2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
3N6RA 1KUTA 2CQYA 1SCUB 3VA7A 5JVDF 4O83A 2VQDA 2YW2A 4TV8F 4FFLA 1JKJB 1M0TA 4IIJF 4HQ6A 5J2TF 2W6MA 4MV1A 4EGQA 5LOVF 4O7YA 1IOWA 4C5AA 2I87A 4O81A 2YZNA 3KAKA 4MAMA 1JLLB 5CAEB 1UC9A 3GLKA 2Z04A 2DIKA 5GONF 2DLNA 4WD3A 3K5HA 1B6RA 3RV3A 1PK8A 2ZDHA 4MA5A 2R7KA 3TW6A 4C5BA 1W96A 1AUXA 2R85A 1M6VA 5JH7F 3BSYA 1EUCB 1KBLA 1KJ8A 4NYEA 1EHIA 2PVPA 1C30A 4XX0B 2DZDA 4FFPA 4FFMA 5HV6A 4TV9F 3NUAA 2FB9A 4FFNA 4EA8A 4I4TF 2YRXA 2YRWA 1JDEA 2W6QA 5C8YF 4GGMX 1IOVA 3HO8A 4FE2A 2PN1A 3BSSA 4ZHQF 2NUAB 4EABA 1DIKA 1GSOA 2CZGA 4ZQIA 3MWDA 1UC8A 1M0WA 4FU0A 3R5HA 3MWEA 3LP8A 1WR2A 4O4HF 5H80A 1GLVA 5CA0F 4O7LA 3Q1KA 2J9GA 3RV4A 4O7NA 4HNVA 5C1OA 1E4EB 1KEEA 2YZMA 3JZFA 2V5AA 3KREA 4QSHA 1Z2NX 1PX2A 2YYAA 4MV6A 1EZ1A 1OBDA 2GLTA 4DIMA 4O7ZA 4C5CA 5CB4F 2NPOA 2R86A 3WO1A 1AUVA 4O86A 4EAAA 4HNUA 2ZDQA 2R6FA 3R9RA 2NU9B 3JRWA 2HJWA 5LP6F 3VPCA 3OUZA 2C00A 4EGJA 4M99A 4L1KA 3VPBA 5BPHA 3DF7A 1CQJB 3BFPA 4FFOA 4ME6A 5CA1F 2W6OA 1EUDB 1W93A 3MJFA 4O7SA 3G8DA 3E5NA 4HR7A 1VBGA 3RFCA 1EYZA 3WO0A 2W71A 5JQGF 2R7MA 5LA6F 3VMMA 3R23A 2R87A 2NU8B 2CNUA 4EG0A 4HNTA 3K5IA 2PBZA 2HGSA 4O7TA 5JQWA 2VR1A 4O7WA 3ORRA 4YJ3F 1VKZA 3TINA 5I47A 5DMXA 4IZOA 3JRXA 4O84A 2V59A 3V4ZA 3VOTA 3ETHA 4XZ3B 4XYMB 4WBNF 3TIIA 4ZOLF 2P0AA 1B6SA 3K3PA 3HB9A 2NU6B 2FPGB 3ETJA 2QF7A 2GPSA 4M9UA 2W6ZA 2W70A 1CQIB 1GSHA 4EA7A 1I7NA 4M9CA 4YJ2F 5LXTF 3QFFA 4ZI7F 3JZIA 1I7LA 2YZGA 3R5FA 2GQRA 4YAKB 2WYOA 2NU7B 1CE8A 5KKNB 4MV4A 3GIDA 1ULZA 2X0SA 3ORQA 5EZYF 4YB8B 2Z02A 2FPIB 3U9SA 2XD4A 1BNCA 2XCLA 4RZQA 4O2BF 2YZLA 2R7LA 4I50F 1GSAA 1KJQA 4M98A 4E4TA 3OUUA 4TUYF 5J2UF 4MV8A 4MV9A 2R84A 4YBZB 3LWBA 3BG5A 4IWXA 2V58A 1KC7A 3N8DA 1KJIA 5KX5F 4YAJB 3AX6A 5IYZF 3U54A 3U55A 2CNQA 1Z2OX 1DV1A 1C3OA 5LYJF 4O82A 2YL2A 2YWVA 3I12A 4Y8VB 4O7RA 3BSWA 2GPWA 4O4LF 1A9XA 4IWYA 2QK4A 4FFRA 3Q2OA 1Z2PX 2FP4B 3SE7A 4IHJF 1CS0A 5C1PA 3VPDA 3WNZA 2CNVA 4FGRA 2R82A 1E4EA 4O2AF 3KALA 4J6EA 4O4IF 1BXRA 2W6PA 4DLKA 2R7NA 2GQSA 3G8CA 4I55F 3KAJA 1T36A 2SCUB 5BPFA 2IP4A 4EA9A 1GGOA 3RUPA 1DV2A 1JDBB 2I8CA 5D8DA 2YS7A 3V4SA 1KJ9A 3HBLA 4O7VA 2DWCA 2ZDGA 3R5XA 3TQTA 3U9TA 5K2MA 3UFXB 2VHEA 3TIGA 4MA0A 1VBHA 1A48A 2YS6A 4O4JF 1OBGA 4MV3A 4MV7A 5FNVF 4XYLB 3AW8A 2I80A 5HBRB 2FPPB 2W6NA 5BMVF 5JVLA 1KJJA 2VPQA 2OLSA
chains in the Genus database with same CATH superfamily
2VZLA 3EUFA 5AK4A 2B61A 4Q93A 4PSDA 3WMWA 3P9ZA 5DI3A 1CVLA 1CLEA 2ZAYA 4L85A 5H82A 1EB9A 4NJOA 4DR7B 2BFFA 1U1EA 5F2EA 4F21A 3UMMA 1O95C 2J5XA 4HRVA 5FBWB 3KVNA 3T5BA 4Z49A 3HHPA 2DWQA 4Y2PA 4I14A 1MB2A 1FYVA 1UJ4A 4Y7CA 1BEZA 3H83A 4MITA 3CH7A 4J3NA 1MGPA 3TLMA 1S0MA 2QX9A 1NQXA 3R9XA 1O0BA 1C1YA 1T91A 2IS4A 1FRQA 3NUAA 4V1CB 2HO4A 4WZBE 1CKEA 1VG0B 3SQXA 1SOMA 1EA5A 3V4RA 3BMXA 3WBFA 1NUUA 1SXQA 1XZAA 1GGNA 4AFNA 3H5AA 4E2XA 4KDCA 5AJUA 4DV2B 4LNUB 1Y7IA 4NXMH 4DJDC 2C4NA 1U5BB 5J4LA 2C42A 4GGPA 4UCWA 3SX4A 1U7OA 4TMFA 3G5LA 3HBJA 1T2NA 5KYWA 2DECA 2B4TO 1T9DA 3OO0A 4N5IX 2BMDA 1OA0A 3NTQA 3EH2A 3NC0C 1JG1A 1R4ZA 3QOXA 3IIJA 2QP3A 1P1KA 1OXSC 4ND8A 2CUKA 3H18A 4P6VF 3M1YA 4LE1A 4GIBA 5I60A 1Z4LA 1YR1A 5JT1A 1PI3A 5GADl 4WV3A 5HJ2A 4FGKA 3B7PA 1Z2AA 2XZDA 2NO9A 1AMNA 1D7AA 5KYXA 2VDMB 3EZNA 1X70A 1ICIA 1KOLA 2HZ7A 5E4TA 5EE3A 4BQNA 1UKBA 4G8DA 2ZETA 2P9QA 2C8VA 3NEYA 1N3LA 5F2NA 2EIHA 4NMXB 1AKVA 3SCZA 3H3FA 1KHTA 4BFUA 1MOPA 2IBKA 4NFLA 2BEKA 3GGPA 2A0YA 5CXUA 1K6EA 2XXAB 1UXIA 4EQ5A 4MHOA 4NYJQ 4PEVA 4CMIB 2ZT6A 3QJGA 1A27A 1JXLA 3C6KA 2VF2A 3T3OA 3GT4A 5BYJA 4LY6A 2FWPA 1TCUA 4FYVA 2K5UA 3UAVA 3OU2A 3K9QO 2N1BA 1MC8A 2IFTA 4ALKA 4OJKA 2IE0A 3VISA 4BZWA 2QNIA 1DCFA 1SEPA 3U7GA 3FX2A 1ZH2A 1Q1AA 2ATVA 3GFVA 3AM3A 3P52A 2P9BA 4JJZA 3F98A 2RGAA 1Z4JA 4P4TA 1GPNA 4R01A 1BHO1 9GPBA 3NC1C 2H48A 2IH2A 4IR7A 4EG6A 4MP8A 4NG5A 4WDQA 5EPUA 2H1FA 2YFYA 4YRZA 5KOHB 1TTPB 2ONYA 4RK6A 5AVXA 1L4MA 3GCWA 3AKDA 1B2RA 3HK2A 5K3EA 1WMFA 2MDTA 4O4LB 2EYUA 3GROA 3KXLA 1SBIA 2C22A 1CRLA 3K15A 5EXPA 4NFYA 3U7JA 2AJLI 1ZG3A 2FA9A 4CUJA 3KYJB 1QO9A 4EKIA 3ILSA 5CLGA 1W1WA 4IR9A 2YMMA 3AUSA 3GTQA 3QEAZ 4YN3A 3WDMA 2W37A 2V6GA 3H6HA 1FDSA 5ED4A 1NR7A 4WKGA 4OOFA 4WN9A 3PR3A 3Q8KA 2BDUA 5FEUA 3G5AA 1HDIA 1EXWA 4G1UC 5KJEA 5E6RB 2QM0A 1ZRMA 3S29A 1K7EB 1EIWA 3K96A 3FLMA 1XTZA 2E4WA 4ZQHA 3GJXB 1X77A 2VXBA 3MQ4A 3GDEA 4EFKA 3ZHUA 4DTCA 3THYB 3N6RA 2UUOA 4I8XA 3OBBA 2Q5EA 4ZMBA 3OJXA 2UYGA 1RQGA 4DEVA 1GGFA 1A7UA 2Y1DA 2YW2A 4FFLA 5AHOA 5J2TF 4GNRA 4IV0A 3R24A 4MV1A 4GXNA 5KFFA 1HQYE 1QGUB 2GCOA 4U8GA 4G26A 1JLLB 4YRSA 2YWJA 4PYLA 1ND6A 5DIFA 2MYUA 4DQNA 1T9KA 3USCS 4LYGA 4MCJA 2ZXEA 5ER6A 2Y99A 6PFKA 3JTMA 2O2YA 1EHIA 3ZHXA 2PMEA 5BV0A 4C22A 2P67A 2JK1A 4ZT2A 1WHSB 3THWB 3GT3A 4K0RA 2CLMB 2UVDA 4BXOA 3L4KA 5FTNA 4EYSA 4BWVA 1H0HA 3ZY6A 1P44A 2QN1A 2PX0A 1NBAA 3SFZA 2VOEA 4Y1EA 3UC5A 1P1HA 3AEQB 1XI2A 5KMGA 1GRNA 4ZHQB 4KE6A 3D0QA 1PLKA 1SU7A 4OA8A 3TSOA 3ZJ4A 5EJ6A 1CERA 2RF4A 3DAYA 5FI3A 3M9WA 5U1PA 2QLBA 1ISPA 4Q7KA 3EEBA 1YQDA 2BHRA 1KI7A 5KFHA 