2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
b'MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
2YZMA 2PN1A 5KKNB 1DIKA 4O7YA 3G8CA 4GGMX 4O7NA 4WBNF 3VOTA 2NUAB 5BPHA 4O2AF 3G8DA 3VPBA 5HBRB 4O4IF 1UC8A 5JQGF 4ZHQF 1ULZA 4MV7A 2W6MA 5C1PA 2CNUA 1I7LA 4MAMA 1EHIA 3MWEA 4C5CA 1EYZA 5J2TF 1BXRA 3JRXA 4XZ3B 4MV1A 2W6QA 3SE7A 5JVLA 3GIDA 4ME6A 5LXTF 2NU7B 3U9SA 1KJJA 4IHJF 4NYEA 2YL2A 1M0TA 5CAEB 2GQSA 3WNZA 1A9XA 5CA0F 4HNTA 2IP4A 3UFXB 5C8YF 5BPFA 1KEEA 1UC9A 4O7VA 3MJFA 2R84A 1DV2A 4O84A 4I4TF 4TUYF 1CQJB 3NUAA 4FFRA 4HR7A 3TIGA 4HNUA 5DMXA 1DV1A 2NU6B 4C5BA 4EGJA 1PK8A 1JKJB 1M6VA 2YWVA 1IOVA 1Z2NX 3VPDA 4FGRA 1JDEA 3TW6A 3K5IA 3WO1A 1GSOA 4FU0A 5LYJF 1PX2A 1GSAA 3BG5A 1BNCA 1W93A 1EUDB 2V58A 1KBLA 4EG0A 2NU8B 3WO0A 4FE2A 1VKZA 4EA7A 2DLNA 1I7NA 2YS7A 2YZNA 4MV3A 2OLSA 2XD4A 4IZOA 2ZDHA 1KJ8A 1GLVA 2YZGA 2CQYA 4ZOLF 5CB4F 5HV6A 3OUUA 4YAJB 4O7LA 1WR2A 4MV9A 2R85A 1C30A 2GPWA 2I87A 1KJ9A 4MV6A 4O86A 4XYLB 4FFLA 4O82A 1E4EB 3N6RA 4I50F 4O4LF 2W6OA 4MA0A 1W96A 4YJ2F 3TINA 4EA9A 5JH7F 3VPCA 1C3OA 4EA8A 3R5FA 3RV3A 4FFNA 1Z2PX 3HBLA 2R87A 4IWYA 4O7ZA 1KC7A 3BSYA 1KUTA 5JVDF 5GONF 3ORQA 2YRWA 1EZ1A 2YS6A 2R7NA 2P0AA 4RZQA 2I80A 3TIIA 3K3PA 3JZIA 4IWXA 5IYZF 2GPSA 4L1KA 2DIKA 5I47A 2V59A 4MA5A 4HNVA 1VBGA 1OBDA 2CZGA 5LOVF 2VR1A 2C00A 2R7LA 2WYOA 2VPQA 4ZI7F 3AX6A 3BFPA 2J9GA 2DZDA 4I55F 1SCUB 3R5HA 2DWCA 3K5HA 1KJQA 3KALA 3KREA 4O4JF 3R5XA 3JRWA 2FB9A 4FFOA 4DIMA 1M0WA 4WD3A 4HQ6A 4ZQIA 2XCLA 2YW2A 5KX5F 4O2BF 4FFPA 4IIJF 2HGSA 5CA1F 4DLKA 3R9RA 4MV8A 2YRXA 4Y8VB 2VQDA 2GLTA 5C1OA 1A48A 5FNVF 4O7WA 4E4TA 2GQRA 2PBZA 1AUXA 4J6EA 4O4HF 3DF7A 1OBGA 5BMVF 1B6SA 2W71A 1T36A 3Q1KA 2R7MA 3Q2OA 5LA6F 4QSHA 3MWDA 4O7RA 4YB8B 3R23A 4O7SA 4C5AA 4M99A 3KAJA 1GSHA 3ORRA 3AW8A 2QF7A 1VBHA 2ZDGA 4M9UA 2YZLA 2NU9B 1KJIA 1JDBB 5JQWA 4EABA 5D8DA 1EUCB 4M9CA 2FP4B 4M98A 2SCUB 3VMMA 3U54A 4XYMB 5H80A 2X0SA 3I12A 2W6PA 3V4SA 2QK4A 2W6NA 3RV4A 3ETJA 2VHEA 2Z04A 1CS0A 2HJWA 2CNVA 4O83A 2R7KA 2CNQA 3U55A 3HB9A 4YJ3F 4TV8F 3GLKA 2R86A 1E4EA 2ZDQA 3VA7A 3QFFA 4MV4A 5K2MA 5LP6F 2V5AA 1AUVA 1B6RA 3U9TA 2YYAA 2FPGB 4XX0B 2I8CA 4FFMA 3HO8A 1CE8A 2PVPA 3RFCA 3TQTA 3BSSA 3V4ZA 2Z02A 3ETHA 3JZFA 3KAKA 4EAAA 4YAKB 3LP8A 4EGQA 1Z2OX 3RUPA 2R82A 4TV9F 5EZYF 2R6FA 1JLLB 3BSWA 4O81A 2W70A 3OUZA 1IOWA 4O7TA 2W6ZA 5J2UF 3LWBA 2FPIB 2FPPB 3N8DA 4YBZB 1GGOA 1CQIB 3E5NA 2NPOA
chains in the Genus database with same CATH superfamily
1DP4A 3WMXA 2Z3WA 1TZMA 4ND5A 2J6HA 5LZ7A 1SZJG 1CBUA 3LCRA 4QWDA 1Z4PX 4CM8A 1X8JA 2OT3B 2SHKA 3QUSA 3CEMA 2BKVA 3G8DA 4JT9A 1TWAA 2G80A 5LR6A 5FBZA 4QBTA 2P27A 3BDVA 2O1XA 4G9BA 2WKRA 1NDHA 2QMUA 5KFQA 4TT3A 1QANA 1E3EA 3RG8A 4M9SA 2A0WA 4B34A 1SD1A 1LC0A 2H2HA 1N6OA 4ZTBA 4QAQA 5H0IA 2B37A 4MROA 1CVLA 1MA0A 2IXAA 2OLEA 3GLFA 2JA8G 3H2JA 2HA4A 4XVQA 3V2UA 5C1DA 3KSUA 1XALA 1T4BA 4UM5A 4AZWA 3I73A 2VNJA 2B8WA 2ZCJA 1F2DA 4XWYA 4ILKA 4AT1A 4TVIA 5DCLA 2JF0A 4F4UA 2WTAA 3INRA 3UYYA 4PRYA 4MQFB 2JA1A 2X3UA 1SVOA 1YQWA 2D59A 2H0AA 3RFVA 2RI1A 2NXCA 1UODA 4FC7A 3UMSA 3PWSA 4XD7D 2GM3A 1KOJA 1I8TA 3HNPA 3IURA 1EB9A 5CX1A 2D8AA 3KPUA 4EPVA 5G2OA 5AKIA 4KOAA 5C80A 3PEWA 1DCTA 2FPUA 3TEKA 4XGRA 2PG3A 4KNWA 2FW7A 3RK0A 3Q87B 1HZZA 1DJMA 4G84A 5KFAA 4OLJA 3KCQA 4JL6A 1SCKA 5HIIA 1BC5A 4RD2A 1GADO 1M2JA 2EP7A 2G0NA 3WHKA 5D85A 5HUHA 4F9TA 4MV0A 5HGXA 2I3BA 4D92A 5LQUA 2NU8A 4D26A 3O8QB 3FGNA 3QXGA 5CVTA 1QH8A 2VUGA 1SZPA 4HT3B 1UT5A 3CFYA 4AJJA 3A6FA 2WJHA 2C57A 4AI6A 2GYUA 4LH7A 3WTBA 4IEFB 1HNZH 1G16A 1T2VA 1ZXLA 2F2TA 4ZQCB 3HQ4O 1GJRA 4DBLC 1XZCA 2OCPA 5DVZA 5IWCA 5BN3A 2HB6A 2ZRGA 5JBIA 3T3EA 1RYYA 1JQDA 3BCSA 1L5KA 2EHDA 3WYFA 1GTJ1 5JH7A 1TU0A 3LQ1A 4RZHA 2COUA 2GEDA 2JASA 5C4IA 1WXEA 1V71A 4CM4B 1N8KA 3SXJA 3RBAA 1PTKA 1GU1A 1Z0IA 1C9KA 121PA 4RADA 4X71A 3AYHB 2W8ZA 5EJFA 2EZ8A 5L4LA 1DG1G 3ZE8A 3FFWA 3COZA 2KM1A 3RE1A 3LZ6A 5HIAA 2XUFA 4GYJA 5KTKA 3NC0B 1SVSA 2CJFA 4D5EA 2YWBA 2ZYVX 2PH5A 2A9OA 1TGYA 4QJIA 2ZUTA 1TMGE 2PZ8A 3WRXC 4KRXA 2R68A 3IR5A 3ONVA 4HLCA 5L1JA 3IVAA 4BQSA 1AMOA 4LSAA 3TZKA 2ERYA 4G5FA 4TKVB 4EMSA 1B00A 3P94A 1PWXA 1RYZA 4UM8B 5JJBA 1XVLA 4M36A 3RJ9A 4JLSA 2IZ7A 3VNBA 5BOSA 4LS3A 4GMDA 3BXXA 4P3PA 2IYOA 1GEGA 5FV4A 2VHUA 5H9VA 3DAFA 3N5CA 4Q39A 1RJFA 2G06A 1S89A 5AJXA 3O8NA 1BKYA 3VVBA 2NVUB 1GPDG 2DSNA 4Q4JA 2LTAA 2CL0X 1KR2A 1SUAA 4LTDA 4EYHB 4D3YA 4PX9A 3L1HA 4DQ0A 2HXYA 1KBZA 1KJWA 4BP3A 3FOWA 4RJLA 4XCXA 1HE1C 1XCMA 1K8XB 1DWUA 3I2YX 4N7MA 3KJIA 3WYCA 5JAQA 1V26A 2XEDA 2WJ3A 2BL4A 1UBEA 3TTWA 3V4PB 1Y1SA 3QIAA 4CLRB 2AMJA 4O33A 1LPBB 3ZDFA 2QX6A 4QYIB 1J1UA 3I9JA 5HF8A 3P27A 3V00A 2LVBA 2REXB 1XZNA 2VYQA 5ALKA 3TW7A 1OT5A 4JI0H 4EK9A 1QIFA 2P3QA 3AEUA 3ZH2A 1V3TA 1SVMA 4WDQA 1P2FA 2JFQA 4Y1EA 2BR3A 4BGUA 1NMSA 1ZHSA 2ODQA 1XTIA 2G76A 2R96A 4N0QA 4NYIQ 4MOWA 4X7BA 2Y6UA 4HNTA 3EXIA 1Z06A 1VPTA 1NRIA 2XGOA 3GLIE 1U0SY 1KU6A 3JSAA 3QWHA 1K89A 1QV9A 2JZNA 1WBDA 4DIEA 2PA3A 2ZT8A 1IM5A 1S1CA 3DKIA 5DEIA 3EPKA 1RC1A 5BSGA 2L19A 1LK5A 1C1XB 1GCAA 4UCVA 4U7GA 