2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
1OBGA 1GLVA 2YWVA 5CB4F 2VPQA 3QFFA 1GGOA 3RV4A 3WNZA 4FFPA 1Z2PX 1VBHA 2YS7A 2R7NA 3LP8A 3RFCA 1ULZA 1T36A 2GLTA 2I87A 2YW2A 2YZMA 3OUZA 1EYZA 4FFMA 5C1OA 4MV4A 4O4HF 3U9TA 4EA7A 2V59A 3AX6A 1KJJA 1CQJB 3VOTA 2V58A 3AW8A 5CA1F 1GSOA 1Z2OX 3V4ZA 4WBNF 4XYMB 2YZNA 4HR7A 2FPIB 4FGRA 4O84A 2W6ZA 2NU8B 1JDEA 2YS6A 5LA6F 3VPBA 3SE7A 5HV6A 4YAKB 5K2MA 2J9GA 1C3OA 3BFPA 3HO8A 4MV9A 5LXTF 4ZOLF 5CA0F 2QK4A 2W6PA 3K5IA 4ZQIA 2NU9B 4E4TA 1GSAA 1IOVA 1EUCB 4XYLB 1B6RA 3TW6A 2W6MA 4YB8B 2X0SA 5BPHA 5H80A 3VMMA 3KAKA 4TV9F 4FFOA 4HQ6A 1I7NA 2QF7A 1EUDB 2YZLA 1WR2A 3N8DA 2GPSA 2W6NA 1CE8A 1BNCA 2CNQA 5D8DA 1PX2A 3K3PA 2XCLA 4TV8F 3DF7A 1UC9A 4GGMX 1CS0A 4FU0A 4MV3A 1PK8A 3TQTA 1W93A 2CNVA 4EABA 3JRXA 3G8DA 3I12A 1AUVA 4FE2A 4O82A 3ETHA 3E5NA 3U55A 1VKZA 2Z04A 4FFRA 3WO1A 1AUXA 1I7LA 1EZ1A 5JH7F 4IHJF 5JVLA 1A48A 4HNUA 2NPOA 2R6FA 4ZHQF 4DIMA 2YRXA 2V5AA 2GQRA 2GPWA 2P0AA 2FP4B 3BG5A 3MWEA 3ORRA 2FB9A 1DV2A 2R85A 1SCUB 1KJQA 2YZGA 5KKNB 3TINA 4Y8VB 4YJ3F 2W70A 5BPFA 5HBRB 3TIIA 1C30A 1EHIA 5I47A 3OUUA 4MV6A 3MJFA 4I4TF 1E4EB 2SCUB 3Q1KA 1M0WA 1B6SA 3JZFA 3WO0A 5JQWA 1IOWA 2Z02A 4EG0A 4J6EA 2OLSA 4O81A 4NYEA 3BSSA 4MV7A 4EAAA 1KJIA 3G8CA 1M6VA 1KJ9A 3HBLA 3Q2OA 2FPGB 3VPCA 3V4SA 3NUAA 2R86A 1GSHA 3TIGA 5BMVF 3GIDA 4EA8A 4IWXA 2XD4A 2DWCA 2R82A 2IP4A 3RV3A 4O4JF 1E4EA 2DIKA 4QSHA 1M0TA 5CAEB 4O7ZA 2I8CA 3KAJA 4MV1A 4O86A 4O4LF 1JKJB 5KX5F 4M99A 3K5HA 3MWDA 3VPDA 2DZDA 1KC7A 1Z2NX 2FPPB 4M9CA 3R9RA 2R7MA 2PN1A 4YAJB 3BSWA 1KJ8A 4DLKA 3R5FA 3JZIA 2ZDHA 3UFXB 1CQIB 5EZYF 2PVPA 4HNTA 1JLLB 3ORQA 4IZOA 4FFNA 4L1KA 4O7VA 1KBLA 4YJ2F 1DIKA 3BSYA 4MAMA 1JDBB 4RZQA 1W96A 2PBZA 5LOVF 4FFLA 5JVDF 5FNVF 3VA7A 3KALA 5IYZF 5LYJF 2WYOA 4I50F 4YBZB 2DLNA 4IWYA 2NU7B 4O7NA 4ME6A 4O4IF 4O83A 3KREA 4WD3A 4O7TA 4O7SA 2C00A 4ZI7F 5J2UF 3RUPA 2VR1A 2R84A 2NU6B 2CNUA 2R7KA 4MV8A 3U9SA 5JQGF 3JRWA 2I80A 3N6RA 5LP6F 4XZ3B 4HNVA 4O2BF 2W6QA 2VQDA 5GONF 3R5HA 1UC8A 2CQYA 4I55F 4O7LA 2CZGA 2R7LA 2NUAB 4EA9A 3HB9A 5C1PA 5DMXA 1A9XA 4MA0A 2R87A 4C5CA 2HJWA 4C5AA 3ETJA 5C8YF 5J2TF 4IIJF 3R23A 2YYAA 2YRWA 2W6OA 1VBGA 4O2AF 1BXRA 2ZDGA 4O7WA 3LWBA 4M98A 2W71A 1OBDA 4O7RA 2VHEA 4MA5A 2YL2A 4EGQA 2GQSA 2HGSA 1DV1A 4C5BA 4XX0B 3U54A 2ZDQA 1KEEA 4EGJA 3GLKA 4M9UA 4O7YA 1KUTA 3R5XA 4TUYF
chains in the Genus database with same CATH superfamily
3A1TA 1TOAA 1VHQA 2RIPA 3RJ9A 1CUCA 3H99A 1GT6A 3VAZA 3G5TA 3BDIA 1SUPA 3L06A 2Q2WA 3ASVA 1BVUA 3QU4A 3ZXYA 2A6PA 4KXLA 1B2RA 4BQNA 1XO1A 2W98A 1J42A 1Q0ZA 3K6SA 4H0NA 1DGQA 1AD2A 1PFKA 5I8PA 3KYHC 4Q1CA 4ZTUB 1E2MA 4R16A 5C5CA 4F3RA 4JBWA 1KRXA 1MH1A 4ND3A 1GGVA 2CN1A 3I9MA 4OYYA 1AE1A 5H70A 3TWOA 1H2ZA 1ZA1A 3LP8A 5IDQA 3GARA 1ADGA 1KKUA 2ILVA 1P91A 4BEWA 1TQ8A 4BZZA 1R8SA 3QZUA 4K87A 3VVBA 4UQPA 3FCCA 2Y6VA 5JXHA 1XEFA 2AQ8A 2P9TA 2VLBA 1GR1A 1EYZA 1UIMA 4I2VA 4LOKA 2QUAA 3HFGA 3D64A 4C0XA 3MMNA 4KDFA 3UPTA 2A5LA 2YTZA 1DOAA 1CTQA 1OWOA 2WAQE 1GPH1 1GGEA 2G9VA 2R7AA 2YWBA 1IN6A 1KIAA 3KQMA 3NP7A 3HWWA 3O8OB 1W4ZA 3DXXA 5EJAA 5C3UA 4K9PA 1QZUA 4F5YA 2VRCD 3LX4A 1EK1A 2QS9A 2RIRA 1M9NA 2HL6A 5F9LA 2VH1A 3KQQA 3KL4A 1NJ2A 2BC9A 2VAVA 3WZ2A 5JZVA 3JARB 3I2IA 1HBJA 2VKQA 3KPWA 2E18A 2VP9A 3EVBA 5BO5A 1A98A 2HH9A 4LF5H 3K2QA 1NMQA 1ZQ9A 1KI6A 4GLLA 1G63A 2C5SA 2IUEA 3FGZA 1TIBA 4NE2A 3ZCXA 4POAA 4DA7A 2I0FA 4C4RA 1BCRA 5I5GA 3JTMA 1U9CA 2WYIA 2RH4A 1UXHA 2A33A 4K8OA 1IHUA 3AEQA 5MN6A 4J2HA 3FNBA 3IPRA 2YNMC 5IAAA 1P61B 4X7BA 3W8DA 4IG9A 4LF5B 4ECEA 4CFYA 2GXUA 5TJ9A 3ZI4A 4TTAA 3UGJA 4FNGA 4NU8X 1E6MA 2FSHA 3W2EA 2V4ZA 3H04A 3OPYI 4IYJA 3REOA 3VZQA 2XCUA 3HO8A 2FLNA 1DWQA 1MABA 2CJWA 2JI4A 2OZEA 1HLDA 2QQ0A 3HPQA 4WDQA 3WJ2A 3WYDA 3ZZ1A 3DBRA 1AMNA 3U56A 3OTIA 2GZ2A 1N32H 2ACWA 4IQGA 3S5JA 3PW4A 1T15A 4ZOLF 3RIZA 5B36A 2AN4A 4YRGA 1FMJA 2ZIEA 1RE1A 2JJ2D 1P4AA 2ZTSA 1Y5RA 2P2GA 1NBHA 3IN5A 3E3AA 4H7HA 4MWOA 3OO1A 1E3JA 4Y1EA 4HQ0A 3OIYA 2O3RA 2GR9A 3OPQA 3R0ZA 3F4LA 4HKTA 2FDCA 1QHGA 1N48A 4XYLB 3QXHA 2XNJA 3I4FA 3ZW8A 4D3YA 2FUNB 2X4LA 1KYZA 2PLNA 3TZLA 1CD5A 3MRXA 5CJPA 1WS6A 3M6UA 3ZDAA 1RJ9A 3EC2A 1FJ2A 3RIHA 1IJFA 2BTQA 5TC4A 3H9EO 5EJ4A 2OT3B 2D62A 1XCBA 2COEA 3UA3A 4DWWA 3QE0A 2P7IA 3NH9A 2EL7A 1B26A 1K27A 1JEQB 2M6SA 2C3PA 4MW0A 1P7ZA 3BH7A 4UDNA 2Q3EA 1BXRB 2YYZA 3A6FA 3JYOA 3TTTA 4G0WA 4R9VA 1MAHA 2DQ4A 3G3EA 3ICCA 3PB3A 5JCXA 1DCFA 1ZSNA 2E6UX 4LK3A 4O5OA 3IRVA 3W5DA 4U7GA 1HDGO 3R77A 2CJXA 3JYHA 2FVXA 1IPFA 3KPJA 1E8DA 1VKJA 2AFIB 5TX7A 4X45A 1BDIA 2EF1A 2PXHA 3W7AA 1RBYA 2QUHA 4UD6A 4HAOA 1P0FA 4KXMA 3SF8B 5C7YA 3WYAA 2QP3A 4D3DA 1ISJA 5ESWA 1E3EA 1I3QA 1SEPA 4NFLA 4MDFA 3PSAA 2R47A 3MPUA 3IEVA 2R5FA 4I8XA 1V3UA 1ZUHA 3AFHA 4DUGA 3M1YA 4R1NA 1ZQ1A 3LG2A 3PF8A 3O3CA 4P35A 4QICA 5IAJA 2QVLA 5TDHA 5KYYA 5HF8A 4E6NA 5HVNA 5CM0A 2PUHA 1QK3A 2CXXA 1NLMA 2YV4A 3N3BC 3T5CA 3PSHA 2WK1A 1J8DA 2V65A 1NTRA 2N1MA 1RMQA 2VSQA 4URHA 4EABA 1ID8A 2EFYA 1CUZA 2Y0SE 1RCUA 3H4VA 4BKOA 2ZI9A 5JNSA 4DL7A 3T41A 4B85A 3HDGA 3SK0A 3VVCA 