2ZDQA

Crystal structure of d-alanine:d-alanine ligase with atp and d-alanine:d-alanine from thermus thermophius hb8
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
319
structure length
319
Chain Sequence
MRVLLIAGGVSPEHEVSLLSAEGVLRHIPFPTDLAVIAQDGRWLLGEKALTALEAKAAPEGEHPFPPPLSWERYDVVFPLLHGRFGEDGTVQGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGEPPVVPFDPPFFVKPANTGSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
rcsb
source organism Thermus thermophilus
molecule tags Ligase
total genus 89
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2zdqA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2zdqA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zdqA01
5C1PA 3JZFA 1W96A 4O4LF 4DLKA 4EA7A 5C1OA 2R87A 3K5IA 1EUCB 4EA9A 3KREA 5LP6F 1GGOA 4O82A 1I7NA 4HQ6A 4MV8A 4L1KA 2V59A 1IOVA 5JQWA 1KC7A 3BSWA 2I8CA 5LXTF 4O7VA 1I7LA 2YZNA 4O2AF 3G8DA 2PVPA 5DMXA 2XCLA 1KUTA 4O7WA 2R7MA 3R23A 4HR7A 1KJQA 2V58A 2J9GA 4QSHA 1AUXA 1GSOA 4HNTA 4IHJF 5LYJF 1BNCA 1EHIA 3N8DA 4O7YA 4O4JF 2YWVA 1C30A 3HBLA 4YAJB 3WO1A 4TUYF 2W6PA 4I50F 3BFPA 1Z2NX 3V4ZA 2HJWA 4FFNA 1GSHA 5BMVF 4FU0A 3HO8A 5C8YF 2YL2A 3U9TA 1JDBB 5HV6A 2FPPB 3K5HA 4M9UA 2QK4A 2YW2A 3TIIA 3MWEA 4XX0B 3U9SA 4TV9F 4FFLA 2W70A 2GLTA 4WD3A 3LWBA 5JH7F 1UC8A 4C5CA 1DIKA 4O86A 1WR2A 2GQSA 3JRXA 4ME6A 3ETHA 2Z02A 3U54A 2VPQA 4XYLB 3QFFA 3TINA 4C5BA 4IWXA 4YJ2F 3RFCA 3VPBA 3JRWA 4MV6A 2CNQA 2CQYA 4O83A 4M9CA 2R86A 3GIDA 5BPFA 1GLVA 2DWCA 2YZMA 4YBZB 3OUZA 3KALA 4O7RA 5JVLA 2IP4A 3G8CA 1PK8A 4O7ZA 1OBGA 2GPWA 3AW8A 2VR1A 3MJFA 2R7LA 2W6MA 3K3PA 5GONF 2W6NA 2GQRA 5CA0F 4O4HF 5I47A 2ZDQA 3R5HA 1SCUB 1ULZA 4ZQIA 4EA8A 1EZ1A 3V4SA 4EGQA 4WBNF 3DF7A 3RV4A 1M0TA 3MWDA 1VBHA 3AX6A 2FPGB 5KKNB 4GGMX 4MA0A 5EZYF 2ZDHA 4MV4A 1A9XA 1B6RA 5H80A 2YS7A 1JDEA 5CAEB 1Z2PX 5IYZF 2YYAA 1UC9A 3RUPA 1W93A 3UFXB 2W6QA 1T36A 4MV1A 2YZGA 2DZDA 4FFPA 1GSAA 4O7TA 2YS6A 3WO0A 2X0SA 5LA6F 3ORQA 4M98A 4MAMA 2YRWA 3JZIA 4DIMA 2R84A 5J2UF 4O84A 1JLLB 2YRXA 4FFMA 4O7SA 5D8DA 3ORRA 4EABA 4MV3A 4EAAA 2CZGA 3LP8A 2QF7A 2V5AA 5HBRB 2WYOA 5JQGF 1A48A 3VPCA 2P0AA 1VKZA 1Z2OX 2SCUB 2W6ZA 3OUUA 3KAJA 4E4TA 4O81A 2Z04A 4EG0A 1B6SA 1CE8A 2NU6B 3R5XA 3N6RA 3WNZA 4I55F 4IZOA 3TQTA 2C00A 3I12A 2CNVA 1E4EB 4Y8VB 1KEEA 4HNUA 4YAKB 1KBLA 3Q1KA 4FFOA 3KAKA 4RZQA 2R7KA 3R5FA 3BSYA 2PN1A 1M0WA 5FNVF 2ZDGA 2W71A 2PBZA 4HNVA 2HGSA 2I80A 2NU9B 4MA5A 4ZI7F 3GLKA 3TW6A 5LOVF 4FE2A 2YZLA 1EYZA 1KJIA 4YJ3F 3R9RA 1VBGA 4M99A 2DLNA 1KJJA 1IOWA 4O7NA 2R85A 4NYEA 3HB9A 3ETJA 1C3OA 4I4TF 1AUVA 4MV9A 5CA1F 1JKJB 2FB9A 5J2TF 2W6OA 5JVDF 2CNUA 5KX5F 4YB8B 2DIKA 1M6VA 4IWYA 1BXRA 1CS0A 4FFRA 2R7NA 1DV2A 4C5AA 3RV3A 1OBDA 3VMMA 3VOTA 4ZOLF 4IIJF 4J6EA 3SE7A 2FPIB 1KJ8A 4XYMB 4O4IF 1CQIB 2I87A 4FGRA 2FP4B 1DV1A 3VA7A 2NUAB 3VPDA 2XD4A 2NU8B 5BPHA 3NUAA 2NU7B 4O7LA 3BG5A 3U55A 3BSSA 4XZ3B 2R82A 2NPOA 4EGJA 5CB4F 3TIGA 1PX2A 1E4EA 4MV7A 3E5NA 2GPSA 1EUDB 4O2BF 1CQJB 1KJ9A 2OLSA 2VQDA 2VHEA 2R6FA 5K2MA 3Q2OA 4TV8F 4ZHQF
chains in the Genus database with same CATH superfamily
1GARA 4GICA 4KPGA 2O4UX 4ECVA 4E30A 2HMUA 3X1DA 4D4KA 2D4AA 1FYEA 3LRXA 3X1XA 1R5JA 4GMXA 1VZ3A 4W1PA 2J3QA 4UUAA 1PUXA 2GS9A 4A92A 4J0JA 1W85A 2PGLA 1RZRD 4MWCA 2WM8A 3OEWA 2GERA 5EE1A 1RYSA 3AF6A 1UF9A 1RZRA 2KMLA 3RSSA 3DOOA 3MTJA 5GY7A 2CNLA 2IZ5A 2IELA 2DBYA 2W2KB 1HFJA 5TPZD 1VBKA 1XK7A 2XGQA 4FNOA 4JI8H 2VHXA 1DWUA 1SOAA 2JVJA 3C98A 1J90A 1SUIA 1YK1A 4C6SA 5HR5A 4E94A 3IO5A 3CF4A 1UEJA 5FDFA 1U0TA 3BMQB 1P16A 3H2JA 4XDGA 3R6TA 2PCLA 1SHZA 1A7AA 1NDHA 1PNQA 3NW9A 3GBSA 3MWFA 2Y1XA 3MAJA 3CEAA 3CCBA 1KE2A 1F6BA 2AFRA 1XD2A 1CNMA 4N7BA 4O8CA 4J7AA 1TM2A 2RK3A 3MTQA 1GUYA 2FEXA 2RB5A 1FDUA 4A3EG 3LPMA 5JVLA 1U0EA 3USCS 3GTPA 1WXIA 2ZLBA 3X43A 1VGQA 4CT0A 4MMZB 5CURA 1LK5A 4D79A 2NAPA 4R2JA 1QB8A 2AFHB 2HDHA 2FLWA 1N6LA 2BFPA 4M76B 4JFAA 1UJNA 4RNNA 3EN0A 3V9AA 2JA5G 1XD9A 4CFYA 5L3SB 2GJ4A 4OXNA 3TQHA 2XEDA 4C6HA 3I2KA 5JZSA 3SHTA 3DV0B 3WWPA 5EE0A 3OE7D 3VUFA 2XX3A 4RD4A 4HMQA 1YK0A 1GGKA 4J8PA 2BELA 3BB4A 4FR2A 2FV8A 4ZAZA 3ZCSA 3HVUA 2GJSA 3R7NA 4M88A 1Z0DA 3QNUA 3ROXA 4MIYA 1NBAA 2FQQA 4MTDA 1D2AA 4FGWA 4ER0A 1BHQ1 4H15A 1PFYA 4F46A 3IDQA 4NZMA 2CJWB 1YOBA 1B2RA 5TE9A 3PICA 2C4WA 4TXNA 2GDJA 5FH9A 5A5GA 3WL6A 1DPGA 2X9LA 5KX5B 4F9GA 2GNPA 1QRDA 1DHRA 3W2TA 3CLUD 4P3KA 3AFGA 2Z2KA 1IXSB 3FGOA 2P30A 1C0PA 2VJKA 1NI3A 1YU6A 5L1KA 1YMVA 4ON9A 3PENA 1ZUNA 2CJYA 3AEKA 1KAOA 2EAUA 3E0QA 1CUGA 3QPWA 2BTQA 1Z4LA 1P0CA 5P8WA 5EP1A 4RENA 1GGEA 2IHTA 2FB9A 4KLAA 4YB8B 2W7PA 1XRSB 3HYTA 4CM5A 3J81k 1HG1A 2PUHA 1QR2A 4P33A 5KS8A 1MFPA 1OJ7A 3BXOA 2XCSB 3W7AA 4BU0A 4IDOA 1E79A 3UT6A 4TQSA 3KCQA 2CMKA 1QK3A 1RKQA 2BLLA 2CD9A 3LVFO 4FKBA 4NOJA 3U55A 2HU7A 1XCPA 3KV3O 1DG3A 2YHUA 4Y1GA 4XZ3B 2E37A 5K3FA 5JAHA 2ZAOA 3F0TA 1KH2A 2J6BA 2Y1DA 2IP1A 4TWZA 3KOUA 1YKFA 2V7BA 3LDFA 3KTDA 4ZHQF 5DX1A 2QRPA 4MGHA 2BQ3A 5LN1A 4QXMA 2I29A 4UOEA 4Q39A 3DZIA 2OFWA 1FFXB 3OJWA 1X7XA 4HQ6A 4N18A 4RVFA 3LT1A 4CMIA 4YO7A 3WKCA 4JR1A 2Z4RA 1P2SA 1CUCA 2J0SA 4DCVA 3OT5A 3VTZA 2QXYA 3EZFA 2QN7A 2G5PA 4BP3A 1G8FA 