1V41E 4G5HA 2XOKA 3LUHA 1Y9DA 4IZ6A 1WZCA 1C0IA 3P5SA 1L5QA 2JKYA 1T3GA 1IPFA 1WO8A 3FZQA 4ED6A 2WF8A 2VAWA 1L5NA 2YASA 3UUEA 2D3TA 1K89A 2WJPA 5EIXA 3PSAA 4BNZA 2GEFA 2HA4A 4CRWB 4QDKA 4BVJA 4LGVA 4UAUA 2PGIA 1JTVA 2W4QA 5F1PA 5IBRA 4IV8A 4Z51A 4FNMA 3UKOA 4AJNA 1PTKA 1QF9A 4GBGA 1TK2A 1UBHS 5AJXA 2RC5A 3A3YA 1Z5ZA 5AUOB 4KH0A 2IV2X 1BXZA 1W30A 5JUWA 1A7JA 2WHRA 2PNJA 4J8PA 3RS2A 5JY6A 5AYVA 2YFQA 1UDBA 4ZC8A 3ROMA 1I4DD 2FSHA 3STXA 1NXVA 1AX9A 1ZMRA 3V9PA 5U9CA 2JZOA 1GUBA 3LMKA 4Q21A 4KYUA 3PQ2A 3T5KA 2W8KA 4XWAA 2ADOA 4B7XA 1XMSA 2RAVA 2W9BA 2REXB 3KJNA 3IR7A 2ID4A 4HBZA 1RAGA 4KXWA 4B0PA 4EZIA 4NZOA 3G0GA 1WY7A 2TSYB 4WGFA 1MO3A 3JVUA 1GXSA 2WYOA 4EPXA 2H08A 3T8YA 2CHVA 4EDHA 1SUSA 2Y1LA 3EGXA 4O6VA 2F67A 1KMHA 4B7CA 2RGWA 5JTUA 3I2KA 1XLTC 1O5TA 2O8FA 1R6TA 1HG0A 4MV8A 3QU7A 4LSAA 4FHGA 4A3IG 4AVYA 4GQBA 3U54A 4XARA 3W6OA 1MUUA 5IKPA 4TYMA 2GAAA 1Y4DE 5E7QA 3GH1A 1T2FA 1UQRA 1Y48E 4L02A 4ZVOA 4ZEWA 3K30A 2DEUA 5LZ8A 1KI8A 2PSDA 3LLMA 3MTDA 3FE2A 1XDDA 3C8ZA 3KC2A 1JDNA 2BRUA 4DRXA 1P3JA 4CM8A 3GTGA 3BJRA 3MJHA 1B15A 2AYXA 4KREA 1CC1S 5AESA 1Z0ZA 2QPTA 3ZCVA 4YVFA 1DUSA 3GC6A 2D62A 4FKMA 2DX7A 1G63A 2J3DA 3NKVA 3QKSA 4HB3A 2F3UA 3KLNA 5ADHA 4N5NA 4FR2A 4E5MA 5CJPA 3MINA 2B5WA 4L0MA 3JSAA 4GPZA 5G1OA 4NJMA 1KJYA 3CGWA 4LBYA 1DKPA 5FYDA 3GRPA 3U37A 1Q20A 2PA3A 2VIIA 4KVGA 2FDCA 1JKJB 3OE5A 3PE4A 3O47A 1DTWB 3X2SA 4FDLA 3DO8A 5J4HA 1DO0A 1RBZA 1ZINA 2H2FA 2ASDA 4MRMA 4V0LA 4XOUA 3DFIA 5ALMA 4QNMA 3K0SA 4QSMA 2YIJA 4LBVA 5EJ7A 3I5XA 4LF9H 1MAHA 3EY4A 4D3SA 4I6JA 1JAZA 1JEQA 4Y6QA 3GJ4A 4QOJA 1ZUNA 2O3QA 4GG1A 1QTIA 3VR0A 3A6EA 4CIAA 5ABPA 3TLBA 1KO8A 4H6XA 2IT1A 4DR2B 2RDJA 4CEHB 1E0JA 2Y2VA 2PX5A 3JQQA 2FB9A 2YC2C 3C5HA 3O74A 4HQRA 2AMYA 5ADVA 2OZKA 3MQFA 4YCMA 4I4TB 4GGMX 1DEOA 4KGZA 1JEEA 2XGQA 3PFKA 3EK2A 1DIKA 1F0PA 1SG0A 2IYWA 2O1EA 3DZKA 2COIA 1Q77A 1XNRB 1N2CE 2W0MA 4UD2A 3CVZA 4QQFA 1W59A 3O2JA 4ED1A 3BUSA 4BZPA 2K6GA 4UE6A 3WWEA 5HHTA 5HQTA 3SN6A 3VMFA 3QPCA 4ZQGA 3ZKAA 5LC1A 4XCXA 1CVIA 1FXSA 1OVMA 2CUZA 1ICEA 1G5PA 5KTTA 2WWYA 2E89A 3T4UA 4I5FA 4LXIA 4J7XA 3TK1A 2MR5A 1X1EA 2DCUA 4QVKA 4LHWA 1MA3A 1XNQB 2ZVJA 5G1PA 4K2AA 4XGQA 3W3AD 3RRNA 4ARIA 4UCOA 1GFWA 5DSZA 3L2OB 4TTVA 5K4GA 4DR2H 1CY6A 1N5MA 1UEJA 2WQ6A 2VJAA 5IG2A 1ADCA 5A0FA 1DZIA 4R1NA 3ZQ4A 3E9MA 3DJFA 2GAIA 4KL8S 3LLSA 2O7VA 3GRAA 1TTHA 3AZPA 3E9DA 1X9GA 2ECOA 5HK9A 5KTKA 4LX0A 3FJYA 2W2TA 3WLJA 2Z4RA 4OBWA 3NKLA 5B1YA 1EA7A 2CN1A 3HFRA 1EZZA 3DPIA 4IIJA 2CYCA 4LJRA 1YAJA 4GZ6A 5KJCA 4LVUA 1M6WA 3KR1A 3I1IA 1Z29A 2PZ8A 1MDBA 4WBSA 1PR9A 3MN1A 2QVCA 1SELA 1ZQ1A 2Q45A 1SQ5A 2GI4A 5GWXA 4HGQA 1CEYA 1DRKA 3P9NA 5EZYF 4JL8A 5DGIA 1Z25A 3F3SA 4AYTA 2WJZB 1FSGA 1RRVA 1E5DA 4JFRA 1ENOA 4MINA 3NV7A 1IVYA 2DWOA 4HXYA 2PL3A 1LC3A 4QGHA 3S99A 1XNQH 4RVUA 4HFJA 2GN8A 1A3CA 4M9ZA 4ZYYA 4PTYA 1T1RA 1E7MA 3TNYA 3F71A 3GTKA 3UWPA 2PZBA 2WV7A 3BD8A 4GLFA 3SC2B 3FYUB 1A8SA 1RXYA 5LYJF 1ODKA 4QXOA 4O82A 4EFEA 1A5ZA 2CNWD 3DE2X 4LY0A 1UDAA 2C5BA 4JGGA 3W9SA 1KOFA 1HC7A 5TT0A 2WU3A 3VKUA 1NFQA 2WI8A 1CZLA 1VRWA 4KI7A 3P1JA 1FY2A 3Q7IA 2DPGA 1AZSC 1U8CB 5JZOA 2AQ8A 3TGPA 1C81A 1LF5A 1DOAA 1VLZA 3B1ZA 2CEKA 3JSNA 2HJHA 3N8NA 5B2FA 3MJDA 4BEBA 1V8ZA 3KUXA 4MA0A 5FUBA 3IOCA 3KKOA 2FW9A 2PBFA 4B4WA 1J33A 1KS2A 5J40A 4C0JA 4CW7A 1GYPA 4I08A 5KQPA 1H94A 4FEYA 4CCAA 2VHUA 3IUBA 1C7QA 2DTDA 5HF8A 1ZK4A 2EJ0A 4V24A 4HWSA 1GU7A 4JAVC 1YOVB 1D2AA 1SK8A 4FJ2A 4S05A 2X15A 1YJXA 1KBOA 3GLKA 2OPBA 4JJ7A 3DPSA 2IXBA 5FTKA 4PFQA 4XQEA 3EBPA 2OHGA 3NIDB 2ZYIA 2ZDHA 1ORRA 1RCFA 4QGSA 4L9AA 3ES9A 4Q0YA 2KJQA 1ZM2A 2IYFA 1C7IA 1E3EA 1CDOA 1QU3A 1U2GC 4NCAA 4L6AA 3R09A 2X22A 4PHHA 2ZXUA 5FOXA 3V8VA 2UXDB 1TMGE 2QU8A 4C7VA 3HWWA 3LPLA 1JH8A 3RVQA 3ZZUA 3OY2A 4G5GA 1MBZA 1XEXA 3R7DA 4DT1B 3RFFA 1RYHA 1UC8A 3ZQ6A 5TR9A 3IBSA 1C7FA 5AK6A 4PICA 3HJUA 2CJPA 2J30A 4YMGA 4L5JA 1LLUA 2X3UA 3KREA 3PDHA 4MS1B 4F3YA 4DNFA 1HOXA 2OFPA 3ST7A 4Q47A 5TQ0A 8ADHA 4W5TA 4OLBA 1UXOA 1VL1A 2W22A 1K8XB 4RV9A 1PSDA 4YQFA 1RBYA 1RCUA 1Z4NA 1SKYB 4K6CA 5KZMB 1CRQA 2P6MA 4FLFA 2E2HA 3R3JA 1YS9A 5C7IO 4JASB 4LHXA 3SAJA 2Q4TA 2X1HA 3EXFB 4EUHA 2BYTA 4N9QA 4O7SA 3D0RA 4L5AA 4L4ZA 2W8BB 2Y0DA 4NYMQ 3FROA 1Z08A 4ID3A 4UHFA 2VWQA 4ZPJA 1HR0B 1S1MA 4GM4A 2E18A 1NW3A 1O03A 5EHIA 4FBUA 1M2EA 1T9AA 1E77A 3B20A 1H1DA 2WYVA 1DPGA 3TTXA 1ONPA 4KXXA 4FE7A 3WK4A 4MWGA 1DGSA 2GD6A 3QLTA 3T41A 3RYFA 3IE2A 3Q7QA 3EZYA 4DILA 1JQLB 4X3OA 3MELA 3ETNA 4ECSA 3D0KA 5EZSA 4EYHB 3DKIA 4HLQB 3IDQA 2QRLA 4IRCA 5LUBA 4MW9A 3R6LA 5AK5A 3WKBA 3FOFC 1L1RA 3TL2A 3CR3C 2ZIGA 5HIIA 1STOA 3WAJA 3ESYA 4QOEA 1O95D 2JCXA 1WTAA 3PW7A 2AG6A 2V5VA 2R7LA 3IIMA 3V4VB 5CLLA 3R7SA 1BGVA 3D3QA 3CLTC 2YWBA 4RAQA 3DHEA 1E0DA 1E1RD 5SYMA 2ZQYA 3SMVA 4AZSA 2OBNA 3QXXA 3H3JA 2EEPA 2WR8A 3DXYA 4U9HS 1XMVA 2IDMA 4E31A 3A7DA 2HI0A 1F9AA 2J5QA 2ZGVA 2HJSA 3FMGA 4BVGA 4KZPA 5AKGA 1HR0H 4BU0A 4RABA 5EQTA 2OFXA 2IHBA 2GCIA 2J67A 4LC1A 1WSDA 4BIIA 1SQGA 4OMDA 1HYBA 3CLKA 5CD1A 4KBGA 4RTOA 4I81A 5B37A 4LNHA 3MXOA 2NO6A 