3OSUA 4UE3S 4J43A 4R0VA 1MT0A 1PS0A 5A6VA 5HXAA 1SWVA 3BC1A 2WKWA 4BMXA 5EI5A 3UPDA 1TYAE 4E5VA 4WAUA 2W2KA 4Y1RB 1YZLA 3DVLA 4NL4H 2XGOA 3NW9A 3UC5A 5MN4A 2VHQA 3KVRA 1XCPA 3QRWA 2IYXA 1SZDA 1N7IA 1SURA 4GSLA 3NCHA 3VZBA 5K3OA 3SF8A 4ZCRA 3D3WA 4LNAA 2PJUA 2X7XA 5A2QW 3F5QA 3FPEA 4J0QA 2FSVC 4Z7JA 1U11A 2VAMA 1NXTA 5AIAA 5LD2B 1JFTA 2WD9A 4FWTA 5JAPA 4KHPH 2F59A 2VNHA 3M82A 1AZTA 3P5BA 4UBOA 1I14A 4K0KB 1JWLA 3OSNA 3T9DA 5EUBA 2IOFA 3LO5A 2GPTA 2PMEA 1G8GA 1KP2A 4LJ5A 5ALMA 2BFDA 1S02A 2WOOA 2YN0A 2JATA 3V2HA 3KKLA 2GMWA 4ECUA 5IT9W 4H3KB 5KTTA 3MS7A 4C4SA 5EHGA 1RWNA 3ORRA 4W9NC 5BSMA 2P2LA 1FUEA 3HKEA 4CDNA 1JH8A 3E9MA 1G42A 1N5DA 2HU5A 3NYQA 3GV0A 1EG2A 2RKBA 3OZ7A 4IJWA 4WPGA 4MINA 3GRCA 3QVGB 3CX6A 5JCJD 3ST7A 2YZGA 4HLDA 4NU6A 2WKSA 3AQIA 4BMZA 4PZDA 5HW0A 3QXXA 1NW3A 5EZQA 1VE7A 2H1LA 4TMWA 2J3EA 1T94A 4CUZA 1MP0A 4ZYWA 2M2IA 1U6IA 1QXSA 3BH0A 1N2IA 3GJQA 1IMOA 3O95A 3N40P 1Z13A 3BTOA 2WM9B 3STWA 3SYRA 1G1AA 1EX7A 1GAJA 1OROA 5EJIA 4DYHA 1MG0A 3BIFA 3RODA 1QTQA 3GAAA 1SH7A 4EBFA 1J2JA 2JDIA 4JODA 3C43A 3BWBA 4HB3A 2EFDB 1IY9A 1DC5A 1T2DA 2I3BA 4IM7A 6PFKA 2PUAA 2CXNA 3NKVA 2Q5JA 4KO4S 2BI7A 4E33A 3K1TA 2WJWA 1TT5A 2ZRIA 1SU4A 4DCJA 2HHHB 1JI3A 4G0VA 4FOLA 2RBGA 4I50A 3JR3A 4BQQA 2BFFA 2H1CA 1VGRA 2QU8A 4QU9A 4X84A 1C9YA 2OCYC 1B1AA 1HYEA 2IFTA 4B48A 1L1QA 3G8CA 5U4XA 4A3DG 4JC4A 2BGMA 1HDEA 5ECYA 3WIOA 2ZSDA 2CE2X 4KX5A 4AJ1A 1XVUA 4D6YA 1AZSC 3JAMA 1ILEA 2V6GA 3CS3A 3HBLA 3T5DA 4CCSA 1E0AA 4HUQA 3W1GA 1SYXB 1KJYA 4BV3A 1XMJA 2PS3A 3M3HA 4DUZH 2XOKD 3LAWA 4ZZIA 2K2WA 4K9OA 1UBOS 5I9BA 1USUA 3DF9A 5BWVA 1DUIA 1KNQA 3VNAA 3LGSA 5FWYA 5BMVF 1K7YA 4R05A 4I7HA 2ZFUA 4LV6A 4IIJB 4H7PA 1D6MA 3HKBB 1PEDA 4YRTA 4DMKA 3PQ6A 3BMQB 2Y66A 1ZRMA 1EXVA 4EHJA 3J81k 4W5RA 2ZCJA 4B3DA 2XMZA 4GNRA 2FLWA 3T5TA 5M29A 2BV3A 3QELB 2DFNA 4Z7QB 3VGPA 1Z4MA 1IJBA 3PQDA 1G20A 3JAWA 1FS6A 2VP2A 1HDYA 2ZBFA 5E4YA 5A5GA 1HDOA 4AKHA 1R8QA 1Q6ZA 2FK1A 3BAAA 4NCXA 4DLZA 3EXG1 5KU7A 4JK3A 2MSDB 4ARVA 2HCFA 1U0FA 1UDAA 2QD2A 2IV7A 1ESEA 3HMQA 1IOZA 3J81W 2R4UA 4YLGA 3TRJA 3WWDA 4DTIA 3VYSB 4HUQB 1TZCA 2EKLA 4GPIB 1S0MA 2Q6VA 4G84A 3QSGA 2V54A 4Q1VA 4ZYVA 4MMXB 3DAGA 3DLIA 4K1XA 2JAPA 3BB4A 3K9HA 3BF8A 4YQYA 5C8YB 3T6KA 1GLNA 1BRMA 1G19A 4JV0A 3AR6A 4GPZA 4JIMA 5DXAA 4TQRA 1L4KA 5KFQA 2GTPA 3EGXA 3DVQX 3ESCA 3UAXA 5LQNA 4FONA 3GC6A 1ZMRA 4FYWA 4IHJB 4G5GA 4O59O 1E4OA 2QTGA 4RJJA 3H20A 1OWTA 3ELYA 3O92A 4LCEA 1W94A 3UCEA 1AG9A 4CG3A 4PTYA 1YQTA 2UYGA 2X23A 1PL7A 2FSUA 2YC4C 1ZHQA 2DGDA 2H4HA 3FCOA 1ZN7A 5G53C 2Q2OA 3HE3A 5EESA 3BSYA 4HHEA 3IV7A 3JVDA 5EXXA 5CCDA 4DJAA 1XA3A 2ENUA 1UBHS 2YDYA 1Y7HA 2XTAA 1JSCA 5CX1A 1T0JB 4FR0A 1BMTA 5LOVF 4PZAA 1T3TA 2ZAGA 3RTEA 3NHUA 1F6DA 5JC1A 1ORWA 1Z8DA 2GBGA 4MDYA 1D1PA 1EZZA 1ZM3A 2DUMA 2PGIA 1VE1A 1JDNA 1I5RA 1DTWB 2BFEB 3N0RA 3HDYA 3MRTA 4XR9A 4AW9A 1K68A 4PG7A 3VA7A 3RUIA 5A4IS 5KOYA 1E8MA 3MWJA 2HJGA 3Q6NA 4IG4A 4XFJA 4AU1A 1U3UA 2J3DA 2AMJA 3F73A 1VIAA 3AVQA 3ZNQA 1SEVA 4YT5A 4Q7QA 1Z88A 4P98A 4TKVA 2YOGA 1QHFA 4NCAA 1Y82A 3KQYA 2JANA 1TYCA 2V5VA 3TG2A 3OLYA 3BS4A 2FJUA 4DN6A 2Q2TA 2DLNA 1FOEB 4CTKA 3QYJA 4K05A 1U94A 1WUIS 2JLQA 3AEUB 2CLKB 3A3NA 1CUAA 4H3HB 4OK5A 5HRAA 1M2OA 1R9NA 3CX4A 1EZ4A 2E2HA 5FKJA 5CVCA 1ZI6A 1TM2A 3GJ3A 2X7HA 3CNOA 4OFBA 1IN1A 4XQGA 4BVLA 3EGOA 2XRYA 1A96A 5ECWA 4MWCA 4RACA 3NLLA 4RS3A 1WSAA 1A4RA 4O8ZA 4PLYA 3K31A 3KTOA 4JUIA 1HE3A 1B14A 1CHDA 1LLQA 1VMKA 5ADVA 5G1OA 2VR1A 5IK2D 5J47A 1E1QA 1A7JA 3C4VA 1IOLA 1FTYA 2C7BA 2NU6B 1E4FT 2HI0A 4US2R 4OXQA 4AWAA 4WGGA 5BN3A 1LQTA 1S2IA 5JRJA 2MIIA 3ZW9A 2OG1A 1QOQB 2ILTA 3I9JA 3KBOA 4D7AA 3NGDA 2RKWA 1Y1TA 3DVSX 2PX4A 3MLAA 3JQRA 1XZHA 3DWGA 2BMDA 4DCMA 5LUAA 2GBLC 1BDJA 1USVA 2ZTVA 4GMDA 4NK5A 4B2LA 4A15A 3FPHA 1W46A 4KH1A 3DBLA 4U2KA 2XGPA 3DTGA 1ZUD1 3WGIA 4EB6A 1TUBB 3U4IA 2YHUA 4UDOA 1BGVA 1P2VA 3GQVA 3LT5A 1RKBA 3QKSA 1M1UA 2VCEA 3E7PA 1U0EA 2O14A 2PT9A 4X6LA 3GH3A 3WQRA 2ZB2A 5EP2A 4WXRA 5LIRA 5DM60 2DM6A 3JU3A 4B0PA 2Q8PA 4ADSG 3BTUA 3T1YH 4WCFA 1H2YA 2C7PA 1QC5A 3MBOA 4EMBA 1ZH2A 1RRMA 4TV8B 1TGYA 2XQJA 2WDZA 2I3DA 2HHJA 3O93A 3P5SA 4QREA 4XB2A 3THXB 1DHRA 4J1QA 3SKXA 1RJGA 1DWOA 1DRWA 1FNNA 2F67A 3WE7A 1OMOA 1E6CA 5DMXA 1WMDA 3QELA 4NAUA 3V6MA 5WRFA 2QTCA 3IT3A 1RBMA 2V3WA 4YO8A 5EZYB 3E1SA 2H8KA 2I4RA 2IDMA 4B4OA 2WWXA 1P18A 2X0EA 5JCJA 1J0XO 4KN5A 4D97A 1FVIA 5FT9A 3QGMA 5IXJA 1V5EA 1L3BA 4D9MA 1DKNA 1Z0FA 2R8YA 3NVAA 3Q0TA 4GVLA 4DBLE 5EJEA 4DA4A 3T5AA 3KRTA 2HSGA 1OQAA 3D8HA 3ICVA 3K15A 4OHXA 3CIFA 1BA2A 2IHBA 4L8FA 5F1PA 1HTWA 1XEWY 4MZXA 1JHVA 3OLWA 3WLJA 4C2AA 1I7DA 1N2GA 4E3WA 3I9OA 1SIWA 2GN0A 4ALMA 2D0PB 1VTKA 4ZQBA 5JJCA 2Z57A 5DHTA 1PSWA 1LSJA 3JD4A 4ZD6A 3ZCPA 2C98A 3H19A 4FCWA 5J2TB 2WSYB 3GT3A 1QK5A 2EKZA 3CSDA 4KDEA 5FNVB 4X61A 1CRWG 1W19A 3SC6A 3PCRB 4FX2A 1RJWA 1N1DA 3TQOA 3I01M 4YAJA 4FW8A 3LT4A 5TXGA 2VJBA 3HCRA 5E7IA 1ZVKA 2VJQA 1WSDA 2CJWB 3A58B 4PM4A 4CF7A 3H0GA 1KYQA 4XYBA 4RIEA 1W36D 2BM9A 3NWJA 2YY6A 2ORYA 1YVDA 2VWPA 2D59A 2Q27A 4ALNA 4DPKA 