2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
molecule keywords D-alanine--D-alanine ligase
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
1KBLA 1C30A 2Z04A 3U9SA 3E5NA 3RV3A 4FFNA 1KUTA 2HJWA 2V59A 5KX5F 1KJ9A 1EHIA 2Z02A 4M99A 2DZDA 2VQDA 1DV2A 5C8YF 5DMXA 1B6RA 4IZOA 1KJIA 2W6OA 3G8DA 1PK8A 3U9TA 3BSYA 3R9RA 1I7NA 3SE7A 2X0SA 1Z2NX 2YZLA 3JZFA 2W70A 4EGJA 1E4EB 2OLSA 3KALA 4IWYA 2YS7A 4EAAA 1W93A 3OUZA 4FFMA 4I55F 2W6PA 2NPOA 4MA0A 4MV1A 4Y8VB 4YAKB 2IP4A 4GGMX 4WD3A 3KAKA 5BPHA 2VPQA 1EYZA 4C5BA 3AW8A 1W96A 4I4TF 3MWEA 3Q2OA 3R5FA 4FFOA 4O83A 2W6ZA 4FU0A 1C3OA 2W6NA 4HNTA 2PN1A 2YZGA 5KKNB 4O84A 4FFLA 2R86A 4FFRA 2ZDGA 2NU7B 4MV6A 3HBLA 4YJ3F 1OBDA 2GQSA 4NYEA 2CNQA 1CQJB 3HB9A 4O7ZA 5CB4F 1Z2OX 4ZQIA 3LWBA 5GONF 5LA6F 3U55A 1WR2A 4EA9A 2GQRA 4HR7A 4EG0A 2P0AA 1KJ8A 5BPFA 1VBHA 1ULZA 3BSSA 2DWCA 5JVDF 2WYOA 2ZDQA 2W6MA 1JDEA 4TV8F 4O7LA 2FP4B 1EUDB 3JZIA 1SCUB 1JDBB 2R87A 4M98A 3BSWA 2I8CA 1EZ1A 4ZI7F 4ZHQF 3GLKA 1IOWA 4M9UA 4ZOLF 4MV7A 1Z2PX 4IWXA 1CE8A 1UC9A 4E4TA 4FFPA 2YW2A 4YJ2F 4HNVA 3ORQA 4I50F 1KJQA 4HNUA 5D8DA 2R82A 2W71A 3TIGA 3N6RA 1M0WA 2W6QA 4O2BF 2V58A 4XX0B 5BMVF 4XYLB 2QK4A 5JQGF 2YZNA 3AX6A 3HO8A 1BXRA 3WO0A 1T36A 3TQTA 3VPDA 1I7LA 4MA5A 1GSAA 1DV1A 3V4SA 3RV4A 5H80A 3G8CA 3ORRA 3LP8A 1AUXA 2R85A 2YRWA 3K5IA 4O86A 4O7NA 1GLVA 1GSHA 2QF7A 4O7RA 3ETJA 2YWVA 5JH7F 4EGQA 2YYAA 3UFXB 2R7LA 5CA1F 2I87A 4C5CA 3GIDA 2VR1A 5CA0F 4DLKA 5C1PA 4EA7A 4TUYF 2SCUB 4MV8A 5HBRB 1UC8A 2NUAB 1E4EA 2CNUA 3K3PA 2CQYA 2CNVA 3BG5A 5J2TF 4O7VA 2NU8B 5HV6A 4TV9F 1A9XA 3JRXA 2R6FA 2PVPA 4M9CA 2FPIB 3R23A 4O7TA 2DLNA 3VPBA 2FPGB 3R5HA 3JRWA 2PBZA 1KJJA 4IIJF 1EUCB 3NUAA 1CS0A 2I80A 2FPPB 2HGSA 3K5HA 3VOTA 2V5AA 2GPWA 3R5XA 4FE2A 5JVLA 1AUVA 4WBNF 3RUPA 1IOVA 3DF7A 2J9GA 2R7KA 3WNZA 2GLTA 4ME6A 3U54A 5FNVF 2XCLA 4XZ3B 5IYZF 5LXTF 1PX2A 3VPCA 2YZMA 2R7MA 2YS6A 2CZGA 4O7YA 5EZYF 1JKJB 4O7SA 3RFCA 4MV3A 3TINA 4C5AA 4O4JF 4RZQA 3I12A 3TW6A 3MJFA 5JQWA 5C1OA 4O7WA 5K2MA 2DIKA 3V4ZA 5LOVF 1M6VA 1B6SA 4O4HF 5I47A 1KC7A 4MV9A 4YBZB 1BNCA 4MAMA 2ZDHA 1VBGA 1VKZA 4O4LF 2FB9A 1JLLB 1GSOA 5LP6F 2YL2A 4QSHA 4L1KA 2NU6B 3ETHA 5LYJF 1DIKA 4XYMB 2VHEA 4O2AF 4FGRA 2GPSA 1A48A 2YRXA 3VA7A 3BFPA 3TIIA 3KREA 3Q1KA 4O81A 3VMMA 3MWDA 3N8DA 4MV4A 3KAJA 4YAJB 1KEEA 1CQIB 3OUUA 1OBGA 4IHJF 2NU9B 4O82A 2XD4A 3QFFA 2C00A 4YB8B 2R84A 4EABA 5CAEB 5J2UF 4DIMA 1M0TA 4J6EA 4HQ6A 3WO1A 1GGOA 4EA8A 4O4IF 2R7NA
chains in the Genus database with same CATH superfamily
4TLDA 2QRGA 1ZGZA 2QTAA 4HNHA 3H0KA 2ZB8A 4D8XA 1R0BA 1U8YA 3IHWA 2XIQA 2D8AA 3LLSA 4DEYA 3BUSA 4V1CA 1XMIA 1DXQA 3E84A 2XIGA 3B9PA 3H1EA 3JQ7A 5B6IA 1PJTA 2GASA 2XKBA 4RENA 4EG3A 3GG2A 2NZUG 5CIWA 2PHZA 2PL5A 1VIDA 1OXBB 1DX9A 3GRFA 2W90A 2CHUA 2VDUE 4D0SA 2SKCA 4OHXA 3QY9A 4KQJA 4Z51A 1OH5A 1WXQA 4OB6A 4JLPA 4KZPA 4X8LA 3S6JA 1P18A 1MHPA 1NZFA 2F9FA 3L92A 3D7MA 1I9GA 2J3JA 4HLCA 4HWKA 1K3UB 2GJSA 2WIFA 5KYWA 1I1LA 1IZ9A 3QA9A 4IZOA 5EGSA 2CEKA 1YK0A 3CKLA 1RZRA 1OCEA 1ZUHA 1N0UA 3H2YA 4MQFA 4UVGA 3UV7A 4BEVA 1UP4A 3BXHA 3KQVA 1K7XB 2BI4A 4CNQA 2DR0A 1EM8B 1TT7A 4TPKA 4JXXA 2Z5FA 4ZO4A 4ZYUA 2OBXA 3EHDA 2VAXA 5CNKA 1BDHA 1RZRD 2BBOA 1K0FA 1Q1GA 2HLNA 4Q0MA 4HN4B 1QNLA 1RXCA 1KP3A 2EKPA 3GCDA 4GRIA 5D85A 4ZT4A 4IWYA 3ZE1B 5F1KA 3ZZUA 3MD9A 3GT0A 4E1AA 4L8VA 3C39A 4D6PA 1BYUA 4DVGA 4DQLA 1GFWA 5JHGB 4BTLA 3BABA 1BHQ1 3AHJA 5AOCA 3OSPA 1WZ2A 1PNTA 1TGVA 2GD6A 2YJ5A 3FTDA 3LYAA 4LYEA 1P7PA 1A8QA 1WRVA 2RD2A 4MLDA 1YU6A 1JR3E 4IGFA 4D42A 2ZS8A 4DT1A 2XE4A 1OBCA 3AMVA 4NBTA 1GQ2A 4REMA 1SUFA 3KKOA 4FX5A 3PL1A 3GDHA 5DYGA 3I8SA 1N6RA 2J9FA 3KAKA 5KTNA 5KFEA 4A2AA 5JCOA 3SJ7A 1N34H 2XDQA 3D8BA 2G5TA 1KFBB 4DL4A 1U4SA 3ZK7A 1OYVA 1V16B 1Q7BA 3QKRA 2G9NA 1EIWA 1U8AA 1CX9B 1J2YA 1GVNB 2P90A 4JOBA 1W96A 1B26A 4GL4A 5HZGA 5AKYA 1TAUA 5GJWC 4QQKA 4BMPB 3KKKA 1LBHA 3FPFA 3JVIA 2DBQA 2FAXA 3IHTA 3QEMB 4JJEA 3PXEA 4QL3A 3ZX4A 5JS1A 2VCYA 3SU8A 3OX2A 4F21A 1ESNA 2YR0A 4EJSC 5L95A 3AUAA 5EXEA 1HH4A 2ZJ5A 4DC0A 1TO2E 2OORC 3BRQA 4D8YA 4GBGA 1A4RA 2X77A 1Z0IA 2X6QA 4UTRA 3IOEA 1TTHA 3HP1A 2GUWA 4C3VA 4EHLA 4FOLA 1JZTA 1YZLA 3JSNA 2BI7A 3HYRA 2IMWP 3IP5A 2PXCA 4FFWA 5CHEA 3TLZA 3J80A 7REQB 1L5YA 1V4BA 1Z8HA 3H16A 2HMSA 1NY5A 4W9MC 4OHZA 2IH4A 2PJUA 2QW8A 1A88A 3GEHA 3JATA 1F48A 1ZCZA 5CT5A 1ECGA 2VEDA 2Z30A 2HDOA 2CFMA 2O9JA 3B1KA 4OY3A 3TOCA 4YJGB 2R1TA 1E5DA 3HCNA 5AXDA 4X54A 3QEKA 4PZZA 1S0NA 3N0WA 4DRXB 1T3LA 3ROFA 2C5GA 1NYLA 2PLNA 4DZTA 4F4CA 1HM5A 1E3DA 2FFAA 4RKEA 3S8EA 1PR6A 4JYAB 3JWGA 5C4MA 1D03A 3LDUA 4IIUA 1F20A 3G8BA 5LJLA 1TUGA 2PBLA 3H05A 5A9TA 3A10A 4G1CA 4RH3A 3L7LA 3U55A 3A4YA 4Y9DA 4DV0H 3WGNA 2ZWIA 4Z54A 4R51A 4JBWA 5I5XA 1UKBA 3VH1A 3ZIAA 3EPGA 1DP4A 4DCUA 3UK6A 1N2HA 5JI2E 2R9VA 1YCFA 1MQ9A 1XX6A 1Z4MA 5KFAA 1AIPA 1YA8A 3IUNA 5FP0A 2EQAA 3DPSA 5GV8A 3WGVA 4DLXA 3GLGE 3TSOA 2G9VA 1EUQA 2LCIA 1RDFA 2E0IA 1I5RA 2R6JA 4QUKA 3ZWYA 2IOFA 2P75A 3MTIA 2D4AA 2YHSA 3UENA 1SG6A 3AEQB 4HZIA 4QUJA 1X3SA 3MINB 2W93A 4O4LB 5TDHA 1K08A 4D45A 2BRUA 2XGMA 