2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
2J9GA 2CZGA 4MV8A 5BPFA 3KAKA 2W71A 4O7NA 4O7LA 1B6RA 2GPWA 2SCUB 4O4JF 4DIMA 4MV9A 2FP4B 2FPIB 4M9CA 4Y8VB 2OLSA 1DIKA 2R7MA 1M0WA 2ZDGA 5JVLA 4MV6A 5J2TF 3GIDA 2XD4A 4YB8B 4O83A 1PX2A 2YW2A 1GGOA 4YAKB 4GGMX 3OUZA 2VR1A 5KKNB 4MV1A 1BXRA 5BPHA 2YRXA 4J6EA 3BFPA 1IOWA 4ZQIA 3G8DA 3V4SA 4FE2A 1KEEA 2CNQA 5H80A 2ZDQA 1GSHA 3N8DA 3KALA 2QK4A 3K5HA 3JZIA 4QSHA 2R6FA 5LXTF 2YZMA 4C5CA 2GPSA 2YS6A 4IZOA 5CAEB 2QF7A 2VPQA 1CS0A 1M6VA 4O86A 3HO8A 2R7LA 1BNCA 5JH7F 5LOVF 3Q2OA 1E4EA 1T36A 2PVPA 2PN1A 1OBDA 2NU8B 5JVDF 5DMXA 2I80A 4IHJF 3I12A 4ZI7F 2I87A 3HB9A 3G8CA 3RFCA 5J2UF 2R7NA 1JLLB 4NYEA 3VPCA 5CB4F 1KC7A 1KJ9A 4HNTA 4O7TA 2R82A 4L1KA 4IWXA 3RV3A 1PK8A 3ETHA 3AX6A 2P0AA 4FFMA 1ULZA 3MJFA 2NPOA 4O7VA 1AUXA 1CQIB 3TIIA 3KAJA 2Z02A 4EG0A 3JRWA 1W96A 4IIJF 1JDBB 3BSYA 2DLNA 1VKZA 2I8CA 1VBGA 3HBLA 4TV8F 3Q1KA 4EABA 2NUAB 2NU6B 4FU0A 2NU9B 1KUTA 1Z2OX 4MAMA 2V5AA 3U55A 4O7SA 4FFPA 5K2MA 5C1PA 3VOTA 4HNUA 1GLVA 4IWYA 2X0SA 2PBZA 4RZQA 3R23A 1UC9A 5KX5F 2YWVA 2CQYA 5D8DA 2Z04A 4I55F 4C5BA 2R84A 3UFXB 2XCLA 2YRWA 1I7LA 4XX0B 1VBHA 2CNUA 4EA9A 2W6PA 5LA6F 1UC8A 4ZOLF 1KJJA 3TIGA 5C8YF 4I50F 2YZLA 3BSWA 1WR2A 3WNZA 5HV6A 5BMVF 3K5IA 2V58A 4HR7A 1IOVA 4TV9F 3R5HA 1A48A 4XZ3B 5I47A 3KREA 2YZGA 2W6ZA 5HBRB 4ZHQF 1EZ1A 1W93A 2FB9A 3BSSA 3QFFA 4MV7A 2W6MA 4DLKA 4M99A 1GSAA 5LP6F 2GLTA 3MWEA 1SCUB 3VPBA 2W70A 1Z2NX 3ETJA 1OBGA 4FFNA 3LWBA 3VMMA 1EHIA 4HNVA 3VA7A 1DV2A 4O84A 4MA5A 3R5XA 3N6RA 3V4ZA 3GLKA 4O4LF 5CA0F 2W6NA 3MWDA 3BG5A 2CNVA 2YZNA 3R5FA 1CE8A 4C5AA 3R9RA 2GQSA 5IYZF 1GSOA 1KJIA 2R86A 4ME6A 2FPPB 1I7NA 2ZDHA 1EYZA 3RUPA 4O2BF 1AUVA 1EUDB 2DWCA 5CA1F 4EA7A 3JRXA 4FGRA 1DV1A 2R87A 5GONF 3SE7A 4XYMB 3AW8A 1EUCB 2W6QA 5FNVF 4EGJA 4FFOA 1C30A 4MV3A 4EAAA 2FPGB 3NUAA 4WD3A 2DIKA 4O82A 4O4HF 3TW6A 3OUUA 4YJ3F 2YS7A 2R7KA 4M9UA 3WO1A 2DZDA 1E4EB 3E5NA 2V59A 3ORRA 1M0TA 4EA8A 4EGQA 2VQDA 4I4TF 4O2AF 5EZYF 2YYAA 4O7RA 4YJ2F 3VPDA 1JKJB 4TUYF 4WBNF 1B6SA 4HQ6A 3TINA 3U54A 2GQRA 3U9SA 1KBLA 4MA0A 4YAJB 4O7YA 5LYJF 2W6OA 1JDEA 4YBZB 1KJQA 2YL2A 5JQWA 3JZFA 4O7ZA 1A9XA 2VHEA 4FFLA 3RV4A 4M98A 4E4TA 5JQGF 5C1OA 1Z2PX 1C3OA 2HGSA 3WO0A 3DF7A 4MV4A 4FFRA 4XYLB 2HJWA 3U9TA 2C00A 2WYOA 1KJ8A 4O4IF 3K3PA 4O81A 4O7WA 3LP8A 2NU7B 2R85A 1CQJB 3ORQA 3TQTA 2IP4A
chains in the Genus database with same CATH superfamily
2HHCA 3ROQA 1S0MA 2XTAA 1AZSC 1TZKA 2ZI6A 3I4CA 4D5EA 2UKDA 1KEWA 1DFIA 1NW3A 3ENKA 2GF0A 2A1TR 1IEQA 1KP9A 4TKZA 3H3JA 1FP2A 4BO2A 1ZD5A 5K8VA 1RRCA 3R09A 1VYHA 4R9VA 3V6HA 1TU3A 2XCTB 2VPSA 5IC6A 3PFFA 1IYEA 2JD0A 3K71B 1DBPA 5JAMA 2DFTA 3JQPA 1IOWA 5E4FA 3WGZA 4D6YA 1Z4MA 1BQ3A 4TSFA 1FLAA 1CRLA 2Z6QA 4J0IA 4MI3A 5ADUS 4OO3A 4NQRA 2X42A 2FZ4A 5TPWB 2Y2UA 1YO6A 1FLDA 2ZAMA 1G16A 4CMHA 2KMLA 2HMWA 2JLCA 4QNNA 1T2UA 3MM4A 1AUPA 4UBKA 5LB4A 4R68A 1AV7A 3MS2A 3TRJA 1IYZA 5IFKA 2JCXA 4K6KA 4JI1H 3PRHA 4X91A 9ABPA 4AP9A 4X7BA 2WMOB 1DUIA 4ZI7F 1FFXA 3S1AB 1E1DA 5FDFA 5IARA 5A62A 3EPKA 3WLRA 3IVAA 1M2VB 4J94A 1KSJA 4I1UA 4I2NA 3FZYA 2WVJA 1TCUA 2ESRA 5T7BA 4YT8A 1K1SA 3PICA 3L4BA 3UGQA 4BKRA 4F21A 8GPBA 1YB2A 4YP5A 5CDHA 4OQFA 5FKJA 3AR7A 3R9KA 1YVEI 3C48A 1N2HA 3HWX1 1ILEA 3QU7A 5AW0A 1X42A 1Z5OA 1B0ZA 3RBZA 1H05A 5KPDA 2Y05A 1JDZA 1HUQA 2CL6X 2IHYA 2P6UA 1NR1A 4YQEA 3JZMA 4PZPA 1GN9A 5IULC 1A27A 5EMNA 1J0XO 2BTEA 3UFXB 3WGHA 2GPNA 3G2PA 5LA6F 3EGEA 3PX2A 2I8LA 4HRXA 1E79A 1UM8A 4QICA 1JU9A 3HKBA 2NO7A 2B1IA 5LUBA 3WLMA 3QEKA 1IZYA 2MSCB 4CM8A 2V6BA 4WQMA 4B3CA 2VLBA 1Z7EA 3EUEA 2IYZA 4NLLA 2I91A 4J7AA 4CKZA 2YUIA 1WY7A 3I04A 4GXQA 1OT3A 1ST2A 4KQEA 5D5PA 4EFEA 2DT8A 2AI1A 1C8LA 2YXPX 2JH9A 1DRWA 5E0OA 1DKOA 3IQZA 4JXZA 2HGWA 2IV3A 5CBPB 5HZGA 1ZNYA 2CEKA 4CEHA 5FFNA 3IRUA 1JA9A 4G1FA 3QYFA 1Q83A 1A2QA 4EL0A 4YCDA 3QQPA 3DEFA 3RB8A 3VKWA 2HQSA 4IDHA 1GQYA 3L4JA 3GGGA 1GPAA 4KGXA 3TNFA 3SGLA 1SZPA 1ZIYA 1KEUA 3A1EA 2GM5A 2W2LD 4EJ0A 4RTPA 1CQJA 2H2FA 3AEKA 4EATA 2GB4A 1E3QA 2IYFA 4WZAB 4I6JA 3DVQX 3D4PA 4GKJH 2UXCB 1Y63A 5KTTA 1E61A 2IS2A 4RZXA 3QBTA 3NRBA 1Y1KE 4CGYA 3NRCA 3HFJA 3BIJA 1WDKA 2Y1CA 5BQ3A 2ZR9A 4O1MA 2DHEA 2AXEA 1R00A 1UINA 2VAMA 1GGFA 4HLUC 2GN9A 3C5WP 1YHZA 1ZD4A 1PT6A 2XRMA 1T2EA 3KEFA 4LTMA 4GX0A 1N3IA 4E3ZA 5DN6D 1NRJB 4XVUA 1J8QA 5FL7D 1XJQA 4X92A 2Y93A 3MVEA 2OHIA 3OZSA 1SM4A 5EPOA 1GXSB 4G4SO 4N49A 1ZVVA 2IFTA 3KOWA 2YZKA 2HRDA 1HKUA 3N2ZB 3WLSA 1I2MA 2C04A 4GC9A 3RIHA 4NMWA 4R7GA 2OXFA 1PZEA 1TVKA 4FFVA 2OLSA 5BVGB 3FCEA 3G82C 3RU7A 5JJBA 3CNQS 2G4LA 3H4BA 3QWUA 4E5SA 3RVNA 2G9VA 2GSWA 3D0QA 3W79A 1NBOA 2ILVA 3OM9A 3TFWA 5G0WA 3IV9A 2LRHA 2JLWA 2IGTA 4DZTA 1ZSNA 2J0VA 5ADHA 4CM3A 5LQRA 2NUAA 3QKWA 4NDAA 1Z9BA 3NHWA 1H3FA 4I5IA 1NY6A 3VJKA 1E64A 4BXXG 1SQFA 4U3JB 4Z99A 1YUBA 2FLWA 4CTKA 5KFWA 4M1QA 4O86A 1ADGA 1SD1A 3INNA 2ZWOA 4C21A 5FOVA 2RKOA 1UQTA 1VCHA 4E7PA 1C80A 3UAXA 1W5EA 1DG1G 5JQGA 4EX7A 4HH1A 4EUSA 1H9AA 1FSPA 4N40A 3WRXC 3HFGA 1US8B 1WTCA 4J4BA 4IFIA 3GARA 1TWCA 2XGOA 2PUJA 4ZAXA 3I01M 4FLFA 