2IEIA 1KS2A 1XUOA 2H1LA 4TZKA 5IJ0B 1XF1A 3CZ5A 8ABPA 3I2JA 2X22A 2I4IA 3W6ZA 3B1FA 2CBGA 4UXHA 1B6GA 3ZE6A 1W19A 3FWKA 1RI1A 5TMDA 2QV7A 5LQUA 3DFKA 3ZC3A 3K5HA 3DTTA 5IBRA 1LNSA 4LZPA 3OD5A 5ALFA 4NYIR 3ZIAA 5DISC 4DWWA 2XF8A 4E31A 3SJ7A 4M7RA 4QWBA 4UE6A 5KOJB 1N5KA 4JLKA 4OKSA 4P5DA 2X0EA 2COUA 5KFEA 1EAYA 1E58A 2BFCB 2DJIA 4HNQA 4C5BA 3VR5A 4CM6A 5C7LO 2C5SA 1S9DA 4MS1B 3H0GG 3U7RA 1ZCZA 3VAAA 2JW5A 4M9CA 3MWJA 4MWGA 4ML3A 1A0OA 2A9KA 2PUWA 5EKDA 4HMPA 1FJ2A 3OWXA 2ZB4A 3RTAA 3CGGA 1Y9JA 2H4YA 3EAFA 3MR3A 4TVSA 2COIA 1IHPA 2WYVA 4RFSB 1K8YB 1CYEA 2V3CC 3BRWD 5G41A 4N40A 2PBFA 3BZUA 4KXYA 2ZWVA 4AP9A 2J5XA 1NBMD 5FLXW 1E9FA 3FMVA 3K9HA 1HQYE 4WZAA 3RYIA 2GNOA 1BXGA 5AVZA 4MKGA 1SJ9A 3NP9A 5IYZF 1PFGA 1W8DA 3JATB 3K6JA 3G9ZA 1GD1O 3RVSA 3W1GA 2FK8A 4ED7A 1AKMA 1Q91A 1YI0A 3N75A 4F4IA 2DBZA 4TMVA 4YRDA 4NMHA 3EY4A 2IFTA 2VP9A 4MW1A 3VR2D 5IP7G 4N12A 1LSUA 1WPRA 2EZTA 1CQWA 3L02A 4ECYA 1Z12A 2WYUA 1ZMOA 4PVDA 1QG4A 1EFHA 1EVLA 3TTYA 2EKBA 3WGUA 1JHRA 1IULA 5IT4A 5KYUA 4Q4JB 1G2OA 4H0NA 3N0TA 3L7KA 4F04A 3NBUA 2XBUA 3UMYA 4JZYA 3KJZA 3V8EA 2HIMA 2BKEA 1V7PC 1KZ7B 4YJFA 3RAFC 2XUGA 4ER3A 1QBGA 1NBME 2QT0A 3DHVA 3O74A 4WZAE 2ZDGA 5K2OA 5LNK6 4BV3A 5ED4A 4B4VA 3VX4A 2I2DA 1XI2A 5L51A 4HEHA 4A8HA 2MSNA 2N42A 1US8A 3HU5A 3DBVO 3GBVA 4BMZA 1X39A 2CFIA 4AZ3A 3D64A 5IJXA 1AO3A 4UM9D 3ZUPA 3ETLA 1H1LA 1R8XA 1Y5LA 1XTIA 2X6TA 3OX3A 2G9NA 4YDRA 5A4JA 4II7A 4M1EA 4BFZA 3OTOH 2BGJA 1T3SA 2ZI3A 1YNSA 4LEIA 3DMFA 1AKWA 1R4MA 2JIRA 3AUXA 4B3FX 4PLWA 4FOOA 2HBYA 4JV1A 1MH9A 1L7OA 4D1YA 1EVQA 1C3LA 2QAJA 3DKRA 3VKVA 2I87A 2UUBH 4LKRA 1JHMA 2F8TA 2P9CA 2O5CA 2ZT6A 3CINA 3CUKA 4BN5A 1K0UA 2XXAB 5DNYB 1G8KA 3FB1A 3EGXB 1SVIA 4HFMA 5KDLA 4DANA 2VQDA 4F3RA 2D1QA 4K81B 5H3CA 2BBSA 2YV3A 2JRCA 3MT8A 1B0AA 3JWPA 4I50B 1AHHA 3G2HA 5DP2A 1O6BA 4RMNA 1WIWA 1RPJA 2YHIA 1HLPA 1OZHA 2R1VB 5A9SB 2VO1A 2CMFA 2XRYA 3SSAA 3HXTA 3CSDA 4D7AA 2E2HA 4KIFA 3DWEX 5DAAA 4YA6A 1ILEA 3N7AA 5C51B 1GV1A 2H07A 4BHTA 4ZFNA 2XCLA 5JSHA 3O7MA 4EDFA 5DYTA 4D3FA 2RHMA 3BL8A 3OECA 3E2IA 3NYIA 3VTAA 3K70C 1E5QA 2FI1A 1W9HA 3WZLA 4AN4A 1GYPA 3EPLA 2PWPA 1TUBA 2HU5A 3CNBA 4UEQA 4Q0YA 4GI7A 1YB1A 1OKKA 3N8NA 4HLCA 3Q9SA 2M1ZA 2YNMD 4DR7B 3H3VH 2R6DA 3LC1O 1DTWB 2HHFA 3D5TA 4KRYA 1XL0A 2EBFX 2LP4Y 3VAYA 1FSFA 1J1IA 3F2VA 4HT3B 2YU9A 2BMFA 2WIJA 5A3JA 1H65A 5KNCH 4MVJG 3FA2A 1K3FA 1V4NA 4LF6B 4D4MA 4NICA 1BVYF 2E82A 2QIOA 2QSZA 2G6TA 2SICE 1XLUA 2PXAA 3A3PA 2MYTA 2VF4X 1NW4A 3OIWA 4MUXA 4UVDA 3G23A 4P81A 2PBLA 1X9NA 4K3UA 2FZKA 3K9BA 5TF0A 3TWOA 1ZH0A 3EZXA 4R7RA 4B0PA 3H3FA 3V9PA 2I34A 4X62H 1WCIA 2EX4A 2HK9A 4RTNA 5IKOA 1CKNA 1ODTC 1DPFA 2XCOA 5BRJA 2NO6A 4QO8A 3UAYA 1RJRA 2PTHA 4ZQBA 3V8MA 1P1HA 4BDSA 3TRDA 4ZALA 2FPGB 4W5TA 4RSMA 3VC3A 5AVXA 1AK2A 1UP4A 3WBBA 2H5IA 4J1TA 1JHQA 1ICIA 5BWCA 4HRXA 4WN9A 5HVNA 2NLOA 4JJ6A 3E1SA 3ZHTA 1I6MA 1G2QA 2I55A 2RF4A 4NNPA 3KL2A 3O0TA 3CCFA 4MW5A 2Q9AA 4Q4DA 5DCYA 1KR5A 2JCGA 3N87A 3ER8A 3MFQA 2XQFA 4M0LA 1QLHA 3AHJA 4OJMX 4N1AA 5HJ2A 4EFEA 1GDHA 5FWYB 3KWMA 3HV2A 1QXSA 2BEUA 2HPHA 3BH6A 4J0EA 4PX9A 3AZPA 2VHZA 4I8DA 3FCEA 4NU0A 4E5UA 4F8JA 3GF4A 5KNCD 4B5LA 3BOSA 3CRMA 4YAKA 2Q5HA 1MIOB 5BYJA 2PLFA 2HG8A 2Z04A 2JI8A 4EG0A 3UMRA 1PZMA 3GOQA 1ISMA 4QM7A 1P1JA 3KBBA 3ZZNA 3KXPA 3RB6A 3RHTA 5IXSA 3JQBA 1J8VA 2R6R1 1DBWA 1CE8B 2UUPA 1TKRA 2OHOA 4LPKA 3CT6A 3A9CA 3ZWWA 4HP8A 5F5XA 3BBLA 1JX4A 3LUCA 4Q9HA 1XZDA 4QXOA 2B0JA 3PUVA 3GFQA 4X66H 2OCBA 4JC0A 3FYDA 2AI2A 1UL1X 2GKSA 5DASA 2R68A 4F2GA 2DAPA 1R00A 3V00A 3SJBA 2P11A 1C3EA 2FG6C 3SC6A 5A04A 1TM5E 1F1BA 4GKAA 1OXSC 4B7AA 4NBWA 1E4GT 1PJLA 4R7TA 3D0KA 2GZMA 3DOEA 4CMAA 3TTUA 5KTPA 3J80W 5ES3A 2KW5A 4FGRA 1C1DA 3IESA 2IXDA 4CMFA 1VSQA 2ID4A 2AEJA 2AE2A 1D1QA 5LL6b 2JHCA 3BSSA 1CUIA 1U0JA 2WU4A 1RFGE 5K1ZA 5AM5A 1CZLA 1PEKE 4NU5A 4R8UA 2C9ZA 4HXEB 1JKXA 4RKYA 2ZK7A 2EGHA 3VO2A 4BO8A 2PU5A 3JQ7B 3P97A 2IY9A 4B48A 4ZZ1A 3OHAA 3KREA 4ZAGA 4RZUA 5DW0A 2HLDA 3G2NA 5NULA 4DYDA 5IDQA 2I8CA 2NP6A 3OZTA 1FL9A 3HM2A 2XWPA 4D43A 5BW6B 4MH0R 2Z8YM 4Q1AA 4UNIA 1TFRA 3HOYG 2ZIWB 1P0PA 1ZD1A 2XOKA 1VL5A 4O7YA 2XNSA 3O3NB 4D80A 2FPIA 4GF5A 1JNXX 4FFNA 1TO1E 2ZI5A 1DBQA 4HTAA 4UD2A 5B4VA 2ZTSA 5C31A 1IZ8A 4BJHB 3AEXA 2H8KA 3TW7A 1VLMA 4MKZA 2OP1A 4O08A 1KZYC 1CQJA 1VSVA 3LWBA 4B46A 4DCCA 3AF2A 2BP7A 2V6IA 2OV3A 1N36B 2X86A 1ZO8A 2AKAB 4U2CA 5JBIA 3I6ZA 2WE7A 3EPHA 4AG6A 4QBTA 3GIJA 3TQFA 3GP8A 2KYRA 3E7XA 2R00C 1S96A 5K0NA 1NAIA 4LYFA 1S4MA 4KI0A 4GYJA 1BA2A 5KO2A 3CR3C 3THOA 4LBWA 2CXRA 4TSKA 3EVDA 1T8UA 1YT5A 2AMJA 2DPXA 1U94A 2OKCA 4XH9B 2G77B 5L6LB 4O7ZA 3SR0A 2YXNA 4QGAA 5KYWA 3T5BA 4WINA 3HRHA 1XRJA 4H1TA 1MO4A 4F4WA 3C7CB 2IDKA 1W47A 3QUCA 5ED0A 4NJEA 3PDJA 3I4NG 1A97A 4PNPA 2GM9A 2JA6A 1OH8A 1H66A 2WC1A 5LUAA 2WFMA 5HDBB 2XDWA 2QBYB 4YUVA 3AF3A 4Q3CA 3GLSA 3GH3A 5H5JA 2P5SA 3VPHA 3FHJA 4F06A 3TZKA 2NZWA 1OIWA 1LTKA 2ZP1A 4KQFA 2YDYA 4IW3B 2PZEA 2DUWA 4W9NA 3L49A 4YJ3A 1TW2A 3K9LA 4N0DA 1W0JA 1PK7A 4TL9A 3KKEA 5L3ZA 3G5UA 2CVFA 2VTKA 2OSBA 2GBLC 4G24A 4J7CA 3DEHA 1FRVA 1A48A 1Z33A 1S0UA 3OESA 4A3CG 1U8ZA 3LNTA 2X2OA 3MMPA 