1YTUA 3BULA 1RI1A 1USKA 4KHZA 4L5CA 4XGNA 4RAYA 3ZHXA 1DBIA 4OKIA 1LNQA 2QEQA 1NE7A 1PIWA 2NU9A 2WKQA 4JT9A 5B3LA 1XL0A 2C07A 3DOHA 3KETA 5DG7A 1TPYA 5JWOA 3PQFA 4HY3A 3KQSA 5BVGA 1N0UA 2FN9A 4CM6A 5E3IA 4TXMA 1QIGA 2FK3A 2ZEJA 2FMHA 3A9CA 4R2IA 4TPKA 1B23P 4WX2B 1HLFA 3P4UA 4KFRA 4PZUA 1KDTA 3TLGA 4IDNA 3VTKA 4X8OA 3ZNOA 4K6OA 2ZIUB 4O4IA 1JTVA 1THTA 3IJPA 4M9UA 2PT5A 2C58A 2J9ZB 3T5HA 2ON6A 2OCBA 2WMOB 5AKHA 5FEMA 4OY3A 3LFUA 1L5FA 5IUJC 1SY7A 1DIGA 1X7HA 1YDWA 4M21A 2FQQA 5CNKA 4ZT5A 2DXIA 4BWFB 3C41J 5A0FA 3B6KA 3M0EA 4R8KA 3PU6A 3OZIA 2GM5A 3EF3A 2FUG6 1KYVA 3EWSA 3I4CA 4MYSA 4JX8A 2D3WA 1OGJA 1JX4A 1IK4A 3NHKA 4ND7A 1VSVA 5AK3A 3DTTA 4TRRA 1J23A 4R9UC 4LYFA 3ZIAA 5JARA 3NVKI 2O8EB 5K3CA 3ZV3A 2QYZA 1EVIA 4BDSA 2VOJA 4L27A 5DCLA 4HDKA 1DGSA 1Z2PX 1BJTA 4IX9A 4NH0A 4P4SB 3ES9A 3RF6A 1Y3AA 3EFBA 4UEQA 1M2FA 2IUUA 1FNDA 3A6ZA 1WSBA 4G01B 4RIGA 3ILVA 2NPIA 2P2YA 3UT5A 4JXXA 4WMLA 2BBWA 1U7HA 3TLCA 4BMPB 3G0IA 5FHRA 2X77A 2XJ4A 3AM3A 2GXQA 3KSDO 4W7HA 1KDVA 4HP8A 5CM9C 5EFOA 3AERA 4PSUA 4HT3B 1SG6A 3DDWA 1L8QA 1E3SA 3ITDA 2C9OA 4UCXA 1R0BA 3ELWA 1FDSA 4HDCA 5KX5A 2OO7A 1VGQA 2Y9PB 3MR5A 1WSWA 4GL4A 2C5GA 2WE7A 3VOTA 1MX3A 2EWWA 3K9CA 5ALJA 1MMFB 2IEBA 3K70C 4NEGA 1GSOA 1ZAUA 2WJ3A 1XZKA 3GEBA 5BXYA 3GNLA 1HMYA 4RKWA 1N33H 4J0DA 3MUFA 5F9MA 2PRJA 1KOFA 3FVWA 4XYMB 4YT4A 2RMKA 3CIOA 3X2FA 4CEIA 3FYSA 2O8EA 4EYOA 1US8A 1YR7A 4BO2A 1EFTA 1XZPA 2J41A 2DWOA 5DWVA 1TI7A 3TMKA 2R3SA 2BN4A 4M0MA 3ZE2B 4DJTA 1RWBA 2XA2A 4ATNA 1TCAA 2G07A 4RTKA 4RZ2A 5DNVA 1LTHR 3ZKAA 2H00A 5LZ2A 3RT1A 4BJHB 1TAQA 2FZ5A 3QK7A 1HEIA 3JARA 1HFWA 2JA1A 2RHBA 2IUYA 3HU5A 2PCJA 3TLAA 5DYTA 1KSJA 4R8LA 3DBVO 3JVEA 1BVHA 2R6HA 4TQSA 1XBTA 3CYFA 4B3BA 1GT91 1K63A 5LOVA 1SHUX 2REOA 5CP8A 4LOHA 4X8LA 4HX2A 2WINI 2ZT6A 3BTSA 2HK6A 3BWEA 4PY2A 1JNYA 2AFHA 4JKYA 3SHVA 3K5IA 3ZY2A 2Z8XA 2BYTA 1U8YA 1JXOA 4DR3B 2ZRFA 3CLUC 3D6MA 4MVJD 2OBLA 1TLLA 4ZJYA 3TECE 3R7FA 1UJMA 1LPNA 2Z5LA 3K1JA 3IHTA 3R6DA 3HLYA 1IOVA 1GO3E 3EVZA 4KYUA 1DCMA 1QQ7A 4M0EA 1A1SA 5E7MA 3W8FA 1NKVA 3BGIA 2OPBA 5CT4A 1PJ2A 3TOXA 3GP8A 2VIIA 1KVUA 3GLHB 3UB3A 5T41A 3O73A 2H92A 3ZGVA 3TOZA 2HQSA 2JA6G 2JIZD 4OMUA 3NOQA 2LXNA 1EX6A 1XJQA 2RGRA 2R4QA 2X1MA 4Z53A 1NM5A 2OXFA 1A0IA 5FBWB 3LTNC 2X4GA 1CP3A 3OQBA 3KD3A 1W34A 3FHJA 4N01A 4CKBB 2BEVA 4JB0A 3V8BA 3OURA 3IUYA 3JWIA 1LBTA 1XZJA 2HDHA 4NZNA 3GGOA 4RCVA 3T7SA 4EOGA 4UOEA 1PEYA 2I33A 3TL3A 4YMTA 3F8TA 1BNCA 1AOXA 2QORA 1KFBB 3OZCA 4TKLA 5JW6A 1N34H 3HB7A 3WLFA 3NC4A 3QV1A 5J4HA 2TMYA 4RHCA 1P2BA 4RHUA 1N2BA 4TLCA 2Z2YA 4CQMA 3DF7A 3GTQA 3A1NA 5F5NA 3RRYA 3R9XB 4JI7B 2QLMA 2MSLA 5FOXA 1M0SA 4X62H 4UPDA 2F48A 1F3OA 1HETA 3GDOA 3KKKA 1JVBA 3C3CA 3NXKA 1QANA 5EWJA 5LN1A 4DR3H 1S0UA 3KDPA 2YZKA 1JYEA 1N3LA 1OT3A 1CS0A 3FZYA 1VXOA 5BRJA 2UXBB 3OD5A 3QE9Y 3OMLA 1V8DA 4WQMA 3V4VB 2PUJA 4J9SA 1JEJA 3CZ5A 5HDQA 3B1XA 3WDLA 3BRSA 3HI6A 3KTAA 1DDGA 2QPLA 4JI4H 3VSAA 1IXZA 3CEAA 3AHDA 3LKBA 2NUBA 1LNSA 3C5HA 3OEED 4LJKA 4PIVA 1TEZA 4MVWA 1K2VN 3TW7A 5A5DA 4XSVA 5EYPA 5CVUA 5EUCA 4O3QA 5AKYA 1UUFA 3ZWQA 5KFMA 2HA4A 4HL6A 3IDZA 4DSZA 1DX4A 2GS9A 3KQOA 4PTLA 4N6NA 3V7WA 4UM8B 1NYLA 2FN8A 2Y67A 5EP1A 1UK8A 3F6YA 1V5FA 4RQAA 1MB4A 1SHTX 4QUIA 1OKKD 3LM8A 3HEMA 3HHPA 3MGGA 5CXSA 5IBCA 5JH7F 2C0PA 4AECA 4B3CA 4BYGA 5IZCC 2AI3A 2I2XB 2COUA 4I9FA 4E09A 2F3PA 3IP7A 4BEVA 5DTEA 5CFRA 5MGBA 4MZDA 1V7CA 2R5WA 3OCVA 2X8BA 4NYIR 1DRVA 4ED8A 3ZPXA 4BMOB 3F3MA 4B31A 2GQRA 4LCJA 4E70A 4GBMA 2J6CA 2XIGA 4A3JG 1NR5A 3FB1A 4GLWA 4A6EA 4DGSA 3G2MA 4CEJB 1UFOA 4W4TA 2XB8A 2XEXA 2FB9A 3PK0A 3HY3A 2E2IA 3L7OA 4JC0A 4JJAA 1QHYA 2WJ4A 3L0OA 1DDIA 2YRFA 1A8IA 4M1ZA 2WG2A 3H87A 1KJQA 4FFVA 4ZOLA 3OX1A 4DIEA 3SHQA 1GL9B 3L02A 3ZZMA 5DHRA 1WLYA 5AMXA 4OFXA 3WL4A 1J1IA 2X40A 2W2XA 3LCCA 3P9KA 3EFEA 4WOBA 4Z4FA 1U8FO 1JDJA 5F77A 1QIHA 4QGBA 1SB8A 1ZITA 2IZ5A 1S03G 1CDZA 1CIVA 2WIAA 2XQVA 3DV0B 2FLKA 3IVRA 3KSRA 5ICSA 1EHIA 1KAHA 4YH1A 5I01A 1Q0HA 1XEXB 2PKRA 1MJ5A 4KO2S 4ID3A 1QGED 4F85A 3PLRA 1ECLA 4G5QA 1ICEA 1ECGA 1LZKA 1UADA 1Z47A 2H2AA 3JZFA 2SICE 4FDMA 2Q99A 2CSXA 3RYTC 1DC3A 5B5SA 3T5MA 2G17A 2PX2A 3RVJA 2CNDA 4Q7LA 4JITA 2HW8A 2INGX 3GUYA 2CBGA 3T5BA 5J1SB 2AW3A 2YWDA 2QV7A 3PDUA 1HA3A 2GRUA 4P83A 4BFYA 2PE5A 2ZULA 1DC4A 2AGOA 2DUUA 3FE2A 1KIMA 3O3MB 5E0OA 3AYXB 3RHSA 3B12A 3IIJA 3K0EA 2O59A 3I53A 1POXA 5B2FA 2IHJA 1G1MA 1ONSA 1XIVA 3QWAA 2ZPTX 4NFSA 3JQGA 1D5WA 4MS1A 1ZVJA 1R74A 4QG7A 2NTNA 3KQPA 3PUXA 3FUWA 4YDSA 4HH0A 3NUAA 1Y34E 2PBLA 5EE1A 3VPHA 1VHDA 4FSDA 4BV8A 2IYUA 3L6DA 2J7KA 3PNKA 4ILKA 2J9RA 5DNCA 3DO5A 1YJAA 4GYYA 3EW7A 3MWEB 4M0LA 4DY6A 3H5AA 4R3WA 2YCBA 4QFDA 1MDFA 2IQIA 3FVTA 3DW3X 2IP4A 1QO0A 1NU8A 4LFCB 4AP9A 1BE6A 1E4EA 1QWSA 3TOCA 4DIOA 3BXFA 3RYFA 2O0KA 3GZTB 4L6AA 4KSCA 2JBAA 3ZS9A 5KFCA 1T2CA 5EJ7A 5JEDA 4CMFA 2P9BA 3KJHA 2V7UA 4WA7A 3DMHA 1GA6A 3G9QA 3WKDA 3Q8MA 3OESA 2PK3A 1LVUA 2WIKA 2IVFA 4FMBB 5JI3E 2QZSA 5LNK6 5CR5A 2BW0A 3H11B 3TLJA 3DMFA 4S1VA 4MEBA 13PKA 2FLPA 1PLKA 1U8ZA 2JPDA 4HQLA 