2V8OA 3DQZA 1WMEA 1DC4A 3CBQA 2VUHB 4V0ME 4FK8A 4HL6A 4E4YA 4KKXB 4L9RA 1NPYA 2VP4A 3BDIA 3S6JA 4RZ2A 4HLUC 1Q16A 1KXJA 1DKLA 2XOEA 2C2ZA 1ZJWA 5ENZA 2QZ9A 4HDKB 2FEMA 1O57A 5IVHA 4JI3H 3AGQA 3L6OO 3H2JA 3YASA 1RJWA 2FJ0A 5FORA 1EFPA 3EIQA 1TKBA 1FYXA 2D1FA 4EGAA 4N6GA 4WCFB 5E6SA 4LSXA 3K92A 4D26A 4NMWA 5KOIA 2ZBGA 2J0QA 4BATA 5M04A 5DGBA 1FP1D 5DTRA 3R5JA 4TM7A 2GBPA 5JVDB 4X6LA 2VF8A 3HJTA 5KHAA 3PNKA 1Q0HA 2WZCA 3KKQA 2KW5A 3I8XA 3I73A 2QN9A 3SQDA 5I7FA 1QXSA 3TOSA 1O6BA 2A9JA 3ZDAA 2I03A 2EDCA 5CCBA 3Q5EA 3MLAA 4ZVUA 1JFLA 2C7GA 2RBEA 3L79A 2P40A 2NOAA 2ZWIA 1F6DA 1NVUQ 1CSEE 5KSZA 3I4CA 3FYDA 4UDOA 5JMWA 1M2VA 3RJMA 5KO2A 2R751 4CI0B 5E7MA 4YUYA 4FDUA 1GP2A 3LP6A 4JYBA 1Z35A 2AK2A 4FFPA 4ZI7A 1RRGA 5ICMA 3W3AH 5BMOA 4FGSA 4G0ZA 4FFNA 2CVZA 5CT6A 2C03A 3D1JA 4YQEA 5BN5B 2HJRA 5KG1A 1PR2A 3L1UA 4OYRA 3I1JA 4FEGA 4JYPA 2OK8A 3LQKA 5EMHA 5CNIA 3RVJA 1SHJA 1AT1A 4WVFA 3DB2A 1KS9A 3QVMA 1GN9A 1O5IA 1WQ4A 1L7XA 5J2UA 3Q9NA 1O94C 4F9EA 4BNMA 3RG8A 1K83A 1JDJA 3AILA 4G3IA 2BZSA 1EX6A 3RB4A 1KI6B 1DIBA 2IHTA 2Q41A 3SSMA 2UVPA 1G42A 5CX1A 4RANA 3A1NA 4BVKA 1TRHA 4CMJA 3S3TA 3ZV5A 2A0UA 5IF3A 2HLDD 2X9LA 2JVJA 1TJ5A 3EZFA 1GQFA 1IBLH 2VTEA 3GLHB 1CY2A 1KVQA 2AVDA 3SVZA 3IR6A 1Y1QA 4UTZA 2P4UA 3PUXA 2I7DA 5JMTA 4MJXA 3PGA1 3OURA 1DQRA 2R7MA 1CZNA 1FVOA 5EIHA 3PW5A 3ZWKA 1GTVA 4RIGA 1SCJA 1WU7A 3O82A 4B6QA 2HK6A 5SYNA 1S9FA 3LXUX 2NP6A 3DBLB 4OQFA 1RAIA 4RKYA 2CMKA 3MBIA 4YJ3B 1SURA 2AG5A 1GL6A 2JGDB 4JC0A 1R6UA 1TA0A 5DN9A 5BQPA 1WXQA 4DDTA 4B83A 2RJOA 2CGEA 1BIFA 2B7BA 4YMIA 2PX2A 4YRPA 2P3OA 3UCFA 3S27A 1FK8A 2WU0A 3MPUA 4LZPA 1XMQB 3TLXA 1XU7A 1I3OA 2ZJ1A 2H0RA 4M1QA 1IQRA 4Z3KA 1QQ6A 2XDWA 5BYBA 1TGYA 5LBIA 2RKWA 1UBNA 2O9JA 2KM1A 1B8VA 1UK6A 3U7FB 3A9UA 1WW2A 2XYVA 5JRJA 2OEPA 3GPDG 5K4AA 4JJIA 4EKYA 3TS1A 5EP2A 1MOZA 2X4IA 3HOZG 2J7PA 4EM6A 1ZA2A 3U31A 3A1FA 5JE8A 1ZZGA 1IE3A 1I4LD 3WJ7A 4BGIA 5DISB 2AA3A 4Y9DA 1NC3A 3BIJA 1FDWA 1X1AA 1IBKB 1TB4A 4RGQA 4D4LA 3HCCA 4H18A 2X6QA 5ITZB 1LBIA 2C61A 4GMXA 2RKOA 3KKPA 3FSGD 4E5DA 1FLNA 2GPJA 2QUZA 4B8YA 3GJSA 3EZLA 4TSFA 2BP7A 3FCUB 2DQZA 4IDNA 3EFOA 3FWKA 4K9RA 3ZYZA 2R8HA 5KAPA 4ZODA 3SLRA 3RS8A 5BUSA 5C46F 1EM8A 1XMQH 1BCRB 2BGRA 3RODA 3I2HA 3PDIA 3CRNA 5JAMA 3LQYA 4D4GA 4BZQA 3PYLA 5B1HA 1RKBA 4Q4JB 3PDWA 1ZHHA 3L93A 2WJYA 3AEZA 3SKYA 4BMSA 1LGYA 1W4AA 5EJEA 2PKQO 3PNLA 3KUDA 4ZU6X 4OBXA 3ZY5A 1HYQA 2GTPA 1RR6A 3RKRA 2YFKA 4PR0A 2O2XA 5KCZA 3QWHA 1NVKA 3Q0EA 5I5WA 2VDRB 4P81A 3OPQA 3WS7A 1U3UA 4WD3A 1SWVA 1RXIA 3RUFA 5F5NA 2BEUB 2IVFA 1G8YA 1VG9B 3TRDA 3WSWA 1GTRA 3OESA 2IY7A 2F8SA 2DLCX 1WUYA 1C30A 3FWYA 2G06A 2QP9X 1ZMXA 2EFDB 1TTQB 4I4NA 3E3MA 2IZ5A 4EA8A 1ONOA 3HABA 3BTUA 3FZGA 1U7TA 1LDGA 3UUFA 4FE2A 1JG4A 4R3UC 4IF6A 1JEYA 3ZDBA 2WQZA 3AERA 4CMEA 1EHCA 3QEMB 4R9RA 3I9KA 5B3JC 1Z45A 3H42B 4P3XA 3EJWA 3ZPXA 4ZYVA 4GF5A 2VUMA 1PQ4A 1YCFA 1ZD4A 4O7NA 2Q21A 2AFHB 3QI7A 2WM8A 3MJTA 2TMKA 1XTPA 2XRFA 1OH5A 1GRQA 1FX1A 5JHHB 5CMLA 5TS3A 8MHTA 3TGLA 2JLQA 1WEHA 4KSBA 5KHOC 2XVXA 2V4UA 1ZD1A 1ZVMA 1B0AA 2OHHA 1ZEJA 2P1DA 1C9YA 3B9RA 1GTMA 3ZGOA 4DB4A 1R8YA 2WT9A 3DO6A 4UTXA 2EEZA 2FSSA 4O59O 1Z22A 1EYZA 3MGCA 1T1SA 1U7DA 1L1EA 3CE9A 2IUEA 4JELA 4K9DA 4ZAZA 4F2GA 1HRDA 3UXYA 4LZAA 3S55A 5JDIA 5B4VA 1H8HD 3LK6A 2VOJA 2ZM6H 1ZCZA 1F9EA 3KXIA 2EWMA 5DV9A 5C9ZA 3EDQA 4DYDA 3EQ8A 3VOTA 2OQRA 2NZXA 2FSVA 5AJTA 1P0PA 1Q15A 3TE7A 2JAWA 2E4YA 4LN1A 1SB8A 3WGJA 1MGOA 1H1LA 2TRSB 2WKRA 2HT6A 3GQCA 5BXYA 4JI7B 4MS3B 1X0XA 1XJCA 1Y1WA 4DMFA 1NQWA 1WXGA 2YDYA 4PCUA 4YALA 3NWJA 4OIMA 2VTBA 2NU7B 1HUQA 1OJLA 2MSNA 3QXSA 5IVDA 5BSKA 2ACEA 2P27A 4PHGA 5C4XG 1A9PA 1T13A 4OXQA 1G6HA 3HMQA 1NW5A 1WCYA 3GJZA 2CVPA 1Y1WG 4AXXA 4BBJA 2I78A 1ZK2A 2G25A 2PH3A 2GR9A 2PUVA 2ZRKA 4L4YA 2HBZA 4Q5IA 4JYMA 4GXQA 1DQYA 3H7AA 2EC5A 4APMA 2PBLA 1UH5A 4TSKA 3AM5A 4IWNA 2J3MA 1GNQA 4ECYA 4FZ5A 3GG9A 2J4DA 3KQVA 1E98A 2L19A 3KAPA 4KUHA 1G20A 1YQQA 5FOUA 2M9MA 1FPMA 5JCOA 1RQPA 5IM4A 1QDLB 1RP7A 3KALA 4PFSA 1Z16A 4DAOA 3MWMA 3P4UA 2I76A 5JFGA 1F8UA 2R8XA 2OBLA 2HPZA 2Y1KA 1DV2A 2Y0PA 4NENA 1J1UA 1NE2A 1B16A 2PLNA 3MYRA 1U28A 4L5CA 3OHAA 1DMRA 3IPYA 2QYOA 3L7LA 4HYKA 1YCDA 5M29A 3GDGA 2FF5A 1QYXA 4C05A 3P45A 1SFRA 2J87A 4BLVA 2VF5X 3N7TA 4K3UA 3ONWA 4YRCA 1DZ3A 1QIKA 1U8AA 4D6YA 5KC8A 3DV2A 4A4DA 4A2QA 1UJ5A 1X8LA 3CB4A 2GAJA 3HDHA 1EE2A 4BE9A 4BL5A 4NVRA 1NBHA 3UG6A 3PNVA 4NEHB 2WHQA 3MAAC 4WHXA 4S1WA 3PNQA 1OE0A 4YRRA 4DUPA 2J48A 3VYRB 3HXLA 4BQIA 1ZLXA 2F64A 1ZCBA 3FW1A 1HKHA 2I99A 3QVWA 3G9TA 4GPTA 3IQEA 4PYRA 2GASA 3JX9A 4BX9A 5G4KB 2H06A 5DX1A 2PT7A 1AGPA 2CFTA 3B1FA 1G3QA 1EFVB 4ZCQA 3M5WA 2ZIWB 3IAEA 5EXXA 1N92A 2Z1NA 3INTA 5KYYB 3AUUA 3GPCA 3MIIA 1VJCA 4LXGA 2W2XA 1B76A 4D0SA 5LBTA 3ICPA 3L8GA 4BUZA 2FKAA 4MWBA 2X8JB 2PJUA 4EUSA 3GOQA 4C0BA 4ZYWA 3G79A 1IHOA 1U63A 2FYTA 2UUBB 1QRRA 3BKXA 4U7WA 4UBKA 1AURA 2IUSA 1RJGA 2QAIA 4ER7A 4LQLA 4C6RA 1HFWA 2OL4A 2QQ5A 5DN6A 4OB6A 1TQ2A 4RADA 4MVJP 2X5JO 1V5FA 4OG2A 2IPLA 1K3FA 2FLPA 2VXYA 2C7RA 3AG5A 5BRAA 