1Z26A 4OKNA 3K5WA 4Q7JB 5A5FA 2AR9A 4CQJA 1Z2CA 1OROA 5A0FA 5CT8A 4D2IA 3A0RB 2PLAA 4E7OA 5I9TA 4OQXA 4JV5H 1KU0A 5LMZA 4XOIA 1WW3A 1XFAA 1YB4A 2AFIA 1IZYA 5FORA 2PK3A 1ZK3A 3IGFA 4FQ8A 1X7YB 3FFBA 4R9SA 4DUYH 5BOSA 4EQ6B 1UODA 3A1FA 3PDHA 2MIIA 3R4CA 1GGHA 3R24A 3G7UA 3ZHBA 1PT9A 2V45A 1BE1A 3PXAA 1TO6A 2NW6A 3MZ0A 3NR2A 1FY2A 3BEOA 1JKJA 1LBHA 1WUHS 2FSHA 1JS1X 2H65A 3RR2A 2HH9A 2LGJA 1IXZA 3NU1A 3I1YA 3M5CA 2PEYA 1XNQB 2SNIE 3QELB 1JUDA 1RC1A 4ZAWA 5H1YA 3S44A 5AUPB 5FX2A 1TQDA 4Z7NB 1M2VB 2M2IA 3G6WA 3QVGB 1C8KA 8MHTA 4DM4A 4YCAA 4DSTA 3RNLA 4RJTA 1IN1A 5LLSA 2R8HA 2V4MA 2XD9A 3TUIC 4X00A 3MN1A 2X8AA 3GTOA 3IUBA 1VCNA 1KS9A 4I1YA 3SYNA 4A15A 3P0FA 5IAEA 3TBHA 1UIRA 2Q29A 1T2CA 1HDXA 4G07A 3MGBA 3PZRA 1HLGA 4J2TA 1MD9A 2HD4A 5K0ZA 2AFIE 2ZRPA 1XZEA 3QA9A 4CDGA 2C57A 4AZWA 5EHQA 3QPCA 1MX3A 1RHRA 1TAGA 4RY8A 1G0OA 3OA2A 3M6AA 3HR8A 1OFTA 2QTWB 4KQ2A 4R1MA 1H2XA 1ZL2A 3KE8A 4U02A 2DYKA 3ZCPA 2ZGIA 5ITSA 1MEOA 2RGNA 4OJNA 5F52A 2VA8A 1QCYA 3CPEA 2PS9A 4IQGA 1T2AA 1I30A 2ODEA 4G8JA 1OPRA 1CUUA 1YBMA 4ERXA 1OC2A 3V55A 1W85B 2PLWA 4KFTA 1SHLA 5E25A 2YMPA 3SIWA 5D5QA 3TTSA 1W1UA 4TMTA 2YV2A 4H17A 4EFBA 3BWBA 3TZCA 3U16A 3PJEA 3W5UA 5E8RA 1ABEA 5HHTA 3PW7A 1WHSB 2XNJA 3FTCA 4WQMA 2UYYA 4RKRA 2R7ZA 4HUQA 3K9FC 1AS2A 1I0ZA 3WGQA 4IUDS 3JQAA 1ZUD1 4OHMA 1IWBB 3LW7A 1A7JA 4M53A 1N2BA 3VPBA 3IAUA 3M4NA 3E82A 2DXIA 2R86A 1RR6A 5LIRA 1XK6A 4GPIB 3SAJA 3EK2A 3DV2A 5HA5A 4Q9JA 5A2QA 1GY8A 4PYQA 3IIMA 2HHJA 4L02A 1N8SA 4LOAA 1EAMA 1G5RA 4OLHA 1IQUA 3DPIA 1Q17A 4JLWA 4R8SA 2I1WA 5EWMA 3RB8A 2Q6KA 1XA3A 2B34A 1RAEA 2HLNA 2BFBA 3FFAA 3I6YA 4MWDA 4DCOA 2J31A 4P7BA 4LF6H 3QV1A 4IVNA 2OHIA 2QD4A 5KYXA 1WD7A 4ZVQA 1N6OA 4GECA 1BC5A 2HLPA 1EXWA 2BTOA 3UUGA 4IINA 5HIKA 1THZA 4TXMA 1VYTA 3KRTA 4XQEA 3L5OA 4WNYA 4MTLA 4TKUA 4UCSA 4KVZA 5JW6A 3DS8A 4KPYA 5TGDA 3EDCA 4HYQA 4NCKA 1FLNA 1IOZA 4LDZA 3THYB 2YVKA 1YQXA 2XTMA 3ILYA 5D1OB 1ODFA 3LP8A 3T1TA 1JDZA 2ETVA 3LPCA 2A86A 2WKQA 1YR9A 1ZH4A 4IIUA 5IZCA 5DSZA 3BKWA 4C7BA 3WV5A 3W1EA 2WKWA 4E4TA 3EC1A 4NJMA 4D26A 3DE6X 2WSSD 3KKLA 4BJ6A 2HJGA 1Q3TA 4AUEA 4AJ4A 2ORED 3GRAA 1ULAA 2HSZA 3R09A 4DLRA 1C9EA 4KO3S 3PWSA 2GJ8A 3L93A 5FI5A 3SBEA 4G3IA 1Y14B 5TIIA 4HWPA 3BTUA 3FJ1A 4XYGA 1SCBA 5DBIA 5DGHA 2NPIA 2WPNA 4WADA 5C4IA 3CY6A 3I8XA 3N0RA 1TE2A 2I7VA 1TZKA 1XEXA 3G5TA 4ZCQA 2CXPA 1PJ8A 1AA6A 3D2CA 5LP6A 5EUBA 2X8LA 4EQZA 4IGKA 1ZUNB 3AEKB 4PGFA 3H4BA 1Y5MA 1WQ4A 4NOMA 4DT1A 1ETHA 4MP3A 1H2EA 2CSUA 4H1HA 2V9CA 2BTQB 2BJWA 3O9MA 5ALQA 5I5EA 3ZY2A 2H2IA 2Z09A 2AUNA 4KRGA 2JAXA 1H2RS 1UJBA 2BE9A 1P72A 4HLUC 1YCGA 4RB2C 2OB2A 5B12A 4LRUA 3AO0B 2PX8A 1ZUWA 4LWQA 1OAAA 2NPOA 4NK4A 1P7CA 2GLXA 4Z0HO 3RTGA 3P5BA 2CLEB 4UEJA 3G6YA 1N3BA 3ZGXA 5CUQA 1Y8QA 4LK2A 4TL8A 3F4LA 2IXBA 3A06A 2WQZA 3TLAA 4BMSA 5JNRA 2QVCA 3VNBA 2IHUA 4MROA 1SN7A 4BP8A 1YDFA 5JXWA 4P3NA 4HPWA 4MVJM 3WLNA 3CW8X 1U2DA 2PKEA 4BQPA 3NHSA 3AOGA 4NARA 5YASA 3OZCA 2PX2A 1XTJA 2KPOA 3OLQA 1BU8A 4OI1A 1VCIA 3PS9A 3FSEA 4CMIB 1QYIA 3E35A 4ZCMA 4KE9A 5JYEA 1ZKDA 3ANXA 2L19A 4XIFA 1R8QA 1YCHA 1KKMA 2P3QA 3KJQA 4X54A 3PC8C 1JBKA 2C2RA 2B92A 1Q0UA 2Z3WA 3TMYA 2DRIA 4XYLA 2GRUA 4LF7B 4E6EA 1XN1A 3GJ7A 1U7WA 4JEIA 1OLSB 3W4IA 4ZWNA 4TLCA 3UWPA 3NFYA 3WBJA 2VDPB 3U26A 3CLVA 1GP2A 2A9OA 3LVQE 2G88A 1G21A 1ZJYA 3EG5A 5JADA 3H9BA 3R3JA 2I91A 3R7SA 1IPEA 5H9WA 4PLTA 3R76A 2E4ZA 4GP9A 1NASA 2B5OA 3NC0B 3WWIA 4QX6A 2QM8A 4O4HF 4ZU1X 2HT1A 1Y33E 3JQ8A 2DPGA 1GCOA 1W44A 4MINA 3ZU6A 3I0NA 1X3SA 4OGWA 4PHTA 2C7OA 4KAFA 4NYJQ 4EA6A 3U3ZA 3CRW1 2LE0A 4EYSA 3UXYA 3AETA 2A9QA 2CLKB 1IJEA 3FJOA 2QZSA 3RYIB 4GMDA 4JXZA 5BV2P 1Q1AA 1BXGB 2R3SA 3GJXB 1Z28A 1QYRA 3CWCA 1T5DX 4LZNA 1TIPA 3LP6A 1HG0A 4FYMA 2I4RA 2QGFA 4D6PA 3S1SA 3SY8A 2VPWA 1UBUS 4F97A 3LYUA 2JZOA 5LL6P 5J47A 4HB2A 5L7TA 5J5VA 3UB4A 1PJQA 3ZR4B 1CRLA 1G21E 4LQCA 3H4IA 5BWVA 5FBWB 4Z5XA 4TN1A 4N76A 2QYHA 2AJTA 4LRWA 4J2OA 1J39A 2AIRA 4ZZIA 5EQTA 6CHYA 4NOLA 4M0KA 2V0NA 4C03A 3TW4A 1OLXA 4OI2A 3EGWA 4TMXA 3R44A 1EJ2A 3RRNA 3SFZA 2A9FA 2YWEA 1YB2A 4MQFB 5GM1A 3RIZA 1QGUB 3ECCA 3OQHA 3FPAA 1NMSA 2ODNA 2IY8A 1W73A 4I14A 4OHXA 1EXNA 1JU3A 3HBFA 3NM5A 2XUZA 3EQ6A 2PMCA 3BK2A 4YJFB 5I48A 1EB9A 2BSAA 1DAIA 2ZR7A 2PQ2A 2Z08A 4F2DA 2PGNA 5IUKC 4Y2VA 3HPRA 4MNTA 1C1HA 3O47A 4DZZA 1YA4A 3VYRB 4WKCA 4G4SP 3HYNA 3V8NA 3PRYA 3QYAA 3IN5A 2GH1A 5AJWA 3JSAA 4UM9B 3ZJ4A 2CLCX 3HRIA 1U2RA 1E2KA 1PZEA 3ABOB 2ERYA 2Z0MA 2FKAA 3JQQA 3G02A 3AL3A 1O4WA 1R4MB 2CLFB 5GPBA 4XJXA 4H4DA 1RTTA 2PQ0A 2Q3LA 3TRHA 3RYTC 3PW5A 4W5RA 2VZEA 2N46A 4IDPA 4KR0A 1ZH8A 2AD1A 1ZU4A 1QR6A 4NNOA 1R6XA 2RHGB 2V6FA 4NVRA 4I9GA 2EIXA 3ANSA 1W96A 4URHA 1FPMA 4RGQA 1JXQA 3AEUB 1XNQH 2VQEH 5JMPA 5EQJB 1LI5A 2G40A 3ESXA 4QWDA 2PUEA 3RYCA 1U81A 4HAXA 1U28C 3DWGA 1B26A 5FLEX 2YHIB 2YJ4A 4LSXA 4LSGA 3LDGA 4DCSA 2FXVA 4ZYVA 5JU6A 4XEHA 1T0PA 1PS8A 3NBZC 4JQSA 2YWVA 2IXAA 2YN0A 2OCAA 2UZIR 1CUFA 5JTUA 2IYYA 5JFGA 2GBGA 3WGKA 4XUEA 4EBFA 1POXA 4BMYA 1JXMA 4OHCA 3THSA 5EEHA 2EERA 1JF8A 2QMYA 1E2JA 3T5LA 1NXQA 5BVGA 2PSFA 3OM0A 2Q3FA 1T2DA 5FLKA 5EESA 4JT4A 3O82A 1MO3A 4YAGA 1GPYA 