1QM5A 4BHTA 3DAOA 2ZSKA 1NXPA 4AMYA 1NR1A 3I04M 4WADA 3X43A 4LXUA 4B35A 4JLKA 1L4HA 3G5UA 3HBNA 2SKEA 4JR1A 5AI5A 4EG5A 3VTZA 2PJDA 2EGHA 1P16A 3IDAA 5DX1A 3GRZA 2X0DA 4YQFA 3WRXA 2VDPB 3O3OB 4GM4A 2JHFA 3HNOA 4UFPA 1ZBDA 4C2MA 3W6ZA 3DOCA 5K09A 4OYRA 2YV1A 5A7FA 3PS9A 3HA7A 3B8EA 4LYAA 3UN1A 5FOSA 1P4SA 1U1EA 3T5LA 1YQQA 4I36A 5HK8A 3W5VA 2EAUA 4DLKA 2OXEA 4W1PA 4GMKA 4YO7A 5EFZA 3JZIA 5JZSA 1UPFA 1Z38A 1VG9B 3H2YA 1V4VA 3IUJA 1P5ZB 1B8OA 2JJ8A 4RA6A 5AM1A 1BO6A 1W73A 1Q0UA 1EDDA 4AS3A 1A76A 1MNQA 2FLVA 2ZIXB 1BE1A 2BI4A 3RAQA 2DTXA 2HK9A 4IZOA 3DCYA 3MJSA 5E1DA 3W2TA 1JZTA 1QZTA 3AUYA 4NU0A 4QUBA 4B7CA 2ZSHA 3U7EB 3O31A 5BQ3A 5M5BA 1V39A 1XMPA 1ZNWA 2W8ZA 2XOEA 2K7FA 3LKVA 3CVWA 4DV2H 2QSZA 1I4EB 2XW6A 4ZU3A 3D3NA 2WVJA 4RNNA 4N9WA 1IYZA 2DPHA 1FTQA 3AKDA 2XBLA 3DE2X 3W2GA 2B2XA 2HC9A 3P27A 2UUCH 4EHLA 2YH2A 1NXOA 4Q3LA 4ER7A 2Z2JA 4OX9Y 1LB1B 2B25A 1HLPA 2FEWB 2UUPA 3C8MA 3LK6A 4F4CA 5MF6A 1TW3A 4G0XA 1Q92A 1TCBA 3P8ZA 4JBLA 1J00A 4F5EA 3ODPA 4NBNA 5KVCA 2W9BB 4JHXA 4CLEA 3O82A 1K9VF 3F98A 4XIGS 1YUMA 1YONA 2FXIA 3R1IA 4GC7A 1YA4A 3C3KA 2GNOA 3T0IA 3N43B 5DGBA 1DQPA 4V24A 2ACVA 3KKZA 2RJOA 3E8MA 4HZUB 2A9RA 4DV5B 4UHDA 2Z6UA 3TQCA 4QO7A 5B3JA 2IS6A 4IWYA 1PL8A 1UJBA 3P2MA 1MVOA 4G1VA 1XRSB 4BEBA 4TXNA 2YFQA 3SD7A 4ME6A 4GXTA 2CVPA 4C3ZA 4CMBA 5K4GA 4O25A 3CJQA 5KVAA 3SVLA 1DFHA 3KREA 1XSEA 2LPMA 2ZVDA 2H7YA 5EERA 4C0KA 3QX9A 3HZHA 3PNYA 5LB2A 1MNAA 4W1RA 1V4NA 4IICA 4S24A 2WQ7A 4OQPA 4DMRA 4O7SA 4DV4B 1HWYA 3AUSA 4RD6A 1N9GB 3ND7A 1YQWA 4RVDA 1EUYA 4O63O 4L28A 3RS3A 1OXVA 2VRNA 1MC1A 2QZ4A 3JATB 4GHWA 3ZVRA 5ICMA 2QR2A 4ZAFA 2CLIB 3N87A 4CR7A 2FR8C 3MNFA 3EYAA 4WKNA 1U8AA 3U4CA 2FFRA 5CXXA 3RYCA 1PD1A 4J91A 3GVPA 2VP6A 3DMDA 2ARKA 2NXCA 4O2BB 5J63A 3J7AC 1OUMA 4LBWA 1WVGA 3V4RA 2DKFA 4BGVA 5AVRA 2R93A 5AK6A 3QIVA 2XMPA 1S2MA 1V41E 4XGQA 1SRRA 1N1EA 3FW1A 4IS3A 1YU9A 3TZEA 4KO1S 1PP4A 2AWNA 1K5GA 3NXSA 4LFAB 3G13A 2NYUA 3BILA 4L9WA 4QZVA 1U0LA 3W7VA 1A9PA 4RZHA 3SVTA 1V7QA 1BX3A 3KHRA 1M8PA 2BSXA 2UZ1A 2PJZA 3FFAA 3I0MA 5I9LA 2Q2QA 2EJTA 2AOTA 4QT0A 1OWLA 3JV7A 5K3FB 3K09A 2JHCA 1WY5A 1NI5A 5JZBA 1P80A 5JCOC 2NUAB 3ONEA 3W79A 4DPLA 5JT1A 1G3MA 3RTDA 2CFRA 1NSTA 2JRCA 4IHJA 4EMTA 5EHIA 1A71A 4O1HA 5U4QA 1UBCA 2GEKA 3C3XA 3IUEA 3IXMA 3TKAA 1ULAA 1CQPA 4TVOA 4B8WA 2IYRA 1RJPA 1IEQA 2Q1TA 1EUZA 4N7JA 5HQTA 1ECPA 4JELA 5B7QA 4ZICA 3ENVA 4YGXB 1OLUB 5KT7A 1CQZA 2VT7A 1KXZA 3NDIA 1BDBA 1YB7A 3GROA 5C8YA 3TQ1A 5K0EA 3AKZA 3IQEA 3AHCA 4LWQA 3C8DA 5J2TF 1MVLA 4BZXA 4I81A 4RF4A 1IBSA 3PRKE 4C6TA 1SBZA 3QXSA 5SY6A 4DSOA 1WVIA 1B0PA 1YJ8A 4RKFA 4YMLA 2REBA 1VBGA 2CXRA 2HMUA 2QOEA 1EFDN 2VQ3A 4LFAH 1N6IA 3B6IA 3EXEB 3GLFB 1GUFA 2ZP1A 3M6VA 1R88A 2B69A 3I30X 1OCEA 4MS3A 4QDTA 3THOA 3L49A 3VYUB 3I28A 2ZRGA 3EUFA 4AT1A 4P0QB 3Q0EA 4WFKA 2W71A 2PO7A 3CWZA 1N2JA 4B4KA 1O08A 2CMKA 2O4CA 4CMDA 1UNNC 2VDRB 1A5TA 2HY7A 3W04A 3VXKA 3NB0A 3ZW7A 4OQ4A 4LF6H 4ZZ3A 4X6UA 2V1UA 3Q41A 3W5OA 1TK3A 4UHJA 1VRVA 3FM9A 5LYJA 4JJ8A 2PEYA 1T8WA 2XXBA 1E63A 2Q3FA 1AB5A 2YY7A 1O5OA 4DVJA 2WP0A 5K9ZA 4KTTE 2PMKA 2EBWA 3GHYA 3Q4GA 4Q1EA 5IYZA 4FWBA 5ECDA 1PRYA 2C4TA 5KOIA 4XD7A 3BORA 1SC1A 5FQOA 1FFDA 5KT4A 2XYPA 2VBCA 1NKSA 2ECFA 3ZDDA 4ZQCB 1GILA 5EJMA 4NWIA 4FYJA 2PMWB 5LMUH 3BGOS 4JCCA 1PU2A 5ENVA 3AB8A 4V38A 5BWNA 5E4JA 5AOVA 3QEBZ 2V7WA 3KZ1E 2AD5A 1UJCA 1RQRA 3O8LA 4WBNB 5J4VA 3PJRA 3R5XA 2H2IA 2ZRJA 3KZNA 2AOXA 2DPXA 2QLJA 2HREA 2JCSA 2O3UA 1XTPA 3RKUA 2WT4A 3SE0A 2QZZA 4KACA 2REXB 2VDKB 3W5CA 3PQ8A 1U90A 4JLDA 2O57A 1VG1A 3RGWS 3UOAB 4EFKA 5LMZA 3OLXA 1ZN2A 1GGMA 2BGKA 3RS7A 2ROQA 4HXGA 2VPQA 4F9TA 2GF2A 4DUGD 3V48A 3QFFA 4EJ6A 4FR5A 1QYCA 1X87A 1NLUA 1W85A 3OIWA 2UXDB 4E3ZA 1K1EA 1CUWA 2W7OA 3AU8A 4YVFA 4JXJA 1DBQA 1E7SA 3IR7A 1SBTA 4GO1A 5AJXA 5HA5A 2OQVA 4ZEVA 1IUKA 1S8FA 2I87A 1OX4A 4E5SA 2YZMA 2VJMB 2PEZA 4DZZA 2CJPA 3OUZA 5LP6A 3OQIA 3P96A 4ZVMA 3QLTA 2HFKA 5C1OA 4MV4A 4DEVA 5AJYA 5K45A 4ZRDA 3MMPA 4W5NA 2YN2A 4RSRA 2ZM6B 2VHVA 4WEQA 3L1KA 5EHXA 1KNXA 2BGNA 1KO8A 4RCYA 3EDMA 2AXQA 5CA1F 4RB2C 1Y89A 2ZYTX 4RHFA 1CRPA 1EFLA 4WY5A 4HH3C 4BAGA 2COKA 3C39A 3UBTA 1FJXA 1GKYA 2G1AA 4Z51A 4JI2B 5C31A 4CHTA 2PIDA 2OSBA 4E51A 1XNGA 2JFYA 3DYIA 1F38A 1XXHA 3WGJA 2CL5A 2HHAA 2VAWA 2DCMA 3D54D 4WA8A 2FSVA 3O1JC 5BURA 4IJ6A 2VA2A 4X3CA 2LGJA 2JEGA 1E1DA 3B3AA 4UHFA 5H3HA 5BWMA 3EVEA 1WP9A 3X1WA 1J5EB 4IDQA 5LPNA 5AKIA 1VDZA 3IEXA 4GZ3A 4Y6GB 5DSXA 5FD6A 5EE9A 5F4ZA 3SJBA 3TFQA 2OY0A 1E69A 1JG3A 2W2KB 1O94C 3N6VA 4J0HA 1IBMB 3W77A 2WAXA 4QYSA 3REGA 5L1IA 2B7CA 4MDHA 3H5TA 3LVRE 2OILA 3QM1A 1HL7A 1EK6A 4HB4A 3TLYA 1C3OA 4AN1A 5LFAA 4BP1A 4C2TA 3JQAB 5DTQA 4FC6A 2ODEA 1KQNA 4RZIA 2C92A 5EGNA 1VE9A 2ZAYA 1RYEA 1LX6A 2HIGA 1FFXA 1VL1A 1QIJA 2EGGA 5ITZB 4B3FX 3RDPA 2HXSA 3W8NA 3ZDYB 1YBMA 1YI1A 2I4TA 3OCXA 1QCCA 2RB4A 4DCSA 3PUWA 2VFAA 4QVGA 1YV9A 1WWKA 1SXJE 4QTUB 2GAOA 2Q5CA 4P38A 1OU4A 3ELUA 3E9RA 1Z74A 3TNYA 3LY8A 5LYJB 5T8KA 4I3HA 4KYIB 3QE2A 4O0MA 5JQGB 1L7EA 3W6NA 1LI5A 3K32A 2H07A 3CEJA 3DB2A 4RD3A 