O3MA 2D8AA 3BHNA 4BX8A 5JJ5A 5CNKA 5DGCA 3HCBA 2FSFA 2X6RA 3IO5A 1OYVA 4J43A 4CM8A 3DLBA 2VUMA 1ULSA 4PAOA 4UEJA 3ACCA 1NRIA 2I1VB 3BDVA 3CNQS 3JATA 3WNVA 4C5CA 4WUVA 1L4HA 3NORA 5CH5A 4XASA 1I7QB 2HBQA 4QKQA 2WNSA 2PANA 3B5JA 1NQTA 2V7WA 3EQ7A 4YROA 5HFJA 3H42B 4I9UA 1E0DA 2JL1A 4UQLA 4K0KH 1EPUA 1KK1A 2M2IA 4GZ3A 2QX4A 3NHRA 1R9TA 3SM3A 5CK5A 5HOQA 3NBYB 1DQRA 3OC6A 3T35A 4MKGA 4NZZA 3OPMA 1QGDA 3M6IA 2BEKA 5K0JA 4TV9B 3BH7A 3JY6A 3ED5A 3NAZA 4GMGA 4HTAA 4JSTA 2QM0A 4PTYA 1EKPA 4I3GA 1TUBA 4KHPH 5G3ZA 3R3HA 4BO3A 1SELA 1HTTA 4QZVA 1IUPA 3D43A 2O3TA 1UMCB 4PFKA 2CFIA 1QG0A 4HVLA 2Y0CA 4WFIA 1LVUA 2O3RA 1X3LA 1T8SA 2AI3A 4JI4H 4DQ0A 1JHYA 1MX3A 4WKCA 4A93G 1QV9A 1UMBA 1G5RA 4HNVA 3MWJA 3QUTA 5DQGA 5LJLA 2XCOA 1TD9A 1M1NB 1PFKA 4DZZA 1C9NA 2VSYA 1JAIA 4G0PA 1JKMA 3M1AA 1TC2A 4PWYA 2CEAA 3ONDA 4RVGA 2IBSA 3WWHA 4ECUA 3FNRA 2H3EA 3X0DA 3P5BA 1KXJA 2QMHA 2F3RA 3ZJYA 1NJ6A 2LIVA 4BGDA 2GD2A 3CN7A 3SSAA 4F6LA 3HGTA 3LLSA 3O3OB 1SBIA 1OA0A 4TLMB 2KHZA 1ZICA 5C37A 5AKGA 1CIVA 1XNHA 5LOVB 4ZVKA 1KVTA 2ZJZA 4IZ6A 1VMKA 4QGFA 1GGVA 1AF4A 3JSLA 3GT4A 2QLLA 3VSEA 2PBLA 1UC5B 1KDZA 4L07A 4CQLB 4G0UA 2QAGA 2R8XA 4KQMA 1G6Q1 4BVGA 3W6PA 3WOHA 1DV1A 2ZB8A 5BQOA 1G6KA 4BHTA 1GITA 3ETLA 4KR0A 1AQJA 4IIHA 1BDHA 2VZLA 2H16A 3FUWA 4Q15A 3P9NA 1XF9A 2X4DA 1UPXA 2YQ5A 1I94B 3JSNA 3LI2A 5JXGA 1TEZA 3ESXA 4JBNA 4BRUA 1Y6GA 3B12A 1FS6A 4LOLA 5FB3A 5KKAA 1W93A 4GI3A 3KU1A 3NDJA 3HU5A 4RK7A 3C15C 3UMRA 2AI2A 4YBZA 2Y77A 1I4TD 1RDFA 2RARA 3C3MA 3EYAA 3TKLA 4HBGA 4KVZA 1DQSA 3I9JA 4MLPA 4BFSA 4BO1A 3HOUG 1Y89A 2H2FA 2A0XA 1ORHA 4AF6A 5JT1A 1ULHA 5LZ8A 2IHKA 1ZMBA 1MDFA 5A6VA 1ZK3A 1RKQA 2DVMA 2Q0SA 2WIBA 2XUAA 