2GF9A 4MCJA 3ROTA 4BX2A 3CRQA 1DAHA 3C6KA 4PIVA 1RKUA 2XWJI 4YBZA 1E5TA 1KRXA 3GT0A 5HW0A 1DLJA 5SZJA 2PJUA 2AC7A 4ARIA 3ZTYA 1N33H 1KDYA 2IEBA 4V0MA 1C4XA 1MGOA 4DMMA 3HN7A 3A4TA 4O7RA 3D4BA 5L7YA 5F73A 1VDZA 2FPLA 2GT1A 2FN7A 1DNPA 3FUVA 2VR1A 1E4FT 4A0FA 3P19A 2YMLA 3F3YA 2ZJTA 3S2YA 4CM9A 2J7PA 4ZQIA 5D00A 2I2FA 2NSHA 2ZBEA 4R2HA 5EE5B 1CKNB 1KO1A 5IZ4A 4FYPA 3ONWA 1NRJB 3TEKA 1KL7A 1HGXA 3CZ4A 2OBFA 4IYRA 4CEJA 2JH9A 1Y5NA 4FJ2A 2V4ZA 2V3VA 1FX1A 3WWHA 3B1VA 1HORA 5GAJA 1XMVA 2OYRA 1XAJA 3WGIA 3BL6A 1U0HC 1RJEA 4S0ZA 3R8XA 1QPBA 1C7FA 4WN9B 3RRBA 2QI9C 5LD2C 5J4KA 4FI3C 2ZEJA 2N1MA 2TSYB 5EFOA 4KW7A 5CVEA 3Q8KA 2GJAA 1UADA 2CLMB 4DG9A 4MW4A 3AI2A 1AS0A 4V0ME 1E5DA 1Z18A 1LVUA 3QXCA 2FEAA 2H16A 5T6MA 3DZBA 4YBRA 4R16A 5A4MS 2BEUB 5JBQA 4Q34A 5FJIA 4LJAA 2KQUA 4RTJA 2YWXA 3NIBA 5AP9A 5LLTA 3PNMA 2R5NA 4YAKB 3UOGA 3E1GA 5U1PA 2J85A 3PE4A 4F56A 2GF2A 2GEBA 3A1CA 4HZUA 2GHQA 4RTMA 2DBQA 3KYHC 2NTEA 5C8XA 5CXSA 3K31A 3PYLA 2ZOSA 1WBBA 3R9RA 4EIWA 2UZ0A 2HIAA 3L0IB 2QVBA 4B9AA 1RWQA 4MUHA 2GUWA 3OTGA 3ORFA 2PZAA 3MCWA 3OWHA 1J5EH 3UEOA 2XGPA 4K03A 4X62B 2OBLA 3WYCA 4DR3B 3IVGA 3AK4A 3RABA 4XWOA 3LSYA 1JIUA 2VHCA 1K97A 3JZDA 4BKRA 1XD8A 1JI3A 1L1QA 1SXJC 2KSQA 3VMMA 2Q3HA 5T4EA 1DIHA 5HK8A 2FX5A 1E59A 2QZ4A 3ZWPA 4HAIA 4ASUA 2RD2A 4K40A 1R4ZA 2FP3A 3GVCA 1FFGA 2X9VA 3HCBA 3A2LA 5BP7A 3H75A 5G02A 1HV8A 4RULA 1ZP6A 1A2BA 4PG8A 3IPAA 3SG0A 4F3TA 1GZVA 4IGAA 2OVFA 2Z6AA 2YCBA 4M8SA 1RQ7A 5I5VA 3OZSA 3D5EA 3U7JA 3JQ9C 3JSLA 3MTDA 5DNVA 4CLRA 5BWRA 5I8WA 1B8NA 3R3HA 4R8UB 1TAUA 1T2UA 1ZZGA 1MOSA 4PAMA 3NHUA 1QHHA 5IKPA 4BIIA 3ULKA 1KZ6A 3QTLA 4I1SA 1H2BA 5B53A 4AI6A 1JWBB 3R0QA 1U7TA 4NTZA 2IQIA 3GPLA 1C7EA 2JVIA 3FVQA 3Q3EA 1F1JA 1GIAA 2W2LA 3S0JA 2IYEA 5IUJC 4ECQA 4HEA1 3MJHA 1YCDA 1C7RA 4QFBA 1EVEA 5DPMA 1UJ4A 4J0CA 2WVJA 4MVYA 3EIHA 1WETA 4EB8A 2QGNA 3L92A 1CY4A 1DO0A 1TKAA 2Y0BA 3FMPB 4RYDA 2P9EA 5EERA 1NUHA 3VJRA 1DAEA 3LXMA 3F7NA 1ZGCA 3PLAE 2DP4E 2BGGA 1I1MA 3BB1A 3MCUA 1RDFA 3N74A 1H1TA 1XROA 3OZ7A 1BX1A 3EG9A 1BAPA 4ME6A 1TU3A 3EQZA 4M1QA 1TDJA 3EMVA 3CKYA 3LY9A 1AHPA 3B78A 4X66B 4K2HA 4TMFA 3N8HA 5BV1A 2BP7B 2WR8A 5CNJA 5TDHA 1KTAA 1V6SA 2VH1A 2QZJA 2XXBA 1KJZA 4NG4A 1R0SA 3ASZA 2J3DA 3GIKA 1NI4B 2QVZX 1R9NA 4EFKA 3MAAC 3LF2A 1PK8A 2DAAA 3DT9A 2I9KA 1HKUA 2C5GA 3SM9A 2TMDA 3CF6R 6REQA 1K86A 1KXJA 1ZM9A 1AQYA 1YRWA 3DF9A 5LDDC 2GPTA 2VDJA 3OT1B 3H8WA 4GRAA 3WNBA 2YMMA 3V4PB 9LDBA 1Q0SA 2Z6VA 4LF7H 3FETA 4PLZA 5D1HA 4ZO7A 4NP6A 3ME5A 1CRPA 3LV8A 1LPPA 3JARA 2PXXA 4QEKA 1XZGA 4ED6A 1N6KA 3IBFA 4RTKA 3HI6A 5F77A 1KY2A 2ZYHA 3CTMA 2WU1A 4NJEB 4XPZA 2BEJA 3I53A 2PE5A 1DGSA 1SBHA 1VB5A 1S2OA 1U6IA 1AQJA 2XITA 3VR5H 1O96A 2XI4A 1BX0A 3QI7A 2JLWA 2Y0DA 4CMEA 1E79D 4Y1RB 2GFQA 1PYDA 2WVHA 5IYZA 3RGWS 1IK4A 2B61A 5G4KA 5A4AA 4L5YA 1WS6A 5EVJA 3B51X 1ZOOA 4HAUA 3VPSA 5J23A 5JQGF 3V4FA 2X8JA 3CX8A 4F4UA 5JV5A 2VBFA 2KBFA 1FYVA 4PM4A 3GK3A 4O0LA 5KG2A 4P6VF 1L8LA 2R97A 3BIFA 3LBNA 4M1SA 4IXDA 4BB0A 5A3SA 4BEBA 1RJ9B 3FNBA 2NO9A 2AEEA 1M0WA 2WU8A 4L8YA 5FNVF 3WWZA 4ZYWA 1A5ZA 4U2GA 1X7HA 1GXSA 3LUHA 2HU8A 3AHGA 1CIVA 4X9XA 4RPLA 5C81A 1JAIA 3CEPB 1TAQA 3RQIA 1W76A 3NP7A 3ROKA 1PRYA 5FA6A 4ZJYA 1A9ZA 1IU9A 4DCNA 2H51A 2DUUA 3LLMA 2NSLA 5REQA 3PVSA 1Z3CA 4XEUA 1QU3A 4YPFA 5CA1F 2WFLA 3DYBA 1JKJB 2MSKA 4FDMA 5IX8A 1J24A 2LCFA 4O4LB 2B0CA 2NUAA 2CFCA 2ASLA 3ZIAD 5DT9A 5MGBA 5GQSA 1KK3A 2P27A 3LUDA 1M8FA 1RWOA 5KFNA 2PQ6A 1A5BB 1NW9B 1XP8A 3IUQA 2NGRA 2VZLA 5FI0B 5CYGA 5BWOA 3H97A 2WNSA 1KYQA 3PDIA 3VR5D 3P9KA 3PEWA 1P9NA 1GU0A 3D02A 1FP7A 3QHPA 1UPFA 1TOAA 5AVKA 2DSNA 3HJHA 3KP1A 2V7UA 4EG1A 1L7MA 4F11A 3BM5A 1DRUA 2PYDA 4QGGA 5AI5A 3TZBA 4JXJA 3TAHA 1FXUA 3E0XA 2YV1A 4QGHA 4LKOA 4EPRA 5AYVA 2K87A 3V46A 3QMPA 3TE6A 3TLKA 1SVMA 1H6DA 4A16A 1IXKA 2P6UA 3RS0A 3Q6MA 1SURA 1YVEI 4ZK2A 3UMCA 3D7RA 2G1KA 5KFQA 1WPXA 1H69A 4OFBA 5EXEA 1A27A 2B4QA 4MUIA 4U7CA 3N2IA 4KOAA 2BEWB 3WQBA 4Y6GB 5LYJF 3TW0A 3GY0A 3UAGA 4ETIA 5BYKA 5D3ZA 3CF2A 3A2NA 1U5CA 1UAYA 4L50A 1KARA 4JV5B 1U9IA 2ZKLA 1X2BA 3EBLA 4XVHA 1P5ZB 4PTLA 5J9FA 1I0LA 1ZISA 4W9RA 1M2OA 2RONA 4DUYB 1SXHA 2CXHA 2XNKA 2F1OA 5AWFC 2OV6A 2UV8A 4CM3A 5TMPA 4GSLA 2VEDA 1SY7A 5AR1A 4QOIA 2XUKA 5ICMA 4QG3A 3U4DA 1N7IA 2R2AA 3HJRA 3QTTA 2WD8A 2YZ2A 1P4SA 1D09A 4N47A 4UCOA 2W2NA 4E2ZA 4XRGA 4UAUA 2CMDA 4F8YA 5K3BA 5KSYA 1OVMA 1POWA 3KZVA 2HQSA 5LKRA 1O95C 2C9MA 2E1RA 2EX1A 4LJ8A 4F85A 3AM3A 1MB3A 4U4AA 1E2HA 1Y4ZA 1KFEB 1NVTA 3F67A 4G5SA 2FW0A 3U44B 3ZE7A 3TTWA 4C2MA 5I7UA 2QW8A 3O8RA 4AKIA 1K0FA 1DRVA 4H7IA 1ULZA 1QONA 2PBRA 2HYDA 1DI0A 2E4WA 3TR0A 4K0RA 1XZMA 3FZQA 4G26A 3DCNA 5F1YA 4QDXA 1PZXA 4CG1A 2HNKA 1K6JA 1J2EA 5IKEA 4P8RA 4AZ0A 5B3JA 4P9NA 1GILA 5H80A 2F62A 5EWMB 2RFLA 4E88A 4Q82A 4OQDA 1VIDA 4A8JC 5IMBA 4G0VA 1G8GA 5KYXB 2N75A 5DGBA 1WKCA 3PQEA 4EEZA 1SKMA 3KTMA 5EYPB 1DIAA 4I5GA 5EHZA 4L8VA 5K45A 4WI1A 1PI3A 3ZD6A 3D8TA 1TCVA 3FXAA 2V97A 1JW9B 3O2JA 3ECSA 1T24A 1PQYA 4DA9A 1NKTA 1HLFA 2FQ1A 4XCQA 3KU4A 2DQKA 4J3FA 1OI3A 4GWLA 3GJQA 4AVYA 1XOIA 3VC7A 1FS6A 1RXWA 3WI7A 3FPEA 1ISHA 4MRMA 2MR5A 5I7EA 1FLAA 4WJZA 