1X1SA 1IZ9A 1P39A 1SR8A 2QUBA 3Q5DA 3RGXA 5COQA 1ZD3A 1WW2A 4CFZA 2XOKA 3Q0IA 2VK4A 1NURA 2XDAA 2XF2A 4P92A 1RJRA 2XCSB 4GR5A 3L7IA 4Y6RA 1NRIA 5LLDA 2BF4A 5AVXA 2WPDA 1LEHA 1R6BX 1WCWA 3WDSA 2VYND 2AOUA 4JLMA 3DVAB 4L8YA 4DCCA 4GOJA 1QO9A 1ZW1A 2B2NA 2H2GA 3JS5A 2O7RA 3OF3A 4B33A 2XUIA 1ADBA 2AW5A 5KJCA 5ALVA 1J7KA 1NW9B 2I1VB 1RXYA 2PM8A 4L7VA 4ECQA 1P4GA 3QUCA 4OSPA 3VC2A 4LJRA 4N7MA 4PZ0A 3RVKA 5MFPA 1NT2A 3LTEA 1XF9A 1SHKA 2CMDA 3F7MA 4AICA 1SVIA 3B48A 3IVGA 2BGIA 2HYDA 2WWGA 3KBBA 3LCUA 3M6XA 1U7TA 4FOSA 4I66A 1XQVA 1YBHA 3EW9A 2FZEA 3U3JA 5FLYA 1V48A 4CL8A 3HADA 4Y67A 4P32A 5KG0A 4RJ2A 4Z99A 1PK8A 2KSQA 1L6IA 4RANA 1UDBA 2OESA 4PYLA 1Q16A 3BK7A 1MORA 2EARA 4DRZA 1AKTA 2H54A 2NNLD 5GVRA 1THZA 4G63A 3P2KA 3U9LA 1CY1A 3E82A 3CXRA 3R20A 4IIEA 3KV3O 4AC9A 1J1UA 1OVMA 1RHUA 4FN5A 5I8WA 821PA 3QKRB 4URVR 2I34A 1IUOA 1WHTB 4RDHA 5E7JA 2MDTA 3HCEA 3I45A 3D6FA 4IR7A 4FE2A 1ZK3A 1ODKA 1V9LA 3S24A 1NJ6A 2RGAA 1R3UA 2VG8A 3AERB 3AM1A 1G8PA 4Q5IA 3OQPA 2CB0A 4YJGA 5JUMA 3ZWWA 4JUBA 4R9SA 4C88A 4FFRA 2DJ5A 4RVOA 3L1JA 1IAVA 2FW8A 5J2UB 3HKCA 4WL0A 2JAOA 3IP8A 1XG5A 1S6YA 3KHHA 1DT3A 2AKAB 4JV2A 1HFKA 3ZGYA 3D6NB 2PZGA 5JXWA 3ZVKA 4WXMA 3M4YA 5CBPA 1P3Y1 1LQ2A 4GDMA 2GFQA 4TMKA 1L7BA 1A48A 4HNUA 1AMOA 1P2DA 5IWAH 1NMZA 4XX1A 2E4YA 5AM0A 1LWNA 2XUHA 4XIIA 1D07A 2ZJ7A 3QFTA 1VHJA 3RKRA 2DUWA 4N0EA 5FPOA 5CHEA 4TMTA 3WSVA 1X7YA 4D1YA 2BR3A 2IBSA 3KEOA 2GNAA 3MILA 1I32A 4U5QA 6Q21A 3R7AA 2KS6A 4XM1A 2C82A 1HDZA 4AP5A 4QBTA 3WZMA 2PBRA 3AJ9A 3FLBA 4L15A 3O8RA 4OI0A 1Z6AA 3W5HA 3I4LA 4M54A 4Z7NB 2CCJA 1N9GA 1E2GA 4N3AA 4NG4A 4W9RA 3IJEB 2CMGA 4IF6A 3UMRA 6NULA 2HIHA 4BN5A 4QU8A 1C4KA 1SNYA 2B0CA 3I58A 4UC0A 2AX3A 1MXFA 4OXYA 5IP5A 3SX0A 3PKIA 1TM5E 4M1SA 4N4AA 4FEYA 2OG2A 3QG1A 3BXEA 3LDAA 5BSWA 1TC1A 3QNMA 3OECA 2OPHA 2AEFA 2IPAB 1RK6A 2X8JA 4GLJA 1JA1A 5AH0A 3E03A 3KUDA 4ZAYA 1TNDA 1PZFA 2WKPA 1ZD9A 2FHPA 3FZGA 3TM4A 2ASEA 4JLUA 3AHFA 2AX4A 2JA2A 2C2YA 3K6SB 4QATA 2GJ8A 5JVDA 2BRUA 2B63A 4UJ5A 1WXHA 2PV0A 4TYQA 3PUKA 3R0VA 1MEEA 2XGQA 2BFMA 3T1OA 2R8RA 1E4EB 3Q1KA 2QWXA 3U80A 3CNHA 2FY8A 4E08A 1IOWA 1N9KA 2ODPA 2F8TA 3JQ9C 2IOYA 3EEOA 4KQKA 1YO6A 1JR3A 3S6JA 3F0TA 4QQNA 3B1WA 4KH0A 2QXUA 3BEOA 3ETNA 4N8EA 5A05A 3TQFA 2ZRDA 4WASA 1Z5UA 4G0PA 4Q34A 3GLGB 1DMSA 1KFJB 1JUDA 4FYYA 5FF9A 4EHHA 5CVVA 4ED3A 3AEXA 5C8VA 1CEEA 1Q3KA 1MFPA 5BR1A 3NBZB 2WHXA 3PEVA 3UB4A 4CIAA 4OL0A 2QTRA 2YWHA 4I5EA 3TIGA 3DAHA 1VJTA 3HBFA 1YRAA 2X5OA 1TJPB 2FPUA 1M2WA 1QONA 1EEHA 4TWAA 3IMFA 4OHUA 1JPJA 4B6SA 2E9SA 1EA5A 4IFTA 2CGEA 4KLZA 1CJBA 4QWCA 5T14A 2EDAA 4WHMA 1JPNA 5E3HA 3CLRD 3HCBA 4B73A 4R1PA 3RG8A 1P1JA 3SKVA 1K4MA 2RGDA 5HP4A 5CFQA 4UCTA 2YJTD 1AC5A 3OWHA 1U3VA 4LX8A 4LHXA 4QXMA 3DKVA 1KH2A 4F6RA 1DWUA 2UVWA 5IH3A 1DIBA 2W37A 1QG4A 2C22A 2V6FA 3HUFA 4FGZA 3WK8A 4BBZA 3AY7A 2HBRA 2X2OA 4KQMA 2XUDA 3TLEA 3TLGB 4IJVA 2QB5A 3K5HA 5KNDD 2HMVA 3OPMA 2FQXA 5I4IA 1R4ZA 3EJ6A 3JQDA 1MX1A 3K4HA 4FX5A 2EEZA 4ZOEA 4X41A 2Y9MB 2HK8A 3WGOA 1AQJA 1XHFA 4M9CA 1T6ZA 4J7CA 3HC7A 4TT3A 3WTBA 3RS9A 4Q02A 3ZJ4A 4WRRA 2FMTA 1EE9A 5KJ1A 3CVZA 3RUDA 2B6NA 3AC0A 1NG1A 2NVOA 3HR4A 3N70A 4PDBA 4ZWNA 2BZGA 4F60A 3HJFA 5AK4A 4UAUA 1HZZC 1C2TA 1BS2A 1YZNA 5ERXA 3WKEA 1JZQA 1X7ZA 2D13A 5FDFA 3OU7A 621PA 3B1ZA 3TM5A 4I1PA 3BH6A 2I54A 3D8BA 4RM3A 5HQ3B 1BWRA 3WK5A 1WO8A 1YB6A 1QAMA 2AFRA 1K89A 1W30A 1LLDA 3DT9A 3QU5A 3SYNA 3LDFA 3K8YA 4FFNA 1NR7A 4RWEA 2IWRA 3WLTA 2HUPA 2HMTA 1NV9A 1NZFA 2BCJQ 3T0GA 2AN5A 4YREA 5C80A 1TWHA 3TQRA 3IPAA 2BBSA 4DMHA 2Q1SA 3FCSB 2XMBA 3PE4A 5E1MA 4O33A 2IIQA 3SJZA 5DQHA 3RK1A 1PYGA 4OYHA 5LZ8A 5B7PA 5I48A 1C14A 1QRSA 4FFLA 1EHYA 1LVHA 1Z7GA 4BMCA 2VZLA 2AC2A 1RLMA 5LXTA 3EQ2A 4TYMA 2EJCA 1VSUA 2B5OA 3K72B 1IDN1 4RULA 3COYA 3BL5A 2MINB 2C59A 3C2QA 5DVZA 3PXCX 2G67A 5ER9A 2VJOA 4L0CA 4TMZA 4FMPA 1YUBA 2P4HX 4C1NA 1LJLA 1GZDA 2BTQB 4QIWA 1Z45A 2FUEA 3FUCA 3K0HA 3ND6A 2Q2VA 1RXVA 1KI3A 2FQ1A 1A8QA 1MOSA 3AR8A 3OQIB 3MFHA 4B3SB 1LDEA 2QD4A 4MVYA 4UKDA 1L2TA 2PKQP 2WICA 2DPIA 4QT4A 5FLMG 5ELLA 4PVCA 2A9PA 3AUTA 3PX3A 2R6ZA 2CW7A 3M4IA 1UFVA 3DP7A 4L5IA 2ZW9A 4NECA 1KJWA 1XCJA 3CPJB 1BMFD 2DPMA 5DXFA 1NBWB 4YAUA 1ID1A 3I0NA 3T7AA 4TZ0A 1BWPA 2EW1A 1K5HA 1J22A 2AL7A 3F4KA 3O2QB 1FL9A 2V9WA 2VSOA 3LQRA 3IFSA 4CF6A 3RYFB 5J2UF 3FTCA 4KQ2A 3GZNB 3PGLA 3U1VA 5EMJA 4BUZA 4DCUA 2PWBA 5B64A 5K8UA 1JKMA 4PCUA 4RLQA 4NXMB 4RETA 3WYNA 3H1PA 4GZMA 4WY8A 5DQIA 1C7EA 1MD9A 2VDQB 5A3QA 3JRWA 1I51A 4IF4A 4YK7A 4DABA 2Q29A 1N36H 4XWYA 2ORVA 3HCOA 3MJHA 2VH2A 3LJKA 4HN2A 2EP7A 1YQDA 3H75A 1UEJA 1MTZA 4LH6A 2Q9UA 3PO2G 1KETA 1ZR4A 2J0EA 3A70A 2HJRA 3HOYG 3EVAA 3Q3JB 4MHSA 4HNVA 4UM9D 5AUQA 3U4HA 4REQA 4DDHA 5TGZA 2HHHH 2ZYDA 1UZLA 1M72A 3W8RA 1CPYA 3QVGA 2BF7A 2F1HA 3U1TA 3GDGA 1UPBA 2OHGA 5DIZA 1DX6A 3OAAD 3ZK9A 3ZLJA 1NMXA 1OC2A 2WDTA 3G9TA 3RF2A 1GO2A 2BM8A 2F6RA 1PX0A 3LXUX 1FYDA 2IGBA 2Z8YA 2O8DB 4X3OA 2I9PA 1F14A 1KZ6A 2QRMA 3A3PA 3GN1A 2REQA 2PLFA 4OA8A 5HGXA 1FLVA 4AKIA 4D74A 1XMQH 1P45A 2HXGA 1XTVA 4U2DA 2IUFA 