1IY0A 3U5TA 4EPTA 4BO2A 2XT0A 3HR7A 1NQUA 4LYJA 1YDWA 3T1NA 5LWHA 1EUDB 3JZIA 3GOHA 4BZXA 1W0JD 2QMEA 4D3DA 4YDQA 3SVTA 3CPJB 4ZOCA 1Q50A 1PUXA 3NOQA 2JFUA 3C15C 3GTQA 3WP1B 1DKLA 3P5BA 4G36A 1YMQA 3FWNA 4R68A 3ZH9B 5I5SA 1QYVA 3IUYA 3IJEB 1DKPA 1P5HA 3PRYA 3QNUA 1NFQA 4L2IA 4UW9A 1Q12A 2BONA 4D46A 3IVGA 3B89A 4BQIA 5HRAA 3PDCA 5J9FA 2W37A 4X62H 1THGA 1TMGE 2B92A 1UC4B 2HTEA 4ARBA 1SXQA 3ZE2B 2AL7A 5JLJA 1NQWA 1QFSA 4O4JB 3MJSA 2K2QB 2LR0A 1TTTA 1QGUA 4K03A 3UJ6A 1JN0A 2ID7A 4DQVA 1L5SA 5IC6A 5E7MA 4COKA 4D0GA 4S24A 2IBTA 3A4NA 4WKBA 4PRKA 4KITB 1XZEA 1CIJA 3HXLA 1VXOA 2NZXA 2YUIA 3FCUB 3PHJA 4RIGA 1M6EX 2C20A 2VBCA 3PJEA 4CV1A 1N5KA 1YHYA 2DBYA 4PYJA 1T29A 2CV0A 3SZUA 2R82A 3VPXA 3WLMA 3TIGA 4JVOA 3LBNA 3NHRA 2ZJ6A 3DMYA 4I1YA 4RPJA 3SM3A 2VWQA 1M6HA 5ELLA 1LW6E 2FN9A 4W63A 3B60A 3KUKA 3WYNA 1BWRA 1MEJA 2QAGC 3R3VA 3PX3A 3PD1A 1G3RA 5ALTA 5FBKA 4EEKA 1GO3E 2WTMA 3H8SA 3NRJA 5T14A 1EK1A 2JIDA 1U3CA 2FWJA 2GM5A 2I6XA 2O6HA 3TY9A 3EA0A 3P9SA 4TZKA 5C1DA 1EVIA 1FNNA 1E2IA 4QUIA 4DLBA 4IMJB 5AYVA 2IITA 5CURA 1NU6A 1RMQA 2X86A 1ZD3A 1VLJA 2MCFA 1SZDA 2XOXA 3REFA 1W52X 1V3VA 4FTWA 3MRXA 4LFCB 3CEMA 1A1SA 1NVWQ 3PD0A 3R9KA 3W6UA 4AJHA 5CAEA 3UT5B 2N47A 1XZIA 3LOQA 3V4OA 1DUVG 1A5SB 3D0KA 3TLCA 3QWUA 4NXNB 3DGFC 2GJKA 1NFFA 2TECE 3PC7A 4UBLA 4BKPA 1M6NA 2ABJA 4FBUA 2NTNA 4JOSA 3LPDA 4OJQA 2PGJA 3UV6A 2HUPA 3DOIA 3WLEA 1GNTA 1OHHA 4YUVA 5DASA 5B58C 2BQUA 3UJBA 3EPIA 1QE0A 2WPNA 4C0SA 5JBIA 3VO2A 1RNLA 5IKXA 1SXPA 2ZCJA 1D4OA 3C6QA 1DINA 1T9BA 2A94A 1G8MA 1DBWA 2FWBA 2G1JA 3COSA 2HMWA 3QVXA 1M2GA 3RSFA 4ED2A 5KDDA 3NIFB 3AFOA 4EBCA 4BO4A 3ZWKA 4O86A 3EVDA 1QX3A 2QZ4A 3HCDA 5JAHA 1C1HA 4MUBA 5DHSA 2EFDB 3B6MA 2II6A 3DWGA 4N0EA 4BKQA 4E03A 5KOJA 2EGUA 5BQ5A 1OXSC 1OI3A 1B8PA 2OWOA 1GXSB 1H85A 1ZNQO 3B3GA 3BC1A 1AKUA 3G7NA 1NULA 1NVVQ 2EFEB 4IIJA 3DC2A 2JGAA 4JFAA 1C1YA 4TUYB 5AKGA 1GM5A 1SC1A 1U7DA 4G3XA 5K8VA 1G7CA 2B69A 2Q9BA 1WW3A 3EDMA 5CA1F 4IR9A 1PTKA 2B8TA 2QTFA 4C5CA 2C22A 4AMVA 2DKOA 1DJOA 5CYFA 5KO2A 1C1DA 1PJBA 2JA7G 1XB2A 3E9EA 3I9V6 4UMEA 4B45A 2BYTA 3CIOA 1T43A 2LUOA 3GNSA 5AICA 3T7SA 1K27A 4ND8B 3W2GA 3BQ1A 4H7PA 3RHZA 3LDGA 2BGKA 2PT9A 5J4KA 1DCKA 2BGIA 1RRFA 5CVEA 1MVOA 3GCGA 4ITVA 4F84A 2PLAA 3AWIA 3CISA 2IS4A 5EE9A 3V42A 1Z6AA 2FOIA 1WSWA 1VL6A 3OA0A 5BW5A 3HP7A 4J6FA 2WINI 1GR1A 2PX3A 3OE7A 3M89A 5KFYA 2ZSKA 3IBSA 3SS8A 1JL3A 1BCSA 3QXCA 4AS3A 4GWKA 1RYRA 2GBLA 3E15A 3PS9A 2PVPA 2GKSA 2ZI4A 3RH0A 3QJYA 2RAUA 2XQFA 5J5CA 1OU0A 3H9QA 3H18A 4OPMA 1UL1X 1TKRA 4L8LA 2VI5A 2FN7A 2ATEA 3Q88A 3CZMA 2YJ3A 1E3LA 3R5JA 4IVPA 1A8PA 1O57A 1I1QB 2NX2A 2WB4A 3RDPA 3T5CA 2ZEJA 3WYAA 1P61B 4ZIRB 1W36B 1CS0A 1XI2A 1GEGA 4TWBA 2R93G 3DA8A 1J9ZA 5CPFA 4FE3A 4EDFA 1U4NA 1RYDA 3QX9A 4GMFA 1QHIA 2ATXA 1BE6A 4GZ6A 3RAQA 1AKVA 4G1EB 2AFIB 3DAFA 2B7LA 3FCYA 3CZQA 2HK8A 4DCSA 3KB6A 4F71A 1BZYA 2RGNA 5HK8A 5A6SA 2OFXA 3PO3G 2OMEA 3N2KB 2F9MA 4MWBA 1P16A 3I1FA 3H87A 1AVTA 2Z0MA 2VF7A 3ECCA 4NCHA 4Q9AA 4BZWA 2IVZA 3KP1A 3NT2A 1H5UA 4DCOA 1AUVA 1ID1A 2G1AA 3MLBA 2ADFA 1N5IA 2V54A 3N39C 2O1SA 2WP0A 1AUPA 1RJQA 3IAM6 4M22A 3SBEA 5M2QA 1JU9A 5FPRA 2AJBA 3IXLA 4AS1A 3UG7A 3I4NG 4JV5B 2AQIA 3S68A 3N0VA 1X7ZA 1OLUA 4HGOA 4QFBA 5FNVF 2VA3A 4KQGA 2QSZA 4JNCA 5JWRA 1CQIA 5B3JA 4PLZA 4LF9H 4HDAA 3L06A 1W4AA 2PD3A 2F3SA 1NRWA 3B1FA 3VPCA 4HEQA 4C43A 1KVQA 1A4UA 4R7GA 1RXYA 2QDXA 4IPTA 3ZQJA 4EM6A 1OOEA 3UGTA 3OF2A 1N2CE 1I7SB 5AK5A 1YVPA 1UOOA 1HKHA 4OHRA 3IAUA 4F9GA 2ASVA 4LBYA 5BNWA 1XTUA 2QP3A 2WWVD 4QUAA 1Q95A 2M32A 5IT9W 3KQYA 3NIWA 2YN2A 4J07A 1AD2A 1BG6A 3SG0A 1JYFA 2FR0A 4LC0A 3H1TA 4PGGA 1OB5A 3GP8A 4KDFA 1FW6A 2O06A 4L02A 5BYKA 1SJ9A 4AUNA 4COOA 4LY6A 3N2EA 2R8IA 4L16A 2IUEA 2ZUDA 3E53A 1GCGA 3I12A 2AC4A 2WJAA 4R1SA 3THSA 2VJYA 4GZMA 3KEGA 3ZLUA 4JCCA 4LZAA 4K6FA 2IYTA 2Y0EA 3L1IA 4IVRA 1YHZA 2ZS9A 4MH0R 1BXRB 1SKYB 3DE1X 4H15A 3TW8A 1UDAA 2EJ2A 3SQXA 4WNYA 1J8VA 1T34A 2VATA 3C74A 4IDNA 2XSZA 4JP8A 4JU9A 4MI6A 4UBNA 2UVPB 3U13A 4EW3A 5ADWA 4MDFA 1BNCA 4DR7H 3PC2A 1MAUA 4HAZA 4KQFA 5BV0A 4JV1A 2G25A 2AA3A 1A0GA 3O03A 1ZICA 3CU5A 4INPA 4BNTA 3COJA 3GVHA 3C4JA 2R65A 1JGTA 4FX2A 4NK5A 3UBMA 4A2CA 4ZDKA 1ZKDA 3FVRA 2R1VB 3NWBA 1M8FA 1XZGA 3AVYA 3T7CA 5A3SA 1V41E 2NO6A 2RB5A 3EA4A 5CCDA 3CX3A 3FHTA 2PZ8A 2CVZA 1XR3A 2ES4A 2O7NA 2VQEH 3DE3X 2JRCA 3TB4A 2JI6A 4Y6QA 4ARVA 2W57A 3U3XA 2EQ5A 2DTDA 4IIBA 2ZT5A 4ZOBA 5LA6B 2IU4A 3PZPA 3R3JA 4KFSA 5G41A 4XYMB 1A2QA 1Q3HA 2BFWA 2X5XA 4Y6RA 2WRZA 3VNVA 1KI3A 4UU8A 5EP2A 1ZIPA 2O7VA 3AF6A 4OSPA 4ZP1A 2RSLA 4HGRA 3COPA 8LDHA 1Q0ZA 3IRVA 4UDNA 3PD7A 1VZ3A 2ZTUA 4GKVA 1E0AA 4B1FA 4WWHA 4QJFA 4E2XA 3VKGA 5FHQA 3IP1A 3QX7A 3KQOA 1A8UA 1MF7A 1JFFB 4J75A 3JQDA 3RVPA 5KYKA 3TN7A 2B99A 1J2RA 1CS0B 4MV4A 3ID6C 1WPQA 1I1HA 3JQBA 5EP3A 1VI2A 1R8SA 5JS6A 3ITEA 3IFSA 2DHCA 4AWBA 3KT0A 4UPDA 3M70A 1CQIB 5T4HA 4EG1A 4GPEA 5CD9A 4YRBA 4FDVA 1TQDA 2C96A 1IN6A 1QH8B 3BEOA 3L1JA 3G2JA 1T15A 2P9BA 5KFXA 2H85A 2VRBA 1GL6A 5MFPA 2J0VA 5M29A 1P39A 1W76A 3L7MA 2VPTA 3AR8A 2ZE8A 4KNVA 