3FPCA 1Q0TA 1KDRA 3DOIA 1DBIA 2ZCVA 3GAAA 3BMOB 2HXYA 1NBWB 3GFRA 3D8BA 4FFVA 3NALA 1HRKA 3ND6A 1EUYA 2JK1A 3U2QA 2PFKA 4S1OA 5K3CA 4CI0B 4U7HA 3PFNA 1DTSA 5LCXA 2FJ0A 3EEQA 1QU2A 4HB0A 5F7OA 3D3EA 1Z47A 3NDBB 2GN1A 1OKKD 3UG7A 3IL2A 2YFHA 4EKDA 3QHAA 5LP6B 4DPLA 3DD1A 3BMXA 1EKFA 5TF4A 3UYLA 4DT1B 1WW2A 3CISA 4NESA 2Z6QA 1L7NA 3H5LA 1E9DA 5B58C 5AW5A 2RHHA 2NACA 2X5OA 2JFWA 2C2HA 1E8DA 3JPWA 4ZC1A 1RMQA 2DPJA 5CVUA 3K2BA 4LVNA 5AW7A 2POCA 2PZFA 4Q9KA 5A03A 5LFAA 2XTAA 4MR8B 3SHOA 3I5XA 1BKDR 2ZS8A 4MVXA 5DK6A 4R8RA 1DAOA 4DR3H 5DBOA 3WLTA 3GMIA 4KX3A 1BJRE 4LRYA 3TLCA 4BJ5A 2C28A 1NG9A 4D99A 1MQ9A 3YASA 3V1TC 1U8CB 1XZIA 4JD5A 2JCVA 3ORYA 3R20A 2YBDA 3C5CA 4BKPA 3LSTA 3JQDA 1H4VB 1XMQB 4HJXA 1Z2NX 3AHDA 3R0JA 1WDMA 4KQ6A 3LULA 1BD3A 3OPYA 3SQLA 3EH1A 3W1VA 3WGLA 4EP1A 5F5LA 4KUHA 1MC5A 2MU1A 2OESA 5CPBA 2PT6A 5EEGA 3ZX5A 5IEBA 1SUSA 1FMJA 4I6JA 3UKDA 3A1DA 4XYLB 3N2LA 4AF6A 2G3YA 2EIYA 1YBFA 2G1JA 1WUTA 4DSNA 4BLRA 2XRFA 4UU0A 1UBFA 3ZK8A 1IZ9A 3WFIA 1GQ2A 3QGMA 1NN0A 3X2SA 1OXMA 4R7ZA 3DBIA 4DIOA 3ZDEA 1OQAA 1DQNA 4HDQB 2B4AA 2B5WA 3AP1A 2OH2A 1G21B 2F48A 2A14A 2OGSA 5FQNA 1DIOB 5CEFA 3ESQA 1Y4UA 3UXMA 3V4OA 2VQFH 2ZQYA 3H8VA 2V55B 1L1RA 4AM8A 2PQMA 5LBUA 3GLQA 3V4VB 3KR2A 3AT1A 2V65A 2W6IA 3PF8A 4C4RA 4DLXA 3JQ8B 4L6AA 4OLJA 3RUPA 4NBNA 3X1KA 3R6DA 4WCFC 1O77A 5HCUA 5LB2A 3IVAA 2VNHA 2HLHA 3LFUA 1Z4IA 2QAGC 1GSAA 4CRWB 3AETB 1WB9A 4MAMA 1NUUA 2YRWA 5FUYA 3CLTC 4E5MA 1PUIA 4BMPB 5B6PA 4EFLA 1SQ5A 2QMQA 2FPKA 3L2PA 1ZBQA 1R9TA 1SWVA 4DPMA 1YV9A 5HBRB 1RYDA 4A5OA 3Q3JB 1T3TA 2L69A 2O8BA 4L6IA 4ILKA 2ANBA 3REOA 3ODPA 4CM4A 3RG8A 1I32A 1QFXA 1QCZA 3T7SA 4XUCA 3SQXA 3OM1A 3ZG6A 4Z53A 3OU6A 4WJKB 4UDOA 5F78A 4BO2A 1ODKA 3RAXA 2J8ZA 1C8BA 2IXFA 4BN0A 4MRSA 2GN0A 1YVDA 4UFZA 5KWEA 4BP9A 3AHCA 2F1IA 2HLDD 3M4YA 3M9NB 3E9CA 5E2IA 1OLXB 2J45A 3QOXA 4R84A 1FSSA 3HCRA 2FUG6 1MQ8B 2GZDA 4HNVA 5I4CA 5AKIA 2NNWB 3QKSA 1EYZA 1G8HA 2XOKD 4GIBA 4ENSA 5E4TA 1V11B 2B5VA 4DAEA 1GTZA 1E2LA 3BJIC 2EJ2A 2WA1A 1NVFA 3MXTA 5M04A 1NQTA 1G6OA 3BEDA 4OBXA 1XCGB 4C7OA 1C41A 2C07A 3FKSA 1VPVA 3Q2KA 4B44A 1IHDA 4A0QA 5I3ZA 1FW6A 2OAP1 5AJUA 1VCOA 3MOIA 2M98A 4NABA 2QMOA 3TF5A 3C3BA 2I99A 3UICA 3QU7A 1HI9A 3KAPA 1II8A 1YKSA 4UPEA 1USWA 4OGFA 3L8EA 2JIPA 5IM5A 1CZHA 3IG0A 4BTVA 3KPVA 2A0WA 1K66A 5EKTA 1CUBA 1FZQA 2ZGVA 1D1PA 2F1JA 1I4OA 2PUAA 1L4MA 3SEAA 1NJ2A 3GCGA 3L0YA 1I80A 1MC8A 4ZANA 4UVIA 1NXTA 4JIGA 3WRVA 4EPYA 5KVQA 1GG2A 3VDNB 4EA9A 1JHAA 1DADA 4YROA 1I7NA 3AJ8A 4QFMA 2O8DA 3D0OA 1VLZA 3DSRA 4A10A 3BULA 3C41J 5FQOA 3GP5A 4JH0A 1FS4A 2FSGA 5JPCA 1O9BA 1TJYA 3TOSA 1FTYA 4X7MA 2GEJA 2RK4A 4QFDA 1OXKB 1WZUA 4UUBA 3ZCTA 3R9WA 1L2ZA 3SI8A 3DBLB 4O4JF 4IWNA 1TTQB 3GUYA 1JG6A 3USES 5TPWA 5KSZA 5DGXA 2BHNA 3M1IA 1L7EA 1OVGA 1JB9A 3KXIA 1Y81A 3PGA1 1GYQA 1GAXA 4RWEA 3C1UA 3PB3A 3IPYA 4HQNA 3W4JA 1L1FA 3T5JA 4GC6A 3KYDA 4I1UA 1W0JD 4M1OA 5JEDA 1ADBA 1M6HA 4U2DA 1ZPDA 3JRXA 1GAQA 3HNPA 1NNLA 4QW8A 2OHVA 5BVGB 3AYXB 1QH1B 2BHLA 2GXQA 2ONJA 4A1OA 1NW8A 3JWJA 2O6HA 4FE4A 3QYJA 4OM7A 3JXEA 3EUFA 3DBOB 5KFZA 3HO6A 4DCUA 5C5DA 4E2YA 4YBZB 3OUZA 1XRNA 3U1BA 1U3FA 4MQEA 4KH1A 1KPGA 5FD6A 1HEIA 1J33A 1JX6A 3RC9A 5I5GA 2WIDA 4P7FA 2FEMA 1RQ2A 4ZCIA 2VTBA 1FSZA 4GMKA 2AEMA 2O6LA 1FFHA 3H11A 5NLLA 1V5IA 4MDHA 4YT2A 2IV3A 1SCDA 4BLQA 2NG1A 1Q7RA 4R8LA 3UMMA 5KYYB 1HE2A 4MIOA 3WLLA 4KUGA 5M7EA 3ZEAA 3S2UA 4YRIA 4F2WA 1E9SA 1NZFA 2D8AA 5D84A 4Y1EA 4UM5A 3WG9A 2P9YA 1B41A 2IXGA 3M9MB 1CIPA 2EZ8A 2OO5A 2OL4A 3EIUA 4V0SA 2VQEB 5EGSA 3WGJA 3ST7A 4JOQA 2H8GA 4M46A 3F9RA 4OXRA 5LWHA 2AG0A 2PU7A 4K0KB 3KJFA 4PEVA 1YJXA 3K3VA 3E4CA 4C6TA 1UEXC 4PYNA 1Q11A 3ZJVA 4GLXA 4G67A 1XNGA 1N34B 3R1IA 3GJ5A 5DIZA 1FYDA 1RM5A 5THKA 1FUUA 4ILEA 3KJEA 2W4MA 1A0GA 1XVVA 2LUOA 1RXVA 3QVVA 3W0LB 3BTOA 2ZUCA 1ZQ1A 3GGJA 2WP0A 2E6KA 4MW9A 3QMWA 5KQMA 3OOWA 2DR2A 3RVNA 1AUPA 4BLVA 2PX3A 2XWBF 2RDIA 1V51A 1WRVA 1HUQA 4TV9B 4FYVA 4YX9A 3MRVA 1VKJA 2GTIA 2PS0A 2Q1XA 1U0RA 2E9SA 1G19A 2ZW9A 3HOUG 1BYIA 3DFZA 2WIKA 4RGBA 1C9NA 1PS0A 3HBAA 1CR1A 3KC2A 1RI4A 1DINA 3I76A 4HZUB 1I7SB 1N33B 4UW9A 2I3AA 1E62A 5B3LA 3B48A 4M3NA 4Z4GA 2O5RA 3AXSA 4ABTA 5ESDA 1SQ6A 4YK7A 3GIQA 3ZN2A 1Z6ZA 1JEQA 4CMBA 3EIXA 2OCGA 2CXOA 4AYXA 1I1LA 4DRZA 2QENA 3C24A 1WMEA 4R0NA 3H5RA 3JQAD 5CB4F 3REFA 1VL6A 2BGLA 3C3PA 3W5BA 2GASA 3DL2A 4X7RA 2HWXA 3K5PA 1QH8A 1A3GA 5ALSA 3I05A 1PSDA 4I4CA 1YQQA 5J4YA 2R66A 2VBGA 2HMVA 2KM1A 5JNWA 4XQCA 5M2QA 2OZEA 1GPWB 2C3MA 2KWIA 1XD2B 2Q4OA 4KRFA 4G8BA 1A9TA 4ZMSA 4FW9A 2CCJA 5B1DA 5JQWA 4UBNA 4CLRB 1E9CA 4XYBA 4N48A 1D03A 2XH8A 1TVCA 5JS1A 1QHHB 1Z6AA 2OPBA 1CEXA 2EV9A 4IHJF 4FDLA 2XCPA 3NJRA 4AY4A 1I1KA 1J1ZA 4GDMA 2RG1A 4YHHB 3ML1A 3KD3A 4B4OA 3KSZO 4BUCA 4JYCA 5AI4A 3PXXA 1Q14A 1RHJA 4D4GA 3BIWA 1P5JA 5LIPA 3O2QB 4H59A 1EK0A 4UU8A 4ONEA 4HWGA 1IZZA 1E2IA 2GTHA 3DEFA 1P6UA 4DM3A 2PIDA 3CSWA 1NL3A 3PUXA 1PT8A 3B9BA 2BFFA 2Q21A 2BHRA 2A7QA 1J5EB 4RV5A 3MMXA 1SC1A 4R1NA 1VPWA 1OFUX 1NT2A 4R4JA 4N3CA 1JH8A 5E7MA 5IHPA 3AJAA 4JT8A 3PK0A 1XMQH 4MGEA 1X2EA 4BY7G 4J0IA 1VLHA 3KTAA 2XA1A 1JZSA 5GONF 4PZCA 3ESDA 4DVJA 