3X1XA 4U02A 3D6NB 1V8OA 4UNSA 3S2FA 1UJBA 3H0GG 2IA5A 3KETA 1XV5A 5KFZA 1M0EA 5FFFA 4XFKA 4GXTA 3R3JA 3I05A 1MO6A 2YN0A 5I5VA 5ITWA 4RA6B 5AVOA 2BAGA 3V1KA 5LZ7A 2H4ZA 2P9QA 3TOXA 2W6ID 2A9PA 1ADCA 5MGNA 3I23A 2PSSA 3OLWA 4LSXA 3QK7A 4RTNA 2ZRJA 3QE0A 2DPIA 1QLJA 3TX6A 1CS0B 2YRWA 2FLPA 2IZ7A 2ZYIA 2I3DA 4Z54A 5B6IA 4IV0A 1HG1A 1Z5PA 1GITA 1X1AA 3AJRA 2W37A 2DBYA 4CW7A 3WLNA 4DMLA 3MQ2A 2FN4A 3KPYA 5DVZA 1JG3A 2BMWA 2IVZA 2TS1A 2P4HX 2OY0A 2QRLA 2WMDA 3BSSA 2EIYA 2X4GA 3GJXB 2ZJTA 3OESA 3L8YA 4P5PA 4ID3A 2W0MA 4A36A 3RO7A 6PFKA 1FMTA 4EHDA 3DBIA 3LPNA 1T9CA 4JYCA 2OAQ1 3QEAZ 3DHVA 3EGWA 3M1YA 3BJRA 3E3LA 4DWVA 4AY6A 3N8GA 1XU4A 3GRUA 3VDRA 3J7AC 5LWQA 5FR1A 5L6MB 2DMRA 3PNQA 2HQOA 5AO9A 1EYZA 5DKFA 1JPJA 2WZCA 1B26A 1I3QA 2MSWA 1RAEA 3QI7A 4UHCA 1T34A 1PG0A 2F9MA 4BDTA 3ZWBA 1V11B 1BE1A 1H9BA 4CEIA 3IQWA 1JZQA 4PPGA 5KYUA 1TUGA 1BS2A 3IPLA 3L93A 2WJWA 4RWEA 4HGRA 3EJ6A 1RS0A 3E0QA 4G4SP 2X8BA 2QKYA 2DR2A 3C6ZA 1ZZGA 2WIDA 3AF4A 4TXHA 5C4XG 2DKOA 4YB8A 1G5HA 4PLHA 2I3ZA 2PLFA 4RSHA 3E7FA 5AXAA 2WG1A 1H5QA 1XD9A 2ZKLA 3I4MG 3L6BA 3MERA 3OTOB 3KXIA 2WJZB 2B30A 2RH5A 4DCPA 5EMKA 5AJVB 4A10A 3QU9A 1O89A 4FX5A 1G4AE 3WLAA 3D4IA 2W58A 4LAFA 5E6RB 1UAGA 1JEQB 4PYNA 4CFSA 1SAYA 2NSYA 1B15A 1PHRA 4RNNA 3M0EA 1B04A 1WPGA 4NYJQ 3TTWA 4LHSA 3KLNA 2CW8A 3T5LA 1ELOA 1PD1A 1Z25A 1RXIA 4I9GA 1W47A 3EGOA 4KREA 4YXWD 1Z5GA 5IAAA 1YZNA 4GLBA 2VKTA 5ITVA 1OFUA 4DY6A 2IZ6A 3ND9A 1WM1A 2G25A 3ZHCA 2NVYA 1M2NA 4FILA 2CJWB 1G2OA 4TTIA 1M2GA 2ZT8A 5E3IA 5EUMA 5MFZA 4FE2A 4LF8H 2AR7A 1ULAA 4HH0A 1JB1A 4TYWA 1CRZA 1BMQA 1XMSA 5AM1A 5TQ0B 3AFOA 3AHCA 4WH0A 3MBKA 2VPQA 4TYYA 2ZYDA 2ZJ8A 3MC1A 1JGTA 1N32H 3IXLA 4OQNA 3RR2A 3ZWVA 5LOVF 3O8BA 5AVQA 4XDYA 2A5JA 4D74A 3ZJYA 1KEPA 4MS4B 2JFYA 1Q20A 4IUDS 2FPXA 4ND2A 1SZJG 4XQGA 3M6IA 4LSZA 2OBXA 2ZB4A 3PE6A 2IV2X 5BN1A 4F1KA 3IJPA 1ZU4A 2V6MA 4ZN6A 1SCUA 1WBJB 2NZWA 2A1UB 4UTXA 5LCXA 2FUG1 2JZOA 1QGUA 2D0DA 4DPKA 1KA9H 2AJDA 1HLGA 3ASUA 1G42A 4QFMA 3ND8A 1DC6A 5CFRA 5THQA 3U55A 1NFFA 2OXTA 4FFPA 3BL6A 2GKGA 5HOEA 3KOXA 2H1WA 1G5RA 2XECA 1V16A 1OJ7A 3CR3C 1BH2A 2FMHA 2YXNA 1A1SA 1ZCJA 4MEAA 4Z0PA 1PJQA 5K1ZA 2VA3A 3QVWA 1DAEA 3AR6A 5JATA 2GRJA 2P6RA 4UBNA 3VR6D 1S96A 3KZ1E 1HT2E 3QUBA 1VG0B 3UZUA 1OX5A 3VR4H 4FCTA 4OX9H 1ZS9A 1HETA 1XXHE 5I47A 5HKKD 4I81A 4WEQA 2WTUA 1AMOA 5JMOA 1EM8B 3D6VA 3UEOA 3IXQA 4BKPA 1QHHA 3RRZA 3AI7A 1MT3A 3IQFA 3PC3A 1YB4A 3VJRA 5LP6A 1UZNA 1NN0A 2ERYA 3BA9A 1SYXB 5CW1A 3IEMA 1HFWA 3GNSA 1SKYE 2JFOA 4Q43A 3TGPA 3E9QA 4XDGA 5ESWA 2VPXA 2FWRA 2ZB8A 1D1SA 1GARA 1N2CB 5FWAA 1OYOA 2TMDA 1GR0A 2ONYA 4MKZA 3NV7A 2D0IA 1PGPA 1H2WA 4HY3A 4O2BA 3O82A 1KI9A 3ZWPA 1OFHA 4L9WA 3ZE1B 1PLLA 2OMEA 4YRQA 3UT0A 5E2IA 5DZSA 4QPCA 1MZVA 1UJNA 3EBOA 5LXTB 4RSGA 2HYDA 4P1ZA 5TB5A 5I3CA 4Y8VA 5GJCA 2E6KA 2V0CA 3SQNA 1F2UA 2PGDA 3O9MA 1MOZA 3SEAA 1NW4A 1I3NA 1Z7WA 4W99A 3ZCUA 3GQBB 1L1EA 4MINA 4HYYA 1ODFA 1I3CA 1O95D 1LLQA 2Z1DA 1E4GT 1SUEA 4PU0A 4PANA 3JVIA 4J0HA 4DRFA 2W2XA 2X1VA 1T9AA 4HPXB 4IDGA 3LT2A 1NXSA 4Q3AA 4QVGA 4DLAA 4HDKA 1CIVA 5JQGF 3ETGA 4BNVA 1X8KA 2PSDA 2HRZA 2J5KA 4KU4A 1XVUA 1QH0A 1V39A 1TWGA 2HVQA 4EFLA 1VLVA 3E4DA 5GQSA 4RNDB 5TEVA 2YN4A 4UCSA 4QRHA 2KB0A 2ERCA 4Q9IA 4RU9A 4Y9SA 3B5IA 3GWZA 3LU1A 1UXOA 2CHGA 2SCUB 5KX5B 2PWBA 1GTG1 2RJ3A 2YJNA 4KR2A 4KFSA 3N0XA 2QGFA 1QIKA 2XCPA 4QDJA 1W29A 2GN1A 4POOA 2IIBA 2BFAA 4PIMA 3L1JA 4DTCA 1LK5A 5BWWA 3O84A 4JLMA 2XV1A 4OL9A 3UH0A 4NBNA 5B3AA 3LP5A 5JS2A 4S12A 1EKVA 2ZJBA 5CPFA 2DG2A 1FUEA 3B12A 1J9GA 3TEKA 2F64A 4DMCA 1J2YA 3OE5A 2DFKB 1C7RA 1LDGA 1H2ZA 3F6YA 2ZDQA 2PFGA 2ONZA 4BNMA 3DDOA 3F1LA 4ZKDA 2BJWA 3DAAA 4GSKA 2OEPA 4XCQA 2CXHA 2ZSAA 3MTGA 1X1EA 1A8IA 5FTKA 5THXA 1GUFA 1QIJA 1ZJYA 3C4JA 4MRPA 4DQKA 4XVRA 4IFEA 5H70A 3QFTA 1ECCA 4O3PA 4JI5H 4AKEA 3U0VA 1MVOA 3D59A 5JYDA 1E4VA 3K8YA 2ZS7A 2JIRA 4YMUA 4JJ6A 1C29B 2CL0X 3G0CA 5CVJA 3G8CA 1KO1A 5TIIA 3IA7A 1KC7A 2FH5B 2CK3D 1S68A 1E9RA 2J0EA 1PVVA 2WM2A 1CW2B 1AKRA 4Q1EA 2WZDA 2W8KA 1JR3E 2QMHA 4YAUA 1N0UA 3M33A 2NMVA 1FRFS 4QC2A 5ENZA 4U1RA 1QXSA 2YWGA 2ES4A 1W96A 4RFVA 3H0GA 4RAOA 3FVTA 3L3BA 4ZCQA 3CLTD 2H8GA 2J9RA 1NPTO 4TWRA 1T4CB 1Z3CA 5K2MA 2Z4RA 4MKIA 3IOMA 2MR6A 2HH9A 1B16A 4W63A 3F7TA 3QLTA 5C31A 1YNOA 2HMTA 2JCSA 4MCHA 2VF4X 1ORHA 2XOEA 2O2EA 3GUZA 5D8DA 4TL8A 5ERYA 4FE4A 1YSCA 1ECLA 1DQPA 4I55A 4XYMA 4D3SA 1XN1A 3T0IA 4PSKA 1T1SA 1R18A 5DHRA 3DM5A 1YE5A 4HLQB 4R8UB 4G01B 4FN5A 1KR5A 3O1IC 5CLIA 4LWQA 1H1LB 4F4UA 2R6JA 5BN5A 4PCVA 2VF2A 4B76A 1QIDA 4YRMA 3TLMA 2JJMA 2CW5A 1CZUA 1ADJA 2VC2B 4ETNA 4RM2A 2VRWA 2VFAA 4X97A 2REQB 2VT7A 1G8FA 3EW9A 1QBKC 1L4UA 2QL7A 2GXAA 4EY8A 2CLCX 4LFCB 1EWVA 2FPSA 3QUQA 4YRNA 3DTNA 2V9CA 4PRKA 4WHMA 1XOIA 3TEFA 4WUVA 2K6GA 1G21B 3WGUA 4Y2PA 3FMGA 3GYBA 3VUFA 3M81A 2AI3A 3ZWWA 4ASUD 3VAAA 4MZDA 1O4WA 2W57A 5FPYA 3G79A 1S2GA 1Y1WG 1EWQA 2PRZA 1V8PA 4GGPA 4DMUB 3AY7A 5KWVA 4P3KA 1MGOA 1PTKA 2ST1A 2JGRA 2J07A 5FNVA 3PRKE 1RXYA 3PGMA 2PR2A 1J09A 1HXHA 3IOEA 1EGAA 1JDJA 1X1BA 3JQBC 1NV8A 4O0MA 