4RE5A 2J3EA 4BC0A 3QW4B 1FKAH 3H9EO 1XOIA 2ZBVA 4CL8A 1KJNA 2R5NA 2E7ZA 2OBNA 5BMVB 2CD7A 4M22A 2JZNA 4ZO8A 1IEVA 2HSZA 4Q9NA 1Y1VG 3LVRE 4B8WA 3KFLA 4IV8A 1OI4A 2P67A 3BMCA 4D80A 5IRCD 3UMBA 1OLXB 1RHUA 4KZPA 2HRCA 2J85A 2II6A 3HG7A 4LTNA 3EW9A 1T0BA 1Q21A 5TQ2B 1V71A 4NX2A 1WB6A 1X77A 1X94A 4FK8A 1U8CB 4R1NA 3M4XA 3WLTA 5F98A 2J0UB 3DFKA 3T4PA 1SFOA 1TC1A 3DULA 1Z6ZA 2GJAA 4N4AA 4TMYA 4LFCB 4L78A 3LH5A 4J0QA 5KTOA 4KYVA 3U60B 5EHGA 1KI1A 1UEIA 3ZXYA 3TR5A 2H65A 4RK4A 4KN9S 4C0QC 3M4IA 4JD5A 2JJYA 3C6XA 3NDRA 3V7FA 4KGVA 3SJBA 4JI5H 4IHQA 5ALWA 1VKOA 4OL9A 4OM8A 4D25A 1XA0A 4EMTA 1TE2A 1EXDA 4NI5A 1FIUA 1GUYA 1W6UA 3IBTA 4JZYA 3AEKA 2HHAA 1SCAA 3MR2A 5DGBA 1JFVA 4DCMA 1WXIA 1SYXB 3I4MG 2VPXA 4OK5A 3C98A 3EUFA 4GQBA 5K8IA 4RV9A 1EK1A 2FR8A 1W30A 4EYSA 2CNVA 1NHWA 3I4LA 3KQPA 4OAOA 3O6VA 5CD9A 1JFLA 2BFCA 5KKNB 1EFDN 5CXUA 3M5DA 3OT4A 2QG9A 4HXYA 3HBJA 1MZPA 5EZYA 5F9LA 2QX6A 2ZRMA 1X1AA 2C31A 3WBFA 4NCBA 2C7RA 1D4FA 1JS1X 1NRJB 2OOSA 4JJ6A 1G5QA 5B58T 3I5YA 1X7HA 4FI3C 4Q9DA 2FW0A 3IC5A 1X39A 3O1IC 1FJHA 4MWGA 1OWPA 1X80B 4MSUA 4UPDA 5I9LA 4YHHH 1DRVA 1TCVA 3OKAA 2K7FA 3GLFA 4AURA 3RIXA 3VJKA 4MPTA 4YRKA 5LUAA 3CB4A 3C6QA 1N25A 3P9XA 1P2BA 4DIDA 1B0UA 3WWOA 3C4VA 5JTUA 1P6UA 4IQ4A 4Z3KA 4RL4A 2CJYA 5LQAA 4DR2H 2HHHH 2CLLB 5KB3A 4BECA 1JEQA 4WCVA 3T3EA 1Z2PX 2R8PA 1EB9A 3O9MA 5F12A 2XXAB 3L7AA 4IGAA 3EFEA 4GX5A 2Y6UA 2VDVE 5FHRA 2XWBF 2J7KA 2LXNA 2C4UA 1NVFA 2XIGA 3D4OA 3QPUA 4PHTA 4QFDA 3SAJA 2QTMA 3I4CA 1DC8A 5KNCH 3B7WA 3FFXA 1BJRE 1PJZA 5KYXB 1ESZA 3CXRA 5F1OA 2IWHA 3SK0A 3ASYA 3PQ4A 4PANA 2P1RA 1ZBDA 1FSFA 3K72B 4Q12A 1FYEA 1KZ4A 4PHGA 2VEDA 1X0VA 3FCEA 4UCOA 5K3OA 2IGBA 1G55A 