1PQPA 1NJ5A 4BQRA 1G18A 3RTDA 2I1VB 1ZOPA 1T0BA 4TRMA 2WP8J 4H2DA 2Q2OA 5FBZA 1M0TA 1U7UA 6REQB 3PPWA 4QDOA 4NV1A 4UM7A 2VA2A 3ZE2B 3M8KA 1X9GA 1Z2EA 1W4ZA 4JP2A 3LC2O 1D2CA 3S55A 1NVXQ 2EJ3A 4EX6A 1C4KA 3G13A 5H83A 1S4QA 1QFZA 3D4NA 3I3OA 1H42A 3NZEA 4XGQA 3KQPA 3CW2A 2AC4A 4BASA 2HMSA 1FQOA 1H3EA 2RHDA 5E2AA 1HMPA 3WMEA 3JALA 4DQKA 1JHPA 2AWOA 1Y48E 2WJ4A 3OVMA 5D8DA 3N7UA 4UTOA 2WB4A 5F9MA 1OFUA 3RUEA 4D56A 1NKVA 1OD6A 3DKKA 5AJVB 5C0OE 4CWAA 2ADMA 5HZGA 5U9CA 1WWKA 4QJ5A 4MVCA 2I65A 3NORA 3U61B 2UVVA 4AO7A 5IVHA 1FFYA 4R2XA 4IEFB 5ICFA 3PCXA 5ITZA 1PJ3A 2ST1A 2IGBA 1M6YA 2OPHA 1TA0A 3IDFA 4PSDA 3UW3A 2WTAA 2ZUDA 3S2GA 1QIJA 2D0PB 2NWQA 1YHNA 1SOVA 2X8JB 2BSQA 2O14A 5K3FB 1C9KA 1QRAA 1X15A 2PLRA 2R8BA 2ZXUA 3ZNNA 1RSZA 1MPXA 3K6KA 2NXEA 3QVJA 1IYEA 2GARA 2NSYA 3S7TA 5ARDA 1D04A 1OB2A 4LWPA 4ZA2A 4D9IA 2X40A 4H3HB 1EP9A 4FKMA 4B73A 1C2TA 5JNTA 5HQJA 2JGIA 1D2MA 1PVVA 5K8LA 3Q6IA 4LMRA 4AFNA 3Q8SB 4TV8A 1X7XB 5IF9A 3AW9A 1TWFA 3JSNA 1QG0A 2Z30A 2BVNA 4Q01A 2Q9UA 2JG3A 3ETJA 2OUIA 5DHFA 5JATA 1WMDA 2LPMA 1UDCA 1DXYA 3WWJA 1BCRA 3Q5DA 5EG5A 1ZR2A 1NQVA 1RQGA 2IVZA 4QLOA 5BV8A 5REQB 4MZXA 4HGQA 3AI7A 3VZRA 1IPFA 3GFBA 4O1MA 2NUAB 2YY5A 2Y9PB 4TSRA 3WMFA 5BQFA 1XTRA 1QUEA 3E1KA 3PHHA 5DCUA 4G2TA 2QMHA 2PX6A 4B3XA 2J41A 4AMZA 3PFFA 4JBGA 1VLJA 4KXXA 1B3RA 3V5NA 2PIAA 4LJ7A 1PLKA 2WB2A 1WMSA 1IQPA 2C4NA 3L9XA 4N8SA 3LLVA 1FDSA 5K6RA 5COAA 4D96A 4FW8A 3M2PA 1I10A 2ZSDA 4H4CA 4KK3A 3MR2A 1YS9A 1KEPA 3RF7A 1P77A 5I7HA 2H11A 5BSTA 2C31A 2VT7A 2EKDA 1VFPA 4Z4CA 1KI2A 2C2OA 2N9UA 3LP5A 4BX0A 3TLYA 3CG4A 4KBYA 4BNMA 3KIPA 2VUSA 2JK0A 3HUUA 1J7JA 3V48A 4K6GA 1YBHA 1IG0A 3S7ZA 4JL8A 2PZBA 4UUGA 2ZWOA 3S6JA 1V41E 2WWYA 4DDMA 4WZAB 4HHEA 3D4LA 4OOFA 4FBUA 1PFWA 3TPFA 2GLUA 1T5IA 4R9RA 1U3VA 3V1UA 3GNTA 4PTYA 1NXXA 3LHFA 1M2OB 1BEZA 1NVAA 4MV0A 1S2GA 4OMDA 3CVJA 3P71T 3PA6A 2O20A 4R8KA 4RCVA 4BTEA 3LIIA 3QKIA 1UDBA 3PO2G 3T4EA 3PFCA 1E3DA 5HIJA 4KITB 3MRTA 3LUAA 1BVUA 4GRDA 4FS1A 1H22A 4D8VA 1G59A 3QKUA 1FXWA 5I5SA 3ND5A 4RVCA 4JWTA 5KI6A 5IFKA 5KYUB 3DNMA 2XB6A 1RCUA 3DMRA 3P52A 4AAYA 1HZZC 1C3XA 4XVUA 1DUIA 2QZZA 4EUSA 5B4UA 3LDHA 1UZUA 1BH2A 2POQX 1CZRA 2P5UA 4MEBA 4ZDWA 4F1JA 3A9RA 4Q1CA 1M9NA 1US8B 2COEA 4AZ0B 3I04M 3TCNA 4ZI2A 4AZ3B 2QRZA 1FYXA 4OHKA 1KIAA 1UKEA 5EWLA 2QX6A 1H1LB 2XGGA 5F3WB 1U3TA 3H1PA 4BVHA 1DC5A 1U2SA 2JFZA 2ZBPA 1UJMA 4HQLA 2ZYSA 1E94E 1NIJA 3B8HA 3VI4B 1HNXB 1F0YA 3TUZC 4ARSA 4EO9A 2WHPA 1ORVA 1X42A 5AHOA 4PRYA 1MJGM 4LJ6A 2PR7A 2XPCA 4HDKA 4R05A 1M0EA 4BU1A 5EOYA 1W94A 1IBCA 1AKEA 4TS9A 3WJ7A 3C5HA 5HM8A 4DLPA 4GMGA 2R8YA 1IUOA 1T3ZA 4BO7A 3HP1A 3HJTA 2IYTA 1U9ZA 5DIFA 1YO6A 3P27A 1CRWG 4EELA 1XRMA 3HGQA 4K0KH 4BATA 2H2DA 5FPOA 2K7ZA 1MAVA 2VP2A 3LH5A 2EDCA 4OV6B 1VL8A 1LWNA 5BXQC 1ZKMA 4BO0A 1I2MA 2VXCA 4CV2A 1NATA 5BWTA 3JU3A 3TE7A 4TXLA 1N34H 1CWUA 4GBJA 5BW8A 2HF9A 5GGYA 2VI5A 5TB5A 3W79A 1GNPA 5J2TF 1CY1A 2HDKA 2AGVA 4Q18A 2VQSA 5ABPA 4JASB 2NU8A 3I42A 5KINB 4CMGA 1VIAA 2B7CA 5JYBA 5AD1A 5DCLA 3X0DA 5KPDA 1TUBB 3R74A 4IJWA 5HKOA 5KDOA 1F17A 1QDEA 5H4HA 3MNFA 4A8PA 3THXA 1QWOA 2NU6A 3WAKA 5KFHA 1M2FA 2I7DA 4A26A 2HHFB 5K3AA 4MV7A 1Z4JA 2AZ4A 3K1TA 4FIZA 5BN4A 1Y3IA 5EJ8A 3I52A 4PN3A 2YIVX 4YYEA 1KZ9A 3DLIA 3OEEA 2DWPA 5CVDA 4Z4IA 3KB8A 4RMHA 4LXQA 4QPCA 5EA2A 5JXIA 5CBPA 1QQAA 1E3WA 3RSOA 4CM9D 2IDZA 4FC6A 3NBYC 5LXTF 1ZD2P 4LRQA 4ZV4A 2J7PD 2GNAA 3HFJA 5DGIA 1XLTC 1THTA 1RBQA 4OSPA 1WCIB 1XEWX 1N7HA 2BE7A 3JCZA 2CFOA 2XIQA 4D42A 2QZ9A 2L18A 1MPTA 2TMYA 1Y1SA 1N3YA 4FFBA 1BGWA 4LFAB 1Z62A 1TVKA 2P4UA 1I4LD 2WLSA 5AI8A 2AC2A 2AG6A 4ZVUA 1OW3B 5EZ6B 4M9UA 3EULA 1BMQA 5LLDA 1SKQA 1J0XO 3U9SA 5KQLA 2REOA 3H87A 1MHPA 2QS9A 4UPDA 4IO1A 1GFWA 5CH5A 5CR5A 4YV2A 5JMOA 2FWNA 3LBAA 1NN1A 4ZOBA 2P9ZA 2ECKA 1TUGA 3L6DA 2LW7A 4LF4B 4TYYA 2QN1A 3IILA 3S8EA 2CE7A 3L46A 4WV3A 2HVQA 3CB2A 5CXUA 4M1TA 3TDKA 4KO8A 3ET4A 4I2NA 3GQBA 4YHHH 2HJRA 1O5IA 5KS2A 1P2VA 1QTNA 3DAPA 2CY0A 3ZWOA 1J0BA 1SMKA 2Q1WA 2IS4A 4E5PA 4NYMR 2VRBA 1TWGA 3HCWA 4BOYA 2C4TA 3A6ZA 1VS0A 5BSVA 1G38A 2IDJA 4YDHB 3HOZG 1WEHA 2HV8A 4DN6A 4WRRA 3N2GA 4O3OA 3ZU4A 4UCUA 5EWFA 2AOTA 1E1MA 3UGTA 2Q3BA 3BIOA 2AN3A 3TLGA 2QRKA 3RM3A 3Q8MA 4MB0A 3Q7EA 5LQKA 4CMKA 4HWRA 3LUGA 2WWXA 3N70A 2YS6A 5BNWA 4Z9YA 3TB6A 5ERGB 1WSCA 2RAFA 4CKXA 1PD0A 5HGJA 3F78A 4LIPD 4ASUD 1I4DD 5JJKA 4HSEA 4AQDA 4CU2A 1JTFA 2AWNA 3N2YA 4D02A 4KYVA 5KFBA 1ECGA 1U99A 4L85A 2P8JA 3OOHA 4FE3A 1C1DB 3PEFA 4RETA 4LA4A 1CUJA 1YONA 5D2CA 3AR5A 1AB5A 4DLLA 1GA1A 2VH2A 1Q7GA 3S8MA 4CM4B 1YR2A 4RHXA 2RE8A 1ZD5A 2KI5A 3CUWA 3RAGA 3NM6B 4C88A 4JBLA 3SNKA 4LH6A 2FZVA 2Q28A 4C7XA 4YNBA 1KAQA 4LFBB 4GEGA 4KYTA 1QZXA 2W2LD 3RKRA 3F73A 1P5FA 4NIMA 4ZHQA 3J7TA 1V1JA 4EYEA 4OP2A 5M29A 3F7OA 4C21A 2Y92A 5AH0A 4O3QA 4HRVA 4HDRA 1RCFA 3UPDA 1OBFO 3KQKA 2QLNA 2D00A 2O05A 3C1TA 5I5TA 1ODSA 2ZZMA 3N58A 2G70A 4C5AA 4DMGA 4Q7QA 2H48A 3ZKWA 1EUQA 1QKIA 2FPIB 4JJKA 2VQFB 3LCMA 1E7QA 2QR5A 1A7UA 3TLEA 1K75A 3KK0A 3UC9A 1AHIA 1QMPA 5TC4A 3BYZA 1DKOA 1J8DA 3AVXA 2H4HA 2DLCX 2C5HA 1CQJB 3PR3A 2R79A 2AMFA 3IAXA 2Z5GA 5TARA 2XHEA 3RO7A 