2YR0A 2D3WA 4B6GA 2ID9A 3R4CA 2XB2A 3U80A 4ZOCA 3GA5A 1OXXK 1TQ8A 3O9VA 4H7KA 4YJKA 2NP7A 2P6MA 4D45A 1M34E 2X8JA 4MIEA 5T4HA 4WOBA 3U54A 2F00A 4OXIA 5JXHA 2GD1O 4Q45A 3JD2A 1KGDA 1U5CA 2VLIA 1YR8A 4PZZA 4EA6A 2CB9A 1ZGZA 1Y3AA 1F06A 4ZAGA 3OOSA 2GX6A 1AXRA 4BVKA 3ZV4A 1HF3A 2XNKA 3ANMA 4JQZA 3GJYA 1LWNA 3C3KA 3B5EA 3T34A 1TJNA 2ACEA 3NM5A 3RBEA 1UBSB 3EIXA 5TPZA 3FNRA 4FIZA 3E8MA 1T4GA 4DQ0A 4W5NA 3DV9A 2J0UB 4UTZA 4DSZA 4X5OA 5AHXA 4BNHA 2ZCVA 4EG3A 4DR5H 2X15A 2DHQA 3H16A 3NEYA 4YRBA 4EH1A 4RETA 2A4KA 3R75A 2Q2UA 2IXFA 3RTGA 3K96A 4DT1B 1W4CA 1YR9A 2PKRA 3KZOA 3HB4X 3QG1A 4CM4B 1YOVA 1EFRA 4PRLA 4Q4AA 3RSLA 1TEXA 2IGBA 3FYSA 1QMGA 4TT3D 4O8CA 5BPHA 1OT5A 4IGEA 2A1TS 5EL0A 4ZXPA 3I5YA 1I4EB 3CUTA 5SZJA 2ZUTA 2VTEA 2Q0XA 3JZIA 2Z2KA 4RCNA 3UK7A 4BLOA 3MINB 4KR3A 3TFOA 1TT5B 3OJOA 1B93A 2FPOA 3LGSA 2BEUA 4YMHA 4FWTA 3PJRA 4JS0A 2XHEA 4X44A 2UYQA 3NCTA 4QUGA 3DVRX 3PWKA 3GRRA 1ZIXA 3HM2A 3BACA 1U7WA 1OYVA 1OAOC 3BD7A 3CVUA 4XCVA 4B7ZA 3CVWA 1NF3A 2GBGA 1MLDA 8AT1A 2WKPA 3QEMB 2PYZA 1I4WA 4UUPA 1QF9A 1VMIA 4G97A 5L9XA 2WSSA 3OZEA 5IKXA 4G5RA 3RF7A 3U31A 4YP0A 4U9UA 3IT3A 3SBDA 3VGJA 4FDLA 3JALA 4PZ9A 1Q77A 3STHA 1GL6A 2AWOA 3K70C 4D9NA 4MR8A 2Y1LA 2HM7A 4DLSA 4LBVA 1G20A 221PA 1L1FA 1NVKA 2X3UA 4JEHA 3SI7A 1DTWA 521PA 1ZJ5A 5KT6A 5CM8B 2I1WA 4MRNA 4J07A 4C1NA 4GKJB 1U0RA 4UEQA 2XUHA 3PWSA 3KZKA 1DXOA 3W9YA 4L8WB 2JFXA 3ZCPA 3OX3A 2IDJA 1GGKA 2CXPA 2WJ6A 4D9BA 2Z3ZA 2NLOA 1H2FA 1W93A 3ILYA 3NQ41 1J0AA 3UFBA 4NJEA 3ZKAA 1XKLA 1J2UA 3LHDA 4J9UE 5EEGA 2R2GA 4CMKA 1Y42X 2TRSB 2WP0A 1D2CA 4FCWA 2AF4C 4BDSA 4A2BA 4OI2A 4REQB 5F3RA 3HP7A 3EC1A 4LZPA 4KYIB 4AF8A 5JIBA 1F2DA 4ABTA 1SWWA 1MNQA 4A7PA 5EXPA 4QGHA 4RKYA 1E0KA 1YRHA 2IC5A 3V7FA 4II7A 3WFJA 2F67A 4QA9A 3P1JA 5HCIA 1JJ7A 5BSRA 2C9OA 1E4YA 1FMCA 1E9BA 2ADFA 3Q9UA 1CSEE 3C4VA 2W2QA 1FY2A 3OEED 2IH5A 3H2YA 3DEIA 3BK7A 2VP0A 5FTLA 1G2IA 2O2SA 1BA2A 1LFAA 1SVLA 4GI5A 3OCJA 2DIKA 1RRMA 3EARA 2FKAA 1WS6A 2VDMB 1HQCA 4BU1A 2Z08A 4WTOA 3WO1A 5I7OA 2Q0QA 1C1YA 2JFZA 4JP2A 1PWYE 4M8NE 4DF3A 2YRFA 2P30A 1ZNWA 4LC9A 3PHCA 4KQKA 1YE8A 4OLBA 3TXXA 2PUBA 1S3SA 5CHYA 4U00A 2Q1UA 5D6OA 4C76A 4II2A 5AVJA 2VQEH 3LYLA 1CRQA 2WTBA 2YJGA 1YQGA 2G8LA 2V5VA 2NADA 5F23A 4EUHA 3R5KA 2OZLA 2C3MA 4A6XA 5DP1A 4RMHA 5CCEA 3GPIA 3X2EA 3I1YA 4N7RA 3NTQA 3N0WA 4FHFA 3WO0A 4Y2VA 4ZV4A 4IIJB 3LF2A 4PFKA 2C00A 1XP8A 4P7GA 5EVCA 5A9RA 2FQQA 3PKIA 2CNOA 3IAUA 1P45A 1Q6YA 4MR9A 4F3NA 4ZDIA 2AJTA 2B35A 4YRCA 1JIHA 3FWHA 1M7GA 2WW8A 4O4JF 3QLUC 2ZBGA 1JFRA 4UM8B 1WDTA 2NXCA 1RKVA 4OOFA 2AC2A 4QPZA 1YT5A 1JPVA 1COWD 1LU9A 2GKSA 4FC7A 3LECA 1KK3A 3C16C 5HIKA 2CUZA 1TO2E 3O6VA 3EVBA 2EERA 2Q50A 3DFMA 1NXQA 3JY6A 5HR5A 1Z6GA 4NFHA 1NZFA 2WAQE 4FKZA 1KH3A 3A04A 1JKIA 1O0SA 5H80A 3H3FA 2C7RA 5JU6A 5HIIA 4ENRA 3GTQA 4L3VA 5EIOA 5BP7A 2R6FA 2IXGA 2PQ6A 4JBIA 5IVKA 1Y7IA 3UJNA 3WFIA 1OASA 4M6WB 1ACLA 1NI3A 5D3MA 4OJTA 2R92A 1ZRNA 1L6RA 1NSFA 2AYXA 5SYAA 5T67A 4I2VA 5LQSA 4FFWA 1BMDA 2X22A 3COSA 4JUCA 4K05A 2ZQZA 2QW1A 1LDEA 4ZI7A 1MH1A 3G5UA 5I9MA 4QBTA 3JU3A 2RF4A 1LNSA 4JB3A 1QQBA 4GOND 1W44A 2J85A 1F5SA 2WUVA 4E0BA 3GRCA 4F06A 3RBXA 4C7VA 3WA6A 3KPUA 3V1MA 1K5DA 1TKCA 2XVAA 1T8YA 4B2IA 2VN8A 4HUTA 5IG2A 1MCZA 3ELYA 1XKXA 2ODTX 1YMQA 2EW2A 2C2DA 3JW8A 5LQDA 3K9FC 1A4RA 1HYEA 1AB5A 3CGWA 4Z8XA 1TAHA 1G2PA 4DQLA 3TL2A 1UBCA 4IX9A 5DW3A 3EA5A 2HU2A 3MHTA 2E85A 5E9JA 1QIEA 3ABQB 3ZS9A 1KZ1A 5LA6A 3Q0TA 5A02A 5F9NA 2VYQA 1X0XA 3I53A 4L6IA 1IXKA 1IZ7A 1CB0A 1UBHS 2P2DA 2FG7C 1BHSA 4XZ3B 1DX6A 1S5PA 7MDHA 1OV6A 2D1FA 3EXEA 3A4LA 1KYIA 3K31A 5B2ZA 4RD0A 2Q41A 2ENWA 4HXEB 3C3PA 4JL5A 3C1UA 2OAGA 5CYPA 4UMDA 1I3KA 1Z4PX 5EIXA 1NTRA 4YJFB 4LV5B 5B55A 2A8YA 4G0WA 3VAYA 5CAEA 5EHNA 3HCRA 4C14A 1VHDA 3E7DA 3LXRA 3TQFA 1EVLA 1Z37A 3PVZA 3PUZA 4G89A 5D87A 3SHQA 3V80A 3UV3A 5CCBA 3NXSA 1YFZA 4V2UA 3SQLA 2M9MA 4LRXA 1DV1A 5ECGC 2QMZA 3JQGB 3N75A 3QKIA 5LQNA 5C8VA 1OLXA 1H5NA 2IF2A 4QGBA 1Y1WA 2B25A 3Q7QA 3H1AA 2FK8A 4AJJA 4LCJA 5KOIA 3EA4A 1T0HB 7AT1A 2YJ6A 3ZPXA 2XY4A 1Z4JA 4NBTA 4PGHA 2YV1A 3ACDA 4BTLA 1NNUA 4QU8A 1A69A 4A23A 4B8ZA 2HU8A 1X7WB 2YHUA 4TMVA 2I2DA 4LF8B 5HSGA 1N4AA 2HWXA 2A6PA 1HO3A 5F2NA 1G8AA 2A84A 4A8JB 3KQNA 3FKSD 4DMMA 4OA5A 1CJTC 4OATA 2R0QC 3AGQA 1C0IA 1WD5A 3A4IA 3GV0A 4RY0A 3VU9B 4MLZA 4UCWA 4QULA 1N32B 3JWIA 5C5CA 1EBFA 2ZCUA 3EISA 4U0KA 3BWDD 3PWTA 3SX0A 2BM9A 1FBNA 3RTEA 2PWYA 2M6SA 5EWLB 4BO9A 4OP2A 3AZOA 2DTEA 3ZXIA 4DIMA 3H9CA 1REQB 2J4DA 5AK0A 3VPGA 1WZUA 4DJEC 1XFAA 3ZC3A 2O6HA 3PUXA 1NUAA 2Q1XA 1U0OC 2FXIA 5LU8A 2X8WA 2A94A 2PPLA 1TM7E 3D3WB 5KYXB 1XX6A 3V9AA 4YP1A 4HRYA 3PNVA 1JQBA 4YJ2B 3WIBA 2Y67A 3COYA 5K5EA 1U0BB 1ZH0A 3WKBA 1KU6A 4C2BA 1P4RA 4YJGA 5K4GA 2YWJA 4L8GA 5B7GA 4QZVA 1M1NB 2JEFA 3LUBA 2N47A 1HLFA 3L7MA 2FWBA 4AQYH 3ZV7A 4ZJYA 5C0OE 3ND6A 5TT0A 4OX9B 2QP9X 3KPJA 1GQSA 4P4NA 4XGQA 2YWBA 1N6IA 1BDMA 3Q8XB 4QGAA 4ZC8A 3UXYA 3BGDA 3AM5A 3BMOB 4F1WA 2Q5HA 3E1GA 1ZFNA 1GG5A 5C7YA 2WVGA 1KJ9A 2NG1A 3NYQA 4XA8A 4DIDA 1E6WA 2VF8A 5EE0A 