2P7HA 4A8PA 4B3XA 3GO4A 1PS8A 1SUSA 2FWIA 3UK0A 5ALOA 4JJZA 2Q3JA 1ZX1A 2QM3A 1WG8A 1HT0A 5EWJB 2HJSA 4K81B 2O23A 4TL7A 1B7GO 1OFHA 2CZCA 2Q2WA 1TU4A 1E2KA 1PEDA 3AESA 3W9UA 2G0NA 4EGQA 3X1YA 4AFNA 4CXMA 2W2OA 1ODJA 4I2NA 2QX7A 4RB1A 4PGFA 3IKTA 2BEUA 2M9MA 3AJ9A 1P1FA 4FMCB 2ORVA 1VG1A 2PZMA 2R5WA 3A9WA 5AJVB 4FEEA 3EEYA 1L3CA 1C4XA 2DTEA 3FFBA 4LNUA 3PHLA 3RRYA 3MBKA 2EF1A 3A3PA 3L5KA 2JCXA 4PLVA 3UFBA 5TQ2A 3OC0A 1G5PA 4XXHA 1EM8B 2QSUA 4DNQA 2WU0A 3UW1A 2ZZNA 2ZWMA 3RV4A 5EIOA 4O4JF 2LDXA 3WFZA 3P71T 3U7QA 4CPDA 1XD2B 3DT8A 1KEWA 1W88A 5KTNA 5LOVA 4HZUB 2PGXA 3BKWA 3I2KA 2K7ZA 1ACLA 1L4GA 2DTXA 3IBFA 3NHAA 4ZCRA 4X63A 4QWWA 5K6TA 1LBQA 1QAMA 1CUHA 4PLPA 1DKQA 2QJFA 3O8OA 5EGNA 3TQQA 3PXCX 2CEKA 1YF3A 5HJEA 3OT5A 4KXYA 2VLBA 3DBOB 3IALA 1GKYA 3L0BA 1SC3A 4XH9B 2CC2A 3QKTA 1O54A 2W58A 5KFAA 3OY7A 3C4JA 3EVCA 4WOCA 4YAGA 1J1UA 3TDKA 3VPGA 3IEKA 1ZVVA 4IXWA 3UWPA 4ZT3A 3RC3A 3J7AC 3TBFA 2HOQA 2J9GA 3TXYA 2GEJA 2NUTB 4ENVA 1X7ZB 5JY1A 4JJ4A 3HMQA 3MCWA 4R6XA 1QH0A 4XE5A 3OU7A 4BKPA 1RTKA 3ZG6A 2H1IA 1A27A 3JD0A 4G63A 5E7IA 1NTRA 1UOPA 5EZQA 3UMSA 2M98A 4KO8A 4EM6A 1WUJS 1V11B 2CBXA 1PR9A 3BTVA 4QDKA 1GR1A 3K6SB 2I7CA 4PNZA 3LYUA 2WJ6A 1LLFA 2PRKA 3CH4B 5GZ6A 1VTKA 3EQZA 3PFHA 4LMAA 5H9WA 5K8UA 1ANKA 1G6HA 5KYNA 3SOZA 5H8WA 2GAOA 3OCJA 2BTOA 3AFIA 4P4LA 4Q47A 3V1MA 1LW7A 1Z45A 2CNNA 4MCHA 3W79A 1P7WA 4CUZA 5LDDC 1S97A 1JSLA 1VJ0A 3R9KA 5HCUA 1C7QA 3LY7A 4HDNB 5D84A 3BZUA 3JPYA 4Q93A 5FUVA 1J0BA 2CHUA 2MSEB 1TMOA 2QMUA 3D8RA 2WTUA 1L5MA 1T2AA 1FPMA 3CX6A 4GXQA 4Q9LA 2DFNA 5CLGA 5FPYA 3HNRA 1O96B 1CZHA 3DDNA 4IGEA 4JMPA 4M55A 4YQEA 5SYMA 4B79A 2P35A 3D3WA 2WSSA 2JIRA 1C0PA 3FMIA 4QBHA 5AKLA 