3P4XA 3NX4A 5EE9A 1M6EX 4GPEA 1FMJA 1WVGA 4A2PA 5K6AA 3NV7A 2YOHA 4DPKA 5KNLA 2OXIA 1XTKA 2PZFA 3ZU5A 2JCSA 4O29A 4AUKA 3U56A 4UCSA 4U9IS 2J3EA 3HJGA 3NEAA 2HO4A 4C4AA 1YZYA 1HGXA 2JHCA 4GPTA 1F51E 3I9LA 1EBBA 1WU8A 2EFEB 5F5NA 1CUCA 4GRDA 4ZXPA 1PSDA 4NY1A 2BJWA 2BFAA 5DTIA 1EUCA 2JFFA 3VO2A 1TT5A 2C2BA 3R5JA 5DBIA 3TGWA 4IHJA 4ZTUB 3TX6A 5K3SA 3AKDA 1P2DA 1J07A 1WX1A 4PG6A 2Y9MB 2RHCA 4MLCA 3KE8A 3USCS 2ZZMA 4H1HA 2QMEA 2VRNA 4X9XA 2VJQA 1E3SA 4Y2UA 4YRMA 4M53A 2O9JA 3GHHA 3EC7A 5CFPA 2IA5A 2VT3A 4U39A 1TEXA 3QKTA 3HR4A 5LYJA 4RB0A 4MGIR 3MCTA 4IDNA 4DEXA 1NC1A 3U49A 4J0JA 2PL5A 2W8KA 1JMKC 1MFZA 2I1LA 4GM4A 5KNDA 3CH4B 4P0QB 3L6DA 1RHMA 4LHXA 1SHZA 4WZ6A 3O82A 1SNYA 3CRRA 1IYEA 1BQEA 2J5XA 3AVWA 3R6GA 3R5HA 1Y4DE 3GAZA 1DGSA 2XNSA 1RQ2A 2Z57A 4I9HA 1UOOA 4WHMA 1J24A 1L3IA 1U4NA 4IJVA 4W1PA 1F5NA 1Y1VA 4CBVA 5CCEA 1HNWH 2HMWA 1AGNA 3B13B 2XUQA 3G6WA 2XE6A 1N2CE 4AIRA 4WECA 1YR3A 4PZ8A 4K2HA 5GONA 3KLBA 1VJCA 5J4LA 1N78A 5KWSA 1WXGA 1N2ZA 2O5RA 1KAHA 3GRYA 3F67A 4Q4LA 2I2FA 2F43B 4BY1G 1MAWA 1IWOA 2H0QA 2H7YA 4EYGA 2VL7A 5KKCA 4BRZA 3KYCA 2BFFA 4RORA 3ZWCA 2G0TA 4L02A 2VP0A 3G17A 1RTTA 1TT7A 2ZBDA 2ZRMA 1P7ZA 5DIZA 2FQXA 5EUBA 3FJYA 4FN5A 1PZFA 4C4TA 1IH8A 2HGWA 3OZWA 2IHKA 3RIXA 4GLJA 1VKRA 3U55A 2WU4A 5GGXA 1Z18A 1WE2A 3R9WA 2BCJQ 2V7TA 4OQNA 5KG0A 4UNPA 2D2XA 3DLCA 4URFA 3PE3A 2IUTA 3AUAA 3BXPA 3MUNA 1FQOA 4R0VA 1RHRA 2W9CA 3LP8A 2AD5A 1P6QA 1A5SB 1UAYA 4Q4HB 2QRKA 1ZINA 4YJKA 5KS8A 3G8AA 2P6NA 4M0CA 1N9KA 5CVUA 1YVPA 1YD7A 3VU8A 4D8TA 3WI7A 1QBKC 4ZCSA 4J9MA 4RK6A 2ZTMA 1O5IA 1G8YA 3RU9A 2PFGA 1RJEA 4PAGA 3QK7A 2CVOA 2ORED 2PX6A 4FZJA 4Q7KA 6PFKA 5KTMA 5D2CA 3R0VA 5EJ5A 3HP1A 4UNQA 2IYTA 5K6TA 5EI5A 1L5QA 4K28A 2FEPA 2H2AA 4WASA 2AGOA 5A4AA 3UMVA 2R62A 3RJZA 2DPHA 4Y2QA 4O7VA 3I1JA 2I54A 1Q3HA 1G2PA 4ZYYA 4E30A 1VIVA 1NQ5A 3QHQA 5BW6B 3ECAA 4O3MA 1R4MA 1SRQA 3D54D 3QYFA 4AJEA 3P20A 3RH0A 1X70A 2AZTA 3GLHB 5GPBA 1TJ3A 2JLCA 4JOCA 3DOUA 3WZMA 4EATA 5CYFA 4RVDA 3PPWA 2NO1A 3T3DA 1NVKA 2RF4A 4KMSA 2Q4BA 3BUSA 3QZ7A 2RGEA 1OWMA 3HGMA 3ROTA 5FBVB 3R5KA 4CT5A 3QELA 4BKPA 2OR3A 4OVKA 2YHAA 3WGYA 3JASA 2OCAA 2A58A 2K6GA 1SQ0A 3WGIA 4FX5A 2JFNA 2XKBA 3RRZA 5EWLB 1D6JA 4N47A 3KG2A 5H8WA 1EX1A 2E2HA 3DBOB 3RRBA 1C3OA 4HDQB 4MR9A 1WKBA 1OFUX 4X8LA 1H3FA 3KJZA 2NT4A 1QVWA 1ZVVA 3SEFA 5H16A 4HF7A 4X00A 1F2VA 2PMKA 5L1KA 4A3EG 4R1LA 3OZCA 3QHPA 4HYKA 1RI5A 3KSMA 4AJLA 3S27A 2F64A 1RT9A 4CM8B 2V7PA 3N6XA 5LOVF 1VG8A 1H1TA 3QXSA 4XQEA 1GHTA 1RQXA 4M21A 1U0TA 1JDPA 1M7BA 1UWVA 5ERYA 2IUSA 3IRVA 4YJ3B 4ZEMA 3KV1A 4ARBA 4HB3A 4RB3C 4MWDA 1TM7E 3AI7A 3WTCA 4RIEA 1G64A 1XZJA 5AXBA 3B1WA 4MV8A 3BERA 4P4NA 4KMMA 1S2MA 2ODBA 1QIGA 3QKRA 1GDTA 3GLFB 5JS8A 4IDAA 4HXGA 1YS7A 1XZAA 3VDRA 2Q62A 3STVA 4BFWA 5ES4B 4I8IA 5HYVA 3LX5A 3GJ7A 1CHDA 1AN9A 4C9BA 3B3AA 3ND6A 1BEUB 3GN1A 1Z4QA 4LFBH 1NUUA 3DE1X 4MW2A 4NMHA 1CERA 1VHWA 3C3KA 1TCBA 2VKQA 2WWTA 2BSAA 2ACEA 5FI3A 1CR6A 5AW5A 1F06A 2HWKA 3HT5A 4JVLA 2ODPA 4J0IA 1YC5A 5DZSA 4KQWA 2LW7A 2AN4A 3KC2A 4FSXA 1M2FA 2IOYA 1YHNA 5D3KA 1E94E 1K3FA 5CX1B 1K7EB 2C77A 3KQTA 1ONSA 2YVQA 4MV5A 2IWRA 4O83A 4ZGBA 4TV8F 2Z4TA 1X1RA 2CCGA 3ZJTA 5LP6F 4LF7H 3C3DA 1J0DA 3CLRC 4RZ3A 3KVRA 4ZU6X 2Q1WA 5AOBA 1ZPDA 5A4FS 2ZKLA 5BN5B 1E3LA 2I4MA 3JAWB 1NN5A 4LE2A 5GZ1A 5KS2A 2EGUA 4PPQA 3WRXA 1JFFA 2FEWB 4ZRDA 4DV5H 2X2PA 3F3KA 1QH8B 2BGTA 1D1QA 1W0JA 2BFMA 4GYYA 5AO9A 5CNIA 4TSKA 3FSRA 3ETNA 4OQQA 1L1QA 3F71A 2VQSA 1SHLA 2BAGA 4YTEA 2AN9A 3ZZ0A 4MHTA 2CSXA 2WTBA 5CITA 4FD2A 3GXOA 2FR8C 1C0EA 4EEQA 2EBUA 5BN3B 3C6ZA 3ZVMA 2HWXA 2WSLA 3WE7A 4PGHA 5JQGF 4R4JA 1M1YA 2B9EA 1UPBA 3LQKA 2WIBA 5JH7B 4I6JA 5FEMA 3UBTA 2FZEA 5FOTA 4HNRA 4ZV4A 2JIMA 2G63A 4QQRA 5LU8A 4PXAA 3FPFA 3DEFA 1XAJA 1TRHA 1YJQA 4R40A 3BHNA 2Q5QA 1UWCA 2WR8A 3SQXA 4HDAA 3QFRA 2DH5A 3IQWA 1X39A 1HE4A 1M2HA 4GKVA 1OU0A 4GIBA 2QE7A 3WJ7A 4EA6A 2EGGA 1TK9A 2BLNA 3E1KA 1PLKA 4ND2A 2NU6B 5CNKA 4YFYA 4FX2A 2BKLA 1M8KA 3C24A 2IMWP 1GEEA 1W0CA 3KKOA 2CDBA 3AMVA 2R1ZA 4R1OA 5B37A 4JVSB 4I46A 1PGQA 1F2TB 4KRFA 2JFBA 3ROXA 3FCCA 2BM0A 3K4PA 3GEPA 1X2BA 1UFRA 4IY1A 3LT2A 1N5LA 5A4KA 4IW3B 1JFSA 4DR7B 1SK8A 3FJ1A 5AM0A 4Q44A 2AUTA 1U2QA 4LI3X 2FX3A 3GFVA 1NJ1A 4PZCA 1WR2A 2Q2VA 5EJ6A 1M7JA 5HKAA 4GWLA 1VSUA 4RFSA 4HJRA 2N75A 1EESA 1F4VA 3F6PA 2UZ3A 4IF6A 1LRJA 1DJQA 1XNJA 3HLKA 3L82B 3V1KA 1KC3A 4Q4JB 4BMCA 3KZNA 1EXNA 3CNBA 2EP8A 1M6HA 4O6VA 3TLJA 5C4MA 5KNCA 2CXSA 4O7ZA 2NMVA 3SHVA 4CN9A 2Z30A 1UWLA 1XMVA 3E9DA 3UHPA 3TZBA 5CT9A 1X7DA 3DKVA 2Y1CA 1Y1VG 2JFYA 3P0EA 5AK5A 2O6HA 5K09A 3ZZTA 5A5EA 3ER6A 1THTA 3J7AK 221PA 3AUYA 1AUOA 5AMXA 4R98A 4G4SO 5CDHA 2CZQA 1FFSA 4H16A 5ECGC 1I6KA 3P9XA 3AEUB 5DN9A 1B8UA 4A6EA 1JA9A 3R74A 1HM5A 4KRYA 4O8CA 4OYHA 2WVGA 5J59A 2XOXA 4CUJA 1BTOA 3T1QA 5F77A 3QA9A 1CW2B 4FN4A 5JC8A 1U1FA 4DIMA 4XJXA 5KBYA 3EXIB 2QV7A 3R3YA 4MITA 2FQWA 2X5RA 3AYZB 4JV0A 1Z16A 2A5FA 1E3MA 1SULA 2GR9A 4AMYA 2JLAA 5FBQB 5GWXA 1OMOA 1P2VA 2QAGB 1MNQA 1VCOA 2ZJAA 3WDKA 2C1XA 3HA5A 2VJPA 5DNWA 3FOCA 4Y3UA 