5IWCA 1Z4PX 4B7UA 5BVHA 2FWMX 3V34A 1EGHA 2H0RA 2WJHA 5JY1A 1EZ4A 5C32A 5JFTA 2ZAYA 4X84A 3OC6A 4H60A 3JV7A 3WTCA 1NMQA 1U7PA 4O3NA 1DUSA 2X9QA 2EBWA 3H2BA 3SC2A 5KYWB 5GOTA 3Q7SA 2FZCA 2YICA 4XJVA 2JI4A 4AJ2A 1AGYA 2VN8A 4HH3C 2ZUFA 5JNUA 3F4BA 4Z54A 2LDXA 1TADA 4B6QA 1ENOA 2XJ4A 1QG6A 1Q1ZA 2I6GA 4BZWA 4E5SA 2VPIA 1ZETA 5K0GA 3ON5A 1G7CA 4PSVA 3LT4A 1XKQA 3WWOA 1YL7A 1H3FA 4YCNA 1Z0IA 2XA9A 2FLPA 5LZ5A 5CJ2A 2OFFA 2NSJA 1RZVA 4ZIRA 1EDBA 5AVWA 4LHSA 4U5QA 3SVZA 3KYDB 1MBZA 2V7GA 2JGRA 1U8FO 3GUUA 4YJ3B 3EXHC 5DVZA 1AUOA 2AGQA 4JI4H 1JLHA 3GLIA 2G36A 2OZLA 4HFRA 5KTSA 1JR2A 1W0KA 2GO1A 1ZRHA 4Q44A 3EZYA 3U7GA 5EZQA 4J0HA 2IWHA 5AQ1A 2H1SA 3INGA 2FPWA 1RIIA 3QKWA 2VH5R 2VUUA 3A32A 1E69A 3QJGA 3ZWAA 5BY2A 2AN9A 4JLDA 1SIUA 4MQEB 1ORWA 4IFIA 3WHKA 1KZHA 3QE0A 2AFIB 4QJ4A 3E9MA 5EZYF 4TWRA 4BPBA 3OY7A 4IX1A 2ZRDA 5BOSB 3NNNA 4AJIA 3CV3A 4YECA 4L8FA 4G1BA 3PR2B 1XZ8A 3A6KA 3G79A 2H2GA 4YWHA 4XTCS 1C8LA 2Y0PA 5IDYA 2XCIA 3O92A 3VKGA 1AV7A 5G3YA 4QTUB 3I8OA 1LBTA 1H2FA 3UFBA 5KT3A 4IH9A 4AL4A 3BTVA 2CL6X 1P75A 3HN6A 1Z0KA 3D6JA 3GEDA 3ORRA 3VC2A 4MV3A 2G06A 3TTTA 1W29A 2NVWA 4PHFA 2PVCA 3RC3A 3DFUA 4G0QA 4EJSA 1YAJA 4DL6A 4J03A 4W5HA 1DAMA 3GLIE 1P1BA 2Y2UA 1YJCA 3OQNA 3ZDZB 1ZD4A 1EB8A 3D3NA 4IG9A 3PEYA 4DNXA 4R41A 1L5RA 3GILA 3H6HA 3TQTA 9ATCA 4U0JA 5GGXA 3AFNA 1KF0A 3V6MA 2H2HA 3F2IA 2BZ1A 1U4OA 4URZR 1G0NA 3UAWA 4U7GA 2PKRA 5DNEA 2Y1FA 1XX6A 1S3FA 3WAGA 2FETA 4BRZA 5I7SA 3RLFA 1HH4A 4TZTA 3RKUA 4G0MA 4WFQA 4AF8A 4ZU6X 1GAWA 4YQFA 3TSOA 1RPZA 3GNLA 1HNXH 1ZHSA 4KLRA 3A4LA 1QX3A 2PFSA 3QI2A 3U80A 4NV0A 3DVRX 4CLOA 1ZXXA 2ZUEA 2CGEA 5FR1A 4CHGA 3DZKA 5MHTA 4LJYA 3HEBA 3U62A 3LUFA 5CT4A 3VOSA 5FAXA 2FG5A 4KFCA 4DR5B 1GR0A 3Q7IA 2O2IA 3ID6C 3DCYA 2VUHB 1H4QA 3T7AA 1LB1B 5DU2A 3H2YA 2FRDC 3QEBZ 5KHAA 4LC0A 5CIYA 4Y8VA 2O1XA 1PWZA 4XWKA 1T6ZA 4YS6A 4J43A 2H54A 3L8YA 2VPSA 2Z5LA 3DKVA 3OZBA 4HUQB 1QP0A 1WR8A 5KYVA 4JJGA 3JQAB 4RGYA 2Q4TA 2JFUA 1XNHA 3NCHA 3ET5A 4C4SA 3DDHA 4PYKA 3KG2A 5DDIP 3KUCA 1AY0A 5D6OA 5FWXA 4CR6A 3A9UA 3L2OB 1Z45A 1YA8A 5KYKA 3WYEA 3R23A 4HR7A 2ORYA 5F98A 5AIBA 4CT4B 5CLHA 2IOQA 1ZG3A 4RK7A 4AJOA 1QGAA 2R60A 5KVAA 1THGA 5KAPA 1UPUA 1W5AA 4BECA 4AUKA 2D1TA 4P5PA 4CL0A 1LDNA 3EAGA 2BFBB 1JDBB 1ZSNA 3PEEA 1B15A 2DBRA 3EZ7A 4HX2A 3V2GA 5D51S 4HQKA 3U0VA 3H19A 4KMMA 1I3NA 5ALZA 1JDJA 5F9LA 2QL9A 2KSWA 1NN3A 4D57A 4RNCA 3KJHA 1WDLA 3IV7A 4FXPA 5K99A 4YRKA 2V4RA 1KI1A 1R6AA 3OZXA 3T4PA 5KHLB 1SC3A 1ZBDA 1GGFA 5M3BA 3TY8A 3U5TA 4TKUB 2XZOA 1RKXA 5A9RA 3E7DA 1IM8A 4E5KA 1A8HA 4RXTA 4CM8A 5I60A 3HSYA 3NWEA 4B80A 2D5CA 5KG3A 4DBVO 3UMJA 3JQFA 4POAA 3K32A 3KPWA 3E58A 4Q45A 1SB9A 4ED9A 2BFFB 4WXPA 4LFAH 1D3AA 3V2UA 2WWHA 1YVRA 2O2EA 3OCUA 4YC7A 1F5NA 4NJMB 4PQRA 3V1KA 5DX0A 2HT6A 5JBNA 2GESA 2CZCA 1R0CA 4Z2AA 4V1CA 3LO5A 3U4GA 4QTTB 5C9ZA 3I4FA 2A30A 4WX2B 1F8YA 4D9FA 3OJFA 4LF4H 4CQMA 2WVAA 2ZRNA 3SOZA 4YACA 3L6EA 1P73A 3RVOA 3K1JA 3L18A 1WY5A 4AS3A 1XEXB 1QPZA 1IXYA 3KKMA 4IKEA 1F2VA 2R7AA 1GR1A 2XDYA 4GZ6A 2HWKA 4O84A 3UH1A 4PAGA 3KLNA 5C5CA 4DABA 3RQSA 4BGIA 2AH5A 2X41A 3T3EA 4XA8A 3TSYA 1T35A 3AR4A 1JH9A 4LDQA 3PFKA 3JALB 3WYGA 4RNMA 1J23A 1V7ZA 4QECA 4X1YA 1Q83A 3PUIA 4BNKA 3ZWQA 1PR6A 4QRDA 1NV9A 3W6OA 5G0SA 1CU1A 4O5OA 3ONEA 1XL1A 3N6RA 1JU9A 4DMUB 1NQAO 2XB9A 2CNVA 1KBOA 4GLFA 4Q24A 5ITZB 3JQPA 4CG3A 1MVNA 3R8CA 1Y8QB 2IKSA 1IPHA 2FEPA 3RGXA 2UKDA 1NRIA 4JVSB 2G4VA 3U39A 2H1VA 4DSAA 1O97D 3K0SA 1WJGA 2EG9A 3T3MB 1P33A 1THMA 3IDOA 4MMYB 1VBGA 1P60A 2R0QC 3PL5A 5AO9A 3W5SA 4LVUA 5DB4A 1KNXA 4AX4A 3OMXA 5SV2A 2ADFA 4P83A 3CF4G 4WXEA 2EDAA 5ECDA 1UJ5A 1SBYA 1QTQA 2YXPX 1DCMA 1CUXA 1EP2B 4WLOA 2FYTA 4HXGA 3Q0IA 4NDNE 3WB2A 5KFCA 3NFRA 5DO9A 3ER6A 2NUPA 1QCCA 1SZJG 1T5SA 1AKYA 3G1UA 1DV1A 2CT8A 5IASA 1KYTA 3FB4A 4QDKA 1OBVA 4FOSA 2HF7A 4ED1A 1PX2A 2FG7C 4JOBA 2BCEA 5TQJA 1K06A 4LFBH 4CBVA 1Z75A 2QDKA 1QHSA 1VJCA 1DRJA 1W59A 4IQFA 2IEGA 4HLNA 3L7NA 2F43A 1JG2A 3AUTA 3GDFA 3LKDA 3O8CA 3CQ9A 3A26A 5F2KA 3UBTA 3W6NA 1KYZA 3WMRA 5AESA 3L0CA 4D25A 1B2LA 4YJKA 5I9MA 5D01A 1ZJ5A 1UK9A 3MERA 1G9XA 4YCDA 1EFCA 4KWHA 4UHJA 4JJEA 4O7WA 4DQVA 2X9GA 5TMEA 3R0ZA 1IIRA 1EINA 5DJ5A 1N4AA 1CKOA 1G3RA 2W6ID 4UVEA 2J08A 2K5UA 5F9HA 4OXYA 5JI3E 1MV8A 4Y30A 5L1JA 5CDYA 4KMOA 3K30A 3P2IA 3HJBA 3KT3A 4ZP1A 1MX9A 1LSJA 2HOQA 3EZLA 1TAEA 1UDAA 1U8TA 1L3IA 2IYOA 4HAZA 4D97A 3CVOA 3F1KA 4OJQA 3GMDA 4D5EA 1XVTA 1F5SA 4BL5A 1QJ4A 3PC6A 1O89A 3NOVA 5JROA 2F90A 5FBHA 1NSYA 2CLHB 1QVAA 1WCYA 2HJ9A 1WV1A 1ZHQA 2YH2A 2D7DA 3T8YA 2QN6A 2GVNA 3PQ7A 3FJYA 5B6IA 3I4MG 4WXYB 4XGRA 4BZZA 1XPUA 5AOAA 4I8IA 1OUMA 1OBGA 4PHGA 4IP0A 4BP1A 5EPEA 2HF2A 4ZEMA 1RYEA 4X45A 1R5NA 4C1NA 1Y1PA 1HZJA 3HOVG 3QQPA 2RIPA 1GRVA 3IB3A 4GU5A 3JYHA 2J6CA 4IJVA 4KMRA 4RIEA 2HADA 3TD6A 3R9XA 1FU8A 1SUBA 3RS9A 3C8UA 2O23A 1G5QA 4W7SA 3CZ9A 4PPNA 2YYAA 4TRNA 4ABYA 3F9CA 4QU9A 1F0PA 4KQ9A 2QQ5A 3FKSD 1JDPA 5FEUA 3G2OA 1YQWA 5LA6F 2FLKA 4JJZA 3SOPA 3UBMA 4OHFA 2A9PA 1IH8A 1OA1A 4ZCPA 3N43B 1R1DA 1JL3A 2Z4TA 3BICA 3GGSA 4TWJA 4M4SA 4QRIA 4BNVA 1LQ2A 1PW7A 3UV6A 5EWLB 1BDHA 1NYQA 3NHBA 3ZBPA 4IDGA 3RC1A 