4XM0A 2IHNA 3JQPA 3OHSX 1MQSA 2ODEA 3AFGA 4ESEA 1L5GB 4MHSA 3GEIA 1QWOA 1X39A 1M54A 2C28A 2F62A 4PO9A 6LDHA 4IDEA 4CE6A 4AKGA 2R7NA 1U9JA 4KYTA 4AJ9A 4YS6A 1UT6A 4F38A 2QRKA 2EKQA 3G2LA 3L7AA 1WMSA 3Q12A 5F33A 1CNEA 3BWEA 2WAAA 3IOYA 4GXNA 1X8JA 4QDZA 3FUUA 1IU9A 4RIIA 3PJGA 5C44G 2RGRA 1ZN2A 3LBFA 4OXYA 1IONA 2AK2A 3R8CA 3OHBA 3ZUPA 2YX1A 4XVCA 4NQRA 4N48A 2XZDA 1FRZA 2AXQA 1JXLA 1FU8A 3H1BA 1TYCA 2QGFA 3LT4A 1YR8A 1P4SA 2ZE6A 3EC1A 3OESA 2ZRAA 4RVCA 2B0CA 3C4QA 4I1RA 2ECOA 2ECKA 2OV3A 3BORA 3H4BA 4MRVA 1HE1C 1VXRA 1UOEA 1BVRA 3BBLA 4ZT3A 3VO8A 3ZN2A 5EJ5A 3W6NA 1MX1A 2DPMA 1MA3A 3BD8A 3D3WB 4NU5A 4EWLA 1JHQA 5DBOA 3TAUA 2DFDA 4XVQA 5JCZA 3UG6A 3PSAA 1D0SA 1JKFA 3EMKA 3DVRX 2QJWA 2P5SA 5AVOA 3EH1A 4RPKA 3SVLA 2E37A 1E69A 5EKUA 1CYDA 4JVSB 2GM9A 3K1AB 5DMXA 4CEIB 4CE5A 5JPCA 2DPLA 1BFKA 1LCIA 2FPWA 1CVRA 2IPMA 4Q43A 1WSBA 1T1GA 1YIDA 2JI4A 5ICFA 3S28A 4F7WA 4O6VA 2ZYIA 4BC1A 2UXBH 1FDTA 1M67A 1G16A 4P7BA 1PK8A 2O7SA 2VJMA 3FYUA 3N3AC 5ECDA 1SYXB 1DFIA 4TXHA 5I7VA 1G6OA 1PCXA 2ZTHA 5C7LO 4XH9B 4ETIA 2H59A 4AZ3B 3C2QA 1JAZA 4KRFA 4I8DA 4OHFA 4PW0A 5K3OA 1ETUA 3QWFA 3A6GA 2X0SA 2CLSA 1HE4A 2BFDA 5EHGA 1R6DA 4B3JA 1IHYA 4S0XA 4BCDA 3S55A 1JVSA 4EGJA 3KQUA 3K70C 1GDTA 3WB2A 1L5ZA 4IYJA 4J0GA 2ECFA 5D86A 2GPYA 5FPSA 1C4XA 3C3XA 4MR9B 4RZIA 4YRNA 1N2ZA 5KYNA 3U1BA 2XVAA 5H81A 1YZKA 4FVTA 2UXBB 1W93A 4FFMA 1JKMA 4ZQCB 5AVWA 4ZQHA 1AKEA 3PKIA 4Q21A 3LOUA 1GRRA 1PLJA 4WCFB 1EWQA 2O8FA 5ED0A 3WGZA 3EARA 2CHFA 1GSIA 1ZAKA 1CG6A 2PDAA 5ALJA 4HEA6 4AMYA 5A4AA 4DV3H 1UH5A 2ZAOA 3TK1A 1FFBA 2GCNA 4YXFA 2GKGA 3MC1A 3CVUA 2PUEA 4GKKB 4Z9YA 4F60A 1PVOA 5EN4A 3IODA 1JI3A 2FJZA 2HRBA 1W2GA 4BYGA 2BGRA 3BXXA 3ETDA 1PO7A 4NABA 4B46A 1Z06A 3BPSA 3G9TA 1G21E 4AJOA 3E58A 1P7ZA 3CYFA 4AZWA 3AF2A 2X8JB 2TYSB 2J59A 3OPYB 3L7YA 4GNRA 3ITDA 5EYPB 1F06A 2LV8A 1A72A 4FYYA 1QDLB 4ZT6A 4ZCPA 3ZNPA 4ZT5A 5EQTA 1Y63A 3LLUA 1ZESA 4B09A 5KU1A 1PW5A 4AW9A 4QICA 1T3SA 2X2PA 5HP4A 2XWJI 4NRDA 5CX4A 3UANA 2WAMA 5K3FB 5IJ0B 3BQ9A 2GDJA 2PMZA 2EX4A 3IAS6 3OU2A 1DX4A 3IKVA 1R5BA 4HX2A 3ABRB 2V4MA 4YBRA 4CJXA 1CLUA 2WPDA 3HS3A 1SBZA 2XXJA 3N2LA 3FZYA 1CUHA 2C57A 2QNIA 3K3VA 2FCRA 2W0MA 4PLVA 2O2SA 3SEZA 4LE2A 5JXGA 5C8XA 3L18A 4LVUA 4CM7A 2P35A 3M83A 1Y6RA 2NU7B 1N7HA 4QJBA 5AKJA 3VFDA 2WFZA 2VHXA 5FO1A 4ILKA 1YMUA 3TJRA 5GZ1A 1PU2A 1QRAA 1D1QA 3QPAA 4BO9A 1KP9A 2X9QA 3HBLA 3FGOA 1TIPA 2M1XA 2PX6A 4YDHB 5EP1A 3V2HA 2O4UX 1UBTS 1O8BA 3LQSA 1W5AA 2OBMA 1O58A 2FVYA 3A11A 1VAJA 2QTCA 1CNMA 4GOMD 4KV7A 5EJ4A 4ECXA 2KBFA 3USCS 5DM60 1AXGA 2J0QA 4CM9D 2P9YA 3HM9A 3DOOA 2Q6IA 5KOHB 5LA6F 1XBTA 2J0SA 3S5JA 3AFNA 5B7GA 5DYNA 1N77A 4HQ0A 3KEFA 3ZLVA 2JBHA 1RZUA 2J1LA 3H9JA 4QEZA 3VC1A 4HR7A 4EA9A 4B0OA 1A8IA 2ZATA 2GPTA 2XOKA 4MROA 2BP7B 3USZA 1MG5A 5FD6A 2FLKA 5BPFA 4F8YA 2QL6A 3HZZA 3RTAA 4DUPA 2RGYA 3BSSA 4LV6A 3VZRA 2CXQA 1TEXA 3CUWA 5HMMA 4P0PB 2PKQP 4PS1A 1KQ3A 1N3LA 3GDWA 3U81A 1FL9A 1HQKA 2VZ0A 2ZYUX 3KU1A 3ELWA 4FDMA 5JANA 1I0ZA 4U9IS 2KBEA 2QYSA 1RI2A 3G0GA 1P2DA 3MEQA 1JR3A 1L2TA 1RJ9A 4HGPA 4LG1A 3ZJ5A 1PWXA 4TQUS 3A3NA 5SZKB 1OX4A 3DM9B 3V1LA 3N8HA 1J20A 1AK2A 5ARCA 1NX9A 4DKXA 2P27A 2NO5A 4C7OA 1XZCA 5HRUA 1Q3TA 1BOOA 4HEA1 1IBSA 3IOBA 1H0RA 4M98A 4RA9B 3S0JA 4G0OA 5KYXB 1CUIA 2PFSA 1IBKB 4NY1A 3A4VA 3KX2A 4TTIA 3WQRA 1DKNA 2XNJA 3GF4A 4L4SA 3HLKA 1QHGA 3OLYA 4JIMA 4KR7A 3R40A 2JA5A 3NDIA 3U26A 1JHPA 4G9BA 3OHAA 1AU9A 1D6SA 1MT3A 4Q3EA 5FIUA 4M9UA 5JADA 1B41A 4YXWD 1Z2PX 3O2JA 1G7SA 2FSVC 3IA7A 4A1FA 5JIBA 3DTYA 5LR6A 5BV2P 1OTYA 1QVRA 1DX6A 2JJYA 2C82A 2HHLA 3D0RA 2XMRA 4ECUA 4RXMA 1E20A 2H2GA 1IQPA 5THXA 3F74A 4LMPA 4NMMA 5K7SA 4YJ2F 1NWCA 3QYPA 1KPIA 1QYCA 3DFMA 3ZGLA 4WVFA 3V7NA 3FY4A 3K94A 1I3KA 1FXSA 3DZJA 1QH1A 2FSGA 3QELA 2C2DA 2PSEA 2B63G 4R8RA 2ZRFA 3ER9A 5GVSA 3MR2A 2JHPA 1WQ3A 1KYIA 5F12A 4U2GA 4H7KA 4ZV7A 3ESQA 5ALZA 3SE0A 3FAZA 3QFCA 1OPRA 1NXTA 2UKDA 4QUGA 5EXXA 5KREA 2GNPA 5L1JA 2XNSA 2C5LA 4N5HX 4S1WA 2QK4A 1Q92A 1ZJZA 1EFPB 2FG6C 4TWJA 1TZKA 3K2BA 2W9CB 4MRNA 3LW8A 4RWEA 2P3LA 1NJ2A 2VIIA 4FYJA 2B82A 4ND5A 4JHXA 4WNAB 5LQCA 3I04A 1CEEA 1XWIA 1AUQA 2E9SA 1LWOA 3PC4A 5B3AA 1BYIA 3IJRA 3Q10A 1U8CB 3AVQA 5DCWA 1QV7A 3M81A 3ND5A 2D7DA 1FSPA 4LSAA 3KWFA 1T36A 3PW4A 2QM0A 5KWVA 2A88A 3BWMA 4MMZB 2AK3A 2V74B 3UJPA 5P21A 3F9CA 4L28A 1U8FO 4BKRA 5DULA 4JYAH 1NLFA 2AUTA 3V4LA 3ZJYA 3Q7SA 3ONFA 2LCQA 3UJ3X 3TJZA 1DHTA 4GR5A 5BR1A 3FZGA 2RCYA 4ERNA 1Z5UA 4RMGA 3LL7A 5FWNA 2BDUA 5JUMA 4M9QA 4RY2A 1YZUA 4EEZA 2BV3A 3QKRB 1GNPA 1RI4A 4XSGA 4F1WA 5KSWB 4AJJA 3CEJA 4R0NA 5E3HA 3HCEA 4DRZA 4CG1A 4Y1FA 5KG2A 2ROQA 4E7OA 4V02A 1N3IA 3SZ3A 4X8HA 1PVDA 3S2GA 4LRUA 3P9NA 1HZZC 1OQAA 3D43A 3T7JA 3DNFA 1P0MA 1UK6A 2BM8A 1GZUA 2PSHA 4UUGA 4PG6A 5BWCA 4C7OB 2E2IA 2FRDC 2LVBA 3KT6A 5TARA 3BRSA 1R3DA 5CM9C 2XZTA 1KI7A 4LWPA 5EVJA 4ER7A 1LDBA 1F5SA 1ZM9A 2YWDA 2JCGA 3N6VA 1IWBB 2W7TA 2YMPA 3V4PB 4DGSA 1JIJA 3VR0A 2J30A 2YIJA 1V5EA 4LGVA 4LJSA 3S1AA 2O2YA 3GRVA 1TJ3A 4O8ZA 5B5SA 1UKYA 2EKBA 3KSRA 3M49A 4WY2A 5F9MA 4JUAA 5I9IA 3FOFC 