2XLCA 2Q1XA 2E85A 4EUFA 5CVEA 2C4TA 1R0KA 2AL7A 1QK4A 4F5YA 2CV0A 4KXXA 3RJMA 4DNXA 4EB6A 3R0ZA 4B2LA 4AJ1A 2FXIA 4ZDIA 1RYRA 5L8VA 5I45A 4ECUA 1EUCB 1P5RA 3TD6A 1BDHA 1PR3A 4GMKA 4K6GA 4U6NA 1XQYA 5JAHA 5CBKA 4IHJB 2ASLA 2WYUA 4FYYA 2YUIA 5GIOE 3RG2A 3E70C 3VZDA 1D1PA 1O87A 4P5DA 2Q2NA 1XR3A 1ZNXA 4LRWA 4WJKB 2Q6LA 2XNDA 2DCMA 4P4GA 3KQPA 4EEZA 3ORFA 3EIQA 5KFIA 1OYVA 4QJ3A 3FNIA 1GAQA 1C3XA 2MYTA 1G8FA 5KSZA 2P78A 5A4JA 4NZPA 2XXAA 2YXDA 3SBDA 1N9GB 4FYJA 4BV3A 2VUTA 3JS5A 1YFZA 4TV9F 4RSMA 2FEOA 1SVNA 2WF6A 3KTAA 4KQEA 3WK9A 4IQ4A 3OE5A 4EJ0A 5EUQB 5THKA 5B1HA 1QYDA 2OXFA 2B1JA 2A5LA 3BMOA 3DKKA 3O73A 4B31A 3VOTA 4DLXA 1WNTA 4BECA 3BRCA 5CH8A 1QGAA 1ATIA 2XD9A 4GPZA 5FD5A 1SB8A 3V32A 1QIIA 4PSVA 3CB4A 4J0EA 1JBQA 3HPRA 1Y5MA 4URWR 1MGPA 3MWEA 1R5JA 3JRXA 2HHHH 2XDYA 4B6OA 2QN6A 1JBKA 3L46A 3RODA 3UNXA 5AFSA 3WNVA 1DG3A 3VFDA 1TD1A 1NLMA 3OE1A 2VUMG 1HLGA 2W8BB 5KT3A 1PR4A 4QOSA 5GONB 2XKKA 5AKHA 3WAJA 4XFJA 4YECA 4A3IG 4MQBA 1M2WA 1YJAA 5GV7A 3N6VA 4Z51A 2REBA 2WP0A 1C50A 2HHFA 2HSJA 3O90A 4YA6A 1PHPA 3PHIA 2LIVA 3KLMX 3NIBA 5D5HA 1QIDA 4KWCA 2HRQA 3KYCB 2BFFB 5H1YA 1XTRA 2ZR7A 3HCCA 2NO9A 3OD1A 4FMDB 3JYPA 3T1TA 2NOAA 1YB4A 3HL4A 1TF2A 3KPWA 1UBCA 3GRRA 3E9YA 5JO0A 1JR3D 3OAAA 3G0CA 5FX2A 5AW9A 3VNUA 2C3PA 1GGKA 3W0LB 1HE2A 4O82A 1CY6A 1H6AA 4R6XA 3UOWA 2BHLA 3SBEA 2QXTA 2GTIA 2CNNA 2CFSA 1WCWA 1DARA 1RABA 4HZUB 4LYAA 4CCWA 1JSXA 3D43A 3IUBA 4FPXA 3WKDA 1EFAA 1W5FA 2VDJA 4ROTA 1ORDA 1TYCA 4FW8A 3U7HB 1CFJA 3LLUA 4MUJA 2YMLA 1V8DA 2PYDA 4N9WA 2QYOA 3LCMA 1RU3A 1LJ8A 2V7GA 4LVNA 4MW4A 3SYTA 4JQCA 4U7FA 4HEHA 3AX6A 3OM8A 4BVJA 1YFKA 4YAUA 1QH9A 3HOXG 3EDOA 1SYXB 4RXMA 2QPTA 1ODJA 1RI2A 5CYGA 4AY3A 1UUFA 2GZHA 4P0TA 2QTLA 4PO9A 1JEOA 6NULA 2ZPTX 3IJPA 2GZ2A 1ZO8A 2OK8A 2V96A 1Q2XA 1A4IA 1R4MB 2FLVA 3C4VA 4N41A 4LK2A 2WF9A 3B89A 1LLUA 2NN3C 3T5HA 2GEKA 1LBIA 2B94A 1VTKA 4D8UA 4O7RA 1YRWA 2B6NA 4XWWA 1ZLYA 2FSSA 1L7RA 5TT0A 5JNSA 2FZ5A 1BYUA 2WJ4A 3PJFA 1P17A 3HR7A 3ZHVA 4JT4A 2BQUA 3WZLA 4NXNB 4Q93A 3H0CA 3V8VA 1ST2A 2WMNB 1ZIXA 2QS9A 2V0CA 5AW7A 3PUKA 2RHHA 2IIPA 1L7AA 2WZCA 1Q7CA 5HEKA 5DG8A 5JSYA 1QR6A 4AXXA 2XSZA 4R0NA 2PKYX 3NT5A 2SCUB 2VSOA 3RS9A 4CMJA 2RGCA 2Z8YM 2HIAA 3H2IA 1IHDA 4TSRA 4DIOA 4CM4A 4AJHA 3PC7A 2AFIE 1C3OB 4LN1A 5JR3A 3EWNA 4XW2A 2X23A 2OQ2A 2YCLA 4L50A 1K92A 4MR9B 3I76A 2ZSDA 1U63A 1HZZC 4R9SA 1A77A 2O54A 3VA7A 2NQ2C 1DRVA 4XH9B 4ZQBA 2QN1A 1C8KA 4EW1A 3RVKA 4KDCA 3UG6A 2L17A 1U90A 2C07A 3CXRA 2FVXA 2ZSJA 1M76A 4Q6BA 1UJMA 4R1NA 3LRTA 2AUMA 2O05A 4L5IA 2R3SA 2PRSA 3HB5X 4YAOA 3BHMA 4WN3A 4HWRA 4J9QA 1TF7A 3ABZA 4KAXA 3ZWYA 4LF9B 1K2VN 2OD2A 3FSJX 4FEEA 5AT1A 5BNWA 1KJZA 4KIFA 1IM8A 2JD2A 4O7NA 4N49A 1W85A 3ESCA 5KG5A 4MUEA 4CFZA 3FD8A 3MJTA 1ZSVA 3GUUA 4FFBB 2XOKD 1RP1A 4XIGS 3L8MA 2XYPA 1NVDA 2PGJA 4Y0VA 4ICIA 2XUPA 2B2NA 3ORHA 4Y67A 4X60A 3G88A 1PNTA 1YWGO 5BOVA 4LQ4A 4E46A 5T4FA 3WJ1A 5FR9A 2GQSA 3AOGA 3QKRB 2GUWA 4HGPA 3H1AA 3FTQA 5DX8A 5EHNA 3WADA 1XWIA 4MVXA 3PR1A 1ZNWA 3VDQA 2PUWA 4HWTA 2GD0A 1HLPA 4O08A 4HRVA 3NUAA 3QPDA 2HMYB 4TSFD 4ZANA 3U3JA 4BBRG 2LD4A 1XT6A 4YPFA 3O4VA 4QSMA 5TB5A 4QBGB 2Y1OA 1NN0A 1KEZA 2DY0A 2ZIXB 1GZDA 2VT2A 3ODPA 4IFIA 4URHA 2IIQA 1URPA 2G1KA 5EIWA 3Q98A 1DZ3A 4JFRA 4DJEC 2GARA 5KB3A 3M4NA 4S24A 4UOZA 2YZNA 3H3VH 2QW1A 4L8FA 4OJKA 1F6WA 2OBFA 2KW5A 3TBKA 9ATCA 3BGIA 1P1BA 4C0QC 3HCWA 4H9GA 1VKHA 4DLYA 5SICE 3GVXA 4LZJA 1AQLA 3FZNA 3HCDA 3WBFA 2J5BA 5B30A 4UBOA 3TQ1A 2KYRA 1CQZA 3BE6A 1DAHA 4OATA 5DNDA 4YMLA 2FWJA 2IUYA 4DEYA 4W5NA 3SIPA 3EEFA 2IHTA 1TJNA 1XELA 3CU5A 3EF1A 2QRGA 1JFFB 5IDQA 2R6ZA 2CXUA 3AFIA 3OESA 5B4TA 2VUIB 4EJFA 1XTSA 5GVSA 1B7GO 1LVHA 1A8IA 3FUVA 3NOVA 4B46A 3O93A 3D4IA 1WV0A 4FGLA 3B8HA 4C4PA 4BMXA 4QE3A 4Z6KA 4L1KA 3RHZA 1GUZA 4M7WA 4TOIA 3VZQA 3LWZA 4IUBS 5DHUA 4HNGA 1XZEA 1CUIA 4EGAA 1E9VA 1USGA 1D6MA 4HG2A 3TRKA 4H31A 4ER6A 1XROA 2X6RA 3FKSA 3HZHA 1C3EA 3R4VA 4MCHA 4IS3A 4DMFA 4GR5A 4EMTA 4QELA 4DKJA 1T5HX 3EVBA 2FJPA 3FG9A 3HCOA 2HA6A 3CRMA 1K1QA 2VQDA 3G2OA 3PCTA 2M98A 2AF3C 4DLBA 4Y9RA 2QAGC 1E2NA 2IU0A 4JKYA 1G60A 1P1IA 1N3YA 3F1LA 4QIHA 3DF7A 1I7SB 1OA1A 3PQEA 2VA3A 4ZCPA 3L05A 1Z8FA 3T1YH 2MU1A 3SDZA 2JEGA 1VLVA 1XYVA 2AXNA 4YJDA 1YZUA 5B6PA 1N6RA 2GCNA 5HQJA 4Q7QA 1SMKA 1ZUNB 4FB4A 4BP1A 4K3UA 4U63A 5T67A 3VDMA 3N41B 2AZDA 5FWYA 2P6PA 2AF4C 1GUBA 1E7SA 1BU8A 3JAMW 3T7TA 4BP9A 2B82A 1U2TA 4Q9HA 4RFSB 1Y1RA 1I3KA 1UBTS 1N1DA 1D2CA 5DQGA 4YXWA 3DHVA 2A0XA 4HYYA 1WPGA 3NNNA 3MN1A 4DR1H 2FDCA 1QBGA 2QXYA 4W82A 3DCYA 1Q0ZA 2VHTA 1V8ZA 3PHGA 3EYYA 4RJ2A 1RI1A 3N39C 2NAFA 1XAIA 5DHQA 1NQOA 2C5LA 2HLHA 1B0ZA 3QUAA 1WRBA 2C3UA 3I5XA 1AOXA 1NBAA 1WSAA 2Z02A 2YXPX 3WWEA 5JCOC 4EZIA 3ADBA 2I2WA 4UATA 5DMHA 4FZ5A 4MW0A 3NO4A 3ONFA 1LQTA 1B76A 4MRAA 3WFJA 4GZ6A 4OL0A 3UK1A 1V41E 2XUKA 2GA8A 3BL6A 2P40A 4GFDA 1KYYA 3JQ7A 3AR8A 3FLEA 1G5TA 2WI8A 1KJNA 3MPOA 1UH5A 2NO6A 4AM8A 2J0QA 4QL3A 5JAOA 1LC3A 2X0KA 1TQHA 1IMJA 4DUGD 2UVDA 3HKCA 4A82A 1GAJA 1I2AA 3OURA 2IIVA 4NENA 1T8UA 1XMJA 3TZHA 1RWBA 4F9FA 