2O54A 4X1OA 2ZIZA 3CPHA 2OGZA 3OMLA 3L8ZA 2XUFA 3E7XA 3AONB 3TW8A 1WXGA 1I6WA 3KQOA 3EXIA 4X1KA 3MJTA 3FYTA 4DMHA 1JHQA 1OBCA 4B48A 2CV0A 1W0JD 5A6SA 1F51E 4J0KA 3X43A 5LMZA 3IJ5A 2XVYA 2Y2VA 4EFMA 3Q88A 2GM4A 3KQWA 4MQMA 4JSTA 3LQRA 3H11A 3OCWA 4INOA 2RGRA 2Y6UA 5JMWA 3ZW8A 3ESRA 5EJ2A 3PW0A 1U2SA 4IS3A 4JU9A 5LMNB 1JEYA 3RRBA 3WL3A 1C3OB 3MMNA 2ASJA 2V58A 2O8FA 5C1IA 2J6HA 3RS3A 1FTGA 1U81A 4AJPA 4M76B 3TIVA 1YQEA 4KLCA 7YASA 2C4NA 5AI0A 4PNEA 2HLDA 2BC9A 2BLNA 4W8OA 1PSWA 1FPQA 4NULA 2XYVA 4JXUA 4CE6A 5IT9A 2W70A 1T9BA 5HF9A 4XB2A 3GZ4A 5KFYA 2YOFA 1WOMA 3FB1A 5HS6A 3DE3X 4UTNA 1Y6JA 4M37A 2BISA 5CXUA 4JJZA 4Q01A 1AN0A 4R5MA 3BEOA 1S3IA 4YDQA 2VDNB 2V6JA 1CY0A 1E3LA 1AURA 1UFQA 1R5BA 4NZOA 2ZRBA 2MHCA 3D7RA 3FGPA 3SVZA 2ADMA 2I7DA 3I5MA 4YRGA 3L18A 4G1MB 1JG4A 2X0JA 5K0GA 4GLFA 1N2GA 4R1TA 3U1TA 3HBAA 3QOFA 4R83A 4DB4A 4YAFA 1FYFA 3L84A 5L3ZA 1WKCA 2RGNA 2IYEA 5A7HA 1P7VA 4FUQA 1AY0A 5DFAA 2J6SA 3TJRA 1YONA 3ZGOA 5JZMA 4MQ4A 1CUFA 1RW4A 3PB3A 1ZW6A 1JKJB 1EINA 1L5VA 2JAWA 1ZIPA 3W34A 4K26A 5LLSA 1HQKA 4N0QA 1FNDA 3OC0A 2DPJA 2FMAA 3IE2A 1NQUA 2F4VH 1RJDA 1DCMA 5JJKA 1VSTA 4MV0A 3ZWXA 2X5KO 5CMLA 2FRVA 3SC6A 4G0YA 4MEBA 4DVGA 2VJLA 2JASA 1AJEA 3LBIA 1AN7A 1YKFA 3Q5DA 4KOAA 3VTAA 4Y2XA 5CNKA 3WGJA 1CZLA 1QRUA 4ZIRB 4G6ZA 1T9DA 2G71A 2SKEA 3U7QA 4F3CA 3GT4A 1BWRA 4MTLA 2R2AA 2IY9A 3Q7EA 3L1UA 1CKMA 3VNVA 2J59A 4RTOA 1R16A 5DJ5A 1W52X 3ONFA 4QLOA 1GKYA 4FBLA 4UQLA 3IUNA 1GAXA 4I50B 1O97C 3C1AA 4F4CA 2C4KA 3OTWA 1N1GA 3MSXA 3DTVD 5AKXA 3Q2KA 5CH3A 5C81A 3KFVA 4CR7A 1Y1LA 3M1AA 4UC0A 1O96B 1NBME 3B5JA 3YASA 2JHAA 1NNI1 4QSHA 3R9IA 2OZKA 1X7XB 4W5OA 1ZETA 3WWOA 3F90A 1GCAA 4NXMB 1TCVA 2BSXA 4AG3A 3JQRA 3LOPA 2ZYVX 3REFA 1MG5A 2G5PA 2IXEA 5F9FA 1YL6A 3G8YA 1TQ4A 5LOVA 2XNJA 4TLBA 2XMZA 4MWBA 3SQOA 3UWDA 4E6PA 3WK5A 3A6PC 3WK8A 3B3JA 3PO3G 3D81A 4B83A 1CF4A 7REQA 1E94E 1ACJA 3DCJA 4OXYA 5B1HA 2XR1A 2P0AA 2VJCA 3ZZUA 4GC7A 4DZZA 1K88A 2BFBA 3MJFA 1H9CA 1I1HA 1DDGA 1VXOA 1IAQA 2EBUA 5G41A 1WD7A 5JLJA 4IPTA 2OL4A 1P7ZA 2DCMA 1DUSA 2BF7A 1VG9B 1II0A 1IH8A 3R6DA 4BUCA 1VB5A 1L7BA 1B1AA 3EH2A 1AS3A 2IYYA 4B8YA 1PR1A 5KU7A 2Q1YA 3GR6A 3RVMA 2W9CA 4KGDA 5MDHA 1KP2A 1TM3E 1HDRA 4P3NA 2JDIA 3L1IA 3GLHA 2IUTA 1UC8A 3N0RA 4FX2A 5CCDA 4PYQA 3WLQA 5COQA 2DR0A 5BWUA 2Z9BA 3RREA 2A0XA 4I5EA 1CX9B 2V6IA 1DTSA 3ZYZA 4BX9A 3UMGA 3DO6A 5BOSB 2WV7A 2AUMA 1N5RA 3M5PA 4HB4A 4HAWA 4HO1X 3QELA 3P2OA 2YMLA 3I37X 3OIDA 1P73A 2J5XA 2HA2A 4KLAA 3O3CA 4IJKA 3CPEA 3AL0C 2ZR0A 1YZKA 3HKDA 2O2IA 3FMFA 3LKBA 4XWKA 3TXYA 2UVRA 4GT1A 4HQLA 2WJAA 4ME6A 3OLCX 2P79A 5F2EA 3A6GA 3ZIDA 3D1LA 3ER6A 3G13A 1PG2A 4DR5B 5J9FA 4RYLA 4E6EA 2ZANA 1A0OA 4U9HS 1KBQA 5E3HA 1XQWA 1P33A 3A7EA 4PHCA 4YCJA 5FWDA 4P7JA 1T9HA 1VDZA 3AJDA 4OHKA 2C1ZA 1O6CA 2HJRA 4Q12A 2UUBH 5KNLA 3BA6A 2E5WA 4C08A 1DCFA 4QHTA 5JS8A 3R74A 5GVSA 1KKMA 2I1QA 4BO5A 3IJRA 3WDMA 1LA2A 5ALFA 5EZYF 1K6IA 2XNDA 2FMKA 4TUYF 1K2WA 4GGOA 1CQZA 3FMOB 3QPDA 4H3HB 2VTBA 3L7LA 3GVXA 3LQ2A 3E8SA 4ZK2A 1OX4A 1WCXA 2W6CX 4WXYB 1DG9A 3WLEA 2IXBA 1EP2B 4YUVA 4CXMA 4BV2A 3JYOA 2QLBA 2B2XA 3KHKA 1GAEO 4WK4B 3HEMA 2WPNA 3TZBA 2GPTA 1X1RA 5KYWA 4YHHH 2XF8A 3RIZA 1SHKA 1OU0A 3FUTA 2REXB 4CEJA 3TQTA 3DZFA 4X1IA 5LWHA 2IEYA 4YRPA 4TTRA 3UAYA 4F4HA 3LSYA 3LDFA 3LVRE 3AFIA 3L6OO 5EXEA 4HFRA 4KQ6A 3FWZA 2NUPB 4ED1A 1XWWA 4FZ3A 3QVTA 4AURA 4CLOA 4BOYA 3BICA 5FPSA 5F7OA 2JFNA 1UP4A 2DBZA 3DFZA 2D5CA 3GGPA 3KUUA 2G6TA 3HZRA 2H1RA 4ZO9A 3NG1A 2JIQA 1XYGA 1Z35A 2K7ZA 1NLZA 4BVAA 3Q3CA 1IXZA 5LYJB 3LE8A 4M1EA 2NYVA 2WD7A 4GSYA 2FOIA 4M0EA 1QYVA 5I5WA 4A2AA 4MVWA 2CXNA 2R7LA 4O4LB 3PSAA 4DSNA 3GMSA 4D7AA 4DUGA 3FN4A 3VHXA 4KH0A 1WMAA 5B7QA 4RBNA 2WMYA 1IHUA 4MYRA 3HA7A 2D7DA 3WBJA 1VBFA 3HU2A 2GCOA 3DZCA 2BH2A 1QH8A 3VQTA 3BHJA 4GI2A 4PY2A 5B3KA 3UZBA 2QRNA 2JJ2D 3NVDA 1E0JA 4A73A 1T8RA 1IC6A 1L5ZA 2A5LA 1QUFA 4KGZA 2VJQA 4EZIA 2KPOA 1QFMA 1EU1A 4G0QA 3C7DB 1FBTA 3U7FB 4PZAA 4Q4HA 1CTQA 5ADVA 1YV9A 4MVJA 4JQSA 4AULA 1KI3A 1VBGA 1EPUA 2OM2A 3TOCA 4RABA 1XD2B 3SBOA 2O0JA 4HNAA 2UYOA 4C7OA 1NOJA 1TK9A 2IYTA 1PDWA 4KWHA 3BXZA 3Q3IA 2Q5LA 4IVRA 1SB9A 2Q9CA 1TD1A 2IUFA 2W90A 2ZFUA 4YT2A 1T2FA 4O2RA 1TFUA 3H2HA 4BVBA 4Q37A 1T0IA 2FW8A 1W5SA 3V4OA 1E2IA 2XBLA 4QU5A 1W8IA 4OP1A 2C2KA 5CITA 1OZHA 1VBKA 3VSDA 2EFEB 1T3HA 2VQEB 1CHDA 2VSXA 3LT5A 4NXNB 2M2IA 4K9NA 1LTKA 2V5UA 3SZOA 4IDEA 2ZYTX 5BWTA 1A97A 3CRNA 3WB0A 1VLLA 2RG1A 4RTSA 3EASA 2WE6A 3AC0A 1XMIA 4TM7A 3C3BA 4NBVA 2YOHA 3WLOA 3ZU6A 4FM9A 2P2SA 3AIMA 4ND1A 1D6JA 5FUBA 4L3OA 1O87A 1VKNA 1PQWA 4PS0A 3W90A 4QJ4A 4HMPA 1WSAA 2W6QA 1P0IA 2AW5A 1OFUX 1BG6A 1KY3A 1V1MA 4OXQA 3H04A 1C30A 1G4UR 1ZUNA 1ABEA 2BEVA 4TRNA 2E1PA 4HXYA 2FRDA 1NVAA 2D2VA 4MRVA 1I32A 3ROZA 3GUCA 3N2IA 2NZ2A 5LD2B 2AIRA 5GWXA 1EDEA 4OFZA 3BT7A 2X1HA 3M9OB 3B2NA 3EBLA 3LXXA 4MARA 1P0CA 4GWLA 2LR0A 3ZJ4A 3T9FA 1LZKA 1GTVA 1OBOA 4CMIA 3KJFA 5EUQB 3JZ6A 2O0LA 2PMKA 3O03A 4D8YA 2Y27A 3S44A 2P11A 3LZCA 4PBCA 4O3OA 3GILA 3THRA 4JYMA 4B34A 5FOWA 3V8NA 3O1JC 3COZA 4J0CA 2ZK7A 