4K9DA 3SBDA 4C14A 4JP5A 2Z6AA 3AM1A 2C7BA 2ZR0A 2VF5X 3ZXSA 2ZWVA 1KDOA 5TS2A 3IB6A 2RK4A 3ORYA 3OCZA 3IIIA 3TBHA 5CB6A 4UM7A 1P29A 2YNMC 3MA0A 4FHGA 4PZDA 2CBGA 4Y98A 5BOVA 1UC8A 1M5UA 4I0WB 4A92A 5IKMA 3CRW1 5COQA 2JLVA 3TZ6A 3G88A 3WGHA 3L7OA 3PEFA 1WVGA 3IXMA 4EK9A 1RTTA 3JAKB 4GZ3A 4E22A 5EIHA 1WXHA 2WMYA 4RS4A 4E2FA 3KZOA 5CJPA 4B17A 4TLAA 3O4HA 4I2VA 3ZDXB 2R2AA 2G28A 4J2HA 3ZDDA 4O7TA 4KBGA 4XUCA 4ASUD 5JASA 4JWKA 4GXQA 2EYUA 3PFCA 4NE7A 4W1RA 5KEIA 1P1IA 2RHOA 4GRDA 4ES6A 2CBZA 2JJ8A 3RIMA 2J67A 2YV3A 1RU3A 4MWZA 1PFKA 4MKHA 4B6QA 3HCFA 2P5YA 5KBYA 1E4FT 1J1IA 2FX5A 2JVIA 2FN4A 4I5GA 4V3BA 4YJGA 3VYUB 5JQGA 1YL6A 3ZLJA 2XJ4A 2XCSB 1BQ4A 2YFHA 1MOSA 5AOVA 2VLIA 4HDMB 2HEIA 1GN9A 2NXCA 4ECAA 1R6BX 4LFCH 1RWXA 4NICA 1BRMA 3JSXA 3FPEA 1NQVA 5KQPA 3HYTA 1UIRA 5DM0A 1XL0A 2HF8A 4K8RB 4NU6A 4KB5A 1V6CA 1TCAA 1I4WA 4ZDJA 5H68A 3R6DA 2QTZA 3EODA 3FH0A 4MVYA 4PG5A 2HYIC 3MCWA 4QAQA 3JQEA 2XNKA 4TLLB 5A4DA 2VT7A 3A2KA 5BQ3A 3UAZA 2RGDA 1FP4A 3PC8C 3M4JA 4RXTA 3TJMA 3KPWA 4HAYA 4JX9A 3LKDA 3OICA 1I0LA 1GTSA 3K32A 3HE3A 3QIVA 3CH7A 2MYUA 4MQ4A 2WAOA 4D3YA 8OHMA 4TYYA 1DGQA 2J5BA 5CXUA 3SN6A 2A1IA 2Q5HA 2ZK7A 1KR2A 3M5DA 1V8ZA 4WTOA 2OV6A 2BGTA 2CT8A 5FPPA 3DBLA 1QQ5A 4ETNA 3L01A 1V7ZA 3L43A 1ZMOA 3TKAA 1L5KA 4P7FA 3MWKA 5JNTA 1SFRA 3LP5A 2XX3A 2B4KA 1JB1A 4RF2A 5JDCC 5I5VA 3R3XA 4DTCA 5J1TB 2CZGA 2OO5C 4E6PA 3CW9A 1E4VA 2CJYA 4EO4A 1A7KA 1L5FA 1URPA 3BE8A 3RHFA 3FFWA 4GPBA 4U2KA 2V9ZA 3B85A 3ND7A 2AV6A 3NDPA 4NPAA 4P4SA 2XUAA 4B7UA 2QS9A 4O4JF 3MSCA 4MTCA 1Y34E 3P2IA 1J22A 1QYXA 1V7CA 2GZSA 4Z9FA 2UUCH 3UAYA 3S44A 3WSTA 4ND7A 3FPBA 2X13A 2ZXFA 2XE6A 3HUUA 1GUAA 4JUIA 3GI1A 3ZIDA 4NYMR 5K2MA 1DS6A 5CW2A 2UUPA 1RLJA 2BGJA 2GF0A 5ALKA 1BS1A 3IDAA 3B7GA 3ADOA 3LQ4A 3LWNA 4LJ6A 3LW7A 4MQFB 4TV8B 2Y1EA 1JA9A 2Y6VA 3UTDA 8ABPA 3RAEC 1CZUA 3O9VA 1IB6A 4LW8A 4RLHA 4TMVA 1UMCB 2AC7A 1BH6A 4UEWA 3U4CA 4CTOA 1SVNA 1WR8A 3MLAA 1AK1A 4UHFA 5E4JA 2JGDB 1M7GA 4U63A 3DZHA 3X43A 2J08A 1R15A 4ZK2A 4U7FA 4RDHA 4RJKA 4O4LF 4KR0A 4M8SA 4GBMA 1SU8A 1L5NA 3ZDCA 1NP6A 3X1KA 1XF9A 3FZEA 2A67A 4YJFB 5EINA 1XP8A 2BSQA 2PXHA 2VK4A 3F6RA 2QUHA 1N5MA 3ZCPA 1ZOPA 5AW6A 4P5PA 1S97A 3JARA 1DDGA 4TMXA 4D9CA 4TTVA 4YJHB 3PFWO 5G0TA 4N47A 5IZCC 4K2HA 1OLOA 3G02A 2IH5A 3L0SA 1L5VA 1N5LA 3FYUB 3ZE6A 3I5YA 4YLYA 1I8TA 1PEYA 2W8ZA 1RAHA 4KQKA 4NENB 2R1VA 1JSXA 3F5MA 3RVOA 1YULA 4CNBA 5BWWA 4QXOA 3RASA 1UKVY 3V80A 3OLZA 3AESB 1D2CA 2X7JA 1SEPA 2GAFA 4TS3A 4YMWA 3TIIA 1AM4D 2IIVA 2OD9A 3PEWA 2QVYX 2H65A 5EYPA 1JU3A 1X7DA 5E0OA 4C07A 5JJBA 4O81A 4DDTA 4UQLA 2JATA 2WLTA 3BMOB 1VSUA 3CEPB 4MARA 4UBOA 5A05A 3NHAA 3WJ2A 3AY3A 2JHCA 3RABA 4OIFA 2BR3A 1T8YA 2FOXA 4BDSA 3T3EA 4ID3A 4C0AC 4EY4A 3VDXA 2COEA 4Z7OB 2VH2A 3RUHA 2WP8J 1KEEA 1YZVA 2BHLA 2OGSA 1A27A 1W94A 2GHIA 1R8QA 3GO4A 4DYDA 2XCRB 4EJ2A 2WIAA 3WHIA 1FNDA 1T10A 3QLUC 3OPXA 4WCFA 2B7CA 3ABQB 1R1DA 2XQKA 1PZGA 2D59A 1Y9ZA 2CE7A 3NBKA 1UAGA 4IQFA 2B61A 4M0EA 3RTGA 4RMJA 1NASA 4RORA 4DV4B 5BMOA 4QWCA 3K0CA 2AVDA 4HQFA 4M9XA 1R8XA 1F4PA 4P7KA 4Q1FA 4LQ4A 4DLYA 4F86A 2I6TA 4C22A 3GGPA 5HG0A 5TLSA 1ESMA 4EA8A 2CLEB 3RK4A 5JMTA 1ZK3A 3QV1A 1IMJA 2EF1A 1GDDA 4RACA 2PH7A 4KMRA 4MPJA 4JI8B 2Z04A 2P9ZA 2A3RA 1KEUA 4I19A 3RC1A 4DMLA 1BMDA 1QHFA 2G04A 4F4YA 5HE9A 1CULC 3UJNA 1P6XA 4GKBA 3NH6A 1U94A 1YXMA 3AR9A 4KSYA 4AJEA 4DV1B 3NETA 3RBEA 5K2OA 4TKVB 1GOTA 3LYUA 4N3NA 3KO8A 5GONB 1KF0A 3OJFA 4LHVA 1IQRA 1AURA 1QC5A 1TFUA 3EWSA 4PZ7A 1NBMA 4JUBA 4Q3LA 2FUKA 5K3CA 4B8WA 4WBNA 5JFOA 2PX4A 1NVAA 1DPFA 1Q6ZA 2F17A 3IIKA 4K9RA 3UB3A 1QCYA 1RXEA 4WPGA 5JBQA 2ZYRA 1NVVR 2QTMA 3AJEA 3QPUA 4RPCA 3GEPA 2HUNA 4ZVRA 1T8UA 1L7RA 3AY7A 2JAXA 2XRYA 3DCYA 3JQCA 3G2NA 3ZE8A 3EXG2 2M05A 3AF3A 4CDNA 4BIIA 3TUJC 1VM6A 2HBYA 4RNOA 1BD3A 3G1UA 1KDPA 2H1VA 3AHIA 4R9VA 3LUPA 3NTVA 4R2KA 1WCMG 4TKUA 4CR8A 2C7GA 3T61A 4H1HA 1JBQA 2I71A 3G8DA 2DKFA 3E4DA 3DLIA 2B2XA 1XMSA 1V39A 3OH8A 1XEXA 2HJHA 2WJ6A 1C0PA 4JZKA 5EJ9A 1J0XO 2RJOA 5EIXA 2FV8A 1LK7A 3LT1A 4R5MA 3T3IA 3O8DA 2HRZA 2X58A 4GMGA 4Y3UA 4RUAA 1V96A 1WZEA 1E7QA 1RJWA 1Y8RA 2FNAA 2POCA 3KUXA 3BMOA 2GZMA 4UUMA 1SU4A 5GOZA 2C2GA 3HSYA 2H9AA 2UU9H 4G63A 4HXEB 1UM9B 5DK4A 4K0KB 1JE1A 2G5CA 1S2MA 3AXTA 2HCTA 1BCSB 2FPXA 2VPIA 4UMVA 1MV5A 1T35A 3EIWA 2BKEA 1R9NA 1YOVA 2EJCA 3E1KA 1K06A 2X9GA 5AI4A 4E5VA 4DG8A 1BXGA 2FPGA 3QYFA 2BFCB 4ALJA 5L3RA 3ZV6A 4HT3B 1UBUS 3T9AA 1Y8RB 1H6DA 3HFSA 3PE4A 4JAVC 2OVBA 2JCSA 2RIPA 1GL9B 1PJRA 4F9EA 2H3EA 2XGOA 4KKVA 3WL8A 3MILA 3M6XA 1YC5A 1YZ3A 2P9CA 3INRA 4V0KA 1LQTA 1WXGA 3WGIA 3QKUA 4BNZA 4RHEA 4REQB 3KSUA 2IPXA 1GGVA 4QX6A 3DOEA 1TQ2A 4UNRA 5JSZA 1SD1A 1NE7A 2J4FA 2NUPB 4KWIA 1IBMB 1GNSA 1ZHOA 1LJ8A 2ONZA 2VCEA 3VSDA 4JVNA 4X7PA 3CJRA 3C43A 1L7DA 3OKPA 2XI4A 1QPZA 4MQ6A 3HRHA 4ZDWA 5KIAA 1BEUB 4PNHA 1XUOA 1V43A 1P0PA 1LPBB 2B8JA 4FU0A 1X1QA 4UCUA 1PN3A 4PPGA 2PNFA 1GP2A 2H1FA 3PP8A 1GYPA 3EPRA 3GPLA 4OV6B 4ALKA 2OXFA 2OL4A 3L84A 3ZKWB 2BTEA 1SUIA 1YQWA 4FNAA 2YZGA 4B82A 2O5EA 4UASA 1LPOA 5K3AA 1U9ZA 4NAVA 4FWIB 1EXMA 