4ZT7A 5L95A 3BQ0A 1QP4A 1A82A 1OBVA 3NBYC 5EKSA 1BMQA 3JWPA 4D97A 3NBQA 4N3NA 1QIMA 4NZZA 2ECPA 4J3JA 1U8TA 4BEVA 4BDSA 2J6UA 2AKYA 4G67A 3Q3GE 2VRCA 2V7QD 3K0SA 2VHYA 4MRMA 4MUKA 5JXHA 3CKMA 2ZJOA 5JDCC 5AJVB 4C7KA 5DM2A 4JUCA 4I4TF 3DDUA 4PIVA 2E4XA 4BMDA 2GRJA 2HEIA 2RAUA 3Q72A 4NU6A 2KBEA 3CLKA 2VTDA 4EKEA 2ZJ8A 1KSGA 2VF2A 1Q91A 3EQ8A 1ZJ5A 4LXHA 5IASA 1EGQA 1Y4SA 1XEAA 1ZA1A 2WU1A 2RGDA 2HU2A 1PG5A 3RC1A 3N40P 1A7AA 3HC7A 2VJOA 1NPTO 2AEEA 4ZOCA 4JI5H 3U7QB 1S2IA 3QGMA 2C83A 3AZOA 1XK5A 2OHHA 3G2LA 3FHCB 3VPCA 1R16A 1CUXA 3LPLA 1HBJA 2QN7A 4WUVA 4OXYA 4OKIA 3UXMA 3U40A 1QUFA 3HBLA 5KTPA 1N32H 4GECA 5LWHA 1NNSA 4EHIA 3LXMA 2X14A 3KTAB 3CSSA 3M4XA 4KFRA 2W7TA 2Q7DA 2D5BA 2QW8A 2YN2A 3FMVA 3BMOB 4DL6A 3L8GA 5K8IA 3A27A 4ZDJA 4JENA 1G5QA 5KWVA 3BK7A 3MR3A 1ZM7A 2FY8A 5BUQA 1WZUA 4MVJM 2H9YA 4B3MB 3MWEB 2QTBA 5F64A 5BURA 3I3SR 4WLFA 1Z2EA 1FRNA 1G21A 1C7QA 1R0RE 1I94B 1IYDA 1YOVA 2GBLC 3VJLA 2CUZA 2QQ0A 4FFOA 2ZIEA 1FIUA 4FK8A 1A9SA 4OB6A 1V7PC 2RHTA 1SXGA 3M4YA 3RRMA 3SIRA 4NEHB 1E2IA 2BM9A 4XOIA 3KQUA 1VSBA 4BQQA 2ARKA 5ULLA 2CFCA 5EZYB 4LXIA 3NCHA 1UBJS 2HHFB 4ZMSA 2TMGA 1GSIA 2ZZKA 4V0SA 1B6SA 3IPRA 4XQ9A 1MRNA 2P68A 5JNWA 1SVWA 5DGDA 2H06A 5DSTA 4QLBA 3ORRA 4RKWA 1VFPA 3ZHTA 1L4FA 3LE8A 4J29A 1JEYB 1ISHA 1E9AA 2LWIA 5IVKA 3IAM6 3E4DA 1U7ZA 3B2NA 3PPVA 4IHKA 4YJ3A 2IXDA 4B3RB 2HQRA 2VIIA 3KQQA 3TAUA 3S40A 3UJCA 3RKUA 1OFTA 1Z6TA 1D2AA 1X1TA 2PLFA 5EZ5A 3R3JA 4FCVA 5BWLA 3U0VA 4E6EA 4ECQA 4RF5A 5JS2A 2R1UA 2FQQA 4GPD1 4LSXA 1B74A 1IBMH 3IGFA 1UJ6A 2J6BA 3E27A 1TEVA 3WLLA 3LUJA 4DJTA 2K87A 1RYMA 1QSGA 1QHYA 2BGIA 4RS3A 5M04A 3TD9A 3RC7A 3OJWA 1HQYE 2P9GA 1OLOA 1GYPA 3NYRA 4BLSA 1NYTA 2UYQA 2WHPA 3EEOA 4U4AA 2XH8A 3MIIA 1OWTA 3JR7A 2GJ8A 4ETIA 4G5QA 2FWAA 1W581 2ABWA 1EX6A 2FJZA 4GZMA 1GL7A 2QOEA 4K9RA 4O25A 4B17A 3V80A 1JSLA 3PUZA 5I4BA 4K6MA 2DQZA 2PHZA 2XCSB 3GEMA 2ZXFA 4HXYA 4XVRA 2QN3A 2JJQA 4QDXA 5FLKA 3NJ8A 5BN5A 4MUNA 4P7JA 3JAWA 1HRDA 3UANA 2PUEA 4JUZA 1ESEA 1KEEA 4D98A 2DCUA 2OB1A 1KNQA 4GQBA 3DDZX 1GQFA 1NNI1 2CGEA 1P3DA 2FUG6 4NECA 3HWRA 3OTOH 4DQUA 4JI4B 3H2KA 1EVLA 1M54A 3ZQJA 4NNPA 5LPNA 4HWSA 3K5IA 5C5DA 1NYQA 4F93B 3E7DA 4H2DA 4L5YA 1Z7EA 1BFUA 3C5EA 2D5CA 1JUDA 2P0YA 3EN0A 4YRPA 3H0GG 1QTNA 1PLLA 1PN3A 2BHNA 4EKIA 3F4KA 5B2FA 1T2NA 1E59A 1CV2A 1KEVA 1L4BA 4BKRA 3ENWA 1WDTA 4Q7LA 3CHYA 1VJ5A 2IYWA 2L69A 4NE2A 2HL6A 4JR2A 3PRJA 2IU6A 1V1RA 4HI0E 5ESRA 2GESA 5HUQA 5ERGB 2E18A 3N6RA 4RKRA 2CZCA 3TW8B 3AFGA 4F4IA 4R51A 3KEMA 3G89A 3A1FA 4CPDA 5JPCA 2XCAA 2NU6A 3CN9A 4B3CA 2ZAOA 2H5JA 3RS0A 3DULA 4PZ7A 2NZVG 2HQOA 3HHEA 1F2TA 2O2DA 2GH1A 4QOEA 4YT4A 4N5IX 2W7OA 3NH6A 4F4YA 2UVRA 2YN0A 1CKEA 4J7XA 1PDWA 1W85B 3UFBA 1E2GA 1Q0LA 1DC7A 3E2IA 4QOJA 1XUOA 4B3SH 1XXHE 4FYMA 2J3IA 1V96A 1XZLA 2QZZA 5EXXA 5HRCA 1GDHA 5CDSA 3FNRA 2ZBUA 1NVEA 4A8HA 1JTFA 2W0MA 4BTLA 4QHYA 5I8WA 4O4JF 1BDBA 2O8BA 1T8RA 4KH0A 1MB2A 2CXNA 5C46F 3FY4A 2OD7A 3JAMA 2NU7A 3FVQA 4XWKA 4R8MA 2VNHA 2Y1DA 2W2LD 4TN5A 4EYQA 1Y9JA 2GQRA 4JLMA 2JNWA 3QWFA 1Z0FA 1M1NA 2PWYA 1T29A 1D0SA 3QE2A 2ZRIA 1FYVA 1NQUA 3GJSA 4YC7A 2F7SA 3N8NA 3PNQA 1SCAA 1X9NA 2EZ4A 4LMYA 1E1KA 4GOKA 5DK6A 2PTHA 3TSOA 3VXKA 4DMKA 2H5LA 2HRDA 5KFCA 2TRSB 5CH3A 5I4KA 2KPOA 3WWIA 1RBZA 4O1HA 3ZE9A 3TKAA 4KK3A 3I34X 2XNHA 4MEBA 4JUDX 3ZU6A 3S2FA 4HEJA 2I33A 3QE0A 5JBNA 3O7WA 3TLXA 4G3XA 5B2EA 1N6NA 2HHJA 2V7WA 2EWVA 5I7EA 2QAGA 1QRAA 1P4HA 3QP9A 3EEIA 3DHNA 2QYSA 4P33A 2Z5FA 9MHTA 3FCYA 1IHXA 5LP6C 1DXOA 2IYNA 3TQIA 3RFCA 2GVDC 1SXJB 3DUWA 2Q50A 3R6DA 4RQBA 2I22A 4KO8A 4J7UA 3ILYA 4ZC1A 2WUWE 2PWPA 4BBJA 4RM2A 2AR7A 4QVKA 1D07A 1H85A 3VR2A 3QVUA 4B45A 4MRRA 4G0YA 4IVNA 2RHDA 4W5JA 3T1OA 1O0BA 3RVLA 2ST1A 3KFLA 4TS3A 1J8DA 1Z15A 2QU8A 4QA9A 2V74B 1J2EA 3NVDA 3UB4A 4D4LA 4KZPA 3IQIX 3DXXA 4UU1A 4R0MA 4YRDA 2GLXA 4F6CA 4GPIB 3RUDA 1VECA 4U0JA 3BE8A 4FGWA 1W9MA 1FQWA 3EDMA 2TS1A 2KE5A 2ZRBA 3TRHA 1E2HA 1RVV1 1HG1A 1ET0A 4WXEA 1N9GA 1IN4A 2RGNC 5JCOA 1TUBA 4H59A 3ELDA 4AJ9A 1KDTA 1QF7A 3WVNA 1Z6YA 3FDZB 4KITB 3ZE6A 5IEJA 4Q3LA 2GOYA 4XD2A 3BIOA 2OBXA 5FWYB 1WDLA 3IHKA 4X93A 3IS3A 4RW0A 1CCWA 3QWBA 1COZA 2NYAA 3QMPA 5E6UA 3ILSA 2MR5A 2EQ5A 5TEVA 4W7IA 2BGUA 4TQRA 1QHGA 3Q7PA 1IEWA 1AKVA 1H2ZA 4GKBA 1YT5A 1Q0SA 1ZC4A 2IPXA 4O4LF 2W8BA 3Q3VA 4ZGWA 5ALPA 5JDCA 3E58A 3HK2A 1GTL1 5IU6A 1CU1A 1L3CA 5EQFA 1GUDA 4MARA 4L8YA 4IF4A 2Z2JA 1Q83A 3OQIA 4X84A 4MO2A 4CMFA 5K0JA 2MTBA 4OFXA 4WACA 1P33A 2BOVA 3U09A 2X9NA 3O03A 2ON6A 1GO3E 1EA7A 1QQ6A 2DPLA 3PD0A 3ZGZA 2FQYA 1J8YF 3RBVA 3JQ7B 1N6KA 2H1IA 1TWFA 1Y1LA 2GN1A 2F3RA 1Z8DA 2FOIA 1KAMA 2Z8XA 5JSZA 3MZ0A 3HKCB 4ERXA 3RNOA 3CONA 3WHLA 3CNLA 4M0JA 3IULA 1SPBS 4NENB 3KAPA 2WAQE 4A3JG 3UWPA 4B40A 2QSJA 3NNSA 4JB2A 1I13A 3AM4A 4UQOA 4BKOA 3V3TA 4HXEB 4HZUA 4ZQIA 4GXRA 2BMFA 2J3MA 4MRMB 4RLSA 4ODIA 1Y3HA 2WU0A 4K87A 3CMCO 3JZAA 4Q3AA 1ZN9A 2EKBA 1MKYA 3REOA 2CMGA 3B5JA 4IJUA 3R6TA 2YW9A 1W75A 2Y27A 2C1EA 3J7AC 2OCDA 1N2EA 3RSHA 1A50B 5EP3A 1FS5A 2EW2A 4BYGA 4BE7B 2RI0A 1DRWA 3VNNA 1S2LA 4CMDA 4NCAA 