3C3WA 2P41A 3HCNA 1WPGA 4DL6A 2EWVA 3U3RA 3I9V6 3A2NA 1W5BA 1QHGA 3TXXA 2OZEA 3AUJB 4MVJM 3UJPA 1QZ3A 3W9UA 5JRDS 4U4AA 3FETA 3ECAA 4ZREA 2ALJA 3B6JA 1ZITA 4Y9UA 4DSUA 4C9BA 2Y1CA 2PS1A 3C6BA 3WISA 4BJHB 5LA6F 1R3UA 4N7RA 4HEHA 4H7KA 4QBIA 2OQIA 1LTHR 3F8TA 5FQNA 2HCRA 5I9NA 3Q85A 1U5AA 2B4RO 2GKSA 1RJ9B 2ODNA 3ZGVA 4DANA 5EKDA 1JIJA 3GLGB 3EWNA 1ABBA 3GP5A 1US8A 4OFWA 3P2MA 4FZVA 4D81A 2FXIA 4ZCPA 1BE0A 1N2XA 4ER5A 1TU4A 3H5VA 5JW6A 4TV8A 2VJYA 4FINA 3OIUA 4PYIA 5CLHA 4ASUA 4MWCA 3ZWOA 3NQ41 4RD2A 2WU1A 1V37A 5E9JA 2NVUA 1SGWA 3QKIA 1UINA 2PK3A 3F74A 3AYZB 3J80W 1EP9A 1QVZA 4K81B 3AONB 1RJDA 3ANXA 2C1EA 2IYQA 1EM6A 1TJ4A 3ESBA 3QY0A 4IHAA 2RGEA 1PIWA 2AXPA 2DUMA 3OM1A 3ELWA 3WK6A 4IDQA 5LQNA 1A2QA 1XTSA 2XVMA 5FL3A 5TS2A 1FMJA 5FLEX 2R5WA 2F90A 4F04A 8ABPA 5C5DA 3T5LA 5LKRA 2OO3A 4PGGA 1LZKA 1LRKA 1M7BA 3PQDA 3TOZA 3BCRA 5HCIA 1X87A 1EFHA 4QYIB 4KPUB 1G9SA 2FZGA 1K88A 1K8RA 4J7UA 1A50B 5A9SA 4TS3A 2G82A 2C2XA 2AK3A 2XQGA 3T9BA 1OWOA 1UAYA 4LRSB 3B60A 2HIGA 2Y1WA 5L4LA 1FRNA 2A5YB 2R3SA 4E5NA 1QG4A 4TMYA 1TIPA 1E6WA 4CV0A 2B92A 2AMVA 4XVUA 2LW7A 4IIYA 1Z4IA 3OLXA 1QZUA 5JZBA 3V8EA 2OORA 3IVMA 4RPJA 4JBGA 5KNDD 3F47A 4CQNA 4AJJA 5ITVA 1TIKA 1QIMA 3HXKA 1VKNA 2A5FA 2JKVA 3W05A 4OHXA 2A33A 2F3SA 5AW8A 5K01A 2SKDA 3V46A 3VSBA 1ZVQA 2BUCA 4C7MA 4DGSA 1XALA 2PRIA 1U8UA 4BX2A 4I0WB 1KYTA 3IVAA 1XT6A 4Q48A 1X7YA 3E1GA 3PB3A 3EHDA 3W1BA 4RM2A 2I34A 4AN1A 2Q4OA 4JR0A 4YRNA 3I04A 5FAXA 5HKKA 4D46A 1V26A 3ZE1B 5DU2A 2EU8A 5JD4A 4J03A 2WW8A 1DKOA 5FBQB 2Z1MA 2O2CA 5GGXA 4YJ2A 2QAGB 1CULC 3HM9A 3FWHA 3B3JA 4DCMA 1ZIXA 5EXDA 5K0CA 2OHFA 4TVOA 3FOWA 3R6TA 4HPWA 4HEJA 3NXSA 2RHWA 3KXYT 4OM7A 3EEOA 1VFNA 2J6IA 3GT0A 1PR0A 4A93G 3TIVA 4GX1A 3WNVA 3RSFA 2FPKA 2BFWA 3T7TA 3HBNA 1MIOA 2G0NA 1TAEA 3HT5A 2A9QA 4BO5A 4CDMA 2YX1A 1DPFA 2Q07A 1QYWA 4C0QC 3ZWQA 4GOMD 4DCNA 3JQAD 1GJRA 4NCHA 1I0IA 3QWUA 1XCJA 2R4TA 2DFDA 1I2DA 4ZV4A 3E4CA 5KPJA 1AUVA 4P83A 2FFAA 4IHJA 2Z8XA 3O4GA 5DXAA 1XU4A 1SH7A 3PYXA 1GPWB 1XWIA 4ENSA 1DFGA 2ON6A 3MT9A 1C9MA 1QYDA 2GZMA 4W1QA 3TYXA 3MJFA 4RMIA 3PEYA 1E62A 2HF9A 1V7QA 3FSJX 3VMMA 2Y27A 1GN8A 4HNQA 2X1VA 1DT3A 3GZNB 4LCJA 3GTPA 5HG0A 1Q0TA 2HGSA 2J6CA 2ARKA 3A04A 2IMWP 2VP5A 4YAOA 4XM0A 2BMWA 2P65A 4Q3DA 1XZMA 1K92A 3O2SB 2AD1A 1ADBA 4BNXA 5DEOA 2NO0A 1CWUA 1R0XA 3GF4A 1WCWA 1P2BA 4IDDA 4PX5A 3GQBB 3LFTA 1WETA 5AKLA 1XMXA 4NDNE 5DDIP 4BNWA 1MXFA 4ZANA 1P7VA 2K4MA 1SXJE 3G2KA 3LX6A 4QDJA 1XR3A 1PW5A 4FIDA 1XFAA 2BCGY 2XMRA 3IDFA 2HBQA 4WLFA 3DBVO 1O5OA 1WH2A 3CZ4A 1YR3A 4R7ZA 2AFIE 1XZJA 3CEHA 5C8ZA 3C6MA 1K2VN 2XDYA 4G0MA 4PHFA 4TV9A 3C7CB 5M7EA 3T9FA 4HRXA 3OEHA 1YU9A 1N8TA 3C7AA 1Z0AA 2TMDA 5EIFA 1KE1A 4UBOA 3Q7PA 2RHBA 3CBGA 4UFZA 3ROTA 4KMOA 3LCRA 2A1IA 3OOSA 4HQLA 1SUAA 2DJIA 1TPZA 4K46A 4N49A 3OSPA 4QU5A 2YUIA 4JV0A 1DXQA 5HGJA 2JJYA 1DTSA 3IH5A 4ZVNA 4YQZA 3GN1A 3TD2A 3K70D 1O94D 4R0VA 5DG8A 5DLFA 5CFMA 4YR3A 4ALMA 3GUUA 5AM2A 2WE6A 2GJAA 5JAIA 2ZAIA 4ZVMA 3H4BA 2NU9A 3U40A 2ZDGA 1LBEA 1IXZA 3CPJB 3RWBA 3CIFA 3U9TA 1ORVA 3T7EA 2GD0A 1NKSA 2V1XA 3ZDFA 1I5EA 3OZAA 3QZ7A 2CNKA 4U7JA 4MV7A 2HIMA 5HOEA 4CLOA 2NO7A 5BMVF 4P3PA 3IJPA 2D5CA 1FYDA 1OBCA 4J90A 1H4SA 2V4ZA 3NGXA 4M83A 3M83A 2FZVA 2ZRCA 4LRQA 2WJ3A 2VN8A 4I8IA 1GQOA 3IOMA 5K1ZA 2PCJA 4AS2A 4PQYA 1T43A 3PRKE 1L5FA 5LJLA 3B3AA 3B3QA 1WF3A 3KBOA 3K5HA 1TUEA 1FDIA 2C8LA 5CEFA 3A6DA 2ZIZA 2D0OB 4O4HA 4E12A 3AEXA 3HQ4O 2V3WA 3OPYB 5CA0A 2G1UA 3N0RA 2OM6A 4AY6A 4N8EA 3IILA 3SZ3A 9LDBA 3LC2O 1QFSA 1M6NA 2OCXA 5IK2A 4L9SA 3ZCTA 2IBTA 4ML3A 1YOBA 3I04M 2CL5A 4F3KA 4I3GA 3TW0A 1IRXA 2PN1A 4OAOA 1PYOA 3PZBA 2PLRA 1Q0PA 5JNTA 4MVCA 3HDJA 3DBHB 2PRJA 3AUTA 4Q4LA 1ZU4A 1T0IA 1LK5A 2W4MA 4UQPA 3V3KA 4FBMA 5IANA 4YAJA 4ZCTA 3EZ9A 4UM9D 2REQA 5LKAA 5DGXA 5FBVB 2X86A 1OILA 3DFKA 2WTXA 3H3VH 1SULA 5I5XA 3LX5A 4EITA 2PJDA 3HA5A 4BRZA 2O6HA 1C8VB 2HHFA 2Q27A 1P1BA 2A2ZA 4KYTA 1P7YA 3IT0A 1ZM9A 3IE0A 2OOSA 5ADUS 4A2BA 4DB2A 3UMCA 4B7ZA 5FADA 4Q4AB 4M99A 4L1KA 5BYAA 4PYMA 1YRAA 3SJZA 4GQAA 4P7FA 3EF3A 4ACAA 2FMHA 5DHTA 2ZZNA 2WU8A 2V4RA 3OM8A 5HK8A 3EIHA 1FFGA 1T8SA 5LIRA 2ZSFA 1CUXA 4K6OA 1FYEA 3IUNA 4MUGA 3H8SA 5HCNA 1CR2A 1GAJA 4AJIA 4L5BA 4LF9B 1JQ3A 4AYBE 2PFGA 3D3WA 4N0EA 3OZEA 4CTMA 1L4NA 1UBKS 3GRYA 3SJAA 3EIEA 2PMFA 5TB5A 4L16A 3WMFA 4TZTA 3RGXA 2EYQA 3T7DA 1U3WA 1DUVG 3RSGA 3H5OA 1TQ4A 1N7IA 3WYCA 1PSZA 2ATXA 2P2ZA 4NZ9A 2ZQZA 1JI3A 1JIUA 3R3VA 3VX4A 2ZBFA 2BFBA 4P58A 3HZRA 1MU0A 1U0TA 2CLLB 3KSZO 3IKLA 1X7ZB 1YTLA 3ETEA 1AUOA 3VZCA 5ICSA 3PUKA 1G19A 1BNCA 1E1YA 4AQDA 2FR8A 4EPYA 3HRIA 2C2YA 3T99A 1NVWQ 3CRZA 4XJSA 2WABA 2IYTA 3ZZ0A 4N0PA 4BVFA 3BGIA 3E5RA 2FX2A 2XIQA 3EPGA 3A4IA 3FUVA 4C03A 3U6BA 2K2WA 4ZC1A 3I8SA 4KDFA 1NE7A 2WM3A 2VS1A 3N44B 3MIZA 1RIFA 4YJGB 2MCTA 1ISIA 1V35A 3WAGA 3RWOA 2WQ7A 2DUUA 3QLUA 2BTQB 2M6RA 1L9KA 4F8YA 4ZGBA 3TXYA 4RPKA 1G8JA 1NMZA 1ZJJA 1CDEA 3SX0A 3NAMA 4B3HA 3B6KA 1OFUX 3REQA 4IHQA 4FN4A 3IRUA 1GRVA 4L8VA 3UMFA 4PQGA 2YWGA 3UQYS 1LU9A 2HGWA 5HZHA 2O20A 1KUTA 4QHSA 1OB2A 4L07A 