3QXGA 2Q6TA 4P38A 1S01A 1ZQ9A 3MBIA 2P6UA 3CN7A 5ICCA 3NWEA 4PCVA 1I4EB 1XGKA 1B93A 1R27A 2JK1A 1ZC3A 5HPYB 4HVTA 2QVBA 3D02A 3T5MA 3K9HA 4JI1B 1LLQA 1M5TA 4ENQA 2WHXA 2YIVX 1W48A 2AG1A 4DWWA 1NX6A 2PO5A 1GGNA 3RS3A 3A1WA 5J63A 2WZCA 1CTQA 2PXAA 1TEHA 4B9AA 5A4JA 1TUBB 4Y0NA 5CJJA 3RO7A 2QTWB 3B8EA 4QYMA 5JJLA 3EVEA 2Z9BA 4V2UA 1P44A 5G0SA 5TVKA 3LWBA 2XV1A 4AFNA 4PAWA 3UPDA 4GC7A 2G4VA 1R0CA 3SX4A 1TX4B 1EE1A 1KAQA 1XCMA 3WLNA 2BAGA 3DMGA 1H4SA 2PQMA 1JILA 3GJSA 1YS9A 4NG5A 1RTKA 1DVRA 3ANTA 1ULUA 2Q5JA 4NH4A 1OYYA 4A2QA 2I65A 1UOPA 4MRSA 2MIIA 4WZBE 2JAQA 4TQGA 3TAXA 2HGXA 1VL1A 3UMRA 1T0HB 1XMVA 4AKHA 2R2GA 3PUIA 4WHMA 5ADHA 5KWSA 4RM2A 3G2KA 3C5EA 4MCIA 1JDPA 4ZQBA 2H07A 3FB1A 2OSVA 3NEAA 3TL6A 4O7LA 1GFIA 2H5JA 3KQTA 1DTSA 2H08A 3DO8A 5HW0A 5L4LA 1Z39A 2B83A 3ACCA 4L72A 1CJVC 3EXIB 2ZRPA 3FNFA 1B3BA 1NE2A 4JMPA 4RHTA 5DPMA 4MS3B 3R7AA 3SJZA 2IGTA 3L05A 3UGQA 4B32A 2OD2A 4ABTA 1H22A 1Q22A 2RKBA 1XQ9A 4NV3A 3ZD6A 1MNQA 1RLTA 3PUHA 1JKIA 3X1WA 2WAQA 4X95A 2KSWA 1RJPA 1B23P 1G5PA 1ZIXA 1I80A 4FYIA 3A0RB 3WNCA 4EQ6B 1EDOA 1J0DA 3GV5B 1NRJB 4YCSA 2GEBA 4AQDA 4HY3A 3MK31 4H16A 4Y0AA 3WB9A 2L18A 5CFNA 5F51A 2EBWA 1YFJA 2WG0A 4I7HA 3MWYW 3Q3VA 1TCUA 4KJXA 5CGQB 1MC5A 3VR5A 4DR7B 1RP7A 4M0MA 4OF4A 2PPLA 5JZBA 1LXCA 2XZLA 1UFRA 2DQZA 4TTJA 1VL2A 3K2QA 1U1EA 2IV7A 3GGSA 3V1UA 2J0UB 4P36A 1YHNA 2Y71A 4HNUA 3LK7A 4BMDA 4PZ6A 4FEEA 1WSAA 3ABSB 3RRZA 4LFAB 1UQRA 3JAKA 4PPFA 1YDHA 5COBA 3RUCA 4EYQA 2VQEB 1U63A 4LJKA 4BZPA 1D6JA 1QKIA 5L3ZA 3O4RA 2IPNA 2Q27A 4M9ZA 2F48A 2FY8A 2EVWX 1D5WA 5LLTA 2VZ9A 2IXDA 4HXYA 2ZBFA 1O9GA 2XRZA 3W6ZA 5DG8A 5JQGF 1SXJA 3GTKA 2BF4A 3AF0A 1WULS 4BJ3A 4OQDA 1NFRA 4U7PB 1Z83A 1E6UA 1G42A 3LVRE 5KJ6A 2A9QA 1G8PA 2HHAA 2I6UA 1S0OA 3WLQA 3ZX5A 5IH7A 2O8BB 4ZI7A 4EEQA 4IHJA 4LVOA 3PPIA 4CTJA 5JO9A 2HIXA 1DKOA 3NPAA 3U62A 4CLEA 4FSXA 5CDHA 2C35B 4XEHA 5FUXA 1M6WA 1T91A 5DAAA 4DANA 1WCXA 4RZRA 5A5EA 2J3LA 2C31A 2C1XA 3C3KA 5JNVA 4Z8YA 1BX0A 3HBAA 4YRCA 1SCNE 2WU3A 1UXKA 4EJMA 1B7GO 5I7WA 2ZULA 4OQMA 1T9DA 1UEXC 1FDSA 1Z4QA 4Q9NA 3PR1A 4ZGWA 3QYJA 4GPTA 1YRHA 2Y67A 4BLSA 4YI3A 1PBNA 3DJYA 3OZ7A 3ZI7A 1Q1BA 2PGXA 2XKJE 1L4MA 1U5AA 2WNIA 1TADA 1MO4A 1PFVA 2YRWA 5GM1A 2OR3A 1MAHA 4CQJA 4EW1A 4C0XA 4PRLA 4F46A 2V7TA 2EJ3A 2F43A 2XE8A 1T4CB 3ANSA 1XROA 2AEEA 3IPLA 5G1NA 3GTMA 3EEOA 1OBHA 4Q12A 1WU7A 1TM4E 4NZ9A 5F35A 3GLHA 1GLVA 1TVEA 2PH1A 3A1SA 4IMIB 1TIKA 5JDIA 5DNUA 3ETJA 3R0IA 4XKJA 3U7EB 2J6SA 4LF4H 1N8KA 2CNLA 3E4CA 1NU8A 3C3DA 3S2UA 1NN1A 4PZ8A 4NSNA 2ZR9A 4HDMA 5JISA 5JY1A 1QP7A 4PX9A 5HKLA 2VTDA 4ZYZA 2Z6UA 4EFEA 1NOIA 3ZWOA 2QAJA 1U0LA 3D2AA 5TVGA 4ETWA 3RADC 4BNDA 3IMCA 1XNJA 3NYIA 1KY5A 4DPMA 4MNTA 1YU9A 3FPKA 4ED9A 4BQEA 3MAJA 3BL8A 5B1IA 2XMPA 2C5EA 3R3YA 5FOQA 3SAJA 1XFAA 4PAQA 4LMYA 1A8SA 1M34E 3LQ1A 3I4LA 3SSNA 4C3OB 3EDCA 4M87A 5K4GA 5HJ5A 4ZYVA 3SZOA 1TZCA 4AZVA 4EG7A 1RJDA 3TG8A 1KAHA 1RZ3A 3A6JA 1G60A 4Q03A 3TNLA 7ABPA 4JODA 2GARA 4GOXA 1YJBA 5CX1B 1G8YA 3VU0A 4RAZA 5G53C 5I51A 1CDDA 4X1OA 4RTNA 3DTFA 4MWSA 4B4OA 2WKRA 5IASA 1HRKA 2F67A 4QO7A 5AWFC 1CUAA 4G0YA 2COGA 3UATA 2C7OA 2FGKA 3LDFA 2DJ5A 3WRYA 2QMYA 3S1LA 4CKCB 2BDEA 4DPKA 1DPGA 4R16A 2REQB 3SQMA 2XYHA 4Q6BA 3WZ2A 1LI7A 5KSOA 4GE0A 3FMOB 2HA3A 3NAMA 1E89A 4PZ0A 2IF2A 2V97A 1EUCB 3BCUA 4UU1A 3GRCA 3TTTA 1M10A 5FOVA 2QIPA 4PSKA 4KL8S 3RANA 5JJCA 2K87A 2OBLA 1MLDA 3BE5A 2NZ8A 3M1IA 1WCWA 4WK0B 3TQCA 4CM1A 2O1XA 3AV0B 4ML3A 2OCYC 3OIDA 4YROA 5D6OA 2NSHA 2AMJA 3EZFA 3VM6A 3GILA 3QXHA 1PLLA 4D9IA 3H5OA 2H7CA 1SXJD 1Z5WA 4AQYH 1OF1A 3MR3A 1NPYA 2JLBA 3LKVA 3K0KA 1R64A 1I2ZA 3M34A 4Q7KA 1SG9A 4AP9A 3LI2A 1D09A 1WVMA 3GPBA 4F5ZA 1DFHA 4G1UC 1ZA1A 4YRLA 1VE5A 3EAQA 4HTAA 4NFLA 4DV3B 1WZIA 4C4TA 3PLNA 4WKCA 4R9NA 5DX1A 2QZ9A 2OXEA 2W9CA 1Z74A 4JI7H 3QLVA 3QPBA 2OGTA 4IJQA 4KVFA 4AB1A 4IGEA 1P8LA 4PZAA 1QX4A 1RPAA 3U40A 3S40A 3FSGD 4PCLA 3NV7A 3NRBA 3WLKX 2A0XA 5FOTA 3GAZA 1JA1A 3PW7A 5LQMA 2JIRA 3KE8A 1UBLS 4KUEA 1L5HB 5ESXA 1NQ5A 2HEGA 1E3SA 2ZWPA 1DAHA 2OZLA 1NYTA 3P96A 4TV9A 2EBFX 2BMEA 5E9QA 2OBFA 1U28A 4ZVOA 4EVSA 1Z6XA 5EY5B 4CETA 4MTEA 4BGUA 5LXTF 4N0DA 4F85A 1C8LA 2CZQA 1O96A 3STVA 4HYYA 3GJYA 4LXYA 3H2JA 3CLUC 2DFLA 3ECSA 5CHYA 5EZSA 3ZK8A 4LX0A 1EGMB 4IIEA 1CJMA 4DUGA 3DXFA 1USKA 3DOJA 1UOQA 1OROA 2MINA 4CV2A 3L1UA 1FYDA 1S7GA 2WUGA 2N42A 4RW0A 1WM1A 2YNMD 4WESB 3ZVRA 2AFHB 2WU0A 4O7SA 4MZXA 1LDGA 1XRQA 3HVHA 3RFCA 4BUCA 1VA4A 5ITSA 2P1DA 2O8CA 1PSZA 4PGAA 2W7OA 1KZ7B 4FYVA 4MV5A 3SVZA 4F6RA 2JA7A 2GZ3A 1E0JA 4R8SA 4E94A 1XFDA 2WSYB 3U60B 1MMFB 5KVCA 2VDLB 1VHLA 4MI3A 3T52A 1TWFA 5DX8A 4Q82A 1SPXA 1UK7A 3DE6X 1E1CB 3WL4A 4DREA 3KKZA 2AS0A 4NC9A 4TL6A 1PZFA 2AZTA 5C1OA 3OCCA 3FROA 4YR0A 5C18A 4H08A 3CUKA 1RHKA 4FC7A 1ZK0A 2X2EA 3SOZA 4GDMA 2R62A 3BFXA 1IJBA 2HT6A 5I5WA 5GY7A 5HFJA 2EYQA 4DV6H 1CY0A 1UDBA 2CK3D 3IAS1 3V46A 3IJPA 3KETA 5HA5A 2BD0A 4B3RH 4G4SO 4DQUA 1P6QA 1YQUA 5E0KB 5H3CA 5DJ5A 5JYBA 3ZDBA 3DYVA 1L3IA 3NAQA 1G8JA 1Z5NA 2JA8G 2JZNA 4M2LA 4N54A 3I92A 2D5IA 4CF6A 2IHJA 1B33N 2OO3A 