4OSOA 2GN6A 3UH0A 1LA2A 3A0UA 5DN9A 5K51A 5KAMA 4PO8A 4F4YA 3ECSA 3T3NA 1J21A 2DFDA 4YMHA 3WNVA 2BISA 2OA0A 3HOVG 1CKMA 5KT6A 1JKIA 2GTHA 3UIEA 2BEKA 2GN8A 4K2AA 1LSUA 4H0FA 2GZDA 3PEUA 5DM1A 4CF3A 3ACCA 3IJRA 4F7WA 1L5OA 4C5AA 4NMWA 4OEHA 2R5NA 2XC9A 2Q3LA 2F4VB 5KFBA 5IKOA 4R2HA 1HOTA 1N36B 1QG0A 2QVZX 3QVXA 3WLMA 1PZHA 1N6OA 1CKNA 3C7DB 3WMWA 4HLCA 2C7QA 3AVXA 1MHPA 3CURA 1QHHA 4IDPA 5HKLA 3MCWA 1A4UA 4LY3A 3ZH2A 5I9IA 3IHWA 2FG7C 5KB3A 2GVDC 2QLTA 1Q2UA 2ZE7A 4MVJF 4NSNA 4C6SA 1Y33E 4BNYA 1DBPA 1L7NA 3QHQA 3KEFA 1L9KA 3LWBA 3AZOA 1FP6A 4RJKA 1OBDA 2OC9A 1JL3A 5CA0A 5KOHA 1HV8A 3W4JA 2QW0X 4S04A 1WEKA 5HOEA 5E9WA 5HEKA 1A9RA 4RK0A 1YK0A 1QZZA 1CK4A 1U3DA 4FFBA 4C2BA 2QGNA 5GZ3A 4YPOA 3FA2A 1UC4B 2W43A 3OTOH 1K75A 5TNXA 4I9UA 1NUSA 4CMKA 3HNPA 1ECFA 2XODA 2DPYA 4KX3A 5DYIA 1C9EA 5IYDG 3C3PA 4QLOA 1KPIA 2JCXA 2R44A 4PEVA 3ZI7A 4IDDA 4YV2A 1A4IA 1NPTO 3GUVA 1QPBA 3TIFA 1P1CA 1NW7A 3KZXA 4NG5A 4MUMA 5A02A 1FKAH 1MC8A 2A59A 1FXWA 1E1KA 2AMVA 1TC2A 4N8DA 3OZAA 4PFKA 4WN3A 4YXWA 1OC4A 4F6CA 5HUJA 2WB1E 3OMWA 3BQ0A 1E2LA 4UD2A 3ZHCA 2C03A 3LIPA 3N2ZB 1U0OC 3DEHA 3WBBA 1DTSA 1Q0QA 1VJ5A 2OAEA 1Y8QB 2JBHA 2QZ9A 3RW9A 4UVEA 4K9SA 2C4UA 1YIOA 4ECYA 3N0WA 5KFIA 1OLXA 1RKXA 2D4AA 2FPWA 3UMSA 2CLFB 1EK5A 2V98A 2ZGIA 1INLA 3C15C 5HF5A 5FCDA 2C7VA 2D0IA 1GGOA 1HYQA 1OILA 2MSCB 2P91A 3BOSA 4AYBE 1C80A 3EPJA 4G65A 1L5NA 2IYOA 4TLDA 1C0KA 3DL2A 3UMFA 4DA8A 2V8OA 3LHSA 5IJZA 3SIPA 1KA9H 1QBKC 3DXYA 3STYA 2YQ5A 4H7KA 4EG3A 5H9WA 2HA5A 5BV8A 1EFCA 2R7NA 2IY7A 4QBKA 1CQXA 1JXLA 2Q9BA 1JXAA 4Q05A 2FPMA 1U2QA 3KTDA 1KEVA 3PYMA 5NLLA 4ZO6A 3BJYA 3G0DA 3FIJA 6LDHA 1OBCA 1Z6ZA 3UV6A 1WBJB 5F7XA 3AR2A 1V1RA 4MGKR 4REMA 3RNLA 4EA7A 2HPHA 1X1EA 4L51A 4DRXB 3SPXA 1OFVA 3K0FB 4Y2TA 4P5PA 1FBTA 1IBLB 2F8LA 4UQLA 1JIKA 2D7CA 1G0NA 1YC2A 1RJDA 3HABA 1G59A 1M6YA 4ITVA 4LX0A 5HZKA 2RD2A 2A1UB 1BQ3A 1KRHA 1O97C 1V5WA 3CR8A 3N2NA 2CFTA 1RAFA 3SHTA 1Y9EA 5K0LA 4UCVA 3QY9A 4PGMA 4D79A 2OYCA 2PUGA 3OLCX 2QVXX 1QOPB 1KWGA 3C14C 3ZD6A 3NBMA 1UK9A 5JVDB 3QEAZ 3JTEA 3THWA 1S0NA 4JBYA 3MUEA 4M37A 5D87A 1PEKE 1P2FA 1O5IA 2ENWA 5KPJA 2QX7A 4RY8A 5AHXA 1YOBA 3B51X 2X7JA 4C7XA 1CF2O 4H6VA 4RDXA 2APJA 3ZBQA 1TX4B 5DULA 3CH5A 4EHIA 4WTOA 5EVCA 2ES4A 3CVYA 1KI2A 1M3SA 2BEJA 3A05A 3PD7A 3Q3GE 3QPAA 4QPDA 1J5XA 3P20A 5JTTA 3A0RB 2ONCA 2JVKA 1I5EA 3U44B 1PL6A 3D8SA 2O5RA 5FTLA 5HGJA 5KFAA 1JMYA 1R3DA 2JRLA 1QU2A 1M2EA 2PQ2A 5L4LA 3L4KA 4S12A 5LBUA 3OICA 1K3TA 1L8AA 3OZTA 5K8CA 4MV9A 1Z26A 3Q7QA 2GH1A 5ED4A 1WOMA 3OWOA 5HJEA 4G81A 1XDWA 4A8PA 5C5EA 1PI3A 2C0CA 2FW1A 1I1QB 4ZOAA 1J4AA 5DBEX 3GMDA 3HJBA 1VPWA 1JDVA 3WTCA 4TL9A 4A6XA 4PV7A 5A5FA 9LDBA 5I7AA 2RGXA 3S7ZA 4CL2A 4DXDA 3SQXA 5BNZA 5C53B 2FTKE 2POCA 4G3XA 3K70B 3CVJA 4O1MA 4CNBA 2B8TA 3ESZA 3ILSA 3LLUA 2X0SA 1RI5A 3LZDA 1QVWA 4KVGA 3S2IA 1ABFA 1V9SA 3PR4A 3DFKA 3R7DA 4RSMA 2ZYAA 3HA2A 4DQXA 2IP2A 2O7VA 4B3TB 2QMQA 5BVHA 2B6HA 4NDZA 4PICA 4YDRA 1SHJA 1NAIA 5F76A 2ZYHA 4P3PA 4QOFA 5KFWA 1OD6A 2R6JA 2JJYA 1Y9ZA 1MRNA 4HRAA 4EPVA 4B46A 4LXGA 4TXHA 5FWNA 1MENA 2CVHA 5ARBA 1A5SB 4RB3C 5LL6b 1S0OA 2NO0A 2ZWPA 1P29A 4NBLA 2G6BA 4JP2A 2ZQZA 4P8RA 2PLRA 3FPKA 4L2IA 4Y2GA 3KUKA 4IMPA 3D6UA 5K0NA 1CE8A 4G07A 3FD8A 3HFRA 4UUQA 4O4JB 4QNRA 5SICE 2BLLA 1Z5GA 2ECKA 1T5BA 2QA5A 3LO8A 3RSQA 3OZWA 3PBKA 3BXZA 3W9UA 3SHFA 5CLFA 1LF5A 3OOEA 4Z9YA 4DV6H 1G5IA 2O0LA 3DZIA 5JSHA 4H60A 4DL5A 2NU7A 2AQ4A 3B52X 4ENRA 4DLAA 4H3VA 5IJ0A 3QKWA 3L1IA 2GYVA 2SNIE 3O4GA 3BKXA 3HXPA 4YCSA 4AULA 1FU4A 4MV3A 4HVTA 3W34A 2J4CA 3TB6A 5CH3A 3TVDA 3CGGA 4A2CA 1I7SB 2C2OA 1F0YA 1PT6A 1PKXA 3P4XA 4RAZA 5EN4A 3SEFA 3GK3A 4Q01A 1FJGB 1DAHA 2WYUA 2QP9X 1NJSA 4P54A 5LP6C 3F8WA 1PBTA 3HVIA 2WFMA 3KU1A 1SM4A 4DT1B 3AO0B 2CNBA 1PQWA 5I9MA 4LXTA 3NT5A 1H94A 4CODB 5JNVA 2XKBA 1QB7A 3L43A 4F8YA 2H1WA 4HWOA 2HZ7A 4LY0A 1ZI9A 3WRYC 5BN1A 4LZJA 4X1KA 1VKZA 1G2IA 2ZTUA 4PR3A 5JXJA 3Q7SA 1AO3A 1UMCA 2DG2A 2IY9A 3CN7A 2XUPA 3B6EA 3D1LA 3DZBA 4MQ6A 1Y14B 2PZBA 3KWMA 2D54A 3FOCA 4BZPA 1IONA 3LPNA 4CCAA 3PDIB 1O6CA 5IFLA 2R6DA 5AW1A 4R01A 4J0IA 3N0XA 2JA5G 3AQ4A 5ECGC 5KJEA 1VP9A 3DSRA 5IULC 2PH5A 1N7HA 3LHFA 4KSYA 4P5DA 3MT0A 2W58A 4JP8A 1K7CA 1R4MB 4HN4B 4DJ5X 4RPKA 4WHXA 3GL9A 2Q6OA 3OU2A 4HGOA 4KC0A 5BNWA 5JY6A 4J2OA 4BE9A 4E7PA 4D9NA 1S2GA 3TSAA 3GIPA 4WSOA 3SNHA 1RQGA 2QT9A 2ZWVA 3DBRB 3DXFA 3K8ZA 3OQ1A 1G2PA 4H0CA 4OQDA 1C8BA 4HS4A 3TQHA 3PXBA 4RY0A 2R85A 4MR9A 5KJFA 1YJBA 4O3PA 1EDZA 2LDBA 1CKNB 1GYFA 2Q8NA 4IRDA 1WNFA 4M1TA 4COKA 1NI4A 4E2XA 2ZPUA 2B7BA 2Z95A 5G4KB 2Q4EA 5J5AA 3UK1A 3AR4A 4BNVA 4EEYA 4U6QA 1KP3A 2O1WA 2L2QA 3BD8A 3ZUPA 1YF3A 3BREA 4N5DA 4KIGA 2EJUA 1YHYA 3P9SA 3WV5A 2IEGA 3PZRA 4DQUA 4N8SA 3BJMA 1L5WA 2WVGA 3FTNA 4IIUA 3L2PA 5JFGA 1PTKA 2VHUA 3OUUA 1DO2A 3H5OA 2ZPAA 4LWZA 4JI5H 1RZRD 3QVMA 1WD5A 3ZXIA 2IY8A 3OZRA 3LWNA 1H1LB 4P7GA 2VATA 3D4PA 3Q88A 3TE7A 3EPGA 3TIVA 3UWSA 4CM3A 4OHZA 4Z4QA 1ZM9A 1SPBS 2IOQA 2Q9CA 3TNLA 1KFEB 1ZGZA 1TZBA 1ZZGA 4DV7B 1G17A 4NICA 2V4QA 4KXQA 3S0JA 2F90A 2V6MA 