3ZLVA 5CFQA 5I4KA 3DWFA 2FMIA 4IRKA 1FRZA 2JA5G 3SPXA 1IAVA 3VBEA 4B5LA 2ODWA 4GNKA 3SJAA 3ZD9A 1J2RA 1FX0B 3ISTA 2Q2OA 1U3WA 1M83A 5LM3A 1Y9AA 4NRDA 4MV8A 2GHTA 1AQJA 1E6LA 1B6RA 1RHMA 1KI1A 4G5QA 1EXVA 4L7VA 4FI3C 4PYRA 3EPGA 3N86A 3D6FA 2CWWA 5D5HA 3NANA 3TR0A 2IHBA 1JECA 3JSNA 1JS1X 1MRNA 5AXDA 2VYVA 3QGMA 3ONVA 3KTAB 3K0CC 3UENA 3I9KA 1LQTA 4LY9A 5DYWA 2IP2A 2D1SA 1K92A 5CIYA 4YMIA 1EUCA 4G8BA 2AHRA 1NPYA 4ZEXA 2ZM6H 2YWCA 2JD2A 1DBSA 1F8XA 4QTYA 1BDIA 3GGDA 2I2AA 3TO5A 2UXDH 2FQWA 4QOEA 2DETA 5FRDA 4JMLA 2M32A 1ZLYA 3UMMA 3OTIA 4ZOBA 3IMCA 2RIRA 2R79A 5BR8H 2JGNA 1SVWA 4MKXA 3AG5A 1J0DA 1Q0LA 3QBVA 3IV6A 4Z4HA 1OBDA 2HJSA 1RYSA 2A14A 2P68A 3QV2A 1KEZA 2R7NA 3EHDA 5HRAA 4TWJA 2GTIA 5KFEA 3AFHA 3GRZA 4EI9A 3NOQA 1IPHA 3JQCA 3AETB 4BCCA 2PSEA 3L4BC 2Q3FA 4QXMA 1RRKA 3EAQA 4J91A 2EJBA 3WB9A 2OK7A 3BA8A 1KDYA 1EDBA 1WCYA 2JI9A 1ZA2A 4ZYLA 2V1XA 1EQUA 3SSMA 2PT9A 1ODTC 1A9SA 1KEEB 4URXR 4G1VA 4I99A 621PA 1MW8X 1YVRA 1ODCA 3U26A 4XVQA 3TS1A 5DISB 3PDHA 2XODA 4Q24A 4C88A 1HDEA 1WHSB 3GV7B 1PEDA 4UU0A 1NVMB 1VC2A 3UWOA 2JIOA 2FPIA 5CB0A 1RCTE 4LE2A 1NULA 3EG9A 4KPEC 5EHIA 4ZOLF 4AJNA 1UT6A 3DHEA 4DL3A 1CUUA 3T3MB 3GFGA 4M0MA 2WTAA 2CKDA 3H2KA 2QAGA 1E1QD 1J9ZA 3F9IA 3D3EA 1KY4A 5BYKA 4RH3A 13PKA 1AG9A 1L7AA 3W5BA 1HEUA 3ZN2A 3H75A 5IWAB 3RASA 1R6XA 3GHHA 2J31A 2I4NA 4EEQA 3KJEA 3V8PA 1FMLA 4ZDKA 2IRWA 2DFPA 3LIIA 4EB6B 4FHDA 1YDFA 2CNVA 1GEEA 1P7CA 2FMXA 4MMYB 4ZU1X 3VKVA 2WB1A 3DYBA 3B89A 4TTVA 1VJTA 3CZQA 1N8NA 1Z8HA 4QREA 2V55B 3DQPA 1XALA 3TOSA 2C8VA 4OXRA 4J1SA 3VYUB 5I8PA 1PQ4A 1ZCFA 1XL1A 3CZCA 2NQTA 3FPCA 4P4UA 1VL0A 1NI4B 2FVXA 3AKZA 4LF5H 5IJWA 1O08A 2I34A 1LNZA 1R6TA 3MD9A 3I2GA 4KJZA 2BKXA 3B6IA 2W98A 2NVOA 2FZWA 1W1UA 3WLKX 4PAGA 4UVGA 3STVA 2X8AA 3EWSA 2JJ8A 2V7XA 5JVDB 5KFRA 1MW9X 2CDNA 2PS1A 4X8HA 1R6DA 3CW8X 5I48A 4PGGA 2CXUA 2WD9A 1VE3A 5L4LA 1DBIA 4MWDA 5DHFA 3Q1LA 2OCLA 4LCBA 2R92G 3GIQA 4AQYB 5CT8A 3HCCA 2P8JA 1VHWA 4D4MA 3OJXA 4CTNA 2RH8A 1M66A 3FSGA 4ARZB 2PLWA 1ARZA 5FPQA 3FSJX 1V5FA 4M98A 1M8PA 1NUPA 2VJBA 3D0RA 1SB8A 5DCYA 4HC4A 3V8QA 2WJHA 3DMHA 1I8TA 2GCGA 3IBFA 3U49A 1QO0D 1NJ1A 5EIFA 4WX2B 5KOHA 1QJ4A 3CBQA 1YA6A 4H7EA 2FR8C 5EE9A 4K7JA 2WAYA 4WERA 1CRWG 2EFGA 2OLKA 1BU5A 1KYQA 5MF6A 4O4JA 2R1TB 4MVJF 2ZDGA 4BBRG 3ZDQA 2EFCB 4ZCLA 3IQGX 4G25A 2HIAA 4BMZA 1IZ0A 4P0QB 1YAJA 4I08A 1QO7A 3HUUA 3O5AA 4YAKB 4D9GA 2H00A 4D4KA 3CJRA 5BNIA 1UODA 3KL2A 1V7QA 3G8DA 1FA9A 1CZNA 4DJJA 3SS8A 5LL6b 3L8MA 4DBLC 4G8DA 4RHTA 3W2TA 4JBHA 4FMCF 3W4KA 2XUIA 3H1PA 4MO9A 4IF6A 4LHZA 4MR7A 3CKLA 3IEPA 4CR8A 1R8JA 4BBJA 1CE8B 1LJLA 5P8WA 1QVAA 3DQZA 2YMMA 3JAWB 4JT8A 1ZGGA 3PC6A 1W48A 5BXQC 2GILA 3EEIA 4Q8EA 1MMFB 1G291 2JH3A 4BTEA 3OT1A 3CVYA 1NUHA 2DTDA 4ZYXA 3GMIA 5IDYA 1ZISA 2WZQA 2AN3A 2XYGA 4GICA 2QUKA 1JILA 3LY7A 3SHOA 2FZKA 2YN2A 1CRPA 5I5UA 3PR5B 1R8QA 3D7LA 4X20A 2GK7A 2B9EA 3JRWA 4MI6A 3B7PA 1TT7A 1VKZA 4QFBA 3VKHA 4X85A 4IRDA 4RGVA 4RPLA 3JYPA 2REBA 4UNIA 1RYYA 1FRVA 2PPVA 1UZMA 3SN6A 2P0EA 3DKVA 1L4YA 4RPGA 3TJZA 4ZEOA 3DSRA 5DN6A 3ZV6A 5E2BA 3R6TA 1FFHA 4KC0A 5TXGA 2A59A 4G2NA 1NSTA 3WA7A 4YA6A 4L4RA 2MYPA 1ETHA 3QEOA 2EVWX 1SR8A 1RK6A 2WIAA 1FP4B 3DDZX 1PG5A 4C0AC 5IAOA 2BF4A 2QY9A 3FETA 1XTJA 3TM4A 4QWCA 3SSNA 4LY0A 1CXZA 5AM4A 4AF6A 2QOEA 2GJAA 2F4VB 4JI1B 2YWFA 4TRRA 3V8EA 2PT5A 3KEQA 3JTMA 1AKVA 3HN7A 4KVZA 4GMXA 1PN3A 1EA5A 3K0AA 4MA5A 5A5GA 3V32A 1U8EA 1E2DA 5CK5A 3TEMA 1R4NB 2IZ0A 2B94A 1M76A 4GMKA 5JALA 1L5QA 1NJ6A 4G3XA 4E12A 4RV4A 3MWFA 3OOHA 2DAPA 3OIGA 3FLMA 1X94A 1CUWA 5EYPB 2XUDA 3O93A 3GLGB 5IVPA 4Y6QA 2B4AA 5DP2A 4JI0H 4ZVKA 4B8WA 3JWHA 3CH7A 4OQZA 4PQGA 4TKVA 5K01A 4B1FA 5K8UA 4UFPA 1E99A 2Q9BA 3WBKA 1NP3A 4CKWA 3AB3A 4L73A 3PTLA 2JHFA 3V6MA 3MRSA 4J8PA 5B1YA 1F3OA 2HEGA 3UN1A 3O1HB 3U3DA 5KFMA 4RNCA 2VA9A 3SIWA 3R3UA 1HR0H 1V37A 2GPJA 5J2UB 3OJLA 3OLVA 2A9RA 2G04A 2QJWA 2IXTA 3WP0A 3ZWCA 3PNKA 5IVDA 4HDAA 2C28A 1H23A 3RJMA 3BMCA 1D2MA 1BHQ1 1C1XA 4JP8A 1DJPA 5K7SA 3GEMA 3A1VA 3NBXX 2UVQA 3IIEA 3PW4A 2OCXA 5HE9A 4GC6A 2JA5A 3RIXA 4XYLB 3EIQA 2DQYA 1R4AA 2N1MA 3P0RA 5DLGA 5KFNA 4LJSA 4Q93A 1JQ3A 4M0DA 1Y8QA 4YGXB 1UM9B 1E4OA 4ZRNA 4E1VA 4X00A 1HMPA 1NQAO 4XQ9A 2VDPB 4KPYA 4AZ0B 3GDWA 1PJ2A 1GL3A 4H7PA 5EXDA 1N57A 1HX7A 2CBGA 3NEAA 1TK2A 1ZD9A 1NVXQ 1JLMA 1FSSA 2DC1A 4BB0A 1T2VA 2XD4A 4ZHSA 1CIPA 1GPKA 4J4HA 4FBGA 3DOOA 1RM3A 3U4CA 4MV1A 1OWPA 2QY6A 5D5QA 1B73A 4E51A 3I83A 3PQ6A 1Z4IA 2NU6A 3C5EA 3D3NA 2ZR8A 1ZDMA 2ZM5A 5HYVA 5IYBG 4QX6A 4UAGA 5DYTA 1MB2A 2H1LA 3DQQA 1AT1A 1R2QA 4V0QA 5EI5A 3FYUB 2CSXA 1RYRA 4YDRA 3ZZ1A 3NHYA 1MQ8B 3FCXA 1TQHA 3UJCA 1CUEA 1X2EA 3OSZA 3M9LA 1CUCA 1KK0A 4MB2A 5BWXA 2QR2A 1CDZA 4ZJPA 3ML1A 4J9RA 1UWLA 1YS4A 4QJ3A 5BV8A 4HAIA 2QN8A 1XNQH 4CCWA 2H7YA 4LJAA 3L43A 4KXXA 1H0RA 2GGSA 1AGNA 2JANA 3MA0A 4D2IA 4UPEA 2HTEA 4MYSA 4M2LA 4FFMA 5L3QA 1VPWA 3GJ8A 3QPWA 3U39A 4IG4A 3BD8A 2IEAA 4EY3A 3QVUA 1DC8A 2P78A 5FOXA 4RA9A 4QWEA 3H7AA 3HBLA 4GYWA 1PR2A 3G2KA 3UATA 3VJLA 1L4HA 1YJBA 4GM1A 1CUYA 4OV6B 1XTSA 