1W8IA 3M33A 5GV8A 5JZSA 1NW4A 1T3LA 1UADA 1E4FT 2FWNA 3BFVA 2VHTA 1P6UA 5LCXA 1YBFA 4D6PA 1XRNA 4RB0A 2R62A 1N25A 1A4UA 2BPOA 3PFNA 3JTEA 3RIHA 5IDXA 3WTCA 2ILTA 2R85A 4OM8A 4YQYA 1W73A 4V0RA 3TRJA 3NIBA 2QM8A 4LDZA 1PR6A 2GHIA 4KLAA 1T25A 5TDHA 5GJBA 7GPBA 3PXBA 1RI1A 2ASJA 5CDSA 4XLZA 4XWTA 5K6TA 3OCYA 5EMJA 3FYSA 1G6Q1 3NEAA 5CNMA 3BXZA 5L3QA 2K7FA 3SZLA 1QSGA 2XNHA 3TRIA 2H65A 1H2FA 4TVIA 4FCTA 1HT3A 1Z13A 4F11A 5HUHA 4B6GA 3EGDA 1R12A 4Y6PA 3WA6A 4BV8A 3QE4A 3PX2A 1ESNA 4QC2A 3CHYA 1DQPA 4MS4A 1IMJA 3V4FA 4IRKA 1XP8A 4F6CA 2QRMA 2XMGA 3BERA 4MV6A 1I4WA 4HWGA 1P5ZB 4M4SA 3W9YA 1OXVA 2OD9A 1CHNA 1K6JA 1FKAH 1L5HB 2VPZA 4O86A 4TWRA 1OASA 2B82A 3VH1A 2V5UA 4G1BA 1TZBA 4TWIA 3PL5A 1LSJA 2QSZA 2M2IA 3PXEA 2VUGA 3L8HA 4LUCA 2OZLA 1Z18A 1PFYA 3K4PA 4A3DG 1DKQA 3HDVA 4XQCA 5DHRA 5J58A 4BAUA 4MR7A 1N7GA 3FNFA 1AGYA 5FTMA 3K5IA 2P11A 3I4LA 3TX2A 5K8IA 2Z9DA 4CGZA 4R1OA 4X41A 3S2ZA 3TINA 4RPLA 3C3YA 2G71A 4JUFA 3JXEA 1SCUA 4ZOLB 3W2FA 1DTEA 1ORWA 2J6UA 2W70A 5AKHA 4N01A 4HAIA 2XVYA 3H1GA 4MUFA 2IL1A 4HV4A 3OWOA 4BEWA 2P69A 3N40P 3HB1A 5TGDA 5JJCA 4K03A 1WXEA 3OIVA 3MJ4A 4KQKA 4KX5A 4F4FA 5FL7D 1HT0A 2PZGA 4DR1H 2QTHA 4IEEA 5HQJA 1KEVA 3T5GA 1NWHA 2JF0A 4YRAA 2B0JA 4B3IA 4BASA 3VNQA 1ZD9A 3H1AA 5A4MS 4KOAA 1NY5A 4ID9A 4IDAA 4YRDA 2XAAA 3HYNA 1YUMA 2O19A 2OHXA 2Z8YM 4R6XA 3EPJA 1PFKA 3P97A 3TBKA 3WGVA 4EJ0A 2JB9A 5BVHB 1YCHA 1ACLA 4I1UA 1Z2OX 3WMEA 1LNZA 3RU9A 1AIPA 1NVXQ 1FFWA 2DY1A 4K9PA 4A3SA 2OKGA 2J7KA 4RU1A 4C14A 5L51A 4ICIA 3SHFA 5LM3A 5LDDC 3CW2A 4ZJUA 4XQ9A 4OGWA 4OHVA 1L5KA 1BGXT 2XUQA 3BEDA 5EWGA 1GG8A 1WQ1R 2HBRA 2YWFA 3FUTA 4UUNA 2VP2A 4A6PA 4D9HA 3ZK8A 3GLVA 1GCIA 3B1WA 3G1TA 1WE2A 2G5TA 3LUPA 3CQ9A 1GQRA 3FTCA 2X2EA 1EDZA 3OU6A 2VP3A 4C4RA 4QXQA 1KYWA 1YGYA 1NZDA 4IMPA 5C1BA 4ZVKA 4L08A 2BFEB 2YXNA 3CWQA 2BY4A 3QTLA 5LDGA 1A9ZA 3QA9A 3A58B 4DGQA 3KYBA 1FNBA 2QR5A 3JAMA 3GGSA 5KNBD 1THMA 4JMLA 3V32A 3GLIB 4ENWA 4TZ6A 1P29A 4CL2A 3UCEA 3JU3A 1S96A 1JE1A 5B7NA 1NY6A 2FPMA 3D8RA 5AW2A 3IR5A 1EG7A 1S8NA 2LTAA 2VYFA 3EC1A 1XAGA 1N6LA 3MTQA 4WCVA 5JSYA 4LOHA 4MIKA 3HJFA 1FFYA 2EQ5A 1ZCJA 1H9CA 1KBLA 6REQA 4WK6A 1BWSA 5G4LA 1JNYA 1MRZA 3LT2A 4WVLA 4IHKA 3VYUB 4C7OA 4GE0A 2ST1A 1XRLA 1ZUWA 4R0MA 3ADPA 1MB3A 1GA6A 4IIDA 4ZVRA 5C18A 3RUIA 5TSDA 1KO4A 4YS6A 1B1CA 3BSSA 4C2TA 4G0OA 4QYSA 2F43B 3EQ6A 5KTYA 1V4BA 4IXNA 1BD3A 2EDAA 1LY1A 2QPLA 1JI0A 3UHPA 1RTKA 1ZX1A 2AT1A 1Z3IX 4E4RA 2RH9B 4XR4A 4JI3B 4C6HA 4NZNA 2NNLD 2II6A 3WV5A 2GDZA 3MOIA 2MYPA 4M8LA 4QTUB 1LJ8A 4EBBA 1ISSA 2FPRA 4UZEA 4KQJA 4JI4H 1S03G 4IDHA 1W75A 3L4SO 4CM3A 3E9CA 4RFSA 2LKDA 1GPMA 4AG5A 4ESHA 2A88A 3D6AA 1XDZA 4I5DA 1AXEA 5L9AA 2AZTA 2RB5A 3FJOA 4B2IA 3NWOA 1VPDA 4WBNA 3FUXA 4XOIA 3F78A 2GKGA 2I4OA 2A14A 1DXOA 2ZWAA 2EZ4A 5AH0A 4RLSA 4GP7A 3U61B 3K6SB 2CXNA 3HUUA 2QNBA 4AKHA 4UVIA 5T4BA 3LBYA 2VRCD 4J0EA 3VTFA 5C5EA 3AHGA 2IODA 4B82A 5FLXA 5EP1A 4CLXA 1W4RA 1Q11A 5HBRA 2XMPA 1DRJA 4A0HA 2H1VA 5A2QA 4RF5A 3MZ0A 3FPFA 1EU1A 4X8LA 4AUNA 3BGDA 3UMBA 1Z56C 3HLYA 1SCKA 4WZZA 3A70A 4XDYA 4MHSA 2QF7A 3T9DA 3STYA 3GUHA 3KOXA 3IP9A 5E9QA 4EG1A 2P6PA 3A4TA 2FOXA 3JZIA 2N0SA 4YAKB 3WIBA 5DLGA 3X1DA 1D5WA 3WI7A 1HY3A 1THZA 2HHHB 1IONA 1VYHA 3RAXA 3N39C 5CYPA 2O59A 1ZC3A 2ZVDA 4OB7A 3QWAA 4IFBA 2HWKA 3U2QA 4E4TA 3KX2A 5TX7A 2QUKA 1MP0A 5KDDA 2VWGA 3U19A 4IBOA 3T06B 3ZKWB 2PEYA 4Q12A 2FGJA 1PTJA 4TWBA 4PZ0A 1Y8RB 4GYYA 1OFVA 2XSZA 4KXNA 1IBLB 3M4ZA 2IS1A 1JE0A 1UP4A 2R6CA 3CEBA 3F4BA 4B71A 3BQ2A 1AUPA 3SE7A 4HLCA 4KO2S 3EMVA 3EOBI 4H1TA 1CKOA 1QFMA 1H6DA 5ALTA 1V71A 3E1KA 1R5OA 5B1SA 3K9LA 4JWTA 4I2VA 2BZ0A 2QLLA 2CJWA 4JIMA 1LW6E 4QTXA 1N6HA 5J1SB 1WQ3A 5GJVC 5KVSA 2GBIA 1XO1A 1F17A 1XCGB 1TL7C 4FW8A 2X5XA 3EPIA 1XWWA 1KH2A 1X74A 3WB1A 1NX9A 2HHHH 5CVVA 5CA1A 4NNPA 4CF6A 2W6NA 2YJNA 2HF7A 1C9NA 3QQ5A 5GOZA 2XIJA 5D1OA 3DMPA 1NN5A 1Y37A 2WJWA 2C04A 4RGYA 2XCQA 2A1UB 4ECTA 3JWPA 4N0MA 1XKLA 4NQZA 3H9BA 2I7CA 3T3DA 5A7GA 3V7UA 4E2YA 4DUGA 3PPYA 1V16A 5KHLB 3EXEA 1NBME 3V97A 2ZCVA 4Q3OA 1N2CA 5JCJD 1T5HX 3I9NA 2IIPA 4Q43A 2HG8A 3WHIA 1ZNYA 3PITA 2D2EA 1H8ED 4J75A 1XZGA 2BVNA 1QMGA 1RLIA 2ZJ8A 4POOA 3ABSB 5HV6A 3FSRA 1N2JA 5DHQA 3MWLA 4C04A 4QUIA 5JO0A 1EKVA 3MT7A 1KR2A 3JAWB 2DPMA 1WZIA 4O2BA 2XE6A 1X7HA 4L15A 4CM6A 5FWYB 1TO6A 2FWAA 1IAQA 3MWEA 4AWAA 2PSHA 3A1SA 3JQPA 3ZCRA 1R0SA 1K8YB 3F5QA 1LLCA 4K6GA 1MFPA 4TYWA 1TVKB 1UOQA 3KJGA 1IJFA 2GBFA 1KEEA 5TV2A 3OTQA 3NJRA 2UU9H 2CLOB 2HK8A 3QPVA 2MYTA 4OLFA 4L0CA 4JXZA 3LL4A 2D1RA 1Z38A 1E6MA 5CB4F 1Y6JA 2FFRA 5FOQA 1MO5A 3UJ6A 4DZZA 1H4VB 1H2WA 5BN1A 1DVRA 1JAHA 4R1SA 1VAJA 2OGZA 5IJ9A 3M4JA 3O3CA 3DOJA 1W93A 3DTNA 5CG2A 2D5AA 2KQUA 4HNHA 2ZRLA 3GIPA 4GU5A 3ASUA 3AKYA 5DGAA 1LEHA 5I8WA 1QWOA 3UT6A 4UMVA 1L5SA 1QHXA 5JSFA 4IVQA 5F9LA 1EDDA 3IHKA 1UWCA 5HDQA 2FG5A 3PUWA 4ADSG 2AR9A 3JYHA 4C29A 4V2UA 3V4ZA 4HUJA 1YR2A 4BUCA 1TD9A 2WJHA 3UN1A 1OGYA 3Q8LA 4LK2A 3SLKA 5KFAA 2PUWA 1AKYA 2NQ8A 4QNNA 3QXGA 1QRTA 2NZ2A 4GUAA 4ZTZB 1JNXX 3LHSA 2BIFA 3CJRA 3AMVA 4MW2A 1GSHA 