4BU0A 2QGZA 5I7UA 4F2GA 3IALA 3T1YB 4ABTA 5F9HA 1M6HA 2O8FB 3ZCQA 4RVNA 5HBRA 1S10A 1E5VA 1QH9A 4MRMA 2VTBB 2L42A 1SQFA 1M6VA 1WPGA 4Y9UA 3LWZA 1XLWA 1XMQB 1FZTA 1C1YA 3IG0A 2H17A 2Z4SA 1QHEA 3GWGA 4LAFA 1I3KA 3CT4A 5CM8B 2C28A 1MVNA 1V8PA 1M83A 5EIHA 1TVKB 3VZPA 2VQSA 3Q8XB 2C8JA 3KYCA 1RP1A 4JASB 2ZK7A 3H9CA 4NPHA 5DTJA 1N1MA 3MYRA 1JQLB 2WU4A 4YNBA 3TTWA 3GLIB 3F7OA 2R751 2YVQA 2R6R1 4KN8A 3N2GB 4GVPA 1C4XA 4L2IB 5CB4A 1P7VA 3A27A 3LMLA 3NPMA 4V0MA 2P69A 1UKZA 5FFNA 4TLMB 3ZVNA 2XWQA 3OEEA 4MCIA 5MDHA 2UVPA 3KZMA 4AZ3A 4ITUA 1NJ1A 1SXIA 1SXJC 4PSAA 4RPIA 2WP8J 5CW1A 4DLPA 1ESMA 3O94A 4YRPA 4X62B 2NN3C 4NESA 4HEQA 1VMAA 4LA4A 4CGYA 1SBCA 1ZXLA 4UPEA 4ZANA 4GPEA 1NJ8A 1I4LD 1CETA 1ZCFA 4RCNA 2XJ9A 4JBGA 4FLEA 2IT1A 3VPDA 3EXHA 4F4WA 1D6JA 2QRKA 3DEFA 3GFVA 3GLHA 4Y98A 3IMCA 3WFIA 1ZGCA 4GYJA 2O1SA 2J32A 2FPPB 1QFXA 4KXFB 4APMA 3LL7A 1R37A 5J9FA 4IOMA 1I3OA 2C9CA 1KAQA 1P8LA 2PS9A 5A1TA 1D7AA 2WBLC 5C52B 3ETDA 1KY5A 1RPJA 3R5JA 4JYBA 5C9ZA 1NN5A 3NBXX 5F5XA 1DC7A 2VSXA 4W5WA 4NZOA 3ONNA 2UKDA 5JYDA 1JDPA 1XAGA 2CJYA 3B82A 3CF0A 3F49S 1C8KA 4A5OA 2PMFA 4EBBA 1D9ZA 2BFNA 1CF9A 5FORA 2ZDHA 1Y5MA 4L3OA 1RQLA 3F78A 3CH4B 2E3JA 2QM7A 2NYAA 2DFLA 5EZYF 3A6KA 2J0VA 2FSGA 4G5OA 3PF9A 3GDFA 3NTLA 5LZ5A 4YUWA 2CLDX 4XD2A 1AKYA 4J0EA 4OKSA 3N2YA 2QBYB 1HKHA 5KYNA 2V03A 4BNUA 3VZRA 1TO1E 1II8A 3BFXA 4XGIA 3RBZA 3REFA 2WHQA 4ARZB 5CK5A 2AKEA 2FN7A 3RYCB 3D6TB 3ZU2A 1Z8FA 2CDNA 2ZREA 4M38A 3WV4A 4QWDA 1XNRH 1GXSB 2QL7A 4LY9A 1ODCA 1EFUA 3GBSA 3GELA 4V3CA 2EQ5A 3VNNA 3SR4A 1BWQA 4DMCA 1Q2XA 3CF2A 3L1HA 2H16A 4HZGA 2GPJA 1AKUA 4R54A 2XNDA 4JV5B 1WXDA 2VRWA 2NMVA 4WK4B 2M32A 1P9OA 4DR2B 2B30A 3W6UA 5LQMA 3U7GA 1QE5A 1YHZA 3THRA 4P93A 5JPDA 2QD5A 1V71A 1VCOA 3CISA 3WYBA 4JKIA 2D2XA 3GGCA 4G2TA 4EKGA 4CF4A 3LX5A 2J5RA 1IQRA 1GUYA 1RQ7A 4HD8A 2XCAA 4C7MA 1YTLA 4Z4HA 2WYOA 2OO5A 1I1KA 4I50F 1EGHA 1QPGA 2GZSA 5D2CA 1PNVA 3E9NA 3R0QA 4RUCA 1X1RA 2JCBA 2HSJA 3GD5A 3AL0C 1THGA 3EZ6A 5DYNA 4A8JC 4M1EA 4I7EA 1NXWA 4NOJA 5FPPA 4P0PB 4WBNA 2QLBA 4R41A 1BN7A 3DDZX 3I9FA 4DV0B 4EY5A 4LECA 1U3GA 1MJGA 3TTXA 2H2FA 1RS0A 4ER0A 1D2GA 5EC8A 3RVOA 4ETSA 2Q3HA 4YP3A 1ONOA 1W9MA 2O8BB 4HYQA 1OIXA 4QDJA 3U37A 4O3OA 1WBDA 3AJEA 1XTUA 3N2IA 4KXYA 4MQEA 4S1OA 5AIBA 1QFYA 2AR7A 2RGWA 3MR6A 4GI2A 2W2NA 4QGGA 2Y4OA 5H02A 1RQPA 3V1LA 2IEIA 4OX9B 2XXAA 3S4YA 1YXMA 4FHDA 4BKUA 2WTUA 1MQ9A 4B5KA 1Y3DE 1I6KA 3P9YA 3SJAA 2QVBA 5BMVB 5HILA 4N1AA 3CCCA 4WY2A 3VU1A 3PEEA 3GA0A 5I45A 4KPEC 4JQZA 1YR9A 5JQGF 4DR2H 3IT0A 2GWHA 4EG6A 3HU1A 5G0WA 1D8TA 5AVVA 1E2BA 4DR6H 4EW3A 4S05A 1J8YF 1I01A 2EIXA 3G9UA 3N2EA 4HB0A 3SXUA 4TZ6A 3M3PA 3ONWA 3HEAA 2EX0A 4HEJA 4XZ3B 2PS1A 1NOKA 1T5DX 2QY9A 1LXCA 4QRHA 1ZOOA 1XPUA 4K9NA 2FFHA 2WHEA 4R84A 3KB2A 1NQ5A 4G9BA 1ADCA 2CQYA 3M34A 3K8OE 1OXUA 4O7LA 3Q3VA 1SC4A 1YQUA 4RTRA 2AR9A 5LMNB 2ZUUA 3FRIA 1OHHA 1VM6A 3OY7A 4LZLA 3ABRB 3HKDA 5K2OA 1Y1VG 1LV8A 1Q14A 2QLLA 3FNRA 1E66A 4WK2B 4HAVA 1JXMA 5M2QA 3V6HA 3V6LA 1KT8A 1TKAA 2NM0A 3NQ41 3UHFA 1NG9A 1HNNA 3N1UA 5JYCA 4I99A 2FH5B 2OV2A 5J3JA 1RAEA 3LU1A 2R87A 1E6KA 1SCBA 3FJYA 3OM8A 3OVMA 2XZPA 2Z5GA 4OM7A 4Q03A 2DX7A 5D5QA 5AT1A 1JEDA 4UZEA 5TQ0A 2W9BA 3JQAD 1P7CA 1Y8ZA 1T2EA 2ZRBA 3AYHB 4GD3Q 4GECA 4LQDA 2X0FA 4C4AA 1MB3A 5TVKA 3V1UA 2HJWA 4IMJB 1QAQA 3QY0A 3JSNA 1OX6A 2R6GA 2BUBA 4R7ZA 4BXOB 1GVHA 5FPSA 3HR7A 2PGJA 2YYAA 1KI6B 2HRRA 3DKKA 3KCNA 3A1DA 4ISCA 2UYYA 2IV2X 4JQCA 5KYKA 1FFYA 1IAQA 1GZHB 1N6HA 2Y0PA 3FFTA 1POWA 2W6OA 3HJRA 3LPDA 4GRIA 3ZHBA 4X54A 4XFKA 4A0SA 1ZUNB 2BIFA 1QGUA 4J9MA 3TRFA 1BYUA 1G38A 2WU0A 2OP0A 1K06A 5GZ6A 2ZCVA 5LZ9A 1X7XA 4P82A 1RLUA 1ET0A 2YBDA 3MT8A 4HNGA 3UG7A 1RWXA 3ZKWA 2W93A 1GPKA 2QX8A 4LHEA 2V7GA 4M49A 2ZJAA 3DQQA 3KEQA 4ZCPA 4DUYH 1K8RA 1V16A 2VHTA 1LS6A 4MARA 5SYAA 1KOLA 1OBHA 2PUBA 2D1FA 2W2VA 3ROTA 1Z2EA 2VHEA 3EDYA 2CUNA 3HGTA 1M5UA 2XOXA 4MI1A 1FBNA 2W6JA 5LQCA 1YVPA 1TQ4A 1XAHA 4D26A 5BT9A 5F12A 4BNZA 2A86A 4HH1A 1JFRA 1EB8A 3ZU5A 2DBYA 5LR6A 4LDPA 1WB6A 5DNYB 4BMYA 3QOXA 4ZMRA 5GPBA 5B58C 2UU9B 1BEEA 2GPBA 4YB8A 4NDAA 5D3MB 4YAEA 2OWOA 3NBUA 1XP8A 1KZHA 2BEWB 4XJVA 5AW2A 1HO3A 2JHAA 4O3NA 4IEIA 3FCXA 3N07A 3A32A 1SKMA 3WMXA 1AM4D 4IDGA 1QQ5A 1EMDA 1QJCA 2RAVA 4V3BA 5DOZA 4LJ8A 3MS4A 1C3JA 5L7WA 5KQGA 1N92A 3EISA 4B7ZA 1E0KA 4CHGA 1EFKA 1NU6A 3TOVA 3PVZA 5REQA 3FG9A 5J4YA 4O7YA 2OXCA 5TMPA 1BDHA 2NVUB 1KUTA 1AQLA 4ZC1A 4KR9A 2WB2A 5EWMA 3ZDXB 4G4IA 4XQ9A 5EWEA 2R65A 1QBGA 2ONJA 3EBPA 4RB0A 3DPUA 1FFHA 3EZNA 4FC7A 1CV2A 4BO9A 2AHOA 4DCNA 2GEVA 2DKNA 2A58A 2X9VA 4LF7B 2AF4C 2I1WA 2ZG6A 1UCFA 3DH0A 1I13A 9GPBA 3NMUF 1IG3A 4CC5A 1CB0A 4EO9A 2O23A 4TS4A 5HK9A 3L8CA 4YUXA 1KY2A 3WNZA 2EXXA 1YMUA 4EB0A 4DRFA 1EG7A 3S29A 3MTQA 1GG2A 3VNBA 3EZLA 1ZU4A 1RT9A 3SLRA 2VYFA 5A04A 4F72A 1XZDA 1YFZA 3DMGA 3N6XA 4QVKA 2XZTA 2DBZA 5BQXA 3DE5X 1R8YA 4IGFA 4HEA1 4A03A 2WYHA 1UJ4A 4P3YA 4NYMQ 3WSWA 2YWEA 5KHOC 3IYLW 4LMAA 5L1KA 1JIUA 4PAGA 1XD8A 4E31A 2XXAB 5I4CA 3JALA 3MIZA 2DAAA 4HFMA 1KJJA 2BVNA 4L4SA 1U5BB 4LMYA 