3NHYA 4BMSA 2ZROA 1EP1B 3W3AD 1COZA 4WDQA 1T5TA 4IVQA 3ZCQA 4EI9A 1NW6A 2CYAA 1S10A 2WK1A 4NFHA 1NQOA 1JEDA 3HBMA 4NXNH 2UUOA 3OQJA 4C0QC 3WKDA 3UJAA 4DUZH 4WCDA 4UHHA 4L4XA 3KQLA 3EPHA 2NV2B 1FLVA 3P9ZA 1KDYA 1O6FA 4GBED 2FYTA 2NT3A 2V5VA 4QYTA 4CG3A 1KYWA 2BGMA 3A26A 3R0XA 4I4LA 3OI7A 1KTIA 2O0MA 4AY2A 3EIUA 1TTPB 2E4YA 2X6RA 3G1WA 4BNHA 4GHWA 4PIMA 2E4VA 4RPLA 4GYJA 5JC8A 1K8RA 1HK7A 4PAGA 1LJLA 1PFQA 2XD9A 1XYGA 4A2WA 4WERA 1JHUA 4EBFA 3MWDA 3AP3A 1IOLA 2W83A 3FFXA 5E3IA 4RM3A 4HGYA 1NW3A 2P9GA 3IUJA 3KPJA 1O94D 3T94A 4ZKDA 3WA7A 5AQ1A 4NS1A 4QXPA 5B7NA 1J2TA 1XAHA 2MOKA 4DNFA 1K7FB 4KN9S 4RYLA 2FXIA 4Q1DA 1MBZA 3KAPA 4BEWA 5A2QW 3KQKA 1K1QA 1N25A 1Z8NA 4I8XA 1TM3E 5JXHA 1ZI8A 1PNRA 2YWXA 3PHLA 4RLFA 2UYQA 4BGVA 3NFYA 1B6GA 4ED8A 3WWCA 3DAAA 2QPOA 3IB3A 4LYAA 3NUQA 3PO2G 1E1RD 5DLQC 1XALA 1FLNA 2XE7A 3OPYA 3QF4B 4GO1A 5LKRA 4A0QA 3GQBA 2HRDA 3NLLA 3KSZO 4RETA 2WIBA 1J9EA 2EIXA 4TQAA 1U0NA 5JNSA 4G26A 5K8LA 3DT8A 1K97A 1MAAA 3L8CA 4O1MA 2A7QA 3PNYA 1XPJA 4DV0B 3E9YA 4OAPA 3UN1A 1C9NA 2P2LA 2CXUA 3OD1A 1F8FA 4L3WA 3IHKA 4OLHA 3HOVG 2H52A 4UTZA 4YBZA 1C81A 1JIKA 4ZU6X 1Z36A 4K46A 4M9RA 4WZAB 5DHUA 1Z38A 3ROGA 4BC0A 1SOUA 3K0FA 1P5RA 3EDYA 3W5AA 1XDBA 2G09A 4IXNA 4MWOA 1BHJA 2ZRNA 2C4HA 3D5TA 1PK9A 1BO6A 5JCPA 3MJTA 4AKIA 2ZANA 3NVMB 5DTQA 4IP0A 3MERA 5J3JA 2NVOA 1JLLA 3ENWA 2OKGA 1XK6A 2JFGA 1W34A 5L3SB 3WLOA 2NUTA 1CKOA 1JR4A 1U3UA 3E23A 3WK9A 1YI1A 1QTRA 2A9JA 2RK3A 2R66A 4MMXB 4MO9A 5DN6A 3UFXA 1IBRA 1GPMA 4KI7A 1SRRA 3LPAA 3WBBA 3R6GA 4ANFA 3E5HA 2ZVDA 2F00A 2PNJA 1FFCA 1ADJA 3QFSA 3C3WA 3SC2B 3QUAA 1TJ4A 1RWOA 3U9TA 1FFWA 1WV1A 5HQ3A 1Z6QA 5AJZA 1XZAA 3VR6D 4BQSA 1W0KA 4TSRA 1W9MA 4KUHA 5HJEA 4IJUA 1E2LA 4JIGA 1ISFA 1I94H 1Z0KA 1ZVJA 1ZX1A 3GX1A 3HP4A 1KC3A 3LVFO 1A5BB 4E07A 4ZJPA 5BNZA 2YVKA 1JHVA 3ZZMA 3FYDA 4ETMA 3K8OE 2J5RA 1TKCA 3DO5A 3RBVA 4D25A 4HB3A 4GX5A 3RTDA 4GICA 2VJPA 1IDOA 2WTFA 4QYSA 3NGLA 3X2SA 1RPZA 4CKEA 2FUG1 2Y27A 4GE3A 4BVJA 3F3MA 1P8AA 2IXBA 2JBAA 3MFYA 4QGFA 4R8UB 1ECFA 4KYIB 1RWMA 2AYZA 2GBGA 3H4IA 1A96A 5H0IA 4B6SA 4BB0A 3RU3A 3UYYA 3BERA 4QFCA 4NAHA 4RSRA 3DEHA 3EGEA 1HMPA 4BPRA 5A62A 4WNCA 5JZ9A 2ALZA 3MS7A 1Y1KE 5KFNA 3DW3X 4WOCA 3PVCA 5AM2A 5JWOA 4G41A 4EG6A 4ECWA 1HX7A 3PL5A 3VUFA 1YZYA 3QTTA 1VRCA 3MN1A 1BC5A 1FOEB 2Q6VA 4GI7A 3STHA 3ZDZB 3ZZ0A 2IBSA 2OHXA 5EJ2A 1BXGB 3IC5A 4HN9A 2E87A 3KJZA 4QXAA 3S29A 4NDZA 2OHFA 4H77A 2HDNB 1THZA 3RIZA 4MA4A 2VHZA 3UXYA 3NVAA 1BW9A 1J8FA 4B3MH 1MRSA 2I62A 3DB1A 4MQEA 1UM8A 4UREA 3M3DA 3V8BA 2AX4A 2IBKA 4IHJB 2ATLA 2VUTA 1NIJA 3HO1A 3KKEA 4Q05A 4J91A 2V4UA 3TMYA 1MB4A 3ZCRA 4BN4A 1YBMA 4E4YA 2UYCA 2TRSB 2FG7C 2XF8A 1PGJA 1EKPA 2EW8A 4DXDA 1GZ3A 3FJYA 3C0FB 5DTJA 2VJDA 2XDWA 3DFIA 3GNLA 3PJDA 1HSOA 2I4LA 2ZU6A 3CR7A 3AERB 2X5OA 4A0RA 1UBEA 1NPTO 1H1LA 1JNXX 1DI0A 2HQ1A 1ZJ4A 4FS3A 5ERYA 5LB4A 3PZBA 3UUGA 3PZRA 2PV0A 3HVJA 2IRWA 3QVTA 1P2UA 1WB5A 3EUFA 1TL7C 5CFOA 5FYDA 1H2FA 2GILA 4KEAA 3HVRA 2YWHA 4X00A 1T2NA 2MHCA 1BVUA 5GADl 1Y81A 3ZGYA 1DAKA 1CQXA 1OW3B 2QTLA 2XTJA 3DG9A 1S9HA 3CB2A 3TOVA 1NBAA 1G55A 4L15A 2MCTA 3GEMA 5C4IA 1ZGAA 1HR0B 3KYIB 3R7DA 5EJ7A 1GARA 1U2EA 3HABA 1QANA 1LSJA 1TZBA 4RB1A 1V4YA 2WHEA 1YRAA 2FSUA 2GLUA 4OHPA 5FBRB 5FL7A 3BREA 2RKOA 1GA6A 2FZ5A 2Z43A 4PC3A 4TSFD 1K9VF 2XB9A 3VNQA 3UBTA 1WUKS 2RHMA 1KQGA 1X15A 5J2TB 3QW2A 4HDNB 4W9NA 1O95C 5LQSA 3KZ1E 4PWYA 4AS2A 3E9CA 4X65B 1B15A 1TJ5A 2X7XA 5FCDA 1M6VB 3SS7X 4ER6A 1RABA 5CXSA 1TPZA 3R76A 2XCOA 3K70B 4UHBA 4Z99A 4CUKA 3WRXC 1QMPA 1KGSA 2XWSA 4QD3A 2OILA 1GKKA 4QULA 1BQ3A 1EWYA 1DE0A 1P7VA 4RJLA 3RBZA 3JR3A 1PR1A 4EZIA 2L69A 2ZIXB 1MIOA 4B4UA 4QO8A 2OCXA 3UK2A 5LNK1 2FRVA 3AYHB 1DXOA 3JYQA 4O4HB 3TFQA 1XOIA 3CEHA 2PT7A 1FDWA 1ANKA 2Q5QA 3D3KA 3HYNA 1BCRB 3O92A 3C48A 3Q2KA 4MQUA 3SHQA 5LQUA 2CL7X 5LQDA 4E30A 3FNRA 1IOWA 1DJNA 4YJFA 2YH2A 4U6PA 2XTZA 4PHTA 1LB1B 2AG8A 4XAQA 3SYNA 3NHLA 3CG0A 2ZJ7A 3L7KA 2CXSA 3TCKA 2W2MA 3DS8A 4C21A 5K8JB 1FMCA 1R0KA 1TW2A 1KK2A 1ZL0A 2IYAA 4Y7CA 3RRXA 1NVFA 3EMDA 4FK8A 4AZSA 2O8DA 4CQMA 3N7AA 4OHOA 1COWA 3TD2A 1SAYA 1D1PA 1GQOA 1WEKA 2QA5A 4HNVA 2HA5A 1T0PA 2FMXA 3DLPX 3I6IA 1HYGA 3V6JA 1KIMA 3OSUA 1Z08A 2LKCA 1RAAA 4RKRA 2CDCA 1DRJA 1NXQA 5LLSA 1X1EA 3CX4A 3WP0A 1RYBA 3FD8A 1SC6A 5ALYA 3G0OA 3EY9A 2OYCA 2GEJA 1LPNA 4CRWB 3JTMA 1Y8CA 4R8LA 3L41A 5KVSA 1MHTA 2LNDA 1EM6A 3M6AA 3OTWA 1SKUA 1EI9A 4KQCA 5AKEA 4ALNA 4EF5A 4GMDA 3SXPA 3VU9B 1FUEA 5KYTA 3AVOA 1LEHA 3CN9A 4GPIB 4Y2VA 2QLBA 2LKDA 4KPEC 4PYOA 2XUIA 1O2DA 1GGMA 4MS1A 2ZJ1A 3B5JA 2P3QA 3H5RA 3LZ6A 3N87A 4R7RA 2PWBA 2WAXA 4OI2A 4F72A 1UZAA 1JFLA 3RVBA 3BTVA 4G4JA 1ILEA 3ZWCA 3GLGA 1GNVA 3QX3A 3I9V1 2IYUA 5CB4A 1HF3A 1VSVA 3M3PA 2A1HA 3GXBA 3QU9A 2A5JA 4LZNA 3F3YA 2XPCA 1X42A 5FLEX 1GKYA 1E4OA 3KVVA 2FE4A 3H2IA 1E8NA 4F4UA 2N0SA 1QGDA 2WAQE 1ZGCA 2EQBA 3U6BA 2XW6A 2Q49A 3GLIB 1OH6A 3FPGA 2BM1A 3TLYA 1H2BA 3U4HA 4F1JA 2KQUA 2IUTA 3AFMA 1CE8B 3I64A 4I5DA 1QGAA 4B3SB 5JEEA 4PG8A 2PMKA 3VH2A 1K6IA 2B6HA 1W9HA 1WE2A 1TO1E 1WHSB 3GPCA 4IKEA 5HDQA 