3TY8A 1XTUA 1DX9A 5IJ0A 3IJEB 2UV8A 4EFMA 3AXTA 1QHIA 3FPCA 4WIAA 5AOAA 1G66A 1Z36A 1F51E 1LDNA 4OFZA 5IH7A 4KFCA 3T9EA 5F7OA 4U00A 1ULTA 4F97A 3IVRA 5FBZA 1IM8A 2PFSA 5FTLA 3CXRA 4UNNA 1W0JA 5DGCA 2XHEA 3RU7A 1KJQA 2JFGA 2L18A 4JI0H 3SE0A 4C2UA 4U7HA 2IP1A 4MB6A 1XZPA 1KKUA 3V6LA 4B3SH 4EMBA 1TAUA 5C53B 1NM5C 3I05A 4NLLA 1N6IA 4ND7A 3IO3A 2R60A 4K05A 2OWDA 4RSRA 5KFDA 4DV0H 3OFJA 2WWFA 4AP9A 3QUBA 4NBWA 4LTMA 4EB0A 4DG9A 4L3VA 3B7WA 3TMYA 4TKUA 5KNBH 1GYFA 3U44A 1UZAA 3GA5A 1W2GA 3COVA 5KFOA 4UDXX 4F0JA 3C1OA 1FUYB 4C3OB 3GAAA 1KSJA 1LWNA 1KC1A 4R9SA 3K4HA 4FGRA 4XW2A 1WOYA 1QGYA 5B1DA 1XVTA 5LQKA 1Y7LA 1PYGA 4BGVA 4O2AB 1KFEB 4KGDA 4M9RA 3EXIB 4GDMA 5L1LA 2JI7A 2ZM6B 4F2DA 1PJ2A 1Q2XA 1ODLA 3IESA 3B1YA 2GCPA 3Q8PB 5ER9A 5BN3A 3LO5A 4OUDA 4PPGA 4IUBS 2BEWB 5IAAA 2GEVA 3MTGA 2ANCA 1H0KA 3AI1A 4UHJA 4MVJA 2RHGB 4C0LA 4FSHA 3QVLA 2YCHA 3H9EO 4P2GA 3VGJA 2VT7A 3HSSA 1KQGA 1D03A 5AM0A 1YQEA 1L6RA 4P35A 2I2BA 4RYDA 4BTVA 1Q1EA 3S1LA 5KYUB 4HZUA 3W5SA 4B8ZA 1M1XB 4B3BA 1HG1A 1QPBA 2C7BA 1I7SB 4MVJG 1AKMA 2AL7A 1XROA 4KIGA 5CLQA 4OLHA 2VUMG 1U0GA 1OXXK 2JGEA 1VSVA 3X2EA 4F45A 4EATA 4OAPA 2DR0A 4PG8A 5JH7F 3KTAB 1Y1PA 2X8WA 2QSJA 5I48A 5L3SB 5E6UB 4J4BA 2IPNA 3DOOA 3ZY2A 2IGBA 2YIVX 3BH7A 3IUMA 1R8QA 2JFXA 1C4KA 2AOXA 2ZR8A 4V03A 3KOWA 5AKKA 1X8JA 3ZH2A 2HVRA 4LJ8A 4TKVA 1WWKA 1BO6A 4F06A 3DG9A 3AUFA 2Y1OA 4JJEA 3WKEA 4QQ8A 5M3BA 1SCQA 4LFCH 2GPAA 2ATIA 3M34A 3Q8MA 1GO3E 4DLWA 3O9MA 1DAFA 4IKOA 4HH4A 2ZR0A 3MFYA 2G70A 3SC6A 4R81A 3RVNA 3KM0A 3HNOA 3EXHA 3K2QA 3DTVB 1TEHA 3OUZA 3ERCA 5JLAA 4EDFA 4GH5A 3JVEA 3DYVA 3AY0A 4E88A 3NHKA 2EKPA 4GWLA 1QHSA 3OP1A 4IAOA 1H5UA 4R7TA 3GJ7A 1SKBA 2PR7A 5CFOA 2WSSA 5I7OA 1B42A 4REQA 4YY3B 2OAP1 2FLNA 1DC3A 5IYCG 5G2OA 2ZG6A 1BROA 3NBYC 5BXQC 2VR1A 3TOXA 1LZLA 2R7AA 3KTOA 4PZ9A 4FXOA 2QOEA 1EIZA 1E1KA 3CVOA 4Z3OA 4LTDA 2V6JA 3H2BA 4LJ5A 4MUKA 1THTA 2YNMA 4GWGA 1MW9X 2XGSA 1RT9A 2VJLA 4ZAFA 1JLMA 4EVQA 1E2EA 2MU1A 4K87A 3OG9A 3V7WA 4X93A 4Z2YA 3C3BA 2GZ1A 1H4TA 4JBWA 4TXLA 5JCZA 2H31A 1OWLA 1YC5A 2EKZA 4BBZA 1O75A 4YRFA 3PL1A 4QUEA 2G77B 2ZCJA 1QFXA 1L4YA 2ZRJA 3NWEA 3L0DA 1A9OA 4PNPA 3IEVA 4HDMB 3FZYA 3WLAA 2HRZA 4V0MA 3V2GA 1A72A 1G38A 3L5KA 1O4VA 4TUYB 4UCXA 4C78A 4YBZB 3FB4A 4LOLA 1YI8A 4NF2A 3E27A 5CFPA 1IYDA 3KOMA 2UUAB 4AF7A 1SBTA 4O3MA 3UO8B 8AT1A 3LPMA 1MB4A 2K7ZA 3DAAA 2HLPA 2XMBA 4UPEA 3T1VA 4R98A 5JSZB 3F8NA 3CSWA 1U98A 4LZOA 4FFSA 4YY3H 2JRLA 3X1MA 5IJAA 3GD7A 1EX1A 3E3OA 1NJSA 3RYIA 5MFZA 1HE3A 4ND3A 2PWZA 1LW7A 2QIPA 2SICE 4UU0A 2BZGA 1I3NA 4A5OA 2ZI7A 3U7RA 2FMTA 5L1JA 2OCIA 1IYZA 2YQ4A 3IBFA 3VKGA 4Y2XA 2BLLA 5L45A 1IOLA 4A8HA 1VMDA 3U4QA 1J0DA 1GUDA 5I7AA 3IOEA 3CISA 1JFFA 1RWKA 2PWYA 2M1XA 4RA9A 4MGHA 4N4AA 1Z2EA 1HTWA 5I9TA 3AEUA 3AFHA 4MICA 1MR3F 3SDZA 2WTBA 5BORA 3QX3A 1OX4B 3Q7RA 4HATA 4U5QA 4AZTA 1NP7A 3NFYA 1VE5A 4LYDA 3AR9A 2VAXA 5EVJA 5LR6A 2P5UA 1BU8A 1SHKA 2Y6VA 3KLMX 4ED2A 4BQEA 1XNJA 2FOLA 3B36A 3E2PA 4AO6A 4BAGA 1D6MA 5LZ2A 1ZNQO 1KVSA 1R0ZA 3DONA 2FFBA 1N5LA 2UUAH 3KZ1E 5AHWA 2P2SA 3ZTWA 2WHYA 2ZRPA 3O92A 5JTTA 5EJ8A 1DNPA 4HYQA 4U2KA 1YB2A 4OX9Y 2Z04A 4JBXA 3C41J 2E1PA 4RIEA 4OL0A 1QOZA 2P3QA 3TNLA 1YFJA 2R1ZA 3RGWS 4F4YA 5BQFA 4RD3A 5HZKA 1M72A 3GFPA 1QIEA 4E3ZA 2GFHA 3VU8A 4CL3A 1DMSA 3AU8A 1KDZA 3LY5A 1E60A 1Y7TA 4RXUA 1YULA 3ZW9A 1Z82A 2Q1SA 4KQ1A 4WESB 1WXHA 1Z4KA 3D6JA 1DC6A 5IP5A 3NBKA 4PZAA 5L1IA 3WJ2A 1QCCA 1J5EB 2Q5HA 1UJCA 1JDEA 3RSLA 4PIMA 1BW9A 1R2QA 1LSUA 3ZW8A 1CY7A 1LDYA 3TEMA 2XUKA 2Q8QA 1DAEA 4OMUA 1UBTS 1OX5A 1CUFA 3VTAA 3GVCA 3QNMA 3GOHA 5LQRA 2H0AA 3VPHA 4DW8A 4U7FA 2WNIA 3P9SA 1AM4D 1XJWA 4MXDA 2WD7B 5F3DA 2H7XA 3M70A 4I4LA 4N12A 4BVEA 5TC4A 1AA6A 1IHUA 1RFLA 1VG8A 3JQ7B 2JIRA 3G8BA 2FLLA 1FFEA 3F8WA 2QAJA 1KAEA 3QTTA 1T2CA 3LQSA 3G2JA 3FDZB 2JW5A 1QO7A 3PQ7A 5BPHA 2O2HA 1AS2A 3RREA 3WLPA 4WE3A 4NL4H 1PYDA 3U3OA 2FZEA 3JPWA 2CFRA 4F4IA 5KIAA 3OT1B 4ZXPA 3EBOA 2QB5A 1TT7A 3TF5A 1PJZA 5E4YA 4G9GA 2GTIA 1UZNA 2ZEJA 1G21A 4G36A 1KT8A 3RK0A 1MXHA 4QXMA 1TVMA 2W6ID 4UU1A 1AG9A 1J5EH 1ISRA 2XTZA 2IHJA 1KSHA 3L9WA 1D6JA 4RPIA 4G1VA 2HV8A 3L7JA 5EY5B 3PEEA 3ML1A 4RHXA 5KEIA 1IUKA 1DJMA 1UFRA 2ECPA 2J0EA 521PA 3CTMA 4TLAA 1D0VA 4CIVA 4O3OA 4Z5XA 4EHFA 1M67A 3RABA 3C8MA 2RGBA 4II3A 1T9CA 5JWHA 5C1IA 4JEUA 1AQNA 1LBHA 1PDWA 3Q7SA 3UYKA 4CMBA 2WJVA 1JSLA 4HS9A 4QIWE 3JW8A 3B8EA 4KMMA 4RH3A 2C4HA 4NPAA 2EG5A 1JR3E 4CHIA 4ARCA 4LPKA 3R0JA 2Q9AA 3RBEA 2V58A 5CB6A 4QA9A 4LMBA 2ODAA 3CX7A 3ENVA 4R54A 3A26A 3OLVA 4GX5A 5NLLA 3NNDA 1LLDA 1UQUA 2QMQA 4OP1A 1JIQA 2WVAA 4FXPA 2V9CA 3G0BA 3NEJA 3KPYA 4OB8A 3ZHQA 4F84A 2J45A 1QHHA 3EGWA 1ENPA 1W2WB 4NZMA 1ACJA 3SF8A 4BPRA 3GMIA 5TGTA 1VHDA 3NVDA 1YU6A 2IW1A 2BI7A 4Q15A 1N9GA 2HPHA 4GFDA 2UXBB 3ZZTA 3E82A 4B3CA 1RI2A 4YLGA 1NONA 4BWYA 4IXWA 2R97A 4YCSA 3GNSA 4P7KA 2OV1A 1OLXB 1NVBA 3KSUA 1I4TD 3ZK7A 4J29A 3GZJA 4NMMA 1QVVA 2DH5A 4I9FA 4AU1A 4CT0A 4ETSA 1N1EA 1B8UA 1VKJA 3GLUA 3R5XA 4NYIR 5C1DA 1IB0A 1TU0A 2R1VA 4JBYA 3NHWA 4GP9A 2WNHA 5KFWA 3ILHA 5JVLA 3CLTD 