3IJEB 1YBFA 1XU4A 2WTFA 2ZFUA 3RTAA 3FHTA 1NW3A 1N2OA 3LF2A 5I7WA 1S68A 2ISCA 4MRPA 2D06A 3OX1A 2ZM6H 4W5OA 3H5AA 2ZUDA 2BVNA 1QU3A 4EBFA 2VPPA 1U5CA 4F5ZA 4RMGA 1YXMA 2AR0A 4HDMA 2HFJA 5AVZA 3C3XA 1UMCB 2GXQA 1EEHA 2GBLA 3URMA 4MVJP 3FB1A 2CLKB 2XADA 4RH1A 3B48A 4PBTA 3FWYA 1JIVA 1FP2A 1G5PA 3Q1LA 4MVJD 5FA8A 1W94A 4KVFA 4KKVA 1FYXA 8LDHA 1LW6E 1DCKA 5SYNA 3HSYA 2COEA 4FNAA 2O3UA 4UCRA 1KSHA 5GY7A 4S1PA 1B3BA 2ZR0A 3UKOA 3I1IA 1T6XA 3RGGA 2OYCA 4A9AA 2E4ZA 1P0QA 3NOXA 4RY9A 2WSYB 1H4SA 5ALSA 3IE2A 5DLYA 5D00A 4P35A 3NXKA 3VNQA 3E5NA 4NEQA 1NFFA 3OH8A 2SCUA 1SG9A 3KKNA 2OL4A 1UKCA 2Y71A 3WKEA 5BPHA 2VA8A 5IX8A 1C3LA 4KCGA 1G21B 3AVYA 3KKMA 2EFHB 2YJZA 1C7JA 2FP3A 2YTZA 1SC4A 3FMIA 1L7VC 3LVBA 3OC6A 3OOHA 4FHZA 1YOVB 1S01A 1E7MA 2ZRAA 3RI3A 4OMCA 3F3YA 5ECWA 5C81A 1N6PA 1AA9A 2A33A 2EKQA 3EEYA 2I91A 3KFVA 3ZIUA 5LL6P 4RJKA 3WNZA 5FTMA 4KFSA 3BX1A 1NXQA 1FYWA 4MYHA 1I3MA 4AK9A 2O3JA 1ZUD1 5GJVC 3OFNA 4Y8VA 1XJ0A 5HIJA 3TDKA 5A3RA 2R00C 1GGVA 1OXKB 4AP9A 3EIUA 2HQ1A 4UU0A 1Z08A 4FVTA 4NQZA 3C1UA 4XDHA 1M10A 2R5WA 3FMOB 2BC9A 3WSTA 1UIRA 2OC4A 3RAEC 3KLNA 1DX9A 4FFBA 1KH1A 3WO0A 4GXTA 2VAWA 4Q0MA 2ONYA 3IP8A 3UT5B 4E2ZA 2VCHA 3G5LA 1T6NA 5EMJA 4UEQA 4J9VA 3MR6A 4D46A 3HDJA 4UTVA 3AK4A 3QPWA 1TCAA 4JXUA 1MMFB 4J8PA 3WNBA 1AB5A 3FMPB 2P30A 3AG5A 4JODA 1XZFA 3L93A 4YYEA 2D3WA 2F8SA 4Q4AA 3ZQKA 4RTPA 1NUSA 5K0SA 2ZIXA 4UBIA 3LLCA 1EXVA 3SI7A 1RFLA 3UC9A 3A1DA 1F0PA 1JX4A 3T35A 1T8SA 1YQEA 4LZOA 3QI2A 2CT8A 3PDHA 2QRZA 4BB0A 1YRYE 5I5GA 1CUSA 1GNSA 2WHPB 4QARA 3UOGA 1LF0A 3GFPA 5L1LA 3VPXA 5I7VA 2W11A 4G36A 3DAYA 3E18A 2E2WA 1OBDA 4AULA 3QZ8A 1WB5A 4U5XA 4H0NA 3CG4A 1U9CA 2CN1A 2FFRA 3VHXA 1USWA 4I3FA 1PFGA 5DGXA 4KE6A 4F04A 1JIJA 3NM4A 1VQ1A 2BGLA 4KE8A 1KEEB 3Q3JB 1O75A 4FWIB 2RARA 1PT7A 2WVAA 4M55A 4HVCA 2BQ3A 2P4EA 1QWOA 4BU0A 1JJVA 4CFYA 1SZCA 3G0IA 2DPJA 2RONA 1YVDA 2G1UA 1C14A 3X1DA 2A1TR 1V8BA 4D6XA 5MFPA 3DO6A 4DJFC 1IIRA 3PFNA 3WJ2A 1U7TA 4EPWA 5EXEA 1NRWA 2A7XA 1E1DA 2RIRA 3LCJA 2HJSA 4OHVA 1P0FA 5DT2A 2P9EA 4A2WA 1N0IA 2AW5A 2Q8PA 3R8XA 5LOVA 5CB0A 4HLUA 1YUBA 3IHWA 1WKVA 4ARCA 3FSGA 1Z2AA 2EARA 4JT2A 1U04A 3P19A 2C96A 1P3Y1 1OGIA 1V1RB 4J3NA 4QRIA 2DAPA 4IBOA 5B7QA 4QECA 1KTAA 3A36A 3KVVA 2PZGA 4W4TA 2GN9A 2C84A 2WVJA 3WLKX 2I3GA 1N2IA 1M5UA 1BHJA 5CX4A 1N92A 3LA8A 4IJKA 4PLWA 5FPSA 1UZLA 2FG6C 2YWCA 1EDDA 1PI3A 3RK1A 1SXJC 2YY7A 4N3AA 1PR6A 1N5OX 2QV0A 1SIWA 4AJOA 3D3NA 5CLIA 3D4OA 3GELA 2IHUA 4XRRA 3QOFA 4UPEA 3UGQA 1ZUNA 3ZW7A 1LTHR 3LQRA 4FDMA 1QZZA 1BQ3A 2EJWA 1GQRA 1GV0A 1JZQA 3PXEA 5J58A 1JKFA 2HBRA 4WBNF 3G7NA 2EQAA 1FW8A 4MW9A 3PSAA 3M1AA 1SCNE 1SOUA 1IJFA 5TIIA 4EDHA 2J33A 4UU8A 4QVIA 4E15A 3FUXA 3TR5A 5A4IS 2DPIA 2O8BB 2QTVB 3NS7A 1MRZA 3X1JA 1ZVMA 4HAVA 3H20A 4G07A 3P71T 2HDNB 3R2JA 3PCRB 1XMSA 2P0EA 3H65A 2NU7B 2EVWX 1Z74A 2Q5CA 1WHSA 2WUGA 3MRSA 5DISB 1H94A 4KN8A 5LP6A 3G3EA 1Z7GA 3ENQA 4PG4A 2BZ0A 4LRTB 1ENZA 2JH8A 1FVIA 3DT8A 5IDYA 1M1NB 4RPCA 3MT8A 3PFFA 4INAA 4TUYF 4EELA 1KFEB 1NBIA 1GNPA 4ARSA 4TL9A 3G7UA 3MJEA 1JKJB 4I5DA 5JY6A 3W5CA 1FNBA 3E9NA 2UZ1B 4MMZB 1PJLA 2ZYHA 1O96A 4JYAH 1ZISA 1BRTA 3CT6A 3ZDCA 4ARVA 3Q6MA 1SUFA 3NOOA 4ZZ3A 1I32A 4IJ5A 1Q17A 3V8NA 1I24A 2D5IA 1LRLA 1W0KA 2PKQP 4A5SA 2IPMA 3CG0A 1TTPB 3O8LA 4KTTE 3I92A 2IH5A 4I4CA 1H1DA 3O6VA 1HWYA 5JQGA 1SIUA 4UFNA 4AZVA 1LI5A 4OGGA 2WFAA 2HREA 1YZHA 1FXWF 3C4JA 1C9MA 3JD4A 1Z0SA 4X41A 5L3QA 3AJ8A 4LV6A 5KSYA 3OQ1A 1EEXB 2RGNA 4DMUB 4FCWA 1IL0A 3D3KA 3GJ4A 3C6YA 4HDRA 1UK9A 3NIGB 2XIQA 4DGSA 3R9IA 1JG4A 2FSVC 1Y7PA 1PUXA 4M0KA 3A4NA 5C53B 3CEAA 3ZDXB 3FBWA 5M34A 3RWBA 4X66B 3SEZA 1XVTA 3IO3A 1QH1A 3NU1A 4CL0A 1SUSA 2BGGA 1M2GA 3TPFA 4D4HA 1T9GS 1GKYA 2J9YB 5J4KA 4RANA 2BBOA 1O54A 2IHBA 2OB2A 3U3ZA 4D0NA 2ZWVA 4Y6GB 5K3EA 2EU8A 4HDOB 2I29A 1JR3E 4ZI7F 3U7QA 1CEXA 3VPSA 3MTAA 4MDYA 1NKTA 1U6IA 4LSMA 5BR8B 2YVAA 3FTDA 4D25A 1NXVA 3ZR4B 5F1KA 5B3LA 4R8VA 2A67A 1GN9A 1PO7A 1EX7A 3O8CA 4WA7A 3HJFA 2JI6A 3R9RA 1XTBA 1QQ5A 1JAZA 1TUBB 2E2IA 4UAUA 3LLSA 3PXUA 3D2CA 1WUIS 4OLFA 4YREA 4JV1A 2Y67A 4FJ1A 3PHCA 4KNVA 4GLFA 3GMDA 4BO4A 4AN0A 4KI0A 1PWYE 3I0NA 3WGQA 1R9TA 1K83A 1MOZA 4TYPA 4QC2A 5EMMA 4NBKA 4IDHA 1VBHA 3NBYB 2QGFA 4DCNA 5E6UB 2XI4A 2O1EA 1ZM2A 1JQJC 1M2VA 3V9PA 1VM6A 4WCDA 4UHJA 2R47A 2EHJA 5CIQA 4PHFA 1ZMBA 1E0DA 4HB0A 1PT8A 4NG5A 2FNAA 4X7RA 2R8RA 2BHSA 1D2NA 2Z6VA 3O31A 3AR3A 5EZYA 1KRHA 4DUPA 3WHIA 1DIGA 1KP2A 1QHSA 2UUBH 2WP8J 2YJ5A 3MINB 3OQIB 5HCIA 3MIZA 2XOEA 3RRNA 5FFFA 1MPTA 4Z1MA 4KQ6A 4UBKA 4CNBA 1K5HA 1VMAA 2XTAA 4BTEA 1S7CA 1SKUA 4IV5A 1U7HA 3BGWA 1XNQB 1Q15A 2QIPA 4D9EA 2IDKA 5CFNA 3ITKA 5EJMA 1T2CA 1JEYA 2BR0A 2QLLA 2HNBA 4I2NA 3FTEA 3P8ZA 5GTDA 4K6FA 4B3TB 1ZL2A 1RYEA 3QZUA 5JSZB 4RS4A 3HB4X 2HYDA 3E82A 1MCZA 2RHRA 3FX2A 2GDJA 1S0OA 5GJWC 1Y5NA 5KFXA 2TMKA 2O3RA 3I53A 2W6MA 5J4HA 1EWKA 5C8ZA 4B74A 2CXPA 4ADSG 2ECKA 2W2VA 2WB1A 1Y8AA 2YU9A 4L9WA 5DNEA 4B5KA 5ARDA 1MHTA 4LVOA 1XTQA 4BO1A 5EL0A 4DW8A 3BIFA 2FSFA 3LT0A 2GM4A 3ASYA 3UKDA 3MJFA 1TA4A 3D3EA 1H9CA 3VOAA 3MK31 