2FSGA 4UM7A 1I3LA 5I5XA 3R23A 1N36H 4PHFA 2CQYA 1S7CA 3PVXA 4D5GA 4M1WA 1KQGA 4CUZA 5DBFA 1RQPA 3V1NA 2XNCA 3VR5H 1I51A 2P7HA 4F38A 2Y0SE 2UUBB 4L07A 1J42A 5GM2A 1BMFD 2V96A 2WWIA 2IPAB 2R6HA 2YFKA 1E1YA 1GZ3A 2DBRA 4EEKA 3HXLA 2CB0A 1WSCA 1QH1B 4R8LA 2BY4A 3CUEF 1W2HA 4A3EG 4OU5A 3LD9A 3GEGA 4UDOA 5EXSA 4B3RH 1EFAA 4ZVQA 2GLTA 3MWEA 3UYLA 4V0RA 2B8NA 5J23A 2X0NA 1B6TA 3KVNA 1DRUA 4UM9D 3ZW7A 1ZPDA 4LXYA 2PJRA 4R5HA 1IQ0A 5KNDH 3FWYA 3ZKWA 4YHHB 3V7YA 4YEDA 1BVRA 1NOIA 4I19A 1EUDB 2C35B 4B46A 3P7MA 3SOZA 4RVNA 3N74A 4H7JA 3N8KA 1HDIA 2QT1A 1C4XA 4DDUA 1IVSA 3E53A 3IAFA 3Q3EA 3K35A 3KTFA 3B60A 2VOEA 4WRRA 3BRWA 1A1VA 3S0JA 4TVOA 4AG5A 1EDDA 5BORA 3CG4A 3COPA 4R0NA 1H3NA 3OFND 1UFOA 3BULA 1SVIA 5K0BA 2QLNA 2X0RA 3IPCA 1I0IA 3UUGA 4JV1A 4I4TF 4O2AF 2OMKA 1JZSA 4QQ8A 2CZCA 1PL7A 1VRCA 1PL6A 3HKZE 1H2AS 3ROTA 1E5VA 3N39C 4YUZA 3SE0A 1S2IA 3K2EA 1UBUS 4W5QA 5C44G 3GL9A 1A9XA 1CR1A 3JV7A 1KFKB 4NLGA 5ALTA 4WEOA 4AY2A 5IT9W 5AW9A 4YAIA 1SEVA 4WZBB 3AJAA 1Q0SA 3OSNA 1YVPA 1O8CA 2FTKE 5FPRA 2WHPA 1A4XA 4WKNA 3IR6A 2HF8A 3VXKA 2XCQA 4IF4A 4JJGA 1T5SA 4AO6A 5I01A 3FCUB 4JJKA 3D2CA 3P97A 4KWCA 3G0DA 3T9AA 3TD2A 2KSWA 1SOMA 4QASA 3HL0A 1X1TA 3V4RA 5REQA 3BWMA 4JVMA 3QIAA 4JUDX 2RCNA 4O83A 3INYA 4WCVA 1CQIA 1EE9A 4ZAWA 4P84A 3K5PA 4YK7A 2X5XA 2O2CA 2M05A 4PC3A 1M74A 4F91B 1RM4A 2G70A 1ZJJA 4EYKA 4CIWA 1U2DA 5TS3A 3U44B 2BKUA 4IIBA 3T7AA 5AH0A 1E1KA 3RNOA 2CLFB 5DAAA 4WBNA 1HOXA 3UV6A 1LLUA 2CVPA 1Z16A 4C03A 3FCCA 1MB3A 2DUJA 4HRAA 2E2WA 1NQWA 2BIFA 2AV6A 3KZVA 3TY8A 4QL3A 3LOQA 3ZIUA 3N5CA 4Q3CA 5CD9A 2R8YA 2YWEA 2R66A 4LV8B 5LC1A 4OSOA 4URZR 4KB5A 4MVYA 1TGVA 2TMGA 1BX3A 3AX6A 1ZHQA 5SYNA 3B38A 1XAGA 4GW3A 1X9HA 3OZCA 1JE1A 1I24A 2PUEA 4YECA 4C0BA 1FDIA 4TROA 4EG0A 3VH1A 3X1YA 3T1NA 3IESA 3N2LA 4R0MA 1QU2A 2QENA 2JK1A 1FDSA 1XTKA 3CNLA 3PUJA 1IJBA 4A3LG 3P8ZA 3DBHA 4CR6A 3I6YA 3MAGA 2B8EA 2EIHA 1P9OA 1B2RA 3FPLA 5JRZA 1N5DA 2Z8YM 4NJMA 1DPGA 1W9MA 2O23A 4HDCA 4DA4A 4UASA 5AHRA 2WFZA 4DLBA 1G5PA 2BTQA 4YP3A 4ED2A 2QT0A 1AKTA 4QE3A 4JVLA 4BNKA 1JHAA 1KFJB 1E58A 3DGEC 3K5WA 5J5AA 4D3XA 5DBEX 1W36B 1QYXA 1MJGM 3W7VA 4DV5H 1WOYA 1XHLA 5E4TA 5T64A 4DCMA 1OWMA 3H40A 5H9VA 2ZPTX 1T4BA 3QYPA 3JASA 1L1RA 3THSA 2D0OB 1QHEA 3H6KA 4ZTZB 4RLHA 1F2TB 1V9SA 1P39A 1DT5A 2CDBA 4Y1GA 1XFDA 4HWSA 2H29A 3RG2A 1I7QB 4QYSA 1YQ9A 2OK8A 2CNWA 3LA8A 4GYJA 4OHYA 4RVGA 1K1QA 3QXGA 3D4BA 4YQZA 3R7DA 2OCGA 2NU8A 5L6LB 1Y1SA 2OC9A 1P7WA 1RPNA 1ZSVA 2W8BA 1SXJB 4S1NA 1UXIA 3HP4A 3NEPX 1QGOA 4RK4A 1VXRA 2B1JA 5I8ZA 4P6VF 3E5HA 3LZDA 2XTMA 1L8XA 2ICAA 3TLGB 2RBKA 1WQ1R 3ORYA 1MOQA 4KSYA 3K0KA 3CQZA 3EXG1 1U90A 4CQMB 1R12A 1FL9A 1V43A 3HKCB 4AIRA 4RSRA 2BWJA 3M89A 3EN0A 5AUPB 2DP4E 1G6OA 3LCMA 4Q6BA 5I45A 1L8OA 3DE0X 1CR4A 4ZYYA 1HYQA 4ETWA 3EZ2A 2UVVA 3URMA 5LQAA 2FUEA 5KFPA 1NNSA 3G6XA 5CLJA 4O7RA 1J97A 1JHXA 2ZM6B 4O8ZA 1BW9A 1WSDA 5EZYA 1KP3A 4TUYA 1RLIA 3PHIA 4MMXB 5TQVA 1C7EA 2UXDB 2VYND 2JI7A 3WLTA 2V4UA 3HXQA 2A9QA 1KR2A 3FFXA 1IQUA 4HB2A 2EWMA 3OQJA 3JWEA 3AFNA 2MSLA 4LSGA 2PLNA 5BQXA 1YRYE 2PIAA 3UK1A 3GTOA 2ONCA 2PJDA 4WESA 1PQUA 4QTXA 1HSZA 4OBWA 4US1R 5HW0A 4NK5A 4C20A 4IY1A 2CLHB 1QUEA 5T4FA 4MVJG 2HCBA 2ECPA 1NU6A 4WWHA 4N6OA 5ALKA 1FJ2A 4CCYA 2NQ2C 5JASA 4WN9A 4ZGGA 4Z4FA 2FWJA 4KQIA 3LBHA 1MIHA 4UFZA 3OIUA 3W7AA 5G40A 3HDVA 3RG8A 4UPDA 4LRYA 3W5VA 3DAYA 1L5OA 1S0OA 5A4MS 3JQ9A 4RM3A 3C98A 1U9CA 1OPRA 3W9BA 3EHEA 4V1CB 4A92A 4K03A 2GXSA 2XEXA 1R5NA 4PC1A 4RELA 3PGJA 4ASUA 3STWA 5AIAA 1PT9A 1WP9A 1T36A 2IMWP 4D0SA 3GIPA 5C7OO 3SR3A 1PS8A 4KK3A 4FW8A 6YASA 3QMPA 2I6UA 3ILXA 4BQPA 4DV0H 3CLSC 2N46A 1YFLA 1UF9A 1VE7A 4W9NA 5IT0A 4JB8A 5G1OA 2J3KA 1NXPA 3AP2A 3IDZA 1MVNA 4Y2HA 4HSGA 4XEUA 1A9YA 3IAS6 5K0NA 3T4XA 5B4VA 3HDGA 4IMPA 3TLXA 4DRXB 4O29A 4V0KA 4M9ZA 1NLFA 1N5LA 2FZCA 2LKDA 2JJ1A 2WYHA 1TEHA 4LF5B 4V03A 1L5SA 3EYWA 3ZWNA 2IHZA 2YTZA 2NSHA 3EZ6A 3H2BA 3MT9A 1WF6A 3MCVA 4H15A 4QOIA 2IIVA 1HE4A 2XVXA 1IBLH 4Z9AA 1AVTA 3BSWA 3PZPA 1K8YB 3A1NA 5FXMA 1YI0A 1HOTA 3L2OB 3U0BA 2FFJA 3TLAA 1KFBB 3NWOA 3ZX5A 1QMPA 1Z2DA 3A4MA 1G59A 4KX5A 1PYDA 1G18A 3DHWC 2GN2A 2AFIA 3WLFA 4HEA6 2R3SA 1QQ6A 1OGYA 4JI5B 2ABJA 2OHXA 3HDYA 1QHNA 4FN4A 5H3CA 1JEJA 2B82A 4EBCA 4TT3A 4NVRA 1O6GA 1IXRC 3Q87B 1IBCA 3H5OA 1K0UA 4O5OA 3EIUA 4ZANA 5JROA 3N59A 2Q6IA 1Z07A 4LXTA 1V4YA 5AW5A 4BYMA 3GJSA 4HWKA 3WGYA 1IPEA 3GTGA 4B45A 1UWKA 5C34B 4B7XA 1BCSB 1W8DA 2DQSA 4RADA 2UUAH 2KYRA 3X1JA 3ZZTA 2OO5A 4BJHB 5BQPA 5JJCA 4Q39A 4DQDA 1OLSB 1QHYA 4B3GA 2BE7A 2GHQA 2HR1A 3UB4A 4F60A 2B4QA 2Q8NA 4G0PA 3BXPA 5HNEA 5J47A 2WVAA 3QA9A 4WBNF 1JTEA 1XGKA 3QHQA 3CTMA 1GO2A 3K0FA 2PZEA 4BLUA 3O31A 2KS6A 3IH5A 4F71A 3MAAC 2QLJA 1UBRS 2ISSD 3N7TA 3CLHA 1V8ZA 1JAZA 4NG4A 4GQBA 3T5MA 4DQXA 1X1QA 5L51A 3K8ZA 5L3RA 3PN1A 2UYYA 4IGFA 1ZXXA 4OQYA 2E5LH 1OH7A 4P58A 3ZD7A 4GBED 2K2QB 3SLRA 3UJ3X 1BKYA 2IIPA 5A4FS 1LS1A 3ADPA 1L8QA 1X7GA 5JEEA 1QAQA 4O63O 4YYZA 2B1GA 4LJLA 5EPUA 1ZJ6A 5EWMB 3WLHA 2CDCA 4JA2A 1XLTC 3I2FA 3RSHA 4L5BA 2GYVA 1RWMA 3I61A 4BQIA 