1SBCA 2GA8A 2V6FA 3QU9A 4U3JA 2YBDA 2GZDA 3H0EA 1OXUA 3FTFA 3ESDA 1EPUA 1E1CA 1E9AA 3KQNA 3LUJA 4ECVA 4UU8A 5B58T 3NS7A 1YJ5A 3PA8A 1KYQA 2RBGA 4QDOA 3EGIA 1FUKA 1FJ2A 2Y0SA 2B25A 4JSTA 1B8NA 1Z4QA 1Y80A 3GGOA 3TXAA 1TWCA 4WERA 2XTJA 1XQ1A 3E9RA 1D0IA 5FQOA 2Y4RA 3KPVA 3CRW1 1OR8A 2X4LA 2P5YA 4BX0A 3LM8A 1IWOA 4UUAA 4EPTA 2UXBH 2WIGA 3G5MA 1G6KA 2O2JA 3SYTA 5ULLA 2W11A 4M9QA 2O3SA 1I2ZA 2ZRBA 4BMPB 4W6QA 2R0QC 5F33A 1RXWA 2P35A 5CM8B 5JFOA 4RTMA 1MT3A 3DMGA 1P1JA 3LF1A 2HSJA 2B83A 4OQZA 3E61A 4KQEA 3NM4A 5GQSA 3SYLA 4NX2A 4MV5A 4IP0A 2VNJA 2WM2A 2OK7A 5LXTB 2EFJA 3DDZX 2D59A 4LOJA 2PZKA 1JSCA 3MS2A 3OZBA 1X9IA 1TT5A 3UGKA 2PKQP 1HT2E 3PFGA 3M4NA 1YB1A 2FE1A 4TT8A 3FPEA 4XJTA 2A1TR 1AV6A 6NULA 3VR4D 3R20A 2TMGA 3R8XA 3A1DA 1Y4ZA 1J0XO 1QC5B 2C5GA 1XQWA 5E3IA 4B6PA 3MCZA 1YKSA 1S5PA 2HWWA 2YV2A 3L43A 5FA8A 2GA9A 2LCQA 4YJDA 3Q72A 5EESA 4S1PA 4Q1DA 3E1SA 4H0FA 4AO8A 1QM5A 2J6SA 2P0EA 2C8KA 1MC4A 2D06A 2IF0A 4X7RA 4O7TA 2PPVA 2VQSA 3DV0B 5FPQA 3C5EA 2UZ1B 2LDXA 1IB6A 3RC2A 4H1WA 3H87A 2C2GA 3SFVA 1DAIA 1LC0A 2CLKB 1MAUA 4B7UA 4B4KA 2QA5A 3RT1A 2J3QA 3O4FA 4E5PA 4CG3A 1JXMA 2IIVA 1WCXA 5I7UA 3VR3D 3GPIA 5C7YA 2UVRA 3H4TA 4AQYB 4AX4A 4Y2HA 2ZULA 3I6YA 6Q21A 4U7PB 1SBZA 3GGDA 4D8VA 3DHYA 3U9SA 4EUKA 4MP6A 2PQMA 3UXMA 3IMCA 1RHUA 3WK7A 2WYWA 1T15A 3IAXA 3IMFA 4FQ7A 4AUMA 4OHWA 5CB0A 3VRHA 1RKUA 3FVVA 1FA9A 2VSFA 3ABQB 1K68A 2PIDA 2E4ZA 3W5UA 5DM70 1K98A 4AS1A 3I45A 4MLCA 3E7XA 3K9FC 3B1VA 4OJNA 4IAJA 2BDEA 4G0VA 5KINB 5LQDA 3A8TA 1U1DA 3O8OB 1YK0A 5AW0A 2LNDA 1JMVA 2CXPA 3ILXA 1VIAA 1YBHA 4MKXA 2R82A 1KZ9A 2ZYAA 4KQWA 1V1MB 1MZVA 4DLKA 3TM5A 2J4FA 2WSYB 4J9QA 1JDVA 4H7JA 3OZWA 4JGBA 3LXRA 2RK6A 3NGDA 1RYZA 4AQYH 1VLHA 4MW1A 3AL3A 4CKXA 4LXTA 4O4JF 4MW6A 2FWRA 2H54A 3K32A 5K3FB 2NIPA 3B70A 3GJ6A 3H1PA 4Q3EA 3N3BC 1GKIA 1OFTA 3ZIUA 1JBEA 4GZ5A 4G5YA 2F00A 3P9RA 3ADOA 3QI2A 5C80A 3G0HA 4U8HA 1GKLA 4R6WA 1XHFA 3I2IA 1U80A 1RWOA 1IEWA 4NBNA 5GZ1A 3CF6R 2ZIXB 2XUGA 4WBXC 1B3RA 1WCIA 2B6HA 3PW4A 2JPDA 4TRRA 4CEIB 4B34A 5CVEA 3DLAA 4N8DA 3VHXA 1Y3FE 4QNRA 3WDSA 2FUKA 2ZRHA 3K09C 2V0GA 2R93A 2WWXA 3SEAA 3NZEA 4BLOA 4JDUA 1TM3E 5ALNA 4RIIA 1CIVA 3GP3A 4R9NA 3U80A 3FVTA 1FFCA 4ZVLA 4R8SA 1D2EA 2Q28A 1RYMA 1MO4A 2D13A 3U7EB 2C5LA 5JV5A 3BAAA 3TQCA 2AGPA 5T4HA 4R2XA 1UM9A 3JD2A 4KVFA 4RL4A 2AEFA 4EAQA 2R93G 4L7QA 2HB6A 1ANKA 4Q4HB 2O0HA 3RTDA 3PDCA 4NCNA 4JGIA 2B1IA 5EINA 3ZI4A 1ZWKA 1RNLA 3AOEA 5LP1A 4CUKA 2IXGA 3UT5A 4QUHA 3LWZA 2Z8YA 4B74A 1BJRE 4BP3A 4Z53A 5C8XA 4FYXA 2YU9A 2PMBA 3F8SA 2VA8A 4ALLA 3ESQA 2W2VA 4D0LB 5KNDH 4J0JA 2F7SA 2HRBA 3KFVA 3PW2A 3HA7A 3VR5D 3S5JA 3EQZA 4RAYA 4ZJZA 1JAXA 2I3ZA 2OYCA 1GCGA 4CHGA 2CMDA 2GBCA 3NOVA 2RH5A 1J2EA 5BWVA 2FDRA 3JQAB 4XSGA 3D8SA 4MR9B 2CUNA 1HM5A 3AV3A 3RADC 5T41A 1RYYA 3I4NG 5IJWA 1ZRHA 2AG1A 5FPHA 4URHA 3WL6A 1U94A 1U02A 3SXUB 4UVEA 3ICCA 4JVNA 2GERA 4X9XA 3UYYA 3OTOB 3GT7A 1AK1A 1R6VA 3O0TA 2FKNA 3ZWVA 3FLEA 2ROQA 3ECCA 2NTYC 1XHLA 4L9WA 1QIDA 1XP5A 4M36A 5L3VA 2HQRA 2EZUA 4HNAB 1DBSA 4CTKA 3DWGA 1ZI9A 1YI1A 1ULZA 2WA2A 3LHKA 5B7GA 1JIVA 2CL6X 3H2ZA 4RY2A 2VEOA 2L2QA 2ZB7A 2DHQA 4L4UA 2I29A 4YV0A 4WZBA 3JATA 3C1AA 4J9PA 2GFQA 3H8VA 3LWBA 4PWQA 5AVZA 5IHPA 1JYSA 5CEJA 1P5FA 1S2DA 4HTFB 2Q2WA 3BCHA 3D4BA 2FDXA 1RWNA 3OQIA 2H63A 1LLFA 3VPGA 1NR5A 4P93A 2D0IA 2B2CA 5B6IA 4J16C 3BSWA 1JHDA 1QS0B 4A3CG 5CFQA 5KU7A 1QYCA 3PGVA 4HJRA 1LRLA 4Q16A 1GNVA 1CEXA 3GRRA 2IZOA 1M74A 2QTBA 3L4JA 3QFHA 1FLAA 4WXHA 4FX2A 2ZB8A 1E1MA 3NHJA 2Q2QA 1EFLA 4NE9A 3OTOH 2MSLA 3A6HA 3G8CA 3HYCA 1OKKD 2J3JA 2WMNB 4I7EA 1XA0A 4HQKA 3WKAA 4BJ3A 3IFSA 3L2PA 4YCCA 2QV7A 1PFVA 3QH4A 3DBOB 5EFOA 1IXSB 2XTNA 1P3Y1 2HC9A 2BMVA 1KNQA 5AKXA 3PTZA 2WF9A 4P4NA 3TEJA 2IH5A 4F56A 4H27A 2CQYA 1DJOA 2NU8A 2YKGA 3IQGX 2DHCA 3E9QA 3JR3A 4OQXA 1JQ5A 4DR1B 2W42A 1VLQA 2ZS9A 2BEVB 5BW5A 4Q0MA 3AR4A 2XYPA 2JFOA 2C59A 4PLVA 4MI3A 5ALYA 4ZYZA 5BWNA 3TBFA 1CV2A 3S7ZA 5KFJA 4MA4A 1G0OA 1SOVA 1ZXBA 1VCIA 4OL9A 1PJ3A 3VR4H 5CM9C 3B6ZA 1GV0A 1NJ1A 2C3OA 3FI9A 2QMHA 3RAGA 2WT8A 4Q03A 4C3ZA 4BNYA 1IHPA 2XB6A 4ETIA 3QP9A 1DGQA 5F1KA 4X20A 421PA 4RTKA 2C2EA 4CMHA 1LTQA 1YDFA 1U0HC 2J9FA 3ZVKA 2VK2A 1DO2A 2VSNA 1KOJA 3O3MB 3E2MA 1VKRA 4QU9A 3F67A 2GEUA 2JD2A 5A4AA 4MAFA 4B3GA 3NIFB 3Q1KA 3OZGA 1Z0KA 1QAQA 3C5WP 5TF0A 5C8DA 1A5AB 3OCJA 4UFOA 3ZD7A 3KEFA 1L2ZA 1D8AA 4IQ8A 3HKZE 2H07A 3ZXYA 5AJHA 3LKVA 1NJ2A 3ZHSA 4EEYA 1VL6A 4RESA 5BNWA 1OXMA 2GSWA 3LD9A 2A1HA 2HJWA 2PJRA 4BU1A 1M2KA 4OA5A 1E2JA 2PAFA 2YZ2A 4O5OA 4QTYA 1BQ4A 3NTOA 2RHCA 2Z98A 3F97A 1XFDA 4O33A 4BO2A 1J8YF 5AOCA 4DARA 4B2LA 3TW4A 1Z12A 4LTNA 5LWQA 4TXHA 1JJIA 2B98A 3R0QA 4ZT6A 2AFIA 2PVSA 3JVIA 3T94A 2JGRA 1U1IA 4AS3A 4BECA 2LUOA 3BMCA 3U1BA 4DLSA 2PSJA 3C85A 4LJLA 1SCDA 4M9CA 4J9SA 3MT8A 5C7LO 3SZOA 4YGYA 3FUWA 2HDOA 1NG9A 1P2GA 2QU7A 1VDMA 1SPXA 5WRFA 1J99A 2XKAA 3WRWA 2R6GA 2KPOA 3PO2G 1PEAA 3ODGA 3RC7A 1UAGA 2AXQA 1N6NA 3WQBA 4BJ5A 1QKKA 1GAQA 4EG8A 2D8MA 1WM1A 4JI4B 5DWDA 3TTUA 1YS7A 3PQ3A 3VAAA 3ZCPA 3P2KA 1A2OA 3F46A 