4L8GA 4TV9A 2D1QA 1V16A 2FFBA 1ZAYA 3IAM1 2HUPA 5F7OA 4A2CA 3W9SA 3PKZA 5AW1A 1LEHA 2PH1A 1C7IA 3KV3O 1B0UA 4Z9AA 4OJMX 3UJ8A 1FE8A 4N7RA 2JGAA 4XUEA 2H52A 3F7NA 2VSYA 4HDMB 1FFDA 4FE2A 4MAFA 1Z56C 5B1SA 3ZOZA 2VXBA 1DFHA 2XGPA 2GI4A 5F51A 2VF7A 1AMNA 3UPUA 2QP9X 3UV6A 4LA4A 2MR6A 3ADOA 1NX6A 2RH5A 1ITZA 1A0GA 1C9NA 2PRJA 3CF2A 1FPMA 5IBRA 5BQXA 4QXQA 1YZLA 4C43A 2EC5A 4WLVA 1V45E 1VXRA 5DE3A 4IO1A 4DV1B 2QTRA 4B71A 2BI8A 2Q0QA 2R00A 2BMAA 4PPFA 1NW4A 3Q5DA 1MD9A 6GPBA 3OECA 5BSHA 2G36A 2YMQA 1NATA 1XTTA 5KCZA 1JAHA 4RD6A 4DWJA 1G0NA 4FI3F 4QOFA 4B2YA 3IYLW 3TLEA 1PZMA 4KXVA 3GOHA 1XEFA 4Q16A 1V3UA 1JLLA 3CUVA 4PR0A 2FPIA 1LCIA 4YMTA 5HF5A 3LT1A 1BD3A 1NMEA 1PQPA 2XMBA 1QAQA 3GZ4A 1KVTA 4R1PA 4PLGA 1NRJB 3TOZA 1FMCA 3GTGA 1QHNA 2UVPA 4KYIB 1LBEA 1VL2A 4BO0A 2IFTA 4BWSC 3TW8A 4PS0A 4TS4A 1OBCA 5HJ2A 4JY7A 3GEDA 1P74A 1V7CA 1WY7A 1ZGCA 1X0VA 2FUG1 3EK2A 3FPKA 1I3CA 2H7VA 3TTYA 3G5UA 4D3FA 3S99A 5DNUA 2BMWA 4AYBE 5TT1A 4Y8VB 3D7SA 3S2SA 2ZT5A 1UKVY 4KO4S 5IN5A 1LQ2A 1SBTA 3WWZA 5C1OA 2PGAA 3BFKA 1EGMB 2PBZA 2BFCA 4J6EA 1OXVA 1TEZA 4TMVA 3EAQA 5C51B 4J2TA 4D2IA 3JTMA 1OU4A 5F9NA 2FZVA 2YDYA 3ZHUA 4E3WA 5H9WA 2IKSA 2Q2TA 1CRPA 2HRCA 2VBIA 4O7SA 1XD9A 3N43B 1RLMA 2PWAA 2RHJA 2DUWA 5KFHA 1U4SA 5COQA 5KI6A 3G1WA 1IN1A 3BJEA 3ZWOA 4EVSA 2EX4A 4WZAA 2C5FA 3S7TA 3V4VB 5FA6A 3ZWBA 1J20A 1W4BA 2HU5A 3C8UA 5ICFA 4PANA 4DLTA 1H05A 3EPLA 2BJHA 4PYRA 3O8DA 1NR5A 4KLZA 3HOZG 3UJHA 1QVRA 1K06A 3G49A 1HT2E 1ZD3A 1S1MA 3TTVA 3IX7A 4XYLA 2Y0EA 4Q4AB 4UHDA 3JZDA 1U0BB 3P96A 5IYCG 2H08A 4EHJA 3CH7A 4YCSA 1VBMA 5I5VA 4BVGA 3UGJA 3IMCA 3GLGA 4ETWA 3R7FA 3DONA 4XWAA 3THSA 1GPBA 2PYZA 1DFGA 3AUFA 5CVJA 4M0MA 5TEWA 4PBSA 4QUDA 4NNJA 1R5OA 5CBPA 4RELA 4WKBA 4NFYA 4TQGA 4AKGA 1EE9A 4DDVA 5JAIA 2ZQYA 5DYYA 3RAGA 1WS6A 5JLJA 3UH1A 1XNRH 4IDPA 2D00A 1J5EB 1Z6AA 4FILA 3VHXB 3V34A 3VPBA 3BFXA 4BKMA 1RD4A 5AYVA 2XQVA 3SNHA 1EYZA 3GTQA 4UMVA 3ABOB 4MV1A 3OLYA 2D0PB 5HILA 4JUIA 3Q9LA 1Y89A 5DISC 4NDNE 3ZE2B 4TQSA 4LCJA 4X45A 4QXAA 3VR0A 3SP1A 1PFYA 1SXJA 3BMNA 1QLJA 4C3ZA 4JJAA 3AM1A 3IB6A 5KO2A 4V0QA 4LJ4A 5JMTA 1I4OA 2PV7A 1A71A 1AHIA 1UJ2A 4KK4A 1OI4A 2DFDA 1YR6A 2X76A 3VPDA 4JJFA 4EJSA 3KLOA 1QKKA 5ALXA 3M4JA 3H2YA 5LOVB 4UTXA 2I7DA 2PLNA 3FWZA 5D3MB 1E3JA 4WJLA 3LXXA 1FYFA 4LV8B 1LGYA 2CLDX 3MILA 2DLNA 5E9WA 4LG1A 3T3HA 4ZO6A 3Q85A 2IYXA 1TVKB 2WF8A 2YOGA 4YRBA 4MQLA 2SKCA 4DCUA 1J0CA 3GPLA 1S8OA 2O14A 5KT4A 5F5LA 3L8HA 5AKEA 5CB8A 1OZGA 4X24A 1CJMA 2WC1A 1R18A 5ES3A 1DKRA 2AC4A 2C2WA 3N2ZB 1FS6A 1XTPA 1U3TA 4L3OA 2XUAA 5FOVA 2HZ7A 1PSZA 2W4IA 2RBKA 3FDZA 1PFWA 3NATA 4PN7A 4DMLA 3L4EA 3LP5A 4OAPA 2FXVA 4U2FA 2FMIA 4LGMA 2YICA 2H1SA 2ACVA 4UVDA 5TQJA 3SX0A 3VH3A 2QLNA 4A93G 3IBYA 3I1YA 1TA9A 1I2ZA 3IMEA 1GP2A 4D4IA 2CCKA 2JAUA 4F5DA 3E22A 4DF3A 1JYSA 2PSSA 2QTHA 1T1SA 5K45A 1AS3A 4YRFA 5KFGA 1M83A 1UFQA 2PUJA 2GJ4A 2IE0A 2ZJYA 5EZSA 2CVPA 3L6CA 2AT1A 4TV8B 2Q3HA 1WHSB 3K1TA 5B64A 3KTDA 5LYYA 2QX7A 3UCXA 2C2MA 5LP6B 4HQRA 3NVKI 3G0OA 4HQ6A 4MYTA 2FSVA 4FS8A 2SKDA 4J91A 1V6SA 4RE5A 5KC9A 1GKLA 2PX5A 4R41A 3ZU3A 4E5MA 3TNYA 1NT4A 4KEAA 3AESA 1QOQB 1S7GA 1NUAA 4G97A 1XYGA 1UEXC 4ZYXA 1DHTA 1O96B 4WERA 1L4UA 4PCLA 3MLBA 4WCFA 3IAHA 4EY8A 4ECZA 4JYMA 1RKQA 2B2XA 1ZQ1A 1AGYA 4C5AA 1WMEA 2DPYA 2PSHA 3QFCA 3NRBA 1M6YA 4NLGA 4J9SA 2ACKA 3ETEA 4M9XA 5JQGB 1W5AA 5KNDH 1R50A 4GP6A 4LXUA 5JYEA 2QD3A 3LI2A 4R16A 3VMMA 1SOWA 4PZ0A 2YIMA 3OIGA 4CKZA 5L3QB 1OWLA 4B6JA 2F59A 4ASUD 1JE1A 2I3AA 3ZVNA 3PXXA 3MLAA 2YWXA 3DHYA 3L7DA 1WCIA 5E7JA 2F4VB 4HDRB 2ZXUA 3ZKAA 2REOA 5JCPA 5F9FA 5HUJA 4WNYA 5KEIA 1E5XA 2VLIA 4OSPA 5SZHB 1QO7A 2DERA 4G1FA 3ULKA 1YSCA 4H77A 1QH1B 2WOOA 4BQPA 4N5MA 3L0CA 1CVIA 3IV7A 4FBUA 1SC3A 2FMAA 3CQZA 4FBGA 3WL4A 1T9DA 2QN2A 2V7EA 4QWMA 3L1IA 3AR6A 3UJDA 2BKUA 3EYWA 1UMCA 5DHFA 1AY0A 1FBNA 4QHTA 1N2GA 3HVKA 3AXSA 4KE9A 5BSEA 5JCXA 3CPJB 1I6WA 3L7YA 3G2QA 4DL5A 5F1OA 3HJUA 3Q12A 3UAVA 3IVMA 4G5YA 3HUUA 3CVWA 3EHDA 2KS6A 4ECXA 1E6WA 1Q44A 1G66A 3TVYA 2Q8QA 3VZPA 3ROZA 3FA2A 1DKLA 3F90A 3EPJA 2QZSA 1NURA 3BWCA 4OOEA 3H5WA 3N07A 3W8NA 1Z73A 4O1IA 2NPFA 3G0GA 2IZ6A 1WQ4A 1T4DA 5IWAH 1S2GA 2HF9A 2P4HX 1I1LA 2C8VA 5JS7A 2ZTLA 4H4EA 3AF3A 1SCBA 2I4IA 2C7QA 2XQIA 4QUBA 2RJOA 4ALLA 1Z0JA 4F6RB 2OYSA 2QTZA 1M2VB 5CFZA 3V4LA 1VL5A 4NL4H 1SA0A 5F21A 2ZDHA 3PGXA 3BB3A 2JBAA 5EEHA 5BUZA 1S2OA 2V98A 3RVDA 4PE5B 4IOKA 2FP4A 2XMGA 4YCMA 4E6NA 5CPFA 1QHHB 1L6RA 5FL3A 3RAXA 2C5GA 3ROFA 1U6KA 1AF7A 5LCXA 3TL3A 3H42B 3LDFA 5IT9W 4AJ2A 1QVZA 3NDRA 4QYXA 4ZD6A 4I4TA 5LDGA 1EPUA 1G1AA 4O3FA 1GILA 5AVWA 2RH9B 4DQDA 3A58B 3EJ6A 2M05A 2VAPA 3GN2A 1DB3A 2C54A 1VA4A 3TIIA 4B5LA 2P1DA 3P9YA 4ED2A 5JRDS 4KMOA 3E15A 1TM2A 4EKNB 1I51A 1KK0A 3H84A 1KQOA 1L7XA 1FMLA 2FPPA 3UT5A 1HDOA 3AU9A 2FMTA 2WYIA 1X8XA 4IR1A 1TVEA 4CKWA 1ZWKA 3MLEA 1Z5UA 1OYWA 3ZDZB 2GX6A 1PNOA 2CK3A 3EXG1 3VO1A 1USKA 3PR3A 3W4KA 4R9UC 3UZOA 3DNFA 4MZXA 3PXGA 2PS3A 3ZV7A 5FOWA 1KQGA 3VH4A 4Y18A 3ES9A 3H97A 2KI5A 5SZIA 1BCSB 2BISA 3W2EA 4RVOA 2V9ZA 5FNVF 4AUMA 