2W2MA 1X74A 3WK7A 4V38A 3AJ9A 3M4IA 1F3LA 1G8HA 1J22A 2FEPA 4ZCTA 2AFHB 4M1TA 5C1BA 2JZCA 3PJFA 4LI0A 4JBGA 1IHPA 4GZLA 1L7RA 3CKMA 1B8OA 1PR0A 4K9QA 2WOOA 3D6MA 5H5JA 5DGDA 1R8XA 1K9SA 4H17A 3O8QA 3RT1A 2LCFA 5F35A 1V7PC 3D31A 1ET0A 4C7KA 3LDGA 4F5ZA 1NP6A 5IDVA 4NYMQ 1IUNA 4WASA 1L7MA 3ANXA 1DGSA 1VE5A 3CLKA 2VAXA 1RYHA 2AEEA 3F3MA 3AKYA 4W9MC 2RHCA 5E6UB 3UOAB 3KXLA 2ZR7A 2GM3A 1C4WA 3I2HA 1GPLA 5F52A 4EEXA 2D8MA 2LD4A 1KY2A 5EWFA 3LRPA 1LW6E 3SEFA 3V2UA 4UU1A 3RKUA 4ID9A 3F5DA 2BP7A 5H0IA 4M8KA 4XTRA 3ITKA 3F73A 2P9EA 5KBYA 3W1BA 2DFLA 5KG4A 1LDBA 3EMBA 3RDPA 1JDBB 4D4GA 2WJVA 4KBYA 1AXEA 3AK4A 2E82A 2FN9A 1K6XA 3LY8A 1GU0A 4HDOB 1PNRA 4WV3A 4EHHA 3HKEA 4FR5A 4PDBA 1B2LA 4IICA 4JI0B 1NRIA 3A6EA 3KQUA 4ZT3A 5JAPA 3AERB 4MKRA 3LMKA 2CNUA 3FHCB 4Y1FA 2G4CA 3VI4B 1TKAA 3SVLA 2QEQA 3M3DA 5IUKC 2C88A 5EP3A 4ZOLA 4W8HA 4HNGA 4RHEA 1XRSB 3L4KA 4JLWA 3RF6A 1SKMA 3FDZA 4M9XA 2A88A 1KL7A 3IAS1 1OI4A 3DDNA 2C3UA 4TV9F 2CGEA 1HR0B 1G8PA 4RE6A 4RMJA 4DIFA 3OCUA 4CDMA 4YR2A 4RL6A 4DNOA 1ZH4A 3OQMA 2GF9A 2OB1A 5CX1B 3BFKA 4OK6A 1R9TA 1MRZA 1DTEA 5CIWA 2XQIA 8OHMA 3E05A 5KFIA 1WE2A 2DUNA 1SXIA 3MPOA 1UNNC 3NDBB 1KRHA 3DW1X 4KJXA 1P0QA 4ZK6A 3R3WA 5DRTA 1GNLA 3OX2A 1E1CB 5FLEX 3SQWA 2PA3A 3A28A 3ZXUB 5I7SA 1E8NA 2IW3A 3HBMA 4KMOA 3BIWA 4D79A 2GAJA 2VIIA 3WZ2A 4DR3H 4TVSA 2ZUFA 4U8HA 2P6PA 3UHJA 3U9LA 3GIIA 1XEXB 2DERA 4ZYTA 3AUFA 1L5FA 1JDSA 4YJDA 3DLTA 4LC0A 4GWKA 2EFDB 5HIAA 3GY0A 5KUTA 2HF2A 4DA7A 3FKIG 4OUDB 5FV7A 2ISCA 5E9WA 1PUIA 2L18A 4Q7EA 5IDWA 3LRXA 4EA8A 3OD5A 1JR6A 3ES9A 4Y67A 1I2KA 1U8ZA 4KMMA 1GNPA 3PUHA 4FD2A 5EESA 1N7HA 1N92A 3STYA 3WGVA 4IDAA 5FO0A 3MJEA 1MDFA 3KB2A 4EO7A 4ZZ0A 1T94A 1BHO1 2OORA 4J2HA 1ZIDA 4OI0A 3UWMA 4K9KA 3EK2A 1A4IA 3LL7A 4Z4GA 3H1FA 4DBLE 1X7HA 2R8PA 2JGEA 5AI8A 3CCFA 3IMKA 2B1RA 2CJFA 3KT6A 2DYKA 4LPSA 4D6XA 2OAEA 3C1TA 4EHNA 4C4AA 3FWKA 4RPHA 1AMUA 2OFPA 1Z33A 5LU9A 4LPKA 1CDEA 5DLPA 4KO4S 4I3GA 4B4OA 3URKA 1HG0A 1ZOPA 1RQGA 3SJZA 4UBLA 1RI4A 2Z4SA 1ZKDA 2JGAA 4ALKA 1KEVA 2WG0A 1E6MA 3IHKA 1UMKA 3TQCA 5C5DA 1KSGA 3G7NA 3R3VA 1IM2A 4D3DA 2H65A 5FI5A 3W1GA 4GAEA 1VA4A 4HLDA 2HDKA 1N2SA 1SXGA 4GDFA 2SKDA 3MFHA 1YBFA 3IERA 3PNOA 1RP1A 2MCTA 1FDVA 2UV8A 1RXUA 4M7PA 1KZGB 1VGQA 1PGQA 1SBIA 4AW9A 3TZCA 5ALPA 4K88A 3EEQA 4CMCA 2CFCA 2JJQA 1VMEA 3HWRA 3SZUA 3WGNA 2O8EB 3DO8A 4FIDA 2ID8A 1PFWA 3FY4A 2EBFX 3BS4A 3OP4A 3N8IA 4W5RA 4WY5A 3WBBA 1VBMA 3FGNA 3SFZA 1VJ5A 1OX6A 2VH2A 3ZWOA 5ADWA 2R6CA 4GMHA 2DY0A 5EEHA 2IUUA 2HCJB 4RPJA 2VCYA 5AI9A 5KMGB 4YRDA 1N33H 1Q1ZA 2GN6A 5ALQA 2V0GA 2C96A 1GTMA 1PBTA 3BCUA 5I9IA 1TB4A 4P81A 5A06A 1W85B 3L1HA 5ED0A 1PFVA 5T8KC 3LLUA 1VKRA 3W8DA 3C0FB 3VR1A 3CXUA 4L57A 1UKZA 3LK6A 5SY9A 4KUGA 3CSSA 1NMEA 3H1EA 3PTAA 3TL6A 4RD4A 4UNPA 4E70A 3G8BA 1N2OA 1SQSA 2GDZA 3R7FA 1P60A 2IEBA 3FUWA 3AF2A 4LYAA 3BB3A 3MT0A 2QX6A 5FJIA 1DE0A 4HKTA 2BM0A 2JEZA 3QTTA 3CM0A 4OMUA 2Y68A 2B4KA 4LNAA 5AK6A 1ZGHA 2X19A 3F9CA 1ZHFA 3HRKA 3KOZA 4AF7A 4QTUB 1WNFA 1PYGA 4A3BG 2IKSA 1E2NA 3PSHA 4L0DA 3VC7A 2Z2IA 1YS2X 2G4VA 1D4FA 1MOSA 2F3SA 2XMRA 4YMTA 3QJGA 4EZEA 1Z4LA 1JEAA 1XA0A 1KYYA 2PH7A 4TKLA 5JS7A 1PGJA 2ZBUA 1LBSA 4FOPA 1JJFA 2H5IA 1R0ZA 4UBJA 2NYAA 2AT1A 2XDQA 1ZM7A 1FU8A 2ZBFA 1QRRA 1XCJA 3B9BA 5J43A 3QNMA 4HEQA 3ZVNA 3NBFA 4QEZA 3WK9A 3H2GA 4CODB 2AGQA 5EIWA 4EVRA 1MO2A 3U37A 2GTPA 4J0QA 4QJIA 3QV1A 2HV9A 4JQOA 3NKVA 4A1FA 4B0PA 5ELMA 4QSMA 3W5AA 4C89A 1EWRA 3WIEA 2DEUA 1VIMA 3TLBA 1XRLA 1ORIA 2HMYB 3DVAA 5TGDA 4ND8B 3AHDA 3GTPA 3L1KA 4MDEA 1P3DA 4FC6A 1T8PA 3PXUA 3GLRA 3TF5A 4PRZA 3WWIA 5CU7A 4ETIA 2V59A 3DEHA 3DZDA 4CF4A 1V95A 2VQDA 2VH1A 2H54A 4JCOA 2AX4A 3TTTA 4J3NA 5AW8A 4OHXA 4XUDA 1SU6A 2RSLA 1EKPA 4PZ7A 1BTOA 3V42A 5AJUA 3IX7A 1R0BA 1G7TA 4OHCA 4D8VA 4DA6A 3JQEA 3A6JA 3OT5A 2Q7OE 3FAKA 3S8EA 1QZ3A 5DEIA 2Z98A 4IGKA 4URVR 3CUSA 3TTUA 1XP5A 1P1KA 2H2WA 1DIRA 4OQXA 3RVLA 3D02A 1Z0ZA 4PYLA 1QK3A 4B0OA 4XXHA 4H0FA 1GVHA 5EMJA 3BAZA 2X76A 2W9BA 3Q7RA 4QUDA 3QMMA 1X39A 3ODGA 2UDPA 1HV8A 1AE1A 4F9FA 1JMYA 1UQRA 2FJPA 2R8KA 2XB4A 1GNRA 3SX2A 1P2UA 1TJYA 3W1EA 1A50B 4J6EA 1N9GA 5CR9A 2HF7A 3MQ4A 2QSJA 2Q4BA 3CH4B 2CXQA 1UBMS 3FTPA 3F74A 3KJIA 3HY3A 3W06A 4D8TA 3KKMA 4RGBA 2WU3A 2H2HA 4RB0A 1H0KA 5KNCH 4IZOA 2PD4A 3ZDXB 5JJIA 1ZOSA 4N5LA 1DCKA 1GO3E 1KJYA 2WTMA 3NETA 4YRZA 4C6HA 1JTFA 4KE8A 5CA0B 1PJ3A 4P0TA 3V7UA 1IWPB 3EVEA 8ADHA 3ZGNA 1T6YA 1ZYUA 4B81A 2DSNA 4F96A 2R4UA 3TVYA 1F8YA 2H2AA 1EE2A 1CJMA 1UIRA 4K1LA 4UCUA 3O92A 1NX9A 2HQRA 3BGSA 4PBRA 4I1VA 2C7VA 3A1DA 3O4FA 2TYSB 1RYFA 4W6QA 3X44A 2R1VB 3QY0A 2O05A 4C3UA 5CDSA 4YHBA 3D8BA 3QRWA 4J03A 3Q1KA 3C6QA 3BD9A 3FF4A 5AYVA 4KQGA 3JATB 4K3UA 1Z6XA 3NFRA 4HNHA 4E5KA 1UZUA 4XGKA 1ODLA 1PZFA 3AEXA 3MLEA 4XM2A 2Y1WA 2UVUA 1TQ2A 4H1TA 2I65A 3T5KA 4Z6KA 4EECA 4N3BA 1XTBA 5FPKA 2AS0A 4UAJA 3LH5A 5SV2A 1KK1A 5LSAA 3PF9A 5EJ9A 3ZU4A 3PO2G 3HBNA 1E4FT 1RC8A 5H4HA 3JAKB 2SBTA 1DJNA 1IOVA 5ANRB 1WMBA 3PQFA 3RU3A 1OWTA 1VPLA 4KIFA 1O0BA 1ZK2A 5LMCA 3CMMA 5DYGA 2V7VA 4CKEA 3S2YA 3QUSA 