4U6PA 3IVXA 1B8VA 2PZKA 1J42A 3QH4A 1HDCA 2W8KA 2I1LA 5C44G 3WA7A 4W6QA 3EE6A 3W5HA 1JQJC 1AD2A 2AF3C 4BMOB 2EG5A 3A3OA 1JFRA 1PDOA 1SA0A 4RL4A 3NX4A 1EBFA 2R25B 4EJ6A 3TI7A 1QQTA 4UULA 4HDKB 4OXXA 2VJAA 4WL0A 4YLGA 4K9QA 1J2UA 1E0DA 1NVVQ 3G6KA 4AW9A 3WGGA 4K9DA 4ND5A 3BA8A 3O4HA 4RO0A 5DTEA 1O0SA 2GHIA 2QU7A 4MLDA 3VDXA 4OF4A 2BH9A 3RYCB 5C35A 2Q49A 3DAAA 3U09A 1E3SA 3LXRA 2VKQA 1Q77A 3RIGA 4XSGA 2J6SA 3IMGA 2BAGA 2XGOA 3MWYW 4CC5A 4OYRA 3G0IA 2QMZA 4PSUA 2RGYA 4W5QA 3SHVA 4F21A 4V0LA 1BRTA 4B3MB 1YZHA 2IA6A 3JVDA 5DX8A 5JY6A 4Z4HA 4U8HA 2XLCA 1ZRNA 1NXWA 1Z4OA 2NU8B 1FU4A 3WQSB 5CP8A 1LDBA 2X13A 1R4AA 3K72B 2BDEA 2LKCA 3O4IA 2FQYA 1TYZA 1W2GA 1YAHA 3BT7A 1TIKA 3THXB 3LW8A 4X95A 1KFBB 3ZI4A 4P82A 1F8UA 4K28A 3WYFA 5J1TB 3SF0A 2R8PA 3RIXA 4QULA 5FA8A 3SYLA 4QD3A 3HLTA 1EQAA 3GR6A 2X5NA 1G17A 1LBSA 1DE0A 3OCYA 5F21A 4E51A 4MJ7A 3EZNA 3ONNA 2AE1A 2V6BA 2UYGA 1E3LA 4FGKA 4DR5H 5CBPB 5ESRA 1JMVA 1BTOA 1E3WB 2FFAA 3ZQ6A 1H2WA 5K6AC 4I08A 4M0JA 3F71A 4LE0A 1VMDA 1A95A 1VECA 1VOTA 2XMBA 3RLIA 3NXKA 2R1ZA 1T6YA 2AL7A 4C2AA 3BIJA 2GCIA 1GSHA 4C2UA 3TFQA 2E49A 3WRYC 1LWOA 4JNCA 1R64A 5JAPA 2ZE8A 5CD9A 3PWTA 4RQTA 3ZZMA 5ALGA 4CEJB 1LGYA 3SX4A 1TVKB 5FD5A 3T9CA 3D7SA 3FUXA 2C0PA 1R9GA 2C82A 3NAGA 1AKTA 1BS9A 4GOLD 3HB7A 4B3CA 1U9JA 5K05A 2VJCA 3T5HA 1WUKS 4RA6A 1GQSA 5TR9A 1GQQA 1B0PA 1BGXT 4HS9A 5KWIA 1T5TA 2AN5A 1UP7A 1ZAUA 2CQYA 2WT4A 4MUAA 2VCHA 5BSRA 1L7BA 1HOTA 2W0MA 4YP0A 1LSOA 3P2EA 3NKVA 3TMAA 4NK5A 5BR8B 3ABQB 2Y6UA 1QP8A 2EWVA 2JEGA 3VSBA 3KSUA 5AVUA 1TZ2A 1GNSA 3TD2A 3FDZA 4X7PA 2HDWA 2J9RA 3KOZA 3H83A 2XSZA 1RCTE 2CVQA 2Q1SA 3T94A 4HWTA 5T67A 5DGCA 1X1BA 3HO1A 1VP3A 3ZK7A 1QAQA 3DHWC 1LC0A 1W581 3QK7A 5G1PA 4OY3A 3MW8A 3DZCA 3QU9A 1Q22A 1VHDA 2OAEA 1T8YA 3CCCA 5A5EA 4RB0A 4ZT7A 2JVKA 2SBTA 4JQYA 1WAMA 4E08A 3BA9A 3MCVA 3MMSA 5IS2A 4IMRA 3C0KA 4M98A 3WLQA 3PT5A 3BXGA 4F72A 3FCUB 3TLGB 1OASA 3H1EA 2FR8A 2AUMA 4KLNA 3IQEA 5T5QA 4IAOA 3NKFA 5BUZA 4LJ5A 1YDEA 3K92A 1MAUA 4AO6A 2PH5A 2Q5OA 4KXQA 4YWJA 3OO0A 2FN4A 3AF0A 1VKHA 1RYFA 3MBOA 2JEJA 3VR4A 4PY2A 4OBBA 4EB6A 1T5BA 4IXNA 3ORHA 3IHKA 2IHNA 3N76A 1NC3A 3AGPA 4I7EA 4XQ9A 1N2JA 3S1LA 4CKYA 3UANA 4G01B 3JD4A 1TQ8A 1DGQA 5CCXA 4L3WA 1Q57A 4IS2A 1PJ2A 2PYIA 1DFIA 2WJIA 1P7VA 5EGNA 4MW6A 3QX8A 3JD0A 2RH5A 4HQ0A 1R3DA 4KXFB 3FZYA 3K7EA 1I3KA 2YVLA 3ZCVA 3IHLA 5HMLA 4A4DA 1HM5A 1RIFA 1CQIA 1BDBA 1TTTA 1VLQA 4NE2A 2C2ZA 3L4JA 3IUMA 4LHEA 3U3KA 3VPXA 4EYHB 1TMOA 1S68A 4C30A 2JGEA 5JDCA 5A7HA 1HTBA 5ILQA 5DQIA 1J5XA 1ZONA 2ZSFA 1M1ZA 4M6WA 3TLMA 4UHKA 3JRNA 3I62A 3ZKWB 1RRFA 4HBGA 2QRLA 4DOMA 5GJVC 3TSAA 1RQXA 2X3YA 4K6FA 3CX6A 4X6UA 1UOPA 3EG9B 4BNHA 3A2MA 1NPYA 3EW7A 2WJJA 3WP0A 3QLUC 1DXOA 3T54A 3UA3A 2NYVA 2B3DA 4RNDB 4YONB 1DJQA 1ISJA 4FC7A 2IEZA 3T5CA 2IBTA 3FDXA 5ER6A 4DJTA 4XB1A 4CI9A 5C3UA 3Q10A 5BVHB 3G8DA 4E1AA 3V4LA 2LVBA 3PDCA 2BMEA 2ZM6B 3SLGA 1H0RA 4PONA 1NJGA 3SQNA 5BUCA 5FRDA 3SDBA 4BVEA 2ZAMA 5HF9A 5SY9A 4Y3UA 3IIJA 3DW1X 4JVNA 2DMRA 2PPLA 2CXSA 1E89A 3T4XA 2HA2A 2Z2ZA 2W6PA 2J3HA 2WT9A 1S97A 4IXTA 3N2KA 5K0JA 3SC2B 4O4HA 1HKHA 1OB5A 4F1KA 5AW9A 1A2OA 4FCCA 4NQZA 3VH1A 1U0LA 2AMYA 3MWEA 2B21A 3JARB 4KAJA 3UPUA 1JB1A 3O9VA 3IHWA 1I7QB 4ES6A 3CZMA 3L6RA 4JA0A 3T7JA 5HNKA 2D13A 5CMLA 5ARBA 3STYA 3NS7A 4KJZA 3DXFA 2VPPA 1PJCA 1O96B 4EG3A 2PR2A 2NXNA 3S29A 2QIPA 1Q84A 2P2SA 4LYGA 2PO7A 5IYZB 2QJRA 5I9IA 4ZIRB 5G4KB 4PAWA 1A82A 1OY1A 4IHAA 1P61B 2QAIA 5EPUA 4FYYA 5EY5B 4DIFA 1X1TA 4IH4A 3DE5X 4A73A 1WE2A 3M3DA 4COOA 1MB0A 1NJ1A 3PHIA 5C5IA 1EIZA 3FBTA 5F3RA 1MXFA 3W2FA 4N7JA 3C97A 1M72A 5IC5A 4JOCA 2WK1A 2CD7A 3DCJA 5HTKA 1G42A 3FNEA 5L40A 5GINE 3WK8A 1EU1A 4PG5A 4ED0A 4G0UA 1GXSB 1NNI1 4WOPA 3P5SA 2V6JA 4J1QA 4Z4EA 4X6LA 3SYTA 1TXGA 4RABA 3BFVA 4QBHA 1ACMA 1CR2A 3ROEA 3SHFA 4LVOA 2AMLA 3GN1A 5DXJA 2UYOA 4M86A 4QARA 3U3XA 2XODA 4GLWA 4E5YA 6YASA 1Y7IA 1D2EA 2G67A 1PL8A 4G5XA 2WFLB 1ZD8A 3FIJA 2JATA 4WLVA 5CFRA 3M6UA 3OO1A 1KYVA 4WKNA 3P2YA 2RIRA 1NZDA 3JAMW 2YHBA 3ADKA 1JV2B 5HIIA 3W5DA 3E9QA 2I62A 3L8HA 4XTRA 4GWKA 4XWAA 5KKAA 4HUJA 1V8ZA 4EJSB 1VSTA 1JQKA 3PDIB 1KMHA 3QBTA 5CM2Z 2V96A 4I2VA 2FUCA 2UZAA 4CZ2A 1J70A 2PN1A 4GM1A 1LDGA 1KI6A 2WAYA 4GL2A 3SC3A 1TO2E 4KK4A 5IK2A 3B3QA 1FDIA 1XCJA 3GQVA 3UZUA 3F9IA 4JDUA 4OREX 2O54A 3T3HA 1CEYA 3RRFA 3ZLVA 3HCPA 4BNWA 3QLEA 1GCAA 2I1QA 1RQNA 4KR9A 2JKYA 4JI4B 2PL3A 2ZVDA 1C3OA 1QZTA 1FDTA 3ZHSA 1ZINA 3MHPA 2XCRB 5KNDA 3FVWA 3NG1A 3R5KA 1Y1LA 2HRDA 4J6EA 1REQA 2IZOA 3AONB 4H08A 1KC1A 2H17A 5EXXA 2OHJA 2ZAIA 4W6ZA 3V6JA 1UFQA 5J2TA 4TM7A 3QWBA 2HHCA 2HA5A 2QJOA 4TKZA 5CR9A 1MAHA 1G5IA 5BNFA 4PO1A 1BQEA 4C4YA 2OECA 4ZOEA 4XGNA 1T9KA 4KXVA 4PHHA 4F9EA 3CGWA 1Z0ZA 1YS6A 4OIMA 5JWOA 4YEDA 4WY5A 1XP5A 1X1EA 5TQ2A 5CM9C 3OHSX 1JIHA 3MFHA 4N0QA 2QYOA 1JTVA 1XHEA 3WJ1A 3IAM6 2JA6G 5DM1A 5K3DA 3WJAA 4INPA 4B3MH 3VNVA 4E5NA 1HEYA 4QUDA 3DEZA 2I5PO 1O94C 4KGVA 4PX2A 4MYHA 4Y2UA 4V2IA 9ABPA 2CDNA 5FWXB 5EIBC 4KGXA 5BSWA 4FB5A 2KLHA 1FDRA 5M5BA 3DZJA 1PR1A 3PO3G 1II9A 4FFLA 4KOEC 1MLDA 5KFTA 3ESCA 4XIYA 1Z5GA 2DJ5A 4CHTA 3GAZA 4LV8B 3NBAA 3KBOA 4WH0A 2XMGA