3ZGVA 1WUJS 4TV9B 3FDSA 1V16B 4MPJA 1YVUA 2QN9A 4F4CA 2CV1A 3C15C 4MQ6A 1SG0A 2B5OA 4LMBA 2A9KA 1SEPA 2EAUA 5FLEX 1HSOA 1VE3A 1NOIA 2QJWA 3WGOA 2G08A 2QRQA 1G20E 5TJ9A 1TZJA 1SC9A 4EJ2A 1TC1A 4H0CA 2IF2A 2Z4RA 2Z98A 5AW3A 1KNXA 4PV7A 2CBXA 2PEYA 4G24A 1DKOA 1N33B 1ZIDA 4LF9H 3OEHD 3SR0A 1LX7A 1WETA 4RACA 3T12A 4QHSA 4Y2HA 1T9AA 3PHLA 3FOZA 2ZIGA 4A91A 3TEMA 1GYQA 3CRVA 4TWJA 2PX2A 1FMFA 2HVSA 1NVMB 5TE9A 4C0LA 3MJRA 5ALYA 3WGVA 2JATA 4GHWA 3RAQA 4C7VA 3TFOA 4BO8A 3TWOA 1FSSA 3G2NA 2XAUA 2UYCA 1ULTA 2BFPA 2ZAGA 1G6HA 3A3KA 2VZLA 3FBGA 1IPFA 4ISCA 4BGDA 4OLAA 4OJNA 3GL9A 3H6KA 1JLLB 3I5YA 2GN0A 4R05A 3QE9Y 2O0LA 2OWOA 2FPIB 4KAJA 2V8BA 1F0YA 3IUPA 3RTGA 1QHIA 3VISA 1UBOS 3T5GA 4C4SA 1E32A 4ZOBA 2YRFA 2UVPB 4NIMA 1I4TD 3AJ9A 2ONZA 1LKZA 4OQEA 3C6XA 4ZHQF 3L0DA 4Y2VA 1SFOA 4X1YA 5ESXA 4FYHA 4W5WA 2NM0A 1U0OC 1NBMA 1G7TA 1UPXA 4D9JA 1CJSA 4LPSA 3MS4A 2ASVA 5K8TA 3IUNA 2JD1A 5CFMA 3OLQA 4G3IA 4WUTA 1UDAA 3HM9A 3V3KA 3LFTA 2BFCB 3OQBA 4JJGA 5DYGA 4ZO9A 3IV9A 2VTKA 3AP3A 2ZK7A 1O5TA 3QMVA 2F3TA 1H42A 2C99A 1E0AA 3GPCA 2RHWA 1CZLA 4MH0R 1Z2NX 2WD8A 2WAXA 4MGYR 1GQQA 1KA9H 4ZT3A 2AZMA 2MSEB 3BAAA 2CVFA 4HVTA 1JI3A 1JSCA 4HLUC 4LF6B 1QCZA 3AUTA 4WZAB 4TKLA 2JGEA 1NPDA 4JX9A 4N0EA 2NUTA 1SHJA 3OFSA 2QTVA 4INPA 3UUWA 2O0KA 4Q0YA 3BZUA 1NDUA 2G4VA 4IKEA 1AGXA 1PJ3A 1KPIA 7AT1A 3K1ZA 3WZ2A 2XT0A 4B4VA 3PNSA 3OFJA 4XYLB 4CM1A 16PKA 5KFYA 1JFTA 3LFHA 1E1RD 4RV5A 3ONEA 1E63A 4K0KB 3UMMA 3GLGB 4B6PA 1MH9A 4B7ZA 1A4RA 3PFCA 3D0OA 1LS6A 4QGBA 4DTCA 2N3ZA 2HJHA 3F74A 1JKJA 1QRRA 4E1AA 4FYXA 5E2IA 3A4YA 4S1NA 2UZ1A 3OICA 1CUEA 1RCUA 3W6UA 1DTSA 2PKWA 2PRZA 1E7YA 3IA7A 3E1GA 4IV8A 2V6MA 4J9RA 1FJGH 1SR8A 1ZCFA 3MM4A 2O2CA 5CBPB 4QFBA 4DCOA 3IXMA 2OHGA 4GMGA 4UVIA 5LQMA 3WMFA 2YWGA 3D5TA 1Q92A 2EEPA 2IU3A 4UBLA 1ZJYA 1MBZA 4MA5A 1ZMOA 1Z12A 1VYTA 1C5KA 1GDDA 3GF4A 1CZRA 5KIAA 3SHFA 1D7OA 2QVZX 2WUDA 5E1MA 5FB3A 1VAJA 2KBFA 3M6AA 5IN4A 2DY1A 4I1IA 1FU7A 2C9CA 4K6NA 3BMNB 4PYJA 3VC3A 4RTNA 5ELXA 3HZOA 1R74A 1DKQA 2ZUBA 1ACJA 1NVUQ 3LQYA 4YMIA 5ALNA 4X62B 1B8OA 4BLVA 4D43A 1HQCA 2NZJA 5KNCH 4I7HA 1WCXA 4ALNA 3MMXA 2Q2UA 4EJSB 4BQOA 5KG6A 1Q3KA 3K4HA 4N5DA 1P29A 4LXXA 1N0HA 4B0PA 3AEQB 1CNEA 1UJCA 1J42A 2BUBA 5KOHB 2O4CA 1GGJA 2WB2A 3R24A 3LUHA 4OD0A 1WZNA 3A32A 2H1OA 4B4WA 4WNCA 3PLRA 1BXZA 2Z09A 1TM5E 3NWPA 2Q2OA 4YROA 5I5EA 2DHDA 4JDUA 4G5RA 3UUFA 4ZT2A 2R1TA 4RD1A 1PL8A 3HDHA 3TW0A 3AFNA 2IPLA 3VX3A 2XRZA 4QRDA 2G8LA 4FJ0A 1Z63A 4IIYA 4CR6A 3HI6A 1TUGA 4D9FA 2PY6A 1C7ZA 3DE3X 3S55A 3WYDA 4LBZA 4LE1A 5DBEX 1L2TA 3EXFB 4HDNA 2CF6A 1IRXA 3U9TA 2IVFA 1H69A 4QRHA 5E7MA 3RU3A 4L2IB 3PT5A 2H18A 1SOMA 2X7HA 2LGJA 5HTKA 3RSCA 4CKEA 4PVDA 2F9LA 3BK1A 4MWBA 4GBMA 2HK8A 5K4HA 3EFBA 3CLUD 5TGZA 3OZFA 4I2VA 1UINA 4BNJA 1V6CA 3MCWA 1U7UA 3GJRA 9LDTA 3E22B 4BAUA 1ZMRA 1XMQB 3FPBA 3VAYA 4X0EA 2W0SA 1K86A 1HV8A 1OHHD 2O3TA 5ADHA 2XQGA 1A4XA 2JCGA 1E5QA 2UVUA 3L6BA 2ZSEA 5E3JA 1Y8RA 2JEOA 1D09A 2JKYA 2WG0A 4MVJE 2CLMB 4BDTA 3B9QA 3MINA 4BFTA 1R0LA 3MB5A 1I0LA 3HDYA 4CIWA 4FR2A 2CLHB 3H6GA 4BQIA 3G5AA 1NW5A 4XTCS 3MAGA 3D7KA 3AESB 2YNMD 3ZW9A 1MLDA 3IESA 5L4SA 4LNHA 4OXXA 3BDAA 3E3NA 1A2KC 2ZSFA 2RKWA 5FPKA 5IH3A 1LLDA 4Q4DA 2H16A 4EL5A 1H9AA 5MF6A 5DMXA 6CHYA 4WCFB 1NYLA 2MDTA 3IBGA 3O9ZA 1TTHA 2FUCA 4P7FA 3EY9A 3DEAA 3WGHA 1I6MA 5IT9A 1UADA 4HP8A 3RF6A 5KTSA 4V2IA 2IHZA 1N5DA 1Z4IA 2W6ID 1RRPA 2F3QA 1RIFA 2PU7A 3UYKA 3MBIA 1RWVA 3I4FA 4IDCA 3ZBTA 1K8QA 2C7VA 1CF2O 1RTKA 1WCIB 4FZ3A 4FZRA 1CZHA 4B3MH 1CRLA 1ZK1A 4KYUA 5KTNA 4Z4EA 3MC1A 3NP9A 3ZV3A 2AEJA 2YVKA 3NALA 4EA8A 4Y2PA 4YYZA 4HTAA 3TRFA 3GEGA 4J4HA 2ZBGA 3D3QA 3X1YA 1P80A 4TVBA 1WMFA 2QM0A 3PXCX 4TRJA 4JOSA 4DZZA 2OGTA 5FPOA 1NY5A 3SDSA 1R9JA 3EH1A 1M34E 1FUUA 4IRCA 1P7CA 2Y77A 4QICA 1AKRA 1Y6ZA 5KSPA 4YMUA 3LRPA 2V59A 2O3SA 3HWWA 2UUPA 2VR1A 3U3MA 2O8NA 2Q6IA 3G2KA 5KYUA 5GQSA 2AMVA 3V5NA 1I14A 1CQPA 4N3BA 4F4JA 3PYLA 1QDLB 3OJFA 3IQEA 5IAOA 4O4LA 3W5SA 4B7AA 1F60A 2X2OA 4LY6A 5K3OA 3VZBA 1XF9A 1HT1E 4NBVA 5BSWA 2Q28A 3CWZA 2QVLA 3USZA 1ZHHA 3T9EA 1TOAA 1Q11A 2JJ1A 4CR8A 1RE0A 4TLBA 4P7BA 3D7LA 3ZBUA 5CDUA 1EJ2A 4LZZA 2WILA 3MTJA 4QIWA 3FYTA 2VRWA 5BMVF 4GBED 1QZXA 4Q9KA 1FNNA 2C3OA 3THXA 3A0UA 4C1BA 4Q21A 2ZOSA 3GVPA 3NPMA 3TSYA 4HX5A 5B3AA 4DARA 4M86A 1LPOA 1YZNA 4FHGA 2O6LA 4NK5A 2JCBA 4OP1A 1SA0B 3LX4A 3PTLA 1OZFA 3VVMA 2JBAB 4JZKA 4ZFNA 3GUVA 1N48A 1VLMA 3H17A 2QTMA 2FP4B 4K5QA 1KYXA 2JLXA 2ASEA 3IAAA 2YQ5A 1L5GB 4QPNA 5KWEA 2UZ4A 3BIXA 3FHJA 1ACMA 2FG7C 1KS2A 2RHOA 5HZHA 3A1CA 4LKOA 4ZKDA 5HKKA 2AOUA 1T8YA 4I4TB 4AJNA 1K7SN 5DRYA 1Y8QA 1LX6A 1VCMA 4QDOA 1Z2DA 3HYRA 1IZ7A 1F8GA 2NP6A 1KQ3A 3JVEA 3L1KA 3E5RA 5FBLB 1NJ8A 5KAPA 4ZVQA 2XB9A 1T24A 5CDGA 1NXOA 1ZX1A 2FPPB 3N8DA 3TL6A 1LF5A 1LW7A 2WPDA 4FDTA 1P8AA 1E8NA 1OWNA 4CKWB 1NKSA 4LK3A 1OXSC 1JXMA 4QUIA 1E2PA 2D1SA 4RNCA 4GAEA 3BHIA 3ETCA 2IHVA 2BHTA 3C7TA 3HU2A 4L4UA 3AIMA 4Q9IA 5ELLA 2O5CA 2CLFB 1XJQA 2PMBA 3FPEA 4RHEA 3G6YA 4AS3A 3RRJA 5YASA 3O1LA 4HUQA 3KQOA 3IT3A 3BMXA 4QGHA 1KAGA 2X0RA 3IP9A 