2I67A 3M6MD 4Z3KA 3PJDA 4NCKA 1LI5A 2O9JA 1YJ8A 4Y7CA 1GFSA 1VS0A 3RAXA 2G72A 3ZDFA 3NH9A 1OZ0A 4GR9A 1O7JA 3VDQA 2HCFA 2J09A 2F8MA 4WXEA 1OVGA 1J56A 3HCNA 4OXNA 4HH3C 3MMPA 4LGMA 4TMYA 1OC2A 3UB3A 3WB2A 5EIAA 3E48A 2R7AA 1E66A 1DXYA 1VIYA 2ANBA 3ZGLA 5F7XA 3EPIA 1JQ5A 3G2IA 4UOQA 3O7MA 4U7TB 1W0KD 2QN1A 2ZWIA 2OBLA 2R8XA 4MVXA 4ZT2A 2CBXA 3RTXA 3BJEA 3V8RA 2NQ8A 2PK3A 3FKIA 2DBQA 1E5DA 3NH6A 1DOHA 4HNQA 4IX1A 3ILVA 1ECBA 4HB0A 4I4TA 4O2AA 3LAWA 2OGSA 3UC5A 1NN1A 5JAUA 4ECZA 5K3OA 2VUUA 1P16A 4JOBA 4U2CA 1RWPA 3UO8B 2RHGB 3U4QB 2EIXA 4NY1A 2WUGA 1GCGA 2PKXA 4M38A 2A67A 3R44A 2W2LA 1V47A 1PU2A 4BBZA 1LI4A 4QECA 3ASVA 1P6QA 1Z7GA 4DV0B 4E32A 3KYHC 4AQ7A 4BS9A 5HCNA 3NC4A 2FK7A 4TSRA 5AFSA 4EHFA 4IDNA 4C30A 2ZYAA 2FJZA 1CEQA 1AKYA 3NWEA 3GBSA 5AW1A 3GIDA 5IHXA 4KSBA 1PLKA 4YX9A 1C3JA 4LRWA 4Q9DA 1VJRA 1KXZA 4EHAA 5UKDA 4UHHA 1E60A 1FF9A 2WWWA 1C0EA 4CDNA 3V4SA 2I6SA 3ZY5A 2Q6KA 2OZEA 2JGDA 2AUNA 5ESDA 4EKDA 1ORVA 5EY5B 5FL7A 1IN5A 5MHTA 1KJZA 1RWKA 1ID8A 4FZ5A 3NAMA 1RVDA 1V1RB 4U5XA 1IBLB 2JFHA 1QRDA 3FTCA 2R8JA 4QELA 4QLAA 4J90A 2JLBA 5HEKA 4XCXA 2XUGA 5KCMA 1I4OA 3I6ZA 4KCGA 5AW6A 2MINA 2CC2A 4OSEA 5GZ6A 1K4KA 1I2DA 2ZE8A 3P9CA 2PAFA 1FTNA 2W4QA 3QWHA 3AHIA 3T5AA 2ZGVA 5A3JA 3ROEA 1Z0IA 4EQ6A 1Z73A 5T14A 1V9CA 4M22A 1U8TA 3DAFA 1S6YA 4HLCA 3VC1A 3DYIA 1P8AA 2Z83A 1XXHB 3HSYA 4GYYA 2H52A 2WWRA 4PC2A 4CM1A 2AUTA 4X3OA 4MQFA 3FOAA 4BNTA 1XTPA 1LSUA 4D9JA 2WQ7A 1CR6A 1GTZA 1SWVA 1EFPA 3AEUA 1UFRA 3A6LA 3ZDBA 4MQUA 5CVUA 4I8XA 3C39A 2UUAB 1ZIOA 3HR7A 5HF6A 3HXOA 1IN8A 3KS9A 5HDBB 4EUEA 3OJCA 5DQHA 1AA6A 4JODA 3G17A 1YDEA 4OJKA 2GNPA 3DS8A 4INPA 4LGYA 4XIFA 4HHEA 5CXXA 4LDAA 3HPRA 2JKZA 3EVZA 4Q9KA 3B7GA 4J3JA 5C8YF 4F92B 4IZIA 2IDZA 3BTOA 2II6A 2BE9A 5CNMA 1U0HC 1OTHA 1EAYA 2OT3B 4EB0A 5F4ZA 5FWYB 3GHYA 3GTLA 2NAPA 4GOJA 3T38A 2AVNA 2PS9A 3AY6A 2UAGA 3QVOA 4RZSA 4LJKA 2GJ4A 3W3AH 4URUR 3H8WA 4WFKA 4CQNA 3PL5A 4AIIA 2W6IA 5C8DA 4L8YA 4AJ4A 1NBEA 1M7JA 3OWHA 2E5LB 4E3WA 4QGSA 1QS0B 4XH9B 1HT3A 3EXFB 4Q66C 2Q2TA 1U6KA 2CVFA 4BNGA 4QXPA 3KSUA 1XK7A 4XX1A 5HMMA 4Y2SA 2FDRA 5GGXA 1NVTA 4B3TH 1XMQH 2RK6A 1XCMA 4I6EA 4JLSA 2C5AA 4WD3A 5FBVB 4JJEA 2CXSA 3H4MA 3QVSA 2Y71A 1RJEA 1EFTA 1KHTA 3M7IA 3FCYA 3QE9Y 1GG2A 2B6HA 2TMKA 3B3AA 5L1KA 3MLBA 3MCAA 1W46A 4PONA 1K89A 1JYFA 2XBUA 4A3KG 1A5BB 1TIPA 2PUDA 2I4OA 1UAAA 3EGXA 5ILQA 3OU7A 1EJ6A 3KO8A 4MLDA 2EJUA 5L53A 4HZUB 4YLYA 4U6NA 4I9UA 4MI1A 1RPZA 5ILOA 1I0ZA 1EA7A 3K72B 3ZDYB 1KMCA 2PL9A 3AUXA 3PQ7A 5AJYA 3T5GA 3H0KA 4HDSA 5F1KA 2Y3IA 2PVCA 1EQ2A 4JP5A 5JAQA 1NONA 2XSZD 1RWWA 1EVJA 3U9TA 4Q02A 1SCAA 3E15A 3K4QA 5D84A 4K9PA 1WUJS 4RTLA 3WS7A 3HCDA 2LZ0A 2IP4A 5ECDA 4AZTA 2IH2A 2V74B 4N6NA 2ATIA 2VRCD 3T3PB 3G9QA 4LRTB 5IC4A 4ZCMA 3CNEA 4TT8A 1EG7A 1RFGE 1LK0A 4FONA 2DXIA 4RCYA 1TX4B 2IE0A 4BGUA 2Y92A 3UCEA 1VJ1A 5FQNA 2JB9A 2C97A 2BGLA 2Q27A 3C2QA 3HSSA 5DNWA 5JXIA 2H9IA 2SKCA 3VDXA 4BO7A 1E0DA 1G20E 5KAPA 1ZCZA 4WKCA 4RACA 3V33A 4F56A 1ZEJA 3QOXA 4CIDA 4M46A 1W76A 4C2AA 4C7JA 3KJNA 5JW6A 1ZC3A 1VLZA 3E5MA 4N82A 5K8CA 2RGDA 3BWEA 2L2QA 4UARA 3A0RB 3WL8A 1PWXA 1OH6A 2JVKA 2QPLA 5EIHA 5LYYA 4Y2UA 4BNLA 1KOJA 3FAZA 3N2NA 4YXWA 2QTVA 5LP6C 1XWFA 3OM0A 4BN4A 4TWZA 2PTGA 3U16A 4ZVMA 3C8MA 4XWWA 4UNRA 1T5HX 2ZXUA 3FBTA 3MWKA 2GO1A 5K0LA 5ALVA 2VXCA 3I1IA 4L08A 3UK2A 3IVCA 3INTA 5JS6A 5DNAA 1USWA 1SCNE 1DAGA 2QPOA 3TMYA 1CPYA 3RE1A 1VCNA 4DR3B 4HEJA 3TQQA 4XWYA 5AIBA 2HLNA 1XDWA 5GPBA 3DL4A 2RI1A 5HX7A 5ITZA 3WQSB 4ZZ3A 2W6PA 1Z6PA 2IU0A 3ZLJA 2WEKA 4YALA 1T9ZA 4NL4H 4NICA 2QAGC 3EUWA 4JGGA 1ZL2A 2XW6A 4MRMA 3WKCA 2IPLA 4IHJB 1PR3A 4CV0A 1ZICA 2PO7A 3OO0A 3AKEA 2HRBA 4GKBA 1UMCB 3BORA 1PT7A 3ROPA 1ZQ7A 3UMBA 1Y9EA 5FBQB 1U5BB 3GAZA 1PJAA 1NA5A 4OHZA 3P0IA 5CJ2A 3SS9X 2NWQA 4UOEA 3G3EA 3MWGA 5KQLA 5EJAA 4LJRA 1UMDB 4YRKA 3LUPA 2QSZA 2OYCA 2EZ4A 1I1MA 2EGUA 2ODAA 5J5VA 1IBKH 2PZGA 5DCWA 1G3MA 2AOTB 3L0PA 1TWAA 1ZKMA 5EGSA 4OCZA 2O57A 5GMOA 3AW8A 4I8DA 2H11A 4BP1A 3VR6A 1M72A 1ZH6A 1P18A 2O2HA 4B31A 4GKKH 3BUSA 5K4AA 1T5BA 3L82B 3EUAA 5HKKA 3CZMA 4NTZA 1ZK4A 4ITUA 1Q0PA 4HUQB 1LRJA 1VLHA 4EIWA 3ZY2A 2ID4A 4LVCA 4I8IA 1H94A 3ORRA 4G5FA 3GLVA 1U9YA 1TA0A 5HJ2A 1ITZA 3L7BA 1CK4A 3Q10A 1KVUA 4IEFB 5KFCA 2JA1A 5ALHA 2YQZA 4QIWA 3SF8A 1VKHA 4C3VA 4DCVA 1IZ8A 2WF8A 4PF1A 3H5WA 3CRQA 4LWZA 1I6MA 3LVQE 1CUVA 1U1CA 1X6VA 3M4ZA 4IRMA 1V5GA 4CQJA 3EZXA 2RMKA 2HXGA 1C4OA 5SY6A 1N33B 2PY6A 3OOEA 4N8DA 3SIXA 2VK4A 3UAZA 4MUMA 2ZRCA 3ET5A 1DWQA 1YQXA 1R9MA 4LK3A 2TMYA 5ENDA 5ALZA 2FPRA 4GPD1 2QX4A 3AU9A 3L8EA 5A4IS 3KHSA 1PI3A 5GOTA 3QOYA 1AM4D 3KHRA 3EFOA 2EX0A 3C7CB 2PMWB 2O1WA 3L8DA 4M4SA 3PW7A 1T2NA 1U9IA 1AOXA 5ALEA 1O95A 2ZWMA 1NXWA 2VRNA 5BN3B 3WNQA 3EVAA 4AWBA 4D9IA 4ABYA 1W88A 3ANYB 1SFRA 2XUZA 4AK9A 4RFSB 1BE8A 4YLEA 4ZHQB 3U1BA 2FHPA 4PVDA 3WJ7A 3TGWA 2B7LA 5PNTA 1OXTA 2A86A 3NX4A 1NLYA 4IOLA 1LC3A 1KARA 5IX8A 4AS2A 4L50A 3KZMA 4X9XA 1YZ3A 3GZJA 3C3EA 2NW6A 5BV1A 2FE3A 3R20A 2HKIA 3NHKA 3W5DA 2NN3C 4UULA 5KG7A 1UEXC 1RM0A 3K6SB 2E6UX 3DE6X 4HX5A