1QTQA 2XMBA 5K3BA 1TQ2A 3K9FC 5T4BA 4Y98A 1J9EA 1U8YA 1V1JA 2WJWA 4QUJA 3GGPA 2NSJA 2AU0A 5FOVA 2E87A 4ZVTA 4H08A 3T12A 5HZGA 4FR2A 4OSEA 2IPOA 4TUYA 3FZYA 4WFJA 4OJNA 3GLFE 3FYCA 1XEWX 4ECXA 4UJ3A 5KBYA 1DUSA 1EKFA 3FUVA 2O8BA 2FSGA 2BZGA 4MLDA 4LWOA 4NCKA 3L4EA 1SRQA 1I01A 1GL3A 2ZJYA 5I7SA 2AW3A 3I5MA 2WKPA 3ZXIA 4YXWD 3IQEA 2I1QA 2GDZA 3WGHA 1QIJA 2C8JA 3CIFA 2F55A 3H4BA 2ISCA 1VL8A 3CW8X 3K9BA 4L3OA 4FFPA 3LYHA 5CYOA 5TQ0A 1Q6ZA 1SCQA 3ESRA 5FWXB 1QVVA 1QF9A 4L57A 2GBGA 3I72A 4PLHA 2CF5A 4ED8A 1P39A 1IJFA 3DE7X 1IWPB 1CVLA 1SUBA 3N6VA 2Y4NA 4O4IB 2X1HA 4F4JA 1TK9A 2W43A 1SY7A 5DF1A 5NULA 2WM9B 1P0IA 3LTEA 4ETWA 2D5CA 4J0MA 2IDMA 5KSYA 2Q6VA 2FPGA 5U4XA 2HJVA 3PNVA 1N1DA 3A0RB 3Q8PB 4CL0A 1AQLA 2WVGA 3Q8SB 3EGXB 3O4RA 5HJ2A 4MUJA 4H77A 1BJTA 1DC6A 1NXXA 2W70A 1TZKA 2MSLA 3PPXA 3I34X 1OWTA 1JEEA 1KYZA 1PNQA 4ECQA 2KM1A 4RO0A 4B17A 3HRHA 3SR3A 2FDCA 3W7VA 1GOTA 4DTCA 3HCRA 1YAHA 3FNBA 3RVDA 2PPVA 2JAWA 1KEPA 2C7OA 4C04A 4U5XA 4IVPA 3DO6A 3OTGA 1LNZA 1HOTA 1YQUA 2BR5A 4A3CG 3A2NA 1LDEA 1N6RA 3MQ4A 3OFND 3CX7A 2C4MA 2AMFA 2Y1WA 4K3VA 4KODA 4Z1MA 2W9CA 4GI2A 2W4IA 4LZOA 4LXUA 3A7DA 1P9NA 5EIAA 2I6FA 3ZDFA 1HYBA 5ALVA 2A30A 4BP1A 1PR0A 1R4ZA 4LWZA 2REQB 2LGJA 4OJYA 3C43A 3AUKA 5I4BA 4JI5B 3VKGA 1BVYF 1C9JA 3G0CA 1IRXA 3T5DA 4AUEA 4PBRA 1R0YA 1L9KA 1XALA 1QHEA 1Y37A 3UPDA 2VTBA 5AJZA 3V5NA 4PYIA 5K3WA 1IZYA 3PR5B 4B3SH 3AFOA 3QUSA 2IIPA 4BY1G 5DYIA 3RRNA 3C4QA 4O4LB 5IKEA 3KKNA 3F7MA 4U7PB 3WLJA 3O8OB 3ZDAA 2XT9A 3WOVA 3A4NA 5ITVA 2IW3A 2O7RA 1H3FA 2B2NA 3SPXA 1B4DA 1N9ZA 2ZQZA 3NM5A 4FHGA 5IDVA 1U9ZA 3VR0A 1U7WA 3NRJA 3OQ1A 1HK7A 4B8ZA 3K4PA 1L6RA 4LOAA 1C3OA 2B8NA 4OJQA 3T3PB 2R85A