3NOQA 4KLRA 4FFRA 5IH7A 1CSEE 1OPRA 2VAVA 4OJYA 3ABRB 3N1UA 1AS2A 3JPYA 5KFKA 5AVXA 5EMHA 1P8JA 4BV2A 4JXKA 4DOMA 2QLTA 2PUCA 1NE2A 3UCFA 4JXXA 3SQNA 3ZV4A 5IKEA 3OZXA 1PUIA 4ZMRA 2OUKA 2C7BA 2FJ0A 3BQ9A 7MHTA 3IILA 1GPMA 1PKEA 3E8MA 1MDFA 2CLCX 2OENG 3PW2A 5T3UA 1WG8A 4ND4A 3TE6A 3BXZA 5MN6A 4JBYA 2PQMA 3IIIA 4CLXA 4EO9A 2IJGX 4NOMA 4C78A 1NHWA 4E5YA 1NE7A 2FFHA 3JPWA 3PFGA 1XRQA 2H85A 1SBZA 5FUMA 3T38A 3NIWA 4KPEC 1QF9A 1OREA 1RACA 3DZHA 1L1RA 3PNOA 4DPLA 1ZQ9A 1E5LA 4IQ0A 3L3BA 5C34B 1R15A 3LECA 3RAFC 4EZBA 4BQEA 2YHUA 4LE0A 5D3MA 1U2SA 2IZ0A 2YH2A 5IYZF 2FHSA 2QLJA 5DYTA 2ADFA 1MJNA 3TIVA 3B3JA 1TVKA 3DAHA 3PO3G 4IQFA 1N56A 3LS2A 4X1YB 3MQFA 4A6XA 5KAMA 1TPZA 4LMPA 4RKQA 3HKDA 4LJ8A 5EWMB 3VJRA 1W1UA 5CXSA 3EG9A 2NZYA 3C3EA 1DRJA 3DD5A 2ZW9A 3M6MD 3U60B 1EVQA 2JGMA 4M1YA 2ONKA 3J7TA 4AO7A 2XKAA 3JD1A 4RESA 1CB7A 2V4UA 2XF8A 5KFWA 1ZM9A 1PR9A 2GAOA 5A3SA 3U5TA 3TPZA 4CGYA 2V9CA 1G291 2YZKA 4K7JA 3W2IA 4DA6A 1U8AA 1X7YA 5HG0A 1EVYA 4EJSC 5F9MA 3GRUA 5B36A 2A0UA 2VHZA 4R1UA 5I9SA 1RWOA 1ZIYA 4RSGA 2VP9A 1GN8A 3GMTA 3PUWA 3LOUA 3LUKA 2ZWAA 3DE2X 2NUTB 1VL0A 4GM1A 3MFQA 4TTIA 5IJ0A 4KN9S 1W6UA 2E6UX 3ZGLA 4TV8A 2WE6A 3HU5A 1ZEJA 5AJUA 2PMEA 2QLMA 2IBMA 4RB1A 5T64A 4IKPA 4QQKA 4WZBE 2RGAA 3FMGA 2XZTA 4DY4A 3IXQA 1EFLA 3F2IA 3TZ6A 3RC2A 3UXYA 1ACLA 1HNXB 3IUSA 5E38A 4B48A 3R41A 5E6RA 4XKJA 3DDSA 4NBSA 3IVXA 1Z47A 4TZ0A 3D59A 1A27A 3MHTA 1FDTA 5GM1A 5LQRA 1C4XA 3GVCA 4U9UA 2RGUA 3TO5A 4H7PA 2UXDB 1VE1A 2QORA 4US0R 4V0RA 1H0SA 4YRSA 4N12A 2PH7A 5C8VA 2PUVA 2QNRA 1O97D 3AJAA 5I5YA 5JPIA 1ZEMA 5JFGA 4I81A 1E2MA 5U4QA 4KAAA 4FMCF 3FPCA 1CDEA 1JDUA 4TT3D 1NG9A 1KZ1A 4V1CB 1QIEA 4XIFA 4C0WA 3VYVA 2IBKA 1TAQA 2ATVA 3AEYA 4MYCA 3IBSA 1PS8A 4N5HX 1L7BA 3SC3A 1UF9A 2ODAA 1E2JA 2WWYA 4X44A 3VR6A 1FDVA 4LJSA 4ZV7A 2HD4A 2G6TA 4ZVNA 4IRMA 3D4PA 3FDXA 1V2GA 3F9RA 1T9KA 3HABA 1MA3A 3SJUA 3CRZA 4E5NA 3TQOA 1LLFA 4WCFC 4ED6A 1ZR4A 5EWJB 1JG1A 2F17A 4FQ8A 1JDEA 1KDZA 4DV6B 4J7CA 2BT4A 1GSOA 4FOOA 1NONA 2FG5A 1PLJA 1M0EA 2DC1A 1BFDA 4ZZ2A 1S8AA 2J32A 4B73A 1B0PA 2XBLA 1IVYA 4BMPB 4KUEA 3JXEA 4F8EA 4F38A 1U3GA 4IH9A 2R1TB 3V8PA 5IKMA 4O4JB 1HYGA 1M8FA 4FNMA 2ZB7A 1KJ9A 3QA3E 4I7EA 2P7IA 4GR4A 5B7NA 1BJKA 5DG9A 4HDNB 4GSYA 4BMNA 3FYDA 1RLOA 1CIJA 1GR1A 3VU1A 2MYPA 1JJBA 4GQAA 2HADA 1JG6A 3HEMA 3B1FA 4V1CI 3IAS6 1KYZA 1Z2PX 4TUYA 3B82A 4CKEB 4YAEA 2HQSA 3H05A 2C4NA 3KPVA 1VBKA 3LBHA 3TFWA 3MUEA 3ZE0B 1KZHA 3I6MA 1CUHA 3RS7A 4F6RA 3ELBA 2OCBA 4JYCA 1V51A 2INGX 2YXLA 3B20A 1B43A 1WL8A 5E2AA 2NXWA 1X7ZA 2DFPA 1JXQA 5EN4A 3P0IA 4CDMA 1QHHA 2XJ9A 3GWGA 3N2NA 1Y8RB 4YGYA 2CW7A 3OHBA 2CL6X 1FXWA 3Q9SA 1AQIA 4IDOA 3U13A 3K5HA 4U7PB 2QB5A 3PA8A 4MPPA 2JEZA 4NQRA 2BR4A 3UHJA 2C9BA 4BNUA 5LMUB 3B6MA 2HEGA 1KDVA 3H1GA 3NANA 3E3AA 3BE5A 3OSUA 2ZRPA 2QJRA 4ENSA 1XA3A 5KTRA 4Y1FA 1C7EA 1WUTA 2E37A 1Q1AA 3MF4A 5CTAA 4H15A 4KLCA 2IW3A 1IZZA 1M2NA 2RSLA 1YJBA 3WDMA 1CX9B 1JGTA 3HCRA 1WW2A 5IYBG 5AJTA 3RBZA 3OJEA 2PKCA 2ZDGA 1U31A 5FJ8G 1Z26A 4RTJA 5JISA 2BM1A 3GFOA 1K2WA 2IPOA 1AZWA 3I30X 3DP9A 2NP7A 1NPYA 5F9LA 1APBA 3ZOKA 5FV7A 2R6HA 3JD0A 2W6PA 1KEKA 3DMNA 2AMLA 2A4MA 3WL8A 1AZLA 4KACA 1BCSA 1W4CA 2PGOA 4NOJA 4F3KA 1ZRMA 4DQLA 1ZOOA 4G2NA 1JE0A 5A06A 4OHCA 4QBKA 3QFFA 2AFHA 2FW8A 4GNKA 1OH5A 4E2YA 5AIBA 5FI0B 5ARCA 2J07A 3WLTA 4OX9B 1I4LD 3SSAA 3EVGA 1XD2A 3PEVA 1GZVA 2BGRA 4XXHA 4RIIA 3MJSA 2P75A 2KJQA 3I45A 4HMPA 1R1DA 2YFKA 2IEGA 2VJBA 3QSGA 3LV8A 3N0XA 1JIKA 1J49A 4IXDA 2AC2A 1N3LA 4MHSA 1GG9A 2BUCA 4J0KA 2XCQA 3GFGA 3B5EA 5BSFA 4MQMA 5KYUB 1WOYA 1E89A 4F3YA 5BV1A 5IT4A 3T3IA 1DDGA 5BR7A 4KQCA 2WKSA 4PAWA 4BNFA 5I5UA 3JD2A 3PNBA 4X90A 3IE1A 1XCLA 4O4LB 4P1ZA 1ZSYA 1UKYA 4WTOA 3LBFA 1G6KA 3HCBA 4BVFA 4Q3OA 1YS2X 2PMCA 1S9HA 4S1OA 1MEOA 2XGGA 2ZRNA 5CA0F 5EIBD 3LQ4A 2XMQA 4PC3A 3JSXA 4DUYB 1XDDA 2B1IA 2GEUA 2IK8A 1DV2A 3L2OB 3HJHA 4G25A 3ZIAA 3FCUB 4UREA 3E5HA 3THXB 4WFQA 4CEIA 1OI7A 1R0WA 1SIOA 3FRHA 2J3JA 4APMA 2POQX 4BJ3A 2FHPA 4BU1A 1T0PA 4FU0A 5BSRA 1DADA 3QEJA 4X91A 4QNNA 5BR1A 3A1SA 2E3JA 3Q0TA 1GZ5A 2OHOA 4EYOA 1A7JA 2C5HA 1YNOA 1ZK4A 4PZLA 5DLPA 4O3SA 2VP6A 2R7AA 2PK3A 3BD8A 1QFSA 3OLXA 4OBBA 1GRNA 3UW1A 4NXMB 1U4OA 1IXYA 2P3LA 4US1R 4HAUA 4UUQA 2AOUB 3BS4A 4R7ZA 4IKOA 4OU5A 3BF8A 1NSTA 4ENUA 5BWTA 1X3SA 2G9RA 1IQUA 3JQAA 1JV2B 3AWIA 1M8JA 5FJIA 2VK4A 1Y8QB 3UJNA 3QU5A 3VOSA 1TKRA 2CC2A 2K7ZA 4EOGA 1D2EA 2HCBA 3KYDA 3CUSA 2E4WA 2DHEA 4MK4A 2PU5A 2XZOA 3HDTA 3EFEA 2C82A 2JB9A 1UXOA 1X1AA 3ZGNA 1SPXA 1HE5A 2WUVA 5H3HA 1V5WA 2H8GA 3KOUA 3FVVA 4DIDA 2I66A 2NVXA 3PKJA 2J48A 4TX1A 1QFYA 3SZ3A 4TWZA 3P0FA 4K3VA 2XGMA 1PS0A 2PSEA 5EJ8A 1C2TA 2NTVA 3DDWA 2V4RA 1C7RA 3QBTA 1RXWA 4YUVA 4AWAA 3PNVA 2VDNB 4D99A 2A1HA 3F8SA 5CLQA 1ZC3A 1V48A 1QP7A 2EIHA 4GR9A 1RIIA 3SHOA 3GV8B 4WZZA 4J0QA 3H1EA 5DB4A 5AVSA 5JZSA 2J6TA 3DCIA 4HUQB 2J0SA 1YDGA 2JFHA 2I8AA 1MW9X 1L5RA 3IOMA 1Y7IA 3KWLA 3EZ6A 4YJFA 2M2IA 2FF5A 2JIZA 1YF3A 4RY0A 2P9FA 4BE9A 4CT4B 3IPYA 1DT3A 1OCEA 3ZNNA 3JQ8B 3WYGA 4DNFA 3NT4A 1Q5PA 4FE7A 4TQ9A 2XT6A