3BQ1A 4IDOA 1XFAA 4JIGA 3TK1A 5A3RA 3TB4A 4CCYA 1DAMA 1RHQA 3VSBA 1UBSB 3MWYW 1TLTA 4DCGA 3MT7A 3T1QA 4FI3F 1CUIA 2R93G 1G291 3Q12A 4FFDA 4BMNA 1D2AA 2J0QA 4PIMA 4BVJA 5DM0A 5AW9A 3ZVMA 4N3BA 2V74B 2ZU6A 3SU8A 1CKOA 2FG6C 4KAXA 4WUTA 4ZHQB 3HYNA 3O83A 1GGFA 4CM8B 4FP9A 1LU9A 3FHOA 4NBSA 4OJMX 3SDBA 1S3FA 2NOAA 4ZOLB 4CN8A 1L4LA 4N5IX 2GCIA 5ITZA 1Q0RA 3RKSA 5AKJA 2O7NA 4O8CA 4JJFA 3IAM6 1TD9A 2B4AA 1TU3A 3DCIA 2BQRA 1Z22A 3FWHA 5JCOA 2E82A 4U02A 5JEEA 5EOVA 1JQKA 3C97A 4LDZA 2W83A 1P44A 2O0MA 3FPJA 3JQPA 1HURA 1AK2A 4DSTA 4ZQEA 5IP9G 2O9JA 3BMCB 4BFSA 3MZ0A 1Y7TA 3DKIA 3FPSA 4PLTA 2NXJA 4HBZA 3FBGA 1DX9A 2A9KA 2C4NA 3F6EX 5KG6A 1NHGA 2Y76A 4JYMA 3FF1A 3CZPA 1UWKA 3OIFA 4GQIA 5HKOA 3RUHA 4MHTA 3BIWA 4Z9AA 3C8UA 3DBIA 1L5HB 2MU1A 3KYJB 4TL7A 2DQZA 4H4DA 5H68A 4CEHA 2IYLD 3ZDRA 2Y0SA 1NUTA 3A6GA 2RAPA 4V2UA 1WDKA 2QTMA 2QX6A 2A1HA 3ZR4B 4BCDA 4YB8B 1FW8A 2O3SA 4L50A 2EP5A 1EGAA 2OGUA 4MGIR 3PUHA 1DEHA 3PPWA 3ZGOA 4IH9A 3PXAA 5LYYA 4QUDA 4AJEA 1FVOA 1B1CA 4TV9F 3R09A 4XYEA 5C18A 4KKXB 4X92A 2IPMA 3A31A 3OC0A 2ATIA 1P7PA 2C9YA 2ZUBA 2BTEA 4S0XA 4TTJA 1QTRA 4E2YA 2MR6A 1YA8A 4GR4A 1MTOA 3PYLA 1NIPA 5EEHA 4DMFA 2OVFA 3LGAA 3DQZA 4LXYA 2CMHA 2IUTA 2MYTA 3M2PA 4OJYA 2FCAA 1DKMA 2J9YB 2JGDB 2VDUE 1NQAO 1Q22A 3BHMA 3TF5A 1C29B 4B83A 3QEKA 5T6MA 2BI8A 5CDFE 5E2IA 4QTXA 4WKOA 4TV8F 1UC9A 1XZIA 5FBVB 3IO5A 3KQHA 3CHYA 3A2NA 3MTBA 4D3FA 1CUYA 3OE4A 4E14A 5JD6A 3W6OA 4GGMX 4MP6A 3B2NA 4IVNA 3C5CA 2OXTA 2RFLA 3ZY4A 1W1IA 5C7LO 2GHQA 3RGZA 2VJLA 2GBIA 2HPZA 4YP1A 3DE0X 3PFNA 3R7WA 2GEJA 3RB8A 4B44A 4EO4A 1GPDG 4YR7A 2WFLA 1H3NA 3QPVA 1GGJA 3B1FA 3MJ4A 4TT3D 5T4EA 3IL2A 3N2GA 3LBNA 2XT6A 4DV2B 1ZKDA 1TZJA 2P2DA 5FO1A 1CU1A 2SKDA 1RTTA 2WAOA 4GI5A 3ID6C 1YS2X 4QTYA 3WWIA 1OI2A 3DT6A 4MVJI 3R40A 4Q48A 1DEAA 4LGYA 3U7RA 4D9HA 1QCYA 4RTJA 1YRHA 4XYGA 3TUIC 1M76A 3ZJTA 2F64A 1W49A 4KZKA 2WRZA 1T1RA 5G2OA 1GVNB 4HDMA 3GDEA 5LMUB 2Z04A 3LA6A 1J20A 3S2YA 3IB6A 4H15A 4M0JA 4LDAA 4KQGA 4UDYX 4A8TA 4Q1DA 1UANA 4H17A 4ZO7A 4ZVRA 1Y8AA 1QPZA 2RCYA 5CX4A 4C04A 5JCPA 2BLNA 1DADA 1XVTA 4UU8A 4PSDA 5HMLA 2QSJA 3QXGA 4IMRA 1JXQA 2VQ6A 2ECQA 2YC2C 1DE0A 3W5SA 1U2PA 4U2FA 4E21A 1EQUA 3EMBA 1T9DA 4XKJA 1COWD 2QLFA 5AHRA 3U7QB 4BO5A 3IAM1 3RLIA 3SEAA 4C08A 4BPRA 2W2TA 4I6EA 4F3CA 2HT1A 1TIPA 4TN5A 3DT8A 2JJMA 3ET5A 3PXXA 3GMSA 3CMMA 3OX4A 4GEGA 1QUEA 2Q2NA 3DS8A 3MWKA 4NF2A 5EL0A 1EKVA 1JS1X 1HRDA 2XUFA 3EOAI 3W3AA 2VSNA 2DR2A 2NACA 3IQGX 1E7YA 1SIUA 4BNHA 4K6NA 4DJFC 2BKEA 1FVHA 4TGLA 3H5WA 4NPAA 5DOVA 5AR1A 5KFXA 2CFIA 1L7RA 3L7KA 4B3GA 2HT6A 2FEAA 1WH2A 1I2BA 1VQ1A 3GIKA 1NBAA 2KMLA 2QV0A 2ZE8A 2QZPA 1NMYA 3K35A 4F5WA 5CYOA 3PUVA 2C42A 4BWYA 1UFQA 1QVRA 2QVCA 4QASA 1YR6A 2QTVB 1UMDB 2XRMA 3NHRA 3P71T 3RB6A 2PZEA 2I03A 2IZ1A 5ISMA 3W5BA 5ELXA 1JN0A 1PNTA 4JC5A 3TNFA 4B3MB 4MV6A 4TVIA 1B6TA 4Q1AA 3TBFA 4O29A 2WI8A 3CW2A 3P9IA 2HGZA 4GM1A 3WBKA 4ED2A 1JHOA 3OF2A 4PG4A 1DAEA 1X1DA 3Q6MA 4I4TA 4BO4A 1WHTA 521PA 1KZYC 4I14A 1GL3A 5HIAA 1TTQB 1ZL0A 2R1VA 3GPBA 4M2LA 4MTLA 2Y4NA 3GFFA 3INNA 4L57A 5BN4A 5KSYA 4UUAA 1QB8A 5DM2A 8OHMA 2QRQA 4B2YA 3A4VA 3L01A 4DADA 2C1EA 3IQIX 4ZGGA 4P84A 1XRJA 5KFEA 4G0YA 2ODTX 1DAKA 4A3LG 3K3VA 4J0CA 3MW8A 5EJ6A 1EVJA 2X1LA 1OB5A 1IEXA 1EESA 1Y5LA 3CV3A 1SXHA 4LYEA 1RWOA 2GPNA 1IZZA 5LMCA 4MITA 4Q93A 5BORA 1JFFB 2YCLA 2VSFA 3TY5A 1CQIA 3OJ0A 4DT1A 4PF1A 1QE3A 3KO8A 1SKBA 5EWGA 3ZYZA 1UL1X 4KKVA 2XYQA 1JYSA 4YCNA 4QOHA 4CKEB 1W4LA 2GN1A 4ILEA 1I0ZA 3DZGA 2A1TS 2CF5A 5FV4A 3D02A 1W5TA 4Y2RA 1BHSA 1U02A 5TT0A 4N82A 5EE3A 4HNAB 4ZXPA 1N0VC 2IVZA 4UVGA 2DIKA 1GYRA 4F7DA 4QSHA 3ISJA 1JB9A 1OX4B 1M0TA 2QMZA 1EVEA 1E92A 3IUPA 4FVTA 4UHBA 1KI9A 3F6CA 3S2SA 3JAKB 5E1OA 3IUNA 3SQWA 3LPMA 1S7CA 1COZA 5GV7A 4YFYA 3AKEA 4YRMA 5CCEA 2GK4A 2BHSA 1C3VA 5CDGA 1DG1G 1OASA 2ZOSA 4TX1A 2HSDA 4EWLA 4R31A 1DAFA 5F2NA 2YJ6A 2AGVA 1T4GA 3PGXA 1HE2A 2XNSA 3M89A 3VR4A 4A23A 2OE2A 4GLOA 3UOGA 1E2HA 1OWPA 3FF4A 4J4BA 3RVNA 1NW5A 4MQ5A 5FTKA 3WGVA 4LOIA 4IUCS 3T4EA 1Z2DA 1Z4QA 1JX6A 3TZKA 3OBIA 2VBIA 3H1EA 3U26A 3PV0A 2I8AA 3IUBA 4WNAA 3MR3A 1GNVA 4E5YA 3NOOA 4OHMA 2GJKA 4ZI5A 5CXUA 1LDNA 2EBFX 5D1OB 1C7IA 3JQ8B 1KQ3A 1HF3A 4LTMA 4BYMA 2ZI6A 3FKJA 4AY6A 2L69A 3WX0A 3DNFA 1MXHA 2ORIA 3G2NA 4YRBA 2GEBA 4GZ6A 4XWGA 4RKYA 4IFEA 5KTRA 4P3NA 1VCNA 1OWMA 4YR2A 1BJRE 4RBNA 5G0TA 5T7BA 2JB9A 3UUWA 3DHYA 3QOWA 3EDCA 4L1KA 3GOQA 1M5RA 1SWWA 4YAGA 3B1VA 5KNBA 4A26A 3OFNA 1N6NA 1U7DA 4FFWA 3ITKA 1IHOA 1ZJZA 5B2ZA 4QPCA 3TY9A 3LNTA 1P6XA 2J46A 4KE7A 4TROA 2MOKA 3RJ5A 4ENUA 2KPOA 3QW2A 4UCSA 1Z6PA 3KDSE 3DO8A 4G4JA 4TVSA 1R0RE 4DNPA 2PSHA 1GN8A 1L5QA 1QH8A 1LPOA 3ZDZB 2XYRA 4W99A 1R0WA 3CUKA 3DEJA 4PZ6A 1KVQA 1XNJA 4L0MA 3LBAA 2OFFA 1ZC3A 1D8AA 1SVLA 2V3CC 2BMJA 3NC0C 3A6LA 4EFNA 5A4DA 2G7ZA 2NUPB 2IK8A 3T52A 3A1EA 3L04A 2P2CA 2P35A 1ZVMA 4Z7OB 3C98A 1RQNA 3UJ6A 5AICA 1YE3A 1YS4A 5JWRA 5TPWB 1NDHA 2GUGA 4NCJA 3UYKA 1XD9A 3F8NA 1SCDA 1O5TA 1E6WA 3PX2A 3T7RA 3ZD8A 3O9VA 2LDXA 2XMQA 4UE2A 4M87A 1JG2A 4HMQA 4Z4CA 4YS6A 1BX0A