1NF8A 2EWMA 3DDUA 3N2GB 4HI0E 4LBZA 4MMYB 2EJ0A 4ZRNA 4ZKEA 3WQQA 4QG3A 3V8NA 3AOGA 3EPPA 4Q7EA 1E1MA 2J6TA 5JEDA 1FYFA 1VMIA 2EIYA 2C4WA 2G4LA 2AWOA 4RGBA 3G7SA 2GK3A 5H9VA 5GPBA 3W5VA 1BGVA 1EVYA 5CD1A 5GJVC 5C7IO 4G84A 1OAOA 1KAEA 3NGXA 2ORED 2G5PA 2CB0A 1ATZA 2ZJBA 3FCEA 4K9PA 4Y6GB 2HIVA 2YFYA 4ZU3A 1P1CA 3WBFA 1F17A 2RJ3A 4TTPA 5FUQA 2IY9A 1ONSA 3GRKA 1M2VA 1H2ZA 4RCVA 4F12A 4HFJA 3DBLB 3VZDA 1PZEA 2R7LA 4C2UA 5CH5A 4AY6A 8AT1A 4CL0A 3M1YA 1D1TA 4QIHA 1N2CA 2G9QA 3UWKA 4TKMA 4H0FA 4BAZA 1RFLA 3GFPA 3LT0A 5FTLA 2C7QA 3FTEA 1N2SA 2HADA 4TZTA 5DGXA 4I4NA 3TY8A 2D1TA 1SKBA 2QMQA 4BB6A 2PZAA 1W4RA 3D3JA 4P7JA 1O4WA 1II0A 2IP1A 4WFIA 5JAMA 1NVTA 1T0JB 4MV8A 3EEQA 5AM3A 1DKMA 1MIOB 2C77A 2VYND 4QPNA 2H1CA 1Z17A 1G5IA 4JBGA 1T5DX 3ROPA 4HNGA 4MEJA 5B4TA 1G8KA 3K3PA 2CQYA 1H2WA 5EPOA 3HJUA 2CNVA 1QHEA 3NDRA 4TV8A 5E7QA 4Z5XA 3MOGA 4O7VA 2QB5A 2OH2A 3LVBA 1JF8A 5AVUA 3OLWA 1AHNA 5KZMB 3HNOA 1A98A 2CVHA 4BLTA 5JR3A 1J0AA 2YYZA 2P5TB 4U2DA 4CF4A 4KNYA 5KQLA 1J5XA 5FUMA 2Q7XA 5EWFA 1LVUA 2ZGVA 3ICOA 1NJ8A 2NYUA 2G1KA 2VJNA 1QGUB 2WHPA 3DHWC 3P4XA 3PFNA 4PG4A 1SKYE 3BCRA 4UEQA 5DNWA 2X4IA 2Y1OA 2PBZA 4PN3A 3TLMA 1ISSA 5IAAA 3UW3A 5BN3A 1EXVA 1JAXA 3BL6A 2V6FA 1TZ2A 4MKGA 4QTTB 2CCJA 1XLTC 2X0JA 5DO9A 4D57A 1WOYA 2C5AA 5ED4A 2AUMA 4M1SA 2YZKA 3KOYA 2FCAA 4LNAA 3UAGA 1S2NA 3ICVA 4MVJG 2Y1KA 2QG4A 4O4IA 5EWJA 3ZZTA 4F4DA 1G98A 2V5AA 4EHIA 2HRQA 3GVXA 3OT4A 2P1ZA 3KZCA 5CA0A 4DMKA 4F3NA 3HXQA 3QVVA 2EERA 4FSHA 2V0NA 2AEMA 4ZI5A 4DIEA 5K20A 1EQUA 1M2KA 2ZXUA 5IVIA 2AHRA 3WDKA 1VP9A 1HZJA 2FP3A 1T0IA 2JAHA 1W1UA 1JZQA 2PL3A 2W43A 4QOSA 5EPEA 1U5BB 4QDOA 3NKFA 2YN0A 2P30A 4W7SA 2IEIA 3RRMA 3H11B 3S70A 2OBNA 2GN0A 3NT4A 2RHHA 5BSHA 1DIHA 2AW5A 4YFYA 2NQ8A 4EVQA 2CV1A 4A8TA 3H5IA 1GTVA 2A59A 2IOFK 1VIYA 5DM4A 2BHNA 1EDZA 2C9ZA 1LTQA 5REQB 3ZDAA 4L27A 2GRJA 1PYOA 2YV2A 5A7FA 4YR9A 5AO9A 3JQ8B 4E6NA 1T24A 1H9BA 1I01A 3QFHA 4TTQA 1SNYA 3LXMA 1DTWB 1NVEA 4ZOLA 1NURA 3P7MA 4G65A 3OCUA 2UXDB 2BWJA 3SSMA 3KZXA 4C9BA 4LJLA 4AMUA 5GZ6A 2MSEB 2SHKA 4LY9A 3W79A 2Q4TA 3LO8A 1IB0A 4HYEA 2IYLD 3HUTA 2FQYA 1P17A 3OURA 4BNYA 4KR9A 1VMEA 5DISC 4ZD6A 1G8GA 2DB3A 1Y3DE 4Q1VA 1XIVA 2BEWB 4D56A 1ODSA 5JPIA 1A5TA 3UB4A 3RM3A 5J4LA 2ANCA 3RFTA 3S2FA 4TRMA 5A4FS 2ZT8A 5AVZA 4P6VF 4QEKA 5BWOA 3JVUA 4R0VA 1XN1A 3RAFC 5DGAA 1YVDA 4NZOA 2AJTA 5KG5A 3GDGA 4RL4A 3F97A 5CVDA 1G3IA 1AGXA 2E49A 1AGNA 4CIDA 5HGXA 4OUKX 1PR2A 2PMCA 1C3LA 2Q6KA 1G9XA 5JYCA 4TUYA 3VR4D 5DVZA 3MJHA 4KQHA 3SNOA 3OG9A 3R3SA 2ZGIA 2XYVA 1BMFD 3P71T 1Y1SA 2ZDHA 2JAPA 3AHCA 2DQ4A 5KFOA 1W0JA 4MTLA 3E82A 5GOTA 1KSGA 4CMEA 2OSBA 3CMCO 4FHCA 1ORRA 4GYYA 5IF9A 3IVXA 3NOXA 3OTHA 3B7WA 1U7HA 5JQGB 4CMIA 2GFHA 2WUWE 4LXQA 3PNVA 3SZGA 4F2PA 4X9XA 3I9NA 5E6RA 4CG0A 1O6ZA 5LP6F 1EFPA 1XTBA 3SNHA 2QR5A 2XOEA 3DZGA 3F6CA 3SQNA 4CQNA 1FLAA 4EYOA 4HRXA 4RTJA 4CTMA 4HLNA 2AJLI 1QG2A 4K3UA 1B3RA 1YS4A 4PF1A 4V0QA 5B4VA 1XHEA 3CBGA 3SYKA 2JGRA 1TQ8A 4WA7A 2DX7A 2G82A 4NL4H 2I7XA 1CIVA 4YWJA 5WRFA 3HKCB 1JYEA 4O2AF 5EJAA 3FWYA 1NJFA 4NCKA 1F9AA 3VJKA 4MYRA 4N5DA 1R0WA 3DYBA 3TR6A 5FULA 3W9YA 1LSOA 3EDOA 3HEMA 1A48A 1KL7A 2YRXA 4XYEA 5A5DA 3H8WA 1QM5A 4LWQA 4OQPA 2XBLA 4G4GA 1SKAA 4CTNA 2I6FA 3FWZA 1D2AA 4QW8A 3B6IA 3RWMB 3ZEIA 1QRSA 3TOXA 1Q83A 3O1LA 1EVLA 4TS1A 2CF5A 2R6ZA 3KSBC 2OY0A 3QE9Y 2PUJA 1N8TA 4J1NA 5HRCA 4YPFA 4HDKA 2QRMA 2QMZA 4J9PA 5TNXA 4JKYA 5FI0B 4D41A 3L8ZA 3PF8A 2JH3A 4Z53A 5AMXA 4IH9A 5P8WA 4JDPA 2YJ4A 4YAKA 5IKEA 1NQAO 1HDYA 3SYRA 1Z0JA 1I0IA 4L6CA 2ZSBA 3IIMA 1H0SA 3WLPA 3G3EA 3A37A 1P0IA 4BY7G 4ZGGA 2VXYA 4BNKA 2D2IA 2RH5A 1WUJS 1DFGA 2WMDA 3X3HA 5HWSA 4QM6A 2WA1A 4RJJA 5IVPA 3WGGA 5KS2A 3E27A 1K5DA 3MWLA 4DLLA 2HJ9A 3D7KA 3OCWA 4RFVA 5T4BA 5DIZA 2I7TA 3NBFA 3OE1A 1M34B 4M1KA 5F78A 1XCLA 1FE8A 4WACA 4B3IA 3SFVA 5C5EA 1S68A 1TWCA 4E1BA 1O7JA 3TECE 1B0UA 1N9ZA 3O74A 1M8KA 1XA0A 5SY9A 1FMTA 4R01A 2L82A 2X2FA 3HVIA 4NATA 1RWKA 2WSSA 3BCSA 4G1VA 5EMLA 3T3GA 1OFUA 3TQSA 2X4GA 3R20A 2O20A 3FPSA 1ZGHA 2PL1A 3DONA 1WMFA 4UZSA 4EF4A 2C9DA 1WSCA 2J3HA 4OHUA 1JX4A 1EZZA 1POWA 3P9RA 2MYNA 1NVUQ 1Z0ZA 2Y6UA 4X62B 4E13A 2GXSA 1O4VA 3NM4A 5B37A 3IVAA 1SCJA 4OJYA 3VDQA 5C5DA 2ZM6B 3A4IA 4RY0A 2PGLA 4N03A 4BPBA 4JXUA 3MPUA 3PQ3A 2VQDA 3A70A 3HA7A 3GUHA 3PA6A 4EAQA 1SUBA 1B6RA 3ZY6A 3ZWAA 4Q3DA 1XDGA 2BH9A 3RVQA 2VUUA 1QYDA 1Y82A 3ZWVA 4JI5H 1T9GR 1W8IA 1PFYA 2OGZA 1V71A 2GZAA 1XTPA 3O82A 4UOQA 1KSHA 1Z68A 5ECGC 5LB2A 1YQTA 3SXUA 2PLWA 4A91A 3IDQA 4AMGA 2DETA 4M1OA 3IPYA 2R8RA 3IMEA 2IU6A 4BKOA 2XBUA 1SQ5A 4V2IA 2G5GX 2X9VA 1EFRA 4FUTA 1ZR4A 1KMCA 4MW5A 3ZPXA 3B6ZA 4JS0A 4NI5A 5IP5A 1A9ZA 1WU8A 5BY2A 5K6RA 1N75A 3Q3GE 5K3DA 5EG5A 2CCKA 2CEAA 1DELA 3KBOA 4YYZA 4K6NA 2WOJA 4F56A 4DL3A 3T4PA 2IIBA 3AF5A 3OE7D 1QRTA 1E5QA 2W6JD 3UWOA 2QPLA 4I7EA 5G0WA 2Y9PB 3D3NA 4I3HA 2C2OA 1KNXA 1RVV1 3NC0B 2GD0A 3EJ6A 4NDNE 1FNCA 5TGDA 4IZIA 2CXHA 3A1VA 2D54A 3JVDA 4Q16A 2P9HA 4D5GA 1C3VA 4EYEA 3W5CA 2VDJA 4YMIA 2RJNA 3GRAA 1ZG3A 4EB0A 4YAKB 1N33B 3MS4A 4P1ZA 1UBOS 2OLKA 2NXJA 5J2UA 