3KZCA 4Z0PA 3OHSX 2HFJA 2VJMA 2K2QB 3LSYA 4PG7A 4OI2A 3FD8A 3UJAA 3TY5A 3DDUA 5AXDA 2EBWA 4WOCA 1UBCA 3GV5B 4WEQA 5LNK6 4E32A 3PZRA 1U04A 2PVCA 4YRQA 2CNVA 3CM0A 4NSNA 5DNDA 2GWHA 3JQ9A 2V8BA 3C45A 3KJXA 3L0OA 4BX8A 2FVXA 3OFNA 1NPTO 2GAFA 2YOFA 1AE1A 3JD0A 3V4PB 1KEPA 5I4KA 1HF3A 3BJEA 4QLBA 3CIOA 2VDKB 3AEKA 1H22A 3E3NA 3QEJA 2FAXA 1R74A 5ALPA 5AOVA 3F3YA 1HNZB 4AKTA 5L9XA 4HSEA 4QHYA 1XWFA 1Y34E 1IDOA 2O8EB 2J0UB 4H7EA 1CJUC 3D6VA 2Y71A 1U3CA 2PKWA 3NPAA 4ZDJA 2XI4A 1ZD8A 2HVSA 3RTBA 3NR2A 2WOOA 2GPYA 3HXQA 4FMCF 4TLBA 2YVUA 5CVTA 1VIMA 5IC6A 3ZJ5A 4EKGA 4OK5A 2XRYA 5BQ3A 2FI1A 4LSWA 4D0NA 1AO0A 2OCKA 1Z17A 2YMPA 4Q7MB 4LYFA 3MJRA 4ZALA 2R7KA 1H2EA 5AW4A 2FPGA 2YOHA 2X2PA 1Z88A 1I10A 3LCJA 2EHJA 3LUKA 2QMOA 4HPJB 3BQ1A 1KORA 2FSUA 2QN3A 4LF8H 1UKYA 4H77A 4LS3A 1PP4A 3K6RA 4HXGA 3UANA 3BWMA 2E49A 4DLBA 3V6MA 4RHTA 1EFUA 4ZAWA 2N75A 4Q4CA 4G0QA 2Z8ZA 3KYDB 3R9KA 1L7NA 3GMDA 1HK7A 1FBNA 1JPVA 2HWYA 4YREA 3ZI0A 1E2QA 3ZDQA 1M1NB 4XLTA 4YC7A 3NHRA 3N8KA 3DH0A 1XB2A 1SYXB 3EGCA 1ZGGA 1T5BA 4JI5H 5KG0A 3D2LA 1HNZH 1RI4A 1GLVA 4PBCA 3GL9A 4RB2C 2XE7A 3PCTA 5CD9A 2C5SA 3LA8A 3EYAA 2ZZMA 5IN4A 3HP1A 3IEIA 4GW3A 1BX3A 4CFSA 4XWKA 3V9AA 1NGSA 3ICVA 1AQUA 5DQIA 3EWAA 1XU9A 4KB5A 3X3HA 1TKAA 3Q0TA 4REMA 4ZI5A 4U2GA 5E25A 1Q44A 3AYHB 3D9QX 4QELA 4A3MG 3VPCA 3R7AA 2YVAA 4UHKA 4NE7A 1VCMA 2ASLA 1SKYE 2E87A 4PG4A 1SK9A 1IG3A 1Z6AA 4GMFA 3TL3A 2XQVA 3ZLUA 2X42A 5KPDA 1CJSA 2WJ6A 4ZFNA 2HXGA 5C35A 3U81A 2JEZA 4KK3A 3VNVA 2ENWA 3WIVA 3OPXA 1UT8A 4N6NA 2H2IA 2ZIFA 3SR3A 1XRRA 3TLYA 3C3PA 2J0SA 2XC9A 3QSYA 3JARA 1YGPA 4FGJA 1WW3A 4GECA 3NBAA 4TLEA 4ARUA 1UR5A 4JYAH 4IX9A 5LWHA 2JVIA 3WA7A 4N7JA 5IASA 1GTSA 3DFFA 4R1MA 2ONJA 2IU4A 4H31A 1JECA 3JQFA 5EZ6B 1VGQA 4LWQA 3ICQB 2MMCA 3H2GA 2COGA 4R5MA 3I2JA 3IAS6 2G8LA 2G28A 4IG9A 4D3ZA 3RSZA 3Q5DA 3PJRA 2GLXA 3KQQA 1FS4A 1Y1LA 1E7RA 1LDMA 2IK8A 4FGZA 2JFWA 4DWJA 2X58A 1Z3CA 2XD4A 4LYHA 3RRYA 5FNZA 2XEXA 2JH9A 1NXPA 2PT5A 1GVNB 4IQGA 3NDIA 3G2PA 2UU9B 5KFNA 2QTNA 2GEDA 2IWRA 3NAQA 4K88A 2RGYA 4YP1A 2HUPA 5KX5B 1G2PA 3UB2A 4EQ6A 3TEKA 4PQEA 4R8VA 4BRSA 1SBNE 2C9ZA 3EC7A 2HSGA 3AB3A 2X19A 3SJUA 3ZHOA 5BWOA 5F2OA 4D6XA 5EUMA 3HPQA 2GESA 4X1IB 4GNKA 4H1VA 5ALLA 1C0EA 3LA6A 4L8GA 3BX1A 4CT5A 3ASYA 3X44A 3N2ZB 4M6WB 1E4EA 2BRUC 4CODB 3B8HA 5ETJA 4I6EA 4H4CA 3ITNA 2A78A 1PUJA 4ZI3A 1IN7A 4WXPA 4X6UA 4R1UA 3EZ7A 3PPXA 3FR8A 3KFLA 3QK7A 4INOA 4Y6OA 3HSKA 2B2XA 2IU0A 3UGJA 3BJZA 1YB4A 5JWRA 5LP6A 1S8AA 4R7GA 3VTKA 5AKJA 4LGMA 3BD7A 3ETLA 1CY8A 4F3RA 3IEUA 3FMPB 2O1XA 1TD1A 4J2TA 1QQ7A 5IW8A 4Q18A 2PTHA 4IIJF 1NQVA 2HTEA 2GN2A 4M7OA 4LSGA 3PCRB 4O1HA 4ZYUA 1M54A 5CJJA 3HWSA 5K3BA 2Q9UA 3CYFA 4JI0B 4EVRA 1PUIA 1ZA1A 4I5EA 1AZWA 3A6PC 3HR7A 1PK8A 4B3SB 3IBCA 3CVVA 4RVFA 1DKUA 4W8OA 3AESA 1VL8A 1PV2A 4TKZA 3SQLA 1YIDA 4DV0B 4KMSA 3RVRA 1C14A 4KR9A 1Y3BE 4ZEXA 1SUIA 3V8BA 1R18A 1WB4A 2M1ZA 4OHMA 1X2EA 1V7ZA 6YASA 2A58A 1WUJS 1M2GA 5H4HA 5H68A 3GBVA 1YL5A 3SEFA 1KDVA 3SR0A 1GNRA 2JJ1D 1VI2A 2VTKA 3KVOA 1LF0A 3FLAA 1QB7A 4MGKR 1P39A 3A9RA 1V7PC 2CBZA 3VJKA 3KYCB 1I1QB 4Q4DA 4G6ZA 1PVDA 3NHAA 4WK2B 1Y8ZA 1YMVA 5IYZA 5AM5A 1IYEA 1LVUA 3SHTA 2SNIE 3BA1A 4QU0A 3W6NA 3OH8A 3CRRA 2DP4E 2PLFA 3O7WA 3NNNA 5FPTA 3A1CA 4B73A 2O3JA 3HBMA 1AKEA 4HNUA 2ZDQA 1D8TA 4FUQA 3OKFA 1JAYA 1NKTA 3V8QA 1TM7E 5A3QA 2WJIA 4KWIA 1NPDA 2Y9MB 5CT9A 4HVTA 1B1AA 2VZEA 1TOAA 2AYZA 1X9HA 4KPGA 5DFAA 2ZGIA 3QVTA 1MO6A 3NDJA 3RBXA 2YWRA 3N0VA 2BM0A 3GRKA 3GLHE 1VBGA 5FFMA 4JKOA 3HVIA 4WI1A 2O03A 3UM9A 1RKVA 1K3UB 4XCQA 2HT1A 4LI0A 2GO1A 5K3CA 2R1TA 1Z8NA 3SJBA 4K3VA 3COJA 4LMPA 1N0HA 4MWZA 4ONEA 1SZDA 4JOSA 3U0GA 3SIPA 1XVIA 1FBTA 4HX2A 2ODQA 5CVUA 1YZGA 3G2QA 5DH9A 1E7SA 3LO8A 2GBLA 3PIDA 1GEGA 5ES4B 3PJEA 4UZSA 1ESDA 1MAVA 5JAZA 1RVDA 4KO3S 3CE6A 1RHRA 3NRBA 3GNTA 4Z0NA 3GLQA 1UL1X 1D1PA 3BQ0A 3KUKA 3VO8A 4PV7A 2WFLA 2WV9A 1D4ZA 5KKNB 1BEUB 2HO5A 4LRTB 5JI3E 5SZKB 4LFCB 2HM7A 4RMJA 3E35A 4NH4A 1V8PA 4GPAA 3MW8A 3OWXA 4G0UA 3J7AK 2XVAA 4I46A 4G2TA 3GK3A 2C4TA 4Z1MA 5G0TA 1L6IA 4ZPXA 4ZJPA 3SYNA 3IKMB 1TGVA 4X62H 2XZOA 3NC0B 4S12A 3TH5A 4M87A 5HIJA 3I12A 1NJ5A 3L0ZA 4I4CA 2C92A 1C7JA 2NV2B 1XTQA 4ZMSA 1FPQA 1YH3A 3ZBQA 5LU8A 4QFMA 1IMOA 1RPTA 4N3GA 4EBCA 5C1PA 4MWOA 4Z4GA 5D51S 2B1RA 5IT0A 1AQLA 3K0AA 2XNKA 2ZYTX 5AMXA 1VJ5A 4WA8A 2GQSA 1T9ZA 7REQB 1PZEA 4KUGA 2XQFA 4PXAA 2QTAA 7MDHA 3RVOA 4E51A 4EUEA 3NBMA 3IJ5A 4MRPA 4RDHA 2A57A 1RK6A 4UBMA 1V2HE 2FPOA 1XPOA 2WHXA 5AKZA 2L82A 5EKSA 2G3YA 3N53A 2R8KA 1YUNA 3P4XA 4ZRDA 2XB2A 1U9IA 2H2HA 2YS6A 4IJVA 2JLYA 4RTPA 1DC7A 1JZTA 4AMUA 5C32A 3OA2A 1A0GA 3WLSA 1KJJA 4TMWA 1WL8A 1SBYA 2REBA 1JHUA 4AJLA 2XBLA 3QBVA 2WICA 2HSEA 2AJDA 3LG2A 2O1WA 5KG6A 4WOBA 1NQTA 3LT0A 1RM3A 3H20A 3LHFA 4IGIA 3EODA 4KPYA 1XMOB 4ED3A 1M5UA 1E63A 2Q3CA 3K0KA 2LP4Y 1T34A 2MSWA 3JR7A 3PWKA 3HDGA 4AJ1A 4FFBB 3RGZA 3W9BA 2IUTA 1QP0A 3EMDA 2G9QA 3PHGA 2OC9A 3T9CA 2JLRA 2OGSA 5G0UA 4X8HA 1SQ0A 4MUMA 1J2JA 1E1QD 1R10A 1UDXA 4HVAA 1F2DA 1VFPA 2AR7A 4X92A 4BX3A 1ZDMA 2PKEA 4BJ6A