1MEOA 2VRNA 1KPGA 2Z8XA 4WDRA 1UBKS 4JEMA 4QDXA 2O0HA 1OGIA 1K6MA 1HWYA 5IHXA 3H2SA 1HTWA 4CCSA 1EYZA 4BLQA 2DHDA 2I3ZA 1E63A 5U1PA 3KAQA 3D6TB 3BA6A 3HGMA 3PXCX 1N9GA 3TVYA 4B6FA 1XTQA 2DLCX 2QRLA 2QMOA 4J0HA 4ROSA 3FJOA 4KN8A 2XB6A 5TB5A 5DQIA 1ZXXA 1QHHA 2H5LA 4CCYA 4DMGA 1L4YA 2IS2A 1YCHA 2OCBA 2P2YA 4ZVTA 4Z0NA 1C30B 3DBVO 5SYMA 2Z08A 1AGYA 3BJMA 4C78A 2DWUA 3JSAA 1TC2A 2XRFA 1GZ5A 3FTPA 2W42A 1M6YA 4Y2YA 1V1MB 1V16A 3OPYI 1Q0RA 2F3UA 3SC3A 1XYVA 5M7EA 3LHSA 2YRFA 4QWAA 3OTOH 3ZHOA 3N2NA 5FPKA 3KSAC 2QL7A 1DQSA 4YV0A 1PT6A 2HLDD 5C46F 2A8YA 2IHBA 2QG6A 1PDVA 1P5FA 4O3PA 4PWQA 2R86A 3ACBA 3FA2A 1KK3A 3DBHA 3NTQA 4MDYA 3UHFA 2O8EB 3ZQ4A 2GM4A 2VQSA 1DAIA 3F8TA 4BHTA 4TL9A 3VH4A 4YIKA 4D4IA 5KFGA 1N5JA 2FE1A 4HPJB 1ZO8A 1YOVB 3EG9B 3EXEA 3JQRA 1AN7A 3VPGA 1EFVB 1N0WA 2HA7A 4MDHA 3U3RA 1A95A 1K0UA 3B36A 4YYEA 1FVFA 5T67A 2XNHA 4RH1A 2KWIA 3OIVA 4CU2A 1NLUA 3BTSA 4JEUA 4ZXFA 5KDOA 1PQ4A 4ZVSA 2DBVO 1EGAA 1HLDA 2QKYA 3GRUA 3QWAA 1R0SA 4OHKA 3SK0A 1NM5A 1OBFO 2UXCH 2V4RA 3BEDA 4RAYA 1X0XA 3KVRA 1PQYA 2IU3A 4X7RA 2A14A 4FCTA 2FU5C 1MB3A 2R11A 2CLKB 4XGRA 1JIVA 3H9BA 4QREA 5LZ5A 1PJ3A 4F45A 2XUDA 1I32A 2BOVA 4U6NA 4IJWA 7ADHA 3P45A 2G07A 3LYLA 1U2DA 5TPWA 3UT0A 3QF7A 2A2ZA 3SIPA 2LDXA 3K16A 3T12A 4BFCA 1UWCA 1JUDA 4ECQA 3ZCUA 1RFGE 1YS1X 3AYXB 1EZ4A 4JI7B 3E2IA 2I22A 3CVYA 1Q0SA 1U0TA 4ECTA 1E2GA 2VH5R 2V7WA 5TS3A 5B57C 5KFRA 4EARA 2GK4A 3PV0A 3UB2A 1AB6A 2OB2A 4WW0A 2CLMB 3WIDA 4YK7A 1OTXA 2PIDA 1RC8A 4YUYA 3EY4A 4A3EG 1XZJA 2BFFB 2DUJA 4BO8A 1P4HA 4KNWA 3BAZA 2J3QA 4KHPB 3AGQA 1HC7A 3FUCA 3RSSA 5BWBA 1MJGA 1H5NA 3K96A 3DYIA 4JR0A 4A2PA 1A7UA 2P65A 4E5NA 3D6NB 3NEPX 4UNNA 4XI9A 3VC7A 2JCVA 3D2BA 3TTUA 1YH3A 1V5WA 1J00A 2VG8A 1XAGA 1SO8A 3UHAA 4B44A 1YBVA 4HC4A 4N18A 3SQDA 2ZFUA 3W0LB 1M1YA 1CE8A 2NW6A 4IH4A 3LX8A 1M3SA 1EQAA 1FDOA 2GTIA 1WCIB 4M0DA 3W9BA 3VYTB 2CD7A 2QD1A 3AK4A 3DOFA 2Y4OA 3HL4A 4IUYA 5FL3A 2ISQA 4FI3C 3SJAA 2XMDA 4BWGA 4PBSA 5FLMG 1SK9A 5FNZA 3ORQA 1C0KA 5B53A 1IM2A 2X0NA 2A9KA 3RSCA 4NCBA 3G2PA 1KJQA 1ZA2A 3ZS8A 2JIQA 5ITWA 2W8KA 4WOPA 1JA0A 3CSUA 4M0CA 1N36B 3N42B 1E4GT 5KFHA 4HSGA 4HD8A 3CEBA 2W2NA 4OGWA 3PBKA 5BVHB 5EHIA 1BDJA 3DW1X 2NU7A 3CQ9A 5DN9A 4LDNA 4Z8XA 4M83A 3S3TA 1PJ4A 2C3UA 1QIGA 2I2DA 3ZWPA 4DJEC 1AKYA 2ZUFA 3T1HB 1XKTA 2P9EA 2FKNA 3SBOA 4H3VA 4BNLA 3AW9A 1VB3A 2HGWA 1CT9A 3P52A 1MH1A 4UBIA 3DL2A 4I9FA 3T7RA 2XHEA 5BV8A 3Q8WA 1Y6ZA 2APJA 2ILTA 4GGOA 2K4MA 4I9NA 4XLTA 5CPBA 4YRQA 5EMMA 3E3OA 3VVMA 5DGBA 1PZNA 2ZIZA 3OZVA 4GD3Q 3HO8A 2FMHA 2QXYA 1OFUX 4DJJA 1UJMA 2G83A 2Q29A 3E35A 3RYCB 1RCTE 2WDTA 1YGPA 2FDRA 4JKIA 3PCRB 4J90A 4MAAA 3AIIA 1N0HA 6YASA 3ER8A 3OJLA 1YE3A 3RJ0A 4A3BG 2BFEB 1C9KA 1C1XB 2J9XB 2OK8A 3JYPA 5C81A 4BNMA 1GADO 2DH5A 3IQFA 4NYMQ 3NW9A 5KSPA 1Z4LA 1G3UA 1I7LA 1N57A 3A9RA 3IPCA 1WP9A 3DE2X 3KQHA 4MA5A 3FLMA 4PYNA 3AG5A 3C41J 1RHRA 2B7BA 3BF8A 4LC1A 3L1KA 4ZEWA 2PY6A 3N58A 1CQZA 2R00A 1NF3A 3K1TA 3PW0A 2AUNA 3H2GA 4J3JA 5TX7A 6AT1A 1R4ZA 3GT3A 3L4BA 4OHBA 5TIIA 5TE9A 1QQ6A 4DADA 4DAOA 2GBFA 1RI1A 4UVEA 4LI3X 1VBNA 1T9GS 2IEYA 2HZBA 3UIEA 1RPTA 1THTA 2GVZC 4YCDA 4UAVA 3RRNA 4DNOA 3AEUA 3UKOA 3S7ZA 1TF5A 1SBHA 4O4HA 1JSLA 4EQ5A 2FZCA 5EIWA 5BNTA 4HFNA 3HU1A 3DLTA 5HIJA 4CL8A 3W2FA 4N9WA 4M0LA 4Q93A 4GUAA 4FHDA 1K63A 2GTHA 2YMLA 1QB8A 3C8UA 3LXRA 4FR2A 1JPNA 4OYLA 4U7WA 1OY1A 5JSFA 4ZQGA 2HI0A 4ETSA 1WXXA 4B0PA 1BX1A 2GEVA 1QOZA 4D4LA 3GFFA 1QIFA 3KBBA 2A33A 4G0QA 1POXA 3H13A 3MW8A 3SIXA 4NG4A 1UKZA 2H8KA 2QN9A 4IOLA 5FWDA 3SYTA 4CDGA 2R8JA 5JD5A 2R97A 5ER9A 1GCOA 3T4UA 5HQ3B 1QIEA 1GPNA 1UDXA 5HKOA 1TVCA 1NDUA 1K5GA 4QJ5A 1JB9A 1KRWA 1CY8A 1G20A 2JLCA 4I1SA 5I3ZA 3LWDA 3HOWG 2OUIA 5DTIA 1JHMA 2SCUB 3CLHA 1Y6GA 3PNQA 3V2IA 4GI2A 4BLRA 5BWLA 2BFFA 1Y8QB 1AY0A 5IAJA 4BXOA 2MJLA 3KWLA 3J7TA 2TMYA 3PWKA 3REQA 2X0RA 3UHOA 4ALIA 5JXIA 4UTXA 1E62A 1CQJA 3L1HA 1NXWA 3ZNOA 1E7MA 1VPDA 2QRPA 1SEVA 1X0VA 4Y7DA 3E0XA 5EVCA 1OVGA 3GFSA 2XNDD 2Z4TA 1HYEA 5KFSA 1FTNA 3IALA 3Q40A 1EFLA 3Q7TA 1K6XA 3D4PA 5CGZA 2QX7A 4NNJA 1XTZA 2H92A 2VP4A 5DNEA 5GV7A 4C0BA 4X8MA 4M9CA 1ONNA 3DE4X 2IX9A 6REQA 2WT9A 3NXSA 4KO4S 1F2UA 2XT6A 4H2DA 1Y7HA 3EUWA 1NNEA 3S2ZA 4JENA 3B1VA 4PICA 4UUAA 1N3YA 4HHEA 3E22A 1TYAE 2P7HA 3JRWA 2YHBA 3A25A 5GM2A 4ZCRA 1E98A 2FQQA 1I3CA 3NASA 2FTKE 5I4IA 1W49A 3E81A 2JCXA 2HPZA 4X85A 3O83A 3OCJA 4H1TA 4WADA 1J99A 1GXSA 3I2JA 3TVDA 2GAOA 4CQLB 1QRUA 1VLLA 1MENA 2WB2A 4NH0A 2BEJA 1MO3A 1RQ2A 2QP9X 2QD3A 3JZAA 1IY1A 1IXYA 4WBNB 1GYFA 1IULA 1QK4A 2L17A 4FE2A 2NTYC 5D3KA 3L8EA 4QFDA 3G0BA 4MPTA 3GGGA 4WXMA 4IR7A 2JJQA 1ORDA 1PWHA 3ECAA 1L4EA 3QHQA 4BGEA 3PT9A 2I9PA 4IICA 4HCJA 2G3YA 1FJHA 1XDDA 3PCXA 5JVLA 3DEFA 4BKUA 2BKLA 3L4SO 3E3LA 1ODTC 4QUDA 3EXG1 4H3SA 2Y99A 4KPUA 5B2FA 5L6MB 3ZKWA 4YVFA 2Z1DA 1U2GC 3LUCA 3MFQA 4DY4A 5F9FA 3W1BA 1WXWA 1TD9A 4YP5A 2C83A 5CFLA 3IEIA 4XW2A 5I5YA 4CF5A 3IBFA 4RB3C 1JFFA 3RVSA 1L4KA 1RI3A 3M3HA 3VTKA 4F2GA 1UPCA 5KT7A 3NNDA 4TMYA 4Y2UA 2RHJA 3O5AA 3JQQA 3EDQA 5IAKA 3ZR4B 4YRIA 3OZSA 1TNDA 5IJXA 5C4GB